1N06A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE riboflavin kinase
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 34
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n06A00
3CTAA 1T6XA 2VBSA 1N07A 4UZEA 2X0KA 5A89A 5A88A 4UZFA 5FO1A 5FNZA 1N06A 1NB0A 2VBUA 1Q9SA 1P4MA 2I1LA 5TRDA 2P3MA 2OYNA 1T6ZA 3OP1A 1NB9A 1MRZA 1T6YA 2VBVA 2VBTA 1S4MA 3BNWA 1N05A 5A8AA 5FO0A 1N08A 3ZUGA
chains in the Genus database with same CATH superfamily
2E1BA 4C0SA 5DN6A 3OEHA 4RD4A 4OOVA 4G6IA 1GJRA 2WR8A 2XNCA 3CCQB 1D1NA 3GSIA 3U6BA 3CCSB 1K73D 3DDYA 2CRVA 5IYRA 1XE1A 1W87A 2YWHA 1U2RA 3CPXA 4WZKA 1I7PA 4XLAA 1QFYA 1WTHD 2GK7A 5LMZA 2WJYA 4WZEA 4B44A 3AGQA 1PJ5A 1IJFA 4NBSA 4XL9A 2D3LA 3BCFA 3ZZTA 3JQPA 5IYWA 4QFMA 3ZPNA 1EP1B 2B7BA 5H59A 2ZTGA 3SKBA 1ZM4A 3J81k 5GV8A 2D9RA 2OBRA 1OHHA 1V5VA 4UZFA 2V7VA 2HLDA 3CPWB 4G7XA 4YAUA 3T56B 1D2EA 3CRZA 1BPLA 3OZVA 1FX0A 1VF7A 4X7EA 2VBVA 4PC3A 3ASQA 1GVHA 3CCUB 3JQQA 1W9XA 3Q3AA 1G7TA 1M1KD 2CBXA 1I8DA 3FPPA 3W5UA 1EP3B 3B78A 4WZLA 2V31A 5E6TA 4IW3B 1WSVA 4II3A 1FRQA 2GJPA 4FXUA 4YHBA 1T6XA 3BQJA 4XNFA 4QUZA 1ELOA 1WOPA 3P27A 4TMVA 1N8RD 3CMEB 1E79A 1W0JA 1JNYA 5IYPA 1E64A 4RDKA 3MMPA 3QFRA 4DNTB 2VBUA 4XORA 4DK0A 5FL7A 1WPCA 4LBYA 4QVAA 4Z4RA 4M53A 2AHOA 3W2IA 1G7RA 1VQNB 1E1QA 2GK6A 4G1BA 2M5SA 1WSRA 3CCMB 4PC7A 2C5HA 2V7WA 2CF4A 3QSYA 3ONYA 1G7CA 2CK3A 4F7DA 3AVUA 4RD1A 1N0UA 2XEXA 3OKXA 4PC2A 3SLNA 2OTJB 1AIPA 3R6JA 4Z4SA 4UZUA 1W35A 1UD2A 5TV2A 5F4OA 4FK8A 3NE5B 2YWGA 3OPOA 2QGGA 4X0CA 3AGPA 3Q38A 3BH4A 5FA6A 2B7CA 3PUNA 3JQRA 1P4MA 1R5OA 3LO8A 4ZCLA 1NJID 3CMAB 1B23P 2V7UA 1H8EA 4YAWA 3WY9A 3A3GA 2V7TA 1YLOA 1KK1A 4RJLA 1N05A 5EMNA 5HZBA 2X85A 4YALA 4RDJA 3OW7A 5KNLA 2BSAA 1N08A 4XKWA 1BX0A 1FNDA 2ZTNA 2VJIA 4HIZA 4LBZA 1IB0A 2VBSA 2VZLA 4RCYA 3WNDA 2X6WA 3KEWA 1F60A 1PJ6A 1UD3A 2GJKA 1DDGA 2ZL5A 4XMYA 1J9ZA 1VQLB 3CCEB 1BMFA 1Y0YA 2OK8A 2Q6LA 4XLEA 3CC2B 3QFSA 2CNDA 2ZL7A 2QE7A 4M0LA 1Q9SA 5KW9A 1WP6A 5IYNA 1GR1A 2B5OA 2GREA 2QDXA 1CNEA 2X6XA 3D26A 2V7QA 1H42A 3ZC3A 5JBQA 3A35A 3W2EA 2QA4B 2VNJA 3JU4A 2C4TA 4AF6A 3BNWA 5AN9A 4QHYA 3CC7B 1G7SA 1IJEA 1BX1A 4P25A 3ZUGA 5BSYA 3VR6A 2JIZA 1FNBA 4UZEA 4X7CA 1K8AD 1BQEA 4H9GA 3W2GA 1VQ5B 3OJXA 5A88A 4E0FA 4XOPA 1A8PA 3AVYA 4TN1A 2WJVA 3ASPA 3V76A 4B4DA 2R9VA 1VQ9B 5F4MA 2DOGA 4RPBA 2ZZQA 1ZM2A 2VJJA 3VO2A 4X06A 3LNNA 4LBVA 2NPFA 2VBTA 4P6YA 4U9UA 2D3NA 4ZCMA 1FNMA 2Q6IA 4BPRA 2X8KA 2PIAA 5BSXA 1KK3A 3Q6QA 4B47A 1E63A 1VJSA 2LZJA 4FWTA 2BF4A 4B43A 1QGZA 3ISXA 1GAWA 4B3FX 1W2BB 1VLYA 1WOOA 2QTZA 1FDRA 4OPVA 1SKYB 4WWVA 3A1PA 1Q82D 1F20A 2XGJA 2ZBUA 4DQLA 4N3GA 4ACBA 2ZXIA 4AF7A 2Q6OA 1E43A 4RM0A 4ROXA 1QH0A 1UD4A 3CESA 4Y7CA 1VQ6B 2I1LA 2YWEA 1NDHA 1UD6A 2OYNA 4G1VA 1H85A 4DNRB 1RQRA 4P22A 3WNBA 1Q86D 1DG1G 4LC0A 4J0QA 5IYQA 4YXWA 4P3IA 4TT3A 4XR6A 4TMXA 3CCJB 2XNJA 2XZPA 4Y9UA 5HXBA 1YI2B 3SEJA 3ASTA 2X53S 2BGJA 4B3XA 2OBSA 1VQKB 1S0UA 2NV4A 3ZIAA 1VQ4B 3ASRA 1TTTA 1QG0A 1KZLA 1UMKA 4XONA 3WXMA 4X8IA 4YELA 2DIEA 3QFTA 2EFGA 3PENA 3A8KA 4P6VF 2XOKA 2P3MA 4TSFA 1KTVA 1SM4A 4YAFA 1YJ9B 3W2FA 1JB9A 3GIRA 1WDTA 3FJOA 4II2A 2DY1A 3FPKA 5TR9A 1KC8D 5FIUA 2OTLB 4DK1A 4PGOA 1YJNB 2DETA 1DDIA 3Q6RA 4YEJA 1YITB 4HE6A 4Z4UA 2X6YA 1YIJB 3U2QA 1V0FA 4RD2A 4RD3A 3CB4A 4RCZA 1EFUA 1HA3A 3ZZ0A 1KD1D 1VQOB 3VNVA 2BN4A 4TMWA 2VNIA 4XN0A 2XZOA 2XZLA 4P9SA 1FRNA 1UD5A 4MYUA 4KKSA 2Q6KA 2C4UA 2BVNA 1ZM9A 4FN5A 3CC4B 2VNHA 3ASSA 1W34A 3GVKA 1WOSA 3HAGA 4M2LA 3OZUA 4X7DA 1NB9A 2WZPP 2X3UA 1E3XA 3A8IA 4PC1A 5THXA 5H5JA 1OB2A 1OGJA 4QV2A 1YHQB 3G71B 2VNKA 4NNJA 4Z4YA 4P12A 5GV7A 4PAAA 1KK0A 1FNCA 4OOXA 4AVZA 3GVLA 3CP2A 4GQNA 4XLCA 2QTLA 1ZUNB 2PMDA 1IHMA 2X0KA 2QN6A 2PE3A 2BM1A 2R6HA 3V7AA 1AMOA 1B2RA 4RD0A 3OE7A 3SJZA 3H9NA 1N06A 2F1MA 3PVDA 4Z1MA 1PJ7A 3CD6B 1I18A 3T51B 2V7XA 3P26A 3OP1A 1MRZA 4ACAA 1VHOA 4MYTA 1S4MA 2BPOA 4QVJA 4Y9RA 2XNDA 4TMZA 3B82A 3GQBA 3GVJA 1E62A 3VO1A 2WYRA 2FX3A 2ZZFA 2ZZEA 1H8HA 4L8JA 3AVTA 2ZBVA 5J3OA 2V4DA 2WSSA 3W5HA 1EWYA 2DEUA 2DCUA 4Z4TA 5CDFA 3ZBTA 4RD6A 4P26A 3CP8A 1WU8A 1QUFA 2KVOA 4B48A 1BJKA 3OZWA 2RC6A 1PKVA 3FKSA 3Q39A 4ZV4A 3RY8A 4AC9A 5TRDA 2RC5A 1VQ7B 1T6YA 4XLHA 1EFCA 3CW2A 3CMMA 2ZXHA 4CQJA 1CNFA 2C78A 4ZGQB 3CXCB 1OGIA 2ZZGA 4RPDA 3CCVB 2BV3A 1HVXA 3OFNA 3QFCA 5KSWB 2JJ1A 4LBWA 1QVGB 2DYIA 3MHPA 4XM3A 5J35A 3ONUA 3G4SB 4UAJA 4JMQA 3WQZA 3BY2A 1ZM3A 1GAQA 1NB0A 1DARA 1TVCA 1YX2A 2WZNA 3AVWA 1VHEA 1K28D 3PA2A 3U6KA 1MABA 2BM0A 3CCLB 4Z4VA 1T6ZA 1HZEA 2GJRA 3ZBUA 2JJ2A 2CC2A 4XN3A 1QX4A 4X07A 4OPSA 2FVGA 3WYAA 1QUEA 4WQMA 4XOTA 3QE2A 2ZL6A 3G05A 4P3YA 5B6IA 3OOCA 1BLIA 1GO2A 1NBMA 4YAOA 1UD8A 1TLLA 2BGIA 4R71A 5TY0A 1XFOA 4KKUA 3I56B 1EP2B 1QFJA 2F1LA 2E1RA 2W6JA 3OJWA 4K1XA 1M90D 1CQXA 3I1FA 1QGAA 4KKTA 3WBJA 3WNCA 4OPOA 3T53B 2Z6BD 4Z4WA 1Q81D 1W0KA 4N3NA 1Q7YD 1D8TA 4Q7JB 3I55B 1Y0RA 5FO0A 4DQKA 3OW2B 3LVBA 3BC9A 5DS0A 1E3ZA 1TUIA 2OK7A 3CTAA 1K9MD 3OAAA 4G7WA 2F43A 3PUMA 2C77A 4P2NA 1YJWB 1OB5A 4RDLA 2EIXA 2DERA 4XQFA 3W5VA 2VYQA 2JDIA 1KJZA 3B8HA 1VLOA 1COWA 1QFZA 1R5BA 4XD7A 2C5BA 5IK2A 5HKKA 1VQPB 4PC6A 3CCRB 5F4JA 1OB0A 1E1RA 3AVVA 4M4SA 3R6KA 1SKQA 4M1KA 2F4NA 2C2WA 2OBTA 4OP7A 3A8JA 1N0VC 5HZAA 1VQ8B 2HMAA 4X05A 4PABA 1R5NA 5A89A 5FO1A 4OOSA 1RQPA 3W2HA 5FNZA 2PLFA 1QGYA 3LQEA 3WBKA 4TMTA 3E20A 1QVFB 3SJPA 2GQFA 3PA1A 3OEEA 4ZCIA 3E1YE 3VMFA 1EFRA 2D74A 4EH1A 3ZZUA 3BCDA 4NCNA 1KQSB 3LQ6A 5L46A 3AVXA 1NRKA 2WPDA 3ES9A 1JA1A 1T5EA 1KMHA 2QMUA 1JJ2B 2J7KA 2HCJB 2ZITA 1JA0A 4C43A 1N07A 4TKOB 4XKVA 1S72B 3G6EB 3SLDA 3MCAA 4XLFA 2HDNB 3H94A 1XB2A 2BMWA 4ZGNB 1WORA 1V0EA 1KRHA 3KL9A 4G5GA 4WZTA 2GPJA 3A3BA 2QEXB 4ASUA 1XQBA 4P1VA 4HE5A 3VNUA 4Z4ZA 2YWFA 4B3GA 1KK2A 4RLZA 3BY1A 1EFTA 5A8AA 2CW5A 5DSZA 1VQMB 4X7FA 2W6IA 2JN9A 1EXMA
chains in the Genus database with same CATH topology
3CTAA 1T6XA 2VBSA 1N07A 4UZEA 2X0KA 5A89A 5A88A 4UZFA 5FO1A 5FNZA 1N06A 1NB0A 2VBUA 1Q9SA 1P4MA 2I1LA 5TRDA 2P3MA 2OYNA 1T6ZA 3OP1A 1NB9A 1MRZA 1T6YA 2VBVA 2VBTA 1S4MA 3BNWA 1N05A 5A8AA 5FO0A 1N08A 3ZUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTA A;  1T6X A;  2VBS A;  1N07 A;  4UZE A;  2X0K A;  5A89 A;  5A88 A;  4UZF A;  5FO1 A;  5FNZ A;  1N06 A;  1NB0 A;  2VBU A;  1Q9S A;  1P4M A;  2I1L A;  5TRD A;  2P3M A;  2OYN A;  1T6Z A;  3OP1 A;  1NB9 A;  1MRZ A;  1T6Y A;  2VBV A;  2VBT A;  1S4M A;  3BNW A;  1N05 A;  5A8A A;  5FO0 A;  1N08 A;  3ZUG A; 
#chains in the Genus database with same CATH topology
 2E1B A;  4C0S A;  5DN6 A;  3OEH A;  4RD4 A;  4OOV A;  4G6I A;  1GJR A;  2WR8 A;  2XNC A;  3CCQ B;  1D1N A;  3GSI A;  3U6B A;  3CCS B;  1K73 D;  3DDY A;  2CRV A;  5IYR A;  1XE1 A;  1W87 A;  2YWH A;  1U2R A;  3CPX A;  4WZK A;  1I7P A;  4XLA A;  1QFY A;  1WTH D;  2GK7 A;  5LMZ A;  2WJY A;  4WZE A;  4B44 A;  3AGQ A;  1PJ5 A;  1IJF A;  4NBS A;  4XL9 A;  2D3L A;  3BCF A;  3ZZT A;  3JQP A;  5IYW A;  4QFM A;  3ZPN A;  1EP1 B;  2B7B A;  5H59 A;  2ZTG A;  3SKB A;  1ZM4 A;  3J81 k;  5GV8 A;  2D9R A;  2OBR A;  1OHH A;  1V5V A;  4UZF A;  2V7V A;  2HLD A;  3CPW B;  4G7X A;  4YAU A;  3T56 B;  1D2E A;  3CRZ A;  1BPL A;  3OZV A;  1FX0 A;  1VF7 A;  4X7E A;  2VBV A;  4PC3 A;  3ASQ A;  1GVH A;  3CCU B;  3JQQ A;  1W9X A;  3Q3A A;  1G7T A;  1M1K D;  2CBX A;  1I8D A;  3FPP A;  3W5U A;  1EP3 B;  3B78 A;  4WZL A;  2V31 A;  5E6T A;  4IW3 B;  1WSV A;  4II3 A;  1FRQ A;  2GJP A;  4FXU A;  4YHB A;  1T6X A;  3BQJ A;  4XNF A;  4QUZ A;  1ELO A;  1WOP A;  3P27 A;  4TMV A;  1N8R D;  3CME B;  1E79 A;  1W0J A;  1JNY A;  5IYP A;  1E64 A;  4RDK A;  3MMP A;  3QFR A;  4DNT B;  2VBU A;  4XOR A;  4DK0 A;  5FL7 A;  1WPC A;  4LBY A;  4QVA A;  4Z4R A;  4M53 A;  2AHO A;  3W2I A;  1G7R A;  1VQN B;  1E1Q A;  2GK6 A;  4G1B A;  2M5S A;  1WSR A;  3CCM B;  4PC7 A;  2C5H A;  2V7W A;  2CF4 A;  3QSY A;  3ONY A;  1G7C A;  2CK3 A;  4F7D A;  3AVU A;  4RD1 A;  1N0U A;  2XEX A;  3OKX A;  4PC2 A;  3SLN A;  2OTJ B;  1AIP A;  3R6J A;  4Z4S A;  4UZU A;  1W35 A;  1UD2 A;  5TV2 A;  5F4O A;  4FK8 A;  3NE5 B;  2YWG A;  3OPO A;  2QGG A;  4X0C A;  3AGP A;  3Q38 A;  3BH4 A;  5FA6 A;  2B7C A;  3PUN A;  3JQR A;  1P4M A;  1R5O A;  3LO8 A;  4ZCL A;  1NJI D;  3CMA B;  1B23 P;  2V7U A;  1H8E A;  4YAW A;  3WY9 A;  3A3G A;  2V7T A;  1YLO A;  1KK1 A;  4RJL A;  1N05 A;  5EMN A;  5HZB A;  2X85 A;  4YAL A;  4RDJ A;  3OW7 A;  5KNL A;  2BSA A;  1N08 A;  4XKW A;  1BX0 A;  1FND A;  2ZTN A;  2VJI A;  4HIZ A;  4LBZ A;  1IB0 A;  2VBS A;  2VZL A;  4RCY A;  3WND A;  2X6W A;  3KEW A;  1F60 A;  1PJ6 A;  1UD3 A;  2GJK A;  1DDG A;  2ZL5 A;  4XMY A;  1J9Z A;  1VQL B;  3CCE B;  1BMF A;  1Y0Y A;  2OK8 A;  2Q6L A;  4XLE A;  3CC2 B;  3QFS A;  2CND A;  2ZL7 A;  2QE7 A;  4M0L A;  1Q9S A;  5KW9 A;  1WP6 A;  5IYN A;  1GR1 A;  2B5O A;  2GRE A;  2QDX A;  1CNE A;  2X6X A;  3D26 A;  2V7Q A;  1H42 A;  3ZC3 A;  5JBQ A;  3A35 A;  3W2E A;  2QA4 B;  2VNJ A;  3JU4 A;  2C4T A;  4AF6 A;  3BNW A;  5AN9 A;  4QHY A;  3CC7 B;  1G7S A;  1IJE A;  1BX1 A;  4P25 A;  3ZUG A;  5BSY A;  3VR6 A;  2JIZ A;  1FNB A;  4UZE A;  4X7C A;  1K8A D;  1BQE A;  4H9G A;  3W2G A;  1VQ5 B;  3OJX A;  5A88 A;  4E0F A;  4XOP A;  1A8P A;  3AVY A;  4TN1 A;  2WJV A;  3ASP A;  3V76 A;  4B4D A;  2R9V A;  1VQ9 B;  5F4M A;  2DOG A;  4RPB A;  2ZZQ A;  1ZM2 A;  2VJJ A;  3VO2 A;  4X06 A;  3LNN A;  4LBV A;  2NPF A;  2VBT A;  4P6Y A;  4U9U A;  2D3N A;  4ZCM A;  1FNM A;  2Q6I A;  4BPR A;  2X8K A;  2PIA A;  5BSX A;  1KK3 A;  3Q6Q A;  4B47 A;  1E63 A;  1VJS A;  2LZJ A;  4FWT A;  2BF4 A;  4B43 A;  1QGZ A;  3ISX A;  1GAW A;  4B3F X;  1W2B B;  1VLY A;  1WOO A;  2QTZ A;  1FDR A;  4OPV A;  1SKY B;  4WWV A;  3A1P A;  1Q82 D;  1F20 A;  2XGJ A;  2ZBU A;  4DQL A;  4N3G A;  4ACB A;  2ZXI A;  4AF7 A;  2Q6O A;  1E43 A;  4RM0 A;  4ROX A;  1QH0 A;  1UD4 A;  3CES A;  4Y7C A;  1VQ6 B;  2I1L A;  2YWE A;  1NDH A;  1UD6 A;  2OYN A;  4G1V A;  1H85 A;  4DNR B;  1RQR A;  4P22 A;  3WNB A;  1Q86 D;  1DG1 G;  4LC0 A;  4J0Q A;  5IYQ A;  4YXW A;  4P3I A;  4TT3 A;  4XR6 A;  4TMX A;  3CCJ B;  2XNJ A;  2XZP A;  4Y9U A;  5HXB A;  1YI2 B;  3SEJ A;  3AST A;  2X53 S;  2BGJ A;  4B3X A;  2OBS A;  1VQK B;  1S0U A;  2NV4 A;  3ZIA A;  1VQ4 B;  3ASR A;  1TTT A;  1QG0 A;  1KZL A;  1UMK A;  4XON A;  3WXM A;  4X8I A;  4YEL A;  2DIE A;  3QFT A;  2EFG A;  3PEN A;  3A8K A;  4P6V F;  2XOK A;  2P3M A;  4TSF A;  1KTV A;  1SM4 A;  4YAF A;  1YJ9 B;  3W2F A;  1JB9 A;  3GIR A;  1WDT A;  3FJO A;  4II2 A;  2DY1 A;  3FPK A;  5TR9 A;  1KC8 D;  5FIU A;  2OTL B;  4DK1 A;  4PGO A;  1YJN B;  2DET A;  1DDI A;  3Q6R A;  4YEJ A;  1YIT B;  4HE6 A;  4Z4U A;  2X6Y A;  1YIJ B;  3U2Q A;  1V0F A;  4RD2 A;  4RD3 A;  3CB4 A;  4RCZ A;  1EFU A;  1HA3 A;  3ZZ0 A;  1KD1 D;  1VQO B;  3VNV A;  2BN4 A;  4TMW A;  2VNI A;  4XN0 A;  2XZO A;  2XZL A;  4P9S A;  1FRN A;  1UD5 A;  4MYU A;  4KKS A;  2Q6K A;  2C4U A;  2BVN A;  1ZM9 A;  4FN5 A;  3CC4 B;  2VNH A;  3ASS A;  1W34 A;  3GVK A;  1WOS A;  3HAG A;  4M2L A;  3OZU A;  4X7D A;  1NB9 A;  2WZP P;  2X3U A;  1E3X A;  3A8I A;  4PC1 A;  5THX A;  5H5J A;  1OB2 A;  1OGJ A;  4QV2 A;  1YHQ B;  3G71 B;  2VNK A;  4NNJ A;  4Z4Y A;  4P12 A;  5GV7 A;  4PAA A;  1KK0 A;  1FNC A;  4OOX A;  4AVZ A;  3GVL A;  3CP2 A;  4GQN A;  4XLC A;  2QTL A;  1ZUN B;  2PMD A;  1IHM A;  2X0K A;  2QN6 A;  2PE3 A;  2BM1 A;  2R6H A;  3V7A A;  1AMO A;  1B2R A;  4RD0 A;  3OE7 A;  3SJZ A;  3H9N A;  1N06 A;  2F1M A;  3PVD A;  4Z1M A;  1PJ7 A;  3CD6 B;  1I18 A;  3T51 B;  2V7X A;  3P26 A;  3OP1 A;  1MRZ A;  4ACA A;  1VHO A;  4MYT A;  1S4M A;  2BPO A;  4QVJ A;  4Y9R A;  2XND A;  4TMZ A;  3B82 A;  3GQB A;  3GVJ A;  1E62 A;  3VO1 A;  2WYR A;  2FX3 A;  2ZZF A;  2ZZE A;  1H8H A;  4L8J A;  3AVT A;  2ZBV A;  5J3O A;  2V4D A;  2WSS A;  3W5H A;  1EWY A;  2DEU A;  2DCU A;  4Z4T A;  5CDF A;  3ZBT A;  4RD6 A;  4P26 A;  3CP8 A;  1WU8 A;  1QUF A;  2KVO A;  4B48 A;  1BJK A;  3OZW A;  2RC6 A;  1PKV A;  3FKS A;  3Q39 A;  4ZV4 A;  3RY8 A;  4AC9 A;  5TRD A;  2RC5 A;  1VQ7 B;  1T6Y A;  4XLH A;  1EFC A;  3CW2 A;  3CMM A;  2ZXH A;  4CQJ A;  1CNF A;  2C78 A;  4ZGQ B;  3CXC B;  1OGI A;  2ZZG A;  4RPD A;  3CCV B;  2BV3 A;  1HVX A;  3OFN A;  3QFC A;  5KSW B;  2JJ1 A;  4LBW A;  1QVG B;  2DYI A;  3MHP A;  4XM3 A;  5J35 A;  3ONU A;  3G4S B;  4UAJ A;  4JMQ A;  3WQZ A;  3BY2 A;  1ZM3 A;  1GAQ A;  1NB0 A;  1DAR A;  1TVC A;  1YX2 A;  2WZN A;  3AVW A;  1VHE A;  1K28 D;  3PA2 A;  3U6K A;  1MAB A;  2BM0 A;  3CCL B;  4Z4V A;  1T6Z A;  1HZE A;  2GJR A;  3ZBU A;  2JJ2 A;  2CC2 A;  4XN3 A;  1QX4 A;  4X07 A;  4OPS A;  2FVG A;  3WYA A;  1QUE A;  4WQM A;  4XOT A;  3QE2 A;  2ZL6 A;  3G05 A;  4P3Y A;  5B6I A;  3OOC A;  1BLI A;  1GO2 A;  1NBM A;  4YAO A;  1UD8 A;  1TLL A;  2BGI A;  4R71 A;  5TY0 A;  1XFO A;  4KKU A;  3I56 B;  1EP2 B;  1QFJ A;  2F1L A;  2E1R A;  2W6J A;  3OJW A;  4K1X A;  1M90 D;  1CQX A;  3I1F A;  1QGA A;  4KKT A;  3WBJ A;  3WNC A;  4OPO A;  3T53 B;  2Z6B D;  4Z4W A;  1Q81 D;  1W0K A;  4N3N A;  1Q7Y D;  1D8T A;  4Q7J B;  3I55 B;  1Y0R A;  5FO0 A;  4DQK A;  3OW2 B;  3LVB A;  3BC9 A;  5DS0 A;  1E3Z A;  1TUI A;  2OK7 A;  3CTA A;  1K9M D;  3OAA A;  4G7W A;  2F43 A;  3PUM A;  2C77 A;  4P2N A;  1YJW B;  1OB5 A;  4RDL A;  2EIX A;  2DER A;  4XQF A;  3W5V A;  2VYQ A;  2JDI A;  1KJZ A;  3B8H A;  1VLO A;  1COW A;  1QFZ A;  1R5B A;  4XD7 A;  2C5B A;  5IK2 A;  5HKK A;  1VQP B;  4PC6 A;  3CCR B;  5F4J A;  1OB0 A;  1E1R A;  3AVV A;  4M4S A;  3R6K A;  1SKQ A;  4M1K A;  2F4N A;  2C2W A;  2OBT A;  4OP7 A;  3A8J A;  1N0V C;  5HZA A;  1VQ8 B;  2HMA A;  4X05 A;  4PAB A;  1R5N A;  5A89 A;  5FO1 A;  4OOS A;  1RQP A;  3W2H A;  5FNZ A;  2PLF A;  1QGY A;  3LQE A;  3WBK A;  4TMT A;  3E20 A;  1QVF B;  3SJP A;  2GQF A;  3PA1 A;  3OEE A;  4ZCI A;  3E1Y E;  3VMF A;  1EFR A;  2D74 A;  4EH1 A;  3ZZU A;  3BCD A;  4NCN A;  1KQS B;  3LQ6 A;  5L46 A;  3AVX A;  1NRK A;  2WPD A;  3ES9 A;  1JA1 A;  1T5E A;  1KMH A;  2QMU A;  1JJ2 B;  2J7K A;  2HCJ B;  2ZIT A;  1JA0 A;  4C43 A;  1N07 A;  4TKO B;  4XKV A;  1S72 B;  3G6E B;  3SLD A;  3MCA A;  4XLF A;  2HDN B;  3H94 A;  1XB2 A;  2BMW A;  4ZGN B;  1WOR A;  1V0E A;  1KRH A;  3KL9 A;  4G5G A;  4WZT A;  2GPJ A;  3A3B A;  2QEX B;  4ASU A;  1XQB A;  4P1V A;  4HE5 A;  3VNU A;  4Z4Z A;  2YWF A;  4B3G A;  1KK2 A;  4RLZ A;  3BY1 A;  1EFT A;  5A8A A;  2CW5 A;  5DSZ A;  1VQM B;  4X7F A;  2W6I A;  2JN9 A;  1EXM A; 
#chains in the Genus database with same CATH homology
 3CTA A;  1T6X A;  2VBS A;  1N07 A;  4UZE A;  2X0K A;  5A89 A;  5A88 A;  4UZF A;  5FO1 A;  5FNZ A;  1N06 A;  1NB0 A;  2VBU A;  1Q9S A;  1P4M A;  2I1L A;  5TRD A;  2P3M A;  2OYN A;  1T6Z A;  3OP1 A;  1NB9 A;  1MRZ A;  1T6Y A;  2VBV A;  2VBT A;  1S4M A;  3BNW A;  1N05 A;  5A8A A;  5FO0 A;  1N08 A;  3ZUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...