1N06A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE riboflavin kinase
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 34
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n06A00
4UZFA 5A88A 1N05A 1S4MA 5FO1A 1T6ZA 1T6XA 3OP1A 5A89A 1P4MA 1N06A 1N08A 1Q9SA 5FO0A 2I1LA 2VBSA 4UZEA 5TRDA 1NB0A 2P3MA 3BNWA 2VBUA 2OYNA 3ZUGA 3CTAA 1MRZA 1N07A 1NB9A 2VBTA 5FNZA 2X0KA 1T6YA 5A8AA 2VBVA
chains in the Genus database with same CATH superfamily
1V5VA 4Z4UA 1QFYA 3QFRA 1QUFA 3W2GA 1ZUNB 2QA4B 2DEUA 2VNJA 1T6XA 3JQRA 2GK7A 1BMFA 1VQLB 5KW9A 1FNBA 2X6WA 3HAGA 4QV2A 1GJRA 2DCUA 5HZBA 1RQPA 1EFCA 4B47A 4ROXA 1W0KA 3WXMA 3CCJB 1HVXA 4OPOA 2QE7A 1E64A 3OKXA 4Z4TA 1N8RD 3MCAA 1NBMA 2R6HA 1VQPB 2JN9A 2YWHA 4TMVA 1QVGB 2BGIA 1I8DA 4RPDA 4XLCA 1DG1G 1E3ZA 3LNNA 1N05A 3LO8A 1Q86D 4XLEA 1CNFA 4RJLA 4ASUA 3GVLA 1A8PA 2ZBUA 4B44A 1N0VC 2ZBVA 1QFZA 3PENA 2BSAA 1OB2A 4FXUA 1FRNA 2Q6OA 3W2FA 5TRDA 4BPRA 4QVAA 1AIPA 3ZBTA 1ZM9A 3V7AA 3VMFA 1V0EA 2V7VA 4YHBA 2ZZFA 3ZIAA 1FRQA 2D3LA 5THXA 4P12A 3ES9A 3OAAA 5J3OA 4IW3B 3CCMB 4YALA 1VQ8B 2C78A 2WPDA 3PUMA 4ZGQB 4ZV4A 1JJ2B 4XN3A 3CCRB 1Y0YA 4X05A 1KMHA 3OEEA 1WSVA 1SKQA 4Y7CA 2WZPP 1NRKA 1B23P 2Z6BD 3PVDA 4EH1A 1NDHA 5CDFA 1K28D 4Z4RA 1D1NA 1HZEA 4ZCLA 3VR6A 1YJWB 1Y0RA 1UD8A 3AVWA 5E6TA 2YWGA 1E63A 2DY1A 4PC1A 4XNFA 3V76A 5GV7A 4P25A 2X6YA 3CCEB 4WWVA 3W5UA 1KK3A 3BNWA 4AC9A 4Z4SA 3OFNA 1UD4A 2E1BA 4DQLA 1AMOA 1YITB 4N3NA 1W35A 3BQJA 3CB4A 2X6XA 2DOGA 4TMXA 2XEXA 1IJFA 4LBVA 3SLNA 3WNCA 3U2QA 4Y9RA 3BH4A 2ZZQA 1RQRA 1DDGA 1KK2A 2CNDA 2X3UA 4U9UA 1N08A 2CBXA 1B2RA 4II3A 1VLYA 4LC0A 1WORA 1QVFB 1VQ5B 3MHPA 5HXBA 2VBSA 1FNMA 1TUIA 2QDXA 3A1PA 4DK0A 5H5JA 2R9VA 3Q6RA 1R5OA 3OJWA 4Z4VA 1BX0A 4RD0A 3WNDA 5IYPA 1CQXA 1WOSA 4XOTA 2BM0A 1HA3A 2XOKA 3GSIA 1PJ7A 3CP8A 2C77A 4AF7A 2QTZA 4JMQA 3CRZA 3GVJA 3VNUA 2RC6A 2PLFA 1YI2B 3OW2B 2ZZEA 2WSSA 2C5BA 5FO1A 4OPVA 2CF4A 2EIXA 2M5SA 3CC4B 1VQ6B 1WOPA 3B78A 3BY2A 2NV4A 4G7WA 3SJPA 2CC2A 2WJVA 3FPPA 1KJZA 4B4DA 4X7FA 4G1VA 2HMAA 1R5BA 2JIZA 4FN5A 2WR8A 4P6VF 3OW7A 1VQ4B 1U2RA 1OHHA 2PE3A 4DNTB 2QEXB 3A3BA 2XZOA 4KKSA 1H85A 3SLDA 4FWTA 1DDIA 1BQEA 3AVTA 1Q81D 5GV8A 2GQFA 1R5NA 1BLIA 1KK1A 1W34A 2GJKA 3ASQA 1EP1B 1YLOA 4LBZA 1S4MA 1GR1A 3VO2A 2B5OA 1EP3B 2AHOA 1QUEA 1KTVA 2ZITA 4RPBA 2DERA 1VHEA 3CESA 5JBQA 3H9NA 4YAWA 3CMEB 2C5HA 1WDTA 3PUNA 2BMWA 4LBWA 1JNYA 4YAOA 3AVXA 2BV3A 1M90D 4P1VA 4XOPA 2KVOA 4Z4WA 2B7BA 4CQJA 1TLLA 4P3YA 3ASPA 1PJ5A 4Z1MA 3MMPA 3KEWA 4RLZA 1EP2B 2GK6A 1T6YA 5A8AA 4AF6A 4XKVA 1KK0A 4B3FX 1M1KD 1VQKB 2JJ2A 1WOOA 3RY8A 2OYNA 4P26A 4ZCIA 4ACBA 3DDYA 4PGOA 1KZLA 2X53S 3OZUA 4TMWA 1E1RA 5BSYA 3WQZA 2C4TA 2VZLA 3ZC3A 4C43A 3ZZUA 5H59A 1IB0A 3G71B 1JB9A 3CD6B 4XORA 2HCJB 3AVUA 4X7CA 3QE2A 2XGJA 4WZEA 1VQOB 4R71A 2DIEA 1NB0A 5F4MA 4G7XA 2CRVA 2D74A 4HIZA 4XR6A 3CTAA 2OTLB 2QTLA 2GJPA 2XZPA 2BVNA 2V31A 2VJIA 5FL7A 3WYAA 3W2IA 3I56B 3FKSA 1VJSA 4X07A 4YEJA 1E3XA 1PJ6A 3W2HA 3AVVA 1WPCA 1S0UA 1JA0A 5A88A 3CXCB 1GO2A 1ZM4A 3P27A 3E1YE 2VYQA 4WZLA 3BCFA 5A89A 3AVYA 4QUZA 3B82A 5IYRA 3ONYA 3CCVB 1VQ9B 1QGZA 3J81k 1QG0A 2QN6A 1FX0A 3T51B 2OBSA 2BGJA 5FA6A 4G5GA 2VBTA 3A8IA 5HKKA 3D26A 5TV2A 4ACAA 5IYWA 3G6EB 2Q6KA 4PC6A 1VQMB 3LVBA 4NNJA 1XQBA 1CNEA 1OB0A 1IJEA 1G7TA 2EFGA 1T6ZA 4X7EA 3FJOA 4OOVA 3WBJA 1Q82D 4UZUA 1PKVA 2ZL5A 3ASRA 3CCSB 2V7WA 4XLAA 4B3GA 4X0CA 1F20A 4KKTA 5TR9A 3Q6QA 1EWYA 4XL9A 1WP6A 4NBSA 4TSFA 1QFJA 3P26A 1T5EA 2V4DA 3QFTA 4J0QA 4XONA 1DARA 4RD2A 1E1QA 3QFCA 3OOCA 3CCQB 3AGQA 4MYUA 3A3GA 4RD1A 5DN6A 1Q9SA 4QHYA 5TY0A 1H8HA 4ZCMA 1F60A 2F1MA 2V7TA 3KL9A 4N3GA 1UD2A 1VHOA 2BM1A 2E1RA 2VNIA 4YAFA 3H94A 3T56B 1VQNB 4B43A 1Q7YD 5FIUA 2YWEA 1N0UA 1MABA 4TMZA 2HDNB 4GQNA 5BSXA 4QVJA 4XD7A 1COWA 1G7SA 1GAWA 1NB9A 4P22A 5AN9A 2Q6LA 1ZM2A 4UAJA 1G7RA 5DS0A 3PA2A 4TMTA 4M53A 2X8KA 3CPXA 2WJYA 4UZFA 2CW5A 4PAAA 3BC9A 3CPWB 2F1LA 4P9SA 1E79A 3ZZ0A 2V7UA 5FO0A 2XNJA 3BCDA 2NPFA 1NJID 2ZZGA 2HLDA 2CK3A 5DSZA 3WNBA 4TKOB 4PC2A 3W2EA 3ZUGA 1MRZA 1TVCA 3W5VA 1QGYA 1E62A 2D9RA 4RCZA 4DNRB 3JQPA 4KKUA 4B3XA 2JDIA 5KSWB 2PMDA 4X06A 4NCNA 5IK2A 4OP7A 3LQ6A 4M2LA 1BPLA 1E43A 2VJJA 3OZWA 3QFSA 4PABA 2OK7A 2WZNA 4XQFA 3ISXA 5F4JA 2V7QA 3FPKA 4RD4A 3BY1A 3CMAB 4Y9UA 2W6JA 3A8JA 4QFMA 1WU8A 2I1LA 2FX3A 2FVGA 4XKWA 3B8HA 3CCLB 2ZXIA 3SEJA 1OGIA 3GIRA 3E20A 2GPJA 3PA1A 2ZTNA 2GREA 5LMZA 2OBRA 1EFUA 4RD6A 1H42A 3ASSA 3VNVA 1TTTA 3Q39A 1UD3A 4P2NA 1VQ7B 2ZTGA 2LZJA 4P6YA 4TT3A 4C0SA 3QSYA 1YIJB 1VF7A 1OB5A 3CP2A 3GVKA 5B6IA 1IHMA 4Z4ZA 4X8IA 4RDJA 1K9MD 4E0FA 1P4MA 4DK1A 4RD3A 1W0JA 4WZTA 2OK8A 1YJNB 3JU4A 1WSRA 2OBTA 2VNHA 4RDLA 2YWFA 4G1BA 2BPOA 1YJ9B 2RC5A 3Q38A 1UD5A 4AVZA 4OOXA 4UZEA 3NE5B 4WQMA 3U6KA 4K1XA 2OTJB 3OE7A 3Q3AA 1G7CA 4M0LA 3CC7B 4OOSA 3VO1A 2XNCA 4FK8A 4II2A 3CC2B 1WTHD 1UMKA 2D3NA 4PC3A 4H9GA 4Q7JB 1J9ZA 1JA1A 1KRHA 1QX4A 3OP1A 1GVHA 3G05A 3ZZTA 2JJ1A 5F4OA 1GAQA 1W87A 2GJRA 2DYIA 1D2EA 1EFTA 1FDRA 2XNDA 3LQEA 4B48A 3ASTA 4P3IA 4WZKA 4X7DA 1XB2A 4MYTA 3WY9A 1V0FA 3A8KA 2P3MA 2VBUA 2ZL6A 3CCUB 1EFRA 1N07A 2F43A 4XMYA 4YXWA 3G4SB 2B7CA 2X0KA 4Z4YA 3OJXA 3R6JA 4XM3A 1ZM3A 4M4SA 1XE1A 3I1FA 4OPSA 3T53B 5HZAA 1EXMA 1S72B 3ZPNA 1K73D 2V7XA 4RM0A 2X85A 4G6IA 1N06A 3OPOA 1KQSB 2Q6IA 1QGAA 1K8AD 4HE5A 1ELOA 1XFOA 4RDKA 1BJKA 3CMMA 3ZBUA 3AGPA 4YELA 4M1KA 4PC7A 3SJZA 3WBKA 1SKYB 2ZL7A 2J7KA 2QGGA 3OZVA 2BN4A 3R6KA 1I18A 2PIAA 4YAUA 5KNLA 1UD6A 1BX1A 1QH0A 5FNZA 3U6BA 3CW2A 4XN0A 2C4UA 1YX2A 3JQQA 4ZGNB 4XLFA 1W2BB 3I55B 1SM4A 2VBVA 3GQBA 1YHQB 1KC8D 3W5HA 1OGJA 2F4NA 2VNKA 1H8EA 5IYQA 4RCYA 1VLOA 1FNDA 2XZLA 1FNCA 2W6IA 1D8TA 4XLHA 1KD1D 4TN1A 2QMUA 4HE6A 5IYNA 2C2WA 4LBYA 2WYRA 5L46A 1I7PA 3ONUA 3A35A 4L8JA 2ZXHA 3SKBA 3OEHA 1W9XA 2BF4A 4DQKA 5EMNA 4F7DA 2DETA 5J35A
chains in the Genus database with same CATH topology
4UZFA 5A88A 1N05A 1S4MA 5FO1A 1T6ZA 1T6XA 3OP1A 5A89A 1P4MA 1N06A 1N08A 1Q9SA 5FO0A 2I1LA 2VBSA 4UZEA 5TRDA 1NB0A 2P3MA 3BNWA 2VBUA 2OYNA 3ZUGA 3CTAA 1MRZA 1N07A 1NB9A 2VBTA 5FNZA 2X0KA 1T6YA 5A8AA 2VBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZF A;  5A88 A;  1N05 A;  1S4M A;  5FO1 A;  1T6Z A;  1T6X A;  3OP1 A;  5A89 A;  1P4M A;  1N06 A;  1N08 A;  1Q9S A;  5FO0 A;  2I1L A;  2VBS A;  4UZE A;  5TRD A;  1NB0 A;  2P3M A;  3BNW A;  2VBU A;  2OYN A;  3ZUG A;  3CTA A;  1MRZ A;  1N07 A;  1NB9 A;  2VBT A;  5FNZ A;  2X0K A;  1T6Y A;  5A8A A;  2VBV A; 
#chains in the Genus database with same CATH topology
 1V5V A;  4Z4U A;  1QFY A;  3QFR A;  1QUF A;  3W2G A;  1ZUN B;  2QA4 B;  2DEU A;  2VNJ A;  1T6X A;  3JQR A;  2GK7 A;  1BMF A;  1VQL B;  5KW9 A;  1FNB A;  2X6W A;  3HAG A;  4QV2 A;  1GJR A;  2DCU A;  5HZB A;  1RQP A;  1EFC A;  4B47 A;  4ROX A;  1W0K A;  3WXM A;  3CCJ B;  1HVX A;  4OPO A;  2QE7 A;  1E64 A;  3OKX A;  4Z4T A;  1N8R D;  3MCA A;  1NBM A;  2R6H A;  1VQP B;  2JN9 A;  2YWH A;  4TMV A;  1QVG B;  2BGI A;  1I8D A;  4RPD A;  4XLC A;  1DG1 G;  1E3Z A;  3LNN A;  1N05 A;  3LO8 A;  1Q86 D;  4XLE A;  1CNF A;  4RJL A;  4ASU A;  3GVL A;  1A8P A;  2ZBU A;  4B44 A;  1N0V C;  2ZBV A;  1QFZ A;  3PEN A;  2BSA A;  1OB2 A;  4FXU A;  1FRN A;  2Q6O A;  3W2F A;  5TRD A;  4BPR A;  4QVA A;  1AIP A;  3ZBT A;  1ZM9 A;  3V7A A;  3VMF A;  1V0E A;  2V7V A;  4YHB A;  2ZZF A;  3ZIA A;  1FRQ A;  2D3L A;  5THX A;  4P12 A;  3ES9 A;  3OAA A;  5J3O A;  4IW3 B;  3CCM B;  4YAL A;  1VQ8 B;  2C78 A;  2WPD A;  3PUM A;  4ZGQ B;  4ZV4 A;  1JJ2 B;  4XN3 A;  3CCR B;  1Y0Y A;  4X05 A;  1KMH A;  3OEE A;  1WSV A;  1SKQ A;  4Y7C A;  2WZP P;  1NRK A;  1B23 P;  2Z6B D;  3PVD A;  4EH1 A;  1NDH A;  5CDF A;  1K28 D;  4Z4R A;  1D1N A;  1HZE A;  4ZCL A;  3VR6 A;  1YJW B;  1Y0R A;  1UD8 A;  3AVW A;  5E6T A;  2YWG A;  1E63 A;  2DY1 A;  4PC1 A;  4XNF A;  3V76 A;  5GV7 A;  4P25 A;  2X6Y A;  3CCE B;  4WWV A;  3W5U A;  1KK3 A;  3BNW A;  4AC9 A;  4Z4S A;  3OFN A;  1UD4 A;  2E1B A;  4DQL A;  1AMO A;  1YIT B;  4N3N A;  1W35 A;  3BQJ A;  3CB4 A;  2X6X A;  2DOG A;  4TMX A;  2XEX A;  1IJF A;  4LBV A;  3SLN A;  3WNC A;  3U2Q A;  4Y9R A;  3BH4 A;  2ZZQ A;  1RQR A;  1DDG A;  1KK2 A;  2CND A;  2X3U A;  4U9U A;  1N08 A;  2CBX A;  1B2R A;  4II3 A;  1VLY A;  4LC0 A;  1WOR A;  1QVF B;  1VQ5 B;  3MHP A;  5HXB A;  2VBS A;  1FNM A;  1TUI A;  2QDX A;  3A1P A;  4DK0 A;  5H5J A;  2R9V A;  3Q6R A;  1R5O A;  3OJW A;  4Z4V A;  1BX0 A;  4RD0 A;  3WND A;  5IYP A;  1CQX A;  1WOS A;  4XOT A;  2BM0 A;  1HA3 A;  2XOK A;  3GSI A;  1PJ7 A;  3CP8 A;  2C77 A;  4AF7 A;  2QTZ A;  4JMQ A;  3CRZ A;  3GVJ A;  3VNU A;  2RC6 A;  2PLF A;  1YI2 B;  3OW2 B;  2ZZE A;  2WSS A;  2C5B A;  5FO1 A;  4OPV A;  2CF4 A;  2EIX A;  2M5S A;  3CC4 B;  1VQ6 B;  1WOP A;  3B78 A;  3BY2 A;  2NV4 A;  4G7W A;  3SJP A;  2CC2 A;  2WJV A;  3FPP A;  1KJZ A;  4B4D A;  4X7F A;  4G1V A;  2HMA A;  1R5B A;  2JIZ A;  4FN5 A;  2WR8 A;  4P6V F;  3OW7 A;  1VQ4 B;  1U2R A;  1OHH A;  2PE3 A;  4DNT B;  2QEX B;  3A3B A;  2XZO A;  4KKS A;  1H85 A;  3SLD A;  4FWT A;  1DDI A;  1BQE A;  3AVT A;  1Q81 D;  5GV8 A;  2GQF A;  1R5N A;  1BLI A;  1KK1 A;  1W34 A;  2GJK A;  3ASQ A;  1EP1 B;  1YLO A;  4LBZ A;  1S4M A;  1GR1 A;  3VO2 A;  2B5O A;  1EP3 B;  2AHO A;  1QUE A;  1KTV A;  2ZIT A;  4RPB A;  2DER A;  1VHE A;  3CES A;  5JBQ A;  3H9N A;  4YAW A;  3CME B;  2C5H A;  1WDT A;  3PUN A;  2BMW A;  4LBW A;  1JNY A;  4YAO A;  3AVX A;  2BV3 A;  1M90 D;  4P1V A;  4XOP A;  2KVO A;  4Z4W A;  2B7B A;  4CQJ A;  1TLL A;  4P3Y A;  3ASP A;  1PJ5 A;  4Z1M A;  3MMP A;  3KEW A;  4RLZ A;  1EP2 B;  2GK6 A;  1T6Y A;  5A8A A;  4AF6 A;  4XKV A;  1KK0 A;  4B3F X;  1M1K D;  1VQK B;  2JJ2 A;  1WOO A;  3RY8 A;  2OYN A;  4P26 A;  4ZCI A;  4ACB A;  3DDY A;  4PGO A;  1KZL A;  2X53 S;  3OZU A;  4TMW A;  1E1R A;  5BSY A;  3WQZ A;  2C4T A;  2VZL A;  3ZC3 A;  4C43 A;  3ZZU A;  5H59 A;  1IB0 A;  3G71 B;  1JB9 A;  3CD6 B;  4XOR A;  2HCJ B;  3AVU A;  4X7C A;  3QE2 A;  2XGJ A;  4WZE A;  1VQO B;  4R71 A;  2DIE A;  1NB0 A;  5F4M A;  4G7X A;  2CRV A;  2D74 A;  4HIZ A;  4XR6 A;  3CTA A;  2OTL B;  2QTL A;  2GJP A;  2XZP A;  2BVN A;  2V31 A;  2VJI A;  5FL7 A;  3WYA A;  3W2I A;  3I56 B;  3FKS A;  1VJS A;  4X07 A;  4YEJ A;  1E3X A;  1PJ6 A;  3W2H A;  3AVV A;  1WPC A;  1S0U A;  1JA0 A;  5A88 A;  3CXC B;  1GO2 A;  1ZM4 A;  3P27 A;  3E1Y E;  2VYQ A;  4WZL A;  3BCF A;  5A89 A;  3AVY A;  4QUZ A;  3B82 A;  5IYR A;  3ONY A;  3CCV B;  1VQ9 B;  1QGZ A;  3J81 k;  1QG0 A;  2QN6 A;  1FX0 A;  3T51 B;  2OBS A;  2BGJ A;  5FA6 A;  4G5G A;  2VBT A;  3A8I A;  5HKK A;  3D26 A;  5TV2 A;  4ACA A;  5IYW A;  3G6E B;  2Q6K A;  4PC6 A;  1VQM B;  3LVB A;  4NNJ A;  1XQB A;  1CNE A;  1OB0 A;  1IJE A;  1G7T A;  2EFG A;  1T6Z A;  4X7E A;  3FJO A;  4OOV A;  3WBJ A;  1Q82 D;  4UZU A;  1PKV A;  2ZL5 A;  3ASR A;  3CCS B;  2V7W A;  4XLA A;  4B3G A;  4X0C A;  1F20 A;  4KKT A;  5TR9 A;  3Q6Q A;  1EWY A;  4XL9 A;  1WP6 A;  4NBS A;  4TSF A;  1QFJ A;  3P26 A;  1T5E A;  2V4D A;  3QFT A;  4J0Q A;  4XON A;  1DAR A;  4RD2 A;  1E1Q A;  3QFC A;  3OOC A;  3CCQ B;  3AGQ A;  4MYU A;  3A3G A;  4RD1 A;  5DN6 A;  1Q9S A;  4QHY A;  5TY0 A;  1H8H A;  4ZCM A;  1F60 A;  2F1M A;  2V7T A;  3KL9 A;  4N3G A;  1UD2 A;  1VHO A;  2BM1 A;  2E1R A;  2VNI A;  4YAF A;  3H94 A;  3T56 B;  1VQN B;  4B43 A;  1Q7Y D;  5FIU A;  2YWE A;  1N0U A;  1MAB A;  4TMZ A;  2HDN B;  4GQN A;  5BSX A;  4QVJ A;  4XD7 A;  1COW A;  1G7S A;  1GAW A;  1NB9 A;  4P22 A;  5AN9 A;  2Q6L A;  1ZM2 A;  4UAJ A;  1G7R A;  5DS0 A;  3PA2 A;  4TMT A;  4M53 A;  2X8K A;  3CPX A;  2WJY A;  4UZF A;  2CW5 A;  4PAA A;  3BC9 A;  3CPW B;  2F1L A;  4P9S A;  1E79 A;  3ZZ0 A;  2V7U A;  5FO0 A;  2XNJ A;  3BCD A;  2NPF A;  1NJI D;  2ZZG A;  2HLD A;  2CK3 A;  5DSZ A;  3WNB A;  4TKO B;  4PC2 A;  3W2E A;  3ZUG A;  1MRZ A;  1TVC A;  3W5V A;  1QGY A;  1E62 A;  2D9R A;  4RCZ A;  4DNR B;  3JQP A;  4KKU A;  4B3X A;  2JDI A;  5KSW B;  2PMD A;  4X06 A;  4NCN A;  5IK2 A;  4OP7 A;  3LQ6 A;  4M2L A;  1BPL A;  1E43 A;  2VJJ A;  3OZW A;  3QFS A;  4PAB A;  2OK7 A;  2WZN A;  4XQF A;  3ISX A;  5F4J A;  2V7Q A;  3FPK A;  4RD4 A;  3BY1 A;  3CMA B;  4Y9U A;  2W6J A;  3A8J A;  4QFM A;  1WU8 A;  2I1L A;  2FX3 A;  2FVG A;  4XKW A;  3B8H A;  3CCL B;  2ZXI A;  3SEJ A;  1OGI A;  3GIR A;  3E20 A;  2GPJ A;  3PA1 A;  2ZTN A;  2GRE A;  5LMZ A;  2OBR A;  1EFU A;  4RD6 A;  1H42 A;  3ASS A;  3VNV A;  1TTT A;  3Q39 A;  1UD3 A;  4P2N A;  1VQ7 B;  2ZTG A;  2LZJ A;  4P6Y A;  4TT3 A;  4C0S A;  3QSY A;  1YIJ B;  1VF7 A;  1OB5 A;  3CP2 A;  3GVK A;  5B6I A;  1IHM A;  4Z4Z A;  4X8I A;  4RDJ A;  1K9M D;  4E0F A;  1P4M A;  4DK1 A;  4RD3 A;  1W0J A;  4WZT A;  2OK8 A;  1YJN B;  3JU4 A;  1WSR A;  2OBT A;  2VNH A;  4RDL A;  2YWF A;  4G1B A;  2BPO A;  1YJ9 B;  2RC5 A;  3Q38 A;  1UD5 A;  4AVZ A;  4OOX A;  4UZE A;  3NE5 B;  4WQM A;  3U6K A;  4K1X A;  2OTJ B;  3OE7 A;  3Q3A A;  1G7C A;  4M0L A;  3CC7 B;  4OOS A;  3VO1 A;  2XNC A;  4FK8 A;  4II2 A;  3CC2 B;  1WTH D;  1UMK A;  2D3N A;  4PC3 A;  4H9G A;  4Q7J B;  1J9Z A;  1JA1 A;  1KRH A;  1QX4 A;  3OP1 A;  1GVH A;  3G05 A;  3ZZT A;  2JJ1 A;  5F4O A;  1GAQ A;  1W87 A;  2GJR A;  2DYI A;  1D2E A;  1EFT A;  1FDR A;  2XND A;  3LQE A;  4B48 A;  3AST A;  4P3I A;  4WZK A;  4X7D A;  1XB2 A;  4MYT A;  3WY9 A;  1V0F A;  3A8K A;  2P3M A;  2VBU A;  2ZL6 A;  3CCU B;  1EFR A;  1N07 A;  2F43 A;  4XMY A;  4YXW A;  3G4S B;  2B7C A;  2X0K A;  4Z4Y A;  3OJX A;  3R6J A;  4XM3 A;  1ZM3 A;  4M4S A;  1XE1 A;  3I1F A;  4OPS A;  3T53 B;  5HZA A;  1EXM A;  1S72 B;  3ZPN A;  1K73 D;  2V7X A;  4RM0 A;  2X85 A;  4G6I A;  1N06 A;  3OPO A;  1KQS B;  2Q6I A;  1QGA A;  1K8A D;  4HE5 A;  1ELO A;  1XFO A;  4RDK A;  1BJK A;  3CMM A;  3ZBU A;  3AGP A;  4YEL A;  4M1K A;  4PC7 A;  3SJZ A;  3WBK A;  1SKY B;  2ZL7 A;  2J7K A;  2QGG A;  3OZV A;  2BN4 A;  3R6K A;  1I18 A;  2PIA A;  4YAU A;  5KNL A;  1UD6 A;  1BX1 A;  1QH0 A;  5FNZ A;  3U6B A;  3CW2 A;  4XN0 A;  2C4U A;  1YX2 A;  3JQQ A;  4ZGN B;  4XLF A;  1W2B B;  3I55 B;  1SM4 A;  2VBV A;  3GQB A;  1YHQ B;  1KC8 D;  3W5H A;  1OGJ A;  2F4N A;  2VNK A;  1H8E A;  5IYQ A;  4RCY A;  1VLO A;  1FND A;  2XZL A;  1FNC A;  2W6I A;  1D8T A;  4XLH A;  1KD1 D;  4TN1 A;  2QMU A;  4HE6 A;  5IYN A;  2C2W A;  4LBY A;  2WYR A;  5L46 A;  1I7P A;  3ONU A;  3A35 A;  4L8J A;  2ZXH A;  3SKB A;  3OEH A;  1W9X A;  2BF4 A;  4DQK A;  5EMN A;  4F7D A;  2DET A;  5J35 A; 
#chains in the Genus database with same CATH homology
 4UZF A;  5A88 A;  1N05 A;  1S4M A;  5FO1 A;  1T6Z A;  1T6X A;  3OP1 A;  5A89 A;  1P4M A;  1N06 A;  1N08 A;  1Q9S A;  5FO0 A;  2I1L A;  2VBS A;  4UZE A;  5TRD A;  1NB0 A;  2P3M A;  3BNW A;  2VBU A;  2OYN A;  3ZUG A;  3CTA A;  1MRZ A;  1N07 A;  1NB9 A;  2VBT A;  5FNZ A;  2X0K A;  1T6Y A;  5A8A A;  2VBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...