1N06A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE riboflavin kinase
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 34
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n06A00
1P4MA 1T6ZA 2I1LA 1NB9A 2X0KA 1T6YA 5A89A 4UZFA 1N05A 2OYNA 5FO1A 1N06A 5A88A 5FNZA 2VBSA 2P3MA 1MRZA 2VBTA 2VBVA 1S4MA 1N08A 5A8AA 5FO0A 3ZUGA 3CTAA 2VBUA 4UZEA 3OP1A 1NB0A 1T6XA 5TRDA 1Q9SA 1N07A 3BNWA
chains in the Genus database with same CATH superfamily
3OOCA 5TV2A 4ACAA 1YITB 1N8RD 5HKKA 4P2NA 2GJKA 3LQ6A 1D2EA 2C4UA 1OB5A 2XNJA 1WTHD 1VQ7B 4P22A 3CRZA 2CC2A 3CCVB 3OW2B 2JJ2A 1BJKA 2VBSA 2X3UA 1E3ZA 2E1BA 4IW3B 1VQ4B 3CPXA 4X06A 2RC6A 1Q7YD 2R6HA 3MMPA 5CDFA 1M1KD 2D9RA 1RQPA 3CCUB 4MYTA 3FKSA 5BSYA 4B43A 2CRVA 4P1VA 1E3XA 3CB4A 1EP2B 1S0UA 3ZBTA 3PA2A 1KK1A 2ZZFA 3ONUA 4G1BA 4RCZA 3AVVA 1SM4A 4B4DA 4FN5A 3CCEB 3CCMB 1K9MD 1QFZA 3D26A 3PENA 1KTVA 1H42A 4TKOB 1QFYA 3G4SB 3VR6A 1QVFB 2FX3A 2EFGA 4P12A 2PLFA 1ZM2A 2VNJA 4LBWA 1WSRA 1KMHA 2WJVA 4FK8A 4Y9UA 5DSZA 2VNKA 4RLZA 2D74A 3P27A 1JA0A 3OJWA 4XOTA 1YJNB 4XLCA 1G7SA 3RY8A 3VNUA 3PA1A 1TUIA 4UZEA 1VHOA 4C0SA 1K28D 2PIAA 4B47A 4OOSA 4G1VA 4P3YA 2BN4A 2V7TA 2ZL6A 1AMOA 4Z4WA 1KZLA 1HA3A 3B8HA 4X0CA 2KVOA 4RPBA 3CP8A 3CMMA 4QUZA 4PC6A 1H8EA 2X0KA 1Q86D 3CCSB 1KK2A 1VQ5B 1VQNB 3A3GA 2XZLA 5DS0A 1KK3A 1T5EA 5FO1A 3CCRB 1ZUNB 5TY0A 1ZM4A 1GJRA 4HIZA 5KNLA 3CC4B 3Q6QA 3U2QA 5F4MA 3OAAA 4AF6A 4PC7A 4XKWA 2CK3A 4PGOA 4XD7A 4G6IA 3H9NA 4M2LA 2GREA 1E64A 2DIEA 4LC0A 3ZZTA 4TMVA 1H85A 1VHEA 4XLAA 1Q9SA 3OEEA 1GR1A 1FDRA 2QE7A 2X6XA 2ZBVA 1PJ6A 2JIZA 3BCDA 1W9XA 1YIJB 2ZITA 3WNDA 4NNJA 1GVHA 1EP3B 5A89A 1ELOA 1DARA 3W2IA 1COWA 2ZTNA 4Z4TA 3WBJA 3JQQA 1EFRA 4U9UA 2BSAA 4G7XA 4RDJA 5IK2A 2JN9A 3H94A 1YHQB 1EP1B 3I56B 5FIUA 4RPDA 1BQEA 4Z1MA 1QX4A 3BCFA 3QFTA 4B3FX 3OE7A 2ZL7A 2HMAA 3SLDA 1QGYA 3OZWA 1FNMA 3CCLB 4DQLA 4RD0A 3ZPNA 5IYRA 1VQ6B 1T6ZA 4TMWA 1GAWA 4ACBA 2OTLB 2OK8A 2JJ1A 3OKXA 2Q6OA 1BX1A 2Q6IA 3BC9A 5HXBA 3WNCA 4OP7A 1PKVA 3PVDA 3T56B 5EMNA 3GQBA 1QGZA 3MHPA 1U2RA 3T51B 3CP2A 1UD8A 2CW5A 4II3A 2WR8A 4FXUA 4B3GA 3J81k 2E1RA 4UAJA 3WNBA 1DG1G 2XNCA 3SJZA 2OTJB 3WBKA 1F60A 1T6XA 2ZZEA 4YXWA 1QUEA 1PJ7A 1SKQA 3LNNA 3T53B 1AIPA 2W6JA 3AVWA 1KD1D 1VLOA 4RD6A 4XM3A 2DYIA 2WZPP 4ZCIA 1K73D 3I1FA 4YELA 1KRHA 1CNFA 2XZOA 1BMFA 5JBQA 2QMUA 1TVCA 5BSXA 2Z6BD 1YJWB 1V0EA 2C2WA 3E20A 1QUFA 4TSFA 2VBTA 4LBZA 2D3NA 1VQKB 2GJRA 4AF7A 4M53A 2X8KA 1V5VA 3JQPA 3AGQA 4WWVA 5H5JA 4AVZA 4DK1A 3R6JA 3W5HA 4WZTA 3VNVA 2V31A 1FNDA 5B6IA 4TMTA 1E43A 2J7KA 3FJOA 4PC1A 4X7DA 3LO8A 4QV2A 4NBSA 3WXMA 5A88A 1E79A 4Z4ZA 4PC2A 2P3MA 2YWGA 5FA6A 2V7WA 2X85A 3CD6B 2AHOA 4XONA 3V7AA 5GV8A 2YWFA 4X07A 1CNEA 2OBRA 2CBXA 3BY1A 4TN1A 2OK7A 4YAOA 2M5SA 2NPFA 2C4TA 1I8DA 5J35A 3ASQA 3CC2B 1KC8D 1RQRA 4C43A 3ES9A 4YAUA 3ZZ0A 3CCJB 2DEUA 4KKSA 4OPVA 4B3XA 3Q39A 1XQBA 2WSSA 5LMZA 3QE2A 2XGJA 2X53S 3MCAA 4F7DA 2BM0A 2B5OA 3OW7A 1N06A 5KSWB 4OOXA 1N0VC 1B23P 1G7RA 2CNDA 3A1PA 2C5BA 1WP6A 4N3GA 2DY1A 3W2HA 5KW9A 4LBVA 2GPJA 4HE6A 3QFRA 4RDLA 4DNTB 3I55B 2VBUA 4Z4RA 1QVGB 1Q81D 1Y0RA 4DQKA 2CF4A 1H8HA 4Z4UA 1K8AD 2GK6A 1J9ZA 2PE3A 1UD4A 2Q6KA 1S72B 1I18A 1NDHA 4YHBA 4PC3A 1WU8A 1W0JA 1E63A 1VQLB 4P6YA 5F4JA 5IYNA 2GK7A 3OPOA 1TLLA 5FNZA 1E1RA 3QFCA 4YALA 4ROXA 3GVJA 1EXMA 1QG0A 5FO0A 4RD1A 2ZXHA 1FNBA 2W6IA 1NB0A 2QN6A 2F43A 3FPPA 2C78A 3BNWA 3W2FA 3WY9A 1N07A 4XN0A 4AC9A 3P26A 1VQ8B 1GAQA 1UD5A 2BV3A 3WQZA 1NB9A 3WYAA 1QH0A 3BH4A 1E1QA 2BM1A 1GO2A 1UMKA 3CESA 4YAFA 1EFCA 1Y0YA 4KKUA 1KK0A 4XNFA 4HE5A 2VJJA 1VJSA 4PAAA 1V0FA 1D1NA 3R6KA 5HZAA 4QFMA 1N08A 2HDNB 2VJIA 4GQNA 1YLOA 1OB0A 4OPSA 4XOPA 4XL9A 3U6KA 1BX0A 1D8TA 2V7VA 2XNDA 4YEJA 1WOPA 1NRKA 2HCJB 3BQJA 3QFSA 4M0LA 4P26A 4RD2A 3CCQB 1VQ9B 4CQJA 4ASUA 1N0UA 1P4MA 4XN3A 3GSIA 5AN9A 1BLIA 3A8IA 3LQEA 4QVJA 1OGIA 3CMAB 3KL9A 1E62A 4UZFA 3U6BA 1WORA 2VNHA 2QA4B 2QDXA 1QGAA 3W5UA 2OYNA 4WZEA 1WOSA 4G5GA 4NCNA 2HLDA 1VQOB 2V4DA 1YJ9B 3W5VA 2D3LA 4XORA 3V76A 1G7CA 1G7TA 4MYUA 3QSYA 4P6VF 4RDKA 2PMDA 3GVKA 4M4SA 4X8IA 2X6YA 2DETA 4TMXA 3VMFA 2GJPA 4Z4SA 3VO2A 2FVGA 4WQMA 1KQSB 4ZGQB 4TMZA 4N3NA 2JDIA 3SJPA 2RC5A 4LBYA 3Q38A 1HVXA 1EFTA 3GIRA 4RCYA 3ZBUA 1XFOA 4B44A 1VQPB 3HAGA 4DK0A 1NJID 1I7PA 3AVXA 2GQFA 1R5OA 4RJLA 2XOKA 1IHMA 1VLYA 1MRZA 3SEJA 4WZKA 1S4MA 3A8KA 2F1MA 4P25A 3SLNA 2QEXB 1OHHA 3A35A 4ZCLA 4H9GA 1B2RA 4RM0A 1WPCA 2V7XA 1EFUA 4X7EA 3ZIAA 2C77A 3OFNA 1ZM9A 2BPOA 2BVNA 4P3IA 3G05A 2WJYA 4ZV4A 5L46A 1XB2A 5GV7A 2I1LA 3SKBA 1NBMA 3ASTA 4K1XA 1FX0A 3ASRA 1M90D 2DERA 1WDTA 3Q6RA 2C5HA 3A8JA 1FRNA 4BPRA 1DDIA 2VYQA 1OB2A 4XLEA 2ZXIA 1IB0A 4RD3A 2QTZA 2Q6LA 2VZLA 3CXCB 4XLFA 4II2A 4WZLA 5IYWA 1F20A 3BY2A 4QHYA 1R5NA 4XKVA 1FRQA 5IYQA 3PUMA 4JMQA 1Q82D 1EWYA 2OBSA 2QTLA 1W35A 3ISXA 3CPWB 1W2BB 2B7CA 2LZJA 1SKYB 3ONYA 4X7CA 4QVAA 1UD3A 1BPLA 5THXA 4E0FA 5J3OA 1JJ2B 4P9SA 1DDGA 4L8JA 1JA1A 2V7QA 2XZPA 3LVBA 3ASSA 1WOOA 1FNCA 5DN6A 4OPOA 1VF7A 2BMWA 2BF4A 5A8AA 2ZZQA 3E1YE 2ZTGA 2DOGA 4PABA 4EH1A 1JNYA 2OBTA 3B78A 2YWHA 3PUNA 4XMYA 2ZBUA 4KKTA 1IJEA 2ZZGA 4XR6A 3CC7B 5TRDA 1PJ5A 4Z4YA 2DCUA 2NV4A 4RD4A 4Z4VA 3DDYA 2F1LA 1YX2A 2XEXA 1W0KA 1CQXA 1UD2A 4YAWA 4Y7CA 1N05A 3B82A 4R71A 5HZBA 2BGJA 3OJXA 1R5BA 4TT3A 4G7WA 3GVLA 3Q3AA 3CMEB 2EIXA 3AGPA 2QGGA 2X6WA 3ZC3A 3W2EA 3ZUGA 3CTAA 3G71B 1QFJA 3AVTA 1XE1A 1VQMB 3A3BA 1WSVA 1JB9A 3OP1A 1IJFA 3W2GA 1YI2B 3AVUA 2BGIA 4Q7JB 3JU4A 4ZCMA 5IYPA 1W87A 4J0QA 2R9VA 1A8PA 4DNRB 3AVYA 2V7UA 5TR9A 4Y9RA 3ZZUA 4ZGNB 4OOVA 4FWTA 1ZM3A 1T6YA 5E6TA 4B48A 1UD6A 3OEHA 2WPDA 3NE5B 1TTTA 1W34A 4X7FA 2VNIA 3OZUA 1OGJA 2F4NA 3KEWA 2YWEA 4UZUA 4XQFA 2B7BA 2VBVA 3CW2A 4M1KA 4X05A 1HZEA 5FL7A 4XLHA 5H59A 2ZL5A 2WYRA 3FPKA 3G6EB 3ASPA 5F4OA 1MABA 1KJZA 2WZNA 3JQRA 3OZVA 3VO1A
chains in the Genus database with same CATH topology
1P4MA 1T6ZA 2I1LA 1NB9A 2X0KA 1T6YA 5A89A 4UZFA 1N05A 2OYNA 5FO1A 1N06A 5A88A 5FNZA 2VBSA 2P3MA 1MRZA 2VBTA 2VBVA 1S4MA 1N08A 5A8AA 5FO0A 3ZUGA 3CTAA 2VBUA 4UZEA 3OP1A 1NB0A 1T6XA 5TRDA 1Q9SA 1N07A 3BNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4M A;  1T6Z A;  2I1L A;  1NB9 A;  2X0K A;  1T6Y A;  5A89 A;  4UZF A;  1N05 A;  2OYN A;  5FO1 A;  1N06 A;  5A88 A;  5FNZ A;  2VBS A;  2P3M A;  1MRZ A;  2VBT A;  2VBV A;  1S4M A;  1N08 A;  5A8A A;  5FO0 A;  3ZUG A;  3CTA A;  2VBU A;  4UZE A;  3OP1 A;  1NB0 A;  1T6X A;  5TRD A;  1Q9S A;  1N07 A;  3BNW A; 
#chains in the Genus database with same CATH topology
 3OOC A;  5TV2 A;  4ACA A;  1YIT B;  1N8R D;  5HKK A;  4P2N A;  2GJK A;  3LQ6 A;  1D2E A;  2C4U A;  1OB5 A;  2XNJ A;  1WTH D;  1VQ7 B;  4P22 A;  3CRZ A;  2CC2 A;  3CCV B;  3OW2 B;  2JJ2 A;  1BJK A;  2VBS A;  2X3U A;  1E3Z A;  2E1B A;  4IW3 B;  1VQ4 B;  3CPX A;  4X06 A;  2RC6 A;  1Q7Y D;  2R6H A;  3MMP A;  5CDF A;  1M1K D;  2D9R A;  1RQP A;  3CCU B;  4MYT A;  3FKS A;  5BSY A;  4B43 A;  2CRV A;  4P1V A;  1E3X A;  3CB4 A;  1EP2 B;  1S0U A;  3ZBT A;  3PA2 A;  1KK1 A;  2ZZF A;  3ONU A;  4G1B A;  4RCZ A;  3AVV A;  1SM4 A;  4B4D A;  4FN5 A;  3CCE B;  3CCM B;  1K9M D;  1QFZ A;  3D26 A;  3PEN A;  1KTV A;  1H42 A;  4TKO B;  1QFY A;  3G4S B;  3VR6 A;  1QVF B;  2FX3 A;  2EFG A;  4P12 A;  2PLF A;  1ZM2 A;  2VNJ A;  4LBW A;  1WSR A;  1KMH A;  2WJV A;  4FK8 A;  4Y9U A;  5DSZ A;  2VNK A;  4RLZ A;  2D74 A;  3P27 A;  1JA0 A;  3OJW A;  4XOT A;  1YJN B;  4XLC A;  1G7S A;  3RY8 A;  3VNU A;  3PA1 A;  1TUI A;  4UZE A;  1VHO A;  4C0S A;  1K28 D;  2PIA A;  4B47 A;  4OOS A;  4G1V A;  4P3Y A;  2BN4 A;  2V7T A;  2ZL6 A;  1AMO A;  4Z4W A;  1KZL A;  1HA3 A;  3B8H A;  4X0C A;  2KVO A;  4RPB A;  3CP8 A;  3CMM A;  4QUZ A;  4PC6 A;  1H8E A;  2X0K A;  1Q86 D;  3CCS B;  1KK2 A;  1VQ5 B;  1VQN B;  3A3G A;  2XZL A;  5DS0 A;  1KK3 A;  1T5E A;  5FO1 A;  3CCR B;  1ZUN B;  5TY0 A;  1ZM4 A;  1GJR A;  4HIZ A;  5KNL A;  3CC4 B;  3Q6Q A;  3U2Q A;  5F4M A;  3OAA A;  4AF6 A;  4PC7 A;  4XKW A;  2CK3 A;  4PGO A;  4XD7 A;  4G6I A;  3H9N A;  4M2L A;  2GRE A;  1E64 A;  2DIE A;  4LC0 A;  3ZZT A;  4TMV A;  1H85 A;  1VHE A;  4XLA A;  1Q9S A;  3OEE A;  1GR1 A;  1FDR A;  2QE7 A;  2X6X A;  2ZBV A;  1PJ6 A;  2JIZ A;  3BCD A;  1W9X A;  1YIJ B;  2ZIT A;  3WND A;  4NNJ A;  1GVH A;  1EP3 B;  5A89 A;  1ELO A;  1DAR A;  3W2I A;  1COW A;  2ZTN A;  4Z4T A;  3WBJ A;  3JQQ A;  1EFR A;  4U9U A;  2BSA A;  4G7X A;  4RDJ A;  5IK2 A;  2JN9 A;  3H94 A;  1YHQ B;  1EP1 B;  3I56 B;  5FIU A;  4RPD A;  1BQE A;  4Z1M A;  1QX4 A;  3BCF A;  3QFT A;  4B3F X;  3OE7 A;  2ZL7 A;  2HMA A;  3SLD A;  1QGY A;  3OZW A;  1FNM A;  3CCL B;  4DQL A;  4RD0 A;  3ZPN A;  5IYR A;  1VQ6 B;  1T6Z A;  4TMW A;  1GAW A;  4ACB A;  2OTL B;  2OK8 A;  2JJ1 A;  3OKX A;  2Q6O A;  1BX1 A;  2Q6I A;  3BC9 A;  5HXB A;  3WNC A;  4OP7 A;  1PKV A;  3PVD A;  3T56 B;  5EMN A;  3GQB A;  1QGZ A;  3MHP A;  1U2R A;  3T51 B;  3CP2 A;  1UD8 A;  2CW5 A;  4II3 A;  2WR8 A;  4FXU A;  4B3G A;  3J81 k;  2E1R A;  4UAJ A;  3WNB A;  1DG1 G;  2XNC A;  3SJZ A;  2OTJ B;  3WBK A;  1F60 A;  1T6X A;  2ZZE A;  4YXW A;  1QUE A;  1PJ7 A;  1SKQ A;  3LNN A;  3T53 B;  1AIP A;  2W6J A;  3AVW A;  1KD1 D;  1VLO A;  4RD6 A;  4XM3 A;  2DYI A;  2WZP P;  4ZCI A;  1K73 D;  3I1F A;  4YEL A;  1KRH A;  1CNF A;  2XZO A;  1BMF A;  5JBQ A;  2QMU A;  1TVC A;  5BSX A;  2Z6B D;  1YJW B;  1V0E A;  2C2W A;  3E20 A;  1QUF A;  4TSF A;  2VBT A;  4LBZ A;  2D3N A;  1VQK B;  2GJR A;  4AF7 A;  4M53 A;  2X8K A;  1V5V A;  3JQP A;  3AGQ A;  4WWV A;  5H5J A;  4AVZ A;  4DK1 A;  3R6J A;  3W5H A;  4WZT A;  3VNV A;  2V31 A;  1FND A;  5B6I A;  4TMT A;  1E43 A;  2J7K A;  3FJO A;  4PC1 A;  4X7D A;  3LO8 A;  4QV2 A;  4NBS A;  3WXM A;  5A88 A;  1E79 A;  4Z4Z A;  4PC2 A;  2P3M A;  2YWG A;  5FA6 A;  2V7W A;  2X85 A;  3CD6 B;  2AHO A;  4XON A;  3V7A A;  5GV8 A;  2YWF A;  4X07 A;  1CNE A;  2OBR A;  2CBX A;  3BY1 A;  4TN1 A;  2OK7 A;  4YAO A;  2M5S A;  2NPF A;  2C4T A;  1I8D A;  5J35 A;  3ASQ A;  3CC2 B;  1KC8 D;  1RQR A;  4C43 A;  3ES9 A;  4YAU A;  3ZZ0 A;  3CCJ B;  2DEU A;  4KKS A;  4OPV A;  4B3X A;  3Q39 A;  1XQB A;  2WSS A;  5LMZ A;  3QE2 A;  2XGJ A;  2X53 S;  3MCA A;  4F7D A;  2BM0 A;  2B5O A;  3OW7 A;  1N06 A;  5KSW B;  4OOX A;  1N0V C;  1B23 P;  1G7R A;  2CND A;  3A1P A;  2C5B A;  1WP6 A;  4N3G A;  2DY1 A;  3W2H A;  5KW9 A;  4LBV A;  2GPJ A;  4HE6 A;  3QFR A;  4RDL A;  4DNT B;  3I55 B;  2VBU A;  4Z4R A;  1QVG B;  1Q81 D;  1Y0R A;  4DQK A;  2CF4 A;  1H8H A;  4Z4U A;  1K8A D;  2GK6 A;  1J9Z A;  2PE3 A;  1UD4 A;  2Q6K A;  1S72 B;  1I18 A;  1NDH A;  4YHB A;  4PC3 A;  1WU8 A;  1W0J A;  1E63 A;  1VQL B;  4P6Y A;  5F4J A;  5IYN A;  2GK7 A;  3OPO A;  1TLL A;  5FNZ A;  1E1R A;  3QFC A;  4YAL A;  4ROX A;  3GVJ A;  1EXM A;  1QG0 A;  5FO0 A;  4RD1 A;  2ZXH A;  1FNB A;  2W6I A;  1NB0 A;  2QN6 A;  2F43 A;  3FPP A;  2C78 A;  3BNW A;  3W2F A;  3WY9 A;  1N07 A;  4XN0 A;  4AC9 A;  3P26 A;  1VQ8 B;  1GAQ A;  1UD5 A;  2BV3 A;  3WQZ A;  1NB9 A;  3WYA A;  1QH0 A;  3BH4 A;  1E1Q A;  2BM1 A;  1GO2 A;  1UMK A;  3CES A;  4YAF A;  1EFC A;  1Y0Y A;  4KKU A;  1KK0 A;  4XNF A;  4HE5 A;  2VJJ A;  1VJS A;  4PAA A;  1V0F A;  1D1N A;  3R6K A;  5HZA A;  4QFM A;  1N08 A;  2HDN B;  2VJI A;  4GQN A;  1YLO A;  1OB0 A;  4OPS A;  4XOP A;  4XL9 A;  3U6K A;  1BX0 A;  1D8T A;  2V7V A;  2XND A;  4YEJ A;  1WOP A;  1NRK A;  2HCJ B;  3BQJ A;  3QFS A;  4M0L A;  4P26 A;  4RD2 A;  3CCQ B;  1VQ9 B;  4CQJ A;  4ASU A;  1N0U A;  1P4M A;  4XN3 A;  3GSI A;  5AN9 A;  1BLI A;  3A8I A;  3LQE A;  4QVJ A;  1OGI A;  3CMA B;  3KL9 A;  1E62 A;  4UZF A;  3U6B A;  1WOR A;  2VNH A;  2QA4 B;  2QDX A;  1QGA A;  3W5U A;  2OYN A;  4WZE A;  1WOS A;  4G5G A;  4NCN A;  2HLD A;  1VQO B;  2V4D A;  1YJ9 B;  3W5V A;  2D3L A;  4XOR A;  3V76 A;  1G7C A;  1G7T A;  4MYU A;  3QSY A;  4P6V F;  4RDK A;  2PMD A;  3GVK A;  4M4S A;  4X8I A;  2X6Y A;  2DET A;  4TMX A;  3VMF A;  2GJP A;  4Z4S A;  3VO2 A;  2FVG A;  4WQM A;  1KQS B;  4ZGQ B;  4TMZ A;  4N3N A;  2JDI A;  3SJP A;  2RC5 A;  4LBY A;  3Q38 A;  1HVX A;  1EFT A;  3GIR A;  4RCY A;  3ZBU A;  1XFO A;  4B44 A;  1VQP B;  3HAG A;  4DK0 A;  1NJI D;  1I7P A;  3AVX A;  2GQF A;  1R5O A;  4RJL A;  2XOK A;  1IHM A;  1VLY A;  1MRZ A;  3SEJ A;  4WZK A;  1S4M A;  3A8K A;  2F1M A;  4P25 A;  3SLN A;  2QEX B;  1OHH A;  3A35 A;  4ZCL A;  4H9G A;  1B2R A;  4RM0 A;  1WPC A;  2V7X A;  1EFU A;  4X7E A;  3ZIA A;  2C77 A;  3OFN A;  1ZM9 A;  2BPO A;  2BVN A;  4P3I A;  3G05 A;  2WJY A;  4ZV4 A;  5L46 A;  1XB2 A;  5GV7 A;  2I1L A;  3SKB A;  1NBM A;  3AST A;  4K1X A;  1FX0 A;  3ASR A;  1M90 D;  2DER A;  1WDT A;  3Q6R A;  2C5H A;  3A8J A;  1FRN A;  4BPR A;  1DDI A;  2VYQ A;  1OB2 A;  4XLE A;  2ZXI A;  1IB0 A;  4RD3 A;  2QTZ A;  2Q6L A;  2VZL A;  3CXC B;  4XLF A;  4II2 A;  4WZL A;  5IYW A;  1F20 A;  3BY2 A;  4QHY A;  1R5N A;  4XKV A;  1FRQ A;  5IYQ A;  3PUM A;  4JMQ A;  1Q82 D;  1EWY A;  2OBS A;  2QTL A;  1W35 A;  3ISX A;  3CPW B;  1W2B B;  2B7C A;  2LZJ A;  1SKY B;  3ONY A;  4X7C A;  4QVA A;  1UD3 A;  1BPL A;  5THX A;  4E0F A;  5J3O A;  1JJ2 B;  4P9S A;  1DDG A;  4L8J A;  1JA1 A;  2V7Q A;  2XZP A;  3LVB A;  3ASS A;  1WOO A;  1FNC A;  5DN6 A;  4OPO A;  1VF7 A;  2BMW A;  2BF4 A;  5A8A A;  2ZZQ A;  3E1Y E;  2ZTG A;  2DOG A;  4PAB A;  4EH1 A;  1JNY A;  2OBT A;  3B78 A;  2YWH A;  3PUN A;  4XMY A;  2ZBU A;  4KKT A;  1IJE A;  2ZZG A;  4XR6 A;  3CC7 B;  5TRD A;  1PJ5 A;  4Z4Y A;  2DCU A;  2NV4 A;  4RD4 A;  4Z4V A;  3DDY A;  2F1L A;  1YX2 A;  2XEX A;  1W0K A;  1CQX A;  1UD2 A;  4YAW A;  4Y7C A;  1N05 A;  3B82 A;  4R71 A;  5HZB A;  2BGJ A;  3OJX A;  1R5B A;  4TT3 A;  4G7W A;  3GVL A;  3Q3A A;  3CME B;  2EIX A;  3AGP A;  2QGG A;  2X6W A;  3ZC3 A;  3W2E A;  3ZUG A;  3CTA A;  3G71 B;  1QFJ A;  3AVT A;  1XE1 A;  1VQM B;  3A3B A;  1WSV A;  1JB9 A;  3OP1 A;  1IJF A;  3W2G A;  1YI2 B;  3AVU A;  2BGI A;  4Q7J B;  3JU4 A;  4ZCM A;  5IYP A;  1W87 A;  4J0Q A;  2R9V A;  1A8P A;  4DNR B;  3AVY A;  2V7U A;  5TR9 A;  4Y9R A;  3ZZU A;  4ZGN B;  4OOV A;  4FWT A;  1ZM3 A;  1T6Y A;  5E6T A;  4B48 A;  1UD6 A;  3OEH A;  2WPD A;  3NE5 B;  1TTT A;  1W34 A;  4X7F A;  2VNI A;  3OZU A;  1OGJ A;  2F4N A;  3KEW A;  2YWE A;  4UZU A;  4XQF A;  2B7B A;  2VBV A;  3CW2 A;  4M1K A;  4X05 A;  1HZE A;  5FL7 A;  4XLH A;  5H59 A;  2ZL5 A;  2WYR A;  3FPK A;  3G6E B;  3ASP A;  5F4O A;  1MAB A;  1KJZ A;  2WZN A;  3JQR A;  3OZV A;  3VO1 A; 
#chains in the Genus database with same CATH homology
 1P4M A;  1T6Z A;  2I1L A;  1NB9 A;  2X0K A;  1T6Y A;  5A89 A;  4UZF A;  1N05 A;  2OYN A;  5FO1 A;  1N06 A;  5A88 A;  5FNZ A;  2VBS A;  2P3M A;  1MRZ A;  2VBT A;  2VBV A;  1S4M A;  1N08 A;  5A8A A;  5FO0 A;  3ZUG A;  3CTA A;  2VBU A;  4UZE A;  3OP1 A;  1NB0 A;  1T6X A;  5TRD A;  1Q9S A;  1N07 A;  3BNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...