1N06A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords PUTATIVE riboflavin kinase
total genus 34
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n06A00
2VBUA 1T6YA 2P3MA 2VBVA 5FO1A 1N06A 2X0KA 1S4MA 4UZFA 2OYNA 4UZEA 1N07A 3CTAA 3OP1A 5TRDA 1NB0A 1P4MA 1T6XA 2VBSA 5A88A 5FNZA 1Q9SA 1NB9A 1N05A 1N08A 2VBTA 1T6ZA 1MRZA 5A89A 3BNWA 5FO0A 5A8AA 2I1LA 3ZUGA
chains in the Genus database with same CATH superfamily
2VBUA 4PC3A 4HE5A 1DG1G 2CK3A 4XL9A 1IB0A 3Q39A 2GK6A 2GPJA 4TMWA 2QEXB 3WYAA 2X6WA 1DDIA 1D1NA 5BSXA 1B2RA 1FX0A 1VQ5B 5HXBA 4ZCMA 2PIAA 4H9GA 4RD1A 2YWFA 1FRQA 3ZPNA 1XB2A 2KVOA 4Z4RA 2GREA 3Q6QA 3G4SB 2JJ1A 3A1PA 2VBTA 3P26A 3GIRA 1R5OA 3A35A 3A8IA 4G1VA 4UAJA 4RDJA 4B4DA 5F4JA 1BPLA 4M1KA 1SKQA 5GV8A 3JU4A 3KEWA 1N8RD 1D2EA 3ZIAA 1KK2A 1BLIA 2OBTA 2GK7A 1FNDA 2BN4A 2BGIA 2YWHA 5DN6A 4XKVA 3FPPA 4G6IA 4G7WA 4Z4UA 2BSAA 2XEXA 4P9SA 3CCSB 1DARA 1XE1A 4UZEA 3LQ6A 4TKOB 1VQNB 1KK1A 4YHBA 4YAUA 1YX2A 2B7CA 4XM3A 1XQBA 3QSYA 2X6XA 5CDFA 4II2A 3T53B 1BMFA 4X8IA 2CNDA 1QFYA 2ZTGA 3CP2A 2XGJA 4XN3A 4WWVA 1FRNA 2Q6IA 3ASRA 3WXMA 3OEHA 1VHOA 3B82A 4FWTA 2WJVA 5J3OA 1R5BA 1BX1A 3OAAA 2HDNB 3QFRA 2ZITA 1GAWA 2J7KA 4WZEA 1N07A 1GAQA 1K73D 2WZNA 2HMAA 3RY8A 2XZPA 3H9NA 2C5BA 2V7UA 4E0FA 2E1BA 4XORA 1KJZA 3E20A 2QA4B 1ZM4A 2R6HA 4M2LA 2JDIA 2PLFA 4X07A 4XN0A 3CCLB 4X7FA 3CCEB 2W6IA 3W2HA 2WR8A 3QFSA 1YJWB 4TN1A 1PJ5A 3ZC3A 4OPSA 1EFUA 4QUZA 5TV2A 2JN9A 5AN9A 1NRKA 3W2IA 2XOKA 4YXWA 2YWGA 3SKBA 4RD0A 4EH1A 1S72B 2QE7A 2XNJA 3LQEA 2V7XA 2X8KA 3BQJA 4P26A 3MCAA 1QUEA 4UZUA 3VO1A 1QH0A 4K1XA 5BSYA 4NBSA 1WOOA 2ZL7A 2B5OA 1AMOA 1TLLA 4ACAA 1BX0A 2BV3A 3B8HA 4PC7A 1J9ZA 4RM0A 3G6EB 2Q6KA 3W5VA 1T6ZA 4QV2A 4B48A 4DNTB 1SKYB 3FPKA 4Z4WA 1VQKB 2NV4A 1FNCA 3Q6RA 1JA1A 3CW2A 2QN6A 2D74A 4P1VA 5E6TA 4OPVA 2GJRA 1G7CA 1UD3A 1R5NA 3ES9A 4IW3B 4R71A 1MABA 1QVGB 1OB0A 2DYIA 2HCJB 4YEJA 2RC6A 4F7DA 1OGIA 1T6XA 1HA3A 1JNYA 1Q9SA 4PC1A 4RJLA 3VO2A 3CB4A 3E1YE 4QVAA 3ZZUA 3CC7B 3VNVA 2OBSA 4RPDA 1E3XA 1EP3B 1QFJA 1OGJA 1U2RA 2PE3A 1VF7A 4Z4ZA 4X7DA 2XZOA 2DIEA 1Q81D 2ZXHA 1CNFA 4M4SA 1PJ7A 2OK7A 1T5EA 1HZEA 4RDLA 5KNLA 4B43A 4Y7CA 4Y9RA 4X06A 1KRHA 3CMMA 1I7PA 5L46A 1KQSB 1E62A 3GVLA 4WZKA 4DK1A 2DERA 1YI2B 1D8TA 1RQRA 1VLYA 2BPOA 1GVHA 4ROXA 4HE6A 4XLHA 1F60A 4XONA 3LNNA 1W34A 3SJPA 1N08A 2OBRA 3ASQA 3AVYA 1Y0RA 1E3ZA 2WJYA 2CRVA 5H59A 3A8JA 1Y0YA 2OTJB 4RDKA 4XQFA 2XNDA 3T51B 5KW9A 2Z6BD 3R6KA 3CD6B 3VR6A 5IYWA 1E63A 3DDYA 3CCRB 1VHEA 3JQQA 4N3GA 4Z4YA 3OZWA 3CXCB 4XOTA 2V7TA 1FNBA 5IK2A 1S0UA 1W2BB 2CC2A 5FIUA 1WSRA 4ACBA 1NJID 4P3IA 1QGYA 4ZGQB 2W6JA 2HLDA 3LO8A 2M5SA 3BNWA 4MYTA 3JQRA 3W5UA 3G71B 2GJPA 3AGQA 3W2GA 4C0SA 3GVKA 4QHYA 5HZBA 4TMVA 1YJNB 4J0QA 2BMWA 1IJFA 1H42A 2V7QA 2X0KA 1UD8A 1A8PA 2WYRA 1ZM3A 2QMUA 2ZBVA 4RPBA 3WBJA 3WQZA 4LBWA 4U9UA 2X53S 1SM4A 2V31A 5TRDA 4RD3A 3OZVA 3ZBTA 3WNBA 1OB5A 1NB9A 3CCMB 4AF6A 1VQPB 2VJIA 1WU8A 4II3A 4YAOA 2ZZQA 5FL7A 4LC0A 4ZCIA 3PENA 4G7XA 2WZPP 3CC2B 2BM1A 5IYQA 3AVVA 1WSVA 4NNJA 2D3LA 3ZUGA 2WSSA 2RC5A 1W87A 3JQPA 1T6YA 2XZLA 1NDHA 2P3MA 3ASTA 2FX3A 2LZJA 2ZTNA 3FKSA 1S4MA 3AVTA 2OYNA 5THXA 1KC8D 1KTVA 2VJJA 4LBVA 3OP1A 3BCDA 3P27A 1WDTA 2FVGA 3CRZA 3GQBA 1ZUNB 4JMQA 3ASPA 4WQMA 1PKVA 1KK3A 2NPFA 4Z4SA 4RLZA 3ONUA 2VZLA 4QFMA 1N0VC 5A89A 3OFNA 5IYRA 1EP2B 4XOPA 1KD1D 4ASUA 4RD2A 1GR1A 1W0JA 4BPRA 4P6VF 1XFOA 5EMNA 4M0LA 2VNHA 4Z4TA 4FK8A 4OPOA 2C2WA 1UD2A 1W35A 2CBXA 4G1BA 2BGJA 2BF4A 2VBVA 1G7SA 4G5GA 4B3XA 1Q82D 1M1KD 4OOXA 4PC6A 4P2NA 3AGPA 4XLCA 3ZBUA 1TVCA 3ZZ0A 2EFGA 1NB0A 3U6BA 5KSWB 5A88A 1DDGA 5TY0A 3PVDA 3VMFA 1WTHD 1G7RA 2C4UA 3SLNA 3W2FA 1N05A 1H8HA 4FN5A 4LBYA 1TUIA 1OHHA 3CMAB 5FO0A 3OZUA 1BJKA 4C43A 2F1MA 2BVNA 3R6JA 3T56B 1H85A 3GVJA 3KL9A 1B23P 3WBKA 1V0FA 1EP1B 3Q38A 1YHQB 3AVWA 1UD5A 2BM0A 2F43A 3PUNA 4L8JA 1CQXA 3A3GA 1YJ9B 2QTZA 1HVXA 4P22A 1WPCA 1BQEA 3BY2A 2ZZGA 4XLFA 2CF4A 2X85A 2GJKA 2ZZEA 3OE7A 2X6YA 3SEJA 1CNEA 5IYNA 4TSFA 4PGOA 2B7BA 2PMDA 4ZCLA 3AVUA 1WOSA 4YELA 3PA1A 1V5VA 3CPXA 3Q3AA 1YITB 5A8AA 1Q86D 3A3BA 4P3YA 3LVBA 4RCYA 3V7AA 3QFCA 4M53A 3OPOA 3MHPA 2F1LA 1AIPA 2E1RA 4AC9A 1QGAA 1K8AD 3OJWA 4X0CA 2ZZFA 3ASSA 4AF7A 3I56B 2ZBUA 4RCZA 1V0EA 4Z4VA 2DY1A 4AVZA 1JJ2B 3WNCA 1VQ4B 4B44A 3OEEA 1E43A 3G05A 1GO2A 2Q6LA 4TMZA 3CCQB 3CP8A 2OTLB 3ZZTA 2JIZA 5J35A 3OW7A 4TT3A 4Q7JB 4RD6A 1VJSA 1ZM2A 1MRZA 3OKXA 2F4NA 4XKWA 3BC9A 4ZV4A 2DCUA 4DQLA 4P25A 3D26A 2XNCA 5FA6A 2CW5A 1FDRA 3MMPA 1I8DA 1H8EA 4LBZA 5GV7A 1VQLB 2OK8A 3SLDA 5B6IA 2YWEA 4GQNA 4B47A 1N06A 1VQMB 3I1FA 1PJ6A 1QUFA 4P6YA 2ZL6A 4TMXA 4FXUA 3BH4A 3ISXA 1COWA 1KZLA 5H5JA 3I55B 2Q6OA 2R9VA 1EFCA 2C5HA 3CESA 2EIXA 1E1RA 5DS0A 2D9RA 5DSZA 4PABA 1E79A 4YAWA 2WPDA 1G7TA 3QFTA 4X05A 4XLAA 4X7EA 3WY9A 1E1QA 1IJEA 1UD4A 3NE5B 1W9XA 4P12A 5IYPA 1QGZA 1K9MD 4TMTA 4WZTA 5FO1A 2C4TA 4OOVA 3PUMA 1EXMA 2X3UA 1RQPA 2ZXIA 4UZFA 4WZLA 1VQ9B 2ZL5A 1YLOA 1QX4A 4DK0A 3OJXA 2D3NA 2VYQA 5TR9A 3BY1A 1YIJB 3CCUB 2DETA 4CQJA 3CCVB 2C77A 3SJZA 1E64A 3OW2B 1JA0A 2VNJA 4KKTA 4X7CA 4OP7A 2C78A 3GSIA 1VQ6B 3AVXA 4NCNA 3U6KA 3CPWB 1OB2A 1EFRA 4HIZA 4XMYA 1WP6A 4OOSA 1EWYA 3CCJB 5LMZA 3V76A 4DQKA 1UMKA 1VLOA 1Q7YD 5HZAA 1F20A 3CTAA 1ELOA 1WORA 1KMHA 1QFZA 2AHOA 1VQOB 2DEUA 3HAGA 1VQ8B 1P4MA 2VBSA 1QG0A 2JJ2A 3B78A 2V4DA 3QE2A 3CMEB 3W2EA 3CC4B 1GJRA 4DNRB 2QDXA 4YALA 3OOCA 4MYUA 5JBQA 1K28D 3WNDA 1ZM9A 4PAAA 3H94A 2QGGA 1W0KA 4KKUA 3U2QA 3VNUA 2DOGA 4PC2A 3FJOA 4YAFA 4ZGNB 4XR6A 4XNFA 5F4OA 1TTTA 1FNMA 3PA2A 1I18A 3ONYA 1EFTA 4QVJA 3J81k 5F4MA 2VNIA 1WOPA 3A8KA 4XLEA 1KK0A 4Y9UA 4B3GA 2V7WA 2V7VA 1JB9A 4N3NA 1M90D 5FNZA 1VQ7B 2GQFA 3BCFA 5HKKA 3W5HA 4Z1MA 1QVFB 4XD7A 2VNKA 1IHMA 1N0UA 2QTLA 4RD4A 4B3FX 2I1LA 4KKSA 1UD6A 1NBMA
chains in the Genus database with same CATH topology
2VBUA 1T6YA 2P3MA 2VBVA 5FO1A 1N06A 2X0KA 1S4MA 4UZFA 2OYNA 4UZEA 1N07A 3CTAA 3OP1A 5TRDA 1NB0A 1P4MA 1T6XA 2VBSA 5A88A 5FNZA 1Q9SA 1NB9A 1N05A 1N08A 2VBTA 1T6ZA 1MRZA 5A89A 3BNWA 5FO0A 5A8AA 2I1LA 3ZUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBU A;  1T6Y A;  2P3M A;  2VBV A;  5FO1 A;  1N06 A;  2X0K A;  1S4M A;  4UZF A;  2OYN A;  4UZE A;  1N07 A;  3CTA A;  3OP1 A;  5TRD A;  1NB0 A;  1P4M A;  1T6X A;  2VBS A;  5A88 A;  5FNZ A;  1Q9S A;  1NB9 A;  1N05 A;  1N08 A;  2VBT A;  1T6Z A;  1MRZ A;  5A89 A;  3BNW A;  5FO0 A;  5A8A A;  2I1L A;  3ZUG A; 
#chains in the Genus database with same CATH topology
 2VBU A;  4PC3 A;  4HE5 A;  1DG1 G;  2CK3 A;  4XL9 A;  1IB0 A;  3Q39 A;  2GK6 A;  2GPJ A;  4TMW A;  2QEX B;  3WYA A;  2X6W A;  1DDI A;  1D1N A;  5BSX A;  1B2R A;  1FX0 A;  1VQ5 B;  5HXB A;  4ZCM A;  2PIA A;  4H9G A;  4RD1 A;  2YWF A;  1FRQ A;  3ZPN A;  1XB2 A;  2KVO A;  4Z4R A;  2GRE A;  3Q6Q A;  3G4S B;  2JJ1 A;  3A1P A;  2VBT A;  3P26 A;  3GIR A;  1R5O A;  3A35 A;  3A8I A;  4G1V A;  4UAJ A;  4RDJ A;  4B4D A;  5F4J A;  1BPL A;  4M1K A;  1SKQ A;  5GV8 A;  3JU4 A;  3KEW A;  1N8R D;  1D2E A;  3ZIA A;  1KK2 A;  1BLI A;  2OBT A;  2GK7 A;  1FND A;  2BN4 A;  2BGI A;  2YWH A;  5DN6 A;  4XKV A;  3FPP A;  4G6I A;  4G7W A;  4Z4U A;  2BSA A;  2XEX A;  4P9S A;  3CCS B;  1DAR A;  1XE1 A;  4UZE A;  3LQ6 A;  4TKO B;  1VQN B;  1KK1 A;  4YHB A;  4YAU A;  1YX2 A;  2B7C A;  4XM3 A;  1XQB A;  3QSY A;  2X6X A;  5CDF A;  4II2 A;  3T53 B;  1BMF A;  4X8I A;  2CND A;  1QFY A;  2ZTG A;  3CP2 A;  2XGJ A;  4XN3 A;  4WWV A;  1FRN A;  2Q6I A;  3ASR A;  3WXM A;  3OEH A;  1VHO A;  3B82 A;  4FWT A;  2WJV A;  5J3O A;  1R5B A;  1BX1 A;  3OAA A;  2HDN B;  3QFR A;  2ZIT A;  1GAW A;  2J7K A;  4WZE A;  1N07 A;  1GAQ A;  1K73 D;  2WZN A;  2HMA A;  3RY8 A;  2XZP A;  3H9N A;  2C5B A;  2V7U A;  4E0F A;  2E1B A;  4XOR A;  1KJZ A;  3E20 A;  2QA4 B;  1ZM4 A;  2R6H A;  4M2L A;  2JDI A;  2PLF A;  4X07 A;  4XN0 A;  3CCL B;  4X7F A;  3CCE B;  2W6I A;  3W2H A;  2WR8 A;  3QFS A;  1YJW B;  4TN1 A;  1PJ5 A;  3ZC3 A;  4OPS A;  1EFU A;  4QUZ A;  5TV2 A;  2JN9 A;  5AN9 A;  1NRK A;  3W2I A;  2XOK A;  4YXW A;  2YWG A;  3SKB A;  4RD0 A;  4EH1 A;  1S72 B;  2QE7 A;  2XNJ A;  3LQE A;  2V7X A;  2X8K A;  3BQJ A;  4P26 A;  3MCA A;  1QUE A;  4UZU A;  3VO1 A;  1QH0 A;  4K1X A;  5BSY A;  4NBS A;  1WOO A;  2ZL7 A;  2B5O A;  1AMO A;  1TLL A;  4ACA A;  1BX0 A;  2BV3 A;  3B8H A;  4PC7 A;  1J9Z A;  4RM0 A;  3G6E B;  2Q6K A;  3W5V A;  1T6Z A;  4QV2 A;  4B48 A;  4DNT B;  1SKY B;  3FPK A;  4Z4W A;  1VQK B;  2NV4 A;  1FNC A;  3Q6R A;  1JA1 A;  3CW2 A;  2QN6 A;  2D74 A;  4P1V A;  5E6T A;  4OPV A;  2GJR A;  1G7C A;  1UD3 A;  1R5N A;  3ES9 A;  4IW3 B;  4R71 A;  1MAB A;  1QVG B;  1OB0 A;  2DYI A;  2HCJ B;  4YEJ A;  2RC6 A;  4F7D A;  1OGI A;  1T6X A;  1HA3 A;  1JNY A;  1Q9S A;  4PC1 A;  4RJL A;  3VO2 A;  3CB4 A;  3E1Y E;  4QVA A;  3ZZU A;  3CC7 B;  3VNV A;  2OBS A;  4RPD A;  1E3X A;  1EP3 B;  1QFJ A;  1OGJ A;  1U2R A;  2PE3 A;  1VF7 A;  4Z4Z A;  4X7D A;  2XZO A;  2DIE A;  1Q81 D;  2ZXH A;  1CNF A;  4M4S A;  1PJ7 A;  2OK7 A;  1T5E A;  1HZE A;  4RDL A;  5KNL A;  4B43 A;  4Y7C A;  4Y9R A;  4X06 A;  1KRH A;  3CMM A;  1I7P A;  5L46 A;  1KQS B;  1E62 A;  3GVL A;  4WZK A;  4DK1 A;  2DER A;  1YI2 B;  1D8T A;  1RQR A;  1VLY A;  2BPO A;  1GVH A;  4ROX A;  4HE6 A;  4XLH A;  1F60 A;  4XON A;  3LNN A;  1W34 A;  3SJP A;  1N08 A;  2OBR A;  3ASQ A;  3AVY A;  1Y0R A;  1E3Z A;  2WJY A;  2CRV A;  5H59 A;  3A8J A;  1Y0Y A;  2OTJ B;  4RDK A;  4XQF A;  2XND A;  3T51 B;  5KW9 A;  2Z6B D;  3R6K A;  3CD6 B;  3VR6 A;  5IYW A;  1E63 A;  3DDY A;  3CCR B;  1VHE A;  3JQQ A;  4N3G A;  4Z4Y A;  3OZW A;  3CXC B;  4XOT A;  2V7T A;  1FNB A;  5IK2 A;  1S0U A;  1W2B B;  2CC2 A;  5FIU A;  1WSR A;  4ACB A;  1NJI D;  4P3I A;  1QGY A;  4ZGQ B;  2W6J A;  2HLD A;  3LO8 A;  2M5S A;  3BNW A;  4MYT A;  3JQR A;  3W5U A;  3G71 B;  2GJP A;  3AGQ A;  3W2G A;  4C0S A;  3GVK A;  4QHY A;  5HZB A;  4TMV A;  1YJN B;  4J0Q A;  2BMW A;  1IJF A;  1H42 A;  2V7Q A;  2X0K A;  1UD8 A;  1A8P A;  2WYR A;  1ZM3 A;  2QMU A;  2ZBV A;  4RPB A;  3WBJ A;  3WQZ A;  4LBW A;  4U9U A;  2X53 S;  1SM4 A;  2V31 A;  5TRD A;  4RD3 A;  3OZV A;  3ZBT A;  3WNB A;  1OB5 A;  1NB9 A;  3CCM B;  4AF6 A;  1VQP B;  2VJI A;  1WU8 A;  4II3 A;  4YAO A;  2ZZQ A;  5FL7 A;  4LC0 A;  4ZCI A;  3PEN A;  4G7X A;  2WZP P;  3CC2 B;  2BM1 A;  5IYQ A;  3AVV A;  1WSV A;  4NNJ A;  2D3L A;  3ZUG A;  2WSS A;  2RC5 A;  1W87 A;  3JQP A;  1T6Y A;  2XZL A;  1NDH A;  2P3M A;  3AST A;  2FX3 A;  2LZJ A;  2ZTN A;  3FKS A;  1S4M A;  3AVT A;  2OYN A;  5THX A;  1KC8 D;  1KTV A;  2VJJ A;  4LBV A;  3OP1 A;  3BCD A;  3P27 A;  1WDT A;  2FVG A;  3CRZ A;  3GQB A;  1ZUN B;  4JMQ A;  3ASP A;  4WQM A;  1PKV A;  1KK3 A;  2NPF A;  4Z4S A;  4RLZ A;  3ONU A;  2VZL A;  4QFM A;  1N0V C;  5A89 A;  3OFN A;  5IYR A;  1EP2 B;  4XOP A;  1KD1 D;  4ASU A;  4RD2 A;  1GR1 A;  1W0J A;  4BPR A;  4P6V F;  1XFO A;  5EMN A;  4M0L A;  2VNH A;  4Z4T A;  4FK8 A;  4OPO A;  2C2W A;  1UD2 A;  1W35 A;  2CBX A;  4G1B A;  2BGJ A;  2BF4 A;  2VBV A;  1G7S A;  4G5G A;  4B3X A;  1Q82 D;  1M1K D;  4OOX A;  4PC6 A;  4P2N A;  3AGP A;  4XLC A;  3ZBU A;  1TVC A;  3ZZ0 A;  2EFG A;  1NB0 A;  3U6B A;  5KSW B;  5A88 A;  1DDG A;  5TY0 A;  3PVD A;  3VMF A;  1WTH D;  1G7R A;  2C4U A;  3SLN A;  3W2F A;  1N05 A;  1H8H A;  4FN5 A;  4LBY A;  1TUI A;  1OHH A;  3CMA B;  5FO0 A;  3OZU A;  1BJK A;  4C43 A;  2F1M A;  2BVN A;  3R6J A;  3T56 B;  1H85 A;  3GVJ A;  3KL9 A;  1B23 P;  3WBK A;  1V0F A;  1EP1 B;  3Q38 A;  1YHQ B;  3AVW A;  1UD5 A;  2BM0 A;  2F43 A;  3PUN A;  4L8J A;  1CQX A;  3A3G A;  1YJ9 B;  2QTZ A;  1HVX A;  4P22 A;  1WPC A;  1BQE A;  3BY2 A;  2ZZG A;  4XLF A;  2CF4 A;  2X85 A;  2GJK A;  2ZZE A;  3OE7 A;  2X6Y A;  3SEJ A;  1CNE A;  5IYN A;  4TSF A;  4PGO A;  2B7B A;  2PMD A;  4ZCL A;  3AVU A;  1WOS A;  4YEL A;  3PA1 A;  1V5V A;  3CPX A;  3Q3A A;  1YIT B;  5A8A A;  1Q86 D;  3A3B A;  4P3Y A;  3LVB A;  4RCY A;  3V7A A;  3QFC A;  4M53 A;  3OPO A;  3MHP A;  2F1L A;  1AIP A;  2E1R A;  4AC9 A;  1QGA A;  1K8A D;  3OJW A;  4X0C A;  2ZZF A;  3ASS A;  4AF7 A;  3I56 B;  2ZBU A;  4RCZ A;  1V0E A;  4Z4V A;  2DY1 A;  4AVZ A;  1JJ2 B;  3WNC A;  1VQ4 B;  4B44 A;  3OEE A;  1E43 A;  3G05 A;  1GO2 A;  2Q6L A;  4TMZ A;  3CCQ B;  3CP8 A;  2OTL B;  3ZZT A;  2JIZ A;  5J35 A;  3OW7 A;  4TT3 A;  4Q7J B;  4RD6 A;  1VJS A;  1ZM2 A;  1MRZ A;  3OKX A;  2F4N A;  4XKW A;  3BC9 A;  4ZV4 A;  2DCU A;  4DQL A;  4P25 A;  3D26 A;  2XNC A;  5FA6 A;  2CW5 A;  1FDR A;  3MMP A;  1I8D A;  1H8E A;  4LBZ A;  5GV7 A;  1VQL B;  2OK8 A;  3SLD A;  5B6I A;  2YWE A;  4GQN A;  4B47 A;  1N06 A;  1VQM B;  3I1F A;  1PJ6 A;  1QUF A;  4P6Y A;  2ZL6 A;  4TMX A;  4FXU A;  3BH4 A;  3ISX A;  1COW A;  1KZL A;  5H5J A;  3I55 B;  2Q6O A;  2R9V A;  1EFC A;  2C5H A;  3CES A;  2EIX A;  1E1R A;  5DS0 A;  2D9R A;  5DSZ A;  4PAB A;  1E79 A;  4YAW A;  2WPD A;  1G7T A;  3QFT A;  4X05 A;  4XLA A;  4X7E A;  3WY9 A;  1E1Q A;  1IJE A;  1UD4 A;  3NE5 B;  1W9X A;  4P12 A;  5IYP A;  1QGZ A;  1K9M D;  4TMT A;  4WZT A;  5FO1 A;  2C4T A;  4OOV A;  3PUM A;  1EXM A;  2X3U A;  1RQP A;  2ZXI A;  4UZF A;  4WZL A;  1VQ9 B;  2ZL5 A;  1YLO A;  1QX4 A;  4DK0 A;  3OJX A;  2D3N A;  2VYQ A;  5TR9 A;  3BY1 A;  1YIJ B;  3CCU B;  2DET A;  4CQJ A;  3CCV B;  2C77 A;  3SJZ A;  1E64 A;  3OW2 B;  1JA0 A;  2VNJ A;  4KKT A;  4X7C A;  4OP7 A;  2C78 A;  3GSI A;  1VQ6 B;  3AVX A;  4NCN A;  3U6K A;  3CPW B;  1OB2 A;  1EFR A;  4HIZ A;  4XMY A;  1WP6 A;  4OOS A;  1EWY A;  3CCJ B;  5LMZ A;  3V76 A;  4DQK A;  1UMK A;  1VLO A;  1Q7Y D;  5HZA A;  1F20 A;  3CTA A;  1ELO A;  1WOR A;  1KMH A;  1QFZ A;  2AHO A;  1VQO B;  2DEU A;  3HAG A;  1VQ8 B;  1P4M A;  2VBS A;  1QG0 A;  2JJ2 A;  3B78 A;  2V4D A;  3QE2 A;  3CME B;  3W2E A;  3CC4 B;  1GJR A;  4DNR B;  2QDX A;  4YAL A;  3OOC A;  4MYU A;  5JBQ A;  1K28 D;  3WND A;  1ZM9 A;  4PAA A;  3H94 A;  2QGG A;  1W0K A;  4KKU A;  3U2Q A;  3VNU A;  2DOG A;  4PC2 A;  3FJO A;  4YAF A;  4ZGN B;  4XR6 A;  4XNF A;  5F4O A;  1TTT A;  1FNM A;  3PA2 A;  1I18 A;  3ONY A;  1EFT A;  4QVJ A;  3J81 k;  5F4M A;  2VNI A;  1WOP A;  3A8K A;  4XLE A;  1KK0 A;  4Y9U A;  4B3G A;  2V7W A;  2V7V A;  1JB9 A;  4N3N A;  1M90 D;  5FNZ A;  1VQ7 B;  2GQF A;  3BCF A;  5HKK A;  3W5H A;  4Z1M A;  1QVF B;  4XD7 A;  2VNK A;  1IHM A;  1N0U A;  2QTL A;  4RD4 A;  4B3F X;  2I1L A;  4KKS A;  1UD6 A;  1NBM A; 
#chains in the Genus database with same CATH homology
 2VBU A;  1T6Y A;  2P3M A;  2VBV A;  5FO1 A;  1N06 A;  2X0K A;  1S4M A;  4UZF A;  2OYN A;  4UZE A;  1N07 A;  3CTA A;  3OP1 A;  5TRD A;  1NB0 A;  1P4M A;  1T6X A;  2VBS A;  5A88 A;  5FNZ A;  1Q9S A;  1NB9 A;  1N05 A;  1N08 A;  2VBT A;  1T6Z A;  1MRZ A;  5A89 A;  3BNW A;  5FO0 A;  5A8A A;  2I1L A;  3ZUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...