4RDLA

Crystal structure of norovirus boxer p domain in complex with lewis y tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
297
Chain Sequence
b'KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQNQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGGGPQTLPINGVFVFISWVSRYYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid
molecule tags Viral protein
source organism Human calicivirus nlv/boxer/2001/us
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
total genus 70
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdlA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdlA01
4OPSA 3Q6RA 4P1VA 5BSXA 4Z4TA 3Q6QA 4WZLA 3ASTA 4X06A 3SLNA 4QUZA 4WZKA 3V7AA 3R6KA 4ROXA 3Q38A 4RDLA 3Q39A 4P26A 3BY1A 3PA1A 4WZTA 4WZEA 4OOVA 3ASQA 4RLZA 4Z4YA 5E6TA 3BQJA 4Z4SA 2OBRA 4RPDA 3R6JA 4P12A 3D26A 5IYNA 4RPBA 5IYWA 5J35A 3SEJA 3ASPA 3SLDA 5IYRA 3PUMA 2OBSA 3PA2A 4X07A 4X7CA 5IYPA 4QV2A 3ASSA 4OOXA 4P2NA 3ASRA 5F4JA 4Z4ZA 4RDJA 3PVDA 4OOSA 4QVAA 4Z4VA 2ZL7A 4P3IA 4Z4UA 4X05A 4OP7A 4X7FA 3BY2A 3LQEA 4OPOA 5IYQA 5HZBA 2ZL6A 1IHMA 5F4OA 5HZAA 4X7DA 2OBTA 3LQ6A 3ONUA 4X7EA 3ONYA 3Q3AA 5BSYA 5F4MA 4RDKA 4RM0A 5KW9A 4P25A 2ZL5A 3RY8A 4QVJA 4OPVA 5J3OA 4X0CA 3SKBA 4Z4WA 4Z4RA 3PUNA 3SJPA
chains in the Genus database with same CATH superfamily
4B3GA 1KRHA 3CC7B 1T6YA 1EFCA 4LBYA 3CCSB 3CESA 2D3LA 2HMAA 1YJWB 5H5JA 1QGAA 1Q7YD 1QG0A 3OAAA 2CC2A 1WORA 2GQFA 4QUZA 1W34A 3R6KA 4PC2A 4KKSA 1ZM2A 1JB9A 3U6BA 1CQXA 1WP6A 2C77A 2C78A 4AF6A 1VQNB 4GQNA 1KD1D 4XONA 4YAOA 2B5OA 3OZUA 3U2QA 4ZGNB 2WYRA 1N06A 1Q86D 3ASQA 3H9NA 3CP2A 1T6XA 3BQJA 3CP8A 4TKOB 4Z4SA 5AN9A 1FRQA 3CD6B 1QFZA 2V31A 3VMFA 4DQLA 2ZBUA 3A3BA 1W0JA 1NB9A 3CRZA 1YI2B 4XL9A 5J35A 5IYWA 2DETA 3SLDA 5IYRA 4FN5A 4PC7A 3W2EA 3G6EB 1R5NA 2KVOA 2OBSA 4K1XA 1H85A 3ISXA 1TVCA 2I1LA 1GAQA 5FNZA 2D9RA 2QE7A 2XNDA 1JA1A 1H8EA 2V7XA 1XB2A 1U2RA 3BNWA 5F4JA 3T56B 3GVJA 1YIJB 1GVHA 1V0EA 2DEUA 4Y9RA 3ZBTA 3ZIAA 2C4TA 3PVDA 4KKTA 5GV7A 1FNDA 2WZPP 5A89A 2F43A 1PJ6A 1WOOA 2FVGA 1QX4A 1OB5A 3AGPA 4Z4VA 1KC8D 1KK2A 2ZL7A 1KZLA 3WXMA 2GPJA 1WU8A 1Q82D 4XN0A 4HE5A 4XM3A 3ZZTA 4P3IA 3LNNA 4ZCMA 4Z4UA 1YJNB 4M53A 1H42A 1D2EA 1FNBA 3VNVA 3OP1A 4XR6A 1RQRA 1QUEA 1UD5A 1OHHA 5HXBA 1IJFA 3ES9A 4PGOA 5IYQA 2LZJA 4C43A 1VQPB 2YWGA 4G1VA 5F4OA 1EP2B 4X7DA 1QVFB 1CNFA 1DG1G 3ONYA 3NE5B 2XOKA 1BJKA 3VR6A 1R5BA 5F4MA 1PKVA 3A8JA 4RD1A 3CCQB 1BPLA 3CC2B 4DK0A 1S72B 3OW2B 4XQFA 2F1MA 2XEXA 1EP3B 1N05A 3A3GA 4LBZA 4XMYA 4N3NA 2ZXIA 3OPOA 3AVWA 1YJ9B 4OPVA 4RD6A 4X0CA 2YWHA 2WR8A 1GR1A 3PUNA 3CCEB 3HAGA 4OPSA 4YELA 4QHYA 2CRVA 4Y7CA 3Q6RA 4ZGQB 3OEEA 5DN6A 4YXWA 3AVVA 5DS0A 2VJIA 4EH1A 1WOSA 1MRZA 1WTHD 3GSIA 4JMQA 3ASTA 1VLYA 1VQ7B 1OGJA 1E62A 2QEXB 1UD8A 4XOTA 3I55B 2DERA 1F60A 4ROXA 4B4DA 3KL9A 3Q39A 5EMNA 2V7UA 2DIEA 2ZTGA 4RD0A 4ZCIA 1F20A 3PA1A 3CCVB 2BM0A 4WZEA 4OOVA 4RLZA 1BX0A 1WPCA 4TMTA 5E6TA 1KMHA 3WBKA 3W2HA 1NRKA 2X0KA 4RPDA 1B2RA 3I56B 1FX0A 1R5OA 4B48A 1S4MA 3D26A 1VQ6B 4RD4A 4NNJA 1VHOA 4MYTA 3CCRB 3W5VA 3SEJA 4FK8A 2V7QA 3ASPA 2ZZGA 3OOCA 4E0FA 3V76A 1T6ZA 4TT3A 3ZPNA 4X7CA 4ZV4A 3P26A 4TSFA 2WJVA 3ASSA 4NCNA 4OOXA 4PAAA 2QN6A 3ASRA 1KK0A 4R71A 4Z4ZA 1K73D 2PLFA 4RDJA 4AC9A 3ZZ0A 4YAFA 4LC0A 3G05A 1GAWA 4P3YA 1M1KD 4TN1A 1XE1A 2PMDA 4L8JA 2DOGA 4M2LA 1UMKA 2C5HA 2EIXA 1VQKB 3A1PA 2HDNB 3AVXA 1ZM4A 2BV3A 1TLLA 3W2GA 4XLAA 2QA4B 5JBQA 1H8HA 1RQPA 2VNIA 3OKXA 4XNFA 2C2WA 5CDFA 3B82A 4OP7A 5A88A 1NB0A 2OYNA 5A8AA 3CCJB 2QGGA 2Z6BD 3WYAA 4OPOA 1E1QA 4II3A 4M4SA 2V7VA 1G7SA 4XD7A 2EFGA 4WWVA 2VBUA 1G7RA 1OB0A 3J81k 5LMZA 3CMEB 2OBTA 3ONUA 3W5HA 3Q3AA 4XN3A 1YITB 2VNKA 1ZUNB 3ZC3A 1EFTA 4IW3B 1AIPA 1SM4A 2R9VA 3MMPA 3QFRA 4RDKA 1M90D 1D8TA 3ZZUA 5KW9A 1VF7A 3ZBUA 1BX1A 1WSVA 2ZTNA 2ZL5A 1YLOA 3E20A 4WQMA 1KK3A 1Q81D 1T5EA 3JU4A 4XLCA 4Z4RA 4X8IA 3SJPA 4DK1A 1WSRA 3G4SB 1QGZA 3JQPA 1VQLB 2R6HA 2B7CA 4G5GA 3G71B 4P1VA 4MYUA 4Z4TA 3W2FA 2C4UA 4X06A 2VNHA 2BM1A 2PE3A 3SLNA 4UAJA 1TTTA 4RD3A 1CNEA 4TMXA 4WZKA 1K9MD 1VQMB 3V7AA 3BCFA 1W87A 2C5BA 3Q38A 4RDLA 4P26A 2VBTA 3AGQA 3BY1A 1W35A 1DDIA 3WBJA 2F1LA 4II2A 2XZOA 1N0UA 2D74A 2F4NA 2HCJB 2QTLA 4Q7JB 2JIZA 4B47A 2RC5A 1K28D 4WZTA 2X3UA 2ZITA 4Z4YA 1VHEA 4XLEA 3CMAB 4TMZA 3CXCB 4PC6A 2XZLA 2DY1A 2OBRA 1NDHA 3VO2A 4N3GA 2BGJA 3R6JA 4XKWA 4P12A 4B3XA 1VQ5B 3A8KA 2NV4A 1E43A 2M5SA 1HVXA 4DQKA 4UZUA 1JNYA 4ASUA 1D1NA 1FRNA 1VQ8B 1OB2A 5TRDA 3OZWA 3GVKA 5KNLA 1GJRA 3T51B 1J9ZA 1P4MA 2JN9A 4P2NA 3BC9A 4RD2A 2V4DA 1COWA 1HZEA 1KK1A 3BH4A 4FXUA 4G1BA 2OK7A 2CK3A 3OFNA 3OZVA 3LO8A 4BPRA 1SKQA 2WZNA 3PENA 2HLDA 1VQ9B 3DDYA 2DCUA 1E3ZA 1EFRA 3A35A 3WNBA 2P3MA 4PC3A 1UD4A 3FPKA 3P27A 3AVTA 2GJRA 3OJWA 2VZLA 2ZZEA 4TMWA 4G6IA 3FJOA 4PC1A 3VNUA 1PJ7A 1VQ4B 1ZM3A 4X7FA 4F7DA 4UZEA 2CW5A 4LBVA 3QFSA 3CB4A 3LQEA 1TUIA 2DYIA 5HZBA 4QFMA 1BMFA 1KTVA 1IHMA 2CF4A 2FX3A 2X6XA 1E3XA 4ACBA 2RC6A 1BLIA 2X85A 2V7WA 5TV2A 2GREA 1Q9SA 2JJ1A 2AHOA 4XKVA 4LBWA 3AVUA 1DARA 1FDRA 1I18A 1EWYA 3CPWB 3CCMB 1V0FA 3GQBA 2VBSA 4P25A 1K8AD 5TR9A 2JJ2A 1Y0YA 3FPPA 4UZFA 1YX2A 3RY8A 3AVYA 5J3OA 4Z4WA 1N8RD 3I1FA 4P22A 2JDIA 4RJLA 3JQRA 5DSZA 2QDXA 3VO1A 3KEWA 3WNDA 1HA3A 1UD2A 5BSXA 5FL7A 1JA0A 2WJYA 4Y9UA 3Q6QA 1E1RA 1IJEA 2VYQA 4WZLA 2E1RA 2XNCA 2GJKA 1W9XA 3CTAA 5FO0A 1I8DA 2CBXA 2X6YA 1XFOA 2CNDA 1S0UA 2Q6IA 4KKUA 1KJZA 4G7XA 2VNJA 4YEJA 3W5UA 5KSWB 2YWEA 3QSYA 5FO1A 1NJID 2GK7A 2V7TA 3GVLA 2Q6OA 2ZBVA 1VQOB 1W0KA 4HIZA 5B6IA 1I7PA 2ZXHA 1YHQB 4ACAA 1UD6A 1E64A 2GK6A 1FNCA 4P6YA 5FA6A 4H9GA 2QMUA 4FWTA 2XZPA 3SJZA 3QE2A 4C0SA 3WQZA 1UD3A 1BQEA 1V5VA 3FKSA 1EP1B 2VBVA 1PJ5A 3OW7A 1N08A 1B23P 5HKKA 4M0LA 5IYNA 2W6IA 2OTJB 4RPBA 2BSAA 2GJPA 2XGJA 3PUMA 4RCZA 1NBMA 2WPDA 3PA2A 4X07A 2WSSA 4B3FX 1N07A 5IYPA 1E63A 4PABA 2B7BA 2OK8A 4QV2A 3BCDA 2Q6KA 2VJJA 2ZZFA 3CC4B 2Q6LA 1QGYA 3MHPA 3JQQA 3H94A 1ELOA 1MABA 3QFCA 4NBSA 2D3NA 3WNCA 4DNRB 2BN4A 2ZZQA 1W2BB 2X6WA 4G7WA 4P6VF 1OGIA 2J7KA 1QH0A 2XNJA 2BPOA 1QFYA 1Y0RA 1KQSB 4B43A 5L46A 3MCAA 4XORA 4OOSA 4QVAA 4HE6A 3ZUGA 2BVNA 1EXMA 1QFJA 3E1YE 1A8PA 3GIRA 4YAWA 3CCUB 5THXA 4XLFA 3B78A 3B8HA 3WY9A 4X05A 3CW2A 3CPXA 5GV8A 1DDGA 4XLHA 2NPFA 2BF4A 4ZCLA 4AVZA 5H59A 2X8KA 3OE7A 3BY2A 2QTZA 2YWFA 2W6JA 1FNMA 1EFUA 1N0VC 4YHBA 4AF7A 2ZL6A 1GO2A 1SKYB 1VJSA 2X53S 1E79A 5IK2A 5HZAA 5FIUA 4DNTB 1WDTA 1QVGB 3W2IA 3LQ6A 4X7EA 1WOPA 4CQJA 2OTLB 2BMWA 3LVBA 3OEHA 3CMMA 5BSYA 4XOPA 3T53B 4TMVA 4B44A 1QUFA 2PIAA 2BGIA 1IB0A 3OJXA 1VLOA 1XQBA 4YALA 3U6KA 4J0QA 4M1KA 4RM0A 5TY0A 4RCYA 1JJ2B 3CCLB 1G7TA 3A8IA 2E1BA 1G7CA 4P9SA 4Z1MA 4QVJA 3QFTA 1AMOA 3SKBA 4U9UA 4YAUA 1ZM9A
chains in the Genus database with same CATH topology
4OPSA 3Q6RA 4P1VA 5BSXA 4Z4TA 3Q6QA 4WZLA 3ASTA 4X06A 3SLNA 4QUZA 4WZKA 3V7AA 3R6KA 4ROXA 3Q38A 4RDLA 3Q39A 4P26A 3BY1A 3PA1A 4WZTA 4WZEA 4OOVA 3ASQA 4RLZA 4Z4YA 5E6TA 3BQJA 4Z4SA 2OBRA 4RPDA 3R6JA 4P12A 3D26A 5IYNA 4RPBA 5IYWA 5J35A 3SEJA 3ASPA 3SLDA 5IYRA 3PUMA 2OBSA 3PA2A 4X07A 4X7CA 5IYPA 4QV2A 3ASSA 4OOXA 4P2NA 3ASRA 5F4JA 4Z4ZA 4RDJA 3PVDA 4OOSA 4QVAA 4Z4VA 2ZL7A 4P3IA 4Z4UA 4X05A 4OP7A 4X7FA 3BY2A 3LQEA 4OPOA 5IYQA 5HZBA 2ZL6A 1IHMA 5F4OA 5HZAA 4X7DA 2OBTA 3LQ6A 3ONUA 4X7EA 3ONYA 3Q3AA 5BSYA 5F4MA 4RDKA 4RM0A 5KW9A 4P25A 2ZL5A 3RY8A 4QVJA 4OPVA 5J3OA 4X0CA 3SKBA 4Z4WA 4Z4RA 3PUNA 3SJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPS A;  3Q6R A;  4P1V A;  5BSX A;  4Z4T A;  3Q6Q A;  4WZL A;  3AST A;  4X06 A;  3SLN A;  4QUZ A;  4WZK A;  3V7A A;  3R6K A;  4ROX A;  3Q38 A;  4RDL A;  3Q39 A;  4P26 A;  3BY1 A;  3PA1 A;  4WZT A;  4WZE A;  4OOV A;  3ASQ A;  4RLZ A;  4Z4Y A;  5E6T A;  3BQJ A;  4Z4S A;  2OBR A;  4RPD A;  3R6J A;  4P12 A;  3D26 A;  5IYN A;  4RPB A;  5IYW A;  5J35 A;  3SEJ A;  3ASP A;  3SLD A;  5IYR A;  3PUM A;  2OBS A;  3PA2 A;  4X07 A;  4X7C A;  5IYP A;  4QV2 A;  3ASS A;  4OOX A;  4P2N A;  3ASR A;  5F4J A;  4Z4Z A;  4RDJ A;  3PVD A;  4OOS A;  4QVA A;  4Z4V A;  2ZL7 A;  4P3I A;  4Z4U A;  4X05 A;  4OP7 A;  4X7F A;  3BY2 A;  3LQE A;  4OPO A;  5IYQ A;  5HZB A;  2ZL6 A;  1IHM A;  5F4O A;  5HZA A;  4X7D A;  2OBT A;  3LQ6 A;  3ONU A;  4X7E A;  3ONY A;  3Q3A A;  5BSY A;  5F4M A;  4RDK A;  4RM0 A;  5KW9 A;  4P25 A;  2ZL5 A;  3RY8 A;  4QVJ A;  4OPV A;  5J3O A;  4X0C A;  3SKB A;  4Z4W A;  4Z4R A;  3PUN A;  3SJP A; 
#chains in the Genus database with same CATH topology
 4B3G A;  1KRH A;  3CC7 B;  1T6Y A;  1EFC A;  4LBY A;  3CCS B;  3CES A;  2D3L A;  2HMA A;  1YJW B;  5H5J A;  1QGA A;  1Q7Y D;  1QG0 A;  3OAA A;  2CC2 A;  1WOR A;  2GQF A;  4QUZ A;  1W34 A;  3R6K A;  4PC2 A;  4KKS A;  1ZM2 A;  1JB9 A;  3U6B A;  1CQX A;  1WP6 A;  2C77 A;  2C78 A;  4AF6 A;  1VQN B;  4GQN A;  1KD1 D;  4XON A;  4YAO A;  2B5O A;  3OZU A;  3U2Q A;  4ZGN B;  2WYR A;  1N06 A;  1Q86 D;  3ASQ A;  3H9N A;  3CP2 A;  1T6X A;  3BQJ A;  3CP8 A;  4TKO B;  4Z4S A;  5AN9 A;  1FRQ A;  3CD6 B;  1QFZ A;  2V31 A;  3VMF A;  4DQL A;  2ZBU A;  3A3B A;  1W0J A;  1NB9 A;  3CRZ A;  1YI2 B;  4XL9 A;  5J35 A;  5IYW A;  2DET A;  3SLD A;  5IYR A;  4FN5 A;  4PC7 A;  3W2E A;  3G6E B;  1R5N A;  2KVO A;  2OBS A;  4K1X A;  1H85 A;  3ISX A;  1TVC A;  2I1L A;  1GAQ A;  5FNZ A;  2D9R A;  2QE7 A;  2XND A;  1JA1 A;  1H8E A;  2V7X A;  1XB2 A;  1U2R A;  3BNW A;  5F4J A;  3T56 B;  3GVJ A;  1YIJ B;  1GVH A;  1V0E A;  2DEU A;  4Y9R A;  3ZBT A;  3ZIA A;  2C4T A;  3PVD A;  4KKT A;  5GV7 A;  1FND A;  2WZP P;  5A89 A;  2F43 A;  1PJ6 A;  1WOO A;  2FVG A;  1QX4 A;  1OB5 A;  3AGP A;  4Z4V A;  1KC8 D;  1KK2 A;  2ZL7 A;  1KZL A;  3WXM A;  2GPJ A;  1WU8 A;  1Q82 D;  4XN0 A;  4HE5 A;  4XM3 A;  3ZZT A;  4P3I A;  3LNN A;  4ZCM A;  4Z4U A;  1YJN B;  4M53 A;  1H42 A;  1D2E A;  1FNB A;  3VNV A;  3OP1 A;  4XR6 A;  1RQR A;  1QUE A;  1UD5 A;  1OHH A;  5HXB A;  1IJF A;  3ES9 A;  4PGO A;  5IYQ A;  2LZJ A;  4C43 A;  1VQP B;  2YWG A;  4G1V A;  5F4O A;  1EP2 B;  4X7D A;  1QVF B;  1CNF A;  1DG1 G;  3ONY A;  3NE5 B;  2XOK A;  1BJK A;  3VR6 A;  1R5B A;  5F4M A;  1PKV A;  3A8J A;  4RD1 A;  3CCQ B;  1BPL A;  3CC2 B;  4DK0 A;  1S72 B;  3OW2 B;  4XQF A;  2F1M A;  2XEX A;  1EP3 B;  1N05 A;  3A3G A;  4LBZ A;  4XMY A;  4N3N A;  2ZXI A;  3OPO A;  3AVW A;  1YJ9 B;  4OPV A;  4RD6 A;  4X0C A;  2YWH A;  2WR8 A;  1GR1 A;  3PUN A;  3CCE B;  3HAG A;  4OPS A;  4YEL A;  4QHY A;  2CRV A;  4Y7C A;  3Q6R A;  4ZGQ B;  3OEE A;  5DN6 A;  4YXW A;  3AVV A;  5DS0 A;  2VJI A;  4EH1 A;  1WOS A;  1MRZ A;  1WTH D;  3GSI A;  4JMQ A;  3AST A;  1VLY A;  1VQ7 B;  1OGJ A;  1E62 A;  2QEX B;  1UD8 A;  4XOT A;  3I55 B;  2DER A;  1F60 A;  4ROX A;  4B4D A;  3KL9 A;  3Q39 A;  5EMN A;  2V7U A;  2DIE A;  2ZTG A;  4RD0 A;  4ZCI A;  1F20 A;  3PA1 A;  3CCV B;  2BM0 A;  4WZE A;  4OOV A;  4RLZ A;  1BX0 A;  1WPC A;  4TMT A;  5E6T A;  1KMH A;  3WBK A;  3W2H A;  1NRK A;  2X0K A;  4RPD A;  1B2R A;  3I56 B;  1FX0 A;  1R5O A;  4B48 A;  1S4M A;  3D26 A;  1VQ6 B;  4RD4 A;  4NNJ A;  1VHO A;  4MYT A;  3CCR B;  3W5V A;  3SEJ A;  4FK8 A;  2V7Q A;  3ASP A;  2ZZG A;  3OOC A;  4E0F A;  3V76 A;  1T6Z A;  4TT3 A;  3ZPN A;  4X7C A;  4ZV4 A;  3P26 A;  4TSF A;  2WJV A;  3ASS A;  4NCN A;  4OOX A;  4PAA A;  2QN6 A;  3ASR A;  1KK0 A;  4R71 A;  4Z4Z A;  1K73 D;  2PLF A;  4RDJ A;  4AC9 A;  3ZZ0 A;  4YAF A;  4LC0 A;  3G05 A;  1GAW A;  4P3Y A;  1M1K D;  4TN1 A;  1XE1 A;  2PMD A;  4L8J A;  2DOG A;  4M2L A;  1UMK A;  2C5H A;  2EIX A;  1VQK B;  3A1P A;  2HDN B;  3AVX A;  1ZM4 A;  2BV3 A;  1TLL A;  3W2G A;  4XLA A;  2QA4 B;  5JBQ A;  1H8H A;  1RQP A;  2VNI A;  3OKX A;  4XNF A;  2C2W A;  5CDF A;  3B82 A;  4OP7 A;  5A88 A;  1NB0 A;  2OYN A;  5A8A A;  3CCJ B;  2QGG A;  2Z6B D;  3WYA A;  4OPO A;  1E1Q A;  4II3 A;  4M4S A;  2V7V A;  1G7S A;  4XD7 A;  2EFG A;  4WWV A;  2VBU A;  1G7R A;  1OB0 A;  3J81 k;  5LMZ A;  3CME B;  2OBT A;  3ONU A;  3W5H A;  3Q3A A;  4XN3 A;  1YIT B;  2VNK A;  1ZUN B;  3ZC3 A;  1EFT A;  4IW3 B;  1AIP A;  1SM4 A;  2R9V A;  3MMP A;  3QFR A;  4RDK A;  1M90 D;  1D8T A;  3ZZU A;  5KW9 A;  1VF7 A;  3ZBU A;  1BX1 A;  1WSV A;  2ZTN A;  2ZL5 A;  1YLO A;  3E20 A;  4WQM A;  1KK3 A;  1Q81 D;  1T5E A;  3JU4 A;  4XLC A;  4Z4R A;  4X8I A;  3SJP A;  4DK1 A;  1WSR A;  3G4S B;  1QGZ A;  3JQP A;  1VQL B;  2R6H A;  2B7C A;  4G5G A;  3G71 B;  4P1V A;  4MYU A;  4Z4T A;  3W2F A;  2C4U A;  4X06 A;  2VNH A;  2BM1 A;  2PE3 A;  3SLN A;  4UAJ A;  1TTT A;  4RD3 A;  1CNE A;  4TMX A;  4WZK A;  1K9M D;  1VQM B;  3V7A A;  3BCF A;  1W87 A;  2C5B A;  3Q38 A;  4RDL A;  4P26 A;  2VBT A;  3AGQ A;  3BY1 A;  1W35 A;  1DDI A;  3WBJ A;  2F1L A;  4II2 A;  2XZO A;  1N0U A;  2D74 A;  2F4N A;  2HCJ B;  2QTL A;  4Q7J B;  2JIZ A;  4B47 A;  2RC5 A;  1K28 D;  4WZT A;  2X3U A;  2ZIT A;  4Z4Y A;  1VHE A;  4XLE A;  3CMA B;  4TMZ A;  3CXC B;  4PC6 A;  2XZL A;  2DY1 A;  2OBR A;  1NDH A;  3VO2 A;  4N3G A;  2BGJ A;  3R6J A;  4XKW A;  4P12 A;  4B3X A;  1VQ5 B;  3A8K A;  2NV4 A;  1E43 A;  2M5S A;  1HVX A;  4DQK A;  4UZU A;  1JNY A;  4ASU A;  1D1N A;  1FRN A;  1VQ8 B;  1OB2 A;  5TRD A;  3OZW A;  3GVK A;  5KNL A;  1GJR A;  3T51 B;  1J9Z A;  1P4M A;  2JN9 A;  4P2N A;  3BC9 A;  4RD2 A;  2V4D A;  1COW A;  1HZE A;  1KK1 A;  3BH4 A;  4FXU A;  4G1B A;  2OK7 A;  2CK3 A;  3OFN A;  3OZV A;  3LO8 A;  4BPR A;  1SKQ A;  2WZN A;  3PEN A;  2HLD A;  1VQ9 B;  3DDY A;  2DCU A;  1E3Z A;  1EFR A;  3A35 A;  3WNB A;  2P3M A;  4PC3 A;  1UD4 A;  3FPK A;  3P27 A;  3AVT A;  2GJR A;  3OJW A;  2VZL A;  2ZZE A;  4TMW A;  4G6I A;  3FJO A;  4PC1 A;  3VNU A;  1PJ7 A;  1VQ4 B;  1ZM3 A;  4X7F A;  4F7D A;  4UZE A;  2CW5 A;  4LBV A;  3QFS A;  3CB4 A;  3LQE A;  1TUI A;  2DYI A;  5HZB A;  4QFM A;  1BMF A;  1KTV A;  1IHM A;  2CF4 A;  2FX3 A;  2X6X A;  1E3X A;  4ACB A;  2RC6 A;  1BLI A;  2X85 A;  2V7W A;  5TV2 A;  2GRE A;  1Q9S A;  2JJ1 A;  2AHO A;  4XKV A;  4LBW A;  3AVU A;  1DAR A;  1FDR A;  1I18 A;  1EWY A;  3CPW B;  3CCM B;  1V0F A;  3GQB A;  2VBS A;  4P25 A;  1K8A D;  5TR9 A;  2JJ2 A;  1Y0Y A;  3FPP A;  4UZF A;  1YX2 A;  3RY8 A;  3AVY A;  5J3O A;  4Z4W A;  1N8R D;  3I1F A;  4P22 A;  2JDI A;  4RJL A;  3JQR A;  5DSZ A;  2QDX A;  3VO1 A;  3KEW A;  3WND A;  1HA3 A;  1UD2 A;  5BSX A;  5FL7 A;  1JA0 A;  2WJY A;  4Y9U A;  3Q6Q A;  1E1R A;  1IJE A;  2VYQ A;  4WZL A;  2E1R A;  2XNC A;  2GJK A;  1W9X A;  3CTA A;  5FO0 A;  1I8D A;  2CBX A;  2X6Y A;  1XFO A;  2CND A;  1S0U A;  2Q6I A;  4KKU A;  1KJZ A;  4G7X A;  2VNJ A;  4YEJ A;  3W5U A;  5KSW B;  2YWE A;  3QSY A;  5FO1 A;  1NJI D;  2GK7 A;  2V7T A;  3GVL A;  2Q6O A;  2ZBV A;  1VQO B;  1W0K A;  4HIZ A;  5B6I A;  1I7P A;  2ZXH A;  1YHQ B;  4ACA A;  1UD6 A;  1E64 A;  2GK6 A;  1FNC A;  4P6Y A;  5FA6 A;  4H9G A;  2QMU A;  4FWT A;  2XZP A;  3SJZ A;  3QE2 A;  4C0S A;  3WQZ A;  1UD3 A;  1BQE A;  1V5V A;  3FKS A;  1EP1 B;  2VBV A;  1PJ5 A;  3OW7 A;  1N08 A;  1B23 P;  5HKK A;  4M0L A;  5IYN A;  2W6I A;  2OTJ B;  4RPB A;  2BSA A;  2GJP A;  2XGJ A;  3PUM A;  4RCZ A;  1NBM A;  2WPD A;  3PA2 A;  4X07 A;  2WSS A;  4B3F X;  1N07 A;  5IYP A;  1E63 A;  4PAB A;  2B7B A;  2OK8 A;  4QV2 A;  3BCD A;  2Q6K A;  2VJJ A;  2ZZF A;  3CC4 B;  2Q6L A;  1QGY A;  3MHP A;  3JQQ A;  3H94 A;  1ELO A;  1MAB A;  3QFC A;  4NBS A;  2D3N A;  3WNC A;  4DNR B;  2BN4 A;  2ZZQ A;  1W2B B;  2X6W A;  4G7W A;  4P6V F;  1OGI A;  2J7K A;  1QH0 A;  2XNJ A;  2BPO A;  1QFY A;  1Y0R A;  1KQS B;  4B43 A;  5L46 A;  3MCA A;  4XOR A;  4OOS A;  4QVA A;  4HE6 A;  3ZUG A;  2BVN A;  1EXM A;  1QFJ A;  3E1Y E;  1A8P A;  3GIR A;  4YAW A;  3CCU B;  5THX A;  4XLF A;  3B78 A;  3B8H A;  3WY9 A;  4X05 A;  3CW2 A;  3CPX A;  5GV8 A;  1DDG A;  4XLH A;  2NPF A;  2BF4 A;  4ZCL A;  4AVZ A;  5H59 A;  2X8K A;  3OE7 A;  3BY2 A;  2QTZ A;  2YWF A;  2W6J A;  1FNM A;  1EFU A;  1N0V C;  4YHB A;  4AF7 A;  2ZL6 A;  1GO2 A;  1SKY B;  1VJS A;  2X53 S;  1E79 A;  5IK2 A;  5HZA A;  5FIU A;  4DNT B;  1WDT A;  1QVG B;  3W2I A;  3LQ6 A;  4X7E A;  1WOP A;  4CQJ A;  2OTL B;  2BMW A;  3LVB A;  3OEH A;  3CMM A;  5BSY A;  4XOP A;  3T53 B;  4TMV A;  4B44 A;  1QUF A;  2PIA A;  2BGI A;  1IB0 A;  3OJX A;  1VLO A;  1XQB A;  4YAL A;  3U6K A;  4J0Q A;  4M1K A;  4RM0 A;  5TY0 A;  4RCY A;  1JJ2 B;  3CCL B;  1G7T A;  3A8I A;  2E1B A;  1G7C A;  4P9S A;  4Z1M A;  4QVJ A;  3QFT A;  1AMO A;  3SKB A;  4U9U A;  4YAU A;  1ZM9 A; 
#chains in the Genus database with same CATH homology
 4OPS A;  3Q6R A;  4P1V A;  5BSX A;  4Z4T A;  3Q6Q A;  4WZL A;  3AST A;  4X06 A;  3SLN A;  4QUZ A;  4WZK A;  3V7A A;  3R6K A;  4ROX A;  3Q38 A;  4RDL A;  3Q39 A;  4P26 A;  3BY1 A;  3PA1 A;  4WZT A;  4WZE A;  4OOV A;  3ASQ A;  4RLZ A;  4Z4Y A;  5E6T A;  3BQJ A;  4Z4S A;  2OBR A;  4RPD A;  3R6J A;  4P12 A;  3D26 A;  5IYN A;  4RPB A;  5IYW A;  5J35 A;  3SEJ A;  3ASP A;  3SLD A;  5IYR A;  3PUM A;  2OBS A;  3PA2 A;  4X07 A;  4X7C A;  5IYP A;  4QV2 A;  3ASS A;  4OOX A;  4P2N A;  3ASR A;  5F4J A;  4Z4Z A;  4RDJ A;  3PVD A;  4OOS A;  4QVA A;  4Z4V A;  2ZL7 A;  4P3I A;  4Z4U A;  4X05 A;  4OP7 A;  4X7F A;  3BY2 A;  3LQE A;  4OPO A;  5IYQ A;  5HZB A;  2ZL6 A;  1IHM A;  5F4O A;  5HZA A;  4X7D A;  2OBT A;  3LQ6 A;  3ONU A;  4X7E A;  3ONY A;  3Q3A A;  5BSY A;  5F4M A;  4RDK A;  4RM0 A;  5KW9 A;  4P25 A;  2ZL5 A;  3RY8 A;  4QVJ A;  4OPV A;  5J3O A;  4X0C A;  3SKB A;  4Z4W A;  4Z4R A;  3PUN A;  3SJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...