4RDLA

Crystal structure of norovirus boxer p domain in complex with lewis y tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
297
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQNQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGGGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
total genus 70
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdlA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdlA01
4P12A 4OOVA 4X7CA 1IHMA 3RY8A 3SJPA 4X7FA 2OBSA 5F4JA 4P26A 3SLNA 3PUNA 4P1VA 2ZL7A 4Z4VA 4QVJA 3ASTA 4Z4RA 4RDKA 5HZBA 4P3IA 4Z4ZA 3Q39A 4X07A 5F4MA 3Q6QA 4X7DA 3R6KA 5HZAA 4RDJA 5BSXA 4OOXA 4WZLA 4Z4WA 4X06A 3LQ6A 3ASPA 4Z4TA 4OP7A 5IYPA 3Q6RA 4RM0A 4QV2A 3SKBA 3R6JA 4X0CA 3BY1A 2OBRA 4QUZA 5BSYA 4QVAA 4ROXA 4OPOA 4WZTA 4RLZA 4OPVA 3D26A 5E6TA 3SEJA 3PA2A 4X7EA 4P25A 3ASRA 4X05A 4RPBA 4RPDA 5F4OA 3PA1A 2ZL5A 4OOSA 3Q3AA 3ASQA 5IYQA 3PUMA 3PVDA 4WZKA 5IYNA 3LQEA 3SLDA 3V7AA 3Q38A 2ZL6A 3BY2A 4P2NA 5J35A 3ASSA 4Z4YA 4RDLA 3ONYA 4OPSA 5KW9A 3ONUA 5IYRA 4WZEA 2OBTA 4Z4SA 3BQJA 4Z4UA 5IYWA 5J3OA
chains in the Genus database with same CATH superfamily
4P12A 2DCUA 3SJZA 1KQSB 4IW3B 2CNDA 3U6BA 2XNJA 4B44A 4PC2A 3CMEB 2X3UA 5EMNA 1W35A 4KKUA 4GQNA 2QA4B 1K8AD 1Y0RA 3GVLA 2C4TA 3A3GA 1OHHA 3SJPA 4YHBA 3W5HA 1ZM2A 2DOGA 2BV3A 4HIZA 2GJKA 4TKOB 4TMVA 4AF7A 3PUNA 2EIXA 3CCQB 1CQXA 4Y9UA 2ZXHA 1OB5A 2HMAA 2VYQA 3FPKA 1HZEA 1VQMB 1PJ6A 3OZWA 1GAQA 5HZBA 1N8RD 2BGIA 4P3IA 5H59A 2DETA 1S0UA 2WJYA 4XOTA 1IB0A 5F4MA 4LBWA 3WQZA 1YIJB 4XORA 4XKWA 4RDJA 3W5UA 5JBQA 4OOXA 1TVCA 2X85A 3A3BA 4Z4WA 1EWYA 1PJ7A 2JJ2A 2VBUA 1E1RA 1E1QA 3CP8A 4N3NA 1T6YA 1WSVA 1QFJA 2YWGA 3MMPA 2QTLA 3H94A 3QE2A 4Z4TA 2VBVA 3VO1A 4PABA 5TV2A 1DG1G 1NJID 1N05A 3AVTA 3CD6B 4QV2A 1VQ6B 1EP1B 1S4MA 3OEHA 2OBRA 4QUZA 3W2HA 1Y0YA 2V7TA 3OKXA 2AHOA 2BVNA 5FA6A 1VQPB 1G7CA 3G6EB 1UD5A 3GVJA 4ROXA 1WOOA 3FJOA 4PC6A 4DK1A 1KK2A 1T6XA 3OW7A 1XE1A 3CTAA 1FRQA 1BX1A 3KEWA 2M5SA 3D26A 4TMZA 1WPCA 3AGPA 2E1RA 5B6IA 3ISXA 1FNMA 3B8HA 3PA2A 4P25A 3OPOA 4B3XA 4RPBA 3WNDA 2P3MA 4FK8A 3G71B 3CCVB 1M1KD 1D8TA 4OOSA 1KK1A 3VO2A 1WSRA 3OOCA 4FXUA 2PE3A 4Z1MA 3G4SB 2WZPP 4G7WA 4AF6A 4FWTA 2GK6A 3T53B 1OB2A 3V7AA 2R9VA 5FNZA 1CNFA 2ZL6A 3BCFA 1QGAA 3GVKA 2F1MA 3JQQA 3PENA 4P2NA 4XNFA 5KSWB 3AVYA 1EFUA 2Q6IA 1XB2A 5J35A 4G7XA 2Z6BD 4Z4YA 4XLEA 2GREA 4OPSA 4PC7A 3A8IA 1IJEA 3JQRA 2EFGA 3ONUA 4AVZA 2JJ1A 2V7VA 5J3OA 1W34A 4ACBA 2ZZGA 4KKTA 4TMXA 3AVXA 1ZUNB 1HA3A 1Q7YD 1IHMA 1R5BA 1BX0A 4II3A 4XD7A 3VMFA 4LBVA 4TMTA 3J81k 2YWHA 3ZBTA 2V31A 3MCAA 4M2LA 1UD2A 1KD1D 4P6YA 3QFCA 4X7FA 2PLFA 3OZVA 2V7UA 3OZUA 4P26A 4ZGNB 2ZTGA 2B5OA 5TR9A 2ZL7A 2CF4A 4Z4VA 4RJLA 5AN9A 3ASTA 4Z4RA 1V0FA 2QDXA 4ZV4A 1UD4A 3A8JA 2DERA 2C5BA 4MYTA 3AVVA 1UD3A 1XFOA 1N0VC 3WY9A 1ZM4A 2X53S 3NE5B 4XLHA 2OTJB 3E20A 3Q39A 4XONA 3CCSB 5LMZA 2CC2A 1VQNB 2GJPA 5HZAA 1GO2A 2LZJA 2C78A 2PMDA 4XL9A 1DDGA 2NV4A 1VQ9B 2ZZEA 1JNYA 1WORA 4G6IA 2QE7A 4X06A 3CCJB 5GV7A 5A88A 3LQ6A 3A35A 1EFTA 4RD4A 2QN6A 3ASPA 1TUIA 3CCUB 4RM0A 3CC7B 2BN4A 3R6JA 5TRDA 4PC3A 1W0KA 4PC1A 4DNRB 2W6JA 1KRHA 2XZLA 4WQMA 1SKQA 3GQBA 5GV8A 5H5JA 4UAJA 2V7XA 5CDFA 1AIPA 4L8JA 4M1KA 3OJWA 4BPRA 5L46A 1H8EA 1YJ9B 3CESA 1Q81D 1WDTA 4B4DA 2BMWA 2CK3A 3U6KA 4OPVA 1YI2B 1A8PA 2BPOA 1W9XA 5E6TA 1SM4A 1OGIA 4X7EA 3CXCB 1VQ7B 4H9GA 3LVBA 3WYAA 1VF7A 4UZUA 2OK7A 4RPDA 5FO0A 1BQEA 5F4OA 3PA1A 1R5OA 2XOKA 1G7TA 2F1LA 1T6ZA 1VQ5B 2QGGA 1N06A 3WXMA 3ASQA 1UMKA 1BMFA 1FRNA 3PUMA 4G5GA 3VR6A 2E1BA 2VNKA 3AGQA 1B23P 2YWFA 1RQPA 3ZZ0A 3SLDA 3BY2A 1PKVA 4EH1A 1VQLB 2W6IA 1DARA 3JQPA 3OE7A 3P26A 1COWA 4YAUA 2X6XA 1UD6A 1EP2B 1UD8A 2FX3A 2DY1A 4RD2A 4FN5A 3BCDA 1E3ZA 2C5HA 1GAWA 1H8HA 3E1YE 4M4SA 4Z4SA 2FVGA 3BQJA 4Z4UA 3CCMB 4DQLA 3OP1A 3CCRB 3T51B 1VLYA 1P4MA 5FO1A 4OOVA 4X7CA 1QVFB 1QG0A 5HKKA 1VHEA 2VNJA 2X6WA 3CMMA 2VNIA 1ELOA 3RY8A 3ZIAA 2HLDA 1CNEA 1QVGB 1W0JA 1D2EA 4KKSA 3GSIA 1I18A 1JA1A 3CMAB 2OBSA 2VBTA 1QUFA 3ZZUA 4P1VA 5FL7A 4PAAA 4YAOA 4N3GA 3QFSA 1GJRA 1FX0A 4B47A 1PJ5A 4JMQA 1MABA 1GR1A 4B48A 1N08A 4RDKA 3OW2B 3W2EA 1S72B 1Q86D 1IJFA 4Z4ZA 2XZOA 5DS0A 4G1BA 4X07A 4XR6A 4X7DA 4YAWA 2X6YA 3B78A 4ZCMA 5BSXA 1YHQB 1V0EA 1U2RA 2V7WA 3CP2A 4NBSA 3FPPA 4XN3A 4P22A 1E43A 2C4UA 1E62A 2KVOA 2HDNB 3QFRA 1EP3B 4UZEA 4ACAA 1NDHA 3LNNA 1I8DA 4RD3A 1WOPA 4UZFA 5A8AA 1HVXA 1QX4A 3AVUA 3W2FA 2QEXB 1V5VA 1YX2A 2B7BA 1KTVA 3WNBA 5DN6A 3WBKA 1OB0A 4X0CA 4HE6A 4YEJA 1NRKA 4TMWA 4XOPA 1FDRA 5BSYA 4P3YA 3WBJA 2BF4A 2WJVA 2V7QA 2CRVA 4RD1A 2WSSA 3ZZTA 4HE5A 1JB9A 1RQRA 2D74A 1QGYA 2V4DA 2XNDA 4CQJA 2WPDA 2NPFA 4Y9RA 3VNVA 1MRZA 2B7CA 2XNCA 2ZBUA 2JIZA 1DDIA 2D3NA 2DIEA 3B82A 1R5NA 3JU4A 3W2IA 1M90D 4TT3A 2ZZQA 4ZCLA 1T5EA 2VJIA 5IYQA 1NBMA 4RD6A 3PVDA 4ASUA 5TY0A 1VQ8B 1TTTA 2XGJA 1B2RA 3W2GA 4RCZA 1F20A 3LQEA 3ZPNA 3Q38A 4XQFA 4ZGQB 3MHPA 4DQKA 1Q9SA 1K28D 1TLLA 4DNTB 1AMOA 4LBZA 5THXA 1NB9A 1EXMA 1QUEA 4RDLA 3U2QA 3VNUA 1WOSA 1FNCA 3ONYA 1EFCA 1ZM3A 2WR8A 4M0LA 1W2BB 2RC5A 3V76A 2DEUA 1K73D 2ZTNA 2XZPA 3G05A 4QFMA 3WNCA 4WZEA 2OBTA 5IYRA 1WP6A 3CCLB 3A1PA 4WWVA 2PIAA 1H42A 3W5VA 2J7KA 3ZUGA 3ES9A 4E0FA 3CB4A 1QFZA 3CRZA 5IK2A 3H9NA 4B43A 1W87A 4XLAA 3DDYA 4ZCIA 4LC0A 1KMHA 4YAFA 4XMYA 1EFRA 4LBYA 2YWEA 1GVHA 1VQKB 5F4JA 3FKSA 4NCNA 3AVWA 4F7DA 3SLNA 1OGJA 2QMUA 3GIRA 4MYUA 4NNJA 4U9UA 2GJRA 1KK3A 5HXBA 4QVJA 4XN0A 1KZLA 2Q6KA 2WYRA 2XEXA 3CPWB 1WTHD 1QH0A 2RC6A 5DSZA 3CPXA 4X8IA 4Y7CA 4B3FX 2VBSA 3I1FA 1E79A 1E3XA 1J9ZA 1F60A 1G7RA 3Q6QA 1YJWB 3LO8A 3R6KA 1ZM9A 4G1VA 4Q7JB 2BSAA 2QTZA 3BNWA 1H85A 1VJSA 4WZLA 1JJ2B 4PGOA 1K9MD 1Q82D 4RD0A 2BM0A 2OK8A 2C2WA 4QHYA 1YITB 5KNLA 2X0KA 3ZBUA 2CBXA 1G7SA 1BJKA 3CC2B 4B3GA 5A89A 3ZC3A 1BPLA 1VQOB 2ZZFA 4M53A 4OP7A 2GK7A 4C43A 5IYPA 1XQBA 3OJXA 3I56B 3Q6RA 3QSYA 3KL9A 1VHOA 3P27A 2VJJA 4J0QA 3SKBA 4XLFA 4II2A 3A8KA 3BY1A 2VZLA 2D9RA 3OFNA 2ZXIA 3HAGA 3QFTA 2OTLB 2GQFA 2DYIA 4K1XA 4QVAA 1SKYB 1KK0A 1NB0A 4OPOA 4WZTA 3BC9A 4RLZA 3SEJA 4DK0A 3OAAA 4XLCA 4P9SA 2ZBVA 3ASRA 2HCJB 1E63A 4X05A 3BH4A 2I1LA 2WZNA 4RCYA 4XM3A 1BLIA 2Q6OA 4YALA 4AC9A 1VQ4B 5FIUA 2ZL5A 3Q3AA 1I7PA 4YXWA 3CCEB 1VLOA 3I55B 1QGZA 1YJNB 1FNBA 1QFYA 2R6HA 4C0SA 4WZKA 2JN9A 4XKVA 4TSFA 2JDIA 5IYNA 2CW5A 2X8KA 1FNDA 2BGJA 2F4NA 2C77A 3T56B 1E64A 3OEEA 2Q6LA 2BM1A 1D1NA 3ASSA 1WU8A 2ZITA 1JA0A 1N07A 2D3LA 4R71A 3CW2A 3CC4B 4YELA 1YLOA 2OYNA 5KW9A 4P6VF 1N0UA 2VNHA 5IYWA 4TN1A 1KJZA 1KC8D 2F43A 2GPJA
chains in the Genus database with same CATH topology
4P12A 4OOVA 4X7CA 1IHMA 3RY8A 3SJPA 4X7FA 2OBSA 5F4JA 4P26A 3SLNA 3PUNA 4P1VA 2ZL7A 4Z4VA 4QVJA 3ASTA 4Z4RA 4RDKA 5HZBA 4P3IA 4Z4ZA 3Q39A 4X07A 5F4MA 3Q6QA 4X7DA 3R6KA 5HZAA 4RDJA 5BSXA 4OOXA 4WZLA 4Z4WA 4X06A 3LQ6A 3ASPA 4Z4TA 4OP7A 5IYPA 3Q6RA 4RM0A 4QV2A 3SKBA 3R6JA 4X0CA 3BY1A 2OBRA 4QUZA 5BSYA 4QVAA 4ROXA 4OPOA 4WZTA 4RLZA 4OPVA 3D26A 5E6TA 3SEJA 3PA2A 4X7EA 4P25A 3ASRA 4X05A 4RPBA 4RPDA 5F4OA 3PA1A 2ZL5A 4OOSA 3Q3AA 3ASQA 5IYQA 3PUMA 3PVDA 4WZKA 5IYNA 3LQEA 3SLDA 3V7AA 3Q38A 2ZL6A 3BY2A 4P2NA 5J35A 3ASSA 4Z4YA 4RDLA 3ONYA 4OPSA 5KW9A 3ONUA 5IYRA 4WZEA 2OBTA 4Z4SA 3BQJA 4Z4UA 5IYWA 5J3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P12 A;  4OOV A;  4X7C A;  1IHM A;  3RY8 A;  3SJP A;  4X7F A;  2OBS A;  5F4J A;  4P26 A;  3SLN A;  3PUN A;  4P1V A;  2ZL7 A;  4Z4V A;  4QVJ A;  3AST A;  4Z4R A;  4RDK A;  5HZB A;  4P3I A;  4Z4Z A;  3Q39 A;  4X07 A;  5F4M A;  3Q6Q A;  4X7D A;  3R6K A;  5HZA A;  4RDJ A;  5BSX A;  4OOX A;  4WZL A;  4Z4W A;  4X06 A;  3LQ6 A;  3ASP A;  4Z4T A;  4OP7 A;  5IYP A;  3Q6R A;  4RM0 A;  4QV2 A;  3SKB A;  3R6J A;  4X0C A;  3BY1 A;  2OBR A;  4QUZ A;  5BSY A;  4QVA A;  4ROX A;  4OPO A;  4WZT A;  4RLZ A;  4OPV A;  3D26 A;  5E6T A;  3SEJ A;  3PA2 A;  4X7E A;  4P25 A;  3ASR A;  4X05 A;  4RPB A;  4RPD A;  5F4O A;  3PA1 A;  2ZL5 A;  4OOS A;  3Q3A A;  3ASQ A;  5IYQ A;  3PUM A;  3PVD A;  4WZK A;  5IYN A;  3LQE A;  3SLD A;  3V7A A;  3Q38 A;  2ZL6 A;  3BY2 A;  4P2N A;  5J35 A;  3ASS A;  4Z4Y A;  4RDL A;  3ONY A;  4OPS A;  5KW9 A;  3ONU A;  5IYR A;  4WZE A;  2OBT A;  4Z4S A;  3BQJ A;  4Z4U A;  5IYW A;  5J3O A; 
#chains in the Genus database with same CATH topology
 4P12 A;  2DCU A;  3SJZ A;  1KQS B;  4IW3 B;  2CND A;  3U6B A;  2XNJ A;  4B44 A;  4PC2 A;  3CME B;  2X3U A;  5EMN A;  1W35 A;  4KKU A;  4GQN A;  2QA4 B;  1K8A D;  1Y0R A;  3GVL A;  2C4T A;  3A3G A;  1OHH A;  3SJP A;  4YHB A;  3W5H A;  1ZM2 A;  2DOG A;  2BV3 A;  4HIZ A;  2GJK A;  4TKO B;  4TMV A;  4AF7 A;  3PUN A;  2EIX A;  3CCQ B;  1CQX A;  4Y9U A;  2ZXH A;  1OB5 A;  2HMA A;  2VYQ A;  3FPK A;  1HZE A;  1VQM B;  1PJ6 A;  3OZW A;  1GAQ A;  5HZB A;  1N8R D;  2BGI A;  4P3I A;  5H59 A;  2DET A;  1S0U A;  2WJY A;  4XOT A;  1IB0 A;  5F4M A;  4LBW A;  3WQZ A;  1YIJ B;  4XOR A;  4XKW A;  4RDJ A;  3W5U A;  5JBQ A;  4OOX A;  1TVC A;  2X85 A;  3A3B A;  4Z4W A;  1EWY A;  1PJ7 A;  2JJ2 A;  2VBU A;  1E1R A;  1E1Q A;  3CP8 A;  4N3N A;  1T6Y A;  1WSV A;  1QFJ A;  2YWG A;  3MMP A;  2QTL A;  3H94 A;  3QE2 A;  4Z4T A;  2VBV A;  3VO1 A;  4PAB A;  5TV2 A;  1DG1 G;  1NJI D;  1N05 A;  3AVT A;  3CD6 B;  4QV2 A;  1VQ6 B;  1EP1 B;  1S4M A;  3OEH A;  2OBR A;  4QUZ A;  3W2H A;  1Y0Y A;  2V7T A;  3OKX A;  2AHO A;  2BVN A;  5FA6 A;  1VQP B;  1G7C A;  3G6E B;  1UD5 A;  3GVJ A;  4ROX A;  1WOO A;  3FJO A;  4PC6 A;  4DK1 A;  1KK2 A;  1T6X A;  3OW7 A;  1XE1 A;  3CTA A;  1FRQ A;  1BX1 A;  3KEW A;  2M5S A;  3D26 A;  4TMZ A;  1WPC A;  3AGP A;  2E1R A;  5B6I A;  3ISX A;  1FNM A;  3B8H A;  3PA2 A;  4P25 A;  3OPO A;  4B3X A;  4RPB A;  3WND A;  2P3M A;  4FK8 A;  3G71 B;  3CCV B;  1M1K D;  1D8T A;  4OOS A;  1KK1 A;  3VO2 A;  1WSR A;  3OOC A;  4FXU A;  2PE3 A;  4Z1M A;  3G4S B;  2WZP P;  4G7W A;  4AF6 A;  4FWT A;  2GK6 A;  3T53 B;  1OB2 A;  3V7A A;  2R9V A;  5FNZ A;  1CNF A;  2ZL6 A;  3BCF A;  1QGA A;  3GVK A;  2F1M A;  3JQQ A;  3PEN A;  4P2N A;  4XNF A;  5KSW B;  3AVY A;  1EFU A;  2Q6I A;  1XB2 A;  5J35 A;  4G7X A;  2Z6B D;  4Z4Y A;  4XLE A;  2GRE A;  4OPS A;  4PC7 A;  3A8I A;  1IJE A;  3JQR A;  2EFG A;  3ONU A;  4AVZ A;  2JJ1 A;  2V7V A;  5J3O A;  1W34 A;  4ACB A;  2ZZG A;  4KKT A;  4TMX A;  3AVX A;  1ZUN B;  1HA3 A;  1Q7Y D;  1IHM A;  1R5B A;  1BX0 A;  4II3 A;  4XD7 A;  3VMF A;  4LBV A;  4TMT A;  3J81 k;  2YWH A;  3ZBT A;  2V31 A;  3MCA A;  4M2L A;  1UD2 A;  1KD1 D;  4P6Y A;  3QFC A;  4X7F A;  2PLF A;  3OZV A;  2V7U A;  3OZU A;  4P26 A;  4ZGN B;  2ZTG A;  2B5O A;  5TR9 A;  2ZL7 A;  2CF4 A;  4Z4V A;  4RJL A;  5AN9 A;  3AST A;  4Z4R A;  1V0F A;  2QDX A;  4ZV4 A;  1UD4 A;  3A8J A;  2DER A;  2C5B A;  4MYT A;  3AVV A;  1UD3 A;  1XFO A;  1N0V C;  3WY9 A;  1ZM4 A;  2X53 S;  3NE5 B;  4XLH A;  2OTJ B;  3E20 A;  3Q39 A;  4XON A;  3CCS B;  5LMZ A;  2CC2 A;  1VQN B;  2GJP A;  5HZA A;  1GO2 A;  2LZJ A;  2C78 A;  2PMD A;  4XL9 A;  1DDG A;  2NV4 A;  1VQ9 B;  2ZZE A;  1JNY A;  1WOR A;  4G6I A;  2QE7 A;  4X06 A;  3CCJ B;  5GV7 A;  5A88 A;  3LQ6 A;  3A35 A;  1EFT A;  4RD4 A;  2QN6 A;  3ASP A;  1TUI A;  3CCU B;  4RM0 A;  3CC7 B;  2BN4 A;  3R6J A;  5TRD A;  4PC3 A;  1W0K A;  4PC1 A;  4DNR B;  2W6J A;  1KRH A;  2XZL A;  4WQM A;  1SKQ A;  3GQB A;  5GV8 A;  5H5J A;  4UAJ A;  2V7X A;  5CDF A;  1AIP A;  4L8J A;  4M1K A;  3OJW A;  4BPR A;  5L46 A;  1H8E A;  1YJ9 B;  3CES A;  1Q81 D;  1WDT A;  4B4D A;  2BMW A;  2CK3 A;  3U6K A;  4OPV A;  1YI2 B;  1A8P A;  2BPO A;  1W9X A;  5E6T A;  1SM4 A;  1OGI A;  4X7E A;  3CXC B;  1VQ7 B;  4H9G A;  3LVB A;  3WYA A;  1VF7 A;  4UZU A;  2OK7 A;  4RPD A;  5FO0 A;  1BQE A;  5F4O A;  3PA1 A;  1R5O A;  2XOK A;  1G7T A;  2F1L A;  1T6Z A;  1VQ5 B;  2QGG A;  1N06 A;  3WXM A;  3ASQ A;  1UMK A;  1BMF A;  1FRN A;  3PUM A;  4G5G A;  3VR6 A;  2E1B A;  2VNK A;  3AGQ A;  1B23 P;  2YWF A;  1RQP A;  3ZZ0 A;  3SLD A;  3BY2 A;  1PKV A;  4EH1 A;  1VQL B;  2W6I A;  1DAR A;  3JQP A;  3OE7 A;  3P26 A;  1COW A;  4YAU A;  2X6X A;  1UD6 A;  1EP2 B;  1UD8 A;  2FX3 A;  2DY1 A;  4RD2 A;  4FN5 A;  3BCD A;  1E3Z A;  2C5H A;  1GAW A;  1H8H A;  3E1Y E;  4M4S A;  4Z4S A;  2FVG A;  3BQJ A;  4Z4U A;  3CCM B;  4DQL A;  3OP1 A;  3CCR B;  3T51 B;  1VLY A;  1P4M A;  5FO1 A;  4OOV A;  4X7C A;  1QVF B;  1QG0 A;  5HKK A;  1VHE A;  2VNJ A;  2X6W A;  3CMM A;  2VNI A;  1ELO A;  3RY8 A;  3ZIA A;  2HLD A;  1CNE A;  1QVG B;  1W0J A;  1D2E A;  4KKS A;  3GSI A;  1I18 A;  1JA1 A;  3CMA B;  2OBS A;  2VBT A;  1QUF A;  3ZZU A;  4P1V A;  5FL7 A;  4PAA A;  4YAO A;  4N3G A;  3QFS A;  1GJR A;  1FX0 A;  4B47 A;  1PJ5 A;  4JMQ A;  1MAB A;  1GR1 A;  4B48 A;  1N08 A;  4RDK A;  3OW2 B;  3W2E A;  1S72 B;  1Q86 D;  1IJF A;  4Z4Z A;  2XZO A;  5DS0 A;  4G1B A;  4X07 A;  4XR6 A;  4X7D A;  4YAW A;  2X6Y A;  3B78 A;  4ZCM A;  5BSX A;  1YHQ B;  1V0E A;  1U2R A;  2V7W A;  3CP2 A;  4NBS A;  3FPP A;  4XN3 A;  4P22 A;  1E43 A;  2C4U A;  1E62 A;  2KVO A;  2HDN B;  3QFR A;  1EP3 B;  4UZE A;  4ACA A;  1NDH A;  3LNN A;  1I8D A;  4RD3 A;  1WOP A;  4UZF A;  5A8A A;  1HVX A;  1QX4 A;  3AVU A;  3W2F A;  2QEX B;  1V5V A;  1YX2 A;  2B7B A;  1KTV A;  3WNB A;  5DN6 A;  3WBK A;  1OB0 A;  4X0C A;  4HE6 A;  4YEJ A;  1NRK A;  4TMW A;  4XOP A;  1FDR A;  5BSY A;  4P3Y A;  3WBJ A;  2BF4 A;  2WJV A;  2V7Q A;  2CRV A;  4RD1 A;  2WSS A;  3ZZT A;  4HE5 A;  1JB9 A;  1RQR A;  2D74 A;  1QGY A;  2V4D A;  2XND A;  4CQJ A;  2WPD A;  2NPF A;  4Y9R A;  3VNV A;  1MRZ A;  2B7C A;  2XNC A;  2ZBU A;  2JIZ A;  1DDI A;  2D3N A;  2DIE A;  3B82 A;  1R5N A;  3JU4 A;  3W2I A;  1M90 D;  4TT3 A;  2ZZQ A;  4ZCL A;  1T5E A;  2VJI A;  5IYQ A;  1NBM A;  4RD6 A;  3PVD A;  4ASU A;  5TY0 A;  1VQ8 B;  1TTT A;  2XGJ A;  1B2R A;  3W2G A;  4RCZ A;  1F20 A;  3LQE A;  3ZPN A;  3Q38 A;  4XQF A;  4ZGQ B;  3MHP A;  4DQK A;  1Q9S A;  1K28 D;  1TLL A;  4DNT B;  1AMO A;  4LBZ A;  5THX A;  1NB9 A;  1EXM A;  1QUE A;  4RDL A;  3U2Q A;  3VNU A;  1WOS A;  1FNC A;  3ONY A;  1EFC A;  1ZM3 A;  2WR8 A;  4M0L A;  1W2B B;  2RC5 A;  3V76 A;  2DEU A;  1K73 D;  2ZTN A;  2XZP A;  3G05 A;  4QFM A;  3WNC A;  4WZE A;  2OBT A;  5IYR A;  1WP6 A;  3CCL B;  3A1P A;  4WWV A;  2PIA A;  1H42 A;  3W5V A;  2J7K A;  3ZUG A;  3ES9 A;  4E0F A;  3CB4 A;  1QFZ A;  3CRZ A;  5IK2 A;  3H9N A;  4B43 A;  1W87 A;  4XLA A;  3DDY A;  4ZCI A;  4LC0 A;  1KMH A;  4YAF A;  4XMY A;  1EFR A;  4LBY A;  2YWE A;  1GVH A;  1VQK B;  5F4J A;  3FKS A;  4NCN A;  3AVW A;  4F7D A;  3SLN A;  1OGJ A;  2QMU A;  3GIR A;  4MYU A;  4NNJ A;  4U9U A;  2GJR A;  1KK3 A;  5HXB A;  4QVJ A;  4XN0 A;  1KZL A;  2Q6K A;  2WYR A;  2XEX A;  3CPW B;  1WTH D;  1QH0 A;  2RC6 A;  5DSZ A;  3CPX A;  4X8I A;  4Y7C A;  4B3F X;  2VBS A;  3I1F A;  1E79 A;  1E3X A;  1J9Z A;  1F60 A;  1G7R A;  3Q6Q A;  1YJW B;  3LO8 A;  3R6K A;  1ZM9 A;  4G1V A;  4Q7J B;  2BSA A;  2QTZ A;  3BNW A;  1H85 A;  1VJS A;  4WZL A;  1JJ2 B;  4PGO A;  1K9M D;  1Q82 D;  4RD0 A;  2BM0 A;  2OK8 A;  2C2W A;  4QHY A;  1YIT B;  5KNL A;  2X0K A;  3ZBU A;  2CBX A;  1G7S A;  1BJK A;  3CC2 B;  4B3G A;  5A89 A;  3ZC3 A;  1BPL A;  1VQO B;  2ZZF A;  4M53 A;  4OP7 A;  2GK7 A;  4C43 A;  5IYP A;  1XQB A;  3OJX A;  3I56 B;  3Q6R A;  3QSY A;  3KL9 A;  1VHO A;  3P27 A;  2VJJ A;  4J0Q A;  3SKB A;  4XLF A;  4II2 A;  3A8K A;  3BY1 A;  2VZL A;  2D9R A;  3OFN A;  2ZXI A;  3HAG A;  3QFT A;  2OTL B;  2GQF A;  2DYI A;  4K1X A;  4QVA A;  1SKY B;  1KK0 A;  1NB0 A;  4OPO A;  4WZT A;  3BC9 A;  4RLZ A;  3SEJ A;  4DK0 A;  3OAA A;  4XLC A;  4P9S A;  2ZBV A;  3ASR A;  2HCJ B;  1E63 A;  4X05 A;  3BH4 A;  2I1L A;  2WZN A;  4RCY A;  4XM3 A;  1BLI A;  2Q6O A;  4YAL A;  4AC9 A;  1VQ4 B;  5FIU A;  2ZL5 A;  3Q3A A;  1I7P A;  4YXW A;  3CCE B;  1VLO A;  3I55 B;  1QGZ A;  1YJN B;  1FNB A;  1QFY A;  2R6H A;  4C0S A;  4WZK A;  2JN9 A;  4XKV A;  4TSF A;  2JDI A;  5IYN A;  2CW5 A;  2X8K A;  1FND A;  2BGJ A;  2F4N A;  2C77 A;  3T56 B;  1E64 A;  3OEE A;  2Q6L A;  2BM1 A;  1D1N A;  3ASS A;  1WU8 A;  2ZIT A;  1JA0 A;  1N07 A;  2D3L A;  4R71 A;  3CW2 A;  3CC4 B;  4YEL A;  1YLO A;  2OYN A;  5KW9 A;  4P6V F;  1N0U A;  2VNH A;  5IYW A;  4TN1 A;  1KJZ A;  1KC8 D;  2F43 A;  2GPJ A; 
#chains in the Genus database with same CATH homology
 4P12 A;  4OOV A;  4X7C A;  1IHM A;  3RY8 A;  3SJP A;  4X7F A;  2OBS A;  5F4J A;  4P26 A;  3SLN A;  3PUN A;  4P1V A;  2ZL7 A;  4Z4V A;  4QVJ A;  3AST A;  4Z4R A;  4RDK A;  5HZB A;  4P3I A;  4Z4Z A;  3Q39 A;  4X07 A;  5F4M A;  3Q6Q A;  4X7D A;  3R6K A;  5HZA A;  4RDJ A;  5BSX A;  4OOX A;  4WZL A;  4Z4W A;  4X06 A;  3LQ6 A;  3ASP A;  4Z4T A;  4OP7 A;  5IYP A;  3Q6R A;  4RM0 A;  4QV2 A;  3SKB A;  3R6J A;  4X0C A;  3BY1 A;  2OBR A;  4QUZ A;  5BSY A;  4QVA A;  4ROX A;  4OPO A;  4WZT A;  4RLZ A;  4OPV A;  3D26 A;  5E6T A;  3SEJ A;  3PA2 A;  4X7E A;  4P25 A;  3ASR A;  4X05 A;  4RPB A;  4RPD A;  5F4O A;  3PA1 A;  2ZL5 A;  4OOS A;  3Q3A A;  3ASQ A;  5IYQ A;  3PUM A;  3PVD A;  4WZK A;  5IYN A;  3LQE A;  3SLD A;  3V7A A;  3Q38 A;  2ZL6 A;  3BY2 A;  4P2N A;  5J35 A;  3ASS A;  4Z4Y A;  4RDL A;  3ONY A;  4OPS A;  5KW9 A;  3ONU A;  5IYR A;  4WZE A;  2OBT A;  4Z4S A;  3BQJ A;  4Z4U A;  5IYW A;  5J3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...