4RDLA

Crystal structure of norovirus boxer p domain in complex with lewis y tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
297
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQNQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGGGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
molecule tags Viral protein
total genus 70
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdlA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdlA01
3Q6RA 3PA2A 3Q38A 4OPSA 4OPVA 4X06A 3SJPA 5F4JA 5E6TA 5J35A 4X05A 3PUNA 4WZLA 4P25A 4RDLA 5BSYA 4X7CA 3R6JA 4P1VA 3ONUA 2ZL5A 4RPBA 5IYWA 3D26A 3BY2A 4RPDA 4QVJA 4WZKA 4X7DA 3ASQA 2ZL7A 3ASRA 5F4OA 2OBTA 5F4MA 3BQJA 3SLNA 3ASSA 4ROXA 5IYQA 4Z4UA 5HZAA 3ONYA 4P12A 4WZEA 3RY8A 4Z4WA 5BSXA 3LQ6A 4WZTA 3LQEA 3PVDA 4QUZA 4RLZA 4RDKA 4Z4RA 3V7AA 4Z4ZA 3R6KA 4X7EA 1IHMA 5HZBA 4X07A 4QV2A 4P3IA 2ZL6A 3PUMA 4RM0A 3PA1A 4OOVA 4X7FA 3ASPA 4RDJA 5IYRA 4Z4VA 5KW9A 3Q6QA 3SKBA 4QVAA 3SEJA 4OOSA 4OPOA 5IYPA 4Z4TA 4Z4SA 4OOXA 4OP7A 5J3OA 2OBRA 4P26A 3Q3AA 3ASTA 2OBSA 4X0CA 5IYNA 4P2NA 4Z4YA 3BY1A 3SLDA 3Q39A
chains in the Genus database with same CATH superfamily
4YALA 4KKUA 4YHBA 4TKOB 4Y7CA 4BPRA 3A8JA 3Q38A 3H94A 5JBQA 1W9XA 4C0SA 1VQ8B 4WWVA 1PJ5A 3CW2A 1VHEA 1Q86D 3U6KA 3W5HA 4DQKA 1FNDA 4TSFA 4YAFA 4GQNA 1N05A 2C77A 1H42A 4X05A 5FNZA 3WXMA 4XQFA 1NB0A 3T56B 2CC2A 4DK1A 2XGJA 3ONUA 2D9RA 1Q9SA 3E1YE 2OTJB 2QMUA 1TLLA 1R5OA 3CCUB 1IJEA 1UMKA 2QA4B 4WZKA 2WSSA 1UD8A 1DARA 1EFRA 1BX0A 1UD4A 4C43A 1D8TA 2CW5A 2EIXA 3CPXA 3QFSA 4G7WA 2X8KA 2BGIA 4XORA 3WNDA 1BMFA 3W2EA 3SLNA 1XE1A 3ZZTA 3MCAA 3CESA 3CTAA 3ASSA 2BVNA 2ZZQA 3JU4A 3A35A 5TR9A 3CMAB 3CCVB 1VF7A 5H59A 5IYQA 2YWEA 1EP2B 1Q81D 3AVUA 3ZC3A 2DERA 2BM0A 4P12A 2V7TA 1RQPA 4LBZA 3W2GA 1R5NA 4WQMA 4XLAA 2X53S 1D1NA 2V4DA 3CB4A 2ZXIA 1W87A 5FO0A 1DDIA 1D2EA 3LQ6A 3CP8A 4P9SA 2YWGA 3OP1A 1K8AD 3SJZA 3FPPA 4J0QA 4B44A 2YWHA 2WJVA 2VBTA 1CNFA 1QVFB 3VR6A 3WBKA 3MHPA 1GO2A 1OB2A 4RCZA 1I18A 2RC5A 3OZVA 3WNBA 4XD7A 3ZZ0A 2V7VA 3WBJA 1H8HA 4XOPA 3OEEA 1S72B 1T6YA 2X3UA 2DIEA 1OGIA 4RD1A 3CMEB 1EWYA 3FPKA 4Z4ZA 2VYQA 4XONA 2R9VA 1YJ9B 1VQ9B 3VMFA 1VQ5B 1VQNB 2BF4A 4X07A 1WSVA 4QV2A 3A8IA 1FRNA 3BC9A 1N0UA 1IB0A 1PKVA 4X7FA 2VZLA 5FA6A 1YI2B 5IYRA 4Z4VA 5LMZA 2GK7A 2KVOA 3SKBA 3W2HA 1H8EA 1KJZA 4FXUA 4TT3A 4CQJA 5A89A 3ZUGA 2QN6A 3ZBTA 4UZUA 1QGZA 4B3FX 1YHQB 2JN9A 3U6BA 1B2RA 4ASUA 4PC3A 1FDRA 3ZIAA 1NJID 2VNKA 3G71B 1HVXA 5IYNA 1E3XA 4P2NA 1VJSA 1ZM4A 3BY1A 3CD6B 2FVGA 3VO1A 3Q6RA 1E63A 4PC1A 4QHYA 1QH0A 4M4SA 1EXMA 3CC2B 1S0UA 3AVVA 3SJPA 2HCJB 4U9UA 2CNDA 2EFGA 4AF6A 2DYIA 5J35A 4XNFA 4RD6A 3T51B 5GV7A 1KK0A 4TMZA 4RDLA 1VLOA 1WTHD 4G5GA 4P3YA 4P1VA 2ZL5A 3I56B 2CF4A 2XNCA 2BSAA 1OGJA 2DY1A 4XKWA 3BY2A 2HMAA 3T53B 2C5BA 3OFNA 1GR1A 1R5BA 3ZPNA 2QEXB 4TN1A 2B7CA 3W5VA 1T6ZA 2RC6A 3WQZA 3CXCB 3ASRA 4IW3B 2M5SA 3CCRB 1I7PA 2R6HA 1G7RA 1WSRA 5F4MA 4LBYA 2QDXA 1G7TA 3JQQA 5H5JA 4ACBA 3CMMA 2XOKA 4AF7A 4AC9A 3I1FA 1J9ZA 3CC4B 4ROXA 4UAJA 1WU8A 3CCJB 3BH4A 3QFRA 1RQRA 3OZWA 4DNRB 1F20A 2OK8A 3RY8A 2Z6BD 2NPFA 4XKVA 3OJWA 2OTLB 4B4DA 4WZTA 1E64A 3LQEA 1W0JA 1PJ6A 1CNEA 1WOSA 2DEUA 1XB2A 1E62A 3AGPA 5DN6A 1K9MD 1F60A 1DDGA 1EP1B 4RLZA 4TMTA 2Q6KA 2XZPA 4XLCA 3A8KA 2OYNA 1WP6A 1FX0A 2V31A 1GAQA 1CQXA 4YAWA 2GQFA 1WPCA 1T5EA 4PC6A 3PENA 1G7CA 4B43A 1G7SA 2ZTNA 4M0LA 1OHHA 4B3GA 1BJKA 3I55B 2DCUA 3OW2B 3R6KA 4X7EA 1IHMA 1QGAA 3P27A 4JMQA 1YX2A 2D3NA 1WOOA 1KQSB 2GK6A 2DOGA 4TMXA 2V7QA 2ZL6A 4XOTA 5FL7A 3WYAA 4RM0A 4PC7A 3ISXA 4RD4A 2BMWA 2AHOA 1VQPB 4G1VA 1YJNB 3ASPA 4RDJA 1KK3A 1AMOA 2E1RA 5KW9A 2PLFA 1SM4A 2GREA 2F4NA 3G05A 3WNCA 5A8AA 2J7KA 5IYPA 1NRKA 1HZEA 3V76A 4QFMA 2W6IA 2PE3A 5L46A 2GJKA 1E43A 1NB9A 3AVXA 1SKQA 1E3ZA 4X0CA 3GVLA 1ZUNB 2F43A 1VQOB 3QSYA 3AVWA 3SLDA 5B6IA 1Q82D 1BX1A 2ZTGA 2ZZGA 4R71A 3PA2A 2OK7A 2XNJA 3P26A 4MYUA 1B23P 4OPSA 2VNIA 4OPVA 5THXA 1Y0RA 4YELA 2VJJA 4II2A 2DETA 1W0KA 2PMDA 2WYRA 5F4JA 5E6TA 1KZLA 3CP2A 1VQ4B 3OOCA 1ZM2A 1EFCA 2NV4A 5AN9A 1EP3B 5A88A 1K28D 4WZLA 4P25A 1YLOA 1ZM3A 1KC8D 2BM1A 2ZZFA 4RD0A 3KL9A 3ZBUA 5IYWA 5HXBA 4ZCLA 3CC7B 3W5UA 1E1RA 4RD2A 4ZGNB 2JDIA 2LZJA 4RPDA 4H9GA 4XLFA 4Q7JB 1KMHA 1KRHA 2ZXHA 2BGJA 5DS0A 3KEWA 3OAAA 3ASQA 1TVCA 3OW7A 4RCYA 2ZL7A 4YAOA 2XZOA 1FNBA 3OZUA 5F4OA 5CDFA 4E0FA 2OBTA 1EFTA 3BQJA 4TMVA 1GVHA 2BPOA 2C5HA 4ZGQB 1KD1D 1TTTA 4NBSA 2YWFA 1OB0A 3OPOA 4TMWA 1V5VA 2CBXA 3QE2A 3FJOA 3AVTA 1PJ7A 4UZEA 2VJIA 2GJRA 1V0EA 5TY0A 4WZEA 1K73D 4Z4WA 4YAUA 3WY9A 3JQPA 2D3LA 5BSXA 1AIPA 2WPDA 1VQ6B 3U2QA 1QFJA 4II3A 1XFOA 4PGOA 1MABA 1M1KD 1JJ2B 1E79A 2GPJA 4HE6A 1VQMB 4XN0A 3VNUA 3BCFA 4FWTA 2QGGA 2WJYA 4P6VF 2V7UA 3B82A 3ZZUA 5KNLA 2D74A 3HAGA 4EH1A 3V7AA 4NCNA 3OEHA 1SKYB 2WZNA 5DSZA 1W2BB 3QFTA 4B47A 1GAWA 1M90D 1HA3A 4DK0A 3FKSA 5HKKA 3OE7A 2Q6LA 1Q7YD 1FRQA 4P6YA 2WR8A 1N07A 3LVBA 4LBWA 2X0KA 3PA1A 2W6JA 5KSWB 3GVKA 2V7XA 3BCDA 3CRZA 5IK2A 3Q6QA 1YIJB 5GV8A 3B78A 4QVAA 3SEJA 1H85A 2E1BA 4OOSA 1KK1A 3CCSB 1WOPA 3VNVA 2VNJA 4Z4SA 3BNWA 3ES9A 4OOXA 1KTVA 1T6XA 2C4UA 4OP7A 5J3OA 5EMNA 4P26A 2CRVA 3Q3AA 3ASTA 1N0VC 2OBSA 4G7XA 3W2FA 1Y0YA 2C2WA 5FO1A 1UD6A 3GQBA 2V7WA 3Q39A 4HIZA 4XR6A 4F7DA 2BN4A 1JNYA 2VNHA 4XN3A 4XMYA 4B48A 2X6WA 1COWA 4X06A 2X6XA 2ZZEA 1XQBA 3E20A 1ELOA 4ACAA 4X8IA 4Y9RA 4N3GA 3A3GA 5TRDA 2F1LA 3PUNA 4L8JA 3G4SB 4FK8A 4G6IA 4RD3A 5BSYA 4X7CA 3R6JA 1GJRA 3A1PA 1U2RA 3CCQB 4RPBA 3D26A 3NE5B 1N06A 2HLDA 4ZCMA 1VQLB 4XM3A 4KKSA 2CK3A 1P4MA 4QVJA 4X7DA 2B7BA 1S4MA 3GVJA 1MRZA 3A3BA 2JIZA 2VBSA 2XNDA 3W2IA 1YITB 2Q6OA 2ZBVA 4DNTB 4Y9UA 4ZV4A 4LBVA 1NDHA 1UD3A 1ZM9A 1UD2A 4KKTA 2C78A 1VQKB 3G6EB 3JQRA 1QFZA 2BV3A 4HE5A 1KK2A 1QGYA 1W35A 4Z4UA 5HZAA 3ONYA 4FN5A 4XLEA 1QUEA 2X6YA 5TV2A 4NNJA 4B3XA 1QVGB 4PC2A 1QX4A 3PVDA 3CCMB 2PIAA 2C4TA 1A8PA 4PABA 2F1MA 1EFUA 4XLHA 2B5OA 3CPWB 3CCEB 3LNNA 2QTLA 4QUZA 3OKXA 1V0FA 1WDTA 1JA0A 1JA1A 4RJLA 4K1XA 3VO2A 1OB5A 2ZBUA 1W34A 1BQEA 2JJ2A 1VHOA 2XEXA 3LO8A 3OJXA 3J81k 4LC0A 4M53A 2XZLA 4RDKA 4Z4RA 2VBUA 2ZITA 1N8RD 2Q6IA 1VLYA 4UZFA 1TUIA 1QG0A 3CCLB 2X85A 5FIUA 3MMPA 5HZBA 1QFYA 4M1KA 1E1QA 1I8DA 2HDNB 3GIRA 4MYTA 1VQ7B 2FX3A 4P3IA 4G1BA 2QE7A 3PUMA 2WZPP 3AVYA 4DQLA 4Z1MA 4AVZA 4OOVA 2GJPA 1WORA 3QFCA 1JB9A 4N3NA 1IJFA 3DDYA 1BPLA 1BLIA 1N08A 2I1LA 2VBVA 4M2LA 4PAAA 4OPOA 3H9NA 4Z4TA 4XL9A 4ZCIA 4YEJA 2P3MA 2QTZA 3AGQA 4YXWA 2OBRA 1QUFA 1DG1G 1FNMA 3GSIA 3B8HA 4P22A 4Z4YA 1YJWB 2JJ1A 1FNCA 1UD5A 1NBMA
chains in the Genus database with same CATH topology
3Q6RA 3PA2A 3Q38A 4OPSA 4OPVA 4X06A 3SJPA 5F4JA 5E6TA 5J35A 4X05A 3PUNA 4WZLA 4P25A 4RDLA 5BSYA 4X7CA 3R6JA 4P1VA 3ONUA 2ZL5A 4RPBA 5IYWA 3D26A 3BY2A 4RPDA 4QVJA 4WZKA 4X7DA 3ASQA 2ZL7A 3ASRA 5F4OA 2OBTA 5F4MA 3BQJA 3SLNA 3ASSA 4ROXA 5IYQA 4Z4UA 5HZAA 3ONYA 4P12A 4WZEA 3RY8A 4Z4WA 5BSXA 3LQ6A 4WZTA 3LQEA 3PVDA 4QUZA 4RLZA 4RDKA 4Z4RA 3V7AA 4Z4ZA 3R6KA 4X7EA 1IHMA 5HZBA 4X07A 4QV2A 4P3IA 2ZL6A 3PUMA 4RM0A 3PA1A 4OOVA 4X7FA 3ASPA 4RDJA 5IYRA 4Z4VA 5KW9A 3Q6QA 3SKBA 4QVAA 3SEJA 4OOSA 4OPOA 5IYPA 4Z4TA 4Z4SA 4OOXA 4OP7A 5J3OA 2OBRA 4P26A 3Q3AA 3ASTA 2OBSA 4X0CA 5IYNA 4P2NA 4Z4YA 3BY1A 3SLDA 3Q39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6R A;  3PA2 A;  3Q38 A;  4OPS A;  4OPV A;  4X06 A;  3SJP A;  5F4J A;  5E6T A;  5J35 A;  4X05 A;  3PUN A;  4WZL A;  4P25 A;  4RDL A;  5BSY A;  4X7C A;  3R6J A;  4P1V A;  3ONU A;  2ZL5 A;  4RPB A;  5IYW A;  3D26 A;  3BY2 A;  4RPD A;  4QVJ A;  4WZK A;  4X7D A;  3ASQ A;  2ZL7 A;  3ASR A;  5F4O A;  2OBT A;  5F4M A;  3BQJ A;  3SLN A;  3ASS A;  4ROX A;  5IYQ A;  4Z4U A;  5HZA A;  3ONY A;  4P12 A;  4WZE A;  3RY8 A;  4Z4W A;  5BSX A;  3LQ6 A;  4WZT A;  3LQE A;  3PVD A;  4QUZ A;  4RLZ A;  4RDK A;  4Z4R A;  3V7A A;  4Z4Z A;  3R6K A;  4X7E A;  1IHM A;  5HZB A;  4X07 A;  4QV2 A;  4P3I A;  2ZL6 A;  3PUM A;  4RM0 A;  3PA1 A;  4OOV A;  4X7F A;  3ASP A;  4RDJ A;  5IYR A;  4Z4V A;  5KW9 A;  3Q6Q A;  3SKB A;  4QVA A;  3SEJ A;  4OOS A;  4OPO A;  5IYP A;  4Z4T A;  4Z4S A;  4OOX A;  4OP7 A;  5J3O A;  2OBR A;  4P26 A;  3Q3A A;  3AST A;  2OBS A;  4X0C A;  5IYN A;  4P2N A;  4Z4Y A;  3BY1 A;  3SLD A;  3Q39 A; 
#chains in the Genus database with same CATH topology
 4YAL A;  4KKU A;  4YHB A;  4TKO B;  4Y7C A;  4BPR A;  3A8J A;  3Q38 A;  3H94 A;  5JBQ A;  1W9X A;  4C0S A;  1VQ8 B;  4WWV A;  1PJ5 A;  3CW2 A;  1VHE A;  1Q86 D;  3U6K A;  3W5H A;  4DQK A;  1FND A;  4TSF A;  4YAF A;  4GQN A;  1N05 A;  2C77 A;  1H42 A;  4X05 A;  5FNZ A;  3WXM A;  4XQF A;  1NB0 A;  3T56 B;  2CC2 A;  4DK1 A;  2XGJ A;  3ONU A;  2D9R A;  1Q9S A;  3E1Y E;  2OTJ B;  2QMU A;  1TLL A;  1R5O A;  3CCU B;  1IJE A;  1UMK A;  2QA4 B;  4WZK A;  2WSS A;  1UD8 A;  1DAR A;  1EFR A;  1BX0 A;  1UD4 A;  4C43 A;  1D8T A;  2CW5 A;  2EIX A;  3CPX A;  3QFS A;  4G7W A;  2X8K A;  2BGI A;  4XOR A;  3WND A;  1BMF A;  3W2E A;  3SLN A;  1XE1 A;  3ZZT A;  3MCA A;  3CES A;  3CTA A;  3ASS A;  2BVN A;  2ZZQ A;  3JU4 A;  3A35 A;  5TR9 A;  3CMA B;  3CCV B;  1VF7 A;  5H59 A;  5IYQ A;  2YWE A;  1EP2 B;  1Q81 D;  3AVU A;  3ZC3 A;  2DER A;  2BM0 A;  4P12 A;  2V7T A;  1RQP A;  4LBZ A;  3W2G A;  1R5N A;  4WQM A;  4XLA A;  2X53 S;  1D1N A;  2V4D A;  3CB4 A;  2ZXI A;  1W87 A;  5FO0 A;  1DDI A;  1D2E A;  3LQ6 A;  3CP8 A;  4P9S A;  2YWG A;  3OP1 A;  1K8A D;  3SJZ A;  3FPP A;  4J0Q A;  4B44 A;  2YWH A;  2WJV A;  2VBT A;  1CNF A;  1QVF B;  3VR6 A;  3WBK A;  3MHP A;  1GO2 A;  1OB2 A;  4RCZ A;  1I18 A;  2RC5 A;  3OZV A;  3WNB A;  4XD7 A;  3ZZ0 A;  2V7V A;  3WBJ A;  1H8H A;  4XOP A;  3OEE A;  1S72 B;  1T6Y A;  2X3U A;  2DIE A;  1OGI A;  4RD1 A;  3CME B;  1EWY A;  3FPK A;  4Z4Z A;  2VYQ A;  4XON A;  2R9V A;  1YJ9 B;  1VQ9 B;  3VMF A;  1VQ5 B;  1VQN B;  2BF4 A;  4X07 A;  1WSV A;  4QV2 A;  3A8I A;  1FRN A;  3BC9 A;  1N0U A;  1IB0 A;  1PKV A;  4X7F A;  2VZL A;  5FA6 A;  1YI2 B;  5IYR A;  4Z4V A;  5LMZ A;  2GK7 A;  2KVO A;  3SKB A;  3W2H A;  1H8E A;  1KJZ A;  4FXU A;  4TT3 A;  4CQJ A;  5A89 A;  3ZUG A;  2QN6 A;  3ZBT A;  4UZU A;  1QGZ A;  4B3F X;  1YHQ B;  2JN9 A;  3U6B A;  1B2R A;  4ASU A;  4PC3 A;  1FDR A;  3ZIA A;  1NJI D;  2VNK A;  3G71 B;  1HVX A;  5IYN A;  1E3X A;  4P2N A;  1VJS A;  1ZM4 A;  3BY1 A;  3CD6 B;  2FVG A;  3VO1 A;  3Q6R A;  1E63 A;  4PC1 A;  4QHY A;  1QH0 A;  4M4S A;  1EXM A;  3CC2 B;  1S0U A;  3AVV A;  3SJP A;  2HCJ B;  4U9U A;  2CND A;  2EFG A;  4AF6 A;  2DYI A;  5J35 A;  4XNF A;  4RD6 A;  3T51 B;  5GV7 A;  1KK0 A;  4TMZ A;  4RDL A;  1VLO A;  1WTH D;  4G5G A;  4P3Y A;  4P1V A;  2ZL5 A;  3I56 B;  2CF4 A;  2XNC A;  2BSA A;  1OGJ A;  2DY1 A;  4XKW A;  3BY2 A;  2HMA A;  3T53 B;  2C5B A;  3OFN A;  1GR1 A;  1R5B A;  3ZPN A;  2QEX B;  4TN1 A;  2B7C A;  3W5V A;  1T6Z A;  2RC6 A;  3WQZ A;  3CXC B;  3ASR A;  4IW3 B;  2M5S A;  3CCR B;  1I7P A;  2R6H A;  1G7R A;  1WSR A;  5F4M A;  4LBY A;  2QDX A;  1G7T A;  3JQQ A;  5H5J A;  4ACB A;  3CMM A;  2XOK A;  4AF7 A;  4AC9 A;  3I1F A;  1J9Z A;  3CC4 B;  4ROX A;  4UAJ A;  1WU8 A;  3CCJ B;  3BH4 A;  3QFR A;  1RQR A;  3OZW A;  4DNR B;  1F20 A;  2OK8 A;  3RY8 A;  2Z6B D;  2NPF A;  4XKV A;  3OJW A;  2OTL B;  4B4D A;  4WZT A;  1E64 A;  3LQE A;  1W0J A;  1PJ6 A;  1CNE A;  1WOS A;  2DEU A;  1XB2 A;  1E62 A;  3AGP A;  5DN6 A;  1K9M D;  1F60 A;  1DDG A;  1EP1 B;  4RLZ A;  4TMT A;  2Q6K A;  2XZP A;  4XLC A;  3A8K A;  2OYN A;  1WP6 A;  1FX0 A;  2V31 A;  1GAQ A;  1CQX A;  4YAW A;  2GQF A;  1WPC A;  1T5E A;  4PC6 A;  3PEN A;  1G7C A;  4B43 A;  1G7S A;  2ZTN A;  4M0L A;  1OHH A;  4B3G A;  1BJK A;  3I55 B;  2DCU A;  3OW2 B;  3R6K A;  4X7E A;  1IHM A;  1QGA A;  3P27 A;  4JMQ A;  1YX2 A;  2D3N A;  1WOO A;  1KQS B;  2GK6 A;  2DOG A;  4TMX A;  2V7Q A;  2ZL6 A;  4XOT A;  5FL7 A;  3WYA A;  4RM0 A;  4PC7 A;  3ISX A;  4RD4 A;  2BMW A;  2AHO A;  1VQP B;  4G1V A;  1YJN B;  3ASP A;  4RDJ A;  1KK3 A;  1AMO A;  2E1R A;  5KW9 A;  2PLF A;  1SM4 A;  2GRE A;  2F4N A;  3G05 A;  3WNC A;  5A8A A;  2J7K A;  5IYP A;  1NRK A;  1HZE A;  3V76 A;  4QFM A;  2W6I A;  2PE3 A;  5L46 A;  2GJK A;  1E43 A;  1NB9 A;  3AVX A;  1SKQ A;  1E3Z A;  4X0C A;  3GVL A;  1ZUN B;  2F43 A;  1VQO B;  3QSY A;  3AVW A;  3SLD A;  5B6I A;  1Q82 D;  1BX1 A;  2ZTG A;  2ZZG A;  4R71 A;  3PA2 A;  2OK7 A;  2XNJ A;  3P26 A;  4MYU A;  1B23 P;  4OPS A;  2VNI A;  4OPV A;  5THX A;  1Y0R A;  4YEL A;  2VJJ A;  4II2 A;  2DET A;  1W0K A;  2PMD A;  2WYR A;  5F4J A;  5E6T A;  1KZL A;  3CP2 A;  1VQ4 B;  3OOC A;  1ZM2 A;  1EFC A;  2NV4 A;  5AN9 A;  1EP3 B;  5A88 A;  1K28 D;  4WZL A;  4P25 A;  1YLO A;  1ZM3 A;  1KC8 D;  2BM1 A;  2ZZF A;  4RD0 A;  3KL9 A;  3ZBU A;  5IYW A;  5HXB A;  4ZCL A;  3CC7 B;  3W5U A;  1E1R A;  4RD2 A;  4ZGN B;  2JDI A;  2LZJ A;  4RPD A;  4H9G A;  4XLF A;  4Q7J B;  1KMH A;  1KRH A;  2ZXH A;  2BGJ A;  5DS0 A;  3KEW A;  3OAA A;  3ASQ A;  1TVC A;  3OW7 A;  4RCY A;  2ZL7 A;  4YAO A;  2XZO A;  1FNB A;  3OZU A;  5F4O A;  5CDF A;  4E0F A;  2OBT A;  1EFT A;  3BQJ A;  4TMV A;  1GVH A;  2BPO A;  2C5H A;  4ZGQ B;  1KD1 D;  1TTT A;  4NBS A;  2YWF A;  1OB0 A;  3OPO A;  4TMW A;  1V5V A;  2CBX A;  3QE2 A;  3FJO A;  3AVT A;  1PJ7 A;  4UZE A;  2VJI A;  2GJR A;  1V0E A;  5TY0 A;  4WZE A;  1K73 D;  4Z4W A;  4YAU A;  3WY9 A;  3JQP A;  2D3L A;  5BSX A;  1AIP A;  2WPD A;  1VQ6 B;  3U2Q A;  1QFJ A;  4II3 A;  1XFO A;  4PGO A;  1MAB A;  1M1K D;  1JJ2 B;  1E79 A;  2GPJ A;  4HE6 A;  1VQM B;  4XN0 A;  3VNU A;  3BCF A;  4FWT A;  2QGG A;  2WJY A;  4P6V F;  2V7U A;  3B82 A;  3ZZU A;  5KNL A;  2D74 A;  3HAG A;  4EH1 A;  3V7A A;  4NCN A;  3OEH A;  1SKY B;  2WZN A;  5DSZ A;  1W2B B;  3QFT A;  4B47 A;  1GAW A;  1M90 D;  1HA3 A;  4DK0 A;  3FKS A;  5HKK A;  3OE7 A;  2Q6L A;  1Q7Y D;  1FRQ A;  4P6Y A;  2WR8 A;  1N07 A;  3LVB A;  4LBW A;  2X0K A;  3PA1 A;  2W6J A;  5KSW B;  3GVK A;  2V7X A;  3BCD A;  3CRZ A;  5IK2 A;  3Q6Q A;  1YIJ B;  5GV8 A;  3B78 A;  4QVA A;  3SEJ A;  1H85 A;  2E1B A;  4OOS A;  1KK1 A;  3CCS B;  1WOP A;  3VNV A;  2VNJ A;  4Z4S A;  3BNW A;  3ES9 A;  4OOX A;  1KTV A;  1T6X A;  2C4U A;  4OP7 A;  5J3O A;  5EMN A;  4P26 A;  2CRV A;  3Q3A A;  3AST A;  1N0V C;  2OBS A;  4G7X A;  3W2F A;  1Y0Y A;  2C2W A;  5FO1 A;  1UD6 A;  3GQB A;  2V7W A;  3Q39 A;  4HIZ A;  4XR6 A;  4F7D A;  2BN4 A;  1JNY A;  2VNH A;  4XN3 A;  4XMY A;  4B48 A;  2X6W A;  1COW A;  4X06 A;  2X6X A;  2ZZE A;  1XQB A;  3E20 A;  1ELO A;  4ACA A;  4X8I A;  4Y9R A;  4N3G A;  3A3G A;  5TRD A;  2F1L A;  3PUN A;  4L8J A;  3G4S B;  4FK8 A;  4G6I A;  4RD3 A;  5BSY A;  4X7C A;  3R6J A;  1GJR A;  3A1P A;  1U2R A;  3CCQ B;  4RPB A;  3D26 A;  3NE5 B;  1N06 A;  2HLD A;  4ZCM A;  1VQL B;  4XM3 A;  4KKS A;  2CK3 A;  1P4M A;  4QVJ A;  4X7D A;  2B7B A;  1S4M A;  3GVJ A;  1MRZ A;  3A3B A;  2JIZ A;  2VBS A;  2XND A;  3W2I A;  1YIT B;  2Q6O A;  2ZBV A;  4DNT B;  4Y9U A;  4ZV4 A;  4LBV A;  1NDH A;  1UD3 A;  1ZM9 A;  1UD2 A;  4KKT A;  2C78 A;  1VQK B;  3G6E B;  3JQR A;  1QFZ A;  2BV3 A;  4HE5 A;  1KK2 A;  1QGY A;  1W35 A;  4Z4U A;  5HZA A;  3ONY A;  4FN5 A;  4XLE A;  1QUE A;  2X6Y A;  5TV2 A;  4NNJ A;  4B3X A;  1QVG B;  4PC2 A;  1QX4 A;  3PVD A;  3CCM B;  2PIA A;  2C4T A;  1A8P A;  4PAB A;  2F1M A;  1EFU A;  4XLH A;  2B5O A;  3CPW B;  3CCE B;  3LNN A;  2QTL A;  4QUZ A;  3OKX A;  1V0F A;  1WDT A;  1JA0 A;  1JA1 A;  4RJL A;  4K1X A;  3VO2 A;  1OB5 A;  2ZBU A;  1W34 A;  1BQE A;  2JJ2 A;  1VHO A;  2XEX A;  3LO8 A;  3OJX A;  3J81 k;  4LC0 A;  4M53 A;  2XZL A;  4RDK A;  4Z4R A;  2VBU A;  2ZIT A;  1N8R D;  2Q6I A;  1VLY A;  4UZF A;  1TUI A;  1QG0 A;  3CCL B;  2X85 A;  5FIU A;  3MMP A;  5HZB A;  1QFY A;  4M1K A;  1E1Q A;  1I8D A;  2HDN B;  3GIR A;  4MYT A;  1VQ7 B;  2FX3 A;  4P3I A;  4G1B A;  2QE7 A;  3PUM A;  2WZP P;  3AVY A;  4DQL A;  4Z1M A;  4AVZ A;  4OOV A;  2GJP A;  1WOR A;  3QFC A;  1JB9 A;  4N3N A;  1IJF A;  3DDY A;  1BPL A;  1BLI A;  1N08 A;  2I1L A;  2VBV A;  4M2L A;  4PAA A;  4OPO A;  3H9N A;  4Z4T A;  4XL9 A;  4ZCI A;  4YEJ A;  2P3M A;  2QTZ A;  3AGQ A;  4YXW A;  2OBR A;  1QUF A;  1DG1 G;  1FNM A;  3GSI A;  3B8H A;  4P22 A;  4Z4Y A;  1YJW B;  2JJ1 A;  1FNC A;  1UD5 A;  1NBM A; 
#chains in the Genus database with same CATH homology
 3Q6R A;  3PA2 A;  3Q38 A;  4OPS A;  4OPV A;  4X06 A;  3SJP A;  5F4J A;  5E6T A;  5J35 A;  4X05 A;  3PUN A;  4WZL A;  4P25 A;  4RDL A;  5BSY A;  4X7C A;  3R6J A;  4P1V A;  3ONU A;  2ZL5 A;  4RPB A;  5IYW A;  3D26 A;  3BY2 A;  4RPD A;  4QVJ A;  4WZK A;  4X7D A;  3ASQ A;  2ZL7 A;  3ASR A;  5F4O A;  2OBT A;  5F4M A;  3BQJ A;  3SLN A;  3ASS A;  4ROX A;  5IYQ A;  4Z4U A;  5HZA A;  3ONY A;  4P12 A;  4WZE A;  3RY8 A;  4Z4W A;  5BSX A;  3LQ6 A;  4WZT A;  3LQE A;  3PVD A;  4QUZ A;  4RLZ A;  4RDK A;  4Z4R A;  3V7A A;  4Z4Z A;  3R6K A;  4X7E A;  1IHM A;  5HZB A;  4X07 A;  4QV2 A;  4P3I A;  2ZL6 A;  3PUM A;  4RM0 A;  3PA1 A;  4OOV A;  4X7F A;  3ASP A;  4RDJ A;  5IYR A;  4Z4V A;  5KW9 A;  3Q6Q A;  3SKB A;  4QVA A;  3SEJ A;  4OOS A;  4OPO A;  5IYP A;  4Z4T A;  4Z4S A;  4OOX A;  4OP7 A;  5J3O A;  2OBR A;  4P26 A;  3Q3A A;  3AST A;  2OBS A;  4X0C A;  5IYN A;  4P2N A;  4Z4Y A;  3BY1 A;  3SLD A;  3Q39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...