4RDLA

Crystal structure of norovirus boxer p domain in complex with lewis y tetrasaccharide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
297
structure length
297
Chain Sequence
KPFSVPNIPMNLMSNSRVPMLIDGMMVSNDQNQVPQFQNGRVTLDGQLQGTTTVSAACIARMRGRIFNNNGNYGVNLAELDGNPYHAFDSPAPLGFPDFGNCDLHMTFVKINPTELSTGDPSGKVVIHSYDATFAPHLGTVKLEDNNELDQFVGKEVVLELTWVSNRTGATLNLWAVPNYGSNLTQASQLAPPIYPPGFGEAIVYFTSTFPTVSNPKVPCTLPQEFVSHFVNEQAPTRGDAALLHYVDPDTHRNLGEFKMYPEGYMTCVPNAGGGPQTLPINGVFVFISWVSRYYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of GI.8 Boxer virus P dimers in complex with HBGAs, a novel evolutionary path selected by the Lewis epitope
pubmed doi rcsb
source organism Human calicivirus nlv/boxer/2001/us
molecule tags Viral protein
molecule keywords Capsid
total genus 70
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4rdlA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4rdlA01
4ROXA 4X7EA 4QV2A 2ZL7A 2OBSA 3BQJA 4P25A 4WZKA 4RM0A 5IYRA 5F4OA 4Z4SA 5HZAA 4QUZA 3ONUA 3SKBA 4X07A 5BSXA 4Z4RA 4X05A 3Q6QA 4P1VA 3R6KA 4WZLA 4QVAA 3ASTA 3V7AA 4OOVA 5IYQA 5F4JA 3BY2A 3ASPA 3PUMA 4OOSA 4X0CA 4RDKA 5J3OA 3LQEA 4WZTA 4OPOA 3D26A 4OOXA 3PVDA 5IYPA 4RDJA 4Z4UA 4WZEA 4OPVA 4Z4WA 3ASRA 3BY1A 3SEJA 5IYWA 4Z4VA 2ZL6A 3ASQA 5E6TA 3Q39A 4X06A 3Q38A 5BSYA 4QVJA 5F4MA 4RLZA 3PUNA 3Q3AA 4P12A 3SLNA 4Z4TA 4OP7A 4P26A 4RPDA 2OBTA 3LQ6A 4Z4YA 3SLDA 3Q6RA 2OBRA 4P3IA 3PA1A 4X7FA 4P2NA 2ZL5A 3ASSA 5HZBA 1IHMA 5IYNA 3PA2A 4X7CA 4RPBA 4OPSA 3SJPA 3RY8A 4RDLA 3R6JA 3ONYA 5J35A 4X7DA 4Z4ZA 5KW9A
chains in the Genus database with same CATH superfamily
4MYTA 4DQKA 1FNMA 4WQMA 4QV2A 2C78A 4RD6A 2OBSA 2VNIA 1Y0RA 3BQJA 2VNHA 4UZUA 2CRVA 3OOCA 1VQ7B 4B44A 3CCRB 4C0SA 1E1RA 4XL9A 4QUZA 3ONUA 3I1FA 1QUEA 2DETA 3H9NA 4LC0A 2X53S 4Y7CA 4II3A 4P1VA 2OTJB 2I1LA 2F1MA 1A8PA 1I18A 2DIEA 1ZM3A 2V7UA 4OOVA 5FIUA 2DERA 3AVXA 1EP3B 1K9MD 4G5GA 3A1PA 2OK8A 1IJEA 4YAFA 4XONA 5AN9A 3KL9A 5DSZA 5IK2A 1QG0A 3ZBTA 2QEXB 2Q6KA 3BY2A 3ASPA 1T6XA 3ES9A 1D1NA 2VBUA 4FWTA 2GJKA 1VQPB 2C4TA 1V0EA 2X0KA 3VNVA 1W34A 3CMAB 2GPJA 4WZTA 2YWGA 1VLOA 3B82A 2DYIA 1Q7YD 1DARA 2BN4A 1WP6A 2F43A 2QDXA 5DN6A 3CCEB 1KK2A 1I7PA 2WZNA 2QMUA 2ZTGA 3AGPA 1G7TA 3ZBUA 1H42A 4Z4UA 3WQZA 4TSFA 1H8HA 2VNKA 4Z4WA 1NRKA 5IYWA 1E43A 2EFGA 5TRDA 4M53A 1S4MA 2PMDA 1N06A 2D74A 4KKUA 3WXMA 3Q38A 3AVUA 4RLZA 1P4MA 3E20A 1VHOA 1EFRA 2BGIA 2FVGA 3FPPA 1JB9A 1RQPA 5KNLA 1KK3A 1SM4A 3ISXA 4OP7A 4FXUA 3LO8A 2WSSA 1ZM9A 1W87A 4RJLA 4CQJA 3OKXA 1S72B 4FN5A 2CF4A 2QE7A 2QGGA 2X85A 4B4DA 2ZITA 5LMZA 1FX0A 1DDGA 3JQPA 4U9UA 2ZBVA 4B47A 3CCVB 1TUIA 4YAOA 4F7DA 1E79A 3JQRA 5H5JA 2XZLA 1ELOA 1BMFA 3MHPA 2ZZGA 4X7FA 4P2NA 5TR9A 2ZL5A 3I56B 1IJFA 1PJ5A 3OEEA 4YAWA 3ASSA 2D3NA 1CQXA 2J7KA 1IHMA 1ZM2A 4X7CA 4KKSA 1PJ7A 1VQMB 3FJOA 2ZZQA 1Q9SA 4OPSA 3AVVA 3RY8A 3ZC3A 4UZEA 5H59A 1UD6A 4EH1A 4RDLA 1M1KD 5CDFA 1EWYA 2JDIA 3CRZA 4J0QA 1N07A 2YWFA 1BX1A 2BMWA 3JQQA 3W5VA 2VJIA 2V7XA 4ACAA 4RD3A 4Z4ZA 4ROXA 3CPWB 4RD4A 1JA1A 3OZWA 4WWVA 3V76A 1QUFA 1KC8D 2DCUA 2WPDA 1PKVA 1W35A 4N3NA 1PJ6A 3A3BA 4LBVA 4DK1A 3G05A 4RM0A 5F4OA 2NPFA 1OHHA 3SKBA 2VJJA 4ZGQB 4YXWA 4X07A 1W2BB 4X05A 1E64A 4G7WA 1YITB 1J9ZA 3CXCB 4Q7JB 4MYUA 1OB5A 4WZLA 2VYQA 3JU4A 5KSWB 4XOPA 3ASTA 1YIJB 3AGQA 1K28D 4B3XA 1F60A 3AVWA 4DQLA 3WBJA 1UMKA 1BJKA 4AF7A 1R5NA 3CMMA 4AF6A 4R71A 4X0CA 1GR1A 5J3OA 1EFUA 1V5VA 2XOKA 3QFCA 4XORA 2OYNA 2X6XA 4AC9A 3CP8A 1R5BA 4TN1A 1GAQA 4IW3B 4P6VF 1T6ZA 2WJYA 1WU8A 3D26A 1YJNB 2C2WA 1VHEA 4G7XA 4RDJA 1MABA 3U2QA 4P9SA 5GV8A 1E1QA 3OZUA 3P27A 4XNFA 1MRZA 4ZCMA 2WR8A 3MMPA 2OTLB 4NCNA 4OPVA 4K1XA 1HVXA 3ASRA 4Z4VA 3B78A 5DS0A 1WPCA 2QN6A 3Q39A 4P22A 5L46A 4XR6A 1NDHA 3GVKA 4QVJA 2ZZFA 4PC6A 1JA0A 1YLOA 3CESA 5B6IA 5FNZA 1GO2A 3T53B 1KJZA 4P12A 3OEHA 1EFCA 3ZZTA 1KK1A 3QFSA 4XLAA 4E0FA 2BGJA 4RPDA 1Q86D 1NBMA 1FRQA 3LQ6A 1D2EA 4ZCLA 3Q6RA 3CC7B 2ZXHA 1VQ6B 3GIRA 4HE6A 2RC6A 3CC4B 1NJID 3OPOA 5FL7A 3J81k 1FNCA 1QVGB 2GJPA 3G71B 3OJXA 2PE3A 3ZZUA 2OK7A 1VQ4B 1Q82D 3OW2B 1QGZA 1T5EA 1V0FA 4XOTA 3LNNA 1I8DA 2XZPA 3WY9A 5HZBA 4TKOB 2BPOA 5TV2A 1G7CA 4QHYA 4PABA 1WDTA 2C5HA 3DDYA 1SKYB 4XLEA 1VLYA 2QA4B 3BNWA 4G1VA 1YX2A 2M5SA 1SKQA 2Q6LA 1BX0A 1T6YA 2B7CA 2GREA 2W6IA 4RD0A 1OB0A 4XLCA 1N8RD 2DEUA 1M90D 5KW9A 3CPXA 1S0UA 2BM0A 1N0VC 4M4SA 2HDNB 4UZFA 2ZL7A 1QGYA 2GQFA 4P25A 4Z1MA 4WZKA 1CNEA 5IYRA 4Z4SA 1N05A 4L8JA 3HAGA 5A88A 1KMHA 3NE5B 1VQOB 3OW7A 2X3UA 5BSXA 4Z4RA 4YALA 2XGJA 3CCQB 2CNDA 4QVAA 1RQRA 2QTZA 1IB0A 4TMWA 2BV3A 1N08A 4XKWA 5FA6A 3W2FA 2V31A 5F4JA 5FO1A 1NB9A 3BCFA 1OGJA 3A8KA 1K8AD 4LBWA 3PUMA 2B7BA 1WOOA 1TLLA 3W5UA 1R5OA 2X6WA 4YAUA 2WJVA 1YJWB 1NB0A 2AHOA 1VQ9B 1VQNB 2C77A 3CD6B 4ASUA 1XE1A 2E1BA 4OPOA 3CCUB 2D3LA 3B8HA 3VO2A 2HCJB 3QE2A 4OOXA 3PVDA 4XN0A 3W5HA 3T56B 4HE5A 2Q6IA 1GAWA 4XM3A 3CB4A 4FK8A 3VMFA 4JMQA 4PAAA 2W6JA 2ZBUA 1KZLA 4WZEA 3VR6A 3GSIA 4XLFA 3SEJA 1B2RA 4B43A 4LBYA 3VO1A 1E63A 4RD2A 4TT3A 3OAAA 5E6TA 4X06A 5BSYA 4ACBA 1G7RA 3W2HA 4PC2A 4XD7A 2E1RA 3SLNA 4B3FX 4KKTA 4Z4TA 3H94A 1QFYA 1OGIA 3CMEB 4H9GA 4Z4YA 2JIZA 3ZZ0A 1BLIA 2NV4A 2R9VA 4P3IA 4AVZA 1W0JA 3OFNA 4II2A 3QFRA 4XMYA 1XB2A 2XNCA 3G6EB 3OE7A 1EP1B 4XKVA 2ZZEA 1VQKB 3MCAA 2HMAA 2X8KA 4XN3A 4DNTB 2VBVA 1H8EA 3BCDA 5HXBA 2V7TA 3I55B 1AMOA 1B23P 4M0LA 3WNBA 2WYRA 4RD1A 3U6KA 2C4UA 2RC5A 1D8TA 1EFTA 1EXMA 2WZPP 1FNDA 3GVLA 4RPBA 5GV7A 2GK6A 2V7WA 2VZLA 2JN9A 4P6YA 3A8IA 1F20A 3OP1A 2B5OA 2X6YA 4PGOA 4TMTA 4XLHA 3ONYA 1WSRA 1W0KA 5J35A 1YI2B 5A89A 2PIAA 2CW5A 3WNDA 3AVYA 1UD4A 1DDIA 4X7DA 1TVCA 2Z6BD 3GVJA 2VBSA 1DG1G 1XQBA 1KRHA 1QX4A 4X7EA 3PENA 4C43A 1CNFA 3LVBA 1VQ5B 4TMZA 2FX3A 2YWEA 2CBXA 3CC2B 5HZAA 5EMNA 2XZOA 3AVTA 1JJ2B 4YEJA 3Q6QA 2QTLA 1COWA 3ZUGA 3R6KA 4NBSA 2DY1A 2XEXA 4N3GA 2CK3A 4YELA 3V7AA 1W9XA 4GQNA 5THXA 5IYQA 3CCLB 2V7QA 5FO0A 1FRNA 2EIXA 2R6HA 3A8JA 1N0UA 3KEWA 4TMXA 2F4NA 3CCMB 4QFMA 1GVHA 3OJWA 1KK0A 1QFJA 2HLDA 1QGAA 4OOSA 1QH0A 4RDKA 2GK7A 3FPKA 1K73D 3WNCA 1GJRA 3LQEA 5JBQA 4ZGNB 1YHQB 4TMVA 1VF7A 4G1BA 3SJZA 4PC1A 4PC3A 4DNRB 4NNJA 4ZCIA 1WORA 4UAJA 3W2IA 1WSVA 1ZM4A 1U2RA 3CP2A 2KVOA 5IYPA 1EP2B 2JJ2A 4PC7A 3W2GA 2F1LA 3P26A 2GJRA 2D9RA 2JJ1A 1G7SA 5A8AA 2VBTA 3OZVA 3CCJB 1FNBA 3BY1A 1OB2A 1UD3A 2ZL6A 3ASQA 1H85A 1QVFB 1YJ9B 1HZEA 5F4MA 3WYAA 2ZTNA 3T51B 3PUNA 3Q3AA 4LBZA 3ZIAA 1Y0YA 2P3MA 3GQBA 1QFZA 3U6BA 3W2EA 2BVNA 4P26A 4HIZA 3FKSA 2Q6OA 1VQ8B 2OBTA 5HKKA 1XFOA 4RCYA 3SLDA 2BF4A 2DOGA 1Q81D 1WOPA 2OBRA 2XNDA 2BSAA 4Y9UA 5TY0A 1VQLB 2ZXIA 2YWHA 4DK0A 2V7VA 4G6IA 1E3ZA 4RCZA 3PA1A 1FDRA 3G4SB 3WBKA 2XNJA 3BC9A 4BPRA 4P3YA 1HA3A 4Y9RA 1KD1D 2CC2A 4YHBA 3ZPNA 4ZV4A 2V4DA 3CCSB 1WTHD 1JNYA 3CW2A 1UD2A 3CTAA 5IYNA 3PA2A 4B3GA 4M1KA 1UD5A 1UD8A 2BM1A 1VJSA 3A3GA 1E3XA 3QFTA 4B48A 3SJPA 3E1YE 2PLFA 1KTVA 1E62A 4X8IA 1KQSB 4M2LA 2VNJA 3BH4A 3R6JA 4XQFA 1BPLA 2LZJA 3A35A 1ZUNB 1TTTA 3VNUA 2C5BA 3QSYA 1AIPA 1BQEA 1WOSA
chains in the Genus database with same CATH topology
4ROXA 4X7EA 4QV2A 2ZL7A 2OBSA 3BQJA 4P25A 4WZKA 4RM0A 5IYRA 5F4OA 4Z4SA 5HZAA 4QUZA 3ONUA 3SKBA 4X07A 5BSXA 4Z4RA 4X05A 3Q6QA 4P1VA 3R6KA 4WZLA 4QVAA 3ASTA 3V7AA 4OOVA 5IYQA 5F4JA 3BY2A 3ASPA 3PUMA 4OOSA 4X0CA 4RDKA 5J3OA 3LQEA 4WZTA 4OPOA 3D26A 4OOXA 3PVDA 5IYPA 4RDJA 4Z4UA 4WZEA 4OPVA 4Z4WA 3ASRA 3BY1A 3SEJA 5IYWA 4Z4VA 2ZL6A 3ASQA 5E6TA 3Q39A 4X06A 3Q38A 5BSYA 4QVJA 5F4MA 4RLZA 3PUNA 3Q3AA 4P12A 3SLNA 4Z4TA 4OP7A 4P26A 4RPDA 2OBTA 3LQ6A 4Z4YA 3SLDA 3Q6RA 2OBRA 4P3IA 3PA1A 4X7FA 4P2NA 2ZL5A 3ASSA 5HZBA 1IHMA 5IYNA 3PA2A 4X7CA 4RPBA 4OPSA 3SJPA 3RY8A 4RDLA 3R6JA 3ONYA 5J35A 4X7DA 4Z4ZA 5KW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ROX A;  4X7E A;  4QV2 A;  2ZL7 A;  2OBS A;  3BQJ A;  4P25 A;  4WZK A;  4RM0 A;  5IYR A;  5F4O A;  4Z4S A;  5HZA A;  4QUZ A;  3ONU A;  3SKB A;  4X07 A;  5BSX A;  4Z4R A;  4X05 A;  3Q6Q A;  4P1V A;  3R6K A;  4WZL A;  4QVA A;  3AST A;  3V7A A;  4OOV A;  5IYQ A;  5F4J A;  3BY2 A;  3ASP A;  3PUM A;  4OOS A;  4X0C A;  4RDK A;  5J3O A;  3LQE A;  4WZT A;  4OPO A;  3D26 A;  4OOX A;  3PVD A;  5IYP A;  4RDJ A;  4Z4U A;  4WZE A;  4OPV A;  4Z4W A;  3ASR A;  3BY1 A;  3SEJ A;  5IYW A;  4Z4V A;  2ZL6 A;  3ASQ A;  5E6T A;  3Q39 A;  4X06 A;  3Q38 A;  5BSY A;  4QVJ A;  5F4M A;  4RLZ A;  3PUN A;  3Q3A A;  4P12 A;  3SLN A;  4Z4T A;  4OP7 A;  4P26 A;  4RPD A;  2OBT A;  3LQ6 A;  4Z4Y A;  3SLD A;  3Q6R A;  2OBR A;  4P3I A;  3PA1 A;  4X7F A;  4P2N A;  2ZL5 A;  3ASS A;  5HZB A;  1IHM A;  5IYN A;  3PA2 A;  4X7C A;  4RPB A;  4OPS A;  3SJP A;  3RY8 A;  4RDL A;  3R6J A;  3ONY A;  5J35 A;  4X7D A;  4Z4Z A;  5KW9 A; 
#chains in the Genus database with same CATH topology
 4MYT A;  4DQK A;  1FNM A;  4WQM A;  4QV2 A;  2C78 A;  4RD6 A;  2OBS A;  2VNI A;  1Y0R A;  3BQJ A;  2VNH A;  4UZU A;  2CRV A;  3OOC A;  1VQ7 B;  4B44 A;  3CCR B;  4C0S A;  1E1R A;  4XL9 A;  4QUZ A;  3ONU A;  3I1F A;  1QUE A;  2DET A;  3H9N A;  4LC0 A;  2X53 S;  4Y7C A;  4II3 A;  4P1V A;  2OTJ B;  2I1L A;  2F1M A;  1A8P A;  1I18 A;  2DIE A;  1ZM3 A;  2V7U A;  4OOV A;  5FIU A;  2DER A;  3AVX A;  1EP3 B;  1K9M D;  4G5G A;  3A1P A;  2OK8 A;  1IJE A;  4YAF A;  4XON A;  5AN9 A;  3KL9 A;  5DSZ A;  5IK2 A;  1QG0 A;  3ZBT A;  2QEX B;  2Q6K A;  3BY2 A;  3ASP A;  1T6X A;  3ES9 A;  1D1N A;  2VBU A;  4FWT A;  2GJK A;  1VQP B;  2C4T A;  1V0E A;  2X0K A;  3VNV A;  1W34 A;  3CMA B;  2GPJ A;  4WZT A;  2YWG A;  1VLO A;  3B82 A;  2DYI A;  1Q7Y D;  1DAR A;  2BN4 A;  1WP6 A;  2F43 A;  2QDX A;  5DN6 A;  3CCE B;  1KK2 A;  1I7P A;  2WZN A;  2QMU A;  2ZTG A;  3AGP A;  1G7T A;  3ZBU A;  1H42 A;  4Z4U A;  3WQZ A;  4TSF A;  1H8H A;  2VNK A;  4Z4W A;  1NRK A;  5IYW A;  1E43 A;  2EFG A;  5TRD A;  4M53 A;  1S4M A;  2PMD A;  1N06 A;  2D74 A;  4KKU A;  3WXM A;  3Q38 A;  3AVU A;  4RLZ A;  1P4M A;  3E20 A;  1VHO A;  1EFR A;  2BGI A;  2FVG A;  3FPP A;  1JB9 A;  1RQP A;  5KNL A;  1KK3 A;  1SM4 A;  3ISX A;  4OP7 A;  4FXU A;  3LO8 A;  2WSS A;  1ZM9 A;  1W87 A;  4RJL A;  4CQJ A;  3OKX A;  1S72 B;  4FN5 A;  2CF4 A;  2QE7 A;  2QGG A;  2X85 A;  4B4D A;  2ZIT A;  5LMZ A;  1FX0 A;  1DDG A;  3JQP A;  4U9U A;  2ZBV A;  4B47 A;  3CCV B;  1TUI A;  4YAO A;  4F7D A;  1E79 A;  3JQR A;  5H5J A;  2XZL A;  1ELO A;  1BMF A;  3MHP A;  2ZZG A;  4X7F A;  4P2N A;  5TR9 A;  2ZL5 A;  3I56 B;  1IJF A;  1PJ5 A;  3OEE A;  4YAW A;  3ASS A;  2D3N A;  1CQX A;  2J7K A;  1IHM A;  1ZM2 A;  4X7C A;  4KKS A;  1PJ7 A;  1VQM B;  3FJO A;  2ZZQ A;  1Q9S A;  4OPS A;  3AVV A;  3RY8 A;  3ZC3 A;  4UZE A;  5H59 A;  1UD6 A;  4EH1 A;  4RDL A;  1M1K D;  5CDF A;  1EWY A;  2JDI A;  3CRZ A;  4J0Q A;  1N07 A;  2YWF A;  1BX1 A;  2BMW A;  3JQQ A;  3W5V A;  2VJI A;  2V7X A;  4ACA A;  4RD3 A;  4Z4Z A;  4ROX A;  3CPW B;  4RD4 A;  1JA1 A;  3OZW A;  4WWV A;  3V76 A;  1QUF A;  1KC8 D;  2DCU A;  2WPD A;  1PKV A;  1W35 A;  4N3N A;  1PJ6 A;  3A3B A;  4LBV A;  4DK1 A;  3G05 A;  4RM0 A;  5F4O A;  2NPF A;  1OHH A;  3SKB A;  2VJJ A;  4ZGQ B;  4YXW A;  4X07 A;  1W2B B;  4X05 A;  1E64 A;  4G7W A;  1YIT B;  1J9Z A;  3CXC B;  4Q7J B;  4MYU A;  1OB5 A;  4WZL A;  2VYQ A;  3JU4 A;  5KSW B;  4XOP A;  3AST A;  1YIJ B;  3AGQ A;  1K28 D;  4B3X A;  1F60 A;  3AVW A;  4DQL A;  3WBJ A;  1UMK A;  1BJK A;  4AF7 A;  1R5N A;  3CMM A;  4AF6 A;  4R71 A;  4X0C A;  1GR1 A;  5J3O A;  1EFU A;  1V5V A;  2XOK A;  3QFC A;  4XOR A;  2OYN A;  2X6X A;  4AC9 A;  3CP8 A;  1R5B A;  4TN1 A;  1GAQ A;  4IW3 B;  4P6V F;  1T6Z A;  2WJY A;  1WU8 A;  3D26 A;  1YJN B;  2C2W A;  1VHE A;  4G7X A;  4RDJ A;  1MAB A;  3U2Q A;  4P9S A;  5GV8 A;  1E1Q A;  3OZU A;  3P27 A;  4XNF A;  1MRZ A;  4ZCM A;  2WR8 A;  3MMP A;  2OTL B;  4NCN A;  4OPV A;  4K1X A;  1HVX A;  3ASR A;  4Z4V A;  3B78 A;  5DS0 A;  1WPC A;  2QN6 A;  3Q39 A;  4P22 A;  5L46 A;  4XR6 A;  1NDH A;  3GVK A;  4QVJ A;  2ZZF A;  4PC6 A;  1JA0 A;  1YLO A;  3CES A;  5B6I A;  5FNZ A;  1GO2 A;  3T53 B;  1KJZ A;  4P12 A;  3OEH A;  1EFC A;  3ZZT A;  1KK1 A;  3QFS A;  4XLA A;  4E0F A;  2BGJ A;  4RPD A;  1Q86 D;  1NBM A;  1FRQ A;  3LQ6 A;  1D2E A;  4ZCL A;  3Q6R A;  3CC7 B;  2ZXH A;  1VQ6 B;  3GIR A;  4HE6 A;  2RC6 A;  3CC4 B;  1NJI D;  3OPO A;  5FL7 A;  3J81 k;  1FNC A;  1QVG B;  2GJP A;  3G71 B;  3OJX A;  2PE3 A;  3ZZU A;  2OK7 A;  1VQ4 B;  1Q82 D;  3OW2 B;  1QGZ A;  1T5E A;  1V0F A;  4XOT A;  3LNN A;  1I8D A;  2XZP A;  3WY9 A;  5HZB A;  4TKO B;  2BPO A;  5TV2 A;  1G7C A;  4QHY A;  4PAB A;  1WDT A;  2C5H A;  3DDY A;  1SKY B;  4XLE A;  1VLY A;  2QA4 B;  3BNW A;  4G1V A;  1YX2 A;  2M5S A;  1SKQ A;  2Q6L A;  1BX0 A;  1T6Y A;  2B7C A;  2GRE A;  2W6I A;  4RD0 A;  1OB0 A;  4XLC A;  1N8R D;  2DEU A;  1M90 D;  5KW9 A;  3CPX A;  1S0U A;  2BM0 A;  1N0V C;  4M4S A;  2HDN B;  4UZF A;  2ZL7 A;  1QGY A;  2GQF A;  4P25 A;  4Z1M A;  4WZK A;  1CNE A;  5IYR A;  4Z4S A;  1N05 A;  4L8J A;  3HAG A;  5A88 A;  1KMH A;  3NE5 B;  1VQO B;  3OW7 A;  2X3U A;  5BSX A;  4Z4R A;  4YAL A;  2XGJ A;  3CCQ B;  2CND A;  4QVA A;  1RQR A;  2QTZ A;  1IB0 A;  4TMW A;  2BV3 A;  1N08 A;  4XKW A;  5FA6 A;  3W2F A;  2V31 A;  5F4J A;  5FO1 A;  1NB9 A;  3BCF A;  1OGJ A;  3A8K A;  1K8A D;  4LBW A;  3PUM A;  2B7B A;  1WOO A;  1TLL A;  3W5U A;  1R5O A;  2X6W A;  4YAU A;  2WJV A;  1YJW B;  1NB0 A;  2AHO A;  1VQ9 B;  1VQN B;  2C77 A;  3CD6 B;  4ASU A;  1XE1 A;  2E1B A;  4OPO A;  3CCU B;  2D3L A;  3B8H A;  3VO2 A;  2HCJ B;  3QE2 A;  4OOX A;  3PVD A;  4XN0 A;  3W5H A;  3T56 B;  4HE5 A;  2Q6I A;  1GAW A;  4XM3 A;  3CB4 A;  4FK8 A;  3VMF A;  4JMQ A;  4PAA A;  2W6J A;  2ZBU A;  1KZL A;  4WZE A;  3VR6 A;  3GSI A;  4XLF A;  3SEJ A;  1B2R A;  4B43 A;  4LBY A;  3VO1 A;  1E63 A;  4RD2 A;  4TT3 A;  3OAA A;  5E6T A;  4X06 A;  5BSY A;  4ACB A;  1G7R A;  3W2H A;  4PC2 A;  4XD7 A;  2E1R A;  3SLN A;  4B3F X;  4KKT A;  4Z4T A;  3H94 A;  1QFY A;  1OGI A;  3CME B;  4H9G A;  4Z4Y A;  2JIZ A;  3ZZ0 A;  1BLI A;  2NV4 A;  2R9V A;  4P3I A;  4AVZ A;  1W0J A;  3OFN A;  4II2 A;  3QFR A;  4XMY A;  1XB2 A;  2XNC A;  3G6E B;  3OE7 A;  1EP1 B;  4XKV A;  2ZZE A;  1VQK B;  3MCA A;  2HMA A;  2X8K A;  4XN3 A;  4DNT B;  2VBV A;  1H8E A;  3BCD A;  5HXB A;  2V7T A;  3I55 B;  1AMO A;  1B23 P;  4M0L A;  3WNB A;  2WYR A;  4RD1 A;  3U6K A;  2C4U A;  2RC5 A;  1D8T A;  1EFT A;  1EXM A;  2WZP P;  1FND A;  3GVL A;  4RPB A;  5GV7 A;  2GK6 A;  2V7W A;  2VZL A;  2JN9 A;  4P6Y A;  3A8I A;  1F20 A;  3OP1 A;  2B5O A;  2X6Y A;  4PGO A;  4TMT A;  4XLH A;  3ONY A;  1WSR A;  1W0K A;  5J35 A;  1YI2 B;  5A89 A;  2PIA A;  2CW5 A;  3WND A;  3AVY A;  1UD4 A;  1DDI A;  4X7D A;  1TVC A;  2Z6B D;  3GVJ A;  2VBS A;  1DG1 G;  1XQB A;  1KRH A;  1QX4 A;  4X7E A;  3PEN A;  4C43 A;  1CNF A;  3LVB A;  1VQ5 B;  4TMZ A;  2FX3 A;  2YWE A;  2CBX A;  3CC2 B;  5HZA A;  5EMN A;  2XZO A;  3AVT A;  1JJ2 B;  4YEJ A;  3Q6Q A;  2QTL A;  1COW A;  3ZUG A;  3R6K A;  4NBS A;  2DY1 A;  2XEX A;  4N3G A;  2CK3 A;  4YEL A;  3V7A A;  1W9X A;  4GQN A;  5THX A;  5IYQ A;  3CCL B;  2V7Q A;  5FO0 A;  1FRN A;  2EIX A;  2R6H A;  3A8J A;  1N0U A;  3KEW A;  4TMX A;  2F4N A;  3CCM B;  4QFM A;  1GVH A;  3OJW A;  1KK0 A;  1QFJ A;  2HLD A;  1QGA A;  4OOS A;  1QH0 A;  4RDK A;  2GK7 A;  3FPK A;  1K73 D;  3WNC A;  1GJR A;  3LQE A;  5JBQ A;  4ZGN B;  1YHQ B;  4TMV A;  1VF7 A;  4G1B A;  3SJZ A;  4PC1 A;  4PC3 A;  4DNR B;  4NNJ A;  4ZCI A;  1WOR A;  4UAJ A;  3W2I A;  1WSV A;  1ZM4 A;  1U2R A;  3CP2 A;  2KVO A;  5IYP A;  1EP2 B;  2JJ2 A;  4PC7 A;  3W2G A;  2F1L A;  3P26 A;  2GJR A;  2D9R A;  2JJ1 A;  1G7S A;  5A8A A;  2VBT A;  3OZV A;  3CCJ B;  1FNB A;  3BY1 A;  1OB2 A;  1UD3 A;  2ZL6 A;  3ASQ A;  1H85 A;  1QVF B;  1YJ9 B;  1HZE A;  5F4M A;  3WYA A;  2ZTN A;  3T51 B;  3PUN A;  3Q3A A;  4LBZ A;  3ZIA A;  1Y0Y A;  2P3M A;  3GQB A;  1QFZ A;  3U6B A;  3W2E A;  2BVN A;  4P26 A;  4HIZ A;  3FKS A;  2Q6O A;  1VQ8 B;  2OBT A;  5HKK A;  1XFO A;  4RCY A;  3SLD A;  2BF4 A;  2DOG A;  1Q81 D;  1WOP A;  2OBR A;  2XND A;  2BSA A;  4Y9U A;  5TY0 A;  1VQL B;  2ZXI A;  2YWH A;  4DK0 A;  2V7V A;  4G6I A;  1E3Z A;  4RCZ A;  3PA1 A;  1FDR A;  3G4S B;  3WBK A;  2XNJ A;  3BC9 A;  4BPR A;  4P3Y A;  1HA3 A;  4Y9R A;  1KD1 D;  2CC2 A;  4YHB A;  3ZPN A;  4ZV4 A;  2V4D A;  3CCS B;  1WTH D;  1JNY A;  3CW2 A;  1UD2 A;  3CTA A;  5IYN A;  3PA2 A;  4B3G A;  4M1K A;  1UD5 A;  1UD8 A;  2BM1 A;  1VJS A;  3A3G A;  1E3X A;  3QFT A;  4B48 A;  3SJP A;  3E1Y E;  2PLF A;  1KTV A;  1E62 A;  4X8I A;  1KQS B;  4M2L A;  2VNJ A;  3BH4 A;  3R6J A;  4XQF A;  1BPL A;  2LZJ A;  3A35 A;  1ZUN B;  1TTT A;  3VNU A;  2C5B A;  3QSY A;  1AIP A;  1BQE A;  1WOS A; 
#chains in the Genus database with same CATH homology
 4ROX A;  4X7E A;  4QV2 A;  2ZL7 A;  2OBS A;  3BQJ A;  4P25 A;  4WZK A;  4RM0 A;  5IYR A;  5F4O A;  4Z4S A;  5HZA A;  4QUZ A;  3ONU A;  3SKB A;  4X07 A;  5BSX A;  4Z4R A;  4X05 A;  3Q6Q A;  4P1V A;  3R6K A;  4WZL A;  4QVA A;  3AST A;  3V7A A;  4OOV A;  5IYQ A;  5F4J A;  3BY2 A;  3ASP A;  3PUM A;  4OOS A;  4X0C A;  4RDK A;  5J3O A;  3LQE A;  4WZT A;  4OPO A;  3D26 A;  4OOX A;  3PVD A;  5IYP A;  4RDJ A;  4Z4U A;  4WZE A;  4OPV A;  4Z4W A;  3ASR A;  3BY1 A;  3SEJ A;  5IYW A;  4Z4V A;  2ZL6 A;  3ASQ A;  5E6T A;  3Q39 A;  4X06 A;  3Q38 A;  5BSY A;  4QVJ A;  5F4M A;  4RLZ A;  3PUN A;  3Q3A A;  4P12 A;  3SLN A;  4Z4T A;  4OP7 A;  4P26 A;  4RPD A;  2OBT A;  3LQ6 A;  4Z4Y A;  3SLD A;  3Q6R A;  2OBR A;  4P3I A;  3PA1 A;  4X7F A;  4P2N A;  2ZL5 A;  3ASS A;  5HZB A;  1IHM A;  5IYN A;  3PA2 A;  4X7C A;  4RPB A;  4OPS A;  3SJP A;  3RY8 A;  4RDL A;  3R6J A;  3ONY A;  5J35 A;  4X7D A;  4Z4Z A;  5KW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...