2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
4TL8A 2ZJYA 5CLQA 4CGZA 1QZXA 4EFNA 2RAPA 4MYUA 4JSTA 3DOEA 3LVRE 2VQSA 4LHVA 2DFTA 5JLJA 3AF3A 3NVAA 5JBQA 4Q7LA 1G20E 3GLFE 1NLZA 4G1UC 4TYQA 1QRAA 4B48A 3MCAA 5DLQC 1W35A 1VIYA 3MRSA 2P67A 3QF4A 4C9BA 1L4UA 3U3KA 2RH5A 2GJ9A 5IK2D 2YNMA 4YAUA 3AVVA 2QRZA 4ZCIA 1HUQA 3L43A 1FRQA 1P9WA 4JJKA 4KHZA 4Q1FA 5FTJA 5KDLA 2HEIA 4AY2A 3CCJB 5ELXA 4XSGA 5JS7A 2PX3A 3LW7A 1OE0A 3QPVA 1S0UA 5FI1B 5HZKA 2KBFA 4G0NA 2VHCA 2C96A 1A82A 4E22A 5GV8A 1I2DA 3LLMA 3TW4A 3TH5A 1P72A 5FPKA 4TQUS 1CRQA 3U4QA 3ZD6A 2D62A 4QGAA 5FOXA 1NVUQ 2FWRA 3KUDA 5K8TA 2FH5B 4RD6A 1A4RA 1W87A 4LBWA 5TMPA 2RHMA 4Q47A 1N6PA 4DLTA 1WBBA 3PITA 4XOIA 5JJIA 4MITA 1W34A 5LB4A 1WCV1 3FPKA 2I4IA 3CKLA 3QXSA 2F55A 4ZDJA 2VYQA 3RS0A 2HYIC 2OLKA 1DAEA 1G5TA 1QH0A 1J2JA 3G6EB 4NZYA 3FHTA 1GZSA 5KDOA 3BOSA 1UBEA 4ZI3A 3CWQA 1X1RA 2DBYA 4JBXA 5C2JB 4TMZA 1TAGA 3ZVNA 1E2LA 2G6BA 1V43A 4JL8A 5EXPA 2BMDA 1P6XA 5FL7A 5BN5A 4KODA 4C30A 3GPLA 4DJTA 2Q6TA 2H5EA 4BZQA 1VIAA 1WRBA 2REOA 2ZJOA 5JSZA 4R9UC 2DYKA 2V7QA 3CPEA 4IRUB 4KAXA 1Q21A 1T3HA 3TUIC 1P4SA 5DE3A 2AD1A 2H7VA 4N3GA 2QMOA 2QMEA 1DAHA 1GWNA 2IBMA 2QNRA 1YVDA 3QENA 5EXXA 4C2TA 5AUNB 4HDQB 1XNJA 3RS7A 3KQUA 2SHKA 3EZ7A 2GILA 3BBPA 4M53A 1ELOA 2D7DA 1VMAA 4PC6A 4HZUB 1B0UA 1FX0A 3Q85A 1TF5A 4TN1A 1LF0A 1NN5A 1Z28A 1QFJA 4XD7A 3EWAA 2B5OA 1KYIA 1E99A 4DUGD 4TYPA 1H8HD 3W6NA 221PA 4YALA 4MKFA 1RPZA 3OFND 4M1KA 2FOLA 2H1LA 4HB0A 4QBGB 2ZRMA 3QFTA 1E2EA 3PUWA 1E32A 2AXPA 3CF0A 2J0UB 2OFWA 4Q4HA 3DM9B 4LZZA 5AJXA 1YZKA 3R7WB 3VR4A 4IDNA 1R7RA 2J7KA 2OG2A 3ZBUA 1G3QA 1EFCA 1TF7A 2VHJA 2HXSA 1W4AA 1UEJA 1XTIA 2G1KA 5JZVA 1QUEA 1E9SA 1W47A 2CMKA 3BJIC 2WJGA 2FSFA 3ZQ6A 3SHFA 4B3XA 1FP7A 2QE7A 4DIEA 3WY9A 2OCYC 4D6PA 2C78A 3K0CA 1ZUNB 4TMTA 3NG1A 1R4AA 2CEAA 2EYUA 5AJVB 2OK8A 3BGWA 3THYA 1CJMA 3LA6A 3K0CC 4PSAA 4LOAA 1M7HA 3RWMB 721PA 4D81A 3I62A 3AP2A 1FNCA 1XTQA 3GJ8A 2GJSA 1LB1B 4N0EA 3QIAA 4HAUA 3SJBA 4MUBA 4BLQA 4CT5A 4E09A 4LWZA 1M6NA 4TMWA 2E1RA 4H9GA 1EP2B 1KI6B 2QTLA 4FIDA 3AQ4A 5LB2A 3IO3A 1QDEA 6Q21A 4MDEA 1TU4A 1K73D 1L8QA 3GLGB 4PHGA 3MJHA 2W6JD 121PA 1CXZA 4KYIB 4L4UA 2BVNA 1KKMA 4YMVA 1KK0A 2VZLA 1US8B 2OZEA 3F8TA 1E96A 1OB2A 1E9EA 1XTKA 2FF7A 2PCJA 1GTVA 1N5KA 3BB1A 5DN6A 1E2IA 1P75A 4TWZA 2WWGA 5SZJA 3VX4A 4HSEA 3IHLA 3CRQA 2ZRIA 5A5GA 4G5QA 1KDPA 4JLNA 4EUNA 2MMCA 5EP4A 4JMPA 5HE8A 1H65A 2PX0A 1N0WA 1VCIA 2ZE7A 4IDPA 2OUKA 3AUXA 3T1OA 2GJKA 2JLZA 1IONA 5KPDA 2BGJA 2WHXA 1WQ1R 4JLOA 2J0VA 2CHVA 3CRW1 2YC4C 2DWQA 3PQCA 3ZIAD 3A4LA 1MOZA 1OIVA 3A6PC 1N6HA 1KI8A 2RMKA 3VR2A 1D2NA 1A7JA 3R9WA 2GBLC 4BFZA 3ZZTA 1ZM3A 2HCJB 4OHZA 3LXXA 4US2R 1CIPA 1E63A 1MO3A 4Q7MB 1VQ6B 3Q8XB 2VSXA 1T6NA 5CDFE 4UNPA 1ESNA 2IS1A 3P20A 3RANA 8OHMA 2QAGB 1XE1A 3RNLA 1TQ6A 3CRRA 1E79D 3KJIA 4M21A 2F1HA 4AI6A 3V4RA 1MT0A 3RS4A 4OHYA 2GA8A 1K6MA 2ZRJA 4A8JB 1OSNA 1YR6A 5BYJA 2XOKA 1IOZA 4PAMA 5FI0B 4AD8A 3HU3A 3I8SA 4Q7KA 3ZVRA 1SKYE 4UQOA 2WAXA 1D6JA 3A1VA 4QBHA 4B76A 5HE9A 1JB1A 4RZ2A 1KTVA 1XMIA 2QM8A 3GJ5A 1TUEA 2BV3A 4TLCA 4Q9IA 2JDID 5JHGB 1MKYA 4RJLA 1G8GA 2CVFA 5JEEA 3JQRA 4GOJA 2IXGA 4TT3A 3BFVA 3HU1A 3NEYA 2CRVA 1TEXA 3N2EA 2H92A 1XZPA 4ABYA 4GRAA 4H1UA 4XVRA 3SU8A 5F98A 2R2AA 2O0JA 4NCKA 4EH1A 2VNIA 1PLKA 2JJ2D 1AMOA 1E3MA 4TMVA 1X8JA 4LHYA 4B43A 4NYJQ 4YXWA 4O2LA 4Q01A 4NONA 4PSKA 4WVFA 2GTPA 2PEZA 2C98A 2GEUA 3TW8B 2O52A 1XD9A 3G82C 2BMJA 1VQOB 3QKTA 2EU8A 2WJYA 3X1DA 5AR1A 2V54A 4NBSA 4CIDA 4DSUA 1BO6A 4OQFA 4P4SB 2GAAA 2E9SA 5FPHA 4PHFA 2MSEB 4XWOA 3CNOA 1RIFA 1P9NA 2O8DB 3K9HA 1EESA 3LAWA 1HURA 1FUUA 3AVOA 2DCUA 2D74A 2YWHA 2R65A 4FI3C 5CJPA 1KY3A 2OSBA 2IYLD 2WZQA 1OJLA 3HJNA 3IO5A 3TLXA 3U61B 1BMFA 4LC0A 3BC1A 4DEYA 1XJQA 5CLLA 5JHHB 3C15C 2C9YA 2N1BA 2REBA 2ZVQX 5FFMA 1P73A 2C9OA 4BFXA 5M04A 2ANCA 2IYZA 3QFCA 1P62B 1VYUA 2WKQA 4TLAA 2QRNA 1E4VA 4TLEA 5L3QB 4LBVA 1J99A 2OBNA 1RYFA 3CF2A 5JI3E 1DO2A 2BGIA 4LBYA 4M9SA 5FPTA 5GV7A 3TKLA 4C0LA 2FU5C 4URXR 1ZRHA 2FG5A 4FCTA 4BASA 2OO7A 4JLVA 4Y9RA 5JCPA 4PC3A 3UMSA 2R6CA 3FE2A 3WBJA 4MGIR 4AYXA 2R6HA 2V1UA 1KSHA 1E2HA 4JT2A 3U7EB 3CC4B 4CEHB 1OIXA 4HLDA 3RRYA 2IS6A 3HYRA 2H57A 1QG4A 1SVWA 5FBRB 4MDFA 5CYPA 3O47A 2B7BA 3P27A 2J7PA 3NWJA 5P21A 2ZS9A 3AVUA 3JQPA 1OFTA 1AGPA 1UEIA 4BZXA 1JA0A 1U94A 3FMPB 3RAPR 3K9LA 4HB2A 2BOVA 1U8ZA 1Z2AA 1HYQA 2VHTA 1T4GA 2Q0HA 4F93B 3CCMB 1NJGA 2QTVB 2GZDA 1Q3TA 3C5HA 3DKPA 3JZAA 5FL7D 4BFSA 2JJ8A 4OI0A 2VHUA 2ZIAA 2AWNA 1G21E 5GJCA 3ZVLA 1DAKA 3C8UA 4KVAA 1Q1EA 4GBMA 1FRNA 3I56B 5BYKA 4P32A 1E2NA 1TX4B 2YOHA 4RCYA 2ZVPX 5A4JA 2V7QD 4POAA 1VQMB 3UATA 2A5GA 1ZUIA 2ZRLA 3OZXA 2BPOA 4WIAA 3ETLA 2B8WA 3GFOA 4IXMA 3D3QA 3P4YA 1KNXA 2XITA 3HPQA 1JR3A 1G8YA 2NGRA 3I73A 4FK8A 3KXLA 3MWJA 4OK5A 4PZZA 2QA4B 2GF0A 2XZOA 1DE0A 3TUZC 3WBKA 2AL7A 3W5HA 4ZGQB 2XXAB 5A0FA 2GNOA 2EWVA 1P3JA 2ZE6A 3IEVA 2ZS7A 3MWKA 5TB5A 2QT0A 3B6EA 1ZP6A 2HV8A 2WWYA 1QHXA 4L9SA 521PA 3JVVA 4AF7A 3BH0A 1YU9A 4XD7D 5TVKA 1N3BA 3K09A 1H8ED 1ZUHA 3O8BA 4Q1CA 4Q4LA 1FTSA 1E4YA 3T35A 4TLDA 1YZQA 4YMUA 4L9WA 4BE7B 1RRFA 4FINA 1W46A 3D7MA 3K09C 4IEEA 4PO9A 1TQ4A 4KSBA 2VSOA 4ACAA 2GCOB 3NH6A 4LJ5A 4OQMA 1KZ7B 4U02A 5L3VA 4WBSA 2WIAA 4JIMA 2QTZA 2P6UA 1FNMA 2UZ3A 4LHZA 3TR0A 3IIMA 4DLWA 1SVIA 4RZXA 1XEXB 2ZR9A 1Q22A 2A5YB 4QHSA 3MG9A 5DISB 4HZUA 2HYDA 3ZJYA 4JLAA 2E87A 2G0NA 4UXJA 5AJWA 1YRAA 3DDCA 1NRJB 3VFDA 2C95A 1FX0B 3PXGA 1G7SA 4PXAA 3IPYA 4TZ6A 2BIFA 5E3HA 2GXAA 1KO4A 4GFDA 4QGFA 3PUVA 2ZITA 1JI0A 3UG7A 4AK9A 1TNDA 4U7DA 2J0UA 3UK6A 2Q9CA 4GT1A 1Z47A 3R7WA 5BWMA 4QBFA 2ZRBA 3AP1A 4I99A 1E64A 2N46A 4QGGA 3U2QA 2O8CB 4DC9A 5L3SB 3HP1A 4CT4B 3DPUA 4YHBA 4B3BA 2FV8A 5JMTA 2IS4A 2CCKA 4XH9B 2DWOA 1WMSA 1ZC3A 2YYZA 5EZ6B 3B1XA 4DUGA 4QKQA 3U7FB 3THOA 3AKEA 1SKQA 3VNUA 4DWJA 2VF8A 3VX3A 2Q3MA 1UFQA 4LJ8A 4C0JA 3PEUA 4M1OA 3BRWD 1FTNA 5DN6D 4D82A 4Q18A 2QEQA 1W0KA 1N6IA 2B92A 2ZPTX 3LX5A 1O3YA 3L0IB 2BSAA 1W5TA 5BXQC 2PCLA 3MWYW 4V0LA 2ECKA 3I4LA 3H84A 5LD2B 2CLDX 1IXSB 2NO0A 5DYIA 4F7DA 1DOAA 4JT4A 3EC1A 4CYMA 4BGDA 3PIRA 1G1MA 2QSYA 3TRFA 2IYWA 1N0UA 3T61A 1JNYA 1R5NA 3F3YA 2RGXA 3W2EA 3PG5A 4ESHA 3KQLA 2ZRKA 3SE0A 3A1WA 2AHOA 2DWPA 4IOJA 3OZVA 3RS2A 4DBLC 3GJ3A 2BEJA 1US8A 4D4MA 4NDZA 3Q5DA 4LV8B 3CX7A 3E5HA 5FL3A 2OXRA 3A8TA 2Q3HA 1S2MA 3AKYA 3GJ6A 1AS2A 3PVSA 3ZYCA 1E1QA 1G3MA 2ZAOA 3T1TA 1UKEA 4I1VA 2AR7A 4PR0A 1E2QA 2IC5A 3CCLB 2D3WA 5IT5A 1GOTA 1VQNB 1E0JA 5GADl 2BMWA 4HAVA 2OHFA 4LV5B 1PUJA 4Q00A 2R6FA 3LNCA 2D7CA 2ZREA 2B6HA 1XTSA 3FDIA 1GVHA 1PUIA 4C0SA 3RS3A 1KI9A 3R9IA 5JJKA 2XNCA 4A6XA 1G8FA 1QVAA 3SYKA 2YJTD 4DLSA 4PC2A 2I3BA 2XOKD 1EWRA 3A1UA 4YAWA 2ZTSA 1FOEB 3U6KA 1NF3A 2PL3A 3OIUA 3AKDA 1ZVQA 4Q7JB 1I4LD 1LV7A 1TLLA 3CMAB 2LKDA 3IHWA 3EX7C 3E1YE 1GDDA 4K8OA 2HJGA 1A1VA 4R71A 1ZYUA 4MH0R 2R8RA 4TT3D 4PO8A 1YITB 5HZHA 3L82B 3IEUA 2QAGA 3L0SA 1K5DA 1A2BA 1QFYA 1E2PA 1M34E 3QBVA 1QHHB 4EDHA 2VNJA 2D06A 2IYSA 2IWRA 1U90A 5JECA 4A8JA 3TSZA 3VTKA 1S1CA 2QAGC 4EPWA 3EAQA 2AD5A 4MRSA 1G6OA 4YXWD 4B2IA 1J8MF 4UJ5A 2ZJAA 1YHQB 4A8JC 3I3SR 1E1RA 4RZ3A 4Y0VA 4F7WA 4DKXA 4LY6A 1OXXK 4PANA 2TMKA 5AWFC 1N5LA 4V0MA 1QHGA 5H70A 3WP0A 3K70B 1N6KA 3Q72A 4PQYA 2ZRCA 4KJZA 3NDPA 3TQCA 1KAGA 5FUVA 3DKVA 1F48A 5J4YA 2Z5FA 3VNVA 1VKJA 2FPKA 4KVGA 4AWXA 3EZ2A 1E9DA 2OK7A 4A2QA 3KB1A 5EMNA 4TTQA 4V02A 4D4KA 3B82A 4OYHA 2VP5A 4LPSA 1CEEA 1NSFA 1Z0AA 4PPGA 2IF0A 4JLPA 2QP3A 2C77A 5D3MB 1UKZA 4BECA 1Z5ZA 2LCFA 5H68A 1XFAA 4US0R 2PJRA 3ECCA 1HTWA 2JLYA 2G88A 2GJAA 2RGNA 4P4SA 4KSCA 3W90A 2QENA 3TUJC 1TEVA 3DZDA 4M22A 5FBQB 3AKCA 1C9KA 2QMUA 1M2OB 1QBKC 3FJOA 2D2EA 5FOTA 1NY6A 3A36A 3D6TB 4B3FX 5JRJA 3QPUA 2RGNC 1UBGA 1HA3A 2WWFA 2JJ2A 4JZKA 2VPPA 2JLRA 4WZAE 2GQFA 3LD9A 4LRWA 1NLYA 5C4MA 5HR5A 4URUR 4HLUA 3V76A 3U6BA 1SXJB 3CNLA 3VHXA 2ZI3A 4PAQA 1Z6TA 2IYQA 1TL7C 3KFXA 1LVGA 3BH7A 2NMVA 2R6DA 1KMHB 2ZYUX 2IYYA 2J7PD 4RCZA 2BJWA 5C1BA 3ZVMA 4HLUC 3B9QA 1DARA 2IA5A 1E98A 2J1LA 5LDDC 2FEOA 2A7QA 1K8RA 2YWGA 4LUCA 3I92A 3PEWA 4B33A 1H42A 5DSZA 1QVGB 1DVRA 1C4OA 4MRPA 4AYWA 2IHYA 3WP1B 1JECA 3GEIA 2QPAA 4TQAA 2VIIA 1RVDA 4TSFA 2L0XA 4CEHA 2G83A 4ZDWA 3VQTA 2J5XA 1OXUA 1PJRA 4LYFA 2GEVA 2W2TA 4A6PA 2Q21A 2EFCB 2ODBA 3SOPA 1NY5A 1HE8B 4Q9JA 3W3ZB 3LQQA 4LBZA 2IUTA 1QHIA 3RRMA 1PZNA 2BCGY 2F7SA 4Q9KA 4DSNA 3ADKA 4RZUA 2P6RA 3FFAA 3GLHE 2J41A 1YIJB 2GK6A 4BEJA 1JJ7A 1JR3D 3CR8A 2UKDA 3X1ZA 4QM6A 2UZIR 3QFSA 1A8PA 3EIQA 3GCGA 3FFBA 4ZKEA 1XEFA 3GLIE 3T5DA 3SHWA 4AC9A 1FQJA 2NPFA 4D2IA 3R9XA 1CKEA 1CR2A 2WKPA 2J46A 2WPDA 4BRUA 4MGKR 4Q4AB 5KUTA 3IBGA 1W36D 1NJID 2YKGA 1GM5A 1ZNWA 2QAJA 3C41J 5FOWA 1KMQA 1N6LA 1JB9A 5TDHA 1OH7A 3AVWA 1KGDA 1OB5A 1P60A 2ZSEA 3TIFA 5HCIA 2EVWX 1IM2A 1G5RA 1CJKC 3VU9B 4MKHA 1KC8D 4FN5A 1RRGA 3KXIA 2EW1A 3EZFA 1OIWA 2XXAA 4HDCA 1OXVA 2JATA 2ZI5A 421PA 4AKGA 2ZANA 4DLZA 4F92B 3M6AA 1R8QA 3EC2A 5EE3A 3ZBTA 1ZIPA 1KDRA 2FPLA 1IAQA 2IT1A 1XBTA 3ICQB 3OJWA 4K81B 2F1RA 2VTKA 2P6NA 1W36B 2YZ2A 2VNHA 1SVKA 3BFKA 3OZUA 2PH1A 5KSPA 1OFHA 3WRYC 3TAHA 2GCOA 4P3YA 1G8HA 4OKSA 4XTRA 5FTLA 1KJWA 4YAOA 1EX6A 1M1YE 4HAZA 4V0KA 4OI2A 2GZHA 2F9MA 2Z83A 3IPXA 3X1YA 4Q1EA 3CIOA 4HB3A 2J0QA 1XEXA 4K46A 4HE6A 5EUQB 3ZH9B 5F3WB 1XD8A 1DAFA 4O25A 1T0JB 1RRPA 1AJEA 1GRRA 2ORVA 1ZNZA 4P4UA 3TMKA 3W6PA 3LWNA 4D4LA 4KYUA 1TTTA 1Z83A 3IIKA 1Z0DA 4Y7CA 1H8EA 2VRWA 3I8XA 3CMEB 4OQNA 5B2ZA 3OAAD 2QDXA 4UNSA 2CCGA 2CL6X 4FCVA 1DS6A 4LC1A 1Z08A 3UWKA 2RGGA 1A2KC 2P5SA 4KBGA 5G3ZA 3KZ1E 4BLRA 4XWKA 3P26A 3M0EA 3PUXA 1KI4A 2F3TA 1NBMA 1TU3A 2PIAA 1W0KD 4PQFA 1RW4A 4MYHA 1ZD1A 1S4QA 4HEJA 2AK3A 5DI3B 1N2CE 2O8CA 4DLXA 2JGNA 1NMYA 4WA7A 5L3SA 1XXHE 1SULA 1HQCA 1DG3A 1EG7A 2VYFA 3QJYA 1VG8A 1N25A 3U3RA 2X1VA 3UMFA 5JEDA 3LVBA 5HPYB 2XNSA 2ZI6A 4BLOA 2R6AA 1QG2A 1QUFA 1GSIA 1Z29A 2WSMA 5L8VA 4D26A 1XJCA 1U99A 3EZ9A 4WZ6A 4XIGS 2ATVA 2JASA 3U3JA 3GLFB 1GKYA 1R2QA 1E1QD 1OFIA 4GPTA 5DO9A 1AKEA 2B8TA 5J40A 1AKYA 3KB2A 1X1SA 3PV0A 4P6VF 5TARA 3MJRA 2VLIA 1YR8A 2WM9B 2A9KA 4HZIA 5HKKA 5AN9A 4Q9HA 2X3UA 2OLJA 3HWSA 4US1R 4URWR 5FR1A 1Z22A 1W1WA 3HR8A 4ITRC 1Z0IA 1S9HA 1KI1A 3CR7A 5LD2C 2Z43A 2QL6A 1W44A 2HJVA 1GG2A 2NQ2C 5DGXA 3W5JA 1UKVY 3KKMA 2VP0A 4XVQA 1YKSA 2VP4A 4BRWA 1NMZA 3AV0B 3B1WA 4G5GA 3DEFA 1UF9A 1YQTA 1VYTA 2A5DA 4FMBB 2ZQ5A 3QXHA 1VECA 4PAOA 4X8OA 2VHQA 4LJYA 1JQJC 2C03A 1AM4D 4BWYA 4DB2A 3TK1A 4DCNA 4YMWA 1YJWB 4C0AC 3H4MA 5EXTA 4ILEA 4GOXA 1E2MA 3KJHA 4DCTA 2IEYA 1SVOA 1IJFA 4DSTA 3KQNA 3W34A 3K9NA 1YZNA 1HY3A 2JCSA 4EPVA 4QHTA 3PEYA 4B3DA 3RHFA 3W6OA 3ASYA 1M90D 1CR0A 2H17A 1XB2A 4HI0E 4MRVA 5TXGA 4DLRA 5L3RA 5SZHB 4IDOA 1GP2A 1YJNB 1FNNA 2BEKA 3WYAA 1XTJA 3K0SA 1QHYA 3TAUA 4Q1BA 3VO2A 3UXMA 3B13B 4C0HA 3T1VA 1E1RD 1II8B 3LXRA 4EPXA 3A4MA 5CB6A 4A36A 3A1TA 5JWRA 1HE1C 1CQXA 1IY0A 5TR9A 2V4ZA 1D8TA 4J0QA 1AQYA 4TTPA 1AS3A 3MLEA 4B2LA 4URVR 4DZZA 2F43B 3AVXA 5GVSA 3QFRA 1T9HA 2WSSA 2ZAMA 3AF2A 1ZBDA 4ON9A 5G53C 1BJKA 1QHHA 1L7VC 1OT3A 4PX9A 1NG9A 1OF1A 1NVXQ 4DSOA 1W7AA 1GNRA 4HE5A 4NE2A 1IY1A 4OQLA 1K9MD 3SQWA 1GIAA 2ONKA 2ZUBA 4WQMA 2UVQA 1G3IA 1R6BX 2FFQA 4HDOB 2YOFA 1Q57A 1IJEA 1DAIA 1VQPB 1AN0A 1OGIA 1KQSB 1GAWA 4RFSB 1NN3A 3S1AA 3J81k 2OBMA 3SR0A 4L5BA 2VH5R 2G9NA 4JLBA 2K5UA 3SNHA 2IX3A 1LNZA 5FUWA 1UMKA 2ZYVX 2FGJA 1GUAA 1NVVR 2QMHA 4V03A 3M4YA 1BYUA 3FMOB 1N6OA 3V00A 5KU1A 1DAGA 2GJ8A 5BN4A 2QBYB 3QVUA 2R6GA 2OFOA 4X8HA 2GZAA 1RFLA 3B9PA 5KOYA 4BQSA 1JEDA 2OCBA 1YR7A 1I4TD 3FTQA 1AA9A 3SYNA 1YI2B 4Q66C 1Z0JA 1TMKA 5B64A 4PHHA 2P3SA 1MO6A 4Q19A 3SBEA 1L4YA 1GL7A 4HUTA 3ES9A 1XMJA 2WAYA 5D3MA 4AG6A 3B2EA 1M74A 4IFBA 2ZRAA 3B1YA 4Z51A 4UNQA 4MUAA 3WYGA 3EPJA 4M1WA 3OESA 1WXQA 3F0TA 2NOAA 2X19A 4RD1A 2CE7A 2ZI9A 5LBIA 2PLRA 2AKYA 2ASEA 2PLFA 2GESA 3CCUB 4DDUA 1KNQA 1MO5A 1UADA 1ZAKA 3MGCA 1E0KA 2YV5A 2ZRDA 4R98A 4S35A 3N70A 4C0BA 4CRWB 5FH9A 4LHWA 3K1JA 3K53A 3BB4A 1W0JA 4TSFD 2AN9A 4I1UA 5F2EA 1JAHA 2CE2X 1KJZA 1D9ZA 4OK6A 4QFMA 1R0ZA 1SXJA 2ZUCA 4RVCA 3U60B 3CONA 1MRNA 3HU2A 5JS8A 1KMHA 1G7CA 5IHPA 1U0LA 1NIPA 3KTAB 1X8KA 1BOFA 4KCGA 3QUSA 1W48A 3UKDA 4C3ZA 4JLJA 1SXJC 4S2EA 4NYMQ 4II7A 1OH6A 5FA6A 3SFZA 5FUXA 4BPBA 4B6EA 3BORA 4KV9A 5FTNA 3LO8A 4P31A 1U0HC 1T5LA 1VQ5B 4XSHA 3CCEB 5AUPB 4JVLA 5KDDA 3VKGA 1JEEA 1UBCA 2WPDD 2AK2A 4ZIRA 5JJLA 2FNAA 4WOPA 5H1YA 2ZE5A 3I5XA 1G41A 2GXQA 5LPNA 4NYIQ 3EPLA 2D4HA 2VO1A 4JYCA 2FN4A 5JRZA 2OE2A 3W2IA 2QQEA 1R0XA 3VKHA 4CF7A 4C2UA 2GXSA 3RC3A 4DEXA 2F1IA 3AP3A 5IF9A 5JFGA 4IEIA 4QBIA 3B1VA 2ZI7A 2WWWA 4IOKA 1XZQA 1B2RA 4LSGA 1IN5A 4Q4AA 3QXCA 1GFIA 4W5JA 5BN3A 2ODNA 3SC3A 4AKEA 1CR4A 3VO1A 4Z1MA 4EJSB 1G18A 4B74A 1FUKA 2JIZA 2VP9A 5CYOA 1COWA 2HLDA 3THWB 3X2SA 1IHUA 1WF3A 1MR3F 1QF9A 1X86B 2PT7A 3OE7D 4PQRA 4PTLA 2DEUA 3OIVA 4L15A 2ZXUA 3SJCA 5GJVC 3A58B 3EASA 4C0KA 3VU9A 4XTCS 2RCNA 4A0FA 1RYHA 3KJGA 4YDSA 3LLUA 3GJ0A 2CLSA 1Q86D 2OXCA 1SKYB 2CJWB 5SZIA 1KRHA 1ZNYA 1H85A 3KXKA 3WNDA 1KIMA 2CXXA 2QUZA 4LJ9A 4B3CA 1GJRA 1XD2B 5KNBA 1FL9A 2G1JA 1T91A 3MFYA 5CM9C 4WXPA 3WNBA 2DY1A 2BMEA 2FE4A 3JVUA 3WXMA 3P32A 1BYIA 4ZGNB 4DDVA 3CX6A 3Q7PA 2QY9A 2ORIA 5CK5A 1J9ZA 1R5BA 1CULC 1TPZA 1ZC4A 2ODWA 2W2XA 2YVUA 1F2TB 2ERXA 1Q12A 1XX6A 3W5UA 2ZU6A 4M1TA 4MQBA 4M9XA 1NBMD 1VCOA 3ZS9A 1E2GA 1R0WA 3FOZA 5HCNA 1JALA 4OQXA 1E62A 2WTUA 1FNBA 2O5VA 3R20A 1BIFA 1VYVA 2JLWA 4IDHA 1KI3A 2ZEJA 4C0QC 3GJXC 3ZZUA 2XEXA 3HDTA 4KFRA 4BFWA 3O8DA 2O8BB 1DBSA 1FFHA 2WBLC 3HYTA 2NZ8A 5EXSA 3ZLJA 3LH5A 1NDHA 1TF2A 2CHQA 3FPAA 3K0FB 2ZM5A 4LYJA 3L8YA 1B23P 2C5LA 5ANRB 1G64A 2QI9C 4DCUA 1MRSA 5CK4A 4B71A 3FWYA 2IYXA 4URZR 2JAQA 4QNMA 5DI3A 2RKOA 4I1OA 1GRQA 3U3MA 4AURA 2VF7A 4CW7A 2JLQA 3E70C 1E9CA 3B78A 2QP9X 5HKKD 2IW3A 4DQLA 4DT1B 3TVTA 1EFRD 5KSWB 2BJVA 3KKOA 4U9UA 3PR1A 4JS0A 1UBFA 1E2DA 4YC7A 4Q1AA 2F1JA 3OAAA 3P4XA 3AVTA 3QF7A 1RC8A 1W36C 2IF2A 3GLFA 3AGQA 4F38A 1FMJA 5KPJA 2X2EA 2XGJA 3E20A 3R8CA 3BERA 2R62A 4KFTA 4ERNA 2ZROA 4LJ6A 4NMMA 3TE6A 5CITA 3BK7A 5B30A 2ATXA 4Z8XA 2PT5A 4MYCA 1IXRC 3I32A 1KK1A 4NCNA 1UKYA 2IHBA 3IBYA 3X1XA 3GFPA 1Z63A 1EP3B 1XRJA 4M0LA 3MMPA 2ZRPA 3T5GA 2QZ4A 1LFDB 3K8YA 3KX2A 1UDXA 1FDRA 3IUYA 3JZMA 5FBVB 1QG0A 5JCZA 3EZ6A 3QQ5A 4NKRA 3RRZA 2ZJ2A 2ZR0A 3VMFA 2MSDB 2OILA 1F60A 4IXNA 5AJZA 4O3MA 2J0SA 5J47A 2AFHE 1Z6XA 2OCAA 4D0NA 2GPJA 2PMKA 2WSSD 2O8EB 3BWDD 1YRBA 3NXSA 3KKNA 2J59A 3CW2A 4M9QA 4MA4A 4CDGA 1P7CA 1CF4A 4JL5A 2DPXA 4DVGA 2A5JA 1CNEA 2X77A 3DZ8A 4OHXA 1G7RA 1U81A 3T15A 1YHNA 4AG5A 3AH8A 3SN6A 4PPNA 2WJHA 2P0EA 3C7KA 4JVNA 1II8A 1LTQA 4MGYR 4PPQA 3NHAA 3AM1A 3KDSE 3T1QA 5FOUA 3QNUA 2F43A 5FOVA 1TQDA 3KL4A 2BMFA 3AF4A 1FP6A 3H86A 4JVMA 3K70D 2HUPA 4EPTA 1Z6YA 4MGZR 1JXMA 1P2UA 2KE5A 1YZTA 2A78A 1BX0A 1YZLA 2OBLA 4JJZA 4RSGA 2KWIA 5GVRA 3E2IA 3VKWA 1DPFA 2IWHA 4A0GA 3CLVA 4B73A 3ICEA 1XF9A 4QM7A 1E9RA 1GO2A 1Z3IX 4EPRA 5J4HA 4A9AA 4RFSA 3CXCB 2AX4A 4BZPA 4GMDA 3THXB 3GD7A 4JVSB 4GP6A 3S1AB 3TVDA 3IKJA 4AKIA 1HT2E 1EWQA 4ESVA 1J90A 1L2TA 4QC2A 1LY1A 1NIJA 2FJUA 1BX1A 1JBKA 1NKTA 1NLFA 3RWOA 1MH1A 3SJZA 4JLMA 4I1SA 3PJRA 4PC7A 5AK0A 4TZ0A 2D2FA 4URYR 2W0SA 1ZM2A 4Z8YA 3W9YA 2QBYA 2GVZC 2QGZA 1G5PA 1G19A 1GITA 4UXHA 2PEYA 3CCSB 1KDOA 1UAAA 1KK3A 1CP2A 3OHMA 3CNNA 1R10A 4JBYA 3U7GA 1W0JD 1ZD9A 4ARZB 3SEAA 3AVQA 1SXJD 2VA8A 3KJEA 1JAIA 2KJQA 4RD4A 2IYRA 4ZCLA 2QPTA 2RC6A 1T3SA 1IN7A 2HF8A 1NKSA 3IQXA 3IDQA 2IS2A 3TJZA 1XDBA 5FR2A 1GL6A 4CEIB 4OBEA 5E7JA 2P5TB 4E5UA 1LF5A 1PLJA 2DFLA 2AWOA 1RJ9A 4MKIA 1EXMA 1XPRA 4NYJR 5EE9A 3ND8A 2FDCA 2QTFA 3IILA 5UKDA 4O0MA 3QBTA 1JPJA 1VG9B 2OAQ1 4DDWA 1VCNA 4LI0A 2A3RA 2VP2A 1U0JA 5H5JA 3L0OA 2F3RA 1U8YA 3CWZA 4RD2A 1JQLB 3UIEA 5EP3A 5CIQA 4JYBA 4JKIA 3KTAA 1KHTA 2ANBA 3B1ZA 2IYVA 3JQQA 3W2FA 3G4SB 3OW2B 2CNDA 1DO0A 1WE2A 1G8PA 2OFXA 4M1MA 5EP2A 4PZYA 3FGNA 1GNPA 2ORWA 2QQ0A 3DMDA 4FMDF 4HB4A 4RFVA 4B2PA 3RC8A 4HAXA 1N5JA 4HATA 1KI2A 4PC1A 2RGBA 3ONWA 2EWWA 5CM8B 3X1WA 2OAP1 3CRZA 4KI0A 2OEPA 3GP8A 5CIWA 4GL2A 2Q9BA 1JR6A 1DDGA 1VPLA 3REFA 4Q4JA 1NP6A 1LS6A 4AKHA 3AEZA 1OKKA 2W2VA 4OHVA 5EZ5A 4PPFA 1Q1QA 4Z1MD 3WYFA 4ZIRB 4NYMR 1HEIA 3I1FA 2JIZD 3QKRA 1COWD 2HLDD 2MSCB 2QGNA 1KSJA 1CJVC 3SYLA 2GKSA 4IOLA 1S1MA 4LHXA 3B60A 4TTRA 5DNYB 3G71B 2J45A 1OGJA 3RABA 5KTYA 2ZRNA 1AZTA 2ZR7A 3GMTA 3K9GA 4OI1A 2FSHA 4B34A 2HT1A 1YZGA 4OJKA 1TQ2A 2KBEA 2RC5A 4DRZA 3EPKA 1RZ3A 3BIFA 3QE2A 2GXUA 3SFVA 1TVCA 3LBHA 2QPOA 4FMDB 1SM4A 4P33A 4RY2A 3VHLB 4UKDA 5EE1A 4KO8A 4GI7A 1CR1A 4NYIR 2CVHA 4FW9A 4U00A 5FPYA 4E07A 2W58A 4WW0A 2ONJA 5CDFA 1QGAA 4F4CA 3AGPA 4EJSA 4ZDKA 1U9IA 1S3GA 1KSGA 4HUQB 5AUQA 3CCQB 3THWA 5TY0A 1KJYA 3ZC3A 2V9PA 1KI7A 3K0EA 4G3XA 1Q7YD 4OHWA 1NJFA 3W8NA 2IK8A 3DVLA 3W5IA 4Y0AA 4P0TA 2NO7A 3BXZA 4EJSC 1U9IC 4PSVA 4B44A 3GLGE 2ZE8A 2WWIA 4C4PA 3WMFA 2DETA 2CJWA 1AQUA 1M8PA 1GVNB 2B7CA 1QVFB 4GP7A 3VAAA 1XD2A 4KXFB 2WJIA 4JSYA 3NC0C 2FFAA 4ZKDA 1K8AD 3TBKA 4UNNA 3PUZA 2JLSA 4NU0A 1N8RD 3LY5A 1XJ0A 2YWFA 1OXTA 1KO8A 4Q5IA 4Q9LA 2PZEA 2RB4A 2GF9A 4EKDA 3CCVB 2BBWA 1AS0A 1Q20A 4MKGA 5CJ2A 3CZPA 2CHGA 3OE7A 3Q7QA 1PLLA 1F2TA 5EQTA 4AF6A 4Q1DA 3RSLA 1CJUC 3N5CA 2HCBA 2XJ4A 2QT1A 1W2HA 2FGKA 4BFTA 2NO1A 1CBUA 3PENA 1R5OA 5H59A 1P2TA 1ZU5A 2X2FA 4IVRA 2QP4A 4DQKA 3WHKA 2PBRA 4V0OA 4Q03A 3REGA 3PFIA 1G16A 1IN6A 1C1YA 2V8OA 4LGMA 2WVJA 1SVLA 3WRXC 3U5ZB 3ADCA 3AVYA 3ZGXA 4LJ7A 1IY2A 1F2UB 3NC1C 4IKEA 3QVVA 2O8BA 3OEEA 2OESA 3KQKA 1FQKA 2OTLB 3K0FA 4BFUA 1K5GA 1AK2A 5FBWB 3RLFA 3LX8A 3W2HA 1XPUA 2VBCA 1BQEA 3UPUA 4WZBE 3SBDA 4G5OA 2XSZA 3L8ZA 4B3GA 4WAUA 4LCBA 2VEDA 3BE4A 4L8GA 1EFHA 4FCWA 2QEXB 2Z6VA 1E9FA 4QRHA 1R8SA 3DL0A 1OHHA 2WOJA 3OIWA 1NVWQ 1YR9A 1I2MA 2WV9A 3NEJA 3SDZA 4DT1A 4Q48A 2PZGA 2I1VB 2W83A 1CU1A 4V0ME 5AJYA 1G4AE 4QXAA 2GDJA 4GDFA 1P9RA 4EPYA 2AXNA 3OZWA 1E2FA 1XCGB 3FB4A 5FOSA 2XAUA 2BBSA 4YMTA 2J9RA 5E7IA 1Y3AA 1XCPA 4ASUA 2O8FA 3AF1A 1NN0A 2IXFA 2ZJ8A 4F4JA 2XZPA 2AKAB 2RGCA 4IJMA 4TMKA 2Z0MA 4B75A 2ZS8A 2PJZA 1M7BA 2EQBA 4NL4H 4OL0A 1T3LA 3LBNA 4HAWA 3ZQJA 1FW6A 1E9BA 1Z8FA 2GRJA 2CNWD 2KSQA 5F9FA 1IXZA 2QU8A 1E69A 4H1VA 2JLVA 4C7OB 5KO2A 3V9PA 5B58C 1CNFA 1GKUB 3GLHB 2ZSDA 4CEJB 1EFRA 1OW3B 3DMNA 4KBFA 1W4CA 1DEKA 2F6RA 3CRVA 3D31A 4LX0A 2Q9AA 5HXBA 3CZQA 2ZETA 1UJ2A 3CPWB 1ANKA 2XNDA 2GEDA 3B8HA 1X8LA 2GCNA 2YOGA 3GLIB 3ZZ0A 5K8IA 3CH5A 3ADBA 4LK2A 2FZ4A 1Q44A 3NBXX 1ONBA 2XB2A 1IB0A 2FFHA 1BS1A 1T0HB 1ZNXA 4YONB 2O8EA 3EA0A 5G41A 4G5RA 4F4IA 1Z0KA 3LFUA 3LW8A 1VTKA 3SS8A 4X8LA 4N3NA 5JI2E 1NN1A 3EIEA 1SVMA 3UWOA 2HDNB 1EWYA 4R2HA 3K0AB 4AIIA 2NO6A 3A4NA 2BBTA 3QE0A 5JWOA 4JBWA 3MWLA 2N42A 1ZW6A 2YWEA 1G7TA 3W5VA 5D3QA 2JLUA 3FMFA 4W9MC 1VQLB 3C16C 2V55B 3EG5A 5C18A 3O8CA 3RDPA 1N6NA 1ZCBA 2IXEA 3CD6B 2V6IA 4YLGA 2FSIA 1SQ5A 2W6IA 1ETUA 2QG6A 4M4SA 2BF4A 4FD2A 5FTMA 2NZJA 3AVPA 2FFBA 5DHAA 4ACBA 1XPOA 4LYHA 2IYTA 2C99A 3CC2B 2OT3B 1KAOA 1W2GA 4R7ZA 3CPJB 821PA 1ODFA 3VR6A 3Q3JB 2GBLA 1VCMA 4PO1A 5EP1A 3KKPA 1MABB 2Z4SA 3AF0A 2ZRFA 1X6VA 3QOFA 4ZI2A 1RKBA 4IVPA 621PA 4BLTA 1ZD8A 3THXA 2WJVA 5H8WA 1T8UA 2FPMA 2ZJBA 1Z6GA 2XTMA 1N5IA 4NH0A 2WKRA 1JA1A 5EJEA 3UANA 4V0NA 3HPRA 3QKSA 2BWJA 2AFIE 4XVUA 5EUMA 1G4UR 5FUYA 4PZLA 1ESMA 2BKEA 1WA5A 1MV5A 1P61B 1F20A 2NPIA 1JXOA 1OPXA 4D25A 1II0A 1WDTA 2QORA 4HLQB 4A1FA 2PMDA 3RSOA 5J4VA 2G0TA 1TUIA 2ZU0C 2ZYTX 2IUUA 2W0MA 4ARZA 1EFUA 2C8VA 1E0AA 2CBZA 5EE0A 1OYWA 1KD1D 2YHSA 3MUFA 3CF6R 3U44B 2XTNA 3NBZC 3BFXA 1BKDR 4PGOA 2XX3A 3EA5A 1G9XA 2R9VA 4DHEA 1XXHB 5IRCD 4XJXA 1S96A 4MRRA 1VQ7B 3NBYC 1DG1G 4CEIA 3EXAA 1N6RA 3CCRB 2GETA 2EFGA 1U2RA 4IVQA 2DHRA 5C46F 1Z06A 1ZM9A 2FMXA 1RJ9B 3NTUA 5L3QA 4YQFA 1YZUA 4QJ5A 3BD9A 5CB8A 5KSYA 3KUCA 2DERA 1CJTC 1T5IA 5K8LA 3R8FA 5FTKA 3RVBA 3BB3A 4FMCF 2DR3A 3PEVA 1ZMXA 3HR7A 5DHFA 1UDWA 4RD3A 3DO6A 3T12A 3CH4B 3UG6A 3CUEF 1QHNA 2CK3A 1W2BB 3A1SA 5EE5B 1OKKD 1NG1A 4A4DA 3FHCB 4D4JA 2C2HA 2WMOB 4LDJA 5BW8A 4DLYA 1XP8A 4M9ZA 1OYYA 1WBDA 3U3OA 1KO5A 1F5NA 3Q9LA 4QGHA 2GHIA 4Z54A 4BLSA 1Q1ZA 4A15A 2ZRHA 3I72A 2QTHA 4TL7A 1QFZA 4K1XA 5KSOA 4PHTA 1SHZA 3O8RA 4A2PA 1NL3A 1UM8A 3FKSA 5DI9A 1VQKB 1NI3A 3GEHA 4M8NE 1S3SA 1O87A 4B32A 1OH8A 1VHLA 3TGPA 2FEMA 4IFEA 4M1YA 4HYYA 1NBME 2QA5A 4DXAA 2JJ1A 3TNFA 4ZO4A 4Q4JB 4A0HA 1U98A 2FX3A 4EQ6B 3KFVA 1D2EA 2QROA 4FMCB 2H8KA 2EFEB 1QGZA 3OEHA 3L2OB 1LS1A 1YJ9B 3QKRB 4I81A 1YJ5A 3EARA 4MRNA 4JKYA 3CX8A 4TQ9A 4D0GA 4DB4A 1WB9A 4OI4A 4ZPXA 4TYWA 3W2GA 1JJ2B 1Q3HA 4RD0A 3I61A 1FNDA 3LV8A 1ZINA 3CC7B 2BKUA 4KFSA 2XNJA 1J8YF 1Q81D 3IGFA 4WXRA 3EPHA 4P4TA 1WP9A 1E6CA 1KZGB 1TADA 3QF4B 2GAOA 2ZSAA 2A5FA 3NBFA 3PUYA 4BFYA 1AZSC 2MMGA 2BCJQ 2NG1A 3QXXA 4HUQA 3QG5A 5GJWC 5E7MA 3GJ7A 1PVOA 1XTRA 3MD0A 2BHRA 4A92A 2XB4A 1DDIA 3EIHA 4DLUA 5B57C 2DFNA 4B4DA 1XMVA 1FMLA 1SGWA 2ZJ5A 3TSOA 4M1SA 1CRPA 4HAYA 2O0HA 1GRNA 1CLUA 4NPHA 1JJVA 3BH6A 4NTZA 4TYYA 1HH4A 3LVQE 2V6JA 3U4QB 1XCMA 4D0LB 4GMXA 4QNRA 3Q5EA 3W8RA 4IDQA 5JWHA 4X8MA 1AIPA 3AB3A 5FBLB 4QL3A 2G3YA 4EAQA 1KSFX 2LWIA 1XMSA 3LQRA 5IK2A 1I7PA 5KNCA 2FA9A 3PCRB 2FSGA 3CRMA 4YDHB 1RE0A 2A30A 3V4FA 1G6HA 3WMGA 4D80A 1IQPA 3OEED 3B7GA 4A0RA 1M1KD 1F3OA 3I5YA 1DTSA 3QEOA 3QPWA 1QGYA 3ASZA 2CCJA 1E9AA 2XSZD 2ODEA 3C14C 5KYKA 4F91B 4NHOA 3CBQA 2XTZA 2EFHB 4KLNA 1R0YA 2F9LA 3GQBA 4KITB 1S8FA 3BS4A 4QJ3A 1OHHD 2PZFA 1ZM4A 4FWTA 3VR3A 3BAFA 5J4LA 3B85A 1S72B 4TLBA 1QHSA 4JLDA 2J87A 1G3UA 3FKQA 1F2UA 2RHDA 4O2RA 1HV8A 4TMXA 2R44A 3W3AA 3LO5A 1CTQA 2EIXA 4XWAA 4B6FA 1Z2CA 5AUOB 3LRPA 4U5XA 5JSZB 3GJ4A 3FMIA 1GR1A 1NSTA 1ZU4A 4QJ4A 2BM1A 3RYTC 4ASUD 5F9HA 5G3YA 1VQ9B 1P2SA 4TL9A 4EFMA 3OJXA 4N0DA 5DIFA 1CS4C 4R2IA 4KU4A 4BUJA 3RRNA 3NDBB 2VNKA 1Y63A 4OK3A 4IOMA 4EFLA 3T06B 2BM0A 2BDTA 4G01B 4AYTA 1ZJ6A 1GL9B 1S9DA 2CL7X 1W49A 4FWIB 4W7SA 4Y9UA 2ZSBA 4G1VA 3WNCA 3SQXA 2C9CA 5DH9A 3L0PA 4YAFA 1X3SA 3QKUA 2QE7D 2REXB 2G77B 3VR1A 1KOFA 3DM5A 3FHOA 3QXJA 1SHKA 2I1QA 3G5UA 1PV4A 4NCHA 2ERYA 3LDAA 1EX7A 1J70A 4NCIA 3P1JA 3KQHA 4QG7A 3MAAC 2XNDD 1A5TA 2O8FB 4KLZA 3NIBA 3CB4A 4IHQA 4Q4HB 2NTYC 1VG1A 1Z0FA 2P2LA 2RGDA 5DYGA 4LYAA 3WHLA 1QVRA 2KB0A 2WJJA 5KNDA 1VQ4B 3ND9A 4LJ4A 4CVNA 2JLXA 1KO1A 2GCPA 3G0HA 2IYUA 1E2KA 1Z07A 4C7OA 1UPTA 4BLPA 2GK7A 3TQFA 3GLHA 4GOKA 2QSZA 2V3CC 2WIBA 1DADA 3ZDQA 3QSYA 1GKIA 1VDZA 1II9A 4CEJA 1H8HA 2JEOA 2J3EA 2X8AA 1GAJA 1EFTA 3OFNA 1XEWY 2RGAA 3NHBA 2ZJZA 3GLIA 1GAQA 3THYB 3D8BA 2OCPA 2OM2A 2Y8EA 3MHPA 1NNEA 1E94E 2NO9A 1SXJE 3EW9A 2O0KA 2W6ID 2OTJB 5G40A 3CM0A 1RRCA 3EWSA 2CNWA 3M1IA 4Q02A 3CO5A 1KI6A 2ZRGA 3MSXA 4JLKA 1D1NA 4M2LA 1ZIOA 4DCSA 3A37A 3K0AA 4G5SA 2FZLA 1KDTA 2XJ9A 1YE8A 1KK2A 1DAMA 4W5WA 3GLGA 1N0VC 2A2ZA 5FPSA 4B47A 4C43A 1D5CA 1GILA 1ZCAA 1OV4A 2W00A 3QG1A 4DDTA 3C5CA 1HT1E 2H18A 3FVQA 2GVDC 4DCVA 4G1BA 2XZLA 3H0KA 3AUYA 4W5HA 2Z4RA 1KY2A 5IDVA 4UXIA 1F6BA 4FXPA 1P2VA 5E95A 1G17A 2IUSA 3ZD7A 3TR5A 3IIJA 1Z6AA 5E4FA 2EFDB 5HTKA 4TL6A 1VG0B 4OJQA 3UMRA 4IW3B 3K70C 1EK0A 1MABA 1OLOA 2EYQA 2W6JA 3IQWA 2B21A 1SVSA 1G3RA 4TYNA 2C04A 1XU4A 5SZKB 1KO7A 3DHWC 5TV2A 1DELA 3KKQA 4LV6A 2BN4A 1GNQA 1LW7A 1VQ8B 3H1TA 3QI2A 4QHYA 1SZPA 4QOSA 5C4GB 1G291 3I55B 3NKVA 3GEEA 5J5CA 3C4JA 4KFUA 3LBIA 3ZS8A 1Q82D 4N1AA 5THXA 1W5SA 3WMEA 3OF5A 1MO4A 2HF9A 3QKSB 1OXSC 4BFVA 1EGAA 1JPNA 1NVVQ 4RKFA 2VSFA 1QX4A 3FYHA 4UJ3A 1HQYE 2HXYA 4BPRA 1NMXA 2BC9A 2JA1A 4BEBA 3QY0A 2VL7A 3ZIAA 1JR3E 2YC2C 1OFUX 1FPMA 3U44A 1J7KA 2CK3D 3QEJA 4A82A 3B5JA 4CZ2A 4DLVA 4B35A 4UNRA 1VHTA 1XXHA 2QN6A 1D9XA 2CLCX 2ZSFA 4GNKA 3SJAA 1M7GA 2LKCA 1Q1BA 1W4RA 2CL0X 4ZCMA 3H2YA 1BH2A 2ZI4A 2BBOA 3CPHA 1XEWX 2HT6A 1V5WA 5J4KA 1E79A 4DIDA 1IBRA 3VR5A 4RKEA 3TSWA 5KHOC 2P65A 4GZMA 3FKSD 2H16A 4NCJA 3N2IA 1XWIA 2QM7A 2DFKB 2VP6A 4I4LA 2GWHA 4EIWA 1EP1B 2KI5A 4ZDIA 1BMFD 1I4DD 4GSYA 2OV2A 2JJ1D 3ADDA 2V1XA 1W4BA 1OH5A 2IEZA 2WMNB 2WWHA 4E03A 5KSZA 4ZV4A 4A2WA 2WICA 1AGRA 4UAJA 3OEHD 2JDIA 2CDNA 4Q21A 5BQ5A 1FZQA 4HLCA 3F5FA 3DOFA 2WWXA 4MYTA 4LJAA 2ZYWX 4L16A 4PFSA 4NP6A 2O8DA 4GZLA 1Q0UA 3SZRA 1IN8A 2YINC 2RGEA 4YMSA 3E1SA 4JL6A 3RS5A 1P5ZB 3OIYA 3U7HB 1E2JA 3GFTA 2IL1A 3T34A 2DB3A 4EQ6A 2NIPA 1D2MA 1ZM7A 2Q3FA 5GJBA 3NH9A 2WOOA 1T8TA 1IN4A 2HMAA 2ZUDA 3SI7A 5K8UA 4LPKA 1U8AA 1E0SA 1KKLA
chains in the Genus database with same CATH superfamily
1U3DA 4AZ3A 4TL8A 1PE0A 4IQFA 1XG5A 3BWCA 3DE5X 3WLPA 4Z4FA 1PEAA 1DKMA 5LQDA 3LVRE 4O4HA 4KKTA 4CNQA 1DEXA 3RYFA 2GFHA 2HK8A 3C3YA 1YRYE 2IPAB 3M4ZA 3VBEA 5JLJA 3NVAA 5JBQA 4Q7LA 5ILOA 1T36A 4G25A 3KVVA 5BSRA 2FXIA 3GLFE 4Z3OA 5DLQC 4HXFB 4P3PA 1MAVA 1USKA 2DE0X 2N75A 3EISA 3MRSA 3Q7TA 4K2HA 3KSZO 4C9BA 2RH5A 1WM1A 4KDEA 3X2EA 4DGSA 5KNCD 1ZHFA 5ESWA 1HUQA 5FTJA 1P9WA 2WIKA 1CZHA 2OC9A 2HEIA 1ONNA 1K86A 2X4LA 1YB5A 3FRHA 3LF2A 3U7RA 4DMMA 1QH8A 1WLYA 1ZG3A 5GINE 5EZYB 2OZVA 5FI1B 5BSMA 5M3BA 2YNMC 5HZKA 2KBFA 5FADA 2L42A 3KV3O 4RLQA 3UQZA 5AW6A 1DHRA 2H52A 3FDXA 3CCBA 4FNGA 4WD3A 2WM2A 5FPKA 1CRQA 3SYTA 3U4QA 1LTHR 3QTLA 4FHEA 3AI7A 3IP3A 4UU7A 3VUEA 1K6EA 2BCEA 2ISQA 3MPUA 2GBCA 2MINA 3DGEC 3M9LA 3ND7A 2PUGA 2FH5B 4RD6A 4MV8A 3VHQA 1NOKA 2ZXEA 2YZKA 1A4RA 3GJSA 3HH8A 3W7AA 5TMPA 2HA7A 1F6WA 4NEGA 3UFXB 2PX2A 3PITA 3MELA 5JJIA 3HDVA 1W34A 5LB4A 1WCV1 1ZJZA 1U0NA 2OWEA 1R6UA 3A3PA 5ARDA 3RRJA 2I4IA 3V6MA 2F55A 4HS9A 3RS0A 4J0FA 2OLKA 3VSDA 4ANFA 5A1TA 5IS2A 3HK2A 3UV3A 4DARA 5KDOA 1E7MA 3CVXA 1XZEA 1UBEA 4ZI3A 3HM9A 5G0SA 1WXEA 4ZRMA 1X1RA 2GYUA 3G7SA 3UAVA 5C2JB 1YS1X 1TAGA 5GM1A 1CT9A 1E2LA 1V43A 4ZXPA 1P6XA 4GX5A 4NBNA 2F59A 4KE9A 4KODA 2PKYX 1SZDA 3TW6A 4DJTA 2Y1WA 1BWPA 4PTZA 2BGNA 2AG1A 3REQA 3VRHA 1ZZGA 1TVMA 3RU2A 1WRBA 3VSBA 5C8ZA 1IVSA 2YS6A 4R9UC 4CQLA 3TUIC 2R5FA 1JYSA 2VSYA 2XPCA 4LZNA 5DE3A 2H7VA 4KUGA 4PG5A 1GLNA 2O2CA 1FYEA 4I1IA 1H2HA 4FFRA 4N3GA 1LDYA 1ID1A 4HH3C 2HQOA 1DAHA 1D4FA 2C4HA 4KQIA 2QNRA 4TUYF 3ZTYA 4WK4B 2DSNA 1XQWA 4S1PA 3VPBA 3ZDFA 1U04A 4DXHA 4DCPA 3E15A 3M49A 3P9IA 1UJ4A 1I8TA 1WSDA 3GVCA 2PD3A 1XNJA 3T99A 3VVLA 4U7PB 1U2ZA 4JEUA 2ODAA 2ZVDA 1ZSYA 1UC9A 2HSEA 3O38A 2GILA 5KNDD 2OD7A 2PR2A 2QTGA 4ZYTA 3BDVA 3NYQA 5CNIA 2D7DA 1VMAA 3CNEA 4EBBA 1K3TA 4GGPA 1LF0A 3AHJA 3K4QA 1OZFA 1JT2A 2FN7A 4G8DA 1D2GA 4LOIA 1E99A 3U4AA 3INGA 1H8HD 4TYPA 4UHDA 1UJCA 2B61A 2D6FA 2IELA 2JKVA 4MKFA 1ZICA 2WMYA 2GCEA 4CMHA 4AKGA 1OY1A 3NGMA 2Q8NA 4FZ3A 3VZQA 2C5BA 3KPUA 4O5OA 1L8XA 2WY2D 3AUSA 4LDNA 4A8HA 4KUHA 3DXFA 3GU3A 3EPRA 3R7WB 3BY1A 4N7RA 3SSNA 2ZJ3A 4X9XA 1B73A 2P3QA 2Q1SA 2YXPX 3STHA 1WMAA 3ITEA 5T6BA 3IMFA 5F2NA 5JQGF 4G67A 5A4MS 3ZW9A 1UEJA 2EBFX 2G1KA 1V5VA 1M0SA 1NXXA 3BJIC 2CMKA 4IS3A 3R8XA 2VDWA 4P83A 1Z4QA 2L2QA 5IC6A 4AQDA 3KT3A 4KQ6A 3Q41A 3RGWS 4EELA 3WY9A 4BMCA 4JJ7A 1WKVA 4D6PA 2WSYB 3L1VA 3CEHA 3NIFB 4BX9A 4TMTA 5KTSA 1M6EX 1PP4A 4MW7A 5E38A 1TKRA 3DB1A 3L7JA 4J7CA 5HS6A 4D3YA 3UBTA 2OK8A 2WLTA 4RHUA 5B36A 3QOYA 4OD0A 1YGPA 1CJMA 3BWVA 3TKAA 2FPPB 3DTTA 3LA6A 1KVRA 4LOAA 3RWMB 1UM9B 4EMTA 5HDQA 3I62A 3AP2A 2ZIFA 1J0BA 4N0EA 4ZVPA 3VPHA 3MJTA 1T4BA 1PRYA 3O6VA 4FGUA 3HO1A 3CW8X 3RC1A 4PSDA 1Y1PA 1DQNA 1KP9A 2PSHA 1T9ZA 3OVMA 2WYOA 2QG4A 2DKOA 2GPAA 4V1CA 3JW8A 3HGTA 4QU9A 1BS9A 2BLLA 2YWBA 5ICGA 3H6GA 4B8ZA 3AF6A 1I3OA 2O3UA 3AQ4A 1RZRD 4RTOA 1YB6A 3O74A 3N53A 5EIBC 4EJ6A 2H9AA 3Q87B 3G7UA 3VZBA 5JNUA 2ZR8A 1K73D 5E3IA 3NDJA 4PHGA 1AV6A 3S2SA 3B53X 3CVOA 3MTQA 4JJGA 1GZUA 2BVNA 4YMVA 1JZTA 4H27A 1FEZA 1US8B 3GAAA 4M54A 3TQIA 3F8TA 1OB2A 1BS2A 5DN6A 1N5KA 4CLXA 2XCLA 1E3WB 2DFPA 1BRMA 1P75A 3FR8A 1YRWA 3VX4A 4HSEA 3WLMA 4ETMA 2X15A 2XXBA 1EBBA 4XD2A 2EOAA 4RHCA 3RU7A 1M8KA 1N2IA 3MRVA 5CW1A 3AR8A 3U4CA 3KUKA 4C88A 4QQ8A 1T2UA 4XXHA 5CDSA 2PX0A 1VCIA 1N7JA 3AUXA 3L93A 3T7CA 5FF9A 1YFZA 4MR9B 2NYAA 1SOUA 2JLZA 2WHXA 2DBRA 1WQ1R 3B1KA 1TVEA 2J0VA 5DCWA 3AXTA 3CRW1 5CX1A 2QL9A 2DWQA 2GYYA 2OBFA 1V2GA 1DTWA 2O4CA 3K35A 4ZAWA 4R05A 5GOZA 4KP7A 4MV4A 3EXEB 5JNWA 5I9MA 4P5EA 4B5LA 5TQ2B 3IOCA 2ZJ7A 1KI8A 2RMKA 2CLKB 1P4MA 1KS2A 2W22A 2X42A 3GELA 3IUMA 2KM1A 4RK6A 3R9WA 3AFGA 3ZZTA 1O94D 1Y34E 1Z62A 3COWA 2Q6LA 1NJ1A 4HWRA 4UCXA 4CCYB 1T6NA 1RXVA 1X9HA 1X2BA 2ZTUA 1Y3DE 1GPNA 1M2JA 2ZTHA 3RANA 1OH5A 3WAJA 2QAGB 3RNLA 2VJIA 4HYEA 5IANA 3FWNA 3KJIA 2XVYA 3JQAB 1MT0A 4COOA 1CS0A 3G5TA 4DMCA 3UT5B 1K6JA 2ZZQA 3CZ9A 1C41A 2W6NA 3HXKA 4IAOA 1MJFA 1H2AS 1OSNA 1OPRA 1YR6A 1RKQA 1DRJA 2WSBA 3AR6A 1AUPA 3FX2A 3NCHA 4KE6A 3HU3A 1XC7A 5JCOA 4GW3A 3V8BA 1JQBA 4OXKA 3A1VA 1C9NA 4FYWA 4B76A 1JB1A 2YQZA 4B7ZA 1T25A 1XMIA 2EZ8A 2QM8A 1KAHA 3ZK7A 4EI8A 4PLFA 1LWNA 3K72B 3QE3A 2JDID 1MKYA 4RJLA 1G8GA 2OD9A 2CVFA 1FNSA 3GY0A 3F6SA 5HXAA 2IXGA 2DPMA 3UA3A 3AF5A 1L5KA 1W96A 3HU1A 4EYOA 1PTJC 3IB3A 4K6KA 4EQZA 1A7AA 1TEXA 1RM5A 4HD8A 3N1UA 1M2FA 2H92A 2UXBB 4P35A 3G02A 4GRAA 4P54A 3WBBA 5BUCA 6LDHA 2V5VA 1EAMA 4E5PA 3LDHA 2R2AA 4ZT3A 1XZKA 3TF5A 2F4VB 2VNIA 3I9FA 3DZBA 4II3A 5KNLA 2XMCA 3ZNOA 1MPXA 2RSLA 1DAPA 4XPIB 1RJEA 2I34A 2CXOA 2HHAA 4YXWA 3GNSA 3KOOA 4NYJQ 4QYTA 1CLEA 2G5CA 2UUOA 1XL0A 1RQPA 1E3JA 4PSKA 2WFAA 3TN7A 4V2UA 4WVFA 1EVKA 4LEIA 7REQA 2GTPA 2GCIA 1DKPA 3D6HA 5LQJA 2WWVD 2PYZA 1ODIA 3TW8B 5DGTA 1WB4A 2Q8PA 3G82C 3QKTA 2PQMA 5L40A 3N6VA 1BFDA 2EU8A 2QRKA 3M1AA 4K6FA 3KNZA 3NETA 2PUFA 4P4SB 1O6FA 3RUIA 1LLCA 2NPOA 3PRJA 4FUQA 2ZCUA 3ODGA 4JU8A 5CYGA 3AESB 3B89A 1MNQA 5I7AA 1MO2A 2FAXA 4BO6A 4C03A 3LAWA 4KRYA 4BMVA 1BE0A 1FUUA 3HXTA 3MILA 1T2NA 3MTBA 4IDFA 2R65A 3A70A 4O1MA 5CUQA 3ZDBA 2MYPA 1B76A 2IYLD 3CZAA 3HJNA 3JAWB 2YNMD 2J4DA 3GWGA 3H5AA 4AJ1A 2R25B 1RHRA 3C15C 1TC1A 2N1BA 3PD7A 2REBA 3DE0X 5AT1A 1KJJA 1ULBA 1VB5A 3JTMA 4BFXA 5BUQA 5J43A 1PJLA 1E2UA 1LPAB 2ANCA 3BD8A 3HSKA 4I6EA 4ZQFA 3RHZA 3ZXXA 4B31A 3QFCA 2QVXX 2A92A 2WKQA 2QRNA 1E4VA 3BMNA 4OIMA 4TLEA 4TLAA 3UFBA 2OBNA 1A9XB 3SJUA 2BEWA 5JI3E 3UW3A 2BGIA 5GV7A 1ICEA 2V4DA 1TJ5A 1HFJA 5H81A 5JV5A 3K8ZA 2NU6A 5AI6A 1IWOA 4URXR 2HCRA 1ZOSA 4I66A 3KAPA 2FG5A 2PX8A 1J21A 2XBUA 3GA0A 2O8NA 2OO7A 4FD3A 3IVAA 1QONA 4PC3A 4JLVA 4OB7A 3Q88A 5JCPA 4DBZA 3FE2A 4K05A 1UP4A 4HS4A 3OZ7A 5TMDA 1L9KA 5CURA 4CEHB 2C7BA 3E3MA 3G05A 3RRYA 4FNMA 1ADCA 4HVTA 2JN9A 1X3LA 3RY8A 2GZRA 4GLBA 2WJWA 5C0OE 2HLHA 4WI1A 4KXMA 3ELDA 5P21A 1IZZA 3AVUA 3JQPA 5EUCA 2QZ9A 3WK6A 4PLZA 1GZHB 1ZXBA 3BMCA 1IUNA 5A4DA 1ZPDA 3FMPB 2GPWA 1I1OA 1VIDA 2PUTA 1U8ZA 2LPMA 4QEKA 2BKAA 2WG1A 1AHPA 3P96A 1X1DA 2TECE 1GYPA 1N5MA 2X14A 4XSVA 5EMLA 5J9FA 3TCKA 2ZTNA 3CCMB 4FKZA 1ZN2A 3EWIA 1NF2A 3KPWA 2QTVB 5FL7D 3C8DA 3DKPA 2VHUA 3R9XB 4R83A 3DOCA 4KVAA 3C8UA 1N32B 1NAIA 1N9KA 3BULA 2CVOA 5BYKA 1JDUA 1GFSA 4ARSA 4BJHB 4MHSA 2ZVPX 3FFWA 5A4JA 1WWKA 3PLAE 1V3TA 4EJFA 5CDUA 3EZXA 4I5GA 4TKOB 3OZXA 2BPOA 2HRQA 4QDZA 3WWCA 1MNAA 4H2DA 1YQXA 3D3QA 3L9WA 4L1KA 3P4YA 2J8ZA 5K6RA 2UZ4A 3D43A 3CMMA 2Q2VA 1JR3A 1RKUA 5I9IA 5K05A 1KR5A 3PUJA 3TZQA 5CFQA 2QYOA 1C3OA 2NO4A 1WEKA 4JC4A 4YYZA 4ZGQB 5F5NA 2ZW9A 1G5HA 2XXAB 2EWVA 4N6GA 4MV3A 4MROA 2C2ZA 4U7FA 4H3KB 5TB5A 2JKZA 1Q9SA 3D8SA 3MTAA 5DW3A 4OGFA 2XZTA 3NHPA 3QUTA 5DXFA 1QHXA 3TSAA 1NX6A 521PA 1NXVA 3EGVA 5C1PA 1U5BB 4UBLA 1KY5A 3FSRA 3K09A 1H8ED 4YRPA 4X6XA 3BXHA 3CCFA 1YS9A 4I5EA 3IT0A 2VR1A 1RYMA 1E4YA 5AVZA 2YV4A 4QSMA 3C3WA 1TZJA 2M32A 3PYXA 2AI1A 2OHOA 4L9WA 4NSNA 4YMUA 4LF8B 1W36C 3ASQA 5H7XA 2FY8A 4U02A 5IJ0B 4LJ5A 1JIUA 1Z5GA 4GYKA 3CVUA 4WBSA 3E9RA 2CFRA 2WIAA 4DE5A 2VLBA 2QTZA 1YRLA 2P6UA 4LHZA 5KNCH 1EJ6A 2OCIA 4N6OA 5EEHA 4RZXA 1KEEB 3VR4D 4K1LA 3Q3AA 2P40A 2R1ZA 2R7LA 4BVBA 4FR0A 3COYA 2AMFA 3QUCA 3DAPA 2A33A 1GN9A 4W1QA 4EHAA 3S1LA 3CS3A 3ZHUA 1I3NA 4IP0A 5DHRA 4PX3A 5DISB 4HZUA 3WJ2A 5AJWA 3JTEA 4R1TA 2DC1A 5SYNA 3L1KA 3DDCA 2O0MA 1L7OA 1R3UA 2R7MA 1G7SA 4PXAA 3U31A 4Z9YA 4YWHA 4V0SA 2J09A 2GXAA 2WYWA 4GFDA 3HEAA 3WNQA 4M0MA 4CQMB 2ZITA 1JI0A 2VZ8A 3K20A 3UG7A 3E7PA 5HS4A 2JK1A 1OFVA 2QYSA 3OKXA 3MWEB 2Q9CA 3IDFA 5HIMA 4F6RA 4UZSA 1SZJG 1L9XA 2ZXHA 2FSVA 4ETWA 1M73E 5JZ9A 2A4KA 4MMZB 4QBFA 2BGUA 3OEYA 1E64A 4ZTUB 3EXIA 5FPQA 5IEBA 4BIIA 4MWGA 3H9NA 4PFJA 1SUFA 4KH1A 4G4SP 3GJTA 1P5JA 4COKA 2OHHA 3GGOA 1RXCA 5JMTA 1ZMTA 2ACEA 7MDHA 4KRGA 2CYAA 1ND6A 4HSGA 2UYOA 2VSQA 3DT6A 2NVUB 1ZUNA 1UK6A 4DUGA 1FQOA 3L1IA 2J5KA 3LA8A 1W85A 1SKQA 3VNUA 4L72A 1B26A 2VF8A 5KQMA 1FJHA 3DJYA 2QK4A 2ZB2A 2Q3MA 1UFQA 5ALWA 3SBXA 3PEUA 3N2ZB 2MIIA 4QAQA 4RO0A 4S3MA 4QTZA 1EE2A 3UWPA 1W0KA 2YXNA 1Y4UA 1ISHA 2VHWA 4H15A 1I10A 1VJ0A 2PCLA 1R5JA 2ECKA 3MWYW 3PFNA 4HADA 3H9JA 4MKRA 4V0LA 4D8WA 1IXSB 3DFUA 3EA4A 4OXRA 3UT0A 1ZVVA 1YWGO 1D2AA 1DOAA 1MDBA 4CYMA 2ODTX 2BFEA 2PQ2A 1A50B 1NNI1 1OBCA 4NBTA 2AEJA 2H1HA 4L5IA 1DBRA 4P92A 3RFXA 3SXPA 3T61A 3QPBA 3NT5A 3EXHA 1QLHA 4OU5A 2RGXA 2IXTA 2OBRA 3ASVA 3W2EA 4MLDA 2Y0BA 1A3CA 2ZRKA 3SE0A 4F12A 1YA8A 1NLMA 2DWPA 2N1MA 4GO1A 3G88A 3RS2A 5AESA 2V31A 2BEJA 1UD4A 1Z6PA 2HV9A 4NDZA 1B0ZA 3JAKA 2BE9A 3Q5DA 4LV8B 4DL9A 5I8PA 5FL3A 5JSHA 5KNDH 3D1LA 1DEAA 2ACKA 3VR2D 3AKYA 1C1XB 3WLNA 5KWEA 2DUUA 3LLVA 1E1QA 1G3MA 2ZAOA 3TCNA 2AR7A 1IBLB 3CT4A 1E2QA 5FNVA 3T7SA 3CCLB 5IT5A 3GF4A 4LE0A 1S2DA 4UUPA 2FKAA 4BUZA 2LGJA 5CT6A 4HAVA 3I4CA 5FXMA 4JI3B 3WDLA 3LNCA 1HFEL 2P9YA 2POQX 2B6HA 4BMPB 4FGKA 4UMEA 3UMVA 1PUIA 3TSYA 4AJJA 2YS7A 5FI5A 1G8FA 1M5RA 4XX1A 4F3KA 5C7LO 4L2IA 2R00C 2YIMA 2ZTSA 1UQRA 3N2LA 1LC0A 4IM7A 3L4KA 1DTWB 4MUMA 1ZVQA 4Q7JB 1IU9A 1I4LD 1LV7A 1IAVA 2K87A 6NULA 1J1ZA 4N49A 3PTAA 2C7RA 2QR2A 1WXWA 4MV0A 2PMEA 5DB4A 3I64A 4U0KA 4ZOCA 1S2IA 5GONB 1OLSA 3R7BA 4B4UA 1A1VA 4I4TB 3AG6A 1K97A 3UUFA 1M0EA 4TT3D 2DHDA 4MQEB 3OLXA 1YITB 4D98A 4EYEA 2XUOA 1JE0A 3G1TA 3IEUA 5LZ8A 3ZWAA 2NZYA 1IOVA 2NTVA 2Y2UA 3DZCA 3FNBA 3PC8A 3QBVA 1TIPA 2IYSA 3DSRA 2QVYX 3DQPA 4DMFA 1U90A 4V39A 3WXBA 2E1PA 4ZZ0A 3TSZA 3VTKA 4RPCA 3NW9A 1S1CA 4RVNA 4MWZA 1ID8A 2AD5A 1Y3IA 3HSYA 2I2FA 3LGXA 4MRSA 4B2IA 1WU7A 1J8MF 2FR8A 2R79A 1OTXA 5BSXA 4KKVA 4UDYX 3OLYA 4RM2A 4ZMRA 2ZJAA 2BGWA 1E7QA 3ZWXA 4A8JC 1KAQA 3BXGA 5GOTA 2Z9DA 3OZIA 2FPSA 4RZ3A 3A8KA 1MQAA 3SKVA 3ZDZB 4LTDA 4DKXA 4PANA 2H6EA 1WZCA 3I52A 2VPYA 4I55A 4A5SA 3ER6A 1N5LA 3IE1A 4YELA 3QVXA 3FPBA 7ABPA 3WLTA 4WT7A 3K70B 4PTYA 1VFPA 1N6KA 4C0JA 1HL7A 4DABA 4OOVA 1HE2A 2XBLA 5AYVA 4PQYA 4WGFA 3WI7A 2ATCA 1N0IA 1JQKA 5L53A 1F48A 1UXKA 5J4YA 3TOCA 4L73A 2VXOA 3GC6A 2DIEA 4G36A 2FPKA 1QKKA 4NECA 5CT5A 4AWXA 2BI8A 4GICA 1SIOA 3EZ2A 4GOND 5EIXA 1YNSA 1IL0A 3KZCA 5FKJA 4R3WA 3LY9A 4F3NA 4DYVA 4U7TB 3IH5A 3NYWA 3QELA 3BBLA 1O0CA 4CL8A 2IF0A 3Q7SA 2FPGA 3QW4B 4TTVA 1VLVA 1YZHA 3ECCA 1EGVB 2PFSA 3E6AA 3ZCXA 3I01M 3OFSA 3DDZX 3BPSA 4KSCA 3W90A 1J9GA 1EWKA 2GQ0A 4M6WB 4X3CA 4FIZA 3TUJC 3UJ9A 2FQYA 3PNLA 1C9KA 2QMUA 2FPIA 4WVLA 1T5OA 1Y6ZA 2IPMA 2O5CA 3V4PB 3A36A 4YRLA 4B3FX 1QWOA 3QPUA 2GFIA 2RGNC 1DKOA 2Z5VA 3UYLA 2HQRA 1SU6A 4OYYA 3UGKA 2MR6A 3URMA 4YQEA 3S99A 4KMOA 5TQ0A 1MIOA 5IYZB 4M86A 2VDQB 1KYWA 3HJCA 3G1WA 4XUDA 3CNLA 4KAFA 1MG0A 1B6RA 5DCLA 2DYIA 2WTXA 3VHXA 5ICCA 2IYQA 3KFXA 4RGVA 1W94A 3BH7A 1M67A 4AU1A 5KTNA 2R6DA 1KMHB 3EOZA 2J7PD 2HNKA 3MS7A 4H3HB 2QU7A 3OLQA 1U0OC 3LKZA 1Y7PA 4HLUC 3AT1A 4OXNA 5HMMA 2XKBA 3EK2A 2XGSA 3BMNB 4LCEA 3K5HA 1MAWA 1ZJYA 2XHZA 3H0EA 2FEOA 3TWOA 4UAUA 3PEWA 3N39C 4BP8A 1QVGB 4D92A 1DVRA 2NU6B 3LPCA 4AYWA 4GYJA 3I76A 2B25A 1JECA 1QQ6A 1TJPB 2QPAA 2O2YA 4Z4IA 4ISCA 4UU8A 3DFZA 4E3WA 1AZLA 1ZIDA 4RTMA 2HA4A 3PT9A 1TEZA 3DAGA 3N2GB 3M6VA 4XWTA 1SKMA 3ISTA 1ORWA 2W2TA 2MJLA 3UJNA 4A6PA 3DP9A 1ISFA 1H6CA 1GPKA 3DUWA 4CDRA 4OQQA 4YV2A 2DKFA 1KQFA 3SOPA 4UM9D 1P33A 2RGWA 5IXJA 4LBZA 2IUTA 3B3QA 3RRMA 2C1XA 1PZNA 4B87A 2XDYA 2CHEA 4M0CA 4RZIA 2XUKA 1H2YA 2GM9A 3M6LA 4DSNA 2E18A 2IOYA 1M54A 5DHTA 3ZH2A 3U9LA 2P6RA 3GLHE 3JQFA 2J41A 3DLAA 5KMGB 1BE6A 3L6DA 3BMCB 3RPEA 4L5JA 3CR8A 5E8RA 1W5AA 1KQNA 4CV3A 3E7FA 4F8EA 3NRCA 4BVHA 5CFZA 1R0CA 2EEPA 3PIDA 1XEFA 4LKOA 1FP1D 3SHWA 3GZJA 5H9WA 1N77A 1CKEA 3DTVD 4L4RA 2F1OA 2WKPA 4LE2A 4JSRA 2ZYRA 4ZO7A 1ZL0A 3U9TA 2X86A 2ZUTA 5A71A 1FE8A 2AFIA 3IBGA 3P9SA 1W36D 1NJID 3B38A 4LGVA 1GM5A 2PZJA 1LWOA 2QAJA 3DD1A 1EM8B 5TDHA 5M34A 1ZJ5A 4I50B 4S2UA 3S7TA 3FCOA 2ZM6B 3DDWA 4UULA 5IVDA 3A9WA 4WDRA 4A8PA 3LFHA 3PDCA 4F5EA 4NU6A 1NOIA 4GGOA 2YASA 4D44A 1CJKC 5CHEA 3P94A 2GD2A 4FN5A 1OFGA 1QAOA 1TD1A 2H59A 1OIWA 2NZUG 1SB9A 2QUBA 2UYYA 3JU3A 1J5XA 4OVKA 421PA 1GR0A 3HB4X 5JXIA 2C8JA 3L7YA 4J16A 4DADA 1BRTA 3BA6A 5EE3A 3DVQX 1ZIPA 2QI9F 2IT1A 3LTEA 4Y6GB 2OV4A 5EC8A 1XBTA 2W70A 2WC1A 2NYUA 1HVXA 1SOWA 5CA1B 4QEZA 3WZ2A 2OY0A 4K81B 2F1RA 2VTKA 3VNSA 3U16A 2P6NA 2P4UA 3KEFA 4PLYA 3OPMA 3MM4A 4O4JA 5AO9A 3LL4A 4YRAA 2QF7A 3RQIA 4G4GA 3BFKA 3L7IA 3HC7A 4HQFA 4RORA 1OFHA 2HA0A 1EFPA 1OZ0A 1VOTA 3JV7A 1NBAA 1KJWA 3VPCA 4YAOA 1F0NA 1EX6A 1L7PA 2EXXA 4HAZA 3EGOA 2GZHA 2NZWA 2Z83A 2J0QA 1F0PA 4HRXA 3UMCA 2X0EA 1GL3A 2C4VA 5DNCA 2BFMA 5AM1A 5C81A 5IJWA 1VSUA 5KVAA 1PW5A 4AS1A 1NVAA 1T0JB 4KYVA 3GGJA 3CWCA 4CQJA 4RJJA 4UUOA 4MVJA 4WERA 2ORVA 1PW7A 1ZNZA 4P4UA 1TAHA 3U4IA 4D5EA 1H0HA 3H3FA 3E82A 4EA7A 2PRZA 3TLGA 1PG5A 1LPBB 2JCGA 3GUHA 1CVRA 2VRWA 4CL0A 3BY2A 2FW0A 3A6HA 4OQNA 3Q11A 4JX8A 4LVCA 2QDXA 4GH5A 4MARA 4FEEA 2WAAA 3AFNA 4UTXA 5HM8A 3OFKA 3JARA 4KQMA 3WLKX 5DTQA 1KA9H 2P5SA 4FOSA 1PL8A 1FMFA 3KZ1E 3CE6A 4E21A 4EHFA 4XWKA 1T9BA 2CKMA 3L7DA 3G49A 2OYNA 3F8SA 2ZWMA 2PIAA 3JQ9A 1H3NA 1JH8A 4QT0A 1IHPA 1XVLA 2ZOSA 3ESXA 3EXIB 3I9V6 1XCJA 2H1FA 4YRQA 5L3SA 3L1UA 4E14A 1HQCA 2VYFA 3G68A 1CY7A 3QJYA 3QRWA 2PAAA 3ZHCA 5CD1A 2X1VA 2B82A 3KT8A 2SNIE 4DAOA 5CDFE 3WC4A 3LVBA 3IMCA 1XF1A 3D8NA 2UV8A 3HMKA 5EEGA 3WR5A 4B5KA 5HPYB 4XLEA 2EGHA 1H94A 4BLOA 1RXSA 5KEIA 1IXYA 5E1BA 2PFGA 1RXWA 3RBXA 3K9CA 4IJKA 1Z29A 3O8OA 2IEBA 4HQRA 4DBVO 3B3AA 2WRZA 3U3JA 3LZ6A 1VBMA 1Y3FE 4WN3A 2GBPA 4MLCA 1IG3A 2WHPA 5FO0A 3K2EA 4MI6A 1PD1A 2H48A 4NV3A 3RJZA 2B8TA 4M1EA 1C3VA 3X3HA 5TARA 4AZWA 4UDXX 4WLUA 1XK6A 1ZMBA 3N7TA 1ABBA 3HWSA 4H18A 1SC4A 3EPPA 4US1R 4CFZA 2D7JA 1CSEE 4JK3A 4FDAA 1S9HA 4DV7B 1V16B 1LSUA 4GEKA 1WX1A 5LD2C 3ZDDA 5ECWA 2CF5A 3QVMA 2QL6A 4B81A 2XKKA 2X5JO 4FW8A 1YS6A 4X7BA 3COVA 1NMZA 3DHYA 3VR4H 2GEFA 3B1WA 3DEFA 4J9VA 1BFKA 1UF9A 2A5DA 4X90A 1Z2EA 2CUZA 1ZEJA 2RBKA 3AU8A 3PQ7A 4MINA 5PNTA 3SICE 2QUIA 3UZUA 4X8OA 5H4HA 5LWHA 2C03A 3JYNA 3NRJA 3GLSA 4DB2A 3EZLA 1K7YA 3LZCA 4LYGA 1WW8A 4BCBA 4HNVA 1PI3A 3FCEA 1E2MA 2E3JA 3A1EA 2B78A 4RTNA 3W34A 3K9NA 1DLIA 4Y3UA 3RTDA 1HY3A 3STUA 5CVJA 4QHTA 5HK9A 2RGYA 2ZYIA 2VJJA 1AUQA 4WZKA 3P2YA 1J39A 1CR0A 4DLRA 2ZPAA 3W77A 1P7WA 2SKCA 5L3RA 4IDOA 1YJNB 1FNNA 1VRWA 4LI3X 4F9TA 3UPTA 4C3VA 3Q7EA 3OA0A 3BCSA 1QHYA 3MINA 4XQGA 3VU8A 2PDAA 4Q1BA 3BREA 5FI3A 1YB7A 3B13B 1NNSA 2W11A 3HKBB 4EUEA 1EJBA 2JVJA 3PJEA 4RYDA 5AW5A 5LYJB 2ZBFA 1HE1C 4RDCA 1CB7A 4S1NA 4G63A 3N8GA 2V4ZA 1D8TA 1G8JA 1T0BA 3VKFA 3WV5A 5C4IA 5K3EA 4E94A 2RFLA 2C2BA 1QH1B 2ZAMA 1ABEA 1H1DA 5G53C 2WKWA 3NOQA 1WZ2A 2HCTA 1T9CA 1NG9A 1NOJA 4L27A 4ESEA 4X7CA 1GNRA 3SQWA 4R8SA 4F3YA 1RPTA 2ZIZA 3DWIA 3W9BA 4QIHA 4BO2A 2ZUBA 3LUBA 3ZHOA 1G3IA 1R6BX 2FFQA 3LHKA 4HDOB 4KSYA 4LNUB 4U5QA 5KQGA 4KMRA 1AN0A 4IL5A 4LXQA 2R6R1 4AFNA 4INOA 1QAMA 3QPDA 3J81k 1P17A 1PGQA 1HO3A 3VXKA 1QB7A 1WIWA 3ILXA 2IV7A 4FONA 1NQUA 3OH8A 2PKCA 4WXEA 3SNHA 2F1LA 1DL5A 4MZDA 1V5IA 5FUWA 2V6FA 1NVVR 3QBJA 1ETHA 1OA1A 4KR6A 4I55B 1XRLA 3QU7A 3LYAA 1TKAA 1YJ8A 2AN3A 3V00A 5DHSA 4HVLA 1BEEA 5FUQA 1AN9A 2JEZA 2I9PA 5K3FB 1SXGA 4JCOA 1M3SA 3NXKA 4MUXA 5BN4A 1C5KA 2BE7A 3PQFA 3QVUA 5C8VA 4Y2JA 4X8HA 3GEGA 3JX9A 4ARUA 1BVHA 3FTQA 2PUWA 1I4TD 1AA9A 4B7UA 4EW3A 4HDRB 4KQ9A 2P5UA 1RCTE 1XHFA 1Z0JA 1P4AA 3P9RA 4IIDA 2I6XA 1RQGA 5AW1A 1BHO1 1L4YA 1GL7A 3DBRA 4N6NA 5BSWA 1X7WA 5I9SA 3GLUA 5D3MA 3B2EA 1M74A 3B1YA 2WJAA 1X70A 3E7XA 3GNLA 3V4SA 4NBKA 3A8JA 4RZHA 5IP5A 4CM9A 3J81A 4FFNA 4X7FA 3HEMA 1BG6A 3I1IA 2WU0A 3EPJA 2I65A 4M1WA 1HTTA 4LN1A 2AOUA 4EIWA 1U8XX 4INAA 3KAQA 4WCVA 4RD1A 1M2OA 2CE7A 2ZI9A 3LCMA 4M0EA 5LBIA 3H7AA 4BVLA 2ASEA 5KYXA 1UOOA 1MB9A 5EJFA 4DR5B 1UADA 5ALUA 3MGCA 4FB5A 3H9BA 2AI3A 1N2ZA 3R7AA 1EEXB 1E3IA 3N70A 4AZSA 5FH9A 3K53A 4RBNA 4TSFD 5JROA 3DT8A 1JAHA 2CE2X 1Y8RA 2RONA 1L5FA 4FS8A 1ZOIA 3E3NA 1HDRA 1SXJA 4FE3A 4GX2A 4EYSA 3RIHA 1JFVA 1HE5A 3IKLA 4DUYB 1MRNA 4GI3A 5BMVA 5JBIA 3HVUA 2KQUA 1IUPA 2JGLA 1PHRA 3V80A 3GX1A 3HABA 4S2EA 5C51B 3LFTA 4HYQA 2GPYA 1NV9A 4I8DA 4WN9B 3SFZA 5BNZA 3AHIA 1T6XA 4Z9AA 1U0HC 4MK4A 2WF7A 5H3HA 3UA4A 4LMRA 4RH1A 4EG4A 3COPA 2P9BA 1LW6E 1BMQA 1QNFA 1WXDA 3C98A 4E33A 1U3WA 5K0LA 4XM3A 1QGUA 1NU8A 3VKGA 1IATA 1UBCA 2H1SA 2H1OA 4S1VA 1VSTA 1DSSG 4WLOA 4WOPA 4KGXA 5H1YA 3B6MA 5DJ5A 1G41A 4X92A 3AL3A 4PVCA 3UH1A 2FI1A 2J9GA 2D4HA 5CLFA 4S1WA 4QATA 5LQAA 3T9EA 3GVHA 5D86A 2WNHA 2QQEA 4BY9E 3OLCX 2G7MC 2XRFA 5BVGA 1ZIXA 1EFAA 1BGXT 4BO9A 2DUNA 3RC3A 1X94A 1QP4A <