2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
4QHTA 1QGAA 4TN1A 2JJ8A 3W5IA 2QU8A 3FDIA 3SS8A 2ZRKA 3KKNA 4BFXA 4PSKA 2C99A 4IKEA 1S3SA 3U3OA 2ZXUA 1SXJA 4IXNA 4OHYA 1XCMA 3EAQA 4R2HA 3QVVA 2HLDD 4CDGA 4XVQA 3OF5A 3B1VA 1C1YA 3IHWA 2BCJQ 3NHAA 4S35A 5G53C 4BFTA 4P6VF 3LAWA 3RWMB 2VH5R 2XJ4A 1SVSA 2F3TA 4NYJR 4JVMA 4FMCB 1XMJA 4UNPA 2GEDA 2BMJA 4UXJA 3RRMA 1W4AA 2FV8A 1Z0FA 3CF6R 3C14C 4TLEA 1GAQA 3OHMA 3G0HA 1ONBA 2Z4SA 2B7BA 2OUKA 4XD7D 4NZYA 4O2LA 2PIAA 4LYHA 3DKVA 1ZNXA 1AA9A 5KHOC 1TU4A 5A5GA 1JR3D 1UEJA 3QPVA 1OSNA 5G3YA 1E2MA 4Q21A 4JJZA 3VNVA 1IN7A 3U44B 2QBYB 1BH2A 3K0FA 4HAYA 1IY2A 1JXMA 4DCTA 4B4DA 3QXSA 4YLGA 1E94E 5JI3E 1NY6A 4GZLA 1YVDA 2GBLA 1Z0IA 2AWNA 3THWA 4BLOA 1CTQA 3FGNA 1TF5A 1F2UB 1U90A 3TKLA 4Y9RA 3FKQA 5KSZA 4GL2A 1M34E 4I1UA 5JS8A 3MWKA 2MMCA 4D4KA 2ONKA 1UM8A 4WZAE 5JZVA 2IX3A 1IAQA 4URXR 4XWAA 1H65A 2NPIA 3DZ8A 2QI9C 3WYGA 3EW9A 1MRSA 1JJ7A 4KODA 4MGYR 4DLSA 5LPNA 1COWA 3T12A 4ZKDA 2WBLC 1VPLA 1YZQA 2P2LA 3CCJB 4IJMA 1U94A 3LW7A 2O8DB 4CGZA 3BXZA 2W00A 5FTNA 2J9RA 2WPDA 1YZGA 3QKSA 3IEVA 3WBKA 1TX4B 2QTHA 1E0JA 1EWYA 2J0UB 5FPYA 2IWRA 4F4CA 4JYBA 3DOFA 3IKJA 3DL0A 2PCJA 1CF4A 3GJ6A 4JLPA 3CRMA 2CE7A 4AD8A 5BYJA 3LVBA 3RS3A 3ICEA 4CEIA 4OQXA 3MHPA 1Q3TA 3WYFA 2D62A 2MSEB 4DCVA 4JLKA 1L8QA 2BBOA 3EZFA 5K8TA 4PXAA 2EIXA 2VHUA 4F38A 3T1OA 1CBUA 2AL7A 2O5VA 4K8OA 2ZJBA 3KTAB 3QI2A 2MMGA 4JSTA 4Q1CA 2IEYA 1F2TB 1J99A 2NTYC 3VR3A 4FMBB 3B82A 1YRAA 2AXPA 4GI7A 221PA 1TQDA 1XPRA 1VQKB 1EFCA 1ZU4A 2XTNA 5K8LA 4OJKA 1NIPA 1FTNA 1V43A 4Q4JB 3W2EA 2JEOA 4JYCA 2HV8A 2QENA 2QA5A 2VYFA 4JT4A 1T8UA 1A2KC 1OPXA 3BB4A 4DT1B 1W1WA 4DZZA 4BUJA 2BM0A 1G5PA 4HLUC 4NP6A 1KQSB 3VKGA 3GFOA 3EPJA 2FFQA 4C4PA 1GSIA 4OHWA 3W5JA 5HKKD 2D06A 3BBPA 5SZHB 5IT5A 5JEDA 2FF7A 1KO5A 5DSZA 2NQ2C 2WKQA 4LV5B 1R0XA 4D4JA 2J3EA 5DHFA 2C78A 1G21E 3L0SA 2W2XA 3ND9A 1J90A 1HYQA 4DLUA 1NKTA 4YMSA 5L8VA 2C95A 2WJJA 2WIAA 4KVGA 1XEWX 1KJZA 1A8PA 1U8YA 1QHIA 2CBZA 3B1YA 2CXXA 4Q48A 1TPZA 4M8NE 1HURA 2RGDA 2WWXA 3CXCB 3EA0A 2W58A 1U99A 2ZQ5A 1XEFA 4PR0A 4Z8XA 3SZRA 3EIHA 4V03A 2W0SA 1G3QA 4TYNA 2P6NA 5EZ6B 1T8TA 1G64A 2ZR9A 2FGKA 3K0SA 2IYRA 1NBMA 3KQUA 4TLAA 2JLVA 1JB1A 2OBLA 5JECA 3KXIA 1II9A 2JATA 2WVJA 2OEPA 3K0AA 3GLGA 1NLYA 2VSOA 1EX7A 2OHFA 1SKYE 3VX3A 1D2NA 1QVRA 3WYAA 4NBSA 4YAUA 3CCMB 3CPWB 2G77B 3OIWA 3HYTA 1T9HA 4BECA 1YHQB 3I1FA 3BFXA 4Q7KA 2XXAB 4OQMA 3AVUA 2WSMA 2B21A 2O8FB 1VG9B 4A2WA 2GDJA 1KSJA 4OI2A 2GJ9A 2K5UA 1X86B 3PEVA 2Q9CA 1EP2B 2I1QA 1YQTA 4US1R 1IY1A 3SHFA 4DLTA 4MKIA 2WTUA 2F9LA 3OZWA 2OXCA 3CCVB 2AKAB 2P65A 2ZSAA 4AG6A 1UKZA 3CCUB 4IDQA 3THYA 2YVUA 2WJIA 1E0AA 2R9VA 3K1JA 4C0JA 1TUIA 1BOFA 1S9HA 2BEJA 2IL1A 4LZZA 4RZXA 1FP6A 3R8FA 4HAWA 1BYUA 3W2HA 2RGGA 1EWQA 4OL0A 1P9NA 1Q1ZA 3QXCA 4RFSB 1KO8A 4KLZA 3QFCA 5TY0A 4D0GA 5J40A 5JSZA 3K09C 3LY5A 2IYLD 2XTZA 4QJ4A 3KQNA 3Q7QA 1YR6A 1AN0A 1QG2A 4ESHA 2QMHA 2CMKA 4YC7A 2OM2A 5FBLB 2VF8A 1NN5A 4RKEA 1W49A 2QEQA 2C03A 3TGPA 3QF4A 3RSOA 1ESNA 4DSOA 2JLYA 4RD4A 1A5TA 1K6MA 2IS6A 2ZS9A 3K53A 1W0KD 4OK6A 4PTLA 4YAWA 1QG4A 1KGDA 3BFVA 2WAYA 1NJID 1KK2A 3A36A 4URYR 4BZXA 2WWYA 1CS4C 1FNNA 1KDOA 2BIFA 1OV4A 3LA6A 1IN4A 4LWZA 3TW4A 4IFBA 1KK0A 1RJ9A 4Q1BA 1KKLA 4JL8A 4DB2A 4R2IA 4M9QA 3QXXA 3BH0A 2G3YA 2QRNA 3L43A 4EPXA 5IF9A 2QSYA 3VU9A 3AVWA 1KY3A 2IYVA 3GFTA 4M9SA 1AQYA 1S4QA 2EWWA 2G1JA 3GLHA 4NDZA 5JHHB 1SHZA 3IUYA 1NVUQ 4HLQB 2GRJA 5EE1A 2ECKA 3FWYA 4BLPA 5L3QA 1IN6A 1HY3A 1AZSC 1UKYA 5DIFA 3CRQA 3P1JA 4P4TA 1YZLA 4NTZA 3X1WA 5KNBA 1EWRA 3KL4A 4GOXA 2J45A 1E9DA 4OHXA 3QEOA 4LK2A 2EFDB 3PG5A 3U3JA 4M1SA 3FOZA 2ODWA 1QFZA 2W6JD 4V02A 3K9NA 4PC2A 2CLDX 3IDQA 2C98A 5EE9A 3Q5EA 4GOKA 1IBRA 3ASZA 4LBWA 2WZQA 5AJVB 3ZS9A 1DADA 1DO2A 2VA8A 2G1KA 1DAKA 1M6NA 3WNDA 3HDTA 3RNLA 1SXJD 3OIUA 3SEAA 2IS1A 1LY1A 5LD2C 4PPGA 3IBGA 3W2FA 3AF2A 4ZDKA 2F3RA 3BB3A 1JNYA 3X1DA 4LRWA 4UQOA 4LHYA 5JRJA 2HCJB 4BLSA 3CBQA 1H85A 4A2PA 2QUZA 4D4MA 3Q3JB 2J0SA 1CNFA 1GDDA 4BFSA 1U98A 1G19A 1DE0A 2VHCA 4HZUB 2YNMA 1K5DA 3CPEA 3PR1A 2NO6A 1WBDA 3W2GA 2A5DA 2EVWX 1W4BA 2XITA 2GQFA 2Q21A 4LHWA 1N0VC 4ZI2A 3GLFE 1E9SA 1G18A 2VTKA 3KFVA 3CCRB 1ZM4A 4H1VA 4AK9A 1CKEA 2OAQ1 4BGDA 4JKYA 4NCIA 4JVLA 4BFUA 2FH5B 3R9XA 5GADl 1Q0UA 2QAGC 3AUYA 3NKVA 2QRZA 3QXJA 5FPKA 4ZCMA 2ZI4A 3AKYA 1ZD1A 2H16A 1NRJB 1E6CA 4HDCA 3A1WA 3UK6A 4M9XA 3DZDA 2OE2A 1Z3IX 1BYIA 4URVR 2Q3MA 5FI0B 2LKDA 4GP7A 4B32A 2NIPA 2B8TA 4M2LA 1R2QA 2OILA 3IO3A 4IVQA 2WM9B 1IHUA 1EX6A 1U81A 3LVQE 1LNZA 2REXB 3N2EA 3AVYA 5HR5A 2GJ8A 3H0KA 4N0EA 1GAWA 4OBEA 3CKLA 1E2PA 1QVGB 1QBKC 4QJ5A 3E1SA 4MRRA 4FW9A 2DWPA 1OE0A 2DYKA 2NZJA 2WJYA 3OJXA 2WWFA 1JPNA 2EFCB 2ZUBA 1ANKA 3CIOA 3E2IA 3HPQA 4M1YA 4C30A 4D25A 2IW3A 4XD7A 3LXRA 2WPDD 5HPYB 5FPSA 5FFMA 1GNRA 4RD0A 2ZRLA 4MRSA 3RS4A 4DXAA 1XU4A 4RCYA 1XMSA 2OLJA 4AYXA 4GOJA 2XOKA 1XCPA 3CZQA 2ZJ2A 2O8CA 1E1QA 3QG1A 4EFLA 4EQ6A 2OXRA 3ADDA 4Y0AA 2FEMA 1R0ZA 3NVAA 4DLVA 4IOJA 3KX2A 4O25A 4TMWA 2VSXA 4PZZA 4FCVA 5LD2B 3D8BA 5G3ZA 3GEEA 5AK0A 3NC1C 1ZMXA 4HB2A 3UWOA 2JLUA 4LC1A 2GXSA 3SQWA 1E2IA 1GAJA 3B13B 1RKBA 1ETUA 2IC5A 4PQYA 4GMDA 4QNRA 3SU8A 2KI5A 4ZDWA 1M7GA 4URWR 3FVQA 1OXTA 3T34A 3HJNA 1NVVR 5AWFC 4IFEA 3AQ4A 2BJVA 4RZ3A 1NL3A 2GF9A 4RZ2A 4X8LA 3EASA 1SXJE 1UBFA 3WP0A 5EE0A 5EE5B 2XGJA 4A1FA 1UBGA 5FTLA 1G6OA 1KD1D 2VBCA 1W44A 4CW7A 4MKHA 5KDDA 1ESMA 2JLZA 4DIDA 4M0LA 1E99A 3NBYC 3U7HB 3V4RA 1OB2A 1GKUB 4CEJB 4I81A 4AKGA 4A8JC 2QAGB 721PA 4YXWA 4IOMA 1KIMA 1Q81D 4LI0A 4DIEA 1XDBA 4OHZA 1G7RA 1JQLB 1M8PA 5B57C 2RB4A 3S1AB 3OIVA 3EC2A 3R7WA 3B7GA 5KSOA 2AHOA 3EWAA 4LYJA 2QPTA 4A6PA 4ZV4A 3GJ7A 1SQ5A 3WMEA 1AK2A 2DR3A 2BBSA 2ZYVX 3KQKA 1OFHA 2IYQA 1GZSA 2FNAA 3DDCA 1IN8A 4KSBA 4DDWA 2C5LA 1VQNB 4F7DA 1XF9A 4IEEA 1QDEA 1S3GA 4B34A 4QBFA 2QORA 4C0LA 3ZVMA 3KJIA 4C3ZA 4WAUA 4QHYA 1JALA 1VCNA 1S9DA 5KUTA 2DEUA 3AV0B 5J4VA 1PUJA 1Z0DA 4ZDJA 2A2ZA 1L7VC 1NBMD 3P20A 3EXAA 5FBRB 1YRBA 3L0IB 3TVDA 4CF7A 1AMOA 3MMPA 1G291 3T61A 1P2UA 1EFUA 1N0UA 4LPSA 2OCBA 3RS7A 3EWSA 1QHSA 1S8FA 5AUOB 5FL3A 3L0OA 2QG6A 2RGEA 2YJTD 521PA 3VAAA 4TTRA 4W5HA 2AWOA 3U6KA 2LCFA 3SFVA 1XD2B 4OI1A 3DEFA 1EG7A 1VHLA 2VP4A 4F4JA 4LV8B 2DPXA 5FOWA 2R6GA 5HKKA 2NO1A 4GZMA 2Q9AA 3CONA 4EAQA 4F92B 3ZC3A 4RD6A 3WNCA 3QXHA 1QG0A 2AD1A 2PEYA 3AKCA 3L2OB 3WRXC 1FQKA 2BJWA 2NO0A 4HLDA 4LPKA 4TL9A 3A1SA 5SZKB 3IQWA 4JBYA 1TNDA 1E2NA 5KYKA 2YZ2A 5EJEA 1Y3AA 1YHNA 2BSAA 5GJWC 5ELXA 3P32A 3LW8A 2OLKA 1EP3B 1XX6A 1WXQA 3CUEF 1ZINA 2FJUA 2R62A 2UVQA 3ZIAA 2A3RA 1KMHB 5FTKA 4II7A 4FIDA 4B3XA 2P67A 1ZBDA 3PEUA 4JMPA 4MYHA 4K1XA 1DVRA 4LBVA 4A8JB 3ZD7A 2RHMA 3TQCA 3VKWA 4HUQA 3QE2A 3MGCA 5FR1A 5KNDA 2G83A 3K0CC 1U9IA 5CDFE 2CHVA 2HDNB 1UDXA 5DHAA 1MABB 5BYKA 3X1ZA 1GKIA 1YR9A 3JVVA 4D0NA 1NNEA 3SJBA 4AC9A 3X1YA 3CCEB 3CM0A 2FPMA 1QFJA 4G01B 1TEXA 1AKYA 4DDTA 1XPUA 3V00A 3VR4A 3QEJA 4DLZA 2ZE7A 3I92A 1KRHA 2IK8A 3DM9B 2Y8EA 1D5CA 4JLDA 4HB4A 2HMAA 5CIQA 3F0TA 4B47A 4D81A 4YAFA 2CRVA 1QHHB 4CZ2A 1SKQA 2ZRHA 3TAHA 1EP1B 1FMJA 1OIXA 2VQSA 5FUWA 2XZOA 3NXSA 4ARZA 4Q02A 5E4FA 4DKXA 1XPOA 1OH7A 2GCNA 1MT0A 2QZ4A 2C77A 2KBEA 4B3DA 4YDSA 5SZJA 4Q19A 1GJRA 3B1WA 2OTJB 1IJFA 1ELOA 1GILA 4WXPA 1XEWY 1E69A 4EFNA 3F8TA 1JXOA 3KJEA 1HTWA 2BMWA 1G7CA 3P4YA 1HT1E 1VIYA 3RRNA 1G8FA 1KI6B 1RIFA 5A0FA 1KO1A 2ONJA 1GTVA 2CCJA 4H9GA 3AVXA 2IYSA 1CR0A 1UBCA 2N42A 5TB5A 3B6EA 2EFGA 2R2AA 1W46A 4CEHB 3GLGE 1NSFA 5DYIA 1IY0A 4PHHA 1L2TA 4DRZA 5FOUA 5JRZA 1CJTC 2YHSA 4OK3A 5G40A 3UG6A 2FN4A 4D82A 3U7EB 2H5EA 4TZ0A 2I4IA 1S0UA 4PSVA 3U6BA 4KCGA 4YMTA 4TMVA 4B74A 1G9XA 1G5RA 1KI4A 1U8AA 5EXXA 4MUAA 2A5YB 1PV4A 1TVCA 5EP4A 5KSYA 4PPNA 1MH1A 3MCAA 3CO5A 4L5BA 3QKRB 2OCAA 2FFBA 3I72A 5BW8A 3I5YA 3KKPA 1G8PA 4LC0A 3A4MA 3ICQB 4JSYA 4OK5A 4B33A 4ZGNB 1Z6GA 2CHQA 2GBLC 5AJZA 3VQTA 1R0WA 1NF3A 2DFLA 3CLVA 2EU8A 1YITB 3KKOA 1AM4D 5JEEA 5F9HA 2ODBA 5CM8B 2ZYTX 1CJKC 5EXPA 4B2LA 4MH0R 3W5HA 1KI8A 4MRNA 3U60B 2GA8A 3QJYA 3RC3A 2D7DA 1Z08A 4MKGA 3ZJYA 3CRW1 4XSHA 5EMNA 3SE0A 3P4XA 3CRZA 3KUDA 4MRVA 2P6UA 2WOOA 4LHXA 4C0SA 3SC3A 4CT5A 1VIAA 1G16A 2VF7A 2Q3FA 3RLFA 1IM2A 2C8VA 4QRHA 1I4TD 2HT6A 2V4ZA 2NO9A 3QF7A 3O8CA 3CF2A 1E3MA 5J5CA 4P33A 3AF3A 2WWWA 4MRPA 2BGIA 5C4MA 2CL6X 1XTIA 4HE6A 1QRAA 3FMIA 5FPTA 1SVKA 2CLSA 2OBNA 5L3RA 1CU1A 1W36C 2WMNB 1G7TA 1Q1BA 4L15A 1SVLA 4DCSA 3EZ9A 4K81B 2E9SA 1P4SA 5CLQA 3GLHE 4PC3A 2H8KA 2ODEA 2FSGA 4JLVA 2XOKD 1E32A 1E1QD 2UZIR 4G1UC 3TR5A 1MO5A 5DNYB 4GT1A 4A36A 3W90A 1TAGA 3LD9A 1YR8A 821PA 1NMXA 3C8UA 2QBYA 3FPAA 3T1TA 2GJAA 5BN3A 1A2BA 1OXUA 4HAUA 5J4KA 4WQMA 1OFUX 2OT3B 3ND8A 3PEWA 2V6IA 8OHMA 4Q7LA 2G6BA 3GMTA 4QBIA 2GPJA 1E2EA 4YHBA 2ANCA 1YZKA 2XSZA 4QM7A 4NCNA 1TUEA 3HU2A 1YZTA 4XVUA 3I4LA 4LUCA 4Q4LA 3U3RA 1AS0A 1M74A 2JDIA 3VMFA 2ZE6A 1NJGA 2FSIA 5GVRA 3I3SR 2C9CA 5IHPA 1MRNA 2VNHA 4WOPA 1PLKA 2FX3A 3BH7A 4E07A 4HI0E 1AS3A 4BE7B 2BVNA 3GCGA 5FOTA 1EFHA 4YQFA 2R6FA 1VG1A 3NBZC 5AUQA 2FFAA 2ZSEA 3K9HA 3R9WA 4NHOA 5AUNB 1W5SA 1HQYE 4MYUA 3BJIC 4Q5IA 4YDHB 2ZI6A 1ZM9A 3DHWC 1GL7A 1Z22A 5HCNA 2C9YA 3X2SA 1JAIA 4YXWD 2O8DA 2RGXA 2C04A 4M21A 4UNNA 3RS0A 5CITA 2F55A 1XNJA 4GMXA 2XX3A 4FMCF 1YE8A 2ZYWX 4L8GA 4CRWB 1G3MA 3PIRA 4QOSA 4AY2A 3LFUA 3NIBA 1X8LA 4GFDA 4XJXA 3WMFA 1MV5A 4A15A 1R5OA 5CYPA 3VTKA 5EXSA 1JI0A 4Q1DA 2QROA 1W7AA 2CK3A 2BF4A 1M2OB 5IDVA 3AVTA 1FL9A 3A1TA 3BORA 1VTKA 3I8XA 4ESVA 2ZAOA 2IYWA 3KXLA 2VYQA 1W2GA 3EC1A 2WJHA 3ZS8A 3P26A 1ZU5A 1AZTA 5CDFA 1W36B 4FN5A 1G17A 4CEIB 1DEKA 3QOFA 1P9WA 3JVUA 4DQLA 1Z0JA 1N5JA 2ZEJA 4Q4JA 3SJAA 5F98A 4M1MA 4IVRA 3K9LA 2VHJA 4E22A 4Z51A 2ODNA 5GV7A 1AGPA 1LF5A 2X8AA 3MRSA 4DT1A 2SHKA 1CRQA 1R5BA 4WIAA 5E7MA 1GO2A 1A1VA 1KTVA 4FCTA 4ZO4A 1TADA 4FMDB 1OB5A 5FI1B 5LBIA 3KUCA 1MO3A 2IHBA 3P27A 1OIVA 4AYTA 4X8MA 4HAVA 2BBWA 2GEVA 4EPTA 5DI3A 4M4SA 2CE2X 2CLCX 4PFSA 2XNDA 1XTSA 1KI7A 2KJQA 4LHVA 2OK7A 5AUPB 4KFUA 1UJ2A 1NMZA 1ZYUA 1VQ7B 1KAGA 1CJUC 2W2VA 3X1XA 3BAFA 3E1YE 1FZQA 2VRWA 3MJRA 2B7CA 4NYIQ 1JBKA 5KDOA 4RSGA 3UG7A 3C4JA 1DAIA 4LJ7A 4NE2A 5GJCA 1YJNB 2WSSD 1US8B 3W9YA 2YC4C 5B58C 1U2RA 4PANA 5TDHA 2YWEA 1WB9A 1CQXA 1ODFA 1NN3A 5TR9A 4WW0A 3RVBA 1Q3HA 4RKFA 3RDPA 3ZIAD 2WHXA 3UKDA 4IEIA 3T1VA 5FH9A 2V1UA 4KVAA 4TL7A 2Z6VA 4EPYA 4BQSA 3TRFA 3KKMA 1CEEA 2O0KA 3KXKA 4Z8YA 3GLIE 3CH4B 4MDFA 1UBEA 3GFPA 2CEAA 4QFMA 1N5KA 2IXEA 1DPFA 2PMDA 2QMUA 1IXRC 3ZZUA 1KJYA 2G88A 2QNRA 3FFBA 1E2FA 3EX7C 3H86A 4C2TA 3TK1A 2GEUA 2ZRAA 2XXAA 1W0JA 2IYUA 1WP9A 2O8FA 4YMUA 1S72B 1LS1A 3NC0C 1ZCBA 3GEHA 3TJZA 3A6PC 1X8JA 5FOXA 2QTFA 3SI7A 1XJ0A 1KYIA 2WMOB 2R6CA 4KITB 4IOKA 1CJMA 2JIZA 2GKSA 2FA9A 1E96A 4LJYA 2WV9A 2V7QA 3DOEA 3OJWA 5C4GB 1XJQA 3G4SB 1XZQA 3W34A 1BS1A 4D80A 2CJWA 3CCSB 2PCLA 1HE1C 4PAOA 1W4CA 1SVOA 3R20A 1PZNA 1KSHA 4JT2A 3D3QA 2V54A 1E2JA 3OIYA 4TQAA 5AR1A 2OSBA 3NDPA 4P32A 2R6AA 4ZIRB 4XH9B 1N3BA 3WY9A 4R71A 4D6PA 2YV5A 3B8HA 4DLYA 3HR8A 1P61B 2VL7A 5H59A 1FOEB 2GXUA 2GZDA 3PXGA 1Z63A 5BQ5A 1E0KA 4BEBA 3Q9LA 3R9IA 3N5CA 3RAPR 5JI2E 3U4QA 1PLJA 3O8DA 4BRWA 5L3SB 1Q1EA 5JSZB 2ZU6A 3H4MA 1PJRA 2IHYA 3TW8B 4I4LA 1VQ6B 4IW3B 2XNCA 2H92A 4QKQA 1NP6A 2WOJA 1OH8A 3QNUA 5DGXA 2GTPA 2HJVA 2QT1A 3DMDA 2FOLA 1DG3A 4OQNA 2OV2A 3LNCA 1D9ZA 4P3YA 1P62B 2PL3A 4EH1A 5JMTA 2A5JA 4Q03A 4LGMA 5KSPA 2HF8A 3MD0A 1E64A 2KSQA 2IYZA 4QGAA 2FZLA 1Q7YD 1J70A 3QIAA 4JZKA 5CLLA 3EIQA 1NVWQ 1Y63A 2JJ2A 1KJWA 2ZVQX 2ZRCA 4M1TA 2ZI5A 3WHKA 4A4DA 1IONA 5LDDC 3AVPA 3PUWA 1VQPB 1G3UA 4QXAA 2RC6A 1X3SA 4JJKA 3LO8A 5AJYA 2ZYUX 1OYWA 1QVAA 5DH9A 3ADBA 1NJFA 2NOAA 2WWHA 3THXA 2A78A 3QKUA 4G5QA 4TLDA 2D7CA 2JCSA 5GJBA 1G4AE 2BWJA 2A5GA 3UMRA 1Q20A 5H70A 4WXRA 3U61B 1W2BB 3JQQA 5KU1A 1D1NA 1CNEA 4C43A 3WXMA 4IDNA 3ETLA 4U02A 1XXHE 2DFKB 3W3ZB 1NIJA 1E2QA 1FQJA 3Q5DA 3SBEA 1Q57A 3TVTA 2DFNA 1GG2A 4JBWA 3KQLA 4B43A 4KV9A 1WE2A 4XOIA 1Q22A 2PT7A 4F4IA 5H8WA 4AIIA 2IYYA 1JJVA 2GCOA 2ZSBA 5AN9A 2C96A 1LFDB 4UNSA 2GNOA 3RWOA 3IIKA 3K09A 4QHSA 1GOTA 1F48A 3RHFA 2DHRA 2RH5A 2WWIA 2QQEA 3SJZA 5CYOA 5CB8A 2VNJA 121PA 1DAEA 1RPZA 1IXZA 3PQCA 5F3WB 2O8BB 1XEXA 1M7HA 3CB4A 4IVPA 3ADKA 1QUEA 3CZPA 5HZHA 3PCRB 3UMFA 4G3XA 5DYGA 2EYUA 3VFDA 3EZ2A 4G1VA 5EP1A 1FNDA 1HV8A 1QHGA 2YYZA 3QSYA 3CCLB 2A5FA 1E2DA 1IOZA 3ZVLA 4W7SA 1Z07A 2JASA 4JL6A 1NKSA 3T35A 4DVGA 3A8TA 2QMEA 5JWOA 3CNLA 2XSZD 4TLBA 3DO6A 4WVFA 4UNQA 2JDID 1DAGA 1FRNA 1KMQA 2BHRA 3G82C 4CYMA 2R6DA 3LLMA 1Q21A 1ZUNB 1Q12A 2DETA 1T3SA 1W5TA 4MKFA 5JFGA 2V3CC 2QGZA 1Z2CA 1N6IA 1QZXA 2IT1A 3FE2A 4W5JA 1J2JA 2RGNA 4RFVA 5D3QA 5H1YA 2RHDA 4PPQA 1JR6A 4E03A 4OYHA 4PQRA 4D0LB 3OZXA 3NBFA 2ZR0A 2QP3A 4JLAA 3VO1A 2C2HA 3KB2A 4DEYA 3N2IA 4PX9A 4B3GA 4HE5A 1G4UR 1W47A 2QY9A 3M0EA 4C7OB 1ZM3A 2OZEA 4A0FA 4HLCA 2FSFA 3CX8A 1UEIA 4OHVA 3Q8XB 4KBGA 3CX7A 3MWLA 2J46A 3AVQA 5JS7A 5CK4A 2FPLA 3FKSA 1P2SA 2QPOA 3GP8A 2CK3D 2D2EA 1P6XA 5KDLA 3IIMA 1Z47A 3NEYA 3Q85A 1E9CA 2AD5A 2PX0A 2ZRNA 1ZIPA 1MO4A 2QSZA 2YWGA 4KI0A 4Q7JB 1XFAA 3GLIA 1J9ZA 4NU0A 2BOVA 3CH5A 3QY0A 2JLXA 1FDRA 1N5IA 1T5LA 3W8NA 3JQPA 3VR2A 2JGNA 1H8EA 4JKIA 3NWJA 3TUIC 5BN4A 2R8RA 1QHNA 1X8KA 5D3MB 4BLQA 1ZW6A 1Z2AA 3REGA 4P31A 1B23P 2CL0X 3B60A 2GAOA 4L9WA 3GEIA 4Q9IA 5J47A 4EIWA 2FEOA 4BEJA 2O0JA 2NO7A 4CEJA 1SKYB 1GWNA 3A1VA 5BWMA 2G0NA 4NL4H 1Z0KA 2N46A 1FRQA 1I2DA 2BC9A 1DAMA 2IUTA 4TQUS 4PSAA 3S1AA 4AKIA 1CR1A 5FTJA 1UMKA 2XNDD 4B3BA 3QUSA 1VQLB 1YZNA 2QM8A 2XTMA 1E4YA 2ZREA 3AP1A 4DSUA 4AKHA 4JLOA 2VNKA 2ZI7A 4PHTA 4RZUA 4C0AC 1SVIA 3J81k 4V0ME 4ERNA 1DTSA 2ZRPA 1HT2E 3U2QA 1BMFA 4M9ZA 1E2GA 1GNQA 1U9IC 2P0EA 2D2FA 3WHLA 2JA1A 4W9MC 1CJVC 2GXAA 2EQBA 4TYPA 3R7WB 3IGFA 2GF0A 2MSDB 4MGKR 2J1LA 1VQ5B 1OXVA 4P4UA 2TMKA 3E20A 2Z4RA 1N6KA 2ERXA 2VIIA 3EPHA 2R6HA 1OKKA 2E87A 3OAAD 3W8RA 5DE3A 3A1UA 5ANRB 4BFZA 5AJXA 1G1MA 2DWOA 5CM9C 1KY2A 4QG7A 1H42A 4B75A 1CP2A 1XTQA 2REBA 2F43B 2W0MA 3CC7B 4URZR 5FBQB 4YMWA 4TMXA 2FGJA 3VNUA 1JA0A 2ZITA 1W0JD 2XJ9A 3FMFA 4DLRA 3KQHA 4B2IA 3HWSA 1JEEA 1PVOA 1K73D 1WRBA 2D3WA 1OXXK 2V9PA 1PUIA 2QDXA 4I1VA 2JIZD 1D9XA 3BERA 3TIFA 2ZETA 2O8EA 3TSWA 4RCZA 4Y7CA 1W2HA 1G3RA 4LJ4A 1VQ8B 2V7QD 3CC4B 5P21A 4NMMA 2V8OA 4BLRA 2ZSFA 2JLRA 2Z5FA 4JLJA 1N6PA 2WSSA 4K46A 1DDGA 1I7PA 1ZM2A 4G5GA 1YJWB 1TMKA 5AJWA 4TLCA 2I3BA 5JWRA 1NG1A 1SGWA 3ZBTA 2H57A 4FI3C 4BPRA 1R6BX 1LB1B 4R98A 3TBKA 1GKYA 1VMAA 3TUJC 3W6OA 2FZ4A 4M1OA 4NH0A 4BFVA 3ZBUA 1KMHA 2QM7A 3T06B 1SULA 1VCOA 5TXGA 1SZPA 1P5ZB 3B78A 5FOVA 4A8JA 2QP4A 4B2PA 4IOLA 4EJSC 3TSOA 4A92A 4IDHA 1F60A 2VO1A 1VYVA 2BKEA 2ZRFA 4DLWA 1UAAA 5JJKA 3G6EB 1XXHA 4AKEA 2D74A 2WIBA 4URUR 2REOA 2CVHA 2VP9A 4V0OA 5EQTA 1N6HA 2WJVA 4C0BA 2BN4A 4B35A 2GVZC 4HUQB 3M4YA 1FTSA 4EPVA 1T3LA 1P72A 2DWQA 5JBQA 2PZEA 4JS0A 4LJ9A 4N1AA 1EFRA 3RRYA 3VR1A 3MG9A 3FPKA 2F7SA 1HH4A 1P60A 1QHHA 2ZAMA 1FNCA 3PENA 2EFEB 2ATVA 1F5NA 3GJ5A 1QHXA 1ZP6A 4TQ9A 3K70D 3NHBA 4N0DA 1LTQA 5EE3A 1G8HA 2F1JA 2GK6A 1U0HC 1JA1A 1I2MA 3QBTA 1VCIA 2ZTSA 3CR7A 3HU3A 1VQOB 1YJ9B 1G5TA 5FPHA 1SXJC 2RKOA 4NYMQ 3GLFB 3UIEA 3U5ZB 2JJ2D 1GP2A 1QVFB 2IYTA 4KYIB 2P5TB 4OKSA 4P4SB 5HTKA 1R7RA 5H68A 1QGYA 3NTUA 4XWKA 5J4YA 1ZIOA 1KI6A 1Q1QA 1F20A 3LVRE 4Q4HA 4ARZB 1RRGA 2AK2A 1OFTA 5FUYA 5B64A 5LB4A 4V0NA 4HZIA 4QGGA 5TARA 4GP6A 1DG1G 1II8B 1BKDR 4CEHA 2FE4A 2J7PA 3F3YA 3B2EA 2ZRDA 4FINA 1AGRA 1G3IA 2IF2A 2Q3HA 1MO6A 3TR0A 1IB0A 1S96A 4M22A 3RS5A 2ZUCA 1EXMA 3W5UA 4NONA 3T5DA 4ZCIA 2ORVA 4UNRA 1FNMA 4TT3D 1N8RD 1HA3A 2R44A 5GVSA 1D6JA 1OT3A 2FG5A 1FUUA 1E62A 2A7QA 3G71B 2OG2A 4XTRA 4W5WA 1KOFA 2FMXA 5F2EA 4JIMA 3FHOA 4TMZA 4TSFA 2FWRA 1YJ5A 1UKVY 4JBXA 1Z29A 4EKDA 3QKRA 2ZS8A 4DSNA 3BB1A 3MLEA 1SHKA 1R0YA 3A4NA 3MUFA 4JLNA 5E95A 3H1TA 5K8UA 2GILA 3OFNA 4DDVA 1P2VA 4LBZA 2DCUA 4EJSB 3BK7A 1GRQA 1U8ZA 4JVSB 2HYDA 3AM1A 3RANA 4Q4AA 5J4LA 1UF9A 4LYAA 4QC2A 4OJQA 1J8MF 2YOFA 2XB4A 1K9MD 1E63A 3I61A 1ZNZA 5G41A 4N3GA 1E9RA 1UKEA 2ZJYA 3BOSA 1R10A 4UJ5A 4LJ5A 3BC1A 3C41J 1T5IA 4TWZA 3OEHD 2B5OA 4US0R 2DBYA 1CXZA 2RAPA 4U9UA 3A4LA 5EXTA 2W2TA 2QQ0A 2NMVA 3T5GA 4E09A 2WAXA 4F7WA 2NPFA 2CDNA 1FX0B 1G20E 1ZJ6A 4GPTA 4LJ8A 2HYIC 1D2EA 1EGAA 2OO7A 4A0HA 1HUQA 2GJKA 1DS6A 4ASUA 2LKCA 5TVKA 5KOYA 1Q82D 3B85A 1SVWA 2Q6TA 4PC7A 2ZRIA 3B9QA 3LRPA 3QFSA 2QEXB 1SXJB 3PV0A 5B30A 4KSCA 5L3VA 1G8GA 1KI9A 1VDZA 3VHLB 3CRVA 4A82A 4NCHA 5JCPA 5JHGB 4BZQA 1GM5A 1OHHD 1T4GA 3LBHA 1IJEA 3KB1A 4QGHA 2ZM5A 4TMKA 3BIFA 6Q21A 3THOA 3ZGXA 4V0MA 3VR5A 2AK3A 2ZI9A 4AI6A 4YONB 2GESA 4I1OA 2RC5A 4LY6A 4HYYA 4JLBA 3KJGA 3U44A 2AKYA 1KO7A 1F3OA 3ZZTA 1YZUA 2JLSA 1LW7A 3Q7PA 2IUSA 3FKSD 5FTMA 2B92A 1UADA 1GL6A 1BX1A 1E0SA 4Q9KA 1XJCA 4MYCA 2AFIE 4QL3A 4RY2A 1P7CA 1P73A 4HEJA 4KFSA 3SYKA 3ZQ6A 2PZGA 4NYIR 1R8QA 3U3KA 1F2UA 2HJGA 2X2FA 2GHIA 4LCBA 3K0FB 1VQMB 3IEUA 4EPRA 1HE8B 4UXHA 4B6EA 1H8ED 3KFXA 4M1WA 1II0A 2ORWA 1YR7A 4MQBA 1IN5A 2J0QA 2ZE8A 4R9UC 4C0KA 2OTLB 5EZ5A 4HUTA 1TLLA 3ES9A 3AB3A 3K8YA 3QG5A 3THWB 4XTCS 1N6RA 1GVHA 5FBWB 1G41A 2PX3A 2Q9BA 3LDAA 3B1ZA 4XWOA 2F1RA 1RFLA 1P9RA 2BPOA 3RYTC 5FBVB 3SYNA 1VYUA 3CMEB 4HB3A 3W6PA 4PZYA 3AF0A 2J0UA 1OLOA 4CT4B 2H18A 4PO1A 2FDCA 3EARA 1EESA 4KXFB 2QAJA 2EYQA 2ZRBA 1CLUA 5F9FA 2Q0HA 2ZJ5A 4MYTA 4EDHA 1RRFA 3A37A 3KZ1E 3OE7A 2IUUA 5KO2A 2GJSA 1BMFD 3FMPB 3QKSB 3QQ5A 4MGZR 3CCQB 4NCKA 4IHQA 1CIPA 2XAUA 3LBIA 1KC8D 3IQXA 3REFA 3NEJA 2VP2A 3KTAA 2AN9A 3VO2A 5IK2A 1AJEA 3AKDA 3DPUA 3LV8A 1F2TA 1OF1A 2OFOA 4D26A 1KDPA 4KLNA 4BFYA 2UKDA 1XTRA 3H2YA 2VPPA 3T15A 1T3HA 3I32A 3I56B 1VYTA 2IEZA 1OKKD 5E3HA 2YKGA 2BDTA 1ZCAA 2CCKA 2XEXA 4O0MA 4GSYA 1V5WA 3TE6A 3WBJA 1YKSA 2X2EA 1RE0A 4FXPA 1DAFA 3NBXX 3MSXA 4AF7A 2QT0A 3O8BA 4FD2A 2YINC 1DELA 2ZJAA 4KJZA 4NYJQ 2EFHB 2OFWA 1CR4A 2V6JA 4GDFA 2AFHE 1TQ4A 2R65A 2ERYA 4QM6A 3FFAA 5HE8A 2HEIA 2B8WA 2VP5A 1FNBA 1E4VA 3AP2A 4OQFA 3U3MA 2P6RA 1W48A 3ZQJA 3WP1B 4YAOA 1BQEA 2H17A 4G5OA 4G5SA 4KO8A 4RD1A 1NY5A 5C1BA 4DJTA 3FMOB 4L9SA 4NCJA 1Z6AA 1XD8A 2RGBA 3A58B 4LDJA 1XTKA 4DCNA 2UZ3A 5FUVA 5FL7D 1TEVA 1US8A 4C9BA 5DI3B 4B73A 3PUXA 1CR2A 2L0XA 1X1SA 4EPWA 1T0JB 1RYHA 2RGCA 1E2KA 1XCGB 1VKJA 1JR3E 4QNMA 3OEEA 3OAAA 4ILEA 1IQPA 2OAP1 3PEYA 4A2QA 1VCMA 3UATA 5J4HA 2ZUDA 4RD2A 3I55B 3IPYA 3SQXA 5HXBA 4LYFA 1Z5ZA 2KE5A 421PA 1KK3A 4Q18A 1OYYA 3I8SA 4N3NA 1N2CE 1XBTA 2IS4A 4H1UA 3ADCA 3K70C 5BN5A 3K0AB 3GLGB 3D7MA 2ZS7A 4RD3A 4UAJA 1H8HA 2GVDC 3QENA 2XNSA 1EFRD 2OCYC 1GL9B 4FMDF 4LJ6A 2F9MA 3AUXA 2I1VB 3GJ0A 2HF9A 4BRUA 3L0PA 1JJ2B 2BMFA 3W2IA 4NPHA 4TL8A 1S2MA 3QPUA 1I4DD 3LX8A 3ZYCA 1NG9A 4Q1FA 4DUGD 3EPKA 1QH0A 5JWHA 3JQRA 1OW3B 4RFSA 4DEXA 3GJ4A 3QBVA 2FSHA 3O47A 3BGWA 3PITA 5DN6A 3THYB 4BASA 2ZIAA 1KO4A 3DMNA 4ZPXA 1GVNB 4Y0VA 4ZIRA 4ACBA 3O8RA 1JB9A 2YC2C 4HLUA 2X1VA 3PJRA 1P2TA 1TF7A 2ZJOA 4LV6A 1ZRHA 2CJWB 2IA5A 4KFRA 1ZC4A 1OJLA 3OW2B 1FP7A 1KDTA 1E79A 1KI3A 1OIWA 3PUYA 1OGJA 5FR2A 1IXSB 5JJIA 4AF6A 2J7PD 3QE0A 2HUPA 1P3JA 1R5NA 2QPAA 3AP3A 4G0NA 3LQRA 4Q01A 3V76A 5L3SA 2WKRA 3GJXC 4PHFA 1Z28A 2GCPA 1L4YA 5GV8A 1RVDA 1AS2A 2XNJA 3NG1A 5FA6A 3JZMA 3SFZA 1ZC3A 2JJ1A 3QF4B 5K8IA 1KDRA 4XSGA 4HB0A 4S2EA 3I73A 1X6VA 3SHWA 4HAZA 1QUFA 3AGPA 3D6TB 1E1RA 2HXYA 3U4QB 1HEIA 2PMKA 1K8AD 3EZ7A 4YALA 3PVSA 4TSFD 2ORIA 4A9AA 4LX0A 4M1KA 1VQ4B 3CC2B 4Y9UA 1JECA 1G6HA 2NG1A 2OFXA 3C7KA 1SVMA 4JVNA 3UANA 4HDQB 4US2R 3HP1A 2OBMA 2QE7A 2VLIA 1DO0A 1KZ7B 1RJ9B 3OFND 5CK5A 3NH9A 4L4UA 5EUMA 1TU3A 2JAQA 1S1MA 3VU9B 1LS6A 2F1IA 5E7IA 1TTTA 3TQFA 1WMSA 1Z06A 4B71A 4OQLA 3GLHB 5UKDA 2BBTA 2BGJA 3IIJA 3B9PA 2WJGA 5DLQC 3KKQA 2E1RA 1LVGA 3K70B 5L3QB 3V9PA 1Q44A 4Q66C 3LO5A 1R4AA 4LHZA 1XE1A 1Z6XA 1Z83A 2MSCB 4QBHA 3CWZA 1DBSA 4DLXA 4O3MA 4MITA 3WNBA 3CWQA 2LWIA 2EW1A 3VHXA 4X8OA 2RGNC 4PQFA 5GJVC 2DB3A 4LOAA 1OH5A 2GETA 4DHEA 4FK8A 4TT3A 4IXMA 1DOAA 3HYRA 3LLUA 4KHZA 4BFWA 2W6IA 4WZ6A 1DARA 3BD9A 4KBFA 2GWHA 3T1QA 4R7ZA 3W5VA 5FOSA 2YOGA 4ASUD 3U7GA 1YIJB 3THXB 4B6FA 4HZUA 4F91B 4UKDA 1E2LA 2G0TA 3R8CA 1UFQA 3LBNA 5KTYA 3HR7A 1ZUIA 2GZAA 4A0GA 4PO9A 1VG8A 2PJRA 1VHTA 4XVRA 2RGAA 4YMVA 4OI0A 1XTJA 2FU5C 4F93B 2ZANA 3V4FA 1C4OA 4Z1MA 5BXQC 2Z83A 2O8BA 1CULC 1LF0A 3AF4A 1K8RA 3BE4A 3KJHA 2CNWA 1QF9A 4O2RA 4PZLA 2GAAA 3QFRA 1K5GA 5M04A 1KZGB 3UMSA 2GCOB 1KI2A 2ZRJA 2F6RA 1NVXQ 3W6NA 3GJ8A 1XWIA 5CB6A 2ZJZA 3SN6A 4G1BA 1W35A 4QBGB 1Q86D 4UXIA 3OEHA 4PO8A 1XEXB 2OCPA 1B0UA 4CVNA 4BLTA 3DVLA 2GZHA 5C2JB 5LB2A 4MDEA 4PAQA 3LXXA 4D2IA 4CIDA 4DBLC 2RCNA 2VZLA 3M6AA 3EPLA 1RRPA 2H7VA 4ZI3A 5KPJA 5DO9A 4TYWA 1ZNWA 3C5HA 1BJKA 3NDBB 4DWJA 3VKHA 3CF0A 4AG5A 2CHGA 2W83A 1TQ6A 4GNKA 2HLDA 2IBMA 4DQKA 1OHHA 1E9AA 4U00A 2DFTA 3FB4A 2QGNA 3L82B 1N6LA 1OFIA 3AVOA 1AIPA 4C7OA 1E2HA 2BM1A 2VSFA 1KNQA 3UPUA 3TSZA 1COWD 4QGFA 2VHTA 2OK8A 2VP0A 5EP3A 3IPXA 3OE7D 1UPTA 1A82A 1RRCA 2QMOA 4B3FX 1UDWA 2PEZA 5HZKA 3HU1A 3TAUA 1T91A 1QGZA 2O8CB 3CD6B 2WKPA 1SM4A 1JR3A 1DDIA 3G5UA 1GUAA 4OI4A 3SR0A 4EQ6B 5IK2D 1NSTA 1GFIA 3BH6A 3FHCB 4Q1EA 1OH6A 3SDZA 1AKEA 3RC8A 2J7KA 3BFKA 5CJPA 2ANBA 2CCGA 2J5XA 1W36D 1DAHA 2H1LA 2J0VA 2JLQA 4PHGA 1HQCA 4ABYA 2PLRA 2VEDA 4L16A 3SOPA 5D3MA 1XP8A 3CPJB 2VNIA 1FMLA 3AEZA 3GQBA 4KYUA 4KFTA 3U7FB 2YWFA 1MKYA 1S1CA 1OXSC 3GLIB 4MUBA 3CNOA 2QAGA 1BX0A 4B3CA 2PH1A 1C9KA 1M90D 2NGRA 3L8YA 5JLJA 2V1XA 2G9NA 3CR8A 1WDTA 4U7DA 4PC6A 1RW4A 3PUZA 3EG5A 3PFIA 1XD9A 4AYWA 1X1RA 1YI2B 1Z6TA 1ZNYA 5CIWA 5E7JA 4C0HA 1D2MA 3TNFA 2JLWA 1E9EA 4LSGA 1KAOA 5TV2A 2P3SA 2BCGY 2XB2A 4XIGS 3PUVA 3BWDD 4RJLA 1EK0A 4ON9A 4PGOA 5KNCA 4HAXA 3GPLA 1JAHA 2BMDA 3IILA 2ATXA 4BZPA 3QKTA 2QTZA 3TMKA 5C18A 3FHTA 3C15C 3QPWA 2P5SA 2AR7A 3QFTA 4M53A 4B44A 1PLLA 3K9GA 3MAAC 4D4LA 1N25A 2RMKA 1OGIA 3SBDA 2PZFA 4JL5A 3CPHA 4LJAA 1WBBA 1M1YE 3OEED 1RC8A 3ZDQA 1FPMA 3E70C 4Q47A 2J41A 3AVVA 4NYMR 2IF0A 4MA4A 1FFHA 2DERA 4PPFA 1M1KD 1XMIA 4TYQA 1N0WA 3WMGA 3EZ6A 3B5JA 4JLMA 1GRRA 3LWNA 3AGQA 1I4LD 2HXSA 2A30A 2D4HA 1F6BA 1U0JA 1QHYA 1XD2A 3LQQA 1T0HB 1ZUHA 1WQ1R 2F43A 2J59A 5THXA 2FFHA 4WZBE 3KDSE 4ZKEA 1VG0B 4U5XA 4I1SA 2PJZA 4Q9HA 1EFTA 1U0LA 1H8HD 4TTPA 1NI3A 1NLZA 4Q7MB 1G8YA 4DDUA 4QJ3A 4C2UA 5IRCD 1N5LA 2XZPA 2ZPTX 3AF1A 3H84A 2B6HA 4LBYA 2VHQA 4EUNA 1VQ9B 2WWGA 1JQJC 4Q00A 2ZVPX 1JEDA 2ZR7A 5C46F 4G5RA 1RZ3A 2X3UA 4UJ3A 5FL7A 4Z54A 3TUZC 2ZRGA 4X8HA 3OZVA 2IYXA 3ASYA 4MGIR 1JPJA 2A9KA 2BEKA 2QA4B 4HATA 3CW2A 5HE9A 4TTQA 2X77A 5KSWB 2F1HA 5DN6D 4TYYA 3ONWA 2IXGA 2IS2A 3NH6A 2O8EB 1XZPA 5A4JA 1ZM7A 4HDOB 4EFMA 1WF3A 4BPBA 3ZZ0A 2GK7A 3K0EA 1NVVQ 3CRRA 3ECCA 1NLFA 4E5UA 3CNNA 1GITA 2QTVB 3IO5A 4DB4A 4Q9LA 1G7SA 1E79D 2FPKA 2QL6A 1MABA 4DC9A 1RYFA 1ZD9A 3UXMA 4AWXA 4B48A 2EWVA 5B2ZA 1O3YA 2YOHA 2ZI3A 2ZROA 1WA5A 1L4UA 4Q1AA 2VP6A 3CMAB 2ZSDA 1T6NA 4IDPA 3VX4A 4TZ6A 2AXNA 3DKPA 4Q9JA 2CVFA 1A4RA 2BKUA 4ZCLA 4HSEA 2JJ1D 3I62A 4NKRA 4FWIB 2GXQA 3RRZA 5JJLA 1VECA 1ZVQA 2OESA 1E1RD 4IDOA 1Z0AA 2ZRMA 1XXHB 1QX4A 4ZGQB 3TH5A 1D8TA 1LV7A 4KAXA 1QFYA 1KK1A 3FJOA 4V0LA 2KBFA 2V55B 2J87A 1KNXA 1WCV1 3RSLA 1KHTA 1GRNA 4DUGA 1N6OA 4A0RA 1KKMA 2QE7D 1W87A 2BV3A 1M7BA 3IBYA 3LH5A 1O87A 4WBSA 2C9OA 1KSGA 3SYLA 3EA5A 1Z8FA 2WICA 4DCUA 1Z6YA 3MFYA 3QVUA 3GLFA 1A7JA 1MR3F 4P4SA 1W4RA 3OESA 5CJ2A 4C0QC 2CNDA 4DSTA 1TQ2A 2QTLA 1J7KA 3C5CA 2PBRA 3I5XA 3L8ZA 3CX6A 4A6XA 2CL7X 3M1IA 3ZVNA 1II8A 3FYHA 1E9FA 2QN6A 3ZLJA 4RVCA 4AURA 1P75A 3N70A 4ITRC 2ZE5A 3MWYW 4B76A 1KSFX 1NDHA 3LX5A 3VR6A 4BWYA 5KPDA 1GNPA 2ZU0C 4Q4HB 621PA 1TF2A 4POAA 3W3AA 5FUXA 1BO6A 1NBME 2PLFA 2W6ID 5HCIA 3E5HA 4GBMA 2YWHA 1GIAA 2BMEA 1E9BA 3ZH9B 3BS4A 2HCBA 2Z0MA 1N6NA 4GRAA 3AKEA 1W0KA 3C16C 3WRYC 5H5JA 3Q72A 3B1XA 3AH8A 3BRWD 1B2RA 1KI1A 3UWKA 4I99A 4ACAA 1TL7C 2N1BA 3DM5A 4P0TA 1GR1A 4KU4A 4J0QA 1XMVA 4TMTA 5TMPA 4Z1MD 1BIFA 4WA7A 2XZLA 3JZAA 3HPRA 1W34A 4IRUB 3K0CA 1MOZA 2AX4A 2O0HA 3SJCA 3ZD6A 2CNWD 2NZ8A 1NMYA 4EJSA 2PT5A 5DISB 3FTQA 2KB0A 5SZIA 3GD7A 1XRJA 4FWTA 4ZDIA 5JCZA 4FCWA 1XB2A 3ZVRA 4PC1A 2IWHA 3RS2A 2X19A 1NN0A 3EIEA 3F5FA 1FW6A 3MWJA 3SNHA 4V0KA 2DY1A 1AQUA 2IXFA 2ZJ8A 1R8SA 2O52A 2QP9X 3MJHA 3TLXA 1YU9A 2Z43A 3OZUA 5DI9A 1FUKA 5EUQB 1J8YF 3RABA 1NN1A 2KWIA 4Q4AB 1E98A 1ZAKA 1ZD8A 2HT1A 3IHLA 2W6JA 4TL6A 3D31A 4PAMA 5EP2A 1FX0A 3GJ3A 2ASEA 1CRPA
chains in the Genus database with same CATH superfamily
3SS8A 2C9DA 1PFQA 2ZRKA 3E7PA 5CVCA 4PSKA 2ACKA 1G66A 3L40A 3MWDA 4RMJA 4B8WA 3MXOA 3DAFA 3DZKA 1S3SA 3U3OA 3N3BC 2MSNA 1GGNA 3EAQA 1EEXB 2HLDD 3MQFA 5EKDA 2ZYSA 5KYNA 1ZR4A 3UAOA 1VE3A 5KC8A 1VZ2A 3IHWA 4A6DA 5KEIA 3FUUA 3HXMA 3GGSA 1IQRA 3OTIA 3R5TA 4JEUA 1JA9A 4BFTA 3NTQA 4BP3A 3IRVA 3LAWA 3RWMB 4XASA 2NP6A 2BYTA 2VH5R 2AOUA 1SVSA 4BMVA 3IP1A 4JVMA 3KL2A 4XI9A 4HGZA 3WR5A 4UXJA 2FW6A 5K03A 3G7NA 4HPXB 4LXQA 1KKUA 3T51B 4Z4ZA 1Z0FA 3K92A 4TLEA 3DGFC 1OYVA 3TNLA 2OUKA 1G0OA 4NZYA 3N6VA 4LYHA 4QPPA 1P4MA 3TIGA 4BV8A 5JISA 3GDWA 5H83A 5KHOC 3LX4A 4B0PA 2QIOA 1M1YA 4DNRB 3FLBA 3L5OA 3VZRA 2ZYHA 1UEJA 4ZYVA 3DLPX 3B2NA 1QK4A 1EM6A 4Q21A 1LH0A 2XT0A 1OOEA 3L79A 4JJZA 4EJ0A 3WADA 3EWIA 3U44B 1P8AA 2FJ0A 3K0FA 3MOIA 1I4EB 2EZUA 5TMEA 4DCTA 4YLGA 4I1RA 2NW6A 5AW4A 3KT8A 2ZB2A 1GYRA 1YVDA 3FHJA 1R0BA 3JYOA 1Z0IA 2AWNA 2E4ZA 3H3XA 2CB0A 2A8YA 2Q1WA 4MZDA 2EP8A 1QQ6A 3P5BA 1IJKA 1BE0A 3FGNA 4RIIA 3EEOA 1F2UB 4J9UE 4ZRMA 3TKLA 4Y9RA 1NV8A 4MEBA 5D85A 4PZDA 2VH1A 2PN1A 5JNLA 1IMOA 3N58A 2CHUA 1ZOOA 3O4RA 1IAQA 2PPLA 1EZ4A 2NPIA 1U5BB 4X61A 2RBEA 4EYKA 2QI9C 1ZXLA 2MWMA 3BL8A 4ZJPA 1H2YA 2QF7A 1JJ7A 2DECA 1K7SN 4KODA 4YRQA 3CZCA 3T7AA 4QICA 4GSLA 1E9VA 3T12A 2H3EA 3FOWA 4KWIA 4X71A 4ZKDA 4QDKA 3ZWBA 2NSYA 2HHLA 4BJ1A 4BQIA 3DP7A 4EMBA 3BSSA 4CGZA 4BB9A 3IP3A 5H4HA 1Y1QA 3UW1A 5BY2A 3V1NA 1AX9A 2ZB8A 2QTHA 4FSDA 1H4QA 2PS0A 5IMSA 1JJBA 1E18A 2D5IA 2RKWA 4JYBA 3KEGA 4BNZA 5A3RA 4F4CA 3ITKA 4AFNA 5INTA 1WORA 2UUCB 3CRMA 1O6CA 2CE7A 2VYVD 2OBTA 1OFUA 1EGVB 2JF0A 3HLTA 1P77A 5K6RA 2JI8A 1Q1GA 1XQBA 2BBOA 1UMCA 2GZMA 4BKPA 4D9IA 1O6ZA 5FHRA 3PA6A 1RSZA 5J43A 1NNUA 3T1OA 4JJIA 3QW4B 4JFRA 1XQYA 3R3ZA 2ZJBA 3LLCA 3ENWA 4M9UA 1HEYA 2MMGA 3MCTA 4KIGA 2NU6A 4GPIB 1XF1A 4XX0A 5C32A 3H0EA 2NTYC 3OLWA 2ZZNA 1NGSA 4FFNA 4FMBB 1YRAA 2D5CA 3KPUA 4KDRA 3WISA 5KQSA 5IYPA 1BWQA 4DSZA 4KR9A 1TQDA 1Y80A 3NHMA 5FO1A 1VQKB 4BDTA 1TAUA 1EFCA 1BXRA 3TLYA 1KH2A 2O57A 1NMSA 4OJKA 4XVCA 1FTNA 4QVGA 4Q4JB 3MWFA 3W2EA 4IMJB 4JYCA 4KBYA 3E4CA 5C8DA 3AF6A 1N06A 1UPUA 3Q15C 2VYFA 4GLLA 4JT4A 5LP6F 3BB4A 1EGHA 1T5TA 4DAOA 2WSYB 3VI3B 3WLIA 1W1WA 2ID9A 1KOLA 2VXOA 4MI1A 1HC7A 1A71A 4R01A 3SDSA 1PDVA 5HXAA 2BM0A 1G5PA 1NW3A 2VDNB 5KWEA 3FCEA 1KQSB 4WK2B 3ZK8A 3LMKA 2IDKA 5LMNB 3W5JA 2VJYA 2D06A 4KN5A 1NI4B 1N34B 3FMGA 2P3MA 3IQGX 1KO5A 1KC3A 1YS6A 3RTEA 4DDKA 1R0XA 3DB1A 3M2TA 4JOCA 3L0SA 3OSUA 2HNAA 2MT9A 3EBOA 1XLTA 1DBWA 1E3IA 2QNBA 1JFFB 2PZ8A 4HXGA 2OSVA 3BZWA 1PSWA 2WJJA 4AQYB 2WIAA 3ZI0A 1WPGA 1E6EA 3OFSA 4KVGA 3T9BA 4PHCA 1KJZA 2QS9A 3G5MA 1QHIA 3ISJA 1QSGA 2CXXA 3FETA 4M8NE 4R2JA 4EY8A 1HURA 2FOXA 3C48A 1XDSA 4PR0A 1XEFA 2ES4A 3CS3A 3SZRA 3FPHA 3EIHA 4BO6A 4TYNA 3TM4A 5EZ6B 2JEZA 3RT9A 3OPMA 2JD0A 3UAXA 3HVJA 4OA8A 4CM3A 5DNUA 2FGKA 1KPHA 3TDMA 2O2HA 2JLVA 1VFPA 2P90A 1JB1A 2OBLA 4P80A 5JU6A 1C9JA 1FTYA 1II9A 2JATA 3EOZA 5CEFA 5JS6A 2XCIA 3EXHC 5TJHA 3ZHOA 4M86A 3F78A 3ORHA 3TQIA 1YE3A 2VSOA 4WADA 5T8KA 1EX7A 2OHFA 2JAUA 2MDTA 5B2EA 4V0SA 4ZZ1A 3WYAA 1KMCA 3CCMB 3CPWB 2G77B 3TFQA 3BT7A 4QPNA 5JZ9A 1DAPA 1U65A 2DQYA 3ZCTA 4F46A 4CETA 3I1FA 3IR5A 5DGCA 4AUMA 1EFPB 2Y66A 3WJ2A 4GWKA 1KSJA 4QWMA 4C4SA 5H7XA 4BVHA 3KV1A 1ORTA 2EGUA 3B2QA 4FDLA 1EP2B 4ZZ3A 5LP1A 3CG4A 3DE7X 1Q1NA 3SHFA 2CBGA 4I1PA 4MKIA 1CB7A 2X7XA 2WTUA 3OZWA 1CHNA 4AG6A 4OD0A 4IDQA 4LNUB 4JENA 2BGMA 2RH4A 1TUIA 1BOFA 1C8VB 3EXG2 3U5TA 3C98A 5CLHA 2F55A 1N2HA 4HDRB 3W2HA 1NYLA 3L77A 1U8CB 2WF8A 1YBFA 4X7RA 5HQJA 3AHJA 4CM8A 4YRJA 3RVJA 4I14A 1EK5A 4PXSA 1FU4A 4JDUA 3JYPA 4ZZIA 1QGUB 3ZWYA 1JEYB 3PYMA 4QOIA 1QG2A 1H2ZA 2A57A 2QMHA 3HP4A 4DLNA 4ESHA 1KEKA 2NU8B 4YC7A 1PNQA 4AX4A 1H1LB 1Y3DE 3ZLBA 3AW8A 5E8RA 4W1QA 4MVJD 4LXXA 4CWAA 4CE6A 4DSOA 1RWQA 1JKJA 3ZY3A 4EK9A 1D7OA 2R4TA 2ZS9A 1UP6A 4ALIA 2VYCA 4HX2A 1B8NA 1KGDA 1ULUA 3R3YA 3OQ6A 2XQIA 2UYQA 5ELLA 2DRIA 4URYR 2AZTA 1V7QA 3KYDA 3QYJA 2WWYA 3DLHA 2ZB7A 3OG9A 3SP1A 1FF9A 1QG6A 3OPVA 4IFBA 1CG6A 1RJ9A 2CXTA 2GLUA 4NDNE 4Q1BA 4R2IA 1SKMA 4NIMA 2G3YA 1Z13A 5IF9A 4M54A 3H94A 2DMRA 1VKRA 2CXQA 2GPYA 2ILVA 1ILWA 3NV7A 4RPLA 1AQYA 4TV9B 1HNZB 1S4QA 1T35A 2G1JA 3GLHA 3HB5X 4MROA 3DHEA 4CM1A 3DF9A 1SHZA 1FP4A 3IUYA 2NACA 4CF6A 5A4FS 2ECKA 1RJEA 1JVSA 3EXHB 4JU9A 4UFOA 1HY3A 1WY7A 1YZLA 3G9UA 3A1CA 1T0IA 3KL4A 3LYAA 4M36A 4C7MA 1E3WB 1NBHA 3TTWA 1WSDA 3QEOA 1HGXA 5T4EA 1V4VA 1YD7A 4NI5A 4OL9A 3IBTA 1I3LA 4M1SA 3BWMA 4V02A 2WP0A 3IDQA 3KQQA 3L7NA 4EJFA 4H15A 4OYYA 3RM3A 1IBRA 5CDHA 3DV2A 4R68A 2WZQA 1B8UA 3N87A 3AJ9A 3E05A 4LA4A 4OQQA 3H5NA 4F2GA 2G8LA 5L95A 3S2FA 2BUCA 2VA8A 1I14A 3ESCA 5BV2P 4NDAA 1DAKA 3EF0A 3PNPA 4WASA 2IQ5A 1SXJD 5EPOA 4P9NA 1V0EA 1HMYA 1RLOA 2E4UA 3DP9A 3SE7A 3H6GA 1P1FA 3VBEA 4HRYA 4GLFA 4XCXA 1TPYA 2OAEA 2B1QA 2NX2A 4FW8A 1XAIA 2FE1A 4C01A 3HNPA 4C4YA 5JAOA 2WJ6A 2ZT7A 4D4MA 3Q3JB 4GUAA 1T36B 4ARCA 1GDDA 4IWNA 2VYND 1B3RA 1K4KA 5DMXA 2A67A 3R0QA 3UT5B 1DE0A 1AMUA 4HZUB 1XUOA 2VUHB 3N39C 5ALVA 3R1IA 1K5DA 1A4UA 2P8JA 2NO6A 3CPEA 3S99A 4O2BB 1B0PA 2XITA 2GQFA 4LHWA 4EZIA 1N0VC 1E9SA 2DKOA 1G18A 1F38A 2VTKA 3QMPA 3CCRB 2IIVA 3HCRA 4YJFA 3WO0A 4AK9A 3FHLA 2P27A 1DI0A 2OAQ1 1USWA 3F9RA 1WZIA 2AYZA 4NCIA 3SSMA 4BTEA 4XKJA 1V47A 1HDOA 3BSYA 3N9IA 3R9XA 1V6AA 1JLLB 2W11A 5DBFA 2QAGC 1T2DA 2XMZA 3C70A 2YMPA 2QVLA 4W6QA 2BT4A 4UU7A 3WIDA 4LF6B 1GDHA 1NUQA 4ZCMA 3AKYA 4CLXA 1JHUA 1R6VA 3H6HA 4GQBA 2R1ZA 1TT7A 2P5UA 4DA6A 5C7OO 4L50A 4U7GA 3EIUA 1DIHA 3G8BA 5EHNA 1SCNE 3A11A 3ACCA 3T6KA 3DNMA 3UK6A 3IAXA 1RCTE 5AOBA 3U4HA 1L7EA 2VS1A 2OE2A 2W93A 5BUCA 4JWTA 1WG8A 4YRNA 2B8TA 4IVQA 3IO3A 1MG0A 5A8AA 3IAHA 1DL5A 4L78A 3H9NA 1IHUA 2C2KA 3MOGA 1U81A 1NE7A 3BWVA 1QP4A 1Q83A 3C3CA 4OBXA 3N2EA 2C82A 3LI2A 2F59A 2VDLB 3ZJ4A 2B34A 5A04A 1ODLA 1YMQA 1Z88A 5HS6A 2IEDA 3ONNA 3ZCVA 4FW9A 3GIRA 1OE0A 2AFRA 2WJYA 3OJXA 3ZE1B 4DTIA 3HPQA 1O94C 3IOYA 3WBBA 2Z6QA 4C30A 4D25A 3HKDA 4IIEA 4PY2A 4XD7A 1CUWA 1G21A 4OPOA 1IJBA 3I1YA 3LXRA 5FPSA 4C7XA 1GNRA 5EIWA 3PQDA 3RS4A 2IH5A 4RCYA 2QRKA 3H2SA 3L7OA 4MJXA 3VXKA 1BEEA 2CDAA 1HZZA 2EFYA 1KJQA 2ZWIA 5AFSA 3FNQA 3OM8A 3PHGA 4EFLA 2OXRA 1GZUA 1UXOA 4JXXA 1R0ZA 5D7BA 3M89A 4IOJA 4LYYA 2QM0A 3D8BA 2FW9A 2LXNA 4CU2A 2Q4TA 3WGOA 2JKZA 4LC1A 4OA5A 4JJ4A 4BCBA 3RFUA 2HY7A 3AOEA 4RELA 4J49A 4IIJF 2AQKA 2XNKA 4GMDA 4QNRA 3VTAA 4ZDWA 2GLTA 2Q6OA 2JFOA 3ZGLA 4RBNA 4AZ3A 4GR9A 1NVVR 2FPUA 4FYJA 3IUEA 4FGJA 4X05A 2RGYA 4PAWA 5BUQA 3FFTA 2BY4A 3JR7A 1L5SA 5JSUA 3BJMA 1HDGO 4HN4B 1YDEA 2ZWMA 4X45A 1UBGA 1WSRA 1T15A 1UJ5A 4KTVE 5A5VA 5CD1A 1W44A 1ESMA 4E4TA 1WTCA 5CBPB 3EVEA 3NBYC 3SICE 4OXXA 1KZ9A 3V4RA 3RSSA 5BYAA 4MTLA 1GKUB 1J39A 3QW2A 4I81A 4A8JC 2QAGB 5JUWA 4LRTB 1XDBA 3PR2B 1JQLB 2OZLB 2CZGA 4F45A 5B57C 1PT9A 2DB3A 2QVZX 4L07A 1T5DX 3EC2A 3RR2A 3SYRA 2ISCA 5GAJA 2QXUA 2VDOB 3EWAA 3QU2A 4LYJA 3RK1A 3WMEA 4X41A 2BBSA 1L1QA 3A4IA 2IYQA 4TKVB 1CJBA 3L1JA 4G7WA 2FNAA 3DDCA 3I39X 3CH6A 1KAMA 2X85A 1C80A 4DDWA 3PTAA 1YH3A 3JQAD 2NTJA 4J75A 1IFXA 1XF9A 4FB5A 4N03A 5DW0A 3U4DA 3VDXA 3AB7A 3IEXA 5JPCA 2DEUA 5FWXA 3AV0B 4DW8A 4FDMA 3SS9X 4HWSA 4I5FA 3O3NB 3OECA 3AERB 3VJMA 3O8LA 9MHTA 2JZCA 4AWAA 1WNFA 2ID7A 5KTMA 1YRBA 2AIRA 4GEGA 5BQOA 3MMPA 3RSQA 1P4HA 4DWVA 3TZKA 1N0UA 2O20A 1TO2E 2OCBA 1A4XA 1EUCB 3KQOA 3RS7A 4BKUA 2Q5OA 5F3DA 1FSPA 5MGNA 4Z3DA 3L0OA 1M1NB 1XJWA 1TXGA 4HZGA 3VAAA 2PUHA 1WQ3A 2NP7A 5FLXA 3NR2A 2VUUA 2D54A 3MRXA 2AC2A 1CVIA 2LCFA 2WF5A 3SFVA 5IH7A 4OPSA 1AHNA 4OI1A 3O21A 2BP7B 1V8OA 4MV9A 3ONDA 5CM2Z 2VP4A 3K6KA 2PXHA 2DPXA 2VAWA 2R6GA 1BH6A 2Q9AA 1KYZA 2PUVA 3CONA 3ZC3A 4B31A 4RD6A 4C6TA 2XCTB 3QXHA 3F7MA 3L2OB 1I18A 4M7OA 4P7FA 4EI2A 3ANLA 5DP2A 4EX7A 1P1HA 3I5UA 1DXQA 1RPZA 2QUIA 3U1VA 10MHA 1BEZA 1CUZA 4ETMA 4RZHA 2J31A 4HLDA 4LPKA 5GIOE 3A1SA 5ESDA 3D7LA 3SC4A 4XWYA 4CN9A 5AM1A 4ZHQB 1IZYA 4JBYA 3FX2A 2R48A 1E2NA 2JG3A 4RULA 2X7HA 4K9NA 4Z0NA 4BVJA 4L8JA 4PG8A 1YHNA 2VXYA 3AI3A 1WSBA 3VH2A 2QTVA 5ELXA 1AY0A 2XR1A 1VHWA 3LW8A 4G25A 4MVXA 4W82A 3CUEF 2IY9A 1I4OA 2NVWA 1G42A 1TAQA 1W52X 3ZIAA 2A3RA 2PRZA 3AILA 3EPPA 3O2SB 3WDMA 1ZPDA 4II7A 1ZBDA 3EEBA 4PLHA 4DIFA 4G0ZA 2OP0A 4A8JB 5HJ7A 4PPYA 3TQCA 1MOSA 2G9RA 3T5BA 3JALB 4OFXA 2KW5A 4MW4A 2FPIA 1Y1TA 1T34A 2E1PA 1LLUA 2OCIA 3GZ4A 2ZZMA 3FOAA 5B7NA 1WQ4A 3QJGA 1J2RA 4O4IB 4GKBA 3EOAI 4RVFA 4GQAA 4AIRA 1YR9A 3JVVA 5D01A 2PO5A 1BZYA 4O1HA 1FFXA 4DDTA 5TLSA 4WTOA 1Z2NX 1CUFA 3CJQA 3OQ1A 4CF3A 4CUJA 1D04A 3I28A 1Y8AA 1KRHA 4JJFA 3SGLA 2EEPA 4BC0A 4QELA 3Q3VA 4HB4A 4MYDA 1MXHA 5DNEA 3O94A 1L5VA 2I2BA 1L8AA 3SHOA 3LQ4A 1Z39A 2H6EA 4IILA 2ORYA 5BR7A 1XZFA 4D9NA 4L3OA 5JCOA 3GCZA 4HX5A 2HKIA 2JHFA 2VQSA 3QOXA 1IQ0A 1XMXA 1XQ1A 2W4IA 3NXSA 1A9YA 2E4YA 3S2UA 3ZX5A 3JX9A 1C7EA 1K75A 1GG9A 1MT0A 2YX1A 3K2IA 3UJBA 3BGSA 1W85B 2KBEA 4X0CA 4FNMA 4ZRNA 3V2GA 1GG5A 1P2GA 3EHEA 2Q3EA 4XDHA 3B1WA 5DHPA 5EESA 4H16A 5KNBD 1KIAA 1ELOA 4MO2A 1GILA 4EFNA 3F8TA 1I30A 1JXOA 2WTBA 3ASRA 3VDRA 4BE4A 3UENA 4KR2A 2BMWA 1GGEA 3P0EA 4KDCA 3LF2A 3MTBA 1HT1E 1VIYA 1VE6A 1RIFA 3P52A 3FYCA 3HI4A 3P4YA 5A0FA 3ZNNA 4JQYA 5K0JA 5C4IA 4H9GA 3PD0A 9LDTA 1CR0A 1IIRA 1M66A 1UBCA 4CNQA 1E2BA 4DWWA 1IWBB 3VNSA 1BCRA 5JZSA 1W46A 2A4KA 2RHOA 3OLYA 4CEHB 2Z4TA 2G9VA 1SUWA 2A9RA 3JQBA 1UFRA 2ZYDA 4DRZA 1LWOA 2JK1A 5A2QA 2FN4A 2O1SA 4D82A 3U7EB 4PZCA 2I4IA 2FEKA 1NE2A 4TMVA 4B74A 2IKQA 2O06A 1FS4A 4XYEA 4REQA 4YMGA 2XH8A 1YB1A 1PV4A 4EVSA 2VXBA 3H1PA 4OVKA 5CXQA 4HH0A 5KSYA 2UYCA 4UHEA 4PPNA 1MH1A 1OQAA 3MCAA 1X14A 3N8NA 4LDAA 4KXYA 5CAEB 4L5BA 1XE3A 1P1CA 2P9EA 3RS9A 4FTWA 4UREA 5AI0A 1G8PA 3A4MA 4B6PA 4M0UA 2R00C 4JSYA 1HI9A 5FNVA 4X66B 1Z6GA 3VQTA 4JQOA 1JG7A 3KRTA 3MZ0A 4R8RA 1NF3A 3INRA 2QVYX 4YRIA 2EU8A 3H9JA 1LLCA 5DVZA 1NQOA 2GN0A 1V1JA 2ODBA 3V8QA 4L28A 4DS3A 1VP3A 4L8YA 5EXPA 1O9GA 3R8XA 4KMRA 3F2IA 4R3WA 4Y7DA 5BUSA 2GA8A 3QJYA 2L19A 1GCOA 4OOVA 3UN1A 2D7DA 3UO8B 1EQAA 5DNVA 4Z4RA 5CFMA 1MRZA 3V4VB 3T38A 1H0HA 1GKKA 5CCDA 1XGKA 4IRXA 3KUDA 3D3NA 2FDXA 2WOOA 4FDVA 1OBHA 3VI4B 4C0SA 4CR6A 3TZHA 1JHZA 1G16A 4RTOA 1ZGBA 4ER6A 1D1TA 1EH5A 2XCLA 4I1YA 2KQUA 1RABA 2NO9A 4K0RA 4U3JB 5HKOA 2OBSA 3WGIA 3QLTA 1V8BA 4JK3A 4P33A 2OVFA 2SECE 2YZGA 1PQYA 2CL6X 2QK4A 3SIWA 2SKDA 1IEQA 3FMIA 5J59A 3QIVA 1KR2A 5ARDA 1EEHA 1HK7A 1ZZGA 4JGIA 4D57A 3OWOA 1CUAA 3OWHA 2OC4A 1W36C 1I94B 1G7TA 1Q1BA 4XQ9A 1U8TA 3MQ2A 1V8DA 2ZZGA 4BMSA 1WHSB 3DZCA 2CF6A 5TGDA 3LHIA 4ZJUA 2H8KA 1NW4A 2ODEA 3D4IA 3O8OA 4JJGA 3TMYA 3U13A 2W2LA 1H6BA 2YW2A 3AEXA 4GP9A 2HMYB 3KLNA 1RM5A 3SF0A 1MO5A 1YA8A 3M6XA 4ZOQI 3N75A 1ZX1A 5E4JA 1JSLA 4F8YA 5DBGA 1TZMA 4P86A 2P35A 3PGKA 2R97A 4GAEA 5FNVF 1QOQB 5LBUA 1NMXA 3KOXA 3RF7A 2ZZQA 1SUCA 3A3OA 1OXUA 2Z08A 5EWJB 1JG3A 1RYDA 5JDIA 3HVRA 2J07A 2JAWA 4WQMA 2BEWA 4YUAA 2R25B 4P7KA 3WWCA 3KEMA 4DCPA 2YN4A 4HMOA 2X7JA 3PEWA 1C2YA 2NSJA 2RH8A 3RC2A 2G6BA 3BH4A 4F1JA 1YZKA 4BNHA 2HZBA 4NCNA 3IODA 3HU2A 1YZTA 3JVIA 3I4LA 3OCZA 4KGVA 1U2GA 2BGKA 3U3RA 1M74A 3DVAB 3ILSA 3VMFA 2ZE6A 4PFJA 1AZWA 2YDXA 3FTPA 3I3SR 3F71A 3M6VA 1NBOA 3VR2D 2PUAA 1ORWA 3MS2A 2Q41A 2HM7A 4BE7B 2BVNA 3PFCA 5K8VA 5CHEA 3ZDDA 4IG9A 1DUSA 1VG1A 2R6FA 3RYFB 3ZUPA 3NBZC 5DHRA 2QLMA 4NHOA 4ZOAA 2P3QA 1RFGE 1W5SA 1SIOA 4NJMB 1XC7A 3FFWA 2IXDA 2EKQA 5JFTA 4G4JA 2O4CA 1Z2OX 1HT0A 2Z98A 1RXIA 3JD1A 4J43A 1TYBE 4JUIA 4M21A 5CITA 4XKVA 1NYTA 2A6PA 1SCUA 2UVPB 4D3XA 3PKIA 1T8RA 2QQFA 5KYGA 1G3MA 3PDUA 3UQYS 4B7XA 4RIEA 3FOCA 3LFUA 4HLNA 3C3AA 1B00A 2CMFA 1BDJA 1JSRA 1VMEA 3GRFA 4A15A 4HH3C 3CLUD 3MXTA 2C9ZA 4KE9A 4RNCA 2DTEA 2QROA 4S1VA 3JTMA 3EN0A 1KFCB 4N9WA 3FI9A 1M2OB 1H0SA 4J7CA 1FL9A 3A1TA 1JDJA 3MUEA 1XQ9A 3NAMA 4LZNA 5DV9A 4DA9A 5L4SA 4ESVA 4Z53A 1FVHA 1Y9AA 2IYEA 3DO5A 1GA4A 1L8LA 2IYWA 4ZJYA 5I7OA 1W2GA 4MKXA 4B46A 1VKOA 1Z0SA 1QIDA 3UV7A 1XKLA 1C8KA 3P26A 4WXHA 5CTAA 1AZTA 1W36B 1G17A 4PS0A 5B1YA 4CEIB 3KUKA 1P9WA 3QOFA 4H6WA 3JVUA 2VPZA 3EUWA 4W63A 3RSGA 4DQLA 3ZY4A 2HA4A 3R5KA 4Q4JA 4UZEA 4QSHA 5A62A 5F98A 1S2NA 2G04A 4PLTA 3UM9A 1ZI8A 2VHJA 3IURA 2ODTX 4E22A 2O8VA 1G6Q1 2ODNA 4OP3A 4Z51A 2X8AA 1FLAA 3GBSA 3W3AH 3AHFA 4RWEA 5TSDA 4KQFA 3OX4A 4GGOA 1GO2A 4IKOA 4WIAA 1AK9A 4ZO4A 2FZKA 3LC1O 4XZ3A 3A3KA 5FI1B 5LBIA 3KUCA 3ZWDA 1RXVA 2VF2A 1E6WA 1H2AS 1C30B 2IHBA 1PJ4A 1UWLA 2J85A 3LZCA 3OZTA 4HK4A 4AYTA 1IHDA 4FR0A 4NU6A 4X8MA 1QTRA 4KQ9A 1NI4A 1OTYA 5DI3A 4NMLA 1VP9A 4MKZA 2XNDA 1XTSA 5KS2A 3T3MB 5ISMA 5AUPB 4LHVA 2OK7A 2IY7A 5HUHA 1SO8A 1I3KA 1NMZA 3UUWA 1VQ7B 4DUZB 4CIWA 1UP7A 1CJUC 4MWBA 5LM3A 1PFGA 1PEKE 3E1YE 1QS0B 2VRWA 3MJRA 4OHOA 3ABQB 4HV4A 1JBKA 2PSSA 3HSYA 3NHFA 3VTZA 4P36A 2HSJA 3LP6A 4RSGA 3UG7A 5KYXA 1JU3A 2WSSD 1N8KA 1U2RA 2F00A 4PANA 5TDHA 1WB9A 1CQXA 1ODFA 3TW0A 1Y6ZA 1NN3A 2GTIA 1KU6A 3U80A 4MRMA 3ZE0B 2CVZA 3QTTA 4F4FA 3T1VA 1E1NA 3OU6A 3EGCA 2PRYA 3EQ2A 2I2FA 4KVAA 4EPYA 5FH9A 4G0XA 1A76A 4PQEA 1DKRA 2QUHA 4PAAA 1A8QA 3ZGZA 1ECFA 2VXCA 1HE2A 4LTMA 2DKNA 3PHHA 3KKMA 1X80B 4P81A 3RASA 3KQHA 2O0KA 3DF7A 2RHRA 2Z2KA 3F7OA 4HN2A 3I45A 3RG8A 4GOLD 3BEOA 5ELMA 5KNDD 5L4NA 3GFPA 3H8VA 4HCJA 2PMDA 1KJYA 3RIEA 3UMVA 3RSCA 1T5HX 3H86A 3M49A 3K1YA 4NJEB 3TK1A 2GEUA 3EY9A 2JCYA 4X8IA 2Y1LA 1F4LA 1GTRA 2IYUA 5KIAA 1EFPA 5B6PA 2X53S 3CFYA 1S72B 3QH4A 5CFOA 3GN2A 1NVBA 4Y98A 1V16A 5AXDA 3A6PC 3TJZA 1IYZA 1NXSA 3ZE8A 4CL0A 1X8JA 3UMCA 1P2FA 5EKSA 4FMPA 2GBCA 2H9IA 1F1JA 1XJ0A 4WNAB 3SI7A 2WG0A 3NMUF 1U7ZA 3G1UA 1Y7LA 4DGQA 4TKZA 4IOKA 1CJMA 2C92A 2O3UA 3KQTA 4QTYA 4KITB 2FA9A 5HHTA 1Z5NA 1RM4A 2J6CA 3SDBA 4C6SA 4EG4A 3UJDA 1WXFA 2JPDA 3IAM6 2CWWA 4LNUA 1RYZA 1A9SA 3C3DA 1J0XO 4B4KA 1GQ2A 4HT3B 4Z49A 1XJQA 1N2IA 2X0RA 3AIOA 3BIWA 3W34A 2GAJA 4D80A 3SC2B 3NRJA 4X65B 4HDRA 2O5EA 2IXBA 3UFBA 2PR2A 3R20A 4PIVA 4ZAXA 5JO9A 1PZNA 4FX5A 2H51A 3BMNA 3P19A 4L27A 3UAWA 1XK6A 4RK4A 3TOZA 3IHTA 5AR1A 3GGPA 3Q3CA 3T3PB 2IOQA 5AXBA 4P32A 4DM7A 2R6AA 4KKXB 3WY9A 3A1DA 1OBVA 5K4HA 2V8BA 3H9GA 3HR8A 1FOEB 1YBHA 1MA0A 4IJWA 1HL7A 2NU8A 2NV4A 3JQGB 1E0KA 1H1LA 2GBIA 4F4HA 2ONCA 3Q6NA 3R0JA 2F1OA 3N0VA 5MN4A 3H2HA 2FLVA 2IFTA 2KLHA 2UZAA 4WINA 4C4TA 2Q9UA 2BRUC 2J6BA 2WZBA 4F11A 2YNMC 1PLJA 1YL5A 4UTRA 4QUBA 3H5WA 3KZCA 1I33A 4AY3A 1JSXA 4BRWA 3PQ2A 4CIAA 2O3RA 1O89A 2GM4A 1PJRA 3SKYA 1GT91 4YH1A 2WRZA 4D42A 4R7GA 1VQ6B 4RW0A 3ANYB 4CM7A 1PJAA 3M6IA 4D44A 2WOJA 2RK3A 2HEGA 5DGXA 1N3YA 1M8KA 4GBGA 4PVCA 2OV2A 2YVAA 1MQSA 5H16A 5IW8A 4EUEA 3KG2A 1TTQB 4Q03A 4QD3A 3GJRA 3I53A 4RQBA 5KSPA 5LMUB 4H6VA 1KE2A 3F1KA 3WLKX 2FOIA 1VSUA 5AI4A 1E64A 2XUJA 3EXHA 3JTEA 5C8ZA 1KMMA 2FZLA 1J70A 2PH5A 1SN7A 3QIAA 4FDAA 4JZKA 5AM5A 4B6JA 4QEZA 2RARA 3IQZA 3BD6A 4D6YA 2CVQA 3CUTA 1E3WA 3NPMA 3WHKA 4ITUA 4FUTA 4R8MA 5LDDC 3I9KA 5GIPE 4RTSA 2BZ1A 2GOYA 3HO8A 1PRYA 5C80A 3WJ7A 1PCXA 1KVRA 1V3QE 2Y1GA 2Y67A 4DR3B 2ZYUX 2C4UA 3L7MA 1IOVA 2GN1A 3PQ6A 5A3QA 2ZGVA 5ERXA 5MN5A 1KDZA 2NOAA 3TNDA 4LYDA 4TXNA 1Z45A 4ZOEA 4AJHA 4INAA 1G4AE 3PQ4A 1T1GA 3RG2A 5I8WA 2BWJA 4JMLA 3MMXA 3EUEA 2AV6A 1HDIA 4RC9A 4Y2TA 1BQ4A 1CNEA 4QTXA 3A0RB 1B6GA 4OUDB 2I62A 2DFKB 3SWWA 3VC2A 4P25A 2PX5A 1YBAA 3L6OO 1E2QA 4G89A 4EMTA 2EV9A 3TVTA 2I5PO 4FEGA 2R47A 1JPVA 2VDJA 3H2GA 5JARA 4XOIA 1Q22A 1UK6A 2PT7A 2AC4A 3UT5A 1J00A 5JANA 4CXMA 2HI0A 2XUKA 1JJVA 4K9KA 3TQHA 1JV2B 2VOEA 4AJ1A 1LFDB 4O2BA 4ZOBA 2GNOA 4PYQA 2HPAA 3CR3C 3UB4A 4ZYLA 4QHSA 2DBVO 1GOTA 3B1JA 4Y8VA 4QV2A 3RHFA 4CKCB 5CYOA 2VNJA 1IUOA 3Q8WA 3GUYA 4LGVA 4L5IA 3CLKA 2Z8XA 1M2VB 1KH1A 2CXRA 2H29A 3ADKA 3HBAA 4RNDB 1UODA 4TV9F 4W1RA 3R2JA 2E5LB 3RV3A 4G3XA 5CJJA 2HMVA 3WGUA 4JC8A 3OQHA 4R2XA 3VFDA 4LF8B 3MT7A 2FXVA 5CG1A 1Q0RA 1GQSA 1IM5A 4BNWA 4E14A 3DBRB 3NFYA 1R74A 3QSYA 5F7JA 1I3NA 4MW0A 4GKJB 5E1BA 2FRVA 1B16A 4CHTA 5E3IA 3AWDA 4W7SA 4ISCA 4KR6A 4JL6A 4DNFA 1P0PA 1GSOA 3SJPA 1RRKA 1WNTA 2XV1A 4HBGA 1C1DA 4QSMA 1HKUA 3WK4A 2XA9A 5ARBA 4IVNA 1FRFS 3FRJA 5JCJA 3A6ZA 3GLSA 4UM5A 4YCSA 2VJMB 1AXRA 2W6PA 1LK5A 3PXAA 4MMZB 5LQNA 4J1QA 1DAGA 1BOOA 1KMQA 3NBKA 4NLLA 4C07A 4CYMA 2R6DA 2H9YA 2IHZA 5ALZA 3T9EA 1CLEA 2XECA 3ZI7A 5BV1A 2P2ZA 3BFJA 2WUDA 5C7LO 2FQWA 5LWHA 3LFHA 5EIOA 4D9HA 1ZH6A 3DW3X 3MJVA 3HXTA 2ZBQA 5JFGA 4UDOA 5GMOA 5K6TA 1N6IA 4TQGA 3G5TA 5D3QA 3U4GA 1IXKA 2HPVA 5C8XA 3D0OA 2KLBA 1YI0A 4FN4A 3WB1A 2QGGA 4PQRA 3PBKA 5CFZA 3UCEA 1FUEA 4B17A 4GOOD 3NBUA 3CLSD 4NPAA 3OC0A 2EXXA 3N2IA 4G5XA 4PX9A 4V2UA 3U0VA 4IBOA 1CB0A 1ZM3A 3PHJA 5D87A 2XF8A 3VHRA<