2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
2BDTA 2RB4A 1SXJA 2AHOA 3FTQA 4KBGA 3ZVNA 4KSBA 2Q9BA 4KFTA 4RFSA 2W00A 3GLHA 5DO9A 1IN6A 4HZUB 2B92A 3DM5A 1NG1A 3AQ4A 5IRCD 1W48A 2XTMA 3PFIA 1D2NA 3WXMA 4EDHA 1XZQA 4TZ6A 2VHQA 1OSNA 2ZRKA 2GCPA 2ZYWX 1K73D 1Z6TA 4QJ4A 5A4JA 1CLUA 1YZQA 1Z5ZA 1US8A 2EIXA 2YJTD 4XJXA 4LHXA 5ELXA 2OCYC 2A2ZA 1NLZA 3GFTA 4LJ7A 2VNIA 5J4YA 3KQLA 4EPXA 1Z47A 1NKTA 4QHYA 2O8FB 2ZRNA 2G1JA 1Q1BA 5KOYA 1OIVA 2BKEA 5B2ZA 2XZLA 1N6NA 1P5ZB 1VCOA 2X8AA 1G7SA 4PQRA 4R2IA 3GPLA 1KJWA 5JS7A 1KK3A 3BB1A 1SVWA 1XTKA 4D4LA 4BFTA 4GI7A 3EA0A 4S2EA 2EQBA 1W5TA 1MO4A 4PHHA 4MYTA 1Q22A 4MH0R 4PO9A 4YALA 2CLCX 2OXRA 1IONA 2DFTA 1L4UA 4M1SA 4QGHA 4X8OA 1JR3E 1IXSB 2VL7A 3CNOA 4TYNA 4DSTA 3B1XA 2XZOA 3GFPA 1ZIOA 1G3UA 3QUSA 1Z83A 4KV9A 3S1AB 5CLQA 4TTQA 2QT1A 3SHWA 1YIJB 1S1CA 1Z0IA 2KWIA 5SZKB 4HYYA 1E9BA 2EWWA 2X77A 4LBVA 3W5IA 6Q21A 2GBLA 3KZ1E 2IYYA 4FW9A 4GFDA 3RLFA 2A5DA 4B73A 3CR8A 2CK3A 3KFVA 2HCJB 1HQCA 2ORVA 2F1JA 4IKEA 2BWJA 4TL6A 2NMVA 3SJAA 1ZUIA 3OIUA 2OESA 1IY1A 4KVGA 4W5JA 4LBWA 2C8VA 4BFVA 1XXHA 1FNDA 2V7QA 3PIRA 2ODEA 1ETUA 1VQOB 2WWGA 3EPJA 2AWNA 4M1MA 2OLKA 1G7CA 2Z83A 4NONA 1JPJA 2OTJB 4DZZA 1VYUA 3C5HA 5BN4A 1G20E 2HLDA 5H1YA 2VLIA 2AKYA 2P0EA 4IJMA 4RFVA 1CJTC 1H8ED 5JRZA 2NG1A 3PCRB 1R5OA 4RD2A 2REOA 2GILA 2GEUA 2GXQA 2HUPA 1U8AA 1G18A 2EFEB 1G3RA 4KHZA 3QY0A 4PANA 4IDOA 3RAPR 4TZ0A 2RHDA 2ZYUX 5AJXA 1Q7YD 1J7KA 4BEBA 4A9AA 4YXWA 3THWB 4PQYA 3R9IA 1Z6GA 2IBMA 1NNEA 2HMAA 1E2DA 3TSOA 4ERNA 1UEIA 1M6NA 1FMJA 2P6NA 4JYBA 1WQ1R 1QH0A 3NBFA 1AS3A 1XTIA 1X3SA 4BZQA 4B3BA 1A1VA 1KI8A 4FK8A 1QVRA 1XCGB 1NIPA 2QA4B 2DWQA 2VO1A 1OH8A 1II9A 2AK2A 1W4AA 3BAFA 4FN5A 4N0EA 1DS6A 2AXPA 2P3SA 4RVCA 3I32A 4HE6A 3PQCA 2BCJQ 1GKIA 4LGMA 5CIQA 3W5HA 5TV2A 3PVSA 2ZANA 3QNUA 1BYUA 5JS8A 4NCHA 5EE5B 3WY9A 2ZJBA 3WHLA 5BXQC 4RJLA 5THXA 1SKYE 2C98A 4TLCA 4PO8A 4R71A 2X1VA 1QF9A 2XNDA 2ZSFA 1X8KA 2OEPA 2ODBA 2IYSA 2XNSA 4JVMA 4K1XA 2EVWX 1OFUX 3ND9A 1Z6XA 4BLPA 4JLMA 3H1TA 1K8AD 1ANKA 4A6PA 3CCSB 4R7ZA 1S96A 1R0ZA 2GESA 3BS4A 1BX0A 3ASYA 3DKVA 4URUR 1QG0A 3OZWA 1GRRA 1TU3A 1AK2A 2MSCB 4PZYA 4QHSA 5EE1A 3VO2A 2GKSA 3SR0A 2J0SA 1O87A 2QTVB 4KJZA 1GAJA 3LD9A 3FKQA 4JT4A 3PEYA 3CWZA 1D1NA 1Q1QA 4JLPA 2O8FA 2CJWB 3CM0A 1GTVA 4Q21A 2V55B 1QRAA 4PSKA 3O8CA 1SVKA 3BIFA 2V3CC 4WVFA 1QFYA 5SZHB 2P67A 3Q9LA 1BIFA 5ANRB 1P75A 1OLOA 1ZCAA 5KSZA 5FBWB 3EZ6A 3ZZ0A 5CK5A 4OQNA 2VIIA 1DDIA 3EIQA 2V6JA 1GKUB 3M0EA 2RAPA 5IT5A 1CTQA 5F9FA 1IBRA 4IEEA 2HEIA 1GR1A 2W58A 2W0MA 1DAMA 4D2IA 2QGZA 4H9GA 5L8VA 4IOMA 2DPXA 2RGBA 2FNAA 1GDDA 4DIEA 2D2FA 4DLYA 3G0HA 2FPMA 2PL3A 2AWOA 4URVR 3Q7PA 2O0JA 3K9GA 1N5LA 4KCGA 1WDTA 1UDWA 2QM8A 5EP4A 5JWOA 2FGKA 3WMEA 3ZVMA 5CB6A 1KO7A 4JLDA 1N2CE 2ZROA 1EWYA 1KK2A 4C9BA 4BPRA 4HB4A 4EFMA 2YWFA 1W2BB 1R0XA 2WHXA 1U99A 3R9WA 2GPJA 2OSBA 3FGNA 821PA 5DE3A 3CONA 3MAAC 4PX9A 1OFIA 5K8UA 3VR5A 2QORA 4G5RA 4TN1A 1EFUA 4JS0A 3KQHA 2QBYA 4DT1B 1VQ9B 2QDXA 1DVRA 1SHKA 4OK5A 3AP2A 3LV8A 1II8A 1AZTA 2PMDA 1S4QA 3KJGA 1NL3A 4AF7A 2FWRA 4BLOA 4OHXA 3W2FA 3WMGA 3U3OA 2ZSDA 4C43A 5IK2D 4Y7CA 2ZSBA 1YRAA 5C2JB 2Z6VA 4ARZA 3RS7A 1FMLA 4UKDA 2R6DA 3H86A 1GRQA 3THWA 1CQXA 3LVQE 1UFQA 3K9HA 1EESA 2VP6A 2FFAA 3GQBA 3GEIA 2ZI5A 1HT1E 4L9WA 2QAGC 4MYHA 4V0MA 2WMNB 2O8CB 1CRQA 3ECCA 4AKEA 1TPZA 3MGCA 1EWQA 1E64A 5K8IA 2GEDA 3KQUA 2QRZA 2VPPA 5A5GA 3HP1A 2ZYTX 2ZRPA 3FHOA 3NEJA 4F91B 2QAGB 1KI4A 2EYQA 4QBHA 4EUNA 3LH5A 3KTAB 2YKGA 1NLFA 4WZ6A 1DPFA 3L0IB 1SVMA 3BH7A 1GO2A 3FMIA 1EFRD 4D81A 4B4DA 4Q4LA 2J1LA 4GDFA 1U0LA 4MYCA 2OFXA 4CW7A 1NI3A 1R8SA 2ZS8A 1KSJA 3JQPA 3CUEF 4QKQA 4BQSA 2QEXB 5GVSA 3TVDA 1UDXA 5FUYA 3FWYA 1F2TA 2B21A 5DNYB 3PG5A 3MRSA 3NBXX 4YAWA 1M1KD 4IW3B 3MJHA 1II0A 3B78A 2A5JA 2F1RA 1T8TA 2E1RA 4PR0A 4B3CA 2G1KA 3OEHA 2VYFA 1W2GA 5FPYA 5FTJA 1KO4A 3HDTA 2IL1A 3AP3A 1IN8A 1E1RD 2YINC 4NHOA 5AN9A 3WP1B 4J0QA 1W1WA 4HB0A 1KTVA 3JQRA 5JECA 4FCWA 4Z1MD 3KB1A 1HT2E 4PZLA 2VHUA 1FRQA 2VP2A 1DG1G 1NBMD 2ZS7A 5KDOA 1H8EA 2R44A 2ZR0A 1RRCA 2Q9AA 1AA9A 3CX6A 3AV0B 4V03A 1XMJA 2RGDA 1A2KC 1VTKA 1QHXA 2OK7A 2C5LA 3LLMA 2HYIC 1Y63A 3U3RA 2BM1A 2G0NA 5DSZA 1TEXA 4LJ5A 5KNBA 4AYXA 5HXBA 2C9OA 4OQLA 4DSNA 1Q44A 2KSQA 2QPOA 1GIAA 3EW9A 4LUCA 1WMSA 3TSZA 2ZVPX 3C7KA 2BVNA 4LJ6A 1W44A 2ZRLA 4X8HA 3W2HA 2QT0A 3K0AA 4DLXA 2DERA 3B2EA 2JLYA 1E9AA 5DYGA 4OKSA 4LJ8A 2H1LA 4LJ9A 3VHLB 2WWXA 2QMOA 3CO5A 4PHTA 1X1SA 4U02A 2GVDC 1E0KA 1NLYA 5E7IA 1XEXA 3NBZC 1CKEA 4PSAA 1KI3A 5HTKA 2BGIA 1NP6A 1WE2A 4CDGA 1S9HA 4Q1DA 4HSEA 3RRYA 3RWMB 4EJSB 3UWKA 4P4UA 4YMUA 2P65A 1X8LA 3HYTA 1GM5A 4RZ3A 1DARA 1F48A 1R10A 3CMEB 1G17A 3PR1A 1G16A 1W34A 3M6AA 5FTKA 1P2UA 5FFMA 3SYNA 2E87A 3NDPA 5CYOA 2ZI6A 2JLRA 4Q18A 1QHYA 1Z22A 2FV8A 1ZINA 2WAYA 2NPIA 3KL4A 3WRYC 5FOSA 4URWR 1W0JD 2O8EB 3B7GA 4US2R 2WWIA 4QG7A 2G9NA 2NO1A 3OIWA 5AUOB 1P2TA 1IN5A 5F3WB 2ZUCA 1YZTA 1Q82D 3FE2A 1GOTA 1WXQA 2J0UB 2PZEA 1E4YA 1ODFA 1XD9A 2H16A 1SULA 3FKSD 1Z0AA 2Z4RA 4NH0A 2QZ4A 5JHGB 3GLGE 4HLUC 4UNRA 4MUBA 3CB4A 4DCNA 1E0AA 4C0HA 4BFSA 4PC2A 2LWIA 4A0FA 1F5NA 1H65A 1AQUA 4QGFA 3P1JA 4LHVA 2XJ9A 4DCUA 3AVVA 3AVUA 4BRUA 4AKIA 3CH5A 1VQPB 3VNUA 1VYVA 2ZJ8A 1FTSA 2BSAA 4BE7B 1I7PA 5CJ2A 3VR6A 3GMTA 4DLZA 1QBKC 2IHYA 3W8NA 4B75A 3QXHA 5FUXA 2HJVA 2JJ8A 2X2FA 1VCIA 4WXPA 4EIWA 3NH6A 3FMFA 4D26A 3U3KA 1N6OA 1KY2A 2C96A 4RZ2A 3LVRE 3SQWA 4EFNA 3RS0A 4G1BA 2QN6A 4Q02A 5H8WA 5EZ6B 4GPTA 3P27A 4HB2A 1R6BX 1UBCA 2PEYA 1UAAA 4Q4JA 1IXRC 3CPHA 1VHLA 3L8YA 3NEYA 3NG1A 4C0AC 4KU4A 3TAUA 4A6XA 2KB0A 3BE4A 1G3IA 2D06A 2V9PA 4NYIR 3LBNA 2OM2A 4BLSA 1XFAA 1KD1D 3IQXA 4GMXA 4ZDKA 5G53C 4ZKEA 5IK2A 3AVOA 2J46A 2ZAOA 3UG7A 3EWAA 2ERXA 2HCBA 4JL6A 4ZKDA 3L8ZA 3QE2A 4L16A 4A82A 3NC0C 3KJHA 4XWKA 2KBFA 3CNNA 2TMKA 1FQJA 1QZXA 1N6RA 1SKYB 1OXVA 4B32A 1ZUHA 3DMDA 1FRNA 1TTTA 2IK8A 1HQYE 1GNRA 1L7VC 2A78A 4KITB 4Q7KA 5EP3A 3VNVA 4Q00A 5FI0B 4IFEA 5DI3A 4DJTA 2QMHA 4JT2A 2JLQA 4JL8A 4WOPA 4M1TA 4PC3A 4NYIQ 2FZ4A 3IHWA 5FL3A 1KGDA 2GZDA 3V00A 4EJSA 4NCJA 4KFSA 4CT4B 5KPJA 1ESMA 3UMRA 1G1MA 4FXPA 1Q81D 2QY9A 4RKFA 1QFZA 5TARA 5KTYA 1XP8A 3GLIE 4KLNA 4A0RA 1JQLB 2BEKA 2OHFA 3QKRB 4OI1A 1A2BA 4RD0A 4GSYA 1S3GA 3W6PA 1KSHA 2PX3A 2H5EA 4YXWD 2FG5A 4OJKA 2VNKA 2HXYA 3K70D 1IJFA 1AS2A 2WOOA 3T1TA 3R9XA 3A1UA 2BHRA 3B1ZA 3D6TB 2FX3A 2J59A 4Y9RA 1DADA 3PUYA 4AI6A 3WNBA 3LAWA 5H59A 2IA5A 2QTFA 3GEEA 4I1OA 3SQXA 1E1RA 2DEUA 1U94A 2I4IA 1E9SA 121PA 3ZBUA 3CF6R 3H0KA 4IVQA 4NL4H 4E5UA 4L8GA 3CZQA 2WJYA 4XTRA 4Z1MA 4YDSA 1KOFA 4JVNA 4XD7D 4UNNA 3A4LA 2PIAA 2R6HA 1W36D 1HURA 1OE0A 4C7OB 3RRMA 1D5CA 1YZKA 3FMOB 2PT5A 4IDQA 4Q4AB 3V9PA 3QG1A 1NIJA 3AM1A 2YHSA 3EIEA 3L0OA 3B1YA 3W8RA 1KO8A 1ZD8A 2WMOB 3EC2A 4MRVA 3NIBA 8OHMA 3G71B 3NWJA 3K09A 3JVUA 1TF5A 3VHXA 3U6BA 2VA8A 3Q7QA 1KSFX 3AGPA 1R8QA 3F3YA 4JL5A 4PQFA 1IJEA 2QTHA 2ONJA 3GLFA 3EXAA 2YOFA 1P2VA 5GJBA 1XJQA 1CR0A 3OAAD 4LRWA 4RSGA 5EE3A 4YMTA 1KMHB 4JBYA 2QU8A 4TL8A 2OZEA 2IXEA 1HE1C 4BZPA 2GJ9A 4F4IA 4EKDA 1EP3B 2ODWA 1MRSA 3B1WA 4YC7A 4I99A 1ZBDA 3THYA 4BFUA 4CZ2A 4M1YA 3A4MA 1UEJA 3AUXA 3MD0A 4XWOA 3AVTA 4IXMA 4YQFA 5JJLA 4V0OA 2CHGA 1EX6A 2EW1A 1ZC3A 3WBJA 4GZMA 4MA4A 5F9HA 2ZI7A 1G5RA 2WWYA 3HWSA 3UIEA 3ONWA 1TQDA 1N6KA 3IHLA 221PA 4PC1A 4LJ4A 1KKLA 2CNWD 3LVBA 1VIYA 2W6JD 1OF1A 3BBPA 1XPUA 2GXSA 1BS1A 1FP6A 2QROA 3CBQA 3AVXA 3MG9A 2G6BA 1G8HA 4KI0A 5DLQC 1UKZA 1W0JA 2NO7A 4LJAA 4JZKA 1E3MA 2IWHA 1N6PA 1XCPA 1YJ9B 2VF8A 4URYR 5E4FA 1I4LD 2BOVA 2VP9A 3SZRA 3FKSA 1Z29A 1H85A 2ZJZA 4JJKA 1NN5A 4LSGA 5L3RA 3QQ5A 4Q9LA 3DPUA 1E2LA 2QSZA 2C9YA 2UKDA 4KXFB 4I1VA 4LV5B 3T5DA 4KYUA 5K8LA 4DB2A 4IDNA 1DE0A 1M34E 1OIWA 4Q66C 3R7WB 3TKLA 4QGAA 4KLZA 4I4LA 3SFZA 2ZRDA 4YMVA 2PH1A 4XSHA 4K8OA 5JMTA 5FA6A 1DAIA 2CCKA 2KBEA 2J45A 5CITA 3VR1A 5CB8A 2W0SA 2JJ1D 4F92B 3KQNA 1E0JA 4RCZA 1QVFB 2BKUA 3PV0A 3T06B 1JJ7A 2BBTA 4HUQA 3I5YA 4CEHA 4PTLA 3I5XA 1V43A 2CDNA 4E07A 2IS2A 3FHCB 1T0JB 2RC5A 1NF3A 2X2EA 3AH8A 4D4MA 4LX0A 4BGDA 1VQ4B 4ZIRA 3A1VA 1FX0B 2JLUA 3P32A 2OCAA 2XSZD 2WAXA 2BF4A 2XOKD 3B9PA 3CF2A 4FMCF 2ZQ5A 4JVLA 4OHZA 2VYQA 1C9KA 4TYQA 3UWOA 3DL0A 1GUAA 4QXAA 5AUNB 2ZI4A 1XCMA 3CCRB 5TVKA 4B74A 1H42A 1M90D 1JALA 4C0QC 2Z0MA 1RFLA 1XWIA 1HUQA 4Q4AA 1IN4A 4Q9HA 2ZEJA 3VU9B 2G3YA 2L0XA 2NOAA 3IEUA 2XB4A 2RGCA 4D4KA 2PJZA 3BXZA 2CL6X 1K8RA 2O8BB 4EPVA 3ZVLA 1E32A 3QF4B 5L3QB 1VG9B 2IYLD 4GT1A 2BCGY 5FTLA 5LD2C 4MDEA 2ERYA 1F2UB 4TQ9A 3B13B 4G5QA 1VECA 4P4TA 2VNJA 3DO6A 3CPEA 3V76A 2ZRAA 4LWZA 3TNFA 3CRZA 2XEXA 4RD3A 1WRBA 3A1WA 1A8PA 1N8RD 1Z0JA 2AFHE 1VQ5B 2PX0A 4MGYR 4HLDA 3OEHD 3CWQA 4JLKA 4F4CA 3EC1A 2QP3A 4IDHA 3T34A 2DWPA 3ZS9A 4DQKA 3QKSB 4PPFA 3L2OB 2AXNA 2CVFA 4XSGA 1HV8A 1PLLA 3P4XA 1S3SA 3CC2B 1Z06A 4LHYA 1Z08A 3O8DA 5DHAA 3W3AA 4TYWA 1CJKC 1FUUA 5GADl 4LOAA 1Q1EA 2JLWA 5DIFA 2ZJ5A 1YZGA 2XXAA 4WW0A 1DO2A 3VKGA 721PA 1QHHB 2DFNA 1E1QD 4NCIA 5SZIA 1MH1A 1O3YA 3GLGB 3D7MA 2PT7A 2WZQA 4B2IA 3LFUA 3U44B 4JJZA 4P3YA 3SEAA 2ZVQX 2OO7A 3MWKA 2GRJA 1T3HA 2R9VA 4HAVA 3T35A 3G82C 1M7HA 4HUTA 3RC8A 2AN9A 3BFVA 3NXSA 3I92A 5B58C 2ZJOA 1M1YE 1OH6A 4LYFA 4RD4A 1T0HB 1HY3A 4C0JA 2ZJYA 3KUCA 4G01B 4XD7A 3WNDA 4DQLA 3C41J 1B23P 3E2IA 1EG7A 1Z6AA 3Q3JB 3RS3A 5JCZA 3CMAB 2G0TA 4NE2A 4O3MA 1UKYA 5EE9A 2B8WA 4ZCLA 2WVJA 3DOFA 3R7WA 1KZGB 3K0FB 2ZRIA 5KO2A 1EK0A 1LNZA 5FPHA 3TH5A 2ZTSA 1MO6A 3K9NA 1X6VA 1CP2A 2W83A 4QM6A 4HZUA 1VQLB 4TMTA 3QEJA 1AZSC 3QXJA 1ONBA 5C18A 1WBDA 3OIYA 3O47A 4TQAA 4M21A 4PHGA 1OH7A 2W2XA 4Q7MB 3QVVA 2C2HA 1YJNB 2IX3A 3T61A 4CGZA 2F43B 3OAAA 1LF5A 1UM8A 2BC9A 3VMFA 1KO5A 3CF0A 3GJXC 2VNHA 1YVDA 4Z51A 2IS4A 2YWGA 1A7JA 1W4RA 2CLDX 3T1VA 4A36A 3LQRA 1WA5A 2WWHA 3QXXA 1WBBA 4YMSA 3CCMB 2CXXA 3TJZA 1KIMA 3TRFA 1G4AE 4DVGA 3QKTA 2AL7A 1P60A 4Q48A 1EFCA 1E63A 2F55A 2XZPA 3W5UA 1SXJE 5JFGA 4HDQB 3CCJB 1GL9B 4ON9A 5GJCA 2O8DB 1RRGA 1NDHA 1GKYA 5EMNA 4Q1AA 4V02A 2CL7X 4US0R 2IW3A 4F38A 5HKKD 4MYUA 4N3NA 4C0SA 1HTWA 2CNWA 5GJWC 4BLTA 3L0PA 2RGAA 2W6JA 5E3HA 4UNPA 4DB4A 3PENA 3BB3A 2XAUA 5LDDC 3I3SR 4WAUA 1EGAA 5L3VA 1AIPA 2AR7A 2XITA 1GSIA 1ZCBA 4TYPA 3PUVA 4YONB 4A4DA 3I4LA 5JSZB 5L3QA 1F2UA 1BOFA 4TMVA 5AJYA 2UZ3A 4W5HA 3ETLA 5UKDA 3UXMA 1NG9A 4YLGA 2OK8A 3S1AA 1KNXA 4RY2A 1YZNA 3KKMA 1D2MA 4D82A 1ZM2A 5B30A 1IXZA 1UJ2A 1W2HA 3MLEA 4IOKA 5HE9A 1DAFA 2ZE6A 2OLJA 3IUYA 3A1SA 4QNRA 5HCIA 3RS4A 1P9WA 1XBTA 5BYJA 3GLIB 3IEVA 4B76A 4NCKA 4N3GA 1K6MA 4QNMA 3QKSA 1ESNA 4Q01A 4A15A 4A8JC 2N1BA 1BYIA 3SBDA 3ICQB 2EYUA 2IYXA 5EXTA 2HT1A 1BH2A 1JJ2B 3BFXA 4YMWA 2ZXUA 3C5CA 4NBSA 1KKMA 3X1WA 2P6UA 1ZNYA 4AKGA 1JA0A 3FDIA 1CS4C 5LD2B 2W2TA 4NYMR 2FMXA 1MOZA 621PA 1BJKA 2JJ1A 1XMSA 4A8JB 3LA6A 3KDSE 2EFGA 3TSWA 2Q9CA 1Z07A 1I4TD 5CM8B 2N46A 2VHTA 2VSOA 2DR3A 3EZFA 3GJ0A 4M2LA 3T5GA 5BN3A 2LCFA 3I61A 2BGJA 1JNYA 3W2GA 3RS2A 2NZJA 3KKOA 4E22A 5JHHB 5K8TA 4K46A 3GD7A 1BX1A 3OFND 2XNCA 2VEDA 3A1TA 5G40A 4B3DA 3SS8A 4IRUB 5JEEA 3CR7A 1X86B 4AYTA 1N25A 2HXSA 1AQYA 1PJRA 2XSZA 2OT3B 2IS6A 3C15C 2XOKA 3UMFA 3QXSA 2D7CA 5J5CA 5HCNA 2GNOA 3QPUA 4FMDB 4A2PA 1TQ4A 1MRNA 2ZREA 1I2MA 2FDCA 1SZPA 1P9NA 4AKHA 1GVNB 3T1QA 3G4SB 4M1OA 1SVOA 1VCNA 5L3SB 3DZ8A 1ZMXA 4DRZA 1UF9A 3TAHA 1E4VA 1SVIA 2ZRBA 1W35A 3AF3A 3IO3A 4BLRA 3CCQB 4BRWA 3THXB 4DC9A 2Y8EA 3I56B 3HYRA 1GVHA 5H68A 1KDTA 1Z3IX 2I3BA 4L4UA 1TUEA 2DBYA 2CNDA 2A5GA 2MMCA 4R98A 4NDZA 4Q1EA 5EUMA 1E2NA 2WWFA 2QQEA 4TLBA 3U4QB 4M1KA 1PZNA 3MCAA 3L0SA 3LBIA 3N5CA 2D7DA 1LS1A 4FCVA 1FNCA 1OXXK 1LVGA 1TU4A 1IB0A 5C1BA 1JR3D 2CJWA 4JSYA 2YOHA 5HZHA 4NP6A 2YV5A 4ZDWA 4ZDIA 3ZLJA 1S1MA 5IHPA 1RJ9B 2BEJA 4JVSB 1KO1A 4RD1A 4L5BA 2RGNC 2RC6A 1T5IA 3LLUA 5FOTA 2HJGA 1KSGA 1QGZA 2RHMA 2ZAMA 5G41A 4OK3A 3AKCA 2V1UA 2G77B 3VO1A 2CCJA 3EG5A 1MV5A 4F93B 1DOAA 4FMCB 2JGNA 3FJOA 1N6IA 2GAAA 3X2SA 5AWFC 1G5TA 1E1QA 3ES9A 4P4SB 2FSGA 4QRHA 1FQKA 2IEZA 1CF4A 1YZLA 5AK0A 3W6OA 1E9CA 1DBSA 1G6OA 4XVUA 4TLEA 2DWOA 2ZR7A 3GJ8A 1FZQA 3W5VA 2REXB 2IEYA 5KSYA 1J99A 2ASEA 4DIDA 2C77A 1VCMA 1ZNZA 2ANBA 4TSFD 2AX4A 2WWWA 2D62A 1Q21A 4D25A 2Z4SA 1JJVA 2YYZA 1VG8A 1ZAKA 1SM4A 2OXCA 3LX5A 5C4GB 4A2QA 2ZU6A 3QVUA 2OG2A 2XGJA 5GV7A 3KFXA 3UANA 4C0LA 3CH4B 4MKHA 3QOFA 3MMPA 1F20A 1VQ6B 1NN3A 5AJVB 2PBRA 4URZR 3RYTC 4ZO4A 2BMDA 3PUWA 4L15A 2MSEB 4DLVA 3HPQA 3X1YA 3HU3A 4OQXA 3C4JA 4DT1A 3DZDA 4OL0A 2EU8A 2D3WA 4ABYA 3EPKA 3FYHA 2GETA 2I1VB 2RGEA 2YZ2A 5KHOC 2FN4A 1HA3A 5CM9C 2O0HA 2WBLC 3F8TA 5KSWB 2F9MA 2QMUA 4KFRA 2VSXA 4DCTA 4BEJA 3NH9A 3GJ5A 1QX4A 4XWAA 4Z54A 2A30A 4ASUD 3QFSA 4W5WA 2GA8A 1LS6A 2FEMA 1GP2A 1ZNWA 2QGNA 1D6JA 4FWIB 1W4CA 5F2EA 2O8CA 2F3TA 3RVBA 4DDTA 4LPSA 5EXXA 2BMJA 1Q20A 4QFMA 1TNDA 2W2VA 3K0CC 3GCGA 5FBLB 3I72A 3HJNA 4G0NA 2HDNB 3SJZA 4K81B 4DKXA 1HH4A 1QVAA 2QPTA 2QAGA 3ICEA 1TEVA 3SHFA 3BWDD 4B33A 1E99A 3KTAA 4US1R 5D3MB 2VTKA 1JB1A 5EP1A 3U7FB 1T4GA 1OT3A 1CJMA 1ZP6A 2DFLA 1VYTA 5HKKA 1YZUA 5L3SA 1D9XA 1M7BA 4JBXA 3SJBA 4AF6A 3DMNA 3Q5EA 3WYAA 1NJGA 4JSTA 2Q21A 2AD1A 3VX3A 3CNLA 3OEED 3PEWA 1CXZA 3M1IA 4D0NA 1JQJC 5CLLA 1NY5A 4CEJB 2FF7A 3U7GA 1G3QA 4QJ5A 2CHQA 5B64A 4IHQA 3A58B 5J40A 4Z8YA 1Z2CA 4BFWA 3P26A 4Q19A 4A1FA 5DI9A 2GVZC 4F4JA 2VQSA 1N5JA 1OGJA 1EWRA 1IHUA 2DETA 1NJID 2JIZD 2YC2C 1U8YA 3TW4A 4EPYA 2UZIR 3KXKA 4CEIB 5AJZA 4G5OA 1RJ9A 2ZS9A 4H1VA 3REFA 1SHZA 1DAGA 2GTPA 1FDRA 4XTCS 2R8RA 5SZJA 3CX7A 4AG5A 1CEEA 1DEKA 3C8UA 4DEXA 2YNMA 4OK6A 3CRMA 5JLJA 2FFHA 4G3XA 4UXIA 4JBWA 1UBEA 4PO1A 1KI1A 1EFTA 1N5KA 1G8FA 3LX8A 3DKPA 3OFNA 2VRWA 3H84A 3VX4A 1LF0A 4DDWA 1QGAA 1HE8B 2PCLA 3H2YA 2IT1A 3TK1A 1P3JA 2QSYA 1GWNA 2RGXA 3N70A 1PUJA 4Q1BA 1MR3F 4ACAA 3KKQA 4ZGNB 4PPGA 3R8FA 2ZSEA 1QG4A 3C14C 2OAP1 4GMDA 2FSFA 4AK9A 3KQKA 4MKFA 4MRSA 3U60B 2GCNA 2NZ8A 4FMBB 1ZD1A 4GNKA 1L2TA 3CCUB 4NKRA 2W6ID 2ZYVX 3TBKA 2KJQA 2IF0A 1S8FA 1P9RA 1X1RA 3PJRA 1VQ8B 5FTMA 1VHTA 5KSPA 2E9SA 2XTNA 2R2AA 4MRRA 2CVHA 3OZXA 3FOZA 1YJ5A 1PVOA 5AR1A 2ZR9A 1L8QA 5J47A 1JXOA 1LB1B 4DHEA 4N0DA 1J90A 4JLNA 2D4HA 4M53A 2CMKA 2FGJA 4UQOA 1LFDB 2YWHA 2V54A 1SXJC 1VQ7B 4BWYA 4POAA 1E2KA 3X1XA 3J81k 3CC7B 1IOZA 5E7JA 2ZPTX 3RS5A 2V8OA 3QEOA 2GHIA 3AF4A 2FFBA 2C9CA 3AKYA 3OW2B 1T91A 1CR1A 3KKPA 4G5SA 3ZH9B 5CJPA 2MMGA 3AVQA 3FPAA 1E2MA 4ZI3A 4M8NE 4I1UA 4HZIA 3T12A 1ELOA 1G41A 1SXJB 1H8HA 2IYQA 4CRWB 2O8EA 4G1VA 4I81A 4Y9UA 2C04A 1IM2A 1NSFA 1SQ5A 3RDPA 4LK2A 2QP4A 1JR3A 4PC6A 2J0UA 2JAQA 3IQWA 4GZLA 4B2LA 2ONKA 3EX7C 1OH5A 1MABB 4HEJA 4AC9A 2F9LA 1A82A 1NSTA 5FOUA 1S0UA 2Q3HA 3VAAA 3U5ZB 4Y0VA 1EP2B 4LDJA 2QAJA 2QI9C 1FNBA 5CK4A 2GAOA 1XTQA 3K0CA 1ZU4A 3ZGXA 5JBQA 1VQKB 1P72A 3N2IA 3WYFA 1US8B 2WJIA 3TUZC 2ZI3A 1Z0DA 4PSVA 4V0LA 3GJ4A 1JI0A 3CRRA 5FTNA 2CHVA 2QG6A 4M9SA 4B48A 4HLUA 4QBIA 4Z8XA 3CCEB 1CBUA 2X19A 3NHAA 4D0GA 4GRAA 4JIMA 4W7SA 2VHCA 4DBLC 4CIDA 3F5FA 1P6XA 4O2RA 2VF7A 1NVUQ 4L9SA 2GF9A 1XB2A 1AMOA 1SGWA 1PLJA 4TSFA 5FBQB 4BPBA 1ZM3A 1YITB 4TT3D 3R20A 1Z0FA 1OYWA 1A4RA 3MJRA 4GOJA 1KDRA 2GJ8A 4UJ3A 3CRVA 4RZXA 5CYPA 3EPHA 5F98A 1NVXQ 1E9EA 1TQ2A 421PA 3QSYA 3AKEA 2PZGA 2ECKA 2GBLC 2XTZA 3ZIAA 4D6PA 4TWZA 3SYKA 3ADBA 5BYKA 5HR5A 2GEVA 3EARA 2HF9A 2ZRMA 3MUFA 5GJVC 3RRNA 3W5JA 1XTJA 4GBMA 1N0WA 1P2SA 2C03A 4TMKA 2H18A 1GILA 2PLFA 3H4MA 1BQEA 1GRNA 3B60A 2HF8A 4OI2A 4OQMA 2JLZA 4CYMA 4EQ6B 2GWHA 2ZRFA 5LPNA 4QBGB 4ASUA 3RABA 3KUDA 5FR1A 2RH5A 1W47A 2ORIA 1IAQA 1YE8A 1WB9A 1UKEA 3IIKA 1XE1A 4FMDF 4PPNA 3D3QA 3BH6A 4IOJA 1D2EA 3B6EA 3E70C 4LI0A 5FL7A 2J3EA 3FFBA 3RWOA 1JAHA 1DDGA 2QQ0A 1KC8D 3VR3A 3TMKA 2OV2A 5AUQA 1XD8A 3CRW1 2Q6TA 1GITA 4JLVA 3EWSA 3ADDA 3QG5A 4XOIA 1U90A 1NRJB 1QFJA 4GOXA 3SYLA 1LV7A 4DXAA 3B85A 2HT6A 3NKVA 2IXGA 2A9KA 4MGKR 2OBLA 4M0LA 3CCLB 3QPWA 4DLWA 3SE0A 3VKHA 3MWYW 5FI1B 1G291 1G9XA 4LC0A 4XVQA 4XIGS 4B3GA 3OEEA 4KVAA 2WICA 1E98A 1DELA 1KAOA 5KNDA 2C95A 4OI4A 1ZNXA 1FP7A 3QPVA 4Q5IA 5HE8A 3TW8B 3QKRA 2QRNA 2ZUBA 4HDCA 1XU4A 3CPJB 4TL7A 2PEZA 1YKSA 4QM7A 1NJFA 1GNQA 4TTPA 2ZRGA 3ZD6A 2R62A 5JI2E 1QHGA 2J41A 4LYJA 2BM0A 3QBVA 2JIZA 1E2QA 2Z5FA 3BRWD 3EA5A 3WP0A 4Q9KA 1E69A 3ZC3A 1PUIA 3NTUA 4BLQA 1YU9A 1E0SA 1R0WA 1MABA 2OCBA 2WPDD 3WHKA 3ZS8A 1E2JA 1WF3A 2FA9A 4GP7A 1BMFD 1NKSA 2DFKB 4C0KA 4NPHA 2F6RA 4M22A 5FPSA 3GP8A 1KDPA 1XD2B 4B35A 1NN1A 3T15A 4C7OA 3TQCA 4B47A 2YVUA 5DHFA 2WJGA 3RANA 3W34A 2RKOA 1AJEA 2J9RA 4ITRC 1QVGB 1WCV1 2ODNA 2QENA 4B34A 1XMVA 3SC3A 4A0GA 4YAOA 1MO5A 3AVYA 2OE2A 1KI6B 4LYHA 5TB5A 4TYYA 4OBEA 3CX8A 4KYIB 4C4PA 4DSOA 5BW8A 2OAQ1 3LDAA 1NMZA 2BBWA 4H1UA 4B6EA 5CDFE 3MSXA 2K5UA 1R5NA 4I1SA 1JEDA 1T5LA 4B44A 1OFHA 2ZRCA 1J8YF 2ZJ2A 3AB3A 3ASZA 2P2LA 3QE0A 3F0TA 1J8MF 3RSOA 4EPWA 1Y3AA 1C1YA 2EFHB 2BJVA 2WV9A 2W6IA 1KMHA 1QHSA 1KRHA 5A0FA 2I1QA 3LWNA 3WRXC 3CLVA 4JLBA 3KB2A 4JKIA 5FPKA 4RZUA 3U3MA 1AGRA 1Z2AA 2HYDA 3BFKA 3SI7A 3CPWB 1L4YA 2OILA 1XPOA 1RC8A 4F7WA 1CU1A 2RGGA 2RMKA 4EPRA 2P5TB 1N6LA 1Q86D 4HAYA 3ZQ6A 1NBME 2Q3FA 5TY0A 2GZHA 2P5SA 4E09A 1U0JA 2GXAA 1XEFA 4D0LB 1CULC 3GFOA 4KSCA 3UK6A 1B2RA 3TR5A 2JASA 3JZMA 3MFYA 3K0EA 3PEVA 4OHWA 5TDHA 4EQ6A 2IYUA 3GJ3A 2BMEA 1T8UA 3O8BA 4LYAA 3Q85A 4WQMA 3WYGA 3IGFA 1QG2A 1YR8A 2HV8A 1XJ0A 2QBYB 2IYZA 3TIFA 1M8PA 1II8B 2ZETA 2R6GA 2UVQA 4HAWA 4IFBA 3GLFE 4EFLA 4II7A 4C2TA 3A6PC 3WNCA 3UPUA 4W9MC 3E20A 1YRBA 4MKGA 1NVWQ 1JR6A 4DEYA 2DYKA 3IIMA 2BBOA 1KQSB 1BO6A 2QL6A 4UJ5A 4HE5A 5HZKA 1IN7A 1AM4D 4ARZB 4A2WA 3AEZA 1YQTA 3W6NA 1BKDR 5EXSA 2PCJA 3ZQJA 4NU0A 2R6AA 1E62A 1VG0B 3I62A 1M2OB 1J2JA 3X1DA 1Z8FA 3QFCA 1ZM4A 4QGGA 3Q5DA 1W87A 2V6IA 2B6HA 1P73A 2R6CA 3NBYC 3OE7D 1VDZA 1GAWA 1G4UR 1FPMA 2LKDA 2FSIA 2ATVA 2GXUA 4R2HA 4TT3A 3LQQA 4X8LA 5G3ZA 4C30A 4AWXA 3C16C 2J0QA 4NYJR 2DY1A 2WTUA 4N1AA 2BN4A 1E2IA 3ADKA 1TVCA 2VP5A 1OIXA 3K0SA 1TMKA 1FL9A 2EFCB 3KJIA 4OJQA 3DM9B 1G5PA 4WIAA 2IYTA 4ZGQB 1FX0A 4M9QA 5AJWA 5KYKA 3B8HA 1IY2A 4LCBA 4B43A 2KI5A 4FINA 1F2TB 4NZYA 1J70A 4ILEA 3W90A 4C3ZA 1ZU5A 2CLSA 2N42A 1JPNA 2IHBA 1P7CA 2O5VA 1VIAA 2JJ2D 4PAMA 3RRZA 2FOLA 2GQFA 1XD2A 2J87A 4KO8A 4ESVA 1OXSC 4OHVA 1KK1A 4PAOA 4S35A 4UAJA 3VU9A 2ZITA 3HPRA 3A37A 2EWVA 2OBNA 3L43A 4U00A 1AKYA 3ZZTA 1JAIA 3GLHE 3OESA 3MWLA 3MHPA 1RE0A 3ZDQA 2O8BA 1ZVQA 1GL6A 2FZLA 1E96A 4HAZA 3UG6A 2C99A 3D31A 1KI6A 2KE5A 3NC1C 3QF4A 4PPQA 4EAQA 5AUPB 1CR4A 4M1WA 2H7VA 2JA1A 2DHRA 2GJAA 2JEOA 4TLDA 2IUUA 5C46F 2ZJAA 4NYJQ 4HB3A 1CRPA 3FB4A 4AURA 3IPYA 3SDZA 5BWMA 5B57C 4C2UA 2BJWA 3EZ2A 2J7PD 1KZ7B 4FWTA 2GZAA 2Q0HA 2QM7A 3ZVRA 1UKVY 4DCSA 3Q72A 2DB3A 1KAGA 1QGYA 4Q9JA 3I8SA 5KDDA 3ND8A 1YR7A 2FPKA 3AP1A 4B2PA 4O25A 3P4YA 1ZJ6A 1HEIA 4U9UA 3FFAA 3QBTA 1OPXA 3KXLA 2H17A 4GL2A 1OGIA 5HPYB 4PAQA 4G1UC 1OKKD 1RYFA 1E9FA 3CXCB 1S2MA 2FFQA 4TMXA 3TUJC 1JXMA 1QHHA 3K0AB 1U8ZA 2ZI9A 5DN6D 3DVLA 5EE0A 5EQTA 1OHHD 2GJKA 3EAQA 3GLGA 2QA5A 3FPKA 4DLRA 3QFRA 4B3XA 1DAHA 3U44A 1M7GA 4RCYA 4PZZA 2VZLA 1KDOA 4LZZA 1JB9A 1Q3TA 1XEXB 4AG6A 2NIPA 4QOSA 3SU8A 3OZUA 4BFZA 4A0HA 1OYYA 4ZI2A 5KPDA 4X8MA 2GJSA 1HYQA 2WPDA 3OHMA 3VTKA 3FHTA 2IYWA 3CD6B 3PUZA 4ZCMA 1BMFA 3NDBB 1P4SA 1KMQA 1SVSA 3ZYCA 1EXMA 1K9MD 1G21E 4E03A 1XXHE 4AIIA 4KBFA 1UPTA 1T3LA 4NCNA 1A5TA 2O0KA 1CNFA 2A3RA 3BORA 1TUIA 5FOWA 2PZFA 2GF0A 3QJYA 3K0FA 1EFHA 3W3ZB 2WJJA 2AKAB 4NYMQ 4ACBA 2J0VA 2QE7D 4LBZA 3B5JA 1RZ3A 4HAXA 3W2IA 4CVNA 1E94E 1FFHA 3IBYA 1DO0A 5FPTA 3V4RA 3SOPA 3CW2A 3BB4A 3ZJYA 1NMYA 1ZM9A 1GFIA 4ZPXA 4Q1FA 1OW3B 2FEOA 4KAXA 2B7CA 1U81A 1DAKA 2IUSA 4LY6A 2PJRA 3OJXA 2F43A 1YHNA 3IO5A 2QNRA 1H8HD 1R4AA 2QEQA 2QMEA 3I8XA 4B3FX 1CJUC 1KJYA 3PITA 2GCOB 4HLCA 4JLAA 3TE6A 4URXR 1JEEA 4WBSA 4FIDA 2FJUA 2NPFA 4OI0A 1YHQB 2RCNA 1NVVR 3BERA 3G5UA 2CEAA 2Z43A 4DDUA 1Q1ZA 1ZRHA 1GNPA 2REBA 2GDJA 4M9ZA 3DOEA 4IXNA 3CCVB 1GAQA 5BN5A 2ANCA 1E2GA 3NHBA 4GP6A 1QUFA 1KY3A 4DLTA 2O8DA 2VSFA 1B0UA 5KNCA 1G7TA 1ZUNB 5EUQB 5FR2A 2IXFA 1R7RA 3GEHA 1COWD 1FNMA 5C4MA 1MO3A 2IS1A 5DGXA 2X3UA 4YAUA 5JEDA 5JSZA 2DCUA 5IDVA 4BFXA 3Q8XB 4Q4JB 4PHFA 3R8CA 2MSDB 1YR6A 5D3QA 1G8PA 1OXUA 1KJZA 2QUZA 5FH9A 1E79D 1NY6A 2WIAA 4Q47A 5FOVA 1N6HA 2F7SA 3A36A 4MGIR 4XVRA 5LB2A 2OFOA 2ZU0C 4Q03A 5E95A 4ZV4A 4EPTA 1VQNB 2CE2X 4AY2A 4IDPA 3GLIA 4HAUA 3E1SA 5J4LA 1W0KD 1PLKA 1EX7A 1XNJA 2WJVA 2VP0A 4FCTA 4Q9IA 3REGA 1N5IA 3RHFA 4DCVA 3L82B 1NVVQ 4G5GA 3QENA 4TL9A 1W5SA 1U2RA 3ZIAD 1XX6A 3ADCA 1N0UA 3B1VA 5KSOA 4BECA 1Q0UA 1P61B 4D80A 2VH5R 1ZW6A 3AF1A 1TLLA 1CR2A 3IILA 4CF7A 2P6RA 3LXXA 2H57A 3OE7A 4MKIA 4A92A 5DISB 3ZBTA 2XNJA 4WZAE 1V5WA 4A8JA 1R5BA 1YI2B 2ZM5A 3SJCA 3CKLA 3KXIA 1U98A 4EJSC 4KFUA 1WP9A 3TLXA 4PGOA 5DI3B 2G88A 2XJ4A 2ORWA 1K5GA 5TMPA 1XTRA 3PEUA 521PA 5J4KA 4TMZA 5FUWA 2FSHA 2JDID 3TR0A 3WBKA 2QP9X 2YC4C 4D4JA 3UMSA 5FL7D 3VR4A 1GG2A 3NVAA 4P31A 5LB4A 1AKEA 1W46A 2JLSA 2WSSD 4LC1A 3U3JA 4O0MA 2B7BA 4JLOA 3LO5A 4QJ3A 3W2EA 4F7DA 1UADA 1TADA 2R65A 3AF2A 3OIVA 4MQBA 3AVWA 1R0YA 5P21A 2JJ2A 1QDEA 3I1FA 1OXTA 1W4BA 3K1JA 5TXGA 1IY0A 3ZD7A 1QUEA 1VQMB 5G3YA 1OB2A 2FPLA 3QF7A 1UMKA 2IUTA 3GJ7A 1KYIA 3N2EA 4IOLA 1TAGA 4DWJA 1FUKA 2H8KA 2NTYC 4Q4HB 2CE7A 3THXA 2G83A 4LPKA 3AGQA 3SFVA 2R6FA 3IIJA 3SN6A 2VP4A 5M04A 4DUGD 4JLJA 1ZIPA 4EH1A 1G64A 1Z6YA 3MWJA 4JMPA 1P62B 1CJVC 1Z63A 3GJ6A 3SNHA 4U7DA 1F6BA 4BASA 2WKQA 5JJIA 3K09C 4LHZA 3LRPA 3O8RA 4V0ME 2A5FA 1S9DA 1E2EA 2J7PA 4V0NA 3U4QA 4UNQA 4LV6A 4MUAA 1SXJD 3LO8A 3EIHA 4C0BA 1EP1B 1GJRA 4FD2A 1G19A 3IBGA 3U2QA 5BQ5A 3I55B 1RPZA 2GCOA 4Y0AA 3SBEA 1N0VC 3E5HA 3LW7A 1E6CA 2WIBA 1E2FA 4TTRA 4WZBE 1RRPA 1OV4A 2IYVA 3OJWA 1RIFA 2FE4A 2ATXA 1ZC4A 1FW6A 1XTSA 3BGWA 3GLFB 3U61B 3K9LA 3PUXA 2JCSA 1C4OA 1OKKA 2AFIE 2ZE7A 2B8TA 1U0HC 3JVVA 2CL0X 5DN6A 4P4SA 1MKYA 1OHHA 2RGNA 3X1ZA 5H5JA 1MT0A 4Q1CA 4HDOB 3LNCA 5KU1A 1Q57A 4TQUS 2VBCA 1N3BA 2OCPA 2OUKA 1E9DA 2B5OA 4QHTA 4OYHA 4V0KA 3THYB 1KI7A 4YAFA 4QL3A 5JJKA 3JQQA 1TF7A 3KJEA 5JCPA 4MGZR 1RRFA 5GVRA 2QTLA 5J4HA 2IC5A 3KX2A 2CBZA 5KUTA 5JZVA 2JATA 3QI2A 5EXPA 1D9ZA 3T1OA 1VMAA 1G8GA 3BC1A 1X8JA 1U9IC 1TF2A 2OTLB 3QXCA 4TLAA 2XB2A 3AF0A 2J5XA 4HATA 1KI2A 3QKUA 2D2EA 2PMKA 1AS0A 2WJHA 1W49A 4B71A 2YOGA 2J7KA 3QFTA 2ZRHA 2JLVA 2A5YB 1RVDA 3BD9A 2JLXA 5FBVB 4OHYA 2XX3A 4LJYA 1YR9A 2QE7A 1KI9A 4R9UC 2A7QA 1D8TA 2WM9B 3LW8A 1VKJA 4PC7A 4O2LA 1XDBA 1KK0A 1FOEB 3CZPA 3IPXA 1PV4A 4PFSA 3I73A 1XF9A 2IF2A 4QC2A 2CK3D 1Q3HA 3TGPA 2BV3A 1G6HA 2PLRA 4FI3C 3WMFA 4UXJA 4OQFA 4LBYA 1LW7A 3FVQA 1G7RA 1EFRA 1KNQA 1Z0KA 2V7QD 4Q7JB 3A8TA 3PXGA 3IDQA 3JZAA 3UATA 1XZPA 2BIFA 3RC3A 3THOA 4RFSB 3CIOA 1NN0A 2ZIAA 3GLHB 3UKDA 2HLDD 3BOSA 2VHJA 1CNEA 1TL7C 1AN0A 3DEFA 4AD8A 1T3SA 1F60A 1LY1A 4ZDJA 3DDCA 1OJLA 3EZ7A 3FMPB 4HUQB 5CDFA 3D8BA 4MDFA 4CEHB 5D3MA 1RKBA 1SKQA 4BUJA 3VFDA 4U5XA 5DYIA 2ZUDA 2NO0A 5E7MA 5TR9A 2GK7A 3DHWC 4B6FA 1COWA 4ZIRB 1G3MA 2IYRA 1XRJA 1AGPA 3HU1A 4Q4HA 3IKJA 3RNLA 3B82A 3AVPA 1Z28A 1TX4B 3BK7A 1W7AA 2OBMA 2FH5B 3P20A 3VKWA 1XMIA 4CEJA 3K8YA 1UBGA 1E79A 4IVPA 2F1IA 2Q3MA 4NMMA 2F3RA 2BMWA 3AKDA 1VG1A 3A4NA 1E2PA 2O52A 1NBMA 4XH9B 5KDLA 3W9YA 1JBKA 2WOJA 4BZXA 4NTZA 1I2DA 4MITA 4AYWA 1M74A 2BMFA 1Q12A 3K53A 5LBIA 1UBFA 3E1YE 1FTNA 1W0KA 3LBHA 4LV8B 2H92A 3AUYA 4PXAA 5FOXA 2OFWA 2XNDD 4YHBA 3QIAA 4CT5A 3RSLA 4IVRA 4CEIA 1ZM7A 4ZCIA 3BJIC 2ZE8A 3U6KA 5JRJA 4P6VF 1KHTA 4P0TA 5JI3E 4DDVA 4DSUA 4WA7A 1K5DA 1OB5A 3G6EB 4BFYA 3OF5A 4IEIA 3HR7A 1YJWB 1GL7A 2ZSAA 3U7HB 2D74A 4MRPA 3EZ9A 1IQPA 3TVTA 1DAEA 3U7EB 3LY5A 1DG3A 3CRQA 2ZE5A 4HI0E 5EZ5A 5CIWA 5GV8A 1QHNA 2CRVA 1ZYUA 4RD6A 1R2QA 4Q7LA 4LHWA 4YDHB 1JA1A 2V1XA 4GOKA 1T9HA 4M4SA 1I4DD 1XXHB 1JECA 2YWEA 1SVLA 2BBSA 2CCGA 1E2HA 2WKPA 4P32A 5JWHA 1GZSA 2FU5C 2JDIA 5EP2A 2WSMA 1OFTA 3EASA 5DH9A 4TMWA 5IF9A 2WSSA 5JWRA 3LXRA 2ZRJA 3K70C 3VR2A 5J4VA 1J9ZA 5FBRB 2XXAB 1XEWY 1T6NA 2LKCA 3HU2A 3B9QA 1QHIA 1DTSA 2NQ2C 4QBFA 2V4ZA 3M4YA 1FNNA 4HLQB 4WXRA 5H70A 2NO6A 5EJEA 3CC4B 3OZVA 1RYHA 2C78A 2NO9A 3VQTA 1G8YA 3ZZUA 2GK6A 3K70B 1RW4A 1XJCA 1LTQA 4RKEA 1U9IA 2BPOA 3HR8A 2QTZA 1W36C 1E9RA 1S72B 1VPLA 4UXHA 1TQ6A 1ZD9A 1NMXA 2AD5A 4KODA 2AK3A 4P33A 4UNSA 3V4FA 1F3OA 4M9XA 5FUVA 4DUGA 1XPRA 2F1HA 2NGRA 4DLUA 2WKRA 1CIPA 2EFDB 3TQFA 2IWRA 1XEWX 3KKNA 2SHKA 4JYCA 3EPLA 3TUIC 4MRNA 4ESHA 1W36B 2QPAA 4JKYA 3BH0A 4DLSA
chains in the Genus database with same CATH superfamily
1YB6A 1P81A 4U7PB 5CBPA 3PE6A 4G23A 1Z6PA 3CYFA 3FTQA 3ORRA 4KBGA 1J0EA 3SQMA 5PGMA 4BP9A 3ASTA 2Q9BA 4X54A 3D8UA 2PIDA 3WWEA 3ZTTA 4CGYA 1BJRE 1FIUA 3QX3A 5DO9A 1QORA 2BEWA 1K7CA 3C0KA 3NQ41 4W9NC 3OQ6A 4WGGA 4CL0A 3BHMA 3KYBA 4MVWA 4EYSA 1AH2A 1K3UB 1JFSA 4IGAA 3G6KA 4UATA 5JQGB 1D2NA 1CVIA 3PF8A 5BXYA 1XZQA 4TZ6A 3GYBA 4BBJA 1TD1A 3DPSA 3U4DA 3DC2A 2FPIB 5CA0A 3NHJA 4QJ4A 1F8UA 1ORHA 2FLKA 4EVQA 2EIXA 3KTFA 1QF6A 1O4WA 3IB3A 1M6WA 1NLZA 4F60A 2EJCA 3RT9A 3OZAA 3KQLA 2PUVA 4ZVQA 1Z47A 1MJ5A 4QHYA 1NKTA 2VJDA 1YRQA 1IDN1 2WFAA 3HCCA 4RW0A 4HO1X 3UJCA 3QWHA 5I9TA 3CLSD 4HN9A 1R66A 4Q0MA 4OPSA 2PQ6A 4LFCB 3UHOA 2WFZA 2QS9A 4MICA 5JS7A 2G9QA 5TQ2B 1KK3A 1E5LA 3BB1A 4AKSA 1I3KA 3N5KA 4YUAA 1SVWA 3CZCA 4D4LA 5LYJB 2HHHB 4JX9A 1QDLB 3EA0A 2PXXA 1I4OA 2GD0A 3VVCA 1GQ2A 4MWCA 1E20A 1R4MA 4MYTA 1YFKA 2GN0A 1U3TA 2OXRA 3IB6A 2GDZA 1YOVA 2NXJA 2ZZEA 1XC7A 3OP4A 4WZAB 1JR3E 3FI9A 3MB8A 1TZKA 3MT8A 3TL6A 1R16A 3N8NA 1XTBA 1IBSA 3C7CB 3PLRA 5A2GA 1ZK0A 1XVAA 1W5BA 1LA2A 2RAUA 4TGLA 4W1SA 5BNTA 1Z83A 4KV9A 5KJCA 3FFTA 4QUEA 3MTGA 2Z9DA 4BKUA 4TTQA 3UGTA 1YIJB 1I8TA 3U7QB 4YR7A 2WWVD 4HVAA 3BM5A 4OHBA 1E9BA 1DAPA 1KQOA 3T3DA 3AYZB 2P4QA 2J0EA 2J9FB 3WBFA 2RHHA 4QDZA 1PL7A 2AJBA 4LCEA 3MEQA 4H7KA 6LDHA 3RLFA 1JPVA 2UYHA 5JASA 1XA0A 1Z35A 4X1KA 4KMOA 5B1HA 1U4SA 3MA0A 4IKEA 1C7IA 1M2VB 2BONA 5LOVF 4FDAA 1IC6A 1PJ5A 3OIUA 1IY1A 4KVGA 3TQQA 5AKHA 1PFKA 4XN3A 3O3MB 1RWOA 2ODEA 1ETUA 1SB9A 2WWGA 4XARA 2AWNA 2B20A 4H0NA 4RDJA 4Z0HO 4NONA 1JPJA 4DZZA 1VYUA 2XTJA 2OYNA 3M1LA 3OY2A 1M1NA 3TTUA 1YVRA 4GWKA 3JSAA 3EVDA 4C7MA 2YZGA 1CJTC 1H8ED 4NAVA 4ARIA 4MIOA 1R5OA 4RD2A 1TVKB 3A6LA 3M6WA 1UBRS 2HUPA 1QS0B 1G18A 1U8AA 1G3RA 4IWYA 3EPPA 4KHZA 3AEUB 2FUKA 4N65A 3OMLA 5BN3B 4TZ0A 1RLMA 1X7ZB 2D3TA 3WAJA 1Q7YD 4BEBA 2D0OB 1XNHA 3DFFA 4OAPA 4FNAA 2X6YA 3WGKA 1OAKA 4PQYA 4S1OA 4AUKA 1OU4A 3QA9A 3THWB 1NNEA 3MTBA 3D4NA 1GGMA 5D2CA 5EIBD 2P6NA 4EY7A 4RY0A 1NKVA 2DMRA 1A4IA 2ABWA 4XUEA 3U4GA 5GGYA 2CXSA 1AUQA 4FK8A 1KI8A 1NIPA 1QVRA 2X0EA 1A1VA 3AEKA 1II9A 1AHHA 1AC5A 1YDEA 3PNBA 3Q0TA 4N0EA 4B3DA 5EXDA 4CMBA 5DNEA 4YPVA 5KU7A 2I6XA 4ZJYA 1X7XB 5F7OA 2D5AA 2XVAA 3UPDA 2YHAA 3HE3A 5EMLA 3LUDA 3LI2A 3GBVA 2OCDA 3FPBA 3HUDA 4JGIA 4MDEA 2RBKA 5TQJA 1AHNA 3KG2A 3WY9A 3NALA 1TECE 1RAGA 1VL8A 1Y3DE 3K6RA 2Y67A 4Y1RB 1NF8A 4OV6B 4XSVA 3X3HA 2DR2A 3FWZA 2AFIB 5K3CA 2C98A 4TLCA 4Y30A 4R71A 1QF9A 2IKSA 2W2NA 1E9VA 2FPPA 2H31A 3TIXB 5I3ZA 4Z3OA 1SA0B 1X8KA 3QI7A 4Y6GB 3RU2A 1OFUX 1ULAA 1WUJS 3ESCA 1DBVO 1K6XA 3HNRA 1SFRA 2O3SA 3H1TA 2ZZFA 1K8AD 4GKKB 3CQ9A 1ZEJA 2ZJ1A 3BS4A 1USVA 1BX0A 3ASYA 1BHO1 1JV2B 4CV2A 1FU4A 1OI2A 3GZJA 4PZYA 3BK2A 2MSCB 4QHSA 4TXMA 4MQEB 2H06A 3ISXA 3SR0A 1YIAA 1O87A 5DEIA 4KJZA 4MROA 3TO5A 2BELA 1M6VA 1XN1A 4WLNA 4HWSA 3HZRA 4WLOA 2OR3A 4WN9B 3UAVA 2DTDA 2Z5GA 3AIKA 3BL6A 3BUSA 2JI7A 1D1NA 3CWZA 4JLPA 3NAGA 4YI5A 2CJWB 1Y4ZA 5BYBA 3ROKA 5AIBA 5CFRA 4N5IX 1ESCA 3RTCA 3O8CA 2D4AA 2PGIA 4CMHA 3DHVA 1QFYA 5SZHB 3OOSA 2Q2VA 4IJVA 3Q9LA 5LYJA 3UICA 5JPDA 3HXTA 1ZCAA 1EX9A 2PN1A 3V2UA 3OQJA 3RT1A 1TM4E 2PHZA 1UP7A 3RE1A 4B6PA 5I7RA 1K88A 2H2DA 3TD2A 1GYPA 2RAPA 5CDUA 1K97A 5C37A 2FZKA 3CB2A 1C8BA 1NVGA 4UVIA 5I4BA 4H9GA 5KWEA 2KMLA 2D5LA 2ZBGA 1CZUA 1EK1A 1TKCA 4O3MA 1XLTA 1SJ9A 4PYIA 1TU0A 2R47A 3WTCA 2DOKA 3D8NA 5ITZB 3U80A 2RE8A 2AWOA 3SF0A 2X2OA 1NOKA 3I52A 2HNBA 3K9GA 4WOBA 1N5LA 4B9AA 1UDWA 2F3UA 5C81A 3MLBA 3F9IA 1RP7A 3WMEA 3WRXA 3WXBA 5JNTA 1ILEA 5IXYA 1B6SA 2NX2A 1WXFA 4JLDA 1SKBA 2Y1XA 1KK2A 2FZVA 4H4CA 5EZYB 3JW8A 1I0LA 1K92A 1MP0A 3WHIA 3BIWA 1EUQA 2WHXA 5T5QA 3CSUA 1VL0A 4EMTA 3R9WA 1BEUB 2GPNA 1Y1KE 4RZQA 3FGNA 4BC0A 1PR0A 4V3BA 4GI2A 4ZVUA 3OQ1A 1JBQA 3VR5A 4JS0A 1RXUA 3DLTA 1Z3CA 1U0GA 1V48A 1VQ9B 4OK5A 3CE9A 1LH0A 1GTG1 3KJGA 1NL3A 1H6CA 4F4UA 2PX8A 2EF0A 1CY8A 1KIAA 5IMSA 4OHXA 1Q14A 5L6LB 2J3IA 1R6UA 3GPCA 4EG7A 3I9OA 4QOEA 1RFGE 4IKOA 3PD0A 4Y7CA 2XWBF 3HDJA 3PUKA 4UBJA 3E9ZA 3AEUA 3OWOA 3RS7A 4WWHA 5DX8A 3DS8A 4I55B 1IN1A 1N77A 2R6DA 4R54A 4C7KA 2O4UX 3THWA 3LVQE 4BJ1A 1SUIA 2ZPUA 2POCA 4L9WA 4CMGA 3W7BA 3DUWA 1EDDA 5KQSA 1UZLA 3PEFA 2UUOA 4K2HA 4F5WA 5LBTA 1EWQA 2DVMA 3SICE 1E64A 4G1EB 1XZIA 2GEDA 3N6XA 1JFVA 4KKXB 3I12A 3KVRA 1X7XA 2ZSHA 5CVDA 4EG6A 2ZRPA 3FHOA 4GLLA 4F91B 1Y37A 2QAGB 3Q3IA 1J4AA 2G5PA 2VSYA 1WM1A 4EUNA 4IV8A 3WQSB 4OJNA 1I10A 3RU7A 4BN0A 1I13A 3OT5A 3VZBA 2G08A 1JR2A 5JZSA 1GO2A 1U7UA 1A69A 1WEKA 4KDFA 4B4DA 5HFAA 4D81A 5CYGA 3P5BA 3FLAA 3DSRA 2VHWA 3FMVA 1U7DA 3FPLA 4GDFA 5FEMA 2W43A 2IY9A 1NI3A 4N9QA 5ALKA 4CW7A 2DY0A 1KSJA 3UC5A 4MVCA 1V7CA 4OLHA 1X42A 2IH2A 2JAWA 3G8CA 1DKPA 1UDXA 3I9FA 1OAOA 1F2TA 3B7PA 1TD9A 4TSRA 4MR7B 5DNYB 1Y8ZA 3NDRA 1J2TA 2I9PA 3HFSA 3ZV6A 4IDGA 2X85A 4WE3A 4UPEA 3IALA 4KQJA 3VZSA 3MJHA 4Q1VA 4NZZA 2CJXA 1T8TA 1LK7A 1QWOA 4MQEA 1ZZGA 1ISPA 5E2AA 2B4RO 3AR5A 4EZEA 2G1KA 2VYFA 5CHYA 1AQ6A 2YNMC 1OXKB 1CUUA 2IL1A 2J5KA 3QVTA 3TZKA 1A0OA 1SPXA 2AOTA 3N8KA 1E6LA 3OLVA 2YINC 1E1RD 3SC4A 3HA5A 5AN9A 4OQPA 4J0QA 4Y2RA 3NUZA 1SD1A 5JD5A 5GPBA 3HUEA 1IPFA 3JXEA 1YV9A 1OBHA 2ETXA 5CA1B 5B3LA 2C9MA 5HTOA 2VP2A 4WD3A 1NBMD 1Z33A 3H94A 4C4SA 5KDOA 4NNJA 4NXMB 2XGGA 2R44A 5C5IA 3D3EA 3D6JA 2Z04A 3SR4A 4ER7A 2X8BA 3AV0B 4PCVA 4V03A 3SEQA 4ZAXA 1XIVA 2VDWA 3ZTWA 2RGDA 5IC4A 2OHJA 2BZGA 3P96A 4WNIA 3LUCA 3AM3A 3GHHA 3PC7A 3WGTA 1XRSB 1KMNA 1Y63A 2W11A 3JR7A 3VYSB 4OFBA 5BNWA 2FLVA 2XUAA 4NPAA 4OQLA 1Q44A 5IAAA 5ITZA 1GIAA 1JYSA 1L7DA 4N76A 1SXGA 1S2IA 1WMSA 1CETA 2IHZA 2YIVX 3ET4A 2W6ZA 4MDYA 4OUKX 1HDXA 2B0JA 2BVNA 4LJ6A 3VOBA 3KOUA 1NP7A 5EZYA 4DIFA 2ZRLA 4HWRA 2XOXA 2Y93A 4TV9A 4ER6A 4DLXA 2DERA 4COOA 1Q0RA 4FD3A 1A27A 2WG0A 1PVDA 1EE2A 2FKAA 2FW1A 1JH9A 4YB8A 4ZRMA 1I6KA 1ZWLA 2C3UA 1T5OA 2H1LA 2JH8A 3ENWA 4LJ9A 1AHPA 3V6LA 1CUBA 3M7IA 3HJTA 2NU7B 2I9KA 4PHTA 3PA1A 1VE9A 2V7EA 1AUPA 2GVDC 3TW6A 1VP3A 4DCMA 2PL9A 2HIHA 3KKEA 5E7IA 1XEXA 4F0JA 3HXOA 4RTNA 1T24A 1KI3A 3HQ4O 3IS3A 3Q0EA 4Q6BA 4RM3A 3RWMB 3DKKA 4EA7A 1UM9B 5ALEA 1X8LA 4RZ3A 4C7VA 1R10A 1JHAA 1NF2A 2ODQA 2R4UA 1G17A 3DZBA 1LD3A 3PR1A 1G16A 2ZIWB 1IAVA 4NSNA 4AULA 3WQZA 2CNLA 2E87A 4I55A 1MB2A 3S1SA 5IYZF 3HCDA 1QHYA 1RM4A 1T2DA 3ZU5A 1TCUA 5G4LA 2NPIA 1CB7A 3JQAD 3M34A 3WRYC 1VKRA 1EB8A 2Y0CA 1RPNA 4BMOB 3B7GA 2PUTA 4EECA 3OIWA 5F3WB 3M49A 2HRZA 3E84A 5DMHA 3IFSA 3AFNA 1GOTA 2PZEA 4OGLA 3B8EA 2X7XA 4TKZA 2QB5A 2DKNA 1F4VA 1PV2A 1ZN7A 3GLGE 2NTJA 5A4DA 3GVJA 4UNRA 1YA4A 1JQ5A 3ZGYA 1Q1NA 3JQ9A 5F5NA 4U0KA 4EUSA 5ADWA 4UUMA 1ZKMA 2C9ZA 2C2YA 3IQEA 1M2NA 1E7MA 4FUQA 4IY1A 4BRUA 2BUAA 5LN1A 4CMJA 2B2XA 3R3JA 2DLDA 1K4KA 2XODA 4WESB 1VYVA 1FTSA 1YS7A 2MWMA 3E7FA 4Z4UA 1IJBA 1C0EA 1M3SA 2C0CA 3GMTA 3W8NA 4B75A 4BVEA 4DLZA 1PKEA 3H17A 3A06A 3KVYA 3VHQA 4WXPA 4EIWA 5KZMB 2XQKA 5SY4A 4CM1A 1N6OA 4RZ2A 1JVSA 5I47A 2XD9A 1JRLA 1JLLA 2PYIA 4DA7A 4WERA 1SUWA 3KB8A 1Z4OA 2LZJA 1NJSA 2DBZA 1PW5A 4N7MA 4TROA 5I7AA 3ENVA 3F1LA 2PRSA 3G5TA 1I5OA 3BMCB 2NU9A 3OWHA 1D7OA 5EZ6B 4GPTA 3SKVA 5JBIA 5BUCA 1C2YA 2PEYA 1GKKA 3A8IA 2PLWA 3ELWA 3OG9A 4DYHA 3NR2A 5EE5B 3E9QA 3L18A 2XTAA 4M36A 3CPHA 4Q3CA 4HQLA 4C0AC 1I3LA 4XM3A 2DG2A 2Q4EA 4OVKA 2P3MA 4U2FA 2KB0A 1XEAA 3GEGA 3TAUA 4A6XA 4YREA 5AVYA 5CA1A 1O0SA 2CFRA 1VKZA 2ECOA 2X86A 4BLSA 4QXQA 1XFAA 4DV1B 2EERA 1LRJA 4TS4A 3ZI7A 1IXYA 1L1RA 4ZKEA 5IK2A 1TJNA 5FBKA 4EYKA 3IVMA 2L19A 3R7DA 3CO0S 4B2YA 3SQDA 4DZTA 2HCBA 4H7JA 3LUJA 3KQQA 2OKCA 3L8ZA 3QE2A 3OT1A 5AW0A 4CDNA 3NC0C 1ST3A 3C6YA 5DXJA 1YR2A 4RPJA 1XF1A 2EZTA 3SAJA 1FQJA 1QZXA 1RABA 1SBIA 3OOEA 4PRKA 4R01A 5B6JA 1SKYB 4DMUB 1OXVA 1ZUHA 1YIDA 1QFMA 1QLJA 5DBFA 4QEZA 1PNVA 1E3WB 1FRNA 1TTTA 1Z56C 3DOIA 1EXVA 1GEEA 1EIZA 3L93A 3FYSA 2H59A 3UT5B 4D99A 4ZTZB 4BQNA 3FETA 5FOQA 5FI0B 1WW3A 2A84A 1GEGA 1RKVA 2QMHA 4UFOA 2XKJE 1G8AA 2PMEA 1EBFA 4JL8A 5C1IA 3STVA 2Q2QA 2ZZGA 3H3FA 1PDOA 4PC3A 3COPA 3PDWA 2FZ4A 3IHWA 4RETA 5F76A 2JNWA 4F5ZA 4MK4A 1BVUA 5T4BA 4XYMA 1NYRA 1UM9A 3UMRA 4FLFA 2WHPA 3CX3A 4RKFA 5KTYA 2QRVA 2ZPAA 4D45A 5JO9A 2D1TA 2Q1UA 3FAKA 3NI2A 4A0RA 4GL4A 1F9EA 1KZ4A 1R1DA 2BEKA 2UXCB 2FSVC 2AF3C 4X3PA 4C07A 1UDBA 1L4HA 2B4AA 3I6IA 3RC1A 4FUTA 4ND8B 3GK3A 1VSBA 1KSHA 4NQZA 4BCCA 8AT1A 2H5EA 2VP3A 2OWDA 4HQNA 1P4MA 3VSBA 1PT8A 1U65A 5E8RA 4O3FA 4DWVA 3D6TB 2I67A 3D6AA 3D8TA 3L9XA 4AI6A 4EYGA 1QNLA 2Q5CA 3GEEA 2WG1A 3LAWA 3FUVA 3V9AA 3ZY6A 1VHEA 2I4IA 5T57A 3ACDA 2VVTA 3G9ZA 4XIFA 3B6JA 3NXKA 4XTRA 3SVLA 3AB7A 2V74B 1KOFA 1FDIA 2B7LA 4JODA 5KYWB 4UNNA 4AP5A 3U19A 4IIUA 3QX8A 2PIAA 4PONA 1OE0A 1V5GA 5C9ZA 2R5WA 1D5CA 2CKMA 3K6JA 3FMOB 4KXQA 2PT5A 4IDQA 3V9PA 5L45A 2YY6A 3OCUA 5KX5A 3AM1A 3C6XA 3CJRA 1HOXA 3L5OA 3KYDB 1FYVA 1KO8A 1D0IA 1SZDA 2E5WA 2OC9A 2PMFA 3B1JA 3NIBA 4YASA 1GPLA 4PX5A 4ZQFA 3VR6H 1K7FB 3RUEA 2JH3A 4IR7A 2EKPA 1H2BA 1PR5A 1QQTA 3L7CA 3MT7A 5E3IA 4JL5A 4UAUA 2WIJA 1JQAA 3NWEA 4PQFA 3I28A 1IJEA 4D9EA 1TA9A 1UBKS 4KQ6A 2QTHA 3MSCA 2OB1A 4P26A 4BXOB 3L1VA 3EXAA 3GLFA 4KNYA 3CMMA 3OLWA 4YQEA 1T8WA 2NVUB 4A8TA 2C2GA 3I6ZA 4KWCA 2BGWA 1JJAA 3VUEA 3WKDA 4IJUA 5EE3A 4YMTA 1QAQA 1RI4A 2E4AA 3BMCA 2OZEA 4F12A 4FB4A 1KDZA 4WBNA 4F45A 3U5TA 2X1LA 1GUDA 2PZKA 1EP3B 1BQ3A 1TTQB 2IU4A 2VT7A 3IERA 4IMRA 3FZYA 4F21A 3LBAA 2REQA 1RMTA 4LFAB 1T1EA 4IIEA 4CG1A 2Q3EA 1UC5B 1SCBA 2CLMB 1UEJA 2JGIA 3AUXA 3HCPA 1Q1AA 1FTGA 1Q0HA 3NKLA 4IXMA 4M83A 5FF9A 4F04A 1AK9A 2EW1A 4ZT6A 2G4LA 3K35A 3WBJA 2I4LA 4Z7NB 5BV2P 2ZI7A 1G5RA 5J43A 1O9HA 5KTOA 5BMOA 1ZBQA 1UMCB 5HQJA 1VLLA 3FPSA 2B36A 4Z86A 5JYCA 1W1IA 3GUUA 1H0SA 3ABOB 4LJ4A 1KKLA 1VLJA 4MPRA 4EFKA 5I4CA 4AY6A 2UYOA 2CNWD 3IEKA 3LVBA 5FAXA 1VIYA 4BNHA 5JNSA 3EEOA 3ODGA 1AZWA 5BSGA 3JWJA 4H6XA 1FP6A 2QROA 3CBQA 5AJTA 1VJDA 4P3XA 3L1IA 2FP4B 3L4BA 1ZOSA 1RHRA 1UKZA 2VWHA 3PQEA 4JUBA 1NR1A 4EJSB 4NMLA 3ZDAA 2IWHA 3FOAA 1N6PA 2B99A 1RYZA 4JI3B 1DFGA 1X7GA 1YJ9B 1E3WA 2WK1A 3IP7A 1I4LD 2BOVA 3C24A 3JVIA 3JYNA 1XZEA 2BZSA 4KDEA 4LSGA 5GZ3A 1ZSVA 2ZK7A 4LRXA 4E2ZA 1CY0A 2X2PA 1KP9A 2ZWOA 4PVCA 1PT9A 4Q9LA 3QW4B 3UOAB 4TV8F 4BLUA 4RK6A 1E2BA 1BEEA 2EQ5A 4KYUA 4LV5B 3T5DA 3P8ZA 4Z7OB 2VCHA 5JZ9A 1HZZA 3TAXA 1DE0A 1BMTA 3R7WB 5HRAA 3WLAA 3AUTA 1NU6A 1JA9A 2GYWA 3WL4A 4H18A 4YMVA 1O94A 1QMPA 4XSHA 5FA6A 1DAIA 3QUQA 1HLFA 2G9VA 3N7UA 4J3JA 4WUTA 4ZOCA 5CITA 5CB8A 1RR6A 2FW8A 2PGAA 4BVFA 3OQNA 2VTBB 4PFKA 3NRBA 2GBFA 4JELA 2A1UA 1QBGA 5IHXA 4L8FA 4KGXA 1J8QA 1F0YA 1IULA 2P9QA 4PTLA 4IV0A 4ISBA 1ONNA 1D1SA 1KEUA 1P9LA 5F1PA 1T0JB 3ZK8A 4Y18A 5LLDA 2FRXA 1O6GA 3EWIA 1TLFA 4X95A 1ZJWA 2Q2WA 3GAAA 5E9WA 3AH8A 5FAKA 1WS6A 3WGYA 3NP9A 4MW2A 3WK6A 4BGDA 1V1MB 1TB4A 5THQA 2C7PA 2JLUA 3P32A 2QSJA 1QFXA 3VAYA 4G24A 2XSZD 4JJ6A 1GAXA 3S2UA 3CF2A 2BKXA 4DR1B 4FMCF 2X41A 2Q5HA 4WH0A 2OV8A 3C39A 3C48A 4TVBA 2OLEA 4OXKA 1GUAA 2X1MA 4QXAA 1V16B 1XCMA 3KHKA 4MVJD 4NE7A 4TKMA 3ZUPA 4FM9A 5G2OA 2ZDHA 4WNAA 5TVKA 4IMPA 4B74A 4E5NA 1ISSA 1I1NA 5J2TF 1CUIA 4LY3A 4BVKA 2O50A 2R8PA 2C9DA 4LSWA 2V4MA 1T1IA 1UBUS 2VAXA 3ESBA 3GPBA 3WGVA 2GBGA 2I1LA 1RD4A 3EGEA 3IEUA 1V41E 3Q9SA 2XB4A 4WEQA 4D4KA 4U6NA 2PJZA 1Q83A 2O8BB 1AKNA 1VZ2A 3N0RA 2FEWB 2V58A 4EPVA 1E32A 3KQVA 3F6SA 4JDUA 2P5YA 2XZTA 3EULA 5IVHA 3HKBB 1NONA 3IOCA 1P6QA 4QPZA 4LKOA 2NVOA 4U2EA 4X7RA 2PYDA 4EA8A 1JQBA 4TQ9A 3INGA 4HNUA 3KOZA 4F5DA 3A35A 1YTLA 4G9GA 4RWEA 1QH8A 4P98A 1MB9A 2EJBA 3AZQA 4BXOA 4QT0A 1OTHA 3DWIA 2CZQA 3BX1A 4FT2A 4O2AF 3WK8A 1GZHB 3LPAA 2F00A 5ICGA 4ARBA 5AM0A 2XEXA 3IDZA 1P5RA 1Z0JA 5IJZA 1XYGA 2PX0A 3MCTA 4HLDA 1XQYA 4CKWA 1MENA 2OWEA 4O4HB 1Z73A 3QKSB 1YMVA 1QK5A 4FKZA 5G1NA 1U1GA 3L2OB 4D3XA 5K3OA 2CVFA 3PU6A 5G0WA 4J0HA 2PFGA 3AR7A 1NZJA 5K01A 1RCTE 1UWKA 1LSUA 1TYAE 1DP4A 2C97A 3RUHA 3KSUA 2RGYA 2ZT5A 3O8DA 4PG8A 1MX9A 1N5DA 2ZT8A 1RQNA 2G80A 1UMCA 1P4JA 2RSLA 4R7GA 4D4HA 2JLWA 4LF6B 3MCUA 5DIFA 2ZJ5A 3DQPA 3ELDA 3NU1A 1DO2A 2G6TA 4H4DA 2DFNA 4LDQA 2YCLA 3DBIA 1QQ5A 3PUIA 3HAGA 3D7MA 3ANTA 1O77A 2WZQA 4J0IA 3DT8A 3OY7A 4ED9A 3WIUA 1X92A 2FP4A 2VAWA 4DOMA 3P9KA 5ALRA 3RTDA 4MWGA 2IYEA 4TOIA 2WVAA 3T35A 2R9VA 4HAVA 5KSOA 2YXBA 4TXNA 4HUTA 5IVIA 3RC8A 3NXSA 2WR8A 4R2JA 3R7SA 2I7DA 2R1TA 1UDAA 3G7NA 3UMJA 1ZVVA 3I83A 2Q3CA 3KUCA 4G01B 1PUXA 2XW6A 4I5IA 1DIAA 4XD7A 1NVDA 1X7YB 1OLUB 3QZUA 4H7FA 5HUJA 3DMGA 4G0XA 1Y1LA 1XP5A 5LQUA 2G0TA 4NE2A 1ZDMA 4B40A 1UKYA 1NUPA 3R5TA 5EE9A 4ZCLA 4YO7A 3R7WA 3ZHCA 1KZGB 1VHDA 4GPEA 3E8SA 5T8KC 2PD3A 4OXIA 3U13A 3HCRA 4QPCA 2O5CA 1MO6A 1WB4A 2CFTA 3GF4A 4C01A 1CP2A 1BFKA 2W83A 1QQAA 1MORA 2WJAA 2FCRA 3QEJA 1QH1B 3OQIB 4DNOA 5AD1A 3QXJA 1Z15A 1S02A 3UVEA 2OPHA 2PS9A 1QYVA 2JLAA 4E30A 4M9CA 1NBHA 3QWBA 4QYTA 4PHGA 4DNPA 3MJ4A 1NQOA 5CAEA 5H7XA 3U1VA 2IX3A 1MJGM 3OU2A 2V0CA 1FBNA 5KQLA 3AWIA 4R2WA 2F1MA 2F43B 4YAIA 2R0QC 3CF0A 3BJEA 1KO5A 5TMEA 5LUAA 2PR7A 4HS4A 2VH1A 1WUYA 3SOZA 3AI3A 2CLDX 3CEHA 1XK7A 1E6EA 4YUWA 5BR4A 1QGUA 1WBBA 4FONA 2PUCA 5FBZA 2MR5A 1V2HE 3WE7A 5JUWA 4LJRA 5JYEA 2WLTA 1WCYA 3WA7A 3QKTA 3TOZA 2B30A 1C0KA 1E63A 1SUSA 4RL6A 1ZK4A 1SXJE 2O7SA 2I65A 4HDQB 5DVZA 4Q1AA 5HKKD 1Z18A 2CL7X 2DQKA 4YECA 1HTWA 1JX6A 3FCYA 3JQ8A 1OTXA 2W6JA 2FR0A 3BB3A 4DB4A 1D6SA 5A2QA 1UANA 1NTOA 5FHQA 5LDDC 2FN9A 2WHYA 2XITA 3AHEA 4PAAA 1H0KA 3PUVA 4IP0A 4IUYA 4OBXA 1H93A 5FRDA 3UXMA 2Z1NA 1NXVA 3ETLA 3UCEA 1XR3A 1YXMA 4RIIA 1BXRA 1KNXA 3GBSA 1HDGO 4RY2A 4YLGA 4AQDA 1D2MA 4D82A 1ZM2A 3F1KA 3O84A 4KR3A 1OX5A 1W2HA 3O2NA 4CF4A 4DQUA 1NYQA 3HDQA 2DTXA 4ENQA 3PQ6A 5JFOA 5DWDA 3RS4A 4QNRA 4RTPA 3LBYA 2UVDA 2BM9A 1PNOA 4CV0A 3SC2A 3GLIB 3HY4A 4B76A 4UOZA 3JPYA 4MUXA 1WU8A 3GH1A 1K6MA 3ILYA 4UMVA 4O4HA 4D57A 5IT0A 3QKSA 5EFOA 1EVJA 1ESNA 4A15A 2P8JA 2O5EA 4A8JC 1AXGA 2JHFA 2YV3A 3T4PA 1Z7WA 2Y66A 1HG1A 3JS5A 3TFWA 4BWFB 5CFMA 3L6UA 5HOEA 5JAHA 5F4MA 1BH2A 3BFXA 4YMWA 3UFXA 5KOIA 4TRRA 3RADC 2ZXUA 3SY8A 4NBSA 1Z13A 4DBLE 4XEUA 4GO1A 3E9MA 2C58A 2O3UA 2YNMD 1J56A 3VDRA 3ZG6A 2FMXA 1MOZA 621PA 1BJKA 3BA6A 2CXRA 1JHMA 3KDSE 3TIVA 5BSKA 1I4TD 2N46A 2JJYA 5F52A 3PUJA 4LGYA 1LWOA 2WIFA 1FZTA 3T5GA 2LCFA 3L84A 1JNYA 2NW6A 3OE4A 3OIGA 3U17A 4N5HX 5JHHB 2X58A 5K8TA 3H83A 1NFQA 1BX1A 2VNAA 2DBRA 2V4DA 3GAMA 3QLVC 3PXDA 4K46A 4LDRA 3J7TA 2GF2A 1PGJA 4JFAA 2J09A 2CUKA 5G40A 3SS8A 4ARSA 2MCFA 1N7HA 1SCKA 3CR7A 3HKCB 3EAFA 3ZE0B 4AYTA 4CHTA 2GM9A 2XB9A 4JP3A 3KPVA 4I9NA 1ECLA 1KFJB 4OQEA 3HCOA 1AQYA 2RKWA 4A6DA 3X1MA 1JLHA 3DZIA 4B7AA 2X3YA 3I1IA 2YXPX 4XGNA 4A2PA 1EFPB 1O9BA 1TQ4A 2V96A 5DOZA 2CWDA 2R8ZA 3O4FA 3PPVA 1I2MA 1N4DA 2WYHA 4R5MA 1C1DB 1P9NA 1NVEA 4AKHA 2KHZA 1NVTA 3FCCA 2ZTVA 5IYWA 4JENA 1L5HB 1YJAA 3Q10A 4AJPA 1QZZA 4B0OA 1VCNA 2P6PA 3TLYA 4KFCA 1UF9A 3EXG2 3PKZA 4XA8A 1W35A 1O95C 4KXVA 1VPTA 4P4LA 2Q5OA 3KE8A 3UXYA 3FNBA 4B9EA 1C0PA 1NJ1A 4MAMA 4X9XA 1WZ2A 4WLVA 4COKA 3I56B 1QH1A 1XCBA 4INPA 5CX4A 4FYPA 2W8BA 3T94A 5L51A 3NMUF 3HXMA 4FBMA 4JWTA 1QM5A 4MARA 5H68A 2I3BA 3PICA 2JF0A 2CNDA 1OFUA 1Q50A 4CM8B 3JD2A 3NHFA 2GR9A 1U1EA 4JXKA 2QQEA 4AM8A 4PYRA 2F4VB 4M1KA 1L7EA 1PZNA 1RXIA 3DMRA 3JQGA 3L0SA 3Q2OA 4JNKA 3DYIA 3K4PA 5FV7A 1ADCA 1TMOA 3K8OE 3WQBA 2YV4A 1RC0A 1V3TA 1BS2A 2HBQA 2WJWA 2ZB2A 4L85A 5DM2A 2Z6QA 3F4KA 1TUBB 1TU4A 2ADFA 4RMNA 4V2UA 4QOHA 2IDMA 1Y4AE 2YOHA 1LI7A 4GG1A 5HZHA 3ZLJA 1S1MA 5IHPA 3OKAA 2QLMA 4JVSB 3A4VA 1EDZA 4RHTA 3T1NA 2J8ZA 1NQAO 2X4IA 3LLUA 4UDYX 2Z6UA 1MC5A 1M8KA 3B89A 3FJ1A 4CU2A 2WTNA 3A28A 1QU3A 3KLOA 1XZFA 4X1YB 3RC9A 3TL3A 3GGDA 2PZMA 3QVMA 4DBZA 2AF4C 2GAAA 1X19A 3T3PB 2M1XA 3RYCA 1JDVA 3ZWQA 2FSGA 3ILXA 1XZJA 3V7YA 4BNIA 5JDIC 1SH7A 3RKUA 2X9LA 4NCAA 1V71A 3ORYA 1L5KA 3W6OA 4RXMA 1E9CA 3EZLA 4PYOA 2WE7A 2DQ4A 3VYWA 1T10A 4DIDA 2Q0QA 1PQ4A 3QX7A 2AZ4A 5GAJA 2JFUA 1VE5A 4D44A 1IZ0A 2WWWA 3P9SA 3EXIB 4D25A 1C7RA 3U4HA 1A96A 1JJVA 4HEA6 2P0AA 4ZU3A 4ZMSA 5C35A 1ZAKA 5C4GB 5JV5A 3WSWA 1Q0TA 5TT0A 5GV7A 1SRRA 2AIRA 1U8CB 4GE0A 1SUEA 2B9VA 4LYEA 4YPFA 3ZOKA 3FKJA 3BD7A 3Q2IA 4P2BA 4CMCA 1VQ6B 1TFRA 4GVPA 5AJVB 5KOJB 3ESAA 3DDUA 5EKSA 2R25B 2WF8A 5IAOA 5AKLA 4ZO4A 2WD7A 4EEKA 1K7YA 4L15A 4DLKA 3KHSA 4FTWA 3HU3A 2P2ZA 4DT1A 3Q15C 3PWTA 4HTFA 4P80A 1Z5GA 4GXRA 3WDKA 4ABYA 3CU5A 2YZ2A 5DNVA 4Z9XA 4CKBB 5CM9C 5JADA 1M1UA 3ESXA 4FSXA 2MT9A 2O0HA 3S28A 4GBGA 3Q87B 3F6CA 3IVAA 3H87A 4URHA 1QIJA 4OSPA 3C6MA 3VNSA 4ZRDA 1RIIA 5D1HA 1VGQA 4IUDS 4XWAA 1XL0A 4QUHA 4E11A 2A30A 4EI9A 2QUBA 3AI2A 4ASUD 1VBKA 1S7CA 4UW9A 3VBCA 1IH8A 3AEXA<