2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
1BX1A 3VHLB 3KXLA 4Q47A 4JLNA 3I56B 1NBMA 1S1CA 1XD2B 1SHZA 1U0JA 3DVLA 5FI1B 1E3MA 1M7GA 1S1MA 4BLTA 4FMBB 2X8AA 4FMCB 3KQHA 1N8RD 2XTMA 5FUWA 3FKQA 3W34A 3CX7A 1D9ZA 3O8CA 1E2JA 3TW8B 4IOLA 3L0OA 3T12A 4AKHA 1U81A 1UBFA 4AI6A 4NYJQ 4ON9A 1KJYA 4FINA 4C0LA 3QKTA 4KITB 3THWB 4D0LB 1E9BA 1PLJA 4CEJB 1NJID 2ZS8A 1FW6A 1R4AA 1MRSA 2IEYA 3ZZTA 3LW8A 4A6PA 1Z5ZA 4RZUA 1PV4A 4CF7A 2I1QA 4J0QA 2IBMA 1Z2AA 3KJIA 5G53C 2DFNA 5FUVA 3CB4A 3TRFA 2D7DA 4NU0A 2X2FA 3M4YA 2O8EB 3IEVA 5CM9C 2NGRA 4AF7A 4OI1A 5IK2D 1UAAA 3L43A 1JR3D 2KWIA 4HDOB 5JCZA 2QMOA 3KKQA 4F38A 3U6KA 1GFIA 5KUTA 1ZW6A 1U0HC 3A1VA 4E5UA 4MRVA 1NSFA 1UJ2A 3OESA 4LJYA 1VQPB 3GEEA 4Q1AA 4JVSB 1M1KD 1E2QA 1OXXK 2EFHB 4ASUA 3GQBA 3ZQJA 1W4AA 3FE2A 1DDGA 4QGFA 3QVVA 4AG5A 4BQSA 1E1RA 1G18A 2P6UA 4GP7A 5K8UA 2RGGA 3KJHA 3NEJA 2O8DA 1Z3IX 4KVGA 2E9SA 5TV2A 1V5WA 2K5UA 4AKEA 1YZLA 3CNOA 2BHRA 1GKYA 3B9PA 2W6IA 4P4SB 4Q18A 1G7SA 1K5DA 4URZR 4OKSA 4LYJA 1E32A 3A58B 4ERNA 1WE2A 1X1SA 3W6NA 5FBLB 1W4CA 3EPJA 3FMOB 4YLGA 4W5JA 1CBUA 2H92A 3IEUA 1GITA 5L3QA 4RKFA 1T4GA 1AQYA 1R2QA 1BO6A 3LAWA 4BFWA 2VTKA 4NPHA 4FMDF 2HCJB 3OZWA 3BAFA 1L8QA 3CONA 1OT3A 1OH7A 4D80A 1TMKA 1E99A 1HA3A 3CIOA 2GK6A 4CEIA 4P3YA 2DCUA 1R5BA 1P3JA 3CF0A 3IUYA 3EG5A 2QAGB 3QBVA 4WW0A 1BKDR 5CK5A 1Q7YD 1VYTA 1E0AA 1RW4A 3DDCA 3FWYA 4TQ9A 1GNQA 5FUXA 3A1WA 2ZREA 3C14C 1NMXA 1B23P 3T1OA 4KFRA 5C4MA 2GXAA 3CNNA 3F0TA 3WYGA 3GLHA 2O0HA 3QF4B 4QOSA 1I4TD 4M9XA 4KAXA 1QFJA 4KYUA 3FB4A 3Q8XB 2Z43A 4U5XA 2RGNC 2XSZD 1G8PA 3O8BA 2AWNA 2J0SA 1E2MA 1SVIA 1WQ1R 4TQUS 4DDTA 1PVOA 2BC9A 1OXVA 4TT3D 2H8KA 4ZGQB 3PUWA 4F92B 1SZPA 4Q21A 4GPTA 1XEWX 4HUQB 1KTVA 2ZANA 2BBOA 5J47A 2VP9A 2ZI7A 1ZJ6A 2VHCA 3V4RA 5BXQC 3T5GA 1VQ4B 3AVOA 3E70C 2ZE7A 5CJPA 2FWRA 3UMFA 5BN4A 1VDZA 2WPDD 3GLHE 1TF2A 3T1TA 3AQ4A 2OILA 4MRRA 4QJ5A 4CEHA 1RJ9A 3CCMB 2GXQA 1VYVA 4JBYA 4UNNA 5G41A 1FUUA 4AKGA 2QP4A 4IHQA 2NO6A 5FTMA 2QTFA 4BEBA 5CDFE 3SZRA 4I1OA 3DPUA 121PA 3I4LA 5GADl 3I55B 4WIAA 2GETA 1BX0A 4NYMR 3LO5A 4Q1BA 1D2EA 4I1SA 1I7PA 3OZXA 3ICQB 1KY2A 1T8UA 3G4SB 2C96A 1CR0A 4OQFA 4JMPA 5G3ZA 2RC5A 3LBHA 4QGGA 5KO2A 1AGRA 2VQSA 4PAMA 2IYSA 1J8YF 2ZAOA 4FCTA 1KK3A 1N0UA 1W34A 1G9XA 2XTNA 2ZS7A 1JAHA 1NN5A 3I73A 4PXAA 1KK0A 2ZSFA 2BDTA 3DZ8A 5CB8A 3FHTA 4ZDKA 3CPEA 4Q9IA 3AVYA 4II7A 4A92A 2NPIA 4PAOA 2EWVA 4RD1A 1FUKA 2QP3A 4NDZA 4B3BA 4PGOA 3BS4A 2PLFA 3OAAA 3SC3A 1U9IA 4BRUA 4ZO4A 1E9AA 3H84A 3P4XA 5BWMA 1MV5A 1VQNB 2G83A 2YNMA 3EZ7A 1BJKA 1Z28A 3GFPA 721PA 2W2VA 3OEEA 1EX6A 3FJOA 1F2UA 1YZTA 1AZTA 3P20A 2YV5A 1E1QD 3K0FA 3PUXA 1CQXA 2RC6A 3CC4B 1RJ9B 3TSWA 2WICA 1Q21A 3MCAA 3U60B 3TKLA 2QM7A 2G6BA 4OJKA 3ZIAD 1FNBA 3K9HA 5THXA 4DLXA 2PJZA 3B82A 1OFTA 1VQOB 1KO8A 1KZ7B 2C9OA 3F5FA 1M1YE 2JGNA 3NXSA 3OFNA 3QE0A 4IDOA 3RC8A 1UEIA 5B58C 1F20A 1AJEA 3VAAA 3WBJA 3OEHA 1PZNA 1JI0A 1WBBA 4DXAA 2ZRDA 3OJXA 1UEJA 2CNWA 3TBKA 3G0HA 2ZYVX 4BPBA 3CMAB 4B74A 5EXXA 3E1SA 2DFTA 3X1XA 2ATXA 1E4YA 3D3QA 1XXHB 2V7QD 2WSMA 2AXNA 5SZHB 1X86B 3CH5A 1KMHB 3QF4A 4IVQA 3BB1A 1GRRA 1TQ4A 3AVTA 2RGDA 1DAGA 2OV2A 4OK5A 3U7EB 3B13B 4MUAA 4PC2A 4HLUA 4LYHA 1J7KA 1Z6GA 3GJ6A 2IYUA 2ZS9A 3N70A 4M1TA 4C0JA 4DDVA 3B1YA 3EPKA 1MO3A 2BM1A 1NKTA 2REBA 4RZ2A 2NO9A 4YXWA 2C78A 2ZETA 4F4CA 4P33A 1GJRA 1Q12A 5CIQA 3N2EA 3MWJA 1DAFA 2QZ4A 3QOFA 3W5HA 4RCZA 2QDXA 1JXOA 4RFSA 1ZBDA 3LA6A 1E96A 3HU3A 5FL3A 3U4QA 4URVR 2QRNA 3CCEB 4OHYA 3EIHA 2FDCA 4LUCA 2WWGA 2ZRHA 4C30A 2PH1A 1RRCA 3OIUA 1E9EA 1VHLA 3TR5A 2G88A 2ZE5A 3AEZA 2RHDA 4QHSA 1YU9A 1H42A 2G77B 1FRQA 1ZNXA 2OTJB 1SKYB 2Z0MA 3B5JA 3EW9A 1FDRA 1FP7A 1GL9B 4YAUA 1W48A 2HJVA 2FV8A 2VH5R 4Q4HB 3OJWA 5FPYA 3U3RA 3VMFA 1XPOA 2KI5A 3GLGA 1EXMA 2R8RA 4URWR 1XP8A 1SXJD 1EK0A 1UKZA 4XD7A 3QENA 2QENA 1BYIA 3A4MA 4YONB 5CITA 1K9MD 4DLRA 1I4LD 2F55A 2D7CA 2ZXUA 2UKDA 1FQKA 3OW2B 4IVRA 2B21A 3CRVA 1O87A 4B3GA 2QPTA 1L4YA 4NMMA 1RRGA 5DI3A 5GJWC 4GNKA 2GCOB 3SR0A 1E2HA 4IXMA 1TLLA 2NPFA 3B6EA 3JZMA 4MRSA 1EFRD 3GJ0A 5JBQA 4IFEA 4M8NE 4TTRA 1N6OA 3FFBA 2CEAA 4EPXA 1D5CA 3SYNA 1PLKA 4TN1A 4A4DA 1TU3A 3KXIA 1E1RD 2UVQA 1M7BA 2GNOA 2XNSA 4GFDA 1NN0A 1NVVQ 1KK2A 2ODEA 3RC3A 5JCPA 5FTLA 1GKIA 3NKVA 1XMSA 3U6BA 2QMHA 2G1KA 2ZRLA 3UWOA 2OE2A 1VQ8B 4I4LA 4LK2A 2CBZA 3VTKA 1W0JA 4YAOA 3U44B 1COWD 3L82B 1TADA 4NYIR 5EP3A 2YWEA 3SHFA 3PITA 2B6HA 1ZCAA 3CC2B 4RKEA 521PA 3AF1A 2B8TA 2AFIE 1GL6A 2VHUA 2D62A 4YMUA 1YI2B 2VL7A 3LVBA 3TJZA 4ZCLA 1UDXA 1KSGA 3IHLA 4DUGD 3B78A 4TWZA 2AR7A 1JECA 1E9SA 3CH4B 3I92A 4LI0A 1XWIA 3CCJB 1CLUA 2MMGA 3CWQA 1XTRA 3DHWC 3MG9A 2F43B 4A6XA 4E07A 3QG5A 1O3YA 1P7CA 3QKSB 2BEJA 4Q48A 3QKSA 4QXAA 1Q1ZA 2W0SA 4V0KA 1E2FA 3RRMA 5KU1A 3I5YA 1R8QA 4AKIA 2F43A 2QSZA 4HAUA 2ZAMA 3AH8A 2FX3A 5JZVA 1JR6A 2ZRGA 2ZQ5A 1VQMB 3KX2A 3PEVA 1VCMA 4D0NA 3CWZA 1FP6A 3LV8A 1XEWY 2IHBA 3TAUA 1NLZA 1JEDA 5HPYB 4JLOA 1XPUA 1VTKA 4YALA 1XPRA 2VA8A 1YR7A 2QP9X 1FPMA 3QXXA 3IIJA 3K70D 4A2PA 1RYFA 3QJYA 2QEXB 1HQYE 5EP2A 4PC6A 2GVDC 1MKYA 4GT1A 2J3EA 3C5HA 4S35A 2JCSA 3SFVA 3V4FA 5FTKA 4D4KA 1LS6A 1NN3A 2W6ID 3KTAB 1KI7A 2XGJA 2DHRA 4GBMA 2REXB 3X1YA 2IS4A 5A5GA 1Q86D 1G64A 4QJ3A 5CYOA 3UXMA 1JEEA 2BBTA 5CYPA 1KDTA 4NCIA 1P2VA 4PPFA 3W6OA 1IONA 1DBSA 1W2BB 1G5TA 1N6IA 1ZUIA 1DO0A 1ZUNB 1R8SA 1VG0B 2X77A 1JBKA 2V54A 4YQFA 4PQRA 2V3CC 3L0PA 3R9IA 3OZVA 2VYFA 4RFVA 3PV0A 3RS2A 3EC2A 4JLKA 2Z83A 3RYTC 1KKMA 4LBZA 3MWLA 1YJWB 3OIWA 4PSKA 3VU9B 3VKGA 2IWHA 2ZRKA 2WSSA 1DE0A 2GHIA 2H18A 3AGPA 2GJKA 3OZUA 4N3NA 2GEUA 1P9NA 2XITA 4X8HA 4QKQA 1EFCA 3ZH9B 2FSGA 5FL7A 4V0OA 1QG0A 2BBSA 4WOPA 2IHYA 3W2EA 2F1HA 4Z8YA 4EFLA 5BN3A 4IXNA 1Z63A 2ZEJA 5KDOA 3EPHA 1DARA 4PO1A 4IW3B 2G0TA 4ZKDA 1KAOA 2FNAA 4XOIA 5IK2A 3CX6A 1KHTA 1W2HA 4U02A 3THOA 2LKCA 2QQEA 3DO6A 2IUSA 3KZ1E 3WY9A 2XB2A 1D2MA 2CHGA 3FHOA 2CK3A 1EFTA 1PUJA 1Y3AA 1DTSA 2VSOA 3BH7A 1LF5A 4Z51A 4MKFA 1LB1B 1E63A 3NBFA 2IF2A 4LWZA 4A8JB 5TARA 4LJ4A 3CCQB 4EIWA 1UBGA 3T06B 2D3WA 2ZSBA 1ZINA 2IF0A 5TR9A 2QA4B 1TTTA 5JWHA 5KTYA 4Q1DA 1IXZA 4WVFA 1Q1EA 2CMKA 2GWHA 4HB0A 4IFBA 3MHPA 4KYIB 1M74A 2JDID 3ZYCA 3FKSA 3SQWA 3AVWA 5KNDA 4JLAA 2JLQA 3IO5A 3UWKA 4TLAA 1XX6A 3QI2A 2C2HA 1TU4A 1IM2A 1KDRA 3BK7A 4KU4A 4UAJA 4JSYA 3PQCA 4U9UA 4XD7D 1NI3A 1ZAKA 2DFLA 2FU5C 1XEXB 3D7MA 1C4OA 3KB1A 3AVQA 4BLPA 4BZQA 4US1R 5J5CA 1ESMA 1OXUA 4V0LA 5FFMA 4D2IA 2FZ4A 4DVGA 2PMDA 4YXWD 2EU8A 3RAPR 1CP2A 3VNVA 4UNRA 3NVAA 3B8HA 3I72A 3VR1A 2PT7A 4AYXA 4Q7JB 5E3HA 4P32A 1QZXA 4C0SA 1G6HA 1P72A 2OLJA 3ASYA 1CIPA 2P67A 1AS2A 4LV5B 4A2WA 1KDOA 3H0KA 3RRYA 1KO1A 1UKVY 3LY5A 1E69A 2ZYTX 3WRYC 5B2ZA 4HEJA 1S72B 1OH6A 1US8A 3SQXA 1BQEA 4Q1EA 1S96A 3LW7A 2VZLA 1N0WA 2FJUA 4ARZB 2VSXA 4TQAA 1NVUQ 4I81A 4RD4A 2ZR7A 4IDPA 3QPUA 1GM5A 1IN6A 2BKEA 3EA5A 1HURA 3ZIAA 1UKYA 3HYRA 2HT1A 4NONA 3MMPA 1KSFX 1U8ZA 1ZU4A 2GXSA 5A0FA 1G6OA 1DAIA 5KNCA 1LVGA 1Z0IA 1E94E 3FPAA 2FFAA 1GWNA 2RMKA 4D6PA 2DYKA 4P0TA 1F5NA 5JRZA 2DBYA 3F3YA 4B35A 3QSYA 3EZ2A 1YJ9B 4EKDA 4V02A 2RAPA 3T35A 2J7PA 2BCGY 2ZSEA 1T91A 1KAGA 1WRBA 1LY1A 2KBFA 3AKDA 4LPKA 4LHYA 3ZJYA 4JVLA 4TMWA 1X8LA 2VPPA 1ZNYA 2FSHA 4AF6A 3A1UA 4JT4A 4GZLA 3S1AB 2HT6A 4JS0A 5SZKB 3G6EB 1E9FA 1GNRA 5H70A 3PEYA 5FPSA 2VNKA 2WSSD 3ASZA 4PHHA 4PR0A 1YITB 3CR7A 1E9DA 1KO5A 2ORVA 1S3SA 2JASA 1U8AA 4C9BA 5AUQA 1OJLA 1SM4A 1W47A 2QTLA 1G19A 2YZ2A 4LJ5A 3UG6A 1TQ2A 1XCGB 4LBVA 2QORA 1ZC4A 4LC1A 2RGAA 3U7FB 4C2TA 1ZC3A 2O52A 5FOUA 4XTRA 4AURA 1W36C 3LDAA 3W9YA 4C0HA 3EXAA 4ZCIA 1M90D 1KJZA 4WQMA 4X8MA 4M2LA 1XE1A 4EPYA 4CT5A 2WJHA 2VNIA 1AGPA 3WYFA 5CM8B 1VQ5B 2IYYA 3MLEA 1SKQA 4HAZA 2QTZA 3KQNA 4MYHA 5L3SB 2CCKA 1FNNA 2BMDA 5KOYA 4CRWB 2CVFA 4NH0A 2OBNA 1Q44A 3ND8A 4A82A 2ZI9A 3D31A 4P4TA 1UFQA 4NTZA 2GA8A 1A2BA 4Q1CA 2OSBA 4OYHA 1G7CA 4PO9A 3AB3A 2A2ZA 5C46F 1N3BA 1L4UA 3LVQE 5AJWA 1FNCA 4OHXA 4BASA 3RS0A 1YRAA 1AIPA 2QBYB 3NH6A 1CEEA 1JPJA 5KSZA 2CNWD 2DR3A 4EJSB 4AYWA 4GI7A 4ZPXA 2RGEA 2VP0A 3DMNA 2FPMA 4QHYA 5L3VA 1NIPA 2WOOA 3DZDA 4JSTA 4PTLA 2IT1A 1H85A 4DQLA 4TL6A 1N6KA 1T3HA 2RCNA 3ZD7A 4BZPA 3BIFA 5JEEA 1KSHA 4KCGA 2R9VA 5E95A 4BUJA 4GOKA 4R2IA 1QFYA 1YR6A 3THXB 3OF5A 1E79A 2Z5FA 4TZ0A 3GLGE 1DG1G 1S8FA 3L0SA 1KK1A 5CJ2A 4LOAA 1OV4A 2FGJA 2X2EA 5TXGA 4XVUA 2PX0A 5HKKA 4NBSA 3NWJA 1T5IA 2IA5A 2QGZA 3WMFA 3ZVLA 1P60A 2HF9A 2C99A 3RS5A 4D4MA 3WXMA 1W87A 4B2IA 3N2IA 1J2JA 1Q0UA 4MRPA 1VCNA 3BORA 4DKXA 3OIYA 1YHQB 3PEUA 5HZKA 5JHHB 5EJEA 1Z8FA 5HE8A 3AF3A 3KQKA 1Q3HA 2DETA 3AV0B 2RGCA 5FBVB 2IS1A 2GVZC 2PX3A 1X8KA 2R65A 2F1IA 2FEOA 4RJLA 1N6NA 2BEKA 3KFVA 1HE8B 1GKUB 3BB3A 1W4RA 2CCGA 2XOKD 4A0GA 2HJGA 3KTAA 3A8TA 3K0SA 1QH0A 1XCMA 4CEJA 4A9AA 2AK2A 4V0ME 1BH2A 3LLMA 5LD2C 3EA0A 4TYNA 5DYGA 4M9ZA 2A5JA 2ZRJA 1CKEA 1G7TA 1GL7A 2ANCA 2JLSA 4JZKA 5KDDA 1WB9A 2EFCB 1CR4A 1LV7A 1T3LA 1VHTA 5EZ5A 2ANBA 1M2OB 3KUCA 1I2DA 1OXSC 4TT3A 2VBCA 2WJJA 4C0QC 3AVUA 4YAFA 1KIMA 4MKGA 3VU9A 4RSGA 4BLSA 1BS1A 3MFYA 4MDEA 4ZCMA 1S9HA 3WHLA 2XZLA 1CRQA 2WPDA 3GEIA 1CNEA 2F9LA 2IEZA 2HXSA 2IUTA 4G01B 4M1YA 4S2EA 2DWPA 1XTSA 2OBMA 2R6AA 3IKJA 3GCGA 1KI8A 2C77A 2YYZA 4DHEA 2CE7A 3RHFA 3KQUA 4MGYR 4RVCA 3IBYA 4G5QA 4A8JC 5JJIA 2R6FA 3EARA 3G5UA 4YC7A 1R0XA 3Q72A 3I8XA 5B64A 2ERXA 3THYA 1EWQA 1FMJA 2HLDD 4LJAA 4Q4JA 2WBLC 1LS1A 1YR8A 4JJKA 3HYTA 3WNDA 3ONWA 3QEOA 1IQPA 4Q4HA 4D81A 4DLSA 4ZGNB 1E0KA 1IN4A 3MGCA 2PIAA 4IEIA 4MA4A 4RD0A 2CLSA 4QM7A 5GJVC 5FBRB 4A15A 2QT0A 2BF4A 2P5TB 5JI2E 2OFOA 3UKDA 4EJSA 2HUPA 4BGDA 3NBXX 1G4AE 1P62B 4UNQA 5B30A 3C5CA 5IRCD 3AF4A 1OH5A 4G1BA 4R9UC 3V76A 3QKRB 4HE5A 4OK6A 1A82A 1G21E 2W58A 3VR5A 5JWOA 1BMFD 2V1UA 1CR2A 1YVDA 4DB2A 2O8DB 1TEVA 1TUEA 5IHPA 1W1WA 4D0GA 1ZRHA 3QFCA 3NIBA 5EUQB 3REFA 1A4RA 5LDDC 2IYLD 1MABB 5AJVB 4AY2A 4Y7CA 4B3DA 3CRRA 4QBHA 5TY0A 2BMEA 3SBDA 2GQFA 1G7RA 1WDTA 5CDFA 3W2IA 2ZRPA 3CPWB 4DUGA 1DELA 1XJCA 4WZ6A 1JB1A 5J4VA 2D74A 4FW9A 3CR8A 1ZYUA 3GFTA 1QVGB 3K8YA 3T34A 2B8WA 3TSZA 1ZM3A 3DEFA 2O8FA 3JQRA 1CR1A 3JVUA 4PFSA 2OLKA 5FBWB 1EFHA 1U8YA 2IYWA 3FPKA 4KVAA 4A0HA 4EPVA 2ZRAA 4OI2A 5FA6A 1IY0A 4QC2A 1Z08A 1A1VA 3IDQA 4B76A 2NG1A 3GLFE 3T1VA 3W90A 4M53A 1Q1BA 3U44A 2E1RA 4Y0AA 1JR3A 1RFLA 4PSVA 2PLRA 1L7VC 4HAWA 3X1ZA 5DHFA 2WAXA 4MUBA 1Z0JA 4V03A 1ZP6A 2CHQA 3B1WA 2GEVA 1ZM4A 2FH5B 3L0IB 1W5TA 3AUYA 3K9GA 2CDNA 3LX5A 1SVLA 4TMZA 1Z47A 3VFDA 3K0AA 1FTNA 2OFWA 1P75A 4N0EA 4PZYA 4DDUA 2EFDB 3EIEA 4EAQA 1FZQA 3W8RA 3GJ5A 4URYR 1OXTA 2ZRMA 3MJHA 4FXPA 4IRUB 2H7VA 4RD6A 3RRNA 3CM0A 3QUSA 4Q7KA 2MMCA 5EP4A 3KKPA 2ZI6A 1J9ZA 4BRWA 1H8ED 5AUPB 1DADA 3K70C 2CXXA 4P31A 1UF9A 3EIQA 3I32A 1QVFB 4HDCA 2H5EA 2XNDD 2I3BA 3PUYA 1W5SA 3I3SR 1JXMA 2CLDX 1KJWA 2JJ1A 5C4GB 2QTHA 2MSDB 2VO1A 1NLYA 2KBEA 2I1VB 4DCNA 4Q1FA 1E2PA 2O8CB 1KI3A 3CF2A 2W6JD 1JQJC 2GKSA 1V43A 1CJVC 1W36D 4DSOA 2PZGA 3CZQA 4QBGB 1MO6A 2QM8A 2FFHA 4K46A 4LC0A 4M1WA 2JEOA 4D82A 4EPRA 3GJ4A 3GFOA 1BYUA 3ZS8A 1CNFA 1AK2A 4DCVA 3I61A 3QXSA 1ZVQA 5EE5B 421PA 3ZD6A 2FFQA 5GVSA 5H8WA 4HI0E 2BGIA 3ES9A 3OEED 2BJWA 3QE2A 2FZLA 1F2TB 3FFAA 2W2XA 3TAHA 4AD8A 1TX4B 4TYWA 3Q7QA 3BB4A 2P6NA 3PFIA 3H86A 5DHAA 2XZPA 2ODWA 1XEXA 4B6EA 4E03A 1UADA 1T0JB 2RH5A 3Q7PA 1YKSA 2YWFA 1LTQA 3TSOA 1XTQA 2QEQA 4XSHA 4IDHA 2JLVA 3HR8A 3GJ7A 3C7KA 2BM0A 1XJQA 1VG8A 3GD7A 2J7PD 3REGA 3LRPA 4QGAA 1Q20A 4OHVA 1CJTC 2TMKA 5SZJA 2I4IA 3SDZA 5J4YA 3U2QA 2PJRA 1K8RA 5EZ6B 1P2TA 1VMAA 4A0RA 2ZJ5A 3KL4A 4HLCA 3U5ZB 1N6HA 1XD9A 2QMUA 3WNBA 2PL3A 3A1SA 2CL0X 2P65A 2GJAA 5EQTA 3V9PA 2V4ZA 3U61B 1OB5A 4G5OA 1QG2A 2P5SA 4UXHA 4FIDA 2WTUA 4JVMA 1QHIA 1VECA 1GP2A 1S4QA 1IAQA 4FI3C 3SU8A 2D2EA 1NNEA 3CNLA 4OBEA 3CRQA 4MRNA 2Q3FA 2AN9A 5KPDA 4JLJA 2WM9B 5AJZA 2ZIAA 3CLVA 1FFHA 2R2AA 5FOTA 1PUIA 5F3WB 2OCBA 3ADKA 4DLTA 2O8BB 4FWIB 3W2HA 1VQ9B 5JWRA 1KI4A 1XZPA 4O3MA 1P73A 4B3FX 1R0ZA 4BE7B 3CCSB 3IQXA 3PIRA 2X1VA 1XCPA 3SNHA 4TMVA 4AYTA 1W49A 4ZV4A 5B57C 4O25A 2QSYA 1J70A 2EVWX 4URXR 1E4VA 3O8DA 5DSZA 4KI0A 1Q81D 4L9WA 2P3SA 1UMKA 1R5OA 3TUJC 4BECA 4QJ4A 3MRSA 5TDHA 1A7JA 2J59A 1AMOA 4FD2A 3NTUA 1NL3A 3Q3JB 4JLBA 2O0JA 2JDIA 3U3JA 4HE6A 3T61A 4TTQA 1ZM2A 4ZDJA 1U98A 2IK8A 3QG1A 1ZD9A 1P2SA 3W3ZB 1A5TA 1GG2A 3UMSA 4YMWA 5E7IA 2IXFA 4DIDA 1II9A 4LHVA 4QNMA 4UQOA 1AN0A 2NO0A 4KHZA 1E0JA 2YINC 3OEHD 4FMDB 4P6VF 1NBMD 2MSEB 2DFKB 4NCJA 1NIJA 3THWA 1QG4A 4DJTA 4KBGA 4LSGA 1MO4A 2AKAB 1VIYA 5JS7A 2Q0HA 3B1VA 3ZQ6A 1F48A 3ETLA 3ICEA 2XSZA 4DDWA 1N25A 1IN8A 4KXFB 3NHAA 1OLOA 4F4JA 1QHXA 4BFTA 5F9FA 3ZGXA 1Y63A 3BFKA 2B5OA 4EUNA 2JATA 4LV8B 5E4FA 1M8PA 4JT2A 1N6RA 3LQQA 4JBXA 1YJ5A 2OESA 2YHSA 3CXCB 3TR0A 4UXJA 2EYQA 3LBNA 2IL1A 3WNCA 1CTQA 1E6CA 3UMRA 1R0YA 2EFEB 3KXKA 4LGMA 2J41A 1OIXA 4V0MA 3KJGA 3QNUA 5FPKA 4URUR 1R10A 4JYCA 1G1MA 1RVDA 1WMSA 2A5FA 2J46A 1GDDA 4LYAA 2CCJA 2J9RA 1EGAA 3FDIA 4IJMA 2BKUA 3Q9LA 4R71A 1T5LA 2FOLA 2OK8A 3JZAA 4ZDIA 2R44A 3K0AB 2XTZA 2IW3A 1P6XA 2DWQA 1G3QA 3T15A 1J8MF 1F2TA 2WWWA 2WJIA 3B1ZA 4BFZA 4ARZA 4QBIA 5JHGB 2Y8EA 4L9SA 3DOEA 2J45A 4R7ZA 2IXEA 5LPNA 2AHOA 1RRFA 4DLVA 4G1VA 2RGNA 2ZTSA 5L3RA 1SVKA 3K9NA 1K73D 1X1RA 2WKPA 4B32A 4KSCA 5IDVA 2VIIA 3AKYA 3TVTA 3WRXC 2DB3A 2GZAA 1OB2A 2ZRCA 1R7RA 2WIBA 3NEYA 4B34A 2VNJA 3VO2A 2Q9BA 4JLVA 2HYIC 3QKUA 4BFUA 2YC4C 2WWIA 4B3XA 1WXQA 4DT1B 5DN6D 4LY6A 4B3CA 4RZ3A 1E2NA 1E9CA 4UKDA 5CK4A 3X1WA 5E7MA 2GCOA 4M21A 1TEXA 2QE7A 1Q1QA 1KD1D 1G17A 4DBLC 3JQQA 2NMVA 4K8OA 1XJ0A 2KE5A 2WOJA 5D3MA 1SKYE 1D2NA 3AKCA 4CDGA 2NTYC 1XTKA 1G5RA 2QL6A 1KDPA 3B60A 1QDEA 1JA1A 2V6IA 2GILA 4EPTA 2CRVA 3ZC3A 4TLCA 2ZJAA 2HMAA 4U00A 1RKBA 2EIXA 3A1TA 3QKRA 4BZXA 3HR7A 4DSNA 1Z6TA 2WIAA 1CULC 1E2GA 2BBWA 4M9QA 1VG9B 2VEDA 4LJ8A 4YAWA 4LJ9A 3VR4A 1JJ2B 1NBME 2CVHA 3CW2A 4XJXA 2XNCA 2PZFA 4NCHA 4EDHA 4TLBA 4C4PA 5L3QB 5LB2A 1FQJA 1H8HA 1HE1C 3H4MA 4LDJA 2ZRBA 2XEXA 1VYUA 2XAUA 2QBYA 3RS7A 1XZQA 1NKSA 3FVQA 2GK7A 2IX3A 1G8GA 4Q4AA 1Q57A 1KI2A 2QT1A 2VLIA 1C1YA 4EJSC 2CLCX 1XTJA 2WMNB 1JPNA 4US0R 4DLYA 2Q3HA 3A4NA 2X19A 4FK8A 1ANKA 3FYHA 1NVVR 5EE1A 2XXAB 1YZQA 1OFHA 3QEJA 3T5DA 1AKEA 1T9HA 1X6VA 5AUOB 1JJ7A 1X8JA 1YR9A 1HQCA 3AM1A 2NIPA 2AWOA 3LFUA 4KFUA 3RS4A 1NJGA 2IYZA 5AR1A 2ONKA 2A30A 4OQNA 2RB4A 3TGPA 1QGAA 4ABYA 4L15A 3SN6A 3W5UA 2O8BA 4HDQB 1AQUA 1QF9A 3QF7A 4DLUA 4D4LA 1Q22A 4FCWA 4YMVA 4GZMA 2FMXA 2JJ8A 3AVPA 1YHNA 3C41J 3IBGA 4F4IA 5CB6A 3VX3A 1QHHA 1U0LA 2YWGA 3F8TA 3SJCA 2QU8A 3KUDA 4HZUB 2ERYA 3KJEA 4N0DA 3PUVA 1M34E 3FHCB 3C16C 3DKPA 3CCRB 2ZRNA 4R2HA 3GJXC 1GUAA 1G20E 1Z6YA 4Q7MB 4A1FA 4EH1A 3C15C 2ZJBA 4PHFA 4L16A 4M1OA 5C1BA 3QY0A 4JVNA 4ITRC 2OK7A 2OAP1 2YJTD 3U7HB 2ZRFA 1ZNZA 1QX4A 3P26A 2XJ9A 3MWYW 4L8GA 1S9DA 2OO7A 2ZR0A 4PQFA 2GRJA 3U3KA 4TL7A 1GSIA 3A36A 1N0VC 3NBZC 3W5JA 2YOFA 3QQ5A 1RE0A 3W2GA 1G4UR 2D2FA 1VQKB 1E2IA 4JJZA 2UZIR 4YDSA 2WWYA 1DAHA 1VPLA 4HLQB 4Q4LA 4GMDA 1QFZA 3TNFA 2OTLB 3BH0A 4DWJA 4HAXA 4HSEA 2JIZD 3OE7A 2GJ8A 3WP1B 2V55B 5AJXA 3BBPA 2PZEA 2NO1A 1FL9A 4DSUA 1FX0B 2OCPA 1KGDA 1GVHA 5KSPA 2LCFA 5BW8A 4TL8A 2IC5A 2F9MA 2CJWA 5FBQB 1D6JA 2WJVA 5SZIA 2Q21A 3RSLA 1TUIA 2F1RA 2IYRA 4BEJA 4TYQA 2OEPA 2JIZA 4G5RA 5AJYA 4K81B 1SVWA 3X2SA 3LVRE 3TQCA 1OH8A 1IOZA 1QRAA 2W6JA 2WKRA 3MD0A 2BIFA 4ILEA 1UPTA 2ATVA 4QBFA 4Q5IA 5CLQA 3FTQA 3DOFA 4JKYA 5H68A 3RLFA 1P4SA 3SYKA 4JBWA 4XIGS 2KJQA 5TB5A 4NKRA 5EE0A 1XU4A 2GAAA 5K8TA 5DGXA 2HXYA 4PZLA 4Q7LA 4XWKA 1VCOA 3HP1A 4LJ6A 4C0BA 2QI9C 4O2LA 3LWNA 1H8EA 4Y0VA 3CRW1 3TE6A 4RZXA 3UG7A 5IT5A 4LRWA 2JLZA 1ZNWA 3W5IA 1DOAA 221PA 2QUZA 4HUQA 1D1NA 2B7CA 4PHTA 2XNDA 5DH9A 2EWWA 5H1YA 4E22A 2QAGC 1GAJA 4O0MA 821PA 3EZFA 2GXUA 5FR2A 1BOFA 1MO5A 4D4JA 3MAAC 5LD2B 3HDTA 4AC9A 2GTPA 3B85A 3P32A 5JJKA 4PAQA 1GAWA 1MRNA 2JA1A 4XH9B 2XZOA 1KMHA 2MSCB 1OKKD 3JVVA 3TLXA 2OCYC 3LLUA 2ZJYA 3M0EA 4TZ6A 2GPJA 1MH1A 3VHXA 3GMTA 2HCBA 1QHNA 3VX4A 4LHWA 1UKEA 4AK9A 1JA0A 3J81k 4YMSA 3E2IA 4YHBA 5AUNB 1U99A 4NE2A 2H1LA 1VQ7B 1IY1A 2B7BA 1KZGB 2KB0A 3R9XA 1IXSB 1U94A 3OFND 2R6GA 3GLGB 2F1JA 3W8NA 2OCAA 1G3IA 2HDNB 2JLWA 1W44A 5F2EA 4LCBA 4XVQA 3EWAA 1KKLA 2Z4SA 3K0FB 2P2LA 3PXGA 2UZ3A 2WWHA 1NP6A 2BMFA 1Q3TA 1QHGA 3I5XA 1E2EA 1VKJA 3CD6B 1IXRC 1G3UA 2IS2A 3R7WA 3SE0A 2FN4A 3LXRA 5G3YA 4DEYA 4DLZA 2G0NA 3S1AA 2IYQA 4LBWA 4Y9UA 2CHVA 5FL7D 4DRZA 4W9MC 4UNPA 4LJ7A 2BGJA 1OGIA 1X3SA 1UBEA 5EXTA 3RNLA 4W5WA 1DO2A 4GSYA 2RGXA 1AKYA 2QG6A 2OHFA 2BMWA 1Z2CA 1G8HA 2J5XA 3QFSA 1NLFA 4Q66C 1PLLA 3B9QA 2BV3A 2ORWA 3Q5EA 1HYQA 3BXZA 4UXIA 3K9LA 1XXHA 5K8IA 5JMTA 2XNJA 1R0WA 3AKEA 4LX0A 4LHXA 4PANA 1Z22A 4GRAA 1QUEA 1FNMA 2Q3MA 3GLFA 4KV9A 1YZNA 4CZ2A 1OHHD 1YQTA 4BLOA 4KFSA 1DAKA 2ZUBA 4MKHA 1JJVA 1BMFA 2FGKA 1NVWQ 5FOVA 2HF8A 4R98A 1J99A 4KFTA 4KLZA 1KOFA 3ND9A 4EFNA 3BC1A 4WA7A 3QXJA 4M9SA 5J4KA 1XXHE 4QRHA 2BVNA 3CKLA 1RZ3A 2LKDA 4ESHA 2ODNA 1KI9A 1HEIA 1F2UB 4E09A 2E87A 1P9RA 2R6CA 3V00A 4B2LA 1YJNB 4XVRA 2GBLC 4PPGA 4QNRA 4ZIRA 1EX7A 2NQ2C 2IUUA 4OHWA 4Z1MA 4B75A 4RD2A 1KMQA 1ESNA 4ESVA 1XNJA 1Z0DA 1ODFA 5AK0A 3WHKA 3WMEA 4C43A 3TIFA 3DKVA 1K8AD 1XRJA 2ZUCA 2YVUA 3TW4A 4US2R 3AVVA 5GVRA 3CMEB 1Z0AA 1ETUA 1SXJC 2W0MA 2CL6X 1OPXA 1U9IC 4Z54A 1N5JA 2ZRIA 2GZHA 3QIAA 3SHWA 2C04A 2ZUDA 2WWFA 3PUZA 5EMNA 3RSOA 3KDSE 4F91B 1KI6B 1COWA 3K09C 3W6PA 1OIWA 2QAGA 1VCIA 5EE9A 1G3MA 1W0JD 2P6RA 1RIFA 3M6AA 3VR6A 4IKEA 3GPLA 1KRHA 1J90A 1KO7A 4HLUC 5EP1A 1HH4A 2FPKA 2GJSA 4A8JA 4TLEA 3MUFA 4JL5A 1TAGA 3UIEA 1SQ5A 4CYMA 4DCSA 2GF9A 3SJAA 4DIEA 3RRZA 1AA9A 5K8LA 1P9WA 2R6DA 1EP3B 1RPZA 2WVJA 3K0EA 1NJFA 1W7AA 1GVNB 4B4DA 3SBEA 1US8B 2BWJA 2GJ9A 5EXSA 3WYAA 1R6BX 3CX8A 3EZ9A 4B47A 2VP6A 4KSBA 2ZE6A 4Q9LA 5IF9A 4D26A 2VP4A 1E9RA 4CEHB 4WAUA 3E5HA 5DO9A 1D9XA 1II8A 3BD9A 5JFGA 1ZIPA 3LO8A 2ZJZA 4JLPA 1IJEA 4MDFA 5BYKA 5FTNA 2OZEA 4HYYA 3ZZ0A 1WBDA 3VR3A 4Z1MD 1EFRA 3QXHA 1HTWA 3GLFB 5D3QA 2A9KA 1YZGA 1TF7A 5KSWB 2FE4A 3AUXA 1GOTA 4XTCS 3ZVNA 1LNZA 1ZCBA 1D8TA 5DI3B 3TH5A 4Q9KA 3PENA 1GILA 2REOA 3WBKA 2ECKA 2AK3A 1CRPA 1AM4D 4C7OB 3VR2A 4G0NA 5DYIA 2JJ2D 2F6RA 3SOPA 2AD1A 3U3MA 3KKNA 3HU2A 1NVXQ 3K1JA 3IPXA 2WV9A 4KLNA 3I62A 3VKHA 1SXJA 5HZHA 1SVSA 1OHHA 2PT5A 1HT2E 1N5LA 4Q9JA 4AWXA 5GV7A 1G8FA 1ZD8A 2VF8A 4GOXA 5G40A 2OAQ1 4TTPA 4OQMA 3VKWA 2QNRA 1H65A 2JJ2A 4O2RA 4W7SA 3FOZA 5FH9A 2JJ1D 2WZQA 1TPZA 2EQBA 2V7QA 2GBLA 3LXXA 1JB9A 1QGZA 3RDPA 3CC7B 2RGBA 3CCVB 1Z6AA 3H1TA 1S2MA 4M0LA 4FMCF 4BWYA 2HEIA 3QFRA 4P4SA 4UJ3A 1JAIA 1TNDA 3M1IA 4WXRA 4WXPA 1LW7A 2VHQA 4Q4JB 2WWXA 5DE3A 4ZI3A 1I4DD 3ECCA 4GDFA 5FTJA 3P1JA 3ZDQA 1RRPA 1N2CE 4DSTA 1ZM9A 1IB0A 4JL8A 1VQLB 2AFHE 2ORIA 1QUFA 2PBRA 2WMOB 2ZR9A 1DPFA 5D3MB 5FOWA 5JSZA 1GR1A 1XMIA 2PCJA 3CPJB 1NMZA 2VHJA 1OIVA 1FMLA 1NRJB 2A78A 1P5ZB 1FTSA 4LBYA 1ONBA 3CF6R 4LZZA 4WZAE 3ZLJA 1EESA 5J4HA 4B73A 4MQBA 3O47A 3AVXA 1Z83A 2ZPTX 5LB4A 3AF0A 1QHYA 2G9NA 2CK3D 3IHWA 3SYLA 4IVPA 2N1BA 5DIFA 4X8OA 5P21A 4DC9A 2VP2A 3OAAD 3ADCA 2OUKA 2AX4A 3L2OB 1MABA 4Q03A 4TMTA 4IOMA 3K0CA 2JLXA 4GP6A 8OHMA 1EG7A 1Z6XA 2BMJA 3FGNA 1SULA 1IN7A 2A7QA 2GEDA 3MSXA 1CF4A 2QA5A 1E79D 3ZZUA 4A2QA 4BFSA 1DDIA 4DLWA 5HKKD 4Q4AB 5HCIA 3Q5DA 5FPHA 5HR5A 1OF1A 3DL0A 1OFIA 3NG1A 1RC8A 2FSIA 2R62A 4PHGA 3UPUA 1CJKC 2ZM5A 4TMXA 3KFXA 5CIWA 1K5GA 2BJVA 2BCJQ 1II0A 3BFVA 1DAMA 1JALA 3FMPB 4OJQA 5FOXA 4OI0A 3CCLB 3NBYC 4M22A 1M7HA 2IYXA 2GCNA 2ZVQX 1AS0A 1DEKA 3IILA 3T1QA 2CNDA 2QAJA 2IYTA 2ZI3A 1QHSA 1DAEA 4BFXA 1YRBA 3RWMB 3THYB 3RS3A 2ZSDA 4LHZA 4MYUA 1XD2A 2N42A 1E0SA 4OQLA 1LF0A 3HU1A 3SFZA 1C9KA 1HY3A 3L8YA 3G71B 2GAOA 4KJZA 4K1XA 5HCNA 3NC1C 3LQRA 1CS4C 3BOSA 4M4SA 2ZU0C 5GJCA 3BFXA 5HTKA 3FKSD 1FOEB 1Z0KA 5DN6A 1NY6A 1Z06A 2YKGA 3HJNA 1S3GA 5JI3E 2OFXA 2VP5A 5F9HA 4HB2A 4MYCA 3TUZC 3I1FA 4GOJA 2G1JA 4ZIRB 1SVMA 3GJ8A 1XBTA 2OBLA 3NC0C 1GNPA 4CVNA 2EFGA 1KNXA 2QN6A 1WCV1 3PVSA 1E2KA 5FPTA 3LBIA 2ZITA 4AIIA 1YIJB 3HWSA 4C2UA 4OK3A 1NMYA 1JNYA 2ODBA 2ZU6A 4Q9HA 2J7KA 4PC3A 3TVDA 4FN5A 2ZI4A 4IEEA 2ZI5A 1ZD1A 5FOSA 1A2KC 4TL9A 5M04A 3SI7A 3U4QB 5GV8A 4LYFA 3CZPA 4H1UA 5HXBA 3R8CA 2FEMA 4M1MA 1KI1A 2PCLA 4ZKEA 1WP9A 2QPAA 1SXJB 4BPRA 2GESA 3QPWA 4HB4A 4JLMA 5C18A 1IHUA 3K09A 4PSAA 4TLDA 5A4JA 2QGNA 4PQYA 2LWIA 5J4LA 2C9YA 2P0EA 2KSQA 1UM8A 2YOHA 2BOVA 3DM9B 3N5CA 4I1UA 5J40A 4DB4A 4MGZR 3RANA 2QRZA 3GLIE 2DEUA 2VRWA 2J0UB 2PMKA 4C0AC 2Q6TA 4B43A 4H1VA 3KB2A 3A6PC 1QVAA 5AWFC 1TQ6A 5DI9A 1L2TA 1F60A 1P61B 2G3YA 3EC1A 3FMFA 4CEIB 3NDBB 2DPXA 621PA 3AF2A 2XOKA 5DLQC 4CT4B 2XXAA 3LX8A 5H5JA 1CXZA 3ZBTA 3IIMA 1II8B 2IYVA 2YC2C 3THXA 4NCKA 3VQTA 1YZUA 1UBCA 3BE4A 4U7DA 4EPWA 2QY9A 1S0UA 3QFTA 4PC7A 3U7GA 1I2MA 2BN4A 2F7SA 3B7GA 1Z07A 4LPSA 2DWOA 2F3RA 5KPJA 4BFYA 1XF9A 1NN1A 4MKIA 3WP0A 4QFMA 3RWOA 4B33A 4JLDA 1GAQA 3IIKA 4IDQA 4W5HA 2JAQA 2FG5A 3BJIC 4Q00A 4TSFD 5FUYA 1T0HB 3VO1A 2AD5A 4H9GA 2A3RA 2WHXA 3P27A 4X8LA 4RFSB 5KYKA 3E1YE 2OG2A 1E62A 2WJGA 4IOJA 1KSJA 3DM5A 1E2DA 3EASA 4BFVA 1LFDB 5JS8A 1OE0A 3NH9A 1N6PA 2A5DA 4ACAA 3I8SA 4HATA 2Q9CA 1GIAA 1DVRA 1KI6A 5FI0B 4CGZA 4YMTA 2ZE8A 3IQWA 4JL6A 2V9PA 1KYIA 3AGQA 3A4LA 4DZZA 2ASEA 1XD8A 3IPYA 4PO8A 5L3SA 3W3AA 1EWYA 2VYQA 2FFBA 3C8UA 4G1UC 2HLDA 5KDLA 4Z8XA 3ADDA 2FA9A 3CRMA 5GJBA 1TL7C 1JR3E 3HPRA 2O8EA 1GO2A 2C03A 2ZJOA 4DT1A 1K6MA 1Z0FA 1OYYA 1W0KD 2VSFA 4DEXA 3BRWD 2C9CA 1GZSA 1RYHA 4MITA 2OT3B 4C3ZA 5LBIA 4CIDA 3ZVRA 4XWAA 2W2TA 2V1XA 2YOGA 3ZS9A 1IBRA 3K70B 3C4JA 4QHTA 1OSNA 5JJLA 5L8VA 1W46A 3PG5A 2O0KA 2ZVPX 4B44A 4WZBE 2H57A 1NG1A 4JYBA 4F7WA 5CLLA 2VHTA 1G3RA 3R9WA 2AKYA 2BPOA 3BH6A 4EFMA 3QBTA 2XX3A 5KSOA 3Q85A 4TYYA 1B0UA 1FNDA 3CBQA 3LD9A 4OL0A 4LV6A 4UNSA 4D25A 2GCPA 3H2YA 2ZSAA 2PEYA 4DCUA 3X1DA 2DERA 4NYIQ 1FRNA 3R20A 1HV8A 4C0KA 3PR1A 2C8VA 2CJWB 2IXGA 4M1SA 4ACBA 3AP3A 3ADBA 2R6HA 3MJRA 5ELXA 4DCTA 4HUTA 1KQSB 3B1XA 5EUMA 3GLHB 3TMKA 3CPHA 4ZDWA 2XB4A 2ZYUX 3QXCA 3GJ3A 1JQLB 4FCVA 1WA5A 4IDNA 4Y9RA 4GMXA 3CCUB 2J0UA 2QQ0A 4NZYA 1HUQA 2JLYA 1W35A 1N6LA 6Q21A 1EWRA 1ZU5A 5BYJA 1MOZA 1HT1E 2XJ4A 1OGJA 2WJYA 1A8PA 4KODA 4ASUD 1IJFA 4PZZA 1YZKA 1EP2B 2WKQA 4RY2A 1SXJE 1GRQA 4NHOA 4WBSA 3G82C 3EPLA 2N46A 2D4HA 5DISB 2C5LA 1G5PA 1F3OA 4G5SA 4I99A 4JKIA 3TUIC 4MGIR 3R7WB 3GP8A 2BSAA 4BLRA 4HB3A 3SJZA 4Q01A 4UJ5A 2X3UA 1NDHA 5TVKA 2QMEA 3GLIB 3B2EA 4QG7A 2IS6A 2NZJA 3D6TB 3MWKA 1IN5A 3EAQA 4N3GA 4OHZA 2DY1A 1W36B 1E2LA 3EZ6A 4FWTA 1R5NA 2AXPA 2FSFA 2J1LA 2F3TA 4EQ6A 4HZUA 3SS8A 1ZIOA 4QM6A 2YWHA 2J0QA 5KNBA 2D06A 1TF5A 1UDWA 5KHOC 4NYMQ 4GL2A 2O8FB 4F7DA 3UK6A 4P4UA 4G5GA 1U90A 1PJRA 4TYPA 2V6JA 3DMDA 4POAA 2GZDA 3HPQA 4I1VA 3SJBA 4N1AA 1OKKA 2ZYWX 4MGKR 1XMVA 1U2RA 1GTVA 3BWDD 1YE8A 4AG6A 4HLDA 1NY5A 4NP6A 1AS3A 1H8HD 3PEWA 2JLUA 1KO4A 2FF7A 1XTIA 3K0CC 1NSTA 1OFUX 2AL7A 2ZROA 2C98A 5E7JA 5H59A 3IO3A 2OM2A 4G3XA 5BQ5A 4XWOA 5JECA 3EX7C 3ZBUA 3NHBA 2V8OA 3W2FA 3OE7D 3CUEF 3ZVMA 1W0KA 3AP1A 3EWSA 2ZJ8A 5AN9A 1WF3A 5JLJA 2CL7X 2A5YB 2W00A 4HZIA 1N5IA 1DG3A 2VF7A 3TK1A 3O8RA 4OI4A 3E20A 3VNUA 3W5VA 3JQPA 2QTVB 3U3OA 4CW7A 2H17A 1F6BA 3D8BA 3BGWA 2QE7D 3SEAA 3GEHA 4A36A 3LH5A 3PJRA 5FR1A 4BLQA 1G41A 1SVOA 3AP2A 5UKDA 4F93B 1MT0A 4QGHA 4IOKA 2L0XA 1TVCA 2J0VA 4QL3A 1XMJA 4HAYA 1N5KA 4KO8A 4B6FA 5EE3A 1G8YA 1ELOA 2JLRA 3FMIA 4PPQA 3UATA 3OHMA 3RABA 1VQ6B 1T6NA 2OXRA 4NL4H 4NCNA 4C7OA 1SGWA 4OQXA 4TSFA 3RVBA 1CJMA 2O5VA 1GRNA 1VIAA 1KC8D 4YDHB 3TQFA 1DS6A 1IY2A 2W83A 3CO5A 2NO7A 1EP1B 1XDBA 2RKOA 2ONJA 4RD3A 2HV8A 5KSYA 1AZSC 1XB2A 4PPNA 2SHKA 2GDJA 1KY3A 1E64A 1E98A 1OYWA 4M1KA 2FPLA 4V0NA 5JSZB 1OW3B 2NZ8A 4PC1A 2RHMA 2OXCA 5ANRB 3WMGA 2B92A 4EQ6B 1G16A 1QGYA 3L8ZA 1CU1A 5F98A 1NF3A 1T3SA 4B48A 2HYDA 4B71A 1VG1A 2A5GA 2GF0A 1G291 5EXPA 4MYTA 3OIVA 1ZM7A 1SHKA 4L5BA 4XSGA 3UANA 2WAYA 4NYJR 1P2UA 3NDPA 4DQKA 1XEFA 3IGFA 1T8TA 4B2PA 5DNYB 3GLIA 2NOAA 1E1QA 2Q9AA 2IWRA 4HAVA 2CE2X 5JEDA 3KQLA 5JRJA 5BN5A 3LNCA 2ZJ2A 2Z6VA 4MH0R 3R8FA 2H16A 3QVUA 2QPOA 1MR3F 1ZMXA 4PX9A 2O8CA 3KKOA 1QHHB 4Q19A 1Z29A 1QVRA 3P4YA 4ZI2A 2QROA 1CJUC 3A37A 1ZUHA 3BERA 2C95A 4RCYA 3K53A 4Q02A 4KBFA 1W4BA 4JIMA 4TMKA 1QBKC 5HE9A 2EYUA 2J87A 1Q82D 1NG9A 1TQDA 1B2RA 3CRZA 1BIFA 4L4UA 3KKMA 5TMPA 1W2GA 2VNHA 2EW1A 3QPVA 4A0FA 1M6NA 1FX0A 2PEZA 1EFUA 1KNQA 2Z4RA 3PCRB 1XFAA 5C2JB
chains in the Genus database with same CATH superfamily
3V42A 2IIBA 1KPIA 5ERYA 3VTZA 1GZVA 3AHCA 5JUWA 1PS9A 3RCBA 4JP1A 1GQ2A 3ESXA 4NHEA 5JQWA 1NBMA 5A1JA 2FVXA 1K0FA 5F7ZA 3MVEA 3CHYA 3DPSA 3AINA 3OKPA 2DR2A 1BGXT 1D3AA 5AKXA 1SMKA 5FI1B 1H66A 1JWBB 3CYFA 4KOAA 2E18A 3MK31 2X8AA 3SIWA 2WF5A 3ZGOA 1N8RD 5FUWA 3QIVA 4M0UA 3FKQA 1FRZA 1HTBA 4LRUA 2I4NA 1E2JA 3O8CA 4IOLA 5CNIA 2PX4A 1VA4A 5ULLA 5JNSA 1UBFA 5AHKA 1LJ8A 2W2QA 1QTRA 3CW8X 3P0HA 1U7WA 1WNFA 3O0TA 1DKLA 1ZCZA 1PLJA 3I04M 1WUKS 3EQ8A 2P6OA 3ICCA 3N9IA 5A89A 3HB9A 3BIWA 2GLTA 3R5FA 1MRSA 4WD3A 3FF4A 4INOA 4RZUA 5CGZA 1PG0A 1PU2A 1XCLA 2NTEA 3FM9A 4Q3OA 1P5HA 1Z2AA 3KJIA 3P2EA 4JGIA 4JYMA 3O82A 3ZWPA 1O6ZA 2EP7A 3CB4A 4U4AA 3UJ8A 4DJAA 5JJBA 1E1CB 3H94A 1PSZA 3M4YA 2C00A 4EI2A 2O8EB 5CM9C 1VP3A 2NGRA 3S2ZA 4GF5A 2C29D 2PBLA 4HDOB 1JR3D 4X9XA 4HT3B 8ATCA 1M5RA 2QMOA 4F38A 2PIDA 3K6JA 1ZW6A 1ORIA 3A1VA 3BILA 3OOWA 2FPIB 1IVSA 1C3JA 4MRVA 5TT1A 1T0BA 3OESA 3H04A 4LJYA 2ZTMA 3GEEA 2RIRA 4JVSB 3AUFA 2JGAA 4N8EA 2ZIUB 1J5PA 1QYCA 1Z73A 2EFHB 2NXJA 3VUEA 4TUYB 1E60A 3ZQJA 4DJ5X 3PS9A 5C8YF 3FE2A 1M1YB 4TZKA 4F6RB 4R2XA 3QLUC 1UPBA 3ASSA 1ACMA 3UT6A 2O8DA 2QD2A 1PR0A 2K5UA 3FXAA 3CNOA 2WUDA 2C5EA 2G25A 3GEGA 1RWPA 3HLKA 4NBNA 4WKCA 1QDUA 2B9EA 3I4FA 3WB1A 5IW8A 2VBUA 4L5AA 5A5DA 1AURA 2J85A 4W6ZA 1SAYA 4XRRA 5FBLB 1W4CA 5BYAA 3EPJA 3FMOB 3G2KA 1E3SA 1YMQA 2R4TA 2H92A 3V4VB 5L3QA 1PT6A 4Z4EA 5KVSA 5GPBA 3OZBA 1T4GA 1AQYA 1VCHA 3OFJA 5JE8A 3CUVA 1BO6A 1WCWA 4BFWA 3WLFA 5TF0A 2GX6A 4OCZA 3CNBA 2P91A 4DIUA 1PL8A 3T1YB 1TRHA 1W85B 1U4OA 2VJPA 5I9BA 4D80A 1OH7A 4R2WA 4CEIA 4N03A 4P3YA 4XNFA 9GPBA 1GNVA 1CZNA 3ETJA 2DU8A 3IUYA 2QAGB 2COKA 1O9GA 1WCIB 4FNAA 3RVJA 1DBWA 3KU1A 4BE9A 1BKDR 3BIJA 1T3ZA 1AH2A 3MT0A 4C5AA 3FWYA 1IDOA 1THTA 2WAAA 1XVLA 1B23P 3ZDFA 3Q6IA 4KFRA 4OJYA 4BAUA 2GXAA 4YRTA 3KE8A 3O4HA 2X5OA 5EXDA 2QJTA 1XRNA 2XWBF 3L02A 1QFJA 3A3YA 2VUSA 4MVJP 4PVCA 2Z43A 3NOQA 3BA6A 3CMCO 3LC0A 3JASA 4U5XA 2C42A 3NHYA 2AWNA 1CZRA 4HAIA 5K8VA 3FVVA 1E2MA 1WQ1R 3ORQA 5LZ4A 5MN5A 3HFSA 4ZGQB 1FYVA 4OGFA 5K6AA 3BTVA 1XEWX 4D9FA 1JIKA 4NCAA 2QUAA 1C2YA 1M2HA 2ZI7A 1ZJ6A 2VQEB 3V4RA 1RBZA 2Y2VA 1F8UA 4QNNA 3T5GA 3WMXA 1AK1A 5H3LA 5CJPA 2P11A 3PXEA 3D2CA 4M8LA 3NOOA 3ZE7A 2AOXA 3T1TA 3CF4G 3FPLA 4ZTUB 3PNQA 4UREA 2FHPA 3RC7A 2OILA 4QJ5A 5IM5A 4CUZA 1RJ9A 3CCMB 1L7MA 2QUHA 4RHFA 2R60A 3IQEA 4JHXA 3V8BA 1FUUA 4H3SA 4W1PA 3P9ZA 4K3UA 3TIXB 2FEAA 4ALKA 2QTFA 4RH3A 4ZEVA 4BEBA 3F73A 3SLNA 2JBWA 4WPGA 1U3TA 121PA 3AX6A 3VAYA 2XCLA 5GADl 3IURA 4WIAA 2X7XA 2GETA 5DNEA 3T7SA 4IEFB 1K86A 4EA9A 3HXOA 3FCXA 3LO5A 4K9SA 1VIDA 2J67A 3SX2A 4L5YA 1F38A 5KQMA 3AEXA 3L9WA 1UOOA 1L1RA 1QCCA 1A96A 2B1RA 2IE0A 1K5HA 1QGUA 3OZXA 4BV2A 4UEJA 3WZMA 5CUQA 3G4SB 2C96A 2OM6A 1V8DA 3MUEA 2R6ZA 3O3MB 1H3FA 4JMPA 4RZQA 1QVZA 3TQHA 2A14A 4B82A 3L4EA 4EG8A 3FOWA 2RHOA 2TRSB 4QGGA 4RHYA 5K7SA 4YR9A 5A2QA 3IRUA 2VQSA 1YVPA 4K6GA 3UJ6A 1J8YF 1QE3A 2NO5A 2ZAOA 3IIEA 1N0UA 5FORA 3HP4A 3N6VA 1XZHA 2QRMA 1YFKA 2A9FA 2BDTA 3V4PB 3WYDA 2VBGA 4QUHA 4UU7A 2P5YA 5EINA 5KI6A 4P36A 1LTHR 2NPIA 3KPJA 1U0NA 5LMUB 3P5BA 2QP3A 5KYXA 4X6XA 5ABPA 2IZ6A 2GD1O 4QRIA 4CR8A 1SUFA 2FZWA 1WW8A 5A06A 4GGMX 1KR5A 4LZNA 4XM0A 3FOCA 1T6XA 1E9AA 3LUPA 3NEPX 2WG0A 3BMQB 3EBOA 3ULKA 1SUCA 3OU7A 3VNBA 2EZTA 1PVVA 2YNMA 3EFOA 3EZ7A 1Z28A 4J07A 2F8TA 1F7UA 1T0IA 1I3MA 1QJCA 4IUCS 1DX9A 3PUXA 5CD1A 5EQFA 2H7XA 4OOFA 3GH3A 1CQXA 3IVAA 3OA0A 3TSWA 4BP3A 3CT4A 3MCAA 3U60B 3TKLA 1DJMA 1ECBA 4OJKA 3ZIAD 4B7XA 1Z3CA 1PVOA 4K3VA 2Z6BD 1ZGCA 3PR2B 5THXA 2OQIA 3AL0C 2PJZA 2ZBQA 3B82A 1K8ZB 1NV8A 3SVZA 2C9OA 1Z36A 1DMRA 2QW0X 3F5FA 3DE4X 1PDOA 3E0XA 5B58C 2N0SA 1AJEA 1WP4A 4R9SA 1ENZA 1L9KA 4M0KA 1SY7A 2KVOA 1WBBA 2Z1DA 1NWHA 2ZRDA 4OD0A 4DXAA 4L4XA 5JPDA 2Q7OE 3TBKA 3G0HA 3CMAB 3BWMA 3F7TA 3UWMA 3X1XA 2X0DA 4DC1A 1IQ0A 1QH1A 1F14A 2PANA 4N6OA 2HQBA 4IF6A 5AKLA 4IVQA 1F5SA 1YHYA 1TQ4A 1YTLA 2RGDA 3NPAA 3QK7A 3QNMA 4OK5A 5CLHA 1J97A 3KSAC 1E2UA 4PC2A 5LP6C 3ZWOA 4JR2A 4W7HA 3ZWQA 1NAIA 3UKOA 3VPFA 2REBA 3GP5A 2NO9A 1E7SA 1ZGGA 3M89A 3PQ5A 4F4CA 3RKRA 2XWSA 3MWJA 5IYRA 3LU1A 5J5VA 4ITVA 1S2OA 4CN8A 4WACA 4YRKA 4MJ7A 4RFSA 1E96A 1KBOA 3MILA 2NPOA 5FL3A 3ZUGA 1HL7A 4NS1A 2QRNA 3GGGA 4C7KA 4MUXA 1ZZGA 5DGIA 5JXIA 2FDCA 4LUCA 4LXUA 3HK2A 2H31A 3FPGA 2VDRB 3OIUA 1E9EA 3N76A 2INGX 1VHLA 3KQTA 5U4XA 4D4MA 4ZYLA 2WINI 4J76A 2YH2A 3GUCA 3QELB 4G26A 2PE3A 4PSUA 1X38A 2V3VA 2CUTA 1P2DA 1ZNXA 3NGMA 1SKYB 2Z0MA 3EW9A 4M37A 3S55A 1GL9B 4YAUA 1W48A 3OLZA 4HGPA 2PRIA 4MHOA 5GZ6A 4KXMA 4QT4A 5BV1A 4E30A 1BPLA 2W98A 1XPOA 2YVLA 3Q11A 3QLTA 2HK9A 4UCFA 5U1PA 2O5CA 1O7JA 3QYFA 4DLRA 4MP3A 4Q24A 3TMAA 4CIXA 1T9ZA 1I4LD 3G59A 2JCYA 3IAS6 5JSUA 2YXDA 5IFLA 1ISFA 2B21A 4X97A 3RPEA 2QPTA 3KOWA 1O0SA 3V2GA 1OFGA 1KVQA 1RAIA 1RRGA 3OMXA 4RW0A 2RHCA 2GCOB 3EYAA 1E2HA 3M4ZA 3LHKA 3B38A 4F9GA 2NPFA 3UWDA 4ZFNA 4F97A 3JZMA 1CJCA 1FRVA 1I6MA 1OYOA 4MRSA 2EHJA 4AN1A 2PZAA 4M8NE 3RBXA 1CSEE 4X7PA 3O8QA 3LQEA 1YJXA 2GERA 1Z4QA 4EPXA 2XVZA 3TXYA 3PU6A 4CMGA 1RAGA 2D0IA 2IUYA 4PW0A 4KIGA 1SZCA 3I6MA 4DM7A 2WSBA 1JKJA 1M5TA 1OTXA 1Y8RB 4XKJA 3KXIA 1WVIA 3TG2A 2JAXA 4UEQA 3JQBC 2XNSA 2GNOA 4HVCA 3K71B 1FYDA 2B9VA 1XN1A 2IPXA 2P9ZA 4LY9A 3G0BA 1UBHS 1MC4A 2ODEA 4RS3A 4YT5A 3TOCA 3CO0S 4U1RA 3DS8A 3RC3A 3UF0A 3ZOKA 1N7IA 4DBZA 5FTLA 1A3CA 1GKIA 3A05A 5JCXA 2VRBA 1Y0RA 2JN9A 1V95A 1E43A 1XMSA 2VAXA 4CV3A 2QMHA 1RWKA 4YUAA 3MT8A 3SXUA 1XTVA 4QYSA 3UWOA 3O4RA 5ISMA 4I4LA 3DT6A 3IOBA 4WZAA 1JILA 3COVA 3H1PA 4RE6A 3AOEA 3VTKA 3CURA 2AW3A 4NYIR 5EP3A 4MV1A 2YWEA 4U7PB 3QJ5A 5ESDA 1N7GA 3HV0A 4XYBA 4B40A 4K2AA 2B8TA 2JLAA 2AFIE 4G5HA 4B4KA 5EMLA 1PFVA 3I4CA 2VL7A 3LVBA 2ZZMA 1LDGA 1UL1X 3OQVA 2X42A 4ZAXA 4A6EA 2OP0A 1KSGA 1AKUA 2BE9A 2BI4A 4DUGD 2AG5A 1JECA 1E9SA 3B6ZA 1NQWA 2BFBB 3BGSA 1NVDA 4KK4A 4LI0A 2REQA 4Y2YA 2EKLA 4GI2A 3O84A 3N86A 2TSYB 2C1XA 3T5TA 1P0IA 2F43B 3X43A 4A6XA 4E07A 3CXRA 1O3YA 2C0QA 1TZJA 3EXFA 1UMBA 3GDGA 1GPAA 3GJYA 3QG5A 3QBDA 3QKSB 4YNBA 4CQMD 4QXAA 1Q1ZA 2W0SA 3RRMA 1VJ0A 3I5YA 3BDAA 1Z62A 4ZJYA 3DXFA 1KYZA 2QSZA 4JBLA 4N7RA 2ZAMA 1RLMA 4YDRA 4E5YA 2JGLA 2F3SA 5A3RA 3CWZA 1FP6A 1QFXA 2GSWA 1GNLA 1A8HA 4CV0A 4AY3A 5CTJA 5I8WA 1NLZA 1JEDA 2AZTA 3G0OA 5JBIA 4JLOA 1XPUA 1VTKA 2P7IA 2IZ0A 2Q4EA 3DV0A 4OLJA 4TV8B 1E0DA 3UJ3X 4XLEA 3K2IA 2YMPA 1RMYA 1YR7A 4ODIA 3VSDA 5IYZA 4IV0A 4JLWA 3U37A 1XDDA 3DLAA 1QO0A 3QJYA 2EP5A 2QEXB 3GN2A 4MW2A 5EP2A 3M34A 1QF6A 4K6CA 2BFDA 2GVDC 3SLGA 4R31A 2ESRA 3AG6A 3C5HA 3I37X 3SFVA 3KB8A 1BX3A 3ZZNA 4D4KA 4GKKB 1NN3A 4F0JA 1E6WA 4BKMA 1Z12A 5EIBD 1GN9A 4FSXA 3PGVA 3DCYA 4MAAA 1IB6A 3FYUB 1OLUA 5CYOA 4J0HA 1NXTA 2O07A 4CBVA 4EAAA 1TD9A 4JA0A 2NW6A 3DOIA 3UT0A 4NCIA 2HQOA 3WKAA 5DGTA 1DBSA 4F6LA 3S2UA 3V7FA 2GI4A 2VSYA 3NYRA 2JK1A 2QD3A 4O29A 1VG0B 2X77A 2E21A 2V54A 3RFVA 1QPZA 4KTVE 1QH1B 3ZQKA 2R4UA 3VNAA 2FXIA 1YJWB 4B80A 2IWHA 1MIOA 1JLMA 2ZRKA 4QVIA 2GJ4A 2O19A 4DXHA 5KC8A 1QYRA 3EVFA 3KHTA 3HI6A 1PX2A 4HC4A 2GEUA 1TJNA 1P9NA 2X5KO 5LQKA 1N3IA 4L5JA 3EIXA 3H1EA 3PLAE 5FL7A 1YRYE 3H11A 1RTKA 4J6FA 1CT9A 3OPMA 3TTSA 4D44A 3VPHA 5C0OE 3DUFA 4Z8YA 1FJXA 4EFLA 1XVVA 1Z63A 3EPHA 5KDOA 3NIWA 1DARA 1QDLB 2HNBA 2FNAA 5IK2A 1EJ0A 1H1DA 3H2IA 1KHTA 4WXMA 4XOIA 1B41A 3THOA 2B99A 3DGEC 3SSMA 2PAFA 3F4BA 3MOGA 3TE6A 3AQIA 5A6SA 3BCHA 5JNVA 4MQ5A 1XZNA 3FHOA 2NTJA 1PJBA 3BMQA 2Z1NA 3OTOB 1YUBA 1Y3AA 1BDBA 1DTSA 1PNRA 2DFPA 4CM4A 3RT1A 1JQ5A 1QM5A 1E63A 1SA0B 1VLHA 3NBFA 5FWXA 4FB4A 1QAOA 3SYMA 1GD1O 1N1MA 3HCAA 4NEQA 1NV9A 1V8FA 3HDQA 2QR2A 2Q8NA 4WADA 4A8JB 5BR7A 5TEVA 5ESRA 1UBGA 2ZSBA 1ZINA 5KTYA 2QX9A 3S7ZA 2D1QA 3E9RA 4WVFA 4V2IA 3ROPA 2C7PA 4NJEB 1Q1EA 2CMKA 2RG1A 4MRAA 3GUHA 3ZYCA 2VPYA 3ACDA 1AX9A 3HYCA 4F7WA 4I36A 2GZ3A 3EQ6A 5TRTA 3B3GA 2A9OA 1TFRA 1WXWA 5G0UA 1BFUA 1QWOA 4XGIA 4QTUB 5CB0A 3AB7A 2UXDB 1Y3BE 4UAJA 1GGEA 1HDCA 3DYBA 4K05A 3EXFB 2K2WA 3ET5A 2W43A 2FU5C 4OQEA 4N6GA 1C4OA 1VJDA 1PR1A 2WJPA 3QE3A 4J0DA 4BNNA 2P4SA 4Z9XA 1QIHA 3L77A 4E2WA 3NTVA 1OXUA 4V0LA 2V9CA 4D2IA 1RBQA 2OBSA 1H2EA 1P4AA 1JLLA 2PMDA 2FZ4A 2IZZA 2BZGA 3WNVA 5IDXA 4RQBA 5LVAA 1MZPA 5BSHA 3RAPR 2Z9BA 5BUSA 4ND2A 1CP2A 2QLLA 5BYBA 1NB9A 4UNRA 4LF6B 1T9BA 5DS0A 3VR1A 2PT7A 2XUHA 1RJEA 2Q5HA 2FSSA 4P32A 1QZXA 4C0SA 1WJGA 3ASYA 1JG2A 3U49A 2B69A 4PGFA 1CF2O 1GPJA 1P4JA 5JDCA 2E48A 1KO1A 2V3CC 4XZ3A 2UAGA 3ZLVA 1UFVA 2AC2A 1US8A 2DBRA 5E4YA 2IYFA 4U7HA 2H3HA 3KSBC 4Q1EA 3CY6A 4XUGB 3N53A 3LW7A 4PG6A 5DGHA 4TRNA 1JBEA 1Y1TA 5FBHA 3ZXUB 1P7VA 3BTOA 3OEYA 4GLJA 1G98A 3JWPA 1L5VA 4R3NA 3UJ7A 3H8SA 4YXFA 4I81A 3A3NA 1W52X 2UYCA 1N9GB 1TVMA 2EATA 1ADYA 2VXBA 3WDLA 4WCVA 1PGPA 2WI8A 5C1PA 3ZIAA 5JSKA 1U0BB 1NU8A 2ZSHA 4AECA 3V4LA 4LIPD 1RKXA 5A0FA 3MMPA 1XZDA 3KTFA 3MQ4A 5BWBA 1P8JA 1KFKB 1M6YA 4QUZA 2W6MA 4PGMA 1Z0IA 4TS4A 4DADA 2W4IA 3FPAA 1GWNA 2AJ8A 1R0KA 2YRWA 5EFZA 3JQ9C 2VTDA 4KPFC 3V8RA 3CEPB 2C94A 3DJYA 1D2RA 3GPIA 5HOQA 1J1UA 3QSYA 1IZ7A 2QTWB 2OZLA 4MWTA 3HUTA 1R8XA 5GM2A 3RSGA 2BCGY 5B2EA 1T91A 1KAGA 1NURA 2VSNA 2KBFA 1G5HA 1D1QA 3AKDA 4LPKA 3ZJYA 4BVJA 2IYOA 3HRKA 1NB0A 2OORA 2UVPB 3CGWA 4KACA 4DK1A 2ZUEA 3I9NA 1JVBA 1AKMA 1X8LA 3E7DA 2ABWA 3CKMA 5D5PA 4JT4A 5FA8A 1LDEA 2HT6A 4JS0A 5SZKB 1E9FA 2WIDA 3KYDB 4X5OA 2VNKA 3H8VA 3LIPA 4PN3A 4PR0A 4ZVLA 4DZTA 3CR7A 4RTNA 5KAPA 2ORVA 3L6UA 4HRVA 5DNWA 4B7AA 3JU4A 3LLSA 1DC6A 1F9EA 1U8AA 2OQRA 3KAQA 4MVYA 2NXEA 2PO7A 3JU3A 4ZCQA 3VSEA 5IUNC 2JFGA 4GE3A 1W8DA 5AUQA 4DIDA 2Z30A 5DRYA 1XAGA 4X91A 5C32A 5IXSA 1QZTA 4FILA 1OZGA 1XCGB 1B43A 1Y9ZA 2J3LA 1IAVA 3G9TA 4U3JB 3DFIA 4XWYA 3T9FA 4C2TA 3IUMA 3BK1A 5LMCA 5AW1A 2HF2A 4XTRA 3KJXA 4AP9A 4MV7A 1QRTA 1Q0SA 2OECA 3EXAA 5A4FS 1RKQA 3GUYA 1N4AA 4X8MA 3SC4A 4M2LA 1IJBA 5IYPA 3TCXB 5JQGF 3HNRA 4PZAA 4CT5A 2GTIA 2V9ZA 4RMJA 5BVGA 5J3OA 2VNIA 2CSUA 1AGPA 1SUIA 3D6UA 3QW2A 1ZI6A 3QWAA 4KQMA 2JGIA 5CM8B 4AJHA 5AW8A 4G0VA 3P0FA 1MGOA 4I6JA 5LCXA 3OWXA 1XMOB 2V7GA 4IHKA 2AI2A 5CX1B 3CE6A 3KQNA 1UJCA 3SIXA 4OB6A 2CCKA 5L3SB 3ASPA 2BMDA 4NZOA 3VNQA 1LPBB 5BPFA 3MLAA 1XNRB 2NXCA 3NKLA 3D31A 4JJGA 1PS8A 2OZVA 1Q7CA 4QA9A 5BQ3A 5K0CA 4MCAA 2PUHA 5ADUS 1WDMA 1MB4A 4ID9A 5JISA 1G7CA 4PO9A 2JBAA 2QJWA 4EENA 2NP7A 4PLWA 1KEKA 4JI0B 3L9XA 3GH1A 1PT8A 3PC8A 4RDIA 3UAZA 3GMDA 4ZMSA 3RROA 1R6AA 3QM1A 1JEYA 3DWGA 1JFVA 1AIPA 1JA9A 1Y1KE 3GJRA 3NH6A 5KSZA 2DR3A 4CG1A 2HA4A 2I6XA 2FVYA 4GI7A 2O6HA 5HF9A 5JH7F 1AMNA 4ZPXA 1J8VA 2J08A 3CG0A 1DLJA 2ACEA 2RGEA 1ULTA 2FPMA 4Q9AA 3LC1O 4U8GA 3T1HB 2H48A 4OHUA 1USUA 3OZCA 4BXOB 5LQMA 4C5BA 4JSTA 4BN5A 4A5OA 3EFOB 4DQLA 4ZJUA 1T3HA 1NQOA 2PGAA 3NPMA 3ZD7A 2X9LA 1CNMA 4E5MA 4KCGA 2GN1A 2PSSA 1NJ8A 4WLNA 4CMJA 3DOHA 5JVDF 4DYHA 3UJNA 1UPUA 2NUAB 3OF5A 4GNRA 4QV2A 3F1LA 4X90A 2VHVA 4BQRA 1Q7GA 5LOVF 3DLBA 2DTEA 2ATEA 2FUNB 1SKAA 3GLGE 1WSBA 3N0WA 3O92A 1BD4A 1UUFA 3MTAA 5ALNA 1SXQA 2EL7A 2JI7A 2ON6A 1RI4A 1W1IA 3C3JA 5CJ2A 5EKXA 3V80A 5LXTA 1RQ7A 4KPYA 1TM5E 1PJAA 1T5IA 2IQIA 1N2GA 2IJGX 1EGMB 3ZVLA 1G38A 1P60A 2DR0A 3NTOA 4OQPA 4AZ0A 4QDJA 1W6RA 3PNBA 3WXMA 1KBZA 2XOEA 2UYQA 4Y2HA 1HX7A 4G2NA 4BVLA 2WYOA 3MNFA 1ID1A 4MQEB 4EHAA 1YLOA 1VCNA 4PVDA 3AI2A 3PEUA 1YHQB 2NYUA 4O63O 5DU2A 2I91A 1UJ4A 2Y1GA 3KKEA 3JPWA 4MS4B 3JY6A 4CV2A 2RGCA 4EDFA 3ASVA 3KBBA 5LZ8A 3C5WP 3VDMA 2R65A 2VF5X 2GPWA 3WMWA 1M73E 3KFVA 3EX7C 1EFAA 2ZCVA 1N2JA 3C3MA 3KTAA 4QTTB 4KO1S 4MUJA 1FFYA 2G0AA 5HIAA 1QH0A 1QPGA 1XCMA 1GPUA 4C03A 3L84A 3HJFA 1QX3A 1IYZA 1L4BA 4DNOA 1DKPA 5F1YA 4IPTA 3AMVA 3PC6A 5B53A 5LD2C 4TYNA 4J2HA 4ZT3A 3CS3A 4LDQA 1G7TA 2ZIXA 1GU0A 1GL7A 1Y9DA 2ANCA 4K9KA 3HWRA 5FRDA 3RIMA 4GR9A 3VHRA 2JIMA 5TE9A 5KDDA 1MA3A 5C9ZA 2DH6A 3PXCX 1Y8QB 1M2OB 3KUCA 4RPLA 1I2DA 3LT4A 5E4TA 1NQAO 1I3NA 4A91A 1MCZA 3AVUA 4KQ1A 1IZ8A 4WRRA 1KIMA 2MSKA 2V58A 1Y1PA 4IWXA 4LYYA 4F2PA 1FNSA 1WB6A 4RSGA 1BS1A 4ZCMA 2R8EA 4FE4A 4DA6A 1CRQA 1N1EA 3IQIX 4E94A 2O8BB 2CB0A 4M1YA 4X92A 2NLOA 3N2LA 1N0IA 4M9UA 4MS1B 2R6AA 4OFXA 3L05A 1KFCB 3EQZA 3GCGA 2DUNA 3IYLW 1HORA 3DTYA 5G0WA 4H60A 5HGJA 3ZHOA 2CE7A 3RHFA 2X5JO 4ZQGA 3K4QA 5JTUA 4XARA 1CB0A 3AR4A 3CZAA 4IJ6A 1E1NA 2J0EA 1YDHA 3I8XA 1V5VA 3UM9A 3THYA 5F73A 3I3OA 3FIJA 3L4BC 4RF5A 2WBLC 1CUZA 1LS1A 3BTUA 5PNTA 3ONWA 3WNDA 4QTZA 1IQPA 2RGRA 5E9QA 4D74A 3C3YA 5G0TA 4RORA 1MTOA 3K94A 5FWXB 1QE5A 2CLSA 3TYXA 4J7XA 4EG5A 4CTMA 4NH4A 1A7AA 2OWEA 3K32A 3O4FA 4PLGA 1T4CA 4IGAA 1GSHA 5DEOA 3DMRA 3I2HA 2HJHA 3NBXX 2LCQA 4BGDA 1P62B 4UNQA 2QTCA 3V7WA 5HZMA 2XUOA 4KZPA 1NYLA 3SZ3A 1KHHA 1U2QA 4AJOA 5JQGA 1JFLA 4R9UC 1OWPA 4ZVNA 3K6SA 2P8SA 2HCTA 3PXDA 1NMQA 1WU8A 4HE5A 4GOLD 4OK6A 1YJ8A 1BMFD 4L0QA 1D6MA 2O8DB 2RIPA 2ZRQA 4EY5A 2EBHX 1R00A 5AOAA 4I9UA 3QFCA 3PQ6A 3FWKA 4GX2A 2ZZQA 4JP8A 3RTDA 1K7EB 1PQUA 1I18A 4AY2A 4RAOA 4UEKA 4UQLA 2D3NA 1P44A 3DNFA 4QBHA 3UB3A 1DKNA 1HZJA 3SBDA 4BNZA 8MHTA 2GQFA 1I1OA 3ESAA 5CDFA 1JG7A 3LBAA 5L95A 3W2IA 1LPAB 4E12A 5FWYA 2JJYA 1JMKC 2EG5A 5L7YA 5HQ3A 3IAS1 1XXLA 2W6PA 2CXSA 1APBA 3B2NA 5BVGB 3ER9A 1JXQA 4JCCA 3HY3A 2P9HA 5TGDA 4QPCA 1JB1A 4GI3A 2D74A 1LX7A 1JGTA 1VKRA 4P38A 2EF0A 2ZBDA 1YU6A 4RF2A 5CXXA 3DEFA 2Q6LA 2O8FA 2AUTA 4PFSA 2G76A 3P9RA 5T6BA 4KVAA 2IYWA 2HDOA 1LRJA 1PJLA 3CJRA 1VPEA 4R68A 2IHUA 1I4WA 1UK6A 2D00A 4L8YA 3TFQA 4DMGA 1SHTX 4LYGA 3FYUA 3T1VA 4M53A 4O2AB 1OI4A 4PQEA 5KYWA 2FWNA 2UZ1B 3U44A 4CLOB 1SVUA 4PSVA 1DEXA 4HAWA 1ZLXA 3SD7A 3BXFA 1HWYA 1UBMS 3JRXA 1Q84A 5C8XA 5DHFA 3T3GA 7AT1A 4W82A 3R5JA 3E4CA 3QUTA 4MUBA 1Z0JA 3DHVA 1KR2A 2CHQA 4L4YA 1YS4A 4YCMA 1W5TA 3SZGA 1K8XB 3IJPA 4ZVPA 1T9AA 1PAUA 1WSAA 4J0GA 1ORTA 3K0AA 4MI1A 3SX4A 3G2MA 4EAQA 3W8RA 3D59A 4J16C 1DFGA 4CKEB 4URYR 1V37A 1OXTA 4IRUB 3MJHA 4FXPA 9ATCA 1QP0A 2B4KA 3P0RA 4CKZA 4RY8A 4NZZA 3GFQA 1ZOPA 2PNFA 4Q7KA 2MMCA 4RACA 2CDAA 3NVMB 2X0EA 1J9ZA 3RS8A 4BRWA 5I7FA 3FNGA 5K99A 1XTZA 3FCEA 1DADA 4IIFA 4NIMA 1I33A 3L4BA 5AUPB 4JI3B 1UF9A 1TTHA 3I32A 2UV8A 3PUYA 3ZDRA 4D9MA 3I6ZA 1IU9A 3I3SR 3RYHA 2JJ1A 4CLXA 3CLHA 2MSDB 4IH1A 4QGSA 2IOYA 3DEZA 3L7OA 3B9RA 2IYPA 3RR2A 3R77A 3D8UA 1MG0A 4F3KA 3FUVA 3W5AA 4LZWA 4QDKA 2W6JD 5BPHA 3T1NA 3DXXA 1V43A 1CJVC 3IH5A 2PZGA 3DR5A 2GWRA 2YIVX 1LEHA 4N39A 4Z53A 5KJFA 1OBFO 5DM1A 1NXSA 1MO6A 1D2GA 4QBGB 2O7RA 4EG0A 1BXGA 4XUCA 3KKZA 1EE1A 4C3UA 3GHHA 2IHTA 3GJ4A 3DGFC 1BYUA 3ELWA 4XIYA 1V71A 1GU1A 4H0FA 1KDYA 5K03A 2DLCX 1QYVA 1Q95A 2GMWA 2OORC 421PA 4E2XA 2GUGA 1QIKA 1QP8A 2FFQA 1MV8A 3OX2A 3LKBA 1Y9JA 4HI0E 2BGIA 2H6EA 3OEED 2YUTA 1NTOA 2FZLA 4UOZA 1GM5A 4H35A 4TYWA 3AEUA 3Q7QA 4D5GA 3EE6A 4MRMB 3IDOA 3WWZA 3L1KA 4MQEA 4E03A 1AHIA 1PD1A 4UEWA 4EHJA 1TM3E 4UMEA 3E22B 2EZ4A 2FN7A 4YJHA 4EHBA 3IA7A 2C5GA 4IIXA 1B8NA 4XSHA 5T57A 1H94A 3V7NA 4IDHA 1KEVA 1NM5C 4GZ6A 2YTZA 2IHZA 4OOXA 3RSZA 3C7KA 1PP4A 1OA1A 5EYPB 3U7QA 3GFSA 4W99A 4TS9A 1E59A 2DC1A 2W2OA 1CJTC 2OMKA 3GV0A 4QREA 2H1RA 4BU0A 3PX7A 5TX7A 2GD2A 4B9EA 3ZV5A 4DR7B 4BMPB 4DA0A 1T3TA 3SDZA 5J4YA 3AJEA 3K6KA 3R2JA 5GOTA 3IODA 4JI5B 1YIDA 2EHDA 2WTXA 1P2TA 4PZDA 5EZ6B 1CY1A 3KL4A 4NDAA 5KINB 1XD9A 1O5TA 1J42A 1GTG1 3Q7IA 2ISSD 4YV7A 2GJAA 3P0JA 5IHXA 3U61B 4ETIA 1AF7A 2FFRA 3NZEA 1WUTA 2NV0A 1GGVA 2P5SA 3FYCA 5GONB 3JXEA 2WTUA 1YFLA 1UXKA 1QBGA 1VECA 3Q7SA 4IO1A 4P5EA 1S4QA 3SU8A 3EPPA 2E4VA 1NNEA 4RIEA 4YJ3A 3CRQA 5KWEA 1MJGM 4GM0A 4JLJA 1NVTA 1JAXA 1VBFA 3DUFB 4U2GA 5AJZA 1KP3A 2FDRA 3AFOA 3PYXA 2FR0A 4QIHA 4LZOA 3IEMA 5F3WB 4QOFA 5A2GA 4A8PA 3D8SA 5EJ4A 1KTIA 4FWIB 1NP3A 4HN2A 1VQ9B 1XA4A 3IESA 4MWCA 3ESZA 2AI1A 1Z6PA 2Z04A 2XBMA 2YNMC 3CCSB 1BKYA 2PGLA 1NJ5A 3PIRA 4FFBB 4K87A 3T4PA 4BE7B 2J3IA 2JVKA 4JASB 4XM1A 3ZWYA 5B57C 2Y76A 2QSYA 1J70A 2YICA 1GCGA 3FD8A 4BNTA 2RAVA 1P80A 4KI0A 3BGOS 3I64A 3NM5A 4X8IA 4IDBA 3KYJB 3BRSA 3U4MA 1U7PA 4PR3A 3MRSA 1PJSA 1AMOA 4QRDA 4JZYA 4D97A 4FD2A 2QK4A 4JLBA 4C6TA 1T8PA 4NC9A 2JDIA 3ZCQA 4WDQA 5KOJB 2HUNA 3T61A 3ZJTA 1EAMA 1O96A 3E9DA 3I09A 4B4WA 1A1SA 4ZDJA 1WABA 2C31A 2UUBB 3QG1A 1ZD9A 1P2SA 4WY8A 1GG2A 5D1HA 4UTVA 1A9PA 4BNMA 3UMSA 3W8FA 5ECYA 2JI9A 1EVQA 3PXXA 4QNMA 4UATA 3DSRA 2R97A 4UQOA 3E2PA 5TMBA 3W4JA 5B2FA 3CLSD 3HM2A 3KOUA 4P83A 4P6VF 1WZCA 1M8GA 3RYFA 2DFKB 5CNJA 3ZWWA 3IAFA 3THWA 4EYSA 1NUPA 2XDQB 4KBGA 5GIPE 1EVZA 4GMGA 4LOHA 4DILA 3ZQ6A 1O77A 5A6VA 3CNQS 1V1RB 3DBVO 1NSYA 4NJMA 4MGHA 5EHIA 3T52A 3TZCA 1VSUA 2ZYSA 4YJ3B 4CLEA 1IN8A 2UXBB 2FSUA 3NHAA 1OLOA 1QHXA 2PVSA 3E3AA 3TTUA 5K0JA