2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
1Q1BA 2WWFA 4BASA 4IKEA 4P31A 3U4QB 4JLNA 4LX0A 1ZCAA 2WPDA 3HU3A 4HAXA 1UAAA 3CM0A 2XB4A 4K1XA 3U4QA 3Q7PA 2BM1A 1KO4A 2GZHA 2KE5A 3LD9A 4FXPA 2FA9A 3NBYC 4V03A 2CXXA 4HLUC 2GJ8A 2O5VA 4DEXA 1Q21A 4X8OA 1OKKD 2C78A 3KUCA 4HDQB 1YJWB 2IYLD 4EJSC 3ZZUA 2JIZA 1KMQA 2ERYA 4QGGA 1BMFA 1S4QA 4BLOA 4US2R 5AJXA 1Q0UA 2W0MA 4D26A 1XMVA 1SQ5A 4BFVA 3ZS8A 5JHGB 3WBJA 1E2NA 2GAOA 3AVTA 3K9HA 1QF9A 4YXWA 2ZSBA 4KFTA 1OHHD 1UEJA 3UK6A 4KBGA 1EP2B 4M53A 1X86B 1G8PA 5C4GB 2ZRJA 4JL6A 4JYCA 4FN5A 3TNFA 1Q1ZA 2XJ9A 3ZVLA 5FL7A 1E96A 2ZPTX 2BVNA 5KSWB 1RJ9A 4PO1A 2QROA 2X2FA 4XH9B 1QHXA 4XTRA 4RFVA 4A82A 3JZMA 3PQCA 1N6IA 2YHSA 3QXJA 4B3FX 2PMKA 1QGZA 3AV0B 2DETA 1T0HB 4YMTA 1SVIA 1P2UA 2BMFA 1MO3A 3KKMA 4AYWA 1S96A 1PJRA 4QG7A 4GOJA 4P33A 2H1LA 4QHTA 1XEWY 4C0HA 3LY5A 1KNXA 4E5UA 1KO5A 3LW8A 1TF7A 2QTFA 2XNCA 1G64A 4C9BA 4RKFA 3CNOA 3DZ8A 5AK0A 2ZSFA 2Z4SA 3EARA 3QXHA 3T06B 4JLBA 3EW9A 3SYKA 2EFHB 2RGEA 2G0NA 1I4TD 1G41A 2QM8A 1XXHA 2ZU0C 3U7EB 4KO8A 5JSZB 1EFUA 4EJSB 1SVSA 4HDOB 3WNDA 1GDDA 1E79D 2HXSA 2VQSA 3KQUA 1TF5A 1E0AA 2J9RA 5E7JA 1CR0A 3HJNA 4B32A 3VO1A 1P2SA 4FWTA 2HT6A 2HCBA 4U9UA 3SHFA 1OH6A 4K46A 1SULA 3VHLB 4AURA 5HPYB 1NN0A 4ASUD 2VNJA 2D4HA 3CCMB 2KB0A 2WJYA 4OHXA 3IBYA 4D0GA 5JMTA 5KSYA 5TR9A 1L4YA 2PX3A 1GVHA 4B44A 3HP1A 4DT1B 3AUYA 1GNPA 2YINC 4BLRA 4UXJA 2QGZA 1IXSB 2E9SA 2DBYA 1KY3A 5KSZA 2IEYA 1XTIA 3K53A 3AVOA 2NZ8A 3GJ3A 4LPKA 1ZAKA 3TVTA 2OEPA 4TSFD 4EFMA 3THYA 1GKYA 2C96A 1VKJA 3K09A 4BPRA 1Z83A 4V0LA 1G291 1OXUA 2BMDA 4FMCF 4EFLA 1Z6TA 1WA5A 1DELA 2XZPA 2VSFA 2O8EB 4NYIQ 4WW0A 4F4JA 3T1VA 2I3BA 1G1MA 4MKIA 1DE0A 1MRNA 5K8LA 4MITA 3U61B 3A58B 5DN6D 1ZNWA 2QE7D 3DM9B 4F7DA 3GEEA 4OHWA 4A6XA 1KSHA 4NMMA 1OYWA 4U5XA 1CS4C 3CCLB 4Q9HA 4Q9LA 1CF4A 1A1VA 4JLVA 3MD0A 2CNDA 1D1NA 4HE6A 2CCKA 3KB1A 1XP8A 3NH9A 5M04A 3QVUA 2OO7A 4HAZA 4JSYA 3SBDA 4G01B 4Q5IA 2CE2X 5BN5A 2RMKA 3EZ2A 3Q5DA 1NG1A 1N5KA 2J87A 1CP2A 1AGRA 3RWMB 3UANA 4PX9A 1F2TB 3QKSB 4WXPA 2H57A 5JJIA 3EPKA 3CCSB 2WOOA 4RD4A 3B13B 1DG3A 5EE0A 3E1SA 1XD2A 4OI1A 3AUXA 2ECKA 4FIDA 1WBBA 1TQDA 3L0PA 4Z1MD 5HZHA 2FGKA 1E9BA 4HLDA 1PUJA 3QY0A 3A36A 1P72A 4URWR 2R65A 4OHYA 4B6FA 3SNHA 1KJYA 3ETLA 1QX4A 3B78A 4UXHA 4URYR 2RGBA 2JLRA 5BQ5A 4EUNA 1NN5A 2D2EA 3ZLJA 4KODA 1K5DA 1W2GA 3H86A 5HE8A 5K8UA 3GFTA 4TLDA 4YMUA 1XX6A 4R7ZA 3BD9A 4ZI3A 1TEXA 2ORIA 5J40A 2JJ1A 4HAWA 4UNNA 1JBKA 4WZAE 4Z54A 3QKTA 3LH5A 2R2AA 4ZGQB 2FFHA 2ZRHA 4M8NE 3VX4A 5GJCA 4NYIR 3HU1A 4X8MA 4PANA 1X1SA 2C77A 1TLLA 4JS0A 1QUFA 2ODNA 2GVDC 2B5OA 1KY2A 1LB1B 1PLJA 1SVMA 2GVZC 4V0KA 5SZJA 2IS6A 5BYJA 1E98A 1YR8A 3TK1A 4TQAA 1YZUA 4NCHA 4BUJA 3AP3A 4QGFA 1TNDA 4U00A 2NG1A 4CT4B 2HF9A 3KKPA 2Q21A 2K5UA 3NEJA 3T35A 3TGPA 1W87A 4HB2A 2VP9A 4RD6A 4PHFA 4YHBA 2BC9A 1OIVA 1OV4A 4ZCIA 1SZPA 1G5PA 5LD2B 1OYYA 4TN1A 5TY0A 1ZINA 3OF5A 3SZRA 1CULC 2RHDA 3OZWA 2WOJA 1VQ4B 1DBSA 3WYGA 1OXSC 2NOAA 3ZD7A 2WJGA 3CCUB 3BH7A 4HUTA 4TMZA 4UKDA 1DAIA 4CEJB 1A4RA 4Q03A 1KI2A 2OESA 4TT3D 4GP6A 4TL7A 4BLTA 1XZQA 5E3HA 4GZLA 4Q01A 5DN6A 5C4MA 1W2BB 3U7FB 4B3XA 1EFRD 1KDOA 1G9XA 2QM7A 2YOFA 3A6PC 4Q9KA 2ZVQX 3T5DA 3Q3JB 1M1KD 4M9SA 2PX0A 1W44A 3QFRA 3SQWA 4D4JA 4KBFA 2FDCA 1UADA 1RRPA 3R8CA 3RC3A 1QG4A 5GADl 2ZRCA 2EWVA 1G8FA 3GLIB 3CIOA 1R6BX 1NMYA 4RSGA 5H59A 3W2EA 2V4ZA 3BERA 3QF4A 1UKEA 4ZKEA 3QOFA 1IN7A 1GWNA 3W2FA 2ZE5A 5FTKA 4AI6A 1EFRA 3W3ZB 3M6AA 5B30A 3IBGA 2JCSA 4WIAA 5FFMA 4S2EA 1EK0A 1R2QA 4UNSA 4DLYA 1Q57A 3MWKA 2ZSAA 2IYSA 2JASA 2BEJA 1HTWA 3NBFA 1Q44A 4KJZA 2YNMA 2ZE8A 3LVBA 2A5DA 3P4XA 5HE9A 4A0GA 4ON9A 3W8NA 3RC8A 1ZIPA 2FPKA 1OFIA 1F20A 4B47A 3QF4B 2NO1A 4RCZA 1S1CA 1OHHA 1XXHE 4MH0R 4HZUA 4Y0VA 3O8RA 1VHTA 3AGPA 1HE1C 3I72A 4RJLA 2WWYA 1Z07A 1MV5A 2NPFA 1Q12A 2D7CA 4NCKA 5DLQC 4MYHA 1W5TA 3CPHA 5G41A 5JLJA 2ZJZA 1VIAA 2Q6TA 3CPJB 3UG6A 4LK2A 2NQ2C 4Q1BA 4LRWA 2PMDA 2VIIA 2IUUA 2C9YA 3JVVA 1YI2B 1P4SA 2KI5A 3AM1A 4RZUA 4A36A 3H4MA 1NVWQ 1K8AD 5L3SA 4W9MC 2P6UA 3PIRA 3LQRA 2AXPA 2QUZA 1X3SA 3HR7A 121PA 2FFBA 2FMXA 1D5CA 3LRPA 1Q1EA 2EQBA 1QVAA 4US1R 2OAQ1 1E2IA 4AG6A 3SQXA 3UKDA 5FPTA 3WBKA 4LWZA 3OAAA 2DFTA 2J3EA 4GZMA 2OXRA 5DHFA 5FPHA 5P21A 2CLSA 3V4RA 1Z0DA 1UMKA 1XCMA 1OF1A 1C1YA 3B2EA 2R6AA 5JJLA 4EPTA 4ZDWA 2NZJA 1XTQA 1CTQA 2FN4A 2VP5A 3BK7A 1HEIA 1BX1A 2PZEA 2CVHA 4JYBA 1YR9A 4M1OA 2EFCB 5TVKA 2IHYA 3PV0A 4TQ9A 3SI7A 2ZJAA 2VNIA 1K9MD 4POAA 1OKKA 1EP1B 1KZGB 4UNPA 3B1ZA 2FEMA 1XPOA 4EIWA 4Q18A 2C04A 2GEVA 4Q9IA 4C0BA 1US8A 3TH5A 3GFPA 2DFNA 3Q5EA 4CF7A 2F43B 1QGAA 1XTKA 3I61A 4W5WA 3QE2A 5G3ZA 2QMHA 4B74A 1CRPA 3ZVNA 4JIMA 3DMNA 2ZRIA 4PFSA 5HZKA 2YKGA 2O8CB 2IS4A 3B7GA 4B35A 4XWOA 1IONA 1V5WA 2BV3A 1CR2A 3OHMA 2WJVA 3B9PA 3K09C 3NIBA 4QOSA 2Z83A 4W7SA 2GBLC 2QTLA 1G8HA 3P32A 4KITB 4CEIB 2QRNA 1ZNZA 1BX0A 5JI2E 2BKEA 2J59A 1Z0AA 3IKJA 3LNCA 5IK2A 4ZDKA 1QVRA 3P20A 2O8DA 4ZI2A 4Y7CA 1SKYE 1VCOA 1OXTA 3THXB 1FNBA 1E2LA 1J8MF 3CC4B 1YRBA 2R8RA 4ZGNB 2PT5A 3E70C 1T0JB 4HZIA 3A8TA 3QEJA 1NL3A 2QNRA 1CU1A 3VX3A 4ABYA 5FA6A 3THWA 1GOTA 1WRBA 2V7QD 1VQPB 2V54A 3ZIAD 3T12A 3DOEA 4XTCS 4YONB 1D6JA 2XOKD 3WMGA 2GF9A 2WJJA 1T6NA 6Q21A 3OJWA 1S3SA 1FL9A 1E9RA 3RRYA 4A4DA 4G5RA 3HYTA 4ASUA 5DH9A 4TYYA 4M22A 2LKDA 1G8GA 1UBFA 4L15A 4OHVA 2D2FA 2QTZA 1FUUA 2QSZA 4LHWA 4G1VA 5FR1A 4YAWA 2ZRAA 2FPLA 521PA 5FOTA 3DHWC 1J9ZA 4UNQA 3UMRA 3W9YA 2ZETA 4M4SA 3ZS9A 1OH8A 3I32A 5LB2A 3GLFE 1W5SA 2H8KA 2JLSA 3FYHA 4PPFA 2HYDA 1F2TA 3KKQA 3QKSA 3TQCA 4ZPXA 2JLQA 4M1TA 4KU4A 1GJRA 3GLHB 2JJ2D 4HB0A 2XNSA 3IIKA 4OHZA 1LS6A 2VHQA 2F9LA 2HLDA 1EWRA 3CPEA 1TUEA 5AJZA 3AGQA 4QRHA 2HMAA 1DTSA 3H84A 4MDEA 4D81A 3DEFA 4MYCA 3MFYA 3RVBA 4IFBA 4IXMA 2OBLA 4M1SA 1E2FA 1N6RA 1PLLA 4DWJA 5JSZA 5KOYA 3BS4A 2PZFA 1GRRA 1JEDA 3GJ0A 4YMSA 2XXAB 3IIJA 4NPHA 5LBIA 3VKWA 1ZUHA 1UM8A 2DR3A 1TTTA 1P9NA 2OFXA 2Z0MA 3BORA 4TL8A 4XVRA 3CR8A 5KNBA 1YJ9B 2XNJA 1EWQA 1SKYB 4V02A 3WYFA 1K8RA 3FMFA 4KVGA 4DKXA 2BMEA 3B1YA 1XMIA 3JQPA 3K0CC 2R6CA 5FI1B 1UKYA 1B0UA 4ARZB 1SXJA 1JJ7A 3GD7A 2IW3A 3TKLA 4UJ3A 4EJSA 4QKQA 2C2HA 2BWJA 1YR7A 4KSCA 5EXXA 4B3DA 1EGAA 1A82A 1Z06A 1ZD8A 2P65A 2GESA 2B7BA 4ZCLA 3FDIA 4LV5B 2PJZA 3N70A 3NHAA 1FTSA 4M9XA 4LJ6A 1N2CE 4B3BA 1AJEA 3D6TB 1OFTA 2WHXA 4C43A 2PCLA 1HV8A 5A5GA 5L3QB 3FWYA 4XWAA 2J41A 5FPSA 4L9WA 2WICA 3ICEA 1WP9A 4UJ5A 2O8EA 4ESVA 1BO6A 3DO6A 3EC2A 3GJXC 2V7QA 4BFXA 1YZKA 1IN5A 2BBSA 2ZYUX 4KHZA 3K70B 3W5HA 1ONBA 3SJAA 5FUVA 4TMVA 3RS5A 2FEOA 2IC5A 1CIPA 3RHFA 2ZI7A 4XD7A 3IPYA 1T5LA 2W6ID 3TE6A 1CNEA 4LYFA 3SU8A 1M2OB 1ZM7A 2FV8A 1NBMA 1VHLA 5FTNA 3W6PA 3EG5A 4C0SA 1IB0A 4IDOA 2CK3A 3EA0A 2WM9B 5CB8A 1QFZA 1XTSA 4ZV4A 4KCGA 1NKSA 3RWOA 2A2ZA 3ZQJA 1U9IC 3IHLA 3OZXA 3RSLA 2V1UA 5HR5A 1G7RA 3QFTA 1Q3TA 3D8BA 5CYPA 3TR0A 3Q9LA 4DZZA 2D06A 2F1RA 3GLIA 3NG1A 2BBWA 3SC3A 1VQ5B 3GJ7A 4Q4HA 3R8FA 1SVWA 4PC6A 3MWJA 4PAOA 5AJVB 1TEVA 1QGYA 3C15C 3G4SB 4Q4JB 4DCUA 1E32A 2ZS7A 3RRNA 4II7A 4DDVA 2NO9A 3AKEA 1Z22A 2GEDA 2RB4A 3EWAA 4DC9A 3K0SA 1JR6A 1FZQA 5H68A 2WWWA 4LHZA 4OK6A 3B85A 2XEXA 1JI0A 3DKPA 2XXAA 3AB3A 5SZIA 2GCPA 5H70A 2FH5B 2GTPA 2BCGY 3VR2A 2WJHA 5JRZA 1N6NA 2P3SA 2QPOA 5HTKA 2B21A 1IJEA 2OBMA 2EFGA 3EZ9A 5C46F 2F55A 3PUYA 4PZZA 5DYGA 4LOAA 4FD2A 2CL7X 4KYUA 2YOHA 5F9FA 2FSIA 2ZSDA 1PZNA 3CX6A 3ZC3A 1G4UR 3OFND 5E95A 3I55B 3WP1B 2D7DA 2AR7A 4QFMA 1IOZA 3EZ6A 1DOAA 1NF3A 3RS2A 5JCPA 1W34A 1VG0B 4R9UC 1KO1A 4LBVA 5FBVB 4OI0A 3A1UA 4G1UC 3LQQA 1NSTA 4ITRC 5CYOA 3U7GA 1Z63A 2OV2A 3LAWA 3C8UA 1RFLA 4DIDA 4DLSA 1Z2CA 3PEUA 4I1OA 2QEXB 1DPFA 1WE2A 3LX5A 3KQNA 2KSQA 3GEIA 2O8DB 4LJ7A 1MABB 2F1HA 3NC0C 4TYQA 2C9OA 2EW1A 4G3XA 1QDEA 1H8EA 1OSNA 4IOLA 2ERXA 2VZLA 3LFUA 1K73D 5B64A 3C5CA 4PC1A 1H65A 5HXBA 1IHUA 4NDZA 1KRHA 4F38A 1R5BA 3VNVA 5EZ5A 5TARA 5GV7A 1RIFA 2OZEA 4IXNA 2BIFA 1QG2A 4EQ6B 2GXSA 1Q86D 1KHTA 4DUGD 2A5JA 3CO5A 4P0TA 4D6PA 2A78A 2O0HA 3CWZA 3ZQ6A 4CZ2A 1KI8A 3FKQA 4AKIA 1D2NA 1YHQB 2VP2A 4XVQA 3LO5A 4A1FA 3ECCA 3EPHA 1ESNA 3X1XA 1N8RD 3PUXA 3OEHD 3MGCA 2RAPA 3EIQA 5DI9A 3OIUA 2IT1A 1FQJA 4Q4JA 3ADCA 4OKSA 4Q1AA 2CJWA 4XOIA 3WMEA 2VF7A 3MMPA 1YZLA 1T3HA 3WRYC 3I5YA 4B33A 5D3MB 3REFA 1U8YA 2G1JA 1XF9A 4URUR 1XE1A 1I2MA 4D0NA 2EWWA 2CDNA 4TL9A 1A5TA 1U8AA 1YE8A 3ONWA 5FL7D 4TLAA 1Q82D 3R7WA 2EIXA 4QBHA 4OI2A 3OAAD 1A7JA 5KNDA 3SHWA 1DAEA 1DARA 2BJWA 3ZH9B 4C0AC 4PGOA 1OPXA 3GCGA 3BGWA 2XGJA 4V0ME 2VNHA 4YMWA 5EE5B 4LC1A 4FI3C 4YAUA 1W4BA 2Q3MA 2ZROA 1S0UA 1KDPA 1OJLA 4FMDB 3N2IA 3VU9B 3NBZC 1NLYA 2IK8A 1RRFA 2G6BA 2BSAA 4DSNA 3KQHA 1IXZA 3QPVA 4TZ0A 3CRZA 2I1VB 5TV2A 3G5UA 3CONA 4TQUS 4D0LB 1WB9A 5IDVA 2J0QA 3CF6R 1G16A 1ZIOA 2A5GA 2ZI4A 4LHXA 2ODEA 4OQLA 4XJXA 3BXZA 3UMSA 1IN4A 2WKQA 2REBA 3WYAA 1S72B 2QPTA 2BMJA 2YWGA 1VCIA 4QHSA 2J45A 1H8HA 1KSJA 4A9AA 5HKKA 5GVSA 1O3YA 5C18A 3SBEA 1M7GA 3VHXA 5AWFC 2J5XA 4B6EA 4DB2A 2IF2A 1HE8B 2XNDA 1GO2A 4LJ4A 2O8CA 4HLUA 1YZNA 3FJOA 4PC7A 2ZYWX 1BMFD 1J90A 3SYNA 1PUIA 1FNCA 4BE7B 1VMAA 3Q85A 1VG1A 1DAMA 2JEOA 1ETUA 4HLQB 4PC3A 4YXWD 2V6JA 5FTLA 3QBTA 2AK3A 3CCRB 3HWSA 3U6KA 1BOFA 5H5JA 4KVAA 2XSZA 1Z2AA 2ZS8A 2FX3A 1AKYA 2ATXA 4I99A 2CJWB 1OXXK 221PA 1RZ3A 2AX4A 5DE3A 5FTMA 4CVNA 4OBEA 1N5JA 3QG5A 2NO0A 3VTKA 1WF3A 1J8YF 2UZ3A 3ICQB 3PUWA 3W5JA 1S1MA 2J1LA 4US0R 1QRAA 5FBWB 4Q21A 4EAQA 2DY1A 2Q3FA 4EFNA 1EFHA 1P61B 3AF1A 4I1SA 4Q1FA 1E64A 2DWQA 1BKDR 3MJRA 3IQXA 2JA1A 3MRSA 4HUQB 3H0KA 3U2QA 2J0SA 2REXB 1E2EA 2VL7A 1Q81D 3QEOA 4IOMA 4LYJA 3Q8XB 4DCVA 2QAGC 2ZITA 4I4LA 1G7CA 2RGXA 2MMGA 2OLKA 4RFSA 2GETA 3RDPA 4MGYR 2ZS9A 3J81k 2P5SA 3K0AB 3GLGA 4RFSB 4TYPA 2G0TA 4QL3A 2CRVA 1KDTA 1G3QA 1R0WA 2FZ4A 2XITA 1FRNA 1WDTA 5LB4A 2ZE7A 3K9NA 1QG0A 5CIQA 5IRCD 3VO2A 1J7KA 4AKGA 4WAUA 3I1FA 3IUYA 2O0JA 2NPIA 3EXAA 4YDHB 2ZRMA 4XD7D 2W2XA 3C16C 2AFHE 3DM5A 5ELXA 2HUPA 4Q7LA 1TVCA 1NN3A 2JIZD 1E2QA 4AG5A 3TW4A 2UZIR 4AYXA 2CK3D 2VP0A 2IA5A 4A6PA 1E2MA 4MRVA 4DSOA 4B75A 1NN1A 2ZIAA 3EIEA 1UDWA 2FE4A 3G71B 2IS2A 2IWHA 1B2RA 4EPYA 1E62A 1YJ5A 5CDFA 3MUFA 4AK9A 4XWKA 3THYB 2ATVA 2CLCX 1P5ZB 3QUSA 2GJKA 1II8B 1F3OA 1P9WA 3GJ6A 4HI0E 3WNBA 3S1AB 1XFAA 2E87A 1E2GA 4IHQA 2GDJA 4JKYA 4X8LA 5DISB 3VMFA 4JBYA 1QHSA 1SVOA 2GKSA 4BFTA 4YMVA 3W5UA 1VECA 1LNZA 2NTYC 4V0MA 3RS0A 4B76A 3ZZTA 1HT1E 4BZXA 2FPMA 3LBIA 2AFIE 2GA8A 2B8TA 3RS4A 2GJAA 1YIJB 1SXJD 4MQBA 2ZRFA 1COWA 4DDUA 2O8FB 1W0KA 1E1RD 1F60A 2AD1A 4ZCMA 2NMVA 1CQXA 1EX6A 2IYYA 3SN6A 1GAQA 1X8KA 3ZZ0A 2QP3A 1UPTA 2PLFA 1NMXA 4RD2A 2GILA 2N1BA 2R62A 2ZJOA 2O8FA 4FINA 1DDGA 4D2IA 4A15A 1RRGA 1T3LA 5K8IA 1E63A 2W83A 3L8ZA 4DIEA 4P4SA 1FNMA 1MH1A 1CKEA 3AVQA 5E4FA 5E7MA 1UKVY 4DQLA 3SE0A 2YC2C 3CRQA 2BF4A 1TMKA 4NONA 1N6PA 4IOKA 1GL7A 1W49A 2ZSEA 1E1RA 3V00A 1YQTA 3MAAC 2X2EA 4DHEA 2XZLA 3EASA 1OFUX 4F92B 3KQKA 5H8WA 2WAXA 2QORA 1IM2A 2WV9A 4HB4A 3LA6A 1KO8A 4QGAA 3U5ZB 3U3OA 4B2PA 3K70C 1GKUB 1ZYUA 2N42A 5A0FA 3SJBA 4MKFA 3BAFA 4YAFA 1F5NA 1ZM9A 4IW3B 2CEAA 1VYUA 1E99A 5THXA 3TQFA 1DO0A 4KFRA 3NHBA 4BFUA 1MOZA 3PR1A 1EP3B 4LI0A 1Q7YD 2DWPA 2G9NA 2C5LA 3LWNA 5DO9A 2FWRA 5EUQB 1AM4D 1GUAA 3A1SA 2X3UA 1VQMB 2W6JD 4C0KA 1P9RA 3WY9A 2C99A 3OZVA 3JVUA 3AF2A 3EC1A 4L4UA 5D3MA 2ZRPA 3A1TA 4CIDA 1KI1A 1NI3A 1VIYA 3PFIA 2GJ9A 3X1WA 1GNRA 1JA0A 1M7BA 3TSZA 1GL9B 3DL0A 1P2TA 4AKEA 1CJUC 1QHHA 4A8JC 3E1YE 2V55B 5KSPA 2QMOA 4PZLA 2QA4B 2ONJA 4TWZA 4X8HA 4QJ3A 1WXQA 1L4UA 1N5IA 3KJGA 4TYWA 1JALA 1CJVC 1Z6YA 1JPNA 3CD6B 4E09A 4LHVA 2ZR9A 2AWOA 3E5HA 5TXGA 5B58C 3HDTA 1ZM4A 2FU5C 2GNOA 2WBLC 3VAAA 1FW6A 4G5QA 4XVUA 1SKQA 4ZO4A 3TVDA 3F3YA 1SHKA 4DLXA 1T9HA 2OTLB 3ZD6A 1GM5A 2A3RA 4O0MA 2GPJA 4WZ6A 3RRMA 4M9QA 3TSOA 1ZU5A 3P1JA 3QXSA 4EPRA 2ZAOA 4RCYA 3W2HA 2JJ8A 4GMXA 1MABA 4GNKA 4RKEA 1OH7A 4QHYA 2H18A 2OUKA 1MO6A 3SEAA 4TMWA 5IF9A 4LUCA 2XX3A 4MYTA 3I8SA 3I92A 4KYIB 4C3ZA 3EA5A 1KK0A 1IQPA 1R0XA 4UNRA 5FOUA 5KPJA 2P67A 4EPXA 2DPXA 5L3VA 3OJXA 5L8VA 3EPJA 3PENA 4DQKA 3H1TA 1N0WA 3FE2A 1LF5A 3MWYW 3PEVA 4PSVA 3W6NA 4L16A 3GPLA 2YOGA 4JBWA 4MGIR 5CK5A 1O87A 1W4CA 1ZM3A 4R71A 5AUNB 4JMPA 4UQOA 3KUDA 3QSYA 1G6HA 1JQJC 2GZAA 2X77A 2XOKA 1FFHA 5G3YA 3TRFA 4UAJA 4BFSA 4YLGA 3OEHA 4KLZA 2H7VA 4CW7A 2OXCA 2IXEA 2ORVA 2OHFA 4PAQA 3FKSD 1U0LA 3W3AA 4ILEA 4KV9A 1CBUA 2PLRA 5FTJA 5GV8A 2BJVA 4E22A 1G7SA 4QXAA 1P2VA 1XZPA 1JJ2B 4JVLA 4OK3A 1ELOA 1D2EA 3Q7QA 2VHUA 2OG2A 2G77B 3V9PA 4B34A 5K8TA 3R9WA 4JLKA 3L8YA 1XPUA 2PL3A 4QNRA 3KQLA 3L43A 2A7QA 2UVQA 4N3NA 2XSZD 3GLHA 1Q1QA 2CL6X 2MSEB 2QAGB 3FHCB 1M74A 1VQKB 3CF2A 1XXHB 1VCMA 4TYNA 4P4TA 2ONKA 3DVLA 5G53C 2HCJB 5F2EA 2OTJB 3FMIA 3VR3A 1CNFA 3EIHA 4HAYA 1P3JA 3B60A 5EP4A 3PITA 1AA9A 1AGPA 1KJWA 3I4LA 5BXQC 5KDOA 2J46A 2XZOA 2VF8A 4EQ6A 4NL4H 3W34A 1XU4A 1VQ7B 4P32A 3U3RA 4HB3A 4D4KA 1Z3IX 5DYIA 1U90A 4GMDA 1A2BA 3TBKA 4TZ6A 5EMNA 4TL6A 1YZGA 4DJTA 5AN9A 1CJTC 2H16A 1BYUA 3O8CA 1SHZA 3VR4A 2GRJA 4JL8A 5JS8A 2A9KA 4QBFA 3LV8A 1WBDA 1XJQA 4BFZA 1WMSA 1ANKA 1TF2A 2JGNA 2VHTA 4LJ9A 4FMDF 1H8HD 2ZEJA 1UFQA 1H42A 2IUTA 3KTAA 3GEHA 1OFHA 4LGMA 2YWHA 3P4YA 2WWXA 3L82B 1W4AA 4IVRA 1CR1A 1EFCA 3VR1A 3SYLA 3VR5A 1TAGA 4FCWA 4K81B 2ZI3A 1XBTA 2QPAA 1G3IA 3AF4A 2WVJA 5CIWA 4A2PA 1CRQA 1UBGA 2EVWX 1AIPA 3WNCA 4ACAA 1FMLA 4L9SA 3FFAA 5CM9C 1ZUIA 4QM6A 1Z47A 2ZAMA 3CRW1 2VYQA 1B23P 1VCNA 2JLZA 4IVPA 4NE2A 4GFDA 4IJMA 2FJUA 1E9FA 1KAOA 1AK2A 2ZYTX 5EJEA 2BGIA 3B1WA 1AS0A 3MJHA 3ASZA 3QI2A 4G5SA 4K8OA 4LJYA 3BB1A 5KNCA 5FBQB 2QTVB 3KDSE 2ORWA 3GJ4A 1XJCA 1OB2A 3AVUA 5CITA 1VTKA 4WQMA 5G40A 5TMPA 4CGZA 3TMKA 1NSFA 2GK6A 1XEXA 1QHHB 3AH8A 1GAJA 4QJ5A 1NVUQ 2ZM5A 1E79A 3PUVA 5JS7A 4Q4AB 2OK7A 4G0NA 4OQFA 3M1IA 1L2TA 3LX8A 3BH0A 2CHVA 1QHIA 3CKLA 4P4UA 4AWXA 5HKKD 5JCZA 5BN4A 3C14C 3NTUA 4Q4LA 2ZRLA 4PXAA 2ZRBA 4AIIA 3JQQA 1AZTA 1N6KA 4QBGB 2GXQA 4DXAA 5TB5A 4GOXA 1OE0A 4IEIA 3R20A 3I3SR 3PEWA 4H1VA 1NY6A 3AF3A 1YRAA 4HAVA 5EXTA 2ZJBA 5JFGA 1FPMA 2BPOA 1YZQA 2ZU6A 3GLFA 3UXMA 4WBSA 2A5FA 4DBLC 2YV5A 1GP2A 1E9EA 2VEDA 3K9GA 3L0OA 4N0DA 3TAHA 2R6FA 4MRPA 2WKPA 2OM2A 1FMJA 4QJ4A 2F1IA 2GHIA 2CBZA 1YU9A 4WZBE 1NIJA 2V3CC 2OFWA 4PQYA 4LHYA 3AQ4A 2FSHA 3NKVA 5KO2A 2ZI6A 2RCNA 3A4MA 2IS1A 3NC1C 5FOXA 1BYIA 2RGAA 2O8BB 3CH4B 5EZ6B 4PO9A 2F9MA 3DZDA 4HEJA 1ZM2A 2D62A 4KAXA 3SDZA 3THOA 4CEJA 3A1VA 2Q9BA 1MT0A 3FMPB 3EZFA 2Z43A 1E3MA 3KJHA 4JJKA 1BQEA 3CCVB 1W48A 1ZJ6A 3HPQA 1II0A 2F3RA 4IOJA 4TMTA 1E4YA 3U60B 1KI6B 4LDJA 1UDXA 5IHPA 1QH0A 2OCYC 4RD1A 2IYVA 1YZTA 3K0EA 2JLVA 2W2TA 1G5TA 2ZREA 4FMBB 3EPLA 3AP1A 1HURA 4G5GA 2UKDA 1P60A 3KL4A 5DIFA 3LVRE 3AF0A 1KIMA 2W6IA 3B1VA 2ZRKA 2I4IA 3X1ZA 4JL5A 3UMFA 3PJRA 1M6NA 2EU8A 1KC8D 3ES9A 1T3SA 2KBEA 2QMEA 4OYHA 4M1YA 1P62B 2IL1A 5FBLB 4AKHA 3CXCB 4DLVA 4BQSA 2OK8A 1R8SA 1GAWA 2JAQA 3KJEA 1HYQA 1IN8A 2QT0A 3QF7A 3BOSA 4LZZA 4NYJR 1W7AA 2G1KA 4TMXA 2JJ1D 3JQRA 4JJZA 3AVXA 4C30A 4F4IA 1XJ0A 3IEUA 2DEUA 3ZDQA 4IVQA 1KI3A 3U44A 1KDRA 3U6BA 1GTVA 2L0XA 5F9HA 1LS1A 4FK8A 1VQ9B 2IYZA 4JVNA 3S1AA 1OT3A 1S2MA 1Y63A 2WMOB 1NDHA 1HH4A 1GILA 8OHMA 1U94A 5DHAA 4TLCA 5BWMA 1KAGA 1G3RA 3CX7A 3T34A 3LXRA 3WHKA 2ASEA 5EP3A 1QFJA 3CC2B 4E07A 2OCBA 1I2DA 2PEZA 2C95A 1TU3A 2WKRA 4EDHA 1BH2A 1R10A 2NO6A 1TQ4A 1E69A 2GJSA 1GFIA 3EWSA 4MKGA 4C0QC 5C1BA 5FOWA 4XIGS 2WIAA 4URZR 3U3JA 4D4MA 3OE7D 5AJYA 2WTUA 621PA 5JBQA 2SHKA 4YDSA 3TW8B 3LDAA 1E9AA 1VQ6B 2VPPA 1U98A 3V76A 3CC7B 3T1QA 3CBQA 2QA5A 4NP6A 421PA 1D8TA 2C9CA 2QZ4A 1FQKA 1OIXA 2XAUA 2QP4A 2FZLA 1GRQA 4PHGA 4KFSA 1J99A 2ZQ5A 4NKRA 5UKDA 2BOVA 2F1JA 3MSXA 1KSFX 2QBYA 4Y0AA 2JLWA 3MHPA 4EH1A 2IYRA 3SJCA 3QG1A 2OILA 3QVVA 2Q0HA 5J4LA 3K9LA 3AVVA 1LW7A 2GAAA 1X8JA 3QKRA 1NG9A 4P3YA 1FX0B 4MRSA 2R6DA 1FNNA 4DSUA 3BWDD 4R98A 3AKYA 5GJWC 4AD8A 2VH5R 3G6EB 4ZIRB 3FGNA 1XB2A 3ADKA 2EFDB 2ZJ8A 2BGJA 1G17A 2AXNA 2QT1A 3GLHE 3FKSA 3LLUA 4Q7MB 3TUIC 1HUQA 2FSGA 3NXSA 5DNYB 4C4PA 4KI0A 3AP2A 2B8WA 1ZW6A 4DVGA 2O52A 3OE7A 2GBLA 1Y3AA 2QTHA 1RC8A 2REOA 2VSOA 4V0NA 4AC9A 3RRZA 5EE9A 3SOPA 2RC5A 1FOEB 3CMAB 2GXUA 4CDGA 2RC6A 5FH9A 1ZUNB 3D31A 4JLMA 3CNNA 1SXJC 4MYUA 1L8QA 4EPVA 3FPAA 1KOFA 5BYKA 2OCAA 3PEYA 3B8HA 2VRWA 2RH5A 2CLDX 1GSIA 3NWJA 1IY0A 1QFYA 1NLFA 2GF0A 1W35A 3CW2A 1NLZA 1H85A 3QIAA 4BWYA 2FFQA 4MDFA 1G18A 2QBYB 3WHLA 1EESA 2RGCA 3KX2A 2BHRA 1G19A 2ZRGA 1RPZA 2EFEB 1N0VC 1US8B 1NBMD 3BE4A 3FOZA 5JI3E 1JPJA 5EQTA 4BRUA 1G21E 2JJ2A 3T5GA 2XTNA 2FG5A 3VKGA 3O8BA 2G88A 3RSOA 1M90D 1KSGA 4S35A 1G20E 1DAGA 1UBCA 1VQNB 3C7KA 5C2JB 3P27A 1XRJA 3DPUA 1HQYE 1T4GA 5BN3A 1Z0IA 5J4KA 1UEIA 1E6CA 4DLWA 4PR0A 1NJGA 2IXGA 1LY1A 4OJKA 4H9GA 4N3GA 3CLVA 2DB3A 5LD2C 4NU0A 1W36C 3GJ8A 3IIMA 1F6BA 4Y9UA 5B2ZA 2O8BA 4Q7JB 4Z51A 2ZRDA 4TTRA 2PBRA 3X1YA 4TMKA 4DLZA 3D3QA 2IYTA 3W8RA 2V1XA 2IF0A 3QPWA 3TR5A 4D25A 4GBMA 2DYKA 2Z5FA 1R5OA 1QHNA 1F2UA 1R8QA 4MRRA 2QQEA 3BBPA 2AHOA 5DI3A 2YWEA 4G5OA 2QGNA 4A92A 4JLPA 1NVVR 2A30A 2YZ2A 5AUOB 4URVR 1FRQA 2ZRNA 1EX7A 3I5XA 3EX7C 1SXJB 2C03A 5CM8B 2BDTA 2ZYVX 5HCNA 2D74A 1KKLA 1XEFA 3TUZC 3MLEA 2HEIA 2NO7A 2R6GA 1KZ7B 5FL3A 1SVLA 4DCNA 3UIEA 2OCPA 5AUQA 1EWYA 1OLOA 4W5JA 4WXRA 3BFKA 3CZQA 1JQLB 3UG7A 5SZKB 1RKBA 2ZJYA 1XEXB 2QE7A 2V6IA 3SJZA 2CCGA 3CX8A 4M1KA 4IDQA 3NEYA 3CRMA 3QXCA 3K1JA 1NKTA 3NVAA 3WP0A 4AYTA 4YC7A 4DB4A 1JXOA 1DO2A 4A0RA 1XD2B 1OGJA 4BLSA 1H8ED 3LW7A 2ZXUA 4GL2A 4Q02A 3U3MA 2VYFA 1JAIA 1RE0A 5SZHB 5LDDC 2HXYA 4FW9A 1IN6A 4Q19A 4B3CA 3UATA 1FDRA 2JLUA 1X8LA 1KI4A 1T91A 1E0KA 1II8A 2HF8A 2KJQA 3CWQA 3ZVRA 1W1WA 3GQBA 1X6VA 4DLRA 2CCJA 1Z6GA 2ZANA 3A4NA 1IY2A 1AMOA 4NCIA 2CHGA 3NBXX 4CEHB 3M0EA 3VR6A 1FNDA 3VNUA 1KI6A 2Z4RA 3A37A 1JB1A 1FX0A 2B7CA 4NCNA 4M2LA 2FFAA 1I4LD 3D7MA 1QUEA 2JDIA 2CHQA 2XB2A 1CXZA 2GEUA 2RGDA 4XSGA 5DSZA 5KU1A 4AF7A 5J4VA 1GRNA 4QM7A 1R4AA 1VG8A 1NVVQ 1DG1G 4O25A 1JNYA 1U81A 3DOFA 3B5JA 2PEYA 1F48A 1XPRA 4DCSA 2C8VA 1G5RA 2BM0A 1CJKC 1Z6XA 4L8GA 4CRWB 2B92A 3N2EA 4YALA 4PO8A 2WWIA 3L0SA 3OESA 1P7CA 2JDID 1ZP6A 1RJ9B 5EP1A 3L2OB 4BEJA 3CH5A 5KPDA 4NBSA 1SXJE 1FP7A 2PZGA 4GSYA 3FPKA 4HATA 5KUTA 5CLQA 2VP4A 3LO8A 3EZ7A 1VYTA 3QKUA 2I1QA 4LJAA 3AKCA 3OIYA 3GP8A 1Q22A 2P6NA 3OW2B 3ZBTA 2G3YA 4Q1CA 3UWKA 4ARZA 2EYQA 2ODBA 4R2IA 4O2LA 3Q72A 1E94E 2ANBA 2XJ4A 3IO5A 4PTLA 4PQFA 5GJBA 3PUZA 4OQXA 4HYYA 4J0QA 5L3QA 5JECA 2V9PA 2GZDA 2ZUDA 3DKVA 4A8JA 2J0UB 4F4CA 3U44B 1AS3A 2C98A 3KB2A 2QMUA 1U99A 1KK3A 3O8DA 3C41J 4LV8B 1GNQA 1AS2A 1MR3F 4FCTA 3K70D 1W0KD 4P6VF 4JLAA 4DDWA 3SR0A 2IX3A 4Z8YA 1DADA 1Z6AA 3LXXA 2D3WA 1UBEA 4B73A 4ZKDA 1LV7A 2F3TA 4JT4A 4U02A 2DFKB 3BH6A 1XNJA 4BPBA 3A4LA 2IHBA 2BN4A 2QDXA 1YITB 1Q3HA 2IYWA 2X19A 5EUMA 3P26A 2CL0X 3IO3A 2QY9A 4BLPA 4A2WA 1R0YA 2AN9A 5KSOA 3OFNA 3MWLA 3DDCA 4HDCA 4HSEA 5EXPA 1DEKA 5J47A 3I62A 2NIPA 2PIAA 4Q47A 4NYMQ 4CYMA 4F93B 3C4JA 4O3MA 1TUIA 1AQYA 2PT7A 1W47A 1T5IA 1TL7C 3ADDA 5FUXA 3FVQA 4RZ3A 5F3WB 1R5NA 4B3GA 3TIFA 1KGDA 4OJQA 3UPUA 1KO7A 3T15A 3RS7A 4PSKA 4RVCA 5J4HA 4C2TA 3ASYA 2XTMA 4WVFA 1P75A 3CB4A 4PHTA 1YR6A 3CCJB 2YVUA 3HR8A 3ZBUA 3AVPA 2IYUA 3CMEB 3RYTC 3SS8A 4LPSA 1TADA 1E1QA 4JLJA 2VSXA 5BW8A 3G0HA 4ZIRA 3OEED 3QPUA 3SFZA 3GLGE 2GCOA 4HE5A 1G4AE 3F8TA 3U3KA 3GJ5A 3TAUA 1IY1A 1EFTA 3MCAA 4Q48A 4LBWA 3CZPA 3TUJC 3WRXC 2MSDB 2R9VA 4AY2A 1GG2A 2J7PA 1G6OA 2BBOA 3RAPR 4DRZA 1D9XA 3VFDA 3RANA 4HZUB 1K5GA 1OXVA 2GWHA 1KYIA 1QVGB 3BC1A 3KZ1E 5KDDA 3THXA 4O2RA 5DGXA 1G3UA 1PLKA 4JKIA 2WWGA 4D4LA 1N6HA 4U7DA 4LBZA 2VO1A 2FOLA 3IILA 4LV6A 4AF6A 1S9DA 4BLQA 3CRVA 4RY2A 1NIPA 4YQFA 3QJYA 4G1BA 3THWB 2OSBA 4A8JB 2WIBA 4RD3A 2W2VA 4LSGA 1N3BA 5GVRA 4DUGA 2RKOA 5KHOC 1LF0A 1KI7A 3W5VA 1XCGB 2Q9AA 1VG9B 4DT1A 1KQSB 3B82A 4BZPA 2CNWA 4ZDIA 2VNKA 1KNQA 3BFVA 4LBYA 1E2KA 4OQNA 4LY6A 2ZJ5A 3B1XA 4I81A 5AR1A 2RGNA 3KFVA 1KMHA 5FPKA 1E2DA 2GQFA 3OEEA 4OL0A 1QBKC 4PQRA 3HPRA 1JXMA 2VA8A 3G82C 4C7OB 4OI4A 5EE1A 3WMFA 3FB4A 3QKRB 4IRUB 1II9A 2GCNA 1C4OA 3QXXA 1BJKA 1T8TA 1P6XA 2QG6A 2WJIA 4QBIA 4Q1DA 4FMCB 4CT5A 2CE7A 1NY5A 2TMKA 3OIWA 3T1OA 1M34E 1GIAA 1W4RA 1HA3A 1J70A 5E7IA 1M7HA 2ZTSA 2LCFA 1R7RA 4B2IA 3U7HB 3NDPA 1NNEA 1RYFA 1VPLA 3EAQA 1G8YA 4HUQA 4JBXA 3RABA 4A0HA 2HLDD 3W6OA 3DMDA 4EKDA 4C2UA 821PA 1WCV1 3BB4A 3KJIA 2AK2A 5KTYA 4JVMA 3I73A 5JWOA 1CLUA 2DCUA 4YAOA 3CPWB 1CR4A 3GMTA 2QRZA 2QEQA 4RZ2A 3W5IA 3AKDA 1Z29A 4ERNA 2CNWD 4MGZR 1NP6A 1BS1A 4JLDA 5FI0B 1YJNB 4PAMA 4Q7KA 4M0LA 3L0IB 4WA7A 1XMSA 3OIVA 2J0UA 3R9XA 1N0UA 1ZD1A 1Z5ZA 3ZJYA 4NTZA 2JLYA 4CEIA 4B43A 5FUWA 4Q4HB 2QN6A 1OIWA 4BFYA 4M1MA 3ZYCA 3NH6A 1AKEA 2P2LA 2FF7A 1KKMA 2ZI5A 3C5HA 4GPTA 2GXAA 3IHWA 3QE0A 5CK4A 5LPNA 3FMOB 1TQ6A 2YYZA 1KTVA 4JLOA 4WOPA 2O0KA 1FP6A 3I56B 4URXR 1LVGA 2H17A 4TSFA 721PA 2ZVPX 4IDNA 3E20A 2HYIC 2QQ0A 4Y9RA 3CUEF 2WSSA 2QAGA 4JZKA 2HT1A 1JEEA 4DCTA 1U8ZA 3GLFB 1GR1A 1OB5A 3IQWA 1JR3D 2IYQA 1Q20A 1JECA 1ESMA 5B57C 5JHHB 2GK7A 2YWFA 3WXMA 1BIFA 2BBTA 2Z6VA 2AKYA 1Z0JA 1PVOA 3ADBA 4I1UA 1SM4A 1C9KA 1IAQA 1AN0A 2B6HA 1VYVA 1EXMA 1YHNA 1GKIA 2IUSA 1T8UA 5IT5A 3CNLA 4I1VA 5IK2D 4NZYA 3QBVA 2HJVA 2VTKA 5H1YA 2WZQA 1EG7A 1Z28A 2AL7A 1NJFA 1KI9A 1Z0KA 2R44A 2AWNA 4BECA 1R0ZA 3KKNA 2DHRA 1WQ1R 1JA1A 1TQ2A 1U2RA 1COWD 2FNAA 2W58A 4OQMA 3I8XA 3M4YA 1K6MA 2W0SA 5KDLA 3NDBB 4FWIB 2P0EA 3X1DA 2DFLA 3CF0A 2ZJ2A 4NCJA 2Q3HA 5FUYA 3IDQA 4Z1MA 4ZDJA 5FPYA 1VQOB 1SGWA 1LFDB 3KXIA 2DWOA 4Q1EA 3KTAB 1IJFA 1ZMXA 1OH5A 3PCRB 1ZCBA 1ZC4A 1RRCA 2ANCA 4MGKR 1ZBDA 4B4DA 4FCVA 2ZE6A 1W46A 3K0AA 3GLGB 3UWOA 4PZYA 2IEZA 3QFCA 4Z8XA 1G3MA 2W00A 1I7PA 2ZUCA 2DERA 3GFOA 1E0JA 1ZNXA 1XDBA 1E1QD 2WWHA 1N5LA 2ODWA 2AKAB 5J4YA 1GZSA 1XEWX 3ZIAA 2RGGA 1XCPA 3FFBA 4N1AA 3RLFA 1X1RA 3GLIE 1OGIA 1NRJB 5CJPA 2QSYA 3BRWD 4D80A 4RZXA 1W2HA 1E2JA 4TLEA 2XNDD 2EYUA 4XSHA 3ND9A 3N5CA 1HY3A 1IBRA 2JATA 1NBME 1MKYA 2WMNB 2P5TB 3QNUA 4PHHA 3B9QA 1HQCA 1SVKA 5ANRB 4BEBA 2NGRA 4MUAA 4C0LA 3O47A 4NHOA 1RW4A 5JZVA 5JEEA 5JWRA 3T1TA 4CEHA 3AEZA 4LYAA 2OLJA 5CLLA 3FHOA 1U0JA 3W2IA 4A2QA 1OW3B 3F5FA 1YVDA 5DI3B 2IYXA 3TSWA 1W36D 4Q4AA 3TJZA 2HV8A 1E2HA 2OAP1 5CB6A 4N0EA 2JLXA 4HLCA 4DLTA 4GP7A 1JB9A 3CCEB 1MO5A 4M9ZA 4IDPA 5L3RA 2RHMA 1DVRA 4MKHA 1JR3A 3X2SA 4Q00A 3K0CA 2PJRA 2OT3B 1YKSA 1S8FA 2ZR0A 4MA4A 3ND8A 4TT3A 1ZC3A 4KSBA 4L5BA 5FOVA 3RNLA 4TLBA 5EXSA 1NMZA 1ZD9A 2OBNA 2J0VA 3CCQB 5JWHA 4PC2A 4LJ5A 1KJZA 1I4DD 1QZXA 4RD0A 4GRAA 2YJTD 1TU4A 2H5EA 2P6RA 2V8OA 1DAKA 2OE2A 2WSMA 2ZR7A 4ESHA 4E03A 4LJ8A 2FGJA 3PXGA 4B2LA 1MO4A 4OK5A 1N6LA 3RS3A 1XWIA 4B48A 3BB3A 1FUKA 4MUBA 2BMWA 1Z8FA 1GL6A 4HAUA 1J2JA 2F6RA 2QAJA 5JRJA 2A5YB 4QNMA 3VKHA 1DAFA 4BZQA 1Z08A 1GVNB 2KBFA 1V43A 2MMCA 3IGFA 4KFUA 1F2UB 1N6OA 2WAYA 3BIFA 2VP6A 3QQ5A 3IPXA 4TTQA 1E4VA 2W6JA 4MRNA 1S9HA 1NJID 1D2MA 3CR7A 1A2KC 3K8YA 3PVSA 3W90A 2VHCA 3IEVA 5HCIA 1DAHA 2G83A 4NYJQ 2CMKA 1FTNA 3FTQA 4PSAA 4JT2A 2CVFA 4R2HA 1U9IA 1RVDA 3MG9A 1E0SA 4IDHA 1PV4A 2PH1A 4IFEA 4V0OA 4IEEA 1XD8A 1E9SA 2FSFA 2IWRA 3AVWA 1JJVA 1LTQA 1KMHB 1TPZA 1CEEA 1TX4B 3BJIC 5F98A 4LYHA 1M8PA 4KLNA 2H92A 1W36B 5JEDA 4B71A 1XTJA 3ZVMA 2LKCA 2IBMA 2QP9X 1QVFB 1GITA 2F7SA 3V4FA 1L7VC 3H2YA 1P73A 4GI7A 5J5CA 3TLXA 1NVXQ 3W2GA 3FHTA 4BFWA 5AJWA 1ZRHA 3BFXA 3QENA 4M1WA 1S3GA 1E9CA 2GCOB 1W0JD 1XD9A 2WSSD 1VDZA 1XTRA 5GJVC 4W5HA 1UKZA 5AUPB 3B6EA 4DEYA 4F7WA 2AD5A 1QHYA 4QGHA 5KYKA 4KXFB 3OZUA 1D9ZA 1ODFA 2N46A 2BKUA 2VBCA 2X1VA 5CJ2A 4DDTA 5JJKA 3HU2A 3E2IA 4DLUA 2Q9CA 1N25A 4BRWA 4D82A 4DSTA 1UF9A 3HYRA 5CDFE 4ACBA 1XMJA 1ZU4A 3REGA 3CRRA 2BCJQ 2QI9C 4NYMR 1KK1A 1E9DA 2QU8A 3KFXA 4QC2A 5L3SB 4GDFA 2X8AA 4Q9JA 1VQLB 4PPQA 4LC0A 3VQTA 5FOSA 4EPWA 4NH0A 2BEKA 4H1UA 3KKOA 4BGDA 1UJ2A 2WPDD 2XTZA 4JVSB 3K0FA 3LLMA 2J7PD 1ZNYA 2MSCB 5FR2A 2VLIA 2PCJA 1ZVQA 2HJGA 1JAHA 3ZGXA 3QFSA 2VHJA 4C0JA 3K0FB 1AQUA 3VU9A 1A8PA 2E1RA 2ZUBA 1G7TA 2YC4C 3R9IA 1DDIA 3PG5A 1W0JA 4PPGA 3LVQE 4LCBA 1KD1D 4TTPA 3AVYA 3F0TA 1VQ8B 5EP2A 3JZAA 3R7WB 2R6HA 2Y8EA 1KK2A 1RYHA 1MRSA 5EE3A 1IXRC 2KWIA 4F91B 1QHGA 3LBHA 2ZI9A 4GT1A 2IXFA 4JSTA 4P4SB 5D3QA 1AZSC 1E2PA 1U0HC 1M1YE 3LBNA 1HT2E 3T61A 4UXIA 2QENA 1Z0FA 4PPNA 3KXLA 5A4JA 4A0FA 3KXKA 5TDHA 1JR3E 3A1WA 2F43A 4M21A 2J7KA 3SFVA 4Q66C 4C7OA 1CJMA 4GOKA 1DS6A 2LWIA 2RGNC 2HDNB 5FBRB 2QL6A 2OFOA
chains in the Genus database with same CATH superfamily
5B58T 1GA6A 5AI6A 3WJ7A 4JOBA 2ESRA 1ZCAA 2WPDA 3IQEA 4PX5A 1K9SA 4PCVA 4NENA 2ZIVB 3HN6A 4V39A 1YASA 4B7AA 1YBAA 1K9VF 4B6JA 5I9TA 3GUVA 3LD9A 1E58A 3Q7PA 2GLTA 2JLCA 4I55F 2HRQA 4LMPA 4Y2GA 2CXXA 1LSJA 2A57A 3SMVA 4DEXA 4OFWA 2H2WA 1M83A 4K86A 3FWHA 2DUJA 3LY8A 4TV9B 4L3WA 2IYLD 1ZK4A 1XG5A 3ZZUA 4EJSC 3TG2A 2XWBF 3PHCA 1YOBA 2JHGA 2QF7A 3BTVA 5SYMA 3W5DA 5EJ8A 2FPGA 1KFEB 1ZL2A 1SQ5A 3MCTA 4I8XA 1E2NA 3ZS8A 2GNAA 2UZ0A 4D3XA 3O8OA 4FFSA 1F12A 1ST2A 3PYLA 2DRIA 4I5GA 1KJJA 1LDBA 2PMWB 1N3YA 4JL6A 4JYCA 4FN5A 2AEFA 2JIDA 2LPMA 1Q1ZA 1QK4A 2CL5A 5FL7A 3ZVLA 1SA0B 2VHVA 1Y7TA 2BVNA 4EELA 1RJ9A 1V3UA 3H6KA 2DBRA 2PGJA 3RASA 3I5UA 5HQ3B 1E3IA 1Z5VA 4Z4SA 3DMGA 1ZWLA 4UBKA 3BULA 3EOAI 2CC2A 2PMKA 5GMOA 2OXTA 1QGZA 3TFQA 1WB4A 3ZV7A 4KLCA 3H65A 3ZCVA 1SVIA 4CM9D 1V1MA 1OI4A 1WXWA 5H9VA 1MO3A 2FPGB 3U09A 3L92A 3GMIA 2M6LA 4QG7A 4P33A 5AI4A 2YR0A 3K2IA 4RK4A 2I78A 1XEWY 4MWGA 4QHTA 4C0HA 1LKZA 2R751 1T9ZA 5CW1A 5HJ5A 4AQ7A 4K0KB 5BNIA 4DV4B 1K3TA 2C7RA 3P2KA 1G64A 2BZ0A 3NBAA 1U7PA 2P79A 3CNOA 1ZIYA 4P5EA 5DT2A 2JAPA 5ERGB 5JXWA 1GQ2A 1BHO1 3QXHA 4K9LA 4JLBA 4LJRA 1Y1SA 2Y77A 4ZVPA 2E4AA 2QM8A 3M81A 1KAEA 4IGEA 1EFUA 3R4VA 1SVSA 4HDOB 2E49A 3R44A 4MJ3A 2IU4A 4MUKA 4AY3A 5IF3A 2EX0A 2HXSA 4MIYA 2IPLA 3KQUA 1TF5A 3SZMA 4XGIA 3GGPA 2WT4A 1U7ZA 5CHYA 3UAZA 4ZAVA 1G20B 4GQAA 1P2SA 3QXGA 1X7HA 4JU8A 2HCBA 4U9UA 1UFRA 3GEMA 1M2NA 2Y6VA 1JSCA 3KE8A 3GA7A 3PXAA 3SHFA 5REQA 1D03A 4D92A 1OH6A 2F4VB 2IE8A 1PT7A 4WTOA 4XQ0A 5ADWA 1OTXA 2D4HA 1H93A 3CCMB 5IW8A 4D0GA 1M6VB 4OHXA 1UOOA 4FYHA 4YELA 1EFVB 1R9JA 1XZGA 3VNAA 1ZISA 1JKXA 4NZOA 3L6DA 5KYUA 4NPAA 2RBEA 4UXJA 5DXAA 1IXSB 2E9SA 1L5SA 4FHZA 1KY3A 5KSZA 1P7VA 2IEYA 1CUUA 1XTIA 2O19A 1MEEA 3AVOA 3WADA 3GJ3A 3W5SA 4I4IA 3MGBA 1TECE 5B2FA 4DPMA 1U9JA 4TSFD 3HB5X 4EFMA 4ARIA 1U8UA 3LC1O 1HK7A 2C96A 1VKJA 3K09A 1Z83A 4P0PB 2GQ0A 2PGDA 5F4MA 1Z6TA 1WA5A 2FQQA 4GRDA 2VSFA 2O8EB 2CDBA 4F4JA 2YY5A 1D6SA 2I87A 3T1VA 1Z38A 3R3JA 3PE6A 3FGZA 1E6UA 5DXFA 1DE0A 3FRIA 3WWEA 2JGMA 5JZSA 3Q9UA 4MITA 5K8LA 4K28A 4HUJA 1NOIA 1OAOA 3U61B 1D2GA 3M49A 2DJ5A 1ZNWA 1A3CA 4MO2A 3OD5A 5FKJA 3TEJA 4OHWA 5B7QA 5IZ4A 3DHYA 2BY4A 1PL7A 4C7BA 4Q9LA 4RY8A 4WXYB 4BKOA 2P77A 4JLVA 4HQ6A 2C7PA 3PJGA 3RK1A 2IKSA 3UGKA 4HE6A 2HA2A 3KB1A 1XP8A 1CIVA 4JSYA 3SBDA 3PL5A 4AULA 4Q5IA 2CE2X 4FGLA 5JDIC 3IURA 1USGA 3EZ2A 2GN2A 3V97A 3ZOKA 3D6VA 1P77A 1N5KA 4J1QA 5LXTF 3G2JA 3RWMB 1VA5A 5KYXB 1OFUA 1V1RB 2IUYA 2O5RA 3BZUA 4GPAA 3MJFA 2VDMB 3EPKA 5JJIA 5EE0A 4RD4A 1X1EA 4IMPA 1OY1A 5ALMA 4OI1A 1TO6A 4KVFA 2R96A 3LFHA 5MHTA 2POCA 4NC9A 4E4YA 3L0PA 3DAPA 3R3UA 4H3VA 4D9HA 5CHEA 4LNUB 2K4MA 4S1WA 4UM5A 1NZJA 4ZA2A 1KZ4A 2QYTA 1P72A 3QWIA 4MVJI 1RPTA 4EW1A 4DADA 4OHYA 2VZ8A 2IIQA 3ETLA 1QX4A 1LWNA 1PSZA 3IV9A 4BP9A 4FLEA 2ZW9A 2JLRA 3SSOA 5AW2A 1RAFA 2P3OA 3GRFA 2YFQA 5BQ5A 1AH2A 2IEDA 1HO3A 3BIOA 3DC2A 3P2YA 1BDHA 5AVJA 1G0OA 1O6FA 2QYHA 1ICEA 3CC8A 5IDQA 1QGDA 1VM6A 1TEXA 1HE4A 2JF0A 3DNMA 2ORIA 1EWKA 4TKZA 5J40A 3CLSD 3PJDA 3VH3A 1XCLA 5KU7A 1ADJA 3K16A 4DNPA 3VX4A 2R2AA 2FFHA 2R1VB 2O3QA 2VZ0A 2ZRHA 4RF5A 4M89A 3TL3A 5GJCA 4NYIR 1TM5E 4K6MA 2W4IA 3ZGZA 4UPVA 3AIKA 2C77A 1SU6A 1W8IA 4YASA 4WDQA 1UBRS 1K8ZB 4U7JA 2VHYA 1MB3A 4OXQA 5SZJA 1OWNA 3PRHA 1CQWA 1I2CA 3ZWCA 3DDHA 5EJ4A 1JE0A 1R6AA 1GGVA 1NR5A 4BUJA 4B4WA 1K5PA 4QGFA 1TNDA 4L95C 4U00A 5IAKA 1RAHA 3HCRA 5FI5A 5LA6F 4TVKA 4BKQA 3KKPA 1XDZA 1TE2A 2E37A 2K5UA 3T35A 5T4FA 3TGPA 2JIBA 3FCAA 3OBIA 1Q74A 5H80A 1P9OA 3I05A 4I50A 1OWOA 1FP1D 3KZNA 5E38A 3BQ9A 1OIVA 1OI2A 3PX2A 3N75A 3W1EA 4ZCIA 1SZPA 3IQIX 1OYYA 1WCIA 4MVWA 4P36A 3O4VA 3HWX1 4JC4A 3OF5A 4G9BA 1CULC 2RHDA 4J16C 4KDCA 3SZRA 2JI8A 2WOJA 1Y8RA 3AZOA 1VQ4B 4PG7A 2WNSA 4BNXA 5FBRB 1RS0A 1MOSA 5KJ6A 5LUBA 1ULAA 3K8OE 3ZD7A 3CCUB 3VRHA 1K6JA 1GYPA 1Y5IA 3TDMA 4Z4VA 1DQYA 1DAIA 1U7UA 5AI9A 3S5JA 4CEJB 4TT3D 2BP7A 2XA1A 5LZ4A 1AGXA 2GWRA 4UZUA 3RTAA 1FFYA 4LZAA 4GZLA 3TG8A 5DN6A 2J9ZB 1PNTA 2BI4A 1KH1A 1MXHA 2ZFUA 3AY6A 1NRXA 3GG9A 1KDOA 1G9XA 1PR5A 2QM7A 4WY2A 3ZHXA 1FVFA 3IAAA 1KA9H 2BE9A 1R5JA 2ZVQX 3L7YA 4Q9KA 4M9SA 3AG5A 2GZ3A 3QFRA 2HZBA 4D4JA 3WQRA 2ZIGA 3QW2A 2FPRA 4J0GA 2BH2A 1QG4A 1H2FA 4KQEA 3DLHA 2E5FA 5EZQA 3YASA 3ESBA 3GLIB 1OZFA 2FZCA 1ZH0A 1HEUA 2BR4A 1FXUA 3CIOA 5ALPA 4C4TA 4RSGA 4QXQA 2BT4A 2NNLD 2IV2X 2O9JA 2PGIA 2V4ZA 1HORA 2IPXA 3BERA 1UKEA 3QF4A 4K6CA 5TMDA 3AY3A 1Q2XA 3W2FA 4X1YA 5EVJA 3T4EA 5C7LO 3CG0A 5KOHB 1G8AA 4R4JA 1PG0A 3M6AA 1O8BA 3LCMA 4PBRA 5FAXA 3IOBA 1JKJA 2JCSA 5BMVA 3C3JA 4QYXA 1EK0A 1V16A 2PYDA 3D9QX 3OWXA 4UNSA 4DLYA 2YICA 3A2LA 2RAFA 2ZCUA 4PAGA 5K7SA 1YC2A 3E3OA 4Y3UA 5G1PA 1BXKA 2JGIA 2WSLA 1IIBA 4MAFA 3VAZA 3UV6A 2H4XA 3NHUA 3WYEA 2CKMA 3V4LA 2IODA 3NR2A 1SUFA 3DEYX 4C5CA 1DRKA 4WBNB 3R0QA 1XTPA 1JHRA 5GINE 3RC1A 3RC8A 1ZIPA 2IH4A 3WQZA 3RK4A 1ZLXA 4FJ0A 5KQSA 1F20A 4B47A 3RO7A 5AK4A 5IMBA 4RCZA 1EFPB 1S1CA 2PS9A 4MH0R 4DM7A 1JV2B 1M1NB 3D3WB 3AGPA 1HE1C 1M2VB 4M99A 5EFZA 1VFNA 2WR8A 4RJLA 2EW8A 2JK0A 4G4SP 2FTKE 1YS1X 4MYHA 1DC8A 5AVRA 2IDZA 4UTNA 3KRTA 1J0DA 1TC1A 1TD9A 1VIAA 3CPJB 3I2HA 1J22A 1SD2A 3SKBA 3EODA 3O4IA 1F8GA 1QFSA 2GUWA 3EGOA 4LK2A 3ONEA 2X6RA 5IAGA 1O58A 3RGWS 4BMNA 4ZAGA 4PYLA 2GH1A 4RXMA 3U1VA 3I2IA 4A36A 5ITZB 1ONOA 4QDJA 4G23A 1Y1KE 3H4MA 4RSRA 5LWHA 4Q15A 3WL3A 3HCDA 2B8NA 4MWTA 2I9KA 3SLDA 1QPGA 3LCJA 2QUZA 1RZRA 1QCDA 2XDWA 3RYFA 3UA4A 4TRJA 2NAPA 1U28C 3IOCA 2DSTA 1RCFA 3ZJVA 2FFBA 4NBLA 4YJGA 5I5EA 1KDVA 2XBMA 3A9RA 3PNBA 2EQBA 3BDIA 3HJRA 3SQXA 4AG6A 3DUFA 3DA8A 5KNBH 4LWZA 4MVJA 1XA3A 2VHXA 2J6BA 2OXRA 4JJEA 1O96B 2CLSA 4NG4A 4YYZA 2FWJA 3JQCA 4A73A 1C1YA 4GOMD 3S28A 4ZQFA 2SKDA 3PHBE 4EPTA 2VTBA 1N33B 2QX6A 2VP5A 3D3NA 3DPSA 1J56A 1HEIA 4BZWA 2PZEA 4RTPA 3L8DA 4JYBA 4QQNA 2I55A 2PMFA 3KXPA 1QRTA 1ZSYA 2EFCB 2XIQA 5GTDA 2D2IA 3OZBA 5BSFA 3E2MA 3NAGA 1QAOA 1KZHA 1KERA 1Q2UA 1LX6A 1TC2A 3OY2A 3PNYA 3DWEX 4YMIA 3TOXA 5AVOA 3GEPA 3WIBA 4LDQA 1KZGB 2XUZA 2Z2JA 3B1ZA 4UNPA 1KH2A 1VJ5A 3IBTA 4MQLA 4Q18A 3EC7A 2C04A 2GEVA 2OD7A 1XKLA 1ABEA 4H0CA 4C0BA 4XNFA 3TH5A 3Q5EA 2DFNA 2C5AA 4EFKA 4F3RA 5GY7A 3G5AA 3ZGNA 3GLUA 4CF7A 1VPDA 5KIAA 4W5WA 1YBVA 2PA3A 4PWYA 1TUGA 2PUEA 3AOEA 4OP1A 1HMYA 4N4AA 3ML1A 2Q3CA 3DMNA 3LJKA 4PFSA 4EKIA 3OKAA 2O8CB 3LRXA 4ZHSA 2FHPA 4JUDX 1IONA 1IOLA 1V5WA 1UAYA 4DHWA 2J30A 1C9DB 2BV3A 4WBNF 3OHMA 1LJUA 1NHGA 4W7SA 3ITKA 1UK9A 3GDGA 2GBLC 1D0IA 1G8HA 2HREA 4ZC1A 3VDRA 5C8VA 4CEIB 1OLUB 1YT5A 2RGWA 1ZNZA 3OQ1A 3SXPA 1KJ8A 1E1CB 4G2TA 1BX0A 1PL0A 3ZQ4A 3ONUA 1P1CA 3L8HA 3IKJA 1Z0AA 3LNCA 3QVSA 5ER9A 5G2OA 1HSOA 4H1WA 4BNFA 3QGMA 4ZI2A 4Y7CA 2X6XA 2J3MA 1OXTA 3THXB 2YWXA 1FNBA 1B8UA 1FA9A 3RU9A 1LCIA 5JDCA 1O03A 1ISRA 3SLNA 3CC4B 2UVPA 2R8RA 1NMSA 2YV4A 3ROEA 2Z6BD 4DDKA 3LPAA 1DU4A 3KQMA 4Z4TA 2C82A 3UAVA 2NZVG 3O8QA 4HZIA 3AF6A 4XIIA 3FDZA 4ND1A 4YDQA 4G84A 1CU1A 4G1CA 4ME6A 5FFFA 4JDPA 3RHTA 3V2IA 4EX6A 1IY8A 1GOTA 3H8WA 2V7QD 3THWA 2AYYA 3E0QA 2C9BA 3ZIAD 3LHSA 3ABIA 5DHTA 3JQFC 3STYA 1N5RA 4D3YA 3DOEA 4FBMA 3SBXA 1SFRA 1D6JA 4RS3A 3SR4A 2FWAA 3OJWA 1I3LA 2BH9A 3MJDA 3NV9A 4WUVA 1R0RE 6REQB 4KPYA 3GP5A 2O5CA 2WM8A 1WMFA 4LRUA 5KYVA 1GPH1 3GK3A 4L8YA 1L7PA 2EATA 1CIJA 2H5LA 2LKDA 4M22A 1G8GA 4L15A 4LKRA 4OHVA 4C14A 2D2FA 2P1DA 5AJHA 4G1VA 5FR1A 2ZRAA 521PA 3WDSA 3DHWC 4S12A 3A32A 4D46A 4M4SA 3J7TA 3ZE1B 2YFYA 3M3HA 1CFZA 3I32A 3Q3GE 4EGJA 2RE8A 4FEGA 4OYLA 4QECA 4ZRDA 3MS7A 4GOND 3DAYA 1G60A 2IFTA 4W9RA 3TQCA 2JLQA 3I45A 4M1TA 5HF5A 3VPGA 1SUCA 1W76A 2XNSA 3LK6A 4JNKA 4M88A 1VMIA 2ET6A 3IRVA 1M1XB 1FBNA 4ZVSA 1EWRA 3CPEA 5AJZA 1RQ7A 4W1RA 4CKBB 3H84A 3PR2B 1EDOA 3DEFA 3MFYA 4BJ3A 4IFBA 4DG8A 2OBLA 4M1SA 3A04A 3CNQS 4JITA 2G08A 1ISFA 3WO0A 4DZRA 1PQYA 1V47A 2PTGA 2D5BA 3H3XA 4MQ6A 1JVNA 1RWQA 2XXAB 4WZEA 3I83A 1ZMRA 3VKWA 1ZUHA 4F8JA 3STWA 1Y81A 3C3EA 1TTTA 2JGDB 3M9WA 3FZQA 4D8XA 5C8XA 1MNQA 3BORA 1AOXA 3VR4H 1YJ9B 5IVPA 3K15A 4OUDB 3QA3E 4DC1A 5KMGB 3WKCA 4ZZ3A 4L75A 1K8RA 4MP6A 3U7QA 2BMEA 3T3OA 1QH8A 4RGYA 3K0CC 5EWJA 2C1EA 2DBVO 5PNTA 3UKOA 2GA9A 3BGIA 4J1SA 1B0UA 4BGIA 4ZJYA 1K3FA 2IW3A 1MDFA 3GJZA 2BE7A 4NBUA 2F4NA 3FFTA 5BSYA 4B3DA 1Z06A 1MA3A 1ZD8A 3I4FA 2B7BA 4ZCLA 1QYXA 1X7WB 2JHFA 1XTVA 3FDIA 3GFQA 4NS1A 2PJZA 3N70A 5CA1A 3EXHC 1N3IA 4NOMA 5K6AA 1N2CE 4FJ2A 1JPVA 4UTZA 4DN6A 1AJEA 5IT4A 1N7IA 3D6TB 4ER3A 3OQNA 2W6OA 1HE2A 4C43A 2PCLA 4MWZA 3U9SA 2EP5A 5A5GA 5C5DA 4RY9A 5L3QB 3UH0A 3Q2OA 2ZZNA 1TA4A 4P0TA 4JQCA 1KOJA 5AVKA 1T1JA 4NATA 3TLGB 1O97D 3CCFA 1ADGA 3UK7A 1AV6A 2O8EA 5CPFA 1TB4A 3F47A 4P25A 2ZIZA 4LE0A 4LGVA 1IN5A 2QNIA 2ZYUX 2AG1A 4KHZA 4B4OA 3K70B 2C88A 3ZOZA 3SJAA 3A1CA 2E4UA 2Q2QA 3I9KA 3RS5A 4E5VA 1CIPA 3JS5A 1J9EA 2EG9A 1U4SA 4XD7A 3GCZA 3KLPX 4PGAA 1JW9B 1QYIA 2O20A 1MZVA 1T5LA 1QIMA 1M8JA 2CUTA 4RMIA 3TE6A 3SU8A 1LC3A 5JCOA 5FTNA 4JZYA 1RYNA 4C0SA 1IB0A 3M1AA 4WK0B 1FRFS 3EA0A 1HNNA 3PPXA 1KYYA 4MV9A 4KCGA 1DQNA 4GBGA 5HR5A 4N65A 4ZJUA 1Q3TA 3D8BA 3TR0A 3B3GA 4BAZA 3JWPA 8AT1A 4UM7A 3GLIA 3FN4A 4TUYB 3TQTA 1XRNA 4EYKA 4MPDA 4PC6A 1A77A 3AJDA 3L7MA 3MWJA 4E3WA 5KYNA 1TEVA 1NVGA 3MHTA 3G4SB 1NXOA 1T10A 3Q12A 3MGGA 3EGDB 4XR4A 5DMXA 4DFDA 3OWOA 3CMCO 4PXYA 4F9FA 4DDVA 1Z22A 2GEDA 3IAS1 4DC9A 4Z9AA 4G0ZA 3RGGA 4XL9A 5I9SA 3SZGA 4QTYA 3ESAA 2EL9A 1STOA 4OK6A 3AIIA 4RH1A 4C04A 2XEXA 1Y34E 3DKPA 1CE8B 3O4FA 2XXAA 2VJQA 3HCAA 1XC7A 2ZYRA 3MLBA 3NHWA 4H08A 3DH0A 4PVCA 4E7PA 2XDQB 1GUZA 3V1UA 4CQLB 5TJ9A 2E18A 4E1BA 3DTNA 5KWJA 2QPOA 5AVZA 2B21A 1GN8A 1IJEA 2OBMA 2LV8A 5G4KA 5K3AA 2EJUA 3MRVA 3COYA 4LOAA 2CD7A 2HSWA 2CL7X 4NBVA 1HYEA 3B12A 1NW7A 3QU7A 1M8FA 1PZNA 3CX6A 3ZC3A 4J16A 1J2UA 2K7ZA 2FI1A 1A8IA 5JAMA 1W52X 1FDTA 5C80A 3GRUA 1DOAA 2G28A 3RF6A 4B17A 3RARA 4ZGGA 5JCPA 2VZEA 2QTCA 4PRZA 1KO1A 5K3DA 4WGGA 1TUBB 1WQ3A 2G36A 2YHUA 1AXEA 1KMMA 1ZONA 3E8XA 4J6FA 2I66A 1EK1A 3F9RA 4ITRC 2QL9A 4Y2JA 4DIKA 1CZRA 4L4ZA 1Z63A 4FIZA 3GB9A 4UFOA 2JKYA 4FYWA 4AX8A 5KINB 4ZAZA 1RFLA 4BMCA 3LXUX 1L4EA 3NEAA 3K8ZA 4P3XA 1P5JA 3T95A 1WNFA 4D45A 2GN9A 1L4HA 3CH7A 3HBLA 3LQ4A 4OL9A 3KQNA 2KSQA 2JHPA 4ITVA 4MKZA 1BKYA 4QYTA 3NC0C 4Y2QA 1W4ZA 2VTEA 4A8HA 2X6WA 5GM1A 2QRHA 1ZKDA 1Z16A 2ON6A 4NNJA 1JHMA 3DE5X 4ZVNA 4H6VA 3DMTC 1E60A 3W1VA 4LXXA 1T2UA 1CY1A 3N1UA 4I4TA 5FA5A 1B3BA 2X23A 2OP1A 3T4XA 4BV3A 2BFBA 5ULLA 5J23A 4Y6QA 1H65A 2HSDA 2WSBA 1GGMA 3EQZA 1KRHA 3IVMA 1DINA 4KMSA 1P4HA 1YC5A 4FHGA 2OZEA 4ZANA 3U49A 5LZ5A 4ARBA 1QG2A 1JFTA 4LC9A 4UUQA 4EGSA 1HFEL 1PGQA 1Y3IA 2K6GA 4QPJC 3FYSA 2JANA 1TOAA 3CO5A 4MA0A 1RHUA 2NXJA 1FYFA 1D8AA 2A78A 1LVUA 2IHJA 3D8NA 4X1OA 5ALIA 1CUYA 3FKQA 3ZQ6A 2R60A 2VP2A 4AKIA 2R0QC 1M5UA 3GC6A 8GPBA 4Q3LA 3HU5A 2X5NA 5SY6A 1UCFA 5E1DA 4ZTBA 2P27A 4GXNA 4OKSA 1SU7A 4TQGA 1U7WA 3WMEA 4N39A 2AW5A 3PIDA 5EIXA 3E8SA 3DCNA 4LOHA 2ZWIA 4BCDA 2O50A 1MC8A 3CKMA 3OM8A 1N36B 1IJKA 1B16A 4N76A 5KNDH 4Y6PA 2QLLA 1NVFA 1XN1A 2EWWA 3QYPA 1Y5NA 5AW9A 3RYIB 2CDNA 4TL9A 1COZA 2P1ZA 3PXBA 4H7DA 3OFSA 3ONWA 4ZVUA 3WGIA 3HACA 1L1QA 1J4AA 1MA0A 1R9GA 2R7KA 3OAAD 4HYEA 4ND2A 3DXXA 4ZAXA 4OM7A 1RLIA 4KPGA 1H4SA 3DZJA 2PUVA 3SHWA 1O0BA 4ONEA 1U04A 2KHZA 2ZB7A 1RLOA 2BL4A 1MQAA 3M82A 3BGWA 2XGJA 4HEA1 4KRXA 4QSMA 1C30B 4V0ME 4DCOA 2VNHA 3G59A 1DUIA 3ZY2A 1YQXA 3HUTA 4FI3C 4E5DA 1A7AA 1S0UA 3MELA 1KAHA 1KDPA 1OTHA 4NS4A 1UM9A 3N2IA 3NBZC 2VAXA 3H6HA 1KFJB 4GHWA 4WZBA 4UREA 1RRFA 2BSAA 1IQUA 1RM3A 1CZHA 2YIDA 1R12A 4IMJB 1KQNA 4FE4A 3QPVA 5EN4A 3Q6QA 3T1HB 3G5UA 4AN1A 1N2HA 3CONA 3G2LA 5M29A 2ECPA 3B9RA 3GOHA 4CPDA 2XYPA 4HQLA 5JVDA 1UFKA 3CF6R 1NZDA 1EVLA 1ZLYA 2CFTA 2FVYA 3K9QO 2ZI4A 2DGDA 3L49A 3EQ9A 2ZLBA 4OQLA 4F3TA 2JGKA 3BGOS 3WNQA 4ABTA 4M38A 1DJPA 3WYAA 3MWDB 1J00A 1VCIA 1EX1A 4EATA 5C51B 4FD3A 4JJFA 1W9XA 4ZYZA 1JUDA 2ARKA 1KSJA 3DCIA 2P8SA 4MVJP 3DCYA 1SG0A 2H1CA 3JQBC 1FFBA 3ROQA 3KXDA 1PW5A 4U7GA 1L4NA 2B0CA 1FFEA 3SBEA 2OZLA 4CF5A 2V3WA 3F1LA 1RRMA 4U63A 3ROGA 3VHXA 4YR9A 3UK1A 1JDUA 4P92A 2J5XA 3AESB 5T4HA 4N49A 1GO2A 4MQEA 1BKSB 3CZCA 1MC1A 4D0SA 5A3JA 3FJOA 1YZNA 4PC7A 2A9OA 2ZYWX 1BMFD 4HXEB 1HL3A 2RGUA 2X0NA 2YW2A 3VPSA 4IJ5A 5LQSA 3T3MB 1YULA 3FNQA 3D3EA 3Q85A 4FEEA 4HLQB 4O59O 1FYXA 5GZ1A 2ZG6A 3UK0A 4J3NA 3L1KA 4KN8A 4MOWA 2IEGA 3TQOA 5FTLA 1BA2A 3PKJA 3SLGA 1PGJA 2OUIA 4R40A 5K8JB 4WNIA 4WL0A 1LBHA 2BDEA 4DK1A 3IV6A 4ZRMA 5EFOA 3HP7A 4BO2A 1YK1A 3KOWA 1GYQA 3HB0A 2LP4Y 1NNLA 2H63A 4V1CA 1MDBA 2QT9A 2R6JA 5EVCA 5CLHA 2SKEA 1LH0A 1Z7EA 3OLQA 1IVNA 5BN5B 3GVXA 1UD5A 3VTKA 4EITA 3JPYA 4MULA 4REMA 2J5BA 3GVJA 4GKVA 1ECBA 3OCVA 1LNSA 2OOSA 1EZZA 4O1HA 3D4OA 5DSTA 5FBWB 3JD0A 1DI0A 3RIGA 3RYIA 5AI0A 3SNKA 4CMHA 5A62A 3IDSA 1ESEA 2W8BB 5CMLA 3DKKA 4X84A 2CW5A 1UPFA 1U6JA 4J7CA 4LRTB 1BKDR 4RGVA 2FMIA 1LA2A 4TXHA 4EL5A 2J0SA 1E2EA 1TVKA 3DS8A 3QEOA 1C41A 2UDPA 1ONNA 2B35A 1MTOA 2ZITA 3KOYA 4G56A 3ZX5A 2WINI 3GXOA 4RWEA 3RIXA 1B00A 3S2ZA 4MGYR 2ZS9A 1JEQB 5CBKA 1WOPA 1SCUA 4Y1RB 2C0CA 5K0NA 3GLGA 2GK3A 1KDTA 5CB4B 1B42A 5I7UA 4LMAA 5G0SA 3V1LA 4QYMA 2ZE7A 5CTJA 3VO2A 3AI2A 3HCPA 3IUYA 4TVOA 5CX1A 2AGVA 1C0EA 1K2VN 2VXCA 1EP9A 1CLEA 3ILHA 3PVCA 3Q2IA 3IHKA 4TPKA 4UOQA 1KFKB 3NVMB 4XD7D 3EUFA 3DM5A 5EXDA 4CF4A 5ELXA 5LOVF 4G8JA 3S2GA 3TW4A 4AG5A 1BQ4A 2QR5A 2HSEA 4FGUA 3TS1A 2F3PA 1MB4A 2FSVA 1FFXB 1NC3A 4IZHA 5DTJA 5HFAA 4B75A 4M46A 1UDWA 3QPBA 1RQGA 3GXBA 4WLFA 3TJRA 2IS2A 2HPHA 3JAWA 3THYB 4XPIB 2CLCX 3GCXA 4JYMA 4EZEA 1HF3A 1F3OA 4PHCA 1JG4A 5FT9A 3GJ6A 3S1AB 3EZXA 3L4KA 4IHQA 2XCOA 2HHJA 2GDJA 4X8LA 1Z4NA 3T9EA 3EMKA 5CG2A 3T99A 3TL2A 2V6GA 4O63O 1YQWA 2NTYC 4EA8A 2R6ZA 4BZXA 3ZZTA 4RM3A 2CVOA 1NB0A 3E5NA 4Q3OA 1L5NA 1C1DB 3HZRA 4OP3A 2GJAA 3RS4A 1OFVA 3WLOA 4ZTUB 2R1TB 3KSRA 2C1ZA 3DZIA 1COWA 4DDUA 3QKIA 2O8FB 2DTXA 1UUFA 2XUGA 1W0KA 2C4UA 1E1RD 3CSUA 5ALYA 2FK8A 1SOAA 4LRSB 2RIPA 3WSWA 5I9IA 1DIGA 2XADA 2QP3A 2SBTA 3I9MA 3IP1A 2ZJOA 4RD2A 2GILA 1ZOOA 4NCAA 3FPFA 4D2IA 6PFKA 3RAFC 1UPAA 1IRIA 5C52B 1ZN7A 4TZTA 5G4KB 4R2KA 3WMXA 2HJSA 4YJDA 3ZTTA 2XHZA 2H08A 1IPFA 2NUTA 1ZK2A 2Y68A 4G63A 4PYJA 3BY1A 5E4FA 2VAPA 3TD2A 4DQLA 4GQBA 4BE9A 1Z56C 3A3YA 3HBMA 3P96A 3PCTA 5FBHA 2IH2A 5JPCA 1TMKA 2GD1O 4DR5B 4WOBA 4P26A 5J9FA 3DBHA 1QO0A 3UNXA 1FFCA 2H00A 2PX2A 4H4CA 2MYTA 1FPQA 2X4LA 2BJHA 1H2ZA 3DZHA 5E6SB 1C81A 4MUEA 5A1TA 3KQKA 1UMCA 4JR2A 1IM2A 3IODA 4OG2A 3U5ZB 1RM5A 4QGAA 3BQJA 3CZMA 1UQRA 2AZ4A 2G06A 3F5DA 3Q9NA 2PMBA 3KZKA 3N7AA 2XQJA 2GREA 4FB5A 3W4JA 4XPZA 3GVPA 4NIMA 1EUQA 2Z2IA 1C9NA 2UYOA 5DZSA 1NJ2A 5ITWA 2DUUA 2WJ4A 4IW3B 3JQFA 2YN2A 4JU9A 4KZKA 1BFKA 3BTOA 3RFXA 1WHTA 4L4YA 3GAAA 2UXBB 2QS9A 1QKKA 3U13A 3DW1X 2GFIA 2BR3A 2R84A 1A88A 1VHWA 3FNFA 2P9CA 4KFRA 4BFUA 3RF7A 1KOGA 1N57A 1HTBA 1YZHA 1I0LA 2FN3A 2NUAA 3BEDA 4U6QA 2C5LA 2RHWA 4YUAA 1GRVA 2FWRA 5J59A 2RKBA 1D2HA 5I7WA 2O3JA 3PNPA 4E12A 2X3UA 1VQMB 2D1SA 2GASA 5EERA 2D2VA 2QN3A 4CBVA 3TLAA 2XW6A 4N9QA 4RHCA 2H4ZA 4L4UA 1L5GB 1GYRA 2ZYAA 1RJEA 1KI1A 5AM1A 1KH3A 1WSBA 1LPPA 1IEWA 4G0OA 3PFIA 4IJKA 4AAYA 3RJZA 4DPLA 1SKMA 1GNRA 2J31A 3NAZA 4RTKA 4FDAA 1GL9B 2ZUSA 1EE9A 1Y89A 1P2TA 3QVGB 4UU7A 4YT5A 1OA1A 4A8JC 4MA5A 4Y6OA 4W9NA 4AKEA 4RC9A 4PBSA 3ZXUB 1R6UA 1PYOA 4QJ3A 1A96A 4TT8A 1QIEA 3BFPA 1L4UA 5EIHA 2JGFA 4HDNA 3O91A 3PWZA 1CJVC 1Z6YA 3G6KA 3CD6B 3T3GA 4JI4B 2XT0A 3UTDA 1DTWA 3PXEA 4XX0B 3ZEIA 5EXEA 5HHTA 3VO8A 3TSCA 2ERCA 3I4CA 4QAJA 3CEPB 1Z5UA 2DQYA 2WBLC 5DYWA 3S70A 2VK1A 4DOMA 5ALUA 4XVUA 1JDPA 1GXSA 2QVGA 3H9NA 1XDDA 3CUSA 3EY4A 3DD1A 1S2GA 3IXQA 4LDNA 3UC9A 4ZQGA 1GM5A 2A3RA 3PGKA 4WZ6A 1WZIA 4W8HA 3IRUA 1K06A 3EVZA 2CFIA 4MVYA 1V96A 2DQKA 2I7VA 4IIVA 1UOQA 2GEFA 2VRBA 2JIRA 3QXSA 3W3AD 3E4CA 3DFZA 1HGXA 2B4TO 3QU2A 2X0JA 2VFAA 1OH7A 4K9RA 4FM9A 1I3NA 3OM9A 3UFBA 2O2HA 2OUKA 1MO6A 1K5HA 4S1OA 4JC0A 4A8TA 4RQUA 1SHTX 2Q3JA 4MYTA 5L7YA 2OR3A 1KK0A 4XR9A 3FCXA 1LQ2A 4CIAA 1RMYA 2ONCA 3D6MA 4UBMA 1BJRE 1NBIA 4B8ZA 3BEOA 2I71A 3OJXA 3L1UA 4HDMB 5L8VA 3FPSA 3EPJA 3X44A 1KMIY 1RTKA 5DOVA 2ZSKA 4A8PA 5JD4A 2WQ7A 1LK0A 2F67A 3A0RB 3G0IA 1KBQA 1C50A 1YDMA 3W6NA 4EYSA 4HVLA 1ORVA 4L16A 4MWDA 3ROFA 3GMSA 3OOEA 3LT2A 2HRZA 4IJVA 2ZBFA 1WKBA 3HDQA 4MV3A 1QGUA 3ZWNA 4DR1B 4CKWA 4KO2S 4QULA 1QHEA 4AJJA 4L8JA 4HF7A 1DXQA 1G6HA 1JQJC 4D4LA 3GHHA 5HYVA 1QQBA 1EM8A 1VBKA 3F6PA 3FYCA 2V3VA 2VQ6A 2GNPA 2XB6A 4OIMA 1SIWA 4RIEA 1T5OA 3VPCA 3AWDA 3EOZA 4H7KA 1ZH2A 3QRWA 4C03A 3DG9A