2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
2B7CA 3QG1A 5KNDA 1XMJA 4LJ5A 4NYJR 2ZQ5A 4GSYA 2GDJA 2GNOA 2WMOB 1QZXA 1RW4A 2JAQA 2OUKA 1QHHA 4P6VF 1PUJA 3FJOA 1G20E 3MJHA 5EE0A 1D9ZA 2ZSEA 4LHZA 2FFAA 2LWIA 2JLSA 1MABA 2RGEA 1EESA 1KMHA 2ZVQX 4ASUD 4ZGNB 1E2HA 5EJEA 1SXJA 2FSHA 4RY2A 1E1RD 3IIKA 2AK3A 2FSIA 4ZPXA 3L8YA 3NH6A 3SBEA 1D9XA 1P6XA 4CVNA 1AIPA 3UPUA 3EPKA 2GESA 2VP6A 5BN3A 3CPEA 1N6LA 1B0UA 5JJLA 1RVDA 2C9OA 2PH1A 1N5IA 4E22A 4HLDA 1T9HA 3IQWA 4QJ3A 2IEZA 2F6RA 3ZZ0A 1RRGA 2FJUA 2NZJA 3R9IA 3SHWA 4DLWA 5LDDC 5E7IA 4CEJA 2C04A 2O8BB 1WRBA 4PO8A 3U44B 1J70A 3TMKA 1AQUA 4A0RA 1XXHB 4DCTA 3A1SA 3GJ3A 4ZIRA 3PQCA 3QKSA 4DQKA 5EP4A 3T5GA 5FOXA 4F7WA 1NVVQ 4RD2A 4LJAA 3EC2A 4E5UA 2ZXUA 2IYSA 4AYXA 1CTQA 2Z83A 2HMAA 3IPYA 2D2EA 1CR2A 2ZE6A 3HYTA 1U0LA 2GZAA 1JJVA 1IN4A 1HYQA 3OEEA 3K0EA 2VSOA 2DFKB 3VU9A 1LTQA 2ZRJA 4F4JA 2MSEB 3VR5A 4PC2A 2XITA 1E9EA 1NSTA 1LF0A 3CZPA 5HTKA 1DO2A 1OHHD 3THWA 5EE1A 3Q5EA 4CEIB 4DB4A 2CCKA 1AKYA 2FPLA 2VBCA 2VHJA 3UXMA 2PZEA 1F48A 3C14C 3QFRA 3GJ5A 5GV8A 4RJLA 1G16A 1P2TA 2HEIA 3Q7PA 4GNKA 4F4CA 3KXLA 1G64A 2HJGA 4L9SA 5F3WB 1HUQA 1IAQA 2ONJA 4PZYA 3SQXA 3B78A 5DIFA 2QP4A 4NYMQ 5CLQA 3B1WA 3TVDA 4YMVA 4B73A 4EQ6B 1Z6YA 4BFYA 2FNAA 1NIJA 4AI6A 1M7GA 4IFEA 4EQ6A 3RANA 2BV3A 2HCBA 4G5RA 1Q57A 1R4AA 4WZAE 1S0UA 4PPQA 5DN6A 3NEYA 2PBRA 1P5ZB 2C9CA 4I4LA 4YLGA 2GJ8A 4PANA 3AGPA 2IUTA 1JJ7A 3MD0A 2G77B 1KI9A 1U9IA 2A5YB 4TZ0A 5GJVC 4CEIA 3CPHA 1SM4A 1VDZA 4TLAA 1CS4C 4LJ9A 2NIPA 4C30A 5GJWC 3ZD6A 4ON9A 4B4DA 3CM0A 4DJTA 3D8BA 4NCJA 3SE0A 1ZNXA 3B1VA 4DCNA 1OFIA 1Q7YD 3FTQA 3B9PA 2OFOA 4JYBA 1CJTC 5D3MA 1Z6AA 3KDSE 3K0SA 3AF2A 1NVWQ 1E63A 4QBFA 1W5SA 3U44A 4OHYA 3AKDA 1O3YA 4Y7CA 4I1UA 3IPXA 3UMSA 2GAAA 4TQUS 5HCIA 4Y9UA 1Z47A 3PR1A 3G71B 4G1BA 4G5OA 5FTKA 1HA3A 1SVSA 5KSOA 1E2FA 1UJ2A 4RZUA 3LY5A 2CBZA 4RFSB 4URVR 1UF9A 2RGNA 4ABYA 2HLDA 3EAQA 4TL9A 1R6BX 1XTJA 2GETA 4DDVA 1YR7A 3K9HA 4NYIQ 4LX0A 5JHGB 2G9NA 2P6UA 1SXJB 3IKJA 5JZVA 2GK6A 2KI5A 2QU8A 2C95A 3K0CA 1ZC3A 2H16A 2VNHA 1CLUA 1N5KA 4P4UA 4QNRA 2RCNA 2VTKA 1P62B 3GEHA 1ZAKA 1ODFA 2CHVA 2KE5A 3GJ4A 4NBSA 1NF3A 1UEJA 1OF1A 3F0TA 4CYMA 4L4UA 2OG2A 4NCNA 1GTVA 1QG2A 3UMRA 5KPJA 3G0HA 2DERA 5AJWA 3PENA 1IXSB 4IOKA 5G3ZA 4JJZA 2BBOA 5J4HA 3WNBA 3OIVA 3W2HA 1EG7A 3FFBA 1Q20A 3CCRB 3OF5A 2WWGA 2ZSBA 2ZJ5A 1E9RA 4TTRA 1XF9A 1ZBDA 1SVWA 1Z06A 3CD6B 3GJ0A 1R8QA 1VMAA 4LHVA 3DHWC 3WMFA 2R6AA 1T3LA 4OI1A 1IXRC 2PT5A 1NLYA 3K53A 1M34E 1FUUA 1CNEA 1W0KA 1R0YA 3QKUA 4C0KA 5KYKA 1J8YF 5KO2A 1SKQA 2QY9A 3A36A 3OAAA 2RC6A 2W2XA 1E62A 1VTKA 2WJJA 1IN6A 1XXHE 1ETUA 3GD7A 3LNCA 4L9WA 1E4YA 4DIEA 1Z0DA 2QRZA 1XWIA 3X1YA 2FPMA 4A6XA 4PPNA 3GP8A 5GJBA 2IYVA 2P3SA 3Q8XB 1S4QA 2RKOA 1FRNA 4M53A 4B44A 1IHUA 2ZANA 4KV9A 4PHFA 3TUJC 5CDFE 3KQUA 1MO3A 3QXSA 3QPWA 5CB8A 4Z1MA 2FMXA 3QI2A 4V0LA 4EPVA 2OK7A 1YI2B 2WWFA 1TL7C 1NP6A 1U81A 1SQ5A 2NO1A 4A0GA 1RC8A 1WB9A 2X2FA 2IXEA 5D3MB 3RC3A 4OI0A 2ZRIA 4AD8A 4WQMA 1FZQA 3P26A 5BN4A 1YRBA 2ZR0A 3LBHA 4X8HA 2CCJA 3CLVA 4OI2A 1W2HA 3CMAB 1HEIA 1WBDA 4IEEA 2B92A 4K46A 4OBEA 4PAOA 2IWHA 3CCLB 1CP2A 2VP4A 5DNYB 5DISB 2W2VA 1E94E 3HYRA 1CRPA 1TUIA 4YAUA 1K73D 4BLOA 5CM9C 4FXPA 4AG6A 4J0QA 2OCPA 2IXFA 2ZRKA 4ARZB 4OQFA 3J81k 1I4LD 1Q3HA 2ZETA 5GJCA 4DDUA 2D74A 4NYMR 4V0MA 1UEIA 3OEHA 3TQFA 3ICQB 3ND9A 5KHOC 4A15A 4QOSA 4JLVA 1QF9A 2QGNA 1BIFA 2BGJA 3KUCA 4EUNA 3GJ8A 4DKXA 2GA8A 1QBKC 5H8WA 2DEUA 3CRMA 2NOAA 5JRZA 4FMCB 5FR1A 4ASUA 4Z1MD 4A2WA 4ZI3A 1KI4A 4C0JA 1P2SA 4TL8A 5B30A 2NGRA 4MRVA 4PZLA 1Z63A 1RIFA 2H57A 3NEJA 1I2DA 1AK2A 2GZHA 4Q4HA 1DG3A 1E79A 1Y3AA 3PUWA 1D2MA 3PITA 1OGJA 1OXTA 3TLXA 3EIHA 1P7CA 1OXVA 2IUSA 2JIZD 1SVMA 1Q22A 2X19A 1E9SA 3IGFA 2XNDD 4M1TA 1E9FA 1E9AA 3FOZA 1G7SA 2Z4SA 3IIMA 3QXHA 2GVZC 2VF8A 3RAPR 2W6IA 4R2HA 5FH9A 3U4QA 1E0SA 2J7PD 4UKDA 3GLIE 3U60B 2O8DB 4Q48A 2N1BA 5FFMA 4ACAA 4YHBA 3RWMB 4QGAA 3KQHA 4XSHA 4TSFD 2NO7A 1II8B 1P73A 4ZIRB 2V6JA 4TMVA 4K8OA 2KBEA 3CF6R 3T35A 2ZI4A 1WMSA 2CHQA 4B2IA 1NMYA 2ZSAA 5ELXA 3REGA 5CB6A 1W47A 5FUYA 4BLRA 1QHSA 4CZ2A 2F9MA 3BBPA 5L3RA 4MKHA 2AFHE 3VR4A 3QNUA 1FX0B 4AY2A 1D2EA 2A9KA 5JSZA 2QNRA 2JLWA 4BQSA 4RZ3A 1EGAA 1TF5A 4Z8XA 2ZRDA 4I81A 3KUDA 4CW7A 1NJFA 1GOTA 3GMTA 3P4YA 4OYHA 3W3AA 1YJ9B 4JIMA 3E5HA 1E9CA 2GCNA 4JJKA 5HE8A 3TUZC 3OE7D 3AVXA 2IWRA 4FW9A 2O8EA 3MWLA 5EQTA 4LV6A 1C1YA 1QHHB 1HE1C 2GBLA 4TN1A 3NBXX 2VNJA 1VPLA 2GCPA 2PX3A 1IM2A 4C0AC 4JL6A 1SKYE 4URYR 2Q3HA 4BPRA 4IVQA 4FWTA 4WZBE 4MYCA 1EFTA 4W7SA 1OH8A 3LW7A 3G82C 1ZCAA 4WW0A 4C7OB 2CCGA 1KO5A 3FHCB 2PMDA 1EP3B 1KAGA 1QHIA 5HZKA 3UG7A 5DSZA 1J8MF 1T4GA 1KAOA 1P9WA 1NN0A 1E3MA 2HXSA 4JLKA 1NVXQ 3CNNA 2V4ZA 5CYPA 2REXB 5H70A 4Q4AB 1NN3A 4HAYA 2ZJAA 2WSSD 3MG9A 3PCRB 4BPBA 3CX6A 5BQ5A 2ZU6A 2PCLA 1OXSC 5FL7D 3REFA 1QVRA 2NQ2C 3L0IB 3CCVB 4JLBA 1AQYA 2GRJA 2FFQA 1D5CA 2PIAA 3W2FA 3CH4B 1CXZA 4MKIA 5AJZA 1YRAA 2JLUA 1YVDA 4IDNA 1KK0A 1J2JA 3BS4A 4N0DA 1GITA 2B6HA 3LV8A 1VHLA 2CLCX 4F38A 2VP5A 4NKRA 1N0VC 1NBME 1F2TA 2QM8A 3Q72A 2WOJA 3AH8A 4O2RA 2AR7A 3RS5A 4A8JB 2CLDX 1U99A 2EQBA 3KFVA 4RVCA 3WRXC 4CEJB 3ASZA 4EPXA 2CNWD 4JLMA 1OGIA 3EIEA 3HR8A 2G1JA 1UM8A 1ZUIA 4A36A 1NLZA 2OSBA 2F3TA 3NWJA 1U2RA 4HATA 4HLUA 3C16C 4EIWA 1GO2A 4C43A 4PAQA 3N70A 5KNCA 3AUYA 4YMTA 2VP0A 3IDQA 4ZI2A 1R0WA 4XWKA 2H5EA 4KVAA 1D1NA 3U3RA 5JS7A 2ZI6A 2YC4C 1PUIA 2J5XA 2WSMA 4CGZA 1M8PA 4IHQA 2EIXA 4PPGA 2O8CB 1II0A 1RYFA 1NJGA 4AIIA 2VP9A 4IXNA 1N6KA 2WWWA 4Q47A 2WM9B 2E87A 3LLMA 2QA5A 1OLOA 4N3NA 3SQWA 1FQJA 1T8TA 2HYIC 1H65A 1L8QA 3RRNA 2Q6TA 1KIMA 2H7VA 2O0KA 2PMKA 2A78A 1O87A 4B33A 4ZDJA 1MO4A 1QHYA 4M22A 4TMXA 2C96A 4XD7D 3B7GA 3SZRA 1CJUC 2FGKA 3LW8A 3UWOA 3GLFE 1G17A 2OM2A 2D3WA 4JBWA 1LNZA 4QBHA 2ERYA 4LJ8A 2OXRA 3W2GA 3Q9LA 4D6PA 3CPWB 2QT1A 3IHLA 4IW3B 3QENA 2FG5A 3EA0A 3I92A 5B64A 3V00A 1G19A 2JJ1D 2KJQA 4QL3A 1I4DD 4W5JA 2CL0X 1YIJB 4QG7A 3MRSA 4UJ3A 4UNQA 3CC4B 2F1JA 4TZ6A 1US8B 2K5UA 3UWKA 3BH6A 4EFLA 4TT3A 3AVYA 1TVCA 1XD2B 3OEED 4JYCA 1T8UA 3TSOA 3PVSA 3HJNA 2HF9A 2ZRLA 2JJ2A 1NDHA 2YWHA 1BO6A 3PXGA 4G5SA 1ZNWA 4PZZA 3ONWA 1OHHA 1E2NA 1L7VC 4P4SB 4F93B 2FWRA 3K1JA 1XB2A 1EX7A 3VX3A 2B5OA 4B43A 2ORWA 5C4GB 3QF4B 5SZHB 1Z0KA 2JLQA 3PIRA 3WHLA 2O0HA 4RD6A 2VSFA 3K70C 4X8MA 1AGPA 3LDAA 5LBIA 2QAGB 4QFMA 3N2IA 1OH7A 4M1WA 1DTSA 2BN4A 2F1HA 4DIDA 3AB3A 4B3GA 1AZSC 2QTLA 1HV8A 2NPIA 3VKWA 2REOA 1XPRA 4RKEA 3BFXA 3VAAA 3QQ5A 4EAQA 1Z08A 2WZQA 3QOFA 3SJBA 2OEPA 4A4DA 4JVLA 4PHGA 3GLGE 3QVVA 1W0JD 3BD9A 3D7MA 5HE9A 2R6DA 1DDIA 1COWA 1QVAA 4KODA 3THXA 4RD1A 1QX4A 2OLKA 2D7DA 3AF3A 4FMCF 4G5GA 2OBLA 3NC0C 3EG5A 4Q9JA 4WAUA 3T34A 2DBYA 2EFEB 2IYUA 2ZYWX 4B3DA 2P5SA 1EWYA 2CVFA 2W83A 3TGPA 2VP2A 1SVLA 4Q9HA 3GJ6A 5EE5B 5CDFA 2G0TA 1QG0A 3K9NA 4Q21A 2QA4B 1Q1EA 1JI0A 5GVRA 4RSGA 3RDPA 2DFTA 3DKPA 4HE6A 2J1LA 4G0NA 4TSFA 3OZWA 5IK2D 4XVUA 2NMVA 2V7QD 2QROA 1DS6A 1FFHA 4IDHA 4P33A 2ZYTX 5HKKD 1V5WA 4RCYA 3X1XA 1QHGA 2IYTA 3IQXA 3KB2A 2N42A 2PZFA 2O52A 3NKVA 4KCGA 4M21A 4PQFA 4TQAA 4LCBA 1SVKA 2J0VA 2B21A 3GFPA 1VHTA 5KUTA 2QUZA 2IS6A 4LHWA 4B76A 5JI3E 4D26A 1ZM2A 2OAQ1 1W0KD 2GWHA 1ZM3A 2DFNA 2QSYA 5BWMA 1A2KC 1IN8A 1G8YA 1OFTA 1G7RA 2OE2A 1G3IA 3HU1A 3W34A 4ZV4A 4BFSA 5FUVA 4UNRA 3IIJA 3SU8A 4KITB 1G4AE 4PXAA 3THYB 2G83A 3ADDA 3W90A 1KTVA 1OJLA 2VF7A 4GMDA 4I1VA 4M1OA 4TL7A 4D0NA 3MJRA 3KQLA 2WWXA 1PZNA 1MO6A 3IO3A 4LYJA 2J46A 3A8TA 3QFSA 1HH4A 2GEDA 1N6PA 4F91B 2GK7A 1BYIA 4GPTA 1L4UA 2DETA 2QTVB 4Q7JB 2XSZA 3UMFA 1VG0B 4KLZA 4XIGS 1KGDA 4LSGA 4OQXA 2QBYA 3VKGA 1GNRA 1OW3B 1YR8A 4NP6A 5C46F 5LB2A 1NJID 4IDOA 2ATXA 1WF3A 1KO1A 4M4SA 3ZC3A 1UFQA 1FNCA 1IB0A 2Q0HA 1D6JA 1KRHA 1X8KA 1ZW6A 1RYHA 2YOFA 1W7AA 4EJSC 1YJ5A 3W8RA 2BCGY 2WIAA 2CE2X 621PA 3O8BA 4P32A 4DLRA 1DELA 3U61B 3AP2A 2J45A 3B13B 3IEVA 3ZDQA 3RS2A 1NBMA 1NNEA 3I8XA 5K8UA 4P4TA 4DLUA 3GCGA 2CHGA 4EFNA 4DUGA 1VCIA 3QBTA 3O8RA 4PO9A 2MSDB 5FOWA 3CF0A 2CEAA 1XNJA 3PV0A 1XFAA 2WPDA 4WA7A 4DT1A 2J0UB 1XTQA 3CNLA 2Z6VA 5IDVA 4QKQA 4OJQA 1E1QA 4FK8A 2OCBA 1W44A 2ZI9A 3I5YA 3NDPA 1JECA 2ZUBA 4UQOA 3AEZA 3VX4A 3OZUA 4BRWA 4C2TA 4QHTA 2IK8A 4URWR 3SJCA 2ZRBA 4JBYA 5EE9A 5EE3A 1IXZA 5CK5A 4AURA 1KY3A 1AM4D 2WJHA 1N5JA 2ZSFA 2ZYVX 1EP1B 2ZE7A 3FFAA 1E1RA 3OIWA 1ESNA 2OBMA 4Q4JA 3EZ9A 2EW1A 3U7EB 2ZR7A 2WOOA 5EUQB 1S3SA 3FPKA 1EP2B 1F5NA 2W0MA 2N46A 1SZPA 2NO6A 2G88A 1XJ0A 1RZ3A 2UVQA 3QXCA 4TLCA 4TMTA 2V8OA 1N6OA 3DZDA 3KL4A 2BOVA 5DHAA 3RLFA 4QGGA 1S8FA 1CRQA 3S1AA 1E2JA 3KKMA 1XMSA 1DAFA 1Z6XA 2CK3A 4HB3A 1DG1G 1ZCBA 2XOKD 5J4VA 3NH9A 4IVRA 4KBFA 4LJ6A 4DBLC 2JCSA 4GMXA 4JLDA 4QM6A 5FBWB 1H85A 4DQLA 3W3ZB 1XJQA 1DO0A 2QZ4A 3QKRB 4RKFA 1FMJA 3WP0A 1KDTA 4Q7LA 5F9FA 2ZUCA 4M1KA 1Z3IX 5KTYA 3L8ZA 3PUXA 3WYFA 4FN5A 2YNMA 4MKGA 1KYIA 3EPHA 4DB2A 2A5DA 4U00A 4HZIA 2IEYA 4Q66C 3PG5A 5FPYA 4GL2A 2PLRA 3NVAA 1NY5A 3CCSB 1NN5A 4ZCLA 1TNDA 4C4PA 3T5DA 4RD3A 1TAGA 3TUIC 2QBYB 2OESA 1EFRA 3PUZA 3ZVLA 3RVBA 3CUEF 5SZIA 3F8TA 1GILA 2Y8EA 2GXAA 4E09A 2HLDD 3LVQE 1A1VA 2GCOB 3B5JA 3GLGA 3QFTA 2BM0A 2HT6A 1R5OA 1Q44A 2JJ2D 1YJWB 1GJRA 4ZDIA 1EXMA 4LC0A 3DDCA 3QKTA 4JL5A 4R98A 3RYTC 2ONKA 3RS0A 3LWNA 2R6FA 4LZZA 2FOLA 2XJ9A 4Q00A 4Q1DA 1TU4A 2HXYA 4G3XA 1ZINA 4A92A 1GNPA 2QEQA 3ZH9B 2ZITA 2B8WA 1G6OA 4URZR 2ATVA 1QFJA 1I4TD 4PQYA 3RSOA 2FV8A 3SFVA 4LJYA 1Z22A 3FKSD 1FP6A 4H1UA 2WJGA 3WRYC 3TNFA 3CCQB 3TE6A 1XCMA 3CRRA 1ZJ6A 1D2NA 2R6CA 4MRNA 5EXTA 4JZKA 3C7KA 4JVNA 3R7WB 3L82B 4TMZA 3CNOA 1JBKA 3ZIAA 4JLOA 1HURA 3C8UA 4QRHA 4B3CA 3TQCA 2AFIE 3FWYA 1E98A 3ZQJA 5G41A 5CITA 2QDXA 3KX2A 3DKVA 2R6HA 2AKYA 1XJCA 4MUBA 3B1YA 1KK1A 3VR3A 3AUXA 4DEXA 4MDEA 1TTTA 4ZDKA 3DPUA 3P20A 2J7PA 1FNDA 3I56B 4OQLA 4B35A 3HU3A 3NIBA 3NBZC 1W34A 1Q86D 3QPUA 2IS4A 1KJYA 1UKYA 1DAGA 1QUEA 4KJZA 4D81A 3BOSA 5CJ2A 3Q85A 3QUSA 4W9MC 1XE1A 4B75A 5JWRA 2QI9C 4II7A 3EWAA 4OK5A 1IOZA 1BKDR 4BEJA 2IYLD 1KC8D 2X77A 3CC7B 3W5IA 5L3QB 1W48A 5FR2A 3NHAA 3B6EA 3QEJA 5G3YA 1E1QD 4EPYA 3DM5A 3DM9B 1F6BA 5AUQA 1FX0A 2AX4A 2PT7A 5D3QA 4L5BA 3BFKA 4BLTA 3TIFA 5JFGA 1CJKC 4XOIA 4TWZA 3P32A 2I1VB 4CT4B 3E1SA 1BX1A 2CXXA 3EZ7A 4QXAA 3A4MA 1J90A 1G5RA 3WXMA 2Z5FA 3LBNA 3OE7A 1CNFA 2GJ9A 2WAXA 1XEWY 4LPSA 4NCKA 2QG6A 1YJNB 1KK3A 1VQ4B 1GVHA 3X1DA 3SHFA 5AJVB 1YHQB 1VG9B 2ANCA 1YQTA 1WXQA 3IBYA 1ZNYA 2H1LA 2R6GA 5TB5A 1XD2A 1IN7A 3V4RA 2XAUA 1R7RA 3WMEA 3MFYA 1IJEA 4R71A 3O8DA 2WBLC 4JL8A 4HB0A 4CIDA 3DO6A 1XD8A 5DI9A 1Z0JA 3CRZA 1FNNA 2RB4A 4EJSA 1SHKA 4BASA 1UBFA 4MYUA 4CDGA 2C03A 4TYQA 1GZSA 3EZ2A 3DZ8A 2QPTA 3FHOA 4HAXA 3CIOA 3CMEB 2GEVA 1LVGA 4B34A 1UDXA 2QL6A 3QIAA 4WXPA 1GRQA 2WKPA 1SULA 4FMBB 4ESVA 3PJRA 1ZNZA 3UIEA 2ODNA 3LH5A 2VL7A 4JVMA 1AMOA 4C7OA 2BMJA 4W5HA 3B82A 1TQDA 2OK8A 3BAFA 4PHTA 1Q81D 3RRZA 2C5LA 1VYUA 4MQBA 3CONA 5FTJA 2ZRHA 2F1RA 3THXB 1M1KD 2AKAB 3VNUA 1Z6TA 1K8AD 3CB4A 1GRRA 1JXOA 2PL3A 2VLIA 4NCHA 2O8EB 2O8CA 2ERXA 3F3YA 2YINC 4LRWA 3GEEA 4OK3A 2R2AA 4M1SA 5EP2A 3V76A 1Q21A 4PPFA 2V55B 1AZTA 1GVNB 1GG2A 5B58C 1X8JA 4B3XA 2C9YA 1JB1A 3QEOA 3WYGA 5C1BA 1S72B 4MH0R 1XMVA 4K1XA 3RSLA 721PA 4E07A 1ZM9A 3R9XA 4M1YA 1MOZA 4HZUB 1I7PA 1M6NA 2J0QA 2A5GA 2CLSA 1T91A 3OZXA 5AK0A 2ORIA 4RCZA 3IILA 2ZRPA 4JLAA 3NTUA 4A8JA 5IF9A 4KBGA 1F2TB 2C8VA 4PFSA 4OHZA 2DWQA 5KOYA 1KOFA 1YKSA 4NZYA 2W2TA 5TMPA 1NBMD 1KD1D 4TLDA 3CH5A 4A6PA 1F2UB 4FD2A 2PZGA 4G1UC 4D0GA 3X1ZA 3R8FA 3MSXA 1JA0A 2CJWA 1MRSA 1QVGB 3CKLA 3LA6A 1DPFA 3GLFB 2WWYA 1R10A 1NSFA 2VIIA 4DZZA 3BE4A 1YHNA 1G4UR 2IYZA 2ZE8A 1MO5A 3EC1A 3HWSA 3KB1A 4Y0AA 1XZQA 2A3RA 4U02A 1G8FA 2FEMA 3HP1A 1Z5ZA 1N3BA 1ZM7A 1XP8A 2BEJA 3NBYC 1NRJB 1YZKA 2V7QA 4DLTA 3K70B 4Q4HB 4M9QA 1AS3A 1G1MA 1W4AA 1MH1A 2IXGA 2JDID 1QGYA 1OIXA 3IBGA 4QBGB 1W4BA 2DHRA 4GT1A 4Q03A 2JLZA 1NIPA 1AGRA 2KSQA 4U7DA 3SDZA 4KSCA 5JBQA 3BWDD 4B71A 1PVOA 3LRPA 4HUQA 2RHMA 4JMPA 4TYYA 3BB3A 5EUMA 1ZU5A 2CVHA 2GVDC 1HQYE 5TVKA 2RGGA 1QFZA 5AJYA 1GL6A 1U8ZA 4B74A 4GRAA 3I61A 1FP7A 1E2MA 1V43A 1WDTA 3B9QA 5JJKA 4PX9A 4UJ5A 3NXSA 4JT2A 2FDCA 1JXMA 1DOAA 4ARZA 1ZM4A 3A1WA 2PCJA 1W36D 3WY9A 3E20A 1BX0A 2GILA 1PJRA 4PTLA 5JSZB 1GL9B 2OFWA 1NVVR 4DC9A 2JEOA 2FGJA 3ES9A 1K5DA 1KI1A 1S1CA 1JALA 4LPKA 1FUKA 4RFSA 3U7FB 2XSZD 5EP3A 2C78A 2O0JA 3B60A 5DE3A 4XVRA 4L8GA 2QPAA 2BBSA 3L43A 3VFDA 4MYTA 2HDNB 3KJGA 4BLSA 3A6PC 1UMKA 3U6BA 2MSCB 4ZO4A 2VYQA 2UKDA 1DAKA 4A0HA 1E6CA 2YWGA 2ZRCA 4HUTA 2F55A 2QN6A 1G21E 1Q1ZA 2OBNA 3VR2A 1W49A 2F1IA 2NO9A 3TAHA 1JNYA 1PLKA 5DYIA 3VMFA 1P9NA 2R44A 4BFTA 1ZYUA 4Q02A 1E99A 2P2LA 1X86B 1E64A 2V6IA 1JEEA 2VHCA 5E4FA 5JI2E 1SXJE 3D6TB 1KI2A 3PUVA 4FCWA 4BWYA 4XWOA 1U0HC 3LO5A 3OIUA 2IC5A 1BYUA 5TY0A 2QQEA 4BLQA 1QUFA 1DAHA 4PSKA 1B23P 1QVFB 4MGZR 2BCJQ 3ZS8A 2XX3A 4Q7MB 3L0PA 5DO9A 4C2UA 2R65A 3W6OA 2BGIA 1N6NA 2XTNA 5K8LA 3X2SA 3CXCB 3A1VA 2BJVA 1OKKA 2IYQA 3I4LA 4MRRA 1A8PA 4OKSA 1OV4A 3QF7A 4FCTA 1GR1A 4Q18A 3QXXA 4BEBA 3BFVA 4LI0A 4C0BA 1TPZA 4M9ZA 3ND8A 1MT0A 5AUOB 2QRNA 3MCAA 2IYRA 2ZI5A 1E79D 4URXR 1XTRA 5JCZA 4US1R 4FINA 4V02A 2IT1A 2FEOA 2VNIA 3R8CA 3AVOA 4XTCS 1U0JA 3ZLJA 2V3CC 421PA 1R5NA 3TR5A 2VYFA 1OE0A 4A2QA 3BIFA 1RJ9B 4O2LA 3T1VA 5JMTA 3OIYA 1VQ9B 5AR1A 4TYNA 221PA 2IF2A 3HR7A 1XEXA 3EZFA 4BZXA 5JEEA 2YYZA 5FPSA 1TU3A 2QE7A 2VNKA 1QGZA 3TR0A 5FTLA 1DVRA 1GAWA 2XNCA 5J4YA 3I5XA 2VQSA 3IO5A 2ZREA 3VR1A 4XH9B 3R9WA 1ZD8A 1N5LA 2PEYA 2RGXA 4LBVA 1E2PA 5E7MA 3E70C 3WHKA 4DSOA 2BM1A 3FKSA 4P3YA 1FTNA 4ESHA 4UNPA 2D2FA 1S96A 1LFDB 2ZIAA 1XZPA 3WBKA 1FOEB 2MMCA 3W5UA 1TLLA 2QPOA 4GI7A 3QKSB 3JVUA 3ICEA 1K9MD 2Q3MA 1ZRHA 1XXHA 1T5IA 2YV5A 1LY1A 4AF6A 4TMWA 1IQPA 2ZJOA 5H68A 5BYJA 1E9DA 3JQPA 1JA1A 2WVJA 1Q0UA 3A58B 1TQ6A 2DY1A 3U3MA 4B32A 2X1VA 1CJVC 3WNCA 3A4LA 3M4YA 1I2MA 2DFLA 3IHWA 1LF5A 1S3GA 3SS8A 4EDHA 1G5TA 1F20A 3KZ1E 1XEWX 5G40A 5JCPA 3ZZUA 2UZ3A 1OT3A 2QT0A 3KTAA 4BZPA 3H2YA 1UPTA 3GQBA 2ZSDA 5M04A 4OQMA 4NH0A 3W8NA 1KSJA 4A1FA 1TF2A 2ZM5A 4C9BA 2YZ2A 1W2BB 1XEXB 1KZGB 4BFVA 5J4KA 4OQNA 3ZGXA 5FTMA 4A2PA 1ZIPA 3EZ6A 2RGCA 4QC2A 2J9RA 2C2HA 4GZMA 5BYKA 2REBA 2WAYA 4C0QC 4CT5A 4WIAA 4D2IA 4PHHA 4CRWB 1KSHA 4HUQB 2HUPA 3N2EA 4HAZA 4LGMA 4GP7A 1P61B 2ZRGA 3AVWA 4AKIA 1CULC 2AXPA 2QMHA 3LQQA 3TKLA 2UZIR 1R2QA 1FTSA 1P4SA 3EXAA 4LYHA 3LLUA 2NO0A 4PR0A 4HE5A 4AC9A 4C3ZA 2FH5B 3TJZA 5KU1A 3B8HA 3EW9A 1RPZA 2FFBA 3SYNA 4GOXA 1ZD9A 4HEJA 3U6KA 2ECKA 4H1VA 3RRYA 1H8EA 1WCV1 2GBLC 2Q9BA 3KTAB 4AWXA 3NC1C 4D0LB 2AWOA 5FA6A 2HF8A 3RABA 2WTUA 5C4MA 4MGIR 4S2EA 4DXAA 4NL4H 3U7HB 3ZS9A 1ZD1A 1M1YE 2VH5R 1GAJA 1OFHA 3GLFA 4O3MA 2BMWA 4Q5IA 4D4MA 1FL9A 3WP1B 4US2R 4M9XA 1BJKA 2P6NA 4G01B 4HAWA 3JQRA 4ILEA 4LWZA 1GUAA 1LS6A 2DWPA 2QAGC 2XTMA 3MGCA 1G291 2L0XA 5FBQB 1KZ7B 1KI7A 4JSTA 3CW2A 1JR3A 1KKLA 1TADA 1DEKA 3F5FA 4P31A 1XDBA 5KDOA 2O8BA 2A5FA 5ANRB 3TBKA 3AV0B 5TR9A 4IKEA 2ZJZA 2RGDA 4V0KA 1CR1A 3CR8A 1E2LA 2ODWA 4O0MA 2XXAA 1TUEA 4JBXA 5FI0B 4HAUA 4LBYA 1CBUA 3TH5A 1EWQA 3BORA 2JDIA 2FX3A 1N25A 2EYQA 5IT5A 1G6HA 2WPDD 2ZS9A 2ZS8A 1WE2A 1KHTA 4EH1A 2GKSA 3PEYA 1T5LA 3ASYA 3BXZA 2LKDA 2X8AA 2OLJA 4NCIA 2VHUA 2V1XA 1YE8A 2QSZA 4KFTA 4MA4A 5KDLA 5J47A 4US0R 3MMPA 4JLPA 3UATA 1RJ9A 2WICA 3K9GA 1IY2A 3H86A 3OFNA 3QFCA 1E32A 3I72A 3B85A 4Q1CA 1DDGA 3C5CA 4W5WA 3UK6A 1JJ2B 4WZ6A 2Z0MA 5DHFA 5FOVA 3GFOA 5KSPA 4Q1BA 4M8NE 1VQ6B 4YMUA 2PJZA 1S1MA 4PGOA 3GEIA 2HV8A 3GJXC 2DWOA 1YZTA 4KYIB 4DLVA 1M7BA 3I73A 2V54A 3VQTA 5AJXA 8OHMA 4MUAA 4YAFA 2ZRFA 3BGWA 1A82A 1CIPA 4LV8B 3BK7A 4B6FA 3CO5A 4MRPA 4QHYA 4B3FX 2W6ID 5FBLB 5FL7A 1G8HA 3CCEB 1OIWA 1P2UA 4OJKA 2ZRNA 1DARA 2BF4A 3KJEA 4U5XA 4BGDA 4V0ME 5TXGA 1KO7A 3VU9B 3CC2B 3B1ZA 4WVFA 3ADBA 1TX4B 4DLSA 2AWNA 1BMFD 2CJWB 3P1JA 3OESA 1JPNA 2ZTSA 4DCVA 4YAWA 2BBWA 5B57C 2FSFA 2AN9A 3K9LA 3MWKA 4QBIA 2RMKA 3VR6A 1OB2A 1K5GA 1NL3A 1XTKA 1LV7A 2FU5C 5H5JA 4O25A 2VO1A 4QJ5A 1TMKA 3LQRA 1EFUA 4B2LA 4RZ2A 4BE7B 4IOJA 4HDCA 4Q01A 1J9ZA 5AWFC 3RNLA 5H59A 2OO7A 2RGAA 2IYWA 1Q1QA 5KSWB 1E69A 1VYTA 1X3SA 2C99A 4HZUA 4KLNA 4OHWA 2NPFA 3AM1A 1E0AA 4A82A 3N5CA 3D3QA 1WA5A 5F98A 1U8AA 2I3BA 1HE8B 4RZXA 3FYHA 2BKUA 3ZVMA 1M90D 3K09C 4LDJA 1H42A 3JZMA 5CK4A 4RD0A 1SXJD 5EXXA 1E4VA 2FPKA 1JR6A 4D82A 3LVRE 2XNSA 1MABB 1FDRA 1OYWA 1T3HA 3CZQA 3MWYW 5CJPA 2OCYC 2D4HA 5DYGA 4POAA 4FIDA 4NDZA 2F9LA 2W6JD 1NKTA 1Q12A 3M1IA 2RH5A 4DDTA 4QGHA 5C2JB 3ZD7A 3D31A 4DLYA 2TMKA 2QGZA 3C5HA 4P0TA 3HU2A 1BS1A 1KDRA 5JJIA 1YR9A 4NHOA 4H9GA 3BH7A 3KQNA 1A2BA 1CF4A 1XMIA 3FHTA 3RS4A 4BECA 2IBMA 4U9UA 2OT3B 5JECA 3MHPA 1OKKD 4XVQA 1LW7A 3KXIA 1OSNA 2ZR9A 2P0EA 4YQFA 4DDWA 4TTQA 2IA5A 1RE0A 1H8HA 2FSGA 1VG1A 3CX7A 2YHSA 3AVTA 5L3SA 2H18A 2GEUA 2EVWX 4IVPA 3LVBA 4JT4A 4WXRA 1ZMXA 5AUNB 3THWB 2H92A 1SHZA 2BMDA 2YJTD 1JR3D 3THOA 1U8YA 4NMMA 5G53C 4YXWA 2JLYA 1KSFX 5SZJA 1CU1A 1NI3A 2IS2A 1MRNA 3WNDA 2NZ8A 4Q7KA 3JQQA 1IN5A 1Z0AA 3K0CC 2XB2A 4TL6A 1X1RA 1U9IC 2WSSA 1U94A 4X8LA 2EU8A 1F2UA 1XPOA 4Q9KA 3FMPB 3FE2A 3W6PA 3DL0A 2IYYA 5K8IA 2VA8A 4GBMA 2EWVA 1EFCA 3T12A 1Y63A 1QFYA 1G41A 4EPTA 2RAPA 3LO8A 6Q21A 3QBVA 4TMKA 3W6NA 1VQ8B 1XU4A 3KXKA 1N6IA 5J5CA 5K8TA 3TAUA 1VQNB 5J40A 3K8YA 2OZEA 4DWJA 2YWEA 1T0JB 1U98A 5E3HA 4C0LA 4DSUA 1VQ5B 2ODBA 1JPJA 1UADA 2BWJA 2VZLA 3NBFA 3H4MA 4LC1A 4HB4A 2AK2A 2JATA 1NMZA 4K81B 3L0SA 5IHPA 4JLJA 4B48A 3I8SA 4YDHB 2JIZA 3EASA 2A30A 1FW6A 1KJZA 1YR6A 1E2EA 1F3OA 2OTLB 1KMHB 1RRPA 3OJXA 2AD1A 5L3QA 5LD2B 4M2LA 1E2IA 4KSBA 4HI0E 1HT1E 1PLJA 1CKEA 1J99A 2OHFA 1UKEA 4QNMA 1FNBA 1R0XA 3W2IA 3I55B 2AHOA 2Q9AA 4KU4A 1QDEA 4BFXA 1E2KA 4D4KA 3U3KA 4UNNA 4IFBA 4Q1FA 3AKCA 2A7QA 5EP1A 4EPWA 3W5VA 4TLEA 4PAMA 1U90A 1GDDA 1OXXK 2FF7A 4YMSA 4PO1A 2OXCA 1KNQA 3CR7A 4OHVA 1L2TA 5FPKA 1VCOA 2FFHA 3E1YE 1G3QA 1K8RA 2PX0A 3CWQA 4BRUA 1ANKA 1BQEA 5IK2A 3CRQA 4HSEA 3TVTA 5FBVB 4BZQA 4XWAA 3T06B 4DRZA 4TLBA 3SNHA 2E9SA 3ZYCA 4FMDB 2R62A 5FTNA 2J0SA 1W4CA 1G5PA 2G6BA 2F3RA 2HJVA 1B2RA 2ZPTX 3A37A 1DE0A 2CDNA 1E0JA 4MRSA 2QP3A 3EPLA 4EJSB 5KSZA 4ACBA 3KKQA 1QHNA 3RHFA 2Z4RA 2G3YA 1AJEA 5GADl 1KI6B 1GRNA 4HLQB 3RRMA 1SXJC 1G9XA 1KDPA 1D8TA 1VKJA 4URUR 4NU0A 4V0NA 1UAAA 1XCPA 1E9BA 4Z8YA 1AN0A 1X1SA 3X1WA 2QMUA 2ZJBA 3NG1A 4DCSA 5IRCD 3AF0A 3U5ZB 3MWJA 4M1MA 3LFUA 2J0UA 2RC5A 3LBIA 4OK6A 4LBWA 4AKHA 4CEHB 3Q5DA 4WOPA 1UKVY 5JS8A 3OZVA 5JWHA 5CLLA 4ERNA 1QGAA 1E2QA 3PUYA 5JEDA 1ZUHA 1HY3A 1R8SA 2VHQA 2BSAA 2BEKA 2OFXA 3CCMB 2OCAA 2WHXA 3G4SB 3QE0A 4KI0A 3EPJA 3TSZA 4IOMA 5BXQC 2F43A 4PC7A 3FKQA 1JQLB 1BH2A 3K70D 2ZI3A 3BB1A 1OH5A 4UXHA 3W2EA 2BC9A 1W4RA 5HR5A 1KKMA 1MKYA 4QM7A 1KK2A 2GTPA 4BFUA 3GLIA 2WJIA 2YWFA 5AN9A 3MAAC 4ITRC 2QQ0A 2GXUA 2HCJB 3WBJA 2QTHA 3O8CA 4N3GA 4JKYA 3H84A 3K0FB 4HDQB 1M74A 3K0AA 3QPVA 2ZYUX 4I99A 3VKHA 4UXIA 1ZIOA 4BFWA 4X8OA 1RFLA 4YALA 2Q3FA 4F4IA 3VHXA 3KJHA 1RRCA 2ZS7A 4EKDA 2ZAMA 1II9A 1VYVA 3SJZA 3DVLA 4LYFA 4IOLA 2BMEA 4CF7A 4LHYA 3T1QA 1LB1B 3QKRA 2CL7X 2VSXA 4M9SA 5CIWA 1UKZA 3THYA 1L4YA 5DI3A 2RHDA 4MKFA 3HDTA 2DR3A 5JWOA 2W58A 1P2VA 2P67A 5FUWA 4S35A 1PLLA 3ETLA 2XEXA 4Z51A 1UBGA 2QTFA 3M6AA 3QJYA 3DOFA 3QY0A 1YZUA 3IEUA 3PEVA 3UKDA 2O8FB 1IY0A 2NTYC 1N0UA 2BMFA 4OL0A 2JJ1A 4KAXA 1SKYB 1YZLA 2Q21A 4OI4A 3OHMA 1TEVA 2ZUDA 3ZQ6A 4ZGQB 1HTWA 2JLVA 4B47A 3R7WA 1GNQA 2IYXA 1N2CE 4R7ZA 3T15A 2PJRA 1EX6A 3I62A 2D06A 3FMOB 4FCVA 4MDFA 2GQFA 2IF0A 1X6VA 1TF7A 1OYYA 2XZPA 1AKEA 2R8RA 4GP6A 3FVQA 3BB4A 3U3OA 4R2IA 2WJVA 5A4JA 1UBCA 2QE7D 1G3RA 2YOGA 4MITA 3V4FA 5THXA 3NHBA 5CYOA 4DCUA 1N8RD 5EMNA 2FN4A 3T61A 4DT1B 1VCNA 4IXMA 3ZVRA 1XCGB 4M0LA 4N1AA 821PA 1XRJA 2ZRMA 2QM7A 5E7JA 4TTPA 5FI1B 5E95A 2BJWA 1X8LA 2W0SA 3TK1A 2ODEA 4XSGA 4V0OA 2CNDA 2CMKA 4PC1A 5HXBA 1DBSA 1HT2E 5B2ZA 2I1QA 1TEXA 4KFUA 1FRQA 1ELOA 3LX5A 2J41A 4Y0VA 2A2ZA 1G3MA 2GJAA 1A7JA 2VHTA 2P5TB 5CM8B 3U3JA 4MGYR 2ZJ2A 5HPYB 4NTZA 3K0FA 4DHEA 1OFUX 4C0SA 5TARA 1P9RA 2BDTA 4DSTA 1Z28A 3UANA 1WP9A 521PA 1W36C 1FPMA 1JQJC 5L8VA 1QHXA 2J7KA 2HT1A 1KI3A 4DUGD 2J3EA 4LY6A 1H8HD 1UBEA 3T1TA 4UAJA 2CRVA 1EFRD 1P75A 1DAIA 1S9HA 1W0JA 4MGKR 4KFRA 5DLQC 1COWD 1Q3TA 3PFIA 3ZVNA 1TQ4A 2VPPA 1NG1A 2BHRA 3AVPA 2WKQA 5FPTA 2MMGA 2O5VA 3T1OA 2B7BA 2GJSA 2BPOA 1XTIA 1IBRA 4AKGA 5L3VA 4ZKEA 1N6RA 3FB4A 4DEYA 3ZBTA 5HKKA 3LX8A 1VIAA 5LPNA 4Z54A 3FMFA 4AG5A 3GLHA 4XD7A 3AKYA 2FZ4A 1VIYA 5GVSA 3FMIA 1GWNA 4PC6A 3G6EB 4AF7A 4Q4JB 3DEFA 3JVVA 1GFIA 2ZE5A 1GKUB 3UG6A 3CCUB 2OILA 4FI3C 3RWOA 1N0WA 4L16A 5A5GA 2WJYA 2XGJA 2JASA 4LYAA 4KYUA 5KNBA 1Z0IA 1YZNA 1ESMA 1NVUQ 4PSVA 5FUXA 3A1UA 1GP2A 4LOAA 3SYLA 2O8FA 2X3UA 1GKIA 1MR3F 2NG1A 3C4JA 1G8PA 5KSYA 1W35A 1NN1A 4PSAA 1KSGA 1QH0A 5FL3A 1SGWA 4KO8A 3C15C 2ZEJA 3RC8A 3KKNA 5LB4A 4TT3D 2CE7A 3C41J 2D62A 3ADKA 4JVSB 1CQXA 3DOEA 2KB0A 2BVNA 3EX7C 5DI3B 2DCUA 1KDOA 1EFHA 4LJ4A 3FPAA 2GCOA 3GLGB 1IONA 5LD2C 1VQLB 3FGNA 4ZCIA 3SC3A 4NYJQ 2EFHB 2DB3A 3SI7A 3GPLA 4DVGA 3AQ4A 2C77A 3SN6A 5AUPB 1CR0A 1G8GA 3SYKA 4A9AA 1A4RA 4AKEA 4D80A 1FNMA 3P4XA 3K0AB 4Q19A 2AXNA 4L15A 1VCMA 2ZVPX 1ONBA 3CX8A 2ANBA 1ZP6A 2IHBA 2PEZA 4G5QA 2C98A 1JR3E 2KWIA 1VQMB 4B3BA 3ZBUA 4NPHA 2JA1A 2ZU0C 2A5JA 2GAOA 5DH9A 3PEWA 1XBTA 2DYKA 2WV9A 3CRW1 3WMGA 3DMDA 1ZUNB 1GM5A 1YITB 1A5TA 2IUUA 1ZC4A 4TYPA 2Z43A 3H1TA 2XB4A 3SBDA 4A0FA 1VQKB 4ZDWA 2KBFA 2ZRAA 1M2OB 4IJMA 3S1AB 2XJ4A 1AS2A 1JEDA 2LCFA 2VRWA 2W6JA 3HPQA 3RS3A 1BMFA 1W36B 1NKSA 1ZVQA 3U2QA 3QSYA 2JLRA 3SEAA 1JAIA 3L2OB 2DPXA 5CIQA 4FWIB 1LS1A 1US8A 3EIQA 4IRUB 1G7CA 1OB5A 4Q9LA 5F9HA 2D7CA 1QRAA 1XPUA 1IJFA 4EFMA 3E2IA 5EZ6B 1Z8FA 4KHZA 2ZROA 4XJXA 2XZLA 1UDWA 2IL1A 1FQKA 4LJ7A 1MV5A 2JGNA 4GOJA 1P60A 3MUFA 3I32A 2YC2C 2WIBA 3GLHB 4I1SA 4HB2A 3I3SR 3KJIA 4F92B 2OAP1 1E2GA 2ZJ8A 3A1TA 4YONB 1Z83A 4RFVA 4NONA 4KVGA 4HYYA 2XOKA 5EXPA 4DSNA 1P3JA 1Q1BA 2QORA 2EFCB 3ZIAD 2E1RA 3BC1A 2HYDA 5A0FA 5FBRB 4JLNA 4PQRA 5DN6D 3U7GA 4XTRA 1RKBA 3TRFA 1WQ1R 1JB9A 1ZU4A 3TW4A 1DAEA 3AVQA 1Z0FA 5J4LA 2AL7A 2WWIA 2XTZA 1OIVA 2EYUA 1E96A 2XNJA 1RRFA 2QAJA 3RS7A 2X2EA 3K09A 1SVOA 1DAMA 4Q9IA 3M0EA 3CCJB 1T6NA 3SJAA 3OEHD 1AA9A 1PV4A 2W00A 1CEEA 2R9VA 1KMQA 1BOFA 1VQ7B 1Z6GA 4E03A 1S2MA 1KJWA 4B6EA 3CF2A 1G18A 2V1UA 3BH0A 5FOTA 1Z07A 2OTJB 1CJMA 3L0OA 4EPRA 2YKGA 5KPDA 3B1XA 3GJ7A 4HLCA 4GFDA 3V9PA 3O47A 3GLIB 2OV2A 1C9KA 3AP1A 1GAQA 1N6HA 4LBZA 4IDPA 5JRJA 2RGBA 3H0KA 4HLUC 1W87A 4Y9RA 1GSIA 3I1FA 2JLXA 2I4IA 2ASEA 2J87A 3P27A 3QF4A 4GDFA 1NLFA 1R5BA 1Q82D 2IX3A 3OFND 3AKEA 3OW2B 3LXRA 4DLZA 2JJ8A 4D25A 2QEXB 3GFTA 3OAAD 3AVUA 5FOSA 1G3UA 1K6MA 2SHKA 3AP3A 4HDOB 4R9UC 3R20A 4AYTA 1F60A 4IDQA 1HQCA 1II8A 1XTSA 1C4OA 3G5UA 2IHYA 2BKEA 1SVIA 1VQPB 1GL7A 4YC7A 1E2DA 1YZGA 1KNXA 2PLFA 4MYHA 3ADCA 3FDIA 3AF1A 4D4LA 5EXSA 5DGXA 2F7SA 1H8ED 1R0ZA 1VG8A 2P65A 4KFSA 3EA5A 3QE2A 121PA 3Q3JB 3KFXA 3A4NA 4NE2A 3W5JA 2H8KA 4Q4AA 4JKIA 2Q9CA 3KQKA 2RGNC 3QVUA 4TYWA 1FMLA 2B8TA 5SZKB 1QG4A 2G0NA 1YZQA 3QG5A 5C18A 3VO1A 1XEFA 5L3SB 1E0KA 4QJ4A 3ZJYA 4UNSA 5F2EA 3LD9A 3VO2A 3HPRA 3VTKA 2EFDB 4LV5B 3SR0A 4YXWD 2IW3A 2WWHA 1YU9A 2FZLA 5TDHA 3CPJB 3W9YA 2ZI7A 2GJKA 2CL6X 4AK9A 2J59A 2WMNB 1GKYA 3BERA 4RD4A 1KO4A 4Q1EA 4V03A 4JS0A 5TV2A 4ZCMA 1XX6A 2BBTA 2FA9A 3IUYA 4BFZA 2QP9X 4F7DA 5FPHA 1EK0A 3KKPA 3WYAA 2XNDA 3LAWA 4BLPA 2CK3D 2WKRA 5HCNA 1VECA 2ZJYA 3VHLB 1J7KA 2FE4A 2EWWA 4TQ9A 3B2EA 3AGQA 3CBQA 1KI8A 3EARA 3ECCA 1W46A 1AS0A 3ZZTA 4Q4LA 5FOUA 1KO8A 1T3SA 5BN5A 3BRWD 1S9DA 2AD5A 1KY2A 4FMDF 2VEDA 4AYWA 2G1KA 1XD9A 3MLEA 1M7HA 3AF4A 2XZOA 2GXQA 4QGFA 4DLXA 2QMEA 2QENA 2QAGA 1OXUA 4UXJA 4LK2A 1NY6A 2F43B 4GOKA 4C0HA 5JHHB 3VNVA 1W2GA 2XXAB 2GHIA 2H17A 3Q7QA 2YVUA 1P72A 5JLJA 1NG9A 2CNWA 4G1VA 4KXFB 1KQSB 3PEUA 2IS1A 2GF0A 5GV7A 1EWRA 3KKOA 4CEHA 4LHXA 1Z2AA 1GIAA 4QHSA 5UKDA 2QMOA 4P4SA 3QXJA 1JAHA 2GXSA 5BW8A 1T0HB 3CWZA 3W5HA 1NMXA 5KDDA 3NDBB 4BUJA 1G7TA 1Z29A 1Z2CA 3BJIC 4HAVA 4I1OA 4ZKDA 5H1YA 4YMWA 3AVVA 3TW8B 2BIFA 1WBBA 1KI6A 4D4JA 3LXXA 2O8DA 2EFGA 3U4QB 3DMNA 2P6RA 3EWSA 2GF9A 2LKCA 1TQ2A 1IY1A 4OHXA 2ORVA 3SOPA 3SFZA 4A8JC 4LUCA 1VQOB 1DADA 4B2PA 5P21A 2GPJA 4YDSA 4YAOA 4N0EA 4IEIA 2ZAOA 1CR4A 1OPXA 4PC3A 4Q1AA 3CRVA 4NYIR 1W5TA 4GZLA 4JSYA 1W1WA 3TSWA 2QTZA 5EZ5A 1OH6A 3OJWA 2GZDA 2V9PA 5HZHA 2YOHA 3GLHE 3JZAA 4WBSA
chains in the Genus database with same CATH superfamily
1Q14A 2B7CA 5EJ8A 1JYSA 3QG1A 1XMJA 4UBJA 3ROZA 2WMOB 4XRRA 1QZXA 5IJ0A 4Y2QA 4AP6A 2OUKA 1Y0BA 1QHHA 2A0UA 3N0WA 4FGZA 1ADFA 1EAYA 2QRGA 3TB4A 3MOSA 3OU7A 5ISMA 2GEBA 3TFWA 4FGLA 1SUBA 2JJMA 3MAGA 2ZSEA 4LHZA 5IVDA 3H3JA 2WMYA 1M66A 2FFAA 1U7WA 2LWIA 2JLSA 2NU6B 1MABA 2POCA 3QA9A 5AICA 1IIRA 5C8YB 1C1XA 1ZSYA 4HWRA 4L57A 1WMFA 4R69A 4KRFA 1E2HA 3BF7A 3GD5A 3N74A 5ELMA 1U4OA 2FSHA 4FMPA 5KNCH 3FVVA 4DXDA 4IFIA 1TKAA 1D9XA 3ZCRA 3VNQA 5IYPA 1WL8A 2JFGA 3EPKA 2GESA 4PNEA 3R7AA 3QEMA 3UO8B 2H1RA 4WDRA 2O1SA 1B0UA 2QTBA 3R0JA 5I4KA 2PH1A 1N5IA 2BGKA 5CA0A 1M1XB 3LUHA 1B3BA 3TRJA 4CEJA 2WF8A 3R9IA 3SHWA 4RJTA 2V7TA 2C04A 4WKNA 1YVRA 2HIMA 4HPJB 3COPA 2GS9A 4PO8A 4ZO9A 2X0NA 4YCJA 1Z9BA 1J70A 1RPTA 3TMKA 3HNPA 1AQUA 4R40A 1XXHB 4EDFA 3A1SA 1FP4B 2LVBA 2RBGA 3JSXA 3KPUA 4YH1A 1KU0A 4ZIRA 5K6AA 2V7VA 1H4VB 2X42A 4LYGA 2X85A 1EA7A 5FOXA 4F7WA 3ANLA 1XJWA 2M6RA 4Y6OA 1SUAA 1BHSA 3B7PA 1JDTA 3EC2A 1Z35A 4JP5A 4O08A 4QYXA 1CTQA 4RDIA 4AYXA 2FWPA 1T5SA 3HYTA 1U0LA 1YCFA 1SMKA 3GFQA 3QLTA 3RKRA 4BCBA 1IN4A 3SFTA 4ARBA 3OEEA 3ELWA 2DFKB 2FETA 1PWXA 1GTL1 5F2NA 5DX0A 2MSEB 3NS7A 4ZZ3A 1NF2A 3VAZA 4CLOA 4N0PA 4MIYA 1QFXA 3D2BA 3CZPA 5HTKA 3U3DA 4OYYA 3CVYA 1UD2A 3F74A 3INYA 4CEIB 3BJEA 2IIVA 2CCKA 4GC9A 4WK4B 2PUCA 3OUTA 3UXMA 1NR7A 3FYCA 2NYVA 3GJ5A 5GV8A 1ACJA 1RHMA 2HEIA 4JUCA 4QXOA 4G8CA 4JBIA 4F4CA 2HJGA 3PXDA 4EYSA 4ZJZA 3HKCB 5ALRA 5JADA 2EZTA 2ONJA 3SQXA 3T7DA 5DIFA 5CLQA 2EX0A 3F2IA 5KINB 4B73A 1E1DA 4EQ6B 1Z6YA 4YCSA 5MN4A 3AUSA 2ID7A 3QLVC 2P3MA 3UYLA 3J7AC 5ECDA 2A59A 1NM5C 2X6QA 3VJRA 4DGSA 2RHHA 3R6LA 2O3SA 4IFEA 4Z9BA 3WVNA 1SQGA 1BW9B 1X3LA 2YTZA 2XYQA 3PB3A 4QVIA 4M7PA 2HCBA 1U2GA 2WIDA 4TZTA 2ZYDA 3NEYA 4RMHA 4BZZA 4LYDA 1V5FA 1P5ZB 3U26A 2C9CA 4YLGA 4ZHQF 1RXUA 4Z4YA 3L8EA 3IQEA 5COQA 3R5XA 2DKNA 2H48A 2WUEA 2XT0A 4J3NA 3TL2A 2YBDA 3NTXA 3I1YA 2WUWE 5GJVC 3WO1A 4R51A 3CPHA 1NYRA 3OOJA 1AXRA 2IIQA 5IDQA 3BN3A 3H0EA 2J3QA 4LJ9A 3NHSA 5LQUA 4MVJG 1P1CA 5GJWC 3OLCX 4B4DA 3UMVA 3ON5A 4R68A 3HCOA 3AEUA 1BROA 3V4LA 4JC8A 3LJKA 4BVKA 2H06A 3O2JA 4OH1A 4QTUB 4BMSA 4NXNB 1JHMA 1LZLA 1RDFA 2Q29A 3N8IA 4HDRB 4JYBA 4TWIA 2A9FA 3M6UA 5EEGA 1RQPA 3VSDA 4AJ2A 3VBCA 4UFNA 3DLAA 1GUBA 3EMVA 5CVEA 3OMXA 4MV4A 3NP9A 1NVWQ 1WO8A 2DP4E 1EFKA 1TM4E 3PJEA 3U44A 4NG4A 4ND2A 2WU4A 4OHYA 5FFNA 4EWLA 2AFIB 3V1KA 4Y7CA 1AKRA 1ZY2A 4I1UA 1U7PA 3RJZA 4Y9UA 3TTVA 3KQVA 1RBMA 1JEOA 4G5OA 4CCWA 1HA3A 1SVSA 2IFTA 2X0RA 2K7FA 4P9NA 5EWJB 4C4ZA 1T4DA 4YTEA 1TQHA 3LY5A 1DQPA 4YAGA 1QE5A 3IMCA 2FE1A 1TC1A 5KYUA 4FE4A 3L7NA 3H75A 1C7FA 4U5QA 1R6BX 1XTJA 3JZFA 5DSXA 5F1OA 3WSWA 1CQIB 1YR7A 2AEFA 3K9HA 4G4SO 4NYIQ 6NULA 1XELA 2W6MA 4KKTA 2G9NA 2C94A 3GJRA 1P0IA 1Z5VA 5EYPA 4KO3S 1L1RA 3R6DA 1HG0A 3RSSA 2COUA 1N5KA 3I2IA 5A88A 3GLRA 2RCNA 2VTKA 1QX3A 1ZEMA 4P4UA 2HH9A 5ADUS 1IHOA 2KE5A 2CHVA 5A3SA 3MS7A 4NBSA 4MA5A 3F0TA 2YXPX 1N34B 1B8VA 2OG2A 4NCNA 1QG2A 5E4YA 3FGZA 3VAYA 1PJ3A 4E46A 1E3TA 2HSJA 2YN4A 1PG0A 4DW8A 5KWJA 4R7TA 1KVTA 3AIIA 5ADVA 3OIVA 3W2HA 1K7FB 4K6KA 1UEXC 2ZJ5A 2DT8A 4ZEVA 2AQIA 4ENTA 2NP6A 5EAIA 9GPBA 3HZRA 1Z4IA 1COZA 3DBHA 4ER3A 4XYMA 2R87A 3IS3A 1M34E 1FUUA 1CNEA 2H2GA 3F71A 3ZQKA 1MQ8B 2V58A 4C0KA 5KO2A 3SEJA 2YQ5A 2QY9A 3U5TA 2PRSA 3A36A 2W2XA 4R41A 4WLUA 3GJSA 4N9WA 3VZBA 4KXWA 1HSOA 4K9NA 2GR9A 4H0CA 4MMZB 3IVRA 2Z6BD 3H2KA 4M0KA 1Y48E 5DMHA 1MJGM 4ZAGA 2B1GA 5JXHA 3C3WA 4MJ7A 1RZRA 3FWPA 3KB6A 4KV9A 3R4VA 5G1PA 2K6GA 3TUJC 5CDFE 1MO3A 3CE9A 1O0SA 2FLKA 3QI2A 2VPWA 1WSAA 3AOEA 4G5YA 4V0LA 2OK7A 4PN7A 1TL7C 1NP6A 2LZ0A 2NO1A 3H2HA 1C9DB 4GM0A 4L3OA 4WKGA 3M83A 4A0GA 1SCNE 5IVPA 5A3VA 4F2WA 2RG7A 5D1NA 2BGWA 4OI0A 4AD8A 3AM4A 4XORA 4JD5A 5FLEX 5J1TB 3TMAA 3CH7A 4HRAA 5BN4A 1JE0A 2HA3A 3HBNA 4RU1A 4X8HA 1MOSA 2YYYA 4BEWA 5DNUA 3HM9A 3KOOA 2C4TA 3X1KA 4D79A 2PQ0A 5ALGA 3DMFA 1VC2A 4IEEA 4EW1A 1B16A 1X39A 3DLIA 3L9XA 3KL9A 3CCLB 4XKVA 3ZY3A 4H59A 5JJ5A 1GU1A 3TZKA 5DNYB 2KLHA 3LNTA 4YAUA 4LQDA 4BLOA 5CM9C 2O2YA 2QXYA 4CMAA 1UWLA 1RHUA 3BZWA 4J0QA 1Q7CA 1RJGA 2IXFA 2OCPA 4UDOA 5F33A 5LMUB 3SLDA 2ONZA 1GQFA 2ZETA 4DDUA 1QO0A 1UEIA 3ICQB 3GA0A 4R9NA 4A15A 2XYVA 4QOSA 4CF6A 1PKXA 5D00A 3TRDA 3BHMA 3KR0A 1QBKC 1CW2B 1XEAA 1Y5IA 2NOAA 1J7JA 2HA4A 2ZKIA 2CUTA 2VJMB 3K2QA 4FMCB 4W5TA 4LJKA 2OO3A 3QU5A 4LMPA 4IVNA 1SCKA 5LQSA 1BG6A 3JYOA 2NGRA 4MRVA 5U9CA 3UNXA 2BH2A 1TFRA 2MU1A 1KIAA 1M3SA 2H57A 2AEJA 2VBGA 1PJTA 3TXAA 4LKOA 4BQIA 3MINB 2IOYA 1N1GA 1HMPA 4MVJM 1JHYA 3JTMA 4XOUA 4ETNA 2QN3A 5C1OA 4WMLA 1NNLA 5JCJA 1L5VA 1Q22A 1XLWA 3P9XA 4OEHA 2OD2A 2Q1WA 2XNDD 2R1TA 1T34A 2CLFB 3FOZA 5FX2A 1CUHA 3SYMA 3MFQA 1G7SA 2PMWB 1E3LA 2IYFA 1WB5A 4GXNA 1RKVA 2W6IA 2CVOA 4M60A 3GUZA 4UE6A 2J7PD 3MTEA 3U60B 3H5WA 4Q48A 3YASA 3ZK8A 3HKEB 3T1NA 5ALKA 4AJOA 4UD6A 2O3TA 3E58A 4QGAA 4A6DA 3AFNA 3WK5A 3V7UA 3PCTA 5CVCA 4K1LA 3U49A 5HKLA 1P7YA 1HETA 1FLVA 2H07A 2SICE 3HDHA 4TMVA 1Q3KA 2CNOA 3I1IA 3TDKA 1RQXA 2YL2A 1WMSA 5ELXA 1NMYA 2ZSAA 5D6NA 3REGA 5CB6A 1U2DC 1KOLA 3E7DA 3FCSB 2JA2A 4BLRA 3Q7TA 4M38A 1XTTA 4CZ2A 5KYXA 3FVTA 5L3RA 4FDLA 4OYLA 4L07A 2AFHE 4U9IS 3ZV6A 2OHOA 5I7AA 2O0LA 4G25A 4X1KA 1L1EA 1BHO1 2B1IA 4EA6A 4BO7A 4X66B 4H6XA 3FLBA 1Q0LA 1AQIA 4RZ3A 3TKYA 1ZOLA 3P96A 4LZOA 3EODA 4I81A 1APBA 4KKXB 3GMTA 3Q12A 4OYHA 4JQSA 1QJCA 5KREA 4ZHQB 4YCCA 3IAXA 3TI9A 1YJ9B 4F3KA 4YN3A 1JU3A 3OE7D 2NSDA 2IWRA 4CM6A 2OBSA 2OZVA 4GECA 1UD3A 2WR8A 3QWFA 3N0XA 3D3KA 1A7KA 1MAHA 1L3CA 4D9FA 1QHHB 1A72A 2DT5A 3WQQA 4NMXB 3ABIA 3NBXX 4TLMB 2V6MA 3EDCA 1VPLA 4A26A 4BVAA 3KYBA 4EAAA 2Q3HA 4BPRA 3DW1X 4ZVSA 3SEZA 3CEJA 3V48A 4WZBE 1OX6A 4MV3A 4AZSA 5CB4F 1DQYA 3ZDCA 5B3JA 2AFHB 2X7JA 4LYYA 1ZCAA 3PYXA 1KO5A 4B8ZA 5K3CA 5K8CA 3P9SA 3F97A 2Z6UA 3UFXA 1EP3B 1HDEA 2BP7B 2A33A 3BE8A 1QHIA 2ADMA 1T4GA 2NSHA 1KAOA 1P9WA 1NN0A 2BM8A 2CXHA 2XVMA 3A04A 3PFHA 5ES3A 2HXSA 1KE1A 4R8SA 5KNCD 1NVXQ 1SVNA 5CYPA 4MO9A 2VTBB 2D4AA 3TBFA 3TSYA 5EHXA 5I7EA 1JQDA 1Z17A 1M6EX 1KMMA 4HS9A 1N2XA 1HDYA 2PCLA 3KT3A 1HMYA 1OXSC 4Z4ZA 3HVKA 3OCYA 3REFA 3V55A 1TYCA 1U0OC 1P45A 3L0IB 4JLBA 3MK31 4OJTA 3SLRA 3QHAA 3T4PA 2QXTA 3IAM1 2I6QA 1FS6A 3CH4B 1MJFA 5AJZA 3VR5D 3NASA 5JNUA 3PNVA 3TRIA 1Z5OA 2GF2A 2H4FA 2AI2A 4N0DA 4O4LB 4D3XA 2CLCX 4F38A 4F9EA 5FA8A 5TPZD 4YUYA 2VP5A 2LRHA 1N0VC 1JDNA 3JARB 3G5AA 4NKRA 2NTVA 1PFYA 2C61A 2AR7A 2H1VA 3DL2A 3KO8A 1W59A 3OOYA 1BCRA 1U99A 3AJDA 1EU1A 3K1AA 4RVCA 1PD1A 3LPMA 3ASZA 4RY8A 4EPXA 5AVVA 3EIEA 3B89A 3G2KA 3HM2A 3AEKA 3HO6A 1O94A 3HEAA 4HRXA 4Z4CA 1U4SA 3OY7A 3EVNA 4EFKA 7GPBA 5LKAA 3EZXA 3C16C 5DM60 3DDYA 1JSXA 4WOKA 4BJ5A 1H1LB 4HVAA 1CF2O 1VA4A 1AQ6A 1GFSA 1G5IA 4GC5A 1P1FA 2P30A 2OGTA 1NU8A 3LQKA 4U2FA 1BD4A 2OC9A 3IDQA 3RRXA 1R0WA 4XWKA 5A3RA 5C7LO 5LZ9A 4JI7B 2FQWA 4XQ0A 1RWPA 4CMEA 4CGZA 5E2AA 1ENZA 1EXNA 2WSMA 5DM2A 3FYUB 3LFTA 4D41A 2OAGA 1M8PA 4XZ3A 5I9BA 1R74A 2ZTVA 2JS7A 1UC9A 2QLBA 4AZ0A 2O8CB 3QU2A 4QRDA 1RYFA 5BR7A 5CBPA 5JXJA 3N8NA 3KLMX 4IXNA 3UJPA 1IOWA 1L4EA 1ZL2A 5IULC 4EZIA 2FDXA 4MPRA 4PLFA 1YU6A 3VH3A 2QA5A 1OLOA 1TJYA 3E27A 4IIEA 4YDRA 1L8QA 3PUIA 3CX3A 1GTRA 2Q6TA 2H7VA 3IP1A 4HXFB 2MYPA 4WTOA 2A78A 3ZXUB 3ER6A 1E6UA 3AR4A 5B53A 3HWRA 4ZZIA 3JVDA 4JBNA 4MS4B 1PFVA 1JFFA 2C96A 4XD7D 1VL6A 3B7GA 3BH4A 2NPOA 3LW8A 5CLGA 5TRTA 1LI4A 3CNEA 5MGNA 3RADC 1MB0A 1VYHA 2L2QA 2Q99A 3CKMA 4II2A 2C54A 4QBHA 4LXUA 4ZCRA 7MHTA 1NQUA 3H5VA 3FLAA 4D6PA 3CWCA 3CPWB 2X5OA 2YFHA 2QT1A 3GMSA 3DBLA 1SC4A 2COKA 1B14A 3GFRA 4EKYA 4F96A 3RUIA 3JD4A 4JB0A 2G9UA 3V00A 2HV9A 3X2FA 1JDSA 4O2AB 2KJQA 1LSSA 1YIJB 3ZNNA 1Y3DE 3MRSA 3EDOA 3RG8A 5JJBA 1SBHA 2PKQP 4K6GA 1US8B 1O1YA 5ELLA 2BDEA 3IBSA 3REOA 1TVCA 1ULUA 3A2MA 3OEED 1T8UA 3TSOA 3PVSA 3LTNC 3HI4A 3W06A 5CVDA 2YWHA 5AIBA 1ZNWA 2RGUA 4OQZA 2NUTA 1E2NA 1L7VC 4P4SB 5DHPA 2R6JA 4F93B 3BKWA 1MW8X 1XB2A 1XSEA 1PE0A 1NBEA 1WEKA 3EBPA 1UODA 4CHGA 1WIWA 2ORWA 5KX5A 4M89A 1Z0KA 2YDXA 4XYGA 3PUJA 4MR7A 3MBIA 1GPBA 3NGXA 2O0HA 1MP0A 3PIRA 3SX4A 3WHLA 3DOCA 2WZBA 3JQ8B 3KPVA 1T4CA 2OBXA 4X8MA 3K70C 4EX6A 3K6SB 2AMYA 2BSXA 2OXFA 5HSGA 3N2IA 5IFKA 1LCIA 1PS9A 2WQZA 4GX5A 1JKIA 3AY7A 2NZUG 3PYMA 1SC6A 5CVJA 4R4JA 4UQPA 4WFJA 2QTLA 2NPIA 1NVDA 2PT9A 2RHWA 4ZOAA 3BFXA 2PM8A 3QQ5A 4X00A 3VAAA 1ZS9A 3MAJA 1X7WB 4EHAA 3ISJA 4HRYA 4XA8A 3QVKA 1K4YA 3PWTA 4YRDA 3JCZA 3MTGA 5EJAA 2GKGA 4E33A 3ST7A 3CLUC 2MTBA 4KODA 4N03A 4RD1A 4PAGA 2D7DA 1MDFA 1JXAA 1T9GS 4NV1A 3HE3A 4G5GA 2OBLA 2R1UA 1B76A 1W76A 1YS2X 3EG5A 3NC0C 4X06A 4EI9A 5G1OA 1W1IA 1HPLA 5CGQB 3V3KA 3VDXA 2I1WA 1DMRA 4O4HF 1JKFA 3WE7A 5LJIA 4YJ2B 4NBLA 2ODAA 1UMDB 1SVLA 2OYCA 4R0MA 3TGPA 5CDFA 3GJ6A 5EE5B 3D4PA 3LPAA 2XWQA 3NVMB 4JJEA 4RVDA 2VK4A 4DEVA 5CFMA 1OAOC 1IZ9A 2ACWA 2R66A 4Q21A 4NU8X 4CR6A 2QA4B 1PL0A 1Q1EA 4XGRA 3R5KA 5LA6A 1Q7TA 2V7XA 2DFTA 3HQ4O 1AHPA 1I6WA 1SHUX 4CM4B 1TJ3A 4D8WA 4XGKA 1FMFA 2LE0A 4CI9A 5FYQA 3HXMA 2OHXA 4IDHA 3UJ9A 2ZYTX 4EARA 1Y8CA 3O3MB 4L5JA 4CMIA 4RCYA 3SLNA 4DIFA 5HIAA 2B8JA 1TZ2A 3AW8A 3DWGA 3NKVA 4PQFA 4KCGA 4RESA 1X94A 4TQAA 4LCBA 4CDRA 2J0VA 4EG1A 4ENUA 5ESDA 1P1HA 4JELA 5CFQA 2QUZA 5JAUA 2YICA 5ITZA 4MIEA 3KSUA 4D26A 1ZM2A 1ULHA 2OAQ1 3NGLA 5L51A 1E6MA 1ZD2P 1LDNA 4L27A 1YR1A 1M75A 2E6KA 3FUVA 2C2MA 1OFTA 3B6JA 3V2HA 1G3IA 2D1YA 2EKZA 4ZV4A 3ENZA 4JGIA 4JU9A 2UYYA 3RQIA 3W34A 1FUEA 3IIJA 3LPDA 1G4AE 3GOQA 2Z08A 2VKTA 2FR1A 3F3KA 4MCIA 4TTIA 3LHSA 5JD4A 1CUDA 3HCBA 1PI3A 4I1VA 4M1OA 4D0NA 1D4OA 1WP4A 3OOWA 3ZHYA 2JHPA 3KQLA 4X05A 1SK9A 3DEJA 3A8TA 4MZDA 3RK0A 1OQAA 3GLQA 1RJEA 1N6PA 4TS1A 1RLMA 3VHXB 2HR1A 2VHEA 2QTVB 2DETA 2XSZA 3G7UA 4HNRA 2HWXA 1VG0B 1SC1A 2FW1A 2AZMA 3R44A 5A04A 5LZ4A 1YTLA 4XGQA 5E9AA 1T1JA 5LB2A 4Y2SA 3AR6A 4UM9B 5TGZA 2ATXA 3NETA 2C4KA 5FLYA 4BQNA 4F2DA 3ZC3A 3CGGA 4QDTA 1FNCA 1IB0A 2Q0HA 4DA8A 5LKRA 3UWDA 1QNLA 1OX5A 3OZAA 4WESB 4BJ1A 1PT5A 1RYHA 2RHRA 1K2WA 2ZLBA 1KZ4A 4MVJF 4EJSC 1KVRA 2WIAA 2HSZA 4C4TA 2Z56A 3FW1A 4P32A 1DELA 3B13B 3DMTA 3ZDQA 3E7XA 4CG1A 4DMCA 4YT8A 4KREA 1J56A 3ZDZB 4C5AA 4JEMA 4LY9A 2IGBA 2ZT6A 4AUKA 3LNNA 1VCIA 1V5GA 3ISVA 1H2FA 4ARSA 3EIFA 5K3SA 1K5PA 4L7VA 2G28A 5CX1A 3B8EA 4ODIA 3TGWA 2WPDA 1G6Q1 1V9SA 2J0UB 3CNLA 5IDVA 4DC1A 4DT1A 2AFVA 2GO1A 1KH1A 3NEPX 5J63A 1Q91A 3QWAA 3MGBA 1JECA 4FJ1A 4UQOA 3AEZA 4Q1VA 3UWPA 3B9BA 4V0QA 4C7MA 3PTAA 4QHTA 2IK8A 4WCFB 4URWR 2ZRBA 3PC6A 5EE9A 2R1VB 1G0OA 4AURA 1KY3A 4HS4A 2B4RO 3ETJA 4KL8S 3EAFA 2PX8A 2ZSFA 3BMCB 2WG0A 1A7UA 1W0CA 3JAWA 3JRNA 3GU3A 1EP1B 2WLTA 2ZE7A 3FFAA 4GVLA 1WCIA 4OHOA 3DV9A 3ZH2A 3MJSA 2IU6A 2JLBA 3IEKA 4RTQA 3HJGA 1NURA 1R5JA 4MIOA 4Q15A 3OOHA 5DP2A 1Z2OX 1IBLB 1N2GA 1H5UA 1R3UA 4NAVA 3GRCA 5EUQB 5LLTA 3ILVA 4I55B 4X3PA 2C7OA 3EGWA 3SMQA 2ZZFA 2G88A 3INGA 3WDMA 5BPHA 2DSTA 2UVQA 1D1PA 3CF4G 2V8OA 4RHYA 3KL4A 3PZRA 5DEIA 4Z2YA 3S2YA 2ILTA 5CDHA 1S8FA 4TV9F 1EUDB 4Y7DA 1E2JA 1FDUA 2HD4A 3ETGA 3K9CA 1FFGA 3KKMA 4PIPA 3OWHA 4GUDA 4HB3A 1NYTA 2IZ0A 3WLJA 4IVRA 5L4NA 3AERB 5G2OA 4GKAA 2OZLA 5C53B 2ZB2A 1CYEA 3OHPA 5K2OA 1U63A 4NZPA 5F9FA 4X8IA 3EGEA 4DADA 4TXJA 1Z3IX 1T4MA 2PR2A 3EFBA 1TK2A 3I6MA 3WYFA 1DJQA 1NFRA 4MKGA 1KYIA 1YHYA 3SM9A 3RSHA 3HNRA 4W63A 3KSMA 4HZIA 2DOKA 4KBYA 3EQ9A 4IS2A 4KK4A 2GA9A 1QIIA 2PWZA 3ZD9A 1NN5A 3D4IA 1UD8A 1A4IA 3WV5A 5LQDA 1SG0A 1Z5WA 3G2MA 2QVCA 3IAUA 5B7PA 3STTA 2JH8A 4ND8A 4C4PA 2QBYB 3ICCA 3TZBA 3GX1A 2H52A 2VAMA 1QQ6A 1FYVA 1B3RA 4R1MA 3EEQA 5JQGA 3P2EA 4M7OA 2JGJA 2HLDD 5B3JC 2VCYA 3W1EA 5H4GA 5H81A 1MIOA 4PFJA 1ZMBA 1PWHA 3FAZA 4Z49A 1R0SA 1NOKA 1Z26A 3JQ8A 2P9HA 1Q44A 1RTKA 2JJ2D 4MR7B 1KJQA 1CJBA 2Z5VA 1TA4A 3PBKA 4ZDIA 5KWVA 3O94A 1EXMA 3QKTA 5FADA 3TMYA 1YQGA 4ES6A 5KKCA 2PGXA 5EKUA 1WLSA 3TBHA 4Q00A 3A7DA 4J0GA 3G6WA 4G3XA 1HG1A 1GNPA 2JB9A 1E92A 2QEQA 4OREX 5FV7A 2ZITA 3K8QA 3S0JA 1G6OA 3EDQA 2X8KA 4FXUA 1I4TD 4KQJA 2C7GA 2X2OA 5B55A 1BE0A 4AJJA 3H7IA 4H1UA 3QUQA 3QW4B 3TE6A 4J0KA 5FKJA 1XCMA 2OHGA 4WNIA 4OXRA 1ZJ6A 2A0YA 2JGIA 4KB5A 5EHNA 3VZRA 4JZKA 1P0MA 3C7KA 2DBRA 3CEMA 4JVNA 2OD9A 3KLOA 4OLFA 2P9ZA 2ZDHA 3G0OA 3LI2A 3RVQA 1JG7A 3R7BA 2V7WA 1WV0A 1JBKA 3ZIAA 2IDZA 3CNOA 3EUAA 3OPYI 2ZXFA 5BSUA 3E4DA 2AFIE 3FWYA 4KMMA 5BVGB 4J9UE 5G41A 4NOKA 4IR7A 3L4KA 2P2DA 2BFFB 1VJ5A 2AKYA 3DKVA 3GZ4A 4JBLA 1Y7LA 3OU2A 3CX4A 4WOJA 4MUBA 5LVAA 1KK1A 4DEXA 3P20A 2KYRA 1MLDA 1FFBA 2XYPA 3CTPA 1H3NA 3UB4A 4B35A 3PJGA 2YVKA 4CL2A 1GLVA 4DM3A 1Y89A 5ILOA 3AX6A 2QRVB 2AJLI 3QPUA 4XJTA 5LCXA 3C3EA 5KYYB 2XB8A 1VB3A 5F4MA 1DAGA 3L02A 3KAKA 3HB5X 5CJ2A 3Q85A 5CYFA 3D64A 2O1WA 2QI9C 4II7A 4PIVA 5EZYF 2XCRB 3ZDDA 2XUAA 5KYWB 3W4JA 1D1QA 4OK5A 4UHDA 5THKA 3EC7A 1T8SA 1ODIA 2QUKA 4RX1A 3W5IA 2J4DA 1ADGA 2X77A 4EHBA 4RTLA 4COOA 5L3QB 3SS9X 1PZGA 2F67A 3EOAI 4FXOA 3PGLA 1AKQA 3GK3A 5DASA 3AJRA 1JEYA 3VJLA 1E1QD 2R86A 3DM5A 3RTBA 3OY2A 4PGAA 1F6BA 4IMIB 4F06A 2ZZGA 2AX4A 3DDNA 2HMUA 3GNSA 4M0CA 3PQDA 4FOLA 4JXKA 3BFKA 4L5BA 2VS1A 3T7EA 2V7EA 2Y1KA 5IG2A 5JYEA 1XWFA 1CJKC 4FDMA 2CFTA 3D7NA 2I1VB 3BIOA 3P32A 4DKJA 4RK5A 4AZVA 1QMGA 1T2NA 1IZ0A 3O03A 1C3EA 4KJXA 3EZ7A 4QXAA 5HGJA 3A4MA 1J90A 4HMOA 4HAOA 5F76A 3OE5A 3RK4A 2GJ9A 4LPSA 1CE8B 1X77A 3R3XA 5AYVA 3WO0A 1W5BA 4I7EA 4BNLA 2FQQA 1SUCA 1GVHA 2J32A 3SHFA 1GZUA 3PP8A 1T2CA 2ANCA 2QOEA 4O4LA 4RF3A 3IBYA 4UE2A 5KTRA 4N4AA 2H1LA 1ULBA 2R6GA 3RTGA 3KR2A 1XD2A 1SQ0A 4HC4A 3RTDA 3VTZA 4A0SA 3V4RA 3TCKA 1MB3A 3AXTA 2YWDA 3EISA 1R8JA 4GMHA 4N5LA 5AKIA 3C1TA 4JL8A 1GPAA 1WCYA 2Q3LA 3M6MD 3OZBA 1FNNA 1J00A 1Q11A 1RLTA 3HJCA 4QUAA 5EMKA 4DMGA 5LXTA 2INGX 4MYUA 4MW4A 1XYYA 1YB6A 2C03A 2REQB 3EIOA 1X0VA 3EZ2A 3KRTA 4Q12A 4TYQA 1ABBA 4E1BA 5DT9A 1YSCA 2HU5A 1I6MA 1KXZA 4H4DA 5CT6A 1GTG1 3G5TA 5E0KB 5A2GA 4B34A 4BV3A 1MD9A 2O7NA 2PS3A 1DC7A 2QL6A 2XQJA 2AA3A 1KFCB 5IKMA 3OZGA 1WHTB 4EJ0A 3Q98A 4ESVA 3GPBA 5B4UA 4LN1A 4YJHA 4AO6A 5DBFA 2WA2A 4ZEXA 1P0FA 1Y1PA 5EJ4A 1I94B 4N48A 1TJNA 2HMWA 1PR2A 4G81A 5K51A 1SD5A 3DZKA 3K1ZA 1BMQA 2F48A 2GM5A 4G26A 1RABA 5ALTA 4E0FA 1Q83A 3FIUA 1MIHA 4ZC1A 1FFWA 3GWZA 2OHVA 1GQQA 3RUAA 3VYWA 4V1CI 1RPNA 1ZJZA 4M1EA 3CPSA 4I1YA 4XIYA 4Z0NA 1JXOA 3H2GA 1USGA 4OA5A 1WBJB 4NCHA 3U4MA 2O0MA 2ERXA 1SD2A 2Y05A 5EMLA 3UM9A 4ZGWA 4J29A 1SXPA 1F1BA 4F3TA 1X7XA 2QX9A 2YCBA 2X0JA 4Y1EA 4KUHA 2P1RA 2VJPA 1Z39A 4LRXA 1RHJA 4J7UA 5F21A 1ETHA 2Z04A 3V76A 4EVIA 5K99A 1E1NA 1LC0A 2V55B 1V8ZA 1AZTA 3QXGA 1WMBA 4FOOA 4LZLA 4WGGA 5HOQA 2QB5A 5HHTA 1JG1A 3BWXA 3QEOA 1YQQA 3H4VA 1LRJA 3DFMA 5ENZA 4MWBA 4E2ZA 2VSYA 3MZ0A 1H2RS 3ASPA 4J91A 4E07A 721PA 1Q7BA 3R9XA 2Q4BA 2W6PA 3GG9A 3NAZA 1MEOA 4GBED 1DRKA 4E5SA 5BORA 3UAGA 1C4WA 4JI0B 3OZXA 3SR4A 3T3NA 4EF6A 1N9GB 3P0EA 1M33A 1GD1O 3K1AB 1FB5A 3OD5A 3NTUA 5BSRA 4KR3A 4N5MA 1E1CA 1EDZA 3VI3B 4I1IA 4NOJA 1Q0ZA 4OHZA 3CRNA 3D8UA 2XUKA 5F2OA 1CEXA 5KNDH 5KOYA 1KOFA 4QDUA 4NZYA 5LQMA 3O92A 1OPRA 2W2TA 2DKFA 5TMPA 4TLDA 1OASA 3CH5A 3R8FA 1LDYA 2PZGA 3LOUA 4MV5A 3X1ZA 4QOFA 2Z09A 3LA6A 2W6ZA 2BEWB 1SCDA 4XX0A 1I7SB 2DTEA 5JS2A 1NSFA 2J48A 2G63A 1XKTA 4BFCA 1G4UR 2ZE8A 3KB1A 3MJCA 2VBFA 1V2GA 4M83A 4Y0AA 3SIPA 4BNNA 2ZZKA 4U02A 4EO9A 1G8FA 4HDKB 3IAEA 1ZH8A 2QZPA 5FA5A 2XAAA 1TKCA 3RCBA 1XP8A 2JIBA 2WTXA 3COVA 1JQAA 3IEPA 4JC4A 2PH3A 2ZIXB 4YAKA 2QTTA 5KAMA 1RLUA 2W4QA 2V7QA 3Q3VA 3UFXB 2IDJA 3ETEA 1E7RA 3NM5A 3EXIB 4CF5A 4WJZA 3QOWA 3BD8A 4UHJA 2AFHA 2JDID 2XB9A 4LY3A 4QBGB 3TEJA 5TLSA 1H94A 4HTFB 2UXDB 4PU0A 2DHRA 3PQ5A 3S3TA 2JLZA 1AGRA 2V45A 5CURA 2B8EA 1SIUA 3OLQA 4ZREA 4XCQA 3SDZA 1KYWA 1XCLA 5JBQA 3VMMA 4FNAA 3D6VA 4B71A 1PVOA 1PJAA 3AR7A 4GMFA 4HUQA 4ZFNA 4H17A 4J7CA 5EUMA 2R48A 1HQYE 1GUYA 5ILQA 4DA0A 4KTTE 1Y82A 5DTIA 4RDJA 2VNSA 1U8ZA 4B74A 2XUDA 1FP7A 1E2MA 1WDTA 2BW0A 2XQFA 3K9WA 1I10A 1SOAA 1TIBA 3E1GA 3G9XA 4UJ5A 1Y0YA 2NU7A 4BX8A 5BNIA 3EB9A 5FBKA 5I7FA 1S6YA 5JVDF 1YI0A 3KEOA 4P4LA 1RQ2A 1I51A 4ARZA 5JAQA 1ZM4A 4MWGA 1XOIA 2VUTA 3FTPA 3K0KA 4HHEA 4P4GA 4JLSA 5DK6A 4ZCSA 3F1LA 4YJDA 3EEBA 1K89A 2DWUA 2P69A 4G4SP 3UA4A 1GL9B 3GQVA 4OGFA 5AKJA 3W7BA 3A06A 3CXRA 1JALA 4RFSA 1FUKA 5I48A 1DWQA 5A0VA 1XQ1A 1GG9A 2OKCA 4BQOA 4I9GA 1KPIA 3CINA 4Y6PA 3CZ4A 5EL0A 1FDWA 3SR3A 4EF5A 3B60A 5DE3A 3P0JA 3X1JA 4WY8A 1Y3HA 4FQ7A 5A9SB 3NTRA 1WXHA 4DQUA 1FSSA 1OYOA 3VFDA 2HDNB 2ZDQA 1TKRA 4DANA 3NV9A 2VYQA 2UKDA 3VVCA 3ZE7A 4QG3A 2YWGA 2ZRCA 1PJ7A 2B4QA 3OQHA 3AO0B 1Z73A 4QBTA 1FMTA 1PNVA 3IUJA 4HNTA 2Y3IA 2F4VB 3HEMA 3QEKA 4UZEA 4BFTA 1HM5A