2D74A

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
407
structure length
403
Chain Sequence
b'KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 90
structure length 403
sequence length 407
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2d74A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d74A01
3WP0A 4YXWA 4B4DA 2UKDA 2EYQA 3BGWA 3UG6A 1FPMA 2ZU0C 2YV5A 2ZVPX 5AJXA 1JBKA 1WQ1R 4Q18A 4AI6A 1OXXK 2O5VA 1P2SA 2R62A 4M1TA 4I1SA 5JBQA 1F48A 3WNCA 4MDEA 3A1TA 3HYRA 5L3SB 3NHBA 1G6HA 2BEJA 5L3VA 4PC7A 4F7WA 2FFHA 3O8BA 2IS6A 5JS8A 2DFNA 2X3UA 1NI3A 1FNBA 1R2QA 1JECA 1IJFA 4JLPA 4EFLA 4DUGA 2RGBA 4QG7A 3CZQA 1EP3B 3EA5A 1VHTA 5KU1A 2YINC 1OKKD 1PV4A 2ZITA 1FZQA 2GZHA 2HJGA 2XEXA 3CX7A 3SEAA 2G3YA 4HAVA 2JDIA 1R8QA 1K5DA 2WIAA 1N5JA 4XJXA 4E07A 1D2EA 1WE2A 3ONWA 4B2IA 3NHAA 1H42A 4MYHA 3DVLA 1E98A 4A6PA 2GNOA 1R0WA 4YALA 2O8DA 1G64A 3CH5A 4CT4B 4TMXA 1FP7A 3CR7A 3VHXA 3OE7D 1N6RA 5KSYA 4V0NA 2ZRLA 2QGZA 2VP9A 1GG2A 2IF2A 4Q7KA 1G16A 1PLJA 4ZDIA 4AY2A 1KI4A 3BXZA 3L0SA 4NYIR 1XRJA 4LV5B 4GOXA 4HZUB 1H8HA 4KSBA 5HE8A 2CCJA 3IBYA 2D7DA 4PSVA 1FOEB 1TQDA 1UBCA 2WJVA 2CDNA 3ZQ6A 5JLJA 2C96A 2IYYA 5JCZA 4DLUA 4DVGA 2BKUA 4JYBA 2NIPA 4CEIA 1P62B 2ERYA 1ZIPA 2AR7A 5FUWA 4A2PA 4M0LA 1XPOA 3VFDA 4WQMA 5TXGA 3OIUA 2XNCA 1OLOA 2YHSA 1CR0A 2F1HA 4UNSA 1LF5A 1QH0A 3OHMA 2W83A 4DLRA 3LLMA 2QAGB 1UEJA 1HQYE 2WJYA 1SXJA 1U0JA 1T5LA 4B3DA 3SZRA 4M22A 4TMZA 2DWOA 2RHDA 1O3YA 1E69A 2WSSD 4LJYA 1GR1A 5EE1A 2ZJ5A 1W48A 3I92A 2FN4A 3I56B 1E2NA 1VPLA 4Q9HA 1M74A 2Z83A 4JZKA 2VNKA 3QVVA 5BYKA 4IOLA 2QMHA 1WRBA 1NMZA 1TF2A 4I1OA 4NHOA 3ES9A 3WMGA 3PXGA 4CEJB 1G4AE 3ADDA 1KIMA 3KUCA 3M6AA 4BFTA 1E96A 4DRZA 4HB3A 4DSUA 4GFDA 3BK7A 5BWMA 2AX4A 4C3ZA 2W6ID 1NN1A 1FFHA 4KYUA 4PO8A 2OCBA 3GLGB 2QE7A 2C99A 5DI3A 4XD7D 4FWIB 2F9MA 4YAFA 1RRPA 2A30A 2ZE6A 3A1WA 4JLNA 4DZZA 5J47A 1KJZA 1TTTA 2OCYC 1YR6A 3IUYA 3QEJA 4O2LA 2W0MA 5EP4A 5B30A 1TNDA 1M1YE 4TMVA 1IN5A 1ZAKA 2YZ2A 1ZM2A 1VIYA 4D0GA 3SC3A 1TQ6A 5C18A 2BGJA 1XXHE 3PITA 2ODBA 2P3SA 4KFSA 1DS6A 3U6BA 2PMKA 3TRFA 1YE8A 1N6KA 3MFYA 4XTRA 4G5OA 1H85A 1VQNB 5FOSA 1NJID 3LD9A 2Z0MA 3CX8A 1GAJA 4Q7LA 1I4DD 4RY2A 4PC3A 2X77A 3Q85A 2WWHA 2J0UA 3WHLA 4L8GA 4A1FA 1G3QA 5DHFA 4V0LA 1GRQA 2GESA 2GEVA 2C95A 4I4LA 2ZE5A 2B92A 1Z28A 2WAXA 2GKSA 4D6PA 3A6PC 1W5SA 1Z29A 2VHUA 3RS0A 4U7DA 3T1VA 4TZ6A 4ZCIA 3P1JA 3T35A 5F3WB 3F8TA 1G6OA 3GJ8A 1XWIA 1Z07A 1S0UA 3LV8A 3LVBA 3QXHA 2NTYC 1MABA 3PUZA 5JCPA 2ECKA 1E0SA 4AD8A 3WYAA 3HDTA 2VF8A 5J5CA 3BAFA 2ZANA 4UAJA 2C78A 1KZ7B 1SHKA 5AN9A 5FBLB 1Z6TA 1P6XA 3C16C 3I55B 2OBMA 4D4KA 1N3BA 2W6JA 3CM0A 4RFVA 3RWOA 2QBYA 2O8CB 4Z51A 1MO5A 2FDCA 3OFNA 1BJKA 4IDPA 4OJQA 5TV2A 3QE0A 5F2EA 3TKLA 3THXA 3A58B 2QZ4A 4TQUS 1SZPA 1Z0AA 1G17A 5FI0B 1NL3A 3I3SR 5JMTA 2JA1A 2WWYA 3CNLA 4YDSA 2G77B 3QBVA 4NDZA 5E7JA 4CF7A 1N6OA 1JEDA 2IXEA 4BFYA 1KSFX 3D3QA 1TUIA 4CGZA 1P75A 1EFHA 3I73A 1X8LA 1JB9A 1CR2A 1SULA 3GQBA 3K0CC 4HUTA 1HA3A 1YZGA 2EIXA 4FCWA 1EGAA 1R10A 3OW2B 3TAUA 1NJGA 1XTIA 2GXSA 3VMFA 1IN6A 1AA9A 1OSNA 4LV8B 3I4LA 4LJ7A 3KKPA 4ZCMA 4BWYA 5EQTA 2GDJA 1LW7A 2IF0A 4ABYA 1AQUA 1EFRA 3VKGA 2NO1A 4W5WA 1IOZA 4BEJA 3K53A 2V6IA 5BYJA 2AN9A 1WCV1 5L8VA 2K5UA 2HXYA 4RD4A 3FVQA 3CCSB 2I1QA 2OE2A 5IF9A 1UMKA 1CJUC 3WBKA 1T5IA 4OHZA 3KFXA 1VQ6B 2ANBA 1XDBA 1KNXA 2V6JA 4Q4JB 4W9MC 2WWXA 4B76A 2BC9A 2QAGC 2ZJ8A 2XB4A 2IXFA 1L4YA 2ZREA 3H0KA 3Q8XB 3GFOA 3L8YA 2Z6VA 2PX3A 5GV7A 1B0UA 4OI1A 1AQYA 1QRAA 2ZR0A 3IIKA 1II0A 2XNSA 4LPKA 4Q9JA 3TLXA 3W3ZB 1BOFA 2FPLA 2J5XA 1P4SA 2QPAA 2IX3A 3KB1A 4BRWA 2C2HA 2J87A 2J59A 3LFUA 1Z6YA 2QA4B 3SR0A 3O8RA 2CVFA 2GCOB 3CRQA 1BQEA 3OZWA 2ZE8A 4TLCA 1IB0A 4MRVA 4AK9A 1ZD9A 3B9QA 3IIMA 1JR3A 1Y63A 3JZMA 3QKRB 4Q4LA 2F43B 2FZLA 2FSIA 5HCIA 2QAJA 2HLDA 4U9UA 2NPIA 5JSZA 2HEIA 3RNLA 1OT3A 1QHIA 4NP6A 2A5JA 1M7BA 2BBTA 2W2VA 2RGEA 1VDZA 2FX3A 1M7GA 1XJCA 4X8LA 1Z0KA 4C0BA 5FTNA 4KU4A 2GEUA 2ZRNA 1T8UA 1QG2A 2XOKA 4OQLA 5FOVA 1MV5A 2CNWA 2C5LA 3PG5A 3B82A 2C04A 1RW4A 1VCMA 4OHWA 5HE9A 4M4SA 1UDWA 4KI0A 3LO8A 3TVTA 3SHFA 3B1ZA 1S1CA 5JHGB 3TSOA 2ZI5A 4JL8A 3GEEA 2QMEA 3BB4A 4X8MA 4FMCB 4MQBA 4C0LA 1B23P 3FB4A 4DCTA 5BXQC 4UKDA 5FBWB 2FPMA 1W2BB 3Q7QA 4NCKA 2QT0A 2VHTA 2ZJBA 3BFXA 3HU2A 3OEEA 5CLQA 1QVRA 3H84A 4M9SA 3B7GA 4A82A 1DO2A 1ZU4A 3K0SA 3BD9A 1P9WA 1P7CA 1D9XA 4RZ3A 4WZAE 3ZGXA 5JS7A 3ZD6A 4WA7A 4OI0A 1GKUB 1XEWY 2KWIA 2PZFA 1EK0A 1NSFA 4MITA 4MRSA 1HQCA 1G8PA 1YZKA 3NH6A 4GMXA 2WICA 1E2GA 1NN0A 2D4HA 4A15A 5C4GB 2AKYA 3MG9A 1YITB 3GLHE 2MMGA 2VQSA 1II8B 5FBQB 2BPOA 3J81k 1W4RA 2VP2A 1AS3A 3C5HA 1UF9A 1JJ2B 1GAQA 2ZYTX 4LHZA 1G5RA 1RIFA 2QMUA 1HTWA 5EE5B 3U7HB 3WP1B 2ERXA 4OHXA 4HE6A 1PVOA 3KKMA 2BCGY 1R5OA 2MMCA 3AVYA 3BWDD 1F20A 2GVDC 1NKSA 4LC1A 4YC7A 121PA 2ANCA 2F7SA 4ARZA 2P6UA 5KO2A 1H65A 2NG1A 2WZQA 5LBIA 3ZS9A 4RD0A 2RKOA 4R98A 4Q9LA 3RS2A 5JJIA 3FPKA 2G88A 2VH5R 4JVNA 4C0KA 4EFMA 5KNBA 2XX3A 1RRCA 1A8PA 3T1QA 3KX2A 3U7GA 2DERA 4O3MA 2A5DA 1COWD 2TMKA 4B71A 1OGJA 2VLIA 4ZIRA 1DAEA 3AF4A 3RANA 3LRPA 1BMFA 2ZTSA 2YKGA 4A0GA 1SGWA 3GLIE 1KDRA 1E1RA 2J0SA 1IXZA 2AXNA 2F1JA 2D06A 3VNUA 4Q03A 1BH2A 1GUAA 1A1VA 4PQFA 1AZTA 3BB1A 1MR3F 3HWSA 5GJWC 2VNJA 4LHVA 4BLTA 1E1QA 4BGDA 1IN8A 1KI8A 3TIFA 2R6AA 4LCBA 2A2ZA 2HF9A 2OLKA 3X1ZA 2ZR7A 4H9GA 2FGJA 2JLYA 4A92A 3NC1C 4EIWA 2KBFA 2QM8A 4NYJQ 3RRZA 4GDFA 2IYZA 3TSZA 4HE5A 1KKLA 2XTMA 3GLFE 3EPJA 2J0VA 5TR9A 4KO8A 4YLGA 1US8B 4ZPXA 1OH6A 2BMFA 5DGXA 4IVQA 4MYUA 4TLBA 1U2RA 1JR6A 1OKKA 1CTQA 1MOZA 4OQXA 4YMSA 5JI2E 1UFQA 2QORA 1QFYA 1O87A 3KL4A 4TT3A 4XVQA 2RHMA 3ZVNA 2IYXA 2GQFA 4M21A 4CRWB 1HEIA 2ORIA 4IOMA 4DLXA 5HZHA 2B6HA 3EC2A 3IHLA 3OAAD 1OXVA 3FYHA 1AGRA 3I32A 5F9HA 1TUEA 4MYTA 5JEEA 4WAUA 1DE0A 1G3UA 4PO9A 4HDCA 1IY2A 3RRYA 3OE7A 2HYIC 1E94E 3FMFA 2VYFA 3IDQA 1NN3A 4MUAA 3NG1A 5DN6D 2VHQA 2OT3B 2Q9AA 5KDOA 1OGIA 3CMAB 4DT1B 4BPBA 2GJSA 3TUZC 3TNFA 1CRQA 5L3SA 2JEOA 5LD2B 1QG0A 1FL9A 1F60A 4DB2A 3FGNA 1W0KD 1YVDA 1YZLA 3PVSA 1L4UA 3CRMA 3CPWB 2ZRAA 4QOSA 4RZUA 4B73A 3UIEA 1XZPA 3CB4A 2B8TA 4A2WA 4QGFA 5G53C 2OEPA 4OJKA 1D1NA 1SVMA 2RGCA 4IDQA 2E1RA 4HUQB 2RGNC 3OIYA 3QKTA 1XMIA 2HV8A 4MGZR 5FTKA 2X19A 3B1WA 3CF6R 2PJRA 2WSSA 1WMSA 2GAOA 4C0JA 2P65A 1WXQA 4DLYA 3CX6A 3E5HA 1UKYA 3TK1A 2GJAA 1OHHA 3GJ7A 3IPXA 4UNNA 3VR4A 4BFZA 2ZRIA 4EQ6B 4DSNA 3U60B 3K0CA 2VL7A 4UNPA 4NCJA 3RRMA 2XSZA 2PMDA 4NMMA 1FNNA 4P0TA 2WPDD 4MH0R 1XXHB 3KUDA 2C8VA 4G5RA 2IEYA 4G0NA 1QHXA 1E32A 4RVCA 2RH5A 3AUYA 3P4YA 2W6IA 4HZUA 1E2HA 2REOA 1CF4A 4EPRA 1EG7A 4Q4AB 2CRVA 1VECA 2EW1A 5EE9A 3BB3A 2D74A 4IHQA 4LYHA 4OBEA 4N3NA 3TJZA 1HT2E 3HPQA 1SVSA 2WOOA 3CRVA 4YONB 3OZXA 5SZIA 3NBXX 2ZI9A 2GRJA 4QFMA 3L82B 1D9ZA 5LDDC 4MGIR 1GNQA 4PO1A 2Q3MA 2LKCA 2QAGA 4TTRA 2QTFA 3QOFA 3P26A 1N25A 5KYKA 1Q57A 5EXSA 4RD2A 1GRNA 1B2RA 4XWOA 5KNCA 2GWHA 2A3RA 4B47A 1P73A 1Z6GA 3K0EA 3PCRB 4NE2A 5FOXA 3KJHA 1FP6A 3LDAA 3CIOA 5FTJA 2ZRCA 2FA9A 1UJ2A 4CEJA 5KSWB 1WBBA 2J9RA 2WVJA 2RAPA 4B33A 4DC9A 2FF7A 1KK3A 2BM1A 3TR5A 1AK2A 3W5UA 3T1TA 1R0ZA 2JLWA 3W5JA 3F5FA 1KD1D 5J4YA 3K0FB 3I8XA 4MGYR 3KQKA 1G5PA 3VR3A 3AVOA 3GLGA 2OK7A 3WYGA 3BH7A 3CMEB 3O8DA 4LY6A 4Z1MA 5AUNB 1X86B 1DO0A 4FXPA 1MRNA 2FFBA 3KKOA 4KHZA 4QL3A 1BIFA 2F1IA 3B1VA 4EH1A 1OIWA 3OIVA 2AD5A 2O8FB 1A2KC 3IIJA 2IUUA 1CLUA 1H8ED 4M8NE 4DEYA 4GZLA 1S2MA 4JLKA 1JQJC 1SXJE 4NONA 2G0NA 2REBA 4II7A 4XTCS 2OFOA 5FOTA 3VX3A 3CPHA 4F4CA 1J2JA 1G7TA 1LB1B 4KFRA 4MGKR 2DFLA 5E3HA 1ZD8A 1XEXB 2ATVA 1E99A 5HCNA 1VMAA 3Q5DA 3QXJA 4D4MA 2XJ4A 3IEVA 3BH0A 4B44A 1DOAA 1ZBDA 1Z8FA 1QGYA 3CRRA 4HAXA 2ASEA 2VHJA 5G3ZA 4D2IA 4NYMQ 3UG7A 1KK1A 4ZI2A 1ZM9A 1J90A 4W7SA 3WBJA 4ERNA 4U00A 4M9XA 2IUSA 1CIPA 2FE4A 2BJVA 2O8EB 4F38A 2OFWA 3DMDA 4QGAA 3AVUA 1GZSA 4I99A 3QE2A 4WXRA 1W49A 4LJ4A 1GVHA 2WWIA 1YI2B 3V00A 1FW6A 1K8AD 4FMBB 3GCGA 4WZ6A 1TMKA 1BS1A 1IN7A 1S72B 2OCPA 2OG2A 4GZMA 1TF5A 3RRNA 1CU1A 1Q22A 2RGXA 5LD2C 1M34E 4WIAA 3F3YA 3T61A 4BLRA 1J70A 1G1MA 4B32A 2JLVA 2VA8A 3CC4B 3VTKA 3ZH9B 2V7QD 3IO3A 2O8CA 2ZJAA 1NBMA 4XH9B 1LNZA 1A82A 5GJBA 2XZPA 1W4AA 1M7HA 2WJGA 1SVWA 2ZAOA 3FKSD 3ZVRA 2V3CC 3JQRA 1K73D 1VG1A 2JGNA 5UKDA 4BLSA 2OV2A 4B43A 1Z0FA 2DHRA 4TZ0A 1RYHA 1EESA 3GEHA 2BF4A 3ZIAD 3U4QB 2AKAB 2WHXA 5EE3A 3C14C 3EARA 4Q1DA 4H1VA 4DLTA 5KOYA 4TL8A 2IYSA 3B78A 4URYR 3L0PA 4HI0E 4QBIA 4B3FX 1HE1C 1BYUA 2CLCX 1U81A 3PEUA 2ZI6A 5JEDA 2QI9C 2ZI3A 4C7OB 2R44A 2AK2A 3QVUA 4URVR 1V5WA 5E7IA 1Z0IA 3PENA 4QXAA 1DEKA 3CXCB 1OH5A 3W2HA 2PX0A 4C0SA 3ZS8A 4RKEA 2XNDA 2C03A 3KJIA 4QBFA 4XVRA 1ELOA 4RCYA 2H5EA 2WJIA 4R2HA 3VKHA 1D2MA 1G7CA 4FMDF 4Q1FA 4M53A 4BZPA 2CHVA 5C4MA 1NMXA 3AVWA 1NVUQ 5HXBA 2DYKA 4IVPA 4JLVA 1T9HA 4H1UA 4KODA 1E79D 2EFEB 4PAQA 4Q4JA 1CRPA 2H17A 1YHNA 4AKGA 1NRJB 2BMJA 5SZHB 3RS5A 4F4JA 1VG0B 3GJ3A 5FL7D 1NVVQ 5L3QB 5FL3A 2C9OA 2OO7A 5K8TA 2CL7X 1YJ9B 1OJLA 4CIDA 1G8YA 3RC3A 4POAA 2DPXA 3KTAB 4A8JB 1QHSA 4Q5IA 3WNBA 2IHYA 2A9KA 4EPWA 4FCVA 1FNDA 2GCOA 2OFXA 4PC1A 3U3KA 3GLHB 2CLSA 3EZ9A 3THOA 1JJ7A 2VO1A 3I62A 2OTLB 4ZDJA 4Y7CA 1Z3IX 4GSYA 5KNDA 1HV8A 1N2CE 1YRAA 2D2EA 3QKRA 2F43A 4GT1A 3V76A 1J99A 3N2EA 5J40A 5IK2D 2HDNB 3WNDA 1TU3A 4L5BA 4DLZA 2BV3A 2VP5A 4PGOA 2NZ8A 1N6HA 1X1SA 3B1XA 1KHTA 2IEZA 2E87A 2REXB 1JEEA 1DAGA 3AF1A 3TAHA 4P32A 5DH9A 4BLQA 3U44B 3IEUA 3EPHA 3FMPB 1FTSA 1LV7A 1G8GA 2OAQ1 4LZZA 4D26A 2KSQA 2R6CA 2ZIAA 2FH5B 1T3LA 1FUKA 2IBMA 1HH4A 2QG6A 2W0SA 4KBFA 4B6FA 3W8NA 1FUUA 4PZZA 2PZGA 3RSOA 3UATA 2P6NA 2RGNA 3BH6A 1F6BA 1CULC 1KOFA 1JNYA 1W35A 4IDOA 2JJ2A 2WKRA 3IO5A 2YOHA 3CCVB 3GLIB 1NNEA 2VTKA 3A8TA 3V9PA 1RRGA 3DL0A 1GKIA 3B60A 4FINA 3AVTA 4B48A 4W5HA 2W00A 3KJGA 4V0KA 1Q3TA 1U0HC 3W6OA 4O0MA 1NLFA 5CIWA 1X8JA 3K70B 1ODFA 4G01B 2DBYA 4PANA 2QMOA 1GL9B 4US0R 2I1VB 1W36D 1R0XA 1KNQA 4EDHA 2V1UA 4ZO4A 5G40A 4XVUA 3CZPA 3X1DA 4HAWA 3GLFB 4LJ9A 3V4FA 4DCUA 2R9VA 5SZJA 5AJVB 4A0HA 2Q3HA 5D3QA 1E4VA 4YQFA 3I1FA 3OEHD 3P4XA 2PBRA 3B1YA 2JATA 1II8A 3SU8A 1VQ7B 2FWRA 4D80A 3UPUA 1E4YA 4IJMA 5FBRB 3SOPA 4Q1AA 1GDDA 4LYJA 5KSOA 3KKQA 4OHVA 2VF7A 4JBWA 2ZR9A 3KQNA 3QBTA 3THYB 4PC2A 5FUVA 4J0QA 2NO9A 5DISB 3H4MA 3IGFA 4RKFA 2QENA 3EPLA 1QHNA 2BN4A 1R4AA 1G21E 2IYLD 3K70D 4L9SA 4P4SA 1E0KA 1TX4B 1U0LA 1SHZA 3U3OA 4JJKA 1XNJA 4PQRA 3K09A 4DQLA 4DLVA 5DE3A 3OAAA 1T3HA 4C2TA 2ZVQX 4B35A 1E2JA 2A5FA 4QM6A 4ZI3A 4FN5A 1UKZA 2EWWA 3W5VA 4M2LA 4TQAA 1P2VA 4AYTA 2KJQA 2R6GA 1MO4A 4YMTA 3L0IB 3KXLA 3G71B 2I4IA 1P9NA 2XNJA 5JJKA 1Y3AA 3AF2A 3DDCA 2IW3A 2RGDA 1R8SA 1VG9B 2GZDA 2HF8A 3Q3JB 2F3TA 1WDTA 2OXCA 3GFTA 4AKHA 2BMDA 2P5SA 4OK6A 4LYAA 1ZIOA 1OYWA 4NKRA 1W0KA 4DWJA 2XTZA 1J7KA 2GXAA 3FFAA 1KZGB 1A2BA 4XIGS 3OJWA 3CO5A 1JJVA 3ZC3A 1QGAA 5CITA 2FV8A 4TYWA 1T3SA 1US8A 3W6PA 5FFMA 3DHWC 4KLZA 2XITA 4TLDA 3LXXA 3A4MA 3MRSA 4KSCA 1YZTA 2YVUA 4QHSA 3DM5A 4KYIB 821PA 3R20A 2Z4RA 4LUCA 4OKSA 3VQTA 5TMPA 1TEVA 4GOKA 4HYYA 3QF7A 4LGMA 3CCJB 2ZSFA 3CCLB 5E7MA 1DDIA 5KSZA 4L4UA 1ZVQA 4E22A 1P61B 4PHFA 3PFIA 1BO6A 4EPVA 2DEUA 3AKEA 4C0HA 1IXSB 4A8JC 5CDFA 4IDNA 3FMIA 1P72A 4A0RA 2HYDA 3EZ6A 4MRNA 1ZNZA 3ICEA 2NO7A 4ASUA 1NG9A 1GNPA 1R5BA 1YJNB 2OZEA 3MJHA 2FOLA 3ND8A 3QG5A 1VYUA 2VSXA 2Q9BA 4IRUB 4JLOA 4ZV4A 4Q1BA 3ADBA 4URZR 1W36C 2ZI7A 1K8RA 4L15A 4DT1A 1MRSA 2Q21A 1A7JA 3FOZA 1FTNA 2EWVA 3LX8A 4LJ5A 4TL9A 3MD0A 1DTSA 4LHYA 2QEXB 3Q5EA 2BIFA 3CCUB 5FPYA 5IDVA 2J7PA 4PAOA 4UJ3A 1W4CA 3AGQA 2EVWX 2FJUA 3IHWA 4U02A 4F93B 3U3RA 1AIPA 4ON9A 4LBYA 3C5CA 4MKGA 2J0QA 4JVSB 4BFXA 2ZM5A 2YNMA 4M1OA 3QG1A 1G8HA 1KSGA 4KLNA 4YXWD 4ZDKA 2ONKA 3NDPA 3BRWD 2ZYVX 4LX0A 3BFKA 4HUQA 4BE7B 1KJYA 3GJ0A 4NCIA 3OJXA 1P2TA 2OCAA 3AB3A 1XPRA 1X6VA 2LKDA 1Q20A 4DXAA 2RMKA 4LPSA 3SBEA 4ITRC 3RSLA 1L8QA 1QUFA 3AH8A 5IRCD 3ZVMA 2GPJA 2QTZA 4JT4A 4Q4HB 2DR3A 4EQ6A 5GVRA 1E9FA 1ANKA 3CWZA 4DUGD 3K70C 1TPZA 2KE5A 3QPWA 1FNCA 1NG1A 1D5CA 2B7CA 2NO6A 1XXHA 3QENA 2ZXUA 1ZW6A 5CB8A 4TMWA 3SFZA 1W4BA 1ZJ6A 1VQ8B 3JQPA 2JDID 3C15C 3TQCA 1JXOA 4L16A 1MKYA 4Q4AA 2GEDA 3SYKA 2QSZA 3FHOA 1E0JA 1OV4A 5BQ5A 5FTLA 1E2FA 1RFLA 4YMUA 1UKVY 1JPJA 4B3BA 3W3AA 2HT6A 1CEEA 3ZZUA 3K9GA 3PV0A 4HB4A 2XZLA 5GV8A 1OIXA 2W2XA 4YMWA 3A37A 3KJEA 1QVAA 2QP9X 2NO0A 1GSIA 3LBHA 5CLLA 2QROA 2C9YA 4JT2A 1GVNB 4S35A 3G4SB 2WTUA 4MDFA 1U9IC 2VEDA 3SBDA 3BE4A 4WW0A 1K5GA 2H16A 4BFVA 5B64A 2N46A 3PJRA 1H8HD 2EFCB 4QM7A 4HB0A 3AKCA 1TADA 3D6TB 2B21A 1JA0A 1EWRA 4B6EA 2JLRA 1R6BX 1XPUA 1YR9A 2QSYA 5DLQC 3DZ8A 1N6LA 4MUBA 3DOEA 4WZBE 4D0NA 5JJLA 3ZZ0A 3CWQA 1VG8A 4OQNA 4HDQB 2QTLA 4TTQA 2ORWA 2IWRA 3U6KA 3QKSB 1CP2A 1Q86D 1GFIA 3PUVA 4PSAA 1SVIA 2CJWB 2YOGA 4IOJA 3LO5A 4Q02A 1SXJD 4TQ9A 5GJVC 3RS4A 1KJWA 1QHHA 4R71A 5JZVA 4K46A 1I4TD 4YDHB 2UZ3A 4Z8YA 3LLUA 2EFGA 2BBOA 1VHLA 3K0FA 4PHGA 4TLEA 2XTNA 3K1JA 3W8RA 3QF4B 2P0EA 2PCJA 4QBHA 5FOUA 1II9A 1EFTA 2VNHA 1OFHA 5E95A 3CRW1 5CJPA 4A0FA 3GMTA 2IWHA 5JWHA 3BFVA 1FQKA 1DAHA 2BDTA 2O8FA 1XF9A 4P4SB 4V0ME 4DDUA 2WWWA 2HT1A 1MT0A 4G3XA 1IQPA 3CH4B 3TR0A 1ZC3A 3VR1A 1KO1A 3AVQA 1I4LD 4JBXA 4TLAA 5C46F 3FHTA 2WOJA 3NBYC 4IEEA 4OK3A 1JQLB 5AJZA 1HURA 1GAWA 2V7QA 2ZRDA 5JFGA 3CC2B 4LC0A 4TN1A 3ZBTA 1W1WA 1XEXA 1SKQA 2PIAA 1ESMA 4A36A 4LJ6A 1M1KD 1YU9A 1G19A 3B8HA 3ETLA 1JAHA 1MH1A 1XP8A 1XZQA 2BWJA 3UK6A 5F98A 3FKSA 1Q1QA 2Q9CA 4PTLA 3EIQA 1RE0A 2CHGA 2X8AA 4DSTA 3LXRA 1N6NA 1NF3A 3PQCA 3ZLJA 3ZIAA 1FRNA 1YJWB 4JLBA 4NYIQ 2ZRJA 1ESNA 5FUYA 1Q44A 4JKYA 3WXMA 2O8EA 1PUIA 5KTYA 4NTZA 4K81B 2YC4C 2PL3A 4JLDA 4RFSB 3GLGE 1QBKC 3KQHA 2GK6A 3SJZA 2OBNA 2QTHA 5CM9C 3T5GA 3ADCA 1CNFA 3EW9A 5J4VA 3GJ5A 2FPKA 1YR7A 3BORA 3C7KA 4I1UA 1E62A 1E9CA 5A5GA 2BJWA 1UADA 1HY3A 1AS0A 3EIEA 5C1BA 1KTVA 1CNEA 3CPJB 1W87A 4XSGA 1KY3A 1DADA 2BSAA 1M8PA 4PX9A 3K0AB 5KPDA 1ZU5A 4FIDA 1E79A 5K8UA 3PEWA 4RD3A 4N3GA 4CYMA 1Q3HA 1F3OA 4GMDA 5CB6A 4O25A 2QRZA 2DWQA 1Q7YD 4KCGA 3GP8A 5DO9A 2GAAA 2WWGA 1NLZA 3I61A 4M1KA 1QG4A 2V8OA 5A4JA 5D3MB 4CW7A 3U4QA 2RGGA 1G3RA 4HDOB 5FR2A 3NXSA 3SS8A 4B75A 5EXPA 5HR5A 4P33A 3AM1A 3OFND 3R7WB 4ACAA 2A5GA 3RLFA 2NMVA 3X1WA 1DPFA 3RVBA 4TYQA 4C7OA 5IHPA 2QT1A 1JXMA 5KDLA 5JRZA 1FMLA 1SQ5A 1SXJC 4PC6A 1JAIA 2QRNA 1GO2A 2ZSEA 1IXRC 3MWJA 3VR6A 1XEFA 4ZKDA 3DZDA 4URWR 1I2MA 5IK2A 1E9BA 2Z5FA 1OB2A 5DYGA 2EU8A 3D31A 3IPYA 4BLOA 2BKEA 4QJ3A 1KI6B 1UM8A 1HYQA 1KRHA 1BKDR 3E2IA 1XE1A 4TL7A 4AF6A 4KJZA 4JBYA 1GL6A 1T4GA 1SVKA 3NC0C 3KXKA 1NBME 1TQ2A 3DMNA 3GFPA 1F2UB 3QFTA 4TMTA 1WP9A 2ZJ2A 2YWEA 2FG5A 3F0TA 5FPSA 2IL1A 3HP1A 4D82A 4I81A 4JL6A 2YOFA 5L3RA 4A6XA 4C30A 3LVQE 2OK8A 2DETA 4A4DA 2BMWA 1N6IA 3PR1A 5L3QA 1SKYE 2GTPA 1EFRD 4ZDWA 1E9SA 1G5TA 4YAUA 2VHCA 3CF2A 2B8WA 5JWRA 4UJ5A 1LS1A 1NP6A 521PA 1E2PA 1U8YA 3KTAA 4XD7A 1OH8A 4A8JA 1ZD1A 2IYQA 1PUJA 4AURA 1U8ZA 3MMPA 2G6BA 3TE6A 4US2R 2GK7A 2QGNA 4C43A 1TF7A 2PJZA 4MRRA 1OYYA 3GLHA 2GA8A 3IQWA 4TTPA 5LB2A 3SNHA 4EAQA 3A1UA 3I5YA 2ZE7A 4JJZA 4LHWA 1YRBA 3AVPA 3QKUA 2AWOA 1N0WA 4M1SA 1KDOA 4FMDB 1UPTA 1OF1A 2BM0A 1Q12A 5AR1A 2ZRFA 3G5UA 3SJAA 2OLJA 5EJEA 1OPXA 1QDEA 5H70A 2WJHA 5B58C 3EX7C 2GVZC 4M1WA 4P3YA 3AGPA 2G1JA 4IXMA 3S1AB 4G1VA 3U3JA 2BEKA 1Z63A 3I8SA 3KFVA 3U7EB 3U44A 4DDWA 3C41J 4M9QA 1XTQA 3D8BA 3IILA 1MO6A 2LCFA 1XTKA 1RVDA 2QM7A 1EX6A 1XJQA 4LI0A 4AG5A 4US1R 4HB2A 1E2KA 1KY2A 1ZM7A 2V1XA 2CK3D 1KQSB 1KO7A 2QA5A 3HYTA 2PT5A 1XCPA 3H86A 1QHHB 2QL6A 4JSTA 4F92B 1DAIA 1G20E 1G3IA 3BJIC 2HLDD 3E20A 3GLIA 3W2IA 1IHUA 3H2YA 4PAMA 4A2QA 2HMAA 4F4IA 2FMXA 2QUZA 1G291 1ZP6A 4MKHA 3CKLA 3QFCA 3REGA 4PPQA 2O8BB 2W2TA 2WKQA 4X8HA 4X8OA 1D2NA 1XD2B 1VCNA 2CE7A 3FTQA 2PEZA 2XOKD 1VYTA 3JQQA 5EZ6B 2OTJB 3E70C 3K9HA 1L7VC 4BQSA 2C98A 3FWYA 3T34A 1Z5ZA 2A7QA 3MSXA 4W5JA 4O2RA 1T0JB 1C9KA 4GP7A 4LHXA 1K6MA 5K8IA 4IDHA 1HUQA 1XJ0A 2DFTA 1VQ9B 3B2EA 3P32A 3GLFA 3WY9A 3DOFA 1XU4A 1ZNXA 4HLDA 4NCNA 4OI2A 4EUNA 3RS7A 3B85A 2ZAMA 6Q21A 2VP6A 2J3EA 1E9RA 3U61B 1D6JA 1VCOA 3EAQA 4DJTA 2ZRGA 4KBGA 1W44A 2YJTD 1KO8A 3MCAA 2BOVA 2OHFA 1RPZA 4QHTA 3NKVA 4Q01A 3OEED 1IY0A 4WOPA 4DLWA 5FOWA 2H92A 4AG6A 1Z0JA 3EA0A 5JHHB 5EP3A 1UDXA 2QTVB 1DDGA 3T15A 1WB9A 4NBSA 4DCNA 1UBFA 4CEHB 3A1VA 4Y0AA 4B2PA 5HZKA 1GILA 4OI4A 4GBMA 5TARA 4LOAA 3CW2A 2ZU6A 4KV9A 3THYA 3UWOA 1EP2B 1KO5A 2D3WA 2QNRA 2ZRMA 3KXIA 1GP2A 3L8ZA 3LWNA 4GI7A 1TLLA 2WV9A 3G82C 4IVRA 2G0TA 5DI9A 2IHBA 3EWSA 2IS2A 3DO6A 1AKEA 1S3GA 2ATXA 4CZ2A 1E6CA 1KI1A 3U5ZB 4XOIA 1VQMB 2F1RA 1VQ4B 2VYQA 1XMVA 3W90A 4EPXA 4DBLC 3BC1A 2A78A 2HXSA 1TEXA 3NBZC 3REFA 1OFIA 1NN5A 1KI7A 4XWAA 4LJ8A 3ICQB 2YWFA 1W34A 1KSHA 2GCNA 4R9UC 2FZ4A 1G8FA 1Z47A 3X1XA 1XCGB 3QPVA 2CXXA 3MWLA 4YMVA 3PEYA 2FSFA 3IBGA 4UXJA 1QX4A 3FMOB 3SDZA 1FRQA 3AVVA 4HAZA 3VHLB 4B34A 4FK8A 4DSOA 3D7MA 2CL0X 2ZYWX 2VBCA 3T5DA 3LQQA 2ZPTX 3SHWA 3TSWA 4Y9UA 2GETA 1TQ4A 2DFKB 2WWFA 5FPTA 1E1RD 3R9WA 3A4NA 1CS4C 4GRAA 2B7BA 3VKWA 1Z08A 5GVSA 4TYNA 3TBKA 1U90A 2ZQ5A 4PHTA 2WM9B 1E64A 1GRRA 1RZ3A 5BN4A 3KQLA 1QHYA 1E1QD 3V4RA 4EFNA 2WSMA 2WMOB 4LWZA 5GADl 3IQXA 2MSCB 3I5XA 5P21A 1TL7C 2H1LA 3MLEA 3EIHA 1LVGA 4Y9RA 1CQXA 2J1LA 2OESA 2ZS9A 3HR7A 3FFBA 1DARA 5TVKA 3UKDA 4RCZA 4JLAA 2ZUDA 3K8YA 4S2EA 1CR1A 1F2TB 1KMHB 4G5GA 1GNRA 3NBFA 4ESVA 1R7RA 1U8AA 2ORVA 5BN3A 5TB5A 2VPPA 3AQ4A 1E0AA 1RJ9B 2XB2A 1U98A 1XMJA 4BFSA 3NEJA 2QPOA 4IOKA 4TT3D 1QGZA 1KAOA 2WBLC 5HKKD 2JCSA 3LBIA 4OHYA 2WMNB 1M90D 1JB1A 1ZCAA 4OQFA 1AS2A 3LA6A 4LSGA 1G7RA 3VNVA 5H1YA 4RJLA 1XEWX 2GBLC 4TL6A 1YZQA 2MSEB 2CE2X 2IYUA 4MA4A 3DM9B 4QGGA 1W36B 4Q66C 2FFQA 2JJ1D 2EFHB 5AK0A 4NYJR 1UKEA 3NEYA 5AUOB 3GJ4A 3ADKA 3OZUA 1DAFA 2GILA 2ZRBA 4D4LA 2NGRA 1PZNA 4LK2A 3VU9B 4QNMA 1NIPA 1QF9A 2V4ZA 1E2MA 3AP2A 3K9LA 1XMSA 2VP0A 3QEOA 4FW9A 4OL0A 4Q4HA 5CDFE 3QI2A 3CCRB 1JI0A 1Q0UA 4DDVA 1TAGA 3E1YE 1QFZA 1Q21A 2OSBA 4JIMA 4RZ2A 1ZNWA 1AM4D 1ZYUA 3CONA 2YWHA 5DNYB 1A5TA 2WKPA 4MKIA 3T12A 4BRUA 2FSHA 3TMKA 5CK5A 2N42A 4Q19A 1XCMA 5DYIA 3HU1A 4DB4A 3MHPA 2PZEA 5CIQA 1YZNA 1T8TA 2JASA 2ZETA 1OHHD 4NCHA 3QNUA 3AKDA 4JKIA 1N0UA 5FPHA 1TVCA 2IXGA 4ZCLA 1GOTA 2N1BA 2XSZD 3QY0A 3WMEA 4GP6A 2GHIA 4M9ZA 3T1OA 4E09A 2VIIA 3C8UA 3OZVA 3CLVA 4AF7A 1KKMA 1JR3E 3RDPA 4MKFA 2FEMA 1NMYA 3VO2A 1COWA 2DY1A 1GTVA 2IYVA 1KMQA 2X2FA 2YC2C 3FE2A 1N5KA 4Q47A 5ANRB 3N5CA 3SE0A 4L9WA 4PR0A 1N0VC 1KAGA 5DSZA 2IYRA 4HLCA 2F6RA 1P60A 5JI3E 2SHKA 4ZGNB 4JS0A 5H5JA 3R8CA 2D7CA 3DPUA 4HAYA 2YYZA 3QKSA 2JLSA 3L0OA 4BLPA 4GNKA 1XTJA 2CJWA 4D81A 4BECA 4KAXA 3ZD7A 1ZCBA 1Z2AA 2WJJA 3TVDA 4EPTA 1EFCA 5FA6A 4K1XA 1QFJA 3W5IA 3W2GA 4MRPA 4UNRA 4IFBA 2ZROA 3QF4A 1RYFA 1AGPA 3CPEA 3CRZA 4P6VF 2A5YB 4A9AA 1K9MD 3EPKA 1NKTA 2V9PA 1CR4A 2C77A 1YQTA 1G18A 1IY1A 3AF3A 1JALA 1GJRA 2F55A 4YHBA 1X8KA 2F9LA 3QUSA 2IS4A 4KXFB 1ZMXA 1Z0DA 4ACBA 3SN6A 2KB0A 3QFRA 3LW7A 4Q7JB 2R6HA 5AWFC 4V03A 1NDHA 1IONA 5EXXA 2OXRA 1LFDB 1CJMA 1GITA 3ZYCA 4BASA 5K8LA 3MJRA 4OQMA 1CXZA 1T0HB 1P3JA 3PEVA 3THWB 3W34A 4TSFD 1S96A 1GKYA 4Z1MD 2IS1A 3KZ1E 3WMFA 4EJSB 3NTUA 1QHGA 5DN6A 2JLUA 2ZRPA 1CKEA 2WIBA 2JJ8A 2BGIA 2QEQA 3RS3A 4LV6A 1IM2A 5H59A 1HE8B 1VCIA 2GJ8A 2H8KA 2JIZD 2GJ9A 2O52A 3N70A 4JVLA 4EKDA 3CBQA 1VTKA 3RWMB 4Y0VA 4IKEA 1XBTA 1W2HA 4RFSA 5TY0A 1UEIA 5A0FA 3TH5A 1QUEA 2WAYA 1AJEA 1EXMA 1BX0A 1G7SA 3ASYA 4DLSA 2PEYA 4AYWA 4HATA 1ONBA 3R9XA 1C1YA 3TUIC 1SKYB 1UBGA 3EZ2A 3QIAA 3W2FA 4EPYA 3ZDQA 4Q7MB 1W0JD 2IT1A 3ND9A 4RD6A 3U2QA 1FX0A 1E9EA 3QXCA 4LJAA 4QGHA 8OHMA 1G9XA 4V0OA 2I3BA 3CF0A 3K0AA 1JPNA 1ZM4A 1VQLB 1YKSA 1OXSC 1QVFB 2IC5A 2UVQA 3AP3A 3ZZTA 4UQOA 2FEOA 2HJVA 2WPDA 2G9NA 2XXAA 1FDRA 1YHQB 2P67A 2IK8A 3SJCA 3PUYA 3SJBA 4JLJA 2B5OA 5D3MA 1LS6A 3SYLA 5DIFA 1VQ5B 2HCBA 2PLFA 1UBEA 4C9BA 1QZXA 621PA 3OESA 2OUKA 2O8DB 1PLKA 4UXHA 3HR8A 4LDJA 1NBMD 4GOJA 2QPTA 1N5IA 4BPRA 2NQ2C 4NYMR 2MSDB 3MUFA 3NIBA 3R7WA 2HUPA 3GPLA 4P31A 4ILEA 4URUR 1AZSC 4E03A 1QVGB 1UAAA 1U99A 1DELA 3A36A 5KSPA 1Z83A 1AN0A 2ZJZA 3MGCA 3SYNA 4QBGB 4LBVA 1EFUA 3R8FA 1N8RD 2OAP1 4D0LB 1KI6A 3UANA 3HU3A 4R7ZA 3BOSA 2ZSDA 3CCQB 1ZC4A 4CEIB 4Z54A 1PLLA 4IXNA 3TUJC 2JLZA 4UNQA 3B13B 4B3GA 5AJWA 4AC9A 1CJTC 1AMOA 2AFIE 1F2UA 3RABA 4UXIA 4NU0A 3M1IA 5EMNA 2CK3A 1Q1ZA 3PUXA 1SXJB 2G83A 221PA 4YAWA 5LB4A 5LPNA 3TW4A 5FH9A 2ODEA 4OYHA 1IBRA 2Q0HA 5EUMA 2W58A 2XNDD 3HJNA 4Q1CA 4DKXA 3QXSA 3SQXA 4NZYA 2LWIA 4D4JA 1WF3A 3A1SA 1XD8A 1E2IA 2RC6A 2CVHA 2H7VA 3O8CA 1XTSA 1ZRHA 3UXMA 1T6NA 2PH1A 2VSFA 1H8EA 3BBPA 4BEBA 1OB5A 3U3MA 3FJOA 4KFUA 3UMFA 1YR8A 2JAQA 4N0DA 2VZLA 3QJYA 2FSGA 4HLUC 4G1UC 4C0QC 5ELXA 4PPFA 1GWNA 5DHAA 3CCMB 2QN6A 3LBNA 5H68A 3K9NA 1J9ZA 5DI3B 3S1AA 3ZBUA 2Y8EA 4AKEA 2RB4A 4HSEA 2JLQA 2VRWA 4DQKA 1FQJA 2GBLA 3B9PA 4Q00A 5J4LA 5JWOA 3TGPA 2AXPA 4DIEA 2ZSBA 2RC5A 3W6NA 1X1RA 3JZAA 2CMKA 4DIDA 4Q1EA 1YJ5A 2QY9A 3Q72A 1KSJA 4XSHA 2GF0A 3CD6B 3AVXA 4HEJA 4Z8XA 1E9DA 5FBVB 4PZLA 5BW8A 1ETUA 4WBSA 4GL2A 2QP4A 1VQPB 1SVLA 3FHCB 4PPGA 4RD1A 4DCSA 1OE0A 1XFAA 3ECCA 3RYTC 4ESHA 4PSKA 2O8BA 4EJSC 1DBSA 2CCGA 1XD2A 3WRYC 5CYPA 1KDTA 4BZXA 2J0UB 1Q81D 2ZSAA 1V43A 1I2DA 1KI9A 3LAWA 1NVVR 3VR5A 3B6EA 1Z22A 4RSGA 3QXXA 1IN4A 3MWKA 1P9RA 3AV0B 4JYCA 3TQFA 3O47A 1XX6A 2DCUA 3WRXC 2R6DA 3L2OB 4G1BA 2J7KA 2Z43A 4BFUA 1Z06A 2JJ2D 2ZRHA 1I7PA 2UZIR 1KK0A 2DB3A 2QE7D 1Z6XA 4DDTA 3QPUA 1KK2A 3TW8B 4JMPA 4BZQA 4LRWA 1MABB 2FFAA 1NVWQ 1KC8D 2ONJA 2CCKA 3LY5A 4BUJA 5E4FA 3EZ7A 3LX5A 2CLDX 3EC1A 5FTMA 1RC8A 4CT5A 3DKVA 3GD7A 1ZM3A 2J45A 4DCVA 4IW3B 3QFSA 1GL7A 3BERA 4JSYA 2P5TB 4CEHA 1KYIA 2ZJYA 3JVUA 2J41A 5J4HA 1M2OB 1CJKC 2QBYB 3THXB 1KO4A 4YAOA 1W2GA 4RZXA 5H8WA 5HTKA 5EXTA 1Q1EA 2O0JA 4Q9IA 1KDPA 3EASA 3P27A 5KPJA 2R2AA 2VNIA 4E5UA 4QHYA 2RCNA 2XAUA 4WVFA 1E2QA 2EFDB 1Q82D 2GJKA 2ODWA 5B2ZA 1EP1B 1FX0B 1P5ZB 1LF0A 2PCLA 2QQ0A 2Z4SA 4AYXA 2EQBA 4FD2A 3ASZA 1OFUX 3W2EA 2D62A 1GIAA 1S1MA 1D8TA 1SVOA 2BVNA 4NH0A 2C9CA 4I1VA 2XJ9A 2G1KA 5BN5A 1C4OA 4Q48A 2ZUCA 2XXAB 1P2UA 5FPKA 3B5JA 2D2FA 4QRHA 4C0AC 4HAUA 4NPHA 3X1YA 1E2EA 1S9DA 1WA5A 5FL7A 2BBWA 3VX4A 1N6PA 5HKKA 3IKJA 2FNAA 4LBWA 2ZUBA 1RRFA 4LYFA 2H57A 2W6JD 1U94A 2HCJB 2KBEA 4D25A 1N5LA 1NY5A 1ZUHA 4LBZA 2NZJA 4JVMA 1FNMA 1R5NA 2QDXA 5SZKB 4AKIA 2CEAA 3L43A 4B2LA 1S8FA 4C4PA 4DHEA 1VQOB 2QQEA 1G3MA 2JJ1A 4TYPA 4B3XA 1ZUIA 1OXTA 2CL6X 3FPAA 5GJCA 4JLMA 4QNRA 2X2EA 5FR1A 1IAQA 5EE0A 1GM5A 3SQWA 3GEIA 1W46A 4QJ4A 2AD1A 4TMKA 2IUTA 1VQKB 3LVRE 5KHOC 4KVAA 1NY6A 1PJRA 1F2TA 2FU5C 1IJEA 1KMHA 3KKNA 2IA5A 3ZJYA 5THXA 4BFWA 3NVAA 721PA 4FMCF 2EYUA 4G5SA 4ZKEA 2XZOA 1RJ9A 1NSTA 1NLYA 1OH7A 2DWPA 3HPRA 4ZGQB 4F91B 1J8MF 2OBLA 3AKYA 4KVGA 3BIFA 1OIVA 5JSZB 3UMRA 1E2LA 1OFTA 2JLXA 2QU8A 2VP4A 3AF0A 1LY1A 3SFVA 1E9AA 4NL4H 3UMSA 3AEZA 3ZQJA 1SM4A 3MAAC 5IT5A 1KGDA 5CJ2A 5CYOA 1WBDA 3NDBB 5AJYA 4ASUD 5JECA 3FDIA 3DEFA 2BMEA 3CR8A 3EZFA 3RC8A 3NH9A 1BX1A 4G5QA 1XD9A 2BBSA 2IYWA 1CBUA 1F5NA 4CDGA 3PIRA 2ZS7A 5G41A 4XWKA 2PLRA 5C2JB 5EZ5A 3EG5A 3G0HA 4KITB 5KUTA 4JL5A 3KB2A 2CBZA 1EWYA 1VIAA 2J46A 3R9IA 1L2TA 3VU9A 421PA 2J7PD 3Q9LA 2P2LA 2R8RA 4PHHA 3A4LA 1KI2A 2BCJQ 5EP1A 2PT7A 2Q6TA 3C4JA 3OEHA 4V0MA 1VYVA 1DAMA 2CNDA 2H18A 4MYCA 1J8YF 1ZUNB 1T91A 1S4QA 1YZUA 3LNCA 3PUWA 3VAAA 3WHKA 1VKJA 1DVRA 2ZRKA 1JR3D 1LTQA 1R0YA 2KI5A 1A4RA 4P4UA 4M1YA 5B57C 1XB2A 1DG3A 1DAKA 3ZVLA 3OIWA 3KDSE 5EUQB 1G4UR 4PPNA 2P6RA 2AWNA 1E3MA 3U7FB 4PXAA 2GZAA 4Q9KA 2E9SA 3LH5A 3OF5A 4F7DA 4TYYA 3G6EB 4OK5A 2QP3A 3JVVA 2XGJA 2AFHE 5G3YA 2R6FA 3UWKA 5KDDA 2ZYUX 3EXAA 4IFEA 4R2IA 5F9FA 2CNWD 3VO1A 3GJXC 2RGAA 4PFSA 5FUXA 1JA1A 5HPYB 3K09C 3CCEB 4QC2A 4FI3C 2CHQA 1BYIA 1W5TA 2AL7A 3M0EA 4PZYA 2OILA 3GJ6A 3MWYW 3AUXA 3RHFA 4HLQB 2V55B 3M4YA 4FWTA 3FKQA 1EX7A 4TWZA 4C2UA 3QQ5A 4TSFA 5JRJA 1ZINA 5CM8B 4HZIA 1Z6AA 3W9YA 4ARZB 5AUPB 4M1MA 4WXPA 1DG1G 1NJFA 1E2DA 1Z2CA 1NIJA 4QKQA 4V02A 4IEIA 4U5XA 1HT1E 1XTRA 2ZEJA 3AP1A 3W5HA 4PQYA 1TU4A 2NPFA 1U9IA 2ZS8A 4FCTA 1YIJB 2JIZA 3CNOA 5TDHA 4ZIRB 2ZJOA 1X3SA 3CNNA 4N1AA 3H1TA 1S9HA 4HLUA 3EWAA 3N2IA 4GPTA 5J4KA 3QSYA 1AKYA 5CK4A 1G41A 2BHRA 1NVXQ 3WYFA 1E63A 1S3SA 2FGKA 4B74A 2V54A 2AK3A 5AUQA 3P20A 4B3CA 3LW8A 1M6NA 2IYTA 3I72A 2F3RA 3CC7B 1OW3B 3LQRA 3T06B 2GXUA 4AWXA 3KQUA 4K8OA 1W0JA 2OM2A 1OXUA 3SI7A 3VR2A 5EP2A 2R65A 4CVNA 1ZNYA 2GF9A 1RKBA 3THWA 1FMJA 1W47A 2GXQA 4DEXA 4Q21A 4EJSA 1EWQA 2O0KA 5M04A 3RAPR 2ODNA 1KI3A 3Q7PA 1CJVC 4URXR 2AHOA 2X1VA 3X2SA 3E1SA 5FI1B 2L0XA 2NOAA 4N0EA 2O0HA 3NWJA 2GCPA 2ZI4A 1MO3A 2VSOA 3DKPA 1W7AA 1BMFD 4AIIA 2Q3FA 1Q1BA 4P4TA 2YWGA 4QJ5A 3BS4A 3CUEF 4KFTA
chains in the Genus database with same CATH superfamily
5LBTA 4B4DA 2EYQA 4OMFG 1D6MA 4OF4A 1Y5LA 3OZEA 4WN9B 3U4DA 1FDWA 1OXXK 2R62A 5TMBA 4ARVA 5JBQA 1XZGA 2WUWE 3MTEA 4J3NA 4K86A 4AKTA 2JLBA 3GNQA 5JO0A 4WJLA 4KN8A 1XKQA 2Z2IA 4ZQHA 1XZDA 1DLJA 2WABA 3DVAA 3PHGA 4YUWA 5CA1F 3KSAC 1NI3A 3ZGZA 1RNLA 3N0XA 2GBIA 3KSMA 1SD1A 2WTBA 1AO3A 1EFDN 1HSOA 1K92A 3K6RA 3M4NA 3M4XA 4L3WA 4DUGA 3QVTA 2J4FA 3HP7A 1ECJA 2RGBA 4M7WA 5C1OA 3EA5A 1P6UA 1VHTA 4UBMA 2YINC 1OKKD 1R50A 1CDOA 4DIOA 1PV4A 3GMIA 3PGLA 2GZHA 3ORFA 4J3FA 3WQSB 1GA4A 1DIRA 3C6KA 4N0PA 1QQ7A 1P0CA 2G3YA 2JDIA 2C3MA 1K5DA 4G84A 4HAVA 1WY7A 2R84A 1D2EA 4O63O 2XMSA 5CU7A 3U48A 1Y0YA 2V9CA 2PA0A 3IMGA 3MWEB 4K9SA 2GZ1A 2NM0A 4MR7B 4WFIA 3WL6A 3ONNA 2CJXA 4A6PA 5KWEA 1Q84A 2OTCA 2D4AA 4H4EA 1G64A 4L57A 4B7UA 5AK0A 4C07A 3T3OA 1FP7A 2E6KA 2HU7A 4P3NA 2OQ2A 2RJOA 3WWYA 1JKJB 4I5IA 3KV3O 2X6WA 1N6RA 3OE7D 4V0NA 3MPUA 4CIBA 5KSYA 1JHZA 1GG2A 1H6AA 3HKBB 1G16A 2R00C 4L4YA 4EELA 2ZIZA 1KI4A 3BXZA 2WU4A 3IA7A 3L0SA 4HHEA 1XRJA 1SOAA 2QZSA 4QYIA 3TCKA 3KTDA 2JFNA 2FLWA 2W7TA 1MC8A 1H8HA 4H7EA 2RHJA 3IBYA 2X0IA 2CUNA 4QUEA 2ABWA 2I65A 2WJVA 2PX4A 4GKJB 2PSFA 1E77A 4Q3LA 5AM2A 4H77A 2CDNA 3ZQ6A 3MAGA 2IYYA 1QH9A 4DLUA 4FR5A 2BKUA 4JYBA 4DK1A 2NIPA 1F51E 3NAQA 1GTJ1 4ZEXA 4B7XA 1ODKA 5C80A 5EERA 3Q39A 2G1UA 2K6GA 5FUWA 1RBMA 1ZBQA 5LA6A 4A2PA 2WRZA 3FDZB 2G28A 2Y9PB 3Q2IA 2YHSA 4UNSA 1Y4AE 4EW3A 3EW7A 3WAJA 2VRCD 1RM3A 1W29A 3LLMA 2QAGB 4JQZA 4F4UA 4MHTA 1SXJA 4BNGA 4B3DA 2Y1EA 3WLEA 1J23A 3SZRA 3WV4A 2A9OA 1RJGA 2WSSD 4HGNA 3EVCA 1GR1A 4LJYA 3VZDA 2ARKA 1QGUA 4WUVA 4CN9A 5A2GA 3SJPA 2P2YA 1KR2A 1E2NA 4NS1A 3ZHZA 1ZOSA 3AOGA 4JZKA 5HOEA 2FX2A 1W52X 3V8VA 2QMHA 1PTKA 3V46A 1FYFA 2PYZA 1TF2A 2PX5A 4I1OA 3GA0A 3WMGA 4INPA 5E3IA 2HBYA 1G4AE 2PV7A 4CEJB 3HHPA 5REQB 1KIMA 2HR1A 3M6AA 3N86A 4UU0A 1E96A 4BMDA 1GGNA 1EK2A 4BCCA 4BX3A 5L9AA 1H0KA 2ZCVA 3M1AA 4HB3A 4E32A 5DPMA 1DBIA 1XZFA 4LNUA 3BK7A 2HWUA 4ZXFA 2GTIA 2W6ID 5IAEA 3OX2A 1D2RA 1QTRA 3GGDA 2XNHA 4F5WA 4PO8A 4G89A 4Z9FA 1V9SA 2OCBA 1DWOA 2B5VA 4X06A 2EBWA 4AUNA 3PI6A 3OD1A 3SICE 1MJHA 4E5NA 5ESWA 2PXHA 1KYWA 1T8SA 5A02A 3F74A 1U7WA 4MIEA 4TYMA 4UDXX 5IC5A 4YAFA 3RUEA 3PSHA 1NI5A 2WYHA 3BJZA 3IUYA 1E1KA 3IQIX 3QEJA 3JARB 3L0ZA 1RZVA 1BZYA 2H2HA 1AUOA 1M1YE 1IN5A 3D26A 4AY5A 3QU7A 2YZ2A 4LHEA 3A8KA 4D5EA 1M34A 1TQ6A 1OX4B 2C4TA 2CXNA 1XXHE 3MN1A 4JWKA 5ITZA 2ODBA 4OQ4A 3CUWA 5BWBA 3AEKB 2HWWA 1FTGA 1FFEA 2GKGA 1UK8A 3NFRA 4YEJA 3MFYA 5FOSA 1NJID 1XE3A 3CX8A 2C2BA 4DC1A 5LOVB 1N8TA 1RLIA 2LCQA 3JV7A 4JYMA 4W8HA 4GEGA 2X77A 2QX6A 2VUIB 4KLCA 4L8GA 4ZYUA 3CCBA 2LDBA 2ZSJA 1QO9A 2JFUA 3CLRC 3LWBA 5I7OA 5J2UF 5DHFA 2CLEB 3C3BA 1JG1A 3DZBA 3FI9A 2XGMA 3OIDA 4I4LA 5HZMA 2OZLB 5F7JA 1Z28A 3TCNA 6ADHA 3RO7A 3EK2A 1CEQA 2GKSA 4E5VA 4ZAGA 2OO5A 3RKUA 1Z29A 3RS0A 3NVMB 4B09A 2OAEA 5CBKA 4KAJA 4TZ6A 2OOKA 3VR3D 3MRXA 4EY4A 1U0NA 1NQAO 4CG0A 5IKPA 4RAOA 5B7PA 4AUKA 2YWBA 3TW8A 4D6XA 1ZI8A 3UHPA 1Z07A 2GLXA 2H54A 3LVBA 3QXHA 4YMGA 1NFFA 5GONA 2NUTB 4RFLA 5JS6A 1Z12A 2V97A 1N9KA 1EM8A 3WYAA 1JDJA 3HDTA 3V6LA 3JQ6A 1PW5A 3A1CA 4JASB 1RAAA 1IWBB 4DXHA 5FBLB 4RDHA 1C0LA 3CZ5A 4R9SA 1UJ6A 1Z6TA 3X1JA 3C16C 3IUBA 3CT6A 3I55B 2WZCA 3RAGA 3HBAA 3UO8B 2OBMA 2W6JA 3ZHTA 2OM6A 3BD7A 3T3DA 3AL0C 2WT4A 2GM3A 3DE1X 2O8CB 1I3NA 1MO5A 2NPOA 5ECWA 2O0MA 1VSTA 4NEHB 3SM9A 3N53A 3UCEA 5ENZA 4IDPA 4BO4A 3ZWXA 1JL3A 1HZZC 2J4DA 3G9UA 4JVOA 2WM8A 5LU9A 5A9SB 4HVLA 4H1TA 5FBHA 4TXJA 3UJHA 2HGZA 3PNKA 3HNOA 5B58T 2PU7A 1SPBS 3CVOA 3OT1B 1Z0AA 1SJ9A 4II3A 2QHXA 3AJEA 3JASA 3MWGA 3RK4A 1M6WA 2WQ7A 4NAUA 1F3LA 3I3SR 2IELA 5TQ0B 1YNSA 3KQTA 4WECA 4F72A 2VH2A 1JEQB 3SJ7A 1D07A 4MVJM 3COWA 4OHOA 3CNHA 3KDPA 1GXSB 1H2ZA 5ICEA 2HNAA 3I73A 1JB9A 5JARA 1JSLA 1UXIA 2Y2UA 1NQVA 1SULA 4ZZ0A 5AVUA 3FJ1A 3LWDA 1BXRB 2ID8A 4NOKA 1R10A 3TAUA 2AZ4A 4J03A 1XTIA 5CCXA 2NZYA 3I12A 3SKVA 1AA9A 3HEAA 3H5TA 1IHDA 1WXXA 3GEBA 3RRJA 1KRXA 5HM6A 4R05A 2GDJA 3IAM6 1JWLA 4YP5A 1Q83A 4O2AB 2WHPA 2HU8A 3DYIA 5I7UA 2W2LA 4TRNA 4RENA 3TMAA 5K3SA 3BY2A 2EF0A 5L8VA 2K5UA 4I3GA 1T9AA 2DUUA 3K1AA 3FVQA 2C7BA 1T5EA 3IB3A 4LEIA 3OOCA 5IF9A 2BD0A 1EVJA 4JEIA 3WBKA 1RWPA 1LPPA 3L9XA 4YPFA 4CKYA 4EY7A 3RV3A 3KYDB 5HQ3B 3UHAA 4FFDA 2WWXA 1PJCA 1VMKA 5FF9A 1V5EA 2RG1A 2QY6A 2XUQA 3VDMA 3WL7A 3W79A 4COKA 3KZMA 3C3AA 1L4YA 2ZREA 3H0KA 3GFOA 5DM4A 1U3WA 2Z6VA 4EUFA 3B9RA 1DKPA 5JSUA 2YXEA 2MWMA 2ZR0A 2XUIA 1GPAA 1PWEA 1FMFA 3B8EA 2QVZX 4BO2A 2FPLA 1P4SA 1VLZA 2FHPA 3G9ZA 3QNMA 4FKMA 3ONYA 2KX7A 4JB3A 5DTIA 3HUEA 3AB8A 1OXMA 3LFUA 1GPJA 3OZIA 3FRIA 2OPHA 2ZBGA 3O8RA 4XM2A 1UBSB 3I4FA 1QYIA 2ZE8A 3K1YA 3M6LA 1IB0A 4B87A 5LMNB 2E5WA 5FI5A 3IIMA 1JR3A 2ZL7A 3R7AA 1PAUA 1Y63A 2GD2A 3QKRB 2W6NA 4Q4LA 4S0ZA 2FSIA 5JJCA 4BP8A 1Z4JA 1PJ6A 3A2NA 3M3DA 2UYGA 5A3SA 1QHIA 1I9GA 1OROA 1UBJS 2JHCA 3DLIA 4GSKA 2RGEA 4YXFA 3LK7A 3ZDYB 4CL2A 4RVHA 1PEYA 4K2AA 4X8LA 3ZXYA 3HVIA 2P2ZA 5CA0B 4NZNA 1MGPA 2PLWA 1K7EB 2X8JA 1CS0B 1YXMA 3EF3A 4NARA 2GEUA 4WLUA 4C1BA 1T8UA 3QEMB 4DAOA 5AW1A 2WYVA 5FOVA 1BGWA 1R66A 1TK3A 1MV5A 2Z1NA 4TS9A 2C5LA 3G6WA 3MT9A 4FYPA 1X7ZB 2J6BA 5BQXA 1YRYE 1KJ8A 4RGYA 4B3JA 4NVRA 2PZKA 3CEPB 4IZHA 1L4GA 2OXFA 5DBIA 1S1CA 3HVUA 4DRXA 5DX8A 4JL8A 2H0RA 1TA9A 4X8MA 4EJ6A 1FF9A 4KKXB 2W71A 2GBPA 4BRSA 1X14A 4KKSA 1U63A 3ZWDA 3UB2A 5I3ZA 2ECPA 5FKJA 4G0PA 1AGYA 3BT7A 1I80A 2WYWA 3Q7QA 4OEHA 2VHTA 3HU2A 3BFXA 2I7TA 1HRDA 5BO5A 2GO7A 4L5IA 2C1XA 5A88A 2IOHA 3ZD9A 2HWXA 1M6HA 3B7GA 5IH3A 3C3KA 3D81A 5KNDD 1HDIA 1ZU4A 2W6OA 3GO4A 2IRWA 5JS7A 3ZGXA 1P7CA 3T51B 3W5AA 1QR6A 1V48A 1IG0A 5DCUA 3DOJA 1Y6ZA 1PK9A 3KOUA 3AFGA 4KAFA 1N7HA 2KWIA 4BKPA 4MV9A 1EK0A 3S7ZA 4AO8A 4PE5B 1E2GA 3IP7A 1UK6A 3HJCA 2Z9DA 2IDMA 2Q0SA 4RJTA 2JVJA 1CRZA 3ROKA 3W7VA 2AKEA 1EVIA 4F56A 2VQSA 5HKAA 1II8B 5FBQB 2PZAA 2VP2A 2AEMA 3R2JA 3C5HA 4UVIA 5U1PA 2NXNA 4B9EA 2CN1A 1JJ2B 1GAQA 4LHZA 4NV0A 1WEHA 2PTHA 1H4TA 3PD7A 4MZXA 2NVUA 2QMUA 1IWPB 1LBTA 1WPQA 2V4MA 4TTSA 3EDQA 5EE5B 1LWNA 2W6ZA 4OHXA 4QBTA 1PVOA 1R5OA 5AVKA 2C9ZA 2EG5A 4K28A 1QPBA 1YR3A 3F5SA 2Z3WA 3BQJA 4QTTB 1J2RA 3LUDA 4O29A 3VNQA 1SB9A 5CXUA 4AMZA 1C5KA 2ZSIA 1GARA 2UUAB 4ARZA 3Q12A 2D0DA 2NG1A 2RKOA 3AG5A 4R98A 3KQSA 3GCXA 1UL1X 2GD0A 2RG7A 3FPKA 3RS2A 1O94C 4JCCA 2WHRA 1UBNA 5JCJD 2Q07A 5DBHX 3O03A 1N1DA 4OH7A 4N7RA 4O3MA 4PLGA 1TJYA 1OGJA 3DULA 4ZIRA 1RI2A 3FSGD 2P9HA 3AF4A 3RANA 2YKGA 4JN6B 1KDRA 4D57A 1E1RA 5C7OO 1IATA 1S7GA 2Z58A 3RBZA 3VV3A 3AM4A 2PT9A 1IXZA 2AXNA 3CUUA 3JAWB 4LWPA 4G0VA 4Q03A 1BH2A 2ID7A 2IU0A 1A1VA 3DOCA 3DLHA 2R8PA 4AZTA 1Z5UA 2WHYA 3HKDA 1O8CA 2Q8QA 1FQOA 3Q10A 4M0MA 1IN8A 4BGDA 2R6AA 4LCBA 4ED9A 2CMHA 4G0QA 3X1ZA 2JLYA 2UU9B 1K68A 3A9SA 1U5CA 2KBFA 4NYJQ 4Q15A 1F4PA 1N2JA 3PU6A 1NQUA 2BCEA 5CPBA 4ZQBA 2Z1MA 3T9DA 3EPJA 4WEOA 4KO8A 3HUDA 4OQZA 4YLGA 5FWYA 1X1QA 2B69A 5IU6A 2IZOA 3K3PA 3WKAA 1W96A 2E0IA 1OTHA 2Q2VA 1X7XA 3HI6A 4PWZA 7ABPA 5ITVA 1OKKA 2GCGA 2ZR8A 2AG1A 4E5DA 4OQXA 1G8KA 2G7ZA 1UFQA 4YMSA 1USGA 3D3WB 1O87A 3NHKA 4NOJA 2VAWA 2PO5A 3L7JA 1ZCFA 4OJYA 2GQFA 1NRXA 3WYDA 4UOQA 3TF5A 2B6HA 3EC2A 2MT9A 3FDXA 3HDGA 3FYHA 3IHLA 3K2QA 1K66A 5BOVA 2CNLA 4OIMA 2XBMA 1U2DA 4EG8A 4HNUA 4GBGA 2HA6A 2NV4A 3F3KA 3TPFA 4LJRA 4RQTA 1CW2B 3QM1A 1ONNA 1YS1X 4PO9A 4BQPA 3VI4B 3OE7A 1CQPA 4URFA 3OCWA 3O84A 2X6YA 4M36A 1EVEA 5FNVB 2OT3B 5KDOA 1XL1A 5J35A 1A76A 2XXBA 3LKVA 3PL1A 4O0LA 5GZ6A 3HUTA 1CRQA 2X9LA 3RLIA 3KUUA 2CF5A 2I9PA 1F60A 4DB2A 2WMYA 2J32A 3RUCA 3SVTA 4MUYA 1M10A 3HVRA 1QS0A 2O3JA 2YMMA 3I01A 4RADA 3CPWB 4JOSA 4ZYVA 2IEGA 3MCZA 1SUPA 1YL5A 3DXFA 4UMFA 2EFYA 1N2HA 4B73A 4FOSA 3PGXA 1XZPA 3UIEA 3CB4A 5C32A 2B8TA 2OHXA 4A2WA 1IHOA 3HCBA 4OJKA 3WWPA 2BTEA 1ULZA 1YD7A 4G97A 5EWMA 5GINE 2PQMA 2RJ3A 2W4QA 2FVYA 4P4GA 4A5OA 3LKDA 3I5AA 3DLBA 2P6MA 2X19A 3B1WA 3MIIA 4UFOA 2WSSA 4XFJA 3EBLA 2X4GA 2H1IA 2VSNA 3C3MA 3HLYA 4XRRA 2UYHA 3UMVA 2EXXA 4MPTA 3CX6A 4YRKA 1GA1A 1R6AA 1XMOB 3TK1A 2FSVC 3PCTA 1OHHA 3V8QA 3IPXA 1EGVB 2E55A 4JP5A 4MQ4A 4WWHA 3JZFA 1L9XA 5IVPA 4GS5A 4K8RB 3U60B 4CKWB 5LC1A 2J3JA 1WZNA 2ZBEA 3N8GA 1BHSA 2XSZA 4TM8A 2AZXA 2Q3DA 1FNNA 2ZTNA 1KWGA 1ESEA 3WZMA 3DW3X 2Q4RA 2Q0XA 2BZ1A 4HGPA 2PKWA 3UJCA 3JX9A 4ETNA 2RH5A 3AUYA 1BE8A 5JCOC 2BKVA 2W6IA 1WKBA 4FOOA 4C7XA 2GPWA 2DTEA 3IKVA 4Z9YA 3IVGA 1EG7A 4MUEA 4EZBA 3AQIA 4EDFA 1Q74A 2AOTB 3NALA 3I05A 4GXTA 2COKA 3L92A 4OBEA 4ZZ2A 3TJZA 2QLNA 1CEXA 1HT2E 2J9FB 4JBLA 1SVSA 3RU2A 5HQTA 1YRLA 5JXGA 3NBXX 4UM9D 2NACA 4K6FA 4QFMA 1Z36A 3KAQA 3W06A 1X3LA 5LIRA 5L7YA 4KP7A 1XK6A 2Q3MA 2LKCA 4MVYA 4E2ZA 3BZUA 3MWDB 3LQEA 3L8FA 3ESYA 3QOFA 3CUTA 4ZT5A 3P26A 1L5KA 5CIYA 5HCNA 5EXSA 5BQPA 3KTOA 3AIOA 3BMOB 4LYEA 4MEJA 5B53A 5A04A 3I9FA 4RTOA 1YGPA 3PCRB 1EYZA 1KP3A 1CF4A 5TGZA 3FF1A 2VAVA 4EHHA 1N5OX 3GLQA 1VE1A 1BGVA 2ZRCA 3MJSA 3K30A 1AKUA 1UJ2A 4FYYA 4JMLA 5I9MA 4B4VA 2AEFA 4BVLA 5KSWB 3L1KA 4RIFA 2CNKA 5CTAA 2QTBA 2WVJA 5H83A 2AJTA 1QB8A 4B33A 2FF7A 4TUYF 4DC9A 4DLBA 1YQGA 4G9GA 1AK2A 1NHGA 3KT6A 4AW9A 2BTQA 2WB4A 5EWLB 5JNWA 3NUZA 1NBWB 1R0ZA 5ICMA 5IX8A 1J00A 2HV9A 5F7ZA 3I6YA 4GC9A 3UKJA 1KD1D 2D0OB 3I8XA 1ILWA 2BEVB 2WUVA 4Q16A 3VR3A 3GLGA 3CXUA 2P91A 4DM7A 1GADO 2X13A 4Z1MA 3V8NA 4I7EA 4FXPA 4JX9A 2FFBA 3KKOA 3R24A 2GAJA 3GFQA 1M1NA 3AFNA 4RPBA 1M6YA 2F1IA 4M1EA 4QL3A 1OIWA 5D3ZA 3AUTA 2CGEA 3HO8A 3ED5A 4ZYZA 3UTDA 3RFFA 2RE8A 1RWOA 3RAEC 2WZPP 2QSJA 1OH6A 1OILA 1LK5A 1VFNA 1UXHA 3QZUA 4NBNA 2G0NA 3C48A 2HJ9A 1DIOB 4E5PA 4HFRA 3AONB 5FOTA 3VX3A 4ENUA 2A5LA 4F4CA 1KVQA 1G7TA 4GXNA 1DRUA 1PJBA 1X9GA 1ADYA 1NJ8A 1TYZA 3C5EA 1XEXB 5J1TB 1K5HA 2ZTUA 1E99A 3DMHA 4BP3A 3JQ8B 1PSZA 2DT8A 2DJIA 3L1VA 4KDRA 2COUA 3BHJA 4R01A 5D3KA 5DCYA 3SYRA 2FCAA 4GM1A 3UHFA 1QH1B 4B44A 1N2IA 1YDHA 2X3YA 3NTRA 3IEVA 4KQXA 5D1HA 1K5PA 1KEPA 2VHJA 1VHOA 4I50B 1RXYA 5BSYA 1LNQA 3E84A 1UJNA 4HWSA 4L51A 1KK1A 4I8XA 4KDCA 1N92A 4DXDA 5FUQA 2V5AA 3TLYA 1Q91A 1V45E 4HDRA 2WA2A 5LN1A 1CIPA 3DVRX 3P71T 4WBXC 2V7EA 2QUAA 5EHGA 2O8EB 1SHUX 4PSDA 5HEKA 3P2IA 2VDQB 4DA0A 3DMDA 4EF4A 4JK3A 3PTLA 4OOXA 4I99A 3QE2A 4WXRA 3MBKA 1W49A 4YJ3A 1XLVA 4LJ4A 3A6JA 3G7NA 4RELA 3MWFA 1FW6A 2W43A 3JQGB 1K8AD 1EG2A 2JC3A 2QD1A 3GCGA 3JATA 3KQPA 4K9DA 1RLUA 3BULA 1M0SA 2PTGA 3D7LA 4R8LA 1S72B 2OCPA 3DUFB 2JI9A 5LD2C 3C3CA 1FYWA 3KP1A 2Y4NA 3UYLA 1K6XA 4V0RA 3SY8A 2JLVA 2VA8A 2HPVA 1DU4A 2OC9A 4UM5A 2PMFA 5JD5A 5DP1A 2V7QD 4UOEA 3G8CA 4W7IA 3SHVA 3IO3A 4EKGA 2YNMC 4OB8A 3EVTA 3DMPA 1NPTO 4HC4A 5KIAA 1FLNA 3PPIA 4L72A 1FA9A 1M7HA 2I78A 3KZCA 1K9VF 1QHFA 2FW6A 3K72B 3OMWA 4BX8A 5EN4A 2Q8NA 3TFOA 1HOTA 3L7OA 2CUZA 2DHRA 4OUKX 4F0JA 4L1KA 1M6VA 4DZTA 2AKAB 3H04A 5JZMA 1MRZA 4Y2JA 1XCOA 4Q1DA 2YCBA 5KOYA 4B17A 3B36A 2P2CA 2X9GA 3PUIA 1OY1A 4G4GA 4URYR 3L0PA 1DP4A 4HI0E 3DE2X 2F2TA 3QPAA 1BYUA 4HWPA 2CLCX 4RQAA 4BNMA 3E3NA 3PEUA 2FPUA 3ZDFA 2ZI3A 2PM8A 4JLSA 2VEOA 3RCBA 4URVR 1ZRMA 3I6MA 4RPLA 5KC8A 1L4NA 3ZWQA 3ZN2A 1JFTA 1DEKA 3CXCB 2QB5A 2UYYA 1JAZA 1OH5A 3K9BA 4HDNB 4AWBA 1PBTA 2PX0A 2G6TA 3E9QA 4XVRA 5FV4A 4CR7A 4RGQA 4GYJA 1KHHA 5KS2A 1AF4A 2WJIA 4MROA 3FWNA 1D2MA 5DS0A 3LUJA 1MT3A 2EFJA 4NBVA 3JVIA 1NVUQ 5JAHA 4KODA 1XFOA 1T9HA 2BHTA 3DHEA 4HTAA 2HO4A 1CRPA 5EQJB 4N01A 2IDZA 1SIWA 3RU7A 2NN3C 3V4LA 5I3CA 2PSDA 1HR0B 1IY8A 3NBMA 1GFZA 3PLNA 2BMJA 2NXCA 3FGPA 4MLPA 1EQAA 2BHSA 2AOWA 3GJ3A 5L3QB 2FEXA 5K8TA 2VKQA 1YJ9B 4CQLA 1Q0TA 3LCRA 3F2VA 2FXIA 4PG4A 1UD8A 4LQDA 5K05A 3U1BA 3B70A 3ZTWA 4A8JB 2YL2A 4O4IA 2VJMA 4Q5IA 2C7QA 1EI9A 1OMOA 1N2EA 5GIPE 3K8OE 3KPUA 2CNNA 1WSVA 3GLHB 1NRWA 1N57A 3UMBA 2OTLB 4ZDJA 4Y7CA 1J2YA 3FUXA 5KWVA 4F5EA 5KNDA 4Q24A 4R0VA 3P9CA 1ZOIA 4M9CA 4YTEA 3R5SA 2DLCX 2R85A 5KEIA 2ONCA 3N2EA 5J40A 4RHYA 4BKQA 2W6CX 2R0QC 1E3ZA 4DLZA 5KQSA 3ANSA 1ZXXA 4QGSA 4FDUA 4KN6A 4FE4A 2RJNA 3EPHA 3UN1A 4DBLE 1TJ5A 1AUXA 1FTSA 1G8GA 2OAQ1 2WM2A 4NRDA 3BIXA 2KSQA 3QLUA 1G98A 4MVJI 3LQ4A 4BO8A 4Z5XA 3D5TA 2X7XA 1DC4A 3H87A 1PDWA 3H97A 4N4AA 3W8NA 2ZM6B 3DBRB 4XAQA 2PZGA 3RSOA 1MX9A 2P6NA 3QJGA 4AX8A 2A88A 2FUCA 3GFBA 2WLTA 2WP0A 4L73A 1KE2A 1W94A 1JNYA 2HSGA 2FUKA 3FGZA 1A2OA 5E1MA 1GQ2A 1OPRA 1UODA 2YOHA 2DM6A 3IHTA 3A8TA 3AR6A 4G1FA 3GLIB 2V4DA 1BU8A 4QQKA 4LZWA 4DLAA 3SYLA 2P90A 1A0OA 1I2AA 4W5HA 5ALRA 5H7XA 5BQFA 5I4KA 3N87A 3AY7A 2JAPA 3KJGA 4KR0A 4V0KA 2WILA 2JBWA 3EG9B 3HKCA 3I0ZA 3ENQA 1OTYA 4LSMA 3VH4A 1YULA 1SKMA 4H6WA 2PUVA 1Q2UA 4G01B 4LQCA 5K0TA 4OATA 5CGQB 3ZU4A 1W36D 5JCJA 5KYWA 4ZANA 5JXIA 1KPHA 4EDHA 2V1UA 1G2QA 4ZO4A 5B7QA 3C0KA 4FEEA 4TT8A 5G40A 4XVUA 1PR2A 1PFUA 5D5QA 2ECFA 3FSGA 4ZCQA 3L0DA 4LJ9A 5CT4A 3TI7A 3V4FA 4ESEA 3TX2A 1DKUA 2TMDA 1V6CA 4DCUA 3LHKA 1HFJA 3NM5A 1K4KA 4Q05A 4A0HA 3OQMA 1E1LA 1T3ZA 5D3QA 2PR2A 1Y34E 3OZTA 2P7HA 4YQFA 2NP7A 3B1YA 4HY3A 3ZU6A 1KP9A 4K6MA 3F8SA 5DHQA 2B94A 5TMEA 5C0OE 2FWRA 2NSJA 3WLLA 3UPUA 1I36A 1K6IA 2HEGA 4Y1FA 2A0WA 5FBRB 1EIWA 2VQ6A 4RMNA 2O1XA 3E9DA 5IPFA 3KKQA 3FR7A 4OHVA 3D4BA 3KQVA 2CFOA 4Y6OA 2W98A 3A0UA 4S12A 2ZR9A 1G38A 1SQFA 3AG6A 3GY0A 1Y5IA 5EWJB 5K51A 5GM1A 3QBTA 3THYB 4PC2A 3CPXA 4UBOA 3MCVA 3BGSA 4P08A 4EKEA 1Y6FA 4FHZA 3OCZA 5BRNA 4J0KA 1QHNA 4GHWA 4J4TA 1HNNA 1PNTA 1V3QE 4S04A 1C41A 2XQVA 4TTVA 4Z6KA 1UD5A 1U0LA 4QWWA 1KQNA 3PUMA 1K63A 1V0JA 4O59O 1SBTA 1MPTA 1PNOA 5CH8A 3LLSA 1NAIA 1S89A 2ET6A 2OP0A 2I4LA 3K09A 3O4HA 3F9CA 4PIMA 1C1DB 4FM9A 2GXAA 1QE5A 1WXWA 2I0FA 2Q6OA 2ZVQX 4GF5A 3ILVA 2A5FA 4IIVA 5GGXA 3T0IA 2EGUA 3NJRA 3TZ6A 1TIKA 2CXUA 1UMBA 1UKZA 3FYUA 4CMEC 3W5VA 4ZI3A 4M2LA 2VPYA 3ZKAA 4QUHA 2JHAA 4AYTA 4IYRA 5AIAA 2R6GA 3SK0A 5LP6A 1QBGA 1MO4A 4KGXA 4XWWA 3KXLA 2CZQA 4TVSA 2R7NA 3G71B 1I14A 2I4IA 2YN0A 4EM6A 1V7QA 3AF2A 2C58A 1ODSA 1FB5A 1K88A 1XP5A 4KQEA 1YI0A 2HF8A 3Q3JB 2F3TA 3U49A 4ZVNA 2VBVA 2ZRQA 1MC1A 3WIDA 2IOQA 4EBBA 1VZ3A 1XZ8A 2BMDA 5BT9A 2CZCA 3SBXA 3LRXA 4AY3A 2L17A 1VJDA 1JR4A 3A2MA 2ZUWA 2CLFB 2I67A 2FK8A 4O5OA 4UE3S 3X2EA 3A28A 3PE6A 3P96A 2DHEA 3DEHA 4M38A 2I7CA 4E1BA 2GASA 4AULA 2YIDA 5JAIA 4JB8A 5LZ9A 1SVUA 1P74A 1SUFA 1US8A 3EGDA 3FNRA 6ABPA 1KTIA 3PLAE 2B36A 3LC2O 4O2BB 3BCHA 3OO1A 3W8FA 1ZLXA 3R74A 1AKNA 1ND6A 2ZDQA 4EECA 1DV1A 4QHSA 1Y8RB 2Z4RA 5BN4B 5JXHA 2ZKLA 5C7YA 3LPDA 5EG5A 1QRSA 1DDIA 2YRFA 4L4UA 1ZVQA 4PHFA 2HKIA 1RKUA 3GXOA 3EIFA 2DEUA 1SBIA 4EPVA 5CLIA 1MX3A 2XYVA 3HZRA 3EJWA 5K3FB 3ZV7A 4IDNA 3FMIA 5JNRA 4LKOA 3LQ6A 2HFJA 4MRNA 1ZNZA 4JJ6A 4KXVA 4P5PA 4BWGA 2HCRA 2ZAIA 3JU3A 2EEZA 1GNPA 3OM1A 3MJHA 2G0AA 3QG5A 4L4ZA 3ND8A 4PQRA 4CM8A 5JBNA 4ZV4A 4MQ5A 2LV8A 1L7NA 4V39A 2ZI7A 4KO4S 1ORIA 4X1KB 1CZOA 4FEYA 1U0EA 5DHUA 1A9YA 1WB5A 2QQFA 1CK4A 2RHBA 3FBGA 1C30A 3H1FA 3LX8A 1ZHFA 4GOLD 4NESA 3EB9A 3Q5EA 3CCUB 1UPBA 2OENG 1PZEA 1U8CB 4L8WB 1R6UA 3IHWA 2EVWX 2FJUA 4U02A 4B3MB 5F76A 1VKZA 3C5CA 2J0QA 4XN0A 1NLUA 4JVSB 4W82A 5F7XA 2D8AA 5HTOA 4MLDA 4WFJA 1QRRA 4DG5A 1G8HA 4IIUA 4CR6A 1RMTA 4YXWD 4ZDKA 9ABPA 1HE3A 4D41A 4LX0A 2AQIA 3BFKA 4HUQA 4BE7B 1Y9EA 1KJYA 3IESA 2AF4C 1H1TA 3RADC 2BR3A 4ARBA 5DVZA 3JAMA 1BLIA 1VJ5A 1ZN2A 2ZQZA 3IS3A 4DR6B 1Q20A 3O4RA 2WZBA 3EVFA 4UHJA 3OPMA 2VNSA 1PJ2A 4DLKA 3L1HA 4ITRC 5LKRA 1JHPA 2PUHA 4KNVA 1QUFA 3AT1A 3PDIB 4Z4SA 1TA0A 1EXNA 4JT4A 4AF8A 4Q4HB 3LQKA 3D7SA 3OTHA 4OBXA 3PYMA 1RABA 5JADA 2XGGA 1AT1A 1ANKA 3RUAA 3A6KA 3CWZA 2XZDA 1TPZA 2KE5A 3JQAA 2YMLA 4TV8B 3K32A 4RM2A 1SBNE 4R1LA 3CURA 3H5LA 4H6PA 4R8MA 4XB2A 3I1YA 1NYRA 4OAPA 3RJ9A 3W7AA 3EEOA 3QENA 1XRQA 2XCQA 3GRAA 4X95A 1PJAA 3FIUA 2ZXUA 5CDTA 3SFZA 3CCCA 4Z99A 1DO8A 1ZJ6A 2HSZA 3UAYA 3Q9UA 2L19A 5HBRA 2M6KA 4AJOA 5K9ZA 4L16A 5DMXA 4PYNA 3NEPX 3LZDA 5LQMA 3C74A 3BKXA 4E94A 4YVFA 1E7YA 5EKSA 3U7QA 4YMUA 1T29A 3UWMA 1JPJA 3RF7A 3UMGA 4RIHA 1CEEA 3I2GA 3K9GA 3PV0A 3FNGA 1BXGA 2W2XA 4QRIA 3W4JA 1E3TA 3LBHA 2QROA 5B2FA 1GVNB 4UNIA 4C08A 2R00A 1UBOS 2N0SA 3G4SB 3ZY3A 3GN1A 3ML1A 1K5GA 2HNBA 5B64A 3Q8MA 1QFMA 2EFCB 2RHCA 2WR8A 3VO8A 1NM5C 4CPDA 3PRKE 3D6TB 5EKUA 4QM7A 1T1RA 1LPBB 2JLRA 5E0OA 2DH5A 4KR7A 2GCEA 1WOYA 4PABA 2VKTA 1OB0A 3B3JA 3ID6C 4IILA 1JBEA 1YC2A 1YVRA 2AIRA 3HI4A 1T5HX 3DKIA 3BZWA 3LQYA 1Y3HA 3D3KA 1J8FA 1Z4MA 2QTLA 1GQYA 2GPAA 3I76A 5EIHA 4PSAA 1Q86D 2HHJA 2WG0A 3DYVA 3MIZA 4LOKA 1N0IA 1M1XB 1Q0QA 1YS2X 4IOJA 4QWMA 4QO7A 4TQ9A 3V1TC 4P7FA 1QONA 4R71A 3GJTA 3PF9A 4K46A 5JZVA 2UZ3A 3N2GB 1P9OA 4X97A 4YBZA 4CWAA 2BBOA 1B0PA 2GM5A 2P0YA 3N07A 3PHIA 3OPYI 3UK2A 3GIRA 3O8LA 4HEQA 2XTNA 4MWDA 2OGSA 4QBHA 2P