3ZPNA

Structure of psb28
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
AMAEIQFIRGINEEVVPDVRLTRARDGSSGQAMFYFDNPKIVQEGNLEVTGMYMVDEEGEIVTRDVNAKFINGQPVAIEATYTMRSPQEWDRFIRFMDRYAASHGLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Psb28 Accessory Factor of Thermosynechococcus Elongatus Photosystem II at 2.3 A
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM II REACTION CENTER PSB28 PROTEIN
total genus 23
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3zpnA00
3ZPNA 2KVOA
chains in the Genus database with same CATH superfamily
3SJPA 1GAWA 3WQZA 1WOPA 1UD8A 3H9NA 4P3YA 3ZBUA 2X6YA 2PE3A 1EWYA 1R5BA 1TUIA 1COWA 3V76A 4OOSA 3T56B 3ZZUA 2X0KA 3ES9A 4HE6A 4Z4RA 1BLIA 2D74A 4XLEA 2F1MA 2VNKA 3GVLA 3BNWA 3ZZ0A 3Q3AA 4X7CA 1NB0A 3W2GA 1UMKA 2KVOA 4HIZA 3CPXA 4LC0A 3QSYA 1I18A 1MABA 4EH1A 1VQKB 3OP1A 1R5OA 1VLOA 1WP6A 5AN9A 4DK0A 3ZUGA 3I1FA 2ZZEA 4P25A 4HE5A 5FIUA 4L8JA 1V0EA 1F60A 4RPBA 3V7AA 4RCZA 2F43A 4G7WA 4ASUA 4ZGNB 1BX1A 1SKQA 4H9GA 1PJ7A 5A89A 1E3ZA 2VJJA 4XKWA 2BM0A 4QV2A 2D9RA 2B7BA 2YWFA 1J9ZA 2BN4A 1R5NA 4YELA 3KEWA 2ZXIA 5HZBA 1Q81D 4C0SA 3CCEB 4XKVA 2DCUA 3CC2B 1VQ7B 2R9VA 4II3A 1FRQA 3CCLB 2QN6A 2QDXA 2WZNA 4RD2A 1PKVA 1YX2A 3VR6A 4UZEA 2CC2A 4Z4WA 4Z4SA 1Q9SA 1OGIA 1DG1G 3A1PA 1WTHD 4XM3A 3GVJA 4IW3B 3SEJA 2GJRA 2VBSA 3GVKA 3ZIAA 1ZM9A 4P2NA 2WZPP 4X07A 1DDIA 3I55B 4YALA 1H8HA 5H5JA 5FA6A 4P3IA 3P26A 5DS0A 5E6TA 1QGZA 2EFGA 2Q6KA 1OGJA 2WSSA 5L46A 3CCUB 2X6WA 4KKTA 1YITB 1TVCA 2E1RA 3PUNA 4B3FX 2DETA 1YHQB 3CCMB 1JA0A 2BGJA 3OZVA 4OPOA 1FNCA 2QA4B 2JDIA 4WZLA 4B3XA 4UAJA 3VMFA 1EFRA 1UD3A 2V7UA 2X6XA 3A8KA 5EMNA 1B23P 4RD1A 3WYAA 1VJSA 1EP1B 2YWEA 3ASTA 4DQKA 4XLFA 4DQLA 3CB4A 2CRVA 5GV8A 3FJOA 3WXMA 1OB5A 1NB9A 5HXBA 2OBRA 2QEXB 2ZL7A 1F20A 4RM0A 3Q6QA 1XB2A 1S0UA 2BM1A 4JMQA 4TMTA 2YWGA 4UZUA 3ZC3A 4AF6A 1EP3B 4DNRB 1G7SA 3W5UA 4Z4TA 1EFCA 2D3LA 1K73D 2NPFA 3SLDA 3KL9A 2VNIA 1QX4A 1W0JA 2C5BA 1TLLA 3ASRA 3ZPNA 3ONUA 1QUEA 1KK0A 4YHBA 4B44A 5IYQA 1JJ2B 4QVJA 1BJKA 3G4SB 4OPVA 1WSRA 2GQFA 3WBKA 4YXWA 3B82A 1QVFB 1I7PA 1OHHA 1UD2A 3U2QA 4G7XA 1E43A 2Q6OA 3R6KA 4TSFA 4E0FA 1IB0A 4NBSA 3W5HA 1EFUA 1XE1A 3J81k 4QHYA 1W2BB 2OK7A 1XFOA 1GR1A 1FDRA 1P4MA 1D8TA 2RC6A 3CRZA 3CMMA 4XN3A 3AVXA 2V7TA 4XORA 2PLFA 1HVXA 2VBTA 1KK1A 4YEJA 1TTTA 1ELOA 2QE7A 3VNUA 1V5VA 2WPDA 3CXCB 1DDGA 1QFJA 3W2FA 1QGAA 4X7FA 3AVWA 3CCRB 1FX0A 1E64A 1WSVA 2F4NA 3ZZTA 1PJ5A 2V7QA 4TMVA 2CNDA 5A88A 4P12A 2X3UA 4WZKA 4ZCMA 1WORA 4ROXA 4Y7CA 4M0LA 4DNTB 4UZFA 1K9MD 3CPWB 3BY2A 2HDNB 4XR6A 4PC1A 4PC7A 3OEHA 5IK2A 2ZBVA 4M1KA 4Z1MA 2BSAA 1GVHA 1QFYA 1G7TA 4X7EA 2M5SA 4AVZA 1KZLA 4XLCA 4KKSA 5F4JA 1NRKA 4Y9RA 1KQSB 1Q86D 1ZM4A 5F4OA 3WNDA 3W2IA 1KRHA 2X53S 2ZITA 1VQNB 5TV2A 3WBJA 4WZTA 5LMZA 1E1QA 3A8IA 3LQEA 3OPOA 1AMOA 1UD4A 1S4MA 2OBSA 1GO2A 3DDYA 1W35A 4RJLA 1KK2A 1KK3A 1VLYA 1A8PA 4B3GA 1N0VC 2CF4A 2JIZA 3LQ6A 4QFMA 2VBUA 3A35A 3FKSA 1N06A 3Q38A 3AVVA 2BV3A 1BQEA 3AVTA 2XEXA 4XOPA 3CC7B 1Y0RA 4RPDA 4B48A 2C5HA 3BCFA 3AGPA 3JQPA 4K1XA 3ASPA 3B78A 5IYPA 1N05A 1V0FA 2GK6A 1M1KD 4WQMA 4P6YA 1SM4A 2ZTNA 4YAWA 1IHMA 2R6HA 4XQFA 1VQMB 1YJ9B 4X7DA 5J35A 4CQJA 4ZGQB 4TT3A 4ZV4A 1IJFA 3OOCA 4B47A 5JBQA 3CCSB 4Z4YA 1WU8A 2VNHA 2RC5A 1CNEA 1HA3A 2P3MA 1FNBA 3CMEB 4NNJA 3OEEA 3QE2A 1SKYB 2CW5A 2Q6LA 1VQ9B 1BPLA 3W2EA 5KW9A 3SLNA 3CMAB 4TMZA 5BSXA 3AGQA 5IYNA 4U9UA 4DK1A 2VJIA 5J3OA 4ZCIA 5DSZA 4XL9A 2NV4A 2PMDA 5H59A 3JQQA 1Y0YA 2Q6IA 4Z4UA 1JA1A 5KSWB 1E62A 3OZWA 1KJZA 3T53B 3CCQB 1QFZA 4F7DA 2WR8A 4OOXA 3ONYA 4TMXA 1QGYA 2X85A 3SKBA 1VQ8B 2ZL5A 1ZM3A 4OPSA 4G1VA 4RD0A 2C4UA 2VNJA 1WDTA 1S72B 3OE7A 3OFNA 4X8IA 1YJWB 3A8JA 2GJPA 3SJZA 1YLOA 3MHPA 4R71A 2W6JA 4P22A 2ZXHA 1KMHA 2DEUA 4LBVA 4YAUA 2QGGA 4XMYA 5FL7A 4FK8A 3FPPA 3OJWA 1OB2A 1D1NA 2JN9A 3D26A 2Z6BD 3NE5B 4RD4A 3LNNA 2F1LA 1CNFA 4P6VF 2OBTA 2JJ2A 2FX3A 1Q7YD 2C2WA 2OYNA 4TN1A 4XONA 3OW2B 1I8DA 1T5EA 3U6KA 3VO2A 3CCJB 3PENA 2XZLA 3ZBTA 1KC8D 1W9XA 1JNYA 3GSIA 2WYRA 1HZEA 4PGOA 4B4DA 1N07A 2DYIA 3G71B 1G7CA 4Q7JB 2B5OA 3QFSA 2XZPA 5B6IA 2DERA 2XZOA 2V7VA 4XNFA 3OAAA 1T6ZA 4TKOB 2J7KA 3W2HA 3P27A 1T6YA 3PA1A 3FPKA 5HKKA 1E79A 3PVDA 2GJKA 5FO1A 2V7XA 1Q82D 3B8HA 2YWHA 4M4SA 5TY0A 3A3GA 3CC4B 5TRDA 3ISXA 4PC3A 2W6IA 2XOKA 1H8EA 4P9SA 4PC2A 4X05A 2BF4A 2JJ1A 1NDHA 1WOSA 1ZM2A 4J0QA 4M2LA 1N0UA 1UD6A 4AF7A 1W0KA 1KD1D 5THXA 1VHEA 2FVGA 4N3NA 2ZZGA 3BQJA 2XNJA 5IYWA 4G6IA 1QG0A 1WPCA 2BGIA 3WNCA 2QTLA 2DIEA 1OB0A 1VQPB 3CD6B 2ZZFA 3CESA 1IJEA 1WOOA 2I1LA 2HLDA 3Q39A 4FXUA 1NJID 1VQ4B 3AVUA 5BSYA 5F4MA 1AIPA 4RDKA 4PAAA 2BVNA 4Z4ZA 1FNDA 3E20A 2C4TA 1GJRA 2C78A 2CBXA 3PA2A 1H42A 3BY1A 2ZTGA 3VNVA 4FWTA 1VQOB 1E63A 2HCJB 4QUZA 4RD3A 4RD6A 4WWVA 2B7CA 1QH0A 4MYUA 2OK8A 2VZLA 2XGJA 4XD7A 1H85A 1G7RA 1N08A 1U2RA 2EIXA 2WJVA 2XNCA 2DY1A 1YIJB 1GAQA 3G05A 4P1VA 1VQLB 3BC9A 3QFTA 2ZL6A 4X0CA 3T51B 2XNDA 4II2A 4Z4VA 1YJNB 1W34A 2V4DA 2OTLB 2BMWA 1KTVA 2V7WA 2DOGA 3LO8A 3ASQA 3GIRA 2C77A 1N8RD 5HZAA 4RLZA 5KNLA 3Q6RA 4GQNA 1UD5A 2PIAA 3RY8A 3OKXA 1K28D 1RQRA 1EFTA 1JB9A 2ZBUA 3R6JA 3MMPA 2AHOA 4G1BA 1XQBA 2QMUA 1PJ6A 4YAFA 3G6EB 1M90D 2GREA 2LZJA 3OW7A 2ZZQA 1YI2B 3WY9A 4LBYA 2V31A 3BCDA 4RDJA 1NBMA 3AVYA 1FNMA 4ZCLA 3CCVB 3PUMA 4YAOA 2QTZA 1ZUNB 1B2RA 2WJYA 4NCNA 4C43A 1CQXA 1QVGB 3A3BA 1VQ5B 4TMWA 1EXMA 2X8KA 2D3NA 1QUFA 4G5GA 5CDFA 4PC6A 5DN6A 4ACBA 3U6BA 3GQBA 3WNBA 4ACAA 4Y9UA 3W5VA 4BPRA 4MYTA 4LBZA 4AC9A 3JQRA 3HAGA 2VBVA 2E1BA 2HMAA 3CTAA 2VYQA 3JU4A 4KKUA 3E1YE 5FNZA 3BH4A 1W87A 1MRZA 4LBWA 4QVAA 1RQPA 4XOTA 5FO0A 3CP8A 2CK3A 3OJXA 1T6XA 3QFCA 4B43A 5A8AA 3ASSA 4OP7A 4XLAA 3OZUA 3LVBA 2BPOA 3MCAA 3VO1A 4PABA 4FN5A 4P26A 1E3XA 5TR9A 1EP2B 2GPJA 4RDLA 4X06A 4N3GA 1K8AD 1DARA 4OOVA 1VQ6B 4XLHA 1FRNA 5IYRA 2GK7A 2OTJB 4RCYA 3H94A 1D2EA 1BMFA 4WZEA 3CW2A 4M53A 1E1RA 1VHOA 1BX0A 4XN0A 5GV7A 3I56B 3CP2A 1VF7A 3QFRA
chains in the Genus database with same CATH topology
4UZUA 2ZZFA 3CESA 3WQZA 2HLDA 4DNRB 2ZTNA 4FXUA 1UD8A 4XQFA 2X6YA 2D3LA 1COWA 4TT3A 1W0JA 3OOCA 3ZPNA 3T56B 2ZTGA 4NNJA 1BLIA 4XLEA 2XGJA 3OEEA 2F1MA 4XD7A 3GVLA 1SKYB 4YXWA 1BPLA 1OHHA 2WJVA 1UD2A 2KVOA 4HIZA 1I18A 3G05A 1E43A 1MABA 3BC9A 4G7XA 4TSFA 4E0FA 4DK1A 2VJIA 3T51B 2XNDA 4II2A 1WP6A 2V4DA 4DK0A 2ZZEA 4XL9A 5KNLA 4GQNA 1UD5A 3CMMA 1V0EA 4L8JA 4XN3A 4XORA 1HVXA 1K28D 3T53B 4ASUA 2F43A 4G7WA 4YEJA 2X85A 1E3ZA 2LZJA 2VJJA 3OW7A 2ZZQA 4XKWA 2QE7A 2V31A 3BCDA 3OE7A 1NBMA 2WPDA 3OFNA 2GJPA 4YELA 3KEWA 2ZXIA 2W6JA 1FX0A 4P22A 2ZXHA 2WJYA 1KMHA 4XKVA 2V7QA 3A3BA 4XMYA 2R9VA 4II3A 5FL7A 2X8KA 2D3NA 3FPPA 1PKVA 3VR6A 5CDFA 3NE5B 2Z6BD 4DNTB 3LNNA 5DN6A 4XR6A 2JJ2A 3GQBA 4XONA 1WTHD 3OEHA 4XM3A 3GVJA 5IK2A 1I8DA 1T5EA 2GJRA 3GVKA 3ZIAA 4Z1MA 2WZPP 3HAGA 2XZLA 1W9XA 2E1BA 1H8HA 1HZEA 2M5SA 3JU4A 4AVZA 4KKUA 1KZLA 4XLCA 4KKSA 3BH4A 1NRKA 4JMQA 2WSSA 4XOTA 2XZPA 3CP8A 2X6WA 2CK3A 4KKTA 4B3FX 2XZOA 4XNFA 3OAAA 4TKOB 2X53S 4XLAA 5HKKA 1E79A 1E1QA 2JDIA 3OPOA 1UD4A 2GJKA 3CP2A 3DDYA 1EFRA 1E3XA 1UD3A 2X6XA 1VLYA 4B3GA 1VJSA 2JIZA 3A3GA 3A35A 2W6IA 2XOKA 1H8EA 4XLFA 3FKSA 2GK7A 4XLHA 2JJ1A 3H94A 1BMFA 4XOPA 1UD6A 1W0KA 3BCFA 2ZZGA 1E1RA 1V0FA 4XN0A 4G6IA 2GK6A 1WPCA 1VF7A 2DIEA 1OB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPN A;  2KVO A; 
#chains in the Genus database with same CATH topology
 3SJP A;  1GAW A;  3WQZ A;  1WOP A;  1UD8 A;  3H9N A;  4P3Y A;  3ZBU A;  2X6Y A;  2PE3 A;  1EWY A;  1R5B A;  1TUI A;  1COW A;  3V76 A;  4OOS A;  3T56 B;  3ZZU A;  2X0K A;  3ES9 A;  4HE6 A;  4Z4R A;  1BLI A;  2D74 A;  4XLE A;  2F1M A;  2VNK A;  3GVL A;  3BNW A;  3ZZ0 A;  3Q3A A;  4X7C A;  1NB0 A;  3W2G A;  1UMK A;  2KVO A;  4HIZ A;  3CPX A;  4LC0 A;  3QSY A;  1I18 A;  1MAB A;  4EH1 A;  1VQK B;  3OP1 A;  1R5O A;  1VLO A;  1WP6 A;  5AN9 A;  4DK0 A;  3ZUG A;  3I1F A;  2ZZE A;  4P25 A;  4HE5 A;  5FIU A;  4L8J A;  1V0E A;  1F60 A;  4RPB A;  3V7A A;  4RCZ A;  2F43 A;  4G7W A;  4ASU A;  4ZGN B;  1BX1 A;  1SKQ A;  4H9G A;  1PJ7 A;  5A89 A;  1E3Z A;  2VJJ A;  4XKW A;  2BM0 A;  4QV2 A;  2D9R A;  2B7B A;  2YWF A;  1J9Z A;  2BN4 A;  1R5N A;  4YEL A;  3KEW A;  2ZXI A;  5HZB A;  1Q81 D;  4C0S A;  3CCE B;  4XKV A;  2DCU A;  3CC2 B;  1VQ7 B;  2R9V A;  4II3 A;  1FRQ A;  3CCL B;  2QN6 A;  2QDX A;  2WZN A;  4RD2 A;  1PKV A;  1YX2 A;  3VR6 A;  4UZE A;  2CC2 A;  4Z4W A;  4Z4S A;  1Q9S A;  1OGI A;  1DG1 G;  3A1P A;  1WTH D;  4XM3 A;  3GVJ A;  4IW3 B;  3SEJ A;  2GJR A;  2VBS A;  3GVK A;  3ZIA A;  1ZM9 A;  4P2N A;  2WZP P;  4X07 A;  1DDI A;  3I55 B;  4YAL A;  1H8H A;  5H5J A;  5FA6 A;  4P3I A;  3P26 A;  5DS0 A;  5E6T A;  1QGZ A;  2EFG A;  2Q6K A;  1OGJ A;  2WSS A;  5L46 A;  3CCU B;  2X6W A;  4KKT A;  1YIT B;  1TVC A;  2E1R A;  3PUN A;  4B3F X;  2DET A;  1YHQ B;  3CCM B;  1JA0 A;  2BGJ A;  3OZV A;  4OPO A;  1FNC A;  2QA4 B;  2JDI A;  4WZL A;  4B3X A;  4UAJ A;  3VMF A;  1EFR A;  1UD3 A;  2V7U A;  2X6X A;  3A8K A;  5EMN A;  1B23 P;  4RD1 A;  3WYA A;  1VJS A;  1EP1 B;  2YWE A;  3AST A;  4DQK A;  4XLF A;  4DQL A;  3CB4 A;  2CRV A;  5GV8 A;  3FJO A;  3WXM A;  1OB5 A;  1NB9 A;  5HXB A;  2OBR A;  2QEX B;  2ZL7 A;  1F20 A;  4RM0 A;  3Q6Q A;  1XB2 A;  1S0U A;  2BM1 A;  4JMQ A;  4TMT A;  2YWG A;  4UZU A;  3ZC3 A;  4AF6 A;  1EP3 B;  4DNR B;  1G7S A;  3W5U A;  4Z4T A;  1EFC A;  2D3L A;  1K73 D;  2NPF A;  3SLD A;  3KL9 A;  2VNI A;  1QX4 A;  1W0J A;  2C5B A;  1TLL A;  3ASR A;  3ZPN A;  3ONU A;  1QUE A;  1KK0 A;  4YHB A;  4B44 A;  5IYQ A;  1JJ2 B;  4QVJ A;  1BJK A;  3G4S B;  4OPV A;  1WSR A;  2GQF A;  3WBK A;  4YXW A;  3B82 A;  1QVF B;  1I7P A;  1OHH A;  1UD2 A;  3U2Q A;  4G7X A;  1E43 A;  2Q6O A;  3R6K A;  4TSF A;  4E0F A;  1IB0 A;  4NBS A;  3W5H A;  1EFU A;  1XE1 A;  3J81 k;  4QHY A;  1W2B B;  2OK7 A;  1XFO A;  1GR1 A;  1FDR A;  1P4M A;  1D8T A;  2RC6 A;  3CRZ A;  3CMM A;  4XN3 A;  3AVX A;  2V7T A;  4XOR A;  2PLF A;  1HVX A;  2VBT A;  1KK1 A;  4YEJ A;  1TTT A;  1ELO A;  2QE7 A;  3VNU A;  1V5V A;  2WPD A;  3CXC B;  1DDG A;  1QFJ A;  3W2F A;  1QGA A;  4X7F A;  3AVW A;  3CCR B;  1FX0 A;  1E64 A;  1WSV A;  2F4N A;  3ZZT A;  1PJ5 A;  2V7Q A;  4TMV A;  2CND A;  5A88 A;  4P12 A;  2X3U A;  4WZK A;  4ZCM A;  1WOR A;  4ROX A;  4Y7C A;  4M0L A;  4DNT B;  4UZF A;  1K9M D;  3CPW B;  3BY2 A;  2HDN B;  4XR6 A;  4PC1 A;  4PC7 A;  3OEH A;  5IK2 A;  2ZBV A;  4M1K A;  4Z1M A;  2BSA A;  1GVH A;  1QFY A;  1G7T A;  4X7E A;  2M5S A;  4AVZ A;  1KZL A;  4XLC A;  4KKS A;  5F4J A;  1NRK A;  4Y9R A;  1KQS B;  1Q86 D;  1ZM4 A;  5F4O A;  3WND A;  3W2I A;  1KRH A;  2X53 S;  2ZIT A;  1VQN B;  5TV2 A;  3WBJ A;  4WZT A;  5LMZ A;  1E1Q A;  3A8I A;  3LQE A;  3OPO A;  1AMO A;  1UD4 A;  1S4M A;  2OBS A;  1GO2 A;  3DDY A;  1W35 A;  4RJL A;  1KK2 A;  1KK3 A;  1VLY A;  1A8P A;  4B3G A;  1N0V C;  2CF4 A;  2JIZ A;  3LQ6 A;  4QFM A;  2VBU A;  3A35 A;  3FKS A;  1N06 A;  3Q38 A;  3AVV A;  2BV3 A;  1BQE A;  3AVT A;  2XEX A;  4XOP A;  3CC7 B;  1Y0R A;  4RPD A;  4B48 A;  2C5H A;  3BCF A;  3AGP A;  3JQP A;  4K1X A;  3ASP A;  3B78 A;  5IYP A;  1N05 A;  1V0F A;  2GK6 A;  1M1K D;  4WQM A;  4P6Y A;  1SM4 A;  2ZTN A;  4YAW A;  1IHM A;  2R6H A;  4XQF A;  1VQM B;  1YJ9 B;  4X7D A;  5J35 A;  4CQJ A;  4ZGQ B;  4TT3 A;  4ZV4 A;  1IJF A;  3OOC A;  4B47 A;  5JBQ A;  3CCS B;  4Z4Y A;  1WU8 A;  2VNH A;  2RC5 A;  1CNE A;  1HA3 A;  2P3M A;  1FNB A;  3CME B;  4NNJ A;  3OEE A;  3QE2 A;  1SKY B;  2CW5 A;  2Q6L A;  1VQ9 B;  1BPL A;  3W2E A;  5KW9 A;  3SLN A;  3CMA B;  4TMZ A;  5BSX A;  3AGQ A;  5IYN A;  4U9U A;  4DK1 A;  2VJI A;  5J3O A;  4ZCI A;  5DSZ A;  4XL9 A;  2NV4 A;  2PMD A;  5H59 A;  3JQQ A;  1Y0Y A;  2Q6I A;  4Z4U A;  1JA1 A;  5KSW B;  1E62 A;  3OZW A;  1KJZ A;  3T53 B;  3CCQ B;  1QFZ A;  4F7D A;  2WR8 A;  4OOX A;  3ONY A;  4TMX A;  1QGY A;  2X85 A;  3SKB A;  1VQ8 B;  2ZL5 A;  1ZM3 A;  4OPS A;  4G1V A;  4RD0 A;  2C4U A;  2VNJ A;  1WDT A;  1S72 B;  3OE7 A;  3OFN A;  4X8I A;  1YJW B;  3A8J A;  2GJP A;  3SJZ A;  1YLO A;  3MHP A;  4R71 A;  2W6J A;  4P22 A;  2ZXH A;  1KMH A;  2DEU A;  4LBV A;  4YAU A;  2QGG A;  4XMY A;  5FL7 A;  4FK8 A;  3FPP A;  3OJW A;  1OB2 A;  1D1N A;  2JN9 A;  3D26 A;  2Z6B D;  3NE5 B;  4RD4 A;  3LNN A;  2F1L A;  1CNF A;  4P6V F;  2OBT A;  2JJ2 A;  2FX3 A;  1Q7Y D;  2C2W A;  2OYN A;  4TN1 A;  4XON A;  3OW2 B;  1I8D A;  1T5E A;  3U6K A;  3VO2 A;  3CCJ B;  3PEN A;  2XZL A;  3ZBT A;  1KC8 D;  1W9X A;  1JNY A;  3GSI A;  2WYR A;  1HZE A;  4PGO A;  4B4D A;  1N07 A;  2DYI A;  3G71 B;  1G7C A;  4Q7J B;  2B5O A;  3QFS A;  2XZP A;  5B6I A;  2DER A;  2XZO A;  2V7V A;  4XNF A;  3OAA A;  1T6Z A;  4TKO B;  2J7K A;  3W2H A;  3P27 A;  1T6Y A;  3PA1 A;  3FPK A;  5HKK A;  1E79 A;  3PVD A;  2GJK A;  5FO1 A;  2V7X A;  1Q82 D;  3B8H A;  2YWH A;  4M4S A;  5TY0 A;  3A3G A;  3CC4 B;  5TRD A;  3ISX A;  4PC3 A;  2W6I A;  2XOK A;  1H8E A;  4P9S A;  4PC2 A;  4X05 A;  2BF4 A;  2JJ1 A;  1NDH A;  1WOS A;  1ZM2 A;  4J0Q A;  4M2L A;  1N0U A;  1UD6 A;  4AF7 A;  1W0K A;  1KD1 D;  5THX A;  1VHE A;  2FVG A;  4N3N A;  2ZZG A;  3BQJ A;  2XNJ A;  5IYW A;  4G6I A;  1QG0 A;  1WPC A;  2BGI A;  3WNC A;  2QTL A;  2DIE A;  1OB0 A;  1VQP B;  3CD6 B;  2ZZF A;  3CES A;  1IJE A;  1WOO A;  2I1L A;  2HLD A;  3Q39 A;  4FXU A;  1NJI D;  1VQ4 B;  3AVU A;  5BSY A;  5F4M A;  1AIP A;  4RDK A;  4PAA A;  2BVN A;  4Z4Z A;  1FND A;  3E20 A;  2C4T A;  1GJR A;  2C78 A;  2CBX A;  3PA2 A;  1H42 A;  3BY1 A;  2ZTG A;  3VNV A;  4FWT A;  1VQO B;  1E63 A;  2HCJ B;  4QUZ A;  4RD3 A;  4RD6 A;  4WWV A;  2B7C A;  1QH0 A;  4MYU A;  2OK8 A;  2VZL A;  2XGJ A;  4XD7 A;  1H85 A;  1G7R A;  1N08 A;  1U2R A;  2EIX A;  2WJV A;  2XNC A;  2DY1 A;  1YIJ B;  1GAQ A;  3G05 A;  4P1V A;  1VQL B;  3BC9 A;  3QFT A;  2ZL6 A;  4X0C A;  3T51 B;  2XND A;  4II2 A;  4Z4V A;  1YJN B;  1W34 A;  2V4D A;  2OTL B;  2BMW A;  1KTV A;  2V7W A;  2DOG A;  3LO8 A;  3ASQ A;  3GIR A;  2C77 A;  1N8R D;  5HZA A;  4RLZ A;  5KNL A;  3Q6R A;  4GQN A;  1UD5 A;  2PIA A;  3RY8 A;  3OKX A;  1K28 D;  1RQR A;  1EFT A;  1JB9 A;  2ZBU A;  3R6J A;  3MMP A;  2AHO A;  4G1B A;  1XQB A;  2QMU A;  1PJ6 A;  4YAF A;  3G6E B;  1M90 D;  2GRE A;  2LZJ A;  3OW7 A;  2ZZQ A;  1YI2 B;  3WY9 A;  4LBY A;  2V31 A;  3BCD A;  4RDJ A;  1NBM A;  3AVY A;  1FNM A;  4ZCL A;  3CCV B;  3PUM A;  4YAO A;  2QTZ A;  1ZUN B;  1B2R A;  2WJY A;  4NCN A;  4C43 A;  1CQX A;  1QVG B;  3A3B A;  1VQ5 B;  4TMW A;  1EXM A;  2X8K A;  2D3N A;  1QUF A;  4G5G A;  5CDF A;  4PC6 A;  5DN6 A;  4ACB A;  3U6B A;  3GQB A;  3WNB A;  4ACA A;  4Y9U A;  3W5V A;  4BPR A;  4MYT A;  4LBZ A;  4AC9 A;  3JQR A;  3HAG A;  2VBV A;  2E1B A;  2HMA A;  3CTA A;  2VYQ A;  3JU4 A;  4KKU A;  3E1Y E;  5FNZ A;  3BH4 A;  1W87 A;  1MRZ A;  4LBW A;  4QVA A;  1RQP A;  4XOT A;  5FO0 A;  3CP8 A;  2CK3 A;  3OJX A;  1T6X A;  3QFC A;  4B43 A;  5A8A A;  3ASS A;  4OP7 A;  4XLA A;  3OZU A;  3LVB A;  2BPO A;  3MCA A;  3VO1 A;  4PAB A;  4FN5 A;  4P26 A;  1E3X A;  5TR9 A;  1EP2 B;  2GPJ A;  4RDL A;  4X06 A;  4N3G A;  1K8A D;  1DAR A;  4OOV A;  1VQ6 B;  4XLH A;  1FRN A;  5IYR A;  2GK7 A;  2OTJ B;  4RCY A;  3H94 A;  1D2E A;  1BMF A;  4WZE A;  3CW2 A;  4M53 A;  1E1R A;  1VHO A;  1BX0 A;  4XN0 A;  5GV7 A;  3I56 B;  3CP2 A;  1VF7 A;  3QFR A; 
#chains in the Genus database with same CATH homology
 4UZU A;  2ZZF A;  3CES A;  3WQZ A;  2HLD A;  4DNR B;  2ZTN A;  4FXU A;  1UD8 A;  4XQF A;  2X6Y A;  2D3L A;  1COW A;  4TT3 A;  1W0J A;  3OOC A;  3ZPN A;  3T56 B;  2ZTG A;  4NNJ A;  1BLI A;  4XLE A;  2XGJ A;  3OEE A;  2F1M A;  4XD7 A;  3GVL A;  1SKY B;  4YXW A;  1BPL A;  1OHH A;  2WJV A;  1UD2 A;  2KVO A;  4HIZ A;  1I18 A;  3G05 A;  1E43 A;  1MAB A;  3BC9 A;  4G7X A;  4TSF A;  4E0F A;  4DK1 A;  2VJI A;  3T51 B;  2XND A;  4II2 A;  1WP6 A;  2V4D A;  4DK0 A;  2ZZE A;  4XL9 A;  5KNL A;  4GQN A;  1UD5 A;  3CMM A;  1V0E A;  4L8J A;  4XN3 A;  4XOR A;  1HVX A;  1K28 D;  3T53 B;  4ASU A;  2F43 A;  4G7W A;  4YEJ A;  2X85 A;  1E3Z A;  2LZJ A;  2VJJ A;  3OW7 A;  2ZZQ A;  4XKW A;  2QE7 A;  2V31 A;  3BCD A;  3OE7 A;  1NBM A;  2WPD A;  3OFN A;  2GJP A;  4YEL A;  3KEW A;  2ZXI A;  2W6J A;  1FX0 A;  4P22 A;  2ZXH A;  2WJY A;  1KMH A;  4XKV A;  2V7Q A;  3A3B A;  4XMY A;  2R9V A;  4II3 A;  5FL7 A;  2X8K A;  2D3N A;  3FPP A;  1PKV A;  3VR6 A;  5CDF A;  3NE5 B;  2Z6B D;  4DNT B;  3LNN A;  5DN6 A;  4XR6 A;  2JJ2 A;  3GQB A;  4XON A;  1WTH D;  3OEH A;  4XM3 A;  3GVJ A;  5IK2 A;  1I8D A;  1T5E A;  2GJR A;  3GVK A;  3ZIA A;  4Z1M A;  2WZP P;  3HAG A;  2XZL A;  1W9X A;  2E1B A;  1H8H A;  1HZE A;  2M5S A;  3JU4 A;  4AVZ A;  4KKU A;  1KZL A;  4XLC A;  4KKS A;  3BH4 A;  1NRK A;  4JMQ A;  2WSS A;  4XOT A;  2XZP A;  3CP8 A;  2X6W A;  2CK3 A;  4KKT A;  4B3F X;  2XZO A;  4XNF A;  3OAA A;  4TKO B;  2X53 S;  4XLA A;  5HKK A;  1E79 A;  1E1Q A;  2JDI A;  3OPO A;  1UD4 A;  2GJK A;  3CP2 A;  3DDY A;  1EFR A;  1E3X A;  1UD3 A;  2X6X A;  1VLY A;  4B3G A;  1VJS A;  2JIZ A;  3A3G A;  3A35 A;  2W6I A;  2XOK A;  1H8E A;  4XLF A;  3FKS A;  2GK7 A;  4XLH A;  2JJ1 A;  3H94 A;  1BMF A;  4XOP A;  1UD6 A;  1W0K A;  3BCF A;  2ZZG A;  1E1R A;  1V0F A;  4XN0 A;  4G6I A;  2GK6 A;  1WPC A;  1VF7 A;  2DIE A;  1OB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...