3ZPNA

Structure of psb28
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
AMAEIQFIRGINEEVVPDVRLTRARDGSSGQAMFYFDNPKIVQEGNLEVTGMYMVDEEGEIVTRDVNAKFINGQPVAIEATYTMRSPQEWDRFIRFMDRYAASHGLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM II REACTION CENTER PSB28 PROTEIN
publication title Crystal Structure of the Psb28 Accessory Factor of Thermosynechococcus Elongatus Photosystem II at 2.3 A
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 23
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3zpnA00
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
4TSFA 4NCNA 1KK2A 3J81k 3U6BA 1UD2A 1UD6A 4FN5A 4P2NA 2VBVA 1SKQA 4N3GA 3A8KA 1FNCA 3GSIA 1QFJA 4XLEA 4B3XA 4B3FX 2WYRA 3CCJB 2DETA 3CCSB 5E6TA 1F20A 2B5OA 4ZCIA 3CC4B 3W2HA 3FPPA 4II3A 2ZITA 3VMFA 3HAGA 1OB0A 2GK7A 3CMMA 1E63A 1BLIA 2OBSA 3WNCA 4P1VA 1WU8A 3ASPA 3WY9A 2DY1A 4PAAA 1K73D 1T6ZA 4M2LA 5TRDA 1KMHA 5AN9A 2PIAA 4WZLA 1E1RA 4B4DA 1R5OA 2B7CA 4UZUA 4Z4YA 1UMKA 2XZOA 1RQPA 1JJ2B 3CPXA 1H85A 1UD3A 1Q82D 3BY2A 4B44A 1XFOA 3SJPA 2HLDA 3B78A 4ZGQB 5FO1A 3W2EA 4PC3A 4ASUA 4RD1A 3V76A 4XR6A 4L8JA 4M1KA 4P9SA 1CNFA 4YXWA 5KW9A 1KD1D 1SM4A 2GJKA 3QE2A 1ZUNB 4OPOA 1U2RA 3B82A 3ZZ0A 4HE5A 1TVCA 2QA4B 4X7FA 2YWFA 1J9ZA 3OJWA 3I56B 3ASTA 2AHOA 3FPKA 4TKOB 3A1PA 3OPOA 4AF6A 1YJNB 3BQJA 1TLLA 3NE5B 1E1QA 4ZCMA 1WORA 1BX0A 1N05A 5DSZA 4DK0A 5IYQA 2D9RA 1QX4A 4G1BA 3CW2A 1VQ6B 4B3GA 3Q6QA 1YX2A 4PC1A 3MHPA 2X85A 4RD4A 1G7CA 1E3ZA 2CBXA 2BV3A 3BCDA 3CC7B 2GJPA 4PC2A 4TMXA 1E64A 1KJZA 1R5BA 1G7SA 3AVYA 2CF4A 4G5GA 2EIXA 5HZBA 1T6XA 2GPJA 3P27A 3R6JA 4YAWA 1DDIA 1GVHA 4RPDA 3OW2B 2WSSA 2DCUA 2X6YA 4Z4RA 1N07A 3GVJA 4FK8A 1DG1G 2EFGA 4QUZA 1VJSA 4Z4TA 3AGPA 1VLOA 5JBQA 4ACAA 1WPCA 2X6WA 4E0FA 3QFCA 2BMWA 1H8HA 2JJ2A 3OEEA 1KK1A 4P6YA 2OTJB 2QEXB 3G4SB 3MCAA 5L46A 4LBZA 1VQKB 3LO8A 2VBUA 1IJEA 1G7RA 4AC9A 2ZL7A 2E1BA 4ZGNB 1BX1A 3CC2B 4AF7A 4XORA 2Q6KA 3OZVA 3SLNA 4RDKA 3SEJA 2Z6BD 2XEXA 2DIEA 4EH1A 4OOVA 2GK6A 1N06A 3ASQA 1T6YA 1JNYA 4G7WA 4XL9A 2WPDA 1FNDA 2VBSA 3QFRA 5KNLA 1OGJA 4M53A 1Y0YA 3GVLA 3ONUA 4X7EA 4XLCA 3ZZUA 4RDJA 1M1KD 1OB5A 4TMVA 1JB9A 1KC8D 4F7DA 2OYNA 3LQ6A 3B8HA 1QGYA 1NB0A 4N3NA 4P12A 4YHBA 2ZBVA 1ZM4A 4RJLA 2OBTA 4X06A 4YELA 2VJJA 3QFSA 3VR6A 1R5NA 3JQQA 4J0QA 2JN9A 2BPOA 1Y0RA 1WOSA 1EFRA 1KZLA 3FJOA 4GQNA 3ZUGA 3WNDA 4KKUA 2CW5A 2WZNA 5FA6A 4WZEA 4Z4UA 4G6IA 3ZC3A 3RY8A 1KTVA 2I1LA 3AVWA 4AVZA 2V7TA 5FNZA 2HCJB 2E1RA 2WR8A 3W2GA 1QH0A 2CNDA 2D3LA 2FVGA 2PE3A 2V31A 1N8RD 2V4DA 3ASRA 1W34A 1E3XA 1QUFA 1EP3B 4K1XA 1WSRA 4NNJA 1VQOB 1ZM9A 3ZZTA 3BH4A 1ZM2A 3VNVA 2QN6A 1D8TA 4X7CA 5J35A 3ZBTA 1EFCA 1PJ5A 3OP1A 3KEWA 4QVJA 1HVXA 2R6HA 1UD8A 1ZM3A 3OZUA 1GR1A 3A8JA 4RM0A 2BM0A 3PUMA 4XQFA 4QVAA 1PJ6A 3OOCA 3ZPNA 1E62A 4Z1MA 3E20A 3OE7A 1OGIA 4XKWA 2W6JA 1GAWA 3W5VA 1WSVA 1V5VA 4OPSA 4MYTA 3CCLB 1VQ7B 1BPLA 2QGGA 2P3MA 2GJRA 4ACBA 3ISXA 4ZCLA 1W87A 2J7KA 2QTZA 5FIUA 2VYQA 4P25A 1XB2A 1W35A 3DDYA 3GIRA 1QGZA 1GO2A 1YIJB 1Q81D 4PC6A 4IW3B 1B23P 1MRZA 4XLFA 5HZAA 3CCVB 3BY1A 3AVTA 3LQEA 5F4OA 5F4MA 4WZTA 4LBYA 3JQPA 1KQSB 4TT3A 4TMZA 3CCUB 4HE6A 1H42A 5A8AA 1FX0A 4B48A 3CCRB 2C4TA 5EMNA 4TN1A 4PABA 4P6VF 3A35A 2V7QA 5IYWA 1VHEA 2V7WA 2ZZQA 2F43A 3LNNA 1WTHD 4P3YA 2JDIA 2X53S 3AGQA 1VQMB 4X8IA 3Q38A 4QFMA 2ZBUA 2C5BA 4WQMA 5HKKA 3Q6RA 3W5HA 1K9MD 3AVXA 3D26A 4YAFA 4H9GA 3H94A 3T51B 2GQFA 2VJIA 5TY0A 3CD6B 4Y7CA 4PC7A 2QMUA 2OK8A 3U2QA 2XOKA 1UD5A 5A89A 1UD4A 2ZZEA 3G71B 4KKTA 2WZPP 3ZIAA 4PGOA 4YAOA 1GJRA 3Q39A 4XNFA 5CDFA 4X0CA 1QFYA 4HIZA 2V7UA 1K28D 3QFTA 3SKBA 3AVVA 1S4MA 3CESA 2VNJA 1Q7YD 4C0SA 3OW7A 2B7BA 2F4NA 3CPWB 1E43A 1N0VC 1YLOA 1WOOA 1QVFB 1I18A 1MABA 1CQXA 4DNRB 2ZZGA 4RCYA 4OP7A 3T56B 1NDHA 2XZLA 2Q6LA 5H5JA 1QUEA 3CP2A 1EP2B 3VO2A 1YI2B 4X7DA 1YJWB 4DQKA 2VNIA 3CXCB 5IYPA 3OJXA 3CB4A 5BSXA 4XOPA 1VQ8B 1S72B 1AIPA 1JA1A 1NJID 1WDTA 1SKYB 1KK3A 2ZTNA 4G1VA 4QV2A 1YHQB 1PJ7A 5B6IA 4XKVA 4Z4VA 4KKSA 1JA0A 3ONYA 1QFZA 1VQ9B 4G7XA 4RDLA 3G6EB 2ZXIA 2HDNB 1EFTA 3P26A 1WP6A 3AVUA 2BM1A 3I1FA 2C77A 5F4JA 3CRZA 2QE7A 5TR9A 2QDXA 1FNMA 4RD3A 1M90D 2VNKA 5FL7A 1IJFA 1VQLB 4NBSA 2YWGA 1COWA 3OFNA 1W9XA 4QHYA 4TMWA 4X05A 1OB2A 5IK2A 4YAUA 3JQRA 2ZXHA 4XOTA 1OHHA 2CC2A 3E1YE 3ES9A 4X07A 2ZZFA 3OEHA 5A88A 4WWVA 2GREA 2M5SA 2KVOA 1VQ4B 4P22A 3SLDA 2PLFA 5FO0A 4XMYA 1I7PA 1G7TA 2X6XA 2VNHA 4OOXA 1HZEA 5IYNA 2ZL5A 4UAJA 2XZPA 2DEUA 1QG0A 2RC5A 4Z4ZA 1XQBA 3JU4A 1V0FA 3W2FA 1FRQA 5BSYA 2D3NA 3MMPA 2XNDA 4RD2A 2X8KA 3CMEB 4RCZA 3VO1A 2X3UA 2ZL6A 4U9UA 1EWYA 5GV8A 3PA1A 3PENA 2V7XA 2F1MA 3GVKA 1T5EA 2Q6OA 5HXBA 4LBVA 5DS0A 1XE1A 1YITB 3CMAB 1I8DA 1BQEA 1IHMA 2VBTA 5J3OA 1VHOA 2LZJA 3A3BA 4FXUA 1VQNB 1P4MA 5THXA 2Q6IA 3WNBA 5KSWB 1QVGB 1ELOA 2D74A 4C43A 3W2IA 1EP1B 2BVNA 4XLAA 4DK1A 3ASSA 3WBKA 1NB9A 4YALA 4YEJA 3WQZA 3CTAA 2QTLA 4P26A 1IB0A 2BGIA 4DQLA 4LBWA 1HA3A 4OOSA 1YJ9B 1VQPB 2HMAA 1A8PA 2DOGA 5TV2A 3PUNA 1S0UA 1W0KA 3G05A 4Y9UA 1VQ5B 4P3IA 3U6KA 2OBRA 4XN0A 2C5HA 1W0JA 1K8AD 2YWHA 3A8IA 1DDGA 4RD0A 4XONA 5GV7A 2VZLA 1WOPA 2C78A 4B43A 2BSAA 4FWTA 2RC6A 1VLYA 2CK3A 3KL9A 4XLHA 4UZEA 3CCQB 2WJYA 3V7AA 1BMFA 1F60A 2XNJA 2NV4A 2BN4A 2OK7A 4II2A 3OKXA 2OTLB 4BPRA 4Z4SA 3CCMB 4UZFA 1KK0A 2CRVA 3PVDA 4Q7JB 2YWEA 4CQJA 1PKVA 3WXMA 1TUIA 3W5UA 1H8EA 3H9NA 2BF4A 2C2WA 4XN3A 2JJ1A 3I55B 4DNTB 1NBMA 1VF7A 3WYAA 3CP8A 4M4SA 1W2BB 1N0UA 5DN6A 4B47A 4RLZA 3SJZA 1D1NA 4LC0A 1FDRA 3ZBUA 2V7VA 3OAAA 3R6KA 4RPBA 4JMQA 4XD7A 1FNBA 3PA2A 3T53B 5H59A 2X0KA 2PMDA 1B2RA 4WZKA 4MYUA 4Y9RA 2XGJA 1E79A 2R9VA 5IYRA 3VNUA 3GQBA 5LMZA 1V0EA 1RQRA 1EFUA 2DERA 2WJVA 3QSYA 1QGAA 4ROXA 1EXMA 2BGJA 3A3GA 3OZWA 3CCEB 1CNEA 1D2EA 3LVBA 4OPVA 2NPFA 3BCFA 1N08A 1GAQA 4M0LA 1AMOA 1Q86D 1BJKA 2XNCA 4TMTA 2JIZA 3BNWA 1NRKA 4Z4WA 1KRHA 3Q3AA 2DYIA 2C4UA 2F1LA 1TTTA 4R71A 2FX3A 2W6IA 3FKSA 2ZTGA 1FRNA 4XM3A 1Q9SA 3WBJA 1DARA 4RD6A 4ZV4A 3BC9A
chains in the Genus database with same CATH topology
4TSFA 5HKKA 1I8DA 2Z6BD 2DIEA 2LZJA 3A3BA 4FXUA 1UD2A 1UD6A 3H94A 3T51B 2GK6A 2VJIA 4XLEA 4B3FX 4G7WA 4XL9A 2WPDA 4XLAA 4DK1A 5KNLA 2XOKA 1UD5A 3FPPA 3GVLA 4XLCA 4YEJA 3WQZA 1UD4A 4II3A 2ZZEA 3HAGA 1OB0A 2GK7A 3CMMA 4KKTA 1BLIA 2WZPP 3ZIAA 5CDFA 4XNFA 4HIZA 1K28D 4YELA 1KMHA 1W0KA 2VJJA 3G05A 3CESA 3VR6A 4XN0A 1W0JA 1E1RA 3OW7A 4UZUA 2XZOA 1E43A 1EFRA 1KZLA 4GQNA 1UD3A 4KKUA 4XONA 4G6IA 2HLDA 1I18A 1MABA 4AVZA 4ASUA 2ZZGA 4DNRB 3T56B 4XLHA 1VLYA 2CK3A 4XR6A 2XZLA 4L8JA 2WJYA 2D3LA 1BMFA 2V31A 3CP2A 4YXWA 2V4DA 2GJKA 1E3XA 4II2A 4NNJA 4XOPA 3BH4A 1PKVA 1SKYB 2ZTNA 3KEWA 1H8EA 1HVXA 4XKVA 1UD8A 4XN3A 2JJ1A 4KKSA 4TKOB 4XQFA 3OPOA 4G7XA 4DNTB 1NBMA 3OOCA 1VF7A 2ZXIA 4Z1MA 3ZPNA 3CP8A 3NE5B 1E1QA 1WP6A 3OE7A 5DN6A 4DK0A 4XKWA 2QE7A 2W6JA 3OAAA 4JMQA 4XD7A 4B3GA 1BPLA 3T53B 2X85A 1E3ZA 2GJRA 5FL7A 3BCDA 2GJPA 2XGJA 1E79A 1COWA 1W9XA 2R9VA 3GQBA 3OFNA 1V0EA 5IK2A 2WJVA 3DDYA 2ZXHA 4XOTA 1OHHA 2ZZFA 3OEHA 4XLFA 3A3GA 2M5SA 2KVOA 2WSSA 2X6YA 4P22A 3BCFA 3GVJA 4XMYA 2X6XA 1VJSA 1HZEA 4TT3A 2XZPA 1WPCA 2X6WA 4E0FA 1FX0A 3JU4A 1V0FA 1H8HA 2JJ2A 3OEEA 2JIZA 2D3NA 1NRKA 2XNDA 3A35A 2X8KA 2V7QA 2ZZQA 2F43A 3LNNA 1WTHD 2W6IA 3FKSA 2ZTGA 2E1BA 2JDIA 2X53S 4XM3A 2F1MA 3GVKA 1T5EA 4XORA 3BC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 4TSF A;  4NCN A;  1KK2 A;  3J81 k;  3U6B A;  1UD2 A;  1UD6 A;  4FN5 A;  4P2N A;  2VBV A;  1SKQ A;  4N3G A;  3A8K A;  1FNC A;  3GSI A;  1QFJ A;  4XLE A;  4B3X A;  4B3F X;  2WYR A;  3CCJ B;  2DET A;  3CCS B;  5E6T A;  1F20 A;  2B5O A;  4ZCI A;  3CC4 B;  3W2H A;  3FPP A;  4II3 A;  2ZIT A;  3VMF A;  3HAG A;  1OB0 A;  2GK7 A;  3CMM A;  1E63 A;  1BLI A;  2OBS A;  3WNC A;  4P1V A;  1WU8 A;  3ASP A;  3WY9 A;  2DY1 A;  4PAA A;  1K73 D;  1T6Z A;  4M2L A;  5TRD A;  1KMH A;  5AN9 A;  2PIA A;  4WZL A;  1E1R A;  4B4D A;  1R5O A;  2B7C A;  4UZU A;  4Z4Y A;  1UMK A;  2XZO A;  1RQP A;  1JJ2 B;  3CPX A;  1H85 A;  1UD3 A;  1Q82 D;  3BY2 A;  4B44 A;  1XFO A;  3SJP A;  2HLD A;  3B78 A;  4ZGQ B;  5FO1 A;  3W2E A;  4PC3 A;  4ASU A;  4RD1 A;  3V76 A;  4XR6 A;  4L8J A;  4M1K A;  4P9S A;  1CNF A;  4YXW A;  5KW9 A;  1KD1 D;  1SM4 A;  2GJK A;  3QE2 A;  1ZUN B;  4OPO A;  1U2R A;  3B82 A;  3ZZ0 A;  4HE5 A;  1TVC A;  2QA4 B;  4X7F A;  2YWF A;  1J9Z A;  3OJW A;  3I56 B;  3AST A;  2AHO A;  3FPK A;  4TKO B;  3A1P A;  3OPO A;  4AF6 A;  1YJN B;  3BQJ A;  1TLL A;  3NE5 B;  1E1Q A;  4ZCM A;  1WOR A;  1BX0 A;  1N05 A;  5DSZ A;  4DK0 A;  5IYQ A;  2D9R A;  1QX4 A;  4G1B A;  3CW2 A;  1VQ6 B;  4B3G A;  3Q6Q A;  1YX2 A;  4PC1 A;  3MHP A;  2X85 A;  4RD4 A;  1G7C A;  1E3Z A;  2CBX A;  2BV3 A;  3BCD A;  3CC7 B;  2GJP A;  4PC2 A;  4TMX A;  1E64 A;  1KJZ A;  1R5B A;  1G7S A;  3AVY A;  2CF4 A;  4G5G A;  2EIX A;  5HZB A;  1T6X A;  2GPJ A;  3P27 A;  3R6J A;  4YAW A;  1DDI A;  1GVH A;  4RPD A;  3OW2 B;  2WSS A;  2DCU A;  2X6Y A;  4Z4R A;  1N07 A;  3GVJ A;  4FK8 A;  1DG1 G;  2EFG A;  4QUZ A;  1VJS A;  4Z4T A;  3AGP A;  1VLO A;  5JBQ A;  4ACA A;  1WPC A;  2X6W A;  4E0F A;  3QFC A;  2BMW A;  1H8H A;  2JJ2 A;  3OEE A;  1KK1 A;  4P6Y A;  2OTJ B;  2QEX B;  3G4S B;  3MCA A;  5L46 A;  4LBZ A;  1VQK B;  3LO8 A;  2VBU A;  1IJE A;  1G7R A;  4AC9 A;  2ZL7 A;  2E1B A;  4ZGN B;  1BX1 A;  3CC2 B;  4AF7 A;  4XOR A;  2Q6K A;  3OZV A;  3SLN A;  4RDK A;  3SEJ A;  2Z6B D;  2XEX A;  2DIE A;  4EH1 A;  4OOV A;  2GK6 A;  1N06 A;  3ASQ A;  1T6Y A;  1JNY A;  4G7W A;  4XL9 A;  2WPD A;  1FND A;  2VBS A;  3QFR A;  5KNL A;  1OGJ A;  4M53 A;  1Y0Y A;  3GVL A;  3ONU A;  4X7E A;  4XLC A;  3ZZU A;  4RDJ A;  1M1K D;  1OB5 A;  4TMV A;  1JB9 A;  1KC8 D;  4F7D A;  2OYN A;  3LQ6 A;  3B8H A;  1QGY A;  1NB0 A;  4N3N A;  4P12 A;  4YHB A;  2ZBV A;  1ZM4 A;  4RJL A;  2OBT A;  4X06 A;  4YEL A;  2VJJ A;  3QFS A;  3VR6 A;  1R5N A;  3JQQ A;  4J0Q A;  2JN9 A;  2BPO A;  1Y0R A;  1WOS A;  1EFR A;  1KZL A;  3FJO A;  4GQN A;  3ZUG A;  3WND A;  4KKU A;  2CW5 A;  2WZN A;  5FA6 A;  4WZE A;  4Z4U A;  4G6I A;  3ZC3 A;  3RY8 A;  1KTV A;  2I1L A;  3AVW A;  4AVZ A;  2V7T A;  5FNZ A;  2HCJ B;  2E1R A;  2WR8 A;  3W2G A;  1QH0 A;  2CND A;  2D3L A;  2FVG A;  2PE3 A;  2V31 A;  1N8R D;  2V4D A;  3ASR A;  1W34 A;  1E3X A;  1QUF A;  1EP3 B;  4K1X A;  1WSR A;  4NNJ A;  1VQO B;  1ZM9 A;  3ZZT A;  3BH4 A;  1ZM2 A;  3VNV A;  2QN6 A;  1D8T A;  4X7C A;  5J35 A;  3ZBT A;  1EFC A;  1PJ5 A;  3OP1 A;  3KEW A;  4QVJ A;  1HVX A;  2R6H A;  1UD8 A;  1ZM3 A;  3OZU A;  1GR1 A;  3A8J A;  4RM0 A;  2BM0 A;  3PUM A;  4XQF A;  4QVA A;  1PJ6 A;  3OOC A;  3ZPN A;  1E62 A;  4Z1M A;  3E20 A;  3OE7 A;  1OGI A;  4XKW A;  2W6J A;  1GAW A;  3W5V A;  1WSV A;  1V5V A;  4OPS A;  4MYT A;  3CCL B;  1VQ7 B;  1BPL A;  2QGG A;  2P3M A;  2GJR A;  4ACB A;  3ISX A;  4ZCL A;  1W87 A;  2J7K A;  2QTZ A;  5FIU A;  2VYQ A;  4P25 A;  1XB2 A;  1W35 A;  3DDY A;  3GIR A;  1QGZ A;  1GO2 A;  1YIJ B;  1Q81 D;  4PC6 A;  4IW3 B;  1B23 P;  1MRZ A;  4XLF A;  5HZA A;  3CCV B;  3BY1 A;  3AVT A;  3LQE A;  5F4O A;  5F4M A;  4WZT A;  4LBY A;  3JQP A;  1KQS B;  4TT3 A;  4TMZ A;  3CCU B;  4HE6 A;  1H42 A;  5A8A A;  1FX0 A;  4B48 A;  3CCR B;  2C4T A;  5EMN A;  4TN1 A;  4PAB A;  4P6V F;  3A35 A;  2V7Q A;  5IYW A;  1VHE A;  2V7W A;  2ZZQ A;  2F43 A;  3LNN A;  1WTH D;  4P3Y A;  2JDI A;  2X53 S;  3AGQ A;  1VQM B;  4X8I A;  3Q38 A;  4QFM A;  2ZBU A;  2C5B A;  4WQM A;  5HKK A;  3Q6R A;  3W5H A;  1K9M D;  3AVX A;  3D26 A;  4YAF A;  4H9G A;  3H94 A;  3T51 B;  2GQF A;  2VJI A;  5TY0 A;  3CD6 B;  4Y7C A;  4PC7 A;  2QMU A;  2OK8 A;  3U2Q A;  2XOK A;  1UD5 A;  5A89 A;  1UD4 A;  2ZZE A;  3G71 B;  4KKT A;  2WZP P;  3ZIA A;  4PGO A;  4YAO A;  1GJR A;  3Q39 A;  4XNF A;  5CDF A;  4X0C A;  1QFY A;  4HIZ A;  2V7U A;  1K28 D;  3QFT A;  3SKB A;  3AVV A;  1S4M A;  3CES A;  2VNJ A;  1Q7Y D;  4C0S A;  3OW7 A;  2B7B A;  2F4N A;  3CPW B;  1E43 A;  1N0V C;  1YLO A;  1WOO A;  1QVF B;  1I18 A;  1MAB A;  1CQX A;  4DNR B;  2ZZG A;  4RCY A;  4OP7 A;  3T56 B;  1NDH A;  2XZL A;  2Q6L A;  5H5J A;  1QUE A;  3CP2 A;  1EP2 B;  3VO2 A;  1YI2 B;  4X7D A;  1YJW B;  4DQK A;  2VNI A;  3CXC B;  5IYP A;  3OJX A;  3CB4 A;  5BSX A;  4XOP A;  1VQ8 B;  1S72 B;  1AIP A;  1JA1 A;  1NJI D;  1WDT A;  1SKY B;  1KK3 A;  2ZTN A;  4G1V A;  4QV2 A;  1YHQ B;  1PJ7 A;  5B6I A;  4XKV A;  4Z4V A;  4KKS A;  1JA0 A;  3ONY A;  1QFZ A;  1VQ9 B;  4G7X A;  4RDL A;  3G6E B;  2ZXI A;  2HDN B;  1EFT A;  3P26 A;  1WP6 A;  3AVU A;  2BM1 A;  3I1F A;  2C77 A;  5F4J A;  3CRZ A;  2QE7 A;  5TR9 A;  2QDX A;  1FNM A;  4RD3 A;  1M90 D;  2VNK A;  5FL7 A;  1IJF A;  1VQL B;  4NBS A;  2YWG A;  1COW A;  3OFN A;  1W9X A;  4QHY A;  4TMW A;  4X05 A;  1OB2 A;  5IK2 A;  4YAU A;  3JQR A;  2ZXH A;  4XOT A;  1OHH A;  2CC2 A;  3E1Y E;  3ES9 A;  4X07 A;  2ZZF A;  3OEH A;  5A88 A;  4WWV A;  2GRE A;  2M5S A;  2KVO A;  1VQ4 B;  4P22 A;  3SLD A;  2PLF A;  5FO0 A;  4XMY A;  1I7P A;  1G7T A;  2X6X A;  2VNH A;  4OOX A;  1HZE A;  5IYN A;  2ZL5 A;  4UAJ A;  2XZP A;  2DEU A;  1QG0 A;  2RC5 A;  4Z4Z A;  1XQB A;  3JU4 A;  1V0F A;  3W2F A;  1FRQ A;  5BSY A;  2D3N A;  3MMP A;  2XND A;  4RD2 A;  2X8K A;  3CME B;  4RCZ A;  3VO1 A;  2X3U A;  2ZL6 A;  4U9U A;  1EWY A;  5GV8 A;  3PA1 A;  3PEN A;  2V7X A;  2F1M A;  3GVK A;  1T5E A;  2Q6O A;  5HXB A;  4LBV A;  5DS0 A;  1XE1 A;  1YIT B;  3CMA B;  1I8D A;  1BQE A;  1IHM A;  2VBT A;  5J3O A;  1VHO A;  2LZJ A;  3A3B A;  4FXU A;  1VQN B;  1P4M A;  5THX A;  2Q6I A;  3WNB A;  5KSW B;  1QVG B;  1ELO A;  2D74 A;  4C43 A;  3W2I A;  1EP1 B;  2BVN A;  4XLA A;  4DK1 A;  3ASS A;  3WBK A;  1NB9 A;  4YAL A;  4YEJ A;  3WQZ A;  3CTA A;  2QTL A;  4P26 A;  1IB0 A;  2BGI A;  4DQL A;  4LBW A;  1HA3 A;  4OOS A;  1YJ9 B;  1VQP B;  2HMA A;  1A8P A;  2DOG A;  5TV2 A;  3PUN A;  1S0U A;  1W0K A;  3G05 A;  4Y9U A;  1VQ5 B;  4P3I A;  3U6K A;  2OBR A;  4XN0 A;  2C5H A;  1W0J A;  1K8A D;  2YWH A;  3A8I A;  1DDG A;  4RD0 A;  4XON A;  5GV7 A;  2VZL A;  1WOP A;  2C78 A;  4B43 A;  2BSA A;  4FWT A;  2RC6 A;  1VLY A;  2CK3 A;  3KL9 A;  4XLH A;  4UZE A;  3CCQ B;  2WJY A;  3V7A A;  1BMF A;  1F60 A;  2XNJ A;  2NV4 A;  2BN4 A;  2OK7 A;  4II2 A;  3OKX A;  2OTL B;  4BPR A;  4Z4S A;  3CCM B;  4UZF A;  1KK0 A;  2CRV A;  3PVD A;  4Q7J B;  2YWE A;  4CQJ A;  1PKV A;  3WXM A;  1TUI A;  3W5U A;  1H8E A;  3H9N A;  2BF4 A;  2C2W A;  4XN3 A;  2JJ1 A;  3I55 B;  4DNT B;  1NBM A;  1VF7 A;  3WYA A;  3CP8 A;  4M4S A;  1W2B B;  1N0U A;  5DN6 A;  4B47 A;  4RLZ A;  3SJZ A;  1D1N A;  4LC0 A;  1FDR A;  3ZBU A;  2V7V A;  3OAA A;  3R6K A;  4RPB A;  4JMQ A;  4XD7 A;  1FNB A;  3PA2 A;  3T53 B;  5H59 A;  2X0K A;  2PMD A;  1B2R A;  4WZK A;  4MYU A;  4Y9R A;  2XGJ A;  1E79 A;  2R9V A;  5IYR A;  3VNU A;  3GQB A;  5LMZ A;  1V0E A;  1RQR A;  1EFU A;  2DER A;  2WJV A;  3QSY A;  1QGA A;  4ROX A;  1EXM A;  2BGJ A;  3A3G A;  3OZW A;  3CCE B;  1CNE A;  1D2E A;  3LVB A;  4OPV A;  2NPF A;  3BCF A;  1N08 A;  1GAQ A;  4M0L A;  1AMO A;  1Q86 D;  1BJK A;  2XNC A;  4TMT A;  2JIZ A;  3BNW A;  1NRK A;  4Z4W A;  1KRH A;  3Q3A A;  2DYI A;  2C4U A;  2F1L A;  1TTT A;  4R71 A;  2FX3 A;  2W6I A;  3FKS A;  2ZTG A;  1FRN A;  4XM3 A;  1Q9S A;  3WBJ A;  1DAR A;  4RD6 A;  4ZV4 A;  3BC9 A; 
#chains in the Genus database with same CATH homology
 4TSF A;  5HKK A;  1I8D A;  2Z6B D;  2DIE A;  2LZJ A;  3A3B A;  4FXU A;  1UD2 A;  1UD6 A;  3H94 A;  3T51 B;  2GK6 A;  2VJI A;  4XLE A;  4B3F X;  4G7W A;  4XL9 A;  2WPD A;  4XLA A;  4DK1 A;  5KNL A;  2XOK A;  1UD5 A;  3FPP A;  3GVL A;  4XLC A;  4YEJ A;  3WQZ A;  1UD4 A;  4II3 A;  2ZZE A;  3HAG A;  1OB0 A;  2GK7 A;  3CMM A;  4KKT A;  1BLI A;  2WZP P;  3ZIA A;  5CDF A;  4XNF A;  4HIZ A;  1K28 D;  4YEL A;  1KMH A;  1W0K A;  2VJJ A;  3G05 A;  3CES A;  3VR6 A;  4XN0 A;  1W0J A;  1E1R A;  3OW7 A;  4UZU A;  2XZO A;  1E43 A;  1EFR A;  1KZL A;  4GQN A;  1UD3 A;  4KKU A;  4XON A;  4G6I A;  2HLD A;  1I18 A;  1MAB A;  4AVZ A;  4ASU A;  2ZZG A;  4DNR B;  3T56 B;  4XLH A;  1VLY A;  2CK3 A;  4XR6 A;  2XZL A;  4L8J A;  2WJY A;  2D3L A;  1BMF A;  2V31 A;  3CP2 A;  4YXW A;  2V4D A;  2GJK A;  1E3X A;  4II2 A;  4NNJ A;  4XOP A;  3BH4 A;  1PKV A;  1SKY B;  2ZTN A;  3KEW A;  1H8E A;  1HVX A;  4XKV A;  1UD8 A;  4XN3 A;  2JJ1 A;  4KKS A;  4TKO B;  4XQF A;  3OPO A;  4G7X A;  4DNT B;  1NBM A;  3OOC A;  1VF7 A;  2ZXI A;  4Z1M A;  3ZPN A;  3CP8 A;  3NE5 B;  1E1Q A;  1WP6 A;  3OE7 A;  5DN6 A;  4DK0 A;  4XKW A;  2QE7 A;  2W6J A;  3OAA A;  4JMQ A;  4XD7 A;  4B3G A;  1BPL A;  3T53 B;  2X85 A;  1E3Z A;  2GJR A;  5FL7 A;  3BCD A;  2GJP A;  2XGJ A;  1E79 A;  1COW A;  1W9X A;  2R9V A;  3GQB A;  3OFN A;  1V0E A;  5IK2 A;  2WJV A;  3DDY A;  2ZXH A;  4XOT A;  1OHH A;  2ZZF A;  3OEH A;  4XLF A;  3A3G A;  2M5S A;  2KVO A;  2WSS A;  2X6Y A;  4P22 A;  3BCF A;  3GVJ A;  4XMY A;  2X6X A;  1VJS A;  1HZE A;  4TT3 A;  2XZP A;  1WPC A;  2X6W A;  4E0F A;  1FX0 A;  3JU4 A;  1V0F A;  1H8H A;  2JJ2 A;  3OEE A;  2JIZ A;  2D3N A;  1NRK A;  2XND A;  3A35 A;  2X8K A;  2V7Q A;  2ZZQ A;  2F43 A;  3LNN A;  1WTH D;  2W6I A;  3FKS A;  2ZTG A;  2E1B A;  2JDI A;  2X53 S;  4XM3 A;  2F1M A;  3GVK A;  1T5E A;  4XOR A;  3BC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...