3ZPNA

Structure of psb28
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
AMAEIQFIRGINEEVVPDVRLTRARDGSSGQAMFYFDNPKIVQEGNLEVTGMYMVDEEGEIVTRDVNAKFINGQPVAIEATYTMRSPQEWDRFIRFMDRYAASHGLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM II REACTION CENTER PSB28 PROTEIN
publication title Crystal Structure of the Psb28 Accessory Factor of Thermosynechococcus Elongatus Photosystem II at 2.3 A
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Photosynthesis
total genus 23
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03912 Psb28 Psb28 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.220 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3zpnA00
2KVOA 3ZPNA
chains in the Genus database with same CATH superfamily
3OJWA 4ZGQB 4OOXA 4TMZA 4LC0A 1KRHA 4TMWA 1W9XA 2V7TA 1VF7A 2D74A 1F20A 1N06A 3JQPA 2DOGA 4B3FX 2X6WA 3AVUA 1W35A 4XD7A 4B43A 1OB2A 1VHOA 2C4UA 3SLDA 1MRZA 2BM0A 1GAWA 3OEHA 3WQZA 1YJ9B 3PA1A 1OB5A 4Z4YA 2CF4A 2VJJA 3T53B 2R9VA 3A8JA 4II3A 3OZWA 1W0KA 3W2IA 4ASUA 4R71A 5CDFA 4RPBA 4TKOB 2X3UA 3AGPA 4II2A 1NB9A 4HE6A 2XGJA 2PE3A 2ZZEA 4WZKA 3CCVB 1SM4A 3BCFA 4M1KA 2OK8A 2JDIA 1UD6A 2PIAA 2QMUA 2OBSA 5A8AA 2XZOA 1HZEA 1Q86D 4DQKA 1FNMA 2WR8A 3Q38A 5GV7A 5TRDA 4YAWA 3B8HA 2C5HA 3VMFA 1VJSA 4P9SA 1EP3B 4X06A 3U6KA 1BPLA 2OK7A 2EFGA 1KK3A 4G1BA 2B7CA 4YAFA 1Y0RA 1UD3A 5FNZA 4DK1A 1N07A 4PGOA 1WOPA 2QE7A 2XNDA 3T56B 1VQ9B 4PABA 3ZZTA 5HKKA 5BSXA 1VQOB 4XLAA 1WTHD 1D2EA 3WY9A 4AF6A 1QGAA 4P3YA 1V0EA 4TN1A 2QGGA 4RD1A 1T5EA 3E1YE 3CMAB 3CPWB 3GQBA 1V5VA 1XFOA 1VQ4B 2CRVA 4XORA 4RDJA 4XL9A 4PC1A 1DARA 4PC3A 4XNFA 2XNCA 4UZFA 2PMDA 4B3GA 2XZLA 3A3BA 1EFRA 2QTLA 4LBVA 2QEXB 3VNUA 1QUEA 2VZLA 2CNDA 1E3XA 4QVJA 4K1XA 2GJKA 4X8IA 5IYPA 3AGQA 2ZTNA 4DK0A 4B4DA 1GO2A 4E0FA 3PENA 4M4SA 3CCJB 1QUFA 1GR1A 3ZZ0A 1Q7YD 4BPRA 4U9UA 1WPCA 4NBSA 1QFZA 4RDLA 4RD2A 3J81k 5FO0A 3HAGA 3KL9A 4RLZA 1VQ6B 4XN0A 4QHYA 4OPSA 1COWA 4DNTB 4TMVA 4OOVA 4B3XA 2DCUA 2V7QA 2P3MA 3BY2A 3AVXA 2X6YA 3B82A 3LQEA 1TVCA 4PAAA 5BSYA 3BCDA 5JBQA 4B47A 3WYAA 2BN4A 4XN3A 1JA1A 1G7RA 1M1KD 2B5OA 4PC7A 1JB9A 1VQPB 2Q6OA 3G71B 3BY1A 4AVZA 4YXWA 2DERA 3Q39A 1Y0YA 4C43A 1W2BB 4N3GA 1E1QA 2V7VA 4P12A 5KSWB 2DYIA 1G7SA 1IB0A 3A8IA 1QG0A 5DN6A 2OTLB 2BGIA 3QSYA 4P3IA 4Y9UA 1J9ZA 1WSVA 1R5BA 4FK8A 3PUMA 1VLYA 3CMEB 4OOSA 4G5GA 1CNEA 2AHOA 1KC8D 2X0KA 3ZUGA 1YI2B 1Q82D 5J3OA 4RCYA 3QFSA 1EXMA 1GAQA 2KVOA 2V7UA 3AVYA 1EWYA 3H9NA 2OTJB 2D9RA 1PJ5A 1BX0A 2W6JA 3KEWA 3ONUA 3LO8A 2DIEA 1VQLB 4WZEA 3JQRA 2WPDA 3ZBTA 2GQFA 1WORA 1XB2A 2NPFA 5FA6A 1YJWB 2JJ1A 1W0JA 3FKSA 3NE5B 4XLHA 2GK7A 3GVLA 3W2FA 2BM1A 1JJ2B 1P4MA 1VQNB 2ZTGA 4RD4A 1F60A 5THXA 1H42A 2J7KA 1V0FA 2YWGA 5FIUA 1T6XA 1GVHA 5TV2A 5DS0A 1CQXA 2WZNA 5TR9A 4QV2A 1T6ZA 2V7WA 2VBVA 3W2HA 5A88A 1OB0A 3CCUB 1UMKA 3WBJA 2VBTA 3W5HA 3H94A 3JU4A 4TT3A 1ZUNB 2ZITA 4LBYA 1Q9SA 2VNKA 1Q81D 5L46A 3PVDA 4RD0A 1YITB 1D8TA 4DNRB 2E1BA 1QGZA 4ZV4A 2QTZA 3OZUA 1S0UA 4MYTA 3CCRB 1K28D 4OP7A 2B7BA 1XE1A 2C4TA 5HXBA 3Q3AA 1WOSA 3ES9A 4FWTA 4Z4TA 1N0UA 3B78A 3WXMA 2BVNA 3ZPNA 2C2WA 4X7DA 3FJOA 2Q6LA 2F43A 2CW5A 4OPVA 5H59A 1T6YA 2XNJA 3CCLB 1EFUA 4P2NA 2R6HA 3SJZA 1OGIA 1AIPA 1WU8A 3I55B 4JMQA 1IJEA 2C78A 3G6EB 5F4MA 2C77A 2E1RA 4L8JA 4CQJA 1VQ5B 4DQLA 1G7CA 2OYNA 1EFTA 3ASQA 2HDNB 4Z1MA 4Z4WA 4B44A 3RY8A 3P26A 2Q6KA 1OHHA 2CBXA 4GQNA 1E1RA 2NV4A 3ZIAA 1QVFB 1UD5A 3ASTA 4XOTA 1DDGA 4RD3A 3GVKA 3CMMA 4TSFA 1TTTA 3MHPA 1BX1A 4RJLA 3GVJA 1QH0A 1E63A 3VO2A 2F1MA 2WSSA 4YELA 3WNCA 4TMXA 1B23P 2V7XA 1UD4A 4M2LA 4Z4ZA 3WNBA 3ZBUA 4X05A 3V76A 4XR6A 4ZGNB 4X0CA 2WYRA 3DDYA 2ZXHA 3BC9A 4XONA 4X7FA 5FL7A 1VQ8B 3AVWA 1EP2B 1OGJA 1I7PA 4FXUA 3AVVA 4G6IA 1BLIA 4P26A 4XLCA 1EFCA 5IYWA 3G4SB 3W5UA 4HE5A 1NJID 4QUZA 3OFNA 4P6VF 1EP1B 1FNDA 3ASRA 2X85A 2JIZA 3CD6B 2ZL5A 1FNCA 4QFMA 3U2QA 3CC2B 4Y7CA 1ZM9A 2EIXA 2XEXA 4MYUA 3BNWA 1ZM3A 3QFTA 2DETA 1U2RA 5IYNA 2D3LA 1H8EA 1PJ6A 4G7XA 4HIZA 4QVAA 4X07A 3W2GA 3W2EA 4ACAA 3PUNA 2VNHA 4LBZA 1TUIA 4F7DA 3JQQA 2BMWA 5IK2A 3SLNA 2CC2A 2V31A 3OPOA 3W5VA 1E3ZA 2VJIA 4Q7JB 2HCJB 2CK3A 4C0SA 3CCQB 4XLFA 3ISXA 4KKTA 4NCNA 2FVGA 2RC6A 3CCMB 1PJ7A 5F4OA 1ZM2A 2WJVA 3I1FA 3OOCA 1W87A 1HVXA 4X7EA 3SJPA 3VO1A 5AN9A 1KJZA 1B2RA 1H8HA 3BQJA 1D1NA 1DG1G 4UZUA 1WDTA 2JN9A 2QN6A 4XQFA 1ZM4A 1KTVA 1E62A 4Z4SA 2I1LA 1S4MA 1E64A 1KK1A 3MCAA 1KD1D 3R6JA 4XMYA 2ZZFA 1NB0A 5E6TA 4UZEA 1VHEA 1S72B 3LQ6A 2VNIA 3P27A 3OZVA 3U6BA 5FO1A 1QX4A 1KMHA 4ZCLA 3VR6A 2ZBUA 2YWFA 3CPXA 3CTAA 2F4NA 4EH1A 2C5BA 3MMPA 1FDRA 5B6IA 2VBSA 3ZC3A 3LVBA 3FPKA 4PC2A 5H5JA 2PLFA 1M90D 1E79A 1TLLA 2YWEA 4UAJA 2Q6IA 2QDXA 1NDHA 3T51B 1YIJB 2BF4A 2JJ2A 2WJYA 4B48A 3A35A 4OPOA 1K9MD 4P22A 2XOKA 3OE7A 3SEJA 3CC7B 4ZCIA 4M0LA 3OW2B 2VBUA 2XZPA 5HZAA 3OW7A 4KKUA 1MABA 1SKQA 4RD6A 4XKWA 2OBRA 3VNVA 1DDIA 3QE2A 4ROXA 5TY0A 2OBTA 3LNNA 3QFCA 5EMNA 1RQRA 3CW2A 1JNYA 1BMFA 3A8KA 3Q6RA 3I56B 5KW9A 1N8RD 4WQMA 4Y9RA 1WP6A 3PA2A 4RM0A 2GJRA 1VLOA 2BPOA 1QVGB 3OP1A 1R5NA 3CCEB 3R6KA 1VQKB 3E20A 5A89A 1K8AD 2GJPA 4H9GA 4LBWA 3AVTA 3WBKA 1YHQB 1YJNB 3Q6QA 4YAUA 4P25A 2M5SA 5KNLA 2HLDA 4RDKA 4WZLA 5HZBA 4AC9A 4XOPA 2HMAA 1H85A 3BH4A 1E43A 4IW3B 1I18A 3ZZUA 3CC4B 1JA0A 1W34A 1RQPA 2X6XA 4J0QA 2LZJA 2D3NA 5J35A 1ELOA 4YALA 4G7WA 3A1PA 2VYQA 1KK0A 3V7AA 1WSRA 2BV3A 1R5OA 3CP8A 4P1VA 4NNJA 5GV8A 2ZZGA 1VQMB 4Z4UA 5IYQA 1N05A 1BQEA 4N3NA 4TMTA 1YX2A 2QA4B 3GSIA 2BSAA 1UD2A 4FN5A 3CESA 1IHMA 1QFYA 2DY1A 1AMOA 1KZLA 1FRQA 1YLOA 1KQSB 1WOOA 2GREA 5F4JA 2YWHA 1N08A 4AF7A 1VQ7B 3D26A 2FX3A 1IJFA 2ZL7A 4ZCMA 1CNFA 1FNBA 1XQBA 2ZZQA 1UD8A 1QFJA 5DSZA 3CRZA 4XM3A 2BGJA 2VNJA 1NBMA 3SKBA 3ASSA 5IYRA 1K73D 3CB4A 4M53A 2ZL6A 5LMZA 4XKVA 4P6YA 4Z4RA 2ZXIA 3CP2A 3OJXA 1SKYB 4RCZA 1PKVA 4Z4VA 2WZPP 1QGYA 2GK6A 3CCSB 3GIRA 3OKXA 3FPPA 1HA3A 2W6IA 4XLEA 1N0VC 1BJKA 3A3GA 1A8PA 1GJRA 3OAAA 4PC6A 2X8KA 3ASPA 3G05A 4WWVA 4RPDA 4YEJA 2GPJA 4KKSA 3ONYA 3WNDA 3OEEA 1KK2A 2V4DA 2F1LA 2DEUA 1FRNA 1NRKA 3QFRA 2Z6BD 4WZTA 4X7CA 4YHBA 2RC5A 4YAOA 4ACBA 2X53S 4G1VA 1FX0A 1G7TA 3CXCB 1I8DA 2ZBVA
chains in the Genus database with same CATH topology
3GVKA 3CMMA 1MABA 4TSFA 4XKWA 4AVZA 4YXWA 1W9XA 3LNNA 1E1QA 1VF7A 3GVJA 1BMFA 4B3FX 2F1MA 2WSSA 2X6WA 4YELA 5DN6A 1WP6A 2GJRA 4XD7A 1UD4A 4XR6A 3OEHA 3WQZA 2GJPA 1VLYA 2ZXHA 3BC9A 3DDYA 4XONA 5FL7A 2VJJA 3T53B 2R9VA 4KKUA 4II3A 1W0KA 4ASUA 2KVOA 4FXUA 5CDFA 4G6IA 4TKOB 1BLIA 4XLCA 2M5SA 4II2A 5KNLA 2W6JA 2HLDA 2XGJA 3KEWA 2ZZEA 4XOPA 2DIEA 3BCFA 2WPDA 3OFNA 2JDIA 1UD6A 1E43A 3BH4A 1I18A 2X85A 2JIZA 2XZOA 1HZEA 2JJ1A 1W0JA 3FKSA 2X6XA 3NE5B 4XLHA 2GK7A 2LZJA 2D3NA 3GVLA 2ZTGA 4G7WA 1V0FA 1VJSA 2D3LA 1H8EA 3CP8A 4G7XA 4HIZA 1BPLA 2ZZGA 4NNJA 1OB0A 1UD3A 1UD2A 5IK2A 4DK1A 2QE7A 2XNDA 3T56B 3CESA 2V31A 3H94A 3JU4A 3OPOA 4TT3A 1E3ZA 2VJIA 2CK3A 5HKKA 4XLFA 1KZLA 1WTHD 4KKTA 4XLAA 1V0EA 4DNRB 1T5EA 2E1BA 2WJVA 3OOCA 3GQBA 1HVXA 2ZZQA 4XORA 1H8HA 1K28D 1UD8A 4XL9A 4UZUA 4XM3A 1NBMA 4XNFA 4XQFA 4B3GA 2XZLA 3A3BA 1EFRA 4XKVA 2ZXIA 3CP2A 4XMYA 1SKYB 1PKVA 2ZZFA 3ZPNA 1E3XA 2WZPP 2F43A 2GJKA 2GK6A 2ZTNA 3FPPA 4DK0A 1KMHA 2W6IA 3VR6A 4XLEA 4E0FA 3A3GA 1WPCA 3OAAA 4JMQA 2X8KA 3G05A 4YEJA 4KKSA 3OEEA 4L8JA 3HAGA 2V4DA 4XN0A 2XZPA 1E79A 1COWA 4DNTB 1NRKA 2V7QA 2Z6BD 3T51B 4Z1MA 2X6YA 2JJ2A 2WJYA 3A35A 3BCDA 1OHHA 4GQNA 1E1RA 2X53S 2XOKA 3OE7A 4P22A 3ZIAA 1UD5A 1FX0A 4XOTA 1I8DA 4XN3A 3OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVO A;  3ZPN A; 
#chains in the Genus database with same CATH topology
 3OJW A;  4ZGQ B;  4OOX A;  4TMZ A;  4LC0 A;  1KRH A;  4TMW A;  1W9X A;  2V7T A;  1VF7 A;  2D74 A;  1F20 A;  1N06 A;  3JQP A;  2DOG A;  4B3F X;  2X6W A;  3AVU A;  1W35 A;  4XD7 A;  4B43 A;  1OB2 A;  1VHO A;  2C4U A;  3SLD A;  1MRZ A;  2BM0 A;  1GAW A;  3OEH A;  3WQZ A;  1YJ9 B;  3PA1 A;  1OB5 A;  4Z4Y A;  2CF4 A;  2VJJ A;  3T53 B;  2R9V A;  3A8J A;  4II3 A;  3OZW A;  1W0K A;  3W2I A;  4ASU A;  4R71 A;  5CDF A;  4RPB A;  4TKO B;  2X3U A;  3AGP A;  4II2 A;  1NB9 A;  4HE6 A;  2XGJ A;  2PE3 A;  2ZZE A;  4WZK A;  3CCV B;  1SM4 A;  3BCF A;  4M1K A;  2OK8 A;  2JDI A;  1UD6 A;  2PIA A;  2QMU A;  2OBS A;  5A8A A;  2XZO A;  1HZE A;  1Q86 D;  4DQK A;  1FNM A;  2WR8 A;  3Q38 A;  5GV7 A;  5TRD A;  4YAW A;  3B8H A;  2C5H A;  3VMF A;  1VJS A;  4P9S A;  1EP3 B;  4X06 A;  3U6K A;  1BPL A;  2OK7 A;  2EFG A;  1KK3 A;  4G1B A;  2B7C A;  4YAF A;  1Y0R A;  1UD3 A;  5FNZ A;  4DK1 A;  1N07 A;  4PGO A;  1WOP A;  2QE7 A;  2XND A;  3T56 B;  1VQ9 B;  4PAB A;  3ZZT A;  5HKK A;  5BSX A;  1VQO B;  4XLA A;  1WTH D;  1D2E A;  3WY9 A;  4AF6 A;  1QGA A;  4P3Y A;  1V0E A;  4TN1 A;  2QGG A;  4RD1 A;  1T5E A;  3E1Y E;  3CMA B;  3CPW B;  3GQB A;  1V5V A;  1XFO A;  1VQ4 B;  2CRV A;  4XOR A;  4RDJ A;  4XL9 A;  4PC1 A;  1DAR A;  4PC3 A;  4XNF A;  2XNC A;  4UZF A;  2PMD A;  4B3G A;  2XZL A;  3A3B A;  1EFR A;  2QTL A;  4LBV A;  2QEX B;  3VNU A;  1QUE A;  2VZL A;  2CND A;  1E3X A;  4QVJ A;  4K1X A;  2GJK A;  4X8I A;  5IYP A;  3AGQ A;  2ZTN A;  4DK0 A;  4B4D A;  1GO2 A;  4E0F A;  3PEN A;  4M4S A;  3CCJ B;  1QUF A;  1GR1 A;  3ZZ0 A;  1Q7Y D;  4BPR A;  4U9U A;  1WPC A;  4NBS A;  1QFZ A;  4RDL A;  4RD2 A;  3J81 k;  5FO0 A;  3HAG A;  3KL9 A;  4RLZ A;  1VQ6 B;  4XN0 A;  4QHY A;  4OPS A;  1COW A;  4DNT B;  4TMV A;  4OOV A;  4B3X A;  2DCU A;  2V7Q A;  2P3M A;  3BY2 A;  3AVX A;  2X6Y A;  3B82 A;  3LQE A;  1TVC A;  4PAA A;  5BSY A;  3BCD A;  5JBQ A;  4B47 A;  3WYA A;  2BN4 A;  4XN3 A;  1JA1 A;  1G7R A;  1M1K D;  2B5O A;  4PC7 A;  1JB9 A;  1VQP B;  2Q6O A;  3G71 B;  3BY1 A;  4AVZ A;  4YXW A;  2DER A;  3Q39 A;  1Y0Y A;  4C43 A;  1W2B B;  4N3G A;  1E1Q A;  2V7V A;  4P12 A;  5KSW B;  2DYI A;  1G7S A;  1IB0 A;  3A8I A;  1QG0 A;  5DN6 A;  2OTL B;  2BGI A;  3QSY A;  4P3I A;  4Y9U A;  1J9Z A;  1WSV A;  1R5B A;  4FK8 A;  3PUM A;  1VLY A;  3CME B;  4OOS A;  4G5G A;  1CNE A;  2AHO A;  1KC8 D;  2X0K A;  3ZUG A;  1YI2 B;  1Q82 D;  5J3O A;  4RCY A;  3QFS A;  1EXM A;  1GAQ A;  2KVO A;  2V7U A;  3AVY A;  1EWY A;  3H9N A;  2OTJ B;  2D9R A;  1PJ5 A;  1BX0 A;  2W6J A;  3KEW A;  3ONU A;  3LO8 A;  2DIE A;  1VQL B;  4WZE A;  3JQR A;  2WPD A;  3ZBT A;  2GQF A;  1WOR A;  1XB2 A;  2NPF A;  5FA6 A;  1YJW B;  2JJ1 A;  1W0J A;  3FKS A;  3NE5 B;  4XLH A;  2GK7 A;  3GVL A;  3W2F A;  2BM1 A;  1JJ2 B;  1P4M A;  1VQN B;  2ZTG A;  4RD4 A;  1F60 A;  5THX A;  1H42 A;  2J7K A;  1V0F A;  2YWG A;  5FIU A;  1T6X A;  1GVH A;  5TV2 A;  5DS0 A;  1CQX A;  2WZN A;  5TR9 A;  4QV2 A;  1T6Z A;  2V7W A;  2VBV A;  3W2H A;  5A88 A;  1OB0 A;  3CCU B;  1UMK A;  3WBJ A;  2VBT A;  3W5H A;  3H94 A;  3JU4 A;  4TT3 A;  1ZUN B;  2ZIT A;  4LBY A;  1Q9S A;  2VNK A;  1Q81 D;  5L46 A;  3PVD A;  4RD0 A;  1YIT B;  1D8T A;  4DNR B;  2E1B A;  1QGZ A;  4ZV4 A;  2QTZ A;  3OZU A;  1S0U A;  4MYT A;  3CCR B;  1K28 D;  4OP7 A;  2B7B A;  1XE1 A;  2C4T A;  5HXB A;  3Q3A A;  1WOS A;  3ES9 A;  4FWT A;  4Z4T A;  1N0U A;  3B78 A;  3WXM A;  2BVN A;  3ZPN A;  2C2W A;  4X7D A;  3FJO A;  2Q6L A;  2F43 A;  2CW5 A;  4OPV A;  5H59 A;  1T6Y A;  2XNJ A;  3CCL B;  1EFU A;  4P2N A;  2R6H A;  3SJZ A;  1OGI A;  1AIP A;  1WU8 A;  3I55 B;  4JMQ A;  1IJE A;  2C78 A;  3G6E B;  5F4M A;  2C77 A;  2E1R A;  4L8J A;  4CQJ A;  1VQ5 B;  4DQL A;  1G7C A;  2OYN A;  1EFT A;  3ASQ A;  2HDN B;  4Z1M A;  4Z4W A;  4B44 A;  3RY8 A;  3P26 A;  2Q6K A;  1OHH A;  2CBX A;  4GQN A;  1E1R A;  2NV4 A;  3ZIA A;  1QVF B;  1UD5 A;  3AST A;  4XOT A;  1DDG A;  4RD3 A;  3GVK A;  3CMM A;  4TSF A;  1TTT A;  3MHP A;  1BX1 A;  4RJL A;  3GVJ A;  1QH0 A;  1E63 A;  3VO2 A;  2F1M A;  2WSS A;  4YEL A;  3WNC A;  4TMX A;  1B23 P;  2V7X A;  1UD4 A;  4M2L A;  4Z4Z A;  3WNB A;  3ZBU A;  4X05 A;  3V76 A;  4XR6 A;  4ZGN B;  4X0C A;  2WYR A;  3DDY A;  2ZXH A;  3BC9 A;  4XON A;  4X7F A;  5FL7 A;  1VQ8 B;  3AVW A;  1EP2 B;  1OGJ A;  1I7P A;  4FXU A;  3AVV A;  4G6I A;  1BLI A;  4P26 A;  4XLC A;  1EFC A;  5IYW A;  3G4S B;  3W5U A;  4HE5 A;  1NJI D;  4QUZ A;  3OFN A;  4P6V F;  1EP1 B;  1FND A;  3ASR A;  2X85 A;  2JIZ A;  3CD6 B;  2ZL5 A;  1FNC A;  4QFM A;  3U2Q A;  3CC2 B;  4Y7C A;  1ZM9 A;  2EIX A;  2XEX A;  4MYU A;  3BNW A;  1ZM3 A;  3QFT A;  2DET A;  1U2R A;  5IYN A;  2D3L A;  1H8E A;  1PJ6 A;  4G7X A;  4HIZ A;  4QVA A;  4X07 A;  3W2G A;  3W2E A;  4ACA A;  3PUN A;  2VNH A;  4LBZ A;  1TUI A;  4F7D A;  3JQQ A;  2BMW A;  5IK2 A;  3SLN A;  2CC2 A;  2V31 A;  3OPO A;  3W5V A;  1E3Z A;  2VJI A;  4Q7J B;  2HCJ B;  2CK3 A;  4C0S A;  3CCQ B;  4XLF A;  3ISX A;  4KKT A;  4NCN A;  2FVG A;  2RC6 A;  3CCM B;  1PJ7 A;  5F4O A;  1ZM2 A;  2WJV A;  3I1F A;  3OOC A;  1W87 A;  1HVX A;  4X7E A;  3SJP A;  3VO1 A;  5AN9 A;  1KJZ A;  1B2R A;  1H8H A;  3BQJ A;  1D1N A;  1DG1 G;  4UZU A;  1WDT A;  2JN9 A;  2QN6 A;  4XQF A;  1ZM4 A;  1KTV A;  1E62 A;  4Z4S A;  2I1L A;  1S4M A;  1E64 A;  1KK1 A;  3MCA A;  1KD1 D;  3R6J A;  4XMY A;  2ZZF A;  1NB0 A;  5E6T A;  4UZE A;  1VHE A;  1S72 B;  3LQ6 A;  2VNI A;  3P27 A;  3OZV A;  3U6B A;  5FO1 A;  1QX4 A;  1KMH A;  4ZCL A;  3VR6 A;  2ZBU A;  2YWF A;  3CPX A;  3CTA A;  2F4N A;  4EH1 A;  2C5B A;  3MMP A;  1FDR A;  5B6I A;  2VBS A;  3ZC3 A;  3LVB A;  3FPK A;  4PC2 A;  5H5J A;  2PLF A;  1M90 D;  1E79 A;  1TLL A;  2YWE A;  4UAJ A;  2Q6I A;  2QDX A;  1NDH A;  3T51 B;  1YIJ B;  2BF4 A;  2JJ2 A;  2WJY A;  4B48 A;  3A35 A;  4OPO A;  1K9M D;  4P22 A;  2XOK A;  3OE7 A;  3SEJ A;  3CC7 B;  4ZCI A;  4M0L A;  3OW2 B;  2VBU A;  2XZP A;  5HZA A;  3OW7 A;  4KKU A;  1MAB A;  1SKQ A;  4RD6 A;  4XKW A;  2OBR A;  3VNV A;  1DDI A;  3QE2 A;  4ROX A;  5TY0 A;  2OBT A;  3LNN A;  3QFC A;  5EMN A;  1RQR A;  3CW2 A;  1JNY A;  1BMF A;  3A8K A;  3Q6R A;  3I56 B;  5KW9 A;  1N8R D;  4WQM A;  4Y9R A;  1WP6 A;  3PA2 A;  4RM0 A;  2GJR A;  1VLO A;  2BPO A;  1QVG B;  3OP1 A;  1R5N A;  3CCE B;  3R6K A;  1VQK B;  3E20 A;  5A89 A;  1K8A D;  2GJP A;  4H9G A;  4LBW A;  3AVT A;  3WBK A;  1YHQ B;  1YJN B;  3Q6Q A;  4YAU A;  4P25 A;  2M5S A;  5KNL A;  2HLD A;  4RDK A;  4WZL A;  5HZB A;  4AC9 A;  4XOP A;  2HMA A;  1H85 A;  3BH4 A;  1E43 A;  4IW3 B;  1I18 A;  3ZZU A;  3CC4 B;  1JA0 A;  1W34 A;  1RQP A;  2X6X A;  4J0Q A;  2LZJ A;  2D3N A;  5J35 A;  1ELO A;  4YAL A;  4G7W A;  3A1P A;  2VYQ A;  1KK0 A;  3V7A A;  1WSR A;  2BV3 A;  1R5O A;  3CP8 A;  4P1V A;  4NNJ A;  5GV8 A;  2ZZG A;  1VQM B;  4Z4U A;  5IYQ A;  1N05 A;  1BQE A;  4N3N A;  4TMT A;  1YX2 A;  2QA4 B;  3GSI A;  2BSA A;  1UD2 A;  4FN5 A;  3CES A;  1IHM A;  1QFY A;  2DY1 A;  1AMO A;  1KZL A;  1FRQ A;  1YLO A;  1KQS B;  1WOO A;  2GRE A;  5F4J A;  2YWH A;  1N08 A;  4AF7 A;  1VQ7 B;  3D26 A;  2FX3 A;  1IJF A;  2ZL7 A;  4ZCM A;  1CNF A;  1FNB A;  1XQB A;  2ZZQ A;  1UD8 A;  1QFJ A;  5DSZ A;  3CRZ A;  4XM3 A;  2BGJ A;  2VNJ A;  1NBM A;  3SKB A;  3ASS A;  5IYR A;  1K73 D;  3CB4 A;  4M53 A;  2ZL6 A;  5LMZ A;  4XKV A;  4P6Y A;  4Z4R A;  2ZXI A;  3CP2 A;  3OJX A;  1SKY B;  4RCZ A;  1PKV A;  4Z4V A;  2WZP P;  1QGY A;  2GK6 A;  3CCS B;  3GIR A;  3OKX A;  3FPP A;  1HA3 A;  2W6I A;  4XLE A;  1N0V C;  1BJK A;  3A3G A;  1A8P A;  1GJR A;  3OAA A;  4PC6 A;  2X8K A;  3ASP A;  3G05 A;  4WWV A;  4RPD A;  4YEJ A;  2GPJ A;  4KKS A;  3ONY A;  3WND A;  3OEE A;  1KK2 A;  2V4D A;  2F1L A;  2DEU A;  1FRN A;  1NRK A;  3QFR A;  2Z6B D;  4WZT A;  4X7C A;  4YHB A;  2RC5 A;  4YAO A;  4ACB A;  2X53 S;  4G1V A;  1FX0 A;  1G7T A;  3CXC B;  1I8D A;  2ZBV A; 
#chains in the Genus database with same CATH homology
 3GVK A;  3CMM A;  1MAB A;  4TSF A;  4XKW A;  4AVZ A;  4YXW A;  1W9X A;  3LNN A;  1E1Q A;  1VF7 A;  3GVJ A;  1BMF A;  4B3F X;  2F1M A;  2WSS A;  2X6W A;  4YEL A;  5DN6 A;  1WP6 A;  2GJR A;  4XD7 A;  1UD4 A;  4XR6 A;  3OEH A;  3WQZ A;  2GJP A;  1VLY A;  2ZXH A;  3BC9 A;  3DDY A;  4XON A;  5FL7 A;  2VJJ A;  3T53 B;  2R9V A;  4KKU A;  4II3 A;  1W0K A;  4ASU A;  2KVO A;  4FXU A;  5CDF A;  4G6I A;  4TKO B;  1BLI A;  4XLC A;  2M5S A;  4II2 A;  5KNL A;  2W6J A;  2HLD A;  2XGJ A;  3KEW A;  2ZZE A;  4XOP A;  2DIE A;  3BCF A;  2WPD A;  3OFN A;  2JDI A;  1UD6 A;  1E43 A;  3BH4 A;  1I18 A;  2X85 A;  2JIZ A;  2XZO A;  1HZE A;  2JJ1 A;  1W0J A;  3FKS A;  2X6X A;  3NE5 B;  4XLH A;  2GK7 A;  2LZJ A;  2D3N A;  3GVL A;  2ZTG A;  4G7W A;  1V0F A;  1VJS A;  2D3L A;  1H8E A;  3CP8 A;  4G7X A;  4HIZ A;  1BPL A;  2ZZG A;  4NNJ A;  1OB0 A;  1UD3 A;  1UD2 A;  5IK2 A;  4DK1 A;  2QE7 A;  2XND A;  3T56 B;  3CES A;  2V31 A;  3H94 A;  3JU4 A;  3OPO A;  4TT3 A;  1E3Z A;  2VJI A;  2CK3 A;  5HKK A;  4XLF A;  1KZL A;  1WTH D;  4KKT A;  4XLA A;  1V0E A;  4DNR B;  1T5E A;  2E1B A;  2WJV A;  3OOC A;  3GQB A;  1HVX A;  2ZZQ A;  4XOR A;  1H8H A;  1K28 D;  1UD8 A;  4XL9 A;  4UZU A;  4XM3 A;  1NBM A;  4XNF A;  4XQF A;  4B3G A;  2XZL A;  3A3B A;  1EFR A;  4XKV A;  2ZXI A;  3CP2 A;  4XMY A;  1SKY B;  1PKV A;  2ZZF A;  3ZPN A;  1E3X A;  2WZP P;  2F43 A;  2GJK A;  2GK6 A;  2ZTN A;  3FPP A;  4DK0 A;  1KMH A;  2W6I A;  3VR6 A;  4XLE A;  4E0F A;  3A3G A;  1WPC A;  3OAA A;  4JMQ A;  2X8K A;  3G05 A;  4YEJ A;  4KKS A;  3OEE A;  4L8J A;  3HAG A;  2V4D A;  4XN0 A;  2XZP A;  1E79 A;  1COW A;  4DNT B;  1NRK A;  2V7Q A;  2Z6B D;  3T51 B;  4Z1M A;  2X6Y A;  2JJ2 A;  2WJY A;  3A35 A;  3BCD A;  1OHH A;  4GQN A;  1E1R A;  2X53 S;  2XOK A;  3OE7 A;  4P22 A;  3ZIA A;  1UD5 A;  1FX0 A;  4XOT A;  1I8D A;  4XN3 A;  3OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...