4G7WA

Crystal structure of the n-terminal domain of the minor coat protein piii from ctxphi
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
SAINCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGEECVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein binding
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7wA00
4G7WA 4G7XA
chains in the Genus database with same CATH superfamily
4U9UA 1G7SA 3CB4A 1WSRA 2WJVA 3B8HA 4QV2A 3CC7B 4XL9A 4RCZA 4TMXA 2F1MA 4L8JA 1NDHA 1DDIA 2NV4A 2OBTA 2JJ1A 2EIXA 4Z4YA 2WZPP 1EP3B 5DN6A 1VQOB 1VQ5B 4RD3A 1QGZA 3GVJA 4TSFA 4TMVA 1D8TA 1FNMA 2V7XA 3FPPA 3BC9A 2F43A 3A8JA 1B23P 2XNJA 5HKKA 4PABA 2OYNA 3OZVA 3OZWA 3Q6RA 4G7WA 4RPDA 3H9NA 4YAOA 2B5OA 2JJ2A 2VBSA 3R6KA 2XGJA 3FKSA 2GK6A 3Q3AA 4CQJA 3OKXA 1GR1A 1RQPA 1NB0A 2FX3A 2WSSA 4IW3B 1FNBA 4AC9A 2GJKA 4XLFA 1FNCA 3WNDA 4H9GA 1ZM3A 3BH4A 4B3XA 1T5EA 3CCJB 5H5JA 5KSWB 2JDIA 2DY1A 5GV7A 5H59A 3WY9A 3T56B 3G71B 1VQ6B 2Z6BD 4RD4A 3RY8A 1VHEA 2C4TA 3AVWA 4P25A 1I7PA 1JB9A 1DARA 3AGPA 4PC1A 4YELA 4B47A 2VZLA 3W5HA 2OBSA 1G7CA 3ZPNA 1J9ZA 2CF4A 4OOVA 1E3ZA 1R5NA 2X0KA 1FDRA 4RD0A 4RCYA 4YXWA 3VMFA 2WPDA 1DDGA 4MYUA 4OOXA 1W0JA 1WP6A 3BY1A 3BY2A 2GREA 4QUZA 1UD2A 1K73D 2BM1A 4P9SA 3AVUA 2E1BA 2EFGA 4XN0A 4RPBA 5DS0A 2XNCA 4G7XA 3ONYA 4TMZA 3BQJA 5IYNA 1VQ4B 1KMHA 3KEWA 3T51B 3W2IA 4X06A 3OJWA 2V7QA 1SKYB 3WBKA 2GK7A 4XQFA 1BJKA 3HAGA 1BX0A 3I55B 1K8AD 3AVYA 1GAWA 5HZAA 1EFUA 3CCVB 4XOTA 4Z4ZA 1F60A 5F4JA 4P3IA 4BPRA 1WDTA 3BNWA 4RD1A 1GAQA 1GVHA 1FRQA 1WU8A 2DYIA 3B78A 3GVLA 4TT3A 4M4SA 2WZNA 5J35A 4ACAA 5JBQA 3WQZA 3G05A 1ZM2A 2PMDA 4P3YA 2C77A 1YI2B 1YITB 5GV8A 4YAUA 3OJXA 1JA1A 2X85A 3ZUGA 1KK1A 3CTAA 3E1YE 4UZUA 3QE2A 1GJRA 1W9XA 4FWTA 3QSYA 4WZLA 2W6JA 2VBUA 3GQBA 1NRKA 3WYAA 3MCAA 3VNUA 2C5BA 4PC7A 2ZZFA 2YWFA 1FX0A 2D3LA 4YAFA 2QDXA 1B2RA 4X8IA 1VQ8B 1KK2A 1QGYA 2ZTGA 1Q86D 3WNBA 5TV2A 2VNIA 4TMWA 1YJ9B 3V76A 2CK3A 3OAAA 2ZL7A 4RJLA 3G6EB 2QMUA 1KK3A 3ZIAA 5F4MA 1KQSB 2E1RA 3ES9A 1CQXA 4GQNA 1D2EA 3Q6QA 3VNVA 3W5VA 1V0EA 2ZL5A 3QFSA 5A8AA 1QVFB 4NCNA 1KRHA 2RC5A 4DNRB 2XZPA 3LVBA 2C78A 1VQLB 4OOSA 3ASQA 1UMKA 3AVTA 1UD6A 4N3NA 1H85A 4XKWA 4XLCA 1QFZA 1E3XA 2BSAA 1Q81D 4XONA 4Y9RA 2CBXA 3P27A 1IJFA 1JNYA 3R6JA 3OFNA 4Z4RA 1I18A 4QFMA 2F1LA 4Y9UA 4LBZA 3WNCA 4ZGNB 1T6YA 1UD3A 1WOSA 3MHPA 1BPLA 2B7BA 2ZBVA 3OEEA 2OTJB 3JU4A 1N05A 3PENA 1SKQA 1EFCA 4B43A 3CCUB 3U6BA 1QX4A 2BF4A 2WYRA 4ZCMA 4LC0A 4TKOB 3CPWB 4M2LA 1HA3A 3CMMA 1EP2B 1EWYA 5IYPA 3VO1A 4ZV4A 3SKBA 4X0CA 4XM3A 3CXCB 4AF6A 5KNLA 3I56B 1VF7A 2V7VA 4C0SA 4RDLA 4B3GA 3D26A 1KK0A 1PJ6A 1A8PA 2YWHA 4HE6A 1SM4A 5A89A 4X7CA 3A3GA 4RDJA 1E1RA 2QTLA 1UD5A 2XEXA 2V7TA 1ZM4A 4KKUA 1RQRA 5FNZA 3QFRA 4Z4VA 3U6KA 1H8HA 3OZUA 4KKTA 3J81k 1OB0A 1I8DA 4XLHA 2Q6OA 4B3FX 1IB0A 4ZGQB 2DETA 3B82A 3QFCA 3ZZUA 5TRDA 1E63A 1COWA 1ZM9A 4OP7A 5TY0A 4PC6A 4XNFA 4WZKA 4B48A 1NB9A 1QFJA 2Q6KA 4XD7A 4RLZA 1VQ7B 2ZXIA 1QUFA 4Q7JB 5KW9A 3PUNA 2X6YA 1S72B 2BGIA 3GSIA 4NNJA 4ASUA 5IYWA 2YWEA 3CRZA 4HIZA 2XOKA 4Z4UA 1D1NA 2J7KA 1EP1B 4C43A 1OHHA 1MRZA 1W34A 2ZXHA 4P22A 2W6IA 3PVDA 1WOPA 2BV3A 5BSXA 1N06A 3FJOA 1N8RD 4X07A 4TMTA 3CMEB 4M1KA 4JMQA 1WORA 4DQLA 3W2GA 1HZEA 4TN1A 1R5BA 2CRVA 4G6IA 1P4MA 1QG0A 1TUIA 5B6IA 2OK8A 3DDYA 2YWGA 1PJ5A 3WXMA 1W2BB 3ISXA 2RC6A 4AF7A 3ZBTA 5TR9A 2VBTA 4Z4SA 3T53B 5IYQA 2VJIA 4Z1MA 1N0UA 2B7CA 4P1VA 1YLOA 2BGJA 1N07A 2DCUA 1VLOA 2BN4A 2X6WA 4M53A 2JN9A 1Y0RA 3V7AA 1V5VA 4RD6A 2ZTNA 2V7UA 1T6XA 2VNHA 4RDKA 1U2RA 1QVGB 3VO2A 1EFTA 1YX2A 3PA1A 3CCSB 2QGGA 4KKSA 3JQRA 1FNDA 4R71A 2XZOA 3ZC3A 1IHMA 4ZCIA 3MMPA 2VNJA 3SEJA 3CC2B 2VYQA 2X3UA 5CDFA 4M0LA 3CCLB 5E6TA 3LQ6A 3A35A 4YALA 1JA0A 4LBWA 4XR6A 1V0FA 2V4DA 1OB2A 4WZTA 2QE7A 5FL7A 3CP2A 1G7TA 2HCJB 1G7RA 2LZJA 1N08A 4QVJA 1GO2A 4X7DA 1WPCA 2KVOA 3Q38A 1YJNB 1M1KD 3NE5B 4DQKA 3OPOA 2HMAA 3ZZ0A 4WWVA 4OPOA 2QA4B 4AVZA 2V7WA 3OE7A 4E0FA 2DIEA 3OW7A 3ASSA 3CCQB 4QVAA 1VHOA 4HE5A 2V31A 4RD2A 2D9RA 4FN5A 4P2NA 1E62A 1NJID 1H42A 1M90D 2AHOA 4XKVA 5HZBA 3CPXA 2GJRA 2X6XA 2R9VA 2BPOA 4FK8A 4UZFA 1MABA 4PC3A 1OB5A 2XNDA 4X7FA 3W2EA 2OTLB 5L46A 4K1XA 4UAJA 2XZLA 5AN9A 4DK0A 1FRNA 1QH0A 4XLEA 1WSVA 1JJ2B 1S0UA 1XB2A 2GQFA 4LBYA 1CNEA 4X05A 4PAAA 2ZZEA 4G1BA 1ELOA 3PUMA 1N0VC 2D74A 3KL9A 3VR6A 5BSYA 1QFYA 1XQBA 5FA6A 4B4DA 1TTTA 1AMOA 1BMFA 2QN6A 4NBSA 4XORA 3LQEA 2OBRA 2ZZQA 2X53S 4WZEA 4P12A 4J0QA 4XMYA 3AVXA 1UD8A 1E79A 2VJJA 4X7EA 1VLYA 1TVCA 2DOGA 3CP8A 4OPVA 1VQPB 1Q7YD 2Q6IA 2DEUA 2NPFA 3G4SB 4DNTB 1PKVA 3OOCA 2VNKA 3BCFA 1YHQB 1BQEA 2GPJA 5LMZA 3OP1A 1VQKB 4P6YA 1DG1G 3CC4B 1OGIA 3JQPA 3ZZTA 1Y0YA 1YJWB 1KJZA 2M5SA 2C5HA 1IJEA 4II3A 4QHYA 2ZZGA 2CNDA 3QFTA 3SLNA 3AGQA 2BVNA 2P3MA 3SLDA 1YIJB 3P26A 1WOOA 4EH1A 1QGAA 4OPSA 2Q6LA 4PC2A 3CCEB 1XFOA 1VJSA 1Q82D 1NBMA 4YEJA 3ASTA 4XLAA 4P26A 2QTZA 1ZUNB 3ONUA 3GVKA 2QEXB 5J3OA 2D3NA 2BM0A 4RM0A 2PE3A 3SJZA 1R5OA 3CCMB 5HXBA 2F4NA 3W2FA 3A8KA 1KC8D 1Q9SA 5A88A 3ZBUA 4UZEA 1QUEA 4ROXA 3A8IA 1EFRA 2BMWA 2X8KA 5EMNA 2PLFA 4II2A 4F7DA 1W35A 5FO0A 3LO8A 1EXMA 1K28D 2JIZA 4ACBA 3Q39A 3CD6B 4G1VA 2FVGA 1KZLA 4Z4WA 2C4UA 3JQQA 4YAWA 3U2QA 5DSZA 3W5UA 1BLIA 3H94A 3A1PA 4WQMA 2ZBUA 4ZCLA 1VQ9B 1E64A 4P6VF 1KD1D 3AVVA 1T6ZA 2ZITA 1TLLA 4N3GA 5IK2A 3CMAB 1CNFA 4FXUA 3PA2A 2DERA 2WR8A 4G5GA 3CCRB 2OK7A 3CESA 2PIAA 1S4MA 3W2HA 3WBJA 1KTVA 1PJ7A 1UD4A 1W0KA 4MYTA 2CW5A 4XOPA 5FO1A 2WJYA 4YHBA 1E43A 5FIUA 3ASRA 4Y7CA 2VBVA 3FPKA 4PGOA 1VQMB 3E20A 1VQNB 2I1LA 1BX1A 2C2WA 1H8EA 4LBVA 2HDNB 5F4OA 1WTHD 3CW2A 3LNNA 4Z4TA 4B44A 3A3BA 3BCDA 1E1QA 1HVXA 3SJPA 2ZL6A 3GIRA 3OW2B 1K9MD 2HLDA 1OGJA 1F20A 5THXA 3I1FA 4DK1A 3OEHA 2CC2A 1W87A 2R6HA 3ASPA 2GJPA 1AIPA 5IYRA 4XN3A 1XE1A
chains in the Genus database with same CATH topology
1W9XA 4XORA 2WJVA 2W6JA 3GQBA 4XL9A 1NRKA 2ZZQA 2X53S 2F1MA 4JMQA 2ZZFA 4L8JA 1FX0A 1E79A 1UD8A 1HZEA 2D3LA 2VJJA 4XMYA 4G6IA 1VLYA 2JJ1A 3CP8A 2ZTGA 2WZPP 3DDYA 4DNTB 5DN6A 1PKVA 3OOCA 2CK3A 3OAAA 3BCFA 3GVJA 4TSFA 3ZIAA 3T53B 2VJIA 3FPPA 3BC9A 4GQNA 4Z1MA 2F43A 1V0EA 5HKKA 4DNRB 2XZPA 2M5SA 4G7WA 1UD6A 4II3A 2X6WA 2ZZGA 4XLCA 2JJ2A 4XKWA 4XN3A 2XGJA 3FKSA 1E3XA 2GK6A 4XONA 2ZTNA 3OFNA 2WSSA 4KKSA 1VJSA 1I18A 2GJKA 4XLFA 2XZOA 1NBMA 1UD3A 4YEJA 3BH4A 1T5EA 4XLAA 5CDFA 1BPLA 3OEEA 3GVKA 3JU4A 2D3NA 3A35A 2JDIA 4XR6A 1V0FA 2V4DA 3T56B 2QE7A 2Z6BD 5FL7A 3CP2A 4TKOB 2LZJA 1WPCA 3CMMA 2KVOA 4YELA 1EFRA 2X8KA 3ZPNA 4II2A 4XM3A 3NE5B 1E3ZA 4YXWA 3OPOA 5KNLA 1K28D 1VF7A 2JIZA 2WPDA 4B3GA 1KZLA 4AVZA 1W0JA 3OE7A 1WP6A 4E0FA 2DIEA 3OW7A 1UD2A 1BLIA 3A3GA 3H94A 1E1RA 1UD5A 2E1BA 4XN0A 4G7XA 4KKUA 2V31A 5IK2A 1H8HA 4KKTA 1KMHA 1OB0A 3KEWA 3T51B 4FXUA 1I8DA 4XLHA 2V7QA 3CESA 1SKYB 4XKVA 4B3FX 2GK7A 4XQFA 1UD4A 1W0KA 2GJRA 2X6XA 2R9VA 3HAGA 4XOPA 2WJYA 1MABA 1E43A 1COWA 4XOTA 2XNDA 3GVLA 4TT3A 4XNFA 2XZLA 3WQZA 4DK0A 4XD7A 3G05A 1H8EA 2ZXIA 4XLEA 1WTHD 3LNNA 2X6YA 3A3BA 3BCDA 1E1QA 1HVXA 4NNJA 4ASUA 2ZZEA 2HLDA 2X85A 4HIZA 4DK1A 3OEHA 2XOKA 3VR6A 1OHHA 2GJPA 2ZXHA 4P22A 1BMFA 4UZUA 2W6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7W A;  4G7X A; 
#chains in the Genus database with same CATH topology
 4U9U A;  1G7S A;  3CB4 A;  1WSR A;  2WJV A;  3B8H A;  4QV2 A;  3CC7 B;  4XL9 A;  4RCZ A;  4TMX A;  2F1M A;  4L8J A;  1NDH A;  1DDI A;  2NV4 A;  2OBT A;  2JJ1 A;  2EIX A;  4Z4Y A;  2WZP P;  1EP3 B;  5DN6 A;  1VQO B;  1VQ5 B;  4RD3 A;  1QGZ A;  3GVJ A;  4TSF A;  4TMV A;  1D8T A;  1FNM A;  2V7X A;  3FPP A;  3BC9 A;  2F43 A;  3A8J A;  1B23 P;  2XNJ A;  5HKK A;  4PAB A;  2OYN A;  3OZV A;  3OZW A;  3Q6R A;  4G7W A;  4RPD A;  3H9N A;  4YAO A;  2B5O A;  2JJ2 A;  2VBS A;  3R6K A;  2XGJ A;  3FKS A;  2GK6 A;  3Q3A A;  4CQJ A;  3OKX A;  1GR1 A;  1RQP A;  1NB0 A;  2FX3 A;  2WSS A;  4IW3 B;  1FNB A;  4AC9 A;  2GJK A;  4XLF A;  1FNC A;  3WND A;  4H9G A;  1ZM3 A;  3BH4 A;  4B3X A;  1T5E A;  3CCJ B;  5H5J A;  5KSW B;  2JDI A;  2DY1 A;  5GV7 A;  5H59 A;  3WY9 A;  3T56 B;  3G71 B;  1VQ6 B;  2Z6B D;  4RD4 A;  3RY8 A;  1VHE A;  2C4T A;  3AVW A;  4P25 A;  1I7P A;  1JB9 A;  1DAR A;  3AGP A;  4PC1 A;  4YEL A;  4B47 A;  2VZL A;  3W5H A;  2OBS A;  1G7C A;  3ZPN A;  1J9Z A;  2CF4 A;  4OOV A;  1E3Z A;  1R5N A;  2X0K A;  1FDR A;  4RD0 A;  4RCY A;  4YXW A;  3VMF A;  2WPD A;  1DDG A;  4MYU A;  4OOX A;  1W0J A;  1WP6 A;  3BY1 A;  3BY2 A;  2GRE A;  4QUZ A;  1UD2 A;  1K73 D;  2BM1 A;  4P9S A;  3AVU A;  2E1B A;  2EFG A;  4XN0 A;  4RPB A;  5DS0 A;  2XNC A;  4G7X A;  3ONY A;  4TMZ A;  3BQJ A;  5IYN A;  1VQ4 B;  1KMH A;  3KEW A;  3T51 B;  3W2I A;  4X06 A;  3OJW A;  2V7Q A;  1SKY B;  3WBK A;  2GK7 A;  4XQF A;  1BJK A;  3HAG A;  1BX0 A;  3I55 B;  1K8A D;  3AVY A;  1GAW A;  5HZA A;  1EFU A;  3CCV B;  4XOT A;  4Z4Z A;  1F60 A;  5F4J A;  4P3I A;  4BPR A;  1WDT A;  3BNW A;  4RD1 A;  1GAQ A;  1GVH A;  1FRQ A;  1WU8 A;  2DYI A;  3B78 A;  3GVL A;  4TT3 A;  4M4S A;  2WZN A;  5J35 A;  4ACA A;  5JBQ A;  3WQZ A;  3G05 A;  1ZM2 A;  2PMD A;  4P3Y A;  2C77 A;  1YI2 B;  1YIT B;  5GV8 A;  4YAU A;  3OJX A;  1JA1 A;  2X85 A;  3ZUG A;  1KK1 A;  3CTA A;  3E1Y E;  4UZU A;  3QE2 A;  1GJR A;  1W9X A;  4FWT A;  3QSY A;  4WZL A;  2W6J A;  2VBU A;  3GQB A;  1NRK A;  3WYA A;  3MCA A;  3VNU A;  2C5B A;  4PC7 A;  2ZZF A;  2YWF A;  1FX0 A;  2D3L A;  4YAF A;  2QDX A;  1B2R A;  4X8I A;  1VQ8 B;  1KK2 A;  1QGY A;  2ZTG A;  1Q86 D;  3WNB A;  5TV2 A;  2VNI A;  4TMW A;  1YJ9 B;  3V76 A;  2CK3 A;  3OAA A;  2ZL7 A;  4RJL A;  3G6E B;  2QMU A;  1KK3 A;  3ZIA A;  5F4M A;  1KQS B;  2E1R A;  3ES9 A;  1CQX A;  4GQN A;  1D2E A;  3Q6Q A;  3VNV A;  3W5V A;  1V0E A;  2ZL5 A;  3QFS A;  5A8A A;  1QVF B;  4NCN A;  1KRH A;  2RC5 A;  4DNR B;  2XZP A;  3LVB A;  2C78 A;  1VQL B;  4OOS A;  3ASQ A;  1UMK A;  3AVT A;  1UD6 A;  4N3N A;  1H85 A;  4XKW A;  4XLC A;  1QFZ A;  1E3X A;  2BSA A;  1Q81 D;  4XON A;  4Y9R A;  2CBX A;  3P27 A;  1IJF A;  1JNY A;  3R6J A;  3OFN A;  4Z4R A;  1I18 A;  4QFM A;  2F1L A;  4Y9U A;  4LBZ A;  3WNC A;  4ZGN B;  1T6Y A;  1UD3 A;  1WOS A;  3MHP A;  1BPL A;  2B7B A;  2ZBV A;  3OEE A;  2OTJ B;  3JU4 A;  1N05 A;  3PEN A;  1SKQ A;  1EFC A;  4B43 A;  3CCU B;  3U6B A;  1QX4 A;  2BF4 A;  2WYR A;  4ZCM A;  4LC0 A;  4TKO B;  3CPW B;  4M2L A;  1HA3 A;  3CMM A;  1EP2 B;  1EWY A;  5IYP A;  3VO1 A;  4ZV4 A;  3SKB A;  4X0C A;  4XM3 A;  3CXC B;  4AF6 A;  5KNL A;  3I56 B;  1VF7 A;  2V7V A;  4C0S A;  4RDL A;  4B3G A;  3D26 A;  1KK0 A;  1PJ6 A;  1A8P A;  2YWH A;  4HE6 A;  1SM4 A;  5A89 A;  4X7C A;  3A3G A;  4RDJ A;  1E1R A;  2QTL A;  1UD5 A;  2XEX A;  2V7T A;  1ZM4 A;  4KKU A;  1RQR A;  5FNZ A;  3QFR A;  4Z4V A;  3U6K A;  1H8H A;  3OZU A;  4KKT A;  3J81 k;  1OB0 A;  1I8D A;  4XLH A;  2Q6O A;  4B3F X;  1IB0 A;  4ZGQ B;  2DET A;  3B82 A;  3QFC A;  3ZZU A;  5TRD A;  1E63 A;  1COW A;  1ZM9 A;  4OP7 A;  5TY0 A;  4PC6 A;  4XNF A;  4WZK A;  4B48 A;  1NB9 A;  1QFJ A;  2Q6K A;  4XD7 A;  4RLZ A;  1VQ7 B;  2ZXI A;  1QUF A;  4Q7J B;  5KW9 A;  3PUN A;  2X6Y A;  1S72 B;  2BGI A;  3GSI A;  4NNJ A;  4ASU A;  5IYW A;  2YWE A;  3CRZ A;  4HIZ A;  2XOK A;  4Z4U A;  1D1N A;  2J7K A;  1EP1 B;  4C43 A;  1OHH A;  1MRZ A;  1W34 A;  2ZXH A;  4P22 A;  2W6I A;  3PVD A;  1WOP A;  2BV3 A;  5BSX A;  1N06 A;  3FJO A;  1N8R D;  4X07 A;  4TMT A;  3CME B;  4M1K A;  4JMQ A;  1WOR A;  4DQL A;  3W2G A;  1HZE A;  4TN1 A;  1R5B A;  2CRV A;  4G6I A;  1P4M A;  1QG0 A;  1TUI A;  5B6I A;  2OK8 A;  3DDY A;  2YWG A;  1PJ5 A;  3WXM A;  1W2B B;  3ISX A;  2RC6 A;  4AF7 A;  3ZBT A;  5TR9 A;  2VBT A;  4Z4S A;  3T53 B;  5IYQ A;  2VJI A;  4Z1M A;  1N0U A;  2B7C A;  4P1V A;  1YLO A;  2BGJ A;  1N07 A;  2DCU A;  1VLO A;  2BN4 A;  2X6W A;  4M53 A;  2JN9 A;  1Y0R A;  3V7A A;  1V5V A;  4RD6 A;  2ZTN A;  2V7U A;  1T6X A;  2VNH A;  4RDK A;  1U2R A;  1QVG B;  3VO2 A;  1EFT A;  1YX2 A;  3PA1 A;  3CCS B;  2QGG A;  4KKS A;  3JQR A;  1FND A;  4R71 A;  2XZO A;  3ZC3 A;  1IHM A;  4ZCI A;  3MMP A;  2VNJ A;  3SEJ A;  3CC2 B;  2VYQ A;  2X3U A;  5CDF A;  4M0L A;  3CCL B;  5E6T A;  3LQ6 A;  3A35 A;  4YAL A;  1JA0 A;  4LBW A;  4XR6 A;  1V0F A;  2V4D A;  1OB2 A;  4WZT A;  2QE7 A;  5FL7 A;  3CP2 A;  1G7T A;  2HCJ B;  1G7R A;  2LZJ A;  1N08 A;  4QVJ A;  1GO2 A;  4X7D A;  1WPC A;  2KVO A;  3Q38 A;  1YJN B;  1M1K D;  3NE5 B;  4DQK A;  3OPO A;  2HMA A;  3ZZ0 A;  4WWV A;  4OPO A;  2QA4 B;  4AVZ A;  2V7W A;  3OE7 A;  4E0F A;  2DIE A;  3OW7 A;  3ASS A;  3CCQ B;  4QVA A;  1VHO A;  4HE5 A;  2V31 A;  4RD2 A;  2D9R A;  4FN5 A;  4P2N A;  1E62 A;  1NJI D;  1H42 A;  1M90 D;  2AHO A;  4XKV A;  5HZB A;  3CPX A;  2GJR A;  2X6X A;  2R9V A;  2BPO A;  4FK8 A;  4UZF A;  1MAB A;  4PC3 A;  1OB5 A;  2XND A;  4X7F A;  3W2E A;  2OTL B;  5L46 A;  4K1X A;  4UAJ A;  2XZL A;  5AN9 A;  4DK0 A;  1FRN A;  1QH0 A;  4XLE A;  1WSV A;  1JJ2 B;  1S0U A;  1XB2 A;  2GQF A;  4LBY A;  1CNE A;  4X05 A;  4PAA A;  2ZZE A;  4G1B A;  1ELO A;  3PUM A;  1N0V C;  2D74 A;  3KL9 A;  3VR6 A;  5BSY A;  1QFY A;  1XQB A;  5FA6 A;  4B4D A;  1TTT A;  1AMO A;  1BMF A;  2QN6 A;  4NBS A;  4XOR A;  3LQE A;  2OBR A;  2ZZQ A;  2X53 S;  4WZE A;  4P12 A;  4J0Q A;  4XMY A;  3AVX A;  1UD8 A;  1E79 A;  2VJJ A;  4X7E A;  1VLY A;  1TVC A;  2DOG A;  3CP8 A;  4OPV A;  1VQP B;  1Q7Y D;  2Q6I A;  2DEU A;  2NPF A;  3G4S B;  4DNT B;  1PKV A;  3OOC A;  2VNK A;  3BCF A;  1YHQ B;  1BQE A;  2GPJ A;  5LMZ A;  3OP1 A;  1VQK B;  4P6Y A;  1DG1 G;  3CC4 B;  1OGI A;  3JQP A;  3ZZT A;  1Y0Y A;  1YJW B;  1KJZ A;  2M5S A;  2C5H A;  1IJE A;  4II3 A;  4QHY A;  2ZZG A;  2CND A;  3QFT A;  3SLN A;  3AGQ A;  2BVN A;  2P3M A;  3SLD A;  1YIJ B;  3P26 A;  1WOO A;  4EH1 A;  1QGA A;  4OPS A;  2Q6L A;  4PC2 A;  3CCE B;  1XFO A;  1VJS A;  1Q82 D;  1NBM A;  4YEJ A;  3AST A;  4XLA A;  4P26 A;  2QTZ A;  1ZUN B;  3ONU A;  3GVK A;  2QEX B;  5J3O A;  2D3N A;  2BM0 A;  4RM0 A;  2PE3 A;  3SJZ A;  1R5O A;  3CCM B;  5HXB A;  2F4N A;  3W2F A;  3A8K A;  1KC8 D;  1Q9S A;  5A88 A;  3ZBU A;  4UZE A;  1QUE A;  4ROX A;  3A8I A;  1EFR A;  2BMW A;  2X8K A;  5EMN A;  2PLF A;  4II2 A;  4F7D A;  1W35 A;  5FO0 A;  3LO8 A;  1EXM A;  1K28 D;  2JIZ A;  4ACB A;  3Q39 A;  3CD6 B;  4G1V A;  2FVG A;  1KZL A;  4Z4W A;  2C4U A;  3JQQ A;  4YAW A;  3U2Q A;  5DSZ A;  3W5U A;  1BLI A;  3H94 A;  3A1P A;  4WQM A;  2ZBU A;  4ZCL A;  1VQ9 B;  1E64 A;  4P6V F;  1KD1 D;  3AVV A;  1T6Z A;  2ZIT A;  1TLL A;  4N3G A;  5IK2 A;  3CMA B;  1CNF A;  4FXU A;  3PA2 A;  2DER A;  2WR8 A;  4G5G A;  3CCR B;  2OK7 A;  3CES A;  2PIA A;  1S4M A;  3W2H A;  3WBJ A;  1KTV A;  1PJ7 A;  1UD4 A;  1W0K A;  4MYT A;  2CW5 A;  4XOP A;  5FO1 A;  2WJY A;  4YHB A;  1E43 A;  5FIU A;  3ASR A;  4Y7C A;  2VBV A;  3FPK A;  4PGO A;  1VQM B;  3E20 A;  1VQN B;  2I1L A;  1BX1 A;  2C2W A;  1H8E A;  4LBV A;  2HDN B;  5F4O A;  1WTH D;  3CW2 A;  3LNN A;  4Z4T A;  4B44 A;  3A3B A;  3BCD A;  1E1Q A;  1HVX A;  3SJP A;  2ZL6 A;  3GIR A;  3OW2 B;  1K9M D;  2HLD A;  1OGJ A;  1F20 A;  5THX A;  3I1F A;  4DK1 A;  3OEH A;  2CC2 A;  1W87 A;  2R6H A;  3ASP A;  2GJP A;  1AIP A;  5IYR A;  4XN3 A;  1XE1 A; 
#chains in the Genus database with same CATH homology
 1W9X A;  4XOR A;  2WJV A;  2W6J A;  3GQB A;  4XL9 A;  1NRK A;  2ZZQ A;  2X53 S;  2F1M A;  4JMQ A;  2ZZF A;  4L8J A;  1FX0 A;  1E79 A;  1UD8 A;  1HZE A;  2D3L A;  2VJJ A;  4XMY A;  4G6I A;  1VLY A;  2JJ1 A;  3CP8 A;  2ZTG A;  2WZP P;  3DDY A;  4DNT B;  5DN6 A;  1PKV A;  3OOC A;  2CK3 A;  3OAA A;  3BCF A;  3GVJ A;  4TSF A;  3ZIA A;  3T53 B;  2VJI A;  3FPP A;  3BC9 A;  4GQN A;  4Z1M A;  2F43 A;  1V0E A;  5HKK A;  4DNR B;  2XZP A;  2M5S A;  4G7W A;  1UD6 A;  4II3 A;  2X6W A;  2ZZG A;  4XLC A;  2JJ2 A;  4XKW A;  4XN3 A;  2XGJ A;  3FKS A;  1E3X A;  2GK6 A;  4XON A;  2ZTN A;  3OFN A;  2WSS A;  4KKS A;  1VJS A;  1I18 A;  2GJK A;  4XLF A;  2XZO A;  1NBM A;  1UD3 A;  4YEJ A;  3BH4 A;  1T5E A;  4XLA A;  5CDF A;  1BPL A;  3OEE A;  3GVK A;  3JU4 A;  2D3N A;  3A35 A;  2JDI A;  4XR6 A;  1V0F A;  2V4D A;  3T56 B;  2QE7 A;  2Z6B D;  5FL7 A;  3CP2 A;  4TKO B;  2LZJ A;  1WPC A;  3CMM A;  2KVO A;  4YEL A;  1EFR A;  2X8K A;  3ZPN A;  4II2 A;  4XM3 A;  3NE5 B;  1E3Z A;  4YXW A;  3OPO A;  5KNL A;  1K28 D;  1VF7 A;  2JIZ A;  2WPD A;  4B3G A;  1KZL A;  4AVZ A;  1W0J A;  3OE7 A;  1WP6 A;  4E0F A;  2DIE A;  3OW7 A;  1UD2 A;  1BLI A;  3A3G A;  3H94 A;  1E1R A;  1UD5 A;  2E1B A;  4XN0 A;  4G7X A;  4KKU A;  2V31 A;  5IK2 A;  1H8H A;  4KKT A;  1KMH A;  1OB0 A;  3KEW A;  3T51 B;  4FXU A;  1I8D A;  4XLH A;  2V7Q A;  3CES A;  1SKY B;  4XKV A;  4B3F X;  2GK7 A;  4XQF A;  1UD4 A;  1W0K A;  2GJR A;  2X6X A;  2R9V A;  3HAG A;  4XOP A;  2WJY A;  1MAB A;  1E43 A;  1COW A;  4XOT A;  2XND A;  3GVL A;  4TT3 A;  4XNF A;  2XZL A;  3WQZ A;  4DK0 A;  4XD7 A;  3G05 A;  1H8E A;  2ZXI A;  4XLE A;  1WTH D;  3LNN A;  2X6Y A;  3A3B A;  3BCD A;  1E1Q A;  1HVX A;  4NNJ A;  4ASU A;  2ZZE A;  2HLD A;  2X85 A;  4HIZ A;  4DK1 A;  3OEH A;  2XOK A;  3VR6 A;  1OHH A;  2GJP A;  2ZXH A;  4P22 A;  1BMF A;  4UZU A;  2W6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...