4G7WA

Crystal structure of the n-terminal domain of the minor coat protein piii from ctxphi
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
SAINCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGEECVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein binding
molecule keywords Putative uncharacterized protein
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7wA00
4G7WA 4G7XA
chains in the Genus database with same CATH superfamily
3CCMB 1GAWA 2VJJA 5A89A 2C77A 4KKSA 1VQ7B 1V5VA 4HE6A 2V7UA 3BC9A 3ASSA 1TLLA 4G1VA 2HLDA 4LBWA 2D3NA 1BJKA 3A3BA 4FK8A 4RDKA 3ZIAA 1WSVA 1EFRA 3A8JA 4LC0A 1D8TA 5HZBA 4HIZA 1EWYA 3WNBA 4H9GA 4QFMA 1ZUNB 2QGGA 3I1FA 1FNDA 1GR1A 4P22A 2C5HA 3H94A 1AIPA 2Q6LA 1XB2A 2Q6OA 1QUFA 3Q6QA 4XLEA 1FRQA 1OB5A 1YITB 3VMFA 2OTLB 1XFOA 2F4NA 2V7QA 3ASTA 2B7CA 4RD1A 4RCYA 2D3LA 2X53S 5LMZA 4Q7JB 3CPWB 4X7FA 1TVCA 1K28D 4TN1A 1QFYA 2V31A 3LNNA 1W2BB 1UD2A 1WOPA 1G7CA 4Z4YA 4ZCMA 4N3NA 4WQMA 2V4DA 4N3GA 1MRZA 1RQPA 1VHOA 3OP1A 4RD6A 2ZBUA 2AHOA 3U6BA 4XLCA 4G1BA 1NJID 4B3GA 1H42A 2YWGA 2DCUA 4GQNA 4P3IA 3SEJA 1HZEA 1ZM2A 3MCAA 3JQPA 5DN6A 2VNKA 4XL9A 5HXBA 4YELA 4M0LA 3W5HA 4MYTA 4RDJA 1HVXA 1UMKA 2CW5A 4LBVA 3OEEA 1ZM4A 2XNJA 2HMAA 3ONUA 5H59A 4QHYA 1T5EA 3W2EA 1J9ZA 1BPLA 1MABA 4Z4TA 1ELOA 4IW3B 4OOVA 3OE7A 2X3UA 2CC2A 4TMTA 3WNCA 1UD5A 3AGPA 4XQFA 4OP7A 2C5BA 1KK1A 2X8KA 5L46A 4G7WA 1PJ6A 1KQSB 5GV8A 2ZTGA 1SM4A 2BM1A 1M90D 4P6VF 4P25A 1QVFB 1BX1A 3CCVB 1WP6A 4FN5A 3QFSA 3CCJB 1T6YA 2VZLA 2X6XA 1WOOA 1OB0A 5DSZA 2GJPA 4QVJA 5AN9A 2PE3A 3JQQA 3CMMA 2PMDA 4P3YA 4X8IA 3PA2A 4F7DA 1CNEA 2X85A 5BSXA 1FX0A 3OFNA 4B47A 2EFGA 1EP2B 1S0UA 2E1RA 2RC6A 2WJVA 5A8AA 1UD3A 1FNMA 5KSWB 3CP2A 4XN3A 1UD8A 2QTZA 5FIUA 5IYNA 3J81k 3ES9A 4LBZA 2HDNB 4Y7CA 2ZXHA 1GAQA 4TSFA 3HAGA 1OGJA 4RD2A 1N05A 3CD6B 2F43A 4PC2A 1SKYB 1E3ZA 1IB0A 3DDYA 3P27A 3I55B 3QFCA 3OZVA 3ONYA 4X06A 2VBVA 1W34A 1WPCA 4XOTA 2C2WA 2ZL6A 2BVNA 4ZGNB 1PKVA 3BY1A 1WDTA 3FKSA 3WBJA 3CPXA 1CNFA 3LQ6A 4E0FA 3CXCB 1K9MD 1VJSA 1NB9A 4U9UA 4TKOB 4XKVA 2QA4B 1JA1A 4M4SA 1EP3B 2DOGA 4P9SA 2GJRA 3MHPA 2JJ2A 3GVKA 1W9XA 4P26A 4B44A 2LZJA 2OK7A 4YHBA 3RY8A 1PJ5A 1FNCA 1U2RA 2FX3A 2V7XA 4UZUA 1K73D 1N07A 3ASQA 1TUIA 2XNCA 5IYRA 2BV3A 5J3OA 4XKWA 1OB2A 4X07A 4P6YA 1YJNB 2QE7A 3CC2B 1YIJB 1QUEA 4G7XA 2OBSA 3BCFA 4ROXA 2DY1A 2ZITA 3OZWA 3B82A 2CK3A 2CBXA 1COWA 1QFZA 1V0FA 1IJEA 1F20A 4JMQA 3B8HA 1NBMA 2BF4A 1BX0A 2OBRA 3A3GA 4PC3A 5FNZA 4DNTB 4X7EA 3CW2A 1IHMA 3BCDA 3ZUGA 3ZZTA 2JIZA 2ZZEA 4YAFA 1KTVA 4YEJA 4DNRB 1N0UA 3LO8A 4DK0A 4ASUA 2B7BA 2GJKA 1H8HA 2WZPP 2FVGA 1N0VC 2J7KA 1EFTA 4PABA 3AVTA 1SKQA 3W5UA 1S4MA 4AVZA 3CCEB 1Y0YA 2XEXA 3OPOA 3ZZUA 1I7PA 5KW9A 3P26A 1A8PA 1OHHA 3QFRA 3PA1A 4OPVA 1G7RA 3KEWA 1VQOB 5IYPA 3A8KA 3PVDA 4BPRA 4WWVA 4PAAA 3OJWA 1EP1B 4Y9UA 2VNJA 2CNDA 4XMYA 3VNUA 3G6EB 4RD3A 4TMVA 3AVXA 5F4JA 3CCUB 5IYWA 4X7CA 4YAWA 4RPBA 4XORA 3G4SB 4XONA 3V76A 3GSIA 4EH1A 2NV4A 1KZLA 1KRHA 2WPDA 3CTAA 4RJLA 2GPJA 5THXA 1KK0A 3W2HA 1R5NA 2KVOA 4HE5A 3KL9A 3BNWA 2BSAA 2Q6KA 3CRZA 4XLHA 3WYAA 2R6HA 2XZPA 2VJIA 2CF4A 1E63A 4G6IA 3A35A 3T51B 4ZV4A 3CCQB 3LQEA 2DIEA 2V7TA 2E1BA 1E3XA 3OW2B 3BQJA 1BQEA 3CESA 2VYQA 4M2LA 2WZNA 3ZBTA 4Z4WA 1QH0A 1DDGA 3MMPA 2JJ1A 4XOPA 1JJ2B 1H85A 3ASPA 4Z1MA 3R6JA 1G7TA 2DERA 3U2QA 3SLDA 2DYIA 1GJRA 5GV7A 4WZKA 3SKBA 4UZFA 1N8RD 1EXMA 4R71A 5JBQA 4Z4RA 5FO1A 3SJZA 2QDXA 1QG0A 2QMUA 1DDIA 3GIRA 4WZEA 5E6TA 1YX2A 4DK1A 2XNDA 1XQBA 3JQRA 1H8EA 2WYRA 3JU4A 3ZBUA 2F1LA 5TY0A 3ISXA 4KKTA 5B6IA 3NE5B 2W6JA 2OYNA 1VQ9B 4CQJA 2DETA 3FJOA 3CCRB 3SJPA 5BSYA 1FNBA 2BGIA 3WXMA 2PIAA 3CCSB 4L8JA 1W35A 5IYQA 3ASRA 2BM0A 1YJ9B 2WJYA 1R5OA 3CP8A 2YWFA 3LVBA 4RD4A 3CC7B 1NB0A 3AGQA 4K1XA 2R9VA 2VBTA 2BPOA 3I56B 1EFCA 2V7WA 1JA0A 4XLFA 3ZPNA 2ZL5A 1JNYA 4XLAA 1GVHA 4RM0A 3WNDA 3ZC3A 1YJWB 3OW7A 2X6WA 3Q38A 5H5JA 2C4UA 2C4TA 1Q7YD 5HZAA 3W2GA 4YALA 3AVWA 1E1RA 3PUNA 1W0KA 4ACAA 2QEXB 1FDRA 1I8DA 2DEUA 1KC8D 5FL7A 1BMFA 1VLOA 4G5GA 3ZZ0A 3FPPA 1KJZA 1WOSA 1PJ7A 1VHEA 3GVLA 4DQKA 2ZTNA 4M1KA 3A1PA 2ZZGA 2VBUA 5DS0A 4AF6A 1N08A 3H9NA 1KD1D 3OEHA 2GK7A 3WBKA 4RDLA 2EIXA 1AMOA 5IK2A 3WQZA 4XR6A 2XOKA 4P12A 4C43A 5TV2A 4TMWA 1NRKA 2ZXIA 1GO2A 1VLYA 2ZBVA 2XZLA 2OK8A 3WY9A 4TMZA 2GREA 3FPKA 1RQRA 3BH4A 3SLNA 1B2RA 1R5BA 4B3FX 1Q9SA 4RPDA 1E64A 4B3XA 2WSSA 3AVVA 1WSRA 4NBSA 2NPFA 2WR8A 4XD7A 3VR6A 5A88A 4OPOA 4X0CA 1KK3A 2BMWA 2D74A 4Z4SA 4AF7A 1G7SA 2M5SA 3Q39A 4YAOA 1QVGB 4YAUA 2JDIA 2GQFA 2Q6IA 4XN0A 3VO1A 3OAAA 3GVJA 2YWEA 4YXWA 4ACBA 4OOXA 1QGZA 1OGIA 1W87A 3A8IA 1VF7A 1TTTA 4UZEA 4X7DA 3CMAB 1E79A 4RCZA 3R6KA 2ZZQA 1VQ8B 3U6KA 1T6ZA 1N06A 1FRNA 3B78A 5TRDA 2F1MA 4NCNA 4Z4ZA 1BLIA 1CQXA 1D1NA 3W2IA 4Z4UA 3V7AA 3CB4A 4XM3A 4PGOA 1M1KD 5FA6A 4Y9RA 4QV2A 4WZTA 3G71B 1W0JA 4RLZA 4ZCLA 1HA3A 2XZOA 3AVUA 1T6XA 3W5VA 4ZGQB 3W2FA 2GK6A 2QN6A 2B5OA 2XGJA 4II2A 1VQLB 1VQ4B 3AVYA 1IJFA 3BY2A 2VBSA 3T56B 5HKKA 4TMXA 4B4DA 1UD4A 3QFTA 1V0EA 1YI2B 2ZL7A 5FO0A 1Y0RA 4MYUA 4UAJA 4XNFA 1VQMB 4P1VA 2P3MA 1DARA 3VNVA 2BN4A 4TT3A 1KMHA 5F4OA 1K8AD 4QUZA 1YHQB 4DQLA 4J0QA 3GQBA 1VQ5B 2JN9A 3D26A 4ZCIA 3Q6RA 4PC1A 1UD6A 3E20A 1JB9A 2OBTA 4B48A 4QVAA 1YLOA 1QGAA 1WORA 3OKXA 5CDFA 2ZZFA 1DG1G 1ZM9A 2VNHA 1E43A 2D9RA 4FXUA 3T53B 4LBYA 4NNJA 2Z6BD 5KNLA 2C78A 3OZUA 1Q81D 4B43A 2PLFA 5EMNA 3VO2A 4II3A 2RC5A 4M53A 1QGYA 4KKUA 4Z4VA 1F60A 4RD0A 1E62A 4FWTA 1Q86D 1D2EA 1S72B 1QX4A 1VQNB 4OPSA 5J35A 2QTLA 1VQ6B 4AC9A 3QE2A 1ZM3A 2W6IA 3PENA 2V7VA 3OOCA 3PUMA 1B23P 4C0SA 1VQPB 4PC7A 5TR9A 1E1QA 1EFUA 2CRVA 2X6YA 2I1LA 3E1YE 3QSYA 1QFJA 2VNIA 4OOSA 2X0KA 2OTJB 1P4MA 3G05A 3CC4B 2HCJB 1WTHD 2YWHA 4X05A 1VQKB 1XE1A 1I18A 3CCLB 1KK2A 4PC6A 5F4MA 2BGJA 4WZLA 3CMEB 4P2NA 1Q82D 1NDHA 1WU8A 3OJXA 3Q3AA
chains in the Genus database with same CATH topology
1SKYB 2VJJA 2JDIA 1E3ZA 2JJ1A 3DDYA 4KKSA 4XN0A 4XOPA 3OAAA 3GVJA 4YXWA 4Z1MA 3BC9A 1VF7A 1WPCA 1E79A 4XOTA 2HLDA 2D3NA 2ZZQA 3A3BA 3ZIAA 1PKVA 3FKSA 1EFRA 4E0FA 2F1MA 1VJSA 1BLIA 4TKOB 4XKVA 4HIZA 4P22A 2GJRA 3H94A 2JJ2A 3GVKA 1W9XA 4XM3A 2LZJA 4XLEA 4UZUA 4DK1A 1W0JA 2XNDA 2V7QA 4XKWA 2XZOA 1H8EA 2D3LA 3JU4A 2GK6A 2QE7A 2X53S 4KKTA 3NE5B 2W6JA 1K28D 4G7XA 2XGJA 2V31A 4II2A 3BCFA 3LNNA 1UD2A 3T56B 5HKKA 2CK3A 2V4DA 4L8JA 1UD4A 1COWA 1V0FA 4JMQA 1V0EA 2WJYA 4XNFA 3CP8A 1NBMA 3A3GA 4XLCA 2R9VA 4TT3A 1KMHA 4B3GA 4GQNA 4DNTB 3GQBA 1HZEA 3BCDA 5DN6A 2JIZA 2ZZEA 4XLFA 4XL9A 1UD6A 3ZPNA 4DNRB 4YEJA 4YELA 4XLAA 1HVXA 5CDFA 4DK0A 3OEEA 2GJKA 2ZZFA 4ASUA 1H8HA 3OW7A 2WZPP 2X6WA 1E43A 1T5EA 4FXUA 3T53B 4NNJA 2Z6BD 1BPLA 1MABA 5KNLA 4AVZA 1E1RA 3OE7A 3OPOA 1W0KA 4II3A 1I8DA 1UD5A 1OHHA 4KKUA 5FL7A 4XQFA 1BMFA 2X8KA 3FPPA 3KEWA 4G7WA 3GVLA 2ZTNA 2ZTGA 2ZZGA 4XMYA 3OEHA 2GK7A 2W6IA 1WP6A 5IK2A 3WQZA 4XR6A 3OOCA 2XOKA 2X6XA 1NRKA 2ZXIA 1E1QA 1VLYA 1OB0A 2XZLA 2GJPA 4XORA 2X6YA 3CMMA 4XONA 2X85A 1FX0A 2F43A 3OFNA 1KZLA 3G05A 3BH4A 2WPDA 4B3FX 1WTHD 2KVOA 2WJVA 1UD3A 4XLHA 2WSSA 1I18A 3CP2A 4XN3A 2XZPA 2VJIA 1UD8A 4G6IA 3A35A 4XD7A 3T51B 3VR6A 2DIEA 2ZXHA 4TSFA 3HAGA 2E1BA 1E3XA 3CESA 2M5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7W A;  4G7X A; 
#chains in the Genus database with same CATH topology
 3CCM B;  1GAW A;  2VJJ A;  5A89 A;  2C77 A;  4KKS A;  1VQ7 B;  1V5V A;  4HE6 A;  2V7U A;  3BC9 A;  3ASS A;  1TLL A;  4G1V A;  2HLD A;  4LBW A;  2D3N A;  1BJK A;  3A3B A;  4FK8 A;  4RDK A;  3ZIA A;  1WSV A;  1EFR A;  3A8J A;  4LC0 A;  1D8T A;  5HZB A;  4HIZ A;  1EWY A;  3WNB A;  4H9G A;  4QFM A;  1ZUN B;  2QGG A;  3I1F A;  1FND A;  1GR1 A;  4P22 A;  2C5H A;  3H94 A;  1AIP A;  2Q6L A;  1XB2 A;  2Q6O A;  1QUF A;  3Q6Q A;  4XLE A;  1FRQ A;  1OB5 A;  1YIT B;  3VMF A;  2OTL B;  1XFO A;  2F4N A;  2V7Q A;  3AST A;  2B7C A;  4RD1 A;  4RCY A;  2D3L A;  2X53 S;  5LMZ A;  4Q7J B;  3CPW B;  4X7F A;  1TVC A;  1K28 D;  4TN1 A;  1QFY A;  2V31 A;  3LNN A;  1W2B B;  1UD2 A;  1WOP A;  1G7C A;  4Z4Y A;  4ZCM A;  4N3N A;  4WQM A;  2V4D A;  4N3G A;  1MRZ A;  1RQP A;  1VHO A;  3OP1 A;  4RD6 A;  2ZBU A;  2AHO A;  3U6B A;  4XLC A;  4G1B A;  1NJI D;  4B3G A;  1H42 A;  2YWG A;  2DCU A;  4GQN A;  4P3I A;  3SEJ A;  1HZE A;  1ZM2 A;  3MCA A;  3JQP A;  5DN6 A;  2VNK A;  4XL9 A;  5HXB A;  4YEL A;  4M0L A;  3W5H A;  4MYT A;  4RDJ A;  1HVX A;  1UMK A;  2CW5 A;  4LBV A;  3OEE A;  1ZM4 A;  2XNJ A;  2HMA A;  3ONU A;  5H59 A;  4QHY A;  1T5E A;  3W2E A;  1J9Z A;  1BPL A;  1MAB A;  4Z4T A;  1ELO A;  4IW3 B;  4OOV A;  3OE7 A;  2X3U A;  2CC2 A;  4TMT A;  3WNC A;  1UD5 A;  3AGP A;  4XQF A;  4OP7 A;  2C5B A;  1KK1 A;  2X8K A;  5L46 A;  4G7W A;  1PJ6 A;  1KQS B;  5GV8 A;  2ZTG A;  1SM4 A;  2BM1 A;  1M90 D;  4P6V F;  4P25 A;  1QVF B;  1BX1 A;  3CCV B;  1WP6 A;  4FN5 A;  3QFS A;  3CCJ B;  1T6Y A;  2VZL A;  2X6X A;  1WOO A;  1OB0 A;  5DSZ A;  2GJP A;  4QVJ A;  5AN9 A;  2PE3 A;  3JQQ A;  3CMM A;  2PMD A;  4P3Y A;  4X8I A;  3PA2 A;  4F7D A;  1CNE A;  2X85 A;  5BSX A;  1FX0 A;  3OFN A;  4B47 A;  2EFG A;  1EP2 B;  1S0U A;  2E1R A;  2RC6 A;  2WJV A;  5A8A A;  1UD3 A;  1FNM A;  5KSW B;  3CP2 A;  4XN3 A;  1UD8 A;  2QTZ A;  5FIU A;  5IYN A;  3J81 k;  3ES9 A;  4LBZ A;  2HDN B;  4Y7C A;  2ZXH A;  1GAQ A;  4TSF A;  3HAG A;  1OGJ A;  4RD2 A;  1N05 A;  3CD6 B;  2F43 A;  4PC2 A;  1SKY B;  1E3Z A;  1IB0 A;  3DDY A;  3P27 A;  3I55 B;  3QFC A;  3OZV A;  3ONY A;  4X06 A;  2VBV A;  1W34 A;  1WPC A;  4XOT A;  2C2W A;  2ZL6 A;  2BVN A;  4ZGN B;  1PKV A;  3BY1 A;  1WDT A;  3FKS A;  3WBJ A;  3CPX A;  1CNF A;  3LQ6 A;  4E0F A;  3CXC B;  1K9M D;  1VJS A;  1NB9 A;  4U9U A;  4TKO B;  4XKV A;  2QA4 B;  1JA1 A;  4M4S A;  1EP3 B;  2DOG A;  4P9S A;  2GJR A;  3MHP A;  2JJ2 A;  3GVK A;  1W9X A;  4P26 A;  4B44 A;  2LZJ A;  2OK7 A;  4YHB A;  3RY8 A;  1PJ5 A;  1FNC A;  1U2R A;  2FX3 A;  2V7X A;  4UZU A;  1K73 D;  1N07 A;  3ASQ A;  1TUI A;  2XNC A;  5IYR A;  2BV3 A;  5J3O A;  4XKW A;  1OB2 A;  4X07 A;  4P6Y A;  1YJN B;  2QE7 A;  3CC2 B;  1YIJ B;  1QUE A;  4G7X A;  2OBS A;  3BCF A;  4ROX A;  2DY1 A;  2ZIT A;  3OZW A;  3B82 A;  2CK3 A;  2CBX A;  1COW A;  1QFZ A;  1V0F A;  1IJE A;  1F20 A;  4JMQ A;  3B8H A;  1NBM A;  2BF4 A;  1BX0 A;  2OBR A;  3A3G A;  4PC3 A;  5FNZ A;  4DNT B;  4X7E A;  3CW2 A;  1IHM A;  3BCD A;  3ZUG A;  3ZZT A;  2JIZ A;  2ZZE A;  4YAF A;  1KTV A;  4YEJ A;  4DNR B;  1N0U A;  3LO8 A;  4DK0 A;  4ASU A;  2B7B A;  2GJK A;  1H8H A;  2WZP P;  2FVG A;  1N0V C;  2J7K A;  1EFT A;  4PAB A;  3AVT A;  1SKQ A;  3W5U A;  1S4M A;  4AVZ A;  3CCE B;  1Y0Y A;  2XEX A;  3OPO A;  3ZZU A;  1I7P A;  5KW9 A;  3P26 A;  1A8P A;  1OHH A;  3QFR A;  3PA1 A;  4OPV A;  1G7R A;  3KEW A;  1VQO B;  5IYP A;  3A8K A;  3PVD A;  4BPR A;  4WWV A;  4PAA A;  3OJW A;  1EP1 B;  4Y9U A;  2VNJ A;  2CND A;  4XMY A;  3VNU A;  3G6E B;  4RD3 A;  4TMV A;  3AVX A;  5F4J A;  3CCU B;  5IYW A;  4X7C A;  4YAW A;  4RPB A;  4XOR A;  3G4S B;  4XON A;  3V76 A;  3GSI A;  4EH1 A;  2NV4 A;  1KZL A;  1KRH A;  2WPD A;  3CTA A;  4RJL A;  2GPJ A;  5THX A;  1KK0 A;  3W2H A;  1R5N A;  2KVO A;  4HE5 A;  3KL9 A;  3BNW A;  2BSA A;  2Q6K A;  3CRZ A;  4XLH A;  3WYA A;  2R6H A;  2XZP A;  2VJI A;  2CF4 A;  1E63 A;  4G6I A;  3A35 A;  3T51 B;  4ZV4 A;  3CCQ B;  3LQE A;  2DIE A;  2V7T A;  2E1B A;  1E3X A;  3OW2 B;  3BQJ A;  1BQE A;  3CES A;  2VYQ A;  4M2L A;  2WZN A;  3ZBT A;  4Z4W A;  1QH0 A;  1DDG A;  3MMP A;  2JJ1 A;  4XOP A;  1JJ2 B;  1H85 A;  3ASP A;  4Z1M A;  3R6J A;  1G7T A;  2DER A;  3U2Q A;  3SLD A;  2DYI A;  1GJR A;  5GV7 A;  4WZK A;  3SKB A;  4UZF A;  1N8R D;  1EXM A;  4R71 A;  5JBQ A;  4Z4R A;  5FO1 A;  3SJZ A;  2QDX A;  1QG0 A;  2QMU A;  1DDI A;  3GIR A;  4WZE A;  5E6T A;  1YX2 A;  4DK1 A;  2XND A;  1XQB A;  3JQR A;  1H8E A;  2WYR A;  3JU4 A;  3ZBU A;  2F1L A;  5TY0 A;  3ISX A;  4KKT A;  5B6I A;  3NE5 B;  2W6J A;  2OYN A;  1VQ9 B;  4CQJ A;  2DET A;  3FJO A;  3CCR B;  3SJP A;  5BSY A;  1FNB A;  2BGI A;  3WXM A;  2PIA A;  3CCS B;  4L8J A;  1W35 A;  5IYQ A;  3ASR A;  2BM0 A;  1YJ9 B;  2WJY A;  1R5O A;  3CP8 A;  2YWF A;  3LVB A;  4RD4 A;  3CC7 B;  1NB0 A;  3AGQ A;  4K1X A;  2R9V A;  2VBT A;  2BPO A;  3I56 B;  1EFC A;  2V7W A;  1JA0 A;  4XLF A;  3ZPN A;  2ZL5 A;  1JNY A;  4XLA A;  1GVH A;  4RM0 A;  3WND A;  3ZC3 A;  1YJW B;  3OW7 A;  2X6W A;  3Q38 A;  5H5J A;  2C4U A;  2C4T A;  1Q7Y D;  5HZA A;  3W2G A;  4YAL A;  3AVW A;  1E1R A;  3PUN A;  1W0K A;  4ACA A;  2QEX B;  1FDR A;  1I8D A;  2DEU A;  1KC8 D;  5FL7 A;  1BMF A;  1VLO A;  4G5G A;  3ZZ0 A;  3FPP A;  1KJZ A;  1WOS A;  1PJ7 A;  1VHE A;  3GVL A;  4DQK A;  2ZTN A;  4M1K A;  3A1P A;  2ZZG A;  2VBU A;  5DS0 A;  4AF6 A;  1N08 A;  3H9N A;  1KD1 D;  3OEH A;  2GK7 A;  3WBK A;  4RDL A;  2EIX A;  1AMO A;  5IK2 A;  3WQZ A;  4XR6 A;  2XOK A;  4P12 A;  4C43 A;  5TV2 A;  4TMW A;  1NRK A;  2ZXI A;  1GO2 A;  1VLY A;  2ZBV A;  2XZL A;  2OK8 A;  3WY9 A;  4TMZ A;  2GRE A;  3FPK A;  1RQR A;  3BH4 A;  3SLN A;  1B2R A;  1R5B A;  4B3F X;  1Q9S A;  4RPD A;  1E64 A;  4B3X A;  2WSS A;  3AVV A;  1WSR A;  4NBS A;  2NPF A;  2WR8 A;  4XD7 A;  3VR6 A;  5A88 A;  4OPO A;  4X0C A;  1KK3 A;  2BMW A;  2D74 A;  4Z4S A;  4AF7 A;  1G7S A;  2M5S A;  3Q39 A;  4YAO A;  1QVG B;  4YAU A;  2JDI A;  2GQF A;  2Q6I A;  4XN0 A;  3VO1 A;  3OAA A;  3GVJ A;  2YWE A;  4YXW A;  4ACB A;  4OOX A;  1QGZ A;  1OGI A;  1W87 A;  3A8I A;  1VF7 A;  1TTT A;  4UZE A;  4X7D A;  3CMA B;  1E79 A;  4RCZ A;  3R6K A;  2ZZQ A;  1VQ8 B;  3U6K A;  1T6Z A;  1N06 A;  1FRN A;  3B78 A;  5TRD A;  2F1M A;  4NCN A;  4Z4Z A;  1BLI A;  1CQX A;  1D1N A;  3W2I A;  4Z4U A;  3V7A A;  3CB4 A;  4XM3 A;  4PGO A;  1M1K D;  5FA6 A;  4Y9R A;  4QV2 A;  4WZT A;  3G71 B;  1W0J A;  4RLZ A;  4ZCL A;  1HA3 A;  2XZO A;  3AVU A;  1T6X A;  3W5V A;  4ZGQ B;  3W2F A;  2GK6 A;  2QN6 A;  2B5O A;  2XGJ A;  4II2 A;  1VQL B;  1VQ4 B;  3AVY A;  1IJF A;  3BY2 A;  2VBS A;  3T56 B;  5HKK A;  4TMX A;  4B4D A;  1UD4 A;  3QFT A;  1V0E A;  1YI2 B;  2ZL7 A;  5FO0 A;  1Y0R A;  4MYU A;  4UAJ A;  4XNF A;  1VQM B;  4P1V A;  2P3M A;  1DAR A;  3VNV A;  2BN4 A;  4TT3 A;  1KMH A;  5F4O A;  1K8A D;  4QUZ A;  1YHQ B;  4DQL A;  4J0Q A;  3GQB A;  1VQ5 B;  2JN9 A;  3D26 A;  4ZCI A;  3Q6R A;  4PC1 A;  1UD6 A;  3E20 A;  1JB9 A;  2OBT A;  4B48 A;  4QVA A;  1YLO A;  1QGA A;  1WOR A;  3OKX A;  5CDF A;  2ZZF A;  1DG1 G;  1ZM9 A;  2VNH A;  1E43 A;  2D9R A;  4FXU A;  3T53 B;  4LBY A;  4NNJ A;  2Z6B D;  5KNL A;  2C78 A;  3OZU A;  1Q81 D;  4B43 A;  2PLF A;  5EMN A;  3VO2 A;  4II3 A;  2RC5 A;  4M53 A;  1QGY A;  4KKU A;  4Z4V A;  1F60 A;  4RD0 A;  1E62 A;  4FWT A;  1Q86 D;  1D2E A;  1S72 B;  1QX4 A;  1VQN B;  4OPS A;  5J35 A;  2QTL A;  1VQ6 B;  4AC9 A;  3QE2 A;  1ZM3 A;  2W6I A;  3PEN A;  2V7V A;  3OOC A;  3PUM A;  1B23 P;  4C0S A;  1VQP B;  4PC7 A;  5TR9 A;  1E1Q A;  1EFU A;  2CRV A;  2X6Y A;  2I1L A;  3E1Y E;  3QSY A;  1QFJ A;  2VNI A;  4OOS A;  2X0K A;  2OTJ B;  1P4M A;  3G05 A;  3CC4 B;  2HCJ B;  1WTH D;  2YWH A;  4X05 A;  1VQK B;  1XE1 A;  1I18 A;  3CCL B;  1KK2 A;  4PC6 A;  5F4M A;  2BGJ A;  4WZL A;  3CME B;  4P2N A;  1Q82 D;  1NDH A;  1WU8 A;  3OJX A;  3Q3A A; 
#chains in the Genus database with same CATH homology
 1SKY B;  2VJJ A;  2JDI A;  1E3Z A;  2JJ1 A;  3DDY A;  4KKS A;  4XN0 A;  4XOP A;  3OAA A;  3GVJ A;  4YXW A;  4Z1M A;  3BC9 A;  1VF7 A;  1WPC A;  1E79 A;  4XOT A;  2HLD A;  2D3N A;  2ZZQ A;  3A3B A;  3ZIA A;  1PKV A;  3FKS A;  1EFR A;  4E0F A;  2F1M A;  1VJS A;  1BLI A;  4TKO B;  4XKV A;  4HIZ A;  4P22 A;  2GJR A;  3H94 A;  2JJ2 A;  3GVK A;  1W9X A;  4XM3 A;  2LZJ A;  4XLE A;  4UZU A;  4DK1 A;  1W0J A;  2XND A;  2V7Q A;  4XKW A;  2XZO A;  1H8E A;  2D3L A;  3JU4 A;  2GK6 A;  2QE7 A;  2X53 S;  4KKT A;  3NE5 B;  2W6J A;  1K28 D;  4G7X A;  2XGJ A;  2V31 A;  4II2 A;  3BCF A;  3LNN A;  1UD2 A;  3T56 B;  5HKK A;  2CK3 A;  2V4D A;  4L8J A;  1UD4 A;  1COW A;  1V0F A;  4JMQ A;  1V0E A;  2WJY A;  4XNF A;  3CP8 A;  1NBM A;  3A3G A;  4XLC A;  2R9V A;  4TT3 A;  1KMH A;  4B3G A;  4GQN A;  4DNT B;  3GQB A;  1HZE A;  3BCD A;  5DN6 A;  2JIZ A;  2ZZE A;  4XLF A;  4XL9 A;  1UD6 A;  3ZPN A;  4DNR B;  4YEJ A;  4YEL A;  4XLA A;  1HVX A;  5CDF A;  4DK0 A;  3OEE A;  2GJK A;  2ZZF A;  4ASU A;  1H8H A;  3OW7 A;  2WZP P;  2X6W A;  1E43 A;  1T5E A;  4FXU A;  3T53 B;  4NNJ A;  2Z6B D;  1BPL A;  1MAB A;  5KNL A;  4AVZ A;  1E1R A;  3OE7 A;  3OPO A;  1W0K A;  4II3 A;  1I8D A;  1UD5 A;  1OHH A;  4KKU A;  5FL7 A;  4XQF A;  1BMF A;  2X8K A;  3FPP A;  3KEW A;  4G7W A;  3GVL A;  2ZTN A;  2ZTG A;  2ZZG A;  4XMY A;  3OEH A;  2GK7 A;  2W6I A;  1WP6 A;  5IK2 A;  3WQZ A;  4XR6 A;  3OOC A;  2XOK A;  2X6X A;  1NRK A;  2ZXI A;  1E1Q A;  1VLY A;  1OB0 A;  2XZL A;  2GJP A;  4XOR A;  2X6Y A;  3CMM A;  4XON A;  2X85 A;  1FX0 A;  2F43 A;  3OFN A;  1KZL A;  3G05 A;  3BH4 A;  2WPD A;  4B3F X;  1WTH D;  2KVO A;  2WJV A;  1UD3 A;  4XLH A;  2WSS A;  1I18 A;  3CP2 A;  4XN3 A;  2XZP A;  2VJI A;  1UD8 A;  4G6I A;  3A35 A;  4XD7 A;  3T51 B;  3VR6 A;  2DIE A;  2ZXH A;  4TSF A;  3HAG A;  2E1B A;  1E3X A;  3CES A;  2M5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...