4G7WA

Crystal structure of the n-terminal domain of the minor coat protein piii from ctxphi
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
SAINCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGEECVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Putative uncharacterized protein
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7wA00
4G7WA 4G7XA
chains in the Genus database with same CATH superfamily
1M90D 1VLYA 1DARA 2QTZA 3OW2B 1SKQA 2R6HA 3FJOA 4Z4ZA 3FPKA 3ES9A 5H5JA 5KNLA 3OFNA 4Z4SA 4RDJA 2Q6IA 2DYIA 2VJIA 4P3YA 4FN5A 3T51B 1FNBA 1W35A 1YJNB 2DETA 1NDHA 3BH4A 3CB4A 4N3NA 1VQ4B 3JQQA 2ZZFA 4LC0A 4G6IA 4LBWA 2DOGA 3W2IA 3A1PA 2PIAA 3I1FA 5A8AA 1VQ7B 1GO2A 1UD2A 3KEWA 3AGQA 4TT3A 4Z4TA 1W0KA 2OK7A 4TKOB 4QV2A 4WQMA 5F4OA 1PJ5A 4CQJA 2XZPA 2BGIA 4B3XA 2BPOA 4WZEA 2ZBUA 3LO8A 4RD2A 4X7DA 4F7DA 1Q7YD 5JBQA 1OB5A 1P4MA 4Z4YA 2RC6A 2VNHA 4Y9UA 4QUZA 2ZL6A 4PABA 1QGAA 4OOSA 3U6KA 3ASTA 2WZPP 2QE7A 1ZM9A 1EFUA 2QDXA 3CD6B 1EFCA 4GQNA 4H9GA 3OP1A 4OP7A 1Q82D 3CCSB 3ONYA 1XFOA 1VQMB 3OJWA 3WYAA 4AVZA 3CC2B 1VQNB 5GV7A 2VBUA 3HAGA 4P9SA 4XQFA 5THXA 2ZZGA 4PAAA 2XOKA 4EH1A 1WU8A 4P12A 3W2EA 1H8EA 2F1LA 1QVGB 5J35A 1R5NA 1BX1A 1YIJB 1W9XA 2VJJA 5B6IA 2JN9A 3ASPA 1GVHA 5DS0A 3WBJA 4ROXA 1EXMA 3VR6A 1NJID 3VNUA 2GJRA 4XR6A 2P3MA 1KK3A 1BPLA 3CRZA 1WORA 3OPOA 1QX4A 3GIRA 4XOTA 1UMKA 3A8IA 3W2GA 2HMAA 4YAFA 1Q86D 4WZLA 4YAWA 3QFCA 4XOPA 5E6TA 3BNWA 1HZEA 2CNDA 3DDYA 1D2EA 2FVGA 4X8IA 1YITB 1JNYA 1KMHA 4BPRA 1MRZA 4UZUA 1E3XA 3ASSA 4QVJA 4WZTA 4OOVA 4P2NA 1W2BB 5DSZA 1E3ZA 1YJ9B 1VQLB 1FRNA 4RJLA 5GV8A 2V7QA 4X7EA 3CCMB 3OAAA 2GJKA 2V7VA 1VQ9B 4ASUA 4PGOA 1VQ6B 1BMFA 4RD1A 2GK7A 2ZTGA 3G71B 3FPPA 1I18A 4C43A 4PC2A 3G6EB 4RD6A 4XN3A 4RD0A 4C0SA 1Y0RA 3A35A 1SM4A 3U6BA 5BSXA 1OGIA 1A8PA 4LBYA 4X06A 1N8RD 2VNIA 1GAWA 4P22A 1VHOA 4RDLA 4XLHA 3D26A 2R9VA 4YAUA 5KW9A 4NBSA 1ZM4A 4Z4UA 3R6JA 1E63A 1G7RA 1YJWB 4B47A 1BQEA 4B4DA 1VQKB 1WTHD 2C5BA 2X6WA 3W5VA 5IYNA 2AHOA 2JJ2A 1V5VA 1WOOA 1ZM2A 2JDIA 1Q9SA 2EIXA 2EFGA 2LZJA 1D8TA 3BC9A 4FXUA 3AVTA 2V7UA 4X7FA 4Q7JB 1PKVA 4XM3A 1WOSA 3V76A 3MMPA 3W2FA 1N07A 4X7CA 3ZZ0A 3JQRA 2CF4A 2ZBVA 3AVUA 1CNEA 3MCAA 4XL9A 3SLDA 4Y9RA 2GQFA 3LVBA 1S0UA 1WSVA 3W5HA 5KSWB 4ZGNB 1W87A 2Q6OA 4XLCA 1FNMA 1B2RA 1PJ6A 4M1KA 4P25A 3H94A 5IK2A 4PC6A 1FNCA 2WJYA 3T53B 1Y0YA 4HE5A 2W6IA 4Z4RA 4RCYA 5IYQA 1QFZA 2BV3A 4II3A 3SEJA 3CCVB 2QN6A 2OTLB 1K28D 3OOCA 3BCDA 4WZKA 4P26A 4AF6A 3OE7A 5L46A 3SJZA 1K9MD 2W6JA 1M1KD 2CC2A 4RD3A 2XNDA 4II2A 5F4JA 2YWHA 2VBTA 3PUNA 3SLNA 3CCRB 1ZUNB 1ELOA 4B44A 1H8HA 5FO0A 1VQ5B 5J3OA 4ZCIA 1GAQA 2Z6BD 2KVOA 3CMMA 5IYPA 2X6XA 1OB0A 4B48A 3AVWA 1OGJA 3ZC3A 4TMTA 2BGJA 1QFJA 5A89A 2DIEA 2D9RA 3Q3AA 4DK1A 1BLIA 4XLEA 4QHYA 1WSRA 4NCNA 4OOXA 3RY8A 3OZUA 3GVLA 1U2RA 2PE3A 5F4MA 4LBZA 1RQRA 4R71A 4TMWA 2VBSA 4B43A 4UZFA 2DEUA 2QEXB 4OPSA 1KZLA 3LQ6A 4XONA 3I56B 2HDNB 1H42A 3GVJA 2OTJB 4TSFA 4Y7CA 5HXBA 1KK0A 1R5BA 3OW7A 4X0CA 1G7CA 3QE2A 3CCLB 4LBVA 1QUEA 4KKSA 3WQZA 1VHEA 3BY1A 1N0VC 1E1RA 5FA6A 4XLAA 4DNRB 2CW5A 1VQPB 3CCEB 1RQPA 2C78A 1VJSA 2F4NA 4UZEA 4XNFA 3VO1A 4B3FX 1T6ZA 4P1VA 4P3IA 4XD7A 1H85A 3OEEA 4RPDA 2WYRA 1HA3A 4YAOA 5AN9A 3PENA 3CPXA 1UD6A 4P6YA 2RC5A 3Q39A 2FX3A 5FL7A 4B3GA 1EP3B 2CBXA 4K1XA 1QUFA 4G1BA 1NB9A 4RLZA 1TVCA 3ISXA 4XN0A 1R5OA 1GR1A 1IB0A 2ZL5A 4YHBA 1VQOB 3B78A 2ZTNA 1SKYB 1F20A 3WNCA 2CRVA 4J0QA 2XNCA 5TY0A 2VNKA 2C4TA 2ZZQA 3VNVA 2ZXIA 1FDRA 3BQJA 3CESA 1NB0A 3B8HA 1AIPA 1NBMA 1WPCA 3JU4A 3PVDA 3Q6RA 1XB2A 1S4MA 1V0FA 2HLDA 4XORA 2VBVA 3GQBA 2X3UA 3FKSA 3P27A 1KJZA 4M0LA 3WY9A 4U9UA 3SJPA 2WPDA 2OYNA 3A8JA 4Z4VA 4ZCMA 2V4DA 3Q38A 2JJ1A 4RD4A 2NV4A 1KD1D 1DG1G 4M2LA 4PC1A 4KKUA 3ASQA 3W5UA 4G1VA 1YX2A 2OBSA 4L8JA 4XKVA 4ZV4A 2XGJA 4NNJA 4E0FA 1E1QA 1D1NA 1QH0A 2WSSA 3CCUB 4G5GA 3QFTA 1T6YA 2C77A 1N0UA 2V7XA 2X8KA 1EP2B 3H9NA 2PMDA 3WNBA 2HCJB 1QGZA 1E79A 4ACBA 1HVXA 2QA4B 4RPBA 1TTTA 3CTAA 4Z1MA 4AC9A 3SKBA 5TV2A 5HZBA 2JIZA 3CMEB 3A3GA 5FIUA 5DN6A 1CNFA 4UAJA 4Z4WA 3CP8A 4M53A 3CW2A 1N06A 2XEXA 1KC8D 3B82A 1TUIA 5A88A 4ACAA 1V0EA 4MYUA 1DDIA 4FWTA 3ZIAA 3E1YE 1VLOA 4G7XA 4JMQA 4PC7A 2NPFA 1IJFA 2ZITA 3ZZTA 1Q81D 2XZLA 2GREA 1JB9A 3ZZUA 1I8DA 2YWGA 1YHQB 1UD4A 2QGGA 1YLOA 3OJXA 3P26A 1WP6A 3QFRA 3MHPA 2GJPA 2DCUA 3BCFA 1G7SA 3GSIA 2BVNA 1VF7A 2VNJA 3CC4B 2YWFA 1EP1B 1BJKA 1QGYA 4X05A 2ZL7A 4G7WA 4KKTA 4P6VF 1N08A 3T56B 3W2HA 3ONUA 2F1MA 1YI2B 2B7BA 1QVFB 3J81k 1JJ2B 2OBRA 1TLLA 2C4UA 2VZLA 1COWA 1JA0A 3QFSA 2B7CA 2D3NA 2WR8A 4HE6A 2OK8A 3CC7B 2DERA 3PUMA 2WJVA 2BN4A 3WXMA 1UD8A 1E62A 1FX0A 3ZUGA 2YWEA 3PA2A 4XKWA 2VYQA 3QSYA 3U2QA 4ZGQB 4TMVA 1QG0A 1I7PA 5IYRA 3V7AA 4OPVA 2M5SA 1W34A 1IHMA 1J9ZA 3ZBTA 4HIZA 4TN1A 1T6XA 2DY1A 2V31A 4X07A 3CCQB 3GVKA 2QTLA 2BM0A 3G4SB 2ZZEA 1WOPA 3OZVA 1VQ8B 4RM0A 3Q6QA 2BF4A 3ZPNA 2CK3A 3KL9A 3R6KA 3ASRA 4XLFA 2XZOA 4RDKA 2QMUA 2F43A 4RCZA 1ZM3A 1E43A 1IJEA 3A8KA 4YALA 1EFRA 1WDTA 3AVVA 4OPOA 3BY2A 4YELA 4MYTA 1FNDA 2C2WA 2C5HA 3CXCB 5CDFA 2V7WA 1XQBA 5FO1A 1OB2A 2E1RA 2X0KA 3CCJB 3G05A 1JA1A 1UD5A 1T5EA 2D3LA 2X85A 2E1BA 2PLFA 1CQXA 5EMNA 1EFTA 5IYWA 3OEHA 3JQPA 4TMZA 4YXWA 1KK1A 5H59A 1B23P 3VO2A 1DDGA 1PJ7A 1UD3A 3A3BA 4WWVA 4IW3B 3WBKA 1NRKA 2BSAA 5TRDA 1KQSB 1BX0A 3VMFA 4FK8A 4ZCLA 2X53S 1N05A 2GPJA 5FNZA 2ZXHA 1G7TA 1W0JA 1MABA 2GK6A 3CPWB 1EWYA 3AVXA 5TR9A 1KTVA 1XE1A 4XMYA 2WZNA 5LMZA 2D74A 1S72B 1GJRA 4YEJA 3OZWA 4DK0A 3E20A 4DQLA 1KRHA 2B5OA 2XNJA 2OBTA 1K73D 4M4SA 2X6YA 1F60A 5HZAA 3WNDA 1K8AD 3AVYA 4PC3A 5BSYA 3AGPA 3LNNA 3ZBUA 1E64A 4AF7A 2J7KA 3OKXA 4N3GA 2V7TA 3I55B 4TMXA 1AMOA 2BMWA 2Q6LA 2Q6KA 1FRQA 4QVAA 4DNTB 1QFYA 1KK2A 3PA1A 3CP2A 4DQKA 5HKKA 4QFMA 3NE5B 3CMAB 2BM1A 1OHHA 3LQEA 2I1LA
chains in the Genus database with same CATH topology
1VLYA 2F1MA 4XD7A 3OEEA 1WTHD 2X6WA 5KNLA 3OFNA 1COWA 2JJ2A 1UD6A 2VJIA 2D3NA 3T51B 2JDIA 2LZJA 5FL7A 2WJVA 3BC9A 4FXUA 4B3GA 3BH4A 1UD8A 1FX0A 2ZZFA 4XN0A 1PKVA 4G6IA 4XKWA 4XM3A 1UD2A 2ZTNA 1SKYB 3KEWA 4TT3A 2M5SA 1W0KA 4TKOB 2ZZQA 2ZXIA 4XL9A 4HIZA 3CESA 2XZPA 1WPCA 1NBMA 2V31A 3JU4A 1V0FA 2HLDA 4XORA 3GVKA 4XLCA 3GQBA 2ZZEA 5IK2A 3FKSA 3H94A 2WPDA 2WJYA 3T53B 2WZPP 2W6IA 3ZPNA 2CK3A 2QE7A 2V4DA 4XLFA 2XZOA 2JJ1A 4II3A 2F43A 1E43A 1K28D 4GQNA 3OOCA 1EFRA 4KKUA 3BCDA 4L8JA 4XKVA 4YELA 5CDFA 4AVZA 3OE7A 2XGJA 3G05A 4NNJA 4E0FA 3HAGA 4XQFA 2W6JA 1E1QA 1UD5A 1T5EA 2D3LA 2ZZGA 2X85A 2XOKA 2E1BA 2WSSA 2XNDA 4II2A 1H8EA 3OEHA 4YXWA 2X8KA 1W9XA 2VJJA 1UD3A 1E79A 1H8HA 3A3BA 1HVXA 1NRKA 3VR6A 3CMMA 2GJRA 2KVOA 2Z6BD 4XR6A 4Z1MA 2X6XA 1OB0A 2X53S 2JIZA 1BPLA 3OPOA 2ZXHA 3A3GA 1W0JA 1MABA 2GK6A 4XOTA 5DN6A 2DIEA 4XOPA 1HZEA 3DDYA 4DK1A 1BLIA 3CP8A 4XMYA 4XLEA 1KMHA 4UZUA 1E3XA 4YEJA 3GVLA 4DK0A 1E3ZA 1V0EA 1KZLA 2V7QA 4XONA 2X6YA 3OAAA 3ZIAA 4G7XA 3GVJA 2GJKA 4TSFA 4ASUA 3LNNA 4JMQA 1BMFA 2XZLA 2GK7A 3OW7A 2ZTGA 1I8DA 1UD4A 4KKSA 3WQZA 3FPPA 1I18A 4DNTB 1E1RA 1WP6A 4XN3A 3CP2A 3A35A 4XLAA 2GJPA 4DNRB 3BCFA 5HKKA 1VF7A 3NE5B 1VJSA 4G7WA 4KKTA 1OHHA 4P22A 4XLHA 2R9VA 3T56B 4XNFA 4B3FX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7W A;  4G7X A; 
#chains in the Genus database with same CATH topology
 1M90 D;  1VLY A;  1DAR A;  2QTZ A;  3OW2 B;  1SKQ A;  2R6H A;  3FJO A;  4Z4Z A;  3FPK A;  3ES9 A;  5H5J A;  5KNL A;  3OFN A;  4Z4S A;  4RDJ A;  2Q6I A;  2DYI A;  2VJI A;  4P3Y A;  4FN5 A;  3T51 B;  1FNB A;  1W35 A;  1YJN B;  2DET A;  1NDH A;  3BH4 A;  3CB4 A;  4N3N A;  1VQ4 B;  3JQQ A;  2ZZF A;  4LC0 A;  4G6I A;  4LBW A;  2DOG A;  3W2I A;  3A1P A;  2PIA A;  3I1F A;  5A8A A;  1VQ7 B;  1GO2 A;  1UD2 A;  3KEW A;  3AGQ A;  4TT3 A;  4Z4T A;  1W0K A;  2OK7 A;  4TKO B;  4QV2 A;  4WQM A;  5F4O A;  1PJ5 A;  4CQJ A;  2XZP A;  2BGI A;  4B3X A;  2BPO A;  4WZE A;  2ZBU A;  3LO8 A;  4RD2 A;  4X7D A;  4F7D A;  1Q7Y D;  5JBQ A;  1OB5 A;  1P4M A;  4Z4Y A;  2RC6 A;  2VNH A;  4Y9U A;  4QUZ A;  2ZL6 A;  4PAB A;  1QGA A;  4OOS A;  3U6K A;  3AST A;  2WZP P;  2QE7 A;  1ZM9 A;  1EFU A;  2QDX A;  3CD6 B;  1EFC A;  4GQN A;  4H9G A;  3OP1 A;  4OP7 A;  1Q82 D;  3CCS B;  3ONY A;  1XFO A;  1VQM B;  3OJW A;  3WYA A;  4AVZ A;  3CC2 B;  1VQN B;  5GV7 A;  2VBU A;  3HAG A;  4P9S A;  4XQF A;  5THX A;  2ZZG A;  4PAA A;  2XOK A;  4EH1 A;  1WU8 A;  4P12 A;  3W2E A;  1H8E A;  2F1L A;  1QVG B;  5J35 A;  1R5N A;  1BX1 A;  1YIJ B;  1W9X A;  2VJJ A;  5B6I A;  2JN9 A;  3ASP A;  1GVH A;  5DS0 A;  3WBJ A;  4ROX A;  1EXM A;  3VR6 A;  1NJI D;  3VNU A;  2GJR A;  4XR6 A;  2P3M A;  1KK3 A;  1BPL A;  3CRZ A;  1WOR A;  3OPO A;  1QX4 A;  3GIR A;  4XOT A;  1UMK A;  3A8I A;  3W2G A;  2HMA A;  4YAF A;  1Q86 D;  4WZL A;  4YAW A;  3QFC A;  4XOP A;  5E6T A;  3BNW A;  1HZE A;  2CND A;  3DDY A;  1D2E A;  2FVG A;  4X8I A;  1YIT B;  1JNY A;  1KMH A;  4BPR A;  1MRZ A;  4UZU A;  1E3X A;  3ASS A;  4QVJ A;  4WZT A;  4OOV A;  4P2N A;  1W2B B;  5DSZ A;  1E3Z A;  1YJ9 B;  1VQL B;  1FRN A;  4RJL A;  5GV8 A;  2V7Q A;  4X7E A;  3CCM B;  3OAA A;  2GJK A;  2V7V A;  1VQ9 B;  4ASU A;  4PGO A;  1VQ6 B;  1BMF A;  4RD1 A;  2GK7 A;  2ZTG A;  3G71 B;  3FPP A;  1I18 A;  4C43 A;  4PC2 A;  3G6E B;  4RD6 A;  4XN3 A;  4RD0 A;  4C0S A;  1Y0R A;  3A35 A;  1SM4 A;  3U6B A;  5BSX A;  1OGI A;  1A8P A;  4LBY A;  4X06 A;  1N8R D;  2VNI A;  1GAW A;  4P22 A;  1VHO A;  4RDL A;  4XLH A;  3D26 A;  2R9V A;  4YAU A;  5KW9 A;  4NBS A;  1ZM4 A;  4Z4U A;  3R6J A;  1E63 A;  1G7R A;  1YJW B;  4B47 A;  1BQE A;  4B4D A;  1VQK B;  1WTH D;  2C5B A;  2X6W A;  3W5V A;  5IYN A;  2AHO A;  2JJ2 A;  1V5V A;  1WOO A;  1ZM2 A;  2JDI A;  1Q9S A;  2EIX A;  2EFG A;  2LZJ A;  1D8T A;  3BC9 A;  4FXU A;  3AVT A;  2V7U A;  4X7F A;  4Q7J B;  1PKV A;  4XM3 A;  1WOS A;  3V76 A;  3MMP A;  3W2F A;  1N07 A;  4X7C A;  3ZZ0 A;  3JQR A;  2CF4 A;  2ZBV A;  3AVU A;  1CNE A;  3MCA A;  4XL9 A;  3SLD A;  4Y9R A;  2GQF A;  3LVB A;  1S0U A;  1WSV A;  3W5H A;  5KSW B;  4ZGN B;  1W87 A;  2Q6O A;  4XLC A;  1FNM A;  1B2R A;  1PJ6 A;  4M1K A;  4P25 A;  3H94 A;  5IK2 A;  4PC6 A;  1FNC A;  2WJY A;  3T53 B;  1Y0Y A;  4HE5 A;  2W6I A;  4Z4R A;  4RCY A;  5IYQ A;  1QFZ A;  2BV3 A;  4II3 A;  3SEJ A;  3CCV B;  2QN6 A;  2OTL B;  1K28 D;  3OOC A;  3BCD A;  4WZK A;  4P26 A;  4AF6 A;  3OE7 A;  5L46 A;  3SJZ A;  1K9M D;  2W6J A;  1M1K D;  2CC2 A;  4RD3 A;  2XND A;  4II2 A;  5F4J A;  2YWH A;  2VBT A;  3PUN A;  3SLN A;  3CCR B;  1ZUN B;  1ELO A;  4B44 A;  1H8H A;  5FO0 A;  1VQ5 B;  5J3O A;  4ZCI A;  1GAQ A;  2Z6B D;  2KVO A;  3CMM A;  5IYP A;  2X6X A;  1OB0 A;  4B48 A;  3AVW A;  1OGJ A;  3ZC3 A;  4TMT A;  2BGJ A;  1QFJ A;  5A89 A;  2DIE A;  2D9R A;  3Q3A A;  4DK1 A;  1BLI A;  4XLE A;  4QHY A;  1WSR A;  4NCN A;  4OOX A;  3RY8 A;  3OZU A;  3GVL A;  1U2R A;  2PE3 A;  5F4M A;  4LBZ A;  1RQR A;  4R71 A;  4TMW A;  2VBS A;  4B43 A;  4UZF A;  2DEU A;  2QEX B;  4OPS A;  1KZL A;  3LQ6 A;  4XON A;  3I56 B;  2HDN B;  1H42 A;  3GVJ A;  2OTJ B;  4TSF A;  4Y7C A;  5HXB A;  1KK0 A;  1R5B A;  3OW7 A;  4X0C A;  1G7C A;  3QE2 A;  3CCL B;  4LBV A;  1QUE A;  4KKS A;  3WQZ A;  1VHE A;  3BY1 A;  1N0V C;  1E1R A;  5FA6 A;  4XLA A;  4DNR B;  2CW5 A;  1VQP B;  3CCE B;  1RQP A;  2C78 A;  1VJS A;  2F4N A;  4UZE A;  4XNF A;  3VO1 A;  4B3F X;  1T6Z A;  4P1V A;  4P3I A;  4XD7 A;  1H85 A;  3OEE A;  4RPD A;  2WYR A;  1HA3 A;  4YAO A;  5AN9 A;  3PEN A;  3CPX A;  1UD6 A;  4P6Y A;  2RC5 A;  3Q39 A;  2FX3 A;  5FL7 A;  4B3G A;  1EP3 B;  2CBX A;  4K1X A;  1QUF A;  4G1B A;  1NB9 A;  4RLZ A;  1TVC A;  3ISX A;  4XN0 A;  1R5O A;  1GR1 A;  1IB0 A;  2ZL5 A;  4YHB A;  1VQO B;  3B78 A;  2ZTN A;  1SKY B;  1F20 A;  3WNC A;  2CRV A;  4J0Q A;  2XNC A;  5TY0 A;  2VNK A;  2C4T A;  2ZZQ A;  3VNV A;  2ZXI A;  1FDR A;  3BQJ A;  3CES A;  1NB0 A;  3B8H A;  1AIP A;  1NBM A;  1WPC A;  3JU4 A;  3PVD A;  3Q6R A;  1XB2 A;  1S4M A;  1V0F A;  2HLD A;  4XOR A;  2VBV A;  3GQB A;  2X3U A;  3FKS A;  3P27 A;  1KJZ A;  4M0L A;  3WY9 A;  4U9U A;  3SJP A;  2WPD A;  2OYN A;  3A8J A;  4Z4V A;  4ZCM A;  2V4D A;  3Q38 A;  2JJ1 A;  4RD4 A;  2NV4 A;  1KD1 D;  1DG1 G;  4M2L A;  4PC1 A;  4KKU A;  3ASQ A;  3W5U A;  4G1V A;  1YX2 A;  2OBS A;  4L8J A;  4XKV A;  4ZV4 A;  2XGJ A;  4NNJ A;  4E0F A;  1E1Q A;  1D1N A;  1QH0 A;  2WSS A;  3CCU B;  4G5G A;  3QFT A;  1T6Y A;  2C77 A;  1N0U A;  2V7X A;  2X8K A;  1EP2 B;  3H9N A;  2PMD A;  3WNB A;  2HCJ B;  1QGZ A;  1E79 A;  4ACB A;  1HVX A;  2QA4 B;  4RPB A;  1TTT A;  3CTA A;  4Z1M A;  4AC9 A;  3SKB A;  5TV2 A;  5HZB A;  2JIZ A;  3CME B;  3A3G A;  5FIU A;  5DN6 A;  1CNF A;  4UAJ A;  4Z4W A;  3CP8 A;  4M53 A;  3CW2 A;  1N06 A;  2XEX A;  1KC8 D;  3B82 A;  1TUI A;  5A88 A;  4ACA A;  1V0E A;  4MYU A;  1DDI A;  4FWT A;  3ZIA A;  3E1Y E;  1VLO A;  4G7X A;  4JMQ A;  4PC7 A;  2NPF A;  1IJF A;  2ZIT A;  3ZZT A;  1Q81 D;  2XZL A;  2GRE A;  1JB9 A;  3ZZU A;  1I8D A;  2YWG A;  1YHQ B;  1UD4 A;  2QGG A;  1YLO A;  3OJX A;  3P26 A;  1WP6 A;  3QFR A;  3MHP A;  2GJP A;  2DCU A;  3BCF A;  1G7S A;  3GSI A;  2BVN A;  1VF7 A;  2VNJ A;  3CC4 B;  2YWF A;  1EP1 B;  1BJK A;  1QGY A;  4X05 A;  2ZL7 A;  4G7W A;  4KKT A;  4P6V F;  1N08 A;  3T56 B;  3W2H A;  3ONU A;  2F1M A;  1YI2 B;  2B7B A;  1QVF B;  3J81 k;  1JJ2 B;  2OBR A;  1TLL A;  2C4U A;  2VZL A;  1COW A;  1JA0 A;  3QFS A;  2B7C A;  2D3N A;  2WR8 A;  4HE6 A;  2OK8 A;  3CC7 B;  2DER A;  3PUM A;  2WJV A;  2BN4 A;  3WXM A;  1UD8 A;  1E62 A;  1FX0 A;  3ZUG A;  2YWE A;  3PA2 A;  4XKW A;  2VYQ A;  3QSY A;  3U2Q A;  4ZGQ B;  4TMV A;  1QG0 A;  1I7P A;  5IYR A;  3V7A A;  4OPV A;  2M5S A;  1W34 A;  1IHM A;  1J9Z A;  3ZBT A;  4HIZ A;  4TN1 A;  1T6X A;  2DY1 A;  2V31 A;  4X07 A;  3CCQ B;  3GVK A;  2QTL A;  2BM0 A;  3G4S B;  2ZZE A;  1WOP A;  3OZV A;  1VQ8 B;  4RM0 A;  3Q6Q A;  2BF4 A;  3ZPN A;  2CK3 A;  3KL9 A;  3R6K A;  3ASR A;  4XLF A;  2XZO A;  4RDK A;  2QMU A;  2F43 A;  4RCZ A;  1ZM3 A;  1E43 A;  1IJE A;  3A8K A;  4YAL A;  1EFR A;  1WDT A;  3AVV A;  4OPO A;  3BY2 A;  4YEL A;  4MYT A;  1FND A;  2C2W A;  2C5H A;  3CXC B;  5CDF A;  2V7W A;  1XQB A;  5FO1 A;  1OB2 A;  2E1R A;  2X0K A;  3CCJ B;  3G05 A;  1JA1 A;  1UD5 A;  1T5E A;  2D3L A;  2X85 A;  2E1B A;  2PLF A;  1CQX A;  5EMN A;  1EFT A;  5IYW A;  3OEH A;  3JQP A;  4TMZ A;  4YXW A;  1KK1 A;  5H59 A;  1B23 P;  3VO2 A;  1DDG A;  1PJ7 A;  1UD3 A;  3A3B A;  4WWV A;  4IW3 B;  3WBK A;  1NRK A;  2BSA A;  5TRD A;  1KQS B;  1BX0 A;  3VMF A;  4FK8 A;  4ZCL A;  2X53 S;  1N05 A;  2GPJ A;  5FNZ A;  2ZXH A;  1G7T A;  1W0J A;  1MAB A;  2GK6 A;  3CPW B;  1EWY A;  3AVX A;  5TR9 A;  1KTV A;  1XE1 A;  4XMY A;  2WZN A;  5LMZ A;  2D74 A;  1S72 B;  1GJR A;  4YEJ A;  3OZW A;  4DK0 A;  3E20 A;  4DQL A;  1KRH A;  2B5O A;  2XNJ A;  2OBT A;  1K73 D;  4M4S A;  2X6Y A;  1F60 A;  5HZA A;  3WND A;  1K8A D;  3AVY A;  4PC3 A;  5BSY A;  3AGP A;  3LNN A;  3ZBU A;  1E64 A;  4AF7 A;  2J7K A;  3OKX A;  4N3G A;  2V7T A;  3I55 B;  4TMX A;  1AMO A;  2BMW A;  2Q6L A;  2Q6K A;  1FRQ A;  4QVA A;  4DNT B;  1QFY A;  1KK2 A;  3PA1 A;  3CP2 A;  4DQK A;  5HKK A;  4QFM A;  3NE5 B;  3CMA B;  2BM1 A;  1OHH A;  3LQE A;  2I1L A; 
#chains in the Genus database with same CATH homology
 1VLY A;  2F1M A;  4XD7 A;  3OEE A;  1WTH D;  2X6W A;  5KNL A;  3OFN A;  1COW A;  2JJ2 A;  1UD6 A;  2VJI A;  2D3N A;  3T51 B;  2JDI A;  2LZJ A;  5FL7 A;  2WJV A;  3BC9 A;  4FXU A;  4B3G A;  3BH4 A;  1UD8 A;  1FX0 A;  2ZZF A;  4XN0 A;  1PKV A;  4G6I A;  4XKW A;  4XM3 A;  1UD2 A;  2ZTN A;  1SKY B;  3KEW A;  4TT3 A;  2M5S A;  1W0K A;  4TKO B;  2ZZQ A;  2ZXI A;  4XL9 A;  4HIZ A;  3CES A;  2XZP A;  1WPC A;  1NBM A;  2V31 A;  3JU4 A;  1V0F A;  2HLD A;  4XOR A;  3GVK A;  4XLC A;  3GQB A;  2ZZE A;  5IK2 A;  3FKS A;  3H94 A;  2WPD A;  2WJY A;  3T53 B;  2WZP P;  2W6I A;  3ZPN A;  2CK3 A;  2QE7 A;  2V4D A;  4XLF A;  2XZO A;  2JJ1 A;  4II3 A;  2F43 A;  1E43 A;  1K28 D;  4GQN A;  3OOC A;  1EFR A;  4KKU A;  3BCD A;  4L8J A;  4XKV A;  4YEL A;  5CDF A;  4AVZ A;  3OE7 A;  2XGJ A;  3G05 A;  4NNJ A;  4E0F A;  3HAG A;  4XQF A;  2W6J A;  1E1Q A;  1UD5 A;  1T5E A;  2D3L A;  2ZZG A;  2X85 A;  2XOK A;  2E1B A;  2WSS A;  2XND A;  4II2 A;  1H8E A;  3OEH A;  4YXW A;  2X8K A;  1W9X A;  2VJJ A;  1UD3 A;  1E79 A;  1H8H A;  3A3B A;  1HVX A;  1NRK A;  3VR6 A;  3CMM A;  2GJR A;  2KVO A;  2Z6B D;  4XR6 A;  4Z1M A;  2X6X A;  1OB0 A;  2X53 S;  2JIZ A;  1BPL A;  3OPO A;  2ZXH A;  3A3G A;  1W0J A;  1MAB A;  2GK6 A;  4XOT A;  5DN6 A;  2DIE A;  4XOP A;  1HZE A;  3DDY A;  4DK1 A;  1BLI A;  3CP8 A;  4XMY A;  4XLE A;  1KMH A;  4UZU A;  1E3X A;  4YEJ A;  3GVL A;  4DK0 A;  1E3Z A;  1V0E A;  1KZL A;  2V7Q A;  4XON A;  2X6Y A;  3OAA A;  3ZIA A;  4G7X A;  3GVJ A;  2GJK A;  4TSF A;  4ASU A;  3LNN A;  4JMQ A;  1BMF A;  2XZL A;  2GK7 A;  3OW7 A;  2ZTG A;  1I8D A;  1UD4 A;  4KKS A;  3WQZ A;  3FPP A;  1I18 A;  4DNT B;  1E1R A;  1WP6 A;  4XN3 A;  3CP2 A;  3A35 A;  4XLA A;  2GJP A;  4DNR B;  3BCF A;  5HKK A;  1VF7 A;  3NE5 B;  1VJS A;  4G7W A;  4KKT A;  1OHH A;  4P22 A;  4XLH A;  2R9V A;  3T56 B;  4XNF A;  4B3F X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...