4G7WA

Crystal structure of the n-terminal domain of the minor coat protein piii from ctxphi
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
SAINCDPNTTTSHQLLFGFGSPIVQSVLFDGCMLDIEKDDYGFVWSCLSNENGDYCKGLYKPRFTQGVSPNWPMCDLSGASAERCIYPYCPEGEECVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structures of a CTX{varphi} pIII Domain Unbound and in Complex with a Vibrio cholerae TolA Domain Reveal Novel Interaction Interfaces.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein binding
total genus 12
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.280 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4g7wA00
4G7XA 4G7WA
chains in the Genus database with same CATH superfamily
4K1XA 2B7CA 4II2A 3GQBA 1M90D 2RC6A 1W0JA 1ZM9A 1B2RA 2ZL5A 4Z4UA 2CK3A 4FWTA 1QG0A 4J0QA 3CCUB 4XL9A 3WNBA 4ZCIA 2ZL7A 3ASTA 4B3FX 5A88A 2NV4A 4YAFA 3QFRA 3AGQA 3OOCA 3LO8A 1H8HA 1E1RA 3OZUA 1W2BB 1VQKB 1IJFA 5FIUA 3V76A 5IYNA 1FNDA 1TLLA 4EH1A 2QE7A 3JQRA 3R6KA 2OBRA 3LVBA 4XNFA 3CCVB 2DEUA 1EFRA 4ASUA 3B78A 1E79A 4Z4RA 1GAQA 4XD7A 1UD8A 4LBVA 1VQNB 4XLEA 3OEEA 1DG1G 2PLFA 3ASPA 3P26A 1QVGB 4B3GA 4ACBA 2OTLB 3PVDA 4ZCMA 1VQ4B 3CESA 1VQ5B 4YAWA 4QVAA 3GVKA 1NRKA 4C0SA 2GK7A 4OOXA 3ZUGA 3Q3AA 2ZZFA 2ZITA 3Q38A 3SEJA 3SJPA 2R9VA 1VHEA 4RD2A 3VR6A 2BM1A 3ZIAA 4RDLA 2BN4A 4X7CA 3W2EA 1VQ7B 4M53A 1FNMA 2DIEA 4HIZA 2F1MA 1FRNA 3OW2B 2BMWA 4X07A 3ZBUA 2QTZA 3LQ6A 1G7TA 3CCLB 5KNLA 1GAWA 3QSYA 5TRDA 5FO0A 3OJWA 3GVJA 3AVVA 1HA3A 5H5JA 1OB0A 2V31A 2VBTA 4TMXA 4B4DA 4NNJA 3E1YE 3Q39A 3CRZA 4P6VF 2CRVA 3CP2A 3I55B 3A3GA 4ACAA 4Q7JB 5KW9A 4M2LA 3W2HA 1T6XA 5GV8A 4RDKA 1XFOA 2ZXIA 5BSYA 3CCRB 2GJKA 2Q6OA 1QFZA 1SKYB 4X06A 5F4MA 1E3XA 3KEWA 1VQLB 4ROXA 1G7RA 3CMMA 1YIJB 4FK8A 2VJJA 3SKBA 4IW3B 3J81k 2HCJB 2WJYA 1N05A 3OJXA 3CXCB 2ZL6A 4MYTA 2GQFA 4B48A 2OBSA 5HXBA 4G5GA 3AVXA 4DK0A 2VYQA 2D3LA 4P25A 3OFNA 1PJ7A 4NBSA 4UZUA 1FNCA 4AF6A 1KK2A 4P26A 4XQFA 4Z4YA 4X8IA 2X6YA 2J7KA 4LC0A 4RD1A 1FX0A 1WDTA 4LBWA 4Z1MA 3SLDA 2BM0A 1EP3B 1MABA 3JQPA 3HAGA 1VLYA 3BNWA 1QUEA 1DDIA 3VO2A 1N06A 4WZEA 4JMQA 1JA0A 2RC5A 1ZM4A 3OPOA 3A8KA 1K8AD 2F43A 3AGPA 4G7XA 2YWFA 4FN5A 3WNCA 1CNFA 3OW7A 1TVCA 2CC2A 1IJEA 1WPCA 1BX0A 2BF4A 1D1NA 4B43A 3CW2A 5BSXA 4ZGNB 1HVXA 3FJOA 2FVGA 3CMEB 5TR9A 2OK7A 4PGOA 1TUIA 5A89A 3ONUA 2C5BA 2ZZGA 4N3NA 2JN9A 1YITB 4Y9UA 2M5SA 1E62A 3OE7A 1JA1A 4BPRA 5IYPA 4HE6A 1KJZA 2V7VA 1VQMB 1COWA 1WP6A 2ZZQA 2F4NA 2WJVA 2P3MA 1XQBA 2YWEA 4G7WA 4Y9RA 4G1BA 4QHYA 3R6JA 4RPDA 3WQZA 2C5HA 1KK0A 2OTJB 2DYIA 3B8HA 1JNYA 2NPFA 1T6ZA 3OZVA 4KKUA 3BY1A 4TSFA 1QGYA 4XN3A 4TMTA 4XM3A 3ZZ0A 1E43A 3W5HA 2ZBUA 4TMZA 4F7DA 1Q82D 1KZLA 3A8IA 2VNIA 4XLFA 1VQOB 4OPVA 2ZTNA 5JBQA 3AVUA 1PJ6A 1FDRA 1D2EA 3U6BA 3G4SB 2JJ2A 1NJID 1H85A 1N0UA 1WSRA 3CC7B 2V7QA 4P2NA 2DY1A 2ZBVA 2E1RA 1AIPA 4R71A 1BJKA 1KQSB 1Q7YD 3ONYA 3W2GA 5HZAA 4QUZA 2PMDA 2EFGA 2XZPA 3T56B 2GREA 1BMFA 3PA1A 3G6EB 4YELA 1VLOA 3CB4A 3VNVA 4YEJA 5TY0A 1MRZA 4X05A 4RD3A 5FA6A 2XOKA 4P12A 3W5UA 2V7XA 4U9UA 5THXA 3AVWA 2AHOA 2XGJA 2V4DA 4RCZA 2X6WA 1EP1B 1G7SA 1KMHA 5TV2A 1CNEA 4P3IA 4TT3A 4Z4TA 2BSAA 4LBYA 1M1KD 1NBMA 1W87A 1WSVA 1EFUA 2WYRA 5A8AA 2VBVA 1S0UA 4X7DA 2BGIA 1W34A 1G7CA 2C4TA 2FX3A 1V0EA 4DK1A 1ELOA 3OP1A 3CP8A 1WTHD 3OZWA 4QVJA 4RM0A 1GVHA 2CBXA 2X6XA 4GQNA 2WZPP 1YHQB 4II3A 3Q6RA 4M4SA 4RD6A 1YJWB 1VQ9B 2HMAA 1A8PA 1H8EA 3PUMA 1GO2A 5KSWB 2CW5A 3DDYA 3BCFA 2D9RA 1I18A 4RJLA 3ZZUA 2ZTGA 3ASSA 4DNRB 2VJIA 2X8KA 4RD0A 3AVTA 3VMFA 5IYQA 3PA2A 1QH0A 3BY2A 5F4OA 1XB2A 2DOGA 2EIXA 4PC2A 5FNZA 1I8DA 1QFJA 2GJRA 1HZEA 4MYUA 2ZZEA 1WOPA 3V7AA 1R5OA 1T6YA 2QGGA 2B7BA 2XNDA 4XLAA 4YALA 4OOVA 1BX1A 4NCNA 3JQQA 3MCAA 2BV3A 2QMUA 3U2QA 1OB5A 1GR1A 2F1LA 2DERA 2Q6KA 4UZFA 4Z4WA 2BPOA 1JB9A 4C43A 3U6KA 4P6YA 2GPJA 4M1KA 1VF7A 5HZBA 4KKTA 3CMAB 2GK6A 2YWGA 1BQEA 3G71B 2VZLA 5J3OA 1Q86D 1QUFA 4E0FA 1NB0A 2OBTA 4B3XA 4B47A 1K73D 5FO1A 4Z4SA 2DCUA 1EP2B 1N07A 3E20A 1F20A 4RD4A 4YHBA 1SM4A 3RY8A 4LBZA 3BCDA 4XORA 1N08A 2CNDA 1SKQA 2V7TA 3ASQA 4XOPA 3ASRA 1V5VA 2C77A 2V7WA 3CCQB 1VQPB 1ZM3A 4AF7A 1R5BA 1UD2A 4AC9A 3CD6B 3QFTA 5AN9A 3BC9A 3T53B 3MMPA 5B6IA 1KC8D 1UMKA 3T51B 4PC3A 1KD1D 1WOSA 1EXMA 1Y0RA 2PIAA 1KK1A 4PC6A 4DNTB 4CQJA 4DQKA 5LMZA 3WNDA 3FPPA 4HE5A 1AMOA 1TTTA 4B44A 2HLDA 3CPXA 1S4MA 1WOOA 2C2WA 4PC7A 4XR6A 3WBJA 1VQ6B 4P1VA 2X85A 5F4JA 4KKSA 5GV7A 5J35A 3I1FA 3G05A 4AVZA 4RPBA 4XOTA 4OPOA 2VNHA 1GJRA 2JIZA 3ISXA 5FL7A 1DDGA 2Z6BD 3SJZA 3CPWB 1NB9A 1XE1A 3Q6QA 3LNNA 1F60A 1Q81D 2LZJA 3W2FA 2JDIA 5IK2A 4X7FA 3H94A 1E63A 3VO1A 4N3GA 1J9ZA 4DQLA 1UD5A 3D26A 4P9SA 1EFCA 4OP7A 4Z4VA 1OGJA 1YLOA 1OHHA 1QVFB 4Y7CA 2D3NA 2XNCA 1D8TA 4UAJA 2ZXHA 3A35A 5H59A 3VNUA 4XLCA 3CCMB 1ZM2A 1PJ5A 1VJSA 3FPKA 3GIRA 1Y0YA 3WBKA 4OOSA 4UZEA 5DN6A 3CTAA 1IHMA 1NDHA 1W35A 3P27A 1YX2A 2VBSA 1RQRA 3FKSA 4P22A 4H9GA 2QDXA 1VQ8B 3OAAA 3PENA 4QV2A 3W2IA 3QE2A 3GVLA 1QGZA 4WZKA 5E6TA 1FNBA 1H42A 4XMYA 5CDFA 2XZLA 1PKVA 1ZUNB 4TN1A 1BPLA 1CQXA 4PC1A 1K9MD 1JJ2B 1W0KA 1T5EA 4L8JA 3SLNA 2QTLA 3H9NA 2B5OA 3A1PA 2CF4A 3B82A 5IYWA 1B23P 3OEHA 2R6HA 4X0CA 3MHPA 3QFSA 2C78A 4RLZA 4WZTA 4Z4ZA 2V7UA 2XNJA 3CCJB 2VNJA 2QA4B 4G1VA 1EFTA 1BLIA 3PUNA 1KRHA 3I56B 1FRQA 3ES9A 4RDJA 3WY9A 5HKKA 4OPSA 1K28D 3BH4A 3ZBTA 2Q6LA 2HDNB 1E1QA 2WR8A 1QX4A 2VNKA 4XLHA 3AVYA 1YJ9B 1VHOA 4TMVA 4YAUA 3WXMA 2I1LA 1RQPA 1V0FA 4TKOB 4X7EA 3WYAA 4ZGQB 4XN0A 5DSZA 5EMNA 2BVNA 4M0LA 3BQJA 2C4UA 1E64A 1EWYA 1IB0A 1Q9SA 1E3ZA 3A8JA 3CC2B 2YWHA 4YAOA 4PAAA 1WU8A 2X53S 3CCSB 2VBUA 2X3UA 3OKXA 2KVOA 3LQEA 3ZZTA 2WZNA 3JU4A 1N0VC 2W6IA 1WORA 2GJPA 3W5VA 3CC4B 2XZOA 1W9XA 1P4MA 1QGAA 4WQMA 4FXUA 2XEXA 4ZCLA 4P3YA 3CCEB 1OB2A 2E1BA 4XONA 2OK8A 3ZPNA 2QN6A 1I7PA 4WWVA 1UD3A 3NE5B 4YXWA 1UD6A 2X0KA 1KTVA 1YI2B 5L46A 1KK3A 2W6JA 4G6IA 1UD4A 4WZLA 4RCYA 2WSSA 4XKVA 2D74A 2QEXB 3KL9A 1OGIA 4PABA 5IYRA 1QFYA 3A3BA 1U2RA 2OYNA 3QFCA 4XKWA 3GSIA 5DS0A 4TMWA 4QFMA 3ZC3A 4ZV4A 2BGJA 1YJNB 1N8RD 1DARA 2PE3A 1S72B 2Q6IA 2DETA 2WPDA 1R5NA 2JJ1A
chains in the Genus database with same CATH topology
1VLYA 5DN6A 4II2A 3GQBA 1I8DA 4JMQA 2GJRA 3OPOA 1HZEA 1W0JA 2F43A 2ZZEA 2CK3A 4G7XA 4XLAA 2XNDA 4P22A 3OAAA 3OW7A 1WPCA 4XL9A 3GVLA 4B3FX 1HVXA 3OOCA 1H8HA 1E1RA 4XMYA 5CDFA 2XZLA 2ZZGA 1PKVA 1VF7A 2M5SA 1BPLA 2QE7A 3OE7A 4KKTA 4XNFA 2GK6A 1T5EA 1W0KA 4L8JA 1EFRA 4ASUA 1COWA 1WP6A 1E79A 2ZZQA 2WJVA 4E0FA 3OEHA 4XD7A 1UD8A 4G7WA 4XLEA 3OEEA 4B3GA 3WQZA 3CESA 4KKUA 4TSFA 4XN3A 3GVKA 1NRKA 4XM3A 1BLIA 1E43A 2GK7A 1KZLA 5HKKA 2ZZFA 3BCDA 4XLFA 2R9VA 3VR6A 4XORA 1K28D 3BH4A 2ZTNA 4XOPA 3ZIAA 1E1QA 1UD2A 4XLHA 2DIEA 3BC9A 2JJ2A 4HIZA 3T53B 2F1MA 3T51B 2V7QA 1V0FA 4TKOB 4XN0A 4DNTB 5KNLA 3FPPA 3GVJA 1E3ZA 1OB0A 2HLDA 2V31A 2XZPA 3T56B 4XR6A 1BMFA 4NNJA 4YELA 2X85A 4KKSA 3CP2A 3G05A 4YEJA 4AVZA 4XOTA 2X53S 2XOKA 2JIZA 3A3GA 2KVOA 5FL7A 2Z6BD 2XGJA 2V4DA 3JU4A 2W6IA 2X6WA 2GJPA 1KMHA 2XZOA 1W9XA 2ZXIA 4TT3A 2GJKA 4FXUA 1SKYB 3LNNA 1E3XA 3KEWA 1NBMA 2E1BA 4XONA 3ZPNA 2LZJA 3CMMA 2JDIA 5IK2A 1UD3A 3NE5B 3H94A 4YXWA 2VJJA 1UD6A 1V0EA 4DK1A 1UD5A 2WJYA 3CP8A 1WTHD 2W6JA 1OHHA 2X6XA 4GQNA 2WZPP 4G6IA 1UD4A 4DK0A 2D3LA 2WSSA 4II3A 4XKVA 3OFNA 2D3NA 4UZUA 2ZXHA 3A35A 1H8EA 4XQFA 3A3BA 3DDYA 3BCFA 1I18A 4XKWA 2X6YA 4XLCA 2ZTGA 4DNRB 1FX0A 4Z1MA 2VJIA 2X8KA 1MABA 2WPDA 3HAGA 3FKSA 1VJSA 2JJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7X A;  4G7W A; 
#chains in the Genus database with same CATH topology
 4K1X A;  2B7C A;  4II2 A;  3GQB A;  1M90 D;  2RC6 A;  1W0J A;  1ZM9 A;  1B2R A;  2ZL5 A;  4Z4U A;  2CK3 A;  4FWT A;  1QG0 A;  4J0Q A;  3CCU B;  4XL9 A;  3WNB A;  4ZCI A;  2ZL7 A;  3AST A;  4B3F X;  5A88 A;  2NV4 A;  4YAF A;  3QFR A;  3AGQ A;  3OOC A;  3LO8 A;  1H8H A;  1E1R A;  3OZU A;  1W2B B;  1VQK B;  1IJF A;  5FIU A;  3V76 A;  5IYN A;  1FND A;  1TLL A;  4EH1 A;  2QE7 A;  3JQR A;  3R6K A;  2OBR A;  3LVB A;  4XNF A;  3CCV B;  2DEU A;  1EFR A;  4ASU A;  3B78 A;  1E79 A;  4Z4R A;  1GAQ A;  4XD7 A;  1UD8 A;  4LBV A;  1VQN B;  4XLE A;  3OEE A;  1DG1 G;  2PLF A;  3ASP A;  3P26 A;  1QVG B;  4B3G A;  4ACB A;  2OTL B;  3PVD A;  4ZCM A;  1VQ4 B;  3CES A;  1VQ5 B;  4YAW A;  4QVA A;  3GVK A;  1NRK A;  4C0S A;  2GK7 A;  4OOX A;  3ZUG A;  3Q3A A;  2ZZF A;  2ZIT A;  3Q38 A;  3SEJ A;  3SJP A;  2R9V A;  1VHE A;  4RD2 A;  3VR6 A;  2BM1 A;  3ZIA A;  4RDL A;  2BN4 A;  4X7C A;  3W2E A;  1VQ7 B;  4M53 A;  1FNM A;  2DIE A;  4HIZ A;  2F1M A;  1FRN A;  3OW2 B;  2BMW A;  4X07 A;  3ZBU A;  2QTZ A;  3LQ6 A;  1G7T A;  3CCL B;  5KNL A;  1GAW A;  3QSY A;  5TRD A;  5FO0 A;  3OJW A;  3GVJ A;  3AVV A;  1HA3 A;  5H5J A;  1OB0 A;  2V31 A;  2VBT A;  4TMX A;  4B4D A;  4NNJ A;  3E1Y E;  3Q39 A;  3CRZ A;  4P6V F;  2CRV A;  3CP2 A;  3I55 B;  3A3G A;  4ACA A;  4Q7J B;  5KW9 A;  4M2L A;  3W2H A;  1T6X A;  5GV8 A;  4RDK A;  1XFO A;  2ZXI A;  5BSY A;  3CCR B;  2GJK A;  2Q6O A;  1QFZ A;  1SKY B;  4X06 A;  5F4M A;  1E3X A;  3KEW A;  1VQL B;  4ROX A;  1G7R A;  3CMM A;  1YIJ B;  4FK8 A;  2VJJ A;  3SKB A;  4IW3 B;  3J81 k;  2HCJ B;  2WJY A;  1N05 A;  3OJX A;  3CXC B;  2ZL6 A;  4MYT A;  2GQF A;  4B48 A;  2OBS A;  5HXB A;  4G5G A;  3AVX A;  4DK0 A;  2VYQ A;  2D3L A;  4P25 A;  3OFN A;  1PJ7 A;  4NBS A;  4UZU A;  1FNC A;  4AF6 A;  1KK2 A;  4P26 A;  4XQF A;  4Z4Y A;  4X8I A;  2X6Y A;  2J7K A;  4LC0 A;  4RD1 A;  1FX0 A;  1WDT A;  4LBW A;  4Z1M A;  3SLD A;  2BM0 A;  1EP3 B;  1MAB A;  3JQP A;  3HAG A;  1VLY A;  3BNW A;  1QUE A;  1DDI A;  3VO2 A;  1N06 A;  4WZE A;  4JMQ A;  1JA0 A;  2RC5 A;  1ZM4 A;  3OPO A;  3A8K A;  1K8A D;  2F43 A;  3AGP A;  4G7X A;  2YWF A;  4FN5 A;  3WNC A;  1CNF A;  3OW7 A;  1TVC A;  2CC2 A;  1IJE A;  1WPC A;  1BX0 A;  2BF4 A;  1D1N A;  4B43 A;  3CW2 A;  5BSX A;  4ZGN B;  1HVX A;  3FJO A;  2FVG A;  3CME B;  5TR9 A;  2OK7 A;  4PGO A;  1TUI A;  5A89 A;  3ONU A;  2C5B A;  2ZZG A;  4N3N A;  2JN9 A;  1YIT B;  4Y9U A;  2M5S A;  1E62 A;  3OE7 A;  1JA1 A;  4BPR A;  5IYP A;  4HE6 A;  1KJZ A;  2V7V A;  1VQM B;  1COW A;  1WP6 A;  2ZZQ A;  2F4N A;  2WJV A;  2P3M A;  1XQB A;  2YWE A;  4G7W A;  4Y9R A;  4G1B A;  4QHY A;  3R6J A;  4RPD A;  3WQZ A;  2C5H A;  1KK0 A;  2OTJ B;  2DYI A;  3B8H A;  1JNY A;  2NPF A;  1T6Z A;  3OZV A;  4KKU A;  3BY1 A;  4TSF A;  1QGY A;  4XN3 A;  4TMT A;  4XM3 A;  3ZZ0 A;  1E43 A;  3W5H A;  2ZBU A;  4TMZ A;  4F7D A;  1Q82 D;  1KZL A;  3A8I A;  2VNI A;  4XLF A;  1VQO B;  4OPV A;  2ZTN A;  5JBQ A;  3AVU A;  1PJ6 A;  1FDR A;  1D2E A;  3U6B A;  3G4S B;  2JJ2 A;  1NJI D;  1H85 A;  1N0U A;  1WSR A;  3CC7 B;  2V7Q A;  4P2N A;  2DY1 A;  2ZBV A;  2E1R A;  1AIP A;  4R71 A;  1BJK A;  1KQS B;  1Q7Y D;  3ONY A;  3W2G A;  5HZA A;  4QUZ A;  2PMD A;  2EFG A;  2XZP A;  3T56 B;  2GRE A;  1BMF A;  3PA1 A;  3G6E B;  4YEL A;  1VLO A;  3CB4 A;  3VNV A;  4YEJ A;  5TY0 A;  1MRZ A;  4X05 A;  4RD3 A;  5FA6 A;  2XOK A;  4P12 A;  3W5U A;  2V7X A;  4U9U A;  5THX A;  3AVW A;  2AHO A;  2XGJ A;  2V4D A;  4RCZ A;  2X6W A;  1EP1 B;  1G7S A;  1KMH A;  5TV2 A;  1CNE A;  4P3I A;  4TT3 A;  4Z4T A;  2BSA A;  4LBY A;  1M1K D;  1NBM A;  1W87 A;  1WSV A;  1EFU A;  2WYR A;  5A8A A;  2VBV A;  1S0U A;  4X7D A;  2BGI A;  1W34 A;  1G7C A;  2C4T A;  2FX3 A;  1V0E A;  4DK1 A;  1ELO A;  3OP1 A;  3CP8 A;  1WTH D;  3OZW A;  4QVJ A;  4RM0 A;  1GVH A;  2CBX A;  2X6X A;  4GQN A;  2WZP P;  1YHQ B;  4II3 A;  3Q6R A;  4M4S A;  4RD6 A;  1YJW B;  1VQ9 B;  2HMA A;  1A8P A;  1H8E A;  3PUM A;  1GO2 A;  5KSW B;  2CW5 A;  3DDY A;  3BCF A;  2D9R A;  1I18 A;  4RJL A;  3ZZU A;  2ZTG A;  3ASS A;  4DNR B;  2VJI A;  2X8K A;  4RD0 A;  3AVT A;  3VMF A;  5IYQ A;  3PA2 A;  1QH0 A;  3BY2 A;  5F4O A;  1XB2 A;  2DOG A;  2EIX A;  4PC2 A;  5FNZ A;  1I8D A;  1QFJ A;  2GJR A;  1HZE A;  4MYU A;  2ZZE A;  1WOP A;  3V7A A;  1R5O A;  1T6Y A;  2QGG A;  2B7B A;  2XND A;  4XLA A;  4YAL A;  4OOV A;  1BX1 A;  4NCN A;  3JQQ A;  3MCA A;  2BV3 A;  2QMU A;  3U2Q A;  1OB5 A;  1GR1 A;  2F1L A;  2DER A;  2Q6K A;  4UZF A;  4Z4W A;  2BPO A;  1JB9 A;  4C43 A;  3U6K A;  4P6Y A;  2GPJ A;  4M1K A;  1VF7 A;  5HZB A;  4KKT A;  3CMA B;  2GK6 A;  2YWG A;  1BQE A;  3G71 B;  2VZL A;  5J3O A;  1Q86 D;  1QUF A;  4E0F A;  1NB0 A;  2OBT A;  4B3X A;  4B47 A;  1K73 D;  5FO1 A;  4Z4S A;  2DCU A;  1EP2 B;  1N07 A;  3E20 A;  1F20 A;  4RD4 A;  4YHB A;  1SM4 A;  3RY8 A;  4LBZ A;  3BCD A;  4XOR A;  1N08 A;  2CND A;  1SKQ A;  2V7T A;  3ASQ A;  4XOP A;  3ASR A;  1V5V A;  2C77 A;  2V7W A;  3CCQ B;  1VQP B;  1ZM3 A;  4AF7 A;  1R5B A;  1UD2 A;  4AC9 A;  3CD6 B;  3QFT A;  5AN9 A;  3BC9 A;  3T53 B;  3MMP A;  5B6I A;  1KC8 D;  1UMK A;  3T51 B;  4PC3 A;  1KD1 D;  1WOS A;  1EXM A;  1Y0R A;  2PIA A;  1KK1 A;  4PC6 A;  4DNT B;  4CQJ A;  4DQK A;  5LMZ A;  3WND A;  3FPP A;  4HE5 A;  1AMO A;  1TTT A;  4B44 A;  2HLD A;  3CPX A;  1S4M A;  1WOO A;  2C2W A;  4PC7 A;  4XR6 A;  3WBJ A;  1VQ6 B;  4P1V A;  2X85 A;  5F4J A;  4KKS A;  5GV7 A;  5J35 A;  3I1F A;  3G05 A;  4AVZ A;  4RPB A;  4XOT A;  4OPO A;  2VNH A;  1GJR A;  2JIZ A;  3ISX A;  5FL7 A;  1DDG A;  2Z6B D;  3SJZ A;  3CPW B;  1NB9 A;  1XE1 A;  3Q6Q A;  3LNN A;  1F60 A;  1Q81 D;  2LZJ A;  3W2F A;  2JDI A;  5IK2 A;  4X7F A;  3H94 A;  1E63 A;  3VO1 A;  4N3G A;  1J9Z A;  4DQL A;  1UD5 A;  3D26 A;  4P9S A;  1EFC A;  4OP7 A;  4Z4V A;  1OGJ A;  1YLO A;  1OHH A;  1QVF B;  4Y7C A;  2D3N A;  2XNC A;  1D8T A;  4UAJ A;  2ZXH A;  3A35 A;  5H59 A;  3VNU A;  4XLC A;  3CCM B;  1ZM2 A;  1PJ5 A;  1VJS A;  3FPK A;  3GIR A;  1Y0Y A;  3WBK A;  4OOS A;  4UZE A;  5DN6 A;  3CTA A;  1IHM A;  1NDH A;  1W35 A;  3P27 A;  1YX2 A;  2VBS A;  1RQR A;  3FKS A;  4P22 A;  4H9G A;  2QDX A;  1VQ8 B;  3OAA A;  3PEN A;  4QV2 A;  3W2I A;  3QE2 A;  3GVL A;  1QGZ A;  4WZK A;  5E6T A;  1FNB A;  1H42 A;  4XMY A;  5CDF A;  2XZL A;  1PKV A;  1ZUN B;  4TN1 A;  1BPL A;  1CQX A;  4PC1 A;  1K9M D;  1JJ2 B;  1W0K A;  1T5E A;  4L8J A;  3SLN A;  2QTL A;  3H9N A;  2B5O A;  3A1P A;  2CF4 A;  3B82 A;  5IYW A;  1B23 P;  3OEH A;  2R6H A;  4X0C A;  3MHP A;  3QFS A;  2C78 A;  4RLZ A;  4WZT A;  4Z4Z A;  2V7U A;  2XNJ A;  3CCJ B;  2VNJ A;  2QA4 B;  4G1V A;  1EFT A;  1BLI A;  3PUN A;  1KRH A;  3I56 B;  1FRQ A;  3ES9 A;  4RDJ A;  3WY9 A;  5HKK A;  4OPS A;  1K28 D;  3BH4 A;  3ZBT A;  2Q6L A;  2HDN B;  1E1Q A;  2WR8 A;  1QX4 A;  2VNK A;  4XLH A;  3AVY A;  1YJ9 B;  1VHO A;  4TMV A;  4YAU A;  3WXM A;  2I1L A;  1RQP A;  1V0F A;  4TKO B;  4X7E A;  3WYA A;  4ZGQ B;  4XN0 A;  5DSZ A;  5EMN A;  2BVN A;  4M0L A;  3BQJ A;  2C4U A;  1E64 A;  1EWY A;  1IB0 A;  1Q9S A;  1E3Z A;  3A8J A;  3CC2 B;  2YWH A;  4YAO A;  4PAA A;  1WU8 A;  2X53 S;  3CCS B;  2VBU A;  2X3U A;  3OKX A;  2KVO A;  3LQE A;  3ZZT A;  2WZN A;  3JU4 A;  1N0V C;  2W6I A;  1WOR A;  2GJP A;  3W5V A;  3CC4 B;  2XZO A;  1W9X A;  1P4M A;  1QGA A;  4WQM A;  4FXU A;  2XEX A;  4ZCL A;  4P3Y A;  3CCE B;  1OB2 A;  2E1B A;  4XON A;  2OK8 A;  3ZPN A;  2QN6 A;  1I7P A;  4WWV A;  1UD3 A;  3NE5 B;  4YXW A;  1UD6 A;  2X0K A;  1KTV A;  1YI2 B;  5L46 A;  1KK3 A;  2W6J A;  4G6I A;  1UD4 A;  4WZL A;  4RCY A;  2WSS A;  4XKV A;  2D74 A;  2QEX B;  3KL9 A;  1OGI A;  4PAB A;  5IYR A;  1QFY A;  3A3B A;  1U2R A;  2OYN A;  3QFC A;  4XKW A;  3GSI A;  5DS0 A;  4TMW A;  4QFM A;  3ZC3 A;  4ZV4 A;  2BGJ A;  1YJN B;  1N8R D;  1DAR A;  2PE3 A;  1S72 B;  2Q6I A;  2DET A;  2WPD A;  1R5N A;  2JJ1 A; 
#chains in the Genus database with same CATH homology
 1VLY A;  5DN6 A;  4II2 A;  3GQB A;  1I8D A;  4JMQ A;  2GJR A;  3OPO A;  1HZE A;  1W0J A;  2F43 A;  2ZZE A;  2CK3 A;  4G7X A;  4XLA A;  2XND A;  4P22 A;  3OAA A;  3OW7 A;  1WPC A;  4XL9 A;  3GVL A;  4B3F X;  1HVX A;  3OOC A;  1H8H A;  1E1R A;  4XMY A;  5CDF A;  2XZL A;  2ZZG A;  1PKV A;  1VF7 A;  2M5S A;  1BPL A;  2QE7 A;  3OE7 A;  4KKT A;  4XNF A;  2GK6 A;  1T5E A;  1W0K A;  4L8J A;  1EFR A;  4ASU A;  1COW A;  1WP6 A;  1E79 A;  2ZZQ A;  2WJV A;  4E0F A;  3OEH A;  4XD7 A;  1UD8 A;  4G7W A;  4XLE A;  3OEE A;  4B3G A;  3WQZ A;  3CES A;  4KKU A;  4TSF A;  4XN3 A;  3GVK A;  1NRK A;  4XM3 A;  1BLI A;  1E43 A;  2GK7 A;  1KZL A;  5HKK A;  2ZZF A;  3BCD A;  4XLF A;  2R9V A;  3VR6 A;  4XOR A;  1K28 D;  3BH4 A;  2ZTN A;  4XOP A;  3ZIA A;  1E1Q A;  1UD2 A;  4XLH A;  2DIE A;  3BC9 A;  2JJ2 A;  4HIZ A;  3T53 B;  2F1M A;  3T51 B;  2V7Q A;  1V0F A;  4TKO B;  4XN0 A;  4DNT B;  5KNL A;  3FPP A;  3GVJ A;  1E3Z A;  1OB0 A;  2HLD A;  2V31 A;  2XZP A;  3T56 B;  4XR6 A;  1BMF A;  4NNJ A;  4YEL A;  2X85 A;  4KKS A;  3CP2 A;  3G05 A;  4YEJ A;  4AVZ A;  4XOT A;  2X53 S;  2XOK A;  2JIZ A;  3A3G A;  2KVO A;  5FL7 A;  2Z6B D;  2XGJ A;  2V4D A;  3JU4 A;  2W6I A;  2X6W A;  2GJP A;  1KMH A;  2XZO A;  1W9X A;  2ZXI A;  4TT3 A;  2GJK A;  4FXU A;  1SKY B;  3LNN A;  1E3X A;  3KEW A;  1NBM A;  2E1B A;  4XON A;  3ZPN A;  2LZJ A;  3CMM A;  2JDI A;  5IK2 A;  1UD3 A;  3NE5 B;  3H94 A;  4YXW A;  2VJJ A;  1UD6 A;  1V0E A;  4DK1 A;  1UD5 A;  2WJY A;  3CP8 A;  1WTH D;  2W6J A;  1OHH A;  2X6X A;  4GQN A;  2WZP P;  4G6I A;  1UD4 A;  4DK0 A;  2D3L A;  2WSS A;  4II3 A;  4XKV A;  3OFN A;  2D3N A;  4UZU A;  2ZXH A;  3A35 A;  1H8E A;  4XQF A;  3A3B A;  3DDY A;  3BCF A;  1I18 A;  4XKW A;  2X6Y A;  4XLC A;  2ZTG A;  4DNR B;  1FX0 A;  4Z1M A;  2VJI A;  2X8K A;  1MAB A;  2WPD A;  3HAG A;  3FKS A;  1VJS A;  2JJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...