1BX1A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
b'HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVQVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 97
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx1A02
3CRZA 1TUIA 4IW3B 2XNCA 1AIPA 1QGAA 1OGJA 1IB0A 4PC1A 1KJZA 2EFGA 3JQPA 1F60A 1Q81D 4F7DA 3I56B 4PC3A 1GO2A 4TMWA 1F20A 3CCVB 4TMXA 3W2GA 1WDTA 4B3XA 1D2EA 2B5OA 4ZCLA 1KD1D 1GAWA 1H42A 4MYUA 4LBZA 2YWFA 1CQXA 3E20A 3QE2A 1R5NA 4YALA 3WBKA 1HA3A 2PMDA 4M2LA 4ZGQB 1YHQB 4Y7CA 4B4DA 3OZWA 3QFCA 2QMUA 5DSZA 2DERA 1XB2A 1KRHA 3U6BA 2XEXA 1KK2A 1QUFA 3AVYA 1Q82D 3VO1A 1W34A 1JA0A 1I7PA 5KSWB 3AVWA 1VQ6B 3WNCA 2BF4A 2BPOA 2R6HA 1AMOA 3CCJB 1DDGA 1GAQA 2E1RA 2BGJA 1N0UA 2VNKA 3CCSB 2OTLB 1IJFA 1EP1B 1B23P 1YIJB 1KQSB 3MHPA 4TN1A 1OGIA 3W2FA 1R5OA 2AHOA 3ZZTA 3ZBUA 3CC4B 2D74A 1QUEA 2XNJA 3CB4A 5TV2A 1VQ8B 1EFUA 2VNIA 3W5HA 1EFCA 5H59A 4G1VA 4ACBA 4K1XA 1QGZA 3B78A 4Y9RA 4UAJA 4B48A 5AN9A 3P26A 3E1YE 2C78A 1FNMA 4AF6A 1IJEA 3LYUA 3OZVA 1W87A 2YWGA 4HE5A 3AVXA 1YI2B 2VNHA 1GVHA 3WNBA 3ZZ0A 1G7TA 1QFZA 1S0UA 3LRXA 1YJ9B 4B44A 2QEXB 1JA1A 1FDRA 1Q86D 2CRVA 4MYTA 4R71A 1W2BB 3FJOA 4G5GA 3QFTA 1U2RA 1NJID 4DQLA 5HXBA 1DARA 3VNVA 1ZUNB 2QA4B 3A1FA 3CMEB 1K9MD 2QDXA 4M4SA 1VQPB 1QVFB 3AGQA 1FRNA 3QSYA 4N3NA 5FA6A 4B43A 1BJKA 1D8TA 2DEUA 4RD2A 4RD6A 1G7RA 4G1BA 4U9UA 1SKQA 1KK1A 1CNFA 1XE1A 3LO8A 1VQMB 1VQKB 3JQRA 1R5BA 3B82A 3VO2A 4ZV4A 1DG1G 1EFTA 1ZM4A 1E63A 1KK3A 3G6EB 1EP3B 3OZUA 3AVTA 2HMAA 4NCNA 3CCLB 3G71B 2PIAA 2OK8A 2RC6A 3CMAB 4RCZA 3ES9A 3WYAA 1YITB 1GJRA 4RD1A 3LVBA 1ZM2A 4M53A 3WBJA 4FN5A 2GQFA 4RCYA 4B47A 2EIXA 1KK0A 1FNBA 2B7CA 1BQEA 1FRQA 4PC7A 1CNEA 3ZC3A 1K73D 1VQNB 2YWHA 5H5JA 1QGYA 2BGIA 1E64A 4YAWA 2BN4A 1TTTA 2PLFA 2VZLA 3CC2B 1GR1A 4YAUA 3VMFA 1EP2B 1E62A 4ZCMA 4QFMA 1DDIA 1A8PA 1K8AD 4M1KA 4LBVA 3I55B 3CCUB 5JBQA 4AC9A 3ZBTA 2BM0A 1KC8D 3OW2B 1M90D 2BVNA 2DY1A 2QTLA 1S72B 4NBSA 4FWTA 3JQQA 3VNUA 3QFRA 1JB9A 3W5VA 2NPFA 1NDHA 1G7CA 1ZM9A 5THXA 1BX1A 4RD4A 1FNDA 3CCQB 4TMTA 4M0LA 4DQKA 1ELOA 1FNCA 3G4SB 4LBWA 3CD6B 1UMKA 1N8RD 1N0VC 1JNYA 2BMWA 1YJNB 1Q7YD 2GPJA 3CCRB 4TMZA 4ZGNB 5GV7A 1VQLB 1W35A 4RD3A 2OTJB 2BSAA 2VYQA 4Y9UA 1VQ7B 1VQOB 2OK7A 3FPKA 4J0QA 1EXMA 2CNDA 2ZITA 3PENA 4YHBA 1TVCA 3W2EA 3I1FA 3W5UA 3MMPA 5EMNA 3W2HA 1M1KD 2FX3A 1D1NA 3WXMA 2BM1A 1G7SA 4BPRA 1OB5A 4WQMA 3U2QA 2QTZA 4ZCIA 2C77A 3CPWB 3CW2A 1VQ9B 5TY0A 1KTVA 3P27A 3CCEB 3WY9A 4RJLA 3MCAA 3WNDA 4YAFA 4C0SA 1JJ2B 2X3UA 3AVVA 3QFSA 1QH0A 4LC0A 4LBYA 4HE6A 1EWYA 4P3YA 4PC2A 3U6KA 4N3GA 3SJZA 4YAOA 1H85A 3AGPA 4Q7JB 4PGOA 3OJWA 4QHYA 5GV8A 3AVUA 1QX4A 1SM4A 1QFJA 4EH1A 1OB2A 3CC7B 3V76A 1J9ZA 2QN6A 1TLLA 1QVGB 1QFYA 4RD0A 5TR9A 2RC5A 2VNJA 1YJWB 1QG0A 2DETA 4FK8A 4ACAA 2J7KA 3OJXA 4H9GA 4C43A 1VQ5B 2HCJB 1VQ4B 3B8HA 3ZZUA 4TMVA 3J81k 4P6VF 2HDNB 2YWEA 4PC6A 4AF7A 3CXCB 2B7BA 1B2RA 3CCMB 1ZM3A 3W2IA 2BV3A 1BX0A 2DCUA
chains in the Genus database with same CATH superfamily
1NMEA 5EQDA 4BP3A 1P2BA 3OU6A 4EY6A 4QECA 5A0VA 4N49A 5JVDF 2YWCA 3V3KA 4TWRA 1ZVKA 1OGJA 3V1MA 2OXFA 2YXPX 2Q1WA 5AW0A 4TUYA 5JCJD 5M5BA 2YS7A 1QJ4A 3NEAA 4WN9A 2B92A 4P33A 2R8OA 1CW2B 1F60A 5TE9A 4MCJA 2AXNA 2WIJA 2FN3A 4R31A 4E3WA 1UK6A 1ZH2A 2ADMA 2GEUA 2GHRA 1PZNA 1Q7BA 2WBLC 4PGAA 4YYEA 3TZKA 5BV1A 2DT8A 4ENQA 1T9ZA 1J0XO 4EEZA 3KQMA 1WV1A 4JC8A 4WL0A 1GZVA 3AF2A 3STXA 4IXWA 4B3XA 1F0YA 4LMAA 4W5JA 2XH8A 4G2TA 1PZEA 3IA2A 2D2VA 3SOZA 3FNHA 3S8YA 2O8VA 2XBUA 5EEHA 3IUBA 5H8WA 4XWKA 4I1OA 3N2GB 4PSDA 3T9EA 3G8CA 3GVXA 2Q6TA 3NBMA 3HVIA 3UC9A 3ISVA 1ZCZA 4MVJH 5JXWA 3QU7A 5B6JA 3QHAA 4C0KA 1U8AA 3E61A 1GAJA 3LIPA 3F46A 4UM9D 5DIZA 1NVFA 2AXEA 1LQTA 2A1IA 3TFQA 2JD1A 1UC4B 4GMDA 3GP5A 3RS9A 3QVUA 2ZRDA 2YUIA 4WKCA 4Q7EA 5ALEA 3ORQA 5L46A 4XSVA 5K3FB 4BFSA 4AKHA 3DEAA 1QKIA 2QZJA 1G20E 2JIMA 3ONNA 4TUYF 4D8WA 3IJ5A 3UANA 1XB2A 4LJ8A 1TAGA 2QE7A 3ABZA 5FRDA 1K3FA 3AVYA 1U90A 4IGAA 3RC2A 2YH2A 1V35A 3FPPA 1K89A 2JJ1A 1ECLA 3BNWA 3D1LA 1JA9A 2FPIB 2YNMD 4LV5B 4HAYA 4MJLA 3IXMA 3X1KA 5JSKA 3HEBA 4NJMB 3L1VA 4Q93A 5K8UA 2FPXA 4BU0A 2OUIA 1GL7A 3SJBA 1XX6A 3H86A 3QUBA 4P80A 1BQ3A 3RU2A 1XJ5A 2AMFA 2P1RA 3TTXA 1BXRB 2A0UA 3AU8A 1C8KA 1UZLA 4I5DA 5GPBA 1AF7A 3L43A 2YIJA 1C1YA 1PJ8A 2E1RA 1T8PA 3P71T 4I19A 2UUAB 1N9GB 4M6WB 1Q20A 3FROA 4EQZA 5KQSA 1NX6A 3FWZA 4AG3A 4KPUB 3Q7PA 5HRAA 3RTGA 1U11A 3ADKA 1Y33E 2OTCA 2Y6VA 2H6EA 3QVVA 2CJYA 3DEHA 1CR4A 4PR3A 2HJRA 2YQ5A 1IDOA 1MAAA 2DG2A 2WU3A 5HF5A 3F7TA 2EJTA 1SCUA 3SGLA 2ZL6A 2AHOA 2X2EA 3WZLA 1EJ0A 2GNPA 4G5QA 4IQGA 2JN9A 1JHUA 4FXOA 3FIUA 1CS0B 2FMKA 1Y8RA 1YB1A 5D00A 1MHTA 5BOVA 5JWHA 3R3ZA 4FD2A 4K3VA 2YJ3A 4XCQA 3HSSA 3VR0A 4YRAA 1XZCA 3E2MA 1HOTA 1KMIY 1VZ3A 2P5SA 4HNUA 1NMXA 3Q8LA 4BGIA 2PAAA 1KVUA 4DRZA 3W3AA 3TTUA 2V4MA 1D4ZA 1DOHA 1KS2A 3ZV4A 2VK2A 3DE2X 3IBFA 3EBOA 4LDZA 3VH2A 4XVCA 3INNA 5HP4A 2ZYWX 4KR6A 3GO4A 3H19A 1QIMA 3C87A 3TIXB 2GSDA 4DBZA 3NV7A 1UPCA 3H1EA 4U63A 5FWYB 4IV0A 4S2UA 3W6PA 4DK1A 3B1XA 3C7DB 3DT8A 4A23A 4BNUA 4GVXA 5J4KA 1UZUA 5AN9A 1LNZA 1YA8A 1HLPA 2IU4A 2X6QA 1U6JA 1IHPA 2X85A 4FNAA 4BVBA 5BV8A 3PQ4A 4ASUA 2DGDA 2AZTA 1IUOA 1XJCA 1P7VA 1OKKA 3G0GA 4P93A 2PXHA 2DQKA 2GYYA 4C4PA 2AD1A 3KQWA 1ISIA 1X2EA 2FG5A 2FMIA 2PKRA 1QLHA 3I9LA 3JQ7B 3OQ6A 4JB3A 3T35A 4LY6A 3UJ9A 4EMUA 1A8UA 2HSZA 2P68A 4E15A 3PPXA 4PRKA 4L4UA 2VNHA 2EP8A 1DXOA 1VCNA 2L69A 3I42A 3ZJVA 5ICSA 2FE1A 4QQRA 2F1LA 2GWRA 4FC7A 1KP9A 3E8MA 3F3SA 3TAHA 4COKA 1JYSA 4MKZA 1Z47A 4WHMA 1YFZA 4LDRA 1N07A 3FDFA 3HB5X 3L4SO 1FVOA 5T67A 3V33A 6YASA 1HDRA 4WNIA 4JYZA 4R3UC 3AUKA 1YQEA 5KQMA 2YIVX 4G5YA 3N0XA 4MW1A 1H2ZA 1NI4A 3TEMA 4UQPA 1U5BB 1RYMA 3V1TC 5JHHB 2JK1A 4CM5A 2YNMC 1WOOA 3UJBA 1YJ8A 3HXMA 4B6RA 2WYUA 4R7TA 5LLSA 4J16C 1ID8A 1T4CB 1QQ5A 3II6X 3MPOA 1RKVA 1EAYA 4NBVA 4OUDB 4Q03A 4E5PA 2F67A 4PNZA 3S1LA 1BFKA 1TQ8A 4RK4A 5C9ZA 3SOPA 2PE3A 2DHRA 4HDMA 4QT0A 2B25A 4DG8A 2HOQA 4JN6B 5ITVA 3VAZA 4FHZA 3D3WB 1DMSA 1E2KA 4GPD1 2BJWA 4YX9A 3ZHTA 3N05A 4CLOA 3QLUC 1FS5A 2I7XA 3OIUA 4LW8A 4JP8A 4BLOA 3MAGA 4L9AA 5FPYA 3KR0A 3M9XA 2ZRKA 3OLZA 2I2WA 3IQXA 1ENOA 2O1EA 2AW3A 3L5OA 4RSRA 4KBGA 1FTYA 1RYHA 3M5WA 4H7KA 3FWNA 1WCIA 1W46A 3KS9A 1D8TA 2VOEA 4RD2A 4RD6A 1N5IA 2NUTA 4YT2A 4LFAB 4G5RA 1JHMA 1YRYE 3I9FA 2AOTA 3DAOA 4AZSA 3EZ9A 2ZDHA 3PNSA 4E2ZA 3ZBPA 3AKEA 3JARB 1YGPA 2BISA 4ZVRA 3F2VA 3CTAA 3UXMA 1KI2A 1U3TA 1Z0JA 4BKPA 4QA9A 3HRHA 1OXBB 4KSBA 4BX0A 2PJRA 5DWVA 1E32A 3GD7A 1Z0AA 4MS4B 5IM4A 2JJ2A 3O75A 1TJYA 3JVIA 4HDNA 5TMEA 3TE6A 2B4AA 2SKEA 4YCDA 4K2HA 2EJBA 1XA0A 1FL9A 5DNEA 2QR3A 3BFVA 3SEAA 1U31A 3PXAA 4RKQA 2E7ZA 1X8LA 3JQBC 3LQ4A 2HBQA 5EZ5A 2OZLB 1FVHA 3R24A 4MDYA 4JAVC 3WR5A 1M83A 5F3WB 2WE8A 1NB9A 1WMBA 2IHYA 1XXHA 2FZEA 3Q6NA 3NVAA 5DSXA 4BNNA 3G88A 1TZ2A 3TNYA 4QDTA 3RS7A 2Q50A 4RCZA 1WSBA 3X1WA 1Z2OX 3N07A 3CNEA 4NKRA 4UBLA 1NWCA 1W2GA 5JCPA 2QL5A 4HGPA 1GNVA 2I4LA 3AFIA 3QMVA 3T9AA 3F73A 2MU1A 3AERB 1GTG1 3WBJA 3A8IA 3LK7A 3EW9A 2Z83A 3E05A 1B0ZA 1TTPB 3B60A 4B47A 1V43A 3K1AB 3P0HA 4FMCF 4IDAA 2IUTA 3THOA 3WRVA 4IX9A 4ZMSA 5HRCA 1JKIA 3STYA 4COOA 3QE0A 4DGQA 4BQFA 4DWVA 4F4CA 1NW7A 2ZBQA 5I4IA 2B7CA 1BQEA 2NV0A 3AY0A 3BJMA 1NZFA 2XTJA 5IHXA 1F6WA 1GRRA 2H29A 1E7QA 3HO8A 3OHMA 4F2DA 4WBXC 1O94A 3PA6A 4YJHB 2NZUG 2RHRA 1N5LA 1SXIA 3RCBA 1VQ1A 1QGOA 4YAWA 3K9FC 5IM4F 1DCKA 4XXHA 2R0QC 3K0BA 5A7HA 2VI5A 3GVCA 3IP1A 3C48A 4ETWA 5GVSA 3PC8A 3SQXA 1ZM7A 4XJXA 5DHRA 1Z74A 4ESVA 1ZLYA 5EHZA 2PX8A 1IUKA 3BMCA 4CQMD 5AKIA 5G2OA 5GZ3A 1D4OA 2NU7B 2G7MC 4Q5IA 3VJMA 1IAQA 1N5OX 2VAMA 1AUVA 4IRMA 3R7WB 3SZOA 3C3MA 3CNQS 2WPDA 3ZWWA 2ZJ4A 1RWOA 4PV7A 3ICVA 3DAHA 4E46A 2A5LA 2AEMA 4ENVA 3FFAA 1DVRA 1XZFA 1KJIA 3TRKA 1JG3A 2ANBA 2RIRA 4XVUA 2QQGA 2ST1A 4HR7A 5EVCA 3ICEA 4J0HA 3OTHA 4R2HA 1QC5A 3FMIA 2AKAB 2JFWA 2B8TA 3QXSA 5CYOA 3FJYA 4HY3A 1UJ4A 3TL6A 2QR2A 2R3SA 5IDYA 2XT9A 1H2BA 5KVVA 2GBFA 1GPLA 4IOJA 1KF0A 3QLVA 3ZCSA 3OFKA 3U9TA 1G60A 2AR9A 4FT2A 2QI9F 4G84A 3WGVA 1I01A 3FYDA 1SHUX 2ZT8A 1PFWA 3K73O 1KZYC 4Y6SA 4RDCA 2CLSA 4WA7A 1V1MB 4JP3A 1CRWG 3HM9A 1QAMA 3AI1A 3WIDA 1ZM9A 4BGDA 1Y4SA 4OBEA 1VRVA 3KQPA 2PSHA 2LVBA 1SKMA 1BX1A 1X7YB 2LKDA 1ID1A 3DVAA 1DFIA 4F6RA 2PZEA 1SA0B 1GPJA 1XYYA 4CT4B 4N12A 3UBMA 4I50B 2WJ6A 2YMQA 3PT9A 2IOFA 4C08A 3ANYB 4DCSA 1TQHA 3RUAA 1U80A 2HMVA 4KQCA 4KDRA 2XE7A 3JQAB 3IB6A 4B87A 3QW4B 2AZ4A 5E4YA 3OOCA 2QW0X 1H4SA 2XGOA 3EISA 3HJCA 3OZTA 3U7EB 4BDSA 2QTRA 3GLIB 2IYXA 1NT2A 1IMOA 1RLUA 3BMNB 2NQ8A 3TR6A 2X0KA 1KS9A 2WM2A 3HWWA 3PRHA 5PNTA 3TPCA 4LBWA 2BKEA 4BV9A 4DZTA 3UCEA 1KFCB 4KAXA 4N5LA 1ZIDA 2OYSA 4UTOA 1ZRSA 5I7RA 1KI9A 2XQVA 3K70B 2OC9A 1GY8A 1LC0A 1WZUA 4X7FA 2V98A 1TA9A 2GKSA 3FOCA 3O4HA 6REQB 5L8VA 2BHLA 1X8KA 1G55A 1BDIA 1BEZA 1LW7A 3PQCA 4FLFA 3EIHA 1KDTA 1M2OA 2P4EA 2G88A 2O23A 1W25A 2WYWA 3RVKA 1XRSB 5B53A 2ZSEA 3H5IA 1MO3A 5CX1A 4RZ2A 2H65A 3FF1A 4RD3A 5FO1A 1KY4A 1RWQA 1WMSA 2ZYIA 4QUBA 3TDKA 2F1IA 1R1DA 5AXAA 2CFCA 2SECE 4YS6A 3OM8A 1OJLA 2GKGA 3K0AB 3LE8A 3PL1A 4JELA 4YJKA 5CRIA 4BB5A 4YLYA 3FDJA 1Z6XA 2D00A 2J0UA 3PJDA 2P9TA 4PYJA 1WXXA 3OZXA 4NV0A 3ENNA 4C4OA 1JIKA 1T6XA 4KACA 3ZNPA 1A69A 1QO0D 3VMMA 3VDRA 3G8DA 4LXQA 3GGSA 4F60A 4WADA 3TN7A 4KQKA 1P3JA 4ZAZA 1XQ6A 1Z2AA 2WTEA 5EMNA 3W2HA 3I9V1 2VP2A 4R83A 3GUHA 4UBMA 4Z51A 3WRWA 2NLOA 4BQRA 2GFIA 4OXKA 3UOAB 1EX7A 1QZUA 1XTVA 4MQ6A 2FN7A 2Q5CA 2WD7A 5J63A 1G7SA 2QROA 1COWA 5ALDA 4WH0A 1HRDA 4RF2A 3RGWS 1I18A 3NHAA 3F3KA 3KZKA 2QTZA 3QBEA 3V2HA 4EG1A 1O58A 4RGYA 1VI2A 4TYMA 2UZ1B 2ZSKA 1BMTA 3PUWA 4DNRB 3ETCA 2GJ9A 2G6TA 3KL9A 4HS9A 4KX5A 1SN7A 1ZICA 3L6UA 1Y1RA 3K0SA 1ODIA 3NT4A 1WKBA 1D03A 1V5WA 3TG2A 3NHMA 2ODTX 3O31A 1OFGA 3D7KA 2VSOA 1UBHS 4URZR 1K2WA 1L9XA 1VA4A 2PL3A 5TGZA 2NSJA 3FFXA 2ODEA 1SUPA 1ZL2A 1NURA 4NBWA 1RXYA 2OL4A 3UCXA 5IF9A 2GJ4A 2OAGA 2QVXX 1KHHA 1TJ3A 2WTNA 1Z63A 2Z2IA 3PVSA 3N2ZB 4PZYA 3UICA 1QDUA 4LC0A 2YMLA 4KKTA 1V9LA 4HE6A 1RFGE 2D3TA 5IM5A 1YA6A 3A9TA 4EKDA 3CWZA 4LMRA 3EC2A 3R7BA 4CIAA 5FAKA 2XTZA 3BCRA 4N3CA 4G97A 1ORRA 3IIEA 1YR6A 2PGJA 5EKDA 1AU9A 1BEEA 3NHWA 2Z1NA 3F1LA 3KBOA 5KAMA 2RGBA 1BDHA 3FPFA 2H4JA 1XDBA 2JI4A 1T9BA 4L2IB 1UDWA 4TTTS 2F3QA 1YKFA 1FQKA 1ZUWA 2NNWB 2VF8A 3FWYA 2QU7A 4WASA 1U5AA 2P78A 3Q87B 4G0NA 1I7LA 1W85A 1XG5A 3TRIA 4EF5A 2AQIA 2GR9A 5D3QA 5CPBA 3RJTA 3QUQA 4REOA 2XCSB 1UD3A 1MVLA 4DR4B 1EGMB 3EGCA 2ODNA 2DSTA 2KBFA 4KXMA 4N8SA 4P9SA 4QC2A 1M6WA 1ST2A 1OY1A 3DBLB 1NVKA 4J4TA 3EA0A 2A3NA 3N7UA 3OHPA 1N1GA 2DULA 2ZE6A 1WUYA 4LJLA 3T12A 2R8EA 5I9IA 3MXTA 1IN6A 1SZCA 1HDOA 2Y99A 3VYWA 2XUPA 5FFMA 4PQFA 2J7KA 3DQQA 1PJTA 2QG4A 4C43A 3F71A 3PQ8A 3LECA 2O7RA 4W7HA 5JSYA 2HUNA 3FRJA 3FYHA 2W6MA 4NDAA 1BOFA 3C6KA 1VRWA 3WLMA 4C29A 3GUVA 3O03A 2HMWA 4J76A 1X86B 2W6JD 2G5GX 3FZEA 3O90A 2KYRA 2VH5R 5LQMA 4RMGA 4L8FA 1O57A 2YZ2A 3T0GA 3E7XA 3WGMA 4OF4A 3RI3A 1UBOS 2H92A 1QE5A 2B61A 4MGEA 1U7XA 4NBUA 4MI9A 2QLLA 3BEOA 2I87A 4EG0A 4A27A 4EY4A 3ETLA 2NVUA 3PNMA 4CKCA 4NFLA 2NM0A 1XXHE 1XTJA 3IFSA 4K03A 2IOYA 1OX4B 3ESRA 1KDYA 2P9GA 2GVDC 3EZ6A 1DQPA 2GK4A 5KOIA 1E3QA 3MLAA 3E23A 2F1JA 1J49A 1W59A 3U7FB 1LF5A 3N6XA 4FEGA 3ZLVA 1TKAA 4C7OA 2EGUA 4PGGA 1CUUA 1LB1B 1QK4A 3Q5EA 3TSOA 1VG1A 3W4KA 5A1TA 4DUPA 5I7OA 4XDGA 4GP7A 3WYBA 1RHUA 3K6SB 4PSAA 1RC8A 1PEDA 3ROTA 1FA9A 2K2WA 1IN5A 1VHLA 4PHGA 2XW6A 3DZBA 3K94A 5JPIA 5IJ0A 2Y1XA 2OXIA 1FTSA 5SYAA 3GJ4A 4PC3A 1CE8B 5HCIA 1H1LA 2VJMB 5BUZA 1T4DA 1BKYA 4CZ2A 2DBZA 4BLPA 2GGSA 3BCHA 3KLMX 3CLHA 5E3JA 3L7CA 2O0JA 4ZCLA 1KD1D 1G9SA 4M98A 2ARKA 2PFSA 3G89A 1UT8A 1XEWY 1RJWA 2Q3EA 1DKPA 2ONZA 1PQPA 2YWFA 1PAUA 1T36A 1YC2A 2O7SA 3JCZA 4LMBA 1IULA 3VX3A 2JG3A 2AG0A 2VRNA 4QJ5A 5C52B 2VJQA 2AN4A 2P1ZA 3E20A 2EYQA 3BB1A 2JRLA 3IAHA 3NYQA 4HXEB 3WNVA 4CNBA 4W5NA 1KC1A 2GPWA 1CU1A 3NIWA 1DIAA 2NO1A 3BWBA 3ZK7A 2IGTA 5T8KA 2PMDA 3AF5A 2GCNA 1OWOA 4JBNA 3HP1A 4Y2QA 3W5IA 2O7NA 4Q48A 4C20A 2P9ZA 4LCEA 5EUCA 2CY0A 5DSZA 4C0LA 4DRXA 4W7SA 2ZJOA 3OF3A 1CQJB 3SF8B 1DJMA 1L4GA 1CYEA 5DRYA 1QUFA 3VR3A 3MLEA 2PFKA 1TW2A 3CR7A 3REQA 2ZZGA 2X9LA 3QTLA 5AW7A 2ZYGA 1WW8A 4OXIA 4ALNA 4MRSA 3AB7A 1T8TA 5K8JB 1A1SA 2ZB2A 1U7WA 1WPCA 2EBHX 4HVAA 4YPVA 5HOQA 4S05A 3T1NA 1U04A 5A1JA 4DQVA 4CODB 4E2YA 4EG7A 1HOXA 1XV5A 5LMZA 3EZGA 3UWPA 2CCGA 1EUYA 4EL5A 4BX2A 5KYYA 3VJRA 2J46A 3RC9A 1U7PA 4MGYR 2Q99A 1GU7A 3RAJA 4O2AB 3AFOA 2AE1A 3CRRA 2ZCUA 5KSYA 3W5AA 4R2KA 1S2DA 3L0OA 1Y80A 2CDRA 1G5IA 3CPJB 3HNPA 3I92A 5D3MB 1F2DA 4R0MA 3AJAA 1DQZA 2WTUA 2BH2A 3SZ3A 1VGQA 2ZUUA 2C9OA 2PSEA 4ZYVA 5CEEA 3SLDA 5BSWA 3OD1A 4PNHA 4WZKA 1MJHA 1UDBA 3GGJA 1O54A 3M7IA 3PD7A 4QNRA 1UJCA 3R2JA 4HK4A 1RXIA 2M32A 3B53X 2YBEA 3EMKA 3H5AA 3MCTA 1E1QA 1RHJA 3O1IC 4X1IA 1Q16A 3CLRC 3P9PA 2D3LA 2R5FA 1IFXA 2JAQA 2CFRA 1G21A 2FQWA 1E77A 4IZIA 3MXOA 4FHFA 4LXTA 1XTQA 3FRHA 5ICGA 2FWJA 1PI3A 4X8HA 4WE3A 1IL0A 3LBAA 4N7BA 3VKVA 2A9OA 1QGZA 2HYIC 2WTAA 3ESAA 4KQGA 3UV3A 1WKCA 1ZGHA 2QD2A 5CW2A 2I1LA 2H17A 2DBYA 1TDJA 5FQOA 3F4BA 2ZAOA 3VPCA 1UADA 5JRJA 3G8YA 2EWMA 1XK6A 2WYIA 4BC1A 3WGYA 4JGGA 4C06A 2GD0A 4CLEA 2D0DA 1XU7A 4EPTA 2I91A 3W1EA 3KTFA 4JLNA 3HGTA 4BVKA 1OI4A 2VDJA 1NXQA 1GUZA 1P7WA 3C1TA 3MBOA 3PDUA 3WYNA 1AOXA 2YRWA 2KJQA 3ZZ0A 1Y0BA 3N8HA 4FW8A 2G40A 4J6FA 3UMJA 3ZWYA 5B36A 3KJXA 5BSYA 5DYGA 1RWNA 1SQSA 4B44A 3GRAA 5K3SA 1DAEA 1F14A 1Q86D 1Q12A 1WLSA 1YR3A 4RPJA 4PYOA 4DCGA 5BSFA 3PNQA 1HKUA 4C88A 2P5UA 2F59A 1MHPA 2ZETA 3E9MA 1AMUA 5HXBA 3PNPA 2P2NA 3B48A 4OHKA 4UEJA 4UM9B 1V4NA 5DM2A 4WFJA 5TMPA 4GDFA 2VQDA 2VQSA 1CR1A 1MTOA 1FDTA 4EVSA 1CULC 3GLRA 1HVXA 3FPAA 1BMFA 1NVWQ 1ZEJA 2J85A 4O5AA 1G8AA 3Q3VA 1UBUS 1Y9EA 3GUZA 2IX9A 4EITA 1XU9A 4PX9A 5B37A 1E99A 1Q9SA 1HDXA 1H94A 3EX7C 5LR6A 4XR4A 1N2XA 4HLQB 3QSYA 3ID6C 1SBQA 4N3NA 1CSEE 2B34A 2BGNA 5AQ1A 4KE7A 1NNLA 3KUUA 1JKMA 4FDUA 3TX6A 1JJFA 1ONSA 4O02B 3UWMA 4F2HA 3GW8A 3EODA 3NIFB 1JDSA 3QEMA 2CXXA 1JVNA 3T7RA 2H4WA 3L7BA 4EKIA 4UVIA 4DM4A 3TAUA 3RLIA 1M6NA 1VSQA 1SRRA 2WE7A 5HFNA 1OE0A 1FJXA 4G1EB 4AY6A 3W9BA 3BT7A 2Y67A 4RMNA 5I9NA 3RAEC 2LZ0A 2C3YA 4R7GA 2P8JA 4ARBA 1B3RA 3IVGA 1W1UA 2FUG6 3ILVA 1NY5A 1V25A 4OJNA 4ZODA 2CHUA 3ZU6A 2J3QA 3FYSA 3H5RA 4JQOA 1A97A 2NO6A 2IW1A 2ACEA 1X7WA 3DB2A 5AVQA 5DK4A 1G4HA 2IBSA 2Q4EA 3PDJA 2C4MA 3KEQA 1UOPA 1SVIA 2QTFA 1X2BA 5AXCA 4O8ZA 1IYZA 3OLVA 4UMEA 5KQGA 1PR4A 2IF2A 3OCWA 1QONA 2CMHA 2DWUA 1TL7C 4JS0A 4S04A 2I80A 1E2FA 1ORDA 3LM8A 4Q3OA 3TW6A 5AVZA 1S9HA 1MP0A 1LS1A 3CEMA 4G01B 3ZNNA 4NMXB 3AB8A 2JI8A 3R3WA 4MUKA 2C83A 1WULS 2JL1A 1ZI8A 3FUWA 3YASA 4L8YA 4V0SA 1NYQA 3MD9A 4M8NE 1N36B 2HD4A 2Z08A 5TARA 4AJLA 2Z8YA 3GEEA 1JSRA 1U0NA 3O1JC 4MV6A 3ZC3A 5F35A 4D3YA 3B6IA 4YR7A 2RI1A 1AE1A 4YJGB 4RDIA 1KP2A 3W8NA 1ZK0A 1TUBB 5INTA 3GGDA 2VRCA 2ECPA 5EP4A 3O82A 1KOGA 4YRIA 3HA5A 4BECA 2I4NA 3TJRA 4FGZA 2CJFA 2DTDA 4AO6A 3FYTA 1GUDA 1TA4A 1O03A 3OCJA 4PPYA 4RSGA 2OESA 1SXJA 4A8PA 4FMPA 3NAQA 5FYQA 4EYEA 1VE5A 2ALJA 4HB2A 1ML3A 1NXSA 1BYIA 4LV6A 1J0BA 4ZCMA 3TTYA 5LUAA 1MPTA 1U2EA 5IRCD 2JLZA 4TYYA 4DMLA 1DDIA 1RVDA 1OI7A 1GP2A 3MGCA 4WCFA 3UA3A 5BNIA 3A9VA 5G4KA 5BUSA 3ISJA 5ADVA 2IYRA 2WY2D 1V2GA 1PHRA 2NACA 4LXHA 1LX7A 2ONJA 3IQZA 1U9YA 3I55B 2EOAA 4Q0MA 5B7QA 2GAIA 5GONA 1BCSB 2XF2A 1FW6A 3OP4A 2IBMA 1SQGA 1QOZA 2ZSFA 1GPYA 3GAAA 4G23A 3ZG6A 1JFLA 2AOUA 2CL7X 3WSVA 3HSKA 3VHRA 2WIAA 1U3FA 5A4DA 5KYXB 3SQWA 3IH5A 1N2HA 4PSCA 4G6IA 3TQSA 4O63O 5BWBA 3TLAA 1V8FA 5CAEB 2OFPA 5GM1A 1KAGA 4M8IA 1U2ZA 4F96A 1LU9A 1A2QA 2ESRA 3O21A 4RY8A 5DX0A 3NOOA 2J41A 3KAKA 2UZIR 4L73A 3EXEB 2I67A 2QZ9A 2YOFA 1F2UA 1R6TA 1QV6A 5LA6B 4D96A 4MO9A 3CX7A 3N0WA 5DI9A 1E4EB 3TFWA 4RTPA 4D4IA 2XOEA 2ZYHA 4M76B 2JFNA 1K1EA 1NUAA 1WF3A 1GEGA 3BD6A 4OQPA 2O59A 1NVUQ 4G6ZA 3RUPA 2HK6A 3V48A 3A1UA 3Q2KA 4JOQA 4OOFA 4YCJA 1H05A 2DX7A 1PW7A 1UC9A 1XU4A 3HBJA 3OOWA 3MMZA 3R3JA 4XGRA 4BKMA 4C1BA 4BLWA 3PTAA 5IUJC 1XDWA 1KVTA 1V8ZA 3GLTA 1CWUA 2J5QA 2PGNA 4LWOA 1Y7PA 3S2UA 5ILQA 2VTBA 1GLVA 4WZAB 3HG7A 4M8LA 1HQDA 2RK4A 5E6RB 5GONF 3RFCA 1E1RA 3MFQA 4I8IA 3T3NA 1YBVA 2YWRA 3GVPA 1NRIA 4G9GA 3GLFE 5C35A 3V42A 1O9BA 4HGRA 2Q4RA 4BNMA 3CINA 3IAS6 4CGYA 2QL7A 3I5XA 1W0KD 1U2SA 3A3NA 1PEYA 2G4CA 3JYQA 1ZJYA 4N82A 5P21A 3EUAA 3X1XA 5BSRA 3RK1A 2XTAA 2BSAA 1EBFA 1G5TA 1HEIA 4Z54A 5LLTA 2VP5A 3BIXA 2XODA 4S0XA 3G0OA 4OO3A 2PRKA 3ED1A 3EQ7A 5ADHA 1JFFB 4BRUA 3JQEA 4J0FA 4YECA 1G21E 1U2PA 3O73A 2W2KB 3VPGA 2ATIA 1QWSA 1XA3A 3USES 2CMDA 3H5VA 4H4DA 1WXGA 2X1VA 1Z4OA 3BQJA 3MJEA 4YDSA 3PUNA 1N3IA 2GTIA 5A9SB 1M1NB 1MJGM 1MV5A 2OWEA 4X0EA 1DIGA 4ZEWA 3MRVA 3N59A 4ZDIA 2GSWA 4FFBB 1FE8A 1PR1A 1GU0A 5AM2A 5EIAA 1ARZA 1AKWA 3P0FA 3TX2A 4IYRA 3SXUB 4DW8A 3F6RA 1SZDA 2WJIA 4H7JA 3QLJA 3J7TA 2V59A 3O0TA 1M1XB 1AK1A 4H1TA 5ALSA 4CQMB 5KPDA 4XQCA 5AVTA 3ETNA 1JQAA 3ZV6A 1XMIA 2WB4A 1C0PA 1LTQA 3RG8A 4QG7A 3ICQB 1J0CA 3ANSA 9GPBA 4I6JA 2HSJA 4YJFA 5CIQA 5DLQC 3DCYA 3G05A 1XRRA 4J4BA 2VDVE 4F06A 1WSRA 3T41A 1Z83A 3QUSA 4GBED 2ZJ1A 3BCUA 5DYIA 2IVZA 3RC3A 4BNJA 2IUEA 4KODA 3AUXA 3MWLA 2G8NA 5DM4A 2C3OA 3HAGA 2OYNA 1A50B 5MF6A 4GR4A 2IPMA 4FFNA 2XVMA 2C99A 3QX9A 1YC5A 1E7WA 4ITRC 4UFNA 1NTOA 3HCNA 1C3LA 4HZUA 4MIOA 4QNMA 3AF4A 3PXBA 4IDEA 4JROA 2IXEA 3L6CA 5KJFA 4KOAA 4M7WA 1OFIA 1NW8A 1XL1A 2VJOA 2LP4Y 3D7NA 4Q00A 5CM9C 3U6KA 1NLYA 1ZIOA 4N3GA 1RHMA 2QTAA 4NLLA 5ARBA 1L4YA 1SBCA 4OA8A 4QLAA 1S7CA 4FYPA 1JPVA 1LTHR 1JE0A 1KJNA 4A73A 3U7HB 3QFFA 3OJWA 2O2IA 3D0RA 3JYOA 5GV8A 3VO9A 5G0TA 2XE6A 2V96A 5K3DA 4D9MA 1FS6A 4H4CA 4C01A 3V8EA 4D9CA 3RVOA 1RXSA 4FE3A 2IHZA 4MDFA 2FJ0A 2FDRA 1IDN1 2W8BB 4M9ZA 1VLYA 3KVYA 2O7VA 1IPFA 4LCBA 2A0KA 4WBSA 2Z2JA 4PICA 1YMQA 2PZGA 1GZSA 3TAXA 1PR5A 1YVUA 4I3FA 3T9DA 3VHQA 3D8TA 4RF3A 2NAFA 1QFYA 5ULLA 3UKJA 5JXIA 2CL0X 4KXVA 1RKQA 1BVUA 1MKYA 1DEHA 1TCAA 1DRKA 1WV0A 4B3SB 2XWQA 1VIMA 2R11A 1WCXA 4MR7B 1OIWA 1C7IA 4YEJA 1ZHFA 2BFMA 4UD2A 5DXJA 4DSTA 1E1MA 1JPUA 3JWIA 5L45A 2WAAA 1SOWA 4FKZA 4QGBA 1Z5UA 3RS4A 4ERXA 1A9PA 3ESQA 5JASA 1A8HA 2DBRA 2ZBDA 5DHQA 3FNFA 2WK1A 3B7PA 2QX7A 5FFFA 2Q7XA 3RHTA 4BP1A 4TX1A 5EJ8A 2PV7A 1PJRA 3DZKA 1DCTA 2BUCA 4RW0A 4GMXA 4MHTA 4PFJA 4G0VA 5BUCA 3GMIA 5CYGA 1XZGA 3NNSA 1A2BA 3K09C 3PYLA 3H1GA 2REQB 3ZD6A 1OXSC 2Z6UA 5DTJA 3FGZA 2CK3A 3K5IA 1OLUA 3DW1X 4JITA 4TTIA 2GM5A 5K3BA 2O3TA 2PRJA 3X43A 5M2QA 1Z34A 3PNLA 3NTRA 1Q1BA 3TM4A 1MC5A 1ENYA 3KOXA 5EHQA 1GTZA 4RIHA 1C50A 3CH5A 4L4ZA 4YAJA 3A25A 3W04A 4QARA 1PT8A 5DW3A 2YDYA 1ECJA 1AIPA 1D0IA 1KMHB 2AG8A 2F8LA 1J5XA 1LVGA 1VJ0A 3H7IA 4YLGA 1U8YA 3AZQA 1I4WA 4ZMBA 4RELA 3NHBA 1NVXQ 3VNRA 2RAVA 4E1BA 4IJ6A 1YF3A 1Z8DA 1R18A 3M6WA 1FC0A 2QLMA 4WOJA 1Q7CA 1RWVA 2ZUDA 1UFKA 2B4RO 3T3IA 2CW5A 2H8KA 2FWAA 4QDZA 2XJ4A 2I03A 3QKSB 4MR8B 3RVPA 3KL4A 1OAKA 2I4MA 5KQLA 4FP9A 4JC4A 5I9MA 2WIKA 4P7JA 1HE4A 3T9FA 3OX4A 4KMOA 4BMVA 4PIVA 1D2EA 2H31A 1J1IA 1SXJE 5AJXA 5C8YB 1XNGA 3K0KA 1CVLA 2R5NA 3O83A 4BZWA 1JSZA 2ZB7A 1V6CA 3C97A 3KKZA 2EFDB 4LBZA 5AOBA 5FBLB 2PNJA 3ZV7A 5BW5A 1P81A 2G72A 2X8JA 5KVCA 3BHIA 3ETGA 3INTA 1DINA 1KAQA 3JWGA 4XIYA 3S8MA 2WJ3A 3C3AA 5A9RA 4NY1A 1GDTA 5J47A 1FUUA 3IX7A 1KO5A 2Q4OA 1JU3A 1E1NA 1GDHA 2IYNA 2JFYA 1C7RA 1OFUX 3UMYA 4TQGA 3RVSA 4PR0A 5KNCH 4KKUA 1SD5A 3MELA 5HJ7A 4ZEMA 2V55B 5IVKA 3RYCA 3MJVA 2JAOA 3D4LA 1SVMA 1PS9A 4E0FA 2QXUA 4K9MA 4BFVA 1NNUA 4Y7CA 1U8UA 2UAGA 4R2JA 4HCJA 3SFTA 1ETHA 2QMUA 3FW1A 3TQFA 3WDLA 4I6GA 2AF3C 1MG0A 3I39X 5E1OA 2JBAB 4DB2A 5HQJA 3ZDZB 1Y8AA 4MGHA 4YRRA 2G4VA 5E8JA 4ZI5A 3S99A 3WRXA 4O4HA 1J0DA 2CEKA 2I2DA 4W82A 4YC7A 4JKIA 1KH1A 4DCTA 3I2FA 4ZHSA 1F17A 1KXJA 1I6LA 4L8VA 5CK4A 2OMEA 5I9LA 3CV3A 1VOTA 4F9EA 4OJKA 2O8EB 2RB4A 2RHWA 4D57A 5KMGA 3LBFA 3BL6A 4OB7A 4C5BA 1E3JA 4CN9A 1X0XA 3WISA 3VU9A 5C1BA 1S6YA 3RT1A 3SX2A 3DOHA 1NAIA 4OXQA 3EXHA 2NYAA 4D9KA 1T35A 5BQ3A 3ZHYA 1S2NA 2HA5A 1QF6A 3G5LA 4G9BA 4TKMA 5HM8A 1B1AA 1YIJB 2BWJA 5AUNB 5EXPA 3H8SA 3OF2A 3B85A 5DM60 4XLLA 3CSSA 2J59A 5LU8A 4TM7A 3ITDA 4RLSA 5B5SA 1KMMA 1J22A 4C3OB 5FI0B 5FJIA 4NQZA 2WWYA 3E70C 2PXCA 1ZJ5A 4YAKA 3NRCA 2V5UA 2EWWA 3DDOA 1G42A 1FFEA 1QUEA 1JPNA 1K4YA 1P7PA 1ST3A 2OZKA 3C70A 5DOZA 2WSMA 5AUQA 1IRXA 2GNOA 2ZRLA 1YUMA 3P97A 3PEFA 4AD8A 4BRSA 4C87A 2QE6A 3M4JA 5DCWA 5H59A 1DNPA 3OOEA 2O50A 4MA5A 4TTRA 3VYUB 3WMRA 4OGFA 4EGFA 1KMQA 4K6MA 4RY0A 1VGVA 2LCFA 4URYR 2I3ZA 4AS1A 1E7MA 1OZGA 4B7ZA 4JVLA 4OOVA 4O4HF 3JQFC 1WZCA 2PD3A 2FG6C 2JIDA 1FP1D 2FHPA 2W2XA 1TF2A 2R1UA 4UE2A 2GYUA 1RAGA 2PZKA 2R6GA 4GI7A 4OL9A 3VSEA 1I3CA 4CV2A 4PYQA 5DHFA 4AROA 1PT7A 3AG5A 4BVEA 1DAMA 1DHRA 4EEKA 3BMOB 1G3RA 3NHLA 2ZPAA 3F9IA 3P26A 4PZEA 3QX7A 1VKZA 2JFQA 3W2TA 2BGMA 1MX9A 3HGMA 5BWNA 2WNSA 1CQWA 1RAEA 1J8VA 4C7BA 2GI4A 3PDIB 3N28A 5B3AA 1V5FA 4HE5A 4NU0A 4XYMA 4I2NA 4M0KA 1IY8A 4A8JC 5EKTA 4LYFA 1YI2B 2OO5A 3KEWA 1JT2A 4TZTA 1XHLA 5J23A 2ZUTA 3OQVA 5JAUA 2IZZA 3N5KA 1TZMA 1B73A 2HPHA 1JI3A 4HWOA 4XGIA 2IXAA 1RQNA 2G9QA 3FKJA 1KI1A 2FY8A 4HUQB 4EJSB 5BV0A 2VK8A 5FV7A 2RKBA 1DBRA 4B80A 1P7ZA 4E94A 1MAWA 5EN4A 5LCXA 2DPXA 4QQKA 1UXHA 5AM1A 2NOAA 2A9PA 2CFSA 2H2IA 2Q3BA 3CSDA 4GM1A 4HKTA 4WI1A 3RS3A 5CFMA 3ABOB 1DARA 2WVAA 4A6DA 5KYTA 5A5DA 2JBHA 3A2LA 1EAMA 4MVJG 4HWKA 4RFSA 3CMEB 2RONA 1VC2A 3K05A 4HVTA 2QDXA 1EP9A 2QRLA 3KHSA 1V0EA 1ZH4A 821PA 4FILA 1UBKS 4HN4B 4O4IB 5E2IA 4ZXPA 5JYEA 5B58C 1YQGA 2OPBA 3NTVA 4PHTA 1BG6A 1XRLA 1B74A 4AULA 4AG6A 3AILA 4AO8A 3H9GA 5CCXA 3U56A 5GVRA 4B3DA 1CUVA 2P6NA 2YJNA 4MUXA 1GNLA 1Z6ZA 4ZO4A 5J1TB 2WINI 3L1JA 2DTXA 3LDHA 1GSIA 2A5DA 4MZXA 4YELA 1CUSA 5J2TB 3E3MA 2WYRA 3HBLA 1POWA 3H1FA 1JYEA 2ZIUB 7ADHA 1CXZA 1EUCB 4HWSA 5D7BA 3V1UA 4XPZA 1VQMB 4EM6A 2JIZD 1HWYA 2GF2A 3LTEA 4Z4FA 2B94A 2GYVA 1LI5A 3SR0A 3UT5A 5ENZA 4D9BA 2UUCB 1QOPB 3I53A 4PAMA 2H07A 1YJQA 1JJIA 1FQJA 1IZ9A 3EN0A 3IAEA 2W2LA 3LCUA 3SBDA 3T7EA 2GJKA 5GQSA 2P3SA 5G1NA 4Z4IA 2PMFA 2GCPA 1RYZA 3UW3A 4XR6A 3PE3A 3O9VA 3D8NA 1M67A 4QEZA 1HV8A 2IYQA 721PA 1AUOA 1NVBA 2NUAB 4EJ0A 1DO0A 3KT8A 3Q3AA 2A9JA 1U1FA 1OC2A 3K0CC 2EBFX 1P4RA 3ZX4A 4QM7A 4EDFA 3CMAB 2FV8A 3S81A 1DAPA 3O3NB 3PFWO 4O0MA 2J0EA 1V5GA 1GJRA 3HWRA 1E9RA 2BZGA 2ZI3A 3X2EA 3P9XA 5A62A 5KWJA 3S40A 4IKOA 3MWEB 2BFWA 1FP2A 4LS3A 3RRYA 5DBHX 3L05A 4N0EA 2VQFB 5BQ5A 4EFKA 2EIXA 2Z9BA 3KUKA 3DFMA 2VVTA 4RWEA 2AD5A 4HOYA 1UD8A 1MN6A 4XLZA 1O0BA 4C5AA 4WOKA 5CK5A 3ACCA 5KU1A 3NBAA 5CVEA 4O2BB 3UKOA 3ZJTA 1NF2A 5H5JA 1T5HX 1O95A 3VZPA 3IODA 1RC0A 1QGYA 2QN3A 2BKUA 2WIBA 3KPYA 2VT2A 1W8IA 4NTZA 1PT6A 4QDUA 4Z0NA 5FNZA 1ZSYA 3VPDA 5K3OA 3C0KA 1YJCA 2ENWA 3N58A 5LWHA 2LIVA 2QTHA 3ND6A 1TAQA 1V6SA 1ZOSA 5IKPA 3I05A 2PLFA 2B2CA 3KJNA 1L1RA 1IOZA 2FSVA 3NOVA 5EIEA 3TB4A 3T7DA 1CQIA 5B1HA 5IKEA 2SNIE 1N32B 4MQLA 4PTZA 3CISA 2K2QB 3NCHA 1JDZA 3OKFA 4MQMA 1WOPA 4UNNA 2XV1A 5CD9A 5HF8A 5L4LA 2XB2A 3CRNA 4G9EA 1CF9A 4XKVA 1UMBA 2C8KA 2V9ZA 4HB3A 3WC4A 3CE6A 5JAPA 1VXOA 1O7JA 3NLLA 4X71A 2ZVQX 4C76A 3PC3A 2J3KA 3NJ4A 1KC8D 3CW9A 1M90D 4M36A 2QVCA 1XAJA 4BATA 2Q4BA 1ZK3A 4NU8X 4JWTA 4ZWNA 5BOSA 4CF4A 1LC3A 2A35A 3A31A 3GV0A 4XYGA 4BX8A 4RHYA 3TLZA 2A88A 5H9WA 4CMCA 3DR5A 1RXVA 3C3YA 4REQB 3UXEA 5B6PA 5FEUA 1UWVA 4TRNA 2IEZA 3ANXA 2WV7A 4RLZA 3ZWCA 1IXYA 4XB1A 1ZYUA 3HK2A 3R9KA 5AP9A 3BORA 1WXEA 1G7CA 3K9CA 2O7QA 3MYYA 3ASVA 3UAOA 3SLKA 4CTOA 1KSHA 3AUAA 5JO0A 2C2BA 3SC4A 4D99A 2YHAA 3N6RA 3BC1A 4BCBA 1R4AA 3B12A 3E22A 4NMMA 1IPEA 1U9ZA 1YZ3A 2Q9CA 2RAPA 3MTDA 3QPDA 4ZO6A 4ZAGA 3AZPA 1QS0A 3ADOA 3OFNA 1WM1A 5EJ9A 3D3KA 5FLYA 2WEKA 2D2FA 1RZRD 2WFLA 1UBTS 4XWGA 4YBRA 4M1ZA 3WQHA 4EVQA 2VP0A 4LJ4A 4IJQA 1UMKA 4L3WA 3HU2A 5L51A 1HLGA 4F7WA 1QH1A 2QQEA 2FB9A 4KH0A 3ZGXA 1Q7YD 2ZZKA 3CE9A 5EYPA 2WDPA 2GZMA 2IYLD 1D5WA 3D9QX 3G9XA 2VYNA 1Y6RA 3I30X 2WAMA 1WB5A 3JASB 3AI3A 4QTUB 5LQAA 2V97A 1S8NA 4MDEA 2HU8A 3ZDEA 3OWOA 3KZ1E 3SQNA 4PLCA 5LOVA 4BFYA 1Q7RA 4Y6OA 3AMVA 4CLDA 2CJXA 4YFYA 1YZYA 3QU2A 4DMUB 3IQFA 2X7XA 3AOEA 1TEZA 3E48A 5GZ6A 3JYHA 3Q3JB 5T5QA 1LLCA 2ZDQA 3V8QA 3GK3A 5GMOA 3WAGA 1DQNA 3OZIA 4GYYA 3RSGA 5FDFA 1OYYA 4QPPA 1U02A 1UBFA 2XDYA 2C92A 5TPZA 4P5PA 4J07A 1P2VA 3MMXA 3H3FA 4XFKA 3GRFA 4YCBA 1A77A 1O5IA 1NUTA 1G20B 3CPEA 4FBMA 2P35A 2B1QA 1QCCA 2VQ3A 4HEQA 1U0FA 1V2HE 4BGVA 2FETA 2Q21A 2V45A 4NECA 3VUFA 4G0XA 4NOJA 3NAMA 2V8OA 3I1YA 4LX8A 5BMVB 3RC8A 4HT3B 4C4TA 3PQ5A 3G0IA 4DDUA 1NOKA 3A6ZA 3BGOS 1G8JA 3NWPA 5ALRA 1ZJZA 1U3DA 4O3MA 1AGPA 1RADA 3M1YA 1ZR4A 5D1HA 5KJ1A 4YO7A 2RFLA 4B40A 4F71A 3RS5A 5KNDH 4QGGA 1SBTA 2JI9A 1LPAB 1TUEA 1MB3A 4YRNA 3H1TA 3HNOA 5CA0A 1G8YA 3EJ6A 4L57A 4I4CA 3PC4A 5IUKC 2Y2VA 3IP3A 1XEWX 3AM4A 3GC6A 2BF7A 5I4KA 2O8FB 4YQEA 3G2MA 3ZD9A 3WL5A 4ADSG 5LOVF 1PNVA 3RVLA 1YI0A 1U0RA 2AYZA 1W1IA 4NPAA 4XMYA 4P54A 4C0SA 4C0QC 1ACJA 3IRUA 3AKDA 3IPLA 1XYGA 5DYTA 1MOQA 5TC4A 4FLMA 4EHDA 3T7IA 3L7AA 2WJWA 1H3EA 2MSNA 2XDQA 3AY3A 1CJKC 4ZI7B 2RH9B 1D2MA 2VF2A 3TLMA 5JH7A 3O74A 1NPYA 1TKRA 2FSIA 2AYYA 5HKKA 4EYGA 3I5YA 2XJ9A 3FYUC 1U2GC 1OH8A 1P62B 1HE8B 3E9EA 3OX3A 4KVZA 1C7FA 2CLFB 2FMXA 1A9SA 3H97A 3OEHD 4M0EA 5ALWA 3V4FA 1IC6A 1QTIA 3OMLA 4M0DA 5TX7A 2NU9A 3MERA 4NENB 1PVVA 1TLTA 2LCIA 2FX5A 4OFBA 2YUTA 4F21A 1EG2A 1FTQA 3BK2A 3C3EA 4CM7A 2EZ4A 1IJBA 1PR6A 3IVXA 3DZJA 1GV1A 1M2JA 1U0SY 1MC4A 3IVMA 1HK7A 1ZKDA 4RGVA 5GJBA 1SM4A 1OXTA 1NBIA 2XYHA 4UNSA 2QUZA 4BGEA 4DBLE 2JHGA 3GZTB 5HGXA 4CDRA 4URVR 3RT7A 1Y6GA 1XNRB 1URPA 1ORWA 2J9ZB 2JIRA 4H60A 3V76A 4OKIA 2EG9A 4Q9LA 4B79A 4WUVA 3GRPA 2I6TA 4H6PA 2QZSA 1VHDA 4MRRA 5IBQA 5A5FA 3AP1A 5CA0F 3K16A 3A35A 2QM3A 4MMZB 1JDVA 1KBOA 2W4QA 3L7LA 4HLUC 4JEHA 4W6ZA 4ZVQA 1N4AA 3GP3A 5J5AA 2UU9B 3UV6A 5DTIA 4AVZA 3E1KA 3C7KA 2PLWA 2ZIZA 1IWBB 1HH4A 4P1ZA 2XDWA 4DLUA 2VCYA 1OAOC 3FHCB 4CI0B 3T7TA 4RZHA 2D0OB 3PWKA 4H9GA 1SRQA 3AEUB 4JJ4A 2PZAA 1GCOA 1RNLA 2QF7A 5AKXA 4F11A 2F6RA 1QKJA 2MDTA 2EKBA 2JDID 3PFKA 3SYLA 5JH7F 5EC8A 2J9FB 1PV1A 1M5UA 1WD7A 4YQYA 1Q0ZA 5C7IO 1TOAA 1Z75A 3KLOA 2AA3A 3P9SA 2CVPA 5HKAA 4IQ0A 1LJ8A 1B3BA 3F5QA 4H6XA 1OILA 4Z2YA 3UXHA 3P94A 1TM2A 1CP3A 3ZZUA 1JSXA 5ALOA 2GVZC 1WF6A 2HM7A 3L1UA 3LLMA 4IWYA 5IJAA 3W7VA 1XD8A 4B3GA 1DL5A 1H3NA 1YOBA 3JALB 1XGKA 4IGFA 1YAJA 1K8RA 1NUQA 3BEDA 5BW6B 5BNFA 2OQVA 3OQNA 1CIPA 5IN4A 2PT6A 2VBSA 4QPDA 5JZMA 3ST7A 3DBHB 2QK4A 3ZWDA 2JGDB 2XR1A 4LY3A 2R97A 2V7WA 2NZJA 2BFPA 5CDFA 2GM3A 3ONDA 4RPCA 4EW2A 4JI7B 1KOLA 1YA4A 2PX2A 2W4MA 4OGWA 5D84A 5J43A 5LIPA 4DVGA 4I4TA 4JC5A 1EFRD 1H8ED 3G9UA 4H18A 1UAGA 3E1SA 5FKJA 3WKBA 4D4LA 4O08A 1IM8A 1R0ZA 3RFTA 4BJ3A 1HE5A 5AVKA 5C1OA 2QWXA 2PTHA 2PVPA 2F7SA 3IXLA 1H65A 1T2VA 1TZKA 2FEOA 2UKDA 4RCVA 3VKFA 5ICCA 4JBHA 4O29A 4B34A 5EHXA 3LYAA 1IQRA 3V5NA 3ZW9A 5C37A 1C9DB 4H3SA 3LXRA 1FDIA 4GHWA 4MCHA 3ZIAD 1P75A 3LQEA 5JFGA 5F52A 3W2GA 1HY3A 1Y98A 2F4VB 3BXPA 3EVEA 1WPXA 2EEPA 3AUFA 5AVOA 5TPWA 1AQLA 5FUWA 1E79A 5GGYA 3EPJA 1ZLXA 2OLJA 4RJKA 4RC9A 1I8DA 2Z57A 1FP7A 1H42A 3BGVA 4MGKR 1HRKA 4NFHA 4UDYX 4AJIA 2OBSA 1DAKA 4Z9FA 3QEKA 2GXUA 3OZ7A 1GCAA 2YHIB 5G3ZA 1BXZA 3C3CA 1MRSA 3QVGA 2TRSB 4TTPA 5JCOC 2H85A 2PUVA 3LGSA 4NV3A 3KR1A 4R2XA 4C05A 4EUFA 5TVGA 3LKZA 2IRWA 4MZDA 3BCDA 1M0WA 2ZVPX 2RGUA 5B1DA 4TTQA 3E53A 1E2JA 2PKXA 4YI3A 1GUBA 5F51A 1NW9B 3DSRA 4HGOA 3RHFA 1U9IC 4ONEA 4F5ZA 2OCIA 4XGQA 2EJUA 1H0SA 4E30A 4FYKA 4BBAA 4G5OA 1AQYA 4XD7A 3H2KA 3PQ2A 4GOLD 4I4TF 4X85A 1W5SA 4JHLA 4CCWA 1IZ8A 1S2MA 3WE7A 1LLUA 3EZ7A 4C7VA 1PYGA 3E5HA 4ZIRA 1Q82D 3TLJA 4DA0A 1SR8A 4H1WA 4C6TA 3MIIA 5HVNA 2UVPA 3Q10A 1I7PA 5KSWB 1ULSA 2VBGA 4QQNA 1C5KA 1L7OA 1LQUA 2HRDA 3NKVA 2D2IA 2IDZA 1KFKB 3Q7IA 3CUYA 2IV3A 4BO5A 3T1HB 2A0WA 4DNFA 2ORED 2DUWA 3OPXA 2BEWB 1RMYA 1X94A 1N6KA 4KZPA 2BGJA 2Z95A 3FUVA 2AZXA 2IS1A 3ZHSA 2J4CA 4ER5A 2Z5FA 1XD2B 1X8JA 2BHTA 1YRHA 2AJLI 2P5TB 1THMA 2B8WA 3SLNA 3FTNA 1OWMA 1G0NA 3QYJA 1M76A 3P1JA 4BO2A 4NU5A 5JD4A 4A0RA 4CEIB 2UYCA 3DDYA 3GEMA 4LJAA 3D1VA 4M1TA 1R5OA 4NNOA 4WZBB 3WLEA 1H93A 4DHWA 6PFKA 2G80A 3OIDA 4ZT4A 4RJTA 1X1DA 2RGEA 3JSAA 4ZZIA 4I08A 3PL5A 2BTQA 3KYDA 1OYVA 5EAIA 4P4SB 3SYTA 4C7JA 4RDKA 5TV2A 3G2IA 3NHJA 1OSNA 4L95C 2O2JA 2Z5GA 1HTWA 4TL7A 5JEEA 4WFIA 4L9WA 3DAYA 3L04A 1QIHA 2XQJA 2P9HA 4MXDA 5LUBA 4C0HA 5G53C 5EIHA 1M2FA 4NPCA 2DR2A 3H4IA 4JZKA 4XIIA 3COVA 2D3WA 2DHEA 1P19A 4NS1A 3ZXSA 2B3DA 1HZZA 4KGVA 5IVIA 3WO0A 2P9EA 3NDJA 2HPVA 2O48X 4KL8S 4KPGA 4KBYA 4ZYUA 1UJBA 1MB2A 1VMKA 2BFAA 2IHBA 5JZ9A 4KQXA 2GXAA 3P8ZA 2CUZA 4ZZ3A 3FCXA 4ARZB 4FLEA 2YY6A 3H18A 3MS7A 4FI3F 3SYNA 5I8WA 3L9WA 3QF4B 5GP1A 5K5EA 3CN9A 5HZHA 1NYTA 4RE6A 4AECA 2IXFA 2HT6A 1I4TD 2C78A 1B2LA 5ERYA 3EWIA 4CV0A 4AK9A 4MV3A 5LQDA 1E0JA 4YMHA 1X1BA 3AJ9A 2M1XA 1LK5A 4JOSA 1ZEMA 4ER3A 3PX7A 2DUNA 3ZPNA 2BMAA 2PLNA 1NRJB 4FGWA 2H08A 1ZW1A 3RSQA 4R8LA 4DJ5X 4CXMA 1Y1PA 2ZI6A 1OBCA 4OMDA 4B5KA 3R5XA 4IV5A 3THXA 2VPIA 3EPKA 5TNXA 2RE8A 3ELDA 1DAIA 1DDOA 1GNQA 4GVLA 2P77A 2VTEA 4DCCA 1MENA 2QRVB 1JA1A 4XSGA 3O91A 5CBPA 1PNTA 4CM4B 1ODTC 1R6BX 1KBQA 2Z58A 3BM5A 5CLFA 2PWYA 4WOBA 3IAXA 4TV8A 2ZOSA 3DDZX 1R6DA 1YZLA 1OWNA 4V1CB 3L46A 1OV6A 2VUIB 4ROXA 3C5EA 2OWDA 1NI3A 3IBGA 4K6GA 4DV1B 3VNVA 1DC7A 1NVDA 2CZCA 3PC2A 2H7CA 2OV8A 4MLCA 3TZBA 3N8GA 4C14A 4N8EA 4E07A 3UJNA 3GGOA 4GVPA 1JNXX 3F67A 4W5TA 3C39A 4NF2A 3WK5A 3R0QA 4HZGA 2D6FA 4JEMA 4IZOA 3ESDA 2B5VA 2QGZA 1P8AA 2O06A 3AGQA 4IDNA 2XGMA 3UHPA 4HHEA 2DMRA 3KHTA 3AL3A 3GUUA 3L7OA 3H11B 3TEFA 3UC5A 1MC8A 2RAFA 3RJ9A 5FA6A 5EE3A 2DF8A 2ATVA 2DPGA 2VP3A 3D3QA 3MEQA 3CRMA 3O2QB 2W2PA 4QDJA 3QI7A 5GWXA 1FNNA 5BYJA 2Z3WA 5LB2A 1BCRB 5IAGA 1GQRA 1JMVA 4EMBA 5DB4A 1UPXA 3PYMA 3CVVA 3F78A 4ZJYA 5A03A 4BAUA 3KQLA 4KRXA 4YRTA 2BYTA 5A71A 2ZUBA 2TMGA 3DO6A 2FJPA 2OBLA 3RYIA 5AIAA 1ZGGA 2QTTA 3NWBA 5BSTA 4L16A 3JAMA 1E2HA 1CUHA 4GZ6A 4U7GA 5AW1A 1E3TA 3KLPX 1NSFA 3O1LA 3EZNA 4TV8F 1I0ZA 1VM6A 1Q1NA 4MEAA 3AEQB 4FOTA 4PQRA 5IW8A 2O0KA 3L8EA 3ZHOA 1JDPA 3D26A 4V0NA 2ZR7A 4JR2A 3CWQA 1BWQA 1VCMA 4FWIB 2IEDA 3LA6A 4ARCA 3DGEC 4CUZA 2QRHA 1PK9A 3V2GA 3IAUA 3H2HA 1X87A 1N6HA 2FXVA 4JI5B 2X5NA 2JH3A 1H3FA 2OK8A 4XOPA 2LNDA 1JALA 3IDZA 1Y6JA 5BSMA 1I5RA 3CUVA 4LMPA 2WRZA 4NE9A 4F46A 4GX5A 1UXKA 2DJ5A 2H2WA 2LWIA 3V3TA 1ZD3A 1RJ9B 3OSUA 2H9IA 3CIFA 3TOXA 1CRQA 3Q1KA 4L27A 4OXRA 4RVGA 5KSPA 4CIXA 1GPAA 5I6DA 1N33B 3IAFA 1JDBB 2GQFA 2G5CA 5SZKB 1IHYA 2H4FA 2ECFA 4KW7A 5TF4A 3S29A 4POOA 5HJ5A 1CBUA 1NLUA 2CVOA 4PC7A 1JR3A 4Q82A 4DQDA 2P69A 2YVKA 1GKYA 5CDFE 1GKUB 4PZ9A 4B8YA 4KQHA 5G02A 3LUDA 2GAFA 3NETA 2P2SA 1WB9A 2BN4A 1BKDR 1GRVA 2UZ3A 4IJKA 1XCOA 2DYKA 3T3HA 4YJ2B 2WMNB 3ZLTA 1QQ6A 5G0WA 1Z0FA 2PX6A 2VZLA 2R66A 4KIUA 3RIHA 1WP9A 1Y7HA 1RAAA 1RRGA 5G0VA 1JIXA 3D8RA 5IDQA 2ETXA 4PZUA 5EMLA 3A6FA 4QFMA 3CF6R 2DR0A 2OBYA 5L4SA 3HJUA 3N8DA 4GF5A 1HL3A 3TLXA 3NBKA 4HLCA 4TSFD 1RCUA 3G7SA 3PQDA 5C0OE 3A4NA 4N5HX 4ZEVA 3KQOA 2E21A 2PUGA 1RM3A 1K8AD 1BTOA 1QQBA 4WSOA 2FRDC 2RGWA 2W71A 3PFHA 3E8SA 4ZOEA 5EJMA 1WCYA 4ER7A 5EWJB 2Q6IA 4RX1A 3L18A 3KJHA 1XTZA 1YS2X 3UO8B 4E21A 3AHIA 3W7AA 3F8WA 4YRSA 3THYB 2HRCA 2XOKD 3TZ6A 3NFYA 3ZH9B 4YMUA 2WZDA 3BA1A 1JFSA 4IIJB 2IY9A 4GKBA 1E3SA 3PXEA 3OETA 4PCUA 3KKPA 4DKJA 1EVJA 1RLMA 4I55A 4G5FA 1WS6A 5DK6A 1JS1X 1BJRE 4BLRA 3MFYA 4Z5XA 5FULA 3PFIA 4EFLA 3C74A 4D25A 1S8AA 1FK8A 2IYEA 4CM9D 1US8B 5JAOA 1UDCA 6ADHA 5IYQA 3EVGA 3SNHA 3UEOA 4A2QA 3F6BX 3R77A 3LHDA 3LXXA 5K3FA 5HJEA 1EFAA 1DG3A 1N2CA 2DWOA 2FR1A 4LRYA 2O8BB 4HQ0A 1FSSA 3NBQA 2HJSA 4LXUA 1D6MA 4NOMA 1IK4A 1NKSA 4CM6A 4AZ3A 2OBBA 2J0VA 4WKOA 1JDJA 1WMFA 1LA2A 4IEEA 4R01A 4U3JB 5AJYA 4BVGA 4F84A 1EFHA 3P2EA 4FIDA 2DAPA 1T6ZA 2FEXA 2W0SA 2FPIA 2WJYA 1GUYA 4FNOA 2JZOA 4GM0A 4U7WA 4XJTA 5EJGA 1TQ6A 3JR3A 4NJMA 3MD0A 3L41A 4K9NA 1TK3A 4FYHA 4HGNA 3RYFB 2K5UA 2C5AA 2FK8A 4NBNA 4NESA 4EJSA 4JVNA 1O5OA 2GAJA 5DM0A 3PWTA 5FTNA 2F2TA 3RRNA 2ID7A 3N9IA 5E1BA 1N9GA 1QRAA 2JKZA 3DOCA 3LY5A 4M6WA 2HB6A 1DEXA 4G37A 4PGHA 1CZNA 4KPUA 4D80A 3U1VA 4LGCA 5JAMA 1QZ3A 3TRHA 4KQIA 2OPHA 3FNQA 1QGUA 3G6KA 2GN4A 1V48A 1T0HB 2ZRFA 3GDGA 3AKZA 4K1LA 4MV0A 2OTJB 1L4MA 4I55F 2J0SA 1VJGA 1VQ7B 3BAFA 5DGIA 1NBMA 1C7QA 5U4QA 3VR6D 1R0LA 5ALNA 5IJWA 3ZI7A 1XI2A 4GX2A 4GSLA 3CLUD 5IYPA 1Z7EA 4G24A 3ASZA 3JQCA 5C5CA 1J8DA 1OA0A 3I9V6 4QELA 1H4QA 1JLMA 1QFXA 1ZGJA 3ZK9A 2C7VA 3X2SA 4BKRA 1C1DB 4FUTA 1KU0A 4UCXA 4TN5A 4HPJB 4IINA 5JTUA 4RK7A 3DOUA 2AMYA 2JRCA 2VNSA 4G86A 3BUSA 3JVUA 3R6KA 2BM1A 5D3KA 5E1MA 4X20B 3T1YB 5FUVA 1E0AA 1D0SA 4H7IA 4IDPA 4OJMX 5AK0A 4ZCIA 5FWYA 2VOJA 2JEYA 3SSNA 1TJ5A 3A4VA 2AOXA 4XFJA 3H0CA 3ZGNA 4BNGA 1QRRA 4S1PA 1YNOA 3WB0A 4UZFA 4HNRA 3K1JA 4PG7A 3HA3A 5GADl 1B14A 2VAVA 3F96A 3KKOA 4QEKA 3HJNA 2GZ2A 3FCAA 1YJAA 5JSUA 1AO0A 3IPXA 3JQ7A 1U0BB 2H1CA 2DOGA 3L7IA 3KJQA 2WSSD 2V31A 2VHEA 4M7PA 4HQOA 5I3ZA 1T8UA 4HXGA 2HXSA 4RJJA 2H0QA 2GF0A 3PCRB 5K0NA 1B4DA 4OQFA 5K9ZA 1W75A 2NU8B 4BFTA 1WDWB 3IIKA 3PRKE 4J0JA 5DNDA 4MYRA 1QK3A 2CNWD 4D44A 3E2PA 4KWCA 4O4LB 3ZY5A 5GINE 2DLCX 2RI6A 3L92A 3X2FA 4QAJA 2A14A 1W6RA 2V1UA 1U5BA 4ECAA 2WWTA 3C5VA 1L8OA 2OV3A 4EPXA 1N2JA 3I6QA 1F8GA 2RHHA 2A6PA 5IKOA 4PS1A 3OLCX 1T4CA 3SJZA 4U0JA 4CU5A 2WC1A 3WMEA 2G63A 4OUDA 4CF6A 1P0QA 4MITA 3RU9A 1T24A 4NE7A 5MGNA 3UFBA 4PGOA 1W8DA 1TTHA 2I66A 5HEKA 3N7TA 2EQBA 4TZ0A 3NH9A 1XEFA 2X5KO 4P7FA 5BSKA 2RCNA 3CEHA 3D3WA 5JMTA 4PPFA 1D4FA 2IP1A 3JATB 3AR2A 3UBTA 1CEEA 4PX5A 1PNQA 2WZNA 4JJFA 3T9CA 2QLBA 2FW8A 3OPNA 3OUZA 5JXJA 4TKZA 5DEIA 5AVUA 3FYUB 2E5FA 1O6CA 2X1HA 4TTJA 5C18A 2Z56A 1FSFA 2HLDD 4ZARA 1WBJB 3MA0A 3TBFA 3ZLJA 2VNJA 4OQMA 3PGMA 4M8SA 2EGHA 4OM7A 3AHDA 5IBPA 3CLUC 3O26A 1TUGA 2PR7A 3P96A 3JARA 2P9CA 3QVKA 2HQOA 4Q7LA 4ACAA 1D1SA 1LPOA 2PGDA 3PUVA 4MJ3A 1HKHA 1K06A 3P5SA 1JWLA 3CNNA 4WCVA 4MAMA 2TSYB 3DCNA 3NAZA 4ZDWA 4B6JA 5A2QA 4JUIA 3DTNA 1EFLA 2ZB8A 1IG0A 1F12A 3G1UA 4MS4A 3PP8A 3KQHA 2JK0A 3ER9A 2V7QD 3HHPA 3CA8A 4EF6A 2OBFA 3DTTA 3U0BA 5FAXA 2QP4A 1P1JA 5E4FA 4TMVA 4I1SA 3H2IA 5F73A 2HDNB 3RSFA 5JANA 3IERA 3M81A 3F1KA 4GYJA 2PQMA 3IMFA 4B2LA 1F8XA 3TUIC 1MFZA 3WS7A 1DBWA 1I1QB 1NG1A 4BFZA 1EM8B 5K20A 5LP1A 4N54A 2GREA 4G7WA 1WXDA 2BV3A 2HGZA 2WTXA 5A6SB 1QIJA 2ZR8A 3SSOA 3UPUA 1QX3A 4FFLA 4R0NA 1CUDA 3BILA 3ZOKA 1TUIA 3BDAA 3HCOA 4EYSA 5CYPA 1H23A 4PSKA 2XB4A 3JQGA 4NXMB 3IELA 2WMOB 4L9RA 4F2WA 1J39A 3C7CB 3AERA 3IQEA 2FWIA 4AJHA 1ODJA 3K1AA 4W1RA 1KE1A 1JR3E 2OGSA 3JAWB 2BFEA 1GFWA 1J5EB 2VFAA 4LYEA 1YDMA 4PHCA 5BWMA 1FMJA 1X1SA 2CUKA 5KSOA 2DH5A 2IP4A 4FNMA 5B2ZA 3N2IA 1NW6A 2W2NA 3KDPA 4MUJA 1ISFA 2X5JO 3F7NA 1KDPA 3KCQA 2C1ZA 4TXLA 4TXNA 5BQOA 4YJHA 3O8QA 1T4BA 1JZSA 3EXG2 3IEUA 3TOSA 1NVGA 1QE3A 1QV9A 1E2EA 1UWCA 2BHNA 4L07A 4Y0AA 2R00C 4I7EA 4QU9A 3K32A 3MINB 2FVGA 1AZSC 1PFKA 4EP1A 1PTJA 2V5VA 3K8QA 1P73A 4EJMA 1QZTA 3IBCA 1SCKA 1QKKA 2XA9A 3R7WA 5F4BA 3GAZA 2X8KA 5CEJA 1Y6FA 5T57A 3I3OA 3RD5A 2AT1A 3L93A 1XCJA 3EGXB 3MSCA 3G2QA 4KIFA 4R5MA 3TQQA 1RPZA 1Q92A 4DIOA 4H3VA 2FKAA 4PNEA 4XJSA 1GTMA 4EW6A 5BRNA 3D8SA 4BMZA 3LKVA 2LCQA 5KC8A 2YV3A 3EEFA 4K6KA 2JFHA 4PAQA 4J1QA 2OE2A 1WSWA 1KRHA 4ZVVA 4FHEA 4D4MA 2A92A 5IJ9B 2Z8XA 3MHTA 4G85A 1U1EA 1T3LA 1XZLA 2G0AA 3WZ2A 1FSPA 4GMKA 1IZZA 1ZC3A 1U0EA 1Z17A 1HG0A 4ZT5A 1PYDA 2V7XA 2GBGA 4EKEA 4TTVA 3HDTA 1QV7A 3W1WA 2IK8A 2XUKA 2MT9A 2A4KA 2H18A 3HYNA 1C4KA 1AMOA 1RWMA 4UDOA 1V1MA 1XUOA 5EE5B 3RR2A 3BXXA 4MQEB 1GPUA 2CV0A 5KZMB 1X7YA 1TM7E 3EW7A 4KQJA 1SA0A 4G56A 4NATA 4MW5A 4I50A 3WNZA 4D5GA 1U2DC 1PDWA 3EMDA 4KDEA 5CA1B 3VRHA 4FDLA 4MQUA 1F0NA 3SBEA 3W2FA 1GYPA 1NATA 3JQAA 5AESA 5LXTB 2D8AA 2IX3A 1L9KA 2XUHA 4MCIA 1OXMA 1T3HA 1YS4A 4RESA 3G2PA 2C5BA 1OREA 4YREA 3VR4A 2HO4A 1G66A 3FA2A 3BF8A 5AO9A 2JFFA 1ESEA 3BMNA 4UUAA 1XF9A 2CDNA 2P40A 1YUBA 1R4NB 2W2OA 4GM4A 4OYRA 4U2BA 8ATCA 4Y1FA 4L02A 4YAIA 3PA1A 1LGYA 2XI4A 4IJ5A 4INAA 4JX9A 2GHIA 3BRQA 3T7JA 2YXNA 3TW8B 2XE8A 3DH0A 4AX8A 4CR6A 2QX8A 4JC0A 5TS3A 6REQA 5FQNA 2IW3A 2HMSA 4G1VA 5JY1A 2H1WA 2SCUB 1DBIA 1N3YA 3TR0A 3AVQA 1T9GS 2UVDA 1ZUIA 4JJEA 2QVBA 3VC2A 1FBTA 3K8OE 3PWZA 5HA5A 4CDGA 3WG9A 3RAFC 1VL0A 2ZR0A 5JLJA 3BE4A 3K4PA 1SXQA 1QE0A 1GQSA 2ZAYA 4BHTA 4BQQA 5AVSA 4ALLA 1WLYA 1NXVA 1CY8A 1OXVA 5KW9A 1WMAA 3UNXA 3TZLA 3OZRA 4TXJA 3K0AA 3B89A 5DLDA 2WB2A 3NFRA 2PWBA 5HS6A 1RYFA 2W83A 3T3EA 1M1YB 1GZ5A 4JEIA 2C5HA 1FNMA 1VRCA 3C6XA 3VR4D 1IWPB 4LDJA 1Y4DE 1ZSNA 3K2EA 3L6RA 1F1JA 1VLMA 1QO7A 1TKBA 5DV9A 2HXYA 1UD4A 2G04A 2P9JA 2PKCA 5FOXA 5TDHA 4BBJA 1UXJA 2R7LA 4DAEA 1E1KA 1HE3A 3FNEA 4RDXA 1UCFA 2RGNA 2GEDA 4HDRB 1XKQA 1SUWA 3HXKA 3JXEA 3QOXA 4WFQA 2DSNA 2D0IA 4K28A 4UQOA 4AY5A 4DIUA 2JLWA 2JLQA 4K7JA 3TNJA 1T43A 3EZLA 2B30A 3JWPA 4LGMA 4X9XA 5L40A 2UZ1A 2P5YA 3H84A 4AN1A 2G83A 1YOVA 2F1MA 1H2HA 2VJCA 3OSZA 3P4UA 5DDIP 2ZT6A 3BERA 4XB2A 4UM5A 1N8KA 1DEKA 3LQYA 2VBIA 2CT8A 5CR9A 4XWOA 5IDXA 3GF4A 4IBOA 1XQWA 4OSOA 3FOFC 3RRBA 4QX6A 1XRNA 3VNSA 5FLKA 4DJTA 2JGEA 3HJGA 1UJ2A 2VSXA 2XUOA 1VXRA 3A1FA 4X61A 3A1TA 1VKOA 3Q15C 3FYCA 1VHTA 3BK7A 4H1UA 4O1HA 5HILA 3WLAA 3PSAA 2MYPA 3ZJYA 2TMKA 4D3SA 4DMHA 3R6LA 1IHMA 3COSA 5HMLA 4IIUA 5C4IA 1GR0A 5AKZA 4CM8B 1DRVA 1FRNA 3LFUA 3QMPA 4RK0A 3CBGA 4UJ3A 5JXGA 4QPCA 3ABQB 1I2DA 4AS3A 4BMPB 4MVJA 4EZIA 3H17A 2FLWA 4D7AA 1ACLA 1B8VA 3EEYA 1BE0A 1GVNB 5DWDA 2ZIXA 3MJTA 2JI7A 3TXAA 1ZN8A 4HAUA 1SHZA 4EB3A 2QY6A 4EGCB 4RH3A 3HCRA 2R4UA 4QASA 5EE1A 5A2GA 4DIEA 5AK4A 1H9AA 4MGIR 4WXPA 2HEGA 3HXOA 1XDUA 3X44A 2D5AA 4ITUA 3CCFA 4L2IA 1Z0IA 4QVJA 1L6RA 4WJKB 1BA3A 4XASA 4DIFA 2GAAA 4FYIA 1ZRNA 2IWRA 1DG1G 4DPLA 4Q4AA 3EIWA 3PDCA 1E0SA 3G1TA 3X1YA 2H9AA 2IE8A 4DA4A 2RHDA 2PGIA 3KPVA 5FL7D 1QP0A 2ZGVA 1EX6A 3ACDA 5TXGA 3H75A 4A0SA 5F7ZA 3DBLA 2WVHA 1QVWA 4RANA 4BO6A 1AF4A 2PXAA 3RIYA 3BY1A 1KOJA 3FPBA 4FYYA 4MWBA 1E6WA 4AUNA 3R7FA 1N5DA 3JU3A 3EH1A 1MX1A 3OTQA 4MS3B 3G71B 1J9EA 4PQGA 1I33A 3ZWQA 3DD1A 1KIFA 2NIPA 2VG8A 1U1CA 2AYXA 3UYKA 4QTYA 3O2NA 4TKOB 5JNVA 1YITB 1AKVA 2XWSA 3HR4A 4JDUA 4JB0A 4RD1A 4KO8A 2N1MA 3GFVA 4LAFA 1ZM2A 3NM6B 4M1SA 3ZHVA 4JMPA 4MVJF 3FWKA 2ASVA 4F85A 4CIWA 2IEIA 4AIIA 1JR4A 2AHRA 1EDOA 5IC4A 1DUVG 5A5GA 1CZLA 1N0HA 4P25A 3O4IA 3OPQA 5FHQA 4D4HA 4E32A 4RPGA 5F77A 1V41E 3ZY4A 2VF4X 3GL9A 3JPWA 4QXMA 1ZR2A 3H0KA 1OX4A 4TTAA 1YS9A 3NVMB 2HF7A 3QXCA 4PZZA 4GX0A 4M49A 5E0KB 4J9UE 2EVWX 2VH2A 3CRW1 4JWKA 4N7RA 4BMXA 3UAWA 4JFRA 1MX3A 1YGYA 2PKYX 4HAWA 4KCGA 4LGYA 1DAOA 1NFFA 3S2YA 1ZGBA 1CS4C 5ALKA 5EZ6B 2BC9A 1W4LA 5DISB 3NYRA 3SDZA 4E7PA 4B3MB 3K6SA 1T2CA 1OLSB 3FWPA 3A6PC 1UOEA 3HWSA 4C7MA 1T13A 2B1RA 4DY6A 3NDRA 2XZLA 3HN7A 1N7HA 2FMTA 4I1RA 3GB9A 1AKYA 1CUAA 1CE8A 3QPWA 4Z4WA 2VJMA 3OA0A 3PHCA 1XVVA 2XHEA 3A1NA 4M1KA 1PW5A 2Q46A 4AN4A 3RS2A 3U09A 3BQNB 5FR1A 3U3RA 3ECCA 3DLAA 1KZ7B 4OYYA 2RGAA 2O8CB 1L4UA 3OW2B 1NG9A 3H4TA 1U7ZA 3LIIA 4C4XA 4D46A 1Z5PA 1LJUA 3BB4A 4RL6A 2WKWA 3P9KA 4MMXB 4OHRA 1CY2A 4MUYA 4A5OA 4QREA 3ZXIA 4AMVA 3EGVA 2PD6A 2P6PA 5AW9A 2WWVD 4ILKA 3HMQA 3OIYA 3PFGA 2PS0A 2OHGA 2Y05A 4BCDA 1O5TA 4JP1A 2QZPA 3ZDQA 1M9NA 1MXFA 1SAYA 3N74A 1JLHA 2Y77A 5JMWA 1HDEA 1DTEA 3CESA 2G9VA 1FNDA 2JIPA 2NXJA 4S3MA 1M10A 3WHPA 2AEJA 1QCYA 1VMDA 2DQSA 1CQJA 1YE5A 1DXQA 1K8YB 3EIOA 3EXIB 3OICA 5D8DA 4KKSA 3CU5A 5CBKA 1I2ZA 3EZFA 4O4JA 1EGHA 3EPPA 5AW3A 2FTKE 5FLEX 2QE7D 1BIFA 2YIMA 5I5EA 4EUEA 3A70A 4TYQA 2NX2A 2NSYA 4FDVA 4NJOA 3M3DA 4Q3KA 1JG2A 2JJ1D 1P4HA 3VKUA 5K2MA 3RSZA 3NT2A 3OEWA 3T1OA 2EHJA 4IH1A 1Q0UA 5FI3A 3TSCA 1R8YA 5CGQB 3AIOA 5F33A 4UEOA 2JLYA 3ZDBA 2QTVB 2VDRB 2YV5A 4P5EA 3NWEA 4FFPA 1KFBB 2J3IA 1GPH1 3I4CA 1DELA 4E5VA 2CXTA 3QVMA 3I9KA 4OG2A 1EXVA 4KPYA 4ZMRA 4EPRA 2EDCA 3GJQA 4ZVUA 1A8QA 4MWGA 4O2AA 2F3RA 4LY0A 5EPEA 4X1YB 1O0CA 1GFIA 3S5UA 1W30A 1L7DA 1CZKA 2FMUA 1CZUA 2J3DA 2NG1A 5D3MA 5AOCA 4GRAA 1XRJA 4KGDA 3TSAA 3G7NA 2DT5A 3AWDA 3PHLA 5I47A 5BYAA 3B6EA 3LCMA 4HNAB 2XNDA 4QL3A 4Y1RB 3T7CA 4BUJA 4UTVA 2ZTVA 1KKLA 3BIWA 1J8FA 5JSFA 4ZICA 2H0AA 4UU8A 3GA0A 4DC0A 3LOQA 4RZ3A 1DGQA 2ZITA 5EMKA 2DFPA 1J99A 1TRKA 3QY9A 1DAGA 3RHSA 2ZWAA 4DIKA 5KTMA 1E61A 4X5OA 3KB1A 3U44B 2VBVA 4ETNA 5E6TA 5CCDA 4R68A 2QX9A 3K4HA 2C2ZA 3A6EA 3QIAA 5KTTA 1SIUA 1Y82A 1YL5A 3W3AD 5EJAA 3LLVA 2DY0A 4L5YA 4O4JF 4OH7A 3QE4A 2L82A 1N1EA 1DKRA 1B1CA 4KQ6A 1NFRA 4WT7A 2EG5A 2Y0DA 1TF7A 3E7DA 4Y9DA 1Y1KE 2JPDA 1RPTA 1YB4A 2J48A 3IYLW 3JWHA 3L8HA 4B6EA 3GRUA 5JCJA 4RTNA 2E1BA 5FEMA 2PH5A 4P7GA 3DBVO 3G5TA 3F5FA 4WGGA 3AJRA 1PR0A 3RK0A 1Y8ZA 1P1BA 2Q6LA 2YWXA 3AUTA 2F48A 4ENTA 4CQLB 2X2PA 1VTKA 3MJRA 1FEZA 2A7XA 2QN8A 3H9UA 5JADA 1KTVA 2Q2OA 4ASUD 1BRMA 5JI3E 5AW5A 4F5YA 4RJLA 1S4MA 3THRA 1P3Y1 4O2AF 3EGWA 3BTVA 2C84A 1U81A 4W1SA 2WILA 3OZGA 1JKFA 3L0IB 3GIDA 4OHWA 2HQSA 2GN8A 4YAFA 4OFXA 4PLHA 4J9VA 4X60A 1PKVA 3QSGA 4CIVA 3IR6A 3X1MA 1NSYA 4XEUA 4E51A 2Y9MB 3SE7A 4YV0A 3RARA 3HP4A 1CZOA 1LRKA 1L5OA 2B4QA 3HZZA 2ENUA 3LWZA 3RAPR 1TU4A 2Y3IA 3NPMA 4GSYA 3H99A 4XCVA 1RBQA 4MA4A 1UBMS 2R84A 4MLPA 3GFQA 4YAOA 1QWOA 1D4AA 2QMYA 1CRLA 2Z1MA 1Q3KA