1BX1A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVQVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
total genus 97
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx1A02
4RD2A 4B43A 1KQSB 1EFTA 3CW2A 4QHYA 3CCUB 1QX4A 4ZCLA 3CCQB 3ZBUA 4ZGQB 2GQFA 2QTZA 1D1NA 5H59A 1CQXA 2PIAA 4ZCIA 3ZC3A 1A8PA 3CCSB 1G7SA 2VYQA 1U2RA 2DERA 3AGPA 3J81k 1QGZA 4FWTA 3U6KA 1AIPA 1VQPB 4TMWA 4G1BA 5KSWB 1FDRA 1E63A 5THXA 1UMKA 2DETA 3JQPA 3LRXA 4PC3A 2QEXB 2OTLB 2XNCA 3P26A 3AGQA 2R6HA 1E64A 1QH0A 5AN9A 3CCRB 3G71B 2C78A 1QUFA 1BX1A 2HDNB 4B48A 3AVUA 3ZZUA 4ACAA 2VNJA 1YI2B 1E62A 3W2HA 1TTTA 1K73D 3QE2A 1YIJB 2QMUA 1VQNB 1EXMA 3OJWA 1OB5A 1B23P 4HE5A 4B4DA 4NBSA 3CB4A 4RJLA 4DQKA 4EH1A 1IJFA 1YJNB 1KK1A 3AVXA 2BGJA 1GAQA 1TVCA 1OGIA 4HE6A 1QGYA 3AVTA 1FNDA 4RD1A 2BF4A 3W5UA 3U6BA 2RC6A 2BN4A 2QDXA 1ZM3A 3ZZ0A 3FJOA 1EP3B 1BJKA 2OK7A 2RC5A 3CXCB 1OGJA 2C77A 4YAWA 3VNVA 1G7TA 3QFSA 2PMDA 1I7PA 4N3GA 4DQLA 4YAUA 1W35A 4MYUA 2E1RA 5JBQA 4NCNA 2AHOA 3AVYA 2VNHA 3WXMA 2BPOA 1CNEA 1KK2A 1QG0A 5TR9A 1N0UA 5GV7A 5HXBA 1DDGA 5H5JA 4YAFA 4AF7A 2HCJB 2QTLA 5TY0A 3WBJA 3WY9A 1G7RA 1VQLB 4RD4A 3ZZTA 4ZGNB 1ZM2A 4PC6A 3CCMB 1VQ9B 1QVFB 5GV8A 3QSYA 4G5GA 3I1FA 2FX3A 3P27A 3W2EA 1GO2A 2DY1A 4M0LA 4RCYA 2BVNA 3VO1A 4AF6A 2J7KA 3W5HA 1KK0A 2BM1A 3CC2B 3I55B 1ELOA 1SKQA 3W2GA 1VQMB 1QFYA 1Q82D 1W34A 3WNDA 3AVVA 4ACBA 5TV2A 4G1VA 2BSAA 3CMEB 4TMTA 4ZV4A 2B7BA 1QUEA 4LBZA 4P6VF 3QFTA 3W5VA 1FNBA 3ZBTA 4AC9A 1VQKB 2XEXA 3JQQA 4M2LA 1DG1G 4RD6A 1Q81D 1F60A 3WBKA 4J0QA 2YWFA 5FA6A 4PGOA 3E1YE 3OJXA 1EP1B 3MCAA 1DDIA 1FNMA 3QFCA 4PC2A 2BM0A 1KJZA 4M53A 3B82A 1FRQA 2DEUA 4C0SA 4C43A 2ZITA 2PLFA 1QFZA 1NJID 4WQMA 1ZM4A 1VQ8B 3V76A 3WNCA 1KRHA 4UAJA 1W2BB 3G6EB 3G4SB 3LO8A 4K1XA 1QGAA 4MYTA 1IJEA 2BV3A 1N8RD 1S72B 4LBYA 3MMPA 3CD6B 2QN6A 1JA1A 2VNIA 4R71A 1OB2A 1QVGB 3OZVA 1SM4A 1EFCA 1GJRA 2YWGA 2B7CA 1M90D 1KC8D 4RD3A 1YJWB 2VZLA 1G7CA 1JJ2B 1WDTA 1EWYA 3VO2A 1VQOB 4U9UA 1M1KD 3PENA 3CCEB 5EMNA 4QFMA 2QA4B 1F20A 2CNDA 4Y9UA 3W2IA 4BPRA 1GAWA 2VNKA 1KK3A 3CC7B 4B44A 1HA3A 1B2RA 3OZWA 1R5BA 1H85A 4N3NA 2BGIA 1BQEA 1N0VC 3B8HA 2YWHA 4RCZA 1JA0A 3WYAA 1GVHA 1D8TA 4LC0A 1YHQB 1VQ7B 3CPWB 1ZM9A 2BMWA 3E20A 1ZUNB 1FRNA 1JB9A 1D2EA 1JNYA 1R5OA 4FN5A 2B5OA 3OW2B 2HMAA 3AVWA 2NPFA 3U2QA 1H42A 1KD1D 3OZUA 4IW3B 3FPKA 1NDHA 3QFRA 1FNCA 3WNBA 4TMZA 1XB2A 1XE1A 1VQ4B 4LBVA 3LYUA 4H9GA 2EIXA 4P3YA 3VMFA 3I56B 4YHBA 1EP2B 1AMOA 2OK8A 2CRVA 1IB0A 2OTJB 1DARA 4F7DA 3B78A 3W2FA 1QFJA 3VNUA 1VQ6B 3SJZA 3ES9A 1R5NA 3CCVB 1BX0A 4RD0A 3CMAB 5DSZA 1YJ9B 1KTVA 1VQ5B 4M1KA 2GPJA 4PC7A 4M4SA 3JQRA 4ZCMA 2EFGA 1GR1A 1S0UA 4Y7CA 1TUIA 3CCLB 3LVBA 4TMXA 1Q86D 2XNJA 2YWEA 3MHPA 2D74A 1J9ZA 3CCJB 1K9MD 4YALA 4LBWA 4TMVA 1W87A 3A1FA 1K8AD 4TN1A 4Q7JB 4FK8A 1TLLA 1Q7YD 4B3XA 1YITB 4YAOA 1CNFA 2X3UA 2DCUA 4PC1A 4Y9RA 3CC4B 3CRZA 1EFUA 4B47A
chains in the Genus database with same CATH superfamily
1FVHA 4A1FA 5I01A 4GX2A 4MUMA 1ZD1A 5DNDA 1KIAA 2X5NA 1RQRA 5L3ZA 3R0XA 1T4BA 1YA8A 4UEJA 2R6FA 1YQTA 2AOTA 3B9BA 4OHMA 5C1DA 3R6GA 4O3MA 1JQAA 4EKYA 4IMJB 2GJ9A 4KFSA 2ARKA 4MW4A 1XVUA 5FEUA 1Q50A 2QGFA 4F3NA 4RVGA 3EJWA 1SC3A 2UYOA 4BEBA 5KOHB 3PFGA 4IUBS 1H4VB 3SHVA 1IVYA 1C3VA 2QTZA 1E2LA 3HYTA 4IFBA 3NTLA 3LQKA 1R6DA 1B8OA 2I6SA 2W2VA 3ESDA 3IURA 3SNKA 4E5UA 4L22A 3CZ5A 2PSHA 3NVAA 1CY7A 2ZCUA 2JLWA 2Y05A 1P72A 1Q0HA 1UEJA 3AHDA 2RH8A 4FEGA 4D9MA 3WKCA 4BGIA 2OD2A 4DNOA 4BWYA 1U0HC 2XVZA 4XAQA 2CLOB 2AOTB 4D4JA 1TMKA 4EG0A 4MDHA 4F21A 3RYCB 1VCIA 2BFEB 2DFPA 1I3MA 3FCCA 4TTPA 5EJ8A 1G2PA 2FP4A 4KAXA 1PF7E 1TO6A 4XWWA 2RGXA 1CHNA 2EKDA 2RHHA 3LK6A 1TAQA 2CLLB 2QL9A 3MWDA 4MVXA 5EE5B 3K70C 2GFQA 2WWFA 2YY7A 1B14A 3F78A 3IAM6 1RDFA 2AEEA 1LS6A 3PPVA 1ETHA 3HFRA 5KSPA 5HSGA 5KJ1A 3QWAA 1JU3A 1SCAA 4GF5A 1YR8A 3DDHA 4W9RA 2GHTA 4CI0B 1AU9A 2I1VB 3DD5A 4BEWA 4M0FA 3PA2A 1IZ9A 3TDMA 4E11A 1O8CA 4B5LA 1MB2A 4GPEA 1AVTA 2P3OA 2WU0A 3EXFB 4TSRA 3T4EA 3WGKA 4CMIB 3JZAA 4WXPA 4CZ2A 3D3QA 3SIWA 4TLBA 3IQZA 1F6DA 1FP6A 2X42A 1DAOA 4OB8A 3AH8A 6CHYA 1FXUA 5JOQA 1M2VB 4B48A 2BFPA 2H8KA 4D92A 4FLMA 1OPXA 1LJLA 1ZITA 2PUAA 1VIYA 1YI2B 4KQ6A 3EXIA 3NJRA 2PUDA 3L84A 3KLMX 4J7UA 2P3QA 1B0ZA 3W8NA 3A04A 1AZWA 1ICIA 2E48A 3JQCA 2HU5A 4GD3Q 3M8KA 4BNNA 5IABA 2W43A 1LEHA 3FFTA 4RH1A 3OQVA 2EERA 3DFUA 4DUZB 3BBPA 3GEHA 4YP7A 2OY0A 3AWIA 3K4PA 3GFSA 2DHCA 1AMUA 5F9FA 1Z38A 1NBEA 3FDJA 2ZPUA 4ZOCA 1S7CA 3LWBA 5IVPA 1P1IA 1T3GA 1YKSA 4KUEA 1TQ4A 1VLZA 2BISA 3KSRA 4ZALA 3RC7A 2QXTA 2GVDC 3CB4A 2R87A 1YJNB 2GEUA 2X3FA 2UYCA 4JCOA 2QX7A 3GGCA 3C85A 1NLFA 1RLTA 3AVXA 3OCJA 4MWBA 2QV7A 3J7AC 1B7GO 4NEQA 4J8PA 3A9SA 1PR6A 3I92A 5A4MS 5JR3A 4RTNA 3VOBA 4XWAA 4NYJQ 3RVRA 3TJMA 4Z2AA 3WHIA 1L5OA 1RCTE 2I2BA 4ILKA 5I7VA 2HEIA 2C7RA 4ZQFA 3FIJA 2ZYDA 3LF1A 4UZSA 4LHWA 2NZUG 2Q0HA 5H16A 3BIFA 4PN7A 1QKKA 3AUKA 4EELA 4YMUA 3RLFA 4IS2A 3A8KA 3PI7A 4OHBA 3VR2D 2X1LA 3PU6A 1C1DA 1XP8A 1XEAA 3C0KA 5CLHA 4C4PA 1KY3A 2UZ4A 3PNSA 3JU3A 3M2TA 5I4IA 3MWYW 3KG2A 2I3ZA 3EZNA 4X0CA 3FM9A 1JYEA 4RHFA 4N3GA 1I7PA 2G76A 4JQOA 3WLJA 5JS1A 4YX9A 2R7MA 5AJZA 3JV7A 4D3DA 2EW1A 2GASA 3JATA 3OLVA 4HAXA 4MROA 4AUNA 4HNSA 1W19A 2NU9A 4PM4A 4KITB 2ZXHA 3DMTC 2IT1A 1IY0A 1Y37A 3AM5A 3FUWA 2H06A 3HBAA 3UCFA 5B7PA 2O5CA 2VF7A 1NBIA 1WRBA 1NSTA 5HXBA 2XTAA 1D7AA 4HDRA 4HDOB 4RACA 3R6JA 1LF5A 2YV4A 1JFVA 4WLUA 1ZU4A 3IP9A 1UPTA 4IEIA 3TH5A 3PVDA 2P9GA 4ZMSA 4XASA 2EX0A 4D5GA 1Y9DA 1SRRA 5ALTA 1PV1A 1CUVA 5AMXA 1OI4A 3GVHA 3C5WP 1L6RA 4PONA 3UKOA 3ZN2A 4OBWA 2HYDA 1NE7A 4K9RA 5CFMA 2G40A 4EBBA 4WFQA 4WZKA 3RREA 3W5CA 4DM3A 5DNAA 1ZI9A 2YWBA 1S2GA 1NT4A 5AVSA 3REQB 5LJIA 4KBFA 1W2GA 2VTBA 3X1WA 3BE4A 1YGYA 5FWAA 4N41A 5DLEA 3K4HA 1STOA 4RDIA 4AMBA 3H87A 1OAAA 2FOLA 3DBRA 3KT6A 4KLAA 1E5LA 1YQEA 5IVIA 3SXUB 3ZIAD 4DR1B 3BDVA 1M5TA 3OPMA 3ZIUA 4Q18A 1I36A 3ZY5A 1QGED 1VA5A 2P3SA 3CKKA 3T7TA 1G5PA 3LECA 4BMSA 4CTJA 4RE5A 4GM4A 2ERYA 4DJFC 4IDQA 5JCZA 2YW9A 4BTEA 3R9WA 1D5CA 1L5QA 4RCYA 10MHA 2DYIA 2TMGA 3R7FA 3GUUA 1JG7A 4BAGA 4OD0A 1SVNA 2BGNA 2VYNA 1I80A 3HDYA 2F3RA 4PAOA 5F76A 2WG2A 2ONZA 3VNRA 2WW8A 2MOKA 3A25A 4ZOLA 1MX5A 2IRWA 4DRZA 2V1XA 3MT9A 5LR6A 2PX3A 4OU5A 5FPYA 3IQEA 2JRCA 1Y1RA 3PG5A 5ARCA 3F90A 3EGWA 2XRYA 5HZBA 1VQ1A 4G0OA 4DA4A 3W2TA 4KMOA 3ZE1B 1QHNA 2ZZMA 2W5UA 5IYRA 3IS3A 4MA4A 5TV2A 1ZD9A 5AKHA 5LYYA 3T5DA 3BM5A 5ALSA 2AFIB 1U2QA 5CM8B 1A1SA 3D6FA 3E5NA 3THWB 1YONA 2IEBA 3MTJA 2A59A 3JU4A 4FZRA 5JI3E 2Z5LA 5C8YF 3CO5A 4JIGA 4R2HA 5GTDA 4JI5B 4OFWA 3ICQB 5CA1A 4M1YA 3HO6A 4E6EA 4MH0R 1CJVC 5CB4A 5KTYA 3G0OA 2R00C 4C0BA 4DVJA 4D44A 1DWOA 3NHMA 2OO7A 1WXDA 3K2EA 4GW3A 2PRZA 3L8HA 1MV5A 2EYQA 3ADPA 1YBHA 4Y9SA 2WD7B 2GK3A 1J4AA 4W1PA 1EAMA 1WSBA 2BAGA 2FPLA 4XYMA 2QJOA 3AHHA 1GG5A 2JFVA 1BFDA 2WHRA 3IALA 4XGQA 2J9GA 3SQOA 5DBIA 2PWBA 2O05A 3U81A 5LZ4A 2NOAA 1UAYA 1GQQA 3MFYA 4IDGA 3BMNB 4X20B 5DMXA 1AQJA 2R84A 3K09A 1N2ZA 1KNXA 1M73E 2FW7A 2YV1A 2ZUSA 4J03A 3H5AA 3ZQUA 3J81A 1DIOB 1BDMA 5ELLA 3QKRA 3WV5A 1ML4A 3SEJA 1MT0A 2I9PA 3UFXA 1RJEA 4GLFA 3U26A 4K6KA 3GFBA 4S1NA 2GEKA 1DQPA 2VQ3A 3EDCA 1WY7A 1VJ0A 2C8VA 3RARA 4JROA 1I7LA 3CEJA 1VQ8B 1YH3A 3QYFA 4PGFA 4UOQA 3SDBA 1TO1E 4GGMX 5IJ0A 2I55A 1ZGGA 3OQJA 3L8GA 5DM0A 5SZKB 1DIBA 3NHPA 3IUSA 4W9NC 5D00A 1FPMA 3EZXA 1JQEA 4OJKA 5L8VA 1O6ZA 1FDSA 2JLCA 3LCCA 3OO0A 4FZ5A 4I9FA 1L5WA 5EPOA 5BMVB 3KXPA 3OIUA 5MHTA 3B20A 5C34B 4BNDA 1UQRA 2XZTA 3GRUA 5DSTA 5ITWA 1VPLA 2BBOA 2HRQA 3KLBA 4FW8A 4KDCA 3SC6A 2X5KO 4MXDA 4KWCA 1QIJA 3F3MA 2ZXEA 3QMWA 2UV8A 1JSCA 3K1AA 4QQFA 1KWKA 2FX2A 3JWHA 5REQB 3WJAA 3H2JA 2AX3A 2OB2A 3F4LA 4FFRA 2YICA 2GA8A 3RC2A 1T2FA 2JK1A 1Z16A 2CNWA 2J3EA 3G59A 1P61B 2B0CA 2VFAA 3KT8A 2HF9A 1HQCA 3OOHA 3RNOA 3MMPA 2YYSA 4N8SA 1CQJA 3TDNA 3KBBA 4NX2A 2QOEA 3RVJA 3MZ0A 3PUWA 3WNQA 5JNLA 3MD0A 2HA2A 3QW2A 4OH7A 3G5AA 5GADl 4FBLA 4WK0B 1G3RA 2REQB 4JC5A 2HHHB 2GCOA 5CUQA 4B17A 3TXAA 4ND7A 2WAOA 5IF3A 1P6UA 1PIWA 3DDCA 3E1SA 3ZH2A 3FWZA 3QE0A 3V8BA 1C2YA 1G2QA 2ZI4A 2GZSA 3H83A 3QV2A 4K9MA 5IUJC 2BYTA 3HI4A 2O8BB 3FFBA 3NTOA 1KC8D 2ZBRA 3CLKA 4RD3A 3PWSA 1G9SA 3VC7A 3RAFC 3W3ZB 3L7CA 3K94A 4B8ZA 4XUGB 3RFCA 1WDTA 1FJHA 2QRVB 4N6GA 1KI1A 1KU0A 4FUTA 4PPGA 1QZUA 3KOZA 1XRSB 1OIVA 3FKQA 1CJUC 5EJMA 2ZDGA 4PQRA 1U7OA 3OQIB 4JP5A 3RJ9A 3U4HA 4YMVA 2DOKA 3RB8A 6REQB 4TQUS 1O57A 3NNDA 1POXA 1VRVA 1QF9A 2E5FA 3JYPA 5I7FA 1TK2A 4XD7D 1XCPA 2A9JA 3I3OA 4BFUA 4F5EA 1ATZA 3STUA 3OP1A 2ZL7A 1GRRA 1Z13A 4N49A 3U4CA 3CX6A 3N28A 2CV1A 1MB9A 3PE3A 3BCHA 4N9QA 3RFTA 5KQGA 2K2QB 2BT4A 4CQLB 4JJIA 1LD3A 4IJVA 1JHMA 2GO1A 3B1YA 4HNGA 3KUXA 1BQEA 1KJ9A 1NB9A 3EDYA 2W4MA 3WWOA 1GZVA 1KPGA 4MULA 4MRAA 5KWJA 1ZK2A 2IITA 4FFBA 5BWMA 3H11B 3BJRA 4IILA 1T4CB 4FI3F 4WKCA 2WKRA 3MFQA 5HVNA 3HZHA 1HOXA 1GVHA 3FWPA 2CXQA 4MQBA 2FK7A 2K7ZA 4Y0NA 1DPGA 1L9KA 4LNHA 1SBNE 2IIVA 4PF1A 5E6UA 4HJXA 3HY6A 1ZLXA 3AKEA 3N0WA 2X0FA 1YHQB 2OZLB 4MVJF 1ILEA 1CB7A 1YZVA 3KTAB 1ZH8A 1DOAA 4OHUA 3E20A 5KTMA 4GKJB 1HZZA 1ZXLA 3EGDA 5EUMA 3MUEA 3G1TA 4NV1A 4HGRA 4RY2A 1JB9A 5A0FA 5LB4A 2O19A 3OQ6A 5JSKA 4LV8B 4Z1OA 2VHXA 1N7GA 3RUFA 3ZI0A 3ZXUB 1MABB 3U2QA 5J4VA 7YASA 4XE5A 4HWOA 2JKVA 1U9CA 2PXHA 2VO1A 3KAQA 4YXWA 2O7NA 4QEDA 5CLIA 3FNFA 2XAAA 3KZ1E 4FFNA 5JAQA 4AJ4A 2GDZA 4CV2A 1M6EX 3TEMA 4KO4S 3KKEA 4WK2B 1P1FA 1MJHA 1QR6A 2HWUA 1JSZA 2CVOA 3VMFA 4WINA 2Q8PA 4Y6OA 3TD6A 4ZDWA 5LQKA 3SVTA 5KPDA 4YJHA 3CTPA 1GNTA 3DMTA 4BAZA 4J2HA 4R16A 5ENDA 3WVNA 5BNFA 2W6OA 5EIEA 2H57A 4IO1A 3TRIA 3A6GA 5JEDA 1TJ5A 4L16A 3O9VA 2O8FB 1KMNA 2RAUA 1G5HA 1ZNWA 2ESRA 3AY0A 4GLLA 3UWDA 4AVZA 2IHTA 3IOMA 2IEIA 3JPYA 4W4TA 2NNWB 1HH4A 2WF8A 2HO5A 3H9EO 4NJMB 3VYSB 3BSFA 1PR0A 3D1VA 3A1CA 3ITNA 4U00A 1KDVA 1LPOA 1C7ZA 1OKKD 1MA3A 3QUBA 4NOKA 4UPVA 3G2MA 1H4SA 2Q6VA 4IIGA 3RADC 2F3SA 3KOOA 2JVIA 2HWXA 4R7TA 4K3VA 4PLFA 4FFBB 4PC7A 2X8BA 3FJ1A 5EP4A 1N8TA 3PITA 5KW9A 2YHIA 2BI4A 4NJEA 2CFIA 4A0RA 5CDHA 3OZSA 5JBIA 1GR1A 1KIFA 2IHKA 5C2JB 5F9MA 1UBOS 1FL9A 1UINA 2WICA 2HAEA 1S3IA 2AMFA 3BH7A 3R3XA 4KFRA 3WGNA 1ZJYA 1XK7A 2FN3A 2OXCA 5GZ3A 2RGGA 3GAFA 1JFSA 5B55A 1CTQA 1GAEO 1OILA 4BNLA 4CMJA 3MPOA 2J9RA 1IULA 4ME6A 3SU8A 1PL7A 1P9OA 1UC9A 1EWRA 2F3QA 2SKCA 2ZI3A 1C4OA 1E92A 3ZIDA 4E5NA 4P32A 3T61A 3V1TC 5D3MA 4Z9YA 1DRVA 2SICE 4NE2A 1UBMS 9LDTA 1UK9A 4LBWA 3ZDBA 1IK4A 1SZJG 3HLYA 4EJ2A 3VR3D 2QLLA 4R1QA 4F9FA 2PVSA 5LBUA 1R0XA 5ALHA 2QP3A 4HQRA 4OQDA 4MQ4A 4IHJB 1OJLA 3AUJB 5FWYB 1I3CA 4E5KA 2TMKA 5B3KA 3QX9A 5CIQA 2A5FA 2O59A 1WDMA 1KVTA 1CEYA 1UFVA 3ZNPA 3KD3A 4N7RA 4B8WA 4ZOBA 4MVJE 3TW0A 1NPTO 5DN6D 3GDOA 2PX2A 1E6UA 1TCUA 3G9QA 5TGDA 1XUOA 2NYUA 3KPJA 3O8RA 3P9RA 4GPBA 2WNSA 1QKIA 2V74B 5B3AA 1NXOA 2GCOB 4X3OA 3PGXA 3MN1A 2IOYA 3I5MA 4X7MA 4EW2A 1W5FA 1CERA 3V97A 5K0TA 3EE6A 3LHKA 1SXGA 4FFPA 5AKJA 5ALNA 1MV8A 5HE9A 3UH0A 3CTAA 3KU1A 4BO9A 2PL9A 4Z7NB 3VJKA 4O0MA 2JFXA 1VIAA 3LQQA 1UK8A 4DWVA 2GN2A 2QM0A 4FYYA 1YCFA 4O4HB 4UUOA 4OO3A 3ZJTA 1EGQA 1P2VA 4L9RA 3AFOA 3NIDB 1NN1A 2GQFA 4BCDA 2CUNA 3H5WA 4L73A 1NAHA 2EL7A 4OQPA 4GBJA 1G20B 1BU5A 1Z6YA 4I19A 2BJHA 2H4ZA 4I8IA 3ZC3A 3FRHA 2G6TA 2IE0A 3IKMB 1GT91 3AUSA 4OREX 3GCDA 1DEKA 4GQAA 3I4CA 2O0JA 5CXSA 4EKGA 4QM6A 1GPKA 3DPSA 1G66A 3VZQA 2QF7A 5AIAA 2Y92A 2OBFA 1URPA 4E1BA 2CSXA 3D3KA 4L6IA 1PJZA 4B7AA 3D4OA 3OZDA 4G25A 4DIKA 1J70A 1YE8A 3GU3A 4LIPD 3QKSA 3UMBA 1U0NA 3VH3A 3NHKA 4IXNA 2X2FA 3GHYA 1XJWA 4FCWA 5B2ZA 1FJ2A 3A6ZA 4RO0A 4E2XA 1DT5A 1XTUA 2ZANA 2OAGA 3LA8A 5FXMA 3R77A 1G6KA 3VR6H 2IHYA 3BGDA 2HBQA 4HEQA 3WDLA 3U7FB 2QQFA 3C14C 3H94A 1X42A 1KO7A 4UUNA 3BA1A 4A8PA 4RESA 4DSAA 3ZDCA 2QRMA 1W30A 3PWKA 4Q9JA 4AIRA 3F0TA 2IV2X 1CP2A 2C2ZA 4LZPA 1J1UA 1ICEA 1CT9A 5DBHX 3RVLA 2ZQ5A 3V32A 1V4NA 1GFZA 2NU8A 1INLA 1DO2A 4P53A 1I2MA 3D6HA 1L7PA 3IP7A 1HE5A 5FPPA 3FPJA 5A88A 1XAHA 3B2EA 3LRPA 5AJUA 1A7JA 4IV5A 3ZHOA 1VDMA 3CVXA 3LRTA 1YJAA 4ACAA 2QUZA 5E2BA 5L7WA 2GXSA 1V35A 3TLGB 4I55F 5JPDA 1F0PA 2R4TA 4DG8A 5JECA 3VKHA 4BRZA 4DMRA 2XGJA 2DPGA 1XCLA 1KR5A 3EEBA 4G86A 2R6R1 2CKMA 2PBZA 3TN7A 5DYTA 4A8JB 3BRWD 5DNVA 3FF4A 3NORA 2Q2VA 2V6FA 3NT4A 1D1SA 3H86A 3R5FA 4LQLA 4HN2A 5GJVC 5CFZA 4NPHA 5CLQA 4GHWA 1XZJA 3DOJA 1CWUA 3ASZA 4M9ZA 1BDJA 4OUDA 4R2MA 5ICGA 4Q3EA 3HCFA 4DQKA 3HKBB 2QB5A 2NP7A 2P0EA 3O90A 2LP4Y 2GN8A 4XWYA 1Q0RA 2B1QA 1FUIA 4R1PA 2Q5QA 5K09A 2QXUA 4G85A 4QDXA 4TQ9A 1BXRB 1SU8A 3R0JA 4W8HA 5K8VA 1KQGA 3LHDA 4QXRA 1JQKA 2PX6A 1L1FA 3N7AA 3RVQA 1KXZA 3TL2A 3JQAD 2F1KA 2DOGA 1DAGA 3HVHA 2PH7A 5TS3A 1FFWA 2C5LA 3ESQA 4JJFA 4OMDA 3WTCA 5JMTA 2PT7A 4ZA2A 1E1RA 5JHGB 1XRMA 4OGFA 5EAIA 3ZZ0A 2HPZA 5J2TA 5ALEA 1OFGA 3P4YA 1DC6A 2D3WA 4WAUA 3ONVA 2CLSA 3LT4A 4NJOA 1NNUA 2C77A 1P5JA 2X13A 3KQYA 3Q9NA 1H05A 3NWEA 2I9KA 2RHJA 5KYGA 1NDQA 3D8RA 4PSUA 3GROA 2JB9A 4UHKA 3GGSA 1MZVA 4NIMA 4QOFA 5TC4A 3R7LA 2JGEA 3U3ZA 1XGKA 1GILA 4EA8A 5KYWA 2W6ID 3OSUA 1NOKA 1Y9EA 3QYPA 3CPEA 4KHPB 2XVYA 2XODA 1A9QA 3ANTA 4HWTA 1E43A 4B4OA 4TLAA 3MIIA 3F2IA 1PYGA 5IHPA 4NY1A 3WXMA 4YAJA 3S2YA 1L0BA 2FETA 2V59A 1OC2A 2HXSA 3AETB 4QUKA 3VVCA 1QQ6A 1KVSA 1XCJA 1UP6A 5EERA 3WE7A 3AYZB 1F8YA 2HLDA 3E0XA 1EI9A 3NRBA 1ESZA 2DPMA 3LVRE 3NC4A 2R751 4J0DA 4JP3A 4URZR 5JS6A 1SUFA 2PWAA 1GY8A 3IVGA 3DE3X 1USUA 4QXQA 1MTZA 2GBGA 4BNGA 1Z74A 4TRMA 4AYTA 3BQNB 3G0DA 4BNZA 3A4IA 5IXSA 4FKMA 1DHTA 1TI7A 4PIPA 1N8NA 1UWCA 2FEWB 3TOVA 3HDGA 2X0DA 1A8SA 4XGNA 1VCNA 5KNDH 2H1LA 1D3AA 2BUBA 3ETHA 4ZRMA 4YCMA 1E7SA 2ZS7A 4HGQA 2Z6BD 3U0BA 1YASA 3VKUA 2BH2A 4COKA 1G8JA 1P4HA 4RK4A 1N8KA 3AESB 2X58A 3CBQA 3KVRA 2IXFA 4HL6A 3FOFC 1M66A 2AN9A 1A77A 1JKJA 2YYAA 5K0NA 1RJ9B 3E6AA 1QQ7A 2XD9A 2X9NA 2CZQA 4IZ6A 1KZHA 1K8ZB 2BHSA 2PKEA 3EA0A 4KGDA 5EI5A 4X1YB 3EQ6A 3ME5A 3OT4A 4V3CA 1GO2A 2UZ1B 4IDHA 1SNYA 1Z6TA 2PD4A 3QBTA 3QTBA 5KC8A 1MFZA 2VTEA 4RENA 3BZBA 4OK5A 4YRZA 1DO0A 3VXKA 4PGGA 3KPYA 4UARA 1Y0YA 1U80A 4YUYA 5CB0A 2OZPA 4X92A 2HMWA 4H7KA 3DOUA 1QMPA 2ZIAA 4WBNB 2FFRA 1GP2A 1U7XA 2QIPA 3KSMA 4JC0A 4PSAA 3TJZA 2W42A 3OX4A 2PUHA 3IBCA 3D6JA 3V00A 4BFYA 4XDHA 4AWBA 2Y66A 5AVTA 3T94A 4FOOA 4RVHA 5T4FA 1OWNA 4TRNA 1LFDB 3WNDA 3DE0X 1JFFB 1KQOA 3A3YA 4Z0PA 4MAFA 1SGWA 1RACA 2NXEA 3A1VA 1RXEA 3K9CA 3MERA 4IEEA 3JYQA 1FYEA 2XQKA 4I55B 3GVPA 4O5OA 4RY8A 4YRFA 4L3OA 5B58C 2R00A 5CYGA 3OQBA 3BFPA 2O5EA 4WADA 4P25A 2CJYA 4D9HA 3T3NA 1DLJA 2PUJA 4X44A 1X0VA 1NY6A 1UPCA 4MARA 4P5EA 2E6KA 1XMPA 3ZBTA 1CUJA 3UJ8A 4B6PA 4EJSC 4B3TB 1NP7A 2Z83A 2A67A 3D3WB 2C95A 3KZXA 4GC5A 4HNRA 4U7WA 1MOPA 2NM0A 2WK1A 2HJGA 4HQ0A 4AJEA 4BV3A 4F60A 2EYUA 1Q81D 1OA0A 1R4MA 1RWBA 3PT5A 4TKVB 4FI3C 2RGRA 3OF3A 3GLVA 1ZH2A 3PV0A 1NF2A 2JZOA 3CUVA 1BKDR 1K6EA 3IMKA 2WQ7A 1U3UA 3BN3A 2ZJAA 3DCYA 5JCOA 3ASTA 4EECA 1KI6A 2FEOA 2FW1A 3C41J 3EIOA 4F3RA 4PC2A 2Z0MA 1YCHA 1HDXA 2HJ9A 2E7ZA 2R86A 3HXOA 1TF7A 3SWWA 1TVEA 4HMPA 3JZDA 4V39A 3NYWA 4WA7A 4WL0A 4ALKA 4DCGA 3KU4A 1YULA 4L4SA 1SH7A 2A5YB 3GJ3A 1LRJA 3GJRA 4IQGA 2E4AA 1O95C 4I1RA 3QA3E 5AXCA 4O0LA 1KJNA 1GQYA 1ZCFA 2WYRA 1M1NA 2HNBA 4AJOA 4B7UA 2EKPA 1XIVA 4MVJG 1NVBA 2VRCA 1PWXA 2PJUA 5L3SA 5LP6F 2UYHA 3UWOA 1XZCA 4P8RA 4Q4AB 3BCFA 2D1QA 4CKZA 2ZSUA 3F6YA 3JQGB 1ECCA 1UQTA 3TW8A 3DVLA 3DUFB 4HN9A 3R7WA 3ETCA 4LOKA 2EWVA 3HJFA 1BYUA 2G7ZA 2DUMA 1U2DA 2JEZA 4EO4A 1QYXA 2Y1XA 2QQ0A 3TW6A 2KYRA 1SK9A 4DIBA 3RRFA 3MQFA 1ZNZA 3ICVA 5BUQA 2ZTUA 3U4IA 3VISA 4Q3KA 1KF0A 4G23A 1ZUD1 4LY0A 3MS7A 4OMUA 1FOEB 4AK9A 5D7BA 2YV2A 3UGTA 5KWSA 4YMHA 3FB1A 1RYNA 3CXUA 3E7WA 4LBYA 4F4JA 3TECE 2EQAA 2NSLA 3PHLA 5JXWA 1MW8X 1PDWA 2J6CA 2YW2A 3BQJA 3RBVA 1PT6A 1PQ4A 4MW1A 1EWQA 3LP5A 3C3PA 4H18A 2E0IA 3WHPA 1T1GA 1T5OA 3CZAA 3ZE2B 4BMPB 1CZKA 2XRZA 2QBYA 5EHGA 3RSHA 5JZOA 3CH7A 2SKEA 4DEYA 2D7CA 1KP3A 1RPZA 1SM4A 1T8SA 7ADHA 3EFHA 4EVIA 1EVQA 3UJNA 2VDVE 2LD4A 4I4NA 3DFFA 2PUWA 3M70A 4P4SA 1WVMA 3BFVA 2G1UA 2A0WA 4OF4A 4DCSA 2ZRQA 5FOUA 1DC3A 3RYIA 2G63A 3BXOA 4PX3A 1T3TA 3AR5A 2GPWA 3B5IA 1AUOA 2PH1A 1N9GB 1NKVA 2ZFUA 3ECCA 3NCHA 4F96A 3KQHA 2EJCA 3AIMA 4P83A 3S2IA 2CHUA 5T8KC 2V31A 4TXLA 3VPCA 3WL8A 4KE9A 5LN1A 4GBGA 4LVOA 3FR7A 1QDLB 3E81A 3O3NB 2GS9A 2ONYA 3EPKA 4FOTA 4B81A 5A5GA 5BT8A 2ZTNA 1VP9A 4IJQA 1RLIA 4LECA 4H31A 4CMKA 1QF6A 4I9HA 4OV6B 2GK6A 3C74A 4JC4A 1HA3A 3QTTA 1ZYUA 4O4HF 1R5BA 3KJZA 5B1SA 1JEQB 3DS8A 5AVKA 4ZVMA 3EODA 5ALYA 2FDCA 2NYRA 2FN4A 4OXKA 1XKXA 3ZHXA 4IIXA 1YUMA 5IDWA 2CXUA 3BSWA 4ND8B 3ZU4A 2WYIA 4FZVA 1M1XB 3BEOA 4FDAA 5AHXA 1U94A 3LKDA 4MP8A 1SD2A 3G17A 3HYCA 4KKSA 1EDEA 4ARBA 1JAIA 1W0JD 2ZE7A 4LTMA 2YIJA 1WZUA 2NUTA 3NWJA 3LWNA 4P35A 5HOEA 1G59A 5K3FA 2JFGA 3EGVA 3DMHA 2PSDA 2QVYX 3GGJA 4KFUA 2YYYA 5LQCA 3RY8A 1KDYA 1L7OA 3AHJA 2QAGC 4BCCA 2V6MA 4HDKA 1TQ2A 4IL5A 1J00A 1J1ZA 1DOHA 4QDKA 5LBTA 1EX9A 4RW0A 2XDQB 4UHBA 5CVCA 3VTFA 2UYQA 1R5OA 4GI7A 4EGCB 4HGZA 1CDDA 5A06A 2JLUA 4P31A 1TDJA 3ZHRA 3QIAA 2D1TA 4Z6KA 6REQA 1FUKA 1P2BA 1C0KA 1H42A 4H6PA 3U7EB 2JFHA 2UUOA 1ZVJA 2DBYA 3GRAA 2JI8A 4CGZA 2BFWA 4FHFA 1RC1A 1Z18A 3V8RA 3G2PA 3CX8A 1A50B 2XMSA 4A1OA 1BDHA 2FDXA 1CRWG 1R6XA 2MSKA 3S1AA 3ZLBA 3RG8A 4HDQB 1YTLA 1H8ED 4PLPA 1F2TA 1V8PA 4EDHA 3WNBA 4MVJA 4PLZA 4RK6A 4DXHA 4PBSA 2Y71A 5B4UA 1VCHA 5DCWA 2HV8A 1ISSA 2IHZA 3RAGA 2GPYA 2IEYA 1HTBA 2H4YA 4UQOA 3KZMA 1KO5A 2KMLA 3L6DA 3I2KA 2OV8A 5IAJA 3BTUA 1J20A 1F6WA 2O3TA 3CLRD 3NDPA 1N1EA 3O91A 5FORA 3PTZA 2W2QA 4FYHA 5I7RA 3D7LA 2C9MA 4TVOA 2B4QA 1SG9A 1WABA 4RLZA 1EFLA 1Z2PX 4F97A 2WWXA 2X0KA 4YLYA 3RLIA 1ARZA 1Y89A 1LPAB 3IH5A 4OU4A 2WSBA 2IJGX 1AKYA 4MYHA 3RU9A 1X8LA 2B83A 4QQ8A 5E4JA 4XB6B 2J0VA 4WIAA 3TAUA 3DUFA 1J8DA 2AL7A 3FRJA 4NPAA 1SVLA 2GM3A 2BCEA 2LCQA 3PUYA 2JLQA 1T9GS 2YMMA 5EJGA 3BZUA 4B3RB 1KTVA 5C5CA 3AIOA 5E1OA 5KKCA 5T64A 3NZEA 1NONA 3WDKA 4GXTA 4BHTA 2VJPA 5GONF 3SLKA 3I5UA 3TIGA 1ACMA 1PD0A 2OBMA 3S40A 3UA4A 2OYSA 9MHTA 2DQYA 3CCLB 4GQBA 1SCBA 3WGOA 3AUXA 1R3UA 4KIUA 4HWSA 4MYSA 2Q4RA 1A4IA 1Z0SA 2HNAA 3OM9A 5MN5A 1M9NA 3C97A 3CF0A 3NHLA 4QUJA 1TFUA 2X14A 1PEAA 3L2OB 2B4TO 4EOGA 3E9NA 4NJMA 2I1LA 4PCAA 1OTHA 1ZUWA 4RAQA 4RKRA 5THQA 3RVDA 4YY3B 1J9ZA 3D6MA 3S2UA 4U1RA 3ROKA 4V0LA 3N9IA 1FFSA 3NHUA 1WZ2A 1GCIA 3IIJA 2JANA 4AKGA 1AXRA 1P9RA 1JH9A 5K0ZA 4TN1A 4WDRA 4LMBA 4BRWA 4J1TA 3D02A 2Y27A 3TW4A 2YHIB 4I36A 1N6PA 3FCEA 4NJEB 1XZBA 4IFTA 1I0ZA 3DUWA 3ZZMA 4BQSA 2FE4A 4M1QA 4M54A 1C5KA 3VKFA 3HADA 5F4ZA 4AP6A 2ZUFA 2WU4A 3H6HA 3NI2A 3WYCA 4F3TA 4PVCA 4LJKA 4YECA 5BR7A 2F1HA 1VC2A 2IU6A 2O2DA 2Z30A 4HXGA 4WXMA 3ZX5A 4LISA 4F9GA 1QFSA 1G42A 4I08A 1KDOA 2WZDA 3SY8A 3DMNA 2DCUA 4PC1A 2YYZA 4AP5A 1NNSA 3R6WA 3MJTA 5FTLA 3GLRA 1O03A 1Z62A 3OIGA 5FQNA 2HK9A 1OYWA 1EFUA 5IT5A 2IPNA 4TPKA 5JNUA 5IN5A 3KJEA 4GL2A 4H27A 3SHFA 3PA8A 3ENQA 3CE9A 1JB1A 1I3KA 3WGZA 5CA1B 5DT9A 7GPBA 4KUHA 1CZNA 3B85A 5JASA 4RJJA 4G01B 3OIWA 4QHYA 1GNLA 1ZO8A 1Q1EA 2D5CA 2H2WA 3OP4A 3RU7A 4C1NA 1Y8CA 4C2BA 1AURA 2EC5A 2OXFA 3JR3A 4FT4A 3FUTA 1VL1A 3T9CA 3LMKA 2PH3A 1MFPA 4WZ6A 5WRFA 4BFVA 1NBOA 4W5NA 5HZGA 1L7DA 3O8LA 2XDAA 3CRVA 5LUBA 1ZWLA 3SF8A 4X05A 1U1CA 2RHGB 1QHHB 3FKJA 3BXFA 4YO8A 2WD8A 5D3KA 5J2UA 1W96A 1AHHA 3L01A 1OFIA 1TD9A 2Y3IA 4H3KB 5JRZA 4HVCA 1BWRA 2NSYA 5E6TA 1ZK0A 1RCFA 3ESRA 1NBWB 3CH4B 5KYUB 4WLEA 4DM4A 2QTVB 4CPDA 1BW9A 1XTPA 2IUTA 2PRIA 2MMCA 1APBA 4CMIA 4E03A 4QOGA 1POWA 3WLQA 4EW1A 1KEKA 4YMWA 4HWRA 4X45A 1GPH1 4FJ1A 3UENA 4PHFA 2P2CA 1HLPA 3M6VA 4EYEA 1OI2A 5DHPA 3VR5H 3WGJA 5EHXA 4H16A 2R6ZA 4TKMA 3WA6A 3G1WA 2O3UA 3UBMA 1SHTX 4M9RA 1XMQB 1KEUA 3IAS6 3KOXA 4KREA 2JL1A 4II3A 4QGGA 4U2DA 5F12A 3BE6A 3KSAC 4CEHB 1U4OA 5DYWA 2Y67A 1YIDA 1RZUA 3AXTA 3PCRB 3CCCA 4K87A 4B7XA 1PTKA 2XQVA 2E4VA 1I0LA 2ACKA 2NX2A 3QYJA 4JA2A 3HUDA 2Z2JA 3UXYA 4C04A 3DAGA 4OLBA 5LYJA 1JDJA 1G8SA 3L1HA 4N47A 3RTAA 4QC2A 5KCMA 4MEAA 1C80A 4OSPA 4HLUA 4MJLA 5ED4A 3O74A 1AXGA 3AP3A 5G02A 5ADVA 4MUBA 4KXNA 1P1HA 3EW9A 5KYWB 3IQHX 1QHYA 1CJSA 1F38A 2Q2NA 4I50F 4RZHA 3DAPA 1UWLA 4KVGA 1I4WA 2WWHA 3TSWA 2A1TR 2FMXA 4WLFA 2O52A 3KE9A 1B15A 1O9GA 5FAKA 2IUUA 2AR0A 1TTTA 1RKQA 4OP3A 5JAMA 3CV3A 1OVGA 2J1LA 1J56A 1T9GR 3AINA 2XB9A 2YCBA 1OYVA 2ZPTX 2WHPA 1F8UA 3R5KA 2CVQA 4BLUA 1W0CA 3ABIA 4YAEA 1YMQA 5DP2A 3QE2A 5EMLA 1C9NA 1K75A 1W2WB 1VQNB 1CZRA 2Y0CA 3HVUA 3N8IA 3VUEA 1NN0A 5J63A 3EXAA 1LH0A 4DJAA 5C7IO 3WGUA 1GKLA 3GRKA 4LHZA 2AOWA 4J90A 5ELMA 1ZOLA 1IY9A 4AWAA 4G1FA 1PLJA 2HSEA 4YCJA 4RJLA 2IGTA 3E3LA 3RSSA 3TCNA 4DMGA 1HE8B 3MUOA 3GEDA 4HDSA 4EP1A 2JHFA 1GQRA 4DR5B 1PG0A 1GAQA 1KORA 3N2LA 2CF5A 1SUIA 4LV5B 3RKSA 4BUJA 4RTOA 4MMZB 4RULA 2ZYIA 3SZMA 3GR6A 4FFWA 1E0SA 2YOFA 3ZGNA 5FUBA 4AN0A 1R5JA 4W7HA 5C5EA 4RTJA 2IYNA 1DSSG 4TLCA 3WLEA 5IMSA 1YSCA 1B93A 2A7QA 2VTDA 3L40A 4EQZA 3D5EA 3SZGA 1T3LA 2ACWA 3NM5A 3L05A 4Y6SA 1EP3B 5FBHA 1PFGA 4FONA 2OK7A 2OLKA 2F59A 2XZLA 4RHUA 5G2OA 1P0FA 3D1JA 5C8YB 5L6LB 1GZ4A 2I4MA 1TB4A 2GYVA 4B9EA 3LS2A 2FZLA 5BY2A 9ABPA 4G1CA 1UANA 3WLFA 3WXBA 1G7TA 1J97A 2PMDA 1P4JA 1ZD4A 5HFAA 4TYNA 4B4VA 3EAQA 4WHMA 1PL0A 4M60A 1UZNA 2F1LA 3UIEA 3H3XA 2VF8A 1IQPA 3HKCA 3CT4A 1G3IA 2ZYAA 5KQMA 2Y8EA 4OKNA 2ONCA 4YJ2A 1TA0A 1PR3A 4KEAA 4AS2A 4BV8A 5JWRA 4LMPA 1M67A 2QM3A 3H4TA 3HCBA 2NPIA 5JD3A 4UTPA 2FPOA 2W0MA 4HUJA 1EUZA 3D2BA 1RPTA 3TZQA 1MABA 4OI1A 1EFRD 3O8CA 3EC1A 5DYIA 1NT2A 5E4YA 4MP6A 1P7PA 1UBTS 4Z7OB 4V1CB 1U3WA 2R97A 1G7RA 3B1JA 3LZ6A 4OQYA 1EVLA 1R7RA 4C4SA 4GX1A 4IUCS 5FOQA 4WNYA 1OMOA 1D4FA 3LVQE 4UZFA 4ZGNB 5EHIA 4AXXA 3G79A 1IN4A 4WH0A 3IR6A 2AIRA 2WHYA 4LOJA 3CUUA 3S7TA 4G5GA 2BJVA 2R7AA 4IJWA 5ALWA 2BR5A 1H9CA 3RIGA 1M72A 1RKVA 4GPD1 4I9UA 1IATA 3ZWMA 2HGZA 2H4FA 2W6JA 1I0IA 4O4JA 3ZJ4A 4BUCA 2J5XA 1CIJA 1EB9A 2C2YA 2OVFA 3HYRA 2VJKA 4TL9A 5GGXA 2GD6A 3B1VA 2OBLA 3RIXA 3WLRA 4LDQA 4YMLA 4L0MA 1CKEA 3FPSA 4UNQA 5FUXA 1QVRA 3QVVA 5LP1A 1H2EA 4WZTA 4HQFA 2H5EA 4J7CA 2Q1WA 2H5JA 4IOKA 1NJSA 4DLLA 4M99A 4AF6A 2F55A 1QRUA 3I28A 5K8UA 5CITA 2BFDB 1M0SA 2CNBA 3WLMA 2DR0A 4DV6B 5GM1A 1P91A 1LNSA 1DQYA 1L4HA 4OK3A 1QFYA 3GOHA 3IJ5A 4KYTA 1ZU5A 4Q7KA 5IEJA 3AVVA 2VYVD 3PYLA 4D0RA 4LZZA 5DW3A 1B1AA 2BGKA 1TUGA 2DUJA 1FX0B 4G0QA 1JIQA 5HF8A 3GK3A 1EK0A 4RIHA 3UGKA 1NSFA 2BFCB 3LBYA 4OPOA 1JYFA 4FXOA 3Q7IA 3ESAA 2BFEA 4JI3B 3NNSA 5HEKA 3BC9A 3R9XB 3LJKA 1GU0A 2ZRHA 4GMXA 4U5QA 2F62A 2HD4A 1ZJ6A 3PR2B 2OPHA 3SE0A 2XUIA 3BRQA 3PDIB 2JBHA 2Q4DA 5I9IA 3TFOA 1KFCB 2C1EA 4ZV7A 5HZMA 3OX1A 2UDPA 3K0AB 5FUQA 1EQAA 4JT8A 3GEPA 4K6GA 4Q6WA 1KFJB 2VT3A 4F7WA 1NQUA 1WV1A 1JJBA 3EZ9A 2WPDD 1RLUA 4XX0A 3T5TA 4HGNA 4M53A 4N3AA 5M5BA 3I0ZA 4XFDA 3EFEA 3ZE8A 4L27A 5AP9A 2X8WA 1Z0KA 5DHTA 2OHVA 4LNAA 2BGMA 3O8OB 4NZOA 1EUQA 2D54A 4D0LB 3SP1A 3BWEA 3SGLA 5JALA 3DA8A 1R4MB 3NXKA 3TIFA 2C5GA 1A8UA 2Y9PB 4Y6LA 2H2DA 4R0NA 3DONA 1J0AA 5JCJA 4QVIA 2X6TA 1IK6A 3RSZA 1EK5A 1U1IA 2ZT6A 3QLUC 2HF8A 1Q1NA 2Y4NA 3GL9A 3H9BA 1E2NA 4QUEA 4UC0A 3UJ7A 2FLKA 3NJ8A 3CLUD 1PI3A 2PBRA 3I64A 1F6BA 3DR3A 5D3ZA 3CX4A 4Z4ZA 3L1VA 2FN9A 4OATA 2DGDA 2CDBA 3DOHA 4PZEA 2WJPA 3VPHA 5FI0B 4DQXA 5CEJA 1ZONA 1ZW6A 3A2MA 1LJ8A 2ZB8A 1V7QA 4EIWA 4D4IA 5LMZA 2RG7A 3JARA 5CB8A 3HNRA 5MDHA 1YRYE 1V3UA 4R7GA 4CR8A 4FEEA 1QGAA 3E9MA 1NBHA 3BULA 3VYTB 1W8IA 3B89A 2HNKA 3KCQA 5CAEB 3VU1A 3W5IA 2C94A 2HV9A 5AXBA 3U7QA 4PRKA 5CVUA 5TLSA 4Q15A 1GZUA 3O4FA 1W73A 4LCEA 2FRDA 1GQSA 2C4VA 4MEJA 5DI9A 3RD5A 4DLNA 1GGJA 2IPXA 3EFBA 4XWKA 1F2UB 3KL2A 2Q5JA 5D5HA 2YNMC 1UKBA 3HXTA 4X24A 4DIMA 2NAPA 2GJSA 4CF7A 5IC4A 1QVGB 3P9YA 3BUSA 4M7PA 3TGPA 4RSGA 5HUQA 2GAOA 1N07A 2QVCA 4LOIA 3BRSA 4ZCSA 4BVKA 2XMDA 3EZ6A 3WWZA 2PL5A 5LLSA 1UJ4A 4MI9A 3W8EA 3B51X 4XVCA 2YQ5A 1L5RA 3ROEA 1U3FA 2BTQA 4H1TA 1OLXB 4HLUC 2Q3BA 1XNQB 3CC8A 2IP1A 4J2TA 3WLIA 1GSAA 1KDPA 2P0AA 1FTGA 1LDBA 3HA5A 1QTRA 1T1JA 2Y68A 4JFRA 1AGYA 7AT1A 3F47A 3HHPA 3SQDA 4X41A 3DJYA 3IAFA 4Y2HA 2WUEA 4NBVA 1PNRA 5AM5A 2JLYA 2WIDA 4PHCA 3N86A 3I6ZA 1GHTA 1LB1B 2P2NA 4N39A 4DR3B 1JJIA 1SCKA 2OBSA 3WK7A 3HA2A 1JIUA 2PGJA 1EE2A 3F8SA 4I6EA 2R8PA 3BD8A 4LF4B 1YDGA 1JMVA 4ZICA 5HZAA 5DHRA 1FSGA 1XRPA 1YB2A 3DEJA 3DGFC 1EJ2A 2OG1A 2A86A 4CM5A 3LGAA 2AZ4A 3FZEA 4DR2B 3UN1A 5LZ9A 1RYDA 3R3UA 4K9LA 5DI3B 3CUEF 3F96A 1FK8A 3QVUA 2Q9UA 3A6HA 3WL6A 1ZDMA 4O8ZA 5ICCA 2ZBPA 4NG4A 2I65A 4FYKA 4IO0A 2JFZA 1N9ZA 4AVYA 3AP1A 1HWYA 1VHWA 2VP6A 1JVNA 3ML1A 1JBKA 3FKSA 3IJEB 1UPBA 2I8AA 3FNEA 3LQEA 3R7NA 1GTL1 3TNJA 1JLLA 1BC5A 1V48A 2WJ3A 3FYHA 3OKCA 1RHRA 5AM4A 5TVGA 4BNUA 4BX2A 3IXQA 2QT9A 1WDKA 2A1UB 3ANLA 4TOIA 4D3FA 1GL6A 2Z3VA 2XXAB 1E6WA 3H5IA 1E94E 4BGDA 2BMWA 1ZUNA 2F1OA 4QLBA 2BHLA 1JJ7A 3DEYX 3EY9A 3OJLA 4F3YA 3Q8MA 3R7WB 4LYHA 1ORVA 3IPLA 3ORYA 3OY7A 1SQ5A 3L6OO 3WK5A 1FLVA 2AJBA 5L3RA 1A7UA 3CLUC 2PYZA 3N2IA 2EG5A 2VHWA 4ARZB 4B0OA 2W2KB 4B6JA 3KV1A 3WSTA 3N8DA 5A62A 1Q9SA 4NTZA 2O1EA 2DULA 1KP9A 1T36A 1BVYF 3R4VA 4HNQA 1OYYA 1ZHHA 4TQGA 1CULC 3GNSA 1G9XA 1G0OA 1L4EA 7REQB 3TR6A 2VHCA 1K97A 1I3OA 4Q1EA 4CU2A 2WAXA 3F67A 1X38A 1AJEA 2C57A 3CCFA 4IIEA 1J8MF 3SYTA 3WG9A 4RK5A 4C01A 1JHXA 5EPUA 2YXLA 4IIYA 4B4WA 5JNTA 1KS2A 2FV8A 4C0HA 1VIMA 3DV0A 1TYAE 3MQ4A 2DIEA 5EGSA 3OM8A 3BHJA 1VKNA 3K1AB 2OK8A 2QI9F 4H0NA 5SICE 1Z37A 3SC2B 4C20A 3SVLA 3NH9A 5HNKA 1UXOA 1AQ6A 3IUBA 4FGUA 3DT9A 4PWYA 2NXJA 4MDEA 3MNFA 5LA6F 3G8YA 3LI2A 4IKOA 4CETA 2B8EA 4J0KA 4R5MA 4WOJA 4DEVA 3TSZA 5A4FS 4ZOAA 1GSOA 1NUPA 1WCIB 3ON5A 4JT4A 3Q2OA 4AJPA 2XVMA 2LCFA 3AK4A 1YJCA 2FA9A 2XAUA 1C8LA 1UM8A 2YVAA 3BD6A 2D3TA 5D3QA 2BHTA 1VG9B 2ZUVA 4LCJA 5CBKA 4QQNA 1NAIA 2ZSEA 2G7MC 1U1DA 3T53B 2Z5GA 3IFSA 3I4LA 5DZSA 5JSZB 4CNBA 3LUAA 3A7EA 3U7RA 3FCAA 4TWJA 5IKMA 1PG5A 2YOHA 5AVZA 4Y7CA 1CY8A 3KOWA 3C8DA 4QGBA 3PWTA 3RNLA 3WDSA 3MAJA 3HEBA 4CTNA 4BNHA 2SCUB 3NYIA 4OA8A 2XNSA 1HXHA 4TTAA 4RBNA 2O3RA 3ZVRA 5FOVA 4EYKA 1FSFA 3IP3A 3OUZA 2A5GA 4RJKA 3STVA 4Q3OA 1TFRA 3IUNA 1X7DA 2ZVDA 3NHBA 1T9KA 2W6QA 2XNJA 2ZAOA 3JSAA 2WI8A 4TV8F 3R8FA 5AW4A 1BMDA 5EZYB 3Q6MA 1K5HA 3A11A 1TJNA 2M6RA 3C5HA 3K9HA 4IXDA 4L07A 5D86A 5DE3A 3KB2A 5IW8A 4E5DA 2QW1A 3BZWA 2AXEA 5LIRA 3IR7A 3W79A 1T6ZA 3ROPA 1XV5A 2HL6A 2YHSA 1GGHA 3VZRA 4KLRA 4Y2SA 2Z95A 1IRIA 3P9CA 1IFXA 4QPCA 2MINB 4B8YA 1ADJA 2JBAA 3JYLA 1C2TA 1PX0A 3UOWA 1TRKA 4UAGA 1OJ7A 1QX3A 1K1EA 1XZDA 2RBEA 1CRQA 1RWVA 1V8DA 4YAOA 2G25A 3ABSB 3FSEA 4WXHA 4AO8A 5K05A 5LUAA 2AJTA 1Z4QA 1PQYA 1R16A 2QKYA 2YQ4A 5CDSA 5IZCC 5AQ1A 2QR5A 1UKYA 1ST3A 2QT0A 2I6GA 1TYDE 1V3VA 2JD2A 2X2PA 3BMCB 3IEXA 1Z36A 3OJOA 1W1UA 4P80A 16PKA 4BMDA 3HO1A 3MAGA 4LDNA 5TMDA 3OCCA 4XORA 4MKRA 3ZYZA 4BQEA 1MDBA 1PW5A 2VL7A 4H6WA 3SX2A 3D6UA 2WAAA 3T99A 5FJJA 4WPGA 1SJ9A 3MQ2A 4C3ZA 1GTJ1 5LQAA 4IVPA 4JMPA 1CJCA 1PJ3A 3ILSA 4C7XA 4IRXA 1YHNA 4QATA 2KQUA 2GZ2A 3ZHTA 2ZYHA 4PYJA 1RXWA 3WR5A 3HBMA 2G8NA 1BG6A 3I9JA 4X8LA 1QHFA 2JGFA 3GBSA 1OWPA 4MAMA 4YRPA 3KWJA 1JXAA 4D02A 1VGRA 4JXKA 4D3XA 2LE0A 1NYRA 2C0QA 4PX5A 4LRWA 4HAVA 3LPAA 3AUAA 3GUYA 3WKBA 2DXIA 2VJIA 1GL7A 2TMYA 1I8TA 1V1JA 4GOJA 4MLPA 4D98A 2PSSA 2IDMA 2F3PA 3AR4A 3HXPA 2W7TA 5DK6A 1H8EA 2O1WA 3PICA 1ULUA 1BTOA 2DBZA 1YRWA 2TECE 1AKNA 4JKOA 2XGSA 4MA5A 3FDIA 5INTA 1EEHA 1P4RA 4RPCA 3AERA 4P0PB 2GCGA 3R6TA 3BXZA 4IGEA 2WUWE 5D3MB 1AGRA 3T3OA 2POQX 4GEGA 3F5SA 2OSBA 4ZU3A 3UAXA 1YIOA 1EUDB 1NBME 1WMFA 4B85A 1U3VA 1H0SA 1E63A 3GUZA 3K2BA 4XW2A 4IPTA 4XGKA 4ZCRA 2QGGA 2ZWIA 1NW5A 4OVKA 1ORHA 3C3JA 1DFHA 3K4QA 4PC3A 2OTLB 4NLLA 3QWFA 4MWSA 4LGYA 2ATVA 1F2TB 1OYOA 4JWKA 1RRGA 2JLZA 2EBUA 1WCXA 1QH0A 1QO9A 2X77A 4AUMA 5BP7A 1Y3DE 1DB3A 3OX2A 3MLAA 5CNJA 3WKEA 2PLNA 5EYPA 1CHDA 2WIAA 2DHDA 1EA5A 3KKPA 2P1DA 1JFLA 2PH5A 3KO8A 3TUJC 3OI7A 1S4MA 5D01A 4OLFA 1D2MA 5DOVA 3VU0A 2X4IA 4Z4RA 3D4LA 4AMVA 3ZUGA 1TADA 3LXXA 2NUPB 1IBCA 521PA 1F9AA 4KV7A 1L5VA 3JYHA 4L5BA 2GZ1A 4DLRA 2VNJA 1YHYA 4TUYF 3TB4A 4D74A 1I4EB 2OCAA 4UNRA 4K8OA 2VUSA 4QTUB 3KJNA 5FYDA 2RGYA 5EP1A 4FGJA 4IWYA 4RORA 4EWLA 4NBUA 1DDOA 4IV0A 4TSFD 4F5YA 5L3QA 3CVYA 3DO6A 2A84A 3GLTA 2OHFA 4JEHA 2NXWA 4IIFA 1WNFA 4NMHA 3MWKA 1T26A 5KC9A 2FG6C 1U63A 3Q2IA 5ER6A 4JU9A 4NK4A 5EZSA 3W1WA 3SVZA 4CKEB 1ZGCA 4EB3A 5CLFA 1Z4PX 3UZUA 2HIMA 3DMGA 4FDUA 5P8WA 1B73A 4TMFA 3FTPA 5LQSA 1U7WA 3RVOA 3FVQA 1VPVA 3LCRA 4UBJA 1AS2A 3I2JA 4ECEA 2X2EA 1PBTA 5L46A 2B94A 2ZUDA 1RWWA 1JG3A 2P7HA 4QXPA 3MHTA 3BJIC 4XM3A 5K99A 3N0VA 3L8CA 3AVTA 2YVUA 1VJCA 3RRMA 4REOA 2BF4A 4K8RB 1PKEA 4IFIA 1JHYA 2RSLA 3GP5A 3W9SA 3HCNA 2JZNA 2YRFA 3LNCA 3SBDA 4FFVA 3OA2A 2QDXA 3WB2A 5KO2A 2C3PA 1KOJA 2Q1TA 4JLJA 2WG1A 3TF5A 3HKDA 3A35A 4UE6A 4IMRA 1X87A 1W94A 4QIHA 2ZRMA 3ZK9A 2BKVA 4JI1B 3A6PC 4M7OA 5E3HA 3I4FA 3P5BA 4NBLA 3OKPA 1C7QA 3FVVA 3GFRA 1T4CA 2V9CA 1RJ9A 3A8IA 2ICAA 4J43A 1K3UB 4ZU1X 3WKAA 4BBPA 1CUCA 1W35A 2D2XA 4MPTA 2IH5A 3MJ4A 2CVHA 2RMKA 3RUCA 4DN6A 5IAAA 1LQ2A 5B6JA 1W52X 4Q02A 2C97A 4E4TA 2CLHB 1OF1A 5KX5B 2GXAA 1VMKA 1Z07A 5IJ9A 1AHPA 2W6IA 4IVQA 3VM6A 4UBMA 2PUVA 5A5VA 1DC8A 2E87A 4G7XA 2L2QA 3U37A 3ZI4A 1NOJA 5B6IA 3QP9A 4BFLA 5EP3A 3T3PB 2R5FA 3LM8A 3T5GA 5GVSA 5HFNA 4GLJA 4JYAB 3GELA 4ZWNA 4DT1B 4JGBA 4JQZA 4DZTA 4D9GA 2Q50A 4WFJA 3CX7A 3ZWCA 2GF9A 2X6YA 3EWAA 2GEFA 1THMA 1SR8A 1ZINA 4M1SA 4YV0A 1T29A 3GFQA 4E2WA 4YH1A 2WT9A 1EVJA 1XF9A 1OFHA 2FLVA 1ZD2P 5IMBA 4DLTA 1XEWY 3E05A 1W4BA 1Y4AE 2QD4A 2ZOSA 2HJVA 4W8GA 4C4ZA 4CLHA 3K30A 1WOYA 3CR3C 2XCUA 5EZ5A 2B5VA 4MW5A 1WD7A 2GCNA 2OMEA 4LK3A 2KE5A 3ZWOA 2QD5A 2FX3A 2I66A 3CNQS 4QULA 4CDNA 2Y0BA 3GT3A 4W5OA 1RLMA 2FFBA 2BM9A 2C8KA 1OA1A 2DAPA 2XDYA 4ONEA 5KTOA 4QPJC 1N9KA 5DLPA 5K6AA 2PNFA 4KIWA 1VIDA 2R1ZA 4HH0A 1UH5A 2AG8A 4YV2A 3BGVA 4RTQA 2HHJA 4GG1A 3BY2A 4US0R 4FHEA 4ERXA 2ORWA 2CLDX 3OCWA 4O33A 2QTFA 3IV7A 3OZ7A 1RFLA 4KG7A 2WY2D 1MOQA 4HTFB 1QLHA 1THTA 3PRYA 3W3AD 4X8HA 4XLCA 2WMNB 3QELA 3I55B 4IRUB 2CHFA 4MO9A 3VSEA 1WB9A 4OAQA 4QWMA 5HE8A 4ZU6X 2CCJA 4EL0A 2J85A 5BN4A 5JSHA 3RK1A 2WF6A 2QIOA 3CUYA 2IZ6A 1M34A 4D4KA 2C2GA 1QE3A 3OH8A 4D9JA 2VZ8A 1BXGA 5DM60 1CPYA 3PXUA 1K7FB 1RM3A 3KUCA 4KK4A 4IHJF 2NYAA 1N2EA 2ZRNA 3KKNA 3DPIA 1EM8A 2JFQA 3W5SA 5HK8A 2ODWA 4IGIA 1WP6A 1SXJC 2BC9A 2PD6A 2WZPP 1OE0A 3HA3A 3JQQA 1J0EA 4K86A 2DVMA 2A9PA 1ENPA 2C7GA 4DR4B 4AAYA 3U7JA 2PT5A 1JF8A 1XROA 1J06A 1DRJA 1LBQA 2VJNA 2ZIWB 3GMDA 3FG9A 1QIHA 5F1PA 2Q41A 4OH1A 2G08A 3O2SB 2Q7OE 1T9ZA 4L2IB 2H08A 3PLRA 3RDPA 3TZHA 1CR6A 1TU3A 3QPUA 1E9EA 5JSUA 1GZ7A 2NLOA 5DTQA 4ZCPA 1E3LA 3AKYA 3A32A 1YAJA 2EP7A 3NT5A 4EHBA 3ODPA 1J90A 4OEHA 1EJ6A 1AS3A 1K5PA 3KEFA 1XXHA 5HUJA 3GJZA 2VRNA 3SLRA 4Z4CA 1BHQ1 4AUKA 4DABA 1I6MA 4MOWA 4BNYA 4BNMA 2CUZA 1N2OA 4Q9KA 1O0CA 2VCYA 5FA5A 2BDEA 4AS3A 4BE4A 4CIWA 3TL6A 1C7IA 1R6VA 3F7NA 3QXGA 3G8DA 4B3BA 1R27A 1VHEA 5K0CA 1U3GA 1SWWA 4YEDA 3RVKA 3HU5A 1Y34E 3SZ3A 4DLPA 1Q12A 3MYYA 3T3IA 1OFUX 3AFHA 3WK9A 4AD8A 1L4MA 4ZGGA 4HWGA 1CUWA 1NRWA 2F90A 3TRJA 4RGBA 2BZGA 3FUXA 3ZE0B 4EB6B 2JFFA 2IIPA 3EDQA 3K5PA 1EVZA 4JKYA 4O2AF 3GBPA 1PK9A 2CLCX 1RABA 3T3EA 1F48A 1P7CA 3J80A 3BWBA 1MDFA 2VT7A 2CXOA 2YC2C 4NZYA 4DRXB 4X97A 1ORIA 2ERXA 2O2YA 1NXWA 4Z0HO 3O93A 1GU1A 4HMQA 2IX3A 1C3OA 2WIBA 1WB5A 2BFMA 1L3CA 2R47A 4FQ5A 2HT1A 1XWWA 5FLYA 4DEXA 3ORQA 3FPBA 1EWVA 2XB6A 2I78A 3O84A 1QS0A 1S3SA 1UR5A 1GG8A 5CT5A 1RAAA 4X3CA 5IPFA 2O8CB 3D8UA 3CD6B 1G3QA 1KHTA 1S2NA 2PGXA 3ZKWA 1V95A 2PSEA 4LOLA 3I9NA 3FYSA 1X7YA 2A0XA 2Y1CA 3NHFA 4KZKA 2X19A 3LBIA 1UIRA 3EG9A 3BK1A 3HWSA 5E1DA 3A6JA 2X7XA 2W6JD 3GO4A 3GLIB 2WKSA 4LTDA 3Q10A 3DC2A 3KHUA 4NCIA 1X7WA 4XIYA 3A0RB 5JZMA 1XZPA 2XE7A 1JEQA 4PLWA 1YR1A 3WLHA 2F4NA 2GLXA 3H9CA 4FP9A 2QD3A 4ARCA 2G0AA 2A9FA 2NPOA 1V9CA 1UDCA 5ECYA 3RE1A 4JI0B 3EBPA 2N0SA 3PNYA 2QUJA 3PXCX 4HTAA 3REFA 5DH9A 1P6QA 3ILXA 2DZDA 3R09A 3WSVA 1KZ9A 2CHVA 3FOCA 4KWHA 1Y7HA 1EGHA 1FU8A 4YN3A 4RV4A 5DNCA 5F98A 3A3BA 2UVQA 5GM2A 4YWHA 5BNIA 2VJAA 1DX4A 3P0IA 2F3UA 3QG5A 4EG8A 3HQ4O 4XUDA 4G36A 2VBSA 1GFIA 2VNKA 3COVA 2J0EA 2G4CA 1WUIS 2W8BB 5DX8A 2HO4A 5HX7A 1PUXA 4RL6A 2C2HA 2NUPA 3EPPA 5C7YA 1L7BA 5SYMA 2Y76A 2VPWA 4HEJA 1ODTC 1SG0A 3G05A 1HE2A 2HFKA 3T1NA 3THRA 4TUYA 3WRXA 2YS7A 4BO6A 4EFMA 3E3OA 1E9AA 1ZZEA 3LCUA 4QBGB 5AJYA 3T5BA 4AN1A 2J31A 4LYAA 5BMVA 1UMDB 1O0BA 3MB5A 2ZVPX 3T1OA 3TZKA 1O9BA 3NDBB 1RQ7A 1U2EA 2Q6TA 4ZREA 1Q7RA 4R1LA 5A7FA 5LLDA 4MUJA 3Q7EA 1XD2A 2ZSAA 3IAAA 4V24A 3I53A 5C3MA 1WO8A 3L1UA 1PVOA 3D64A 2EKLA 4FX5A 4PS0A 3WYAA 1QORA 1X7ZB 1Z4MA 2RHOA 2ZRAA 3EG5A 1PVVA 3LOUA 3MCVA 3OWHA 3R23A 2D13A 2YOGA 2R2AA 2VT2A 3Q7RA 5ALOA 2GTIA 2IF2A 3ENNA 3WWYA 5KNCA 1H4TA 1T10A 3HY3A 4L1KA 4YRKA 5ER9A 4R6WA 1BU8A 2P2YA 3PNPA 4XEHA 1G63A 3C6QA 1X1CA 4BU0A 4ESHA 4IIBA 1UMBB 3EXG1 3AUYA 3O8DA 3OZAA 4JLBA 4OLJA 1WSAA 5A1TA 1XOIA 4F2WA 3A1TA 4FNMA 4BNWA 4D6PA 1A2BA 2ZKLA 4K9SA 3UNXA 1OAOC 1YR7A 2NTYC 4XDGA 3Q3EA 4QAQA 1R18A 4EITA 1N2BA 5CW1A 4INOA 4MS3A 3HCWA 1BD4A 1MORA 5HF6A 3F7MA 3DL7A 4L8FA 1P81A 1N3BA 1E3XA 4V0QA 4BDSA 4RX1A 2Q9AA 3JQFA 4OM8A 3M9LA 1RU3A 3DBHB 2O7SA 1Z28A 3FLAA 1BDIA 1OX6A 1WPGA 5CD9A 4KSYA 4I4TB 2P4SA 4TV8B 3BTSA 1ISGA 4P92A 3GMTA 4EMUA 3UBTA 3PD1A 4HAZA 4KP7A 1VSUA 2X2OA 3THWA 1QLWA 1IM2A 4OQFA 3ZTYA 4BLQA 1NVVQ 1SC1A 1IB0A 2QMHA 1VB3A 3AUFA 4JUFA 2O0MA 2Q4BA 3W2FA 2AE1A 3LBNA 1GGMA 1L8OA 2Z1MA 4MR9A 4P0QB 3I8SA 2OESA 4OIMA 1ZRSA 2CUKA 3KZVA 5KX5A 2G5CA 3MT8A 5EWJB 1KYVA 2CDAA 5D1HA 3W1EA 4ZVUA 2ZSHA 4QDUA 3NASA 2W70A 5E1BA 4EJMA 1W9XA 4RLHA 4EI7A 1XDUA 4HF7A 2CBZA 4RD0A 1SAYA 1H5QA 4HPJB 1HYHA 4TWRA 2CFTA 3JQ8A 3HEAA 4O29A 3N70A 3JQRA 4FQ8A 5ULLA 3KSUA 5I9BA 2P8JA 3VKVA 5IT4A 3PNBA 3RGWS 2AN5A 2CXHA 3HL0A 3QNWA 4CU5A 3OEEA 4FILA 5D87A 1TUIA 1KZLA 4AKEA 5KU7A 3M9XA 3PXEA 5CG1A 5IAOA 4CUZA 2D2EA 3TLXA 3DF7A 2O2SA 3NAQA 1K7XB 4GR5A 4KQ1A 2XMZA 2XA2A 5TQ0B 4P26A 4QUZA 1B8NA 1H1TA 3EBOA 3OLYA 4HDAA 3MHPA 4D9FA 2D74A 2QE7A 2PEZA 3O82A 3E9DA 4FYMA 4M0EA 2DCMA 5P21A 5EWJA 1B3BA 3K5HA 3A6EA 4IIVA 2PYDA 3W34A 3PDCA 4LC9A 2JIMA 2WKQA 2AV6A 1PFQA 1R3DA 3CH5A 3IRVA 3WMXA 2NGRA 2OZKA 1YD7A 2R2GA 1DL5A 1P60A 1NUUA 5B7NA 3JQGA 1UXIA 4B3XA 2IP4A 2IF0A 1R6UA 3H65A 1WEHA 3B9PA 2VQ6A 3D7MA 4E21A 2NZVG 2PD3A 4UVHA 3UB3A 3FX2A 1A88A 1OOEA 4ZVOA 3WSWA 4UVIA 3OC0A 1M1NB 1RWXA 4TV8A 3GLGA 3GCXA 4MJXA 2VXOA 1PJ8A 1YRQA 3BDIA 2UZIR 2W00A 3M6FA 1JSLA 1SKBA 3OE1A 4GWLA 2LVBA 4L8YA 4XPIA 3TLZA 2P7IA 4GP6A 5HK9A 1ZR2A 3ND6A 1O6CA 5LD2C 3HCRA 2ODNA 4K9PA 3TK1A 4CFSA 3IPAA 4G1EB 1IG3A 1MOZA 1TM4E 4TN5A 4ZAWA 4B43A 5IUKC 1E2HA 2XA1A 2O8BA 1JVBA 2GPNA 2FMHA 5LQRA 4M36A 1GUYA 1XMJA 2G09A 4PAMA 1SELA 1G8AA 1DTWB 4GQNA 1QO0A 3JQAA 1MT3A 3ZBUA 2DKOA 4GUDA 2W9XA 2ZYUX 1TO2E 3AT1A 2PL1A 3JQ9A 4F85A 1NV8A 1QO0D 2J09A 4B3IA 4DGSA 4Y67A 1IY2A 1UAGA 3O95A 4WZBE 4A7PA 3EGXB 3TPFA 2II6A 1PJTA 2AI1A 4US1R 1FXWA 2OV3A 4MKGA 3KD2A 1U2RA 1H3NA 2P68A 2Y1OA 2WJAA 4R51A 1JAZA 1UPFA 3BVPA 3CNOA 4PLYA 5BUCA 5IBPA 4ZT4A 2FWAA 3PYXA 2WJWA 1YDFA 1B8UA 5AKKA 1RBYA 4ZQEA 1E9DA 5E9AA 1AIPA 2WJ4A 5HQJA 2C7OA 1NFQA 2A33A 4BLVA 1E5VA 1ZGZA 2AFHE 3QF4B 2WMOB 3S99A 4LYFA 3WJ1A 1NZDA 4PNHA 4F11A 1KFBB 3ZX4A 2B92A 4EENA 3G8CA 4HKTA 2EXXA 3KQNA 5IJ0B 1UT5A 4C3OB 1N0IA 1NWHA 4Y1RB 3N59A 5BSGA 2OCBA 1XQBA 5IEBA 3GIWA 2EFJA 3K0BA 4EGJA 4EEKA 4FOLA 2FWIA 3A6KA 3PUZA 6LDHA 3QQ5A 5DN9A 1NI3A 1H2BA 1G20E 2GEVA 1BXRA 3B1WA 3CFYA 2ACVA 1AUPA 2YY6A 4QT0A 4YLEA 1A9SA 1TQ8A 4KKUA 3WNVA 2SNIE 5F4MA 3HP4A 1UD3A 4HLDA 3JQ7B 1WU7A 1VGVA 3T9BA 3V1UA 4BKMA 1C3JA 4HAWA 3ROMA 5CBPA 3GDWA 3B9RA 3C2QA 1I33A 3AI2A 3Q85A 1S8OA 3R76A 2A3RA 5TT0A 3AWDA 1QV7A 2I4OA 1NRXA 3EDMA 1GPWB 2ZJ7A 1DWPA 2NTJA 2WVHA 4F8JA 3ZD7A 5G0TA 2BFDA 3T52A 4Z4IA 1M0WA 4EJ0A 4G65A 2D9RA 5BORA 1PRYA 5JEEA 4BRUA 5HOQA 1YIJB 3PXBA 1MQ8B 4PZAA 2QMUA 1L5FA 1Y6ZA 4LZLA 1CYEA 1OB5A 2J0QA 1IEWA 5EFOA 1YFJA 1B23P 1BPLA 3OHSX 2C3MA 3T4UA 3O4IA 2A58A 4NYIQ 1WSVA 1ECBA 4FFLA 1B41A 4LRUA 2ONJA 2C82A 1II9A 2ZTMA 1QYVA 5T6MA 1DBSA 2UKDA 4EH1A 1CUHA 2IA5A 3DKRA 3W8DA 3QPCA 4YI5A 1N2CE 3ZD8A 3AFIA 2C2KA 1COZA 4RGYA 1GPBA 1B6RA 4RZXA 2J5BA 3WGHA 4WJKB 5TB5A 4HE6A 2H1HA 1N05A 3NV9A 2PE3A 1FPQA 4OXRA 1AC5A 4U7GA 2EWMA 4EQ6B 4CIDA 4V1CI 1WCWA 2AFIE 1COWD 1FTYA 1I7QB 4Z1MA 2JFBA 2F00A 2XVAA 1QQAA 2BN4A 4LZAA 3ZE7A 5A3SA 5F3WB 1DI0A 4X65B 4TVSA 1UDBA 2BKEA 3HDTA 1MX3A 1I7SB 1V1RA 4NBWA 3NM4A 4ZI2A 4GSKA 5LMUB 4RF3A 1E89A 3C1AA 2VRBA 3IIKA 1VKOA 1ZL2A 5CM9C 4C03A 5KYYB 1NXQA 3N74A 1QR2A 1IAQA 2OSVA 3R8XA 2C9DA 1R8JA 3IULA 1CS4C 2O20A 2C04A 1D9XA 4WOBA 3TLMA 3ITKA 3NFYA 4K0RA 2JBWA 3W8FA 2B4RO 3K8OE 4ANFA 3IVAA 4CF5A 3MPUA 1MO2A 1KK2A 2WJZB 3AQIA 1KDTA 5FAXA 1QGUB 5GV7A 1FP4A 2VDNB 5CIYA 1DEOA 2YZ2A 3UW3A 4IVRA 5IZCA 4LFAB 1E1LA 3EQZA 4AF7A 4NOJA 3PC6A 3K70D 1ZN7A 2B4AA 4DUPA 4KVFA 2HCJB 1OV4A 2A30A 2FUKA 4J1QA 1UBKS 1GUAA 2OO5C 2ZVQX 5AM3A 5ES3A 3NWPA 4D97A 1VM6A 3VR1A 1Q0QA 1EZ1A 2OGTA 1FDUA 1ZI6A 1XD2B 2VH2A 1R9GA 1QO7A 1T8WA 4RF4A 5ESXA 1V9LA 4KPEC 2ZZGA 1TC2A 1MJ5A 2GJ4A 2PRSA 2QNIA 2QTCA 3G2IA 4KQMA 4KKVA 2OECA 1QS0B 2A0KA 4XSGA 5JMWA 5BQFA 4QOJA 5GVRA 1C30B 4TTSA 1AN9A 1ZBQA 5ADUS 4KE8A 1OR8A 3W2EA 1C29B 4Y2RA 1GARA 5A89A 1BS2A 2JHPA 2OYNA 4E46A 3FVWA 4BZQA 1SY7A 4NSNA 4PZDA 3AVOA 5JNSA 4C7BA 1T2CA 3MWLA 2ADMA 4XL9A 2FZGA 3B3FA 1ZGBA 2X5JO 2ZJZA 4MYRA 4M1WA 3WLOA 4DCVA 4ASUA 4G24A 2Q5LA 2GK4A 4UM7A 1Q0TA 1FS6A 3TQRA 5IAGA 4H1VA 1PVDA 2H1VA 2Q5HA 2Z58A 4OI0A 4FD3A 4BFCA 4B79A 3JRNA 3TCXB 4A3SA 2VDRB 1U2DC 4WZAA 3GXOA 2VSFA 2BM1A 1JEDA 4PTYA 5IDQA 1ELOA 1QHIA 2JFYA 1YCGA 4U2EA 4I50B 1QHHA 3WRYC 1Q1BA 1CUIA 3U9LA 1YK0A 2W6NA 2GSDA 3AIKA 2Z8ZA 2AOXA 1EINA 2YJ4A 3CKLA 4UM8B 3RGGA 4WNCA 3WIVA 4RLFA 1KERA 4HYYA 4I14A 2C5EA 4IKEA 4O6VA 3SR3A 1FEZA 2MJLA 2OXEA 3DCNA 4M9SA 4UPEA 5I4BA 4XD2A 3K0SA 5L51A 1O87A 4PPYA 4TMTA 3UA3A 1KO4A 4BJ1A 3QUSA 4JGIA 3M1LA 3H1FA 3QOXA 4UPDA 1QSGA 3QFTA 1TECE 2DBQA 3OZTA 4DLUA 2GJKA 4X60A 3S55A 5JDCC 4ROXA 2I03A 3H16A 2BRUC 2QG9A 1FUEA 4PGHA 3Q3IA 4HN4B 5BR1A 5BRAA 2XYGA 2YDYA 3HMQA 1OC4A 1IZ0A 1EKXA 3KYCB 3L8YA 3PA6A 4TWZA 3AMVA 5F78A 4YNBA 3P0JA 1D04A 2XKJE 4EM6A 3N58A 1E2JA 5H0IA 4BO0A 2XCTB 3D4PA 3M82A 1JHAA 2BHRA 3I6YA 4UFOA 1QDEA 1YJQA 1IMJA 2CL6X 3T1VA 3KJQA 1PQPA 4R41A 3RS0A 4EPTA 2Q4EA 3QGMA 1DDIA 2AB0A 5C4IA 1G8YA 4MKXA 4MR7B 5F64A 1U9IC 3C45A 3JCZA 4XWGA 3VO8A 1KJZA 3DO5A 2W2NA 1KEZA 2MDTA 1BRMA 1QRDA 3ONFA 3RVSA 3WO0A 2XITA 2IZ0A 4D46A 1BVUA 2ODPA 3S2EA 1PT9A 3ELUA 4KMRA 3LDUA 1J5XA 4C43A 4X1KA 2ID7A 4KR9A 2BIFA 1TU4A 3KTOA 2M1ZA 3C7TA 4L4YA 3GN2A 1Z0ZA 2H92A 4I5FA 2LDBA 4WFKA 3STHA 5JSYA 5E8JA 2UVDA 3QVOA 1P1RA 5IJZA 1X7GA 2XA9A 2D06A 4HI0E 5EUBA 1W581 1FLDA 3K9NA 2ZBUA 4OK6A 1HDZA 5IAEA 1QE0A 3PKZA 5DX0A 1I5RA 1SOMA 2X1HA 3WS7A 4IIUA 5AOCA 4BQOA 5ALUA 2UYYA 3G6EB 2ZG6A 3KXLA 3UKJA 3UT0A 4X95A 2AQ8A 3IDAA 2G82A 5I51A 4K26A 4R1OA 2Y1FA 3EN0A 4RNCA 3ZW8A 3LP6A 1UBNA 2JJ2D 4OXQA 2CNNA 2XECA 1YTUA 1VE3A 5JZSA 1FMCA 4MKZA 4AJ2A 4BO7A 3C6MA 3LQ2A 3N6XA 1DAHA 2GTHA 3C87A 4B6GA 1LSSA 1YX2A 3I1IA 4W82A 3O1IC 4BAUA 4G6IA 2CXSA 1K7YA 3CCBA 4EZBA 4DR7B 4X0EA 5E9QA 1YRHA 1Y4UA 2WM2A 3KQTA 3CEHA 2IHJA 3NALA 1XALA 4O02B 2YWCA 3UEOA 2NAFA 2RGAA 1U7UA 1M7BA 3C48A 1F06A 3BGSA 1NATA 4MICA 3S44A 3T7RA 3TOSA 3L02A 4IOLA 1V45E 1XFDA 1XTBA 2PY6A 4CMGA 3KE8A 3D6VA 1RC0A 2V3WA 1QH8B 1RI4A 4IHQA 2OA0A 5B57C 2P65A 3AF5A 5BN4B 8ADHA 1O89A 2IK8A 2FWBA 4KO3S 5DFAA 4BB5A 4CJXA 4FM9A 5E3JA 2XSZA 2VZLA 2P9YA 3KQKA 3WWCA 1FFCA 4MVWA 1G4HA 4NFLA 2WR8A 5E6SB 1UFOA 3LCVB 3SXPA 3V1NA 3NETA 3C3EA 1ECJA 3GFFA 4DWWA 5L45A 4OQMA 3TAHA 4FWBA 7MDHA 1E2EA 4FVTA 4YI3A 4YRCA 1T5EA 4CM4A 1QM5A 4XVRA 1PUJA 2P40A 4EG6A 5ITZB 1FVFA 5AOBA 5AVYA 1QQTA 3HYLA 3WRXC 4HBGA 2C9ZA 4Y9UA 1G55A 3IEPA 5TNXA 3OEED 2CUTA 2MHCA 2OPBA 5FOSA 5I45A 5JIBA 3HU1A 3ZW9A 4JI7B 5K51A 1Q3TA 3GA7A 2M98A 3TB6A 1D2RA 4D2IA 1SXHA 1I1HA 2VPIA 3P5SA 3PNLA 1LU9A 5H4GA 2JKYA 1HE1C 2Q9BA 1XLWA 3AV0B 2VK4A 4L72A 4RSHA 3I83A 3CUTA 4X1OA 1IQ0A 2OENG 3DOFA 3NS7A 1V7CA 1RYEA 2ZIXB 4X20A 3B8HA 4AS1A 2AKYA 2H11A 4MA0A 1CE8B 3BJMA 5EIOA 3MJCA 4LHYA 1R9NA 3NHWA 3WFIA 4XJTA 1I4TD 2EZTA 1MD9A 2V7WA 4L78A 1LQTA 2IBTA 1OAOA 1RKBA 3DQZA 4JP8A 4L7QA 1F5SA 1QYDA 3EAGA 4D4MA 2OZLA 1CF4A 3CPWB 1W5AA 1HTTA 2YZ7A 4WJZA 1F3OA 2AF3C 2I4IA 1EG7A 1RE0A 1CD5A 4FS8A 1GUZA 3FDZA 3IOBA 4KYUA 2XGMA 2TYSB 3CZRA 3UUEA 1NKSA 1NQTA 2A5JA 3IVCA 4RVFA 3TMKA 1R4NB 1K7CA 3JQFC 2HQ1A 3NBAA 3PBKA 4MGKR 4OBBA 1LCIA 2HMAA 1C9KA 3GP3A 4UM9D 1UXHA 2HR1A 3LPNA 1BS9A 3OM0A 5AD1A 4PZLA 1KD1D 1PP4A 1W1WA 4LF5B 2F3TA 1MB3A 2PJZA 1I2BA 3D31A 3KAPA 4KI7A 4LDJA 4OYYA 5FUVA 4BP8A 5B4VA 5FLKA 3EVAA 3HDJA 2FPPA 2C98A 1IOZA 3OZFA 3PYMA 4H17A 1DC5A 3DNFA 1XE1A 1Z7EA 4MS4A 1UBHS 5DT2A 3RH0A 2DHRA 3BAZA 1UKCA 3I3SR 3KXDA 3LPDA 1XTSA 3CRQA 4NBNA 1JHRA 1H2ZA 1TJ4A 5DNWA 1T8YA 2DLNA 1T34A 1FFBA 1LFAA 1UBJS 2YVKA 2BKLA 2HLDD 3I2IA 4YO7A 3GXBA 3Q5EA 1AMOA 3I09A 3KSZO 4FXPA 4I1UA 4XONA 2Z9BA 3G88A 3GJ7A 3RFVA 2EDAA 4HG2A 3TSCA 5DWDA 4K81B 1G1AA 3ZWBA 3TBHA 4C6TA 4H7EA 3SLGA 1ADCA 3BTOA 3VNUA 3ZHSA </