1BX1A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVQVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 97
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx1A02
4YAFA 1EXMA 4FWTA 1KD1D 5TR9A 3QSYA 1JA0A 3CCJB 1VQ7B 1KJZA 3AGPA 3U6KA 4G5GA 1VQ9B 1QG0A 1OB5A 2FX3A 4J0QA 1QX4A 2BGJA 1ZUNB 2B5OA 3VO1A 2EFGA 5GV7A 3PENA 3FPKA 1S0UA 4LBWA 1EP2B 2OK8A 3VO2A 2D74A 3W5HA 1AIPA 2VYQA 3CD6B 1DDGA 3AVXA 4RD1A 4Y7CA 2QTZA 2OTLB 3G6EB 1GO2A 1QGAA 4G1BA 3AVVA 1EFTA 1R5OA 3OZUA 3E20A 1KTVA 4DQKA 3ZZ0A 4PC3A 4RD3A 2RC6A 2NPFA 2XNJA 3JQPA 4ACBA 5TY0A 1IJFA 3ZZTA 2VNKA 1K8AD 4B43A 3CC4B 4P6VF 1VQ5B 1D8TA 4C0SA 4TMZA 1F60A 3U6BA 4C43A 1YI2B 1ZM3A 1OB2A 1FNCA 1NDHA 1YHQB 4RD0A 4M1KA 1KK1A 4RCYA 3G4SB 3CMAB 4ACAA 1FDRA 1ZM9A 4LBVA 2B7BA 1UMKA 4FN5A 4AF7A 3VNUA 3OZVA 1QFJA 4K1XA 3W2EA 1YIJB 1A8PA 3AGQA 3QFTA 1VQ4B 5HXBA 4AC9A 2HCJB 1BX0A 1YJWB 3ZC3A 3W2HA 1W34A 4H9GA 1DARA 4PC7A 1KK2A 1OGJA 4P3YA 4QFMA 1KRHA 1AMOA 3CCUB 1B2RA 3JQQA 4TN1A 4N3NA 1GAWA 1JNYA 2YWFA 5THXA 4RCZA 3CCQB 3CCRB 5JBQA 3AVWA 1KK0A 4B4DA 1I7PA 1BQEA 2DY1A 4QHYA 4PC6A 4ZV4A 1TVCA 1CNEA 3VMFA 1G7CA 1QVGB 4Q7JB 1FRQA 1WDTA 2CNDA 1G7RA 1ZM2A 5DSZA 1YITB 1R5NA 1DG1G 2YWHA 4ZCLA 1H42A 4AF6A 1CQXA 2GPJA 4MYTA 3LRXA 4M53A 1G7TA 1VQ8B 4YAWA 2BMWA 3CC7B 3MCAA 1CNFA 2DETA 2BV3A 1FRNA 3CCSB 3I56B 3QFSA 3G71B 1EP3B 3QFCA 1GVHA 2BPOA 4M0LA 5H59A 3WYAA 2R6HA 3I55B 2QTLA 4YAOA 3WY9A 4U9UA 3JQRA 3AVYA 1KK3A 4ZGNB 3CXCB 4M2LA 2X3UA 1YJ9B 4YALA 1E64A 1QGZA 1M1KD 1W35A 1GR1A 1KQSB 4IW3B 1R5BA 1VQOB 1ZM4A 3LYUA 3ZBTA 4B47A 4TMTA 1BJKA 1VQLB 3VNVA 2GQFA 4FK8A 2VZLA 4RJLA 2QA4B 4TMXA 4MYUA 2DEUA 1H85A 1EFUA 1QH0A 2J7KA 1D1NA 2QDXA 5H5JA 4HE5A 2YWGA 2E1RA 3FJOA 1ELOA 4B44A 3J81k 3ES9A 1N0VC 2ZITA 3CW2A 4YHBA 1M90D 4LBZA 3OJXA 3AVTA 1OGIA 5KSWB 1IJEA 3WNCA 4YAUA 4HE6A 1SKQA 4PC2A 1DDIA 2XEXA 2CRVA 4Y9UA 4ZCMA 3MHPA 3E1YE 3CCLB 1KC8D 3CCEB 1TTTA 4TMVA 1JJ2B 1BX1A 3CB4A 2QMUA 1D2EA 2C77A 3W2FA 1QFYA 3WXMA 1U2RA 1B23P 4B48A 4Y9RA 1W87A 1JB9A 2XNCA 4NCNA 3P27A 1Q82D 3MMPA 1K9MD 5GV8A 1YJNB 2PIAA 4EH1A 2BN4A 4LC0A 1N8RD 1HA3A 2EIXA 1TUIA 3V76A 4TMWA 2VNHA 4RD2A 2OTJB 2PLFA 3WNDA 2BF4A 1Q81D 5AN9A 3P26A 2B7CA 2BM0A 1J9ZA 3OJWA 2QN6A 4RD6A 1QUEA 3OW2B 2YWEA 4UAJA 1Q86D 1EFCA 3ZBUA 1QUFA 3CCVB 4G1VA 5EMNA 1GAQA 3CC2B 1FNBA 1VQPB 1XB2A 1QFZA 2VNJA 3CPWB 3A1FA 4ZCIA 1S72B 4F7DA 4DQLA 1FNMA 1JA1A 2VNIA 4LBYA 1VQNB 1SM4A 3LVBA 4ZGQB 1E63A 4NBSA 1E62A 3ZZUA 3U2QA 1K73D 4R71A 4M4SA 1W2BB 1IB0A 3LO8A 3QE2A 2DCUA 2PMDA 5TV2A 2BSAA 5FA6A 3CMEB 1F20A 2BVNA 3W5VA 3QFRA 1TLLA 2QEXB 1Q7YD 3WBKA 3B82A 3OZWA 3W2GA 1FNDA 2C78A 3CCMB 1QVFB 1VQ6B 3I1FA 3W2IA 1NJID 1QGYA 2OK7A 2HMAA 4PC1A 1N0UA 1GJRA 3SJZA 2DERA 2BGIA 4PGOA 3WBJA 4B3XA 1VQKB 2BM1A 3AVUA 3CRZA 4WQMA 1G7SA 3B78A 4RD4A 3WNBA 4BPRA 4N3GA 1VQMB 3B8HA 1XE1A 3W5UA 1EP1B 2HDNB 2AHOA 1EWYA 2RC5A
chains in the Genus database with same CATH superfamily
1L4KA 3DZKA 1M1XB 4DNTB 4XAQA 4XXHA 3HUTA 3UEOA 1WQ4A 4MCHA 2IZ6A 3L18A 3MT8A 1BVRA 2VJMB 3MB5A 3TG2A 2FW0A 2WYOA 4WPGA 1REQA 2FSGA 3DA8A 3G02A 1T3TA 2P8JA 2COUA 1Z13A 4XIIA 1NMZA 3A2MA 1UM8A 3O8LA 3C3DA 4F2WA 2CDBA 2JK0A 4M9XA 2G70A 1BEZA 5C7IO 1OXUA 2YYAA 3O82A 4DV0B 3TLBA 4DS3A 3N53A 4OQYA 4C29A 1K7YA 1V11A 2FQWA 5DJ5A 2IS1A 4DILA 3FCYA 3PX3A 1XTQA 1WKBA 4D9KA 2G1AA 4EY8A 2G09A 2L82A 1WIWA 2QUJA 4R7GA 3NAZA 1RDFA 4RVCA 4US0R 1CRZA 4MCAA 3SOPA 1XRLA 4CKEB 2CXTA 3ABRB 1U9JA 1ZI8A 2FU5C 2OXRA 3DUFA 1JIIA 1ZD1A 2PUJA 3ETEA 2JIRA 5SZKB 3RIGA 3U5ZB 3M2PA 3E3MA 3VOSA 1ACMA 4HJXA 4DM7A 4D99A 3DAPA 2XGOA 1UDAA 3LY5A 1NI4B 2H7VA 3RASA 3S1AA 2H5JA 3A8TA 1HYBA 3CD6B 4YP5A 1Z22A 2XXAB 4FUTA 4C2AA 2LWIA 3NUZA 1AJEA 2JFFA 1RM3A 1N9GA 2E4WA 4OHFA 4N6NA 3BMNA 2FE4A 4EATA 5ALTA 5B3JC 4X91A 1K6IA 3YASA 5F23A 1G1MA 1UBTS 3B7GA 4XYGA 1XBTA 3Q40A 3L5OA 3FHCB 4DAOA 4QDUA 3AR3A 1YB2A 2R00C 4U39A 2CSUA 1P33A 3OHPA 4LKRA 2YWRA 2Y0DA 3TAHA 2BKAA 2HA2A 3QM1A 2VEDA 4MRSA 3RFXA 4ECAA 2I33A 1QH8B 1WPXA 2EKPA 3O9MA 1YR1A 3F6YA 1GPJA 1V7ZA 5IN5A 4G0VA 3TIXB 4O2RA 3W77A 3DYBA 1MQAA 2QU7A 2XQGA 2ORVA 3VNRA 1KL7A 1NN5A 2IW1A 5JZ9A 2PTGA 3F49S 3ND5A 4R2HA 1GNVA 5HKLA 5LIRA 5KQRA 1KY5A 4K81B 1LC3A 1FTYA 4HGOA 4IGEA 1P7PA 4PGAA 4AAYA 3WNZA 3PJEA 3M6VA 4Z7JA 2GBIA 4F4IA 5M7EA 1O1YA 2Z3WA 3VO9A 3G88A 1D07A 2VVTA 2XSZD 3U6BA 4C43A 1DFGA 1TE2A 3G2KA 3RWOA 4HGYA 2HX1A 1F1JA 3KUUA 1KETA 4QYIB 1M0EA 1ZD2P 1LWOA 1PEDA 2FFRA 3ZHTA 1HM5A 4XRRA 4IXWA 1JWBB 3LVFO 5HQ3B 3KWJA 1KK1A 1ZN7A 4UNIA 3NLLA 4I3FA 1WB4A 5BRJA 4EPTA 5JQWA 4OMCA 2ORYA 2PH3A 4DLTA 2X76A 3MCUA 3EWIA 4AFNA 5ARDA 2CMDA 2GM9A 3N5KA 2GD6A 4HMQA 3EH1A 3WL3A 1JIVA 4Q82A 4AF7A 3RTAA 2CT8A 3NDJA 1DPGA 3ZE0B 1VE5A 4B3CA 1CEEA 3ZQ6A 2G06A 4OOFA 4EA8A 4WACA 1CX9B 1LRLA 2I22A 2QLNA 3HS3A 4FI3F 721PA 3HB4X 3BA6A 1HR0B 1SH7A 2YFKA 3AEXA 5A0FA 5IDQA 3ZQJA 3D8RA 1VQ4B 1RBZA 2XVXA 1A5BB 2H4WA 2Z2KA 3EAFA 2H1SA 4OBBA 3CNNA 3WKAA 3ZGNA 5CNKA 2JGAA 3G5MA 3RTCA 3TBKA 4KLRA 2I2DA 2FEPA 1JTEA 4PGMA 3QXSA 5JMTA 3ZC3A 3F7OA 4AXBA 4KOEC 2H2GA 1VDZA 1DARA 2IODA 2ZIWB 3NIGB 1KSGA 2RD2A 2BKLA 3FB1A 3JYPA 2DLCX 4M1OA 4HMPA 5EFOA 3BMOA 1JHYA 1TK9A 3SMVA 1FP4A 4AJ4A 4D4HA 3EX7C 3EVDA 3CCUB 1JXOA 2RGAA 2X6TA 3D1VA 2XMCA 1T8RA 1VE1A 3K1AA 3X2SA 1KE1A 4Q1BA 4TS3A 1USVA 3KD3A 2XCRB 1D3AA 4KO4S 4D9NA 5CA0B 1GTSA 3K2EA 4HAYA 2X0EA 4FYYA 2DG2A 4BGDA 2QTVA 2GLTA 5L4NA 1Z3IX 2WIFA 1B2LA 2DGDA 3MM4A 3NEYA 4JHLA 3ROPA 4BO9A 3L1IA 3CCQB 3P8ZA 3CR3C 1D1SA 2OV2A 3BK2A 3CJTA 5IUJC 1QV9A 3ZI4A 2AK3A 3LUBA 2W6PA 3ZE6A 4E12A 1VKNA 5JYBA 3JARB 4YWHA 2PUHA 2C99A 3WK4A 3HCBA 4LVOA 1G19A 3PC2A 4EAQA 3LWBA 1NG9A 4MB2A 4R0MA 1YTUA 4X06A 3GUUA 2YV4A 3QVLA 3H6HA 1J00A 3I53A 3S3TA 3W9YA 2DMRA 3NWJA 3GT3A 4P26A 2ZP1A 4KWEA 4RIFA 1ZH6A 3UYLA 1G7CA 4WJKB 1A04A 4CMEA 1B6RA 1RTKA 4BQEA 2CHEA 1RBYA 2BGMA 4X00A 2WJHA 1SAYA 4LY3A 3QTBA 4FE7A 4G1MB 4O2AF 2CVPA 3EIHA 4E5KA 1GA4A 3EF1A 1V6SA 2Q99A 1EWRA 1R5NA 3BCSA 1L5VA 1Z4OA 1W1IA 3X1JA 4G36A 4ZVTA 3KWMA 1G2PA 1NYLA 3H0CA 5FYQA 4J3FA 2RBEA 2WKQA 4C0KA 3GJZA 4INAA 3M7IA 1C3EA 3LZDA 3GFQA 1WSWA 1Z2OX 3Q39A 1RT9A 3WQSB 4A73A 3LRXA 5DW3A 4M53A 3BWCA 5JNTA 4HLDA 5FXMA 1QYWA 1SUBA 4PHCA 5AI9A 3DL4A 4YAWA 1JS1X 3RC8A 4KPGA 3IBTA 2J5BA 4R1QA 4WMLA 3UPUA 4AO7A 3L6UA 2M9MA 4MAMA 1MV8A 3C1TA 2A86A 5EKXA 1FOEB 3AIOA 1FFWA 1SHJA 4YASA 4Y2HA 1BHJA 3RSSA 3QTTA 2WF5A 5JO0A 4MV3A 3D3WA 4PSAA 5E8RA 1ZNXA 5C1PA 5IK2D 4CMIA 4U9HS 2OKCA 1KQOA 3ER9A 4RENA 1P9RA 2BHTA 3N2GB 3U1BA 3V7WA 4C0WA 4P1VA 1L5WA 1XNHA 4QQ8A 4JI0B 4P7GA 2HLPA 4PIVA 1UJMA 4DLPA 1C2YA 3AERA 4DGQA 3O3OB 2HSGA 3HKEB 2IIPA 4GI7A 5HTKA 2XE7A 1IM8A 1Y6RA 3NQ41 5ESRA 4BFUA 1ISPA 4IQ4A 5C4MA 3TOCA 1EUDB 2B8WA 5H3LA 2DPGA 2VAXA 5CCEA 3R6KA 4M7WA 4PX2A 4PRKA 2G88A 1AQ6A 1KQSB 1BXRB 1GL7A 2ZRGA 3GJ6A 4TRNA 4FHFA 4CLRB 4CL2A 3R3XA 1Z3CA 4MVJA 2UYOA 3NOVA 2TECE 1UBHS 3LYUA 2FNAA 3NORA 1OA0A 5CFOA 3KR1A 5K0BA 3R0XA 5F2EA 4C0LA 1QIFA 3EW7A 1BS2A 1K27A 4L1KA 4LJ6A 2ZJ7A 3NH6A 3ZVMA 1KOFA 4Z4FA 1XYYA 2DFDA 4C87A 3NDBB 5AHOA 3ECSA 3JRWA 4NK5A 3WGIA 3COWA 3TFQA 1Y8ZA 2BZ0A 1ESEA 4TMXA 4P34A 4XVQA 1G6HA 1SOUA 4CCYA 3EVGA 2WJVA 5J4HA 4F97A 4FDUA 3ZCRA 1OB0A 1JZTA 1UIRA 1L8XA 2FZ5A 3HVUA 1Z74A 4B17A 2EU8A 3LM8A 4BFYA 2O3SA 1X14A 3C6QA 3KEMA 3AKZA 2JHAA 2W2KB 3I2FA 2D5LA 2RHRA 2I1VB 1UK8A 2PCLA 3H2SA 5FP0A 2HCBA 3FDXA 4IKOA 4UC0A 4D5GA 3RARA 3L1VA 2ZUWA 2H54A 1XDGA 4Z7OB 3CW2A 3LX4A 1NW3A 3QYPA 3LXXA 4LBZA 1RPZA 1ZY2A 2IHVA 4RH1A 3FCOA 1IQPA 3OLCX 4B2PA 2NV6A 5AW6A 1FUKA 1JQLB 1MO6A 1DDIA 3QG5A 1DU4A 3H18A 1T5LA 1UD2A 5C3UA 3TZHA 1J8YF 2GVDC 3GFPA 5TEVA 1BYIA 2OD9A 1MCZA 5BW8A 2XT0A 2VRNA 1H0KA 4MNTA 2AXEA 4DR3B 1GZHB 2Q41A 1V1MA 3MWEB 5T8KC 3LE8A 5DXJA 1XLTA 5FTKA 1N06A 1XHLA 2VPYA 5JE8A 4LCJA 5KVVA 3AL2A 3I61A 2GM5A 4QPJC 1BG6A 1I7DA 1TTTA 1ZJ6A 2H08A 2V8OA 2H1OA 1C3OB 1VTKA 2XKBA 1SUFA 1U4NA 1SCAA 4PSUA 2HMYB 4YRMA 3L2OB 3LT0A 4PLTA 2HMSA 3JYHA 2Q0QA 1QFSA 5NULA 3D81A 1N2IA 3FPFA 5LBIA 2QAGC 1J20A 4V1CB 1YA8A 1NJ8A 1E4EA 4GD3Q 1BAPA 1AUVA 2OCKA 3KJEA 1T9GS 1UJ2A 5I9NA 3WXMA 2J3DA 3V2IA 1NVMB 4HB4A 2XMRA 1OPXA 1SZJG 3HWRA 1PQUA 1B23P 1N6NA 1PJ6A 4YDHB 1T8PA 4Z9XA 2Q4DA 2PUVA 2WF7A 3Q72A 4JJ8A 4BZZA 2QMZA 1RS0A 1QRSA 2B8EA 4PYOA 5DN6D 1K7SN 2FX2A 4B8WA 5FBVB 4RK5A 3ROGA 3DCYA 3G23A 4JB8A 4JUIA 3GB9A 1U2QA 5AO9A 3KAJA 2OECA 1I3KA 3IPCA 4BWVA 5IYQA 4HNVA 1X8LA 2IOHA 5IM5A 4H7KA 5GONA 1U4SA 4LC0A 3H17A 1NQTA 2VSQA 4KDFA 1B8OA 1I7SB 2ZRQA 4ZEVA 4JD5A 2UZ4A 2VPZA 1JHMA 3FSGA 2NZUG 3ZJ4A 5A1TA 5IJ9A 4PAQA 4BFXA 1Y8CA 2RKOA 4KSBA 2ZL7A 1TA0A 4WADA 1XTRA 2J5XA 5AQ1A 1NUQA 2QEQA 4I8DA 3T9DA 1XCOA 1ZRSA 3GAAA 1TL7C 3G0DA 4NESA 2Q4OA 3F74A 3RIYA 5KOJB 3C4JA 4OJQA 1AXGA 4DIOA 2MR6A 4XYMA 5EIWA 5CB4A 4JX8A 4ITRC 4E5YA 1FQJA 1FUIA 3G0OA 5EESA 3T0GA 4RHTA 3V7UA 4C78A 2JNWA 4C7VA 3O3CA 5KNDH 3BXPA 4PXSA 2DQYA 2VT7A 2J4FA 4N9WA 1V3UA 3BMCA 2CMFA 4V0KA 3GRVA 3N74A 4H60A 4E2ZA 4DSZA 3F8TA 4YMHA 1ADCA 3RSZA 4UZUA 5LPNA 4N39A 1G20E 2Y99A 3EVTA 5AK3A 4M1ZA 1BN6A 3KQMA 5K3DA 4MWGA 4BQRA 1G66A 3UHJA 1SCIA 1LF5A 2VDKB 3B5EA 3MFYA 4L4YA 1RXSA 1Z33A 2AI3A 2NSLA 2VQSA 1E1NA 3PHHA 3RYHA 2GASA 1XPOA 1LB1B 1PKEA 1Z0AA 3A1FA 3MWLA 1FFAA 4YJHB 5JWRA 3CLRC 1O96A 3SLDA 2FSVA 3HH8A 4BRUA 2OBLA 1HT2E 1O03A 1KORA 4PZCA 4URXR 3TLYA 1DMSA 4LJAA 4B81A 1KAOA 1UWCA 1UJ6A 3IO5A 3R5HA 5H82A 3UJPA 4OY3A 4RTNA 5KAMA 1R8YA 3D0RA 3ROEA 1G20B 2W6OA 3P9SA 5EC8A 1X1SA 4W5HA 521PA 4JQCA 5JH7F 2FX5A 4UE2A 3OIVA 3MLEA 3UM9A 4G8DA 3V4FA 4UCFA 2F3SA 2JIZA 4U2CA 4UOZA 2O6HA 1WO8A 2XTAA 3KHTA 1YE8A 2GUGA 3ZD8A 1E6WA 2B6NA 5DW0A 2P69A 3RVLA 1LKZA 1NWCA 1RJ9A 2ZAYA 1T5HX 3KPUA 2QJOA 2EG5A 1N3LA 4KZKA 4OHMA 1P1FA 1VL1A 2BSAA 3JAWB 3R0VA 3K8YA 5ALUA 3PJRA 3SVLA 1UOQA 4WKPA 4LA4A 4J7AA 4OFBA 4ZTZB 2GN9A 2I54A 3VKWA 5I7AA 3OC6A 3H2IA 4MRRA 2IXGA 2ZTGA 5JTUA 2BFEA 2GZMA 2M1XA 3OOHA 1PWZA 5CT5A 5GM1A 4E15A 1I94B 3CE9A 4HVAA 1XD2A 2AQKA 2NVWA 1JLKA 3MB8A 3B82A 1P7WA 1CIVA 2OAP1 2VDQB 4EVQA 5CJJA 3TUIC 1A5AB 1L8QA 2DSTA 3PZRA 1P4AA 1ZICA 1OTXA 2OGTA 2V4DA 3H2GA 3JQ9A 4FZVA 3ISVA 3KQPA 4YK7A 1CEQA 5F1PA 2OA0A 1UP7A 1SQSA 3OE7A 1VQ6B 4LE2A 3W2IA 1UINA 4PBTA 1QK5A 4HRVA 4K6CA 3U7GA 1UBLS 3LDHA 3V42A 5F5LA 1OH6A 4CYMA 2XV1A 4CEIB 2VJQA 4B6FA 1DAOA 1CUUA 2FEWB 3O2SB 2PZEA 3CYFA 3CY6A 2QS9A 4KQJA 1JSXA 4TLDA 3GNLA 2EXXA 3HGQA 1XNRB 3WBJA 4ZHQA 1HFKA 3F8SA 4KYVA 2ZYUX 4HTAA 1IN8A 1B42A 3FNEA 4F6RA 1YC2A 3N0TA 5FNVA 3SXJA 4XOUA 3Q98A 4JZKA 1IUKA 3DE0X 3X1WA 4HNTA 3KTOA 3W3AA 4YO8A 3U3JA 4RTJA 2VDOB 4KWIA 4C0HA 1T35A 2NU7B 4BPRA 1ZESA 1E7WA 4D56A 1SXPA 3TTUA 3O1IC 4NJMB 3KU1A 2ZBDA 1XE1A 2GN6A 3PDUA 4NDZA 5E9JA 3HKCB 2AFIE 1XALA 2BOVA 2C3OA 3E5NA 3ZWDA 2F90A 2QXTA 2JC3A 2V4ZA 1FX0A 3OLVA 4UZSA 4IPTA 3DOHA 3GSIA 1PS8A 4ZAXA 1NFQA 4IHQA 3TW4A 1M2NA 1GPDG 2QUBA 5B3AA 4GF5A 4MS4A 3TSAA 2E48A 3MT0A 1LQ2A 4YUAA 2YHSA 1USWA 2UDPA 3G1TA 1F8UA 1O95D 2PGJA 1VGVA 3TTWA 1L3CA 1WJGA 2PA0A 2QW0X 4MVJF 4QUZA 1C2TA 1DCMA 1RRMA 2P65A 3I0ZA 3FSRA 2BCEA 4IFIA 4UQPA 5F2NA 3F73A 1E3WA 2X14A 1UK9A 2AFIB 2D5AA 3FYDA 1ESZA 2FX3A 4NHEA 2BE9A 4CV0A 2HJHA 4IL5A 2OSVA 2FUKA 1H2RS 2OVFA 1HETA 1JFLA 4HF7A 4Q9DA 2EW2A 3RK0A 3OHSX 3H7IA 2PUWA 1B93A 2ZRBA 1WL8A 3GPCA 5KS2A 1AZWA 1ZIPA 1OWNA 1T3SA 2NYRA 5G0TA 3SFVA 4AICA 4PG8A 1ZKDA 4XKVA 3F47A 3QGMA 1ZQ1A 2AEMA 1IN5A 3IPXA 4FGLA 3VR2A 2QTFA 1GA1A 1X7YA 4RQBA 4BNTA 5CIYA 4JKYA 4MP8A 3HBAA 4UUNA 2GTIA 1ESCA 4HY3A 2X5JO 4NYMQ 4IJ6A 1JL3A 3Q0EA 5EJ9A 2JJQA 4WIAA 1T5TA 2HRDA 3CB2A 3T1OA 3VKFA 4NENB 2G1JA 1LNQA 1RKXA 3NUGA 2PRKA 1C0PA 2X2EA 4LX0A 5GZ1A 2B0JA 2OORA 3GEDA 4RJJA 5JHHB 4HJRA 4M1SA 4HWPA 3OLYA 2O2JA 3IJ5A 2R5FA 3KYCB 2VTBA 2J09A 1XVIA 3UHPA 1ZD8A 3VYWA 1NBHA 3ZZ0A 1Y4UA 3EFHA 1CS0B 3KIPA 1FMTA 2WFMA 3C14C 3MMZA 2XF2A 4MRVA 3AI7A 1O0CA 2FZ4A 2PAFA 2E5LB 5I7OA 2N46A 3MNFA 1P0PA 1DELA 3IUJA 3VVBA 1DHRA 3DKRA 5G0SA 1KIAA 1PW5A 3BL6A 4YN3A 3V2UA 7REQA 4YWJA 2IVZA 2UYHA 5DLDA 2ZYSA 1U3GA 3VH1A 1H6BA 5K0SA 3KKPA 3ZZTA 3H2ZA 1V1RB 2Q8NA 2LKCA 1YVDA 2EWMA 5TVGA 3TJRA 3X1KA 1IEQA 1RAHA 4HQRA 3UG6A 5JS2A 3QLJA 4L7VA 3LGSA 4QGHA 5EPUA 4NARA 3A6FA 4ZXFA 4DEVA 5HMLA 1WOMA 2CLMB 1YDFA 2R6DA 2VWPA 2ZAIA 5JDCC 3T9EA 2C03A 3OIUA 4KR3A 5C4IA 3PK0A 1I51A 1OSNA 3NU1A 2H8GA 3OE1A 4H35A 3FTCA 2RHWA 2GEUA 2Y92A 4K9RA 4OQDA 2DHDA 4OQMA 4W82A 4DTCA 4KXQA 5KJCA 4YHHB 4M1KA 4CMJA 4Q9LA 1VHJA 1YI1A 3L7DA 3NTXA 5HBGA 3KUCA 1KDVA 3HYLA 1AKEA 2AZDA 3C7TA 1YS7A 3STTA 3ZCTA 1J2UA 1WTHD 2PGAA 1F4VA 2BGRA 1TI7A 3IFSA 4HPXB 8OHMA 3E5RA 4OJYA 4FR2A 4WL0A 2GNAA 3MCWA 2DPXA 4YMGA 2QBYB 4DV3B 3LDFA 4XSVA 5GONF 1REQB 3ACDA 3ADPA 1A8QA 3AIMA 1HQYE 4XD7A 2IHYA 3VNUA 3H5RA 4OYYA 1SEPA 5THQA 4HIZA 2C00A 2V55B 4LJ7A 2CBZA 4XR9A 4J4BA 2BGWA 2PZGA 4CJXA 3SXUA 4MWOA 1COZA 5IJZA 4A8JC 4G8BA 1XR3A 2GN8A 1V11B 1UJNA 1E3QA 2YXPX 3V55A 4U6NA 1M0SA 4KQWA 4M1MA 1BWRA 4F56A 4PGFA 4R2XA 2SBTA 5FUQA 2JIDA 1WLSA 5FT9A 2HF2A 1XLUA 4D9BA 3A0UA 1YQ9A 4MGHA 2PBLA 2YMPA 4UKDA 1WR8A 3ABQB 1SIBE 3DUFB 4XQ9A 4YAKA 3GC6A 3AI3A 4U7JA 5DRYA 2P2LA 4ZAVA 4I36A 3S1AB 2VDNB 3I9LA 3PXXA 4XM0A 4PZZA 1TD1A 1A9TA 3V3KA 4AURA 3D8SA 3JCZA 4U2KA 1MC8A 2JA2A 4QSHA 3SXPA 5MGNA 1N9GB 1BMDA 1WBDA 3BMNB 3J7TA 1VXRA 1XIVA 2EGHA 5BN3A 3JQCA 4J1TA 1DBVO 1OILA 3JQ8A 3Q5EA 1C7RA 4WK2B 2JLSA 4MDEA 4XW2A 1RVV1 4N8DA 4DR2B 1TT7A 3H99A 1JHAA 3K3PA 3Q6RA 5EQJB 1DV2A 5IH3A 4PICA 5TQ0A 2DBYA 2YV2A 3DMFA 4UE6A 4XWGA 2IRWA 1CY0A 2JFOA 5CNMA 4YRNA 2F1RA 2HA0A 5ETJA 3RAFC 3E7FA 1Y0YA 3QNUA 3ER8A 1DC5A 3B53X 1SXQA 2Z6BD 3CUKA 5D5QA 2RE8A 1KMQA 2NLOA 1Y9DA 4PLGA 1PO7A 3LP8A 1RQXA 1UPTA 4G8JA 3TSOA 3F7TA 4FCVA 4B7UA 1XDUA 1TA4A 2Y1WA 3ETCA 4O5OA 4A23A 4EKYA 5H68A 1OTHA 2DBZA 4IGAA 1HZZA 5DTEA 3VH4A 5DM70 1JKMA 1KP2A 4HFNA 4QBFA 4XUGB 2O5VA 3A25A 4WLVA 2GDZA 4XPZA 3QNWA 5CLGA 1CQXA 2IYPA 5AVJA 1K28D 4IDCA 3WNQA 3WYGA 2JAQA 2O2ZA 4YMUA 3TIGA 4EP1A 1PWEA 3G9ZA 3UMFA 3GEGA 5BUZA 5I7SA 4RELA 2W8BA 1PTJA 4MJXA 4G0NA 2YWXA 4RH0A 4TYNA 4X63A 2OB1A 3JW8A 2BV3A 3V6MA 5BV2P 4D5EA 2XD4A 3HRIA 5KJEA 5DM4A 1UD5A 1RE1A 1Y7TA 2A9JA 1BS9A 2MTBA 1Q6ZA 1XV5A 2GVNA 2QIOA 2YMLA 2KX7A 8AT1A 1R8JA 4TXMA 3A6GA 1E1KA 3MFQA 3GXBA 3U9LA 3ZWNA 1J8QA 2I8CA 3FGPA 2VAWA 1BKSB 5TX7A 2ETXA 2FW8A 3C3KA 3PTZA 4CWAA 4I4LA 2WFLA 3FI9A 1QP7A 2QRUA 2GN4A 2JLXA 1K4YA 2OVBA 4E4RA 3VPCA 3HN7A 1EKXA 3O83A 5L3SA 4IWYA 4Q21A 2J1LA 1VKZA 3D4NA 4X8IA 3C5CA 1WMSA 2W2OA 3BMOB 3K05A 1FP4B 3CF6R 4XYEA 4IDNA 2FP4A 3TVTA 3HABA 3VU9A 2QZSA 3RO7A 5BPFA 3K1AB 1RWNA 2ZAGA 2FEOA 2ID4A 1PLKA 2OL4A 2E4AA 3PPXA 2CVFA 2BI4A 4LHYA 4QHTA 2CBXA 5FWDA 3RTBA 5IU6A 5JDIC 3GRZA 4GPD1 4PE5B 3D2AA 4DN6A 1P62B 3MELA 1RU3A 4IQFA 2GYYA 3VNVA 1QRDA 2QTVB 4RETA 5DGDA 2A1UA 2FCAA 3KZNA 2NXJA 4QYSA 3T0FA 3Q8KA 2CNWA 3WL5A 5KNDD 5EXXA 4OGFA 3HYSA 1I7QB 3N28A 2EFEB 3RAGA 4FJ1A 4Z0NA 2H1LA 5LCXA 4ETIA 2XCSB 1G5FA 5AJTA 4R2KA 4YGYA 2P7HA 2P75A 3LK6A 3NBZC 1AS3A 2WAXA 3A4TA 4K9DA 4KH1A 3HDTA 3QKIA 4PZAA 3B1KA 4BFVA 4UM7A 5CDGA 1KH2A 3AZQA 3PR3A 4E21A 3LXUX 1DOAA 1RPAA 3FOBA 4G0OA 3U3OA 1ORVA 4MUEA 1H8ED 3HFSA 3DONA 1Y1RA 2JDIA 3L7BA 1JDUA 3KDPA 2CFSA 4EW3A 3EY9A 3UOAB 5E4FA 4YRZA 3ORHA 2HI0A 5ALDA 5BSUA 3OOWA 3JD3A 1JMYA 3M4YA 3NBAA 4I81A 3OFVA 2V3CC 2FJUA 1KSFX 1ND5A 1I5RA 4TXHA 2OM6A 4K8RB 1AKUA 4B3FX 1E2UA 2GAJA 4E2FA 3PEWA 3FDJA 1FYVA 4OAPA 2FN7A 2QXYA 1N5DA 4C3UA 1P9LA 1WPQA 4IH4A 1YH3A 1EWQA 2B2NA 2BFMA 4TYQA 3TKYA 3M6XA 1IXYA 2QJRA 4EB3A 1YQWA 1NVWQ 3UV7A 1EFPA 1FTNA 4FJ2A 4LJ8A 1E1DA 2GXUA 3LPNA 4TWJA 1D2EA 4MEAA 3NRBA 3Q6IA 1U9IC 4GBJA 2UUCB 4HO1X 1QE5A 2ZYGA 3D3WB 4Q9KA 2ZDHA 1OWMA 3VAZA 2ERYA 2CD9A 1CETA 4CMIB 4DMKA 3MS2A 1K6EA 1BWPA 1BCRA 2RHDA 3KJXA 4CUJA 1Z28A 5EJFA 4ND4A 4F9FA 4HWGA 2EKQA 4Y9RA 3QKTA 3T06B 3VDQA 3SWWA 1OFUA 2FZEA 1SCNE 3AERB 2GB4A 3ZZ1A 3L79A 3FUCA 4AJIA 3P9PA 4ZARA 1MR3F 5CM9C 1U0HC 3RVKA 1K8RA 1N2CA 3U4DA 5DCYA 2A0FA 5AVSA 5JC1A 3EVAA 4IIFA 4MUHA 4AQYB 5DT2A 2H5IA 3ILVA 4KV9A 3CPEA 3EPHA 2R86A 3IAXA 3FTNA 2MWMA 2HK9A 2C3UA 3NHFA 2ILVA 2SKDA 3HZRA 1EJ0A 5HE9A 3MJTA 1TAGA 1ZMRA 3Q6NA 1SNYA 4ZMBA 1VKJA 3F7MA 2QLBA 3KYDA 5LLDA 1W36D 1KI1A 2OTJB 2OHXA 2JI4A 1N36B 1AKTA 1H0SA 1ZVKA 2KB0A 1RAFA 1K7XB 3BMQA 2OHIA 3GMSA 3W5JA 5JFOA 5SZJA 3QRWA 2HYIC 1M6HA 4NMHA 4CCYB 1CE8A 1VSBA 2HA3A 4EDHA 4EM6A 3O47A 4IF6A 2JIBA 1KQGA 1BE1A 4A6EA 2QRQA 4ADSG 2JIQA 3D6UA 4X90A 1MH1A 4Y2PA 1XQBA 4D96A 3GNSA 1PGNA 4BX0A 3WLPA 2F1LA 2FK8A 3CCVB 1ADBA 2NACA 3AC0A 5J9FA 4AP5A 5KSZA 1KWGA 3FNRA 3OX3A 3E5MA 3AV0B 3GXOA 5D2CA 1QF7A 3JU4A 3TQSA 4GMXA 2WWYA 1QXSA 2Y93A 1DC4A 3KHKA 4NBRA 4DSTA 1LK7A 4L8FA 1ZSNA 2OR3A 1SHLA 4OHKA 3RD5A 4DQUA 4PBRA 4W5TA 4JVNA 3LQYA 2VNJA 4KXMA 1N2OA 5IANA 1V1MB 1R0WA 4JNCA 1MZPA 4XOPA 4FHEA 1P4JA 3RS3A 3BD6A 4MVJM 4TLEA 1CY6A 2DT5A 1UFKA 3ZVNA 2ZRKA 2BFDA 1F7UA 1GQFA 3RLFA 1H2YA 4ZQEA 5AKZA 3JYNA 2H06A 4PZPA 3NASA 4EYOA 4P7KA 3ADCA 4TV8F 5IJXA 2JGKA 2QTRA 2IHBA 5EQTA 3L07A 3Q10A 2GESA 3E9CA 1E4EB 1ZG3A 3GH3A 3WWZA 1CUAA 5I7UA 5JYDA 1ZIYA 1VCHA 2ZWOA 3IKLA 4P0QB 2REOA 4Y9SA 4UFNA 2GZ2A 1JECA 2RH9B 3M33A 3UY4A 4C7XA 4LXIA 2PMDA 4Q47A 1V5EA 2EL7A 4Q4HA 1YGPA 4JWKA 2JAPA 2AXPA 2I3AA 1U0FA 1WZCA 2JLQA 1QE3A 1G5TA 2R97A 4KW7A 1TM5E 3I52A 2R751 3QLTA 4V0OA 1I1QB 2V1UA 2NTYC 4ISCA 3F6BX 2PZJA 4FJ0A 4OL9A 4EKGA 1P45A 1SD5A 3Q7EA 4XWKA 5CB0A 1YD7A 1FUUA 5GJWC 2G07A 3GLRA 4QC2A 3E7DA 2H85A 1I3LA 1EHCA 1NLYA 4CM9D 5EERA 8ADHA 5GONB 4D9GA 4YPVA 2CF6A 3RS5A 1JXAA 4EGCB 1HSZA 2QX9A 1Y33E 2FAXA 2XB9A 5J5CA 3J7AC 2ZZKA 3EOBI 3L4BC 4LCBA 4TUYF 4YT8A 1L4MA 5AOAA 5B4UA 1KGSA 3TL6A 1XYVA 5IJ9B 4AJ1A 1DEOA 3AONB 1EFLA 1PK8A 2ZUSA 2IC5A 2M6SA 4HAVA 3T5TA 3E05A 4HDOB 3USCS 2OK7A 5HVNA 4AJHA 4JGBA 4G4SO 3QX7A 3M4ZA 4TLAA 2NXCA 4V0SA 3WKBA 3ZE8A 4NFHA 2EHJA 2C83A 3CZRA 4OSPA 2FW9A 4C9BA 5CB4B 2AUNA 3ITDA 3EXHA 4KQCA 5B30A 2DERA 1DQNA 2BGIA 1W4RA 2CF5A 3O8BA 4INPA 4JJEA 3IBYA 5BSMA 3TL2A 4DYVA 4L4ZA 3WLLA 1RZUA 1TO2E 3F4LA 4N6GA 1E2IA 3F71A 3DZFA 3G5TA 3NGLA 4IZHA 1AF7A 1AKRA 2G9UA 3FR8A 2AZMA 3BMCB 3P1JA 4PZ0A 4RA6A 4FXOA 3OPYA 5DSXA 3SIWA 4GKKB 1GY8A 5JV5A 4CL8A 1PNVA 4RDHA 2VJJA 1VQMB 2DUMA 1HLPA 3M34A 3TJMA 4LDZA 4PAOA 4XTRA 4X3PA 4PM4A 1FNSA 1N75A 2VDPB 3GFOA 3BIWA 4MKHA 4MQBA 1K0FA 5E2IA 3A9TA 4WESA 1VF7A 3HM2A 4FWTA 3MBKA 3W4KA 3RYHB 1Y3FE 1ISRA 3CCJB 3IUPA 3RC2A 1G6OA 3ZEAA 4Q05A 4G56A 2RGDA 1GKYA 1CF4A 1E9CA 2G5CA 4W99A 3S5JA 4RC9A 1O96B 1X1AA 4G1FA 1T0IA 3PPIA 1WVMA 4IDHA 3WC4A 1B4DA 2O8EA 4QDKA 2O9JA 4TYWA 2IYLD 3QIVA 4Y2QA 1VQ9B 1O57A 2IZ1A 2AKYA 3AF6A 2DUUA 1P74A 4EG3A 5K0EA 4FUQA 4HAXA 4NZNA 4F8EA 2PX4A 2ATXA 3KQOA 1Y63A 4HDNA 3OZFA 3C7AA 3VSBA 1EG2A 2DPMA 1AY0A 3W9SA 4KSCA 4L74A 2RGBA 3GJRA 2QROA 4PZDA 4Q1VA 2ONZA 4Y6QA 1JALA 1FQWA 2BI7A 5K9ZA 1K4MA 1NNUA 1RJ9B 1YZQA 4QU0A 2X0DA 3U3MA 4BUZA 3BTVA 3H8SA 1O94A 2GZSA 5BN4A 1KDRA 2PV0A 3JWEA 2KBFA 2IUYA 3MGGA 3SS9X 1XCJA 2F48A 1AUOA 2Q6TA 4NRDA 3RHZA 4IOMA 1KDZA 2FR1A 4CMKA 5BSGA 3HCPA 3D3QA 3GBPA 3TD6A 4D45A 2C29D 2HGSA 9GPBA 4RKFA 4RD1A 4CM3A 4Z49A 3JQFA 1GA6A 2VHJA 1GO2A 2BFEB 4KACA 1I13A 3ASSA 3QVMA 3OKCA 5K8IA 1JTVA 3ORRA 3LKVA 4OLHA 1XD2B 1M83A 1SELA 1Y5NA 1HDXA 3E3AA 3ZHXA 3U4QA 3PQ8A 2I7VA 3KJQA 3V1KA 3OQ1A 1Z38A 2BKXA 1XZKA 1P31A 3DJYA 2DFPA 2NU9A 5IDXA 3QEAZ 4TKVA 5GMOA 1TLTA 5BSYA 1FXWA 3R75A 1T13A 2CK3D 3TH5A 2CYCA 5LKAA 4YO7A 1XMXA 2Z2YA 4AQDA 4X41A 1SR8A 3JZDA 5F4BA 3OTIA 3BK7A 4C4XA 1RHUA 2DH6A 3OX1A 1V8BA 4EOGA 4P86A 1ZUIA 4C88A 3WS7A 1VE6A 4U1RA 4N6OA 4AY2A 1ML4A 3G6WA 5A8AA 2B7LA 4N40A 3RBZA 1W7AA 2FVYA 1EUYA 2V59A 4F6RB 4REOA 4RE5A 4GEGA 1MO2A 4IUCS 3SY8A 5FNVB 1WRBA 1P9OA 2XNDD 2F1MA 3G2JA 3L0CA 3RRZA 3TVYA 2C5EA 3FDIA 4M0PA 1QF9A 3LTEA 3OWHA 5IZ4A 3M70A 4XTCS 3N05A 1MN6A 2ZIXA 4X6YA 3NBXX 1VG9B 2KMLA 5I4BA 1Q0SA 1W6UA 5ANRB 3RC9A 2YYSA 3NWEA 3LQKA 1T4BA 5GADl 1JFFA 5HUHA 1FX0B 2C5AA 1K88A 2Z3ZA 2A8YA 2OUIA 3O84A 1KPIA 4V0NA 4X45A 1NQ5A 1II0A 4LV5B 4U6QA 4RJ2A 5HX7A 3ND7A 4Y7DA 4MS4B 1JRLA 5K8UA 2WKRA 1SIOA 3QI7A 3RBVA 3ZLUA 1R0YA 2RG7A 3I3OA 2GVZC 3L7KA 4N0PA 3SE0A 4BNUA 2A33A 2V6MA 2IW3A 3IAAA 2XAUA 3ZK7A 5KYKA 5MN6A 4Y1GA 1E3WB 4RL6A 1N2EA 1A8PA 3ONYA 2YBEA 1ZSVA 2JD1A 5AXDA 2AUMA 3BHJA 4GC9A 3O8NA 4QBTA 5U4QA 4FOTA 3WLEA 4Z51A 5E7QA 5GVRA 1MAUA 2WHYA 4FYVA 4RY2A 4A10A 2C2GA 2FR8C 1TC2A 4LG1A 5JXWA 3IAS6 5ECYA 3N59A 1VE3A 1NW6A 5HIIA 1FCJA 1PD0A 3G8BA 3RE1A 4K87A 4BRSA 1U8YA 2W5UA 1VJRA 1NXPA 2CGEA 4MUYA 4P3YA 4ZO6A 1YRHA 4QV2A 3BSWA 4H1UA 2Q5QA 4LEIA 5ILGA 2OO5C 1AKQA 5TF0A 3WAKA 3HJGA 1AB6A 2OXFA 1BFKA 3TBHA 3W1EA 3FIUA 4B3DA 5K20A 4ROTA 1U7TA 3W78A 2XADA 3RTEA 4E31A 1D2HA 2PXCA 3FUTA 3SEFA 4C4OA 2J6BA 1GXSB 2CXUA 4RTKA 4X85A 3AU8A 4RMIA 1ZX1A 1OAOC 2WPDD 1A82A 4BP1A 2WF6A 3NETA 4KXUA 2R2GA 2R7LA 3JPYA 4RTQA 2I2BA 2V9ZA 1VYHA 1R16A 2Y1KA 2Z4TA 3OJFA 2Y2VA 4YMSA 1GD1O 4XKWA 1OX4B 2P4UA 4NZMA 3W9BA 2VTBB 5DE3A 4E30A 3ORQA 4R01A 5ED0A 4AKHA 5D3KA 1VKOA 3BJIC 3ET5A 4OHXA 3ZG6A 3FDZA 3VJKA 4JJGA 5FHRA 1WPRA 2H2DA 3RWBA 2PSJA 1XZNA 2BZ1A 3NKFA 4A3SA 7REQB 1QRAA 2PMWB 2Z6UA 2HPZA 3V4RA 3R3UA 3QQ5A 1Y9JA 2O4UX 4Z3DA 4W5JA 2GEJA 2A2ZA 1LX6A 1MEEA 2ZTUA 3AF0A 4MUAA 1CNEA 5LA6F 3QXHA 1WY5A 2C07A 4KE8A 4K6GA 4P58A 2ERXA 4X7EA 1Y1KE 3C3PA 3UAXA 2JGFA 4XOIA 4CU5A 3FKSA 4EF4A 3EMVA 5EINA 4F1JA 5JCXA 1PZEA 3WIEA 3LT4A 1PWYE 4MPDA 2X0NA 5B2ZA 1RQLA 2SICE 1WSRA 1SBHA 1QAQA 2X7HA 3SNHA 1UAGA 2PL5A 3PGMA 3U3RA 3C48A 4MYSA 4ER6A 1NVTA 3UB3A 1WUIS 2R65A 3IT2A 2O7RA 4NHOA 4ZJYA 3VKHA 1F9AA 4PX5A 3ZU2A 1HNZB 3N2EA 3DV9A 4RNCA 4D79A 5D85A 2JJ1D 2WU1A 4ZCQA 4D2IA 4TKOB 1RLTA 1FRNA 1SOAA 2OFPA 1WW2A 4C5AA 2QUAA 3NHAA 5CNIA 4G9EA 5E3HA 4LYEA 2Y05A 2H18A 2VKTA 3K70C 5T6MA 4WEOA 2O3JA 3SXUB 3ZWOA 3X3HA 2AYZA 5DNCA 3E84A 5JR3A 3K6JA 1EX7A 2F8TA 2H1FA 1VRCA 3ZDBA 1N0WA 4BMPB 3EDRA 2GF2A 1F2TA 3HE3A 1YKGA 2QMYA 3BYZA 3C97A 5F7XA 4M2LA 3B38A 1FPQA 4QAJA 4LHVA 3D3EA 1IRXA 3PT9A 3BXXA 2H5LA 2RBKA 1JBEA 2VUTA 1LX7A 3GJXC 3L82B 3UTDA 2M6RA 1VLZA 4YMTA 1EA7A 4ENPA 1M1KD 2V3VA 1YMQA 3N75A 4M21A 4A82A 4UUBA 4Q0MA 3P9KA 3HVKA 5HF5A 4OOSA 3FYSA 4BVBA 4DY4A 1A8UA 2MJLA 2O14A 2NV4A 1IPFA 1NDQA 3R23A 1D0IA 1R5BA 1GUAA 3ZCUA 2C8LA 3UZUA 5AVWA 5JSQA 3DMHA 4CLOA 4BTVA 5EJ4A 4JL5A 2L2QA 2BD0A 4KC0A 1N3BA 4KGDA 4FHGA 4ZVOA 1E66A 5AESA 5BN3B 4TZ6A 3G1WA 2GQFA 4NMMA 2I03A 1XL0A 3I9OA 3JQ8B 3U19A 3AM5A 1J9GA 4MYUA 2JASA 2QGFA 4DREA 2JJ8A 2ZKLA 3PFKA 1H85A 2Y1GA 5EXTA 10MHA 5EKUA 4RZHA 4Q3AA 4MQLA 1V0EA 5CYPA 5TQ0B 4ENVA 2E4YA 4WBNA 3IKJA 4NZ9A 1R9MA 1U1IA 2NTVA 2PX8A 3U39A 5C1DA 5KTRA 3MTGA 3N76A 3GZNA 5H5JA 2G9VA 1E99A 1MX9A 4J1NA 2N75A 3GVLA 1UXIA 3EIOA 1WCWA 3NFYA 3OO0A 1Q1AA 2PY6A 4IDOA 4M88A 2FKNA 1JZSA 4DYHA 2GK7A 3W5IA 3TO5A 3ASPA 1D1TA 3QKUA 4JUFA 1HC7A 1T6YA 1TW2A 4DV4B 4WZTA 4ZN6A 1Q6YA 3CNQS 4J2OA 2E0IA 4GMKA 1FW6A 3KNZA 4M9RA 3E82A 2GKGA 1FEZA 3C1UA 1Y1PA 2JLRA 1AHIA 3FX2A 4GC5A 5F4MA 3AM4A 3DWFA 1IHMA 1B0AA 3LC0A 3AWIA 7MHTA 1L5MA 4P6YA 1KY4A 3ZU4A 4DAEA 1QQ7A 2OSBA 3I8XA 1H2AS 3VHRA 2PVSA 4KLAA 4G5QA 3CCEB 2W4IA 4MRMA 5ALXA 5BURA 2V6JA 3UWMA 1JJ2B 2GD1O 5AT1A 3LV8A 3ANNA 4S2UA 5GIPE 2VHQA 1GADO 1X0XA 2WTMA 5FI5A 3OUZA 1AUXA 2F9MA 4HGPA 2DFLA 1E1YA 4PQFA 2JFUA 2W22A 3RKSA 4DLRA 4ZMRA 5D7NA 4YMLA 1ZCAA 4AZTA 4EPRA 3G8CA 1JH8A 1A7KA 4XGKA 4NH4A 5CBPA 2VQEB 2ZYRA 1IOZA 1YVPA 3FTQA 1GEGA 2XB2A 1ABBA 3QYJA 2QQ5A 1WWKA 2X8WA 2WFLB 3I9KA 3K35A 4PZ9A 1QHFA 4JP1A 5FLXA 1CR4A 2GK3A 3B3GA 1PK9A 3CRW1 2DP4E 3A04A 5LYJA 3VVLA 1DEKA 2W93A 5E6RA 3CKLA 1GNRA 1K63A 2EDAA 4X5OA 2FQXA 3GN2A 3RFFA 4CTMA 4UTPA 2E6UX 4JS0A 2VDWA 1XDDA 4HNSA 1VGRA 1L5ZA 4MHOA 5L3SB 4QO8A 1SVWA 2WD9A 3O2JA 3QF7A 4G97A 4A1FA 5BQ5A 1P2DA 2Y0PA 1E8NA 4DC0A 6AT1A 5HFJA 2NOAA 3C3CA 1N8SA 2J30A 2WY2D 1M5RA 2IS4A 3UWOA 4GZ5A 4UPVA 2HXGA 2FP4B 1UMCA 1HA3A 3Q12A 4XFKA 1MAAA 3VU9B 4B6RA 4LNAA 4EL0A 1VPVA 2B1QA 2G0NA 1PJAA 1X8KA 3MT7A 4MVXA 1I0LA 1R50A 5IX8A 4UUOA 2P91A 1UMDA 2QSUA 2QVYX 1LFAA 2WM9B 1U1CA 3IP7A 3RUPA 2B4KA 5AVXA 4KGZA 1NP7A 4P0PB 1LSJA 2I78A 4ENRA 3EQZA 3W5SA 1HDEA 2A1UB 3N3AC 2OBMA 4PZEA 4UHHA 2BJVA 5F21A 2FG5A 3I92A 3QEMA 1NMSA 4KIJA 3V1TC 4B7CA 2HRCA 4G5FA 4F2PA 4E3ZA 1T5OA 2PYZA 2QSYA 1GDDA 4QVIA 3K9WA 4OLAA 2EKZA 2I34A 1WOOA 4NMWA 5FJJA 1P91A 3T3DA 1JH9A 3W5AA 3RK1A 1H0RA 1OLUA 4MP3A 4E5DA 2VL7A 2FWRA 3HDVA 2JI7A 3R0IA 3DHYA 4GAEA 4L8LA 4KNWA 1IAVA 4M0KA 3ROMA 3VPAA 2AG8A 2JJ2D 2VUSA 3BXOA 4XIYA 3S29A 5AOBA 4BBPA 1SKUA 1SVLA 1YE5A 1ZW6A 3ZY3A 4EQ6A 2AS0A 1M72A 3B60A 2D2XA 1QR6A 1S2IA 3C5HA 1RXYA 1YFKA 4HEA1 2H48A 2JI6A 5FTNA 4WGFA 2XPCA 4EMUA 3GRFA 2XYVA 2FN8A 4HLNA 5KNCA 5DMHA 4EA9A 5B7NA 1G2IA 3D7LA 2GJ9A 2AJCA 1G16A 3FFXA 2V7VA 4ECEA 5J2TA 2NUAA 3TZLA 1OC2A 2ZUFA 4S0XA 3OUTA 4QUGA 4RDIA 1LQUA 2Q49A 3BDVA 1TM4E 3IQFA 3JD4A 4ARSA 4MMXB 3DBHA 4RTSA 4PQRA 3ICVA 1ULZA 1HTWA 4OP2A 1YI8A 4F7DA 2H1IA 2V7PA 3EW9A 4TTVA 3UJ9A 2GHRA 1SUWA 1P1KA 2XW6A 2XMBA 3HFRA 3GCGA 5KCMA 4LJKA 1H6CA 2BDTA 4I9UA 3O4RA 3TEMA 4AYXA 2I3GA 1G3IA 3DFZA 3TQQA 5KC8A 1ECFA 5E3IA 1AXRA 1EFPB 1IG0A 1JI0A 1Z2NX 3MT9A 4BFSA 4FPXA 4P4TA 1Q3HA 1OROA 1ULAA 2VKQA 2QY6A 4B85A 3HJTA 1J1UA 1Z63A 3IBGA 2ZR9A 3U5TA 1RYFA 3CEHA 4DCGA 5LR6A 1V3TA 3SQWA 3CP8A 5TARA 1BCRB 4E1VA 1KARA 4GYKA 4WY2A 2QZ4A 5AOCA 2XWSA 2D06A 5D7BA 2H11A 1C9MA 5HKBA 2AZXA 5C31A 4RLQA 4J7CA 5LQCA 4PTZA 1UBRS 2C31A 2ASEA 2Q3MA 3FWKA 4IDQA 5CPBA 1H4VB 2JVIA 1AKMA 1OLSA 2UYYA 1Z0JA 3V48A 5DHQA 3NUQA 3R1IA 2ZXUA 1RI5A 1N2CB 1IOVA 1Q7YD 1UKCA 2BMFA 3C4VA 4UBJA 3IVXA 3GVPA 3QKSA 5T41A 1BVHA 3B3JA 1N5RA 3LLMA 3HBLA 5AI4A 4ENUA 2J0SA 3MMNA 1UKBA 1G1AA 1KR5A 1G3UA 1V26A 2BEUA 4IIJF 2WNSA 3S2YA 4L6AA 4LY6A 5JFGA 3KYDB 4U6SA 3EA4A 3HDGA 4DCNA 2B92A 4EZEA 1NBOA 3JRXA 3LCMA 4M8LA 2QVBA 3W04A 2VZ0A 4OX9Y 5FF9A 3WKCA 3LNNA 3BMQB 4XEHA 5SYMA 5TMPA 1GITA 1NPYA 3T3OA 1YS1X 1CE8B 1U7UA 4OJMX 1EFVA 1GU0A 2WUFA 2XMSA 1QTNA 5C7OO 4FNMA 1IXSB 2PMCA 4PCVA 4NCXA 1Z4QA 3L9WA 1DRUA 1J2JA 2RJNA 3TRJA 5JLJA 3PCRB 3B9RA 2CF4A 1P6XA 4BYMA 4RD4A 3D0KA 2GO7A 5LP6A 1JR3D 4AWXA 4ER5A 1A72A 3NAQA 3EYWA 3SR4A 1NJSA 4GPEA 3L41A 2B83A 3W5UA 5LB4A 1XO1A 4WA7A 4U2FA 2FEAA 2O3RA 2P3QA 4KPUA 4P82A 2OBSA 2AWNA 4KAFA 2I9KA 1UD3A 1EWYA 2PUDA 1X94A 1VSTA 3CLTC 4H18A 1PJZA 5KJ6A 2QENA 3EPRA 3LW8A 1LFDB 1T24A 3FLBA 4FB5A 3JQBC 4V02A 4I2NA 2FMFA 1DL5A 3HU1A 1S2GA 3JVIA 4DPKA 4OQNA 5IARA 2HSZA 1W0KA 4Z0TA 2P6OA 4YX9A 2PIDA 4PSVA 3RSOA 1A7AA 4QTXA 2YQ4A 3FXAA 3SZUA 1H5NA 3SF8A 2BAGA 3W7BA 1N5JA 1J8MF 2BFDB 1LVHA 5G1OA 3P4XA 3AFNA 3N7AA 2F67A 2YV3A 5ALJA 2VOEA 2VBSA 3ABIA 5BQXA 5JS8A 2PBRA 2FOXA 4J0QA 1XMOB 5ESXA 4Y6GB 4HVLA 2XBLA 2JLUA 1TW3A 1U99A 1H8HA 3NE5B 4UZFA 3Q87B 1L4YA 4IILA 3F4BA 3IRUA 4ON9A 4RZIA 5GQSA 2ZU0C 3KKLA 4LFCB 4G7XA 1LBIA 1NJ5A 3HG7A 3Q8XB 1QH1A 1MLDA 2O3TA 1LD3A 5IYWA 2AD1A 4FE4A 1Z2PX 2B78A 1BLIA 3RVBA 3FBWA 3TLGA 4WBNF 4Q4HB 1XCGB 5ALIA 1PX2A 4C7JA 1EX1A 1KZGB 1XK7A 3GARA 1S3IA 3NBYC 2XUIA 4KVAA 4N01A 4BL5A 1DJQA 1H6AA 2QMHA 2RDMA 3RUDA 1A1VA 3O03A 1VIMA 1T0UA 1G41A 4D3ZA 2X8LA 2Q9UA 3QZUA 1V0FA 2B20A 2UUPA 5D84A 1P2UA 4BNJA 2YFQA 2BEVA 4X24A 1SU6A 2AR9A 2QLTA 2X41A 2ZJ0A 3CV3A 3EXG1 1XXHE 4ZOQI 5JEEA 3VI4B 3ZWBA 3GZTB 4HRXA 5IRCD 3OZUA 1E1RA 5EY5B 4EJSA 5LOVF 2PZKA 1I0ZA 3TKLA 2VJIA 2IX9A 4IH1A 1GNTA 3K0FA 1AV6A 2HSDA 1N57A 3LG2A 2ZE5A 3HVIA 3D8BA 1OU0A 3WOHA 1TIPA 5FQOA 5BUCA 3WYCA 1YHYA 3EGIA 1Q0ZA 4YT4A 2IY7A 4A0QA 1JR3E 2AKAB 4Z2AA 3OA0A 4KPFC 4CLEA 3EGDA 4ACBA 2CLOB 5TY0A 2PFKA 4GOKA 3THYA 3EXHB 1HE4A 1K4KA 3KUKA 4KEAA 4QQRA 4D1YA 4MYHA 4ONEA 1RBQA 3T9CA 1SBNE 2XDQA 4ARBA 3CP2A 4BS9A 4C0SA 4TLBA 2XITA 3LY9A 4RA6B 3X44A 2N1MA 2PTHA 4R1OA 4YJ2F 2A9OA 3OPYB 2Z1NA 5BMOA 1SXJA 1ZI6A 3NHMA 1UBFA 2C0PA 2FEXA 4QFDA 1NDHA 1H69A 2ZI7A 4PTYA 4D0NA 1L5RA 5LYJF 4XFJA 1U8TA 5IVPA 1TFUA 1XVAA 2MSWA 3GDHA 3O3NB 3VA7A 2R1VA 1RQGA 4IQ8A 3WHPA 3WK5A 3U44A 4OQLA 2GETA 4WESB 2NM0A 1QX3A 3VGPA 2QNRA 1BMFA 2C7GA 1RZVA 3NZEA 4DZZA 1LPMA 1KQNA 4F3RA 2OO3A 1NE2A 3GVKA 2PWYA 3CLRD 1TJ4A 3M5DA 4DCUA 3W5CA 2G9QA 1RWVA 3AEQA 3KT0A 5E4TA 5I5EA 1R64A 2Z8YA 3T4EA 1CZRA 3DTNA 3VR4A 2O8EB 2HU8A 3LUAA 4CQLA 4WUVA 3TCNA 2FW1A 2YTZA 1Z5VA 4K1XA 3W2EA 2CNOA 3KV3O 1FDSA 3UK7A 1GTZA 1VXOA 1YIAA 3QPDA 4O1MA 4U3JA 1I5OA 3B2EA 3I39X 3HDJA 4H15A 3D8TA 4WXYB 1XLVA 3AHFA 3RM3A 3ETGA 1LSSA 4LXUA 4HDNB 1MX1A 2FWMX 4S1WA 4PNZA 4V2IA 3ZLBA 3HDHA 2GJRA 5FORA 3ISTA 5JBIA 1IHXA 2PLRA 5BSWA 3SFZA 3ZWCA 2HBYA 1KZ9A 3A1PA 1ONBA 4H9GA 4X20A 1FP7A 1RWQA 2CL6X 3GNQA 4OI2A 1ZA2A 5B64A 5BN4B 4IY1A 5B1EA 3D59A 2ZJYA 3P0HA 1OGJA 4Q9IA 4IV5A 2Z9CA 3NPAA 4XGNA 1ABEA 3WBFA 3EG5A 3OM1A 5JZBA 3HK2A 4NBLA 3WGNA 4DIEA 1JEEA 1KAMA 3LHKA 2TMKA 5JNWA 3LA8A 4PZUA 4CIDA 1MIOA 4CEJB 3OEEA 1J33A 2C7PA 1RAGA 3HP4A 2X2OA 1R6DA 1DAGA 3QP9A 3PV0A 4G63A 1KZ6A 1N4DA 3DOJA 3NKLA 4UMFA 3T53B 4I6EA 3UAYA 4E88A 5I9LA 1Y80A 5J2TF 4YCCA 4DV7B 1ISMA 3U4QB 1W5TA 3AETA 2DLNA 2R7NA 4HPWA 4LHEA 3M6FA 1GKUB 1VG0B 1IVNA 3P4UA 1UAAA 2Q4TA 2NU9B 1KQFA 4OU5A 1QZTA 2M98A 4TKVB 1KSHA 1N07A 3TNYA 2AHRA 1I7PA 3AY6A 3TZ6A 3KS9A 4LZPA 4D46A 3A37A 4IUDS 2OBYA 1PT6A 5HKOA 5TSDA 3UBTA 2VBVA 1YBVA 1UBNA 2H0QA 2V0GA 2IIVA 5A3JA 5C18A 5HGXA 2Q6VA 3VMFA 4IHJA 2ZGVA 4D4IA 4EGQA 2LW7A 3CRMA 3D6AA 2VTVA 3NAGA 4BZPA 2R25B 4OGKA 4OQXA 3RT7A 4HVCA 4LC9A 1OBOA 3M5CA 4FBMA 2V0NA 4QELA 6LDHA 2OBBA 2VHVA 3LHSA 1X7WA 2IK8A 4FIDA 2EATA 3QOYA 4QXPA 3ZCXA 2DC1A 4KKUA 2H3EA 3OIGA 4V39A 4A91A 3O1JC 4YCLA 2LRHA 2ZIXB 5TQVA 5AD1A 1L1EA 3E15A 1JIUA 2GREA 4K9SA 1NW5A 1GZ3A 2WU8A 3D9QX 2DECA 3GCZA 3W8RA 3V2GA 5JCPA 1JFFB 5CFLA 5HCIA 3W4IA 2XKKA 4IINA 2JLYA 2H3HA 2NVOA 4MIYA 3PXEA 4NFSA 4PPNA 4QTZA 2P6NA 4RV4A 3WTBA 2RI6A 2ROQA 1UCFA 3AUYA 4AJLA 1HLFA 2P77A 2NYUA 1TUEA 1ZD5A 3QFSA 2Y1FA 4V0LA 1QRUA 1DX6A 1QMPA 2B34A 1ODFA 6ABPA 4M89A 2ZANA 4OHYA 4OUDA 5HFAA 1U02A 1VJGA 5CITA 5GJBA 2ACEA 2GOYA 2ZUCA 3PX7A 1RBMA 1XMIA 2C54A 1I3NA 3WY9A 2B4RO 4P12A 1UBEA 2VYCA 1L9KA 1HDYA 1I24A 2XWQA 5DZSA 5LM3A 3P0JA 2P27A 4CGZA 3S8MA 2P0YA 3PGXA 2I0FA 1OI3A 3M6MD 1E64A 2WG1A 4LGVA 2XEDA 1JDPA 1K6JA 3G0HA 1NVAA 2YHUA 1ZO8A 3BWDD 5LDGA 5LP6F 2G5PA 2PDAA 4JCCA 1J90A 2N42A 2P9CA 1MFPA 1Z5ZA 4J9UE 3U7IA 1X9GA 3TEFA 4JL6A 3E61A 3JWJA 2HCRA 3OCUA 4E70A 1R8QA 2XGSA 1WMFA 5DEOA 4B32A 4CF4A 3IPRA 1MC5A 4V3BA 3F6PA 2SCUB 3ZWYA 2BELA 4TVKA 3H6GA 1WNFA 2BHNA 2XVMA 2ZT7A 5DM0A 3LX8A 2GCGA 1QIEA 2ZROA 4FONA 4UUPA 5HIAA 1XFOA 5I5GA 1MOPA 2BEKA 3L6DA 4QDJA 4DIDA 1YJBA 1XVTA 2PX3A 5H80A 3OY7A 1BS1A 7GPBA 3LFUA 3FDZB 1ZRHA 2IHUA 3SP1A 1NKTA 4X9XA 4UHFA 1XDZA 2PU5A 1DCTA 2YIDA 1GG9A 2IITA 2XUZA 4E6PA 3M6LA 4BX8A 4Q3OA 2CZGA 1FRVA 3RHSA 4H3VA 3TRDA 3CU5A 4IDAA 3RKUA 1DDOA 1F8GA 2ECQA 5K0TA 3EFEA 5AW4A 3KJFA 1F3OA 5BUQA 3FCXA 2BFPA 3OJXA 3G9QA 3GT0A 5ALGA 5GGXA 3RK4A 2UXBB 2G1KA 1VE9A 1N2HA 4HWSA 4GYYA 2OKGA 4MR7A 4ZQBA 4DBVO 3R6JA 3I34X 2JAOA 3T9BA 1GR0A 1OA1A 3UK0A 3LWZA 2J5QA 4HRYA 1BE0A 1P2GA 1USGA 1OAKA 1HSOA 4MWEA 3COJA 4IVNA 1FS6A 3BHIA 2GARA 3D6VA 3QWIA 4GBED 4NYIQ 1Z12A 4IHKA 2J3QA 2DKOA 4HV4A 3OTOB 1QFXA 1FSSA 1ND6A 2WQZA 3ZGVA 4EY5A 2XDYA 1WUYA 4WZAA 5FWYB 1ZN8A 3ORSA 1T8SA 3CGWA 4IVPA 2REQA 3SYLA 2GBLC 1DRJA 2PLWA 4ZI3A 4OXYA 1SBTA 3T56B 2ATVA 4OHZA 5EWLA 1LK5A 3TOXA 5ITWA 1V5GA 1QFYA 1Y7IA 2FFHA 4U4AA 1UJBA 1AGPA 2VHYA 2XDAA 4HX2A 4P5PA 3WYEA 3O93A 3RC7A 1HTTA 4INOA 1Y9AA 4KUHA 1M1UA 1QHXA 4OXQA 2A0YA 4B48A 4U2DA 2GXQA 1Z8FA 4X6XA 1C50A 1F2TB 4JH0A 2B1GA 4QPNA 1E2LA 1Q21A 2NXEA 1Q12A 5D1NA 4D9MA 4OQQA 4HADA 4HTFA 4MQUA 3QPCA 3SX0A 5A4KA 2UZ0A 2PIAA 1CZOA 3UB4A 4X95A 3KVOA 3AJAA 2WUVA 4FB4A 1UOEA 2R4TA 4BV2A 1V9SA 1RLOA 4E14A 4EFKA 3RFTA 2W42A 1WW8A 2ZUBA 3MS4A 1P1JA 2BZGA 5U4XA 2YJTD 5BQFA 2IL1A 2QTWB 5HQTA 2AQIA 1FVOA 4TL8A 4RPCA 1XG5A 1YIOA 3SHTA 2NT4A 4CLOB 2WQ7A 5CTJA 3MAJA 4MXDA 1HEYA 4CLXA 1SMKA 1C7JA 2X15A 3LGAA 1KNXA 1U8XX 1Z4KA 2Y67A 3BRQA 5AN9A 3PP8A 1T5EA 4NIMA 1ORHA 3L02A 4IUBS 2YR0A 3TZQA 2OFXA 4J2HA 3OJWA 1VP9A 2COEA 4JOSA 4B80A 1H2ZA 4UTNA 5LMZA 1VCMA 4GRIA 3WBBA 2HV9A 3TRHA 2QTGA 1I10A 2JCSA 1C5KA 2YOHA 4JOBA 4WBNB 4OH1A 3E7XA 2ZVJA 2B4AA 5IVDA 4KXXA 4UUQA 3GZNB 5A4AA 5EHZA 3M3HA 1EFCA 4RZ2A 3ZBUA 1ZGCA 4LXQA 4PIPA 4LSZA 2Y1EA 4TLCA 5LZ4A 5KNCD 1KI6A 1GAQA 3EDMA 4PXYA 3H04A 1W47A 4RFSA 4S1VA 2IHNA 1GN9A 1YB6A 1WXXA 2HJVA 3PNPA 1SKYE 2ON6A 4QVAA 1QYXA 2HK8A 3KTDA 1NR1A 3KUXA 4E1AA 4YYZA 5G4KA 5FWYA 1ZOSA 2XNKA 2Y1CA 4G9GA 5CXSA 2CE7A 2F8SA 4GEKA 2Y2UA 4OGGA 1TZBA 3VOAA 3AEKA 1HE3A 5F7JA 1Z18A 3A2LA 5JAPA 1A98A 3MCVA 1FJ2A 4WZZA 1GPYA 4UD2A 3DCIA 2CVQA 3OAAA 1YS9A 3C6KA 3CWCA 4HSGA 5J58A 1M34A 2FFJA 3GEPA 3HA7A 1Z68A 4MRMB 4NOJA 2AFRA 3VPHA 2XXBA 1JILA 1U28C 2ZIEA 4QE3A 3QVOA 4FFMA 2PS1A 1MBZA 4WBXC 1YL6A 1QK4A 2JIOA 3K9FC 4YRKA 2QTMA 4Q3BA 1KU0A 2BBWA 3V1NA 2IPNA 4BE9A 3ZI0A 2QIPA 2WV9A 3OY2A 5D1HA 4YBRA 3VR6H 2GERA 2VQ6A 2D1YA 1L4EA 4JB0A 2I55A 1HBJA 4JYCA 4M60A 4NICA 2HLDD 1VOTA 3QU4A 5DP2A 4MVCA 5DT9A 4RO0A 5HCNA 3UK1A 4IQ0A 4TWBA 2H2HA 5CBPB 1K73D 2HQSA 1O5OA 3K0CA 4N9QA 4LF9B 2V58A 4ERXA 5TPWA 1S3FA 5DBGA 3QBDA 3RAPR 2ZATA 3EBPA 2YVAA 4XCVA 3L0IB 1LDMA 1ULTA 3QE2A 2PX5A 4ZOBA 1OWLA 2R9VA 1F0NA 2A6PA 2VPPA 4IDBA 4FLEA 3REFA 3V8BA 5FA6A 5LYJB 2NQTA 5E6RB 3THOA 1XJQA 1U3UA 2IFTA 3NONA 4L4UA 2A7XA 3GRUA 4OJKA 3NANA 4B6GA 2VDWB 1XTTA 5F3RA 3DVQX 2G1PA 1U0SY 5E3JA 5CVDA 3NMUF 1WMAA 2C42A 3N9IA 4KJZA 5HRAA 1H2FA 3TQCA 3CLKA 3AHCA 1DOHA 2NZ2A 4IIBA 1N6KA 3PHGA 4KAJA 3T52A 3VH2A 5J1SB 3W34A 2FW6A 5WRFA 2E6KA 1E9VA 3G85A 3RUFA 1UMCB 3ZV3A 3QUCA 2H1WA 1ZK4A 2VH2A 3TLMA 3W05A 1OZAA 3PUIA 1PJCA 1Q1BA 2C5SA 3BWMA 3QG1A 2C78A 1UMDB 4X05A 3JX9A 3NPMA 4LJSA 5DHFA 1IQ0A 1XSEA 2XMDA 2YXDA 4G24A 5T64A 3ZR4B 4E7OA 4URUR 3RIHA 1TM3E 3CHYA 3HR7A 1CD5A 1ADYA 4HSEA 4MLCA 3WX0A 4WT7A 4XLEA 3E9DA 4L2IA 4M36A 5E1BA 3P32A 3QEMB 1RCUA 2FFAA 3OA2A 4ED9A 4LS3A 4NBWA 1X2BA 5BT8A 1Q7BA 3C8ZA 5A0VA 2M32A 1JHOA 1EWTA 5A7HA 4J4HA 2VT2A 4HXFB 1N9ZA 3DFMA 1VHTA 2LD4A 1DOZA 2FV8A 1OLUB 1QYCA 5L46A 2PH5A 3OF2A 4XUCA 1AKNA 2ZCJA 5J5AA 4MS1A 1Z26A 3MD0A 4XSGA 2WU3A 4J1QA 2F8LA 3H1AA 1YFZA 5EZ6B 4ZVVA 1D1QA 1JEJA 1BDJA 2XKJE 3E1GA 3ZNOA 2FR0A 4B6OA 4EQ6B 2PA3A 3WVNA 3ZTTA 2CJWA 1QGED 2VYVA 4OPSA 3HFGA 1ZCZA 1BJTA 3IAHA 5E6UA 3VISA 3KOZA 1LDYA 4B31A 1ZNQO 1OXKB 4Q9NA 5JS1A 3IIEA 3B6MA 4DOMA 3TAUA 1HUQA 2XTJA 4K9LA 4FZJA 1CC1S 5J2TB 2J32A 2ZJ4A 4LW8A 2O2IA 5DBFA 2NUAB 3V4PB 4E5SA 5GY7A 3L01A 1YZFA 4NEHB 4GWGA 1KJQA 3HLTA 4RMJA 4ZT5A 4KN8A 5IMBA 4D8UA 3DBHB 4N82A 2RG1A 3AHIA 3WGKA 2ZDGA 2EFHB 3R7SA 3WB0A 2MU1A 2E21A 3SYNA 3LF1A 4NPAA 2OD7A 3DNPA 3L6BA 4XM1A 3I8SA 1U04A 1F8XA 3QPUA 3PT5A 3BCDA 1MZVA 4GOLD 5GPBA 2AIRA 3RBXA 1CR1A 3G6KA 4ZO4A 4JYZA 1WV1A 4IYJA 1JI3A 4L9WA 4BTEA 1XHEA 5F77A 1RD4A 4XH9B 2XOKA 4FTWA 4C14A 4QBHA 3U7FB 3FPKA 2MSEB 2IP4A 2AOUA 1WDLA 2AC2A 3LQQA 3IQIX 2IY8A 4HFMA 1ECPA 5ISMA 5JSZA 3GFRA 4ASUA 3AKEA 5JXJA 3Q9UA 1OLSB 3TD9A 2AZTA 2H0AA 4IIVA 3O75A 2CJPA 5AI0A 2GPNA 3FD8A 4UUMA 3QKSB 1QWOA 4P84A 3WMEA 2HA5A 4L27A 2LZ0A 1PSZA 3RQIA 4J0DA 4EBBA 2VHEA 3DAOA 1KTVA 1OKKD 4LVUA 2W4MA 3M83A 2BEUB 3RRJA 4CIBA 4JODA 4AZ0A 1FFYA 3DOUA 2W7TA 3T38A 1NULA 1IK6A 3R0QA 4ESHA 1YK1A 2AK2A 2VK1A 3HUEA 1Z5NA 1O0SA 2O2EA 2VP6A 3KELA 3SSAA 2VPWA 3L06A 1ZVVA 1ISGA 1DFIA 1TUBA 2HC9A 3ZNQA 4N4AA 1PR4A 3KOXA 1E43A 1EFVB 5F9MA 2JI9A 1DIHA 1S89A 1YB7A 3IS3A 3PLRA 5TGZA 5DX8A 3TZKA 3OE5A 5KWEA 3TD2A 3V33A 2JK1A 3LC7O 4P6VF 1GG8A 1YAJA 1PR5A 2ZWAA 3VDMA 1KDOA 2CL0X 3FZEA 2F4NA 3R74A 1YVEI 1Z16A 4OIMA 5LP6B 2Q6IA 1DRWA 2R00A 3NCHA 4Y98A 4MW9A 2QNBA 4L22A 5LMNB 2J67A 2QYHA 3DHEA 3KXLA 4YECA 3O2NA 4KYTA 1IC6A 2MMGA 3O4JA 4BU1A 3OQMA 1QNLA 3FF4A 3PL1A 4KPUB 4R9UC 2AL7A 3IHLA 2WW8A 3BAFA 4R84A 5DYGA 5F7ZA 4YUWA 4Z8YA 3GHHA 4DJAA 4EKDA 2BR3A 2C2MA 1TVMA 1M2VA 3G7UA 4FD3A 1SBQA 1Z56C 3HB0A 1H66A 5J4LA 3TS1A 3VR4D 4KIUA 2WVHA 1DWOA 1TCAA 1HI9A 4J03A 5JQGF 3I6MA 4R1LA 3ZN2A 3O4HA 1DP4A 4NV0A 4UU0A 1DQSA 3HUUA 1VLMA 2J7PD 4QA9A 3SF8B 1J2RA 3C41J 1KOGA 3KE8A 4UCXA 2VQDA 4PO3X 1DBSA 2QG6A 5BMVA 3CS3A 1M7HA 4A2PA 3OG9A 4KR7A 2OV6A 4FHZA 4MHSA 3TQTA 2EWWA 2WUEA 4FYXA 3LUHA 5JCOA 1Y42X 4PO1A 5JG7A 4Z2YA 1GWNA 2P9GA 1AK1A 1WMDA 3JYQA 4JDPA 1LGYA 4NYIR 4PVDA 1FU8A 4RESA 5CA0F 2YINC 1H0HA 1QH1B 3E70C 4N8SA 5C80A 4RLSA 3TLGB 3C3WA 5CNJA 1PUJA 1GGVA 1UZAA 3RWMB 3G0CA 1BMQA 3HRHA 1K9VF 4J0HA 1PN3A 5ELXA 1O54A 1VSVA 2Z4SA 2OAQ1 2ODPA 4YUZA 3R8FA 4GKBA 4URWR 4D4MA 2ATEA 3NHUA 4TSFD 5HWSA 4A0HA 2E9SA 3P0FA 4O59O 3SHWA 1E4VA 4P53A 3VC2A 1CJSA 4MKFA 4D74A 4FZRA 5ER6A 4I55A 2BEVB 4W6ZA 1B73A 1XTVA 4CG1A 2Q3CA 2P79A 4BKMA 2BEWA 1NM5A 2BFAA 1DX9A 1WDKA 3WSTA 1XA4A 4ZA2A 4NK4A 4EJSB 1YAHA 4JUAA 4TWAA 1ZMTA 2M5SA 3HN2A 2OILA 3TI9A 4MQMA 2XUPA 1PZHA 1SCQA 2GO1A 2VDJA 2XD9A 3K0FB 3OCVA 3ONEA 4RHXA 3KQWA 2YXEA 5BSFA 2HB6A 4GRDA 2WTAA 2MT9A 5LB2A 3HJCA 4D4KA 3CJQA 3T7IA 1NJFA 4PC6A 4PFJA 4IX1A 1YDMA 2C58A 1G8KA 3E35A 3WOVA 1ORIA 3I23A 1I9GA 1MQSA 2OB2A 3EGDB 5BN5A 3UAZA 1B76A 4DL9A 1JLMA 3THYB 3GEBA 1GCOA 4Q7MB 1RPJA 1QJCA 2QD1A 2X2FA 3SKBA 1Y8QA 5F52A 1UXOA 1DKMA 1R0ZA 4I5EA 3WDLA 2PH7A 2XDQB 4JT8A 5DB4A 5TMEA 1YITB 2JFQA 3GVJA 4GW3A 4Q93A 1FLNA 4HR7A 1R0LA 1Z5WA 2E82A 1SXJB 1NLZA 3R6WA 1IMOA 1WU8A 4X44A 5J63A 1NATA 4C0JA 4CM7A 1DKOA 1G8FA 2EW1A 2D13A 2Z2XA 4EJ6A 1G3MA 1G6Q1 3PJFA 3ELDA 1ZCFA 3P0RA 1JSCA 3OCZA 1GL3A 2R1VB 1QQTA 4E7PA 4F3CA 2CZCA 3PWKA 3U44B 2BKEA 5TQJA 1OLOA 3F1LA 3MTJA 3OEWA 2OCBA 3ICOA 2R1TA 1DAHA 4NE7A 2ZEJA 3GEIA 4A6DA 2R6JA 3VVCA 1BE6A 4PLZA 4GUAA 1UZMA 3EUFA 5IC4A 1R6VA 2WSSD 3AEQB 5BSRA 5BYKA 3M6WA 4C03A 1Y98A 5ALNA 4RCVA 5HTOA 3OPVA 5E9AA 3ZNNA 2BFFA 3AJEA 4CQLB 2LZJA 1QHGA 2Q9CA 2CC2A 5GGYA 2I9PA 2OBXA 4C5CA 2X7JA 1Q19A 2C9CA 2AGVA 3MCTA 3OECA 2QN9A 4U3JB 1CVLA 5AHXA 1Z6ZA 3D2CA 5TB5A 2NZWA 2HLHA 5K1ZA 3U80A 2AE2A 1ZIDA 4CQMD 4DLWA 4WA8A 3CXCB 1G18A 3OQBA 2EEZA 2RGNC 2V7GA 1YOVA 3FI0A 4JVLA 4R8SA 4WCFA 3ZK9A 3ZNPA 5IG2A 3OQOA 1PR3A 4X20B 1L1QA 4RQTA 4CNBA 2HHCA 4OYRA 2QY9A 2WB2A 5D6OA 3D3JA 4XVCA 2RIPA 1NP3A 5IXYA 1D4ZA 4MS3A 1MRSA 3K8ZA 4I4IA 5FBKA 3WE7A 3VAAA 1EX6A 3DXYA 1G0NA 1VJCA 2WB4A 2CB9A 2R79A 1STOA 3O92A 4WH0A 5CH8A 3QE9Y 4CF5A 1MIOB 3IL2A 2QE7A 2ZFUA 3KDAA 3N87A 4BE7B 1S7GA 3K0SA 3GJ7A 3GU3A 3LNTA 2FPWA 1PL0A 3SBOA 3GPBA 3IHWA 2JEOA 5BT9A 1QPZA 3AETB 3NALA 2P3MA 2CV1A 1V39A 1X1QA 4C4TA 1K3FA 3S2FA 5AW7A 3ZUPA 2LXNA 5C35A 1FJXA 3EVFA 1QBKC 3LNCA 4Z4TA 3F5DA 1RJEA 1U0JA 1NLUA 3ZX4A 4BOYA 4HVTA 4OI0A 1P4GA 2Z8YM 5B12A 5C7LO 3O9VA 3IQGX 1S5PA 3EF0A 4QECA 4S3MA 2YWGA 4U2EA 2I67A 4YP7A 4RHUA 1JMVA 1QZXA 2I29A 2PMFA 4UNRA 3G8DA 1ZK2A 1U7WA 1GT6A 1WSDA 3FHLA 4IHJB 2HJRA 3ENZA 2B69A 2QD2A 3TL3A 2WVJA 5F1KA 4L28A 2AR7A 1O9GA 3LDAA 3MGBA 5CURA 5E1OA 3WWDA 5JC8A 2ZM6B 1OH7A 3G2QA 3L1UA 1U7DA 4G5HA 5HZAA 1A76A 1X7WB 1R6TA 1KZ1A 4RZUA 1CUYA 1T8YA 4K5QA 5C7YA 3R8CA 3W7AA 4YLEA 1CUIA 3B52X 2GPYA 2H31A 2YNMA 2OCDA 4NBNA 1R9NA 2EJBA 3ASYA 3WGYA 3ZY4A 1EK0A 2P2CA 4BEVA 4YJ3A 2YKGA 3E1YE 1IONA 5IUNC 4GG1A 3KKKA 2AR0A 3OZGA 2QVCA 5FBZA 4BMDA 5C8XA 4C3OB 3D4BA 3U61B 4EFNA 4Y67A 4FZ5A 3UJCA 2YWJA 5AI8A 4GR9A 2CLLB 4TRJA 2IU0A 1NPDA 2PZLA 1GGEA 1XMVA 2JHCA 1ZK3A 5EP2A 5HJ2A 3T9AA 4AT1A 1WHTA 1TC1A 2ACVA 5DMXA 1L5SA 3W6NA 3UF0A 1KMNA 2NNLD 4KCGA 2C77A 1E2KA 1JA9A 1SCUA 1JDTA 2V4UA 4EF5A 5AW9A 2O05A 4OUDB 4Q9HA 3SR3A 4LY9A 3WMFA 4WW0A 1N6IA 2EJTA 5ALKA 3C5VA 4KSYA 1ZITA 5EZSA 3U9SA 4GI1A 2D8MA 1W87A 1Q7GA 3Q3VA 4N54A 4PG7A 2XNCA 2ZM5A 1O87A 2BUAA 1Z4IA 4D8WA 4QBKA 1YNSA 2ZBUA 4MJLA 2D00A 3V1YA 1YSCA 2Z1MA 1OVMA 2JFGA 3JQEA 3RF6A 2HJSA 2VUIB 1Z36A 2FMUA 3D7KA 3LVRE 3DD5A 4JLVA 2VRWA 4HNHA 2RH4A 4XYBA 1CUCA 1DQZA 4LMPA 4D0GA 1RNLA 1KNQA 4Z4IA 4RXTA 4Z99A 3S68A 4W7IA 2V31A 2DWQA 2XCTB 4JJ6A 1YGYA 3PE4A 4GQNA 4ZRMA 1N33B 2IS2A 1QF6A 3AIIA 2PLFA 1UWKA 1LRKA 4P9NA 3F4KA 1QONA 1T0BA 1MT0A 4JUDX 1H23A 4MO9A 1Q2UA 2PRIA 1XZGA 2YDYA 1TB4A 1OBVA 4YROA 2ZJ2A 2MR5A 4RE6A 4C2TA 1Q77A 3PKZA 2X8BA 1UZNA 2K5UA 1LPBB 3RYFB 4XB6B 4LSMA 2NZXA 4WTOA 5E7IA 3IIIA 3U48A 1QRTA 2PBZA 2PL1A 8ABPA 4I9FA 3KJZA 3LLCA 3IXMA 4DLKA 3BEOA 4F3KA 3IVGA 1ESNA 4P4SA 2K4MA 2QI9C 1T34A 3OEYA 1SWWA 2G76A 4KXWA 4RABA 4W8GA 4XCXA 421PA 5KB3A 1JWLA 1KEUA 3DVRX 3GGOA 1SZDA 1VZ2A 2P62A 1GDHA 4IFEA 1UZUA 2DHRA 4J4TA 2TS1A 4UNNA 2WTXA 1W5AA 4JZYA 2JLWA 4NAUA 1T9ZA 4TROA 4FN4A 2IA5A 1H2HA 2NSHA 4EO7A 4ZGBA 4MKZA 5J1TB 4MR7B 1TUGA 1AZTA 1Z75A 1L8AA 3ONFA 4WY5A 3ZCQA 1L5FA 2Q28A 3Q3EA 3ZD6A 1XCMA 1F06A 3IBSA 1MPXA 4RZQA 1QFZA 3WDMA 1MEJA 4NCJA 3TB6A 5B58C 3RS4A 3O8CA 3DHVA 3L3BA 4DIUA 5FPKA 2W9XA 2FHPA 4Z3OA 5IT4A 3ZDRA 2HO5A 1QANA 2HRZA 3OM0A 2GPTA 3TINA 1KA9H 4GVPA 3UAVA 4MW2A 4NG5A 4WZAB 2OXIA 3KSBC 1HE1C 1Z62A 4Q4AA 5FFFA 3PGA1 4LXXA 2REQB 4H08A 4IJ5A 4NAHA 4V24A 3WB1A 3OX2A 3CX6A 4IIEA 2XWBF 2PGXA 4HI0E 4NAVA 4L9AA 3GRRA 4HATA 2VP4A 5EWLB 4D6PA 4KQEA 3K70D 1US8A 1WCXA 5FLYA 4W7SA 4QQFA 4JYAB 1Z0FA 3KL4A 3MEQA 3ED1A 2J08A 3WP1B 2VHXA 2ZI5