1BX1A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVQVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
total genus 97
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx1A02
1NDHA 1R5BA 1TVCA 4TMXA 4B44A 3AVUA 4FK8A 2RC5A 1OGJA 2C77A 4B43A 1GO2A 4G5GA 3CCEB 2C78A 1IJFA 3A1FA 4C43A 2NPFA 4AC9A 4B3XA 4M4SA 2VYQA 2BPOA 2QDXA 5GV8A 1QUFA 5FA6A 2HMAA 4YAWA 3CCRB 4M53A 1KK2A 3QE2A 1E64A 4N3NA 3CB4A 1CQXA 1VQMB 3ES9A 1TLLA 3I1FA 1GVHA 1K9MD 2YWEA 4RCZA 3LRXA 2VNJA 4WQMA 1K73D 5H5JA 3WBKA 1DG1G 1EP1B 4J0QA 4P6VF 3CCUB 2DCUA 1H42A 3V76A 2BGIA 5AN9A 4RD2A 3ZZ0A 4HE6A 3G4SB 1YJ9B 1M1KD 1VQ5B 3ZBUA 1FNCA 1GAWA 2OTLB 4LBVA 1QUEA 4R71A 4QFMA 1GJRA 2BSAA 2X3UA 4RCYA 1WDTA 1E63A 3QFCA 4ACAA 2QTZA 1EFTA 5KSWB 4ZGQB 3CMAB 3CD6B 4YAUA 3I55B 4RD0A 4RD1A 3LVBA 4HE5A 1JNYA 2EIXA 1SKQA 2AHOA 1ZM2A 3CCJB 2XNCA 1OGIA 5EMNA 3WBJA 1K8AD 3QSYA 3W2GA 3LO8A 2ZITA 2D74A 1H85A 3VO1A 3CC7B 1JA0A 2HCJB 4G1BA 4N3GA 3AVYA 3PENA 1QFJA 4LC0A 4PC2A 4PC1A 2QTLA 3CCVB 4RD6A 3CPWB 2RC6A 3CCLB 3MHPA 5TY0A 2VNIA 3WNCA 4ZGNB 1IB0A 1XE1A 2YWGA 4RJLA 2YWFA 1S0UA 2OK7A 3OW2B 3OZVA 1OB5A 1SM4A 1G7CA 2BM0A 1B2RA 1VQ6B 1KJZA 3W5UA 4G1VA 3WXMA 4IW3B 3J81k 5GV7A 4YALA 4YAFA 4DQLA 1EWYA 2PMDA 1JB9A 4Y9UA 3WNDA 3W2IA 4EH1A 4ACBA 3AGPA 3OJXA 1EXMA 4TMTA 3P26A 4NBSA 3FPKA 1S72B 3MMPA 1N8RD 1G7RA 1FRNA 3OJWA 1FNMA 3W5VA 1Q82D 3CW2A 1YITB 2VNHA 2GQFA 3VNUA 4YHBA 1DARA 1W87A 3MCAA 2DERA 1QGYA 3AGQA 3QFTA 4Y9RA 1W35A 1EP3B 1F60A 1FNDA 1VQPB 4PC7A 4YAOA 5JBQA 3JQQA 1ELOA 1QGAA 4ZCIA 3U6BA 5THXA 4BPRA 3WNBA 3CC4B 1J9ZA 1KD1D 3LYUA 1XB2A 4B48A 4Q7JB 1YHQB 4P3YA 3W2HA 1VQOB 1I7PA 4TMVA 2CRVA 1D1NA 1A8PA 1QGZA 1E62A 1U2RA 2PIAA 4TN1A 1JA1A 1N0VC 5HXBA 4UAJA 3FJOA 1KC8D 1BX0A 3E20A 1VQ8B 2OTJB 1R5OA 1YJWB 1VQNB 2PLFA 3U6KA 3AVWA 2YWHA 1FDRA 3VO2A 4RD4A 3B82A 3ZZTA 3W2EA 2R6HA 2XEXA 1TTTA 3W2FA 4M1KA 4NCNA 1BX1A 4MYUA 3U2QA 1KK1A 3AVXA 3W5HA 1M90D 4F7DA 1YJNB 1Q86D 4FWTA 1VQ4B 1IJEA 1W34A 2BN4A 3CXCB 4M0LA 3P27A 1Q81D 4QHYA 5TR9A 4PC3A 3ZC3A 1KRHA 2FX3A 1EP2B 1DDIA 2VNKA 2DETA 2DY1A 1NJID 4LBZA 2B7CA 3AVVA 1R5NA 5DSZA 4K1XA 1CNFA 3QFSA 1QVFB 4ZCLA 3SJZA 2QA4B 1QFYA 2BF4A 2HDNB 4ZV4A 1QH0A 5H59A 1F20A 2OK8A 3CMEB 4LBYA 2QN6A 4M2LA 4MYTA 1HA3A 3VMFA 1VQ9B 1ZUNB 1KQSB 1DDGA 1ZM9A 4U9UA 1AMOA 3ZBTA 3VNVA 4TMZA 1EFCA 3OZWA 3CRZA 1B23P 3JQRA 1QG0A 2QMUA 2QEXB 1GAQA 4C0SA 4PC6A 3WYAA 1JJ2B 3QFRA 4Y7CA 1FRQA 1QX4A 2BGJA 2GPJA 2BMWA 2BVNA 4TMWA 3G6EB 4B47A 1ZM4A 1OB2A 3E1YE 1QFZA 1G7TA 2BM1A 4H9GA 1VQ7B 1EFUA 1G7SA 1N0UA 3B78A 2EFGA 2XNJA 1FNBA 4B4DA 3CC2B 3I56B 1W2BB 1GR1A 1Q7YD 3ZZUA 1QVGB 4LBWA 2J7KA 4DQKA 1UMKA 1D2EA 1AIPA 1YI2B 3CCQB 1CNEA 3G71B 2DEUA 1KTVA 4RD3A 3CCSB 2E1RA 3B8HA 4AF7A 5TV2A 1YIJB 2B7BA 1D8TA 2CNDA 4ZCMA 3JQPA 4PGOA 2BV3A 4AF6A 3OZUA 3AVTA 3CCMB 1BQEA 1VQKB 1BJKA 3WY9A 4FN5A 1VQLB 1TUIA 1KK0A 2B5OA 1ZM3A 1KK3A 2VZLA
chains in the Genus database with same CATH superfamily
2WSSD 4IIJA 4KAJA 3OF3A 3VC2A 4KQ9A 5G1OA 4WWHA 4H6XA 1N6PA 4E5YA 4BO0A 3L4KA 4XSHA 4ZAWA 2I4TA 2XUOA 1Y1PA 4B44A 4LDAA 4G5HA 4N40A 2XWSA 3WC4A 2C5SA 5BRAA 4DJDC 4JC8A 3S8EA 3ZIDA 3AP2A 2RC5A 5BSTA 3GAZA 5HZKA 4EM6A 2BGWA 1NJ8A 4B4VA 2A5YB 1DNPA 1P0CA 3ER9A 2P27A 4QT0A 2D7DA 4MDYA 3HWX1 2EARA 3C74A 3HFJA 2C77A 3HDYA 4JN6B 2IZZA 3RAPR 4DANA 2E9SA 5A0TA 5KJ6A 1PJSA 1KJYA 2C5FA 2XKAA 3KKOA 4LYYA 5LQJA 2WHPA 1VA4A 2Q4DA 3V2IA 1IQRA 2J5BA 3FFXA 3V1NA 2ZOSA 3F3MA 3V1TC 3ZQ6A 1CZKA 5L3QA 2GCOB 1KZ7B 2ZE8A 3Q12A 5IT4A 3LQYA 3K9BA 4MRNA 4YK7A 2XMCA 4OL0A 1HDOA 3OPQA 1DUVG 2IGBA 3FKSA 1GV0A 3KHUA 4L0MA 1XYVA 3FDZA 3T94A 2ZUCA 3K53A 3VOBA 1OFVA 3F8TA 1Z83A 3WNVA 4ESHA 5K5EA 2IXDA 5KYTA 3V7WA 2IZ6A 2F1HA 3CB4A 4L51A 2E1PA 3V48A 1FYFA 1IHXA 3OKXA 4KE8A 3QOWA 2HSGA 4KCGA 3OCCA 3RJ9A 1SUBA 1USIA 1Q9SA 3EGVA 1FUYB 5AJTA 3HCAA 1VYTA 2DOKA 3LT4A 1E3XA 4HGZA 3L49A 1TLTA 4H7EA 3AF3A 2ZYUX 4MVWA 2QN3A 2FJUA 2A0XA 1F6BA 4CLHA 3VGPA 3H7IA 1BWQA 5AW8A 4TWZA 3RADC 3EAQA 1KFJB 1E3TA 1ESMA 1BWRA 4PX5A 4B75A 1EDZA 5GZ1A 3HM2A 3BE5A 1QHIA 3OUZA 2ZCVA 4RS4A 1OX5A 1OZ0A 5C8YB 4LRSB 2NVUB 3F46A 4AD8A 4BECA 4RH1A 2G0AA 3GFOA 3OZ7A 4Q4AB 1H2AS 1Y8RA 3G0CA 3KXPA 3LPCA 1QG6A 4GFDA 1L5QA 2OHJA 4RY8A 1V1JA 4RPKA 4R6XA 4ZODA 5ES3A 5AWFC 4C5AA 2WF6A 3QX7A 4ZEXA 2QW1A 2C9OA 1GKYA 1KP3A 3WRXC 3BRCA 3G7NA 2YV5A 3QFFA 3UH1A 3AUUA 5DIZA 2JIQA 3A2NA 4MYSA 1E3SA 4MR9A 1JG3A 2I4RA 4FOLA 1E2DA 2NTYC 2D8MA 3LIPA 1UWLA 4LJAA 4HB3A 4LOAA 4CYMA 4KE6A 5KDDA 1GAWA 2QLJA 2VDPB 3TAXA 5AHKA 1C7ZA 3TW4A 4RLFA 4AJ1A 4DNXA 5JI3E 1FU8A 2P2LA 1R0RE 3FTEA 4Q19A 3BC1A 4XDGA 1MJFA 1HLFA 2WIJA 5K2OA 3H4TA 1GGEA 3JQAD 3HM9A 2WB2A 1LI5A 3MQ4A 2W2MA 2ZKIA 1DCMA 1IPEA 5CLLA 3QVLA 2WJ6A 2W6ID 4HDSA 5BV7A 1MO6A 2NMVA 1N6HA 2HI0A 2WWVD 3J7AC 3DDCA 5KNBH 3FPPA 1D9XA 1U1CA 2FK8A 3EZ6A 4DB2A 1IXRC 2Q0QA 3MCZA 4HDNB 2BMDA 3OOYA 3OZCA 4PAMA 2RHHA 2PNJA 4EELA 2WHXA 3R7BA 3EE6A 4HUQB 3FTCA 3QA9A 4JUIA 2H6EA 3PUNA 4TXHA 5HGXA 3AXSA 3RJZA 2Y3IA 4JLPA 4LZJA 1L4NA 3UMYA 3VZCA 3RRJA 1NC1A 1NOIA 3HR4A 3WKDA 3EW9A 3W2GA 4ENRA 1SD2A 3VPDA 1FYXA 3CUVA 1HE1C 3N6VA 3RODA 3VO1A 2P2DA 3Q7EA 4Y2TA 5FLKA 2ID9A 4WFJA 2QTGA 4HWPA 3CS3A 2QJFA 4OK6A 2IU0A 4ZI3A 4CR6A 2D00A 4OCZA 1N2CA 1UBNA 5HFJA 1PW5A 3B1FA 1JWBB 5FYDA 4EGCB 5ESRA 4ENWA 4B09A 1OXUA 3VPAA 1M1NA 1IH8A 4IDBA 2XD9A 4PBSA 4JBHA 1XKQA 3IUMA 4BYGA 1TTPB 3ZV4A 5JAHA 2XXAB 2AG1A 1KYWA 1JHQA 1T34A 4NJEB 3E1KA 2V45A 2XUIA 4D4HA 1OI4A 2IPAB 4DR2B 2F3SA 5EWJB 5CW1A 1EVJA 4YEDA 2YWFA 3ZVLA 1YSCA 4YRQA 1ZI8A 3ZW7A 4Q1VA 3E7XA 5EHIA 1Y1QA 4D0SA 3EQ9A 3ZD6A 3R9WA 4YX9A 1G9XA 4MUBA 2JNWA 4ENQA 4HMPA 3H9BA 1LB1B 2EV9A 4CR7A 1XJCA 1ZMTA 2GTHA 4AN4A 3AETB 5BV1A 2Z4SA 1ZY2A 5E38A 4D4JA 4ZU3A 2PH7A 1O6FA 2ZUUA 2FRDC 1OPXA 1OT5A 2JIPA 3AF2A 3KB6A 1V8ZA 4FOTA 2IHVA 2W11A 2WF8A 3FOEC 1GPAA 2Q7DA 5IULC 4EG5A 1X1DA 2FB9A 4CW7A 4PWYA 1UD4A 2BOVA 5J5AA 4ABYA 4LVNA 3KVRA 5HGJA 3EG9A 4QYIA 2YDYA 5EC8A 2JHCA 4E7PA 1A7JA 4TV8B 1IY8A 2YZMA 3L0IB 2G8LA 5B30A 4H4EA 4YBZA 2PGOA 5BWMA 2P6RA 1W2HA 5LLTA 1CIPA 3BA6A 4H1WA 2ZREA 3KYDB 1LUAA 1U7UA 3F73A 1RWPA 4FYPA 2QQEA 4I1PA 3ICPA 4QPNA 4KH0A 4CKCB 5HP4A 3LGSA 4ALLA 4CODB 3ENQA 3IQIX 1N9GA 1DKLA 5JECA 1UXGA 4P58A 2JVKA 1Z4JA 4TROA 1QIJA 3SYLA 1JMKC 1VP9A 2P11A 4YCSA 3HP4A 4IIUA 2XYQA 3KZXA 2C5AA 3CF6R 2BKVA 4DLNA 1P4GA 1YQUA 5K3BA 1W5BA 4U9HS 4UUQA 2GJSA 2IXBA 4FTWA 3O3OB 4ADSG 4QOJA 5ILQA 3RVMA 4N5LA 4EZBA 2IY7A 1QVZA 2W2OA 1NUUA 2PQ2A 2Z30A 3BTSA 4FQ8A 1E4EB 3X1KA 2ZXHA 5GONA 4MUJA 4OKNA 2QA5A 4OM7A 4I81A 4QRHA 5C32A 5SV2A 3M1YA 4ZT7A 1W35A 4IMPA 5FHQA 3P4UA 3I62A 3DBVO 4RV9A 5JMTA 2OEPA 1ZJWA 4RPGA 3T0FA 3GD7A 4RTNA 4PC7A 3VKHA 2JD0A 3FFWA 5JY1A 3BHMA 4QPCA 3A27A 1G5TA 2R86A 2R11A 3LSTA 1N78A 1T2FA 4WJZA 3MIZA 2IX9A 1O95A 1X80A 5E1OA 1GEEA 5JHGB 1ZZGA 1BSVA 4LX8A 1GPNA 3CG4A 3TQCA 2A3RA 3K1AA 1FFGA 4R69A 4BY9E 5EYPA 4DLUA 4A0GA 2X22A 3JU3A 2XSZD 4GD3Q 5BW5A 4RPIA 2LKDA 4YJ2B 3LDAA 3WZ2A 1Q6ZA 4YNBA 5IKPA 1OX4B 1ZL0A 3N1UA 4L6IA 4YACA 1VL1A 2OV1A 2Q5JA 1ML3A 1G0OA 2Z83A 2ZI4A 3DM5A 3I9NA 1N2HA 2WHRA 4JMLA 4OXKA 2A7QA 5DHPA 5CXXA 3R6JA 3K9WA 3ZZ1A 2QIOA 1LC0A 5CYFA 2AQIA 1J7JA 3OP1A 1EDDA 1OV6A 1SHLA 2WTNA 1PQYA 1RIIA 3MUNA 4OQLA 4EO4A 5FLXA 5KJ1A 4XQFA 5E2BA 1PRYA 3RI3A 1WTCA 2BTQA 5CFRA 4N0PA 4DR4B 4D7AA 1YZUA 1EQUA 2ZXIA 2XIJA 2ZYSA 2OTJB 1GL9B 1KZGB 2H00A 1R5OA 4L76A 4MV6A 3ZK7A 1EWRA 1K63A 3OKFA 1J0EA 1PVDA 1RWXA 1KI7A 2FGJA 3GEPA 4OPSA 4IKEA 4B31A 4DDTA 5I7SA 1W2WB 1CTQA 1G21E 4FT2A 1XF1A 5IXSA 1H6AA 1C3JA 2I8AA 1G8KA 3DCJA 3V7NA 1M2KA 5C5IA 5AHRA 1J00A 1ZJZA 4A4DA 4GNKA 1T1SA 3FETA 2YBDA 4D1YA 4G81A 4PRKA 5JU6A 4BNDB 3L43A 2IJGX 4DQ0A 3DC7A 5HKLA 1EZ1A 1L5HB 4Q3CA 2MINA 3IUQA 2Z2KA 4MKRA 2WV9A 4WOBA 1ZCAA 4QGSA 4A2CA 5B7GA 3SDZA 5JY6A 4HQRA 5CB4A 3F9RA 1Q95A 1M90D 1F14A 1U0OC 4Z6KA 3DL2A 1IHOA 1W5FA 1CK4A 1O9BA 4C07A 3M7IA 1PJLA 2ZJZA 3IELA 4OGLA 5L4NA 3PQ3A 5LN1A 4YCNA 2QE7A 3EVZA 1NBMA 3OZBA 4CEJA 2YV3A 4KR0A 4AJJA 1PTKA 2BFNA 1SBIA 1PDOA 1P9LA 3QQPA 3BWVA 2D2FA 4KQXA 3JQFA 2JIMA 2KWIA 2WT4A 1BJRE 2PFSA 5CTJA 5G0VA 1C30B 5A4JA 3KE9A 4LPKA 1TXGA 4L4YA 3I04A 1T5LA 4M9ZA 4NCBA 3F71A 3JWGA 4KQ1A 1DWQA 3RGWS 4BTEA 4LZNA 4DRZA 3DP9A 2IPOA 4B4KA 1I4TD 2LE0A 1M83A 3CC8A 5FHRA 3R7SA 3ZKAA 3E23A 1INLA 1GR0A 1MPXA 1EP2B 3HCEA 4DNRB 4NRDA 3QNUA 2ZDGA 4NY1A 4R01A 5DKFA 1OXKB 2DETA 4XB1A 5EEGA 3QIAA 4DEXA 1I80A 2IYFA 5J4LA 3IA2A 5JS7A 2IE0A 3LBFA 2ZRNA 1C9JA 4J7XA 1W4LA 3UA3A 1J39A 3B2EA 3HL0A 3H6HA 1QYCA 5CNIA 3IS3A 1R0XA 5KB3A 4E30A 4OB7A 4RJIA 2HO5A 2RARA 4JLJA 2PVPA 1CEQA 3LX8A 2OK8A 3EVCA 4GKKB 4E5SA 1J7KA 2QGZA 3G2OA 3SZ3A 3H1BA 4DRXB 3FB1A 1C8KA 1B26A 2X3YA 4OLAA 3NCHA 1VG9B 1UJNA 3AERB 2X7JA 4ZOLB 4BNHA 2H2WA 4F2WA 4R16A 5FUBA 2GRAA 3VBEA 1RKQA 2WNIA 3E82A 2B8WA 1IZ0A 1DJQA 2EFYA 3I3SR 4PGAA 5B1HA 3QBDA 4O29A 2TS1A 5CHEA 4A3SA 3MTBA 3HEMA 2Z1MA 2IKSA 3BDVA 5H3HA 2HDHA 3UWSA 4WDQA 1QORA 1K8QA 3SLGA 1MJNA 3OQ6A 4CIWA 1M54A 5IYZB 3EPKA 3ZQUA 1NV8A 1XGKA 1LK5A 1V7QA 1D7AA 2ZE7A 4YRNA 2HK6A 4L4UA 3WQQA 4N7MA 4DARA 5BSUA 1K0FA 4LQLA 4ZO9A 1X74A 4M38A 2AJTA 3CJQA 1CDZA 3Q38A 3I39X 2JAHA 1YBVA 4FW8A 2JCXA 1KH1A 2GDJA 3D1JA 3HWWA 4QWWA 4UCXA 4M0UA 1STOA 1XZLA 3BCHA 3BSYA 1JDPA 2CUKA 2ZYHA 2REOA 1SXPA 1T36A 1U9CA 1Y7IA 2WDPA 10MHA 5T67A 2E4ZA 5B2FA 3QPDA 2DJIA 1ZIDA 1EEHA 1U0FA 2GO1A 4PSCA 2A14A 4U2FA 3B1YA 3AM1A 2FF7A 3VU0A 1JEYA 3IQHX 1ZVQA 1XD9A 4JIGA 3COZA 5K3FB 3TOZA 4DA7A 5AKGA 1EKXA 1WWKA 3FM9A 5HFAA 4BWVA 3L6OO 5BMOA 4KXUA 2GDZA 3BFVA 2QLNA 1SC9A 7ADHA 4A6DA 1Q1BA 1G7TA 1D0SA 5TT0A 2Z3ZA 3ON5A 1NUPA 3M49A 3NHSA 2OO3A 1Z6QA 4M1YA 1HVXA 3T9EA 3UGTA 2NU6A 4DJAA 5YASA 4WBSA 4IIBA 4NVRA 4BV3A 2EFGA 5ARCA 2G4LA 3AXTA 4EHBA 5K4GA 2R60A 4FMCF 1DKUA 1YOVA 2VAMA 4F56A 4YS6A 2JI6A 3NJRA 5EIOA 1GR1A 5JEEA 2FRVA 3VH2A 1U1FA 2DZDA 3LHDA 5L95A 2WLSA 3EXEA 4UVHA 2C5BA 4BNLA 1H9BA 4R3UC 2PCJA 2X0NA 3ANLA 1U3VA 1YHNA 3LNTA 4LZLA 4LG1A 5BYBA 3V4PB 1TE2A 2OG2A 3WMFA 1XQ6A 9MHTA 2O0MA 3QF4B 4TKUB 4TV9F 3EH1A 4GWKA 4CNBA 3A7DA 1QIHA 3ANYB 3PYMA 3PHCA 2JEZA 4O4JF 3TLKA 3C3CA 3ZTYA 4N5HX 2HCFA 2DEUA 2V65A 4XR6A 3ILYA 3B8EA 5FO1A 3CCSB 2AN1A 2ATVA 3RYCB 4OQYA 3TSCA 1RPZA 3OHMA 1A7UA 3PLRA 4H35A 3JQGA 3VZPA 1TVMA 4AULA 1E1RD 3GIWA 4AS1A 1AKNA 1QYWA 3TNYA 5EMMA 1WPGA 4F8EA 3KPVA 4I14A 3M4JA 1GGNA 3C8MA 3KP1A 3T9DA 2I6TA 1M34E 5G02A 4C3ZA 3GUHA 3KYJB 3JVEA 5TSDA 2FN3A 4XIFA 1WZIA 3LX5A 5CPBA 4YRTA 1YX2A 2JKVA 3CG0A 3ZCVA 2I7VA 3GY0A 3GDGA 2H1CA 1W5SA 3DT6A 1GZHB 1Z6TA 3NS7A 4X7FA 5CDFA 5B53A 1S96A 3LLSA 3R7AA 2GCNA 2RHOA 5SY6A 1HETA 3FCOA 3M4NA 4AS3A 3FYUA 1SK8A 2WIDA 1R64A 4WRRA 3V7YA 1LQTA 1ZN7A 2PU5A 1R0WA 4KG7A 4NFHA 3GLFA 3RO7A 1K5PA 3WY9A 4PICA 3QEOA 4ZT5A 3TBFA 1OLXA 4NATA 1J2TA 1P9WA 1XZQA 2J07A 4RQUA 1SIUA 3JQCA 5EUCA 4Y30A 3CPXA 1T43A 1VQLB 4IQ8A 2GPSA 3QEAZ 1YZKA 3TM5A 1JR4A 2R7NA 3JQAB 1R0KA 4I7EA 3AP1A 2HF7A 4Q3DA 4R9VA 1GL7A 4TZTA 5U4XA 2QYTA 3PI7A 2VZLA 1P5RA 1RAIA 3RIYA 5JADA 4Q0MA 2Q3FA 4IF4A 1RWWA 3G2MA 4RY2A 2B1IA 1XZIA 4EW3A 2WE8A 3K3PA 1E1DA 3EX7C 1VDZA 4RC9A 1TW3A 1IZ8A 2E85A 3CVVA 3SDBA 5BN5A 1HWYA 2AT1A 3EDYA 1RDFA 4DDHA 4URHA 4BZZA 2W8BA 3A4VA 1HLDA 2D5AA 4TTPA 3WYNA 5B12A 2YMQA 1HORA 3D6MA 5HRCA 2QMQA 3HCOA 2IZ1A 4ZJZA 1GO2A 1IE3A 4G5GA 1T8UA 2H07A 5JAIA 3N8KA 1AGRA 1MH9A 4EKDA 1W6UA 4X07A 4ER0A 2NTVA 4G5YA 3TZKA 4AC9A 4CKEA 1V16B 1XFOA 4M4SA 2REXB 1W88B 4NNOA 1QOZA 3ZDQA 3MS4A 2ECPA 3SXUB 4CXMA 1U04A 1Z0IA 3JVUA 3I4FA 4Q01A 1N2OA 3U17A 4CQLB 2XOXA 3B53X 4S12A 4IFBA 3M6LA 3SS8A 4KOAA 4U7TB 2WFLB 2VJKA 4RJJA 4QRDA 3QWIA 3WQSB 4G41A 2PWAA 4QUGA 1LSJA 3KKQA 3MTDA 4YCMA 5GIOE 3KD2A 4V3CA 3JYOA 3T1VA 1XNQB 3ZE9A 1XXHA 6CHYA 3SBEA 3P71T 5ALIA 2ZSBA 3GVJA 2VF2A 3Q5GA 1TM3E 4NOKA 1WPXA 2Q2QA 1GVHA 2VHYA 3AR6A 3EY4A 3WQBA 1VHJA 3U60B 2GZAA 3H83A 4KVZA 1DSSG 5EJGA 5K3EA 3UANA 4OU5A 1KMHB 4WESA 3RJMA 3K0SA 2OBSA 1CZHA 4G0UA 1HNXB 2R2AA 4ZQCB 4E6PA 1DELA 1FUEA 3FWZA 2JZNA 3ZEAA 2KBFA 2GCOA 2BH9A 2ZJ0A 3LH5A 4ZPJA 3WBBA 4IG9A 2ZUBA 2FTKE 5CYGA 3SBDA 4AG6A 2QSJA 3OQOA 1LGYA 2A0KA 5CGQB 1Z8DA 4LNHA 3H6GA 3X1XA 2GI4A 1HSZA 1XTRA 3CCUB 1SQFA 2XR1A 4PIVA 1GTJ1 1E18A 2FW1A 2J0SA 4TTIA 1H42A 1P62B 5KKCA 4ZARA 3R4CA 2YQ5A 1KJQA 3ZLUA 2YJTD 2R5FA 2I91A 1PZNA 2ZIZA 4H3KB 3FYHA 4LJ5A 5ELLA 2NUAB 1YJ5A 1E3IA 5K0NA 1NMEA 4KIWA 4WUVA 1AV7A 1J06A 1YRBA 4OD0A 4AMGA 2WF9A 1JDNA 2NQ2C 1NVVR 4AUNA 4EKGA 3RKRA 2FY8A 2CLDX 4QDJA 4QYTA 2JB9A 1K8YB 3FCCA 5GJBA 3KQPA 4JYMA 5DLDA 1VKJA 1R66A 4XQ9A 5B58T 5ALTA 3UWOA 3DL7A 3L8FA 4W82A 2AG6A 3A9WA 1OCEA 4ZOBA 5EMKA 2AN4A 3F49S 3PHJA 2JIZD 4GF5A 3X1MA 4D56A 3F96A 4RK6A 2BSQA 1E63A 2C3OA 4RX1A 4EBFA 4PFQA 2EWVA 2WIKA 3CUKA 3LP8A 5CFQA 3DKRA 2UYOA 2ZEJA 3LTNC 4NR0A 1UC8A 3JQDA 4ALJA 2BM8A 3K94A 1H2XA 2OUKA 3G2QA 3HZRA 3RFXA 1SK9A 2WY2D 5C8ZA 3N74A 2Q8QA 3BMOB 3EXHC 1Q92A 4RKEA 3OQIB 5IRCD 1YF3A 1AOXA 3OM0A 3N58A 3QKWA 3II6X 4HBZA 2IX3A 3AIIA 3FYCA 1J0BA 3MOGA 5C8XA 4REMA 2OCPA 2JHAA 3Q3EA 4UVIA 3GJ3A 4J0IA 3UKJA 5JIBA 4B7UA 1KZYC 2AXQA 2P9FA 3L4SO 4GOMD 2D62A 3R74A 5J2TA 3PFIA 4V0MA 1OI2A 3O4GA 5ESDA 2HCJB 1RHRA 2QT9A 3U9LA 2AS0A 1HNZB 1R6TA 2R65A 3GLTA 2EKBA 1E2PA 3LQRA 3MGAA 4NJMA 3I1IA 1VL0A 2G4VA 4TMFA 5FH9A 1P80A 2EWWA 1TO2E 2WINI 3GBSA 5TF0A 4CF5A 5AD1A 4TUYF 2PZMA 1UMCA 2D5IA 5LA6F 3NAZA 4JY7A 5CT6A 3TL6A 4TWIA 4KLNA 1KMNA 4HDNA 5CLQA 3HJTA 3DKPA 1NSFA 4AKSA 4G85A 4BX8A 4U2GA 4DT1B 2IBSA 1WZ2A 1OUMA 2BMVA 1ANKA 3DL0A 1BPLA 2Q1YA 5B3LA 4KVFA 1J1UA 4F4HA 3ASPA 3EBPA 5EJ6A 5JALA 4JJAA 1DKRA 3KL9A 4AJNA 3RNLA 4ESOA 2QR2A 1ZHOA 3MCWA 3Q0TA 1Z56C 3W5UA 2EJBA 4B7ZA 3MLBA 3MCUA 2Y1DA 3AY6A 3V3TA 3HC7A 1TRHA 3HSKA 4PFKA 4IWXA 1X7XB 3UF0A 3TN7A 4OQFA 4NDAA 2K2WA 2NUTB 1WZUA 3CEHA 4WLEA 1EWYA 3BMCB 3KDAA 3P9NA 3QP9A 4L16A 5F3WB 3PNSA 3W2IA 2YWJA 3L7BA 4PZYA 5I7HA 5ER6A 5L4SA 1CUHA 4PPYA 2ZGVA 3TGPA 3D3WA 1XCBA 1K2WA 1SZDA 3AF1A 3GT0A 3COSA 2JLBA 4KR6A 2C7BA 2RHGB 4GI2A 4IGIA 4K2HA 1E5TA 1UBEA 1ZZEA 3P0JA 1W0KA 2RIPA 3NO4A 1CYDA 3G02A 3NTVA 5ABPA 5DHAA 5IM5A 1XMVA 4JLKA 2YXBA 5KOHA 4MQFB 1AKQA 2VQDA 3BJEA 1JLKA 3P9RA 5FPHA 4TYMA 4D41A 3W5VA 3L1VA 4QWMA 3H9JA 2F4NA 2ZAOA 2J31A 1A8HA 2AHRA 2B4TO 1QH9A 1OV4A 1YB6A 4L9AA 4YRFA 1JIUA 4J2OA 5I6DA 3FOZA 2Q3HA 4HQNA 4KLAA 3K2BA 2O2HA 3KCQA 4MGIR 1D2AA 3A1SA 3ROXA 5KWJA 3CIFA 4U2KA 4UD6A 1CDEA 4TV8A 4ZJUA 4IQ4A 3MWKA 1KVQA 1W30A 5JSZA 1Z5NA 4WK0B 5J5CA 4HV4A 3NTLA 1L8QA 1G21B 2H2DA 2XDYA 4N8SA 4NEQA 3TW8B 1CF2O 4WNAB 1S2NA 2QG4A 4I2VA 3VPFA 3QYFA 3ZWCA 4BPRA 3AIMA 1EINA 3IT1A 4YP7A 3WNBA 2A84A 5EWMA 3SIRA 3KOOA 3CC4B 4XLZA 3F8WA 3WLKX 2Q41A 2POQX 4J4BA 2Q3CA 4JC5A 1R4MA 3FPFA 4PZUA 4WNIA 4LDNA 3LQ1A 2BGNA 4EY7A 4YRKA 1U6KA 3FJYA 5JNVA 2UUCB 1XD8A 1O95C 1Y1TA 5ERGB 4MQ5A 5F9HA 1QGED 3GLKA 3H2BA 4JLDA 2DOGA 3V8BA 3GA0A 1YQWA 2OCIA 1N08A 2IW3A 2X41A 4N1AA 4CL0A 5HIIA 2ZKLA 2PKXA 1CY8A 3KUUA 2Z4TA 1K6XA 3BQNB 5AUQA 2P65A 1JG1A 3OC6A 1SCJA 3PFCA 2O19A 2Z3VA 1YS7A 2NZYA 1DKNA 2VDWB 2I54A 4IXWA 2QUIA 3GD5A 3SEZA 2Q6IA 1NKVA 3EOBI 3T35A 4CG1A 1KC8D 1KDTA 2OD2A 4X24A 3UFXA 2D1RA 4RJKA 4Z2YA 2BKXA 4C88A 5FTNA 1NQ5A 3CPEA 1GDHA 5F3RA 4EJSC 4REOA 1DXOA 1YR6A 2IODA 3PYXA 3WIOA 2VJNA 1CY1A 4GR9A 5H02A 2J6BA 4BP9A 3ICEA 5ALNA 1MR3F 3PFNA 4YUVA 2QRLA 2WICA 5I5EA 1PT8A 1ZAKA 4O3MA 3A2KA 4LFBB 3ZZTA 1SGWA 2A1TS 2JW5A 1UP7A 2YHIB 1QV6A 3AUFA 4HL6A 4LYFA 4YJ2A 1SHZA 3R5HA 3EOZA 2CL6X 2GN9A 4U7GA 3ROMA 4F46A 5LM3A 4X6UA 4B9AA 4OEHA 3OT1B 4WKBA 1Y0RA 3PD0A 3VSBA 1J70A 1HQYE 4MHOA 4UATA 1VLJA 1I3MA 1MGPA 5FYQA 3GC6A 4DMUB 5CD9A 4PYKA 2IS1A 1UBUS 2CKMA 3GA5A 2W6PA 2FPXA 1P0QA 2BCJQ 3GWGA 5JCPA 1JXMA 4QJ4A 4WE3A 4JQZA 2PUCA 4ZANA 3HMQA 1YZTA 4J4TA 1SIOA 1XA3A 5KHLB 4L5IA 5HFNA 1PS0A 1PR2A 3V1KA 1IHMA 5FUWA 3VYUB 3VH4A 2QM0A 3LOUA 4CF6A 4QX6A 4AVYA 3ONWA 4RZHA 3W6PA 4F60A 1N75A 2NAPA 3AU8A 5EHNA 3S4YA 1XMIA 2J9FB 3FKJA 5K3SA 3UOGA 1WSVA 3OCWA 3R0JA 4MW0A 3IAUA 3TZ6A 3JD3A 1HFEL 1IHDA 2PLRA 3A1EA 3FMFA 1JEJA 1XDDA 2WT9A 3MCTA 4L50A 4L6AA 5DI9A 5E7QA 3UAWA 4EG0A 4ZN6A 5JMOA 2UVPB 5E6RB 5P21A 2TSYB 5LYJA 3WV5A 5JNUA 1IG0A 1UDAA 4IQGA 3UGJA 3WOVA 2QT0A 2WQ6A 3FE2A 5EIEA 4R1SA 1E94E 4XM3A 4N5IX 4Z51A 1QKJA 3B3AA 4LJ6A 1H4TA 5ALLA 5FNVF 4RTQA 2XCRB 1I0ZA 1MO5A 1RT9A 2B5VA 3G17A 3PBKA 4KFRA 2WAXA 3JR3A 5KNLA 1HDCA 3LK6A 3M6MD 4AURA 1XDZA 4F4FA 2JGAA 1GILA 2O4CA 3DXZA 2LDXA 1M6VA 3K1TA 4A5SA 1KY5A 2Q5LA 1A5SB 2H9YA 3TRFA 1VHOA 1R16A 1V48A 1YVRA 1XTBA 1W1WA 2FUEA 2YYAA 1W19A 3FFAA 4P4SB 4GE3A 3TMKA 4EHAA 2QVBA 4Q4LA 1ADBA 4PNPA 4AZ0B 1FYVA 3U44A 1GKIA 1NY5A 1U8AA 4FEGA 4X8OA 3SSOA 1M7HA 4U7FA 5KQMA 1AV6A 2CL0X 1VLMA 4H15A 3WFJA 1X38A 4BMSA 4PQRA 5F5XA 3TVTA 1G5IA 5SYMA 1TCBA 3TQFA 4QKQA 3HQ4O 5AW9A 2GPYA 5HKKA 4P32A 4M8NE 1X8XA 4X62B 3LW8A 3RK0A 5IHXA 1Z8FA 4V0OA 4LJRA 5CCBA 5KYNA 4MGHA 4WBNB 4P08A 3WDMA 2DPLA 2I6GA 1PX0A 2PBRA 1WXXA 3W3AH 4QUAA 2GTIA 3R8XA 4P7BA 1OWLA 2NSYA 2MMGA 4A8PA 2WC1A 3UYLA 1YZ3A 2EX4A 5MGNA 4ZOAA 3P7MA 3JQRA 1KEPA 4M21A 3RH0A 4PPQA 1HM5A 1W29A 3ASZA 5NLLA 1ODIA 3H3JA 1BE6A 5CG1A 1O08A 2A7XA 2DVMA 2FEPA 1NQTA 3A6ZA 4YQYA 4F5ZA 1R6DA 3DWFA 3DC2A 2F9LA 4WZAA 4ZK2A 4BO9A 3R3XA 3QFRA 4O1HA 4U7DA 3GNSA 1S89A 1Z4LA 2ZROA 4MS1A 2BGJA 2ZRGA 1XDUA 4P7GA 3FLMA 5F33A 3DE6X 3TOCA 4IFTA 1KY4A 1OI3A 4M0EA 2H1RA 1M34B 5TNXA 3HYNA 2DBQA 2AOVA 4C4PA 1N8KA 3SU8A 2GEUA 4AJKA 4EW1A 4FILA 4GOLD 3TWOA 3QPVA 4PF1A 4DA6A 1CY7A 1R6VA 1U0EA 3ZK9A 2V8BA 3NBXX 1EUQA 2TMYA 3H9GA 2V7QD 3CISA 4FX2A 4HLNA 1E7SA 2C04A 3RTCA 2W83A 4Y2GA 5CIYA 1HE8B 2OZLB 3CR8A 4L0QA 3RRYA 3THRA 3UW1A 4DREA 5LLDA 1NXSA 4PNHA 3MWFA 3I9MA 4MUKA 4AIIA 3KQTA 2ZI5A 4KO8A 4R5MA 3HJGA 4FHCA 3SMVA 4DBLC 2XNHA 3DFUA 2LCFA 1D6MA 4A0RA 4OUDA 4MUAA 2EBHX 4TMKA 1N6KA 2CEKA 1YZGA 1AIPA 3QKRB 3C1TA 2B8JA 3QV2A 3IAEA 3H8SA 4NHEA 5IAEA 2GZSA 2AI2A 5KYXB 3I58A 2YL2A 2OAP1 1L1QA 1AQ6A 2OLJA 2ZBDA 4MPRA 3FFTA 4I3HA 1RHMA 2Q4EA 4S1TA 2QBYA 1GA6A 3H2ZA 1TJ4A 1V3TA 3G7UA 5C18A 2EFDB 2PEYA 2YOGA 3OTQA 1YCFA 3M9XA 3PZBA 1I8TA 1H0RA 2J41A 2CNDA 2BGMA 4PAQA 1EE2A 4QREA 1X1QA 7YASA 1DQZA 2BUAA 3TOSA 4JS0A 3LYHA 1GUZA 5DEOA 1LS1A 4F6CA 4A7PA 1F2UA 3ESZA 4PZAA 4PGOA 1G8JA 2BBWA 1HDIA 1U4OA 2OCYC 2RH5A 3D8TA 4X7PA 3NDBB 5AVXA 2NP7A 4BZXA 1P7PA 1KMMA 2DUNA 1DO2A 3ZYCA 4C4RA 4CIAA 2CVPA 4KO4S 4MR8B 5E95A 1DV1A 2B5WA 4I50B 2Y9MB 3ERCA 1KAGA 3C3XA 3IQEA 4HY3A 4R5HA 5K8UA 4OI1A 1EFAA 3HY6A 3KVYA 3VYVA 2FWJA 3E9EA 3EDMA 5FP0A 1W36D 4JHXA 1A04A 1XCJA 4KMSA 2I22A 3KZ1E 5ALGA 4N6GA 5GIPE 2XXJA 1GN9A 1XLWA 1YZNA 3FN4A 2O7SA 3CP8A 4ASUA 2AVNA 3HA7A 3FYUC 4A8JA 5IW8A 3ZWBA 4AZ3B 2NZJA 3NDRA 3X0DA 1L7VC 1B6RA 2H06A 2IYYA 4NF2A 2G82A 4RY9A 4DR3B 4M88A 4WKOA 1POXA 3E9CA 1JLHA 1P5FA 3MGKA 4LJ4A 4N18A 5DYYA 3RVNA 4RM0A 4LXQA 1A72A 1ZM3A 1JU3A 2OWEA 4LE1A 3SI7A 3LNNA 1YIOA 2H08A 1UZLA 2WJZB 5JAQA 4NZ9A 4EVQA 4GT1A 2H0QA 1J0AA 1K27A 4REQA 4L8VA 1TVCA 4ZRNA 1XRJA 5FV7A 5GWXA 3U3OA 5EIAA 4BL5A 2ILTA 4JVSB 4QDZA 1HDZA 2AJBA 1YL6A 3AHJA 4PYRA 2MR5A 3PIIA 1OVGA 1Z0JA 2VZ9A 2H3HA 4G67A 5K99A 1PF7E 2QAGA 2A0YA 4FMCB 4UVGA 4XVUA 3M5WA 1JKMA 4EHIA 4QSHA 4Z9FA 4H3VA 1XTVA 1UT8A 1WP4A 1MB9A 1XZFA 3VPXA 4HBGA 3VR5D 1NOKA 4WEQA 2CLCX 2C2MA 2DQ4A 1G8SA 5LDGA 4YAEA 2VDVE 2IYAA 5LUAA 4BEWA 1COWD 1C81A 3E0QA 1UMBA 1GL6A 4XONA 1ES9A 2RK6A 2ZQ5A 4V39A 4O4JB 5A89A 4AY3A 3JQAA 5D51S 2OO5C 4LHEA 1DIRA 1L4UA 3I2IA 3IBYA 3DZDA 1IWOA 4PGGA 2VAXA 1ISGA 1GQ2A 1WB5A 2Z8YM 4QVKA 5EP2A 3VC1A 4YAWA 1DC5A 1XL0A 5GVRA 1SKAA 5C5DA 1Z4OA 2VTBB 3HN2A 1QTRA 2PHZA 3QE2A 3LECA 2NSJA 5CR9A 3ST7A 2I55A 3HCPA 4RS3A 2R66A 1W5AA 3PL5A 2J6CA 3WX0A 3SC3A 5L3SB 1I2BA 1OD6A 1KJIA 2AKYA 1Y9ZA 3GUUA 4D43A 3FSGD 4TXLA 5REQA 3N8IA 1O96B 2CUTA 2ZJBA 3PEFA 4RCZA 2J6HA 4X0CA 5A4KA 1BGWA 1XMXA 5TRDA 3OBIA 4WINA 4AXXA 2LV8A 4NG5A 3SLNA 2PJUA 4URYR 4D57A 5B55A 3OQMA 2HEIA 1IZ7A 2GEKA 3H5WA 3ZHXA 4FWIB 4Y6RA 3QM1A 2P6PA 3C3YA 2ACKA 4JT8A 1EWTA 1A4UA 1PJBA 3GJTA 4FCVA 1BW9B 5TVGA 3ZGNA 1IQPA 4QIHA 3ZW8A 2WSLA 4RSHA 4HXFB 1E4OA 1L7OA 1ZW6A 1X7ZB 4LKOA 4UW9A 3DKIA 5LZ4A 2FMHA 4K6KA 3O92A 4IY1A 2ZRJA 5BR8B 2ZL6A 1JHAA 1EI9A 4X3OA 2XDQA 5JNSA 4KTVE 3PC4A 3WWCA 3D02A 4PGFA 4CU5A 4X20B 2PKYX 5AN9A 1SVWA 3IERA 4R8VA 3UFBA 1NVTA 3G4SB 3VR6A 4GOKA 1K3TA 1L7NA 4L73A 5I8WA 2Z2ZA 1RAAA 3QIVA 3R7WB 5DP2A 3AY3A 4H6WA 4PV7A 4A92A 4WW0A 1V5FA 4TLMB 2XQGA 2ZB3A 2WM3A 5DDIP 4AY6A 1N07A 1MPTA 4G4SP 4QOEA 1U6IA 2L19A 4JQSA 1ESEA 4BGEA 3GRPA 1TM4E 2H85A 1MO3A 1ZNXA 4JLUA 1RBZA 1AKEA 3D9QX 4RCYA 1FDSA 3OIFA 1VHTA 5K0LA 3VPSA 2IZ0A 2ONJA 3BWMA 5JVDF 5EXEA 4CFYA 3U61B 3LLCA 1PJTA 2P9QA 1GWNA 1P4RA 3F4LA 4G0PA 2DTXA 1H8HA 2ZB2A 4PLVA 1FDTA 2J85A 1YL7A 1K2VN 4PNEA 5GJWC 1U9YA 2ZRBA 4NFLA 4P4GA 1A5TA 3UNXA 4HC4A 3WGUA 2J7PD 4MWSA 2HNAA 3PNQA 4JZYA 4BKOA 4EW6A 2OXIA 1I8DA 3Q8KA 3KD3A 3LVBA 1KXJA 3MJVA 5EXSA 3UUGA 2A57A 1K3UB 2Q1WA 3WB2A 4JL8A 1OC4A 5AVZA 2ERCA 4XQ0A 3CLUD 3MD0A 4UBJA 5IUNC 4KAAA 1M5TA 4QYWA 3LO8A 4TRRA 4TYQA 1GITA 3PGKA 3H8WA 3WISA 1NQUA 2YVKA 3O8DA 1DLIA 4L27A 3ZVRA 1N5DA 4X64B 3S81A 1TMGE 2CHVA 4DNQA 1E2UA 4L8JA 2ZS9A 2G0NA 1YL5A 2IHZA 5EE1A 2BEVA 4KGXA 2CDNA 2OXFA 3RU3A 4UUMA 4B3IA 5AUOB 5C9ZA 2QJOA 1W46A 4KGDA 4EENA 2VQEB 2DFTA 5KC8A 2QYSA 8MHTA 3PUVA 3ROTA 4C4XA 5JE8A 4K40A 1KAMA 1N2SA 4ANFA 2B4QA 1YA6A 4Z1MD 4Z9YA 2D1SA 3BMOA 2WIGA 2VBGA 3FWHA 1Z6XA 3LYAA 1S3IA 2D54A 4MVXA 5A1JA 3MHPA 1UPBA 1LU9A 2ID7A 3BDAA 4XR9A 2H2HA 4LDQA 1PYGA 2BEWB 4C06A 1IB0A 1XE1A 3L6RA 2UYHA 1V47A 2G28A 1S0UA 2HYDA 1PFGA 2VJIA 2WJGA 3OZVA 2JJMA 2HA7A 5T5QA 3A9CA 4QHTA 3W5IA 2I76A 4JKOA 2B61A 4F2HA 2P2CA 1ZA1A 3NIDB 1B2RA 3BAFA 3HCWA 1XCLA 4OIMA 1WBJB 1JLLB 3IT3A 4FGSA 2H11A 4UPDA 1J22A 1SWWA 4YH1A 5ALKA 4BBAA 3RB8A 1F2TB 3ZYZA 1BAPA 4I6GA 3WA7A 3ZNPA 4EMBA 1R0CA 3CH6A 3Q3AA 1DX6A 4YALA 1X3SA 3PCRB 4D79A 4DQVA 1NUSA 3M3DA 4UXHA 4ZCTA 1GADO 4EI2A 4Q9NA 4DUGD 5BT8A 3C6XA 1PT6A 4KL8S 4L4SA 4WY8A 3EIQA 1Y5NA 4MUFA 5BR1A 5ADVA 3BWXA 3HHPA 3F4KA 3SSAA 3Q2IA 1EXMA 2BI7A 3PXBA 4DT1A 1VG8A 4PHHA 3P26A 5DHQA 3EVGA 4K3UA 1SULA 5IMBA 1KH2A 3CNLA 5H4HA 3TRDA 2N1MA 4EMSA 3DEKA 1YBAA 1P77A 3ZS8A 1K5HA 3GVIA 3PPIA 5LD2C 4W6QA 4R7ZA 4FB5A 1FCJA 5ISMA 4RHCA 4LSGA 2XOEA 1N3YA 1XLVA 4J07A 2XLBA 2HIAA 3AX6A 4R2IA 4C5CA 1KEKA 1LV8A 2K7FA 2PR7A 4WLNA 1YZHA 2O6LA 2PZFA 4RVFA 4G0ZA 4JXKA 4DYHA 4NYMR 2NUTA 4NKRA 4EEKA 3K9GA 4XQEA 4JJEA 4NSNA 3OOJA 2O5EA 1T0UA 5C4IA 1H3NA 3UMJA 4TTVA 1T6XA 1WHTB 2HFJA 1AF4A 3PNPA 1E2KA 4XLCA 1DADA 3CN9A 1MEJA 4FBLA 1VI6A 1J5EB 1B15A 1GGMA 2C4WA 1XZEA 3G23A 4IYJA 5ALVA 3AB3A 5EA2A 5EQJB 1ELOA 2F3RA 1H4SA 4I1UA 4TUYB 1VJCA 3QVUA 2FMXA 4J3JA 1S4QA 1GFWA 3ZY5A 2CYAA 4NS4A 3IVGA 3U39A 1JAZA 3VR1A 3AF6A 3TLAA 3P5SA 4MQFA 3VR6H 1B8NA 1CE8B 1Q1QA 3IPLA 1AS0A 2IOFK 5K0EA 2XD4A 1ZOSA 2WTBA 4X7CA 5AJWA 5AKXA 4LV8B 3SM3A 1WP6A 1IEWA 5KOYA 5JZMA 2ZRLA 3ROEA 3A2MA 3G7SA 4KFCA 1RRKA 1GP2A 3JAMA 2UU9B 5G4KB 1MW8X 2VBSA 2JFQA 3PE3A 5A04A 4DV6B 1EAMA 1TECE 2DLNA 3AHFA 3GYBA 3KTAB 4LKRA 1GPMA 4M46A 1RQXA 3NCTA 4J7UA 3EZLA 1N6LA 2PIAA 4K9RA 3UXHA 2WP0A 1OFIA 1IM2A 4BE9A 5BQOA 4CMIA 1EA7A 2W2NA 2X4IA 1UC5B 2ZB8A 3G5AA 4OIFA 2C5GA 1W8IA 1G21A 3WLMA 3TGLA 2Y1WA 1QP0A 4DXAA 2GNAA 4CT4B 4X0EA 1THGA 2JI9A 5ALXA 2FKAA 2CVOA 3EFOB 2ZBEA 4EJMA 1SPBS 3W3ZB 1CRLA 4M0CA 3F5FA 4IEEA 3QBVA 5KINB 1ODFA 1VMAA 2CL7X 5K51A 4MW1A 5BR4A 1VXOA 3UOWA 3U0BA 4KN6A 2L2QA 3E9NA 1IUNA 1E5DA 4UHDA 4JJ7A 3W2EA 2WU4A 2F55A 1K68A 3NETA 5JO9A 4ARUA 2WTUA 2ZSAA 3NDIA 4PS1A 1U1IA 1PZXA 5KVSA 3KZKA 1VMIA 1PAUA 3THYB 4LC9A 1R6XA 1XPJA 1E0KA 2P9JA 1WKVA 2W43A 4O4HF 1XWWA 4YCDA 3ABSB 3ROGA 3FTNA 3BD6A 2ZTSA 3ASUA 4LYJA 5C52B 2G4CA 1QHYA 1S8NA 1D2RA 3LI2A 3K0CC 3VNSA 4GRIA 2OCKA 3UICA 1BS9A 2JANA 4RK0A 3KLBA 2Q6TA 2VYND 3KZCA 4CM7A 4IV5A 5TQVA 4WL0A 4BKMA 3H2YA 4P5DA 4E5DA 4BZQA 1RI5A 3F4BA 4YUAA 4JJFA 1NONA 1V11B 1BE1A 2BFFB 4IDOA 2BJHA 1SOWA 4YLYA 3ZU6A 3CXCB 5HJ7A 2W37A 3LBYA 3CTMA 2YHIA 3E3MA 4XN3A 1NY6A 5ED0A 3HI4A 4MUMA 2XE7A 3WXBA 2FMFA 2I3BA 4FFDA 3WMEA 4F9TA 3NHMA 1TEVA 3LCUA 2PMFA 4RFSA 1LBSA 3PQ4A 5EZ5A 4FFVA 3ZWOA 4O59O 3USCS 4BFWA 1EIWA 4DABA 5JSFA 3ZS9A 4UM5A 2C2WA 3KVNA 3TQQA 3U13A 3VU9B 1PL8A 2X40A 3TR5A 3HWSA 5TPZA 5EZYB 3FPBA 2DKNA 2PRKA 1H0HA 4D4IA 2G80A 5IPFA 4X5OA 2EF0A 1R0LA 1A5ZA 1GGFA 2GZMA 1NE7A 1YZYA 3FWYA 2VOJA 3V4LA 3LQEA 1K9SA 3OQJA 2FPMA 2IIQA 1F20A 2P6MA 2WWFA 1UD5A 1YK0A 3EZYA 4TMYA 2ODAA 1GUAA 4DE5A 4DJEC 3Q5EA 5JRZA 4W9MC 1M2WA 3KCNA 4GI7A 3W8DA 4MYTA 3H19A 4LF9B 1RE1A 3VMFA 3AUYA 2GBCA 1W36B 1OZFA 2OQVA 5IJ0B 4FBMA 2YTZA 4Q9HA 1QS0A 3GFGA 1PHRA 2GHTA 3MILA 2V98A 3Q5DA 1T4BA 4P83A 3E7PA 3FPSA 5E2IA 4M89A 3VU1A 1HDRA 4DC0A 1AMOA 2WSMA 4OP7A 1E1RA 4UQOA 3UQZA 4QXRA 1Y6FA 3DHWC 5HF8A 4PQGA 1AT1A 2MSCB 3L7MA 2CBGA 1ZGZA 1F12A 3CRZA 4CQMA 3BCUA 4DKXA 1VHWA 4QTXA 5EIXA 2PBFA 3O93A 3H2SA 3N2GB 4G8CA 3NATA 3IE1A 2CT8A 2L82A 1Q5PA 1T1EA 4MQBA 4OHCA 1JYSA 4ND8A 4BV8A 2ZRIA 2I4NA 2GZ3A 3SWWA 4RWZA 1SQ6A 4D3YA 2XE8A 4AZ0A 4DDMA 1U3WA 1JXAA 1XU9A 4J4HA 3COJA 4CGZA 2OHXA 3DS8A 3K1JA 1DZIA 2BBTA 2VXBA 4MQLA 4X7MA 1FRQA 1QTNA 3VHXA 1R4NA 3CGWA 2YFYA 1BYIA 2NP6A 3TZHA 1J6UA 3WRVA 3JWEA 4ZXFA 2C9DA 1WDKA 2WA1A 1Y89A 3GW8A 1VJGA 1SBTA 1H4QA 1Y1LA 2YUTA 3NW9A 3RROA 3HU2A 3VTAA 4I9FA 5JD3A 2YW9A 4L6CA 1JLSA 3WOHA 4Q4JB 2FXIA 4NENA 1YVDA 1JPNA 3ORSA 1TC1A 1GSIA 1E9SA 4XX0B 4Y67A 5G3YA 3QQ5A 4CCAA 3G3EA 4Z0NA 4Z9AA 1QQ5A 2GF2A 2CE2X 1TZBA 2G7MC 2WU3A 3AOGA 3A04A 4D9NA 4O0LA 3BZUA 1Q7YD 3N2ZB 2UUPA 5H80A 3IQGX 1IVSA 4KLRA 5DW0A 2F4VB 1FLVA 4LBWA 2O7RA 1CYEA 3RHSA 2Y1GA 2EKZA 4I8IA 4HDRA 5FRDA 5C31A 4G56A 3OU7A 9GPBA 2FU5C 1FTQA 2RAVA 2BFEA 3F6YA 3RAEC 1RBMA 3KU1A 5CNJA 3RVRA 5KOIA 3DLTA 1H1DA 4ETWA 4U4AA 1M34A 1LDMA 1WXQA 4JV5B 3DOIA 1Q0PA 2IHBA 4ME6A 3FHTA 1XTSA 2PRIA 4OFXA 3IO5A 1GCAA 3DD1A 1KF0A 5I9LA 2G6TA 3L46A 2G5CA 4NX2A 1Y6GA 2VSYA 4M0MA 4ZCMA 4R7GA 3V8VA 1BLIA 3ACBA 1PNQA 3ECCA 2Y1XA 3CONA 3JQ7A 1KL7A 2WTEA 3AKEA 1U28C 5ED4A 2OZLA 1OYVA 4EY8A 1K6IA 2BV3A 3HBLA 1UEJA 2OCLA 3WWYA 1E20A 2PRSA 3Q0EA 4BWFB 3PA2A 5CYPA 4I1OA 3TAHA 5CX1A 3TRKA 4FKBA 3Q8WA 3OTHA 4JKIA 1T15A 1LW7A 2CLOB 2WU0A 2O6HA 3GUCA 3Q2KA 2VP3A 4CTOA 2IHTA 3FDJA 4I4NA 3VR2A 2X77A 1TO6A 3E8MA 1QLJA 3KJHA 2IHKA 5DXFA 5BMVF 3SKYA 4KMOA 2X5JO 4HQKA 2IHUA 3RUHA 4FB4A 2MSNA 3CESA 4R41A 3U9SA 3ETNA 3MTJA 1CY6A 3DEZA 2X6TA 3C0KA 2J3MA 2OILA 4P5PA 5AK4A 4D0NA 2Y27A 4OI0A 3WLOA 2OCDA 2G63A 3DGEC 5DT2A 4DLRA 1HKUA 2H4FA 1LRLA 2BTOA 4L2IA 4A8JC 3GJ8A 4IPTA 4GZLA 1XJ5A 1UT5A 2R6JA 1FFEA 1MQAA 1U1EA 3P2YA 4QQRA 4B3MB 5AIAA 4BQEA 1Y6ZA 1G3MA 2W6JA 1FVOA 3TXXA 1DAGA 3LF1A 5IVDA 3D0KA 3OQBA 1YRHA 1U2EA 4ZDKA 5BSVA 5KYYA 1PHPA 3F78A 4RDIA 1O87A 1E66A 1RPJA 1FX0A 1RRGA 3AHEA 2BEKA 5AT1A 3WWPA 1NSTA 2DWCA 2IZ5A 3D7MA 3L07A 4G84A 4CCYB 1HG0A 1CZUA 2EEZA 2GD1O 4BRUA 2I2BA 4DWOA 2GWHA 5ICGA 1Z6ZA 3G8BA 2LWIA 3I52A 1V1RA 1H1TA 2VEDA 3CE6A 3LX6A 3AT1A 3MWEA 4NI5A 2QAGC 3R3YA 3KOMA 2XYGA 5KSZA 3OU6A 1YS9A 3GUVA 5AHWA 4YROA 5L53A 1OVMA 5F9FA 4G8BA 1KSFX 5DO9A 2QX8A 1J42A 2QRHA 4RA6A 5CJJA 2JIZA 2QDXA 2DUUA 3MYYA 4P34A 4OYHA 1OU0A 4MV4A 2VAVA 3EGXB 2QD2A 1QB7A 3NBYC 4PN7A 1A5BB 4Z7JA 2OFWA 1GLVA 2QW0X 2TMKA 3P0IA 4W8OA 3LC1O 4B3CA 3T5AA 4IOJA 1DFHA 1QH1B 1E77A 3SBOA 3OHSX 4XB2A 3AJ9A 3WB9A 2WW8A 3G0DA 4Y2YA 1QJCA 4XYLA 4D92A 1VQMB 4NMWA 3ES9A 1T2VA 1WXGA 4X65B 1NU8A 3DAPA 3PDCA 3USZA 5C8VA 5CD1A 1G6HA 5EPEA 2FHPA 2YJ6A 2JI8A 3I1FA 1XL1A 3RUEA 3JALA 3KEQA 1T0JB 1TA9A 1J8YF 4F3CA 4EUHA 2HMWA 3K0FA 4ARZA 4PINA 3FPCA 3OFKA 1X2BA 2K5UA 2R6CA 3JQBC 3CLKA 1KEWA 2CXXA 1SN7A 2AH5A 2D2XA 2NV6A 4NS1A 1ZK2A 1M2FA 1AU9A 3K2IA 1SAYA 4NPHA 5EE9A 2AXNA 4TV9A 4IGEA 2J9XB 3PX2A 1UKEA 1NJGA 3JX9A 3ESCA 1OH8A 3P9CA 2OV6A 2FFQA 5FBHA 2H4HA 5ARBA 3IJ5A 5HOQA 4MYCA 3HJHA 4HSEA 3B3GA 2PWYA 1TNDA 3V8MA 5B5SA 3SQWA 2Y71A 5IHPA 4R8RA 4RTSA 3ORQA 1QU3A 1IOWA 1ID8A 1OWNA 1U2GA 5HWSA 4JWTA 2DCUA 1R12A 3ED1A 5CDSA 5SICE 5KWIA 4OLBA 1RVV1 3INNA 3L06A 2JJ1A 2AFHE 1Z18A 2EQBA 4PQEA 1X3LA 2CY0A 3CE9A 1U8EA 3QGMA 4PSAA 1PJ6A 2HA2A 4TLAA 2ZL5A 1DO0A 3U3KA 3LHSA 4BUZA 1XMPA 4DCMA 4F21A 1PV2A 2J0UA 1WRBA 4HB2A 4E2FA 3LQFA 3CZ5A 3FCXA 2ZWVA 1KPIA 1YE5A 4IXDA 5C7IO 2PD3A 1ATIA 1EPUA 2AX4A 2QK4A 3BXXA 4HTFB 5IVKA 4OXYA 5CK4A 1QVRA 3KXIA 3V55A 4YELA 1UQTA 1W4ZA 2BEUB 1G5RA 1GZSA 1TPYA 3I01A 4Z8YA 3U7JA 2Q07A 5IJ9A 5FWYB 4HT3B 3QFCA 3G9TA 3HXKA 4C2UA 1EGHA 3KSRA 4I5GA 2F8MA 4DGQA 5CFMA 2QN9A 3SKVA 3I8SA 2A1IA 2DQYA 2RHTA 4M0FA 1JHUA 5BUZA 1JFTA 1PNVA 1R9NA 4BVLA 5HR5A 1BKSB 2XB8A 1N4DA 5L46A 1I2DA 3OQHA 4PFJA 3AY7A 1USGA 1VE1A 2CHUA 4L02A 1OLSB 4XWAA 5I9MA 5HKBA 2F8TA 3R24A 4KPFC 4JCOA 4DPMA 5KYGA 3K9NA 4NCIA 3RBAA 4DMHA 2FH5B 5E6TA 4ROTA 5DHSA 2ACEA 1XTUA 2G9ZA 1BMTA 3E7DA 5FTLA 5CJPA 5AHXA 1VPEA 3D2LA 3RRBA 2GF0A 4N0DA 3GZNA 4KRGA 3I9OA 1KBZA 3KEGA 4D8VA 3DQPA 4URZR 1E9CA 3SLRA 5KNDD 3EK2A 4GGOA 1AA6A 2VUSA 1ONNA 2YOHA 2GFIA 2M2IA 2XUKA 2QPOA 2ONZA 3F67A 3LSYA 1WB4A 3BHJA 4JEMA 1T1JA 1V45E 1WVMA 1Y98A 2C57A 3FY4A 1RPNA 4URVR 3PPWA 5BOSB 4KW7A 3E22B 3PUKA 4BLRA 2GAFA 3ND9A 4JBXA 1CR1A 2MSLA 3AKCA 4ALMA 1EBFA 4YXWD 3CURA 1DAHA 2JZOA 3IH5A 5FQNA 1DRJA 2O8CB 1BHQ1 3ZVKA 2OBFA 1FEZA 2OWDA 1N1DA 2HIGA 1SXGA 2HBYA 1USWA 4O0MA 4F8YA 5C1BA 4S05A 1N7IA 5DK4A 1MHPA 2ET6A 2R751 3ID6C 1VLYA 3BNWA 1E9FA 3BM5A 4MV8A 5HW0A 4AUMA 1RKBA 2BW0A 3SM9A 2AQKA 3WHKA 1AA9A 2C99A 2PM8A 3QU4A 1F4VA 2XGMA 3AM5A 4F6RB 1NNSA 5E3JA 2FQWA 2AX3A 4B3FX 1ZI6A 3B48A 3ZDDA 4K46A 2YQZA 3IKMB 4LFAB 4PM4A 3FZGA 4XH9B 4CV0A 1C0KA 1RE0A 2PUWA 3BXPA 4MP3A 3EGOA 4NCJA 1ZITA 3I5UA 1JALA 4MP6A 3O4IA 3PFFA 3UC5A 1BH2A 3DMNA 4NBSA 3MT9A 4EB8A 2QTFA 5BNWA 4Z4HA 5DBEX 2WKSA 2DM6A 2WPNA 1J2UA 2CMKA 3DULA 4YJDA 1GL3A 1GKKA 2H5JA 1TUGA 2JFPA 4OHBA 1RZVA 2D3LA 5I47A 4QBTA 3CX6A 4DMMA 3AF5A 2WQZA 3CXRA 4DEVA 1DRKA 1OE0A 4L5BA 3OEED 1DC7A 1VHQA 3OE7D 4HDKB 4IXNA 4OBXA 4RA6B 1I4OA 2CD7A 1XVVA 2JFGA 3FVVA 3OX3A 3S2YA 3H1EA 4OI4A 3RC3A 1P6UA 1UR5A 2GQFA 1RC1A 2GXSA 2Z3WA 4UQLA 3VNUA 2ZP1A 4H1HA 4A2PA 5HZBA 5KQLA 4QNMA 2FPLA 3WWOA 1W87A 3MCAA 4V2UA 4KQCA 5DGDA 3TRIA 2VJPA 3P4XA 2I6QA 4R9UC 3TOVA 3U31A 4EBBA 4DA4A 4ZT4A 4G37A 1S3FA 1FFSA 1DC4A 3OWOA 4CKXA 3NBMA 1RXYA 3V4ZA 3EVDA 1MOQA 4I66A 5JBQA 4QDUA 5FX2A 1HOTA 1L4EA 3KKLA 4HWGA 4QFCA 4AYTA 1J2JA 4MQEB 5AQ1A 5EGSA 2X8AA 2PAAA 4W4TA 1E9AA 1J25A 4KJXA 1HZEA 4WJKB 1SB9A 3PKZA 4Q82A 5AVVA 3DHNA 3R76A 1F0YA 2A5LA 1KS2A 3OMXA 3PXUA 2YYSA 3FPEA 4M86A 4AX8A 4AQ7A 4NDNE 5H9VA 3MTQA 4KE9A 1B8UA 2B8NA 4P80A 1P6XA 1QIMA 5J59A 1J49A 1CXZA 2XMBA 3BGDA 3NANA 4WVFA 1XKLA 4IJUA 5KYUA 4ZMBA 2Y05A 4TXMA 4WN3A 5EVCA 3S7TA 1IN6A 5TJ9A 1Z5WA 2FPGB 3FHCB 1A50B 4DADA 4X05A 3T3NA 1KJNA 3MCVA 1N5LA 2XCSB 4U7WA 2HXSA 3RF7A 1LSOA 1LX6A 2SKCA 3OX4A 4NULA 5JLAA 3ZGLA 4I3GA 4G63A 3A14A 4P4LA 2JEYA 3CKYA 1XAJA 2M1XA 2NTJA 3NHLA 3SC6A 2B36A 3ANNA 3NKLA 4CLXA 5F4MA 2GCIA 1SXJE 5PNTA 4BRWA 1Z07A 2BZSA 5LA6A 1CUJA 5K0FA 4IS3A 2OQRA 2CMDA 4UM9D 2HF8A 1SZCA 1Z06A 3L7DA 3HA3A 3D7RA 3NOXA 3GRFA 4UE6A 3VX4A 9LDTA 3HO6A 2IU4A 3RFCA 2CB9A 3VSEA 1P0FA 4NMXB 3QE0A 1Z6PA 2Y2UA 4UBIA 2GFHA 4GBED 1VE9A 1MC5A 4JGGA 1O4WA 2EX1A 1C1XA 2VPXA 2IEYA 1IN5A 2Q5FA 2YFKA 3C4JA 3LUCA 4IJWA 3O9ZA 1B00A 2Q2NA 4FCTA 4R40A 1O97C 4LDZA 1OAOC 1JAXA 4X45A 3E4DA 5G4KA 3VDXA 5G3ZA 3BWEA 4EIWA 1LCIA 4W1PA 5LP6B 3MTEA 5AW4A 5LNK1 4I1VA 2VPWA 3DQQA 3PGLA 3LDUA 3HB0A 3ROKA 4AYWA 3V9AA 4DGSA 5E4JA 2F1LA 1OBFO 2OUIA 1P4JA 3I64A 3QITA 4FX5A 4AN0A 1GZ5A 1RCUA 4C6RA 4F9FA 5FLEX 5EIWA 4E4YA 3E3LA 3BK2A 3LS2A 4X63A 6Q21A 2PH5A 3FF1A 2HDOA 1IVNA 3I9V6 1QDLB 2Z6VA 3R6TA 4DCVA 4DIOA 3HRHA 1MT3A 3NEJA 1RQGA 3DE5X 4HWSA 1T5DX 2FE4A 2DUJA 3DEYX 4W5HA 5EZQA 3VZQA 3D7LA 2V3VA 1FL9A 1PT7A 4ND4A 5CUQA 3ZI4A 2L42A 5K0GA 4EO9A 4S1OA 5HE8A 1C9DB 3G2KA 3ICWA 4YV1A 2SNIE 4Z0TA 1DDIA 4F85A 1SXJD 3GCXA 5K01A 1JEQA 3IEMA 2FPKA 3ETJA 4IJ6A 4XWTA 4Y2VA 4YQZA 4B3BA 1BVYF 4F4CA 1YD7A 1TDJA 5C34B 3WL5A 2NSDA 5I7OA 2WWHA 2ZIEA 3D7SA 3HFGA 4KWEA 3UK6A 5BWOA 3ZLVA 3KQNA 2MWMA 1W76A 2HWWA 1CF9A 1C2TA 2Z1DA 1FTYA 3CBQA 3D8BA 3CKLA 1VA5A 5GPBA 1K9VF 3KWJA 4CF4A 4G7XA 3DFIA 4NARA 2WYOA 4O8ZA 1FK8A 2VATA 4S1NA 1UP6A 1JWLA 2N46A 2ZSHA 1HA3A 4GLFA 4RENA 1VPWA 2O8EA 4FLMA 1VQ9B 3ZCQA 1ZUNB 3QW2A 2ZUWA 1DDGA 1Q91A 3ITNA 4KFUA 3PRKE 1VI2A 5IBPA 1KIMA 1RRPA 3EEBA 3R9KA 2MYNA 3WKCA 4P86A 1LPBB 1OYOA 3OLQA 2GARA 4QFBA 3CNHA 4FDUA 3DLAA 4JVOA 4C89A 3T5MA 2Z56A 4OFWA 4DR1B 4IOMA 1QFSA 4LRTB 4P3NA 4C1NA 3P4YA 4NE9A 4E51A 2DG2A 1R0BA 2FAXA 1AZLA 4KIGA 4CM1A 1RVDA 5DS0A 3K2QA 3AZOA 1UD8A 3HK2A 3WLLA 4JVLA 1I1OA 4JH0A 4M1SA 4N48A 3FSJX 4AKHA 2XZDA 4E5PA 1YHYA 2AFIE 1QCDA 1PX2A 1JHVA 1QK5A 2YC4C 4EHNA 2WK1A 4I9UA 1ZJ6A 4JBYA 4QL3A 4EUFA 5GGXA 1G18A 5DSTA 4BUJA 2DR2A 5DZSA 4BKPA 1U98A 3GUYA 4RIFA 1RFGE 4Q3BA 5HMMA 4KQJA 4XVQA 4FGJA 2I3ZA 1II9A 1PSDA 2ZIUB 4C6SA 1ZM4A 4OSEA 5JOQA 1YS6A 1XEWY 4KYTA 4YV0A 3P2KA 4CKBB 2BGGA 2WBLC 3P0EA 4BBPA 1ZRMA 4C0KA 4CLEA 1HO3A 2H92A 1OBVA 3K4PA 4IHJA 5IJZA 4EDHA 5FOWA 1G4UR 3IUNA 1ECFA 3M0EA 1OREA 2JCSA 1WXIA 2Q8PA 4UHBA 5GINE 2IEAA 4R83A 2R87A 2AMVA 4D5EA 1MC4A 2FN7A 3CC2B 2PRYA 4MJXA 3I56B 2A0WA 3CEJA 1V6AA 3UYKA 3FUVA 5I7RA 2VF8A 1BFKA 4LXIA 4I55F 1OB0A 3E1GA 4RK7A 2DBVO 5IYPA 3TEMA 3S1AB 2G36A 2HWXA 1X1RA 1UMKA 4XNFA 1EUDA 5JSYA 5BVHA 5C1OA 1XK7A 1I9CA 1L6IA 3DV0B 4JYCA 1LQ2A 3UXEA 2W93A 1CUVA 4LY6A 4B40A 3PR2B 2O2SA 3PC3A 2VP6A 3IB6A 3G2PA 5DM2A 3S2IA 2QNRA 3FCYA 3PRJA 2DFLA 3VR5A 4OLHA 3B8HA 3R20A 2CGEA 1P18A 1CZNA 3PNOA 1RIFA 5TV2A 1COWA 3NEAA 1EK2A 3SE0A 5I3CA 1SVMA 5FI0B 4WLVA 4EG1A 1CS4C 4BVGA 1KWKA 5LMUB 4D0GA 4P38A 3SQDA 1J5PA 3JQPA 2O07A 2PUJA 3GLSA 1V25A 4L95C 3VR4A 4EI8A 3S2EA 1W52X 3PRYA 3HCNA 3L4BA 1UT6A 4JVMA 4U00A 1Z0FA 9ATCA 2VK4A 1J8DA 3EXG1 3FVTA 5FNVA 2Y8EA 3T9FA 3E2MA 3Q6IA 3G8YA 3P2EA 1M1UA 2Q45A 2R00A 3IHKA 2B25A 2WZQA 4UFPA 1Y81A 3VPBA 1WZNA 5IK2D 1VCIA 1VFNA 3OCJA 2ZRFA 4RAOA 5ANRB 1IZZA 2R68A 3QMPA 1P5ZB 5LXTF 3AWIA 1Y7HA 2RB4A 3FSGA 3RFFA 5JPDA 4EUKA 1Y3IA 3SNKA 1YR2A 2HEGA 3LXXA 4UE2A 2GLXA 4E22A 1YGYA 2GUWA 2ODEA 4GICA 4IG4A 2ZBRA 4WOPA 3MBKA 5AJUA 3T3IA 2YJZA 3LC7O 3ZE8A 4G8JA 1AJEA 3CRMA 4TTRA 4BNWA 1KYYA 4GW3A 1YS4A 4HATA 2R0QC 3VKWA 2ZDQA 4UDXX 4OPOA 4WN9B 1M2GA 1R5BA 1UXKA 1G3RA 2QVCA 1U5BB 1TKBA 1TVEA 1M6NA 4HGYA 2PS9A 2PA0A 4YWJA 5BSYA 3CNOA 4BLUA 2NUPA 4JI3B 3L7LA 1EVZA 3G79A 2BJWA 3AVUA 3HLYA 1DHTA 2M1ZA 3SJPA 4X06A 1UINA 2FUCA 3HSYA 3K5HA 1XNJA 3K73O 4GZ3A 4A10A 4PABA 1LK0A 3LWNA 2C4NA 1RMTA 5IANA 5GZ3A 5KAMA 1DS6A 4GOXA 1M9NA 1WB6A 3OQVA 5EL0A 2OYCA 3UMGA 3MERA 3F3SA 3NHRA 1V3UA 4AJ9A 4YV7A 4F3TA 4DCCA 5TMBA 2X58A 3HB9A 2Z5GA 4HNGA 3GJSA 4LYEA 1QQBA 3KXLA 3A35A 3PF9A 3IRUA 1WVGA 3UEOA 3AYZB 3ZOZA 4DTCA 1UBKS 3KQSA 4TGLA 3VJRA 1XVAA 2CXRA 4YAIA 1JIXA 3K9FC 4J8PA 2C20A 1FLNA 3AZPA 5HBRA 2DIEA 1YDHA 4MSUA 3RYFA 3B89A 4IXMA 1R0ZA 4IEFB 4RIIA 1ZNZA 3T7IA 4CI0B 2UZ1B 3VH1A 2HMAA 2Y1KA 4O4LB 2F00A 3DOFA 3QV1A 4BFXA 3SD7A 2J3IA 2HMTA 3MTGA 2W71A 4UARA 4WNYA 5G1PA 3IAM6 4RGQA 3D3JA 5IAGA 3LLMA 4HS4A 3N2IA 1FVHA 4TTSA 3F5SA 4LQ4A 2GSDA 3IBGA 4NABA 2O3TA 4FFMA 1Y8QA 2O2GA 1SCNE 1VJTA 2VBFA 3I6YA 4F86A 2GPTA 2W7TA 5H4GA 2XQIA 1HE4A 2YNMD 2GYVA 4MRAA 1DBWA 1DTWA 1VQ1A 1AG9A 2QM7A 4QPDA 3WE7A 5DYIA 1GQQA 2ZYRA 4MVYA 5E1BA 4Q3EA 4E09A 4OFBA 2RCYA 2VNAA 3WDSA 2ZTVA 3V4SA 1J1IA 2W70A 4P81A 1P39A 4FDAA 1EWKA 4C2BA 4V24A 1K73D 2O0KA 4ABTA 4ZMRA 3Q85A 4H7JA 3TLCA 5BMVB 2B34A 3EGXA 1NI5A 5EMJA 2IP2A 4E2XA 2YX1A 3AFGA 1A9ZA 1KC1A 3MQ2A 4BXOA 1I6MA 2UXDB 4P6VF 1RXCA 3W1WA 1NMYA 1ETUA 1IIRA 4YMIA 1EUCB 3N2EA 4AZVA 2Y1EA 1RRMA 4FZ5A 2GA8A 3BT7A 1AK9A 2ZSEA 3PCXA 2H4XA 3Q3VA 2P9GA 2D5CA 2DH5A 4JU8A 3S2SA 1R8YA 3K20A 1QZXA 2CF4A 3H5AA 2RGGA 4HE6A 4G5SA 4JK3A 1QE5A 4ZA2A 3C3MA 1HEUA 5FUXA 1EFPA 4BU1A 1ABBA 1CEYA 1QFMA 3WSVA 1U2GC 2N9UA 3ZJ4A 1XF9A 4FMDB 2P91A 4IDPA 1LBEA 4WECA 2ZI6A 1SUSA 1GG8A 1L8AA 1C7JA 4ZVNA 2Q4RA 3P5BA 3T3HA 1QQAA 3PD7A 4PZCA 4NU0A 2G70A 3AL2A 4TWBA 5BVGA 2MYTA 2VDUE 1I3KA 4GMHA 3VR5H 1ESZA 4ZV9A 2EW8A 4KSCA 4ACAA 3SQNA 4URFA 3WA6A 1ZUIA 1TM1E 2JFZA 1MO2A 3IUYA 4FEEA 5IDXA 5E8RA 2GNOA 4IS2A 1QYXA 4DUGA 5KSWB 4XCQA 3RRZA 4C0QC 3UAGA 3VR4H 2VDOB 4O3FA 1U8YA 2CMFA 1YUNA 4U7PB 3FNIA 1B0AA 2VDJA 4GMFA 3ZLJA 3PD1A 1HT3A 4HWOA 2ICAA 3CMMA 1V26A 3D64A 4DC9A 1KZ4A 3A06A 3IVCA 3L6BA 3G1WA 4RE6A 2HUNA 1YJXA 1QO7A 3VV2A 4TT3D 4EB6A 1L5VA 5DM1A 1T3SA 2VBVA 1T2UA 3F90A 3ZWXA 1WJGA 1AUQA 2ZUVA 3M9WA 3CCJB 2E82A 1XZHA 2LVBA 1M2OA 5FPKA 3C3JA 2NU8B 4MB6A 3AEYA 4HPJB 3IBCA 5AKIA 4RTRA 1GPYA 3PITA 2NACA 1JA0A 3N7UA 1U3CA 5B2EA 1UJBA 1IXKA 1EGAA 2AR9A 3BGWA 3JTMA 1I5RA 3SX0A 5F23A 4ALNA 5ALDA 1D2HA 2OMEA 1D9ZA 9ABPA 3WKAA 3PHLA 4ZZIA 4Z9BA 3LGAA 3EWIA 3RLFA 1UZNA 4PC1A 1F1BA 1XAIA 2QG6A 3G1UA 4CEHA 1TM7E 3H9NA 2FPIB 3F74A 4IVQA 4KVAA 1RLTA 4RD6A 1Z5OA 3WLHA 3ZI7A 4L28A 3CPWB 3KV3O 3TZLA 1U3TA 4JYPA 4RZQA 2O9JA 2DBZA 4JJKA 1EEXB 4UTVA 1VI5A 1XN4A 3WNCA 4ZGNB 1WPQA 3NAGA 1MZPA 4RJLA 3GK3A 3NHFA 3GVPA 3R6GA 4P36A 5EOVA 4OBWA 2FJPA 4HGQA 3CZQA 3TRJA 3FHOA 1ZPDA 1LTQA 4M9SA 2NPIA 1G7CA 1Z26A 3EGDA 1GNQA 3LL7A 4JLVA 5ELMA 2P3OA 4UM9B 4NIMA 1NAHA 1JKXA 1KJZA 2C9YA 4JI1B 4EFKA 3BK1A 3FMIA 1RD4A 1SU6A 4TL9A 1H93A 1C4KA 1WZEA 3BN3A 4N0MA 1OW3B 3KLNA 4HQLA 3ZH2A 1BQ3A 3S2UA 2VPZA 1Y6QA 4HCJA 3ZJYA 3CJRA 4IHQA 5BRNA 2QLBA 4TVSA 3EIXA 4JXXA 1Y8AA 4NICA 5U9CA 3C43A 2C5HA 1JGTA 2WVHA 2L69A 4NBVA 4LYAA 2D2EA 5IC4A 3QTLA 4OLFA 3OLWA 3AR4A 5AM1A 4RPBA 2W4IA 1KPHA 3E22A 1SZJG 1ARZA 5FI1B 3CXUA 2JG3A 2QRVA 3FUUA 3M1LA 2PX5A 3NDJA 3UY4A 4DIDA 2VR1A 5TT1A 5ES4B 1O0BA 5HQ3A 5JYBA 4YMUA 1YQ9A 3NGLA 3L8GA 1J8QA 3OZFA 2Q62A 1BEZA 5K8JB 1BDHA 4K86A 2ZK7A 3OUUA 1ECGA 1YFZA 1J5XA 3P9QA 3RS2A 1GFIA 4BNIA 4BJ6A 1QC5B 1YNSA 1AGXA 1Q6YA 2FZEA 2OOKA 3S29A 2PSDA 1WXDA 1SOVA 2D0PB 1ZM7A 1EK6A 4DG5A 3LGXA 3ZE1B 2XB6A 2QU7A 4E46A 1Y82A 2O20A 5EHQA 1SXJB 2F1IA 3B6ZA 3H5OA 4UE3S 2Z2JA 3SS7X 4CBVA 5MN5A 1FNDA 2VBIA 2QN2A 1DPGA 2IDZA 1RP1A 1NHWA 2O5VA 4CIBA 3GFQA 5JVDA 1YA8A 1GPBA 2IYSA 1FSPA 1ZN8A 4G24A 2OLEA 3KSBC 1BHO1 1NVEA 3ASQA 3A3PA 3LKBA 1XBTA 1Z88A 4X1IB 3GT7A 3WKBA 5BUQA 4V1CB 4HZIA 1GTRA 1J2EA 1ULZA 1XD2B 3SXPA 2BHRA 2FSVA 2G07A 3Q11A 2CXSA 3DBOB 4H6VA 1YHZA 1OLUA 2OR3A 3EDOA 2B92A 3T6KA 2CK3D 2P30A 4IZ6A 2JGLA 4L8LA 1XEAA 2IPLA 2YZKA 3HP7A 4FYKA 3WL4A 1RWVA 4KDFA 1L7PA 5D5PA 5F52A 4QICA 1MDFA 1CR6A 4G65A 5DM70 2CRVA 2DT8A 4KBGA 3E27A 3EUAA 3D81A 4C87A 5D7BA 3CRW1 2RGYA 3MELA 2J48A 3JVDA 1ZL2A 2KW5A 3E2IA 3KWMA 3SHQA 3MBOA 3MAGA 1C50A 4Y1GA 4NHOA 3OHPA 3QE4A 4K03A 3QEMB 3HKEB 3GLGB 2VK2A 3HS3A 3W6NA 3I1YA 3IRVA 1N5JA 1IUOA 1CP3A 1J2YA 4KOEC 1DBSA 3HTXA 1ZD5A 4UMFA 3TKYA 2VJMB 2R8RA 3Q0IA 3D3NA 5ITZB 3M4YA 3IESA 3RT7A 3ZDRA 4ZYZA 2VQ6A 1DB3A 1TCUA 1YA4A 3R77A 3GVLA 3FX2A 3Q88A 3N70A 3OY7A 2RAUA 3WDLA 1A8SA 2R8YA 3CUUA 5KWSA 1XI2A 3OURA 3A2LA 1BX1A 2J1LA 2VKQA 1PR0A 2VCYA 1SIWA 1N34B 4Y2JA 2GLUA 5BYKA 3ZLTA 4JGBA 4F4IA 1ZSYA 4C4AA 4WXYB 1PJ7A 4BRSA 4C4TA 4PIPA 2PSSA 3PXEA 1Y3AA 4NAVA 4F7DA 2R8EA 4DUPA 2G9RA 2I1QA 2OHOA 1F9AA 1A9TA 2PPVA 3M5DA 2LW7A 3CINA 3HKDA 1ZWLA 4KQFA 3H42B 3A9VA 3C8UA 5DASA 5K8LA 1OH5A 1UEIA 3DE2X 2IKQA 1NP3A 4AY4A 4QNRA 1N7JA 1B73A 1EVYA 3DBLA 2GO7A 3IALA 3L2OB 3KKNA 3FZNA 4WLUA 4ZCSA 1ABEA 4UEKA 5ALOA 1U7PA 4I6JA 3DLBA 5CA0F 5LB2A 3C3DA 2GPWA 1NYQA 2ZB4A 3L1HA 1P44A 3S5JA 2P0EA 3P1JA 2C31A 3PFGA 4OMFG 1MTOA 4HNTA 2CLFB 3SYTA 3ROQA 3OOWA 1KEUA 5JNWA 2VT3A 1DQPA 3L1KA 3UBTA 1TCVA 1UEXC 1T5EA 5HZAA 2JFWA 3KQVA 2O3QA 3MXOA 3TLGB 5LQDA 4QBGB 2DKFA 3FRIA 1RWBA 1RXVA 3DPSA 4D96A 4E5VA 1VBKA 2AEMA 2VZ8A 2AFIB 4B84A 4CTJA 3RSZA 1ORVA 4MZXA 2HSZA 1U3GA 1QHSA 1P17A 2QW8A 5M2QA 4LS3A 4HG2A 3CWZA 3OZRA 4ZWNA 5LMNB 1Y5RA 1RQNA 1KYXA 4GVLA 3WLRA 4YPFA 5IWCA 4INJA 2O06A 2DU8A 2PFGA 1VIAA 5DI3A 5B36A 1C80A 2ZPAA 2WAMA 5HYVA 2C58A 4K8OA 3OEWA 4EDFA 3M2TA 2PZEA 4UU8A 5JXIA 2IY8A 3AEKB 1LVGA 2V7VA 5KOJB 3NOQA 3JWIA 3CZCA 3NG1A 3BHNA 2FQYA 1KQSB 3ZXSA 4JENA 1WOPA 3EZ9A 1DIOB 1KKUA 3R3WA 4YMGA 3CX8A 5F73A 1JTEA 3SEQA 2NGRA 4MUNA 2GN6A 5C3UA 1SRRA 3BICA 3IVAA 4XWWA 1NPYA 4BVHA 4RACA 3DZGA 1NBIA 2CYBA 4BWGA 1L4GA 4C3VA 3RSHA 4Y6GB 3ZUGA 1GSHA 3D7KA 3QKSA 1D1PA 4XUEA 3NBKA 1I33A 4CL2A 3WRWA 4OGKA 4A03A 4FD3A 3D4OA 5FOVA 3V8EA 2X9GA 3VR3A 1JW9B 4MS3B 1B42A 2R4QA 3I2KA 2IUUA 4IGKA 2W2LA 3U7IA 1Q7BA 1SXHA 2CFRA 2PRZA 2NU7B 1PK9A 1VIVA 2R8XA 3COYA 3DHEA 3R44A 4PRZA 4A15A 1L9XA 3IHTA 4FGUA 1ZKDA 2NXCA 2NV0A 3PEUA 3P2JA 3T7EA 3X43A 2W2KA 1GCGA 4Y7CA 4PHGA 1CQJA 2HT6A 2VT7A 1F1JA 1VL8A 3I2JA 2M5SA 1K5GA 4KPUB 3UB3A 5DMHA 4MDEA 4BN4A 2J9YB 3ISXA 1KE1A 4L9WA 5AH0A 3DVRX 1II8A 4DCPA 4TMWA 5HS4A 4GYWA 3L02A 3R3VA 3LQ4A 3SHFA 4MQMA 1BX3A 1W1IA 3P9KA 1S01A 4LAFA 1N2IA 1SD5A 4DG9A 3G9ZA 4ZT6A 3UJAA 1CKEA 5L45A 1D3AA 1RI3A 2R1TB 5HKOA 3FTQA 5JWRA 1BDJA 1I6WA 3GDHA 5JC8A 2PE5A 4HEJA 5HIKA 3U4AA 1NVGA 2XMZA 1Z39A 5F98A 1JQ3A 1B0PA 3OIUA