1BX1A

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
296
structure length
296
Chain Sequence
b'HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVQVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 97
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1bx1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1bx1A02
4P6VF 3AVVA 4G5GA 3VNVA 1F60A 4FK8A 3WY9A 2HDNB 3LYUA 1SKQA 4R71A 5TR9A 3CCLB 1HA3A 2XNCA 3P26A 4B47A 1G7RA 1GO2A 5TY0A 2BV3A 4PC3A 1KK1A 1FRQA 1QUFA 1VQ5B 3U6KA 4WQMA 3G4SB 4DQKA 1KC8D 4ZCLA 4TMZA 5GV8A 1BJKA 4QFMA 3WNBA 3G6EB 2XNJA 1NJID 1YJ9B 3J81k 1Q7YD 2RC5A 3CB4A 1UMKA 1QGYA 1CNEA 4RD6A 4MYUA 2ZITA 1QGAA 3FPKA 3W2IA 5DSZA 4B48A 2GQFA 1M1KD 1K73D 3LVBA 2B7BA 4UAJA 3W5HA 2BM1A 2VZLA 2D74A 4H9GA 2CNDA 1EP1B 4LBWA 1CQXA 1QVGB 1VQOB 3W2EA 2VNHA 4FN5A 1DARA 2XEXA 5HXBA 5FA6A 4ACAA 1AMOA 1FNDA 1QFYA 2VNIA 1VQ8B 3B82A 3W5VA 1KD1D 4N3NA 3AVWA 2BN4A 2QA4B 3WBKA 2PLFA 2DETA 1OB2A 4ZCIA 1WDTA 4TMVA 1YJWB 2R6HA 3CC7B 3JQRA 1YI2B 4P3YA 1DDIA 1TTTA 3ZBUA 1QG0A 4ZGQB 4ZV4A 1EFCA 1QH0A 4PC6A 4B43A 1GVHA 3CXCB 1YHQB 1GJRA 2DEUA 4YAWA 4C43A 3B78A 2PIAA 3W2FA 3QFCA 3ZZTA 4K1XA 1FNCA 2CRVA 2FX3A 1OGIA 4M4SA 1BX0A 1AIPA 1TLLA 3MMPA 1IJFA 1EXMA 4G1VA 2BF4A 2BMWA 2OTJB 1Q82D 1I7PA 2B5OA 1GR1A 2C77A 1QX4A 3CCQB 1IB0A 1N0UA 3PENA 1YIJB 4FWTA 4U9UA 3CW2A 2RC6A 2OK7A 1ZM3A 4LBVA 1VQLB 4NCNA 1E63A 4PGOA 4HE5A 3P27A 3AVUA 1G7TA 4PC7A 1R5NA 3QFRA 4RD2A 1B2RA 4RD4A 3CCUB 2QN6A 4RCZA 2BVNA 4G1BA 1N8RD 2B7CA 3CRZA 1XE1A 3QFTA 4C0SA 3B8HA 3ZC3A 4J0QA 1JJ2B 1S72B 4AF6A 1D8TA 4N3GA 3VMFA 4RD3A 2VYQA 3LRXA 3CMAB 1JB9A 4YAOA 1U2RA 1Q86D 1KK2A 1G7SA 1H42A 1TUIA 4TMWA 4HE6A 1DDGA 1W34A 1CNFA 4F7DA 3AGPA 3OZVA 1B23P 3I55B 4YHBA 2BPOA 1JA1A 4B3XA 1VQMB 3CCMB 1K8AD 3E1YE 3W2HA 1K9MD 2DCUA 4Q7JB 3CPWB 3CD6B 1FNBA 4DQLA 5THXA 1DG1G 3SJZA 2VNKA 2BM0A 2OK8A 1W2BB 2DERA 1QUEA 1D2EA 2HMAA 4ZGNB 1E62A 2BSAA 4M2LA 2QMUA 3G71B 3QFSA 1OGJA 4RCYA 2NPFA 3VO1A 4YAFA 1KQSB 2EFGA 2X3UA 2HCJB 1W35A 1VQ6B 1R5BA 1ZUNB 1VQ9B 2VNJA 4MYTA 3OW2B 1H85A 2BGJA 3E20A 3WNCA 1ZM2A 1JA0A 5EMNA 4Y9RA 3OZUA 1E64A 1G7CA 4B44A 1FNMA 5H59A 4ZCMA 1OB5A 3CC2B 3WNDA 1QFZA 1F20A 1S0UA 4B4DA 1A8PA 3QE2A 3CC4B 4LBZA 3V76A 2AHOA 2OTLB 1QGZA 3CCRB 1VQPB 4QHYA 4TMXA 3QSYA 3W2GA 2QTZA 3WXMA 1D1NA 5JBQA 1GAQA 3WYAA 4NBSA 3CCEB 4PC2A 3FJOA 1GAWA 4TMTA 1KK3A 3MHPA 3W5UA 2J7KA 3U2QA 1EWYA 4Y7CA 2YWEA 1XB2A 5AN9A 3AVTA 4ACBA 3WBJA 1J9ZA 1SM4A 2BGIA 4IW3B 4Y9UA 1FRNA 3A1FA 1QFJA 3OJXA 4RD1A 1EP2B 3AVYA 2C78A 1Q81D 1NDHA 4YAUA 3I56B 2YWFA 3AVXA 1N0VC 2QTLA 1FDRA 2QDXA 3JQPA 1JNYA 3ZBTA 1M90D 3AGQA 4M53A 1W87A 1KK0A 3CCJB 4YALA 1VQ7B 1VQNB 2DY1A 4TN1A 3U6BA 5H5JA 2YWGA 2E1RA 4M0LA 3LO8A 1EFUA 1R5OA 3CCVB 4AC9A 4LBYA 2QEXB 3ZZ0A 2PMDA 3OJWA 1ZM4A 4EH1A 4PC1A 3CMEB 1YITB 2GPJA 1IJEA 3VO2A 4LC0A 1BQEA 3VNUA 1EP3B 3MCAA 5KSWB 1EFTA 4M1KA 1ELOA 2EIXA 1KTVA 3ES9A 5TV2A 5GV7A 1TVCA 1VQKB 1KJZA 3JQQA 3CCSB 4BPRA 1BX1A 4AF7A 2YWHA 1YJNB 4RD0A 3ZZUA 1KRHA 3I1FA 4RJLA 1ZM9A 3OZWA 1VQ4B 1QVFB
chains in the Genus database with same CATH superfamily
3CT4A 3SZRA 2PV0A 4ZOLB 4U00A 2I0FA 1SHZA 2OEPA 4XQGA 4X97A 2A5JA 3NEAA 1JE1A 2L42A 3O8DA 4CMBA 4CF7A 2F4VB 3LE8A 2X0DA 1U2PA 4D4LA 3PR1A 5LD2C 4G5XA 4TWIA 5ALTA 3WQQA 1TZMA 2VPIA 3PE4A 3WV5A 1LSJA 3NNNA 4BASA 5KNDD 1G6Q1 1AK2A 3AUAA 5AOVA 2AC4A 1UC8A 1NW8A 3K0CA 5EE5B 3CCLB 2BFOA 2VDOB 1VBFA 1Y4SA 1NP3A 5FFMA 2IITA 3MWGA 1EJ6A 4X1YB 1E66A 5JCXA 1WMDA 1Z38A 3D43A 3IS3A 3KV3O 4WH0A 1KH1A 2GLTA 4QBTA 3TLGB 4OHRA 5JSYA 3GGSA 1I7DA 1U7HA 2FWBA 1P9RA 3G8CA 1F06A 4RIGA 1KK1A 5IAEA 1QUFA 1XIVA 1OZGA 3GLIA 2OSVA 5IT4A 2NO9A 3N8IA 5DTRA 4RUKA 1ZK0A 1RWBA 2CYCA 4KPYA 3BFPA 1B00A 2WJ3A 2GBLC 3DXYA 1GSIA 4XM2A 1ORDA 1WZEA 2BBWA 1ZWLA 2E6UX 1LPSA 3PF9A 4PZZA 2M5SA 1CULC 1Z5OA 2QX6A 3RQIA 1Q1ZA 2D2XA 1XEAA 4TQ9A 2ENUA 4UHHA 3RWBA 1JLHA 5LQRA 4OVKA 1KEVA 1ISGA 5COAA 4H6XA 3OOJA 3DVSX 5KHAA 1Z06A 4EP1A 3LPLA 2NO1A 4MQLA 1GPUA 5A4KA 2HHJA 3ILYA 3PC2A 4BXOA 4NXNB 2WVGA 3BG5A 1A9TA 3NHLA 3DULA 3VC1A 4QEZA 3OT1A 1PFQA 1U3WA 1NW4A 1NJID 2J3EA 1U31A 3OWXA 4J94A 5E95A 3PHCA 4MW5A 1F48A 1PK9A 1MAUA 3BL6A 3OESA 3AVOA 2LV8A 4FIZA 4RHXA 3ZE7A 3Q12A 2A3RA 2QRHA 1OYWA 4K2HA 3BMXA 1VPVA 3U1BA 1YZGA 1GG8A 1H1LA 1TKRA 2RJOA 3ONVA 1V2HE 3PCRB 4RVFA 3UJAA 4CEJB 4W5NA 4GH5A 5THQA 4Z1MD 4HNVA 1OXBB 2VF4X 3IPLA 1BG6A 1MA3A 1X1CA 2NNWB 2GZRA 3C3AA 3HVJA 5HIJA 5IZ4A 3IQGX 4A36A 3F5FA 3HKEA 1ZJZA 3E9MA 3PL5A 1M1KD 3Q98A 4IOKA 4NHOA 3VV3A 1UDWA 3B6KA 4R01A 4E5DA 3FYDA 5KNBA 1QPZA 1U3TA 1L1RA 4HAVA 3ET4A 1G42A 1M1YE 4BBZA 3QOWA 1EVZA 3CVXA 2C4UA 4CF4A 3F3YA 3PV0A 5JCPA 1Z4OA 3GLFB 1X8KA 2AIRA 2ZE7A 5FOXA 4L95C 5MN5A 1RKBA 1IJKA 1X1BA 2CL0X 2Z8YA 2D1QA 3A36A 3DAHA 5D3MA 5A6SB 3VC7A 4II2A 2ZJ7A 2EXXA 5GJWC 1N2GA 1HFJA 3RTEA 4ADSG 4YRKA 2JJQA 2XKKA 1GPBA 1TTPB 1DJPA 1IXSB 4KK3A 2VYND 3O8QA 2DTDA 3SD7A 4JBWA 4B40A 3CNBA 5G02A 1PZGA 1XCLA 2HA5A 4GLFA 4HLUC 1RCFA 2Q5FA 2L2QA 2IPOA 5G2OA 4CIVA 3AVWA 1PQYA 2QB5A 2OD9A 1U65A 5AT1A 1ZL2A 1FFSA 2QA4B 1VLYA 3KDPA 1UKAA 4YFVA 1SVLA 2P6OA 3H11B 3GNTA 1NUTA 3O03A 4IIJF 4QG7A 4ZPJA 4B2YA 5T57A 3MCZA 1YHYA 1XNQB 4TMFA 4EDHA 2B8NA 1WPCA 1JZTA 1J0DA 1TKCA 2AB0A 3FUCA 2ZUDA 3NRCA 1EEXB 2NTNA 4IX9A 5DGHA 3VPSA 1MD9A 1UT5A 1A9XA 1M6VB 1MHTA 4FGJA 4G97A 3L8FA 4RVDA 2HGZA 2Z5VA 5AKYA 3ZCUA 2H7VA 1B8UA 1SBTA 2RK3A 2RGNA 5FTJA 1E3JA 5KIAA 1L8QA 2HJVA 1UOPA 4F5EA 4L9AA 1E3QA 2ZJ5A 1JR3D 4P38A 4CEIB 2HRQA 1AF4A 2J59A 4ARZA 1YB7A 1AN9A 1S3FA 4B7AA 3R7SA 4CT5A 2PZGA 1U2TA 2Q3DA 3B2EA 4G1EB 4CM9A 4EA9A 3ZBUA 1GT91 3OSUA 5CIQA 3W8NA 1SG6A 1WABA 4F9FA 3QE4A 5CDSA 3II6X 4BB0A 5K8JB 2D7DA 4I3FA 3IXMA 4Q02A 5ULLA 1RE1A 3RFUA 3T1YB 4N3CA 3VHLB 5A62A 4ZVRA 4RTSA 2X6XA 2DEUA 1EU1A 4EKGA 1Q3KA 2JVKA 3AG6A 3C43A 1ORRA 5AOCA 5EOVA 2X9VA 3RKUA 2JD0A 3NETA 3ZTWA 2BGMA 3FDFA 5KQRA 3CH6A 3I5UA 5FPPA 3C8DA 1FNCA 4XB2A 1Y3CE 1TXGA 3AIIA 5EC8A 5CDFA 5CEEA 2Q3HA 3NHJA 1BX0A 1WNTA 2IY8A 4GZ6A 3W5IA 4K5QA 2X6QA 2JIQA 2JFYA 5E6SB 3W0LB 1JDNA 1PE0A 2G6BA 4M7PA 1M0SA 1MT0A 4G1VA 5L3ZA 3T54A 2J3MA 1OI7A 3A6PC 1ZK4A 1R9GA 4ND6A 1C2TA 4U7FA 3IQWA 3TSWA 1WP9A 3WBFA 3CNLA 1WO8A 3I61A 3HM9A 3FTNA 1N0UA 1YIJB 3O2JA 1T0UA 4JGIA 3WQZA 3VVCA 2XCIA 1YB6A 2ZJOA 4PO9A 5FBQB 2R5NA 4FZRA 4HRAA 2IIQA 4TTJA 5FEMA 2PU5A 1XMOB 4KLRA 3VO9A 2QLMA 4O5OA 4EMSA 5DW3A 2RKOA 1JJVA 2E4YA 4PC7A 1P4MA 1R5NA 1KJWA 3JX9A 5C1IA 3IUYA 2Q1WA 2YZNA 3R6DA 4RDIA 3OIDA 1E7RA 2NTVA 4DUGD 2WSIA 2P3QA 1LJLA 3SS9X 3V1MA 2I1VB 2PKQO 1VHTA 1DC8A 2E9SA 1CXZA 3GZNA 4EAQA 3EMKA 5HJ7A 2Q3BA 5B7PA 4JU8A 2N1BA 2OVFA 3QVGB 2GBGA 3QM1A 3OE7A 4NPAA 2RHLA 1X1RA 3ASYA 1BJRE 1UPFA 4M0MA 1ECLA 3CXUA 4M9UA 3R41A 4F12A 1DIAA 3I09A 3S2UA 1DBVO 1YI0A 2FR8C 5H8WA 2FEXA 4RZ3A 3HJFA 3M8KA 1YDFA 2WWGA 4V24A 4O4HB 1HOTA 1XDZA 2YX1A 1D8TA 1ZNXA 1TJNA 2ATCA 3BL8A 3GT7A 1Y7HA 4BVFA 3QEAZ 1SCUB 1M2OA 1G6OA 4LW8A 1THGA 2XR1A 2GS9A 5LR6A 3DW1X 2O7VA 3H1PA 2JLXA 2BJHA 1OXMA 3LNCA 3PKJA 3ZHXA 2WC1A 3MUFA 3QH4A 4YAOA 5JPCA 4S05A 3LNNA 2G5CA 4L4RA 1I4EB 4D41A 4N39A 4JGBA 3VR4D 4ND7A 4RABA 1PK8A 3NTQA 5K01A 4B74A 5ADVA 1HDCA 5F9FA 4YROA 3PT5A 4B4OA 1ZH6A 1W34A 1P1IA 3EW9A 3F8SA 4G0XA 4OB6A 4WEQA 5A5DA 1QONA 2AKAB 2GYWA 2IEGA 5CB8A 3Q7RA 4OP2A 3Q1KA 1GD1O 2OXFA 4ZYWA 1K0UA 2W83A 4OU4A 3QBDA 5C1DA 1Y4UA 2EL7A 4X54A 1NF9A 1UD3A 2DYIA 3L0ZA 3DBIA 1E92A 1BHJA 1EK2A 1N6RA 4G9GA 4HVTA 4XN0A 4A26A 4UHDA 4E32A 3HRHA 1C30B 1YL6A 2ZW9A 4DLZA 3W2HA 3AETA 1IN8A 4Z5XA 4DLYA 3OZFA 4LY0A 4QTXA 2R3SA 3VJRA 5K09A 3HL0A 1A8HA 3IH5A 4DW8A 1M76A 2BP7B 3K9NA 2ZBVA 1L5SA 1RI4A 5ICEA 4GI7A 3LT1A 5ICCA 1X0XA 3Q8MA 2UXDB 3L9XA 2JGNA 2RI1A 3UAZA 4H7JA 5KWIA 3LBHA 3NBXX 4PVCA 4AVZA 5E6UB 1WHSB 1UINA 1ZIYA 3Q8LA 2C5AA 4A3SA 2FLWA 2B61A 2GVDC 1JH8A 4FWBA 1Z7WA 3HMQA 1BO6A 1JJFA 1VRCA 3DTVB 3HCWA 2R1VB 2UZ1B 2QX9A 2WG0A 2HMAA 2PL3A 2PRSA 2A86A 3B3FA 2IPXA 2Y9PB 3HR7A 4J1QA 3IDSA 3CEAA 1B8NA 3L43A 3DC7A 3LBFA 3D0OA 4W9NA 2DLCX 1YS1X 4G8CA 5CXQA 2AOUB 5HJ5A 1H4SA 2AC2A 5FTMA 5KX5F 3QE9Y 2JHPA 4QUBA 2Y8EA 2DFNA 2FSIA 2WY2D 1NDUA 3KJIA 5KNDH 2ZETA 4DCVA 1U3DA 2X3UA 1MC1A 1J8MF 3U48A 5IKEA 4OATA 4GYJA 5HDBB 2CJYA 4G0OA 4ZT3A 4UKDA 1G291 3PBKA 3V80A 1AS2A 1DTWB 4LZNA 3JQ9A 4BO3A 5L6MB 5T3UA 5BN4A 1DOHA 2EGUA 4YP9A 2JLYA 2BGJA 5H83A 3E0QA 3WBBA 4WKBA 4N5IX 5LDHA 1YDMA 5FQNA 1WRBA 4L7QA 1G2PA 1PZEA 3PXCX 2W4MA 3MBKA 3GYBA 3MSXA 2Q49A 3R8CA 2AV6A 3AF6A 1BZYA 5JJ5A 4DR2B 4H31A 4KGZA 4YJ2F 1I3MA 3CLRC 5TEWA 1YRLA 5AKLA 4IPTA 5C4MA 3FNBA 4TV8F 2A94A 3KKLA 2V7QD 3KTAB 2BR3A 1A8PA 2EIHA 3HHPA 3KQQA 4LKRA 2WV9A 4MCHA 2FSVC 4R8VA 3ZVLA 4CEHA 7MDHA 5JXIA 4FYHA 3LUGA 5BXYA 4FT2A 3R6KA 3A06A 3G2JA 3I6MA 1YS9A 3HA5A 1YBMA 3FPFA 4XEUA 2OL4A 4UUNA 3DC2A 3X1ZA 3LDUA 2HQBA 4HDNB 3AV0B 4LJ7A 2V6IA 4PRZA 3HY6A 5EP3A 2OHIA 1FMLA 3LX8A 2B6HA 2CZCA 1YJCA 4Z54A 4FTWA 2ZJ8A 4Z4ZA 5F4MA 2XYHA 1K3FA 4X7MA 1WMBA 1Z4IA 4NENA 2OV8A 5I9BA 3KOUA 5DCUA 4DV0B 1L5KA 3LECA 3NORA 5CK5A 2C4MA 4FQ8A 5LMUB 4HH4A 4WKPA 2QX4A 2VZ9A 5GTDA 3CRQA 2PMBA 5BNWA 1T5SA 4NARA 1BOOA 3EFOA 4EI8A 3BFVA 2YWEA 3KOZA 3LP5A 4HXYA 2H17A 5D5HA 5DTJA 5MGBA 1VI2A 4JC8A 2P6PA 1ZGAA 3Q8XB 4BVAA 5ADHA 4M36A 2FGKA 3UJHA 3E7WA 5KJEA 3GSIA 1EDDA 4NDAA 1P2BA 4K8OA 4Z0NA 3QMPA 2EV9A 3F4KA 3CIFA 3K5IA 4KXUA 3VUFA 3HB7A 3KJXA 2VDQB 4OJQA 4AS2A 2WF9A 3KTFA 4BVGA 1VLMA 4JP3A 4R8KA 4TUYB 3BJZA 4YLYA 3I28A 2NW6A 2ZROA 3EQZA 4KP7A 2PR7A 3TR6A 4HWRA 1DT5A 3HXKA 4UDYX 3H04A 1SK9A 3LPAA 4FFSA 3RQSA 5LXTA 3BH7A 1DMRA 1ZEMA 3ZV3A 4WJLA 1E6EA 5AUPB 1JQJC 4R69A 5CIYA 2WD7A 4Q05A 5K6AA 1EDBA 3UBTA 2ADOA 4GR5A 4XDZA 2EU8A 1YHNA 4AJ9A 1MW9X 1LVUA 1U9CA 2ACEA 3BK1A 4ZT6A 2IU0A 1XZLA 5F1PA 1KJQA 2I87A 4ZYUA 5JYDA 1DCTA 3TX6A 5BP7A 4QVIA 1ZHOA 1PG5A 4LY9A 1JT9A 1TCBA 2BLLA 5BN5A 1J4AA 2PSSA 3UQZA 3H2BA 3S2GA 3SF8B 1NBMD 1UH5A 1MX5A 1Y0RA 1SBCA 2GCPA 2LIPA 3AZPA 5CM2Z 4ENQA 1VQNB 1UODA 1GGJA 1W5BA 3U6BA 2GZAA 4W5QA 1E4EA 2GF2A 1W8DA 3BCHA 1JR2A 3OLYA 4HDCA 4A2CA 5G4KB 1NXPA 4HB0A 3RIYA 3ZLVA 3F98A 2Z2KA 3BB4A 1AH2A 3F6CA 3UQYS 2M2IA 4QRHA 2XOKA 1Z4QA 1Q6YA 3KT6A 3QPVA 3KJGA 4KQKA 1PS0A 3RFTA 3F6RA 3PEUA 3NTXA 3SQDA 4DZTA 2NUAA 1V1MA 3IOYA 1Z8NA 5A1TA 4C88A 4EIWA 5DLPA 1TKBA 3GVLA 4V38A 2C0CA 4HB3A 2IYUA 5ELMA 2G9NA 4H7KA 5KKCA 3QZUA 4B34A 5F52A 4W6QA 5FRDA 5L40A 2R00A 3OQJA 4RH3A 3WRXC 1WVMA 3ZZMA 3PEWA 1Y0BA 1JFRA 1SPBS 1BXKA 2AJ8A 3BXGA 2CLDX 4PPGA 4UVDA 2G9RA 3RYFA 3UG7A 1YRWA 1JPVA 3BMOA 3UOAB 2PAFA 2XB4A 4NBRA 3UEOA 2O8CA 3ABIA 4PG6A 4DLBA 1NN1A 3T35A 3OOEA 3AC0A 3DMRA 3W3AA 1CR0A 1XSEA 1HL7A 3ILSA 2RI6A 5ALYA 2WW8A 2Q0QA 1GGFA 4JR2A 2JVJA 2FQWA 3ZKWA 1WW8A 3R4VA 1LDNA 1O95A 1F4PA 1M1YA 2IQIA 1SOVA 1J0XO 3MJHA 3P2OA 4UHKA 4KLZA 2ONZA 1XQBA 1AZWA 2H52A 4HGZA 3FSJX 1VG1A 4TXNA 4AD8A 4L5IA 4DV5B 1CY6A 1Y8AA 1HR0B 2Q5EA 1WCIB 4DNXA 1L4HA 1N57A 4HWOA 3IDQA 2YWHA 3L9WA 2JAUA 2QUAA 3GJQA 1Z2NX 1QHSA 3BWEA 3ESXA 4D8UA 3OA2A 4C0QC 1Y1KE 4RM0A 3OF5A 1IDN1 4AQ7A 5HE9A 4PCLA 5J47A 5LQMA 2QTCA 2XCQA 1H5QA 2PUFA 4WNIA 5CIWA 3L8GA 3L8CA 2R8YA 4G65A 3N70A 4PCAA 4ER7A 4JSTA 5D3ZA 2YZGA 3RWOA 2FDCA 1XRQA 3EMDA 3P20A 3C5VA 5IRCD 4KXMA 4P6YA 3JAWB 4G5GA 4PLHA 1HQDA 1C1XA 5CFOA 5ICMA 1IOZA 3D8HA 4IHJF 3NGLA 4CIWA 3BDAA 4PHCA 4PXSA 4F8EA 1J33A 1PX0A 1P5JA 2O2EA 4OHBA 5DLEA 5JNSA 2J9GA 3HXOA 1NP7A 2DJ5A 4ZMBA 5EWMA 2AZMA 3UHOA 3NTLA 4DLRA 2OV2A 4F6LA 3ITNA 3JQFA 3H8JA 1D4AA 3DE3X 1T35A 2P2SA 3KOYA 3SYNA 2QP9X 5C8YF 3F46A 2V7TA 3SQOA 1NQXA 5DISB 3ZX5A 1QK3A 4TGLA 3CM0A 3D1JA 3QJ5A 4GE0A 3B9BA 4R2IA 1DAFA 2O2YA 3B36A 3EASA 4RQBA 2CDAA 2RB5A 3VR4H 5DT2A 4DPMA 5BMVF 3NDIA 1PJAA 1HE4A 3ENNA 3G4SB 5HEKA 4ALLA 1QAQA 5FXMA 1YCFA 1E4YA 4ZRNA 2IC5A 1VGRA 1SH7A 2HRCA 1Z0FA 3OZAA 4KVFA 5DM1A 5CBPB 4IS2A 4WY8A 4YCMA 1D4OA 1EGMB 4MS3B 1C7ZA 5FJJA 3I73A 1R0RE 1VL6A 2I8AA 4DMLA 4R2KA 4U2FA 1MZPA 5IG2A 4BMCA 4IUDS 3RRYA 1ZRSA 3P0IA 1MENA 4LJRA 3SNHA 2BC9A 4X24A 2OB1A 4ERXA 1ZI9A 4QNRA 2XUDA 4KE6A 4PLPA 1TUGA 4FDAA 2AH5A 5DM0A 5LZ5A 4B76A 1PHPA 4AJPA 3N58A 1CQIB 4GOMD 1UMKA 2RGBA 3IOCA 5TRTA 4B75A 4KU4A 3K6SB 5AI5A 1A3CA 2FQXA 4S1WA 1YO6A 2ZOSA 3D26A 4AF8A 4C0BA 5DHPA 4CT4B 5B36A 2BJWA 1WB6A 3EGOA 1O8CA 1OIVA 2TMGA 4Y0NA 3QVOA 4LE2A 3NDPA 1Y7IA 5JCJA 5T67A 3FCYA 2WJZB 2GQFA 1Z6GA 4KFTA 3REQB 3SKVA 4Q4HA 1UBGA 5IANA 4L4ZA 2XV1A 2A30A 2VT6A 3ESYA 1C1HA 3LCUA 3NIWA 1L4KA 1XRRA 5G0SA 5JECA 3ZW9A 1Q0PA 4A4DA 1M34B 1KKMA 2CL6X 3FZYA 1J99A 1ZN7A 3KOXA 1P5HA 3Q9LA 3E18A 3R5FA 3IPAA 5IARA 1MIHA 3TW4A 3PNVA 4CKBB 2P67A 3NWPA 1VIYA 4BNFA 4GKAA 1BFDA 1KSFX 1WBJB 2MINB 2DPGA 1PP4A 1L5WA 1OXTA 4EFMA 2L69A 3ZUGA 1YT5A 4EYKA 5I7WA 1XF1A 2Y1OA 2H4JA 3HABA 3DOIA 3BCFA 1E2KA 4HTAA 4XIGS 5J4HA 4R2HA 3R7WA 5K0CA 4TN5A 5FHRA 5MF6A 5C52B 2YFYA 3IE0A 1AHNA 3DZ8A 2ZUBA 1OMOA 3S7ZA 5HWSA 1T2DA 1ZH2A 2JD1A 2QD1A 1PR9A 3FRIA 3H9JA 2F8SA 3G9UA 2ZDQA 1MR3F 4NCJA 2QORA 1E0DA 5TMDA 1XEXB 4IZ6A 4DV1B 4KKTA 1I1HA 1RIIA 1CUWA 3T7CA 4AY5A 2QRQA 1CF9A 2R6FA 3NHYA 1BSVA 3H2HA 3OETA 4FLEA 2AR7A 2RK6A 2Z6BD 3QP9A 1RBQA 1SOUA 5B3JC 1X77A 2VJMA 6REQB 3PWSA 3H65A 3T3OA 4N9QA 4G23A 4D3YA 4HYYA 2O9JA 4CM9D 3OE1A 3KJZA 2O48X 4Q39A 4LYEA 2DKNA 2AG8A 2YYZA 2XUZA 2BEJA 3Q6MA 2XTNA 4QXRA 3T7TA 2B94A 2ZYUX 1RACA 3RRZA 4ENUA 2DY0A 1QANA 2YYSA 2J4CA 4RZHA 5K3SA 1JQAA 3SU8A 4TYNA 4PNHA 3A6LA 1RABA 3ILVA 3UGQA 1T0HB 3W1VA 4B6JA 5CFPA 2ZZGA 2PDAA 1L5VA 1CB0A 2GEKA 3NZEA 1ADFA 3O4GA 2DTEA 1E32A 4F5WA 1D5CA 1HT0A 2M1XA 1U0TA 2QAGC 3L0SA 3NX4A 5EIWA 4PZEA 2HMSA 4QODA 4UC0A 5P8WA 3AVQA 2WA2A 4Z99A 3SEQA 4JB0A 1RYMA 2ZATA 1JRLA 4NONA 3KQKA 1E89A 3BF7A 2NV2B 3V4ZA 2Z0MA 4X20B 1YHQB 1WM1A 2JD2A 2JGRA 3KAKA 4DRXA 2EFDB 2VK1A 4NIMA 1TM5E 3GLFE 1PJ2A 3H9UA 3VISA 5BRAA 5K9ZA 2QPOA 2DE0X 1DBPA 1DJOA 2QMHA 5KJ6A 2PIAA 2B0JA 2J5XA 1WSRA 3IV9A 1X7WB 4MW1A 3LUJA 4PGHA 4DV6B 3Q9NA 5JSUA 4G0WA 1JMVA 4TTTS 3UO8B 1CX9B 5JYBA 3PHLA 4O5AA 1X2BA 3F6BX 1TD9A 1C4WA 1NV9A 3B6ZA 1MH9A 4ZJYA 2ZTVA 3X1JA 3VU1A 5BRJA 3IX7A 2BF4A 2B78A 3A3YA 5DN6A 1OGYA 1TF2A 2AL7A 1ITZA 2BMWA 4IGFA 1CIPA 2OLKA 1XCOA 4MTCA 3VHXA 1M8JA 3IR5A 4WN9B 5E4FA 2JC3A 1BU8A 4EI2A 2ZU6A 3SE7A 5LC1A 3KL4A 821PA 3R1IA 5IMBA 4MAMA 3T34A 4YRAA 5ISMA 2H08A 2PBLA 2I6UA 3ONUA 1G8AA 2Y66A 4XAQA 4Z1OA 4RZSA 3I62A 1XZPA 1TQ4A 2A7XA 3R9IA 3LKZA 1DTEA 4Y98A 3T5DA 3TLAA 5CVTA 2V8OA 2ATXA 3E03A 4BFTA 1E59A 1XL1A 2NZJA 3OF3A 4LA4A 1XAJA 4S1OA 4A6DA 4DYDA 2IGTA 1FU7A 3QFRA 1YZLA 3CNNA 4YECA 1N5JA 4IJVA 4Z53A 1Z6PA 3NQ41 4M0KA 5ARCA 4ZYVA 1RAIA 4MP3A 3LUKA 3TECE 2P9HA 3DWEX 4YASA 2GEDA 3SY8A 1CR2A 1O96A 1OXKB 2DHQA 2MYPA 4QYTA 2IY7A 4LKOA 1O4VA 4F3YA 1Y5NA 2AVDA 2XYRA 3BH0A 1FTQA 1SG9A 2II6A 5F5LA 5JYEA 4RLQA 1PHRA 2F9LA 4L8LA 1T0IA 5I51A 3ORRA 4ZANA 3QFTA 4HRVA 1EE1A 4G0YA 3X43A 1KMNA 3TBHA 1W1UA 4KWIA 2G7MC 2QR3A 1E5LA 3RBAA 3RAJA 3ITKA 3BMCB 3A6KA 4OAOA 4OJNA 4RNCA 1QH9A 3SYMA 3SBOA 3S2ZA 4N3GA 1KPIA 4FD2A 5CITA 4HNUA 3G2IA 3MGCA 2C31A 4IO0A 4BEJA 1V11B 1H8ED 5E38A 4CFZA 1RKQA 4KVZA 2GM4A 3ROXA 2G4LA 3U1VA 3GGGA 1NX9A 1YMVA 2FOIA 3THSA 4CODB 4V0SA 4CLEA 1QC5B 2J46A 1R0BA 2YXBA 1TJPB 1KK2A 3KBBA 4G7WA 4PLVA 3HYRA 1H42A 5H7XA 4R1NA 4D2IA 1FQJA 1E2MA 3T3IA 3CBGA 1L7DA 4W1RA 1G9SA 4W99A 3USCS 3WDKA 3FTFA 3PQFA 4LCBA 4NCIA 4B8YA 5F23A 3WZMA 1LJ8A 3I4FA 4RGQA 4FGKA 4ZAYA 4GSLA 4II3A 3DQZA 2ZCVA 1NNI1 2FA9A 1T2VA 3T56B 1K8AD 2A0WA 2IXEA 2CSXA 1CT9A 1EVIA 4CR8A 3HFRA 1YUNA 5AMXA 4YY3B 2Z5GA 4W82A 2QX8A 4E3WA 1B15A 4IDFA 4D7AA 4EG3A 1KY2A 1D5WA 1B26A 1B0UA 4RA6B 4L5BA 4PQYA 3U4GA 4WOPA 4LZZA 3IQZA 3U62A 2D3LA 1OLUB 2YNMA 2VZ0A 5INTA 1YQEA 2DPXA 1YIDA 3D6NB 2OK8A 3I2FA 1MJGA 3I6ZA 3RDPA 1ESDA 4YT8A 1CEXA 1VJDA 3N6VA 2QYTA 4GLOA 1EA5A 1WXEA 1TM7E 2BFAA 3BRSA 2JASA 2NLOA 3GXOA 4E46A 3KSDO 4KQHA 2POCA 4AWAA 4CCWA 2OKCA 3ONDA 2VAPA 1OGJA 2QGGA 1MTOA 1SURA 4IIVA 3L7OA 4YRDA 4YWHA 1QFSA 4TKZA 4GFDA 4DADA 2SICE 1Z07A 5K0FA 4RMNA 2DMRA 2CL5A 2PQ2A 3RYIA 1DIGA 5I9TA 5IUKC 4POOA 4MR7A 1EDZA 4MJLA 1GGEA 4KW7A 1DQNA 3ZI7A 4D9JA 5B4TA 1K2WA 1QK4A 1EBBA 1GDTA 3DE6X 1OI4A 2Y77A 4W5RA 3AESA 4MYTA 4Y67A 1TK2A 3OICA 2RHOA 3EG9A 2B6NA 4MW0A 2P3SA 4NEGA 4PX2A 5L3QA 3TWOA 1SU4A 1MGPA 2Q8QA 1YACA 1U80A 3QF4B 3MCUA 4GECA 5FOQA 3HWSA 3HKCA 1H05A 2NSJA 1QRDA 3VPXA 1WR8A 1BN6A 2PBRA 1V4BA 1B8VA 3WNDA 3B3QA 3DOUA 1W44A 2WINI 3UKOA 1A8UA 4YBRA 2PUEA 2X5JO 1C9JA 2QD2A 3B8EA 4LVCA 4GR9A 5BXQC 3WLLA 5FO1A 2Q3EA 5CNKA 1OF1A 1H69A 3QW4B 1LXCA 3IPRA 4MGHA 4K40A 5HF9A 4ZIRB 1H94A 1K8RA 1R50A 3DLTA 5GPBA 3GFSA 1SB8A 4CDMA 3G2MA 2GXAA 1BWQA 2ODPA 3MT8A 5DNWA 4CM1A 1L3CA 3E9QA 3HYSA 5DCYA 2DWCA 3REGA 1G98A 2ZYAA 4ZQIA 1CNMA 5DM70 2JGEA 1DFHA 2PKRA 5EIHA 3G5UA 3SZ3A 4MPRA 4WD3A 2UVPB 4JC0A 4IWXA 2AOTB 4DAOA 2WU0A 3OX2A 3DVAA 3GRCA 3NLLA 4G9BA 1RJFA 5EMLA 3Q88A 1M10A 3E8XA 1CVLA 3E3MA 3VU0A 4HQRA 2VP9A 4DQ0A 3N53A 3FKJA 1HQYE 4W6ZA 4XIFA 3TAUA 3G68A 2IHZA 1TF5A 4JOSA 3KPJA 2ORWA 4M6WA 4RULA 2ZCJA 4OXIA 5A02A 4CJXA 2WP8J 3PX3A 6Q21A 3KZKA 4L3WA 2X76A 1P74A 3KQLA 1LI5A 1KOFA 4O02B 4IW3B 1PV2A 2X2PA 3OM8A 3OJEA 4Q21A 4BX0A 2QUIA 1WORA 3NKLA 3T3HA 3DOOA 3Q6IA 1QFJA 1QCDA 1GUAA 1K6IA 3QJYA 4YX9A 1YONA 3BCRA 3IHLA 1CE8B 4YUAA 1WE2A 2UZIR 3EJWA 2ZR8A 4R1PA 3K15A 2CGEA 3WISA 2DH5A 3BXOA 3IL2A 2X4IA 3E35A 4YMSA 3EXHB 4D0GA 2YV5A 4NG4A 3MFQA 2NVOA 5B3AA 3V6MA 3MWJA 4Y6GB 1NJ1A 5BOSA 2IU6A 5TJHA 4LSZA 1I01A 4HYTA 3GT0A 1F2UB 3E7FA 2OHOA 5AK4A 5HQJA 1A97A 3E27A 4S1NA 4RADA 2YH2A 1B14A 1DAIA 4WLFA 5EPEA 3I58A 5F2NA 4JBIA 1R7RA 5P21A 2QQEA 5JSKA 3EDOA 1JBQA 1QNLA 4QLBA 3IAHA 4B87A 2XOKD 2IYOA 3HNRA 2PT7A 3GVCA 2QD4A 3GW8A 2GWHA 3CN7A 3L93A 4MMZB 3ASZA 2OAP1 1AO3A 3S29A 3P1JA 4A5SA 4I46A 1NW5A 2IYTA 1V5VA 1NMXA 4N5LA 3GJZA 1WMEA 5DDIP 4ECAA 2Q07A 4YT2A 1JAZA 5F4JA 1LDYA 3P5SA 2YWGA 1DFIA 2W42A 3WOVA 1GILA 3NO4A 4NESA 4U5XA 1X7XA 4M49A 2AXNA 4G7XA 4IV8A 1N77A 2GQ0A 3CCVB 1NVWQ 1C3VA 3AKZA 1B76A 4EFKA 1ULAA 5DNAA 1FZTA 1TYZA 2QD3A 4EKYA 1YB2A 2YFHA 3EEBA 2ZWMA 3IQXA 2XYPA 3AQ4A 1F9AA 4O2LA 2FFBA 3DL4A 2ZT8A 1CUZA 1DAPA 2GI4A 3GJ6A 1YQUA 1PR1A 2GBIA 2O2CA 3RNOA 5LIPA 2JLQA 1WOOA 2FEWB 5DYGA 4R0NA 1UZAA 4G37A 2WJHA 2CUZA 2Y99A 4MQFB 1UAGA 5F2KA 4N47A 4D0SA 4GX5A 2WYVA 1UT8A 1O95D 3D8SA 1LB1B 3KUDA 1R10A 4S2EA 4B83A 3CZ4A 1MN6A 3PZRA 2JFVA 4V3BA 3D5TA 1C0LA 5IJXA 4FFVA 3C85A 1C7IA 3GT3A 2VP0A 3IODA 2ZGVA 3L02A 4RKWA 1TT5A 2ECFA 1ELOA 5LLSA 4RC9A 2HJSA 3E9CA 3LCJA 4LVNA 5FBKA 4KR9A 3W4IA 4OMFG 1P9OA 1PKXA 4IGAA 4ILEA 3VDMA 2AMVA 2FFRA 3UCFA 3ZTYA 3M6XA 5HIAA 4QFBA 1ZISA 5IDQA 4DPLA 1GEGA 2CXRA 2EZUA 1IBKB 2Q5CA 1RLIA 3T7DA 3IYLW 1GRRA 2E18A 3A9RA 4MYSA 1NVGA 5CT9A 3RVQA 4BGDA 1JWLA 1OWOA 4F4IA 1BX1A 2C5HA 1PBTA 4MS1A 1DWUA 5CXSA 3KD2A 4UTRA 3L8MA 2C96A 1NBAA 1ZK3A 4IXDA 2FK7A 3C7TA 1YDHA 4E0FA 3B9QA 1KRHA 4P33A 1QIJA 3ZWMA 3SJCA 1SVIA 4D9BA 1BFKA 1OYYA 3HFJA 4Q3LA 1XN1A 2OAQ1 4U7HA 3CRRA 4MR9B 4LWQA 1M6HA 1FTWA 4I6JA 5E7JA 3P9NA 4HUTA 2IVFA 3K3PA 3QWAA 3UC9A 2PD4A 1FW8A 3OM0A 5A3RA 1YQWA 4G2NA 1R6TA 3R9XB 3KQOA 4N0PA 5AVUA 4GUDA 3N2NA 4ZAZA 5DYWA 1UPTA 1TO1E 4ZTUB 3FWNA 4ZK6A 4XIYA 2CV0A 4OLAA 3QWHA 2F8MA 2XE7A 2B99A 1ZGBA 1GG9A 2QYSA 1ONOA 2CY0A 3LHIA 3O2QB 3BJIC 2YVAA 4ZALA 2BCEA 3HS3A 3VXKA 4ZVVA 3LGXA 4AUEA 4HDQB 5KYWB 4HVLA 1KH3A 4FC6A 2GOYA 4U9HS 3RFXA 1LGYA 4RFSA 3WGUA 3CTPA 1I1QB 3DLAA 4BWVA 2XNCA 4I9GA 3KE8A 3LX4A 1G7RA 4I2NA 2WE7A 4BO9A 3I45A 4BQQA 2PUCA 2G36A 3IHWA 3CKYA 1QH8A 1ZUNA 2BI7A 3BPSA 3OTWA 1XWWA 4IS3A 3KZNA 2K2WA 1P2SA 3A6ZA 1GRNA 4PIVA 2AEEA 4XE5A 2G5TA 4Z8YA 3H9GA 4RV5A 3IVCA 1DWPA 2EG9A 2ZIWB 4MWTA 1N1GA 2C5EA 3AF4A 3DMYA 3S55A 3TH5A 3EVTA 5CG1A 4C0LA 1UBCA 1PGQA 1ZAKA 3RS8A 2ZPUA 3GLFA 2VG8A 3RVSA 4LS3A 1CUUA 3L6RA 5PNTA 5ED0A 5AXCA 1JLLB 2ZBPA 4MS4B 1UC5B 3T0IA 4DLTA 4PN3A 5EKUA 5JCJD 4QOEA 1K3UB 1Z37A 4R6XA 1NC1A 5SY4A 1PL0A 2WYOA 1T8PA 2WHPA 3LTEA 1VSBA 4KBYA 4LSGA 5HJ2A 4RDJA 1A82A 1KZ6A 1T0JB 1TC2A 2J6BA 3KX2A 5T64A 3RD5A 1AKQA 2CLOB 2VJAA 3NPAA 5JSZB 4MYUA 3HJTA 5KTOA 4N5HX 1M7GA 4E3ZA 2PY6A 2ZS9A 2WMDA 4CLRB 3M5DA 1VKNA 1QGAA 3O9MA 2P62A 5DSZA 1M2KA 3L7KA 5B6PA 4Q18A 5H80A 5J59A 5HNKA 3HN6A 3OPQA 3WMWA 3STYA 5KKAA 4CDGA 3NXSA 1UM9B 2VYFA 4TMYA 1IHPA 2QHXA 4B9AA 1DX6A 2FPGA 2QZZA 3UAGA 1CUEA 1R6UA 3K32A 4H7IA 3V8QA 1CRLA 1EP1B 3D8UA 1S9HA 1UT6A 4CTKA 4O2BB 4QBGB 1T9HA 2FG6C 1W9HA 2E4WA 2IUYA 3PQCA 4WLVA 1CUXA 1RRFA 3L7CA 2FVYA 4DA8A 4RENA 2JEOA 2EVWX 4BB5A 5J4YA 5LSAA 3T9EA 1IXKA 1DC4A 1V5FA 1PKEA 4CMIB 1CJCA 3HJRA 3U4IA 3R2JA 4WPGA 3A04A 1RQPA 1I3LA 1SHJA 3AHEA 4O2RA 1ISHA 3WIBA 4HJXA 3V7WA 2IEZA 2FFJA 4I6GA 1IOLA 1BXRA 2OILA 2WZDA 3R09A 1L8LA 2QRUA 3E58A 2WU1A 2ONJA 4CKCB 5EKXA 2O3RA 1WU7A 1W4AA 1Y9DA 2X8WA 2ZJFA 3D1VA 4LYAA 4OSEA 4XWYA 1EVQA 1XCJA 1S9DA 1MEOA 5LQJA 3EXG1 4EK9A 4AMZA 1BXGA 5JO9A 3P8ZA 3NH9A 3QUBA 3VPAA 2J0EA 2VWHA 1CW2B 4BVHA 2HY7A 3ZZNA 4JA0A 4URYR 2YV3A 1P0IA 4GOXA 5J2TB 4I1YA 1A8QA 1M73E 1N1DA 3GN2A 4P3OA 4AUKA 4NF2A 3O91A 4BMZA 2WWXA 1HLFA 1SUSA 3L82B 4I5DA 5TQ2A 4MCAA 2UXBB 2J1LA 1N08A 5AHOA 3S5JA 2V8BA 4P3YA 1N9GA 2CXSA 2JFGA 2PKXA 2V54A 3AUKA 3I52A 1TMGE 2Z04A 3ACCA 4HAOA 3V3TA 3NTOA 5F98A 5J5VA 1S96A 4BO1A 2XOEA 4N48A 1ZHHA 1DHRA 4QXQA 1PTJC 3LYLA 4GZ3A 1EM8A 1Q92A 3A6FA 3IULA 1A88A 4GPTA 5F5NA 3E7PA 4NS4A 5EPUA 3MXTA 1RWNA 1WV1A 3E3LA 4BCDA 1QRUA 1VLLA 4F3NA 2I6GA 1L5LA 1RAEA 2C4KA 2IDZA 1NZJA 3OIVA 3WX0A 3HDJA 5ALMA 1BA2A 2HSGA 3FCEA 3PD7A 5JPDA 5FAXA 3MUNA 4P2GA 3KKPA 2WSBA 1FSZA 2H2GA 4X95A 1B42A 1UBOS 4Y6SA 5K2MA 5HG0A 3M34A 2I55A 2I3BA 3KB1A 2B37A 4C43A 4PZAA 1PO7A 2A9PA 1USIA 3NYIA 2A5LA 4KACA 3VAYA 3QU9A 5DN6D 3OJLA 3HVKA 5HMLA 4YUWA 3ETLA 1WSVA 3S1LA 1WCWA 5CFZA 1IM5A 4RKFA 5LP1A 3ZWAA 2O14A 2G4CA 3WWZA 4XDYA 3C24A 4I5FA 4BYMA 4E7OA 2UUPA 3LBYA 3JRWA 4LRSB 1Y63A 5LLDA 2CCJA 1YAJA 3EXAA 5KTTA 5WRFA 1BRMA 1EXNA 4JELA 3LVRE 1VMIA 2GREA 5FYQA 4ESEA 4MGYR 4CKWA 5KOJA 4LF8B 2NSDA 4NTZA 1GPJA 5M34A 3GC6A 4D6XA 3ZE6A 2WSSD 2I4RA 3ETHA 4M3NA 1G1MA 1KETA 5E9QA 3VVBA 3AL2A 4F45A 3TUZC 4GQIA 5JATA 2AJCA 4FWTA 3M6VA 3OLQA 4IHAA 3O8RA 1BRTA 2JPDA 4BCBA 2WB4A 3CT6A 2GN6A 3FNFA 1NRJB 2V7EA 3BE8A 5CGQB 5EP2A 2V7BA 5D7NA 3TYXA 5JAUA 4FYKA 1W4LA 4MB2A 2FSHA 1J8FA 3L6OO 1U7DA 1UDAA 1ZXXA 4BMSA 4PPNA 5E3JA 3JWIA 1U0NA 2OHVA 2ZDHA 4WMLA 3DHWC 3OIWA 3ABOB 3LFTA 2QUZA 3BM5A 4ANFA 1BW9B 3NH6A 3NM6B 1DAMA 4ZA2A 3SXUA 2O8EB 3KT8A 2PM8A 1WUIS 2DWUA 2GAFA 1L4MA 3LOQA 1U98A 3UN1A 5IKXA 4LOLA 5FTLA 4C7OA 4GE3A 5IW8A 2A0KA 3ZHUA 4XRRA 3TBFA 1E5VA 4YMHA 3PC6A 1YNOA 3K8OE 4J07A 5M5BA 2FEMA 5C1BA 1RXIA 2O8VA 3PEYA 4QZVA 1W5AA 1CJUC 3L7YA 4WAUA 2ZYDA 3KUCA 1NSFA 1FFXB 1P44A 4XOIA 4ETMA 5JBNA 1L4BA 2WTNA 4YAIA 2HA7A 4FGLA 1HMPA 1G7SA 1N78A 3PJFA 3NYQA 4YN3A 1EWKA 1XWIA 3W4KA 2WWYA 1DDGA 3K0CC 5EQFA 3ZN2A 2HU5A 3D6UA 2PJZA 2XB9A 3OVMA 3PR2B 1JI3A 4V1CB 4HBGA 4FHGA 3PYLA 3OZDA 1MJHA 4M99A 1UPCA 4EJSA 3I55B 1OFUX 5A5GA 1DAHA 2YWRA 5C3UA 1KZ7B 1A4XA 2QN3A 2YNMD 3S7TA 1MC4A 3GDHA 3CTAA 1JHQA 2X0JA 4QPZA 4XUGB 3PIIA 4WBNA 3FYTA 3WWYA 2B8EA 3DZDA 3SOZA 3OEYA 2XZTA 1NA5A 2BFEA 4JI6B 3C41J 5CA1F 1ESEA 3NWEA 4UMVA 4P5EA 3R9KA 1XLUA 4G1MB 2CFTA 3VR3D 3HYTA 4NFHA 8MHTA 4D5EA 3DT6A 1JU9A 5AVOA 1NW3A 2QM7A 4C0JA 2ERCA 2V7GA 3GLRA 1KYYA 4BUJA 5J2UF 2AFVA 3K0BA 3G2LA 2EJWA 2M32A 3IXQA 3ZEIA 4XL9A 3LDGA 3CLTC 1FXUA 3I9MA 4L07A 2OUKA 1E2UA 2PXCA 2AWNA 1U3CA 2JA1A 2P5SA 4MA5A 1KF0A 1HLGA 3L0BA 3ZDDA 2NQTA 3NE5B 4ZGNB 1RKUA 2QG6A 3IEXA 3ZHVA 1OFHA 1FX0A 2ZTHA 3I2HA 1D1PA 2B2NA 3A2NA 1SUCA 3NAZA 5EJ5A 4BFYA 2AOWA 3HHEA 5F1OA 4HKTA 4II7A 3ZDCA 3OPVA 2NXJA 4EB8A 3DZHA 5AM3A 1W35A 3QPDA 3K16A 4BNYA 1W6UA 4CIAA 2ON6A 2AK2A 3SJAA 2O20A 5JVDB 1WZCA 3JVDA 2W93A 2CSUA 3OOHA 2AFIE 5CCBA 1SXPA 1SXJB 4JYPA 4YJ3F 4JB2A 3SMQA 3TIGA 4KREA 3K9FC 4EQ6B 3T06B 1D6SA 3KL2A 2PPVA 3KEWA 4L6AA 1OXSC 1JIVA 3HWRA 1QF9A 3U7JA 4DIMA 4B33A 1JHVA 4DBVO 1HM5A 1QP7A 2Z3ZA 3Q39A 4OKNA 2C04A 3K1JA 3QU4A 4NNPA 1GITA 4KDRA 1ULUA 3LKVA 3BFXA 4X5OA 5GGXA 4E15A 1BGXT 3UOGA 7ABPA 5H59A 5K0BA 4ZCMA 3RC9A 5KWSA 1WSWA 1Z28A 2GTHA 4EY8A 2IBTA 3FDXA 3CC2B 3KAPA 2GJKA 4FBMA 4IIEA 1F20A 4JP5A 3V7YA 2A6PA 3CXRA 3OG9A 2X85A 2Q2OA 3IQDB 3OPOA 1MOQA 2ZE5A 2JVIA 1KVSA 1MQ8B 3CF6R 1BGVA 4H0CA 3S44A 4NBLA 4FDTA 1L7XA 4QG3A 5LWQA 1TZJA 1X87A 5DXAA 5CB6A 1V9CA 1QQBA 2EF0A 2WJWA 3WWEA 3S99A 5FOVA 5JO0A 3W05A 4O4JA 1UWLA 1VP3A 4FR5A 3ZPXA 1XZIA 1UAAA 4BKRA 3D7RA 3FGNA 2IT1A 3DMPA 4MCJA 5JLAA 2QTZA 3LHDA 5JCOA 4AZWA 1B6GA 4XLCA 3AFMA 1SUWA 2ZRFA 5FPQA 1DHTA 3ENVA 4JX9A 4L2IA 2GAJA 1XHEA 4P4TA 4R8LA 4UZSA 2RGNC 3T5BA 3WYNA 1BEUB 4CQLB 1YOVB 1KKUA 4M9RA 4DY4A 3A58B 4PBRA 3RRMA 1DUIA 1SD5A 1Y8RA 4LXXA 4YDSA 5HYVA 1OH8A 3W5UA 3NEJA 1GTL1 1V39A 2WWTA 4G4IA 4PRYA 3OOCA 1BQ3A 4JY7A 1T1JA 1COWA 1SXIA 2QNIA 1AV7A 2WTEA 2AF4C 1O7JA 2JI6A 3A1DA 3LCMA 4OP1A 5KWVA 3OPNA 3RFFA 3HB1A 5AVYA 1P9NA 4DXHA 4EKNB 1IXRC 1W8IA 1K28D 1A8SA 1CRWG 3WBJA 1A5TA 1LC3A 1U6JA 2C2BA 2HNBA 1K6XA 2O5RA 2VSXA 5EHIA 1AQ6A 2H85A 4JQCA 5G0UA 2HQ1A 3PGKA 5CB4B 5LL6P 2CT8A 1YIAA 3OOYA 4KR0A 1DBQA 1GDDA 1O94A 1FRNA 1JGTA 3C5WP 4O4IA 2IYAA 3UXMA 1V6AA 3ASSA 2D3WA 2ZYIA 4ZVPA 4U7GA 2KJQA 3LTNC 1KEUA 4TYYA 1VL5A 2DP4E 3HNPA 2JI9A 3NONA 1MNAA 1ONBA 1AK9A 1A27A 4WWHA 1RXSA 2GPTA 2I6TA 1FVXA 16PKA 1RXWA 4RPHA 3MW8A 1SVNA 1N75A 1V8OA 2XWSA 4HATA 3AWDA 4B6FA 4ZHQA 1KJ8A 4RMJA 4J0FA 2ZRJA 5IDWA 4DA7A 1NFQA 1MJNA 1TZBA 2HBQA 2X3FA 3IUNA 3QELA 4IQ4A 4L4SA 3HV0A 3SZGA 5ED4A 1EIWA 4BX2A 4LE0A 4EVRA 1QXSA 2PTGA 2WAMA 3F1KA 4P0TA 4KPUA 4KJXA 2QRVA 4Q1AA 3ONYA 1MQAA 3QKRB 4FFDA 1YZFA 1ZM7A 4N3AA 1MX1A 1PQWA 4LOAA 5ALHA 3UKDA 5A5FA 4ITUA 1HSOA 3A4NA 2JFFA 3L1JA 1XD2B 3K8QA 2ZRCA 1KHHA 1Z5PA 1V47A 3GWZA 3O8OA 3QMMA 4HGQA 4JR0A 3SM9A 4ND4A 4DNTB 4LQ4A 3DR5A 1KMHA 1PT8A 2RHJA 3D7NA 4ITVA 3L7BA 4IIBA 2HD4A 3BZWA 4Q93A 4ZEXA 4C4YA 4D79A 4NICA 1ISSA 2NX2A 4M0LA 3CY6A 3FOCA 4PE5B 1OAOA 3ZE8A 5FL7A 4B82A 1F8XA 3TJZA 3WJ2A 1QLJA 1B1AA 2GBCA 5AW8A 3ZWYA 4Z4WA 2QL5A 3BWCA 3SG0A 2R9VA 5C8DA 4D81A 2F3PA 3FBGA 3U7QA 3UHPA 2J33A 4CUKA 3T9FA 2VHQA 2I4OA 3SYKA 4Z7QB 5CDYA 3H19A 3E9ZA 4OOXA 4H7DA 1CUJA 2P0YA 1F12A 3MHTA 4M76B 2VT2A 4EH1A 3EUWA 1QHYA 2B20A 1FOEB 1P5ZB 4FOLA 1G64A 2ST1A 4V1CI 1QO7A 1V9LA 4QJBA 3DMFA 4AT1A 1WQ3A 2NOAA 3G9XA 5B1YA 1KAOA 1WULS 4C4ZA 2ZR0A 1JWBB 4GP9A 4CIYA 2QU7A 1T29A 3H3FA 3HRKA 3F7NA 2ETVA 3BGVA 4X0EA 2PWAA 4YRBA 4B3CA 2GVZC 3MMXA 3AW8A 1GZ7A 3PQ3A 4BE9A 1Z0JA 3L41A 3F4BA 3PFGA 1EIZA 1Z25A 3LIPA 2XADA 3DH0A 4L78A 3PGLA 1FFGA 3JQQA 1T5LA 2OBBA 3MLEA 1HTWA 4BPRA 2EX1A 2EZ8A 2ZRLA 4A91A 4X7DA 2D3TA 4K9DA 2A0FA 3AEKA 3ASRA 4HWTA 2JF0A 3KELA 4L8WB 2QR2A 1IQPA 1PJ6A 4UD6A 4B3TB 1FP7A 2FRDA 4BYGA 3AY0A 3IEMA 3N0XA 2CXTA 3UJPA 1E3SA 3LFUA 1U2GA 4UU8A 5AKEA 4DIFA 5HX7A 1SFRA 1PR6A 1TCCA 2O1XA 5JRJA 2PX0A 3OZRA 3ENZA 3ULKA 2GWRA 3BK2A 1H9BA 3PG5A 4WZAB 1P19A 5DTMA 3B12A 1TX4B 4AZSA 3HZHA 1QHFA 1ZVVA 1OXUA 2HXGA 3IQIX 2C8LA 3BB3A 2UDPA 2F9FA 3WY9A 4ZO8A 5FLXA 1GZDA 5IJ9A 4PO3X 3RKRA 3TQSA 5JSHA 1ZRMA 4PAOA 2A0UA 5KTRA 4EHAA 1W581 5TR9A 4HGYA 3B3GA 4COOA 3TTVA 3GEGA 4MRVA 3WLHA 4Z6KA 3DOCA 2AQ8A 4EZIA 2O8NA 3V7AA 5DWDA 2IZOA 1GOTA 1XZGA 4XLAA 2VRBA 4W9NC 5DSTA 5DWQA 3UHFA 4B47A 1QTNA 3DWIA 3N74A 3UJCA 5EJ6A 5I7EA 2HUPA 2XQJA 3RG2A 2XDYA 1LPNA 2FZ4A 1H6DA 4AKEA 4RTRA 2C7OA 2J4FA 1VMAA 3DSRA 1OLSB 3NI2A 4IICA 4BE4A 1NQOA 2FPRA 5IUJC 1WX1A 4DR3B 3WGVA 2CDBA 3JATB 3TGWA 1FBNA 1E9RA 4MGZR 4B4UA 2BM8A 2FKNA 5IEJA 1RRVA 1VE3A 2PO5A 4ZV7A 5DSXA 2WF6A 3LUFA 4RPLA 2AS0A 4ZOBA 4RU1A 4BV2A 5B7GA 1R0WA 2OQ2A 3JQ9C 1VGQA 4DSNA 1QIDA 2H9IA 2RHCA 3HZOA 1KE1A 1XXLA 2BH9A 2OZKA 4CV2A 3R3HA 3G6EB 3LVFO 1N3IA 3HJCA 5K6TA 2QUKA 3KXDA 3O4IA 4TZKA 4ZOCA 4PHFA 4I36A 3U1TA 3J81k 1HNWB 3PZBA 3MTJA 4FMCB 4W7IA 1C8BA 2ET6A 2YJNA 4P4UA 1QHHA 3DYBA 2IA5A 3MM4A 3URMA 1QLHA 4UREA 2LTAA 4KX5A 1NFFA 4ZT4A 3MELA 1C41A 4BKUA 4BBJA 1E3WA 2QRPA 1NR1A 3PKZA 3QOYA 4J3JA 3GP3A 2I3ZA 4TWAA 1C8LA 1Z39A 3JPYA 1DIBA 1OTYA 3MFYA 3WLSA 4JOBA 4ZEOA 3RLIA 3SGLA 4F9EA 4RETA 1E43A 4ARCA 1JSZA 5DCLA 4HRXA 4PCUA 2FVGA 4NJEB 5D2CA 5J4VA 2PS0A 1XLTA 3A9SA 1FPMA 5JXHA 2WT4A 2RHRA 4JKOA 4PZ0A 5C35A 2VNHA 2Z98A 4X6XA 2CNBA 3NC0C 1HYEA 3I72A 4JXJA 4EJFA 2HAEA 3QY0A 4YPVA 1NRIA 2F3UA 2N3ZA 4ZO7A 4XVRA 1FDVA 3H1EA 3E5NA 2AT1A 4C5BA 4N03A 1AMOA 1KIFA 5ICFA 1XHFA 1SQ5A 2WJIA 3PGJA 4LJ8A 4Z7OB 1QOZA 3CPSA 1C9NA 1FE8A 2RH5A 3MAAC 3T95A 5KTKA 3GEBA 4DDHA 4EB6B 1ZA2A 4WY5A 3ESZA 4I4TA 1PJ7A 3EPKA 2XITA 4D0LB 2BEWA 4KODA 2WAYA 5CX4A 2W6OA 2I9PA 3GFRA 3CLKA 2XZDA 4RWEA 3QPWA 7ADHA 2NP7A 3ZHRA 4ZCIA 3TUIC 2RCYA 4X64B 2ZR7A 1EESA 5KYUA 1ZD4A 3IKTA 1Y89A 4KJZA 3GBVA 3JWPA 5IH3A 3EF0A 3FCSB 3NFYA 4R6WA 4J29A 1GAJA 4HL6A 4P92A 2AUTA 3NBAA 4FUQA 3FAKA 1HVXA 1J7JA 3RJMA 3C7DB 1VBNA 4H18A 2GERA 1FVHA 1F1BA 1ODCA 3NP7A 5FWXA 3ECCA 3JQRA 5IAGA 1JMKC 2M6KA 1IHMA 1I2ZA 1LLDA 3O1IC 5EE1A 2ATIA 1SQ0A 4NE9A 2OMEA 2J41A 1DELA 3CJQA 4BMNA 1YH3A 1P29A 3BCUA 1EE2A 1G8JA 4QXMA 5K6AC 4MEJA 2EWMA 1F6WA 3GGDA 1NXXA 4UW9A 4AJEA 5H3CA 3Q4GA 2CE2X 2IOFA 3H99A 1NAIA 1E1RA 2HHLA 3UZUA 2X8BA 4B79A 2IYEA 2WF8A 3QEKA 1I10A 4I1IA 3ETDA 3TL2A 2AKYA 3SLRA 4DE5A 5JDIA 4A8TA 1UDCA 3IE1A 1DGQA 4FCCA 4JT9A 4UFPA 4LISA 2GNOA 4MO9A 3T1TA 2CJWA 3DMGA 3P9CA 3ZJYA 1M1XB 3E9EA 3M9LA 1EDOA 4C4OA 3OQ1A 4E5VA 3ZD7A 2D9RA 1N2CE 1NVVR 1KC3A 3MS2A 4NYMR 1IWPB 1BIFA 2Q3JA 4EKDA 1MIOB 4BNLA 5FPYA 4M4SA 3TTYA 1QVVA 5EUQB 5H4GA 4JJIA 5HBRA 3R5HA 5KAMA 3L49A 4DV3B 4OY3A 4LHWA 1NF8A 5DOVA 3N2GA 4WOJA 2OTJB 2WU4A 1P5RA 4IH4A 2G83A 3D6AA 1P1BA 3A6HA 2R00C 4DMCA 1KP2A 3LPNA 3LJKA 3V4RA 5HDQA 5CFLA 1K86A 1PDVA 3DBHA 3SJBA 3SC2A 2CNLA 1BOFA 4F71A 4CT0A 1J0AA 1P91A 3EFBA 4D3SA 2YUTA 1CUAA 3PQEA 4EGFA 4RSMA 2O1WA 4Y1RB 3WRWA 5FA8A 4PR0A 2GA9A 2Q50A 3DUWA 3AVUA 3PC8A 5B1SA 2OP0A 2YC4C 1GNVA 1E0KA 1KFCB 2AFIA 3A0RB 1G8YA 3WK5A 2B4TO 3RUDA 2H1LA 1MW8X 2ZXHA 1O95C 4PINA 1QIKA 2AZDA 3K5PA 1QG2A 1IEWA 4BC1A 3I23A 3TLXA 5CPFA 4YV2A 4CQMA 3ROZA 1GXSB 3IBFA 3TMKA 3TNLA 1TI7A 4L9RA 3B70A 1CS0B 1G55A 4Q37A 5DLDA 3W90A 1JQDA 1SCKA 4RA9B 5GM2A 2WIFA 2P4EA 2IS2A 1SCJA 3NNSA 3H97A 4KN9S 5G1OA 1H2XA 2O0KA 1M3SA 4OPMA 4E6EA 4ZGWA 3CN9A 4D8TA 1ECCA 4EUEA 4DA0A 2G25A 3RSSA 3WDSA 4XOPA 2WFAA 3HCFA 1L9KA 1CJBA 4EVIA 1DVRA 3Q2KA 1I7LA 3EY4A 4HO1X 3IPYA 3JAKB 4UBNA 1GP2A 4QDJA 3SI7A 4DC9A 3EA0A 1PV4A 4CGZA 3PFKA 2GRJA 4TOIA 3DEZA 3OKPA 5L7YA 3ZWNA 3GROA 4FGUA 1XFAA 3DTNA 5CEFA 4IDQA 4LTNA 1T9KA 2WHEA 1IYZA 3P0JA 5JPIA 1G19A 2ZQ5A 1W5TA 1VKOA 1BVYF 3ZNQA 3W79A 3H6KA 4QQ8A 4UCWA 1M5UA 1F0KA 2ALJA 3JQFC 3VDRA 2YN0A 3GRZA 4LZJA 4PYJA 1UBJS 4F7DA 3SIXA 2VLIA 1K6JA 2HF2A 5T6MA 4N41A 3I1JA 2NAPA 4KIWA 1A96A 1MV8A 5JISA 3BRWD 3EEQA 1EB8A 1C3OA 1DKOA 2P9TA 3TE6A 3LO5A 4IBOA 4U5QA 5ES3A 2M1ZA 5REQB 4EL0A 3K5HA 3R0JA 1K5PA 4DCOA 2X42A 3BA6A 3HR8A 2DCUA 1OFIA 3M3PA 1FMTA 3NUGA 5HILA 2F90A 3CD6B 3ANLA 4CMHA 3C3PA 4FFNA 1DBRA 5K1ZA 2H7YA 3RY8A 4K9SA 3IV6A 1HI9A 2ZSUA 3G8BA 1QU2A 1MG0A 3WHLA 3A9TA 2JJ1D 3L79A 3K0FA 1GRVA 3FLEA 4WZBE 2VCYA 2AMFA 4LMPA 3KSMA 3G88A 4QDXA 5I9MA 3SKBA 1T1SA 1PFYA 1X7ZB 1IN4A 4HN9A 3ZLTA 3PUWA 4GMKA 4DXAA 4RDXA 2QROA 3NEYA 2DUUA 3HCCA 5GIOE 3PX7A 2IYRA 1DPFA 2FF5A 3MWDA 1LEHA 1E3DA 4R41A 1Y6RA 3S2IA 1NVVQ 3CNEA 4NYMQ 4YJ2A 4D97A 4PSDA 4MR8B 1N25A 4TQUS 4A8HA 4YHHB 2I67A 1HDIA 2IUEA 1RYHA 2QIOA 3SE0A 1V1RB 2H0RA 1RQXA 1GSOA 1TPZA 2ZSBA 4G5FA 1OHHA 1K27A 2I8LA 4BB9A 3G8AA 4N6GA 2MCFA 2OXIA 4K9RA 1NSTA 2A84A 3NXKA 4AWXA 3QLTA 3FRHA 2CVZA 2W70A 3KETA 2VTBB 4DDMA 1H85A 2KM1A 2HJHA 2GESA 4L0QA 1GQQA 2EBFX 3A8TA 1KA9H 1MDFA 2ZQZA 3C39A 2R2AA 5AI4A 2G76A 4UVEA 4JJGA 4RPKA 5IDYA 1LRKA 2ZJZA 1NXTA 4YRGA 1HT1E 1PJ5A 5JDCA 1JYFA 3U60B 1EWQA 2NPOA 1NXOA 2YXLA 2MR6A 3ZNNA 5HS6A 2DUMA 4J2OA 1Q44A 3B6IA 2VYCA 5I7SA 3EY9A 5LOVF 1ZCFA 2ID4A 2V6FA 3SBXA 1D04A 2FPLA 3CO0S 5JI2E 4EHIA 3PYXA 4Q3KA 3A4TA 5CLGA 4EECA 2PUGA 4B4DA 4G4SO 1M54A 4EUNA 5DS0A 1RHMA 3PHIA 4J16A 5IYRA 1EAYA 5BWBA 2XTAA 1IQ0A 4POAA 1R2QA 4L73A 3JY6A 2HMWA 3LZDA 3TVDA 3OAAA 2VDUE 4MV1A 3FHOA 3AY3A 3C7AA 3S1AA 5EN4A 3TE7A 1S2DA 4JT2A 3ZHYA 4EW6A 3D6JA 1EUDA 1OY1A 2EF1A 1COWD 1YZNA 3AJDA 3NBQA 4HADA 2A8YA 1Z12A 2OWDA 5JBQA 3TO5A 3HDTA 2Q2WA 3LCRA 5IHXA 3T1HB 1RXEA 3WL6A 4NBSA 4WZZA 2CBZA 4TL6A 5DFAA 4DK1A 2N9UA 4LOJA 5AHKA 4ZYXA 1KK3A 4DT1A 3FUWA 4BVEA 4YT4A 3VAAA 1CLUA 1QVZA 4AYTA 4ENPA 2CXNA 2QAIA 3QNWA 3RODA 1O94D 2WM9B 4FSDA 4RMGA 4ZT7A 4B32A 4BZPA 1T6XA 2VUHB 2WMYA 2Y0PA 4HJRA 4OKSA 5CAEA 3GQVA 3I9JA 1H2YA 1GFZA 1US8B 5LP6A 4I7EA 4MW9A 3S27A 4ASUA 4FWIB 1E98A 1GA1A 2YJZA 4LDQA 4JVSB 2X22A 2R7AA 3QA3E 5FUXA 1I5RA 5A2QA 3NC1C 2BFFB 3QPBA 4E2ZA 4JJ7A 3SBEA 4R54A 1ZUWA 4KO8A 2JAHA 1RSZA 2NYVA 5K0LA 3RCBA 3N7TA 1B73A 1JAHA 2DR0A 1A0OA 1S01A 3C8UA 3LSTA 4B6EA 3WJAA 1ZLYA 1MA0A 1FMCA 1BH6A 3EZLA 1XA4A 5ALKA 2R4QA 1DQPA 5EZQA 3W1EA 4UVHA 3MCWA 4PBTA 2W6JA 4HGNA 4YCJA 1H4TA 2XT0A 3EEFA 3FLBA 3QTTA 5KOHB 2ZREA 4KFUA 2QNBA 4X85A 2PE3A 4C4TA 1CU1A 3EQ9A 2GTPA 4QVJA 4K6GA 4XIIA 4EI7A 1AHHA 2VDWA 4KXLA 1LPAB 1CJSA 4NCHA 2Z6UA 1SZPA 1UBFA 4TLCA 2LPMA 3T4PA 1CDZA 1EH5A 1M2GA 1VPEA 2FLKA 2V7PA 5DPMA 2Z57A 5T41A 1ZFNA 4J4BA 4WZ6A 2ADFA 1ZVJA 2YHAA 4B3GA 2YQZA 4M1MA 5C0OE 2WICA 3RS2A 1NMSA 3GI1A 2DVMA 4FS8A 4WOBA 3PNQA 2C7GA 4LJSA 1XZ8A 1Z5NA 3HK2A 4IUYA 1KYWA 2I4TA 2JJ8A 2O2ZA 5FULA 3THYB 3CEPB 3AR6A 4YCDA 3BQNB 4HNQA 4YMIA 2Q5LA 2EHJA 2JAXA 1P1RA 2M9MA 2ZZEA 2W4IA 3DDNA 4XIJA 2WWHA 2O6LA 2Y76A 3ASTA 1G5QA 1JT2A 3GJ8A 4KEAA 2NXEA 1J2YA 3NWBA 5G4LA 2FRVA 4PV7A 2IEYA 2WNIA 3ZWCA 1MEEA 2O2XA 4GM1A 4X8IA 1EVKA 1QDEA 4HVAA 3VX3A 3WHKA 1YJQA 4TTAA 4B6SA 4MUJA 3QEMB 5B2EA 4Z9BA 2XQGA 1PFGA 3COYA 4UE6A 3M81A 1Z18A 4WFQA 4ZI5A 1NW6A 3VDXA 2RGGA 4AKSA 3GMDA 3KSBC 1I3OA 4HX2A 4S1VA 2VNAA 4MRMA 5ANRB 1LD3A 3RYCB 2IOHA 4RBNA 3CMEB 4GM4A 5LCXA 4KPFC 1T1RA 4I14A 1GGHA 2GHQA 4LC0A 2FZGA 3JXEA 4G0ZA 1EFRD 1DEXA 4G86A 1PKVA 4UNQA 3ZXIA 1GL3A 3PDWA 4GRAA 1QTIA 5JIBA 2GJRA 4CQJA 2V0CA 1IUKA 3KZ1E 2XJ4A 1AGNA 3PFFA 5ES4B 1W9XA 3PVZA 5DNDA 1GPWB 2YY7A 3RUFA 5I7FA 2V3CC 1S3GA 1UJ6A 3EIWA 4M88A 1RHJA 3QOFA 3CJRA 2P6MA 1RQ2A 3NEPX 1F1JA 1KTVA 1UWCA 4G81A 4M1QA 4QDZA 3W6ZA 2AQHA 3C8ZA 4FZVA 4JV5B 3MS7A 1JB1A 3OKFA 3W06A 1T3TA 4IFTA 3LT4A 5DGXA 2ZTNA 4HG2A 1OWNA 1P9WA 3CCCA 3D3JA 4BNMA 1QGDA 1UJCA 3G0CA 2VT7A 4H60A 4JJ8A 3EVDA 3B1YA 3EXFA 3LOUA 3TL6A 1TOAA 3H6GA 2KW5A 2MSWA 4MV7A 2DOKA 3T5GA 4H7PA 2J07A 2A9KA 3I1FA 4RJLA 4CU2A 1W96A 1YVEI 2VF8A 2XGSA 3EMVA 3ZYZA 2G67A 1LTQA 1ZEJA 1J8VA 2LW7A 3R3UA 3ED1A 4MP8A 3AR5A 4R81A 3T4EA 5IK2A 3W9SA 3BTSA 4HB2A 4RGYA 3BBLA 1JPJA 1A1SA 5BMVA 4ARVA 3FYUB 4K9KA 3NHRA 2H63A 1XE3A 1EK6A 3ANYB 3VRHA 3A70A 4WECA 4X3OA 2V4ZA 4CTOA 2HWXA 1Z45A 2JFUA 1UP4A 1UJ2A 1WOYA 1YJXA 2A9RA 4IJMA 3D4BA 3SLNA 4YRIA 4IR7A 2P3OA 2MU1A 3MRSA 3G7SA 1RYDA 4HEA6 3GLTA 4H4DA 3T5TA 4LRWA 2YNMC 3BMQA 4G84A 1GGKA 4C2TA 1DQSA 1M33A 2A4MA 2C88A 3IERA 3L77A 4DEXA 3AM1A 5AXBA 1II0A 4X1IA 1YE8A 2PZFA 5HUHA 4RDCA 1SEPA 1A2OA 1W19A 2BTOA 4MPPA 5BUCA 1JHPA 4QE3A 2QV7A 1DJMA 3DBOB 3COWA 3HXLA 1Z0AA 1ULZA 5G3ZA 5AVSA 1QO0A 1R6BX 2E4UA 3L01A 4YQZA 1UFOA 1KO1A 1GZ6A 5F21A 2IUFA 4X1OA 4BIMA 2BFDA 3WGOA 4LZWA 2ZWIA 4GPAA 5CW2A 5KNCA 3CH7A 3CSSA 2GYUA 3FPCA 4BLSA 1WP6A 2ZS8A 3X1MA 3WL8A 1Q83A 2XMZA 5HSGA 2WM2A 4KN6A 4WQMA 4G3XA 1RW4A 5TX7A 5K3EA 2HF7A 1E1LA 1R3UA 3GJYA 3NM5A 1L5RA 5EJ7A 1VLJA 4TMZA 1F5NA 3L5OA 1LJUA 1MAHA 3QVSA 5JCZA 3QKTA 5SYNA 5DRYA 5IEBA 1DQZA 2H1WA 3KTDA 3KZOA 1EQ2A 4U8HA 3H13A 1K7YA 3WKCA 4ZD6A 3RIEA 4IIGA 3QWIA 2CW5A 3K7EA 4BJ1A 3RANA 5K0ZA 2D4AA 3RUAA 1E9DA 3QX8A 1N2CA 2YWXA 4Q15A 4OHVA 4UU7A 1Q7YD 1Y0YA 1U04A 5BYBA 4C78A 2QTFA 3KEGA 1C3XA 1C9YA 1R0YA 3CESA 1UM8A 3LLMA 4NFLA 1M74A 4KITB 3VX4A 3EDCA 4WVLA 4CKEA 4YAJA 3AEUA 2JGDB 2QVBA 1Y1PA 2CB0A 5L53A 2GK4A 3U9LA 1W36D 1T9AA 1G41A 4NK4A 2HQSA 3W2IA 3R40A 2W48A 1QVRA 4MEBA 2D3NA 1GA4A 4JDPA 3FPHA 4TPKA 4UCXA 4F04A 3P9KA 2B7BA 4MPTA 1P77A 1P6XA 1WD7A 2C2XA 4NCXA 2GARA 1Z6ZA 2H4XA 2PL1A 2Q21A 3DQQA 4LRQA 3EZ7A 3F74A 1FVOA 4P84A 2X5KO 4XGKA 4EO9A 1TKAA 2XE4A 1CQXA 1JIJA 4EA7A 1VKHA 5CD9A 3ISJA 1OFVA 3LUHA 3CFYA 1XTIA 3WLTA 4Q7QA 2V6BA 4ZI3A 1QHIA 2EOAA 2XQFA 4NAUA 3QTLA 5KB3A 3IELA 1NULA 1ORWA 4IXMA 5JH7B 2OM2A 1CRPA 1CY7A 1Y1LA 3FDIA 1BCSA 1FUIA 1W5FA 1E7YA 3P2JA 1YC5A 1ZQ9A 1YZVA 2X4DA 1OFTA 1G2QA 4HXEB 5CCXA 1CUSA 1VQ8B 3B82A 3IVXA 3AUXA 4LFBB 3Q9SA 5FFNA 3ESAA 4DL9A 3TRKA 5J4KA 1K2VN 4BY9E 2JK0A 3KQYA 5F33A 3LY5A 3OEEA 1W48A 5LBUA 1H2WA 5GZ3A 4R0MA 4PGGA 3U4QB 4XSGA 4AMVA 2FSUA 2VVTA 2IRWA 2XIQA 1QLWA 4L0CA 4JYZA 2AI1A 1UP6A 5BVHA 3LQEA 2FV8A 1X70A 3NBFA 3LDAA 4OYRA 3RRXA 5LKRA 1XAIA 3I9NA 2D4HA 1IG0A 1LRJA 3ODPA 1JG7A 2FYTA 1E58A 2IZ5A 1XTZA 2FMKA 4GIBA 1AUXA 2H4FA 3C3WA 2RARA 4ZVQA 3EXG2 4ZCRA 1WSAA 4Y2UA 2QXYA 5EY5B 2IYQA 1DXOA 2J5QA 1WAMA 3FSRA 3V8PA 3N8HA 3AT1A 1AZLA 1OXXK 4FE4A 4H7FA 5AUQA 2B2CA 4AMUA 4LY6A 4OREX 3PX2A 3CE9A 1MT3A 2OZLB 4ISCA 4D46A 4W9MC 2Q8PA 3D6VA 3BHNA 4JODA 1F2DA 1FYVA 2I65A 2QTNA 3HGTA 3PC7A 4O2AB 521PA 4W4TA 4AULA 4DMRA 1Z08A 2WPDA 3IQHX 5G1NA 2D8AA 4OXNA 2YMLA 2IZZA 2QVYX 1OFUA 2WFLA 1O6ZA 3B53X 2TSYB 3CURA 4PIMA 4R16A 5ALZA 1F4VA 3BICA 4UEOA 4EM6A 3SBDA 1NU8A 3H9BA 5B53A 2XVXA 2H2AA 2L0XA 5DGTA 3RK4A 4AN4A 1YE5A 2R1TB 3FGPA 4E5KA 2FETA 4ZK2A 5C51B 1KY5A 3E1SA 3IUEA 3M4YA 1JHYA 3AEQB 1O0BA 1B43A 3LC1O 4QPPA 4EO4A 1NI4B 2FH5B 5JY6A 1SOWA 2XDWA 4IDCA 4B7XA 1FJHA 4D26A 4MZXA 5FO0A 2QJRA 2LCQA 2O8BA 2VIIA 4D6PA 4TVBA 3ZWQA 1YQQA 2F17A 2XY4A 2CHUA 3EIOA 4WZBA 2PUBA 3CMCO 1UK6A 3UM9A 4XX0B 3WZ2A 4UBOA 3GJ3A 1TQDA 4UEKA 3OCYA 4KMMA 3ZS8A 4XKWA 3QBVA 3LOPA 3ET5A 2C77A 1IM8A 2FFQA 4DR1B 1OH7A 3UYKA 5I01A 3TZ6A 3FHLA 2VSYA 3M5WA 3GXBA 3W9BA 4A0FA 3FOFC 1JYSA 4R98A 1BYUA 2QSJA 3EQ6A 4DBLE 1UDRA 2YS6A 3A9VA 4PIPA 5FWYA 4DV4B 2CYBA 4BO8A 1JPUA 4I5IA 3R6TA 2H3HA 2ZAOA 4IH9A 4RVNA 3SICE 4LAFA 1Y33E 4MKHA 1Q57A 4RL4A 3SHVA 2F43B 1ZH4A 5K5EA 1ESZA 1PQPA 2C0QA 3IR6A 4RZXA 2JKYA 4FZJA 3S40A 4OQPA 2LZJA 1XMJA 4I50A 3WKEA 4YYZA 4IZOA 1R64A 4H1VA 1I4LD 2I8CA 4KIJA 5I9NA 1CG6A 1H3EA 3EAQA 4P4SA 1VPWA 3OUTA 1E2JA 4TS9A 1L5QA 5FKJA 1E6MA 3TW8A 3TUJC 1ZMRA 2HPVA 2QGNA 3ZE0B 4ZI7F 4Q19A 5CBKA 1N8RD 1O97D 2Z83A 4RIIA 3EVGA 3V97A 3AHIA 1JKMA 2CD9A 4K6HA 5FEUA 3QQPA 1TO2E 3O21A 4UHBA 1ISIA 2RD2A 2BHRA 2CK3D 2GM5A 4J0QA 4ZOLA 4JNKA 2G3YA 5KSYA 1UOEA 1C14A 4YYEA 3BSSA 1UCFA 3BMNB 1PR4A 4BRZA 1T5DX 4TKLA 1YZ3A 3R3YA 1WW3A 4FD3A 1LDMA 1YBAA 1WKBA 4FEGA 4NKRA 2X13A 2C7QA 4I6EA 3CZ5A 2ZJ3A 3GVIA 1MCZA 3A4LA 4X1YA 1EFHA 1SVMA 1MNQA 1LU9A 1GPDG 1Z7BA 2I2XB 3CE6A 3ZS9A 4P12A 4FEAA 5I9LA 3CPHA 1W4ZA 4Q4JB 2PAAA 2DR3A 2CUKA 3TLGA 4R1TA 3PFHA 2JIBA 4BFZA 1H9AA 3FCXA 3K2IA 4E7PA 1R9MA 1SUDA 2GEBA 3IC5A 4GOLD 4RK7A 3PNMA 2IDJA 2BPOA 3GP8A 3OA0A 3UB2A 5DHQA 3M9XA 2NO7A 3HCPA 3LDHA 4F8JA 4QXOA 4H17A 3M49A 3R20A 2F1MA 2NU7B 5DNEA 4AIIA 4BTVA 3E1YE 2J3QA 4O1HA 6YASA 4ZVOA 5KO2A 1ZVKA 2Z2YA 4UTOA 1X6VA 1LPMA 1R1DA 1NKVA 4OLHA 1BS2A 2VTVA 4LMRA 1AGRA 3N8KA 2FP4B 1TPYA 4UCQA 3W7BA 1U9JA 1FVFA 1Q3HA 1Y8QA 3FN4A 3G1WA 3K20A 1FNBA 3EHEA 1DU4A 4UM8B 5A5EA 1ZBDA 3KXIA 3SXPA 4JBHA 1O0SA 2I4NA 3WDLA 1TMYA 3OF2A 2Z2XA 3FPEA 3ZHCA 1P31A 4RESA 2PGAA 1ZIOA 3FRJA 1WV0A 3UPDA 2HCBA 4JH0A 3HN7A 4UEQA 2WMOB 1FJXA 3AKEA 1PVOA 1QUEA 1BS1A 2VH2A 4HAYA 3PWTA 5DLYA 4NBVA 1PJBA 1TJ5A 3CBQA 4E13A 4PGAA 5L7TA 1OHHD 2A9VA 4TMKA 1WQ4A 2WKWA 4CEJA 3G71B 1U2EA 2CHGA 3NV9A 1WWKA 5EKSA 3UBMA 5FT9A 4BZZA 4ENWA 2XMSA 4DTIA 4XJTA 1X2EA 4C2BA 2NPFA 2QKYA 5KJCA 3H5TA 4B3SB 4WK2B 3I30X 1TLFA 1PI3A 3EDQA 1HORA 1XZEA 5BSRA 3DFUA 4N7RA 1RHUA 1SOAA 4L51A 3SZOA 4YIKA 2O0MA 4US2R 3ASPA 1KY4A 4H1WA 2K7ZA 2C57A 4C04A 5JWOA 1IY9A 3EVZA 4OSPA 4DRYA 3M4NA 1K5DA 5A6SA 1AA6A 5EMKA 3V1NA 3F5MA 3BREA 5CNIA 4FKBA 5ITZB 1SMKA 3HB5X 4BZWA 2IHUA 3KXLA 4UHJA 4F5DA 2OBYA 4TT8A 1JA0A 4DA9A 4OK6A 3TLCA 3DTTA 4DR4B 2JANA 3Q1LA 4BKOA 3H2KA 2PKCA 4K87A 3SHQA 4LY3A 3G2NA 1L2TA 1FFWA 2GGSA 1KFKB 1I3KA 1NX6A 1XCBA 3LW7A 1N8SA 4LIPD 4U0KA 3QE2A 3IAM6 4AJJA 5GOTA 2H2HA 1MO6A 1XA3A 2IHBA 4NFYA 3ZX4A 5JBIA 3OFKA 2H0AA 2CJXA 2EZ9A 2ZDGA 3JYNA 4LBZA 4PFKA 3MINB 3N2KB 4EX6A 1DIRA 2CJFA 1EK0A 4ZAFA 3C6KA 4CI9A 2OTLB 8ABPA 3COZA 3ITDA 5BR4A 1M6VA 2OMKA 1OTHA 3CCRB 4QJ5A 3DHVA 3AERB 3CC8A 2QYHA 4YEDA 4A73A 2QPAA 3BXEA 1ACMA 3W2GA 4F11A 1VYUA 3OBIA 2VF5X 5HTOA 4BQNA 3IHKA 4CEIA 1D1NA 3IP1A 1LS6A 1GAQA 3FOAA 4LK2A 3Q11A 4OX9Y 1U0SY 2H16A 4MOWA 1VF7A 4E21A 1Q7GA 2Y67A 2CDCA 3W6OA 4O4LB 5IM4A 4JLOA 4E4YA 1Z83A 3Q0IA 4FT4A 3HBFA 5DMHA 3JYQA 1YQXA 1ZXBA 1DJNA 4IDHA 3BGDA 5EUBA 1SU6A 4CCYB 3RU9A 4AS1A 3RRNA 8OHMA 2AEJA 3PQ7A 4KDCA 1R37A 3R75A 1TCUA 5IHPA 1NNEA 1XEFA 2X8AA 3C1UA 3AXSA 4L75A 4N8SA 4B8WA 2PLRA 1SUFA 3P0HA 1TYDE 2J32A 2WIKA 2UVQA 3OKCA 2PFSA 3FPAA 3OJXA 2H4HA 2BY4A 3AUUA 4D9EA 2C83A 4HPJB 4QSHA 3E2IA 4BLTA 1NFRA 2OGTA 3Q8WA 1L5HB 3ZUPA 2XUFA 2IHTA 3GCZA 3H5AA 5DI3B 5E6SA 4W5HA 3EUAA 3WK7A 4UARA 3GA5A 3I3OA 4F91B 3BZUA 3PIDA 1E2IA 2QQ0A 2W8ZA 1FUKA 1H2ZA 3EVAA 4IJQA 4MUHA 1CR6A 4JI4B 4YAUA 5T5QA 4R3UC 3PDIB 1NM5A 4A7PA 3F97A