2V7UA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosylmethionine and chloride ion
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXY ADENOSINE SYNTHETASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7uA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7uA01
1RQPA 2ZBVA 2V7UA 1RQRA 5LMZA 2CC2A 2Q6KA 2C2WA 2CW5A 2Q6LA 2CBXA 2Q6OA 2WR8A 2ZBUA 2V7WA 2C5HA 2F4NA 2Q6IA 2V7TA 1WU8A 2V7VA 4CQJA 2C5BA 5B6IA 2C4UA 5FIUA 2V7XA 2C4TA
chains in the Genus database with same CATH superfamily
3ZW8A 1L3BA 3TIVA 2FSHA 2QNRA 2H92A 2WQ7A 1HI9A 3P0HA 3SZRA 1PIWA 1LVUA 5LDHA 4OBBA 3EH1A 1JZQA 3G2IA 3NH6A 1VPDA 3VNSA 1JJFA 5JEEA 4DR5B 4KN8A 2D0DA 1TM2A 2PT7A 4LBWA 4A8HA 4BMXA 3ST7A 2KLHA 3UBMA 4DR6B 1DXYA 2Q4RA 4RKRA 2PRIA 2HC9A 4AC9A 4OQMA 2IUSA 4D3XA 4F9EA 3GJQA 4RL4A 3GNQA 2WPDA 2JGEA 3EGWA 5LXTB 2H00A 1H3EA 4RZHA 1PFVA 3KR2A 3T0IA 3A4IA 5AW1A 5LQMA 1PWHA 5C8XA 1Y8QB 1FFBA 1CUAA 3LFUA 3E82A 2QG6A 1B8NA 4MUFA 2UKDA 3JQAD 4BYMA 3S8EA 2C2HA 3Q0EA 4LYAA 4M1WA 2ZIAA 2FEOA 3RNLA 3ZD8A 1R8QA 5HTOA 2GPJA 2GBIA 1EDOA 3I55B 2QAGC 1S9HA 2H4YA 3C41J 3GLGA 1DO0A 4P84A 3ABIA 3FNGA 1OAOC 4DB4A 3WLEA 3ER8A 2XUDA 4XOTA 3ZDXB 2X8KA 1C1XB 1ZKDA 2IVFA 5K0CA 2WJZB 3KE9A 2XT0A 3RU7A 3RVSA 5ANRB 1UP6A 1K3TA 1R5NA 1YC2A 1Q0HA 2HDWA 2QVYX 3EGEA 4EYKA 1R6BX 1R10A 3T99A 3ZDAA 4KO4S 3IE2A 1L9XA 4RGQA 2Q0SA 3BXEA 2YWDA 2BUCA 2Y92A 1XNJA 1V5IA 2AEEA 4YAWA 2PZJA 3OZEA 4BNVA 1VLZA 3RKSA 3OZUA 1E6KA 4CI9A 3N86A 1SIBE 3RVLA 4DLPA 3AM5A 3EEFA 8ADHA 1FS4A 3AB7A 4MRMB 1RE1A 1AKYA 5IF3A 1BS9A 1SU8A 4XTCS 4HAIA 2OXEA 4DC9A 2MTBA 3FH0A 2WABA 1N2EA 3A7DA 4I7EA 2BWJA 4NOJA 1LLDA 2R6R1 1E4YA 3S29A 3D1LA 1TUBA 2VSXA 4HDCA 3S8YA 4BN5A 1L7DA 2PEYA 1T0PA 3HZOA 3L6UA 3M4YA 4H15A 4QTUB 4ZALA 4HN4B 2PBLA 3QEBZ 1U2GC 2E6UX 2IY9A 5DLPA 1XRQA 5FTWA 3VKFA 3MWDA 3PFWO 3VJKA 2ZR9A 2FFQA 4RDIA 1LI5A 1TM5E 4QU0A 4EPVA 1F3OA 2B99A 1NI3A 4BKMA 1DKRA 1CR4A 3V2HA 4D3DA 2CMFA 2I2FA 4MMYB 1ZBDA 3GJZA 4C4PA 1YJWB 1MMFB 3Q4GA 2CE7A 1XTJA 1ZSVA 1PG5A 3O93A 4I1IA 4O0LA 3G5MA 3SLDA 4YTEA 4YRPA 4XKJA 1DTSA 5H0IA 1VI5A 1VLMA 3RHFA 1QGZA 3TGPA 2Z1NA 2RK4A 3LH5A 3OIYA 4GEKA 4IH9A 4AZ3B 1U8EA 5H4HA 3QP9A 3ZNPA 4X0EA 2I7DA 4QUGA 1DDGA 1S7GA 1I30A 1Y6GA 4L72A 1J0XO 2GZMA 4BQSA 1M33A 3LBYA 5BSRA 4M6WA 1E2MA 1QO0A 4K9DA 4OQQA 1H5UA 1RQLA 1XK6A 2M6RA 2B7LA 3EZ9A 3HSYA 4CV1A 3GRKA 4HGYA 5AOBA 4Z0HO 3LXUX 3VH3A 2JVJA 3QXXA 2BFEA 2AV6A 5B6PA 3NYIA 3DZDA 4WGFA 3ESAA 4P36A 2PKWA 1D1TA 8MHTA 1Q21A 4J1TC 1QHXA 2Y1LA 5A04A 4Z3DA 4QVIA 4ZCIA 1KEKA 1IDN1 3SF0A 4D81A 1SCUB 3DM5A 1R5JA 3FKJA 3JRNA 4K03A 1YR2A 2AFIA 3ZDYB 1AKWA 3AF6A 3VUFA 3WLLA 1YH3A 4ZU6X 2IYRA 3FCUB 1IHPA 3BT7A 3A4LA 3CZ5A 3OFVA 3QPUA 2APJA 2X7JA 4GPAA 4QUZA 4P3IA 4C22A 4BP8A 4CKEB 1JXQA 3HUUA 2FMXA 1JKIA 1Y8CA 4Q4HB 4BN4A 5HXBA 1IBCA 3I09A 4DCPA 1U2QA 4JJIA 2QDKA 5EMNA 1N2IA 1P5HA 2P1DA 3MRSA 4LDQA 4HUTA 4JJFA 2IW3A 1C7EA 4AN0A 1DCKA 2Z2KA 3JQDA 2NXNA 4R31A 5AXAA 3U49A 1Q15A 1DTEA 2IXGA 3EVEA 4IGEA 3CVVA 1DBPA 2WSMA 4CNBA 3H0EA 2GF9A 4ZVKA 4EG6A 3JPWA 2Z5GA 4HZGA 3A3BA 4L0DA 1C0KA 2WOJA 4QUIA 3SC3A 3QITA 3O9MA 3IDFA 3Q7QA 3VOTA 4X7RA 4EO7A 1I7SB 2A30A 2OBTA 1SPBS 1PWYE 4BMNA 1CQIA 4RJJA 3QVJA 4DTIA 1YJXA 1VM6A 2D59A 3RTBA 5H9VA 5B1YA 1XJQA 1ENYA 4M54A 5AVSA 5KYXA 4LE1A 1J9EA 4D5GA 3KPVA 1NW9B 2EATA 2CLFB 1DC8A 4WMLA 1Y7HA 5G4LA 1KMNA 4NEHB 2PAAA 2ZIUB 1P1HA 4H7EA 4EI8A 4BJ6A 2ZJ8A 3M9XA 4UM8B 4CCAA 3FI0A 3BFPA 1LK7A 2I7VA 4B82A 1GQYA 1TVKA 1ZMTA 2ENWA 2FKNA 2NVOA 5AOVA 1JBKA 1RI5A 3NC4A 4NBWA 3L0IB 3IPYA 4O4LF 1EVIA 2AN4A 3I9LA 3DV9A 4XFJA 4E94A 2O5CA 3PQ5A 1THTA 4COKA 2Y1KA 2VDWA 1ZL2A 1X3LA 2FWJA 2VRWA 2H1SA 4TLAA 1DRKA 3FSJX 4R0NA 5FL7D 4YCMA 3VA7A 2GKSA 3HKCB 4M0FA 3PCXA 2OPBA 3HU5A 3TK1A 3TVYA 4BMPB 1KDZA 1LNQA 2PFSA 1KIAA 1OGJA 1ZK0A 3B9RA 1CUSA 1ZGHA 3ETNA 2C8JA 2KE5A 3EZXA 3VSCA 5FTMA 4IX1A 1ORWA 2DLNA 3QTLA 1VI2A 4LJKA 1E9DA 3LFTA 3I4LA 3Q6IA 1VCMA 4JR2A 4NP6A 3ROEA 3KR0A 2OBYA 3DOJA 5LDGA 4MV1A 1VRWA 2JFNA 2PGXA 4XPIA 3W5CA 1GPWB 3WLIA 2JH3A 3LP5A 4IEEA 1IJBA 1GITA 2E85A 1XZCA 4MA5A 3RARA 3O1IC 4PLWA 1AO0A 1VZ3A 5GOTA 4BMOB 1GNQA 2UYOA 2P35A 5JPIA 4YGXB 3K0BA 1T8PA 4N41A 1DV2A 2CUTA 3AERA 1J33A 1W5AA 3SKXA 3ZGOA 4TTRA 4GRDA 4DMGA 2CXRA 1TCVA 1XXLA 1YDFA 5I5EA 1XHLA 2HYDA 2NVUA 4H60A 4U6SA 4CU5A 1HNWB 4EW3A 3V5NA 2XCIA 3AFOA 1U5BB 3L5KA 4F04A 4KR2A 4J3JA 3U5TA 2Z2YA 1W4BA 2Q1YA 3MRXA 4GOND 2WU0A 4X65B 2X3UA 3NV7A 5IJZA 2QLBA 1DJLA 3FCEA 2GM4A 1K5DA 2OP0A 4FT4A 4Y6GB 3V8NA 2RGAA 1RE0A 4MGEA 4O25A 5C52B 2AJLI 2O5RA 4PFJA 4EBBA 1Z88A 1GILA 4R1MA 5D3QA 4HLNA 1IG0A 3T4EA 4PZAA 4QTTB 2VT7A 4INPA 3UQYS 4YJ3B 2Y71A 3ITKA 1B1AA 2R6DA 2WDZA 3HRIA 4BO9A 4LXIA 1HDZA 3RY8A 1N7IA 1U6IA 5FRDA 3OE1A 1IE3A 1QK3A 4YXWD 3KAPA 2NSDA 1IJFA 2C4NA 2Y77A 1G18A 4RC9A 4BMZA 4RTQA 1YIDA 4OHVA 5IX8A 1WTHD 1VCIA 4DIKA 4R3UC 2CNLA 1S2LA 2WUWE 2HHJA 2XB9A 3HRKA 1X9GA 5AI5A 3ZXUB 3VO2A 4B4VA 1QQ5A 1Z45A 4W1PA 2B3DA 3IVXA 2B34A 4MJ3A 5TQ0A 3QOWA 5JDCA 3A04A 3Q3EA 2ZYWX 4UDYX 4BTLA 3RKRA 1J9ZA 1K5PA 4F4CA 4E08A 1NE7A 4EAAA 3BQNB 3A2LA 2RG7A 5FBVB 3IP5A 3DNFA 5F51A 4M1TA 3F5SA 2RK3A 5WRFA 1NG1A 1PV2A 2B2XA 5IAEA 4F71A 1CJBA 2VPZA 4YP1A 1BYIA 1X3SA 2HX1A 2GYVA 2JLQA 1G9TA 3KSRA 4HMPA 3LCCA 1Y4SA 2WM8A 5CVCA 3S3TA 3U09A 1NT4A 1Q0PA 2CLKB 3QMWA 4F2WA 5I7EA 1EM8A 3A9CA 1RJEA 4OUKX 1T3GA 2VPIA 3J7TA 1BFDA 3HH8A 2WNIA 3UGTA 1DAMA 2WF5A 3AONB 3ZV4A 4IRXA 1CZOA 3EASA 2X3YA 5CURA 4BHTA 1ULSA 4R1LA 4DCSA 2VJCA 2F9LA 3OFKA 2Y1GA 1STOA 1W9XA 4LGMA 4MO9A 2VPWA 5DTMA 2YW2A 3RTEA 3MQ4A 5JRJA 2PQMA 1MAWA 2GJSA 2VNHA 2IEIA 2AJBA 3ASUA 4LMPA 3UICA 1R4NB 1AC5A 3NT4A 4FHGA 4F45A 1NJ5A 2D13A 4ENRA 7REQB 1JF8A 2OHJA 2IBSA 4M86A 2VJAA 2W0SA 3UH0A 4KWEA 1FOEB 4CM9A 4Z4GA 1V5GA 1UDAA 2FP4A 2QJRA 2AN5A 3VNAA 4LNUA 3Q40A 1UPTA 3BMOB 4E5KA 1E1QD 1O95A 4EW6A 3MXOA 2AS0A 5DO9A 1DRJA 3AILA 4B87A 1W76A 3S1LA 4KNYA 1RIFA 2DWQA 2MYUA 4TTAA 1OFIA 1GCIA 1UP7A 5CR9A 4P4SA 1ZONA 2DM6A 2CL5A 1R4MA 2HB6A 1UXIA 5FPTA 1RPJA 1UADA 3FYDA 1YZFA 4KQ2A 4AJKA 5ADUS 3HEAA 1UIMA 2YZGA 1CZUA 3R7WB 4A0SA 3O94A 1OB0A 1CNEA 3N7UA 5CLIA 2F6RA 3SQMA 1J49A 1GPKA 2E4VA 1WCV1 4IXNA 3A1NA 1LDNA 1ULZA 1XE3A 2CHEA 4U2KA 3UY4A 4GL4A 1HKUA 1NU6A 4RQTA 5KYUA 2CW5A 2KX7A 2O57A 2Z04A 3I28A 4BVGA 1O2DA 2PX8A 4ZOEA 3D9QX 4HDNB 3CWZA 1K8XB 1C81A 1MAHA 5ENDA 2LPMA 3MWDB 5AI0A 4V1CI 3T52A 4R0MA 1N78A 2MMGA 1CJKC 2HAEA 3H1BA 2ZIEA 3HJAA 4HC4A 1IHMA 1CEXA 1XQVA 1AUQA 2OORC 4M53A 1PFUA 4MX8A 2EFJA 4BJHB 4FOLA 1B3RA 2DFDA 5DM1A 1YB7A 4XMYA 1C9YA 1PRYA 2H0RA 5EKSA 1N1EA 3T5BA 5L9AA 3HJCA 4Q48A 1M1XB 3A31A 5DTQA 5E3JA 1PZGA 2FSPA 3G9QA 3IIEA 5TMEA 3I42A 1RZVA 2GO1A 4XVCA 5J5VA 1ZCBA 2AOTA 4G36A 4A91A 8ABPA 4HNRA 5LIPA 4TTTS 4BO8A 4WIAA 1WXHA 3G8CA 2R79A 2V7WA 2R0QC 4RW0A 4HGZA 4EHDA 4O4HF 4NCBA 1L5ZA 2QR2A 1YCGA 3CPXA 1UKBA 2BFEB 1CJMA 1D3AA 2PT6A 2X15A 4ARBA 3PUXA 2CN1A 2QG9A 2WZQA 3IPLA 3V8PA 5K3AA 3HRHA 3B3JA 1CIJA 3QF7A 3CH4B 5IDYA 4R3NA 3S2UA 4LOHA 5A7HA 4HQ6A 1KIFA 5TX7A 3UFXA 5SZHB 1FDIA 4RE5A 4D9IA 1ISPA 1TQDA 2VP2A 1KO1A 5LZ9A 4DLSA 4NOKA 1WO8A 4JBXA 1JIIA 3D3WB 5DMXA 1N5KA 3L8YA 3SNHA 4ZFNA 4H59A 2QVBA 3AV3A 1RWBA 2PM8A 1KQSB 2ZRHA 1YD7A 2NGRA 4MRPA 4XX0A 1UZUA 3GW8A 5DT9A 3OD1A 4GRIA 2VWQA 3UJ3X 1UM9A 2DTEA 2IY7A 2QSYA 4MV9A 4RPIA 5F4BA 3GG9A 2Q41A 4IKPA 2NTVA 5HSGA 2XF8A 4WA8A 2AFRA 1L4KA 4EB3A 3AW9A 3G2PA 1Q92A 3KZ1E 2W6IA 1A2OA 2XDWA 4OLAA 1WS6A 1BN7A 4KUHA 1T6ZA 3ZTTA 1JHMA 3MA0A 1YS2X 1CVIA 3ZGYA 3BTVA 4M36A 2JFYA 1YFKA 5ITVA 1CZNA 3NXSA 4RHXA 5I9MA 3BH0A 3ESRA 1J2JA 5HZGA 3DP7A 3BWXA 4GKBA 2JGNA 2KSQA 4WK0B 4MR7A 5HFNA 4AJ1A 3CN7A 1CQIB 3G9ZA 3M3PA 3RYCA 4CFSA 5H83A 3OOSA 4WOJA 4DHWA 1G8YA 1PK7A 2R6CA 1OR8A 2GQ0A 3GVKA 3DF7A 5KHAA 3R5XA 5EG5A 4UTOA 3P27A 2BP7A 3BORA 3F6RA 3K8YA 1E2UA 1DWOA 2VQ6A 3LQFA 3U48A 2ZPUA 3ZGZA 1NY5A 3KD3A 4JEHA 2IPAB 4XGQA 4B9EA 1NOJA 5BVGB 1G8SA 4HQFA 1EX9A 1SVMA 5T3YA 1D8TA 1J8DA 1XVLA 3EHEA 2BC9A 4QO8A 2FSVA 4O2BB 2CJXA 2W2TA 2VZLA 2IZOA 4V2IA 4A6EA 5K2OA 5EIAA 2W2LD 5HDBB 5J4KA 2B9VA 2BEJA 4XVHA 5E38A 3OZDA 3KVVA 4RJTA 1U28A 3TIIA 2YMLA 1XE1A 5ALXA 2VDWB 4MW1A 3PA8A 2EARA 3K53A 2HRZA 4L4YA 4A03A 4K6CA 1QS0B 2QE6A 3ODPA 3EEIA 5KDLA 4U7FA 5C34B 2Q1XA 1FLDA 1A88A 9LDTA 1V8FA 2AKYA 2IGBA 1PDVA 1JMKC 3TUZC 2YOHA 3JCZA 1G5QA 2PD6A 3VZPA 2O2YA 3WC4A 3QH4A 4UUBA 3W5IA 3MG9A 3EARA 5KS2A 3CZ9A 4ML3A 3CC4B 5JD6A 5K2MA 1UOOA 1OIVA 2IE0A 2IYVA 3AI7A 1T4CB 4A10A 3WIUA 1J9GA 2G4LA 2NO9A 4NV1A 3EPPA 1YUNA 1SUBA 3GA0A 1ZIDA 2M6KA 2IU3A 1E2DA 1QOQB 5HS4A 2PUJA 3GBVA 3ZZ1A 3RADC 3DKRA 1Z35A 1NF2A 2XJ4A 3AERB 3OJFA 3OQIB 3KXKA 4IEIA 1H93A 3F7NA 2QUHA 3KE8A 2EJTA 1QHIA 4NR0A 2R6JA 1Y7IA 1BA2A 3LSTA 3A8KA 3H16A 1WKCA 4U2GA 5HP4A 4TZ6A 4K40A 1ZCZA 2SECE 1J5EB 3CZAA 1I3LA 3HP7A 3MRTA 3SI7A 3F8WA 2QG4A 2W2KB 1QGUA 4KN6A 2VBFA 4K81B 3B6ZA 4OQZA 2VDLB 3R7NA 2JFHA 4RIEA 3EPJA 5J2TA 2VDOB 2XVYA 3JAMA 5H16A 3UOAB 3ER6A 3S99A 1X7GA 1F7UA 5K8UA 2KS6A 4C78A 4TV9F 3UWPA 1LD3A 1YJCA 1XD8A 2P75A 2ZRBA 2W83A 3PFKA 4Z2YA 3RV4A 2AVDA 1KJ9A 2HQ1A 4P54A 1R12A 2R66A 5E0KB 2NLOA 4LW8A 5HFAA 3W7BA 1NURA 1UKEA 3ON5A 4UMEA 2UVQA 2W8BA 2EQ5A 4P9SA 4FHCA 3EH2A 1FRZA 4LXXA 1FMLA 4P86A 5B6JA 2PZBA 2JCBA 3PVSA 4DILA 1HA3A 1A04A 2J9FA 1J24A 2GF0A 4XB1A 3ILHA 1AHPA 3DBLA 2HYIC 3BK1A 3F71A 1CWUA 2Z1DA 5A71A 3T5MA 2C03A 4YPFA 2JA1A 3TVDA 1CEQA 3DULA 1CIVA 5D3MA 5DNWA 2C3PA 5KVVA 1ZI8A 1NFQA 1CUHA 4M76B 1M34A 5IPFA 5IEBA 3GLIE 3ZDDA 3GVCA 4B84A 3VHXB 1T29A 1IZ7A 2XYVA 3O82A 1TIBA 4B31A 3AUJB 4D4GA 2HSWA 2YWHA 1YQUA 2P7IA 2VJKA 3FR8A 3H11B 3LUKA 3QK7A 5TSDA 4CV3A 1NFRA 3QZUA 4NK5A 1HXHA 3FCOA 3KZKA 3LK7A 5ITWA 5T4EA 3WL6A 2FX3A 1ZIYA 1YI8A 1XFOA 1D5WA 1KMMA 4WUTA 3UW3A 3OG9A 2VP5A 3M83A 5BSGA 3IJPA 4DSZA 4FFPA 1O54A 3DWIA 3OA0A 4WKOA 3TXAA 3E2MA 5FPYA 3T9BA 4W5RA 3GARA 1D4OA 2Z09A 4P34A 2HMAA 5CBPA 2O7SA 3HZRA 4IIYA 5K03A 1Z7WA 4H6PA 4DV6B 4GX0A 1XAGA 5B3LA 1UJNA 3ABOB 3AF0A 4BO1A 2G7ZA 3LT4A 1NMQA 2AOVA 2DQZA 3HN7A 5B3AA 4ERXA 4BTVA 4NFLA 2IJGX 5IC4A 1DC6A 4XEUA 1PQUA 3QV1A 3I9MA 5IN5A 5I01A 3HXOA 4MW6A 4XW2A 4LWOA 4PYNA 3Q6NA 1M2KA 4EJ2A 1I8DA 4OK6A 4K2AA 4CCWA 3VPSA 4J9VA 5TJ9A 3CHYA 4HPXB 4BU1A 1GNRA 2PMCA 3ANNA 5BMOA 5H3LA 1U9YA 1MR3F 4O4LA 4GXQA 3Q8LA 1UBMS 3SIWA 5DNDA 4ZMSA 4ROSA 1YV9A 2NP7A 2J5RA 3JSXA 3C5CA 5LZ7A 1XSEA 3D3JA 3EQ2A 2I4RA 1GQOA 1E3TA 4URYR 1V5EA 1IK6A 5DOVA 3DTYA 1NUSA 2YHUA 1MPTA 1OOEA 4LNUB 1SRQA 3MM4A 4TTQA 2DR2A 3OT4A 3A6HA 1XJWA 2GZSA 4CT5A 4F5DA 4G0MA 1W0CA 3C14C 3EXIA 1YFZA 5C32A 1XJCA 5A1TA 2JIQA 1H9CA 1KYIA 4MCAA 4HHEA 4L5IA 4FFRA 3LPCA 7ADHA 1JIVA 2ZJ5A 1WXEA 3NHYA 4X63A 3V48A 4MGIR 4HNQA 2VI5A 3ZY6A 1E9EA 4OHPA 3AUFA 4PQRA 5JVDB 2PKCA 4UZSA 3WB1A 1DIOB 1NSTA 4DB2A 2NV6A 3HB4X 5IVIA 1UWCA 2ZVDA 2ZXUA 4YJKA 3NFRA 3BXPA 3U3KA 2JD0A 3E9RA 5B55A 5K0JA 3F6YA 2GHIA 4CLRA 1UXJA 1O0CA 5KYUB 1T1JA 3H5TA 3DQQA 1IG3A 2FHPA 3A8TA 2CCJA 4HNSA 3LNNA 2AUNA 3LHDA 4IP0A 5ILOA 4MPRA 2E55A 4EJFA 4UUPA 1IYZA 1GTG1 1YJ5A 4FEEA 1F8XA 2GUGA 4CTMA 4LJ7A 4F2HA 3TF5A 4YBRA 2C2KA 4RD1A 3TSZA 3W8FA 4BQPA 4TTPA 2HV9A 5FPHA 4DGQA 1M90D 3GNSA 1IB6A 2F1MA 4CCYB 4MQ4A 1NMYA 1RKXA 3KQVA 2HQBA 4BWGA 1TECE 2J3MA 2Y4OA 2ZT6A 3QKWA 3S1AB 4KB5A 4EB8A 4BVJA 1EP2B 3ORSA 3PFGA 4FCVA 3WK4A 1SEPA 3E0QA 1GTSA 1WETA 1DRUA 1NW7A 1D4FA 2AOTB 2W2QA 4HB3A 3EJ6A 1B73A 1ISSA 1SQSA 4NNPA 3ZN2A 3T12A 3WZ2A 1QBGA 3U4AA 3WB0A 3U40A 1ZLYA 3PGXA 5E7MA 5EIWA 4H2DA 1H4VB 1OBCA 3MRVA 4JYMA 3C7DB 3EPRA 1E62A 4RZ2A 3E81A 4RY2A 4F06A 1QK4A 5H81A 2ZUUA 3CONA 3NH9A 4LYJA 4LZLA 4OCZA 1OZGA 5L8VA 1NVGA 4HLQB 4O8ZA 1GR1A 1K8RA 4GBED 4IHKA 1NW6A 2G04A 2ZXEA 1QE3A 2FLVA 4IFIA 5I48A 3DEYX 3VI4B 1A4RA 2UUOA 3KQPA 4YHBA 1CUJA 1VHQA 3WGJA 2Z83A 3PC3A 4FZJA 4DE5A 1YQXA 1IIBA 5EJGA 2EKQA 5KHLB 1T9GR 1JAHA 3U7RA 4GDMA 4XN3A 4RLZA 5U4QA 3HNOA 3NX4A 3PVDA 2VLIA 3K4PA 2EYUA 1NYLA 4PG6A 1O3YA 3WQQA 3RFUA 4H18A 4R7TA 4OGLA 3USZA 4KU4A 2W2OA 1MU0A 1NNUA 4XWKA 2P6PA 1D2CA 1LQ2A 1QHHB 3A9RA 1L8LA 4A23A 2QSUA 4BKRA 2P2GA 1FNCA 3OFNA 1C3JA 2E2WA 5AK0A 1U90A 1C7JA 4R68A 1T34A 3KR1A 1Q2XA 2Q07A 2XDQB 4YJFA 3VR5H 1F8UA 3FLAA 1Y4ZA 1UEXC 2JH9A 5DCWA 4C2BA 3OZIA 4E2FA 3OQ1A 4BCBA 1N9GA 3N76A 2I62A 4ZI7F 2EX0A 2MSCB 3DDZX 5ALDA 4I46A 4XWGA 1L7OA 5JLJA 5CCXA 3QE9Y 3DE5X 1N6HA 4ZTZB 1WB9A 2CNNA 4QUBA 1DU4A 3BCHA 2GPYA 3ZTYA 1NW8A 3NVDA 4LY3A 1DBVO 4QX6A 3DOIA 2Z2ZA 5IFLA 2XYRA 1JFTA 2OZKA 3B82A 3EVBA 4MUJA 4CG0A 3S70A 5AM5A 1E2QA 1HLGA 3TAHA 3EW7A 3INNA 2C1XA 2KVOA 1LS1A 3H3JA 1WB5A 4QBTA 1PQWA 1B7GO 3HN2A 1UKCA 2X9NA 2LIPA 5CT5A 5CXXA 4EYSA 1CF4A 1H0HA 1O5IA 4QLAA 4DDHA 5J3OA 1K6EA 2M1XA 3LCRA 1Z2AA 4WW0A 1KAMA 3ROQA 1N6LA 1XZAA 1UD8A 2C5SA 5A2GA 1JQAA 4LDRA 1KSGA 4QYXA 5ICGA 2YYZA 4NNOA 2J9XB 5E0OA 3ELBA 4ZGNB 5EE1A 4TWRA 2AYXA 4L1KA 5H5JA 1FTNA 2C2OA 2YBEA 2B8WA 2PGIA 5JSKA 3WNCA 3AK4A 3N8DA 3ESZA 5KYWB 3I39X 5C8YF 4Z8YA 3LQ4A 3IDAA 1WD5A 1CY4A 3H8SA 3M34A 2YFHA 2VK8A 4HWGA 1Y1KE 3ZR4B 1A95A 5BW5A 2QORA 4R5MA 1HDRA 2KBFA 3CF4G 2AFHE 4LDZA 3RWMB 3WGHA 2CEKA 2NZVG 2SKDA 1LI4A 3KHUA 2GREA 2G9ZA 4EHLA 2O1XA 3NHJA 5EJ8A 3LUPA 4H7JA 4B45A 4E5NA 1L2TA 3REGA 4MKIA 3PC2A 4M2LA 1DJQA 1EESA 1PBNA 4Z4WA 2BKXA 1NB0A 1ND5A 1XZGA 3W5HA 1FS5A 3MTEA 1T6BY 2X4IA 1RJWA 1U0HC 4QHSA 3VHQA 4PC3A 1Q1QA 3IOBA 2PJRA 5BO5A 5B7GA 3LC0A 3THXA 1JHXA 4GYJA 2ODEA 4Q16A 4F96A 1XCPA 1I3OA 1RIIA 2VF7A 1KEUA 2I2CA 4MICA 1NAHA 2YXEA 1Z4LA 3QLVA 3TQOA 2FPSA 1P1KA 1DAHA 1GARA 4RESA 1NLZA 3EEQA 4PG8A 4C5CA 5NULA 1NI4A 2NU6A 5BSWA 2WIJA 1OXXK 1JEYA 2E4WA 2WUFA 10MHA 4U8GA 3DE2X 1CW2B 4B85A 2FX5A 4G09A 2X8JA 4X85A 1I3KA 1RHMA 5JJIA 4MVYA 4RTOA 1WU7A 2QL5A 3HDTA 3L8HA 3O8CA 2LGJA 1CFZA 4MCJA 5C4GB 4KFCA 1XALA 2I29A 4FKMA 1CD5A 5JNRA 3O26A 1CDZA 2OV4A 1DAFA 1A4IA 2G72A 4MV7A 5J2TB 3EXFA 2WJYA 1ID1A 3GLRA 4NJMA 5DX8A 3NP7A 3VR4H 3FOBA 2P9EA 4Q39A 3A37A 4NMXB 2DR3A 5IZCC 1G3IA 5HIAA 2JFUA 3FG9A 2ATVA 2C5BA 3QVMA 2W9XA 5IMSA 4WXEA 1M8GA 1VPVA 4G8CA 4M22A 1UXOA 2H2HA 3EVDA 3I9NA 5DXJA 2O3SA 3OLXA 3CCVB 2QMUA 2P77A 2G17A 4MMXB 2D5CA 4RLFA 1CZLA 2BEVA 4KKVA 3RYIB 5JRZA 4B8WA 1RXCA 2O8EA 5J1TB 2G4VA 4C43A 3DLPX 3ZNOA 1NR1A 3BJMA 1KZLA 4B4OA 5JSZB 1LPNA 2XI4A 2WJJA 1UIRA 1PUIA 2HLDD 5D3MB 2PL5A 3C4QA 4LYHA 3BTUA 3OOYA 1ZOIA 1M34B 2R8YA 5DYYA 4FB5A 2FPWA 3SSAA 3HMQA 1SMKA 2JKVA 1AT1A 3MWEA 4BOYA 3DDHA 3ML1A 2JHFA 1F48A 1X7ZA 2BSXA 2Q49A 4G23A 4GLLA 2EG9A 2DHQA 3IEMA 1MTZA 4M1KA 4F56A 4D3FA 4M38A 2A5JA 2WRZA 2FWIA 3ZY4A 3ASRA 1L5OA 5G0VA 4JEMA 3AXSA 1KO5A 3PFIA 4ZI5A 3KPYA 4BKPA 1K7XB 1PQYA 3FHOA 4PHHA 3AKEA 3EVAA 3BRWD 4R9RA 4KXFB 2HSGA 2H5EA 1QE0A 2XVZA 4G85A 5D5HA 3SVLA 2IKQA 1YULA 3ZE9A 2ERYA 5L7YA 5HZKA 3QFCA 1XLTA 4MRRA 5BNZA 2XNCA 4B6JA 1A8PA 4BX3A 3X2FA 1Z5UA 1N5OX 5EIBC 3OKAA 1JG1A 3UHFA 4QFBA 4Q1CA 1VQ4B 1JHYA 4G4IA 1F17A 2HK6A 3QW2A 1L4EA 1VP9A 2BHSA 4RVGA 3K70C 3K32A 5K0SA 1G1AA 5JXWA 1GJRA 4A73A 4BE7B 1JI3A 5LOVA 1OZ0A 1TF7A 4JMLA 3WADA 1G20B 4IQFA 1MORA 1I7QB 2OENG 3MMNA 3QUCA 1RADA 3KVOA 1R0CA 4U5QA 5CM2Z 3KKZA 5GOZA 2WYVA 2QT9A 5IDWA 3WGIA 3DS8A 2G09A 2OXIA 3QYFA 1BKYA 1TJNA 4WZLA 1OBHA 1YDGA 2ZYTX 4JJ4A 3JQ8A 5E9JA 1NKVA 2HMVA 1TT5B 2Q6KA 2ODQA 3FVRA 2Z57A 4BZZA 8GPBA 3OZTA 1CR6A 1P77A 3GXBA 4IJMA 4QWMA 4ER3A 4EUFA 4MGYR 3VTFA 3NEJA 4PPYA 4CF5A 4CUZA 1QIHA 2Y0CA 1YX2A 4AUNA 4D96A 4DXHA 2PDAA 1E8NA 3G17A 3G79A 4GQBA 3V1TC 4UEWA 5JJLA 4L2IA 1S8NA 4BVBA 2X6XA 2KPOA 2GK3A 4DLTA 1Q19A 2C9MA 1ONSA 3LPMA 4G7XA 4IHJF 3HUEA 4D82A 4ODIA 1TK2A 1XUOA 4B3CA 3EXIB 2LDXA 3NHFA 3KJQA 3CMMA 1K8YB 1OWLA 3BJIC 5ILGA 3TNLA 3V4LA 3ZWDA 1HTBA 3K9HA 2A58A 3LPDA 1GDTA 2WKSA 4R8SA 1C3XA 3D0RA 4WLVA 3KQKA 1O9HA 1ZP6A 3E53A 3FPBA 3IMEA 3R24A 4XUDA 3PL5A 3UEOA 1YO6A 1AUVA 2D0OB 2Y27A 3FFTA 3CW9A 3QE2A 3JWEA 2QVZX 3LXRA 1YCFA 4J2HA 5LB2A 3WRXC 5TLSA 5IM4A 4GWGA 2J09A 1AV6A 3TQCA 5ESWA 2PUCA 4G25A 4MI9A 2E1BA 3H2GA 5KNDA 4GDFA 3LUFA 3HBMA 3DEIA 3Q3GE 3VYTB 4ZGBA 5A0VA 4ND7A 3FPSA 2VNKA 3NHUA 4HH0A 5HUJA 1KNQA 4K9NA 1M1KD 4US1R 5JBIA 1NX6A 2ANBA 2QNBA 3SCZA 5A6SB 1E98A 1E9BA 1AGNA 4IILA 4C4SA 4E5SA 2G80A 3ZWNA 4HZIA 3MCTA 4BQIA 2H59A 3Q3VA 6NULA 4FUQA 4QG7A 4BFLA 4TXJA 3MQFA 2JBHA 3UZUA 4LF7B 1P61B 1SCKA 3GP3A 1KBZA 3GJTA 1Z5PA 2FEKA 4MVJA 3EQ7A 3AUYA 3AUSA 4BBPA 4X05A 1QYDA 2WZDA 2YIJA 1YR8A 1OXMA 1VHLA 3T7RA 4DSOA 3B9QA 5L7WA 1V71A 4EF6A 3C6BA 4KR0A 4NY1A 2JHAA 3AI2A 5M3BA 3TTYA 1HL3A 1PNVA 3BA1A 1XU7A 3DZJA 3EUFA 3FUWA 3ZS8A 4XKWA 3HCOA 3K05A 3K6JA 1ZD3A 1T0IA 1Z06A 4AFNA 2JIPA 3PDUA 1UPFA 5TEWA 4B83A 2AQHA 1SG0A 3T5AA 1DE0A 4UTVA 1VSUA 4E22A 4JK3A 2II6A 1GAEO 4NRDA 4EZIA 3M1YA 2HBZA 4OB7A 1YXMA 3UOWA 4R2KA 4DPLA 1C3EA 1G4AE 2CVOA 3RM3A 2O2EA 4RH3A 4EPYA 4CETA 3RTAA 1VG0B 4XX1A 4CUKA 5C1BA 1P7CA 5COBA 1FUUA 1JYFA 4I6JA 2QXUA 2Q4DA 4Q3NA 5BQ5A 3JQBA 2FFAA 1WVGA 2OQ2A 3CLRD 2IYUA 2GRJA 5K6AA 2PUFA 1XAIA 2UVDA 2ZVPX 2FG7C 1VHOA 1XTIA 3V00A 1YZYA 3B9BA 3QKRB 5FWNA 1EEHA 4RTMA 3DVSX 3MWLA 1JPUA 1G8KA 5CLGA 3RROA 3LGAA 5MF6A 3P7MA 3GRRA 1T8SA 2QRZA 5TPWA 2J32A 2ZW9A 1Z0DA 2GARA 3OLQA 2ZUWA 3IP3A 5AVQA 2WLTA 2C07A 1ECJA 1SBYA 3MJVA 2JL1A 1N2JA 3C5VA 1L7PA 3KEOA 2ZBRA 3IUSA 4H4DA 5HK9A 3ETCA 5CX1A 2LWIA 4FHEA 1DFHA 3UN1A 2QN9A 1G21B 3OEEA 1QIDA 3C8DA 1AUPA 1FSPA 4YJFB 4YI3A 4FDUA 2NYVA 4YA6A 2WFZA 4CODB 4BKQA 3LYLA 1SCBA 3MIZA 3EB9A 4ACAA 3IQHX 3GVLA 4XD7D 1U3TA 1JB9A 1F4PA 1TKBA 3LX4A 4QTZA 3RS5A 1U3DA 1DZ3A 3AX6A 3ANLA 1E7WA 2CLHB 2WQ6A 5B2ZA 1DPGA 4QGAA 4MYDA 3H9QA 3GFTA 3WLPA 1XZFA 4NENA 1D07A 4X44A 3WBFA 4KI0A 4BO2A 1LTKA 2FSSA 3QUQA 2W70A 4ER0A 3HJFA 2C31A 2CD7A 3F1LA 5ALNA 4Q82A 3A6ZA 3T1NA 3K72B 4DADA 1SVUA 3A0RB 4KV9A 1Z6AA 1TRKA 5ITZA 2BGGA 1YE3A 2ECFA 1VKJA 2RHOA 4FFOA 1J1ZA 1Q1BA 4FMCB 1W0KD 5DBHX 4BQNA 1G4HA 3JASA 2HZ7A 4TUYF 4ATNA 4HS4A 1LZKA 4KPYA 1DQSA 4FKBA 1XTRA 3L7KA 3W3AD 3MXTA 4XM1A 2UYCA 4KWCA 3SR4A 5C37A 4LF5B 3ORYA 1KHHA 1T1EA 4IXMA 4EUSA 4GL2A 1FX1A 4YCDA 5BV8A 4GSLA 4ZQCB 3TOCA 1BD4A 2AHOA 3IIKA 1PVDA 3KLNA 3IQFA 1ADJA 3VJMA 4GNKA 1LSJA 2QM3A 2ISQA 1T25A 4NYIQ 3KL4A 1XNQB 4NX2A 3GLFE 1T24A 1RSZA 5B4UA 5JAPA 5FI0B 2DPXA 3OPQA 2CXHA 4Q9AA 4MI6A 4RACA 4B0OA 421PA 4EF4A 2WZBA 4POOA 4M1MA 4CW7A 1C50A 2ID7A 2G8NA 4KWIA 4YPOA 1B6TA 1YNSA 2O1WA 4U39A 3D6TB 2AWNA 2ZB3A 4IRUB 4ZKEA 5HPYB 3T3EA 1V9LA 5HUHA 1YJBA 3PLNA 4YRZA 3KV1A 3CE9A 3ITEA 2CFRA 2GB4A 3WL3A 1E3SA 3BKWA 4K9SA 5K4HA 4TKZA 4EHNA 4WN9B 3VPCA 2BFDA 2UZAA 3RC7A 2EJUA 1NBME 2IXTA 5HA5A 3EVFA 5L45A 5KQSA 3RI3A 4JWKA 2UXBB 3LQQA 4JR0A 3WI7A 1DTWB 5D01A 7MHTA 1I2CA 5A4MS 2FUG6 2XZDA 1JFFA 5GWXA 2AW3A 4B9AA 3IDOA 5I3ZA 2IS2A 1HL7A 3U62A 1NVFA 3U7QA 4RV9A 2LZJA 4KPUA 4TTJA 4DZRA 3FPCA 1IZ0A 5KHOC 2GDZA 3UK6A 3ZBPA 1G38A 3U9TA 2KJQA 3LC7O 3OBBA 2F8MA 2JN9A 2GVNA 4ZD6A 2QRKA 1TKAA 1Y1TA 3EXFB 5LZ8A 2JCYA 3OUZA 3PQEA 1KF0A 1DC7A 5FPSA 2P9CA 5AVVA 2C9DA 3L7IA 3ZGLA 1T1GA 3RU9A 2FQYA 5LB4A 1TUGA 3TD2A 5JW6A 1GTRA 2FPPB 3JW8A 4BC1A 2WWHA 1WG8A 3AM4A 3HP4A 2AJCA 4M0UA 4DCOA 2YVLA 4DA4A 1VPWA 2OK7A 3EULA 1D2MA 3LX8A 2XMSA 3IDSA 1VE6A 2RKOA 2NZWA 4KIFA 3S5UA 2FWBA 2Y1FA 2X19A 2B2NA 1E0AA 2ES4A 1XZIA 3IQZA 5FQOA 4X20B 3CIOA 4Q3EA 1TRHA 2Q5EA 5DHQA 4IMRA 1KYTA 2IV7A 3SQLA 2A7QA 4HEA6 1P9LA 5ER9A 3ZVNA 2HOQA 4UEJA 2HW8A 2WMNB 2JIRA 3A4YA 2XT9A 2J85A 5J5AA 1X1CA 3S2ZA 3X3HA 3G6KA 5A5FA 4DR4B 4RCZA 1BYUA 3ND9A 3PP8A 2ZB4A 4YJHA 1VHTA 4HUQA 1H5QA 1HH4A 2BCEA 1XQWA 4WBSA 5DK4A 3U7HB 4B3MB 5DVZA 1QX3A 4BBAA 2J5XA 3IURA 2HCJB 1R8XA 1S4QA 1V26A 2C2ZA 1X1TA 3FVVA 3MWYW 3V6LA 1G291 2IHJA 1PFYA 4NOLA 1Y9JA 3RFCA 4EVQA 5J4HA 2W2XA 1JB1A 5M2QA 3LGXA 3OBIA 3LZDA 5GJVC 4ZI7A 1JAIA 3DEHA 5ED0A 3FTFA 5AVUA 3PGLA 3THRA 1W48A 2FZKA 3OX3A 4Q03A 2A9VA 3H1FA 3BFXA 1VP3A 3Q72A 4MYCA 1U1GA 3DMTC 4NZOA 2C4TA 1RPNA 1XD2B 4OXYA 1EAYA 1JS1X 4BVHA 2ZP1A 2GXSA 3LC1O 3WX0A 2I91A 4DCMA 1W4ZA 4BLPA 4Z4SA 4WNIA 2OBMA 1N6KA 5KCMA 4LMBA 3RVJA 3KJXA 3DAYA 1UEIA 5IJ9B 2J46A 1Z56C 2EW8A 3IJ5A 2BSQA 5F2NA 2D06A 4D25A 4G2TA 3DB2A 4Y2PA 2FNAA 2X7XA 1KK3A 1CUCA 1KAHA 3GEBA 5E8RA 3ZJVA 2Q6TA 4QHYA 3ZOZA 1TGVA 4LXGA 1A9RA 3HUFA 3ZD9A 5F9MA 1LSOA 4HEJA 4I50B 3MBOA 2WKQA 4MYRA 3VVCA 3SEJA 1V8BA 5EHIA 3TNYA 4AG5A 2R86A 1RKVA 2EFEB 2H1WA 4NFHA 3VPAA 4EGJA 3QI7A 1GL7A 5C8YA 1F06A 1QV9A 2P0EA 1CUBA 3TOZA 3JTMA 4KLZA 4R54A 3E5MA 3ILVA 5I7VA 1U0BB 1TZJA 3PQ2A 4PZPA 3JPYA 3VC1A 4EELA 3I3OA 4DLZA 3PUJA 3PUYA 4XOPA 3WNZA 2JRCA 3FBWA 4D0NA 5DB4A 3OHMA 3BGIA 1TMKA 3W1VA 4MDEA 4PHFA 1Z08A 1JALA 3Q5EA 2VG8A 3GLKA 1HFJA 1XAJA 4QDOA 1PI3A 1DJMA 2IUTA 1ZI6A 1CY7A 4JI2B 4N12A 4GKJB 1U2SA 2ONKA 4UHDA 3CTMA 4L8VA 4WDRA 1NYTA 1IVSA 5CA1F 4QPPA 3C1AA 4B3IA 3THWA 3DOUA 4N0QA 2B0CA 2O3QA 5F1KA 2H48A 3VPXA 2R11A 3CEPB 1L5SA 5TS3A 4Z51A 1QHEA 2B3TA 3N2GB 1OA1A 3CXUA 4IWXA 4Y2SA 4A8JB 3EY9A 1TKRA 2LNDA 2YN0A 1PEDA 5JDIA 4RKWA 3RIXA 4P4NA 2A92A 4LJ8A 3MTJA 5FI5A 5ARBA 1MAVA 4Q7KA 4JJ6A 2AOWA 5DCYA 5HIIA 1CS0A 4E88A 2I1VB 4RCYA 1Y98A 1J2UA 4KZKA 3UF0A 3PHBE 5K6TA 1Y3IA 2QUKA 3I6QA 4QUDA 5IAGA 4D5EA 1NNSA 3AGPA 1I4OA 3CUEF 5CB8A 2PFKA 1I7NA 1Z6QA 2DFVA 2PVSA 3QFTA 4C3ZA 4CZ2A 4KI7A 4D9HA 4BB5A 2ADFA 3I9V6 1QQ7A 3JWPA 2YY6A 1MB0A 1OZHA 2D0PB 1PJ4A 1T36B 1R0LA 1LA2A 2RSLA 1E3LA 1P0CA 2OQRA 1Z3IX 5TMBA 1A5AB 1Y80A 3G2OA 2YY5A 3C48A 3OJEA 4URUR 4RFLA 3LHSA 3SXUA 1S5PA 4DQVA 1RR6A 3E2IA 4JFRA 4F5ZA 3HAGA 2NP6A 3PLAE 2JLXA 4KOAA 3AP2A 1E94E 2Y6UA 2BJWA 1N08A 1RAFA 5CXSA 5AM4A 5FB3A 2X0FA 4KXYA 3LIPA 4E70A 2OYRA 1RLOA 1UBGA 4BNDA 1J70A 4R5HA 4YAGA 1B8UA 1Z68A 2R00C 3DZ8A 1ESMA 2P9TA 4R41A 3W8RA 5EOVA 1AM4D 3IAS1 2M6SA 4QVKA 3FPKA 4OHWA 4AP5A 4CMCA 4ZHSA 1R74A 4D1YA 1N2HA 4L74A 1SC9A 2X6TA 3EBPA 2V7EA 1N2CE 1ZJJA 3RQSA 1U7ZA 4YQYA 1Y0RA 4CIAA 3PUVA 1DKPA 1RVDA 2Z8ZA 3IMKA 1AA9A 1YAHA 3CF2A 2ICAA 4OB8A 5CFZA 3GAZA 5J47A 1YHYA 3LPNA 1KOJA 3T1OA 2ZUVA 3SM3A 1GHTA 1MRSA 1RWPA 3BRCA 3NUQA 2IYNA 2OILA 1S2IA 1X7XA 3PFHA 2VO1A 4JLJA 4WGGA 4XM3A 2MSLA 4BCCA 4ZIRB 3KOOA 2OBLA 1GG2A 4L57A 1KR5A 3L0PA 2O59A 4A9AA 3STVA 1KJJA 3TX2A 3FGOA 5CX1B 4EG8A 4HWOA 3GVHA 4KBYA 3QX3A 3O3NB 1E66A 2IQ5A 3II6X 4ER7A 3L0YA 3BTSA 4YR9A 3AZQA 2ZYHA 3EF0A 4YS6A 1NW4A 4CU2A 3T4PA 4LZPA 3OWHA 1QRUA 2H4XA 3TTWA 2O8FA 2BM8A 2VUHB 3HYRA 4OHOA 3BH7A 3R5FA 4F3TA 2WMOB 3EWIA 2FZCA 5HKAA 1HBJA 1Y9EA 1JEAA 1ZGZA 1DMSA 1WA5A 2B83A 3U3MA 2FV8A 4HE6A 1ONBA 4J0FA 1YQQA 2VYVD 3U1VA 2IUEA 4OJQA 5CYPA 4DLBA 4OA5A 4D99A 3KALA 2HWWA 3AR4A 1V5VA 4XNFA 1GADO 3DEFA 1YDEA 3O91A 3RAPR 3RSFA 2IXAA 1MEJA 5KTSA 5EE5B 1W88A 2OGWA 4F0JA 2C7GA 3ET5A 1U8UA 4X64B 1JG3A 2WSIA 4MIYA 5CAEA 3G7UA 3A14A 4TSFA 1TTHA 4M37A 1YI1A 2GA9A 3Q39A 4J8PA 4KQEA 1T1SA 4IHJA 2L69A 1JR6A 4KLNA 4FZ5A 2YHIA 5GV8A 3AM1A 3PXEA 3C7CB 2WW8A 3LUBA 4JBWA 4WKCA 2A9RA 1M1YA 1XPUA 1T0HB 2OO5A 1H6CA 1YOVA 4K3VA 4N5MA 2RCYA 3DE4X 5FOTA 821PA 4MV5A 4UVDA 2H7VA 2AXPA 4HDRB 4BDTA 5GV7A 1WMSA 3CBQA 3TN7A 2FXIA 3AQ4A 3FB1A 1W4LA 2QRGA 3QWIA 4JD5A 2W6OA 4M9ZA 4DYHA 2AOUA 2RHDA 2V6MA 1AS2A 1TIPA 2BGKA 3AM3A 2H2IA 3IQGX 4PO1A 1KK1A 3GWGA 4GGPA 1TC1A 2X7HA 2AXEA 3G23A 2QWXA 4JB3A 4LJLA 1N07A 4Z0NA 5HOEA 3KEQA 4JB8A 1AV7A 2JC3A 1AE1A 1QONA 4L3VA 3UMCA 3NEPX 3RGWS 5CDHA 4FGLA 2AQIA 3ISVA 2EGHA 2BE7A 2P2ZA 4FXOA 3ISTA 2MMCA 5AXDA 2XVAA 5EWJA 3W6OA 4C4AA 2XKKA 1A50B 1EEXB 4BMSA 4PZCA 1JU4A 1S4MA 5JS8A 3WY9A 1QG4A 3WKDA 4Z4HA 3EHDA 1K0FA 1Z13A 2KWIA 4WZZA 2HO5A 4HFJA 2XWSA 1GSAA 3GDFA 4M99A 2BTOA 1JJAA 1T2FA 2VHEA 3UJ6A 4AJ4A 3LY9A 2I4LA 4BX8A 3G8BA 1PZXA 4LGVA 1JI0A 4RENA 1BXKA 3TRKA 3CSUA 1Y5IA 1QTRA 5I9IA 3FLMA 1L4NA 2UZ3A 3U3DA 5B6IA 4JVLA 4BO6A 1L5VA 1Z12A 1NHWA 3P5BA 4FFWA 4QUEA 3M1AA 3TQHA 2CNWA 4KO8A 5G1NA 4BFVA 1SUPA 3PYLA 3H18A 1T4GA 5I8PA 5JS1A 1GSIA 2IHUA 5DNAA 4D0GA 4WZEA 1NJ2A 1U1EA 3A05A 1G5PA 4CN9A 1ZEMA 4DLKA 2P9HA 5HJ5A 1U2TA 2I99A 3QQ5A 4FP9A 5CVEA 1WUJS 1E60A 3BK7A 2W2VA 1ZNQO 3PT5A 1XQ1A 5HZBA 1NVAA 2NU9A 3OU2A 4PRZA 5C31A 3ZUGA 1P7ZA 2JDID 2PJDA 1FCJA 2A1TS 3K8OE 4JZYA 3UMSA 4EKYA 4YJHB 1MJHA 3LQ2A 5T8KC 5TXGA 1H6AA 4C5AA 2AK2A 3H05A 4LKOA 4R1SA 5K1ZA 4KYTA 3TLAA 3KQLA 2W6ZA 3OURA 5BPFA 2QZSA 1WUHS 3WKCA 3E8MA 4NU0A 4ETNA 1SULA 4F3NA 3NASA 3FGNA 4Q3CA 1J8QA 1WHTB 3O0DA 4J1NA 5LZ5A 3VZRA 4HD8A 4IDBA 1Q17A 1S01A 2P27A 4MS1A 3FGZA 2X41A 2FPGA 2VDUE 3BQMB 4KHPB 4NBRA 1UFKA 1D7AA 4PIPA 3LP6A 5AIBA 1Y5MA 2YRWA 4HJRA 5F7XA 3H99A 3VR6A 2EWVA 4LHEA 5EUBA 4F3RA 3J81A 3OZSA 1IZYA 1NDHA 5GVSA 3GPBA 4OIMA 1L8XA 2Q9UA 3H87A 3CCQB 4Y3UA 3V3KA 3D5EA 3H9CA 3BCFA 1XCOA 1DCFA 3AUTA 3DO5A 3I0NA 4ND8B 3U31A 5D8DA 1DUIA 1VKRA 1ZOSA 5B4VA 2D4HA 5JECA 2QTWB 2RGXA 2FMTA 1CP2A 1FA9A 5IVKA 2GOYA 3P9KA 5TNXA 1O89A 5FR1A 3F6BX 4RF2A 3TUJC 4HEHA 2H1CA 5DJ5A 5BUCA 3K96A 1ZM2A 3QU9A 3EVNA 4IIBA 1SVOA 3FTEA 4J7AA 2FGKA 4KQ6A 1SVSA 4WA7A 3TNFA 2Z6QA 1PR4A 3RSGA 1BWRA 1T2EA 1OVGA 1Y8AA 3VYWA 1IUKA 4TUYA 3Q9LA 1SGWA 2QRLA 3D6JA 2ODAA 1BIFA 3Q98A 4KYIB 4BQFA 4S2EA 4RHUA 2Q4EA 2BFFA 3R3YA 5G53C 5TS2A 5GADl 2ZR7A 3JTEA 3K2EA 4BKUA 4CIBA 2EW2A 2GN2A 4WE3A 3RK1A 2Q4OA 3AIMA 3H5IA 4BY9E 2I6XA 3ZHZA 2DT5A 1KMCA 2DYKA 3TTXA 1RXUA 1NSFA 1FP1D 1L8AA 2A5GA 4ZZ2A 4AKEA 3L8ZA 4AWXA 3ETHA 4GYYA 3M89A 1VE9A 1S2OA 3PDJA 3WL8A 1P31A 1WPCA 4HVTA 4GI2A 5IJAA 4BUZA 2X86A 5F73A 3VH4A 4WZAA 1HLPA 1OF1A 1QGED 3B5IA 2WY2D 3OQ6A 2X40A 3OQVA 1LGYA 3HU1A 4HDQB 3EZ7A 3THWB 5C1DA 1GDHA 4MVJM 4HQKA 4RMHA 4YBZA 4E7OA 1KI4A 1C9MA 1NV8A 2YXLA 1UK7A 4AIIA 4EYEA 5K8IA 4ZI3A 4O6VA 1WOMA 5L3VA 2WAYA 2XIJA 2IDKA 1Z0SA 2YJ4A 4DUPA 4HQLA 4CT0A 5CD9A 1I94B 2VKTA 5A4AA 5KYNA 1UBHS 4LV8B 3BMQA 3WBBA 1L7EA 3T5CA 5IWCA 1CE8A 1MC8A 3G0HA 2O50A 2QENA 2FN4A 4UUQA 4KLAA 4PCLA 5FNZA 3AEZA 4RDXA 4B3SB 4PZEA 1Z6TA 1PR6A 1Q1GA 1ZS9A 1JP7A 2NACA 1A2QA 2JIOA 1A4XA 3NT5A 2XTZA 4NOMA 4PNZA 2REQB 4M9CA 1CC1S 2EHJA 2NO4A 2X6RA 3DE0X 3PU6A 4GEGA 4MWBA 4OQXA 5REQA 1W2BB 3UJAA 4DNRB 1GGEA 1A9PA 1UAGA 5IJWA 3KQHA 2BVNA 5JHHB 4B3TB 2YXBA 2Z5FA 2W90A 1G5FA 2F64A 3JVVA 1W75A 2B4AA 1Z6ZA 3F96A 1ZX1A 3KS9A 3LF2A 3LZ6A 1X7HA 1Z29A 4EX6A 1IHUA 4LPKA 1SURA 2AMJA 3LUDA 1FSFA 4ZVTA 4ETMA 3NG1A 1YASA 4NE9A 2ZTNA 1O57A 1OH8A 1SVLA 4PFSA 2AX4A 3GGOA 2JJ2D 5M29A 2R6FA 2D5IA 1JMVA 3TD6A 3Q9SA 3FUUA 2UXCB 3C8HA 1IVNA 3DDUA 2WYOA 1RYFA 3A9SA 3U39A 1P2SA 3COYA 2ABWA 3IT3A 4WESB 3WZLA 1O1YA 1CRPA 1QH8A 2PLNA 5BWBA 9GPBA 2JIZD 4ZO8A 1HTTA 1RQ7A 4YN3A 1E0DA 4FFBB 4HGRA 3LTEA 5JZ9A 5LOVB 1GUZA 1OLUB 4R9VA 4E4TA 3U4QA 2O9JA 2AJDA 2ZWOA 3FKSD 4HKTA 2JEZA 3QLEA 2Y9PB 3PRYA 3BDVA 3DP9A 4JAVC 1EI9A 4Y18A 5PGMA 1X8JA 4E3WA 4WPGA 1T9HA 2ASEA 2XMCA 1IEVA 2X9QA 3JQCA 2C8VA 3CXRA 1X7XB 4LTDA 4QDZA 4XOIA 3BE4A 5G02A 5C7IO 1EP3B 3BY1A 3JXEA 1DFIA 2XYHA 3D59A 1E18A 1KI3A 2C0PA 1ODLA 3TINA 5JE8A 3ANSA 1CRWG 1NJ6A 3LO5A 4L0MA 2RIPA 4RY0A 1Y1LA 1YL7A 2OQIA 3L43A 3LLCA 4H7PA 3TOVA 2ZRDA 1DVRA 3QKTA 2CL6X 3CX7A 1O7JA 1RKUA 1S2GA 3FKQA 3E1KA 1NIPA 3RWBA 3B89A 4JP8A 1CZRA 2EP8A 1SHLA 4K87A 4MQFA 2DBRA 1G6HA 5LD2C 1K97A 1UBOS 1I3MA 3DR5A 3UAWA 1XWWA 2YY7A 2G1PA 2BGRA 5JNLA 1R9NA 3DWEX 4OXIA 5ER6A 3KOMA 4U2CA 5LA6F 2F59A 3CWQA 4JI4B 3ZE8A 1G3UA 1U2DC 4KPEC 3KL2A 4C4TA 4ZV9A 3H7AA 1XRNA 3L4KA 3U4HA 1FNDA 4IIFA 4PLTA 1REQA 2H3EA 2FZVA 2I2BA 3B1KA 3B53X 3BWYA 3P32A 3SYLA 3TZHA 4BQRA 1XNGA 2V45A 3EAQA 2Y1OA 1EWKA 1G8JA 1RRMA 5BMVB 5AMXA 1Z28A 4YRFA 5CA0B 1RLMA 1KBQA 2QTNA 5AKYA 4B2PA 6CHYA 2M6LA 4MHSA 4ON9A 3WJ1A 1EVEA 2VDVE 1V2HE 3IA7A 2ZTUA 2CDRA 1CUUA 5EVJA 2HH9A 4CQLA 3LXXA 2IDZA 1WEKA 1XWFA 1EE1A 5BT9A 1OXTA 1ODSA 2C4WA 3HWSA 2QQFA 1M2GA 3OOJA 4TYQA 5B3JC 3Q8KA 1CV2A 4DIEA 1WMFA 2HA2A 2J6CA 4K9KA 4WKBA 3IVAA 1YRLA 1ZD8A 2X76A 2YHIB 3Q87B 2RI1A 5GONB 2ZZGA 3ZE0B 1NRWA 2YOGA 4QPZA 3ZDEA 4IDPA 2YV2A 5CA1A 5HIJA 4B7UA 1SVKA 3B1VA 2P4QA 1C30A 4S2UA 4YV1A 2OFPA 4BXOA 3V8EA 4LMRA 3OW2B 3VJRA 3OLCX 1WOPA 3OQPA 5EP3A 4ES6A 3PYMA 1UBNA 4P7GA 1ZVQA 3SDSA 2FW9A 1ZHFA 2Y8EA 4OMFG 2BKLA 4FBMA 4S1NA 5EY5B 2R1VA 4K9QA 4RJIA 3IBCA 1VHJA 1XZPA 3WICA 3HGMA 1V6CA 1Z73A 2IA5A 2FOXA 4D92A 4QASA 4BPRA 2X22A 5KJ1A 3RC2A 3D4PA 3EWSA 4Z9BA 1W36C 4F3KA 1QP0A 3ICVA 1QIEA 1K9VF 2GPBA 2H57A 2O20A 3DFKA 1DLIA 1WBJB 2CZGA 3NHWA 3QUSA 3RC1A 3RVQA 4AMGA 4E12A 5H82A 2QY9A 2RARA 3GDGA 4KWHA 2D2IA 4QVJA 2FE1A 1GT91 1L5WA 2N9UA 2WYUA 3O2NA 3VZDA 3AUKA 1RU3A 3PPVA 5EWJB 1P73A 1ID8A 2JI7A 3AUAA 3OFJA 1WLSA 1ODIA 4HVCA 4QFDA 4CLXA 5AJUA 3UCFA 2WHYA 4QBKA 2B6NA 1Z2DA 4HWKA 2FFJA 1XXHE 1ZFNA 2V7QD 2VPTA 4G0OA 4RS4A 1QDEA 3T7CA 1E5QA 1YZTA 2QR5A 2C4HA 1RWQA 1NASA 5HW0A 4X7MA 3W6UA 2RHHA 2I6FA 3JWIA 2D3LA 2IV3A 1O6BA 2AN1A 4OSOA 2BF7A 4DNQA 4PWYA 2SKEA 1WDMA 1J1IA 4WTOA 1XZMA 1THGA 1ZXBA 2JASA 1E6WA 1M72A 1UP4A 2PU7A 3UTDA 4B73A 4WQMA 3ND8A 1HYGA 1YVUA 4QVAA 2NN3C 2IIPA 1PO7A 1TJ4A 3OCZA 1ZO8A 4JENA 4QYMA 1OC2A 1UPBA 2PH1A 4S1PA 2B37A 2GCGA 1KI1A 2HTEA 2PK3A 4JKOA 4N49A 3V4FA 4ZDIA 4ANFA 1Z8FA 1ZD5A 1IM2A 3CLSD 1DO8A 4YONB 1E5DA 4JHLA 2Q29A 5EAIA 1X38A 2C2YA 3P97A 1KP3A 1ORHA 3ESDA 3EXHA 4GUAA 2NU9B 3WMEA 2IIQA 1VL2A 1GGVA 3ASTA 3ZX4A 2GBGA 3VBEA 2H2DA 4MRNA 2X0RA 1U6KA 3L1UA 1QBKC 1UPCA 4FGKA 2WM3A 4ZO4A 1PJLA 1OAKA 2CZQA 3W2TA 1EFAA 1XU4A 3QA3E 5F64A 5A4IS 5HILA 2SCUB 4IZHA 3B1ZA 1Q6YA 3UGKA 4R1QA 2Z3WA 4TGLA 2DT8A 4B6PA 1IPEA 4A1OA 4ZYZA 3PX7A 2XT6A 2D5AA 1VQMB 2FR8C 2FPGB 3DZGA 3FXAA 4H3HB 4IJUA 4I6EA 4LS3A 1XF1A 2CMHA 3A8JA 1SR8A 5AJYA 4H35A 5ERGB 3VH2A 2GVDC 3GIDA 4L51A 3TSCA 1TEXA 3GUYA 3H1TA 4B7ZA 4ZCSA 1O8BA 5ALUA 4ARVA 1T15A 2RGBA 2RGWA 1KC3A 1IWBB 1T2VA 1CUFA 1NQWA 1G20E 1ZC4A 3MINB 2GX6A 2BUBA 1PW5A 2V4ZA 1UJ2A 4AYTA 2GN8A 4IBOA 3UHOA 3MGAA 4E13A 3GLSA 4YFYA 2VATA 1VPEA 2P9FA 3GBSA 1TDJA 1PL6A 5LVAA 4RTPA 2MJLA 1K7SN 1A5BB 2CXNA 4WEQA 3RYHB 4Z4RA 1UZNA 2V58A 3NR2A 2CNKA 1CQWA 4UATA 4XCXA 2WEKA 2J41A 3SX0A 1KMHA 1U31A 1JHAA 1NXSA 4IMPA 4OU4A 3OI7A 2I87A 5H3CA 5E6UA 3SHTA 1P6UA 2BFFB 2D0IA 3D4OA 3L1VA 1QLJA 2CF4A 2ZIVB 3OKXA 1CB0A 1XLWA 2HMSA 3FNIA 4P31A 3UNXA 1EFTA 2XCOA 5JQGB 3W7VA 2J45A 4AY3A 1QNFA 4HAZA 3ZCPA 2X1HA 3ZNQA 4DGSA 1X7WB 1FEZA 2VDMB 3VAAA 2V31A 1GL9B 4KNVA 2JFFA 4L75A 1C8BA 5F1OA 4A2QA 3E6AA 2XSZD 3P4XA 2DBZA 4RHFA 3ZTWA 2VNSA 3M8KA 3FOWA 2J0SA 5HRCA 2C9BA 2WSYB 3HB5X 5AJWA 3G2LA 4AT1A 1E1RD 3PPXA 1WHSA 2A9KA 2GKGA 4EQZA 1EDEA 1UMCA 4D44A 3EGIA 3MGKA 3HR7A 1WZCA 1O6CA 3SYNA 1SCAA 1N8TA 3ZDCA 2XNJA 4JJZA 3ELDA 1P6QA 2YBDA 3MTBA 5KQGA 1D6SA 1RJDA 4DG5A 4PPNA 5FUQA 1KAQA 2C88A 3HUDA 3LQRA 3AL0C 2BMFA 2W6PA 4YLGA 1I33A 1P9OA 3CV3A 1C9NA 3ROZA 1KHTA 2C2GA 4HNAB 5I7FA 4DV0B 3NTQA 1CIPA 1NVDA 3G13A 3C87A 4XLAA 5KINB 1JJVA 3R3XA 3D0KA 1M1UA 1OXKB 2VKQA 1PEAA 3AI3A 3M5CA 4LZNA 4ZOBA 5EJMA 4EQ6B 4ZDKA 1X9HA 3R5TA 1SXQA 1J0AA 16PKA 1OX6A 4E3ZA 4FTWA 4MQEA 2QKYA 4OLBA 1FUYB 4HYQA 4JVOA 1JVNA 2VF5X 4ZOCA 2PCJA 4ZVMA 1KO8A 1VL8A 3GFRA 5TARA 2H9IA 1AZTA 4F8EA 2O5EA 3K9BA 4FINA 1AKMA 3SC4A 1CERA 2EBUA 2D7CA 3PUWA 4O2AF 6LDHA 4JLOA 2I4NA 2YZNA 1MN6A 4WRRA 2OXTA 2JCGA 3OZXA 3ANXA 4HNGA 1DKNA 4KE8A 4BPBA 2CFCA 5CDSA 4BNYA 5K5EA 1HE8B 4JLWA 2CFIA 1UJ4A 2WI8A 3Q6MA 3SIXA 2VHXA 3HJHA 4DVJA 4P5DA 2ZAGA 3AEUA 5FEMA 3SN6A 1TMGE 1K7FB 3MJTA 1TPYA 1RWVA 1E3JA 3K0CC 2UZ4A 3CB4A 1UJ5A 2LBPA 1MOPA 1D1PA 3C4JA 2I65A 4RDJA 5FUVA 1X70A 5DHRA 5AOCA 1YRAA 1G21E 1VGVA 2VC2B 3MS7A 3RYTC 3N7AA 3VR3D 5GGYA 2I4TA 4FM9A 2ZVQX 3NW9A 4QQ8A 5HCUA 1IIRA 3WGGA 4F4JA 1MDBA 4YV7A 3ZJ5A 2ECKA 3ZXYA 3V3TA 3RD5A 5C1PA 3L07A 1J20A 4YO7A 1IONA 2B5WA 4E2XA 2GAFA 3FTNA 3IAM1 1LRKA 1JECA 2PMKA 4MNTA 1NBAA 4PXAA 2RGDA 2EJWA 3CB2A 4AP6A 4HQNA 8AT1A 1X13A 5EHZA 4RD2A 4P7BA 3KTFA 3A3OA 4PO3X 4DAOA 5A3RA 4G07A 1EFKA 1BNCA 2I3DA 3AEQA 3EDMA 1KR2A 3LX5A 3PWTA 4Q01A 3U9SA 3M5WA 4N1AA 3LQEA 4JLMA 4Y2JA 3L3BA 5MN4A 2X2FA 1QQ6A 4BJ5A 1DEKA 1QAOA 3T38A 4M83A 1E1MA 2VT2A 1Q0SA 2GILA 4X8LA 4UNRA 4G0UA 3NHRA 3OT1A 4OHUA 5B37A 3ZHBA 3SF8B 1TZCA 3TEJA 3OCCA 1VE1A 4J0KA 5TB5A 2RHGB 3CF6R 2QE7A 1RAAA 4ND5A 1RPAA 2P0AA 5CNKA 3UAZA 3EEOA 1WP9A 1K73D 2JARA 2XZOA 3K9FC 1Z6GA 3MZ0A 3R44A 5AIAA 1YTUA 1Z2PX 1TTTA 2QTAA 3HKEB 3IUYA 4CL3A 4CMIA 4B7AA 4KQJA 2ZKLA 2FUNB 1IM8A 3AHHA 3B6IA 1PYGA 4Q3BA 5GTDA 1HE4A 5EZ6B 2ZJ2A 3TSWA 2PWZA 4UPVA 4HDKB 1JFRA 5IH3A 4FSDA 1FSGA 3KYJB 4L4SA 3ZIAA 2IY8A 2OSBA 1YHZA 1E6MA 1Q16A 3PE3A 4R4JA 4BE9A 5K8VA 1Q3TA 1P7VA 4BMVA 3BXGA 1OTYA 1XTVA 1PG0A 2KM1A 2QLNA 1ESEA 3OX1A 4KEAA 1PSZA 2KBEA 3FYHA 4ARCA 1C30B 3P9RA 2QRHA 3H9NA 3KYDA 4YAOA 1TQ2A 1YQ9A 4NU8X 4D2IA 2LE0A 3WQZA 2P79A 3NNNA 2J7KA 3WVNA 3L77A 2QX8A 4YUVA 3I05A 2R1VB 2NZXA 1C0PA 5D51S 4PTLA 4UPDA 4G01B 3OTQA 1DQPA 3EGDB 3HU2A 1YJAA 3FOAA 4XQCA 3BULA 3R77A 4B6GA 5K8CA 2YCBA 5E4FA 4HP8A 3N28A 5JU6A 2BEKA 3K15A 2VLBA 1JDBC 3SYKA 3VU1A 2XOXA 3N9IA 2W98A 4PANA 1CP3A 4X54A 3T3MB 1RZRD 1D1NA 3RJZA 5JO0A 3QFFA 1VA5A 2DYIA 4A6DA 4AF7A 1ADYA 2ZJ6A 3GI1A 2F1KA 5LYYA 4CDMA 4ZGWA 2F67A 5CT6A 2D54A 1YKSA 4XAQA 2GN0A 2O0HA 3IEUA 1PT6A 1BW9A 3L6CA 2VHUA 4ZARA 3ZNNA 1AA6A 4RUKA 2HSEA 4KFRA 1LWNA 2FPIB 3URKA 2H5JA 3G71B 1WUKS 2PCLA 4LGCA 3PHIA 1SQ5A 3GY0A 4BNTA 2YDXA 4W63A 4E14A 3TLGA 1USWA 4MSUA 4XL9A 4NFYA 1T8WA 3R6KA 1DO2A 2CYAA 2V4UA 3CRZA 4OQFA 2QM0A 1X8XA 3ILXA 5H7XA 3BRQA 5EMJA 4D8WA 3KQUA 4DR1B 1M2NA 3IBYA 4UNSA 4DY6A 5AW7A 3UOGA 1PLKA 3ZK9A 1N6OA 1XFAA 2GJPA 3CPWB 4O59O 1AKVA 2ECPA 4TKLA 4YX9A 2B1JA 3LL4A 5ALSA 3PK0A 1G4UR 1EAMA 1XRJA 2R68A 3A1CA 2YNMA 3GIRA 1H85A 3CUTA 3BGWA 3MS2A 4M8LA 5EEHA 3TLEA 3T9DA 1Y3HA 5CK5A 3GGPA 4X3OA 3GDHA 2NAFA 1WOOA 1ABFA 3VDNB 1W2HA 3VDQA 1MLDA 4N5HX 1Q7RA 1RI2A 3LVRE 3SBEA 5TPZA 3RVMA 1MQSA 4ARZA 1AQNA 1XG5A 1VL1A 1OWOA 3QBDA 4FCTA 4I4NA 3EIUA 1QZ3A 3EXHB 1W30A 3PR1A 4QULA 5B3JA 4LJSA 4RK1A 4XLHA 2XW6A 3AFMA 1SKBA 2O4CA 2ZM5A 1AQLA 1GPBA 5ELMA 2EFCB 1BGVA 2QUZA 4JASB 4TVOA 5K3FA 2IOFA 1GQRA 1NGSA 4WFQA 1EFRD 1MVOA 2ADMA 2BFOA 3DONA 2UYHA 1H05A 1XMOB 2ZUEA 5JH7F 4BFWA 5J2UA 1QJCA 4Q19A 4D9CA 2A94A 4Y2XA 3H2BA 6PFKA 1W6RA 3BGDA 1KAGA 1EVQA 1K92A 3D2BA 1E1CA 3I4FA 3I5MA 4AMBA 4UCFA 5LYJF 1Q0LA 4FR2A 1NPDA 3ZLJA 4G0QA 4TLMB 3B6MA 1G9SA 2P69A 3E23A 3KWJA 4U0JA 3D8HA 2QTLA 1FX0B 3R7FA 4KVFA 2AZ4A 3I72A 4J75A 2W93A 5LA6A 3RJ5A 5M34A 1BQ4A 3GG2A 1M6VA 2A78A 1FNNA 2VL7A 4DDKA 2YN2A 1HURA 1TMYA 5EHGA 5CLHA 2POCA 2VBGA 3QVTA 4FYHA 1VDZA 2PKYX 4KQGA 1R6TA 2X1VA 2W6JA 2GEBA 4JFAA 3LUJA 5KTTA 4LJ4A 2H7YA 4XEHA 3I3SR 3M3HA 1F20A 3ASPA 2X4LA 5DI3A 4KVGA 1WXIA 2ZANA 4D41A 4ZGGA 9MHTA 4IGKA 4NZPA 3P2JA 1YB4A 2YW9A 1M9NA 1E9SA 2PKXA 1CKEA 1NONA 3LDFA 4OMUA 5EUQB 1KMHB 3MSCA 1IK4A 1E3DA 3DDCA 3MEQA 3WNBA 3AL2A 4IHAA 2BRUA 5DHPA 2O8FB 4RKQA 3LPAA 4JGIA 1SVIA 2MYNA 1Q1ZA 2C3OA 1P74A 4W8HA 4ZDWA 1AU9A 3MTGA 5JCOC 3A3KA 2J9GA 2IYXA 4I3HA 1XJ0A 2O54A 1T6XA 3A4MA 1P4SA 1IAVA 3CSSA 2Q2NA 4CQMA 2VAPA 3CMCO 3DBVO 2C9YA 1OWPA 3FDZA 3FMGA 1ZL0A 2P90A 4QDJA 1IEWA 3OTHA 1FPMA 3WNDA 3L46A 5CH3A 1JYEA 2IXDA 4Z4QA 4AX8A 4YACA 2IFTA 4QBFA 1WHSB 1JLRA 1IZ9A 2YR0A 4Z2AA 1JZSA 5ADHA 3DMGA 1EE9A 5ALZA 3OMXA 5F3WB 2QSZA 3O84A 4DNTB 4MVCA 3GWZA 4L3WA 4Z0TA 4DLRA 3I8SA 1E4VA 5FIUA 2DHEA 2ZPTX 3KJNA 1E1NA 1NUQA 4YMSA 1FIUA 3LT5A 4P3NA 3PUZA 5H1YA 1M83A 2UDPA 1VE7A 3O4IA 3SQDA 1H2WA 2ON6A 4M7OA 4Z4CA 1MO2A 3S2FA 1ATZA 1IJKA 2M98A 1DELA 4MEBA 2V8OA 4WK4B 4LZZA 2XRFA 5I51A 1YDWA 3DD1A 2R8BA 3IP9A 4IV8A 4LPSA 3HWWA 4UHCA 1XF9A 4ZYYA 1WZNA 4RPBA 1CS4C 2OKGA 2PU5A 3WZMA 2QU7A 1J5PA 3WGVA 4TL9A 1GZUA 2GN4A 2IX3A 5T7BA 1FB5A 2NZ8A 3AVPA 5ENVA 4UQOA 3LRPA 1Z4OA 4C4XA 4II2A 2VHTA 4FHDA 5IBRA 2P68A 5JNSA 5DHAA 2AYZA 3ILYA 4C7XA 4ZJPA 5KNCA 1UDWA 3RWOA 3SEQA 4KX3A 3QYPA 2NU8A 4EI2A 1O4WA 1FYEA 1NMEA 1Z18A 3NWOA 3PJFA 3U3RA 1VMIA 5HKKD 5J4YA 1KTIA 1T6YA 2PKQP 4N4AA 3OKFA 5K8LA 3A6PC 3H5NA 3NHZA 3MCAA 4IFBA 5C5EA 1QCCA 1HE5A 1ST2A 1ODCA 3CT6A 3G5AA 4FMDF 4PX5A 1QMPA 3EJWA 3IB6A 3I04A 3PDCA 3PJDA 3QNWA 2Q8QA 4QSHA 3PFFA 1CJSA 1MB2A 5CDUA 1IVYA 3OQBA 2RJOA 5FD8A 4KXUA 2PMFA 1C4WA 1KYQA 2X5XA 3A7EA 3QA9A 2G9NA 1E2BA 1V16A 4IGIA 1GUAA 3ENWA 4WLUA 4Q7QA 5FNVA 3LZCA 2VPQA 4FW8A 1ZAYA 1I9CA 5EZSA 3SJBA 5IDQA 4W9NA 3EBLA 2HRDA 4PYIA 1JPNA 2C1EA 3K92A 4BP3A 1O8CA 4H7FA 3C6YA 2EGGA 4OQNA 4Y2RA 4D7AA 4BEWA 1X6VA 2DPHA 2H4FA 2WZCA 4GQNA 2GHRA 4YP6A 1IY9A 3V4RA 1ODJA 2A6PA 1PJCA 1XEWY 1P33A 4RLSA 3SEZA 3QVXA 1A72A 4YWHA 3QE4A 1X8KA 3S2SA 4MPDA 4EA6A 2W22A 2HL6A 4JI5B 4JBIA 4OGGA 1A8QA 4ID3A 3PKIA 3BAFA 4O5OA 1OPRA 2A59A 1NXPA 1OI4A 4J3NA 2QGFA 1H0SA 3WRVA 4ZT7A 2FJUA 4FSHA 4TT3D 4RLQA 2GJKA 3T9FA 1V11B 1CY8A 4CEIB 1IUNA 4NCIA 3H8JA 5HQ3A 3AEQB 3C3DA 1JAZA 1GPLA 3KZNA 2BMDA 4CMHA 3H4MA 3UGJA 2AMLA 3PNSA 5A62A 5IAOA 3THYB 1Q7EA 3HJUA 3FF1A 1EFCA 5AI8A 3UV3A 4AG6A 5BSKA 2UUAB 5KWSA 1KJIA 3HJBA 3RF7A 2ZS8A 4IGFA 2V0CA 2J3KA 3COPA 1Z0IA 5JEDA 4A7PA 1X1SA 1H23A 1U0NA 3FUCA 4OF4A 2PZ8A 1SHJA 1GDDA 4B32A 1HY3A 1QHNA 1DSSG 3A70A 3R6DA 3CVOA 3BHMA 3CR7A 1EWVA 2XNSA 2RGGA 1KYZA 5IDVA 5FDFA 1SXJA 4X7FA 4OXQA 3B20A 3NHAA 2XH8A 2PH5A 4GZ6A 3TR5A 4JU9A 4Z9AA 3B85A 4O4JF 3MK31 2QPOA 5CM8B 2QRNA 3EAFA 3RFVA 4B35A 1QX4A 1RI4A 4BC0A 1BXRA 2E4UA 1M7HA 3M70A 3PQ4A 3QIVA 4Z4UA 2WILA 3QE0A 1QHYA 2EWWA 4R8LA 3PGA1 4F8JA 2DWPA 3EXEA 3NRCA 6REQB 2HCTA 3N6RA 4TKUB 1ENOA 1PZNA 2WYHA 3A3YA 3KYDB 5CDYA 3EIEA 3CW2A 3K30A 1QFMA 2M32A 2DLDA 5E7IA 4HLUA 2V8BA 3ROXA 3TBHA 2XTMA 3FYCA 4TLEA 2QL9A 3U1BA 5THXA 1PZHA 4JX9A 4MUGA 1W35A 2OO7A 5HRUA 2QZ9A 2RDMA 3E22B 3PYXA 4QJ5A 5DYIA 5BYAA 3K0CA 3LT1A 2IXFA 2CLDX 2E4YA 4BO5A 2WJWA 3GO4A 3OIVA 1USVA 1RJ9A 2A88A 4Q9JA 1GAJA 2VYFA 1MJFA 3ZZ0A 2YWXA 3AWDA 3EA5A 4O8CA 5E2BA 5JAOA 1JDJA 2GXAA 4Z4YA 1T5OA 1TE2A 2TRSB 4EJSB 3ADCA 1VZ2A 2OCDA 5B30A 5DYNA 1W4AA 2O7QA 2Q5QA 1SO8A 1VJTA 2OWDA 1Z0FA 5CMLA 5ECWA 3MVEA 2GD2A 2WTBA 3HCDA 3LI2A 5EE3A 3GRUA 2ONJA 3ZE6A 4CE6A 4X61A 4EENA 4POAA 3E05A 4HUJA 2WSBA 2CVFA 2WTEA 1BW9B 2DP4E 4G65A 4KQFA 5T67A 4JXXA 2HJRA 2FF7A 3IULA 1ILWA 3PT9A 5FBWB 4LI0A 4CR8A 1B1CA 4MWDA 4NG5A 4Q21A 2GK4A 1JH9A 5I47A 3C3WA 1CY1A 2QU8A 2B8NA 4OLJA 5EI5A 3GRVA 1DG3A 1B14A 1JQJC 2P1RA 1U3GA 3LYHA 4O2AA 5ALWA 2NUTA 5HZHA 2ST1A 3QXCA 4ZK2A 2JCXA 1IBKB 1Q1EA 4RPGA 4OFWA 1CX9B 1D6JA 3MCVA 2FR0A 3I23A 3BX1A 2WIBA 1H4SA 3TQTA 1VECA 1ZU5A 3UPTA 3DCIA 5C3MA 1QKJA 1IY2A 2ZDHA 3H9UA 1XIVA 3M3DA 1OXBB 2CT8A 2C97A 2Q7DA 4OU5A 4C9BA 1AKEA 1J8YF 3NPMA 3K0FB 3SP1A 4EZEA 5JAHA 2OFFA 1MA0A 3NAGA 3OQNA 1KEZA 5CDFE 5FX2A 1F2TA 2A4MA 3MSXA 3DNMA 3JQRA 3OE5A 4L78A 4PGAA 5ECDA 1SRRA 3WRWA 4E1BA 2GZ2A 1CNMA 2YRFA 3DXZA 1U3UA 4OOVA 3IP1A 2AF4C 2C1ZA 3USES 1UOPA 1SOUA 1UBJS 3BBPA 1R2QA 4KDRA 5HMLA 1Y8RA 2ZITA 3K5WA 4IV5A 5K3FB 1HFEL 3JAKB 1C7FA 1OYVA 5FL7A 4GBMA 3LKVA 4C2TA 3TW6A 1HYHA 3IXQA 1T1RA 4S05A 2BGWA 1K3FA 1PDWA 3FFXA 1FTWA 1FQOA 3OCJA 3TLJA 5B36A 2DWCA 3ENKA 2PR7A 4HXEB 1ZR2A 4ZODA 2VDKB 3O4FA 4XUGB 1QIMA 2ORYA 3UT6A 2PSJA 1JR4A 4HX9A 4TQAA 1ZGAA 3GMDA 1BDBA 4QOHA 5E2IA 3VKVA 5FEUA 5JRDS 1JXMA 5DCUA 3TLBA 1RXEA 1M6VB 1PTKA 1NBWB 4KBGA 4QDXA 4RXUA 2FU5C 4UDNA 5JQGF 5JWOA 1LQUA 5AVYA 3OQJA 1AQUA 2BFAA 1W5BA 2I71A 3OMWA 3KRTA 4WJKB 1CNFA 1VKZA 5AQEA 5BUQA 4I1RA 2JFGA 2HK7A 3TMAA 1OBOA 2XV1A 3KSUA 3FLEA 1YJ8A 4D4IA 1KQGA 3DVLA 4US0R 4EY6A 3SFZA 2XKBA 2P0YA 3E0XA 1Q81D 2Y76A 3K09C 4GP9A 5IYZF 1F12A 2GTPA 4RZ3A 3SD7A 5IFKA 4U7DA 1MX9A 2C0CA 1ULHA 1C29B 1Y3CE 3AHCA 4B6OA 4AL4A 4IYJA 2QLTA 4KXWA 4TZTA 3OZWA 2FDXA 3OC0A 1EQAA 4R2LA 2XCQA 3UT5B 3ERCA 2X85A 1V2GA 1QYRA 2H2WA 2WFAA 4NAHA 1EIWA 1BH6A 2EYQA 4KMOA 1DBRA 3SJPA 2IYPA 3QVVA 5EC8A 2JRLA 2R2AA 4AUKA 3H1GA 3BD8A 1UT6A 3CZRA 3KTOA 5HWSA 4JDPA 1NMSA 3FW1A 1UCFA 3ENNA 1UJCA 4RPCA 2JEYA 2G88A 2ZRCA 2AL7A 2G71A 2WA2A 4RJLA 3FTQA 3HXKA 4EO9A 1HTWA 4ISCA 5PNTA 4B3HA 1SD2A 5CLFA 5P21A 4QYWA 3CNQS 4Y0AA 1Z26A 2FEXA 4FC6A 4E03A 3HV0A 3WGMA 2VUTA 2X8BA 4YXWA 2B5VA 5JZBA 4RIGA 4UBIA 3ZC3A 1AKUA 1CBUA 2AH5A 2I4IA 2VS1A 4O02B 3Q15C 1DDOA 3L0ZA 3PR2B 1L9KA 1NE2A 1VBFA 3EXAA 2IYLD 3GHYA 3MAGA 3RC9A 5L95A 2C5HA 2XA2A 4YRLA 2P9BA 3DAOA 4AW9A 4H1HA 1JKFA 3FIJA 5KYGA 3QJ5A 1RCTE 5FLXA 1GXSA 4FS3A 4HRXA 4C0BA 1ACJA 2HJVA 3P4UA 4RULA 3E2PA 4TYMA 1QANA 4TMXA 3MTIA 4A0HA 2OYNA 1T8UA 3V42A 2H07A 5AUQA 3UAGA 1OTXA 3WGQA 4IDNA 3WRYA 1UD2A 1JQEA 2ZZFA 2A2ZA 3VR5D 2E48A 4R6XA 1F9AA 2CV2A 1E77A 2ZQ5A 2BGUA 4HAXA 4KR7A 2Q3HA 2Q21A 2VBIA 1C2TA 4PR3A 2IHZA 3NBQA 2RBKA 4PPFA 4QDKA 5FH9A 3CRMA 4CPDA 2GT1A 4ESOA 5JCPA 1MUUA 3MHPA 3LU1A 4LV5B 3CBGA 1U7PA 2Y2UA 2F4NA 2BCJQ 2OLEA 1SN7A 3VRHA 2GCOA 4W5OA 4HVLA 4GI1A 4K7JA 1M6YA 1N6NA 1WXGA 1U9JA 2POQX 2WJVA 5KTYA 3JU4A 3FHLA 3R2JA 4GAEA 4BNUA 1CG6A 2ZVJA 4MJ7A 1W5FA 2ODTX 4C0KA 1ORDA 3B5JA 3ENQA 2QLJA 1VBKA 1YONA 4M87A 4BWFB 1FNBA 1J4AA 3HJRA 5ALVA 3WIOA 1F6BA 1WD7A 4LZJA 4XLLA 5LR6A 2GNOA 4ZVRA 2Q3FA 1V16B 1NN0A 2GWHA 1R15A 1E7QA 1SXIA 1VIVA 3A6LA 3KKOA 4IINA 4M7WA 5FNVB 5JLAA 4CT4B 3N2EA 5B7QA 5BSEA 1WXFA 1S3FA 1WPXA 4LYYA 2BH9A 4Z7QB 3PGVA 4XGRA 1WXDA 1II8B 4R8RA 1E9VA 1EDZA 1P5FA 2QX4A 3EY4A 1ENPA 3ND6A 2MSWA 4HK4A 1K63A 4GPEA 3GPDG 4QO7A 4TV8B 5JH7A 3DEJA 2XZTA 2IYEA 2OWEA 5EHNA 1PR3A 5LYJA 1YKFA 1CR2A 4C2AA 2OAP1 1CUVA 4GKKB 4B7XA 1RKBA 3VR0A 2J5QA 5HKOA 1JKJA 1NXTA 3E48A 3I6ZA 1F7VA 1C5KA