5A88A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with adp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
147
Chain Sequence
RHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 31
structure length 147
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a88A00
5FO0A 1N05A 1NB0A 3OP1A 1NB9A 3CTAA 1N06A 5FO1A 2VBVA 2VBTA 5TRDA 2VBUA 5A8AA 4UZFA 3ZUGA 2P3MA 1Q9SA 1MRZA 2I1LA 5FNZA 1T6ZA 4UZEA 1P4MA 1S4MA 1N08A 2X0KA 5A89A 3BNWA 1T6XA 2OYNA 2VBSA 1N07A 5A88A 1T6YA
chains in the Genus database with same CATH superfamily
3VR6A 4Z4WA 1CQXA 4GQNA 3ZZUA 4RCZA 4OP7A 3CCLB 3AVWA 1WU8A 3SJZA 3W2IA 1COWA 4KKTA 2E1BA 2R6HA 3B82A 4OOVA 1JA0A 5TRDA 1QUFA 3OE7A 4M4SA 5DN6A 4Z4RA 1VQ9B 3GVKA 3CC4B 1I18A 1TVCA 1VLYA 1T6ZA 2CC2A 2F1MA 3A8JA 3BY2A 3CRZA 4L8JA 4XLCA 1PJ6A 4XLFA 1PJ5A 4TMWA 2HLDA 3BY1A 3A1PA 3PENA 3Q3AA 1VQ7B 3CB4A 1QVGB 1QUEA 4C0SA 4QV2A 4K1XA 5BSXA 4RD6A 1PKVA 3SEJA 3VMFA 5J3OA 1M90D 4LBZA 1KK3A 1D2EA 2HMAA 2Q6KA 5GV8A 3AGPA 2WJYA 4XR6A 1XQBA 4PGOA 3U6BA 1W0KA 4XN0A 4FXUA 4LBWA 4WZLA 1KJZA 2XOKA 1E1RA 2BV3A 3ASQA 3NE5B 2X85A 4YHBA 3J81k 3ONUA 4P22A 2BM0A 2ZXIA 5HZAA 1WTHD 3QFRA 1ZM9A 3CCJB 2X6XA 2X0KA 2V7WA 3OOCA 1NRKA 4Z1MA 5IYPA 2ZITA 5HXBA 3VO1A 4Z4ZA 3SKBA 2X6WA 4ZCIA 3R6JA 3G05A 5A88A 3WQZA 1KK1A 5B6IA 5H59A 1OHHA 1GVHA 2Q6IA 1Y0YA 3CPXA 1EP3B 1NJID 1ELOA 5IYWA 4M0LA 1QFZA 1F60A 3A3BA 4Z4TA 2VYQA 1GJRA 2YWEA 3AVUA 1YIJB 3B8HA 3BQJA 2R9VA 3R6KA 2V7XA 1E64A 1EFTA 2XZOA 1HVXA 4ZCMA 1DG1G 1EFUA 5KNLA 1VQ4B 1GAQA 3MHPA 1UD8A 4X7EA 3JQPA 2BGIA 4FK8A 4M2LA 2GK6A 1E62A 1SKYB 2CRVA 1KD1D 1GO2A 1N8RD 2WSSA 4TMVA 3SLDA 2VNIA 2XEXA 2WPDA 2VBTA 4B4DA 4RD0A 1TTTA 1UD4A 1QGAA 1U2RA 4KKUA 1H8EA 4ZCLA 2P3MA 3WBJA 4RD1A 4ZGNB 5DS0A 1K73D 5H5JA 3I55B 1XB2A 1VQPB 3WYAA 2OBSA 3W5VA 1QG0A 4RPDA 2LZJA 4AC9A 1Q82D 1GR1A 1CNEA 2YWGA 2B7CA 1BQEA 2WZNA 4R71A 2C78A 4QVJA 3WNBA 3CXCB 1YX2A 2CW5A 2OYNA 1KK0A 2VZLA 5HKKA 1M1KD 4XORA 4B3GA 1KTVA 1VLOA 4G7XA 1QGYA 2PLFA 1E3XA 3QE2A 2QA4B 2DETA 3GIRA 4B3FX 1BPLA 5E6TA 1VF7A 1TLLA 3PA2A 1EWYA 2ZXHA 1Q9SA 2BSAA 3ES9A 1QFYA 4FWTA 4QHYA 1W2BB 3A35A 1T5EA 5F4JA 1EP2B 2QEXB 4RD2A 5A89A 1YI2B 2BVNA 2BMWA 1KC8D 4B3XA 4DNTB 1IB0A 2PE3A 1WSVA 4PABA 4XL9A 4P12A 2XZLA 1FX0A 2QN6A 4MYTA 4XKWA 3CC7B 3KEWA 3V7AA 3CD6B 3A8KA 4QFMA 3BC9A 1WOPA 2JIZA 1W9XA 5KW9A 2Q6LA 1G7CA 4UZFA 1UD5A 4M1KA 1FNMA 1VHEA 5TV2A 4G7WA 2V7QA 1I7PA 2GK7A 3QFCA 2ZL6A 3T56B 2C5BA 4HIZA 2DCUA 4P1VA 3SJPA 3H9NA 2DYIA 4OPOA 1UMKA 1QFJA 1DDGA 4RM0A 4G1BA 4XOTA 4H9GA 5EMNA 4TMTA 2V4DA 4FN5A 2JDIA 3Q38A 1JB9A 1F20A 1IJEA 1N06A 1WDTA 4Q7JB 4TT3A 4X7CA 1VQKB 2DY1A 3CCMB 5F4OA 4AF7A 4G1VA 2C5HA 2GJKA 3LVBA 2ZBVA 1VQ8B 1BX1A 4PAAA 1OGIA 2CNDA 3W5HA 1P4MA 3H94A 4AVZA 2D9RA 4LC0A 1JJ2B 3OW2B 1BX0A 2NPFA 2DOGA 4X0CA 3ZBTA 4E0FA 4F7DA 5IYNA 2RC5A 3Q39A 1EP1B 1WOSA 4XLAA 4XM3A 4YALA 3BNWA 4X05A 1HZEA 4B48A 4Z4VA 4AF6A 2F43A 5CDFA 4OPSA 1R5NA 1PJ7A 1VQOB 1D1NA 4ROXA 4P26A 1NB0A 2BF4A 1VQ5B 4RPBA 4WWVA 2DEUA 4OPVA 2F4NA 1BJKA 4II2A 3OW7A 2XNDA 5DSZA 1DDIA 2C4UA 2V7TA 1JNYA 1VQ6B 2AHOA 4RDJA 3WY9A 4YEJA 4N3NA 4G6IA 4ACAA 5FNZA 3CMEB 4TSFA 1I8DA 1YJNB 4P9SA 3FKSA 3W2FA 3OKXA 5BSYA 2XGJA 3AVVA 3A8IA 2D74A 4TN1A 1OGJA 3AGQA 4XLHA 2WR8A 1EFCA 1Q81D 5IYQA 4NCNA 1E43A 1V5VA 2JJ1A 4XLEA 5FO0A 3W2GA 1UD3A 2QTLA 2ZZGA 4X7DA 1DARA 1XFOA 5GV7A 3W5UA 1YJWB 2OTLB 4Z4UA 1H8HA 1TUIA 2C77A 2VBVA 3BCDA 1VQLB 1MABA 1H85A 2XNJA 4PC6A 1W35A 1J9ZA 4YELA 2QDXA 2XNCA 4Z4YA 2VNJA 3G6EB 1E63A 1S72B 1W87A 1V0FA 3T51B 4EH1A 5TY0A 2ZL5A 3ZIAA 1WSRA 3CCSB 1Q86D 3I1FA 1ZM2A 4X8IA 2D3NA 2EIXA 4RJLA 5KSWB 1QVFB 1UD2A 4ASUA 3OP1A 2W6IA 3CTAA 3VO2A 3OAAA 3E20A 2NV4A 3HAGA 2GJRA 2FVGA 2PMDA 1KMHA 3U6KA 4YAUA 3FPKA 4P3IA 4II3A 2V7VA 1S4MA 2Q6OA 3MMPA 2BPOA 4YAWA 2ZBUA 2X53S 2DIEA 4ZGQB 4XMYA 1ZM4A 2VNHA 1KZLA 1IJFA 1QH0A 3VNUA 1AIPA 3PUMA 4XKVA 3CP2A 4RLZA 1D8TA 1OB2A 2QE7A 4WQMA 2ZZEA 4LBVA 1N0VC 1Q7YD 4P25A 1NDHA 3VNVA 1NB9A 3W2EA 4RD3A 1K9MD 1E3ZA 2OBRA 1S0UA 5THXA 2BM1A 1G7RA 5IYRA 1OB5A 1YJ9B 1EFRA 3RY8A 2I1LA 3P27A 4UZEA 2ZTGA 4LBYA 2V31A 1E1QA 4TMXA 2GQFA 2QMUA 3OEEA 4X06A 4B44A 3OZUA 4Z4SA 2B7BA 2WJVA 1VHOA 1YHQB 2ZL7A 1NBMA 2VNKA 4N3GA 3WXMA 2CK3A 2FX3A 2HCJB 4TKOB 1N05A 1R5BA 3PUNA 4U9UA 3FJOA 4YAOA 3PA1A 4DK1A 1WOOA 1YITB 3GQBA 3CMAB 3OEHA 5FO1A 3OJXA 3LQEA 3ISXA 3CESA 2VJJA 3GVJA 1FRNA 3QSYA 3WNDA 1G7TA 5J35A 1MRZA 1KK2A 3T53B 2PIAA 1VQMB 5IK2A 4HE6A 1EXMA 1RQPA 2BGJA 2CF4A 2GPJA 2VJIA 1BMFA 2OK7A 4UAJA 1QGZA 1WORA 2QGGA 1FNBA 1GAWA 1T6XA 2C2WA 2X6YA 4XN3A 3GSIA 2RC6A 2YWFA 3CCEB 2XZPA 4PC7A 4YXWA 1H42A 2ZZQA 2EFGA 4JMQA 3LNNA 1N0UA 3G4SB 4QVAA 1BLIA 3GVLA 1JA1A 2F1LA 3ZZTA 1W34A 4HE5A 1E79A 1B23P 3W2HA 3Q6RA 3CW2A 4DK0A 3OFNA 3BH4A 3AVTA 1A8PA 1K8AD 3WBKA 1CNFA 1FDRA 3LQ6A 5HZBA 1W0JA 1RQRA 4NNJA 4XQFA 1WPCA 3KL9A 2X8KA 3ZBUA 1SM4A 3ASSA 3CCQB 3I56B 4XOPA 2GJPA 3BCFA 1G7SA 4P6YA 3SLNA 2E1RA 1FRQA 1HA3A 2HDNB 3QFTA 4UZUA 2OBTA 4WZTA 5FL7A 2B5OA 3ASTA 5L46A 5LMZA 1K28D 4RD4A 1Y0RA 3Q6QA 1OB0A 3OPOA 3D26A 4C43A 2Z6BD 4PC3A 1WP6A 1XE1A 4P2NA 4RCYA 5AN9A 2ZTNA 1QX4A 2BN4A 3MCAA 4OOSA 3DDYA 1R5OA 2V7UA 3ONYA 4B47A 4X07A 2M5SA 3ZC3A 2DERA 3AVXA 4WZEA 4PC2A 1T6YA 5A8AA 3QFSA 4DQLA 1ZM3A 2JN9A 3V76A 3PVDA 3A3GA 1SKQA 4M53A 4CQJA 4RDLA 1VQNB 4YAFA 2C4TA 3FPPA 3ZZ0A 4P3YA 2VBUA 1FNCA 4KKSA 3CCVB 4NBSA 2X3UA 2WYRA 3CC2B 1FNDA 3U2QA 4MYUA 4TMZA 3B78A 4QUZA 1B2RA 5JBQA 4XONA 1N08A 4G5GA 2WZPP 3CCRB 3ZPNA 2OTJB 4OOXA 4ZV4A 2GREA 4RDKA 3E1YE 1YLOA 2KVOA 3JU4A 4DNRB 4Y9UA 1N07A 3JQQA 4Y7CA 2OK8A 4DQKA 4P6VF 4ACBA 3P26A 1V0EA 2JJ2A 5FIUA 4J0QA 1KQSB 4PC1A 2ZZFA 4B43A 4Y9RA 5FA6A 2QTZA 3WNCA 3CMMA 1AMOA 1ZUNB 3ZUGA 1VJSA 3CCUB 3CPWB 1IHMA 3OZVA 3CP8A 3G71B 2J7KA 3ASRA 4XNFA 3AVYA 2D3LA 4IW3B 3ASPA 2W6JA 2YWHA 5F4MA 1UD6A 3JQRA 3OZWA 4XD7A 5TR9A 4BPRA 4WZKA 1KRHA 3OJWA 4X7FA 2VBSA 3LO8A 2CBXA
chains in the Genus database with same CATH topology
5FO0A 1N05A 1NB0A 3OP1A 1NB9A 3CTAA 1N06A 5FO1A 2VBVA 2VBTA 5TRDA 2VBUA 5A8AA 4UZFA 3ZUGA 2P3MA 1Q9SA 1MRZA 2I1LA 5FNZA 1T6ZA 4UZEA 1P4MA 1S4MA 1N08A 2X0KA 5A89A 3BNWA 1T6XA 2OYNA 2VBSA 1N07A 5A88A 1T6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FO0 A;  1N05 A;  1NB0 A;  3OP1 A;  1NB9 A;  3CTA A;  1N06 A;  5FO1 A;  2VBV A;  2VBT A;  5TRD A;  2VBU A;  5A8A A;  4UZF A;  3ZUG A;  2P3M A;  1Q9S A;  1MRZ A;  2I1L A;  5FNZ A;  1T6Z A;  4UZE A;  1P4M A;  1S4M A;  1N08 A;  2X0K A;  5A89 A;  3BNW A;  1T6X A;  2OYN A;  2VBS A;  1N07 A;  5A88 A;  1T6Y A; 
#chains in the Genus database with same CATH topology
 3VR6 A;  4Z4W A;  1CQX A;  4GQN A;  3ZZU A;  4RCZ A;  4OP7 A;  3CCL B;  3AVW A;  1WU8 A;  3SJZ A;  3W2I A;  1COW A;  4KKT A;  2E1B A;  2R6H A;  3B82 A;  4OOV A;  1JA0 A;  5TRD A;  1QUF A;  3OE7 A;  4M4S A;  5DN6 A;  4Z4R A;  1VQ9 B;  3GVK A;  3CC4 B;  1I18 A;  1TVC A;  1VLY A;  1T6Z A;  2CC2 A;  2F1M A;  3A8J A;  3BY2 A;  3CRZ A;  4L8J A;  4XLC A;  1PJ6 A;  4XLF A;  1PJ5 A;  4TMW A;  2HLD A;  3BY1 A;  3A1P A;  3PEN A;  3Q3A A;  1VQ7 B;  3CB4 A;  1QVG B;  1QUE A;  4C0S A;  4QV2 A;  4K1X A;  5BSX A;  4RD6 A;  1PKV A;  3SEJ A;  3VMF A;  5J3O A;  1M90 D;  4LBZ A;  1KK3 A;  1D2E A;  2HMA A;  2Q6K A;  5GV8 A;  3AGP A;  2WJY A;  4XR6 A;  1XQB A;  4PGO A;  3U6B A;  1W0K A;  4XN0 A;  4FXU A;  4LBW A;  4WZL A;  1KJZ A;  2XOK A;  1E1R A;  2BV3 A;  3ASQ A;  3NE5 B;  2X85 A;  4YHB A;  3J81 k;  3ONU A;  4P22 A;  2BM0 A;  2ZXI A;  5HZA A;  1WTH D;  3QFR A;  1ZM9 A;  3CCJ B;  2X6X A;  2X0K A;  2V7W A;  3OOC A;  1NRK A;  4Z1M A;  5IYP A;  2ZIT A;  5HXB A;  3VO1 A;  4Z4Z A;  3SKB A;  2X6W A;  4ZCI A;  3R6J A;  3G05 A;  5A88 A;  3WQZ A;  1KK1 A;  5B6I A;  5H59 A;  1OHH A;  1GVH A;  2Q6I A;  1Y0Y A;  3CPX A;  1EP3 B;  1NJI D;  1ELO A;  5IYW A;  4M0L A;  1QFZ A;  1F60 A;  3A3B A;  4Z4T A;  2VYQ A;  1GJR A;  2YWE A;  3AVU A;  1YIJ B;  3B8H A;  3BQJ A;  2R9V A;  3R6K A;  2V7X A;  1E64 A;  1EFT A;  2XZO A;  1HVX A;  4ZCM A;  1DG1 G;  1EFU A;  5KNL A;  1VQ4 B;  1GAQ A;  3MHP A;  1UD8 A;  4X7E A;  3JQP A;  2BGI A;  4FK8 A;  4M2L A;  2GK6 A;  1E62 A;  1SKY B;  2CRV A;  1KD1 D;  1GO2 A;  1N8R D;  2WSS A;  4TMV A;  3SLD A;  2VNI A;  2XEX A;  2WPD A;  2VBT A;  4B4D A;  4RD0 A;  1TTT A;  1UD4 A;  1QGA A;  1U2R A;  4KKU A;  1H8E A;  4ZCL A;  2P3M A;  3WBJ A;  4RD1 A;  4ZGN B;  5DS0 A;  1K73 D;  5H5J A;  3I55 B;  1XB2 A;  1VQP B;  3WYA A;  2OBS A;  3W5V A;  1QG0 A;  4RPD A;  2LZJ A;  4AC9 A;  1Q82 D;  1GR1 A;  1CNE A;  2YWG A;  2B7C A;  1BQE A;  2WZN A;  4R71 A;  2C78 A;  4QVJ A;  3WNB A;  3CXC B;  1YX2 A;  2CW5 A;  2OYN A;  1KK0 A;  2VZL A;  5HKK A;  1M1K D;  4XOR A;  4B3G A;  1KTV A;  1VLO A;  4G7X A;  1QGY A;  2PLF A;  1E3X A;  3QE2 A;  2QA4 B;  2DET A;  3GIR A;  4B3F X;  1BPL A;  5E6T A;  1VF7 A;  1TLL A;  3PA2 A;  1EWY A;  2ZXH A;  1Q9S A;  2BSA A;  3ES9 A;  1QFY A;  4FWT A;  4QHY A;  1W2B B;  3A35 A;  1T5E A;  5F4J A;  1EP2 B;  2QEX B;  4RD2 A;  5A89 A;  1YI2 B;  2BVN A;  2BMW A;  1KC8 D;  4B3X A;  4DNT B;  1IB0 A;  2PE3 A;  1WSV A;  4PAB A;  4XL9 A;  4P12 A;  2XZL A;  1FX0 A;  2QN6 A;  4MYT A;  4XKW A;  3CC7 B;  3KEW A;  3V7A A;  3CD6 B;  3A8K A;  4QFM A;  3BC9 A;  1WOP A;  2JIZ A;  1W9X A;  5KW9 A;  2Q6L A;  1G7C A;  4UZF A;  1UD5 A;  4M1K A;  1FNM A;  1VHE A;  5TV2 A;  4G7W A;  2V7Q A;  1I7P A;  2GK7 A;  3QFC A;  2ZL6 A;  3T56 B;  2C5B A;  4HIZ A;  2DCU A;  4P1V A;  3SJP A;  3H9N A;  2DYI A;  4OPO A;  1UMK A;  1QFJ A;  1DDG A;  4RM0 A;  4G1B A;  4XOT A;  4H9G A;  5EMN A;  4TMT A;  2V4D A;  4FN5 A;  2JDI A;  3Q38 A;  1JB9 A;  1F20 A;  1IJE A;  1N06 A;  1WDT A;  4Q7J B;  4TT3 A;  4X7C A;  1VQK B;  2DY1 A;  3CCM B;  5F4O A;  4AF7 A;  4G1V A;  2C5H A;  2GJK A;  3LVB A;  2ZBV A;  1VQ8 B;  1BX1 A;  4PAA A;  1OGI A;  2CND A;  3W5H A;  1P4M A;  3H94 A;  4AVZ A;  2D9R A;  4LC0 A;  1JJ2 B;  3OW2 B;  1BX0 A;  2NPF A;  2DOG A;  4X0C A;  3ZBT A;  4E0F A;  4F7D A;  5IYN A;  2RC5 A;  3Q39 A;  1EP1 B;  1WOS A;  4XLA A;  4XM3 A;  4YAL A;  3BNW A;  4X05 A;  1HZE A;  4B48 A;  4Z4V A;  4AF6 A;  2F43 A;  5CDF A;  4OPS A;  1R5N A;  1PJ7 A;  1VQO B;  1D1N A;  4ROX A;  4P26 A;  1NB0 A;  2BF4 A;  1VQ5 B;  4RPB A;  4WWV A;  2DEU A;  4OPV A;  2F4N A;  1BJK A;  4II2 A;  3OW7 A;  2XND A;  5DSZ A;  1DDI A;  2C4U A;  2V7T A;  1JNY A;  1VQ6 B;  2AHO A;  4RDJ A;  3WY9 A;  4YEJ A;  4N3N A;  4G6I A;  4ACA A;  5FNZ A;  3CME B;  4TSF A;  1I8D A;  1YJN B;  4P9S A;  3FKS A;  3W2F A;  3OKX A;  5BSY A;  2XGJ A;  3AVV A;  3A8I A;  2D74 A;  4TN1 A;  1OGJ A;  3AGQ A;  4XLH A;  2WR8 A;  1EFC A;  1Q81 D;  5IYQ A;  4NCN A;  1E43 A;  1V5V A;  2JJ1 A;  4XLE A;  5FO0 A;  3W2G A;  1UD3 A;  2QTL A;  2ZZG A;  4X7D A;  1DAR A;  1XFO A;  5GV7 A;  3W5U A;  1YJW B;  2OTL B;  4Z4U A;  1H8H A;  1TUI A;  2C77 A;  2VBV A;  3BCD A;  1VQL B;  1MAB A;  1H85 A;  2XNJ A;  4PC6 A;  1W35 A;  1J9Z A;  4YEL A;  2QDX A;  2XNC A;  4Z4Y A;  2VNJ A;  3G6E B;  1E63 A;  1S72 B;  1W87 A;  1V0F A;  3T51 B;  4EH1 A;  5TY0 A;  2ZL5 A;  3ZIA A;  1WSR A;  3CCS B;  1Q86 D;  3I1F A;  1ZM2 A;  4X8I A;  2D3N A;  2EIX A;  4RJL A;  5KSW B;  1QVF B;  1UD2 A;  4ASU A;  3OP1 A;  2W6I A;  3CTA A;  3VO2 A;  3OAA A;  3E20 A;  2NV4 A;  3HAG A;  2GJR A;  2FVG A;  2PMD A;  1KMH A;  3U6K A;  4YAU A;  3FPK A;  4P3I A;  4II3 A;  2V7V A;  1S4M A;  2Q6O A;  3MMP A;  2BPO A;  4YAW A;  2ZBU A;  2X53 S;  2DIE A;  4ZGQ B;  4XMY A;  1ZM4 A;  2VNH A;  1KZL A;  1IJF A;  1QH0 A;  3VNU A;  1AIP A;  3PUM A;  4XKV A;  3CP2 A;  4RLZ A;  1D8T A;  1OB2 A;  2QE7 A;  4WQM A;  2ZZE A;  4LBV A;  1N0V C;  1Q7Y D;  4P25 A;  1NDH A;  3VNV A;  1NB9 A;  3W2E A;  4RD3 A;  1K9M D;  1E3Z A;  2OBR A;  1S0U A;  5THX A;  2BM1 A;  1G7R A;  5IYR A;  1OB5 A;  1YJ9 B;  1EFR A;  3RY8 A;  2I1L A;  3P27 A;  4UZE A;  2ZTG A;  4LBY A;  2V31 A;  1E1Q A;  4TMX A;  2GQF A;  2QMU A;  3OEE A;  4X06 A;  4B44 A;  3OZU A;  4Z4S A;  2B7B A;  2WJV A;  1VHO A;  1YHQ B;  2ZL7 A;  1NBM A;  2VNK A;  4N3G A;  3WXM A;  2CK3 A;  2FX3 A;  2HCJ B;  4TKO B;  1N05 A;  1R5B A;  3PUN A;  4U9U A;  3FJO A;  4YAO A;  3PA1 A;  4DK1 A;  1WOO A;  1YIT B;  3GQB A;  3CMA B;  3OEH A;  5FO1 A;  3OJX A;  3LQE A;  3ISX A;  3CES A;  2VJJ A;  3GVJ A;  1FRN A;  3QSY A;  3WND A;  1G7T A;  5J35 A;  1MRZ A;  1KK2 A;  3T53 B;  2PIA A;  1VQM B;  5IK2 A;  4HE6 A;  1EXM A;  1RQP A;  2BGJ A;  2CF4 A;  2GPJ A;  2VJI A;  1BMF A;  2OK7 A;  4UAJ A;  1QGZ A;  1WOR A;  2QGG A;  1FNB A;  1GAW A;  1T6X A;  2C2W A;  2X6Y A;  4XN3 A;  3GSI A;  2RC6 A;  2YWF A;  3CCE B;  2XZP A;  4PC7 A;  4YXW A;  1H42 A;  2ZZQ A;  2EFG A;  4JMQ A;  3LNN A;  1N0U A;  3G4S B;  4QVA A;  1BLI A;  3GVL A;  1JA1 A;  2F1L A;  3ZZT A;  1W34 A;  4HE5 A;  1E79 A;  1B23 P;  3W2H A;  3Q6R A;  3CW2 A;  4DK0 A;  3OFN A;  3BH4 A;  3AVT A;  1A8P A;  1K8A D;  3WBK A;  1CNF A;  1FDR A;  3LQ6 A;  5HZB A;  1W0J A;  1RQR A;  4NNJ A;  4XQF A;  1WPC A;  3KL9 A;  2X8K A;  3ZBU A;  1SM4 A;  3ASS A;  3CCQ B;  3I56 B;  4XOP A;  2GJP A;  3BCF A;  1G7S A;  4P6Y A;  3SLN A;  2E1R A;  1FRQ A;  1HA3 A;  2HDN B;  3QFT A;  4UZU A;  2OBT A;  4WZT A;  5FL7 A;  2B5O A;  3AST A;  5L46 A;  5LMZ A;  1K28 D;  4RD4 A;  1Y0R A;  3Q6Q A;  1OB0 A;  3OPO A;  3D26 A;  4C43 A;  2Z6B D;  4PC3 A;  1WP6 A;  1XE1 A;  4P2N A;  4RCY A;  5AN9 A;  2ZTN A;  1QX4 A;  2BN4 A;  3MCA A;  4OOS A;  3DDY A;  1R5O A;  2V7U A;  3ONY A;  4B47 A;  4X07 A;  2M5S A;  3ZC3 A;  2DER A;  3AVX A;  4WZE A;  4PC2 A;  1T6Y A;  5A8A A;  3QFS A;  4DQL A;  1ZM3 A;  2JN9 A;  3V76 A;  3PVD A;  3A3G A;  1SKQ A;  4M53 A;  4CQJ A;  4RDL A;  1VQN B;  4YAF A;  2C4T A;  3FPP A;  3ZZ0 A;  4P3Y A;  2VBU A;  1FNC A;  4KKS A;  3CCV B;  4NBS A;  2X3U A;  2WYR A;  3CC2 B;  1FND A;  3U2Q A;  4MYU A;  4TMZ A;  3B78 A;  4QUZ A;  1B2R A;  5JBQ A;  4XON A;  1N08 A;  4G5G A;  2WZP P;  3CCR B;  3ZPN A;  2OTJ B;  4OOX A;  4ZV4 A;  2GRE A;  4RDK A;  3E1Y E;  1YLO A;  2KVO A;  3JU4 A;  4DNR B;  4Y9U A;  1N07 A;  3JQQ A;  4Y7C A;  2OK8 A;  4DQK A;  4P6V F;  4ACB A;  3P26 A;  1V0E A;  2JJ2 A;  5FIU A;  4J0Q A;  1KQS B;  4PC1 A;  2ZZF A;  4B43 A;  4Y9R A;  5FA6 A;  2QTZ A;  3WNC A;  3CMM A;  1AMO A;  1ZUN B;  3ZUG A;  1VJS A;  3CCU B;  3CPW B;  1IHM A;  3OZV A;  3CP8 A;  3G71 B;  2J7K A;  3ASR A;  4XNF A;  3AVY A;  2D3L A;  4IW3 B;  3ASP A;  2W6J A;  2YWH A;  5F4M A;  1UD6 A;  3JQR A;  3OZW A;  4XD7 A;  5TR9 A;  4BPR A;  4WZK A;  1KRH A;  3OJW A;  4X7F A;  2VBS A;  3LO8 A;  2CBX A; 
#chains in the Genus database with same CATH homology
 5FO0 A;  1N05 A;  1NB0 A;  3OP1 A;  1NB9 A;  3CTA A;  1N06 A;  5FO1 A;  2VBV A;  2VBT A;  5TRD A;  2VBU A;  5A8A A;  4UZF A;  3ZUG A;  2P3M A;  1Q9S A;  1MRZ A;  2I1L A;  5FNZ A;  1T6Z A;  4UZE A;  1P4M A;  1S4M A;  1N08 A;  2X0K A;  5A89 A;  3BNW A;  1T6X A;  2OYN A;  2VBS A;  1N07 A;  5A88 A;  1T6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...