5A88A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with adp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
147
Chain Sequence
RHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 31
structure length 147
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a88A00
1MRZA 2VBSA 2VBUA 3BNWA 1N06A 4UZFA 1P4MA 5A8AA 5FNZA 4UZEA 5A89A 1T6YA 1N05A 5FO1A 3ZUGA 5FO0A 1N08A 1NB0A 1T6XA 1T6ZA 1N07A 5A88A 2VBTA 2P3MA 2X0KA 1NB9A 1Q9SA 2I1LA 3CTAA 1S4MA 2VBVA 2OYNA 3OP1A 5TRDA
chains in the Genus database with same CATH superfamily
1V0EA 1W0JA 4B44A 1BQEA 1CQXA 1OGJA 4XLFA 3ZPNA 3ZBUA 2X6YA 3AGQA 4XMYA 1N06A 4FN5A 4Z4YA 4RPBA 1OB5A 1GAQA 1BJKA 3I55B 2BV3A 3H9NA 4P3IA 1G7CA 3CP2A 1U2RA 2LZJA 1XFOA 1H42A 2FVGA 3P26A 3ZIAA 3W5VA 1VQ4B 4MYTA 1E43A 1N07A 1T6ZA 4G1BA 4P1VA 3W5HA 4BPRA 2ZL5A 3Q39A 2X85A 1N8RD 2OBRA 2VNHA 3CTAA 3VMFA 5L46A 1UD2A 1YIJB 4YAWA 1VQKB 4P6YA 3W5UA 3RY8A 5TRDA 4DK0A 1H85A 2BPOA 2W6JA 4II2A 3GVLA 3CPXA 3OAAA 1RQPA 3BC9A 2ZBVA 4RDLA 2D3NA 4G7WA 4UZUA 2ZTNA 1NJID 1ZM3A 3OZUA 1QVGB 3SKBA 1HA3A 2XZPA 1DDGA 4ZCIA 5IYNA 3CCUB 2BN4A 1CNEA 1FNCA 2JJ1A 2ZXIA 1NB0A 5KSWB 2XNDA 4G7XA 2D9RA 3CC7B 1KK1A 3WNCA 1W35A 2FX3A 3A8IA 3AGPA 5CDFA 3MMPA 4ASUA 3CCJB 5AN9A 2C2WA 3VNUA 1EFCA 1VQLB 3G4SB 3PVDA 1FRQA 2ZITA 2VNJA 5DS0A 1KZLA 4II3A 3BH4A 4XNFA 1YX2A 5BSYA 1ZUNB 1VQNB 2QDXA 2ZZFA 4QVJA 1H8HA 4M1KA 1E62A 4RDKA 1VLOA 2X6WA 1S0UA 4FXUA 1WORA 3JQQA 3SLDA 1DDIA 1JA1A 1BX0A 1KK3A 3G6EB 3ASPA 3QFCA 4WZEA 3GVKA 1K9MD 1KMHA 5FO0A 2QEXB 1EFUA 4QUZA 1EP3B 3AVTA 3I1FA 1BPLA 3OOCA 4XOTA 2WZPP 4KKSA 1WTHD 5FIUA 3U2QA 1VQ5B 4X05A 1N0VC 4Z4VA 2WJYA 3CCLB 2BM1A 2CNDA 4F7DA 4AC9A 3FJOA 3WNDA 4NBSA 3ZBTA 4B47A 1EP1B 2YWGA 4TT3A 2OTJB 5IYQA 4L8JA 1XE1A 5FNZA 1VJSA 2F1LA 2D74A 5A89A 1CNFA 1ZM4A 3ZZUA 4X7CA 2ZBUA 1KTVA 3CCRB 3Q6RA 4Y9UA 3LQEA 1QUFA 2KVOA 1V0FA 1VQOB 2ZL7A 2DEUA 1W2BB 1JA0A 2BGJA 3PUMA 4RD2A 2BGIA 1D1NA 2GREA 1SKYB 3SJZA 4N3NA 3WYAA 3CMAB 4MYUA 4RDJA 2WZNA 4XKVA 4PC6A 4LBWA 3AVWA 5J35A 5TR9A 2VBSA 3CESA 1UD5A 2HDNB 3QE2A 1YJ9B 4RM0A 4XONA 1QG0A 1TUIA 1N05A 1FNDA 4K1XA 1PJ6A 2GJKA 5IYWA 2DOGA 1EFTA 1M90D 1F60A 4RCZA 3R6KA 3D26A 1GVHA 3CD6B 4M53A 4X8IA 5E6TA 2WSSA 1M1KD 4P22A 1EFRA 1E3ZA 2VZLA 1FDRA 4Z4TA 5KNLA 4C0SA 4ACBA 4ZCMA 4QHYA 4ZCLA 1K8AD 1NDHA 2QMUA 2ZZEA 1UD4A 1VHEA 4UAJA 1W87A 2QGGA 2VBUA 3GVJA 2CBXA 3NE5B 2VJIA 4AVZA 3CPWB 3T51B 1WPCA 1Q86D 2D3LA 3OJWA 1R5BA 2QTLA 1NRKA 2V4DA 3ES9A 1VQPB 2Z6BD 1YITB 2BMWA 1UMKA 1WSVA 4XQFA 4RD6A 1FX0A 3GSIA 2GK7A 5A88A 3WNBA 2P3MA 5F4JA 4RD4A 3W2EA 4DQLA 1TVCA 3AVVA 1KK2A 1QX4A 1I8DA 4XLAA 3BCFA 3JQRA 3CCQB 3T53B 1UD3A 3QFSA 2QA4B 1IB0A 5HXBA 1AIPA 1IJEA 4LBVA 3OZWA 2VJJA 4WQMA 4M2LA 2J7KA 3AVUA 4Z4RA 2YWHA 1Q81D 1R5NA 2ZZQA 3VNVA 1D8TA 1COWA 1ZM9A 3QSYA 2V7VA 4RD0A 2XZLA 1VQ7B 2F43A 5JBQA 3DDYA 1SKQA 4XL9A 4WWVA 3A35A 4YAOA 3B78A 4PC2A 1VQ9B 3HAGA 4G5GA 2CC2A 4WZKA 3A3GA 4LBZA 1GR1A 5A8AA 1WU8A 1BLIA 4QVAA 2BM0A 1T6YA 2Q6LA 3PENA 4YALA 4Z4UA 3OE7A 1KRHA 1QGAA 2ZZGA 4DNRB 1QFZA 2XNJA 1BX1A 3Q6QA 3OW2B 4TMXA 1OHHA 3FPPA 1F20A 3LO8A 3OJXA 3W2FA 1VHOA 4N3GA 4Z4ZA 2PMDA 3BY1A 1MABA 4OOVA 4ACAA 2I1LA 2GPJA 3CB4A 1IJFA 5THXA 2BF4A 1YI2B 4Z4SA 3VO1A 4PAAA 4XM3A 2V7XA 1ZM2A 4AF6A 4GQNA 3CW2A 1Q7YD 4YELA 1VQ6B 2GJRA 3WBKA 4P26A 4RLZA 4FK8A 3T56B 2HLDA 4XKWA 1AMOA 4DNTB 4U9UA 3CMMA 3WXMA 2V31A 1Q82D 2BSAA 2C5HA 2GQFA 2WR8A 1T6XA 4P6VF 2VYQA 1H8EA 4PC3A 5F4MA 2X0KA 1E1QA 3A8KA 4X7DA 1Q9SA 1OGIA 1GO2A 3B82A 2VBVA 3WY9A 4TMWA 1KD1D 1EXMA 4TN1A 1W9XA 3BY2A 2Q6IA 3CCEB 5BSXA 1S72B 2QN6A 4YAUA 2DIEA 2ZXHA 2EFGA 4J0QA 1FNMA 4ROXA 5TY0A 3MHPA 1FNBA 2V7QA 2V7TA 1I7PA 2OK7A 4OOXA 3OFNA 4YEJA 5FO1A 1WDTA 1WOSA 5DN6A 4B43A 5HZBA 1Y0RA 2B5OA 4QV2A 4P9SA 2Q6KA 5KW9A 2V7WA 1YLOA 2XOKA 2C5BA 2VBTA 1WOPA 2VNIA 4PC1A 4NNJA 1NB9A 1W0KA 5HZAA 4WZTA 3SEJA 3WQZA 4M4SA 3U6BA 1HVXA 1SM4A 2JIZA 2X53S 4ZV4A 4X7FA 3BNWA 1VLYA 3CCMB 1WSRA 3Q38A 4UZFA 1JJ2B 3CC4B 2DCUA 4LC0A 4KKTA 1EP2B 4B4DA 1E64A 3A1PA 1VQMB 2OK8A 2JN9A 2PE3A 2DYIA 4XLEA 4P3YA 2WPDA 1G7TA 2PLFA 4B3FX 2OBTA 1QGYA 3PUNA 2R9VA 3ASRA 2C77A 2XZOA 3E1YE 2EIXA 4P12A 4Z4WA 4XLHA 4ZGNB 1S4MA 3B8HA 4P2NA 4HE5A 1PJ5A 1K28D 3ONUA 3JQPA 4NCNA 3VR6A 3WBJA 3PA1A 1MRZA 1YJNB 1OB2A 1PKVA 2RC5A 2XNCA 1QVFB 3AVXA 4YHBA 4OOSA 2B7BA 4ZGQB 2Q6OA 1RQRA 4XOPA 3V7AA 3ONYA 4G1VA 1XQBA 2XGJA 5H5JA 1FRNA 4CQJA 3J81k 5HKKA 2NPFA 1KC8D 3GQBA 3ASTA 1TLLA 4DQKA 1XB2A 3CCVB 2BVNA 3ASQA 3ISXA 4TMVA 5FL7A 1E79A 4RD3A 4RCYA 5F4OA 5IYPA 1QGZA 4TSFA 4QFMA 1BMFA 2GJPA 3OP1A 1A8PA 4H9GA 1IHMA 1R5OA 2HCJB 2QTZA 4E0FA 1KK0A 1OB0A 2M5SA 3W2IA 2GK6A 3JU4A 4XN0A 4X06A 1QUEA 2R6HA 4XN3A 3V76A 4OPVA 4G6IA 4C43A 2DY1A 5IYRA 4B3GA 1G7SA 4X0CA 4XR6A 4AF7A 1ELOA 1N08A 4Y9RA 1E3XA 2CF4A 4Z1MA 3OZVA 4TMZA 1YHQB 3G05A 2CRVA 5B6IA 4LBYA 3OW7A 3PA2A 3U6KA 5DSZA 3I56B 2DERA 3KL9A 4HIZA 3R6JA 1V5VA 3SJPA 2E1BA 4OPOA 3CCSB 3QFRA 2YWFA 3OEEA 1TTTA 1JNYA 1QFYA 1B23P 4RPDA 4XORA 4X07A 1Y0YA 3CMEB 4P25A 1J9ZA 1NBMA 2X8KA 4UZEA 1B2RA 3E20A 2RC6A 3P27A 1VF7A 1JB9A 2OTLB 4YAFA 5J3OA 1DARA 2B7CA 4IW3B 4XLCA 1D2EA 5GV7A 4XD7A 3LVBA 2WYRA 1EWYA 2V7UA 2X6XA 2OBSA 4YXWA 2C4TA 1VQ8B 1I18A 3Q3AA 3ZZTA 3QFTA 1WOOA 2HMAA 4KKUA 3W2HA 3MCAA 2OYNA 1QFJA 2F1MA 1G7RA 4DK1A 4RD1A 5H59A 1UD8A 2F4NA 1N0UA 1QH0A 3A8JA 3OKXA 4OP7A 4PC7A 1E63A 3KEWA 2X3UA 1E1RA 4B3XA 2JJ2A 1KQSB 3ZUGA 1WP6A 1GJRA 2CK3A 4TKOB 3A3BA 3BQJA 3ZC3A 3H94A 4FWTA 4JMQA 4M0LA 1K73D 5TV2A 3VO2A 5GV8A 3SLNA 2YWEA 4PABA 2WJVA 2E1RA 2C78A 3ASSA 2VNKA 2ZL6A 3FPKA 3CXCB 3GIRA 5FA6A 2XEXA 3LNNA 2JDIA 3FKSA 4WZLA 4HE6A 5EMNA 4Y7CA 4TMTA 5LMZA 1DG1G 1P4MA 1YJWB 1T5EA 2PIAA 3W2GA 3ZZ0A 1HZEA 5IK2A 4EH1A 3OEHA 1UD6A 4RJLA 4X7EA 3CRZA 3G71B 2W6IA 4OPSA 1W34A 1GAWA 3CP8A 4R71A 2ZTGA 4PGOA 4B48A 2AHOA 2CW5A 3LQ6A 1PJ7A 2C4UA 4Q7JB 1KJZA 2DETA 3OPOA 3AVYA 2NV4A 2QE7A 3CC2B 3BCDA
chains in the Genus database with same CATH topology
1MRZA 2VBSA 2VBUA 3BNWA 1N06A 4UZFA 1P4MA 5A8AA 5FNZA 4UZEA 5A89A 1T6YA 1N05A 5FO1A 3ZUGA 5FO0A 1N08A 1NB0A 1T6XA 1T6ZA 1N07A 5A88A 2VBTA 2P3MA 2X0KA 1NB9A 1Q9SA 2I1LA 3CTAA 1S4MA 2VBVA 2OYNA 3OP1A 5TRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MRZ A;  2VBS A;  2VBU A;  3BNW A;  1N06 A;  4UZF A;  1P4M A;  5A8A A;  5FNZ A;  4UZE A;  5A89 A;  1T6Y A;  1N05 A;  5FO1 A;  3ZUG A;  5FO0 A;  1N08 A;  1NB0 A;  1T6X A;  1T6Z A;  1N07 A;  5A88 A;  2VBT A;  2P3M A;  2X0K A;  1NB9 A;  1Q9S A;  2I1L A;  3CTA A;  1S4M A;  2VBV A;  2OYN A;  3OP1 A;  5TRD A; 
#chains in the Genus database with same CATH topology
 1V0E A;  1W0J A;  4B44 A;  1BQE A;  1CQX A;  1OGJ A;  4XLF A;  3ZPN A;  3ZBU A;  2X6Y A;  3AGQ A;  4XMY A;  1N06 A;  4FN5 A;  4Z4Y A;  4RPB A;  1OB5 A;  1GAQ A;  1BJK A;  3I55 B;  2BV3 A;  3H9N A;  4P3I A;  1G7C A;  3CP2 A;  1U2R A;  2LZJ A;  1XFO A;  1H42 A;  2FVG A;  3P26 A;  3ZIA A;  3W5V A;  1VQ4 B;  4MYT A;  1E43 A;  1N07 A;  1T6Z A;  4G1B A;  4P1V A;  3W5H A;  4BPR A;  2ZL5 A;  3Q39 A;  2X85 A;  1N8R D;  2OBR A;  2VNH A;  3CTA A;  3VMF A;  5L46 A;  1UD2 A;  1YIJ B;  4YAW A;  1VQK B;  4P6Y A;  3W5U A;  3RY8 A;  5TRD A;  4DK0 A;  1H85 A;  2BPO A;  2W6J A;  4II2 A;  3GVL A;  3CPX A;  3OAA A;  1RQP A;  3BC9 A;  2ZBV A;  4RDL A;  2D3N A;  4G7W A;  4UZU A;  2ZTN A;  1NJI D;  1ZM3 A;  3OZU A;  1QVG B;  3SKB A;  1HA3 A;  2XZP A;  1DDG A;  4ZCI A;  5IYN A;  3CCU B;  2BN4 A;  1CNE A;  1FNC A;  2JJ1 A;  2ZXI A;  1NB0 A;  5KSW B;  2XND A;  4G7X A;  2D9R A;  3CC7 B;  1KK1 A;  3WNC A;  1W35 A;  2FX3 A;  3A8I A;  3AGP A;  5CDF A;  3MMP A;  4ASU A;  3CCJ B;  5AN9 A;  2C2W A;  3VNU A;  1EFC A;  1VQL B;  3G4S B;  3PVD A;  1FRQ A;  2ZIT A;  2VNJ A;  5DS0 A;  1KZL A;  4II3 A;  3BH4 A;  4XNF A;  1YX2 A;  5BSY A;  1ZUN B;  1VQN B;  2QDX A;  2ZZF A;  4QVJ A;  1H8H A;  4M1K A;  1E62 A;  4RDK A;  1VLO A;  2X6W A;  1S0U A;  4FXU A;  1WOR A;  3JQQ A;  3SLD A;  1DDI A;  1JA1 A;  1BX0 A;  1KK3 A;  3G6E B;  3ASP A;  3QFC A;  4WZE A;  3GVK A;  1K9M D;  1KMH A;  5FO0 A;  2QEX B;  1EFU A;  4QUZ A;  1EP3 B;  3AVT A;  3I1F A;  1BPL A;  3OOC A;  4XOT A;  2WZP P;  4KKS A;  1WTH D;  5FIU A;  3U2Q A;  1VQ5 B;  4X05 A;  1N0V C;  4Z4V A;  2WJY A;  3CCL B;  2BM1 A;  2CND A;  4F7D A;  4AC9 A;  3FJO A;  3WND A;  4NBS A;  3ZBT A;  4B47 A;  1EP1 B;  2YWG A;  4TT3 A;  2OTJ B;  5IYQ A;  4L8J A;  1XE1 A;  5FNZ A;  1VJS A;  2F1L A;  2D74 A;  5A89 A;  1CNF A;  1ZM4 A;  3ZZU A;  4X7C A;  2ZBU A;  1KTV A;  3CCR B;  3Q6R A;  4Y9U A;  3LQE A;  1QUF A;  2KVO A;  1V0F A;  1VQO B;  2ZL7 A;  2DEU A;  1W2B B;  1JA0 A;  2BGJ A;  3PUM A;  4RD2 A;  2BGI A;  1D1N A;  2GRE A;  1SKY B;  3SJZ A;  4N3N A;  3WYA A;  3CMA B;  4MYU A;  4RDJ A;  2WZN A;  4XKV A;  4PC6 A;  4LBW A;  3AVW A;  5J35 A;  5TR9 A;  2VBS A;  3CES A;  1UD5 A;  2HDN B;  3QE2 A;  1YJ9 B;  4RM0 A;  4XON A;  1QG0 A;  1TUI A;  1N05 A;  1FND A;  4K1X A;  1PJ6 A;  2GJK A;  5IYW A;  2DOG A;  1EFT A;  1M90 D;  1F60 A;  4RCZ A;  3R6K A;  3D26 A;  1GVH A;  3CD6 B;  4M53 A;  4X8I A;  5E6T A;  2WSS A;  1M1K D;  4P22 A;  1EFR A;  1E3Z A;  2VZL A;  1FDR A;  4Z4T A;  5KNL A;  4C0S A;  4ACB A;  4ZCM A;  4QHY A;  4ZCL A;  1K8A D;  1NDH A;  2QMU A;  2ZZE A;  1UD4 A;  1VHE A;  4UAJ A;  1W87 A;  2QGG A;  2VBU A;  3GVJ A;  2CBX A;  3NE5 B;  2VJI A;  4AVZ A;  3CPW B;  3T51 B;  1WPC A;  1Q86 D;  2D3L A;  3OJW A;  1R5B A;  2QTL A;  1NRK A;  2V4D A;  3ES9 A;  1VQP B;  2Z6B D;  1YIT B;  2BMW A;  1UMK A;  1WSV A;  4XQF A;  4RD6 A;  1FX0 A;  3GSI A;  2GK7 A;  5A88 A;  3WNB A;  2P3M A;  5F4J A;  4RD4 A;  3W2E A;  4DQL A;  1TVC A;  3AVV A;  1KK2 A;  1QX4 A;  1I8D A;  4XLA A;  3BCF A;  3JQR A;  3CCQ B;  3T53 B;  1UD3 A;  3QFS A;  2QA4 B;  1IB0 A;  5HXB A;  1AIP A;  1IJE A;  4LBV A;  3OZW A;  2VJJ A;  4WQM A;  4M2L A;  2J7K A;  3AVU A;  4Z4R A;  2YWH A;  1Q81 D;  1R5N A;  2ZZQ A;  3VNV A;  1D8T A;  1COW A;  1ZM9 A;  3QSY A;  2V7V A;  4RD0 A;  2XZL A;  1VQ7 B;  2F43 A;  5JBQ A;  3DDY A;  1SKQ A;  4XL9 A;  4WWV A;  3A35 A;  4YAO A;  3B78 A;  4PC2 A;  1VQ9 B;  3HAG A;  4G5G A;  2CC2 A;  4WZK A;  3A3G A;  4LBZ A;  1GR1 A;  5A8A A;  1WU8 A;  1BLI A;  4QVA A;  2BM0 A;  1T6Y A;  2Q6L A;  3PEN A;  4YAL A;  4Z4U A;  3OE7 A;  1KRH A;  1QGA A;  2ZZG A;  4DNR B;  1QFZ A;  2XNJ A;  1BX1 A;  3Q6Q A;  3OW2 B;  4TMX A;  1OHH A;  3FPP A;  1F20 A;  3LO8 A;  3OJX A;  3W2F A;  1VHO A;  4N3G A;  4Z4Z A;  2PMD A;  3BY1 A;  1MAB A;  4OOV A;  4ACA A;  2I1L A;  2GPJ A;  3CB4 A;  1IJF A;  5THX A;  2BF4 A;  1YI2 B;  4Z4S A;  3VO1 A;  4PAA A;  4XM3 A;  2V7X A;  1ZM2 A;  4AF6 A;  4GQN A;  3CW2 A;  1Q7Y D;  4YEL A;  1VQ6 B;  2GJR A;  3WBK A;  4P26 A;  4RLZ A;  4FK8 A;  3T56 B;  2HLD A;  4XKW A;  1AMO A;  4DNT B;  4U9U A;  3CMM A;  3WXM A;  2V31 A;  1Q82 D;  2BSA A;  2C5H A;  2GQF A;  2WR8 A;  1T6X A;  4P6V F;  2VYQ A;  1H8E A;  4PC3 A;  5F4M A;  2X0K A;  1E1Q A;  3A8K A;  4X7D A;  1Q9S A;  1OGI A;  1GO2 A;  3B82 A;  2VBV A;  3WY9 A;  4TMW A;  1KD1 D;  1EXM A;  4TN1 A;  1W9X A;  3BY2 A;  2Q6I A;  3CCE B;  5BSX A;  1S72 B;  2QN6 A;  4YAU A;  2DIE A;  2ZXH A;  2EFG A;  4J0Q A;  1FNM A;  4ROX A;  5TY0 A;  3MHP A;  1FNB A;  2V7Q A;  2V7T A;  1I7P A;  2OK7 A;  4OOX A;  3OFN A;  4YEJ A;  5FO1 A;  1WDT A;  1WOS A;  5DN6 A;  4B43 A;  5HZB A;  1Y0R A;  2B5O A;  4QV2 A;  4P9S A;  2Q6K A;  5KW9 A;  2V7W A;  1YLO A;  2XOK A;  2C5B A;  2VBT A;  1WOP A;  2VNI A;  4PC1 A;  4NNJ A;  1NB9 A;  1W0K A;  5HZA A;  4WZT A;  3SEJ A;  3WQZ A;  4M4S A;  3U6B A;  1HVX A;  1SM4 A;  2JIZ A;  2X53 S;  4ZV4 A;  4X7F A;  3BNW A;  1VLY A;  3CCM B;  1WSR A;  3Q38 A;  4UZF A;  1JJ2 B;  3CC4 B;  2DCU A;  4LC0 A;  4KKT A;  1EP2 B;  4B4D A;  1E64 A;  3A1P A;  1VQM B;  2OK8 A;  2JN9 A;  2PE3 A;  2DYI A;  4XLE A;  4P3Y A;  2WPD A;  1G7T A;  2PLF A;  4B3F X;  2OBT A;  1QGY A;  3PUN A;  2R9V A;  3ASR A;  2C77 A;  2XZO A;  3E1Y E;  2EIX A;  4P12 A;  4Z4W A;  4XLH A;  4ZGN B;  1S4M A;  3B8H A;  4P2N A;  4HE5 A;  1PJ5 A;  1K28 D;  3ONU A;  3JQP A;  4NCN A;  3VR6 A;  3WBJ A;  3PA1 A;  1MRZ A;  1YJN B;  1OB2 A;  1PKV A;  2RC5 A;  2XNC A;  1QVF B;  3AVX A;  4YHB A;  4OOS A;  2B7B A;  4ZGQ B;  2Q6O A;  1RQR A;  4XOP A;  3V7A A;  3ONY A;  4G1V A;  1XQB A;  2XGJ A;  5H5J A;  1FRN A;  4CQJ A;  3J81 k;  5HKK A;  2NPF A;  1KC8 D;  3GQB A;  3AST A;  1TLL A;  4DQK A;  1XB2 A;  3CCV B;  2BVN A;  3ASQ A;  3ISX A;  4TMV A;  5FL7 A;  1E79 A;  4RD3 A;  4RCY A;  5F4O A;  5IYP A;  1QGZ A;  4TSF A;  4QFM A;  1BMF A;  2GJP A;  3OP1 A;  1A8P A;  4H9G A;  1IHM A;  1R5O A;  2HCJ B;  2QTZ A;  4E0F A;  1KK0 A;  1OB0 A;  2M5S A;  3W2I A;  2GK6 A;  3JU4 A;  4XN0 A;  4X06 A;  1QUE A;  2R6H A;  4XN3 A;  3V76 A;  4OPV A;  4G6I A;  4C43 A;  2DY1 A;  5IYR A;  4B3G A;  1G7S A;  4X0C A;  4XR6 A;  4AF7 A;  1ELO A;  1N08 A;  4Y9R A;  1E3X A;  2CF4 A;  4Z1M A;  3OZV A;  4TMZ A;  1YHQ B;  3G05 A;  2CRV A;  5B6I A;  4LBY A;  3OW7 A;  3PA2 A;  3U6K A;  5DSZ A;  3I56 B;  2DER A;  3KL9 A;  4HIZ A;  3R6J A;  1V5V A;  3SJP A;  2E1B A;  4OPO A;  3CCS B;  3QFR A;  2YWF A;  3OEE A;  1TTT A;  1JNY A;  1QFY A;  1B23 P;  4RPD A;  4XOR A;  4X07 A;  1Y0Y A;  3CME B;  4P25 A;  1J9Z A;  1NBM A;  2X8K A;  4UZE A;  1B2R A;  3E20 A;  2RC6 A;  3P27 A;  1VF7 A;  1JB9 A;  2OTL B;  4YAF A;  5J3O A;  1DAR A;  2B7C A;  4IW3 B;  4XLC A;  1D2E A;  5GV7 A;  4XD7 A;  3LVB A;  2WYR A;  1EWY A;  2V7U A;  2X6X A;  2OBS A;  4YXW A;  2C4T A;  1VQ8 B;  1I18 A;  3Q3A A;  3ZZT A;  3QFT A;  1WOO A;  2HMA A;  4KKU A;  3W2H A;  3MCA A;  2OYN A;  1QFJ A;  2F1M A;  1G7R A;  4DK1 A;  4RD1 A;  5H59 A;  1UD8 A;  2F4N A;  1N0U A;  1QH0 A;  3A8J A;  3OKX A;  4OP7 A;  4PC7 A;  1E63 A;  3KEW A;  2X3U A;  1E1R A;  4B3X A;  2JJ2 A;  1KQS B;  3ZUG A;  1WP6 A;  1GJR A;  2CK3 A;  4TKO B;  3A3B A;  3BQJ A;  3ZC3 A;  3H94 A;  4FWT A;  4JMQ A;  4M0L A;  1K73 D;  5TV2 A;  3VO2 A;  5GV8 A;  3SLN A;  2YWE A;  4PAB A;  2WJV A;  2E1R A;  2C78 A;  3ASS A;  2VNK A;  2ZL6 A;  3FPK A;  3CXC B;  3GIR A;  5FA6 A;  2XEX A;  3LNN A;  2JDI A;  3FKS A;  4WZL A;  4HE6 A;  5EMN A;  4Y7C A;  4TMT A;  5LMZ A;  1DG1 G;  1P4M A;  1YJW B;  1T5E A;  2PIA A;  3W2G A;  3ZZ0 A;  1HZE A;  5IK2 A;  4EH1 A;  3OEH A;  1UD6 A;  4RJL A;  4X7E A;  3CRZ A;  3G71 B;  2W6I A;  4OPS A;  1W34 A;  1GAW A;  3CP8 A;  4R71 A;  2ZTG A;  4PGO A;  4B48 A;  2AHO A;  2CW5 A;  3LQ6 A;  1PJ7 A;  2C4U A;  4Q7J B;  1KJZ A;  2DET A;  3OPO A;  3AVY A;  2NV4 A;  2QE7 A;  3CC2 B;  3BCD A; 
#chains in the Genus database with same CATH homology
 1MRZ A;  2VBS A;  2VBU A;  3BNW A;  1N06 A;  4UZF A;  1P4M A;  5A8A A;  5FNZ A;  4UZE A;  5A89 A;  1T6Y A;  1N05 A;  5FO1 A;  3ZUG A;  5FO0 A;  1N08 A;  1NB0 A;  1T6X A;  1T6Z A;  1N07 A;  5A88 A;  2VBT A;  2P3M A;  2X0K A;  1NB9 A;  1Q9S A;  2I1L A;  3CTA A;  1S4M A;  2VBV A;  2OYN A;  3OP1 A;  5TRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...