5A88A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with adp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
147
Chain Sequence
b'RHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
molecule tags Transferase
source organism Corynebacterium ammoniagenes
publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
total genus 31
structure length 147
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a88A00
1MRZA 1Q9SA 4UZFA 2VBVA 1S4MA 5A8AA 5A89A 3BNWA 1N07A 2P3MA 1N05A 3CTAA 3ZUGA 1NB0A 1N08A 1T6YA 2OYNA 2I1LA 1T6XA 2VBSA 1N06A 5FNZA 2VBUA 5A88A 5FO1A 1NB9A 2VBTA 3OP1A 1P4MA 5TRDA 2X0KA 1T6ZA 4UZEA 5FO0A
chains in the Genus database with same CATH superfamily
3W2IA 1Y0RA 3Q3AA 2Q6OA 1AIPA 4M1KA 1UMKA 2C4TA 5FL7A 3SJPA 3OJWA 4X7DA 4PAAA 2ZTGA 3VNUA 4PABA 1EP2B 4WWVA 4G7WA 4Y9RA 2NPFA 2LZJA 3G6EB 2QN6A 4OPOA 2C5HA 2F43A 3CPXA 1T6XA 3OW7A 2X6WA 2F4NA 3JU4A 1FNMA 1QH0A 3W5VA 3OP1A 1GR1A 1XQBA 2F1MA 3Q39A 4BPRA 4C43A 4B3GA 3MMPA 3HAGA 4RJLA 1KRHA 2D9RA 3PENA 5CDFA 1TUIA 2HDNB 1UD4A 4TT3A 1NRKA 1E79A 3QFSA 1G7SA 1KK2A 4M0LA 2BPOA 4YAFA 1J9ZA 4P1VA 2ZXHA 4QV2A 4XLFA 1NJID 4NNJA 3QFCA 4YALA 1T6YA 1ZM4A 5BSXA 2OYNA 2I1LA 2BVNA 1ZM2A 3Q6QA 2B7CA 2QTLA 4M2LA 1YJWB 4XN3A 4Z4YA 1KJZA 4II2A 1WOOA 4TMTA 1GVHA 2Z6BD 3CRZA 4PC1A 2EIXA 2WYRA 2DOGA 3LQEA 5IYWA 3PA1A 1I7PA 1N0UA 3PA2A 4L8JA 4E0FA 4ZCIA 1NDHA 1Q9SA 4ZV4A 3CCEB 2WJVA 4XN0A 3A1PA 2ZZQA 4KKUA 2P3MA 4ZCLA 4N3NA 2V7UA 2JJ2A 4B3XA 4KKSA 4Z4TA 4YAWA 1YJNB 1JB9A 1YIJB 1ZUNB 5DS0A 2XZLA 1WP6A 1N08A 1JJ2B 3WY9A 3VNVA 3GVLA 1M90D 1S0UA 3R6JA 5KW9A 1UD2A 4Z4UA 2HMAA 3P27A 4RCZA 1VLOA 4EH1A 2BF4A 1PJ6A 5TR9A 4DNRB 3OJXA 4XQFA 4P12A 3H94A 4ZGNB 1MRZA 1G7TA 5BSYA 5KSWB 3OAAA 3A8KA 1VQLB 1KK0A 5IYNA 1W0JA 4AF6A 1FNCA 4DK0A 1IJEA 2ZZEA 3D26A 1M1KD 3R6KA 2XOKA 2VYQA 4RLZA 2GJPA 3MCAA 4RD2A 1N8RD 1AMOA 2ZL6A 2RC6A 4X05A 3V76A 2QDXA 2OBTA 1BX1A 1VQPB 1T6ZA 4M4SA 4FN5A 4QUZA 1HZEA 3MHPA 1DDGA 4TMXA 1Y0YA 1QUEA 3W2EA 1E64A 1W9XA 2M5SA 1KK3A 1DARA 2Q6KA 3CCUB 2BMWA 4RD6A 4Z4RA 1Q82D 4WZLA 1W2BB 3FJOA 5EMNA 1QUFA 3B78A 3FKSA 2XGJA 2DCUA 1TVCA 1WORA 4Y9UA 2DIEA 2VBSA 1V5VA 2CRVA 3ISXA 2GK7A 3PUMA 1E3XA 3ZZ0A 4XD7A 4P26A 4XKWA 4P3IA 3CD6B 1GJRA 4Z4VA 5IYQA 4XL9A 3GVJA 3CXCB 1K28D 4G5GA 1QX4A 3ASSA 4FXUA 4RDLA 1KD1D 3CCSB 1CNFA 3WBKA 3AGQA 3WNBA 2X6XA 2PLFA 3AVVA 2BN4A 2YWHA 1A8PA 1UD5A 1QFYA 2GREA 3BNWA 3OZWA 4YELA 2JJ1A 3CPWB 1WDTA 1QVFB 1H42A 4XM3A 1RQPA 3ZPNA 3ES9A 2ZTNA 3OZUA 4XONA 1VQ8B 1FRNA 3SKBA 2QTZA 3CC4B 3CCQB 3G05A 2WZNA 4RPDA 2X6YA 3AVUA 3T53B 1E63A 4WZTA 4GQNA 2DERA 1UD6A 5F4JA 4DQKA 1FNBA 2BGIA 4LBVA 1VQ5B 2VJJA 3I56B 1ELOA 1PJ5A 5GV8A 2B5OA 4HE6A 3BY1A 4PC3A 3OFNA 1XB2A 1N07A 1UD3A 4FK8A 1QFJA 2X53S 4B48A 1BQEA 4QVAA 4RD1A 1I18A 4RPBA 4LBZA 1Q7YD 4PC6A 2EFGA 2WR8A 4LBWA 4LBYA 1B23P 4H9GA 1TLLA 3AVWA 1NBMA 4RDJA 1Q81D 2VBUA 3W5HA 3CC2B 4NBSA 5FO1A 4AC9A 3E20A 2W6IA 3AGPA 1G7CA 4LC0A 3J81k 2E1RA 4X8IA 1QVGB 4P6YA 1V0FA 1HA3A 3AVTA 3A3GA 2PMDA 3JQRA 4DK1A 2OTLB 1OGJA 2BM1A 3CCVB 2D74A 4M53A 2XNDA 1VJSA 1FNDA 3ASTA 2JDIA 3G71B 3U6BA 2BV3A 3P26A 2ZBVA 1TTTA 4WZEA 3BY2A 1QGZA 5FNZA 3AVYA 4Z4ZA 1YJ9B 2PIAA 4U9UA 3SLDA 4Z4SA 3CC7B 2CBXA 3OZVA 3ASQA 2VBTA 3WNDA 3T56B 4G1VA 1VLYA 1WOSA 4RCYA 2CC2A 3AVXA 4R71A 1E1RA 5FO0A 1N0VC 3RY8A 1S4MA 3WNCA 1G7RA 2WZPP 3JQQA 4WZKA 1BJKA 2R9VA 2QA4B 1BPLA 3Q6RA 2QE7A 1SKYB 4XR6A 2V7VA 3VO1A 4G6IA 2ZITA 5L46A 4P2NA 4II3A 5GV7A 1VQKB 3ZIAA 2V7WA 2F1LA 1VF7A 3LO8A 5A88A 2OK8A 2J7KA 1IB0A 4HIZA 3QSYA 1YX2A 4TSFA 1P4MA 1XE1A 4J0QA 3W5UA 1EXMA 3E1YE 1EP1B 4UZEA 1H8EA 2GK6A 2D3LA 1FX0A 2C5BA 1MABA 2XNJA 1QG0A 3CESA 3BH4A 3GIRA 5HKKA 1YHQB 2RC5A 4HE5A 4YXWA 2ZL5A 4JMQA 5DSZA 4OOVA 2OTJB 1ZM9A 4OPSA 2ZZGA 4B44A 3LVBA 2AHOA 2VZLA 2ZZFA 3VMFA 1KMHA 2XEXA 3OOCA 2VNJA 4P25A 2VJIA 3WQZA 3WYAA 5B6IA 1H85A 3G4SB 4RD0A 1E62A 1KZLA 1YI2B 3PUNA 4MYTA 3QE2A 5FA6A 1KQSB 4ZGQB 2VNIA 3JQPA 2X0KA 1VQMB 2QMUA 3WBJA 1EFTA 1QGYA 1OB0A 2Q6IA 3ZBTA 1PJ7A 2VBVA 3ZBUA 1R5OA 1WSRA 4XOTA 2VNHA 2XNCA 3DDYA 3ZUGA 4KKTA 3V7AA 2GQFA 3GVKA 2V4DA 4Z1MA 1EWYA 1OB2A 4YEJA 1N06A 2WPDA 4OOSA 2W6JA 3W2FA 3OE7A 4F7DA 2NV4A 2CF4A 2XZPA 2YWGA 3OPOA 5F4MA 1YITB 1OHHA 1DG1G 3FPKA 1V0EA 1U2RA 3CMMA 4XLCA 1PKVA 5HZAA 2C77A 4AVZA 4P9SA 4XLHA 2C78A 4ZCMA 1ZM3A 4P6VF 4YHBA 5A89A 4QVJA 4UAJA 3CCMB 1WOPA 2QGGA 4QHYA 1NB0A 2D3NA 2C4UA 3BC9A 1EFUA 1COWA 3ZZTA 4WQMA 5H5JA 2HCJB 2V7XA 1F20A 1GO2A 3ZC3A 3A3BA 4K1XA 2CK3A 2BM0A 2ZL7A 2B7BA 2BSAA 3Q38A 5F4OA 1RQRA 2GJRA 3CCRB 4ROXA 4DNTB 1KC8D 4XNFA 3OEHA 4OOXA 2KVOA 3QFTA 2QEXB 5TRDA 4X07A 1SM4A 5DN6A 1GAWA 1S72B 3OKXA 2CW5A 1IJFA 4PC7A 2DEUA 3T51B 1W34A 2V7QA 4RDKA 2WSSA 3A35A 3I1FA 5A8AA 4OPVA 3KL9A 3SJZA 1QFZA 3GQBA 4ACAA 1Q86D 1BX0A 4G7XA 1WTHD 4B47A 4RD4A 4PGOA 1K73D 2FX3A 2WJYA 2YWEA 2CNDA 4XKVA 1FDRA 5IK2A 1CNEA 1F60A 3LNNA 3SLNA 3CCLB 3BCDA 4TMVA 1EP3B 1VHEA 4X06A 3LQ6A 4TN1A 5J35A 4Z4WA 5J3OA 4TMZA 3I55B 3CCJB 1BMFA 1E1QA 4AF7A 3BQJA 2C2WA 2OK7A 2ZBUA 2JN9A 3GSIA 1D2EA 1UD8A 4C0SA 3CP8A 3NE5B 2DETA 5THXA 5H59A 5KNLA 2V31A 1T5EA 5AN9A 1GAQA 4FWTA 3CTAA 3B8HA 4UZUA 1VQ6B 3WXMA 1W87A 1R5BA 2FVGA 5E6TA 3VO2A 1D1NA 5TV2A 4ACBA 1QGAA 1H8HA 2VNKA 3W2GA 2X3UA 3FPPA 1CQXA 4MYUA 1K8AD 3ZZUA 4P22A 4B4DA 3QFRA 3OW2B 1SKQA 4RD3A 4XLAA 3CB4A 4CQJA 4Y7CA 4P3YA 3ONUA 2GPJA 5HXBA 1R5NA 1OGIA 2R6HA 2DY1A 3CW2A 1W0KA 3U2QA 5IYRA 1E3ZA 1JNYA 3A8JA 1N05A 4XORA 3B82A 1JA0A 5FIUA 1DDIA 2XZOA 4IW3B 1WPCA 4XOPA 1VQ7B 4X7EA 4TKOB 4B43A 5HZBA 4YAUA 4X7CA 3ASRA 4YAOA 4X7FA 1VQ9B 4XLEA 4ASUA 4TMWA 2E1BA 5IYPA 2BGJA 3A8IA 5JBQA 3CMAB 1K9MD 4QFMA 3U6KA 3CMEB 3SEJA 2PE3A 2X85A 1VHOA 4B3FX 4UZFA 4DQLA 1KK1A 2JIZA 3CP2A 2DYIA 3W2HA 1WU8A 4PC2A 1JA1A 1W35A 3OEEA 1HVXA 5TY0A 1IHMA 3PVDA 4G1BA 2OBSA 1YLOA 3KEWA 4XMYA 2YWFA 1D8TA 4RM0A 1XFOA 1BLIA 3H9NA 1EFCA 1FRQA 1OB5A 3VR6A 1KTVA 3ONYA 2HLDA 2OBRA 5LMZA 2ZXIA 1NB9A 1VQNB 1EFRA 1VQ4B 1I8DA 1WSVA 1B2RA 2GJKA 2Q6LA 3ASPA 1VQOB 4OP7A 2V7TA 4X0CA 1E43A 4Q7JB 4N3GA 3BCFA 4NCNA 2X8KA
chains in the Genus database with same CATH topology
1MRZA 1Q9SA 4UZFA 2VBVA 1S4MA 5A8AA 5A89A 3BNWA 1N07A 2P3MA 1N05A 3CTAA 3ZUGA 1NB0A 1N08A 1T6YA 2OYNA 2I1LA 1T6XA 2VBSA 1N06A 5FNZA 2VBUA 5A88A 5FO1A 1NB9A 2VBTA 3OP1A 1P4MA 5TRDA 2X0KA 1T6ZA 4UZEA 5FO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MRZ A;  1Q9S A;  4UZF A;  2VBV A;  1S4M A;  5A8A A;  5A89 A;  3BNW A;  1N07 A;  2P3M A;  1N05 A;  3CTA A;  3ZUG A;  1NB0 A;  1N08 A;  1T6Y A;  2OYN A;  2I1L A;  1T6X A;  2VBS A;  1N06 A;  5FNZ A;  2VBU A;  5A88 A;  5FO1 A;  1NB9 A;  2VBT A;  3OP1 A;  1P4M A;  5TRD A;  2X0K A;  1T6Z A;  4UZE A;  5FO0 A; 
#chains in the Genus database with same CATH topology
 3W2I A;  1Y0R A;  3Q3A A;  2Q6O A;  1AIP A;  4M1K A;  1UMK A;  2C4T A;  5FL7 A;  3SJP A;  3OJW A;  4X7D A;  4PAA A;  2ZTG A;  3VNU A;  4PAB A;  1EP2 B;  4WWV A;  4G7W A;  4Y9R A;  2NPF A;  2LZJ A;  3G6E B;  2QN6 A;  4OPO A;  2C5H A;  2F43 A;  3CPX A;  1T6X A;  3OW7 A;  2X6W A;  2F4N A;  3JU4 A;  1FNM A;  1QH0 A;  3W5V A;  3OP1 A;  1GR1 A;  1XQB A;  2F1M A;  3Q39 A;  4BPR A;  4C43 A;  4B3G A;  3MMP A;  3HAG A;  4RJL A;  1KRH A;  2D9R A;  3PEN A;  5CDF A;  1TUI A;  2HDN B;  1UD4 A;  4TT3 A;  1NRK A;  1E79 A;  3QFS A;  1G7S A;  1KK2 A;  4M0L A;  2BPO A;  4YAF A;  1J9Z A;  4P1V A;  2ZXH A;  4QV2 A;  4XLF A;  1NJI D;  4NNJ A;  3QFC A;  4YAL A;  1T6Y A;  1ZM4 A;  5BSX A;  2OYN A;  2I1L A;  2BVN A;  1ZM2 A;  3Q6Q A;  2B7C A;  2QTL A;  4M2L A;  1YJW B;  4XN3 A;  4Z4Y A;  1KJZ A;  4II2 A;  1WOO A;  4TMT A;  1GVH A;  2Z6B D;  3CRZ A;  4PC1 A;  2EIX A;  2WYR A;  2DOG A;  3LQE A;  5IYW A;  3PA1 A;  1I7P A;  1N0U A;  3PA2 A;  4L8J A;  4E0F A;  4ZCI A;  1NDH A;  1Q9S A;  4ZV4 A;  3CCE B;  2WJV A;  4XN0 A;  3A1P A;  2ZZQ A;  4KKU A;  2P3M A;  4ZCL A;  4N3N A;  2V7U A;  2JJ2 A;  4B3X A;  4KKS A;  4Z4T A;  4YAW A;  1YJN B;  1JB9 A;  1YIJ B;  1ZUN B;  5DS0 A;  2XZL A;  1WP6 A;  1N08 A;  1JJ2 B;  3WY9 A;  3VNV A;  3GVL A;  1M90 D;  1S0U A;  3R6J A;  5KW9 A;  1UD2 A;  4Z4U A;  2HMA A;  3P27 A;  4RCZ A;  1VLO A;  4EH1 A;  2BF4 A;  1PJ6 A;  5TR9 A;  4DNR B;  3OJX A;  4XQF A;  4P12 A;  3H94 A;  4ZGN B;  1MRZ A;  1G7T A;  5BSY A;  5KSW B;  3OAA A;  3A8K A;  1VQL B;  1KK0 A;  5IYN A;  1W0J A;  4AF6 A;  1FNC A;  4DK0 A;  1IJE A;  2ZZE A;  3D26 A;  1M1K D;  3R6K A;  2XOK A;  2VYQ A;  4RLZ A;  2GJP A;  3MCA A;  4RD2 A;  1N8R D;  1AMO A;  2ZL6 A;  2RC6 A;  4X05 A;  3V76 A;  2QDX A;  2OBT A;  1BX1 A;  1VQP B;  1T6Z A;  4M4S A;  4FN5 A;  4QUZ A;  1HZE A;  3MHP A;  1DDG A;  4TMX A;  1Y0Y A;  1QUE A;  3W2E A;  1E64 A;  1W9X A;  2M5S A;  1KK3 A;  1DAR A;  2Q6K A;  3CCU B;  2BMW A;  4RD6 A;  4Z4R A;  1Q82 D;  4WZL A;  1W2B B;  3FJO A;  5EMN A;  1QUF A;  3B78 A;  3FKS A;  2XGJ A;  2DCU A;  1TVC A;  1WOR A;  4Y9U A;  2DIE A;  2VBS A;  1V5V A;  2CRV A;  3ISX A;  2GK7 A;  3PUM A;  1E3X A;  3ZZ0 A;  4XD7 A;  4P26 A;  4XKW A;  4P3I A;  3CD6 B;  1GJR A;  4Z4V A;  5IYQ A;  4XL9 A;  3GVJ A;  3CXC B;  1K28 D;  4G5G A;  1QX4 A;  3ASS A;  4FXU A;  4RDL A;  1KD1 D;  3CCS B;  1CNF A;  3WBK A;  3AGQ A;  3WNB A;  2X6X A;  2PLF A;  3AVV A;  2BN4 A;  2YWH A;  1A8P A;  1UD5 A;  1QFY A;  2GRE A;  3BNW A;  3OZW A;  4YEL A;  2JJ1 A;  3CPW B;  1WDT A;  1QVF B;  1H42 A;  4XM3 A;  1RQP A;  3ZPN A;  3ES9 A;  2ZTN A;  3OZU A;  4XON A;  1VQ8 B;  1FRN A;  3SKB A;  2QTZ A;  3CC4 B;  3CCQ B;  3G05 A;  2WZN A;  4RPD A;  2X6Y A;  3AVU A;  3T53 B;  1E63 A;  4WZT A;  4GQN A;  2DER A;  1UD6 A;  5F4J A;  4DQK A;  1FNB A;  2BGI A;  4LBV A;  1VQ5 B;  2VJJ A;  3I56 B;  1ELO A;  1PJ5 A;  5GV8 A;  2B5O A;  4HE6 A;  3BY1 A;  4PC3 A;  3OFN A;  1XB2 A;  1N07 A;  1UD3 A;  4FK8 A;  1QFJ A;  2X53 S;  4B48 A;  1BQE A;  4QVA A;  4RD1 A;  1I18 A;  4RPB A;  4LBZ A;  1Q7Y D;  4PC6 A;  2EFG A;  2WR8 A;  4LBW A;  4LBY A;  1B23 P;  4H9G A;  1TLL A;  3AVW A;  1NBM A;  4RDJ A;  1Q81 D;  2VBU A;  3W5H A;  3CC2 B;  4NBS A;  5FO1 A;  4AC9 A;  3E20 A;  2W6I A;  3AGP A;  1G7C A;  4LC0 A;  3J81 k;  2E1R A;  4X8I A;  1QVG B;  4P6Y A;  1V0F A;  1HA3 A;  3AVT A;  3A3G A;  2PMD A;  3JQR A;  4DK1 A;  2OTL B;  1OGJ A;  2BM1 A;  3CCV B;  2D74 A;  4M53 A;  2XND A;  1VJS A;  1FND A;  3AST A;  2JDI A;  3G71 B;  3U6B A;  2BV3 A;  3P26 A;  2ZBV A;  1TTT A;  4WZE A;  3BY2 A;  1QGZ A;  5FNZ A;  3AVY A;  4Z4Z A;  1YJ9 B;  2PIA A;  4U9U A;  3SLD A;  4Z4S A;  3CC7 B;  2CBX A;  3OZV A;  3ASQ A;  2VBT A;  3WND A;  3T56 B;  4G1V A;  1VLY A;  1WOS A;  4RCY A;  2CC2 A;  3AVX A;  4R71 A;  1E1R A;  5FO0 A;  1N0V C;  3RY8 A;  1S4M A;  3WNC A;  1G7R A;  2WZP P;  3JQQ A;  4WZK A;  1BJK A;  2R9V A;  2QA4 B;  1BPL A;  3Q6R A;  2QE7 A;  1SKY B;  4XR6 A;  2V7V A;  3VO1 A;  4G6I A;  2ZIT A;  5L46 A;  4P2N A;  4II3 A;  5GV7 A;  1VQK B;  3ZIA A;  2V7W A;  2F1L A;  1VF7 A;  3LO8 A;  5A88 A;  2OK8 A;  2J7K A;  1IB0 A;  4HIZ A;  3QSY A;  1YX2 A;  4TSF A;  1P4M A;  1XE1 A;  4J0Q A;  3W5U A;  1EXM A;  3E1Y E;  1EP1 B;  4UZE A;  1H8E A;  2GK6 A;  2D3L A;  1FX0 A;  2C5B A;  1MAB A;  2XNJ A;  1QG0 A;  3CES A;  3BH4 A;  3GIR A;  5HKK A;  1YHQ B;  2RC5 A;  4HE5 A;  4YXW A;  2ZL5 A;  4JMQ A;  5DSZ A;  4OOV A;  2OTJ B;  1ZM9 A;  4OPS A;  2ZZG A;  4B44 A;  3LVB A;  2AHO A;  2VZL A;  2ZZF A;  3VMF A;  1KMH A;  2XEX A;  3OOC A;  2VNJ A;  4P25 A;  2VJI A;  3WQZ A;  3WYA A;  5B6I A;  1H85 A;  3G4S B;  4RD0 A;  1E62 A;  1KZL A;  1YI2 B;  3PUN A;  4MYT A;  3QE2 A;  5FA6 A;  1KQS B;  4ZGQ B;  2VNI A;  3JQP A;  2X0K A;  1VQM B;  2QMU A;  3WBJ A;  1EFT A;  1QGY A;  1OB0 A;  2Q6I A;  3ZBT A;  1PJ7 A;  2VBV A;  3ZBU A;  1R5O A;  1WSR A;  4XOT A;  2VNH A;  2XNC A;  3DDY A;  3ZUG A;  4KKT A;  3V7A A;  2GQF A;  3GVK A;  2V4D A;  4Z1M A;  1EWY A;  1OB2 A;  4YEJ A;  1N06 A;  2WPD A;  4OOS A;  2W6J A;  3W2F A;  3OE7 A;  4F7D A;  2NV4 A;  2CF4 A;  2XZP A;  2YWG A;  3OPO A;  5F4M A;  1YIT B;  1OHH A;  1DG1 G;  3FPK A;  1V0E A;  1U2R A;  3CMM A;  4XLC A;  1PKV A;  5HZA A;  2C77 A;  4AVZ A;  4P9S A;  4XLH A;  2C78 A;  4ZCM A;  1ZM3 A;  4P6V F;  4YHB A;  5A89 A;  4QVJ A;  4UAJ A;  3CCM B;  1WOP A;  2QGG A;  4QHY A;  1NB0 A;  2D3N A;  2C4U A;  3BC9 A;  1EFU A;  1COW A;  3ZZT A;  4WQM A;  5H5J A;  2HCJ B;  2V7X A;  1F20 A;  1GO2 A;  3ZC3 A;  3A3B A;  4K1X A;  2CK3 A;  2BM0 A;  2ZL7 A;  2B7B A;  2BSA A;  3Q38 A;  5F4O A;  1RQR A;  2GJR A;  3CCR B;  4ROX A;  4DNT B;  1KC8 D;  4XNF A;  3OEH A;  4OOX A;  2KVO A;  3QFT A;  2QEX B;  5TRD A;  4X07 A;  1SM4 A;  5DN6 A;  1GAW A;  1S72 B;  3OKX A;  2CW5 A;  1IJF A;  4PC7 A;  2DEU A;  3T51 B;  1W34 A;  2V7Q A;  4RDK A;  2WSS A;  3A35 A;  3I1F A;  5A8A A;  4OPV A;  3KL9 A;  3SJZ A;  1QFZ A;  3GQB A;  4ACA A;  1Q86 D;  1BX0 A;  4G7X A;  1WTH D;  4B47 A;  4RD4 A;  4PGO A;  1K73 D;  2FX3 A;  2WJY A;  2YWE A;  2CND A;  4XKV A;  1FDR A;  5IK2 A;  1CNE A;  1F60 A;  3LNN A;  3SLN A;  3CCL B;  3BCD A;  4TMV A;  1EP3 B;  1VHE A;  4X06 A;  3LQ6 A;  4TN1 A;  5J35 A;  4Z4W A;  5J3O A;  4TMZ A;  3I55 B;  3CCJ B;  1BMF A;  1E1Q A;  4AF7 A;  3BQJ A;  2C2W A;  2OK7 A;  2ZBU A;  2JN9 A;  3GSI A;  1D2E A;  1UD8 A;  4C0S A;  3CP8 A;  3NE5 B;  2DET A;  5THX A;  5H59 A;  5KNL A;  2V31 A;  1T5E A;  5AN9 A;  1GAQ A;  4FWT A;  3CTA A;  3B8H A;  4UZU A;  1VQ6 B;  3WXM A;  1W87 A;  1R5B A;  2FVG A;  5E6T A;  3VO2 A;  1D1N A;  5TV2 A;  4ACB A;  1QGA A;  1H8H A;  2VNK A;  3W2G A;  2X3U A;  3FPP A;  1CQX A;  4MYU A;  1K8A D;  3ZZU A;  4P22 A;  4B4D A;  3QFR A;  3OW2 B;  1SKQ A;  4RD3 A;  4XLA A;  3CB4 A;  4CQJ A;  4Y7C A;  4P3Y A;  3ONU A;  2GPJ A;  5HXB A;  1R5N A;  1OGI A;  2R6H A;  2DY1 A;  3CW2 A;  1W0K A;  3U2Q A;  5IYR A;  1E3Z A;  1JNY A;  3A8J A;  1N05 A;  4XOR A;  3B82 A;  1JA0 A;  5FIU A;  1DDI A;  2XZO A;  4IW3 B;  1WPC A;  4XOP A;  1VQ7 B;  4X7E A;  4TKO B;  4B43 A;  5HZB A;  4YAU A;  4X7C A;  3ASR A;  4YAO A;  4X7F A;  1VQ9 B;  4XLE A;  4ASU A;  4TMW A;  2E1B A;  5IYP A;  2BGJ A;  3A8I A;  5JBQ A;  3CMA B;  1K9M D;  4QFM A;  3U6K A;  3CME B;  3SEJ A;  2PE3 A;  2X85 A;  1VHO A;  4B3F X;  4UZF A;  4DQL A;  1KK1 A;  2JIZ A;  3CP2 A;  2DYI A;  3W2H A;  1WU8 A;  4PC2 A;  1JA1 A;  1W35 A;  3OEE A;  1HVX A;  5TY0 A;  1IHM A;  3PVD A;  4G1B A;  2OBS A;  1YLO A;  3KEW A;  4XMY A;  2YWF A;  1D8T A;  4RM0 A;  1XFO A;  1BLI A;  3H9N A;  1EFC A;  1FRQ A;  1OB5 A;  3VR6 A;  1KTV A;  3ONY A;  2HLD A;  2OBR A;  5LMZ A;  2ZXI A;  1NB9 A;  1VQN B;  1EFR A;  1VQ4 B;  1I8D A;  1WSV A;  1B2R A;  2GJK A;  2Q6L A;  3ASP A;  1VQO B;  4OP7 A;  2V7T A;  4X0C A;  1E43 A;  4Q7J B;  4N3G A;  3BCF A;  4NCN A;  2X8K A; 
#chains in the Genus database with same CATH homology
 1MRZ A;  1Q9S A;  4UZF A;  2VBV A;  1S4M A;  5A8A A;  5A89 A;  3BNW A;  1N07 A;  2P3M A;  1N05 A;  3CTA A;  3ZUG A;  1NB0 A;  1N08 A;  1T6Y A;  2OYN A;  2I1L A;  1T6X A;  2VBS A;  1N06 A;  5FNZ A;  2VBU A;  5A88 A;  5FO1 A;  1NB9 A;  2VBT A;  3OP1 A;  1P4M A;  5TRD A;  2X0K A;  1T6Z A;  4UZE A;  5FO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...