5A88A

Crystal structure of the riboflavin kinase module of fad synthetase from corynebacterium ammoniagenes in complex with adp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
147
Chain Sequence
RHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTEAPVSGNMEPEVAYAAAISVGTNQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYFLQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
molecule tags Transferase
molecule keywords RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF
total genus 31
structure length 147
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 5a88A00
2VBVA 4UZEA 1S4MA 2I1LA 1MRZA 4UZFA 2VBUA 1P4MA 5A89A 3ZUGA 1N05A 1T6ZA 5FO1A 1Q9SA 1T6XA 1N07A 1N08A 3OP1A 1T6YA 2VBSA 1N06A 2VBTA 5TRDA 2X0KA 5FO0A 3BNWA 1NB0A 5FNZA 5A8AA 2P3MA 3CTAA 2OYNA 5A88A 1NB9A
chains in the Genus database with same CATH superfamily
3ZBTA 4MYTA 4ZGQB 4ACBA 2CC2A 3VNVA 3G05A 4C43A 4P25A 4B47A 1F20A 1YJ9B 1N05A 4ROXA 4X07A 2QDXA 3H94A 4LBZA 3PUMA 2QN6A 4YAOA 4X8IA 2XGJA 4P3YA 2YWFA 5LMZA 2C2WA 1T6YA 3QSYA 3HAGA 1G7SA 1N06A 1JNYA 5BSXA 2XNJA 2JJ2A 5EMNA 1TTTA 3GVKA 2VNHA 1E64A 2F4NA 1QVFB 2F43A 1QGAA 2ZZGA 4RD4A 3W2FA 3GSIA 2QE7A 2W6IA 2D3NA 1UD2A 3CCMB 4YHBA 4F7DA 2CNDA 4P3IA 2C4TA 1K8AD 1BQEA 3D26A 4X06A 4Z4UA 1W87A 1QFYA 3SLNA 3GQBA 3WNDA 1GO2A 1TUIA 1N07A 4IW3B 3W5UA 4TMTA 2V7WA 2ZBUA 4CQJA 1VQMB 1QUEA 4DNTB 1NJID 2X3UA 1VQ8B 4OOVA 1TLLA 1VHOA 1COWA 4FXUA 3OZVA 4WZTA 2YWEA 3W2HA 1W34A 4B43A 3AVTA 3R6JA 2WJVA 3I55B 3CCLB 1R5BA 4XN3A 2Z6BD 2W6JA 4PC3A 4WWVA 1VLOA 2BF4A 5E6TA 1I18A 2QEXB 4P1VA 5H59A 3Q3AA 1CQXA 4RDLA 4TMZA 3OW7A 4FWTA 3CMAB 1WPCA 3A8KA 3PUNA 5HKKA 5BSYA 4WZLA 1UD8A 3LNNA 4X7CA 5DSZA 1E63A 1S72B 2OTLB 5TRDA 5FA6A 3OJXA 3CC7B 3CP8A 3ASTA 1EP2B 4B44A 1N0VC 4UAJA 3A3BA 2VBVA 1PKVA 4OP7A 4NCNA 2VBUA 1CNFA 1FX0A 4RD0A 3CCQB 4U9UA 4OPOA 4ZCMA 1HVXA 4KKSA 1E62A 4XKWA 1T6ZA 3A8IA 4OOSA 2EFGA 1DDIA 2BMWA 2BN4A 3CCSB 1E1RA 4QV2A 4G6IA 4LBWA 4RM0A 1PJ6A 1D8TA 1QGZA 1V0FA 5AN9A 2QA4B 3B82A 3A35A 1VQNB 3FPPA 3Q6QA 1JA1A 4PC1A 4XLFA 1KQSB 4AVZA 4P12A 1OB0A 1E79A 1QVGB 2F1LA 5KSWB 3AGPA 4X7EA 4N3NA 4XN0A 2R6HA 5GV8A 4UZFA 1RQRA 3V76A 5KNLA 2YWHA 1QX4A 4YAFA 4P22A 4QHYA 4ZGNB 4LBVA 3W5VA 1Q7YD 1YX2A 1FDRA 1XQBA 1BLIA 3OP1A 2BM1A 2V7UA 3NE5B 4Z1MA 1QFJA 2OK7A 3ASSA 5L46A 4HE6A 2X53S 4J0QA 4XORA 2VNKA 3U2QA 2PLFA 5B6IA 2BPOA 2BSAA 1KK0A 4XKVA 3BCDA 2D74A 1GAQA 3B78A 4QFMA 4Z4VA 2GJPA 1XE1A 2ZL6A 4WZEA 3BCFA 2LZJA 1M1KD 1VQ7B 4RDJA 3J81k 2GQFA 4ACAA 2QTLA 3T53B 1P4MA 1FNDA 2PIAA 3ZUGA 3SJZA 3AVXA 4PC2A 4Z4WA 3CC4B 3VR6A 4E0FA 4Q7JB 3ASQA 3W2IA 3I1FA 3LQ6A 4XLCA 2V31A 2XNDA 4XONA 3T51B 1H8HA 3PENA 2DIEA 1H8EA 4P6YA 3BNWA 1K73D 1RQPA 2FX3A 3U6BA 3AVWA 2XZPA 1KD1D 4FK8A 4C0SA 3FKSA 4G5GA 4PABA 4RCZA 1MABA 1OGIA 1W35A 5J35A 1AMOA 1BMFA 1S4MA 2I1LA 2GREA 4G1BA 4X7DA 4TKOB 1S0UA 2ZZFA 3BH4A 3E1YE 3SJPA 3OZUA 2ZTNA 3BQJA 4XLEA 2DYIA 2XEXA 3B8HA 3CD6B 3BC9A 3FPKA 5IYNA 1B23P 4Z4RA 4YEJA 4OPSA 2CBXA 1WTHD 4II2A 1IJFA 1QH0A 1WORA 4Y9UA 1R5NA 1V0EA 4XNFA 2X0KA 5F4MA 3ZZUA 3VMFA 2GPJA 2JDIA 3BY1A 3P27A 2BM0A 1VQ6B 3QFCA 4GQNA 4B3GA 3A1PA 1DARA 3ONYA 2V7VA 3A8JA 3LO8A 5HXBA 1VF7A 3ISXA 1I7PA 2OBTA 1ZUNB 3JQRA 4II3A 1KK1A 1W2BB 1HZEA 2GK7A 3OZWA 3PA1A 4MYUA 1SKQA 4TMWA 4BPRA 1KK2A 3CCVB 1G7TA 1WU8A 4NNJA 3CP2A 1J9ZA 3ONUA 4XOPA 2HDNB 3W5HA 1VLYA 2ZXIA 4AC9A 1XB2A 2DOGA 4YELA 5IYRA 2VZLA 1WOSA 1QUFA 1SM4A 1ZM2A 3MHPA 1GAWA 4KKTA 2HMAA 4AF6A 1FNBA 4YAWA 1FRNA 2DETA 3VNUA 1JJ2B 4DK0A 1GJRA 5TV2A 5A89A 2JJ1A 2QTZA 2D3LA 4M2LA 1I8DA 2WZNA 2WPDA 2X6WA 1JB9A 1D1NA 2VJJA 2NV4A 4P6VF 1BJKA 2OBRA 4KKUA 1M90D 1EWYA 1EFUA 1KTVA 4XD7A 3W2EA 2DY1A 3R6KA 4G1VA 2OTJB 3PVDA 2OYNA 1QFZA 4XLAA 1Q82D 1YJNB 2Q6OA 4P9SA 4DQKA 3MCAA 1OGJA 3OAAA 1YITB 5FL7A 5TY0A 1GVHA 2DERA 4RCYA 4XLHA 3G6EB 3QFSA 1WOOA 4N3GA 4B3FX 1K9MD 1Q9SA 1VQKB 2RC6A 4PC7A 1N0UA 5THXA 3E20A 3WBJA 4RJLA 1YI2B 3CCUB 2VBSA 4B4DA 5IYPA 1EFRA 4XR6A 3AVYA 5IYQA 2AHOA 3Q6RA 5DN6A 5HZBA 1OB2A 2D9RA 2VNJA 2ZBVA 3CRZA 3QFTA 2C5HA 2BV3A 2E1RA 5A88A 4P2NA 4TSFA 1W0JA 4XMYA 1KMHA 3CCEB 3CB4A 4M4SA 1KJZA 1G7RA 4PC6A 4HE5A 3Q38A 4ASUA 1FNCA 1E3ZA 3CXCB 3CCRB 1EP1B 3JQQA 1IJEA 1AIPA 4RPBA 1IB0A 2KVOA 4RD1A 2ZITA 1EP3B 4WZKA 1N8RD 1VQOB 2JIZA 3ES9A 4M0LA 4TT3A 4Y9RA 2WZPP 3T56B 2HCJB 2GJRA 3I56B 1BPLA 1W0KA 3P26A 2Q6KA 3ZBUA 4DK1A 4XQFA 3WNBA 1VJSA 1G7CA 1R5OA 2OK8A 4QUZA 5A8AA 5KW9A 1VQ4B 4XOTA 4YAUA 3SEJA 2ZL5A 5J3OA 4Z4ZA 2JN9A 3WY9A 1DG1G 3A3GA 2PMDA 1EXMA 2J7KA 4ZV4A 2ZXHA 3LVBA 4QVAA 4PAAA 3CPXA 1ZM3A 2XNCA 2Q6IA 2V7QA 3OEHA 1WSRA 1T6XA 4XL9A 3W2GA 5F4JA 3GIRA 1CNEA 1ZM9A 2ZTGA 1A8PA 1E3XA 4RD2A 4YXWA 1WOPA 2WYRA 3WXMA 1PJ5A 5DS0A 4JMQA 3Q39A 2B7CA 4ZCIA 2QMUA 3ASRA 1YHQB 2QGGA 3VO1A 1NBMA 1Y0YA 3BY2A 1ZM4A 3OFNA 2WSSA 2RC5A 1SKYB 1K28D 4X05A 4PGOA 2X8KA 5JBQA 2VYQA 5IK2A 3G71B 1IHMA 2BGJA 3OPOA 1VQ5B 2M5SA 3CC2B 3KEWA 5CDFA 2CF4A 3H9NA 5GV7A 3AGQA 3ZC3A 1UMKA 2CRVA 1BX0A 3CMEB 2Q6LA 4YALA 2X6YA 3OOCA 1YLOA 3ZIAA 4DNRB 4RD6A 1H85A 1H42A 2V7TA 3WQZA 2V7XA 1VHEA 2C4UA 1V5VA 2ZZQA 1T5EA 1MRZA 3ASPA 5TR9A 1QG0A 4UZEA 2BVNA 3OJWA 3PA2A 4QVJA 4UZUA 3DDYA 1TVCA 2EIXA 2VJIA 3SLDA 1Q81D 2PE3A 4X7FA 1UD5A 3OE7A 1VQLB 3QE2A 1KRHA 2NPFA 4AF7A 1NRKA 2ZL7A 1D2EA 3WNCA 1E43A 1JA0A 1N08A 3CESA 3CMMA 4LBYA 4P26A 4K1XA 3CPWB 1OB5A 1UD4A 1YJWB 4NBSA 2B7BA 1HA3A 3JQPA 4OOXA 3CCJB 4Z4YA 1KZLA 1NDHA 1QGYA 3V7AA 3LQEA 2XZLA 2C77A 2ZZEA 4M53A 5FNZA 1OHHA 4Z4SA 3OEEA 2P3MA 1VQ9B 2DCUA 2VBTA 4OPVA 2OBSA 2BGIA 1PJ7A 1UD3A 4XM3A 2YWGA 3WBKA 3ZZ0A 4B48A 3U6KA 3JU4A 3AVVA 4R71A 4TMXA 2F1MA 2VNIA 3OKXA 4H9GA 3AVUA 3KL9A 1VQPB 4RDKA 5FO1A 2DEUA 3CW2A 3FJOA 4TMVA 1ELOA 4WQMA 1Q86D 5HZAA 3SKBA 3GVLA 4DQLA 4EH1A 3RY8A 4LC0A 4G7WA 3OW2B 4B3XA 2GJKA 1FRQA 1EFTA 2CW5A 1UD6A 4Z4TA 1YIJB 1KC8D 1F60A 3QFRA 1EFCA 2HLDA 4L8JA 1NB0A 1U2RA 3VO2A 2X6XA 3CTAA 3ZPNA 1W9XA 3G4SB 1NB9A 4TN1A 1Y0RA 2WJYA 4RD3A 5FIUA 1BX1A 2V4DA 1WP6A 2WR8A 3GVJA 2XOKA 1XFOA 2FVGA 4RLZA 2XZOA 2X85A 4RPDA 3MMPA 5H5JA 1E1QA 4X0CA 1FNMA 4ZCLA 4HIZA 3ZZTA 1KK3A 5F4OA 1DDGA 4M1KA 4G7XA 5IYWA 1GR1A 2GK6A 2CK3A 5FO0A 4FN5A 2C78A 2R9VA 1WDTA 1WSVA 2E1BA 1B2RA 4Y7CA 3WYAA 2C5BA 2B5OA
chains in the Genus database with same CATH topology
2VBVA 4UZEA 1S4MA 2I1LA 1MRZA 4UZFA 2VBUA 1P4MA 5A89A 3ZUGA 1N05A 1T6ZA 5FO1A 1Q9SA 1T6XA 1N07A 1N08A 3OP1A 1T6YA 2VBSA 1N06A 2VBTA 5TRDA 2X0KA 5FO0A 3BNWA 1NB0A 5FNZA 5A8AA 2P3MA 3CTAA 2OYNA 5A88A 1NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBV A;  4UZE A;  1S4M A;  2I1L A;  1MRZ A;  4UZF A;  2VBU A;  1P4M A;  5A89 A;  3ZUG A;  1N05 A;  1T6Z A;  5FO1 A;  1Q9S A;  1T6X A;  1N07 A;  1N08 A;  3OP1 A;  1T6Y A;  2VBS A;  1N06 A;  2VBT A;  5TRD A;  2X0K A;  5FO0 A;  3BNW A;  1NB0 A;  5FNZ A;  5A8A A;  2P3M A;  3CTA A;  2OYN A;  5A88 A;  1NB9 A; 
#chains in the Genus database with same CATH topology
 3ZBT A;  4MYT A;  4ZGQ B;  4ACB A;  2CC2 A;  3VNV A;  3G05 A;  4C43 A;  4P25 A;  4B47 A;  1F20 A;  1YJ9 B;  1N05 A;  4ROX A;  4X07 A;  2QDX A;  3H94 A;  4LBZ A;  3PUM A;  2QN6 A;  4YAO A;  4X8I A;  2XGJ A;  4P3Y A;  2YWF A;  5LMZ A;  2C2W A;  1T6Y A;  3QSY A;  3HAG A;  1G7S A;  1N06 A;  1JNY A;  5BSX A;  2XNJ A;  2JJ2 A;  5EMN A;  1TTT A;  3GVK A;  2VNH A;  1E64 A;  2F4N A;  1QVF B;  2F43 A;  1QGA A;  2ZZG A;  4RD4 A;  3W2F A;  3GSI A;  2QE7 A;  2W6I A;  2D3N A;  1UD2 A;  3CCM B;  4YHB A;  4F7D A;  2CND A;  4P3I A;  2C4T A;  1K8A D;  1BQE A;  3D26 A;  4X06 A;  4Z4U A;  1W87 A;  1QFY A;  3SLN A;  3GQB A;  3WND A;  1GO2 A;  1TUI A;  1N07 A;  4IW3 B;  3W5U A;  4TMT A;  2V7W A;  2ZBU A;  4CQJ A;  1VQM B;  1QUE A;  4DNT B;  1NJI D;  2X3U A;  1VQ8 B;  4OOV A;  1TLL A;  1VHO A;  1COW A;  4FXU A;  3OZV A;  4WZT A;  2YWE A;  3W2H A;  1W34 A;  4B43 A;  3AVT A;  3R6J A;  2WJV A;  3I55 B;  3CCL B;  1R5B A;  4XN3 A;  2Z6B D;  2W6J A;  4PC3 A;  4WWV A;  1VLO A;  2BF4 A;  5E6T A;  1I18 A;  2QEX B;  4P1V A;  5H59 A;  3Q3A A;  1CQX A;  4RDL A;  4TMZ A;  3OW7 A;  4FWT A;  3CMA B;  1WPC A;  3A8K A;  3PUN A;  5HKK A;  5BSY A;  4WZL A;  1UD8 A;  3LNN A;  4X7C A;  5DSZ A;  1E63 A;  1S72 B;  2OTL B;  5TRD A;  5FA6 A;  3OJX A;  3CC7 B;  3CP8 A;  3AST A;  1EP2 B;  4B44 A;  1N0V C;  4UAJ A;  3A3B A;  2VBV A;  1PKV A;  4OP7 A;  4NCN A;  2VBU A;  1CNF A;  1FX0 A;  4RD0 A;  3CCQ B;  4U9U A;  4OPO A;  4ZCM A;  1HVX A;  4KKS A;  1E62 A;  4XKW A;  1T6Z A;  3A8I A;  4OOS A;  2EFG A;  1DDI A;  2BMW A;  2BN4 A;  3CCS B;  1E1R A;  4QV2 A;  4G6I A;  4LBW A;  4RM0 A;  1PJ6 A;  1D8T A;  1QGZ A;  1V0F A;  5AN9 A;  2QA4 B;  3B82 A;  3A35 A;  1VQN B;  3FPP A;  3Q6Q A;  1JA1 A;  4PC1 A;  4XLF A;  1KQS B;  4AVZ A;  4P12 A;  1OB0 A;  1E79 A;  1QVG B;  2F1L A;  5KSW B;  3AGP A;  4X7E A;  4N3N A;  4XN0 A;  2R6H A;  5GV8 A;  4UZF A;  1RQR A;  3V76 A;  5KNL A;  2YWH A;  1QX4 A;  4YAF A;  4P22 A;  4QHY A;  4ZGN B;  4LBV A;  3W5V A;  1Q7Y D;  1YX2 A;  1FDR A;  1XQB A;  1BLI A;  3OP1 A;  2BM1 A;  2V7U A;  3NE5 B;  4Z1M A;  1QFJ A;  2OK7 A;  3ASS A;  5L46 A;  4HE6 A;  2X53 S;  4J0Q A;  4XOR A;  2VNK A;  3U2Q A;  2PLF A;  5B6I A;  2BPO A;  2BSA A;  1KK0 A;  4XKV A;  3BCD A;  2D74 A;  1GAQ A;  3B78 A;  4QFM A;  4Z4V A;  2GJP A;  1XE1 A;  2ZL6 A;  4WZE A;  3BCF A;  2LZJ A;  1M1K D;  1VQ7 B;  4RDJ A;  3J81 k;  2GQF A;  4ACA A;  2QTL A;  3T53 B;  1P4M A;  1FND A;  2PIA A;  3ZUG A;  3SJZ A;  3AVX A;  4PC2 A;  4Z4W A;  3CC4 B;  3VR6 A;  4E0F A;  4Q7J B;  3ASQ A;  3W2I A;  3I1F A;  3LQ6 A;  4XLC A;  2V31 A;  2XND A;  4XON A;  3T51 B;  1H8H A;  3PEN A;  2DIE A;  1H8E A;  4P6Y A;  3BNW A;  1K73 D;  1RQP A;  2FX3 A;  3U6B A;  3AVW A;  2XZP A;  1KD1 D;  4FK8 A;  4C0S A;  3FKS A;  4G5G A;  4PAB A;  4RCZ A;  1MAB A;  1OGI A;  1W35 A;  5J35 A;  1AMO A;  1BMF A;  1S4M A;  2I1L A;  2GRE A;  4G1B A;  4X7D A;  4TKO B;  1S0U A;  2ZZF A;  3BH4 A;  3E1Y E;  3SJP A;  3OZU A;  2ZTN A;  3BQJ A;  4XLE A;  2DYI A;  2XEX A;  3B8H A;  3CD6 B;  3BC9 A;  3FPK A;  5IYN A;  1B23 P;  4Z4R A;  4YEJ A;  4OPS A;  2CBX A;  1WTH D;  4II2 A;  1IJF A;  1QH0 A;  1WOR A;  4Y9U A;  1R5N A;  1V0E A;  4XNF A;  2X0K A;  5F4M A;  3ZZU A;  3VMF A;  2GPJ A;  2JDI A;  3BY1 A;  3P27 A;  2BM0 A;  1VQ6 B;  3QFC A;  4GQN A;  4B3G A;  3A1P A;  1DAR A;  3ONY A;  2V7V A;  3A8J A;  3LO8 A;  5HXB A;  1VF7 A;  3ISX A;  1I7P A;  2OBT A;  1ZUN B;  3JQR A;  4II3 A;  1KK1 A;  1W2B B;  1HZE A;  2GK7 A;  3OZW A;  3PA1 A;  4MYU A;  1SKQ A;  4TMW A;  4BPR A;  1KK2 A;  3CCV B;  1G7T A;  1WU8 A;  4NNJ A;  3CP2 A;  1J9Z A;  3ONU A;  4XOP A;  2HDN B;  3W5H A;  1VLY A;  2ZXI A;  4AC9 A;  1XB2 A;  2DOG A;  4YEL A;  5IYR A;  2VZL A;  1WOS A;  1QUF A;  1SM4 A;  1ZM2 A;  3MHP A;  1GAW A;  4KKT A;  2HMA A;  4AF6 A;  1FNB A;  4YAW A;  1FRN A;  2DET A;  3VNU A;  1JJ2 B;  4DK0 A;  1GJR A;  5TV2 A;  5A89 A;  2JJ1 A;  2QTZ A;  2D3L A;  4M2L A;  1I8D A;  2WZN A;  2WPD A;  2X6W A;  1JB9 A;  1D1N A;  2VJJ A;  2NV4 A;  4P6V F;  1BJK A;  2OBR A;  4KKU A;  1M90 D;  1EWY A;  1EFU A;  1KTV A;  4XD7 A;  3W2E A;  2DY1 A;  3R6K A;  4G1V A;  2OTJ B;  3PVD A;  2OYN A;  1QFZ A;  4XLA A;  1Q82 D;  1YJN B;  2Q6O A;  4P9S A;  4DQK A;  3MCA A;  1OGJ A;  3OAA A;  1YIT B;  5FL7 A;  5TY0 A;  1GVH A;  2DER A;  4RCY A;  4XLH A;  3G6E B;  3QFS A;  1WOO A;  4N3G A;  4B3F X;  1K9M D;  1Q9S A;  1VQK B;  2RC6 A;  4PC7 A;  1N0U A;  5THX A;  3E20 A;  3WBJ A;  4RJL A;  1YI2 B;  3CCU B;  2VBS A;  4B4D A;  5IYP A;  1EFR A;  4XR6 A;  3AVY A;  5IYQ A;  2AHO A;  3Q6R A;  5DN6 A;  5HZB A;  1OB2 A;  2D9R A;  2VNJ A;  2ZBV A;  3CRZ A;  3QFT A;  2C5H A;  2BV3 A;  2E1R A;  5A88 A;  4P2N A;  4TSF A;  1W0J A;  4XMY A;  1KMH A;  3CCE B;  3CB4 A;  4M4S A;  1KJZ A;  1G7R A;  4PC6 A;  4HE5 A;  3Q38 A;  4ASU A;  1FNC A;  1E3Z A;  3CXC B;  3CCR B;  1EP1 B;  3JQQ A;  1IJE A;  1AIP A;  4RPB A;  1IB0 A;  2KVO A;  4RD1 A;  2ZIT A;  1EP3 B;  4WZK A;  1N8R D;  1VQO B;  2JIZ A;  3ES9 A;  4M0L A;  4TT3 A;  4Y9R A;  2WZP P;  3T56 B;  2HCJ B;  2GJR A;  3I56 B;  1BPL A;  1W0K A;  3P26 A;  2Q6K A;  3ZBU A;  4DK1 A;  4XQF A;  3WNB A;  1VJS A;  1G7C A;  1R5O A;  2OK8 A;  4QUZ A;  5A8A A;  5KW9 A;  1VQ4 B;  4XOT A;  4YAU A;  3SEJ A;  2ZL5 A;  5J3O A;  4Z4Z A;  2JN9 A;  3WY9 A;  1DG1 G;  3A3G A;  2PMD A;  1EXM A;  2J7K A;  4ZV4 A;  2ZXH A;  3LVB A;  4QVA A;  4PAA A;  3CPX A;  1ZM3 A;  2XNC A;  2Q6I A;  2V7Q A;  3OEH A;  1WSR A;  1T6X A;  4XL9 A;  3W2G A;  5F4J A;  3GIR A;  1CNE A;  1ZM9 A;  2ZTG A;  1A8P A;  1E3X A;  4RD2 A;  4YXW A;  1WOP A;  2WYR A;  3WXM A;  1PJ5 A;  5DS0 A;  4JMQ A;  3Q39 A;  2B7C A;  4ZCI A;  2QMU A;  3ASR A;  1YHQ B;  2QGG A;  3VO1 A;  1NBM A;  1Y0Y A;  3BY2 A;  1ZM4 A;  3OFN A;  2WSS A;  2RC5 A;  1SKY B;  1K28 D;  4X05 A;  4PGO A;  2X8K A;  5JBQ A;  2VYQ A;  5IK2 A;  3G71 B;  1IHM A;  2BGJ A;  3OPO A;  1VQ5 B;  2M5S A;  3CC2 B;  3KEW A;  5CDF A;  2CF4 A;  3H9N A;  5GV7 A;  3AGQ A;  3ZC3 A;  1UMK A;  2CRV A;  1BX0 A;  3CME B;  2Q6L A;  4YAL A;  2X6Y A;  3OOC A;  1YLO A;  3ZIA A;  4DNR B;  4RD6 A;  1H85 A;  1H42 A;  2V7T A;  3WQZ A;  2V7X A;  1VHE A;  2C4U A;  1V5V A;  2ZZQ A;  1T5E A;  1MRZ A;  3ASP A;  5TR9 A;  1QG0 A;  4UZE A;  2BVN A;  3OJW A;  3PA2 A;  4QVJ A;  4UZU A;  3DDY A;  1TVC A;  2EIX A;  2VJI A;  3SLD A;  1Q81 D;  2PE3 A;  4X7F A;  1UD5 A;  3OE7 A;  1VQL B;  3QE2 A;  1KRH A;  2NPF A;  4AF7 A;  1NRK A;  2ZL7 A;  1D2E A;  3WNC A;  1E43 A;  1JA0 A;  1N08 A;  3CES A;  3CMM A;  4LBY A;  4P26 A;  4K1X A;  3CPW B;  1OB5 A;  1UD4 A;  1YJW B;  4NBS A;  2B7B A;  1HA3 A;  3JQP A;  4OOX A;  3CCJ B;  4Z4Y A;  1KZL A;  1NDH A;  1QGY A;  3V7A A;  3LQE A;  2XZL A;  2C77 A;  2ZZE A;  4M53 A;  5FNZ A;  1OHH A;  4Z4S A;  3OEE A;  2P3M A;  1VQ9 B;  2DCU A;  2VBT A;  4OPV A;  2OBS A;  2BGI A;  1PJ7 A;  1UD3 A;  4XM3 A;  2YWG A;  3WBK A;  3ZZ0 A;  4B48 A;  3U6K A;  3JU4 A;  3AVV A;  4R71 A;  4TMX A;  2F1M A;  2VNI A;  3OKX A;  4H9G A;  3AVU A;  3KL9 A;  1VQP B;  4RDK A;  5FO1 A;  2DEU A;  3CW2 A;  3FJO A;  4TMV A;  1ELO A;  4WQM A;  1Q86 D;  5HZA A;  3SKB A;  3GVL A;  4DQL A;  4EH1 A;  3RY8 A;  4LC0 A;  4G7W A;  3OW2 B;  4B3X A;  2GJK A;  1FRQ A;  1EFT A;  2CW5 A;  1UD6 A;  4Z4T A;  1YIJ B;  1KC8 D;  1F60 A;  3QFR A;  1EFC A;  2HLD A;  4L8J A;  1NB0 A;  1U2R A;  3VO2 A;  2X6X A;  3CTA A;  3ZPN A;  1W9X A;  3G4S B;  1NB9 A;  4TN1 A;  1Y0R A;  2WJY A;  4RD3 A;  5FIU A;  1BX1 A;  2V4D A;  1WP6 A;  2WR8 A;  3GVJ A;  2XOK A;  1XFO A;  2FVG A;  4RLZ A;  2XZO A;  2X85 A;  4RPD A;  3MMP A;  5H5J A;  1E1Q A;  4X0C A;  1FNM A;  4ZCL A;  4HIZ A;  3ZZT A;  1KK3 A;  5F4O A;  1DDG A;  4M1K A;  4G7X A;  5IYW A;  1GR1 A;  2GK6 A;  2CK3 A;  5FO0 A;  4FN5 A;  2C78 A;  2R9V A;  1WDT A;  1WSV A;  2E1B A;  1B2R A;  4Y7C A;  3WYA A;  2C5B A;  2B5O A; 
#chains in the Genus database with same CATH homology
 2VBV A;  4UZE A;  1S4M A;  2I1L A;  1MRZ A;  4UZF A;  2VBU A;  1P4M A;  5A89 A;  3ZUG A;  1N05 A;  1T6Z A;  5FO1 A;  1Q9S A;  1T6X A;  1N07 A;  1N08 A;  3OP1 A;  1T6Y A;  2VBS A;  1N06 A;  2VBT A;  5TRD A;  2X0K A;  5FO0 A;  3BNW A;  1NB0 A;  5FNZ A;  5A8A A;  2P3M A;  3CTA A;  2OYN A;  5A88 A;  1NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...