4P6YA

Crystal structure of the m42 aminopeptidase tmpep1050 from thermotoga maritima
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
b'MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Crystal structure of the M42 aminopeptidase TmPep1050 from Thermotoga maritima
rcsb
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4p6yA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p6yA01
3B2YA 1M4LA 3CT9A 4ZY2A 2V8VA 7CPAA 4MHNA 4DYOA 3NA6A 2ZEOA 3FEEA 1H8LA 5JH9A 4P4BA 1ELLP 2QJ8A 1DTDA 1VIXA 2O53A 4W9YA 3B3VA 3ISXA 3FX6A 4MCQA 3S9LA 4NGQA 5HVHA 3H8EA 2Q43A 5K8PA 1ARLA 3TC8A 2BCOA 5JGFA 4NJQA 2FVGA 1CP6A 1Y7EA 5HVGA 1LOKA 4MXUA 4PPZA 3PB9X 3D7FA 1ZG8A 3LMSA 3KR4A 4FBEA 1XFOA 2ZOGA 3PFEA 3V38A 2PJ7A 2PIZA 3IEHA 1IGBA 2XEIA 4MCPA 4YWYA 3NFZA 4O23A 4OC0A 5LYDA 3FMCA 1PCAA 3KL9A 2JBJA 1CP7A 4UEEA 2PJ9A 3RZAA 2PJ4A 4IHMA 1LAMA 2JEWA 3PEIA 2HC9A 4OC1A 5ELYA 1AYEA 3I1UA 4X8IA 3D68A 4NFRA 3FVLA 3WABA 4R76A 2RFHA 4NGMA 2CTBA 4P4IA 4FAIA 5CBMA 1F2PA 5THWA 4KSIA 3FF3A 4NGRA 4ZX8A 1HDUA 1EE3P 3IO1A 3T8WA 2PJ5A 3KI9A 1ZLIA 4NGPA 3L2NA 1CPXA 4A39A 4PQAA 1IY7A 4ZX9A 1GYTA 1XRYA 2VL1A 1CPSA 4PXBA 2ZEGA 6CPAA 4ZYQA 1LCPA 2BOAA 2V8GA 2ZEDA 3NH4A 3DGVA 2PCUA 3KZWA 3MN8A 1CG2A 2PJ3A 4UEZA 1ZLHA 4F8ZA 5K8MA 2V77A 3BHXA 2XEFA 4P4EA 2POKA 1ZG7A 3BI0A 1ZG9A 1LANA 1YMEA 1TKHA 2CF4A 2CIJA 4MHZA 1FNOA 4EFDA 2GREA 3QNVA 4A37A 4UF4A 2ZEMA 5LRGA 3SI1A 2BO9A 5F09A 1XJOA 3NH5A 1AMPA 2DEAA 3N5FA 1CBXA 2V8DA 4TNUA 2QVPA 2G9DA 3PB4X 1Q7LA 1F57A 5LRJA 5K8NA 5CPAA 8CPAA 4MHYA 2V8HA 1R43A 2EK8A 4R6TA 2IQ6A 5DS0A 4P4DA 3D7DA 4ZI6A 3MRUA 2Q4ZA 1HDQA 2QYVA 3D67A 4JZ0A 4OMEA 4CPAA 1TF8A 4K3NA 2O4HA 5LYFA 1PYTB 5K8OA 2GU2A 3RBUA 4B6ZA 3D7HA 1NSAA 2HB6A 3FEDA 1TKJA 3KQXA 1F2OA 2F7VA 3KHZA 4ZY1A 2C6PA 2PJ0A 1VGYA 3D66A 1QQ9A 3VATA 4FUUA 4BD9A 2ZENA 2AFUA 2GLFA 4OC5A 4IAVA 2AFWA 3FH4A 1Z5RA 2ZEHA 2NSMA 3PFOA 4EWTA 1LFWA 2EK9A 2AFZA 5HVFA 3CDXA 2OOTA 1RTQA 3VH9A 4F9VA 4DUKA 3SJGA 3PB7X 3IWWA 3BXMA 2Q51A 3HLPA 1R3NA 2ZEPA 3ISZA 3K2KA 2ZELA 3PRTA 5LYIA 5I4MA 1HEEA 1VHEA 4A38A 4OP4A 2PJCA 3B35A 3SJFA 2NYQA 5IB9A 1Y0YA 4F9UA 4P10A 3B3TA 2PJ1A 1ELMP 3KQZA 4PXCA 4OC3A 3FECA 3FJUA 3WC6A 3GLJA 4P4FA 3DLJA 4H2KA 4G1PA 3RAMA 3K9TA 4Q7AA 4OIDA 2RB7A 2C1CA 3B3CA 3HUVA 2EWBA 2J9AA 2PVWA 3IFEA 4WWVA 4P6YA 1YSJA 2PE3A 4EMEA 3V7ZA 1TKFA 2IMOA 3WC5A 3B3SA 5D29A 3PBEA 2GLJA 2OR4A 4ZY0A 4UIBA 2JBKA 3SI2A 1YW6A 3D4UA 3H8FA 4OC4A 5JM6A 5LYLA 3IC1A 1LAPA 1Z8LA 4AXVA 4OKOA 1TF9A 3KR5A 2F8HA 1ARMA 2PJ6A 4X3RA 4X2TA 4R7MA 4LQGA 2AFSA 3PB8X 3S9NA 1JQGA 2PJ2A 2WZNA 3BI1A 2XEGA 2C6GA 4ONWA 4NGSA 3IIBA 2PJAA 4FWUA 1BAVA 4UEFA 2PRQA 4Z65A 1VHOA 3KHXA 3KASA 4OC2A 2I3CA 3SJEA 1FT7A 2WYRA 3VARA 2PIYA 5J1QA 2PJ8A 1XMBA 4OIWA 4PXDA 4RUHA 4WJBA 4A94A 3H8GA 3SJXA 4MCSA 3GUXA 1BPNA 2PVVA 1BPMA 4DJLA 2ANPA 3WT4A 3NH8A 1BLLE 3KGQA 2CTCA 3TX8A 1TXRA 3JRUA 4P44A 4P4JA 1UWYA 2C6CA 4NJRA 1Z2LA 4MCRA 1Y0RA 1CX8A 1KWMA 3D7GA 4MHPA 1YLOA 1DE4C 1QMUA 3B7IA 2ZEFA 3B3WA 4MRIA 4UIAA 4IK2A 1OBRA 4GM5A 4TWEA 3IJ3A 4R8FA 3WC7A 2AFXA 2ZEEA 3SI0A 4NGNA 4JYWA 1XBUA 2PJBA 3LWUA 2AFOA 2IJZA 3PBBA 5HXDA 3GB0A 4P45A 5LRKA 4YU9A 2ABZA 5D8NA 2AFMA 3CPAA 3S9MA 4MMOA 2XEJA 2ZOFA 1YW4A 4PXEA 3CPXA 3PB6X 4NGTA
chains in the Genus database with same CATH superfamily
2GJPA 1XE4A 3CZXA 4XLEA 4G6IA 2V8VA 4B3GA 2F5IA 2ZEOA 2WJVA 4Y7CA 4P25A 1N8RD 1SKYB 2BGIA 4KVME 2YWFA 2O53A 4W9YA 3FX6A 1G7TA 3QFTA 1Y9WA 3F0AA 4XLFA 4G1VA 4YELA 5K8PA 4UWIA 2JN9A 4X06A 2IL4A 1WDTA 2WZPP 1EP2B 2X8KA 3ASRA 3BNWA 4M1KA 4HE5A 4NJQA 3D2PA 1EFRA 2GJRA 1Y7EA 2HQYA 2FT0A 4MXUA 4M3SA 3LMSA 2CBXA 1M1DA 4II9A 2ZOGA 3PFEA 3ZIAA 2Q6OA 4B13A 4DNTB 2PJ7A 3IEHA 1OGIA 3NFZA 4O23A 4OC0A 1PCAA 1IJFA 1IHMA 5G22A 2EO8A 1XOVA 1B6BA 1HVXA 1RQPA 2ARHA 1TIQA 4NNJA 3R6KA 1YR0A 2JEWA 2I00A 3NE8A 1WPCA 3LVBA 2YWEA 3TE4A 2RFHA 3KEWA 3U6KA 2EFGA 1F2PA 2B7BA 3VO2A 1EE3P 1M4IA 5KSWB 3CW2A 2P3MA 2E1RA 3L2NA 4A39A 1V0FA 1S7NA 2HLDA 4WZKA 1XF8A 4ZX9A 4WZLA 4LUAA 5HXBA 3LO8A 1XRYA 2F1LA 2GK6A 6CPAA 1QUFA 2VNKA 2QMLA 5TY0A 2Z3KA 2HUZA 2BOAA 5J8FA 2ZEDA 3WR7A 2ZZFA 3NH4A 3G05A 1VQ8B 2REEA 3LNNA 3MN8A 2B7CA 5KTDA 4XN3A 4RD2A 1YJNB 4G7WA 5K8MA 4UCNA 1E79A 3DSBA 3GY9A 1N08A 1YREA 3G71B 3BI0A 4Z4RA 2X7BA 3TTHA 1YMEA 4MFZA 1GR1A 1IICA 1FNOA 4X7CA 1QG0A 1T6XA 4U9UA 3R96A 2CRVA 1W87A 3OFNA 3T9YA 3V8IA 2G3AA 2CC2A 2D3LA 4UF4A 2ZBVA 2ZEMA 5A88A 4M53A 5LRGA 3EXNA 5BWAB 1XJOA 3NH5A 3J81k 1PUAA 4MY3A 4ZGNB 4OOVA 1S3ZA 3PUNA 1F57A 3R1KA 1Q7YD 1D1NA 2CW5A 2EK8A 2VNJA 4ZI6A 2Q4ZA 2EBJA 3V7AA 4CAVA 3D67A 3OW7A 4PAAA 2O4HA 1VQ7B 3ZPNA 4A30A 2H5MA 2M5SA 3CCJB 1W9XA 3MGDA 2A4NA 2P0WA 1KUVA 4B6ZA 2EIXA 3FEDA 4ZY1A 1PKVA 1B23P 2FIWA 1BMFA 1GO2A 4CYNA 3VATA 2WUUA 3FBUA 4BD9A 3FPPA 5G21A 1Z5RA 1K8AD 1YVOA 1UMKA 1FX0A 4PV6A 4Y49B 4OOSA 1B87A 5DWNA 4NBSA 1VQOB 4FK8A 1E3ZA 1GJRA 2VJJA 4YAFA 1S72B 4NCZA 3TO6A 3PB7X 3IWWA 3HLPA 1NB0A 4Z4SA 1BLIA 4C68A 1ON0A 5BSXA 3ISZA 2I79A 3D3SA 4P26A 3WXMA 5IYRA 1G7RA 3PRTA 1HEEA 4OAEA 2OK8A 1QSTA 2B5GB 4NEXA 3FPKA 4CRZB 2KCWA 4XM3A 4P10A 4B5OA 3PGPA 2PJ1A 4F6AA 2OH1A 3KQZA 4MY0A 5AG4A 3WC6A 4UFVA 2DOGA 2Q6LA 3WYAA 2QA4B 2ZZGA 4P4FA 1KJZA 1QGYA 4G1PA 4CQJA 3BJ7A 1WOPA 1DDIA 1Q2CA 2ZPAA 4OIDA 4FD4A 2V7UA 4MFLA 4RD0A 1UFHA 2EWBA 4KLVA 4YGOA 3W2EA 4P6YA 4EMEA 2IMOA 3CXCB 1QFZA 4UCPA 4Y9UA 3CCSB 3OJXA 2OK7A 2GLJA 5B6IA 2OR4A 2FXFA 3EY5A 1MJAA 3SI2A 4KOTA 2ZL6A 4OC4A 4H6ZA 1Z8LA 1D8TA 1N05A 3NE7A 3BY1A 2X0KA 3E0KA 2ZXHA 4XOPA 4QC6A 3LQEA 2F8HA 2PJ6A 1ELOA 4X2TA 3OZUA 2P6FA 2AFSA 3PB8X 3ASSA 3S9NA 4AVCA 1JQGA 3FXTA 2C6GA 4UBRA 4YAUA 3IIBA 2PJAA 2X6XA 3G4SB 4EVYA 4MFKA 1G7SA 2GFQA 5G20A 3WNCA 5DSZA 1P0HA 2EVNA 1VHOA 2F4NA 3IGRA 3KHXA 4OC2A 3SJEA 5LMZA 4OPVA 2PIYA 3VARA 1NDHA 2PJ8A 1NRKA 1FNCA 4GQNA 4RUHA 1S0UA 1J9ZA 2DF5A 4CGOA 4RD1A 4XORA 4C7HA 3OOCA 2VEZA 4MCSA 1BPMA 3GIUA 4HE6A 4DJLA 3NH8A 1WWZA 4J3GA 2VYQA 1FY7A 1WSRA 4TSFA 1MRZA 1TXRA 4RCZA 3I55B 4P44A 2JEVA 3W6XA 2J8NA 2X6YA 3S6GA 3PUMA 2BSWA 1DE4C 2LZJA 4YXWA 1M1KD 4YAOA 1FNDA 4IK2A 1OBRA 2VBUA 3IJ3A 1S5KA 1AIPA 4R8FA 2AJ6A 2B3UA 2ZEEA 4II2A 4NGNA 1XBUA 1VF7A 1ZUNB 2AFOA 2DIEA 4PC3A 4QV2A 5LRKA 3CPAA 3TT2A 2C5BA 3CD6B 1V0EA 3FKSA 2P6GA 4X0CA 1YW4A 1XMTA 2BVNA 1I1DA 1CQXA 5FO1A 2OZUA 1UD6A 3B2YA 3CT9A 3W91A 1VQ9B 4ZY2A 4OADA 4DYOA 4JMQA 5IV0A 1JA1A 1ELLP 4Y49C 1DTDA 5AN9A 1Z4RA 1PJ6A 5F46A 1Z9UA 5DWMA 1UD4A 5EBVA 3S9LA 1QUEA 2GE3A 4TT3A 4R71A 1EP1B 3VNVA 2FCKA 1NBMA 4Z4WA 2FVGA 4R9MA 5HVGA 2G0BA 3LODA 1YJ9B 1MJBA 2B4DB 1ZG8A 3CXPA 4F0YA 4FBEA 2R7HA 1I8DA 4DQKA 2PIZA 3ZZUA 3CESA 3CCLB 1SKQA 1CP7A 4UEEA 2KVOA 3RZAA 2PJ4A 2VXKA 4R87A 4XPDC 4E0AA 3A1PA 3A3BA 3PEIA 4OC1A 4NSQA 5ELYA 2ZL7A 4ZGQB 1AMOA 1AYEA 2AE6A 3I1UA 4X8IA 3D68A 3MMPA 3CXQA 1N06A 4HIZA 3AGQA 4JWPA 1YI2B 2Z3LA 4P2NA 4A2ZA 1T6ZA 5IYNA 1KK2A 1HDUA 3SXNA 4UWJA 1ZLIA 2PDOA 4RPBA 1XEBA 3JQQA 3AVVA 4Z4VA 1RQRA 4A33A 2ZTGA 1GYTA 3D2MA 2ZEGA 3OZVA 2GJKA 1TUIA 5HKKA 1LCPA 3CMAB 3KZWA 4UEZA 3ZUGA 1ZLHA 4F8ZA 2NMTA 4OOXA 2XEFA 4LX9A 4C43A 1VQKB 4KOWA 2PR1A 1YK3A 1WOOA 4Z4ZA 1LANA 1K73D 4XLCA 2XZOA 2CIJA 4XKVA 3R9EA 1HA3A 2Q4YA 4R3KA 3A35A 3A8KA 3A8IA 2OBSA 5H86A 4OPSA 1QSOA 1JB9A 3W5VA 4EFDA 3GKRA 3QNVA 5IX3A 2Q6KA 3OPOA 1HZEA 1KMHA 2JIZA 4RS2A 3T56B 1VLYA 4L8JA 3KKWA 2DEAA 1H85A 1S4MA 3Q6RA 1WORA 4HNXB 2QVPA 4ORFA 4QUSA 3PB4X 4AB7A 5K8NA 3NE5B 4PK2A 2V8HA 3H5ZA 5DS0A 4P4DA 5F47A 4B47A 3FNCA 2GPJA 3GIRA 2OTLB 1ZM2A 1VQNB 4K3NA 3SJPA 4RI1A 1Z4EA 3CCRB 3LQ6A 1W35A 2QIRA 2WPXA 3MCAA 4RD6A 3TCVA 1NSAA 3CC4B 3ASPA 1F2OA 2FX3A 1VLOA 2X6WA 2CNDA 4FUUA 1WK4A 1EFTA 1QX4A 4KORA 3BCFA 2NSMA 2Z10A 5KTCA 4B43A 2X85A 3HAGA 4X07A 1IJEA 2BSAA 5C82A 4P9SA 4Z4YA 2OOTA 3TO9A 3U2QA 1RTQA 2XOKA 4LBZA 1XE1A 1LRZA 3SJGA 3BC9A 4B44A 4HNYB 1PJ5A 1R3NA 2WSSA 3FRMA 1FNBA 3WQZA 5F4MA 3K2KA 4KKUA 3OP1A 2YNCC 3DNSA 4KZTA 3CRZA 3W5UA 2OZHA 5LYIA 1OGJA 2W6IA 2FIAA 1KK1A 4OP4A 1QH0A 1UD2A 3SJFA 2D3NA 2V4DA 5KTAA 5IB9A 4B5PA 4AVBA 2BF4A 4RCYA 4II3A 2BM0A 4ZCIA 2BM1A 4PXCA 3FJUA 3GYAA 5IK2A 4CGPA 3ZJ0A 4NF1A 3K9TA 2Q4VA 2RB7A 5F48A 1JA0A 1BQEA 4TMTA 2C1CA 3H4QA 2PVWA 4XOTA 3IWGA 3V76A 2OBTA 5EMNA 4E2AA 2PE3A 4XPKA 4E0FA 5HZBA 3B3SA 4NCNA 4JD6A 5D29A 4GS4A 5A28A 3TOAA 3Q38A 2D9RA 4FXUA 1YW6A 4C2XA 1FDRA 1VQLB 4N3NA 4MFPA 2VZZA 4MI4A 1TF9A 3KR5A 4M4SA 1M4DA 1OB5A 1VQPB 2JLMA 3CCVB 3A9LA 1YX0A 4X3RA 4P12A 5JBQA 2BUEA 1EFUA 3P27A 1QFJA 3I1FA 5F4OA 4P1VA 2C27A 2EUIA 1KTVA 3Q39A 4FWUA 1BAVA 4UEFA 1E62A 4TMXA 4Z65A 3ZZIA 1IU8A 3KASA 2I3CA 2WYRA 2Z3OA 3G6EB 5J1QA 3E20A 3WBJA 3JVNA 3U6BA 3H8GA 3R9GA 4AG9A 3QSYA 1BPNA 3QAHA 2GQFA 1GAQA 2FL4A 2Q04A 2ANPA 2VBTA 1BLLE 4CYOA 3T51B 2CTCA 4NJRA 4HPSA 4MCRA 3D7GA 2V7QA 3QAYA 3B7IA 2QTLA 1QGZA 3F8KA 3B3WA 1CJWA 5TV2A 1VQMB 4UFWA 3DR6A 2YGWA 1E3XA 1AUGA 3WC7A 2AFXA 3LWUA 1E63A 3FYNA 3CB4A 3GB0A 2ABZA 5D8NA 4LQ6A 3S9MA 1CNEA 2Z6BD 1IB0A 1VJSA 3GVJA 3W2FA 5IYQA 2F43A 4NGTA 1M4LA 2YWGA 3ZZ0A 4B4DA 3NA6A 3FEEA 1H8LA 1FRNA 4X7EA 1QFYA 4KVXA 2Z3PA 2CY2A 4P4BA 5GCNA 1NMTA 1JJ2B 4KKTA 4XMYA 4F0XA 5JQ4A 2BV3A 4NGQA 2BEIA 2E1BA 1VHSA 3H8EA 1S7KA 3B8GA 1VQ5B 5GV7A 1KK3A 5JGFA 4OPOA 1CP6A 3IU2A 2VBVA 1LOKA 4TMVA 1NSLA 3KR4A 4ROXA 1YHQB 4MBUA 1XFOA 1E1RA 4XPLA 3V38A 2ZZQA 3CP2A 1IGBA 2XEIA 3VO1A 4MCPA 4YWYA 2NV4A 5FVJA 3FMCA 1M44A 3KL9A 2JBJA 2QDXA 3TOBA 4OLLA 4IHMA 1LAMA 5J8CA 5KW9A 3OZWA 1K9MD 2D4OA 1FNMA 2D74A 2QN6A 3QB8A 1F60A 4NFRA 4B3XA 4C0SA 3FVLA 5H84A 3WABA 3AGPA 4R76A 3QE2A 1TTTA 1YQEA 2B58A 4MJ8A 4NGMA 1D2EA 4FD7A 4FAIA 3ONYA 4Z1MA 4M0LA 1YLEA 1QSNA 3BQJA 4CYQA 4NGRA 5FIUA 4PK3A 3IO1A 1IIDA 4WZTA 3T8WA 2PJ5A 3KI9A 4YRHA 3PA1A 4NGPA 4XN0A 1CPXA 5F49A 2WPDA 5AG7A 3W2HA 4BBHA 1IY7A 2C78A 4CGMA 4LBYA 1H42A 2XZPA 3CCEB 2QEXB 3IU1A 4PXBA 2GIVA 2AHOA 2DPTA 3PP9A 4ZYQA 1I18A 1RO5A 4L89A 2ZBUA 2OU2A 3DGVA 4RDLA 3OAAA 2YNCA 3RYOA 3FB3A 1B2RA 1E1QA 3BHXA 4TKOB 5J35A 5IYWA 3C26A 3W5HA 2V7WA 4QVTA 1ZG7A 3DDDA 4J0QA 4PABA 4AVZA 4RDJA 1K28D 1QGAA 2K5TA 1KZFA 4CAFA 4X5KA 1KUXA 2GREA 2JDCA 2BO9A 5F09A 4B10A 2R8VA 4KS9A 4Q38A 1GHEA 3DDYA 1ZM9A 4JLYA 1F20A 4MFQA 5CPAA 4MHYA 2CXAA 1R43A 4R6TA 2IQ6A 5FO0A 2V7VA 1PJ7A 1Y7RA 4CPAA 1T6YA 3VWEA 1Q81D 5K8OA 2GU2A 2XZLA 4FN5A 1UD3A 2DPSA 3OEHA 3SJZA 3W2IA 2HB6A 3KHZA 2W6JA 1Z8XA 2PJ0A 2XEXA 1VGYA 3AVYA 3CCMB 3G3SA 5HMNA 3PZJA 1S7FA 4B14A 1R57A 2HMAA 2ZENA 4B48A 2AFUA 3N7ZA 2GLFA 2PIAA 4OC5A 2AFWA 3FH4A 4M2LA 2ZEHA 3PFOA 3JUWA 1P4MA 4KOUA 2JJ2A 3SLNA 2OBRA 5C88A 1U2RA 2AFZA 3R95A 1GVHA 4DK1A 1W0JA 4CAWA 2QTZA 3VH9A 2PMDA 3CC7B 4H6UA 5IB0A 1Q82D 4DUKA 1X10A 2J8MA 1BOBA 4WQMA 4FD5A 2V7XA 1TLLA 3JQRA 1U6MA 2PLFA 4MYUA 4YHBA 3H94A 4X7FA 1IOIA 2ZW7A 2GANA 1GAWA 3VNUA 4IW3B 2CK3A 3CCUB 3BCDA 1JWQA 1VQ4B 2ZELA 5I4MA 2Z11A 1VHEA 5L46A 3RNZA 4YALA 3W2GA 1EXMA 1Y0YA 2R6HA 4F9UA 4PC6A 1R5BA 3MHPA 3H9NA 4HKFA 2DXQA 4B5PB 1XIXA 1ELMP 4RPDA 1E64A 2R9VA 3FECA 4X7DA 2Y0MA 5E96A 2X53S 2XGJA 2Z0ZA 3DLJA 4H2KA 3ONUA 3BJ8A 3RAMA 4CS0B 5AG6A 3B3CA 3HUVA 1ZO0A 4WWVA 4ASUA 4KUBA 2QE7A 4C2ZA 5THXA 1YSJA 4XNFA 3JU4A 2FE7A 2VJIA 3V7ZA 3EC4A 3LD2A 4DNRB 3WC5A 2VNHA 4KOSA 2NPFA 1I21A 4M6HA 2R1IA 3PBEA 4ZY0A 1XQBA 4JXQA 2JBKA 3D4UA 1QVGB 4KUAA 3H8FA 3OWCA 5JM6A 4ACAA 1EFCA 1LAPA 1OB0A 3A8JA 4P22A 3AVWA 4AXVA 1L0CA 5FA6A 4TMZA 1MK4A 2PR8A 2B5OA 2XNDA 1BO4A 1ARMA 4Y9RA 2WR8A 4R7MA 4YEJA 4CAEA 4ZCLA 3F5BA 4PGOA 4TN1A 2PC1A 1KQSB 2HDNB 3BI1A 4QHYA 1N0VC 2ZITA 4CRYB 4JJXA 4UZUA 4XD7A 5H59A 4JXRA 5AG5A 4RD4A 4PSWA 1K4JA 1H8EA 1WTHD 1FT7A 4TMWA 2ZW6A 3JTKA 5EMIA 2OZGA 1FRQA 2P6EA 4OIWA 4WJBA 4A94A 2BMWA 3OEEA 2CNTA 3GUXA 2PVVA 3EFAA 4RJLA 3RY8A 2WJYA 2DY1A 3WT4A 4WZEA 5EC4A 4PC7A 3E1YE 5A8AA 1SM4A 2B4DA 2C6CA 4F7DA 2F1MA 1Y0RA 1KWMA 2DEUA 2VBSA 1YLOA 3BLNA 4LC0A 2ZEFA 1R5NA 5E6TA 4OP7A 4MRIA 4P3IA 4GM5A 2Z3NA 1ZM4A 3SI0A 1OB2A 1IYKA 4JYWA 2PJBA 1W2BB 4P45A 4M6IA 3CCQB 1JNYA 4CYPA 4LBWA 2HV2A 2AFMA 3P26A 4MMOA 2XEJA 1Y9KA 4PXEA 2PSWA 1E43A 3AVUA 3TFYA 2XNCA 1T5EA 2C2WA 3CP8A 7CPAA 3ZBTA 4MHNA 4UFXA 2C77A 3B8HA 2O28A 2FSRA 3QFSA 4XNHB 3OE7A 5JH9A 2YNEA 2QJ8A 1VIXA 3B3VA 3ISXA 4UAJA 2DERA 4MCQA 4FWTA 3EO4A 5HVHA 2G3TA 2Q43A 1ARLA 1PU9A 3TC8A 5H5JA 3I3GA 2BCOA 5FL7A 1X12A 4RLZA 4PPZA 3ASQA 3PB9X 3T90A 3R6JA 4KKSA 3D7FA 2J7KA 4G5GA 1MJ9A 5ISVA 4K1XA 3CC2B 2QMUA 5LYDA 4I49A 3SEJA 2PJ9A 1A8PA 4Q7JB 4B12A 2VZLA 3S6FA 3SXOA 1KUYA 4MHDA 4G1BA 1IOFA 2HC9A 1KC8D 2R98A 1M4GA 3S6KA 4C2YA 1IB1E 4KOXA 1S60A 5TR9A 2C4UA 1WSVA 4EH1A 4E8OA 2ZTNA 2CTBA 4P4IA 2Z3MA 5CBMA 3D8PA 2ZXVA 5THWA 1YJWB 4KSIA 3FF3A 4ZX8A 1SQHA 3TO7A 5I0CA 1S7LA 2VQYA 4AF7A 3UY5A 3WNBA 4PQAA 1Z8TA 1Q2YA 2J8RA 4UZEA 2D4PA 4AVAA 2VI7A 4GXHA 5HZAA 1COWA 3GVLA 3G8WA 3P2HA 4XKWA 4A32A 1KD1D 3ASTA 1CPSA 2VL1A 2Q7BA 4ZGYB 4P6VF 2VNIA 2V8GA 4QUZA 1CNFA 2PCUA 4XL9A 3GSIA 1CG2A 2PJ3A 1Z8WA 2V77A 2WPWA 2X3UA 3D26A 4P4EA 2POKA 3Q6QA 4KSAA 2DYIA 3WBKA 5DN6A 1ZG9A 1WU8A 4R3LA 2BL1A 1TKHA 1VKCA 2CF4A 4MHZA 1KRHA 4KLWA 2QGGA 4AC9A 1CM0A 3ES9A 2BGJA 4ZCMA 4ZBGA 4A37A 5CDFA 4RM0A 3SI1A 4G7XA 3QFCA 3BH4A 1AMPA 3N5FA 4Q36A 1CBXA 2ATRA 2JDIA 4AG7A 4QVJA 1P4NA 4HNWB 2V8DA 4TNUA 4UCMA 3W6SA 3PA2A 2G9DA 2YNDA 1W0KA 1Q7LA 1QSRA 5LRJA 2PRBA 4C7IA 8CPAA 2YWHA 2BPOA 3D7DA 3MRUA 4BINA 1HDQA 2QYVA 4M6GA 5HH1A 4JZ0A 4OMEA 4RN7A 1TVCA 5A27A 1TF8A 5LYFA 1PYTB 4A95A 4ONUA 3RBUA 4MYTA 3OW2B 1DDGA 3GQBA 1ZM3A 2V31A 3D7HA 3PVDA 2RC6A 2ZW5A 1TKJA 3KQXA 2F7VA 2C6PA 3D66A 1KZLA 3I9SA 1QQ9A 3T53B 1J4JA 4IAVA 1XB2A 1Q2DA 5J3OA 2RC4A 4UA3A 4EWTA 1LFWA 2EK9A 5CNPA 2C4TA 4B11A 2B4BA 5HVFA 3CDXA 3OKXA 1BX0A 1IYLA 3QFRA 4K30A 4F9VA 2Q7SA 4YAWA 1DG1G 2Q6IA 1WOSA 4Z4UA 1Q86D 3OJWA 3BXMA 2ODFA 2Q51A 1H8HA 4RD3A 2ZEPA 2PQ8A 2WSAA 4R57A 3ZBUA 4XR6A 1UD5A 4QBJA 3RO0A 2XNJA 3VWDA 1OHHA 4IUSA 2CNMA 2OTJB 4M85A 2ZXIA 4A38A 2BN4A 2PJCA 3B35A 3WY9A 4PSXA 5JPHA 4X05A 1N0UA 2I1LA 2RC5A 2NYQA 3B82A 4KVOE 4U9YA 4A31A 1M90D 3SLDA 1RXTA 1NJID 3B3TA 3VR6A 4RDKA 3JQPA 4OC3A 1BX1A 3ZC3A 4CGNA 1G7CA 3GLJA 5AGEA 1MABA 3WNDA 1EWYA 4QVAA 5IYPA 4XLHA 1A2ZA 5A89A 2QECA 4AF6A 4Q7AA 4IF5A 3ZZTA 1NE9A 2J9AA 3IFEA 3CMMA 3DR8A 2B5GA 2Q44A 2DCUA 4XNHC 4XPDB 1TKFA 4PC1A 1QSMA 1OZPA 1NB9A 4H89A 4MFJA 4UZFA 4U9ZA 1V5VA 4B3FX 4UIBA 4DK0A 3I56B 4QB9A 3LACA 2C5HA 5LYLA 3IC1A 2VZYA 4KSFA 2ZZEA 2B3VA 4OKOA 3SHPA 1I7PA 4LQGA 4QFMA 2GK7A 1Q9SA 3AVTA 4U5YA 4ZV4A 2WZNA 2PJ2A 1WP6A 1UD8A 2XEGA 3R9FA 4ONWA 4DNCA 3FJOA 5F4JA 3VMFA 1N71A 4NGSA 1I12A 2HCJB 3A3GA 3GVKA 1YVKA 3BY2A 4XLAA 1V0CA 2JJ1A 2PRQA 1N07A 4PC2A 2Q0YA 4KOVA 4XQFA 4P3YA 3CMEB 2FS5A 1EP3B 4H9GA 4BMHA 4BPRA 1XMBA 4KOYA 4PXDA 5G1ZA 4YFJA 1YIJB 3SJXA 3S6HA 4CAXA 1R5OA 2DETA 5GV8A 4DQLA 3Q3AA 3KGQA 5KNLA 3CXSA 5TRDA 3TX8A 3JRUA 1YGHA 4P4JA 2REFA 2CNSA 1VQ6B 1UWYA 4NXYA 1QVFB 1Z2LA 2ZL5A 1CX8A 4MHPA 1QMUA 1DARA 4Z4TA 3CTAA 5BSYA 4N3GA 4UIAA 4L8AA 4TWEA 1YITB 2VBQA 4XONA 2OYNA 3IWEA 1KK0A 1W34A 5FNZA 2OB0A 2IJZA 2JDDA 3PBBA 2ZW4A 4FD6A 5HXDA 3B78A 4CGLA 4YU9A 1BPLA 3CPWB 3SKBA 4LBVA 1YX2A 3K9UA 3AVXA 2ZOFA 3FIXA 2V7TA 3CPXA 3PB6X 4ACBA 1BJKA 3PENA 3P2FA
chains in the Genus database with same CATH topology
3B2YA 1M4LA 3CT9A 4ZY2A 2V8VA 7CPAA 4MHNA 4DYOA 3NA6A 2ZEOA 3FEEA 1H8LA 5JH9A 4P4BA 1ELLP 2QJ8A 1DTDA 1VIXA 2O53A 4W9YA 3B3VA 3ISXA 3FX6A 4MCQA 3S9LA 4NGQA 5HVHA 3H8EA 2Q43A 5K8PA 1ARLA 3TC8A 2BCOA 5JGFA 4NJQA 2FVGA 1CP6A 1Y7EA 5HVGA 1LOKA 4MXUA 4PPZA 3PB9X 3D7FA 1ZG8A 3LMSA 3KR4A 4FBEA 1XFOA 2ZOGA 3PFEA 3V38A 2PJ7A 2PIZA 3IEHA 1IGBA 2XEIA 4MCPA 4YWYA 3NFZA 4O23A 4OC0A 5LYDA 3FMCA 1PCAA 3KL9A 2JBJA 1CP7A 4UEEA 2PJ9A 3RZAA 2PJ4A 4IHMA 1LAMA 2JEWA 3PEIA 2HC9A 4OC1A 5ELYA 1AYEA 3I1UA 4X8IA 3D68A 4NFRA 3FVLA 3WABA 4R76A 2RFHA 4NGMA 2CTBA 4P4IA 4FAIA 5CBMA 1F2PA 5THWA 4KSIA 3FF3A 4NGRA 4ZX8A 1HDUA 1EE3P 3IO1A 3T8WA 2PJ5A 3KI9A 1ZLIA 4NGPA 3L2NA 1CPXA 4A39A 4PQAA 1IY7A 4ZX9A 1GYTA 1XRYA 2VL1A 1CPSA 4PXBA 2ZEGA 6CPAA 4ZYQA 1LCPA 2BOAA 2V8GA 2ZEDA 3NH4A 3DGVA 2PCUA 3KZWA 3MN8A 1CG2A 2PJ3A 4UEZA 1ZLHA 4F8ZA 5K8MA 2V77A 3BHXA 2XEFA 4P4EA 2POKA 1ZG7A 3BI0A 1ZG9A 1LANA 1YMEA 1TKHA 2CF4A 2CIJA 4MHZA 1FNOA 4EFDA 2GREA 3QNVA 4A37A 4UF4A 2ZEMA 5LRGA 3SI1A 2BO9A 5F09A 1XJOA 3NH5A 1AMPA 2DEAA 3N5FA 1CBXA 2V8DA 4TNUA 2QVPA 2G9DA 3PB4X 1Q7LA 1F57A 5LRJA 5K8NA 5CPAA 8CPAA 4MHYA 2V8HA 1R43A 2EK8A 4R6TA 2IQ6A 5DS0A 4P4DA 3D7DA 4ZI6A 3MRUA 2Q4ZA 1HDQA 2QYVA 3D67A 4JZ0A 4OMEA 4CPAA 1TF8A 4K3NA 2O4HA 5LYFA 1PYTB 5K8OA 2GU2A 3RBUA 4B6ZA 3D7HA 1NSAA 2HB6A 3FEDA 1TKJA 3KQXA 1F2OA 2F7VA 3KHZA 4ZY1A 2C6PA 2PJ0A 1VGYA 3D66A 1QQ9A 3VATA 4FUUA 4BD9A 2ZENA 2AFUA 2GLFA 4OC5A 4IAVA 2AFWA 3FH4A 1Z5RA 2ZEHA 2NSMA 3PFOA 4EWTA 1LFWA 2EK9A 2AFZA 5HVFA 3CDXA 2OOTA 1RTQA 3VH9A 4F9VA 4DUKA 3SJGA 3PB7X 3IWWA 3BXMA 2Q51A 3HLPA 1R3NA 2ZEPA 3ISZA 3K2KA 2ZELA 3PRTA 5LYIA 5I4MA 1HEEA 1VHEA 4A38A 4OP4A 2PJCA 3B35A 3SJFA 2NYQA 5IB9A 1Y0YA 4F9UA 4P10A 3B3TA 2PJ1A 1ELMP 3KQZA 4PXCA 4OC3A 3FECA 3FJUA 3WC6A 3GLJA 4P4FA 3DLJA 4H2KA 4G1PA 3RAMA 3K9TA 4Q7AA 4OIDA 2RB7A 2C1CA 3B3CA 3HUVA 2EWBA 2J9AA 2PVWA 3IFEA 4WWVA 4P6YA 1YSJA 2PE3A 4EMEA 3V7ZA 1TKFA 2IMOA 3WC5A 3B3SA 5D29A 3PBEA 2GLJA 2OR4A 4ZY0A 4UIBA 2JBKA 3SI2A 1YW6A 3D4UA 3H8FA 4OC4A 5JM6A 5LYLA 3IC1A 1LAPA 1Z8LA 4AXVA 4OKOA 1TF9A 3KR5A 2F8HA 1ARMA 2PJ6A 4X3RA 4X2TA 4R7MA 4LQGA 2AFSA 3PB8X 3S9NA 1JQGA 2PJ2A 2WZNA 3BI1A 2XEGA 2C6GA 4ONWA 4NGSA 3IIBA 2PJAA 4FWUA 1BAVA 4UEFA 2PRQA 4Z65A 1VHOA 3KHXA 3KASA 4OC2A 2I3CA 3SJEA 1FT7A 2WYRA 3VARA 2PIYA 5J1QA 2PJ8A 1XMBA 4OIWA 4PXDA 4RUHA 4WJBA 4A94A 3H8GA 3SJXA 4MCSA 3GUXA 1BPNA 2PVVA 1BPMA 4DJLA 2ANPA 3WT4A 3NH8A 1BLLE 3KGQA 2CTCA 3TX8A 1TXRA 3JRUA 4P44A 4P4JA 1UWYA 2C6CA 4NJRA 1Z2LA 4MCRA 1Y0RA 1CX8A 1KWMA 3D7GA 4MHPA 1YLOA 1DE4C 1QMUA 3B7IA 2ZEFA 3B3WA 4MRIA 4UIAA 4IK2A 1OBRA 4GM5A 4TWEA 3IJ3A 4R8FA 3WC7A 2AFXA 2ZEEA 3SI0A 4NGNA 4JYWA 1XBUA 2PJBA 3LWUA 2AFOA 2IJZA 3PBBA 5HXDA 3GB0A 4P45A 5LRKA 4YU9A 2ABZA 5D8NA 2AFMA 3CPAA 3S9MA 4MMOA 2XEJA 2ZOFA 1YW4A 4PXEA 3CPXA 3PB6X 4NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2Y A;  1M4L A;  3CT9 A;  4ZY2 A;  2V8V A;  7CPA A;  4MHN A;  4DYO A;  3NA6 A;  2ZEO A;  3FEE A;  1H8L A;  5JH9 A;  4P4B A;  1ELL P;  2QJ8 A;  1DTD A;  1VIX A;  2O53 A;  4W9Y A;  3B3V A;  3ISX A;  3FX6 A;  4MCQ A;  3S9L A;  4NGQ A;  5HVH A;  3H8E A;  2Q43 A;  5K8P A;  1ARL A;  3TC8 A;  2BCO A;  5JGF A;  4NJQ A;  2FVG A;  1CP6 A;  1Y7E A;  5HVG A;  1LOK A;  4MXU A;  4PPZ A;  3PB9 X;  3D7F A;  1ZG8 A;  3LMS A;  3KR4 A;  4FBE A;  1XFO A;  2ZOG A;  3PFE A;  3V38 A;  2PJ7 A;  2PIZ A;  3IEH A;  1IGB A;  2XEI A;  4MCP A;  4YWY A;  3NFZ A;  4O23 A;  4OC0 A;  5LYD A;  3FMC A;  1PCA A;  3KL9 A;  2JBJ A;  1CP7 A;  4UEE A;  2PJ9 A;  3RZA A;  2PJ4 A;  4IHM A;  1LAM A;  2JEW A;  3PEI A;  2HC9 A;  4OC1 A;  5ELY A;  1AYE A;  3I1U A;  4X8I A;  3D68 A;  4NFR A;  3FVL A;  3WAB A;  4R76 A;  2RFH A;  4NGM A;  2CTB A;  4P4I A;  4FAI A;  5CBM A;  1F2P A;  5THW A;  4KSI A;  3FF3 A;  4NGR A;  4ZX8 A;  1HDU A;  1EE3 P;  3IO1 A;  3T8W A;  2PJ5 A;  3KI9 A;  1ZLI A;  4NGP A;  3L2N A;  1CPX A;  4A39 A;  4PQA A;  1IY7 A;  4ZX9 A;  1GYT A;  1XRY A;  2VL1 A;  1CPS A;  4PXB A;  2ZEG A;  6CPA A;  4ZYQ A;  1LCP A;  2BOA A;  2V8G A;  2ZED A;  3NH4 A;  3DGV A;  2PCU A;  3KZW A;  3MN8 A;  1CG2 A;  2PJ3 A;  4UEZ A;  1ZLH A;  4F8Z A;  5K8M A;  2V77 A;  3BHX A;  2XEF A;  4P4E A;  2POK A;  1ZG7 A;  3BI0 A;  1ZG9 A;  1LAN A;  1YME A;  1TKH A;  2CF4 A;  2CIJ A;  4MHZ A;  1FNO A;  4EFD A;  2GRE A;  3QNV A;  4A37 A;  4UF4 A;  2ZEM A;  5LRG A;  3SI1 A;  2BO9 A;  5F09 A;  1XJO A;  3NH5 A;  1AMP A;  2DEA A;  3N5F A;  1CBX A;  2V8D A;  4TNU A;  2QVP A;  2G9D A;  3PB4 X;  1Q7L A;  1F57 A;  5LRJ A;  5K8N A;  5CPA A;  8CPA A;  4MHY A;  2V8H A;  1R43 A;  2EK8 A;  4R6T A;  2IQ6 A;  5DS0 A;  4P4D A;  3D7D A;  4ZI6 A;  3MRU A;  2Q4Z A;  1HDQ A;  2QYV A;  3D67 A;  4JZ0 A;  4OME A;  4CPA A;  1TF8 A;  4K3N A;  2O4H A;  5LYF A;  1PYT B;  5K8O A;  2GU2 A;  3RBU A;  4B6Z A;  3D7H A;  1NSA A;  2HB6 A;  3FED A;  1TKJ A;  3KQX A;  1F2O A;  2F7V A;  3KHZ A;  4ZY1 A;  2C6P A;  2PJ0 A;  1VGY A;  3D66 A;  1QQ9 A;  3VAT A;  4FUU A;  4BD9 A;  2ZEN A;  2AFU A;  2GLF A;  4OC5 A;  4IAV A;  2AFW A;  3FH4 A;  1Z5R A;  2ZEH A;  2NSM A;  3PFO A;  4EWT A;  1LFW A;  2EK9 A;  2AFZ A;  5HVF A;  3CDX A;  2OOT A;  1RTQ A;  3VH9 A;  4F9V A;  4DUK A;  3SJG A;  3PB7 X;  3IWW A;  3BXM A;  2Q51 A;  3HLP A;  1R3N A;  2ZEP A;  3ISZ A;  3K2K A;  2ZEL A;  3PRT A;  5LYI A;  5I4M A;  1HEE A;  1VHE A;  4A38 A;  4OP4 A;  2PJC A;  3B35 A;  3SJF A;  2NYQ A;  5IB9 A;  1Y0Y A;  4F9U A;  4P10 A;  3B3T A;  2PJ1 A;  1ELM P;  3KQZ A;  4PXC A;  4OC3 A;  3FEC A;  3FJU A;  3WC6 A;  3GLJ A;  4P4F A;  3DLJ A;  4H2K A;  4G1P A;  3RAM A;  3K9T A;  4Q7A A;  4OID A;  2RB7 A;  2C1C A;  3B3C A;  3HUV A;  2EWB A;  2J9A A;  2PVW A;  3IFE A;  4WWV A;  4P6Y A;  1YSJ A;  2PE3 A;  4EME A;  3V7Z A;  1TKF A;  2IMO A;  3WC5 A;  3B3S A;  5D29 A;  3PBE A;  2GLJ A;  2OR4 A;  4ZY0 A;  4UIB A;  2JBK A;  3SI2 A;  1YW6 A;  3D4U A;  3H8F A;  4OC4 A;  5JM6 A;  5LYL A;  3IC1 A;  1LAP A;  1Z8L A;  4AXV A;  4OKO A;  1TF9 A;  3KR5 A;  2F8H A;  1ARM A;  2PJ6 A;  4X3R A;  4X2T A;  4R7M A;  4LQG A;  2AFS A;  3PB8 X;  3S9N A;  1JQG A;  2PJ2 A;  2WZN A;  3BI1 A;  2XEG A;  2C6G A;  4ONW A;  4NGS A;  3IIB A;  2PJA A;  4FWU A;  1BAV A;  4UEF A;  2PRQ A;  4Z65 A;  1VHO A;  3KHX A;  3KAS A;  4OC2 A;  2I3C A;  3SJE A;  1FT7 A;  2WYR A;  3VAR A;  2PIY A;  5J1Q A;  2PJ8 A;  1XMB A;  4OIW A;  4PXD A;  4RUH A;  4WJB A;  4A94 A;  3H8G A;  3SJX A;  4MCS A;  3GUX A;  1BPN A;  2PVV A;  1BPM A;  4DJL A;  2ANP A;  3WT4 A;  3NH8 A;  1BLL E;  3KGQ A;  2CTC A;  3TX8 A;  1TXR A;  3JRU A;  4P44 A;  4P4J A;  1UWY A;  2C6C A;  4NJR A;  1Z2L A;  4MCR A;  1Y0R A;  1CX8 A;  1KWM A;  3D7G A;  4MHP A;  1YLO A;  1DE4 C;  1QMU A;  3B7I A;  2ZEF A;  3B3W A;  4MRI A;  4UIA A;  4IK2 A;  1OBR A;  4GM5 A;  4TWE A;  3IJ3 A;  4R8F A;  3WC7 A;  2AFX A;  2ZEE A;  3SI0 A;  4NGN A;  4JYW A;  1XBU A;  2PJB A;  3LWU A;  2AFO A;  2IJZ A;  3PBB A;  5HXD A;  3GB0 A;  4P45 A;  5LRK A;  4YU9 A;  2ABZ A;  5D8N A;  2AFM A;  3CPA A;  3S9M A;  4MMO A;  2XEJ A;  2ZOF A;  1YW4 A;  4PXE A;  3CPX A;  3PB6 X;  4NGT A; 
#chains in the Genus database with same CATH topology
 2GJP A;  1XE4 A;  3CZX A;  4XLE A;  4G6I A;  2V8V A;  4B3G A;  2F5I A;  2ZEO A;  2WJV A;  4Y7C A;  4P25 A;  1N8R D;  1SKY B;  2BGI A;  4KVM E;  2YWF A;  2O53 A;  4W9Y A;  3FX6 A;  1G7T A;  3QFT A;  1Y9W A;  3F0A A;  4XLF A;  4G1V A;  4YEL A;  5K8P A;  4UWI A;  2JN9 A;  4X06 A;  2IL4 A;  1WDT A;  2WZP P;  1EP2 B;  2X8K A;  3ASR A;  3BNW A;  4M1K A;  4HE5 A;  4NJQ A;  3D2P A;  1EFR A;  2GJR A;  1Y7E A;  2HQY A;  2FT0 A;  4MXU A;  4M3S A;  3LMS A;  2CBX A;  1M1D A;  4II9 A;  2ZOG A;  3PFE A;  3ZIA A;  2Q6O A;  4B13 A;  4DNT B;  2PJ7 A;  3IEH A;  1OGI A;  3NFZ A;  4O23 A;  4OC0 A;  1PCA A;  1IJF A;  1IHM A;  5G22 A;  2EO8 A;  1XOV A;  1B6B A;  1HVX A;  1RQP A;  2ARH A;  1TIQ A;  4NNJ A;  3R6K A;  1YR0 A;  2JEW A;  2I00 A;  3NE8 A;  1WPC A;  3LVB A;  2YWE A;  3TE4 A;  2RFH A;  3KEW A;  3U6K A;  2EFG A;  1F2P A;  2B7B A;  3VO2 A;  1EE3 P;  1M4I A;  5KSW B;  3CW2 A;  2P3M A;  2E1R A;  3L2N A;  4A39 A;  1V0F A;  1S7N A;  2HLD A;  4WZK A;  1XF8 A;  4ZX9 A;  4WZL A;  4LUA A;  5HXB A;  3LO8 A;  1XRY A;  2F1L A;  2GK6 A;  6CPA A;  1QUF A;  2VNK A;  2QML A;  5TY0 A;  2Z3K A;  2HUZ A;  2BOA A;  5J8F A;  2ZED A;  3WR7 A;  2ZZF A;  3NH4 A;  3G05 A;  1VQ8 B;  2REE A;  3LNN A;  3MN8 A;  2B7C A;  5KTD A;  4XN3 A;  4RD2 A;  1YJN B;  4G7W A;  5K8M A;  4UCN A;  1E79 A;  3DSB A;  3GY9 A;  1N08 A;  1YRE A;  3G71 B;  3BI0 A;  4Z4R A;  2X7B A;  3TTH A;  1YME A;  4MFZ A;  1GR1 A;  1IIC A;  1FNO A;  4X7C A;  1QG0 A;  1T6X A;  4U9U A;  3R96 A;  2CRV A;  1W87 A;  3OFN A;  3T9Y A;  3V8I A;  2G3A A;  2CC2 A;  2D3L A;  4UF4 A;  2ZBV A;  2ZEM A;  5A88 A;  4M53 A;  5LRG A;  3EXN A;  5BWA B;  1XJO A;  3NH5 A;  3J81 k;  1PUA A;  4MY3 A;  4ZGN B;  4OOV A;  1S3Z A;  3PUN A;  1F57 A;  3R1K A;  1Q7Y D;  1D1N A;  2CW5 A;  2EK8 A;  2VNJ A;  4ZI6 A;  2Q4Z A;  2EBJ A;  3V7A A;  4CAV A;  3D67 A;  3OW7 A;  4PAA A;  2O4H A;  1VQ7 B;  3ZPN A;  4A30 A;  2H5M A;  2M5S A;  3CCJ B;  1W9X A;  3MGD A;  2A4N A;  2P0W A;  1KUV A;  4B6Z A;  2EIX A;  3FED A;  4ZY1 A;  1PKV A;  1B23 P;  2FIW A;  1BMF A;  1GO2 A;  4CYN A;  3VAT A;  2WUU A;  3FBU A;  4BD9 A;  3FPP A;  5G21 A;  1Z5R A;  1K8A D;  1YVO A;  1UMK A;  1FX0 A;  4PV6 A;  4Y49 B;  4OOS A;  1B87 A;  5DWN A;  4NBS A;  1VQO B;  4FK8 A;  1E3Z A;  1GJR A;  2VJJ A;  4YAF A;  1S72 B;  4NCZ A;  3TO6 A;  3PB7 X;  3IWW A;  3HLP A;  1NB0 A;  4Z4S A;  1BLI A;  4C68 A;  1ON0 A;  5BSX A;  3ISZ A;  2I79 A;  3D3S A;  4P26 A;  3WXM A;  5IYR A;  1G7R A;  3PRT A;  1HEE A;  4OAE A;  2OK8 A;  1QST A;  2B5G B;  4NEX A;  3FPK A;  4CRZ B;  2KCW A;  4XM3 A;  4P10 A;  4B5O A;  3PGP A;  2PJ1 A;  4F6A A;  2OH1 A;  3KQZ A;  4MY0 A;  5AG4 A;  3WC6 A;  4UFV A;  2DOG A;  2Q6L A;  3WYA A;  2QA4 B;  2ZZG A;  4P4F A;  1KJZ A;  1QGY A;  4G1P A;  4CQJ A;  3BJ7 A;  1WOP A;  1DDI A;  1Q2C A;  2ZPA A;  4OID A;  4FD4 A;  2V7U A;  4MFL A;  4RD0 A;  1UFH A;  2EWB A;  4KLV A;  4YGO A;  3W2E A;  4P6Y A;  4EME A;  2IMO A;  3CXC B;  1QFZ A;  4UCP A;  4Y9U A;  3CCS B;  3OJX A;  2OK7 A;  2GLJ A;  5B6I A;  2OR4 A;  2FXF A;  3EY5 A;  1MJA A;  3SI2 A;  4KOT A;  2ZL6 A;  4OC4 A;  4H6Z A;  1Z8L A;  1D8T A;  1N05 A;  3NE7 A;  3BY1 A;  2X0K A;  3E0K A;  2ZXH A;  4XOP A;  4QC6 A;  3LQE A;  2F8H A;  2PJ6 A;  1ELO A;  4X2T A;  3OZU A;  2P6F A;  2AFS A;  3PB8 X;  3ASS A;  3S9N A;  4AVC A;  1JQG A;  3FXT A;  2C6G A;  4UBR A;  4YAU A;  3IIB A;  2PJA A;  2X6X A;  3G4S B;  4EVY A;  4MFK A;  1G7S A;  2GFQ A;  5G20 A;  3WNC A;  5DSZ A;  1P0H A;  2EVN A;  1VHO A;  2F4N A;  3IGR A;  3KHX A;  4OC2 A;  3SJE A;  5LMZ A;  4OPV A;  2PIY A;  3VAR A;  1NDH A;  2PJ8 A;  1NRK A;  1FNC A;  4GQN A;  4RUH A;  1S0U A;  1J9Z A;  2DF5 A;  4CGO A;  4RD1 A;  4XOR A;  4C7H A;  3OOC A;  2VEZ A;  4MCS A;  1BPM A;  3GIU A;  4HE6 A;  4DJL A;  3NH8 A;  1WWZ A;  4J3G A;  2VYQ A;  1FY7 A;  1WSR A;  4TSF A;  1MRZ A;  1TXR A;  4RCZ A;  3I55 B;  4P44 A;  2JEV A;  3W6X A;  2J8N A;  2X6Y A;  3S6G A;  3PUM A;  2BSW A;  1DE4 C;  2LZJ A;  4YXW A;  1M1K D;  4YAO A;  1FND A;  4IK2 A;  1OBR A;  2VBU A;  3IJ3 A;  1S5K A;  1AIP A;  4R8F A;  2AJ6 A;  2B3U A;  2ZEE A;  4II2 A;  4NGN A;  1XBU A;  1VF7 A;  1ZUN B;  2AFO A;  2DIE A;  4PC3 A;  4QV2 A;  5LRK A;  3CPA A;  3TT2 A;  2C5B A;  3CD6 B;  1V0E A;  3FKS A;  2P6G A;  4X0C A;  1YW4 A;  1XMT A;  2BVN A;  1I1D A;  1CQX A;  5FO1 A;  2OZU A;  1UD6 A;  3B2Y A;  3CT9 A;  3W91 A;  1VQ9 B;  4ZY2 A;  4OAD A;  4DYO A;  4JMQ A;  5IV0 A;  1JA1 A;  1ELL P;  4Y49 C;  1DTD A;  5AN9 A;  1Z4R A;  1PJ6 A;  5F46 A;  1Z9U A;  5DWM A;  1UD4 A;  5EBV A;  3S9L A;  1QUE A;  2GE3 A;  4TT3 A;  4R71 A;  1EP1 B;  3VNV A;  2FCK A;  1NBM A;  4Z4W A;  2FVG A;  4R9M A;  5HVG A;  2G0B A;  3LOD A;  1YJ9 B;  1MJB A;  2B4D B;  1ZG8 A;  3CXP A;  4F0Y A;  4FBE A;  2R7H A;  1I8D A;  4DQK A;  2PIZ A;  3ZZU A;  3CES A;  3CCL B;  1SKQ A;  1CP7 A;  4UEE A;  2KVO A;  3RZA A;  2PJ4 A;  2VXK A;  4R87 A;  4XPD C;  4E0A A;  3A1P A;  3A3B A;  3PEI A;  4OC1 A;  4NSQ A;  5ELY A;  2ZL7 A;  4ZGQ B;  1AMO A;  1AYE A;  2AE6 A;  3I1U A;  4X8I A;  3D68 A;  3MMP A;  3CXQ A;  1N06 A;  4HIZ A;  3AGQ A;  4JWP A;  1YI2 B;  2Z3L A;  4P2N A;  4A2Z A;  1T6Z A;  5IYN A;  1KK2 A;  1HDU A;  3SXN A;  4UWJ A;  1ZLI A;  2PDO A;  4RPB A;  1XEB A;  3JQQ A;  3AVV A;  4Z4V A;  1RQR A;  4A33 A;  2ZTG A;  1GYT A;  3D2M A;  2ZEG A;  3OZV A;  2GJK A;  1TUI A;  5HKK A;  1LCP A;  3CMA B;  3KZW A;  4UEZ A;  3ZUG A;  1ZLH A;  4F8Z A;  2NMT A;  4OOX A;  2XEF A;  4LX9 A;  4C43 A;  1VQK B;  4KOW A;  2PR1 A;  1YK3 A;  1WOO A;  4Z4Z A;  1LAN A;  1K73 D;  4XLC A;  2XZO A;  2CIJ A;  4XKV A;  3R9E A;  1HA3 A;  2Q4Y A;  4R3K A;  3A35 A;  3A8K A;  3A8I A;  2OBS A;  5H86 A;  4OPS A;  1QSO A;  1JB9 A;  3W5V A;  4EFD A;  3GKR A;  3QNV A;  5IX3 A;  2Q6K A;  3OPO A;  1HZE A;  1KMH A;  2JIZ A;  4RS2 A;  3T56 B;  1VLY A;  4L8J A;  3KKW A;  2DEA A;  1H85 A;  1S4M A;  3Q6R A;  1WOR A;  4HNX B;  2QVP A;  4ORF A;  4QUS A;  3PB4 X;  4AB7 A;  5K8N A;  3NE5 B;  4PK2 A;  2V8H A;  3H5Z A;  5DS0 A;  4P4D A;  5F47 A;  4B47 A;  3FNC A;  2GPJ A;  3GIR A;  2OTL B;  1ZM2 A;  1VQN B;  4K3N A;  3SJP A;  4RI1 A;  1Z4E A;  3CCR B;  3LQ6 A;  1W35 A;  2QIR A;  2WPX A;  3MCA A;  4RD6 A;  3TCV A;  1NSA A;  3CC4 B;  3ASP A;  1F2O A;  2FX3 A;  1VLO A;  2X6W A;  2CND A;  4FUU A;  1WK4 A;  1EFT A;  1QX4 A;  4KOR A;  3BCF A;  2NSM A;  2Z10 A;  5KTC A;  4B43 A;  2X85 A;  3HAG A;  4X07 A;  1IJE A;  2BSA A;  5C82 A;  4P9S A;  4Z4Y A;  2OOT A;  3TO9 A;  3U2Q A;  1RTQ A;  2XOK A;  4LBZ A;  1XE1 A;  1LRZ A;  3SJG A;  3BC9 A;  4B44 A;  4HNY B;  1PJ5 A;  1R3N A;  2WSS A;  3FRM A;  1FNB A;  3WQZ A;  5F4M A;  3K2K A;  4KKU A;  3OP1 A;  2YNC C;  3DNS A;  4KZT A;  3CRZ A;  3W5U A;  2OZH A;  5LYI A;  1OGJ A;  2W6I A;  2FIA A;  1KK1 A;  4OP4 A;  1QH0 A;  1UD2 A;  3SJF A;  2D3N A;  2V4D A;  5KTA A;  5IB9 A;  4B5P A;  4AVB A;  2BF4 A;  4RCY A;  4II3 A;  2BM0 A;  4ZCI A;  2BM1 A;  4PXC A;  3FJU A;  3GYA A;  5IK2 A;  4CGP A;  3ZJ0 A;  4NF1 A;  3K9T A;  2Q4V A;  2RB7 A;  5F48 A;  1JA0 A;  1BQE A;  4TMT A;  2C1C A;  3H4Q A;  2PVW A;  4XOT A;  3IWG A;  3V76 A;  2OBT A;  5EMN A;  4E2A A;  2PE3 A;  4XPK A;  4E0F A;  5HZB A;  3B3S A;  4NCN A;  4JD6 A;  5D29 A;  4GS4 A;  5A28 A;  3TOA A;  3Q38 A;  2D9R A;  4FXU A;  1YW6 A;  4C2X A;  1FDR A;  1VQL B;  4N3N A;  4MFP A;  2VZZ A;  4MI4 A;  1TF9 A;  3KR5 A;  4M4S A;  1M4D A;  1OB5 A;  1VQP B;  2JLM A;  3CCV B;  3A9L A;  1YX0 A;  4X3R A;  4P12 A;  5JBQ A;  2BUE A;  1EFU A;  3P27 A;  1QFJ A;  3I1F A;  5F4O A;  4P1V A;  2C27 A;  2EUI A;  1KTV A;  3Q39 A;  4FWU A;  1BAV A;  4UEF A;  1E62 A;  4TMX A;  4Z65 A;  3ZZI A;  1IU8 A;  3KAS A;  2I3C A;  2WYR A;  2Z3O A;  3G6E B;  5J1Q A;  3E20 A;  3WBJ A;  3JVN A;  3U6B A;  3H8G A;  3R9G A;  4AG9 A;  3QSY A;  1BPN A;  3QAH A;  2GQF A;  1GAQ A;  2FL4 A;  2Q04 A;  2ANP A;  2VBT A;  1BLL E;  4CYO A;  3T51 B;  2CTC A;  4NJR A;  4HPS A;  4MCR A;  3D7G A;  2V7Q A;  3QAY A;  3B7I A;  2QTL A;  1QGZ A;  3F8K A;  3B3W A;  1CJW A;  5TV2 A;  1VQM B;  4UFW A;  3DR6 A;  2YGW A;  1E3X A;  1AUG A;  3WC7 A;  2AFX A;  3LWU A;  1E63 A;  3FYN A;  3CB4 A;  3GB0 A;  2ABZ A;  5D8N A;  4LQ6 A;  3S9M A;  1CNE A;  2Z6B D;  1IB0 A;  1VJS A;  3GVJ A;  3W2F A;  5IYQ A;  2F43 A;  4NGT A;  1M4L A;  2YWG A;  3ZZ0 A;  4B4D A;  3NA6 A;  3FEE A;  1H8L A;  1FRN A;  4X7E A;  1QFY A;  4KVX A;  2Z3P A;  2CY2 A;  4P4B A;  5GCN A;  1NMT A;  1JJ2 B;  4KKT A;  4XMY A;  4F0X A;  5JQ4 A;  2BV3 A;  4NGQ A;  2BEI A;  2E1B A;  1VHS A;  3H8E A;  1S7K A;  3B8G A;  1VQ5 B;  5GV7 A;  1KK3 A;  5JGF A;  4OPO A;  1CP6 A;  3IU2 A;  2VBV A;  1LOK A;  4TMV A;  1NSL A;  3KR4 A;  4ROX A;  1YHQ B;  4MBU A;  1XFO A;  1E1R A;  4XPL A;  3V38 A;  2ZZQ A;  3CP2 A;  1IGB A;  2XEI A;  3VO1 A;  4MCP A;  4YWY A;  2NV4 A;  5FVJ A;  3FMC A;  1M44 A;  3KL9 A;  2JBJ A;  2QDX A;  3TOB A;  4OLL A;  4IHM A;  1LAM A;  5J8C A;  5KW9 A;  3OZW A;  1K9M D;  2D4O A;  1FNM A;  2D74 A;  2QN6 A;  3QB8 A;  1F60 A;  4NFR A;  4B3X A;  4C0S A;  3FVL A;  5H84 A;  3WAB A;  3AGP A;  4R76 A;  3QE2 A;  1TTT A;  1YQE A;  2B58 A;  4MJ8 A;  4NGM A;  1D2E A;  4FD7 A;  4FAI A;  3ONY A;  4Z1M A;  4M0L A;  1YLE A;  1QSN A;  3BQJ A;  4CYQ A;  4NGR A;  5FIU A;  4PK3 A;  3IO1 A;  1IID A;  4WZT A;  3T8W A;  2PJ5 A;  3KI9 A;  4YRH A;  3PA1 A;  4NGP A;  4XN0 A;  1CPX A;  5F49 A;  2WPD A;  5AG7 A;  3W2H A;  4BBH A;  1IY7 A;  2C78 A;  4CGM A;  4LBY A;  1H42 A;  2XZP A;  3CCE B;  2QEX B;  3IU1 A;  4PXB A;  2GIV A;  2AHO A;  2DPT A;  3PP9 A;  4ZYQ A;  1I18 A;  1RO5 A;  4L89 A;  2ZBU A;  2OU2 A;  3DGV A;  4RDL A;  3OAA A;  2YNC A;  3RYO A;  3FB3 A;  1B2R A;  1E1Q A;  3BHX A;  4TKO B;  5J35 A;  5IYW A;  3C26 A;  3W5H A;  2V7W A;  4QVT A;  1ZG7 A;  3DDD A;  4J0Q A;  4PAB A;  4AVZ A;  4RDJ A;  1K28 D;  1QGA A;  2K5T A;  1KZF A;  4CAF A;  4X5K A;  1KUX A;  2GRE A;  2JDC A;  2BO9 A;  5F09 A;  4B10 A;  2R8V A;  4KS9 A;  4Q38 A;  1GHE A;  3DDY A;  1ZM9 A;  4JLY A;  1F20 A;  4MFQ A;  5CPA A;  4MHY A;  2CXA A;  1R43 A;  4R6T A;  2IQ6 A;  5FO0 A;  2V7V A;  1PJ7 A;  1Y7R A;  4CPA A;  1T6Y A;  3VWE A;  1Q81 D;  5K8O A;  2GU2 A;  2XZL A;  4FN5 A;  1UD3 A;  2DPS A;  3OEH A;  3SJZ A;  3W2I A;  2HB6 A;  3KHZ A;  2W6J A;  1Z8X A;  2PJ0 A;  2XEX A;  1VGY A;  3AVY A;  3CCM B;  3G3S A;  5HMN A;  3PZJ A;  1S7F A;  4B14 A;  1R57 A;  2HMA A;  2ZEN A;  4B48 A;  2AFU A;  3N7Z A;  2GLF A;  2PIA A;  4OC5 A;  2AFW A;  3FH4 A;  4M2L A;  2ZEH A;  3PFO A;  3JUW A;  1P4M A;  4KOU A;  2JJ2 A;  3SLN A;  2OBR A;  5C88 A;  1U2R A;  2AFZ A;  3R95 A;  1GVH A;  4DK1 A;  1W0J A;  4CAW A;  2QTZ A;  3VH9 A;  2PMD A;  3CC7 B;  4H6U A;  5IB0 A;  1Q82 D;  4DUK A;  1X10 A;  2J8M A;  1BOB A;  4WQM A;  4FD5 A;  2V7X A;  1TLL A;  3JQR A;  1U6M A;  2PLF A;  4MYU A;  4YHB A;  3H94 A;  4X7F A;  1IOI A;  2ZW7 A;  2GAN A;  1GAW A;  3VNU A;  4IW3 B;  2CK3 A;  3CCU B;  3BCD A;  1JWQ A;  1VQ4 B;  2ZEL A;  5I4M A;  2Z11 A;  1VHE A;  5L46 A;  3RNZ A;  4YAL A;  3W2G A;  1EXM A;  1Y0Y A;  2R6H A;  4F9U A;  4PC6 A;  1R5B A;  3MHP A;  3H9N A;  4HKF A;  2DXQ A;  4B5P B;  1XIX A;  1ELM P;  4RPD A;  1E64 A;  2R9V A;  3FEC A;  4X7D A;  2Y0M A;  5E96 A;  2X53 S;  2XGJ A;  2Z0Z A;  3DLJ A;  4H2K A;  3ONU A;  3BJ8 A;  3RAM A;  4CS0 B;  5AG6 A;  3B3C A;  3HUV A;  1ZO0 A;  4WWV A;  4ASU A;  4KUB A;  2QE7 A;  4C2Z A;  5THX A;  1YSJ A;  4XNF A;  3JU4 A;  2FE7 A;  2VJI A;  3V7Z A;  3EC4 A;  3LD2 A;  4DNR B;  3WC5 A;  2VNH A;  4KOS A;  2NPF A;  1I21 A;  4M6H A;  2R1I A;  3PBE A;  4ZY0 A;  1XQB A;  4JXQ A;  2JBK A;  3D4U A;  1QVG B;  4KUA A;  3H8F A;  3OWC A;  5JM6 A;  4ACA A;  1EFC A;  1LAP A;  1OB0 A;  3A8J A;  4P22 A;  3AVW A;  4AXV A;  1L0C A;  5FA6 A;  4TMZ A;  1MK4 A;  2PR8 A;  2B5O A;  2XND A;  1BO4 A;  1ARM A;  4Y9R A;  2WR8 A;  4R7M A;  4YEJ A;  4CAE A;  4ZCL A;  3F5B A;  4PGO A;  4TN1 A;  2PC1 A;  1KQS B;  2HDN B;  3BI1 A;  4QHY A;  1N0V C;  2ZIT A;  4CRY B;  4JJX A;  4UZU A;  4XD7 A;  5H59 A;  4JXR A;  5AG5 A;  4RD4 A;  4PSW A;  1K4J A;  1H8E A;  1WTH D;  1FT7 A;  4TMW A;  2ZW6 A;  3JTK A;  5EMI A;  2OZG A;  1FRQ A;  2P6E A;  4OIW A;  4WJB A;  4A94 A;  2BMW A;  3OEE A;  2CNT A;  3GUX A;  2PVV A;  3EFA A;  4RJL A;  3RY8 A;  2WJY A;  2DY1 A;  3WT4 A;  4WZE A;  5EC4 A;  4PC7 A;  3E1Y E;  5A8A A;  1SM4 A;  2B4D A;  2C6C A;  4F7D A;  2F1M A;  1Y0R A;  1KWM A;  2DEU A;  2VBS A;  1YLO A;  3BLN A;  4LC0 A;  2ZEF A;  1R5N A;  5E6T A;  4OP7 A;  4MRI A;  4P3I A;  4GM5 A;  2Z3N A;  1ZM4 A;  3SI0 A;  1OB2 A;  1IYK A;  4JYW A;  2PJB A;  1W2B B;  4P45 A;  4M6I A;  3CCQ B;  1JNY A;  4CYP A;  4LBW A;  2HV2 A;  2AFM A;  3P26 A;  4MMO A;  2XEJ A;  1Y9K A;  4PXE A;  2PSW A;  1E43 A;  3AVU A;  3TFY A;  2XNC A;  1T5E A;  2C2W A;  3CP8 A;  7CPA A;  3ZBT A;  4MHN A;  4UFX A;  2C77 A;  3B8H A;  2O28 A;  2FSR A;  3QFS A;  4XNH B;  3OE7 A;  5JH9 A;  2YNE A;  2QJ8 A;  1VIX A;  3B3V A;  3ISX A;  4UAJ A;  2DER A;  4MCQ A;  4FWT A;  3EO4 A;  5HVH A;  2G3T A;  2Q43 A;  1ARL A;  1PU9 A;  3TC8 A;  5H5J A;  3I3G A;  2BCO A;  5FL7 A;  1X12 A;  4RLZ A;  4PPZ A;  3ASQ A;  3PB9 X;  3T90 A;  3R6J A;  4KKS A;  3D7F A;  2J7K A;  4G5G A;  1MJ9 A;  5ISV A;  4K1X A;  3CC2 B;  2QMU A;  5LYD A;  4I49 A;  3SEJ A;  2PJ9 A;  1A8P A;  4Q7J B;  4B12 A;  2VZL A;  3S6F A;  3SXO A;  1KUY A;  4MHD A;  4G1B A;  1IOF A;  2HC9 A;  1KC8 D;  2R98 A;  1M4G A;  3S6K A;  4C2Y A;  1IB1 E;  4KOX A;  1S60 A;  5TR9 A;  2C4U A;  1WSV A;  4EH1 A;  4E8O A;  2ZTN A;  2CTB A;  4P4I A;  2Z3M A;  5CBM A;  3D8P A;  2ZXV A;  5THW A;  1YJW B;  4KSI A;  3FF3 A;  4ZX8 A;  1SQH A;  3TO7 A;  5I0C A;  1S7L A;  2VQY A;  4AF7 A;  3UY5 A;  3WNB A;  4PQA A;  1Z8T A;  1Q2Y A;  2J8R A;  4UZE A;  2D4P A;  4AVA A;  2VI7 A;  4GXH A;  5HZA A;  1COW A;  3GVL A;  3G8W A;  3P2H A;  4XKW A;  4A32 A;  1KD1 D;  3AST A;  1CPS A;  2VL1 A;  2Q7B A;  4ZGY B;  4P6V F;  2VNI A;  2V8G A;  4QUZ A;  1CNF A;  2PCU A;  4XL9 A;  3GSI A;  1CG2 A;  2PJ3 A;  1Z8W A;  2V77 A;  2WPW A;  2X3U A;  3D26 A;  4P4E A;  2POK A;  3Q6Q A;  4KSA A;  2DYI A;  3WBK A;  5DN6 A;  1ZG9 A;  1WU8 A;  4R3L A;  2BL1 A;  1TKH A;  1VKC A;  2CF4 A;  4MHZ A;  1KRH A;  4KLW A;  2QGG A;  4AC9 A;  1CM0 A;  3ES9 A;  2BGJ A;  4ZCM A;  4ZBG A;  4A37 A;  5CDF A;  4RM0 A;  3SI1 A;  4G7X A;  3QFC A;  3BH4 A;  1AMP A;  3N5F A;  4Q36 A;  1CBX A;  2ATR A;  2JDI A;  4AG7 A;  4QVJ A;  1P4N A;  4HNW B;  2V8D A;  4TNU A;  4UCM A;  3W6S A;  3PA2 A;  2G9D A;  2YND A;  1W0K A;  1Q7L A;  1QSR A;  5LRJ A;  2PRB A;  4C7I A;  8CPA A;  2YWH A;  2BPO A;  3D7D A;  3MRU A;  4BIN A;  1HDQ A;  2QYV A;  4M6G A;  5HH1 A;  4JZ0 A;  4OME A;  4RN7 A;  1TVC A;  5A27 A;  1TF8 A;  5LYF A;  1PYT B;  4A95 A;  4ONU A;  3RBU A;  4MYT A;  3OW2 B;  1DDG A;  3GQB A;  1ZM3 A;  2V31 A;  3D7H A;  3PVD A;  2RC6 A;  2ZW5 A;  1TKJ A;  3KQX A;  2F7V A;  2C6P A;  3D66 A;  1KZL A;  3I9S A;  1QQ9 A;  3T53 B;  1J4J A;  4IAV A;  1XB2 A;  1Q2D A;  5J3O A;  2RC4 A;  4UA3 A;  4EWT A;  1LFW A;  2EK9 A;  5CNP A;  2C4T A;  4B11 A;  2B4B A;  5HVF A;  3CDX A;  3OKX A;  1BX0 A;  1IYL A;  3QFR A;  4K30 A;  4F9V A;  2Q7S A;  4YAW A;  1DG1 G;  2Q6I A;  1WOS A;  4Z4U A;  1Q86 D;  3OJW A;  3BXM A;  2ODF A;  2Q51 A;  1H8H A;  4RD3 A;  2ZEP A;  2PQ8 A;  2WSA A;  4R57 A;  3ZBU A;  4XR6 A;  1UD5 A;  4QBJ A;  3RO0 A;  2XNJ A;  3VWD A;  1OHH A;  4IUS A;  2CNM A;  2OTJ B;  4M85 A;  2ZXI A;  4A38 A;  2BN4 A;  2PJC A;  3B35 A;  3WY9 A;  4PSX A;  5JPH A;  4X05 A;  1N0U A;  2I1L A;  2RC5 A;  2NYQ A;  3B82 A;  4KVO E;  4U9Y A;  4A31 A;  1M90 D;  3SLD A;  1RXT A;  1NJI D;  3B3T A;  3VR6 A;  4RDK A;  3JQP A;  4OC3 A;  1BX1 A;  3ZC3 A;  4CGN A;  1G7C A;  3GLJ A;  5AGE A;  1MAB A;  3WND A;  1EWY A;  4QVA A;  5IYP A;  4XLH A;  1A2Z A;  5A89 A;  2QEC A;  4AF6 A;  4Q7A A;  4IF5 A;  3ZZT A;  1NE9 A;  2J9A A;  3IFE A;  3CMM A;  3DR8 A;  2B5G A;  2Q44 A;  2DCU A;  4XNH C;  4XPD B;  1TKF A;  4PC1 A;  1QSM A;  1OZP A;  1NB9 A;  4H89 A;  4MFJ A;  4UZF A;  4U9Z A;  1V5V A;  4B3F X;  4UIB A;  4DK0 A;  3I56 B;  4QB9 A;  3LAC A;  2C5H A;  5LYL A;  3IC1 A;  2VZY A;  4KSF A;  2ZZE A;  2B3V A;  4OKO A;  3SHP A;  1I7P A;  4LQG A;  4QFM A;  2GK7 A;  1Q9S A;  3AVT A;  4U5Y A;  4ZV4 A;  2WZN A;  2PJ2 A;  1WP6 A;  1UD8 A;  2XEG A;  3R9F A;  4ONW A;  4DNC A;  3FJO A;  5F4J A;  3VMF A;  1N71 A;  4NGS A;  1I12 A;  2HCJ B;  3A3G A;  3GVK A;  1YVK A;  3BY2 A;  4XLA A;  1V0C A;  2JJ1 A;  2PRQ A;  1N07 A;  4PC2 A;  2Q0Y A;  4KOV A;  4XQF A;  4P3Y A;  3CME B;  2FS5 A;  1EP3 B;  4H9G A;  4BMH A;  4BPR A;  1XMB A;  4KOY A;  4PXD A;  5G1Z A;  4YFJ A;  1YIJ B;  3SJX A;  3S6H A;  4CAX A;  1R5O A;  2DET A;  5GV8 A;  4DQL A;  3Q3A A;  3KGQ A;  5KNL A;  3CXS A;  5TRD A;  3TX8 A;  3JRU A;  1YGH A;  4P4J A;  2REF A;  2CNS A;  1VQ6 B;  1UWY A;  4NXY A;  1QVF B;  1Z2L A;  2ZL5 A;  1CX8 A;  4MHP A;  1QMU A;  1DAR A;  4Z4T A;  3CTA A;  5BSY A;  4N3G A;  4UIA A;  4L8A A;  4TWE A;  1YIT B;  2VBQ A;  4XON A;  2OYN A;  3IWE A;  1KK0 A;  1W34 A;  5FNZ A;  2OB0 A;  2IJZ A;  2JDD A;  3PBB A;  2ZW4 A;  4FD6 A;  5HXD A;  3B78 A;  4CGL A;  4YU9 A;  1BPL A;  3CPW B;  3SKB A;  4LBV A;  1YX2 A;  3K9U A;  3AVX A;  2ZOF A;  3FIX A;  2V7T A;  3CPX A;  3PB6 X;  4ACB A;  1BJK A;  3PEN A;  3P2F A; 
#chains in the Genus database with same CATH homology
 3B2Y A;  1M4L A;  3CT9 A;  4ZY2 A;  2V8V A;  7CPA A;  4MHN A;  4DYO A;  3NA6 A;  2ZEO A;  3FEE A;  1H8L A;  5JH9 A;  4P4B A;  1ELL P;  2QJ8 A;  1DTD A;  1VIX A;  2O53 A;  4W9Y A;  3B3V A;  3ISX A;  3FX6 A;  4MCQ A;  3S9L A;  4NGQ A;  5HVH A;  3H8E A;  2Q43 A;  5K8P A;  1ARL A;  3TC8 A;  2BCO A;  5JGF A;  4NJQ A;  2FVG A;  1CP6 A;  1Y7E A;  5HVG A;  1LOK A;  4MXU A;  4PPZ A;  3PB9 X;  3D7F A;  1ZG8 A;  3LMS A;  3KR4 A;  4FBE A;  1XFO A;  2ZOG A;  3PFE A;  3V38 A;  2PJ7 A;  2PIZ A;  3IEH A;  1IGB A;  2XEI A;  4MCP A;  4YWY A;  3NFZ A;  4O23 A;  4OC0 A;  5LYD A;  3FMC A;  1PCA A;  3KL9 A;  2JBJ A;  1CP7 A;  4UEE A;  2PJ9 A;  3RZA A;  2PJ4 A;  4IHM A;  1LAM A;  2JEW A;  3PEI A;  2HC9 A;  4OC1 A;  5ELY A;  1AYE A;  3I1U A;  4X8I A;  3D68 A;  4NFR A;  3FVL A;  3WAB A;  4R76 A;  2RFH A;  4NGM A;  2CTB A;  4P4I A;  4FAI A;  5CBM A;  1F2P A;  5THW A;  4KSI A;  3FF3 A;  4NGR A;  4ZX8 A;  1HDU A;  1EE3 P;  3IO1 A;  3T8W A;  2PJ5 A;  3KI9 A;  1ZLI A;  4NGP A;  3L2N A;  1CPX A;  4A39 A;  4PQA A;  1IY7 A;  4ZX9 A;  1GYT A;  1XRY A;  2VL1 A;  1CPS A;  4PXB A;  2ZEG A;  6CPA A;  4ZYQ A;  1LCP A;  2BOA A;  2V8G A;  2ZED A;  3NH4 A;  3DGV A;  2PCU A;  3KZW A;  3MN8 A;  1CG2 A;  2PJ3 A;  4UEZ A;  1ZLH A;  4F8Z A;  5K8M A;  2V77 A;  3BHX A;  2XEF A;  4P4E A;  2POK A;  1ZG7 A;  3BI0 A;  1ZG9 A;  1LAN A;  1YME A;  1TKH A;  2CF4 A;  2CIJ A;  4MHZ A;  1FNO A;  4EFD A;  2GRE A;  3QNV A;  4A37 A;  4UF4 A;  2ZEM A;  5LRG A;  3SI1 A;  2BO9 A;  5F09 A;  1XJO A;  3NH5 A;  1AMP A;  2DEA A;  3N5F A;  1CBX A;  2V8D A;  4TNU A;  2QVP A;  2G9D A;  3PB4 X;  1Q7L A;  1F57 A;  5LRJ A;  5K8N A;  5CPA A;  8CPA A;  4MHY A;  2V8H A;  1R43 A;  2EK8 A;  4R6T A;  2IQ6 A;  5DS0 A;  4P4D A;  3D7D A;  4ZI6 A;  3MRU A;  2Q4Z A;  1HDQ A;  2QYV A;  3D67 A;  4JZ0 A;  4OME A;  4CPA A;  1TF8 A;  4K3N A;  2O4H A;  5LYF A;  1PYT B;  5K8O A;  2GU2 A;  3RBU A;  4B6Z A;  3D7H A;  1NSA A;  2HB6 A;  3FED A;  1TKJ A;  3KQX A;  1F2O A;  2F7V A;  3KHZ A;  4ZY1 A;  2C6P A;  2PJ0 A;  1VGY A;  3D66 A;  1QQ9 A;  3VAT A;  4FUU A;  4BD9 A;  2ZEN A;  2AFU A;  2GLF A;  4OC5 A;  4IAV A;  2AFW A;  3FH4 A;  1Z5R A;  2ZEH A;  2NSM A;  3PFO A;  4EWT A;  1LFW A;  2EK9 A;  2AFZ A;  5HVF A;  3CDX A;  2OOT A;  1RTQ A;  3VH9 A;  4F9V A;  4DUK A;  3SJG A;  3PB7 X;  3IWW A;  3BXM A;  2Q51 A;  3HLP A;  1R3N A;  2ZEP A;  3ISZ A;  3K2K A;  2ZEL A;  3PRT A;  5LYI A;  5I4M A;  1HEE A;  1VHE A;  4A38 A;  4OP4 A;  2PJC A;  3B35 A;  3SJF A;  2NYQ A;  5IB9 A;  1Y0Y A;  4F9U A;  4P10 A;  3B3T A;  2PJ1 A;  1ELM P;  3KQZ A;  4PXC A;  4OC3 A;  3FEC A;  3FJU A;  3WC6 A;  3GLJ A;  4P4F A;  3DLJ A;  4H2K A;  4G1P A;  3RAM A;  3K9T A;  4Q7A A;  4OID A;  2RB7 A;  2C1C A;  3B3C A;  3HUV A;  2EWB A;  2J9A A;  2PVW A;  3IFE A;  4WWV A;  4P6Y A;  1YSJ A;  2PE3 A;  4EME A;  3V7Z A;  1TKF A;  2IMO A;  3WC5 A;  3B3S A;  5D29 A;  3PBE A;  2GLJ A;  2OR4 A;  4ZY0 A;  4UIB A;  2JBK A;  3SI2 A;  1YW6 A;  3D4U A;  3H8F A;  4OC4 A;  5JM6 A;  5LYL A;  3IC1 A;  1LAP A;  1Z8L A;  4AXV A;  4OKO A;  1TF9 A;  3KR5 A;  2F8H A;  1ARM A;  2PJ6 A;  4X3R A;  4X2T A;  4R7M A;  4LQG A;  2AFS A;  3PB8 X;  3S9N A;  1JQG A;  2PJ2 A;  2WZN A;  3BI1 A;  2XEG A;  2C6G A;  4ONW A;  4NGS A;  3IIB A;  2PJA A;  4FWU A;  1BAV A;  4UEF A;  2PRQ A;  4Z65 A;  1VHO A;  3KHX A;  3KAS A;  4OC2 A;  2I3C A;  3SJE A;  1FT7 A;  2WYR A;  3VAR A;  2PIY A;  5J1Q A;  2PJ8 A;  1XMB A;  4OIW A;  4PXD A;  4RUH A;  4WJB A;  4A94 A;  3H8G A;  3SJX A;  4MCS A;  3GUX A;  1BPN A;  2PVV A;  1BPM A;  4DJL A;  2ANP A;  3WT4 A;  3NH8 A;  1BLL E;  3KGQ A;  2CTC A;  3TX8 A;  1TXR A;  3JRU A;  4P44 A;  4P4J A;  1UWY A;  2C6C A;  4NJR A;  1Z2L A;  4MCR A;  1Y0R A;  1CX8 A;  1KWM A;  3D7G A;  4MHP A;  1YLO A;  1DE4 C;  1QMU A;  3B7I A;  2ZEF A;  3B3W A;  4MRI A;  4UIA A;  4IK2 A;  1OBR A;  4GM5 A;  4TWE A;  3IJ3 A;  4R8F A;  3WC7 A;  2AFX A;  2ZEE A;  3SI0 A;  4NGN A;  4JYW A;  1XBU A;  2PJB A;  3LWU A;  2AFO A;  2IJZ A;  3PBB A;  5HXD A;  3GB0 A;  4P45 A;  5LRK A;  4YU9 A;  2ABZ A;  5D8N A;  2AFM A;  3CPA A;  3S9M A;  4MMO A;  2XEJ A;  2ZOF A;  1YW4 A;  4PXE A;  3CPX A;  3PB6 X;  4NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...