4P6YA

Crystal structure of the m42 aminopeptidase tmpep1050 from thermotoga maritima
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Crystal structure of the M42 aminopeptidase TmPep1050 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4p6yA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p6yA01
2O4HA 2QVPA 3WABA 1ARLA 3FX6A 4Z65A 2C6PA 3D7HA 2NYQA 4ZY1A 4P4EA 4KSIA 3MN8A 1HDUA 3PB6X 4PPZA 1BPMA 2GU2A 1BLLE 2ANPA 1H8LA 2ZEOA 4OC0A 4X2TA 5HVGA 2ABZA 2DEAA 2PJ6A 1HEEA 3PB8X 1Q7LA 2GLJA 4PXCA 1VHEA 3FMCA 3B3TA 3IWWA 2GREA 3VARA 2QJ8A 4UEEA 4UIAA 2WZNA 1PYTB 2V77A 3V38A 2XEFA 4R76A 4IAVA 2AFOA 4R7MA 2ZEPA 3D66A 2ZEFA 3NA6A 1UWYA 4OKOA 2PJ8A 2PJ2A 2PVWA 3N5FA 1LOKA 2PJ4A 3ISZA 4NGNA 4WJBA 4X3RA 4OC5A 3IFEA 3S9MA 7CPAA 3DGVA 2QYVA 1XRYA 4P6YA 4PXDA 4NJQA 2GLFA 2PJ9A 5LYLA 4BD9A 1ELMP 4EFDA 3RAMA 4ZX9A 1YW4A 4DUKA 4NFRA 2WYRA 1ZG7A 4F9VA 2HC9A 4A38A 4OC3A 2AFWA 4OIWA 3KQXA 4MCSA 3GB0A 5I4MA 3PBEA 2BOAA 3IO1A 2IQ6A 5CPAA 3NH4A 4CPAA 4R6TA 2PVVA 2I3CA 2ZEGA 3SJFA 1CPSA 1QQ9A 4AXVA 2CTCA 1XMBA 4FWUA 4P4FA 4MRIA 3WC6A 4P4DA 4F8ZA 2PCUA 1AMPA 1XBUA 1YLOA 4YWYA 3KHXA 1AYEA 4GM5A 5DS0A 5K8NA 5HVHA 4PXBA 2BCOA 1HDQA 2RFHA 5K8PA 2CF4A 3HUVA 4MHPA 3FEEA 5JH9A 3CDXA 3CPAA 2AFXA 2AFSA 2PJ7A 2EWBA 4WWVA 2PE3A 2V8VA 1CPXA 3PBBA 2ZEMA 2ZEEA 1DTDA 2HB6A 2ZEHA 2V8DA 3NH8A 4OC2A 3H8FA 3D67A 1LCPA 1RTQA 3PRTA 2VL1A 3ISXA 1ARMA 1TKHA 3B3WA 2V8GA 2Q51A 3KZWA 3PFEA 4ZYQA 1LANA 2C6GA 4OC4A 3BI1A 2IMOA 5F09A 5LRJA 3SJXA 2ZEDA 1EE3P 1FT7A 2PIZA 4MHNA 4OP4A 3B3VA 4JZ0A 2EK9A 1VGYA 4OMEA 1YW6A 2POKA 3KASA 1R3NA 3VH9A 5HXDA 3QNVA 2C6CA 5JGFA 2RB7A 4P10A 4NJRA 5LRGA 1CG2A 2ZELA 5LYFA 3S9NA 2OR4A 3D7GA 1XJOA 4EWTA 3FF3A 2JBKA 4NGPA 4NGSA 2ZOFA 3S9LA 1M4LA 3GLJA 4P4BA 4JYWA 1Z8LA 1BPNA 1VIXA 1PCAA 2NSMA 3PB4X 4PQAA 3KL9A 4P44A 4NGQA 2O53A 2JBJA 1QMUA 5LYIA 2V8HA 4ZX8A 3KQZA 3BHXA 3NFZA 4MHZA 4UEZA 3D4UA 1CX8A 3B3CA 4R8FA 1BAVA 2ZOGA 4F9UA 4K3NA 2PIYA 1OBRA 5CBMA 3PB9X 3KGQA 4P4JA 3JRUA 3GUXA 2PJAA 4P4IA 4FBEA 1ZLIA 2PRQA 2Q43A 3IC1A 4OC1A 3B2YA 4MCQA 4P45A 4ZY0A 5LYDA 3L2NA 5IB9A 4PXEA 3FECA 2F8HA 2JEWA 3SJGA 4A37A 1GYTA 4UIBA 4A94A 3H8EA 3SI1A 1YSJA 1CP7A 4TWEA 4ZI6A 5LRKA 4NGRA 6CPAA 2PJCA 4H2KA 1DE4C 1ELLP 1LAPA 4MXUA 4ZY2A 4ONWA 4B6ZA 5D29A 3B3SA 1Y0YA 4OIDA 3FEDA 1ZLHA 4NGTA 4DYOA 5JM6A 3HLPA 2PJ0A 4RUHA 3KI9A 3D68A 1TF9A 3B35A 3PFOA 3WT4A 3KHZA 4Q7AA 4LQGA 1Z2LA 1Y7EA 4DJLA 3MRUA 3SJEA 4O23A 4IHMA 4FAIA 1ZG9A 1TKFA 1FNOA 2PJ5A 1IY7A 3K2KA 4W9YA 4G1PA 1F57A 5J1QA 2PJ3A 5D8NA 1JQGA 3TX8A 2EK8A 3KR5A 2C1CA 3LMSA 1F2PA 1Y0RA 4NGMA 2IJZA 4MCRA 4MHYA 3T8WA 4TNUA 2XEGA 1TXRA 3IIBA 3H8GA 3RBUA 1TF8A 1TKJA 3K9TA 4UEFA 2F7VA 1ZG8A 4YU9A 1F2OA 8CPAA 5HVFA 5K8OA 2PJ1A 3LWUA 3FVLA 2CIJA 3BXMA 2ZENA 3PB7X 2OOTA 1NSAA 1IGBA 3IEHA 5ELYA 2BO9A 2XEJA 3WC5A 3FJUA 1VHOA 4X8IA 4IK2A 3VATA 3D7FA 2AFUA 3FH4A 3V7ZA 3CT9A 1CBXA 4MMOA 3TC8A 2Q4ZA 3SI0A 2AFMA 2PJBA 4A39A 2G9DA 1XFOA 3CPXA 4FUUA 3WC7A 4UF4A 1KWMA 5K8MA 3B7IA 4MCPA 2AFZA 3PEIA 3IJ3A 3SI2A 1Z5RA 2XEIA 4EMEA 5THWA 3D7DA 2CTBA 3RZAA 1YMEA 2FVGA 1LFWA 3DLJA 3I1UA 1R43A 3BI0A 2J9AA 1CP6A 3KR4A 1LAMA 3NH5A
chains in the Genus database with same CATH superfamily
2R8VA 3FX6A 2CY2A 2NYQA 4ZY1A 3LNNA 3A3GA 2EFGA 4KSIA 5BSYA 3MN8A 4DNCA 4Z4YA 4PPZA 1XOVA 2DEAA 5J3OA 1XB2A 1YR0A 4C43A 4R87A 3PB8X 3IWWA 3QB8A 1U6MA 2GREA 5FO1A 1N06A 2YWFA 3E20A 2DETA 3CCRB 1QG0A 2VBSA 1IJFA 4IAVA 4P9SA 1YQEA 1VQNB 3CC2B 1ZM3A 5IYQA 3D66A 2CNSA 2JJ2A 4P3IA 3NA6A 1UWYA 4OKOA 1ZM2A 2X6XA 2JLMA 2CK3A 2PJ8A 3QE2A 3TT2A 1D8TA 2GFQA 4B3FX 4NF1A 1LOKA 4KOSA 2ZTNA 4NGNA 2C5BA 2O28A 1TIQA 4C2YA 3IWEA 3IFEA 5F46A 2QYVA 2BM0A 4P6YA 1KC8D 5TY0A 3S6KA 3BY2A 4B4DA 3G6EB 1ELMP 4ZBGA 1QGZA 1VQ7B 1YW4A 2WYRA 4AVZA 4AVAA 1NJID 1YVKA 5B6IA 5HZBA 4A38A 1Q2YA 1OZPA 4MJ8A 2QECA 2AFWA 3EO4A 3KQXA 1WOPA 2ZBUA 2WUUA 4FN5A 2BOAA 3IO1A 3BQJA 5CNPA 3NH4A 3AVTA 2BGIA 3AVYA 2CTCA 2F1MA 2Z3LA 4FWUA 2ZL7A 4EH1A 2PCUA 2Z6BD 3FJOA 3ZZTA 1VKCA 2Z3MA 4A30A 1KRHA 4MFLA 4CAFA 4G5GA 1AYEA 3OJXA 1FRNA 5GV8A 5DS0A 3FRMA 3LVBA 4XLHA 3CCLB 3QSYA 1HDQA 3N7ZA 4WZKA 5K8PA 3W5VA 4UBRA 4BBHA 4Q38A 3CPAA 2AFXA 4TMVA 4ZGQB 4GQNA 3FPPA 3FIXA 1VHSA 1XE1A 2ZEMA 2PC1A 2HB6A 5E96A 3NH8A 4KSFA 2XNCA 2OBSA 1T6ZA 4P2NA 3D67A 3H8FA 3EXNA 3TFYA 2VL1A 2P6GA 1S7LA 3EFAA 2OB0A 3IWGA 2E1RA 1HA3A 5F4MA 4UWIA 3D3SA 4NXYA 1MRZA 4QVJA 1E62A 3A3BA 2ZEDA 1EE3P 5H59A 3RYOA 3MGDA 3B3VA 4XNHC 4JZ0A 2Q6KA 4OMEA 4NEXA 5KNLA 3GY9A 3CP2A 2POKA 4M0LA 3VH9A 5HXDA 4OPOA 1H8HA 4YHBA 2RB7A 2PMDA 1N08A 2ZELA 1Q9SA 1M1DA 1M4GA 2OZUA 2OR4A 4II9A 3D7GA 5IYNA 1CM0A 4EWTA 4B44A 4NGPA 4RPDA 3S9LA 3SJZA 1EFTA 1YVOA 1N8RD 4PC6A 4P4BA 2YGWA 3CXPA 3B8GA 4OPSA 1BPNA 1VIXA 2YWGA 3PB4X 4PQAA 1FNMA 1QMUA 4UCPA 2V8HA 3QFCA 4CYOA 3G4SB 1KZFA 3ES9A 1COWA 1W9XA 2ZXIA 4ZX8A 4AG7A 3ASTA 1V0CA 4X7DA 3TTHA 3KQZA 1S7FA 4Y7CA 2Q0YA 4UEZA 4MHDA 3W2GA 4AC9A 3CPWB 4B14A 3ONUA 4F9UA 5BSXA 1OBRA 1Q2DA 2C78A 3VO1A 4P4JA 3JRUA 2HMAA 2PRQA 4P45A 3LD2A 5LYDA 3L2NA 4YAWA 3A9LA 2C5HA 1KK2A 2BF4A 3B8HA 1NRKA 2F8HA 2XOKA 4KOWA 3LO8A 1E63A 2ZBVA 4ZV4A 5AG5A 4KOTA 4IW3B 4MFZA 2B3UA 4RD4A 4NBSA 4B5PA 1LAPA 4B6ZA 3T51B 2B4DA 4XONA 5DWNA 1E3ZA 4G7WA 3W6SA 4XORA 4B5OA 3AVXA 4DYOA 1N0UA 1EWYA 1K4JA 3D26A 3KI9A 1TF9A 1I7PA 3PFOA 2Q04A 3KHZA 2GJRA 3WQZA 1B6BA 2WPWA 4YELA 4CYNA 1AIPA 1ZG9A 3KEWA 2PJ5A 4MYUA 4G1PA 4K30A 4M4SA 3J81k 3VNUA 2C77A 3E1YE 3G05A 3CC4B 4CRYB 3TO7A 2X6YA 5FIUA 3CW2A 2C1CA 1F2PA 4NGMA 5AG4A 3WXMA 2HV2A 3A8JA 2XEGA 3FB3A 4QUSA 4CGPA 2JEVA 1TKJA 1UFHA 2F7VA 2B7BA 8CPAA 1Q81D 3OWCA 2CIJA 4JXRA 1WOSA 1EFUA 3DDYA 1KK1A 2F5IA 2M5SA 3IEHA 4HPSA 2BO9A 4LBZA 2XEJA 3FJUA 1VHOA 4C7IA 4X8IA 4RI1A 1RQRA 3R6KA 3I1FA 2J8MA 4TKOB 4EVYA 4R71A 4MMOA 2JIZA 2J7KA 4NNJA 2Q4ZA 3SI0A 4QFMA 2AFMA 1F60A 2BVNA 4ROXA 2PJBA 1XFOA 4FUUA 4PAAA 5DWMA 1QVGB 1KWMA 3U6BA 3F8KA 3OE7A 3B7IA 1W0JA 4RS2A 1M90D 3VMFA 1KK0A 3PEIA 4YGOA 1Z4EA 2BL1A 1Z5RA 2XEIA 4MFKA 5IK2A 4EMEA 2JN9A 2CTBA 2OBTA 2ZTGA 5G22A 3RZAA 3I1UA 3DLJA 4KKUA 4B5PB 5IB0A 3BC9A 1Q2CA 1N71A 2B4DB 4ACBA 4MI4A 1IOFA 2RC5A 3KR4A 3NH5A 1IOIA 1ARLA 3D7HA 4PSWA 4RDKA 2VBVA 5L46A 1VQMB 3W2HA 4C68A 1JJ2B 3A1PA 5A8AA 1BPMA 4BPRA 3CZXA 2V7TA 1MK4A 3ASSA 2ZEOA 4OC0A 5KTCA 3JQRA 5HVGA 1M44A 2ABZA 2YNCA 3WY9A 4RPBA 2GLJA 1VHEA 2C4UA 2P3MA 1QSMA 3FMCA 4B13A 2V7XA 3BJ8A 4XNFA 1DDGA 2QJ8A 3DNSA 4UEEA 1YX2A 1PYTB 1IICA 4JD6A 2V77A 2XEFA 4KS9A 4TN1A 4R76A 4Z4UA 4CGNA 1DDIA 4JWPA 2ZZFA 2AFOA 4R7MA 1G7RA 2VNIA 3OFNA 1J4JA 3ZPNA 1YX0A 3B78A 3H5ZA 2PVWA 4PK2A 1VQ8B 3N5FA 3DSBA 1NB9A 3ASPA 2GE3A 4R57A 2Z10A 5DN6A 4KOVA 3AVWA 4WJBA 4HNYB 2VZYA 4OC5A 5BWAB 2XEXA 4OLLA 1XRYA 3DR8A 4Z4VA 1IYKA 2OH1A 2PR8A 2PJ9A 1FX0A 4RM0A 3H4QA 3RAMA 4L8JA 1MABA 4E8OA 2OTJB 3PA1A 1W35A 4G6IA 1FRQA 4DUKA 4NFRA 1VLOA 1SM4A 4PGOA 1ZG7A 4OADA 1P0HA 4UCMA 2Z3PA 4OC3A 4R3KA 4OIWA 2OK7A 3GB0A 2PLFA 4A31A 5I4MA 2FL4A 3BCFA 4PSXA 2B4BA 2PIAA 4NCNA 2X53S 2IQ6A 4B10A 2QE7A 2FE7A 4U5YA 2J8RA 4UZUA 3CESA 5EMNA 5J35A 1XIXA 2WJYA 3VO2A 4P4FA 2B5OA 4MRIA 4PV6A 3S6FA 1XBUA 4DQLA 3AGQA 1Z8XA 4UA3A 4UCNA 4XPKA 4U9YA 5K8NA 5HVHA 2BCOA 4TMXA 4PK3A 2Q4VA 4PC1A 5JH9A 2QMUA 3ZZIA 4P22A 3GKRA 1WSRA 3I3GA 5IYPA 1PUAA 2AFSA 2PJ7A 2FIWA 2PE3A 2WJVA 5THXA 4G1VA 1E79A 4MFPA 1FNDA 3AGPA 1EFRA 4XR6A 2I00A 2VYQA 1YJWB 3K9UA 1Z8WA 1VQKB 2V8GA 2Q51A 2QTLA 3KZWA 2BGJA 5TR9A 3FNCA 4LX9A 4E2AA 1YJNB 1EP1B 3PFEA 4OC4A 2G3AA 4CRZB 1M4DA 5FNZA 5IYWA 5J8FA 5F09A 2PDOA 5C88A 1P4NA 3Q6QA 2FSRA 1V0EA 2D3LA 3SLNA 5LRJA 5KTAA 1VQ5B 1FT7A 2DY1A 2B5GB 5ISVA 3P2HA 4RCYA 4KVXA 3QFTA 3R6JA 2GPJA 3FBUA 1R3NA 4N3GA 1PJ6A 5KSWB 5JGFA 3CXQA 4AF6A 4P10A 4UFWA 5LRGA 1GHEA 1CG2A 1K9MD 3LACA 5LYFA 3S9NA 1XJOA 3SKBA 4XOPA 2VZLA 3FF3A 2JBKA 2D4PA 2F43A 1IB0A 4X7FA 4LC0A 1KUXA 1M4LA 3GLJA 2ZXHA 2EBJA 1TVCA 1PCAA 1Y7RA 1BX0A 3KL9A 2R98A 4XLAA 2XNDA 4DQKA 4HIZA 2O53A 4QVAA 1RXTA 2VJIA 2LZJA 4XKWA 4XN3A 5EC4A 5IX3A 4OOXA 4LBWA 4LBVA 4M53A 1QSNA 1HZEA 2AJ6A 1UD4A 3D4UA 3W91A 1YHQB 1CX8A 3OOCA 1ZO0A 1QFJA 1VJSA 4OAEA 3WNBA 4KLWA 4FBEA 3W5UA 1G7SA 4DNTB 4OC1A 4Y49C 4RD2A 3QAYA 4YAUA 2CRVA 4N3NA 4PXEA 4ORFA 1OB2A 1BO4A 3CRZA 2OBRA 4P26A 1D1NA 2DOGA 1OB5A 3H8EA 4I49A 2BMWA 1N07A 4F6AA 4ZI6A 5LRKA 2VJJA 3S6HA 3SEJA 2PJCA 3QFSA 3CB4A 3T53B 4ACAA 1DE4C 4H2KA 4ZY2A 4ONWA 3OZWA 4GXHA 1Y0YA 2ZL6A 3FEDA 4WZTA 4Z4SA 3VWEA 5KW9A 2Q7SA 3OZVA 5JM6A 3HLPA 3RY8A 3PZJA 3B35A 4H9GA 2QMLA 1FNCA 3MHPA 1D2EA 4XQFA 4LQGA 1Z2LA 1Y7EA 2V7WA 1ZM9A 3VWDA 4A2ZA 4B48A 4IHMA 1E43A 4FWTA 3OJWA 2ZW5A 1IYLA 1FNOA 3D8PA 3DDDA 5HH1A 1F57A 1NBMA 5J1QA 1G7CA 2PJ3A 4FXUA 1JQGA 3P27A 4P6VF 4CGOA 4KLVA 2REEA 2QEXB 2IJZA 2WPXA 4MCRA 1Z9UA 4KKTA 4K1XA 4FK8A 1EXMA 1GJRA 1ON0A 2VZZA 4KKSA 2D9RA 3K9TA 2Q6OA 2GK7A 5F4JA 1QSOA 4YRHA 3PGPA 4YU9A 1F2OA 5HVFA 3C26A 1BJKA 3CTAA 3Q3AA 3BXMA 3E0KA 1NSAA 1EP2B 1H42A 3I9SA 5ELYA 4J0QA 3RO0A 4DK0A 4R9MA 3WC5A 2REFA 3VATA 2AFUA 1S5KA 4YFJA 3V7ZA 4C2XA 3CT9A 3MMPA 4Y49B 2NPFA 1R5OA 4XL9A 2G9DA 2X0KA 3BY1A 2ZZEA 5K8MA 4P3YA 4MCPA 1KQSB 1YREA 3JUWA 4KUBA 4UWJA 3R95A 2AE6A 4X05A 1QH0A 2VEZA 4XPDC 3GYAA 3R9FA 1YMEA 1RQPA 3BI0A 1WOOA 5H86A 3G8WA 1OHHA 3WNDA 2X3UA 3NE7A 5F47A 2DEUA 1B23P 4LBYA 2O4HA 2QVPA 3WABA 5TRDA 5C82A 5J8CA 3V8IA 4P1VA 2H5MA 4P4EA 3CCUB 2DYIA 3GSIA 4Q36A 1HDUA 4H6UA 1VQPB 2GU2A 2ANPA 1H8LA 4RDJA 4M6GA 4ONUA 4CYPA 4XNHB 4X2TA 2CW5A 1AUGA 4M2LA 5F49A 1HEEA 1Q7LA 3B3TA 3TO9A 3G71B 1XF8A 4UIAA 1S3ZA 2JDCA 3V38A 2CBXA 4BINA 2OZHA 2B58A 1G7TA 2R1IA 1SKYB 4RCZA 1VQOB 2ZPAA 4AB7A 2JDDA 2ZEPA 1JWQA 2ZEFA 2D3NA 3DR6A 1PKVA 3OPOA 1NE9A 2XZLA 2P6EA 2X7BA 2WR8A 2OYNA 5JQ4A 3ISZA 4A33A 4DK1A 2CNMA 1X10A 4X5KA 1GAQA 4X3RA 1BX1A 4QUZA 5DSZA 3S9MA 3DGVA 1N0VC 1S7KA 2BM1A 3SLDA 1I12A 3IU1A 3A8IA 4NJQA 4KVOE 5AG7A 5LYLA 1GAWA 2F1LA 1WU8A 4AVCA 1QVFB 1B87A 3I55B 5F48A 4F9VA 5CDFA 4HNWB 1ZM4A 1DG1G 2HC9A 2Q6IA 4UZEA 1GVHA 4YAOA 5HKKA 4TMTA 1YI2B 4HE6A 3PBEA 2PRBA 3CCJB 3ZJ0A 2P0WA 5CPAA 3MCAA 4CPAA 2PVVA 2I3CA 2ZEGA 5EMIA 1QQ9A 1XMBA 2QA4B 3WC6A 1YLEA 4P4DA 4TSFA 4Y9RA 2EIXA 3GVKA 3FYNA 4OOVA 1YLOA 2RC6A 3CCVB 4GM5A 1KMHA 3W2EA 3FKSA 4Z1MA 1CJWA 5A28A 2RFHA 3Q6RA 5AGEA 1KUVA 4MY0A 2CXAA 4XD7A 4WWVA 3AVUA 3P26A 5FA6A 2QIRA 2W6JA 1A2ZA 3LQ6A 3OP1A 3PRTA 1AMOA 3B3WA 1S0UA 4P12A 3W5HA 4II2A 3CCQB 4RD3A 1LANA 4B12A 2C6GA 1L0CA 3BH4A 4J3GA 1VQ6B 1IB1E 2IMOA 3GIRA 2Z11A 1T6YA 2VNKA 2WSAA 3CMAB 3WNCA 1I8DA 4UFVA 5H84A 2C4TA 1M1KD 1QGYA 1WWZA 1S72B 5A27A 4U9ZA 2ATRA 2K5TA 2VI7A 1VGYA 2GQFA 1KJZA 3JQPA 4OP7A 2HCJB 2WZPP 2DXQA 3QNVA 3SJPA 2C6CA 2B5GA 1Z8TA 1P4MA 3EC4A 1N05A 1TLLA 2NMTA 1MJBA 1WP6A 2HLDA 4QC6A 4NGSA 3CP8A 1FY7A 2V31A 1KTVA 1RO5A 4YEJA 1W2BB 4WZEA 3OKXA 4JYWA 3FXTA 2OZGA 3ZIAA 3CCEB 5G21A 4ZGYB 1V5VA 2X6WA 4G1BA 3SXNA 3CD6B 2QTZA 4NGQA 3BCDA 5LYIA 2JJ1A 4CS0B 2YWEA 4M3SA 2X8KA 2PSWA 3ZUGA 2C2WA 4MHZA 4AVBA 4ASUA 1VQLB 2VBQA 4XKVA 3B3CA 4XN0A 4MFQA 1BAVA 1ZUNB 2ZOGA 2I79A 2BSAA 4K3NA 1S7NA 2PIYA 5CBMA 2FS5A 1E3XA 3GUXA 3GQBA 3VNVA 3S6GA 2FXFA 3CCSB 4P4IA 2PR1A 4P25A 1ZLIA 2V7UA 1Z4RA 1JA1A 4UZFA 1JB9A 4ZY0A 4JMQA 3ZC3A 5IB9A 1Y9WA 4M6HA 2JEWA 1NMTA 2KVOA 1JA0A 2AHOA 4UIBA 4A94A 3SI1A 4RD6A 2GK6A 5AN9A 1YSJA 1CP7A 5FL7A 4TWEA 2F4NA 1H8EA 2D4OA 3NE8A 3OEHA 1VQ4B 3JQQA 6CPAA 1K8AD 1LRZA 4RDLA 4CQJA 5IV0A 2VBUA 5D29A 3B3SA 2QN6A 4GS4A 1ZLHA 2Y0MA 4NGTA 1IHMA 4QHYA 4UFXA 3TO6A 1PJ5A 4RUHA 4A32A 3D68A 4U9UA 2J8NA 4LUAA 1PJ7A 4PC7A 2HQYA 4Q7AA 5HMNA 4X06A 3F5BA 4CAVA 3MRUA 2ZW7A 1DARA 3CC7B 1TKFA 2OU2A 3K2KA 1IY7A 4W9YA 1XMTA 2EUIA 5G20A 3LQEA 4IF5A 3TX8A 2EK8A 2ZW4A 3D2PA 3KR5A 4RD0A 3OEEA 1R57A 4Z4RA 4PABA 1Q7YD 4MHYA 3T8WA 1I1DA 1KZLA 3OZUA 3IIBA 4ZCLA 3CXCB 2ZW6A 4NCZA 3ZZUA 4M85A 4UEFA 2B7CA 2HDNB 1WSVA 5K8OA 2PJ1A 2CNDA 3FVLA 3W2IA 3V7AA 2Z0ZA 1A8PA 3W2FA 3W6XA 2B3VA 4II3A 1WORA 4QBJA 2VQYA 4KZTA 4X7EA 1H85A 4KOYA 4XLFA 4IK2A 3FH4A 2JDIA 1QUFA 2VXKA 3ONYA 1CBXA 3NE5B 3ZBUA 4WQMA 4A39A 3CPXA 4JXQA 4UF4A 5GV7A 3A8KA 3AVVA 2YNEA 2AFZA 1XQBA 3SI2A 1OGJA 4LQ6A 1UD5A 1FNBA 4CAWA 2W6IA 1BLIA 1UD8A 2FVGA 1LFWA 4RLZA 2Q44A 2WSSA 3Q38A 4X7CA 4IUSA 2QDXA 4C0SA 4ZCMA 5JPHA 3WBJA 2DPTA 2HUZA 1YITB 4Z65A 2C6PA 5H5JA 4C7HA 4H6ZA 2ZL5A 3BNWA 3B82A 1UD3A 3P2FA 3PB6X 1BLLE 2YNDA 1BOBA 2BN4A 2PJ6A 2ZXVA 1PU9A 1R5NA 1WDTA 4PXCA 2E1BA 2GJKA 2G0BA 4CGLA 1W87A 1YJ9B 3VARA 1T6XA 2A4NA 3PENA 2WZNA 5HZAA 1BMFA 2CNTA 2R6HA 3ZBTA 4F0XA 3WBKA 2EVNA 2YWHA 2X85A 3PUMA 5JBQA 2FT0A 4ZGNB 2BEIA 1QSTA 4PC3A 3CCMB 5FO0A 5A88A 2FIAA 4MBUA 2PJ2A 1SKQA 2PJ4A 4CGMA 4KSAA 1WPCA 1OGIA 4KOXA 1CNEA 4RJLA 7CPAA 3TE4A 2DF5A 1TUIA 4MY3A 4PXDA 4QV2A 2GLFA 3CMEB 4BD9A 4EFDA 4ZX9A 3ASQA 2Z3KA 1MJAA 2WPDA 1IJEA 1UMKA 2Q7BA 2BUEA 4HE5A 1J9ZA 4C2ZA 2FX3A 4R3LA 4MCSA 2GANA 4FD5A 3VR6A 2CC2A 5GCNA 1UD6A 2QGGA 1BQEA 4Q7JB 4R6TA 2GJPA 1IIDA 3SJFA 1GO2A 1CPSA 4AXVA 3SHPA 3H9NA 4F8ZA 3GVJA 4XPLA 4RD1A 1AMPA 3PUNA 4YWYA 3KHXA 3V76A 4FD6A 1K28D 2V4DA 3BLNA 2XGJA 4Z4TA 1KK3A 4PXBA 1E1QA 4NSQA 1NSLA 4KVME 2CF4A 3HUVA 4MHPA 3FEEA 3CDXA 2EWBA 4MFJA 4ZCIA 2V8VA 1Q86D 3CXSA 2BPOA 1YGHA 1Q82D 1CPXA 3PBBA 3PA2A 2ZEEA 3KKWA 1KUYA 1DTDA 4QB9A 3F0AA 2ZEHA 2IL4A 2V8DA 4AF7A 3JVNA 4OC2A 2Z3OA 1LCPA 3HAGA 1RTQA 2I1LA 4MYTA 3ISXA 1ARMA 1TKHA 5TV2A 4Z4ZA 4ZYQA 4B43A 5E6TA 3T90A 3BI1A 3JTKA 3FPKA 3U6KA 2FCKA 4AG9A 1YIJB 4TMZA 4TT3A 4XOTA 3D2MA 5F4OA 1GR1A 3SJXA 4B3GA 4MHNA 2PIZA 4OP4A 3WYAA 3ZZ0A 2EK9A 1YW6A 1EFCA 3KASA 1UD2A 4M1KA 4Z4WA 4HKFA 4E0FA 3R9GA 4NJRA 3TOAA 2VNJA 4KUAA 1I21A 4TMWA 3QAHA 1VQ9B 4BMHA 2ZOFA 2Q6LA 5G1ZA 3IGRA 1CQXA 1Z8LA 4F7DA 1W34A 3WR7A 5HXBA 2NSMA 5KTDA 4L89A 4P44A 3OAAA 2JBJA 3EY5A 3GVLA 1VLYA 4UAJA 4B3XA 1EP3B 4YXWA 3BHXA 5I0CA 3NFZA 4XPDB 4QVTA 3UY5A 4FD7A 1VF7A 1XE4A 3OW7A 1B2RA 4B47A 2GIVA 4A95A 4Y9UA 4YAFA 3IU2A 3JU4A 4CAEA 1E64A 2ZZGA 4R8FA 1TTTA 4XLCA 1KD1D 3PB9X 3KGQA 1T5EA 3GIUA 5IYRA 4F0YA 4E0AA 5A89A 2PJAA 1QGAA 2XZPA 2Q43A 3IC1A 3B2YA 5LMZA 4MCQA 2P6FA 1FDRA 2Q4YA 1IU8A 3Q39A 1ELOA 2OTLB 3FECA 3QFRA 1M4IA 1MJ9A 3SJGA 4A37A 1GYTA 4CYQA 1QFYA 1NB0A 2DPSA 1QFZA 2RC4A 3U2QA 4DNRB 1JNYA 4WZLA 4NGRA 1QUEA 1OB0A 1ELLP 4MXUA 4OIDA 2NV4A 4X0CA 2XNJA 2PJ0A 1K73D 3T9YA 2YNCC 3PVDA 3WT4A 2G3TA 4B11A 2R9VA 4JJXA 4FD4A 3R9EA 4L8AA 4HNXB 4DJLA 3TCVA 4H89A 3RNZA 2VNHA 3SJEA 4O23A 3PP9A 4FAIA 1YK3A 2BV3A 4OOSA 2D74A 4M6IA 1W0KA 5D8NA 2ODFA 4XMYA 1E1RA 1CNFA 4X07A 3LMSA 1Y0RA 3TOBA 2R7HA 3LODA 1I18A 2C27A 3OW2B 4TNUA 2ZITA 1TXRA 1NDHA 4XLEA 3H8GA 4JLYA 2DIEA 3RBUA 1TF8A 2V7VA 3I56B 2ZZQA 1ZG8A 1S60A 1HVXA 2OK8A 3T56B 1V0FA 4PC2A 3LWUA 3BJ7A 2ZENA 3PB7X 2OOTA 5EBVA 1IGBA 3R96A 3SXOA 4G7XA 3G3SA 3D7FA 1X12A 1BPLA 2V7QA 3CMMA 1WK4A 2XZOA 4XM3A 1Y9KA 1WTHD 4KOUA 2ARHA 4RN7A 3TC8A 1QX4A 2PQ8A 4CAXA 3WC7A 3A35A 4KORA 1R5BA 3R1KA 4OPVA 3IJ3A 2BSWA 2KCWA 4YALA 1S4MA 2DERA 1F20A 5THWA 3D7DA 5AG6A 1SQHA 1XEBA 2VBTA 1R43A 2J9AA 1QSRA 2EO8A 2DCUA 3ASRA 2Z3NA 3H94A 1CP6A 1U2RA 5FVJA 1LAMA
chains in the Genus database with same CATH topology
2O4HA 2QVPA 3WABA 1ARLA 3FX6A 4Z65A 2C6PA 3D7HA 2NYQA 4ZY1A 4P4EA 4KSIA 3MN8A 1HDUA 3PB6X 4PPZA 1BPMA 2GU2A 1BLLE 2ANPA 1H8LA 2ZEOA 4OC0A 4X2TA 5HVGA 2ABZA 2DEAA 2PJ6A 1HEEA 3PB8X 1Q7LA 2GLJA 4PXCA 1VHEA 3FMCA 3B3TA 3IWWA 2GREA 3VARA 2QJ8A 4UEEA 4UIAA 2WZNA 1PYTB 2V77A 3V38A 2XEFA 4R76A 4IAVA 2AFOA 4R7MA 2ZEPA 3D66A 2ZEFA 3NA6A 1UWYA 4OKOA 2PJ8A 2PJ2A 2PVWA 3N5FA 1LOKA 2PJ4A 3ISZA 4NGNA 4WJBA 4X3RA 4OC5A 3IFEA 3S9MA 7CPAA 3DGVA 2QYVA 1XRYA 4P6YA 4PXDA 4NJQA 2GLFA 2PJ9A 5LYLA 4BD9A 1ELMP 4EFDA 3RAMA 4ZX9A 1YW4A 4DUKA 4NFRA 2WYRA 1ZG7A 4F9VA 2HC9A 4A38A 4OC3A 2AFWA 4OIWA 3KQXA 4MCSA 3GB0A 5I4MA 3PBEA 2BOAA 3IO1A 2IQ6A 5CPAA 3NH4A 4CPAA 4R6TA 2PVVA 2I3CA 2ZEGA 3SJFA 1CPSA 1QQ9A 4AXVA 2CTCA 1XMBA 4FWUA 4P4FA 4MRIA 3WC6A 4P4DA 4F8ZA 2PCUA 1AMPA 1XBUA 1YLOA 4YWYA 3KHXA 1AYEA 4GM5A 5DS0A 5K8NA 5HVHA 4PXBA 2BCOA 1HDQA 2RFHA 5K8PA 2CF4A 3HUVA 4MHPA 3FEEA 5JH9A 3CDXA 3CPAA 2AFXA 2AFSA 2PJ7A 2EWBA 4WWVA 2PE3A 2V8VA 1CPXA 3PBBA 2ZEMA 2ZEEA 1DTDA 2HB6A 2ZEHA 2V8DA 3NH8A 4OC2A 3H8FA 3D67A 1LCPA 1RTQA 3PRTA 2VL1A 3ISXA 1ARMA 1TKHA 3B3WA 2V8GA 2Q51A 3KZWA 3PFEA 4ZYQA 1LANA 2C6GA 4OC4A 3BI1A 2IMOA 5F09A 5LRJA 3SJXA 2ZEDA 1EE3P 1FT7A 2PIZA 4MHNA 4OP4A 3B3VA 4JZ0A 2EK9A 1VGYA 4OMEA 1YW6A 2POKA 3KASA 1R3NA 3VH9A 5HXDA 3QNVA 2C6CA 5JGFA 2RB7A 4P10A 4NJRA 5LRGA 1CG2A 2ZELA 5LYFA 3S9NA 2OR4A 3D7GA 1XJOA 4EWTA 3FF3A 2JBKA 4NGPA 4NGSA 2ZOFA 3S9LA 1M4LA 3GLJA 4P4BA 4JYWA 1Z8LA 1BPNA 1VIXA 1PCAA 2NSMA 3PB4X 4PQAA 3KL9A 4P44A 4NGQA 2O53A 2JBJA 1QMUA 5LYIA 2V8HA 4ZX8A 3KQZA 3BHXA 3NFZA 4MHZA 4UEZA 3D4UA 1CX8A 3B3CA 4R8FA 1BAVA 2ZOGA 4F9UA 4K3NA 2PIYA 1OBRA 5CBMA 3PB9X 3KGQA 4P4JA 3JRUA 3GUXA 2PJAA 4P4IA 4FBEA 1ZLIA 2PRQA 2Q43A 3IC1A 4OC1A 3B2YA 4MCQA 4P45A 4ZY0A 5LYDA 3L2NA 5IB9A 4PXEA 3FECA 2F8HA 2JEWA 3SJGA 4A37A 1GYTA 4UIBA 4A94A 3H8EA 3SI1A 1YSJA 1CP7A 4TWEA 4ZI6A 5LRKA 4NGRA 6CPAA 2PJCA 4H2KA 1DE4C 1ELLP 1LAPA 4MXUA 4ZY2A 4ONWA 4B6ZA 5D29A 3B3SA 1Y0YA 4OIDA 3FEDA 1ZLHA 4NGTA 4DYOA 5JM6A 3HLPA 2PJ0A 4RUHA 3KI9A 3D68A 1TF9A 3B35A 3PFOA 3WT4A 3KHZA 4Q7AA 4LQGA 1Z2LA 1Y7EA 4DJLA 3MRUA 3SJEA 4O23A 4IHMA 4FAIA 1ZG9A 1TKFA 1FNOA 2PJ5A 1IY7A 3K2KA 4W9YA 4G1PA 1F57A 5J1QA 2PJ3A 5D8NA 1JQGA 3TX8A 2EK8A 3KR5A 2C1CA 3LMSA 1F2PA 1Y0RA 4NGMA 2IJZA 4MCRA 4MHYA 3T8WA 4TNUA 2XEGA 1TXRA 3IIBA 3H8GA 3RBUA 1TF8A 1TKJA 3K9TA 4UEFA 2F7VA 1ZG8A 4YU9A 1F2OA 8CPAA 5HVFA 5K8OA 2PJ1A 3LWUA 3FVLA 2CIJA 3BXMA 2ZENA 3PB7X 2OOTA 1NSAA 1IGBA 3IEHA 5ELYA 2BO9A 2XEJA 3WC5A 3FJUA 1VHOA 4X8IA 4IK2A 3VATA 3D7FA 2AFUA 3FH4A 3V7ZA 3CT9A 1CBXA 4MMOA 3TC8A 2Q4ZA 3SI0A 2AFMA 2PJBA 4A39A 2G9DA 1XFOA 3CPXA 4FUUA 3WC7A 4UF4A 1KWMA 5K8MA 3B7IA 4MCPA 2AFZA 3PEIA 3IJ3A 3SI2A 1Z5RA 2XEIA 4EMEA 5THWA 3D7DA 2CTBA 3RZAA 1YMEA 2FVGA 1LFWA 3DLJA 3I1UA 1R43A 3BI0A 2J9AA 1CP6A 3KR4A 1LAMA 3NH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4H A;  2QVP A;  3WAB A;  1ARL A;  3FX6 A;  4Z65 A;  2C6P A;  3D7H A;  2NYQ A;  4ZY1 A;  4P4E A;  4KSI A;  3MN8 A;  1HDU A;  3PB6 X;  4PPZ A;  1BPM A;  2GU2 A;  1BLL E;  2ANP A;  1H8L A;  2ZEO A;  4OC0 A;  4X2T A;  5HVG A;  2ABZ A;  2DEA A;  2PJ6 A;  1HEE A;  3PB8 X;  1Q7L A;  2GLJ A;  4PXC A;  1VHE A;  3FMC A;  3B3T A;  3IWW A;  2GRE A;  3VAR A;  2QJ8 A;  4UEE A;  4UIA A;  2WZN A;  1PYT B;  2V77 A;  3V38 A;  2XEF A;  4R76 A;  4IAV A;  2AFO A;  4R7M A;  2ZEP A;  3D66 A;  2ZEF A;  3NA6 A;  1UWY A;  4OKO A;  2PJ8 A;  2PJ2 A;  2PVW A;  3N5F A;  1LOK A;  2PJ4 A;  3ISZ A;  4NGN A;  4WJB A;  4X3R A;  4OC5 A;  3IFE A;  3S9M A;  7CPA A;  3DGV A;  2QYV A;  1XRY A;  4P6Y A;  4PXD A;  4NJQ A;  2GLF A;  2PJ9 A;  5LYL A;  4BD9 A;  1ELM P;  4EFD A;  3RAM A;  4ZX9 A;  1YW4 A;  4DUK A;  4NFR A;  2WYR A;  1ZG7 A;  4F9V A;  2HC9 A;  4A38 A;  4OC3 A;  2AFW A;  4OIW A;  3KQX A;  4MCS A;  3GB0 A;  5I4M A;  3PBE A;  2BOA A;  3IO1 A;  2IQ6 A;  5CPA A;  3NH4 A;  4CPA A;  4R6T A;  2PVV A;  2I3C A;  2ZEG A;  3SJF A;  1CPS A;  1QQ9 A;  4AXV A;  2CTC A;  1XMB A;  4FWU A;  4P4F A;  4MRI A;  3WC6 A;  4P4D A;  4F8Z A;  2PCU A;  1AMP A;  1XBU A;  1YLO A;  4YWY A;  3KHX A;  1AYE A;  4GM5 A;  5DS0 A;  5K8N A;  5HVH A;  4PXB A;  2BCO A;  1HDQ A;  2RFH A;  5K8P A;  2CF4 A;  3HUV A;  4MHP A;  3FEE A;  5JH9 A;  3CDX A;  3CPA A;  2AFX A;  2AFS A;  2PJ7 A;  2EWB A;  4WWV A;  2PE3 A;  2V8V A;  1CPX A;  3PBB A;  2ZEM A;  2ZEE A;  1DTD A;  2HB6 A;  2ZEH A;  2V8D A;  3NH8 A;  4OC2 A;  3H8F A;  3D67 A;  1LCP A;  1RTQ A;  3PRT A;  2VL1 A;  3ISX A;  1ARM A;  1TKH A;  3B3W A;  2V8G A;  2Q51 A;  3KZW A;  3PFE A;  4ZYQ A;  1LAN A;  2C6G A;  4OC4 A;  3BI1 A;  2IMO A;  5F09 A;  5LRJ A;  3SJX A;  2ZED A;  1EE3 P;  1FT7 A;  2PIZ A;  4MHN A;  4OP4 A;  3B3V A;  4JZ0 A;  2EK9 A;  1VGY A;  4OME A;  1YW6 A;  2POK A;  3KAS A;  1R3N A;  3VH9 A;  5HXD A;  3QNV A;  2C6C A;  5JGF A;  2RB7 A;  4P10 A;  4NJR A;  5LRG A;  1CG2 A;  2ZEL A;  5LYF A;  3S9N A;  2OR4 A;  3D7G A;  1XJO A;  4EWT A;  3FF3 A;  2JBK A;  4NGP A;  4NGS A;  2ZOF A;  3S9L A;  1M4L A;  3GLJ A;  4P4B A;  4JYW A;  1Z8L A;  1BPN A;  1VIX A;  1PCA A;  2NSM A;  3PB4 X;  4PQA A;  3KL9 A;  4P44 A;  4NGQ A;  2O53 A;  2JBJ A;  1QMU A;  5LYI A;  2V8H A;  4ZX8 A;  3KQZ A;  3BHX A;  3NFZ A;  4MHZ A;  4UEZ A;  3D4U A;  1CX8 A;  3B3C A;  4R8F A;  1BAV A;  2ZOG A;  4F9U A;  4K3N A;  2PIY A;  1OBR A;  5CBM A;  3PB9 X;  3KGQ A;  4P4J A;  3JRU A;  3GUX A;  2PJA A;  4P4I A;  4FBE A;  1ZLI A;  2PRQ A;  2Q43 A;  3IC1 A;  4OC1 A;  3B2Y A;  4MCQ A;  4P45 A;  4ZY0 A;  5LYD A;  3L2N A;  5IB9 A;  4PXE A;  3FEC A;  2F8H A;  2JEW A;  3SJG A;  4A37 A;  1GYT A;  4UIB A;  4A94 A;  3H8E A;  3SI1 A;  1YSJ A;  1CP7 A;  4TWE A;  4ZI6 A;  5LRK A;  4NGR A;  6CPA A;  2PJC A;  4H2K A;  1DE4 C;  1ELL P;  1LAP A;  4MXU A;  4ZY2 A;  4ONW A;  4B6Z A;  5D29 A;  3B3S A;  1Y0Y A;  4OID A;  3FED A;  1ZLH A;  4NGT A;  4DYO A;  5JM6 A;  3HLP A;  2PJ0 A;  4RUH A;  3KI9 A;  3D68 A;  1TF9 A;  3B35 A;  3PFO A;  3WT4 A;  3KHZ A;  4Q7A A;  4LQG A;  1Z2L A;  1Y7E A;  4DJL A;  3MRU A;  3SJE A;  4O23 A;  4IHM A;  4FAI A;  1ZG9 A;  1TKF A;  1FNO A;  2PJ5 A;  1IY7 A;  3K2K A;  4W9Y A;  4G1P A;  1F57 A;  5J1Q A;  2PJ3 A;  5D8N A;  1JQG A;  3TX8 A;  2EK8 A;  3KR5 A;  2C1C A;  3LMS A;  1F2P A;  1Y0R A;  4NGM A;  2IJZ A;  4MCR A;  4MHY A;  3T8W A;  4TNU A;  2XEG A;  1TXR A;  3IIB A;  3H8G A;  3RBU A;  1TF8 A;  1TKJ A;  3K9T A;  4UEF A;  2F7V A;  1ZG8 A;  4YU9 A;  1F2O A;  8CPA A;  5HVF A;  5K8O A;  2PJ1 A;  3LWU A;  3FVL A;  2CIJ A;  3BXM A;  2ZEN A;  3PB7 X;  2OOT A;  1NSA A;  1IGB A;  3IEH A;  5ELY A;  2BO9 A;  2XEJ A;  3WC5 A;  3FJU A;  1VHO A;  4X8I A;  4IK2 A;  3VAT A;  3D7F A;  2AFU A;  3FH4 A;  3V7Z A;  3CT9 A;  1CBX A;  4MMO A;  3TC8 A;  2Q4Z A;  3SI0 A;  2AFM A;  2PJB A;  4A39 A;  2G9D A;  1XFO A;  3CPX A;  4FUU A;  3WC7 A;  4UF4 A;  1KWM A;  5K8M A;  3B7I A;  4MCP A;  2AFZ A;  3PEI A;  3IJ3 A;  3SI2 A;  1Z5R A;  2XEI A;  4EME A;  5THW A;  3D7D A;  2CTB A;  3RZA A;  1YME A;  2FVG A;  1LFW A;  3DLJ A;  3I1U A;  1R43 A;  3BI0 A;  2J9A A;  1CP6 A;  3KR4 A;  1LAM A;  3NH5 A; 
#chains in the Genus database with same CATH topology
 2R8V A;  3FX6 A;  2CY2 A;  2NYQ A;  4ZY1 A;  3LNN A;  3A3G A;  2EFG A;  4KSI A;  5BSY A;  3MN8 A;  4DNC A;  4Z4Y A;  4PPZ A;  1XOV A;  2DEA A;  5J3O A;  1XB2 A;  1YR0 A;  4C43 A;  4R87 A;  3PB8 X;  3IWW A;  3QB8 A;  1U6M A;  2GRE A;  5FO1 A;  1N06 A;  2YWF A;  3E20 A;  2DET A;  3CCR B;  1QG0 A;  2VBS A;  1IJF A;  4IAV A;  4P9S A;  1YQE A;  1VQN B;  3CC2 B;  1ZM3 A;  5IYQ A;  3D66 A;  2CNS A;  2JJ2 A;  4P3I A;  3NA6 A;  1UWY A;  4OKO A;  1ZM2 A;  2X6X A;  2JLM A;  2CK3 A;  2PJ8 A;  3QE2 A;  3TT2 A;  1D8T A;  2GFQ A;  4B3F X;  4NF1 A;  1LOK A;  4KOS A;  2ZTN A;  4NGN A;  2C5B A;  2O28 A;  1TIQ A;  4C2Y A;  3IWE A;  3IFE A;  5F46 A;  2QYV A;  2BM0 A;  4P6Y A;  1KC8 D;  5TY0 A;  3S6K A;  3BY2 A;  4B4D A;  3G6E B;  1ELM P;  4ZBG A;  1QGZ A;  1VQ7 B;  1YW4 A;  2WYR A;  4AVZ A;  4AVA A;  1NJI D;  1YVK A;  5B6I A;  5HZB A;  4A38 A;  1Q2Y A;  1OZP A;  4MJ8 A;  2QEC A;  2AFW A;  3EO4 A;  3KQX A;  1WOP A;  2ZBU A;  2WUU A;  4FN5 A;  2BOA A;  3IO1 A;  3BQJ A;  5CNP A;  3NH4 A;  3AVT A;  2BGI A;  3AVY A;  2CTC A;  2F1M A;  2Z3L A;  4FWU A;  2ZL7 A;  4EH1 A;  2PCU A;  2Z6B D;  3FJO A;  3ZZT A;  1VKC A;  2Z3M A;  4A30 A;  1KRH A;  4MFL A;  4CAF A;  4G5G A;  1AYE A;  3OJX A;  1FRN A;  5GV8 A;  5DS0 A;  3FRM A;  3LVB A;  4XLH A;  3CCL B;  3QSY A;  1HDQ A;  3N7Z A;  4WZK A;  5K8P A;  3W5V A;  4UBR A;  4BBH A;  4Q38 A;  3CPA A;  2AFX A;  4TMV A;  4ZGQ B;  4GQN A;  3FPP A;  3FIX A;  1VHS A;  1XE1 A;  2ZEM A;  2PC1 A;  2HB6 A;  5E96 A;  3NH8 A;  4KSF A;  2XNC A;  2OBS A;  1T6Z A;  4P2N A;  3D67 A;  3H8F A;  3EXN A;  3TFY A;  2VL1 A;  2P6G A;  1S7L A;  3EFA A;  2OB0 A;  3IWG A;  2E1R A;  1HA3 A;  5F4M A;  4UWI A;  3D3S A;  4NXY A;  1MRZ A;  4QVJ A;  1E62 A;  3A3B A;  2ZED A;  1EE3 P;  5H59 A;  3RYO A;  3MGD A;  3B3V A;  4XNH C;  4JZ0 A;  2Q6K A;  4OME A;  4NEX A;  5KNL A;  3GY9 A;  3CP2 A;  2POK A;  4M0L A;  3VH9 A;  5HXD A;  4OPO A;  1H8H A;  4YHB A;  2RB7 A;  2PMD A;  1N08 A;  2ZEL A;  1Q9S A;  1M1D A;  1M4G A;  2OZU A;  2OR4 A;  4II9 A;  3D7G A;  5IYN A;  1CM0 A;  4EWT A;  4B44 A;  4NGP A;  4RPD A;  3S9L A;  3SJZ A;  1EFT A;  1YVO A;  1N8R D;  4PC6 A;  4P4B A;  2YGW A;  3CXP A;  3B8G A;  4OPS A;  1BPN A;  1VIX A;  2YWG A;  3PB4 X;  4PQA A;  1FNM A;  1QMU A;  4UCP A;  2V8H A;  3QFC A;  4CYO A;  3G4S B;  1KZF A;  3ES9 A;  1COW A;  1W9X A;  2ZXI A;  4ZX8 A;  4AG7 A;  3AST A;  1V0C A;  4X7D A;  3TTH A;  3KQZ A;  1S7F A;  4Y7C A;  2Q0Y A;  4UEZ A;  4MHD A;  3W2G A;  4AC9 A;  3CPW B;  4B14 A;  3ONU A;  4F9U A;  5BSX A;  1OBR A;  1Q2D A;  2C78 A;  3VO1 A;  4P4J A;  3JRU A;  2HMA A;  2PRQ A;  4P45 A;  3LD2 A;  5LYD A;  3L2N A;  4YAW A;  3A9L A;  2C5H A;  1KK2 A;  2BF4 A;  3B8H A;  1NRK A;  2F8H A;  2XOK A;  4KOW A;  3LO8 A;  1E63 A;  2ZBV A;  4ZV4 A;  5AG5 A;  4KOT A;  4IW3 B;  4MFZ A;  2B3U A;  4RD4 A;  4NBS A;  4B5P A;  1LAP A;  4B6Z A;  3T51 B;  2B4D A;  4XON A;  5DWN A;  1E3Z A;  4G7W A;  3W6S A;  4XOR A;  4B5O A;  3AVX A;  4DYO A;  1N0U A;  1EWY A;  1K4J A;  3D26 A;  3KI9 A;  1TF9 A;  1I7P A;  3PFO A;  2Q04 A;  3KHZ A;  2GJR A;  3WQZ A;  1B6B A;  2WPW A;  4YEL A;  4CYN A;  1AIP A;  1ZG9 A;  3KEW A;  2PJ5 A;  4MYU A;  4G1P A;  4K30 A;  4M4S A;  3J81 k;  3VNU A;  2C77 A;  3E1Y E;  3G05 A;  3CC4 B;  4CRY B;  3TO7 A;  2X6Y A;  5FIU A;  3CW2 A;  2C1C A;  1F2P A;  4NGM A;  5AG4 A;  3WXM A;  2HV2 A;  3A8J A;  2XEG A;  3FB3 A;  4QUS A;  4CGP A;  2JEV A;  1TKJ A;  1UFH A;  2F7V A;  2B7B A;  8CPA A;  1Q81 D;  3OWC A;  2CIJ A;  4JXR A;  1WOS A;  1EFU A;  3DDY A;  1KK1 A;  2F5I A;  2M5S A;  3IEH A;  4HPS A;  2BO9 A;  4LBZ A;  2XEJ A;  3FJU A;  1VHO A;  4C7I A;  4X8I A;  4RI1 A;  1RQR A;  3R6K A;  3I1F A;  2J8M A;  4TKO B;  4EVY A;  4R71 A;  4MMO A;  2JIZ A;  2J7K A;  4NNJ A;  2Q4Z A;  3SI0 A;  4QFM A;  2AFM A;  1F60 A;  2BVN A;  4ROX A;  2PJB A;  1XFO A;  4FUU A;  4PAA A;  5DWM A;  1QVG B;  1KWM A;  3U6B A;  3F8K A;  3OE7 A;  3B7I A;  1W0J A;  4RS2 A;  1M90 D;  3VMF A;  1KK0 A;  3PEI A;  4YGO A;  1Z4E A;  2BL1 A;  1Z5R A;  2XEI A;  4MFK A;  5IK2 A;  4EME A;  2JN9 A;  2CTB A;  2OBT A;  2ZTG A;  5G22 A;  3RZA A;  3I1U A;  3DLJ A;  4KKU A;  4B5P B;  5IB0 A;  3BC9 A;  1Q2C A;  1N71 A;  2B4D B;  4ACB A;  4MI4 A;  1IOF A;  2RC5 A;  3KR4 A;  3NH5 A;  1IOI A;  1ARL A;  3D7H A;  4PSW A;  4RDK A;  2VBV A;  5L46 A;  1VQM B;  3W2H A;  4C68 A;  1JJ2 B;  3A1P A;  5A8A A;  1BPM A;  4BPR A;  3CZX A;  2V7T A;  1MK4 A;  3ASS A;  2ZEO A;  4OC0 A;  5KTC A;  3JQR A;  5HVG A;  1M44 A;  2ABZ A;  2YNC A;  3WY9 A;  4RPB A;  2GLJ A;  1VHE A;  2C4U A;  2P3M A;  1QSM A;  3FMC A;  4B13 A;  2V7X A;  3BJ8 A;  4XNF A;  1DDG A;  2QJ8 A;  3DNS A;  4UEE A;  1YX2 A;  1PYT B;  1IIC A;  4JD6 A;  2V77 A;  2XEF A;  4KS9 A;  4TN1 A;  4R76 A;  4Z4U A;  4CGN A;  1DDI A;  4JWP A;  2ZZF A;  2AFO A;  4R7M A;  1G7R A;  2VNI A;  3OFN A;  1J4J A;  3ZPN A;  1YX0 A;  3B78 A;  3H5Z A;  2PVW A;  4PK2 A;  1VQ8 B;  3N5F A;  3DSB A;  1NB9 A;  3ASP A;  2GE3 A;  4R57 A;  2Z10 A;  5DN6 A;  4KOV A;  3AVW A;  4WJB A;  4HNY B;  2VZY A;  4OC5 A;  5BWA B;  2XEX A;  4OLL A;  1XRY A;  3DR8 A;  4Z4V A;  1IYK A;  2OH1 A;  2PR8 A;  2PJ9 A;  1FX0 A;  4RM0 A;  3H4Q A;  3RAM A;  4L8J A;  1MAB A;  4E8O A;  2OTJ B;  3PA1 A;  1W35 A;  4G6I A;  1FRQ A;  4DUK A;  4NFR A;  1VLO A;  1SM4 A;  4PGO A;  1ZG7 A;  4OAD A;  1P0H A;  4UCM A;  2Z3P A;  4OC3 A;  4R3K A;  4OIW A;  2OK7 A;  3GB0 A;  2PLF A;  4A31 A;  5I4M A;  2FL4 A;  3BCF A;  4PSX A;  2B4B A;  2PIA A;  4NCN A;  2X53 S;  2IQ6 A;  4B10 A;  2QE7 A;  2FE7 A;  4U5Y A;  2J8R A;  4UZU A;  3CES A;  5EMN A;  5J35 A;  1XIX A;  2WJY A;  3VO2 A;  4P4F A;  2B5O A;  4MRI A;  4PV6 A;  3S6F A;  1XBU A;  4DQL A;  3AGQ A;  1Z8X A;  4UA3 A;  4UCN A;  4XPK A;  4U9Y A;  5K8N A;  5HVH A;  2BCO A;  4TMX A;  4PK3 A;  2Q4V A;  4PC1 A;  5JH9 A;  2QMU A;  3ZZI A;  4P22 A;  3GKR A;  1WSR A;  3I3G A;  5IYP A;  1PUA A;  2AFS A;  2PJ7 A;  2FIW A;  2PE3 A;  2WJV A;  5THX A;  4G1V A;  1E79 A;  4MFP A;  1FND A;  3AGP A;  1EFR A;  4XR6 A;  2I00 A;  2VYQ A;  1YJW B;  3K9U A;  1Z8W A;  1VQK B;  2V8G A;  2Q51 A;  2QTL A;  3KZW A;  2BGJ A;  5TR9 A;  3FNC A;  4LX9 A;  4E2A A;  1YJN B;  1EP1 B;  3PFE A;  4OC4 A;  2G3A A;  4CRZ B;  1M4D A;  5FNZ A;  5IYW A;  5J8F A;  5F09 A;  2PDO A;  5C88 A;  1P4N A;  3Q6Q A;  2FSR A;  1V0E A;  2D3L A;  3SLN A;  5LRJ A;  5KTA A;  1VQ5 B;  1FT7 A;  2DY1 A;  2B5G B;  5ISV A;  3P2H A;  4RCY A;  4KVX A;  3QFT A;  3R6J A;  2GPJ A;  3FBU A;  1R3N A;  4N3G A;  1PJ6 A;  5KSW B;  5JGF A;  3CXQ A;  4AF6 A;  4P10 A;  4UFW A;  5LRG A;  1GHE A;  1CG2 A;  1K9M D;  3LAC A;  5LYF A;  3S9N A;  1XJO A;  3SKB A;  4XOP A;  2VZL A;  3FF3 A;  2JBK A;  2D4P A;  2F43 A;  1IB0 A;  4X7F A;  4LC0 A;  1KUX A;  1M4L A;  3GLJ A;  2ZXH A;  2EBJ A;  1TVC A;  1PCA A;  1Y7R A;  1BX0 A;  3KL9 A;  2R98 A;  4XLA A;  2XND A;  4DQK A;  4HIZ A;  2O53 A;  4QVA A;  1RXT A;  2VJI A;  2LZJ A;  4XKW A;  4XN3 A;  5EC4 A;  5IX3 A;  4OOX A;  4LBW A;  4LBV A;  4M53 A;  1QSN A;  1HZE A;  2AJ6 A;  1UD4 A;  3D4U A;  3W91 A;  1YHQ B;  1CX8 A;  3OOC A;  1ZO0 A;  1QFJ A;  1VJS A;  4OAE A;  3WNB A;  4KLW A;  4FBE A;  3W5U A;  1G7S A;  4DNT B;  4OC1 A;  4Y49 C;  4RD2 A;  3QAY A;  4YAU A;  2CRV A;  4N3N A;  4PXE A;  4ORF A;  1OB2 A;  1BO4 A;  3CRZ A;  2OBR A;  4P26 A;  1D1N A;  2DOG A;  1OB5 A;  3H8E A;  4I49 A;  2BMW A;  1N07 A;  4F6A A;  4ZI6 A;  5LRK A;  2VJJ A;  3S6H A;  3SEJ A;  2PJC A;  3QFS A;  3CB4 A;  3T53 B;  4ACA A;  1DE4 C;  4H2K A;  4ZY2 A;  4ONW A;  3OZW A;  4GXH A;  1Y0Y A;  2ZL6 A;  3FED A;  4WZT A;  4Z4S A;  3VWE A;  5KW9 A;  2Q7S A;  3OZV A;  5JM6 A;  3HLP A;  3RY8 A;  3PZJ A;  3B35 A;  4H9G A;  2QML A;  1FNC A;  3MHP A;  1D2E A;  4XQF A;  4LQG A;  1Z2L A;  1Y7E A;  2V7W A;  1ZM9 A;  3VWD A;  4A2Z A;  4B48 A;  4IHM A;  1E43 A;  4FWT A;  3OJW A;  2ZW5 A;  1IYL A;  1FNO A;  3D8P A;  3DDD A;  5HH1 A;  1F57 A;  1NBM A;  5J1Q A;  1G7C A;  2PJ3 A;  4FXU A;  1JQG A;  3P27 A;  4P6V F;  4CGO A;  4KLV A;  2REE A;  2QEX B;  2IJZ A;  2WPX A;  4MCR A;  1Z9U A;  4KKT A;  4K1X A;  4FK8 A;  1EXM A;  1GJR A;  1ON0 A;  2VZZ A;  4KKS A;  2D9R A;  3K9T A;  2Q6O A;  2GK7 A;  5F4J A;  1QSO A;  4YRH A;  3PGP A;  4YU9 A;  1F2O A;  5HVF A;  3C26 A;  1BJK A;  3CTA A;  3Q3A A;  3BXM A;  3E0K A;  1NSA A;  1EP2 B;  1H42 A;  3I9S A;  5ELY A;  4J0Q A;  3RO0 A;  4DK0 A;  4R9M A;  3WC5 A;  2REF A;  3VAT A;  2AFU A;  1S5K A;  4YFJ A;  3V7Z A;  4C2X A;  3CT9 A;  3MMP A;  4Y49 B;  2NPF A;  1R5O A;  4XL9 A;  2G9D A;  2X0K A;  3BY1 A;  2ZZE A;  5K8M A;  4P3Y A;  4MCP A;  1KQS B;  1YRE A;  3JUW A;  4KUB A;  4UWJ A;  3R95 A;  2AE6 A;  4X05 A;  1QH0 A;  2VEZ A;  4XPD C;  3GYA A;  3R9F A;  1YME A;  1RQP A;  3BI0 A;  1WOO A;  5H86 A;  3G8W A;  1OHH A;  3WND A;  2X3U A;  3NE7 A;  5F47 A;  2DEU A;  1B23 P;  4LBY A;  2O4H A;  2QVP A;  3WAB A;  5TRD A;  5C82 A;  5J8C A;  3V8I A;  4P1V A;  2H5M A;  4P4E A;  3CCU B;  2DYI A;  3GSI A;  4Q36 A;  1HDU A;  4H6U A;  1VQP B;  2GU2 A;  2ANP A;  1H8L A;  4RDJ A;  4M6G A;  4ONU A;  4CYP A;  4XNH B;  4X2T A;  2CW5 A;  1AUG A;  4M2L A;  5F49 A;  1HEE A;  1Q7L A;  3B3T A;  3TO9 A;  3G71 B;  1XF8 A;  4UIA A;  1S3Z A;  2JDC A;  3V38 A;  2CBX A;  4BIN A;  2OZH A;  2B58 A;  1G7T A;  2R1I A;  1SKY B;  4RCZ A;  1VQO B;  2ZPA A;  4AB7 A;  2JDD A;  2ZEP A;  1JWQ A;  2ZEF A;  2D3N A;  3DR6 A;  1PKV A;  3OPO A;  1NE9 A;  2XZL A;  2P6E A;  2X7B A;  2WR8 A;  2OYN A;  5JQ4 A;  3ISZ A;  4A33 A;  4DK1 A;  2CNM A;  1X10 A;  4X5K A;  1GAQ A;  4X3R A;  1BX1 A;  4QUZ A;  5DSZ A;  3S9M A;  3DGV A;  1N0V C;  1S7K A;  2BM1 A;  3SLD A;  1I12 A;  3IU1 A;  3A8I A;  4NJQ A;  4KVO E;  5AG7 A;  5LYL A;  1GAW A;  2F1L A;  1WU8 A;  4AVC A;  1QVF B;  1B87 A;  3I55 B;  5F48 A;  4F9V A;  5CDF A;  4HNW B;  1ZM4 A;  1DG1 G;  2HC9 A;  2Q6I A;  4UZE A;  1GVH A;  4YAO A;  5HKK A;  4TMT A;  1YI2 B;  4HE6 A;  3PBE A;  2PRB A;  3CCJ B;  3ZJ0 A;  2P0W A;  5CPA A;  3MCA A;  4CPA A;  2PVV A;  2I3C A;  2ZEG A;  5EMI A;  1QQ9 A;  1XMB A;  2QA4 B;  3WC6 A;  1YLE A;  4P4D A;  4TSF A;  4Y9R A;  2EIX A;  3GVK A;  3FYN A;  4OOV A;  1YLO A;  2RC6 A;  3CCV B;  4GM5 A;  1KMH A;  3W2E A;  3FKS A;  4Z1M A;  1CJW A;  5A28 A;  2RFH A;  3Q6R A;  5AGE A;  1KUV A;  4MY0 A;  2CXA A;  4XD7 A;  4WWV A;  3AVU A;  3P26 A;  5FA6 A;  2QIR A;  2W6J A;  1A2Z A;  3LQ6 A;  3OP1 A;  3PRT A;  1AMO A;  3B3W A;  1S0U A;  4P12 A;  3W5H A;  4II2 A;  3CCQ B;  4RD3 A;  1LAN A;  4B12 A;  2C6G A;  1L0C A;  3BH4 A;  4J3G A;  1VQ6 B;  1IB1 E;  2IMO A;  3GIR A;  2Z11 A;  1T6Y A;  2VNK A;  2WSA A;  3CMA B;  3WNC A;  1I8D A;  4UFV A;  5H84 A;  2C4T A;  1M1K D;  1QGY A;  1WWZ A;  1S72 B;  5A27 A;  4U9Z A;  2ATR A;  2K5T A;  2VI7 A;  1VGY A;  2GQF A;  1KJZ A;  3JQP A;  4OP7 A;  2HCJ B;  2WZP P;  2DXQ A;  3QNV A;  3SJP A;  2C6C A;  2B5G A;  1Z8T A;  1P4M A;  3EC4 A;  1N05 A;  1TLL A;  2NMT A;  1MJB A;  1WP6 A;  2HLD A;  4QC6 A;  4NGS A;  3CP8 A;  1FY7 A;  2V31 A;  1KTV A;  1RO5 A;  4YEJ A;  1W2B B;  4WZE A;  3OKX A;  4JYW A;  3FXT A;  2OZG A;  3ZIA A;  3CCE B;  5G21 A;  4ZGY B;  1V5V A;  2X6W A;  4G1B A;  3SXN A;  3CD6 B;  2QTZ A;  4NGQ A;  3BCD A;  5LYI A;  2JJ1 A;  4CS0 B;  2YWE A;  4M3S A;  2X8K A;  2PSW A;  3ZUG A;  2C2W A;  4MHZ A;  4AVB A;  4ASU A;  1VQL B;  2VBQ A;  4XKV A;  3B3C A;  4XN0 A;  4MFQ A;  1BAV A;  1ZUN B;  2ZOG A;  2I79 A;  2BSA A;  4K3N A;  1S7N A;  2PIY A;  5CBM A;  2FS5 A;  1E3X A;  3GUX A;  3GQB A;  3VNV A;  3S6G A;  2FXF A;  3CCS B;  4P4I A;  2PR1 A;  4P25 A;  1ZLI A;  2V7U A;  1Z4R A;  1JA1 A;  4UZF A;  1JB9 A;  4ZY0 A;  4JMQ A;  3ZC3 A;  5IB9 A;  1Y9W A;  4M6H A;  2JEW A;  1NMT A;  2KVO A;  1JA0 A;  2AHO A;  4UIB A;  4A94 A;  3SI1 A;  4RD6 A;  2GK6 A;  5AN9 A;  1YSJ A;  1CP7 A;  5FL7 A;  4TWE A;  2F4N A;  1H8E A;  2D4O A;  3NE8 A;  3OEH A;  1VQ4 B;  3JQQ A;  6CPA A;  1K8A D;  1LRZ A;  4RDL A;  4CQJ A;  5IV0 A;  2VBU A;  5D29 A;  3B3S A;  2QN6 A;  4GS4 A;  1ZLH A;  2Y0M A;  4NGT A;  1IHM A;  4QHY A;  4UFX A;  3TO6 A;  1PJ5 A;  4RUH A;  4A32 A;  3D68 A;  4U9U A;  2J8N A;  4LUA A;  1PJ7 A;  4PC7 A;  2HQY A;  4Q7A A;  5HMN A;  4X06 A;  3F5B A;  4CAV A;  3MRU A;  2ZW7 A;  1DAR A;  3CC7 B;  1TKF A;  2OU2 A;  3K2K A;  1IY7 A;  4W9Y A;  1XMT A;  2EUI A;  5G20 A;  3LQE A;  4IF5 A;  3TX8 A;  2EK8 A;  2ZW4 A;  3D2P A;  3KR5 A;  4RD0 A;  3OEE A;  1R57 A;  4Z4R A;  4PAB A;  1Q7Y D;  4MHY A;  3T8W A;  1I1D A;  1KZL A;  3OZU A;  3IIB A;  4ZCL A;  3CXC B;  2ZW6 A;  4NCZ A;  3ZZU A;  4M85 A;  4UEF A;  2B7C A;  2HDN B;  1WSV A;  5K8O A;  2PJ1 A;  2CND A;  3FVL A;  3W2I A;  3V7A A;  2Z0Z A;  1A8P A;  3W2F A;  3W6X A;  2B3V A;  4II3 A;  1WOR A;  4QBJ A;  2VQY A;  4KZT A;  4X7E A;  1H85 A;  4KOY A;  4XLF A;  4IK2 A;  3FH4 A;  2JDI A;  1QUF A;  2VXK A;  3ONY A;  1CBX A;  3NE5 B;  3ZBU A;  4WQM A;  4A39 A;  3CPX A;  4JXQ A;  4UF4 A;  5GV7 A;  3A8K A;  3AVV A;  2YNE A;  2AFZ A;  1XQB A;  3SI2 A;  1OGJ A;  4LQ6 A;  1UD5 A;  1FNB A;  4CAW A;  2W6I A;  1BLI A;  1UD8 A;  2FVG A;  1LFW A;  4RLZ A;  2Q44 A;  2WSS A;  3Q38 A;  4X7C A;  4IUS A;  2QDX A;  4C0S A;  4ZCM A;  5JPH A;  3WBJ A;  2DPT A;  2HUZ A;  1YIT B;  4Z65 A;  2C6P A;  5H5J A;  4C7H A;  4H6Z A;  2ZL5 A;  3BNW A;  3B82 A;  1UD3 A;  3P2F A;  3PB6 X;  1BLL E;  2YND A;  1BOB A;  2BN4 A;  2PJ6 A;  2ZXV A;  1PU9 A;  1R5N A;  1WDT A;  4PXC A;  2E1B A;  2GJK A;  2G0B A;  4CGL A;  1W87 A;  1YJ9 B;  3VAR A;  1T6X A;  2A4N A;  3PEN A;  2WZN A;  5HZA A;  1BMF A;  2CNT A;  2R6H A;  3ZBT A;  4F0X A;  3WBK A;  2EVN A;  2YWH A;  2X85 A;  3PUM A;  5JBQ A;  2FT0 A;  4ZGN B;  2BEI A;  1QST A;  4PC3 A;  3CCM B;  5FO0 A;  5A88 A;  2FIA A;  4MBU A;  2PJ2 A;  1SKQ A;  2PJ4 A;  4CGM A;  4KSA A;  1WPC A;  1OGI A;  4KOX A;  1CNE A;  4RJL A;  7CPA A;  3TE4 A;  2DF5 A;  1TUI A;  4MY3 A;  4PXD A;  4QV2 A;  2GLF A;  3CME B;  4BD9 A;  4EFD A;  4ZX9 A;  3ASQ A;  2Z3K A;  1MJA A;  2WPD A;  1IJE A;  1UMK A;  2Q7B A;  2BUE A;  4HE5 A;  1J9Z A;  4C2Z A;  2FX3 A;  4R3L A;  4MCS A;  2GAN A;  4FD5 A;  3VR6 A;  2CC2 A;  5GCN A;  1UD6 A;  2QGG A;  1BQE A;  4Q7J B;  4R6T A;  2GJP A;  1IID A;  3SJF A;  1GO2 A;  1CPS A;  4AXV A;  3SHP A;  3H9N A;  4F8Z A;  3GVJ A;  4XPL A;  4RD1 A;  1AMP A;  3PUN A;  4YWY A;  3KHX A;  3V76 A;  4FD6 A;  1K28 D;  2V4D A;  3BLN A;  2XGJ A;  4Z4T A;  1KK3 A;  4PXB A;  1E1Q A;  4NSQ A;  1NSL A;  4KVM E;  2CF4 A;  3HUV A;  4MHP A;  3FEE A;  3CDX A;  2EWB A;  4MFJ A;  4ZCI A;  2V8V A;  1Q86 D;  3CXS A;  2BPO A;  1YGH A;  1Q82 D;  1CPX A;  3PBB A;  3PA2 A;  2ZEE A;  3KKW A;  1KUY A;  1DTD A;  4QB9 A;  3F0A A;  2ZEH A;  2IL4 A;  2V8D A;  4AF7 A;  3JVN A;  4OC2 A;  2Z3O A;  1LCP A;  3HAG A;  1RTQ A;  2I1L A;  4MYT A;  3ISX A;  1ARM A;  1TKH A;  5TV2 A;  4Z4Z A;  4ZYQ A;  4B43 A;  5E6T A;  3T90 A;  3BI1 A;  3JTK A;  3FPK A;  3U6K A;  2FCK A;  4AG9 A;  1YIJ B;  4TMZ A;  4TT3 A;  4XOT A;  3D2M A;  5F4O A;  1GR1 A;  3SJX A;  4B3G A;  4MHN A;  2PIZ A;  4OP4 A;  3WYA A;  3ZZ0 A;  2EK9 A;  1YW6 A;  1EFC A;  3KAS A;  1UD2 A;  4M1K A;  4Z4W A;  4HKF A;  4E0F A;  3R9G A;  4NJR A;  3TOA A;  2VNJ A;  4KUA A;  1I21 A;  4TMW A;  3QAH A;  1VQ9 B;  4BMH A;  2ZOF A;  2Q6L A;  5G1Z A;  3IGR A;  1CQX A;  1Z8L A;  4F7D A;  1W34 A;  3WR7 A;  5HXB A;  2NSM A;  5KTD A;  4L89 A;  4P44 A;  3OAA A;  2JBJ A;  3EY5 A;  3GVL A;  1VLY A;  4UAJ A;  4B3X A;  1EP3 B;  4YXW A;  3BHX A;  5I0C A;  3NFZ A;  4XPD B;  4QVT A;  3UY5 A;  4FD7 A;  1VF7 A;  1XE4 A;  3OW7 A;  1B2R A;  4B47 A;  2GIV A;  4A95 A;  4Y9U A;  4YAF A;  3IU2 A;  3JU4 A;  4CAE A;  1E64 A;  2ZZG A;  4R8F A;  1TTT A;  4XLC A;  1KD1 D;  3PB9 X;  3KGQ A;  1T5E A;  3GIU A;  5IYR A;  4F0Y A;  4E0A A;  5A89 A;  2PJA A;  1QGA A;  2XZP A;  2Q43 A;  3IC1 A;  3B2Y A;  5LMZ A;  4MCQ A;  2P6F A;  1FDR A;  2Q4Y A;  1IU8 A;  3Q39 A;  1ELO A;  2OTL B;  3FEC A;  3QFR A;  1M4I A;  1MJ9 A;  3SJG A;  4A37 A;  1GYT A;  4CYQ A;  1QFY A;  1NB0 A;  2DPS A;  1QFZ A;  2RC4 A;  3U2Q A;  4DNR B;  1JNY A;  4WZL A;  4NGR A;  1QUE A;  1OB0 A;  1ELL P;  4MXU A;  4OID A;  2NV4 A;  4X0C A;  2XNJ A;  2PJ0 A;  1K73 D;  3T9Y A;  2YNC C;  3PVD A;  3WT4 A;  2G3T A;  4B11 A;  2R9V A;  4JJX A;  4FD4 A;  3R9E A;  4L8A A;  4HNX B;  4DJL A;  3TCV A;  4H89 A;  3RNZ A;  2VNH A;  3SJE A;  4O23 A;  3PP9 A;  4FAI A;  1YK3 A;  2BV3 A;  4OOS A;  2D74 A;  4M6I A;  1W0K A;  5D8N A;  2ODF A;  4XMY A;  1E1R A;  1CNF A;  4X07 A;  3LMS A;  1Y0R A;  3TOB A;  2R7H A;  3LOD A;  1I18 A;  2C27 A;  3OW2 B;  4TNU A;  2ZIT A;  1TXR A;  1NDH A;  4XLE A;  3H8G A;  4JLY A;  2DIE A;  3RBU A;  1TF8 A;  2V7V A;  3I56 B;  2ZZQ A;  1ZG8 A;  1S60 A;  1HVX A;  2OK8 A;  3T56 B;  1V0F A;  4PC2 A;  3LWU A;  3BJ7 A;  2ZEN A;  3PB7 X;  2OOT A;  5EBV A;  1IGB A;  3R96 A;  3SXO A;  4G7X A;  3G3S A;  3D7F A;  1X12 A;  1BPL A;  2V7Q A;  3CMM A;  1WK4 A;  2XZO A;  4XM3 A;  1Y9K A;  1WTH D;  4KOU A;  2ARH A;  4RN7 A;  3TC8 A;  1QX4 A;  2PQ8 A;  4CAX A;  3WC7 A;  3A35 A;  4KOR A;  1R5B A;  3R1K A;  4OPV A;  3IJ3 A;  2BSW A;  2KCW A;  4YAL A;  1S4M A;  2DER A;  1F20 A;  5THW A;  3D7D A;  5AG6 A;  1SQH A;  1XEB A;  2VBT A;  1R43 A;  2J9A A;  1QSR A;  2EO8 A;  2DCU A;  3ASR A;  2Z3N A;  3H94 A;  1CP6 A;  1U2R A;  5FVJ A;  1LAM A; 
#chains in the Genus database with same CATH homology
 2O4H A;  2QVP A;  3WAB A;  1ARL A;  3FX6 A;  4Z65 A;  2C6P A;  3D7H A;  2NYQ A;  4ZY1 A;  4P4E A;  4KSI A;  3MN8 A;  1HDU A;  3PB6 X;  4PPZ A;  1BPM A;  2GU2 A;  1BLL E;  2ANP A;  1H8L A;  2ZEO A;  4OC0 A;  4X2T A;  5HVG A;  2ABZ A;  2DEA A;  2PJ6 A;  1HEE A;  3PB8 X;  1Q7L A;  2GLJ A;  4PXC A;  1VHE A;  3FMC A;  3B3T A;  3IWW A;  2GRE A;  3VAR A;  2QJ8 A;  4UEE A;  4UIA A;  2WZN A;  1PYT B;  2V77 A;  3V38 A;  2XEF A;  4R76 A;  4IAV A;  2AFO A;  4R7M A;  2ZEP A;  3D66 A;  2ZEF A;  3NA6 A;  1UWY A;  4OKO A;  2PJ8 A;  2PJ2 A;  2PVW A;  3N5F A;  1LOK A;  2PJ4 A;  3ISZ A;  4NGN A;  4WJB A;  4X3R A;  4OC5 A;  3IFE A;  3S9M A;  7CPA A;  3DGV A;  2QYV A;  1XRY A;  4P6Y A;  4PXD A;  4NJQ A;  2GLF A;  2PJ9 A;  5LYL A;  4BD9 A;  1ELM P;  4EFD A;  3RAM A;  4ZX9 A;  1YW4 A;  4DUK A;  4NFR A;  2WYR A;  1ZG7 A;  4F9V A;  2HC9 A;  4A38 A;  4OC3 A;  2AFW A;  4OIW A;  3KQX A;  4MCS A;  3GB0 A;  5I4M A;  3PBE A;  2BOA A;  3IO1 A;  2IQ6 A;  5CPA A;  3NH4 A;  4CPA A;  4R6T A;  2PVV A;  2I3C A;  2ZEG A;  3SJF A;  1CPS A;  1QQ9 A;  4AXV A;  2CTC A;  1XMB A;  4FWU A;  4P4F A;  4MRI A;  3WC6 A;  4P4D A;  4F8Z A;  2PCU A;  1AMP A;  1XBU A;  1YLO A;  4YWY A;  3KHX A;  1AYE A;  4GM5 A;  5DS0 A;  5K8N A;  5HVH A;  4PXB A;  2BCO A;  1HDQ A;  2RFH A;  5K8P A;  2CF4 A;  3HUV A;  4MHP A;  3FEE A;  5JH9 A;  3CDX A;  3CPA A;  2AFX A;  2AFS A;  2PJ7 A;  2EWB A;  4WWV A;  2PE3 A;  2V8V A;  1CPX A;  3PBB A;  2ZEM A;  2ZEE A;  1DTD A;  2HB6 A;  2ZEH A;  2V8D A;  3NH8 A;  4OC2 A;  3H8F A;  3D67 A;  1LCP A;  1RTQ A;  3PRT A;  2VL1 A;  3ISX A;  1ARM A;  1TKH A;  3B3W A;  2V8G A;  2Q51 A;  3KZW A;  3PFE A;  4ZYQ A;  1LAN A;  2C6G A;  4OC4 A;  3BI1 A;  2IMO A;  5F09 A;  5LRJ A;  3SJX A;  2ZED A;  1EE3 P;  1FT7 A;  2PIZ A;  4MHN A;  4OP4 A;  3B3V A;  4JZ0 A;  2EK9 A;  1VGY A;  4OME A;  1YW6 A;  2POK A;  3KAS A;  1R3N A;  3VH9 A;  5HXD A;  3QNV A;  2C6C A;  5JGF A;  2RB7 A;  4P10 A;  4NJR A;  5LRG A;  1CG2 A;  2ZEL A;  5LYF A;  3S9N A;  2OR4 A;  3D7G A;  1XJO A;  4EWT A;  3FF3 A;  2JBK A;  4NGP A;  4NGS A;  2ZOF A;  3S9L A;  1M4L A;  3GLJ A;  4P4B A;  4JYW A;  1Z8L A;  1BPN A;  1VIX A;  1PCA A;  2NSM A;  3PB4 X;  4PQA A;  3KL9 A;  4P44 A;  4NGQ A;  2O53 A;  2JBJ A;  1QMU A;  5LYI A;  2V8H A;  4ZX8 A;  3KQZ A;  3BHX A;  3NFZ A;  4MHZ A;  4UEZ A;  3D4U A;  1CX8 A;  3B3C A;  4R8F A;  1BAV A;  2ZOG A;  4F9U A;  4K3N A;  2PIY A;  1OBR A;  5CBM A;  3PB9 X;  3KGQ A;  4P4J A;  3JRU A;  3GUX A;  2PJA A;  4P4I A;  4FBE A;  1ZLI A;  2PRQ A;  2Q43 A;  3IC1 A;  4OC1 A;  3B2Y A;  4MCQ A;  4P45 A;  4ZY0 A;  5LYD A;  3L2N A;  5IB9 A;  4PXE A;  3FEC A;  2F8H A;  2JEW A;  3SJG A;  4A37 A;  1GYT A;  4UIB A;  4A94 A;  3H8E A;  3SI1 A;  1YSJ A;  1CP7 A;  4TWE A;  4ZI6 A;  5LRK A;  4NGR A;  6CPA A;  2PJC A;  4H2K A;  1DE4 C;  1ELL P;  1LAP A;  4MXU A;  4ZY2 A;  4ONW A;  4B6Z A;  5D29 A;  3B3S A;  1Y0Y A;  4OID A;  3FED A;  1ZLH A;  4NGT A;  4DYO A;  5JM6 A;  3HLP A;  2PJ0 A;  4RUH A;  3KI9 A;  3D68 A;  1TF9 A;  3B35 A;  3PFO A;  3WT4 A;  3KHZ A;  4Q7A A;  4LQG A;  1Z2L A;  1Y7E A;  4DJL A;  3MRU A;  3SJE A;  4O23 A;  4IHM A;  4FAI A;  1ZG9 A;  1TKF A;  1FNO A;  2PJ5 A;  1IY7 A;  3K2K A;  4W9Y A;  4G1P A;  1F57 A;  5J1Q A;  2PJ3 A;  5D8N A;  1JQG A;  3TX8 A;  2EK8 A;  3KR5 A;  2C1C A;  3LMS A;  1F2P A;  1Y0R A;  4NGM A;  2IJZ A;  4MCR A;  4MHY A;  3T8W A;  4TNU A;  2XEG A;  1TXR A;  3IIB A;  3H8G A;  3RBU A;  1TF8 A;  1TKJ A;  3K9T A;  4UEF A;  2F7V A;  1ZG8 A;  4YU9 A;  1F2O A;  8CPA A;  5HVF A;  5K8O A;  2PJ1 A;  3LWU A;  3FVL A;  2CIJ A;  3BXM A;  2ZEN A;  3PB7 X;  2OOT A;  1NSA A;  1IGB A;  3IEH A;  5ELY A;  2BO9 A;  2XEJ A;  3WC5 A;  3FJU A;  1VHO A;  4X8I A;  4IK2 A;  3VAT A;  3D7F A;  2AFU A;  3FH4 A;  3V7Z A;  3CT9 A;  1CBX A;  4MMO A;  3TC8 A;  2Q4Z A;  3SI0 A;  2AFM A;  2PJB A;  4A39 A;  2G9D A;  1XFO A;  3CPX A;  4FUU A;  3WC7 A;  4UF4 A;  1KWM A;  5K8M A;  3B7I A;  4MCP A;  2AFZ A;  3PEI A;  3IJ3 A;  3SI2 A;  1Z5R A;  2XEI A;  4EME A;  5THW A;  3D7D A;  2CTB A;  3RZA A;  1YME A;  2FVG A;  1LFW A;  3DLJ A;  3I1U A;  1R43 A;  3BI0 A;  2J9A A;  1CP6 A;  3KR4 A;  1LAM A;  3NH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...