4P6YA

Crystal structure of the m42 aminopeptidase tmpep1050 from thermotoga maritima
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the M42 aminopeptidase TmPep1050 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4p6yA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p6yA01
1CX8A 4X2TA 1TXRA 1F57A 3BHXA 2V8VA 8CPAA 1BLLE 3MRUA 3K2KA 5LRJA 3NH4A 4R76A 1CPSA 2V8HA 2AFUA 4MHYA 3PBBA 4NGRA 2PIZA 3QNVA 2C6PA 3IC1A 4P6YA 2POKA 1ZLHA 1R43A 2GREA 2JBJA 3SJXA 1HEEA 1XRYA 3SJEA 3CDXA 1XJOA 2F8HA 3ISZA 1DTDA 4MCPA 3D67A 3KI9A 5K8NA 3D7GA 4Z65A 5D8NA 3FEEA 4F8ZA 1Z5RA 5JM6A 2ZEHA 3PFOA 1DE4C 4OC2A 6CPAA 5LYDA 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 1ARMA 4F9UA 3NH8A 2ZOFA 3D68A 2PJ4A 3N5FA 4NFRA 4P4FA 3TC8A 5LRKA 3PRTA 3FF3A 4P4JA 3WC7A 2PVVA 1XFOA 1HDQA 3FECA 1YW4A 4FUUA 2XEGA 3KQXA 4NGMA 3D66A 2JBKA 1VIXA 3FX6A 4ZI6A 3PB4X 3S9MA 3FVLA 4UIAA 1IGBA 2PRQA 2ZENA 2PJ3A 4G1PA 2ZEMA 4PPZA 2HB6A 4YU9A 2EWBA 5LYIA 3PEIA 2PJBA 4PXDA 1PCAA 1BPNA 2CF4A 3WT4A 1QMUA 5JH9A 2PVWA 2XEFA 4NGQA 5K8PA 2GLJA 4JYWA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 5HXDA 4H2KA 1QQ9A 5LYFA 3FH4A 4BD9A 3B7IA 2NSMA 1Q7LA 2CTBA 3CPAA 2CIJA 1GYTA 4UEEA 3IEHA 4NJRA 3IFEA 2DEAA 3B35A 4NGPA 1IY7A 2ANPA 1CP6A 1TF8A 2AFMA 3LMSA 4FAIA 4OC1A 2CTCA 1Y7EA 4OKOA 4PXBA 3WABA 4O23A 2EK9A 4K3NA 2RB7A 2VL1A 2V77A 4UEFA 2PJ9A 2ZEGA 3VH9A 1R3NA 2PJ7A 3SJFA 4OIDA 1FT7A 2IMOA 3B3SA 1AMPA 2QYVA 2V8GA 4P4DA 4EMEA 1UWYA 2OR4A 3B2YA 2BCOA 3B3CA 4ONWA 3CPXA 2IQ6A 3VARA 3KL9A 4P10A 1LCPA 4MXUA 3D7FA 2FVGA 3VATA 3KHXA 1JQGA 2J9AA 4IK2A 1RTQA 3DLJA 1CPXA 1LOKA 3SI2A 4DYOA 3PB7X 2ZEFA 3KASA 3RAMA 1LAPA 1AYEA 2C6GA 4R6TA 5F09A 3IIBA 5J1QA 1FNOA 4OMEA 4UIBA 1OBRA 4MCRA 3KR5A 4OC4A 1ZG9A 2HC9A 2WYRA 4MHNA 4OC0A 5DS0A 4MMOA 2PJ2A 4NGTA 2PJ5A 5LYLA 1LAMA 2BO9A 4DUKA 4Q7AA 4ZY0A 2V8DA 4GM5A 1TF9A 5CPAA 5CBMA 3MN8A 5THWA 4RUHA 1NSAA 4MCQA 2Q51A 3GB0A 4ZX9A 4NGNA 2C1CA 4FWUA 3L2NA 3T8WA 3BXMA 1EE3P 3SI1A 3PB9X 3IJ3A 4R8FA 3RZAA 3DGVA 2O4HA 4ZY2A 1PYTB 3IWWA 3CT9A 4PXEA 7CPAA 1TKHA 1YMEA 2QJ8A 4W9YA 1VGYA 2ZEOA 3NA6A 4A39A 3IO1A 2PIYA 2I3CA 2IJZA 2PJCA 3B3VA 2PJ0A 3ISXA 2O53A 1BAVA 1ZLIA 2BOAA 1YLOA 4KSIA 2Q43A 4OC5A 2RFHA 2EK8A 5K8OA 1ELMP 1CG2A 4NJQA 4A38A 1ARLA 2PCUA 3HLPA 1ZG8A 4A94A 1YSJA 4ZY1A 1F2OA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 5HVGA 3H8GA 4MHPA 1ZG7A 3S9LA 2ZOGA 3GLJA 4NGSA 3JRUA 1Z2LA 4OIWA 2AFSA 2ABZA 4X3RA 2NYQA 5HVFA 3TX8A 1Y0YA 2ZEDA 4FBEA 4WJBA 5IB9A 4ZX8A 3K9TA 4TWEA 3SJGA 4ZYQA 1YW6A 1LANA 1H8LA 1KWMA 2JEWA 3D4UA 3V38A 3KZWA 5K8MA 3KQZA 2PJ8A 3H8EA 3KGQA 1ELLP 4AXVA 4P45A 4P4BA 4JZ0A 5JGFA 3FEDA 4UEZA 2AFZA 4WWVA 2Q4ZA 3WC5A 1CBXA 3NFZA 4MHZA 4P44A 4EWTA 3S9NA 3V7ZA 1TKJA 2AFOA 2C6CA 3KR4A 4PXCA 5LRGA 1LFWA 3FMCA 2XEJA 4EFDA 1HDUA 1CP7A 1VHEA 3PFEA 1TKFA 3RBUA 4MCSA 4R7MA 5ELYA 4OP4A 4YWYA 2F7VA 3NH5A 1F2PA 2PJ6A 4TNUA 5D29A 4UF4A 2PE3A 3GUXA 5I4MA 2XEIA 3D7DA 2G9DA 2ZEEA 4A37A 4F9VA 2GLFA 3B3TA 4MRIA 3FJUA 2PJ1A 4P4EA 1XBUA 1BPMA 1M4LA 3HUVA 1Y0RA 3BI0A 3H8FA 5HVHA 3I1UA 4X8IA 1XMBA 3PBEA 4P4IA 4B6ZA 4IAVA 4CPAA 2WZNA 2AFXA 2GU2A 2AFWA 3SI0A 4IHMA 3LWUA 2ZELA 3PB6X 2ZEPA
chains in the Genus database with same CATH superfamily
1CX8A 4X2TA 2Z3PA 1IOFA 1TXRA 1F57A 3FNCA 3BHXA 1NSLA 2FT0A 1YGHA 3MRUA 1JJ2B 3A9LA 4XOPA 3MHPA 4M4SA 3NH4A 4R76A 2CNTA 2C5HA 3PBBA 4XPKA 1Z8WA 3QNVA 1IHMA 3G8WA 4P6YA 1T5EA 2GREA 2HQYA 3DR8A 1HEEA 2PR1A 4LBWA 1B6BA 4MCPA 4KKUA 2VBVA 1S60A 2EBJA 5D8NA 5DN6A 3FEEA 3C26A 4M3SA 4CGOA 3I56B 2J8NA 1GR1A 5JM6A 3PFOA 4G5GA 3UY5A 6CPAA 3B3WA 2HLDA 4HPSA 1OGIA 3D68A 4XNFA 4NFRA 2F1LA 2OBTA 4XNHC 1I21A 3S6GA 3FECA 1K8AD 3FIXA 1K28D 2EUIA 4YELA 4R87A 1IYLA 3ZZIA 3FX6A 1D1NA 1KD1D 5L46A 2QMLA 5FO0A 4ZI6A 4F6AA 2QECA 2C2WA 3CCQB 2ARHA 1TLLA 4NF1A 4UCMA 1V0EA 2I00A 2PRQA 5F49A 2YGWA 3S6KA 2Q7SA 2WJYA 3T9YA 5IYPA 4PC3A 2GFQA 1BO4A 1FX0A 5AGEA 4BMHA 2QGGA 4YU9A 4RM0A 4IW3B 5GCNA 4B10A 1KMHA 1GHEA 3EO4A 3PEIA 3CCSB 1Q7YD 2PJBA 3QFSA 3A3GA 4GS4A 4PXDA 5IK2A 4P6VF 5HZAA 3KKWA 3PGPA 5JH9A 4ZGNB 4RN7A 1OHHA 2GLJA 3RO0A 5FO1A 5KSWB 4H2KA 1QQ9A 4Z4SA 2REEA 4XOTA 2JJ2A 5A8AA 3CPAA 4P25A 3ZZ0A 1H8EA 2YNEA 3AVYA 1AIPA 4NEXA 5C88A 3IFEA 5G22A 2KVOA 4QVJA 1CP6A 1M1KD 1SM4A 3VMFA 1I1DA 4QVAA 1Y7EA 4OKOA 2C4TA 2RB7A 4LBVA 2OK7A 2V77A 2Z11A 2PJ9A 3QB8A 3ASRA 3W6SA 1YHQB 1S72B 2FSRA 3ZC3A 3JQPA 2JIZA 1XMTA 1FT7A 3B3SA 4A2ZA 2G0BA 3QSYA 4BPRA 3B78A 3D2MA 3OW7A 2V8GA 1MJ9A 3OOCA 2KCWA 3F8KA 4AVBA 2BF4A 2AE6A 3R9FA 4P3IA 3VARA 3KL9A 5TRDA 4P10A 4J0QA 4MXUA 4TT3A 1S4MA 2FVGA 4MFQA 2ZW5A 1JQGA 2Q4VA 1G7TA 2OYNA 4HE5A 2B5OA 1XQBA 5A88A 1CPXA 4X05A 2XEXA 1AUGA 3EC4A 1LAPA 3QAYA 4CAFA 2BPOA 2DEUA 5J1QA 2BV3A 1N71A 4CAVA 3CW2A 5EC4A 4UIBA 1QGYA 1B87A 1S0UA 1OB2A 2DF5A 4OC0A 4ZCMA 1I7PA 4R3KA 4MMOA 1BX1A 1N0VC 1Y7RA 1LAMA 4F7DA 4Q7AA 2AHOA 3W2IA 4GM5A 1BX0A 4RDJA 4UBRA 2OBSA 3W5UA 1A8PA 4QC6A 5E6TA 3GB0A 4NGNA 4TMWA 4F0YA 4YEJA 4B5PB 3T8WA 3BXMA 1N05A 1PKVA 2CNSA 1QUEA 1BJKA 4XD7A 5G1ZA 4TN1A 1N0UA 4ACAA 4LC0A 2RC5A 2O4HA 2JDCA 1I8DA 2AJ6A 3CT9A 7CPAA 4RDKA 1PJ6A 3AVXA 4XM3A 2ZEOA 2GPJA 3CC7B 3OPOA 1YK3A 1EFCA 4P26A 3IO1A 4U5YA 1VLYA 1W34A 1N8RD 2BVNA 3B3VA 1UD3A 1S7NA 5KTCA 2W6JA 2OZGA 3V8IA 3WNBA 1BAVA 4KSIA 1YLOA 2Q43A 2EK8A 4CYPA 1NMTA 1H42A 4C2YA 5E96A 4YAFA 4E0FA 4A38A 1ARLA 1W87A 2P6EA 3ES9A 3ZBUA 4ZY1A 1S7KA 3VWDA 1Q9SA 5C82A 1OB5A 2OOTA 4LQGA 3D7HA 5HVGA 3CMEB 4RD0A 2WPXA 4MHPA 1M4GA 1ZG7A 2V7TA 2ZOGA 1RQPA 3Q3AA 5AN9A 1WTHD 2AFSA 4Z4ZA 2C5BA 4MY3A 4X3RA 5HVFA 2ZEDA 1KJZA 4MFLA 4FBEA 1H8HA 3K9TA 5TY0A 1GJRA 5FIUA 2Y0MA 1YW6A 2JDDA 1XEBA 4MBUA 2Z3NA 1F20A 1BOBA 1K73D 2CBXA 5EMIA 1KK2A 1WU8A 1N06A 5H59A 3WXMA 3H8EA 3KGQA 4XMYA 2QA4B 2P6GA 4MFZA 3Q6QA 5JGFA 2A4NA 4N3NA 4LBYA 3AVUA 4WWVA 3QE2A 3U6BA 5IYNA 4KOUA 3EY5A 5H5JA 2J8MA 4CGNA 4DNRB 5LRGA 5H86A 3FMCA 3H5ZA 1TVCA 5A89A 2B7BA 2XEJA 4QBJA 1UD5A 5FL7A 1CP7A 3EFAA 3BY1A 3G71B 3OFNA 4MCSA 2ODFA 2PJ6A 3G3SA 5KNLA 3G4SB 4PABA 4UF4A 1EFRA 2XZOA 4H89A 1QFJA 3TFYA 4PV6A 3W91A 2ZEEA 4A37A 1NDHA 3PUNA 1KUYA 4CYOA 3FJUA 4P4EA 1EXMA 1E3ZA 3HUVA 2G3TA 4YXWA 4TKOB 3BI0A 4CAWA 4RD6A 2OK8A 1Z9UA 1VQ7B 4A31A 2AFXA 2C4UA 3FJOA 2AFWA 3P2FA 2QTLA 1WORA 3PB6X 4AVCA 3B82A 2ZEPA 4JJXA 4B43A 1BLLE 1F60A 3K2KA 1CPSA 2WZPP 3Q39A 3FKSA 1YVOA 3GIUA 4NGRA 4B11A 3R1KA 3ASPA 1Z8TA 4QVTA 2POKA 2V7WA 2O28A 2BUEA 3VO2A 3RNZA 4XLFA 2ZTGA 4UA3A 1IYKA 3CDXA 5J3OA 2ZXVA 1VQOB 4OAEA 5K8NA 1EWYA 3VWEA 4UWJA 2D74A 2OH1A 3TCVA 2DCUA 4Z4UA 2XNJA 1Z5RA 2ZITA 1JWQA 3DDYA 1OZPA 1ZM3A 1IJEA 2F4NA 3AVVA 5HH1A 2ZEHA 4L89A 4NCZA 4OC2A 1IB1E 4DJLA 2QVPA 1COWA 3PB8X 1G7CA 3GVKA 1ARMA 4F9UA 3N5FA 2B4BA 3PRTA 4KSAA 3WY9A 2G3AA 4P4JA 3WC7A 2PVVA 2ZBVA 1E1RA 1HDQA 4II2A 5J8FA 1DDIA 3A1PA 4WZTA 4FN5A 2XEGA 3KQXA 3ZUGA 2FE7A 2JBKA 2ZL7A 1N07A 4RLZA 2EVNA 1B2RA 1E43A 2ATRA 4NBSA 3WNDA 1JA0A 1ZM9A 2Q6OA 4C7IA 4KS9A 1WOSA 4XPLA 1IGBA 2Z3MA 4WQMA 1BPLA 5HXBA 2PJ3A 2HB6A 3SEJA 4CRYB 3OZUA 4PSXA 2ZZEA 1BPNA 1WK4A 5GV7A 2XZPA 3WT4A 5F47A 1QMUA 3SJPA 1KUXA 1XE4A 3CESA 4KVME 4JYWA 1WOOA 3WC6A 1VHOA 4ZGQB 3BI1A 3KHZA 2VI7A 5LYFA 4KZTA 2QTZA 3OJXA 3TOBA 4BD9A 4M2LA 4B12A 1Q7LA 2CTBA 3P2HA 2X53S 3LVBA 3D3SA 1TTTA 3TO9A 4CAEA 5IYWA 2Q4YA 4A30A 2DEAA 3B35A 2FIAA 1NRKA 3LMSA 3ZJ0A 3WABA 3E1YE 4O23A 1RO5A 3CCUB 2VL1A 3CMAB 1W0JA 2VJJA 4UEFA 1R5BA 1EFTA 2ZEGA 3I1FA 2PJ7A 1YLEA 2CXAA 4OIDA 1YJ9B 2RC6A 1WDTA 2V7UA 3CCRB 4MJ8A 3R96A 4UWIA 3CCLB 1KRHA 4P4DA 4EMEA 3B3CA 1EFUA 4C2XA 4B5OA 4KORA 1Y9WA 2F43A 4P12A 2DXQA 4XLCA 4B3FX 2X0KA 1B23P 3BQJA 1MK4A 1RTQA 4Q36A 4XQFA 3SI2A 1LRZA 4KOXA 4WZKA 2WSAA 1MABA 4PC2A 3KASA 4CGMA 5GV8A 1YIJB 2P3MA 5F09A 4QUSA 4B3GA 2X7BA 1FNOA 4MYUA 2B4DA 4X7EA 3CXPA 4G1VA 3KR5A 4H6UA 4OC4A 3TO7A 5KW9A 3P27A 2HC9A 2CY2A 2R1IA 5KTDA 2XZLA 3F0AA 1WP6A 2VNIA 3W2HA 4X07A 4XL9A 2BO9A 2J7KA 4L8AA 3CP2A 4R3LA 2XNCA 3WQZA 3MN8A 4Y9UA 1NSAA 2Q51A 4ZX9A 3IWGA 3PA2A 4FWUA 2OZHA 3L2NA 1S5KA 2HCJB 1YI2B 1M44A 4JMQA 3SI1A 3IJ3A 4R8FA 3AGPA 4RD3A 3CMMA 4JWPA 1P4NA 1EP1B 4C68A 2VZZA 1PYTB 3NE7A 2ZW7A 3OKXA 1TKHA 4G6IA 2PDOA 2Q6IA 4MFKA 4ONUA 4Z4WA 5KTAA 2QJ8A 2VBQA 2QDXA 4A39A 2IJZA 4K1XA 4PK3A 4PK2A 3TTHA 2PR8A 4C2ZA 2X3UA 3ISXA 2O53A 3VNVA 1ZLIA 4OC5A 2RFHA 4M6IA 2NV4A 2OTJB 2BM1A 4NJQA 1G7RA 4WZLA 4A94A 3GKRA 4F0XA 1VQNB 4RD4A 4YRHA 4OC3A 2X8KA 2HV2A 3HAGA 4UCNA 2BL1A 3GLJA 4YAUA 2ZL6A 1Z2LA 2Z3KA 1T6XA 1VQMB 4CS0B 1S7FA 2E1BA 2NYQA 1HZEA 4KVXA 2HDNB 4WJBA 3CRZA 3T56B 3B8GA 4TWEA 3SJGA 4QFMA 1MJAA 3RY8A 3D4UA 4M1KA 2D4PA 1J4JA 1XF8A 5DWMA 4A95A 4P45A 4JZ0A 4UFXA 3U2QA 1U2RA 3FYNA 4UEZA 3LNNA 2Q4ZA 4UAJA 4Z1MA 5JPHA 2DOGA 1CBXA 4EWTA 3V7ZA 3SLDA 3NE5B 1V0CA 3Q38A 1KTVA 3H94A 4U9YA 2YWFA 1VJSA 4U9ZA 4OLLA 4EFDA 1QG0A 1T6YA 4DQLA 1OB0A 4YGOA 1VHEA 5IX3A 3OJWA 4C0SA 4R7MA 4OP4A 5ELYA 2D3LA 3NH5A 4Q7JB 3JQQA 3SJZA 5D29A 4CRZB 2VQYA 3D7DA 2BGJA 1VF7A 2VNKA 4MRIA 2PJ1A 2FL4A 3MGDA 2Q04A 1M4LA 2GK7A 3I1UA 5IV0A 2F1MA 4X8IA 5LMZA 2YNDA 2VNJA 4P4IA 1I18A 2WZNA 4U9UA 3PA1A 5G21A 4AVZA 2DPTA 2R8VA 4IHMA 4XORA 1E79A 3BJ8A 3JU4A 3ASTA 3GY9A 3D8PA 1VQPB 5LRJA 1VKCA 2V8HA 1XIXA 4PSWA 3T53B 3OP1A 4MHYA 1Q82D 4QV2A 2DERA 4P2NA 3VNUA 2PIZA 4M0LA 3FPKA 1Z4EA 4HKFA 1FNDA 4Z4TA 2OU2A 3Q6RA 2ZXHA 1VQ4B 2R7HA 3ISZA 4KKTA 1DTDA 4E8OA 3CC2B 3KI9A 3JTKA 3D7GA 4FD5A 1PU9A 1KK0A 5B6IA 1YVKA 3W2GA 2RC4A 1W2BB 3CCJB 4RPBA 2HUZA 4RS2A 2PSWA 1UD2A 1DG1G 4C43A 1E64A 1QX4A 3FPPA 3CXQA 3V7AA 5LYDA 1T6ZA 2Z0ZA 4KLVA 4RD1A 4JXRA 4AC9A 2ZOFA 1ZUNB 4P4FA 3TC8A 3FF3A 3WBJA 1E1QA 4CYNA 1YW4A 3G05A 4UZEA 4PC6A 1KUVA 2OTLB 4NGMA 3D66A 3WNCA 1VIXA 2H5MA 1CNFA 4TMZA 1N08A 2NPFA 3AVWA 1XOVA 4OOXA 3S9MA 2CRVA 1DARA 1FNMA 1QFYA 3FVLA 4UIAA 1W9XA 2ZENA 1GAWA 1WSVA 3SLNA 1HA3A 4L8JA 2ZEMA 4MHDA 1Q2YA 3GQBA 3OZWA 5F46A 2PMDA 2VJIA 5LYIA 3IU1A 2R9VA 1VQ8B 1PCAA 2M5SA 4KOSA 3FB3A 4HE6A 4PC1A 2PVWA 2XEFA 3LACA 2V4DA 2PQ8A 5K8PA 2VBUA 1RXTA 3W2EA 5AG4A 4ROXA 2CK3A 5HXDA 4J3GA 3ZPNA 4AF7A 4M53A 5F4OA 3BLNA 3R9GA 4Z4YA 3P26A 4KUAA 3S6HA 4DNCA 1R5NA 2CIJA 1GYTA 4UEEA 4KOTA 3IEHA 5DWNA 3K9UA 3PUMA 3I55B 3PENA 1OGJA 2K5TA 4OC1A 4M6GA 2GIVA 4PXBA 2GJPA 2EK9A 4K3NA 1W35A 4XN3A 2V31A 1IICA 1P0HA 3SXOA 4II3A 1R3NA 2VBTA 1QSTA 2FS5A 2R98A 4NNJA 4OPOA 3W2FA 2ZL5A 1VHSA 4AG9A 3CD6B 1AMPA 4QUZA 2XGJA 2B4DB 1FNBA 3LQEA 2B58A 1UWYA 2OR4A 3B2YA 4DNTB 3H9NA 4XR6A 1IB0A 1IOIA 4ONWA 3CPXA 3T90A 2WR8A 3OAAA 4ACBA 4CQJA 2NMTA 2X6WA 4B13A 3D7FA 5BWAB 3LQ6A 3VATA 3KHXA 4IK2A 1M4DA 3DLJA 1LOKA 1QGAA 1VQ6B 4DYOA 3PB7X 2HMAA 2ZEFA 3ZIAA 2WJVA 2Q44A 5FVJA 3RAMA 2VZYA 3BCFA 4YHBA 4R6TA 3OWCA 4HNXB 2VNHA 1BQEA 4KOVA 2DIEA 4OOSA 4OMEA 1Y9KA 4CGPA 3G6EB 4Y9RA 3IU2A 4MCRA 1QGZA 4OADA 3CZXA 2PRBA 4MHNA 5DS0A 4RDLA 2Z6BD 4XPDC 4Z4VA 1NJID 2PJ2A 2BGIA 1KK3A 4X7FA 3ASQA 4TMVA 3IWEA 4PAAA 4ZY0A 2V8DA 3ZZUA 3MCAA 2I79A 2ZW4A 3LO8A 1YX0A 1MJBA 5CPAA 1WSRA 5CBMA 3CCEB 1Z8XA 3CC4B 5DSZA 1IU8A 2W6IA 2C1CA 4RI1A 3A8KA 1R5OA 2DYIA 1H85A 3PB9X 1VLOA 3RZAA 3DGVA 1E3XA 4CYQA 4IF5A 3DNSA 4BINA 3MMPA 4E0AA 3IWWA 4EH1A 5F4JA 3CCVB 4MFJA 1YQEA 4W9YA 1PJ7A 1ELOA 3CXSA 3NA6A 1SKQA 1NB0A 1QVFB 4GQNA 5AG7A 5IYRA 4RPDA 4MI4A 5FNZA 1SKYB 4CGLA 2C77A 3W5VA 2OBRA 3W5HA 4GXHA 5K8OA 4RCZA 3ONYA 5J8CA 3GSIA 4QHYA 1CG2A 3CXCB 2ZZGA 4CAXA 2CNDA 2YWGA 1GVHA 4OPVA 1CNEA 5THXA 4H6ZA 3LD2A 2PCUA 3HLPA 5TR9A 1F2OA 3OW2B 4UFWA 4XONA 1YJWB 4ORFA 1FRQA 5EMNA 1MRZA 4HNYB 2FCKA 4G7XA 3S9LA 2BM0A 4ZCIA 4NGSA 4XN0A 3JRUA 1QSMA 3TO6A 2EFGA 4OIWA 1VQLB 2V7XA 4NSQA 5A28A 1CJWA 3TX8A 1Y0YA 3QFCA 3A35A 4ZX8A 2IL4A 4ZYQA 3OZVA 4Z4RA 2E1RA 1NE9A 2R6HA 3R6KA 4H9GA 4NCNA 4ZBGA 2CW5A 2PC1A 1KZFA 3N7ZA 1VQ5B 3BH4A 3SHPA 4XPDB 3A8JA 3FEDA 3DDDA 2AFZA 4E2AA 5FA6A 2QN6A 3WC5A 1GO2A 3NFZA 4MFPA 3JQRA 4MHZA 4P44A 4Y7CA 1FDRA 3TOAA 1VQKB 1TKJA 2AFOA 1S7LA 3AVTA 2YWEA 1E63A 1WOPA 1P4MA 1HDUA 2QMUA 1KK1A 1BLIA 1TKFA 3RBUA 4YWYA 2F7VA 2C78A 4TNUA 3E20A 4KVOE 3CP8A 2PE3A 2ZZFA 2XEIA 5I4MA 4YAOA 2G9DA 2VBSA 4LQ6A 4F9VA 1X12A 3TT2A 4A33A 3R6JA 1XBUA 4PC7A 3W6XA 4B3XA 1Y0RA 5IYQA 1Q2DA 3H8FA 5HVHA 4B6ZA 2GJKA 1U6MA 4CPAA 2Q7BA 4PGOA 1Q86D 3D2PA 4P1VA 2GU2A 5J35A 1A2ZA 3SI0A 1Z4RA 2DETA 4RCYA 4R9MA 3LWUA 2EIXA 1VQ9B 4HNWB 4JLYA 2VZLA 5F4MA 2FIWA 2V8VA 8CPAA 2B5GB 3SXNA 1QSRA 4AB7A 2JDIA 3A8IA 2AFUA 4P9SA 1PJ5A 2C6PA 3IC1A 4KUBA 3TE4A 2EO8A 4M85A 1ZLHA 1R43A 2JBJA 1I12A 3SJXA 1XRYA 3SJEA 3KEWA 1XJOA 2F8HA 3F5BA 3D67A 1FRNA 4LBZA 3NE8A 4Z65A 3BJ7A 3R95A 3JUWA 4F8ZA 5HMNA 1QSNA 4X06A 2GE3A 3FRMA 1AMOA 5IB0A 3H4QA 2I1LA 1DE4C 4RD2A 2PJAA 2JJ1A 3NH8A 5BSYA 4JD6A 2PJ4A 5LRKA 1XFOA 4LUAA 2Q6KA 4XLEA 1YJNB 3ONUA 4I49A 1XE1A 4UFVA 2OB0A 4FUUA 4X5KA 5A27A 4FK8A 2D4OA 2B7CA 2JLMA 4FXUA 1UFHA 1QUFA 4B48A 1JA1A 4HIZA 3PB4X 1M1DA 1UMKA 2JN9A 3S6FA 4II9A 2WSSA 3PZJA 3ZZTA 1JB9A 4XKWA 4TMXA 4KKSA 5JBQA 1IIDA 2CC2A 4G1PA 3CCMB 4PPZA 1GAQA 3QFRA 2EWBA 2QEXB 1KQSB 2Q0YA 4AVAA 2CF4A 5F48A 1XB2A 3ASSA 1Q81D 4FD6A 4NGQA 5JQ4A 1W0KA 3WR7A 2Z3OA 4PQAA 2XNDA 1HVXA 3OEHA 2ZXIA 1CM0A 4AF6A 3PVDA 5HKKA 4A32A 3T51B 4OP7A 4Y49C 1WPCA 3FH4A 3B7IA 2NSMA 4KOWA 2GK6A 4XLAA 4UZUA 2YNCC 4OOVA 4M6HA 2Q6LA 1CQXA 1YITB 4NJRA 5G20A 3R9EA 4UZFA 4B5PA 4NGPA 1IY7A 2ANPA 1NB9A 2VYQA 1TF8A 4X7CA 2QE7A 1G7SA 2AFMA 4KLWA 4FAIA 3BC9A 2CTCA 3QAHA 2ZW6A 4DQKA 2ZPAA 1TUIA 3VH9A 4B44A 4BBHA 4X7DA 3SJFA 4YAWA 1QVGB 2GANA 1ZM2A 1M4IA 1M90D 2IMOA 4FD7A 2QYVA 4G7WA 1E62A 2OZUA 1S3ZA 4DK1A 4IUSA 2BCOA 4B47A 3QFTA 2QIRA 2D3NA 1KC8D 2IQ6A 5CNPA 2GJRA 1LCPA 3ZBTA 4R71A 4KSFA 3WBKA 2Z3LA 4WZEA 3BCDA 2J9AA 3CB4A 1QSOA 2BN4A 4JXQA 4X0CA 1TIQA 2Z10A 3VO1A 1BMFA 3VR6A 1AYEA 2C6GA 4UCPA 5ISVA 3IIBA 3EXNA 3I3GA 5AG6A 1OBRA 1QFZA 2VEZA 1ZG9A 2WYRA 3E0KA 5H84A 2FXFA 1UD6A 4LX9A 3WYAA 1V0FA 4NGTA 2PJ5A 5LYLA 2BEIA 1L0CA 4XNHB 2XOKA 1YREA 4DUKA 1DDGA 4ZCLA 1K4JA 1TF9A 3BY2A 4K30A 3A3BA 2ZZQA 5THWA 4RUHA 4P3YA 3RYOA 3DSBA 4MCQA 1EP3B 2ZTNA 3JVNA 3SKBA 1FNCA 3BNWA 3CTAA 4FWTA 1EE3P 2X6YA 5TV2A 4Y49B 2PIAA 2BSAA 4P22A 1V5VA 2YWHA 2BMWA 4ZY2A 4PXEA 1ON0A 3B8HA 3J81k 1YMEA 1VGYA 1K9MD 4FD4A 2CNMA 2LZJA 2PIYA 2I3CA 2V7VA 2PJCA 3OE7A 4ASUA 5AG5A 2PJ0A 4MY0A 4G1BA 2BOAA 1QH0A 3FBUA 3GVLA 4R57A 5CDFA 3GYAA 1ELMP 1UD4A 2C27A 3CPWB 3V76A 1UD8A 4Q38A 4DK0A 1ZG8A 1YSJA 4TMTA 1Z8LA 3FXTA 3H8GA 3D26A 2J8RA 3GVJA 2P6FA 1ZO0A 1RQRA 4XLHA 3LODA 2X85A 1YR0A 2DY1A 2B3UA 4EVYA 1J9ZA 4YFJA 5EBVA 2ABZA 1D8TA 2D9RA 2P0WA 1IJFA 2BSWA 2V7QA 5IB9A 3OEEA 5I0CA 2ZBUA 3DR6A 1LANA 4KOYA 1H8LA 1KWMA 2PLFA 3U6KA 2JEWA 3V38A 4RJLA 1KZLA 3KZWA 4B4DA 3KQZA 5K8MA 2FX3A 2PJ8A 2WPDA 1ELLP 5HZBA 4AXVA 4P4BA 3AGQA 2REFA 4N3GA 2X6XA 1JNYA 4OPSA 4TSFA 4ZGYB 1YX2A 3I9SA 3S9NA 4YALA 2C6CA 3KR4A 4PXCA 1LFWA 2YNCA 1SQHA 1NBMA 3GIRA 2WUUA 2B3VA 2F5IA 3PFEA 1FY7A 2B5GA 1WWZA 1X10A 1F2PA 2WPWA 3GUXA 3IGRA 4ZV4A 2JEVA 2GLFA 3B3TA 4XKVA 5BSXA 4B14A 1BPMA 2VXKA 1EP2B 1R57A 4QB9A 4MYTA 1XMBA 3PBEA 4IAVA 1D2EA 2DPSA 4NXYA 3PP9A 1PUAA 4C7HA 2GQFA 2ZELA 4AG7A 1Q2CA 1ZM4A
chains in the Genus database with same CATH topology
1CX8A 4X2TA 1TXRA 1F57A 3BHXA 2V8VA 8CPAA 1BLLE 3MRUA 3K2KA 5LRJA 3NH4A 4R76A 1CPSA 2V8HA 2AFUA 4MHYA 3PBBA 4NGRA 2PIZA 3QNVA 2C6PA 3IC1A 4P6YA 2POKA 1ZLHA 1R43A 2GREA 2JBJA 3SJXA 1HEEA 1XRYA 3SJEA 3CDXA 1XJOA 2F8HA 3ISZA 1DTDA 4MCPA 3D67A 3KI9A 5K8NA 3D7GA 4Z65A 5D8NA 3FEEA 4F8ZA 1Z5RA 5JM6A 2ZEHA 3PFOA 1DE4C 4OC2A 6CPAA 5LYDA 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 1ARMA 4F9UA 3NH8A 2ZOFA 3D68A 2PJ4A 3N5FA 4NFRA 4P4FA 3TC8A 5LRKA 3PRTA 3FF3A 4P4JA 3WC7A 2PVVA 1XFOA 1HDQA 3FECA 1YW4A 4FUUA 2XEGA 3KQXA 4NGMA 3D66A 2JBKA 1VIXA 3FX6A 4ZI6A 3PB4X 3S9MA 3FVLA 4UIAA 1IGBA 2PRQA 2ZENA 2PJ3A 4G1PA 2ZEMA 4PPZA 2HB6A 4YU9A 2EWBA 5LYIA 3PEIA 2PJBA 4PXDA 1PCAA 1BPNA 2CF4A 3WT4A 1QMUA 5JH9A 2PVWA 2XEFA 4NGQA 5K8PA 2GLJA 4JYWA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 5HXDA 4H2KA 1QQ9A 5LYFA 3FH4A 4BD9A 3B7IA 2NSMA 1Q7LA 2CTBA 3CPAA 2CIJA 1GYTA 4UEEA 3IEHA 4NJRA 3IFEA 2DEAA 3B35A 4NGPA 1IY7A 2ANPA 1CP6A 1TF8A 2AFMA 3LMSA 4FAIA 4OC1A 2CTCA 1Y7EA 4OKOA 4PXBA 3WABA 4O23A 2EK9A 4K3NA 2RB7A 2VL1A 2V77A 4UEFA 2PJ9A 2ZEGA 3VH9A 1R3NA 2PJ7A 3SJFA 4OIDA 1FT7A 2IMOA 3B3SA 1AMPA 2QYVA 2V8GA 4P4DA 4EMEA 1UWYA 2OR4A 3B2YA 2BCOA 3B3CA 4ONWA 3CPXA 2IQ6A 3VARA 3KL9A 4P10A 1LCPA 4MXUA 3D7FA 2FVGA 3VATA 3KHXA 1JQGA 2J9AA 4IK2A 1RTQA 3DLJA 1CPXA 1LOKA 3SI2A 4DYOA 3PB7X 2ZEFA 3KASA 3RAMA 1LAPA 1AYEA 2C6GA 4R6TA 5F09A 3IIBA 5J1QA 1FNOA 4OMEA 4UIBA 1OBRA 4MCRA 3KR5A 4OC4A 1ZG9A 2HC9A 2WYRA 4MHNA 4OC0A 5DS0A 4MMOA 2PJ2A 4NGTA 2PJ5A 5LYLA 1LAMA 2BO9A 4DUKA 4Q7AA 4ZY0A 2V8DA 4GM5A 1TF9A 5CPAA 5CBMA 3MN8A 5THWA 4RUHA 1NSAA 4MCQA 2Q51A 3GB0A 4ZX9A 4NGNA 2C1CA 4FWUA 3L2NA 3T8WA 3BXMA 1EE3P 3SI1A 3PB9X 3IJ3A 4R8FA 3RZAA 3DGVA 2O4HA 4ZY2A 1PYTB 3IWWA 3CT9A 4PXEA 7CPAA 1TKHA 1YMEA 2QJ8A 4W9YA 1VGYA 2ZEOA 3NA6A 4A39A 3IO1A 2PIYA 2I3CA 2IJZA 2PJCA 3B3VA 2PJ0A 3ISXA 2O53A 1BAVA 1ZLIA 2BOAA 1YLOA 4KSIA 2Q43A 4OC5A 2RFHA 2EK8A 5K8OA 1ELMP 1CG2A 4NJQA 4A38A 1ARLA 2PCUA 3HLPA 1ZG8A 4A94A 1YSJA 4ZY1A 1F2OA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 5HVGA 3H8GA 4MHPA 1ZG7A 3S9LA 2ZOGA 3GLJA 4NGSA 3JRUA 1Z2LA 4OIWA 2AFSA 2ABZA 4X3RA 2NYQA 5HVFA 3TX8A 1Y0YA 2ZEDA 4FBEA 4WJBA 5IB9A 4ZX8A 3K9TA 4TWEA 3SJGA 4ZYQA 1YW6A 1LANA 1H8LA 1KWMA 2JEWA 3D4UA 3V38A 3KZWA 5K8MA 3KQZA 2PJ8A 3H8EA 3KGQA 1ELLP 4AXVA 4P45A 4P4BA 4JZ0A 5JGFA 3FEDA 4UEZA 2AFZA 4WWVA 2Q4ZA 3WC5A 1CBXA 3NFZA 4MHZA 4P44A 4EWTA 3S9NA 3V7ZA 1TKJA 2AFOA 2C6CA 3KR4A 4PXCA 5LRGA 1LFWA 3FMCA 2XEJA 4EFDA 1HDUA 1CP7A 1VHEA 3PFEA 1TKFA 3RBUA 4MCSA 4R7MA 5ELYA 4OP4A 4YWYA 2F7VA 3NH5A 1F2PA 2PJ6A 4TNUA 5D29A 4UF4A 2PE3A 3GUXA 5I4MA 2XEIA 3D7DA 2G9DA 2ZEEA 4A37A 4F9VA 2GLFA 3B3TA 4MRIA 3FJUA 2PJ1A 4P4EA 1XBUA 1BPMA 1M4LA 3HUVA 1Y0RA 3BI0A 3H8FA 5HVHA 3I1UA 4X8IA 1XMBA 3PBEA 4P4IA 4B6ZA 4IAVA 4CPAA 2WZNA 2AFXA 2GU2A 2AFWA 3SI0A 4IHMA 3LWUA 2ZELA 3PB6X 2ZEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  4X2T A;  1TXR A;  1F57 A;  3BHX A;  2V8V A;  8CPA A;  1BLL E;  3MRU A;  3K2K A;  5LRJ A;  3NH4 A;  4R76 A;  1CPS A;  2V8H A;  2AFU A;  4MHY A;  3PBB A;  4NGR A;  2PIZ A;  3QNV A;  2C6P A;  3IC1 A;  4P6Y A;  2POK A;  1ZLH A;  1R43 A;  2GRE A;  2JBJ A;  3SJX A;  1HEE A;  1XRY A;  3SJE A;  3CDX A;  1XJO A;  2F8H A;  3ISZ A;  1DTD A;  4MCP A;  3D67 A;  3KI9 A;  5K8N A;  3D7G A;  4Z65 A;  5D8N A;  3FEE A;  4F8Z A;  1Z5R A;  5JM6 A;  2ZEH A;  3PFO A;  1DE4 C;  4OC2 A;  6CPA A;  5LYD A;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  1ARM A;  4F9U A;  3NH8 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  4NFR A;  4P4F A;  3TC8 A;  5LRK A;  3PRT A;  3FF3 A;  4P4J A;  3WC7 A;  2PVV A;  1XFO A;  1HDQ A;  3FEC A;  1YW4 A;  4FUU A;  2XEG A;  3KQX A;  4NGM A;  3D66 A;  2JBK A;  1VIX A;  3FX6 A;  4ZI6 A;  3PB4 X;  3S9M A;  3FVL A;  4UIA A;  1IGB A;  2PRQ A;  2ZEN A;  2PJ3 A;  4G1P A;  2ZEM A;  4PPZ A;  2HB6 A;  4YU9 A;  2EWB A;  5LYI A;  3PEI A;  2PJB A;  4PXD A;  1PCA A;  1BPN A;  2CF4 A;  3WT4 A;  1QMU A;  5JH9 A;  2PVW A;  2XEF A;  4NGQ A;  5K8P A;  2GLJ A;  4JYW A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  5HXD A;  4H2K A;  1QQ9 A;  5LYF A;  3FH4 A;  4BD9 A;  3B7I A;  2NSM A;  1Q7L A;  2CTB A;  3CPA A;  2CIJ A;  1GYT A;  4UEE A;  3IEH A;  4NJR A;  3IFE A;  2DEA A;  3B35 A;  4NGP A;  1IY7 A;  2ANP A;  1CP6 A;  1TF8 A;  2AFM A;  3LMS A;  4FAI A;  4OC1 A;  2CTC A;  1Y7E A;  4OKO A;  4PXB A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  2RB7 A;  2VL1 A;  2V77 A;  4UEF A;  2PJ9 A;  2ZEG A;  3VH9 A;  1R3N A;  2PJ7 A;  3SJF A;  4OID A;  1FT7 A;  2IMO A;  3B3S A;  1AMP A;  2QYV A;  2V8G A;  4P4D A;  4EME A;  1UWY A;  2OR4 A;  3B2Y A;  2BCO A;  3B3C A;  4ONW A;  3CPX A;  2IQ6 A;  3VAR A;  3KL9 A;  4P10 A;  1LCP A;  4MXU A;  3D7F A;  2FVG A;  3VAT A;  3KHX A;  1JQG A;  2J9A A;  4IK2 A;  1RTQ A;  3DLJ A;  1CPX A;  1LOK A;  3SI2 A;  4DYO A;  3PB7 X;  2ZEF A;  3KAS A;  3RAM A;  1LAP A;  1AYE A;  2C6G A;  4R6T A;  5F09 A;  3IIB A;  5J1Q A;  1FNO A;  4OME A;  4UIB A;  1OBR A;  4MCR A;  3KR5 A;  4OC4 A;  1ZG9 A;  2HC9 A;  2WYR A;  4MHN A;  4OC0 A;  5DS0 A;  4MMO A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  1LAM A;  2BO9 A;  4DUK A;  4Q7A A;  4ZY0 A;  2V8D A;  4GM5 A;  1TF9 A;  5CPA A;  5CBM A;  3MN8 A;  5THW A;  4RUH A;  1NSA A;  4MCQ A;  2Q51 A;  3GB0 A;  4ZX9 A;  4NGN A;  2C1C A;  4FWU A;  3L2N A;  3T8W A;  3BXM A;  1EE3 P;  3SI1 A;  3PB9 X;  3IJ3 A;  4R8F A;  3RZA A;  3DGV A;  2O4H A;  4ZY2 A;  1PYT B;  3IWW A;  3CT9 A;  4PXE A;  7CPA A;  1TKH A;  1YME A;  2QJ8 A;  4W9Y A;  1VGY A;  2ZEO A;  3NA6 A;  4A39 A;  3IO1 A;  2PIY A;  2I3C A;  2IJZ A;  2PJC A;  3B3V A;  2PJ0 A;  3ISX A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  1YLO A;  4KSI A;  2Q43 A;  4OC5 A;  2RFH A;  2EK8 A;  5K8O A;  1ELM P;  1CG2 A;  4NJQ A;  4A38 A;  1ARL A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  1YSJ A;  4ZY1 A;  1F2O A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  5HVG A;  3H8G A;  4MHP A;  1ZG7 A;  3S9L A;  2ZOG A;  3GLJ A;  4NGS A;  3JRU A;  1Z2L A;  4OIW A;  2AFS A;  2ABZ A;  4X3R A;  2NYQ A;  5HVF A;  3TX8 A;  1Y0Y A;  2ZED A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  3K9T A;  4TWE A;  3SJG A;  4ZYQ A;  1YW6 A;  1LAN A;  1H8L A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  3KZW A;  5K8M A;  3KQZ A;  2PJ8 A;  3H8E A;  3KGQ A;  1ELL P;  4AXV A;  4P45 A;  4P4B A;  4JZ0 A;  5JGF A;  3FED A;  4UEZ A;  2AFZ A;  4WWV A;  2Q4Z A;  3WC5 A;  1CBX A;  3NFZ A;  4MHZ A;  4P44 A;  4EWT A;  3S9N A;  3V7Z A;  1TKJ A;  2AFO A;  2C6C A;  3KR4 A;  4PXC A;  5LRG A;  1LFW A;  3FMC A;  2XEJ A;  4EFD A;  1HDU A;  1CP7 A;  1VHE A;  3PFE A;  1TKF A;  3RBU A;  4MCS A;  4R7M A;  5ELY A;  4OP4 A;  4YWY A;  2F7V A;  3NH5 A;  1F2P A;  2PJ6 A;  4TNU A;  5D29 A;  4UF4 A;  2PE3 A;  3GUX A;  5I4M A;  2XEI A;  3D7D A;  2G9D A;  2ZEE A;  4A37 A;  4F9V A;  2GLF A;  3B3T A;  4MRI A;  3FJU A;  2PJ1 A;  4P4E A;  1XBU A;  1BPM A;  1M4L A;  3HUV A;  1Y0R A;  3BI0 A;  3H8F A;  5HVH A;  3I1U A;  4X8I A;  1XMB A;  3PBE A;  4P4I A;  4B6Z A;  4IAV A;  4CPA A;  2WZN A;  2AFX A;  2GU2 A;  2AFW A;  3SI0 A;  4IHM A;  3LWU A;  2ZEL A;  3PB6 X;  2ZEP A; 
#chains in the Genus database with same CATH topology
 1CX8 A;  4X2T A;  2Z3P A;  1IOF A;  1TXR A;  1F57 A;  3FNC A;  3BHX A;  1NSL A;  2FT0 A;  1YGH A;  3MRU A;  1JJ2 B;  3A9L A;  4XOP A;  3MHP A;  4M4S A;  3NH4 A;  4R76 A;  2CNT A;  2C5H A;  3PBB A;  4XPK A;  1Z8W A;  3QNV A;  1IHM A;  3G8W A;  4P6Y A;  1T5E A;  2GRE A;  2HQY A;  3DR8 A;  1HEE A;  2PR1 A;  4LBW A;  1B6B A;  4MCP A;  4KKU A;  2VBV A;  1S60 A;  2EBJ A;  5D8N A;  5DN6 A;  3FEE A;  3C26 A;  4M3S A;  4CGO A;  3I56 B;  2J8N A;  1GR1 A;  5JM6 A;  3PFO A;  4G5G A;  3UY5 A;  6CPA A;  3B3W A;  2HLD A;  4HPS A;  1OGI A;  3D68 A;  4XNF A;  4NFR A;  2F1L A;  2OBT A;  4XNH C;  1I21 A;  3S6G A;  3FEC A;  1K8A D;  3FIX A;  1K28 D;  2EUI A;  4YEL A;  4R87 A;  1IYL A;  3ZZI A;  3FX6 A;  1D1N A;  1KD1 D;  5L46 A;  2QML A;  5FO0 A;  4ZI6 A;  4F6A A;  2QEC A;  2C2W A;  3CCQ B;  2ARH A;  1TLL A;  4NF1 A;  4UCM A;  1V0E A;  2I00 A;  2PRQ A;  5F49 A;  2YGW A;  3S6K A;  2Q7S A;  2WJY A;  3T9Y A;  5IYP A;  4PC3 A;  2GFQ A;  1BO4 A;  1FX0 A;  5AGE A;  4BMH A;  2QGG A;  4YU9 A;  4RM0 A;  4IW3 B;  5GCN A;  4B10 A;  1KMH A;  1GHE A;  3EO4 A;  3PEI A;  3CCS B;  1Q7Y D;  2PJB A;  3QFS A;  3A3G A;  4GS4 A;  4PXD A;  5IK2 A;  4P6V F;  5HZA A;  3KKW A;  3PGP A;  5JH9 A;  4ZGN B;  4RN7 A;  1OHH A;  2GLJ A;  3RO0 A;  5FO1 A;  5KSW B;  4H2K A;  1QQ9 A;  4Z4S A;  2REE A;  4XOT A;  2JJ2 A;  5A8A A;  3CPA A;  4P25 A;  3ZZ0 A;  1H8E A;  2YNE A;  3AVY A;  1AIP A;  4NEX A;  5C88 A;  3IFE A;  5G22 A;  2KVO A;  4QVJ A;  1CP6 A;  1M1K D;  1SM4 A;  3VMF A;  1I1D A;  4QVA A;  1Y7E A;  4OKO A;  2C4T A;  2RB7 A;  4LBV A;  2OK7 A;  2V77 A;  2Z11 A;  2PJ9 A;  3QB8 A;  3ASR A;  3W6S A;  1YHQ B;  1S72 B;  2FSR A;  3ZC3 A;  3JQP A;  2JIZ A;  1XMT A;  1FT7 A;  3B3S A;  4A2Z A;  2G0B A;  3QSY A;  4BPR A;  3B78 A;  3D2M A;  3OW7 A;  2V8G A;  1MJ9 A;  3OOC A;  2KCW A;  3F8K A;  4AVB A;  2BF4 A;  2AE6 A;  3R9F A;  4P3I A;  3VAR A;  3KL9 A;  5TRD A;  4P10 A;  4J0Q A;  4MXU A;  4TT3 A;  1S4M A;  2FVG A;  4MFQ A;  2ZW5 A;  1JQG A;  2Q4V A;  1G7T A;  2OYN A;  4HE5 A;  2B5O A;  1XQB A;  5A88 A;  1CPX A;  4X05 A;  2XEX A;  1AUG A;  3EC4 A;  1LAP A;  3QAY A;  4CAF A;  2BPO A;  2DEU A;  5J1Q A;  2BV3 A;  1N71 A;  4CAV A;  3CW2 A;  5EC4 A;  4UIB A;  1QGY A;  1B87 A;  1S0U A;  1OB2 A;  2DF5 A;  4OC0 A;  4ZCM A;  1I7P A;  4R3K A;  4MMO A;  1BX1 A;  1N0V C;  1Y7R A;  1LAM A;  4F7D A;  4Q7A A;  2AHO A;  3W2I A;  4GM5 A;  1BX0 A;  4RDJ A;  4UBR A;  2OBS A;  3W5U A;  1A8P A;  4QC6 A;  5E6T A;  3GB0 A;  4NGN A;  4TMW A;  4F0Y A;  4YEJ A;  4B5P B;  3T8W A;  3BXM A;  1N05 A;  1PKV A;  2CNS A;  1QUE A;  1BJK A;  4XD7 A;  5G1Z A;  4TN1 A;  1N0U A;  4ACA A;  4LC0 A;  2RC5 A;  2O4H A;  2JDC A;  1I8D A;  2AJ6 A;  3CT9 A;  7CPA A;  4RDK A;  1PJ6 A;  3AVX A;  4XM3 A;  2ZEO A;  2GPJ A;  3CC7 B;  3OPO A;  1YK3 A;  1EFC A;  4P26 A;  3IO1 A;  4U5Y A;  1VLY A;  1W34 A;  1N8R D;  2BVN A;  3B3V A;  1UD3 A;  1S7N A;  5KTC A;  2W6J A;  2OZG A;  3V8I A;  3WNB A;  1BAV A;  4KSI A;  1YLO A;  2Q43 A;  2EK8 A;  4CYP A;  1NMT A;  1H42 A;  4C2Y A;  5E96 A;  4YAF A;  4E0F A;  4A38 A;  1ARL A;  1W87 A;  2P6E A;  3ES9 A;  3ZBU A;  4ZY1 A;  1S7K A;  3VWD A;  1Q9S A;  5C82 A;  1OB5 A;  2OOT A;  4LQG A;  3D7H A;  5HVG A;  3CME B;  4RD0 A;  2WPX A;  4MHP A;  1M4G A;  1ZG7 A;  2V7T A;  2ZOG A;  1RQP A;  3Q3A A;  5AN9 A;  1WTH D;  2AFS A;  4Z4Z A;  2C5B A;  4MY3 A;  4X3R A;  5HVF A;  2ZED A;  1KJZ A;  4MFL A;  4FBE A;  1H8H A;  3K9T A;  5TY0 A;  1GJR A;  5FIU A;  2Y0M A;  1YW6 A;  2JDD A;  1XEB A;  4MBU A;  2Z3N A;  1F20 A;  1BOB A;  1K73 D;  2CBX A;  5EMI A;  1KK2 A;  1WU8 A;  1N06 A;  5H59 A;  3WXM A;  3H8E A;  3KGQ A;  4XMY A;  2QA4 B;  2P6G A;  4MFZ A;  3Q6Q A;  5JGF A;  2A4N A;  4N3N A;  4LBY A;  3AVU A;  4WWV A;  3QE2 A;  3U6B A;  5IYN A;  4KOU A;  3EY5 A;  5H5J A;  2J8M A;  4CGN A;  4DNR B;  5LRG A;  5H86 A;  3FMC A;  3H5Z A;  1TVC A;  5A89 A;  2B7B A;  2XEJ A;  4QBJ A;  1UD5 A;  5FL7 A;  1CP7 A;  3EFA A;  3BY1 A;  3G71 B;  3OFN A;  4MCS A;  2ODF A;  2PJ6 A;  3G3S A;  5KNL A;  3G4S B;  4PAB A;  4UF4 A;  1EFR A;  2XZO A;  4H89 A;  1QFJ A;  3TFY A;  4PV6 A;  3W91 A;  2ZEE A;  4A37 A;  1NDH A;  3PUN A;  1KUY A;  4CYO A;  3FJU A;  4P4E A;  1EXM A;  1E3Z A;  3HUV A;  2G3T A;  4YXW A;  4TKO B;  3BI0 A;  4CAW A;  4RD6 A;  2OK8 A;  1Z9U A;  1VQ7 B;  4A31 A;  2AFX A;  2C4U A;  3FJO A;  2AFW A;  3P2F A;  2QTL A;  1WOR A;  3PB6 X;  4AVC A;  3B82 A;  2ZEP A;  4JJX A;  4B43 A;  1BLL E;  1F60 A;  3K2K A;  1CPS A;  2WZP P;  3Q39 A;  3FKS A;  1YVO A;  3GIU A;  4NGR A;  4B11 A;  3R1K A;  3ASP A;  1Z8T A;  4QVT A;  2POK A;  2V7W A;  2O28 A;  2BUE A;  3VO2 A;  3RNZ A;  4XLF A;  2ZTG A;  4UA3 A;  1IYK A;  3CDX A;  5J3O A;  2ZXV A;  1VQO B;  4OAE A;  5K8N A;  1EWY A;  3VWE A;  4UWJ A;  2D74 A;  2OH1 A;  3TCV A;  2DCU A;  4Z4U A;  2XNJ A;  1Z5R A;  2ZIT A;  1JWQ A;  3DDY A;  1OZP A;  1ZM3 A;  1IJE A;  2F4N A;  3AVV A;  5HH1 A;  2ZEH A;  4L89 A;  4NCZ A;  4OC2 A;  1IB1 E;  4DJL A;  2QVP A;  1COW A;  3PB8 X;  1G7C A;  3GVK A;  1ARM A;  4F9U A;  3N5F A;  2B4B A;  3PRT A;  4KSA A;  3WY9 A;  2G3A A;  4P4J A;  3WC7 A;  2PVV A;  2ZBV A;  1E1R A;  1HDQ A;  4II2 A;  5J8F A;  1DDI A;  3A1P A;  4WZT A;  4FN5 A;  2XEG A;  3KQX A;  3ZUG A;  2FE7 A;  2JBK A;  2ZL7 A;  1N07 A;  4RLZ A;  2EVN A;  1B2R A;  1E43 A;  2ATR A;  4NBS A;  3WND A;  1JA0 A;  1ZM9 A;  2Q6O A;  4C7I A;  4KS9 A;  1WOS A;  4XPL A;  1IGB A;  2Z3M A;  4WQM A;  1BPL A;  5HXB A;  2PJ3 A;  2HB6 A;  3SEJ A;  4CRY B;  3OZU A;  4PSX A;  2ZZE A;  1BPN A;  1WK4 A;  5GV7 A;  2XZP A;  3WT4 A;  5F47 A;  1QMU A;  3SJP A;  1KUX A;  1XE4 A;  3CES A;  4KVM E;  4JYW A;  1WOO A;  3WC6 A;  1VHO A;  4ZGQ B;  3BI1 A;  3KHZ A;  2VI7 A;  5LYF A;  4KZT A;  2QTZ A;  3OJX A;  3TOB A;  4BD9 A;  4M2L A;  4B12 A;  1Q7L A;  2CTB A;  3P2H A;  2X53 S;  3LVB A;  3D3S A;  1TTT A;  3TO9 A;  4CAE A;  5IYW A;  2Q4Y A;  4A30 A;  2DEA A;  3B35 A;  2FIA A;  1NRK A;  3LMS A;  3ZJ0 A;  3WAB A;  3E1Y E;  4O23 A;  1RO5 A;  3CCU B;  2VL1 A;  3CMA B;  1W0J A;  2VJJ A;  4UEF A;  1R5B A;  1EFT A;  2ZEG A;  3I1F A;  2PJ7 A;  1YLE A;  2CXA A;  4OID A;  1YJ9 B;  2RC6 A;  1WDT A;  2V7U A;  3CCR B;  4MJ8 A;  3R96 A;  4UWI A;  3CCL B;  1KRH A;  4P4D A;  4EME A;  3B3C A;  1EFU A;  4C2X A;  4B5O A;  4KOR A;  1Y9W A;  2F43 A;  4P12 A;  2DXQ A;  4XLC A;  4B3F X;  2X0K A;  1B23 P;  3BQJ A;  1MK4 A;  1RTQ A;  4Q36 A;  4XQF A;  3SI2 A;  1LRZ A;  4KOX A;  4WZK A;  2WSA A;  1MAB A;  4PC2 A;  3KAS A;  4CGM A;  5GV8 A;  1YIJ B;  2P3M A;  5F09 A;  4QUS A;  4B3G A;  2X7B A;  1FNO A;  4MYU A;  2B4D A;  4X7E A;  3CXP A;  4G1V A;  3KR5 A;  4H6U A;  4OC4 A;  3TO7 A;  5KW9 A;  3P27 A;  2HC9 A;  2CY2 A;  2R1I A;  5KTD A;  2XZL A;  3F0A A;  1WP6 A;  2VNI A;  3W2H A;  4X07 A;  4XL9 A;  2BO9 A;  2J7K A;  4L8A A;  3CP2 A;  4R3L A;  2XNC A;  3WQZ A;  3MN8 A;  4Y9U A;  1NSA A;  2Q51 A;  4ZX9 A;  3IWG A;  3PA2 A;  4FWU A;  2OZH A;  3L2N A;  1S5K A;  2HCJ B;  1YI2 B;  1M44 A;  4JMQ A;  3SI1 A;  3IJ3 A;  4R8F A;  3AGP A;  4RD3 A;  3CMM A;  4JWP A;  1P4N A;  1EP1 B;  4C68 A;  2VZZ A;  1PYT B;  3NE7 A;  2ZW7 A;  3OKX A;  1TKH A;  4G6I A;  2PDO A;  2Q6I A;  4MFK A;  4ONU A;  4Z4W A;  5KTA A;  2QJ8 A;  2VBQ A;  2QDX A;  4A39 A;  2IJZ A;  4K1X A;  4PK3 A;  4PK2 A;  3TTH A;  2PR8 A;  4C2Z A;  2X3U A;  3ISX A;  2O53 A;  3VNV A;  1ZLI A;  4OC5 A;  2RFH A;  4M6I A;  2NV4 A;  2OTJ B;  2BM1 A;  4NJQ A;  1G7R A;  4WZL A;  4A94 A;  3GKR A;  4F0X A;  1VQN B;  4RD4 A;  4YRH A;  4OC3 A;  2X8K A;  2HV2 A;  3HAG A;  4UCN A;  2BL1 A;  3GLJ A;  4YAU A;  2ZL6 A;  1Z2L A;  2Z3K A;  1T6X A;  1VQM B;  4CS0 B;  1S7F A;  2E1B A;  2NYQ A;  1HZE A;  4KVX A;  2HDN B;  4WJB A;  3CRZ A;  3T56 B;  3B8G A;  4TWE A;  3SJG A;  4QFM A;  1MJA A;  3RY8 A;  3D4U A;  4M1K A;  2D4P A;  1J4J A;  1XF8 A;  5DWM A;  4A95 A;  4P45 A;  4JZ0 A;  4UFX A;  3U2Q A;  1U2R A;  3FYN A;  4UEZ A;  3LNN A;  2Q4Z A;  4UAJ A;  4Z1M A;  5JPH A;  2DOG A;  1CBX A;  4EWT A;  3V7Z A;  3SLD A;  3NE5 B;  1V0C A;  3Q38 A;  1KTV A;  3H94 A;  4U9Y A;  2YWF A;  1VJS A;  4U9Z A;  4OLL A;  4EFD A;  1QG0 A;  1T6Y A;  4DQL A;  1OB0 A;  4YGO A;  1VHE A;  5IX3 A;  3OJW A;  4C0S A;  4R7M A;  4OP4 A;  5ELY A;  2D3L A;  3NH5 A;  4Q7J B;  3JQQ A;  3SJZ A;  5D29 A;  4CRZ B;  2VQY A;  3D7D A;  2BGJ A;  1VF7 A;  2VNK A;  4MRI A;  2PJ1 A;  2FL4 A;  3MGD A;  2Q04 A;  1M4L A;  2GK7 A;  3I1U A;  5IV0 A;  2F1M A;  4X8I A;  5LMZ A;  2YND A;  2VNJ A;  4P4I A;  1I18 A;  2WZN A;  4U9U A;  3PA1 A;  5G21 A;  4AVZ A;  2DPT A;  2R8V A;  4IHM A;  4XOR A;  1E79 A;  3BJ8 A;  3JU4 A;  3AST A;  3GY9 A;  3D8P A;  1VQP B;  5LRJ A;  1VKC A;  2V8H A;  1XIX A;  4PSW A;  3T53 B;  3OP1 A;  4MHY A;  1Q82 D;  4QV2 A;  2DER A;  4P2N A;  3VNU A;  2PIZ A;  4M0L A;  3FPK A;  1Z4E A;  4HKF A;  1FND A;  4Z4T A;  2OU2 A;  3Q6R A;  2ZXH A;  1VQ4 B;  2R7H A;  3ISZ A;  4KKT A;  1DTD A;  4E8O A;  3CC2 B;  3KI9 A;  3JTK A;  3D7G A;  4FD5 A;  1PU9 A;  1KK0 A;  5B6I A;  1YVK A;  3W2G A;  2RC4 A;  1W2B B;  3CCJ B;  4RPB A;  2HUZ A;  4RS2 A;  2PSW A;  1UD2 A;  1DG1 G;  4C43 A;  1E64 A;  1QX4 A;  3FPP A;  3CXQ A;  3V7A A;  5LYD A;  1T6Z A;  2Z0Z A;  4KLV A;  4RD1 A;  4JXR A;  4AC9 A;  2ZOF A;  1ZUN B;  4P4F A;  3TC8 A;  3FF3 A;  3WBJ A;  1E1Q A;  4CYN A;  1YW4 A;  3G05 A;  4UZE A;  4PC6 A;  1KUV A;  2OTL B;  4NGM A;  3D66 A;  3WNC A;  1VIX A;  2H5M A;  1CNF A;  4TMZ A;  1N08 A;  2NPF A;  3AVW A;  1XOV A;  4OOX A;  3S9M A;  2CRV A;  1DAR A;  1FNM A;  1QFY A;  3FVL A;  4UIA A;  1W9X A;  2ZEN A;  1GAW A;  1WSV A;  3SLN A;  1HA3 A;  4L8J A;  2ZEM A;  4MHD A;  1Q2Y A;  3GQB A;  3OZW A;  5F46 A;  2PMD A;  2VJI A;  5LYI A;  3IU1 A;  2R9V A;  1VQ8 B;  1PCA A;  2M5S A;  4KOS A;  3FB3 A;  4HE6 A;  4PC1 A;  2PVW A;  2XEF A;  3LAC A;  2V4D A;  2PQ8 A;  5K8P A;  2VBU A;  1RXT A;  3W2E A;  5AG4 A;  4ROX A;  2CK3 A;  5HXD A;  4J3G A;  3ZPN A;  4AF7 A;  4M53 A;  5F4O A;  3BLN A;  3R9G A;  4Z4Y A;  3P26 A;  4KUA A;  3S6H A;  4DNC A;  1R5N A;  2CIJ A;  1GYT A;  4UEE A;  4KOT A;  3IEH A;  5DWN A;  3K9U A;  3PUM A;  3I55 B;  3PEN A;  1OGJ A;  2K5T A;  4OC1 A;  4M6G A;  2GIV A;  4PXB A;  2GJP A;  2EK9 A;  4K3N A;  1W35 A;  4XN3 A;  2V31 A;  1IIC A;  1P0H A;  3SXO A;  4II3 A;  1R3N A;  2VBT A;  1QST A;  2FS5 A;  2R98 A;  4NNJ A;  4OPO A;  3W2F A;  2ZL5 A;  1VHS A;  4AG9 A;  3CD6 B;  1AMP A;  4QUZ A;  2XGJ A;  2B4D B;  1FNB A;  3LQE A;  2B58 A;  1UWY A;  2OR4 A;  3B2Y A;  4DNT B;  3H9N A;  4XR6 A;  1IB0 A;  1IOI A;  4ONW A;  3CPX A;  3T90 A;  2WR8 A;  3OAA A;  4ACB A;  4CQJ A;  2NMT A;  2X6W A;  4B13 A;  3D7F A;  5BWA B;  3LQ6 A;  3VAT A;  3KHX A;  4IK2 A;  1M4D A;  3DLJ A;  1LOK A;  1QGA A;  1VQ6 B;  4DYO A;  3PB7 X;  2HMA A;  2ZEF A;  3ZIA A;  2WJV A;  2Q44 A;  5FVJ A;  3RAM A;  2VZY A;  3BCF A;  4YHB A;  4R6T A;  3OWC A;  4HNX B;  2VNH A;  1BQE A;  4KOV A;  2DIE A;  4OOS A;  4OME A;  1Y9K A;  4CGP A;  3G6E B;  4Y9R A;  3IU2 A;  4MCR A;  1QGZ A;  4OAD A;  3CZX A;  2PRB A;  4MHN A;  5DS0 A;  4RDL A;  2Z6B D;  4XPD C;  4Z4V A;  1NJI D;  2PJ2 A;  2BGI A;  1KK3 A;  4X7F A;  3ASQ A;  4TMV A;  3IWE A;  4PAA A;  4ZY0 A;  2V8D A;  3ZZU A;  3MCA A;  2I79 A;  2ZW4 A;  3LO8 A;  1YX0 A;  1MJB A;  5CPA A;  1WSR A;  5CBM A;  3CCE B;  1Z8X A;  3CC4 B;  5DSZ A;  1IU8 A;  2W6I A;  2C1C A;  4RI1 A;  3A8K A;  1R5O A;  2DYI A;  1H85 A;  3PB9 X;  1VLO A;  3RZA A;  3DGV A;  1E3X A;  4CYQ A;  4IF5 A;  3DNS A;  4BIN A;  3MMP A;  4E0A A;  3IWW A;  4EH1 A;  5F4J A;  3CCV B;  4MFJ A;  1YQE A;  4W9Y A;  1PJ7 A;  1ELO A;  3CXS A;  3NA6 A;  1SKQ A;  1NB0 A;  1QVF B;  4GQN A;  5AG7 A;  5IYR A;  4RPD A;  4MI4 A;  5FNZ A;  1SKY B;  4CGL A;  2C77 A;  3W5V A;  2OBR A;  3W5H A;  4GXH A;  5K8O A;  4RCZ A;  3ONY A;  5J8C A;  3GSI A;  4QHY A;  1CG2 A;  3CXC B;  2ZZG A;  4CAX A;  2CND A;  2YWG A;  1GVH A;  4OPV A;  1CNE A;  5THX A;  4H6Z A;  3LD2 A;  2PCU A;  3HLP A;  5TR9 A;  1F2O A;  3OW2 B;  4UFW A;  4XON A;  1YJW B;  4ORF A;  1FRQ A;  5EMN A;  1MRZ A;  4HNY B;  2FCK A;  4G7X A;  3S9L A;  2BM0 A;  4ZCI A;  4NGS A;  4XN0 A;  3JRU A;  1QSM A;  3TO6 A;  2EFG A;  4OIW A;  1VQL B;  2V7X A;  4NSQ A;  5A28 A;  1CJW A;  3TX8 A;  1Y0Y A;  3QFC A;  3A35 A;  4ZX8 A;  2IL4 A;  4ZYQ A;  3OZV A;  4Z4R A;  2E1R A;  1NE9 A;  2R6H A;  3R6K A;  4H9G A;  4NCN A;  4ZBG A;  2CW5 A;  2PC1 A;  1KZF A;  3N7Z A;  1VQ5 B;  3BH4 A;  3SHP A;  4XPD B;  3A8J A;  3FED A;  3DDD A;  2AFZ A;  4E2A A;  5FA6 A;  2QN6 A;  3WC5 A;  1GO2 A;  3NFZ A;  4MFP A;  3JQR A;  4MHZ A;  4P44 A;  4Y7C A;  1FDR A;  3TOA A;  1VQK B;  1TKJ A;  2AFO A;  1S7L A;  3AVT A;  2YWE A;  1E63 A;  1WOP A;  1P4M A;  1HDU A;  2QMU A;  1KK1 A;  1BLI A;  1TKF A;  3RBU A;  4YWY A;  2F7V A;  2C78 A;  4TNU A;  3E20 A;  4KVO E;  3CP8 A;  2PE3 A;  2ZZF A;  2XEI A;  5I4M A;  4YAO A;  2G9D A;  2VBS A;  4LQ6 A;  4F9V A;  1X12 A;  3TT2 A;  4A33 A;  3R6J A;  1XBU A;  4PC7 A;  3W6X A;  4B3X A;  1Y0R A;  5IYQ A;  1Q2D A;  3H8F A;  5HVH A;  4B6Z A;  2GJK A;  1U6M A;  4CPA A;  2Q7B A;  4PGO A;  1Q86 D;  3D2P A;  4P1V A;  2GU2 A;  5J35 A;  1A2Z A;  3SI0 A;  1Z4R A;  2DET A;  4RCY A;  4R9M A;  3LWU A;  2EIX A;  1VQ9 B;  4HNW B;  4JLY A;  2VZL A;  5F4M A;  2FIW A;  2V8V A;  8CPA A;  2B5G B;  3SXN A;  1QSR A;  4AB7 A;  2JDI A;  3A8I A;  2AFU A;  4P9S A;  1PJ5 A;  2C6P A;  3IC1 A;  4KUB A;  3TE4 A;  2EO8 A;  4M85 A;  1ZLH A;  1R43 A;  2JBJ A;  1I12 A;  3SJX A;  1XRY A;  3SJE A;  3KEW A;  1XJO A;  2F8H A;  3F5B A;  3D67 A;  1FRN A;  4LBZ A;  3NE8 A;  4Z65 A;  3BJ7 A;  3R95 A;  3JUW A;  4F8Z A;  5HMN A;  1QSN A;  4X06 A;  2GE3 A;  3FRM A;  1AMO A;  5IB0 A;  3H4Q A;  2I1L A;  1DE4 C;  4RD2 A;  2PJA A;  2JJ1 A;  3NH8 A;  5BSY A;  4JD6 A;  2PJ4 A;  5LRK A;  1XFO A;  4LUA A;  2Q6K A;  4XLE A;  1YJN B;  3ONU A;  4I49 A;  1XE1 A;  4UFV A;  2OB0 A;  4FUU A;  4X5K A;  5A27 A;  4FK8 A;  2D4O A;  2B7C A;  2JLM A;  4FXU A;  1UFH A;  1QUF A;  4B48 A;  1JA1 A;  4HIZ A;  3PB4 X;  1M1D A;  1UMK A;  2JN9 A;  3S6F A;  4II9 A;  2WSS A;  3PZJ A;  3ZZT A;  1JB9 A;  4XKW A;  4TMX A;  4KKS A;  5JBQ A;  1IID A;  2CC2 A;  4G1P A;  3CCM B;  4PPZ A;  1GAQ A;  3QFR A;  2EWB A;  2QEX B;  1KQS B;  2Q0Y A;  4AVA A;  2CF4 A;  5F48 A;  1XB2 A;  3ASS A;  1Q81 D;  4FD6 A;  4NGQ A;  5JQ4 A;  1W0K A;  3WR7 A;  2Z3O A;  4PQA A;  2XND A;  1HVX A;  3OEH A;  2ZXI A;  1CM0 A;  4AF6 A;  3PVD A;  5HKK A;  4A32 A;  3T51 B;  4OP7 A;  4Y49 C;  1WPC A;  3FH4 A;  3B7I A;  2NSM A;  4KOW A;  2GK6 A;  4XLA A;  4UZU A;  2YNC C;  4OOV A;  4M6H A;  2Q6L A;  1CQX A;  1YIT B;  4NJR A;  5G20 A;  3R9E A;  4UZF A;  4B5P A;  4NGP A;  1IY7 A;  2ANP A;  1NB9 A;  2VYQ A;  1TF8 A;  4X7C A;  2QE7 A;  1G7S A;  2AFM A;  4KLW A;  4FAI A;  3BC9 A;  2CTC A;  3QAH A;  2ZW6 A;  4DQK A;  2ZPA A;  1TUI A;  3VH9 A;  4B44 A;  4BBH A;  4X7D A;  3SJF A;  4YAW A;  1QVG B;  2GAN A;  1ZM2 A;  1M4I A;  1M90 D;  2IMO A;  4FD7 A;  2QYV A;  4G7W A;  1E62 A;  2OZU A;  1S3Z A;  4DK1 A;  4IUS A;  2BCO A;  4B47 A;  3QFT A;  2QIR A;  2D3N A;  1KC8 D;  2IQ6 A;  5CNP A;  2GJR A;  1LCP A;  3ZBT A;  4R71 A;  4KSF A;  3WBK A;  2Z3L A;  4WZE A;  3BCD A;  2J9A A;  3CB4 A;  1QSO A;  2BN4 A;  4JXQ A;  4X0C A;  1TIQ A;  2Z10 A;  3VO1 A;  1BMF A;  3VR6 A;  1AYE A;  2C6G A;  4UCP A;  5ISV A;  3IIB A;  3EXN A;  3I3G A;  5AG6 A;  1OBR A;  1QFZ A;  2VEZ A;  1ZG9 A;  2WYR A;  3E0K A;  5H84 A;  2FXF A;  1UD6 A;  4LX9 A;  3WYA A;  1V0F A;  4NGT A;  2PJ5 A;  5LYL A;  2BEI A;  1L0C A;  4XNH B;  2XOK A;  1YRE A;  4DUK A;  1DDG A;  4ZCL A;  1K4J A;  1TF9 A;  3BY2 A;  4K30 A;  3A3B A;  2ZZQ A;  5THW A;  4RUH A;  4P3Y A;  3RYO A;  3DSB A;  4MCQ A;  1EP3 B;  2ZTN A;  3JVN A;  3SKB A;  1FNC A;  3BNW A;  3CTA A;  4FWT A;  1EE3 P;  2X6Y A;  5TV2 A;  4Y49 B;  2PIA A;  2BSA A;  4P22 A;  1V5V A;  2YWH A;  2BMW A;  4ZY2 A;  4PXE A;  1ON0 A;  3B8H A;  3J81 k;  1YME A;  1VGY A;  1K9M D;  4FD4 A;  2CNM A;  2LZJ A;  2PIY A;  2I3C A;  2V7V A;  2PJC A;  3OE7 A;  4ASU A;  5AG5 A;  2PJ0 A;  4MY0 A;  4G1B A;  2BOA A;  1QH0 A;  3FBU A;  3GVL A;  4R57 A;  5CDF A;  3GYA A;  1ELM P;  1UD4 A;  2C27 A;  3CPW B;  3V76 A;  1UD8 A;  4Q38 A;  4DK0 A;  1ZG8 A;  1YSJ A;  4TMT A;  1Z8L A;  3FXT A;  3H8G A;  3D26 A;  2J8R A;  3GVJ A;  2P6F A;  1ZO0 A;  1RQR A;  4XLH A;  3LOD A;  2X85 A;  1YR0 A;  2DY1 A;  2B3U A;  4EVY A;  1J9Z A;  4YFJ A;  5EBV A;  2ABZ A;  1D8T A;  2D9R A;  2P0W A;  1IJF A;  2BSW A;  2V7Q A;  5IB9 A;  3OEE A;  5I0C A;  2ZBU A;  3DR6 A;  1LAN A;  4KOY A;  1H8L A;  1KWM A;  2PLF A;  3U6K A;  2JEW A;  3V38 A;  4RJL A;  1KZL A;  3KZW A;  4B4D A;  3KQZ A;  5K8M A;  2FX3 A;  2PJ8 A;  2WPD A;  1ELL P;  5HZB A;  4AXV A;  4P4B A;  3AGQ A;  2REF A;  4N3G A;  2X6X A;  1JNY A;  4OPS A;  4TSF A;  4ZGY B;  1YX2 A;  3I9S A;  3S9N A;  4YAL A;  2C6C A;  3KR4 A;  4PXC A;  1LFW A;  2YNC A;  1SQH A;  1NBM A;  3GIR A;  2WUU A;  2B3V A;  2F5I A;  3PFE A;  1FY7 A;  2B5G A;  1WWZ A;  1X10 A;  1F2P A;  2WPW A;  3GUX A;  3IGR A;  4ZV4 A;  2JEV A;  2GLF A;  3B3T A;  4XKV A;  5BSX A;  4B14 A;  1BPM A;  2VXK A;  1EP2 B;  1R57 A;  4QB9 A;  4MYT A;  1XMB A;  3PBE A;  4IAV A;  1D2E A;  2DPS A;  4NXY A;  3PP9 A;  1PUA A;  4C7H A;  2GQF A;  2ZEL A;  4AG7 A;  1Q2C A;  1ZM4 A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  4X2T A;  1TXR A;  1F57 A;  3BHX A;  2V8V A;  8CPA A;  1BLL E;  3MRU A;  3K2K A;  5LRJ A;  3NH4 A;  4R76 A;  1CPS A;  2V8H A;  2AFU A;  4MHY A;  3PBB A;  4NGR A;  2PIZ A;  3QNV A;  2C6P A;  3IC1 A;  4P6Y A;  2POK A;  1ZLH A;  1R43 A;  2GRE A;  2JBJ A;  3SJX A;  1HEE A;  1XRY A;  3SJE A;  3CDX A;  1XJO A;  2F8H A;  3ISZ A;  1DTD A;  4MCP A;  3D67 A;  3KI9 A;  5K8N A;  3D7G A;  4Z65 A;  5D8N A;  3FEE A;  4F8Z A;  1Z5R A;  5JM6 A;  2ZEH A;  3PFO A;  1DE4 C;  4OC2 A;  6CPA A;  5LYD A;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  1ARM A;  4F9U A;  3NH8 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  4NFR A;  4P4F A;  3TC8 A;  5LRK A;  3PRT A;  3FF3 A;  4P4J A;  3WC7 A;  2PVV A;  1XFO A;  1HDQ A;  3FEC A;  1YW4 A;  4FUU A;  2XEG A;  3KQX A;  4NGM A;  3D66 A;  2JBK A;  1VIX A;  3FX6 A;  4ZI6 A;  3PB4 X;  3S9M A;  3FVL A;  4UIA A;  1IGB A;  2PRQ A;  2ZEN A;  2PJ3 A;  4G1P A;  2ZEM A;  4PPZ A;  2HB6 A;  4YU9 A;  2EWB A;  5LYI A;  3PEI A;  2PJB A;  4PXD A;  1PCA A;  1BPN A;  2CF4 A;  3WT4 A;  1QMU A;  5JH9 A;  2PVW A;  2XEF A;  4NGQ A;  5K8P A;  2GLJ A;  4JYW A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  5HXD A;  4H2K A;  1QQ9 A;  5LYF A;  3FH4 A;  4BD9 A;  3B7I A;  2NSM A;  1Q7L A;  2CTB A;  3CPA A;  2CIJ A;  1GYT A;  4UEE A;  3IEH A;  4NJR A;  3IFE A;  2DEA A;  3B35 A;  4NGP A;  1IY7 A;  2ANP A;  1CP6 A;  1TF8 A;  2AFM A;  3LMS A;  4FAI A;  4OC1 A;  2CTC A;  1Y7E A;  4OKO A;  4PXB A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  2RB7 A;  2VL1 A;  2V77 A;  4UEF A;  2PJ9 A;  2ZEG A;  3VH9 A;  1R3N A;  2PJ7 A;  3SJF A;  4OID A;  1FT7 A;  2IMO A;  3B3S A;  1AMP A;  2QYV A;  2V8G A;  4P4D A;  4EME A;  1UWY A;  2OR4 A;  3B2Y A;  2BCO A;  3B3C A;  4ONW A;  3CPX A;  2IQ6 A;  3VAR A;  3KL9 A;  4P10 A;  1LCP A;  4MXU A;  3D7F A;  2FVG A;  3VAT A;  3KHX A;  1JQG A;  2J9A A;  4IK2 A;  1RTQ A;  3DLJ A;  1CPX A;  1LOK A;  3SI2 A;  4DYO A;  3PB7 X;  2ZEF A;  3KAS A;  3RAM A;  1LAP A;  1AYE A;  2C6G A;  4R6T A;  5F09 A;  3IIB A;  5J1Q A;  1FNO A;  4OME A;  4UIB A;  1OBR A;  4MCR A;  3KR5 A;  4OC4 A;  1ZG9 A;  2HC9 A;  2WYR A;  4MHN A;  4OC0 A;  5DS0 A;  4MMO A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  1LAM A;  2BO9 A;  4DUK A;  4Q7A A;  4ZY0 A;  2V8D A;  4GM5 A;  1TF9 A;  5CPA A;  5CBM A;  3MN8 A;  5THW A;  4RUH A;  1NSA A;  4MCQ A;  2Q51 A;  3GB0 A;  4ZX9 A;  4NGN A;  2C1C A;  4FWU A;  3L2N A;  3T8W A;  3BXM A;  1EE3 P;  3SI1 A;  3PB9 X;  3IJ3 A;  4R8F A;  3RZA A;  3DGV A;  2O4H A;  4ZY2 A;  1PYT B;  3IWW A;  3CT9 A;  4PXE A;  7CPA A;  1TKH A;  1YME A;  2QJ8 A;  4W9Y A;  1VGY A;  2ZEO A;  3NA6 A;  4A39 A;  3IO1 A;  2PIY A;  2I3C A;  2IJZ A;  2PJC A;  3B3V A;  2PJ0 A;  3ISX A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  1YLO A;  4KSI A;  2Q43 A;  4OC5 A;  2RFH A;  2EK8 A;  5K8O A;  1ELM P;  1CG2 A;  4NJQ A;  4A38 A;  1ARL A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  1YSJ A;  4ZY1 A;  1F2O A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  5HVG A;  3H8G A;  4MHP A;  1ZG7 A;  3S9L A;  2ZOG A;  3GLJ A;  4NGS A;  3JRU A;  1Z2L A;  4OIW A;  2AFS A;  2ABZ A;  4X3R A;  2NYQ A;  5HVF A;  3TX8 A;  1Y0Y A;  2ZED A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  3K9T A;  4TWE A;  3SJG A;  4ZYQ A;  1YW6 A;  1LAN A;  1H8L A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  3KZW A;  5K8M A;  3KQZ A;  2PJ8 A;  3H8E A;  3KGQ A;  1ELL P;  4AXV A;  4P45 A;  4P4B A;  4JZ0 A;  5JGF A;  3FED A;  4UEZ A;  2AFZ A;  4WWV A;  2Q4Z A;  3WC5 A;  1CBX A;  3NFZ A;  4MHZ A;  4P44 A;  4EWT A;  3S9N A;  3V7Z A;  1TKJ A;  2AFO A;  2C6C A;  3KR4 A;  4PXC A;  5LRG A;  1LFW A;  3FMC A;  2XEJ A;  4EFD A;  1HDU A;  1CP7 A;  1VHE A;  3PFE A;  1TKF A;  3RBU A;  4MCS A;  4R7M A;  5ELY A;  4OP4 A;  4YWY A;  2F7V A;  3NH5 A;  1F2P A;  2PJ6 A;  4TNU A;  5D29 A;  4UF4 A;  2PE3 A;  3GUX A;  5I4M A;  2XEI A;  3D7D A;  2G9D A;  2ZEE A;  4A37 A;  4F9V A;  2GLF A;  3B3T A;  4MRI A;  3FJU A;  2PJ1 A;  4P4E A;  1XBU A;  1BPM A;  1M4L A;  3HUV A;  1Y0R A;  3BI0 A;  3H8F A;  5HVH A;  3I1U A;  4X8I A;  1XMB A;  3PBE A;  4P4I A;  4B6Z A;  4IAV A;  4CPA A;  2WZN A;  2AFX A;  2GU2 A;  2AFW A;  3SI0 A;  4IHM A;  3LWU A;  2ZEL A;  3PB6 X;  2ZEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...