4P6YA

Crystal structure of the m42 aminopeptidase tmpep1050 from thermotoga maritima
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
b'MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Crystal structure of the M42 aminopeptidase TmPep1050 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4p6yA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p6yA01
4EFDA 3LMSA 2ZEHA 3S9NA 2PE3A 3IEHA 4TNUA 4Z65A 2V8HA 2DEAA 2WYRA 3B3TA 2FVGA 2QJ8A 1ZLIA 3N5FA 2AFUA 4OC3A 5ELYA 4UEEA 2F7VA 4YWYA 3KL9A 2PRQA 5CPAA 4UIBA 4OMEA 4WWVA 3PB8X 3NH4A 1H8LA 3V7ZA 2PIZA 3IJ3A 4UEFA 5THWA 3FMCA 2XEGA 3KZWA 2O4HA 1VHEA 7CPAA 2PJ8A 1CP7A 2ZOGA 4PPZA 2CIJA 4ONWA 4F8ZA 3VATA 4IAVA 4OC1A 1YW4A 3VARA 1CPSA 5DS0A 4ZY1A 3JRUA 1ARLA 4OC2A 5J1QA 3FECA 4PXEA 1LAPA 2V8DA 2BO9A 3H8FA 5JGFA 3WC6A 1HDUA 4AXVA 5CBMA 4ZYQA 1Z5RA 4MCRA 2C6CA 4ZI6A 5LYLA 3TC8A 3PFOA 1ELMP 5D8NA 4UF4A 1TKHA 1AMPA 1NSAA 8CPAA 3KHZA 4TWEA 1GYTA 3B3SA 3T8WA 2Q51A 1FT7A 2AFXA 1VHOA 5D29A 1LANA 1UWYA 5F09A 1LOKA 3FVLA 4MMOA 3FX6A 2PCUA 2PJ7A 2PJ5A 1XRYA 4MHNA 3QNVA 3FH4A 2AFWA 3PB6X 3D7HA 3WC5A 1DE4C 4MXUA 4G1PA 4PXCA 1XFOA 1Y7EA 3WC7A 6CPAA 4JYWA 2F8HA 3CDXA 4P45A 4A37A 3WT4A 3PBEA 2PJCA 1Y0YA 3SJFA 3SJGA 2PJ9A 4WJBA 1CG2A 3BI1A 2EWBA 4MHPA 1RTQA 2XEIA 1ARMA 4OC5A 4KSIA 1ZLHA 2ABZA 2XEJA 3V38A 3CPAA 3VH9A 1Z8LA 3BHXA 4NGQA 3SI0A 2XEFA 3D67A 4K3NA 4DYOA 2G9DA 2GREA 4OIDA 3SI2A 4P4EA 2BOAA 2WZNA 2NYQA 1FNOA 1OBRA 4NGMA 3SJXA 2Q43A 3MRUA 1AYEA 4MCSA 4OC0A 1VIXA 5K8OA 3PRTA 4BD9A 2AFOA 3B7IA 3SI1A 5HXDA 3BI0A 4DJLA 1CBXA 1XJOA 4UIAA 4H2KA 1Y0RA 4NFRA 3I1UA 2ZEDA 4P4DA 2PVVA 4GM5A 3S9MA 2ZEGA 3HUVA 4R76A 3FF3A 4P4IA 2JEWA 4FUUA 3LWUA 2IQ6A 3DGVA 2NSMA 2PIYA 2AFMA 1BLLE 1ZG9A 4P4FA 5LRKA 3B2YA 4B6ZA 3IC1A 3GB0A 1ELLP 2EK9A 2HB6A 5I4MA 2CF4A 1F2PA 2ZEOA 1PYTB 3IWWA 2V8GA 2OOTA 3GLJA 3D7GA 1Q7LA 2GLFA 2HC9A 3D68A 3D7DA 2IJZA 2V77A 1CP6A 4W9YA 1JQGA 2POKA 2PJ4A 2O53A 4R7MA 3B3VA 5LYIA 3IFEA 4P4JA 4EWTA 1HDQA 5LYDA 1XBUA 3KR4A 2JBJA 3S9LA 2GLJA 1TKFA 4PXDA 3GUXA 4F9VA 2ZEFA 2BCOA 4FBEA 3K9TA 2PJBA 4OC4A 4PXBA 3FEDA 1IGBA 3B35A 3PBBA 3MN8A 4P44A 4R8FA 3KQXA 4ZY0A 1F2OA 3NH5A 1VGYA 2J9AA 4UEZA 3FJUA 3D4UA 3D66A 3PB7X 3PB9X 4NGRA 4NJQA 3DLJA 3H8EA 5JH9A 3B3CA 5IB9A 3RBUA 3SJEA 1DTDA 2AFZA 2C1CA 4O23A 4P4BA 1ZG7A 3KHXA 4MHYA 4PQAA 1F57A 2CTBA 2PVWA 2QVPA 1YW6A 1BAVA 4R6TA 4X8IA 3NFZA 2I3CA 2PJ3A 3L2NA 4NGSA 2ANPA 1YMEA 4ZX8A 3FEEA 3NH8A 2PJAA 4Q7AA 4MHZA 2RB7A 4IK2A 4NGTA 1LCPA 4MCPA 5JM6A 1R43A 3K2KA 1CPXA 2VL1A 1QQ9A 4ZY2A 2GU2A 2PJ6A 3PEIA 4A94A 5HVHA 2ZENA 3ISXA 5K8NA 1ZG8A 2CTCA 2Q4ZA 3IIBA 4P6YA 4OIWA 4DUKA 1CX8A 3KASA 2ZEPA 3HLPA 3CPXA 3CT9A 3WABA 4LQGA 2ZEMA 3KR5A 3H8GA 4YU9A 3ISZA 5LRGA 3PFEA 2QYVA 2RFHA 3D7FA 2PJ2A 4FWUA 4JZ0A 3RAMA 1XMBA 1R3NA 1IY7A 2PJ0A 1BPMA 2AFSA 2C6GA 1TF8A 2JBKA 3PB4X 4NGNA 1TF9A 4OKOA 1LFWA 3KQZA 4X3RA 1KWMA 5K8PA 1HEEA 5LRJA 4F9UA 3KGQA 4A39A 4A38A 2IMOA 4RUHA 4FAIA 3RZAA 4IHMA 1M4LA 2PJ1A 4NGPA 2ZOFA 2C6PA 3IO1A 4NJRA 5HVFA 2OR4A 2ZELA 4OP4A 4MCQA 1EE3P 2EK8A 4MRIA 2ZEEA 1QMUA 1YSJA 3NA6A 4CPAA 1Z2LA 1YLOA 1LAMA 3B3WA 4P10A 3BXMA 1PCAA 5LYFA 4X2TA 2V8VA 1BPNA 5K8MA 4EMEA 4ZX9A 5HVGA 1TXRA 3TX8A 3KI9A 1TKJA
chains in the Genus database with same CATH superfamily
4C68A 2PC1A 2ZEHA 2J8MA 4LX9A 3ONUA 4XORA 1MABA 2VZLA 2WYRA 1JA0A 2FVGA 2ZZGA 3OZUA 1BOBA 1NJID 4F0YA 1P4NA 2PIAA 2VEZA 3T9YA 2QECA 4UA3A 3R6JA 2FT0A 4YGOA 1E79A 4OPSA 2ZXHA 3WYAA 4KORA 4YXWA 1CP7A 3RYOA 4YRHA 3OPOA 2BL1A 3VATA 3W5HA 1FY7A 3VARA 5DS0A 3BH4A 3ZIAA 3D2PA 1KZFA 4HNYB 1VKCA 4UAJA 3CD6B 2PRBA 4MYTA 1LAPA 4FD5A 3I3GA 2Q0YA 1HDUA 4AXVA 2R7HA 4NXYA 1OGJA 3NE7A 2YNCC 4MCRA 2ZL6A 2P3MA 5D8NA 4UF4A 4P6VF 3FPKA 5FIUA 1YX2A 1NSAA 3ASSA 3SJZA 8CPAA 3KHZA 1VQKB 3OOCA 1VQ8B 4ZCIA 1R57A 2R98A 2RC4A 3GY9A 3IU2A 1FT7A 2BSWA 5D29A 4RD4A 1H8EA 1BJKA 1LOKA 1SKQA 2PCUA 2PJ5A 3D3SA 4U9UA 4L89A 2VBTA 1ELOA 2RC6A 2VNJA 2E1RA 3WC5A 4B48A 3A9LA 4M0LA 4G1PA 1Y7EA 3SXOA 3CDXA 4KSAA 3WY9A 3SJGA 3CCEB 3T90A 4JWPA 4OP7A 1NB0A 2O28A 4RD0A 1G7RA 4MI4A 3BI1A 4ACBA 2EWBA 2GPJA 4A33A 2B4DB 2XEIA 2HCJB 4OC5A 3I55B 2ZPAA 1YVKA 3SKBA 3SLDA 3CPWB 3V38A 4LBYA 3VH9A 4XONA 1Z8LA 4DYOA 4TMZA 2GREA 4Z4TA 4XR6A 1YREA 1FNOA 4CGPA 2BM0A 4AG7A 1QSMA 5K8OA 2AJ6A 4XL9A 4B12A 1UMKA 2NV4A 3B7IA 3DR8A 3CMAB 4PV6A 4II9A 4C7HA 2VJJA 4BPRA 2YGWA 4H2KA 1Y0RA 3LO8A 2YWEA 3SHPA 3JQRA 2CW5A 1E43A 4WQMA 2X0KA 3OW2B 1J4JA 4R76A 2BPOA 2GJRA 4I49A 5G20A 1Z8WA 2IQ6A 1FDRA 5AN9A 3W5UA 1E1RA 1EP1B 1S4MA 1FNMA 2CF4A 1PYTB 1N07A 3IWWA 1Y9KA 1BPLA 2D4PA 3S6GA 4A95A 2HC9A 3D68A 2DYIA 3D7DA 2ZBUA 1K73D 2Z0ZA 1T5EA 2CNSA 1XBUA 2OK7A 5HZBA 3OFNA 3EC4A 1TKFA 4PXDA 4F9VA 1HZEA 3ZPNA 3K9TA 3FXTA 3CZXA 2BGIA 4OC4A 2OBSA 2VZZA 2LZJA 2EFGA 4C0SA 3FEDA 4R3KA 1IGBA 1VHSA 3B35A 4HNWB 1KK1A 4R8FA 4ZY0A 4Z4ZA 1V0CA 1VGYA 3DDDA 2VBUA 3SLNA 5F49A 1YLEA 3P26A 1S3ZA 3B3CA 5IB9A 2XZLA 2A4NA 3CXQA 1IJEA 1OB2A 2QA4B 4II3A 1NBMA 3CP2A 4M2LA 5GV7A 4PQAA 1TUIA 1XE1A 1E3ZA 3MGDA 1I21A 4Q38A 3OAAA 3CCMB 4AVBA 4KKUA 1BAVA 4QUZA 2XGJA 4KOTA 3GIRA 3NFZA 3L2NA 3VNVA 2X7BA 1PKVA 3FEEA 3WNDA 4OAEA 4Q7AA 1S72B 1ZM4A 5AG4A 4MHZA 4NGTA 4KOSA 3GSIA 2Z3NA 2PMDA 1GHEA 3JU4A 2PJ6A 5HVHA 4MFKA 5TRDA 3IIBA 3OEEA 4CRZB 4G1BA 1CX8A 1W34A 1WPCA 2D3NA 1YITB 4YEJA 4AVAA 5KW9A 2HQYA 1GVHA 3BNWA 4NF1A 2OTLB 4UBRA 4YU9A 3W91A 4TKOB 3PFEA 5HMNA 2B7BA 1N0VC 1FNCA 4YAFA 2W6IA 2IL4A 1Q9SA 1XMBA 2BUEA 2F4NA 1BQEA 1TTTA 2C6GA 2JBKA 3WBKA 1TLLA 3EO4A 4NGNA 3FNCA 1TF9A 4XLCA 5BWAB 1DDGA 4XN3A 4OKOA 1LFWA 1S7KA 2PR1A 3CMMA 2ZW7A 2VJIA 3ZBTA 2F5IA 3W2HA 1VQOB 2FL4A 1ZM3A 2YNCA 1HA3A 1XE4A 1HEEA 4RDKA 2XEXA 2F1MA 1QX4A 4GXHA 3QAYA 4B11A 1T6XA 4A38A 2IMOA 2DEUA 2JJ1A 4IHMA 2PJ1A 4NEXA 2GFQA 3H94A 2ZOFA 3H4QA 1OB0A 5J3OA 1LRZA 4JXQA 1S0UA 1QSRA 2C5HA 3Q6QA 2I79A 1EE3P 4MRIA 3OJXA 3NA6A 4X5KA 1U6MA 3G05A 4E8OA 4EH1A 4QB9A 2VXKA 1LAMA 2VQYA 3B3WA 5JQ4A 2DIEA 1K28D 4X2TA 1DG1G 1G7TA 1AMOA 1BPNA 2PLFA 1Q82D 1FNDA 1S7LA 3QFSA 2QDXA 3KI9A 3AGQA 2Q04A 4X0CA 3T53B 3LMSA 2WSSA 5BSXA 1MJ9A 3TOAA 3S9NA 4FD7A 4F6AA 3IEHA 4Z65A 1N71A 4RM0A 3WXMA 1PJ7A 2QJ8A 5TY0A 1ZLIA 4PAAA 2C78A 2CK3A 4M6GA 2Y0MA 3FRMA 4YWYA 2C5BA 3KL9A 4UIBA 2OZUA 2G0BA 2M5SA 3G6EB 1YJ9B 4RDJA 4OMEA 3VMFA 4WWVA 1EP3B 1H8LA 2PIZA 5CNPA 1Q86D 2VYQA 3KZWA 2ZOGA 3JTKA 4F8ZA 3BCFA 4IAVA 4Z4RA 1YW4A 1TIQA 4OC2A 5BSYA 3VNUA 4KSFA 3SXNA 1PJ5A 2QTZA 2B5OA 3OZVA 3T51B 2V8DA 2BO9A 4HKFA 2C6CA 3TC8A 3A8JA 4B43A 2JDCA 2B5GB 1E62A 3ASTA 1AMPA 1WWZA 3CCLB 1PU9A 4NCZA 4U5YA 2C4UA 4TWEA 3T8WA 1M4IA 1MJBA 3CXCB 4FD4A 2VNHA 2ZTGA 1I1DA 2AFXA 1VHOA 1Q7YD 1IICA 1UWYA 5F09A 4AF6A 4MMOA 1F60A 1Z9UA 5E96A 3BLNA 5G1ZA 3OZWA 3PGPA 5H86A 3DR6A 3MCAA 4PXCA 4QUSA 4X7CA 4N3NA 3TTHA 2B58A 3Q6RA 1YGHA 1K4JA 2V7VA 4H9GA 3Q3AA 4P45A 4MY0A 2Q6IA 1Y0YA 5FNZA 4PK2A 3SJFA 2PJ9A 1YHQB 4RD6A 1COWA 2VI7A 1Y9WA 3FB3A 1RTQA 4HE5A 3ZZTA 4RD1A 1FNBA 1YIJB 1IOFA 1Z8TA 4RJLA 4KSIA 3P2HA 3TCVA 2GE3A 1VQ7B 2CXAA 2XEJA 4RPBA 2D3LA 4KUBA 2B3VA 1DDIA 5IYRA 2P6FA 3WNCA 4C2ZA 2R1IA 5AGEA 1QGYA 4OIDA 3SI2A 4P4EA 2WZNA 2OYNA 1ON0A 2Q43A 3MRUA 1IHMA 1FRQA 4P25A 2NPFA 1AYEA 1NB9A 1VIXA 3JQPA 3TO7A 3PRTA 1VQNB 1XF8A 2GANA 2AFOA 1P4MA 3BY2A 3QFCA 1JB9A 2Z10A 2R6HA 1QG0A 3CC2B 2ZZQA 4OADA 1D8TA 3WQZA 1YK3A 2J8RA 2GJPA 1M4DA 4OPVA 4CAXA 4GM5A 3S9MA 2ZEGA 5IYNA 3BJ7A 4NNJA 4P4IA 3D8PA 1OZPA 2XZPA 3PP9A 3ZJ0A 2PQ8A 2AFMA 1WOPA 2R9VA 4KKTA 1VQMB 4P4FA 3HAGA 3GB0A 3SJPA 2HDNB 1WDTA 1F2PA 4M4SA 5I0CA 3CC7B 2YWHA 4DNCA 2OOTA 4UWIA 3D7GA 2X8KA 1Q7LA 3B82A 3W2EA 2JIZA 1XB2A 2OBRA 4ROXA 1JQGA 4R7MA 3WR7A 1CM0A 1W2BB 4EWTA 5IYWA 1HDQA 3G3SA 2DCUA 5A89A 4A30A 2Q4YA 2GLJA 1EFTA 4MJ8A 4NBSA 1RQRA 2AHOA 2XNJA 1BO4A 3V8IA 4PXBA 4AVZA 4E0FA 2WZPP 1BMFA 1QFJA 1B23P 1V5VA 3P2FA 3CMEB 3CCJB 3MN8A 3B78A 1CNEA 1D2EA 1E64A 3J81k 1F2OA 2J9AA 3T56B 3D2MA 3D66A 3PB7X 4BMHA 3PB9X 4NGRA 1HVXA 1QSTA 3W2GA 4AB7A 1R5BA 3FKSA 4TT3A 4P4BA 3KHXA 1YJNB 1F57A 2P6EA 3TT2A 1GO2A 4P26A 2QEXB 1YW6A 3ES9A 1EFUA 1UD2A 4R6TA 4TMVA 3GIUA 2V7TA 1IOIA 2ANPA 2VZYA 2X6XA 4F0XA 4ACAA 1YMEA 2PJAA 4KLVA 3R95A 4Y9UA 4LBVA 5DSZA 1WTHD 5L46A 1B87A 1IYLA 1ZUNB 4ZY2A 1H42A 1X10A 4QVAA 3PEIA 5KTDA 2I00A 3ISXA 4LUAA 2Q4ZA 4P6YA 4DUKA 4CYQA 4CQJA 2I1LA 3CPXA 3S6HA 3CT9A 5KSWB 3KR5A 2BV3A 3ZUGA 4UZFA 4FD6A 3AVWA 2QYVA 3TE4A 2VNKA 5J35A 4FWUA 3R6KA 1VQ9B 4A2ZA 2BEIA 4UFVA 5E6TA 1R3NA 3AGPA 1N8RD 1R5OA 3MMPA 4PC3A 5LMZA 1Q81D 2HLDA 2EO8A 3KQZA 2X3UA 5IYPA 1S60A 2B5GA 4QC6A 4PABA 4QVTA 3DNSA 2HMAA 1N06A 4XNHB 5EBVA 4X7DA 3TFYA 3D26A 2OBTA 1M4LA 4DQKA 5AG5A 1P0HA 2AE6A 2ARHA 1UD3A 2C6PA 3IO1A 2OZHA 5HXBA 4OP4A 4XN0A 4MCQA 2JLMA 1VF7A 4CGNA 2C2WA 2ZEEA 1QUEA 4XLHA 1YLOA 4Q36A 3VWDA 1BLIA 1H85A 3R96A 1S7NA 3TO6A 1KQSB 5HH1A 4KS9A 4XLAA 4KVOE 3S6FA 3OW7A 1E1QA 4QVJA 3Q39A 1B6BA 1UD4A 2F43A 3TX8A 1TKJA 2NMTA 4NSQA 4B13A 1QH0A 5H59A 2PE3A 1B2RA 3SEJA 5FL7A 2DEAA 1K8AD 4RD3A 2WJYA 3B3TA 3R1KA 2WR8A 1OB5A 1NSLA 5DWMA 1IU8A 4Z1MA 4XD7A 5F4JA 5ELYA 2F7VA 2PRQA 1L0CA 4CAEA 4CYNA 5DWNA 3PB8X 3NH4A 3V7ZA 5H84A 4P1VA 3IJ3A 3A8IA 1WSRA 5THWA 1WOOA 4CAVA 3AVTA 2XEGA 3P27A 5FA6A 4KLWA 2Z3PA 7CPAA 2PJ8A 1SM4A 4AVCA 4PPZA 2CIJA 4ONWA 4YHBA 4A31A 4MFZA 3LODA 1CPSA 4NCNA 5J1QA 3WNBA 2GIVA 4TMWA 4ZGQB 1Q2DA 1V0EA 3FECA 2Z6BD 4PXEA 4UFXA 1E63A 3R9EA 4R87A 3H8FA 5JGFA 3WC6A 2D9RA 3CXSA 4MY3A 5FVJA 4ZYQA 5AG6A 4C43A 1Z5RA 2QE7A 4ZI6A 1I18A 4LQ6A 1ELMP 1J9ZA 4R57A 4B3GA 1JNYA 4C2XA 2V31A 1QVGB 4TN1A 3QB8A 1D1NA 3B3SA 3GKRA 3RNZA 3OWCA 2VBSA 4RCZA 2QMUA 2Q51A 3CB4A 5KNLA 1M44A 2X53S 4JD6A 3FX6A 4U9ZA 2PJ7A 3QNVA 3W6SA 5GCNA 3FH4A 3KKWA 3PB6X 4AC9A 1Q2YA 3D7HA 4B4DA 4YELA 4BINA 1DE4C 1XFOA 4PC7A 4JYWA 1R5NA 4CYOA 4G7WA 1W0KA 2PJCA 5HKKA 1A8PA 4ZGYB 2QMLA 2F1LA 4WJBA 1KTVA 4UFWA 3QFTA 4ZV4A 2QTLA 4FK8A 5A88A 4MHPA 3W5VA 4CYPA 2PSWA 2ATRA 3OJWA 4DK0A 2OU2A 1AIPA 3CW2A 2B4DA 2ABZA 2Z3KA 4FXUA 3CPAA 3BHXA 4NGQA 3PVDA 1VQ5B 2XEFA 4K3NA 4QV2A 1G7SA 1QSNA 1M1DA 1YX0A 5F46A 4L8JA 4B5PB 3WBJA 2NYQA 1NMTA 1W0JA 4NGMA 3SJXA 4A32A 3GQBA 4II2A 4OC0A 3TO9A 4G7XA 4BD9A 5KTAA 3CESA 1A2ZA 3SI1A 2FIAA 5HXDA 3BI0A 4DJLA 4YAOA 4OOXA 1XJOA 3C26A 4UIAA 4L8AA 3S6KA 2DERA 1SQHA 2C77A 4X06A 4Z4SA 3VR6A 3GVLA 1KZLA 1ZO0A 3DSBA 4YAWA 2X85A 3HUVA 3FF3A 2JEWA 4FUUA 5KTCA 5F47A 4KOVA 5IK2A 3DGVA 1BLLE 3JQQA 1H8HA 5LRKA 1ELLP 2EK9A 5I4MA 1Z4EA 3V76A 1VJSA 1VQ6B 1XQBA 1RXTA 5C88A 1EXMA 2V8GA 1I8DA 1XEBA 4H6UA 4R3LA 1KJZA 2GLFA 5THXA 4XPKA 2ZBVA 4KKSA 4W9YA 2POKA 3VO1A 2PJ4A 4CGOA 4OLLA 2O53A 3B3VA 4PC2A 5LYIA 2Z11A 2RC5A 3RY8A 5LYDA 2EUIA 5JBQA 3GYAA 3KR4A 4B3XA 4K30A 1M4GA 2JBJA 4ORFA 4KOUA 5A8AA 1ZM9A 4MYUA 2OZGA 2ZEFA 3GUXA 4FBEA 2XNDA 2V7WA 3H9NA 4OPOA 5TV2A 4P12A 3LQ6A 3RO0A 4XKWA 4P44A 1KUYA 3ZZIA 2PR8A 1VLYA 4J3GA 4CGMA 3ASQA 5IYQA 2ZW6A 4UEZA 3FJUA 3D4UA 2FCKA 2HV2A 5EMIA 4G1VA 3H8EA 4KVME 2OH1A 3UY5A 3H5ZA 4RLZA 1M1KD 3FJOA 1VQLB 4H6ZA 4MFJA 3RBUA 3SJEA 1BX1A 2ZZFA 1DTDA 3CCUB 4IF5A 1M90D 4UCPA 3QSYA 2XOKA 4PSWA 1YR0A 2CTBA 1RO5A 2PVWA 4X05A 4DQLA 4P22A 2DF5A 4X8IA 3AVXA 5J8CA 2DY1A 2V7UA 2I3CA 2PJ3A 3NH8A 2RB7A 4XPLA 1LCPA 3EY5A 1QVFB 3ONYA 2ZL7A 1R43A 3K2KA 3W6XA 4XOPA 2JDIA 4X7EA 2ODFA 2VL1A 1QQ9A 2V7QA 2ZL5A 2QGGA 1VLOA 3LQEA 4A94A 2W6JA 4H89A 2ZENA 5K8NA 4K1XA 2CTCA 2ZTNA 4IW3B 2EVNA 2DPTA 4OIWA 2YWGA 2OK8A 2ZEPA 3KEWA 4ZGNB 3CTAA 1CNFA 4LQGA 3B8HA 2ZEMA 2D4OA 2FIWA 3H8GA 2FE7A 2V7XA 4OOSA 1MRZA 5LRGA 2P6GA 3BY1A 5A28A 5A27A 1NDHA 2RFHA 2FX3A 3D7FA 4KUAA 2PJ2A 2GQFA 4GQNA 4M3SA 1YJWB 5ISVA 3F0AA 3W2IA 3GVKA 1BPMA 2H5MA 2AFSA 3A3BA 4RS2A 4WZLA 3PB4X 1QGAA 1IB0A 2ZXVA 4MFPA 1T6ZA 2K5TA 4ZCLA 5IB0A 4X3RA 4TMTA 4HNXB 1KWMA 5IV0A 3PUNA 4YFJA 2CNDA 1FX0A 1KD1D 3W2FA 2EBJA 5K8PA 5TR9A 2XZOA 3CC4B 3CCVB 4F9UA 4CS0B 2C4TA 2OTJB 3KGQA 4RN7A 4Q7JB 4FAIA 1IJFA 4MFLA 1VQ4B 4NGPA 4U9YA 4NJRA 1N0UA 2WJVA 3IWGA 5G21A 3G8WA 2EK8A 1WORA 1YVOA 1YSJA 4CPAA 4UWJA 4AG9A 3IGRA 1CQXA 4XOTA 2PDOA 2C27A 4KOYA 4X7FA 1IIDA 4DNRB 5LYFA 3F5BA 4KOXA 2V8VA 1AUGA 4UCMA 5K8MA 4EMEA 4TMXA 1S7FA 2G3TA 4ZX9A 4R9MA 5HVGA 4B10A 3PZJA 5J8FA 4EFDA 1N05A 1IYKA 2QN6A 4MHDA 4RPDA 1JA1A 4KVXA 3U2QA 4YALA 4TNUA 2WUUA 2V8HA 2JEVA 1KMHA 3DDYA 3ZC3A 3N5FA 1UD5A 4B5PA 2AFUA 4OC3A 4UEEA 2Q6KA 5CPAA 1WU8A 4CRYB 3FBUA 2WPXA 2QIRA 4RCYA 1BX0A 3I1FA 4UEFA 3OEHA 2FSRA 3E20A 3FMCA 2O4HA 1VHEA 2J7KA 4F7DA 3QFRA 2KCWA 4XKVA 4OC1A 1ZM2A 5HZAA 4ZY1A 3JRUA 1ARLA 4CGLA 3GVJA 5IX3A 2YNEA 1CJWA 5EC4A 2Q7BA 3I9SA 5F48A 3A3GA 1T6YA 1YQEA 2Q6LA 2VBQA 4LBWA 3PA2A 1UD8A 5CBMA 4J0QA 4C7IA 3OKXA 5LYLA 3PFOA 4ZBGA 4XNHC 5G22A 5FO0A 1TKHA 2JJ2A 1GYTA 4MBUA 3R9FA 1XOVA 3BQJA 3A8KA 2OB0A 3ZZ0A 1GR1A 2DXQA 3QE2A 4XLFA 3IWEA 1LANA 1WSVA 2DETA 3PA1A 3FVLA 2BGJA 1XRYA 2KVOA 4MHNA 1FRNA 1OHHA 2EIXA 2AFWA 1KK3A 2ZXIA 3LVBA 3AVVA 2YNDA 4DNTB 4XQFA 4MXUA 4M6IA 3V7AA 4B14A 4RD2A 6CPAA 3WC7A 2F8HA 3Q38A 3CCQB 3WT4A 3PBEA 4A37A 3CCRB 4FWTA 1N08A 3E0KA 3CRZA 3PUMA 1CG2A 2D74A 2HUZA 4HPSA 4JXRA 1EP2B 2Q4VA 4FN5A 5C82A 2FS5A 1ARMA 1ZLHA 2BMWA 4G6IA 4PGOA 5F4MA 1QGZA 5F4OA 3SI0A 2B4BA 3D67A 2R8VA 2G9DA 2Q7SA 1XMTA 4XPDC 2BOAA 1OBRA 3BCDA 4XLEA 2JN9A 4MCSA 4PC6A 4XPDB 4N3GA 3U6KA 3OP1A 4UZUA 2CNMA 4HIZA 3FIXA 1CBXA 3VO2A 1KK0A 4JLYA 2REFA 2G3AA 3LACA 4NFRA 2J8NA 1EFCA 3I1UA 3CP8A 4C2YA 2ZEDA 4P3YA 4P4DA 1MJAA 2PVVA 4CAWA 1I7PA 4UZEA 3LWUA 3FPPA 2NSMA 2PIYA 1DARA 4CAFA 2WPWA 1ZG9A 4LBZA 4P2NA 3B2YA 4B6ZA 3IC1A 2GK7A 2HB6A 3QAHA 2ZEOA 5GV8A 3AVYA 2ZZEA 4AF7A 4Z4UA 3CCSB 4E0AA 3GLJA 3EXNA 1Y7RA 4PSXA 4WZKA 4LC0A 2VBVA 2IJZA 2V77A 3IU1A 1CP6A 4ASUA 1JJ2B 4G5GA 4M1KA 1IB1E 1QFZA 1EFRA 3IFEA 4P4JA 1GAWA 5AG7A 2VNIA 4TSFA 3I56B 1PUAA 1I12A 2X6YA 5DN6A 3S9LA 1WK4A 2Q6OA 4XM3A 4OOVA 5JPHA 2BCOA 1KC8D 1W35A 3NE5B 4B5OA 2PJBA 2BSAA 3AVUA 3MHPA 1OGIA 3JVNA 3LD2A 4Z4VA 3N7ZA 1KK2A 2B3UA 2DPSA 4PK3A 1NE9A 3PBBA 3TOBA 2ZW5A 3KQXA 3NH5A 4B47A 3EFAA 4RDLA 4NJQA 1Z4RA 3DLJA 4PC1A 1WP6A 1SKYB 4EVYA 4QHYA 5JH9A 2CBXA 3NE8A 1YI2B 1MK4A 2AFZA 4B3FX 2C1CA 4O23A 1ZG7A 4MHYA 1QSOA 2BVNA 1GAQA 1NRKA 1V0FA 4Y7CA 2QVPA 1PJ6A 4QFMA 3A35A 4Y9RA 4M6HA 3VWEA 2GJKA 4NGSA 1S5KA 2GK6A 4ZX8A 1QFYA 3F8KA 1F20A 3BC9A 1UFHA 3ASPA 1KUXA 4IK2A 4Z4YA 2REEA 3G4SB 1E3XA 4M53A 1KUVA 2B7CA 4MCPA 1KRHA 2CRVA 2CC2A 1WOSA 5JM6A 1X12A 2WSAA 1UD6A 2Z3OA 5CDFA 1CPXA 4XMYA 4XNFA 2GU2A 1G7CA 2ZITA 3OE7A 3LNNA 3E1YE 2V4DA 2WPDA 4JMQA 1ZG8A 2Z3LA 2Z3MA 4HE6A 1GJRA 1W9XA 3KASA 2YWFA 3HLPA 2FXFA 3WABA 5FO1A 3ASRA 3ISZA 4X07A 4Z4WA 3ZZUA 2ZW4A 4KZTA 3U6BA 2XNCA 4JZ0A 4WZEA 3PENA 1TVCA 3RAMA 4P9SA 2X6WA 1IY7A 2P0WA 2PJ0A 3BJ8A 1TF8A 3ZBUA 3FYNA 1RQPA 1EWYA 4ONUA 1W87A 1Z8XA 4M85A 5EMNA 5B6IA 2DOGA 4QBJA 4ZCMA 3K9UA 2BM1A 4UCNA 5LRJA 4P3IA 1Q2CA 2CNTA 4KOWA 2BN4A 2BF4A 4A39A 2Q44A 4RUHA 3RZAA 4MFQA 4R71A 3G71B 2JDDA 4BBHA 4GS4A 5HVFA 4WZTA 2OR4A 1U2RA 4B44A 2ZELA 1JWQA 4IUSA 3A1PA 1K9MD 1QMUA 4YAUA 5H5JA 2E1BA 4Y49C 4RI1A 1Z2LA 1VQPB 4P10A 2CY2A 4Y49B 3BXMA 1PCAA 3B8GA 3R9GA 3JUWA 3CXPA 1XIXA 4JJXA 1QUFA 1TXRA 4E2AA 4DK1A
chains in the Genus database with same CATH topology
4EFDA 3LMSA 2ZEHA 3S9NA 2PE3A 3IEHA 4TNUA 4Z65A 2V8HA 2DEAA 2WYRA 3B3TA 2FVGA 2QJ8A 1ZLIA 3N5FA 2AFUA 4OC3A 5ELYA 4UEEA 2F7VA 4YWYA 3KL9A 2PRQA 5CPAA 4UIBA 4OMEA 4WWVA 3PB8X 3NH4A 1H8LA 3V7ZA 2PIZA 3IJ3A 4UEFA 5THWA 3FMCA 2XEGA 3KZWA 2O4HA 1VHEA 7CPAA 2PJ8A 1CP7A 2ZOGA 4PPZA 2CIJA 4ONWA 4F8ZA 3VATA 4IAVA 4OC1A 1YW4A 3VARA 1CPSA 5DS0A 4ZY1A 3JRUA 1ARLA 4OC2A 5J1QA 3FECA 4PXEA 1LAPA 2V8DA 2BO9A 3H8FA 5JGFA 3WC6A 1HDUA 4AXVA 5CBMA 4ZYQA 1Z5RA 4MCRA 2C6CA 4ZI6A 5LYLA 3TC8A 3PFOA 1ELMP 5D8NA 4UF4A 1TKHA 1AMPA 1NSAA 8CPAA 3KHZA 4TWEA 1GYTA 3B3SA 3T8WA 2Q51A 1FT7A 2AFXA 1VHOA 5D29A 1LANA 1UWYA 5F09A 1LOKA 3FVLA 4MMOA 3FX6A 2PCUA 2PJ7A 2PJ5A 1XRYA 4MHNA 3QNVA 3FH4A 2AFWA 3PB6X 3D7HA 3WC5A 1DE4C 4MXUA 4G1PA 4PXCA 1XFOA 1Y7EA 3WC7A 6CPAA 4JYWA 2F8HA 3CDXA 4P45A 4A37A 3WT4A 3PBEA 2PJCA 1Y0YA 3SJFA 3SJGA 2PJ9A 4WJBA 1CG2A 3BI1A 2EWBA 4MHPA 1RTQA 2XEIA 1ARMA 4OC5A 4KSIA 1ZLHA 2ABZA 2XEJA 3V38A 3CPAA 3VH9A 1Z8LA 3BHXA 4NGQA 3SI0A 2XEFA 3D67A 4K3NA 4DYOA 2G9DA 2GREA 4OIDA 3SI2A 4P4EA 2BOAA 2WZNA 2NYQA 1FNOA 1OBRA 4NGMA 3SJXA 2Q43A 3MRUA 1AYEA 4MCSA 4OC0A 1VIXA 5K8OA 3PRTA 4BD9A 2AFOA 3B7IA 3SI1A 5HXDA 3BI0A 4DJLA 1CBXA 1XJOA 4UIAA 4H2KA 1Y0RA 4NFRA 3I1UA 2ZEDA 4P4DA 2PVVA 4GM5A 3S9MA 2ZEGA 3HUVA 4R76A 3FF3A 4P4IA 2JEWA 4FUUA 3LWUA 2IQ6A 3DGVA 2NSMA 2PIYA 2AFMA 1BLLE 1ZG9A 4P4FA 5LRKA 3B2YA 4B6ZA 3IC1A 3GB0A 1ELLP 2EK9A 2HB6A 5I4MA 2CF4A 1F2PA 2ZEOA 1PYTB 3IWWA 2V8GA 2OOTA 3GLJA 3D7GA 1Q7LA 2GLFA 2HC9A 3D68A 3D7DA 2IJZA 2V77A 1CP6A 4W9YA 1JQGA 2POKA 2PJ4A 2O53A 4R7MA 3B3VA 5LYIA 3IFEA 4P4JA 4EWTA 1HDQA 5LYDA 1XBUA 3KR4A 2JBJA 3S9LA 2GLJA 1TKFA 4PXDA 3GUXA 4F9VA 2ZEFA 2BCOA 4FBEA 3K9TA 2PJBA 4OC4A 4PXBA 3FEDA 1IGBA 3B35A 3PBBA 3MN8A 4P44A 4R8FA 3KQXA 4ZY0A 1F2OA 3NH5A 1VGYA 2J9AA 4UEZA 3FJUA 3D4UA 3D66A 3PB7X 3PB9X 4NGRA 4NJQA 3DLJA 3H8EA 5JH9A 3B3CA 5IB9A 3RBUA 3SJEA 1DTDA 2AFZA 2C1CA 4O23A 4P4BA 1ZG7A 3KHXA 4MHYA 4PQAA 1F57A 2CTBA 2PVWA 2QVPA 1YW6A 1BAVA 4R6TA 4X8IA 3NFZA 2I3CA 2PJ3A 3L2NA 4NGSA 2ANPA 1YMEA 4ZX8A 3FEEA 3NH8A 2PJAA 4Q7AA 4MHZA 2RB7A 4IK2A 4NGTA 1LCPA 4MCPA 5JM6A 1R43A 3K2KA 1CPXA 2VL1A 1QQ9A 4ZY2A 2GU2A 2PJ6A 3PEIA 4A94A 5HVHA 2ZENA 3ISXA 5K8NA 1ZG8A 2CTCA 2Q4ZA 3IIBA 4P6YA 4OIWA 4DUKA 1CX8A 3KASA 2ZEPA 3HLPA 3CPXA 3CT9A 3WABA 4LQGA 2ZEMA 3KR5A 3H8GA 4YU9A 3ISZA 5LRGA 3PFEA 2QYVA 2RFHA 3D7FA 2PJ2A 4FWUA 4JZ0A 3RAMA 1XMBA 1R3NA 1IY7A 2PJ0A 1BPMA 2AFSA 2C6GA 1TF8A 2JBKA 3PB4X 4NGNA 1TF9A 4OKOA 1LFWA 3KQZA 4X3RA 1KWMA 5K8PA 1HEEA 5LRJA 4F9UA 3KGQA 4A39A 4A38A 2IMOA 4RUHA 4FAIA 3RZAA 4IHMA 1M4LA 2PJ1A 4NGPA 2ZOFA 2C6PA 3IO1A 4NJRA 5HVFA 2OR4A 2ZELA 4OP4A 4MCQA 1EE3P 2EK8A 4MRIA 2ZEEA 1QMUA 1YSJA 3NA6A 4CPAA 1Z2LA 1YLOA 1LAMA 3B3WA 4P10A 3BXMA 1PCAA 5LYFA 4X2TA 2V8VA 1BPNA 5K8MA 4EMEA 4ZX9A 5HVGA 1TXRA 3TX8A 3KI9A 1TKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFD A;  3LMS A;  2ZEH A;  3S9N A;  2PE3 A;  3IEH A;  4TNU A;  4Z65 A;  2V8H A;  2DEA A;  2WYR A;  3B3T A;  2FVG A;  2QJ8 A;  1ZLI A;  3N5F A;  2AFU A;  4OC3 A;  5ELY A;  4UEE A;  2F7V A;  4YWY A;  3KL9 A;  2PRQ A;  5CPA A;  4UIB A;  4OME A;  4WWV A;  3PB8 X;  3NH4 A;  1H8L A;  3V7Z A;  2PIZ A;  3IJ3 A;  4UEF A;  5THW A;  3FMC A;  2XEG A;  3KZW A;  2O4H A;  1VHE A;  7CPA A;  2PJ8 A;  1CP7 A;  2ZOG A;  4PPZ A;  2CIJ A;  4ONW A;  4F8Z A;  3VAT A;  4IAV A;  4OC1 A;  1YW4 A;  3VAR A;  1CPS A;  5DS0 A;  4ZY1 A;  3JRU A;  1ARL A;  4OC2 A;  5J1Q A;  3FEC A;  4PXE A;  1LAP A;  2V8D A;  2BO9 A;  3H8F A;  5JGF A;  3WC6 A;  1HDU A;  4AXV A;  5CBM A;  4ZYQ A;  1Z5R A;  4MCR A;  2C6C A;  4ZI6 A;  5LYL A;  3TC8 A;  3PFO A;  1ELM P;  5D8N A;  4UF4 A;  1TKH A;  1AMP A;  1NSA A;  8CPA A;  3KHZ A;  4TWE A;  1GYT A;  3B3S A;  3T8W A;  2Q51 A;  1FT7 A;  2AFX A;  1VHO A;  5D29 A;  1LAN A;  1UWY A;  5F09 A;  1LOK A;  3FVL A;  4MMO A;  3FX6 A;  2PCU A;  2PJ7 A;  2PJ5 A;  1XRY A;  4MHN A;  3QNV A;  3FH4 A;  2AFW A;  3PB6 X;  3D7H A;  3WC5 A;  1DE4 C;  4MXU A;  4G1P A;  4PXC A;  1XFO A;  1Y7E A;  3WC7 A;  6CPA A;  4JYW A;  2F8H A;  3CDX A;  4P45 A;  4A37 A;  3WT4 A;  3PBE A;  2PJC A;  1Y0Y A;  3SJF A;  3SJG A;  2PJ9 A;  4WJB A;  1CG2 A;  3BI1 A;  2EWB A;  4MHP A;  1RTQ A;  2XEI A;  1ARM A;  4OC5 A;  4KSI A;  1ZLH A;  2ABZ A;  2XEJ A;  3V38 A;  3CPA A;  3VH9 A;  1Z8L A;  3BHX A;  4NGQ A;  3SI0 A;  2XEF A;  3D67 A;  4K3N A;  4DYO A;  2G9D A;  2GRE A;  4OID A;  3SI2 A;  4P4E A;  2BOA A;  2WZN A;  2NYQ A;  1FNO A;  1OBR A;  4NGM A;  3SJX A;  2Q43 A;  3MRU A;  1AYE A;  4MCS A;  4OC0 A;  1VIX A;  5K8O A;  3PRT A;  4BD9 A;  2AFO A;  3B7I A;  3SI1 A;  5HXD A;  3BI0 A;  4DJL A;  1CBX A;  1XJO A;  4UIA A;  4H2K A;  1Y0R A;  4NFR A;  3I1U A;  2ZED A;  4P4D A;  2PVV A;  4GM5 A;  3S9M A;  2ZEG A;  3HUV A;  4R76 A;  3FF3 A;  4P4I A;  2JEW A;  4FUU A;  3LWU A;  2IQ6 A;  3DGV A;  2NSM A;  2PIY A;  2AFM A;  1BLL E;  1ZG9 A;  4P4F A;  5LRK A;  3B2Y A;  4B6Z A;  3IC1 A;  3GB0 A;  1ELL P;  2EK9 A;  2HB6 A;  5I4M A;  2CF4 A;  1F2P A;  2ZEO A;  1PYT B;  3IWW A;  2V8G A;  2OOT A;  3GLJ A;  3D7G A;  1Q7L A;  2GLF A;  2HC9 A;  3D68 A;  3D7D A;  2IJZ A;  2V77 A;  1CP6 A;  4W9Y A;  1JQG A;  2POK A;  2PJ4 A;  2O53 A;  4R7M A;  3B3V A;  5LYI A;  3IFE A;  4P4J A;  4EWT A;  1HDQ A;  5LYD A;  1XBU A;  3KR4 A;  2JBJ A;  3S9L A;  2GLJ A;  1TKF A;  4PXD A;  3GUX A;  4F9V A;  2ZEF A;  2BCO A;  4FBE A;  3K9T A;  2PJB A;  4OC4 A;  4PXB A;  3FED A;  1IGB A;  3B35 A;  3PBB A;  3MN8 A;  4P44 A;  4R8F A;  3KQX A;  4ZY0 A;  1F2O A;  3NH5 A;  1VGY A;  2J9A A;  4UEZ A;  3FJU A;  3D4U A;  3D66 A;  3PB7 X;  3PB9 X;  4NGR A;  4NJQ A;  3DLJ A;  3H8E A;  5JH9 A;  3B3C A;  5IB9 A;  3RBU A;  3SJE A;  1DTD A;  2AFZ A;  2C1C A;  4O23 A;  4P4B A;  1ZG7 A;  3KHX A;  4MHY A;  4PQA A;  1F57 A;  2CTB A;  2PVW A;  2QVP A;  1YW6 A;  1BAV A;  4R6T A;  4X8I A;  3NFZ A;  2I3C A;  2PJ3 A;  3L2N A;  4NGS A;  2ANP A;  1YME A;  4ZX8 A;  3FEE A;  3NH8 A;  2PJA A;  4Q7A A;  4MHZ A;  2RB7 A;  4IK2 A;  4NGT A;  1LCP A;  4MCP A;  5JM6 A;  1R43 A;  3K2K A;  1CPX A;  2VL1 A;  1QQ9 A;  4ZY2 A;  2GU2 A;  2PJ6 A;  3PEI A;  4A94 A;  5HVH A;  2ZEN A;  3ISX A;  5K8N A;  1ZG8 A;  2CTC A;  2Q4Z A;  3IIB A;  4P6Y A;  4OIW A;  4DUK A;  1CX8 A;  3KAS A;  2ZEP A;  3HLP A;  3CPX A;  3CT9 A;  3WAB A;  4LQG A;  2ZEM A;  3KR5 A;  3H8G A;  4YU9 A;  3ISZ A;  5LRG A;  3PFE A;  2QYV A;  2RFH A;  3D7F A;  2PJ2 A;  4FWU A;  4JZ0 A;  3RAM A;  1XMB A;  1R3N A;  1IY7 A;  2PJ0 A;  1BPM A;  2AFS A;  2C6G A;  1TF8 A;  2JBK A;  3PB4 X;  4NGN A;  1TF9 A;  4OKO A;  1LFW A;  3KQZ A;  4X3R A;  1KWM A;  5K8P A;  1HEE A;  5LRJ A;  4F9U A;  3KGQ A;  4A39 A;  4A38 A;  2IMO A;  4RUH A;  4FAI A;  3RZA A;  4IHM A;  1M4L A;  2PJ1 A;  4NGP A;  2ZOF A;  2C6P A;  3IO1 A;  4NJR A;  5HVF A;  2OR4 A;  2ZEL A;  4OP4 A;  4MCQ A;  1EE3 P;  2EK8 A;  4MRI A;  2ZEE A;  1QMU A;  1YSJ A;  3NA6 A;  4CPA A;  1Z2L A;  1YLO A;  1LAM A;  3B3W A;  4P10 A;  3BXM A;  1PCA A;  5LYF A;  4X2T A;  2V8V A;  1BPN A;  5K8M A;  4EME A;  4ZX9 A;  5HVG A;  1TXR A;  3TX8 A;  3KI9 A;  1TKJ A; 
#chains in the Genus database with same CATH topology
 4C68 A;  2PC1 A;  2ZEH A;  2J8M A;  4LX9 A;  3ONU A;  4XOR A;  1MAB A;  2VZL A;  2WYR A;  1JA0 A;  2FVG A;  2ZZG A;  3OZU A;  1BOB A;  1NJI D;  4F0Y A;  1P4N A;  2PIA A;  2VEZ A;  3T9Y A;  2QEC A;  4UA3 A;  3R6J A;  2FT0 A;  4YGO A;  1E79 A;  4OPS A;  2ZXH A;  3WYA A;  4KOR A;  4YXW A;  1CP7 A;  3RYO A;  4YRH A;  3OPO A;  2BL1 A;  3VAT A;  3W5H A;  1FY7 A;  3VAR A;  5DS0 A;  3BH4 A;  3ZIA A;  3D2P A;  1KZF A;  4HNY B;  1VKC A;  4UAJ A;  3CD6 B;  2PRB A;  4MYT A;  1LAP A;  4FD5 A;  3I3G A;  2Q0Y A;  1HDU A;  4AXV A;  2R7H A;  4NXY A;  1OGJ A;  3NE7 A;  2YNC C;  4MCR A;  2ZL6 A;  2P3M A;  5D8N A;  4UF4 A;  4P6V F;  3FPK A;  5FIU A;  1YX2 A;  1NSA A;  3ASS A;  3SJZ A;  8CPA A;  3KHZ A;  1VQK B;  3OOC A;  1VQ8 B;  4ZCI A;  1R57 A;  2R98 A;  2RC4 A;  3GY9 A;  3IU2 A;  1FT7 A;  2BSW A;  5D29 A;  4RD4 A;  1H8E A;  1BJK A;  1LOK A;  1SKQ A;  2PCU A;  2PJ5 A;  3D3S A;  4U9U A;  4L89 A;  2VBT A;  1ELO A;  2RC6 A;  2VNJ A;  2E1R A;  3WC5 A;  4B48 A;  3A9L A;  4M0L A;  4G1P A;  1Y7E A;  3SXO A;  3CDX A;  4KSA A;  3WY9 A;  3SJG A;  3CCE B;  3T90 A;  4JWP A;  4OP7 A;  1NB0 A;  2O28 A;  4RD0 A;  1G7R A;  4MI4 A;  3BI1 A;  4ACB A;  2EWB A;  2GPJ A;  4A33 A;  2B4D B;  2XEI A;  2HCJ B;  4OC5 A;  3I55 B;  2ZPA A;  1YVK A;  3SKB A;  3SLD A;  3CPW B;  3V38 A;  4LBY A;  3VH9 A;  4XON A;  1Z8L A;  4DYO A;  4TMZ A;  2GRE A;  4Z4T A;  4XR6 A;  1YRE A;  1FNO A;  4CGP A;  2BM0 A;  4AG7 A;  1QSM A;  5K8O A;  2AJ6 A;  4XL9 A;  4B12 A;  1UMK A;  2NV4 A;  3B7I A;  3DR8 A;  3CMA B;  4PV6 A;  4II9 A;  4C7H A;  2VJJ A;  4BPR A;  2YGW A;  4H2K A;  1Y0R A;  3LO8 A;  2YWE A;  3SHP A;  3JQR A;  2CW5 A;  1E43 A;  4WQM A;  2X0K A;  3OW2 B;  1J4J A;  4R76 A;  2BPO A;  2GJR A;  4I49 A;  5G20 A;  1Z8W A;  2IQ6 A;  1FDR A;  5AN9 A;  3W5U A;  1E1R A;  1EP1 B;  1S4M A;  1FNM A;  2CF4 A;  1PYT B;  1N07 A;  3IWW A;  1Y9K A;  1BPL A;  2D4P A;  3S6G A;  4A95 A;  2HC9 A;  3D68 A;  2DYI A;  3D7D A;  2ZBU A;  1K73 D;  2Z0Z A;  1T5E A;  2CNS A;  1XBU A;  2OK7 A;  5HZB A;  3OFN A;  3EC4 A;  1TKF A;  4PXD A;  4F9V A;  1HZE A;  3ZPN A;  3K9T A;  3FXT A;  3CZX A;  2BGI A;  4OC4 A;  2OBS A;  2VZZ A;  2LZJ A;  2EFG A;  4C0S A;  3FED A;  4R3K A;  1IGB A;  1VHS A;  3B35 A;  4HNW B;  1KK1 A;  4R8F A;  4ZY0 A;  4Z4Z A;  1V0C A;  1VGY A;  3DDD A;  2VBU A;  3SLN A;  5F49 A;  1YLE A;  3P26 A;  1S3Z A;  3B3C A;  5IB9 A;  2XZL A;  2A4N A;  3CXQ A;  1IJE A;  1OB2 A;  2QA4 B;  4II3 A;  1NBM A;  3CP2 A;  4M2L A;  5GV7 A;  4PQA A;  1TUI A;  1XE1 A;  1E3Z A;  3MGD A;  1I21 A;  4Q38 A;  3OAA A;  3CCM B;  4AVB A;  4KKU A;  1BAV A;  4QUZ A;  2XGJ A;  4KOT A;  3GIR A;  3NFZ A;  3L2N A;  3VNV A;  2X7B A;  1PKV A;  3FEE A;  3WND A;  4OAE A;  4Q7A A;  1S72 B;  1ZM4 A;  5AG4 A;  4MHZ A;  4NGT A;  4KOS A;  3GSI A;  2Z3N A;  2PMD A;  1GHE A;  3JU4 A;  2PJ6 A;  5HVH A;  4MFK A;  5TRD A;  3IIB A;  3OEE A;  4CRZ B;  4G1B A;  1CX8 A;  1W34 A;  1WPC A;  2D3N A;  1YIT B;  4YEJ A;  4AVA A;  5KW9 A;  2HQY A;  1GVH A;  3BNW A;  4NF1 A;  2OTL B;  4UBR A;  4YU9 A;  3W91 A;  4TKO B;  3PFE A;  5HMN A;  2B7B A;  1N0V C;  1FNC A;  4YAF A;  2W6I A;  2IL4 A;  1Q9S A;  1XMB A;  2BUE A;  2F4N A;  1BQE A;  1TTT A;  2C6G A;  2JBK A;  3WBK A;  1TLL A;  3EO4 A;  4NGN A;  3FNC A;  1TF9 A;  4XLC A;  5BWA B;  1DDG A;  4XN3 A;  4OKO A;  1LFW A;  1S7K A;  2PR1 A;  3CMM A;  2ZW7 A;  2VJI A;  3ZBT A;  2F5I A;  3W2H A;  1VQO B;  2FL4 A;  1ZM3 A;  2YNC A;  1HA3 A;  1XE4 A;  1HEE A;  4RDK A;  2XEX A;  2F1M A;  1QX4 A;  4GXH A;  3QAY A;  4B11 A;  1T6X A;  4A38 A;  2IMO A;  2DEU A;  2JJ1 A;  4IHM A;  2PJ1 A;  4NEX A;  2GFQ A;  3H94 A;  2ZOF A;  3H4Q A;  1OB0 A;  5J3O A;  1LRZ A;  4JXQ A;  1S0U A;  1QSR A;  2C5H A;  3Q6Q A;  2I79 A;  1EE3 P;  4MRI A;  3OJX A;  3NA6 A;  4X5K A;  1U6M A;  3G05 A;  4E8O A;  4EH1 A;  4QB9 A;  2VXK A;  1LAM A;  2VQY A;  3B3W A;  5JQ4 A;  2DIE A;  1K28 D;  4X2T A;  1DG1 G;  1G7T A;  1AMO A;  1BPN A;  2PLF A;  1Q82 D;  1FND A;  1S7L A;  3QFS A;  2QDX A;  3KI9 A;  3AGQ A;  2Q04 A;  4X0C A;  3T53 B;  3LMS A;  2WSS A;  5BSX A;  1MJ9 A;  3TOA A;  3S9N A;  4FD7 A;  4F6A A;  3IEH A;  4Z65 A;  1N71 A;  4RM0 A;  3WXM A;  1PJ7 A;  2QJ8 A;  5TY0 A;  1ZLI A;  4PAA A;  2C78 A;  2CK3 A;  4M6G A;  2Y0M A;  3FRM A;  4YWY A;  2C5B A;  3KL9 A;  4UIB A;  2OZU A;  2G0B A;  2M5S A;  3G6E B;  1YJ9 B;  4RDJ A;  4OME A;  3VMF A;  4WWV A;  1EP3 B;  1H8L A;  2PIZ A;  5CNP A;  1Q86 D;  2VYQ A;  3KZW A;  2ZOG A;  3JTK A;  4F8Z A;  3BCF A;  4IAV A;  4Z4R A;  1YW4 A;  1TIQ A;  4OC2 A;  5BSY A;  3VNU A;  4KSF A;  3SXN A;  1PJ5 A;  2QTZ A;  2B5O A;  3OZV A;  3T51 B;  2V8D A;  2BO9 A;  4HKF A;  2C6C A;  3TC8 A;  3A8J A;  4B43 A;  2JDC A;  2B5G B;  1E62 A;  3AST A;  1AMP A;  1WWZ A;  3CCL B;  1PU9 A;  4NCZ A;  4U5Y A;  2C4U A;  4TWE A;  3T8W A;  1M4I A;  1MJB A;  3CXC B;  4FD4 A;  2VNH A;  2ZTG A;  1I1D A;  2AFX A;  1VHO A;  1Q7Y D;  1IIC A;  1UWY A;  5F09 A;  4AF6 A;  4MMO A;  1F60 A;  1Z9U A;  5E96 A;  3BLN A;  5G1Z A;  3OZW A;  3PGP A;  5H86 A;  3DR6 A;  3MCA A;  4PXC A;  4QUS A;  4X7C A;  4N3N A;  3TTH A;  2B58 A;  3Q6R A;  1YGH A;  1K4J A;  2V7V A;  4H9G A;  3Q3A A;  4P45 A;  4MY0 A;  2Q6I A;  1Y0Y A;  5FNZ A;  4PK2 A;  3SJF A;  2PJ9 A;  1YHQ B;  4RD6 A;  1COW A;  2VI7 A;  1Y9W A;  3FB3 A;  1RTQ A;  4HE5 A;  3ZZT A;  4RD1 A;  1FNB A;  1YIJ B;  1IOF A;  1Z8T A;  4RJL A;  4KSI A;  3P2H A;  3TCV A;  2GE3 A;  1VQ7 B;  2CXA A;  2XEJ A;  4RPB A;  2D3L A;  4KUB A;  2B3V A;  1DDI A;  5IYR A;  2P6F A;  3WNC A;  4C2Z A;  2R1I A;  5AGE A;  1QGY A;  4OID A;  3SI2 A;  4P4E A;  2WZN A;  2OYN A;  1ON0 A;  2Q43 A;  3MRU A;  1IHM A;  1FRQ A;  4P25 A;  2NPF A;  1AYE A;  1NB9 A;  1VIX A;  3JQP A;  3TO7 A;  3PRT A;  1VQN B;  1XF8 A;  2GAN A;  2AFO A;  1P4M A;  3BY2 A;  3QFC A;  1JB9 A;  2Z10 A;  2R6H A;  1QG0 A;  3CC2 B;  2ZZQ A;  4OAD A;  1D8T A;  3WQZ A;  1YK3 A;  2J8R A;  2GJP A;  1M4D A;  4OPV A;  4CAX A;  4GM5 A;  3S9M A;  2ZEG A;  5IYN A;  3BJ7 A;  4NNJ A;  4P4I A;  3D8P A;  1OZP A;  2XZP A;  3PP9 A;  3ZJ0 A;  2PQ8 A;  2AFM A;  1WOP A;  2R9V A;  4KKT A;  1VQM B;  4P4F A;  3HAG A;  3GB0 A;  3SJP A;  2HDN B;  1WDT A;  1F2P A;  4M4S A;  5I0C A;  3CC7 B;  2YWH A;  4DNC A;  2OOT A;  4UWI A;  3D7G A;  2X8K A;  1Q7L A;  3B82 A;  3W2E A;  2JIZ A;  1XB2 A;  2OBR A;  4ROX A;  1JQG A;  4R7M A;  3WR7 A;  1CM0 A;  1W2B B;  4EWT A;  5IYW A;  1HDQ A;  3G3S A;  2DCU A;  5A89 A;  4A30 A;  2Q4Y A;  2GLJ A;  1EFT A;  4MJ8 A;  4NBS A;  1RQR A;  2AHO A;  2XNJ A;  1BO4 A;  3V8I A;  4PXB A;  4AVZ A;  4E0F A;  2WZP P;  1BMF A;  1QFJ A;  1B23 P;  1V5V A;  3P2F A;  3CME B;  3CCJ B;  3MN8 A;  3B78 A;  1CNE A;  1D2E A;  1E64 A;  3J81 k;  1F2O A;  2J9A A;  3T56 B;  3D2M A;  3D66 A;  3PB7 X;  4BMH A;  3PB9 X;  4NGR A;  1HVX A;  1QST A;  3W2G A;  4AB7 A;  1R5B A;  3FKS A;  4TT3 A;  4P4B A;  3KHX A;  1YJN B;  1F57 A;  2P6E A;  3TT2 A;  1GO2 A;  4P26 A;  2QEX B;  1YW6 A;  3ES9 A;  1EFU A;  1UD2 A;  4R6T A;  4TMV A;  3GIU A;  2V7T A;  1IOI A;  2ANP A;  2VZY A;  2X6X A;  4F0X A;  4ACA A;  1YME A;  2PJA A;  4KLV A;  3R95 A;  4Y9U A;  4LBV A;  5DSZ A;  1WTH D;  5L46 A;  1B87 A;  1IYL A;  1ZUN B;  4ZY2 A;  1H42 A;  1X10 A;  4QVA A;  3PEI A;  5KTD A;  2I00 A;  3ISX A;  4LUA A;  2Q4Z A;  4P6Y A;  4DUK A;  4CYQ A;  4CQJ A;  2I1L A;  3CPX A;  3S6H A;  3CT9 A;  5KSW B;  3KR5 A;  2BV3 A;  3ZUG A;  4UZF A;  4FD6 A;  3AVW A;  2QYV A;  3TE4 A;  2VNK A;  5J35 A;  4FWU A;  3R6K A;  1VQ9 B;  4A2Z A;  2BEI A;  4UFV A;  5E6T A;  1R3N A;  3AGP A;  1N8R D;  1R5O A;  3MMP A;  4PC3 A;  5LMZ A;  1Q81 D;  2HLD A;  2EO8 A;  3KQZ A;  2X3U A;  5IYP A;  1S60 A;  2B5G A;  4QC6 A;  4PAB A;  4QVT A;  3DNS A;  2HMA A;  1N06 A;  4XNH B;  5EBV A;  4X7D A;  3TFY A;  3D26 A;  2OBT A;  1M4L A;  4DQK A;  5AG5 A;  1P0H A;  2AE6 A;  2ARH A;  1UD3 A;  2C6P A;  3IO1 A;  2OZH A;  5HXB A;  4OP4 A;  4XN0 A;  4MCQ A;  2JLM A;  1VF7 A;  4CGN A;  2C2W A;  2ZEE A;  1QUE A;  4XLH A;  1YLO A;  4Q36 A;  3VWD A;  1BLI A;  1H85 A;  3R96 A;  1S7N A;  3TO6 A;  1KQS B;  5HH1 A;  4KS9 A;  4XLA A;  4KVO E;  3S6F A;  3OW7 A;  1E1Q A;  4QVJ A;  3Q39 A;  1B6B A;  1UD4 A;  2F43 A;  3TX8 A;  1TKJ A;  2NMT A;  4NSQ A;  4B13 A;  1QH0 A;  5H59 A;  2PE3 A;  1B2R A;  3SEJ A;  5FL7 A;  2DEA A;  1K8A D;  4RD3 A;  2WJY A;  3B3T A;  3R1K A;  2WR8 A;  1OB5 A;  1NSL A;  5DWM A;  1IU8 A;  4Z1M A;  4XD7 A;  5F4J A;  5ELY A;  2F7V A;  2PRQ A;  1L0C A;  4CAE A;  4CYN A;  5DWN A;  3PB8 X;  3NH4 A;  3V7Z A;  5H84 A;  4P1V A;  3IJ3 A;  3A8I A;  1WSR A;  5THW A;  1WOO A;  4CAV A;  3AVT A;  2XEG A;  3P27 A;  5FA6 A;  4KLW A;  2Z3P A;  7CPA A;  2PJ8 A;  1SM4 A;  4AVC A;  4PPZ A;  2CIJ A;  4ONW A;  4YHB A;  4A31 A;  4MFZ A;  3LOD A;  1CPS A;  4NCN A;  5J1Q A;  3WNB A;  2GIV A;  4TMW A;  4ZGQ B;  1Q2D A;  1V0E A;  3FEC A;  2Z6B D;  4PXE A;  4UFX A;  1E63 A;  3R9E A;  4R87 A;  3H8F A;  5JGF A;  3WC6 A;  2D9R A;  3CXS A;  4MY3 A;  5FVJ A;  4ZYQ A;  5AG6 A;  4C43 A;  1Z5R A;  2QE7 A;  4ZI6 A;  1I18 A;  4LQ6 A;  1ELM P;  1J9Z A;  4R57 A;  4B3G A;  1JNY A;  4C2X A;  2V31 A;  1QVG B;  4TN1 A;  3QB8 A;  1D1N A;  3B3S A;  3GKR A;  3RNZ A;  3OWC A;  2VBS A;  4RCZ A;  2QMU A;  2Q51 A;  3CB4 A;  5KNL A;  1M44 A;  2X53 S;  4JD6 A;  3FX6 A;  4U9Z A;  2PJ7 A;  3QNV A;  3W6S A;  5GCN A;  3FH4 A;  3KKW A;  3PB6 X;  4AC9 A;  1Q2Y A;  3D7H A;  4B4D A;  4YEL A;  4BIN A;  1DE4 C;  1XFO A;  4PC7 A;  4JYW A;  1R5N A;  4CYO A;  4G7W A;  1W0K A;  2PJC A;  5HKK A;  1A8P A;  4ZGY B;  2QML A;  2F1L A;  4WJB A;  1KTV A;  4UFW A;  3QFT A;  4ZV4 A;  2QTL A;  4FK8 A;  5A88 A;  4MHP A;  3W5V A;  4CYP A;  2PSW A;  2ATR A;  3OJW A;  4DK0 A;  2OU2 A;  1AIP A;  3CW2 A;  2B4D A;  2ABZ A;  2Z3K A;  4FXU A;  3CPA A;  3BHX A;  4NGQ A;  3PVD A;  1VQ5 B;  2XEF A;  4K3N A;  4QV2 A;  1G7S A;  1QSN A;  1M1D A;  1YX0 A;  5F46 A;  4L8J A;  4B5P B;  3WBJ A;  2NYQ A;  1NMT A;  1W0J A;  4NGM A;  3SJX A;  4A32 A;  3GQB A;  4II2 A;  4OC0 A;  3TO9 A;  4G7X A;  4BD9 A;  5KTA A;  3CES A;  1A2Z A;  3SI1 A;  2FIA A;  5HXD A;  3BI0 A;  4DJL A;  4YAO A;  4OOX A;  1XJO A;  3C26 A;  4UIA A;  4L8A A;  3S6K A;  2DER A;  1SQH A;  2C77 A;  4X06 A;  4Z4S A;  3VR6 A;  3GVL A;  1KZL A;  1ZO0 A;  3DSB A;  4YAW A;  2X85 A;  3HUV A;  3FF3 A;  2JEW A;  4FUU A;  5KTC A;  5F47 A;  4KOV A;  5IK2 A;  3DGV A;  1BLL E;  3JQQ A;  1H8H A;  5LRK A;  1ELL P;  2EK9 A;  5I4M A;  1Z4E A;  3V76 A;  1VJS A;  1VQ6 B;  1XQB A;  1RXT A;  5C88 A;  1EXM A;  2V8G A;  1I8D A;  1XEB A;  4H6U A;  4R3L A;  1KJZ A;  2GLF A;  5THX A;  4XPK A;  2ZBV A;  4KKS A;  4W9Y A;  2POK A;  3VO1 A;  2PJ4 A;  4CGO A;  4OLL A;  2O53 A;  3B3V A;  4PC2 A;  5LYI A;  2Z11 A;  2RC5 A;  3RY8 A;  5LYD A;  2EUI A;  5JBQ A;  3GYA A;  3KR4 A;  4B3X A;  4K30 A;  1M4G A;  2JBJ A;  4ORF A;  4KOU A;  5A8A A;  1ZM9 A;  4MYU A;  2OZG A;  2ZEF A;  3GUX A;  4FBE A;  2XND A;  2V7W A;  3H9N A;  4OPO A;  5TV2 A;  4P12 A;  3LQ6 A;  3RO0 A;  4XKW A;  4P44 A;  1KUY A;  3ZZI A;  2PR8 A;  1VLY A;  4J3G A;  4CGM A;  3ASQ A;  5IYQ A;  2ZW6 A;  4UEZ A;  3FJU A;  3D4U A;  2FCK A;  2HV2 A;  5EMI A;  4G1V A;  3H8E A;  4KVM E;  2OH1 A;  3UY5 A;  3H5Z A;  4RLZ A;  1M1K D;  3FJO A;  1VQL B;  4H6Z A;  4MFJ A;  3RBU A;  3SJE A;  1BX1 A;  2ZZF A;  1DTD A;  3CCU B;  4IF5 A;  1M90 D;  4UCP A;  3QSY A;  2XOK A;  4PSW A;  1YR0 A;  2CTB A;  1RO5 A;  2PVW A;  4X05 A;  4DQL A;  4P22 A;  2DF5 A;  4X8I A;  3AVX A;  5J8C A;  2DY1 A;  2V7U A;  2I3C A;  2PJ3 A;  3NH8 A;  2RB7 A;  4XPL A;  1LCP A;  3EY5 A;  1QVF B;  3ONY A;  2ZL7 A;  1R43 A;  3K2K A;  3W6X A;  4XOP A;  2JDI A;  4X7E A;  2ODF A;  2VL1 A;  1QQ9 A;  2V7Q A;  2ZL5 A;  2QGG A;  1VLO A;  3LQE A;  4A94 A;  2W6J A;  4H89 A;  2ZEN A;  5K8N A;  4K1X A;  2CTC A;  2ZTN A;  4IW3 B;  2EVN A;  2DPT A;  4OIW A;  2YWG A;  2OK8 A;  2ZEP A;  3KEW A;  4ZGN B;  3CTA A;  1CNF A;  4LQG A;  3B8H A;  2ZEM A;  2D4O A;  2FIW A;  3H8G A;  2FE7 A;  2V7X A;  4OOS A;  1MRZ A;  5LRG A;  2P6G A;  3BY1 A;  5A28 A;  5A27 A;  1NDH A;  2RFH A;  2FX3 A;  3D7F A;  4KUA A;  2PJ2 A;  2GQF A;  4GQN A;  4M3S A;  1YJW B;  5ISV A;  3F0A A;  3W2I A;  3GVK A;  1BPM A;  2H5M A;  2AFS A;  3A3B A;  4RS2 A;  4WZL A;  3PB4 X;  1QGA A;  1IB0 A;  2ZXV A;  4MFP A;  1T6Z A;  2K5T A;  4ZCL A;  5IB0 A;  4X3R A;  4TMT A;  4HNX B;  1KWM A;  5IV0 A;  3PUN A;  4YFJ A;  2CND A;  1FX0 A;  1KD1 D;  3W2F A;  2EBJ A;  5K8P A;  5TR9 A;  2XZO A;  3CC4 B;  3CCV B;  4F9U A;  4CS0 B;  2C4T A;  2OTJ B;  3KGQ A;  4RN7 A;  4Q7J B;  4FAI A;  1IJF A;  4MFL A;  1VQ4 B;  4NGP A;  4U9Y A;  4NJR A;  1N0U A;  2WJV A;  3IWG A;  5G21 A;  3G8W A;  2EK8 A;  1WOR A;  1YVO A;  1YSJ A;  4CPA A;  4UWJ A;  4AG9 A;  3IGR A;  1CQX A;  4XOT A;  2PDO A;  2C27 A;  4KOY A;  4X7F A;  1IID A;  4DNR B;  5LYF A;  3F5B A;  4KOX A;  2V8V A;  1AUG A;  4UCM A;  5K8M A;  4EME A;  4TMX A;  1S7F A;  2G3T A;  4ZX9 A;  4R9M A;  5HVG A;  4B10 A;  3PZJ A;  5J8F A;  4EFD A;  1N05 A;  1IYK A;  2QN6 A;  4MHD A;  4RPD A;  1JA1 A;  4KVX A;  3U2Q A;  4YAL A;  4TNU A;  2WUU A;  2V8H A;  2JEV A;  1KMH A;  3DDY A;  3ZC3 A;  3N5F A;  1UD5 A;  4B5P A;  2AFU A;  4OC3 A;  4UEE A;  2Q6K A;  5CPA A;  1WU8 A;  4CRY B;  3FBU A;  2WPX A;  2QIR A;  4RCY A;  1BX0 A;  3I1F A;  4UEF A;  3OEH A;  2FSR A;  3E20 A;  3FMC A;  2O4H A;  1VHE A;  2J7K A;  4F7D A;  3QFR A;  2KCW A;  4XKV A;  4OC1 A;  1ZM2 A;  5HZA A;  4ZY1 A;  3JRU A;  1ARL A;  4CGL A;  3GVJ A;  5IX3 A;  2YNE A;  1CJW A;  5EC4 A;  2Q7B A;  3I9S A;  5F48 A;  3A3G A;  1T6Y A;  1YQE A;  2Q6L A;  2VBQ A;  4LBW A;  3PA2 A;  1UD8 A;  5CBM A;  4J0Q A;  4C7I A;  3OKX A;  5LYL A;  3PFO A;  4ZBG A;  4XNH C;  5G22 A;  5FO0 A;  1TKH A;  2JJ2 A;  1GYT A;  4MBU A;  3R9F A;  1XOV A;  3BQJ A;  3A8K A;  2OB0 A;  3ZZ0 A;  1GR1 A;  2DXQ A;  3QE2 A;  4XLF A;  3IWE A;  1LAN A;  1WSV A;  2DET A;  3PA1 A;  3FVL A;  2BGJ A;  1XRY A;  2KVO A;  4MHN A;  1FRN A;  1OHH A;  2EIX A;  2AFW A;  1KK3 A;  2ZXI A;  3LVB A;  3AVV A;  2YND A;  4DNT B;  4XQF A;  4MXU A;  4M6I A;  3V7A A;  4B14 A;  4RD2 A;  6CPA A;  3WC7 A;  2F8H A;  3Q38 A;  3CCQ B;  3WT4 A;  3PBE A;  4A37 A;  3CCR B;  4FWT A;  1N08 A;  3E0K A;  3CRZ A;  3PUM A;  1CG2 A;  2D74 A;  2HUZ A;  4HPS A;  4JXR A;  1EP2 B;  2Q4V A;  4FN5 A;  5C82 A;  2FS5 A;  1ARM A;  1ZLH A;  2BMW A;  4G6I A;  4PGO A;  5F4M A;  1QGZ A;  5F4O A;  3SI0 A;  2B4B A;  3D67 A;  2R8V A;  2G9D A;  2Q7S A;  1XMT A;  4XPD C;  2BOA A;  1OBR A;  3BCD A;  4XLE A;  2JN9 A;  4MCS A;  4PC6 A;  4XPD B;  4N3G A;  3U6K A;  3OP1 A;  4UZU A;  2CNM A;  4HIZ A;  3FIX A;  1CBX A;  3VO2 A;  1KK0 A;  4JLY A;  2REF A;  2G3A A;  3LAC A;  4NFR A;  2J8N A;  1EFC A;  3I1U A;  3CP8 A;  4C2Y A;  2ZED A;  4P3Y A;  4P4D A;  1MJA A;  2PVV A;  4CAW A;  1I7P A;  4UZE A;  3LWU A;  3FPP A;  2NSM A;  2PIY A;  1DAR A;  4CAF A;  2WPW A;  1ZG9 A;  4LBZ A;  4P2N A;  3B2Y A;  4B6Z A;  3IC1 A;  2GK7 A;  2HB6 A;  3QAH A;  2ZEO A;  5GV8 A;  3AVY A;  2ZZE A;  4AF7 A;  4Z4U A;  3CCS B;  4E0A A;  3GLJ A;  3EXN A;  1Y7R A;  4PSX A;  4WZK A;  4LC0 A;  2VBV A;  2IJZ A;  2V77 A;  3IU1 A;  1CP6 A;  4ASU A;  1JJ2 B;  4G5G A;  4M1K A;  1IB1 E;  1QFZ A;  1EFR A;  3IFE A;  4P4J A;  1GAW A;  5AG7 A;  2VNI A;  4TSF A;  3I56 B;  1PUA A;  1I12 A;  2X6Y A;  5DN6 A;  3S9L A;  1WK4 A;  2Q6O A;  4XM3 A;  4OOV A;  5JPH A;  2BCO A;  1KC8 D;  1W35 A;  3NE5 B;  4B5O A;  2PJB A;  2BSA A;  3AVU A;  3MHP A;  1OGI A;  3JVN A;  3LD2 A;  4Z4V A;  3N7Z A;  1KK2 A;  2B3U A;  2DPS A;  4PK3 A;  1NE9 A;  3PBB A;  3TOB A;  2ZW5 A;  3KQX A;  3NH5 A;  4B47 A;  3EFA A;  4RDL A;  4NJQ A;  1Z4R A;  3DLJ A;  4PC1 A;  1WP6 A;  1SKY B;  4EVY A;  4QHY A;  5JH9 A;  2CBX A;  3NE8 A;  1YI2 B;  1MK4 A;  2AFZ A;  4B3F X;  2C1C A;  4O23 A;  1ZG7 A;  4MHY A;  1QSO A;  2BVN A;  1GAQ A;  1NRK A;  1V0F A;  4Y7C A;  2QVP A;  1PJ6 A;  4QFM A;  3A35 A;  4Y9R A;  4M6H A;  3VWE A;  2GJK A;  4NGS A;  1S5K A;  2GK6 A;  4ZX8 A;  1QFY A;  3F8K A;  1F20 A;  3BC9 A;  1UFH A;  3ASP A;  1KUX A;  4IK2 A;  4Z4Y A;  2REE A;  3G4S B;  1E3X A;  4M53 A;  1KUV A;  2B7C A;  4MCP A;  1KRH A;  2CRV A;  2CC2 A;  1WOS A;  5JM6 A;  1X12 A;  2WSA A;  1UD6 A;  2Z3O A;  5CDF A;  1CPX A;  4XMY A;  4XNF A;  2GU2 A;  1G7C A;  2ZIT A;  3OE7 A;  3LNN A;  3E1Y E;  2V4D A;  2WPD A;  4JMQ A;  1ZG8 A;  2Z3L A;  2Z3M A;  4HE6 A;  1GJR A;  1W9X A;  3KAS A;  2YWF A;  3HLP A;  2FXF A;  3WAB A;  5FO1 A;  3ASR A;  3ISZ A;  4X07 A;  4Z4W A;  3ZZU A;  2ZW4 A;  4KZT A;  3U6B A;  2XNC A;  4JZ0 A;  4WZE A;  3PEN A;  1TVC A;  3RAM A;  4P9S A;  2X6W A;  1IY7 A;  2P0W A;  2PJ0 A;  3BJ8 A;  1TF8 A;  3ZBU A;  3FYN A;  1RQP A;  1EWY A;  4ONU A;  1W87 A;  1Z8X A;  4M85 A;  5EMN A;  5B6I A;  2DOG A;  4QBJ A;  4ZCM A;  3K9U A;  2BM1 A;  4UCN A;  5LRJ A;  4P3I A;  1Q2C A;  2CNT A;  4KOW A;  2BN4 A;  2BF4 A;  4A39 A;  2Q44 A;  4RUH A;  3RZA A;  4MFQ A;  4R71 A;  3G71 B;  2JDD A;  4BBH A;  4GS4 A;  5HVF A;  4WZT A;  2OR4 A;  1U2R A;  4B44 A;  2ZEL A;  1JWQ A;  4IUS A;  3A1P A;  1K9M D;  1QMU A;  4YAU A;  5H5J A;  2E1B A;  4Y49 C;  4RI1 A;  1Z2L A;  1VQP B;  4P10 A;  2CY2 A;  4Y49 B;  3BXM A;  1PCA A;  3B8G A;  3R9G A;  3JUW A;  3CXP A;  1XIX A;  4JJX A;  1QUF A;  1TXR A;  4E2A A;  4DK1 A; 
#chains in the Genus database with same CATH homology
 4EFD A;  3LMS A;  2ZEH A;  3S9N A;  2PE3 A;  3IEH A;  4TNU A;  4Z65 A;  2V8H A;  2DEA A;  2WYR A;  3B3T A;  2FVG A;  2QJ8 A;  1ZLI A;  3N5F A;  2AFU A;  4OC3 A;  5ELY A;  4UEE A;  2F7V A;  4YWY A;  3KL9 A;  2PRQ A;  5CPA A;  4UIB A;  4OME A;  4WWV A;  3PB8 X;  3NH4 A;  1H8L A;  3V7Z A;  2PIZ A;  3IJ3 A;  4UEF A;  5THW A;  3FMC A;  2XEG A;  3KZW A;  2O4H A;  1VHE A;  7CPA A;  2PJ8 A;  1CP7 A;  2ZOG A;  4PPZ A;  2CIJ A;  4ONW A;  4F8Z A;  3VAT A;  4IAV A;  4OC1 A;  1YW4 A;  3VAR A;  1CPS A;  5DS0 A;  4ZY1 A;  3JRU A;  1ARL A;  4OC2 A;  5J1Q A;  3FEC A;  4PXE A;  1LAP A;  2V8D A;  2BO9 A;  3H8F A;  5JGF A;  3WC6 A;  1HDU A;  4AXV A;  5CBM A;  4ZYQ A;  1Z5R A;  4MCR A;  2C6C A;  4ZI6 A;  5LYL A;  3TC8 A;  3PFO A;  1ELM P;  5D8N A;  4UF4 A;  1TKH A;  1AMP A;  1NSA A;  8CPA A;  3KHZ A;  4TWE A;  1GYT A;  3B3S A;  3T8W A;  2Q51 A;  1FT7 A;  2AFX A;  1VHO A;  5D29 A;  1LAN A;  1UWY A;  5F09 A;  1LOK A;  3FVL A;  4MMO A;  3FX6 A;  2PCU A;  2PJ7 A;  2PJ5 A;  1XRY A;  4MHN A;  3QNV A;  3FH4 A;  2AFW A;  3PB6 X;  3D7H A;  3WC5 A;  1DE4 C;  4MXU A;  4G1P A;  4PXC A;  1XFO A;  1Y7E A;  3WC7 A;  6CPA A;  4JYW A;  2F8H A;  3CDX A;  4P45 A;  4A37 A;  3WT4 A;  3PBE A;  2PJC A;  1Y0Y A;  3SJF A;  3SJG A;  2PJ9 A;  4WJB A;  1CG2 A;  3BI1 A;  2EWB A;  4MHP A;  1RTQ A;  2XEI A;  1ARM A;  4OC5 A;  4KSI A;  1ZLH A;  2ABZ A;  2XEJ A;  3V38 A;  3CPA A;  3VH9 A;  1Z8L A;  3BHX A;  4NGQ A;  3SI0 A;  2XEF A;  3D67 A;  4K3N A;  4DYO A;  2G9D A;  2GRE A;  4OID A;  3SI2 A;  4P4E A;  2BOA A;  2WZN A;  2NYQ A;  1FNO A;  1OBR A;  4NGM A;  3SJX A;  2Q43 A;  3MRU A;  1AYE A;  4MCS A;  4OC0 A;  1VIX A;  5K8O A;  3PRT A;  4BD9 A;  2AFO A;  3B7I A;  3SI1 A;  5HXD A;  3BI0 A;  4DJL A;  1CBX A;  1XJO A;  4UIA A;  4H2K A;  1Y0R A;  4NFR A;  3I1U A;  2ZED A;  4P4D A;  2PVV A;  4GM5 A;  3S9M A;  2ZEG A;  3HUV A;  4R76 A;  3FF3 A;  4P4I A;  2JEW A;  4FUU A;  3LWU A;  2IQ6 A;  3DGV A;  2NSM A;  2PIY A;  2AFM A;  1BLL E;  1ZG9 A;  4P4F A;  5LRK A;  3B2Y A;  4B6Z A;  3IC1 A;  3GB0 A;  1ELL P;  2EK9 A;  2HB6 A;  5I4M A;  2CF4 A;  1F2P A;  2ZEO A;  1PYT B;  3IWW A;  2V8G A;  2OOT A;  3GLJ A;  3D7G A;  1Q7L A;  2GLF A;  2HC9 A;  3D68 A;  3D7D A;  2IJZ A;  2V77 A;  1CP6 A;  4W9Y A;  1JQG A;  2POK A;  2PJ4 A;  2O53 A;  4R7M A;  3B3V A;  5LYI A;  3IFE A;  4P4J A;  4EWT A;  1HDQ A;  5LYD A;  1XBU A;  3KR4 A;  2JBJ A;  3S9L A;  2GLJ A;  1TKF A;  4PXD A;  3GUX A;  4F9V A;  2ZEF A;  2BCO A;  4FBE A;  3K9T A;  2PJB A;  4OC4 A;  4PXB A;  3FED A;  1IGB A;  3B35 A;  3PBB A;  3MN8 A;  4P44 A;  4R8F A;  3KQX A;  4ZY0 A;  1F2O A;  3NH5 A;  1VGY A;  2J9A A;  4UEZ A;  3FJU A;  3D4U A;  3D66 A;  3PB7 X;  3PB9 X;  4NGR A;  4NJQ A;  3DLJ A;  3H8E A;  5JH9 A;  3B3C A;  5IB9 A;  3RBU A;  3SJE A;  1DTD A;  2AFZ A;  2C1C A;  4O23 A;  4P4B A;  1ZG7 A;  3KHX A;  4MHY A;  4PQA A;  1F57 A;  2CTB A;  2PVW A;  2QVP A;  1YW6 A;  1BAV A;  4R6T A;  4X8I A;  3NFZ A;  2I3C A;  2PJ3 A;  3L2N A;  4NGS A;  2ANP A;  1YME A;  4ZX8 A;  3FEE A;  3NH8 A;  2PJA A;  4Q7A A;  4MHZ A;  2RB7 A;  4IK2 A;  4NGT A;  1LCP A;  4MCP A;  5JM6 A;  1R43 A;  3K2K A;  1CPX A;  2VL1 A;  1QQ9 A;  4ZY2 A;  2GU2 A;  2PJ6 A;  3PEI A;  4A94 A;  5HVH A;  2ZEN A;  3ISX A;  5K8N A;  1ZG8 A;  2CTC A;  2Q4Z A;  3IIB A;  4P6Y A;  4OIW A;  4DUK A;  1CX8 A;  3KAS A;  2ZEP A;  3HLP A;  3CPX A;  3CT9 A;  3WAB A;  4LQG A;  2ZEM A;  3KR5 A;  3H8G A;  4YU9 A;  3ISZ A;  5LRG A;  3PFE A;  2QYV A;  2RFH A;  3D7F A;  2PJ2 A;  4FWU A;  4JZ0 A;  3RAM A;  1XMB A;  1R3N A;  1IY7 A;  2PJ0 A;  1BPM A;  2AFS A;  2C6G A;  1TF8 A;  2JBK A;  3PB4 X;  4NGN A;  1TF9 A;  4OKO A;  1LFW A;  3KQZ A;  4X3R A;  1KWM A;  5K8P A;  1HEE A;  5LRJ A;  4F9U A;  3KGQ A;  4A39 A;  4A38 A;  2IMO A;  4RUH A;  4FAI A;  3RZA A;  4IHM A;  1M4L A;  2PJ1 A;  4NGP A;  2ZOF A;  2C6P A;  3IO1 A;  4NJR A;  5HVF A;  2OR4 A;  2ZEL A;  4OP4 A;  4MCQ A;  1EE3 P;  2EK8 A;  4MRI A;  2ZEE A;  1QMU A;  1YSJ A;  3NA6 A;  4CPA A;  1Z2L A;  1YLO A;  1LAM A;  3B3W A;  4P10 A;  3BXM A;  1PCA A;  5LYF A;  4X2T A;  2V8V A;  1BPN A;  5K8M A;  4EME A;  4ZX9 A;  5HVG A;  1TXR A;  3TX8 A;  3KI9 A;  1TKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...