4P6YA

Crystal structure of the m42 aminopeptidase tmpep1050 from thermotoga maritima
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Crystal structure of the M42 aminopeptidase TmPep1050 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4p6yA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p6yA01
3RBUA 5LRJA 1H8LA 4OP4A 1TKFA 1RTQA 5LYIA 3CPXA 2DEAA 4DYOA 2Q51A 2AFXA 1FNOA 5LRGA 6CPAA 1DE4C 2PIYA 4R6TA 3D68A 1EE3P 2J9AA 4UEZA 3B3VA 4FUUA 2XEIA 1ZG9A 4NGPA 3NH8A 8CPAA 3B3TA 5LYDA 4GM5A 4MMOA 4ZX9A 3KASA 3IFEA 2ZEPA 2IMOA 1OBRA 3TC8A 2OOTA 3VH9A 3KL9A 4A38A 5THWA 5K8NA 1TF9A 4G1PA 3B3SA 4WWVA 5DS0A 2JBKA 2CF4A 2C6GA 2POKA 2CTBA 3IC1A 4BD9A 3H8EA 3D66A 1M4LA 1LOKA 2PVWA 5K8PA 4P45A 3D7HA 3B3WA 4X2TA 3KR5A 5LYLA 4PXDA 4A37A 4P4BA 1CPSA 3SI1A 3GUXA 2ZOGA 1ELMP 1QQ9A 1CP7A 3D7FA 3L2NA 3BI1A 4CPAA 1XMBA 4OKOA 7CPAA 1AYEA 4MCRA 1LAPA 3ISZA 4MCQA 3VATA 3MRUA 4JYWA 2BCOA 3FMCA 4IHMA 5HVHA 5HXDA 2PJ9A 4F9VA 2PVVA 1HDQA 2XEJA 4MHYA 1VHEA 4NGRA 3GLJA 4R76A 2AFWA 2V77A 1LFWA 2V8HA 3WC6A 1YW6A 1HDUA 2EK8A 2ZENA 3NH5A 2HC9A 3B3CA 3HUVA 3PEIA 3IO1A 3WT4A 2QVPA 2Q4ZA 2RB7A 3KR4A 4MCSA 2AFUA 4OMEA 1JQGA 3LMSA 4P10A 1TXRA 3B2YA 2AFMA 4OC3A 3CT9A 2PJ0A 3PFEA 3SJGA 2EWBA 3K9TA 1NSAA 4EWTA 1TF8A 2RFHA 4MHNA 5JGFA 2PJ2A 2C1CA 1ZG7A 4FBEA 5CBMA 3IJ3A 3DLJA 4MHPA 2HB6A 2GLFA 4UIAA 3NA6A 3NFZA 3WC7A 4JZ0A 3FVLA 3IWWA 3PRTA 1BAVA 3GB0A 3SJXA 4UEEA 4FWUA 3BHXA 4RUHA 1LAMA 1Q7LA 3SJFA 2PJ6A 4R7MA 4OC0A 2GU2A 3QNVA 2JBJA 5HVFA 1CPXA 4Z65A 3I1UA 3FF3A 1F57A 3PB6X 3RAMA 1AMPA 5K8OA 2QYVA 4P4IA 4B6ZA 2AFZA 2ZEEA 3FEDA 1R43A 2V8GA 2AFOA 3K2KA 4MCPA 3PBBA 1XBUA 3JRUA 4PPZA 4PXEA 5K8MA 4Q7AA 3V38A 4YWYA 2GREA 2ZOFA 4NGQA 4UIBA 2ABZA 4DUKA 3RZAA 4X8IA 2AFSA 1IGBA 4PXBA 4WJBA 3KI9A 2PJBA 4NGMA 2ZEGA 2JEWA 5I4MA 5ELYA 4P6YA 2CTCA 4X3RA 3D7DA 2WZNA 2ZEMA 2ZEHA 2ZEOA 5F09A 4OIWA 4H2KA 3SJEA 3FH4A 1ZLHA 2VL1A 1ARLA 3KZWA 2PJCA 1UWYA 1CX8A 1Y7EA 3FEEA 5D8NA 2PJ4A 2C6CA 2GLJA 4W9YA 1LCPA 3N5FA 4FAIA 2CIJA 4ZYQA 2PJ8A 2I3CA 4UF4A 4NGNA 4A94A 4PQAA 2PJ1A 3KQXA 2PJAA 2XEGA 3PB9X 1IY7A 4TNUA 4MHZA 5JM6A 4MRIA 3PFOA 1VHOA 4NGTA 3V7ZA 3PB4X 2QJ8A 2PE3A 5LYFA 4F8ZA 3WABA 2PIZA 4NJRA 3FJUA 4TWEA 1TKHA 2NYQA 2C6PA 2BOAA 4LQGA 2WYRA 4IK2A 4ZY1A 3T8WA 3SI2A 1BPNA 1R3NA 1FT7A 4NGSA 5IB9A 2IJZA 4MXUA 1BPMA 4P4FA 4DJLA 3WC5A 3TX8A 1CP6A 1XFOA 2XEFA 3KQZA 2ZEDA 3PBEA 1YSJA 3B7IA 1ZLIA 2Q43A 3PB8X 4P4JA 1LANA 1Z8LA 2O53A 1CG2A 1YMEA 3VARA 4IAVA 2PJ7A 4YU9A 3BXMA 3PB7X 3FX6A 4ZX8A 4AXVA 3H8GA 3IEHA 4OC5A 3HLPA 2F8HA 2PJ3A 3D7GA 2ZEFA 1TKJA 4OIDA 3SI0A 1ZG8A 2V8VA 1PCAA 5CPAA 3KGQA 5J1QA 2OR4A 1CBXA 3BI0A 3H8FA 4P4EA 4UEFA 2PJ5A 4F9UA 5JH9A 1VIXA 4OC1A 3B35A 2PRQA 4A39A 1ARMA 1YW4A 3IIBA 3KHZA 3CDXA 1KWMA 1XJOA 2G9DA 5HVGA 4ONWA 5D29A 3D4UA 1XRYA 4ZY2A 4ZY0A 2PCUA 4K3NA 2IQ6A 5LRKA 1BLLE 1F2PA 1QMUA 4EMEA 3S9LA 4PXCA 3S9MA 1F2OA 2F7VA 1PYTB 2O4HA 3MN8A 1Z2LA 4ZI6A 1GYTA 3S9NA 4EFDA 3KHXA 1Y0RA 1HEEA 2NSMA 2EK9A 3CPAA 4P44A 2FVGA 1VGYA 4O23A 4OC2A 4KSIA 3DGVA 2BO9A 4P4DA 4NFRA 3ISXA 4NJQA 3D67A 1Z5RA 4R8FA 4OC4A 3NH4A 3FECA 2V8DA 2ZELA 1Y0YA 2ANPA 1ELLP 3LWUA 1DTDA 1YLOA
chains in the Genus database with same CATH superfamily
1KK2A 3CC4B 2PR8A 3GVLA 1NBMA 1HVXA 3GIUA 3VMFA 3OZVA 2J8RA 2XZOA 2VXKA 2B4BA 1RTQA 1I12A 4OADA 4G1BA 1X10A 1AMOA 3CCEB 1IJFA 4CRZB 1CM0A 2ZBVA 2BUEA 4KLVA 4MY3A 5LRGA 1QVGB 4KVOE 2J9AA 3B3VA 3DDDA 4ASUA 2XEIA 3W2IA 1YK3A 4NGPA 3QAHA 4MFKA 2OH1A 8CPAA 3OE7A 3ASSA 1KZLA 4RN7A 1FNBA 1OGJA 1YQEA 2EIXA 3IFEA 3IU1A 4XLAA 1T6YA 3ASPA 3CCUB 1NMTA 1OBRA 2QIRA 2P6FA 4IUSA 1MK4A 5K8NA 4G1PA 1T6ZA 4TMTA 2VBVA 4WWVA 5DS0A 3B3SA 5GCNA 2JBKA 1KMHA 2QMLA 4EH1A 4P6VF 4II3A 3CCRB 3IC1A 4JWPA 3S6KA 1S7KA 2VJIA 4ACAA 1H8HA 1KD1D 4Y7CA 1VLYA 3ONUA 1E63A 4P45A 4P12A 4X2TA 4PXDA 2C2WA 4C68A 2ZOGA 3GVKA 1VQKB 2Q7BA 3LNNA 3DNSA 1Z9UA 2VBUA 3FPPA 3HAGA 2ZZEA 1M4IA 3PZJA 4PC2A 2WZPP 3CC7B 5FO1A 3MHPA 4MCRA 4WZEA 5A28A 2XNCA 2Q6OA 2V4DA 2D3LA 1MABA 2PJ9A 3WY9A 4DK1A 4X5KA 2AHOA 2D4OA 3ASRA 4XL9A 3GLJA 4R76A 5TV2A 2AFWA 1FNCA 2V8HA 3T90A 3R6KA 4UWIA 1YW6A 5G20A 3F5BA 5J3OA 2ZENA 1WOPA 3B3CA 4KVME 1FNDA 4RM0A 2Q4ZA 2BSAA 4G1VA 1QSMA 4MCSA 4UWJA 1RXTA 4WZLA 2BN4A 4X05A 1DDGA 4JXRA 4RCZA 2GK7A 2V7UA 2E1RA 3PFEA 3SJGA 4QVJA 1B6BA 2HUZA 3ZZUA 4EWTA 1VJSA 4LQ6A 4K30A 5H84A 2C1CA 1ZG7A 4FBEA 4ZV4A 5CBMA 1S3ZA 4CAWA 4TKOB 2GLFA 2ZW4A 2ZZFA 3NA6A 4P26A 3FPKA 4KKSA 4X06A 2GQFA 1RO5A 3FVLA 4JXQA 3IWGA 4M6IA 3PRTA 3DDYA 1BAVA 4KS9A 3SJXA 2PR1A 3OOCA 4L89A 3A3BA 3WNDA 4ORFA 4RUHA 1S7LA 4OC0A 3W2HA 4XLFA 3CXCB 3QNVA 1Q9SA 4N3NA 4KOVA 2QMUA 2XNJA 1M90D 3LQEA 5HKKA 1N8RD 4XPKA 3FB3A 3FF3A 1F57A 1Q7YD 3PB6X 3JQPA 1AMPA 3LD2A 4P4IA 1P0HA 1XB2A 1R43A 2Q7SA 4NBSA 2AFOA 2V8GA 2C4UA 2C5HA 2KVOA 3JRUA 4PXEA 3AVTA 5K8MA 3OZWA 3BJ8A 3SJPA 3ASTA 4F7DA 1YJWB 1IIDA 1OGIA 4WQMA 4UBRA 2JN9A 4CYOA 2JEWA 2OBTA 5ELYA 4B5PA 4P6YA 2V7VA 4X3RA 4BPRA 1K4JA 4Z4TA 3W5UA 4KSAA 2X7BA 4QVTA 2ZW7A 2GPJA 4H2KA 4AB7A 4ZGQB 4PAAA 3SJEA 3FH4A 5BWAB 1CQXA 2PIAA 2CNTA 1ARLA 1E3XA 2C5BA 1WSRA 1WU8A 1Z4EA 3KZWA 1UWYA 2OZHA 1Y7EA 5F47A 2W6JA 4LX9A 2GLJA 1EFTA 2B4DA 3N5FA 2CIJA 4AC9A 2PJ8A 1BX0A 3ZIAA 4II9A 4LBVA 2PJAA 2F5IA 3TCVA 3P27A 2B58A 3R9EA 3PB9X 2BVNA 5JM6A 4MRIA 3PFOA 1E62A 4U9UA 4MFPA 3V7ZA 1VF7A 4AVBA 3JQQA 3FRMA 3H5ZA 3LQ6A 2PIZA 3SLDA 2FXFA 3QSYA 3CD6B 3T8WA 3SI2A 2BV3A 2X6WA 1BPNA 3B8GA 1Q81D 5DSZA 4NGSA 2Z3OA 4CAVA 5IYRA 2ZL7A 5IB9A 3LVBA 4MXUA 1UD6A 2WR8A 3WC5A 4GS4A 5EBVA 2PSWA 4AVCA 1N0VC 3E1YE 2XOKA 5IYNA 3WQZA 3B7IA 1KUYA 4P4JA 1NB0A 3PA1A 1Q82D 1Z8LA 1CG2A 1ON0A 3A9LA 3CTAA 4CGOA 1Z4RA 3VWDA 1HZEA 3FX6A 4AXVA 4C0SA 2F8HA 2PJ3A 4KOTA 4C2YA 3JQRA 3PUNA 5KNLA 1SQHA 1TTTA 3B78A 1ZG8A 1QUEA 4EVYA 4IF5A 1YJNB 4CYNA 4OOVA 2YWGA 1UD2A 3CCQB 3KGQA 3QFRA 4PK2A 3H8FA 4YAUA 3ZZTA 4XN3A 1EP2B 1XEBA 2PJ5A 3ZPNA 3CW2A 3FKSA 3QFTA 4A39A 5F4JA 1FNMA 1ARMA 2XNDA 3ES9A 2FS5A 1RQPA 1F60A 1KUXA 1YW4A 4IW3B 4PV6A 3CDXA 4FD6A 1KUVA 5D29A 3D4UA 4ZY2A 2PQ8A 1IOIA 3CCVB 4YXWA 1TVCA 3S6HA 3V8IA 4RD1A 1BLLE 2DF5A 5LRKA 1QMUA 1V0CA 3S9LA 4P22A 2DEUA 1R57A 1ZM9A 1RQRA 3IU2A 1I21A 2F7VA 2ZXIA 3TFYA 2O4HA 5DWMA 1N0UA 5E6TA 1Z2LA 5E96A 3VNUA 1COWA 1Y7RA 3S6GA 4G5GA 2NSMA 5HMNA 4CRYB 1VGYA 1TUIA 1A8PA 1H8EA 3DGVA 4NFRA 4RPDA 1LRZA 3TE4A 4OC4A 4ZCLA 3FECA 2V8DA 3CP2A 3OP1A 1ELLP 3LWUA 1DTDA 3B8HA 3R1KA 1YLOA 3GYAA 2CXAA 5LRJA 5BSXA 2FT0A 5G21A 3NE7A 4ZCMA 3GQBA 1TKFA 1EP1B 5LYIA 4G6IA 1PUAA 4DYOA 3OWCA 2ATRA 3CXPA 1EXMA 3JU4A 2GJPA 1FNOA 6CPAA 3QB8A 1N05A 4R6TA 4UEZA 1EE3P 4XPDC 2ZTNA 4FUUA 3A8KA 5A8AA 1CJWA 3BC9A 3R9GA 2FE7A 1Q2YA 4JJXA 2WPWA 2QGGA 4A32A 1R5OA 3TT2A 3U6KA 4M53A 1W0KA 3FNCA 2DIEA 3VH9A 2BEIA 5A89A 5FO0A 4NSQA 1EFCA 3CESA 4XR6A 4KOUA 1QSNA 2CF4A 2JDCA 1IYKA 3LO8A 1OHHA 3R9FA 3IGRA 1UFHA 1JA1A 1KZFA 5GV8A 4P3YA 1D2EA 1Q2CA 4OP7A 2YWEA 1OB0A 3H8EA 2WJYA 1PJ7A 2PVWA 5F48A 3D7HA 1W0JA 2R8VA 2C78A 2Q6LA 3W2GA 2R6HA 5LYLA 4A37A 1BPLA 5THXA 5F49A 4XNHC 3SI1A 1QQ9A 4RD0A 1S7NA 5KSWB 3BI1A 4BMHA 1N08A 1VLOA 4II2A 4RD3A 1LAPA 4MCQA 3MRUA 4JYWA 2BCOA 4MHDA 1D8TA 1QGYA 2QEXB 3EC4A 4XLEA 5HVHA 4Y49B 2PVVA 5J35A 1HDQA 4Z4YA 3FIXA 4P1VA 5AG4A 3G05A 3G4SB 1DG1G 1VKCA 2CK3A 5IV0A 2OK7A 1WK4A 4OMEA 1JQGA 4QVAA 3LMSA 4YGOA 1TXRA 2B5GA 2AFMA 4OC3A 1WDTA 4B4DA 2OU2A 3K9TA 1JWQA 2I79A 1V0FA 2Z11A 2RC5A 1VQ9B 1QGZA 4JLYA 4KOWA 3TTHA 3P26A 3IJ3A 2HB6A 3G3SA 4QB9A 4KKUA 2ZXHA 4MFJA 3PP9A 1NDHA 5HZBA 4AVZA 4UEEA 3BHXA 3W5VA 2V7QA 4HIZA 4PC7A 3Q3AA 4QBJA 1BJKA 3V76A 4CQJA 4K1XA 2JBJA 1BOBA 2VBQA 2OTJB 4HE5A 3I1UA 4DQKA 5K8OA 2HMAA 1CNEA 4B3FX 2ZEEA 2JDDA 2CW5A 2VNKA 3K2KA 2ZTGA 4RJLA 1YGHA 2X3UA 1XBUA 4B10A 1W9XA 2P0WA 3W6XA 2FIWA 3SKBA 4AG9A 4UCNA 2Z3LA 3IWEA 2AFSA 4PXBA 4WJBA 3KI9A 2HDNB 1W35A 4R9MA 2E1BA 2PJBA 5I4MA 3T53B 3R96A 2CTCA 3D7DA 4X7FA 4UFWA 2ZEMA 4UA3A 4XMYA 1MJAA 2EO8A 1WORA 4OIWA 1DARA 4ZGNB 3T9YA 3NE5B 1R5BA 3VO2A 1KRHA 4XONA 4C2XA 1QSRA 3S6FA 3MCAA 4HPSA 5DWNA 3D26A 4LUAA 4OPVA 3FEEA 5D8NA 5C88A 3QFSA 4TMXA 4XKVA 4X7CA 4MFZA 2JJ1A 4A94A 2B7CA 1Y9KA 3F0AA 2PJ1A 2VYQA 2BGJA 3KQXA 3ASQA 2XEGA 1S7FA 4Y9RA 1IY7A 5A88A 2RC4A 2Y0MA 2XZPA 1D1NA 4RPBA 4OLLA 1VHOA 1K8AD 5FVJA 4ZCIA 4NGTA 4TN1A 2QJ8A 5EMNA 4NCNA 1ZM2A 1VQLB 5AG6A 2ARHA 3WABA 2OZUA 4N3GA 3RO0A 3DSBA 2Z0ZA 4GXHA 4Z4VA 2WYRA 4LQGA 2GK6A 3Q6QA 2NV4A 3PGPA 2VBTA 3E0KA 4YEJA 2B3VA 3W2FA 4LBWA 3KQZA 2YWFA 3Q38A 1P4NA 3PBEA 1YSJA 2Z10A 1QSTA 4KLWA 4DNRB 2D4PA 1PJ6A 1IU8A 2Q43A 4NXYA 1LANA 1CNFA 3CB4A 3SLNA 1YMEA 5IK2A 3WBJA 2QA4B 2WSAA 3N7ZA 4JMQA 4YU9A 4PSWA 1M4DA 2DY1A 3D7GA 2C77A 4QHYA 3QAYA 4DNCA 2ZEFA 2OBRA 1NE9A 2V8VA 4AF6A 3G8WA 3OEEA 2OR4A 1CBXA 2Z6BD 2DOGA 1VQPB 4F9UA 1VIXA 5H86A 4PGOA 5A27A 4C7IA 2V31A 4HE6A 3QFCA 2B5OA 4FWTA 4P2NA 3AVVA 4Q36A 4PC3A 1XMTA 4UZUA 4RLZA 3AGPA 1XRYA 4Z4UA 2VNIA 5JPHA 4K3NA 2VQYA 4RD4A 4CAFA 2VNJA 3R95A 1F2PA 2FCKA 3VO1A 4EMEA 2BF4A 4PXCA 3KEWA 4B11A 3CP8A 5BSYA 2CNDA 3S9MA 1VQ4B 1PYTB 3I56B 4RDLA 2IL4A 4EFDA 3JUWA 3KHXA 4DNTB 2EK9A 1B2RA 1GAWA 2X8KA 2B5GB 1N71A 2X0KA 3I55B 4UZEA 1YI2B 3I3GA 4QV2A 1H42A 5KW9A 2Q44A 3BH4A 4NJQA 3NH4A 3OW2B 4E0AA 2W6IA 1KC8D 3NE8A 4QUSA 4CYQA 2P6EA 1N07A 4OP4A 1E3ZA 4OPOA 5KTCA 1I1DA 2QE7A 5F4MA 4PC1A 3KKWA 2AFXA 4LC0A 2BL1A 2D74A 1DE4C 2PIYA 3D68A 1E1QA 4L8JA 3AGQA 1YR0A 1VQ5B 2V7XA 2ZL5A 4OAEA 3NH8A 2QTZA 4CAEA 5JQ4A 3B3TA 4GM5A 4MMOA 1VQNB 1J9ZA 5H5JA 1E1RA 2X53S 2ZEPA 2O28A 1I18A 2NMTA 3SHPA 1QH0A 4X07A 3RYOA 2OOTA 3KL9A 4A38A 1F20A 2YNCA 2BGIA 4R71A 2POKA 3TOBA 2OK8A 1QVFB 3T56B 4JD6A 2QTLA 2GANA 2JEVA 4BD9A 1Q2DA 3D66A 4M2LA 2DETA 1LOKA 3B3WA 3KR5A 1ZUNB 2WPDA 4P4BA 1CPSA 1ELMP 1CP7A 4RD6A 3D3SA 5FNZA 4Z1MA 4QC6A 3VWEA 1WTHD 3VR6A 2Q6KA 7CPAA 1AYEA 3ISZA 4KUBA 3FMCA 5L46A 2VZZA 5HXDA 3BJ7A 4F9VA 3CCSB 4MYTA 2BSWA 4A31A 1YHQB 4MHYA 1VHEA 2OYNA 1JJ2B 4NGRA 2X6YA 2EBJA 4UCMA 1LFWA 1W34A 1HDUA 4B3XA 4HNYB 5LMZA 3NH5A 3HUVA 1M1DA 2QVPA 4DQLA 1T6XA 4TMVA 2AJ6A 3KR4A 4J3GA 4KOYA 2AFUA 3ZJ0A 1XQBA 2QN6A 4LBZA 3W2EA 3JVNA 3BLNA 4CGNA 3CT9A 2PJ0A 1UD4A 3B82A 2WSSA 5AG5A 4M1KA 4HNXB 1NSAA 3Q6RA 4FD4A 5HZAA 1UMKA 3PUMA 4TMZA 4KORA 5CDFA 2DYIA 5JGFA 4P3IA 4MYUA 1AIPA 3G71B 2ZZGA 3DLJA 4MHPA 2CBXA 1TLLA 3NFZA 3WC7A 4P25A 1QX4A 4MFLA 5TY0A 3IWWA 2PDOA 1QGAA 4XN0A 3GB0A 4XNFA 4FWUA 3ZUGA 1PU9A 3MGDA 1QFZA 2DCUA 1KTVA 1Q7LA 2LZJA 4RI1A 3WR7A 4R7MA 2C4TA 3G6EB 1WWZA 5HVFA 4FD7A 3EFAA 3WBKA 3RY8A 4CYPA 4BINA 4PABA 3RAMA 4XLHA 2QYVA 3CRZA 4B6ZA 4RCYA 1PKVA 4MCPA 4M85A 1YLEA 4M4SA 4PPZA 3V38A 1QUFA 1E64A 2ZOFA 1K73D 5C82A 3GSIA 4RD2A 5FL7A 2P3MA 4X8IA 1Z8TA 3TO6A 4AF7A 2FL4A 3ONYA 2Q0YA 1QFJA 2VEZA 2ZEGA 2D9RA 1GR1A 2WZNA 1ZM4A 1U2RA 3H94A 4M0LA 3FXTA 4MBUA 2PMDA 3H9NA 4ACBA 2ZEOA 3WNBA 2GJRA 4OOXA 4B48A 1XIXA 2VL1A 2YNDA 1X12A 4KKTA 4LBYA 5KTDA 4UZFA 1JA0A 2PJCA 1CX8A 4XOTA 2DXQA 3OFNA 2PJ4A 2C6CA 4UCPA 1SM4A 3I1FA 4W9YA 2P6GA 4FAIA 4KVXA 4YRHA 4ZYQA 2WPXA 2I3CA 3AVWA 4UF4A 1DDIA 4Q7JB 3U6BA 1KQSB 4FXUA 3SXNA 4TNUA 3DR6A 5I0CA 2DERA 2JLMA 4B43A 2PE3A 3GY9A 1IB0A 1YREA 1ELOA 4P9SA 2GFQA 5LYFA 3ZC3A 4NJRA 5TR9A 3GVJA 5HH1A 1TKHA 2WUUA 2NYQA 3BCFA 3CCJB 1W87A 3CXQA 3EY5A 1FT7A 3BY2A 3TX8A 1FRNA 3ZZIA 2R9VA 3VNVA 3VARA 4IAVA 2PJ7A 3BXMA 3PB7X 4ZX8A 3W6SA 4OC5A 3HLPA 4XM3A 4TMWA 1XE1A 1OB5A 3FYNA 4NCZA 2JIZA 3EO4A 3SI0A 4L8AA 4RDKA 5CPAA 4A2ZA 3AVYA 5J1QA 3CMMA 3W91A 3CZXA 1KK1A 4E2AA 1E43A 1BQEA 2XGJA 4OC1A 2BM1A 2CC2A 2EFGA 1HA3A 3JTKA 3RNZA 1WSVA 4HKFA 5JBQA 3A1PA 3C26A 2BMWA 4ONWA 2Z3KA 4H6UA 2YNEA 4ROXA 4MI4A 4M6GA 4ZY0A 2PCUA 4B44A 2HV2A 4WZKA 2G3TA 4UFVA 4B47A 4XPDB 1BLIA 3BNWA 4R87A 2ODFA 2REFA 4Z4WA 3DR8A 1WP6A 1NJID 2HQYA 1WPCA 2K5TA 3MN8A 1V0EA 5CNPA 3P2FA 4ZI6A 1GYTA 1KK0A 1HEEA 2G0BA 2FVGA 3BCDA 5KTAA 4O23A 4OC2A 4KSIA 1S72B 2BO9A 2ZZQA 3CMAB 3ISXA 4MFQA 4Y9UA 2Z3NA 1Z5RA 2JJ2A 1AUGA 2ZELA 1Y0YA 2ANPA 5J8CA 2ZITA 3RBUA 3K9UA 3FJOA 1H8LA 1IB1E 3GIRA 3W5HA 1S5KA 3CPXA 5G1ZA 2DEAA 2I00A 4A95A 4C43A 2WJVA 2Q51A 4XNHB 4ONUA 2VNHA 4OPSA 4B3GA 1N06A 3TOAA 1GJRA 1ZG9A 4KOSA 1U6MA 1J4JA 1VQ7B 5LYDA 4H9GA 2OTLB 4ZX9A 3KASA 5FA6A 1IOFA 4XOPA 1XF8A 3D2MA 4FK8A 2IMOA 1YITB 3BY1A 4KZTA 4NEXA 3TO9A 2REEA 3V7AA 1R5NA 3TC8A 1ZM3A 5THWA 4A30A 2AE6A 1NRKA 3OEHA 1TF9A 1P4MA 4CGLA 1NB9A 2C6GA 4TT3A 3P2HA 1S0UA 1M44A 2CTBA 2CRVA 1QG0A 2GE3A 2CNMA 1T5EA 2V7TA 1M4LA 3MMPA 5FIUA 5K8PA 2F43A 3OW7A 5TRDA 2J8MA 3GUXA 1K9MD 4X0CA 1G7SA 1S4MA 3SJZA 3D7FA 4YAOA 3L2NA 3FBUA 5EC4A 3SEJA 2V7WA 4CPAA 3A35A 1Q86D 1XMBA 3A3GA 4MY0A 4OKOA 2OZGA 2R1IA 3CC2B 3VATA 4F0XA 4YAFA 1OZPA 1YX0A 1BO4A 4IHMA 1FX0A 2QECA 1I7PA 1Y9WA 3D2PA 4NNJA 2XEJA 2OBSA 1SKQA 2B7BA 4C2ZA 3H4QA 1WOOA 2V77A 3WC6A 2DPTA 4R3LA 2EK8A 3E20A 1IICA 4UFXA 2HC9A 4FD5A 1GVHA 3PEIA 3IO1A 3WT4A 2R7HA 4KSFA 5G22A 2RB7A 4QFMA 4NF1A 2F4NA 1MJBA 4A33A 3QE2A 3TO7A 4P10A 4YAWA 3B2YA 5F4OA 2YWHA 2EWBA 1GO2A 1TF8A 2RFHA 4MHNA 5ISVA 5J8FA 1FRQA 2ZL6A 3LACA 2PJ2A 2VI7A 1I8DA 4UIAA 1UD3A 4JZ0A 2Q4VA 2R98A 1IJEA 1BMFA 2F1MA 4Q38A 1G7TA 2A4NA 4BBHA 1ZO0A 5EMIA 5IB0A 4Y49C 1VQ8B 1LAMA 2HCJB 3SJFA 2PJ6A 5IX3A 2GU2A 3ZBTA 1CPXA 2J8NA 4R3KA 4Z65A 4CS0B 1EFUA 2Q04A 1UD8A 4CGMA 2CNSA 1M4GA 3R6JA 1K28D 2G3AA 4KUAA 1PJ5A 2FSRA 4YHBA 4KOXA 4CGPA 2AFZA 1YJ9B 3U2QA 5H59A 3FEDA 4E8OA 1JNYA 1WOSA 3CCLB 3PBBA 4GQNA 3BQJA 4Q7AA 3ZBUA 4X7DA 4YWYA 2GREA 5HXBA 1W2BB 4XLCA 2D3NA 4NGQA 4FN5A 4UIBA 3PENA 2ABZA 4DUKA 5F46A 2GIVA 1YVKA 3RZAA 1IGBA 3A8JA 4M3SA 2ZBUA 4AVAA 2F1LA 2H5MA 4NGMA 1G7RA 3CCMB 2PC1A 4AG7A 2PRBA 1XOVA 1M1KD 4F6AA 1MJ9A 3CPWB 1B23P 5IYPA 4XQFA 4XD7A 2ZEHA 5F09A 3CMEB 5B6IA 3AVUA 1B87A 2Q6IA 2ZW5A 4UAJA 3OJWA 1ZLHA 4ZGYB 1L0CA 1IYLA 2ZW6A 2I1LA 4J0QA 2EUIA 2BPOA 2GJKA 2YNCC 4U5YA 1YX2A 4PC6A 1H85A 2Z3MA 3I9SA 1EFRA 1LCPA 4XORA 1VHSA 4C7HA 4HNWB 4NGNA 2NPFA 4PQAA 4MJ8A 2VBSA 4R57A 4MHZA 2VZYA 1BX1A 4B5OA 2YGWA 4B14A 4H89A 2M5SA 3LODA 3PB4X 3F8KA 1EWYA 5AGEA 4F8ZA 5AG7A 2OB0A 1VQMB 3FJUA 4TWEA 1QFYA 2C6PA 2BOAA 4IK2A 1VQ6B 2EVNA 4WZTA 4ZY1A 4YELA 1KK3A 1MRZA 3EXNA 1R3NA 5AN9A 2FIAA 2IJZA 4DJLA 1BPMA 4P4FA 3WYAA 3GKRA 1CP6A 1VQOB 1QSOA 1XFOA 2XEFA 4PK3A 2ZEDA 2J7KA 4I49A 3CXSA 1ZLIA 3PB8X 2X6XA 3WXMA 4YFJA 1Z8WA 2O53A 1V5VA 2B3UA 1A2ZA 2BM0A 2ZXVA 3OKXA 1E79A 2RC6A 4XPLA 3AVXA 4Z4SA 3H8GA 3IEHA 4G7XA 1Z8XA 5DN6A 4F0YA 2KCWA 1TKJA 4OIDA 4XKWA 3D8PA 3J81k 2XEXA 1PCAA 4PSXA 1NSLA 4Z4ZA 4U9ZA 1YIJB 3T51B 3BI0A 4P4EA 4UEFA 4B12A 4YALA 2X85A 5JH9A 1EP3B 3B35A 2PRQA 1FY7A 4B5PB 1OB2A 3IIBA 3KHZA 3OJXA 1KWMA 1XJOA 5IYQA 2Z3PA 3UY5A 2G9DA 3ZZ0A 5HVGA 4TSFA 4OOSA 4ZBGA 3OAAA 2JDIA 2XZLA 3A8IA 2IQ6A 1YVOA 1G7CA 4M6HA 4RDJA 3OPOA 4QUZA 4U9YA 4H6ZA 1UD5A 1IHMA 4B13A 4DK0A 3OZUA 1GAQA 1GHEA 1S60A 2C27A 1F2OA 1KJZA 1XE4A 1TIQA 2B4DB 4Z4RA 2PLFA 3S9NA 2ZPAA 1Y0RA 4RS2A 2VZLA 3CPAA 2HLDA 5IYWA 4P44A 1JB9A 2DPSA 4E0FA 2Q4YA 4G7WA 4P4DA 3WNCA 2QDXA 2CY2A 3SXOA 2VJJA 3Q39A 4CAXA 3D67A 4R8FA 3PA2A 1FDRA 5GV7A 4X7EA 2FX3A 3PVDA 1SKYB
chains in the Genus database with same CATH topology
3RBUA 5LRJA 1H8LA 4OP4A 1TKFA 1RTQA 5LYIA 3CPXA 2DEAA 4DYOA 2Q51A 2AFXA 1FNOA 5LRGA 6CPAA 1DE4C 2PIYA 4R6TA 3D68A 1EE3P 2J9AA 4UEZA 3B3VA 4FUUA 2XEIA 1ZG9A 4NGPA 3NH8A 8CPAA 3B3TA 5LYDA 4GM5A 4MMOA 4ZX9A 3KASA 3IFEA 2ZEPA 2IMOA 1OBRA 3TC8A 2OOTA 3VH9A 3KL9A 4A38A 5THWA 5K8NA 1TF9A 4G1PA 3B3SA 4WWVA 5DS0A 2JBKA 2CF4A 2C6GA 2POKA 2CTBA 3IC1A 4BD9A 3H8EA 3D66A 1M4LA 1LOKA 2PVWA 5K8PA 4P45A 3D7HA 3B3WA 4X2TA 3KR5A 5LYLA 4PXDA 4A37A 4P4BA 1CPSA 3SI1A 3GUXA 2ZOGA 1ELMP 1QQ9A 1CP7A 3D7FA 3L2NA 3BI1A 4CPAA 1XMBA 4OKOA 7CPAA 1AYEA 4MCRA 1LAPA 3ISZA 4MCQA 3VATA 3MRUA 4JYWA 2BCOA 3FMCA 4IHMA 5HVHA 5HXDA 2PJ9A 4F9VA 2PVVA 1HDQA 2XEJA 4MHYA 1VHEA 4NGRA 3GLJA 4R76A 2AFWA 2V77A 1LFWA 2V8HA 3WC6A 1YW6A 1HDUA 2EK8A 2ZENA 3NH5A 2HC9A 3B3CA 3HUVA 3PEIA 3IO1A 3WT4A 2QVPA 2Q4ZA 2RB7A 3KR4A 4MCSA 2AFUA 4OMEA 1JQGA 3LMSA 4P10A 1TXRA 3B2YA 2AFMA 4OC3A 3CT9A 2PJ0A 3PFEA 3SJGA 2EWBA 3K9TA 1NSAA 4EWTA 1TF8A 2RFHA 4MHNA 5JGFA 2PJ2A 2C1CA 1ZG7A 4FBEA 5CBMA 3IJ3A 3DLJA 4MHPA 2HB6A 2GLFA 4UIAA 3NA6A 3NFZA 3WC7A 4JZ0A 3FVLA 3IWWA 3PRTA 1BAVA 3GB0A 3SJXA 4UEEA 4FWUA 3BHXA 4RUHA 1LAMA 1Q7LA 3SJFA 2PJ6A 4R7MA 4OC0A 2GU2A 3QNVA 2JBJA 5HVFA 1CPXA 4Z65A 3I1UA 3FF3A 1F57A 3PB6X 3RAMA 1AMPA 5K8OA 2QYVA 4P4IA 4B6ZA 2AFZA 2ZEEA 3FEDA 1R43A 2V8GA 2AFOA 3K2KA 4MCPA 3PBBA 1XBUA 3JRUA 4PPZA 4PXEA 5K8MA 4Q7AA 3V38A 4YWYA 2GREA 2ZOFA 4NGQA 4UIBA 2ABZA 4DUKA 3RZAA 4X8IA 2AFSA 1IGBA 4PXBA 4WJBA 3KI9A 2PJBA 4NGMA 2ZEGA 2JEWA 5I4MA 5ELYA 4P6YA 2CTCA 4X3RA 3D7DA 2WZNA 2ZEMA 2ZEHA 2ZEOA 5F09A 4OIWA 4H2KA 3SJEA 3FH4A 1ZLHA 2VL1A 1ARLA 3KZWA 2PJCA 1UWYA 1CX8A 1Y7EA 3FEEA 5D8NA 2PJ4A 2C6CA 2GLJA 4W9YA 1LCPA 3N5FA 4FAIA 2CIJA 4ZYQA 2PJ8A 2I3CA 4UF4A 4NGNA 4A94A 4PQAA 2PJ1A 3KQXA 2PJAA 2XEGA 3PB9X 1IY7A 4TNUA 4MHZA 5JM6A 4MRIA 3PFOA 1VHOA 4NGTA 3V7ZA 3PB4X 2QJ8A 2PE3A 5LYFA 4F8ZA 3WABA 2PIZA 4NJRA 3FJUA 4TWEA 1TKHA 2NYQA 2C6PA 2BOAA 4LQGA 2WYRA 4IK2A 4ZY1A 3T8WA 3SI2A 1BPNA 1R3NA 1FT7A 4NGSA 5IB9A 2IJZA 4MXUA 1BPMA 4P4FA 4DJLA 3WC5A 3TX8A 1CP6A 1XFOA 2XEFA 3KQZA 2ZEDA 3PBEA 1YSJA 3B7IA 1ZLIA 2Q43A 3PB8X 4P4JA 1LANA 1Z8LA 2O53A 1CG2A 1YMEA 3VARA 4IAVA 2PJ7A 4YU9A 3BXMA 3PB7X 3FX6A 4ZX8A 4AXVA 3H8GA 3IEHA 4OC5A 3HLPA 2F8HA 2PJ3A 3D7GA 2ZEFA 1TKJA 4OIDA 3SI0A 1ZG8A 2V8VA 1PCAA 5CPAA 3KGQA 5J1QA 2OR4A 1CBXA 3BI0A 3H8FA 4P4EA 4UEFA 2PJ5A 4F9UA 5JH9A 1VIXA 4OC1A 3B35A 2PRQA 4A39A 1ARMA 1YW4A 3IIBA 3KHZA 3CDXA 1KWMA 1XJOA 2G9DA 5HVGA 4ONWA 5D29A 3D4UA 1XRYA 4ZY2A 4ZY0A 2PCUA 4K3NA 2IQ6A 5LRKA 1BLLE 1F2PA 1QMUA 4EMEA 3S9LA 4PXCA 3S9MA 1F2OA 2F7VA 1PYTB 2O4HA 3MN8A 1Z2LA 4ZI6A 1GYTA 3S9NA 4EFDA 3KHXA 1Y0RA 1HEEA 2NSMA 2EK9A 3CPAA 4P44A 2FVGA 1VGYA 4O23A 4OC2A 4KSIA 3DGVA 2BO9A 4P4DA 4NFRA 3ISXA 4NJQA 3D67A 1Z5RA 4R8FA 4OC4A 3NH4A 3FECA 2V8DA 2ZELA 1Y0YA 2ANPA 1ELLP 3LWUA 1DTDA 1YLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBU A;  5LRJ A;  1H8L A;  4OP4 A;  1TKF A;  1RTQ A;  5LYI A;  3CPX A;  2DEA A;  4DYO A;  2Q51 A;  2AFX A;  1FNO A;  5LRG A;  6CPA A;  1DE4 C;  2PIY A;  4R6T A;  3D68 A;  1EE3 P;  2J9A A;  4UEZ A;  3B3V A;  4FUU A;  2XEI A;  1ZG9 A;  4NGP A;  3NH8 A;  8CPA A;  3B3T A;  5LYD A;  4GM5 A;  4MMO A;  4ZX9 A;  3KAS A;  3IFE A;  2ZEP A;  2IMO A;  1OBR A;  3TC8 A;  2OOT A;  3VH9 A;  3KL9 A;  4A38 A;  5THW A;  5K8N A;  1TF9 A;  4G1P A;  3B3S A;  4WWV A;  5DS0 A;  2JBK A;  2CF4 A;  2C6G A;  2POK A;  2CTB A;  3IC1 A;  4BD9 A;  3H8E A;  3D66 A;  1M4L A;  1LOK A;  2PVW A;  5K8P A;  4P45 A;  3D7H A;  3B3W A;  4X2T A;  3KR5 A;  5LYL A;  4PXD A;  4A37 A;  4P4B A;  1CPS A;  3SI1 A;  3GUX A;  2ZOG A;  1ELM P;  1QQ9 A;  1CP7 A;  3D7F A;  3L2N A;  3BI1 A;  4CPA A;  1XMB A;  4OKO A;  7CPA A;  1AYE A;  4MCR A;  1LAP A;  3ISZ A;  4MCQ A;  3VAT A;  3MRU A;  4JYW A;  2BCO A;  3FMC A;  4IHM A;  5HVH A;  5HXD A;  2PJ9 A;  4F9V A;  2PVV A;  1HDQ A;  2XEJ A;  4MHY A;  1VHE A;  4NGR A;  3GLJ A;  4R76 A;  2AFW A;  2V77 A;  1LFW A;  2V8H A;  3WC6 A;  1YW6 A;  1HDU A;  2EK8 A;  2ZEN A;  3NH5 A;  2HC9 A;  3B3C A;  3HUV A;  3PEI A;  3IO1 A;  3WT4 A;  2QVP A;  2Q4Z A;  2RB7 A;  3KR4 A;  4MCS A;  2AFU A;  4OME A;  1JQG A;  3LMS A;  4P10 A;  1TXR A;  3B2Y A;  2AFM A;  4OC3 A;  3CT9 A;  2PJ0 A;  3PFE A;  3SJG A;  2EWB A;  3K9T A;  1NSA A;  4EWT A;  1TF8 A;  2RFH A;  4MHN A;  5JGF A;  2PJ2 A;  2C1C A;  1ZG7 A;  4FBE A;  5CBM A;  3IJ3 A;  3DLJ A;  4MHP A;  2HB6 A;  2GLF A;  4UIA A;  3NA6 A;  3NFZ A;  3WC7 A;  4JZ0 A;  3FVL A;  3IWW A;  3PRT A;  1BAV A;  3GB0 A;  3SJX A;  4UEE A;  4FWU A;  3BHX A;  4RUH A;  1LAM A;  1Q7L A;  3SJF A;  2PJ6 A;  4R7M A;  4OC0 A;  2GU2 A;  3QNV A;  2JBJ A;  5HVF A;  1CPX A;  4Z65 A;  3I1U A;  3FF3 A;  1F57 A;  3PB6 X;  3RAM A;  1AMP A;  5K8O A;  2QYV A;  4P4I A;  4B6Z A;  2AFZ A;  2ZEE A;  3FED A;  1R43 A;  2V8G A;  2AFO A;  3K2K A;  4MCP A;  3PBB A;  1XBU A;  3JRU A;  4PPZ A;  4PXE A;  5K8M A;  4Q7A A;  3V38 A;  4YWY A;  2GRE A;  2ZOF A;  4NGQ A;  4UIB A;  2ABZ A;  4DUK A;  3RZA A;  4X8I A;  2AFS A;  1IGB A;  4PXB A;  4WJB A;  3KI9 A;  2PJB A;  4NGM A;  2ZEG A;  2JEW A;  5I4M A;  5ELY A;  4P6Y A;  2CTC A;  4X3R A;  3D7D A;  2WZN A;  2ZEM A;  2ZEH A;  2ZEO A;  5F09 A;  4OIW A;  4H2K A;  3SJE A;  3FH4 A;  1ZLH A;  2VL1 A;  1ARL A;  3KZW A;  2PJC A;  1UWY A;  1CX8 A;  1Y7E A;  3FEE A;  5D8N A;  2PJ4 A;  2C6C A;  2GLJ A;  4W9Y A;  1LCP A;  3N5F A;  4FAI A;  2CIJ A;  4ZYQ A;  2PJ8 A;  2I3C A;  4UF4 A;  4NGN A;  4A94 A;  4PQA A;  2PJ1 A;  3KQX A;  2PJA A;  2XEG A;  3PB9 X;  1IY7 A;  4TNU A;  4MHZ A;  5JM6 A;  4MRI A;  3PFO A;  1VHO A;  4NGT A;  3V7Z A;  3PB4 X;  2QJ8 A;  2PE3 A;  5LYF A;  4F8Z A;  3WAB A;  2PIZ A;  4NJR A;  3FJU A;  4TWE A;  1TKH A;  2NYQ A;  2C6P A;  2BOA A;  4LQG A;  2WYR A;  4IK2 A;  4ZY1 A;  3T8W A;  3SI2 A;  1BPN A;  1R3N A;  1FT7 A;  4NGS A;  5IB9 A;  2IJZ A;  4MXU A;  1BPM A;  4P4F A;  4DJL A;  3WC5 A;  3TX8 A;  1CP6 A;  1XFO A;  2XEF A;  3KQZ A;  2ZED A;  3PBE A;  1YSJ A;  3B7I A;  1ZLI A;  2Q43 A;  3PB8 X;  4P4J A;  1LAN A;  1Z8L A;  2O53 A;  1CG2 A;  1YME A;  3VAR A;  4IAV A;  2PJ7 A;  4YU9 A;  3BXM A;  3PB7 X;  3FX6 A;  4ZX8 A;  4AXV A;  3H8G A;  3IEH A;  4OC5 A;  3HLP A;  2F8H A;  2PJ3 A;  3D7G A;  2ZEF A;  1TKJ A;  4OID A;  3SI0 A;  1ZG8 A;  2V8V A;  1PCA A;  5CPA A;  3KGQ A;  5J1Q A;  2OR4 A;  1CBX A;  3BI0 A;  3H8F A;  4P4E A;  4UEF A;  2PJ5 A;  4F9U A;  5JH9 A;  1VIX A;  4OC1 A;  3B35 A;  2PRQ A;  4A39 A;  1ARM A;  1YW4 A;  3IIB A;  3KHZ A;  3CDX A;  1KWM A;  1XJO A;  2G9D A;  5HVG A;  4ONW A;  5D29 A;  3D4U A;  1XRY A;  4ZY2 A;  4ZY0 A;  2PCU A;  4K3N A;  2IQ6 A;  5LRK A;  1BLL E;  1F2P A;  1QMU A;  4EME A;  3S9L A;  4PXC A;  3S9M A;  1F2O A;  2F7V A;  1PYT B;  2O4H A;  3MN8 A;  1Z2L A;  4ZI6 A;  1GYT A;  3S9N A;  4EFD A;  3KHX A;  1Y0R A;  1HEE A;  2NSM A;  2EK9 A;  3CPA A;  4P44 A;  2FVG A;  1VGY A;  4O23 A;  4OC2 A;  4KSI A;  3DGV A;  2BO9 A;  4P4D A;  4NFR A;  3ISX A;  4NJQ A;  3D67 A;  1Z5R A;  4R8F A;  4OC4 A;  3NH4 A;  3FEC A;  2V8D A;  2ZEL A;  1Y0Y A;  2ANP A;  1ELL P;  3LWU A;  1DTD A;  1YLO A; 
#chains in the Genus database with same CATH topology
 1KK2 A;  3CC4 B;  2PR8 A;  3GVL A;  1NBM A;  1HVX A;  3GIU A;  3VMF A;  3OZV A;  2J8R A;  2XZO A;  2VXK A;  2B4B A;  1RTQ A;  1I12 A;  4OAD A;  4G1B A;  1X10 A;  1AMO A;  3CCE B;  1IJF A;  4CRZ B;  1CM0 A;  2ZBV A;  2BUE A;  4KLV A;  4MY3 A;  5LRG A;  1QVG B;  4KVO E;  2J9A A;  3B3V A;  3DDD A;  4ASU A;  2XEI A;  3W2I A;  1YK3 A;  4NGP A;  3QAH A;  4MFK A;  2OH1 A;  8CPA A;  3OE7 A;  3ASS A;  1KZL A;  4RN7 A;  1FNB A;  1OGJ A;  1YQE A;  2EIX A;  3IFE A;  3IU1 A;  4XLA A;  1T6Y A;  3ASP A;  3CCU B;  1NMT A;  1OBR A;  2QIR A;  2P6F A;  4IUS A;  1MK4 A;  5K8N A;  4G1P A;  1T6Z A;  4TMT A;  2VBV A;  4WWV A;  5DS0 A;  3B3S A;  5GCN A;  2JBK A;  1KMH A;  2QML A;  4EH1 A;  4P6V F;  4II3 A;  3CCR B;  3IC1 A;  4JWP A;  3S6K A;  1S7K A;  2VJI A;  4ACA A;  1H8H A;  1KD1 D;  4Y7C A;  1VLY A;  3ONU A;  1E63 A;  4P45 A;  4P12 A;  4X2T A;  4PXD A;  2C2W A;  4C68 A;  2ZOG A;  3GVK A;  1VQK B;  2Q7B A;  3LNN A;  3DNS A;  1Z9U A;  2VBU A;  3FPP A;  3HAG A;  2ZZE A;  1M4I A;  3PZJ A;  4PC2 A;  2WZP P;  3CC7 B;  5FO1 A;  3MHP A;  4MCR A;  4WZE A;  5A28 A;  2XNC A;  2Q6O A;  2V4D A;  2D3L A;  1MAB A;  2PJ9 A;  3WY9 A;  4DK1 A;  4X5K A;  2AHO A;  2D4O A;  3ASR A;  4XL9 A;  3GLJ A;  4R76 A;  5TV2 A;  2AFW A;  1FNC A;  2V8H A;  3T90 A;  3R6K A;  4UWI A;  1YW6 A;  5G20 A;  3F5B A;  5J3O A;  2ZEN A;  1WOP A;  3B3C A;  4KVM E;  1FND A;  4RM0 A;  2Q4Z A;  2BSA A;  4G1V A;  1QSM A;  4MCS A;  4UWJ A;  1RXT A;  4WZL A;  2BN4 A;  4X05 A;  1DDG A;  4JXR A;  4RCZ A;  2GK7 A;  2V7U A;  2E1R A;  3PFE A;  3SJG A;  4QVJ A;  1B6B A;  2HUZ A;  3ZZU A;  4EWT A;  1VJS A;  4LQ6 A;  4K30 A;  5H84 A;  2C1C A;  1ZG7 A;  4FBE A;  4ZV4 A;  5CBM A;  1S3Z A;  4CAW A;  4TKO B;  2GLF A;  2ZW4 A;  2ZZF A;  3NA6 A;  4P26 A;  3FPK A;  4KKS A;  4X06 A;  2GQF A;  1RO5 A;  3FVL A;  4JXQ A;  3IWG A;  4M6I A;  3PRT A;  3DDY A;  1BAV A;  4KS9 A;  3SJX A;  2PR1 A;  3OOC A;  4L89 A;  3A3B A;  3WND A;  4ORF A;  4RUH A;  1S7L A;  4OC0 A;  3W2H A;  4XLF A;  3CXC B;  3QNV A;  1Q9S A;  4N3N A;  4KOV A;  2QMU A;  2XNJ A;  1M90 D;  3LQE A;  5HKK A;  1N8R D;  4XPK A;  3FB3 A;  3FF3 A;  1F57 A;  1Q7Y D;  3PB6 X;  3JQP A;  1AMP A;  3LD2 A;  4P4I A;  1P0H A;  1XB2 A;  1R43 A;  2Q7S A;  4NBS A;  2AFO A;  2V8G A;  2C4U A;  2C5H A;  2KVO A;  3JRU A;  4PXE A;  3AVT A;  5K8M A;  3OZW A;  3BJ8 A;  3SJP A;  3AST A;  4F7D A;  1YJW B;  1IID A;  1OGI A;  4WQM A;  4UBR A;  2JN9 A;  4CYO A;  2JEW A;  2OBT A;  5ELY A;  4B5P A;  4P6Y A;  2V7V A;  4X3R A;  4BPR A;  1K4J A;  4Z4T A;  3W5U A;  4KSA A;  2X7B A;  4QVT A;  2ZW7 A;  2GPJ A;  4H2K A;  4AB7 A;  4ZGQ B;  4PAA A;  3SJE A;  3FH4 A;  5BWA B;  1CQX A;  2PIA A;  2CNT A;  1ARL A;  1E3X A;  2C5B A;  1WSR A;  1WU8 A;  1Z4E A;  3KZW A;  1UWY A;  2OZH A;  1Y7E A;  5F47 A;  2W6J A;  4LX9 A;  2GLJ A;  1EFT A;  2B4D A;  3N5F A;  2CIJ A;  4AC9 A;  2PJ8 A;  1BX0 A;  3ZIA A;  4II9 A;  4LBV A;  2PJA A;  2F5I A;  3TCV A;  3P27 A;  2B58 A;  3R9E A;  3PB9 X;  2BVN A;  5JM6 A;  4MRI A;  3PFO A;  1E62 A;  4U9U A;  4MFP A;  3V7Z A;  1VF7 A;  4AVB A;  3JQQ A;  3FRM A;  3H5Z A;  3LQ6 A;  2PIZ A;  3SLD A;  2FXF A;  3QSY A;  3CD6 B;  3T8W A;  3SI2 A;  2BV3 A;  2X6W A;  1BPN A;  3B8G A;  1Q81 D;  5DSZ A;  4NGS A;  2Z3O A;  4CAV A;  5IYR A;  2ZL7 A;  5IB9 A;  3LVB A;  4MXU A;  1UD6 A;  2WR8 A;  3WC5 A;  4GS4 A;  5EBV A;  2PSW A;  4AVC A;  1N0V C;  3E1Y E;  2XOK A;  5IYN A;  3WQZ A;  3B7I A;  1KUY A;  4P4J A;  1NB0 A;  3PA1 A;  1Q82 D;  1Z8L A;  1CG2 A;  1ON0 A;  3A9L A;  3CTA A;  4CGO A;  1Z4R A;  3VWD A;  1HZE A;  3FX6 A;  4AXV A;  4C0S A;  2F8H A;  2PJ3 A;  4KOT A;  4C2Y A;  3JQR A;  3PUN A;  5KNL A;  1SQH A;  1TTT A;  3B78 A;  1ZG8 A;  1QUE A;  4EVY A;  4IF5 A;  1YJN B;  4CYN A;  4OOV A;  2YWG A;  1UD2 A;  3CCQ B;  3KGQ A;  3QFR A;  4PK2 A;  3H8F A;  4YAU A;  3ZZT A;  4XN3 A;  1EP2 B;  1XEB A;  2PJ5 A;  3ZPN A;  3CW2 A;  3FKS A;  3QFT A;  4A39 A;  5F4J A;  1FNM A;  1ARM A;  2XND A;  3ES9 A;  2FS5 A;  1RQP A;  1F60 A;  1KUX A;  1YW4 A;  4IW3 B;  4PV6 A;  3CDX A;  4FD6 A;  1KUV A;  5D29 A;  3D4U A;  4ZY2 A;  2PQ8 A;  1IOI A;  3CCV B;  4YXW A;  1TVC A;  3S6H A;  3V8I A;  4RD1 A;  1BLL E;  2DF5 A;  5LRK A;  1QMU A;  1V0C A;  3S9L A;  4P22 A;  2DEU A;  1R57 A;  1ZM9 A;  1RQR A;  3IU2 A;  1I21 A;  2F7V A;  2ZXI A;  3TFY A;  2O4H A;  5DWM A;  1N0U A;  5E6T A;  1Z2L A;  5E96 A;  3VNU A;  1COW A;  1Y7R A;  3S6G A;  4G5G A;  2NSM A;  5HMN A;  4CRY B;  1VGY A;  1TUI A;  1A8P A;  1H8E A;  3DGV A;  4NFR A;  4RPD A;  1LRZ A;  3TE4 A;  4OC4 A;  4ZCL A;  3FEC A;  2V8D A;  3CP2 A;  3OP1 A;  1ELL P;  3LWU A;  1DTD A;  3B8H A;  3R1K A;  1YLO A;  3GYA A;  2CXA A;  5LRJ A;  5BSX A;  2FT0 A;  5G21 A;  3NE7 A;  4ZCM A;  3GQB A;  1TKF A;  1EP1 B;  5LYI A;  4G6I A;  1PUA A;  4DYO A;  3OWC A;  2ATR A;  3CXP A;  1EXM A;  3JU4 A;  2GJP A;  1FNO A;  6CPA A;  3QB8 A;  1N05 A;  4R6T A;  4UEZ A;  1EE3 P;  4XPD C;  2ZTN A;  4FUU A;  3A8K A;  5A8A A;  1CJW A;  3BC9 A;  3R9G A;  2FE7 A;  1Q2Y A;  4JJX A;  2WPW A;  2QGG A;  4A32 A;  1R5O A;  3TT2 A;  3U6K A;  4M53 A;  1W0K A;  3FNC A;  2DIE A;  3VH9 A;  2BEI A;  5A89 A;  5FO0 A;  4NSQ A;  1EFC A;  3CES A;  4XR6 A;  4KOU A;  1QSN A;  2CF4 A;  2JDC A;  1IYK A;  3LO8 A;  1OHH A;  3R9F A;  3IGR A;  1UFH A;  1JA1 A;  1KZF A;  5GV8 A;  4P3Y A;  1D2E A;  1Q2C A;  4OP7 A;  2YWE A;  1OB0 A;  3H8E A;  2WJY A;  1PJ7 A;  2PVW A;  5F48 A;  3D7H A;  1W0J A;  2R8V A;  2C78 A;  2Q6L A;  3W2G A;  2R6H A;  5LYL A;  4A37 A;  1BPL A;  5THX A;  5F49 A;  4XNH C;  3SI1 A;  1QQ9 A;  4RD0 A;  1S7N A;  5KSW B;  3BI1 A;  4BMH A;  1N08 A;  1VLO A;  4II2 A;  4RD3 A;  1LAP A;  4MCQ A;  3MRU A;  4JYW A;  2BCO A;  4MHD A;  1D8T A;  1QGY A;  2QEX B;  3EC4 A;  4XLE A;  5HVH A;  4Y49 B;  2PVV A;  5J35 A;  1HDQ A;  4Z4Y A;  3FIX A;  4P1V A;  5AG4 A;  3G05 A;  3G4S B;  1DG1 G;  1VKC A;  2CK3 A;  5IV0 A;  2OK7 A;  1WK4 A;  4OME A;  1JQG A;  4QVA A;  3LMS A;  4YGO A;  1TXR A;  2B5G A;  2AFM A;  4OC3 A;  1WDT A;  4B4D A;  2OU2 A;  3K9T A;  1JWQ A;  2I79 A;  1V0F A;  2Z11 A;  2RC5 A;  1VQ9 B;  1QGZ A;  4JLY A;  4KOW A;  3TTH A;  3P26 A;  3IJ3 A;  2HB6 A;  3G3S A;  4QB9 A;  4KKU A;  2ZXH A;  4MFJ A;  3PP9 A;  1NDH A;  5HZB A;  4AVZ A;  4UEE A;  3BHX A;  3W5V A;  2V7Q A;  4HIZ A;  4PC7 A;  3Q3A A;  4QBJ A;  1BJK A;  3V76 A;  4CQJ A;  4K1X A;  2JBJ A;  1BOB A;  2VBQ A;  2OTJ B;  4HE5 A;  3I1U A;  4DQK A;  5K8O A;  2HMA A;  1CNE A;  4B3F X;  2ZEE A;  2JDD A;  2CW5 A;  2VNK A;  3K2K A;  2ZTG A;  4RJL A;  1YGH A;  2X3U A;  1XBU A;  4B10 A;  1W9X A;  2P0W A;  3W6X A;  2FIW A;  3SKB A;  4AG9 A;  4UCN A;  2Z3L A;  3IWE A;  2AFS A;  4PXB A;  4WJB A;  3KI9 A;  2HDN B;  1W35 A;  4R9M A;  2E1B A;  2PJB A;  5I4M A;  3T53 B;  3R96 A;  2CTC A;  3D7D A;  4X7F A;  4UFW A;  2ZEM A;  4UA3 A;  4XMY A;  1MJA A;  2EO8 A;  1WOR A;  4OIW A;  1DAR A;  4ZGN B;  3T9Y A;  3NE5 B;  1R5B A;  3VO2 A;  1KRH A;  4XON A;  4C2X A;  1QSR A;  3S6F A;  3MCA A;  4HPS A;  5DWN A;  3D26 A;  4LUA A;  4OPV A;  3FEE A;  5D8N A;  5C88 A;  3QFS A;  4TMX A;  4XKV A;  4X7C A;  4MFZ A;  2JJ1 A;  4A94 A;  2B7C A;  1Y9K A;  3F0A A;  2PJ1 A;  2VYQ A;  2BGJ A;  3KQX A;  3ASQ A;  2XEG A;  1S7F A;  4Y9R A;  1IY7 A;  5A88 A;  2RC4 A;  2Y0M A;  2XZP A;  1D1N A;  4RPB A;  4OLL A;  1VHO A;  1K8A D;  5FVJ A;  4ZCI A;  4NGT A;  4TN1 A;  2QJ8 A;  5EMN A;  4NCN A;  1ZM2 A;  1VQL B;  5AG6 A;  2ARH A;  3WAB A;  2OZU A;  4N3G A;  3RO0 A;  3DSB A;  2Z0Z A;  4GXH A;  4Z4V A;  2WYR A;  4LQG A;  2GK6 A;  3Q6Q A;  2NV4 A;  3PGP A;  2VBT A;  3E0K A;  4YEJ A;  2B3V A;  3W2F A;  4LBW A;  3KQZ A;  2YWF A;  3Q38 A;  1P4N A;  3PBE A;  1YSJ A;  2Z10 A;  1QST A;  4KLW A;  4DNR B;  2D4P A;  1PJ6 A;  1IU8 A;  2Q43 A;  4NXY A;  1LAN A;  1CNF A;  3CB4 A;  3SLN A;  1YME A;  5IK2 A;  3WBJ A;  2QA4 B;  2WSA A;  3N7Z A;  4JMQ A;  4YU9 A;  4PSW A;  1M4D A;  2DY1 A;  3D7G A;  2C77 A;  4QHY A;  3QAY A;  4DNC A;  2ZEF A;  2OBR A;  1NE9 A;  2V8V A;  4AF6 A;  3G8W A;  3OEE A;  2OR4 A;  1CBX A;  2Z6B D;  2DOG A;  1VQP B;  4F9U A;  1VIX A;  5H86 A;  4PGO A;  5A27 A;  4C7I A;  2V31 A;  4HE6 A;  3QFC A;  2B5O A;  4FWT A;  4P2N A;  3AVV A;  4Q36 A;  4PC3 A;  1XMT A;  4UZU A;  4RLZ A;  3AGP A;  1XRY A;  4Z4U A;  2VNI A;  5JPH A;  4K3N A;  2VQY A;  4RD4 A;  4CAF A;  2VNJ A;  3R95 A;  1F2P A;  2FCK A;  3VO1 A;  4EME A;  2BF4 A;  4PXC A;  3KEW A;  4B11 A;  3CP8 A;  5BSY A;  2CND A;  3S9M A;  1VQ4 B;  1PYT B;  3I56 B;  4RDL A;  2IL4 A;  4EFD A;  3JUW A;  3KHX A;  4DNT B;  2EK9 A;  1B2R A;  1GAW A;  2X8K A;  2B5G B;  1N71 A;  2X0K A;  3I55 B;  4UZE A;  1YI2 B;  3I3G A;  4QV2 A;  1H42 A;  5KW9 A;  2Q44 A;  3BH4 A;  4NJQ A;  3NH4 A;  3OW2 B;  4E0A A;  2W6I A;  1KC8 D;  3NE8 A;  4QUS A;  4CYQ A;  2P6E A;  1N07 A;  4OP4 A;  1E3Z A;  4OPO A;  5KTC A;  1I1D A;  2QE7 A;  5F4M A;  4PC1 A;  3KKW A;  2AFX A;  4LC0 A;  2BL1 A;  2D74 A;  1DE4 C;  2PIY A;  3D68 A;  1E1Q A;  4L8J A;  3AGQ A;  1YR0 A;  1VQ5 B;  2V7X A;  2ZL5 A;  4OAE A;  3NH8 A;  2QTZ A;  4CAE A;  5JQ4 A;  3B3T A;  4GM5 A;  4MMO A;  1VQN B;  1J9Z A;  5H5J A;  1E1R A;  2X53 S;  2ZEP A;  2O28 A;  1I18 A;  2NMT A;  3SHP A;  1QH0 A;  4X07 A;  3RYO A;  2OOT A;  3KL9 A;  4A38 A;  1F20 A;  2YNC A;  2BGI A;  4R71 A;  2POK A;  3TOB A;  2OK8 A;  1QVF B;  3T56 B;  4JD6 A;  2QTL A;  2GAN A;  2JEV A;  4BD9 A;  1Q2D A;  3D66 A;  4M2L A;  2DET A;  1LOK A;  3B3W A;  3KR5 A;  1ZUN B;  2WPD A;  4P4B A;  1CPS A;  1ELM P;  1CP7 A;  4RD6 A;  3D3S A;  5FNZ A;  4Z1M A;  4QC6 A;  3VWE A;  1WTH D;  3VR6 A;  2Q6K A;  7CPA A;  1AYE A;  3ISZ A;  4KUB A;  3FMC A;  5L46 A;  2VZZ A;  5HXD A;  3BJ7 A;  4F9V A;  3CCS B;  4MYT A;  2BSW A;  4A31 A;  1YHQ B;  4MHY A;  1VHE A;  2OYN A;  1JJ2 B;  4NGR A;  2X6Y A;  2EBJ A;  4UCM A;  1LFW A;  1W34 A;  1HDU A;  4B3X A;  4HNY B;  5LMZ A;  3NH5 A;  3HUV A;  1M1D A;  2QVP A;  4DQL A;  1T6X A;  4TMV A;  2AJ6 A;  3KR4 A;  4J3G A;  4KOY A;  2AFU A;  3ZJ0 A;  1XQB A;  2QN6 A;  4LBZ A;  3W2E A;  3JVN A;  3BLN A;  4CGN A;  3CT9 A;  2PJ0 A;  1UD4 A;  3B82 A;  2WSS A;  5AG5 A;  4M1K A;  4HNX B;  1NSA A;  3Q6R A;  4FD4 A;  5HZA A;  1UMK A;  3PUM A;  4TMZ A;  4KOR A;  5CDF A;  2DYI A;  5JGF A;  4P3I A;  4MYU A;  1AIP A;  3G71 B;  2ZZG A;  3DLJ A;  4MHP A;  2CBX A;  1TLL A;  3NFZ A;  3WC7 A;  4P25 A;  1QX4 A;  4MFL A;  5TY0 A;  3IWW A;  2PDO A;  1QGA A;  4XN0 A;  3GB0 A;  4XNF A;  4FWU A;  3ZUG A;  1PU9 A;  3MGD A;  1QFZ A;  2DCU A;  1KTV A;  1Q7L A;  2LZJ A;  4RI1 A;  3WR7 A;  4R7M A;  2C4T A;  3G6E B;  1WWZ A;  5HVF A;  4FD7 A;  3EFA A;  3WBK A;  3RY8 A;  4CYP A;  4BIN A;  4PAB A;  3RAM A;  4XLH A;  2QYV A;  3CRZ A;  4B6Z A;  4RCY A;  1PKV A;  4MCP A;  4M85 A;  1YLE A;  4M4S A;  4PPZ A;  3V38 A;  1QUF A;  1E64 A;  2ZOF A;  1K73 D;  5C82 A;  3GSI A;  4RD2 A;  5FL7 A;  2P3M A;  4X8I A;  1Z8T A;  3TO6 A;  4AF7 A;  2FL4 A;  3ONY A;  2Q0Y A;  1QFJ A;  2VEZ A;  2ZEG A;  2D9R A;  1GR1 A;  2WZN A;  1ZM4 A;  1U2R A;  3H94 A;  4M0L A;  3FXT A;  4MBU A;  2PMD A;  3H9N A;  4ACB A;  2ZEO A;  3WNB A;  2GJR A;  4OOX A;  4B48 A;  1XIX A;  2VL1 A;  2YND A;  1X12 A;  4KKT A;  4LBY A;  5KTD A;  4UZF A;  1JA0 A;  2PJC A;  1CX8 A;  4XOT A;  2DXQ A;  3OFN A;  2PJ4 A;  2C6C A;  4UCP A;  1SM4 A;  3I1F A;  4W9Y A;  2P6G A;  4FAI A;  4KVX A;  4YRH A;  4ZYQ A;  2WPX A;  2I3C A;  3AVW A;  4UF4 A;  1DDI A;  4Q7J B;  3U6B A;  1KQS B;  4FXU A;  3SXN A;  4TNU A;  3DR6 A;  5I0C A;  2DER A;  2JLM A;  4B43 A;  2PE3 A;  3GY9 A;  1IB0 A;  1YRE A;  1ELO A;  4P9S A;  2GFQ A;  5LYF A;  3ZC3 A;  4NJR A;  5TR9 A;  3GVJ A;  5HH1 A;  1TKH A;  2WUU A;  2NYQ A;  3BCF A;  3CCJ B;  1W87 A;  3CXQ A;  3EY5 A;  1FT7 A;  3BY2 A;  3TX8 A;  1FRN A;  3ZZI A;  2R9V A;  3VNV A;  3VAR A;  4IAV A;  2PJ7 A;  3BXM A;  3PB7 X;  4ZX8 A;  3W6S A;  4OC5 A;  3HLP A;  4XM3 A;  4TMW A;  1XE1 A;  1OB5 A;  3FYN A;  4NCZ A;  2JIZ A;  3EO4 A;  3SI0 A;  4L8A A;  4RDK A;  5CPA A;  4A2Z A;  3AVY A;  5J1Q A;  3CMM A;  3W91 A;  3CZX A;  1KK1 A;  4E2A A;  1E43 A;  1BQE A;  2XGJ A;  4OC1 A;  2BM1 A;  2CC2 A;  2EFG A;  1HA3 A;  3JTK A;  3RNZ A;  1WSV A;  4HKF A;  5JBQ A;  3A1P A;  3C26 A;  2BMW A;  4ONW A;  2Z3K A;  4H6U A;  2YNE A;  4ROX A;  4MI4 A;  4M6G A;  4ZY0 A;  2PCU A;  4B44 A;  2HV2 A;  4WZK A;  2G3T A;  4UFV A;  4B47 A;  4XPD B;  1BLI A;  3BNW A;  4R87 A;  2ODF A;  2REF A;  4Z4W A;  3DR8 A;  1WP6 A;  1NJI D;  2HQY A;  1WPC A;  2K5T A;  3MN8 A;  1V0E A;  5CNP A;  3P2F A;  4ZI6 A;  1GYT A;  1KK0 A;  1HEE A;  2G0B A;  2FVG A;  3BCD A;  5KTA A;  4O23 A;  4OC2 A;  4KSI A;  1S72 B;  2BO9 A;  2ZZQ A;  3CMA B;  3ISX A;  4MFQ A;  4Y9U A;  2Z3N A;  1Z5R A;  2JJ2 A;  1AUG A;  2ZEL A;  1Y0Y A;  2ANP A;  5J8C A;  2ZIT A;  3RBU A;  3K9U A;  3FJO A;  1H8L A;  1IB1 E;  3GIR A;  3W5H A;  1S5K A;  3CPX A;  5G1Z A;  2DEA A;  2I00 A;  4A95 A;  4C43 A;  2WJV A;  2Q51 A;  4XNH B;  4ONU A;  2VNH A;  4OPS A;  4B3G A;  1N06 A;  3TOA A;  1GJR A;  1ZG9 A;  4KOS A;  1U6M A;  1J4J A;  1VQ7 B;  5LYD A;  4H9G A;  2OTL B;  4ZX9 A;  3KAS A;  5FA6 A;  1IOF A;  4XOP A;  1XF8 A;  3D2M A;  4FK8 A;  2IMO A;  1YIT B;  3BY1 A;  4KZT A;  4NEX A;  3TO9 A;  2REE A;  3V7A A;  1R5N A;  3TC8 A;  1ZM3 A;  5THW A;  4A30 A;  2AE6 A;  1NRK A;  3OEH A;  1TF9 A;  1P4M A;  4CGL A;  1NB9 A;  2C6G A;  4TT3 A;  3P2H A;  1S0U A;  1M44 A;  2CTB A;  2CRV A;  1QG0 A;  2GE3 A;  2CNM A;  1T5E A;  2V7T A;  1M4L A;  3MMP A;  5FIU A;  5K8P A;  2F43 A;  3OW7 A;  5TRD A;  2J8M A;  3GUX A;  1K9M D;  4X0C A;  1G7S A;  1S4M A;  3SJZ A;  3D7F A;  4YAO A;  3L2N A;  3FBU A;  5EC4 A;  3SEJ A;  2V7W A;  4CPA A;  3A35 A;  1Q86 D;  1XMB A;  3A3G A;  4MY0 A;  4OKO A;  2OZG A;  2R1I A;  3CC2 B;  3VAT A;  4F0X A;  4YAF A;  1OZP A;  1YX0 A;  1BO4 A;  4IHM A;  1FX0 A;  2QEC A;  1I7P A;  1Y9W A;  3D2P A;  4NNJ A;  2XEJ A;  2OBS A;  1SKQ A;  2B7B A;  4C2Z A;  3H4Q A;  1WOO A;  2V77 A;  3WC6 A;  2DPT A;  4R3L A;  2EK8 A;  3E20 A;  1IIC A;  4UFX A;  2HC9 A;  4FD5 A;  1GVH A;  3PEI A;  3IO1 A;  3WT4 A;  2R7H A;  4KSF A;  5G22 A;  2RB7 A;  4QFM A;  4NF1 A;  2F4N A;  1MJB A;  4A33 A;  3QE2 A;  3TO7 A;  4P10 A;  4YAW A;  3B2Y A;  5F4O A;  2YWH A;  2EWB A;  1GO2 A;  1TF8 A;  2RFH A;  4MHN A;  5ISV A;  5J8F A;  1FRQ A;  2ZL6 A;  3LAC A;  2PJ2 A;  2VI7 A;  1I8D A;  4UIA A;  1UD3 A;  4JZ0 A;  2Q4V A;  2R98 A;  1IJE A;  1BMF A;  2F1M A;  4Q38 A;  1G7T A;  2A4N A;  4BBH A;  1ZO0 A;  5EMI A;  5IB0 A;  4Y49 C;  1VQ8 B;  1LAM A;  2HCJ B;  3SJF A;  2PJ6 A;  5IX3 A;  2GU2 A;  3ZBT A;  1CPX A;  2J8N A;  4R3K A;  4Z65 A;  4CS0 B;  1EFU A;  2Q04 A;  1UD8 A;  4CGM A;  2CNS A;  1M4G A;  3R6J A;  1K28 D;  2G3A A;  4KUA A;  1PJ5 A;  2FSR A;  4YHB A;  4KOX A;  4CGP A;  2AFZ A;  1YJ9 B;  3U2Q A;  5H59 A;  3FED A;  4E8O A;  1JNY A;  1WOS A;  3CCL B;  3PBB A;  4GQN A;  3BQJ A;  4Q7A A;  3ZBU A;  4X7D A;  4YWY A;  2GRE A;  5HXB A;  1W2B B;  4XLC A;  2D3N A;  4NGQ A;  4FN5 A;  4UIB A;  3PEN A;  2ABZ A;  4DUK A;  5F46 A;  2GIV A;  1YVK A;  3RZA A;  1IGB A;  3A8J A;  4M3S A;  2ZBU A;  4AVA A;  2F1L A;  2H5M A;  4NGM A;  1G7R A;  3CCM B;  2PC1 A;  4AG7 A;  2PRB A;  1XOV A;  1M1K D;  4F6A A;  1MJ9 A;  3CPW B;  1B23 P;  5IYP A;  4XQF A;  4XD7 A;  2ZEH A;  5F09 A;  3CME B;  5B6I A;  3AVU A;  1B87 A;  2Q6I A;  2ZW5 A;  4UAJ A;  3OJW A;  1ZLH A;  4ZGY B;  1L0C A;  1IYL A;  2ZW6 A;  2I1L A;  4J0Q A;  2EUI A;  2BPO A;  2GJK A;  2YNC C;  4U5Y A;  1YX2 A;  4PC6 A;  1H85 A;  2Z3M A;  3I9S A;  1EFR A;  1LCP A;  4XOR A;  1VHS A;  4C7H A;  4HNW B;  4NGN A;  2NPF A;  4PQA A;  4MJ8 A;  2VBS A;  4R57 A;  4MHZ A;  2VZY A;  1BX1 A;  4B5O A;  2YGW A;  4B14 A;  4H89 A;  2M5S A;  3LOD A;  3PB4 X;  3F8K A;  1EWY A;  5AGE A;  4F8Z A;  5AG7 A;  2OB0 A;  1VQM B;  3FJU A;  4TWE A;  1QFY A;  2C6P A;  2BOA A;  4IK2 A;  1VQ6 B;  2EVN A;  4WZT A;  4ZY1 A;  4YEL A;  1KK3 A;  1MRZ A;  3EXN A;  1R3N A;  5AN9 A;  2FIA A;  2IJZ A;  4DJL A;  1BPM A;  4P4F A;  3WYA A;  3GKR A;  1CP6 A;  1VQO B;  1QSO A;  1XFO A;  2XEF A;  4PK3 A;  2ZED A;  2J7K A;  4I49 A;  3CXS A;  1ZLI A;  3PB8 X;  2X6X A;  3WXM A;  4YFJ A;  1Z8W A;  2O53 A;  1V5V A;  2B3U A;  1A2Z A;  2BM0 A;  2ZXV A;  3OKX A;  1E79 A;  2RC6 A;  4XPL A;  3AVX A;  4Z4S A;  3H8G A;  3IEH A;  4G7X A;  1Z8X A;  5DN6 A;  4F0Y A;  2KCW A;  1TKJ A;  4OID A;  4XKW A;  3D8P A;  3J81 k;  2XEX A;  1PCA A;  4PSX A;  1NSL A;  4Z4Z A;  4U9Z A;  1YIJ B;  3T51 B;  3BI0 A;  4P4E A;  4UEF A;  4B12 A;  4YAL A;  2X85 A;  5JH9 A;  1EP3 B;  3B35 A;  2PRQ A;  1FY7 A;  4B5P B;  1OB2 A;  3IIB A;  3KHZ A;  3OJX A;  1KWM A;  1XJO A;  5IYQ A;  2Z3P A;  3UY5 A;  2G9D A;  3ZZ0 A;  5HVG A;  4TSF A;  4OOS A;  4ZBG A;  3OAA A;  2JDI A;  2XZL A;  3A8I A;  2IQ6 A;  1YVO A;  1G7C A;  4M6H A;  4RDJ A;  3OPO A;  4QUZ A;  4U9Y A;  4H6Z A;  1UD5 A;  1IHM A;  4B13 A;  4DK0 A;  3OZU A;  1GAQ A;  1GHE A;  1S60 A;  2C27 A;  1F2O A;  1KJZ A;  1XE4 A;  1TIQ A;  2B4D B;  4Z4R A;  2PLF A;  3S9N A;  2ZPA A;  1Y0R A;  4RS2 A;  2VZL A;  3CPA A;  2HLD A;  5IYW A;  4P44 A;  1JB9 A;  2DPS A;  4E0F A;  2Q4Y A;  4G7W A;  4P4D A;  3WNC A;  2QDX A;  2CY2 A;  3SXO A;  2VJJ A;  3Q39 A;  4CAX A;  3D67 A;  4R8F A;  3PA2 A;  1FDR A;  5GV7 A;  4X7E A;  2FX3 A;  3PVD A;  1SKY B; 
#chains in the Genus database with same CATH homology
 3RBU A;  5LRJ A;  1H8L A;  4OP4 A;  1TKF A;  1RTQ A;  5LYI A;  3CPX A;  2DEA A;  4DYO A;  2Q51 A;  2AFX A;  1FNO A;  5LRG A;  6CPA A;  1DE4 C;  2PIY A;  4R6T A;  3D68 A;  1EE3 P;  2J9A A;  4UEZ A;  3B3V A;  4FUU A;  2XEI A;  1ZG9 A;  4NGP A;  3NH8 A;  8CPA A;  3B3T A;  5LYD A;  4GM5 A;  4MMO A;  4ZX9 A;  3KAS A;  3IFE A;  2ZEP A;  2IMO A;  1OBR A;  3TC8 A;  2OOT A;  3VH9 A;  3KL9 A;  4A38 A;  5THW A;  5K8N A;  1TF9 A;  4G1P A;  3B3S A;  4WWV A;  5DS0 A;  2JBK A;  2CF4 A;  2C6G A;  2POK A;  2CTB A;  3IC1 A;  4BD9 A;  3H8E A;  3D66 A;  1M4L A;  1LOK A;  2PVW A;  5K8P A;  4P45 A;  3D7H A;  3B3W A;  4X2T A;  3KR5 A;  5LYL A;  4PXD A;  4A37 A;  4P4B A;  1CPS A;  3SI1 A;  3GUX A;  2ZOG A;  1ELM P;  1QQ9 A;  1CP7 A;  3D7F A;  3L2N A;  3BI1 A;  4CPA A;  1XMB A;  4OKO A;  7CPA A;  1AYE A;  4MCR A;  1LAP A;  3ISZ A;  4MCQ A;  3VAT A;  3MRU A;  4JYW A;  2BCO A;  3FMC A;  4IHM A;  5HVH A;  5HXD A;  2PJ9 A;  4F9V A;  2PVV A;  1HDQ A;  2XEJ A;  4MHY A;  1VHE A;  4NGR A;  3GLJ A;  4R76 A;  2AFW A;  2V77 A;  1LFW A;  2V8H A;  3WC6 A;  1YW6 A;  1HDU A;  2EK8 A;  2ZEN A;  3NH5 A;  2HC9 A;  3B3C A;  3HUV A;  3PEI A;  3IO1 A;  3WT4 A;  2QVP A;  2Q4Z A;  2RB7 A;  3KR4 A;  4MCS A;  2AFU A;  4OME A;  1JQG A;  3LMS A;  4P10 A;  1TXR A;  3B2Y A;  2AFM A;  4OC3 A;  3CT9 A;  2PJ0 A;  3PFE A;  3SJG A;  2EWB A;  3K9T A;  1NSA A;  4EWT A;  1TF8 A;  2RFH A;  4MHN A;  5JGF A;  2PJ2 A;  2C1C A;  1ZG7 A;  4FBE A;  5CBM A;  3IJ3 A;  3DLJ A;  4MHP A;  2HB6 A;  2GLF A;  4UIA A;  3NA6 A;  3NFZ A;  3WC7 A;  4JZ0 A;  3FVL A;  3IWW A;  3PRT A;  1BAV A;  3GB0 A;  3SJX A;  4UEE A;  4FWU A;  3BHX A;  4RUH A;  1LAM A;  1Q7L A;  3SJF A;  2PJ6 A;  4R7M A;  4OC0 A;  2GU2 A;  3QNV A;  2JBJ A;  5HVF A;  1CPX A;  4Z65 A;  3I1U A;  3FF3 A;  1F57 A;  3PB6 X;  3RAM A;  1AMP A;  5K8O A;  2QYV A;  4P4I A;  4B6Z A;  2AFZ A;  2ZEE A;  3FED A;  1R43 A;  2V8G A;  2AFO A;  3K2K A;  4MCP A;  3PBB A;  1XBU A;  3JRU A;  4PPZ A;  4PXE A;  5K8M A;  4Q7A A;  3V38 A;  4YWY A;  2GRE A;  2ZOF A;  4NGQ A;  4UIB A;  2ABZ A;  4DUK A;  3RZA A;  4X8I A;  2AFS A;  1IGB A;  4PXB A;  4WJB A;  3KI9 A;  2PJB A;  4NGM A;  2ZEG A;  2JEW A;  5I4M A;  5ELY A;  4P6Y A;  2CTC A;  4X3R A;  3D7D A;  2WZN A;  2ZEM A;  2ZEH A;  2ZEO A;  5F09 A;  4OIW A;  4H2K A;  3SJE A;  3FH4 A;  1ZLH A;  2VL1 A;  1ARL A;  3KZW A;  2PJC A;  1UWY A;  1CX8 A;  1Y7E A;  3FEE A;  5D8N A;  2PJ4 A;  2C6C A;  2GLJ A;  4W9Y A;  1LCP A;  3N5F A;  4FAI A;  2CIJ A;  4ZYQ A;  2PJ8 A;  2I3C A;  4UF4 A;  4NGN A;  4A94 A;  4PQA A;  2PJ1 A;  3KQX A;  2PJA A;  2XEG A;  3PB9 X;  1IY7 A;  4TNU A;  4MHZ A;  5JM6 A;  4MRI A;  3PFO A;  1VHO A;  4NGT A;  3V7Z A;  3PB4 X;  2QJ8 A;  2PE3 A;  5LYF A;  4F8Z A;  3WAB A;  2PIZ A;  4NJR A;  3FJU A;  4TWE A;  1TKH A;  2NYQ A;  2C6P A;  2BOA A;  4LQG A;  2WYR A;  4IK2 A;  4ZY1 A;  3T8W A;  3SI2 A;  1BPN A;  1R3N A;  1FT7 A;  4NGS A;  5IB9 A;  2IJZ A;  4MXU A;  1BPM A;  4P4F A;  4DJL A;  3WC5 A;  3TX8 A;  1CP6 A;  1XFO A;  2XEF A;  3KQZ A;  2ZED A;  3PBE A;  1YSJ A;  3B7I A;  1ZLI A;  2Q43 A;  3PB8 X;  4P4J A;  1LAN A;  1Z8L A;  2O53 A;  1CG2 A;  1YME A;  3VAR A;  4IAV A;  2PJ7 A;  4YU9 A;  3BXM A;  3PB7 X;  3FX6 A;  4ZX8 A;  4AXV A;  3H8G A;  3IEH A;  4OC5 A;  3HLP A;  2F8H A;  2PJ3 A;  3D7G A;  2ZEF A;  1TKJ A;  4OID A;  3SI0 A;  1ZG8 A;  2V8V A;  1PCA A;  5CPA A;  3KGQ A;  5J1Q A;  2OR4 A;  1CBX A;  3BI0 A;  3H8F A;  4P4E A;  4UEF A;  2PJ5 A;  4F9U A;  5JH9 A;  1VIX A;  4OC1 A;  3B35 A;  2PRQ A;  4A39 A;  1ARM A;  1YW4 A;  3IIB A;  3KHZ A;  3CDX A;  1KWM A;  1XJO A;  2G9D A;  5HVG A;  4ONW A;  5D29 A;  3D4U A;  1XRY A;  4ZY2 A;  4ZY0 A;  2PCU A;  4K3N A;  2IQ6 A;  5LRK A;  1BLL E;  1F2P A;  1QMU A;  4EME A;  3S9L A;  4PXC A;  3S9M A;  1F2O A;  2F7V A;  1PYT B;  2O4H A;  3MN8 A;  1Z2L A;  4ZI6 A;  1GYT A;  3S9N A;  4EFD A;  3KHX A;  1Y0R A;  1HEE A;  2NSM A;  2EK9 A;  3CPA A;  4P44 A;  2FVG A;  1VGY A;  4O23 A;  4OC2 A;  4KSI A;  3DGV A;  2BO9 A;  4P4D A;  4NFR A;  3ISX A;  4NJQ A;  3D67 A;  1Z5R A;  4R8F A;  4OC4 A;  3NH4 A;  3FEC A;  2V8D A;  2ZEL A;  1Y0Y A;  2ANP A;  1ELL P;  3LWU A;  1DTD A;  1YLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...