4P6YA

Crystal structure of the m42 aminopeptidase tmpep1050 from thermotoga maritima
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAHIDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the M42 aminopeptidase TmPep1050 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 114
structure length 331
sequence length 331
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 4p6yA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p6yA01
1GYTA 3NH8A 5JH9A 4EWTA 1ZG8A 3B3SA 4MXUA 1DTDA 2BCOA 4YWYA 2CF4A 3PRTA 3PB4X 2ZEGA 4MHNA 4P45A 1CX8A 4ZX9A 4LQGA 2ZOFA 2ANPA 4MHYA 2OOTA 4IK2A 2ZEHA 3D68A 1BAVA 4ONWA 1CPSA 3RZAA 1PYTB 1YMEA 4P10A 1QQ9A 4OC4A 2ZEMA 3LMSA 1ZG7A 2POKA 3SI1A 4A37A 1F2PA 2PRQA 3B3TA 1TKHA 2ZEDA 1F57A 4EFDA 1Z5RA 1FNOA 1UWYA 4PPZA 2PJ0A 4ZY1A 3HLPA 5CPAA 4WJBA 2DEAA 3I1UA 3SI0A 1CPXA 5THWA 3BXMA 1TF8A 3KASA 1QMUA 3GUXA 3S9MA 2V8GA 3VARA 4UIBA 5LRKA 1Z8LA 2JBKA 4OKOA 3IWWA 4F9VA 1NSAA 2NSMA 4PXEA 5F09A 3B3WA 2Q51A 5HVHA 2QYVA 3WC6A 3BI0A 4G1PA 4BD9A 4EMEA 2AFXA 1H8LA 3KHZA 3GB0A 4OC0A 2AFUA 3NFZA 3PB7X 3TC8A 4PQAA 3FMCA 3L2NA 2Q4ZA 3WT4A 3B35A 2FVGA 1XJOA 3FF3A 4P4DA 2PIZA 4UF4A 4W9YA 5JGFA 3PFOA 2ZEEA 2PVVA 3CT9A 4NGPA 8CPAA 4NJRA 4NGQA 3D7DA 5J1QA 3RBUA 4P6YA 3DLJA 2PJ8A 2G9DA 7CPAA 3BHXA 3CDXA 2JBJA 3KQXA 3PB8X 4DUKA 3D4UA 3SJFA 2V77A 3IC1A 3K9TA 3H8FA 4X2TA 3KI9A 5HXDA 1ARLA 2AFOA 5LYIA 3H8EA 3PBEA 2IJZA 1R3NA 4OP4A 5LRJA 2ZENA 4FAIA 4CPAA 3B2YA 4R8FA 5IB9A 2OR4A 3KGQA 1YSJA 2PJCA 3JRUA 4OC3A 2C1CA 1BPNA 1Q7LA 3KQZA 3ISZA 5JM6A 3D7GA 4GM5A 5LYLA 2F8HA 4OMEA 3T8WA 4MCQA 4A38A 4NJQA 1Y0YA 3B7IA 4ZYQA 1CP7A 2BO9A 1TKJA 3CPXA 5LYFA 1LOKA 1HDQA 3B3CA 5K8OA 3IIBA 3IO1A 1VHOA 3TX8A 4ZY2A 1LANA 3HUVA 4UEZA 4B6ZA 3NA6A 3GLJA 3KR5A 1Y0RA 2BOAA 3PFEA 3LWUA 1VHEA 2PJ9A 2NYQA 3IJ3A 2GLFA 3WC7A 1HDUA 2PJAA 4FWUA 4R6TA 4DYOA 4MCPA 1VGYA 2HB6A 1YLOA 3V38A 3VATA 2IQ6A 2O53A 2CTBA 1TF9A 3PB9X 2ZELA 3MRUA 1TXRA 4A39A 2AFZA 2VL1A 1KWMA 3S9LA 4JZ0A 3D66A 2PVWA 4FBEA 2CIJA 4P44A 4TWEA 2PJ1A 3WABA 2GREA 4P4BA 1XMBA 1VIXA 2PIYA 3H8GA 3SJGA 1XBUA 1Y7EA 3MN8A 2WYRA 1TKFA 4A94A 2AFWA 2GU2A 4MCSA 1XFOA 3FH4A 1LFWA 1CBXA 1LCPA 5K8MA 3V7ZA 1BLLE 2IMOA 3D67A 5CBMA 4NGTA 3D7FA 1LAMA 1IY7A 1ELLP 4MRIA 3DGVA 2V8HA 4PXBA 5ELYA 3NH4A 2F7VA 1EE3P 3PBBA 5LRGA 2V8VA 1FT7A 3FVLA 2XEGA 4R76A 3N5FA 4Z65A 4OC1A 1CP6A 2O4HA 2C6GA 3BI1A 4ZX8A 5D29A 2XEJA 2PE3A 3PEIA 2EWBA 1HEEA 4UEEA 4NFRA 4P4IA 2PJ2A 4X8IA 4P4EA 3PB6X 3FEEA 4PXCA 3SJXA 4PXDA 4NGNA 4ZY0A 3FJUA 2GLJA 2V8DA 2C6PA 3FEDA 3KR4A 2J9AA 1R43A 5K8PA 4YU9A 3KZWA 4OC2A 3IFEA 5HVGA 1ZLIA 2XEFA 5HVFA 1ELMP 3IEHA 4OIDA 4DJLA 4WWVA 4Q7AA 3NH5A 2XEIA 2PJBA 4NGRA 4NGSA 4ZI6A 1CG2A 5I4MA 2PJ6A 3RAMA 2AFSA 2PJ3A 3SJEA 2EK8A 1DE4C 3K2KA 1BPMA 2AFMA 1IGBA 5D8NA 1OBRA 4IHMA 2EK9A 4OIWA 4UEFA 2HC9A 3KL9A 5DS0A 2JEWA 2PJ5A 1AYEA 4IAVA 4TNUA 3S9NA 4MHPA 4MCRA 4O23A 1ZLHA 2WZNA 3FECA 3D7HA 1PCAA 4MMOA 4F8ZA 3KHXA 2ZEPA 1YW6A 2I3CA 4FUUA 3B3VA 2QVPA 2PJ7A 4F9UA 4AXVA 1RTQA 2ABZA 4KSIA 1Z2LA 1JQGA 1LAPA 2C6CA 5K8NA 4MHZA 3FX6A 4RUHA 5LYDA 1F2OA 1ARMA 1AMPA 4X3RA 4P4FA 1YW4A 4NGMA 2ZEFA 2CTCA 4OC5A 2RFHA 3QNVA 4R7MA 3SI2A 4P4JA 2Q43A 2ZEOA 2QJ8A 4UIAA 1XRYA 4H2KA 2PCUA 3VH9A 3CPAA 2PJ4A 3WC5A 1M4LA 4JYWA 1ZG9A 4K3NA 2ZOGA 2RB7A 6CPAA 3ISXA
chains in the Genus database with same CATH superfamily
3NH8A 1ZG8A 1M90D 4LBZA 2WR8A 1N0UA 2BCOA 1CX8A 2YWGA 3QSYA 3CW2A 4ZX9A 4B10A 2ZOFA 2FSRA 3ZZTA 3ZZUA 2G3AA 3H9NA 1E3ZA 2Z3LA 1XOVA 4EH1A 4UBRA 3RZAA 1NB9A 4WZEA 1YMEA 1N05A 2WJYA 4P10A 1QQ9A 3ZZIA 2BM1A 2GJPA 1H8EA 1S7KA 4AVAA 4XLEA 4JXRA 2P6FA 1TKHA 4EFDA 5TRDA 1M4IA 1Z5RA 2R7HA 1EWYA 3DDDA 1XF8A 4ZY1A 4CAXA 3CTAA 2Z6BD 1OHHA 4TMWA 3JQPA 5CDFA 5CPAA 5HMNA 2HUZA 2DEAA 3I1UA 2VBVA 1OB2A 1CPXA 1UD2A 3P27A 1TF8A 3KASA 1DDIA 3GUXA 1Y7RA 1EP2B 1BLIA 4KKUA 1KC8D 2V8GA 4II2A 1Z8LA 4CYOA 2V4DA 1KUXA 4F9VA 3MMPA 4Q7JB 2DEUA 3LODA 2ZL6A 2NSMA 3IWEA 4PXEA 2DETA 5EMIA 1IYKA 1S72B 5IK2A 4RD6A 3I1FA 4ROXA 2Y0MA 5HVHA 3CCRB 1Q86D 2GE3A 2ZZEA 3ASTA 4Z4RA 1M1DA 1R57A 3FMCA 3ASRA 1HA3A 1YIJB 4AVZA 2V7TA 1Q2CA 2B58A 1AIPA 1RO5A 2KVOA 4AG7A 2OZHA 4KOSA 4NGQA 1GAWA 1I7PA 1S3ZA 2R9VA 4B12A 1ZO0A 4B14A 3RBUA 3B8GA 3SJZA 3DR8A 2GJRA 4UFXA 4DK0A 1W87A 1I12A 1S0UA 2WUUA 5HKKA 2JBJA 2BF4A 3PB8X 1EFCA 4KOYA 2QGGA 2V77A 1K73D 1JB9A 3W5HA 1RXTA 4P3IA 1FY7A 2HLDA 2AFOA 3EY5A 5F4OA 4MFPA 2G3TA 2PR8A 4N3NA 1NBMA 2V7WA 4FAIA 1NMTA 4CPAA 3B2YA 1Q82D 4K30A 1EFRA 1YSJA 3OP1A 3G3SA 4PSXA 1PUAA 4F7DA 3JRUA 4UWJA 4AF7A 3ISZA 1KJZA 2Q04A 3CC4B 4U9UA 3T9YA 5GV8A 5LYLA 4RJLA 1QVFB 4OMEA 4G1VA 1G7SA 3OE7A 4ZGNB 4G7XA 1B23P 1EFTA 1HDQA 4Z4WA 5KTCA 3ZZ0A 2D4OA 2F5IA 4CAWA 1VHOA 3FRMA 3N7ZA 4ZY2A 1D2EA 2X53S 4B6ZA 3NE8A 3GLJA 2YNDA 1Y0RA 3FXTA 5FO1A 3PFEA 1VHEA 4X07A 5G1ZA 1QGZA 1OB5A 3ZC3A 4FWUA 1KZFA 4OP7A 2BMWA 3A8KA 4XM3A 2HB6A 5EC4A 4U5YA 4B5PB 2VEZA 1VQ6B 1N08A 1TXRA 2Q4VA 4A39A 3GSIA 3CCMB 2I00A 2AHOA 5GCNA 4KVOE 3CMMA 3FKSA 3CRZA 4JZ0A 1N06A 2PVWA 4YALA 2AJ6A 4FD7A 4GXHA 3H4QA 5HXBA 2BGJA 5F49A 2GJKA 2PSWA 2R1IA 5JQ4A 1XBUA 4ZGYB 1Y7EA 3WYAA 2WYRA 1A8PA 4A94A 2GIVA 4OPVA 4NF1A 2GU2A 2FX3A 3DNSA 2P6EA 3V7AA 3IGRA 3GQBA 3C26A 2XZLA 5F47A 2C2WA 2ZBUA 5KW9A 3ONUA 3NE7A 2HV2A 2V8HA 3LVBA 1KMHA 5E6TA 2F1LA 3FVLA 3VNUA 2C4TA 3PUNA 4Q36A 3OZWA 4RDLA 5IYNA 4HE6A 2HDNB 3WBKA 2O4HA 3CB4A 1BMFA 2PE3A 3R9EA 4ASUA 4HNWB 1JWQA 4YFJA 2EIXA 5FO0A 2GQFA 3MGDA 4LQ6A 4NFRA 1BO4A 3FEEA 4OPSA 4KKSA 4X7CA 2Z3PA 4KLVA 4RCZA 2QMUA 4PXDA 3Q6QA 4ZY0A 3FJUA 2V8DA 5IB0A 4UAJA 2C6PA 2BM0A 1R43A 2VBUA 3LQ6A 2CNSA 4IW3B 2YWFA 2FS5A 5HVFA 1T5EA 1YX2A 4MY0A 2QDXA 4KSAA 4WWVA 4Q7AA 4XNHB 4DJLA 4UZEA 5G20A 3NH5A 1HVXA 2PJBA 2CC2A 4KVXA 4NGRA 1SM4A 1T6YA 4ZI6A 2VBQA 1CG2A 5I4MA 3RAMA 2AFSA 2EK8A 1WSVA 2B7BA 5TY0A 4MI4A 3OZVA 3K2KA 4XPLA 1J4JA 1IGBA 5D8NA 3TE4A 1FDRA 3QFCA 4RLZA 5C82A 3GVLA 1KK0A 1Y9KA 2QEXB 4OIWA 2C5BA 1WWZA 2P6GA 4RDKA 3I56B 1KTVA 2J8RA 3CXCB 1QUEA 1Q2YA 2PJ7A 4AXVA 1RTQA 2B4DA 3SLDA 3QAHA 4LUAA 1T6ZA 1JQGA 4R71A 5K8NA 1NDHA 1XQBA 3RYOA 5DWMA 2Z3KA 4J3GA 5EBVA 4P9SA 4NXYA 1QG0A 4QB9A 3RNZA 2VZLA 1YX0A 5AG4A 1QGYA 4Z4YA 4G1BA 4B43A 4OC5A 3ZUGA 2QJ8A 2V7QA 3W5VA 3JU4A 3BJ8A 1NSLA 4X7DA 4PC7A 2DOGA 3TOBA 2ZOGA 2VI7A 4FD5A 3TO6A 3OJWA 2VBTA 4RD3A 2B7CA 5DN6A 4MFLA 4EWTA 4BMHA 2CF4A 3PB4X 4MHNA 2X3UA 4M0LA 3CXQA 1MABA 2ANPA 4MHYA 4U9YA 4RS2A 1WPCA 2Q6IA 4X7EA 1QFYA 1Z8WA 4JD6A 4ONWA 5I0CA 1WK4A 3EXNA 4YHBA 4XMYA 4XR6A 3LMSA 1ZG7A 2GK7A 1F2PA 5E96A 1Q81D 3LACA 3B3TA 3A3BA 3JTKA 4H89A 2ZEDA 3DSBA 4CS0B 2D74A 2B4DB 4KVME 2KCWA 1XE1A 1Z8XA 1FNCA 2XZPA 5AG5A 1GO2A 2JJ2A 1QFZA 4B3XA 1FNMA 4P2NA 2VZZA 3VARA 3BY1A 2BV3A 1WOSA 2PDOA 3IWWA 1MJ9A 3B78A 3PENA 2V7VA 2BPOA 1NSAA 2DPTA 3NE5B 1AUGA 1W9XA 3GY9A 1M4DA 3WXMA 5IYPA 2Q51A 1M44A 2QYVA 2EFGA 3J81k 4G1PA 4FD6A 3WC6A 5TR9A 1H8LA 4A33A 2D9RA 3PB7X 3CXPA 2O28A 1QX4A 4G6IA 2FL4A 4PQAA 1IJFA 2WJVA 3WT4A 4UCNA 2FVGA 3FF3A 4KLWA 4UF4A 2C4UA 2Z3OA 1UD8A 1VQ5B 4BINA 2ZEEA 1KK1A 1FX0A 3CT9A 4AVCA 3T56B 4X5KA 1QVGB 3W2FA 1IYLA 4P6YA 2PJ8A 1XEBA 1VQLB 2WPDA 4C0SA 1IU8A 3KQXA 4DUKA 3D4UA 3SJFA 5KNLA 1V0CA 4B3GA 3A9LA 3H8FA 1I18A 2XNCA 1R3NA 2OTLB 4M6GA 1GVHA 1IB0A 4C2ZA 3T90A 2GPJA 4OC3A 3EC4A 4TN1A 4TMVA 1QSNA 3CC7B 1Q7LA 1E63A 3KQZA 3IU1A 2PQ8A 3FBUA 4B44A 4RCYA 3D3SA 2G0BA 3D7GA 4CYQA 4UCMA 4MFKA 3VWEA 4CYPA 2VNJA 4MCQA 4A38A 1OGIA 4ZYQA 3RO0A 3TT2A 4P1VA 2BO9A 2Q4YA 1TKJA 4CGLA 5LYFA 1LOKA 4UZFA 1FRQA 1Q9SA 3IIBA 2QECA 4AB7A 4KOXA 3HUVA 2J7KA 3NA6A 1YJNB 4HIZA 3FNCA 1TUIA 2BOAA 2DF5A 3LWUA 2BUEA 2VJIA 3R9FA 2ZTNA 3JVNA 4PSWA 1P0HA 5IYRA 2VNKA 4P22A 4Y9UA 2PJAA 3FB3A 5A27A 4R6TA 3QFRA 4XL9A 4MHDA 4TSFA 5AGEA 4XOPA 4MCPA 4ZBGA 3VO2A 3FYNA 2IQ6A 3OEHA 3D2MA 2ZELA 3MRUA 2ZL7A 5IX3A 3ZPNA 5ISVA 1KWMA 2JDIA 3TTHA 3S9LA 1ELOA 1BX0A 3MHPA 2PJ1A 2OBRA 2R8VA 4ACBA 3AGQA 3MN8A 4ZCLA 3OKXA 1SKQA 2VJJA 1TKFA 4MCSA 1XFOA 5A88A 1LFWA 1U6MA 1OGJA 2VXKA 4XPDB 3WNDA 3F5BA 3CXSA 4F6AA 4AF6A 4NGTA 1DARA 3D7FA 1LAMA 4YAFA 1IY7A 5GV7A 1WU8A 4RD4A 2ZZGA 3DGVA 3CZXA 4PXBA 1XMTA 3TCVA 2PR1A 2V8VA 2EVNA 1FT7A 3A8IA 3T51B 4OC1A 3P2FA 3ASQA 1CP6A 3SLNA 2C6GA 2QN6A 2FIAA 2HQYA 3JUWA 2M5SA 3BI1A 4XN3A 4ZX8A 1J9ZA 4KOVA 2XEJA 1R5NA 1PKVA 1H85A 5F48A 2ZITA 4DNRB 1D1NA 4UEEA 1U2RA 2REFA 2V7XA 2PJ2A 4HPSA 4P4EA 3JQQA 4QUZA 3PB6X 4PXCA 2CBXA 3I55B 2OTJB 4MFZA 1ZUNB 2ZXHA 3AVTA 4QV2A 1Q2DA 3SJXA 2Z10A 4NGNA 2J8NA 2GLJA 3TFYA 5K8PA 1CNFA 4YU9A 2K5TA 3R95A 4MYUA 2B5GA 4OC2A 1JA1A 3CMAB 1ELMP 4HNYB 4KSFA 4OIDA 4F0XA 4C2YA 3A3GA 1ZM9A 1EP1B 4OPOA 4MBUA 1KK3A 1NB0A 3AVXA 4CAEA 2X6YA 2VBSA 1OBRA 4OADA 4M1KA 5AG6A 4E0FA 1VKCA 2ZZFA 4KOTA 4XLCA 2JEWA 3RY8A 2PJ5A 1SQHA 1KK2A 3PZJA 4IAVA 3S9NA 4MHPA 4O23A 2WZNA 3VNVA 5DSZA 4CGMA 4U9ZA 4XPDC 2ZEPA 3I9SA 4CRYB 2CNTA 2VQYA 4FUUA 2QVPA 3R1KA 2ZW5A 2ABZA 2PMDA 2R98A 1W2BB 4M6HA 4CGPA 1Z2LA 5KSWB 3KKWA 2QA4B 3DDYA 3GYAA 3CCSB 2EBJA 4QUSA 4RDJA 1N0VC 2XNDA 3WBJA 1X10A 1YQEA 5LYDA 1F2OA 4XONA 1AMOA 3W5UA 2E1RA 2JN9A 1Z4EA 1YW4A 2WPWA 1VQ4B 3OOCA 4R7MA 2FE7A 2Q43A 2ZEOA 2V7UA 3GIUA 2J8MA 3QE2A 2RC5A 4N3GA 4H2KA 4R3LA 5BWAB 3VH9A 3WC5A 1S5KA 4AG9A 3LO8A 4JYWA 1JJ2B 4WZTA 1MRZA 2BL1A 2RB7A 5J8CA 2X6WA 3OW7A 1GYTA 5JH9A 4YWYA 4YAWA 1NJID 3G05A 4R3KA 3AVWA 3WNBA 4YGOA 4H9GA 2ZZQA 1XE4A 4LQGA 1G7TA 1QUFA 3VMFA 4B48A 4C7IA 4IK2A 3D68A 1YGHA 4LC0A 1IOFA 4ORFA 4GQNA 1CPSA 5F46A 2Z11A 1W0JA 1PYTB 1VLYA 4OC4A 4A37A 2PRQA 2Q7BA 3ZIAA 1WDTA 1F57A 2ZXVA 1FNOA 1UWYA 3BJ7A 1M4GA 1SKYB 4M53A 4TMTA 2YWEA 3PA1A 3SJPA 4QVAA 1K28D 3HLPA 4P12A 1QGAA 1KQSB 1QSMA 4NBSA 3OAAA 4NEXA 3E0KA 2WSAA 5HZAA 3SI0A 1X12A 3BXMA 3LD2A 3G71B 5DWNA 1VHSA 3S9MA 3ES9A 4OOSA 2WPXA 2JBKA 2CK3A 4KOWA 5FL7A 3OZUA 4ZV4A 3G8WA 2DPSA 2DERA 1RQPA 2ODFA 4B5OA 3U6KA 5G21A 4H6UA 3B3WA 1D8TA 1I21A 4MFQA 1UD5A 2FXFA 2DXQA 2E1BA 3BI0A 1QSRA 1YJ9B 1CJWA 2W6IA 2AFXA 1W34A 2EO8A 2AFUA 5THXA 1K9MD 1YVOA 2BSWA 3L2NA 4XKVA 3D26A 3B35A 3VO1A 1BX1A 4X05A 4P4DA 2PIZA 2VYQA 4I49A 1DG1G 2XZOA 5BSXA 5JGFA 3W6XA 3P2HA 4A31A 4XNFA 4R57A 2PVVA 4A30A 5EMNA 8CPAA 5J1QA 7CPAA 3BHXA 3CDXA 1ZM4A 4X06A 1VQOB 3CCQB 1E3XA 3IC1A 5H59A 3KI9A 1ARLA 1MJAA 5LYIA 3W91A 3H8EA 4OP4A 2Q6OA 1IOIA 4LBVA 4KKTA 4P26A 2B4BA 3OW2B 3ZJ0A 1LRZA 3W2IA 4L8JA 2WZPP 1QSTA 4R8FA 4YXWA 5A8AA 3A1PA 1B6BA 4QVJA 3KGQA 3ASSA 2QIRA 2PJCA 3SEJA 2CY2A 4HKFA 2C1CA 2ZBVA 1S7FA 1KZLA 4M85A 1VQKB 1MJBA 5JM6A 2R6HA 4KORA 1BQEA 2ZL5A 4GM5A 3T53B 5AN9A 2F4NA 2F8HA 3T8WA 3KEWA 4ONUA 3B7IA 4X7FA 4C43A 2X85A 2PRBA 1E64A 3B3CA 5K8OA 3BCDA 4JXQA 4YEJA 3IO1A 1XIXA 3TX8A 3B82A 3LQEA 4Y7CA 2PC1A 4UEZA 4UCPA 3KR5A 4QBJA 1W0KA 4A2ZA 3CP2A 4II9A 4PGOA 1I8DA 2Z3NA 2GLFA 3QFSA 2ZW4A 2X6XA 1VGYA 2DIEA 4RM0A 4LX9A 4Y9RA 3V38A 1Z4RA 2X8KA 3BH4A 4R87A 2O53A 3GKRA 2VNHA 3MCAA 4LBWA 2VL1A 3OJXA 4KS9A 1IHMA 1VQ9B 1VQNB 4CYNA 4DNCA 1N8RD 1JNYA 3D66A 2OYNA 2CIJA 4P44A 1BPLA 2OB0A 5JPHA 1CQXA 3SXOA 3F8KA 4B13A 1XMBA 3G4SB 3CCEB 4HNXB 2JDCA 2XEXA 2ZXIA 2OBSA 3H8GA 3AVVA 3IU2A 3SJGA 2ARHA 3LNNA 2AFWA 2GANA 2ZW7A 1EFUA 3FH4A 2BVNA 4XD7A 1M1KD 4NCZA 3CD6B 3CCJB 5KTAA 5K8MA 4PC3A 4EVYA 3EO4A 3V7ZA 1BLLE 4WQMA 2IMOA 3D67A 5HH1A 5CBMA 1UD4A 3B8HA 1F20A 1E62A 4PK2A 1MK4A 1VF7A 5KTDA 2VZYA 4Z4VA 4MRIA 4M3SA 3NH4A 2Q7SA 1EE3P 3D8PA 3PBBA 5LRGA 2JLMA 1A2ZA 3R6KA 2X7BA 2XEGA 4R76A 3N5FA 4Z65A 1R5OA 2A4NA 3SHPA 4OOVA 1WORA 5D29A 4Z4UA 2XNJA 4WZKA 4LBYA 2EWBA 2C78A 1HEEA 1GJRA 3QFTA 1XB2A 4X8IA 3FIXA 4TMZA 1Q7YD 4A32A 4XOTA 1UFHA 4Z1MA 1H42A 3KR4A 2YGWA 3FEDA 2J9AA 1I1DA 3KZWA 1QSOA 5H5JA 3IFEA 4P25A 2RC6A 1ZLIA 2ZPAA 1GR1A 1DDGA 1UMKA 4P6VF 4QHYA 1IB1E 4AC9A 2XEIA 1KRHA 1G7RA 4BPRA 4NGSA 4J0QA 3JQRA 1IJEA 2PJ6A 2PJ3A 4Y49C 1DE4C 3QAYA 4XNHC 1BPMA 2AFMA 1WP6A 2BGIA 3A35A 3CC2B 1PU9A 1E1RA 4CAVA 2EK9A 2HC9A 3KL9A 5DS0A 4CGNA 1FNDA 4ZCMA 1YVKA 4C7HA 4TNUA 3U2QA 4B5PA 4MCRA 5CNPA 1ZLHA 3D7HA 4G5GA 5IYWA 4F8ZA 4MY3A 4XORA 1YW6A 5FA6A 2I3CA 3B3VA 3PGPA 2EUIA 2VNIA 4C2XA 4OAEA 2W6JA 2FIWA 2C6CA 2Z0ZA 1N71A 1WTHD 3BCFA 3I3GA 1BJKA 5LMZA 4OOXA 3Q3AA 2JDDA 1AMPA 1S4MA 5G22A 5A89A 4X3RA 3TOAA 4IUSA 3ZBUA 2ZEFA 4R9MA 2CTCA 3CCVB 2RFHA 3SI2A 5C88A 3BY2A 2Q6LA 4XLFA 5J3OA 2PCUA 1YLEA 2C27A 4JMQA 4MJ8A 4K3NA 4CAFA 1V0EA 4A95A 3AVUA 2CXAA 3Q6RA 3B3SA 3EFAA 1DTDA 4MXUA 3PRTA 2ZEGA 3WNCA 1UD6A 4P45A 2NV4A 2JIZA 3BQJA 3W2GA 2OOTA 2ZEHA 1BAVA 4XPKA 2D3NA 2FT0A 4FN5A 3ONYA 1PJ5A 3SKBA 1YI2B 3K9UA 1V5VA 3PUMA 5F4MA 2ZEMA 2POKA 3SI1A 4Y49B 3CESA 2OBTA 3F0AA 3IWGA 4Q38A 4YRHA 4PPZA 2PJ0A 5BSYA 4HE5A 3SXNA 1B2RA 2GFQA 4MFJA 3FPKA 2OZUA 4RPDA 2OZGA 1Y9WA 1W35A 4B47A 3HAGA 4WJBA 1VQPB 4PV6A 5THWA 2B3VA 4UWIA 2REEA 1QMUA 4B3FX 1E43A 4UIBA 5LRKA 2LZJA 4OKOA 1G7CA 4MYTA 2CNDA 4TKOB 2Q44A 5F09A 2Q0YA 1FNBA 4B11A 3TO7A 5H86A 1TTTA 4M6IA 4Z4TA 4BD9A 4EMEA 3KHZA 3GB0A 4OC0A 3NFZA 3TC8A 1WOPA 2Q4ZA 4RPBA 1ZM3A 1K8AD 1YR0A 1QFJA 2OK7A 1XJOA 4DQLA 3CCLB 4PC2A 2YNCC 4NSQA 4W9YA 2ATRA 5JBQA 2XGJA 3PFOA 4G7WA 1Z9UA 1YK3A 2PLFA 4NGPA 4NJRA 3H94A 3U6BA 1QH0A 3D7DA 4L8AA 3DLJA 1S7LA 2G9DA 2JEVA 1NE9A 1S7NA 1IIDA 3GVKA 1T6XA 3OWCA 3R9GA 4ACAA 3K9TA 5FIUA 4X2TA 5HXDA 2YWHA 3CP8A 4DK1A 3PBEA 4K1XA 2IJZA 3ZBTA 4KUBA 1V0FA 3PP9A 4UFWA 5LRJA 2ZENA 2DCUA 4ZCIA 2QMLA 2Z3MA 1YJWB 5IB9A 3Q39A 3BLNA 2OR4A 3W2EA 1E79A 3WY9A 2ZW6A 1BPNA 1CNEA 1VQ8B 1L0CA 1BOBA 2WSSA 1E1QA 4QVTA 4H6ZA 2OK8A 4FXUA 4PABA 3E1YE 3QB8A 4JLYA 1JA0A 4CGOA 4NJQA 1Y0YA 2NPFA 1PJ6A 1CP7A 2H5MA 2JJ1A 4QFMA 1VQMB 2FCKA 3CPXA 4KOUA 4II3A 4B4DA 3E20A 3S6GA 5FNZA 1LANA 3R6JA 1K4JA 3CCUB 4M4SA 3CMEB 5A28A 4X0CA 3VR6A 2RC4A 4YELA 4UA3A 3OFNA 1TVCA 4NNJA 2PJ9A 1VLOA 2NYQA 3IJ3A 2D4PA 3PVDA 4F0YA 3WC7A 2NMTA 1RQRA 1HDUA 1TLLA 4DYOA 3AGPA 1ON0A 4RD1A 1YLOA 3BNWA 1VQ7B 3VATA 5IV0A 3FPPA 2CTBA 1TF9A 3PB9X 4PC1A 1VJSA 2D3LA 2AFZA 3TO9A 1YITB 1B87A 4FBEA 4XLHA 4TWEA 3WABA 2GREA 3PA2A 4P4BA 3G6EB 5TV2A 1VIXA 4IF5A 3W6SA 3S6FA 2PIYA 2Q6KA 1NRKA 3WQZA 4PK3A 3V76A 2I1LA 4ZGQB 4UFVA 5L46A 2B3UA 2PIAA 4RD2A 2YNEA 1CBXA 4DQKA 4L89A 1LCPA 1UD3A 4P3YA 4NCNA 2OH1A 3GVJA 1WOOA 4E0AA 1S60A 2GK6A 3UY5A 4RN7A 2CNMA 3DR6A 3S6HA 1ELLP 3AVYA 2DY1A 5ELYA 2F7VA 4AVBA 3S6KA 3Q38A 3BC9A 4JJXA 3CPWB 2QTZA 4XN0A 5IYQA 2BSAA 3PEIA 4PC6A 2YNCA 4P4IA 4CQJA 3V8IA 4C68A 4XQFA 4FD4A 2I79A 2B5OA 4WZLA 1YREA 1COWA 3ASPA 5FVJA 2V31A 3W2HA 1N07A 2BN4A 1IICA 1H8HA 2QTLA 4TT3A 2QE7A 1ZM2A 5HZBA 5HVGA 2XEFA 3IEHA 4YAOA 4KUAA 4FK8A 1EP3B 4Z4SA 5AG7A 3OPOA 2BEIA 3SJEA 3WR7A 4CRZB 1F60A 4BBHA 4FWTA 2X0KA 4IHMA 4UEFA 1R5BA 1CM0A 2P0WA 2XOKA 4RD0A 2F1MA 4UZUA 1P4NA 1AYEA 2P3MA 2F43A 3FECA 1PCAA 4MMOA 1KUVA 3KHXA 5J35A 3P26A 4QC6A 4F9UA 2C5HA 4KSIA 1FRNA 1PJ7A 1OB0A 1LAPA 2HCJB 5F4JA 4JWPA 4M2LA 5B6IA 2IL4A 1EXMA 2DYIA 2B5GB 2ZTGA 1Z8TA 4MHZA 3FX6A 3OEEA 3H5ZA 1HZEA 4XLAA 4RUHA 3A8JA 4OLLA 4TMXA 1ARMA 1GAQA 4RI1A 4P4FA 5H84A 4NGMA 4E2AA 4E8OA 2HMAA 1WSRA 4PAAA 3GIRA 2C77A 2OU2A 3QNVA 4P4JA 4DNTB 2CRVA 4Z4ZA 4UIAA 1XRYA 3VWDA 1KD1D 4XKWA 1KUYA 3FJOA 1OZPA 1YHQB 2AE6A 2PJ4A 3CPAA 3D2PA 1M4LA 4KZTA 1ZG9A 2CW5A 1TIQA 5J8FA 6CPAA 1P4MA 1GHEA 4YAUA 4GS4A 3R96A 3ISXA
chains in the Genus database with same CATH topology
1GYTA 3NH8A 5JH9A 4EWTA 1ZG8A 3B3SA 4MXUA 1DTDA 2BCOA 4YWYA 2CF4A 3PRTA 3PB4X 2ZEGA 4MHNA 4P45A 1CX8A 4ZX9A 4LQGA 2ZOFA 2ANPA 4MHYA 2OOTA 4IK2A 2ZEHA 3D68A 1BAVA 4ONWA 1CPSA 3RZAA 1PYTB 1YMEA 4P10A 1QQ9A 4OC4A 2ZEMA 3LMSA 1ZG7A 2POKA 3SI1A 4A37A 1F2PA 2PRQA 3B3TA 1TKHA 2ZEDA 1F57A 4EFDA 1Z5RA 1FNOA 1UWYA 4PPZA 2PJ0A 4ZY1A 3HLPA 5CPAA 4WJBA 2DEAA 3I1UA 3SI0A 1CPXA 5THWA 3BXMA 1TF8A 3KASA 1QMUA 3GUXA 3S9MA 2V8GA 3VARA 4UIBA 5LRKA 1Z8LA 2JBKA 4OKOA 3IWWA 4F9VA 1NSAA 2NSMA 4PXEA 5F09A 3B3WA 2Q51A 5HVHA 2QYVA 3WC6A 3BI0A 4G1PA 4BD9A 4EMEA 2AFXA 1H8LA 3KHZA 3GB0A 4OC0A 2AFUA 3NFZA 3PB7X 3TC8A 4PQAA 3FMCA 3L2NA 2Q4ZA 3WT4A 3B35A 2FVGA 1XJOA 3FF3A 4P4DA 2PIZA 4UF4A 4W9YA 5JGFA 3PFOA 2ZEEA 2PVVA 3CT9A 4NGPA 8CPAA 4NJRA 4NGQA 3D7DA 5J1QA 3RBUA 4P6YA 3DLJA 2PJ8A 2G9DA 7CPAA 3BHXA 3CDXA 2JBJA 3KQXA 3PB8X 4DUKA 3D4UA 3SJFA 2V77A 3IC1A 3K9TA 3H8FA 4X2TA 3KI9A 5HXDA 1ARLA 2AFOA 5LYIA 3H8EA 3PBEA 2IJZA 1R3NA 4OP4A 5LRJA 2ZENA 4FAIA 4CPAA 3B2YA 4R8FA 5IB9A 2OR4A 3KGQA 1YSJA 2PJCA 3JRUA 4OC3A 2C1CA 1BPNA 1Q7LA 3KQZA 3ISZA 5JM6A 3D7GA 4GM5A 5LYLA 2F8HA 4OMEA 3T8WA 4MCQA 4A38A 4NJQA 1Y0YA 3B7IA 4ZYQA 1CP7A 2BO9A 1TKJA 3CPXA 5LYFA 1LOKA 1HDQA 3B3CA 5K8OA 3IIBA 3IO1A 1VHOA 3TX8A 4ZY2A 1LANA 3HUVA 4UEZA 4B6ZA 3NA6A 3GLJA 3KR5A 1Y0RA 2BOAA 3PFEA 3LWUA 1VHEA 2PJ9A 2NYQA 3IJ3A 2GLFA 3WC7A 1HDUA 2PJAA 4FWUA 4R6TA 4DYOA 4MCPA 1VGYA 2HB6A 1YLOA 3V38A 3VATA 2IQ6A 2O53A 2CTBA 1TF9A 3PB9X 2ZELA 3MRUA 1TXRA 4A39A 2AFZA 2VL1A 1KWMA 3S9LA 4JZ0A 3D66A 2PVWA 4FBEA 2CIJA 4P44A 4TWEA 2PJ1A 3WABA 2GREA 4P4BA 1XMBA 1VIXA 2PIYA 3H8GA 3SJGA 1XBUA 1Y7EA 3MN8A 2WYRA 1TKFA 4A94A 2AFWA 2GU2A 4MCSA 1XFOA 3FH4A 1LFWA 1CBXA 1LCPA 5K8MA 3V7ZA 1BLLE 2IMOA 3D67A 5CBMA 4NGTA 3D7FA 1LAMA 1IY7A 1ELLP 4MRIA 3DGVA 2V8HA 4PXBA 5ELYA 3NH4A 2F7VA 1EE3P 3PBBA 5LRGA 2V8VA 1FT7A 3FVLA 2XEGA 4R76A 3N5FA 4Z65A 4OC1A 1CP6A 2O4HA 2C6GA 3BI1A 4ZX8A 5D29A 2XEJA 2PE3A 3PEIA 2EWBA 1HEEA 4UEEA 4NFRA 4P4IA 2PJ2A 4X8IA 4P4EA 3PB6X 3FEEA 4PXCA 3SJXA 4PXDA 4NGNA 4ZY0A 3FJUA 2GLJA 2V8DA 2C6PA 3FEDA 3KR4A 2J9AA 1R43A 5K8PA 4YU9A 3KZWA 4OC2A 3IFEA 5HVGA 1ZLIA 2XEFA 5HVFA 1ELMP 3IEHA 4OIDA 4DJLA 4WWVA 4Q7AA 3NH5A 2XEIA 2PJBA 4NGRA 4NGSA 4ZI6A 1CG2A 5I4MA 2PJ6A 3RAMA 2AFSA 2PJ3A 3SJEA 2EK8A 1DE4C 3K2KA 1BPMA 2AFMA 1IGBA 5D8NA 1OBRA 4IHMA 2EK9A 4OIWA 4UEFA 2HC9A 3KL9A 5DS0A 2JEWA 2PJ5A 1AYEA 4IAVA 4TNUA 3S9NA 4MHPA 4MCRA 4O23A 1ZLHA 2WZNA 3FECA 3D7HA 1PCAA 4MMOA 4F8ZA 3KHXA 2ZEPA 1YW6A 2I3CA 4FUUA 3B3VA 2QVPA 2PJ7A 4F9UA 4AXVA 1RTQA 2ABZA 4KSIA 1Z2LA 1JQGA 1LAPA 2C6CA 5K8NA 4MHZA 3FX6A 4RUHA 5LYDA 1F2OA 1ARMA 1AMPA 4X3RA 4P4FA 1YW4A 4NGMA 2ZEFA 2CTCA 4OC5A 2RFHA 3QNVA 4R7MA 3SI2A 4P4JA 2Q43A 2ZEOA 2QJ8A 4UIAA 1XRYA 4H2KA 2PCUA 3VH9A 3CPAA 2PJ4A 3WC5A 1M4LA 4JYWA 1ZG9A 4K3NA 2ZOGA 2RB7A 6CPAA 3ISXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYT A;  3NH8 A;  5JH9 A;  4EWT A;  1ZG8 A;  3B3S A;  4MXU A;  1DTD A;  2BCO A;  4YWY A;  2CF4 A;  3PRT A;  3PB4 X;  2ZEG A;  4MHN A;  4P45 A;  1CX8 A;  4ZX9 A;  4LQG A;  2ZOF A;  2ANP A;  4MHY A;  2OOT A;  4IK2 A;  2ZEH A;  3D68 A;  1BAV A;  4ONW A;  1CPS A;  3RZA A;  1PYT B;  1YME A;  4P10 A;  1QQ9 A;  4OC4 A;  2ZEM A;  3LMS A;  1ZG7 A;  2POK A;  3SI1 A;  4A37 A;  1F2P A;  2PRQ A;  3B3T A;  1TKH A;  2ZED A;  1F57 A;  4EFD A;  1Z5R A;  1FNO A;  1UWY A;  4PPZ A;  2PJ0 A;  4ZY1 A;  3HLP A;  5CPA A;  4WJB A;  2DEA A;  3I1U A;  3SI0 A;  1CPX A;  5THW A;  3BXM A;  1TF8 A;  3KAS A;  1QMU A;  3GUX A;  3S9M A;  2V8G A;  3VAR A;  4UIB A;  5LRK A;  1Z8L A;  2JBK A;  4OKO A;  3IWW A;  4F9V A;  1NSA A;  2NSM A;  4PXE A;  5F09 A;  3B3W A;  2Q51 A;  5HVH A;  2QYV A;  3WC6 A;  3BI0 A;  4G1P A;  4BD9 A;  4EME A;  2AFX A;  1H8L A;  3KHZ A;  3GB0 A;  4OC0 A;  2AFU A;  3NFZ A;  3PB7 X;  3TC8 A;  4PQA A;  3FMC A;  3L2N A;  2Q4Z A;  3WT4 A;  3B35 A;  2FVG A;  1XJO A;  3FF3 A;  4P4D A;  2PIZ A;  4UF4 A;  4W9Y A;  5JGF A;  3PFO A;  2ZEE A;  2PVV A;  3CT9 A;  4NGP A;  8CPA A;  4NJR A;  4NGQ A;  3D7D A;  5J1Q A;  3RBU A;  4P6Y A;  3DLJ A;  2PJ8 A;  2G9D A;  7CPA A;  3BHX A;  3CDX A;  2JBJ A;  3KQX A;  3PB8 X;  4DUK A;  3D4U A;  3SJF A;  2V77 A;  3IC1 A;  3K9T A;  3H8F A;  4X2T A;  3KI9 A;  5HXD A;  1ARL A;  2AFO A;  5LYI A;  3H8E A;  3PBE A;  2IJZ A;  1R3N A;  4OP4 A;  5LRJ A;  2ZEN A;  4FAI A;  4CPA A;  3B2Y A;  4R8F A;  5IB9 A;  2OR4 A;  3KGQ A;  1YSJ A;  2PJC A;  3JRU A;  4OC3 A;  2C1C A;  1BPN A;  1Q7L A;  3KQZ A;  3ISZ A;  5JM6 A;  3D7G A;  4GM5 A;  5LYL A;  2F8H A;  4OME A;  3T8W A;  4MCQ A;  4A38 A;  4NJQ A;  1Y0Y A;  3B7I A;  4ZYQ A;  1CP7 A;  2BO9 A;  1TKJ A;  3CPX A;  5LYF A;  1LOK A;  1HDQ A;  3B3C A;  5K8O A;  3IIB A;  3IO1 A;  1VHO A;  3TX8 A;  4ZY2 A;  1LAN A;  3HUV A;  4UEZ A;  4B6Z A;  3NA6 A;  3GLJ A;  3KR5 A;  1Y0R A;  2BOA A;  3PFE A;  3LWU A;  1VHE A;  2PJ9 A;  2NYQ A;  3IJ3 A;  2GLF A;  3WC7 A;  1HDU A;  2PJA A;  4FWU A;  4R6T A;  4DYO A;  4MCP A;  1VGY A;  2HB6 A;  1YLO A;  3V38 A;  3VAT A;  2IQ6 A;  2O53 A;  2CTB A;  1TF9 A;  3PB9 X;  2ZEL A;  3MRU A;  1TXR A;  4A39 A;  2AFZ A;  2VL1 A;  1KWM A;  3S9L A;  4JZ0 A;  3D66 A;  2PVW A;  4FBE A;  2CIJ A;  4P44 A;  4TWE A;  2PJ1 A;  3WAB A;  2GRE A;  4P4B A;  1XMB A;  1VIX A;  2PIY A;  3H8G A;  3SJG A;  1XBU A;  1Y7E A;  3MN8 A;  2WYR A;  1TKF A;  4A94 A;  2AFW A;  2GU2 A;  4MCS A;  1XFO A;  3FH4 A;  1LFW A;  1CBX A;  1LCP A;  5K8M A;  3V7Z A;  1BLL E;  2IMO A;  3D67 A;  5CBM A;  4NGT A;  3D7F A;  1LAM A;  1IY7 A;  1ELL P;  4MRI A;  3DGV A;  2V8H A;  4PXB A;  5ELY A;  3NH4 A;  2F7V A;  1EE3 P;  3PBB A;  5LRG A;  2V8V A;  1FT7 A;  3FVL A;  2XEG A;  4R76 A;  3N5F A;  4Z65 A;  4OC1 A;  1CP6 A;  2O4H A;  2C6G A;  3BI1 A;  4ZX8 A;  5D29 A;  2XEJ A;  2PE3 A;  3PEI A;  2EWB A;  1HEE A;  4UEE A;  4NFR A;  4P4I A;  2PJ2 A;  4X8I A;  4P4E A;  3PB6 X;  3FEE A;  4PXC A;  3SJX A;  4PXD A;  4NGN A;  4ZY0 A;  3FJU A;  2GLJ A;  2V8D A;  2C6P A;  3FED A;  3KR4 A;  2J9A A;  1R43 A;  5K8P A;  4YU9 A;  3KZW A;  4OC2 A;  3IFE A;  5HVG A;  1ZLI A;  2XEF A;  5HVF A;  1ELM P;  3IEH A;  4OID A;  4DJL A;  4WWV A;  4Q7A A;  3NH5 A;  2XEI A;  2PJB A;  4NGR A;  4NGS A;  4ZI6 A;  1CG2 A;  5I4M A;  2PJ6 A;  3RAM A;  2AFS A;  2PJ3 A;  3SJE A;  2EK8 A;  1DE4 C;  3K2K A;  1BPM A;  2AFM A;  1IGB A;  5D8N A;  1OBR A;  4IHM A;  2EK9 A;  4OIW A;  4UEF A;  2HC9 A;  3KL9 A;  5DS0 A;  2JEW A;  2PJ5 A;  1AYE A;  4IAV A;  4TNU A;  3S9N A;  4MHP A;  4MCR A;  4O23 A;  1ZLH A;  2WZN A;  3FEC A;  3D7H A;  1PCA A;  4MMO A;  4F8Z A;  3KHX A;  2ZEP A;  1YW6 A;  2I3C A;  4FUU A;  3B3V A;  2QVP A;  2PJ7 A;  4F9U A;  4AXV A;  1RTQ A;  2ABZ A;  4KSI A;  1Z2L A;  1JQG A;  1LAP A;  2C6C A;  5K8N A;  4MHZ A;  3FX6 A;  4RUH A;  5LYD A;  1F2O A;  1ARM A;  1AMP A;  4X3R A;  4P4F A;  1YW4 A;  4NGM A;  2ZEF A;  2CTC A;  4OC5 A;  2RFH A;  3QNV A;  4R7M A;  3SI2 A;  4P4J A;  2Q43 A;  2ZEO A;  2QJ8 A;  4UIA A;  1XRY A;  4H2K A;  2PCU A;  3VH9 A;  3CPA A;  2PJ4 A;  3WC5 A;  1M4L A;  4JYW A;  1ZG9 A;  4K3N A;  2ZOG A;  2RB7 A;  6CPA A;  3ISX A; 
#chains in the Genus database with same CATH topology
 3NH8 A;  1ZG8 A;  1M90 D;  4LBZ A;  2WR8 A;  1N0U A;  2BCO A;  1CX8 A;  2YWG A;  3QSY A;  3CW2 A;  4ZX9 A;  4B10 A;  2ZOF A;  2FSR A;  3ZZT A;  3ZZU A;  2G3A A;  3H9N A;  1E3Z A;  2Z3L A;  1XOV A;  4EH1 A;  4UBR A;  3RZA A;  1NB9 A;  4WZE A;  1YME A;  1N05 A;  2WJY A;  4P10 A;  1QQ9 A;  3ZZI A;  2BM1 A;  2GJP A;  1H8E A;  1S7K A;  4AVA A;  4XLE A;  4JXR A;  2P6F A;  1TKH A;  4EFD A;  5TRD A;  1M4I A;  1Z5R A;  2R7H A;  1EWY A;  3DDD A;  1XF8 A;  4ZY1 A;  4CAX A;  3CTA A;  2Z6B D;  1OHH A;  4TMW A;  3JQP A;  5CDF A;  5CPA A;  5HMN A;  2HUZ A;  2DEA A;  3I1U A;  2VBV A;  1OB2 A;  1CPX A;  1UD2 A;  3P27 A;  1TF8 A;  3KAS A;  1DDI A;  3GUX A;  1Y7R A;  1EP2 B;  1BLI A;  4KKU A;  1KC8 D;  2V8G A;  4II2 A;  1Z8L A;  4CYO A;  2V4D A;  1KUX A;  4F9V A;  3MMP A;  4Q7J B;  2DEU A;  3LOD A;  2ZL6 A;  2NSM A;  3IWE A;  4PXE A;  2DET A;  5EMI A;  1IYK A;  1S72 B;  5IK2 A;  4RD6 A;  3I1F A;  4ROX A;  2Y0M A;  5HVH A;  3CCR B;  1Q86 D;  2GE3 A;  2ZZE A;  3AST A;  4Z4R A;  1M1D A;  1R57 A;  3FMC A;  3ASR A;  1HA3 A;  1YIJ B;  4AVZ A;  2V7T A;  1Q2C A;  2B58 A;  1AIP A;  1RO5 A;  2KVO A;  4AG7 A;  2OZH A;  4KOS A;  4NGQ A;  1GAW A;  1I7P A;  1S3Z A;  2R9V A;  4B12 A;  1ZO0 A;  4B14 A;  3RBU A;  3B8G A;  3SJZ A;  3DR8 A;  2GJR A;  4UFX A;  4DK0 A;  1W87 A;  1I12 A;  1S0U A;  2WUU A;  5HKK A;  2JBJ A;  2BF4 A;  3PB8 X;  1EFC A;  4KOY A;  2QGG A;  2V77 A;  1K73 D;  1JB9 A;  3W5H A;  1RXT A;  4P3I A;  1FY7 A;  2HLD A;  2AFO A;  3EY5 A;  5F4O A;  4MFP A;  2G3T A;  2PR8 A;  4N3N A;  1NBM A;  2V7W A;  4FAI A;  1NMT A;  4CPA A;  3B2Y A;  1Q82 D;  4K30 A;  1EFR A;  1YSJ A;  3OP1 A;  3G3S A;  4PSX A;  1PUA A;  4F7D A;  3JRU A;  4UWJ A;  4AF7 A;  3ISZ A;  1KJZ A;  2Q04 A;  3CC4 B;  4U9U A;  3T9Y A;  5GV8 A;  5LYL A;  4RJL A;  1QVF B;  4OME A;  4G1V A;  1G7S A;  3OE7 A;  4ZGN B;  4G7X A;  1B23 P;  1EFT A;  1HDQ A;  4Z4W A;  5KTC A;  3ZZ0 A;  2D4O A;  2F5I A;  4CAW A;  1VHO A;  3FRM A;  3N7Z A;  4ZY2 A;  1D2E A;  2X53 S;  4B6Z A;  3NE8 A;  3GLJ A;  2YND A;  1Y0R A;  3FXT A;  5FO1 A;  3PFE A;  1VHE A;  4X07 A;  5G1Z A;  1QGZ A;  1OB5 A;  3ZC3 A;  4FWU A;  1KZF A;  4OP7 A;  2BMW A;  3A8K A;  4XM3 A;  2HB6 A;  5EC4 A;  4U5Y A;  4B5P B;  2VEZ A;  1VQ6 B;  1N08 A;  1TXR A;  2Q4V A;  4A39 A;  3GSI A;  3CCM B;  2I00 A;  2AHO A;  5GCN A;  4KVO E;  3CMM A;  3FKS A;  3CRZ A;  4JZ0 A;  1N06 A;  2PVW A;  4YAL A;  2AJ6 A;  4FD7 A;  4GXH A;  3H4Q A;  5HXB A;  2BGJ A;  5F49 A;  2GJK A;  2PSW A;  2R1I A;  5JQ4 A;  1XBU A;  4ZGY B;  1Y7E A;  3WYA A;  2WYR A;  1A8P A;  4A94 A;  2GIV A;  4OPV A;  4NF1 A;  2GU2 A;  2FX3 A;  3DNS A;  2P6E A;  3V7A A;  3IGR A;  3GQB A;  3C26 A;  2XZL A;  5F47 A;  2C2W A;  2ZBU A;  5KW9 A;  3ONU A;  3NE7 A;  2HV2 A;  2V8H A;  3LVB A;  1KMH A;  5E6T A;  2F1L A;  3FVL A;  3VNU A;  2C4T A;  3PUN A;  4Q36 A;  3OZW A;  4RDL A;  5IYN A;  4HE6 A;  2HDN B;  3WBK A;  2O4H A;  3CB4 A;  1BMF A;  2PE3 A;  3R9E A;  4ASU A;  4HNW B;  1JWQ A;  4YFJ A;  2EIX A;  5FO0 A;  2GQF A;  3MGD A;  4LQ6 A;  4NFR A;  1BO4 A;  3FEE A;  4OPS A;  4KKS A;  4X7C A;  2Z3P A;  4KLV A;  4RCZ A;  2QMU A;  4PXD A;  3Q6Q A;  4ZY0 A;  3FJU A;  2V8D A;  5IB0 A;  4UAJ A;  2C6P A;  2BM0 A;  1R43 A;  2VBU A;  3LQ6 A;  2CNS A;  4IW3 B;  2YWF A;  2FS5 A;  5HVF A;  1T5E A;  1YX2 A;  4MY0 A;  2QDX A;  4KSA A;  4WWV A;  4Q7A A;  4XNH B;  4DJL A;  4UZE A;  5G20 A;  3NH5 A;  1HVX A;  2PJB A;  2CC2 A;  4KVX A;  4NGR A;  1SM4 A;  1T6Y A;  4ZI6 A;  2VBQ A;  1CG2 A;  5I4M A;  3RAM A;  2AFS A;  2EK8 A;  1WSV A;  2B7B A;  5TY0 A;  4MI4 A;  3OZV A;  3K2K A;  4XPL A;  1J4J A;  1IGB A;  5D8N A;  3TE4 A;  1FDR A;  3QFC A;  4RLZ A;  5C82 A;  3GVL A;  1KK0 A;  1Y9K A;  2QEX B;  4OIW A;  2C5B A;  1WWZ A;  2P6G A;  4RDK A;  3I56 B;  1KTV A;  2J8R A;  3CXC B;  1QUE A;  1Q2Y A;  2PJ7 A;  4AXV A;  1RTQ A;  2B4D A;  3SLD A;  3QAH A;  4LUA A;  1T6Z A;  1JQG A;  4R71 A;  5K8N A;  1NDH A;  1XQB A;  3RYO A;  5DWM A;  2Z3K A;  4J3G A;  5EBV A;  4P9S A;  4NXY A;  1QG0 A;  4QB9 A;  3RNZ A;  2VZL A;  1YX0 A;  5AG4 A;  1QGY A;  4Z4Y A;  4G1B A;  4B43 A;  4OC5 A;  3ZUG A;  2QJ8 A;  2V7Q A;  3W5V A;  3JU4 A;  3BJ8 A;  1NSL A;  4X7D A;  4PC7 A;  2DOG A;  3TOB A;  2ZOG A;  2VI7 A;  4FD5 A;  3TO6 A;  3OJW A;  2VBT A;  4RD3 A;  2B7C A;  5DN6 A;  4MFL A;  4EWT A;  4BMH A;  2CF4 A;  3PB4 X;  4MHN A;  2X3U A;  4M0L A;  3CXQ A;  1MAB A;  2ANP A;  4MHY A;  4U9Y A;  4RS2 A;  1WPC A;  2Q6I A;  4X7E A;  1QFY A;  1Z8W A;  4JD6 A;  4ONW A;  5I0C A;  1WK4 A;  3EXN A;  4YHB A;  4XMY A;  4XR6 A;  3LMS A;  1ZG7 A;  2GK7 A;  1F2P A;  5E96 A;  1Q81 D;  3LAC A;  3B3T A;  3A3B A;  3JTK A;  4H89 A;  2ZED A;  3DSB A;  4CS0 B;  2D74 A;  2B4D B;  4KVM E;  2KCW A;  1XE1 A;  1Z8X A;  1FNC A;  2XZP A;  5AG5 A;  1GO2 A;  2JJ2 A;  1QFZ A;  4B3X A;  1FNM A;  4P2N A;  2VZZ A;  3VAR A;  3BY1 A;  2BV3 A;  1WOS A;  2PDO A;  3IWW A;  1MJ9 A;  3B78 A;  3PEN A;  2V7V A;  2BPO A;  1NSA A;  2DPT A;  3NE5 B;  1AUG A;  1W9X A;  3GY9 A;  1M4D A;  3WXM A;  5IYP A;  2Q51 A;  1M44 A;  2QYV A;  2EFG A;  3J81 k;  4G1P A;  4FD6 A;  3WC6 A;  5TR9 A;  1H8L A;  4A33 A;  2D9R A;  3PB7 X;  3CXP A;  2O28 A;  1QX4 A;  4G6I A;  2FL4 A;  4PQA A;  1IJF A;  2WJV A;  3WT4 A;  4UCN A;  2FVG A;  3FF3 A;  4KLW A;  4UF4 A;  2C4U A;  2Z3O A;  1UD8 A;  1VQ5 B;  4BIN A;  2ZEE A;  1KK1 A;  1FX0 A;  3CT9 A;  4AVC A;  3T56 B;  4X5K A;  1QVG B;  3W2F A;  1IYL A;  4P6Y A;  2PJ8 A;  1XEB A;  1VQL B;  2WPD A;  4C0S A;  1IU8 A;  3KQX A;  4DUK A;  3D4U A;  3SJF A;  5KNL A;  1V0C A;  4B3G A;  3A9L A;  3H8F A;  1I18 A;  2XNC A;  1R3N A;  2OTL B;  4M6G A;  1GVH A;  1IB0 A;  4C2Z A;  3T90 A;  2GPJ A;  4OC3 A;  3EC4 A;  4TN1 A;  4TMV A;  1QSN A;  3CC7 B;  1Q7L A;  1E63 A;  3KQZ A;  3IU1 A;  2PQ8 A;  3FBU A;  4B44 A;  4RCY A;  3D3S A;  2G0B A;  3D7G A;  4CYQ A;  4UCM A;  4MFK A;  3VWE A;  4CYP A;  2VNJ A;  4MCQ A;  4A38 A;  1OGI A;  4ZYQ A;  3RO0 A;  3TT2 A;  4P1V A;  2BO9 A;  2Q4Y A;  1TKJ A;  4CGL A;  5LYF A;  1LOK A;  4UZF A;  1FRQ A;  1Q9S A;  3IIB A;  2QEC A;  4AB7 A;  4KOX A;  3HUV A;  2J7K A;  3NA6 A;  1YJN B;  4HIZ A;  3FNC A;  1TUI A;  2BOA A;  2DF5 A;  3LWU A;  2BUE A;  2VJI A;  3R9F A;  2ZTN A;  3JVN A;  4PSW A;  1P0H A;  5IYR A;  2VNK A;  4P22 A;  4Y9U A;  2PJA A;  3FB3 A;  5A27 A;  4R6T A;  3QFR A;  4XL9 A;  4MHD A;  4TSF A;  5AGE A;  4XOP A;  4MCP A;  4ZBG A;  3VO2 A;  3FYN A;  2IQ6 A;  3OEH A;  3D2M A;  2ZEL A;  3MRU A;  2ZL7 A;  5IX3 A;  3ZPN A;  5ISV A;  1KWM A;  2JDI A;  3TTH A;  3S9L A;  1ELO A;  1BX0 A;  3MHP A;  2PJ1 A;  2OBR A;  2R8V A;  4ACB A;  3AGQ A;  3MN8 A;  4ZCL A;  3OKX A;  1SKQ A;  2VJJ A;  1TKF A;  4MCS A;  1XFO A;  5A88 A;  1LFW A;  1U6M A;  1OGJ A;  2VXK A;  4XPD B;  3WND A;  3F5B A;  3CXS A;  4F6A A;  4AF6 A;  4NGT A;  1DAR A;  3D7F A;  1LAM A;  4YAF A;  1IY7 A;  5GV7 A;  1WU8 A;  4RD4 A;  2ZZG A;  3DGV A;  3CZX A;  4PXB A;  1XMT A;  3TCV A;  2PR1 A;  2V8V A;  2EVN A;  1FT7 A;  3A8I A;  3T51 B;  4OC1 A;  3P2F A;  3ASQ A;  1CP6 A;  3SLN A;  2C6G A;  2QN6 A;  2FIA A;  2HQY A;  3JUW A;  2M5S A;  3BI1 A;  4XN3 A;  4ZX8 A;  1J9Z A;  4KOV A;  2XEJ A;  1R5N A;  1PKV A;  1H85 A;  5F48 A;  2ZIT A;  4DNR B;  1D1N A;  4UEE A;  1U2R A;  2REF A;  2V7X A;  2PJ2 A;  4HPS A;  4P4E A;  3JQQ A;  4QUZ A;  3PB6 X;  4PXC A;  2CBX A;  3I55 B;  2OTJ B;  4MFZ A;  1ZUN B;  2ZXH A;  3AVT A;  4QV2 A;  1Q2D A;  3SJX A;  2Z10 A;  4NGN A;  2J8N A;  2GLJ A;  3TFY A;  5K8P A;  1CNF A;  4YU9 A;  2K5T A;  3R95 A;  4MYU A;  2B5G A;  4OC2 A;  1JA1 A;  3CMA B;  1ELM P;  4HNY B;  4KSF A;  4OID A;  4F0X A;  4C2Y A;  3A3G A;  1ZM9 A;  1EP1 B;  4OPO A;  4MBU A;  1KK3 A;  1NB0 A;  3AVX A;  4CAE A;  2X6Y A;  2VBS A;  1OBR A;  4OAD A;  4M1K A;  5AG6 A;  4E0F A;  1VKC A;  2ZZF A;  4KOT A;  4XLC A;  2JEW A;  3RY8 A;  2PJ5 A;  1SQH A;  1KK2 A;  3PZJ A;  4IAV A;  3S9N A;  4MHP A;  4O23 A;  2WZN A;  3VNV A;  5DSZ A;  4CGM A;  4U9Z A;  4XPD C;  2ZEP A;  3I9S A;  4CRY B;  2CNT A;  2VQY A;  4FUU A;  2QVP A;  3R1K A;  2ZW5 A;  2ABZ A;  2PMD A;  2R98 A;  1W2B B;  4M6H A;  4CGP A;  1Z2L A;  5KSW B;  3KKW A;  2QA4 B;  3DDY A;  3GYA A;  3CCS B;  2EBJ A;  4QUS A;  4RDJ A;  1N0V C;  2XND A;  3WBJ A;  1X10 A;  1YQE A;  5LYD A;  1F2O A;  4XON A;  1AMO A;  3W5U A;  2E1R A;  2JN9 A;  1Z4E A;  1YW4 A;  2WPW A;  1VQ4 B;  3OOC A;  4R7M A;  2FE7 A;  2Q43 A;  2ZEO A;  2V7U A;  3GIU A;  2J8M A;  3QE2 A;  2RC5 A;  4N3G A;  4H2K A;  4R3L A;  5BWA B;  3VH9 A;  3WC5 A;  1S5K A;  4AG9 A;  3LO8 A;  4JYW A;  1JJ2 B;  4WZT A;  1MRZ A;  2BL1 A;  2RB7 A;  5J8C A;  2X6W A;  3OW7 A;  1GYT A;  5JH9 A;  4YWY A;  4YAW A;  1NJI D;  3G05 A;  4R3K A;  3AVW A;  3WNB A;  4YGO A;  4H9G A;  2ZZQ A;  1XE4 A;  4LQG A;  1G7T A;  1QUF A;  3VMF A;  4B48 A;  4C7I A;  4IK2 A;  3D68 A;  1YGH A;  4LC0 A;  1IOF A;  4ORF A;  4GQN A;  1CPS A;  5F46 A;  2Z11 A;  1W0J A;  1PYT B;  1VLY A;  4OC4 A;  4A37 A;  2PRQ A;  2Q7B A;  3ZIA A;  1WDT A;  1F57 A;  2ZXV A;  1FNO A;  1UWY A;  3BJ7 A;  1M4G A;  1SKY B;  4M53 A;  4TMT A;  2YWE A;  3PA1 A;  3SJP A;  4QVA A;  1K28 D;  3HLP A;  4P12 A;  1QGA A;  1KQS B;  1QSM A;  4NBS A;  3OAA A;  4NEX A;  3E0K A;  2WSA A;  5HZA A;  3SI0 A;  1X12 A;  3BXM A;  3LD2 A;  3G71 B;  5DWN A;  1VHS A;  3S9M A;  3ES9 A;  4OOS A;  2WPX A;  2JBK A;  2CK3 A;  4KOW A;  5FL7 A;  3OZU A;  4ZV4 A;  3G8W A;  2DPS A;  2DER A;  1RQP A;  2ODF A;  4B5O A;  3U6K A;  5G21 A;  4H6U A;  3B3W A;  1D8T A;  1I21 A;  4MFQ A;  1UD5 A;  2FXF A;  2DXQ A;  2E1B A;  3BI0 A;  1QSR A;  1YJ9 B;  1CJW A;  2W6I A;  2AFX A;  1W34 A;  2EO8 A;  2AFU A;  5THX A;  1K9M D;  1YVO A;  2BSW A;  3L2N A;  4XKV A;  3D26 A;  3B35 A;  3VO1 A;  1BX1 A;  4X05 A;  4P4D A;  2PIZ A;  2VYQ A;  4I49 A;  1DG1 G;  2XZO A;  5BSX A;  5JGF A;  3W6X A;  3P2H A;  4A31 A;  4XNF A;  4R57 A;  2PVV A;  4A30 A;  5EMN A;  8CPA A;  5J1Q A;  7CPA A;  3BHX A;  3CDX A;  1ZM4 A;  4X06 A;  1VQO B;  3CCQ B;  1E3X A;  3IC1 A;  5H59 A;  3KI9 A;  1ARL A;  1MJA A;  5LYI A;  3W91 A;  3H8E A;  4OP4 A;  2Q6O A;  1IOI A;  4LBV A;  4KKT A;  4P26 A;  2B4B A;  3OW2 B;  3ZJ0 A;  1LRZ A;  3W2I A;  4L8J A;  2WZP P;  1QST A;  4R8F A;  4YXW A;  5A8A A;  3A1P A;  1B6B A;  4QVJ A;  3KGQ A;  3ASS A;  2QIR A;  2PJC A;  3SEJ A;  2CY2 A;  4HKF A;  2C1C A;  2ZBV A;  1S7F A;  1KZL A;  4M85 A;  1VQK B;  1MJB A;  5JM6 A;  2R6H A;  4KOR A;  1BQE A;  2ZL5 A;  4GM5 A;  3T53 B;  5AN9 A;  2F4N A;  2F8H A;  3T8W A;  3KEW A;  4ONU A;  3B7I A;  4X7F A;  4C43 A;  2X85 A;  2PRB A;  1E64 A;  3B3C A;  5K8O A;  3BCD A;  4JXQ A;  4YEJ A;  3IO1 A;  1XIX A;  3TX8 A;  3B82 A;  3LQE A;  4Y7C A;  2PC1 A;  4UEZ A;  4UCP A;  3KR5 A;  4QBJ A;  1W0K A;  4A2Z A;  3CP2 A;  4II9 A;  4PGO A;  1I8D A;  2Z3N A;  2GLF A;  3QFS A;  2ZW4 A;  2X6X A;  1VGY A;  2DIE A;  4RM0 A;  4LX9 A;  4Y9R A;  3V38 A;  1Z4R A;  2X8K A;  3BH4 A;  4R87 A;  2O53 A;  3GKR A;  2VNH A;  3MCA A;  4LBW A;  2VL1 A;  3OJX A;  4KS9 A;  1IHM A;  1VQ9 B;  1VQN B;  4CYN A;  4DNC A;  1N8R D;  1JNY A;  3D66 A;  2OYN A;  2CIJ A;  4P44 A;  1BPL A;  2OB0 A;  5JPH A;  1CQX A;  3SXO A;  3F8K A;  4B13 A;  1XMB A;  3G4S B;  3CCE B;  4HNX B;  2JDC A;  2XEX A;  2ZXI A;  2OBS A;  3H8G A;  3AVV A;  3IU2 A;  3SJG A;  2ARH A;  3LNN A;  2AFW A;  2GAN A;  2ZW7 A;  1EFU A;  3FH4 A;  2BVN A;  4XD7 A;  1M1K D;  4NCZ A;  3CD6 B;  3CCJ B;  5KTA A;  5K8M A;  4PC3 A;  4EVY A;  3EO4 A;  3V7Z A;  1BLL E;  4WQM A;  2IMO A;  3D67 A;  5HH1 A;  5CBM A;  1UD4 A;  3B8H A;  1F20 A;  1E62 A;  4PK2 A;  1MK4 A;  1VF7 A;  5KTD A;  2VZY A;  4Z4V A;  4MRI A;  4M3S A;  3NH4 A;  2Q7S A;  1EE3 P;  3D8P A;  3PBB A;  5LRG A;  2JLM A;  1A2Z A;  3R6K A;  2X7B A;  2XEG A;  4R76 A;  3N5F A;  4Z65 A;  1R5O A;  2A4N A;  3SHP A;  4OOV A;  1WOR A;  5D29 A;  4Z4U A;  2XNJ A;  4WZK A;  4LBY A;  2EWB A;  2C78 A;  1HEE A;  1GJR A;  3QFT A;  1XB2 A;  4X8I A;  3FIX A;  4TMZ A;  1Q7Y D;  4A32 A;  4XOT A;  1UFH A;  4Z1M A;  1H42 A;  3KR4 A;  2YGW A;  3FED A;  2J9A A;  1I1D A;  3KZW A;  1QSO A;  5H5J A;  3IFE A;  4P25 A;  2RC6 A;  1ZLI A;  2ZPA A;  1GR1 A;  1DDG A;  1UMK A;  4P6V F;  4QHY A;  1IB1 E;  4AC9 A;  2XEI A;  1KRH A;  1G7R A;  4BPR A;  4NGS A;  4J0Q A;  3JQR A;  1IJE A;  2PJ6 A;  2PJ3 A;  4Y49 C;  1DE4 C;  3QAY A;  4XNH C;  1BPM A;  2AFM A;  1WP6 A;  2BGI A;  3A35 A;  3CC2 B;  1PU9 A;  1E1R A;  4CAV A;  2EK9 A;  2HC9 A;  3KL9 A;  5DS0 A;  4CGN A;  1FND A;  4ZCM A;  1YVK A;  4C7H A;  4TNU A;  3U2Q A;  4B5P A;  4MCR A;  5CNP A;  1ZLH A;  3D7H A;  4G5G A;  5IYW A;  4F8Z A;  4MY3 A;  4XOR A;  1YW6 A;  5FA6 A;  2I3C A;  3B3V A;  3PGP A;  2EUI A;  2VNI A;  4C2X A;  4OAE A;  2W6J A;  2FIW A;  2C6C A;  2Z0Z A;  1N71 A;  1WTH D;  3BCF A;  3I3G A;  1BJK A;  5LMZ A;  4OOX A;  3Q3A A;  2JDD A;  1AMP A;  1S4M A;  5G22 A;  5A89 A;  4X3R A;  3TOA A;  4IUS A;  3ZBU A;  2ZEF A;  4R9M A;  2CTC A;  3CCV B;  2RFH A;  3SI2 A;  5C88 A;  3BY2 A;  2Q6L A;  4XLF A;  5J3O A;  2PCU A;  1YLE A;  2C27 A;  4JMQ A;  4MJ8 A;  4K3N A;  4CAF A;  1V0E A;  4A95 A;  3AVU A;  2CXA A;  3Q6R A;  3B3S A;  3EFA A;  1DTD A;  4MXU A;  3PRT A;  2ZEG A;  3WNC A;  1UD6 A;  4P45 A;  2NV4 A;  2JIZ A;  3BQJ A;  3W2G A;  2OOT A;  2ZEH A;  1BAV A;  4XPK A;  2D3N A;  2FT0 A;  4FN5 A;  3ONY A;  1PJ5 A;  3SKB A;  1YI2 B;  3K9U A;  1V5V A;  3PUM A;  5F4M A;  2ZEM A;  2POK A;  3SI1 A;  4Y49 B;  3CES A;  2OBT A;  3F0A A;  3IWG A;  4Q38 A;  4YRH A;  4PPZ A;  2PJ0 A;  5BSY A;  4HE5 A;  3SXN A;  1B2R A;  2GFQ A;  4MFJ A;  3FPK A;  2OZU A;  4RPD A;  2OZG A;  1Y9W A;  1W35 A;  4B47 A;  3HAG A;  4WJB A;  1VQP B;  4PV6 A;  5THW A;  2B3V A;  4UWI A;  2REE A;  1QMU A;  4B3F X;  1E43 A;  4UIB A;  5LRK A;  2LZJ A;  4OKO A;  1G7C A;  4MYT A;  2CND A;  4TKO B;  2Q44 A;  5F09 A;  2Q0Y A;  1FNB A;  4B11 A;  3TO7 A;  5H86 A;  1TTT A;  4M6I A;  4Z4T A;  4BD9 A;  4EME A;  3KHZ A;  3GB0 A;  4OC0 A;  3NFZ A;  3TC8 A;  1WOP A;  2Q4Z A;  4RPB A;  1ZM3 A;  1K8A D;  1YR0 A;  1QFJ A;  2OK7 A;  1XJO A;  4DQL A;  3CCL B;  4PC2 A;  2YNC C;  4NSQ A;  4W9Y A;  2ATR A;  5JBQ A;  2XGJ A;  3PFO A;  4G7W A;  1Z9U A;  1YK3 A;  2PLF A;  4NGP A;  4NJR A;  3H94 A;  3U6B A;  1QH0 A;  3D7D A;  4L8A A;  3DLJ A;  1S7L A;  2G9D A;  2JEV A;  1NE9 A;  1S7N A;  1IID A;  3GVK A;  1T6X A;  3OWC A;  3R9G A;  4ACA A;  3K9T A;  5FIU A;  4X2T A;  5HXD A;  2YWH A;  3CP8 A;  4DK1 A;  3PBE A;  4K1X A;  2IJZ A;  3ZBT A;  4KUB A;  1V0F A;  3PP9 A;  4UFW A;  5LRJ A;  2ZEN A;  2DCU A;  4ZCI A;  2QML A;  2Z3M A;  1YJW B;  5IB9 A;  3Q39 A;  3BLN A;  2OR4 A;  3W2E A;  1E79 A;  3WY9 A;  2ZW6 A;  1BPN A;  1CNE A;  1VQ8 B;  1L0C A;  1BOB A;  2WSS A;  1E1Q A;  4QVT A;  4H6Z A;  2OK8 A;  4FXU A;  4PAB A;  3E1Y E;  3QB8 A;  4JLY A;  1JA0 A;  4CGO A;  4NJQ A;  1Y0Y A;  2NPF A;  1PJ6 A;  1CP7 A;  2H5M A;  2JJ1 A;  4QFM A;  1VQM B;  2FCK A;  3CPX A;  4KOU A;  4II3 A;  4B4D A;  3E20 A;  3S6G A;  5FNZ A;  1LAN A;  3R6J A;  1K4J A;  3CCU B;  4M4S A;  3CME B;  5A28 A;  4X0C A;  3VR6 A;  2RC4 A;  4YEL A;  4UA3 A;  3OFN A;  1TVC A;  4NNJ A;  2PJ9 A;  1VLO A;  2NYQ A;  3IJ3 A;  2D4P A;  3PVD A;  4F0Y A;  3WC7 A;  2NMT A;  1RQR A;  1HDU A;  1TLL A;  4DYO A;  3AGP A;  1ON0 A;  4RD1 A;  1YLO A;  3BNW A;  1VQ7 B;  3VAT A;  5IV0 A;  3FPP A;  2CTB A;  1TF9 A;  3PB9 X;  4PC1 A;  1VJS A;  2D3L A;  2AFZ A;  3TO9 A;  1YIT B;  1B87 A;  4FBE A;  4XLH A;  4TWE A;  3WAB A;  2GRE A;  3PA2 A;  4P4B A;  3G6E B;  5TV2 A;  1VIX A;  4IF5 A;  3W6S A;  3S6F A;  2PIY A;  2Q6K A;  1NRK A;  3WQZ A;  4PK3 A;  3V76 A;  2I1L A;  4ZGQ B;  4UFV A;  5L46 A;  2B3U A;  2PIA A;  4RD2 A;  2YNE A;  1CBX A;  4DQK A;  4L89 A;  1LCP A;  1UD3 A;  4P3Y A;  4NCN A;  2OH1 A;  3GVJ A;  1WOO A;  4E0A A;  1S60 A;  2GK6 A;  3UY5 A;  4RN7 A;  2CNM A;  3DR6 A;  3S6H A;  1ELL P;  3AVY A;  2DY1 A;  5ELY A;  2F7V A;  4AVB A;  3S6K A;  3Q38 A;  3BC9 A;  4JJX A;  3CPW B;  2QTZ A;  4XN0 A;  5IYQ A;  2BSA A;  3PEI A;  4PC6 A;  2YNC A;  4P4I A;  4CQJ A;  3V8I A;  4C68 A;  4XQF A;  4FD4 A;  2I79 A;  2B5O A;  4WZL A;  1YRE A;  1COW A;  3ASP A;  5FVJ A;  2V31 A;  3W2H A;  1N07 A;  2BN4 A;  1IIC A;  1H8H A;  2QTL A;  4TT3 A;  2QE7 A;  1ZM2 A;  5HZB A;  5HVG A;  2XEF A;  3IEH A;  4YAO A;  4KUA A;  4FK8 A;  1EP3 B;  4Z4S A;  5AG7 A;  3OPO A;  2BEI A;  3SJE A;  3WR7 A;  4CRZ B;  1F60 A;  4BBH A;  4FWT A;  2X0K A;  4IHM A;  4UEF A;  1R5B A;  1CM0 A;  2P0W A;  2XOK A;  4RD0 A;  2F1M A;  4UZU A;  1P4N A;  1AYE A;  2P3M A;  2F43 A;  3FEC A;  1PCA A;  4MMO A;  1KUV A;  3KHX A;  5J35 A;  3P26 A;  4QC6 A;  4F9U A;  2C5H A;  4KSI A;  1FRN A;  1PJ7 A;  1OB0 A;  1LAP A;  2HCJ B;  5F4J A;  4JWP A;  4M2L A;  5B6I A;  2IL4 A;  1EXM A;  2DYI A;  2B5G B;  2ZTG A;  1Z8T A;  4MHZ A;  3FX6 A;  3OEE A;  3H5Z A;  1HZE A;  4XLA A;  4RUH A;  3A8J A;  4OLL A;  4TMX A;  1ARM A;  1GAQ A;  4RI1 A;  4P4F A;  5H84 A;  4NGM A;  4E2A A;  4E8O A;  2HMA A;  1WSR A;  4PAA A;  3GIR A;  2C77 A;  2OU2 A;  3QNV A;  4P4J A;  4DNT B;  2CRV A;  4Z4Z A;  4UIA A;  1XRY A;  3VWD A;  1KD1 D;  4XKW A;  1KUY A;  3FJO A;  1OZP A;  1YHQ B;  2AE6 A;  2PJ4 A;  3CPA A;  3D2P A;  1M4L A;  4KZT A;  1ZG9 A;  2CW5 A;  1TIQ A;  5J8F A;  6CPA A;  1P4M A;  1GHE A;  4YAU A;  4GS4 A;  3R96 A;  3ISX A; 
#chains in the Genus database with same CATH homology
 1GYT A;  3NH8 A;  5JH9 A;  4EWT A;  1ZG8 A;  3B3S A;  4MXU A;  1DTD A;  2BCO A;  4YWY A;  2CF4 A;  3PRT A;  3PB4 X;  2ZEG A;  4MHN A;  4P45 A;  1CX8 A;  4ZX9 A;  4LQG A;  2ZOF A;  2ANP A;  4MHY A;  2OOT A;  4IK2 A;  2ZEH A;  3D68 A;  1BAV A;  4ONW A;  1CPS A;  3RZA A;  1PYT B;  1YME A;  4P10 A;  1QQ9 A;  4OC4 A;  2ZEM A;  3LMS A;  1ZG7 A;  2POK A;  3SI1 A;  4A37 A;  1F2P A;  2PRQ A;  3B3T A;  1TKH A;  2ZED A;  1F57 A;  4EFD A;  1Z5R A;  1FNO A;  1UWY A;  4PPZ A;  2PJ0 A;  4ZY1 A;  3HLP A;  5CPA A;  4WJB A;  2DEA A;  3I1U A;  3SI0 A;  1CPX A;  5THW A;  3BXM A;  1TF8 A;  3KAS A;  1QMU A;  3GUX A;  3S9M A;  2V8G A;  3VAR A;  4UIB A;  5LRK A;  1Z8L A;  2JBK A;  4OKO A;  3IWW A;  4F9V A;  1NSA A;  2NSM A;  4PXE A;  5F09 A;  3B3W A;  2Q51 A;  5HVH A;  2QYV A;  3WC6 A;  3BI0 A;  4G1P A;  4BD9 A;  4EME A;  2AFX A;  1H8L A;  3KHZ A;  3GB0 A;  4OC0 A;  2AFU A;  3NFZ A;  3PB7 X;  3TC8 A;  4PQA A;  3FMC A;  3L2N A;  2Q4Z A;  3WT4 A;  3B35 A;  2FVG A;  1XJO A;  3FF3 A;  4P4D A;  2PIZ A;  4UF4 A;  4W9Y A;  5JGF A;  3PFO A;  2ZEE A;  2PVV A;  3CT9 A;  4NGP A;  8CPA A;  4NJR A;  4NGQ A;  3D7D A;  5J1Q A;  3RBU A;  4P6Y A;  3DLJ A;  2PJ8 A;  2G9D A;  7CPA A;  3BHX A;  3CDX A;  2JBJ A;  3KQX A;  3PB8 X;  4DUK A;  3D4U A;  3SJF A;  2V77 A;  3IC1 A;  3K9T A;  3H8F A;  4X2T A;  3KI9 A;  5HXD A;  1ARL A;  2AFO A;  5LYI A;  3H8E A;  3PBE A;  2IJZ A;  1R3N A;  4OP4 A;  5LRJ A;  2ZEN A;  4FAI A;  4CPA A;  3B2Y A;  4R8F A;  5IB9 A;  2OR4 A;  3KGQ A;  1YSJ A;  2PJC A;  3JRU A;  4OC3 A;  2C1C A;  1BPN A;  1Q7L A;  3KQZ A;  3ISZ A;  5JM6 A;  3D7G A;  4GM5 A;  5LYL A;  2F8H A;  4OME A;  3T8W A;  4MCQ A;  4A38 A;  4NJQ A;  1Y0Y A;  3B7I A;  4ZYQ A;  1CP7 A;  2BO9 A;  1TKJ A;  3CPX A;  5LYF A;  1LOK A;  1HDQ A;  3B3C A;  5K8O A;  3IIB A;  3IO1 A;  1VHO A;  3TX8 A;  4ZY2 A;  1LAN A;  3HUV A;  4UEZ A;  4B6Z A;  3NA6 A;  3GLJ A;  3KR5 A;  1Y0R A;  2BOA A;  3PFE A;  3LWU A;  1VHE A;  2PJ9 A;  2NYQ A;  3IJ3 A;  2GLF A;  3WC7 A;  1HDU A;  2PJA A;  4FWU A;  4R6T A;  4DYO A;  4MCP A;  1VGY A;  2HB6 A;  1YLO A;  3V38 A;  3VAT A;  2IQ6 A;  2O53 A;  2CTB A;  1TF9 A;  3PB9 X;  2ZEL A;  3MRU A;  1TXR A;  4A39 A;  2AFZ A;  2VL1 A;  1KWM A;  3S9L A;  4JZ0 A;  3D66 A;  2PVW A;  4FBE A;  2CIJ A;  4P44 A;  4TWE A;  2PJ1 A;  3WAB A;  2GRE A;  4P4B A;  1XMB A;  1VIX A;  2PIY A;  3H8G A;  3SJG A;  1XBU A;  1Y7E A;  3MN8 A;  2WYR A;  1TKF A;  4A94 A;  2AFW A;  2GU2 A;  4MCS A;  1XFO A;  3FH4 A;  1LFW A;  1CBX A;  1LCP A;  5K8M A;  3V7Z A;  1BLL E;  2IMO A;  3D67 A;  5CBM A;  4NGT A;  3D7F A;  1LAM A;  1IY7 A;  1ELL P;  4MRI A;  3DGV A;  2V8H A;  4PXB A;  5ELY A;  3NH4 A;  2F7V A;  1EE3 P;  3PBB A;  5LRG A;  2V8V A;  1FT7 A;  3FVL A;  2XEG A;  4R76 A;  3N5F A;  4Z65 A;  4OC1 A;  1CP6 A;  2O4H A;  2C6G A;  3BI1 A;  4ZX8 A;  5D29 A;  2XEJ A;  2PE3 A;  3PEI A;  2EWB A;  1HEE A;  4UEE A;  4NFR A;  4P4I A;  2PJ2 A;  4X8I A;  4P4E A;  3PB6 X;  3FEE A;  4PXC A;  3SJX A;  4PXD A;  4NGN A;  4ZY0 A;  3FJU A;  2GLJ A;  2V8D A;  2C6P A;  3FED A;  3KR4 A;  2J9A A;  1R43 A;  5K8P A;  4YU9 A;  3KZW A;  4OC2 A;  3IFE A;  5HVG A;  1ZLI A;  2XEF A;  5HVF A;  1ELM P;  3IEH A;  4OID A;  4DJL A;  4WWV A;  4Q7A A;  3NH5 A;  2XEI A;  2PJB A;  4NGR A;  4NGS A;  4ZI6 A;  1CG2 A;  5I4M A;  2PJ6 A;  3RAM A;  2AFS A;  2PJ3 A;  3SJE A;  2EK8 A;  1DE4 C;  3K2K A;  1BPM A;  2AFM A;  1IGB A;  5D8N A;  1OBR A;  4IHM A;  2EK9 A;  4OIW A;  4UEF A;  2HC9 A;  3KL9 A;  5DS0 A;  2JEW A;  2PJ5 A;  1AYE A;  4IAV A;  4TNU A;  3S9N A;  4MHP A;  4MCR A;  4O23 A;  1ZLH A;  2WZN A;  3FEC A;  3D7H A;  1PCA A;  4MMO A;  4F8Z A;  3KHX A;  2ZEP A;  1YW6 A;  2I3C A;  4FUU A;  3B3V A;  2QVP A;  2PJ7 A;  4F9U A;  4AXV A;  1RTQ A;  2ABZ A;  4KSI A;  1Z2L A;  1JQG A;  1LAP A;  2C6C A;  5K8N A;  4MHZ A;  3FX6 A;  4RUH A;  5LYD A;  1F2O A;  1ARM A;  1AMP A;  4X3R A;  4P4F A;  1YW4 A;  4NGM A;  2ZEF A;  2CTC A;  4OC5 A;  2RFH A;  3QNV A;  4R7M A;  3SI2 A;  4P4J A;  2Q43 A;  2ZEO A;  2QJ8 A;  4UIA A;  1XRY A;  4H2K A;  2PCU A;  3VH9 A;  3CPA A;  2PJ4 A;  3WC5 A;  1M4L A;  4JYW A;  1ZG9 A;  4K3N A;  2ZOG A;  2RB7 A;  6CPA A;  3ISX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...