2OYNA

Crystal structure of cdp-bound protein mj0056 from methanococcus jannaschii, pfam duf120
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
137
structure length
137
Chain Sequence
SLVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0056
publication title Crystal structure of hypothetical protein from Methanococcus jannaschii bound to CDP
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Structural genomics, unknown function
total genus 25
structure length 137
sequence length 137
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2oynA01
1T6ZA 4UZFA 3OP1A 2VBUA 5A8AA 2I1LA 2OYNA 1T6XA 5A88A 1N07A 5TRDA 1MRZA 1NB0A 2P3MA 3BNWA 2X0KA 1N05A 5FO1A 2VBTA 2VBSA 5FNZA 1P4MA 5FO0A 1NB9A 3ZUGA 1S4MA 2VBVA 4UZEA 3CTAA 5A89A 1Q9SA 1T6YA 1N06A 1N08A
chains in the Genus database with same CATH superfamily
1CNEA 3OP1A 4OPVA 3ZIAA 4DQKA 1VLYA 4WZLA 2V31A 2OK7A 1W0JA 3OPOA 3OJXA 4XD7A 4YAWA 2PIAA 1TLLA 2X0KA 2BM1A 1VQ6B 5EMNA 1V0FA 2ZZFA 1QVFB 1EP2B 2CC2A 4G7XA 4UZUA 4Y7CA 2CBXA 2DOGA 2X6WA 3ES9A 4X07A 2WJYA 1ZM4A 4XLFA 1M90D 1EWYA 4RM0A 4XOPA 1UD3A 2ZL5A 1GO2A 4ACAA 4ZGNB 3WQZA 2CW5A 1T6ZA 1DG1G 2Q6IA 2VNKA 1SKYB 3WNDA 4B47A 1Q82D 3OZWA 1VHEA 1AIPA 1QGYA 2D9RA 2VZLA 4NBSA 4RD0A 4UAJA 5HXBA 1ZM9A 4JMQA 1VQPB 1JA1A 1PJ6A 1E1QA 3BCDA 4KKSA 1OB2A 3GVLA 5DS0A 5FO1A 2XZOA 2OBTA 1E43A 3MMPA 1UD5A 1UD8A 1E3ZA 2CRVA 3ASPA 4N3NA 4OOSA 1FDRA 2Q6OA 4ZCIA 1BQEA 5HZBA 4PABA 2X53S 4II3A 4MYTA 2XNCA 3GIRA 3WNCA 1QGZA 4FK8A 1YJ9B 3AVVA 3Q39A 1N08A 3CC2B 3A8KA 2V7XA 2C5HA 3WNBA 1NJID 1KJZA 1RQPA 2RC6A 3B82A 1EP1B 4Z4ZA 2QEXB 2QE7A 1KRHA 4M53A 2V4DA 4P3IA 4RD3A 3OJWA 1DARA 3ZC3A 4AF7A 2ZL6A 3CCEB 4P9SA 5IYPA 5FNZA 4G6IA 1G7RA 1UD4A 1FNMA 2J7KA 4U9UA 4WWVA 5FO0A 3DDYA 4B48A 1WORA 2PE3A 2AHOA 4X8IA 1EXMA 4ZCLA 2XEXA 5TY0A 2GK6A 3PA1A 2F43A 4QHYA 2ZL7A 2VNHA 1VJSA 1N0UA 2GJKA 1K8AD 1YIJB 1VHOA 1PKVA 4CQJA 3SLDA 2E1BA 3SEJA 3W2FA 1E79A 3NE5B 4M4SA 3GVJA 1NB0A 2BPOA 2ZXHA 4RPBA 2BM0A 3AVWA 1OHHA 3LNNA 2WSSA 5DSZA 3T56B 4HIZA 3FPPA 4P6YA 4XONA 4FN5A 2OTJB 4YXWA 5HZAA 5TR9A 4ACBA 1QUEA 1GAWA 1VQMB 1K73D 2GJRA 1WOSA 4OOVA 4X06A 4TMXA 2VBSA 1VLOA 1W87A 1E3XA 4XLCA 1IJEA 2M5SA 1FNCA 1T6XA 1B2RA 3VMFA 2BGIA 3Q3AA 1TTTA 3JQRA 4L8JA 2GQFA 1OGJA 3ISXA 4IW3B 4OP7A 2QGGA 1WTHD 3AGQA 3LQ6A 3VR6A 1K9MD 2EIXA 2DIEA 5JBQA 1E1RA 3ZUGA 2GJPA 3SKBA 4Z4WA 4G7WA 2NV4A 4X0CA 1R5NA 2HLDA 5FIUA 1G7TA 3OZVA 2GREA 3W2EA 1SKQA 4LBWA 5KW9A 2HCJB 3OKXA 1TVCA 4C43A 3CD6B 3SLNA 2QDXA 3CCVB 1Q7YD 1VQ5B 4ZV4A 1PJ7A 3A8JA 1WDTA 4P12A 3U2QA 4AF6A 1VQKB 1QUFA 2GPJA 3CP8A 4XNFA 3ASTA 4TKOB 2BN4A 4Z4YA 4WZTA 2VYQA 2ZZGA 3ZPNA 5IYRA 1WSRA 4II2A 1VQ7B 1YHQB 1DDGA 4B3FX 1WPCA 1FNBA 3OW2B 2WZNA 3E20A 1IJFA 2JJ2A 4X7DA 1QGAA 3MCAA 1KK0A 3VO1A 3W2GA 4Z4UA 1OB5A 2FX3A 2XZLA 1GAQA 2B7BA 2ZXIA 2ZZQA 4XKWA 2XGJA 1FRNA 3PVDA 1FNDA 2E1RA 4AVZA 5IYNA 4NNJA 3P26A 4FWTA 4WZEA 2C4TA 1E62A 3ASQA 4KKUA 4M0LA 5IK2A 3V7AA 2BMWA 4X7EA 2JJ1A 2P3MA 4P2NA 1WOPA 4YELA 5B6IA 4TMTA 4B43A 3CC7B 1Y0YA 1UD2A 2XOKA 4XN0A 3QFTA 3LVBA 3JQQA 4GQNA 3LQEA 4UZEA 3VO2A 3W5HA 2EFGA 3PENA 4YEJA 1QH0A 4Y9UA 4TMVA 5J3OA 5H59A 2QN6A 4DK0A 5DN6A 5TV2A 1Q9SA 1T6YA 3ZZUA 4XLAA 3CMEB 2WZPP 2V7UA 1PJ5A 3T51B 3CCLB 3CRZA 5AN9A 2C5BA 5A8AA 3I56B 3CW2A 1G7CA 3SJZA 1OB0A 2D3LA 2R6HA 3GVKA 4PC1A 3CCQB 4B44A 3ZZTA 4KKTA 4QV2A 5GV8A 2JN9A 1NDHA 4G1BA 1VQLB 1BJKA 4PC2A 2C77A 2DYIA 3MHPA 1EFUA 2V7VA 5FL7A 1ELOA 3ONYA 1BPLA 3CESA 2Q6LA 4RDJA 1CNFA 2DCUA 4YALA 1N06A 3P27A 4OPSA 4ASUA 5F4OA 2V7WA 3A35A 3W2IA 5F4JA 2VBUA 1YJWB 2GK7A 4M1KA 2I1LA 4OOXA 4XN3A 5BSXA 2RC5A 2WYRA 2PLFA 1KK2A 3V76A 1N07A 4X7FA 2JIZA 1G7SA 3KL9A 4B4DA 1MRZA 1D8TA 4BPRA 2BF4A 2Q6KA 1AMOA 3VNVA 1M1KD 1E64A 4OPOA 4YHBA 1Q81D 1H8HA 2R9VA 1VQ4B 2XNDA 1ZM2A 4P1VA 4H9GA 4RPDA 4RD1A 5A89A 5HKKA 1N0VC 2ZITA 1UMKA 4P25A 1KK1A 4Z4TA 1QFYA 4PC7A 5THXA 4DNRB 3G71B 3R6KA 5L46A 3LO8A 4RCZA 4YAUA 1A8PA 4QUZA 5TRDA 1ZM3A 2VNJA 4P26A 3W2HA 1JJ2B 2X3UA 3AGPA 4N3GA 2DERA 2ZTGA 3BY2A 3BY1A 5FA6A 1F20A 1QFJA 1HZEA 2VJIA 3A3GA 1XFOA 4Y9RA 1S72B 1GR1A 3OW7A 3CC4B 3A3BA 5GV7A 1KTVA 4XLHA 3WBKA 1R5OA 4NCNA 4C0SA 3QSYA 1GVHA 3CMAB 1EFTA 3BC9A 4UZFA 1NRKA 2V7QA 1QVGB 4TMZA 2ZZEA 3AVYA 1I8DA 2VNIA 2W6JA 4DNTB 3PUMA 4PC3A 1UD6A 1RQRA 3AVTA 1QX4A 4AC9A 4TSFA 1VQ9B 1WSVA 3FKSA 5E6TA 1YJNB 3ZBUA 2BVNA 3A1PA 1WU8A 3CCSB 1H85A 1BX0A 2QA4B 4XOTA 1JNYA 2YWGA 3JQPA 1COWA 4XLEA 1W2BB 4YAFA 5IYQA 1YITB 2WJVA 2YWFA 1QFZA 1H42A 2CK3A 5H5JA 4R71A 2C78A 3H94A 1SM4A 3WBJA 3T53B 4B3XA 1VQNB 3B78A 4K1XA 4TMWA 1CQXA 2QTLA 2BSAA 3CCMB 2VBTA 2ZTNA 2OBRA 3OFNA 4Z4SA 5LMZA 3CCUB 2DEUA 3CPXA 3BH4A 4X05A 1NB9A 3H9NA 4LBZA 2F4NA 3I1FA 2PMDA 2QTZA 3CMMA 3WY9A 4P22A 4E0FA 2XZPA 1WOOA 1F60A 3BQJA 3ZBTA 1XB2A 3ONUA 3OE7A 4P6VF 4FXUA 2VJJA 3Q6RA 3G05A 4LC0A 4XMYA 4RCYA 2X85A 3CCRB 2OYNA 1BMFA 5J35A 2OK8A 3OEEA 4P3YA 4QFMA 5CDFA 2YWHA 4XKVA 2B5OA 1KZLA 3QE2A 4HE6A 4G5GA 4DK1A 4ZGQB 5IYWA 1EFCA 3BNWA 3CP2A 2BV3A 4B3GA 4PAAA 1D1NA 3R6JA 1IB0A 4X7CA 1MABA 3I55B 1IHMA 1KD1D 2V7TA 1S4MA 2NPFA 5KNLA 2QMUA 1KQSB 3HAGA 1VQ8B 3PA2A 1ZUNB 1BLIA 4WQMA 1I7PA 1EFRA 2CF4A 3QFSA 1H8EA 3W5UA 3W5VA 1WP6A 1YI2B 1I18A 4Z4VA 4WZKA 4DQLA 2C4UA 5A88A 3GSIA 4G1VA 1Y0RA 1TUIA 3BCFA 1N05A 3G6EB 2X6XA 4F7DA 4RD2A 3CPWB 3Q38A 1T5EA 2VBVA 1VQOB 2BGJA 1N8RD 1HVXA 1W35A 2D3NA 3OAAA 3CXCB 3G4SB 3CTAA 1J9ZA 1KMHA 1OGIA 1R5BA 3AVXA 1JA0A 3KEWA 2WPDA 4TT3A 3CB4A 3WXMA 2FVGA 2B7CA 4MYUA 2F1MA 3OZUA 2X8KA 1YX2A 1FRQA 2JDIA 4QVJA 1W0KA 3FPKA 1BX1A 3OOCA 2C2WA 5KSWB 2DETA 1QG0A 4PGOA 4PC6A 3E1YE 4Z4RA 4XORA 1DDIA 4ROXA 1EP3B 1D2EA 2ZBUA 4J0QA 2XNJA 1P4MA 2WR8A 5F4MA 3D26A 1V5VA 1XQBA 4XL9A 3VNUA 2OBSA 3U6KA 1HA3A 2KVOA 4XQFA 2HMAA 2DY1A 3ZZ0A 2W6IA 1Q86D 1JB9A 4M2LA 3GQBA 2YWEA 2F1LA 2HDNB 4RDLA 2LZJA 3J81k 4RDKA 4QVAA 1B23P 1GJRA 4Q7JB 3OEHA 2D74A 3U6BA 3B8HA 3FJOA 1KC8D 2ZBVA 5BSYA 1S0UA 3ASRA 3SJPA 3WYAA 2OTLB 1K28D 3QFRA 1W34A 1XE1A 4LBYA 3RY8A 4Z1MA 4XM3A 3PUNA 4HE5A 1W9XA 2X6YA 1E63A 3AVUA 1VF7A 1V0EA 1FX0A 3Q6QA 1YLOA 4RLZA 1U2RA 4LBVA 4ZCMA 4EH1A 3ASSA 1KK3A 1NBMA 2Z6BD 4RD4A 4RJLA 4XR6A 3CCJB 3QFCA 4YAOA 4RD6A 3JU4A 4TN1A 3A8IA 2CNDA
chains in the Genus database with same CATH topology
1T6ZA 4UZFA 3OP1A 2VBUA 5A8AA 2I1LA 2OYNA 1T6XA 5A88A 1N07A 5TRDA 1MRZA 1NB0A 2P3MA 3BNWA 2X0KA 1N05A 5FO1A 2VBTA 2VBSA 5FNZA 1P4MA 5FO0A 1NB9A 3ZUGA 1S4MA 2VBVA 4UZEA 3CTAA 5A89A 1Q9SA 1T6YA 1N06A 1N08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6Z A;  4UZF A;  3OP1 A;  2VBU A;  5A8A A;  2I1L A;  2OYN A;  1T6X A;  5A88 A;  1N07 A;  5TRD A;  1MRZ A;  1NB0 A;  2P3M A;  3BNW A;  2X0K A;  1N05 A;  5FO1 A;  2VBT A;  2VBS A;  5FNZ A;  1P4M A;  5FO0 A;  1NB9 A;  3ZUG A;  1S4M A;  2VBV A;  4UZE A;  3CTA A;  5A89 A;  1Q9S A;  1T6Y A;  1N06 A;  1N08 A; 
#chains in the Genus database with same CATH topology
 1CNE A;  3OP1 A;  4OPV A;  3ZIA A;  4DQK A;  1VLY A;  4WZL A;  2V31 A;  2OK7 A;  1W0J A;  3OPO A;  3OJX A;  4XD7 A;  4YAW A;  2PIA A;  1TLL A;  2X0K A;  2BM1 A;  1VQ6 B;  5EMN A;  1V0F A;  2ZZF A;  1QVF B;  1EP2 B;  2CC2 A;  4G7X A;  4UZU A;  4Y7C A;  2CBX A;  2DOG A;  2X6W A;  3ES9 A;  4X07 A;  2WJY A;  1ZM4 A;  4XLF A;  1M90 D;  1EWY A;  4RM0 A;  4XOP A;  1UD3 A;  2ZL5 A;  1GO2 A;  4ACA A;  4ZGN B;  3WQZ A;  2CW5 A;  1T6Z A;  1DG1 G;  2Q6I A;  2VNK A;  1SKY B;  3WND A;  4B47 A;  1Q82 D;  3OZW A;  1VHE A;  1AIP A;  1QGY A;  2D9R A;  2VZL A;  4NBS A;  4RD0 A;  4UAJ A;  5HXB A;  1ZM9 A;  4JMQ A;  1VQP B;  1JA1 A;  1PJ6 A;  1E1Q A;  3BCD A;  4KKS A;  1OB2 A;  3GVL A;  5DS0 A;  5FO1 A;  2XZO A;  2OBT A;  1E43 A;  3MMP A;  1UD5 A;  1UD8 A;  1E3Z A;  2CRV A;  3ASP A;  4N3N A;  4OOS A;  1FDR A;  2Q6O A;  4ZCI A;  1BQE A;  5HZB A;  4PAB A;  2X53 S;  4II3 A;  4MYT A;  2XNC A;  3GIR A;  3WNC A;  1QGZ A;  4FK8 A;  1YJ9 B;  3AVV A;  3Q39 A;  1N08 A;  3CC2 B;  3A8K A;  2V7X A;  2C5H A;  3WNB A;  1NJI D;  1KJZ A;  1RQP A;  2RC6 A;  3B82 A;  1EP1 B;  4Z4Z A;  2QEX B;  2QE7 A;  1KRH A;  4M53 A;  2V4D A;  4P3I A;  4RD3 A;  3OJW A;  1DAR A;  3ZC3 A;  4AF7 A;  2ZL6 A;  3CCE B;  4P9S A;  5IYP A;  5FNZ A;  4G6I A;  1G7R A;  1UD4 A;  1FNM A;  2J7K A;  4U9U A;  4WWV A;  5FO0 A;  3DDY A;  4B48 A;  1WOR A;  2PE3 A;  2AHO A;  4X8I A;  1EXM A;  4ZCL A;  2XEX A;  5TY0 A;  2GK6 A;  3PA1 A;  2F43 A;  4QHY A;  2ZL7 A;  2VNH A;  1VJS A;  1N0U A;  2GJK A;  1K8A D;  1YIJ B;  1VHO A;  1PKV A;  4CQJ A;  3SLD A;  2E1B A;  3SEJ A;  3W2F A;  1E79 A;  3NE5 B;  4M4S A;  3GVJ A;  1NB0 A;  2BPO A;  2ZXH A;  4RPB A;  2BM0 A;  3AVW A;  1OHH A;  3LNN A;  2WSS A;  5DSZ A;  3T56 B;  4HIZ A;  3FPP A;  4P6Y A;  4XON A;  4FN5 A;  2OTJ B;  4YXW A;  5HZA A;  5TR9 A;  4ACB A;  1QUE A;  1GAW A;  1VQM B;  1K73 D;  2GJR A;  1WOS A;  4OOV A;  4X06 A;  4TMX A;  2VBS A;  1VLO A;  1W87 A;  1E3X A;  4XLC A;  1IJE A;  2M5S A;  1FNC A;  1T6X A;  1B2R A;  3VMF A;  2BGI A;  3Q3A A;  1TTT A;  3JQR A;  4L8J A;  2GQF A;  1OGJ A;  3ISX A;  4IW3 B;  4OP7 A;  2QGG A;  1WTH D;  3AGQ A;  3LQ6 A;  3VR6 A;  1K9M D;  2EIX A;  2DIE A;  5JBQ A;  1E1R A;  3ZUG A;  2GJP A;  3SKB A;  4Z4W A;  4G7W A;  2NV4 A;  4X0C A;  1R5N A;  2HLD A;  5FIU A;  1G7T A;  3OZV A;  2GRE A;  3W2E A;  1SKQ A;  4LBW A;  5KW9 A;  2HCJ B;  3OKX A;  1TVC A;  4C43 A;  3CD6 B;  3SLN A;  2QDX A;  3CCV B;  1Q7Y D;  1VQ5 B;  4ZV4 A;  1PJ7 A;  3A8J A;  1WDT A;  4P12 A;  3U2Q A;  4AF6 A;  1VQK B;  1QUF A;  2GPJ A;  3CP8 A;  4XNF A;  3AST A;  4TKO B;  2BN4 A;  4Z4Y A;  4WZT A;  2VYQ A;  2ZZG A;  3ZPN A;  5IYR A;  1WSR A;  4II2 A;  1VQ7 B;  1YHQ B;  1DDG A;  4B3F X;  1WPC A;  1FNB A;  3OW2 B;  2WZN A;  3E20 A;  1IJF A;  2JJ2 A;  4X7D A;  1QGA A;  3MCA A;  1KK0 A;  3VO1 A;  3W2G A;  4Z4U A;  1OB5 A;  2FX3 A;  2XZL A;  1GAQ A;  2B7B A;  2ZXI A;  2ZZQ A;  4XKW A;  2XGJ A;  1FRN A;  3PVD A;  1FND A;  2E1R A;  4AVZ A;  5IYN A;  4NNJ A;  3P26 A;  4FWT A;  4WZE A;  2C4T A;  1E62 A;  3ASQ A;  4KKU A;  4M0L A;  5IK2 A;  3V7A A;  2BMW A;  4X7E A;  2JJ1 A;  2P3M A;  4P2N A;  1WOP A;  4YEL A;  5B6I A;  4TMT A;  4B43 A;  3CC7 B;  1Y0Y A;  1UD2 A;  2XOK A;  4XN0 A;  3QFT A;  3LVB A;  3JQQ A;  4GQN A;  3LQE A;  4UZE A;  3VO2 A;  3W5H A;  2EFG A;  3PEN A;  4YEJ A;  1QH0 A;  4Y9U A;  4TMV A;  5J3O A;  5H59 A;  2QN6 A;  4DK0 A;  5DN6 A;  5TV2 A;  1Q9S A;  1T6Y A;  3ZZU A;  4XLA A;  3CME B;  2WZP P;  2V7U A;  1PJ5 A;  3T51 B;  3CCL B;  3CRZ A;  5AN9 A;  2C5B A;  5A8A A;  3I56 B;  3CW2 A;  1G7C A;  3SJZ A;  1OB0 A;  2D3L A;  2R6H A;  3GVK A;  4PC1 A;  3CCQ B;  4B44 A;  3ZZT A;  4KKT A;  4QV2 A;  5GV8 A;  2JN9 A;  1NDH A;  4G1B A;  1VQL B;  1BJK A;  4PC2 A;  2C77 A;  2DYI A;  3MHP A;  1EFU A;  2V7V A;  5FL7 A;  1ELO A;  3ONY A;  1BPL A;  3CES A;  2Q6L A;  4RDJ A;  1CNF A;  2DCU A;  4YAL A;  1N06 A;  3P27 A;  4OPS A;  4ASU A;  5F4O A;  2V7W A;  3A35 A;  3W2I A;  5F4J A;  2VBU A;  1YJW B;  2GK7 A;  4M1K A;  2I1L A;  4OOX A;  4XN3 A;  5BSX A;  2RC5 A;  2WYR A;  2PLF A;  1KK2 A;  3V76 A;  1N07 A;  4X7F A;  2JIZ A;  1G7S A;  3KL9 A;  4B4D A;  1MRZ A;  1D8T A;  4BPR A;  2BF4 A;  2Q6K A;  1AMO A;  3VNV A;  1M1K D;  1E64 A;  4OPO A;  4YHB A;  1Q81 D;  1H8H A;  2R9V A;  1VQ4 B;  2XND A;  1ZM2 A;  4P1V A;  4H9G A;  4RPD A;  4RD1 A;  5A89 A;  5HKK A;  1N0V C;  2ZIT A;  1UMK A;  4P25 A;  1KK1 A;  4Z4T A;  1QFY A;  4PC7 A;  5THX A;  4DNR B;  3G71 B;  3R6K A;  5L46 A;  3LO8 A;  4RCZ A;  4YAU A;  1A8P A;  4QUZ A;  5TRD A;  1ZM3 A;  2VNJ A;  4P26 A;  3W2H A;  1JJ2 B;  2X3U A;  3AGP A;  4N3G A;  2DER A;  2ZTG A;  3BY2 A;  3BY1 A;  5FA6 A;  1F20 A;  1QFJ A;  1HZE A;  2VJI A;  3A3G A;  1XFO A;  4Y9R A;  1S72 B;  1GR1 A;  3OW7 A;  3CC4 B;  3A3B A;  5GV7 A;  1KTV A;  4XLH A;  3WBK A;  1R5O A;  4NCN A;  4C0S A;  3QSY A;  1GVH A;  3CMA B;  1EFT A;  3BC9 A;  4UZF A;  1NRK A;  2V7Q A;  1QVG B;  4TMZ A;  2ZZE A;  3AVY A;  1I8D A;  2VNI A;  2W6J A;  4DNT B;  3PUM A;  4PC3 A;  1UD6 A;  1RQR A;  3AVT A;  1QX4 A;  4AC9 A;  4TSF A;  1VQ9 B;  1WSV A;  3FKS A;  5E6T A;  1YJN B;  3ZBU A;  2BVN A;  3A1P A;  1WU8 A;  3CCS B;  1H85 A;  1BX0 A;  2QA4 B;  4XOT A;  1JNY A;  2YWG A;  3JQP A;  1COW A;  4XLE A;  1W2B B;  4YAF A;  5IYQ A;  1YIT B;  2WJV A;  2YWF A;  1QFZ A;  1H42 A;  2CK3 A;  5H5J A;  4R71 A;  2C78 A;  3H94 A;  1SM4 A;  3WBJ A;  3T53 B;  4B3X A;  1VQN B;  3B78 A;  4K1X A;  4TMW A;  1CQX A;  2QTL A;  2BSA A;  3CCM B;  2VBT A;  2ZTN A;  2OBR A;  3OFN A;  4Z4S A;  5LMZ A;  3CCU B;  2DEU A;  3CPX A;  3BH4 A;  4X05 A;  1NB9 A;  3H9N A;  4LBZ A;  2F4N A;  3I1F A;  2PMD A;  2QTZ A;  3CMM A;  3WY9 A;  4P22 A;  4E0F A;  2XZP A;  1WOO A;  1F60 A;  3BQJ A;  3ZBT A;  1XB2 A;  3ONU A;  3OE7 A;  4P6V F;  4FXU A;  2VJJ A;  3Q6R A;  3G05 A;  4LC0 A;  4XMY A;  4RCY A;  2X85 A;  3CCR B;  2OYN A;  1BMF A;  5J35 A;  2OK8 A;  3OEE A;  4P3Y A;  4QFM A;  5CDF A;  2YWH A;  4XKV A;  2B5O A;  1KZL A;  3QE2 A;  4HE6 A;  4G5G A;  4DK1 A;  4ZGQ B;  5IYW A;  1EFC A;  3BNW A;  3CP2 A;  2BV3 A;  4B3G A;  4PAA A;  1D1N A;  3R6J A;  1IB0 A;  4X7C A;  1MAB A;  3I55 B;  1IHM A;  1KD1 D;  2V7T A;  1S4M A;  2NPF A;  5KNL A;  2QMU A;  1KQS B;  3HAG A;  1VQ8 B;  3PA2 A;  1ZUN B;  1BLI A;  4WQM A;  1I7P A;  1EFR A;  2CF4 A;  3QFS A;  1H8E A;  3W5U A;  3W5V A;  1WP6 A;  1YI2 B;  1I18 A;  4Z4V A;  4WZK A;  4DQL A;  2C4U A;  5A88 A;  3GSI A;  4G1V A;  1Y0R A;  1TUI A;  3BCF A;  1N05 A;  3G6E B;  2X6X A;  4F7D A;  4RD2 A;  3CPW B;  3Q38 A;  1T5E A;  2VBV A;  1VQO B;  2BGJ A;  1N8R D;  1HVX A;  1W35 A;  2D3N A;  3OAA A;  3CXC B;  3G4S B;  3CTA A;  1J9Z A;  1KMH A;  1OGI A;  1R5B A;  3AVX A;  1JA0 A;  3KEW A;  2WPD A;  4TT3 A;  3CB4 A;  3WXM A;  2FVG A;  2B7C A;  4MYU A;  2F1M A;  3OZU A;  2X8K A;  1YX2 A;  1FRQ A;  2JDI A;  4QVJ A;  1W0K A;  3FPK A;  1BX1 A;  3OOC A;  2C2W A;  5KSW B;  2DET A;  1QG0 A;  4PGO A;  4PC6 A;  3E1Y E;  4Z4R A;  4XOR A;  1DDI A;  4ROX A;  1EP3 B;  1D2E A;  2ZBU A;  4J0Q A;  2XNJ A;  1P4M A;  2WR8 A;  5F4M A;  3D26 A;  1V5V A;  1XQB A;  4XL9 A;  3VNU A;  2OBS A;  3U6K A;  1HA3 A;  2KVO A;  4XQF A;  2HMA A;  2DY1 A;  3ZZ0 A;  2W6I A;  1Q86 D;  1JB9 A;  4M2L A;  3GQB A;  2YWE A;  2F1L A;  2HDN B;  4RDL A;  2LZJ A;  3J81 k;  4RDK A;  4QVA A;  1B23 P;  1GJR A;  4Q7J B;  3OEH A;  2D74 A;  3U6B A;  3B8H A;  3FJO A;  1KC8 D;  2ZBV A;  5BSY A;  1S0U A;  3ASR A;  3SJP A;  3WYA A;  2OTL B;  1K28 D;  3QFR A;  1W34 A;  1XE1 A;  4LBY A;  3RY8 A;  4Z1M A;  4XM3 A;  3PUN A;  4HE5 A;  1W9X A;  2X6Y A;  1E63 A;  3AVU A;  1VF7 A;  1V0E A;  1FX0 A;  3Q6Q A;  1YLO A;  4RLZ A;  1U2R A;  4LBV A;  4ZCM A;  4EH1 A;  3ASS A;  1KK3 A;  1NBM A;  2Z6B D;  4RD4 A;  4RJL A;  4XR6 A;  3CCJ B;  3QFC A;  4YAO A;  4RD6 A;  3JU4 A;  4TN1 A;  3A8I A;  2CND A; 
#chains in the Genus database with same CATH homology
 1T6Z A;  4UZF A;  3OP1 A;  2VBU A;  5A8A A;  2I1L A;  2OYN A;  1T6X A;  5A88 A;  1N07 A;  5TRD A;  1MRZ A;  1NB0 A;  2P3M A;  3BNW A;  2X0K A;  1N05 A;  5FO1 A;  2VBT A;  2VBS A;  5FNZ A;  1P4M A;  5FO0 A;  1NB9 A;  3ZUG A;  1S4M A;  2VBV A;  4UZE A;  3CTA A;  5A89 A;  1Q9S A;  1T6Y A;  1N06 A;  1N08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...