2OYNA

Crystal structure of cdp-bound protein mj0056 from methanococcus jannaschii, pfam duf120
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
137
structure length
137
Chain Sequence
SLVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0056
publication title Crystal structure of hypothetical protein from Methanococcus jannaschii bound to CDP
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Structural genomics, unknown function
total genus 25
structure length 137
sequence length 137
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2oynA01
3ZUGA 1N08A 2VBUA 1T6ZA 5TRDA 2VBTA 1Q9SA 2OYNA 1NB0A 1T6XA 1NB9A 1N06A 1S4MA 2X0KA 5FNZA 1N05A 3CTAA 5A89A 2VBVA 4UZFA 2P3MA 5A88A 1P4MA 3BNWA 5A8AA 5FO1A 1N07A 1T6YA 3OP1A 4UZEA 1MRZA 2VBSA 5FO0A 2I1LA
chains in the Genus database with same CATH superfamily
2DOGA 3CB4A 3ZUGA 2QTLA 2J7KA 3SKBA 2XNDA 3QFRA 4NNJA 3CCEB 1TUIA 4YAFA 2BN4A 4TKOB 1TLLA 2GJKA 2X6WA 3CCQB 1R5OA 4G7XA 3B78A 4YXWA 3SLDA 2ZL5A 3AVTA 4TT3A 3Q39A 5IK2A 1DDIA 1ZM3A 3GVJA 1KZLA 2P3MA 4XKVA 3AVXA 3MMPA 2Q6IA 2BGIA 1E43A 1N07A 1ZM2A 1BLIA 1VQ8B 4RD3A 4XLEA 5HXBA 1WSRA 4P6YA 1CNFA 1RQRA 2WJVA 1VQNB 2OTJB 4Z4RA 5F4MA 2I1LA 3ZC3A 4P3IA 3W2FA 4TMTA 5E6TA 2JJ2A 1V0EA 4JMQA 3A1PA 2E1BA 4XM3A 5HZBA 1KD1D 1NB9A 4OPOA 3AVUA 2B5OA 3W2EA 2GPJA 3WBJA 4TMWA 1FNCA 1VQOB 4NBSA 1W87A 2ZXIA 2PLFA 2HMAA 3A8IA 3H9NA 4P26A 1EFUA 2ZZGA 2X8KA 4X8IA 1MRZA 4DK0A 1G7RA 1Y0YA 2C5BA 1EFRA 1FDRA 2HLDA 3GSIA 1YITB 1E3XA 5H59A 1IHMA 3WYAA 3WNCA 3G71B 2X3UA 1I18A 1EP3B 1H8HA 4QHYA 1W9XA 1ELOA 2RC5A 2NPFA 1EP2B 4BPRA 1AMOA 2WR8A 4RDLA 2CC2A 5HKKA 1FNMA 3CPWB 1SKYB 1K9MD 2V7XA 1N8RD 3Q3AA 4UZUA 2XZPA 1UD8A 3CCVB 4U9UA 1V0FA 4FXUA 4II3A 3W5VA 1EWYA 2XGJA 4B4DA 1B2RA 2BV3A 4MYTA 4NCNA 2ZTNA 1F20A 3BH4A 2QA4B 4RD2A 3RY8A 2C5HA 5GV7A 5AN9A 3WXMA 1DARA 2AHOA 3R6KA 5DS0A 1WTHD 2GK7A 1QVGB 1JA0A 3E1YE 1WDTA 2F43A 3PENA 2HCJB 3ZZUA 1R5BA 2C78A 4C0SA 3FJOA 3VNUA 3OJXA 5TV2A 1MABA 1FNBA 4XKWA 3VR6A 1I8DA 2DCUA 4XNFA 3OFNA 1COWA 5IYRA 3CC7B 1IJEA 3V7AA 2XNJA 3R6JA 4P12A 4XL9A 3U6KA 1G7TA 4X7EA 4ZGQB 3ZBTA 1W2BB 1N08A 2FVGA 1T6ZA 5THXA 1F60A 2VBTA 3B8HA 4J0QA 2YWHA 1SM4A 2WZNA 3OE7A 4PGOA 1OB2A 1BPLA 2BMWA 1KC8D 2X6XA 2OK7A 1J9ZA 1GVHA 3U6BA 4II2A 3NE5B 2C4TA 3ZPNA 5FIUA 3OZVA 3SEJA 4WZEA 1VQ5B 4HE5A 1YX2A 4ZCIA 1BJKA 1KRHA 4QVAA 2D9RA 2Q6KA 4FK8A 3FPKA 4RJLA 1UD5A 3W5UA 2PIAA 1GAWA 1XQBA 2CRVA 3AGPA 2VJJA 3CCUB 3OW7A 5IYNA 2KVOA 4OP7A 2C77A 4M0LA 5TY0A 3A3GA 2CW5A 4XN3A 1VQPB 4G5GA 1Q9SA 2XZOA 3LO8A 1H42A 4G6IA 1NB0A 2YWGA 3OJWA 4ACBA 1QUFA 3QFCA 3HAGA 3QFSA 3AVYA 2DIEA 2Q6OA 4QFMA 4M53A 1E3ZA 5GV8A 3ZBUA 3CTAA 4HE6A 2VBVA 4HIZA 1QFZA 3ZZTA 3QSYA 1B23P 1IJFA 4H9GA 3ZZ0A 3A3BA 4Z4YA 3P27A 3WY9A 1KJZA 3OEEA 3PA2A 2WYRA 1N0VC 4AVZA 4P2NA 2F1MA 1CNEA 3PVDA 2BSAA 2Q6LA 3MHPA 1K8AD 4L8JA 3V76A 4X7CA 4XLAA 2W6JA 3QFTA 3CPXA 3LNNA 2LZJA 1NBMA 4OOXA 4RLZA 2BGJA 3CRZA 3DDYA 2QDXA 4XORA 1YJNB 2V7VA 3OAAA 1SKQA 2ZXHA 4IW3B 1E79A 4Z4ZA 3H94A 3Q6QA 1QUEA 5A8AA 1CQXA 4KKSA 4B3XA 2B7CA 3I55B 4XQFA 2FX3A 3PUNA 1TVCA 2GREA 2QN6A 4ASUA 2OBRA 2X53S 1QH0A 1JNYA 1GO2A 4UAJA 4R71A 1VLYA 3A35A 3CCRB 2DETA 1E64A 1VQ9B 1WOPA 1PJ5A 3OKXA 5TR9A 5L46A 2DERA 3VO1A 4RPBA 1EFTA 5TRDA 4RDKA 3PUMA 1UD2A 4XONA 2R6HA 4PC2A 2ZL7A 2GJRA 4EH1A 3G4SB 3T56B 1WOSA 2QMUA 2X85A 4C43A 4G1BA 1WORA 4XMYA 4UZFA 2NV4A 3JQQA 4WZLA 2JN9A 1TTTA 4MYUA 4AF7A 1Q81D 2EFGA 4XOTA 1YJWB 3OEHA 1KK3A 2VNIA 2Z6BD 1N0UA 4CQJA 1T6YA 3BCFA 1OHHA 2M5SA 2WJYA 4QV2A 1VQMB 1EXMA 2YWEA 3I1FA 4M1KA 2C2WA 4B47A 2GJPA 3ONYA 4YAWA 1HA3A 4G7WA 4X06A 1S72B 2XZLA 4YHBA 3VNVA 1JB9A 4YAUA 1PKVA 3PA1A 4DNTB 4B3GA 4E0FA 4YAOA 3W2HA 1XE1A 3Q38A 1OGIA 4Z4UA 2ZZFA 3CCLB 3KL9A 1OGJA 4X7DA 1QGZA 4TMVA 4YELA 5FO1A 4M4SA 1UD6A 1YI2B 3ASTA 1PJ6A 2ZTGA 4RD6A 1YLOA 2VNHA 1XB2A 3P26A 1DG1G 3ZIAA 4FWTA 3GVKA 1QGYA 3I56B 2GK6A 1WU8A 3BY1A 4WQMA 1HVXA 3FPPA 5J3OA 4P22A 4PABA 4AC9A 4PAAA 3WQZA 1QG0A 3GVLA 4WZKA 1NDHA 3A8JA 4YALA 5IYWA 4ACAA 1I7PA 3MCAA 1Q82D 1E62A 1QVFB 4KKUA 3CXCB 2XEXA 3E20A 3OZUA 4XOPA 5CDFA 4Z4SA 1G7SA 1K73D 2C4UA 1BQEA 5F4JA 1QGAA 2VNKA 1VHOA 1ZM9A 3OP1A 3BCDA 5HZAA 4ZGNB 2V7QA 2QGGA 2E1RA 1VQKB 3AGQA 4Y9RA 2JDIA 3G6EB 2WPDA 3OZWA 2ZZEA 4DQKA 2OBTA 3W5HA 2OBSA 4YEJA 2ZITA 3LQEA 5JBQA 1T6XA 1G7CA 4RD4A 1H85A 1JA1A 1UD3A 4ZCLA 2QE7A 4RD0A 1S4MA 1EFCA 4Z1MA 4Z4WA 2X0KA 3BQJA 4WZTA 2DY1A 2CBXA 4Y9UA 4RD1A 3CMMA 3CCMB 3ES9A 3KEWA 1GJRA 5A89A 4ROXA 4OPVA 4Q7JB 5BSXA 2B7BA 3CESA 4B44A 1D1NA 3OOCA 1U2RA 2VJIA 4AF6A 3ASPA 1Y0RA 1E1QA 5BSYA 1D8TA 3BY2A 1M90D 4PC3A 5FO0A 4X0CA 3VMFA 4PC6A 4B43A 4TSFA 3ASRA 1H8EA 3ASQA 3CC2B 4LBWA 1R5NA 4N3NA 2JIZA 4P9SA 4XLFA 3ISXA 1YHQB 2BM1A 2CF4A 4ZV4A 1N06A 3ASSA 2GQFA 3CP8A 2BF4A 5FNZA 4LBVA 4RDJA 1W0JA 2V7TA 1Q86D 2OTLB 1KK1A 2QTZA 5A88A 1M1KD 2D3NA 2XOKA 4KKTA 3BC9A 4P1VA 3CW2A 1BMFA 3GIRA 2V7WA 1NRKA 4RCYA 4DK1A 1PJ7A 1OB0A 1RQPA 4TMZA 1Q7YD 2VBSA 3AVWA 4Y7CA 2WZPP 3J81k 1VQ7B 1GR1A 3SJZA 4ZCMA 2EIXA 3VO2A 5LMZA 2VZLA 2WSSA 4LC0A 4K1XA 5FL7A 1KQSB 1FNDA 2HDNB 2ZBVA 4XLHA 4RPDA 1V5VA 1N05A 1ZUNB 1KK2A 1W35A 1BX0A 3GQBA 4FN5A 2VYQA 4LBZA 1P4MA 2BVNA 4OOSA 4WWVA 2BPOA 2R9VA 1E63A 1QFJA 1A8PA 3JU4A 2DYIA 4P6VF 3LQ6A 4DQLA 3AVVA 5J35A 3T51B 2CK3A 3OW2B 1S0UA 1YIJB 3W2GA 1VQ6B 2VNJA 2PE3A 1YJ9B 2D3LA 3CC4B 2D74A 1QFYA 1W0KA 2OYNA 1QX4A 1VQ4B 4X7FA 2CNDA 3WBKA 1VQLB 4F7DA 3WNBA 2PMDA 2X6YA 4G1VA 5DSZA 4QVJA 2QEXB 1VF7A 4TN1A 2ZL6A 3SJPA 1VJSA 3BNWA 2F4NA 1E1RA 1FRNA 2RC6A 4M2LA 3T53B 5KSWB 1HZEA 4PC1A 1NJID 2XNCA 3JQPA 2OK8A 3B82A 3W2IA 1KMHA 1T5EA 5H5JA 5EMNA 3OPOA 1WPCA 4Z4TA 3D26A 1VHEA 3CCSB 2VBUA 3FKSA 3CMEB 1K28D 4GQNA 5DN6A 2ZBUA 5FA6A 2JJ1A 2V4DA 3QE2A 4XN0A 2F1LA 1UD4A 2ZZQA 5KW9A 4OOVA 1D2EA 1IB0A 1XFOA 5B6IA 2BM0A 5F4OA 5KNLA 3ONUA 4P25A 4PC7A 2DEUA 4X07A 5IYPA 4B48A 5IYQA 2YWFA 3CCJB 4UZEA 1VLOA 3G05A 4RCZA 4P3YA 4B3FX 1FX0A 3CD6B 4XD7A 1DDGA 1WOOA 2W6IA 3A8KA 1OB5A 1BX1A 4XLCA 4OPSA 4Z4VA 1W34A 1KTVA 3LVBA 1EP1B 4LBYA 1WP6A 4QUZA 3SLNA 3U2QA 2V31A 1FRQA 1KK0A 3CP2A 1AIPA 4XR6A 1WSVA 1UMKA 1ZM4A 4RM0A 1GAQA 1JJ2B 2V7UA 4TMXA 4DNRB 3CMAB 4N3GA 4X05A 3WNDA 3JQRA 3Q6RA
chains in the Genus database with same CATH topology
3ZUGA 1N08A 2VBUA 1T6ZA 5TRDA 2VBTA 1Q9SA 2OYNA 1NB0A 1T6XA 1NB9A 1N06A 1S4MA 2X0KA 5FNZA 1N05A 3CTAA 5A89A 2VBVA 4UZFA 2P3MA 5A88A 1P4MA 3BNWA 5A8AA 5FO1A 1N07A 1T6YA 3OP1A 4UZEA 1MRZA 2VBSA 5FO0A 2I1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUG A;  1N08 A;  2VBU A;  1T6Z A;  5TRD A;  2VBT A;  1Q9S A;  2OYN A;  1NB0 A;  1T6X A;  1NB9 A;  1N06 A;  1S4M A;  2X0K A;  5FNZ A;  1N05 A;  3CTA A;  5A89 A;  2VBV A;  4UZF A;  2P3M A;  5A88 A;  1P4M A;  3BNW A;  5A8A A;  5FO1 A;  1N07 A;  1T6Y A;  3OP1 A;  4UZE A;  1MRZ A;  2VBS A;  5FO0 A;  2I1L A; 
#chains in the Genus database with same CATH topology
 2DOG A;  3CB4 A;  3ZUG A;  2QTL A;  2J7K A;  3SKB A;  2XND A;  3QFR A;  4NNJ A;  3CCE B;  1TUI A;  4YAF A;  2BN4 A;  4TKO B;  1TLL A;  2GJK A;  2X6W A;  3CCQ B;  1R5O A;  4G7X A;  3B78 A;  4YXW A;  3SLD A;  2ZL5 A;  3AVT A;  4TT3 A;  3Q39 A;  5IK2 A;  1DDI A;  1ZM3 A;  3GVJ A;  1KZL A;  2P3M A;  4XKV A;  3AVX A;  3MMP A;  2Q6I A;  2BGI A;  1E43 A;  1N07 A;  1ZM2 A;  1BLI A;  1VQ8 B;  4RD3 A;  4XLE A;  5HXB A;  1WSR A;  4P6Y A;  1CNF A;  1RQR A;  2WJV A;  1VQN B;  2OTJ B;  4Z4R A;  5F4M A;  2I1L A;  3ZC3 A;  4P3I A;  3W2F A;  4TMT A;  5E6T A;  2JJ2 A;  1V0E A;  4JMQ A;  3A1P A;  2E1B A;  4XM3 A;  5HZB A;  1KD1 D;  1NB9 A;  4OPO A;  3AVU A;  2B5O A;  3W2E A;  2GPJ A;  3WBJ A;  4TMW A;  1FNC A;  1VQO B;  4NBS A;  1W87 A;  2ZXI A;  2PLF A;  2HMA A;  3A8I A;  3H9N A;  4P26 A;  1EFU A;  2ZZG A;  2X8K A;  4X8I A;  1MRZ A;  4DK0 A;  1G7R A;  1Y0Y A;  2C5B A;  1EFR A;  1FDR A;  2HLD A;  3GSI A;  1YIT B;  1E3X A;  5H59 A;  1IHM A;  3WYA A;  3WNC A;  3G71 B;  2X3U A;  1I18 A;  1EP3 B;  1H8H A;  4QHY A;  1W9X A;  1ELO A;  2RC5 A;  2NPF A;  1EP2 B;  4BPR A;  1AMO A;  2WR8 A;  4RDL A;  2CC2 A;  5HKK A;  1FNM A;  3CPW B;  1SKY B;  1K9M D;  2V7X A;  1N8R D;  3Q3A A;  4UZU A;  2XZP A;  1UD8 A;  3CCV B;  4U9U A;  1V0F A;  4FXU A;  4II3 A;  3W5V A;  1EWY A;  2XGJ A;  4B4D A;  1B2R A;  2BV3 A;  4MYT A;  4NCN A;  2ZTN A;  1F20 A;  3BH4 A;  2QA4 B;  4RD2 A;  3RY8 A;  2C5H A;  5GV7 A;  5AN9 A;  3WXM A;  1DAR A;  2AHO A;  3R6K A;  5DS0 A;  1WTH D;  2GK7 A;  1QVG B;  1JA0 A;  3E1Y E;  1WDT A;  2F43 A;  3PEN A;  2HCJ B;  3ZZU A;  1R5B A;  2C78 A;  4C0S A;  3FJO A;  3VNU A;  3OJX A;  5TV2 A;  1MAB A;  1FNB A;  4XKW A;  3VR6 A;  1I8D A;  2DCU A;  4XNF A;  3OFN A;  1COW A;  5IYR A;  3CC7 B;  1IJE A;  3V7A A;  2XNJ A;  3R6J A;  4P12 A;  4XL9 A;  3U6K A;  1G7T A;  4X7E A;  4ZGQ B;  3ZBT A;  1W2B B;  1N08 A;  2FVG A;  1T6Z A;  5THX A;  1F60 A;  2VBT A;  3B8H A;  4J0Q A;  2YWH A;  1SM4 A;  2WZN A;  3OE7 A;  4PGO A;  1OB2 A;  1BPL A;  2BMW A;  1KC8 D;  2X6X A;  2OK7 A;  1J9Z A;  1GVH A;  3U6B A;  4II2 A;  3NE5 B;  2C4T A;  3ZPN A;  5FIU A;  3OZV A;  3SEJ A;  4WZE A;  1VQ5 B;  4HE5 A;  1YX2 A;  4ZCI A;  1BJK A;  1KRH A;  4QVA A;  2D9R A;  2Q6K A;  4FK8 A;  3FPK A;  4RJL A;  1UD5 A;  3W5U A;  2PIA A;  1GAW A;  1XQB A;  2CRV A;  3AGP A;  2VJJ A;  3CCU B;  3OW7 A;  5IYN A;  2KVO A;  4OP7 A;  2C77 A;  4M0L A;  5TY0 A;  3A3G A;  2CW5 A;  4XN3 A;  1VQP B;  4G5G A;  1Q9S A;  2XZO A;  3LO8 A;  1H42 A;  4G6I A;  1NB0 A;  2YWG A;  3OJW A;  4ACB A;  1QUF A;  3QFC A;  3HAG A;  3QFS A;  3AVY A;  2DIE A;  2Q6O A;  4QFM A;  4M53 A;  1E3Z A;  5GV8 A;  3ZBU A;  3CTA A;  4HE6 A;  2VBV A;  4HIZ A;  1QFZ A;  3ZZT A;  3QSY A;  1B23 P;  1IJF A;  4H9G A;  3ZZ0 A;  3A3B A;  4Z4Y A;  3P27 A;  3WY9 A;  1KJZ A;  3OEE A;  3PA2 A;  2WYR A;  1N0V C;  4AVZ A;  4P2N A;  2F1M A;  1CNE A;  3PVD A;  2BSA A;  2Q6L A;  3MHP A;  1K8A D;  4L8J A;  3V76 A;  4X7C A;  4XLA A;  2W6J A;  3QFT A;  3CPX A;  3LNN A;  2LZJ A;  1NBM A;  4OOX A;  4RLZ A;  2BGJ A;  3CRZ A;  3DDY A;  2QDX A;  4XOR A;  1YJN B;  2V7V A;  3OAA A;  1SKQ A;  2ZXH A;  4IW3 B;  1E79 A;  4Z4Z A;  3H94 A;  3Q6Q A;  1QUE A;  5A8A A;  1CQX A;  4KKS A;  4B3X A;  2B7C A;  3I55 B;  4XQF A;  2FX3 A;  3PUN A;  1TVC A;  2GRE A;  2QN6 A;  4ASU A;  2OBR A;  2X53 S;  1QH0 A;  1JNY A;  1GO2 A;  4UAJ A;  4R71 A;  1VLY A;  3A35 A;  3CCR B;  2DET A;  1E64 A;  1VQ9 B;  1WOP A;  1PJ5 A;  3OKX A;  5TR9 A;  5L46 A;  2DER A;  3VO1 A;  4RPB A;  1EFT A;  5TRD A;  4RDK A;  3PUM A;  1UD2 A;  4XON A;  2R6H A;  4PC2 A;  2ZL7 A;  2GJR A;  4EH1 A;  3G4S B;  3T56 B;  1WOS A;  2QMU A;  2X85 A;  4C43 A;  4G1B A;  1WOR A;  4XMY A;  4UZF A;  2NV4 A;  3JQQ A;  4WZL A;  2JN9 A;  1TTT A;  4MYU A;  4AF7 A;  1Q81 D;  2EFG A;  4XOT A;  1YJW B;  3OEH A;  1KK3 A;  2VNI A;  2Z6B D;  1N0U A;  4CQJ A;  1T6Y A;  3BCF A;  1OHH A;  2M5S A;  2WJY A;  4QV2 A;  1VQM B;  1EXM A;  2YWE A;  3I1F A;  4M1K A;  2C2W A;  4B47 A;  2GJP A;  3ONY A;  4YAW A;  1HA3 A;  4G7W A;  4X06 A;  1S72 B;  2XZL A;  4YHB A;  3VNV A;  1JB9 A;  4YAU A;  1PKV A;  3PA1 A;  4DNT B;  4B3G A;  4E0F A;  4YAO A;  3W2H A;  1XE1 A;  3Q38 A;  1OGI A;  4Z4U A;  2ZZF A;  3CCL B;  3KL9 A;  1OGJ A;  4X7D A;  1QGZ A;  4TMV A;  4YEL A;  5FO1 A;  4M4S A;  1UD6 A;  1YI2 B;  3AST A;  1PJ6 A;  2ZTG A;  4RD6 A;  1YLO A;  2VNH A;  1XB2 A;  3P26 A;  1DG1 G;  3ZIA A;  4FWT A;  3GVK A;  1QGY A;  3I56 B;  2GK6 A;  1WU8 A;  3BY1 A;  4WQM A;  1HVX A;  3FPP A;  5J3O A;  4P22 A;  4PAB A;  4AC9 A;  4PAA A;  3WQZ A;  1QG0 A;  3GVL A;  4WZK A;  1NDH A;  3A8J A;  4YAL A;  5IYW A;  4ACA A;  1I7P A;  3MCA A;  1Q82 D;  1E62 A;  1QVF B;  4KKU A;  3CXC B;  2XEX A;  3E20 A;  3OZU A;  4XOP A;  5CDF A;  4Z4S A;  1G7S A;  1K73 D;  2C4U A;  1BQE A;  5F4J A;  1QGA A;  2VNK A;  1VHO A;  1ZM9 A;  3OP1 A;  3BCD A;  5HZA A;  4ZGN B;  2V7Q A;  2QGG A;  2E1R A;  1VQK B;  3AGQ A;  4Y9R A;  2JDI A;  3G6E B;  2WPD A;  3OZW A;  2ZZE A;  4DQK A;  2OBT A;  3W5H A;  2OBS A;  4YEJ A;  2ZIT A;  3LQE A;  5JBQ A;  1T6X A;  1G7C A;  4RD4 A;  1H85 A;  1JA1 A;  1UD3 A;  4ZCL A;  2QE7 A;  4RD0 A;  1S4M A;  1EFC A;  4Z1M A;  4Z4W A;  2X0K A;  3BQJ A;  4WZT A;  2DY1 A;  2CBX A;  4Y9U A;  4RD1 A;  3CMM A;  3CCM B;  3ES9 A;  3KEW A;  1GJR A;  5A89 A;  4ROX A;  4OPV A;  4Q7J B;  5BSX A;  2B7B A;  3CES A;  4B44 A;  1D1N A;  3OOC A;  1U2R A;  2VJI A;  4AF6 A;  3ASP A;  1Y0R A;  1E1Q A;  5BSY A;  1D8T A;  3BY2 A;  1M90 D;  4PC3 A;  5FO0 A;  4X0C A;  3VMF A;  4PC6 A;  4B43 A;  4TSF A;  3ASR A;  1H8E A;  3ASQ A;  3CC2 B;  4LBW A;  1R5N A;  4N3N A;  2JIZ A;  4P9S A;  4XLF A;  3ISX A;  1YHQ B;  2BM1 A;  2CF4 A;  4ZV4 A;  1N06 A;  3ASS A;  2GQF A;  3CP8 A;  2BF4 A;  5FNZ A;  4LBV A;  4RDJ A;  1W0J A;  2V7T A;  1Q86 D;  2OTL B;  1KK1 A;  2QTZ A;  5A88 A;  1M1K D;  2D3N A;  2XOK A;  4KKT A;  3BC9 A;  4P1V A;  3CW2 A;  1BMF A;  3GIR A;  2V7W A;  1NRK A;  4RCY A;  4DK1 A;  1PJ7 A;  1OB0 A;  1RQP A;  4TMZ A;  1Q7Y D;  2VBS A;  3AVW A;  4Y7C A;  2WZP P;  3J81 k;  1VQ7 B;  1GR1 A;  3SJZ A;  4ZCM A;  2EIX A;  3VO2 A;  5LMZ A;  2VZL A;  2WSS A;  4LC0 A;  4K1X A;  5FL7 A;  1KQS B;  1FND A;  2HDN B;  2ZBV A;  4XLH A;  4RPD A;  1V5V A;  1N05 A;  1ZUN B;  1KK2 A;  1W35 A;  1BX0 A;  3GQB A;  4FN5 A;  2VYQ A;  4LBZ A;  1P4M A;  2BVN A;  4OOS A;  4WWV A;  2BPO A;  2R9V A;  1E63 A;  1QFJ A;  1A8P A;  3JU4 A;  2DYI A;  4P6V F;  3LQ6 A;  4DQL A;  3AVV A;  5J35 A;  3T51 B;  2CK3 A;  3OW2 B;  1S0U A;  1YIJ B;  3W2G A;  1VQ6 B;  2VNJ A;  2PE3 A;  1YJ9 B;  2D3L A;  3CC4 B;  2D74 A;  1QFY A;  1W0K A;  2OYN A;  1QX4 A;  1VQ4 B;  4X7F A;  2CND A;  3WBK A;  1VQL B;  4F7D A;  3WNB A;  2PMD A;  2X6Y A;  4G1V A;  5DSZ A;  4QVJ A;  2QEX B;  1VF7 A;  4TN1 A;  2ZL6 A;  3SJP A;  1VJS A;  3BNW A;  2F4N A;  1E1R A;  1FRN A;  2RC6 A;  4M2L A;  3T53 B;  5KSW B;  1HZE A;  4PC1 A;  1NJI D;  2XNC A;  3JQP A;  2OK8 A;  3B82 A;  3W2I A;  1KMH A;  1T5E A;  5H5J A;  5EMN A;  3OPO A;  1WPC A;  4Z4T A;  3D26 A;  1VHE A;  3CCS B;  2VBU A;  3FKS A;  3CME B;  1K28 D;  4GQN A;  5DN6 A;  2ZBU A;  5FA6 A;  2JJ1 A;  2V4D A;  3QE2 A;  4XN0 A;  2F1L A;  1UD4 A;  2ZZQ A;  5KW9 A;  4OOV A;  1D2E A;  1IB0 A;  1XFO A;  5B6I A;  2BM0 A;  5F4O A;  5KNL A;  3ONU A;  4P25 A;  4PC7 A;  2DEU A;  4X07 A;  5IYP A;  4B48 A;  5IYQ A;  2YWF A;  3CCJ B;  4UZE A;  1VLO A;  3G05 A;  4RCZ A;  4P3Y A;  4B3F X;  1FX0 A;  3CD6 B;  4XD7 A;  1DDG A;  1WOO A;  2W6I A;  3A8K A;  1OB5 A;  1BX1 A;  4XLC A;  4OPS A;  4Z4V A;  1W34 A;  1KTV A;  3LVB A;  1EP1 B;  4LBY A;  1WP6 A;  4QUZ A;  3SLN A;  3U2Q A;  2V31 A;  1FRQ A;  1KK0 A;  3CP2 A;  1AIP A;  4XR6 A;  1WSV A;  1UMK A;  1ZM4 A;  4RM0 A;  1GAQ A;  1JJ2 B;  2V7U A;  4TMX A;  4DNR B;  3CMA B;  4N3G A;  4X05 A;  3WND A;  3JQR A;  3Q6R A; 
#chains in the Genus database with same CATH homology
 3ZUG A;  1N08 A;  2VBU A;  1T6Z A;  5TRD A;  2VBT A;  1Q9S A;  2OYN A;  1NB0 A;  1T6X A;  1NB9 A;  1N06 A;  1S4M A;  2X0K A;  5FNZ A;  1N05 A;  3CTA A;  5A89 A;  2VBV A;  4UZF A;  2P3M A;  5A88 A;  1P4M A;  3BNW A;  5A8A A;  5FO1 A;  1N07 A;  1T6Y A;  3OP1 A;  4UZE A;  1MRZ A;  2VBS A;  5FO0 A;  2I1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...