2OYNA

Crystal structure of cdp-bound protein mj0056 from methanococcus jannaschii, pfam duf120
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
137
structure length
137
Chain Sequence
SLVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MJ0056
publication title Crystal structure of hypothetical protein from Methanococcus jannaschii bound to CDP
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 25
structure length 137
sequence length 137
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2oynA01
4UZEA 2OYNA 2VBTA 5A89A 1Q9SA 1T6YA 2I1LA 2VBVA 2P3MA 3CTAA 1NB0A 3BNWA 5FO0A 1P4MA 1NB9A 1N06A 1T6XA 5A8AA 1N08A 1S4MA 5A88A 4UZFA 2VBSA 3ZUGA 1T6ZA 2VBUA 5TRDA 3OP1A 1N05A 2X0KA 1N07A 1MRZA 5FO1A 5FNZA
chains in the Genus database with same CATH superfamily
1COWA 4G1VA 2ZXHA 1N8RD 3OKXA 2OTJB 3KL9A 4TKOB 4OPSA 4Z1MA 3CC7B 5F4OA 3CPWB 1VQMB 3PA2A 4TMWA 2B7BA 2CW5A 3T51B 4ZCIA 4NBSA 4RD1A 2W6IA 1BQEA 1KJZA 2V7QA 4TMVA 1VQ7B 1E3ZA 1W35A 2Q6LA 4XL9A 2XZLA 1E62A 1T6ZA 2VBUA 2PIAA 3CCQB 4E0FA 1UD8A 2BF4A 3GIRA 1HA3A 2QDXA 2HLDA 4XORA 1W9XA 1CNFA 4RPDA 2Q6OA 1NRKA 2JN9A 1FNDA 3ASTA 2PMDA 4PC2A 1JA0A 1EFCA 3VMFA 1J9ZA 2I1LA 4G5GA 4N3NA 3AVWA 4IW3B 2F43A 1YI2B 4FXUA 1EP3B 3CPXA 1QX4A 2D74A 4RLZA 2M5SA 4FWTA 1WU8A 1P4MA 3SLDA 1BX0A 2KVOA 3OFNA 3E20A 3V76A 1G7TA 4PGOA 2CBXA 2WR8A 5DN6A 2ZXIA 2V7WA 1YHQB 2X0KA 3BQJA 1GJRA 3GVJA 3NE5B 3ONUA 3WYAA 4F7DA 4Z4UA 4B48A 3CCMB 3CCRB 4X05A 3U2QA 2XNJA 4PC6A 4YALA 2QTLA 1KK2A 2D9RA 3Q38A 2ZL5A 1UD2A 4G1BA 3CCEB 2Q6KA 4HIZA 5F4JA 4L8JA 3A1PA 1R5OA 4WZTA 2XNDA 4XD7A 4YAUA 3B78A 3GQBA 3OE7A 4DNRB 2QE7A 4KKUA 5E6TA 1GVHA 1QUFA 2BPOA 4OPVA 4Y9UA 2NPFA 3GVLA 2VNKA 5BSXA 2WJVA 3GVKA 2X53S 4P3IA 1S4MA 4KKTA 1EP2B 4DQKA 4XLCA 1TVCA 1QGYA 3MMPA 3OW2B 4YEJA 4AF6A 3P27A 5KNLA 1OB2A 5HZBA 4OOVA 5J35A 1UMKA 1G7RA 1YX2A 3CMAB 1NBMA 5B6IA 4P9SA 3WNCA 3FJOA 2X8KA 3I55B 5IYWA 4Y7CA 3Q3AA 2ZZEA 3ONYA 1K73D 3ES9A 2QMUA 4YHBA 1EFRA 2R9VA 1N0VC 3MHPA 3AVTA 4XKWA 1VQ4B 3W5UA 1KQSB 2JDIA 5F4MA 1OHHA 4B3GA 2ZZGA 4XN0A 3WQZA 1WOPA 1VHOA 1WPCA 1SKQA 3FPPA 1OB5A 1XQBA 1HVXA 1E79A 3ZZUA 1GAWA 5IYRA 5DS0A 4QHYA 1H42A 3CP2A 3AGQA 4JMQA 3A35A 4RPBA 4UZUA 2ZBVA 3JQQA 1CNEA 4XOTA 1VLOA 4M1KA 1S72B 1KRHA 4OP7A 1K9MD 3G71B 1M1KD 2CF4A 4X8IA 3CCVB 3VNUA 2VNHA 4MYTA 1SM4A 3LO8A 2X3UA 1W2BB 4X06A 5IK2A 3A3GA 4XOPA 3OP1A 3FKSA 1MRZA 1PJ7A 1T5EA 1W0JA 3CMMA 3VR6A 1D8TA 3R6KA 2YWGA 3CESA 2EFGA 3PA1A 3CP8A 2D3LA 1E1QA 1FRQA 1K28D 4X7EA 2QEXB 1BX1A 2NV4A 4X7DA 4P3YA 1VQ8B 2XEXA 3PUNA 1JNYA 2OBSA 4G7XA 1A8PA 3E1YE 1ZUNB 2BM0A 3KEWA 1QFZA 1VQLB 3P26A 4Z4RA 4UZFA 2X6XA 2VBSA 3W2FA 2XZOA 3AVYA 4RDKA 3OPOA 4YAOA 2C4TA 1GO2A 1PJ6A 1RQPA 4YXWA 4OPOA 1Q9SA 3CXCB 4P22A 1VQ9B 1E63A 1V5VA 1W34A 3CB4A 4X7FA 1ZM4A 3Q6RA 3H9NA 1W87A 1VQPB 3CCUB 3BCFA 3CRZA 1QGAA 1R5NA 2DY1A 4N3GA 1N08A 4QVAA 5A88A 1JJ2B 5JBQA 2OTLB 2BSAA 2JJ2A 2GJPA 4RCYA 1Y0YA 3CW2A 4HE6A 1N05A 2FX3A 2DEUA 3OAAA 4TMXA 4RD4A 5HXBA 2JJ1A 4TT3A 4NNJA 2QN6A 3U6KA 1AIPA 3W2EA 4Z4ZA 4MYUA 1VLYA 4G7WA 3CCSB 1FRNA 3BC9A 4M4SA 4PC1A 3QFSA 2V4DA 3ZPNA 4ZGNB 4WZKA 3VNVA 2WPDA 1GAQA 2WYRA 1BJKA 4QVJA 1NB0A 3BNWA 4BPRA 1ZM9A 4U9UA 1U2RA 1UD4A 3PUMA 3BCDA 1QGZA 1T6XA 1VQNB 3ZIAA 1VF7A 4PAAA 1D2EA 3LQ6A 4RCZA 4ZCMA 1IJEA 1WSVA 2V7VA 3OZWA 4G6IA 2ZITA 3LVBA 3SEJA 3I56B 1PJ5A 5GV8A 3PVDA 4ACAA 1MABA 1JA1A 3OZUA 1KTVA 1KD1D 1HZEA 3HAGA 4YAFA 4RM0A 5LMZA 2YWFA 3ZC3A 3G4SB 1XB2A 4K1XA 2XNCA 3AVVA 1NJID 3A8JA 3WBJA 1R5BA 3GSIA 2LZJA 2GPJA 4ASUA 3CTAA 3B82A 1B2RA 3CC2B 4ZV4A 3QFCA 4R71A 5TY0A 2C2WA 3OOCA 4ZCLA 4PC3A 4B4DA 1WP6A 1UD3A 4Z4YA 2W6JA 4P1VA 1EWYA 2HMAA 4WZLA 1QVGB 3BY1A 2DOGA 1YLOA 3ZZ0A 1VJSA 3V7AA 4DK0A 4RJLA 2ZL6A 1FX0A 2XZPA 3W2GA 4ACBA 2E1RA 4Z4WA 2ZL7A 3H94A 2C4UA 2R6HA 4TSFA 1WOSA 1H8EA 2WJYA 3LQEA 3ZBTA 2EIXA 1Q81D 1FNBA 4XKVA 2BN4A 2BM1A 2XOKA 2V7XA 4PABA 1YITB 2E1BA 4LBZA 3W5HA 1WORA 3WY9A 3JQRA 1OGIA 4XLEA 3T56B 5BSYA 2VNIA 3JU4A 3ASQA 4WZEA 4PC7A 4C43A 1XE1A 3CMEB 1DDGA 3OEEA 1BPLA 3QFRA 4B44A 4FK8A 2ZZFA 3WNBA 1YJ9B 3WNDA 1NDHA 2ZTGA 1M90D 4XN3A 2OBRA 2WZPP 1F60A 1KK0A 2GQFA 4YELA 3SJZA 5J3OA 4UZEA 1G7SA 2CC2A 2D3NA 3VO1A 5IYPA 2VBTA 3JQPA 5A89A 3Q39A 2B5OA 4LC0A 1VQOB 1DDIA 2ZZQA 3G05A 3D26A 1Q86D 4YAWA 2OK8A 2RC6A 2VNJA 2ZTNA 3AVXA 2B7CA 3ASPA 4P6VF 2GK6A 1KK1A 1H85A 2WZNA 2F1LA 1E1RA 2OK7A 2BGIA 5TR9A 1FNCA 2CK3A 5L46A 1QG0A 4H9GA 4RD0A 2BVNA 1F20A 5EMNA 1FNMA 4NCNA 3ZUGA 2BGJA 3ASRA 2CRVA 2OBTA 2XGJA 3T53B 1N07A 3WBKA 4AC9A 3QSYA 2DETA 1KK3A 2VJIA 3FPKA 3G6EB 3ISXA 2J7KA 4DNTB 5KW9A 2QGGA 4UAJA 3OJXA 2F1MA 2HCJB 3OEHA 1VHEA 4Z4SA 1VQ5B 2ZBUA 2DERA 1CQXA 1ZM2A 3VO2A 4M53A 2GK7A 4XLAA 4RD2A 2BV3A 1UD6A 1S0UA 2FVGA 4RDLA 3B8HA 2DCUA 2X6WA 4ZGQB 1BLIA 3A8IA 3QE2A 4QV2A 1KC8D 2GREA 4WWVA 4XLHA 5H5JA 2GJRA 1KMHA 2C5BA 4TN1A 5AN9A 1I7PA 2DIEA 4RDJA 3W5VA 1RQRA 4B3XA 3ZZTA 1T6YA 2YWEA 1KZLA 1WOOA 2VBVA 2P3MA 2QTZA 1EP1B 1EXMA 1E43A 1GR1A 1VQKB 1D1NA 1XFOA 3W2IA 4DQLA 5FO0A 1NB9A 1N06A 4LBVA 3WXMA 5KSWB 4Y9RA 3ASSA 3MCAA 5A8AA 3CCJB 2QA4B 1PKVA 1E64A 4RD6A 4XNFA 1TLLA 5HZAA 5FO1A 1UD5A 4XMYA 1AMOA 4OOXA 2RC5A 4HE5A 1ZM3A 1Q7YD 4AF7A 3AVUA 1YJNB 3LNNA 1DG1G 2OYNA 3A8KA 3RY8A 1YIJB 2BMWA 1WDTA 2VYQA 4P2NA 1TUIA 3PENA 4QUZA 4B47A 5FL7A 1EFUA 2DYIA 1QFYA 4Z4VA 3OJWA 4KKSA 4P25A 3SKBA 1VQ6B 3R6JA 4CQJA 2VJJA 3CC4B 5DSZA 2X85A 4EH1A 4LBYA 1B23P 4P12A 1JB9A 4DK1A 4M2LA 2PLFA 5IYQA 1OB0A 4XLFA 2WSSA 2VZLA 1QFJA 2V31A 4LBWA 4X07A 4II3A 5TRDA 1OGJA 5FNZA 5IYNA 1V0FA 4GQNA 1K8AD 3SJPA 2V7TA 4B43A 4RD3A 2GJKA 5FA6A 5HKKA 1I18A 3W2HA 2PE3A 5CDFA 4XONA 5H59A 4XQFA 4P26A 2V7UA 3J81k 3OW7A 3I1FA 3AGPA 4WQMA 3BH4A 3ZBUA 3CD6B 4C0SA 1V0EA 5THXA 5FIUA 2JIZA 3DDYA 1IHMA 1I8DA 1BMFA 2YWHA 5GV7A 1WSRA 2CNDA 1H8HA 3QFTA 4AVZA 2Q6IA 3BY2A 4ROXA 4XM3A 1G7CA 1N0UA 4X0CA 4FN5A 2C5HA 1WTHD 3U6BA 1QUEA 2X6YA 4Z4TA 4II2A 1IJFA 4Q7JB 3A3BA 4M0LA 4P6YA 1Q82D 2AHOA 1E3XA 3SLNA 3CCLB 4B3FX 1FDRA 1QVFB 3Q6QA 1IB0A 2Z6BD 4TMZA 1Y0RA 4XR6A 4QFMA 5TV2A 1DARA 1SKYB 2C78A 2HDNB 1EFTA 4TMTA 1YJWB 3OZVA 1QH0A 4J0QA 4X7CA 1ELOA 2F4NA 1W0KA 1TTTA 2C77A 4OOSA
chains in the Genus database with same CATH topology
4UZEA 2OYNA 2VBTA 5A89A 1Q9SA 1T6YA 2I1LA 2VBVA 2P3MA 3CTAA 1NB0A 3BNWA 5FO0A 1P4MA 1NB9A 1N06A 1T6XA 5A8AA 1N08A 1S4MA 5A88A 4UZFA 2VBSA 3ZUGA 1T6ZA 2VBUA 5TRDA 3OP1A 1N05A 2X0KA 1N07A 1MRZA 5FO1A 5FNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZE A;  2OYN A;  2VBT A;  5A89 A;  1Q9S A;  1T6Y A;  2I1L A;  2VBV A;  2P3M A;  3CTA A;  1NB0 A;  3BNW A;  5FO0 A;  1P4M A;  1NB9 A;  1N06 A;  1T6X A;  5A8A A;  1N08 A;  1S4M A;  5A88 A;  4UZF A;  2VBS A;  3ZUG A;  1T6Z A;  2VBU A;  5TRD A;  3OP1 A;  1N05 A;  2X0K A;  1N07 A;  1MRZ A;  5FO1 A;  5FNZ A; 
#chains in the Genus database with same CATH topology
 1COW A;  4G1V A;  2ZXH A;  1N8R D;  3OKX A;  2OTJ B;  3KL9 A;  4TKO B;  4OPS A;  4Z1M A;  3CC7 B;  5F4O A;  3CPW B;  1VQM B;  3PA2 A;  4TMW A;  2B7B A;  2CW5 A;  3T51 B;  4ZCI A;  4NBS A;  4RD1 A;  2W6I A;  1BQE A;  1KJZ A;  2V7Q A;  4TMV A;  1VQ7 B;  1E3Z A;  1W35 A;  2Q6L A;  4XL9 A;  2XZL A;  1E62 A;  1T6Z A;  2VBU A;  2PIA A;  3CCQ B;  4E0F A;  1UD8 A;  2BF4 A;  3GIR A;  1HA3 A;  2QDX A;  2HLD A;  4XOR A;  1W9X A;  1CNF A;  4RPD A;  2Q6O A;  1NRK A;  2JN9 A;  1FND A;  3AST A;  2PMD A;  4PC2 A;  1JA0 A;  1EFC A;  3VMF A;  1J9Z A;  2I1L A;  4G5G A;  4N3N A;  3AVW A;  4IW3 B;  2F43 A;  1YI2 B;  4FXU A;  1EP3 B;  3CPX A;  1QX4 A;  2D74 A;  4RLZ A;  2M5S A;  4FWT A;  1WU8 A;  1P4M A;  3SLD A;  1BX0 A;  2KVO A;  3OFN A;  3E20 A;  3V76 A;  1G7T A;  4PGO A;  2CBX A;  2WR8 A;  5DN6 A;  2ZXI A;  2V7W A;  1YHQ B;  2X0K A;  3BQJ A;  1GJR A;  3GVJ A;  3NE5 B;  3ONU A;  3WYA A;  4F7D A;  4Z4U A;  4B48 A;  3CCM B;  3CCR B;  4X05 A;  3U2Q A;  2XNJ A;  4PC6 A;  4YAL A;  2QTL A;  1KK2 A;  2D9R A;  3Q38 A;  2ZL5 A;  1UD2 A;  4G1B A;  3CCE B;  2Q6K A;  4HIZ A;  5F4J A;  4L8J A;  3A1P A;  1R5O A;  4WZT A;  2XND A;  4XD7 A;  4YAU A;  3B78 A;  3GQB A;  3OE7 A;  4DNR B;  2QE7 A;  4KKU A;  5E6T A;  1GVH A;  1QUF A;  2BPO A;  4OPV A;  4Y9U A;  2NPF A;  3GVL A;  2VNK A;  5BSX A;  2WJV A;  3GVK A;  2X53 S;  4P3I A;  1S4M A;  4KKT A;  1EP2 B;  4DQK A;  4XLC A;  1TVC A;  1QGY A;  3MMP A;  3OW2 B;  4YEJ A;  4AF6 A;  3P27 A;  5KNL A;  1OB2 A;  5HZB A;  4OOV A;  5J35 A;  1UMK A;  1G7R A;  1YX2 A;  3CMA B;  1NBM A;  5B6I A;  4P9S A;  3WNC A;  3FJO A;  2X8K A;  3I55 B;  5IYW A;  4Y7C A;  3Q3A A;  2ZZE A;  3ONY A;  1K73 D;  3ES9 A;  2QMU A;  4YHB A;  1EFR A;  2R9V A;  1N0V C;  3MHP A;  3AVT A;  4XKW A;  1VQ4 B;  3W5U A;  1KQS B;  2JDI A;  5F4M A;  1OHH A;  4B3G A;  2ZZG A;  4XN0 A;  3WQZ A;  1WOP A;  1VHO A;  1WPC A;  1SKQ A;  3FPP A;  1OB5 A;  1XQB A;  1HVX A;  1E79 A;  3ZZU A;  1GAW A;  5IYR A;  5DS0 A;  4QHY A;  1H42 A;  3CP2 A;  3AGQ A;  4JMQ A;  3A35 A;  4RPB A;  4UZU A;  2ZBV A;  3JQQ A;  1CNE A;  4XOT A;  1VLO A;  4M1K A;  1S72 B;  1KRH A;  4OP7 A;  1K9M D;  3G71 B;  1M1K D;  2CF4 A;  4X8I A;  3CCV B;  3VNU A;  2VNH A;  4MYT A;  1SM4 A;  3LO8 A;  2X3U A;  1W2B B;  4X06 A;  5IK2 A;  3A3G A;  4XOP A;  3OP1 A;  3FKS A;  1MRZ A;  1PJ7 A;  1T5E A;  1W0J A;  3CMM A;  3VR6 A;  1D8T A;  3R6K A;  2YWG A;  3CES A;  2EFG A;  3PA1 A;  3CP8 A;  2D3L A;  1E1Q A;  1FRQ A;  1K28 D;  4X7E A;  2QEX B;  1BX1 A;  2NV4 A;  4X7D A;  4P3Y A;  1VQ8 B;  2XEX A;  3PUN A;  1JNY A;  2OBS A;  4G7X A;  1A8P A;  3E1Y E;  1ZUN B;  2BM0 A;  3KEW A;  1QFZ A;  1VQL B;  3P26 A;  4Z4R A;  4UZF A;  2X6X A;  2VBS A;  3W2F A;  2XZO A;  3AVY A;  4RDK A;  3OPO A;  4YAO A;  2C4T A;  1GO2 A;  1PJ6 A;  1RQP A;  4YXW A;  4OPO A;  1Q9S A;  3CXC B;  4P22 A;  1VQ9 B;  1E63 A;  1V5V A;  1W34 A;  3CB4 A;  4X7F A;  1ZM4 A;  3Q6R A;  3H9N A;  1W87 A;  1VQP B;  3CCU B;  3BCF A;  3CRZ A;  1QGA A;  1R5N A;  2DY1 A;  4N3G A;  1N08 A;  4QVA A;  5A88 A;  1JJ2 B;  5JBQ A;  2OTL B;  2BSA A;  2JJ2 A;  2GJP A;  4RCY A;  1Y0Y A;  3CW2 A;  4HE6 A;  1N05 A;  2FX3 A;  2DEU A;  3OAA A;  4TMX A;  4RD4 A;  5HXB A;  2JJ1 A;  4TT3 A;  4NNJ A;  2QN6 A;  3U6K A;  1AIP A;  3W2E A;  4Z4Z A;  4MYU A;  1VLY A;  4G7W A;  3CCS B;  1FRN A;  3BC9 A;  4M4S A;  4PC1 A;  3QFS A;  2V4D A;  3ZPN A;  4ZGN B;  4WZK A;  3VNV A;  2WPD A;  1GAQ A;  2WYR A;  1BJK A;  4QVJ A;  1NB0 A;  3BNW A;  4BPR A;  1ZM9 A;  4U9U A;  1U2R A;  1UD4 A;  3PUM A;  3BCD A;  1QGZ A;  1T6X A;  1VQN B;  3ZIA A;  1VF7 A;  4PAA A;  1D2E A;  3LQ6 A;  4RCZ A;  4ZCM A;  1IJE A;  1WSV A;  2V7V A;  3OZW A;  4G6I A;  2ZIT A;  3LVB A;  3SEJ A;  3I56 B;  1PJ5 A;  5GV8 A;  3PVD A;  4ACA A;  1MAB A;  1JA1 A;  3OZU A;  1KTV A;  1KD1 D;  1HZE A;  3HAG A;  4YAF A;  4RM0 A;  5LMZ A;  2YWF A;  3ZC3 A;  3G4S B;  1XB2 A;  4K1X A;  2XNC A;  3AVV A;  1NJI D;  3A8J A;  3WBJ A;  1R5B A;  3GSI A;  2LZJ A;  2GPJ A;  4ASU A;  3CTA A;  3B82 A;  1B2R A;  3CC2 B;  4ZV4 A;  3QFC A;  4R71 A;  5TY0 A;  2C2W A;  3OOC A;  4ZCL A;  4PC3 A;  4B4D A;  1WP6 A;  1UD3 A;  4Z4Y A;  2W6J A;  4P1V A;  1EWY A;  2HMA A;  4WZL A;  1QVG B;  3BY1 A;  2DOG A;  1YLO A;  3ZZ0 A;  1VJS A;  3V7A A;  4DK0 A;  4RJL A;  2ZL6 A;  1FX0 A;  2XZP A;  3W2G A;  4ACB A;  2E1R A;  4Z4W A;  2ZL7 A;  3H94 A;  2C4U A;  2R6H A;  4TSF A;  1WOS A;  1H8E A;  2WJY A;  3LQE A;  3ZBT A;  2EIX A;  1Q81 D;  1FNB A;  4XKV A;  2BN4 A;  2BM1 A;  2XOK A;  2V7X A;  4PAB A;  1YIT B;  2E1B A;  4LBZ A;  3W5H A;  1WOR A;  3WY9 A;  3JQR A;  1OGI A;  4XLE A;  3T56 B;  5BSY A;  2VNI A;  3JU4 A;  3ASQ A;  4WZE A;  4PC7 A;  4C43 A;  1XE1 A;  3CME B;  1DDG A;  3OEE A;  1BPL A;  3QFR A;  4B44 A;  4FK8 A;  2ZZF A;  3WNB A;  1YJ9 B;  3WND A;  1NDH A;  2ZTG A;  1M90 D;  4XN3 A;  2OBR A;  2WZP P;  1F60 A;  1KK0 A;  2GQF A;  4YEL A;  3SJZ A;  5J3O A;  4UZE A;  1G7S A;  2CC2 A;  2D3N A;  3VO1 A;  5IYP A;  2VBT A;  3JQP A;  5A89 A;  3Q39 A;  2B5O A;  4LC0 A;  1VQO B;  1DDI A;  2ZZQ A;  3G05 A;  3D26 A;  1Q86 D;  4YAW A;  2OK8 A;  2RC6 A;  2VNJ A;  2ZTN A;  3AVX A;  2B7C A;  3ASP A;  4P6V F;  2GK6 A;  1KK1 A;  1H85 A;  2WZN A;  2F1L A;  1E1R A;  2OK7 A;  2BGI A;  5TR9 A;  1FNC A;  2CK3 A;  5L46 A;  1QG0 A;  4H9G A;  4RD0 A;  2BVN A;  1F20 A;  5EMN A;  1FNM A;  4NCN A;  3ZUG A;  2BGJ A;  3ASR A;  2CRV A;  2OBT A;  2XGJ A;  3T53 B;  1N07 A;  3WBK A;  4AC9 A;  3QSY A;  2DET A;  1KK3 A;  2VJI A;  3FPK A;  3G6E B;  3ISX A;  2J7K A;  4DNT B;  5KW9 A;  2QGG A;  4UAJ A;  3OJX A;  2F1M A;  2HCJ B;  3OEH A;  1VHE A;  4Z4S A;  1VQ5 B;  2ZBU A;  2DER A;  1CQX A;  1ZM2 A;  3VO2 A;  4M53 A;  2GK7 A;  4XLA A;  4RD2 A;  2BV3 A;  1UD6 A;  1S0U A;  2FVG A;  4RDL A;  3B8H A;  2DCU A;  2X6W A;  4ZGQ B;  1BLI A;  3A8I A;  3QE2 A;  4QV2 A;  1KC8 D;  2GRE A;  4WWV A;  4XLH A;  5H5J A;  2GJR A;  1KMH A;  2C5B A;  4TN1 A;  5AN9 A;  1I7P A;  2DIE A;  4RDJ A;  3W5V A;  1RQR A;  4B3X A;  3ZZT A;  1T6Y A;  2YWE A;  1KZL A;  1WOO A;  2VBV A;  2P3M A;  2QTZ A;  1EP1 B;  1EXM A;  1E43 A;  1GR1 A;  1VQK B;  1D1N A;  1XFO A;  3W2I A;  4DQL A;  5FO0 A;  1NB9 A;  1N06 A;  4LBV A;  3WXM A;  5KSW B;  4Y9R A;  3ASS A;  3MCA A;  5A8A A;  3CCJ B;  2QA4 B;  1PKV A;  1E64 A;  4RD6 A;  4XNF A;  1TLL A;  5HZA A;  5FO1 A;  1UD5 A;  4XMY A;  1AMO A;  4OOX A;  2RC5 A;  4HE5 A;  1ZM3 A;  1Q7Y D;  4AF7 A;  3AVU A;  1YJN B;  3LNN A;  1DG1 G;  2OYN A;  3A8K A;  3RY8 A;  1YIJ B;  2BMW A;  1WDT A;  2VYQ A;  4P2N A;  1TUI A;  3PEN A;  4QUZ A;  4B47 A;  5FL7 A;  1EFU A;  2DYI A;  1QFY A;  4Z4V A;  3OJW A;  4KKS A;  4P25 A;  3SKB A;  1VQ6 B;  3R6J A;  4CQJ A;  2VJJ A;  3CC4 B;  5DSZ A;  2X85 A;  4EH1 A;  4LBY A;  1B23 P;  4P12 A;  1JB9 A;  4DK1 A;  4M2L A;  2PLF A;  5IYQ A;  1OB0 A;  4XLF A;  2WSS A;  2VZL A;  1QFJ A;  2V31 A;  4LBW A;  4X07 A;  4II3 A;  5TRD A;  1OGJ A;  5FNZ A;  5IYN A;  1V0F A;  4GQN A;  1K8A D;  3SJP A;  2V7T A;  4B43 A;  4RD3 A;  2GJK A;  5FA6 A;  5HKK A;  1I18 A;  3W2H A;  2PE3 A;  5CDF A;  4XON A;  5H59 A;  4XQF A;  4P26 A;  2V7U A;  3J81 k;  3OW7 A;  3I1F A;  3AGP A;  4WQM A;  3BH4 A;  3ZBU A;  3CD6 B;  4C0S A;  1V0E A;  5THX A;  5FIU A;  2JIZ A;  3DDY A;  1IHM A;  1I8D A;  1BMF A;  2YWH A;  5GV7 A;  1WSR A;  2CND A;  1H8H A;  3QFT A;  4AVZ A;  2Q6I A;  3BY2 A;  4ROX A;  4XM3 A;  1G7C A;  1N0U A;  4X0C A;  4FN5 A;  2C5H A;  1WTH D;  3U6B A;  1QUE A;  2X6Y A;  4Z4T A;  4II2 A;  1IJF A;  4Q7J B;  3A3B A;  4M0L A;  4P6Y A;  1Q82 D;  2AHO A;  1E3X A;  3SLN A;  3CCL B;  4B3F X;  1FDR A;  1QVF B;  3Q6Q A;  1IB0 A;  2Z6B D;  4TMZ A;  1Y0R A;  4XR6 A;  4QFM A;  5TV2 A;  1DAR A;  1SKY B;  2C78 A;  2HDN B;  1EFT A;  4TMT A;  1YJW B;  3OZV A;  1QH0 A;  4J0Q A;  4X7C A;  1ELO A;  2F4N A;  1W0K A;  1TTT A;  2C77 A;  4OOS A; 
#chains in the Genus database with same CATH homology
 4UZE A;  2OYN A;  2VBT A;  5A89 A;  1Q9S A;  1T6Y A;  2I1L A;  2VBV A;  2P3M A;  3CTA A;  1NB0 A;  3BNW A;  5FO0 A;  1P4M A;  1NB9 A;  1N06 A;  1T6X A;  5A8A A;  1N08 A;  1S4M A;  5A88 A;  4UZF A;  2VBS A;  3ZUG A;  1T6Z A;  2VBU A;  5TRD A;  3OP1 A;  1N05 A;  2X0K A;  1N07 A;  1MRZ A;  5FO1 A;  5FNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...