2OYNA

Crystal structure of cdp-bound protein mj0056 from methanococcus jannaschii, pfam duf120
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
137
structure length
137
Chain Sequence
b'SLVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0056
publication title Crystal structure of hypothetical protein from Methanococcus jannaschii bound to CDP
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Structural genomics, unknown function
total genus 25
structure length 137
sequence length 137
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2oynA01
2VBUA 2VBSA 2P3MA 4UZEA 1MRZA 5FO1A 5A89A 2I1LA 3OP1A 1Q9SA 5FNZA 5FO0A 5TRDA 1P4MA 1NB0A 2OYNA 2X0KA 1N08A 2VBTA 3BNWA 2VBVA 4UZFA 1T6ZA 1N05A 5A88A 1T6XA 1N06A 1T6YA 3CTAA 1NB9A 5A8AA 1S4MA 1N07A 3ZUGA
chains in the Genus database with same CATH superfamily
4FN5A 1E3ZA 2QE7A 3BY2A 3GSIA 3OW7A 4YAFA 5L46A 5H59A 3I55B 3CXCB 3R6JA 4P6VF 2WZPP 2WJYA 1QVFB 1PJ6A 2ZBUA 3CCEB 2WJVA 2QMUA 3BY1A 2WSSA 4IW3B 4B43A 3JQRA 5IYQA 4PC1A 5KNLA 3CESA 4RDKA 3CCQB 2E1BA 1N08A 2RC6A 1YX2A 3KEWA 3SLNA 3CCJB 1VQ8B 1T6YA 3OZWA 1VF7A 4Z4TA 4OPOA 2D3LA 1QVGB 1K8AD 1QUFA 1I8DA 1YI2B 3VNUA 4B3XA 1E63A 1MABA 1U2RA 2Q6IA 1F60A 3ES9A 3CCMB 4X8IA 3CP2A 4P22A 2DCUA 3W2HA 4Z4YA 2YWHA 4ZCLA 1BJKA 1KK2A 1MRZA 3CB4A 3G71B 3B82A 3AVTA 1EP2B 3LNNA 3LVBA 3Q6RA 2BV3A 2F1MA 1NB0A 1RQPA 2X6YA 3WBKA 4RLZA 5E6TA 1AMOA 4P3YA 3GVLA 3ZPNA 1N05A 3DDYA 2VNIA 3OZVA 1DARA 4XD7A 4AVZA 3QE2A 4JMQA 1GVHA 4AC9A 1S0UA 1VQ9B 3WXMA 1VQ5B 3ZUGA 3CMAB 2EFGA 1EP1B 2C5BA 4XLAA 4K1XA 2BN4A 2V7WA 4F7DA 4Z1MA 3PA1A 3VO1A 1WSRA 2Q6LA 5J3OA 3U6KA 2VNKA 4RCYA 1ZUNB 2OK7A 3OE7A 1COWA 1Y0RA 2CC2A 2BGIA 4TMWA 3AVWA 3OKXA 3OOCA 2ZITA 4X0CA 4Z4ZA 1R5BA 2BSAA 4LBWA 5H5JA 4TKOB 1WORA 4HE6A 1QUEA 1VJSA 1ZM9A 2GK7A 2HMAA 3W5VA 4X7DA 2GQFA 3U6BA 3CMEB 3Q6QA 4EH1A 3MHPA 1KD1D 4YELA 4RJLA 4YAWA 2JDIA 2X3UA 4DK1A 2PE3A 3MMPA 1G7TA 1UD5A 4YAOA 2ZTNA 4AF7A 1GAWA 4NNJA 4QFMA 3VR6A 4C43A 4Y7CA 1KK1A 1B23P 3QFTA 4PAAA 3AVUA 1EXMA 1UD2A 2R6HA 3WYAA 3PENA 1P4MA 2VJIA 1TLLA 4LBVA 2ZL5A 3NE5B 4P3IA 1W2BB 4TN1A 2VBVA 1WSVA 3SLDA 3CW2A 1PKVA 1TVCA 2C2WA 1N06A 2GREA 2OTLB 5B6IA 4WWVA 3WQZA 2DERA 4KKUA 4TMTA 1H8HA 4XLEA 4LBYA 2GJKA 4PC2A 5J35A 2JN9A 2DEUA 1KMHA 1H85A 4WZEA 3OPOA 2Q6OA 1BQEA 1ZM3A 1KTVA 1SM4A 2C4UA 1FNCA 1JNYA 1IJFA 4ZCMA 4OPSA 1IB0A 3G05A 1K28D 3ONYA 4B47A 1XQBA 2X0KA 3CMMA 3B8HA 1UD3A 1VQ4B 5F4OA 5A88A 2VZLA 1K73D 1UD4A 2X8KA 1UMKA 3OJXA 4QHYA 1QGAA 2CF4A 3BH4A 4PC7A 4RD6A 4UZUA 1S72B 1N0UA 4YAUA 2XZLA 2CW5A 1ELOA 3WNDA 1VLOA 1OHHA 3D26A 4B48A 5LMZA 1NBMA 1VQ6B 4NCNA 4OPVA 5IYNA 4QUZA 3B78A 5FNZA 4G7WA 4X7FA 3PA2A 4FXUA 4XN3A 5FO0A 3ASSA 4DK0A 3A3BA 4Z4SA 4XONA 1PJ7A 4X07A 1T5EA 4M2LA 5KSWB 2F4NA 3ASPA 4FK8A 4UAJA 3JQPA 2NPFA 1YJWB 1Q82D 1VQ7B 2ZTGA 2YWFA 4G6IA 1DG1G 3BQJA 3ASRA 4NBSA 1FNBA 4XKVA 1SKQA 3W5HA 3ZC3A 1VQPB 1E3XA 2ZZGA 4U9UA 4YEJA 2KVOA 4PC3A 4LBZA 1N8RD 4XM3A 3W2IA 2P3MA 1EFCA 2OBRA 1I7PA 5A89A 1PJ5A 2PIAA 4RDJA 1XB2A 4ZGQB 1G7RA 1QH0A 2C78A 1H42A 2JIZA 4B3FX 1KK0A 1W0KA 5FL7A 4PABA 3GVKA 3RY8A 4XOPA 3VO2A 1EP3B 3FPKA 4II3A 2C5HA 2X85A 1VQKB 2ZZQA 4YXWA 3U2QA 4ASUA 1CQXA 4PC6A 4QVJA 2HCJB 1DDIA 1E1RA 2WYRA 5FA6A 3V76A 5THXA 4TMVA 4J0QA 1DDGA 3ZBTA 3W5UA 3QFCA 2BF4A 5DN6A 2HDNB 2V7TA 2JJ2A 2OTJB 3PUNA 3ZBUA 2R9VA 2W6JA 4RD1A 3P27A 4G1VA 3AVVA 1Q9SA 1WTHD 3AGQA 1Q81D 2BM0A 5CDFA 1VQOB 2VNHA 3OEHA 4P1VA 3WY9A 1B2RA 1FRNA 2PLFA 4M53A 1WP6A 1G7SA 1WOPA 4TMZA 3VNVA 1Y0YA 1YLOA 2VBTA 5F4JA 1HZEA 4RD0A 2WZNA 1JJ2B 4N3NA 1D2EA 3CRZA 1W35A 3ASTA 4XKWA 4XLCA 2XEXA 2ZXIA 3CC4B 4G1BA 3V7AA 1YJNB 2X53S 2Q6KA 1V0EA 2QGGA 3H9NA 1Q7YD 4N3GA 4XQFA 3GVJA 3I1FA 3ONUA 2CNDA 3OP1A 2CK3A 3E20A 3KL9A 4G5GA 2B5OA 2V7VA 2XGJA 1WDTA 4XL9A 1W34A 3Q39A 5EMNA 3AVXA 1KJZA 2NV4A 4XNFA 1CNFA 1ZM4A 2GJRA 1G7CA 1E43A 3OEEA 4XLHA 2OK8A 5FIUA 2W6IA 2QTLA 1H8EA 3OJWA 5AN9A 3CTAA 3J81k 1YITB 1QX4A 2VNJA 2DY1A 1TUIA 3AGPA 4HIZA 3ZZUA 4DNTB 4ACAA 1FDRA 1F20A 1V0FA 2QDXA 2XNDA 1NDHA 2HLDA 3A8JA 2GPJA 4RDLA 3BCDA 1NRKA 5HXBA 2XZPA 1KZLA 3QFSA 5IYPA 3G6EB 3A1PA 4TSFA 4GQNA 4P12A 2RC5A 4M1KA 4RD4A 3FKSA 3CPXA 5BSXA 5IYWA 2QA4B 1OGIA 5HZAA 2BPOA 3BNWA 4B3GA 1VLYA 3GIRA 3GQBA 1A8PA 4Y9RA 2J7KA 4PGOA 2BVNA 5TY0A 5IYRA 3SEJA 2EIXA 4B44A 1ZM2A 1CNEA 4WQMA 1W0JA 4RD2A 3CCVB 4M4SA 1R5NA 4OOSA 4AF6A 3I56B 4HE5A 4TMXA 2B7BA 2D74A 1OB5A 1FNDA 3VMFA 1WOOA 1YJ9B 5IK2A 1N0VC 3E1YE 3ASQA 3SKBA 2BGJA 1AIPA 5DSZA 3SJZA 1KRHA 2FX3A 2OBSA 2X6XA 2DOGA 2DETA 3HAGA 2JJ1A 3LQEA 3A8IA 4KKSA 3FPPA 1QFYA 3CP8A 1RQRA 2ZXHA 1VQMB 4RCZA 3CC2B 4P2NA 1VHOA 4XORA 1E62A 4ZCIA 1Q86D 4CQJA 5DS0A 2VBUA 4M0LA 4WZLA 4RD3A 4XR6A 3SJPA 2BM1A 1M90D 2XZOA 1WU8A 3JU4A 1GR1A 1BMFA 3LO8A 3FJOA 1I18A 4X06A 1W87A 3W2FA 2D3NA 3A3GA 2BMWA 4C0SA 4X05A 1QG0A 4Z4VA 4UZFA 2YWEA 1JA0A 3CCLB 1BLIA 4Q7JB 2C77A 4XLFA 4TT3A 5GV8A 4ZGNB 2Z6BD 5JBQA 4ACBA 2XOKA 1N07A 4G7XA 4P6YA 1V5VA 2LZJA 2PMDA 4KKTA 3WNCA 4BPRA 4P25A 2M5SA 2F43A 2VBSA 2QN6A 4Y9UA 3OAAA 1VQNB 3ISXA 4RM0A 2DYIA 4WZTA 1JB9A 3QSYA 2DIEA 3CD6B 2FVGA 2AHOA 4RPBA 2OBTA 5TV2A 3WBJA 2V4DA 3A8KA 4Z4WA 1FNMA 3ZZTA 1UD8A 2F1LA 3WNBA 4B4DA 5A8AA 3BCFA 1KK3A 2CRVA 1QFJA 2ZL7A 2WR8A 3JQQA 1E1QA 4L8JA 1BX0A 2XNJA 1M1KD 1GO2A 3T56B 4R71A 3Q38A 3MCAA 1NJID 1D8TA 3G4SB 1K9MD 2ZBVA 4OOXA 4WZKA 5BSYA 4Z4UA 3W2GA 2YWGA 4X7CA 3ZIAA 4H9GA 2QTZA 4P9SA 5TR9A 3Q3AA 2VJJA 2VYQA 4DQKA 1T6ZA 5HKKA 4FWTA 4II2A 4E0FA 1KC8D 3CPWB 3H94A 4QVAA 1IJEA 1NB9A 1E64A 2WPDA 4OP7A 1QGZA 5HZBA 1YHQB 1S4MA 4LC0A 1WPCA 1XE1A 4XOTA 3CCUB 1WOSA 1E79A 5FO1A 4YHBA 1FX0A 5GV7A 3CCRB 3QFRA 3OZUA 2D9RA 2GK6A 4DNRB 1EWYA 4RPDA 5TRDA 2X6WA 3BC9A 2OYNA 1UD6A 1HA3A 3CCSB 1GJRA 1VHEA 1D1NA 1EFTA 1T6XA 2GJPA 3ZZ0A 4ROXA 3PUMA 1TTTA 4OOVA 1R5OA 1GAQA 2QEXB 3CC7B 1IHMA 2ZZEA 5KW9A 1QFZA 3AVYA 2C4TA 1SKYB 3T53B 3OW2B 2V7XA 1EFRA 4ZV4A 1YIJB 2V7UA 2B7CA 1JA1A 3LQ6A 3PVDA 3R6KA 4UZEA 4YALA 2V7QA 1W9XA 1EFUA 2I1LA 4XMYA 4QV2A 4X7EA 1KQSB 2V31A 4Z4RA 1J9ZA 1VQLB 2ZL6A 2XNCA 3A35A 1OB2A 4MYUA 3P26A 2ZZFA 1FRQA 4DQLA 2CBXA 3OFNA 3W2EA 5F4MA 1HVXA 1QGYA 3T51B 1XFOA 1BPLA 1OGJA 4MYTA 4P26A 1OB0A 2E1RA 1BX1A 4XN0A
chains in the Genus database with same CATH topology
2VBUA 2VBSA 2P3MA 4UZEA 1MRZA 5FO1A 5A89A 2I1LA 3OP1A 1Q9SA 5FNZA 5FO0A 5TRDA 1P4MA 1NB0A 2OYNA 2X0KA 1N08A 2VBTA 3BNWA 2VBVA 4UZFA 1T6ZA 1N05A 5A88A 1T6XA 1N06A 1T6YA 3CTAA 1NB9A 5A8AA 1S4MA 1N07A 3ZUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBU A;  2VBS A;  2P3M A;  4UZE A;  1MRZ A;  5FO1 A;  5A89 A;  2I1L A;  3OP1 A;  1Q9S A;  5FNZ A;  5FO0 A;  5TRD A;  1P4M A;  1NB0 A;  2OYN A;  2X0K A;  1N08 A;  2VBT A;  3BNW A;  2VBV A;  4UZF A;  1T6Z A;  1N05 A;  5A88 A;  1T6X A;  1N06 A;  1T6Y A;  3CTA A;  1NB9 A;  5A8A A;  1S4M A;  1N07 A;  3ZUG A; 
#chains in the Genus database with same CATH topology
 4FN5 A;  1E3Z A;  2QE7 A;  3BY2 A;  3GSI A;  3OW7 A;  4YAF A;  5L46 A;  5H59 A;  3I55 B;  3CXC B;  3R6J A;  4P6V F;  2WZP P;  2WJY A;  1QVF B;  1PJ6 A;  2ZBU A;  3CCE B;  2WJV A;  2QMU A;  3BY1 A;  2WSS A;  4IW3 B;  4B43 A;  3JQR A;  5IYQ A;  4PC1 A;  5KNL A;  3CES A;  4RDK A;  3CCQ B;  2E1B A;  1N08 A;  2RC6 A;  1YX2 A;  3KEW A;  3SLN A;  3CCJ B;  1VQ8 B;  1T6Y A;  3OZW A;  1VF7 A;  4Z4T A;  4OPO A;  2D3L A;  1QVG B;  1K8A D;  1QUF A;  1I8D A;  1YI2 B;  3VNU A;  4B3X A;  1E63 A;  1MAB A;  1U2R A;  2Q6I A;  1F60 A;  3ES9 A;  3CCM B;  4X8I A;  3CP2 A;  4P22 A;  2DCU A;  3W2H A;  4Z4Y A;  2YWH A;  4ZCL A;  1BJK A;  1KK2 A;  1MRZ A;  3CB4 A;  3G71 B;  3B82 A;  3AVT A;  1EP2 B;  3LNN A;  3LVB A;  3Q6R A;  2BV3 A;  2F1M A;  1NB0 A;  1RQP A;  2X6Y A;  3WBK A;  4RLZ A;  5E6T A;  1AMO A;  4P3Y A;  3GVL A;  3ZPN A;  1N05 A;  3DDY A;  2VNI A;  3OZV A;  1DAR A;  4XD7 A;  4AVZ A;  3QE2 A;  4JMQ A;  1GVH A;  4AC9 A;  1S0U A;  1VQ9 B;  3WXM A;  1VQ5 B;  3ZUG A;  3CMA B;  2EFG A;  1EP1 B;  2C5B A;  4XLA A;  4K1X A;  2BN4 A;  2V7W A;  4F7D A;  4Z1M A;  3PA1 A;  3VO1 A;  1WSR A;  2Q6L A;  5J3O A;  3U6K A;  2VNK A;  4RCY A;  1ZUN B;  2OK7 A;  3OE7 A;  1COW A;  1Y0R A;  2CC2 A;  2BGI A;  4TMW A;  3AVW A;  3OKX A;  3OOC A;  2ZIT A;  4X0C A;  4Z4Z A;  1R5B A;  2BSA A;  4LBW A;  5H5J A;  4TKO B;  1WOR A;  4HE6 A;  1QUE A;  1VJS A;  1ZM9 A;  2GK7 A;  2HMA A;  3W5V A;  4X7D A;  2GQF A;  3U6B A;  3CME B;  3Q6Q A;  4EH1 A;  3MHP A;  1KD1 D;  4YEL A;  4RJL A;  4YAW A;  2JDI A;  2X3U A;  4DK1 A;  2PE3 A;  3MMP A;  1G7T A;  1UD5 A;  4YAO A;  2ZTN A;  4AF7 A;  1GAW A;  4NNJ A;  4QFM A;  3VR6 A;  4C43 A;  4Y7C A;  1KK1 A;  1B23 P;  3QFT A;  4PAA A;  3AVU A;  1EXM A;  1UD2 A;  2R6H A;  3WYA A;  3PEN A;  1P4M A;  2VJI A;  1TLL A;  4LBV A;  2ZL5 A;  3NE5 B;  4P3I A;  1W2B B;  4TN1 A;  2VBV A;  1WSV A;  3SLD A;  3CW2 A;  1PKV A;  1TVC A;  2C2W A;  1N06 A;  2GRE A;  2OTL B;  5B6I A;  4WWV A;  3WQZ A;  2DER A;  4KKU A;  4TMT A;  1H8H A;  4XLE A;  4LBY A;  2GJK A;  4PC2 A;  5J35 A;  2JN9 A;  2DEU A;  1KMH A;  1H85 A;  4WZE A;  3OPO A;  2Q6O A;  1BQE A;  1ZM3 A;  1KTV A;  1SM4 A;  2C4U A;  1FNC A;  1JNY A;  1IJF A;  4ZCM A;  4OPS A;  1IB0 A;  3G05 A;  1K28 D;  3ONY A;  4B47 A;  1XQB A;  2X0K A;  3CMM A;  3B8H A;  1UD3 A;  1VQ4 B;  5F4O A;  5A88 A;  2VZL A;  1K73 D;  1UD4 A;  2X8K A;  1UMK A;  3OJX A;  4QHY A;  1QGA A;  2CF4 A;  3BH4 A;  4PC7 A;  4RD6 A;  4UZU A;  1S72 B;  1N0U A;  4YAU A;  2XZL A;  2CW5 A;  1ELO A;  3WND A;  1VLO A;  1OHH A;  3D26 A;  4B48 A;  5LMZ A;  1NBM A;  1VQ6 B;  4NCN A;  4OPV A;  5IYN A;  4QUZ A;  3B78 A;  5FNZ A;  4G7W A;  4X7F A;  3PA2 A;  4FXU A;  4XN3 A;  5FO0 A;  3ASS A;  4DK0 A;  3A3B A;  4Z4S A;  4XON A;  1PJ7 A;  4X07 A;  1T5E A;  4M2L A;  5KSW B;  2F4N A;  3ASP A;  4FK8 A;  4UAJ A;  3JQP A;  2NPF A;  1YJW B;  1Q82 D;  1VQ7 B;  2ZTG A;  2YWF A;  4G6I A;  1DG1 G;  3BQJ A;  3ASR A;  4NBS A;  1FNB A;  4XKV A;  1SKQ A;  3W5H A;  3ZC3 A;  1VQP B;  1E3X A;  2ZZG A;  4U9U A;  4YEJ A;  2KVO A;  4PC3 A;  4LBZ A;  1N8R D;  4XM3 A;  3W2I A;  2P3M A;  1EFC A;  2OBR A;  1I7P A;  5A89 A;  1PJ5 A;  2PIA A;  4RDJ A;  1XB2 A;  4ZGQ B;  1G7R A;  1QH0 A;  2C78 A;  1H42 A;  2JIZ A;  4B3F X;  1KK0 A;  1W0K A;  5FL7 A;  4PAB A;  3GVK A;  3RY8 A;  4XOP A;  3VO2 A;  1EP3 B;  3FPK A;  4II3 A;  2C5H A;  2X85 A;  1VQK B;  2ZZQ A;  4YXW A;  3U2Q A;  4ASU A;  1CQX A;  4PC6 A;  4QVJ A;  2HCJ B;  1DDI A;  1E1R A;  2WYR A;  5FA6 A;  3V76 A;  5THX A;  4TMV A;  4J0Q A;  1DDG A;  3ZBT A;  3W5U A;  3QFC A;  2BF4 A;  5DN6 A;  2HDN B;  2V7T A;  2JJ2 A;  2OTJ B;  3PUN A;  3ZBU A;  2R9V A;  2W6J A;  4RD1 A;  3P27 A;  4G1V A;  3AVV A;  1Q9S A;  1WTH D;  3AGQ A;  1Q81 D;  2BM0 A;  5CDF A;  1VQO B;  2VNH A;  3OEH A;  4P1V A;  3WY9 A;  1B2R A;  1FRN A;  2PLF A;  4M53 A;  1WP6 A;  1G7S A;  1WOP A;  4TMZ A;  3VNV A;  1Y0Y A;  1YLO A;  2VBT A;  5F4J A;  1HZE A;  4RD0 A;  2WZN A;  1JJ2 B;  4N3N A;  1D2E A;  3CRZ A;  1W35 A;  3AST A;  4XKW A;  4XLC A;  2XEX A;  2ZXI A;  3CC4 B;  4G1B A;  3V7A A;  1YJN B;  2X53 S;  2Q6K A;  1V0E A;  2QGG A;  3H9N A;  1Q7Y D;  4N3G A;  4XQF A;  3GVJ A;  3I1F A;  3ONU A;  2CND A;  3OP1 A;  2CK3 A;  3E20 A;  3KL9 A;  4G5G A;  2B5O A;  2V7V A;  2XGJ A;  1WDT A;  4XL9 A;  1W34 A;  3Q39 A;  5EMN A;  3AVX A;  1KJZ A;  2NV4 A;  4XNF A;  1CNF A;  1ZM4 A;  2GJR A;  1G7C A;  1E43 A;  3OEE A;  4XLH A;  2OK8 A;  5FIU A;  2W6I A;  2QTL A;  1H8E A;  3OJW A;  5AN9 A;  3CTA A;  3J81 k;  1YIT B;  1QX4 A;  2VNJ A;  2DY1 A;  1TUI A;  3AGP A;  4HIZ A;  3ZZU A;  4DNT B;  4ACA A;  1FDR A;  1F20 A;  1V0F A;  2QDX A;  2XND A;  1NDH A;  2HLD A;  3A8J A;  2GPJ A;  4RDL A;  3BCD A;  1NRK A;  5HXB A;  2XZP A;  1KZL A;  3QFS A;  5IYP A;  3G6E B;  3A1P A;  4TSF A;  4GQN A;  4P12 A;  2RC5 A;  4M1K A;  4RD4 A;  3FKS A;  3CPX A;  5BSX A;  5IYW A;  2QA4 B;  1OGI A;  5HZA A;  2BPO A;  3BNW A;  4B3G A;  1VLY A;  3GIR A;  3GQB A;  1A8P A;  4Y9R A;  2J7K A;  4PGO A;  2BVN A;  5TY0 A;  5IYR A;  3SEJ A;  2EIX A;  4B44 A;  1ZM2 A;  1CNE A;  4WQM A;  1W0J A;  4RD2 A;  3CCV B;  4M4S A;  1R5N A;  4OOS A;  4AF6 A;  3I56 B;  4HE5 A;  4TMX A;  2B7B A;  2D74 A;  1OB5 A;  1FND A;  3VMF A;  1WOO A;  1YJ9 B;  5IK2 A;  1N0V C;  3E1Y E;  3ASQ A;  3SKB A;  2BGJ A;  1AIP A;  5DSZ A;  3SJZ A;  1KRH A;  2FX3 A;  2OBS A;  2X6X A;  2DOG A;  2DET A;  3HAG A;  2JJ1 A;  3LQE A;  3A8I A;  4KKS A;  3FPP A;  1QFY A;  3CP8 A;  1RQR A;  2ZXH A;  1VQM B;  4RCZ A;  3CC2 B;  4P2N A;  1VHO A;  4XOR A;  1E62 A;  4ZCI A;  1Q86 D;  4CQJ A;  5DS0 A;  2VBU A;  4M0L A;  4WZL A;  4RD3 A;  4XR6 A;  3SJP A;  2BM1 A;  1M90 D;  2XZO A;  1WU8 A;  3JU4 A;  1GR1 A;  1BMF A;  3LO8 A;  3FJO A;  1I18 A;  4X06 A;  1W87 A;  3W2F A;  2D3N A;  3A3G A;  2BMW A;  4C0S A;  4X05 A;  1QG0 A;  4Z4V A;  4UZF A;  2YWE A;  1JA0 A;  3CCL B;  1BLI A;  4Q7J B;  2C77 A;  4XLF A;  4TT3 A;  5GV8 A;  4ZGN B;  2Z6B D;  5JBQ A;  4ACB A;  2XOK A;  1N07 A;  4G7X A;  4P6Y A;  1V5V A;  2LZJ A;  2PMD A;  4KKT A;  3WNC A;  4BPR A;  4P25 A;  2M5S A;  2F43 A;  2VBS A;  2QN6 A;  4Y9U A;  3OAA A;  1VQN B;  3ISX A;  4RM0 A;  2DYI A;  4WZT A;  1JB9 A;  3QSY A;  2DIE A;  3CD6 B;  2FVG A;  2AHO A;  4RPB A;  2OBT A;  5TV2 A;  3WBJ A;  2V4D A;  3A8K A;  4Z4W A;  1FNM A;  3ZZT A;  1UD8 A;  2F1L A;  3WNB A;  4B4D A;  5A8A A;  3BCF A;  1KK3 A;  2CRV A;  1QFJ A;  2ZL7 A;  2WR8 A;  3JQQ A;  1E1Q A;  4L8J A;  1BX0 A;  2XNJ A;  1M1K D;  1GO2 A;  3T56 B;  4R71 A;  3Q38 A;  3MCA A;  1NJI D;  1D8T A;  3G4S B;  1K9M D;  2ZBV A;  4OOX A;  4WZK A;  5BSY A;  4Z4U A;  3W2G A;  2YWG A;  4X7C A;  3ZIA A;  4H9G A;  2QTZ A;  4P9S A;  5TR9 A;  3Q3A A;  2VJJ A;  2VYQ A;  4DQK A;  1T6Z A;  5HKK A;  4FWT A;  4II2 A;  4E0F A;  1KC8 D;  3CPW B;  3H94 A;  4QVA A;  1IJE A;  1NB9 A;  1E64 A;  2WPD A;  4OP7 A;  1QGZ A;  5HZB A;  1YHQ B;  1S4M A;  4LC0 A;  1WPC A;  1XE1 A;  4XOT A;  3CCU B;  1WOS A;  1E79 A;  5FO1 A;  4YHB A;  1FX0 A;  5GV7 A;  3CCR B;  3QFR A;  3OZU A;  2D9R A;  2GK6 A;  4DNR B;  1EWY A;  4RPD A;  5TRD A;  2X6W A;  3BC9 A;  2OYN A;  1UD6 A;  1HA3 A;  3CCS B;  1GJR A;  1VHE A;  1D1N A;  1EFT A;  1T6X A;  2GJP A;  3ZZ0 A;  4ROX A;  3PUM A;  1TTT A;  4OOV A;  1R5O A;  1GAQ A;  2QEX B;  3CC7 B;  1IHM A;  2ZZE A;  5KW9 A;  1QFZ A;  3AVY A;  2C4T A;  1SKY B;  3T53 B;  3OW2 B;  2V7X A;  1EFR A;  4ZV4 A;  1YIJ B;  2V7U A;  2B7C A;  1JA1 A;  3LQ6 A;  3PVD A;  3R6K A;  4UZE A;  4YAL A;  2V7Q A;  1W9X A;  1EFU A;  2I1L A;  4XMY A;  4QV2 A;  4X7E A;  1KQS B;  2V31 A;  4Z4R A;  1J9Z A;  1VQL B;  2ZL6 A;  2XNC A;  3A35 A;  1OB2 A;  4MYU A;  3P26 A;  2ZZF A;  1FRQ A;  4DQL A;  2CBX A;  3OFN A;  3W2E A;  5F4M A;  1HVX A;  1QGY A;  3T51 B;  1XFO A;  1BPL A;  1OGJ A;  4MYT A;  4P26 A;  1OB0 A;  2E1R A;  1BX1 A;  4XN0 A; 
#chains in the Genus database with same CATH homology
 2VBU A;  2VBS A;  2P3M A;  4UZE A;  1MRZ A;  5FO1 A;  5A89 A;  2I1L A;  3OP1 A;  1Q9S A;  5FNZ A;  5FO0 A;  5TRD A;  1P4M A;  1NB0 A;  2OYN A;  2X0K A;  1N08 A;  2VBT A;  3BNW A;  2VBV A;  4UZF A;  1T6Z A;  1N05 A;  5A88 A;  1T6X A;  1N06 A;  1T6Y A;  3CTA A;  1NB9 A;  5A8A A;  1S4M A;  1N07 A;  3ZUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...