2OYNA

Crystal structure of cdp-bound protein mj0056 from methanococcus jannaschii, pfam duf120
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
137
structure length
137
Chain Sequence
SLVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein from Methanococcus jannaschii bound to CDP
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MJ0056
total genus 25
structure length 137
sequence length 137
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2oynA01
2I1LA 1T6XA 2VBTA 3OP1A 2VBVA 1N07A 5A89A 4UZFA 1Q9SA 5FNZA 2OYNA 1NB9A 1T6YA 1S4MA 1N08A 5FO0A 5FO1A 5A8AA 3CTAA 1P4MA 2P3MA 2X0KA 5A88A 5TRDA 4UZEA 2VBUA 1NB0A 1T6ZA 1N06A 1N05A 3ZUGA 3BNWA 2VBSA 1MRZA
chains in the Genus database with same CATH superfamily
4B3FX 2C77A 2VNKA 2EIXA 2PE3A 3FKSA 3I1FA 5F4MA 4E0FA 2ZXIA 5FNZA 2BVNA 4PGOA 1YHQB 3CCVB 4XNFA 4B4DA 1K9MD 1XFOA 1AIPA 3WBKA 2WJVA 3OOCA 1VQMB 1TTTA 4ZGNB 1QG0A 1OGIA 3CTAA 2GJKA 1VQ8B 4Z4WA 4G5GA 5TRDA 1A8PA 1FNBA 2GPJA 1TLLA 3AVUA 3ZBUA 3Q39A 5HXBA 3QSYA 2PIAA 2X8KA 4WZLA 4PC3A 1T5EA 3CC4B 1WU8A 2W6JA 4C43A 2C2WA 1GR1A 3CCRB 1N07A 2Q6LA 3CCQB 3CB4A 1RQRA 3OZWA 3NE5B 5IYRA 4U9UA 4M4SA 4C0SA 1WP6A 3CCEB 2XNJA 4LBZA 2BPOA 4NCNA 5THXA 1D8TA 1AMOA 2VNHA 3ZPNA 1QFYA 4FK8A 4DNRB 2BGJA 3LNNA 2X0KA 4PC7A 1W87A 1E3XA 4K1XA 4X07A 4TMXA 3W2EA 3KEWA 1TUIA 2XGJA 1EFCA 1OGJA 1IB0A 1DDGA 4P26A 1QUFA 3WNBA 1K73D 1PJ7A 2Z6BD 1DDIA 1I18A 1E1QA 1PJ5A 2VBSA 2ZBUA 1T6XA 2GK7A 1N0UA 3T56B 2D9RA 3CMEB 4Z4ZA 3GVLA 4LBWA 1R5OA 4DK1A 2C5BA 2DCUA 4II2A 4EH1A 2GJPA 5TR9A 1KK0A 2QMUA 1KD1D 3WQZA 4B47A 3U2QA 4Y7CA 2W6IA 3CC2B 4II3A 3D26A 4P12A 2WZPP 2AHOA 2QTZA 1I8DA 3ONUA 1VQOB 1Q86D 1EXMA 2C4UA 5GV7A 1Q7YD 2X6WA 3AVWA 4DNTB 4OPVA 2OTJB 2VYQA 1UD4A 4XR6A 3WNCA 2BN4A 3AVXA 4ASUA 3V76A 4OOXA 1V0EA 3ONYA 2V7UA 1JNYA 1G7RA 4LBYA 1OB5A 4QVJA 3J81k 4QUZA 3CMMA 3U6KA 3JQRA 4LBVA 1R5BA 4RD4A 4X0CA 3WNDA 5IYNA 1VHEA 2V4DA 4G7XA 1P4MA 5H5JA 4B44A 4ZGQB 1YJ9B 1GO2A 1N0VC 3PA2A 4WZEA 4Z4RA 2Q6KA 3VNVA 1NRKA 3DDYA 4JMQA 1W2BB 1FDRA 2QTLA 1G7CA 4QFMA 4WQMA 4TMTA 1KQSB 5HZAA 3OEHA 4UAJA 1YLOA 2OTLB 2CRVA 1D2EA 5GV8A 4OOVA 2V7VA 2CW5A 4RJLA 4PABA 5KSWB 4R71A 3A1PA 4X7DA 3AVTA 1ZM2A 3H94A 3BY1A 2XZPA 3OPOA 2D74A 5H59A 2F4NA 2VJIA 4NNJA 4XM3A 4TSFA 3CPWB 2GQFA 2QDXA 3W5UA 3HAGA 1WDTA 1VJSA 4HE6A 3WBJA 1GAQA 3G05A 3CCUB 2QN6A 1YJWB 2OK7A 3SJPA 1QFJA 2VBTA 4PAAA 1V0FA 4B3XA 3I56B 4AF6A 1B23P 2R6HA 2FX3A 3ASSA 4UZFA 1FNDA 1E64A 2C4TA 1QGAA 4RD0A 5FA6A 3Q6RA 4Z4YA 4M1KA 4YAWA 5FO1A 3W2GA 1SM4A 4YEJA 2PMDA 4X8IA 4N3GA 2X85A 3B82A 1K8AD 3CXCB 3QFRA 4G1VA 1M90D 3BY2A 2JJ2A 2HMAA 4XLHA 1XB2A 1BX1A 3CCMB 4KKSA 3B78A 4BPRA 1F60A 3OKXA 5F4JA 2C78A 4P2NA 5HKKA 5IYPA 2XNDA 2ZITA 4B48A 1VQ9B 1EP2B 2V7WA 2DIEA 4XMYA 2QEXB 4KKTA 4XN3A 4MYUA 3CP2A 1QVGB 1JA0A 1H85A 4RPDA 1H8HA 3OFNA 2ZBVA 4UZEA 1MABA 3MMPA 1KK2A 3QFTA 3PUNA 1OB2A 2CBXA 1E63A 2YWFA 2CNDA 1UD8A 1Y0YA 1YX2A 2NV4A 1VQ6B 2GREA 1BPLA 1N06A 1FRQA 1FNMA 5DN6A 5DSZA 4Z4TA 2BMWA 4J0QA 3CD6B 1NBMA 3B8HA 1ZM3A 3W5HA 2VJJA 4TN1A 2WJYA 2ZZQA 4FN5A 1KMHA 2ZL6A 2YWHA 2BGIA 4XLAA 4ZCIA 1YIJB 4OOSA 5EMNA 2DYIA 3SLDA 4AVZA 5HZBA 1N8RD 3WY9A 1QH0A 4YAOA 4P25A 1WTHD 2F1LA 2XOKA 1W0KA 3W2FA 1QUEA 3A8KA 4TMWA 1H8EA 1NB0A 4AC9A 3OZVA 4Y9UA 3T51B 3BNWA 5FIUA 1KK1A 4F7DA 4RDKA 1KK3A 1QVFB 2X6YA 2V31A 3JQPA 4NBSA 2QA4B 3I55B 4X7FA 2B5OA 1EFRA 2WR8A 2OYNA 3E20A 3GVKA 1VF7A 2OBTA 1COWA 2OK8A 5A8AA 4XLFA 1W35A 4DQKA 4Z4VA 1I7PA 1BQEA 5LMZA 5IYWA 1D1NA 1BJKA 1EP1B 2CF4A 2R9VA 2X6XA 4QV2A 3A8IA 3W2IA 5A88A 5FL7A 3OAAA 4P9SA 1G7SA 1VLYA 3LVBA 3R6JA 2HLDA 3CRZA 1QFZA 2B7CA 3A3GA 3SEJA 3OW7A 4TT3A 4XLCA 4XLEA 1VQPB 1GAWA 3WXMA 1ELOA 1RQPA 4DQLA 1Q9SA 2XEXA 4PC1A 3AVVA 4HE5A 1BX0A 2E1RA 4HIZA 1EFUA 4OPOA 2EFGA 1Q81D 4P3YA 1NJID 3PUMA 4WZTA 4X7CA 2DEUA 4N3NA 3BH4A 2BV3A 2BM0A 4RD1A 4RDLA 1Q82D 1E3ZA 4RD2A 2ZZFA 3ZZTA 1PJ6A 3OJXA 3PENA 2E1BA 2JN9A 3ASPA 2Q6OA 3LQEA 2D3NA 4Z1MA 3ASRA 3SJZA 1DG1G 3G6EB 5A89A 1JA1A 1E43A 1SKQA 1EP3B 2WPDA 2CC2A 4DK0A 4B3GA 1WORA 3BCFA 2F1MA 2KVOA 1ZM9A 1XQBA 5DS0A 2X3UA 3AGQA 2ZL7A 1OHHA 3ASTA 1WPCA 3SLNA 3CW2A 4XN0A 4H9GA 2HCJB 4ACAA 4YXWA 4TMZA 4FXUA 1HA3A 3VR6A 1F20A 4KKUA 4YAUA 3W2HA 4XD7A 2XNCA 3P26A 3BC9A 2WZNA 3GVJA 5B6IA 2CK3A 3R6KA 4ZCLA 4YAFA 4TMVA 3ISXA 4P6VF 3ZUGA 5E6TA 1EWYA 1MRZA 3MCAA 4ROXA 4X7EA 4B43A 2QE7A 1KTVA 1UD3A 2WYRA 1UD2A 3FJOA 1CNEA 4M53A 5KNLA 1E62A 1NB9A 3PA1A 5J3OA 1S4MA 2OBSA 3P27A 4OPSA 5J35A 5FO0A 5BSXA 3ZBTA 1K28D 3JU4A 2ZZEA 3JQQA 1S0UA 2P3MA 4RLZA 4RD3A 4M0LA 4G7WA 2ZZGA 1B2RA 5KW9A 1HZEA 4RD6A 1DARA 3AGPA 3OJWA 2DETA 1WSRA 3A35A 2I1LA 2XZOA 4Z4SA 1EFTA 1YJNB 1S72B 3LO8A 3V7AA 4UZUA 1U2RA 3QFSA 4G1BA 3CESA 5AN9A 1IHMA 4FWTA 1N08A 4Q7JB 1FNCA 1WOPA 3G71B 1CNFA 1QX4A 2B7BA 2YWGA 2JDIA 5F4OA 1E79A 1JB9A 2RC5A 2VBUA 5IK2A 3WYAA 4RCYA 3CCLB 1VQNB 3GQBA 1G7TA 3PVDA 3CCSB 1UD6A 1CQXA 2D3LA 1KRHA 4P1VA 3ZZ0A 5TY0A 2DOGA 1BLIA 2ZTGA 2ZL5A 3KL9A 3OP1A 1UD5A 1VQLB 1VHOA 1QGYA 1ZUNB 2HDNB 3ZZUA 1XE1A 1R5NA 5CDFA 4G6IA 4RPBA 4XONA 1IJFA 3OW2B 1M1KD 3CC7B 2LZJA 3H9NA 2F43A 2YWEA 1OB0A 4M2LA 1Y0RA 4MYTA 1V5VA 2DY1A 4YHBA 4TKOB 3LQ6A 3U6BA 3ASQA 3VNUA 1J9ZA 2Q6IA 2VZLA 4XORA 4IW3B 2JJ1A 4WZKA 3VMFA 4XOPA 4RCZA 4P22A 2VNIA 1VLOA 2X53S 1T6ZA 1WOSA 4YALA 3QFCA 2BM1A 4L8JA 4XQFA 3OZUA 3G4SB 4X06A 1VQ7B 1N05A 1FRNA 3E1YE 3GSIA 3Q38A 1TVCA 4PC2A 1VQ4B 1W34A 1VQKB 4ZCMA 1SKYB 1YITB 2FVGA 2GK6A 3VO2A 1W9XA 1T6YA 3CMAB 4RDJA 4AF7A 1GVHA 3ES9A 2VNJA 2JIZA 3OE7A 3QE2A 4RM0A 1KZLA 2RC6A 3BCDA 2M5SA 3Q6QA 2GJRA 1JJ2B 3SKBA 4XKWA 4QVAA 3GIRA 1WSVA 3VO1A 3T53B 1IJEA 3ZC3A 1E1RA 1YI2B 3CP8A 3OEEA 4P6YA 5L46A 5TV2A 2C5HA 5JBQA 2PLFA 2V7QA 4P3IA 1H42A 3MHPA 2OBRA 2VBVA 4WWVA 4LC0A 3FPKA 2V7XA 1KJZA 3AVYA 2BF4A 3A8JA 1VQ5B 4X05A 4PC6A 4XOTA 1WOOA 3Q3AA 1HVXA 2ZTNA 5IYQA 5BSYA 3BQJA 1QGZA 2NPFA 4Z4UA 1GJRA 1BMFA 1PKVA 2J7KA 4YELA 3CCJB 4QHYA 2V7TA 3W5VA 1ZM4A 2BSAA 4ACBA 3ZIAA 2ZXHA 3FPPA 4XL9A 2WSSA 1UMKA 4OP7A 2QGGA 3CPXA 3RY8A 4ZV4A 2DERA 4XKVA 1NDHA 1FX0A 4GQNA 4Y9RA 2XZLA 4CQJA 3A3BA 1KC8D 1W0JA
chains in the Genus database with same CATH topology
2I1LA 1T6XA 2VBTA 3OP1A 2VBVA 1N07A 5A89A 4UZFA 1Q9SA 5FNZA 2OYNA 1NB9A 1T6YA 1S4MA 1N08A 5FO0A 5FO1A 5A8AA 3CTAA 1P4MA 2P3MA 2X0KA 5A88A 5TRDA 4UZEA 2VBUA 1NB0A 1T6ZA 1N06A 1N05A 3ZUGA 3BNWA 2VBSA 1MRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1L A;  1T6X A;  2VBT A;  3OP1 A;  2VBV A;  1N07 A;  5A89 A;  4UZF A;  1Q9S A;  5FNZ A;  2OYN A;  1NB9 A;  1T6Y A;  1S4M A;  1N08 A;  5FO0 A;  5FO1 A;  5A8A A;  3CTA A;  1P4M A;  2P3M A;  2X0K A;  5A88 A;  5TRD A;  4UZE A;  2VBU A;  1NB0 A;  1T6Z A;  1N06 A;  1N05 A;  3ZUG A;  3BNW A;  2VBS A;  1MRZ A; 
#chains in the Genus database with same CATH topology
 4B3F X;  2C77 A;  2VNK A;  2EIX A;  2PE3 A;  3FKS A;  3I1F A;  5F4M A;  4E0F A;  2ZXI A;  5FNZ A;  2BVN A;  4PGO A;  1YHQ B;  3CCV B;  4XNF A;  4B4D A;  1K9M D;  1XFO A;  1AIP A;  3WBK A;  2WJV A;  3OOC A;  1VQM B;  1TTT A;  4ZGN B;  1QG0 A;  1OGI A;  3CTA A;  2GJK A;  1VQ8 B;  4Z4W A;  4G5G A;  5TRD A;  1A8P A;  1FNB A;  2GPJ A;  1TLL A;  3AVU A;  3ZBU A;  3Q39 A;  5HXB A;  3QSY A;  2PIA A;  2X8K A;  4WZL A;  4PC3 A;  1T5E A;  3CC4 B;  1WU8 A;  2W6J A;  4C43 A;  2C2W A;  1GR1 A;  3CCR B;  1N07 A;  2Q6L A;  3CCQ B;  3CB4 A;  1RQR A;  3OZW A;  3NE5 B;  5IYR A;  4U9U A;  4M4S A;  4C0S A;  1WP6 A;  3CCE B;  2XNJ A;  4LBZ A;  2BPO A;  4NCN A;  5THX A;  1D8T A;  1AMO A;  2VNH A;  3ZPN A;  1QFY A;  4FK8 A;  4DNR B;  2BGJ A;  3LNN A;  2X0K A;  4PC7 A;  1W87 A;  1E3X A;  4K1X A;  4X07 A;  4TMX A;  3W2E A;  3KEW A;  1TUI A;  2XGJ A;  1EFC A;  1OGJ A;  1IB0 A;  1DDG A;  4P26 A;  1QUF A;  3WNB A;  1K73 D;  1PJ7 A;  2Z6B D;  1DDI A;  1I18 A;  1E1Q A;  1PJ5 A;  2VBS A;  2ZBU A;  1T6X A;  2GK7 A;  1N0U A;  3T56 B;  2D9R A;  3CME B;  4Z4Z A;  3GVL A;  4LBW A;  1R5O A;  4DK1 A;  2C5B A;  2DCU A;  4II2 A;  4EH1 A;  2GJP A;  5TR9 A;  1KK0 A;  2QMU A;  1KD1 D;  3WQZ A;  4B47 A;  3U2Q A;  4Y7C A;  2W6I A;  3CC2 B;  4II3 A;  3D26 A;  4P12 A;  2WZP P;  2AHO A;  2QTZ A;  1I8D A;  3ONU A;  1VQO B;  1Q86 D;  1EXM A;  2C4U A;  5GV7 A;  1Q7Y D;  2X6W A;  3AVW A;  4DNT B;  4OPV A;  2OTJ B;  2VYQ A;  1UD4 A;  4XR6 A;  3WNC A;  2BN4 A;  3AVX A;  4ASU A;  3V76 A;  4OOX A;  1V0E A;  3ONY A;  2V7U A;  1JNY A;  1G7R A;  4LBY A;  1OB5 A;  4QVJ A;  3J81 k;  4QUZ A;  3CMM A;  3U6K A;  3JQR A;  4LBV A;  1R5B A;  4RD4 A;  4X0C A;  3WND A;  5IYN A;  1VHE A;  2V4D A;  4G7X A;  1P4M A;  5H5J A;  4B44 A;  4ZGQ B;  1YJ9 B;  1GO2 A;  1N0V C;  3PA2 A;  4WZE A;  4Z4R A;  2Q6K A;  3VNV A;  1NRK A;  3DDY A;  4JMQ A;  1W2B B;  1FDR A;  2QTL A;  1G7C A;  4QFM A;  4WQM A;  4TMT A;  1KQS B;  5HZA A;  3OEH A;  4UAJ A;  1YLO A;  2OTL B;  2CRV A;  1D2E A;  5GV8 A;  4OOV A;  2V7V A;  2CW5 A;  4RJL A;  4PAB A;  5KSW B;  4R71 A;  3A1P A;  4X7D A;  3AVT A;  1ZM2 A;  3H94 A;  3BY1 A;  2XZP A;  3OPO A;  2D74 A;  5H59 A;  2F4N A;  2VJI A;  4NNJ A;  4XM3 A;  4TSF A;  3CPW B;  2GQF A;  2QDX A;  3W5U A;  3HAG A;  1WDT A;  1VJS A;  4HE6 A;  3WBJ A;  1GAQ A;  3G05 A;  3CCU B;  2QN6 A;  1YJW B;  2OK7 A;  3SJP A;  1QFJ A;  2VBT A;  4PAA A;  1V0F A;  4B3X A;  3I56 B;  4AF6 A;  1B23 P;  2R6H A;  2FX3 A;  3ASS A;  4UZF A;  1FND A;  1E64 A;  2C4T A;  1QGA A;  4RD0 A;  5FA6 A;  3Q6R A;  4Z4Y A;  4M1K A;  4YAW A;  5FO1 A;  3W2G A;  1SM4 A;  4YEJ A;  2PMD A;  4X8I A;  4N3G A;  2X85 A;  3B82 A;  1K8A D;  3CXC B;  3QFR A;  4G1V A;  1M90 D;  3BY2 A;  2JJ2 A;  2HMA A;  4XLH A;  1XB2 A;  1BX1 A;  3CCM B;  4KKS A;  3B78 A;  4BPR A;  1F60 A;  3OKX A;  5F4J A;  2C78 A;  4P2N A;  5HKK A;  5IYP A;  2XND A;  2ZIT A;  4B48 A;  1VQ9 B;  1EP2 B;  2V7W A;  2DIE A;  4XMY A;  2QEX B;  4KKT A;  4XN3 A;  4MYU A;  3CP2 A;  1QVG B;  1JA0 A;  1H85 A;  4RPD A;  1H8H A;  3OFN A;  2ZBV A;  4UZE A;  1MAB A;  3MMP A;  1KK2 A;  3QFT A;  3PUN A;  1OB2 A;  2CBX A;  1E63 A;  2YWF A;  2CND A;  1UD8 A;  1Y0Y A;  1YX2 A;  2NV4 A;  1VQ6 B;  2GRE A;  1BPL A;  1N06 A;  1FRQ A;  1FNM A;  5DN6 A;  5DSZ A;  4Z4T A;  2BMW A;  4J0Q A;  3CD6 B;  1NBM A;  3B8H A;  1ZM3 A;  3W5H A;  2VJJ A;  4TN1 A;  2WJY A;  2ZZQ A;  4FN5 A;  1KMH A;  2ZL6 A;  2YWH A;  2BGI A;  4XLA A;  4ZCI A;  1YIJ B;  4OOS A;  5EMN A;  2DYI A;  3SLD A;  4AVZ A;  5HZB A;  1N8R D;  3WY9 A;  1QH0 A;  4YAO A;  4P25 A;  1WTH D;  2F1L A;  2XOK A;  1W0K A;  3W2F A;  1QUE A;  3A8K A;  4TMW A;  1H8E A;  1NB0 A;  4AC9 A;  3OZV A;  4Y9U A;  3T51 B;  3BNW A;  5FIU A;  1KK1 A;  4F7D A;  4RDK A;  1KK3 A;  1QVF B;  2X6Y A;  2V31 A;  3JQP A;  4NBS A;  2QA4 B;  3I55 B;  4X7F A;  2B5O A;  1EFR A;  2WR8 A;  2OYN A;  3E20 A;  3GVK A;  1VF7 A;  2OBT A;  1COW A;  2OK8 A;  5A8A A;  4XLF A;  1W35 A;  4DQK A;  4Z4V A;  1I7P A;  1BQE A;  5LMZ A;  5IYW A;  1D1N A;  1BJK A;  1EP1 B;  2CF4 A;  2R9V A;  2X6X A;  4QV2 A;  3A8I A;  3W2I A;  5A88 A;  5FL7 A;  3OAA A;  4P9S A;  1G7S A;  1VLY A;  3LVB A;  3R6J A;  2HLD A;  3CRZ A;  1QFZ A;  2B7C A;  3A3G A;  3SEJ A;  3OW7 A;  4TT3 A;  4XLC A;  4XLE A;  1VQP B;  1GAW A;  3WXM A;  1ELO A;  1RQP A;  4DQL A;  1Q9S A;  2XEX A;  4PC1 A;  3AVV A;  4HE5 A;  1BX0 A;  2E1R A;  4HIZ A;  1EFU A;  4OPO A;  2EFG A;  1Q81 D;  4P3Y A;  1NJI D;  3PUM A;  4WZT A;  4X7C A;  2DEU A;  4N3N A;  3BH4 A;  2BV3 A;  2BM0 A;  4RD1 A;  4RDL A;  1Q82 D;  1E3Z A;  4RD2 A;  2ZZF A;  3ZZT A;  1PJ6 A;  3OJX A;  3PEN A;  2E1B A;  2JN9 A;  3ASP A;  2Q6O A;  3LQE A;  2D3N A;  4Z1M A;  3ASR A;  3SJZ A;  1DG1 G;  3G6E B;  5A89 A;  1JA1 A;  1E43 A;  1SKQ A;  1EP3 B;  2WPD A;  2CC2 A;  4DK0 A;  4B3G A;  1WOR A;  3BCF A;  2F1M A;  2KVO A;  1ZM9 A;  1XQB A;  5DS0 A;  2X3U A;  3AGQ A;  2ZL7 A;  1OHH A;  3AST A;  1WPC A;  3SLN A;  3CW2 A;  4XN0 A;  4H9G A;  2HCJ B;  4ACA A;  4YXW A;  4TMZ A;  4FXU A;  1HA3 A;  3VR6 A;  1F20 A;  4KKU A;  4YAU A;  3W2H A;  4XD7 A;  2XNC A;  3P26 A;  3BC9 A;  2WZN A;  3GVJ A;  5B6I A;  2CK3 A;  3R6K A;  4ZCL A;  4YAF A;  4TMV A;  3ISX A;  4P6V F;  3ZUG A;  5E6T A;  1EWY A;  1MRZ A;  3MCA A;  4ROX A;  4X7E A;  4B43 A;  2QE7 A;  1KTV A;  1UD3 A;  2WYR A;  1UD2 A;  3FJO A;  1CNE A;  4M53 A;  5KNL A;  1E62 A;  1NB9 A;  3PA1 A;  5J3O A;  1S4M A;  2OBS A;  3P27 A;  4OPS A;  5J35 A;  5FO0 A;  5BSX A;  3ZBT A;  1K28 D;  3JU4 A;  2ZZE A;  3JQQ A;  1S0U A;  2P3M A;  4RLZ A;  4RD3 A;  4M0L A;  4G7W A;  2ZZG A;  1B2R A;  5KW9 A;  1HZE A;  4RD6 A;  1DAR A;  3AGP A;  3OJW A;  2DET A;  1WSR A;  3A35 A;  2I1L A;  2XZO A;  4Z4S A;  1EFT A;  1YJN B;  1S72 B;  3LO8 A;  3V7A A;  4UZU A;  1U2R A;  3QFS A;  4G1B A;  3CES A;  5AN9 A;  1IHM A;  4FWT A;  1N08 A;  4Q7J B;  1FNC A;  1WOP A;  3G71 B;  1CNF A;  1QX4 A;  2B7B A;  2YWG A;  2JDI A;  5F4O A;  1E79 A;  1JB9 A;  2RC5 A;  2VBU A;  5IK2 A;  3WYA A;  4RCY A;  3CCL B;  1VQN B;  3GQB A;  1G7T A;  3PVD A;  3CCS B;  1UD6 A;  1CQX A;  2D3L A;  1KRH A;  4P1V A;  3ZZ0 A;  5TY0 A;  2DOG A;  1BLI A;  2ZTG A;  2ZL5 A;  3KL9 A;  3OP1 A;  1UD5 A;  1VQL B;  1VHO A;  1QGY A;  1ZUN B;  2HDN B;  3ZZU A;  1XE1 A;  1R5N A;  5CDF A;  4G6I A;  4RPB A;  4XON A;  1IJF A;  3OW2 B;  1M1K D;  3CC7 B;  2LZJ A;  3H9N A;  2F43 A;  2YWE A;  1OB0 A;  4M2L A;  1Y0R A;  4MYT A;  1V5V A;  2DY1 A;  4YHB A;  4TKO B;  3LQ6 A;  3U6B A;  3ASQ A;  3VNU A;  1J9Z A;  2Q6I A;  2VZL A;  4XOR A;  4IW3 B;  2JJ1 A;  4WZK A;  3VMF A;  4XOP A;  4RCZ A;  4P22 A;  2VNI A;  1VLO A;  2X53 S;  1T6Z A;  1WOS A;  4YAL A;  3QFC A;  2BM1 A;  4L8J A;  4XQF A;  3OZU A;  3G4S B;  4X06 A;  1VQ7 B;  1N05 A;  1FRN A;  3E1Y E;  3GSI A;  3Q38 A;  1TVC A;  4PC2 A;  1VQ4 B;  1W34 A;  1VQK B;  4ZCM A;  1SKY B;  1YIT B;  2FVG A;  2GK6 A;  3VO2 A;  1W9X A;  1T6Y A;  3CMA B;  4RDJ A;  4AF7 A;  1GVH A;  3ES9 A;  2VNJ A;  2JIZ A;  3OE7 A;  3QE2 A;  4RM0 A;  1KZL A;  2RC6 A;  3BCD A;  2M5S A;  3Q6Q A;  2GJR A;  1JJ2 B;  3SKB A;  4XKW A;  4QVA A;  3GIR A;  1WSV A;  3VO1 A;  3T53 B;  1IJE A;  3ZC3 A;  1E1R A;  1YI2 B;  3CP8 A;  3OEE A;  4P6Y A;  5L46 A;  5TV2 A;  2C5H A;  5JBQ A;  2PLF A;  2V7Q A;  4P3I A;  1H42 A;  3MHP A;  2OBR A;  2VBV A;  4WWV A;  4LC0 A;  3FPK A;  2V7X A;  1KJZ A;  3AVY A;  2BF4 A;  3A8J A;  1VQ5 B;  4X05 A;  4PC6 A;  4XOT A;  1WOO A;  3Q3A A;  1HVX A;  2ZTN A;  5IYQ A;  5BSY A;  3BQJ A;  1QGZ A;  2NPF A;  4Z4U A;  1GJR A;  1BMF A;  1PKV A;  2J7K A;  4YEL A;  3CCJ B;  4QHY A;  2V7T A;  3W5V A;  1ZM4 A;  2BSA A;  4ACB A;  3ZIA A;  2ZXH A;  3FPP A;  4XL9 A;  2WSS A;  1UMK A;  4OP7 A;  2QGG A;  3CPX A;  3RY8 A;  4ZV4 A;  2DER A;  4XKV A;  1NDH A;  1FX0 A;  4GQN A;  4Y9R A;  2XZL A;  4CQJ A;  3A3B A;  1KC8 D;  1W0J A; 
#chains in the Genus database with same CATH homology
 2I1L A;  1T6X A;  2VBT A;  3OP1 A;  2VBV A;  1N07 A;  5A89 A;  4UZF A;  1Q9S A;  5FNZ A;  2OYN A;  1NB9 A;  1T6Y A;  1S4M A;  1N08 A;  5FO0 A;  5FO1 A;  5A8A A;  3CTA A;  1P4M A;  2P3M A;  2X0K A;  5A88 A;  5TRD A;  4UZE A;  2VBU A;  1NB0 A;  1T6Z A;  1N06 A;  1N05 A;  3ZUG A;  3BNW A;  2VBS A;  1MRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...