2V7TA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosyl-l-homocysteine and chloride ion
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7tA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7tA01
2CBXA 2V7XA 2ZBUA 2C4TA 2V7UA 2C5BA 2WR8A 2CW5A 5LMZA 1RQRA 2ZBVA 2V7WA 2F4NA 2Q6KA 2V7TA 2Q6LA 1RQPA 2CC2A 2V7VA 2Q6IA 2C2WA 5B6IA 1WU8A 2C5HA 2C4UA 2Q6OA 4CQJA 5FIUA
chains in the Genus database with same CATH superfamily
4GYJA 4JBLA 2X85A 1U8XX 2DERA 1TQ4A 2RBGA 5HGJA 1ZIOA 2M2IA 5B7NA 5FH9A 4W5QA 4BVHA 1CNEA 1LY1A 1XP5A 3P2IA 4UAVA 3NTXA 4YB8A 4DLPA 3FPPA 4HQFA 4ZQGA 2A0YA 4U9HS 5KNLA 2YUTA 4U7WA 3BRWD 3RLFA 1KJYA 2JIPA 3CN7A 1VQ4B 3IAHA 4XQEA 5ALNA 5LMUB 4R6WA 1T9BA 3LY9A 4Q3KA 4Y1FA 4X9XA 4ZV4A 4LKRA 4KZKA 3OPYB 5C9ZA 5F7JA 5DM2A 3A3YA 3GMTA 3F5SA 5HDQA 4WNCA 2VUHB 2ZRNA 4N54A 5ARCA 3WJ7A 4BGIA 3WFJA 1QHIA 1XAGA 4G5HA 2FWBA 2OY0A 3EGOA 1YVPA 2B37A 3HADA 3QX9A 4R01A 4LJSA 3LTEA 1P9NA 4JU8A 4DCSA 2UYCA 5KO2A 1FTQA 2FI1A 2I1LA 2V96A 3D1JA 3M5PA 1HTTA 1Z5VA 1E4OA 4G0VA 5LQSA 3EDCA 3AY0A 2PMBA 3C8DA 2NZWA 3CLUC 4EGQA 4ZXFA 1ZJWA 5KDDA 5BQPA 4BQQA 1RLIA 3IKMB 1FFGA 1QHGA 3A8JA 1OBVA 4IIEA 1P2BA 4QTTB 3IRVA 3VU8A 4ZI3A 2PUGA 4L6IA 4PX2A 1KIFA 2R8ZA 3DE4X 4XVQA 4EKEA 5BV7A 4EA9A 4KX5A 3DOFA 4UBIA 3A3OA 4W63A 3VVBA 1JAYA 3D1VA 2VSFA 3A37A 4A27A 1TT5A 2YWHA 3IT3A 2Z2IA 2R5WA 3B36A 2ILVA 1YZQA 4FCVA 3R20A 1RABA 1BXKA 3VXKA 3I92A 3PGJA 5L6MB 1NJ1A 1ZN9A 3CKKA 3R0ZA 4JCOA 2B98A 2H4XA 4TRRA 3E9MA 3TLJA 2VZ8A 5TMDA 3U0BA 4EM6A 5JATA 1UMDA 3U62A 2C3OA 1ULTA 2RGNA 2NU8B 2QG6A 3AHJA 4LECA 5C18A 4MP8A 1OI7A 4LVNA 2AA3A 2AR0A 2I66A 3EXIA 2OORC 2CN1A 4X7EA 4I5EA 4X93A 5HP4A 2I2DA 3JAKB 4X20A 1IXSB 4PZ0A 2VC2B 1B6TA 3BGWA 3IPLA 3PJDA 4ZI2A 2JI4A 1M2JA 5ICMA 5A2QA 3NBFA 1R0BA 4BMNA 3Q87B 2OFOA 2WWRA 3IVAA 1MOSA 1JQ3A 1T9GS 3FXAA 3HA5A 4J75A 3RS8A 1L9KA 1QORA 5A06A 3DO8A 4FNOA 4Q9HA 2GJRA 5EIHA 3SC4A 3DCNA 3IJEB 4CM4B 3GVXA 4H1HA 3W7VA 3T1HB 1OFGA 2RK4A 1DCFA 1KHHA 2IYRA 1G8JA 4ZEOA 5AI4A 2YJ5A 3AJDA 4XUDA 4M1KA 3PX3A 4OL9A 4KPYA 3KKPA 1EXMA 2A2ZA 1E1DA 4KFTA 1ODTC 3CR8A 5HKKA 2JFBA 1R64A 1C3OB 1NR5A 2AE1A 3ZCRA 2RHJA 2Q2NA 4BMOB 1FY2A 4CQMB 5AJTA 1EBFA 1GV1A 1SXJD 4LXQA 1EHYA 2O7VA 2BTOA 1T4CA 5FLYA 3OLWA 2X3FA 1OLUA 1Q7RA 1EXNA 4S1WA 4C22A 4EEXA 4IP0A 4U7HA 4PQRA 3EEQA 2W6IA 1JA9A 2BI4A 3ZH2A 1A9YA 1HYBA 2V31A 2I8AA 3HJBA 1PEKE 4QPPA 1A76A 2I4NA 3HYNA 4PBSA 5BQOA 2D62A 3ETGA 4BAGA 5B3LA 1TYEB 3MFYA 3EXFA 3I32A 1YS1X 3N2IA 2DT5A 2NG1A 4L0CA 5ITWA 5IARA 1EK2A 3NYIA 1ORIA 1HBJA 5F23A 3IQIX 3A7EA 3FIJA 4S12A 3MG9A 3P9SA 3W0LB 4EPTA 4RZ3A 4PIPA 1BCSA 3F5MA 1Q0TA 2GCGA 5ILQA 2CCJA 4BO6A 2OCAA 2R86A 4LCBA 4WKBA 1N57A 1UDAA 5D2CA 2IYUA 3E9RA 2PHZA 4PBRA 4BWFB 4N18A 1BSVA 4EW2A 2O8CB 4FCWA 2QVLA 3QF4A 1XRQA 5EJ2A 4G8CA 5A8AA 5GOZA 1YSCA 4CUKA 1FK8A 4DB4A 2R1UA 4RJJA 4TRNA 4WCFC 4YRMA 3W8FA 1GEEA 2NX2A 1LW6E 4OP7A 4KHPB 1B0PA 1W49A 2Y68A 1PI3A 4UQOA 4L7QA 1RI1A 4KQFA 4P5DA 3CLUD 2X0IA 3EXG2 4MA5A 2IK8A 1JQEA 3RI3A 3CHYA 2JAXA 1QIDA 1E9DA 4D6XA 4DCJA 5HIJA 1Q3HA 5CFRA 4Y1EA 1J2YA 2YDXA 3X44A 2R7LA 1E79D 1CVRA 1EK1A 1QHXA 1UT5A 1YBHA 2BFOA 4RY0A 2PUDA 2VVTA 3T3MB 3FFBA 1NDQA 3G82C 3LWBA 2QXUA 3BEOA 1TDJA 1SBQA 5L6LB 1VC2A 2G80A 2Q0XA 3LRPA 3QFHA 4LWZA 5J59A 4A1OA 4DAOA 1NG1A 4IGAA 5SZHB 5CT9A 4N6GA 3A6KA 1DQYA 3TBHA 3QHAA 2KPOA 5FBKA 4RLFA 5KYVA 2R7AA 4ZIRB 4D8YA 1L5YA 1GUBA 3K6SB 2W42A 3IUQA 4G07A 3VZSA 3V00A 2OCLA 1J5XA 2XUZA 1UP4A 1PHRA 1U7XA 1HF3A 5EFZA 4O2AB 4D3FA 4EATA 3AUSA 4B7UA 4HYTA 4MZDA 1Q2UA 3R6GA 4KE6A 3UA3A 1Y6GA 4G0NA 1XU9A 5IVDA 1EKXA 1HDIA 4D7AA 4EI7A 3FBTA 1XTPA 2RGRA 3ICPA 5FUYA 3T9EA 1JHAA 2CVFA 3ABZA 3VO8A 4BL5A 1QVZA 1QU2A 2AD1A 4EMUA 3QGMA 1I2MA 3CJTA 3B6JA 4LF7B 2R6GA 2OXEA 2BAGA 3HVHA 4DA8A 2B9EA 2W11A 2YIJA 3JZMA 2GTPA 3U56A 4HL6A 3T5GA 3W8DA 1CX9B 4QYXA 2N1BA 3T4XA 3PD0A 2VTBA 3EVNA 3RUCA 3G2IA 1ZOIA 2C98A 2P9QA 3JYQA 2PZMA 3FBWA 2OYCA 3MXOA 1C80A 1NVVR 1SBIA 2VKQA 2JAHA 1Q20A 3R7WA 3U37A 4PANA 5E7QA 2G72A 1ESZA 1RKBA 2HWKA 3LQ4A 5ITSA 3LCCA 2II6A 4BCCA 1N0HA 2WY2D 1LC3A 2QD4A 4HLUA 4KR6A 1QH8A 4GSLA 1RHKA 1KA9H 1HURA 4PTZA 1NVMB 1JQBA 4DYDA 3JQ7B 2JLRA 1RWBA 5AK3A 4BBJA 3MWYW 3U1BA 4XR9A 2JD1A 5BSMA 2XKAA 4LJYA 5CLIA 3M2TA 3TEMA 1UC8A 1DP4A 4IH4A 1RHQA 4Y67A 4E70A 2IS6A 2EVWX 5KQPA 1TCCA 4IIFA 4AJHA 3FHTA 1EUDB 1JJIA 4U5XA 7MDHA 3ZBQA 3PA1A 2C9DA 3K0FA 5FPSA 1JXQA 2GAAA 1RWVA 4NICA 3ZE7A 3ZDQA 5EZYF 1CRZA 3N8KA 5TMBA 4RDLA 4Y0AA 5K8CA 2DKNA 4FGSA 4HXFB 5HFNA 1KMQA 1SXPA 3IEUA 3RAJA 1QTIA 1Y1LA 1OXXK 1FQKA 3RABA 1P6XA 4O25A 3FTNA 1O6BA 1HNZB 1EWRA 5I7VA 1MA3A 4C6TB 1IOWA 3K6RA 1UT6A 2XKBA 5D1HA 4G86A 1Z7BA 3QYPA 5IAJA 2OCGA 4ND5A 3L7KA 1UDCA 1ZJ6A 4KQKA 3D26A 2ZS8A 3S1AA 2X5OA 5FAKA 5LD2B 4IOJA 1Y34E 2J6IA 3COSA 3MT0A 2PJUA 3P26A 1KAHA 2VYFA 4KVAA 5DHRA 3B3QA 4PQFA 5FI5A 5CFLA 3ZVKA 4RU1A 2HWWA 2H1OA 4I6EA 1OVGA 3Q3CA 621PA 4JI5B 1DVRA 1KI1A 4O8CA 4OMUA 3WK6A 5IANA 3HB9A 4KFCA 1JQAA 2I91A 2OXCA 1J99A 3IP7A 4PQEA 3RNLA 3V8QA 1W4CA 1ES9A 1P5FA 1KDTA 1T2EA 1AU9A 2DCMA 4NFYA 3TS1A 4EG6A 1I2CA 1FRZA 2BM8A 2XBLA 5L3QA 4XIYA 1IN7A 5G4KB 5GVSA 4W5WA 1R8SA 3PUKA 3ZHTA 1SD2A 1JP7A 3DOOA 3PFBA 2FR0A 1NUUA 5EMNA 5EZYA 3VVLA 4ZDIA 3OCYA 3AJRA 1Z8DA 4HFMA 5IVPA 3DOJA 1N7IA 1UZMA 4F71A 1SWWA 1RC8A 3ZLJA 5A0VA 1I1HA 1OZHA 1W88B 2IZ1A 3ES9A 3SS8A 1MCZA 1YIOA 1WVMA 2Z5LA 4G63A 3M6MD 4A16A 3TWOA 3COJA 1WDLA 3H1FA 4W4TA 1EGQA 2UZAA 3FGNA 3MBIA 4BCBA 4BOYA 5JCXA 5KJ1A 3B7PA 3CZAA 2FEPA 1V3UA 2R1TB 2VQFB 2CNLA 2OV4A 1PSDA 1BWQA 2XXJA 4Z99A 1X92A 5BSFA 2W6NA 1SOVA 3ZPNA 1IRIA 4R6XA 1Q17A 1E1MA 1RAGA 4YFYA 2A0XA 4EPRA 1BROA 2REQB 3EMKA 4OQMA 1F2UB 1OH8A 1XEXA 5SY6A 5FWYB 4ZREA 3EAGA 3JZAA 1SH7A 2OCKA 3D81A 3L0DA 1PWXA 3B2EA 4TUYB 3ZGXA 2OAQ1 2B4QA 5KYXA 2RHWA 3C8MA 3IT1A 5TMPA 2DWUA 5DP2A 4TV9B 1KYYA 3UA4A 1WB6A 4RZSA 1G55A 4N41A 4EARA 4PHGA 4QBFA 1GPKA 3EG9A 3EBLA 2YNMA 3PJGA 1Y8RA 4XQCA 4D8WA 4QPNA 4IV5A 1ZEMA 2XVYA 3V5NA 3DDUA 2Z9BA 1F0KA 5BN4B 1VJ1A 1A98A 4CQMD 1SVNA 1W5BA 2Q41A 2XNHA 3A36A 4KX3A 4BX2A 1SKYE 2PR7A 2ZW9A 2SHKA 3NAMA 4IAOA 5EE3A 6Q21A 1PVOA 2JIDA 4E1AA 4RETA 5C53B 4QLAA 4TWZA 4ZGGA 4GPD1 3UENA 1L5SA 1KC3A 1FA9A 4ER5A 4U9IS 3P71T 3L7BA 2G3YA 5ITVA 5H82A 3DHWC 3UG7A 5ECYA 3QXGA 1DJQA 4LNUB 2YQ4A 3DV0B 4CKCB 1Q0UA 4QDXA 4DEVA 3LOQA 2QI9F 3HJUA 3WLIA 4ECAA 1E1RA 2YVKA 1RXWA 3ABOB 1WMDA 4BVKA 3U1TA 1R6XA 2BFMA 3RFFA 3VH4A 2AF3C 4G01B 4BLTA 1KSGA 4KN6A 2XHZA 3GBVA 5C80A 4M88A 1K8ZB 3HFGA 1E7MA 3PEWA 4HDKB 1ST2A 3LIPA 2C9YA 1T36A 2Z83A 1PDVA 3TG2A 4FOTA 2OCDA 2R47A 3QU5A 1S6YA 4H3HB 5E6SB 3C1UA 3H99A 3ORRA 4ZCRA 1CC1S 3ZDBA 4WASA 1W36B 2ZTMA 4B40A 1RQ7A 5JS2A 3ICWA 1CF9A 1B3BA 1WCIA 3CG4A 4MWSA 2OKGA 2M1XA 3E03A 3L02A 4PTYA 4FTWA 2ANCA 2GPAA 3ECSA 5EEHA 2PH1A 4FHGA 1V6CA 5JSKA 3ZBPA 4Z51A 4P25A 1JJFA 3NC1C 5AUNB 1UAYA 1VJTA 3AI3A 3OTIA 3REOA 2OAGA 4DNOA 4J9VA 1ZM2A 1WETA 5I4BA 2ZSDA 4RYLA 1E6MA 4WN9B 1AKQA 4NIMA 2VOJA 4UM8B 1FXUA 4ADSG 1BAPA 1JHQA 3NIDB 1HVXA 1ONSA 4ZZ0A 3E1YE 3EXG1 1WHTB 4ZVOA 1Y1TA 3M3DA 1N5LA 3KWFA 3PC3A 2VHWA 3WLFA 4R4JA 3KAQA 4LBWA 1L4NA 2OQVA 3H2SA 3G02A 2PWYA 3ENQA 3JSXA 3U9SA 3PIRA 3OQJA 1BD3A 2GRUA 5CK4A 1G60A 3ZN2A 3L18A 1VI5A 4ALLA 4Z53A 4XNFA 1ZP6A 5A3JA 3RFVA 1JLRA 4PSKA 3G9XA 4MQ4A 5KYWA 1Q7TA 4UZUA 2BGJA 2XYGA 4FHCA 1OBOA 2C3YA 3NOVA 5DGHA 3MUEA 5KTYA 3H8WA 1HFWA 4LBVA 1RXCA 2XT0A 4XXHA 1O4VA 4QO7A 1R2QA 4U8GA 2EERA 1G7TA 4K88A 1IQPA 3SFVA 3STTA 4MUGA 5CRIA 4M60A 3D7RA 1XB2A 2J7PA 3EW9A 3V8MA 6GPBA 4DXHA 1HORA 4XGRA 4GBJA 4CTJA 4NJOA 3GH1A 3S3TA 2PS1A 4D3DA 3I2GA 2GJSA 3T12A 4AG3A 4JBYA 3DXYA 3L4EA 4OLHA 4DUYB 2XCUA 1K6JA 1NLZA 2WJ4A 3LJKA 2EJTA 3L7DA 5EHIA 1ZDMA 3TM4A 3S8EA 4H9GA 721PA 4IFEA 5JFOA 1SVLA 3R9KA 4P26A 1KPGA 3E8MA 2F90A 2IP4A 4OHOA 2OYRA 3NETA 4X71A 3V9PA 1T2FA 1ZVMA 1AZLA 5C52B 1LX7A 2HFKA 3EVFA 2EIXA 1K7FB 4UVGA 1BGVA 3IUPA 2ZT7A 2I2XB 4I6GA 3OZDA 3JU3A 1NQWA 2KQUA 3D8BA 4I1SA 4JU9A 1CQJA 4UTPA 1FLAA 2N3ZA 4I1RA 3KOMA 4P0TA 3UWKA 2QLNA 3WLHA 5EXXA 3WGMA 2JFOA 2NPIA 3WMFA 4TQ9A 2HIHA 3EPLA 3SE7A 2FXVA 2C7RA 3DAOA 1NYQA 1AMOA 3RSOA 1VQ1A 2W00A 4LJ5A 1A7UA 1YVRA 1WTHD 1FFCA 2VHUA 2HPZA 3OT1A 2X9VA 1G5QA 2VCYA 3IUYA 1MOZA 4YS6A 3ZY5A 4A8JA 4A8TA 1X14A 3INNA 2YR0A 4WFJA 4Q7MB 3H94A 2WSBA 3H2JA 1JB1A 1ECLA 1T1IA 5DSXA 4FOSA 1RBYA 2F1RA 3BH6A 2A4MA 1ISHA 1GG8A 4MICA 4DJEC 5ALVA 1KIAA 1V96A 1XBTA 2HQSA 1OXKB 1OWLA 1HE4A 2R00C 4Z4TA 4GOND 1DXYA 4JYBA 3IX7A 4V03A 4L3WA 4LCEA 3AB7A 4QBHA 5AJZA 1LLQA 3MGBA 4OOVA 2PKYX 1M1YA 1B16A 4E5VA 1P9WA 1VB5A 3IILA 1XTJA 3KTDA 4CM7A 4NPHA 1PT5A 2Q46A 1BKDR 1MB2A 4K86A 1VLLA 2H2WA 4QA9A 3IJRA 1LBIA 3T0FA 4DNRB 3Q5DA 4WZBA 5GIOE 4Y98A 1TZBA 3SEJA 1E0JA 4TVSA 1N2CB 5BV8A 3DYBA 5JAMA 3JR3A 3PC6A 5JSYA 2CE2X 2ZIFA 5BW6B 5T3YA 1EVYA 2Z95A 3DP9A 4LZWA 1TM7E 2OSBA 3I4LA 4KR2A 2NU6A 2I4RA 3HVUA 4DNPA 5KNBD 3TE7A 1MRZA 4JMQA 2X77A 2XUJA 1XD9A 4KN9S 1HX7A 4LWOA 1R0XA 5DBOA 3DEAA 1KXJA 1G5HA 1WMFA 4MO2A 5LWQA 3BMNB 2WSLA 4M3NA 1RVDA 3GEDA 3E15A 4DCOA 4OIMA 2X4IA 4DY6A 1X7ZB 4R8KA 2PX8A 3AL2A 4RPHA 3MYYA 4ONEA 2YZMA 5CTJA 1ZD4A 4KREA 1XZAA 4Y6OA 1UM9A 1AT1A 1EJ0A 1XEAA 2DVMA 1WDTA 3KT0A 3NEAA 2P9JA 4M87A 4O33A 3T7KA 3VOBA 4BFTA 1SVKA 3MJSA 1H0HA 3FUTA 1GTZA 5HIAA 3GLFB 3GFOA 3L0SA 3LOUA 1ISJA 1W85A 2D0IA 2ZG6A 4TMWA 2BZSA 4G81A 3N2EA 2ZI7A 3AF5A 5DX1A 2F8MA 1Y7IA 1J09A 3H5WA 1SURA 4QGBA 3F7TA 2HT6A 2XQJA 5K8IA 1C8LA 2PX6A 1I8TA 1DRKA 2HHJA 1N9GB 4Q01A 3UGJA 1WEKA 1BH6A 5HZMA 1R0LA 2Y1KA 3V8PA 4QJIA 3OZWA 1B1CA 3LPLA 4EMSA 4Z7NB 3KIPA 1ZJ5A 3HCOA 2QZ4A 1LPNA 2V3WA 4FDVA 3VO1A 1E8MA 3K2BA 3ORFA 1OFUA 1Y7PA 4UEJA 3SEQA 2FQWA 2DQYA 1SXQA 2XCLA 5G41A 1P1FA 2IH5A 1VYVA 4YCAA 4Q12A 2Z6VA 1QPBA 3DBLA 4I0WB 3PEYA 3VNBA 1C9EA 3ND9A 1UK8A 4BO3A 4KBYA 5JVDB 4I46A 3URKA 2ZRPA 1P0QA 4HWOA 4JJEA 1MB9A 1ZD1A 1YOVA 4AS2A 4X3CA 4OI4A 1O89A 1EB8A 4XFJA 2VP4A 4QYIA 1C1DA 2PBRA 1A5SB 3KEOA 2X6XA 3NT5A 2CRVA 2MYTA 1QTNA 2GGSA 4RLSA 1RVV1 4C20A 2PANA 2AG5A 2ZI4A 1AQUA 3RKRA 2YUIA 3O38A 1ZAKA 2FLKA 3HKCA 4G0WA 3BXPA 2BRUA 1Y3BE 3LVRE 2AEEA 4AN1A 2G1PA 5HQ3B 1TMKA 2J4CA 4ZT5A 3SNKA 1RYFA 4BKRA 4JXZA 4AY6A 5JW6A 3KB6A 5CPFA 5GPBA 4ENSA 1VQNB 1MORA 2BFCA 4LPKA 2XQFA 4DR5B 1WXEA 1Z2AA 3S40A 1X1EA 5ELMA 2A1TS 2ZI6A 1VIMA 3LYAA 1KDRA 3GJ0A 1CQIA 2QG4A 4NOJA 1SN7A 4L9SA 5CYPA 2Y0CA 1W5EA 1M1YE 2AUTA 2FLWA 3C98A 3RU7A 2R48A 5K8TA 2Z3WA 4II3A 4KVGA 3O83A 3ZVMA 2VHZA 4FNGA 3H5AA 3ZH9B 4WZBE 3ZGZA 1TD9A 4YRSA 3FD8A 1PUIA 2WG2A 2ZWIA 3K5HA 3PEUA 3T7EA 3QPCA 4PGAA 2UUOA 2JLYA 1OLSA 2CLOB 2CMKA 2QORA 2V55B 3PZRA 1R0RE 3FTQA 4W9NC 4FGUA 2OHJA 3JYLA 4ON9A 3N8HA 5KYUA 3H5NA 1P4AA 2UYYA 2WEKA 3LC7O 4QQFA 4AO7A 2IL1A 4BWYA 3A9SA 3K2IA 1H4VB 4OHZA 1YB6A 1IM2A 2XCQA 3KFXA 3LXMA 4K6HA 1NE7A 4ZO7A 1L5HA 1YDHA 1QZ3A 2PS0A 2GBGA 2QLLA 1XPOA 1ONPA 3G5UA 1NJID 1N3IA 1O58A 3IP5A 1QJ4A 4MYHA 4BU1A 4CT4B 4RD6A 5AJWA 3ESAA 1KAGA 3PFNA 4C08A 1HYGA 1SIOA 2AOUA 4ENQA 1U8EA 4Q66C 1F8XA 5C32A 4XSHA 1PJ2A 4L02A 1U4OA 3GVPA 5EGNA 1MGOA 4PR3A 4ZGWA 4TLCA 5FOTA 2H7YA 2P91A 3JYNA 3I5YA 3EDRA 1PKEA 5CVCA 4KMSA 2BR5A 1JHDA 3OF3A 2FPUA 3VYTB 5TGZA 4D5GA 1M33A 1T5OA 3WLTA 1NQVA 3ABSB 4L6AA 3D3EA 3SC2B 3KQQA 1A2OA 3AF2A 4V0RA 2FZKA 2FE4A 2C4KA 3N0XA 4XUCA 3C7DB 4HBZA 3RJ5A 3CH5A 3JQAA 3LDGA 1QB7A 1N2IA 3T7IA 3A8KA 3GO4A 4Y2SA 1IAVA 2P3QA 2NU7B 5DHAA 4KGVA 2O5CA 1FMFA 1HFEL 4ARZB 2ZBFA 4QV2A 5IH3A 5CDSA 4ZJYA 1TC2A 2NVUA 3FVVA 1RE1A 5LR6A 4ZMSA 1WTAA 4XX1A 2DM6A 3WYAA 3Q0EA 3F73A 2ODBA 4I1PA 2CLSA 1QNLA 2FX2A 3AW8A 1VRWA 1X74A 4B6FA 5FWAA 4XGQA 4ZQHA 4E15A 3RVQA 1ESNA 1ZMXA 3GFBA 4CKBA 4X7MA 1F6WA 2DHDA 2E4XA 3EPPA 5AW1A 2WYWA 1CY1A 2G1UA 2BN4A 3NUZA 4HUQA 1TZMA 1REQB 2VPYA 4R1OA 4PC6A 4HAUA 5DTRA 1S9DA 4ZTUB 1QF6A 1C4WA 3OT5A 1NU8A 3ZKWA 2MSEB 13PKA 1N8SA 1QNFA 3CCUB 2ZCVA 3C5VA 5H7XA 4ZHQA 3KC2A 3PYMA 1N5MA 3PJEA 4MQEA 3KSAC 1BDBA 1PNRA 3HB7A 2RONA 4F45A 2L42A 1ZCAA 3B5JA 3PGKA 2IELA 1R0CA 3FPSA 4FIZA 4HTFA 1L7RA 1NXWA 3WO0A 4OGGA 4ZQBA 2Y0PA 3A31A 5D5HA 4JA2A 5JYEA 4HI0E 1VKNA 3KS9A 5K1ZA 1U9JA 3FX2A 2ZSKA 4KKUA 3QQ5A 1TIKA 4C76A 2OO3A 5FEUA 3QG1A 3WYGA 2UZ4A 5EJFA 1QIKA 3RD5A 3T3DA 4O2LA 1JEYA 4G4IA 4MWZA 2QQGA 1XT6A 2EGGA 3E6AA 5TJ9A 2WZBA 4P4SA 5IBQA 1KRWA 4N1AA 1Y5MA 3P0HA 1IEVA 2B4TO 1Y3CE 3DR3A 4DCVA 5KHAA 1OE0A 1X80A 1OX4B 1E59A 2BZ0A 2Q9BA 5IPFA 5HUQA 2PFGA 4AL4A 2IS1A 1B76A 4D46A 2WF8A 4BZZA 3NZEA 3OHMA 3AEUB 2H8GA 3M34A 1NUHA 3E3LA 4CTOA 2JIMA 4IIDA 5IZCA 2H7CA 4HPWA 1X1BA 2D1YA 4YRAA 1QK3A 2HADA 3UWOA 4Q3EA 2DHQA 3H5OA 1LH0A 1HA3A 3HO8A 4NAUA 2TS1A 4UJ5A 1AQJA 4ZJPA 2ACKA 3TGWA 1CRPA 3BXZA 3DTNA 4MQ6A 3HKBA 4S1TA 3LDFA 4MWTA 4XM2A 3RRZA 4M9UA 3ICEA 1KD1D 4CHTA 1FDRA 3WJAA 1G8HA 3BL6A 1B3RA 4NRDA 4JHLA 3WE7A 1KMCA 2ADOA 2CWWA 5AKZA 3U16A 4IWNA 1BKYA 5E6RB 3MINB 3JARA 4GRDA 4GE3A 1NMQA 4YQYA 2PPLA 1W87A 3AY6A 5DGXA 3VMMA 1IOLA 2PYIA 1SHJA 1K68A 3UCEA 3H17A 4IMPA 2KJQA 4DJ5X 3DE0X 4EF4A 2C2XA 2QY6A 2YV5A 4Z4CA 3EPJA 3ASYA 4L72A 1HT3A 4XIJA 1WW2A 4BMPB 2D9RA 5KSOA 2OOSA 4Q0MA 3EFOA 3FDJA 3PUVA 4H0FA 3D7LA 3WA6A 1U8TA 5JALA 3ZJYA 4WFIA 1AJEA 3UYKA 1DAFA 1QVAA 2YBDA 1P2TA 2ZTLA 2P4QA 5ALIA 1T5SA 3HA2A 3H3FA 4ZEXA 2XY4A 2XDYA 3QLVA 1R0ZA 2ZQ5A 1FTGA 4YJDA 1N5RA 1OCEA 5E6UA 2D0OB 4HQLA 4UATA 2UYQA 2FRVA 2O1EA 3VO9A 1XDWA 1WJGA 2CUTA 3B82A 1H1LB 4JGBA 1KBOA 2QTRA 3QBJA 2CZQA 3E4DA 4BDTA 4EJ0A 1B74A 2VK2A 3EPHA 2D3LA 1JDJA 2QP4A 2H1LA 3V76A 1K4YA 1WSDA 1XF1A 3BIFA 3UJHA 1J1UA 2OYNA 1NJ8A 2HSZA 2M5SA 2ZB2A 4RVOA 3WVNA 1Z6ZA 3KV3O 4LZOA 1NR1A 2H63A 1MOQA 3KNZA 1T3SA 3UKOA 2A84A 3T3PB 4F06A 2GPYA 1M2HA 2BELA 2W6PA 2FPIA 1O97C 3D4OA 4PS0A 1O94A 3PPWA 4RIFA 1YBMA 3TM5A 1FTSA 1XDSA 2FWPA 1AA9A 2XUIA 3O82A 4OFZA 3OSUA 1A9XA 4HE6A 2AGVA 2H92A 4R8VA 1E2EA 2NYVA 3NASA 1YNOA 2BGUA 5J40A 3N2GB 4BNFA 4CVNA 1W30A 1I1QB 1GXSB 1UBRS 1CDOA 1JR3E 3K5WA 3B48A 4HDSA 1NMEA 2ZR8A 2FPPB 2UVQA 3H9CA 4HDQB 2A86A 3AZQA 2HA7A 4J16A 2JFUA 1KO1A 1JQDA 3KL4A 4PM4A 2ATIA 3VQTA 1RJGA 4X6YA 1H1DA 3MB5A 3EQ8A 5KNCA 1GY8A 1P1BA 3HYCA 4I4NA 4DBLE 2VUTA 4ZO9A 4BQFA 1OX5A 1Y63A 5CCXA 2POQX 1WTCA 2HW8A 3OUUA 4HWTA 3H16A 3MMNA 5AIAA 5H80A 5CAEB 2GM5A 4P5PA 2I78A 3F8SA 1E0KA 3NV7A 1JYSA 2F3TA 4PLZA 3JQFC 1T1EA 1XCGB 4PLHA 3TRJA 2PBFA 5AIBA 1Z4JA 1J8FA 1MVLA 4KIUA 1VCOA 4POAA 1RCTE 2QLTA 4EP1A 2CNOA 4KJXA 5H8WA 2WHXA 5HF5A 3ZY4A 1NVGA 3K0SA 3ZGVA 4G85A 3OJXA 3HWWA 1Z0FA 2XE7A 5AM0A 3LW8A 4B43A 3CC2B 5TF4A 2GRJA 3PXXA 2J32A 3KVNA 1GYRA 3HB5X 4FYVA 3T41A 3R8FA 3V8BA 1E3QA 4MDFA 3PB3A 5HQJA 1EE9A 1HXHA 1CV2A 3SZMA 4H7IA 3C3CA 3MJCA 2H2GA 1E2IA 2EJWA 4DK0A 4WRRA 3C7TA 3UT5B 1ZBQA 2WWHA 3R3WA 1Z13A 3K1AB 4YMGA 2FFJA 1M2GA 1JHOA 2CJPA 4O4HF 1P75A 4OI1A 5JPCA 1XYGA 2EJBA 2FETA 1WU7A 3D6AA 5EE0A 3TPFA 5IEBA 2WM3A 1WHSA 3KE8A 2ZTHA 3MCWA 3RBXA 3RYHA 2C97A 3AZPA 3QPVA 3WDMA 3AEXA 1L8OA 4Z0HO 3B52X 1P1RA 3BE6A 2SKCA 3OF5A 4OH7A 5JRJA 4KMMA 2C59A 4BLVA 3AKZA 3PFCA 1JTEA 1LRLA 3CPWB 1WO8A 2K2WA 3ANTA 5KJCA 3C6BA 3KL2A 1IB6A 1CRLA 1Y0RA 5JRDS 2QTAA 3OOJA 4ZCTA 4WA7A 1TAHA 5AVOA 2UXCB 4A6XA 3Q2IA 2PIDA 1NRWA 5B7PA 3A6ZA 1B23P 2FLVA 2YV1A 3DFMA 2QJRA 4I7EA 4QXQA 3RT1A 4LVCA 2CLFB 2I2BA 3AFIA 3N6VA 1ZH2A 4TWIA 3HRKA 4FXOA 3QPBA 4JP1A 5EC8A 5FF9A 4X62B 1XNRB 4I4IA 1XR3A 4UHBA 2X58A 5FOSA 5B58C 1IXZA 2IYZA 3EDOA 3CF0A 4YT4A 1RRKA 4LTNA 3GLIA 1HYEA 2J0QA 1L7BA 1WXQA 2JF0A 3M9XA 2VZ0A 3JY6A 1ZJZA 4G1FA 2DSTA 4PONA 2OHGA 4O4HA 1XE3A 5L3SA 2AZMA 4G9BA 3THRA 3TQFA 3FGZA 3DEZA 2GK3A 1IHDA 2CKDA 1E9FA 1HDGO 2TMGA 1OYWA 2DJ5A 1GAQA 2QRZA 1ZU5A 3UMVA 3QXXA 1H5UA 1C9JA 2F9MA 2I22A 2OCIA 1BJKA 4URXR 2GO1A 4WESB 2P68A 1VL8A 3FKSA 1DIAA 1HG0A 3L6CA 2HU8A 2HEIA 4MJ3A 3NV9A 4DIFA 2ZTUA 2HM7A 4K1XA 4BAZA 4EUSA 5AW0A 3BHIA 2WPDA 2YWJA 2XKKA 4BCDA 1WSVA 4A2CA 2JLCA 4RD1A 4C14A 4F56A 1O97D 2JZOA 3R3JA 1L0BA 5IM4F 1CW2B 5AVYA 1P1HA 5E3JA 1Z0AA 2CNWD 2H2AA 3D2AA 4J0CA 3VR6D 4O2BB 2DQZA 1X7XB 2JLZA 3PVDA 1W8DA 3IEXA 2VDQB 1G41A 1I2AA 2WD7B 1IHPA 1TEHA 3KSMA 4LPSA 4KXVA 2VJMB 4OQNA 5JZMA 3QWIA 3UK0A 3CCVB 3UXEA 1G3MA 3NMUF 2VQ3A 4D9GA 1T8TA 2J8ZA 2M1ZA 1QYWA 4FHEA 4X63A 3LIIA 2OCPA 3VPDA 3MWDB 4V1CA 3PUXA 5HE8A 1KDVA 1NM5C 3T06B 3UZUA 4UBKA 4UDYX 4K9PA 4LK3A 4TKUA 3S2IA 2B1JA 2I2WA 3DE7X 5DOVA 1MG0A 3HNOA 1U3DA 2DLCX 1ACJA 1T9KA 2BHLA 5LUBA 3RTAA 3QENA 2HCJB 1YXMA 1CTQA 1QIFA 3C1OA 4NZOA 3SSAA 3QFRA 2ZIVB 1XHLA 3AR3A 3TTYA 1DEXA 2A9VA 4MW9A 2AL7A 3EB9A 5D5QA 1CG6A 3K0CA 2UUPA 5K3FA 4MKRA 1OIWA 5CW1A 5BV0A 1M0EA 3WLNA 4EY7A 4YCCA 3FGOA 1J6UA 2GF9A 2Q27A 4DV2B 1PWHA 3ZDRA 2A5YB 3OZTA 2ORVA 3CF4G 2QUAA 1IL0A 1ODJA 2OHVA 3N7AA 3WL5A 4YMVA 2AMYA 2Y9MB 4MP3A 4O4LB 4J0EA 3K05A 3ONEA 4IEFB 1HT1E 2QX9A 1NWCA 3PQFA 2VHVA 4WCVA 2VZEA 5K51A 4N0PA 4L5BA 4LRSB 2WAOA 2APJA 4R05A 2M6KA 5GGYA 2J85A 3CVUA 1L8LA 2ZI5A 1SB8A 2W2QA 5B53A 1L7EA 1MAVA 4RTPA 1VG8A 1K3FA 2ZB8A 3IAXA 3IOCA 4AUKA 4J4HA 3C6QA 3PA6A 4B6JA 2AW5A 3NDIA 2GYYA 5K0CA 5ALYA 5C4MA 2WFLA 2VAXA 5JCJA 1YZYA 3KPUA 1U1DA 2G8LA 1NG9A 1PYDA 1EK5A 3IEIA 5E95A 1OZGA 1B41A 4MUIA 3WQRA 4JELA 2A3NA 4CM9D 1XPRA 4JK3A 3GLIE 1FZTA 1RC1A 1GZSA 3BTUA 1I2DA 1E9CA 5A6VA 4MCJA 1A3CA 3CMAB 1V7ZA 2Q5CA 1DV1A 4Q18A 3N74A 4GVXA 4BN5A 4QUIA 3UGQA 1JG1A 2PCLA 5IXYA 3AL0C 4RA6B 1EDOA 3IBSA 1TU3A 2V3CC 5L3ZA 3SBXA 5EJ8A 3I6YA 2D13A 3ZYZA 4CW7A 1TEXA 1QGZA 3RS5A 2UVPA 1ULHA 4RMGA 3ASSA 4YACA 3B51X 1DJNA 2H08A 2QMZA 3T0IA 1F17A 2OESA 4Z1MA 1XP8A 2IYYA 3IR7A 1TTPB 4ALNA 4IDBA 4QHYA 4ID9A 4XM0A 3EZ2A 2RAUA 1YA8A 3D8HA 2QDKA 3C6ZA 3F9RA 1U8YA 3OPYI 2YN0A 5KYGA 3OETA 1FDUA 2CYBA 1FFAA 1T8PA 3LGSA 3PHLA 4X1KA 3TI9A 4RPKA 3VNQA 5CCEA 3GRAA 3SFTA 2NNLD 1Y4SA 2GO7A 2DBYA 2PFSA 3C5WP 4LYDA 3V2UA 3CUTA 3ZJUA 5LBIA 1PWYE 3QVGB 4M1OA 5G4LA 2LTAA 4X64B 1W46A 2PGNA 4KQIA 3EC1A 3MMZA 2X86A 5FBQB 4A5SA 1GR1A 2MCFA 2C0PA 3LQFA 2PWAA 3F8WA 1K0FA 2QTLA 4IKPA 1J07A 4B6RA 5BUCA 1UT8A 5J2TB 3BCSA 3OJCA 5JQGF 3CEJA 4MRAA 4PSDA 4L08A 4FSHA 3IIJA 3IP6A 3VH3A 3QVWA 1P0IA 4KP7A 1FTYA 3ZZNA 4BHTA 2CYAA 4C0XA 2ZREA 1WMEA 121PA 3WWPA 3VI3B 3ZWVA 1K5HA 2NAPA 5HTOA 5TPWB 2FRDA 4BKQA 2FZ4A 3W1EA 1DFHA 1Y4DE 2WILA 5EJ9A 5CDHA 2VBFA 5IRCD 4KRYA 1H2XA 3BB4A 3TLXA 1XTIA 2DOKA 4DDHA 5ENDA 3P0JA 3G5MA 4Z49A 1BDJA 1JWAB 4BRUA 1CF2O 1GTSA 3ZE8A 2JAUA 2RKBA 2HL6A 2ECKA 3DTVB 5EPUA 1IHUA 4KRFA 1DPFA 2I3GA 2QRJA 3Q10A 3E2MA 3FYDA 4JQCA 2XI4A 5F77A 3SDZA 4XH9B 4G0UA 5JH7F 2JJ8A 3BJZA 5AICA 1ADJA 3RARA 3Q40A 5FORA 3RK4A 5IJXA 1AKWA 5ALDA 1FS5A 4ZU1X 2E5LB 1T8RA 1XVTA 4GE0A 5KVSA 1ZC4A 1G7RA 1M1ZA 1MC5A 2HJ9A 2NZYA 3NKVA 4FU0A 3RQSA 5GIPE 3BIJA 3OQIB 1UOPA 3TB6A 1U0EA 4YT5A 1BFUA 3LL7A 5AXCA 1DXHA 1EFLA 1KAEA 1FQOA 3E5RA 5FBRB 1FW6A 4M9RA 4I1IA 5JQGA 5IAAA 3AOEC 4B7XA 4F4FA 2CDAA 3HCBA 4NZYA 4G4SO 1A9SA 4BGVA 1II8A 1ZGBA 3CEMA 2IGTA 1R6AA 5DH9A 4ZV9A 4A6PA 2X0RA 2NSHA 3TIFA 1VIVA 3IXQA 2FR8A 3BIOA 3FOAA 4YH1A 3FFXA 1C3OA 1ZICA 3KAJA 4J90A 3DPUA 4KFSA 3A3KA 3RT9A 2XDAA 4MLPA 3SKXA 5JD6A 2GS9A 1R6BX 3ZD6A 3NPMA 3WWCA 2CHQA 4G7WA 3HU1A 5CM8B 5F3RA 2NXCA 5GMOA 3TAHA 3VR5H 3IKVA 1VMAA 3CTPA 3GH3A 3RT7A 5C37A 1PGNA 4UVIA 1EIWA 1GFWA 1W34A 5AMXA 1QHHB 5EMMA 2CVQA 2WLSA 3LFHA 5CYFA 4IUBS 4OQXA 4P81A 3ROMA 5JH7A 1ZD9A 2RDMA 3W9BA 2VT2A 4BUZA 3ETJA 5K0GA 2VLBA 1VM6A 3IDSA 1OWNA 1GP2A 4GVLA 1BTOA 3TZHA 2ZM5A 5TPZD 1V9CA 5LB2A 4HYQA 2P6PA 3RVDA 3WKBA 1A5AB 1PNOA 2AQKA 3HUUA 3RVSA 1YQXA 1YU9A 3LYUA 4IJWA 4Z8XA 2P2YA 4N5IX 4OKSA 1GSOA 2O57A 4DA6A 2XCOA 3OEHA 4RGBA 2GK6A 1QR6A 3T7SA 5C8ZA 2E21A 5EMLA 1I7NA 5J4YA 2F4VB 8OHMA 3AX6A 4GOLD 2ZYIA 1PZHA 1J25A 2HA3A 3AU8A 4KMOA 3L0IB 1Y8QA 2BDTA 4O6VA 3UMJA 1I13A 1YJBA 4FGZA 3VH1A 2XNDD 4G0ZA 3UATA 3AIIA 4O2AF 4ENTA 1JX6A 2UZ1B 2O8CA 4FWIB 4LUCA 2HWUA 5K3SA 1DNPA 4EG8A 2AWOA 3EZ7A 4II7A 5F5LA 2MMCA 2VHTA 3N87A 4IICA 1LDMA 1H2FA 2GVZC 3EC7A 4ZCMA 4WV3A 2VIIA 2O4UX 3K0KA 2EW1A 3FPEA 2BFBB 4I8IA 4HQNA 1SXHA 3RUEA 4WK0B 1WUHS 2HCRA 1FYWA 4JX9A 3BT7A 1O03A 3BC1A 2H2DA 3BGVA 4GYYA 4P2GA 1TAQA 4D4LA 2GCIA 5K4HA 1TVKB 1FSPA 3FZQA 4D0RA 2FQYA 1JDNA 2E1BA 3MIZA 4HDMA 4M37A 4OB7A 4WY8A 4WOJA 2RHTA 4NJMB 1CEQA 2YOFA 4ROTA 3M1YA 3TLEA 2XECA 5ERYA 5JNLA 4DLWA 2J3DA 1NB9A 1XEWX 4GRAA 1I01A 2VA9A 5KUTA 2BGGA 2RCYA 3LBAA 1PP4A 3BXGA 4AWXA 2F17A 2OUKA 3OX1A 4K8RB 1J23A 3SVTA 1Z5GA 2WHEA 3WGNA 4ZIRA 5JNRA 5LSAA 2HUPA 3K6SA 4TZ0A 4C01A 3IOMA 4A0RA 1E43A 1ABEA 1FFBA 1YI1A 1TECE 2GXQA 4D1YA 3G5AA 4O2AA 5E9JA 1BRMA 1BMFA 2OTLB 2QR3A 4D74A 4M0KA 3AVXA 3R9XA 2H9AA 4LC0A 3EWNA 4MTLA 3MSCA 4MV8A 4EHLA 2BSXA 4JQSA 2DIEA 1J8QA 3FLBA 3FDIA 3SZUA 2VXBA 3SHQA 3E8XA 1HUQA 2WAYA 5MGNA 4PX3A 4W5OA 4LDAA 3Q6MA 1YQEA 4F93B 4Q9DA 5THKA 3K9CA 4OQFA 2C95A 1NHGA 2IZZA 2J9RA 1QCYA 3ZDDA 3FPHA 4JLNA 1DDGA 4UXJA 3RC1A 3BRCA 1FUYB 2PUWA 4NHOA 5TGDA 1M75A 5JAIA 2V97A 3M83A 3EVBA 2XA1A 3QOYA 4NK4A 3JRWA 5C1IA 3DAPA 3CE6A 4XVCA 3SXJA 2HUNA 2X4LA 5FTNA 3RHSA 1QO9A 3C1AA 3HGTA 3G6KA 2NO0A 3DEKA 3CLRC 3VNRA 3O47A 1CEYA 3BIXA 2GJKA 2PMKA 3JQ7A 3RU3A 5K7SA 1KK0A 3D7SA 4I19A 5DXJA 5I9SA 3RADC 3HPRA 4QD3A 3IB6A 1U2GA 1CULC 1JIVA 3A6HA 4D26A 3GMSA 2O8FB 4OFWA 5DHUA 2CMHA 3LCRA 1W5FA 1OV4A 1HLFA 2X76A 3EAFA 3NAQA 1TI7A 4PFJA 1EUDA 4YASA 2GH1A 2A5GA 3D6MA 2MJLA 3CM0A 1GRQA 5A7GA 2GEDA 2Y2VA 2XZLA 1YQTA 3L6OO 1IBLB 4O02B 4AT1A 2VOEA 4JJZA 5IP5A 1QCZA 4GL2A 1O96B 3IPAA 3QM1A 5ALOA 4QXPA 2VNJA 4V0MA 1VMKA 4UE6A 4LNHA 1ZY2A 2P62A 2ZIXB 5D1NA 4BMCA 1I5RA 2IYPA 3ASUA 4O0MA 5EXEA 1R5JA 1R8XA 2WBLC 1KKUA 3NALA 3KE9A 4ARVA 3AEQB 3KSUA 1EJ6A 1UXOA 3O8OB 3B3JA 3PNKA 5L4SA 4E5KA 4F9FA 2LWIA 1ZIPA 2GQ0A 2QTHA 1J8YF 4BNWA 1AZWA 1LBQA 2QLBA 5CT6A 4CM1A 3ZTYA 4RTLA 5ADWA 5DTJA 1U2QA 3EGDB 1F14A 4Q6WA 3JVUA 3A1CA 5KJFA 5F1PA 4LISA 4TUYF 1BW9B 1WMBA 4PC7A 2R85A 1KEPA 2HHCA 1OYYA 2NSDA 4B3IA 3G2KA 4V0LA 1TO1E 3I9JA 3IIIA 3HI4A 3ONFA 2BMDA 4K0RA 4R41A 1POXA 4TV9F 3DG9A 4CM5A 1EXVA 1C2YA 3EEOA 5J1TB 4G8DA 2C7OA 4TS4A 1GA6A 1RYMA 1S2GA 2ODNA 1NW4A 2H16A 2YMPA 1YTLA 1M90D 3H97A 4COKA 3HJGA 5GINE 1YGPA 2ZSFA 4D6YA 1SBCA 1Q57A 2QRPA 5IDQA 3FZGA 4TS3A 3UY4A 3DTVD 5JMTA 4JLSA 4G0YA 2W4IA 5KOIA 3EZ6A 3GAFA 4BPBA 2C77A 2EF0A 4X7RA 4RK0A 2HLHA 1KEZA 5LZ9A 2HQRA 1E7QA 3WRXA 4CCYB 3IV9A 5IK2A 1RD4A 1FP6A 2R1TA 3IXMA 1I2ZA 3K0AA 5DBFA 4ZQIA 1H5NA 2Q5OA 4AJ2A 1VQMB 3DHVA 3EIFA 3H8SA 1G3UA 5EA2A 3HJCA 1TJ4A 4MEJA 2WIDA 3ZTTA 2HDNB 1CJMA 1F2UA 1G19A 1PK9A 1RJWA 1VJRA 4NL4H 2BOVA 4RKEA 4TT3A 5FWYA 2ACVA 4C0AC 3IT0A 1RIFA 2VXCA 1U0HC 2I7XA 4TUYA 4XUEA 4BRSA 1KEUA 4CKYA 4OOEA 3KAPA 3PNVA 5BP7A 4QEZA 4CG3A 5CX4A 3GG2A 4FE4A 3U3ZA 6REQB 3DLBA 2Q8PA 3F5QA 2QGFA 4NE2A 2DZDA 4TV9A 2K7FA 3MF4A 1U63A 2O48X 1W5TA 2XB8A 4ESOA 4HIZA 1HK7A 1T4MA 4X45A 1EHIA 3ZWYA 4GQBA 2F64A 5IVIA 5CCDA 3QE3A 4LYAA 2LUOA 1SBYA 2WKRA 3LKVA 3MWEB 1YV9A 1QYCA 4IVQA 3CNLA 4QKQA 3RGWS 4LFCB 4AUMA 3ZU4A 5BN4A 1F2DA 1JHMA 1O1YA 2D0DA 4DUGA 3ADDA 1VJDA 3TNYA 3L5OA 1KFBB 4QQRA 3ND5A 2GFIA 1GUFA 4HAWA 4MO9A 2DFNA 1T3TA 5B3JA 5J23A 2YVUA 1NJFA 3ASVA 2CV0A 4HGNA 1D1PA 1T1SA 2QLJA 2X5XA 4BMDA 3GGCA 4UEQA 2AYXA 2RI1A 2YVAA 3FRJA 3GJZA 3OFND 4IG4A 4F97A 2I65A 1Y5RA 3RYCB 4L74A 4AQDA 1QFXA 3GHYA 2GWRA 4UM7A 1YL5A 3FHCB 3E0QA 1J5PA 3CLRD 3DV0A 1QH9A 3EPRA 1FDTA 1W29A 1Z7YA 4ZU3A 1JHYA 4KXNA 2YWBA 1DRJA 4B6SA 4XKVA 2FCRA 3B1VA 3CPXA 4DLZA 5I7HA 3TQRA 3TLYA 5CG2A 5IT4A 3JQQA 2BBSA 5AJXA 4BYMA 4DJDC 5C8XA 3LT5A 5JNWA 2XUDA 3EYWA 2R5FA 3JPWA 1WXXA 2X23A 3MMXA 1QGDA 2VRCD 1S2NA 4KPFC 1PFWA 3A1UA 3PVZA 1QHEA 3GUVA 2B0JA 5BQ5A 1OU0A 4NAHA 2C2MA 3ROZA 5E6SA 3VZQA 2NV6A 3OICA 5DN9A 5A3SA 4P0QB 4JD5A 3BSWA 5BQFA 1S1MA 5KJ6A 2IJGX 3X2FA 3UAWA 4EHBA 2UYGA 3IP3A 3RTEA 4DLNA 5KINB 3IQEA 3P9CA 1DO2A 1TL7C 2QK4A 3B9RA 4JB0A 5TJHA 1QIHA 2O7NA 1LCIA 4F7WA 1XMSA 1ZD8A 4XW2A 2VHCA 1AGNA 1NP3A 1NQAO 1ISPA 3CC4B 4M86A 4MS1B 4GQNA 3BQMB 4EUNA 3L0CA 2BJVA 5JJCA 3ZD7A 3IOBA 4WN9A 1U3FA 2VAWA 5DM1A 4EBBA 5EAIA 3M2PA 4DLBA 4FR5A 4C06A 3I62A 2ZR7A 4PZUA 5ED4A 1ND6A 4Q3LA 4IQ8A 1D2RA 2ECQA 1TCVA 1UBSB 1NPYA 2PY6A 3SIPA 3TD9A 3WZMA 5CVTA 2WFAA 1D2AA 3U60B 2GVNA 1ODFA 3SX2A 3TK1A 3L5KA 3QY0A 1W35A 2I2AA 1ZGAA 2EG9A 2ZYSA 4U7DA 1VPLA 1T5IA 1ZZEA 4CN9A 3ELBA 4WLVA 1Z6XA 1DWPA 1MIOB 1O95C 1Z5WA 4QODA 3SDSA 4CMEC 5DNCA 3KDPA 1ZJJA 3K1TA 2NT3A 3OOHA 3Q8XB 4KN5A 4URFA 1ZZGA 2IVZA 4ZP1A 3R0QA 4O4IB 5EYPA 5F52A 5CB4F 3DT9A 4JUFA 2Q50A 3HKDA 1L4KA 2HU5A 4B3MB 4B76A 1S2OA 2LIVA 4KGDA 4L9RA 2B8EA 3CRW1 5FJJA 1EAMA 3DTYA 3BD6A 3ZXYA 4WWVA 4KH1A 3QSGA 4RPDA 1U1GA 2JASA 3ILSA 5FYQA 5KEIA 4G89A 3CUEF 4BNKA 3A10A 3LDAA 5LB4A 4PXAA 1FDWA 4MKGA 4DR2B 4LXYA 1E6UA 3H8JA 2OP1A 4B33A 4LX8A 2ZJ8A 3ZIAD 5CNJA 4XIFA 1E5VA 4US0R 4KQGA 4N5LA 1VL5A 1XZEA 2IYQA 1F60A 3BIWA 1A0OA 2WHRA 3A26A 2O8NA 3IHLA 4FJ0A 3AUUA 1T0IA 3IE2A 4ITRC 3TOCA 4QUAA 4BB5A 3E35A 1OKKA 1Z4KA 2FPXA 4CLDA 4DEXA 4HV4A 4PN3A 1ZQ1A 3Q11A 1LTKA 4YRIA 2C00A 1KTIA 4GGMX 5ICSA 3THYA 1JEAA 3HSSA 3F49S 3FYUB 2DLNA 2PPVA 4XVHA 1M2WA 5FPTA 3UEOA 1WDMA 3A06A 5KWEA 5IDXA 1EDEA 2BDEA 2GKGA 1R8YA 2EC5A 2WU8A 1YE5A 1H22A 1JG6A 5IYRA 1WKCA 2AX3A 1YD7A 4QJ5A 4X0EA 5FRDA 3V1MA 4FZVA 1Q1EA 3I5MA 4GPEA 2GN9A 3BK1A 4Q1CA 5D5PA 4D56A 4F5EA 4NZNA 4L9WA 3RRNA 3WGQA 1FP4B 2JFHA 4CV0A 2JHAA 4H6XA 1Q50A 4YRNA 2A7XA 1OGJA 2I3AA 4BGDA 4CCWA 5IDWA 2R6R1 1N36B 2C94A 3EZNA 1P0MA 2Z1MA 4HP8A 5HTKA 4AZ3B 2ANBA 1YK0A 2XD4A 2N46A 4C0JA 4YLEA 2FG7C 2QN6A 2HB6A 3P2MA 4BQRA 1UWVA 4MW4A 2XMSA 3LCMA 1VA4A 1CVIA 3E4CA 1LBEA 3UF0A 3GPBA 3HO1A 4Q24A 1NUQA 5JAUA 1XKQA 4BLQA 2YWEA 1DZIA 1GQOA 2CFOA 4E07A 1X1AA 1ZN8A 3DHEA 2VNHA 2C83A 2OM6A 1OILA 3DLPX 4R1NA 5KQRA 1R15A 4I36A 4HQ6A 1FX0B 4AI6A 3DZCA 4XLFA 1Y1KE 2A6PA 2WRZA 3C8ZA 3N39C 3Q7RA 3QOFA 3RO7A 3RWMB 2QUIA 3VX3A 1X9HA 4AUNA 3OJWA 2WYUA 4NBUA 1ZO8A 4LSWA 4ENWA 1EFPB 2ZPTX 3D4PA 1L4GA 1OXSC 2E85A 3CNHA 5DN6A 3H7IA 1LDBA 4G9EA 4EO9A 1M1NA 4HGOA 2MT9A 1OFVA 2YTZA 4S35A 4B6GA 1JSCA 2F3QA 1P0FA 2YRXA 3BMNA 1MP0A 2ILTA 1NF9A 3U9LA 3ESXA 3HKEB 3T35A 3X1DA 3GVLA 4Z4YA 2X4DA 4C7XA 1KO7A 1U7UA 4AMYA 1H8HA 1X7ZA 3D0KA 4U00A 3ESBA 1T2UA 4P3PA 3D64A 1OLXA 5BSKA 1P4GA 3MTDA 1FNSA 2VCHA 1ZW6A 2L18A 4BO2A 2QENA 1Q6YA 1UQTA 1KI6B 2EIHA 4MB2A 1GPAA 1DL5A 2B3TA 4MYDA 2XMDA 2FFBA 4LMAA 4LI3X 3F0TA 2ZROA 1JU9A 4EA6A 3MPUA 3QLUC 3OU7A 1GZDA 2J08A 3FVQA 1H6DA 3Q88A 2CXOA 3MS7A 4G0MA 4ZZ2A 3R9IA 3VKWA 1FXSA 1N9GA 2X7JA 5AVUA 1I33A 2NSJA 3CSSA 3EEYA 4MQ5A 2OBLA 5DFAA 3EF3A 4WL0A 4C4TA 3DMFA 4YMUA 4GU5A 3AI2A 1O9BA 3FZNA 1EX1A 3TDKA 1QBGA 1O95D 1BXRB 1T3GA 4Q4HA 2X5NA 1Z74A 1YACA 2HJWA 1HDCA 3AT1A 3D0OA 2REBA 4FFVA 2JJ2D 3QJYA 1CJSA 3E23A 2PVPA 2PGJA 3KQOA 3C5EA 4P35A 5D51S 1CB7A 2QM8A 2EFJA 1TO2E 1WEHA 2E4ZA 3EA0A 2VBGA 2ZIAA 5JY6A 2HJRA 3OCXA 3F4LA 2Q3FA 2IDJA 4J1TC 1CFZA 4YX9A 2D54A 4MI6A 3ADKA 1IHXA 5GM2A 4NFSA 5E1MA 3ESCA 4JH0A 1Z6GA 3ENKA 1DQRA 4LFBB 3ANMA 2J6CA 2QW1A 4XB1A 3GLQA 3DT6A 2Q2WA 3AOGA 2GR9A 3OG9A 4J6EA 3WGIA 5CLLA 4LWPA 5J3JA 1GWNA 4ARSA 4Z4GA 1YASA 1LUAA 3A28A 4ME6A 1XZKA 3PKIA 1T2AA 3DQZA 4IIBA 4DB2A 1K27A 2CFSA 3TRFA 1FF9A 1Z2NX 1J24A 2ZRIA 2YW9A 5K3BA 5HQ3A 5F64A 2NYRA 3WRYC 4QNNA 1P1IA 5CBPA 4JC5A 3RVOA 4DV4B 1V8PA 1P1JA 1RRFA 4JI1B 4YV7A 1JEQB 3R2JA 3UXMA 2I6FA 1ESMA 4GFDA 4Q1VA 3E20A 2GLXA 3H0EA 4CQNA 5IFLA 1I1NA 1V9SA 1ZHHA 4GWKA 4IDOA 1YTUA 1RYYA 4DMCA 2QN3A 2ZJ2A 3B3AA 4RM2A 3UMRA 4F8EA 1W0JA 3V7NA 1X9GA 2EBWA 1UD5A 1NX6A 5A3RA 2XRZA 3DNMA 3F6BX 3V33A 4TRMA 2QP9X 3L84A 3Q3IA 1WQ1R 1T26A 2FV8A 2JH9A 3MM4A 3EGVA 3DDSA 3O4FA 1PW5A 5CMLA 4EL5A 1O0SA 4OFXA 4OJTA 3S68A 1N2CE 2ICAA 3DV2A 4LZLA 2A0WA 2ISQA 1SQFA 3RS7A 1K86A 3KKMA 5IHPA 2JZCA 3OURA 5LA6F 2UUCB 4RJLA 5FP0A 1FNMA 1EGHA 3AVYA 1WOYA 3ZWNA 1M2OB 4Z9AA 4F0JA 2CUZA 4DLSA 3QEJA 3EFEA 3MSXA 4FNAA 2IIVA 3RC9A 3IPXA 2DWOA 3WIBA 4YHBA 4NULA 3UV7A 5JC1A 3FMGA 1A2QA 4DDKA 5KWIA 3F2VA 4RHXA 4YT8A 1NFQA 2O2SA 4MW1A 1P4MA 5IYQA 2G9NA 3PWTA 3W2FA 3CYFA 1ZITA 3UANA 3A05A 3O3CA 1K9VF 1EUCA 1YKGA 3UOAB 5LQDA 2G0AA 2FFHA 3D7KA 4M89A 1M0TA 3OJFA 5ED0A 1OB2A 3E7FA 3PLAE 1KWKA 4R2JA 4BX0A 4WZAB 2K87A 1XPUA 4KDEA 1G21B 2ODPA 4I9UA 1E9BA 2DH5A 4MULA 3KCNA 1B4DA 3I76A 4HAIA 5U4QA 1Z28A 3AHDA 2PRIA 3WMXA 1E2GA 2X8WA 2YIDA 1GOTA 1OZ0A 1XZNA 1YR7A 1IUNA 4JR1A 3U4QA 1S8OA 4PGOA 1GQRA 1QYVA 4D8XA 1DAGA 4RF2A 6YASA 2IWHA 5JXGA 3MWGA 1VG9B 2FDRA 5ENZA 4DQ0A 3PT5A 2G4LA 4RFSB 1QZXA 4V0SA 1MTOA 3PNLA 5EN4A 3DOUA 1CT9A 4RSRA 5LA6A 3R4VA 1O9GA 1M6EX 2CYCA 3UJDA 2GCOB 3UTCA 3NHLA 2IY7A 2OZVA 4D9HA 5JDCC 4ARZA 2KBFA 1KJ9A 5J9FA 5K8VA 2IYTA 4BLPA 1ZCJA 3BPSA 4R8RA 2WC1A 2P41A 3SR3A 5JPDA 5DIZA 3I6BA 3L79A 1YS6A 3KYJB 3PUMA 4FR2A 5E9QA 4ND1A 4CLOB 1JT9A 2GAOA 3CX3A 4YPVA 4ZZ1A 2BBWA 1RHJA 3MMSA 4GH5A 2NGRA 5I4CA 1H2BA 3U7IA 3I8OA 2F55A 3RYTC 1U2ZA 4XLCA 1M2VB 1XZLA 3EVTA 5BNFA 3NS7A 5ESDA 4CM3A 4GM1A 3T5AA 3KKOA 2E6KA 4MWGA 3CSUA 4H15A 2IBTA 3ZWOA 4B48A 3EN0A 1QGYA 1REQA 1E32A 3HDTA 5AT1A 3N6XA 1EESA 3HI6A 4CV2A 2ZBDA 1P72A 3GA7A 1YQWA 4OX9B 2HTFA 1Y98A 2ZXIA 5CA0F 1N0VC 4JQZA 5FO0A 4CIXA 1QRRA 3FPBA 3MBKA 1J33A 1TYCA 5K0ZA 2FCAA 2MSDB 4KDCA 4NY1A 3H2HA 2O59A 4PCVA 1QGUB 1DTSA 1CUSA 2DHRA 3KZCA 2NUBA 1WX1A 3FCCA 4S1OA 5KTNA 3EC2A 2H9IA 2HPVA 4YCBA 3UHJA 2XWBF 3ZWAA 4EHIA 2FUKA 2G6BA 1EVIA 3C3PA 3VNSA 2O2ZA 1XMOB 3L77A 3IQXA 2Q9AA 4LZZA 4D9EA 2CHVA 2XUGA 1IULA 1M2KA 1Z5UA 1M0SA 4GI1A 4MKIA 1RXUA 1DC3A 1J7KA 2GZMA 5BQ3A 2ZJ1A 1VQLB 2EP8A 4W6QA 3TZCA 4K9NA 2X19A 2BFEB 1QTRA 3ELYA 1K1EA 4MVJD 4TSKA 2OV1A 5FL7D 4ZYZA 1YA6A 2BEUB 2HDHA 4QU0A 3F6YA 3MPOA 1N92A 4Z6KA 4UHHA 5JAQA 5I7UA 2X0KA 3EGWA 4B32A 2XYRA 3UNXA 4DNQA 1V41E 3RVRA 2HD4A 3LUBA 2YRWA 4R1PA 3M6VA 3QKIA 1OX4A 2J3KA 5KTTA 4Q9KA 4IUCS 3BHMA 3C3DA 2VT7A 3WNZA 3GVJA 4U7PB 1JHXA 4EJMA 2QIPA 1SC6A 2W93A 3AEUA 4ER7A 2W48A 4FD3A 5FBZA 5BW5A 4YJHB 5AVSA 3ZG6A 2JCVA 4Q02A 3LHSA 1A2KC 1L5VA 2ZZKA 5I7WA 1MV5A 1JQLB 5B7GA 3K1ZA 5H68A 2VA8A 4DA4A 5KNDH 4U3JB 3WQBA 1R7RA 4F3RA 4UOZA 4QXMA 3PDWA 1RSZA 1EZZA 1SCKA 1VB3A 2JGRA 2YIVX 4FYWA 2QN9A 4QHTA 4RY2A 4JNKA 3ZR4B 2V65A 3CEAA 5EE9A 3KLOA 2OA0A 2JLVA 1DBQA 1FE8A 1SQ6A 2FG6C 1BDHA 5DE3A 3KYCA 1JECA 1Q0LA 3G1WA 2HN9A 2QE6A 1YZ3A 2KW5A 4M4SA 1LDEA 1H8EA 1GIAA 3EJ6A 4G1UC 3VSCA 1HR0B 1D8TA 2QTVB 2G71A 4YJFA 2I1WA 3GJ5A 1BRTA 4G0PA 3TTUA 3CESA 1E0SA 5DHTA 2DGDA 4UJ3A 1ZISA 2I3ZA 1VCMA 2JJMA 3HA7A 3R7DA 3WKCA 1MV8A 5LOVF 3S8YA 1LK0A 1G4HA 3IQGX 3DEFA 4BC1A 1M0WA 3B6ZA 3PJFA 1KI2A 2C9BA 3G6EB 3KHTA 3PX2A 1FVXA 5DBGA 2IYEA 3KLPX 4DYHA 4JB3A 2XUAA 2CC2A 3A1WA 5FL3A 2UXBB 3UFBA 2J31A 1YJCA 2DFTA 3ENZA 5GV8A 1JFLA 1H6AA 1L7DA 2JS7A 5CTAA 3RBAA 3CT4A 4DDMA 5LZ2A 2V7QA 1Z73A 3CRNA 1YZFA 2G1JA 3Q7IA 2HEGA 1DIOB 2ASEA 4FC7A 4OGFA 4E2YA 2GZHA 1HH4A 3LLCA 1IZ8A 1P62B 4C7OB 2XF2A 1SVOA 4BFZA 3AFNA 2ECOA 4RVNA 4F86A 4JBGA 2BEWB 3LXRA 1CZLA 1K28D 1VHLA 2JCSA 2V4ZA 2EF1A 5TS2A 5DM60 5I4KA 2QGZA 1Q0ZA 1DEKA 1PSWA 3GJ4A 4I55B 4ENVA 1Z47A 3BY2A 3N76A 3HXLA 4BNHA 1E3JA 1V0FA 5K6TA 5KYYB 3KPYA 1YHZA 2GESA 1TCBA 5IAGA 5LXTF 3TQCA 4LJ6A 4O2RA 5KI6A 5K8UA 3FMIA 4HUJA 3VR4A 4UD6A 1CHNA 1GA4A 3F3KA 3H83A 3IH5A 5KBYA 3HUFA 1U5CA 1M3SA 2B2CA 4EJ6A 5TMEA 4D5EA 3QKRA 4KQWA 3DFZA 1K73D 4FB5A 3SXUA 5B3AA 1SCUB 3RK1A 5LOVA 1EDBA 2FPPA 3AF6A 4PVDA 1EWVA 1LS6A 1M34B 3ANXA 5LMCA 2ZTSA 4XWAA 2DR0A 2Z4SA 3M0EA 1LSSA 4S1NA 3ZDXB 2I62A 4Q1DA 5MF6A 2DLDA 1TA9A 4XARA 3W78A 4AIRA 4OKIA 4OXKA 4YRRA 4HNVA 1V4VA 5AW5A 2D7CA 4WKCA 2OWEA 2QMEA 3QW4B 5CAEA 2H07A 2E9SA 3ROGA 1LA2A 1AF7A 1E1YA 2EKPA 2R1ZA 4P92A 1N3BA 4PV7A 5B4TA 2VS1A 2HCTA 4CKZA 3SZGA 1JAHA 1FBTA 1E2KA 1FVHA 1HT2E 2CJXA 4D8TA 4ZRMA 1DKUA 2WZNA 2O3RA 1SUFA 2PVSA 1G63A 2CNNA 2FMTA 5AXAA 5TQVA 3V7AA 2OHOA 2X8BA 3L8ZA 2Y0EA 1RW4A 5FLXA 3KYBA 4TT8A 4IFTA 5LXTA 1P4HA 4MRMA 1J2JA 2W2VA 3I64A 3OX2A 2HZBA 2R84A 2Q5EA 5DYNA 2W5UA 3AGPA 4MW6A 1ZM4A 4IQFA 2VBTA 3K1AA 3ZXUB 1XHFA 5KVVA 3VHXB 2WU0A 2CLDX 1PGJA 4PO9A 4UFOA 4PYJA 2G77B 4M1ZA 3MS4A 4NCHA 1ZMRA 5EHNA 4AJLA 5JBNA 3IKTA 4HEJA 1N5IA 1MAAA 1P3DA 4PWZA 5ESXA 3GLFA 4N76A 1M1KD 1V8OA 4EGJA 4KPUB 3O8CA 5KHLB 4LF5B 2OQ2A 4B3RB 4U1RA 3I2FA 2QTCA 1SKBA 1AZTA 3H5LA 4EB0A 1PF7E 3BZWA 3D6UA 5JCOC 1QFYA 2ZSJA 3WNVA 4KMRA 2QRKA 1THGA 3BD8A 1UJNA 3P9PA 5H83A 1RCFA 2I55A 4RD4A 3QK7A 5L7YA 3U4AA 1ST3A 1EG2A 4H08A 1MAWA 2FFQA 2AN1A 3NTRA 4PYQA 3VOSA 3X1JA 4AO8A 5K0SA 4QREA 3LGAA 4ZOCA 3KELA 2RGDA 1S8AA 4GYKA 4TV8F 1CXZA 2H5IA 3RTCA 4O2BF 4KOAA 3ZIDA 3RVPA 2F3SA 5SV2A 3OU2A 3DHNA 3GVHA 1NVTA 3R6TA 4IV0A 1MO6A 5FBLB 5L40A 4X94A 1WQ3A 2ORIA 4G4GA 3G13A 5DK6A 3WOHA 1IJKA 2QZJA 4N01A 1GZ4A 1OBCA 2QE7D 3H2YA 1ULSA 1ZX1A 1N6PA 5EMHA 1QYDA 5G02A 4BNXA 1FYDA 3TZKA 4BLWA 1JLSA 3A9RA 4UHKA 3AETB 2ZTNA 3KPWA 1J0BA 3DZBA 3JQ9C 5CD1A 4U02A 5LLDA 1XDDA 5B2FA 3W6ZA 2VDVE 1NT4A 4XE5A 3ZDEA 2PUCA 1S89A 1KVRA 3I8XA 2DFKB 2FXIA 3CCEB 3R5HA 4QVIA 1IIBA 3L6UA 1QV6A 4XIGS 3FUVA 4WESA 3DAFA 4G24A 4V0NA 2BM0A 4N03A 1CUEA 1I14A 4WHMA 4FMPA 2FJPA 3GC6A 4OJQA 4TMKA 4HEA1 2EWMA 4H1VA 4Q7EA 4CM8B 1RI4A 3V4LA 4KWEA 3S1LA 1CJVC 4WZEA 1EQUA 2D1TA 3KQPA 4RADA 1DCMA 3MOIA 5G0WA 5BSUA 4E09A 2VDMB 3P2KA 1MXHA 2PUEA 1DU4A 2Y1XA 4RANA 1PCXA 2VHJA 4DDWA 1DQPA 4ILKA 4EB6A 3TXXA 4TV8A 1ZGZA 4ZDWA 4O2BA 1Z22A 4O4LF 5AW4A 1ORDA 2NZVG 2O7RA 3G8BA 4WD3A 4ZHSA 2VJDA 2WD7A 3SEAA 5A0TA 2INGX 1MABB 2VJMA 2QVGA 3H3XA 1AQYA 3GJYA 5HF9A 3SNHA 3T5BA 4A73A 5KTRA 1YFZA 2IUTA 2DKOA 3BBLA 5IFKA 2ZXUA 3A1EA 3MWDA 3DE5X 2YFYA 1PJTA 4J6FA 5CR9A 3LP8A 4FJ2A 2P9YA 4J9UE 4KYIB 4G6ZA 2D74A 3H5TA 1YZKA 4UMEA 1NSFA 1V8FA 1Z7WA 1TW2A 2ST1A 1YMQA 5EJAA 3F6CA 3MXTA 1YJ5A 1II0A 3HQ4O 4G2NA 1J0DA 2BHRA 3NHYA 4EUFA 4IDEA 3IQHX 1DXOA 4JVMA 1DB3A 4OOXA 3SYMA 4GXRA 4XIIA 3CUVA 1X7GA 2QVCA 4E2XA 4FR0A 2W83A 3PGMA 3M9WA 3OY7A 3TZQA 3ZXSA 2FEMA 5ELLA 4ZJZA 2DETA 1OXUA 4MQLA 2WM8A 3E22A 3Q2OA 1KP3A 4PG6A 2R8YA 3GDOA 5I9NA 3S2EA 1C9MA 1GGJA 2YDYA 5CXUA 1MMFB 5AM3A 1DCKA 3M4JA 4YRDA 1Z6AA 1U4SA 4UXIA 4RQAA 4WOPA 1FU8A 3S27A 4IGKA 4QVAA 1CU1A 3EWAA 3WQSB 1LVUA 4O4LA 3RRMA 2NYAA 5JD3A 5K6AA 5AI8A 4CQLA 4JKIA 1S7GA 4D9MA 3QIAA 1OI4A 1N0UA 3GVCA 4GOMD 4IR7A 4R69A 1X39A 4Z8YA 1HNXB 3OWXA 3WBFA 4XQGA 1PGPA 3ENNA 4JOBA 1GLGA 1GSIA 4KWIA 4EBFA 5BN3A 1OPRA 3BF8A 4KXQA 2WNSA 3N7UA 2X1VA 1U0BB 2Z30A 3TGLA 1YRLA 1B2LA 4RGQA 2BGTA 1A8IA 4LMRA 3I23A 3WB0A 3E1GA 4HK4A 4TTPA 3ZV3A 3H5RA 3Q72A 3H42B 1L5LA 1RPAA 1RRVA 1TQHA 4QLBA 3D6HA 2R2GA 1A96A 2HK7A 4B4OA 3I3SR 2BZGA 1D2HA 1CLEA 3CZQA 2XE8A 2AFVA 2AMFA 1DBWA 1JIKA 4MAMA 5KKNB 4X1YB 4OJNA 2QRVB 1H2EA 2YZNA 3FOCA 5AYVA 3WLJA 3D6NB 4AF6A 4P31A 5EJEA 1OSNA 2XRYA 2ZI3A 4YALA 4M1MA 1S9HA 3QTBA 3K31A 1BHO1 1K8QA 1SPXA 2C7GA 2P9HA 1NP7A 4RA6A 4S0XA 4X84A 5J43A 5SZJA 4ARUA 1MJFA 1V35A 1R37A 4AROA 3FI0A 4QXAA 1KQPA 2Y1CA 1GPBA 1RI2A 3OZIA 4OQQA 1RJEA 4JR0A 2I8LA 5C1DA 2RJNA 3EFHA 3HXKA 3AP2A 4IEEA 1DQZA 2ZJFA 3LFTA 4JROA 4I4CA 4RZUA 3ZTWA 1R5NA 4N6OA 1VRCA 4QPCA 5DXAA 2FMUA 2GBLC 2A58A 1ZC3A 2FG5A 2ZK7A 3W3AD 4FQ5A 4G4JA 3B9BA 1SVWA 3WV5A 1A9QA 1JDBC 4X05A 1M1XB 5HQTA 4AQYB 3MGCA 2FKNA 1C29B 2QA4B 4MPDA 1A50B 4MUYA 1NBIA 2ZB4A 1ZNWA 3PXEA 4F5YA 5C5CA 4PYNA 3ACCA 3B85A 5F33A 3VU3A 4X91A 4JUDX 2YOHA 3ET5A 2O3SA 1EGMB 3TUJC 3PNOA 1LTQA 4XJSA 2Q6KA 1ZUIA 4PXYA 2WJYA 4OPOA 3NHPA 4P33A 4MVJP 3T9BA 1Z08A 4R2HA 2IYAA 2V4MA 1VQKB 4KUGA 3TJRA 4HN2A 1NJ6A 3KUXA 1NRJB 2H4ZA 3L46A 5LIRA 1OH5A 1T13A 2BGRA 4HQOA 5EPOA 2I6QA 4KQCA 3TOVA 4U2CA 1W44A 5FKJA 3ZBUA 2FP4B 1U9IC 1KJIA 1VQ9B 2QYTA 3GGDA 4EB8A 1ECBA 1FB5A 3D3WB 4KQ9A 1WD5A 3WC4A 3RB8A 3KETA 1PKXA 4TMZA 2ZYHA 1V4NA 1HDEA 1N06A 1TT5B 3KSZO 2JI8A 2O8EB 2O0HA 4Z7QB 1JI0A 4HX5A 2ZR0A 2EFHB 5FULA 1VECA 1IZ0A 5ALGA 4KK4A 4BIIA 4E5UA 4HPXB 1SKQA 1BEEA 1II9A 1ZSYA 2DBVO 2FUCA 2HQOA 1M2EA 3DTVA 4G2TA 4ZVTA 3RV4A 2FY8A 2P77A 4E08A 2D5AA 1GDDA 4W8HA 1UMDB 4WN3A 2RAPA 2O5VA 2MINA 1FUUA 2PS3A 3FUCA 2AI2A 2ETVA 2ZUCA 2QEXB 3J81k 3QH4A 5CIQA 1MZPA 3BBPA 3AONB 2QNBA 4O0LA 4C0HA 4DG9A 3NNNA 2OILA 2Q49A 1T8WA 4Q34A 5C1BA 3PX7A 4YR9A 1WB9A 1GQ2A 3FVWA 3BY1A 2X7XA 3B2QA 4WQMA 1PU2A 3ORHA 2NNWB 3CUYA 1AGYA 1OTHA 3OQIA 3LOPA 4P1ZA 3TW0A 4KGZA 3HBFA 3LCUA 4QIHA 5KKAA 1R8QA 2IHNA 1KJ8A 3PXAA 1DC5A 1E1NA 3L0OA 3V4SA 1BG6A 3NVAA 3IP8A 1KBQA 4BVBA 3KG2A 4ESHA 3IVCA 2BGMA 4FN4A 4ALIA 3OJOA 3EMBA 4MPRA 3QU2A 5TEWA 3T6KA 3C3MA 5BSHA 1JJAA 2FPLA 3ANLA 4NECA 1BYIA 4ZYWA 1N2XA 4IH1A 2HJVA 4AY4A 5KDOA 2O50A 1AIPA 2ZJBA 4LXHA 3VKGA 4MR9B 1NXVA 1RIIA 3SSOA 1B2RA 3U1VA 4PG4A 1GG9A 1Z2PX 2C2ZA 3U3MA 4CLXA 3R74A 3GGSA 1W19A 3GUYA 4DLYA 4GP6A 5K4AA 1IMJA 1YKFA 2BWJA 1KFJB 5H16A 4EI8A 2QA5A 2XOKA 1PNVA 4YQZA 1QHHA 1BGWA 2HMVA 5CEJA 1O2DA 1IWBB 3FPCA 3LY7A 5BN1A 1ULBA 3IHTA 1ZU4A 4YP6A 4AP9A 1L8XA 2E4AA 2HCBA 2GYWA 1XTBA 2W43A 2ZTVA 1XVIA 2R79A 3DZKA 4IDGA 2BFAA 1PQPA 4RK6A 5B36A 4US2R 4GQIA 2CHGA 3HY4A 1R4NB 1Z6PA 4M38A 4J1NA 4OUDB 5ECWA 4BKUA 3EXFB 3NCTA 1ZRSA 4YQFA 2IVFA 4DA0A 3V4ZA 3NHFA 4ITVA 1CY7A 2NTJA 3KXIA 1ODLA 3N2NA 1SBZA 2VRCA 3WNBA 1QR2A 4YELA 1PZGA 1ZXXA 2HGSA 2Y27A 3RTDA 1L5FA 4JEHA 1SBHA 5CYGA 4QM7A 1OB5A 3H9UA 4K9LA 2F3PA 4ZN6A 3TINA 3ROXA 1V1MA 2P35A 3WI7A 2DH6A 3PSHA 2CBZA 9LDBA 5CUQA 2YN2A 4MUBA 1H66A 3SX4A 2EARA 2JLWA 4KSBA 3F96A 1U2TA 1JJBA 4LDRA 5KDLA 2LE0A 1ECPA 2XYPA 3NVMB 3RUAA 3MFQA 2Y66A 4WA8A 2RAFA 3DD1A 3LG2A 1Z26A 3PQ4A 3AFOA 4ER6A 4L16A 2P40A 1INLA 3DB2A 3WGUA 5E3IA 2Q7DA 2KHZA 4OHUA 2YZKA 4XOTA 3LLSA 1HI9A 1EX9A 1XVLA 1H65A 4LWQA 3IFSA 4L5IA 2ZZMA 1P0PA 4FMCB 4MHTA 2RGNC 3EVCA 1CS0B 3FNRA 4CCAA 2YYSA 5IKEA 4UNPA 2C9CA 4FW9A 4HVTA 4YAJA 2BEJA 4QFBA 4HJRA 1N32B 2IS4A 4J2OA 3IOEA 3MT8A 3I4CA 3CCMB 2CL7X 2PKQO 1J70A 4R98A 3ZX5A 4WSOA 4J94A 1JR4A 4N40A 3PEFA 4QOHA 3PP8A 4DG8A 3WMRA 2HLDD 3IUSA 4UEKA 1P9LA 1NKSA 3T4EA 1SCJA 4QOFA 4CCSA 1S4QA 4UARA 4CU5A 3UMSA 1BIFA 1V7CA 5IJWA 3LT2A 5HK8A 5GM1A 4Z2YA 2BISA 5IJAA 4KV7A 2PGDA 3IMFA 3EIWA 4KIJA 5LYYA 1ULUA 2HHLA 4L8JA 4F4IA 1JVSA 2WUEA 1TU0A 1TYDE 2RJ3A 5J47A 1WD7A 1OA1A 1XEWY 2RHHA 4JLAA 5FI0B 4YRZA 2TMDA 3ZU5A 4WX2B 1JILA 4UBOA 3DGEC 1MLDA 1YR3A 3K0HA 2Q5HA 1DMSA 5FJIA 4RKFA 3L1IA 4JYCA 5L3SB 4JP8A 2FEXA 5KZMB 4JLPA 3FMFA 3MK31 1EUQA 2IHYA 3I2IA 4BFXA 2IP2A 2WJZB 4LHWA 3AUJB 3M9LA 1SC4A 4KO3S 3CVXA 3KK0A 1U8UA 1USGA 3I2KA 4OIFA 4PPFA 2ERXA 2E37A 1WP6A 4I3FA 5KMGB 1PEDA 3BUSA 1L7NA 1JW9B 3HN6A 2AEMA 3KXDA 2AKYA 3MT9A 3O75A 4QRIA 3R9WA 1D7OA 4WT7A 4NXNB 4B3BA 1IN5A 3I9NA 4UE2A 5EHQA 1LB1B 3TB4A 3KBOA 1XLVA 4BC0A 2D3TA 4RAOA 2C4MA 2VWHA 2J0VA 4XFDA 5CVEA 3RHFA 3F47A 3L9WA 4V39A 4HZUB 1HGXA 3ILHA 3QPAA 4L28A 4AG5A 2Q3DA 3T5MA 1M2FA 2QAIA 3CLKA 3KTOA 1EFRA 4B47A 2HLPA 2V59A 1NVUQ 2XZTA 4OJKA 5TQ0A 4KAFA 2IV2X 4B83A 1UZLA 1ENZA 2X9GA 2WKWA 5I8PA 3LHDA 1SZPA 2PVCA 4PBTA 2V54A 4NBRA 1M6WA 4HLQB 2ONCA 2CL0X 1YDMA 4XLLA 3LQKA 4MSUA 1O96A 4DQVA 1VE6A 3NTUA 1XWFA 2ZIXA 3GDFA 5K3DA 2CT8A 1LLUA 4I14A 4O8ZA 3ZI0A 5CT8A 1GUYA 1RPNA 4H4EA 4JKOA 4IVPA 3WAGA 2WWFA 1Z8FA 3AEQA 4WY2A 1D4FA 3NOXA 3GEHA 3O8OA 3P20A 3WK4A 3WLPA 2VJNA 4GQAA 1YCFA 1Z8HA 3ETLA 3F8TA 3FA2A 4OQZA 1PTJA 4NQRA 4GG1A 2MWMA 3V7YA 1PBNA 3W5BA 1D9XA 4V3CA 4BP9A 3E5HA 4NI5A 1QVRA 3EGDA 4OCZA 5JI2E 1RP7A 4LI0A 3F7NA 1ZM7A 4GUDA 1E7WA 4MYUA 1JHRA 4HOYA 4LCJA 1XALA 4PIVA 4U2KA 3ZQUA 2IH4A 1MB3A 5BVHB 5FO1A 4ALJA 3SLNA 3IEKA 4LSGA 2BR4A 4AMUA 3TVTA 5CDTA 5G1PA 4C4XA 2ZITA 2RHLA 1GTMA 4EVQA 1HY3A 2QX4A 3GJ3A 5DASA 2HXYA 4LMBA 4PINA 4LYEA 2AJ8A 1E92A 4MPTA 4BVEA 1TGYA 3GLVA 2WKPA 3CCRB 1K66A 4M8SA 1X9IA 3V2GA 1QO0A 2D2VA 2NU9A 1GNSA 2OBXA 3KJEA 3O1LA 4J49A 1IUKA 4R2KA 2ZE6A 3JYHA 4CHGA 1TM3E 4JOCA 4D97A 4NCIA 2E89A 3ORQA 3RYIA 2QZ9A 5AKLA 1DXQA 2P4HX 2PL5A 3NVDA 4MQUA 5JT1A 4B3JA 3H84A 3VNVA 5K45A 1CR0A 2KB0A 1DX4A 1OLOA 1PW7A 4KL8S 4UD2A 3NO4A 2V98A 3DKRA 4ZU6X 5TC4A 4QYSA 3OTWA 4IGIA 1UCFA 2GPSA 1UMBB 4IRMA 4ODIA 3IERA 1O95A 3DUFB 4LA4A 4X8LA 3PYLA 5DLYA 3X3HA 2VJPA 4DTIA 5G53C 5C4IA 5GZ1A 3KUDA 2NLOA 2CJWA 3KJHA 5DMXA 5FI1B 3FR8A 3NEJA 3R7AA 5D3QA 3G8AA 1LSOA 2JIRA 3AQ4A 3BXXA 1YQ9A 4URUR 4B31A 4YAUA 1H2AS 3KB8A 4BBPA 1BE8A 1O6FA 1XDGA 4MR8B 4NDZA 1BEUB 3GWGA 4Y6GB 3O4IA 3MD0A 1JLMA 4E4TA 4RVDA 4C3UA 3ESZA 4BE4A 5LCXA 3DKPA 2J3QA 4HLUC 1ZSNA 1SGWA 2ZDHA 5H9VA 4BKMA 3QF7A 3H2ZA 4FBLA 2WT9A 2BI7A 4DCUA 5TVGA 3EG9B 3Q0TA 3X2EA 1Y8RB 2OHIA 4CDMA 5HKKD 3HGQA 1G8AA 3UUEA 4EHKA 1FFDA 2F1LA 4YJ2B 1CJCA 3V4FA 5HR5A 3TLGB 3T9FA 5I01A 1ZLYA 3LT0A 3BJMA 4I4TB 4UBLA 5EHGA 4D4IA 5IASA 1H93A 3MUNA 2CNBA 1GKLA 3RYCA 3PD7A 2CLLB 2JK0A 3FSJX 2HZ7A 3LX4A 4B7ZA 5DYIA 2QRGA 1ZVJA 5KYNA 4XONA 2B8NA 2W6ID 5LL6P 3GW8A 2P6RA 3PENA 2VJOA 1WPGA 3UJ6A 1U2DA 1RI3A 3C85A 1UPCA 4GF5A 3VR0A 3FNIA 4ETMA 2G4VA 1ECCA 1KH2A 2VJQA 1CHDA 3OPOA 3KWLA 2IW1A 3P4YA 2GCNA 5TE9A 1T10A 4F2PA 3DO6A 3A9TA 2ZRFA 1JJ2B 1B15A 3NP9A 1HOXA 3W7BA 2DBQA 1YI2B 4NX2A 2ZPUA 3H6HA 4O4IF 1KYTA 1KI4A 1TPYA 4U2GA 1QKKA 2R4TA 2JAWA 3EZGA 2XZOA 3HE3A 1YK1A 4GSYA 4MRVA 4PLYA 5HZHA 5BR4A 1WV0A 2J48A 2QL6A 5I9LA 3RSCA 3J81A 3NGLA 1T36B 1Q1ZA 3A25A 2O6HA 1H2YA 3EULA 4PZEA 3AJ8A