2V7TA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosyl-l-homocysteine and chloride ion
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 76
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7tA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7tA01
2Q6IA 2CBXA 2CW5A 5FIUA 2C4TA 5B6IA 2ZBUA 2F4NA 2V7UA 5LMZA 2Q6KA 2Q6LA 4CQJA 2ZBVA 2C4UA 2V7VA 2Q6OA 2C5BA 2V7TA 1RQPA 1WU8A 1RQRA 2CC2A 2WR8A 2V7WA 2V7XA 2C2WA 2C5HA
chains in the Genus database with same CATH superfamily
4LSWA 5FNVA 3KVOA 3LHFA 5C18A 3IEPA 4YI5A 1GG2A 3OO0A 5H4HA 4Q37A 2BCJQ 4M87A 1RM4A 3ASSA 1NVBA 1O95C 2C5GA 3DEJA 2XW6A 3QXGA 5A2GA 3HVRA 1FSZA 3ACBA 1GU0A 5BSWA 2IOHA 3ET5A 2XIJA 2OUIA 2Z08A 3IQWA 2JA2A 3UA4A 4YRRA 3Q7RA 3KZOA 3LUFA 2AZ4A 4MVJF 4B6GA 4EHLA 2JI7A 4QBKA 5AW8A 1FZTA 1UAYA 2J6CA 2VJBA 1UQRA 1IY9A 3NH9A 4NFLA 4RHXA 4JBWA 3C3BA 1CSEE 2D3TA 2Q27A 1YTLA 4JFRA 5HZBA 4HD8A 4N0QA 1ZHHA 1W87A 4YIKA 3V4OA 4Q15A 5ABPA 2QUHA 3WQQA 2O9JA 4JL6A 2OZLA 3WIEA 4L28A 1HWYA 3CPSA 4YXWA 5AHKA 1OAAA 2XMQA 1E77A 1JLSA 2C4MA 3OJWA 2G0AA 4G3XA 3U4MA 1G20E 1A95A 1LFDB 2PO7A 4ZQCB 4ENQA 1Q7TA 1K92A 5JQWA 2Q6TA 2X4IA 4LOHA 4NDAA 1A7KA 4EYGA 2XEDA 4BXOA 3D0KA 2BSAA 1QAQA 3BRQA 3MBKA 2PCJA 2OD7A 2WHQA 3M83A 3VSCA 4B79A 4MW0A 5A0TA 4ZYYA 2ZZKA 5AW7A 4JI0B 2B9VA 1FUIA 2VBIA 2IP2A 3M4XA 1FTSA 4R5HA 1Q19A 1ABFA 3HCWA 4RVNA 3TQRA 2ODQA 4NNOA 4FONA 5L45A 3KQKA 3BAFA 2VJJA 2PRKA 1H23A 4KO1S 2XB6A 1R5JA 5A02A 5J35A 2X1VA 3GLHE 3BZWA 4FMCF 4ISBA 4JLJA 3W1WA 4A03A 3AERB 1EG2A 2FX5A 2J7PD 3FY4A 3OPVA 1NVVR 4XR6A 3B6KA 4WWVA 1CQPA 4KBFA 5FOXA 5EIXA 4R6XA 1Z26A 3UWOA 4IQGA 3AY6A 4WBXC 2AOTA 2ZR8A 2YY6A 1SG0A 3KB8A 3QIAA 1U31A 2HLDD 3Q2OA 2GYYA 4GR5A 1QZXA 4NOMA 5K3OA 2IH2A 2DAPA 2IJGX 3L7CA 3TSZA 1W85A 2J46A 4DADA 1UJ5A 2OENG 4BL5A 5ICEA 2Q6KA 1KVUA 2UZIR 1LNSA 2R4UA 3PICA 4JLSA 5B7NA 4LXYA 3FCXA 3OE1A 4JH0A 1BD3A 2X7HA 3AVVA 2IYPA 2JIQA 1SY7A 1X3LA 3EDMA 2O2CA 3GCXA 5T4EA 3WLFA 5HKOA 2ZRAA 3EWNA 2BKLA 4XN0A 1QFSA 3G1UA 3K5IA 4J4HA 4YQEA 4NCBA 1B93A 3K9GA 1IDN1 2COKA 2H0QA 2V74B 1CRWG 1T15A 1NP3A 1Y1KE 1A8SA 3FAKA 5EP3A 4EK9A 2UXBB 4F9TA 4KPFC 3B78A 3DEKA 2R97A 1H8EA 3PDIA 3R5HA 1RZRA 1YUMA 3MERA 4OMDA 3FTCA 3E9CA 1E3ZA 2A86A 3HFGA 4JYZA 4EVIA 5EZYA 3KQLA 3RFXA 4QU9A 1Q1EA 4RQBA 1KRWA 2E4AA 3LDHA 1IM8A 1PZEA 4AXXA 4DTCA 5KMGA 4OLJA 3NX4A 3PHGA 2QZSA 5CA1B 2G5TA 3Q8KA 3ZWWA 2E4YA 2P4UA 1ODCA 2IHTA 1WP4A 5FADA 5HIJA 4F4FA 1W73A 1RQRA 1OLOA 4J2OA 2ACEA 3ESAA 3RHTA 4HP8A 2IPXA 3O03A 4YCDA 1JG6A 5HUHA 5DM1A 1KQGA 3JWHA 3RAJA 2BFNA 4CV0A 1VA5A 3I2IA 1HMPA 1RPTA 2HMWA 3L8YA 1BCSB 4JI2B 1XC7A 4OHCA 4IKOA 1G0NA 3P97A 4Q6BA 3I39X 4KAFA 3COZA 4BQRA 1QX3A 3IS3A 3BXOA 2FFBA 1CR4A 1JYEA 1N2BA 3KSZO 1SBCA 3BZBA 3RJTA 3UT0A 1JDBC 1JHQA 4HNRA 5DTMA 1E3WB 3F67A 3RC7A 5GM2A 1P91A 3W5CA 4C7OB 2DSNA 4JKIA 4H4CA 1OH5A 3IFSA 2RCYA 4WNIA 1CJSA 3RBZA 2CZCA 1UFOA 3IVXA 4LWOA 5AICA 3NC4A 4DTIA 1PZNA 3L41A 5K1ZA 5GJWC 5L7YA 2WP8J 4QHYA 3IIEA 1EM8B 4JI3B 3C3EA 3L5OA 2XTNA 1WDLA 5KVSA 1GSIA 4NAVA 3R7LA 2JFQA 2J07A 2VWPA 4GKJB 2O8CB 4BE9A 2MHCA 3CMMA 2A58A 4MEBA 2IDMA 3OQOA 4N40A 2IGTA 1YRHA 2JFFA 2WKRA 3NWEA 3WWEA 2HRQA 4BLSA 1O94C 4KXFB 5H80A 3JASA 4LF6B 3GGCA 3SBXA 2JBAB 2AW5A 3DCIA 1A8QA 4WNYA 3ISXA 1XA0A 4DIBA 2PL5A 4ARUA 4RVUA 4Y2JA 2FMFA 1NXXA 3ZGZA 2XH8A 1VSTA 3CYFA 1CY2A 3FYUC 4MR9B 1XK6A 2NUTA 4BWFB 2ZTSA 3EIFA 5L6MB 5DSTA 1Y4AE 3ZQ6A 2PA0A 3SP1A 3G2KA 4DCTA 1NRIA 4JYCA 5I9BA 3WHLA 1WV0A 2Q4DA 3LKDA 3O75A 1RXYA 1Q2XA 1X1TA 4TKZA 3RTAA 4EIWA 2C4KA 4MRVA 3LLUA 1VI5A 2H2IA 2I1LA 1NURA 4X1KA 1DKQA 1GT91 1H4VB 1YIDA 4A0GA 5JS7A 3WA7A 3ESDA 1JMKC 2E82A 1CDOA 3FVRA 1WW8A 4H2DA 4MW9A 4UKDA 2P6OA 4URUR 5D00A 1AJEA 3DTVB 3UPTA 4BYGA 4MX8A 1NZJA 2ID9A 4B4UA 4KRXA 2ZRGA 5E7JA 2DGDA 6GPBA 3A6EA 4LV5B 1J23A 2R2AA 2FPIA 3NUQA 3K9LA 4W1PA 2DUUA 2GN1A 1YX2A 1E5XA 2TMKA 4GSLA 4LRWA 3GAZA 3AR4A 3KXIA 3P0IA 1WKBA 1C2TA 3JALB 1YB1A 2XKJE 1E0SA 1JXOA 3CNNA 2F3UA 4K6OA 1J5XA 3S5UA 1RE0A 2A0YA 4F56A 1DAOA 2HLNA 4HEQA 2BH2A 3W4JA 1VQPB 1AZSC 1T9ZA 3OCXA 2FK8A 1F6WA 1FE8A 3SZLA 3IMKA 2OBFA 5BWNA 4OHVA 1W2BB 2V54A 1M2OA 3UFXB 3N2IA 2D0IA 3DPIA 1DBQA 2YWDA 3WDMA 1AQJA 2ZTNA 3S2UA 1U3TA 4V3BA 2DT5A 3AL3A 1YK0A 4QYSA 4JMPA 4YP9A 4ZCRA 4PIPA 5EA2A 4RLQA 4RZ2A 2YXDA 3MVEA 2A0KA 3RVQA 3S1LA 3THYB 3DFUA 1FP2A 5U4XA 3Q7PA 4MMXB 1XEXA 4KIWA 1QB7A 2JD0A 2PGDA 5CDTA 4MI9A 1T5DX 1YE8A 4FPXA 4YCCA 2YXEA 3I30X 4KKUA 2V7WA 1F8FA 2IEZA 2UAGA 4Y2HA 3UXEA 3AIMA 3FCOA 4ALNA 3DFZA 4M6WA 4WEQA 4ZCTA 4M7PA 4NE7A 2JJMA 3T99A 4YJFB 4DNXA 3DYBA 4N0PA 1D8TA 2ZSHA 4MITA 2YWGA 4MPTA 4YRQA 4H9GA 4FKBA 3FNRA 1YBHA 1NW7A 4K46A 3TW6A 2FG7C 4BMPB 5TSDA 4BQQA 4K87A 1QJ4A 3LPCA 1MABA 3KHSA 3RHZA 2J0EA 2GPAA 2OCLA 3RH0A 4C3OB 1BE6A 3CLVA 3SAJA 5IVPA 4OSEA 3GV0A 3U4IA 4XYBA 2EDCA 3DHWC 1D1SA 3QWIA 3CZRA 1GUDA 4ERNA 4B85A 4JLOA 1LSJA 2I9KA 2IHVA 3NGMA 3ORHA 4MV1A 1XZAA 4C04A 4M0DA 2X7JA 2NZ8A 1DEXA 2GZ1A 1P9RA 2WSBA 1GILA 3OAAA 2A0WA 2H5JA 2WJIA 3DJFA 4AT1A 1PT7A 4C4AA 3RVLA 2WD9A 1M54A 2W70A 5FDFA 1T9GS 3LNCA 5IN4A 1T9GR 5CFLA 1FYFA 3GUYA 2RGXA 2QAIA 4AECA 1VBFA 3EARA 1UZUA 3D6HA 3L0ZA 4KN8A 3W4KA 2IODA 2XA1A 1D0IA 1T9KA 5HE8A 1ZCJA 4CM9A 4YYZA 3I2GA 3O7MA 4YRBA 6Q21A 5FOWA 1H85A 1N2CA 1T1GA 3DBRA 4PFSA 2CD7A 1K5GA 5AOBA 1KERA 3C3MA 4RF4A 3BHMA 1GY8A 3P9RA 1FSPA 2Y77A 5HF9A 1MBZA 4DA7A 5JIBA 3IR5A 1ADYA 5LXTA 2E9SA 1G9XA 4EI8A 2QNRA 3ITKA 3RYFA 3O4GA 4KVGA 4II3A 1UZNA 3ANNA 2I29A 1IK6A 1A71A 3H1PA 3KWMA 4JNKA 4QSHA 3WGYA 2GRAA 4XIJA 5FWXB 2QUKA 4JJKA 3K1AA 1U5CA 1VPDA 3JVVA 1J7JA 3M9LA 4H0NA 4LUCA 5CA0A 3LV8A 3WGVA 4BUJA 4CMEA 2PUGA 3OJXA 1JEEA 3E0QA 1O5OA 1QQTA 4PSDA 3PC8A 1ANKA 2BFMA 5H0IA 3FUCA 1GR0A 4GQNA 3QWFA 4H7PA 3PL1A 2JW5A 4NCXA 3CW9A 3TIFA 5I47A 5JROA 3FWPA 1B15A 4QFMA 1FXWA 1WVGA 1P5FA 3AHJA 1G5HA 2ZTGA 2B92A 2JLVA 1DAGA 4G8DA 5SV2A 4D25A 4KRFA 4WJZA 3I12A 4OJQA 4CEHB 1P1IA 1U65A 4P80A 3NWPA 4RETA 1RLMA 3N74A 5IN5A 2AXPA 3KEGA 4LISA 4HZUB 2UVQA 1MORA 2PKRA 3HRHA 3NIFB 5REQA 4YMIA 3ZOKA 2K2QB 4MDFA 4UHFA 2V03A 3HXQA 4PAAA 1N2CE 2ZCJA 1HTBA 4IP0A 1M8KA 4AJOA 2LXNA 4GHWA 1XQXA 2JFUA 2FMXA 3E4DA 3HLYA 4G86A 4M8NE 4R4JA 3WS7A 4BCBA 3ZLBA 2O4UX 5ARCA 5C8YB 1QK4A 3II6X 2JVKA 1JJ7A 1K89A 3L9WA 2KBEA 4IXNA 2CNDA 2Q2QA 3MNFA 1ADGA 4PXAA 2DCUA 1NULA 2YZNA 4R2MA 3RS9A 3ZJ5A 3SQWA 4URWR 4FWIB 1WR8A 2HJGA 1LKZA 2DKFA 1NC3A 4X95A 1SZCA 2JEYA 1Z0AA 2MYPA 4X94A 2FG6C 4FCWA 5DO9A 4K88A 3LYHA 1V41E 1FC0A 1P7ZA 3H7AA 3HEMA 1F5SA 2QRVA 4MOWA 3IP8A 4ZMBA 2CFTA 1VPLA 2CV1A 2Y4OA 1WCYA 3OPYA 2EBWA 5EY5B 1J09A 5MHTA 5HRUA 3K0CC 2WT9A 3DSRA 4R8SA 3GLIE 3T7CA 4E5PA 3U44B 2VKQA 5CM9C 2HR1A 3SXJA 1SNYA 3V00A 1MB2A 2WA1A 5FX2A 3BJEA 2IY9A 1TTTA 1BH2A 4L8VA 5KOHB 2QBYA 3W06A 2J45A 5BNFA 1QR2A 2EFHB 3HUTA 4C78A 2Z2JA 3ASQA 4CKBA 1ILEA 4M1MA 4DA0A 1RBYA 4MW6A 4JJ7A 2CWWA 1DTWA 5EEHA 1ORRA 1DC3A 4YGYA 4DCOA 5JFTA 1JG2A 1Q3KA 2H1CA 1YJXA 4TLMB 1X19A 4AP6A 4BVEA 1ZKDA 3A25A 1WCV1 3EZFA 3GN2A 5T6MA 4IVPA 3MRTA 3OZIA 2EW1A 4UW9A 1XHFA 1ZOPA 2H9IA 1P5HA 3ONNA 2BHLA 2YWJA 3HKBB 1LW6E 1Q0LA 2GD2A 3HI6A 3Q88A 1EWYA 1X7HA 2IOFK 5ESXA 4BB6A 4DIMA 2C96A 2WYIA 1N7HA 4XLTA 4YCSA 4BMOB 4EPYA 1C50A 1QG4A 4JP1A 3UOAB 2BKAA 4O4JA 4AN0A 1KF0A 4NXMB 5K8UA 3TD2A 5IJ9A 2WU1A 3KZKA 3D54D 4UTRA 5J4HA 4BNGA 2O2GA 4BO5A 1U8ZA 4HDKA 4RH3A 1N32B 1HE5A 1P2UA 2IH4A 1KO7A 1NR7A 2VNJA 3DAHA 3DCYA 1TA9A 3R0ZA 4L72A 2VHEA 1N2HA 4PM4A 2CHEA 3BCUA 3TM4A 2C8KA 1UOPA 1KQ3A 2LUOA 1WCIA 1PDVA 4F4CA 4OOXA 1SJ9A 4DEYA 3WE7A 1CS0B 2QM0A 4W8OA 5HCIA 1FJGB 5K51A 1H6CA 2XVAA 1Y5IA 3LQQA 2R79A 2Q0XA 1Q95A 3KSDO 1E7WA 4BFUA 1P3JA 1G9SA 4W6ZA 4TXMA 3T9AA 1S0UA 3NS7A 4MZXA 2G7ZA 2OA0A 5DBGA 3RU7A 3H2IA 1ZC4A 3C3WA 4YTEA 3WV4A 3GROA 3WAGA 4M38A 2E5LB 4GWGA 3IX7A 1Y3HA 4PGMA 2P77A 3GI1A 2NO7A 4I36A 2YIMA 2Q2WA 3B6MA 1GRRA 4H08A 4OK5A 1WB9A 5IFLA 3DA8A 2JGLA 3CRQA 1IJBA 2HMAA 2BEUA 2JD1A 2Q9AA 2DHDA 4UUAA 3KK0A 1SEVA 4XMYA 1AKVA 2BR5A 1YBVA 2WD7B 3B1KA 4XWAA 3IRVA 3WLKX 2COEA 3ED5A 1V5WA 2V9PA 3RWMB 1ZBDA 3R4CA 4P33A 5AMXA 3U7QA 3URMA 1XYVA 2PAFA 4NJEA 2VTBA 1BWSA 1GZHB 1KFKB 1M1NA 5AXAA 4COKA 1A5BB 2ZTHA 4JT4A 2CMFA 4ZYTA 1XROA 3E9QA 2PYZA 2OG1A 4XOUA 3IAFA 1RZRD 1HLDA 3AUKA 1DVRA 2HNAA 4G8JA 2AIRA 1IONA 3UO8B 4X7RA 2QUZA 4L8LA 3R3WA 3T7KA 4TS9A 3ZY2A 4M9XA 1U7OA 2PSSA 4D2IA 2VPIA 1YHYA 3ESBA 3TE7A 3GPIA 3DAYA 4HDCA 5IYPA 4I4IA 3R7NA 2O59A 4Y30A 3ILVA 2WF7A 4F86A 3QUQA 1SC3A 3DH0A 3GUHA 3NOXA 1FMJA 4G0QA 1U0FA 2EX0A 2HWWA 3FYSA 1SOVA 4KOAA 3TZ6A 1RIIA 4LRYA 3VX4A 4QUZA 3DOEA 4CM4A 2YY7A 3RY8A 1E2IA 3HXOA 3IMFA 3ZJUA 1IWOA 1FK8A 3S1AA 2UV8A 4JYPA 5ALTA 4AY4A 2OV3A 4DV6B 2ZBUA 4LV8B 1A76A 5F5XA 3ZGLA 4ZN6A 1L7DA 1PGJA 1VPTA 5J63A 1U6KA 4CF3A 4U2BA 5KNCH 5KTMA 4ILEA 3DLAA 1ENZA 5E2IA 2PRZA 4I3GA 2DJ5A 2WM2A 1THGA 5F51A 9MHTA 5K09A 3OJFA 4NNJA 2VBVA 1K7XB 3GSIA 1M1UA 1VE9A 1RSZA 5KX5F 1YKFA 4BP8A 1X15A 4A7PA 2BF7A 3HCFA 1J0EA 2PV0A 4MPRA 3R0VA 1GZ4A 1YT5A 2PH5A 1RKBA 2A5FA 3HEBA 2ZRNA 2BFFA 1JEJA 1SOUA 4HDAA 4HN9A 4NY1A 3VR5H 1I3LA 1IG3A 5EJAA 1JEYB 3I37X 1GPH1 1T1JA 1NWCA 3NGLA 2PUEA 2GETA 2PMFA 4CMIB 4C07A 4U6SA 3CXCB 5AWFC 2JN9A 2Q0SA 1WDTA 2ZWAA 3GVPA 4LBWA 1UDRA 3DOUA 3ONDA 3QVLA 4OHFA 2O50A 3X1WA 5CVTA 3WGKA 1KVQA 3BE8A 3T3PB 4P25A 2PX8A 3CW8X 2QG4A 5IJAA 5I4BA 3JR3A 4XUEA 3HDQA 1GTG1 3A1TA 5HYVA 2WUVA 2C57A 3AETB 4U7PB 1GAJA 1XZEA 4X63A 1Q3TA 4UAVA 3HLKA 4JBNA 4DNOA 3D3JA 3SHWA 2ZYDA 5JBIA 5JE8A 1ZRSA 2DU8A 2QN9A 3A1VA 3B7PA 3DO8A 3HL0A 5DCLA 5AVSA 5AO9A 5F52A 1ZGGA 3I5YA 1USVA 2AD1A 4NEGA 3LNTA 4GF5A 4LYHA 3EIEA 1ZEJA 3SJ7A 2HMUA 3UJCA 1PVVA 3E7XA 1L7NA 3VJKA 1PL0A 1J0DA 1YB2A 5JECA 2IPNA 2GQ0A 3HTXA 1WLSA 1UK9A 2NADA 1Y3DE 4FNOA 1DL5A 4KN5A 3VKFA 4QGSA 4S04A 1UBUS 5BW4A 2ZBGA 2XQFA 2G25A 3HCCA 2YC2C 2V8BA 3AU9A 2O5CA 1FNMA 3ZKAA 1T8YA 3O92A 1EPUA 2HCBA 4FCTA 3FFAA 4GVXA 3WK5A 1T5TA 4EY5A 1ZMBA 1B2RA 1IVYA 2G1AA 5EE1A 4AXBA 5KWEA 4FR2A 4BQFA 1DBWA 3GFOA 2FWMX 1DWQA 1PWHA 3MSCA 4GP7A 1N05A 1FYVA 4TKMA 5D1HA 5H1YA 5EJ4A 1MA3A 2GYVA 4LJAA 8OHMA 3HK2A 3GXOA 1D9ZA 1FLDA 2W5UA 1DRWA 3E3LA 1E66A 4LJ6A 3D7RA 4UNRA 2GO7A 1SKQA 2XF2A 5EJ8A 4F2WA 5L8VA 4QOEA 3PHIA 4WUVA 4JI1B 2FP4A 5EGSA 4R7ZA 5LDDC 3RHFA 2G9ZA 3BKWA 4MUNA 2J9FB 1NT2A 5AKYA 3ZHCA 3DV0A 5IH7A 4LDQA 4P31A 3SQNA 5KIAA 2O2DA 4KE6A 1MT0A 2EQBA 4GKBA 5FPYA 4ZFNA 2G28A 5D8DA 4C2BA 4WIAA 2W6IA 3M6UA 3FVWA 3K8ZA 4TYYA 4DIFA 5DGXA 3KAQA 2A0XA 2INGX 3F2VA 4WOPA 1G8HA 3PYXA 4KMMA 1GSHA 2HHJA 3F49S 5AJZA 2GNOA 3D8SA 5CLJA 1F48A 1WMEA 4OHXA 4R9SA 3CUUA 3UM9A 5LKRA 1ZRHA 4FN5A 2GRJA 1Z7YA 4Q9DA 1C4XA 4IXTA 3JZDA 4I1YA 1EDDA 3L7IA 4G5RA 4CQLB 4GQBA 4MJ7A 2PIAA 2AS0A 2PVSA 5SYAA 3DDOA 4A16A 4CBVA 5B6PA 4IPTA 3DOIA 3EGOA 3WJ1A 4O2BA 4O6VA 5CXQA 1ZIXA 2FEKA 2XVXA 3PGA1 1QTIA 3EVEA 3R6WA 3ZDQA 1FVHA 3GLFA 1EB9A 3N0RA 1R7RA 2XEXA 1KZ1A 2YCLA 2CSUA 3FR8A 4FLMA 2IU0A 4JKYA 1NBOA 1AUXA 3PUYA 4RK0A 1HLFA 5IAOA 2FRDC 4JS0A 3NUZA 5DF1A 2XXAB 3UJ9A 4QQFA 1A2KC 1SVOA 3FCEA 3HJUA 1T0HB 1T9AA 4WY8A 4BLOA 1H8HD 2AGVA 3A3KA 4IDOA 4WK0B 4DWVA 2ZXUA 3WK7A 5TPWA 4XSHA 4A0FA 2C04A 2ZGVA 2PG3A 1CEQA 1Z6XA 4FX2A 1H0KA 3LH5A 3AVQA 2AOXA 821PA 3JYHA 2PS3A 4OQDA 2GEFA 5AI8A 1FP6A 1GQQA 3QY9A 4R2WA 5AK0A 4C88A 1LGYA 4FVTA 3M9WA 3F5DA 2FPGB 2YV2A 4QYIA 3EB9A 4V0LA 3F7MA 3DJYA 2Q5IA 1ML3A 1CY4A 2R1TA 4ZEXA 3GCDA 1GCOA 4RM3A 4ZI5A 1NNEA 4NEHB 3VJRA 1Y5RA 3KXKA 4MUMA 2P91A 4FR0A 4I1VA 4RYLA 3TR0A 4N3BA 3UH0A 4TMZA 2DPYA 1JHUA 4S2UA 3ZTTA 3IQFA 4BN4A 4GSYA 3NWBA 4GH5A 2CBXA 5EERA 4KPUA 1MU0A 4UVHA 2P0AA 4R5MA 2QIOA 1TJ5A 3I09A 3VTKA 1R4AA 4ZCQA 1T2FA 2EG5A 4LXIA 4ZRDA 5FUWA 3SKBA 1MF7A 3B3AA 3NDIA 4CKZA 2ZUCA 1U7WA 5HZKA 1LX7A 4YMTA 2ZRHA 8ADHA 2WFZA 3PRKE 4QT4A 4BPBA 3ZV3A 4IF6A 3M4ZA 5EWJA 1C1XB 1KFEB 3A9RA 1U0HC 2BI8A 3HO1A 1MJ5A 3OKPA 2V7BA 4O4HB 3CUKA 3DKVA 3ELYA 4R8LA 1UMBB 3H1AA 5EMHA 3ZNPA 3WI7A 1KKLA 4EG8A 4MUJA 3JU4A 5HX7A 1E2MA 3VSAA 3HP4A 4BO8A 1NJFA 1Z74A 2IEAA 1X86B 3EAGA 2J85A 3HL4A 4N9QA 1MVOA 4RA9A 3H13A 1U2PA 4P08A 1T8SA 4NENA 3WWCA 4P0QB 4UHEA 1MX9A 3LT4A 1EWVA 4BNJA 1NYQA 1OU0A 3BFKA 3PHCA 2DPLA 1G2OA 2JCXA 4QRHA 1PJ4A 4DM3A 3IIMA 1TO6A 1WNTA 2QGGA 2R11A 2JBHA 3DL4A 3L07A 3PPYA 4U2EA 4HUTA 5LZ9A 4HQFA 4F5EA 3U5TA 3WIOA 4Z1MD 5AJYA 1JWLA 4HEJA 3VU9B 4CRWB 1XE1A 1MJGA 4BNZA 1AC5A 5HKLA 2OO3A 4HAZA 1HEUA 4LRSB 2ZJOA 4X6YA 4K6CA 2D8MA 3RU2A 5U9CA 5ERXA 3C5CA 4MWCA 2AF4C 4TV9A 4GXNA 5AOAA 3LY9A 3OOSA 1CUVA 1FYDA 2YV1A 2WJ6A 3LFUA 4JBHA 5B1IA 1N33B 4F1JA 4AO7A 4KFSA 1M2VB 1N5LA 2QGFA 3BWVA 2Z5VA 3GN1A 4GDMA 1IAVA 5JLAA 2UYGA 3D3QA 4OQMA 3RKUA 3VV3A 1NXPA 4KAAA 4IG4A 4BJHB 3WOVA 2DBVO 1T6NA 2OBBA 3VC7A 2HK9A 3QVGA 4CLRB 2BDUA 4CJXA 5EXTA 1XMVA 3ZS8A 1GDHA 4EW6A 2ODAA 2ZDHA 5I7HA 1IC6A 3WGMA 1HFJA 1EXMA 1CUIA 5EL0A 3OICA 4Z6KA 2JC3A 1DX4A 5C1DA 3FMVA 4XD7A 3FCCA 4AG3A 3E20A 4TRMA 4V0SA 1WUTA 5LP6C 3GPLA 3Q5DA 5FPTA 3JRXA 4JLDA 1DCFA 1FXSA 1WPXA 2WTEA 1J2RA 1YNOA 1VDZA 3HC7A 5JAQA 3CZQA 2QL7A 1YZ3A 5LC1A 2DPHA 2AOWA 2Q28A 1Y6JA 2PR7A 3PR2B 2YUTA 4EO7A 2O48X 4MJ3A 1U1IA 2VOEA 4Z4FA 2HYDA 2C5LA 4EVSA 3K0HA 3PKIA 1Z8HA 5L3VA 3EDOA 2VK4A 4WECA 3V4LA 4C30A 1SXIA 5J4VA 1E9DA 1U02A 2ONKA 1QO0A 2Y3IA 2QRZA 3VOSA 4PF1A 1AD2A 5FUYA 2X6QA 1GNVA 1F06A 1MOPA 2DH6A 2OV4A 3PS9A 4IIDA 4MWBA 4F21A 2F43B 1H2BA 2BE9A 3QJYA 1RT9A 1LRLA 1NBHA 1Z6YA 3LQEA 2B4QA 2BW0A 2MTBA 3WBJA 2ZYGA 2VZ8A 3ORQA 4QBHA 1MJFA 1W19A 1RW4A 3AVPA 1FSGA 4QG7A 3VHXB 1L4MA 3L8HA 1LPNA 3ICOA 3K9CA 1PZXA 2EJVA 1IXSB 4AUKA 3NHAA 3QGMA 1T6BY 2VYFA 3O5AA 2ATXA 2Y0CA 3GRAA 5EKDA 2ZLBA 5GZ1A 5JRZA 1Z5GA 2H4WA 4GLLA 2XTAA 4ALMA 4TWBA 4YAWA 1UFVA 2ZJAA 4D80A 4DB2A 6NULA 3FTPA 1LFAA 2AN4A 2W6NA 2HWUA 4CFSA 2FP3A 3K5WA 1C3OA 4BX0A 4ZT5A 3WDSA 1UPFA 3G8BA 1PJ3A 2RMKA 4C0QC 3NORA 1EX9A 1JVNA 4MAAA 5IC6A 2QLLA 4QJBA 2VSQA 3OY2A 3L1HA 3L6CA 5JSHA 1PDOA 1P61B 3O8OA 5C32A 3U4QA 1XQWA 1PJ8A 4UTOA 4BX3A 1O5TA 2FPUA 1VKZA 2XV1A 1XTRA 1NSFA 2XCQA 3C3AA 3LIIA 4J8PA 5LMNB 5H82A 5ALWA 3K30A 3IRUA 4TKOB 4WZEA 1DX9A 1GZ5A 1Z68A 2QTGA 4F4IA 2QIPA 3ZS9A 5CFQA 5KU7A 2YXNA 3CPJB 1MA0A 2OCXA 4BP3A 1NJSA 4C4XA 2MSLA 1OQAA 1YQDA 2PYDA 4G84A 2X1HA 2HSWA 1LD3A 1JN0A 2PN1A 3GGDA 4FFLA 4MV8A 4N1AA 4AG6A 5KYUB 1QHFA 1ZNQO 3KSBC 5KUTA 3KUKA 1EGAA 3BIWA 3A9VA 1MPXA 3JV7A 3EZ2A 3MD9A 5FBKA 2P67A 2NO0A 3QF4B 2BP7A 4ONEA 3ZWAA 1N0VC 5T57A 3MCUA 1A7JA 2OM2A 1ZD9A 3AUXA 3FGOA 4HNGA 4EY6A 1GTRA 1JGTA 1WIWA 3H5TA 4X0EA 2WA2A 2QAGC 2I78A 1SB8A 4LVNA 3ROQA 1U3CA 3RUCA 2PD3A 4K9OA 1QTNA 3TXYA 4FB4A 1T6ZA 3MTAA 1D6NA 4O1IA 1QZZA 1JDZA 1RKVA 3F4BA 3NHFA 3ROKA 3NE5B 1V1RA 3S27A 3STXA 3T4PA 1HKUA 3UT5A 5DI3A 3WWOA 4B6OA 4N47A 5FEMA 3HG7A 1L0BA 2ID4A 2H3HA 5CT6A 2GBFA 2CL7X 4LQ4A 4OBWA 3FNEA 3ZEAA 2QXTA 3PQCA 1UINA 3NAZA 5LQSA 1GN9A 3GJRA 4HWTA 4ZKEA 4ZKDA 1E1LA 1ULTA 2L17A 3NAGA 1H1LA 2AXNA 3D6JA 1GLVA 1CJCA 1V47A 4Q01A 2HIAA 4Y98A 3DDSA 1XZMA 4M1ZA 2HQRA 1SZPA 4ZHQF 1N6RA 5L7WA 1GM5A 1R0XA 3HU3A 1E0JA 4LPSA 1U9IA 2XTJA 3P71T 2CJPA 3HU5A 3CF4G 3OOCA 1TK3A 2H65A 1J8VA 5JQGB 1LPBB 1F0YA 3PHLA 1G7SA 2GTIA 2QN1A 4MR7B 3CCSB 1TK9A 4W5HA 4E31A 1P18A 2PDAA 1H6BA 1SKUA 1G1MA 2D5IA 1VL8A 2WWIA 3T9FA 3WTBA 3PR1A 2I2CA 3L01A 1NJ2A 2JGAA 3HV0A 3RS8A 1SBNE 4G0XA 1VBNA 3FNBA 3QLJA 1QGUA 2OFFA 1BLIA 3V7NA 3U60B 1D04A 4O2AF 1C9KA 3ZEIA 2JI4A 5KCZA 5FIUA 3A1UA 2JI8A 5E38A 2BUAA 5AKJA 1NASA 1JA1A 4ND4A 1EWQA 2O7SA 4OL9A 3WYGA 3ZKWA 5B58T 4I0WB 2CF5A 1CPYA 1ZUNA 3CG0A 4K26A 2CLHB 2O1SA 3GCZA 1QO7A 3HZZA 3KEOA 4IWNA 4JLMA 4EB3A 3S5JA 4AKTA 5AI0A 3DKKA 3BXPA 1EP2B 5CNIA 4DLYA 3EC7A 1AQIA 4MGZR 4LJSA 1E62A 3V6MA 1TMYA 4LHXA 1GFWA 1NBMA 1QYCA 2YQ4A 1UJ4A 2GCIA 4MDYA 5CCDA 2Y1OA 2CJYA 1ZOIA 1M3SA 3IP3A 4JLUA 2JJ2A 4H1WA 3BMQB 1C30B 2Y9PB 2OR3A 3RC3A 3TAUA 4TQUS 2ZSBA 3DDCA 3CINA 2B98A 1X1QA 1M72A 1P4SA 3GJ6A 4GX5A 3C8HA 4DJDC 4LYYA 2YR0A 3C6KA 4S1VA 4DYDA 4GM4A 4PC1A 5FTJA 1E6WA 2ZUFA 2DQYA 1EFKA 1PDWA 2IZ5A 3PLRA 4IDBA 4NYMQ 5DTEA 5LPNA 4ENVA 4PHGA 4Z9XA 3T1TA 2EFYA 2FX3A 2NZJA 4QTUB 1REQB 3N3AC 2B82A 4IDNA 5E4JA 3TDNA 5IDXA 2IYRA 4M9ZA 4P53A 4J4TA 1YQWA 3LGXA 2P3LA 1KD1D 4LNUA 4UBNA 4W82A 5JVDA 4PG5A 2QRMA 2XQKA 4OQXA 1LX6A 3T6KA 4CM8B 5K0CA 4ZGWA 1M74A 3VNUA 2Q1YA 5AM1A 3GD5A 2BGWA 4OSOA 1K3FA 1OX6A 4MYUA 1Z75A 2PZKA 5TV2A 3CN9A 3I72A 4QYTA 4S0XA 5DTQA 2GBGA 3T34A 2WTUA 4DZZA 3TSOA 1XJ5A 4JJIA 2YICA 4RV4A 1FYXA 1NBME 1U2DA 1E3QA 1G291 3V32A 4AZ0B 1THTA 1N78A 4J16C 4P7FA 5IASA 1PUJA 3ENKA 1YVRA 3UAXA 2MR5A 1G2QA 1VSUA 3D6AA 2OAQ1 3LT1A 3W8DA 3AVWA 1IB6A 1TQDA 3D2LA 3VU1A 2GFQA 2PMDA 5DK6A 3K9FC 3IIKA 1FP1D 3UUWA 1Y7IA 4H60A 1XU4A 4TZTA 4HV4A 3DBLA 2W6ID 2QB5A 1Q77A 4QOFA 2EZ4A 1DV1A 3JQ8B 3NOOA 2G7MC 1M2KA 1XHEA 4GEGA 4XKJA 1SVKA 2H0RA 1II9A 2HPAA 1EE2A 2EGHA 2J3DA 3MF4A 4V0NA 1R12A 1I8DA 3MWFA 4Q3KA 1M67A 2FPSA 3QV1A 2Z5LA 4YLGA 4AMZA 3IE2A 1T8UA 2H11A 1U0JA 2P40A 2RK4A 1Y6ZA 4LEIA 2B2XA 3CCUB 1OYYA 3RIXA 5KTRA 4CFZA 3V5NA 2W2QA 3PKJA 3IAAA 3OZSA 2R5WA 5LQJA 2PE5A 4L3OA 1FFGA 3K0FA 3VTZA 1QRTA 5CX4A 2OBRA 2ATEA 5IYZF 1ECFA 2CT8A 3LQRA 1W36C 1CQZA 3H9CA 1A97A 5DB4A 3PEFA 5J5AA 5DW0A 1UC8A 1DWOA 4Q12A 3SSAA 4BUZA 5IX8A 3PQ3A 4RELA 1SXJD 2QTZA 3A28A 3ANSA 3TLYA 3UV7A 4ER3A 4WJLA 2GO1A 2Z3WA 1JRLA 1S8AA 4XPIB 5JXHA 4HVCA 3QUSA 1BOFA 1IM5A 1OREA 3IEXA 3WKCA 1ESMA 2CLCX 3ANLA 3VPSA 1IATA 2BGMA 2J3JA 3WR5A 4G85A 4RF2A 2KYRA 3P9PA 2GK3A 2PKEA 1UMDA 4BNNA 3OFVA 4P4LA 5G4LA 3D31A 4BUCA 4TLEA 5CXUA 1F1JA 1FF9A 3CMCO 5A2QA 1SBTA 1UC9A 4B9EA 3MCAA 4DDWA 1KS2A 2FZLA 3ER6A 3RSFA 4AZTA 1MVLA 2CVQA 3FGZA 3E1SA 1O87A 3FFXA 2HBZA 2NU8A 3S4YA 1NXVA 1U28C 2Y1KA 4CKWA 2QN2A 3C1TA 1F6DA 4EYKA 1G9TA 4DC1A 3A1CA 5AIBA 1IBRA 5A4MS 2DPXA 2HCJB 4PGOA 1SC4A 3QEOA 2Y67A 2JGEA 5HQJA 5EE5B 4EUHA 4DQ0A 1X0XA 1XQ1A 2CUZA 4OQZA 3LRPA 2Q6IA 2IYZA 3VH4A 3KVRA 4QVGA 2NYUA 4JZKA 1GVNB 2JASA 4ZCIA 2R86A 4W99A 3V1KA 2O8DB 1UKYA 5IZCA 1P31A 3CCMB 3CH7A 4MUIA 1RP1A 4S3MA 2F48A 2W4MA 3T7JA 4TPKA 3DE6X 5LA6F 1S8NA 5L9AA 4TLDA 4URFA 2P2GA 4GAEA 2X86A 1UP6A 4UE6A 3C1UA 1HDGO 1KMHB 3FTNA 1TAGA 3DHYA 4BWVA 3Q6MA 1TJNA 1VB5A 3QQPA 3T5CA 2GCGA 3VAAA 2HO4A 2Z2ZA 4Y9TA 1JX6A 5KSOA 3SJUA 2WV7A 1NP7A 3O26A 1EG7A 4JENA 4N7RA 1EUCB 2HCRA 3R20A 1PR5A 1ZXXA 4AMGA 2D2XA 5JCXA 4M0LA 2O3SA 3E22B 1TPYA 1RRFA 2JF0A 2QGZA 3FCUB 4Q18A 3WZMA 1E2DA 1XCBA 3A70A 1Z5ZA 3F3SA 4HVTA 3T06B 1O89A 1T3HA 3PGMA 5D85A 2ECPA 4A8JB 1YVDA 3PA1A 2RKBA 4FYKA 1ZK4A 4LY9A 3QLEA 3DW3X 1X9GA 1JDUA 2VXCA 3E2IA 3G2JA 2HJVA 3D1JA 3WGHA 4GGPA 3I92A 5DTIA 3RSQA 3B3GA 4OA5A 1T25A 2GPJA 4WEOA 5KNCA 3M2PA 4BX2A 4EL0A 2Y1GA 1BN7A 3AERA 3B9BA 3G7NA 2JFPA 3HI4A 4QELA 1KDZA 3RG8A 1HMYA 1U8UA 4I66A 3FSGD 5DRTA 1GTSA 3J80A 4PNZA 3F90A 3UPDA 4M2LA 5JNTA 1FFBA 4P5PA 2ZL6A 3MFYA 1SXPA 2IX9A 3CN7A 1Z0FA 3GRYA 1ZONA 2O0JA 2BWJA 1F4PA 2C03A 1YZUA 2AHRA 4A27A 3H65A 1RP7A 3UMGA 4CTKA 5LP6F 5FOUA 3INRA 4NMLA 1FOEB 3ENVA 5FEUA 1YRBA 2B37A 4Y2VA 3V4PB 2Q7OE 4PICA 2RG7A 4Y0NA 2JIPA 3I2KA 3UMVA 5BUCA 2CXSA 1VP3A 3EWIA 5L51A 4GBED 4D3ZA 1U4NA 4Y67A 2I7XA 4ETMA 2C2YA 1DC5A 1KQPA 3EPKA 3DQZA 3VMFA 4JIGA 1DXOA 3V7YA 4B71A 2GPNA 3Q7TA 5NLLA 1OXTA 2BZSA 1IQPA 3QK7A 3GDWA 4XLEA 4JP2A 2B1JA 1GG9A 5P21A 3CC7B 3RB8A 4LC0A 2PKWA 1HVXA 3LOUA 3OUTA 1YI8A 4KBGA 4C5CA 3DC2A 3G2MA 5CB4B 2AQIA 1P6QA 2W42A 3OCCA 4PSVA 1RHMA 2BPOA 1GGFA 2ZZQA 1U1EA 1AQYA 4HLNA 5GY7A 1V8DA 2QS9A 1U6IA 2HTEA 1OB0A 3TX6A 5ARBA 3W1VA 1KKMA 2M6KA 5CA1A 3JAKB 3VU0A 3BTOA 1OH6A 2WVAA 4R68A 3CKMA 2IP4A 2I6FA 4IQ8A 4DPMA 4LF4B 1E0KA 3ABQB 3BH6A 3AV0B 4L3WA 5AD1A 3VDRA 1PEDA 4MRPA 3KKZA 4ZAVA 2PSDA 2YVUA 4QBIA 4PQYA 2PZMA 2DZDA 3OM9A 1GHTA 3OH8A 4GS5A 4L9SA 1BCSA 4DR6B 4II2A 2V7XA 2OD2A 4E2WA 1OH8A 4GVLA 1FQKA 1DMRA 2GJ4A 3C6BA 2Y2VA 4MRSA 1WSBA 4I46A 5IDYA 3W7VA 4DCSA 4DLVA 1BEEA 4NBNA 4NJMA 3ZX5A 4AKGA 2PMEA 1E3WA 1U0BB 1E7RA 3GA7A 1TM1E 3CSDA 2XUKA 3ZHSA 4C7OA 2VWHA 4J9UE 4MUYA 3NIDB 2Q3LA 5KQPA 1M83A 4YREA 3E8XA 9ABPA 1I14A 2G9RA 1Z56C 3QA3E 4C2UA 5ESRA 5LL6P 3LZDA 4NX2A 1ACLA 4GOXA 1S2OA 1EVIA 3L82B 1RPNA 2IUFA 4Z4GA 3LX8A 1EXVA 2E4UA 1EM8A 4LX8A 4DLTA 1HNNA 5BW8A 1V5VA 1F0NA 1FTGA 2GZ2A 1SCAA 2FEOA 4BKOA 2A9FA 2O8CA 4J0FA 1U3GA 3EQ8A 3GVIA 4OREX 4X05A 4V38A 3URKA 2GN8A 1P7WA 4WXMA 3BF8A 1YASA 3WDKA 4CG3A 3PNMA 4EX7A 1FYWA 3QRWA 3AJEA 3ETGA 5C7YA 2QQ0A 3T0IA 5AVWA 3NFRA 1VPVA 2JBAA 3EVTA 4DOMA 1SELA 2WUGA 5JSFA 2ZAGA 4F12A 3KSAC 1KJQA 2H92A 4WWHA 2C5AA 2R0QC 1JW9B 1P1KA 3COWA 5ALXA 4J1NA 3NLLA 1D8AA 4K86A 5J3JA 2QLNA 2Y1FA 3TAXA 3ZNQA 3EC1A 2QTLA 2A92A 2G0TA 3RK0A 3HJCA 6AT1A 3FKJA 4OQNA 2F59A 1C1DB 1DWPA 1QHGA 3JQBC 1OXUA 4UBIA 1I6MA 3JD4A 2R6DA 2XNKA 3IYLW 2A59A 3VMMA 4YK7A 1Q12A 4TYWA 1NAIA 2AN1A 1L7QA 4PLZA 1Z08A 4DZRA 2WM9B 3NT2A 4OAQA 2E85A 5AVYA 4Q3AA 1ZU5A 4BDTA 2BT4A 2D5BA 1KI9A 2NQ2C 3CTMA 4AUMA 1F5NA 1K8ZB 2W7TA 5AJXA 4WLFA 5BWMA 4DK0A 2OT3B 3FPAA 3T7AA 2ZR9A 2C31A 4DXAA 1O3YA 3A4TA 1W75A 1UZMA 3G5LA 3JALA 3U48A 2J48A 4JV5B 4LYEA 4QBGB 2X8KA 2K5UA 5H70A 1JALA 3CRNA 3RR2A 3IHLA 1ZN7A 2GZAA 2OKGA 3D3KA 1J2EA 3GVJA 2KQUA 3KEMA 4M37A 4R71A 1U9YA 4YCJA 4ZOLF 2NVUB 4HR7A 4NCAA 3LUPA 3MTGA 1OUMA 3A32A 3A6ZA 4JDPA 3SX0A 1EUDB 3QVMA 3UFXA 3TLMA 3VYRB 3WHPA 2LIVA 3H2BA 2BDEA 3QEKA 4MICA 4EG6A 4OXNA 1P39A 3FLEA 4MO9A 3THYA 5D01A 4XM0A 3JARB 4U9IS 2F1RA 4OTZA 4XFDA 3ABZA 1TM7E 4DEXA 5AVUA 5F4JA 1TVKB 4DRXB 5AM2A 3R7BA 1BGXT 4TSKA 2ACWA 4JI6B 2FJ0A 3L6BA 3AUUA 5CLQA 1SFRA 5BY2A 2PAAA 1OIWA 2IHZA 3FSJX 4FUQA 5C35A 1TTHA 4AVZA 4PINA 4IZIA 3T61A 4O4IB 3P9KA 3ROFA 1GUFA 3QLVC 2ZZFA 2BGNA 1L8AA 2NV0A 4RD4A 4DV7B 2R85A 1E1RD 3BS4A 5FTMA 4C5AA 3AY7A 3KTAB 2W2TA 3LOQA 3CCEB 1CZLA 3KBOA 3IKLA 4WZZA 1M8JA 2IYVA 1G55A 1RRPA 4LJ4A 5LDGA 4MV7A 5A04A 5DHUA 3WK9A 4PBSA 4W1QA 3EXHB 2M6RA 3A10A 3H0KA 3AR8A 3HXKA 2VH5R 3BL5A 1GG8A 4MMZB 1WP9A 2X5NA 1TQ8A 3VFDA 4YALA 1PK8A 3FTEA 2FGKA 1SC9A 3JQEA 5DM2A 2FDCA 2DWOA 4RIEA 1G38A 3ROMA 1XSEA 3AF4A 2ZIVB 4AP5A 4X7CA 3UMMA 4B4WA 1W25A 2EL7A 4DPKA 2ZT7A 3ABSB 1NLZA 2AX3A 3BRSA 2I7DA 5B6JA 3MTDA 3CESA 3FZEA 3V8QA 1JU9A 5C34B 3A05A 3RUHA 5CJPA 1KO8A 2YIJA 1PQUA 2EZUA 3RYHB 4C7BA 1BXRB 3R7FA 4Z3KA 1RQXA 3TR5A 1IUPA 2KS6A 1JXAA 3TG2A 2EGGA 1B4DA 1EINA 3QFHA 4GWLA 4OK3A 4UBJA 5KO2A 3NHWA 1LU9A 4IVQA 4OX9B 1U3UA 4OHOA 3E5MA 5FWXA 2Q3HA 3GR6A 3WYCA 2BDTA 1JZQA 3CMEB 1OBVA 1EI9A 1AQUA 1IVNA 1WRBA 4G5QA 5AKEA 5TRTA 2GHRA 5EJMA 1NDQA 1CQJB 4R2IA 5ELLA 4JWKA 2W0MA 1KYZA 4XCQA 4P2BA 4KLAA 1I80A 4DSAA 1OT3A 2VVTA 1BA2A 2X8AA 4Z4QA 1KZYC 1Y6GA 4CEHA 4H3HB 3E48A 4B83A 1ZJZA 3D8TA 1RWOA 4LKOA 3T12A 4C6TB 2G1UA 3B7WA 4HZUA 2B25A 4KYVA 1TEHA 2XYGA 5B37A 1NW3A 2BGTA 2IV3A 1G6Q1 4UZSA 1W5AA 2ZATA 2J3IA 5EHZA 1KSHA 4UZFA 3UJ7A 1E6MA 3F6RA 2BTEA 1VQ6B 1MNQA 3BGSA 5T41A 1EMDA 4IIJB 1PV1A 3PFGA 2EFJA 5CUQA 5FPQA 2ZOSA 5IJ0B 5C8YA 2DUWA 4JMQA 2C2HA 4IUDS 5DHRA 2XDYA 2VT7A 4J94A 1HT2E 1KJYA 4D4MA 1YRQA 3O90A 4X5OA 3BGOS 3V1NA 4QOGA 2O2XA 2WT8A 5EIHA 4CTJA 4IH4A 1XEWY 4PZPA 3B13B 3WXBA 3C7CB 1QGZA 1PJRA 1QYIA 2CEKA 1IZ0A 2G0NA 2WM8A 2VP3A 4OHRA 3L4BA 1NI4B 2VL7A 3CUSA 4QE3A 2Q1XA 1H93A 4MLCA 2V1XA 3D5TA 1CETA 1UPTA 3WGZA 2ZRLA 1YVPA 4GXRA 4P9SA 1H0SA 3BJIC 4OHYA 3SVZA 3MC1A 3G2LA 4MZDA 2XOKA 4O63O 3U44A 3L4KA 1Q7BA 3IE0A 4HTFB 3IDZA 4YT5A 4Z7OB 4DM4A 1P0MA 2W0SA 2WZQA 4H6PA 5L3SB 1H9AA 3CT4A 2WSSA 3CNEA 4GGMX 4OGGA 5KOHA 1XJ0A 2QTBA 4YECA 3IQEA 1TL7C 1IM2A 3RPEA 1NKTA 1QZUA 1ZUIA 2PJDA 2KPOA 1I5RA 1LPAB 2AK3A 4NZMA 4IRUB 2RKWA 5IBCA 3ZWOA 4CMBA 1SWWA 3UJHA 2ZWIA 4XM3A 1P62B 2SKCA 1KI2A 2UYQA 2ZUSA 4R1MA 2GXQA 1N0HA 4AK9A 3QU4A 1EU1A 2JH3A 4WN3A 3HKBA 4MQLA 4E22A 3WQHA 3AC0A 5KSPA 3N3BC 3N70A 3NMUF 1RJGA 1CS4C 4TMYA 5FFFA 2R8PA 2UZ1B 5IJXA 1SRQA 3R3HA 3D8RA 1OLSB 4PW0A 1RAFA 5TGTA 1B8VA 2IV2X 1R9NA 3IDQA 1C7EA 3ISVA 3ZJTA 2P8JA 5LZ2A 2GDZA 3GRKA 3N7TA 5TPZD 2FETA 4BO7A 1XYGA 1I1NA 1PWYE 3ZK9A 4UUMA 2X4GA 2RHMA 3PC8C 3DE4X 3G13A 1UKZA 3F6EX 1GPLA 1XZDA 4BC0A 4XVCA 3DUFB 2ATVA 1J5EB 3WBKA 1LF5A 1CS0A 5JEEA 1NU6A 3AP1A 1JG7A 4JI5B 1LPOA 3IVAA 4WXYB 5D5PA 4B3CA 3E7DA 1SHTX 1T3LA 3O93A 4JVNA 3I9NA 3EGWA 3ORFA 3HEAA 2A9OA 1AO0A 4RHUA 2FE1A 1MXHA 5FA6A 3IP7A 1NPDA 1UBTS 4OX9Y 3AF1A 3G0IA 5TMBA 4A3SA 4U7WA 2IEBA 5CVDA 4B7CA 2A9QA 5A3RA 5JNLA 4YAOA 1Z36A 2I4NA 4YAEA 3VR5D 4BEVA 3LPLA 4F71A 3EBLA 4DLPA 3U61B 3OQMA 1DT5A 1U0LA 4DLZA 4UTVA 1G3MA 2PSHA 2M6SA 1M0WA 1BRTA 1JKIA 4EELA 5J9FA 4FT2A 5JTTA 2MIIA 4Q7MB 1LLQA 1EJ2A 3CNLA 3FAZA 2WD7A 4YUWA 4CQMD 3UMCA 2A9JA 1L7VC 1FFCA 3IPXA 3PNYA 3EIWA 4KNVA 4H7DA 2BRUA 1XTSA 2FI1A 4LZJA 4YLEA 3EBPA 5E2AA 3KOYA 2YMQA 5K05A 4X7DA 5EJIA 5ALLA 5FNVF 4KUGA 1CD5A 4LKRA 4NQRA 4MYTA 4QODA 1NQAO 1XRRA 2V4DA 5HM6A 4LE2A 1C9EA 5KDOA 4MVJM 3KZMA 3LQFA 3ANMA 1TU0A 3AVXA 2P1ZA 4U7DA 2DH5A 2ZB4A 4ZZ0A 2JGNA 3KSMA 4FDUA 5EKSA 1KQNA 4B74A 4IIHA 2BBTA 2CL6X 2EYUA 2G1KA 4YRFA 5FYDA 2HJRA 1K7FB 4FYJA 4B73A 4CI9A 1BXKA 3RBXA 3WZLA 1CLUA 4C0KA 3OLXA 3X2EA 2RK3A 4EKEA 1E3IA 2CLSA 5ILOA 1MW9X 3A6DA 3SDBA 4RJTA 4D44A 3MT7A 4GYKA 2HRDA 1N34B 3WB9A 2IYWA 3ERCA 3BSWA 3K7EA 3QXJA 5KNDA 5IS2A 2FXIA 2H1OA 4YCAA 3AFNA 4ACAA 3HH8A 4IDAA 2FW8A 4XGKA 4JX9A 4OH1A 5ALZA 3EISA 3SX2A 2Q29A 1TZ2A 2Z09A 4HNAB 3ZPXA 3F6YA 1EBUA 3HACA 4IKPA 1DGQA 3G71B 4UM5A 3E9YA 3PHBE 4OJTA 1E2NA 2BGRA 1KSGA 4RL6A 3CJTA 4D8WA 1W5BA 3I53A 3SZUA 2CMKA 2CHFA 5BSHA 2H4FA 1NW8A 1BS9A 4D9MA 4OL0A 3UGJA 4KK3A 1T3TA 3EVFA 1XD8A 3F6BX 2JIZA 1DCTA 1LY1A 3LKBA 4UHBA 1RWPA 5JBNA 2OWDA 3ZTWA 3SX4A 4D8TA 1M34B 4YUXA 3I58A 5HR5A 2GF2A 1FBTA 2WU4A 1V1JA 2AB0A 1SBQA 3CRZA 3VSEA 4FDMA 1ZOOA 4QT0A 5MN6A 1Y3IA 1S6YA 4EO9A 1LV7A 5IDQA 3SSNA 4HWSA 4WD3A 4CMIA 5BN4A 1D4ZA 1QV9A 1C8KA 1QH8B 1JXMA 5IU6A 1XMSA 1GGMA 1TMGE 2C82A 3NBFA 3SHFA 3T5MA 1EE1A 1HV8A 4JP5A 1YRYE 2D8AA 1OFUA 1TJ3A 2ZIXB 3T56B 4A0HA 2XYHA 5DM0A 1T35A 3CPEA 3AETA 4ZMSA 3EPPA 4L8GA 4LJ7A 2B78A 4N6GA 5HOQA 5BN1A 4DLUA 4TKVB 3UTDA 3MGCA 3K0BA 4ER0A 1JPVA 4NZZA 4RD6A 3DAGA 3GJ4A 3HN7A 2RHHA 4L76A 1VL0A 3QG5A 3G8AA 3RVMA 4Z4YA 1QG0A 1VM6A 2HDNB 3E23A 3V48A 1X7WB 4W9NA 3DDZX 3OO1A 1RLJA 2WZNA 1JIJA 1Y5MA 1CR0A 3W6ZA 3MG9A 4GI2A 3AJ8A 4QJ4A 1M6WA 3JD3A 3KKLA 3P45A 1U9JA 5FTNA 1NXWA 5COAA 5EZYF 1OA1A 3DTVD 3PYLA 2VAXA 3QVXA 2BGUA 2Y2UA 4NABA 2B7LA 5AJVB 3PVSA 3UPUA 4I1UA 1IMJA 2R7NA 2XI4A 2JVIA 3EVCA 1XALA 4N7BA 2RGGA 1RI5A 3SQXA 4HAVA 1KPIA 2GXSA 2AE1A 4KEAA 1AHHA 4Q0MA 4EHDA 2HJ9A 2VG8A 3RBAA 4BO1A 2QY9A 3UXMA 3KUUA 4EHAA 2H0AA 3F7OA 1JJFA 5E7MA 5C81A 5HHTA 2ZJ2A 4BVKA 1DDGA 1E9RA 1IZ7A 1VGVA 1YJ8A 3OFNA 4RNDB 1ID1A 3LSYA 1CB7A 1T4CB 4BCCA 2Q5OA 1AGRA 1N2SA 1Z82A 3ABOB 2H8KA 4PV7A 4YRLA 3UV3A 4Z7NB 4EUEA 3FHTA 1ZG3A 1GV1A 1O6CA 3NWJA 3QFTA 1QYXA 4CU2A 1INLA 2J09A 1AUOA 3HBNA 3PCXA 3X2SA 2EOAA 2GZSA 2XXBA 2J9FA 4IDEA 4O3MA 1T34A 4EF4A 4CT0A 1P9OA 3H2HA 1PNOA 3K2BA 1YMUA 2JJ1A 3ZZUA 4O2AB 2XIQA 3FWKA 3UWKA 1DO0A 3V2IA 3RQIA 1DEOA 4C0JA 1AK9A 1LVHA 1XKQA 1OTYA 4NKRA 3O2JA 2WSIA 4QJ5A 1BX3A 2MSKA 2VSOA 1PFVA 1PFQA 4CIBA 1RC8A 3NHKA 2DUMA 4G6IA 3L7AA 5J4YA 1G4HA 1QNFA 1PU2A 4DBLC 4G4IA 3D6MA 3L6RA 4BNFA 3V8NA 5CFOA 4CQLA 4TKLA 1F7UA 1JU4A 2V3VA 4NDZA 1CUXA 1MFPA 2J41A 1IOVA 2X9LA 3AUSA 3KDPA 2FE4A 1XZLA 3DTNA 4G56A 4MQBA 4NZOA 4IS3A 4D57A 3EG9B 3GK3A 5I9SA 2R00A 1HDCA 2QTVB 1TZJA 1T29A 4XR4A 1KIMA 1VCOA 2N0SA 4EKDA 5CNMA 4M60A 3ORRA 3O8NA 4LHZA 3SC4A 4PLPA 4J90A 3QEMB 1KC8D 2AN3A 5KI6A 3WSVA 3G0OA 1JHPA 4CKEA 5AW6A 4R7GA 2XXAA 2ADOA 1HEIA 3T3OA 1Y63A 1Y0YA 4QDZA 2CLLB 3Q0IA 3WJAA 3CKLA 1E2JA 5LYJA 4MWGA 2F1MA 2JZOA 1GKIA 5LIRA 3G5TA 1UD6A 3G9ZA 2CY0A 4PVCA 3DE3X 2R48A 2K87A 2GK7A 2J5QA 1WSRA 2OFWA 1QVRA 3M9XA 1NW4A 3JAWB 3X1XA 4PCVA 3KR0A 2NW6A 2ACVA 3PK0A 3ND7A 3ET4A 2C2KA 1YJBA 4FW9A 1L4NA 1IJEA 3EE6A 4LRUA 2FPGA 2PQMA 1VHTA 2R47A 3CX4A 3CVYA 5CPBA 4CUZA 2ZJ6A 4C03A 4URZR 1BE1A 4WZAB 3EEOA 2X9GA 1IBLB 4X7FA 3AJDA 4AY2A 3NFYA 2WPDA 1U2RA 2XQIA 3N7AA 4FCCA 5DNEA 1IEWA 3UJ3X 4X61A 4DGQA 4MIOA 3FE2A 4MPJA 2D00A 2H4YA 3SVTA 5KW9A 2BTOA 2FW1A 3HM9A 3U7FB 1JIVA 4OYYA 5HKKD 3V34A 3E9MA 4LF9B 3CJRA 4JLWA 5K01A 2G83A 3A7DA 1IQUA 5HMLA 4UOEA 2OPBA 5KS2A 2X53S 4UQOA 3E5HA 5FI3A 1E98A 5T7BA 4GZ3A 4AZSA 1ODKA 3I2HA 1QFMA 1KBQA 2IXEA 1R8JA 3KVYA 3EEFA 1MG0A 5IJZA 2C4WA 1X8LA 3BPSA 3ZTYA 2Y9MB 3OE5A 4Y0VA 4YB8A 2PWPA 2Y1DA 2Z30A 1C1XA 3DZIA 5FBWB 4UVGA 4QUAA 4ZGGA 3NTQA 3MCTA 5C5EA 1UMBA 5KB3A 2HDHA 3NP9A 4BO6A 2KW5A 2G63A 1E5VA 2JFOA 2XR1A 2ZS9A 4TVOA 4MV5A 3K0EA 3GIRA 3T3EA 2A30A 2XYVA 1UD5A 1YK1A 4WADA 2NGRA 4KR6A 2J4FA 2EZ9A 2J9XB 2ZCUA 5FWAA 3ZY3A 1A4RA 3P2MA 2VPWA 2CK3A 1YB6A 4X64B 4HMPA 1OBCA 4J0QA 5KEIA 3H4TA 4QEKA 3DMDA 4XQGA 4EW2A 5IT4A 1YIOA 4I2NA 4QO8A 1V5GA 1F1BA 2ZBQA 4KQIA 1OY1A 2V96A 3VU9A 1RWVA 2CBGA 3DVAB 4JBLA 1K8RA 3BREA 1U8YA 3GQVA 3TR6A 3ZWCA 3WYFA 4BV2A 1TM3E 4TN1A 1ZY2A 2GD1O 4JOSA 1CW2B 4N6NA 2ILVA 3B48A 2XOKD 2Q3FA 2XLBA 1M2VA 1ZIPA 4HYTA 1RHKA 1WCXA 4N76A 3N75A 4O5OA 1XKLA 3RYIB 4CDGA 1XYYA 2QZJA 4TROA 3MIZA 2OCBA 1GLNA 3TW0A 2AYYA 3GT7A 1ZYUA 1NF3A 3MTQA 4KIGA 3O7WA 1JH8A 2PSJA 3MN1A 4PSUA 2VRNA 1JBEA 4KODA 1MRSA 4LMPA 4CLRA 1JFTA 1NFRA 3WL8A 2PLRA 4UUBA 4GL2A 4KKVA 1L4EA 4EG7A 2I3AA 5FUBA 4TTPA 1WUYA 3UT6A 3OM0A 5ELXA 1Q6ZA 1HDOA 4BHTA 2R7AA 5BMVF 1CUHA 5GV8A 4ZQIA 2ATIA 4ZVVA 1TF2A 1ZGZA 3V1UA 3VPCA 2Q2OA 1ODTC 1UK7A 1V8OA 3OPYI 3B2EA 3HR7A 1UKVY 4MVJA 4C3VA 3KXPA 5IC5A 5IRCD 5J47A 2OKCA 1ESDA 3RC1A 1Y5NA 3IAEA 4JOQA 5K0LA 3RK4A 2HSDA 5CK5A 5IJWA 5CA0F 5TMPA 3L8EA 1W52X 2OP0A 4CF7A 1BU8A 4BLUA 4QUKA 1T4DA 1XJCA 1CIJA 4JOBA 4P32A 2FN3A 4XARA 1W1WA 2IXFA 1UKAA 3QQ5A 2F3SA 5HE9A 3USES 1V9SA 1ND5A 2B21A 4PHTA 5DTJA 2XHZA 4Q4DA 4EPXA 4P3KA 3VHXA 3DEZA 3RO7A 5JFGA 2BFBA 2G8NA 3UH1A 2Z1DA 1EX7A 3ZZMA 6PFKA 5AW3A 4QHTA 2WIGA 3BWMA 4MW2A 1O9GA 1LBSA 1SCBA 3ROZA 1V8FA 3G89A 3I56B 1N7IA 2XKKA 4L8WB 1LV8A 4RM0A 4N65A 3ZY6A 2RBKA 2FLWA 3CF6R 3R2JA 4EUKA 3QBEA 3F46A 3LECA 3T5BA 3TSWA 3NANA 1JF8A 1TGYA 4JBYA 2C9DA 1NY5A 4YP1A 2Z2YA 1HC7A 4WLEA 4ZK6A 3O83A 5G0TA 5C51B 2NVBA 4KSBA 4XOPA 4N5HX 5LMCA 4QQ8A 2XZOA 1S3SA 1JHRA 4MVJE 3EEIA 1JQBA 5JH7B 1XA3A 1WZUA 1CZNA 4EAQA 1H3EA 1MW8X 3QU5A 4X93A 2QT1A 1ZM3A 1W5FA 1CB0A 3KSUA 3TBHA 1XKXA 1AU9A 3H2YA 4OJNA 3RS7A 2PZJA 4BBJA 5C3MA 4W5NA 5I7RA 2DCMA 1ULUA 3ZW9A 2EIHA 4A8TA 5BSXA 5KNLA 2FEWB 1R2QA 1UIRA 5LMUB 2LGJA 5I7UA 5K2OA 2QTHA 3VM6A 1NXSA 3KBBA 1XNJA 2HPHA 3PC2A 4FYIA 4F4UA 1EQ2A 2PGIA 1VJ1A 3O47A 1JJAA 2TS1A 3QF4A 4Q7LA 4X24A 3VJLA 1BKSB 4J3FA 4B8ZA 1X1DA 1KY5A 3UG6A 2E1BA 3I04M 3JZAA 2WB4A 4Z4UA 4G1FA 4K9KA 5BWLA 1LRJA 1UBMS 2BF4A 2C88A 2QJRA 4RXTA 2G9NA 4EJFA 5DVZA 4P7JA 4PR0A 1IQRA 1N0IA 1XPOA 1GNPA 2BI7A 2WNSA 2LR0A 5C1IA 5DNDA 4RWZA 4NBSA 4MJLA 4JI4B 3C14C 1YZKA 1V45E 2BY4A 1DJOA 4KDCA 4NYJQ 1SRRA 2Q5HA 1W0JA 2V4UA 3CEPB 1XAHA 2IS6A 1DC6A 5EXPA 1ECCA 1PG5A 1RXUA 1Y8CA 1R3UA 2PFGA 3E53A 4QUJA 3RRZA 1GL9B 1K8AD 3M6VA 1VQ9B 4L78A 5C8ZA 3SMVA 2VHYA 3DLCA 5AXCA 1DP4A 1IXZA 1ZINA 1D2RA 2DPGA 4JLAA 1B74A 5BR1A 1E99A 3RJ9A 5K4AA 2X0DA 1SUFA 4O4JF 1NVDA 3UHPA 1VQNB 3CKKA 3KL9A 2JIDA 3HYRA 3PC4A 3Q3VA 1QH1B 1XAIA 2F1LA 2NZ2A 2RH9B 3OHSX 2WQ7A 3I42A 1G59A 3EUWA 1E1QA 2E37A 3TIVA 3NBMA 2HY7A 2RH5A 4MKIA 4OCZA 2CVFA 4U5QA 5JQGA 1E79D 3CLRC 5AJTA 4CNBA 4WX2B 4MR7A 5IABA 2NSYA 1HY3A 1KYVA 1W5EA 3FHJA 4WERA 5GOZA 2PMBA 4NWIA 1MO5A 2AMFA 2W6PA 4E70A 1HK7A 4P2NA 1OC2A 1N6KA 1SKMA 2VDVE 1BTOA 1Q1BA 2EDAA 1AUPA 1E5DA 2VQSA 2CXNA 2D13A 2VYVA 4Y9SA 3W0LB 2EFDB 3G0DA 3MAAC 1OPXA 1HZZC 3EA5A 3HZOA 4FS8A 4ZXFA 3M6AA 3SC2A 3ZE2B 1K5HA 1DKOA 4PZCA 1P3Y1 1QGDA 2C07A 2VXYA 2B1IA 1J00A 4ID3A 3CTAA 2AOUB 3CZPA 4IOLA 1PF7E 4ROTA 2UDPA 1WPGA 4INZA 3T95A 2C4TA 5J23A 4W5QA 2R65A 1VL6A 3TRIA 3UZUA 1QVGB 2BBOA 3EZNA 2XX3A 1BSVA 3LL7A 4B6RA 5JFOA 3WKEA 1QFZA 4LS3A 1EDBA 2WJZB 3PF8A 4TVBA 4I6GA 1GO2A 4E5NA 1K08A 1AVTA 1OKKD 3L8GA 3OEHD 4LGMA 1FW8A 5LQMA 4QASA 3PUKA 2W00A 1CY8A 4UNSA 4Q24A 2CLOB 4WJKB 4YAIA 2P9BA 5IANA 4CEJB 2WNHA 1VP9A 1SUEA 3IO3A 5C1BA 2PZFA 1A88A 2CUKA 2R2GA 3BMQA 4D5EA 5FLXA 4LZAA 1C30A 2FRXA 3LO5A 2BBWA 4PFQA 2QYHA 5JSUA 2QUAA 2IU6A 2ZJ1A 1NB0A 1YB7A 1JAYA 2XQGA 1DEAA 4OBBA 2X41A 3NVDA 5B1HA 5IKMA 1L8XA 5IEBA 4N03A 5EIAA 1J22A 3L0DA 5I8WA 3PKZA 2MINB 5IG2A 1D2CA 4TL6A 1ZU4A 2HU5A 5IXJA 4R2LA 3UKDA 4BMSA 1REQA 1YBAA 2CFRA 3SI7A 5A0FA 4YMSA 3I9JA 2P4HX 4HGYA 4L95C 4YELA 2ZZGA 1CTQA 1E4EB 3I5UA 5ALJA 2H2FA 4JCCA 1V37A 2QRGA 4NYMR 1MEJA 1QDLB 1X1BA 1SQSA 4DWWA 5I48A 2HD4A 2BGLA 2C9CA 2HK6A 2EX1A 1VL1A 2GAAA 3OLYA 4H1HA 2OYCA 4WZTA 3D2BA 3OEED 4UHJA 5KSWB 2ODEA 1Q6YA 3KQWA 3MM4A 1QHNA 4MQEB 5SYNA 1P60A 4AZ0A 5L6LB 1Z8DA 1JIQA 2BHRA 2G9VA 4KB5A 2JGFA 1JI0A 3A1EA 2UUCB 5FA8A 1ZR4A 1K1EA 3NHJA 5TMDA 4B4DA 1YS4A 2E4ZA 3OMWA 3RLIA 3NETA 2OWEA 2Q5JA 4XDHA 4F85A 5ALVA 1Y7HA 4P8RA 5EJ5A 4CLHA 2QT9A 2J3QA 2JJ1D 1U9IC 1XTQA 2P30A 2R1ZA 1WW3A 3ROPA 4X97A 2OZEA 1XZFA 2GA9A 2YHBA 2Q6VA 1Q7GA 4YV2A 3MK31 4R51A 3JQ8A 4KQ2A 4WMLA 1SBIA 3RF7A 3RAFC 4N3NA 4M7WA 3TG8A 1FDOA 4RCYA 1M2FA 2PZAA 3A1NA 3CLSD 2HC9A 3L92A 4REMA 2CB0A 4V03A 5DI9A 2IU3A 2ZB7A 3HA3A 2EV9A 3PNOA 3UJ8A 2B61A 4EY8A 4M1SA 4BQEA 2GBCA 1KH1A 3M6FA 1TKRA 3OZBA 3E15A 3QPCA 5TGDA 2LD4A 3WP0A 4YRJA 1JTFA 4EA9A 3PITA 2XOXA 3OX1A 3RSLA 2A9RA 3WNDA 3VSBA 3GELA 2JKZA 4P7KA 1RAHA 1FU8A 4LG1A 3U31A 4P36A 1K7YA 2HSJA 4IEIA 3OLWA 1PP4A 1SIOA 1HZJA 1B42A 1L3CA 3QVVA 3GB9A 1TU4A 5DLYA 4OIMA 1WAMA 4NPAA 1JQJC 2Q5FA 3FPPA 1DHRA 3NEJA 4M7OA 4XPIA 4BN5A 1UBOS 4AS3A 2NSJA 3IUSA 3TBFA 1O6ZA 4DXDA 1N5MA 2I1QA 4R0MA 1RAGA 3UW3A 4R98A 3AINA 4ALIA 5FBVB 2H7XA 2LPMA 3UGKA 2AG5A 2FG5A 5G41A 3HNRA 4IXMA 2WYRA 4QRDA 3T1NA 2MYNA 3H16A 2OQVA 5JU6A 3WLMA 1VLJA 1DIRA 3X0DA 3B1JA 1E18A 3IDAA 1H6DA 3QUAA 3VPXA 3ZZ1A 3DVQX 4DILA 5C1OA 1NHGA 2EAUA 5KHOC 5CCEA 1Z45A 2A35A 3DZJA 3LFTA 2Z98A 3E7PA 3L5KA 4QDXA 4ZAYA 6CHYA 2IIBA 1XU7A 3LVQE 1TNDA 1Z37A 1ZD3A 5BQPA 4G01B 1EP3B 1YQEA 5AUNB 5F77A 1ECGA 2E6KA 2G1PA 3AIKA 2DM6A 1XT6A 2ZCVA 4X1IB 5A9TA 1KBZA 2BM9A 3DV2A 3V2GA 3WB0A 4BV3A 1E2QA 3M5PA 5DN6D 1GCIA 1QHEA 3TINA 1BDHA 1Z6AA 1V6AA 2D59A 3L1VA 1YS6A 1VG1A 2C5SA 4H77A 3WWYA 2JAXA 2O8DA 4QUBA 4RQAA 4YS6A 1NJ5A 1BW9B 2GGSA 2XMCA 4ZI7B 2XXJA 2N1MA 3QSYA 4FE7A 4S2EA 1T2AA 4ISCA 2O6LA 3A04A 4Z8YA 1ZWKA 1IRIA 4J75A 2H1LA 4UVIA 4RDJA 2BMAA 4XVRA 1LBIA 4KLNA 1U2DC 2Z5FA 4FX5A 4GXTA 1RBZA 2V7GA 4RGQA 3UMBA 1PFGA 2GLTA 2YKGA 3BJMA 4PYNA 1V7ZA 4XLHA 3OOJA 1KMHA 4L27A 4OH7A 5G1NA 1WJGA 3VPAA 4E3WA 2X5JO 1ZD5A 3JD2A 5JZSA 3TGLA 4JZYA 1KSJA 1NX6A 1BDIA 1R5NA 2XCIA 1MDBA 2ZVDA 3CH4B 4RV5A 2ZUVA 3LU1A 4HUJA 3P9IA 4YEDA 1VCIA 2O07A 1EUCA 4UEJA 1HQYE 3FRHA 1UADA 2Y1EA 4G5GA 2DUNA 1L5SA 2Q07A 4PIVA 3E22A 1R0BA 3AI2A 3PVZA 4OBXA 1MT3A 3UY4A 2QW1A 2Q3JA 3CXUA 1U0GA 2QNBA 3VAYA 2ZRQA 3EQ2A 3PIDA 2Q4TA 3RT9A 5L4LA 2GVZC 3NNNA 1COWA 2D3WA 3CCQB 4WK2B 1AT1A 1E3MA 3FWZA 2FPOA 3KTFA 3DE1X 3WK8A 4U02A 4B2IA 5IF9A 5GINE 2O19A 4ZQBA 4O2BF 4B80A 2VJMB 4DQXA 5C5IA 4HB3A 4C87A 4DIDA 1UAGA 4EG1A 1T8PA 3PNQA 5JDIA 1FMLA 1ZN9A 4H18A 2VDJA 4HAXA 2O8BB 1SD1A 4QGHA 3HCPA 1O9HA 1N6HA 1P2GA 4UEWA 1YCGA 4A73A 2V9ZA 4FC7A 1FFAA 1TKBA 1M7GA 4C0XA 1B00A 1TQ6A 3SIPA 1XLTA 5CYOA 2XCSB 3DBVO 4AF6A 2PUTA 1QHHB 2Q21A 3MGBA 4Y0AA 5DLDA 1I4LD 2ZPAA 4YJDA 4PNPA 1QCYA 5JJKA 5LIPA 3RIYA 4E15A 2I87A 3ESRA 3O6VA 1IJKA 1P0FA 4MMYB 4DUZB 2CNWA 5IM4A 1WD7A 4RVSA 2R87A 1A9QA 1KZ7B 2YV5A 3PNBA 5C0OE 1NL3A 1V3VA 2CEAA 1VIYA 3AP2A 1Z88A 2Q1WA 3HVHA 4FU0A 3W77A 4ARZB 5JI2E 1XZPA 3RAEC 1WBDA 3JYPA 4YAKA 5IUJC 4I99A 4B7XA 4PAWA 3S0JA 3QELB 4XCXA 1F20A 1U2SA 5E4YA 1G8FA 1T0UA 4LDRA 4E13A 2O3TA 2NZXA 4U0JA 3DC7A 2GM5A 3LPDA 2EGUA 3SLDA 1C8BA 2HK7A 2V6MA 2WU0A 3M6MD 1Z0SA 2FZ5A 3QM1A 4XUCA 3TQQA 2JGDB 5CB4A 4BQSA 3ADOA 4A0SA 5BSFA 3G6KA 1GEEA 1QRAA 2QLFA 5AN9A 2X5OA 3KEFA 1MAWA 2W6JA 1II0A 3BH4A 2JZCA 3I73A 3KZVA 5BN5B 5CFPA 3NHLA 2CNNA 3JAKA 1DBSA 2CF6A 3ZCUA 1BO6A 3KPVA 4FGUA 5IZCC 3AEYA 3I6BA 1ISIA 4IO0A 3RFVA 1PAUA 1EFRA 1ZLYA 1A9OA 1YJ9B 3PBKA 1QUEA 2VDPB 1AQLA 2AUNA 3T4EA 3N8GA 1Y0BA 4UVDA 5ICCA 4P4SB 2MCFA 2WMNB 4N39A 3LLCA 2PMCA 2EXXA 2IYSA 3A0RB 3OTWA 1KEKA 1RRKA 2B0CA 1HF3A 3EY4A 5BV7A 5AXBA 2VCHA 5J58A 4ETIA 1O0CA 4B44A 2J9GA 4DR1B 2PIDA 4PANA 5LWHA 1T8TA 2NXEA 5LOVB 3C7DB 3TQOA 2G80A 3A4LA 4C1BA 5CIQA 1NSYA 3Q38A 3ITEA 5DH9A 4J7XA 4KQXA 3EOAI 4ZAZA 3TOSA 1T4MA 4C14A 5D7NA 4TWAA 1W4ZA 2G09A 3DNPA 1GRQA 1JAXA 3LDGA 5DYTA 4TV9F 4M8LA 4X1YB 1N92A 3JXEA 3QMPA 4E21A 4XGNA 4B81A 1GPYA 1XX6A 3Q3GE 4ERXA 2GESA 4NNPA 1U8FO 1WXQA 1L5QA 4JVMA 4J0DA 5IUNC 3K2IA 1OGJA 2VUIB 3N2NA 2WOJA 3Q11A 2ZJYA 3GVXA 3W5JA 4MGKR 1HOTA 3F8WA 5TF0A 5K6TA 1F8GA 1RWMA 3EGXB 3LX4A 5JCJD 3OFKA 1P5JA 4MQUA 5T3UA 4DR5B 2P4EA 2YW9A 5BSEA 1U5BA 2WF9A 5B1SA 3DAPA 4URXR 3RU9A 1HDXA 2LWIA 3REFA 1B3RA 5IDVA 3R76A 3UAOA 3ZD7A 3VXKA 5DZSA 1QH0A 1A9XB 1XCOA 4ENPA 1C1DA 3LG2A 1PR0A 4I1PA 2R7MA 1M1XB 5AK4A 5FOTA 2VT3A 4B5LA 2QV0A 3EPRA 5BXYA 1DTEA 1TPZA 3L6OO 2WJPA 2YYYA 4YO7A 4N49A 4ESHA 1E1QD 1V2GA 3TOCA 1NXTA 4E94A 3KOMA 4B4KA 1DSSG 4F6LA 3C41J 1N3IA 4ZO7A 3Q85A 2OZKA 5JJIA 1U7PA 1KDOA 3V76A 4I7EA 1T5OA 1R8XA 1RPZA 2R96A 2WP0A 4GX1A 2KJQA 3I6IA 4NARA 3V7WA 3GH3A 3VVMA 1X8JA 1YR8A 2VYVD 3PPIA 3ZD9A 4US2R 5CAEB 1PW7A 1GITA 2NVUA 1PD1A 4P1VA 1EUDA 1II8B 2E4WA 1BQ3A 2YZ2A 1MB3A 5GIPE 3DGFC 3LYUA 1EVQA 4ZTUB 3HPRA 3TQHA 5D51S 5HP4A 4W8HA 4MA5A 2DYIA 4MWEA 5B6IA 3CCLB 3JARA 1BQ4A 1TO1E 2WIBA 1A9PA 5ES3A 1QR6A 1O1YA 1TVKA 3AQ4A 1Z28A 4Q03A 1TQ4A 3SJCA 4DRXA 3ZPNA 4DA8A 1Z38A 2QUIA 5E8RA 2V98A 4F11A 3UW1A 1IWBB 3RJMA 1IJFA 3QMWA 1E8MA 3MWGA 3QH4A 3IDOA 1BVRA 4NIMA 5J5VA 4BZXA 3QUTA 4IIGA 1Y9ZA 1YCFA 4M89A 2E89A 4KXUA 2VSNA 3C3CA 1Q50A 4PAQA 2JGJA 3G2NA 2OLKA 3JQAB 3H5IA 3KTAA 4TSFA 3GMDA 3NV9A 3ON5A 5KJFA 2QPLA 4G26A 3R9WA 1G64A 1YJQA 3KPYA 3N2YA 4ARAA 4H0CA 2RGNA 5FUQA 4ZU6X 1P81A 2BTQB 4K0KB 4BYMA 1S7GA 3O4VA 5DHPA 4DC0A 3IEIA 1W5SA 3NM5A 4JIMA 3C24A 3ZCSA 3Q6RA 4BJ5A 1WETA 3K8YA 2I6XA 3OA2A 4MNTA 4XIIA 4DK1A 1K7EB 3LO8A 1TUEA 3JCZA 4HYYA 2IH5A 4G1CA 3ZHBA 1JQ3A 2ZANA 3T5TA 2VTEA 3G1TA 1E4VA 1IHXA 2Q62A 4JBXA 3ILHA 3RVRA 3EGDB 5I4KA 2ADFA 3WADA 3Q8LA 3QG1A 3W5SA 1SKYB 1OH7A 1JLMA 3WWPA 1EUQA 1C4OA 1HQKA 2K7ZA 3DNMA 3L7KA 2I7CA 1IY8A 3BFPA 5EMKA 2D06A 2WWXA 2OPHA 1XQYA 1E3EA 2PUVA 3USCS 5B7PA 1JG1A 3RYHA 1T2EA 4JBGA 4L8JA 5H9WA 1XMXA 4ZC1A 4X00A 3RVJA 4Q4AA 2GH1A 3RRFA 1B6GA 2QP3A 2A9PA 1Q7CA 4QOJA 4YMGA 1C1YA 3LQ6A 2M32A 4B33A 1XUOA 1A3CA 2I2WA 3S2GA 2HF9A 4Q9LA 4DYHA 2ZYVX 5ALKA 1CXZA 1U3FA 3U2QA 3KKNA 4Q3NA 3PVCA 1XN1A 3Q8WA 5IK2D 4Z4WA 4M8KA 1WXXA 3VC3A 2CCJA 4YMHA 2SNIE 2FH5B 5GIOE 3NVAA 1HSZA 1R0CA 1F2UB 4NEQA 2GSDA 3H4IA 2HEIA 5DX0A 4PG4A 1SA0B 3ZWBA 1CDDA 3E8SA 2JH9A 3QPBA 1L4UA 1P8AA 4I5FA 3HN2A 4QGBA 4AZ3B 1B0AA 1CQJA 1GQYA 3AKDA 4XQ0A 1LPSA 1K3UB 4EH1A 4RKEA 2ZSIA 4W1SA 5I4IA 2GI4A 2R5NA 3C5WP 2B83A 1JJIA 1ETUA 1UD3A 3C4VA 3IQDB 3R3JA 4GG1A 3TNYA 4FMDF 5FORA 1R4NB 2WWHA 1BMFD 4DDHA 1HT3A 1ULHA 3FSEA 1IVSA 3INTA 4D8YA 3AVYA 4MJXA 1QX4A 2BVNA 2PE3A 1G98A 4MQ4A 3AU8A 1RIFA 1AS2A 3HU1A 3K6RA 3PYMA 4KWEA 3OZTA 2D3LA 1JWBB 3FH0A 3IESA 5CP8A 3TOXA 2EP8A 3H4VA 4OKNA 3B6JA 3FHCB 2G9UA 4TVKA 1R16A 2V9CA 3T9DA 4CGYA 1M10A 1R10A 4IIJA 2GEJA 5KCMA 4BVJA 4CW7A 4L0QA 3HDTA 5K9ZA 2AZTA 1XD2B 3FF4A 4FHCA 4GBJA 3A4YA 4ZRNA 5AM5A 2PMWB 4LWQA 4BGEA 3K6SA 3MMSA 3TRDA 4YRMA 4JHXA 5DM70 2O2HA 2IZ7A 3GJ3A 3MBOA 2EJCA 4PO1A 3MWJA 1I94B 5I01A 2F8SA 1WKVA 4YP5A 1NI4A 3LE8A 4C05A 1V35A 3AW8A 1RQNA 4FGZA 4FQ5A 4B46A 2COUA 4S1PA 5K5EA 3EPHA 4U9UA 1CRPA 3B3FA 2GS9A 1KYIA 4XUGB 1XZBA 4IJVA 4N12A 3W2EA 5JVDF 4E88A 4HTFA 3KYBA 3ZU6A 4HGPA 3MW8A 4WFIA 4JWTA 1W0CA 3B1VA 2ZYIA 3PQFA 2FU5C 5H3HA 2IPLA 2A84A 3LKVA 4HATA 4D45A 1U7TA 1WXIA 2BI4A 1RFLA 2PEYA 1EVEA 4Y6PA 1NYTA 3DO5A 3KT0A 2G6TA 2VJYA 3IOYA 1D2HA 3QBJA 1D1TA 3ASRA 2BHSA 1RHUA 4M49A 4LIPD 1NKVA 1H4SA 2BSXA 3EZLA 4KXQA 1FNSA 1NWHA 1W8IA 1NRWA 1O08A 5FCDA 3MYYA 4I4NA 3H0CA 4C4OA 4D8VA 2CLKB 1D3AA 3I2JA 1MAUA 4FOOA 4QLAA 4C29A 5HXBA 3X1DA 3UAYA 4PC3A 2Y0DA 1R88A 1Z0JA 3DKPA 3QTTA 2IHKA 3FFWA 4OF4A 5FLEX 2XDQB 3OTGA 3STWA 1U7HA 1OLSA 3SYNA 2MT9A 3HUDA 1VLHA 2OXTA 2X3FA 3ZLJA 1YDFA 1C7FA 1GRVA 4R1OA 2FFJA 2HFKA 2X76A 1ISJA 1T0PA 4WW0A 5EIEA 1AV7A 3ENWA 3ZYCA 2ET6A 4DMFA 4LDNA 2LP4Y 2DT8A 2PWYA 4N4AA 3I01M 1O0BA 3CZCA 1QK5A 3C6MA 2HPZA 2V7QD 3DUFA 1MD9A 4US1R 4PX3A 2HU2A 4RPIA 4X7BA 1IEVA 4TMVA 4PLCA 5KYWB 1YKSA 3L0PA 1VMAA 2VYND 3DXYA 5EHIA 3WNVA 3IMEA 3FZGA 3W5BA 3W04A 1R74A 4QJIA 5BW6B 4XORA 4YC7A 2YS7A 3GF4A 3RSSA 5GGYA 4CMJA 2JFNA 2OXFA 2M1ZA 3Q12A 4G2NA 5EP4A 1FFEA 2FFQA 1XZNA 3UUFA 5EGNA 2IBSA 1EFTA 2EWWA 4GR9A 4LHVA 4JJ8A 2A4MA 4PRYA 4UE2A 2IXDA 4RTPA 1F3LA 2ZULA 1ZUD1 3B1ZA 2CNWD 3ONVA 4DLXA 3GEPA 2QMHA 2WE8A 2CJXA 4C1NA 1VECA 3V4SA 2I6QA 1YQTA 4UPDA 2H1RA 1KJ9A 3CE9A 4N5DA 4O02B 4DDVA 4M54A 5L40A 3MWYW 1I4OA 1TYEB 4TQAA 4TM7A 2OXIA 4JP8A 3HRKA 2OHXA 3NBXX 2JLZA 3ZDYB 3R74A 4YYEA 3L4BC 2APJA 3FYCA 1TTPB 3SIWA 3JQCA 3MD0A 3WXMA 3TSCA 2RGBA 1DG1G 1XV5A 3W2IA