2V7TA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosyl-l-homocysteine and chloride ion
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7tA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7tA01
2V7UA 2C2WA 2V7WA 2ZBUA 2C5HA 4CQJA 5LMZA 2V7TA 2V7XA 2ZBVA 2F4NA 2C4TA 2Q6OA 5B6IA 2Q6IA 1RQPA 2CC2A 2C4UA 2CW5A 2CBXA 2Q6KA 1WU8A 1RQRA 2V7VA 2C5BA 5FIUA 2WR8A 2Q6LA
chains in the Genus database with same CATH superfamily
4NZPA 2Z3ZA 4MAMA 2Y99A 5L4NA 4QUZA 3FSGD 3KKQA 4G97A 5A3SA 1EKXA 3LWBA 1YITB 3PT5A 4L28A 3U3RA 4MR8B 2FX3A 4ZOQI 1XD2A 3TJZA 4MI9A 4GMKA 1FP7A 3DDSA 4B84A 1JT9A 3U60B 1FTYA 4YONB 3T95A 1QFYA 1OX4B 3HVRA 1IQUA 1QG6A 2PKQO 1S89A 2X15A 3I5YA 2M6SA 5HKLA 2EGHA 3L01A 1U7XA 1E2LA 2Z30A 2I33A 721PA 1CRQA 1XDSA 4PM4A 3EDYA 1CETA 1NBIA 1P44A 1ZISA 3R5FA 2X9QA 1L7OA 1RCTE 1TEVA 1X7ZB 2D00A 5F7OA 4RTMA 3CNLA 2XD4A 1H8ED 4P33A 4W8OA 1Y6GA 1CJKC 4UTNA 4ZQCB 2DPYA 4B7AA 2WYIA 2WJPA 3WI7A 4ARIA 1AZWA 1XN4A 2ZUBA 1WB5A 5BR1A 3U4GA 4LW8A 2REOA 5J35A 1A4XA 1JEQA 1XUOA 5CVEA 1V0EA 4CMKA 3LV8A 4JYZA 3QNWA 2WIAA 1C9EA 1GGFA 1MZPA 2FSUA 4LCBA 1K7XB 1NKVA 2VHUA 1BVRA 1NVFA 1T9BA 3QF7A 4MVJI 3V5NA 1Z5UA 2P4UA 3C3WA 4JI4B 2C84A 4J2TA 4PZLA 1ZJJA 1USVA 1GA4A 1J42A 5FBZA 1XFOA 1OXBB 2GHRA 1OU4A 4X1KB 4Y9DA 5BR4A 1UFQA 1W8DA 3NO4A 1P4MA 1KQ3A 3A1WA 4HAOA 3RFCA 3R4VA 4K2AA 1U8YA 2H11A 4YREA 1P5ZB 3NTQA 1SO8A 3TNJA 3P9IA 3TRIA 5BMVA 1QWSA 1XZFA 2XOEA 1FDUA 1U0RA 1K89A 1I3LA 2IHKA 4G1CA 2LIVA 4LNHA 1TD9A 3PIDA 2O8FA 3N6VA 4PLYA 1XLVA 3NFYA 2I7DA 3BK1A 2JFWA 3PNSA 1DO8A 3R6TA 4JR2A 4HNTA 1PLLA 2B6NA 2I99A 3QK7A 5AKLA 2J5XA 1II8B 3WRXA 3OJEA 3CVXA 2NVWA 5TE9A 3PTZA 2RGGA 4OH7A 5CX1A 2LE0A 3HB7A 3D3QA 1UQTA 3T7AA 3W8RA 4Z53A 1VQPB 1MW9X 5B58T 1NVEA 1U9IA 1GU1A 2XRZA 3ZJVA 3I09A 2ZSFA 1DC5A 2F3TA 2GTIA 1LX6A 4H7PA 4RZSA 3I1FA 1XTUA 3UCFA 4WK6A 2G9NA 4Z4EA 2FWJA 4TT3D 3U4CA 4NK5A 3KX2A 1CUYA 3ULKA 1W4BA 2PYDA 1NHWA 4R6XA 1PHRA 3NHUA 3PXUA 4LNAA 4BAGA 2HRZA 1T4CB 4GRIA 5AHWA 4JYAB 3FFXA 3SMVA 1V48A 3WTCA 1WHSA 1UT8A 3IKVA 2OO3A 2P75A 1EAYA 4XPIA 2J3EA 2EFGA 3WNZA 4C0KA 4CFYA 3AERA 3HJCA 3PFBA 4JLKA 2BI7A 2C96A 5D3QA 4ALIA 1SVWA 1ZOOA 1SC6A 5ULLA 2DF8A 4L3VA 5BSKA 5A9RA 3CVWA 5BNTA 1N57A 5JADA 2DU8A 4LMPA 3DYBA 1IH8A 4BY9E 4HRAA 2W00A 1BXGB 5ITZB 3H1GA 3D6MA 4LXXA 1AK1A 4ZCQA 3WBFA 1KI7A 3ZY3A 1DQPA 4FZRA 3T3PB 2PGDA 4Q3NA 4F92B 3RVRA 1E5VA 4ZI7A 4GECA 1XCOA 2DPGA 2IT1A 1OZHA 2D2EA 1JLLB 2DOGA 2PZLA 2RGEA 3DWGA 4N9WA 3TQRA 5H4GA 4RKRA 4IG9A 3JWHA 4B85A 7MDHA 4H08A 4RPGA 1FLNA 2FUG6 1F2UB 1U8FO 2DKFA 3GG9A 4ID3A 5FWYB 2AZXA 1RZUA 3NHAA 1BZYA 1E96A 1PT9A 2YWFA 5ALMA 2V65A 1IZYA 2MR5A 4MKFA 2NZJA 2ZZNA 4BLOA 2V96A 4FGLA 3AP3A 5ADUS 2ANBA 5SZHB 2VHEA 3S2SA 3TK1A 3E7WA 4LBWA 4P22A 3AQ4A 1Q91A 3HQ4O 3JYQA 1OFVA 4HZGA 3T12A 4ZALA 2W4QA 1EPUA 1VHOA 2PKEA 5ALLA 1AUOA 1G63A 2X1VA 5CFRA 4IDDA 2VLIA 2ZWAA 3D8HA 5IT4A 3K2EA 4IVQA 4UHEA 1A7AA 1EX9A 4EGFA 1X38A 3DVLA 3WKBA 4CMJA 4CIYA 4OTZA 5FULA 3Q3GE 1IMOA 2BUAA 1JZSA 1XELA 2GK3A 3C48A 4XQCA 5FOXA 4DNQA 2G8NA 2C2XA 4F6CA 1GRQA 2JHPA 1UXGA 1K3UB 2PGAA 4R71A 3PUKA 2J48A 3QKSA 3TM5A 3TQHA 3QENA 4EVSA 5DJ5A 3OT4A 4D4HA 1EZ4A 5CB8A 3KQKA 4MP3A 1XAGA 2AXPA 1L5HA 1WUIS 2FR0A 3AKEA 2JG3A 3ODPA 3DAHA 2RC5A 4B0PA 3L8DA 4Y1GA 1K7EB 1XCLA 3Q1KA 4MA4A 4TWZA 5D84A 4AF8A 4C7MA 4CTOA 4QRIA 5KVAA 3HP1A 4IDQA 2XGJA 5KAMA 1VBKA 3GR6A 4ISBA 2UVQA 2B1GA 1ZCBA 4UCQA 3BRWA 1O1YA 4DBLC 1HYEA 4ZCIA 1C0IA 1SNYA 3CBGA 5HJ2A 3I9OA 4ZICA 1D5CA 3G5UA 3ZHTA 4GLOA 1GTRA 1FDTA 1GAQA 1WZNA 2OAEA 1U8CB 1PV2A 1RRMA 1MJ5A 3D5EA 3PITA 4G5OA 2P11A 1UXOA 1A2BA 1A77A 1CVIA 1E2EA 4UE2A 3ZJ5A 4BNUA 1UK9A 3S2ZA 3ET4A 5GOZA 4D98A 2VJIA 4NBSA 1CEYA 1G20E 1VIMA 2I2BA 3KYDA 8ATCA 1HL7A 1EIZA 2I67A 3HMQA 4UJ5A 1EWTA 2IEDA 3GAZA 3T7DA 4C0XA 4FMDF 3UGQA 1EM8B 3DAYA 3F73A 3GY0A 1XEXB 2AZMA 2BMEA 1ZI6A 2J3LA 2Q3JA 3WYBA 2PFKA 3FKSA 1JLHA 3B48A 3O2JA 4A15A 2YV4A 3ZWWA 1UDWA 1MA3A 2AEFA 3M6FA 3RC9A 4JMLA 3QWFA 5HUQA 4I5IA 4H7HA 5AM5A 2O14A 5CHEA 1WCIB 1Z5NA 2GJRA 1T4MA 4MRNA 4DUPA 1MMFB 3L1HA 1VL6A 5J4HA 2VWQA 2G5TA 2YHUA 5J2TB 3DOHA 1JAZA 2R0QC 2D5BA 5BSUA 4H1TA 5HS6A 2YDXA 2YYYA 2BR3A 2OBNA 3R1IA 4WZEA 3I2FA 4IDFA 2IA5A 3WGQA 4AF6A 4NABA 3AJRA 2R79A 2N3ZA 1T2AA 5DYWA 2HI0A 1XMIA 4OPOA 1GZ6A 1HGXA 5IKMA 2XCLA 3AW9A 2VYCA 1DIOB 3K92A 1WBJB 3OHSX 2IYYA 1UC9A 5ALGA 1M8PA 3EEYA 1OASA 4M9SA 2VTBB 4RE6A 2XZDA 3ME5A 2FUNB 5HBRA 4O1MA 2VQSA 2ZCVA 1RWPA 2H06A 4XD2A 4AN1A 4JI2B 2HPZA 2PLRA 3KCNA 4V0OA 4BMYA 4N3GA 1EGQA 2G07A 2RARA 4WWVA 2XITA 3DMFA 3GT3A 4XR6A 4K87A 4OHCA 4OH1A 4QQKA 5F5LA 3BFJA 3FWNA 4NHEA 4GYKA 5ICSA 3D1VA 3TZCA 4PSAA 1SELA 1J07A 3QW2A 1EUYA 4WVLA 3NDIA 4Q1AA 4BC1A 4BMVA 2ZS8A 4QTXA 4DBLE 3GRKA 5LZ5A 2IHBA 1H9CA 1KQOA 1U7UA 4PQYA 3VO1A 4OXNA 4CI0B 3GBPA 1WXEA 4CGZA 3D8TA 3N58A 2ZB3A 3GN2A 4P3NA 5DTRA 4AMBA 2Y1KA 1R4NB 2EBWA 5EHXA 4QBKA 5EGNA 5IYZF 2IBTA 1CY7A 2EJVA 4KO8A 2J7PA 1E3WB 4CNBA 3A26A 2CLDX 3B6KA 1I3KA 3DMYA 2JGDB 4OUDA 4EPVA 1QFXA 2QVGA 3E2PA 4ENSA 3PUIA 5HCNA 4LYFA 1DIAA 2H1LA 2MYPA 3GLFA 4YMUA 1NBOA 1JDZA 3RI3A 4BPBA 4Z54A 2VDVE 4GRAA 2I91A 1RHUA 2EFDB 2BUBA 4NX2A 2P9FA 1UFRA 3E3LA 3R23A 1E2UA 5JTUA 3NUGA 2JLUA 2AS0A 1TC1A 1B4DA 4E14A 1DC4A 4P7GA 1XNRB 4M54A 5AI6A 4KAFA 8MHTA 1SKYB 5BVHB 4QGGA 1JIQA 3N2NA 2X6QA 4FR2A 3U7JA 4I50F 3VZPA 4RDKA 1SCDA 2WZDA 3KKLA 5B1YA 1PFKA 4RHEA 3FCUB 4XDZA 4ENTA 1G3RA 1N6NA 1Z0ZA 2FOXA 1PR3A 2Y2UA 3E8XA 3VNUA 1MDFA 3DEHA 3IAS1 4RK4A 4JXZA 2F4NA 2F2TA 2WUWE 3JD1A 2XYGA 4OK3A 5EC8A 1KE1A 2FMFA 4G5RA 4UCXA 5FF9A 5AW4A 2JLZA 2XKKA 2RGDA 1Q74A 3BD9A 3AVWA 1K6EA 1P75A 4U0JA 3L6OO 2X8WA 4LXQA 4FDMA 1BYUA 3DEZA 5GVRA 2TMYA 3KQSA 4QARA 4WXMA 3Q87B 2O8DB 1IBCA 2NYRA 1QJCA 4FMCB 2J9XB 4N82A 1X7WB 3WRYA 1E99A 2JLAA 1L7QA 3P20A 2Y66A 4GWGA 1HEUA 1S2NA 2JI7A 5JCOC 1FRZA 2HU7A 3W3AH 3RVBA 3N07A 3AHGA 1PWEA 4LECA 5FYDA 3U3KA 1N32B 4K03A 1IOWA 4PIPA 4F38A 5BUQA 1PG2A 3ZLTA 4EYGA 5PGMA 1SCUA 4E32A 1C1DA 4WEQA 5EMNA 1ZPDA 1C29B 1MRNA 3LVBA 3QF4A 1LVHA 2GZHA 3VSEA 1XCJA 3WHKA 4EPTA 1W88A 3AR3A 5TQJA 5LP6C 3KFXA 4O2BF 1K8YB 1C2TA 3EE6A 5I9BA 2E18A 3ZGYA 3KJIA 3LGAA 1D8AA 1XK6A 2GYWA 2NQ8A 3WJAA 5K09A 2JIMA 1ZCZA 4B35A 3K6JA 5DRTA 1YLOA 1GTSA 1DO2A 2QNBA 4Q7QA 2YY5A 2VNJA 1DAKA 1N6LA 2PH7A 2PSDA 4RD2A 3I8SA 5LWHA 3B5EA 4RHTA 1Y9ZA 3BSYA 3GVJA 1I1QB 4YRSA 2BFFB 3U0BA 1J9ZA 4FR5A 4NYIR 4Q6WA 5AVOA 5AW7A 4RS4A 2LCFA 3H83A 1D1PA 1GA1A 5KDOA 4HAYA 3QFSA 1QVRA 5CVDA 1DRKA 1E6CA 4GKBA 2FEOA 4OFWA 1CS0A 1TKRA 5JXGA 1PF7E 5KYXB 1I32A 1R9MA 3WIVA 5EAIA 5AVTA 3A9SA 4I9NA 3WDSA 5JI2E 3VDNB 2C04A 1BG6A 1B74A 3VO9A 1WPQA 3L4SO 2JBAA 2Y71A 2JI9A 2WSLA 1LBEA 1SA0B 4BAUA 4G2TA 3WZMA 4F8EA 4IEIA 2FNAA 4ZAZA 3A1SA 2YNMA 1E7WA 3R9WA 2QPOA 1A9YA 3P9SA 4A5OA 3UN1A 2DFKB 1NJID 2NXNA 2GTHA 4RESA 2YN4A 1JBQA 2CSUA 2PANA 1YJAA 3UHAA 3HVUA 5HFNA 4NCHA 4RTLA 5I7VA 4YJ2A 4Z0NA 2P3QA 3LF1A 4Y8VA 3LVFO 4GX2A 4M1WA 3R4CA 3GRYA 4I55A 1UPXA 1CD5A 3H4MA 3TR0A 2GD6A 4I1IA 1CUEA 1SBYA 1X9GA 3GSIA 1KMCA 1FFDA 3IP1A 4KKUA 4EFDA 4BX3A 2I4TA 2IEAA 4PC7A 3MJTA 3WIDA 4M49A 1WVIA 3ZGXA 1ZUNA 2YZKA 2PJRA 5CDSA 2NZXA 2EC5A 5KW9A 4WZAA 1ICEA 5G0UA 3DMDA 5IT0A 3H18A 1RXEA 3DE2X 1JH9A 2PBFA 3LUCA 5EJEA 2FSVC 4LC1A 5KTSA 2JCVA 4UU8A 3B9RA 2FOLA 4HAXA 4J0DA 3PLNA 4MARA 5FLKA 1NI4B 4HY3A 4KFUA 5H81A 4D6YA 2RGXA 4DQLA 3B6MA 1EH5A 2QB5A 3KM0A 2C7RA 2LKDA 4R9SA 4YDHB 3VYSB 4II3A 1CKEA 2J5QA 2XMRA 3DMTA 4YI5A 1Z3CA 2RHLA 3H1PA 2IUEA 1GU7A 3IKJA 2OBFA 4RX1A 3L7OA 1SFRA 4X41A 1B6TA 1E4OA 5ALJA 2F8TA 3E9QA 1PWYE 4F9TA 5KTYA 4BP8A 4S3MA 2QD1A 4DA9A 1O6GA 1U1EA 4L5JA 1FBTA 2YXEA 4S12A 2J4CA 1CRZA 3KXKA 1ZL2A 2V9CA 2QRLA 4ZCRA 3STHA 4TTIA 1B7GO 3ONUA 3ZU3A 1A88A 2WKQA 5LCXA 2HA7A 1FJ2A 4TS3A 3K8ZA 4CMEA 2CMHA 4HGRA 3ZKWB 1IXYA 3ABQB 3E81A 4CBVA 3CN9A 3O21A 2NO0A 1I4LD 3DPIA 4I8DA 4IFBA 1MH9A 3RSCA 3MMXA 4CIVA 3OU6A 5D3MB 2B69A 4M9CA 1VE1A 3BJMA 5DHFA 5DN9A 2CXSA 4MWOA 3T1HB 1JKXA 5IVDA 2Q2WA 2QS9A 1E3EA 2Z1NA 4UNPA 4CCYB 1QFMA 4AKEA 5EIBD 2UU9B 1AN9A 1W8IA 2R85A 5SY6A 5LXTB 3NHPA 4NS1A 3KL9A 4QBFA 4IUYA 4FB5A 1L7EA 4G1VA 4AY4A 5L3VA 4H3VA 4LSWA 1N9GB 1P72A 4E12A 2OKCA 5CA0B 2QTAA 2JFFA 2PVSA 4NBKA 3EXHC 2OYRA 1SOUA 2R1UA 4MLDA 3ITDA 4Q6BA 5LLSA 4BO4A 1DXOA 1A2KC 3PQ3A 4E51A 4O4LB 2BTEA 1Z83A 3DT6A 1DPFA 1ZESA 2YUIA 3NHFA 2IVFA 4XN3A 2QNIA 2VDNB 3IJ5A 4PFQA 4WK4B 3OPYA 3UK7A 1DQSA 1U2DA 3U37A 3BMNB 5FPKA 3FWZA 2AMJA 4YJFB 1KNXA 1V7QA 2AR0A 5TY0A 2HBQA 2QM3A 3B1FA 3AF2A 3U1TA 4AICA 4BEJA 4CKEA 4BXOA 2FWPA 3L3BA 4DC9A 2G6TA 3RRJA 5IDWA 1PEYA 4KPEC 3OJFA 4FDVA 4L4YA 1W1IA 3IDOA 5DULA 3AVVA 1DKMA 3EGWA 4HDKA 1CULC 2GYYA 4CI9A 5AW3A 1V9LA 2YFYA 1AUVA 2F64A 5P21A 3SHQA 1EG2A 5BW8A 3IP7A 3B7PA 5IYWA 4HYYA 5AT1A 2I34A 5C7IO 3G0IA 1O2DA 2ZI4A 1T5OA 3WBKA 2ZBDA 3ORHA 4R1NA 4US2R 1SZCA 5CAEB 3VVBA 3GCDA 3P0IA 4KEAA 3JRWA 2EOAA 2QHXA 3SYLA 1N5KA 2OL4A 3OO0A 4NL4H 3QYPA 3W4IA 3LSYA 3NATA 3P9XA 4OOSA 1UJCA 4GW3A 4LJ4A 3CG4A 3CMAB 2NWQA 4ZJZA 2XEDA 3DD5A 3GQBA 3TZ6A 3K9FC 2Q27A 4FOLA 3W78A 4ACAA 3OZEA 4IJKA 3VV3A 4AT1A 5ICMA 1LSOA 1VCHA 4JBLA 2RI0A 2WMDA 3Q5DA 2YQZA 3AEQA 3KPVA 2P0YA 4PG8A 1GZ4A 4GOOD 5KQSA 2AXNA 4GI2A 4N39A 5A7FA 3OJLA 4FC6A 1G17A 4QDJA 2CW5A 5GV8A 1HO3A 1ZI9A 4FNMA 1H0HA 5SV2A 3OQVA 1FRVA 2A5JA 3ROFA 2PV0A 1CY6A 1QZUA 2H5LA 4FYIA 1NVDA 4BX2A 4ZQHA 2C2HA 1O5IA 3OE5A 4B45A 3W3AD 4W7IA 2JEYA 4NIMA 4JC5A 2FB9A 2PS9A 1T91A 3MRXA 3FUXA 3FPJA 3QVWA 1NVUQ 4LZZA 3U62A 1UDBA 2ZRCA 1XZJA 1ORHA 3ESDA 3PA1A 4YT5A 3ZV7A 1N3LA 1J2EA 2SECE 1Q15A 3BHNA 3KUUA 4BMSA 2ZRAA 1QYDA 4KI7A 4Z9AA 2H1HA 1HV8A 3HO6A 3QPDA 4L8JA 4LRTB 1VHDA 2Q0HA 3R7LA 1N3IA 3MT7A 3QNMA 4CEHA 3I1IA 5DHAA 1JG3A 2VJNA 5EWMA 2C4UA 1F4VA 2D3TA 1MB3A 3IUSA 3NETA 2PSJA 3SBEA 2FPGA 2BMJA 4B43A 1WX1A 4BVJA 2FGJA 2EGGA 4S35A 4QOJA 3D4LA 3UUEA 4B3IA 1I8TA 4EGAA 4P31A 4LOLA 1D2NA 3T5CA 1Z56C 2ZQZA 5I9IA 1I6WA 2IOHA 2ODEA 3UWSA 5JISA 3EGXB 3GK3A 4OHUA 3HZHA 4Q9KA 2B82A 3BERA 2WU1A 4NEQA 1UPBA 2OXCA 2V9PA 4LJRA 4DM7A 1PQWA 1Z6AA 3EQ7A 1I3CA 5DFAA 4ESOA 1G4AE 3U9SA 1JKIA 5CCBA 2MSDB 5IBQA 3GFTA 3WV5A 4C0LA 4EUHA 3FZEA 4KLAA 2ATVA 2HQ1A 4ZEXA 5KOJB 4X7FA 1PTKA 1VQ7B 1E79D 2ONYA 5LJLA 1YQUA 3GEPA 1TO2E 3CW2A 1CFZA 1SXJD 1U7HA 3EFHA 2D7CA 3SVTA 4MTLA 2PGJA 4HQFA 4YCSA 1XQXA 3M9XA 4AS3A 3K96A 2HO4A 2NXEA 1CLEA 1Z39A 2ROQA 3H1BA 3HB1A 3JSXA 3MWGA 3C6MA 1JLRA 3IVAA 3Q98A 2IP1A 1UBGA 4GEGA 1ONNA 5ALZA 5BSFA 2FY8A 4D0SA 3ZK7A 4L73A 3DUFA 4ZQFA 1W96A 2HTEA 3HP4A 3LUKA 1YAHA 1H2ZA 2CKDA 3TX6A 3OIWA 5J2UA 1KQPA 1MIOB 1VPDA 1CJCA 4LG1A 3HXPA 3GLGB 4YO8A 3ICQB 4RM0A 1Q1BA 4MUAA 2V7XA 2EZ8A 4MWSA 4OP3A 5C1BA 4S04A 4Z3DA 3SVZA 2RMKA 2FUEA 5C46F 2JANA 4BV2A 3EDCA 2M98A 4R1MA 4ZTUB 3GPIA 3PTAA 3PEFA 5ILGA 5CU7A 2QMHA 1UMBB 3CZ4A 3NRJA 4XXHA 3RYIA 5JD4A 4M0DA 4GPEA 3LDAA 4M3NA 4KMOA 3LYLA 1XDUA 1BOFA 4FNOA 2EQAA 4LJ8A 3VDXA 2ZUDA 4D8UA 2ZTLA 5A4AA 3UT5A 1IATA 5LZ4A 2VNKA 2G4LA 1ULHA 3ENZA 3RK0A 3SR4A 1JR3D 2FPWA 3DFZA 1ZNQO 2QGZA 5DMHA 1L5SA 3DXFA 3ZV4A 2GRJA 2ID7A 4PWZA 1XKQA 3WWPA 1CEEA 2H5JA 3KL2A 2Q5JA 4JI6B 1AUPA 4EKNB 1R8YA 5KJ6A 3OLWA 1L4YA 4WUTA 1PVVA 4R0NA 2QTZA 2IDJA 3AI3A 1ZD5A 3TGPA 3Q11A 3VNSA 4OYYA 3ZDEA 2ZT5A 2HCFA 2IIPA 3AHJA 5FUYA 4YHHB 3U4AA 2UVPA 1EUCA 4ITVA 3CU5A 4HC4A 1VLQA 2DFTA 4HGQA 1V71A 4NH0A 3RLFA 2IP2A 3ZJTA 2ZIGA 5KUTA 3O3OB 4KQ1A 3OX1A 1YJ9B 2RAVA 4L6IA 2J46A 1T9CA 2Q5EA 4TWAA 2EDAA 3DPUA 4MOWA 4TROA 4EELA 3GH3A 3VZCA 3QVKA 5LOVB 1I14A 4UVIA 1E9EA 3I9V6 3IAM6 4NXMB 2QX8A 4RH0A 3ANLA 1ECGA 4DA0A 5CGZA 2C2KA 2P9EA 3C85A 3LFHA 5GMOA 1G5IA 2I1VB 2VF8A 4WOKA 4E88A 4F84A 7REQB 1N5JA 1AN0A 2BEJA 5FBLB 3TLKA 4E2WA 3JY6A 3GRPA 1QFZA 1Z36A 3N2KB 3ZE9A 1PWZA 2AJCA 2Z8ZA 2NVUB 3BGSA 1K92A 3CZMA 3LKVA 4PGMA 3QHPA 2FV8A 1E2BA 1OBOA 3AH8A 2YN0A 1JPUA 2Z95A 4HGNA 1X13A 3PDWA 1JDVA 5JE8A 3BXZA 4L27A 4UU0A 2QVBA 4UAUA 1OGYA 5IDQA 5JPDA 4LGMA 4RVSA 3SM9A 4GAEA 1L5WA 3KOWA 1XCBA 3ICOA 2FWMX 4P5PA 2R25B 3CIOA 4NBWA 4YMSA 1RS0A 1CIJA 1O89A 2FUCA 2Z83A 1YXMA 5GOTA 1FFWA 1GSHA 2VL7A 1R27A 1D09A 1V7PC 1GDDA 4FFOA 1HYQA 4M1TA 4RF2A 2R6HA 2O4UX 1FP6A 4Y2GA 4NULA 3WRWA 1VDMA 5BN4B 5G0TA 4MS1A 2OK7A 1XP8A 4Q4JA 1ZAYA 1XYGA 2N9UA 3U5ZB 5TIIA 4HQ6A 1IB6A 2ZJ1A 2GERA 4W5RA 2DJIA 2J0VA 3DTVD 4CKCA 3O4IA 2H2HA 3DBHA 2DRIA 3IP8A 4JLNA 3SD7A 5CBKA 3F6BX 1MJHA 2FZKA 3HZRA 1E9SA 2H5IA 2XXJA 1M7GA 1U4OA 3FW1A 3PRHA 2P27A 2VFAA 3AGPA 4JVNA 3U2QA 1XF9A 2O07A 1ORVA 1VXOA 3PDJA 5T4HA 2D1QA 2HIMA 1PEAA 1ZD4A 2VO1A 3WDKA 3SI7A 2JJ2D 1AD2A 2VYNA 1T13A 4M89A 3FZYA 3JASB 3R77A 3UVEA 1JG1A 4BLUA 2ZTNA 1Q0ZA 1XQ6A 3HI6A 4WZBE 4COKA 3AY7A 1QSGA 1ZIOA 1WO8A 1RJ9B 3ROTA 3LCCA 2J9RA 2ZSJA 1KTIA 1EE2A 4F56A 2M1XA 4LE2A 3CGWA 5EKXA 4IMJB 4KE8A 1NXVA 4MR9A 2GARA 1O5OA 1V3VA 3A6DA 2Q5CA 3EUEA 3JQ8B 1J5XA 1W4ZA 4LMRA 4V2IA 5AJHA 5ALTA 5ERYA 2QA5A 3C7DB 3HA5A 1LLFA 4OJQA 4YMTA 4YCLA 5DW0A 3C3JA 1T1EA 4GL4A 1B41A 1U6KA 4V39A 3D6FA 3GDGA 5E0OA 1NVTA 4MGIR 3QZUA 3K0AA 1C9NA 2ZRGA 4PANA 1TFRA 1T8YA 2IHZA 4RXTA 3MCUA 1KD1D 2JZCA 4GPAA 4RDHA 1G5PA 2YL2A 3BAFA 3L5KA 4R9NA 1T5EA 3HM9A 3VO2A 1WDWB 4HIZA 3K32A 3B70A 2R7NA 4H3KB 1O0BA 4FE4A 2VXBA 3PL5A 1PT6A 4QX6A 3HM2A 2MINA 2VUSA 5ERGB 2O4CA 3KAQA 1QVWA 1IOLA 2MOKA 4BQQA 3COZA 1E1QA 1FSSA 3W79A 3CLUC 3TR6A 3AYZB 1I3MA 3PXCX 4XLFA 3AR7A 2VWGA 2CHQA 3IUYA 5AKHA 3IPYA 5E7MA 4LY0A 2DY1A 1PL0A 1RFLA 2VBGA 3EZGA 3WSVA 4Y0AA 1L2TA 3E5MA 3QLJA 5C8YA 2C94A 1SBIA 1Z26A 2VTKA 3KC2A 3PB3A 4WESA 4DYHA 3VYWA 3A10A 1B43A 3GT7A 2DEUA 1WVGA 1XP5A 3Q2OA 3GRZA 4IL5A 2CDCA 4P1VA 4QYIA 2IF2A 1H3FA 3JATA 3HHEA 4RY2A 1ATIA 3K9HA 3OIUA 3PTLA 3L6EA 4INZA 2Y27A 3A31A 2C7BA 4F7DA 3DVAA 2Q9CA 3GJXC 1J2YA 3IT2A 4G23A 2Z58A 1NAIA 4BGIA 1UZAA 3OG9A 3RH0A 3I9NA 4Q3LA 3IURA 3EQZA 2GD2A 2E6UX 2R87A 2GPBA 4MVJA 2FZVA 2RFLA 2LNDA 3S5UA 1PX0A 3PEYA 3VYRB 3LTEA 1R5NA 4A8PA 5IN4A 3L02A 4XGQA 3SZGA 5HEKA 3AFOA 2R65A 1WXHA 4PABA 2EBFX 2PMFA 4PICA 3MMPA 4QPDA 4BEVA 5MHTA 4JB2A 2PTGA 2RHJA 4EX7A 3C6BA 2EZ4A 4IIDA 4ZU3A 4BU0A 1GGNA 2AL7A 3R3SA 4A8JA 1JHRA 3EASA 4IJQA 5KVQA 4XLLA 1YFKA 4FI3C 4N0QA 2E4WA 3W5JA 4K46A 2D7JA 4BO8A 1SGWA 2HBYA 3I9FA 4X8MA 4WFKA 3SSAA 2ECQA 5ARCA 4OQZA 3R7DA 2BBSA 3I12A 2ZJBA 5EPOA 2JCSA 2EKZA 1Y7IA 4BNGA 3KJEA 2R60A 2X8JB 2J6HA 1G6HA 1GN8A 3NHMA 5LP6F 1HLDA 4BJ1A 3CKKA 1RMQA 1KO4A 4V0LA 3IMGA 2WTNA 4P2NA 1Y7LA 3MLBA 5E3JA 4OHOA 2IV3A 2E1PA 4ARSA 2OCYC 3K72B 5CB4F 5LQMA 4DV0B 2PUDA 2ZJ5A 3GIRA 2CFCA 1UK8A 1VPLA 1XCMA 2ZKIA 4EG0A 1L4UA 3T4XA 1V2GA 4D1YA 5SY4A 1ITZA 4HYQA 2FPLA 4C05A 4TTTS 3WICA 2PE5A 1X9HA 2FWNA 3LY7A 4A0HA 5AHXA 4MV9A 4WLOA 3IYLW 1UMCA 2FZ5A 4LJLA 4N5MA 4WKBA 3F7MA 4TMXA 1CXZA 1GGVA 2ZOSA 2O8EA 3OZ7A 2BKAA 3E22B 2WSIA 3SM3A 4KQGA 4HB2A 3VH3A 4ZTZB 5TPZA 2C0PA 4RXUA 1KGSA 2VBCA 3K15A 1T1GA 3KFLA 3A3OA 4O2RA 5CJ2A 3DULA 4ZGNB 3IALA 3ENNA 2HLHA 3HFSA 1LQUA 5ALXA 1THGA 1IOZA 2PPLA 3X44A 2BFWA 2Q5IA 1FFXB 4BP3A 3AL2A 2DX7A 3G2LA 2CDAA 4DNXA 5ITSA 5MFPA 4EAAA 1YJCA 2GJ8A 5DNVA 2HF2A 1ST3A 2HWYA 4CG1A 1V8DA 2ZTGA 3KZNA 3NEAA 1BDMA 4YAIA 3JSAA 5AI9A 3FYUC 1JKFA 4YCJA 5BQPA 3ZGOA 4H0CA 2ZXHA 2XNHA 3O4GA 2X1HA 4FUQA 2ZDHA 3SWWA 1CX9B 3BYZA 5JG7A 3FTNA 1IULA 1N8TA 3L0IB 1G6Q1 2MSKA 3P27A 5DWVA 3B82A 1BMQA 1UKVY 2ZB7A 3AJEA 2X53S 3KOUA 1JLMA 5ALRA 1YRHA 5JCJA 2PMBA 4MEBA 4KQEA 1HSOA 2FSFA 3E2MA 2FW0A 2LZJA 5CDFA 2OTCA 4LYHA 3SXUA 4N3NA 3DXXA 3ELDA 3KEGA 3HCDA 5KJFA 5ITWA 1NR5A 1T0PA 4O4HA 2REQB 1OWMA 3A4IA 2W8BA 4REQA 1TQDA 2H1SA 2ZWOA 1OY1A 3O8LA 3OMLA 3WB1A 1QYRA 1E9FA 4JJ8A 4KLCA 4QREA 1E2NA 13PKA 2UZ1B 2FDCA 1I5RA 1H0RA 2ST1A 3PQ6A 1E18A 3WNVA 3G9QA 1AKNA 2NT4A 1GYRA 1J8VA 3NNNA 3AOGA 4G2NA 4BE4A 1USGA 4AJIA 3RVDA 3ZZ0A 4B6GA 2VHYA 3T56B 1G2QA 1IN7A 1S3SA 2GAJA 1QR2A 3OT5A 3HXKA 4XR4A 2A94A 3RM3A 1CNEA 3WBBA 2NU7A 3ND8A 4WJKB 1OTXA 2B8JA 3OLYA 4JDPA 4E4TA 1VMDA 1A97A 1PNVA 3BRWD 3KU4A 3TIXB 2FW1A 4AY2A 1XI2A 5H9VA 5FNVF 3ZPXA 3R0XA 1KKLA 4JP3A 2J07A 1JDJA 3DOEA 2GX6A 5K6RA 3II6X 3EFOA 1JE1A 1U1FA 2NTYC 3AUUA 1DQZA 3L6DA 1DEKA 5HZBA 3K0FB 4DCUA 4EPWA 5G1PA 3QVMA 4ENVA 3K70C 4Q7MB 5T8KA 1Z2PX 4XL9A 5FL7A 4WFJA 5JS7A 4POOA 4ZCPA 4IDGA 1HEYA 2UAGA 5HF5A 1QJ4A 1ZGCA 3LDGA 2DWPA 1KVUA 5EKTA 3FNHA 3GZ4A 2WLSA 1G7TA 2YJTD 1T34A 5LVAA 3FKSD 3IKMB 2NAPA 4AIRA 3CMEB 2J7KA 2E85A 3AIKA 5CH5A 2Y2VA 4YJGA 2VQ6A 1VCIA 2ZAYA 1OYYA 1QYIA 2GJ9A 5HIAA 1PGJA 5ALSA 3JD2A 2ZIAA 4WACA 3OOHA 1WTHD 2R97A 3T94A 4ZODA 5IYZB 4HX5A 1E66A 2B78A 4UVEA 1WUYA 3H65A 4B3RB 1VP9A 1Q1QA 2CXHA 1P1FA 1N2CA 2G1UA 2GT1A 2MHCA 3TD6A 3SIRA 4NAHA 5BNWA 1T5LA 1NBMA 1YZYA 3F5QA 1FZTA 2BZ0A 4OATA 3NQ41 1WTAA 4JOSA 2RKOA 7ADHA 2I66A 4NOKA 1SBQA 4W5OA 2ID4A 3NVAA 4I0WB 5EZSA 3TW4A 4F5EA 4OQPA 1BMFD 4TZKA 1QTQA 4H2DA 1MO5A 4UVGA 2VHJA 3UAVA 1VL1A 1CZKA 4Y9SA 5E6SA 4GBMA 3D0KA 3K09C 1RJFA 3CRMA 1DOZA 3CRRA 3ZZNA 1WBBA 4G07A 3NANA 4UM8B 3ZTYA 4LF8B 1YUBA 1Y9DA 1YKGA 2PUEA 4RPBA 3MBIA 4WK2B 4DY6A 1OH5A 4C2UA 4I50B 3OZVA 4KOEC 4RLZA 1W581 3OU7A 1WMSA 2QVCA 2IXGA 4QVGA 2W43A 3A1UA 1WZEA 2Y4NA 4ZANA 2BLLA 3FYTA 4BNVA 4RPLA 1ISIA 2CVZA 2VSFA 3CH5A 4IDCA 2PAFA 5B4TA 4F04A 4LF9B 4JENA 4ZVSA 3TR5A 3H9NA 2XE6A 3IDQA 4KYUA 3QE0A 4UBLA 4B3HA 3FWYA 4UHKA 5E2AA 2PUAA 3ZVMA 3T7KA 3D4OA 4GQBA 5JNSA 3MHTA 5TC4A 1LPMA 5AOCA 5LN1A 1NVKA 3ADDA 1GTG1 5K0ZA 1KP2A 1T9GS 2V6FA 1MBZA 2W2QA 3B6JA 3S3TA 5KYUB 3Q6QA 1HNXB 2OCDA 2ZIUB 3TOCA 5EQFA 1T9ZA 4ZARA 4EFMA 3IIIA 5JJCA 3ROMA 2Q1SA 1DG3A 5FWXA 1NW9B 4GOJA 2HF7A 2NXCA 4L8WB 4PQFA 1I9GA 2LR0A 4FT4A 1CR2A 1Q0QA 1I1OA 2BCJQ 4M0UA 1U0TA 1GG5A 1WXGA 3V34A 2F1IA 3GDHA 4EYSA 3IB3A 5A5VA 3AESB 2O5EA 4G01B 3TTWA 3BTVA 1C9JA 2W83A 4CV0A 1SHTX 3OTGA 1GEEA 4H3SA 2V7UA 2NV4A 2ZZGA 3H5NA 3PQ7A 3H0CA 1G8JA 4O2BB 1LF0A 1ZIDA 2ZZMA 1EVIA 1YZNA 1E1CB 3O2NA 5EEGA 5AUOB 1Z33A 3ECCA 4O4JA 2XLBA 5IULC 2X9NA 3PBKA 2Z9DA 3C15C 1R8XA 4DV1B 4NK4A 3LH5A 1ISRA 1T9HA 4P81A 4KXQA 1ETUA 3NIFB 5B55A 1U0GA 4XM2A 1ZGJA 4FK8A 3TJRA 2VHXA 1RMYA 5HJEA 1LVUA 2OBSA 5DZSA 3ZCPA 4TTAA 3NJRA 4B83A 3D6NB 2FPXA 3EEQA 1J7KA 2WFLB 3HVIA 3ZNQA 1Q2UA 1FVFA 1VG8A 2QUZA 4XJXA 2XZLA 3FGNA 4FWIB 4QA9A 3GPCA 3R5HA 3OPMA 5F4BA 1Z12A 4NMHA 1IDOA 5DXAA 2BKLA 3AW8A 4D9IA 2JJ1A 4U7GA 1Z7YA 1RLJA 4KKSA 2QORA 1C3VA 3GGDA 2ID9A 3HJTA 4ZO9A 1JKJA 3H9GA 4I1SA 1PNRA 2C8VA 2EVWX 5I9LA 4GR9A 3KEMA 4PG6A 3PE6A 2A0FA 4Q3AA 5AHOA 4DEXA 4UM9B 2UYHA 1W25A 1R9JA 4UTOA 3ZHRA 4DMCA 1MJGM 1T6ZA 1E5XA 1MTOA 4TUYF 2DBRA 3A14A 1Y0YA 3FB1A 1ZNXA 2VEOA 2VYVA 3IPXA 1JJ2B 3FR8A 3GROA 1KU6A 2B3DA 2CXXA 2PFSA 3MNFA 5E1BA 4BLVA 4G1BA 3HCPA 2I7CA 1S6YA 2G7ZA 4E5DA 1CUFA 5A4DA 5I01A 2RI1A 4H0NA 1CR4A 3QEAZ 4DSUA 1SULA 4PGHA 4KE9A 2A1UA 4L8YA 2CJFA 1UBRS 1IY8A 4GO1A 4P34A 2W0SA 4CT5A 4F12A 5JYDA 3WFJA 3PHHA 3BK7A 2WILA 2I2AA 4PHGA 5AW1A 3O6VA 2KS6A 4QKQA 2OMEA 3L0CA 4F85A 4AS1A 3G17A 1Z2NX 2X22A 2RHBA 3D7NA 2ADMA 3OT1B 1SVNA 2YCLA 1JZQA 4BMDA 3AFMA 1GD1O 3KWMA 4D8XA 4I36A 4O4IF 3T0FA 4Q4AA 2VHCA 1RLIA 1ZO8A 2B37A 1SVSA 3NM5A 2VK8A 4OXYA 5IEBA 3TMYA 1EDEA 3MGGA 4UREA 3V42A 3VU8A 2A57A 4NPHA 1DEOA 1NHGA 5IBPA 4NEHB 1AQJA 2B2NA 3NCTA 3QTBA 5TRDA 3AIMA 3DFIA 5H7XA 4BE9A 1Y3DE 2IIQA 2XUQA 2YNMD 3ENWA 3UWOA 5B3AA 3T3OA 3GJ3A 4BKOA 4D46A 2W6QA 2FSGA 5CDUA 1GPYA 4AO6A 1ZIPA 3D2CA 3I0NA 4HRYA 5L3QA 2DFDA 3ZQ4A 1FUYB 4EHLA 1LU9A 4YUWA 1WZCA 3ANTA 2VJLA 2ZIFA 4J0HA 1E9CA 2XDYA 3LX4A 2Q2QA 3X43A 5G53C 4DLNA 1HNNA 1KDOA 3IPCA 1KXZA 4C7XA 5LDDC 4YELA 1GTL1 4LC9A 4GLBA 1VCNA 3OSUA 4FQ5A 4Y1FA 3VUEA 1U3TA 4AQDA 2GF2A 1I0LA 4MB6A 5KQLA 3B8EA 1ZQ1A 2I78A 3NBQA 3JQCA 4MA5A 5KOHA 1N2OA 3A9WA 3LUHA 4L78A 4ZOLA 1DEXA 1O77A 2AD5A 2FEWB 3DAFA 2J3HA 3KZOA 3TEJA 4MUFA 4CYMA 2VDPB 2YS7A 3SC2B 2P2YA 3I76A 1O94A 3WLEA 1TVKA 1WA5A 4J16C 5DYNA 2W6ZA 3K1JA 4QFCA 1BFDA 1J8QA 3IP6A 4B3MB 5CNKA 2FSHA 4DCTA 3AOEC 4Q1VA 4JUBA 4GXTA 4JQZA 9GPBA 2BEVB 4UDYX 1G3MA 1HQCA 4KXWA 4O5AA 4X20B 5AW9A 4DMGA 2EEPA 4MEJA 1WKCA 5TVKA 1N2SA 3MWYW 5K9ZA 3LQ4A 1C7JA 2RGCA 1Z75A 5G40A 1RHJA 2XUGA 1ZSNA 1A8IA 4OHYA 2EHDA 1XPUA 1QAMA 1YB1A 4IIJA 2OCKA 3NKFA 1TZKA 2P6UA 3FMVA 3LWDA 3Q10A 4S0XA 4U1RA 4W6QA 3KOMA 3SSMA 4IUDS 3LQEA 2X8KA 1BCSA 1NKTA 2R7LA 1OCEA 3IJRA 5JJIA 2VCEA 1CQZA 2OV3A 3EFBA 1NMQA 1XMJA 3FHCB 1F0NA 3O7MA 5K0JA 1YHYA 3EA0A 1KY5A 2DP4E 3BWBA 3HYRA 1M10A 5LC1A 4DUYB 2WUEA 3EN0A 1XHLA 2CLIB 2VF7A 3F97A 2ECFA 4IZOA 3S0JA 4HE6A 2FYTA 5IJWA 4WDQA 1Q0RA 3PNYA 2JH8A 3V32A 3ISXA 2FDRA 2FQQA 4DLXA 1BDBA 4Q7LA 1WS6A 3DP9A 3MC1A 3GRCA 2C61A 4KX5A 2C2YA 3RYFA 2L17A 3I2IA 4PN3A 1JTEA 1NUTA 5HGJA 2Q2OA 1NL3A 2OZLA 4MQUA 5CDGA 1V2HE 1BO6A 2FRXA 1U5BA 2VT6A 1Y4SA 3TAHA 4BNXA 3HU2A 2F1MA 1LNQA 1NUQA 1TTQB 2GZ1A 1W36D 3U39A 1NW3A 3JU3A 1KRXA 3COPA 1ILEA 5C8DA 3GJ7A 5EI5A 4IQ8A 3IVGA 2O2JA 3HKBB 1BNCA 2R2AA 3NHRA 1KHHA 4MUHA 1ULZA 4NDNE 3JQGA 2W42A 2VP9A 4BO1A 4MZXA 2PUWA 3G02A 3LX6A 4ZPXA 5JAHA 3ND6A 3VR6H 3WWDA 3GIWA 1N7JA 1AK9A 4W9RA 4AD8A 5F98A 2PXCA 2QAGC 1L8LA 3F7NA 4GXQA 1G64A 1U3WA 2AG5A 2QL6A 4EY7A 2VNIA 1D1QA 1J09A 4BMCA 1P2FA 1Z5WA 3DL4A 4MP8A 2VZ9A 2OTLB 3EWSA 3PRYA 2WM9B 3FPCA 1M1NA 2CL5A 2PZFA 3HFJA 2HCJB 1UXJA 4UZFA 2DG2A 3LT2A 1R4MB 5AOBA 1CJUC 2Q7DA 2PAAA 4PAMA 2AVDA 5AK5A 3KLNA 1JJIA 3R3ZA 2QR2A 4RL6A 2X2PA 3R0IA 3TNYA 1UWLA 1X70A 1Y34E 4CF5A 2QRVA 4PO9A 5TMEA 5ARBA 4I1PA 1H2EA 4CDNA 4YLGA 4K9KA 4C01A 1ZH0A 2PV7A 2VDOB 2VJMB 1E32A 2NQ2C 2WIJA 3OIVA 4UTVA 5BYKA 2WSBA 1X0VA 1IJBA 5DEIA 1C4WA 4B7XA 5IAGA 4C6HA 5JD5A 1AKUA 3OM0A 4JWTA 1KJJA 4E94A 3H2GA 3OLVA 2GEBA 1BXRA 3K8QA 1Y6JA 5GP1A 3EOAI 2Q6KA 4P93A 1DC7A 5IUKC 1UBJS 3EWAA 1GO2A 1RJGA 1UWKA 1A27A 3AI1A 2BD0A 1ESNA 2O0HA 3MM4A 4I3GA 4TKUB 3LS2A 4LOKA 5MDHA 5ELLA 3EXAA 2W2KA 4M0EA 4NNJA 1K6MA 1S7GA 2PFGA 3K0HA 3QU5A 3K30A 4P3OA 3N2YA 4B6SA 1FMTA 1WG8A 5L3SB 1CF2O 4I1UA 3WL8A 5F23A 3M81A 5EJ7A 3VSBA 4UAJA 1C9YA 2VUHB 1ZU4A 2ONZA 4JROA 2DR3A 2R4QA 2X0EA 5JTTA 4UDOA 3A2MA 1E94E 1P4GA 3U7QA 1T0JB 5L45A 1MX5A 1GXSB 4TTSA 5JVDF 1W5AA 3AIIA 3L4BC 4E15A 1QXSA 2KJQA 1ZRMA 4KQXA 4MP6A 4EEXA 5HQ3A 1N75A 2V8BA 2WYHA 1G20B 1L5RA 4HZUB 4HGOA 4E2XA 1QDEA 3KQWA 2BFCB 3C7TA 1MFPA 4NH4A 4C4XA 1GYQA 5JV5A 4FI3F 4KJXA 3CTMA 1LBHA 5L7YA 3I2YX 1N8SA 2E2WA 2FFAA 4ZK6A 2OB2A 3FCSB 1H3EA 1NOJA 1T15A 1ZEMA 2V4MA 2I3GA 1NF3A 1C2YA 1YS4A 5B30A 3J80A 3B6IA 5LBIA 2BE9A 4DMRA 4RC9A 1PNTA 1Z2CA 1Z6ZA 2VUTA 3D02A 3G0GA 3C0KA 3W2GA 3WKEA 5I47A 1G8MA 2D8AA 4O0MA 3U3XA 2Y05A 2NGRA 1H66A 3DYIA 2R62A 5E9WA 4FWTA 1NJ6A 3J7TA 3CCSB 4TTPA 2WFZA 3O7WA 4G8CA 4RLQA 3DW3X 3KR2A 5KWIA 2ZXUA 1RJEA 2GD1O 1L7AA 2E0IA 4UU1A 3AF0A 5KNCD 4N54A 3TIFA 2GCOA 1JWBB 1PD1A 1QE3A 1Z07A 1TD1A 1PK8A 2ZRHA 1RZRD 1UBOS 4GPTA 3C43A 3Q2KA 1IAQA 5HRCA 5CLLA 4LVNA 1GFWA 3O8DA 3F49S 1VRWA 3PR3A 4GOXA 4P4SA 4C30A 3I9MA 5FUXA 3ABRB 4Y6LA 4EF4A 4QQRA 2ZVJA 1E6LA 2PZEA 4RK6A 2ANCA 4N7RA 2NADA 5EXEA 3EXG2 1Z28A 5A7GA 3RUAA 5BW5A 1LBQA 1TGYA 2EWMA 4YCBA 4DRZA 5JMWA 5EKDA 2EATA 4UXIA 3FNGA 1KMNA 4WN9B 2WOJA 5A5DA 2BTOA 4HADA 1W87A 1D2GA 1XTIA 3A4VA 4QJBA 1RHMA 3RU7A 3ZZMA 3RJTA 3QOXA 3SFTA 1XGKA 3FDZA 2BM8A 3FIJA 2OQIA 2HK7A 3HR7A 2D5CA 1WUJS 3N7UA 2CXOA 4IV5A 4JJZA 5EZ6B 3TTVA 4Z4QA 3L41A 2XBLA 1PD0A 4M1QA 3KSMA 4EQ6B 4XN0A 5I45A 1I4DD 4JYCA 5HSGA 1FL9A 1DDOA 2IEIA 3JD3A 3EULA 821PA 3R0ZA 4F46A 3CLSD 3PL1A 4DREA 3O2QB 4X7MA 5THQA 1IPEA 1PFQA 1P5FA 1QANA 4X0CA 1Q3HA 2VNSA 2DKNA 3K35A 3THYB 2PRSA 1A5AB 2GJAA 4PC1A 4DYVA 2IS6A 2FG5A 1UBHS 3UPUA 3LQ1A 5CD9A 1NAHA 3FSJX 2P6OA 3L1UA 4G6ZA 4GI7A 4ZREA 4WXEA 2WK1A 2HCBA 3UTCA 3EVTA 1VTKA 3QLVC 5TV2A 4EOGA 5FOVA 4DNOA 1NVVR 2AJBA 4MHOA 1JJFA 1ADGA 2FX2A 3GOQA 1WSRA 2EBUA 3CRNA 3CRW1 4WBXC 4XB6B 3ZCVA 4DM4A 2AN9A 2IEGA 4IEEA 4RCVA 1VLYA 2G08A 1XXLA 3RLIA 3OZXA 3OOWA 4YRTA 4O08A 3JQDA 4RH1A 4S1WA 2HRBA 4M7RA 5REQB 3S27A 3GLUA 4A82A 2BYTA 2FTKE 3P26A 1JI0A 2IKSA 3FDIA 3WWEA 6REQB 4CL2A 1T9DA 1UBSB 2WWGA 4ANFA 2FP4B 2WIBA 4M87A 4DY4A 3FAKA 1WEHA 4FOSA 3UWMA 3H7AA 2PT7A 3PDHA 3PNLA 1L4HA 4GPBA 1I4WA 3M3DA 4WJZA 3HVJA 3OH8A 4LTDA 1TI7A 4BE7B 2H2FA 2JLQA 4KIJA 1ZH2A 1NVMB 2OFOA 2WU4A 3JALA 4PSDA 2FQWA 1U7TA 3Q7IA 1GN9A 4V3CA 1TIBA 1KBZA 3TI7A 4EB6B 4XORA 5DI9A 1AS0A 1MW8X 4YXFA 2JGEA 2HJRA 4J49A 3KS9A 2F8MA 1EFPA 2HRCA 5JC1A 3NASA 3VR6D 1DTWA 5LBUA 2VKTA 4RABA 4G24A 2XRYA 3GXBA 4B8WA 4QU5A 2CF4A 4UE6A 5AVUA 1BRTA 4DQ0A 1O96B 2I5PO 3BL8A 1FDIA 2VQDA 1YCFA 3CCCA 3F6RA 4HWTA 2F62A 4M0FA 4YP7A 5ALVA 4U7FA 3SNKA 1RYDA 1V35A 4HZIA 4BFUA 1CYDA 3L8EA 3BBPA 5HIKA 3M4ZA 5GJWC 3GAAA 2AWNA 4D3SA 3K0BA 4UTPA 1KDRA 3TMAA 2P4EA 1MOSA 5SZKB 4YT8A 3RAGA 1EP2B 3UB3A 2H5EA 5DF1A 1CR6A 1BH6A 1MV8A 4EKDA 2FF7A 2ZR9A 4LX0A 4MR8A 4MMXB 3H9QA 2XWQA 1M1UA 2ZCUA 2ZYUX 1Y1PA 4IRMA 3JQBA 2VYND 1TU3A 4AL4A 1QKJA 1OX4A 4AURA 1L8XA 3ROXA 3EVCA 1EJ6A 1Z8HA 2ZRIA 3O8NA 4ZDWA 3ZV5A 4A6EA 1H4QA 4ESHA 3MS4A 2VP5A 1YOVA 1DEHA 3NDPA 3KEFA 3LC7O 4LE1A 1M67A 4C88A 1FSGA 2O3SA 4TL7A 3JQPA 3LKDA 5ENZA 1D2EA 1NLZA 3NPMA 3UHOA 3QOFA 3CCLB 3HB5X 4NJMB 2N46A 3Q85A 4D6PA 1LK7A 2WI8A 4UATA 5E2IA 2WYUA 1UKCA 3GT4A 2JJMA 3AUYA 2C3YA 2L69A 4DIMA 5JD6A 3ZE2B 2G7MC 1Y37A 4ZRMA 4NCXA 5CLGA 5IAOA 5IU6A 1PLJA 1TT7A 3X3HA 1DRWA 3I42A 3PCRB 3G6EB 3G1TA 4KIFA 3T5TA 3I6ZA 2P4SA 4ENPA 4XB2A 4D79A 4BTVA 3GFRA 3SQLA 3R6LA 1R6VA 3PHLA 4LSGA 4P3KA 1SVMA 3WGLA 5HM8A 3AEXA 2ZTVA 1DIBA 1YR6A 4MV1A 1HE4A 3MMSA 3IIJA 3VPHA 4Z4ZA 1Z0KA 2Y4OA 1UUFA 3BDIA 3HKDB 4G67A 4X1KA 3IVXA 4YDQA 1QQBA 1NFRA 2GR9A 4FKMA 4TX1A 4TVKA 4BV8A 1R0WA 3ICVA 1E1QD 3MJEA 2QN8A 4F6RA 1C3JA 5IBCA 5I4IA 3K6SA 4RZIA 4NBUA 1N4DA 1XTVA 3IAS6 2ZBQA 2QG4A 3EXG1 2PQ6A 2AQKA 2G3YA 2FZGA 1MGOA 1DINA 1NN0A 2DPXA 2VOEA 2VT7A 3GW8A 4I1YA 4UEWA 3WQBA 4ZYXA 5LP6B 1W1UA 3NHBA 4J91A 4X1IA 1NNEA 1PS8A 2DPMA 5C34B 3UW3A 3D0RA 1KL7A 4F4CA 3OPXA 4KKVA 1Y9AA 4DMKA 5CB4B 4JOQA 3PKZA 5DSTA 4EG3A 5A4MS 5JDIA 3H11B 4MB2A 4BO6A 2YV2A 5CCEA 1X92A 2JGKA 2RGUA 1VXRA 1FMCA 3IV6A 2ZB8A 1J4AA 1YDMA 2HIGA 5G2OA 2EHJA 3SIWA 3IQIX 4EHJA 1BW9A 1PVDA 2YUTA 2XCQA 1YQGA 2YXDA 2ZEJA 3QG5A 4DL9A 1WVMA 2A1TR 1G8GA 1IEXA 3CP2A 1L7BA 4N41A 1L5YA 4NE7A 4WBSA 2QOEA 3D26A 1V0JA 2J0EA 2H3EA 2A0XA 4D57A 1Q1AA 4JUFA 1GRVA 4GNKA 2EG5A 4PRYA 4TTVA 5EWJB 3FHLA 1ABBA 1RM3A 3RYTC 1LWNA 3L7DA 2D54A 4IRXA 5H80A 3L04A 2O48X 1YB2A 5EOVA 4EUFA 1JMVA 5JH7A 5DBGA 4O29A 1VSVA 3GV0A 3MGBA 4LBVA 5KCMA 1BU5A 2QNRA 2OBRA 3C6XA 3IESA 1WUHS 1VYTA 5GZ1A 1BXGA 3X0DA 4RFVA 3ESZA 1NVAA 3CB2A 2YINC 3EZ9A 1E0JA 3PGVA 3NVMB 1Y8RB 4PAGA 4QLAA 3AJ8A 3L93A 2W9XA 1BKYA 1MO3A 2X5NA 3EVAA 5DW3A 4BB5A 4BGUA 3BF8A 3RSHA 5A4IS 5L4SA 1JLLA 1G60A 2JFZA 4B2PA 1OW3B 1YQXA 4GHWA 1QG0A 2OG1A 3FDFA 4Z86A 3WLSA 1ZQ9A 1USKA 3BE8A 2E4XA 2EF0A 4PZCA 2WNSA 3DKRA 1NP3A 1EJBA 4Q1DA 1GZHB 1GPLA 3AC0A 4TKMA 1F2UA 3MRSA 4E7OA 4V1CB 4AC9A 3EPLA 1G5HA 4CFZA 1AGRA 4WIAA 2N1BA 1QGOA 3QVJA 3RJ5A 4LHZA 1C81A 3G8YA 2OSBA 3TFWA 2IH2A 1ZM4A 1Q12A 1XKXA 1HZZC 3AF1A 1QFSA 3BH6A 3BKXA 1PZXA 1TJPB 5HF8A 1E60A 1ZUIA 3N05A 1X3LA 1UK6A 1IUOA 2J4DA 1YR7A 3JQ9A 4PQRA 5E1MA 1XAIA 5TPZD 1THTA 1Z62A 2R7MA 3NT4A 2V8OA 2MYUA 4R8SA 4HEHA 3W7BA 3WWZA 1CE8B 1F8GA 2G4CA 1TL7C 2IY8A 2GAIA 4L5IA 4AY5A 4P5DA 2CJPA 2QWXA 4IZ6A 4LDNA 4GMFA 3KLMX 3EHEA 3OA2A 5M29A 2OGSA 3GFVA 4YVFA 1PKEA 1Z7EA 3QU4A 1JR4A 4HNUA 1CF4A 5FNVB 5JROA 5K2OA 4W1QA 3HCFA 1EE9A 4ERNA 3E1YE 4QOSA 4MR7B 3ZGVA 4H59A 4I5GA 5EJ9A 5G4KA 2Y0BA 3OU2A 2EJWA 4Z9XA 4CM9A 1J5EB 1OI2A 2QZZA 3PC7A 4V2UA 4Q7JB 2C99A 1P1JA 1F2VA 3IBGA 2W6ID 4JLVA 5AKKA 5JCJD 1OLUB 3A36A 1W2BB 1GNLA 2FW9A 3PGJA 4TKZA 3QBJA 1OD6A 5TRTA 1JXAA 5L53A 1LA2A 1QH1A 2JKVA 1YDEA 3OP4A 4MGZR 2CSXA 1MG0A 2H48A 4DNFA 4AZ0B 1UKYA 1EGHA 2PIDA 2ETVA 3QELB 1LRKA 3V1KA 5K4HA 1TKBA 4B6EA 2WWXA 1OF1A 4KV9A 4IJ5A 3PVDA 4PRZA 1SH7A 3BKWA 4Y18A 3ZY2A 2E5LB 1M8GA 2CXUA 4Y7DA 4Q93A 4FYXA 4QYSA 4KPYA 3NZEA 5D5PA 2LXNA 1OYOA 1V6SA 3ETCA 3DMRA 4GH5A 1NSTA 3H5LA 1L5KA 2OCLA 1X3SA 2ZT6A 1CJTC 1VCMA 1Q0TA 3FOAA 1KH3A 5A4KA 2R6CA 4A0SA 5B37A 4JI8B 4QXOA 4B82A 1G19A 5L51A 2QJOA 1VPTA 1B3RA 2JAPA 1H6AA 2PDAA 2P5TB 3DZIA 3FBTA 5CCDA 3NMUF 3DE6X 3EIEA 3HRHA 1XEXA 3SJBA 1DIGA 5LB4A 4NTZA 2D3NA 1GNTA 3W5HA 1E1LA 4ZJYA 3LRTA 3I2JA 4PYRA 3QY0A 1J00A 4LX8A 3UQZA 1XDGA 5TQ0B 1NTRA 3U3OA 2YZMA 3INTA 3K2BA 3WKAA 5FL7D 5LMZA 4BNNA 2Q3HA 2ZQYA 4XWOA 1TTPB 3E9MA 2ZBVA 3VPAA 3OUUA 2Z8YM 5JSQA 1K5HA 3UMYA 3BT7A 3LK6A 2CUKA 3GLIE 1Z4MA 3VJKA 4ODIA 4EPXA 4JBNA 1SBHA 1LXCA 4DLKA 2Z9CA 4EENA 1H4VB 4GVLA 2J3KA 4BNZA 5HS4A 1JIUA 3C4VA 4P82A 3AZOA 3I04M 5CGQB 4NFYA 4I4CA 3PC3A 3UYKA 1SQ0A 1KYVA 2QP4A 1Y1TA 2QQ0A 1R0CA 2VDWB 3DO8A 3O0TA 3CONA 4WX2B 4UNSA 4KMRA 5DGIA 3UT6A 3O8OA 4O8ZA 1WP9A 3MTGA 1IN8A 4KE6A 2FZCA 4GQNA 1M2OB 3OZIA 1X9IA 3ICPA 4DR1B 2ZJFA 4LN1A 5KYVA 1K28D 4YDSA 1SMKA 3R44A 2GBCA 5HP4A 4YP6A 5IBRA 3WQQA 1NBMD 2GM4A 3GGOA 1RQ7A 3UGKA 3WL7A 2GMWA 3QEMB 4WPGA 5JI3E 5J4LA 1XZCA 1RD4A 3AUTA 2Y1EA 3C6ZA 3TVTA 2YVUA 1DC3A 3T9BA 4QDZA 3HC7A 3OOYA 4LDJA 1WZUA 1A9XA 2OCGA 5G02A 3LW7A 1TX4B 1HMYA 1L5ZA 1P1RA 2BFEB 3HGQA 2PH5A 3O3MB 4X63A 4X7RA 5CURA 4D82A 2JN9A 2OK8A 4F4DA 3ZDZB 1GCAA 3KT8A 2Q6LA 1M1KD 3VU9B 2HXSA 2O6LA 2YWBA 1WDMA 4EA9A 4M4SA 2RJOA 2VJKA 2JATA 3LQKA 4TYNA 2JGDA 3UJ9A 3MXOA 2HIHA 2EYUA 3B1ZA 2Q50A 4R81A 2R4TA 1FMLA 1YNOA 2Q1XA 3KUDA 4J1TC 2BKVA 3TYXA 3VKVA 1RM5A 2IXEA 4US1R 1Z29A 2BKUA 4KVZA 3QVTA 5BNIA 2J3DA 3GNLA 3W6PA 3ACDA 3GJYA 3CNNA 1PR6A 3RRMA 4ND5A 1Y5RA 3Q9UA 4AYTA 4D97A 5BYBA 5CJJA 4Z4FA 3TSAA 1MAAA 2ISQA 1SXJC 5JANA 1Y8AA 1C30A 3HJBA 3C16C 1SWVA 4H1WA 3GOHA 4RPDA 1D04A 3E7XA 1GCGA 3U7RA 4HLQB 1I5EA 4TUYB 1J22A 4QSMA 3ROKA 5JFGA 1EESA 4XGIA 2FAXA 4A27A 2AMLA 4RPIA 3PJEA 3EMDA 3RC7A 6Q21A 4CEIB 3FUVA 1NVXQ 4IYJA 3G89A 5IAAA 2JDIA 2HOQA 5DCUA 2FFJA 3D6UA 2O8DA 5JT1A 1HX7A 3SX2A 1UBLS 4GG1A 4W5NA 4W7SA 4TMWA 2Q28A 3OCXA 3LYHA 3O93A 3V1TC 1TEHA 1G3UA 2GDZA 1WOMA 4TS1A 4JI5B 1CB7A 1K4MA 4DILA 4F4HA 4KK4A 1V0FA 2VXCA 5EUCA 3UMGA 3IRUA 1M74A 2WVAA 2Y1DA 2ZQ5A 3FVTA 3HY6A 1U11A 3VRHA 3U4QA 2GBGA 1EGVB 2NO9A 3RSZA 4AVZA 3OTWA 1K7SN 3CCQB 1DKRA 1G21E 2SKEA 3UAWA 1Y98A 2KLBA 3BC1A 3F8WA 4LVOA 4E4RA 5HNKA 1TM5E 1UPTA 1D6NA 1HWYA 4O4IB 3S4YA 1XLTC 1NQOA 2BH2A 1IRIA 2A4KA 1ZD2P 1KOFA 3SDZA 4TYPA 2BY4A 4US0R 2FG7C 5CH8A 4ZA2A 2YMMA 3V7YA 2P90A 3AJ9A 3H05A 4BKMA 4LPKA 2O8VA 4I1VA 1K7FB 2HH9A 4EEZA 3IXMA 5DLDA 4KIGA 3JARA 1GAXA 2V6JA 3P45A 2WLTA 1KYIA 4JASB 4ZVMA 4JC8A 4KQCA 1JNYA 1K8AD 2MU1A 3DBLA 3V2IA 2HCTA 2YQ4A 4KQ6A 1F4PA 3FR7A 3CX4A 3RIXA 4WZBB 1TMYA 4KN6A 4PZYA 5H8WA 1RKUA 1ND6A 4F93B 1YFZA 1WQ4A 5FP0A 4K9MA 2RH4A 2B4QA 4FINA 1SEVA 2AB0A 4BTLA 1SA0A 1SXJE 3ELWA 2Q9UA 1C7IA 3AL3A 3NDJA 4RY9A 3VR5H 4BVLA 4C7BA 3DLPX 4ZO4A 4IQ0A 2CLCX 3FMGA 1J1UA 1KQGA 5A05A 4N5NA 1P0FA 5IARA 1YJWB 1JAIA 2WU8A 3EDRA 1O4WA 1DPGA 4LNUB 1RPAA 2JAXA 1DFHA 4KTTE 4DWWA 5BN5A 1TZCA 1LDBA 3GEDA 4YPFA 5LNK1 2GBLC 4DDTA 1YRWA 1PG5A 2WIFA 2X42A 4C76A 2HXYA 3TB4A 4XRGA 3T53B 3ES9A 1TYEB 3F90A 4QEZA 2ZBPA 5AW5A 1Z7BA 4C2TA 5KSWB 3BTOA 3I83A 1EUQA 4HAUA 1PV1A 2JVKA 3L7MA 4J0JA 4ND8A 5G0VA 4GVXA 2GBIA 1ONSA 2OMKA 3OZCA 3WB0A 5KHLB 3PJRA 1KZ4A 4MW2A 1KY2A 1HK7A 3EMBA 2QTVB 1SM4A 2VA9A 1SN7A 3DZCA 4LS3A 5FEMA 3T9CA 5BRJA 5JJ5A 5JNWA 1Q20A 1HZJA 1OV4A 2Z56A 3L8FA 1NI4A 4B1FA 3O75A 2ZSEA 4HVTA 4F2DA 1FRFS 1JPNA 4DZTA 4WXHA 3BA6A 3EUWA 3THXA 1JR3E 3BCHA 4ER7A 1A04A 1RM0A 2TS1A 5CFPA 1TPYA 1T4DA 3F2IA 4IMRA 2WD8A 1DARA 1FYDA 4GX1A 2CNWA 2J9FA 4RVHA 5DGCA 3OLCX 1E3TA 1YVRA 2BH9A 2YZ7A 3QGMA 3HJUA 3U3DA 1GPKA 4WCFC 1E2KA 2G4VA 5BVGA 1PGOA 2PUGA 1SK8A 5I7FA 3R7NA 1TFUA 1YZFA 2X1MA 5D7NA 1A8HA 5E2BA 5FUMA 2R96A 4M7OA 3WL5A 3VNVA 5KNCA 1CR0A 1YRBA 2P9BA 3JWGA 1Q84A 3KE9A 3O31A 4LRQA 4Z2YA 3RYHB 2EL7A 3X1JA 3ZKWA 1U2QA 1SCNE 2BFBB 3UMCA 5LPNA 3ZDCA 2YFQA 3T1VA 4G63A 2WMNB 1MVLA 5HK8A 5CXQA 5EJ5A 2VJJA 1YJ5A 4YRRA 3RS3A 4FTWA 3W90A 3ZLJA 2PMCA 5D3MA 1EBUA 2ZP1A 1E0KA 5HF9A 3VNAA 1X1AA 1XDBA 1Y0BA 1BQEA 2RK3A 4MV7A 1TXGA 4MS4B 1P1CA 2P2CA 1U0LA 3AWDA 4EJSA 2ZVDA 3HR4A 2W6OA 3S81A 2PS3A 1KI3A 1N07A 5AIAA 4G26A 2SHKA 4BKRA 1MAHA 1WPCA 1YZQA 2QRMA 2YIJA 4KKXB 4GNRA 4MZDA 4B71A 1PNQA 2BCEA 2PX3A 1ULSA 4MULA 3T7CA 4EY4A 2BSQA 1MIHA 1OA0A 1CYEA 3TNLA 3AQIA 4M86A 5BRAA 2P1ZA 2OCPA 1X80B 1KVTA 5DN6A 1FRNA 1U2TA 4L3OA 5ECWA 5T4BA 3EXFA 2P6MA 4QXPA 3U6KA 3JQRA 4O4LA 3E6AA 3T06B 1NVWQ 3TLGA 5HKKD 1ZOLA 3N0WA 4KK3A 1YR3A 3CVVA 1OGIA 2AUMA 4NCIA 3LHIA 3W8FA 1KFJB 4TYQA 3WB2A 2OBLA 3WP0A 4ZEWA 4A2PA 3W4JA 1RR6A 1NQWA 1XZMA 1DS6A 1JHAA 3VH1A 4ZGQB 3BSFA 3OOEA 2AFHE 3KQOA 1QIKA 3WIBA 1YC2A 4P0TA 1O54A 1F48A 5IJ0B 2J67A 1UC8A 3LE8A 1ISFA 3DDHA 3KTAB 4AMVA 1XMPA 5TT0A 5LQCA 3OE7A 3M5DA 3THWB 2O5CA 2HW8A 4C06A 3FX2A 4RZXA 1BX1A 1RXUA 4LYAA 5CAEA 4LOJA 1GAEO 5TF0A 1NUUA 1RW4A 3OTHA 3WFIA 3IIMA 4S24A 3ZWBA 5CDHA 2ZS9A 2HLPA 4ZQBA 4ZDIA 1ATZA 2P67A 5EWLA 4UE3S 2L82A 4I9FA 3WRXC 2CVHA 2XGGA 3HWRA 5EIHA 2OHVA 3M9WA 4C4OA 5CA1F 4FDTA 1XPJA 2EZ9A 4M98A 4KFRA 4YJ3F 4XCXA 5EVJA 5K3CA 4CLOB 3T3DA 5JVDB 3HXMA 2VPWA 3AHCA 2I3DA 4RORA 4NFLA 5DHUA 5FYQA 4K1LA 4IDEA 4PLWA 4ECEA 1N08A 3C3EA 1YR1A 4IHKA 4F1WA 2C2ZA 1OWNA 4HHEA 4URWR 4ZVVA 2QROA 3LYAA 3F8TA 1UEXC 1SAYA 2UDPA 3QX3A 3AKZA 1CERA 1IDN1 1JHVA 1P3DA 3A8JA 3PEUA 1Y1QA 3KJXA 2XQKA 2GK7A 2ODTX 3RKSA 4HWPA 3HGTA 2IPNA 2ZFUA 3OUTA 4D56A 1GKIA 3EWNA 1FXWA 4XKWA 3QVOA 5FOSA 3L49A 1NP6A 3QE4A 3P4UA 3CKMA 3C3BA 4NBLA 3IJPA 3CJRA 2FSIA 3C8ZA 3JD0A 3ASZA 1KZGB 1ZOPA 2COKA 2FDXA 5CRIA 5T4FA 4IMPA 3UCXA 2XZOA 2GPNA 4G5XA 4PXYA 1RQ2A 4YMGA 1ZM3A 1KJIA 3BRCA 3ZWCA 2X7HA 3QPUA 3BSSA 1QU2A 2CZQA 2IPOA 2PBLA 1PTJC 3E0XA 2NX2A 5BSMA 2ES4A 3IL2A 1SHJA 4EDFA 3JQEA 2F43B 3H2IA 4LRXA 5FTNA 2Q5HA 2C7PA 3L8CA 5JHGB 1OWPA 3LO5A 2RAPA 3PICA 4G0YA 1AK2A 2QQGA 3H0EA 4XAQA 4TSFA 1GKKA 4RNCA 4B7ZA 1GPJA 2JEOA 5CBPB 2X6TA 1TU4A 1BJKA 2QUHA 3W06A 3QX8A 1RYEA 4K9PA 3BGDA 1V8PA 4Q19A 3SKYA 2Y0DA 3NH9A 3X1YA 1EBFA 2H3HA 5K1ZA 2OQVA 2OYCA 3UKOA 3WOHA 4AK9A 1MT0A 1XT6A 1GUBA 3VR5D 2I6GA 1TCAA 3KTFA 1K4YA 3F4LA 2GAAA 1QPBA 3PQDA 3SZLA 3TW6A 3WL3A 1U2GA 4ASUA 4EMSA 1A95A 2LV8A 5F4ZA 1S96A 3ECAA 3MPOA 3ASQA 1S2OA 5FWDA 1RYBA 1X7XA 1Y3IA 3FYUB 4ZV7A 3GCXA 3QKIA 3K7EA 3E20A 4LJ6A 3QE2A 1JT2A 3AFNA 5CJPA 3V8VA 1MG5A 3LK7A 1SU6A 1FP4A 1TZ2A 3AXSA 3PHJA 5EYPB 2WHPB 3JQAA 4JV5B 4B6JA 1G55A 1B14A 1QVVA 2VDMB 5AHRA 3DEKA 2ET6A 2CK3A 3HE3A 3EZNA 5EMJA 3VZSA 4GLJA 2H1IA 3BGIA 3Q0EA 5JZSA 2IHTA 2WE7A 3HCAA 1N6PA 3P2OA 3K8OE 4KE7A 3FG9A 2NTNA 4IW3B 1Q11A 2B7LA 2G0TA 3H3FA 3HGMA 3N74A 3OZAA 4MV8A 4QSHA 3EGDB 4YGXB 4D0RA 4LCEA 1P5RA 3Q8WA 1ZEJA 3E5RA 3ZQKA 1WMFA 3JZDA 1VHQA 4IGFA 4DR6B 1U3FA 2FZWA 2JB9A 4HX9A 4V0RA 5EERA 3RRFA 4D80A 5AVYA 4FBLA 2WWRA 3LY9A 4A16A 4EG6A 5I3CA 5DM60 1Q81D 3DS8A 3DZDA 1ZDMA 5GV7A 1FYWA 2J85A 1S01A 2K7ZA 3NG1A 3PDIB 3AUSA 4C9BA 1LRJA 10MHA 1TQ8A 1W9XA 1VC2A 3E35A 4HYEA 2NP6A 5K8UA 1XZBA 2UYOA 3DV9A 4J6FA 3BTSA 4D4KA 1Z9BA 4LBZA 5C4MA 1A50B 5J23A 4MUEA 2UUOA 4ZT7A 3DL0A 5J3OA 3MCAA 4RANA 4RJIA 5LKAA 4LZPA 5K3OA 3VHXB 1DJQA 3GZNA 4MYDA 3PNMA 1E1YA 5CH3A 3TLXA 2CFOA 3AR4A 1JMYA 1TTHA 2CYCA 3IHKA 1JB1A 1ZMBA 2P9GA 3B3FA 3O73A 1Z4IA 4A2CA 4XYEA 4F5ZA 5A1TA 2YJZA 1GY8A 1B73A 3HL0A 3C3KA 5LOVA 1TLTA 4YBRA 1A4IA 4CKXA 3V46A 4Z6KA 3IQEA 5BURA 2PD3A 1I7DA 2JCGA 4D9FA 4DJDC 2RKBA 2G0NA 4ZHQF 4PSCA 3QKTA 2E4YA 1SBCA 2W22A 4K3VA 3TGLA 1MABA 5FBKA 1EVLA 3BTUA 3KT6A 3P96A 4L8GA 1YI0A 4M8SA 4N6OA 4BMPB 4PNEA 3NGXA 3UB4A 4D43A 1SHZA 2ASEA 2Z6QA 3E3OA 3SLDA 1J21A 3MCWA 1IB0A 4HLUC 4HNGA 4PYJA 4RPCA 3R74A 2QSYA 4W1PA 1XAJA 4PBRA 4Q3EA 2EP7A 5A03A 5A2QA 5DGXA 2FQXA 5J5AA 4YJDA 4WLFA 5DCLA 2CZGA 5C1IA 1ZRNA 1SVKA 4G65A 3OOSA 2VA8A 1SG9A 3E4DA 4Y6RA 5BN4A 1B0ZA 2CVOA 4B4WA 4XWGA 3EDQA 1AKVA 3ZNPA 5KWEA 4YUAA 1IN6A 3LF2A 1S4MA 4NBTA 3F6YA 1G8KA 1QB7A 1YI1A 3KXDA 3KTDA 2PKCA 2AJ8A 3OQMA 1N6HA 2AI2A 1SUWA 2FI1A 1V9SA 1MXFA 2G0AA 2OVFA 4JL5A 5K0FA 3EG9B 2QMZA 3W7VA 2WF5A 1JEYA 2K7FA 5FI0B 5I7SA 1XZEA 4MI6A 3WTBA 5B5SA 2GHTA 3DXYA 2FWRA 2HXGA 2XF2A 3MRTA 4FFMA 3EJ6A 4OFBA 1GRNA 4EHKA 3RHZA 4DA7A 2VT3A 4QUDA 2FUG1 3QVVA 3FPPA 1Y81A 3IAFA 1U9ZA 2OO7A 2A92A 2IFTA 1PS0A 2YQ5A 1KEPA 1JU4A 3ETEA 3I72A 1XZDA 1IK6A 1NIJA 2Q3MA 3GARA 3STYA 2PKWA 5KPJA 1GRRA 1G9TA 1Q9SA 1RJ9A 3VAAA 2ACKA 1XRQA 3ZWDA 3ORFA 1H4TA 4KU4A 4S1NA 1N5OX 4UU7A 4B4DA 2IYNA 3HN6A 2EXXA 4QXAA 2BWJA 4KB5A 4R98A 4CQMA 5K3FB 4Y2PA 4BO3A 1Q7EA 5AW0A 1BFUA 5JDCC 4IXMA 5KYTA 3SOPA 2CDBA 1TVCA 3MW8A 1UINA 4UPEA 1V43A 5B1HA 4AU1A 1XRRA 1JV2B 4OPVA 2IE8A 5F73A 4RKFA 3CRZA 1OU0A 2IYWA 4W1SA 5FPSA 3W9YA 4BNJA 4CMAA 2CC2A 1P5JA 2H1FA 2QSZA 4HX2A 3GA5A 3MWLA 1N6IA 1I01A 4XB1A 5HZAA 1GT6A 5BWBA 2HQRA 5K0EA 4QODA 2J30A 5IHPA 2YZ2A 2VNHA 2IYPA 4R5HA 4KN5A 4FGUA 5HQTA 2BL4A 3PEEA 4EPYA 3O8BA 1UWCA 3GRVA 2ECOA 4DIKA 2FJ0A 2IYSA 3F5SA 5AWFC 4EI9A 4RGBA 4QEDA 2LGJA 5DLEA 5JLJA 5CFNA 1XTRA 2ORWA 2C31A 1XZIA 3N8KA 1J9GA 1YQEA 1AHPA 1RRCA 4HQNA 4EW1A 1SC9A 3WQZA 2I3AA 1AHHA 1AQNA 4JSTA 1Z17A 3U7IA 4C5CA 3UAOA 2RKWA 4EW2A 5IJ9B 4XX0A 2Y76A 1FJXA 2DYIA 2ON6A 2X5JO 3D2BA 3DC7A 3WLRA 3WYDA 5KMGB 4TXMA 2VPPA 2HLDD 3LWZA 4FGSA 3RIYA 3U4HA 2ACWA 1AMNA 3WLQA 3WLJA 1SVOA 4X45A 1T5DX 1UEIA 3HB4X 3IR5A 4HWKA 1CUHA 3GC6A 2R8PA 3QWAA 4UZSA 1KKMA 5FI1B 1SKMA 3M9LA 4XDGA 1GTJ1 2ZYHA 4FPXA 1BA3A 4DBZA 4RIIA 3UV7A 2N0SA 4DKXA 2FEXA 4ENUA 1Z15A 3C3MA 2WAXA 4XLTA 2WTUA 5EVCA 1Z2AA 3KZVA 1CRWG 4DIOA 1QHHA 3AY0A 1NI5A 5ADVA 1E3IA 1YBAA 3PS9A 2VZEA 3I8XA 4NJOA 3RHSA 3SEZA 5K0BA 1HTBA 5CT4A 1QP8A 5IMSA 1F3OA 1KERA 4MO9A 3T5DA 1M2KA 5EFOA 3ZX5A 4L8VA 3OZWA 2NTJA 5IM4F 3GLFE 3AWIA 1Z08A 1KMQA 3VC1A 1LQ2A 3BWCA 1ZAKA 1KFEB 2LUOA 1WD7A 2NPIA 3VTFA 4ENRA 4TYYA 4Z9BA 5CFQA 3PIIA 5CM2Z 4BP1A 4HG2A 5BYAA 1R6BX 1TRHA 3CINA 4KWTA 3RBVA 2Q2NA 4Y67A 4Y6SA 4G84A 5EE3A 5T67A 3U3MA 3PENA 4L51A 4ARAA 1ZGGA 1PJ2A 2HEGA 4MITA 5H59A 5EXDA 2H2AA 2VJOA 5JMPA 2WUFA 4EQZA 4WNAB 3C5WP 4UKDA 4V1CI 5H16A 1II0A 5BOSA 3WV4A 1FF9A 3R7BA 4DLLA 1F7VA 3LGXA 3Q3EA 4LIPD 2V31A 3PD0A 2I8LA 3G85A 4K26A 2ZUTA 1KMMA 5DLYA 2CFRA 2ZATA 3IQGX 2OG2A 3RNOA 1DUVG 1HLFA 3E23A 3E9YA 3EYWA 4OQYA 4QPCA 4E6EA 3T5BA 5IWAB 3A0RB 2IUSA 1JDSA 5B3JC 4ACBA 3INNA 1CUXA 1QHFA 4GBED 5BN3B 4WY5A 2VAVA 4ROTA 1EQ2A 1K7YA 3BWYA 1AC5A 1XFAA 3CWCA 5DM0A 3L4EA 3CEHA 1WOYA 3FSEA 3KZCA 3LXRA 1HTWA 2N42A 2D5AA 1E6WA 1Z4JA 2ERYA 3CEMA 3DEYX 3P19A 1XIVA 2B2CA 4KRXA 4OQEA 5SZJA 2BP7A 3PPVA 3Q3HA 3NIWA 4QICA 4QLOA 5EZYF 4JXKA 4MUBA 1Y6QA 3SBDA 3HLKA 2VUIB 1VQ4B 1E2FA 1TCVA 1U8ZA 1LD3A 4ZT6A 4EJ6A 3TFOA 3QI2A 1L7MA 4YAGA 1QHGA 3Q8XB 4BOYA 1TMOA 2FWAA 2JGAA 1P9WA 1PWXA 1YZTA 2WV7A 3OUZA 4Z4YA 5DDIP 3NWOA 5EN4A 2XMCA 3GJ4A 3ASTA 1FFXA 4JLDA 1V1RB 2HTFA 4KXUA 4MCJA 4TLDA 3QE9Y 1O0CA 2JIQA 3NWEA 1C0EA 5LUBA 4M6WA 1ZC4A 2V7GA 2HU8A 4AJLA 2QSUA 1MHPA 3PHIA 1MDBA 2MSCB 3D31A 1YR9A 3EIWA 3VO8A 2C00A 1V11A 1CP2A 1CY0A 4KO1S 4Y1RB 2DHEA 5CXXA 4BQEA 1FQJA 2HL6A 3R9KA 4YXWD 2E1BA 4RDLA 2H9YA 1NNI1 4AQ7A 2C3MA 1P80A 1L8AA 2AA3A 4FXUA 2R86A 4CMIB 1T8SA 1R5JA 1MO6A 3DMHA 5AJYA 4MV5A 1HNZB 4HNAB 1RLMA 2H7XA 2QJWA 5IW8A 3BH0A 4MIYA 4CU2A 4TKVA 2KBEA 2REQA 3LKZA 4UAVA 1H2RS 1NMXA 4JLBA 5BSRA 3RUFA 3RVOA 3LU1A 3A9TA 4HWRA 2IEBA 3KP1A 5G3YA 4TYMA 4CM9D 5EG5A 1JEJA 1KEWA 1KBOA 4WOCA 4ZQEA 5AXAA 2Y1XA 5JD3A 5L3RA 5BWMA 4K6CA 4OUKX 5CT9A 4YYEA 3F4KA 1D1TA 1VQ9B 1HY3A 2DJ5A 4PGAA 4PYKA 4OQFA 4UDNA 3WQHA 1JHXA 1Z73A 1NC3A 2F48A 5DM1A 4OL0A 5DYYA 2OA0A 2P5UA 4RF4A 3I5UA 1YIOA 2GEJA 3GEIA 3RV3A 1IN5A 1W36C 1FQKA 3NHWA 5FTWA 4MHTA 4P3IA 1FUUA 4XW2A 4EZIA 5E6TA 1R4AA 1K1EA 3QXHA 2JJQA 3AHEA 3HKCA 2B30A 4P4UA 4U7PB 3KPWA 1UBNA 1R4ZA 3BMOB 4PWYA 3K0FA 2EP5A 1DJLA 1JALA 4WZAE 1MXHA 3IO5A 4JLSA 4MAAA 4E5SA 4KDFA 1EVJA 4IWXA 4X1OA 4LWPA 2GZDA 3KHTA 4HAVA 1KI6B 2XA1A 2LCQA 3UJ8A 2GRUA 2HMVA 2GPTA 4ZCLA 1E5DA 2LCIA 2HT1A 1A9RA 1GHTA 1N6KA 4PLVA 2I9PA 1E2QA 2OYNA 3D4PA 4GE0A 2HA2A 2C2WA 1RWNA 2GSWA 3SPXA 3WL4A 2AKEA 3ZGZA 2QAGB 1MQ8B 2NSLA 1VIYA 3N7AA 1KAHA 2PEZA 5E8JA 4RTQA 2VF4X 1OXXK 4K40A 5L6LB 3FOWA 4N7BA 5CIWA 3SC3A 4JP5A 1FK8A 2DCUA 1N2GA 2EJUA 5B6IA 4ONEA 4XTRA 1HF3A 2WPDD 3W2FA 1JJVA 3TRDA 3V97A 1KZLA 2TMDA 4Y2RA 5J59A 5FR1A 2GN0A 2P9HA 5F4OA 1L1EA 4DJEC 4QU0A 3TUIC 5KI6A 3ZWNA 4M36A 3P0RA 4DCPA 4RHUA 4UUMA 4DARA 3ET5A 2X2FA 4PPFA 4Z4CA 3X2FA 4E09A 5C9ZA 3TECE 2YBEA 3ZBUA 1M66A 4LKRA 5JWOA 3VKHA 3RCBA 5KNCH 1LV8A 3UAZA 5F1KA 1CUGA 4JELA 4JLOA 1KC8D 1N1DA 3DV0B 3H1FA 4RW0A 5ALUA 1KH2A 2VTDA 4H4DA 4MROA 1ADCA 1VF7A 4TZ0A 1BGVA 1VL0A 3DVRX 3OKCA 2C78A 3I28A 4LZNA 1NM5C 2PSSA 2QLJA 3HDVA 3L06A 4GQAA 3UENA 2C9MA 4QGFA 5A9SA 4BZXA 1ODIA 4DXAA 3RTGA 3H1TA 4C87A 2YRFA 5A62A 1RWBA 4LI0A 3DE5X 4UVHA 4YWJA 1NA5A 2BONA 2YJGA 2X3UA 4ZIRB 5HOQA 2PQMA 3QKWA 3R9XA 4V38A 5BMVF 1M0WA 2VYFA 1EB8A 3IDFA 3K9BA 3MMNA 1Q6ZA 4I1RA 4P26A 4Z51A 3B3JA 4CTJA 1M2WA 3BCUA 2RDMA 4ETMA 4TMVA 3H2YA 4UOZA 4N3CA 5BMOA 3OX2A 5ESRA 1UZMA 3RS8A 3M4NA 3EEFA 2W6JA 4CHTA 1CUSA 2PZBA 2ZRPA 2E6KA 4G85A 4OGLA