2V7TA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosyl-l-homocysteine and chloride ion
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYGREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Mechanism of enzymatic fluorination in Streptomyces cattleya.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2v7tA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2v7tA01
5LMZA 2Q6OA 5B6IA 2C2WA 2ZBUA 2V7TA 2Q6KA 1RQPA 2ZBVA 2WR8A 2C4TA 2CC2A 2Q6LA 4CQJA 2CW5A 5FIUA 2V7VA 2V7UA 2C5HA 2V7XA 2C5BA 1RQRA 1WU8A 2CBXA 2V7WA 2Q6IA 2F4NA 2C4UA
chains in the Genus database with same CATH superfamily
1JE1A 1PYOA 3QITA 4YAEA 4CMAA 3FCYA 1MJFA 3GBVA 1NR5A 1XCGB 1VRWA 3GZJA 4QJ5A 3PVCA 2DWUA 1VSQA 2ID8A 4RGQA 3OU7A 4ZAWA 2E5WA 3B12A 2MDTA 2ZAMA 1A82A 2EL9A 5JQGB 3LBNA 3RGGA 1RCTE 2VHZA 3ECSA 5BSEA 3BJEA 4M0LA 2QE7D 4CIAA 1PTKA 1WS6A 2FSSA 1PK7A 2OAQ1 4JOQA 1A8SA 1R4MA 5E9AA 2V1XA 4RDXA 3ZWVA 2IOQA 3QI2A 1M3SA 1VG1A 1Y4DE 3FLAA 1Q1GA 2D7JA 3IP5A 3KSZO 5I4CA 3TE7A 3BORA 3LLSA 4G1FA 5GOZA 4KFRA 2IP1A 3RVLA 4BV2A 2GNOA 2FDRA 1V8BA 2J6HA 3CF4G 1ADCA 2WD7B 2ECOA 1OAAA 1X13A 4S12A 3WMGA 4RJKA 4JL8A 1Z7GA 4D9CA 2VIIA 3AFOA 3DA8A 3N8DA 2ST1A 4MKXA 3OU2A 4ZXFA 1A98A 4MB0A 2NOAA 4D0GA 3A1EA 3BWVA 3PJGA 3NQ41 3ZXSA 4I0WB 2C5GA 4D79A 1K28D 4B6FA 3NBMA 4B17A 4PLWA 5IJWA 4NS1A 2YJGA 1SOMA 4LSZA 5DH9A 4NFLA 3TZEA 1Q5PA 3ANXA 2HTEA 4EL0A 4HLUC 4YJ3A 3KXPA 1JI3A 1QPBA 3BCUA 1P9OA 3I09A 2FWNA 3R3HA 3GNLA 4PZUA 4WZZA 3OCWA 1BU5A 3SYRA 3HDVA 4ROTA 1WCIB 4Y2RA 1NVBA 1FLDA 3R7SA 1FSZA 5JD3A 4HYYA 5E6RA 2D2FA 5AI4A 3KTFA 5DM70 4QVJA 2XHZA 2YIJA 5BVGA 3EY4A 3S81A 1X1QA 2JGIA 3LZCA 1XA3A 1RKBA 1GSAA 4CMBA 1XKQA 4EYQA 2G5GX 4HB3A 1P5HA 1VJ1A 4W9MC 1IQRA 3KXKA 4PIMA 4BQEA 2QJFA 3P0JA 3TKAA 1RKUA 4ZIRA 4GSKA 4QUBA 3HXMA 2PLFA 2L82A 3V8QA 3AIOA 4B87A 4RVDA 4W5OA 2L19A 1ZONA 2VF5X 2XEDA 2BMFA 3KHKA 4YAOA 5DGIA 3GBSA 4XH9B 3A1DA 1POXA 1U4SA 3QEJA 3QK7A 4JP1A 5F7ZA 4E32A 1V1JA 3QF4B 1XZPA 4EF6A 2OCXA 2HFJA 3UWPA 1DFHA 2W93A 3NHMA 3B82A 3JYHA 5BOSA 2AD1A 2A0KA 1FEZA 1SQ6A 2HRBA 3I73A 3I6MA 2J5QA 1RWKA 2OCAA 2C95A 2ZJAA 3I04M 2DLNA 3A6LA 1JI0A 3L6RA 1I8TA 3QIVA 2ZDHA 3TLGB 2I4RA 3OPYB 3WK8A 8OHMA 1X74A 3GEEA 2PLWA 4WZTA 2VSYA 1GTMA 4WK4B 1UEIA 1YBVA 1BS9A 2Y0BA 2VRNA 1MRSA 3E9RA 3EIUA 3L82B 3OE4A 5FWYB 2IYLD 1HE4A 5KJEA 2SKEA 1JR6A 1N57A 3GCGA 5JZVA 1C2TA 1TAQA 2QT0A 3JD1A 2EHJA 3IVGA 4JQZA 3BQMB 1NVWQ 2VWQA 5IYWA 3D6TB 5EP2A 1JKJA 2AOUB 1IHDA 3E7WA 1E6LA 3I9KA 4XR9A 4DDKA 2WHPB 2ZIUB 3KAPA 3P1JA 4FQ7A 1NF8A 4OQFA 4MJLA 3OQHA 5CVDA 5BQFA 5AK6A 2F3PA 1XE1A 4L4YA 2ZL7A 4UXIA 1QG4A 4TYQA 1SCNE 4G86A 1V5VA 2OO5A 1RXIA 1FFEA 5J40A 4FVTA 4YALA 3H5OA 4GX2A 1E5LA 1DIHA 5E1DA 2BMWA 4GGPA 5ED0A 3HU1A 5T4EA 2R48A 3WJ7A 4QTYA 2FPIB 5ALUA 1N4AA 4W8HA 2ROQA 5C2JB 2BKVA 3UBMA 2I99A 2YXDA 821PA 4BAGA 5I5EA 3THYA 1HY3A 2GEKA 1MABA 1WTHD 3G17A 3H0KA 1GU7A 3KE8A 3WKAA 1QAMA 2XAAA 2Y2VA 3DUFA 3IAUA 4RZ3A 4H0NA 3RTAA 2BLNA 4LY6A 4ENQA 2OYNA 1AG9A 1QFMA 4AL4A 1FFCA 1I14A 2Q9UA 3H4IA 1O95A 2WIFA 3EHEA 2F7SA 4NECA 5DSXA 3A8IA 3SIRA 1S1CA 2PWZA 3D4OA 4RE6A 4TLCA 1H4SA 1UIRA 1UFRA 5B6IA 2FWRA 1K7YA 2JKYA 5LZ8A 1RZRD 4GKKB 2C9BA 4TWRA 3UTDA 3TDKA 1MB2A 4OL9A 1IM5A 4O02B 3OJOA 1Z4NA 1NW8A 2OHFA 2X8AA 2ZREA 4Q6WA 4J16A 4A91A 3EWNA 4ZMBA 1SVMA 4FDMA 1G3RA 2IF0A 2NUBA 3EBLA 5HFAA 1BCRA 1A7KA 4N54A 1JLLB 2C9DA 5HS6A 5IU6A 1CY0A 1K0FA 2VHTA 2QF7A 4MS3A 1XZAA 2ASVA 3HJAA 4IMPA 4ZGBA 1GNTA 1CVLA 1GRVA 4UFOA 1WPXA 3DCNA 4HVLA 1C0LA 1JFVA 1LPBB 2QTTA 3V34A 1QP8A 2C42A 2ZRJA 4QFDA 5E9JA 2OSVA 4F2DA 1XTIA 4UHDA 1XMXA 1VGRA 3ZHXA 4DSOA 3L6EA 1VL8A 4XJSA 3IAAA 5CA0A 1L5QA 3ZIUA 2H8GA 1QVZA 4OX9Y 2AQ8A 2BEWB 1K3FA 1N0HA 1KQPA 2HNBA 4TRRA 3SBOA 3TTUA 3DFMA 3KVRA 5DSTA 2R87A 4XLHA 1LLUA 4OHCA 1Z0KA 1E98A 1G9XA 2WK1A 4WBXC 3N8KA 4BBZA 4CKEB 1VJRA 1Y5IA 1G3QA 1YVEI 3KTOA 1BJRE 1JDBB 4KPUB 4CL3A 2XE8A 3D0OA 4PLVA 4B82A 3P5BA 1EGQA 4NICA 4U0KA 4F2PA 4K46A 2C9MA 4PXSA 2J7KA 3ZK8A 2VPYA 3ZEAA 1YB1A 3OLZA 3J7AC 1M1NB 3ZJVA 2RG7A 3G5UA 1F48A 5IM5A 2FSFA 3OLVA 2G1PA 4A03A 4MX8A 1QG0A 4NFHA 3USCS 2FFAA 1PVOA 1F17A 1X1RA 1PFKA 4RHCA 3OHMA 5KNDH 3AWIA 3C48A 1C7QA 3UMCA 1J4AA 4FZ3A 4NXMB 3D3EA 4HLNA 1VL2A 5IJ9A 3C7TA 1HORA 1Y7LA 1XQVA 4DXDA 2E49A 3ZK9A 3J81A 1Z7WA 5LD2B 1RS0A 1KI7A 2PJRA 4TV9A 2WJJA 3EGDB 4M0DA 3DVSX 5IYZA 2LIPA 2XMRA 4JB3A 4RELA 2QTZA 1RHRA 1S5PA 2F8MA 1U9IA 2XWQA 5CVJA 2BFAA 1F4LA 2I2CA 3E20A 2ZTMA 3HBNA 3FOWA 4IKOA 4NATA 4RK5A 5FO1A 1TJPB 1YFKA 4K28A 5FHQA 1O57A 5JZOA 5LQNA 2PTGA 3U4MA 4COKA 3C1AA 1IOWA 2JIDA 3VPSA 3PDHA 1NW6A 4OO3A 3TW8B 4NENB 1YACA 3A6ZA 3AKDA 1IBSA 4FE4A 5KWSA 2HHCA 2PH5A 1ZD5A 4JS0A 5AO9A 5KYVA 1I4WA 3TM5A 2Y93A 1VRVA 5ITSA 4DAOA 1GLVA 3MELA 2E1PA 2QZ9A 3HDJA 1FCJA 4O59O 4QXAA 2CLSA 1ZMRA 3NCTA 4HGQA 4HIZA 3T0IA 3UIEA 1A95A 2XUAA 3RO7A 2GO1A 3QW2A 4RM0A 3DL4A 5K05A 1FIUA 1MG0A 1Z0IA 1PL0A 3K9BA 3QBEA 5DLYA 4JJZA 4W7IA 3U48A 3E9NA 2PSJA 1M6HA 2DRIA 2YV4A 1DO0A 2VP9A 2JI6A 1Y33E 3PPXA 1I9CA 4CMJA 2MYTA 3BWBA 4D0LB 1EK5A 2GZAA 1FYWA 3PGKA 2P6RA 4L51A 4QAJA 2V5UA 3WR5A 1SXJB 1LBIA 2K87A 3USZA 1RRPA 3LT0A 1VE1A 2HI0A 3R76A 2D6FA 3NYWA 2C2HA 1T0HB 2H1HA 2LPMA 5J5CA 3SSNA 4PN3A 4ZZ0A 1TZ2A 1WDLA 1KAGA 4P5EA 3K9WA 4UNIA 4X1IA 1N2CA 3W9UA 5JROA 1EK0A 1DC8A 4CCYA 6ABPA 5ALJA 1LJLA 3UAWA 3TLKA 2ZJZA 2GCGA 4BMDA 2XUOA 3EMBA 3R3VA 2H1OA 2C84A 4N41A 1SD1A 4B45A 3K9CA 5A3QA 3MC1A 3SQXA 2CBZA 3OKXA 1TAGA 4RVGA 3I6YA 5EMNA 1MC4A 2WIJA 1JSCA 3JQCA 2F48A 5TR9A 2LKDA 4CDGA 1DHRA 1LPNA 2O6HA 2ORED 3BFJA 1XQ6A 3ZZUA 3K96A 1JR2A 4QXPA 3MS4A 1U0JA 2BF4A 1E3IA 2Z08A 3AUFA 4AO7A 1FDWA 2C2KA 2GK4A 1P60A 1LD3A 3FNRA 4GQBA 4R31A 3RUIA 5C81A 5KTYA 1MRNA 3P2JA 4I66A 4P7FA 4XLEA 1DS6A 4C43A 4MPRA 3EFBA 3G59A 3ICPA 4JLUA 2B35A 3NALA 2ACEA 2DUUA 1CNMA 1CIJA 2EP5A 4ZGWA 1CJBA 4I1VA 1N0WA 1XCOA 4OU4A 4QU9A 3H3FA 5BQPA 1MH1A 3MYYA 3N7AA 2FW9A 3MWKA 4GDFA 3Q40A 2YCLA 2JCSA 5F2KA 1B3RA 3GO4A 3NH6A 3D31A 5CNJA 4BO2A 2K7FA 1YE8A 2HDHA 2QR2A 1KI6B 3JQAD 1RYFA 2X2OA 2YRWA 3KWMA 2BEVA 1FYXA 4UBNA 2EBHX 4D25A 2I55A 4E11A 3LVQE 3FUCA 5ALXA 5JCXA 2BM1A 1L1FA 3O9MA 4MQ4A 5KJFA 4OUKX 2O3TA 4FD3A 1T1JA 1P1BA 5GZ1A 5E8RA 4X5OA 3LA8A 3C3DA 3D7NA 5KYWB 3GXOA 3QP9A 3W1WA 1OF1A 4B4KA 2NU7B 1A8HA 1YS4A 3B2NA 2NP6A 1U2QA 2G71A 1PYDA 2BSXA 4M1MA 1BDJA 3TEFA 4D0NA 1H4VB 1C4XA 1YZTA 3EOBI 4DSZA 1PHPA 1U28C 2IW1A 2XBUA 3VZQA 4JWTA 1AF7A 5J59A 1MEOA 1FP4A 1X9HA 1DRWA 1FP6A 1L5VA 2DWOA 2NSLA 2PQ0A 3FPCA 3KB8A 4GUDA 4GC5A 2PUWA 1J2EA 1B93A 1YKSA 2DUJA 3FLMA 1UM9A 4FBLA 1XROA 4PG4A 3VSAA 1ZOIA 3QYJA 3SE7A 1L8XA 4E6PA 2I3AA 5FPPA 4EBBA 1AOXA 2IIPA 1N0UA 3PCTA 4O3FA 1KVRA 5KMGB 4FTWA 2YX1A 3F4BA 4K9PA 1F60A 2ZI4A 2X58A 1SOVA 3MRXA 3KWLA 1OX4B 1VJ5A 4HDSB 4JDUA 1IY1A 4ZGQB 1CLUA 1JW9B 2CUZA 3QVWA 2OYRA 3REQA 3WIVA 2ZW9A 4PPYA 2V1UA 2VYVA 2VPZA 1DJQA 2TS1A 4ALMA 4AY5A 4X7EA 2RK3A 2E1RA 3FAZA 4YV7A 2JJ2A 5CLFA 3NKLA 3BHMA 3O8LA 3Q6IA 3WRXA 3T7SA 4BJ5A 4GRAA 4MUMA 5KVSA 1H69A 3ADCA 4GVLA 2ZKLA 1LJ8A 1CUCA 2QAGB 4J7AA 3CSDA 2EFDB 3R3SA 3C43A 3V1NA 2XGSA 1VFPA 1U7WA 1SBQA 4G2NA 4WY5A 5F77A 3V7UA 1RQLA 3NJ4A 4JKOA 3AX6A 4MUKA 1WM1A 4HP8A 5A71A 3N6XA 1DHTA 4W1QA 3NMUF 1OMOA 3NOXA 2W58A 4HQRA 1JF8A 1LV7A 3VV3A 1C30B 1XSEA 4L07A 3BK7A 2J6BA 3M1IA 2X41A 2Y77A 4RLZA 3DDCA 3EF0A 4RVFA 2YNMD 2XKBA 3DGFC 2HW8A 4G0UA 4E2YA 1P19A 4F3RA 3H5RA 1V1MB 5ALNA 3K2BA 3O83A 5BURA 3OQMA 3GLIE 3GDWA 3MG9A 1SU4A 5J1TB 4X92A 3M33A 4WBSA 2VTVA 3QM1A 2B2NA 1RWNA 3FPJA 1C29B 3AM3A 3B6KA 3L01A 4WXHA 4RD2A 5JATA 2BBOA 3ML1A 5MN5A 1KS9A 3K0CC 2HJSA 4B3XA 3EY9A 1IY8A 1DEOA 2YJ5A 5MGBA 2J45A 2J5RA 3UHOA 1DX6A 3WB2A 1U6IA 4W5QA 1UK7A 1RQXA 4DC1A 3M3DA 4BNKA 5INTA 3W3AA 1LLDA 2XVMA 1SU7A 1LGYA 1JNXX 1LSOA 4HUQB 2KB0A 4LOIA 3X1MA 4ZAFA 3OM0A 3FPLA 5J2UB 4LC9A 5K99A 4UEKA 5K20A 3PIDA 2YMPA 3A3NA 3R23A 1LEHA 5G02A 5B7QA 4NZNA 2IU4A 3VU9B 4NMWA 3HKBB 2VRCA 5FPHA 5BSMA 3ZWAA 4QD3A 5FYDA 2WTMA 2GJ8A 2PX3A 2QTVA 2QN3A 3ZHZA 1K06A 2JAUA 5JU6A 3A70A 3OZUA 2WOJA 2GD6A 1TA9A 4IDEA 4ZOAA 4EW3A 2Q07A 3E27A 3GJ4A 3RE1A 4D9JA 4HB2A 4UDYX 4GPAA 2RSLA 4BVEA 1MRZA 1CS0B 3WLEA 1YAHA 4CQMB 5IJ0A 1T2NA 3P19A 4DNRB 5IKOA 2VZ8A 1L7XA 4LOHA 3RJMA 2R68A 3HDGA 1DP4A 2O3RA 4XVCA 3VMMA 2PLNA 3ABIA 4KNVA 4RJLA 1QKJA 2AEMA 3D1VA 4BN4A 1OPRA 2IGBA 1E20A 3X1KA 3HXKA 4A8HA 2VPIA 4GECA 2EJVA 3A2NA 3IUJA 4I08A 4UHJA 2VDRB 3EZ9A 4KVAA 2NQ8A 4BRZA 5IT4A 1ACMA 5LU8A 3O4IA 1E3XA 1GNRA 1MOZA 3T9FA 3CRVA 2PMEA 1UZUA 1X80A 4WCFC 1KHHA 3UN1A 5LLSA 3REGA 3HUEA 1SQ5A 1U7PA 1JHZA 1E3WA 4V2UA 1O4VA 1UD6A 3IBSA 4S1VA 1VYTA 2CXPA 4EB6B 5C37A 3TLCA 2O7SA 5E1MA 1VTKA 3PEEA 1OXSC 3VRHA 4YAWA 2ZYHA 1G291 3KQSA 2BSQA 1HI9A 1TVCA 4PU0A 4JUFA 3OT5A 3TZCA 4NRDA 4DIBA 2UXCB 3KB2A 4M8KA 1A5AB 2O5EA 1LDEA 1IUNA 4DCJA 1NE7A 4AJJA 1PZNA 4CIYA 1QGYA 1EGMB 1LQ2A 1MXFA 2AI3A 2JFOA 1DBPA 4ML3A 4P4SA 3PB3A 1JFTA 5CH8A 1PQYA 3QGMA 3UT5B 2BHRA 1K97A 2Z2ZA 4V1CI 5HOEA 3R75A 1R4MB 2AG0A 2WZDA 4J43A 4LJ7A 4AUEA 1PDVA 3BFPA 4P3IA 3DEHA 2QVZX 1A7AA 1NI4B 4LJYA 5IPFA 1F8XA 5LB4A 3VGPA 2Y1GA 4JC0A 3RQSA 1EAMA 3B6ZA 3GT0A 3HI4A 2RKWA 3NDPA 2F17A 3ZDRA 1ZA2A 3RLIA 5L3SA 1SKUA 3FA2A 4CJXA 2CWWA 4IY1A 4B85A 2IDMA 3G5LA 4HAYA 3TQCA 2LVBA 2Y1EA 4RCZA 1RJEA 1Z74A 1KMHB 3AFIA 3BGOS 3FKJA 5JHHB 3PDCA 4MRMB 1P7WA 3CFYA 1PE0A 2CXXA 1DBQA 4BVLA 2F3UA 1ZWLA 3JQBC 4BRUA 1G2OA 2VZ9A 2IS4A 4E4RA 2D5IA 2QQGA 1NR1A 2Q1UA 3GN2A 1V25A 2FN7A 3JQEA 3JXEA 4HD8A 1LLQA 3OZBA 3PR2B 4CODB 1PNRA 1TTTA 4QYMA 1E2QA 1C14A 2G9ZA 3OUTA 5BORA 5SYNA 1P9NA 1U31A 2R44A 1XIVA 2O23A 4A8JA 4BP8A 1WBJB 1PFWA 1WW3A 2B2CA 2YXEA 1EP2B 2P6MA 5ECWA 1VMKA 2RGYA 1XZBA 2XT9A 5K03A 5A2GA 2VG8A 5CIWA 4UQPA 4Y2UA 3WRYC 3DZFA 3DE2X 2H4YA 3FPHA 4D9FA 1L8AA 3K0FB 3N2ZB 3ODGA 4PQEA 4R84A 4GSYA 4ZOLA 1ZN8A 3DD1A 4UCXA 4Y9TA 4J7UA 1ZD8A 1ECLA 4GE0A 5IUJC 2BFFA 4QQNA 1ZK3A 1H2XA 3OFKA 3UUFA 5JARA 3IMFA 1U04A 2Z3ZA 3R0XA 4JROA 5I5GA 1W76A 4H0CA 1WLYA 5KYKA 4FGWA 4CM9A 4YT5A 4TVOA 4XOTA 1GA1A 4D2IA 2GTPA 3CTAA 1FP7A 4JSYA 4ZRDA 2CMHA 2PKXA 1NP6A 2EHDA 5AHWA 4F96A 2EZ8A 2Y76A 3RU9A 4R41A 5AKJA 3TSYA 2QG6A 2M6SA 2ET6A 3QVOA 3VVLA 1T13A 3FOAA 1ZLYA 2BTQA 1VGQA 1Q7CA 1ZM3A 1CQXA 1EDZA 1I2DA 2VT3A 2Q50A 2W4MA 3F7MA 1MQ8B 2PKCA 4JHXA 3V4VB 1WUIS 5AW8A 5LB2A 4WINA 1I1NA 1NBMA 1HQKA 3PEUA 3D1JA 4JITA 3SWWA 1NX6A 3DNMA 5LNK1 3CZMA 3MSXA 1J0AA 3T3IA 2XJ4A 3KL9A 2R8BA 4J1SA 4PYRA 3VX4A 1N07A 2R3SA 1A04A 1W85B 5K1ZA 2PUEA 2J46A 1KEWA 5J4KA 3PFCA 1Q22A 4AVZA 2WV9A 2XGGA 1ESNA 4IX9A 4LYDA 1VIDA 4TKLA 4DDWA 2UZ1A 1A2OA 1I3LA 2C9YA 3QSGA 4LQCA 1OT5A 2VPWA 1UD4A 4UU8A 1A71A 3L7LA 2G5TA 4CCAA 3ZXYA 2A14A 1RAFA 4WKNA 1UJ5A 3F6CA 2UYQA 1ECBA 4TWAA 2R86A 3RUCA 2VOJA 1WXXA 4V0QA 3PX3A 4IP0A 1E2UA 1UINA 1AKQA 1J70A 1IU9A 4MITA 1V26A 3CZAA 3DE1X 1Q2UA 5AQEA 3CCSB 5DX0A 1IEXA 2E87A 1EFPA 2QSYA 4AJ4A 1DWUA 1XNGA 3K9GA 3D2CA 4YCJA 3GDHA 1YKGA 4XVHA 2VPXA 2ZE5A 3LK6A 4OQLA 4ZVPA 2BDUA 2AFHA 4FP9A 3L8YA 3FVTA 4L3WA 1NM5A 4Q0MA 4C78A 4DCVA 1EEHA 1TCUA 3H2JA 1JWAB 4J0GA 2B94A 8ATCA 3B20A 3T1TA 2QRVA 1PZGA 3EG5A 4CKBB 4DA7A 5E2AA 1B73A 4ITVA 5EEHA 4YMGA 4XCVA 2X4DA 3T5DA 1YDWA 5LDGA 1ECGA 2Q4TA 3BZUA 4PBSA 2CHUA 4BTEA 2WWIA 5T8KC 1S2LA 4YRGA 2C3YA 1M0SA 6REQA 4U2KA 1BQEA 3TZLA 2BUAA 1QVRA 4OQXA 1ZC4A 4U39A 1KR5A 5L4NA 3RFUA 4ROXA 3OCCA 1JALA 3WG9A 1D6SA 1J39A 1WEHA 5F23A 1A9XA 3V3KA 2B37A 5AJTA 1V9CA 3QVUA 4X1IB 4XLCA 2VWHA 3G1UA 4BJ6A 1CDEA 2C0PA 3EG9B 4LV5B 4PANA 4RK1A 1KTIA 2H2GA 4LHZA 3RAFC 3HL4A 2W9XA 2WNIA 2NT3A 3C3JA 1XLUA 3KKKA 2AJ8A 4QDTA 4JLMA 1GSOA 4QT4A 3QVTA 3K35A 4YRNA 3FPAA 3HYCA 3SYLA 1KQSB 3DT8A 1OLUB 3KZMA 2BR5A 2VHWA 3ENZA 1GL9B 2YHAA 5CFNA 3GD5A 3KUKA 4MK4A 1NKVA 3FWYA 3DDOA 1Y6JA 3F96A 2ZI7A 4D3FA 3SZGA 3NANA 3HVIA 4MVJG 3WFJA 2R62A 2D3TA 3RRXA 3WGGA 3KQWA 2B83A 4GKAA 1MKYA 2E4UA 1KO7A 4CL0A 2UZ0A 3QYFA 2YYYA 4FGLA 4TQAA 3U1TA 2F6RA 4RK4A 2ZBRA 3DE6X 5JH7F 1G6KA 5IBCA 4I55A 1HL3A 2GEVA 2GSDA 5G1NA 2A88A 1Z39A 3O3OB 5IAOA 4BXOB 3GOQA 1TIBA 1Q86D 3BXOA 1UT5A 5EKXA 3TSWA 3VTZA 4WV3A 5DTEA 1G5PA 4DA4A 3IULA 4O4LB 3H2YA 1UMDA 1BO6A 5EPUA 1WKVA 2NVUA 5JG7A 4BBAA 1HURA 5HUQA 5DHRA 3THXB 2CCKA 4TTQA 4WUTA 4ZOQI 3G9QA 5LP6A 2YQ4A 3Q88A 3UICA 1SB9A 2XE7A 1PGPA 4W5RA 3QLUA 1RBQA 1GGEA 2VSFA 4PXYA 1EX1A 3LHDA 4Z1MD 4R01A 3H4VA 4C4ZA 4J4BA 1FOEB 1XZFA 1FNDA 4CM7A 1KJZA 3NM5A 3WOHA 1PR5A 1DWQA 2CF6A 5E6TA 1F12A 1JTFA 3TLAA 3SBXA 1MA0A 2WZQA 3CRZA 1GPUA 1V0JA 2OA0A 5J47A 3O1LA 2IZ5A 1R88A 3GIWA 1LRJA 2R751 1B42A 2V9PA 1DQZA 2V96A 2NIPA 3GHHA 4PZ9A 4UNSA 4X7RA 5TQ0A 3L0SA 1DB3A 1NXVA 3RUFA 3WLQA 4XSGA 3AUXA 1K7FB 1VHLA 2XX3A 5B7GA 5HRCA 3NP7A 3P5SA 1VP9A 2UKDA 1ORDA 5C53B 1TRHA 3D6HA 3OAAD 3OX1A 1BKYA 1H93A 1RXWA 1LFDB 2JJ1D 1UDBA 3GNQA 3L0ZA 3MOGA 5JAPA 2BHLA 1RHQA 4YJ2B 4JLBA 4ZV4A 2EG5A 2GNAA 1BWRA 2ZIWB 2W2LD 5KHAA 4DZZA 2J9RA 2NTNA 4J90A 4OHKA 4XE5A 4N03A 2HPAA 5HFNA 1ZR2A 1E6CA 2ESRA 4OPSA 4XB6B 2GHTA 3FFBA 1T9GS 2IZZA 3QOFA 4TSRA 4KZPA 5CEEA 3F47A 1T3TA 1N3YA 3OBIA 3WMWA 4EPVA 4IZOA 3G7UA 1W19A 1P73A 1VMIA 3K5IA 3UJ3X 3ZCTA 5A89A 5EHIA 2P9CA 3H6KA 4PCLA 3DZBA 4RIEA 4BCCA 4WRRA 4W9NA 3WLLA 4BFTA 3AY0A 1R8SA 1PFVA 2AN3A 3QQ5A 4PGGA 1STOA 5GJCA 3NIGB 4O2BB 3GFTA 2DX7A 3WADA 3JVVA 3CT6A 4MCAA 2EDCA 4MUIA 3X1DA 1DRKA 1FMLA 1H2BA 1U5AA 1C41A 3S99A 3RC3A 1TDJA 4X6YA 2I54A 2ZTGA 2QIOA 3KXLA 2DBYA 4LVUA 3TTWA 1G8GA 1SCUB 3FGPA 4AWAA 1H22A 1W2WB 4JFRA 3G89A 1T5SA 1TO6A 2GJAA 1CZLA 1OJLA 3GLUA 1CQPA 1IHOA 2QVLA 1E6MA 1TJ3A 1SOAA 3PUWA 4RHTA 3TG2A 5GZ6A 2NX2A 1PFUA 2LP4Y 2LBPA 3B38A 4F5EA 4ZKDA 1WUYA 2G72A 4RY8A 3ICEA 3GEGA 4Q5IA 4XGNA 2WKPA 1PWEA 2C7BA 3KUXA 1SHTX 3AM5A 2HK8A 4IXTA 2BGTA 1M5UA 2G09A 2DMRA 2PT5A 3DR5A 1GILA 4MARA 3MTJA 4RK7A 2GBGA 4BO5A 1NG9A 2O8BB 1TYCA 1F5NA 1BRMA 2G4LA 5CLLA 4DLKA 1G18A 3S8EA 1D1NA 3H6GA 3KR2A 5CIYA 5E4TA 4GWKA 2ZYVX 5C4MA 1FMJA 3HNRA 4F11A 2G80A 4BBPA 1XEAA 1DNPA 4Z9AA 2V7VA 2VJCA 3I64A 2OBXA 3PQ6A 3WV5A 3OQOA 2VLBA 1PDOA 1FUYB 1QHEA 2DFDA 5HE9A 5F98A 4AKHA 1J07A 4OI2A 2J32A 5H3LA 2FWMX 2QDKA 3IBTA 2CD9A 1N2XA 2NUAA 1PNVA 1PG0A 2GUGA 4RVUA 2OCIA 3T7RA 2XA2A 4IEIA 3GL9A 5P21A 4JIMA 1URPA 4EUHA 3W2FA 1MTZA 3I76A 4HAIA 4LI3X 4RKQA 2B6HA 3NC0C 2XCLA 5BOVA 4Y0VA 121PA 4HWOA 5IMSA 3LAWA 3R44A 3SIWA 3DJFA 1ZC3A 2JIPA 3A6EA 3GG9A 1JDUA 1UXOA 3LRPA 4IGFA 4IDQA 3KYDB 4TXNA 3THSA 1SC1A 2Q1TA 2HU7A 5JBQA 1W0JD 3COWA 3IB6A 4LQDA 4JVLA 3SGLA 3ZU6A 1GHTA 3TGPA 3STVA 3PEFA 4JVSB 3QWBA 3TIVA 2WUDA 1JAZA 2SBTA 4EFLA 1ESEA 1I2AA 3R5HA 2CHQA 5EZYB 4Q4HA 3WYAA 2JZNA 4JH0A 1J2TA 2X8WA 1E4EB 1MIOB 2H5EA 5HGXA 3AI7A 5K6RA 2REQA 4X54A 5K0LA 3VUFA 5IDWA 4RTOA 3D2LA 3FRJA 3RFFA 3V7YA 4PC3A 4DC9A 1U4OA 3KB6A 2BISA 4QT0A 3D4IA 3H1TA 2HIHA 3QHPA 4A1FA 4KN8A 5TMEA 4YMSA 1XN4A 3O4JA 4RTNA 3L6OO 3ND9A 5AW9A 1ZM7A 2D8MA 3HVUA 4Z3OA 1MXHA 4H18A 3ZXXA 4ZQGA 3KCQA 2PEYA 4BNIA 2QRGA 2IYRA 1L7NA 2ZULA 4U7FA 3VYRB 1KDTA 4CM6A 3LRTA 3OCUA 3GDGA 5LA6B 3SIPA 3AY6A 2VATA 3IQWA 4OIMA 4RTKA 4U2GA 4XRGA 2DTXA 4FN4A 3ZJ4A 3VR5H 4DK1A 5KCZA 3RQIA 1ZUD1 2PYDA 4XOPA 4NU0A 1FMTA 5COBA 3HB7A 2QUIA 4V3BA 2IH5A 2E5FA 5JYEA 1OD6A 4U7PB 3U31A 4J4TA 2ZTHA 1T9GR 4NTZA 3RV4A 1N8SA 4WN9A 4PHFA 5SYAA 1Z8DA 5EYPA 3RI3A 2NN3C 2ZT5A 4DVGA 1JA9A 4HQNA 3BHNA 2ZZEA 3CRMA 1W0KA 1THTA 1PX0A 2ZUCA 4RM3A 3VPCA 2BCGY 3OQBA 4OA5A 2WZNA 3MLEA 2OZPA 2HBRA 2K7ZA 4PZLA 4PAAA 4R54A 5B64A 5H81A 1RCUA 3QJ5A 4FXUA 4NK4A 2ZSIA 5MGNA 4MGIR 2PZEA 1YQUA 4M4SA 1BXZA 3EUAA 4MV1A 5EJ2A 2IEZA 3TLYA 4BVKA 1QJ4A 4LJSA 5I9LA 4DUYB 1EFTA 1ZL2A 3FWNA 3S1AA 2CXUA 2PL1A 5FUMA 1Z8FA 1COWD 2TSYB 3LF2A 4MKRA 4QPJC 2FRDC 5EFZA 1FFGA 4S1PA 4BKRA 4FMCF 3FMGA 1L4LA 2YV2A 3KO8A 4EKDA 4CIVA 2QRNA 1GNQA 3BSWA 3DO6A 3TH5A 7REQA 1SHKA 3B9RA 3O7MA 4G9EA 5FNVF 3VDNB 1GA4A 1ODFA 4ZJZA 4OATA 2RGGA 2XB2A 2QD3A 2BFPA 3VR4H 4CEHB 1H1LA 1UT6A 1EKXA 1EZ1A 3MWFA 4OL0A 1Z2OX 4L95C 2ZSUA 1W4CA 4UUNA 4H6PA 1N8NA 3T8YA 2AX4A 3F8SA 1FZQA 2E4XA 4RS4A 4UUQA 4UZSA 1L5GB 2C9ZA 3GJRA 3GUHA 4NONA 1TLLA 3IEUA 2YWCA 4CMIA 3S8MA 4L9AA 2CJPA 5FX2A 4NI5A 3IKMB 5KB3A 5JY6A 1GAJA 4IMIB 1TYAE 3L4BA 2QNRA 4QHSA 1UMCA 1UZLA 2C9CA 4ENTA 2GYVA 2ZL5A 3X2FA 1RJFA 3ZR4B 1MT0A 2LV8A 2W2VA 3R0IA 3W4IA 4YR9A 2NVOA 1F2UB 4MRVA 4E33A 2C9OA 3N7UA 3KP1A 3ONFA 4UHFA 4BVGA 2UVPB 2C7OA 4GKVA 1T9DA 1W8DA 2YWDA 2DKOA 2AFIE 4BYMA 5J4VA 1JPNA 2YUTA 3I01A 5EOVA 2XDYA 2IUEA 3VA7A 1PGNA 3F5DA 5ILOA 4G0VA 4QVKA 2NO0A 1RTKA 3AONB 3L41A 2J0UA 3LX5A 5AMXA 1YFLA 5FOVA 1SCIA 5AIBA 3DE0X 6ADHA 2HGSA 2NSHA 2VP2A 2XH8A 1SRRA 2YWFA 2AC2A 3QEMA 4RZXA 4XZ3A 4JYMA 5JSZA 4PFQA 3KEGA 2HBQA 2OVBA 4CT4B 4F60A 1C1DB 4MZXA 3E8SA 4JYAB 3ABOB 4ERXA 3JCZA 1M66A 5FI3A 4BIIA 3Q6QA 1M33A 1E4OA 1B4DA 3ZU3A 2XUKA 2FPXA 1RWWA 1P8JA 3L40A 4LSMA 3GGDA 2JGRA 1ISSA 2WWXA 1PSWA 2ZPUA 3IRVA 3TYXA 4UUBA 2JFXA 4R8MA 3L7DA 3FDJA 3GZNB 2OFXA 1VQKB 3HCRA 2F3QA 3NYRA 1YFJA 1R50A 1RC1A 3AHEA 3V33A 1WXGA 1MV8A 1PNQA 2V5AA 1Z4LA 4XUDA 1P2UA 1LPOA 4OHOA 4R8KA 4DL9A 3I72A 5BYJA 2O0MA 4Q7MB 3MWDB 2C77A 2ZITA 1I51A 4HGZA 5EQJB 5C1PA 3BPSA 3VR1A 3G5TA 2JFUA 1EB9A 1Z6AA 1V8OA 2IIVA 2QLFA 1ZH0A 1M7BA 5DBIA 4E5NA 1ZXBA 2I4NA 4NAHA 4NDAA 4ZDWA 2HLHA 3BEOA 1VLHA 3UAOA 2RI0A 3GCWA 3S3TA 1OFVA 4U0JA 2HMAA 1OIXA 1Q1NA 4KH0A 5BMVB 5AKIA 2FUG6 4YJDA 1GEGA 4HG2A 1F9EA 1IVYA 1YF3A 1C81A 2J9ZB 3B7PA 3E5HA 1XBTA 1SUAA 3BCRA 1Y6QA 3WIEA 2X1HA 2W2TA 3V4ZA 4EVRA 1ID1A 4WZKA 4KR2A 4G23A 4BO6A 3OG9A 1VCMA 1DJNA 1OUMA 1WY7A 4J2HA 4QDOA 4DXHA 1T1EA 4FWTA 3RHSA 4Z4WA 5A9SB 2D74A 2QA4B 4YJFB 1O7JA 3FXAA 5D87A 1DBRA 4ON9A 3AHIA 3UMRA 2GAJA 4C0XA 4J1TA 4MAMA 2EZTA 3NIBA 3NV9A 3PJDA 1K8XB 3AKEA 4JVNA 3GVPA 2HNAA 3F78A 2OHVA 2SICE 1MX9A 4H1WA 5K4GA 1DELA 3OX2A 1UWLA 5D86A 1C1XB 3T9AA 2CSUA 2H2IA 4JJ6A 1KYWA 3QKTA 3RSHA 4CV3A 2ZZMA 4KSBA 1RLUA 1C50A 3KUUA 3GJ8A 4ND8A 1DDIA 2B7LA 4LE0A 4MV5A 5H16A 4AP9A 5BP7A 1DKPA 3LMKA 1U2SA 3ER9A 3C16C 4QWWA 1APBA 5DMXA 2CFOA 1XZEA 1AKRA 4IDNA 1GL6A 2NXCA 4DVJA 1UXHA 3VH2A 1IVNA 1S8OA 1J97A 3CKMA 2XBLA 3MWGA 3S0JA 3D26A 3IJRA 5FAKA 4EUNA 3OQNA 4IILA 3Q3AA 1CE8A 1TMKA 3VSEA 1JEYA 1DOAA 3PD1A 1OQAA 1RVDA 3O75A 2OGSA 2C59A 1RAHA 1CF4A 4AJEA 5AXBA 1KRWA 1P74A 3LVFO 1CNEA 3ZBQA 4BDSA 3M8KA 1JXMA 3GA7A 3KFLA 2QGZA 4KI7A 2VDKB 5ERXA 1E99A 4P22A 2HA2A 3E2PA 2NO1A 3A3PA 4C0JA 2EYUA 2H7XA 1XAHA 4KHZA 4B6GA 3EA5A 3UWMA 4NU8X 4M0KA 4JENA 1RAGA 3VI3B 4CNQA 1PEAA 2DQKA 2GBFA 3N6RA 4DTCA 1U0SY 1ENZA 1GPDG 1JS1X 2X3YA 3O5AA 4Y0NA 4CM8B 3QLVA 3QEAZ 4RSMA 2F90A 3DEZA 1BN7A 3FFXA 2QTFA 1RM4A 1VCIA 1YR1A 5IANA 3SD7A 3ZLJA 3GLQA 2OO7A 4DQDA 4H77A 1OT3A 3E3AA 1Z4PX 1XOIA 2EEZA 4XWWA 3GLFA 1FTQA 4C9BA 4OI4A 3KQKA 1O94D 1OLXB 4RY0A 4QTUB 3JU3A 1H5NA 3PR3A 4BWVA 1M2OA 2HF2A 2QLLA 1H3NA 5AVQA 3DGEC 1DX4A 2G40A 3WB9A 2IHJA 2XGOA 4Q3CA 1KNXA 3OC0A 3SP1A 1E7MA 3DHNA 1S7CA 3ZBPA 4Q3KA 2BEKA 2FFRA 3ZI0A 4TYYA 2Z9CA 2HYDA 3TECE 5HS4A 3F6EX 3GJXC 4KEAA 4OBBA 3L77A 3EF3A 2OBSA 1AB5A 2TMGA 1U6JA 1JHAA 2YICA 3ORFA 4PSAA 1X70A 2XCUA 1H1DA 2VSQA 4EG0A 1CQWA 3EA4A 4L8YA 1JEDA 1LJUA 1R64A 1ILWA 1FRQA 4DWVA 2AHOA 3H16A 4N76A 1BDBA 5FWXA 4ZT6A 1ILEA 3Q10A 1D03A 3ROKA 3W7AA 3SX4A 3K1AB 4FMBB 1AKYA 1JDJA 2AN4A 2HJWA 4G1CA 3CS3A 4CV0A 4FCVA 4U7WA 4BFVA 2YVQA 4YI5A 2NMVA 4GGMX 1EESA 1W36C 4H59A 2PS9A 3NNDA 2YXBA 1JG3A 4QVAA 5E2IA 5DXAA 2CVHA 1ZI9A 3DUWA 3LX6A 4QGGA 4W5WA 1P9WA 3ZVNA 1NVAA 1AUVA 2CVFA 4ER0A 5IZ4A 5ELXA 1QGED 1JHOA 1N5LA 1KAOA 3V8NA 1B2RA 1RE1A 2GPNA 4EGCB 5F9FA 4JLPA 1GQOA 3FWHA 4I4TF 1Q3KA 3OBBA 1GRNA 1G3IA 1X8KA 2GA8A 2YWXA 4DMUB 2Q3DA 4DMGA 4BU1A 4I1PA 1UD2A 4XLZA 4FHEA 1NDQA 3R6KA 3FR8A 3MTDA 4GPTA 4X45A 3FZEA 1UEXC 1YLOA 2OCLA 3KEQA 1MVNA 2ECKA 3LQ2A 3C3MA 2HU8A 3PHCA 3QVGB 4IDGA 5DASA 5AOAA 3UJ8A 2J9YB 5KSPA 2G67A 2BGKA 2CLFB 4F9TA 3B1VA 4UARA 2CZQA 4EBFA 1GZ6A 4PHTA 5JZSA 3UMVA 2Z6VA 4IAOA 5AH0A 1J1ZA 1VXRA 3GUUA 3RU3A 3V2HA 1UBCA 3ZUPA 1ZVQA 5A5DA 5TB5A 3TJRA 4KSYA 2QX8A 2Z58A 4HYEA 4S1WA 1RXVA 4BNYA 2OK7A 3L7IA 1Y5RA 1SBYA 1Z28A 1ZJ6A 5EKTA 4DY6A 1FW6A 3FYUA 4JL6A 2GTHA 2AL7A 2UUPA 4IQGA 2P9JA 3STYA 1E1RD 2ZTVA 3DVAA 3FCOA 1E5TA 1CZUA 2I8CA 5CHEA 2CBXA 2JGLA 4JJGA 4EY8A 4GR9A 4KYUA 1YQEA 3Q39A 1WQ1R 3IXQA 4URZR 4C29A 3MINA 4RKFA 3JX9A 1I4DD 1E3JA 2DIEA 1OHHD 2W8BA 5GZ3A 1JYSA 2UYGA 3EVCA 4K6GA 2D0DA 1QJCA 4KYTA 3UTCA 4LFCB 3NXKA 3DFIA 3N8NA 4G0QA 5H82A 4ZJYA 4ZCTA 1MJGA 2GCEA 4LE2A 4UE2A 2QRQA 4WZ6A 3VSCA 4X8IA 3OOJA 1K66A 3JQ8A 1VPLA 3LK7A 4A10A 2QTHA 3TBKA 4G8BA 2FWAA 1C3VA 4M37A 5BV7A 1UDAA 4XTCS 2Q9AA 3E0XA 3ID6C 5JNWA 2QGNA 4EFKA 1UOPA 5CFOA 1TUIA 4G1VA 1YMVA 4QUEA 4UEOA 3SXUA 3AHFA 5KQRA 2EG9A 4FEGA 2DFNA 1DT3A 1PVVA 2FCRA 5FA6A 4GOND 4IMJB 2WYRA 5ERGB 3A04A 5JPCA 1FUUA 2OD2A 4OVKA 1SA0A 2I1QA 1VKRA 4QEDA 1KBQA 5IYQA 2FPPB 4N49A 5HMLA 3SJBA 2A30A 1U8FO 2BZ1A 3TI9A 2MYPA 2IHBA 1CETA 1ZOPA 1PJSA 1PR3A 2RGUA 3KQPA 4PAGA 1Z36A 3NORA 4P83A 5KI6A 4E3ZA 2V9ZA 4UNRA 1PEYA 3E0QA 3LCUA 2PK3A 3D6MA 2YBEA 3UENA 1EVJA 4AW9A 5IFKA 4P36A 4BO3A 3ROGA 5EEGA 4EKGA 4YV0A 1NMYA 1D2HA 5FLEX 1KZYC 5C8ZA 4PFJA 3L6BA 2N1BA 3E7PA 4JYPA 3I9OA 4F38A 1OTHA 4CMGA 2ZI9A 2KSQA 3LPAA 2R84A 4Y2YA 4MS1A 1DRUA 3CSSA 4UJ5A 4YP6A 3UUWA 4X06A 5BNTA 5CT9A 1WOMA 1F20A 4RV4A 5FPTA 2E9SA 3I3SR 3WICA 3G6WA 5IUNC 4ROSA 4FFRA 4B3HA 3EPLA 2ETVA 3CJQA 2YZ7A 2I6UA 3BMCA 4ZHQF 2JI9A 2W43A 3COVA 4X7FA 3WMRA 3C8HA 2IYUA 1H6BA 4BNJA 5KNCD 2QPLA 2NU6A 3GT7A 4KR6A 1I3OA 2WDZA 4AO8A 1V8DA 3CVXA 2FE4A 1PWYE 1TPZA 4R69A 5JEEA 1JAYA 4Y9RA 2EDAA 3KKPA 1M34A 2P7IA 2ZUFA 2O7NA 1SIWA 2COEA 4KUEA 3TF5A 3VOTA 3FYSA 1IQUA 1Q74A 2QLJA 2LXNA 4HNRA 1K7CA 1PIWA 3FDZA 3HBMA 2NACA 4M1SA 1VE7A 2C03A 3BREA 1MD9A 2UUOA 1BOOA 4GBMA 4EENA 5IULC 2A1UA 4DNFA 4BQQA 2QR3A 3PQ2A 3RASA 5BV1A 5KCMA 2XADA 3CWCA 3QKRA 2VUHB 3QJGA 1OAOA 4IDFA 4KB5A 5LN1A 4C7JA 4WNYA 2QRUA 5EPEA 5B12A 1WY5A 4FBMA 3FYTA 3BCDA 2ZYWX 3ORRA 1E66A 5F3DA 4CIWA 2ZP1A 4F8JA 2VJBA 3CNHA 5E6SB 4MVJE 1X1CA 2ZYGA 1UZNA 1KK1A 1VA4A 2QUHA 2Y1OA 3DFUA 3PK0A 1K5GA 2WJVA 1G5QA 4D4MA 1TNDA 3FJOA 2JJYA 1KEPA 1KHTA 1OFUX 1U0RA 1H0SA 1D0IA 2FJPA 3H3JA 4O2LA 1I5EA 3KHUA 1WHTB 2WF6A 3HU5A 4RQUA 2I1WA 4QSHA 4Y6SA 5AKEA 4EI7A 3KALA 4YUWA 5I7EA 3CC2B 4DMKA 3ZUGA 1TTPB 2JFQA 5CPFA 3ENVA 1S2DA 1UWCA 2YJTD 2ZIVB 3K0EA 1Z3IX 2CF5A 3E1KA 5B37A 4YHHB 3CMMA 2CNOA 2FA9A 5FI5A 5BXYA 4X65B 1K8RA 4L50A 3BC9A 1R0LA 4M83A 4DWJA 1FP2A 3OEWA 5LXTA 3N53A 2FR1A 4L57A 1DCTA 3UMMA 2EQBA 1VQ6B 2NVBA 1N92A 2XYQA 3UOGA 1Y8CA 2QOEA 2R85A 3AR8A 5L6MB 1GFSA 5AKLA 1SVOA 5ENZA 1X0XA 2VH1A 3EODA 3FAKA 3QMWA 4UULA 5CB8A 3K1ZA 4QRDA 1XE3A 4Y7CA 2REXB 4ZYWA 1MB3A 3G9UA 3AJ9A 5AW0A 4MIEA 2P40A 1QDUA 2Q1WA 2O1XA 3W5AA 3GP5A 3WIOA 4Q4CA 1U80A 4NP6A 4U7GA 5ITVA 1CC1S 1DDGA 1RXCA 1HKUA 1CQIB 3COPA 3F0TA 3IEVA 2DEUA 5F12A 1EJ2A 1FVOA 1X7DA 4OJYA 4BIMA 5DHSA 5TJHA 4BPRA 5IBPA 5C7OO 1FFXA 2DR3A 1H66A 3VISA 4EHJA 4G84A 1T4DA 1VJSA 1RYNA 3C6YA 2H11A 2ZOSA 3ZZNA 2KVOA 3DMFA 3SC3A 3PRHA 2FGJA 2JI7A 3OICA 2XNCA 2VXYA 4C0AC 3CUEF 3HB4X 1UXJA 5DRYA 3B7GA 4G8DA 4YR7A 2I7VA 1V11B 4G5FA 1WP4A 5A5VA 4OHPA 1WXIA 4HE5A 1OFTA 3FDFA 1PJ3A 2CJWB 3IAHA 4PNEA 3GSIA 1OLSA 2GVDC 2E7ZA 1FTSA 3CMCO 4U2FA 5H80A 5I48A 3HPRA 2M6RA 3ZXUB 4GOJA 4TKMA 4WZBA 2OO3A 4FGUA 1PJBA 4ZVMA 2QGGA 1JECA 4NULA 4C0WA 1MO5A 4QDZA 2ILTA 4JBHA 4TLLB 2V3WA 2WMYA 2OCBA 3Q8XB 4Z3DA 1JQBA 1QIDA 4U9UA 1Y80A 4OQPA 3PDIB 4MCJA 1T8SA 5C1BA 3OW7A 2I4LA 5C18A 3GOHA 4XGRA 1C9KA 2IF2A 2XRMA 2APJA 3DL7A 3M1AA 1UC9A 4MEAA 3DOHA 5G0UA 3AETA 3G79A 3MFYA 3MPUA 3TZBA 3VU8A 3H9QA 2JHGA 2V97A 4Z9FA 3E9CA 4N65A 4EW6A 5IT0A 1S3SA 2MMGA 4J0HA 3SSAA 4DCPA 4Y1EA 3QFTA 3BD6A 4OJTA 4PAMA 2V55B 1EVEA 3L7CA 4WNAA 4MR8B 4YGXB 1EFDN 4CLEA 4GX5A 2B4RO 1RBZA 1YOVB 1UF9A 2GN2A 4Q3OA 1VE6A 5AI9A 3R5SA 7REQB 3CC7B 1JUDA 2FUG1 2QYSA 1PJLA 3FPFA 3ZOKA 3FWPA 2HMUA 1JFFB 1R3DA 2Y27A 3AFNA 3KKQA 5BSUA 3TB6A 4C01A 2UV8A 3H9NA 4RKWA 3H1FA 2O20A 4AYTA 4KQFA 3ZHOA 3H5WA 1QYCA 1OI2A 2R4QA 3IC5A 3WE7A 1KORA 5F5LA 1VIMA 1I5OA 4YK7A 2WWFA 3KZXA 3HUUA 2PUBA 4H4DA 1SUWA 1V4VA 1MAWA 1PEKE 1DXYA 1CRZA 3C6ZA 5E7QA 1YVUA 4WADA 1PT6A 3C87A 4XUGB 4WCFB 1YZHA 3U6KA 2QHXA 2JFZA 1SBHA 3MZ0A 4HX5A 4MRPA 2DE0X 1PV4A 3MW8A 1RBMA 2RGBA 2H2DA 4OPOA 2WJ6A 1PJCA 4B7XA 2ID4A 3RC9A 2OK8A 1KP2A 1Z0DA 1QYWA 3HJUA 2BBTA 4EAQA 1VLVA 2ZJ6A 5FOXA 5AI5A 5B58C 2HYIC 1CPYA 2NUAB 1TJ4A 2OSBA 2PX4A 1VHTA 3PFGA 4QUDA 4TQ9A 2EKLA 3WXMA 1VBFA 1P6UA 4LJ9A 4X1KA 3U9LA 5JBNA 2GYUA 4Q1FA 1UK8A 2X40A 1JPVA 4N82A 1E1CB 1UBEA 4IDOA 4TWZA 1YD7A 1U02A 5KDLA 4CUKA 5LKRA 1OI3A 4HXFB 1ICEA 4C03A 4CKWA 1YRWA 2QQ5A 3DOJA 3KEFA 1CYEA 3OSUA 1EUYA 1EGVB 2I7DA 3IXLA 3WGLA 4MR7B 2X5XA 3RVQA 2IEDA 4OXYA 2UZAA 3FMFA 1XPJA 3G9TA 3G8DA 3QVMA 2WF8A 3UYLA 3WLFA 1F7UA 1EZZA 1N36B 1VMAA 2K4MA 1WXQA 5KNLA 1C2YA 1P5FA 1QBGA 2Z8ZA 1R0WA 3LT5A 4I9NA 4TM7A 4TUYF 3KAKA 4ZT7A 5M34A 3BF8A 4BJ1A 3UOAB 4D3DA 1U2DA 1PT8A 3GA5A 5H1YA 5AVRA 4V1CB 4NOJA 2XIJA 1VLOA 4I81A 4IFIA 3D5EA 3BXGA 2NUTA 5EE0A 3NS7A 4M53A 2Q5CA 2NW6A 1IPFA 3H5IA 3PYMA 4EQ6A 1ZOOA 2XB8A 3G2JA 4UVEA 5UKDA 4BE4A 5HW0A 1PK8A 3J7TA 4MQFA 1NUHA 1XR3A 5EJ8A 1PGOA 4BX0A 3NV7A 1D2CA 4P92A 3QU4A 3S44A 2HU5A 2EZUA 4RHUA 2IIBA 3ASYA 1WBBA 2C2BA 1BLIA 4B84A 5KVCA 3DOEA 2PBLA 1NVXQ 1X1SA 3DAGA 3P9YA 2O48X 4I2VA 4K6CA 1KZ7B 4X41A 1KYTA 3H9EO 4KIGA 4UMVA 2OHJA 5ENDA 3TJMA 4CE6A 4G5GA 3GRAA 3QU7A 2I7CA 4QDXA 3RC7A 2CXSA 4QTTB 1Y3FE 2ZT8A 4IF4A 3H97A 4TZTA 1F2TB 1V0EA 1QE3A 1XAIA 3LZ6A 2JLZA 4UE6A 3T3DA 4PZDA 1NRJB 1MIHA 1GN9A 4UUOA 1V96A 2IV3A 3FZGA 2BFEB 5DTRA 2RJ3A 4F84A 4ZCIA 3CNBA 4KC0A 1CHDA 1DADA 4XLFA 2BM9A 4G5RA 1KZLA 1HNWB 2FX2A 4NC9A 3DQQA 4XXHA 3ZZ1A 1UXKA 4CF4A 4KIJA 2BRUC 2JH3A 3TL2A 3ZHUA 3WBJA 2YJ6A 2CNWA 3EIWA 3PQ8A 5JDIC 1KY3A 4R2MA 4TMVA 1L4HA 2FZWA 3L7OA 2OMEA 2ID7A 4HMQA 4WHMA 3S5UA 4UREA 3NDRA 3ER8A 1IPHA 2VWGA 2B8WA 5JNUA 1DPGA 4KBFA 1OX5A 2J85A 1AA9A 1S4QA 4N7JA 3VH4A 4MV3A 4LF5B 5LPNA 4FR0A 1D4FA 1UD5A 4RPBA 2D0PB 3IQZA 1NXWA 1JILA 2IHUA 3GI1A 5D6NA 4E22A 3BTSA 5K3SA 3ANTA 4QLOA 4Y2TA 2EV9A 1N7IA 2CJFA 2OGTA 3NXSA 3Q6MA 1K5PA 2ZTUA 2R96A 4MW0A 4X1OA 5DTMA 4BJHB 1ZJWA 1DXOA 2D2EA 1JZSA 1UAYA 1XQ9A 4DMCA 2JW5A 3ISVA 3RS3A 1IATA 3MGBA 2VBGA 1YT5A 4URYR 2NO4A 3DF7A 4WWVA 1QU2A 1QRDA 4FEEA 4NBLA 1M0WA 2QSUA 5JD5A 2EXXA 3BWDD 3OZDA 3T9CA 5KQSA 1SY7A 1TMYA 4LTNA 2V31A 3MS7A 3EZ7A 5JMOA 5LDHA 1X3SA 4AF6A 1Y5LA 3RFTA 2FTKE 4DV0B 3QXJA 3U4QB 1PJ7A 1PL8A 3PF9A 4URWR 2VDUE 3NVMB 1Z4MA 1HG0A 3M83A 3GXBA 1USIA 1U3FA 3F67A 2RKOA 3CE6A 3V9AA 4Q3DA 4RCYA 2PUJA 4ZCPA 1KDOA 2JLBA 3HH8A 3H94A 1QV6A 4HGOA 5EIHA 3JAKB 1PQWA 2XWSA 3ZW9A 3BB3A 1XA0A 4B1FA 5I3ZA 3SFTA 4GZ3A 3A6KA 3CVWA 2CDNA 4H08A 3WQSB 2IE0A 5JI3E 4UVGA 2D59A 4NG5A 4Z4CA 4JX9A 1T4CA 3IOMA 1Y3CE 5BN4A 2I33A 3LNNA 2QWXA 3K8ZA 2WRZA 3IIKA 2YHIA 5DYIA 4AIRA 4OOVA 2HJGA 2QRKA 3CR7A 4G5SA 4XYBA 3VTAA 3ICVA 3IPYA 4JUIA 2JLCA 3ESZA 5HCNA 3VHXA 1P31A 1JIXA 1V1RB 4EJFA 4EYGA 1W0CA 1YBHA 5BVHA 3IO5A 4OGGA 1UFQA 3BF7A 1Y98A 3O8CA 4P4UA 3PUYA 3D6UA 3GVKA 1MFZA 3HCDA 4OK5A 3V9PA 2FSVA 1P0QA 1EYZA 2HOQA 4Z99A 1AGNA 3SEZA 3WLPA 2HRDA 5HBGA 4F2WA 4ZI7F 4K3UA 3CPWB 2ZAGA 3R3JA 4IZ6A 4IXDA 4JUBA 2J3HA 3WGHA 3ZDCA 2ZUDA 2O14A 1U90A 4AMVA 2J0SA 1BSVA 2OBFA 3NHYA 5I7HA 3OLWA 2AA3A 1L1RA 2H06A 4N1AA 1PJ8A 2E82A 2EARA 3ZHVA 1DFIA 1CW2B 1LLCA 4PQRA 5G1OA 1XN1A 1F4PA 1SURA 3RHFA 4ALKA 3ZDQA 5ABPA 3P0EA 5A0FA 2FB9A 3GRVA 1C0KA 2DP4E 4LYHA 4RDCA 3ISTA 1JIVA 3RIXA 3SR3A 4OHYA 1EIZA 3M70A 1YK1A 4RJIA 4CMEA 4CR7A 3HC7A 3SF8A 5C51B 2MWMA 3H1EA 3BRWA 2IJGX 1GTRA 4CF5A 3DAYA 2JEYA 4V0NA 3NNNA 4FZ5A 4D1YA 4L5JA 2PV0A 5DGDA 5DTJA 1Q82D 2GMWA 3EFHA 2ZIAA 4TT3D 1JKFA 5DBOA 5DK6A 3RVKA 1YBMA 1EFUA 4G1UC 4HAWA 1BVUA 1FS4A 3AUKA 3RV3A 3TNLA 2NO7A 3OEEA 5CA1A 4OQNA 5CU7A 3WL5A 2YR0A 3OF5A 2AZXA 3SLGA 1N2IA 1HMPA 1SO8A 1YZ3A 2ZS7A 1GT91 5L3RA 4XQCA 2PZGA 4A0HA 4QJ3A 2G07A 2ZUBA 3UA3A 1U0FA 3PA2A 3PXCX 5F3RA 4JXJA 4C21A 3FIUA 4C4SA 3SVZA 3LOPA 3I2FA 5ALEA 3U3DA 3OF3A 5I7AA 3GJSA 3ZZTA 3OJ0A 4A82A 4ETMA 4L8WB 3VM6A 4KWHA 1MB4A 3KS9A 4ENWA 5FH9A 3EJ6A 5JISA 5AJVB 4YMIA 5JD4A 4GZLA 4XX0B 3NJRA 5AI6A 4CRWB 2V8OA 2AFHE 3JQRA 1NOKA 5E2BA 4AZ3B 4LTMA 2QROA 4KIFA 1E1QD 4DQVA 4HRAA 4QASA 4DNPA 3KUCA 3AP3A 2AJCA 5EJEA 1DCMA 4NBSA 5CVCA 5K6AA 4LYAA 3TX2A 3SE0A 1WW8A 2BR3A 2NWQA 4IS2A 4KQEA 1QZZA 5AM3A 2VAVA 3DV0B 3AJEA 4WZAA 3ZHBA 4PG7A 1E2DA 3CISA 4TWBA 4U8HA 5DYYA 1B8UA 3EZLA 4OQEA 1RLTA 1CFJA 3JVDA 2GWHA 2AQKA 2VYVD 2GKGA 1W25A 1XC7A 3JZMA 4N8DA 3TL3A 2QTLA 1K4KA 1Q0RA 3TQOA 2JJ2D 4JL5A 3LCCA 3O2JA 1DAEA 4H7FA 3RYFA 1XFDA 1RJ9B 2FEPA 4F2GA 3BXPA 4JV5B 1EHYA 5KTOA 2DBQA 1Q0HA 1SULA 4L8GA 1DDOA 2EATA 2YN2A 4W63A 3THWA 2DM6A 3DD5A 1N08A 4TVKA 3VDXA 5TQVA 2BOVA 3UK6A 3B5EA 5C46F 5K5EA 1P45A 1SBIA 1WUKS 3KPJA 4O3MA 1KJWA 1OOEA 4F4HA 2JBHA 2X23A 2XYVA 2ZS9A 3CC8A 1YULA 4R9NA 3S2IA 1CK4A 3ITEA 4IFEA 3MXTA 5IKXA 3RG8A 1RYHA 4KO1S 2J48A 3CCJB 3I9LA 1U0TA 4H27A 1CUSA 4ZTBA 5T67A 1H0KA 3GR6A 3H99A 4OX9B 1GPYA 4QARA 4ICIA 2R00A 5K3FB 5KAMA 1EUCB 5FV7A 2JLYA 3CUUA 1Z5PA 3IQEA 4X24A 1D5CA 5CYPA 3RPEA 4BLRA 1PJQA 2O2DA 2YC4C 4HLUA 1M6EX 3HA7A 2C0QA 1U98A 4OQYA 2BE9A 4LXTA 2J9FA 1Z25A 4OP7A 1D6JA 1P6XA 2JK1A 1L3IA 3REOA 4YO7A 2OOSA 3W6ZA 4F5WA 1J7KA 1HFWA 4FEAA 3H87A 4A7PA 4II7A 5T64A 1JJVA 4NMLA 1YDMA 2BJVA 5JNVA 2O3JA 4X63A 5LQUA 3LLUA 2W6ZA 3OX4A 4K2AA 5AKXA 3W3AD 2PGNA 4LK3A 1IEVA 3DXZA 3HNOA 3OPVA 3A32A 4HADA 4C6TA 1ZVVA 1XTZA 2YRFA 2BZSA 3HU3A 5EHQA 4R7ZA 3S40A 4F8YA 3STWA 1GL3A 1Z5GA 5K3EA 5K0ZA 4GI5A 1WOPA 3GQBA 1O58A 3BN3A 1JJFA 1T3HA 1X7XB 2HF9A 3IEMA 1M1UA 3FYHA 3IR7A 1P39A 3L5OA 3OSZA 3UYKA 1W2BB 2Q0QA 5K0SA 3NVDA 1KJIA 1GU1A 5AXAA 2VRCD 2A92A 3JAWA 3VKUA 3GVLA 4ZHQA 2EJWA 2RJOA 3F97A 2BFCA 4B3GA 3KSMA 5SYMA 3S28A 3V46A 3X0DA 3PWZA 4DLRA 4I4IA 3SHVA 1DU4A 1SD5A 4PBRA 5JS7A 1DBVO 1N9KA 2OBYA 2HLDA 2ZJ8A 3MQFA 3VNUA 2YWHA 3Q6NA 5GJWC 1QH9A 1SVIA 2CKDA 4HEHA 2AD5A 1QHSA 3V00A 5CT5A 1TIKA 4B6SA 2A9OA 1O77A 4JKIA 4AJPA 3COYA 3BGSA 1C7IA 1DTWB 3HJCA 3QMPA 2HRRA 4W9RA 1BHO1 5FHRA 4ZV9A 1X3LA 3HMKA 3TQFA 4CTOA 3BH4A 1HDRA 4IIJF 4XYGA 4Y2JA 4HAVA 3FUUA 4IIFA 1BXRA 2IPLA 4Q05A 4WUVA 3O0DA 3CPSA 1XVUA 1DKNA 2P6NA 5TPWB 5EE3A 3QXCA 3C74A 5I47A 4ZTUB 1IBMB 2IYZA 4LBYA 5JSKA 2HCJB 4N4AA 4NBUA 2JIZA 1KA9H 1YCFA 3SSMA 2MSLA 4PN7A 4AB1A 3BJZA 1BEZA 1JHDA 1IHUA 3IHTA 4IDAA 4NQRA 4DR1B 4HEA1 1G4AE 4HN9A 2XQIA 4H7IA 4EJSC 4Q82A 3OE7A 3OCXA 3ABSB 1BXKA 1OWMA 2QL6A 4IHJA 4P53A 3PNOA 4QOGA 4Z54A 3MGGA 3BAFA 1Z8NA 2Q3FA 2RB4A 1KYZA 3EFOA 4HDNA 4QHYA 4ISCA 5JASA 1XZJA 1TOAA 1TCCA 5JFOA 4JOCA 4E5MA 5U4XA 3RYIB 1QANA 2DTDA 1SQ0A 3DR3A 3B78A 4ND4A 3LLMA 4KSCA 1EJ0A 4QELA 3S68A 2FCAA 4DB2A 1DBWA 4RS3A 1ESZA 2SKCA 2C5HA 1EWYA 1ZZEA 5JADA 4HCJA 1NOIA 1GGKA 3IEXA 2QYTA 1W96A 3W04A 1KRXA 3VXKA 4WGGA 1NNLA 3FTPA 4KQ9A 5DO9A 4URVR 1PK9A 3QMVA 3ZQUA 1SBZA 5AVZA 2ICAA 5IM4F 4XGQA 3ZD7A 3WJ2A 4IDHA 4XQ9A 2VA9A 2Y67A 2VBTA 2C07A 2HJ9A 3DTVA 2HIAA 2Y0CA 1TO2E 3KG2A 4PYOA 5EESA 4E4YA 5DJ5A 2GSWA 4PQFA 3A0UA 4AJHA 2QUZA 2KS6A 5CP8A 1GPNA 4G07A 5JD6A 3E1SA 4AN0A 4R5HA 1LTHR 3QOXA 1MCZA 4J1NA 2DPHA 1K9MD 3KE9A 4WK2B 4EG7A 1Z22A 1D2EA 1M2VB 2FZGA 2WINI 3BDAA 3OW2B 1G4UR 1HDEA 3CLRD 4U3JA 4H6WA 3VU1A 5FFFA 3W3ZB 2PY6A 2N46A 4TLEA 4XJVA 2AJBA 4E1BA 2XLCA 5FB3A 1Y8QB 2NZWA 2BT4A 1HDGO 2EW8A 2I7XA 1LY1A 5LOVA 2WBLC 4C0QC 5JJIA 3RU7A 1SHJA 2C5LA 4G01B 2G4CA 3INYA 2GJKA 1FSFA 2I2FA 3GN1A 3SAJA 3NEPX 1G17A 5FBZA 2X0EA 2ECPA 3VGJA 2IZ1A 3D8NA 2OG2A 4EUSA 1AURA 4DV1B 1LRLA 3SC2B 1JFSA 1C4KA 5GWXA 1AV7A 3M9XA 5KVQA 2ZWOA 3ADDA 3ZEIA 1EUDB 1QAQA 4P9NA 2VHXA 4Y30A 4YFVA 1B41A 1R66A 2OM2A 1SQSA 1UKYA 3PYXA 1AQUA 3OLYA 3RFCA 1BDMA 3A4NA 2PZMA 3CH7A 4EYOA 2JN9A 1X7WA 5I7UA 4MYRA 4DSUA 2Y05A 3KQMA 4J0EA 4ZVRA 3TNFA 1DAPA 3FYDA 5AM0A 1JN0A 4GWGA 2X53S 2MSDB 2Q3CA 1UODA 4TN5A 3CR8A 4MW6A 5DKFA 5IKMA 2WHEA 2OZEA 3LDHA 2B3DA 1JG1A 5AVXA 4CM9D 1K2WA 3KD2A 4OJNA 3AHCA 4HNHA 3O91A 2DFTA 2QMHA 1T9ZA 1Q2XA 3BL8A 2ZI6A 8AT1A 5I01A 1GNLA 4MEBA 3H9BA 4U4AA 3Q85A 4M0MA 4MINA 2AG1A 1CY4A 2Q9BA 3WLKX 1R4ZA 3QH4A 2LKCA 4KXQA 2VHYA 5ANRB 4GPBA 1MQAA 5BW8A 1B8PA 5HDQA 3ABQB 2I34A 3FB4A 1Q6ZA 2CVPA 3K6JA 2X7XA 3HP7A 4RA6B 1E0DA 3R8XA 2ZZNA 1EG7A 3LOQA 1RXEA 3ZGYA 2J09A 3ACCA 3REFA 3E2MA 2IBTA 2H4FA 2XWJI 1NPDA 4I9GA 4J3NA 4PXAA 1L7EA 3T34A 2GEJA 2YZNA 5JC1A 2LD4A 5CT6A 5FNVB 1POWA 3ZDAA 3RAPR 3K5HA 1BHQ1 4LJ4A 4LJKA 1M1KD 2VDWB 4MUXA 3TZQA 3ABRB 1IE3A 2JCYA 2Z4RA 1S2NA 3DL0A 3PENA 2Q41A 2C2XA 1YXMA 2P2YA 3NG1A 4O4JA 4P7JA 4YASA 3KPVA 3I9FA 3CG0A 1G6Q1 3DXYA 1XXHB 1KEUA 2B7CA 1QOQB 4RIGA 2IHKA 3AQ4A 3UQYS 1ZKMA 5K7SA 1PUIA 4W1SA 4RL4A 4HZUA 4NIMA 1YQWA 2SCUB 3EDRA 3CPEA 2H2WA 2PXCA 2V58A 3SM3A 3BT7A 4C7KA 3NE5B 1NVKA 1SG0A 3LY8A 4CQJA 1JEOA 4LRQA 4RDIA 2DHDA 5E7IA 3TSOA 4BQRA 4EFMA 4M9RA 3CNNA 4UBIA 1IZYA 5F33A 1HDCA 4XD7A 1Q1EA 1N8KA 3G88A 4XIFA 3IAXA 5H4HA 3ZWYA 5LQMA 2R8ZA 3PJEA 1TFRA 3I2GA 2H92A 4I50F 4W5NA 4OHZA 2VTBA 1OZFA 3RK0A 3S2ZA 1ZH8A 3QKSA 3A37A 4TWJA 2WUWE 4O4HA 2Y1LA 3IHLA 3FX2A 3FHCB 3V4OA 4D6XA 1V3QE 2GX6A 3AR9A 1HLFA 3HEBA 1AJEA 2H1WA 5CD9A 4Z4SA 3IMKA 1PBTA 4OSPA 5AR1A 3E5MA 3LHFA 1PWZA 1Z08A 1D8TA 4UEJA 5F1OA 3WMXA 3OZAA 2B5WA 2QSZA 3LYHA 5CAEA 3T5MA 2O19A 1EFVA 1BYIA 2ZEJA 2ONCA 4JYBA 5MN6A 5ARCA 2BHSA 4GL4A 4TUYA 1W1WA 5AVVA 3DBHA 5EI5A 1QB7A 1ZSVA 5EXXA 4HLDA 3WOVA 3WLJA 3CCQB 2WMOB 2II6A 3FCEA 4FUQA 4NCHA 1IC6A 3BC1A 2FK8A 1AQNA 4YELA 1M2GA 2FSPA 2WJYA 2RC5A 2J07A 8ABPA 1PUXA 2VN8A 1PW5A 3H18A 2EBUA 5JSHA 2GFHA 1C8LA 3FNIA 1NHGA 1R3UA 3P26A 2ON6A 2ALJA 4Q6BA 2BV3A 3JQDA 2C0CA 4CQLB 3N28A 3VYUB 3R7LA 2FLKA 1PL7A 4RU1A 3CZ4A 2UXDB 2E6KA 3A6JA 4RDJA 5JSQA 5ALIA 2DPYA 1R5JA 1JLKA 1Z75A 2OFWA 5TARA 5BR4A 4JI4B 3DAHA 3C1UA 4BV9A 2JGMA 3GV0A 5C8XA 1MZPA 4B2YA 1JU9A 1AT1A 2AXNA 2JLRA 4EG6A 2GK3A 2HLNA 3PKJA 2CLKB 2IEIA 3VO2A 4LS3A 1XXLA 3QPVA 3ZHTA 2NTYC 2Q2VA 4H1HA 5K8TA 1PJRA 1VHQA 2DLDA 2ECQA 2WV7A 3BCSA 3KYCB 2BTOA 4DXAA 3I2HA 3ROXA 2VYCA 4ZK2A 5FOWA 3C5VA 5BSXA 3O8OB 3Q9NA 1J8DA 1I4EB 3NHPA 3EA0A 3CB4A 1Y6ZA 3K1TA 4M46A 4YAIA 1QONA 1Z9BA 4B6PA 4DQ0A 4XWOA 2VQEB 3RKUA 3Q6RA 3WVNA 3HE3A 1LK5A 5FUXA 1G6HA 1WOYA 3PC2A 5B3LA 2V0CA 1RMYA 4ID3A 1JH8A 2P79A 1Z2PX 4MUNA 1YMQA 1AUQA 2DKFA 4OM8A 1LB1B 2AG5A 3UKOA 1U28A 3V55A 3QNMA 4U7JA 1KDZA 3OJXA 1ABFA 2GCOA 3ONYA 2OENG 3WYFA 3EHDA 1QGDA 2JHFA 3GF4A 5WRFA 2LCFA 4F04A 3BQNB 1P6QA 3QX8A 1XCJA 3DWEX 3NHLA 3CPXA 1XZHA 2XYHA 3D54D 2A9QA 2D3WA 3CF6R 4OXNA 4B3DA 2I71A 3CLUD 4OLAA 2ZRAA 4MRRA 2B1RA 1OW3B 3D6JA 2TECE 4O33A 4I9UA 4B5KA 2ZBPA 3Q9UA 1P0MA 3MWLA 3LUJA 5E0KB 4BMYA 3H86A 3GRFA 1Z4KA 4DFDA 2X5OA 3BMXA 1ZR4A 1IXRC 1SXJE 4OYLA 1CR4A 1P1JA 4GPIB 3BGWA 4GPEA 5FO0A 3WGUA 5AQ1A 5LZ2A 2FZKA 4G0MA 3L6CA 4CM4B 2D3NA 2XODA 3PU6A 5JMWA 3A3OA 5CB4F 1UJCA 1OFUA 3MBKA 4ZAYA 2UUAB 5ELLA 3BH7A 3HYTA 3F6SA 4AZWA 4EJ2A 3RODA 4RJTA 2VJDA 1V71A 5C8YA 2VEOA 4IL5A 3UJDA 1WMDA 3OTQA 4CT5A 4CV2A 4A8PA 3E3LA 4Z4GA 3IDQA 4W4TA 2H5JA 4YRIA 1KIFA 5F1KA 1B0UA 4BLVA 4KMRA 2Z2IA 1WL8A 4NZOA 2ODQA 1YTLA 2WQ7A 1CD5A 4YMLA 1JHQA 2PA3A 4LC0A 3LC0A 3TAXA 1AA6A 3WL7A 1YR3A 3NONA 5ALRA 1W36B 1O96A 1HFKA 4DOMA 2WFMA 1S72B 3GQVA 1SUPA 1M75A 2G9VA 4PRKA 4EOGA 2IPAB 4K2HA 1XZIA 2ECFA 2WQZA 3RYHB 5F4ZA 3LFUA 1G2QA 1LWNA 3TMAA 3ZX4A 4DPKA 1L8LA 4OFBA 1DC5A 1J0XO 2HB6A 3ZI4A 1NF2A 1G41A 5HTOA 4G0WA 4JT9A 2PFSA 1I7LA 2QLMA 2P75A 3G49A 3IVMA 3N3AC 4MJ3A 4Z0TA 4XQGA 5F51A 5FI1B 4DEYA 3NBXX 4GX0A 4YRSA 4US2R 4P12A 3PZRA 2GZSA 5K51A 1H1TA 1ZWKA 3L02A 2OHXA 1C7FA 1D1QA 2NZYA 4D8UA 4GXTA 4K9NA 3EIHA 4DV4B 1T5EA 4NBTA 3U9SA 3SXJA 4XFKA 4Y9UA 3RT9A 4ZI7A 3T7IA 5HR5A 4CI9A 2QL7A 2JFHA 4QPPA 5ADWA 3JRXA 3LIPA 1SBCA 1JIIA 2WYVA 3IEPA 1J8VA 5G0TA 5EC8A 1ZDMA 2P90A 1QPZA 2KJQA 5JCPA 1E2KA 3DOIA 1O9GA 4DJEC 2XWBF 1BEUB 4DLUA 3H65A 2QR5A 2P5YA 2LNDA 1OYOA 3AEQA 2CHFA 4MV9A 4N48A 1VZ2A 5FQOA 3P2YA 2HSGA 4XM0A 3TSAA 5C80A 1K6XA 1E1DA 2J3DA 3AF3A 1ODJA 3FDIA 3JV7A 3HZOA 3PUKA 4HGNA 4K88A 3C5CA 1Z7YA 2EVWX 5EWLB 3T35A 3WWDA 4AQDA 2E3JA 4YMHA 5B36A 4YJKA 3PE6A 4BGDA 3UBTA 4G0XA 2E0IA 2PRSA 3RSGA 1JDPA 2BE7A 4YRCA 5BW5A 4Q4DA 1EDOA 5IG2A 2X3FA 2WIGA 2MINB 4BLTA 3ZGOA 3BMQA 1KEEB 1M8JA 1MAUA 2CVZA 4B6OA 1UKAA 2HO4A 5TGDA 4CKCB 1T5OA 1NTOA 1WPQA 1DJOA 2OD7A 3QUCA 4FZVA 5EXDA 2XTNA 2WJPA 5DN6A 4I4TB 1I2CA 5TVGA 5LBTA 2PX0A 3PXDA 1EFRA 2B4QA 3FZQA 4XUEA 1R6DA 5TV2A 5KJ6A 1ADJA 1RT9A 4G41A 4EA8A 2RD2A 4PVCA 5JS2A 4I6JA 5ESWA 3ZCSA 1XX6A 3OIDA 4OIFA 1YIOA 2LCIA 2ZYIA 1AK1A 5EA2A 5L4SA 4KTVE 4Z7JA 5BNWA 3ZHQA 1P61B 3PCXA 2QGFA 4MPJA 5JRDS 2L0XA 5BUQA 1KR2A 2E18A 5FL7D 2JNWA 1GA6A 5DNEA 4D8XA 3PHBE 2H31A 5MDHA 2VT2A 3O8QB 5FBHA 2FPLA 4B3BA 1QHNA 1A69A 2QD4A 1S96A 4IFBA 4XUCA 4WZAB 3ZV7A 1S89A 2D8AA 2JHPA 3HO1A 1TU4A 1NT4A 4TZ6A 1UWVA 3LDGA 1MFPA 1DG3A 2YL2A 2Z04A 5FTMA 1C3EA 2Q0SA 2QMEA 3VU0A 3BXHA 1I2MA 2PJZA 2H1RA 2JLSA 4Y2GA 5EWMB 1IWOA 3ASRA 4CQNA 1TECE 1LNQA 3S55A 5GONF 1LW7A 1T43A 2BIFA 3MRVA 3JQ7A 4TKZA 2YWEA 4LNUA 2FXIA 1YHNA 2QN8A 3UJ9A 2GZ1A 4L4XA 2QI9C 2VRWA 3GVHA 3ONVA 1JU4A 1MJHA 3QE2A 4RY9A 3ET4A 4A6DA 4B32A 4DR2B 1WU7A 1L7BA 2BYTA 3LH5A 4RA9B 2GD2A 2WU4A 3H42B 3UW3A 3ITNA 5FD8A 3NBUA 4CL2A 3DZHA 3OZIA 2YNMA 1Y1TA 3CXCB 3AVPA 3GFPA 3T1VA 3E9QA 3T3MB 7AT1A 3AOEC 2R97A 2Z09A 3E4CA 4MNTA 3LPDA 1E0AA 4X05A 2D4HA 1A8UA 4MRNA 1XT6A 1CIPA 1M2WA 3CUWA 2YDXA 2HEIA 5ICEA 3EDYA 4NHEA 3VJKA 2VDNB 2KYRA 2W4QA 2P3OA 1JR4A 4PBTA 3O1HB 3BKWA 2YZGA 5F4JA 3JQ9A 2RGCA 3GC6A 3PFHA 3FNGA 5DK4A 1P1IA 1W88B 2A5JA 5FCDA 5KWJA 4TVBA 5E0OA 4B3SB 3AIKA 1CLEA 3CH6A 4LBZA 5E4JA 3PE4A 2WKSA 3WKCA 1U7DA 4BNZA 1N6PA 4MGEA 3OFVA 4G3XA 2XDQA 3LUAA 2F00A 2X6QA 4ITRC 3AWDA 4MAFA 2Q7OE 2F2TA 1YZVA 1RYZA 1J2RA 1AGRA 1VBNA 3BHIA 5A4IS 1IXKA 3WGIA 1LRKA 4X95A 3UANA 1OWLA 2LW7A 1I0IA 2XI4A 5HZMA 4JZYA 1C7RA 1AXRA 1OBFO 4OKNA 5PGMA 3R6LA 4POOA 5JUWA 1DMSA 1WF6A 1I10A 4YUVA 3VR6D 4UFPA 1FUKA 3OZ7A 5H5JA 4I1UA 4DR4B 4FQ8A 2PQ6A 3L1KA 3WGVA 3S4YA 4F7DA 4OHMA 4IIDA 3TLEA 4WNCA 1ATZA 1VYVA 3FYCA 3GK3A 2V0NA 4FHGA 4MV7A 1ZMXA 4X07A 4NZZA 3V3TA 3QX3A 1IMJA 1PF7E 2ACWA 4FW9A 4GGOA 1X38A 5BV2P 2ZSFA 4ZRNA 2OBLA 1KFJB 1HM5A 1TIPA 2BHTA 2D0OB 3A0RB 3EF1A 4WOPA 2IYFA 4HDKB 4QECA 3U0VA 1BKSB 2FNAA 3CXRA 1SIBE 3FHLA 5FORA 4AMZA 3OP1A 3IURA 1UKVY 4F8EA 5IRCD 1G5HA 3VR4A 4CLRA 2PKQP 3NO4A 1GUAA 1MEEA 3HYNA 3GEDA 3MUNA 4G4SP 3GUZA 4YP1A 4Z0HO 1L7DA 5T57A 3TQIA 3ZWCA 1N9GB 1GCAA 5JPDA 4IUBS 1PLKA 2CLMB 2QZSA 4IWNA 3U7QA 1BWSA 5DSZA 2DERA 2ZVPX 2MSKA 2QYOA 3QXSA 4FOPA 2XQKA 4A6XA 4F45A 3H9CA 3PUHA 3ONDA 3A4VA 4BC1A 2C2OA 3DCJA 4LHVA 2QA5A 4YDRA 3VQTA 2BD0A 4KFCA 2Z2KA 3DEKA 3DQPA 1AK2A 4HB4A 4K9MA 6YASA 1X14A 1V8PA 3HB0A 1IM2A 1U94A 2N3ZA 3QE3A 4N3AA 1KK0A 4AJIA 4EX6A 1PS8A 1T4BA 3FF1A 3D43A 3PUMA 1VLJA 1T36A 3QMMA 4RLHA 1YHZA 1G19A 2D5AA 1N34B 2UUCB 1NKSA 5L46A 2WDPA 2MSWA 4MPDA 4LF6B 1SOUA 2RBEA 4URFA 4WQMA 5DWVA 3HK2A 1NBWB 4W6ZA 2OXIA 4KKVA 1M34E 2VTEA 2JDID 3DO8A 3SKYA 3MERA 1GM5A 2YY7A 4JQOA 1E94E 1BJTA 2C88A 4HDRB 3N74A 4NDNE 4A73A 4AJ2A 5JV5A 1FFHA 4Z0NA 1BMFA 3GH3A 2G0NA 2MMCA 3SC4A 3GJZA 2HDOA 1N2ZA 4KNWA 1X8LA 2ZCJA 4OOFA 1NXTA 3M1YA 3MMZA 4QXQA 5T8KA 4DS3A 1L9KA 1ULUA 1OKKD 1CULC 1RWOA 1FK8A 2VAXA 3QA9A 1WU8A 4M0UA 5A5FA 1NURA 3HBJA 3OQ6A 3BEDA 2AZMA 3CNQS 3ZNNA 1UOQA 2W6MA 1NR7A 3B13B 3QLEA 2B8NA 3PGJA 1GZUA 2NPOA 4IQ0A 3L8FA 5ITZA 2I7TA 4GW3A 4ILKA 2X9VA 3HR8A 4TTVA 1QRAA 4WK0B 3A1FA 3BWXA 3SVTA 4IICA 3P9SA 3Q7QA 1CR0A 5HEKA 1XPRA 3EFEA 2QW1A 3R7WA 2VDOB 1YHYA 1OFHA 3OOCA 3KELA 1Q7RA 1IWPB 2A57A 4RABA 4LK2A 3BKXA 1WZIA 4ZVSA 4ATNA 4PY2A 2RHMA 3STXA 1KVQA 1R4NA 4BU0A 4D45A 4O08A 2GK6A 1C1YA 5DW3A 2HH9A 4FE3A 1F2DA 5BPHA 2GJPA 3IPCA 2Y68A 1RYMA 4DJDC 3LQQA 5CBPA 1KJNA 2ZB8A 1RCFA 1GRCA 2F9FA 1JEQB 1WP6A 2QJTA 1SUBA 4H7PA 4UCFA 4EY5A 2Z6QA 4LY0A 2X6YA 3EXAA 3P0FA 4WXPA 4XRRA 5JWRA 3LT4A 1KVSA 4AI6A 2HA5A 1MDFA 2PV7A 2J3LA 4IOJA 1DAFA 3GEIA 4EFNA 2JASA 3UMYA 1TZCA 4DV6B 3HKEA 2BL4A 1G21B 3JASB 4HQFA 4I5GA 4ZU3A 4YAGA 3CWZA 3ZVLA 3PA8A 4RO0A 1E7RA 3ONWA 3GGCA 4C7VA 2B92A 4FX5A 3ZH9B 4K81B 2X0DA 2BBWA 3RVOA 1RSZA 2AE1A 2H0QA 3NETA 3SSOA 4JUCA 4L6AA 4IIYA 2XUQA 2OBRA 2P65A 3EGIA 2XGJA 1YR9A 1O6CA 4XKJA 4WESA 3A4YA 3AUTA 4REQB 1V41E 1V7QA 4GX1A 2JH9A 2G88A 1XNJA 1NLFA 2IIQA 3R0QA 2BVNA 4UDNA 3QA3E 1YITB 2PT7A 4MULA 5F7JA 4M6WB 4CR8A 2DFVA 5LD2C 5K3DA 4P6YA 1W34A 1R8QA 3KSUA 1WZEA 3ZBUA 3GLTA 4JJ8A 4C22A 5I7RA 2WWHA 3ONUA 5JWOA 3MMPA 4ZTZB 1P0FA 2R7KA 1CUVA 3D9QX 3QXHA 2WTXA 4Q9IA 1P4RA 5DGCA 1CX9B 1DXQA 3MAAC 5EKSA 4YFYA 5JXGA 3M34A 3OKPA 3OO0A 3WY9A 2QRHA 1ZJ4A 1DKMA 4QNNA 3IX7A 2R7MA 3SJ7A 1E9EA 4FNMA 1ZBQA 2IHZA 2W0MA 1KZ1A 1T8RA 1XJWA 4JZKA 4L22A 4MGHA 3T1QA 5TQ2B 2DLCX 1QIHA 4WZBE 1ONNA 1B14A 3GNTA 3KKZA 2CYCA 3KBOA 4I9HA 5DF1A 2O8DB 3FPPA 1WJGA 4E5VA 4QC2A 1WOOA 2G17A 3NATA 3ZLVA 2KX7A 3CYFA 4X9XA 1ANKA 3RSFA 3HCFA 3C70A 4ZN6A 1EFCA 4RAOA 4KLRA 4LQLA 5H3CA 2IX9A 3U3KA 1YVDA 3V4LA 4G5XA 1QHHB 1V16B 3N8GA 1AUOA 2ZJ2A 1CWUA 3OPMA 5J2TB 1U9ZA 1E6UA 2JBAA 4OUDB 3QPAA 1CZKA 3VR3D 3C98A