4HE5A

Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
REFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Unknown function
molecule keywords Peptidase family U32
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he5A00
1GR1A 4UAJA 2BM0A 1D2EA 3VO2A 1VQMB 4LBWA 3PENA 4MYTA 3CCEB 4RCZA 4AF6A 2HMAA 3W2HA 2HDNB 4TMXA 3U6BA 2QMUA 3J81k 3W5VA 1B2RA 4B43A 2BV3A 1QGZA 2CNDA 1GVHA 1R5OA 1NDHA 3WY9A 3QE2A 1VQ5B 1ELOA 3ZBTA 1UMKA 3B78A 4C0SA 2XNCA 3ZZUA 1QFJA 2YWEA 1QH0A 2PLFA 1YHQB 4M2LA 1IJFA 1VQOB 1W2BB 1KK2A 3QFSA 4B3XA 3MCAA 2RC5A 1NJID 3U2QA 2QTLA 2DERA 2VNIA 2QN6A 1SKQA 2XEXA 1KQSB 1ZM9A 1AMOA 1QVGB 4AC9A 4PC1A 2BM1A 4U9UA 3W5HA 1BQEA 4NCNA 4RCYA 3VNVA 3WNCA 2VZLA 4NBSA 1W87A 2PMDA 3E20A 1VQ4B 1M1KD 2BGIA 3CCRB 3QFRA 1YJNB 1B23P 1G7TA 1ZUNB 2QDXA 4RD0A 3FJOA 2DCUA 3VNUA 4BPRA 1A8PA 1DDGA 4LBYA 1TVCA 2VNKA 5TV2A 2EIXA 1JNYA 2OK7A 1VQPB 1ZM2A 4ZCIA 4B4DA 1M90D 5TR9A 3P26A 2YWFA 2VNJA 5H59A 1QFZA 3AGQA 3ZBUA 3WXMA 4FN5A 2BF4A 2B7CA 1R5NA 4QHYA 3WNBA 2EFGA 5THXA 5H5JA 4TMZA 4M4SA 4H9GA 1BX1A 3MHPA 3I56B 1N0UA 1BX0A 4YALA 3AVUA 2BMWA 5GV8A 3OZVA 2QEXB 2QA4B 1KRHA 1R5BA 1F60A 4EH1A 1IJEA 3OZUA 1Q82D 4YHBA 2AHOA 3G4SB 1KTVA 3WYAA 1IB0A 1TTTA 1HA3A 3CCQB 2PIAA 2E1RA 4TMVA 4DQLA 1D8TA 3LVBA 4IW3B 1QVFB 2BN4A 4F7DA 1Q7YD 2RC6A 3ZC3A 1OGIA 1GJRA 4LBVA 3W5UA 3JQPA 1EFTA 3CRZA 3MMPA 1KC8D 5DSZA 1FRNA 2BPOA 1QG0A 4FWTA 1QUFA 3B8HA 3CW2A 4Y9RA 1H42A 5HXBA 4P3YA 4Y7CA 1CNFA 1GO2A 3AVTA 2VNHA 1EWYA 4RD1A 4LBZA 1YITB 1DG1G 4HE5A 1OGJA 4P6VF 3CCLB 4RD3A 4M0LA 2QTZA 4ZCMA 4G1VA 4PC7A 4FK8A 1N8RD 1E63A 1VQ9B 1K9MD 2DEUA 4PC2A 1JA1A 1QGYA 2B5OA 1KJZA 3CMAB 2R6HA 4PC6A 4RJLA 4RD6A 3CD6B 1VQ8B 3P27A 4N3NA 4PGOA 2OTLB 2C78A 4MYUA 1VQ6B 1QGAA 1EP3B 1E62A 3SJZA 3W2IA 1FRQA 1XB2A 1FNMA 2BSAA 2DY1A 5TY0A 4ACAA 3WBJA 1GAQA 1QFYA 4M1KA 4Q7JB 3OJWA 3OJXA 1U2RA 4C43A 4QFMA 3W2EA 1Q86D 2YWHA 1J9ZA 1FNCA 3VMFA 4K1XA 3AVYA 4B44A 1G7SA 4M53A 2X3UA 3CB4A 3I55B 3W2FA 1I7PA 1F20A 1EP1B 1VQKB 1VQ7B 4YAOA 1KK3A 3CC2B 3AVVA 1E64A 3AVWA 3ZZTA 3AGPA 4TN1A 3ES9A 2OTJB 1N0VC 1JA0A 4Y9UA 2VYQA 4RD4A 4YAFA 3V76A 1Q81D 1K8AD 4B48A 1VQNB 4ZCLA 1FDRA 1OB2A 3B82A 1YJWB 3I1FA 3WNDA 5FA6A 4AF7A 3G6EB 2D74A 1ZM3A 1SM4A 4G5GA 3CCMB 1K73D 2J7KA 1YJ9B 1DARA 3OZWA 1EP2B 5EMNA 1GAWA 4ACBA 3CCUB 1EFCA 4TMWA 1KK1A 1W34A 3W2GA 1KK0A 3AVXA 1EXMA 4ZV4A 2BVNA 1BJKA 3U6KA 1QUEA 3OW2B 2FX3A 4PC3A 2HCJB 4WQMA 1VQLB 3QSYA 1TLLA 1D1NA 2GQFA 1DDIA 1WDTA 2YWGA 3JQRA 1KD1D 3CCSB 1YI2B 5GV7A 4B47A 4ZGQB 2OK8A 3CCJB 4LC0A 1G7RA 1ZM4A 2GPJA 1YIJB 1H85A 1S72B 4G1BA 1FNBA 4N3GA 4YAWA 2B7BA 3QFCA 1QX4A 3CC7B 2CRVA 3QFTA 1EFUA 1XE1A 1CQXA 3CMEB 1JB9A 4HE6A 2NPFA 3ZZ0A 2C77A 3CCVB 3FPKA 4ZGNB 2XNJA 3JQQA 1AIPA 4J0QA 4RD2A 2DETA 2ZITA 5KSWB 1G7CA 3CXCB 4TMTA 3LO8A 2BGJA 3E1YE 1JJ2B 1FNDA 3WBKA 5AN9A 1TUIA 1OB5A 1CNEA 4YAUA 1S0UA 1W35A 5JBQA 3VO1A 4R71A 3CPWB 4DQKA 3G71B 3CC4B
chains in the Genus database with same CATH superfamily
4KKTA 1GR1A 4GQNA 2QGGA 2Q6LA 4UAJA 3SLNA 2XZLA 1V0EA 1Y0RA 3ASQA 2BM0A 1D2EA 3VO2A 1VQMB 4B3GA 5HZBA 2VBVA 4LBWA 2DIEA 3ISXA 3PENA 5IYRA 4MYTA 3BCFA 3CCEB 4RCZA 4AF6A 2HMAA 3W2HA 2HDNB 4TMXA 2JJ2A 3U6BA 2QMUA 2X8KA 3J81k 3D26A 3W5VA 4Z4YA 1B2RA 4B43A 2VJIA 1I18A 2BV3A 4UZEA 1QGZA 4Z4WA 2R9VA 4X7FA 2CNDA 1GVHA 1R5OA 1E1QA 1NDHA 3WY9A 2CK3A 3QE2A 1VQ5B 1ELOA 3ZBTA 3BNWA 2C5HA 1H8EA 1UMKA 1PKVA 3B78A 3CP8A 4C0SA 4Z4RA 2XNCA 2JJ1A 4PABA 1Q9SA 1QFJA 3ZZUA 2YWEA 1QH0A 2PLFA 3ASRA 1YHQB 4M2LA 3OPOA 5A89A 3GVLA 4QVAA 1XFOA 4P22A 1IJFA 4Z4ZA 1VQOB 1OB0A 1W2BB 1KK2A 3ASTA 3QFSA 3ASPA 3T56B 4B3XA 5BSXA 4II3A 3MCAA 2RC5A 2GJRA 4DK1A 3U2QA 2QTLA 1NJID 2DERA 2VNIA 4YELA 4WZTA 2OYNA 3PUNA 2QN6A 1SKQA 4B3FX 3FPPA 4RDJA 4XM3A 2XEXA 1KQSB 2GK6A 4OOXA 4P2NA 1ZM9A 1AMOA 2HLDA 1QVGB 2ZZEA 4AC9A 2GK7A 4PC1A 2BM1A 4QVJA 4U9UA 3W5HA 2M5SA 4XQFA 1BQEA 3WQZA 4NCNA 1W9XA 4RCYA 3VNVA 3WNCA 2VZLA 4XKWA 4NBSA 4Z4VA 1W87A 2PMDA 4RDKA 1BLIA 3E20A 1VQ4B 1M1KD 2X6WA 2W6JA 3BH4A 3BY2A 2BGIA 3CCRB 5HKKA 3QFRA 3T53B 1YJNB 2ZXHA 5FIUA 1G7TA 1ZUNB 1B23P 2QDXA 4RD0A 3FJOA 2DCUA 3VNUA 4OOVA 3V7AA 4BPRA 1A8PA 1DDGA 4LBYA 3KL9A 1TVCA 2VNKA 5TV2A 2EIXA 1JNYA 1N07A 2OK7A 3A3GA 1VQPB 1ZM2A 4AVZA 1N08A 5L46A 3PA1A 4ZCIA 4B4DA 1M90D 5TR9A 3P26A 1IHMA 3CESA 2YWFA 2VNJA 1E3XA 5H59A 2ZL7A 1K28D 1QFZA 4XOTA 3AGQA 3OKXA 3ZBUA 2DYIA 4DK0A 4FN5A 3WXMA 2BF4A 2B7CA 1UD4A 1R5NA 4QHYA 4XLEA 3LQ6A 3GIRA 4XONA 3WNBA 4XN3A 1UD2A 1VF7A 3LNNA 2EFGA 5THXA 4WZKA 3A8JA 5H5JA 4TMZA 4M4SA 4H9GA 1BX1A 3MHPA 4XD7A 2V7XA 2CF4A 1BPLA 3RY8A 3I56B 2V7VA 1N0UA 4YXWA 1BX0A 4YALA 2NV4A 5IYWA 5BSYA 3AVUA 4X7EA 2BMWA 5KNLA 5GV8A 3OZVA 2JDIA 2QEXB 4P26A 4XLCA 2QA4B 1KRHA 2WJVA 3Q3AA 1R5BA 1F60A 1PJ6A 3NE5B 2F1LA 4WWVA 4EH1A 4II2A 2ZBVA 1WOSA 3A35A 1IJEA 3OZUA 1Q82D 5TRDA 4YHBA 3Q6QA 5B6IA 2AHOA 2GJPA 2WZNA 3G4SB 3OP1A 2C2WA 1KTVA 1OHHA 3H94A 3WYAA 1YLOA 1IB0A 2F1MA 1TTTA 1HA3A 3CCQB 5IYNA 4DNTB 2PIAA 4P1VA 2E1RA 4TMVA 2X6YA 1WPCA 4DQLA 3ZPNA 1N06A 5J35A 5A8AA 5E6TA 3DDYA 5HZAA 1EFRA 1SKYB 3OE7A 1D8TA 3ONYA 4OPVA 3ASSA 3LVBA 4IW3B 3ONUA 1QVFB 2BN4A 1WORA 1S4MA 4F7DA 2ZZQA 2D3LA 4XORA 1Q7YD 4RM0A 2VBSA 2RC6A 4OPSA 3ZC3A 1OGIA 1GJRA 4LBVA 5IK2A 1E43A 3W5UA 3JQPA 1BMFA 5F4MA 3VR6A 2C4TA 1EFTA 5DN6A 1XQBA 2X85A 3FKSA 3CRZA 3MMPA 1KC8D 4UZFA 5DSZA 4WZEA 1FRNA 2OBSA 1HVXA 1W0JA 2BPOA 2Z6BD 1QG0A 3CP2A 4FWTA 1QUFA 3B8HA 3OOCA 1KZLA 1VLOA 3Q39A 2D3NA 2OBTA 2V7QA 2XOKA 3CW2A 4Y9RA 1H42A 3BY1A 5HXBA 4P3YA 4Y7CA 1CNFA 3T51B 1GO2A 3AVTA 2VNHA 1EWYA 4X05A 4RD1A 4LBZA 3CMMA 4X7DA 1YITB 1UD3A 1DG1G 4HE5A 2WYRA 4Z4UA 4G7WA 4Z4TA 1OGJA 4P6VF 3CCLB 4RD3A 4M0LA 2QTZA 4ZCMA 4KKSA 3LQEA 4WZLA 2F4NA 4G1VA 4PC7A 2ZXIA 1VLYA 4FK8A 1N8RD 1E63A 1VQ9B 1K9MD 2DEUA 4PC2A 1JA1A 1QGYA 1Y0YA 2XNDA 2B5OA 1KJZA 3CMAB 2ZZFA 3GVKA 2R6HA 4PC6A 3Q6RA 4RJLA 1COWA 4L8JA 4RD6A 2ZL6A 1T6ZA 1YX2A 2V31A 1VQ8B 2WJYA 3CD6B 3P27A 4N3NA 4PGOA 4QUZA 2KVOA 4RLZA 1E1RA 2OTLB 4HIZA 3R6KA 1T6XA 2C78A 1I8DA 4MYUA 1VQ6B 1QGAA 1EP3B 1E62A 3SJZA 3W2IA 1FRQA 1XB2A 1FNMA 2BSAA 2DY1A 2WR8A 5TY0A 4ACAA 3WBJA 4CQJA 1UD6A 5FNZA 1HZEA 1GAQA 2E1BA 1T6YA 2ZBUA 1QFYA 3A8KA 2P3MA 4M1KA 5F4OA 1WOOA 4Q7JB 3OJWA 3OFNA 3OJXA 1U2RA 3OEEA 4G7XA 3SKBA 3Q38A 3SLDA 4C43A 4QFMA 1WP6A 3W2EA 1N05A 1Q86D 2YWHA 4TSFA 1J9ZA 1FNCA 2V7TA 5J3OA 3VMFA 4K1XA 3AVYA 4B44A 1G7SA 4M53A 2Q6KA 2ZL5A 2X3UA 1WSRA 3H9NA 2VJJA 3CB4A 3I55B 3W2FA 1I7PA 2XZOA 2PE3A 3OAAA 1F20A 1MRZA 1EP1B 1VQKB 1VQ7B 4YAOA 1E79A 1KK3A 2CW5A 3CC2B 3AVVA 1WSVA 1E64A 2OBRA 3AVWA 3ZZTA 4RDLA 2VBUA 3AGPA 4TN1A 3ES9A 2OTJB 3A3BA 1V5VA 4ROXA 1N0VC 1JA0A 3GSIA 2FVGA 2ZTNA 5FO0A 4Y9UA 4YEJA 2VYQA 4RD4A 4XOPA 4YAFA 3V76A 1Q81D 1K8AD 4B48A 3HAGA 1VQNB 4UZUA 2DOGA 4XMYA 1T5EA 1RQPA 3BC9A 3PUMA 4ZCLA 2ZTGA 1NB9A 2D9RA 1FDRA 2WSSA 1OB2A 1V0FA 3B82A 3OW7A 1E3ZA 4X06A 3SEJA 1YJWB 4XLHA 4P12A 3I1FA 2LZJA 3WNDA 5FA6A 2V4DA 4AF7A 4OOSA 1NRKA 3G6EB 1KMHA 3GVJA 2D74A 5CDFA 1ZM3A 2X53S 1SM4A 4G5GA 4P9SA 1WTHD 3A8IA 3OEHA 3CCMB 1MABA 1K73D 1UD8A 2J7KA 4JMQA 1YJ9B 1DARA 5LMZA 2VBTA 3OZWA 1EP2B 5EMNA 1GAWA 2CC2A 4ACBA 3CCUB 1P4MA 1EFCA 4TMWA 4XLFA 1KK1A 1W34A 3W2GA 1KK0A 3AVXA 5DS0A 1PJ5A 5FL7A 1EXMA 4ZV4A 2BVNA 1BJKA 3CTAA 5IYQA 3U6KA 2JN9A 3BCDA 1QUEA 4Z4SA 3OW2B 2FX3A 4PC3A 2X6XA 2HCJB 3JU4A 2WZPP 2CBXA 4WQMA 4Z1MA 1VQLB 3QSYA 1TLLA 2JIZA 4XLAA 4OPOA 1VJSA 4X7CA 4RPDA 1D1NA 4RPBA 2GQFA 1DDIA 1UD5A 1WDTA 2YWGA 3JQRA 1KD1D 3CCSB 1YI2B 3PA2A 4X0CA 1PJ7A 5GV7A 2QE7A 2W6IA 1W0KA 1NB0A 2X0KA 1VHOA 4B47A 4ASUA 5A88A 4ZGQB 2OK8A 4XR6A 3CCJB 4LC0A 2XGJA 4P25A 1G7RA 1ZM4A 3BQJA 2GPJA 1YIJB 1H85A 2I1LA 1H8HA 3PVDA 4P3IA 1S72B 4G1BA 1RQRA 1FNBA 3KEWA 4N3GA 4YAWA 2B7BA 3QFCA 1QX4A 4FXUA 4KKUA 4XKVA 2V7UA 2CRVA 5KW9A 3CC7B 3QFTA 4DNRB 1EFUA 1XE1A 2F43A 1CQXA 3CMEB 4X07A 1JB9A 1VHEA 2V7WA 4TT3A 4HE6A 5F4JA 2NPFA 3ZZ0A 2C77A 3CCVB 4TKOB 4OP7A 4XL9A 3FPKA 4XN0A 4ZGNB 2XNJA 2ZZGA 4X8IA 3JQQA 3SJPA 2C5BA 2Q6OA 1AIPA 4J0QA 4RD2A 2DETA 2GJKA 2ZITA 3ZUGA 5KSWB 1NBMA 2XZPA 1G7CA 1WOPA 4G6IA 3CXCB 4TMTA 4E0FA 3LO8A 2BGJA 4PAAA 5IYPA 3E1YE 1JJ2B 1FX0A 1FNDA 3WBKA 4NNJA 2WPDA 5AN9A 3G05A 1TUIA 1OB5A 4P6YA 1CNEA 4YAUA 3R6JA 2GREA 4XNFA 1S0UA 1WU8A 5FO1A 1W35A 4QV2A 3VO1A 2C4UA 4R71A 5JBQA 3CPWB 2Q6IA 3CPXA 3A1PA 4DQKA 3ZIAA 3G71B 3GQBA 3CC4B
chains in the Genus database with same CATH topology
1GR1A 4UAJA 2BM0A 1D2EA 3VO2A 1VQMB 4LBWA 3PENA 4MYTA 3CCEB 4RCZA 4AF6A 2HMAA 3W2HA 2HDNB 4TMXA 3U6BA 2QMUA 3J81k 3W5VA 1B2RA 4B43A 2BV3A 1QGZA 2CNDA 1GVHA 1R5OA 1NDHA 3WY9A 3QE2A 1VQ5B 1ELOA 3ZBTA 1UMKA 3B78A 4C0SA 2XNCA 3ZZUA 1QFJA 2YWEA 1QH0A 2PLFA 1YHQB 4M2LA 1IJFA 1VQOB 1W2BB 1KK2A 3QFSA 4B3XA 3MCAA 2RC5A 1NJID 3U2QA 2QTLA 2DERA 2VNIA 2QN6A 1SKQA 2XEXA 1KQSB 1ZM9A 1AMOA 1QVGB 4AC9A 4PC1A 2BM1A 4U9UA 3W5HA 1BQEA 4NCNA 4RCYA 3VNVA 3WNCA 2VZLA 4NBSA 1W87A 2PMDA 3E20A 1VQ4B 1M1KD 2BGIA 3CCRB 3QFRA 1YJNB 1B23P 1G7TA 1ZUNB 2QDXA 4RD0A 3FJOA 2DCUA 3VNUA 4BPRA 1A8PA 1DDGA 4LBYA 1TVCA 2VNKA 5TV2A 2EIXA 1JNYA 2OK7A 1VQPB 1ZM2A 4ZCIA 4B4DA 1M90D 5TR9A 3P26A 2YWFA 2VNJA 5H59A 1QFZA 3AGQA 3ZBUA 3WXMA 4FN5A 2BF4A 2B7CA 1R5NA 4QHYA 3WNBA 2EFGA 5THXA 5H5JA 4TMZA 4M4SA 4H9GA 1BX1A 3MHPA 3I56B 1N0UA 1BX0A 4YALA 3AVUA 2BMWA 5GV8A 3OZVA 2QEXB 2QA4B 1KRHA 1R5BA 1F60A 4EH1A 1IJEA 3OZUA 1Q82D 4YHBA 2AHOA 3G4SB 1KTVA 3WYAA 1IB0A 1TTTA 1HA3A 3CCQB 2PIAA 2E1RA 4TMVA 4DQLA 1D8TA 3LVBA 4IW3B 1QVFB 2BN4A 4F7DA 1Q7YD 2RC6A 3ZC3A 1OGIA 1GJRA 4LBVA 3W5UA 3JQPA 1EFTA 3CRZA 3MMPA 1KC8D 5DSZA 1FRNA 2BPOA 1QG0A 4FWTA 1QUFA 3B8HA 3CW2A 4Y9RA 1H42A 5HXBA 4P3YA 4Y7CA 1CNFA 1GO2A 3AVTA 2VNHA 1EWYA 4RD1A 4LBZA 1YITB 1DG1G 4HE5A 1OGJA 4P6VF 3CCLB 4RD3A 4M0LA 2QTZA 4ZCMA 4G1VA 4PC7A 4FK8A 1N8RD 1E63A 1VQ9B 1K9MD 2DEUA 4PC2A 1JA1A 1QGYA 2B5OA 1KJZA 3CMAB 2R6HA 4PC6A 4RJLA 4RD6A 3CD6B 1VQ8B 3P27A 4N3NA 4PGOA 2OTLB 2C78A 4MYUA 1VQ6B 1QGAA 1EP3B 1E62A 3SJZA 3W2IA 1FRQA 1XB2A 1FNMA 2BSAA 2DY1A 5TY0A 4ACAA 3WBJA 1GAQA 1QFYA 4M1KA 4Q7JB 3OJWA 3OJXA 1U2RA 4C43A 4QFMA 3W2EA 1Q86D 2YWHA 1J9ZA 1FNCA 3VMFA 4K1XA 3AVYA 4B44A 1G7SA 4M53A 2X3UA 3CB4A 3I55B 3W2FA 1I7PA 1F20A 1EP1B 1VQKB 1VQ7B 4YAOA 1KK3A 3CC2B 3AVVA 1E64A 3AVWA 3ZZTA 3AGPA 4TN1A 3ES9A 2OTJB 1N0VC 1JA0A 4Y9UA 2VYQA 4RD4A 4YAFA 3V76A 1Q81D 1K8AD 4B48A 1VQNB 4ZCLA 1FDRA 1OB2A 3B82A 1YJWB 3I1FA 3WNDA 5FA6A 4AF7A 3G6EB 2D74A 1ZM3A 1SM4A 4G5GA 3CCMB 1K73D 2J7KA 1YJ9B 1DARA 3OZWA 1EP2B 5EMNA 1GAWA 4ACBA 3CCUB 1EFCA 4TMWA 1KK1A 1W34A 3W2GA 1KK0A 3AVXA 1EXMA 4ZV4A 2BVNA 1BJKA 3U6KA 1QUEA 3OW2B 2FX3A 4PC3A 2HCJB 4WQMA 1VQLB 3QSYA 1TLLA 1D1NA 2GQFA 1DDIA 1WDTA 2YWGA 3JQRA 1KD1D 3CCSB 1YI2B 5GV7A 4B47A 4ZGQB 2OK8A 3CCJB 4LC0A 1G7RA 1ZM4A 2GPJA 1YIJB 1H85A 1S72B 4G1BA 1FNBA 4N3GA 4YAWA 2B7BA 3QFCA 1QX4A 3CC7B 2CRVA 3QFTA 1EFUA 1XE1A 1CQXA 3CMEB 1JB9A 4HE6A 2NPFA 3ZZ0A 2C77A 3CCVB 3FPKA 4ZGNB 2XNJA 3JQQA 1AIPA 4J0QA 4RD2A 2DETA 2ZITA 5KSWB 1G7CA 3CXCB 4TMTA 3LO8A 2BGJA 3E1YE 1JJ2B 1FNDA 3WBKA 5AN9A 1TUIA 1OB5A 1CNEA 4YAUA 1S0UA 1W35A 5JBQA 3VO1A 4R71A 3CPWB 4DQKA 3G71B 3CC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GR1 A;  4UAJ A;  2BM0 A;  1D2E A;  3VO2 A;  1VQM B;  4LBW A;  3PEN A;  4MYT A;  3CCE B;  4RCZ A;  4AF6 A;  2HMA A;  3W2H A;  2HDN B;  4TMX A;  3U6B A;  2QMU A;  3J81 k;  3W5V A;  1B2R A;  4B43 A;  2BV3 A;  1QGZ A;  2CND A;  1GVH A;  1R5O A;  1NDH A;  3WY9 A;  3QE2 A;  1VQ5 B;  1ELO A;  3ZBT A;  1UMK A;  3B78 A;  4C0S A;  2XNC A;  3ZZU A;  1QFJ A;  2YWE A;  1QH0 A;  2PLF A;  1YHQ B;  4M2L A;  1IJF A;  1VQO B;  1W2B B;  1KK2 A;  3QFS A;  4B3X A;  3MCA A;  2RC5 A;  1NJI D;  3U2Q A;  2QTL A;  2DER A;  2VNI A;  2QN6 A;  1SKQ A;  2XEX A;  1KQS B;  1ZM9 A;  1AMO A;  1QVG B;  4AC9 A;  4PC1 A;  2BM1 A;  4U9U A;  3W5H A;  1BQE A;  4NCN A;  4RCY A;  3VNV A;  3WNC A;  2VZL A;  4NBS A;  1W87 A;  2PMD A;  3E20 A;  1VQ4 B;  1M1K D;  2BGI A;  3CCR B;  3QFR A;  1YJN B;  1B23 P;  1G7T A;  1ZUN B;  2QDX A;  4RD0 A;  3FJO A;  2DCU A;  3VNU A;  4BPR A;  1A8P A;  1DDG A;  4LBY A;  1TVC A;  2VNK A;  5TV2 A;  2EIX A;  1JNY A;  2OK7 A;  1VQP B;  1ZM2 A;  4ZCI A;  4B4D A;  1M90 D;  5TR9 A;  3P26 A;  2YWF A;  2VNJ A;  5H59 A;  1QFZ A;  3AGQ A;  3ZBU A;  3WXM A;  4FN5 A;  2BF4 A;  2B7C A;  1R5N A;  4QHY A;  3WNB A;  2EFG A;  5THX A;  5H5J A;  4TMZ A;  4M4S A;  4H9G A;  1BX1 A;  3MHP A;  3I56 B;  1N0U A;  1BX0 A;  4YAL A;  3AVU A;  2BMW A;  5GV8 A;  3OZV A;  2QEX B;  2QA4 B;  1KRH A;  1R5B A;  1F60 A;  4EH1 A;  1IJE A;  3OZU A;  1Q82 D;  4YHB A;  2AHO A;  3G4S B;  1KTV A;  3WYA A;  1IB0 A;  1TTT A;  1HA3 A;  3CCQ B;  2PIA A;  2E1R A;  4TMV A;  4DQL A;  1D8T A;  3LVB A;  4IW3 B;  1QVF B;  2BN4 A;  4F7D A;  1Q7Y D;  2RC6 A;  3ZC3 A;  1OGI A;  1GJR A;  4LBV A;  3W5U A;  3JQP A;  1EFT A;  3CRZ A;  3MMP A;  1KC8 D;  5DSZ A;  1FRN A;  2BPO A;  1QG0 A;  4FWT A;  1QUF A;  3B8H A;  3CW2 A;  4Y9R A;  1H42 A;  5HXB A;  4P3Y A;  4Y7C A;  1CNF A;  1GO2 A;  3AVT A;  2VNH A;  1EWY A;  4RD1 A;  4LBZ A;  1YIT B;  1DG1 G;  4HE5 A;  1OGJ A;  4P6V F;  3CCL B;  4RD3 A;  4M0L A;  2QTZ A;  4ZCM A;  4G1V A;  4PC7 A;  4FK8 A;  1N8R D;  1E63 A;  1VQ9 B;  1K9M D;  2DEU A;  4PC2 A;  1JA1 A;  1QGY A;  2B5O A;  1KJZ A;  3CMA B;  2R6H A;  4PC6 A;  4RJL A;  4RD6 A;  3CD6 B;  1VQ8 B;  3P27 A;  4N3N A;  4PGO A;  2OTL B;  2C78 A;  4MYU A;  1VQ6 B;  1QGA A;  1EP3 B;  1E62 A;  3SJZ A;  3W2I A;  1FRQ A;  1XB2 A;  1FNM A;  2BSA A;  2DY1 A;  5TY0 A;  4ACA A;  3WBJ A;  1GAQ A;  1QFY A;  4M1K A;  4Q7J B;  3OJW A;  3OJX A;  1U2R A;  4C43 A;  4QFM A;  3W2E A;  1Q86 D;  2YWH A;  1J9Z A;  1FNC A;  3VMF A;  4K1X A;  3AVY A;  4B44 A;  1G7S A;  4M53 A;  2X3U A;  3CB4 A;  3I55 B;  3W2F A;  1I7P A;  1F20 A;  1EP1 B;  1VQK B;  1VQ7 B;  4YAO A;  1KK3 A;  3CC2 B;  3AVV A;  1E64 A;  3AVW A;  3ZZT A;  3AGP A;  4TN1 A;  3ES9 A;  2OTJ B;  1N0V C;  1JA0 A;  4Y9U A;  2VYQ A;  4RD4 A;  4YAF A;  3V76 A;  1Q81 D;  1K8A D;  4B48 A;  1VQN B;  4ZCL A;  1FDR A;  1OB2 A;  3B82 A;  1YJW B;  3I1F A;  3WND A;  5FA6 A;  4AF7 A;  3G6E B;  2D74 A;  1ZM3 A;  1SM4 A;  4G5G A;  3CCM B;  1K73 D;  2J7K A;  1YJ9 B;  1DAR A;  3OZW A;  1EP2 B;  5EMN A;  1GAW A;  4ACB A;  3CCU B;  1EFC A;  4TMW A;  1KK1 A;  1W34 A;  3W2G A;  1KK0 A;  3AVX A;  1EXM A;  4ZV4 A;  2BVN A;  1BJK A;  3U6K A;  1QUE A;  3OW2 B;  2FX3 A;  4PC3 A;  2HCJ B;  4WQM A;  1VQL B;  3QSY A;  1TLL A;  1D1N A;  2GQF A;  1DDI A;  1WDT A;  2YWG A;  3JQR A;  1KD1 D;  3CCS B;  1YI2 B;  5GV7 A;  4B47 A;  4ZGQ B;  2OK8 A;  3CCJ B;  4LC0 A;  1G7R A;  1ZM4 A;  2GPJ A;  1YIJ B;  1H85 A;  1S72 B;  4G1B A;  1FNB A;  4N3G A;  4YAW A;  2B7B A;  3QFC A;  1QX4 A;  3CC7 B;  2CRV A;  3QFT A;  1EFU A;  1XE1 A;  1CQX A;  3CME B;  1JB9 A;  4HE6 A;  2NPF A;  3ZZ0 A;  2C77 A;  3CCV B;  3FPK A;  4ZGN B;  2XNJ A;  3JQQ A;  1AIP A;  4J0Q A;  4RD2 A;  2DET A;  2ZIT A;  5KSW B;  1G7C A;  3CXC B;  4TMT A;  3LO8 A;  2BGJ A;  3E1Y E;  1JJ2 B;  1FND A;  3WBK A;  5AN9 A;  1TUI A;  1OB5 A;  1CNE A;  4YAU A;  1S0U A;  1W35 A;  5JBQ A;  3VO1 A;  4R71 A;  3CPW B;  4DQK A;  3G71 B;  3CC4 B; 
#chains in the Genus database with same CATH topology
 4KKT A;  1GR1 A;  4GQN A;  2QGG A;  2Q6L A;  4UAJ A;  3SLN A;  2XZL A;  1V0E A;  1Y0R A;  3ASQ A;  2BM0 A;  1D2E A;  3VO2 A;  1VQM B;  4B3G A;  5HZB A;  2VBV A;  4LBW A;  2DIE A;  3ISX A;  3PEN A;  5IYR A;  4MYT A;  3BCF A;  3CCE B;  4RCZ A;  4AF6 A;  2HMA A;  3W2H A;  2HDN B;  4TMX A;  2JJ2 A;  3U6B A;  2QMU A;  2X8K A;  3J81 k;  3D26 A;  3W5V A;  4Z4Y A;  1B2R A;  4B43 A;  2VJI A;  1I18 A;  2BV3 A;  4UZE A;  1QGZ A;  4Z4W A;  2R9V A;  4X7F A;  2CND A;  1GVH A;  1R5O A;  1E1Q A;  1NDH A;  3WY9 A;  2CK3 A;  3QE2 A;  1VQ5 B;  1ELO A;  3ZBT A;  3BNW A;  2C5H A;  1H8E A;  1UMK A;  1PKV A;  3B78 A;  3CP8 A;  4C0S A;  4Z4R A;  2XNC A;  2JJ1 A;  4PAB A;  1Q9S A;  1QFJ A;  3ZZU A;  2YWE A;  1QH0 A;  2PLF A;  3ASR A;  1YHQ B;  4M2L A;  3OPO A;  5A89 A;  3GVL A;  4QVA A;  1XFO A;  4P22 A;  1IJF A;  4Z4Z A;  1VQO B;  1OB0 A;  1W2B B;  1KK2 A;  3AST A;  3QFS A;  3ASP A;  3T56 B;  4B3X A;  5BSX A;  4II3 A;  3MCA A;  2RC5 A;  2GJR A;  4DK1 A;  3U2Q A;  2QTL A;  1NJI D;  2DER A;  2VNI A;  4YEL A;  4WZT A;  2OYN A;  3PUN A;  2QN6 A;  1SKQ A;  4B3F X;  3FPP A;  4RDJ A;  4XM3 A;  2XEX A;  1KQS B;  2GK6 A;  4OOX A;  4P2N A;  1ZM9 A;  1AMO A;  2HLD A;  1QVG B;  2ZZE A;  4AC9 A;  2GK7 A;  4PC1 A;  2BM1 A;  4QVJ A;  4U9U A;  3W5H A;  2M5S A;  4XQF A;  1BQE A;  3WQZ A;  4NCN A;  1W9X A;  4RCY A;  3VNV A;  3WNC A;  2VZL A;  4XKW A;  4NBS A;  4Z4V A;  1W87 A;  2PMD A;  4RDK A;  1BLI A;  3E20 A;  1VQ4 B;  1M1K D;  2X6W A;  2W6J A;  3BH4 A;  3BY2 A;  2BGI A;  3CCR B;  5HKK A;  3QFR A;  3T53 B;  1YJN B;  2ZXH A;  5FIU A;  1G7T A;  1ZUN B;  1B23 P;  2QDX A;  4RD0 A;  3FJO A;  2DCU A;  3VNU A;  4OOV A;  3V7A A;  4BPR A;  1A8P A;  1DDG A;  4LBY A;  3KL9 A;  1TVC A;  2VNK A;  5TV2 A;  2EIX A;  1JNY A;  1N07 A;  2OK7 A;  3A3G A;  1VQP B;  1ZM2 A;  4AVZ A;  1N08 A;  5L46 A;  3PA1 A;  4ZCI A;  4B4D A;  1M90 D;  5TR9 A;  3P26 A;  1IHM A;  3CES A;  2YWF A;  2VNJ A;  1E3X A;  5H59 A;  2ZL7 A;  1K28 D;  1QFZ A;  4XOT A;  3AGQ A;  3OKX A;  3ZBU A;  2DYI A;  4DK0 A;  4FN5 A;  3WXM A;  2BF4 A;  2B7C A;  1UD4 A;  1R5N A;  4QHY A;  4XLE A;  3LQ6 A;  3GIR A;  4XON A;  3WNB A;  4XN3 A;  1UD2 A;  1VF7 A;  3LNN A;  2EFG A;  5THX A;  4WZK A;  3A8J A;  5H5J A;  4TMZ A;  4M4S A;  4H9G A;  1BX1 A;  3MHP A;  4XD7 A;  2V7X A;  2CF4 A;  1BPL A;  3RY8 A;  3I56 B;  2V7V A;  1N0U A;  4YXW A;  1BX0 A;  4YAL A;  2NV4 A;  5IYW A;  5BSY A;  3AVU A;  4X7E A;  2BMW A;  5KNL A;  5GV8 A;  3OZV A;  2JDI A;  2QEX B;  4P26 A;  4XLC A;  2QA4 B;  1KRH A;  2WJV A;  3Q3A A;  1R5B A;  1F60 A;  1PJ6 A;  3NE5 B;  2F1L A;  4WWV A;  4EH1 A;  4II2 A;  2ZBV A;  1WOS A;  3A35 A;  1IJE A;  3OZU A;  1Q82 D;  5TRD A;  4YHB A;  3Q6Q A;  5B6I A;  2AHO A;  2GJP A;  2WZN A;  3G4S B;  3OP1 A;  2C2W A;  1KTV A;  1OHH A;  3H94 A;  3WYA A;  1YLO A;  1IB0 A;  2F1M A;  1TTT A;  1HA3 A;  3CCQ B;  5IYN A;  4DNT B;  2PIA A;  4P1V A;  2E1R A;  4TMV A;  2X6Y A;  1WPC A;  4DQL A;  3ZPN A;  1N06 A;  5J35 A;  5A8A A;  5E6T A;  3DDY A;  5HZA A;  1EFR A;  1SKY B;  3OE7 A;  1D8T A;  3ONY A;  4OPV A;  3ASS A;  3LVB A;  4IW3 B;  3ONU A;  1QVF B;  2BN4 A;  1WOR A;  1S4M A;  4F7D A;  2ZZQ A;  2D3L A;  4XOR A;  1Q7Y D;  4RM0 A;  2VBS A;  2RC6 A;  4OPS A;  3ZC3 A;  1OGI A;  1GJR A;  4LBV A;  5IK2 A;  1E43 A;  3W5U A;  3JQP A;  1BMF A;  5F4M A;  3VR6 A;  2C4T A;  1EFT A;  5DN6 A;  1XQB A;  2X85 A;  3FKS A;  3CRZ A;  3MMP A;  1KC8 D;  4UZF A;  5DSZ A;  4WZE A;  1FRN A;  2OBS A;  1HVX A;  1W0J A;  2BPO A;  2Z6B D;  1QG0 A;  3CP2 A;  4FWT A;  1QUF A;  3B8H A;  3OOC A;  1KZL A;  1VLO A;  3Q39 A;  2D3N A;  2OBT A;  2V7Q A;  2XOK A;  3CW2 A;  4Y9R A;  1H42 A;  3BY1 A;  5HXB A;  4P3Y A;  4Y7C A;  1CNF A;  3T51 B;  1GO2 A;  3AVT A;  2VNH A;  1EWY A;  4X05 A;  4RD1 A;  4LBZ A;  3CMM A;  4X7D A;  1YIT B;  1UD3 A;  1DG1 G;  4HE5 A;  2WYR A;  4Z4U A;  4G7W A;  4Z4T A;  1OGJ A;  4P6V F;  3CCL B;  4RD3 A;  4M0L A;  2QTZ A;  4ZCM A;  4KKS A;  3LQE A;  4WZL A;  2F4N A;  4G1V A;  4PC7 A;  2ZXI A;  1VLY A;  4FK8 A;  1N8R D;  1E63 A;  1VQ9 B;  1K9M D;  2DEU A;  4PC2 A;  1JA1 A;  1QGY A;  1Y0Y A;  2XND A;  2B5O A;  1KJZ A;  3CMA B;  2ZZF A;  3GVK A;  2R6H A;  4PC6 A;  3Q6R A;  4RJL A;  1COW A;  4L8J A;  4RD6 A;  2ZL6 A;  1T6Z A;  1YX2 A;  2V31 A;  1VQ8 B;  2WJY A;  3CD6 B;  3P27 A;  4N3N A;  4PGO A;  4QUZ A;  2KVO A;  4RLZ A;  1E1R A;  2OTL B;  4HIZ A;  3R6K A;  1T6X A;  2C78 A;  1I8D A;  4MYU A;  1VQ6 B;  1QGA A;  1EP3 B;  1E62 A;  3SJZ A;  3W2I A;  1FRQ A;  1XB2 A;  1FNM A;  2BSA A;  2DY1 A;  2WR8 A;  5TY0 A;  4ACA A;  3WBJ A;  4CQJ A;  1UD6 A;  5FNZ A;  1HZE A;  1GAQ A;  2E1B A;  1T6Y A;  2ZBU A;  1QFY A;  3A8K A;  2P3M A;  4M1K A;  5F4O A;  1WOO A;  4Q7J B;  3OJW A;  3OFN A;  3OJX A;  1U2R A;  3OEE A;  4G7X A;  3SKB A;  3Q38 A;  3SLD A;  4C43 A;  4QFM A;  1WP6 A;  3W2E A;  1N05 A;  1Q86 D;  2YWH A;  4TSF A;  1J9Z A;  1FNC A;  2V7T A;  5J3O A;  3VMF A;  4K1X A;  3AVY A;  4B44 A;  1G7S A;  4M53 A;  2Q6K A;  2ZL5 A;  2X3U A;  1WSR A;  3H9N A;  2VJJ A;  3CB4 A;  3I55 B;  3W2F A;  1I7P A;  2XZO A;  2PE3 A;  3OAA A;  1F20 A;  1MRZ A;  1EP1 B;  1VQK B;  1VQ7 B;  4YAO A;  1E79 A;  1KK3 A;  2CW5 A;  3CC2 B;  3AVV A;  1WSV A;  1E64 A;  2OBR A;  3AVW A;  3ZZT A;  4RDL A;  2VBU A;  3AGP A;  4TN1 A;  3ES9 A;  2OTJ B;  3A3B A;  1V5V A;  4ROX A;  1N0V C;  1JA0 A;  3GSI A;  2FVG A;  2ZTN A;  5FO0 A;  4Y9U A;  4YEJ A;  2VYQ A;  4RD4 A;  4XOP A;  4YAF A;  3V76 A;  1Q81 D;  1K8A D;  4B48 A;  3HAG A;  1VQN B;  4UZU A;  2DOG A;  4XMY A;  1T5E A;  1RQP A;  3BC9 A;  3PUM A;  4ZCL A;  2ZTG A;  1NB9 A;  2D9R A;  1FDR A;  2WSS A;  1OB2 A;  1V0F A;  3B82 A;  3OW7 A;  1E3Z A;  4X06 A;  3SEJ A;  1YJW B;  4XLH A;  4P12 A;  3I1F A;  2LZJ A;  3WND A;  5FA6 A;  2V4D A;  4AF7 A;  4OOS A;  1NRK A;  3G6E B;  1KMH A;  3GVJ A;  2D74 A;  5CDF A;  1ZM3 A;  2X53 S;  1SM4 A;  4G5G A;  4P9S A;  1WTH D;  3A8I A;  3OEH A;  3CCM B;  1MAB A;  1K73 D;  1UD8 A;  2J7K A;  4JMQ A;  1YJ9 B;  1DAR A;  5LMZ A;  2VBT A;  3OZW A;  1EP2 B;  5EMN A;  1GAW A;  2CC2 A;  4ACB A;  3CCU B;  1P4M A;  1EFC A;  4TMW A;  4XLF A;  1KK1 A;  1W34 A;  3W2G A;  1KK0 A;  3AVX A;  5DS0 A;  1PJ5 A;  5FL7 A;  1EXM A;  4ZV4 A;  2BVN A;  1BJK A;  3CTA A;  5IYQ A;  3U6K A;  2JN9 A;  3BCD A;  1QUE A;  4Z4S A;  3OW2 B;  2FX3 A;  4PC3 A;  2X6X A;  2HCJ B;  3JU4 A;  2WZP P;  2CBX A;  4WQM A;  4Z1M A;  1VQL B;  3QSY A;  1TLL A;  2JIZ A;  4XLA A;  4OPO A;  1VJS A;  4X7C A;  4RPD A;  1D1N A;  4RPB A;  2GQF A;  1DDI A;  1UD5 A;  1WDT A;  2YWG A;  3JQR A;  1KD1 D;  3CCS B;  1YI2 B;  3PA2 A;  4X0C A;  1PJ7 A;  5GV7 A;  2QE7 A;  2W6I A;  1W0K A;  1NB0 A;  2X0K A;  1VHO A;  4B47 A;  4ASU A;  5A88 A;  4ZGQ B;  2OK8 A;  4XR6 A;  3CCJ B;  4LC0 A;  2XGJ A;  4P25 A;  1G7R A;  1ZM4 A;  3BQJ A;  2GPJ A;  1YIJ B;  1H85 A;  2I1L A;  1H8H A;  3PVD A;  4P3I A;  1S72 B;  4G1B A;  1RQR A;  1FNB A;  3KEW A;  4N3G A;  4YAW A;  2B7B A;  3QFC A;  1QX4 A;  4FXU A;  4KKU A;  4XKV A;  2V7U A;  2CRV A;  5KW9 A;  3CC7 B;  3QFT A;  4DNR B;  1EFU A;  1XE1 A;  2F43 A;  1CQX A;  3CME B;  4X07 A;  1JB9 A;  1VHE A;  2V7W A;  4TT3 A;  4HE6 A;  5F4J A;  2NPF A;  3ZZ0 A;  2C77 A;  3CCV B;  4TKO B;  4OP7 A;  4XL9 A;  3FPK A;  4XN0 A;  4ZGN B;  2XNJ A;  2ZZG A;  4X8I A;  3JQQ A;  3SJP A;  2C5B A;  2Q6O A;  1AIP A;  4J0Q A;  4RD2 A;  2DET A;  2GJK A;  2ZIT A;  3ZUG A;  5KSW B;  1NBM A;  2XZP A;  1G7C A;  1WOP A;  4G6I A;  3CXC B;  4TMT A;  4E0F A;  3LO8 A;  2BGJ A;  4PAA A;  5IYP A;  3E1Y E;  1JJ2 B;  1FX0 A;  1FND A;  3WBK A;  4NNJ A;  2WPD A;  5AN9 A;  3G05 A;  1TUI A;  1OB5 A;  4P6Y A;  1CNE A;  4YAU A;  3R6J A;  2GRE A;  4XNF A;  1S0U A;  1WU8 A;  5FO1 A;  1W35 A;  4QV2 A;  3VO1 A;  2C4U A;  4R71 A;  5JBQ A;  3CPW B;  2Q6I A;  3CPX A;  3A1P A;  4DQK A;  3ZIA A;  3G71 B;  3GQB A;  3CC4 B; 
#chains in the Genus database with same CATH homology
 1GR1 A;  4UAJ A;  2BM0 A;  1D2E A;  3VO2 A;  1VQM B;  4LBW A;  3PEN A;  4MYT A;  3CCE B;  4RCZ A;  4AF6 A;  2HMA A;  3W2H A;  2HDN B;  4TMX A;  3U6B A;  2QMU A;  3J81 k;  3W5V A;  1B2R A;  4B43 A;  2BV3 A;  1QGZ A;  2CND A;  1GVH A;  1R5O A;  1NDH A;  3WY9 A;  3QE2 A;  1VQ5 B;  1ELO A;  3ZBT A;  1UMK A;  3B78 A;  4C0S A;  2XNC A;  3ZZU A;  1QFJ A;  2YWE A;  1QH0 A;  2PLF A;  1YHQ B;  4M2L A;  1IJF A;  1VQO B;  1W2B B;  1KK2 A;  3QFS A;  4B3X A;  3MCA A;  2RC5 A;  1NJI D;  3U2Q A;  2QTL A;  2DER A;  2VNI A;  2QN6 A;  1SKQ A;  2XEX A;  1KQS B;  1ZM9 A;  1AMO A;  1QVG B;  4AC9 A;  4PC1 A;  2BM1 A;  4U9U A;  3W5H A;  1BQE A;  4NCN A;  4RCY A;  3VNV A;  3WNC A;  2VZL A;  4NBS A;  1W87 A;  2PMD A;  3E20 A;  1VQ4 B;  1M1K D;  2BGI A;  3CCR B;  3QFR A;  1YJN B;  1B23 P;  1G7T A;  1ZUN B;  2QDX A;  4RD0 A;  3FJO A;  2DCU A;  3VNU A;  4BPR A;  1A8P A;  1DDG A;  4LBY A;  1TVC A;  2VNK A;  5TV2 A;  2EIX A;  1JNY A;  2OK7 A;  1VQP B;  1ZM2 A;  4ZCI A;  4B4D A;  1M90 D;  5TR9 A;  3P26 A;  2YWF A;  2VNJ A;  5H59 A;  1QFZ A;  3AGQ A;  3ZBU A;  3WXM A;  4FN5 A;  2BF4 A;  2B7C A;  1R5N A;  4QHY A;  3WNB A;  2EFG A;  5THX A;  5H5J A;  4TMZ A;  4M4S A;  4H9G A;  1BX1 A;  3MHP A;  3I56 B;  1N0U A;  1BX0 A;  4YAL A;  3AVU A;  2BMW A;  5GV8 A;  3OZV A;  2QEX B;  2QA4 B;  1KRH A;  1R5B A;  1F60 A;  4EH1 A;  1IJE A;  3OZU A;  1Q82 D;  4YHB A;  2AHO A;  3G4S B;  1KTV A;  3WYA A;  1IB0 A;  1TTT A;  1HA3 A;  3CCQ B;  2PIA A;  2E1R A;  4TMV A;  4DQL A;  1D8T A;  3LVB A;  4IW3 B;  1QVF B;  2BN4 A;  4F7D A;  1Q7Y D;  2RC6 A;  3ZC3 A;  1OGI A;  1GJR A;  4LBV A;  3W5U A;  3JQP A;  1EFT A;  3CRZ A;  3MMP A;  1KC8 D;  5DSZ A;  1FRN A;  2BPO A;  1QG0 A;  4FWT A;  1QUF A;  3B8H A;  3CW2 A;  4Y9R A;  1H42 A;  5HXB A;  4P3Y A;  4Y7C A;  1CNF A;  1GO2 A;  3AVT A;  2VNH A;  1EWY A;  4RD1 A;  4LBZ A;  1YIT B;  1DG1 G;  4HE5 A;  1OGJ A;  4P6V F;  3CCL B;  4RD3 A;  4M0L A;  2QTZ A;  4ZCM A;  4G1V A;  4PC7 A;  4FK8 A;  1N8R D;  1E63 A;  1VQ9 B;  1K9M D;  2DEU A;  4PC2 A;  1JA1 A;  1QGY A;  2B5O A;  1KJZ A;  3CMA B;  2R6H A;  4PC6 A;  4RJL A;  4RD6 A;  3CD6 B;  1VQ8 B;  3P27 A;  4N3N A;  4PGO A;  2OTL B;  2C78 A;  4MYU A;  1VQ6 B;  1QGA A;  1EP3 B;  1E62 A;  3SJZ A;  3W2I A;  1FRQ A;  1XB2 A;  1FNM A;  2BSA A;  2DY1 A;  5TY0 A;  4ACA A;  3WBJ A;  1GAQ A;  1QFY A;  4M1K A;  4Q7J B;  3OJW A;  3OJX A;  1U2R A;  4C43 A;  4QFM A;  3W2E A;  1Q86 D;  2YWH A;  1J9Z A;  1FNC A;  3VMF A;  4K1X A;  3AVY A;  4B44 A;  1G7S A;  4M53 A;  2X3U A;  3CB4 A;  3I55 B;  3W2F A;  1I7P A;  1F20 A;  1EP1 B;  1VQK B;  1VQ7 B;  4YAO A;  1KK3 A;  3CC2 B;  3AVV A;  1E64 A;  3AVW A;  3ZZT A;  3AGP A;  4TN1 A;  3ES9 A;  2OTJ B;  1N0V C;  1JA0 A;  4Y9U A;  2VYQ A;  4RD4 A;  4YAF A;  3V76 A;  1Q81 D;  1K8A D;  4B48 A;  1VQN B;  4ZCL A;  1FDR A;  1OB2 A;  3B82 A;  1YJW B;  3I1F A;  3WND A;  5FA6 A;  4AF7 A;  3G6E B;  2D74 A;  1ZM3 A;  1SM4 A;  4G5G A;  3CCM B;  1K73 D;  2J7K A;  1YJ9 B;  1DAR A;  3OZW A;  1EP2 B;  5EMN A;  1GAW A;  4ACB A;  3CCU B;  1EFC A;  4TMW A;  1KK1 A;  1W34 A;  3W2G A;  1KK0 A;  3AVX A;  1EXM A;  4ZV4 A;  2BVN A;  1BJK A;  3U6K A;  1QUE A;  3OW2 B;  2FX3 A;  4PC3 A;  2HCJ B;  4WQM A;  1VQL B;  3QSY A;  1TLL A;  1D1N A;  2GQF A;  1DDI A;  1WDT A;  2YWG A;  3JQR A;  1KD1 D;  3CCS B;  1YI2 B;  5GV7 A;  4B47 A;  4ZGQ B;  2OK8 A;  3CCJ B;  4LC0 A;  1G7R A;  1ZM4 A;  2GPJ A;  1YIJ B;  1H85 A;  1S72 B;  4G1B A;  1FNB A;  4N3G A;  4YAW A;  2B7B A;  3QFC A;  1QX4 A;  3CC7 B;  2CRV A;  3QFT A;  1EFU A;  1XE1 A;  1CQX A;  3CME B;  1JB9 A;  4HE6 A;  2NPF A;  3ZZ0 A;  2C77 A;  3CCV B;  3FPK A;  4ZGN B;  2XNJ A;  3JQQ A;  1AIP A;  4J0Q A;  4RD2 A;  2DET A;  2ZIT A;  5KSW B;  1G7C A;  3CXC B;  4TMT A;  3LO8 A;  2BGJ A;  3E1Y E;  1JJ2 B;  1FND A;  3WBK A;  5AN9 A;  1TUI A;  1OB5 A;  1CNE A;  4YAU A;  1S0U A;  1W35 A;  5JBQ A;  3VO1 A;  4R71 A;  3CPW B;  4DQK A;  3G71 B;  3CC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...