4HE5A

Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
b'REFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase family U32
molecule tags Unknown function
source organism Geobacillus thermoleovorans
publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he5A00
4M1KA 2HCJB 1K8AD 3LO8A 4B43A 2HDNB 5H59A 3ZZ0A 4RD3A 1KRHA 3V76A 2BN4A 2VYQA 5TV2A 2OTLB 1YJNB 1TUIA 4QFMA 4P3YA 1WDTA 4YHBA 2BSAA 5H5JA 2X3UA 1QFZA 3ES9A 4U9UA 1VQOB 2OK8A 4M53A 4TMXA 1TVCA 1YI2B 3J81k 1FNBA 1VQ7B 2ZITA 2RC6A 4LC0A 3CPWB 1QUEA 3AVWA 2BV3A 3WBJA 2BF4A 1EFTA 4B44A 1FNCA 3AVUA 4H9GA 1S0UA 4ZGQB 4Y9RA 4YALA 3B8HA 1TLLA 4C0SA 3CW2A 1R5OA 1K73D 3G71B 2YWHA 3WNDA 4PC6A 2QMUA 2AHOA 3AVTA 1QX4A 1KK3A 3VO1A 2VNKA 1QGZA 3CC2B 3OJWA 3CCSB 3CD6B 4ACBA 3CB4A 3OZWA 1OGJA 1VQ8B 4M4SA 1YIJB 2E1RA 4HE5A 3WYAA 1Q81D 1FNDA 5TR9A 1GAWA 5KSWB 3ZZTA 2D74A 1DDIA 3AVVA 4ACAA 4RD4A 1EFCA 1W2BB 3AGPA 4RCZA 1ZM3A 2QA4B 1VQPB 3E1YE 3I1FA 4TMWA 4G5GA 3U6BA 3VNUA 1OB5A 1EP1B 3OJXA 4F7DA 1VQ6B 2FX3A 4FWTA 1VQ4B 1YJWB 1ZUNB 4TN1A 3CCRB 1OB2A 4Y7CA 4B48A 4R71A 1I7PA 1EFUA 2DY1A 3G4SB 1YJ9B 3I56B 1QVGB 2QDXA 1BX1A 4PGOA 2BM1A 3AGQA 1G7SA 1IJEA 3OW2B 3AVXA 1NDHA 2PIAA 3U2QA 1FRNA 1JB9A 4MYUA 2BPOA 4HE6A 3VNVA 1E63A 3CC7B 4P6VF 3AVYA 3ZZUA 2OTJB 1W34A 3B78A 2DEUA 1N8RD 4G1BA 2PMDA 2XNCA 4LBZA 4J0QA 1R5BA 2BVNA 1EXMA 2B7CA 2BGIA 4EH1A 2PLFA 1EP3B 5GV8A 2R6HA 3ZC3A 5AN9A 4RCYA 4LBVA 1N0UA 3FPKA 2BMWA 2XNJA 4PC3A 2YWEA 1NJID 4QHYA 2DERA 4YAFA 4NBSA 1JA1A 1G7RA 1QFJA 1VQ5B 5TY0A 1BQEA 4BPRA 1QFYA 3WNCA 1CNFA 3VMFA 1OGIA 4UAJA 2GQFA 1KC8D 1D8TA 1QGYA 1AMOA 5GV7A 3G6EB 3QFTA 3CCLB 4N3GA 1YITB 1XB2A 2XEXA 1KD1D 3CCMB 3OZUA 3CRZA 3MCAA 3JQQA 1G7TA 1CNEA 2CNDA 2VNHA 5FA6A 1HA3A 3W2IA 1FDRA 1FRQA 4RD6A 1B23P 4LBYA 2EIXA 5DSZA 2QN6A 2VNJA 4PC2A 1DDGA 5EMNA 4AC9A 1E62A 3E20A 1A8PA 1SKQA 4TMZA 3CCEB 4Y9UA 1IJFA 1QGAA 4IW3B 1KTVA 4DQLA 1H85A 3QE2A 1M90D 1AIPA 1ZM2A 2B7BA 1K9MD 4N3NA 1KQSB 1YHQB 1BJKA 1IB0A 3OZVA 1QUFA 2DCUA 3W5UA 1FNMA 2C77A 1W87A 3SJZA 1QVFB 3CXCB 4WQMA 4ZCIA 4ZCLA 4TMTA 1F20A 2CRVA 1F60A 3W2FA 3W2GA 1VQMB 4RJLA 3CCVB 2VNIA 2J7KA 3QFCA 3CMEB 4RD2A 4RD0A 4ZGNB 3I55B 3CCUB 1DARA 3VO2A 1DG1G 1QG0A 4YAUA 4FK8A 3JQRA 1Q7YD 4AF6A 2YWFA 1TTTA 2RC5A 1VQKB 3P26A 3ZBTA 2EFGA 3B82A 2QEXB 1UMKA 3QFRA 4Q7JB 3CCJB 1VQ9B 1SM4A 3W2EA 1ZM9A 3W5VA 1QH0A 2QTZA 1J9ZA 1JA0A 3U6KA 2OK7A 4PC7A 4YAOA 1GJRA 1KK0A 3WNBA 4C43A 4PC1A 4MYTA 1JJ2B 1GAQA 3ZBUA 5JBQA 3CC4B 1ELOA 1GO2A 1BX0A 4TMVA 1JNYA 1KJZA 2YWGA 3QFSA 4LBWA 1N0VC 4M2LA 3W2HA 1H42A 1R5NA 3CCQB 3PENA 1D2EA 1KK1A 2DETA 3WXMA 1CQXA 1M1KD 4B3XA 2NPFA 1G7CA 1GR1A 3MMPA 3JQPA 4ZCMA 4B47A 4B4DA 1U2RA 3P27A 3WY9A 1Q82D 2B5OA 3QSYA 3FJOA 2VZLA 4M0LA 1KK2A 4NCNA 4YAWA 3W5HA 1ZM4A 1D1NA 1EP2B 1VQLB 1XE1A 4K1XA 1EWYA 3MHPA 4AF7A 3LVBA 1S72B 2C78A 4ZV4A 4FN5A 2GPJA 3WBKA 4G1VA 2BM0A 3CMAB 2HMAA 5HXBA 1VQNB 5THXA 4RD1A 1E64A 1Q86D 4DQKA 1GVHA 1B2RA 2BGJA 1W35A 2QTLA
chains in the Genus database with same CATH superfamily
4Z4VA 2X53S 2GK7A 2GJRA 4M1KA 4XMYA 2D9RA 2HCJB 4DK0A 1K8AD 1VLOA 3LO8A 4B43A 5TRDA 2HDNB 5H59A 3ASQA 3ZZ0A 4DNRB 4RD3A 1KRHA 3GVJA 3JU4A 3V76A 2BN4A 2VYQA 5TV2A 2OTLB 1YJNB 1E79A 1TUIA 4P3YA 4QFMA 1WDTA 4YELA 2F1MA 4G7WA 1XQBA 3Q6RA 1UD4A 1WSVA 4YHBA 2BSAA 1OHHA 3A8IA 1T6YA 5H5JA 2X3UA 1QFZA 3ES9A 4U9UA 4Z4WA 2V7QA 1VQOB 2ZBVA 2OK8A 2Q6KA 3GQBA 2XNDA 3SEJA 5BSYA 4M53A 3OW7A 4RPBA 4TMXA 1TVCA 1YI2B 3J81k 1FNBA 2ZZEA 1VQ7B 2Z6BD 2ZITA 4XORA 1BPLA 4L8JA 4WZTA 2RC6A 1E43A 2X85A 2V7VA 4LC0A 3CPWB 1T5EA 2Q6OA 1QUEA 3DDYA 2CW5A 4XD7A 1V0FA 3AVWA 2BV3A 3WBJA 2BF4A 1EFTA 3BY2A 4XNFA 3WQZA 2CK3A 4B44A 4XONA 1FNCA 5IYWA 1E1RA 3AVUA 4H9GA 1S0UA 4OPOA 3FPPA 4ZGQB 4OPSA 1W0JA 2C4UA 4Y9RA 4YALA 3B8HA 5IYNA 1TLLA 4C0SA 3CW2A 5F4JA 1E3ZA 1R5OA 3T56B 1Y0RA 1K73D 1H8HA 3G71B 2YWHA 5IK2A 3D26A 3WNDA 4PC6A 2QMUA 4RLZA 2AHOA 3AVTA 1QX4A 2WJYA 4P22A 4Z4ZA 1KK3A 4P26A 3VO1A 2R9VA 2VNKA 4XQFA 5CDFA 1QGZA 1HZEA 3CC2B 3OJWA 3CCSB 4XKVA 2JJ2A 2LZJA 3OEEA 4X7DA 3LQEA 4Z4SA 3CD6B 4ACBA 3CB4A 2HLDA 1PJ5A 3OZWA 1OGJA 1VQ8B 1VJSA 5IYPA 5A88A 4M4SA 1YIJB 1N06A 2E1RA 2C2WA 4HE5A 3WYAA 1Q81D 1FNDA 1VLYA 5TR9A 3OAAA 1NB0A 4WZKA 2V7UA 1GAWA 5KSWB 3BCDA 3ZZTA 2JJ1A 2OYNA 2D74A 4Z4YA 4OOVA 2XZLA 1DDIA 3AVVA 4B3FX 2XZOA 3BCFA 4ACAA 4P25A 4RPDA 1N08A 5IYQA 3OEHA 4RD4A 4G7XA 4X8IA 4XR6A 1EFCA 4P2NA 1NRKA 1W0KA 1W2BB 3AGPA 2GJKA 4RCZA 1ZM3A 4P3IA 4XLEA 2QA4B 1VQPB 3E1YE 3I1FA 4TMWA 3PA1A 1RQRA 4G5GA 3U6BA 2V7XA 5FL7A 3VNUA 2D3LA 5FO1A 1OB5A 1MRZA 1EP1B 3OJXA 4F7DA 1VQ6B 3CTAA 2FX3A 5L46A 4FWTA 5KNLA 2PE3A 5IYRA 2W6JA 1VQ4B 1YJWB 1ZUNB 4TN1A 2C5HA 3Q3AA 3ZPNA 3CCRB 1WORA 4FXUA 1OB2A 4II2A 4P12A 4Y7CA 4B48A 4R71A 4WZEA 2XGJA 3FKSA 1WP6A 1I7PA 1EFUA 2DY1A 2JDIA 4JMQA 3G4SB 3ISXA 2X6XA 3I56B 1YJ9B 1QVGB 2QDXA 3ASTA 3OKXA 2XZPA 4WWVA 1BX1A 4DNTB 2C5BA 2WR8A 4PGOA 2BM1A 2Q6LA 2X6WA 1UD8A 4XN0A 3AGQA 1G7SA 1IJEA 2VBSA 3OW2B 3AVXA 1NDHA 2PIAA 3U2QA 1FRNA 1JB9A 2VBTA 3ZUGA 2ZTGA 1UD2A 2KVOA 4MYUA 2BPOA 4HE6A 3VNVA 2X0KA 1E63A 3CC7B 4P6VF 3AVYA 2OBTA 3ZZUA 4XM3A 4OPVA 2OTJB 1PKVA 4DK1A 3OP1A 1W34A 3B78A 2DEUA 4X07A 1COWA 1N8RD 4G1BA 4X06A 3GIRA 3ZIAA 2PMDA 2XNCA 4LBZA 3CP8A 2GJPA 4J0QA 1WOPA 1R5BA 4RDJA 5HZBA 2BVNA 1EXMA 1UD3A 2VJIA 2B7CA 2BGIA 4EH1A 1NBMA 2WZPP 2PLFA 1EP3B 5GV8A 2R6HA 3ZC3A 3GVKA 3ASPA 3GSIA 5AN9A 3BQJA 4RCYA 4LBVA 1N0UA 3FPKA 4KKTA 1WSRA 4XLFA 2D3NA 3R6JA 3Q6QA 3Q39A 2BMWA 2GREA 2XNJA 2JIZA 2XOKA 2JN9A 4PC3A 2YWEA 1NJID 4QHYA 2F43A 2DERA 3SLNA 2V4DA 4YAFA 4NBSA 1JA1A 1G7RA 2ZZQA 1QFJA 1VQ5B 2WYRA 5TY0A 1WU8A 1BQEA 3LNNA 5LMZA 4BPRA 4QVJA 4XLHA 1BMFA 1QFYA 3WNCA 1CNFA 5FO0A 2X8KA 3VMFA 1OGIA 4UAJA 2GQFA 1KC8D 1D8TA 1OB0A 1QGYA 4ROXA 3BH4A 1AMOA 5GV7A 1T6ZA 3QFTA 3G6EB 4X7FA 4RDLA 1XFOA 3V7AA 3CCLB 4X05A 4N3GA 1WTHD 3ASRA 4Z4TA 4QVAA 1XB2A 2XEXA 1YITB 3CCMB 1KD1D 3OZUA 1YX2A 3CRZA 3MCAA 5F4OA 3JQQA 1EFRA 1Q9SA 2F4NA 1G7TA 1CNEA 2CNDA 2VNHA 5FA6A 1HA3A 1SKYB 2GK6A 1FDRA 3W2IA 1FRQA 1T6XA 2DYIA 4RD6A 1B23P 3A1PA 2V7TA 1WOOA 4LBYA 2EIXA 4II3A 2CBXA 2M5SA 5DSZA 2VBVA 4HIZA 3HAGA 2QN6A 2VNJA 4PC2A 1DDGA 3CMMA 5J3OA 4Z1MA 4XOPA 5EMNA 4AC9A 1E62A 3E20A 2WZNA 1A8PA 1YLOA 1SKQA 3ONYA 4TMZA 1S4MA 3CCEB 3A35A 1IJFA 1QGAA 1KZLA 3NE5B 4Y9UA 4IW3B 1P4MA 1KTVA 3CP2A 4DQLA 1H85A 3QE2A 2DIEA 3T53B 1UD5A 2E1BA 1AIPA 2ZL6A 4P9SA 4UZUA 1M90D 1ZM2A 2B7BA 1K9MD 4N3NA 1KQSB 1YHQB 1BJKA 1IB0A 3OZVA 4QUZA 2ZL7A 1QUFA 4TSFA 2DCUA 5E6TA 3W5UA 4GQNA 1FNMA 1V5VA 2C77A 2VJJA 2X6YA 5A89A 1W87A 5HKKA 3SJZA 3PUNA 3PA2A 1QVFB 3CXCB 2QE7A 4WQMA 4X7CA 4ZCIA 4ZCLA 4TMTA 1F20A 2WJVA 2CRVA 1F60A 1I18A 2W6IA 3OOCA 3OPOA 4B3GA 3W2FA 2F1LA 3SJPA 3W2GA 1VQMB 4OP7A 3A3GA 2OBRA 2VNIA 2J7KA 4RJLA 3CCVB 3QFCA 3A8JA 3CMEB 4RD2A 4RD0A 4UZFA 4ZGNB 3I55B 3CCUB 3VR6A 1DARA 1N05A 1KMHA 3VO2A 4CQJA 2WSSA 3ONUA 5F4MA 1DG1G 1QG0A 1E1QA 2CC2A 2ZZGA 5J35A 4YAUA 4FK8A 3JQRA 1Y0YA 1Q7YD 4RDKA 4AF6A 3BC9A 2YWFA 1TTTA 2RC5A 1VQKB 3P26A 3SKBA 3ZBTA 5DS0A 2EFGA 4X7EA 3ASSA 3B82A 3PVDA 5B6IA 1K28D 2QEXB 1W9XA 1UMKA 4P6YA 3OE7A 1I8DA 3QFRA 4Q7JB 1BLIA 3CCJB 1VF7A 1VQ9B 1SM4A 3W2EA 4G6IA 1ZM9A 1NB9A 3W5VA 1QH0A 3A8KA 2QTZA 1WOSA 4Z4UA 1J9ZA 2C4TA 3H9NA 1JA0A 1WPCA 3H94A 3U6KA 4TKOB 4RM0A 2OK7A 5FIUA 4PC7A 4PABA 2CF4A 4YAOA 2VBUA 1GJRA 1KK0A 3WNBA 5HZAA 4C43A 4PC1A 4OOXA 4MYTA 2ZZFA 1HVXA 3KEWA 1JJ2B 4PAAA 4E0FA 1GAQA 3ZBUA 2ZTNA 4NNJA 5JBQA 2QGGA 3CC4B 3LQ6A 5A8AA 5DN6A 2NV4A 1RQPA 2ZXHA 1ELOA 4AVZA 4XOTA 1GO2A 3A3BA 1BX0A 4UZEA 2I1LA 4TMVA 3RY8A 1JNYA 1KJZA 4XL9A 3OFNA 4P1VA 1PJ6A 2YWGA 3QFSA 4LBWA 1N0VC 4M2LA 3W2HA 3T51B 4KKUA 1H42A 1R5NA 3CCQB 3PENA 1MABA 3Q38A 1D2EA 4Z4RA 4OOSA 1KK1A 1PJ7A 4YXWA 2DETA 2OBSA 3WXMA 1CQXA 3CESA 5BSXA 2FVGA 1M1KD 1E3XA 4B3XA 2NPFA 2V7WA 3CPXA 1G7CA 1GR1A 3MMPA 4XKWA 3JQPA 3KL9A 4ZCMA 1V0EA 2Q6IA 4B47A 4B4DA 1U2RA 3R6KA 3P27A 3BNWA 3WY9A 5FNZA 5KW9A 1Q82D 2B5OA 4QV2A 3QSYA 4TT3A 3FJOA 4XLAA 4YEJA 2VZLA 1VHEA 4M0LA 1KK2A 4X0CA 4NCNA 4YAWA 3W5HA 1FX0A 1ZM4A 1D1NA 1EP2B 1N07A 1VQLB 3SLDA 1XE1A 4K1XA 1EWYA 3MHPA 3PUMA 1VHOA 2P3MA 2ZXIA 4AF7A 3LVBA 1S72B 2C78A 4ZV4A 4FN5A 2ZBUA 3G05A 4WZLA 1UD6A 2GPJA 3WBKA 2ZL5A 4G1VA 2V31A 1IHMA 1H8EA 2BM0A 4ASUA 3CMAB 2DOGA 4KKSA 2HMAA 5HXBA 1VQNB 5THXA 3GVLA 4RD1A 1E64A 1Q86D 2WPDA 4DQKA 1GVHA 3BY1A 1B2RA 4XLCA 2BGJA 1W35A 4XN3A 2QTLA
chains in the Genus database with same CATH topology
4M1KA 2HCJB 1K8AD 3LO8A 4B43A 2HDNB 5H59A 3ZZ0A 4RD3A 1KRHA 3V76A 2BN4A 2VYQA 5TV2A 2OTLB 1YJNB 1TUIA 4QFMA 4P3YA 1WDTA 4YHBA 2BSAA 5H5JA 2X3UA 1QFZA 3ES9A 4U9UA 1VQOB 2OK8A 4M53A 4TMXA 1TVCA 1YI2B 3J81k 1FNBA 1VQ7B 2ZITA 2RC6A 4LC0A 3CPWB 1QUEA 3AVWA 2BV3A 3WBJA 2BF4A 1EFTA 4B44A 1FNCA 3AVUA 4H9GA 1S0UA 4ZGQB 4Y9RA 4YALA 3B8HA 1TLLA 4C0SA 3CW2A 1R5OA 1K73D 3G71B 2YWHA 3WNDA 4PC6A 2QMUA 2AHOA 3AVTA 1QX4A 1KK3A 3VO1A 2VNKA 1QGZA 3CC2B 3OJWA 3CCSB 3CD6B 4ACBA 3CB4A 3OZWA 1OGJA 1VQ8B 4M4SA 1YIJB 2E1RA 4HE5A 3WYAA 1Q81D 1FNDA 5TR9A 1GAWA 5KSWB 3ZZTA 2D74A 1DDIA 3AVVA 4ACAA 4RD4A 1EFCA 1W2BB 3AGPA 4RCZA 1ZM3A 2QA4B 1VQPB 3E1YE 3I1FA 4TMWA 4G5GA 3U6BA 3VNUA 1OB5A 1EP1B 3OJXA 4F7DA 1VQ6B 2FX3A 4FWTA 1VQ4B 1YJWB 1ZUNB 4TN1A 3CCRB 1OB2A 4Y7CA 4B48A 4R71A 1I7PA 1EFUA 2DY1A 3G4SB 1YJ9B 3I56B 1QVGB 2QDXA 1BX1A 4PGOA 2BM1A 3AGQA 1G7SA 1IJEA 3OW2B 3AVXA 1NDHA 2PIAA 3U2QA 1FRNA 1JB9A 4MYUA 2BPOA 4HE6A 3VNVA 1E63A 3CC7B 4P6VF 3AVYA 3ZZUA 2OTJB 1W34A 3B78A 2DEUA 1N8RD 4G1BA 2PMDA 2XNCA 4LBZA 4J0QA 1R5BA 2BVNA 1EXMA 2B7CA 2BGIA 4EH1A 2PLFA 1EP3B 5GV8A 2R6HA 3ZC3A 5AN9A 4RCYA 4LBVA 1N0UA 3FPKA 2BMWA 2XNJA 4PC3A 2YWEA 1NJID 4QHYA 2DERA 4YAFA 4NBSA 1JA1A 1G7RA 1QFJA 1VQ5B 5TY0A 1BQEA 4BPRA 1QFYA 3WNCA 1CNFA 3VMFA 1OGIA 4UAJA 2GQFA 1KC8D 1D8TA 1QGYA 1AMOA 5GV7A 3G6EB 3QFTA 3CCLB 4N3GA 1YITB 1XB2A 2XEXA 1KD1D 3CCMB 3OZUA 3CRZA 3MCAA 3JQQA 1G7TA 1CNEA 2CNDA 2VNHA 5FA6A 1HA3A 3W2IA 1FDRA 1FRQA 4RD6A 1B23P 4LBYA 2EIXA 5DSZA 2QN6A 2VNJA 4PC2A 1DDGA 5EMNA 4AC9A 1E62A 3E20A 1A8PA 1SKQA 4TMZA 3CCEB 4Y9UA 1IJFA 1QGAA 4IW3B 1KTVA 4DQLA 1H85A 3QE2A 1M90D 1AIPA 1ZM2A 2B7BA 1K9MD 4N3NA 1KQSB 1YHQB 1BJKA 1IB0A 3OZVA 1QUFA 2DCUA 3W5UA 1FNMA 2C77A 1W87A 3SJZA 1QVFB 3CXCB 4WQMA 4ZCIA 4ZCLA 4TMTA 1F20A 2CRVA 1F60A 3W2FA 3W2GA 1VQMB 4RJLA 3CCVB 2VNIA 2J7KA 3QFCA 3CMEB 4RD2A 4RD0A 4ZGNB 3I55B 3CCUB 1DARA 3VO2A 1DG1G 1QG0A 4YAUA 4FK8A 3JQRA 1Q7YD 4AF6A 2YWFA 1TTTA 2RC5A 1VQKB 3P26A 3ZBTA 2EFGA 3B82A 2QEXB 1UMKA 3QFRA 4Q7JB 3CCJB 1VQ9B 1SM4A 3W2EA 1ZM9A 3W5VA 1QH0A 2QTZA 1J9ZA 1JA0A 3U6KA 2OK7A 4PC7A 4YAOA 1GJRA 1KK0A 3WNBA 4C43A 4PC1A 4MYTA 1JJ2B 1GAQA 3ZBUA 5JBQA 3CC4B 1ELOA 1GO2A 1BX0A 4TMVA 1JNYA 1KJZA 2YWGA 3QFSA 4LBWA 1N0VC 4M2LA 3W2HA 1H42A 1R5NA 3CCQB 3PENA 1D2EA 1KK1A 2DETA 3WXMA 1CQXA 1M1KD 4B3XA 2NPFA 1G7CA 1GR1A 3MMPA 3JQPA 4ZCMA 4B47A 4B4DA 1U2RA 3P27A 3WY9A 1Q82D 2B5OA 3QSYA 3FJOA 2VZLA 4M0LA 1KK2A 4NCNA 4YAWA 3W5HA 1ZM4A 1D1NA 1EP2B 1VQLB 1XE1A 4K1XA 1EWYA 3MHPA 4AF7A 3LVBA 1S72B 2C78A 4ZV4A 4FN5A 2GPJA 3WBKA 4G1VA 2BM0A 3CMAB 2HMAA 5HXBA 1VQNB 5THXA 4RD1A 1E64A 1Q86D 4DQKA 1GVHA 1B2RA 2BGJA 1W35A 2QTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1K A;  2HCJ B;  1K8A D;  3LO8 A;  4B43 A;  2HDN B;  5H59 A;  3ZZ0 A;  4RD3 A;  1KRH A;  3V76 A;  2BN4 A;  2VYQ A;  5TV2 A;  2OTL B;  1YJN B;  1TUI A;  4QFM A;  4P3Y A;  1WDT A;  4YHB A;  2BSA A;  5H5J A;  2X3U A;  1QFZ A;  3ES9 A;  4U9U A;  1VQO B;  2OK8 A;  4M53 A;  4TMX A;  1TVC A;  1YI2 B;  3J81 k;  1FNB A;  1VQ7 B;  2ZIT A;  2RC6 A;  4LC0 A;  3CPW B;  1QUE A;  3AVW A;  2BV3 A;  3WBJ A;  2BF4 A;  1EFT A;  4B44 A;  1FNC A;  3AVU A;  4H9G A;  1S0U A;  4ZGQ B;  4Y9R A;  4YAL A;  3B8H A;  1TLL A;  4C0S A;  3CW2 A;  1R5O A;  1K73 D;  3G71 B;  2YWH A;  3WND A;  4PC6 A;  2QMU A;  2AHO A;  3AVT A;  1QX4 A;  1KK3 A;  3VO1 A;  2VNK A;  1QGZ A;  3CC2 B;  3OJW A;  3CCS B;  3CD6 B;  4ACB A;  3CB4 A;  3OZW A;  1OGJ A;  1VQ8 B;  4M4S A;  1YIJ B;  2E1R A;  4HE5 A;  3WYA A;  1Q81 D;  1FND A;  5TR9 A;  1GAW A;  5KSW B;  3ZZT A;  2D74 A;  1DDI A;  3AVV A;  4ACA A;  4RD4 A;  1EFC A;  1W2B B;  3AGP A;  4RCZ A;  1ZM3 A;  2QA4 B;  1VQP B;  3E1Y E;  3I1F A;  4TMW A;  4G5G A;  3U6B A;  3VNU A;  1OB5 A;  1EP1 B;  3OJX A;  4F7D A;  1VQ6 B;  2FX3 A;  4FWT A;  1VQ4 B;  1YJW B;  1ZUN B;  4TN1 A;  3CCR B;  1OB2 A;  4Y7C A;  4B48 A;  4R71 A;  1I7P A;  1EFU A;  2DY1 A;  3G4S B;  1YJ9 B;  3I56 B;  1QVG B;  2QDX A;  1BX1 A;  4PGO A;  2BM1 A;  3AGQ A;  1G7S A;  1IJE A;  3OW2 B;  3AVX A;  1NDH A;  2PIA A;  3U2Q A;  1FRN A;  1JB9 A;  4MYU A;  2BPO A;  4HE6 A;  3VNV A;  1E63 A;  3CC7 B;  4P6V F;  3AVY A;  3ZZU A;  2OTJ B;  1W34 A;  3B78 A;  2DEU A;  1N8R D;  4G1B A;  2PMD A;  2XNC A;  4LBZ A;  4J0Q A;  1R5B A;  2BVN A;  1EXM A;  2B7C A;  2BGI A;  4EH1 A;  2PLF A;  1EP3 B;  5GV8 A;  2R6H A;  3ZC3 A;  5AN9 A;  4RCY A;  4LBV A;  1N0U A;  3FPK A;  2BMW A;  2XNJ A;  4PC3 A;  2YWE A;  1NJI D;  4QHY A;  2DER A;  4YAF A;  4NBS A;  1JA1 A;  1G7R A;  1QFJ A;  1VQ5 B;  5TY0 A;  1BQE A;  4BPR A;  1QFY A;  3WNC A;  1CNF A;  3VMF A;  1OGI A;  4UAJ A;  2GQF A;  1KC8 D;  1D8T A;  1QGY A;  1AMO A;  5GV7 A;  3G6E B;  3QFT A;  3CCL B;  4N3G A;  1YIT B;  1XB2 A;  2XEX A;  1KD1 D;  3CCM B;  3OZU A;  3CRZ A;  3MCA A;  3JQQ A;  1G7T A;  1CNE A;  2CND A;  2VNH A;  5FA6 A;  1HA3 A;  3W2I A;  1FDR A;  1FRQ A;  4RD6 A;  1B23 P;  4LBY A;  2EIX A;  5DSZ A;  2QN6 A;  2VNJ A;  4PC2 A;  1DDG A;  5EMN A;  4AC9 A;  1E62 A;  3E20 A;  1A8P A;  1SKQ A;  4TMZ A;  3CCE B;  4Y9U A;  1IJF A;  1QGA A;  4IW3 B;  1KTV A;  4DQL A;  1H85 A;  3QE2 A;  1M90 D;  1AIP A;  1ZM2 A;  2B7B A;  1K9M D;  4N3N A;  1KQS B;  1YHQ B;  1BJK A;  1IB0 A;  3OZV A;  1QUF A;  2DCU A;  3W5U A;  1FNM A;  2C77 A;  1W87 A;  3SJZ A;  1QVF B;  3CXC B;  4WQM A;  4ZCI A;  4ZCL A;  4TMT A;  1F20 A;  2CRV A;  1F60 A;  3W2F A;  3W2G A;  1VQM B;  4RJL A;  3CCV B;  2VNI A;  2J7K A;  3QFC A;  3CME B;  4RD2 A;  4RD0 A;  4ZGN B;  3I55 B;  3CCU B;  1DAR A;  3VO2 A;  1DG1 G;  1QG0 A;  4YAU A;  4FK8 A;  3JQR A;  1Q7Y D;  4AF6 A;  2YWF A;  1TTT A;  2RC5 A;  1VQK B;  3P26 A;  3ZBT A;  2EFG A;  3B82 A;  2QEX B;  1UMK A;  3QFR A;  4Q7J B;  3CCJ B;  1VQ9 B;  1SM4 A;  3W2E A;  1ZM9 A;  3W5V A;  1QH0 A;  2QTZ A;  1J9Z A;  1JA0 A;  3U6K A;  2OK7 A;  4PC7 A;  4YAO A;  1GJR A;  1KK0 A;  3WNB A;  4C43 A;  4PC1 A;  4MYT A;  1JJ2 B;  1GAQ A;  3ZBU A;  5JBQ A;  3CC4 B;  1ELO A;  1GO2 A;  1BX0 A;  4TMV A;  1JNY A;  1KJZ A;  2YWG A;  3QFS A;  4LBW A;  1N0V C;  4M2L A;  3W2H A;  1H42 A;  1R5N A;  3CCQ B;  3PEN A;  1D2E A;  1KK1 A;  2DET A;  3WXM A;  1CQX A;  1M1K D;  4B3X A;  2NPF A;  1G7C A;  1GR1 A;  3MMP A;  3JQP A;  4ZCM A;  4B47 A;  4B4D A;  1U2R A;  3P27 A;  3WY9 A;  1Q82 D;  2B5O A;  3QSY A;  3FJO A;  2VZL A;  4M0L A;  1KK2 A;  4NCN A;  4YAW A;  3W5H A;  1ZM4 A;  1D1N A;  1EP2 B;  1VQL B;  1XE1 A;  4K1X A;  1EWY A;  3MHP A;  4AF7 A;  3LVB A;  1S72 B;  2C78 A;  4ZV4 A;  4FN5 A;  2GPJ A;  3WBK A;  4G1V A;  2BM0 A;  3CMA B;  2HMA A;  5HXB A;  1VQN B;  5THX A;  4RD1 A;  1E64 A;  1Q86 D;  4DQK A;  1GVH A;  1B2R A;  2BGJ A;  1W35 A;  2QTL A; 
#chains in the Genus database with same CATH topology
 4Z4V A;  2X53 S;  2GK7 A;  2GJR A;  4M1K A;  4XMY A;  2D9R A;  2HCJ B;  4DK0 A;  1K8A D;  1VLO A;  3LO8 A;  4B43 A;  5TRD A;  2HDN B;  5H59 A;  3ASQ A;  3ZZ0 A;  4DNR B;  4RD3 A;  1KRH A;  3GVJ A;  3JU4 A;  3V76 A;  2BN4 A;  2VYQ A;  5TV2 A;  2OTL B;  1YJN B;  1E79 A;  1TUI A;  4P3Y A;  4QFM A;  1WDT A;  4YEL A;  2F1M A;  4G7W A;  1XQB A;  3Q6R A;  1UD4 A;  1WSV A;  4YHB A;  2BSA A;  1OHH A;  3A8I A;  1T6Y A;  5H5J A;  2X3U A;  1QFZ A;  3ES9 A;  4U9U A;  4Z4W A;  2V7Q A;  1VQO B;  2ZBV A;  2OK8 A;  2Q6K A;  3GQB A;  2XND A;  3SEJ A;  5BSY A;  4M53 A;  3OW7 A;  4RPB A;  4TMX A;  1TVC A;  1YI2 B;  3J81 k;  1FNB A;  2ZZE A;  1VQ7 B;  2Z6B D;  2ZIT A;  4XOR A;  1BPL A;  4L8J A;  4WZT A;  2RC6 A;  1E43 A;  2X85 A;  2V7V A;  4LC0 A;  3CPW B;  1T5E A;  2Q6O A;  1QUE A;  3DDY A;  2CW5 A;  4XD7 A;  1V0F A;  3AVW A;  2BV3 A;  3WBJ A;  2BF4 A;  1EFT A;  3BY2 A;  4XNF A;  3WQZ A;  2CK3 A;  4B44 A;  4XON A;  1FNC A;  5IYW A;  1E1R A;  3AVU A;  4H9G A;  1S0U A;  4OPO A;  3FPP A;  4ZGQ B;  4OPS A;  1W0J A;  2C4U A;  4Y9R A;  4YAL A;  3B8H A;  5IYN A;  1TLL A;  4C0S A;  3CW2 A;  5F4J A;  1E3Z A;  1R5O A;  3T56 B;  1Y0R A;  1K73 D;  1H8H A;  3G71 B;  2YWH A;  5IK2 A;  3D26 A;  3WND A;  4PC6 A;  2QMU A;  4RLZ A;  2AHO A;  3AVT A;  1QX4 A;  2WJY A;  4P22 A;  4Z4Z A;  1KK3 A;  4P26 A;  3VO1 A;  2R9V A;  2VNK A;  4XQF A;  5CDF A;  1QGZ A;  1HZE A;  3CC2 B;  3OJW A;  3CCS B;  4XKV A;  2JJ2 A;  2LZJ A;  3OEE A;  4X7D A;  3LQE A;  4Z4S A;  3CD6 B;  4ACB A;  3CB4 A;  2HLD A;  1PJ5 A;  3OZW A;  1OGJ A;  1VQ8 B;  1VJS A;  5IYP A;  5A88 A;  4M4S A;  1YIJ B;  1N06 A;  2E1R A;  2C2W A;  4HE5 A;  3WYA A;  1Q81 D;  1FND A;  1VLY A;  5TR9 A;  3OAA A;  1NB0 A;  4WZK A;  2V7U A;  1GAW A;  5KSW B;  3BCD A;  3ZZT A;  2JJ1 A;  2OYN A;  2D74 A;  4Z4Y A;  4OOV A;  2XZL A;  1DDI A;  3AVV A;  4B3F X;  2XZO A;  3BCF A;  4ACA A;  4P25 A;  4RPD A;  1N08 A;  5IYQ A;  3OEH A;  4RD4 A;  4G7X A;  4X8I A;  4XR6 A;  1EFC A;  4P2N A;  1NRK A;  1W0K A;  1W2B B;  3AGP A;  2GJK A;  4RCZ A;  1ZM3 A;  4P3I A;  4XLE A;  2QA4 B;  1VQP B;  3E1Y E;  3I1F A;  4TMW A;  3PA1 A;  1RQR A;  4G5G A;  3U6B A;  2V7X A;  5FL7 A;  3VNU A;  2D3L A;  5FO1 A;  1OB5 A;  1MRZ A;  1EP1 B;  3OJX A;  4F7D A;  1VQ6 B;  3CTA A;  2FX3 A;  5L46 A;  4FWT A;  5KNL A;  2PE3 A;  5IYR A;  2W6J A;  1VQ4 B;  1YJW B;  1ZUN B;  4TN1 A;  2C5H A;  3Q3A A;  3ZPN A;  3CCR B;  1WOR A;  4FXU A;  1OB2 A;  4II2 A;  4P12 A;  4Y7C A;  4B48 A;  4R71 A;  4WZE A;  2XGJ A;  3FKS A;  1WP6 A;  1I7P A;  1EFU A;  2DY1 A;  2JDI A;  4JMQ A;  3G4S B;  3ISX A;  2X6X A;  3I56 B;  1YJ9 B;  1QVG B;  2QDX A;  3AST A;  3OKX A;  2XZP A;  4WWV A;  1BX1 A;  4DNT B;  2C5B A;  2WR8 A;  4PGO A;  2BM1 A;  2Q6L A;  2X6W A;  1UD8 A;  4XN0 A;  3AGQ A;  1G7S A;  1IJE A;  2VBS A;  3OW2 B;  3AVX A;  1NDH A;  2PIA A;  3U2Q A;  1FRN A;  1JB9 A;  2VBT A;  3ZUG A;  2ZTG A;  1UD2 A;  2KVO A;  4MYU A;  2BPO A;  4HE6 A;  3VNV A;  2X0K A;  1E63 A;  3CC7 B;  4P6V F;  3AVY A;  2OBT A;  3ZZU A;  4XM3 A;  4OPV A;  2OTJ B;  1PKV A;  4DK1 A;  3OP1 A;  1W34 A;  3B78 A;  2DEU A;  4X07 A;  1COW A;  1N8R D;  4G1B A;  4X06 A;  3GIR A;  3ZIA A;  2PMD A;  2XNC A;  4LBZ A;  3CP8 A;  2GJP A;  4J0Q A;  1WOP A;  1R5B A;  4RDJ A;  5HZB A;  2BVN A;  1EXM A;  1UD3 A;  2VJI A;  2B7C A;  2BGI A;  4EH1 A;  1NBM A;  2WZP P;  2PLF A;  1EP3 B;  5GV8 A;  2R6H A;  3ZC3 A;  3GVK A;  3ASP A;  3GSI A;  5AN9 A;  3BQJ A;  4RCY A;  4LBV A;  1N0U A;  3FPK A;  4KKT A;  1WSR A;  4XLF A;  2D3N A;  3R6J A;  3Q6Q A;  3Q39 A;  2BMW A;  2GRE A;  2XNJ A;  2JIZ A;  2XOK A;  2JN9 A;  4PC3 A;  2YWE A;  1NJI D;  4QHY A;  2F43 A;  2DER A;  3SLN A;  2V4D A;  4YAF A;  4NBS A;  1JA1 A;  1G7R A;  2ZZQ A;  1QFJ A;  1VQ5 B;  2WYR A;  5TY0 A;  1WU8 A;  1BQE A;  3LNN A;  5LMZ A;  4BPR A;  4QVJ A;  4XLH A;  1BMF A;  1QFY A;  3WNC A;  1CNF A;  5FO0 A;  2X8K A;  3VMF A;  1OGI A;  4UAJ A;  2GQF A;  1KC8 D;  1D8T A;  1OB0 A;  1QGY A;  4ROX A;  3BH4 A;  1AMO A;  5GV7 A;  1T6Z A;  3QFT A;  3G6E B;  4X7F A;  4RDL A;  1XFO A;  3V7A A;  3CCL B;  4X05 A;  4N3G A;  1WTH D;  3ASR A;  4Z4T A;  4QVA A;  1XB2 A;  2XEX A;  1YIT B;  3CCM B;  1KD1 D;  3OZU A;  1YX2 A;  3CRZ A;  3MCA A;  5F4O A;  3JQQ A;  1EFR A;  1Q9S A;  2F4N A;  1G7T A;  1CNE A;  2CND A;  2VNH A;  5FA6 A;  1HA3 A;  1SKY B;  2GK6 A;  1FDR A;  3W2I A;  1FRQ A;  1T6X A;  2DYI A;  4RD6 A;  1B23 P;  3A1P A;  2V7T A;  1WOO A;  4LBY A;  2EIX A;  4II3 A;  2CBX A;  2M5S A;  5DSZ A;  2VBV A;  4HIZ A;  3HAG A;  2QN6 A;  2VNJ A;  4PC2 A;  1DDG A;  3CMM A;  5J3O A;  4Z1M A;  4XOP A;  5EMN A;  4AC9 A;  1E62 A;  3E20 A;  2WZN A;  1A8P A;  1YLO A;  1SKQ A;  3ONY A;  4TMZ A;  1S4M A;  3CCE B;  3A35 A;  1IJF A;  1QGA A;  1KZL A;  3NE5 B;  4Y9U A;  4IW3 B;  1P4M A;  1KTV A;  3CP2 A;  4DQL A;  1H85 A;  3QE2 A;  2DIE A;  3T53 B;  1UD5 A;  2E1B A;  1AIP A;  2ZL6 A;  4P9S A;  4UZU A;  1M90 D;  1ZM2 A;  2B7B A;  1K9M D;  4N3N A;  1KQS B;  1YHQ B;  1BJK A;  1IB0 A;  3OZV A;  4QUZ A;  2ZL7 A;  1QUF A;  4TSF A;  2DCU A;  5E6T A;  3W5U A;  4GQN A;  1FNM A;  1V5V A;  2C77 A;  2VJJ A;  2X6Y A;  5A89 A;  1W87 A;  5HKK A;  3SJZ A;  3PUN A;  3PA2 A;  1QVF B;  3CXC B;  2QE7 A;  4WQM A;  4X7C A;  4ZCI A;  4ZCL A;  4TMT A;  1F20 A;  2WJV A;  2CRV A;  1F60 A;  1I18 A;  2W6I A;  3OOC A;  3OPO A;  4B3G A;  3W2F A;  2F1L A;  3SJP A;  3W2G A;  1VQM B;  4OP7 A;  3A3G A;  2OBR A;  2VNI A;  2J7K A;  4RJL A;  3CCV B;  3QFC A;  3A8J A;  3CME B;  4RD2 A;  4RD0 A;  4UZF A;  4ZGN B;  3I55 B;  3CCU B;  3VR6 A;  1DAR A;  1N05 A;  1KMH A;  3VO2 A;  4CQJ A;  2WSS A;  3ONU A;  5F4M A;  1DG1 G;  1QG0 A;  1E1Q A;  2CC2 A;  2ZZG A;  5J35 A;  4YAU A;  4FK8 A;  3JQR A;  1Y0Y A;  1Q7Y D;  4RDK A;  4AF6 A;  3BC9 A;  2YWF A;  1TTT A;  2RC5 A;  1VQK B;  3P26 A;  3SKB A;  3ZBT A;  5DS0 A;  2EFG A;  4X7E A;  3ASS A;  3B82 A;  3PVD A;  5B6I A;  1K28 D;  2QEX B;  1W9X A;  1UMK A;  4P6Y A;  3OE7 A;  1I8D A;  3QFR A;  4Q7J B;  1BLI A;  3CCJ B;  1VF7 A;  1VQ9 B;  1SM4 A;  3W2E A;  4G6I A;  1ZM9 A;  1NB9 A;  3W5V A;  1QH0 A;  3A8K A;  2QTZ A;  1WOS A;  4Z4U A;  1J9Z A;  2C4T A;  3H9N A;  1JA0 A;  1WPC A;  3H94 A;  3U6K A;  4TKO B;  4RM0 A;  2OK7 A;  5FIU A;  4PC7 A;  4PAB A;  2CF4 A;  4YAO A;  2VBU A;  1GJR A;  1KK0 A;  3WNB A;  5HZA A;  4C43 A;  4PC1 A;  4OOX A;  4MYT A;  2ZZF A;  1HVX A;  3KEW A;  1JJ2 B;  4PAA A;  4E0F A;  1GAQ A;  3ZBU A;  2ZTN A;  4NNJ A;  5JBQ A;  2QGG A;  3CC4 B;  3LQ6 A;  5A8A A;  5DN6 A;  2NV4 A;  1RQP A;  2ZXH A;  1ELO A;  4AVZ A;  4XOT A;  1GO2 A;  3A3B A;  1BX0 A;  4UZE A;  2I1L A;  4TMV A;  3RY8 A;  1JNY A;  1KJZ A;  4XL9 A;  3OFN A;  4P1V A;  1PJ6 A;  2YWG A;  3QFS A;  4LBW A;  1N0V C;  4M2L A;  3W2H A;  3T51 B;  4KKU A;  1H42 A;  1R5N A;  3CCQ B;  3PEN A;  1MAB A;  3Q38 A;  1D2E A;  4Z4R A;  4OOS A;  1KK1 A;  1PJ7 A;  4YXW A;  2DET A;  2OBS A;  3WXM A;  1CQX A;  3CES A;  5BSX A;  2FVG A;  1M1K D;  1E3X A;  4B3X A;  2NPF A;  2V7W A;  3CPX A;  1G7C A;  1GR1 A;  3MMP A;  4XKW A;  3JQP A;  3KL9 A;  4ZCM A;  1V0E A;  2Q6I A;  4B47 A;  4B4D A;  1U2R A;  3R6K A;  3P27 A;  3BNW A;  3WY9 A;  5FNZ A;  5KW9 A;  1Q82 D;  2B5O A;  4QV2 A;  3QSY A;  4TT3 A;  3FJO A;  4XLA A;  4YEJ A;  2VZL A;  1VHE A;  4M0L A;  1KK2 A;  4X0C A;  4NCN A;  4YAW A;  3W5H A;  1FX0 A;  1ZM4 A;  1D1N A;  1EP2 B;  1N07 A;  1VQL B;  3SLD A;  1XE1 A;  4K1X A;  1EWY A;  3MHP A;  3PUM A;  1VHO A;  2P3M A;  2ZXI A;  4AF7 A;  3LVB A;  1S72 B;  2C78 A;  4ZV4 A;  4FN5 A;  2ZBU A;  3G05 A;  4WZL A;  1UD6 A;  2GPJ A;  3WBK A;  2ZL5 A;  4G1V A;  2V31 A;  1IHM A;  1H8E A;  2BM0 A;  4ASU A;  3CMA B;  2DOG A;  4KKS A;  2HMA A;  5HXB A;  1VQN B;  5THX A;  3GVL A;  4RD1 A;  1E64 A;  1Q86 D;  2WPD A;  4DQK A;  1GVH A;  3BY1 A;  1B2R A;  4XLC A;  2BGJ A;  1W35 A;  4XN3 A;  2QTL A; 
#chains in the Genus database with same CATH homology
 4M1K A;  2HCJ B;  1K8A D;  3LO8 A;  4B43 A;  2HDN B;  5H59 A;  3ZZ0 A;  4RD3 A;  1KRH A;  3V76 A;  2BN4 A;  2VYQ A;  5TV2 A;  2OTL B;  1YJN B;  1TUI A;  4QFM A;  4P3Y A;  1WDT A;  4YHB A;  2BSA A;  5H5J A;  2X3U A;  1QFZ A;  3ES9 A;  4U9U A;  1VQO B;  2OK8 A;  4M53 A;  4TMX A;  1TVC A;  1YI2 B;  3J81 k;  1FNB A;  1VQ7 B;  2ZIT A;  2RC6 A;  4LC0 A;  3CPW B;  1QUE A;  3AVW A;  2BV3 A;  3WBJ A;  2BF4 A;  1EFT A;  4B44 A;  1FNC A;  3AVU A;  4H9G A;  1S0U A;  4ZGQ B;  4Y9R A;  4YAL A;  3B8H A;  1TLL A;  4C0S A;  3CW2 A;  1R5O A;  1K73 D;  3G71 B;  2YWH A;  3WND A;  4PC6 A;  2QMU A;  2AHO A;  3AVT A;  1QX4 A;  1KK3 A;  3VO1 A;  2VNK A;  1QGZ A;  3CC2 B;  3OJW A;  3CCS B;  3CD6 B;  4ACB A;  3CB4 A;  3OZW A;  1OGJ A;  1VQ8 B;  4M4S A;  1YIJ B;  2E1R A;  4HE5 A;  3WYA A;  1Q81 D;  1FND A;  5TR9 A;  1GAW A;  5KSW B;  3ZZT A;  2D74 A;  1DDI A;  3AVV A;  4ACA A;  4RD4 A;  1EFC A;  1W2B B;  3AGP A;  4RCZ A;  1ZM3 A;  2QA4 B;  1VQP B;  3E1Y E;  3I1F A;  4TMW A;  4G5G A;  3U6B A;  3VNU A;  1OB5 A;  1EP1 B;  3OJX A;  4F7D A;  1VQ6 B;  2FX3 A;  4FWT A;  1VQ4 B;  1YJW B;  1ZUN B;  4TN1 A;  3CCR B;  1OB2 A;  4Y7C A;  4B48 A;  4R71 A;  1I7P A;  1EFU A;  2DY1 A;  3G4S B;  1YJ9 B;  3I56 B;  1QVG B;  2QDX A;  1BX1 A;  4PGO A;  2BM1 A;  3AGQ A;  1G7S A;  1IJE A;  3OW2 B;  3AVX A;  1NDH A;  2PIA A;  3U2Q A;  1FRN A;  1JB9 A;  4MYU A;  2BPO A;  4HE6 A;  3VNV A;  1E63 A;  3CC7 B;  4P6V F;  3AVY A;  3ZZU A;  2OTJ B;  1W34 A;  3B78 A;  2DEU A;  1N8R D;  4G1B A;  2PMD A;  2XNC A;  4LBZ A;  4J0Q A;  1R5B A;  2BVN A;  1EXM A;  2B7C A;  2BGI A;  4EH1 A;  2PLF A;  1EP3 B;  5GV8 A;  2R6H A;  3ZC3 A;  5AN9 A;  4RCY A;  4LBV A;  1N0U A;  3FPK A;  2BMW A;  2XNJ A;  4PC3 A;  2YWE A;  1NJI D;  4QHY A;  2DER A;  4YAF A;  4NBS A;  1JA1 A;  1G7R A;  1QFJ A;  1VQ5 B;  5TY0 A;  1BQE A;  4BPR A;  1QFY A;  3WNC A;  1CNF A;  3VMF A;  1OGI A;  4UAJ A;  2GQF A;  1KC8 D;  1D8T A;  1QGY A;  1AMO A;  5GV7 A;  3G6E B;  3QFT A;  3CCL B;  4N3G A;  1YIT B;  1XB2 A;  2XEX A;  1KD1 D;  3CCM B;  3OZU A;  3CRZ A;  3MCA A;  3JQQ A;  1G7T A;  1CNE A;  2CND A;  2VNH A;  5FA6 A;  1HA3 A;  3W2I A;  1FDR A;  1FRQ A;  4RD6 A;  1B23 P;  4LBY A;  2EIX A;  5DSZ A;  2QN6 A;  2VNJ A;  4PC2 A;  1DDG A;  5EMN A;  4AC9 A;  1E62 A;  3E20 A;  1A8P A;  1SKQ A;  4TMZ A;  3CCE B;  4Y9U A;  1IJF A;  1QGA A;  4IW3 B;  1KTV A;  4DQL A;  1H85 A;  3QE2 A;  1M90 D;  1AIP A;  1ZM2 A;  2B7B A;  1K9M D;  4N3N A;  1KQS B;  1YHQ B;  1BJK A;  1IB0 A;  3OZV A;  1QUF A;  2DCU A;  3W5U A;  1FNM A;  2C77 A;  1W87 A;  3SJZ A;  1QVF B;  3CXC B;  4WQM A;  4ZCI A;  4ZCL A;  4TMT A;  1F20 A;  2CRV A;  1F60 A;  3W2F A;  3W2G A;  1VQM B;  4RJL A;  3CCV B;  2VNI A;  2J7K A;  3QFC A;  3CME B;  4RD2 A;  4RD0 A;  4ZGN B;  3I55 B;  3CCU B;  1DAR A;  3VO2 A;  1DG1 G;  1QG0 A;  4YAU A;  4FK8 A;  3JQR A;  1Q7Y D;  4AF6 A;  2YWF A;  1TTT A;  2RC5 A;  1VQK B;  3P26 A;  3ZBT A;  2EFG A;  3B82 A;  2QEX B;  1UMK A;  3QFR A;  4Q7J B;  3CCJ B;  1VQ9 B;  1SM4 A;  3W2E A;  1ZM9 A;  3W5V A;  1QH0 A;  2QTZ A;  1J9Z A;  1JA0 A;  3U6K A;  2OK7 A;  4PC7 A;  4YAO A;  1GJR A;  1KK0 A;  3WNB A;  4C43 A;  4PC1 A;  4MYT A;  1JJ2 B;  1GAQ A;  3ZBU A;  5JBQ A;  3CC4 B;  1ELO A;  1GO2 A;  1BX0 A;  4TMV A;  1JNY A;  1KJZ A;  2YWG A;  3QFS A;  4LBW A;  1N0V C;  4M2L A;  3W2H A;  1H42 A;  1R5N A;  3CCQ B;  3PEN A;  1D2E A;  1KK1 A;  2DET A;  3WXM A;  1CQX A;  1M1K D;  4B3X A;  2NPF A;  1G7C A;  1GR1 A;  3MMP A;  3JQP A;  4ZCM A;  4B47 A;  4B4D A;  1U2R A;  3P27 A;  3WY9 A;  1Q82 D;  2B5O A;  3QSY A;  3FJO A;  2VZL A;  4M0L A;  1KK2 A;  4NCN A;  4YAW A;  3W5H A;  1ZM4 A;  1D1N A;  1EP2 B;  1VQL B;  1XE1 A;  4K1X A;  1EWY A;  3MHP A;  4AF7 A;  3LVB A;  1S72 B;  2C78 A;  4ZV4 A;  4FN5 A;  2GPJ A;  3WBK A;  4G1V A;  2BM0 A;  3CMA B;  2HMA A;  5HXB A;  1VQN B;  5THX A;  4RD1 A;  1E64 A;  1Q86 D;  4DQK A;  1GVH A;  1B2R A;  2BGJ A;  1W35 A;  2QTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...