4HE5A

Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
REFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase family U32
publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Unknown function
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he5A00
4NCNA 4M53A 3CCEB 1QGZA 4C43A 3FPKA 3AGPA 1QG0A 1VQOB 4R71A 3QFTA 2X3UA 4PC7A 3CC4B 3VO2A 4G5GA 1M1KD 2AHOA 2BGJA 5THXA 4YHBA 2DERA 1E63A 4TMWA 4Y7CA 4AF7A 4ZCLA 1N0VC 1VQMB 3B82A 3AVVA 5H59A 1AIPA 3CCSB 1VQ7B 3WYAA 3VO1A 4ZV4A 1SKQA 4TN1A 3WXMA 1JA1A 3I55B 3WNBA 1G7CA 1F60A 3P27A 4U9UA 4LBZA 1HA3A 3OJXA 4WQMA 1EWYA 1VQNB 1W87A 4PC1A 1IB0A 1QGAA 1GVHA 4AF6A 1TVCA 2VNHA 1D8TA 1W34A 1QFZA 1CQXA 1NJID 1BQEA 1IJEA 5GV8A 4AC9A 3ZC3A 4B44A 2BN4A 2GQFA 3FJOA 2PLFA 3LVBA 1GAWA 3E1YE 4UAJA 1GJRA 3ZBTA 1D2EA 4M2LA 2OK8A 4RJLA 1FDRA 1G7SA 1UMKA 4G1BA 2GPJA 1Q81D 4PC6A 2RC6A 1KK2A 2EFGA 4B4DA 1Q7YD 1Q82D 2YWEA 4LBVA 1BX1A 4H9GA 3OZVA 3WBJA 3VNVA 1YJ9B 1K9MD 2QTZA 1FNDA 4TMVA 1H42A 1TLLA 3B8HA 1OB5A 4RD2A 2HMAA 1VQKB 1XB2A 2NPFA 1M90D 3WNCA 1OGIA 2QN6A 4TMZA 3V76A 1G7TA 4Y9RA 2VNIA 2ZITA 4RD3A 2BGIA 3JQRA 1YHQB 2QEXB 1GAQA 1BJKA 1ZUNB 4NBSA 3P26A 3I1FA 4FN5A 3CW2A 4ZCMA 3OZUA 3ZBUA 2CRVA 1QUEA 1R5NA 2VNKA 3ES9A 3CPWB 1DDGA 5KSWB 5H5JA 3VNUA 4MYTA 3CC2B 1GR1A 1B2RA 3W2HA 1DG1G 2EIXA 2VNJA 2PMDA 1R5BA 2VZLA 5AN9A 4N3GA 1EP2B 2VYQA 3U6BA 1QUFA 1W2BB 1YIJB 3PENA 2BV3A 3CXCB 2XNCA 3WY9A 3CB4A 4J0QA 3JQPA 1KTVA 4B48A 3I56B 2BMWA 4TMXA 1J9ZA 3CCUB 4IW3B 2CNDA 1FRNA 2HCJB 1ELOA 3CCQB 4LC0A 2YWFA 1E64A 3AVTA 4F7DA 2BPOA 1B23P 4QFMA 2QTLA 3G4SB 2QDXA 2YWHA 1S0UA 2BVNA 3W2IA 1VQ8B 3E20A 3CCLB 3ZZUA 1ZM3A 1YJWB 1ZM2A 4PC3A 1N0UA 3QE2A 4G1VA 1NDHA 1EXMA 1DDIA 1KJZA 3W2FA 1VQPB 2FX3A 1FNMA 4Y9UA 1QVFB 3CMEB 2DCUA 2B7BA 3CRZA 1W35A 3CMAB 1VQ4B 3CD6B 3LO8A 1FRQA 5TY0A 4YAUA 4EH1A 1K73D 1FNBA 4RCZA 1JJ2B 1KQSB 1F20A 4RCYA 1VQ6B 2XNJA 2OTLB 2C77A 4B3XA 1TTTA 2BF4A 4YAOA 1EP1B 1KRHA 3MMPA 4LBYA 4ZGQB 1QH0A 2D74A 3J81k 1ZM9A 4MYUA 4ACAA 1R5OA 1IJFA 4QHYA 4YALA 4YAWA 4P6VF 1K8AD 4HE5A 1YI2B 3W5HA 2BM1A 3U2QA 3CCMB 1KC8D 1AMOA 4M0LA 3QSYA 1YITB 3W2GA 2B7CA 1EFCA 3W5UA 5JBQA 2BM0A 1SM4A 5EMNA 1XE1A 3G6EB 4N3NA 2YWGA 3VMFA 3WBKA 3U6KA 3AVUA 4ACBA 3QFCA 1QFYA 1VQLB 1KK1A 1JA0A 4B47A 4RD0A 4M4SA 1U2RA 1CNEA 1VQ5B 2J7KA 1KD1D 4RD1A 4YAFA 1A8PA 3OJWA 1TUIA 4ZGNB 1DARA 1EFUA 1VQ9B 2DY1A 1JNYA 4Q7JB 4ZCIA 2XEXA 4PC2A 4DQKA 4FWTA 1EP3B 4RD6A 3JQQA 3AVXA 3WNDA 4FK8A 1H85A 2DEUA 1S72B 1QFJA 4P3YA 5FA6A 3W5VA 3OZWA 2PIAA 3QFRA 3AVYA 1ZM4A 4TMTA 3CCJB 1WDTA 3MCAA 3B78A 4BPRA 3ZZTA 2QMUA 4DQLA 1E62A 2DETA 1Q86D 1OGJA 4K1XA 1EFTA 3MHPA 3W2EA 3QFSA 3ZZ0A 1KK0A 1N8RD 1JB9A 2R6HA 2E1RA 1CNFA 3G71B 1G7RA 2QA4B 4LBWA 3CC7B 1OB2A 1FNCA 1I7PA 2C78A 2BSAA 4HE6A 1D1NA 1GO2A 2HDNB 1YJNB 2OTJB 1QVGB 3SJZA 2RC5A 1QX4A 1QGYA 4M1KA 3CCRB 3AVWA 3AGQA 5TR9A 2OK7A 2B5OA 4B43A 4RD4A 1KK3A 1BX0A 5TV2A 5DSZA 5GV7A 3CCVB 3OW2B 5HXBA 4PGOA 4C0SA
chains in the Genus database with same CATH superfamily
4NCNA 4M53A 3CPXA 4UZEA 3CCEB 3GVLA 3ONUA 4XL9A 1QGZA 1E1RA 3OOCA 4RPDA 5F4JA 4C43A 1P4MA 3FPKA 4P2NA 4WZKA 3AGPA 2ZBUA 1QG0A 3BY2A 1VQOB 4R71A 1E79A 3QFTA 2X3UA 4PC7A 3CC4B 3HAGA 3VO2A 4G5GA 5TRDA 1M1KD 2AHOA 3OAAA 2WZPP 2BGJA 3ISXA 5HKKA 4QVJA 2XOKA 2HLDA 5THXA 4YHBA 2DERA 4RDLA 1RQRA 1VLOA 5FL7A 1E63A 3GVJA 4TKOB 4TMWA 1VJSA 3OFNA 4Y7CA 3T51B 4AF7A 1XQBA 1WOSA 5IYWA 4ZCLA 1N0VC 1VQMB 3B82A 4P12A 1VHOA 3AVVA 2X6XA 2X6WA 3CESA 5H59A 2C5BA 1AIPA 1WSRA 3CCSB 3OEEA 2P3MA 3BCFA 4P26A 2FVGA 4YELA 1VQ7B 4Z4YA 4HIZA 3WYAA 3VO1A 4ZV4A 1T6YA 3A3BA 1W0JA 5BSXA 1SKQA 1KMHA 4TN1A 3WXMA 1JA1A 3OW7A 3I55B 3PUMA 3WNBA 2JN9A 3NE5B 1G7CA 4B3GA 1MABA 1F60A 3P27A 4U9UA 4LBZA 4WZLA 2W6JA 1HA3A 3OJXA 3KL9A 3R6KA 2X0KA 4WQMA 1WOPA 2OYNA 1EWYA 1W87A 1XFOA 1PJ7A 1VQNB 4PC1A 2WYRA 1IB0A 1QGAA 1GVHA 4AF6A 1TVCA 2VNHA 1D8TA 2CBXA 1WORA 1W34A 2OBTA 4XR6A 4DK1A 1QFZA 4RLZA 3GQBA 1CQXA 2XNDA 4Z4UA 5A89A 5KW9A 1NJID 1BQEA 1IJEA 2E1BA 5GV8A 4AC9A 3Q38A 3ZC3A 4B44A 2BN4A 2GQFA 1WOOA 3FJOA 2DIEA 2PLFA 3LVBA 5IYPA 1UD8A 1S4MA 1GAWA 3E1YE 4UAJA 4C0SA 4KKSA 1IHMA 1VLYA 1GJRA 2Z6BD 4DK0A 3ZBTA 1Q9SA 1YLOA 2ZXHA 4XOTA 2Q6IA 1D2EA 4M2LA 2OK8A 1PKVA 3H9NA 4RJLA 1FDRA 1G7SA 1UMKA 4B3FX 4Z4ZA 5B6IA 2V7UA 4G1BA 2GPJA 2C5HA 3PVDA 4X07A 4PC6A 1Q81D 2RC6A 4X7FA 4Z1MA 4Z4VA 5FO0A 2C4TA 1KK2A 2EFGA 4B4DA 1Q7YD 1Q82D 2YWEA 2V7VA 1N07A 4LBVA 1BX1A 1OHHA 4H9GA 3OZVA 2GJPA 3WBJA 2VBVA 4OPVA 3VNVA 1T5EA 1YJ9B 5A88A 1K9MD 2QTZA 1FNDA 1YX2A 1WP6A 3PA2A 1WPCA 3Q39A 4TMVA 1UD6A 4TSFA 1H42A 1TLLA 3ASQA 4ASUA 3BC9A 3B8HA 1OB5A 2OBSA 4RD2A 1BMFA 2HMAA 4FXUA 1VQKB 1XB2A 2NPFA 2WPDA 1M90D 1WSVA 2X53S 3WNCA 1OGIA 2QN6A 3FKSA 4TMZA 4X06A 3V76A 1G7TA 4Y9RA 2C2WA 3SLNA 2VNIA 2ZITA 4RD3A 2BGIA 3JQRA 1YHQB 1Y0RA 2QEXB 1GAQA 3V7AA 1BJKA 1ZUNB 5KNLA 5IYRA 2XZOA 4NBSA 1PJ5A 3P26A 3I1FA 4FN5A 1EFRA 3CW2A 2VJJA 4ZCMA 3OZUA 3ZBUA 3SLDA 2CRVA 1QUEA 1FX0A 1R5NA 2R9VA 3BCDA 2ZL7A 2VNKA 3ES9A 3CPWB 3OKXA 2D3LA 4II3A 1DDGA 5KSWB 5H5JA 1HVXA 1UD5A 4MYTA 3VNUA 3CC2B 1GR1A 3BY1A 5LMZA 1B2RA 3W2HA 3ZIAA 1DG1G 2EIXA 2VNJA 2PMDA 1BPLA 4KKUA 2GK6A 3D26A 3CP8A 1R5BA 4Z4SA 2VZLA 5AN9A 4N3GA 3VR6A 1EP2B 1UD2A 2VYQA 4X7CA 3U6BA 1QUFA 1W2BB 2ZZGA 2QE7A 1YIJB 1N08A 2JJ2A 3ASSA 3PENA 2BV3A 2F4NA 3R6JA 4WWVA 3BH4A 3CXCB 2XNCA 2DYIA 3CB4A 4XOPA 3WY9A 4J0QA 4II2A 4NNJA 3JQPA 1KTVA 2V7TA 4L8JA 4B48A 1E43A 3I56B 2BMWA 4TMXA 3Q6QA 1J9ZA 3CCUB 5E6TA 4IW3B 4CQJA 5J35A 2CNDA 1FRNA 2HCJB 1ELOA 3CCQB 1UD3A 2QGGA 2ZL5A 4LC0A 2YWFA 1MRZA 1WTHD 1E64A 4DNTB 3AVTA 4F7DA 2BPOA 1B23P 3PUNA 4QFMA 3GIRA 1K28D 4JMQA 4XKVA 4WZTA 3CMMA 2QTLA 2F1MA 3G4SB 2QDXA 4OOVA 2YWHA 5FNZA 1S0UA 4XMYA 1UD4A 2BVNA 2D3NA 1H8HA 2Q6OA 3BNWA 3W2IA 1V0EA 1VQ8B 4P9SA 4UZUA 4XLHA 2VBUA 1SKYB 4P3IA 3E20A 4XQFA 3CTAA 3H94A 3CCLB 3ZUGA 3ZZUA 1ZM3A 3KEWA 3SEJA 4X0CA 1YJWB 2GJRA 1ZM2A 4PC3A 1N0UA 3QE2A 4G1VA 2CK3A 1NDHA 1EXMA 2ZBVA 3SKBA 1DDIA 1KJZA 4WZEA 3W2FA 1VQPB 2FX3A 1Y0YA 1FNMA 3BQJA 4Y9UA 1QVFB 3CMEB 2DCUA 2B7BA 2ZXIA 3LQ6A 4XLCA 3CRZA 1W35A 3CMAB 1RQPA 1VQ4B 2OBRA 4QV2A 3ASTA 3CD6B 2KVOA 3LO8A 1FRQA 5TY0A 4YAUA 4EH1A 1K73D 3Q6RA 1FNBA 4YXWA 4X8IA 2ZTNA 4RCZA 1JJ2B 3OP1A 1KQSB 1F20A 4RCYA 1VQ6B 1W0KA 2XNJA 2OTLB 2C77A 2GJKA 4B3XA 3DDYA 1TTTA 4P25A 4QVAA 1N05A 2BF4A 3LNNA 2CW5A 4XLFA 4YAOA 1EP1B 1KRHA 3MMPA 4LBYA 2WJYA 1QH0A 2D74A 4RPBA 4ZGQB 3J81k 1WU8A 3T56B 1ZM9A 4GQNA 4MYUA 1VHEA 4OP7A 1I18A 5FIUA 2ZTGA 4ACAA 1R5OA 5IK2A 1NRKA 1W9XA 1IJFA 4QHYA 4YALA 1T6XA 4RDJA 4YAWA 4P6VF 1K8AD 4HE5A 2W6IA 2WJVA 1YI2B 2CC2A 2ZL6A 3A3GA 3W5HA 3GVKA 5J3OA 4PAAA 2CF4A 1NB0A 2WZNA 2BM1A 3A1PA 5F4MA 3U2QA 3CCMB 5HZAA 1KC8D 2VBSA 2D9RA 1AMOA 4M0LA 4X7EA 2M5SA 3QSYA 1YITB 4G6IA 3CP2A 3W2GA 5DN6A 3A8IA 2B7CA 5CDFA 1EFCA 4TT3A 3W5UA 5JBQA 4P22A 2BM0A 1V0FA 2V31A 4RDKA 4QUZA 4E0FA 2X8KA 3G05A 1SM4A 5EMNA 1XE1A 3WQZA 3RY8A 2X85A 3G6EB 4N3NA 2YWGA 2VJIA 3VMFA 3WBKA 3U6KA 2GK7A 3A35A 4Z4WA 4P1VA 1NB9A 3AVUA 4XM3A 4ACBA 3QFCA 1QFYA 4XORA 4DNRB 1VQLB 4XN0A 1KK1A 1NBMA 3ASRA 4Z4RA 1JA0A 1BLIA 3OEHA 3Q3AA 4B47A 4RD0A 4M4SA 1U2RA 2XZPA 4P6YA 4YEJA 1CNEA 1VQ5B 2J7KA 4XN3A 5A8AA 1KD1D 2GREA 4G7XA 4XD7A 4RD1A 5F4OA 2JIZA 4YAFA 1A8PA 3OJWA 2F43A 3A8KA 1TUIA 4XNFA 4ZGNB 1DARA 1E3ZA 1EFUA 1VQ9B 2WR8A 1VF7A 2DY1A 3ASPA 1JNYA 4Q7JB 4ZCIA 2XEXA 4PC2A 2Q6KA 1OB0A 4DQKA 4XKWA 2X6YA 3ONYA 4FWTA 4OPOA 1EP3B 4RD6A 2JJ1A 3JQQA 4OOSA 3AVXA 3WNDA 4FK8A 2XZLA 3T53B 1HZEA 3GSIA 1H85A 4OOXA 2DEUA 1S72B 1QFJA 4P3YA 5FA6A 3W5VA 3OZWA 4X05A 2PIAA 3QFRA 5IYNA 3AVYA 1COWA 1V5VA 4PABA 2WSSA 3OPOA 2LZJA 1ZM4A 4TMTA 1E3XA 3CCJB 1WDTA 3MCAA 3JU4A 1N06A 2C4UA 3B78A 3ZZTA 4KKTA 4BPRA 2QMUA 4DQLA 1E62A 2DETA 1Q86D 1H8EA 1OGJA 4K1XA 5FO1A 1EFTA 4RM0A 3MHPA 2ZZQA 4X7DA 2XGJA 2PE3A 3PA1A 3W2EA 5BSYA 5HZBA 3QFSA 2DOGA 3ZZ0A 1KK0A 1N8RD 1JB9A 2R6HA 2E1RA 1CNFA 3G71B 1G7RA 2NV4A 2Q6LA 4OPSA 2QA4B 4XONA 2I1LA 4LBWA 3CC7B 1OB2A 1FNCA 1I7PA 2C78A 2BSAA 4HE6A 4Z4TA 1D1NA 2F1LA 1GO2A 1PJ6A 2HDNB 1YJNB 2OTJB 2V7XA 5DS0A 1QVGB 3SJZA 5L46A 2RC5A 1QX4A 1QGYA 2VBTA 2V7QA 4M1KA 3CCRB 4XLEA 3AVWA 2ZZEA 3AGQA 2ZZFA 3SJPA 3A8JA 2OK7A 2B5OA 5TR9A 4B43A 4RD4A 4AVZA 1KK3A 1BX0A 2V4DA 4G7WA 2V7WA 5TV2A 4XLAA 5DSZA 4ROXA 1T6ZA 5GV7A 2JDIA 5IYQA 3CCVB 3OW2B 3OE7A 1I8DA 4UZFA 3FPPA 5HXBA 1E1QA 4PGOA 3ZPNA 1KZLA 3LQEA
chains in the Genus database with same CATH topology
4NCNA 4M53A 3CCEB 1QGZA 4C43A 3FPKA 3AGPA 1QG0A 1VQOB 4R71A 3QFTA 2X3UA 4PC7A 3CC4B 3VO2A 4G5GA 1M1KD 2AHOA 2BGJA 5THXA 4YHBA 2DERA 1E63A 4TMWA 4Y7CA 4AF7A 4ZCLA 1N0VC 1VQMB 3B82A 3AVVA 5H59A 1AIPA 3CCSB 1VQ7B 3WYAA 3VO1A 4ZV4A 1SKQA 4TN1A 3WXMA 1JA1A 3I55B 3WNBA 1G7CA 1F60A 3P27A 4U9UA 4LBZA 1HA3A 3OJXA 4WQMA 1EWYA 1VQNB 1W87A 4PC1A 1IB0A 1QGAA 1GVHA 4AF6A 1TVCA 2VNHA 1D8TA 1W34A 1QFZA 1CQXA 1NJID 1BQEA 1IJEA 5GV8A 4AC9A 3ZC3A 4B44A 2BN4A 2GQFA 3FJOA 2PLFA 3LVBA 1GAWA 3E1YE 4UAJA 1GJRA 3ZBTA 1D2EA 4M2LA 2OK8A 4RJLA 1FDRA 1G7SA 1UMKA 4G1BA 2GPJA 1Q81D 4PC6A 2RC6A 1KK2A 2EFGA 4B4DA 1Q7YD 1Q82D 2YWEA 4LBVA 1BX1A 4H9GA 3OZVA 3WBJA 3VNVA 1YJ9B 1K9MD 2QTZA 1FNDA 4TMVA 1H42A 1TLLA 3B8HA 1OB5A 4RD2A 2HMAA 1VQKB 1XB2A 2NPFA 1M90D 3WNCA 1OGIA 2QN6A 4TMZA 3V76A 1G7TA 4Y9RA 2VNIA 2ZITA 4RD3A 2BGIA 3JQRA 1YHQB 2QEXB 1GAQA 1BJKA 1ZUNB 4NBSA 3P26A 3I1FA 4FN5A 3CW2A 4ZCMA 3OZUA 3ZBUA 2CRVA 1QUEA 1R5NA 2VNKA 3ES9A 3CPWB 1DDGA 5KSWB 5H5JA 3VNUA 4MYTA 3CC2B 1GR1A 1B2RA 3W2HA 1DG1G 2EIXA 2VNJA 2PMDA 1R5BA 2VZLA 5AN9A 4N3GA 1EP2B 2VYQA 3U6BA 1QUFA 1W2BB 1YIJB 3PENA 2BV3A 3CXCB 2XNCA 3WY9A 3CB4A 4J0QA 3JQPA 1KTVA 4B48A 3I56B 2BMWA 4TMXA 1J9ZA 3CCUB 4IW3B 2CNDA 1FRNA 2HCJB 1ELOA 3CCQB 4LC0A 2YWFA 1E64A 3AVTA 4F7DA 2BPOA 1B23P 4QFMA 2QTLA 3G4SB 2QDXA 2YWHA 1S0UA 2BVNA 3W2IA 1VQ8B 3E20A 3CCLB 3ZZUA 1ZM3A 1YJWB 1ZM2A 4PC3A 1N0UA 3QE2A 4G1VA 1NDHA 1EXMA 1DDIA 1KJZA 3W2FA 1VQPB 2FX3A 1FNMA 4Y9UA 1QVFB 3CMEB 2DCUA 2B7BA 3CRZA 1W35A 3CMAB 1VQ4B 3CD6B 3LO8A 1FRQA 5TY0A 4YAUA 4EH1A 1K73D 1FNBA 4RCZA 1JJ2B 1KQSB 1F20A 4RCYA 1VQ6B 2XNJA 2OTLB 2C77A 4B3XA 1TTTA 2BF4A 4YAOA 1EP1B 1KRHA 3MMPA 4LBYA 4ZGQB 1QH0A 2D74A 3J81k 1ZM9A 4MYUA 4ACAA 1R5OA 1IJFA 4QHYA 4YALA 4YAWA 4P6VF 1K8AD 4HE5A 1YI2B 3W5HA 2BM1A 3U2QA 3CCMB 1KC8D 1AMOA 4M0LA 3QSYA 1YITB 3W2GA 2B7CA 1EFCA 3W5UA 5JBQA 2BM0A 1SM4A 5EMNA 1XE1A 3G6EB 4N3NA 2YWGA 3VMFA 3WBKA 3U6KA 3AVUA 4ACBA 3QFCA 1QFYA 1VQLB 1KK1A 1JA0A 4B47A 4RD0A 4M4SA 1U2RA 1CNEA 1VQ5B 2J7KA 1KD1D 4RD1A 4YAFA 1A8PA 3OJWA 1TUIA 4ZGNB 1DARA 1EFUA 1VQ9B 2DY1A 1JNYA 4Q7JB 4ZCIA 2XEXA 4PC2A 4DQKA 4FWTA 1EP3B 4RD6A 3JQQA 3AVXA 3WNDA 4FK8A 1H85A 2DEUA 1S72B 1QFJA 4P3YA 5FA6A 3W5VA 3OZWA 2PIAA 3QFRA 3AVYA 1ZM4A 4TMTA 3CCJB 1WDTA 3MCAA 3B78A 4BPRA 3ZZTA 2QMUA 4DQLA 1E62A 2DETA 1Q86D 1OGJA 4K1XA 1EFTA 3MHPA 3W2EA 3QFSA 3ZZ0A 1KK0A 1N8RD 1JB9A 2R6HA 2E1RA 1CNFA 3G71B 1G7RA 2QA4B 4LBWA 3CC7B 1OB2A 1FNCA 1I7PA 2C78A 2BSAA 4HE6A 1D1NA 1GO2A 2HDNB 1YJNB 2OTJB 1QVGB 3SJZA 2RC5A 1QX4A 1QGYA 4M1KA 3CCRB 3AVWA 3AGQA 5TR9A 2OK7A 2B5OA 4B43A 4RD4A 1KK3A 1BX0A 5TV2A 5DSZA 5GV7A 3CCVB 3OW2B 5HXBA 4PGOA 4C0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCN A;  4M53 A;  3CCE B;  1QGZ A;  4C43 A;  3FPK A;  3AGP A;  1QG0 A;  1VQO B;  4R71 A;  3QFT A;  2X3U A;  4PC7 A;  3CC4 B;  3VO2 A;  4G5G A;  1M1K D;  2AHO A;  2BGJ A;  5THX A;  4YHB A;  2DER A;  1E63 A;  4TMW A;  4Y7C A;  4AF7 A;  4ZCL A;  1N0V C;  1VQM B;  3B82 A;  3AVV A;  5H59 A;  1AIP A;  3CCS B;  1VQ7 B;  3WYA A;  3VO1 A;  4ZV4 A;  1SKQ A;  4TN1 A;  3WXM A;  1JA1 A;  3I55 B;  3WNB A;  1G7C A;  1F60 A;  3P27 A;  4U9U A;  4LBZ A;  1HA3 A;  3OJX A;  4WQM A;  1EWY A;  1VQN B;  1W87 A;  4PC1 A;  1IB0 A;  1QGA A;  1GVH A;  4AF6 A;  1TVC A;  2VNH A;  1D8T A;  1W34 A;  1QFZ A;  1CQX A;  1NJI D;  1BQE A;  1IJE A;  5GV8 A;  4AC9 A;  3ZC3 A;  4B44 A;  2BN4 A;  2GQF A;  3FJO A;  2PLF A;  3LVB A;  1GAW A;  3E1Y E;  4UAJ A;  1GJR A;  3ZBT A;  1D2E A;  4M2L A;  2OK8 A;  4RJL A;  1FDR A;  1G7S A;  1UMK A;  4G1B A;  2GPJ A;  1Q81 D;  4PC6 A;  2RC6 A;  1KK2 A;  2EFG A;  4B4D A;  1Q7Y D;  1Q82 D;  2YWE A;  4LBV A;  1BX1 A;  4H9G A;  3OZV A;  3WBJ A;  3VNV A;  1YJ9 B;  1K9M D;  2QTZ A;  1FND A;  4TMV A;  1H42 A;  1TLL A;  3B8H A;  1OB5 A;  4RD2 A;  2HMA A;  1VQK B;  1XB2 A;  2NPF A;  1M90 D;  3WNC A;  1OGI A;  2QN6 A;  4TMZ A;  3V76 A;  1G7T A;  4Y9R A;  2VNI A;  2ZIT A;  4RD3 A;  2BGI A;  3JQR A;  1YHQ B;  2QEX B;  1GAQ A;  1BJK A;  1ZUN B;  4NBS A;  3P26 A;  3I1F A;  4FN5 A;  3CW2 A;  4ZCM A;  3OZU A;  3ZBU A;  2CRV A;  1QUE A;  1R5N A;  2VNK A;  3ES9 A;  3CPW B;  1DDG A;  5KSW B;  5H5J A;  3VNU A;  4MYT A;  3CC2 B;  1GR1 A;  1B2R A;  3W2H A;  1DG1 G;  2EIX A;  2VNJ A;  2PMD A;  1R5B A;  2VZL A;  5AN9 A;  4N3G A;  1EP2 B;  2VYQ A;  3U6B A;  1QUF A;  1W2B B;  1YIJ B;  3PEN A;  2BV3 A;  3CXC B;  2XNC A;  3WY9 A;  3CB4 A;  4J0Q A;  3JQP A;  1KTV A;  4B48 A;  3I56 B;  2BMW A;  4TMX A;  1J9Z A;  3CCU B;  4IW3 B;  2CND A;  1FRN A;  2HCJ B;  1ELO A;  3CCQ B;  4LC0 A;  2YWF A;  1E64 A;  3AVT A;  4F7D A;  2BPO A;  1B23 P;  4QFM A;  2QTL A;  3G4S B;  2QDX A;  2YWH A;  1S0U A;  2BVN A;  3W2I A;  1VQ8 B;  3E20 A;  3CCL B;  3ZZU A;  1ZM3 A;  1YJW B;  1ZM2 A;  4PC3 A;  1N0U A;  3QE2 A;  4G1V A;  1NDH A;  1EXM A;  1DDI A;  1KJZ A;  3W2F A;  1VQP B;  2FX3 A;  1FNM A;  4Y9U A;  1QVF B;  3CME B;  2DCU A;  2B7B A;  3CRZ A;  1W35 A;  3CMA B;  1VQ4 B;  3CD6 B;  3LO8 A;  1FRQ A;  5TY0 A;  4YAU A;  4EH1 A;  1K73 D;  1FNB A;  4RCZ A;  1JJ2 B;  1KQS B;  1F20 A;  4RCY A;  1VQ6 B;  2XNJ A;  2OTL B;  2C77 A;  4B3X A;  1TTT A;  2BF4 A;  4YAO A;  1EP1 B;  1KRH A;  3MMP A;  4LBY A;  4ZGQ B;  1QH0 A;  2D74 A;  3J81 k;  1ZM9 A;  4MYU A;  4ACA A;  1R5O A;  1IJF A;  4QHY A;  4YAL A;  4YAW A;  4P6V F;  1K8A D;  4HE5 A;  1YI2 B;  3W5H A;  2BM1 A;  3U2Q A;  3CCM B;  1KC8 D;  1AMO A;  4M0L A;  3QSY A;  1YIT B;  3W2G A;  2B7C A;  1EFC A;  3W5U A;  5JBQ A;  2BM0 A;  1SM4 A;  5EMN A;  1XE1 A;  3G6E B;  4N3N A;  2YWG A;  3VMF A;  3WBK A;  3U6K A;  3AVU A;  4ACB A;  3QFC A;  1QFY A;  1VQL B;  1KK1 A;  1JA0 A;  4B47 A;  4RD0 A;  4M4S A;  1U2R A;  1CNE A;  1VQ5 B;  2J7K A;  1KD1 D;  4RD1 A;  4YAF A;  1A8P A;  3OJW A;  1TUI A;  4ZGN B;  1DAR A;  1EFU A;  1VQ9 B;  2DY1 A;  1JNY A;  4Q7J B;  4ZCI A;  2XEX A;  4PC2 A;  4DQK A;  4FWT A;  1EP3 B;  4RD6 A;  3JQQ A;  3AVX A;  3WND A;  4FK8 A;  1H85 A;  2DEU A;  1S72 B;  1QFJ A;  4P3Y A;  5FA6 A;  3W5V A;  3OZW A;  2PIA A;  3QFR A;  3AVY A;  1ZM4 A;  4TMT A;  3CCJ B;  1WDT A;  3MCA A;  3B78 A;  4BPR A;  3ZZT A;  2QMU A;  4DQL A;  1E62 A;  2DET A;  1Q86 D;  1OGJ A;  4K1X A;  1EFT A;  3MHP A;  3W2E A;  3QFS A;  3ZZ0 A;  1KK0 A;  1N8R D;  1JB9 A;  2R6H A;  2E1R A;  1CNF A;  3G71 B;  1G7R A;  2QA4 B;  4LBW A;  3CC7 B;  1OB2 A;  1FNC A;  1I7P A;  2C78 A;  2BSA A;  4HE6 A;  1D1N A;  1GO2 A;  2HDN B;  1YJN B;  2OTJ B;  1QVG B;  3SJZ A;  2RC5 A;  1QX4 A;  1QGY A;  4M1K A;  3CCR B;  3AVW A;  3AGQ A;  5TR9 A;  2OK7 A;  2B5O A;  4B43 A;  4RD4 A;  1KK3 A;  1BX0 A;  5TV2 A;  5DSZ A;  5GV7 A;  3CCV B;  3OW2 B;  5HXB A;  4PGO A;  4C0S A; 
#chains in the Genus database with same CATH topology
 4NCN A;  4M53 A;  3CPX A;  4UZE A;  3CCE B;  3GVL A;  3ONU A;  4XL9 A;  1QGZ A;  1E1R A;  3OOC A;  4RPD A;  5F4J A;  4C43 A;  1P4M A;  3FPK A;  4P2N A;  4WZK A;  3AGP A;  2ZBU A;  1QG0 A;  3BY2 A;  1VQO B;  4R71 A;  1E79 A;  3QFT A;  2X3U A;  4PC7 A;  3CC4 B;  3HAG A;  3VO2 A;  4G5G A;  5TRD A;  1M1K D;  2AHO A;  3OAA A;  2WZP P;  2BGJ A;  3ISX A;  5HKK A;  4QVJ A;  2XOK A;  2HLD A;  5THX A;  4YHB A;  2DER A;  4RDL A;  1RQR A;  1VLO A;  5FL7 A;  1E63 A;  3GVJ A;  4TKO B;  4TMW A;  1VJS A;  3OFN A;  4Y7C A;  3T51 B;  4AF7 A;  1XQB A;  1WOS A;  5IYW A;  4ZCL A;  1N0V C;  1VQM B;  3B82 A;  4P12 A;  1VHO A;  3AVV A;  2X6X A;  2X6W A;  3CES A;  5H59 A;  2C5B A;  1AIP A;  1WSR A;  3CCS B;  3OEE A;  2P3M A;  3BCF A;  4P26 A;  2FVG A;  4YEL A;  1VQ7 B;  4Z4Y A;  4HIZ A;  3WYA A;  3VO1 A;  4ZV4 A;  1T6Y A;  3A3B A;  1W0J A;  5BSX A;  1SKQ A;  1KMH A;  4TN1 A;  3WXM A;  1JA1 A;  3OW7 A;  3I55 B;  3PUM A;  3WNB A;  2JN9 A;  3NE5 B;  1G7C A;  4B3G A;  1MAB A;  1F60 A;  3P27 A;  4U9U A;  4LBZ A;  4WZL A;  2W6J A;  1HA3 A;  3OJX A;  3KL9 A;  3R6K A;  2X0K A;  4WQM A;  1WOP A;  2OYN A;  1EWY A;  1W87 A;  1XFO A;  1PJ7 A;  1VQN B;  4PC1 A;  2WYR A;  1IB0 A;  1QGA A;  1GVH A;  4AF6 A;  1TVC A;  2VNH A;  1D8T A;  2CBX A;  1WOR A;  1W34 A;  2OBT A;  4XR6 A;  4DK1 A;  1QFZ A;  4RLZ A;  3GQB A;  1CQX A;  2XND A;  4Z4U A;  5A89 A;  5KW9 A;  1NJI D;  1BQE A;  1IJE A;  2E1B A;  5GV8 A;  4AC9 A;  3Q38 A;  3ZC3 A;  4B44 A;  2BN4 A;  2GQF A;  1WOO A;  3FJO A;  2DIE A;  2PLF A;  3LVB A;  5IYP A;  1UD8 A;  1S4M A;  1GAW A;  3E1Y E;  4UAJ A;  4C0S A;  4KKS A;  1IHM A;  1VLY A;  1GJR A;  2Z6B D;  4DK0 A;  3ZBT A;  1Q9S A;  1YLO A;  2ZXH A;  4XOT A;  2Q6I A;  1D2E A;  4M2L A;  2OK8 A;  1PKV A;  3H9N A;  4RJL A;  1FDR A;  1G7S A;  1UMK A;  4B3F X;  4Z4Z A;  5B6I A;  2V7U A;  4G1B A;  2GPJ A;  2C5H A;  3PVD A;  4X07 A;  4PC6 A;  1Q81 D;  2RC6 A;  4X7F A;  4Z1M A;  4Z4V A;  5FO0 A;  2C4T A;  1KK2 A;  2EFG A;  4B4D A;  1Q7Y D;  1Q82 D;  2YWE A;  2V7V A;  1N07 A;  4LBV A;  1BX1 A;  1OHH A;  4H9G A;  3OZV A;  2GJP A;  3WBJ A;  2VBV A;  4OPV A;  3VNV A;  1T5E A;  1YJ9 B;  5A88 A;  1K9M D;  2QTZ A;  1FND A;  1YX2 A;  1WP6 A;  3PA2 A;  1WPC A;  3Q39 A;  4TMV A;  1UD6 A;  4TSF A;  1H42 A;  1TLL A;  3ASQ A;  4ASU A;  3BC9 A;  3B8H A;  1OB5 A;  2OBS A;  4RD2 A;  1BMF A;  2HMA A;  4FXU A;  1VQK B;  1XB2 A;  2NPF A;  2WPD A;  1M90 D;  1WSV A;  2X53 S;  3WNC A;  1OGI A;  2QN6 A;  3FKS A;  4TMZ A;  4X06 A;  3V76 A;  1G7T A;  4Y9R A;  2C2W A;  3SLN A;  2VNI A;  2ZIT A;  4RD3 A;  2BGI A;  3JQR A;  1YHQ B;  1Y0R A;  2QEX B;  1GAQ A;  3V7A A;  1BJK A;  1ZUN B;  5KNL A;  5IYR A;  2XZO A;  4NBS A;  1PJ5 A;  3P26 A;  3I1F A;  4FN5 A;  1EFR A;  3CW2 A;  2VJJ A;  4ZCM A;  3OZU A;  3ZBU A;  3SLD A;  2CRV A;  1QUE A;  1FX0 A;  1R5N A;  2R9V A;  3BCD A;  2ZL7 A;  2VNK A;  3ES9 A;  3CPW B;  3OKX A;  2D3L A;  4II3 A;  1DDG A;  5KSW B;  5H5J A;  1HVX A;  1UD5 A;  4MYT A;  3VNU A;  3CC2 B;  1GR1 A;  3BY1 A;  5LMZ A;  1B2R A;  3W2H A;  3ZIA A;  1DG1 G;  2EIX A;  2VNJ A;  2PMD A;  1BPL A;  4KKU A;  2GK6 A;  3D26 A;  3CP8 A;  1R5B A;  4Z4S A;  2VZL A;  5AN9 A;  4N3G A;  3VR6 A;  1EP2 B;  1UD2 A;  2VYQ A;  4X7C A;  3U6B A;  1QUF A;  1W2B B;  2ZZG A;  2QE7 A;  1YIJ B;  1N08 A;  2JJ2 A;  3ASS A;  3PEN A;  2BV3 A;  2F4N A;  3R6J A;  4WWV A;  3BH4 A;  3CXC B;  2XNC A;  2DYI A;  3CB4 A;  4XOP A;  3WY9 A;  4J0Q A;  4II2 A;  4NNJ A;  3JQP A;  1KTV A;  2V7T A;  4L8J A;  4B48 A;  1E43 A;  3I56 B;  2BMW A;  4TMX A;  3Q6Q A;  1J9Z A;  3CCU B;  5E6T A;  4IW3 B;  4CQJ A;  5J35 A;  2CND A;  1FRN A;  2HCJ B;  1ELO A;  3CCQ B;  1UD3 A;  2QGG A;  2ZL5 A;  4LC0 A;  2YWF A;  1MRZ A;  1WTH D;  1E64 A;  4DNT B;  3AVT A;  4F7D A;  2BPO A;  1B23 P;  3PUN A;  4QFM A;  3GIR A;  1K28 D;  4JMQ A;  4XKV A;  4WZT A;  3CMM A;  2QTL A;  2F1M A;  3G4S B;  2QDX A;  4OOV A;  2YWH A;  5FNZ A;  1S0U A;  4XMY A;  1UD4 A;  2BVN A;  2D3N A;  1H8H A;  2Q6O A;  3BNW A;  3W2I A;  1V0E A;  1VQ8 B;  4P9S A;  4UZU A;  4XLH A;  2VBU A;  1SKY B;  4P3I A;  3E20 A;  4XQF A;  3CTA A;  3H94 A;  3CCL B;  3ZUG A;  3ZZU A;  1ZM3 A;  3KEW A;  3SEJ A;  4X0C A;  1YJW B;  2GJR A;  1ZM2 A;  4PC3 A;  1N0U A;  3QE2 A;  4G1V A;  2CK3 A;  1NDH A;  1EXM A;  2ZBV A;  3SKB A;  1DDI A;  1KJZ A;  4WZE A;  3W2F A;  1VQP B;  2FX3 A;  1Y0Y A;  1FNM A;  3BQJ A;  4Y9U A;  1QVF B;  3CME B;  2DCU A;  2B7B A;  2ZXI A;  3LQ6 A;  4XLC A;  3CRZ A;  1W35 A;  3CMA B;  1RQP A;  1VQ4 B;  2OBR A;  4QV2 A;  3AST A;  3CD6 B;  2KVO A;  3LO8 A;  1FRQ A;  5TY0 A;  4YAU A;  4EH1 A;  1K73 D;  3Q6R A;  1FNB A;  4YXW A;  4X8I A;  2ZTN A;  4RCZ A;  1JJ2 B;  3OP1 A;  1KQS B;  1F20 A;  4RCY A;  1VQ6 B;  1W0K A;  2XNJ A;  2OTL B;  2C77 A;  2GJK A;  4B3X A;  3DDY A;  1TTT A;  4P25 A;  4QVA A;  1N05 A;  2BF4 A;  3LNN A;  2CW5 A;  4XLF A;  4YAO A;  1EP1 B;  1KRH A;  3MMP A;  4LBY A;  2WJY A;  1QH0 A;  2D74 A;  4RPB A;  4ZGQ B;  3J81 k;  1WU8 A;  3T56 B;  1ZM9 A;  4GQN A;  4MYU A;  1VHE A;  4OP7 A;  1I18 A;  5FIU A;  2ZTG A;  4ACA A;  1R5O A;  5IK2 A;  1NRK A;  1W9X A;  1IJF A;  4QHY A;  4YAL A;  1T6X A;  4RDJ A;  4YAW A;  4P6V F;  1K8A D;  4HE5 A;  2W6I A;  2WJV A;  1YI2 B;  2CC2 A;  2ZL6 A;  3A3G A;  3W5H A;  3GVK A;  5J3O A;  4PAA A;  2CF4 A;  1NB0 A;  2WZN A;  2BM1 A;  3A1P A;  5F4M A;  3U2Q A;  3CCM B;  5HZA A;  1KC8 D;  2VBS A;  2D9R A;  1AMO A;  4M0L A;  4X7E A;  2M5S A;  3QSY A;  1YIT B;  4G6I A;  3CP2 A;  3W2G A;  5DN6 A;  3A8I A;  2B7C A;  5CDF A;  1EFC A;  4TT3 A;  3W5U A;  5JBQ A;  4P22 A;  2BM0 A;  1V0F A;  2V31 A;  4RDK A;  4QUZ A;  4E0F A;  2X8K A;  3G05 A;  1SM4 A;  5EMN A;  1XE1 A;  3WQZ A;  3RY8 A;  2X85 A;  3G6E B;  4N3N A;  2YWG A;  2VJI A;  3VMF A;  3WBK A;  3U6K A;  2GK7 A;  3A35 A;  4Z4W A;  4P1V A;  1NB9 A;  3AVU A;  4XM3 A;  4ACB A;  3QFC A;  1QFY A;  4XOR A;  4DNR B;  1VQL B;  4XN0 A;  1KK1 A;  1NBM A;  3ASR A;  4Z4R A;  1JA0 A;  1BLI A;  3OEH A;  3Q3A A;  4B47 A;  4RD0 A;  4M4S A;  1U2R A;  2XZP A;  4P6Y A;  4YEJ A;  1CNE A;  1VQ5 B;  2J7K A;  4XN3 A;  5A8A A;  1KD1 D;  2GRE A;  4G7X A;  4XD7 A;  4RD1 A;  5F4O A;  2JIZ A;  4YAF A;  1A8P A;  3OJW A;  2F43 A;  3A8K A;  1TUI A;  4XNF A;  4ZGN B;  1DAR A;  1E3Z A;  1EFU A;  1VQ9 B;  2WR8 A;  1VF7 A;  2DY1 A;  3ASP A;  1JNY A;  4Q7J B;  4ZCI A;  2XEX A;  4PC2 A;  2Q6K A;  1OB0 A;  4DQK A;  4XKW A;  2X6Y A;  3ONY A;  4FWT A;  4OPO A;  1EP3 B;  4RD6 A;  2JJ1 A;  3JQQ A;  4OOS A;  3AVX A;  3WND A;  4FK8 A;  2XZL A;  3T53 B;  1HZE A;  3GSI A;  1H85 A;  4OOX A;  2DEU A;  1S72 B;  1QFJ A;  4P3Y A;  5FA6 A;  3W5V A;  3OZW A;  4X05 A;  2PIA A;  3QFR A;  5IYN A;  3AVY A;  1COW A;  1V5V A;  4PAB A;  2WSS A;  3OPO A;  2LZJ A;  1ZM4 A;  4TMT A;  1E3X A;  3CCJ B;  1WDT A;  3MCA A;  3JU4 A;  1N06 A;  2C4U A;  3B78 A;  3ZZT A;  4KKT A;  4BPR A;  2QMU A;  4DQL A;  1E62 A;  2DET A;  1Q86 D;  1H8E A;  1OGJ A;  4K1X A;  5FO1 A;  1EFT A;  4RM0 A;  3MHP A;  2ZZQ A;  4X7D A;  2XGJ A;  2PE3 A;  3PA1 A;  3W2E A;  5BSY A;  5HZB A;  3QFS A;  2DOG A;  3ZZ0 A;  1KK0 A;  1N8R D;  1JB9 A;  2R6H A;  2E1R A;  1CNF A;  3G71 B;  1G7R A;  2NV4 A;  2Q6L A;  4OPS A;  2QA4 B;  4XON A;  2I1L A;  4LBW A;  3CC7 B;  1OB2 A;  1FNC A;  1I7P A;  2C78 A;  2BSA A;  4HE6 A;  4Z4T A;  1D1N A;  2F1L A;  1GO2 A;  1PJ6 A;  2HDN B;  1YJN B;  2OTJ B;  2V7X A;  5DS0 A;  1QVG B;  3SJZ A;  5L46 A;  2RC5 A;  1QX4 A;  1QGY A;  2VBT A;  2V7Q A;  4M1K A;  3CCR B;  4XLE A;  3AVW A;  2ZZE A;  3AGQ A;  2ZZF A;  3SJP A;  3A8J A;  2OK7 A;  2B5O A;  5TR9 A;  4B43 A;  4RD4 A;  4AVZ A;  1KK3 A;  1BX0 A;  2V4D A;  4G7W A;  2V7W A;  5TV2 A;  4XLA A;  5DSZ A;  4ROX A;  1T6Z A;  5GV7 A;  2JDI A;  5IYQ A;  3CCV B;  3OW2 B;  3OE7 A;  1I8D A;  4UZF A;  3FPP A;  5HXB A;  1E1Q A;  4PGO A;  3ZPN A;  1KZL A;  3LQE A; 
#chains in the Genus database with same CATH homology
 4NCN A;  4M53 A;  3CCE B;  1QGZ A;  4C43 A;  3FPK A;  3AGP A;  1QG0 A;  1VQO B;  4R71 A;  3QFT A;  2X3U A;  4PC7 A;  3CC4 B;  3VO2 A;  4G5G A;  1M1K D;  2AHO A;  2BGJ A;  5THX A;  4YHB A;  2DER A;  1E63 A;  4TMW A;  4Y7C A;  4AF7 A;  4ZCL A;  1N0V C;  1VQM B;  3B82 A;  3AVV A;  5H59 A;  1AIP A;  3CCS B;  1VQ7 B;  3WYA A;  3VO1 A;  4ZV4 A;  1SKQ A;  4TN1 A;  3WXM A;  1JA1 A;  3I55 B;  3WNB A;  1G7C A;  1F60 A;  3P27 A;  4U9U A;  4LBZ A;  1HA3 A;  3OJX A;  4WQM A;  1EWY A;  1VQN B;  1W87 A;  4PC1 A;  1IB0 A;  1QGA A;  1GVH A;  4AF6 A;  1TVC A;  2VNH A;  1D8T A;  1W34 A;  1QFZ A;  1CQX A;  1NJI D;  1BQE A;  1IJE A;  5GV8 A;  4AC9 A;  3ZC3 A;  4B44 A;  2BN4 A;  2GQF A;  3FJO A;  2PLF A;  3LVB A;  1GAW A;  3E1Y E;  4UAJ A;  1GJR A;  3ZBT A;  1D2E A;  4M2L A;  2OK8 A;  4RJL A;  1FDR A;  1G7S A;  1UMK A;  4G1B A;  2GPJ A;  1Q81 D;  4PC6 A;  2RC6 A;  1KK2 A;  2EFG A;  4B4D A;  1Q7Y D;  1Q82 D;  2YWE A;  4LBV A;  1BX1 A;  4H9G A;  3OZV A;  3WBJ A;  3VNV A;  1YJ9 B;  1K9M D;  2QTZ A;  1FND A;  4TMV A;  1H42 A;  1TLL A;  3B8H A;  1OB5 A;  4RD2 A;  2HMA A;  1VQK B;  1XB2 A;  2NPF A;  1M90 D;  3WNC A;  1OGI A;  2QN6 A;  4TMZ A;  3V76 A;  1G7T A;  4Y9R A;  2VNI A;  2ZIT A;  4RD3 A;  2BGI A;  3JQR A;  1YHQ B;  2QEX B;  1GAQ A;  1BJK A;  1ZUN B;  4NBS A;  3P26 A;  3I1F A;  4FN5 A;  3CW2 A;  4ZCM A;  3OZU A;  3ZBU A;  2CRV A;  1QUE A;  1R5N A;  2VNK A;  3ES9 A;  3CPW B;  1DDG A;  5KSW B;  5H5J A;  3VNU A;  4MYT A;  3CC2 B;  1GR1 A;  1B2R A;  3W2H A;  1DG1 G;  2EIX A;  2VNJ A;  2PMD A;  1R5B A;  2VZL A;  5AN9 A;  4N3G A;  1EP2 B;  2VYQ A;  3U6B A;  1QUF A;  1W2B B;  1YIJ B;  3PEN A;  2BV3 A;  3CXC B;  2XNC A;  3WY9 A;  3CB4 A;  4J0Q A;  3JQP A;  1KTV A;  4B48 A;  3I56 B;  2BMW A;  4TMX A;  1J9Z A;  3CCU B;  4IW3 B;  2CND A;  1FRN A;  2HCJ B;  1ELO A;  3CCQ B;  4LC0 A;  2YWF A;  1E64 A;  3AVT A;  4F7D A;  2BPO A;  1B23 P;  4QFM A;  2QTL A;  3G4S B;  2QDX A;  2YWH A;  1S0U A;  2BVN A;  3W2I A;  1VQ8 B;  3E20 A;  3CCL B;  3ZZU A;  1ZM3 A;  1YJW B;  1ZM2 A;  4PC3 A;  1N0U A;  3QE2 A;  4G1V A;  1NDH A;  1EXM A;  1DDI A;  1KJZ A;  3W2F A;  1VQP B;  2FX3 A;  1FNM A;  4Y9U A;  1QVF B;  3CME B;  2DCU A;  2B7B A;  3CRZ A;  1W35 A;  3CMA B;  1VQ4 B;  3CD6 B;  3LO8 A;  1FRQ A;  5TY0 A;  4YAU A;  4EH1 A;  1K73 D;  1FNB A;  4RCZ A;  1JJ2 B;  1KQS B;  1F20 A;  4RCY A;  1VQ6 B;  2XNJ A;  2OTL B;  2C77 A;  4B3X A;  1TTT A;  2BF4 A;  4YAO A;  1EP1 B;  1KRH A;  3MMP A;  4LBY A;  4ZGQ B;  1QH0 A;  2D74 A;  3J81 k;  1ZM9 A;  4MYU A;  4ACA A;  1R5O A;  1IJF A;  4QHY A;  4YAL A;  4YAW A;  4P6V F;  1K8A D;  4HE5 A;  1YI2 B;  3W5H A;  2BM1 A;  3U2Q A;  3CCM B;  1KC8 D;  1AMO A;  4M0L A;  3QSY A;  1YIT B;  3W2G A;  2B7C A;  1EFC A;  3W5U A;  5JBQ A;  2BM0 A;  1SM4 A;  5EMN A;  1XE1 A;  3G6E B;  4N3N A;  2YWG A;  3VMF A;  3WBK A;  3U6K A;  3AVU A;  4ACB A;  3QFC A;  1QFY A;  1VQL B;  1KK1 A;  1JA0 A;  4B47 A;  4RD0 A;  4M4S A;  1U2R A;  1CNE A;  1VQ5 B;  2J7K A;  1KD1 D;  4RD1 A;  4YAF A;  1A8P A;  3OJW A;  1TUI A;  4ZGN B;  1DAR A;  1EFU A;  1VQ9 B;  2DY1 A;  1JNY A;  4Q7J B;  4ZCI A;  2XEX A;  4PC2 A;  4DQK A;  4FWT A;  1EP3 B;  4RD6 A;  3JQQ A;  3AVX A;  3WND A;  4FK8 A;  1H85 A;  2DEU A;  1S72 B;  1QFJ A;  4P3Y A;  5FA6 A;  3W5V A;  3OZW A;  2PIA A;  3QFR A;  3AVY A;  1ZM4 A;  4TMT A;  3CCJ B;  1WDT A;  3MCA A;  3B78 A;  4BPR A;  3ZZT A;  2QMU A;  4DQL A;  1E62 A;  2DET A;  1Q86 D;  1OGJ A;  4K1X A;  1EFT A;  3MHP A;  3W2E A;  3QFS A;  3ZZ0 A;  1KK0 A;  1N8R D;  1JB9 A;  2R6H A;  2E1R A;  1CNF A;  3G71 B;  1G7R A;  2QA4 B;  4LBW A;  3CC7 B;  1OB2 A;  1FNC A;  1I7P A;  2C78 A;  2BSA A;  4HE6 A;  1D1N A;  1GO2 A;  2HDN B;  1YJN B;  2OTJ B;  1QVG B;  3SJZ A;  2RC5 A;  1QX4 A;  1QGY A;  4M1K A;  3CCR B;  3AVW A;  3AGQ A;  5TR9 A;  2OK7 A;  2B5O A;  4B43 A;  4RD4 A;  1KK3 A;  1BX0 A;  5TV2 A;  5DSZ A;  5GV7 A;  3CCV B;  3OW2 B;  5HXB A;  4PGO A;  4C0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...