4HE5A

Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
REFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Peptidase family U32
publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he5A00
4M4SA 4HE6A 3CCRB 4AF6A 1ZM9A 2OK8A 1BX1A 1VQMB 2BPOA 2VYQA 4ZGNB 5DSZA 1QFYA 1QGAA 3B78A 2DETA 4YAFA 3VMFA 1GAWA 3CCUB 4TN1A 1FNDA 3I55B 2XNJA 1VQ8B 1TVCA 3P27A 2EFGA 1ZUNB 1KK1A 1EP3B 2DY1A 2VNIA 4Q7JB 2HCJB 1IJEA 3AVVA 3WY9A 3I1FA 3SJZA 1VQ4B 1JA0A 3ZZ0A 4WQMA 3W2IA 1YIJB 3CCQB 3AGPA 2R6HA 4RCYA 4B43A 2GQFA 3WXMA 3W5UA 4LBYA 1FNCA 1G7RA 1ZM4A 1G7CA 3OJWA 3CXCB 3OW2B 1KK0A 1SKQA 4RD4A 3ZBUA 2CNDA 1EFCA 4M53A 1QGYA 2DCUA 1FNBA 3PENA 4UAJA 3AVXA 2X3UA 4YALA 1FDRA 4Y7CA 1W87A 1W2BB 1JA1A 1KJZA 4FN5A 1QX4A 2OK7A 2RC6A 5AN9A 1M90D 4PGOA 3LO8A 1YJNB 5TV2A 1FRNA 1R5NA 2OTLB 1W35A 1N0UA 1S72B 1DARA 4B47A 1FNMA 4TMVA 4DQKA 3OZVA 4G5GA 1VQ6B 1Q82D 2PMDA 2YWEA 4ZCIA 4IW3B 3CRZA 1CQXA 5HXBA 1Q7YD 1VQOB 1KC8D 4LBZA 5EMNA 2XEXA 4DQLA 4PC2A 1E63A 2BV3A 3FPKA 2FX3A 4TMTA 1YI2B 2YWFA 3CB4A 4Y9RA 5THXA 3CCEB 1VQKB 3CCLB 5JBQA 4TMWA 1KQSB 1HA3A 1R5BA 1D1NA 2VZLA 3CCVB 4B3XA 3OZUA 2QTZA 1YJWB 3W2FA 2XNCA 3ZBTA 5H5JA 1WDTA 4P6VF 3I56B 5H59A 4G1BA 4YHBA 1F60A 4RCZA 4NCNA 1BQEA 3CCSB 4ACBA 1S0UA 1ZM2A 4BPRA 1AMOA 3U6BA 1VQLB 1QUEA 2RC5A 1TLLA 1N8RD 3QFSA 4M1KA 3AVTA 1F20A 4YAOA 2QEXB 1I7PA 1U2RA 4YAUA 2VNHA 1YJ9B 2J7KA 1QFJA 4RD3A 4FWTA 3CC7B 2BGIA 1QUFA 2HDNB 3OJXA 3WNBA 4C0SA 3MCAA 2BF4A 4LBVA 3AVYA 3W2GA 1XE1A 4M2LA 4QHYA 3QSYA 1UMKA 4K1XA 4AF7A 2ZITA 3B82A 3CPWB 4R71A 3W2HA 1GVHA 3U2QA 4N3GA 1BJKA 2GPJA 3AVUA 4ZGQB 2YWGA 3VO2A 2BSAA 1GO2A 4F7DA 1EFTA 1DDGA 2QTLA 4RD6A 4B4DA 3QFTA 3W2EA 1GAQA 2B5OA 3WNDA 1CNEA 1KK3A 4N3NA 2C77A 3LVBA 3ES9A 4M0LA 2DEUA 3G4SB 5GV7A 4TMZA 2C78A 1YITB 2BVNA 2NPFA 1OB2A 4J0QA 5FA6A 1J9ZA 3CC2B 3MMPA 1H42A 4U9UA 1VQ7B 3AGQA 2EIXA 1H85A 2DERA 3MHPA 1NDHA 3V76A 3WYAA 5KSWB 1KTVA 1A8PA 3FJOA 4LC0A 4RD0A 1OGIA 2D74A 1M1KD 1QVGB 1QFZA 1TUIA 3QFCA 2VNJA 1ELOA 4AC9A 4FK8A 1BX0A 3W5VA 3J81k 3QE2A 3ZZTA 1K73D 3G6EB 4PC1A 4B44A 3G71B 1VQ9B 4QFMA 5TR9A 1KK2A 4PC3A 2BM0A 1GJRA 3WBJA 3QFRA 2PLFA 2B7BA 4ACAA 1JNYA 4TMXA 1VQNB 4RJLA 4RD1A 4NBSA 1NJID 4EH1A 3CD6B 2BMWA 2BM1A 1Q86D 1N0VC 1Q81D 1CNFA 4P3YA 4MYUA 3U6KA 3CCJB 1K8AD 1ZM3A 2AHOA 2HMAA 1EFUA 3ZZUA 1E62A 4ZCLA 3WNCA 4C43A 1QVFB 3P26A 5GV8A 2OTJB 4PC6A 1JJ2B 2QDXA 1FRQA 3E1YE 4H9GA 1QG0A 3CW2A 4MYTA 4G1VA 3E20A 4Y9UA 3VO1A 1YHQB 1B2RA 2BGJA 3W5HA 1EP2B 1KRHA 4PC7A 2YWHA 3JQPA 1VQ5B 1K9MD 1OB5A 4ZCMA 3AVWA 1EWYA 3CC4B 1TTTA 1EP1B 1D2EA 2QN6A 1DDIA 1EXMA 4ZV4A 1IB0A 3OZWA 4LBWA 3CMEB 3WBKA 3JQRA 2PIAA 4YAWA 1AIPA 3ZC3A 1JB9A 1DG1G 2VNKA 1W34A 1G7TA 1SM4A 3CCMB 2QA4B 4B48A 1QGZA 5TY0A 2BN4A 3CMAB 1GR1A 1D8TA 1IJFA 4HE5A 3VNUA 1G7SA 1B23P 1E64A 2CRVA 4RD2A 3VNVA 3JQQA 1KD1D 2B7CA 1VQPB 1OGJA 1R5OA 2E1RA 1XB2A 2QMUA 3B8HA 1QH0A
chains in the Genus database with same CATH superfamily
4M4SA 4HE6A 5FO1A 4XLHA 2ZL6A 3WQZA 3CCRB 3D26A 4AF6A 2ZXIA 4OPOA 1ZM9A 2OK8A 1BX1A 4XN3A 1VQMB 2DYIA 2BPOA 2VYQA 4ZGNB 2ZBUA 5DSZA 1YLOA 2Q6IA 1W9XA 1QFYA 1QGAA 2JIZA 4OOSA 1UD5A 3B78A 2DETA 4YAFA 5A88A 3VMFA 4OPVA 4DK0A 1GAWA 3CCUB 4TN1A 1FNDA 1XFOA 2XNJA 3I55B 1VQ8B 1TVCA 2X85A 3H9NA 5FL7A 3P27A 2EFGA 1ZUNB 1KK1A 1EP3B 2DY1A 1T5EA 1MRZA 2VNIA 4Q7JB 2HCJB 4X07A 1IJEA 3AVVA 3WY9A 5KNLA 2X8KA 3I1FA 3SJZA 1VQ4B 4G6IA 1BMFA 1JA0A 3ZZ0A 4WQMA 3W2IA 2F1LA 1YIJB 3CCQB 4JMQA 3AGPA 2R6HA 4YEJA 4RCYA 4TKOB 4B43A 2GQFA 4RM0A 3WXMA 3W5UA 4LBYA 1UD4A 4UZUA 2P3MA 1VJSA 3Q39A 1WTHD 4XKVA 1FNCA 1G7RA 1VF7A 4XQFA 2X6XA 2CBXA 3CP2A 1E43A 1ZM4A 1G7CA 1WOSA 2CF4A 3OJWA 3CXCB 1UD8A 2V7WA 3OW2B 1KK0A 1VHOA 3PUNA 1SKQA 1P4MA 4RD4A 3ZBUA 2CNDA 1H8HA 2GK7A 2XZLA 5F4OA 1EFCA 3G05A 4M53A 4ASUA 2CW5A 2GK6A 2KVOA 5BSXA 1QGYA 2F4NA 3SLDA 1K28D 2D9RA 2DCUA 1FNBA 3PENA 3KEWA 4UAJA 3AVXA 2X3UA 4YALA 1FDRA 4Y7CA 4X7FA 2GJRA 1W87A 2QE7A 1W2BB 1JA1A 1KJZA 4FN5A 5TRDA 2VBSA 1QX4A 2HLDA 1T6XA 2OK7A 2RC6A 5AN9A 1M90D 3BY1A 1N07A 3FPPA 3A3GA 2V7QA 2V7XA 4XR6A 3T53B 5E6TA 4PGOA 3LO8A 2Q6KA 1WPCA 1V0FA 5TV2A 1YJNB 4RDKA 2ZBVA 3PVDA 4TT3A 2XNDA 1FRNA 1R5NA 2OTLB 2XGJA 1W35A 1N0UA 1S72B 1DARA 4B47A 2OBSA 1FNMA 4TMVA 5A89A 4DQKA 2ZL7A 4G7WA 2CK3A 3OZVA 1OHHA 4G5GA 1VQ6B 1Q82D 2PMDA 1SKYB 2YWEA 3DDYA 3OKXA 3A8IA 3SLNA 4G7XA 4RLZA 1NB9A 4IW3B 3CRZA 4ZCIA 5HZAA 1CQXA 4E0FA 5LMZA 5HXBA 5L46A 3OEEA 3PA1A 4P25A 1Q7YD 1VQOB 5J35A 3CPXA 2JN9A 3ASTA 3Q6RA 1KC8D 4X7EA 2ZZEA 1EFRA 3OE7A 4LBZA 3A8KA 2XEXA 2DIEA 5EMNA 4DQLA 4PC2A 4KKUA 3GVLA 1N05A 3BNWA 5F4MA 1E63A 2BV3A 4Z4RA 4Z4VA 3FPKA 4X7CA 2FX3A 1H8EA 4TMTA 1YI2B 2C4TA 2V31A 2YWFA 3OP1A 2XZPA 3CB4A 4Y9RA 5THXA 3CCEB 2V7TA 1COWA 1VQKB 1S4MA 3CCLB 1VQ9B 5JBQA 4TMWA 2LZJA 3V7AA 1KQSB 1HA3A 2XOKA 1E3ZA 4P9SA 1R5BA 3A8JA 1D1NA 2VZLA 3CCVB 4NNJA 2VBVA 4X7DA 3CESA 1HVXA 2WZNA 3LQ6A 3OZUA 2QTZA 4B3XA 1YJWB 3W2FA 2XNCA 3ZBTA 5H5JA 1WDTA 3Q38A 4P6VF 1E1RA 3CTAA 3I56B 4X06A 1UD3A 4X8IA 3ONYA 3KL9A 5H59A 4G1BA 4YHBA 2ZTGA 1F60A 4RCZA 4RPBA 4NCNA 3OOCA 3H94A 4WZTA 1BQEA 3CCSB 3ASPA 4ACBA 5HKKA 1V5VA 1S0UA 5DS0A 3A35A 3R6KA 1PJ6A 1ZM2A 1I18A 4BPRA 1AMOA 2W6IA 3BC9A 4CQJA 2WYRA 3U6BA 3BY2A 4B3FX 5FNZA 1VQLB 1QUEA 4RPDA 2RC5A 1TLLA 1N8RD 3QFSA 4M1KA 1XQBA 3AVTA 4OOVA 4DK1A 1F20A 2C4UA 4P22A 2NV4A 4GQNA 4YAOA 2JJ2A 2QEXB 1I7PA 1U2RA 4YAUA 2VNHA 4XD7A 4XL9A 2C5BA 2F43A 1PJ7A 4TSFA 1YJ9B 5BSYA 2J7KA 1OB0A 1QFJA 3ISXA 4RD3A 4FWTA 3CC7B 2BGIA 1QUFA 4WZLA 2HDNB 5FIUA 1RQPA 1HZEA 3OJXA 3R6JA 5J3OA 2V7UA 3WNBA 4KKTA 4C0SA 1MABA 3MCAA 3NE5B 3GQBA 4II2A 4P26A 2BF4A 4LBVA 3ASRA 1VLOA 3AVYA 3W2GA 1XE1A 2R9VA 2GJKA 4OPSA 4M2LA 4QHYA 3QSYA 1UMKA 4Z4ZA 3GSIA 4K1XA 4AF7A 2ZITA 2I1LA 3B82A 3CPWB 3A1PA 4R71A 3W2HA 1GVHA 3U2QA 2X53S 4N3GA 4WWVA 1BJKA 2GPJA 2JDIA 3AVUA 3CMMA 4ZGQB 2YWGA 3OW7A 2OBRA 3VO2A 2BSAA 1GO2A 4KKSA 3T51B 4XMYA 3BCDA 4F7DA 2V4DA 2D3NA 3Q3AA 1EFTA 3BQJA 1DDGA 2QTLA 5CDFA 4RD6A 4B4DA 3QFTA 4DNRB 3LQEA 4ROXA 3W2EA 1GAQA 2B5OA 2W6JA 2ZTNA 3CP8A 5DN6A 3ZIAA 3WNDA 1CNEA 1KK3A 4N3NA 2C77A 3LVBA 3ES9A 4RDJA 4Z4UA 4M0LA 2DEUA 3G4SB 5GV7A 4TMZA 1VLYA 2C78A 1YITB 4P3IA 2BVNA 2NPFA 3PA2A 2VJJA 4XOPA 4L8JA 2PE3A 1OB2A 2WPDA 2ZZQA 4J0QA 1J9ZA 3OEHA 5FA6A 3CC2B 4XN0A 3MMPA 5HZBA 1H42A 3ASQA 1E79A 4U9UA 1VQ7B 3AGQA 3GIRA 2EIXA 2Q6OA 1H85A 1UD2A 2DERA 3OFNA 4XNFA 5F4JA 5IYWA 2Z6BD 3A3BA 3MHPA 1Q9SA 2C5HA 3RY8A 2ZL5A 2JJ1A 4Z4TA 5A8AA 1NDHA 3V76A 1WORA 3WYAA 5KSWB 1N08A 3GVJA 1KTVA 4XLAA 2WJVA 1A8PA 3FJOA 4LC0A 4RD0A 1OGIA 5B6IA 5IYRA 2D74A 1V0EA 4P2NA 3ZUGA 1M1KD 2X6YA 1QFZA 1QVGB 1TUIA 1E1QA 1YX2A 2VNJA 3QFCA 1E3XA 2ZZFA 1ELOA 4AC9A 2DOGA 1T6YA 1WSVA 4FK8A 1BX0A 3W5VA 2VBTA 3J81k 3QE2A 3ZZTA 4Z4SA 1K73D 3G6EB 4OOXA 1RQRA 2WJYA 2GREA 3LNNA 4PC1A 4B44A 4QFMA 5TR9A 3OAAA 3G71B 1KK2A 4PC3A 2BM0A 4QVAA 1GJRA 3GVKA 4P1VA 4HIZA 3WBJA 4P6YA 3SJPA 1BPLA 4Z4WA 3QFRA 4QVJA 2PLFA 2B7BA 4ACAA 1JNYA 3FKSA 4TMXA 1VQNB 1WSRA 4RD1A 4RJLA 4AVZA 3ONUA 2FVGA 4NBSA 2QGGA 2VBUA 1NJID 4EH1A 3CD6B 2BMWA 2BM1A 3SEJA 1Q86D 1NRKA 1N0VC 1Q81D 1CNFA 4P3YA 4MYUA 1I8DA 4Z4YA 3U6KA 4X0CA 4II3A 4XORA 2VJIA 1PJ5A 1WOPA 4XM3A 2ZZGA 3CCJB 1K8AD 3Q6QA 3T56B 4XLEA 3ZPNA 4QV2A 1ZM3A 2AHOA 2HMAA 3HAGA 1EFUA 4WZKA 2XZOA 3ZZUA 4PABA 1E62A 4YELA 4ZCLA 3WNCA 4C43A 1QVFB 3P26A 5GV8A 2OTJB 4PC6A 1KMHA 1N06A 4P12A 1JJ2B 2QDXA 1FRQA 2Q6LA 3E1YE 4H9GA 5IK2A 4XONA 1QG0A 1T6ZA 3CW2A 4X05A 4FXUA 4MYTA 4G1VA 3E20A 1PKVA 4Y9UA 3VO1A 2X6WA 3SKBA 1W0JA 1YHQB 1NB0A 1B2RA 1FX0A 1WOOA 2CC2A 2BGJA 3W5HA 1EP2B 3OPOA 1KRHA 4PC7A 4XLFA 2YWHA 3BCFA 3JQPA 1WU8A 4YXWA 1VQ5B 4B3GA 2E1BA 1K9MD 1OB5A 4ZCMA 3AVWA 2WR8A 1W0KA 2OBTA 1EWYA 3BH4A 4PAAA 3CC4B 5KW9A 1TTTA 1WP6A 5IYPA 1EP1B 1D2EA 2QN6A 1DDIA 1EXMA 1UD6A 5IYQA 4ZV4A 4UZFA 2F1MA 1IB0A 3OZWA 4LBWA 2WSSA 3CMEB 1Y0YA 1Y0RA 3WBKA 4RDLA 4Z1MA 4UZEA 2X0KA 2WZPP 3JQRA 1KZLA 2OYNA 2PIAA 4XKWA 4YAWA 1IHMA 1AIPA 2V7VA 3ZC3A 1JB9A 1DG1G 2VNKA 1W34A 2M5SA 1G7TA 1SM4A 3CCMB 2QA4B 3PUMA 4B48A 1QGZA 5TY0A 2BN4A 3CMAB 2D3LA 3VR6A 4XOTA 1GR1A 1D8TA 2C2WA 3ASSA 1IJFA 2GJPA 4HE5A 5FO0A 4OP7A 3VNUA 4WZEA 1G7SA 4QUZA 1NBMA 1B23P 1E64A 2CRVA 4XLCA 4RD2A 3VNVA 3JQQA 4DNTB 1KD1D 5IYNA 2B7CA 1VQPB 3JU4A 1OGJA 1R5OA 2E1RA 1XB2A 2QMUA 1BLIA 1VHEA 2ZXHA 3B8HA 1QH0A
chains in the Genus database with same CATH topology
4M4SA 4HE6A 3CCRB 4AF6A 1ZM9A 2OK8A 1BX1A 1VQMB 2BPOA 2VYQA 4ZGNB 5DSZA 1QFYA 1QGAA 3B78A 2DETA 4YAFA 3VMFA 1GAWA 3CCUB 4TN1A 1FNDA 3I55B 2XNJA 1VQ8B 1TVCA 3P27A 2EFGA 1ZUNB 1KK1A 1EP3B 2DY1A 2VNIA 4Q7JB 2HCJB 1IJEA 3AVVA 3WY9A 3I1FA 3SJZA 1VQ4B 1JA0A 3ZZ0A 4WQMA 3W2IA 1YIJB 3CCQB 3AGPA 2R6HA 4RCYA 4B43A 2GQFA 3WXMA 3W5UA 4LBYA 1FNCA 1G7RA 1ZM4A 1G7CA 3OJWA 3CXCB 3OW2B 1KK0A 1SKQA 4RD4A 3ZBUA 2CNDA 1EFCA 4M53A 1QGYA 2DCUA 1FNBA 3PENA 4UAJA 3AVXA 2X3UA 4YALA 1FDRA 4Y7CA 1W87A 1W2BB 1JA1A 1KJZA 4FN5A 1QX4A 2OK7A 2RC6A 5AN9A 1M90D 4PGOA 3LO8A 1YJNB 5TV2A 1FRNA 1R5NA 2OTLB 1W35A 1N0UA 1S72B 1DARA 4B47A 1FNMA 4TMVA 4DQKA 3OZVA 4G5GA 1VQ6B 1Q82D 2PMDA 2YWEA 4ZCIA 4IW3B 3CRZA 1CQXA 5HXBA 1Q7YD 1VQOB 1KC8D 4LBZA 5EMNA 2XEXA 4DQLA 4PC2A 1E63A 2BV3A 3FPKA 2FX3A 4TMTA 1YI2B 2YWFA 3CB4A 4Y9RA 5THXA 3CCEB 1VQKB 3CCLB 5JBQA 4TMWA 1KQSB 1HA3A 1R5BA 1D1NA 2VZLA 3CCVB 4B3XA 3OZUA 2QTZA 1YJWB 3W2FA 2XNCA 3ZBTA 5H5JA 1WDTA 4P6VF 3I56B 5H59A 4G1BA 4YHBA 1F60A 4RCZA 4NCNA 1BQEA 3CCSB 4ACBA 1S0UA 1ZM2A 4BPRA 1AMOA 3U6BA 1VQLB 1QUEA 2RC5A 1TLLA 1N8RD 3QFSA 4M1KA 3AVTA 1F20A 4YAOA 2QEXB 1I7PA 1U2RA 4YAUA 2VNHA 1YJ9B 2J7KA 1QFJA 4RD3A 4FWTA 3CC7B 2BGIA 1QUFA 2HDNB 3OJXA 3WNBA 4C0SA 3MCAA 2BF4A 4LBVA 3AVYA 3W2GA 1XE1A 4M2LA 4QHYA 3QSYA 1UMKA 4K1XA 4AF7A 2ZITA 3B82A 3CPWB 4R71A 3W2HA 1GVHA 3U2QA 4N3GA 1BJKA 2GPJA 3AVUA 4ZGQB 2YWGA 3VO2A 2BSAA 1GO2A 4F7DA 1EFTA 1DDGA 2QTLA 4RD6A 4B4DA 3QFTA 3W2EA 1GAQA 2B5OA 3WNDA 1CNEA 1KK3A 4N3NA 2C77A 3LVBA 3ES9A 4M0LA 2DEUA 3G4SB 5GV7A 4TMZA 2C78A 1YITB 2BVNA 2NPFA 1OB2A 4J0QA 5FA6A 1J9ZA 3CC2B 3MMPA 1H42A 4U9UA 1VQ7B 3AGQA 2EIXA 1H85A 2DERA 3MHPA 1NDHA 3V76A 3WYAA 5KSWB 1KTVA 1A8PA 3FJOA 4LC0A 4RD0A 1OGIA 2D74A 1M1KD 1QVGB 1QFZA 1TUIA 3QFCA 2VNJA 1ELOA 4AC9A 4FK8A 1BX0A 3W5VA 3J81k 3QE2A 3ZZTA 1K73D 3G6EB 4PC1A 4B44A 3G71B 1VQ9B 4QFMA 5TR9A 1KK2A 4PC3A 2BM0A 1GJRA 3WBJA 3QFRA 2PLFA 2B7BA 4ACAA 1JNYA 4TMXA 1VQNB 4RJLA 4RD1A 4NBSA 1NJID 4EH1A 3CD6B 2BMWA 2BM1A 1Q86D 1N0VC 1Q81D 1CNFA 4P3YA 4MYUA 3U6KA 3CCJB 1K8AD 1ZM3A 2AHOA 2HMAA 1EFUA 3ZZUA 1E62A 4ZCLA 3WNCA 4C43A 1QVFB 3P26A 5GV8A 2OTJB 4PC6A 1JJ2B 2QDXA 1FRQA 3E1YE 4H9GA 1QG0A 3CW2A 4MYTA 4G1VA 3E20A 4Y9UA 3VO1A 1YHQB 1B2RA 2BGJA 3W5HA 1EP2B 1KRHA 4PC7A 2YWHA 3JQPA 1VQ5B 1K9MD 1OB5A 4ZCMA 3AVWA 1EWYA 3CC4B 1TTTA 1EP1B 1D2EA 2QN6A 1DDIA 1EXMA 4ZV4A 1IB0A 3OZWA 4LBWA 3CMEB 3WBKA 3JQRA 2PIAA 4YAWA 1AIPA 3ZC3A 1JB9A 1DG1G 2VNKA 1W34A 1G7TA 1SM4A 3CCMB 2QA4B 4B48A 1QGZA 5TY0A 2BN4A 3CMAB 1GR1A 1D8TA 1IJFA 4HE5A 3VNUA 1G7SA 1B23P 1E64A 2CRVA 4RD2A 3VNVA 3JQQA 1KD1D 2B7CA 1VQPB 1OGJA 1R5OA 2E1RA 1XB2A 2QMUA 3B8HA 1QH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4S A;  4HE6 A;  3CCR B;  4AF6 A;  1ZM9 A;  2OK8 A;  1BX1 A;  1VQM B;  2BPO A;  2VYQ A;  4ZGN B;  5DSZ A;  1QFY A;  1QGA A;  3B78 A;  2DET A;  4YAF A;  3VMF A;  1GAW A;  3CCU B;  4TN1 A;  1FND A;  3I55 B;  2XNJ A;  1VQ8 B;  1TVC A;  3P27 A;  2EFG A;  1ZUN B;  1KK1 A;  1EP3 B;  2DY1 A;  2VNI A;  4Q7J B;  2HCJ B;  1IJE A;  3AVV A;  3WY9 A;  3I1F A;  3SJZ A;  1VQ4 B;  1JA0 A;  3ZZ0 A;  4WQM A;  3W2I A;  1YIJ B;  3CCQ B;  3AGP A;  2R6H A;  4RCY A;  4B43 A;  2GQF A;  3WXM A;  3W5U A;  4LBY A;  1FNC A;  1G7R A;  1ZM4 A;  1G7C A;  3OJW A;  3CXC B;  3OW2 B;  1KK0 A;  1SKQ A;  4RD4 A;  3ZBU A;  2CND A;  1EFC A;  4M53 A;  1QGY A;  2DCU A;  1FNB A;  3PEN A;  4UAJ A;  3AVX A;  2X3U A;  4YAL A;  1FDR A;  4Y7C A;  1W87 A;  1W2B B;  1JA1 A;  1KJZ A;  4FN5 A;  1QX4 A;  2OK7 A;  2RC6 A;  5AN9 A;  1M90 D;  4PGO A;  3LO8 A;  1YJN B;  5TV2 A;  1FRN A;  1R5N A;  2OTL B;  1W35 A;  1N0U A;  1S72 B;  1DAR A;  4B47 A;  1FNM A;  4TMV A;  4DQK A;  3OZV A;  4G5G A;  1VQ6 B;  1Q82 D;  2PMD A;  2YWE A;  4ZCI A;  4IW3 B;  3CRZ A;  1CQX A;  5HXB A;  1Q7Y D;  1VQO B;  1KC8 D;  4LBZ A;  5EMN A;  2XEX A;  4DQL A;  4PC2 A;  1E63 A;  2BV3 A;  3FPK A;  2FX3 A;  4TMT A;  1YI2 B;  2YWF A;  3CB4 A;  4Y9R A;  5THX A;  3CCE B;  1VQK B;  3CCL B;  5JBQ A;  4TMW A;  1KQS B;  1HA3 A;  1R5B A;  1D1N A;  2VZL A;  3CCV B;  4B3X A;  3OZU A;  2QTZ A;  1YJW B;  3W2F A;  2XNC A;  3ZBT A;  5H5J A;  1WDT A;  4P6V F;  3I56 B;  5H59 A;  4G1B A;  4YHB A;  1F60 A;  4RCZ A;  4NCN A;  1BQE A;  3CCS B;  4ACB A;  1S0U A;  1ZM2 A;  4BPR A;  1AMO A;  3U6B A;  1VQL B;  1QUE A;  2RC5 A;  1TLL A;  1N8R D;  3QFS A;  4M1K A;  3AVT A;  1F20 A;  4YAO A;  2QEX B;  1I7P A;  1U2R A;  4YAU A;  2VNH A;  1YJ9 B;  2J7K A;  1QFJ A;  4RD3 A;  4FWT A;  3CC7 B;  2BGI A;  1QUF A;  2HDN B;  3OJX A;  3WNB A;  4C0S A;  3MCA A;  2BF4 A;  4LBV A;  3AVY A;  3W2G A;  1XE1 A;  4M2L A;  4QHY A;  3QSY A;  1UMK A;  4K1X A;  4AF7 A;  2ZIT A;  3B82 A;  3CPW B;  4R71 A;  3W2H A;  1GVH A;  3U2Q A;  4N3G A;  1BJK A;  2GPJ A;  3AVU A;  4ZGQ B;  2YWG A;  3VO2 A;  2BSA A;  1GO2 A;  4F7D A;  1EFT A;  1DDG A;  2QTL A;  4RD6 A;  4B4D A;  3QFT A;  3W2E A;  1GAQ A;  2B5O A;  3WND A;  1CNE A;  1KK3 A;  4N3N A;  2C77 A;  3LVB A;  3ES9 A;  4M0L A;  2DEU A;  3G4S B;  5GV7 A;  4TMZ A;  2C78 A;  1YIT B;  2BVN A;  2NPF A;  1OB2 A;  4J0Q A;  5FA6 A;  1J9Z A;  3CC2 B;  3MMP A;  1H42 A;  4U9U A;  1VQ7 B;  3AGQ A;  2EIX A;  1H85 A;  2DER A;  3MHP A;  1NDH A;  3V76 A;  3WYA A;  5KSW B;  1KTV A;  1A8P A;  3FJO A;  4LC0 A;  4RD0 A;  1OGI A;  2D74 A;  1M1K D;  1QVG B;  1QFZ A;  1TUI A;  3QFC A;  2VNJ A;  1ELO A;  4AC9 A;  4FK8 A;  1BX0 A;  3W5V A;  3J81 k;  3QE2 A;  3ZZT A;  1K73 D;  3G6E B;  4PC1 A;  4B44 A;  3G71 B;  1VQ9 B;  4QFM A;  5TR9 A;  1KK2 A;  4PC3 A;  2BM0 A;  1GJR A;  3WBJ A;  3QFR A;  2PLF A;  2B7B A;  4ACA A;  1JNY A;  4TMX A;  1VQN B;  4RJL A;  4RD1 A;  4NBS A;  1NJI D;  4EH1 A;  3CD6 B;  2BMW A;  2BM1 A;  1Q86 D;  1N0V C;  1Q81 D;  1CNF A;  4P3Y A;  4MYU A;  3U6K A;  3CCJ B;  1K8A D;  1ZM3 A;  2AHO A;  2HMA A;  1EFU A;  3ZZU A;  1E62 A;  4ZCL A;  3WNC A;  4C43 A;  1QVF B;  3P26 A;  5GV8 A;  2OTJ B;  4PC6 A;  1JJ2 B;  2QDX A;  1FRQ A;  3E1Y E;  4H9G A;  1QG0 A;  3CW2 A;  4MYT A;  4G1V A;  3E20 A;  4Y9U A;  3VO1 A;  1YHQ B;  1B2R A;  2BGJ A;  3W5H A;  1EP2 B;  1KRH A;  4PC7 A;  2YWH A;  3JQP A;  1VQ5 B;  1K9M D;  1OB5 A;  4ZCM A;  3AVW A;  1EWY A;  3CC4 B;  1TTT A;  1EP1 B;  1D2E A;  2QN6 A;  1DDI A;  1EXM A;  4ZV4 A;  1IB0 A;  3OZW A;  4LBW A;  3CME B;  3WBK A;  3JQR A;  2PIA A;  4YAW A;  1AIP A;  3ZC3 A;  1JB9 A;  1DG1 G;  2VNK A;  1W34 A;  1G7T A;  1SM4 A;  3CCM B;  2QA4 B;  4B48 A;  1QGZ A;  5TY0 A;  2BN4 A;  3CMA B;  1GR1 A;  1D8T A;  1IJF A;  4HE5 A;  3VNU A;  1G7S A;  1B23 P;  1E64 A;  2CRV A;  4RD2 A;  3VNV A;  3JQQ A;  1KD1 D;  2B7C A;  1VQP B;  1OGJ A;  1R5O A;  2E1R A;  1XB2 A;  2QMU A;  3B8H A;  1QH0 A; 
#chains in the Genus database with same CATH topology
 4M4S A;  4HE6 A;  5FO1 A;  4XLH A;  2ZL6 A;  3WQZ A;  3CCR B;  3D26 A;  4AF6 A;  2ZXI A;  4OPO A;  1ZM9 A;  2OK8 A;  1BX1 A;  4XN3 A;  1VQM B;  2DYI A;  2BPO A;  2VYQ A;  4ZGN B;  2ZBU A;  5DSZ A;  1YLO A;  2Q6I A;  1W9X A;  1QFY A;  1QGA A;  2JIZ A;  4OOS A;  1UD5 A;  3B78 A;  2DET A;  4YAF A;  5A88 A;  3VMF A;  4OPV A;  4DK0 A;  1GAW A;  3CCU B;  4TN1 A;  1FND A;  1XFO A;  2XNJ A;  3I55 B;  1VQ8 B;  1TVC A;  2X85 A;  3H9N A;  5FL7 A;  3P27 A;  2EFG A;  1ZUN B;  1KK1 A;  1EP3 B;  2DY1 A;  1T5E A;  1MRZ A;  2VNI A;  4Q7J B;  2HCJ B;  4X07 A;  1IJE A;  3AVV A;  3WY9 A;  5KNL A;  2X8K A;  3I1F A;  3SJZ A;  1VQ4 B;  4G6I A;  1BMF A;  1JA0 A;  3ZZ0 A;  4WQM A;  3W2I A;  2F1L A;  1YIJ B;  3CCQ B;  4JMQ A;  3AGP A;  2R6H A;  4YEJ A;  4RCY A;  4TKO B;  4B43 A;  2GQF A;  4RM0 A;  3WXM A;  3W5U A;  4LBY A;  1UD4 A;  4UZU A;  2P3M A;  1VJS A;  3Q39 A;  1WTH D;  4XKV A;  1FNC A;  1G7R A;  1VF7 A;  4XQF A;  2X6X A;  2CBX A;  3CP2 A;  1E43 A;  1ZM4 A;  1G7C A;  1WOS A;  2CF4 A;  3OJW A;  3CXC B;  1UD8 A;  2V7W A;  3OW2 B;  1KK0 A;  1VHO A;  3PUN A;  1SKQ A;  1P4M A;  4RD4 A;  3ZBU A;  2CND A;  1H8H A;  2GK7 A;  2XZL A;  5F4O A;  1EFC A;  3G05 A;  4M53 A;  4ASU A;  2CW5 A;  2GK6 A;  2KVO A;  5BSX A;  1QGY A;  2F4N A;  3SLD A;  1K28 D;  2D9R A;  2DCU A;  1FNB A;  3PEN A;  3KEW A;  4UAJ A;  3AVX A;  2X3U A;  4YAL A;  1FDR A;  4Y7C A;  4X7F A;  2GJR A;  1W87 A;  2QE7 A;  1W2B B;  1JA1 A;  1KJZ A;  4FN5 A;  5TRD A;  2VBS A;  1QX4 A;  2HLD A;  1T6X A;  2OK7 A;  2RC6 A;  5AN9 A;  1M90 D;  3BY1 A;  1N07 A;  3FPP A;  3A3G A;  2V7Q A;  2V7X A;  4XR6 A;  3T53 B;  5E6T A;  4PGO A;  3LO8 A;  2Q6K A;  1WPC A;  1V0F A;  5TV2 A;  1YJN B;  4RDK A;  2ZBV A;  3PVD A;  4TT3 A;  2XND A;  1FRN A;  1R5N A;  2OTL B;  2XGJ A;  1W35 A;  1N0U A;  1S72 B;  1DAR A;  4B47 A;  2OBS A;  1FNM A;  4TMV A;  5A89 A;  4DQK A;  2ZL7 A;  4G7W A;  2CK3 A;  3OZV A;  1OHH A;  4G5G A;  1VQ6 B;  1Q82 D;  2PMD A;  1SKY B;  2YWE A;  3DDY A;  3OKX A;  3A8I A;  3SLN A;  4G7X A;  4RLZ A;  1NB9 A;  4IW3 B;  3CRZ A;  4ZCI A;  5HZA A;  1CQX A;  4E0F A;  5LMZ A;  5HXB A;  5L46 A;  3OEE A;  3PA1 A;  4P25 A;  1Q7Y D;  1VQO B;  5J35 A;  3CPX A;  2JN9 A;  3AST A;  3Q6R A;  1KC8 D;  4X7E A;  2ZZE A;  1EFR A;  3OE7 A;  4LBZ A;  3A8K A;  2XEX A;  2DIE A;  5EMN A;  4DQL A;  4PC2 A;  4KKU A;  3GVL A;  1N05 A;  3BNW A;  5F4M A;  1E63 A;  2BV3 A;  4Z4R A;  4Z4V A;  3FPK A;  4X7C A;  2FX3 A;  1H8E A;  4TMT A;  1YI2 B;  2C4T A;  2V31 A;  2YWF A;  3OP1 A;  2XZP A;  3CB4 A;  4Y9R A;  5THX A;  3CCE B;  2V7T A;  1COW A;  1VQK B;  1S4M A;  3CCL B;  1VQ9 B;  5JBQ A;  4TMW A;  2LZJ A;  3V7A A;  1KQS B;  1HA3 A;  2XOK A;  1E3Z A;  4P9S A;  1R5B A;  3A8J A;  1D1N A;  2VZL A;  3CCV B;  4NNJ A;  2VBV A;  4X7D A;  3CES A;  1HVX A;  2WZN A;  3LQ6 A;  3OZU A;  2QTZ A;  4B3X A;  1YJW B;  3W2F A;  2XNC A;  3ZBT A;  5H5J A;  1WDT A;  3Q38 A;  4P6V F;  1E1R A;  3CTA A;  3I56 B;  4X06 A;  1UD3 A;  4X8I A;  3ONY A;  3KL9 A;  5H59 A;  4G1B A;  4YHB A;  2ZTG A;  1F60 A;  4RCZ A;  4RPB A;  4NCN A;  3OOC A;  3H94 A;  4WZT A;  1BQE A;  3CCS B;  3ASP A;  4ACB A;  5HKK A;  1V5V A;  1S0U A;  5DS0 A;  3A35 A;  3R6K A;  1PJ6 A;  1ZM2 A;  1I18 A;  4BPR A;  1AMO A;  2W6I A;  3BC9 A;  4CQJ A;  2WYR A;  3U6B A;  3BY2 A;  4B3F X;  5FNZ A;  1VQL B;  1QUE A;  4RPD A;  2RC5 A;  1TLL A;  1N8R D;  3QFS A;  4M1K A;  1XQB A;  3AVT A;  4OOV A;  4DK1 A;  1F20 A;  2C4U A;  4P22 A;  2NV4 A;  4GQN A;  4YAO A;  2JJ2 A;  2QEX B;  1I7P A;  1U2R A;  4YAU A;  2VNH A;  4XD7 A;  4XL9 A;  2C5B A;  2F43 A;  1PJ7 A;  4TSF A;  1YJ9 B;  5BSY A;  2J7K A;  1OB0 A;  1QFJ A;  3ISX A;  4RD3 A;  4FWT A;  3CC7 B;  2BGI A;  1QUF A;  4WZL A;  2HDN B;  5FIU A;  1RQP A;  1HZE A;  3OJX A;  3R6J A;  5J3O A;  2V7U A;  3WNB A;  4KKT A;  4C0S A;  1MAB A;  3MCA A;  3NE5 B;  3GQB A;  4II2 A;  4P26 A;  2BF4 A;  4LBV A;  3ASR A;  1VLO A;  3AVY A;  3W2G A;  1XE1 A;  2R9V A;  2GJK A;  4OPS A;  4M2L A;  4QHY A;  3QSY A;  1UMK A;  4Z4Z A;  3GSI A;  4K1X A;  4AF7 A;  2ZIT A;  2I1L A;  3B82 A;  3CPW B;  3A1P A;  4R71 A;  3W2H A;  1GVH A;  3U2Q A;  2X53 S;  4N3G A;  4WWV A;  1BJK A;  2GPJ A;  2JDI A;  3AVU A;  3CMM A;  4ZGQ B;  2YWG A;  3OW7 A;  2OBR A;  3VO2 A;  2BSA A;  1GO2 A;  4KKS A;  3T51 B;  4XMY A;  3BCD A;  4F7D A;  2V4D A;  2D3N A;  3Q3A A;  1EFT A;  3BQJ A;  1DDG A;  2QTL A;  5CDF A;  4RD6 A;  4B4D A;  3QFT A;  4DNR B;  3LQE A;  4ROX A;  3W2E A;  1GAQ A;  2B5O A;  2W6J A;  2ZTN A;  3CP8 A;  5DN6 A;  3ZIA A;  3WND A;  1CNE A;  1KK3 A;  4N3N A;  2C77 A;  3LVB A;  3ES9 A;  4RDJ A;  4Z4U A;  4M0L A;  2DEU A;  3G4S B;  5GV7 A;  4TMZ A;  1VLY A;  2C78 A;  1YIT B;  4P3I A;  2BVN A;  2NPF A;  3PA2 A;  2VJJ A;  4XOP A;  4L8J A;  2PE3 A;  1OB2 A;  2WPD A;  2ZZQ A;  4J0Q A;  1J9Z A;  3OEH A;  5FA6 A;  3CC2 B;  4XN0 A;  3MMP A;  5HZB A;  1H42 A;  3ASQ A;  1E79 A;  4U9U A;  1VQ7 B;  3AGQ A;  3GIR A;  2EIX A;  2Q6O A;  1H85 A;  1UD2 A;  2DER A;  3OFN A;  4XNF A;  5F4J A;  5IYW A;  2Z6B D;  3A3B A;  3MHP A;  1Q9S A;  2C5H A;  3RY8 A;  2ZL5 A;  2JJ1 A;  4Z4T A;  5A8A A;  1NDH A;  3V76 A;  1WOR A;  3WYA A;  5KSW B;  1N08 A;  3GVJ A;  1KTV A;  4XLA A;  2WJV A;  1A8P A;  3FJO A;  4LC0 A;  4RD0 A;  1OGI A;  5B6I A;  5IYR A;  2D74 A;  1V0E A;  4P2N A;  3ZUG A;  1M1K D;  2X6Y A;  1QFZ A;  1QVG B;  1TUI A;  1E1Q A;  1YX2 A;  2VNJ A;  3QFC A;  1E3X A;  2ZZF A;  1ELO A;  4AC9 A;  2DOG A;  1T6Y A;  1WSV A;  4FK8 A;  1BX0 A;  3W5V A;  2VBT A;  3J81 k;  3QE2 A;  3ZZT A;  4Z4S A;  1K73 D;  3G6E B;  4OOX A;  1RQR A;  2WJY A;  2GRE A;  3LNN A;  4PC1 A;  4B44 A;  4QFM A;  5TR9 A;  3OAA A;  3G71 B;  1KK2 A;  4PC3 A;  2BM0 A;  4QVA A;  1GJR A;  3GVK A;  4P1V A;  4HIZ A;  3WBJ A;  4P6Y A;  3SJP A;  1BPL A;  4Z4W A;  3QFR A;  4QVJ A;  2PLF A;  2B7B A;  4ACA A;  1JNY A;  3FKS A;  4TMX A;  1VQN B;  1WSR A;  4RD1 A;  4RJL A;  4AVZ A;  3ONU A;  2FVG A;  4NBS A;  2QGG A;  2VBU A;  1NJI D;  4EH1 A;  3CD6 B;  2BMW A;  2BM1 A;  3SEJ A;  1Q86 D;  1NRK A;  1N0V C;  1Q81 D;  1CNF A;  4P3Y A;  4MYU A;  1I8D A;  4Z4Y A;  3U6K A;  4X0C A;  4II3 A;  4XOR A;  2VJI A;  1PJ5 A;  1WOP A;  4XM3 A;  2ZZG A;  3CCJ B;  1K8A D;  3Q6Q A;  3T56 B;  4XLE A;  3ZPN A;  4QV2 A;  1ZM3 A;  2AHO A;  2HMA A;  3HAG A;  1EFU A;  4WZK A;  2XZO A;  3ZZU A;  4PAB A;  1E62 A;  4YEL A;  4ZCL A;  3WNC A;  4C43 A;  1QVF B;  3P26 A;  5GV8 A;  2OTJ B;  4PC6 A;  1KMH A;  1N06 A;  4P12 A;  1JJ2 B;  2QDX A;  1FRQ A;  2Q6L A;  3E1Y E;  4H9G A;  5IK2 A;  4XON A;  1QG0 A;  1T6Z A;  3CW2 A;  4X05 A;  4FXU A;  4MYT A;  4G1V A;  3E20 A;  1PKV A;  4Y9U A;  3VO1 A;  2X6W A;  3SKB A;  1W0J A;  1YHQ B;  1NB0 A;  1B2R A;  1FX0 A;  1WOO A;  2CC2 A;  2BGJ A;  3W5H A;  1EP2 B;  3OPO A;  1KRH A;  4PC7 A;  4XLF A;  2YWH A;  3BCF A;  3JQP A;  1WU8 A;  4YXW A;  1VQ5 B;  4B3G A;  2E1B A;  1K9M D;  1OB5 A;  4ZCM A;  3AVW A;  2WR8 A;  1W0K A;  2OBT A;  1EWY A;  3BH4 A;  4PAA A;  3CC4 B;  5KW9 A;  1TTT A;  1WP6 A;  5IYP A;  1EP1 B;  1D2E A;  2QN6 A;  1DDI A;  1EXM A;  1UD6 A;  5IYQ A;  4ZV4 A;  4UZF A;  2F1M A;  1IB0 A;  3OZW A;  4LBW A;  2WSS A;  3CME B;  1Y0Y A;  1Y0R A;  3WBK A;  4RDL A;  4Z1M A;  4UZE A;  2X0K A;  2WZP P;  3JQR A;  1KZL A;  2OYN A;  2PIA A;  4XKW A;  4YAW A;  1IHM A;  1AIP A;  2V7V A;  3ZC3 A;  1JB9 A;  1DG1 G;  2VNK A;  1W34 A;  2M5S A;  1G7T A;  1SM4 A;  3CCM B;  2QA4 B;  3PUM A;  4B48 A;  1QGZ A;  5TY0 A;  2BN4 A;  3CMA B;  2D3L A;  3VR6 A;  4XOT A;  1GR1 A;  1D8T A;  2C2W A;  3ASS A;  1IJF A;  2GJP A;  4HE5 A;  5FO0 A;  4OP7 A;  3VNU A;  4WZE A;  1G7S A;  4QUZ A;  1NBM A;  1B23 P;  1E64 A;  2CRV A;  4XLC A;  4RD2 A;  3VNV A;  3JQQ A;  4DNT B;  1KD1 D;  5IYN A;  2B7C A;  1VQP B;  3JU4 A;  1OGJ A;  1R5O A;  2E1R A;  1XB2 A;  2QMU A;  1BLI A;  1VHE A;  2ZXH A;  3B8H A;  1QH0 A; 
#chains in the Genus database with same CATH homology
 4M4S A;  4HE6 A;  3CCR B;  4AF6 A;  1ZM9 A;  2OK8 A;  1BX1 A;  1VQM B;  2BPO A;  2VYQ A;  4ZGN B;  5DSZ A;  1QFY A;  1QGA A;  3B78 A;  2DET A;  4YAF A;  3VMF A;  1GAW A;  3CCU B;  4TN1 A;  1FND A;  3I55 B;  2XNJ A;  1VQ8 B;  1TVC A;  3P27 A;  2EFG A;  1ZUN B;  1KK1 A;  1EP3 B;  2DY1 A;  2VNI A;  4Q7J B;  2HCJ B;  1IJE A;  3AVV A;  3WY9 A;  3I1F A;  3SJZ A;  1VQ4 B;  1JA0 A;  3ZZ0 A;  4WQM A;  3W2I A;  1YIJ B;  3CCQ B;  3AGP A;  2R6H A;  4RCY A;  4B43 A;  2GQF A;  3WXM A;  3W5U A;  4LBY A;  1FNC A;  1G7R A;  1ZM4 A;  1G7C A;  3OJW A;  3CXC B;  3OW2 B;  1KK0 A;  1SKQ A;  4RD4 A;  3ZBU A;  2CND A;  1EFC A;  4M53 A;  1QGY A;  2DCU A;  1FNB A;  3PEN A;  4UAJ A;  3AVX A;  2X3U A;  4YAL A;  1FDR A;  4Y7C A;  1W87 A;  1W2B B;  1JA1 A;  1KJZ A;  4FN5 A;  1QX4 A;  2OK7 A;  2RC6 A;  5AN9 A;  1M90 D;  4PGO A;  3LO8 A;  1YJN B;  5TV2 A;  1FRN A;  1R5N A;  2OTL B;  1W35 A;  1N0U A;  1S72 B;  1DAR A;  4B47 A;  1FNM A;  4TMV A;  4DQK A;  3OZV A;  4G5G A;  1VQ6 B;  1Q82 D;  2PMD A;  2YWE A;  4ZCI A;  4IW3 B;  3CRZ A;  1CQX A;  5HXB A;  1Q7Y D;  1VQO B;  1KC8 D;  4LBZ A;  5EMN A;  2XEX A;  4DQL A;  4PC2 A;  1E63 A;  2BV3 A;  3FPK A;  2FX3 A;  4TMT A;  1YI2 B;  2YWF A;  3CB4 A;  4Y9R A;  5THX A;  3CCE B;  1VQK B;  3CCL B;  5JBQ A;  4TMW A;  1KQS B;  1HA3 A;  1R5B A;  1D1N A;  2VZL A;  3CCV B;  4B3X A;  3OZU A;  2QTZ A;  1YJW B;  3W2F A;  2XNC A;  3ZBT A;  5H5J A;  1WDT A;  4P6V F;  3I56 B;  5H59 A;  4G1B A;  4YHB A;  1F60 A;  4RCZ A;  4NCN A;  1BQE A;  3CCS B;  4ACB A;  1S0U A;  1ZM2 A;  4BPR A;  1AMO A;  3U6B A;  1VQL B;  1QUE A;  2RC5 A;  1TLL A;  1N8R D;  3QFS A;  4M1K A;  3AVT A;  1F20 A;  4YAO A;  2QEX B;  1I7P A;  1U2R A;  4YAU A;  2VNH A;  1YJ9 B;  2J7K A;  1QFJ A;  4RD3 A;  4FWT A;  3CC7 B;  2BGI A;  1QUF A;  2HDN B;  3OJX A;  3WNB A;  4C0S A;  3MCA A;  2BF4 A;  4LBV A;  3AVY A;  3W2G A;  1XE1 A;  4M2L A;  4QHY A;  3QSY A;  1UMK A;  4K1X A;  4AF7 A;  2ZIT A;  3B82 A;  3CPW B;  4R71 A;  3W2H A;  1GVH A;  3U2Q A;  4N3G A;  1BJK A;  2GPJ A;  3AVU A;  4ZGQ B;  2YWG A;  3VO2 A;  2BSA A;  1GO2 A;  4F7D A;  1EFT A;  1DDG A;  2QTL A;  4RD6 A;  4B4D A;  3QFT A;  3W2E A;  1GAQ A;  2B5O A;  3WND A;  1CNE A;  1KK3 A;  4N3N A;  2C77 A;  3LVB A;  3ES9 A;  4M0L A;  2DEU A;  3G4S B;  5GV7 A;  4TMZ A;  2C78 A;  1YIT B;  2BVN A;  2NPF A;  1OB2 A;  4J0Q A;  5FA6 A;  1J9Z A;  3CC2 B;  3MMP A;  1H42 A;  4U9U A;  1VQ7 B;  3AGQ A;  2EIX A;  1H85 A;  2DER A;  3MHP A;  1NDH A;  3V76 A;  3WYA A;  5KSW B;  1KTV A;  1A8P A;  3FJO A;  4LC0 A;  4RD0 A;  1OGI A;  2D74 A;  1M1K D;  1QVG B;  1QFZ A;  1TUI A;  3QFC A;  2VNJ A;  1ELO A;  4AC9 A;  4FK8 A;  1BX0 A;  3W5V A;  3J81 k;  3QE2 A;  3ZZT A;  1K73 D;  3G6E B;  4PC1 A;  4B44 A;  3G71 B;  1VQ9 B;  4QFM A;  5TR9 A;  1KK2 A;  4PC3 A;  2BM0 A;  1GJR A;  3WBJ A;  3QFR A;  2PLF A;  2B7B A;  4ACA A;  1JNY A;  4TMX A;  1VQN B;  4RJL A;  4RD1 A;  4NBS A;  1NJI D;  4EH1 A;  3CD6 B;  2BMW A;  2BM1 A;  1Q86 D;  1N0V C;  1Q81 D;  1CNF A;  4P3Y A;  4MYU A;  3U6K A;  3CCJ B;  1K8A D;  1ZM3 A;  2AHO A;  2HMA A;  1EFU A;  3ZZU A;  1E62 A;  4ZCL A;  3WNC A;  4C43 A;  1QVF B;  3P26 A;  5GV8 A;  2OTJ B;  4PC6 A;  1JJ2 B;  2QDX A;  1FRQ A;  3E1Y E;  4H9G A;  1QG0 A;  3CW2 A;  4MYT A;  4G1V A;  3E20 A;  4Y9U A;  3VO1 A;  1YHQ B;  1B2R A;  2BGJ A;  3W5H A;  1EP2 B;  1KRH A;  4PC7 A;  2YWH A;  3JQP A;  1VQ5 B;  1K9M D;  1OB5 A;  4ZCM A;  3AVW A;  1EWY A;  3CC4 B;  1TTT A;  1EP1 B;  1D2E A;  2QN6 A;  1DDI A;  1EXM A;  4ZV4 A;  1IB0 A;  3OZW A;  4LBW A;  3CME B;  3WBK A;  3JQR A;  2PIA A;  4YAW A;  1AIP A;  3ZC3 A;  1JB9 A;  1DG1 G;  2VNK A;  1W34 A;  1G7T A;  1SM4 A;  3CCM B;  2QA4 B;  4B48 A;  1QGZ A;  5TY0 A;  2BN4 A;  3CMA B;  1GR1 A;  1D8T A;  1IJF A;  4HE5 A;  3VNU A;  1G7S A;  1B23 P;  1E64 A;  2CRV A;  4RD2 A;  3VNV A;  3JQQ A;  1KD1 D;  2B7C A;  1VQP B;  1OGJ A;  1R5O A;  2E1R A;  1XB2 A;  2QMU A;  3B8H A;  1QH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...