4HE5A

Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
REFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase family U32
publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Unknown function
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he5A00
2DCUA 2B5OA 1G7CA 1EFTA 1KJZA 4B48A 4HE5A 3VO2A 1OGIA 5KSWB 1FNCA 3CB4A 1YITB 3P27A 4AF6A 4C0SA 3CCVB 3V76A 2OK7A 1KC8D 3CC2B 3LO8A 3ES9A 1VQLB 1W2BB 4TMZA 1YI2B 1FRNA 3B82A 4C43A 3CCRB 1EFCA 1JA0A 2BMWA 1HA3A 2C77A 2BN4A 2E1RA 2HMAA 3QFSA 5TR9A 3W2FA 4YAOA 1R5NA 1B2RA 1XB2A 2VZLA 4ACAA 1FRQA 2QEXB 3G4SB 2DEUA 3QFCA 4DQLA 1JNYA 3AVVA 3W5UA 4LC0A 1JJ2B 3JQQA 1DDIA 2HCJB 2CRVA 4MYTA 2QDXA 2RC6A 1A8PA 1I7PA 4RD0A 4HE6A 1QFZA 1K9MD 1JB9A 1YIJB 3WNDA 1IB0A 4Y9UA 3WNCA 1QH0A 3JQRA 2VNJA 1G7RA 2YWGA 3OJXA 4LBZA 5H5JA 1GO2A 2GPJA 1D1NA 2EIXA 1DDGA 4AF7A 4EH1A 4P3YA 1YJ9B 3CCJB 1QUEA 3MMPA 4YHBA 1ELOA 2R6HA 4NBSA 3JQPA 3U6BA 1EP3B 2ZITA 4G5GA 2J7KA 3OW2B 1EP2B 1M1KD 2B7BA 1ZM4A 2DETA 4B4DA 2BGIA 1KQSB 4Y7CA 3W2EA 1BQEA 4Q7JB 1KRHA 2VNIA 4F7DA 3AVYA 3MCAA 1GAQA 1FDRA 1YJNB 3AVWA 3MHPA 1W34A 2BM1A 4RD3A 4QHYA 4G1BA 4PC7A 1S72B 4RCZA 4M1KA 1VQNB 3FJOA 3FPKA 2QN6A 2BV3A 2XNJA 2YWFA 1DARA 1EXMA 2XNCA 1BX0A 1YJWB 2BPOA 1QGYA 2XEXA 3B78A 4U9UA 4M2LA 3CMAB 1CQXA 3OZWA 4BPRA 1CNEA 3CPWB 3VNVA 3CD6B 3CW2A 1GJRA 1OB2A 3QE2A 4QFMA 1ZM9A 4RD2A 2D74A 1M90D 4AC9A 2PLFA 1TTTA 3I55B 1EP1B 4WQMA 1VQPB 1G7SA 4ZCIA 2HDNB 2VNKA 4UAJA 1K73D 1NDHA 1FNDA 2CNDA 1QUFA 3VNUA 2X3UA 4TMWA 3CCSB 1FNMA 1AIPA 3W2HA 1ZM3A 1KK2A 1H85A 3VMFA 3E20A 5HXBA 1G7TA 4PC1A 1N0VC 3WBJA 5THXA 4MYUA 3QFRA 3CCQB 5GV7A 2OK8A 3WBKA 1SKQA 3CCEB 3W2GA 1KK3A 2BGJA 4ZV4A 3AGQA 3CCMB 3ZBUA 5JBQA 4TMXA 3CCLB 1U2RA 4LBVA 1Q82D 1B23P 3CMEB 4FK8A 2QA4B 1VQ6B 2VNHA 2OTJB 2QMUA 1FNBA 3AVXA 2BM0A 4RCYA 1OB5A 1JA1A 3SJZA 3W5HA 1S0UA 4PC2A 4YALA 5DSZA 3P26A 4PGOA 4TMTA 3G71B 3OZVA 4PC6A 1BX1A 1WDTA 1GVHA 1VQ9B 3G6EB 1BJKA 4B47A 2BF4A 3ZZ0A 1KD1D 4FWTA 5EMNA 2B7CA 1IJFA 1UMKA 4YAWA 3W2IA 2PMDA 4P6VF 4ZCMA 1KK0A 3OZUA 1AMOA 3CC7B 3WNBA 5AN9A 4H9GA 1IJEA 3CXCB 1W35A 1EWYA 2C78A 1KK1A 4K1XA 1VQ4B 5FA6A 1J9ZA 3CCUB 1QGZA 4RD6A 1XE1A 4J0QA 2OTLB 3OJWA 1ZM2A 1VQ8B 1W87A 1TUIA 2YWHA 1K8AD 4G1VA 1F60A 1GAWA 4B44A 4N3NA 3LVBA 4TN1A 3WY9A 2DERA 1GR1A 1OGJA 1R5BA 4RD4A 1N0UA 2YWEA 1E64A 2NPFA 1QVGB 5TY0A 4YAFA 1VQ5B 1QFJA 4YAUA 1EFUA 3I1FA 1KTVA 4R71A 5TV2A 4RJLA 4B3XA 2QTLA 4PC3A 1QX4A 1QFYA 4RD1A 1D8TA 4N3GA 4DQKA 3AGPA 5H59A 3ZZTA 1TVCA 2DY1A 1DG1G 4FN5A 1CNFA 4TMVA 1ZUNB 1D2EA 3W5VA 3CRZA 4M53A 3B8HA 5GV8A 1TLLA 3QSYA 1QVFB 1YHQB 4M0LA 3AVUA 1SM4A 4M4SA 4LBYA 1VQOB 4B43A 2AHOA 1Q86D 3U2QA 1Q7YD 1E63A 4ACBA 3AVTA 4NCNA 1QG0A 3ZZUA 4LBWA 1NJID 3ZBTA 2PIAA 1Q81D 1VQKB 4IW3B 3E1YE 3J81k 3WXMA 3U6KA 3PENA 2EFGA 2BVNA 3WYAA 3QFTA 3VO1A 2FX3A 1N8RD 2GQFA 1QGAA 3I56B 1E62A 4Y9RA 1F20A 2VYQA 4ZGQB 2QTZA 3CC4B 3ZC3A 4ZCLA 1VQMB 2RC5A 2BSAA 1H42A 1R5OA 1VQ7B 4ZGNB
chains in the Genus database with same CATH superfamily
2JN9A 2V7QA 2DCUA 2B5OA 1G7CA 1WPCA 1EFTA 1KJZA 1VHOA 2V31A 4B48A 4HE5A 3VO2A 1OGIA 5KSWB 1T6YA 1N07A 1FNCA 2C5BA 3CB4A 1YITB 3P27A 4X06A 4AF6A 4C0SA 4XLFA 4QV2A 2WPDA 5FO0A 2QGGA 1UD6A 4X07A 4RDJA 3V76A 3CCVB 2OK7A 2OBSA 3CC2B 1KC8D 1NBMA 5HKKA 3LO8A 1RQPA 1VLYA 4DK0A 2C5HA 5TRDA 3FPPA 3SLDA 5LMZA 3ES9A 1VQLB 2ZZFA 2CW5A 1W2BB 4TMZA 2VJJA 3V7AA 3OAAA 5E6TA 4UZEA 1FRNA 2CBXA 3B82A 4C43A 3CCRB 4XR6A 1EFCA 2F1MA 1YI2B 3ASQA 4WZKA 1JA0A 2BMWA 3RY8A 5F4JA 1V0FA 2X6WA 1HA3A 2C77A 4RPBA 5FL7A 4OOVA 1WOPA 2BN4A 3LQ6A 2ZZEA 4XKVA 5IYRA 4P9SA 1UD4A 2E1RA 5HZBA 2HMAA 3QFSA 2OBTA 2DOGA 5TR9A 1WP6A 3W2FA 4YAOA 3ONYA 4P2NA 2OBRA 1R5NA 4XLCA 1B2RA 4GQNA 1XB2A 2VZLA 4ACAA 1FRQA 5BSYA 2QEXB 4XORA 3G4SB 2DEUA 2CK3A 3T51B 2WJYA 3QFCA 4DQLA 1JNYA 3AVVA 3W5UA 4LC0A 1JJ2B 3OEEA 3JQQA 1DDIA 2HCJB 2CRVA 4MYTA 2QDXA 4G7WA 4XN3A 4P3IA 2RC6A 1A8PA 1I7PA 4UZFA 2Q6OA 4RD0A 3T56B 4HE6A 1QFZA 1K9MD 2JIZA 4WZLA 2DYIA 1JB9A 5IYNA 1YIJB 3SKBA 1IB0A 3WNDA 4Y9UA 3OPOA 4KKSA 3WNCA 4KKUA 1QH0A 2DIEA 3JQRA 3R6JA 2VNJA 3LNNA 4NNJA 1PKVA 1OHHA 3BY2A 1G7RA 2YWGA 3OJXA 4LBZA 5H5JA 4KKTA 1GO2A 3D26A 1E1RA 2GPJA 1D1NA 4E0FA 5FO1A 2EIXA 2Q6IA 1DDGA 2F43A 4AF7A 4P3YA 4EH1A 1YJ9B 3CP8A 3CCJB 1QUEA 4YXWA 3SLNA 5A89A 2JJ1A 3CMMA 1MABA 1ELOA 2R6HA 3MMPA 4G6IA 4YHBA 3A3GA 1BMFA 4NBSA 3JQPA 3U6BA 1EP3B 4PABA 4Z4VA 2ZITA 4P6YA 4G5GA 2J7KA 3OW2B 1EP2B 2M5SA 1M1KD 2B7BA 1Y0YA 1ZM4A 2DETA 1IHMA 2BGIA 4OP7A 4B4DA 1KQSB 4Y7CA 3W2EA 5F4OA 1BQEA 2Z6BD 2V7VA 4Q7JB 4XN0A 1KRHA 2VNIA 4F7DA 3AVYA 3G05A 3MCAA 1GAQA 1FDRA 2R9VA 1YJNB 3AVWA 1V5VA 3MHPA 1W34A 2BM1A 4RD3A 2ZBVA 4QHYA 2WR8A 4G1BA 4P26A 4PC7A 4XL9A 2WZPP 1S72B 4RCZA 3BY1A 4M1KA 1WOSA 4OPVA 2F4NA 4ROXA 1VQNB 4XQFA 3FJOA 4RDLA 1T6ZA 4Z4SA 4OPSA 3FPKA 4RM0A 4OOXA 3GVLA 2QN6A 2BV3A 1WTHD 2XNJA 2YWFA 1DARA 1EXMA 4AVZA 3PA2A 2XNCA 3A3BA 1BX0A 1YJWB 2BPOA 4II2A 1QGYA 1I18A 2XEXA 3B78A 4U9UA 2XZOA 4M2LA 4Z1MA 3CMAB 4RPDA 1CQXA 2WZNA 3OZWA 2X85A 4BPRA 4TKOB 1CNEA 5DS0A 3CPWB 5F4MA 3LQEA 3VNVA 4RLZA 1OB0A 3CD6B 3CW2A 3KL9A 3A1PA 1GJRA 1OB2A 4YELA 1XFOA 3QE2A 4QFMA 3SJPA 1ZM9A 4RD2A 2D74A 1N08A 1M90D 1T5EA 4AC9A 2VBVA 3A8IA 1S4MA 2PLFA 1TTTA 3I55B 1FX0A 3CPXA 4XLEA 2QE7A 1EP1B 2GJRA 4WQMA 1VQPB 1G7SA 2WSSA 4ZCIA 2HDNB 2VNKA 2XZPA 3BNWA 3PUMA 4UAJA 1RQRA 2X6YA 1K73D 1FNDA 1NDHA 4Z4ZA 2C4TA 1I8DA 2CNDA 1UD2A 2V7UA 1QUFA 4X0CA 3VNUA 2X3UA 2X0KA 4TMWA 1EFRA 3CCSB 1FNMA 1AIPA 2E1BA 3WQZA 3W2HA 1ZM3A 1KK2A 4XLAA 4II3A 2ZL6A 1K28D 2X53S 2VBTA 1H85A 2XGJA 2XOKA 3OW7A 3VMFA 3E20A 1W9XA 4G7XA 1PJ7A 2X6XA 5HXBA 1G7TA 4P25A 3ASRA 3KEWA 4PC1A 2GK6A 4XOPA 1N0VC 3WBJA 5THXA 1VF7A 2P3MA 4MYUA 3QFRA 3CCQB 5GV7A 3OEHA 3GVKA 2OK8A 3WBKA 1SKQA 3CCEB 1COWA 3W2GA 1P4MA 2D3NA 1KK3A 3GQBA 3PUNA 4OPOA 3CP2A 4RDKA 2BGJA 4XKWA 5J35A 5FIUA 1E3ZA 4ZV4A 3AGQA 1E1QA 3CCMB 3ASPA 4XM3A 1BPLA 2JJ2A 3ZBUA 4YEJA 5JBQA 4TMXA 2C4UA 3GSIA 3ZUGA 3CCLB 1UD3A 1U2RA 4LBVA 3CESA 4QVAA 1Q82D 3CMEB 1B23P 4FK8A 3Q38A 2QA4B 1VQ6B 3BCFA 4UZUA 1YLOA 2VNHA 3A8KA 1VLOA 2XZLA 2QMUA 2OTJB 1FNBA 3AVXA 2BM0A 4RCYA 4XLHA 5L46A 1OB5A 1H8HA 2OYNA 1JA1A 3SJZA 1VHEA 3W5HA 1WORA 4X8IA 5BSXA 1S0UA 1MRZA 3R6KA 4PC2A 3P26A 4YALA 5DSZA 4PGOA 4TMTA 4XD7A 2ZL7A 3G71B 3OZVA 4PC6A 5IYPA 1BX1A 2ZBUA 3DDYA 3OE7A 1WDTA 2VBUA 5KW9A 1GVHA 5CDFA 1VJSA 5B6IA 1VQ9B 3G6EB 1BJKA 2LZJA 3GIRA 4B47A 3OP1A 2BF4A 3ZZ0A 3ZIAA 2PE3A 1KD1D 4FWTA 5EMNA 2B7CA 1V0EA 1IJFA 3PA1A 4X7DA 4Z4UA 4XMYA 1UMKA 4YAWA 2VJIA 1BLIA 3W2IA 2PMDA 4P6VF 4ZCMA 1KK0A 3OZUA 3Q6RA 1AMOA 2WJVA 2ZTNA 5FNZA 3CC7B 2Q6LA 1Q9SA 4PAAA 3WNBA 3ZPNA 5AN9A 2Q6KA 4H9GA 4Z4YA 1IJEA 4DNRB 3CXCB 4WWVA 5IYWA 5J3OA 1H8EA 4X7FA 3FKSA 1N05A 4P22A 1W35A 1EWYA 2C78A 1WU8A 1KK1A 4K1XA 1VQ4B 5FA6A 1HVXA 4QUZA 1PJ6A 1J9ZA 3CCUB 3BC9A 4Z4TA 3BH4A 1QGZA 5A8AA 4Z4RA 4RD6A 1YX2A 1XE1A 3ONUA 4J0QA 2OTLB 3OJWA 4WZEA 1ZM2A 3Q3AA 4WZTA 1VQ8B 1W87A 1TUIA 2GK7A 2YWHA 5IYQA 1WSRA 1Y0RA 4FXUA 1T6XA 2ZXHA 1HZEA 1F60A 2GJPA 4G1VA 1GAWA 1K8AD 2FVGA 4B44A 2WYRA 4N3NA 4QVJA 5DN6A 2ZL5A 3LVBA 2C2WA 4TSFA 3SEJA 1PJ5A 4TN1A 4XONA 3WY9A 2DERA 1GR1A 5HZAA 1OGJA 1R5BA 4RD4A 1E43A 2GJKA 2D3LA 1N06A 1N0UA 2YWEA 1E64A 2NPFA 1QVGB 2CF4A 5TY0A 1XQBA 3ASTA 4OOSA 3Q39A 4X05A 3JU4A 2KVOA 1NRKA 1W0KA 4L8JA 1QFJA 4YAFA 1VQ5B 4XNFA 4YAUA 1E79A 1EFUA 3I1FA 3Q6QA 1KTVA 4R71A 5TV2A 4RJLA 4B3XA 2QTLA 1SKYB 3GVJA 4PC3A 1QX4A 3ISXA 1QFYA 1KZLA 2ZZQA 4RD1A 2ZZGA 1D8TA 4N3GA 4DQKA 2NV4A 4B3GA 2W6JA 3AGPA 5H59A 3ZZTA 1TVCA 3CTAA 2DY1A 1WOOA 4DNTB 1E3XA 1DG1G 2V7WA 2VBSA 4FN5A 1CNFA 1W0JA 4TMVA 2D9RA 1ZUNB 2JDIA 1D2EA 4B3FX 3VR6A 3W5VA 3CRZA 3OFNA 3B8HA 4M53A 3T53B 5GV8A 1TLLA 5KNLA 3QSYA 1QVFB 2I1LA 1YHQB 3BCDA 3OOCA 4M0LA 3AVUA 1SM4A 4M4SA 4Z4WA 2V7TA 4LBYA 1VQOB 4B43A 2W6IA 2CC2A 3H9NA 2AHOA 4XOTA 1WSVA 3NE5B 1Q86D 3A8JA 3U2QA 1Q7YD 1E63A 4ACBA 3AVTA 4NCNA 1QG0A 2HLDA 3ZZUA 4LBWA 1NB0A 1NJID 1NB9A 3ZBTA 2PIAA 3ASSA 1Q81D 1VQKB 2V7XA 4IW3B 4X7CA 4P12A 4P1VA 3E1YE 3J81k 4CQJA 1KMHA 2F1LA 2XNDA 1UD8A 3WXMA 4HIZA 4DK1A 5A88A 3U6KA 3PENA 2EFGA 2BVNA 1UD5A 4X7EA 5IK2A 3PVDA 3WYAA 3QFTA 3VO1A 3H94A 2FX3A 1N8RD 2GQFA 1QGAA 4ASUA 2GREA 3I56B 4TT3A 1E62A 4Y9RA 1F20A 2X8KA 4JMQA 2ZTGA 2VYQA 4ZGQB 2ZXIA 2QTZA 3A35A 3CC4B 2V4DA 3OKXA 3HAGA 4ZCLA 3ZC3A 2RC5A 1VQMB 2BSAA 3BQJA 1H42A 1R5OA 1VQ7B 4ZGNB
chains in the Genus database with same CATH topology
2DCUA 2B5OA 1G7CA 1EFTA 1KJZA 4B48A 4HE5A 3VO2A 1OGIA 5KSWB 1FNCA 3CB4A 1YITB 3P27A 4AF6A 4C0SA 3CCVB 3V76A 2OK7A 1KC8D 3CC2B 3LO8A 3ES9A 1VQLB 1W2BB 4TMZA 1YI2B 1FRNA 3B82A 4C43A 3CCRB 1EFCA 1JA0A 2BMWA 1HA3A 2C77A 2BN4A 2E1RA 2HMAA 3QFSA 5TR9A 3W2FA 4YAOA 1R5NA 1B2RA 1XB2A 2VZLA 4ACAA 1FRQA 2QEXB 3G4SB 2DEUA 3QFCA 4DQLA 1JNYA 3AVVA 3W5UA 4LC0A 1JJ2B 3JQQA 1DDIA 2HCJB 2CRVA 4MYTA 2QDXA 2RC6A 1A8PA 1I7PA 4RD0A 4HE6A 1QFZA 1K9MD 1JB9A 1YIJB 3WNDA 1IB0A 4Y9UA 3WNCA 1QH0A 3JQRA 2VNJA 1G7RA 2YWGA 3OJXA 4LBZA 5H5JA 1GO2A 2GPJA 1D1NA 2EIXA 1DDGA 4AF7A 4EH1A 4P3YA 1YJ9B 3CCJB 1QUEA 3MMPA 4YHBA 1ELOA 2R6HA 4NBSA 3JQPA 3U6BA 1EP3B 2ZITA 4G5GA 2J7KA 3OW2B 1EP2B 1M1KD 2B7BA 1ZM4A 2DETA 4B4DA 2BGIA 1KQSB 4Y7CA 3W2EA 1BQEA 4Q7JB 1KRHA 2VNIA 4F7DA 3AVYA 3MCAA 1GAQA 1FDRA 1YJNB 3AVWA 3MHPA 1W34A 2BM1A 4RD3A 4QHYA 4G1BA 4PC7A 1S72B 4RCZA 4M1KA 1VQNB 3FJOA 3FPKA 2QN6A 2BV3A 2XNJA 2YWFA 1DARA 1EXMA 2XNCA 1BX0A 1YJWB 2BPOA 1QGYA 2XEXA 3B78A 4U9UA 4M2LA 3CMAB 1CQXA 3OZWA 4BPRA 1CNEA 3CPWB 3VNVA 3CD6B 3CW2A 1GJRA 1OB2A 3QE2A 4QFMA 1ZM9A 4RD2A 2D74A 1M90D 4AC9A 2PLFA 1TTTA 3I55B 1EP1B 4WQMA 1VQPB 1G7SA 4ZCIA 2HDNB 2VNKA 4UAJA 1K73D 1NDHA 1FNDA 2CNDA 1QUFA 3VNUA 2X3UA 4TMWA 3CCSB 1FNMA 1AIPA 3W2HA 1ZM3A 1KK2A 1H85A 3VMFA 3E20A 5HXBA 1G7TA 4PC1A 1N0VC 3WBJA 5THXA 4MYUA 3QFRA 3CCQB 5GV7A 2OK8A 3WBKA 1SKQA 3CCEB 3W2GA 1KK3A 2BGJA 4ZV4A 3AGQA 3CCMB 3ZBUA 5JBQA 4TMXA 3CCLB 1U2RA 4LBVA 1Q82D 1B23P 3CMEB 4FK8A 2QA4B 1VQ6B 2VNHA 2OTJB 2QMUA 1FNBA 3AVXA 2BM0A 4RCYA 1OB5A 1JA1A 3SJZA 3W5HA 1S0UA 4PC2A 4YALA 5DSZA 3P26A 4PGOA 4TMTA 3G71B 3OZVA 4PC6A 1BX1A 1WDTA 1GVHA 1VQ9B 3G6EB 1BJKA 4B47A 2BF4A 3ZZ0A 1KD1D 4FWTA 5EMNA 2B7CA 1IJFA 1UMKA 4YAWA 3W2IA 2PMDA 4P6VF 4ZCMA 1KK0A 3OZUA 1AMOA 3CC7B 3WNBA 5AN9A 4H9GA 1IJEA 3CXCB 1W35A 1EWYA 2C78A 1KK1A 4K1XA 1VQ4B 5FA6A 1J9ZA 3CCUB 1QGZA 4RD6A 1XE1A 4J0QA 2OTLB 3OJWA 1ZM2A 1VQ8B 1W87A 1TUIA 2YWHA 1K8AD 4G1VA 1F60A 1GAWA 4B44A 4N3NA 3LVBA 4TN1A 3WY9A 2DERA 1GR1A 1OGJA 1R5BA 4RD4A 1N0UA 2YWEA 1E64A 2NPFA 1QVGB 5TY0A 4YAFA 1VQ5B 1QFJA 4YAUA 1EFUA 3I1FA 1KTVA 4R71A 5TV2A 4RJLA 4B3XA 2QTLA 4PC3A 1QX4A 1QFYA 4RD1A 1D8TA 4N3GA 4DQKA 3AGPA 5H59A 3ZZTA 1TVCA 2DY1A 1DG1G 4FN5A 1CNFA 4TMVA 1ZUNB 1D2EA 3W5VA 3CRZA 4M53A 3B8HA 5GV8A 1TLLA 3QSYA 1QVFB 1YHQB 4M0LA 3AVUA 1SM4A 4M4SA 4LBYA 1VQOB 4B43A 2AHOA 1Q86D 3U2QA 1Q7YD 1E63A 4ACBA 3AVTA 4NCNA 1QG0A 3ZZUA 4LBWA 1NJID 3ZBTA 2PIAA 1Q81D 1VQKB 4IW3B 3E1YE 3J81k 3WXMA 3U6KA 3PENA 2EFGA 2BVNA 3WYAA 3QFTA 3VO1A 2FX3A 1N8RD 2GQFA 1QGAA 3I56B 1E62A 4Y9RA 1F20A 2VYQA 4ZGQB 2QTZA 3CC4B 3ZC3A 4ZCLA 1VQMB 2RC5A 2BSAA 1H42A 1R5OA 1VQ7B 4ZGNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCU A;  2B5O A;  1G7C A;  1EFT A;  1KJZ A;  4B48 A;  4HE5 A;  3VO2 A;  1OGI A;  5KSW B;  1FNC A;  3CB4 A;  1YIT B;  3P27 A;  4AF6 A;  4C0S A;  3CCV B;  3V76 A;  2OK7 A;  1KC8 D;  3CC2 B;  3LO8 A;  3ES9 A;  1VQL B;  1W2B B;  4TMZ A;  1YI2 B;  1FRN A;  3B82 A;  4C43 A;  3CCR B;  1EFC A;  1JA0 A;  2BMW A;  1HA3 A;  2C77 A;  2BN4 A;  2E1R A;  2HMA A;  3QFS A;  5TR9 A;  3W2F A;  4YAO A;  1R5N A;  1B2R A;  1XB2 A;  2VZL A;  4ACA A;  1FRQ A;  2QEX B;  3G4S B;  2DEU A;  3QFC A;  4DQL A;  1JNY A;  3AVV A;  3W5U A;  4LC0 A;  1JJ2 B;  3JQQ A;  1DDI A;  2HCJ B;  2CRV A;  4MYT A;  2QDX A;  2RC6 A;  1A8P A;  1I7P A;  4RD0 A;  4HE6 A;  1QFZ A;  1K9M D;  1JB9 A;  1YIJ B;  3WND A;  1IB0 A;  4Y9U A;  3WNC A;  1QH0 A;  3JQR A;  2VNJ A;  1G7R A;  2YWG A;  3OJX A;  4LBZ A;  5H5J A;  1GO2 A;  2GPJ A;  1D1N A;  2EIX A;  1DDG A;  4AF7 A;  4EH1 A;  4P3Y A;  1YJ9 B;  3CCJ B;  1QUE A;  3MMP A;  4YHB A;  1ELO A;  2R6H A;  4NBS A;  3JQP A;  3U6B A;  1EP3 B;  2ZIT A;  4G5G A;  2J7K A;  3OW2 B;  1EP2 B;  1M1K D;  2B7B A;  1ZM4 A;  2DET A;  4B4D A;  2BGI A;  1KQS B;  4Y7C A;  3W2E A;  1BQE A;  4Q7J B;  1KRH A;  2VNI A;  4F7D A;  3AVY A;  3MCA A;  1GAQ A;  1FDR A;  1YJN B;  3AVW A;  3MHP A;  1W34 A;  2BM1 A;  4RD3 A;  4QHY A;  4G1B A;  4PC7 A;  1S72 B;  4RCZ A;  4M1K A;  1VQN B;  3FJO A;  3FPK A;  2QN6 A;  2BV3 A;  2XNJ A;  2YWF A;  1DAR A;  1EXM A;  2XNC A;  1BX0 A;  1YJW B;  2BPO A;  1QGY A;  2XEX A;  3B78 A;  4U9U A;  4M2L A;  3CMA B;  1CQX A;  3OZW A;  4BPR A;  1CNE A;  3CPW B;  3VNV A;  3CD6 B;  3CW2 A;  1GJR A;  1OB2 A;  3QE2 A;  4QFM A;  1ZM9 A;  4RD2 A;  2D74 A;  1M90 D;  4AC9 A;  2PLF A;  1TTT A;  3I55 B;  1EP1 B;  4WQM A;  1VQP B;  1G7S A;  4ZCI A;  2HDN B;  2VNK A;  4UAJ A;  1K73 D;  1NDH A;  1FND A;  2CND A;  1QUF A;  3VNU A;  2X3U A;  4TMW A;  3CCS B;  1FNM A;  1AIP A;  3W2H A;  1ZM3 A;  1KK2 A;  1H85 A;  3VMF A;  3E20 A;  5HXB A;  1G7T A;  4PC1 A;  1N0V C;  3WBJ A;  5THX A;  4MYU A;  3QFR A;  3CCQ B;  5GV7 A;  2OK8 A;  3WBK A;  1SKQ A;  3CCE B;  3W2G A;  1KK3 A;  2BGJ A;  4ZV4 A;  3AGQ A;  3CCM B;  3ZBU A;  5JBQ A;  4TMX A;  3CCL B;  1U2R A;  4LBV A;  1Q82 D;  1B23 P;  3CME B;  4FK8 A;  2QA4 B;  1VQ6 B;  2VNH A;  2OTJ B;  2QMU A;  1FNB A;  3AVX A;  2BM0 A;  4RCY A;  1OB5 A;  1JA1 A;  3SJZ A;  3W5H A;  1S0U A;  4PC2 A;  4YAL A;  5DSZ A;  3P26 A;  4PGO A;  4TMT A;  3G71 B;  3OZV A;  4PC6 A;  1BX1 A;  1WDT A;  1GVH A;  1VQ9 B;  3G6E B;  1BJK A;  4B47 A;  2BF4 A;  3ZZ0 A;  1KD1 D;  4FWT A;  5EMN A;  2B7C A;  1IJF A;  1UMK A;  4YAW A;  3W2I A;  2PMD A;  4P6V F;  4ZCM A;  1KK0 A;  3OZU A;  1AMO A;  3CC7 B;  3WNB A;  5AN9 A;  4H9G A;  1IJE A;  3CXC B;  1W35 A;  1EWY A;  2C78 A;  1KK1 A;  4K1X A;  1VQ4 B;  5FA6 A;  1J9Z A;  3CCU B;  1QGZ A;  4RD6 A;  1XE1 A;  4J0Q A;  2OTL B;  3OJW A;  1ZM2 A;  1VQ8 B;  1W87 A;  1TUI A;  2YWH A;  1K8A D;  4G1V A;  1F60 A;  1GAW A;  4B44 A;  4N3N A;  3LVB A;  4TN1 A;  3WY9 A;  2DER A;  1GR1 A;  1OGJ A;  1R5B A;  4RD4 A;  1N0U A;  2YWE A;  1E64 A;  2NPF A;  1QVG B;  5TY0 A;  4YAF A;  1VQ5 B;  1QFJ A;  4YAU A;  1EFU A;  3I1F A;  1KTV A;  4R71 A;  5TV2 A;  4RJL A;  4B3X A;  2QTL A;  4PC3 A;  1QX4 A;  1QFY A;  4RD1 A;  1D8T A;  4N3G A;  4DQK A;  3AGP A;  5H59 A;  3ZZT A;  1TVC A;  2DY1 A;  1DG1 G;  4FN5 A;  1CNF A;  4TMV A;  1ZUN B;  1D2E A;  3W5V A;  3CRZ A;  4M53 A;  3B8H A;  5GV8 A;  1TLL A;  3QSY A;  1QVF B;  1YHQ B;  4M0L A;  3AVU A;  1SM4 A;  4M4S A;  4LBY A;  1VQO B;  4B43 A;  2AHO A;  1Q86 D;  3U2Q A;  1Q7Y D;  1E63 A;  4ACB A;  3AVT A;  4NCN A;  1QG0 A;  3ZZU A;  4LBW A;  1NJI D;  3ZBT A;  2PIA A;  1Q81 D;  1VQK B;  4IW3 B;  3E1Y E;  3J81 k;  3WXM A;  3U6K A;  3PEN A;  2EFG A;  2BVN A;  3WYA A;  3QFT A;  3VO1 A;  2FX3 A;  1N8R D;  2GQF A;  1QGA A;  3I56 B;  1E62 A;  4Y9R A;  1F20 A;  2VYQ A;  4ZGQ B;  2QTZ A;  3CC4 B;  3ZC3 A;  4ZCL A;  1VQM B;  2RC5 A;  2BSA A;  1H42 A;  1R5O A;  1VQ7 B;  4ZGN B; 
#chains in the Genus database with same CATH topology
 2JN9 A;  2V7Q A;  2DCU A;  2B5O A;  1G7C A;  1WPC A;  1EFT A;  1KJZ A;  1VHO A;  2V31 A;  4B48 A;  4HE5 A;  3VO2 A;  1OGI A;  5KSW B;  1T6Y A;  1N07 A;  1FNC A;  2C5B A;  3CB4 A;  1YIT B;  3P27 A;  4X06 A;  4AF6 A;  4C0S A;  4XLF A;  4QV2 A;  2WPD A;  5FO0 A;  2QGG A;  1UD6 A;  4X07 A;  4RDJ A;  3V76 A;  3CCV B;  2OK7 A;  2OBS A;  3CC2 B;  1KC8 D;  1NBM A;  5HKK A;  3LO8 A;  1RQP A;  1VLY A;  4DK0 A;  2C5H A;  5TRD A;  3FPP A;  3SLD A;  5LMZ A;  3ES9 A;  1VQL B;  2ZZF A;  2CW5 A;  1W2B B;  4TMZ A;  2VJJ A;  3V7A A;  3OAA A;  5E6T A;  4UZE A;  1FRN A;  2CBX A;  3B82 A;  4C43 A;  3CCR B;  4XR6 A;  1EFC A;  2F1M A;  1YI2 B;  3ASQ A;  4WZK A;  1JA0 A;  2BMW A;  3RY8 A;  5F4J A;  1V0F A;  2X6W A;  1HA3 A;  2C77 A;  4RPB A;  5FL7 A;  4OOV A;  1WOP A;  2BN4 A;  3LQ6 A;  2ZZE A;  4XKV A;  5IYR A;  4P9S A;  1UD4 A;  2E1R A;  5HZB A;  2HMA A;  3QFS A;  2OBT A;  2DOG A;  5TR9 A;  1WP6 A;  3W2F A;  4YAO A;  3ONY A;  4P2N A;  2OBR A;  1R5N A;  4XLC A;  1B2R A;  4GQN A;  1XB2 A;  2VZL A;  4ACA A;  1FRQ A;  5BSY A;  2QEX B;  4XOR A;  3G4S B;  2DEU A;  2CK3 A;  3T51 B;  2WJY A;  3QFC A;  4DQL A;  1JNY A;  3AVV A;  3W5U A;  4LC0 A;  1JJ2 B;  3OEE A;  3JQQ A;  1DDI A;  2HCJ B;  2CRV A;  4MYT A;  2QDX A;  4G7W A;  4XN3 A;  4P3I A;  2RC6 A;  1A8P A;  1I7P A;  4UZF A;  2Q6O A;  4RD0 A;  3T56 B;  4HE6 A;  1QFZ A;  1K9M D;  2JIZ A;  4WZL A;  2DYI A;  1JB9 A;  5IYN A;  1YIJ B;  3SKB A;  1IB0 A;  3WND A;  4Y9U A;  3OPO A;  4KKS A;  3WNC A;  4KKU A;  1QH0 A;  2DIE A;  3JQR A;  3R6J A;  2VNJ A;  3LNN A;  4NNJ A;  1PKV A;  1OHH A;  3BY2 A;  1G7R A;  2YWG A;  3OJX A;  4LBZ A;  5H5J A;  4KKT A;  1GO2 A;  3D26 A;  1E1R A;  2GPJ A;  1D1N A;  4E0F A;  5FO1 A;  2EIX A;  2Q6I A;  1DDG A;  2F43 A;  4AF7 A;  4P3Y A;  4EH1 A;  1YJ9 B;  3CP8 A;  3CCJ B;  1QUE A;  4YXW A;  3SLN A;  5A89 A;  2JJ1 A;  3CMM A;  1MAB A;  1ELO A;  2R6H A;  3MMP A;  4G6I A;  4YHB A;  3A3G A;  1BMF A;  4NBS A;  3JQP A;  3U6B A;  1EP3 B;  4PAB A;  4Z4V A;  2ZIT A;  4P6Y A;  4G5G A;  2J7K A;  3OW2 B;  1EP2 B;  2M5S A;  1M1K D;  2B7B A;  1Y0Y A;  1ZM4 A;  2DET A;  1IHM A;  2BGI A;  4OP7 A;  4B4D A;  1KQS B;  4Y7C A;  3W2E A;  5F4O A;  1BQE A;  2Z6B D;  2V7V A;  4Q7J B;  4XN0 A;  1KRH A;  2VNI A;  4F7D A;  3AVY A;  3G05 A;  3MCA A;  1GAQ A;  1FDR A;  2R9V A;  1YJN B;  3AVW A;  1V5V A;  3MHP A;  1W34 A;  2BM1 A;  4RD3 A;  2ZBV A;  4QHY A;  2WR8 A;  4G1B A;  4P26 A;  4PC7 A;  4XL9 A;  2WZP P;  1S72 B;  4RCZ A;  3BY1 A;  4M1K A;  1WOS A;  4OPV A;  2F4N A;  4ROX A;  1VQN B;  4XQF A;  3FJO A;  4RDL A;  1T6Z A;  4Z4S A;  4OPS A;  3FPK A;  4RM0 A;  4OOX A;  3GVL A;  2QN6 A;  2BV3 A;  1WTH D;  2XNJ A;  2YWF A;  1DAR A;  1EXM A;  4AVZ A;  3PA2 A;  2XNC A;  3A3B A;  1BX0 A;  1YJW B;  2BPO A;  4II2 A;  1QGY A;  1I18 A;  2XEX A;  3B78 A;  4U9U A;  2XZO A;  4M2L A;  4Z1M A;  3CMA B;  4RPD A;  1CQX A;  2WZN A;  3OZW A;  2X85 A;  4BPR A;  4TKO B;  1CNE A;  5DS0 A;  3CPW B;  5F4M A;  3LQE A;  3VNV A;  4RLZ A;  1OB0 A;  3CD6 B;  3CW2 A;  3KL9 A;  3A1P A;  1GJR A;  1OB2 A;  4YEL A;  1XFO A;  3QE2 A;  4QFM A;  3SJP A;  1ZM9 A;  4RD2 A;  2D74 A;  1N08 A;  1M90 D;  1T5E A;  4AC9 A;  2VBV A;  3A8I A;  1S4M A;  2PLF A;  1TTT A;  3I55 B;  1FX0 A;  3CPX A;  4XLE A;  2QE7 A;  1EP1 B;  2GJR A;  4WQM A;  1VQP B;  1G7S A;  2WSS A;  4ZCI A;  2HDN B;  2VNK A;  2XZP A;  3BNW A;  3PUM A;  4UAJ A;  1RQR A;  2X6Y A;  1K73 D;  1FND A;  1NDH A;  4Z4Z A;  2C4T A;  1I8D A;  2CND A;  1UD2 A;  2V7U A;  1QUF A;  4X0C A;  3VNU A;  2X3U A;  2X0K A;  4TMW A;  1EFR A;  3CCS B;  1FNM A;  1AIP A;  2E1B A;  3WQZ A;  3W2H A;  1ZM3 A;  1KK2 A;  4XLA A;  4II3 A;  2ZL6 A;  1K28 D;  2X53 S;  2VBT A;  1H85 A;  2XGJ A;  2XOK A;  3OW7 A;  3VMF A;  3E20 A;  1W9X A;  4G7X A;  1PJ7 A;  2X6X A;  5HXB A;  1G7T A;  4P25 A;  3ASR A;  3KEW A;  4PC1 A;  2GK6 A;  4XOP A;  1N0V C;  3WBJ A;  5THX A;  1VF7 A;  2P3M A;  4MYU A;  3QFR A;  3CCQ B;  5GV7 A;  3OEH A;  3GVK A;  2OK8 A;  3WBK A;  1SKQ A;  3CCE B;  1COW A;  3W2G A;  1P4M A;  2D3N A;  1KK3 A;  3GQB A;  3PUN A;  4OPO A;  3CP2 A;  4RDK A;  2BGJ A;  4XKW A;  5J35 A;  5FIU A;  1E3Z A;  4ZV4 A;  3AGQ A;  1E1Q A;  3CCM B;  3ASP A;  4XM3 A;  1BPL A;  2JJ2 A;  3ZBU A;  4YEJ A;  5JBQ A;  4TMX A;  2C4U A;  3GSI A;  3ZUG A;  3CCL B;  1UD3 A;  1U2R A;  4LBV A;  3CES A;  4QVA A;  1Q82 D;  3CME B;  1B23 P;  4FK8 A;  3Q38 A;  2QA4 B;  1VQ6 B;  3BCF A;  4UZU A;  1YLO A;  2VNH A;  3A8K A;  1VLO A;  2XZL A;  2QMU A;  2OTJ B;  1FNB A;  3AVX A;  2BM0 A;  4RCY A;  4XLH A;  5L46 A;  1OB5 A;  1H8H A;  2OYN A;  1JA1 A;  3SJZ A;  1VHE A;  3W5H A;  1WOR A;  4X8I A;  5BSX A;  1S0U A;  1MRZ A;  3R6K A;  4PC2 A;  3P26 A;  4YAL A;  5DSZ A;  4PGO A;  4TMT A;  4XD7 A;  2ZL7 A;  3G71 B;  3OZV A;  4PC6 A;  5IYP A;  1BX1 A;  2ZBU A;  3DDY A;  3OE7 A;  1WDT A;  2VBU A;  5KW9 A;  1GVH A;  5CDF A;  1VJS A;  5B6I A;  1VQ9 B;  3G6E B;  1BJK A;  2LZJ A;  3GIR A;  4B47 A;  3OP1 A;  2BF4 A;  3ZZ0 A;  3ZIA A;  2PE3 A;  1KD1 D;  4FWT A;  5EMN A;  2B7C A;  1V0E A;  1IJF A;  3PA1 A;  4X7D A;  4Z4U A;  4XMY A;  1UMK A;  4YAW A;  2VJI A;  1BLI A;  3W2I A;  2PMD A;  4P6V F;  4ZCM A;  1KK0 A;  3OZU A;  3Q6R A;  1AMO A;  2WJV A;  2ZTN A;  5FNZ A;  3CC7 B;  2Q6L A;  1Q9S A;  4PAA A;  3WNB A;  3ZPN A;  5AN9 A;  2Q6K A;  4H9G A;  4Z4Y A;  1IJE A;  4DNR B;  3CXC B;  4WWV A;  5IYW A;  5J3O A;  1H8E A;  4X7F A;  3FKS A;  1N05 A;  4P22 A;  1W35 A;  1EWY A;  2C78 A;  1WU8 A;  1KK1 A;  4K1X A;  1VQ4 B;  5FA6 A;  1HVX A;  4QUZ A;  1PJ6 A;  1J9Z A;  3CCU B;  3BC9 A;  4Z4T A;  3BH4 A;  1QGZ A;  5A8A A;  4Z4R A;  4RD6 A;  1YX2 A;  1XE1 A;  3ONU A;  4J0Q A;  2OTL B;  3OJW A;  4WZE A;  1ZM2 A;  3Q3A A;  4WZT A;  1VQ8 B;  1W87 A;  1TUI A;  2GK7 A;  2YWH A;  5IYQ A;  1WSR A;  1Y0R A;  4FXU A;  1T6X A;  2ZXH A;  1HZE A;  1F60 A;  2GJP A;  4G1V A;  1GAW A;  1K8A D;  2FVG A;  4B44 A;  2WYR A;  4N3N A;  4QVJ A;  5DN6 A;  2ZL5 A;  3LVB A;  2C2W A;  4TSF A;  3SEJ A;  1PJ5 A;  4TN1 A;  4XON A;  3WY9 A;  2DER A;  1GR1 A;  5HZA A;  1OGJ A;  1R5B A;  4RD4 A;  1E43 A;  2GJK A;  2D3L A;  1N06 A;  1N0U A;  2YWE A;  1E64 A;  2NPF A;  1QVG B;  2CF4 A;  5TY0 A;  1XQB A;  3AST A;  4OOS A;  3Q39 A;  4X05 A;  3JU4 A;  2KVO A;  1NRK A;  1W0K A;  4L8J A;  1QFJ A;  4YAF A;  1VQ5 B;  4XNF A;  4YAU A;  1E79 A;  1EFU A;  3I1F A;  3Q6Q A;  1KTV A;  4R71 A;  5TV2 A;  4RJL A;  4B3X A;  2QTL A;  1SKY B;  3GVJ A;  4PC3 A;  1QX4 A;  3ISX A;  1QFY A;  1KZL A;  2ZZQ A;  4RD1 A;  2ZZG A;  1D8T A;  4N3G A;  4DQK A;  2NV4 A;  4B3G A;  2W6J A;  3AGP A;  5H59 A;  3ZZT A;  1TVC A;  3CTA A;  2DY1 A;  1WOO A;  4DNT B;  1E3X A;  1DG1 G;  2V7W A;  2VBS A;  4FN5 A;  1CNF A;  1W0J A;  4TMV A;  2D9R A;  1ZUN B;  2JDI A;  1D2E A;  4B3F X;  3VR6 A;  3W5V A;  3CRZ A;  3OFN A;  3B8H A;  4M53 A;  3T53 B;  5GV8 A;  1TLL A;  5KNL A;  3QSY A;  1QVF B;  2I1L A;  1YHQ B;  3BCD A;  3OOC A;  4M0L A;  3AVU A;  1SM4 A;  4M4S A;  4Z4W A;  2V7T A;  4LBY A;  1VQO B;  4B43 A;  2W6I A;  2CC2 A;  3H9N A;  2AHO A;  4XOT A;  1WSV A;  3NE5 B;  1Q86 D;  3A8J A;  3U2Q A;  1Q7Y D;  1E63 A;  4ACB A;  3AVT A;  4NCN A;  1QG0 A;  2HLD A;  3ZZU A;  4LBW A;  1NB0 A;  1NJI D;  1NB9 A;  3ZBT A;  2PIA A;  3ASS A;  1Q81 D;  1VQK B;  2V7X A;  4IW3 B;  4X7C A;  4P12 A;  4P1V A;  3E1Y E;  3J81 k;  4CQJ A;  1KMH A;  2F1L A;  2XND A;  1UD8 A;  3WXM A;  4HIZ A;  4DK1 A;  5A88 A;  3U6K A;  3PEN A;  2EFG A;  2BVN A;  1UD5 A;  4X7E A;  5IK2 A;  3PVD A;  3WYA A;  3QFT A;  3VO1 A;  3H94 A;  2FX3 A;  1N8R D;  2GQF A;  1QGA A;  4ASU A;  2GRE A;  3I56 B;  4TT3 A;  1E62 A;  4Y9R A;  1F20 A;  2X8K A;  4JMQ A;  2ZTG A;  2VYQ A;  4ZGQ B;  2ZXI A;  2QTZ A;  3A35 A;  3CC4 B;  2V4D A;  3OKX A;  3HAG A;  4ZCL A;  3ZC3 A;  2RC5 A;  1VQM B;  2BSA A;  3BQJ A;  1H42 A;  1R5O A;  1VQ7 B;  4ZGN B; 
#chains in the Genus database with same CATH homology
 2DCU A;  2B5O A;  1G7C A;  1EFT A;  1KJZ A;  4B48 A;  4HE5 A;  3VO2 A;  1OGI A;  5KSW B;  1FNC A;  3CB4 A;  1YIT B;  3P27 A;  4AF6 A;  4C0S A;  3CCV B;  3V76 A;  2OK7 A;  1KC8 D;  3CC2 B;  3LO8 A;  3ES9 A;  1VQL B;  1W2B B;  4TMZ A;  1YI2 B;  1FRN A;  3B82 A;  4C43 A;  3CCR B;  1EFC A;  1JA0 A;  2BMW A;  1HA3 A;  2C77 A;  2BN4 A;  2E1R A;  2HMA A;  3QFS A;  5TR9 A;  3W2F A;  4YAO A;  1R5N A;  1B2R A;  1XB2 A;  2VZL A;  4ACA A;  1FRQ A;  2QEX B;  3G4S B;  2DEU A;  3QFC A;  4DQL A;  1JNY A;  3AVV A;  3W5U A;  4LC0 A;  1JJ2 B;  3JQQ A;  1DDI A;  2HCJ B;  2CRV A;  4MYT A;  2QDX A;  2RC6 A;  1A8P A;  1I7P A;  4RD0 A;  4HE6 A;  1QFZ A;  1K9M D;  1JB9 A;  1YIJ B;  3WND A;  1IB0 A;  4Y9U A;  3WNC A;  1QH0 A;  3JQR A;  2VNJ A;  1G7R A;  2YWG A;  3OJX A;  4LBZ A;  5H5J A;  1GO2 A;  2GPJ A;  1D1N A;  2EIX A;  1DDG A;  4AF7 A;  4EH1 A;  4P3Y A;  1YJ9 B;  3CCJ B;  1QUE A;  3MMP A;  4YHB A;  1ELO A;  2R6H A;  4NBS A;  3JQP A;  3U6B A;  1EP3 B;  2ZIT A;  4G5G A;  2J7K A;  3OW2 B;  1EP2 B;  1M1K D;  2B7B A;  1ZM4 A;  2DET A;  4B4D A;  2BGI A;  1KQS B;  4Y7C A;  3W2E A;  1BQE A;  4Q7J B;  1KRH A;  2VNI A;  4F7D A;  3AVY A;  3MCA A;  1GAQ A;  1FDR A;  1YJN B;  3AVW A;  3MHP A;  1W34 A;  2BM1 A;  4RD3 A;  4QHY A;  4G1B A;  4PC7 A;  1S72 B;  4RCZ A;  4M1K A;  1VQN B;  3FJO A;  3FPK A;  2QN6 A;  2BV3 A;  2XNJ A;  2YWF A;  1DAR A;  1EXM A;  2XNC A;  1BX0 A;  1YJW B;  2BPO A;  1QGY A;  2XEX A;  3B78 A;  4U9U A;  4M2L A;  3CMA B;  1CQX A;  3OZW A;  4BPR A;  1CNE A;  3CPW B;  3VNV A;  3CD6 B;  3CW2 A;  1GJR A;  1OB2 A;  3QE2 A;  4QFM A;  1ZM9 A;  4RD2 A;  2D74 A;  1M90 D;  4AC9 A;  2PLF A;  1TTT A;  3I55 B;  1EP1 B;  4WQM A;  1VQP B;  1G7S A;  4ZCI A;  2HDN B;  2VNK A;  4UAJ A;  1K73 D;  1NDH A;  1FND A;  2CND A;  1QUF A;  3VNU A;  2X3U A;  4TMW A;  3CCS B;  1FNM A;  1AIP A;  3W2H A;  1ZM3 A;  1KK2 A;  1H85 A;  3VMF A;  3E20 A;  5HXB A;  1G7T A;  4PC1 A;  1N0V C;  3WBJ A;  5THX A;  4MYU A;  3QFR A;  3CCQ B;  5GV7 A;  2OK8 A;  3WBK A;  1SKQ A;  3CCE B;  3W2G A;  1KK3 A;  2BGJ A;  4ZV4 A;  3AGQ A;  3CCM B;  3ZBU A;  5JBQ A;  4TMX A;  3CCL B;  1U2R A;  4LBV A;  1Q82 D;  1B23 P;  3CME B;  4FK8 A;  2QA4 B;  1VQ6 B;  2VNH A;  2OTJ B;  2QMU A;  1FNB A;  3AVX A;  2BM0 A;  4RCY A;  1OB5 A;  1JA1 A;  3SJZ A;  3W5H A;  1S0U A;  4PC2 A;  4YAL A;  5DSZ A;  3P26 A;  4PGO A;  4TMT A;  3G71 B;  3OZV A;  4PC6 A;  1BX1 A;  1WDT A;  1GVH A;  1VQ9 B;  3G6E B;  1BJK A;  4B47 A;  2BF4 A;  3ZZ0 A;  1KD1 D;  4FWT A;  5EMN A;  2B7C A;  1IJF A;  1UMK A;  4YAW A;  3W2I A;  2PMD A;  4P6V F;  4ZCM A;  1KK0 A;  3OZU A;  1AMO A;  3CC7 B;  3WNB A;  5AN9 A;  4H9G A;  1IJE A;  3CXC B;  1W35 A;  1EWY A;  2C78 A;  1KK1 A;  4K1X A;  1VQ4 B;  5FA6 A;  1J9Z A;  3CCU B;  1QGZ A;  4RD6 A;  1XE1 A;  4J0Q A;  2OTL B;  3OJW A;  1ZM2 A;  1VQ8 B;  1W87 A;  1TUI A;  2YWH A;  1K8A D;  4G1V A;  1F60 A;  1GAW A;  4B44 A;  4N3N A;  3LVB A;  4TN1 A;  3WY9 A;  2DER A;  1GR1 A;  1OGJ A;  1R5B A;  4RD4 A;  1N0U A;  2YWE A;  1E64 A;  2NPF A;  1QVG B;  5TY0 A;  4YAF A;  1VQ5 B;  1QFJ A;  4YAU A;  1EFU A;  3I1F A;  1KTV A;  4R71 A;  5TV2 A;  4RJL A;  4B3X A;  2QTL A;  4PC3 A;  1QX4 A;  1QFY A;  4RD1 A;  1D8T A;  4N3G A;  4DQK A;  3AGP A;  5H59 A;  3ZZT A;  1TVC A;  2DY1 A;  1DG1 G;  4FN5 A;  1CNF A;  4TMV A;  1ZUN B;  1D2E A;  3W5V A;  3CRZ A;  4M53 A;  3B8H A;  5GV8 A;  1TLL A;  3QSY A;  1QVF B;  1YHQ B;  4M0L A;  3AVU A;  1SM4 A;  4M4S A;  4LBY A;  1VQO B;  4B43 A;  2AHO A;  1Q86 D;  3U2Q A;  1Q7Y D;  1E63 A;  4ACB A;  3AVT A;  4NCN A;  1QG0 A;  3ZZU A;  4LBW A;  1NJI D;  3ZBT A;  2PIA A;  1Q81 D;  1VQK B;  4IW3 B;  3E1Y E;  3J81 k;  3WXM A;  3U6K A;  3PEN A;  2EFG A;  2BVN A;  3WYA A;  3QFT A;  3VO1 A;  2FX3 A;  1N8R D;  2GQF A;  1QGA A;  3I56 B;  1E62 A;  4Y9R A;  1F20 A;  2VYQ A;  4ZGQ B;  2QTZ A;  3CC4 B;  3ZC3 A;  4ZCL A;  1VQM B;  2RC5 A;  2BSA A;  1H42 A;  1R5O A;  1VQ7 B;  4ZGN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...