4HE5A

Crystal structure of the selenomethionine variant of the c-terminal domain of geobacillus thermoleovorans putative u32 peptidase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
REFAGLVLGYDPETGIATVQQRNHFRPGDEVEFFGPEIENFTQVIEKIWDEDGNELDAARHPLQIVKFKVKRPLFPYNMMRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ultratight crystal packing of a 10 kDa protein.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Unknown function
molecule keywords Peptidase family U32
total genus 15
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16325 Peptidase_U32_C Peptidase family U32 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4he5A00
3MMPA 3FJOA 2XNCA 4RD1A 2AHOA 1QFZA 1U2RA 1VQ4B 2C78A 3QFRA 3I55B 2OK7A 1QFJA 4B43A 3CC4B 2BF4A 2BV3A 1OGIA 4TMXA 3CC7B 1FNDA 1W87A 1N8RD 3ZBTA 1VQOB 3U6BA 3CXCB 2DEUA 1QX4A 3LVBA 1VQ5B 3WBKA 4R71A 1OB2A 1G7CA 3W2FA 1UMKA 2VNIA 1K73D 1I7PA 4RD6A 1BX1A 3CPWB 2BPOA 3OZWA 1KTVA 1F20A 3CMAB 1W34A 3CCSB 2EFGA 3W2IA 1QH0A 4PC6A 2BN4A 1KD1D 4TMTA 3CMEB 4AF7A 4MYUA 1XB2A 1FNMA 4U9UA 3FPKA 4J0QA 4LBYA 1VQLB 1NDHA 3CRZA 4IW3B 3OJWA 3QFSA 3ZZ0A 4B47A 4Y7CA 2OK8A 1GVHA 3WBJA 5AN9A 4DQKA 1OGJA 1JA1A 1M90D 3W2GA 4B4DA 4YAUA 4N3NA 3WY9A 2QEXB 4WQMA 4DQLA 2DCUA 2QTLA 2VYQA 4HE6A 2YWHA 4P6VF 1ELOA 4M53A 3WNCA 3AVTA 2BGJA 1VQNB 4ZCIA 1W2BB 3E1YE 1VQ7B 1R5BA 4LBWA 1BQEA 2FX3A 1ZM3A 1EFUA 1E62A 2D74A 4NCNA 5THXA 3CCUB 1KK1A 3ZZUA 3SJZA 3V76A 3VMFA 1Q81D 2E1RA 5DSZA 3G4SB 3QFCA 3AVWA 1GR1A 2YWEA 1EWYA 3OJXA 3CCMB 4YALA 2CRVA 1H42A 1VQ9B 3JQQA 4Q7JB 4C43A 1ZM4A 1E64A 4QHYA 4NBSA 4ZV4A 1ZUNB 3ZC3A 5H5JA 2B7BA 2PMDA 1DDIA 1VQ6B 2VNHA 4ZCMA 2VZLA 2BM0A 2YWGA 1DG1G 1KRHA 3B82A 2HCJB 3JQPA 1G7TA 4ZCLA 1QGAA 1AMOA 4H9GA 4PGOA 1FNCA 4M0LA 1IJFA 4P3YA 4TMZA 4K1XA 1BJKA 1BX0A 2X3UA 3G71B 2HDNB 3VO1A 3MCAA 1KC8D 1QGYA 2OTJB 4RD2A 4Y9RA 4QFMA 4TN1A 2ZITA 3W5UA 1M1KD 2CNDA 1QUEA 3VO2A 3B78A 4YAFA 3QE2A 1VQMB 2BM1A 1FDRA 3U6KA 4RJLA 5KSWB 1EFTA 1IB0A 4M1KA 2RC6A 3B8HA 1VQKB 4ZGQB 2BSAA 1EFCA 3CD6B 1FNBA 3P27A 3CCEB 3I1FA 2HMAA 1CQXA 1A8PA 4YAOA 1QG0A 3VNVA 1QUFA 1TUIA 1SM4A 2B5OA 3QFTA 1EP3B 1S72B 1Q86D 4RCYA 1WDTA 3W2HA 4HE5A 1N0VC 3CCLB 3W5VA 5TR9A 4AC9A 2PLFA 4MYTA 1K8AD 2QN6A 4ZGNB 1KK0A 1F60A 3CCQB 1JA0A 4ACAA 3W5HA 5HXBA 1FRQA 3JQRA 3CB4A 1GAQA 4FN5A 4TMWA 1YI2B 1FRNA 1D1NA 1KQSB 1JNYA 5EMNA 4LC0A 4UAJA 3OZVA 2QTZA 4F7DA 4M4SA 1N0UA 2BMWA 1YJNB 3E20A 1VQPB 2XEXA 3W2EA 2DETA 1QFYA 4YAWA 1DARA 2XNJA 1QVGB 4YHBA 4N3GA 1S0UA 1XE1A 2DERA 5JBQA 5GV7A 3ES9A 1EP2B 1NJID 3CCJB 4B48A 1VQ8B 1H85A 3CCVB 3AVVA 4B3XA 1B2RA 3CCRB 1R5OA 1J9ZA 1GAWA 5H59A 3I56B 2OTLB 1D2EA 3U2QA 1K9MD 2QMUA 1B23P 3CC2B 1JJ2B 1Q82D 2BGIA 3AVYA 3G6EB 1GJRA 1GO2A 3MHPA 1R5NA 1HA3A 4BPRA 2NPFA 3CW2A 4RCZA 4PC7A 2R6HA 1G7RA 3OZUA 4ACBA 1Q7YD 4PC3A 1YITB 2BVNA 3WNBA 1ZM2A 1YIJB 1CNFA 1EP1B 2PIAA 2RC5A 3ZZTA 3AVUA 1G7SA 2J7KA 1KJZA 1DDGA 4B44A 3VNUA 2YWFA 1YJWB 1IJEA 4AF6A 4EH1A 1TVCA 2QA4B 5GV8A 4RD0A 4LBVA 1E63A 4G1VA 3AGQA 2C77A 3AGPA 4M2LA 1TLLA 3J81k 4TMVA 1SKQA 1KK2A 1ZM9A 4PC1A 4RD3A 1D8TA 1YJ9B 3P26A 4Y9UA 5TV2A 2DY1A 1W35A 1CNEA 2QDXA 1QVFB 1AIPA 2B7CA 3LO8A 3WYAA 1YHQB 3ZBUA 4PC2A 2VNKA 2GQFA 2VNJA 4FK8A 4C0SA 2GPJA 3PENA 1TTTA 5FA6A 5TY0A 1JB9A 1QGZA 4G1BA 4G5GA 4LBZA 3OW2B 3QSYA 3AVXA 1KK3A 1OB5A 4FWTA 4RD4A 3WNDA 2EIXA 3WXMA 1EXMA
chains in the Genus database with same CATH superfamily
3MMPA 2V4DA 2V7VA 3ASSA 3CPXA 1NB9A 3FJOA 3A35A 4DNTB 2KVOA 1WSRA 2XNCA 2AHOA 1QFZA 4RD1A 2HLDA 2V7UA 1U2RA 4Z4RA 3A8KA 5E6TA 1VQ4B 2C78A 4P25A 4YELA 3QFRA 3I55B 2V7QA 2OK7A 1QFJA 1KZLA 4B43A 3CC4B 3ISXA 2BF4A 4XOPA 4RDJA 3PA1A 2BV3A 2C4TA 1OGIA 4OP7A 5DS0A 4TMXA 3BQJA 3CC7B 1WOOA 4KKTA 4P1VA 1FNDA 1W87A 3R6KA 1N8RD 1T5EA 4XLFA 3OE7A 3GVLA 5FIUA 3ZBTA 1VQOB 3U6BA 3CXCB 2DEUA 3GVKA 1QX4A 3LVBA 1IHMA 1VQ5B 3WBKA 4R71A 1OB2A 1COWA 2D3NA 2OBTA 1G7CA 2V7XA 3W2FA 5IYPA 1XFOA 1UMKA 3D26A 2VNIA 3A1PA 1K73D 1I7PA 4RD6A 3LNNA 5IYQA 1BX1A 3CPWB 2BPOA 3OZWA 1KTVA 1F20A 3CMAB 1VF7A 3T51B 3SKBA 1W34A 5FL7A 3CCSB 2EFGA 3W2IA 1QH0A 4G6IA 4PC6A 2BN4A 1KD1D 4TMTA 3CMEB 4AF7A 4WWVA 4MYUA 1XB2A 1FNMA 4U9UA 3FPKA 2X6YA 4J0QA 4X8IA 3CESA 4LBYA 3OKXA 2V7TA 2QE7A 2WZPP 1NDHA 1VQLB 3CRZA 4IW3B 4XN0A 3OJWA 2WPDA 3QFSA 3GSIA 2ZZEA 3ZZ0A 2CF4A 4B47A 1HZEA 4Y7CA 2OK8A 1GVHA 3WBJA 5AN9A 2ZXIA 4DQKA 1OGJA 1UD6A 2R9VA 1T6ZA 3Q39A 1JA1A 3GIRA 2ZTNA 5IK2A 1NBMA 1M90D 3W2GA 4B4DA 3H94A 4XKWA 4WZLA 1RQPA 4YAUA 4N3NA 4YEJA 1YLOA 2GJPA 2C4UA 4XLEA 3WY9A 2QEXB 4WQMA 2F43A 1WP6A 4RDKA 1PJ7A 4DQLA 2DCUA 5F4JA 2QTLA 2VYQA 3H9NA 4HE6A 4II2A 2YWHA 4P6VF 1ELOA 4M53A 3WNCA 3AVTA 2BGJA 1VQNB 1E1QA 4ZCIA 1E3XA 1W9XA 1W2BB 3E1YE 4AVZA 1VQ7B 2Z6BD 1RQRA 2P3MA 4XL9A 4XORA 1I8DA 1R5BA 4LBWA 3V7AA 1BQEA 1SKYB 2FX3A 1ZM3A 1EFUA 4Z1MA 1E62A 2D74A 1E3ZA 4NCNA 5THXA 3Q3AA 2OYNA 4II3A 3CCUB 3LQ6A 4X0CA 1KK1A 3ZZUA 3SJZA 4RLZA 3V76A 3VMFA 1Q81D 4FXUA 4OOSA 2WJVA 1WOPA 2E1RA 1S4MA 5DSZA 3G4SB 3KEWA 3QFCA 3AVWA 1WTHD 4RPDA 1GR1A 2YWEA 1EWYA 3OJXA 3CCMB 3PA2A 4YALA 2CRVA 1H42A 4P12A 1VQ9B 3JQQA 4Q7JB 2V31A 4C43A 2E1BA 1ZM4A 1E64A 2DIEA 4TT3A 4QHYA 2JDIA 4NBSA 1P4MA 4ZV4A 5LMZA 1ZUNB 5FNZA 3ZC3A 5H5JA 3ASPA 3ZIAA 1V5VA 2B7BA 3ONUA 2PMDA 1DDIA 2ZTGA 4QVJA 1VHEA 3OEHA 4XMYA 4X7DA 1VQ6B 2VNHA 4ZCMA 1XQBA 4RM0A 2VZLA 2BM0A 3OPOA 2YWGA 2D9RA 1DG1G 1KRHA 3B82A 2HCJB 3SLNA 3JQPA 3BCDA 4P22A 1G7TA 2X0KA 4ZCLA 4QV2A 1QGAA 1AMOA 4H9GA 4TKOB 4PGOA 1FNCA 1KMHA 4L8JA 4M0LA 4E0FA 5BSXA 1IJFA 1FX0A 1WU8A 1K28D 4P3YA 1T6XA 4TMZA 5A8AA 5F4OA 2GREA 4K1XA 2C2WA 3WQZA 2ZL6A 1BJKA 1BX0A 2X3UA 3G71B 2HDNB 3VO1A 3MCAA 4XQFA 3OP1A 1KC8D 1QGYA 1N06A 1MRZA 2OTJB 2CBXA 4RD2A 4Y9RA 4TSFA 4QFMA 4TN1A 2ZITA 3W5UA 1M1KD 2CNDA 1QUEA 4UZUA 3VO2A 3B78A 5J3OA 2QGGA 2CC2A 4YAFA 2WSSA 3OW7A 3QE2A 3KL9A 2WYRA 1VQMB 2BM1A 1FDRA 3U6KA 4RJLA 5KSWB 1WSVA 2PE3A 3LQEA 1UD8A 1EFTA 1IB0A 4M1KA 1Y0RA 2RC6A 2W6IA 3B8HA 5A89A 4WZTA 1VQKB 3FPPA 4G7XA 4QUZA 4ZGQB 2BSAA 1EFCA 3FKSA 4Z4YA 3CD6B 3GQBA 3ZPNA 1VLYA 2CK3A 1N05A 2XZPA 1BLIA 4OOXA 2Q6LA 1FNBA 5L46A 3P27A 4XD7A 2Q6IA 3CCEB 5TRDA 3I1FA 2HMAA 1CQXA 1E43A 3RY8A 1A8PA 3OOCA 4ROXA 1EFRA 4YAOA 4OPOA 1QG0A 2NV4A 3VNVA 1QUFA 5FO0A 4UZFA 1TUIA 4X7CA 1SM4A 1VLOA 5IYWA 2V7WA 1OHHA 2B5OA 3QFTA 1EP3B 1S72B 5IYRA 2GK7A 2WJYA 3BCFA 3A3BA 1Q86D 4XNFA 3DDYA 2VBUA 4RCYA 1WDTA 4XLAA 5B6IA 2VJIA 3W2HA 4HE5A 1N0VC 2VBTA 4XKVA 3CCLB 3W5VA 1BPLA 5TR9A 4Z4TA 2CW5A 4AC9A 3PVDA 4Z4UA 2PLFA 4MYTA 3HAGA 1K8AD 4WZKA 2QN6A 4ZGNB 2XNDA 1KK0A 4DK0A 1F60A 1UD4A 2X53S 3CCQB 2F4NA 1JA0A 1OB0A 4ACAA 4XLCA 3W5HA 3CMMA 5HXBA 1N08A 4OOVA 2GK6A 2Q6OA 1FRQA 3JQRA 4XONA 3CB4A 5DN6A 1GAQA 3R6JA 4FN5A 1N07A 4TMWA 1YI2B 1FRNA 1D1NA 4KKUA 5KW9A 1KQSB 2ZL7A 1JNYA 5EMNA 4LC0A 4UAJA 3OZVA 2QTZA 2X8KA 2F1MA 4F7DA 3OFNA 4M4SA 1E79A 1N0UA 2BMWA 3PUMA 3E20A 1YJNB 1VQPB 3BY2A 2XEXA 5HKKA 4P6YA 2JJ1A 3W2EA 4XLHA 3ZUGA 4G7WA 2DETA 3ASRA 1QFYA 2JIZA 4YAWA 1DARA 4XM3A 2WZNA 2XNJA 4DK1A 1QVGB 4YHBA 4N3GA 1UD3A 1VHOA 1S0UA 1XE1A 2D3LA 3Q38A 2DERA 5JBQA 5GV7A 3T56B 3ES9A 2GJRA 1EP2B 1NJID 2X6XA 4PAAA 3CCJB 2VBVA 1WORA 4B48A 1VQ8B 2C5BA 3A3GA 1H85A 1Q9SA 3ASQA 3CCVB 3AVVA 4X07A 4B3XA 1B2RA 2Q6KA 2C5HA 3CCRB 1R5OA 2XOKA 1J9ZA 4XN3A 1HVXA 1GAWA 5HZBA 1T6YA 5H59A 3I56B 2OTLB 1D2EA 3Q6QA 3U2QA 2OBSA 1K9MD 2DOGA 2QMUA 4Z4ZA 2VBSA 1B23P 2LZJA 4ASUA 1PJ5A 1PJ6A 3CC2B 4GQNA 4DNRB 1JJ2B 4OPSA 1V0EA 3ONYA 1Q82D 2I1LA 4Z4VA 2BGIA 3AVYA 1I18A 1V0FA 3G6EB 1GJRA 2GJKA 3A8JA 4B3GA 4HIZA 1GO2A 3MHPA 1R5NA 1HA3A 3Q6RA 2ZXHA 2XZOA 1WOSA 4BPRA 5HZAA 2NPFA 2WR8A 3CW2A 2X6WA 4PC7A 4RCZA 2R6HA 1G7RA 2ZBVA 4X06A 5J35A 3BNWA 4RPBA 1NRKA 3OZUA 4ACBA 1MABA 1UD5A 2FVGA 2OBRA 5CDFA 1Q7YD 4PC3A 1YITB 3A8IA 2BVNA 3WNBA 1ZM2A 4P3IA 1YIJB 1W0JA 3CP2A 1Y0YA 3CTAA 4NNJA 4YXWA 1W0KA 1CNFA 1EP1B 2PIAA 2RC5A 3ZZTA 3AVUA 1G7SA 2J7KA 1KJZA 1DDGA 4B44A 2F1LA 4B3FX 3VNUA 5KNLA 2YWFA 1YJWB 1IJEA 3GVJA 3BH4A 4AF6A 1TVCA 4EH1A 2QA4B 5GV8A 4Z4WA 4RD0A 5F4MA 4P2NA 4LBVA 1WPCA 1E63A 4G1VA 3AGQA 2C77A 3AGPA 3G05A 3OAAA 4M2LA 1TLLA 4X7FA 3J81k 4TMVA 4WZEA 3SEJA 1H8HA 1KK2A 1SKQA 1ZM9A 4PC1A 4RD3A 1D8TA 3ASTA 4CQJA 1YJ9B 3SJPA 3P26A 4Y9UA 1UD2A 3BC9A 2X85A 5TV2A 3JU4A 2DY1A 1H8EA 4PABA 1BMFA 1W35A 1YX2A 1CNEA 2QDXA 1QVFB 1AIPA 2B7CA 3LO8A 1NB0A 3WYAA 1YHQB 3CP8A 3ZBUA 2W6JA 4KKSA 4PC2A 2ZL5A 1E1RA 2VNKA 5BSYA 2GQFA 2VNJA 4FK8A 2M5SA 4C0SA 2GPJA 3PENA 2VJJA 4X05A 1TTTA 4RDLA 3NE5B 5FA6A 4XOTA 2DYIA 5A88A 1PKVA 5TY0A 1JB9A 4OPVA 2JN9A 1QGZA 4G1BA 4G5GA 3OEEA 2JJ2A 5FO1A 3VR6A 4LBZA 2XZLA 4P9SA 4P26A 2ZZFA 4UZEA 3SLDA 3OW2B 3QSYA 2ZBUA 4Z4SA 2ZZQA 3T53B 2ZZGA 4X7EA 3AVXA 1KK3A 4QVAA 1OB5A 3BY1A 4JMQA 4FWTA 1VJSA 4RD4A 5IYNA 3WNDA 2XGJA 2EIXA 3PUNA 4XR6A 3WXMA 1EXMA
chains in the Genus database with same CATH topology
3MMPA 3FJOA 2XNCA 4RD1A 2AHOA 1QFZA 1U2RA 1VQ4B 2C78A 3QFRA 3I55B 2OK7A 1QFJA 4B43A 3CC4B 2BF4A 2BV3A 1OGIA 4TMXA 3CC7B 1FNDA 1W87A 1N8RD 3ZBTA 1VQOB 3U6BA 3CXCB 2DEUA 1QX4A 3LVBA 1VQ5B 3WBKA 4R71A 1OB2A 1G7CA 3W2FA 1UMKA 2VNIA 1K73D 1I7PA 4RD6A 1BX1A 3CPWB 2BPOA 3OZWA 1KTVA 1F20A 3CMAB 1W34A 3CCSB 2EFGA 3W2IA 1QH0A 4PC6A 2BN4A 1KD1D 4TMTA 3CMEB 4AF7A 4MYUA 1XB2A 1FNMA 4U9UA 3FPKA 4J0QA 4LBYA 1VQLB 1NDHA 3CRZA 4IW3B 3OJWA 3QFSA 3ZZ0A 4B47A 4Y7CA 2OK8A 1GVHA 3WBJA 5AN9A 4DQKA 1OGJA 1JA1A 1M90D 3W2GA 4B4DA 4YAUA 4N3NA 3WY9A 2QEXB 4WQMA 4DQLA 2DCUA 2QTLA 2VYQA 4HE6A 2YWHA 4P6VF 1ELOA 4M53A 3WNCA 3AVTA 2BGJA 1VQNB 4ZCIA 1W2BB 3E1YE 1VQ7B 1R5BA 4LBWA 1BQEA 2FX3A 1ZM3A 1EFUA 1E62A 2D74A 4NCNA 5THXA 3CCUB 1KK1A 3ZZUA 3SJZA 3V76A 3VMFA 1Q81D 2E1RA 5DSZA 3G4SB 3QFCA 3AVWA 1GR1A 2YWEA 1EWYA 3OJXA 3CCMB 4YALA 2CRVA 1H42A 1VQ9B 3JQQA 4Q7JB 4C43A 1ZM4A 1E64A 4QHYA 4NBSA 4ZV4A 1ZUNB 3ZC3A 5H5JA 2B7BA 2PMDA 1DDIA 1VQ6B 2VNHA 4ZCMA 2VZLA 2BM0A 2YWGA 1DG1G 1KRHA 3B82A 2HCJB 3JQPA 1G7TA 4ZCLA 1QGAA 1AMOA 4H9GA 4PGOA 1FNCA 4M0LA 1IJFA 4P3YA 4TMZA 4K1XA 1BJKA 1BX0A 2X3UA 3G71B 2HDNB 3VO1A 3MCAA 1KC8D 1QGYA 2OTJB 4RD2A 4Y9RA 4QFMA 4TN1A 2ZITA 3W5UA 1M1KD 2CNDA 1QUEA 3VO2A 3B78A 4YAFA 3QE2A 1VQMB 2BM1A 1FDRA 3U6KA 4RJLA 5KSWB 1EFTA 1IB0A 4M1KA 2RC6A 3B8HA 1VQKB 4ZGQB 2BSAA 1EFCA 3CD6B 1FNBA 3P27A 3CCEB 3I1FA 2HMAA 1CQXA 1A8PA 4YAOA 1QG0A 3VNVA 1QUFA 1TUIA 1SM4A 2B5OA 3QFTA 1EP3B 1S72B 1Q86D 4RCYA 1WDTA 3W2HA 4HE5A 1N0VC 3CCLB 3W5VA 5TR9A 4AC9A 2PLFA 4MYTA 1K8AD 2QN6A 4ZGNB 1KK0A 1F60A 3CCQB 1JA0A 4ACAA 3W5HA 5HXBA 1FRQA 3JQRA 3CB4A 1GAQA 4FN5A 4TMWA 1YI2B 1FRNA 1D1NA 1KQSB 1JNYA 5EMNA 4LC0A 4UAJA 3OZVA 2QTZA 4F7DA 4M4SA 1N0UA 2BMWA 1YJNB 3E20A 1VQPB 2XEXA 3W2EA 2DETA 1QFYA 4YAWA 1DARA 2XNJA 1QVGB 4YHBA 4N3GA 1S0UA 1XE1A 2DERA 5JBQA 5GV7A 3ES9A 1EP2B 1NJID 3CCJB 4B48A 1VQ8B 1H85A 3CCVB 3AVVA 4B3XA 1B2RA 3CCRB 1R5OA 1J9ZA 1GAWA 5H59A 3I56B 2OTLB 1D2EA 3U2QA 1K9MD 2QMUA 1B23P 3CC2B 1JJ2B 1Q82D 2BGIA 3AVYA 3G6EB 1GJRA 1GO2A 3MHPA 1R5NA 1HA3A 4BPRA 2NPFA 3CW2A 4RCZA 4PC7A 2R6HA 1G7RA 3OZUA 4ACBA 1Q7YD 4PC3A 1YITB 2BVNA 3WNBA 1ZM2A 1YIJB 1CNFA 1EP1B 2PIAA 2RC5A 3ZZTA 3AVUA 1G7SA 2J7KA 1KJZA 1DDGA 4B44A 3VNUA 2YWFA 1YJWB 1IJEA 4AF6A 4EH1A 1TVCA 2QA4B 5GV8A 4RD0A 4LBVA 1E63A 4G1VA 3AGQA 2C77A 3AGPA 4M2LA 1TLLA 3J81k 4TMVA 1SKQA 1KK2A 1ZM9A 4PC1A 4RD3A 1D8TA 1YJ9B 3P26A 4Y9UA 5TV2A 2DY1A 1W35A 1CNEA 2QDXA 1QVFB 1AIPA 2B7CA 3LO8A 3WYAA 1YHQB 3ZBUA 4PC2A 2VNKA 2GQFA 2VNJA 4FK8A 4C0SA 2GPJA 3PENA 1TTTA 5FA6A 5TY0A 1JB9A 1QGZA 4G1BA 4G5GA 4LBZA 3OW2B 3QSYA 3AVXA 1KK3A 1OB5A 4FWTA 4RD4A 3WNDA 2EIXA 3WXMA 1EXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMP A;  3FJO A;  2XNC A;  4RD1 A;  2AHO A;  1QFZ A;  1U2R A;  1VQ4 B;  2C78 A;  3QFR A;  3I55 B;  2OK7 A;  1QFJ A;  4B43 A;  3CC4 B;  2BF4 A;  2BV3 A;  1OGI A;  4TMX A;  3CC7 B;  1FND A;  1W87 A;  1N8R D;  3ZBT A;  1VQO B;  3U6B A;  3CXC B;  2DEU A;  1QX4 A;  3LVB A;  1VQ5 B;  3WBK A;  4R71 A;  1OB2 A;  1G7C A;  3W2F A;  1UMK A;  2VNI A;  1K73 D;  1I7P A;  4RD6 A;  1BX1 A;  3CPW B;  2BPO A;  3OZW A;  1KTV A;  1F20 A;  3CMA B;  1W34 A;  3CCS B;  2EFG A;  3W2I A;  1QH0 A;  4PC6 A;  2BN4 A;  1KD1 D;  4TMT A;  3CME B;  4AF7 A;  4MYU A;  1XB2 A;  1FNM A;  4U9U A;  3FPK A;  4J0Q A;  4LBY A;  1VQL B;  1NDH A;  3CRZ A;  4IW3 B;  3OJW A;  3QFS A;  3ZZ0 A;  4B47 A;  4Y7C A;  2OK8 A;  1GVH A;  3WBJ A;  5AN9 A;  4DQK A;  1OGJ A;  1JA1 A;  1M90 D;  3W2G A;  4B4D A;  4YAU A;  4N3N A;  3WY9 A;  2QEX B;  4WQM A;  4DQL A;  2DCU A;  2QTL A;  2VYQ A;  4HE6 A;  2YWH A;  4P6V F;  1ELO A;  4M53 A;  3WNC A;  3AVT A;  2BGJ A;  1VQN B;  4ZCI A;  1W2B B;  3E1Y E;  1VQ7 B;  1R5B A;  4LBW A;  1BQE A;  2FX3 A;  1ZM3 A;  1EFU A;  1E62 A;  2D74 A;  4NCN A;  5THX A;  3CCU B;  1KK1 A;  3ZZU A;  3SJZ A;  3V76 A;  3VMF A;  1Q81 D;  2E1R A;  5DSZ A;  3G4S B;  3QFC A;  3AVW A;  1GR1 A;  2YWE A;  1EWY A;  3OJX A;  3CCM B;  4YAL A;  2CRV A;  1H42 A;  1VQ9 B;  3JQQ A;  4Q7J B;  4C43 A;  1ZM4 A;  1E64 A;  4QHY A;  4NBS A;  4ZV4 A;  1ZUN B;  3ZC3 A;  5H5J A;  2B7B A;  2PMD A;  1DDI A;  1VQ6 B;  2VNH A;  4ZCM A;  2VZL A;  2BM0 A;  2YWG A;  1DG1 G;  1KRH A;  3B82 A;  2HCJ B;  3JQP A;  1G7T A;  4ZCL A;  1QGA A;  1AMO A;  4H9G A;  4PGO A;  1FNC A;  4M0L A;  1IJF A;  4P3Y A;  4TMZ A;  4K1X A;  1BJK A;  1BX0 A;  2X3U A;  3G71 B;  2HDN B;  3VO1 A;  3MCA A;  1KC8 D;  1QGY A;  2OTJ B;  4RD2 A;  4Y9R A;  4QFM A;  4TN1 A;  2ZIT A;  3W5U A;  1M1K D;  2CND A;  1QUE A;  3VO2 A;  3B78 A;  4YAF A;  3QE2 A;  1VQM B;  2BM1 A;  1FDR A;  3U6K A;  4RJL A;  5KSW B;  1EFT A;  1IB0 A;  4M1K A;  2RC6 A;  3B8H A;  1VQK B;  4ZGQ B;  2BSA A;  1EFC A;  3CD6 B;  1FNB A;  3P27 A;  3CCE B;  3I1F A;  2HMA A;  1CQX A;  1A8P A;  4YAO A;  1QG0 A;  3VNV A;  1QUF A;  1TUI A;  1SM4 A;  2B5O A;  3QFT A;  1EP3 B;  1S72 B;  1Q86 D;  4RCY A;  1WDT A;  3W2H A;  4HE5 A;  1N0V C;  3CCL B;  3W5V A;  5TR9 A;  4AC9 A;  2PLF A;  4MYT A;  1K8A D;  2QN6 A;  4ZGN B;  1KK0 A;  1F60 A;  3CCQ B;  1JA0 A;  4ACA A;  3W5H A;  5HXB A;  1FRQ A;  3JQR A;  3CB4 A;  1GAQ A;  4FN5 A;  4TMW A;  1YI2 B;  1FRN A;  1D1N A;  1KQS B;  1JNY A;  5EMN A;  4LC0 A;  4UAJ A;  3OZV A;  2QTZ A;  4F7D A;  4M4S A;  1N0U A;  2BMW A;  1YJN B;  3E20 A;  1VQP B;  2XEX A;  3W2E A;  2DET A;  1QFY A;  4YAW A;  1DAR A;  2XNJ A;  1QVG B;  4YHB A;  4N3G A;  1S0U A;  1XE1 A;  2DER A;  5JBQ A;  5GV7 A;  3ES9 A;  1EP2 B;  1NJI D;  3CCJ B;  4B48 A;  1VQ8 B;  1H85 A;  3CCV B;  3AVV A;  4B3X A;  1B2R A;  3CCR B;  1R5O A;  1J9Z A;  1GAW A;  5H59 A;  3I56 B;  2OTL B;  1D2E A;  3U2Q A;  1K9M D;  2QMU A;  1B23 P;  3CC2 B;  1JJ2 B;  1Q82 D;  2BGI A;  3AVY A;  3G6E B;  1GJR A;  1GO2 A;  3MHP A;  1R5N A;  1HA3 A;  4BPR A;  2NPF A;  3CW2 A;  4RCZ A;  4PC7 A;  2R6H A;  1G7R A;  3OZU A;  4ACB A;  1Q7Y D;  4PC3 A;  1YIT B;  2BVN A;  3WNB A;  1ZM2 A;  1YIJ B;  1CNF A;  1EP1 B;  2PIA A;  2RC5 A;  3ZZT A;  3AVU A;  1G7S A;  2J7K A;  1KJZ A;  1DDG A;  4B44 A;  3VNU A;  2YWF A;  1YJW B;  1IJE A;  4AF6 A;  4EH1 A;  1TVC A;  2QA4 B;  5GV8 A;  4RD0 A;  4LBV A;  1E63 A;  4G1V A;  3AGQ A;  2C77 A;  3AGP A;  4M2L A;  1TLL A;  3J81 k;  4TMV A;  1SKQ A;  1KK2 A;  1ZM9 A;  4PC1 A;  4RD3 A;  1D8T A;  1YJ9 B;  3P26 A;  4Y9U A;  5TV2 A;  2DY1 A;  1W35 A;  1CNE A;  2QDX A;  1QVF B;  1AIP A;  2B7C A;  3LO8 A;  3WYA A;  1YHQ B;  3ZBU A;  4PC2 A;  2VNK A;  2GQF A;  2VNJ A;  4FK8 A;  4C0S A;  2GPJ A;  3PEN A;  1TTT A;  5FA6 A;  5TY0 A;  1JB9 A;  1QGZ A;  4G1B A;  4G5G A;  4LBZ A;  3OW2 B;  3QSY A;  3AVX A;  1KK3 A;  1OB5 A;  4FWT A;  4RD4 A;  3WND A;  2EIX A;  3WXM A;  1EXM A; 
#chains in the Genus database with same CATH topology
 3MMP A;  2V4D A;  2V7V A;  3ASS A;  3CPX A;  1NB9 A;  3FJO A;  3A35 A;  4DNT B;  2KVO A;  1WSR A;  2XNC A;  2AHO A;  1QFZ A;  4RD1 A;  2HLD A;  2V7U A;  1U2R A;  4Z4R A;  3A8K A;  5E6T A;  1VQ4 B;  2C78 A;  4P25 A;  4YEL A;  3QFR A;  3I55 B;  2V7Q A;  2OK7 A;  1QFJ A;  1KZL A;  4B43 A;  3CC4 B;  3ISX A;  2BF4 A;  4XOP A;  4RDJ A;  3PA1 A;  2BV3 A;  2C4T A;  1OGI A;  4OP7 A;  5DS0 A;  4TMX A;  3BQJ A;  3CC7 B;  1WOO A;  4KKT A;  4P1V A;  1FND A;  1W87 A;  3R6K A;  1N8R D;  1T5E A;  4XLF A;  3OE7 A;  3GVL A;  5FIU A;  3ZBT A;  1VQO B;  3U6B A;  3CXC B;  2DEU A;  3GVK A;  1QX4 A;  3LVB A;  1IHM A;  1VQ5 B;  3WBK A;  4R71 A;  1OB2 A;  1COW A;  2D3N A;  2OBT A;  1G7C A;  2V7X A;  3W2F A;  5IYP A;  1XFO A;  1UMK A;  3D26 A;  2VNI A;  3A1P A;  1K73 D;  1I7P A;  4RD6 A;  3LNN A;  5IYQ A;  1BX1 A;  3CPW B;  2BPO A;  3OZW A;  1KTV A;  1F20 A;  3CMA B;  1VF7 A;  3T51 B;  3SKB A;  1W34 A;  5FL7 A;  3CCS B;  2EFG A;  3W2I A;  1QH0 A;  4G6I A;  4PC6 A;  2BN4 A;  1KD1 D;  4TMT A;  3CME B;  4AF7 A;  4WWV A;  4MYU A;  1XB2 A;  1FNM A;  4U9U A;  3FPK A;  2X6Y A;  4J0Q A;  4X8I A;  3CES A;  4LBY A;  3OKX A;  2V7T A;  2QE7 A;  2WZP P;  1NDH A;  1VQL B;  3CRZ A;  4IW3 B;  4XN0 A;  3OJW A;  2WPD A;  3QFS A;  3GSI A;  2ZZE A;  3ZZ0 A;  2CF4 A;  4B47 A;  1HZE A;  4Y7C A;  2OK8 A;  1GVH A;  3WBJ A;  5AN9 A;  2ZXI A;  4DQK A;  1OGJ A;  1UD6 A;  2R9V A;  1T6Z A;  3Q39 A;  1JA1 A;  3GIR A;  2ZTN A;  5IK2 A;  1NBM A;  1M90 D;  3W2G A;  4B4D A;  3H94 A;  4XKW A;  4WZL A;  1RQP A;  4YAU A;  4N3N A;  4YEJ A;  1YLO A;  2GJP A;  2C4U A;  4XLE A;  3WY9 A;  2QEX B;  4WQM A;  2F43 A;  1WP6 A;  4RDK A;  1PJ7 A;  4DQL A;  2DCU A;  5F4J A;  2QTL A;  2VYQ A;  3H9N A;  4HE6 A;  4II2 A;  2YWH A;  4P6V F;  1ELO A;  4M53 A;  3WNC A;  3AVT A;  2BGJ A;  1VQN B;  1E1Q A;  4ZCI A;  1E3X A;  1W9X A;  1W2B B;  3E1Y E;  4AVZ A;  1VQ7 B;  2Z6B D;  1RQR A;  2P3M A;  4XL9 A;  4XOR A;  1I8D A;  1R5B A;  4LBW A;  3V7A A;  1BQE A;  1SKY B;  2FX3 A;  1ZM3 A;  1EFU A;  4Z1M A;  1E62 A;  2D74 A;  1E3Z A;  4NCN A;  5THX A;  3Q3A A;  2OYN A;  4II3 A;  3CCU B;  3LQ6 A;  4X0C A;  1KK1 A;  3ZZU A;  3SJZ A;  4RLZ A;  3V76 A;  3VMF A;  1Q81 D;  4FXU A;  4OOS A;  2WJV A;  1WOP A;  2E1R A;  1S4M A;  5DSZ A;  3G4S B;  3KEW A;  3QFC A;  3AVW A;  1WTH D;  4RPD A;  1GR1 A;  2YWE A;  1EWY A;  3OJX A;  3CCM B;  3PA2 A;  4YAL A;  2CRV A;  1H42 A;  4P12 A;  1VQ9 B;  3JQQ A;  4Q7J B;  2V31 A;  4C43 A;  2E1B A;  1ZM4 A;  1E64 A;  2DIE A;  4TT3 A;  4QHY A;  2JDI A;  4NBS A;  1P4M A;  4ZV4 A;  5LMZ A;  1ZUN B;  5FNZ A;  3ZC3 A;  5H5J A;  3ASP A;  3ZIA A;  1V5V A;  2B7B A;  3ONU A;  2PMD A;  1DDI A;  2ZTG A;  4QVJ A;  1VHE A;  3OEH A;  4XMY A;  4X7D A;  1VQ6 B;  2VNH A;  4ZCM A;  1XQB A;  4RM0 A;  2VZL A;  2BM0 A;  3OPO A;  2YWG A;  2D9R A;  1DG1 G;  1KRH A;  3B82 A;  2HCJ B;  3SLN A;  3JQP A;  3BCD A;  4P22 A;  1G7T A;  2X0K A;  4ZCL A;  4QV2 A;  1QGA A;  1AMO A;  4H9G A;  4TKO B;  4PGO A;  1FNC A;  1KMH A;  4L8J A;  4M0L A;  4E0F A;  5BSX A;  1IJF A;  1FX0 A;  1WU8 A;  1K28 D;  4P3Y A;  1T6X A;  4TMZ A;  5A8A A;  5F4O A;  2GRE A;  4K1X A;  2C2W A;  3WQZ A;  2ZL6 A;  1BJK A;  1BX0 A;  2X3U A;  3G71 B;  2HDN B;  3VO1 A;  3MCA A;  4XQF A;  3OP1 A;  1KC8 D;  1QGY A;  1N06 A;  1MRZ A;  2OTJ B;  2CBX A;  4RD2 A;  4Y9R A;  4TSF A;  4QFM A;  4TN1 A;  2ZIT A;  3W5U A;  1M1K D;  2CND A;  1QUE A;  4UZU A;  3VO2 A;  3B78 A;  5J3O A;  2QGG A;  2CC2 A;  4YAF A;  2WSS A;  3OW7 A;  3QE2 A;  3KL9 A;  2WYR A;  1VQM B;  2BM1 A;  1FDR A;  3U6K A;  4RJL A;  5KSW B;  1WSV A;  2PE3 A;  3LQE A;  1UD8 A;  1EFT A;  1IB0 A;  4M1K A;  1Y0R A;  2RC6 A;  2W6I A;  3B8H A;  5A89 A;  4WZT A;  1VQK B;  3FPP A;  4G7X A;  4QUZ A;  4ZGQ B;  2BSA A;  1EFC A;  3FKS A;  4Z4Y A;  3CD6 B;  3GQB A;  3ZPN A;  1VLY A;  2CK3 A;  1N05 A;  2XZP A;  1BLI A;  4OOX A;  2Q6L A;  1FNB A;  5L46 A;  3P27 A;  4XD7 A;  2Q6I A;  3CCE B;  5TRD A;  3I1F A;  2HMA A;  1CQX A;  1E43 A;  3RY8 A;  1A8P A;  3OOC A;  4ROX A;  1EFR A;  4YAO A;  4OPO A;  1QG0 A;  2NV4 A;  3VNV A;  1QUF A;  5FO0 A;  4UZF A;  1TUI A;  4X7C A;  1SM4 A;  1VLO A;  5IYW A;  2V7W A;  1OHH A;  2B5O A;  3QFT A;  1EP3 B;  1S72 B;  5IYR A;  2GK7 A;  2WJY A;  3BCF A;  3A3B A;  1Q86 D;  4XNF A;  3DDY A;  2VBU A;  4RCY A;  1WDT A;  4XLA A;  5B6I A;  2VJI A;  3W2H A;  4HE5 A;  1N0V C;  2VBT A;  4XKV A;  3CCL B;  3W5V A;  1BPL A;  5TR9 A;  4Z4T A;  2CW5 A;  4AC9 A;  3PVD A;  4Z4U A;  2PLF A;  4MYT A;  3HAG A;  1K8A D;  4WZK A;  2QN6 A;  4ZGN B;  2XND A;  1KK0 A;  4DK0 A;  1F60 A;  1UD4 A;  2X53 S;  3CCQ B;  2F4N A;  1JA0 A;  1OB0 A;  4ACA A;  4XLC A;  3W5H A;  3CMM A;  5HXB A;  1N08 A;  4OOV A;  2GK6 A;  2Q6O A;  1FRQ A;  3JQR A;  4XON A;  3CB4 A;  5DN6 A;  1GAQ A;  3R6J A;  4FN5 A;  1N07 A;  4TMW A;  1YI2 B;  1FRN A;  1D1N A;  4KKU A;  5KW9 A;  1KQS B;  2ZL7 A;  1JNY A;  5EMN A;  4LC0 A;  4UAJ A;  3OZV A;  2QTZ A;  2X8K A;  2F1M A;  4F7D A;  3OFN A;  4M4S A;  1E79 A;  1N0U A;  2BMW A;  3PUM A;  3E20 A;  1YJN B;  1VQP B;  3BY2 A;  2XEX A;  5HKK A;  4P6Y A;  2JJ1 A;  3W2E A;  4XLH A;  3ZUG A;  4G7W A;  2DET A;  3ASR A;  1QFY A;  2JIZ A;  4YAW A;  1DAR A;  4XM3 A;  2WZN A;  2XNJ A;  4DK1 A;  1QVG B;  4YHB A;  4N3G A;  1UD3 A;  1VHO A;  1S0U A;  1XE1 A;  2D3L A;  3Q38 A;  2DER A;  5JBQ A;  5GV7 A;  3T56 B;  3ES9 A;  2GJR A;  1EP2 B;  1NJI D;  2X6X A;  4PAA A;  3CCJ B;  2VBV A;  1WOR A;  4B48 A;  1VQ8 B;  2C5B A;  3A3G A;  1H85 A;  1Q9S A;  3ASQ A;  3CCV B;  3AVV A;  4X07 A;  4B3X A;  1B2R A;  2Q6K A;  2C5H A;  3CCR B;  1R5O A;  2XOK A;  1J9Z A;  4XN3 A;  1HVX A;  1GAW A;  5HZB A;  1T6Y A;  5H59 A;  3I56 B;  2OTL B;  1D2E A;  3Q6Q A;  3U2Q A;  2OBS A;  1K9M D;  2DOG A;  2QMU A;  4Z4Z A;  2VBS A;  1B23 P;  2LZJ A;  4ASU A;  1PJ5 A;  1PJ6 A;  3CC2 B;  4GQN A;  4DNR B;  1JJ2 B;  4OPS A;  1V0E A;  3ONY A;  1Q82 D;  2I1L A;  4Z4V A;  2BGI A;  3AVY A;  1I18 A;  1V0F A;  3G6E B;  1GJR A;  2GJK A;  3A8J A;  4B3G A;  4HIZ A;  1GO2 A;  3MHP A;  1R5N A;  1HA3 A;  3Q6R A;  2ZXH A;  2XZO A;  1WOS A;  4BPR A;  5HZA A;  2NPF A;  2WR8 A;  3CW2 A;  2X6W A;  4PC7 A;  4RCZ A;  2R6H A;  1G7R A;  2ZBV A;  4X06 A;  5J35 A;  3BNW A;  4RPB A;  1NRK A;  3OZU A;  4ACB A;  1MAB A;  1UD5 A;  2FVG A;  2OBR A;  5CDF A;  1Q7Y D;  4PC3 A;  1YIT B;  3A8I A;  2BVN A;  3WNB A;  1ZM2 A;  4P3I A;  1YIJ B;  1W0J A;  3CP2 A;  1Y0Y A;  3CTA A;  4NNJ A;  4YXW A;  1W0K A;  1CNF A;  1EP1 B;  2PIA A;  2RC5 A;  3ZZT A;  3AVU A;  1G7S A;  2J7K A;  1KJZ A;  1DDG A;  4B44 A;  2F1L A;  4B3F X;  3VNU A;  5KNL A;  2YWF A;  1YJW B;  1IJE A;  3GVJ A;  3BH4 A;  4AF6 A;  1TVC A;  4EH1 A;  2QA4 B;  5GV8 A;  4Z4W A;  4RD0 A;  5F4M A;  4P2N A;  4LBV A;  1WPC A;  1E63 A;  4G1V A;  3AGQ A;  2C77 A;  3AGP A;  3G05 A;  3OAA A;  4M2L A;  1TLL A;  4X7F A;  3J81 k;  4TMV A;  4WZE A;  3SEJ A;  1H8H A;  1KK2 A;  1SKQ A;  1ZM9 A;  4PC1 A;  4RD3 A;  1D8T A;  3AST A;  4CQJ A;  1YJ9 B;  3SJP A;  3P26 A;  4Y9U A;  1UD2 A;  3BC9 A;  2X85 A;  5TV2 A;  3JU4 A;  2DY1 A;  1H8E A;  4PAB A;  1BMF A;  1W35 A;  1YX2 A;  1CNE A;  2QDX A;  1QVF B;  1AIP A;  2B7C A;  3LO8 A;  1NB0 A;  3WYA A;  1YHQ B;  3CP8 A;  3ZBU A;  2W6J A;  4KKS A;  4PC2 A;  2ZL5 A;  1E1R A;  2VNK A;  5BSY A;  2GQF A;  2VNJ A;  4FK8 A;  2M5S A;  4C0S A;  2GPJ A;  3PEN A;  2VJJ A;  4X05 A;  1TTT A;  4RDL A;  3NE5 B;  5FA6 A;  4XOT A;  2DYI A;  5A88 A;  1PKV A;  5TY0 A;  1JB9 A;  4OPV A;  2JN9 A;  1QGZ A;  4G1B A;  4G5G A;  3OEE A;  2JJ2 A;  5FO1 A;  3VR6 A;  4LBZ A;  2XZL A;  4P9S A;  4P26 A;  2ZZF A;  4UZE A;  3SLD A;  3OW2 B;  3QSY A;  2ZBU A;  4Z4S A;  2ZZQ A;  3T53 B;  2ZZG A;  4X7E A;  3AVX A;  1KK3 A;  4QVA A;  1OB5 A;  3BY1 A;  4JMQ A;  4FWT A;  1VJS A;  4RD4 A;  5IYN A;  3WND A;  2XGJ A;  2EIX A;  3PUN A;  4XR6 A;  3WXM A;  1EXM A; 
#chains in the Genus database with same CATH homology
 3MMP A;  3FJO A;  2XNC A;  4RD1 A;  2AHO A;  1QFZ A;  1U2R A;  1VQ4 B;  2C78 A;  3QFR A;  3I55 B;  2OK7 A;  1QFJ A;  4B43 A;  3CC4 B;  2BF4 A;  2BV3 A;  1OGI A;  4TMX A;  3CC7 B;  1FND A;  1W87 A;  1N8R D;  3ZBT A;  1VQO B;  3U6B A;  3CXC B;  2DEU A;  1QX4 A;  3LVB A;  1VQ5 B;  3WBK A;  4R71 A;  1OB2 A;  1G7C A;  3W2F A;  1UMK A;  2VNI A;  1K73 D;  1I7P A;  4RD6 A;  1BX1 A;  3CPW B;  2BPO A;  3OZW A;  1KTV A;  1F20 A;  3CMA B;  1W34 A;  3CCS B;  2EFG A;  3W2I A;  1QH0 A;  4PC6 A;  2BN4 A;  1KD1 D;  4TMT A;  3CME B;  4AF7 A;  4MYU A;  1XB2 A;  1FNM A;  4U9U A;  3FPK A;  4J0Q A;  4LBY A;  1VQL B;  1NDH A;  3CRZ A;  4IW3 B;  3OJW A;  3QFS A;  3ZZ0 A;  4B47 A;  4Y7C A;  2OK8 A;  1GVH A;  3WBJ A;  5AN9 A;  4DQK A;  1OGJ A;  1JA1 A;  1M90 D;  3W2G A;  4B4D A;  4YAU A;  4N3N A;  3WY9 A;  2QEX B;  4WQM A;  4DQL A;  2DCU A;  2QTL A;  2VYQ A;  4HE6 A;  2YWH A;  4P6V F;  1ELO A;  4M53 A;  3WNC A;  3AVT A;  2BGJ A;  1VQN B;  4ZCI A;  1W2B B;  3E1Y E;  1VQ7 B;  1R5B A;  4LBW A;  1BQE A;  2FX3 A;  1ZM3 A;  1EFU A;  1E62 A;  2D74 A;  4NCN A;  5THX A;  3CCU B;  1KK1 A;  3ZZU A;  3SJZ A;  3V76 A;  3VMF A;  1Q81 D;  2E1R A;  5DSZ A;  3G4S B;  3QFC A;  3AVW A;  1GR1 A;  2YWE A;  1EWY A;  3OJX A;  3CCM B;  4YAL A;  2CRV A;  1H42 A;  1VQ9 B;  3JQQ A;  4Q7J B;  4C43 A;  1ZM4 A;  1E64 A;  4QHY A;  4NBS A;  4ZV4 A;  1ZUN B;  3ZC3 A;  5H5J A;  2B7B A;  2PMD A;  1DDI A;  1VQ6 B;  2VNH A;  4ZCM A;  2VZL A;  2BM0 A;  2YWG A;  1DG1 G;  1KRH A;  3B82 A;  2HCJ B;  3JQP A;  1G7T A;  4ZCL A;  1QGA A;  1AMO A;  4H9G A;  4PGO A;  1FNC A;  4M0L A;  1IJF A;  4P3Y A;  4TMZ A;  4K1X A;  1BJK A;  1BX0 A;  2X3U A;  3G71 B;  2HDN B;  3VO1 A;  3MCA A;  1KC8 D;  1QGY A;  2OTJ B;  4RD2 A;  4Y9R A;  4QFM A;  4TN1 A;  2ZIT A;  3W5U A;  1M1K D;  2CND A;  1QUE A;  3VO2 A;  3B78 A;  4YAF A;  3QE2 A;  1VQM B;  2BM1 A;  1FDR A;  3U6K A;  4RJL A;  5KSW B;  1EFT A;  1IB0 A;  4M1K A;  2RC6 A;  3B8H A;  1VQK B;  4ZGQ B;  2BSA A;  1EFC A;  3CD6 B;  1FNB A;  3P27 A;  3CCE B;  3I1F A;  2HMA A;  1CQX A;  1A8P A;  4YAO A;  1QG0 A;  3VNV A;  1QUF A;  1TUI A;  1SM4 A;  2B5O A;  3QFT A;  1EP3 B;  1S72 B;  1Q86 D;  4RCY A;  1WDT A;  3W2H A;  4HE5 A;  1N0V C;  3CCL B;  3W5V A;  5TR9 A;  4AC9 A;  2PLF A;  4MYT A;  1K8A D;  2QN6 A;  4ZGN B;  1KK0 A;  1F60 A;  3CCQ B;  1JA0 A;  4ACA A;  3W5H A;  5HXB A;  1FRQ A;  3JQR A;  3CB4 A;  1GAQ A;  4FN5 A;  4TMW A;  1YI2 B;  1FRN A;  1D1N A;  1KQS B;  1JNY A;  5EMN A;  4LC0 A;  4UAJ A;  3OZV A;  2QTZ A;  4F7D A;  4M4S A;  1N0U A;  2BMW A;  1YJN B;  3E20 A;  1VQP B;  2XEX A;  3W2E A;  2DET A;  1QFY A;  4YAW A;  1DAR A;  2XNJ A;  1QVG B;  4YHB A;  4N3G A;  1S0U A;  1XE1 A;  2DER A;  5JBQ A;  5GV7 A;  3ES9 A;  1EP2 B;  1NJI D;  3CCJ B;  4B48 A;  1VQ8 B;  1H85 A;  3CCV B;  3AVV A;  4B3X A;  1B2R A;  3CCR B;  1R5O A;  1J9Z A;  1GAW A;  5H59 A;  3I56 B;  2OTL B;  1D2E A;  3U2Q A;  1K9M D;  2QMU A;  1B23 P;  3CC2 B;  1JJ2 B;  1Q82 D;  2BGI A;  3AVY A;  3G6E B;  1GJR A;  1GO2 A;  3MHP A;  1R5N A;  1HA3 A;  4BPR A;  2NPF A;  3CW2 A;  4RCZ A;  4PC7 A;  2R6H A;  1G7R A;  3OZU A;  4ACB A;  1Q7Y D;  4PC3 A;  1YIT B;  2BVN A;  3WNB A;  1ZM2 A;  1YIJ B;  1CNF A;  1EP1 B;  2PIA A;  2RC5 A;  3ZZT A;  3AVU A;  1G7S A;  2J7K A;  1KJZ A;  1DDG A;  4B44 A;  3VNU A;  2YWF A;  1YJW B;  1IJE A;  4AF6 A;  4EH1 A;  1TVC A;  2QA4 B;  5GV8 A;  4RD0 A;  4LBV A;  1E63 A;  4G1V A;  3AGQ A;  2C77 A;  3AGP A;  4M2L A;  1TLL A;  3J81 k;  4TMV A;  1SKQ A;  1KK2 A;  1ZM9 A;  4PC1 A;  4RD3 A;  1D8T A;  1YJ9 B;  3P26 A;  4Y9U A;  5TV2 A;  2DY1 A;  1W35 A;  1CNE A;  2QDX A;  1QVF B;  1AIP A;  2B7C A;  3LO8 A;  3WYA A;  1YHQ B;  3ZBU A;  4PC2 A;  2VNK A;  2GQF A;  2VNJ A;  4FK8 A;  4C0S A;  2GPJ A;  3PEN A;  1TTT A;  5FA6 A;  5TY0 A;  1JB9 A;  1QGZ A;  4G1B A;  4G5G A;  4LBZ A;  3OW2 B;  3QSY A;  3AVX A;  1KK3 A;  1OB5 A;  4FWT A;  4RD4 A;  3WND A;  2EIX A;  3WXM A;  1EXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...