2BMWA

Ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bmwA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bmwA02
3QFRA 1GO2A 4B48A 1KK0A 1SM4A 4U9UA 1YJWB 1VQ4B 4FN5A 4ZV4A 4TMZA 3W5HA 4G5GA 4TMWA 1BQEA 1XB2A 5H5JA 1VQNB 3OZWA 3VO1A 1YJNB 1IJFA 3U6BA 1ZM2A 3AVXA 1TLLA 1QG0A 1OGJA 4RJLA 2BM0A 3WBKA 3AVTA 1FNDA 1D2EA 1IJEA 1KTVA 2HCJB 4M0LA 3ZZ0A 1VQ6B 4N3NA 2QA4B 1K9MD 3CCRB 1GJRA 3MCAA 3G71B 1VQ9B 4RD6A 4AC9A 4PC1A 4BPRA 1VQMB 1K73D 4B4DA 1EP1B 2ZITA 4FK8A 1GVHA 3P27A 2YWHA 3W5VA 1Q7YD 4TMXA 4LBZA 3QFCA 3AVVA 3QFSA 4PC7A 4YHBA 1DARA 3JQQA 1KJZA 2BSAA 4N3GA 3G4SB 4EH1A 4K1XA 4TMTA 1JA1A 1KK1A 2HMAA 2PMDA 5TY0A 3VNUA 4P3YA 1KQSB 3CRZA 5HXBA 2BF4A 4LBYA 3CC2B 2YWFA 2OTLB 1G7SA 1GR1A 3B8HA 1AIPA 1Q81D 4QHYA 1VQ7B 5GV8A 3JQPA 3I55B 1YJ9B 1YITB 1R5OA 2DY1A 2HDNB 2C78A 1Q82D 1N0VC 1JNYA 3CCQB 2AHOA 2VNHA 1JB9A 3CC7B 4RD0A 5AN9A 1W87A 1CNFA 1QFZA 4F7DA 4TN1A 3WY9A 1A8PA 1S72B 3WNBA 1YI2B 2VNJA 2DEUA 1U2RA 1I7PA 4Y9UA 3J81k 4RCZA 1XE1A 4TMVA 2VYQA 1QVGB 1J9ZA 4LC0A 1M90D 1G7RA 3VO2A 1QH0A 1BX1A 4QFMA 1VQ5B 4M2LA 1KC8D 1WDTA 5H59A 3CCJB 1ZUNB 2PLFA 2QDXA 2NPFA 1QFJA 4RD3A 1B2RA 3E20A 1G7TA 4YAOA 1FNBA 1HA3A 3CD6B 3A1FA 3WNDA 1KK2A 1G7CA 5DSZA 4UAJA 4YALA 3ES9A 4Q7JB 1EP3B 4FWTA 4ZGNB 4G1BA 5JBQA 1QGAA 1SKQA 4M53A 1M1KD 2BMWA 3CXCB 4DQKA 2EFGA 4ZCLA 3AGQA 3I56B 3OZVA 4RD1A 3LVBA 1QUEA 1EFCA 4YAWA 1VQ8B 3MMPA 1F60A 3G6EB 3ZZTA 4PC2A 2GPJA 3WNCA 1ELOA 1KK3A 3E1YE 3SJZA 4B47A 3MHPA 2OTJB 1JJ2B 2BGJA 2BM1A 3CCLB 3OZUA 4PGOA 4ZCMA 3CCSB 4AF7A 2DCUA 1Q86D 4Y7CA 3WYAA 4MYTA 2QEXB 4RD4A 5EMNA 2RC6A 4C0SA 4YAFA 1D8TA 4R71A 4NBSA 4RD2A 1CNEA 1NDHA 3AVWA 2DETA 2X3UA 4LBWA 3QFTA 2VNIA 2VNKA 2OK7A 5KSWB 1AMOA 2BPOA 1W34A 2C77A 5TV2A 1R5NA 5FA6A 4PC3A 3AVYA 1E62A 3P26A 1W35A 2PIAA 4B44A 3AVUA 1VQLB 2QTZA 2BVNA 4LBVA 3LRXA 3QE2A 1OGIA 1ZM4A 2RC5A 2CRVA 1YIJB 1EXMA 1QFYA 3W2FA 1KRHA 1FRQA 1DG1G 3CCEB 3QSYA 3AGPA 3ZBTA 3B82A 2FX3A 1B23P 4P6VF 1N8RD 3ZZUA 3V76A 4M1KA 2VZLA 1OB2A 4NCNA 1QGZA 3W5UA 4H9GA 3U2QA 1D1NA 1QX4A 2DERA 3ZBUA 1GAWA 1E64A 1FNCA 3OJWA 1N0UA 4ZCIA 4B3XA 2BV3A 3CW2A 3LO8A 3CMEB 1EP2B 4ACAA 1ZM9A 1R5BA 1VQOB 3CMAB 2D74A 5GV7A 3FPKA 4C43A 2BN4A 4AF6A 2GQFA 1W2BB 1GAQA 4HE5A 3W2HA 1EWYA 4IW3B 1F20A 3I1FA 2BGIA 2B7BA 2EIXA 2R6HA 3CPWB 4PC6A 4YAUA 3WXMA 3CC4B 1NJID 1YHQB 4HE6A 3OJXA 4RCYA 3W2EA 3W2IA 5THXA 2XEXA 2QTLA 4DQLA 3LYUA 2QN6A 4M4SA 1FDRA 1TUIA 1JA0A 3U6KA 4MYUA 1FRNA 2YWEA 1EFUA 4G1VA 3PENA 1DDIA 3CB4A 1E63A 1TTTA 4Y9RA 3CCUB 2XNCA 4ACBA 1OB5A 3CCMB 2E1RA 2J7KA 4B43A 5TR9A 1S0UA 1VQPB 2OK8A 4J0QA 1UMKA 1K8AD 1IB0A 3B78A 3VMFA 2CNDA 1BX0A 2B7CA 1QUFA 3W2GA 3FJOA 1QVFB 2QMUA 1KD1D 1FNMA 1EFTA 1H85A 4WQMA 3VNVA 1DDGA 3CCVB 1QGYA 2XNJA 1VQKB 1H42A 1CQXA 3ZC3A 3JQRA 2YWGA 3OW2B 3WBJA 1BJKA 2B5OA 1ZM3A 4ZGQB 1TVCA
chains in the Genus database with same CATH superfamily
5DM60 1B76A 4ZT2A 2V7XA 3OMXA 3LQ2A 3O91A 4NKRA 1GO2A 1UIRA 2C3UA 2PPLA 1ZUD1 2O6LA 3VHLB 5E6UB 3TSAA 1EHYA 4JDPA 1L7DA 1PV2A 2O9JA 2R1VA 4N6OA 4PSVA 2HXYA 2PQMA 3NJ8A 2Y1DA 4WCFA 4ZDWA 3KV3O 4TMZA 1X9IA 3ETJA 3DWGA 1YQDA 2RHDA 1NUPA 2B21A 1T9KA 2CFCA 2VG8A 3P0HA 2GUWA 4Y2VA 1XZGA 2P41A 3AEKA 4P7GA 3ENKA 2VUTA 2JGMA 1RJ9B 5K0FA 4F11A 1Z63A 1VPWA 1Z22A 4QDUA 2CE7A 1EK5A 2OQ2A 2RB5A 4Y2YA 3FIUA 5LDGA 3ITDA 3TECE 5ALUA 4G67A 3T7EA 2WIGA 3ZNPA 3OF5A 2P65A 2H7XA 3OPMA 2PUFA 5HUJA 3MLBA 2Y71A 4NV3A 3HAGA 3S8MA 3QRWA 2H5LA 2PSJA 4JBLA 3ANLA 4JKYA 3PGJA 2P67A 5IAAA 1RWNA 2L82A 1KO4A 1V7QA 4GGOA 4KSBA 4TLDA 5HWSA 1STOA 1KI7A 3C3MA 4PHHA 4R2MA 2C7PA 1TUGA 1VYTA 2JAUA 4OMCA 1WXEA 3WAKA 4YRJA 2PWYA 4K1LA 1YI0A 5F7JA 2Q27A 1MRZA 2FMTA 4XUEA 2YJ3A 2WSMA 2IXTA 4IOKA 2R6ZA 1MO3A 2H7CA 3MWEB 3BGOS 1QYRA 3LUCA 5L51A 1YJBA 2ZREA 2ZRIA 1BX3A 2EG9A 1P1RA 2JGRA 4BP1A 1KZLA 3D0KA 3L4BC 3QKTA 4K9MA 5JVDA 2ZYUX 2RCYA 3DAHA 3KHSA 1L4GA 3QPCA 2I2DA 1B4DA 3ASSA 2IBTA 3PITA 4JI7B 4PTZA 1O2DA 4O4HF 4XLTA 3ZWBA 1HZJA 2JFBA 4BS9A 1PJ3A 4RAQA 5HZBA 4I1RA 4E14A 1U94A 2JRLA 2B35A 1VMEA 5BSFA 3OUTA 3WHKA 1T6YA 2YJTD 5IDWA 5H70A 1T8TA 1K5DA 3AOEC 1PNRA 2BFAA 3F6CA 4DK1A 4JLNA 2JHGA 2GBFA 3OETA 4XCXA 2F43A 5I7EA 3EMBA 4J1NA 5G40A 1EKXA 3W6UA 1ZBQA 5I4IA 1T3TA 4V03A 3U44A 1Z25A 1U0GA 1PVDA 1WOPA 4C0AC 3P27A 3GJRA 5EZYB 4POAA 1TQ2A 1EUQA 3QVTA 1ORRA 1JE0A 4KOAA 2WQ6A 2ZRPA 3NWEA 1OLSB 2H7VA 2R7AA 1VSBA 2OA0A 4MEBA 4R8VA 4HN4B 4XUCA 4P4SB 1FFAA 1FSZA 2BUCA 4MDYA 4O2BB 5DT9A 1ONNA 2IYFA 1QR2A 3D6TB 4ALMA 3ROGA 3W2TA 4HGPA 5JNVA 1CUYA 2LCFA 1S2GA 3MJFA 5IAJA 3DPSA 3RYIA 1ZFNA 5AVVA 2IZ1A 4P26A 1VSVA 3QZUA 2RGNC 2XY4A 1MN6A 3DFMA 1NWHA 1R27A 5EE5B 4HL6A 1FJHA 3IDSA 5F7ZA 4G63A 1MUUA 3GGPA 3I9V1 5IG2A 1OTHA 1KJNA 4KH0A 3RTAA 4BNVA 2PWZA 2Q3MA 1CUGA 1BTOA 1E0AA 1KY3A 5JY1A 3BRSA 3FNIA 1USKA 4M8KA 5CITA 1FUYB 3AIOA 3I45A 3N0RA 2HQRA 2OXCA 4MPJA 4I6GA 4MVWA 4QUJA 1U0EA 5FUXA 1WF3A 1MZVA 4FGKA 4XWTA 1N5IA 4YP1A 3RODA 2JVIA 5E0KB 1RZUA 2CHEA 5EPOA 3PPIA 3D5QA 1YJ9B 4IDCA 3CNHA 1VBMA 3F8SA 3JWIA 1DG3A 4YLGA 4AYXA 2ORYA 3GVLA 1YQQA 4YV1A 3PVDA 1K06A 1Z2PX 2E7ZA 1LVHA 2I80A 2OV8A 1BZYA 2AN3A 3PEEA 4H3KB 4JSRA 2GBLC 4X97A 1K7EB 4LNHA 1OC4A 2F90A 2JLVA 1TQ8A 2Q2WA 1LTHR 3G9UA 1FY2A 2GI4A 4O6VA 5D87A 5TMDA 3ZJ4A 3IBGA 1RBZA 3A9CA 2YY6A 4UUAA 1A8UA 1G8JA 2BL4A 4LX0A 3CTPA 1T1EA 3KB6A 1A96A 1BROA 3H04A 1OGYA 3PR2B 3R7AA 3RIYA 3TLJA 3U80A 3WMGA 3WQQA 3OCXA 4E4TA 3TQRA 2PZFA 2GTPA 2V7QD 2A4MA 2W5UA 2W58A 4X6UA 1MOZA 3AJAA 3BD8A 5KBYA 5C34B 4YAGA 2QQ0A 2W8ZA 2EYQA 3FUXA 1S2MA 1XJQA 3NHAA 3MUFA 2DUNA 3SR3A 1LZKA 4X0CA 1YQGA 3FZEA 3PIRA 1I33A 3ZUPA 5BR8B 1I6MA 1OWOA 3DS8A 1DRKA 3FVWA 2HSZA 1EESA 4DSOA 1PJ7A 2J0QA 1WUTA 3VZPA 4JWKA 3LDHA 4D80A 4GZ3A 1A8SA 2UUBB 2ZM5A 3UA3A 5FPHA 1LF5A 2PT7A 3WOVA 2V4UA 3HO8A 3PHIA 2QN7A 3NKVA 3IPAA 3R3UA 4GC5A 4ERNA 3K73O 3H6KA 4Y9SA 4LC0A 4G23A 5CG2A 2QMHA 4RHCA 2JLXA 1KH3A 4E5SA 2IYRA 1SZJG 3X1ZA 2IKQA 3HL0A 4AULA 3G17A 3VSDA 4MDHA 5HKOA 5P21A 2XR1A 4AY6A 2AFRA 1G3IA 3ZX4A 5D01A 1BX1A 2QI9F 3B3AA 3EISA 1C5KA 4M83A 2QQEA 4RHFA 5DK6A 1DE0A 3I23A 4KWCA 4IXWA 4MS3A 3CCJB 2PLFA 1RM3A 1OJ7A 1Q0RA 4FE4A 2PAFA 3JD0A 3DTVA 1B2RA 4LYJA 2Z4RA 4NYJQ 2DC1A 5G0UA 3WYGA 5BR4A 3KWLA 2FR0A 3HDTA 3BA6A 4C3OB 5LJIA 5G02A 4OJQA 4XIGS 1FW6A 3ZKWA 1GGMA 4DR1B 5AHXA 4MARA 5T8KA 2NSYA 1ZRNA 3IB6A 1Z15A 1MF7A 4J16A 4U7WA 3QXCA 1Q92A 2Y0PA 1HZZA 1T5HX 2IXGA 4JBHA 3T7JA 5FBHA 4XDHA 4XI9A 4C1NA 4DRZA 4J07A 4TQ9A 3BGWA 1HSZA 5KIAA 2FKAA 2O3UA 3WV5A 2AXNA 4AU1A 1Q95A 3GVPA 3G2HA 4UUNA 1EFHA 2OLJA 2OGWA 4TTAA 3HE3A 4EYSA 3SYMA 1Z6YA 4Z4GA 1IUKA 1Z06A 3ICCA 4C2TA 4C7BA 1ZVVA 3AGQA 4GP6A 3HV2A 1FYEA 4QXAA 1L6RA 4GKKB 4RQAA 5AW3A 1J8QA 2XTJA 2V98A 3E9CA 3OTOB 1WBDA 3CMMA 2LVBA 1PX2A 1UMCB 4LKOA 2VBCA 4QGAA 1TKBA 4EB6A 5G53C 5CT6A 1KQGA 3HVRA 1RD4A 2WG1A 1WXXA 3UTCA 5LMCA 1SCBA 3A3KA 3FJYA 2YRWA 2AYYA 3PU6A 4NV1A 4WJKB 5AK5A 3WGVA 4W8GA 1C0LA 1NXTA 5G1PA 1HYHA 3FCEA 4X7BA 3TG2A 2O8BA 3L06A 3VR2D 1NUTA 3GA0A 1R9GA 3TZBA 1M2WA 2P35A 2ZSBA 3H97A 3P9NA 4B3JA 4YUWA 4DV5B 3L02A 3AP3A 3RBAA 1PTKA 3QVWA 3OFKA 4IVPA 2W90A 1PG0A 3GROA 1PKEA 4WKPA 1IRXA 4Q9IA 4DC9A 3LWNA 5CFNA 1Z6GA 4EABA 1JJ2B 4MWGA 5TF4A 3V2GA 4WXPA 1Y7PA 4DSAA 5JALA 3EGDB 3DZDA 4FEGA 1PFUA 3H83A 3CCLB 1R8XA 5KNBH 1E3JA 3RU3A 4NJMB 3GOQA 4Q01A 3VH4A 2KE5A 3P2EA 4P5DA 1GIAA 1NZJA 3Q7IA 5JS6A 1Y8RB 2QY9A 3JASB 4KQ6A 3G8CA 1LJ8A 4B6PA 4ESOA 3WLMA 1UJMA 1H2WA 5L6MB 3I5YA 1NQOA 4BBJA 4C88A 3ZVRA 1DJMA 3TUZC 3LV8A 1R16A 4HYQA 2A9QA 4KN8A 4WKNA 3WDKA 4JFRA 1C81A 3BREA 3RVDA 1QIMA 1V43A 4CT5A 1I80A 3AU8A 5A3JA 3B2NA 3G8BA 2PAAA 4WFIA 1SQFA 2UKDA 3ED5A 1JG2A 3WDLA 2AMFA 3CUEF 4JY7A 1MO5A 1IQPA 2FW8A 2VUUA 4IH1A 1EI9A 2UZ1B 2XMQA 4L3VA 1J4AA 4XZ3A 3TYXA 1S7CA 4GI7A 4N0MA 4C5BA 4EI2A 4CXMA 3SJBA 4FUTA 4W5TA 2EGUA 4BWFB 4ZI7A 4D98A 1R8YA 2JZCA 4TUYB 3Q3EA 5FFFA 2FK7A 2IEGA 4J1QA 3T5PA 2DETA 2GB4A 3L6DA 3B2QA 2D2IA 2FEXA 1Q1QA 2Q2VA 1X7YB 2VNIA 1QBGA 2IHTA 5DKFA 5ELXA 4HYYA 1AMOA 3UHAA 4BE9A 2P6OA 3MCUA 4EW2A 3T0FA 3V8NA 2OQIA 5IANA 1B1AA 1BHO1 3KKZA 3T1OA 4B0PA 3HGQA 1E6LA 3WQSB 3ZEAA 4G1FA 3I28A 3ESDA 2AOTB 1VG9B 1DV2A 4G5SA 3S68A 3VDMA 1R50A 1ZL0A 2IYPA 1CE8A 4B6OA 2ECPA 2C20A 2WUWE 1S9DA 4MRAA 2QTZA 4YIKA 3SMQA 3MK31 3FHTA 5LMNB 1KI3A 4NK4A 3VR6A 1L7RA 1I9GA 1UP7A 3GFTA 5L3RA 2QTAA 2NUAA 3RS4A 3HDHA 4CI0B 5E1MA 1RI5A 2HCTA 1W5SA 4WEOA 4FX5A 4YLYA 3NYRA 4PVCA 4NDNE 4QARA 2VAVA 3N74A 3IE0A 5BSEA 2WR8A 5FOWA 2BBOA 1GWNA 1KR2A 1RWWA 2ZJ5A 3QU2A 3ZHTA 2O5EA 1D04A 2K87A 4UCXA 1V45E 3RUIA 1Z0SA 2B7LA 3ICPA 3OZEA 1G0NA 2CLEB 3URKA 5C9ZA 5JAPA 1BDBA 4PPYA 3FETA 4ALKA 1A9PA 1C9KA 4P6VF 2GK4A 3AFNA 3ANSA 3DWFA 3DZIA 4MV7A 4Q05A 4Y2JA 5G0VA 2BYTA 4N5DA 4R1QA 4P4UA 1OB2A 3MJHA 3EOAI 2QVYX 3RANA 3W5UA 2G04A 3AR8A 1MQ8B 3PT5A 1ORWA 2QUJA 3O1LA 4DVJA 3ZBUA 1UOOA 3UATA 4LVUA 1OX4A 1YMVA 2FUNB 1DINA 1QLHA 2D7CA 2HRBA 1FSGA 3OJWA 1K7SN 3FUWA 3GARA 3U3DA 3DNFA 2UXCB 3GJTA 3N53A 4E2XA 4OAOA 4ZAWA 3U5TA 2EFDB 1RAGA 3JQAB 2HBRA 1W0CA 3N39C 3AEUA 1K5HA 4XVRA 1O08A 5J4HA 1YR3A 2ZJ0A 3BXHA 5DX8A 1T13A 2OCIA 2QNIA 2JGAA 4RQTA 5DBEX 5K20A 1WW2A 1XDZA 2FDRA 4MR8B 3V1LA 3GGGA 1RJ9A 4P54A 1LJLA 2Y1XA 1JG6A 3BTSA 3LSYA 4IVNA 4DCCA 3BERA 3M3HA 4NBLA 5B1SA 3RUEA 2CZCA 1I0IA 2DECA 3VPDA 2QTVA 2ZYSA 3PQ3A 5KNDA 2LW7A 3UMMA 5FDFA 1KQ3A 2PL3A 3CBGA 4ZVMA 5K3DA 1W5AA 3VJLA 3WRYA 4BJ5A 4EQZA 2XB2A 5JYEA 4OMFG 1KEUA 2WIFA 5F5XA 3BJMA 2QX9A 1S8OA 1P4AA 1XQVA 3HVUA 3IAAA 1KI2A 4ZOLF 4IS2A 4ENWA 5IJ9B 1W0JD 1A9OA 2QUBA 4FEAA 2NOAA 2FLVA 4J1TC 3U4CA 2ID7A 1KHTA 1SXGA 3AMVA 1W9HA 4E1BA 1L4HA 2YVLA 1NXPA 1OH8A 1XVAA 1FFYA 2DBYA 2P3SA 3N05A 3UHOA 3PYXA 2IHVA 4FFBA 4IDBA 4TKUB 1ZOPA 3NQ41 4PBTA 4ZV7A 1KQOA 1RP1A 5ERXA 1Y4ZA 3W90A 4BLTA 4DB4A 1PJ2A 3INNA 2HREA 2HXGA 1FRNA 4MIYA 4IIXA 1QG2A 2QXTA 2AVDA 3L40A 5BWOA 3DAGA 3UUFA 5C1IA 2O8EB 1XZMA 5G0WA 4DVGA 3NWPA 4BXOA 2XBMA 2OZVA 3NEAA 1O4VA 3UJHA 2I62A 1TE2A 3L05A 5IVPA 1DXQA 1L4KA 1U1IA 5SV2A 1KARA 4XFJA 3M70A 4UDNA 3ZW8A 1FP6A 1NVAA 4L5BA 2MMCA 1JEEA 1C7RA 2NTJA 2QGNA 4CN8A 4RXUA 2W48A 4G6ZA 4FLMA 4J90A 5T4FA 1HMYA 4CBVA 1NP7A 4PHTA 1G2OA 1IATA 3D8NA 1XTSA 5DM4A 4N03A 2GPTA 4MR7B 3TMYA 3TI7A 2IH5A 3E35A 3I5MA 2PE3A 1PD0A 1RCTE 3FCSB 4NNPA 5E4JA 1XTQA 3PDJA 3X1MA 1UBRS 4ND5A 3INRA 2Z9DA 1PJLA 1SVLA 4UATA 4EGJA 4URUR 1C0IA 4Q1CA 1OQAA 2GXUA 2FLKA 2HQBA 4JB3A 3RVLA 2IEAA 4PE5B 4R7TA 4RTNA 3BK1A 4XX0A 4C7OB 2AYZA 1I7LA 1XJ5A 1R64A 3MZ0A 4EG8A 2AQ8A 3GEGA 3H5RA 4N5LA 3W5BA 2Y0CA 3PEFA 4U7JA 4ANFA 2X7XA 5AVKA 3DBRA 3R5TA 4HPWA 4BCDA 4V0LA 2HMWA 3A6KA 1T4GA 2C57A 3OZ7A 3VKHA 2YHIB 4LHYA 4FEYA 1SCJA 2REOA 2W98A 1NUUA 2QM3A 4RF4A 1WMAA 2QEQA 1A9ZA 5GJWC 4PU0A 3CN7A 4D96A 3ASRA 1DJNA 3BOSA 3R3YA 4BCBA 4EF4A 1CIJA 4CMAA 3R7DA 2RKWA 2V7EA 3ZDQA 3C48A 1J99A 2GKOA 2OKGA 4HAYA 2WWYA 4JC5A 5DOZA 5HZMA 1GTMA 1KEVA 3GDWA 3IT3A 5ARDA 3WRXC 3OPYB 1X1EA 1WV0A 1U0TA 1TA4A 3GGJA 1UMBA 1VMAA 1IG3A 3DV9A 4J8PA 2ZBUA 2PXHA 3V8EA 4EUNA 4TMWA 3T3IA 3UBMA 3NZEA 5LM3A 1QJCA 1V11A 1VQNB 1P4GA 3JWJA 2E4YA 2V7BA 2X1MA 3MBKA 4Q4JA 3ZWMA 3TNYA 5EQTA 5JCPA 2HRZA 2OV4A 4BNHA 5D84A 5F1YA 3HM9A 3ZOZA 4BY9E 3OZCA 4RPCA 4LTDA 1ACJA 4WZTA 1MGOA 1P1BA 2VSYA 3A4IA 3L6EA 5C31A 3FTDA 2PU7A 4G65A 5ER6A 5DHAA 1XD2B 2VDWA 5FA8A 4B7CA 2FFRA 5C1DA 2QTFA 3R7BA 5LLTA 3AVXA 1G3UA 2PSHA 2Z95A 3D43A 2X77A 5ELMA 1L5HB 5FB3A 2ZS7A 1Z3CA 3OIGA 2A4KA 4U9IS 3V4VB 4EL0A 4HTFB 3MWLA 5I9TA 3M34A 1LPNA 1UPAA 2H2GA 2O7NA 3DMTA 4M7PA 4AN1A 4BJHB 4DSNA 4YV2A 1AGYA 4UFOA 3HWWA 1J33A 1KAGA 2Y9MB 2DQYA 1WM1A 4G5YA 4WD3A 4J6FA 2ARKA 3A6GA 3AVPA 3TPZA 4DLZA 3HFSA 3ON5A 4RM2A 2OHOA 3PUIA 1EVJA 1RMQA 1PE0A 3GFSA 1Y3AA 2QTRA 1KTVA 1M8PA 3G7NA 4H6VA 2PX0A 4A2PA 3H2GA 4B80A 4TYWA 1EXNA 1JJFA 1T9CA 2M2IA 1VJSA 1N6RA 2X6QA 1GFWA 1NULA 3GRUA 3M33A 2CJPA 3V8BA 1JFVA 2MOKA 2WYOA 2HDWA 3LC7O 1OXUA 4XOTA 3JQCA 5ICEA 4LJRA 1J21A 1CS0B 4WNAA 4KQFA 5KPDA 2QAGB 4KK3A 2R25B 4E09A 4YTEA 3L7BA 3SHOA 1H2XA 3OQOA 5J5CA 1IHMA 5JNUA 3O93A 1FSPA 4PZPA 4B5KA 4AXBA 1XTIA 4DL9A 2VT6A 2Q6IA 2HAEA 4QXOA 4JEMA 3GVCA 4BDTA 1SXHA 1YFJA 1HUQA 1Z13A 2CLOB 2IYVA 3R7FA 2WF6A 1L5OA 2GWHA 1RP7A 1U0JA 5HEKA 2Z6UA 1G3QA 4J9UE 4LE0A 3TL3A 3GWGA 3BWYA 4IQFA 1HDRA 3VNBA 2W6CX 2D3TA 3PTZA 1HX7A 5ALFA 1OY1A 2P4QA 3R24A 2W8BA 4ZQGA 3COPA 1Z36A 3GZ4A 3VAYA 1YD7A 3EEBA 1QK4A 4ZPXA 4L5YA 5DTMA 3ST7A 4G9BA 3JVVA 1WOMA 4OQZA 4I4LA 4YAIA 5KB3A 3QI2A 4Z4HA 4Q6WA 4RU1A 3FKSA 1GUBA 2O48X 2FH5B 3HWRA 4D74A 1UMCA 1MX1A 5ER9A 1KAHA 3SS8A 2JCSA 4ZYWA 3DD1A 4P3YA 1GL6A 2GBIA 4RY2A 3PFGA 1MIHA 2A33A 1V35A 2ATIA 4C4ZA 3HJAA 2P9BA 4D6YA 4GICA 5NULA 4YMGA 3E8MA 2DB3A 3KB8A 4CHTA 2PS1A 4Q3DA 5DEIA 1Q16A 5EP4A 1LDNA 3HWSA 1VM6A 2QM8A 3K9FC 4A0GA 4DV6B 4WK6A 5F52A 1NASA 4OGWA 5BWCA 1PHRA 5FULA 2QXYA 2R5NA 3PEVA 4BN5A 4C2AA 1J2TA 1XPOA 2VJLA 3GZNA 3JS5A 3UJBA 3B89A 1J90A 3G9ZA 4DANA 1O96B 1P2FA 1R6VA 1X8XA 2KSQA 3FF4A 1KDPA 2XYHA 1Y0RA 1E60A 3D6VA 3IAS1 2XRMA 3CF0A 4P4NA 5A3VA 4R68A 4CF6A 2GFQA 4ASUA 1Q19A 4OHUA 1JBKA 2H2HA 1E0KA 2UVQA 4TKLA 1SCUB 1P0MA 2BEUB 2PZKA 4KFTA 1SBTA 4PEVA 1ACMA 2E3JA 2FZWA 3FLBA 4V0MA 5A6VA 2CNNA 4UXHA 4BVJA 5B1EA 3HJTA 5CB8A 3CCQB 1ZLXA 2WAOA 4A10A 3CEJA 3ZGLA 1EBFA 2ZIWB 1QTNA 2FPPB 2ZIZA 2GQ0A 3EIHA 3IIKA 2P7HA 2PD6A 4R8KA 4BO8A 3C3DA 2BI8A 4N76A 4Z3KA 1QFZA 3DCNA 2UVPB 3MWJA 3HU2A 3QY0A 2JJQA 2OBYA 3PA8A 4L8VA 4P2BA 4PQFA 3T94A 1OD6A 5CFLA 1OUMA 4JR0A 2AEJA 2FK8A 5LQUA 4LC1A 1D3AA 2OMEA 4MK4A 4TRNA 3FOEC 4MS4A 1GNTA 2BJWA 1PFGA 5LB4A 1MJGM 3AC0A 3I9OA 4BGIA 4PANA 1U2RA 3ZUGA 4ZOCA 1IXRC 2X23A 1NQXA 1CX9B 4XOPA 4GPZA 3F7NA 3CFYA 3X1WA 3MUEA 2HU7A 3PS9A 2VJIA 3UICA 3WJ1A 3JQDA 4G1UC 1QZZA 4D3SA 3IQWA 3OUUA 2D8AA 4AKHA 1Y5NA 2O6HA 1L7PA 2HA6A 1EIZA 1V41E 4LCJA 5JRDS 2WILA 4KB5A 4Z86A 3BRQA 1AS2A 4FOLA 4UDYX 3FTEA 1EGHA 4M2LA 4HBGA 1WDTA 1PJCA 1XAIA 2IXBA 4F06A 3ONYA 4RD3A 3EEFA 5E38A 3RTEA 5JROA 3RC1A 1G7TA 4JKIA 2PANA 3ROTA 1GYRA 1WEKA 3WL3A 2QNRA 1G64A 3QU4A 2QD5A 3JQ8A 4W63A 1ZH6A 5AW0A 3WNDA 4RFVA 1DAKA 1XJ0A 3GJ4A 1H6CA 4KPEC 1OH5A 1YQEA 2ZU6A 3W8DA 2P3OA 4KO4S 5DBGA 4KXNA 3CUYA 2SKCA 5TMPA 4WSOA 4D4LA 3AHDA 4DDMA 5BSWA 5ISMA 3IODA 4LA4A 3BILA 1M73E 3EN0A 8GPBA 3W4JA 3CXCB 4C1BA 2ZRFA 2EWVA 3K2QA 4LWOA 2G83A 3IPCA 2FN3A 4EPRA 4IIDA 1OBOA 1NW4A 3KVNA 2F9FA 2PMFA 4QLOA 1NQWA 2RIRA 1A3CA 4HC4A 2MYTA 4R16A 4JYCA 2BE9A 2PMBA 2O7VA 2B94A 1X1RA 2I9KA 1CF9A 1VLMA 1V37A 4QYTA 1H4TA 1DKPA 5AI6A 5KNCD 4E2FA 1R0YA 1E59A 1HOXA 1FTGA 1VQ8B 3I2KA 3GNTA 3RBZA 2X0DA 3GLUA 3AF3A 1BSVA 3E7WA 1U9CA 3DP7A 2AEFA 1ND6A 1NVBA 3D2CA 4PC2A 4WFQA 4F9TA 3Q8MA 2QPOA 3RSHA 2ZI3A 4RTOA 4GX5A 3A6FA 1U3VA 3DDNA 4UFPA 3PFBA 2ZVJA 4IJKA 1NE7A 3PYMA 1KK3A 3TR0A 4F91B 4L78A 1E2QA 3C87A 5AH0A 1F5SA 1YHYA 4US1R 1LLUA 2JPDA 5EJ5A 4CUJA 4WADA 5FWDA 1Q7BA 2VDLB 4BQFA 4EB0A 3CVUA 4AAYA 5KOHB 4NJEA 1DRUA 3ZHXA 5F2OA 4R4JA 3GRCA 1X1DA 1F8YA 4DUYB 4NCAA 3DDYA 4OCZA 2DHDA 1ZIYA 2RJOA 3PCTA 1GUFA 5L95A 3RFVA 2AZXA 3HYRA 2TMKA 1Q86D 5IW8A 3T5DA 1AUOA 1MJGA 3KXIA 3U56A 4OHKA 4DKJA 4KAAA 5B2ZA 4MYTA 2IHJA 3IS3A 5FOVA 3ZXSA 1GITA 5CCBA 5EWMB 2VJAA 2PUGA 3K6SA 5FTWA 4X8MA 1Y6GA 1P9RA 3VC2A 1WB9A 4RXMA 1DQZA 2GTHA 3FDXA 4BJ6A 2CJWB 3Q15C 1CEYA 4N47A 3DV2A 1D8TA 1ADGA 3R3WA 3PPXA 3I2YX 1VL1A 3LHDA 4YIHA 2RHWA 3C5CA 2X0FA 3DHYA 1IY0A 3HSYA 2QR3A 3IIJA 1C0PA 2GJSA 3G0IA 4LNUB 4D1YA 2X3UA 3ZWQA 3IKLA 1ESEA 1KP2A 1EVKA 3LUAA 3R5KA 3S7ZA 3UAYA 4BMCA 4N0PA 2PKQP 5ALLA 1Z0AA 3AF0A 1I10A 3L7MA 4P22A 1R6BX 4UVDA 3ML1A 4YI5A 421PA 5F98A 4QU8A 3NB0A 1QP8A 2O07A 3VH3A 1LVGA 1KZ7B 3MSXA 5COAA 2FWPA 3IHWA 5DYGA 2G5PA 4QOGA 1MAUA 3DCYA 4MLZA 3TB6A 2CMDA 4IFIA 1KOLA 3A28A 2WI8A 1A7AA 4RQBA 2QKYA 1IN5A 4F4DA 1YJCA 4CT0A 2OCGA 4QREA 4WBNB 1TEVA 2ZL6A 3AVUA 1Z5GA 2D0PB 1XDBA 4RDJA 1SUIA 3H0KA 3HCCA 3JQFC 3PDHA 1XNRB 3HXLA 1XEWX 1IOZA 2FAXA 5D3KA 3BGVA 2J3DA 4UM9B 3ZHRA 1YV9A 1R4NA 2IY8A 4LPSA 4M9UA 1RPAA 4M21A 2ZUTA 1EXMA 1QFYA 1PW5A 1XEFA 3EVCA 4CPDA 4Z7JA 1F7UA 4DLXA 4OU5A 2OHGA 1E2MA 4YJ3B 1Z2CA 4Y2QA 1H2HA 1FFSA 1OC2A 3M0EA 5JMPA 3VVMA 4JIGA 3A70A 3T4UA 1LTQA 1XZ8A 2KLBA 3OT1B 5A02A 4L50A 3DHEA 3D4NA 4BB9A 2JVJA 1UPCA 1DUIA 4J3JA 1YB4A 2V7QA 2I0FA 1ZNZA 3AR4A 4N48A 1U3FA 2IXFA 1DAMA 3F49S 1I5EA 2GA9A 4MW5A 4YWJA 2I5PO 3PHGA 4OJTA 3U7JA 2GCPA 1E1CB 3BJIC 2PS9A 3ABRB 5SY9A 5BUZA 5LQKA 2PXXA 3K2EA 3P9CA 3QVGB 1HSOA 3BK2A 1WR8A 5A05A 4J1SA 1JQ5A 3NPMA 3IDQA 2V7UA 2CXRA 4UTZA 3OU2A 3OIUA 4GYWA 2V6FA 4U2GA 2XXAB 1IG0A 4OQQA 2XF2A 3L1HA 2BFDB 3P2KA 5AW5A 3SQOA 2V4MA 3GL9A 3K6RA 4MA4A 3KDSE 2R4QA 1UBLS 1JAXA 1EQAA 3H5TA 1UBKS 3L7JA 3LH5A 4DIEA 1MT3A 3GLKA 4QZVA 3E61A 3C41J 1NR1A 3TQFA 4R0VA 4BEVA 3FLAA 1KDVA 3RSGA 4FGJA 2H1HA 3F7TA 3OPNA 3RYCA 4TM8A 4CKCA 2BEWA 3A14A 3EXG1 1NHWA 3EA4A 8ADHA 1VE7A 1V1MA 2JCGA 2HM7A 3RWBA 2GAFA 2DJ5A 4H27A 4KIUA 4OQ4A 3VDNB 2BN4A 1KU6A 3U9LA 3BGIA 2DJIA 2XKBA 1C29B 3CLTD 3KEOA 3CVVA 3K0SA 3THWB 1JG3A 2SBTA 1BN7A 3TR5A 3AEQA 4BP9A 1XD2A 3GCZA 3ZI7A 4F9FA 3E5NA 1RBYA 1ZPDA 4V0NA 2H2IA 3O21A 3OIWA 2PH5A 5COBA 1L5HA 2FMUA 1X1SA 4YAUA 1GGJA 3T9BA 1NJID 4CV0A 2BC9A 2QRMA 4PZEA 4QO7A 5BT9A 3UHPA 2YINC 5FFMA 2RGYA 1QPZA 2D5CA 5KPJA 3D8BA 3CIOA 2IWRA 2X4IA 3EWIA 1JHAA 2AXQA 2XTZA 3HFJA 4E1VA 2YQ5A 2I6GA 1AM4D 3U7QA 5CYPA 4YUVA 1NAHA 2Q6KA 1MVLA 4HAWA 4Z2AA 2LPMA 4K6CA 4PN3A 3QUTA 4L07A 1JFTA 5A9RA 1N2BA 3A2KA 4YQZA 3AX6A 4CEHA 1A5AB 2WMYA 3THYB 3PHLA 4AUNA 3N3AC 4X7RA 4UMDA 4PGAA 1TO6A 2PMEA 1WDMA 4DM4A 3NP7A 3PDUA 2ZUCA 2HPAA 1H2BA 4ZMBA 1JP7A 3WGJA 1SUAA 1EFKA 3CLUD 3IR6A 4XVHA 2MSEB 3NHJA 1IFXA 3SVTA 3C3AA 4ZDKA 1M1NB 2N46A 1PDOA 3VR2A 5IJ0A 4HFMA 4CN9A 4OHYA 1TT5B 5TR9A 2VHTA 3OIDA 1NMEA 3ZDRA 5DO9A 3I0NA 3IBFA 3L6BA 3UG6A 1KO8A 1JIXA 3EG9B 5JI3E 2JIZD 1WUHS 2HCFA 2WDPA 3LCUA 3PNPA 4R31A 3USES 3FCUB 1BVHA 5DM1A 3ZQUA 2WICA 2KS6A 1JQBA 1UBUS 4QJ5A 2CXSA 4XLFA 1Q22A 2H4JA 2Q3DA 3VKWA 1FSFA 3RSSA 1Y63A 2NSHA 5U9CA 2Y4NA 5EG5A 1NFFA 1QTRA 2IU3A 3LKBA 4MKZA 4EI9A 1V9CA 4PM4A 5JZMA 1MAHA 1L3CA 3I83A 2BDEA 1ZAKA 1N25A 2JI7A 3ZN2A 3CE6A 3R3SA 2M6KA 2ZWOA 5JYBA 1KAQA 4MMZB 4AZ3A 1U2GA 2IEBA 1HT3A 3FLEA 3HSKA 4L3WA 4WAUA 3W4KA 3L0SA 1G42A 3T1YB 1F3OA 1JX6A 1PU2A 1U3UA 4UEOA 2RHCA 1F6BA 1H5QA 4Y1EA 3HBMA 5HDQA 1DG9A 3MWYW 4HAIA 4MUAA 1TF2A 4AUEA 3GLFB 4KNYA 3K8YA 4XIJA 4QBGB 1VGVA 4N7JA 1UL1X 4NPCA 4AY5A 4F4JA 2I2CA 4QNNA 1KMIY 4BB6A 5BQFA 2MMGA 1NBIA 1JHVA 1FDWA 5IDQA 4FYYA 4HBZA 3RO7A 3TZKA 4HNVA 1UDWA 3FHLA 4QG7A 2HPHA 4TKZA 4B7AA 4DUPA 4ZAZA 3RVRA 5T3UA 4BMVA 1PQUA 3QLVA 1XKTA 2VDPB 3M49A 4X41A 3C4QA 3C39A 3BSWA 1MC1A 5EWJA 4K86A 3RVNA 3ZCVA 1GPBA 4DA7A 2GM3A 1QHIA 5ESDA 2W22A 3EIOA 2PS3A 4G5GA 4GIBA 4P86A 3DYIA 3NEPX 1SIWA 2HH9A 4RA6A 4V0ME 3H8VA 1SULA 2QR5A 3RGGA 2ZYTX 1JAYA 1Y3IA 3FSJX 2QVCA 2C42A 3A1TA 1CUFA 3DWIA 3GJ8A 3KLPX 3FTQA 4Y9TA 5BO5A 3BWCA 5A7HA 4CKBB 1L5VA 2YNMD 4EJSA 3EQ2A 3NORA 2AG6A 1ZI6A 4KE9A 4BVEA 5JQWA 4L5IA 4MUKA 1Q91A 3AF2A 4PAGA 5HRAA 1ZR4A 4MA5A 2YMQA 4ESHA 5C5DA 4C6TA 3DULA 4LYFA 3UV3A 4AKSA 3PJGA 2FR1A 2WT8A 1S8FA 4MGYR 3CZ4A 2R97A 3VV3A 2J30A 1NM5A 4H7FA 3FZNA 4B76A 4Y2GA 3A8IA 3LNNA 2V6IA 4ZU3A 4RJLA 4Z3OA 4P32A 2CL0X 4K6MA 5SYAA 4B45A 1ECBA 2ZE6A 1ZN2A 3HKEA 1CP2A 4LZAA 1RM5A 4AJEA 5HS4A 3SHVA 3C7DB 2D1SA 2Q6VA 4ZQHA 2A5FA 2HRRA 3C45A 3GRAA 3N8IA 2VZ8A 2IOYA 5JI2E 5JMWA 3EXEB 3U4QB 4L9SA 5J40A 1KOJA 3OE7D 4OK6A 2P11A 4NOMA 3C8UA 3UWSA 3ZZ0A 1IIRA 5CNMA 3M4XA 2V9PA 4NYIR 2EYUA 3PC2A 3SICE 4XIIA 1GJRA 1TZBA 2VQSA 3F46A 2CXPA 3L7KA 1O57A 4NPHA 4C7VA 3P97A 1AGNA 3KVOA 2EJWA 2G8LA 4Y0AA 5HQTA 4YP7A 1E0DA 1IJKA 4YMTA 1GFZA 1OROA 3OHSX 4QQRA 4AC9A 4CL2A 1U90A 5A5GA 3ET5A 3A10A 2HNKA 5H9WA 5K8JB 1T8RA 2V74B 2AN9A 2BBSA 2BIFA 2VJMA 1FB5A 1G6HA 1YK0A 4BAZA 5BNWA 5K8UA 4C4RA 1MW8X 3HN2A 3BULA 1RXVA 5IF9A 3NBZC 1R5JA 4BV8A 1T5BA 4CIVA 5JPCA 2YVQA 3QU5A 5DSTA 4N01A 1SCKA 1Q57A 1H93A 1VBNA 4ND7A 3IV7A 5CB4B 5KNBD 3KFVA 2H16A 1H5UA 4NJOA 4RFSB 4EZEA 4OQLA 4AQYB 3AVVA 1ATZA 1KAOA 1WCIB 1RQLA 1X7WA 1ZD5A 2EKLA 5KSPA 3ZNQA 1US8A 3IR5A 4PRZA 4YCDA 1U3CA 4HMQA 3ZW7A 2ZJ6A 3OQ6A 5C37A 4DCTA 3ROFA 2E37A 2FVXA 2HBZA 2MSCB 4LRSB 1K8QA 1ZICA 2BBWA 5EAIA 1SXPA 1HDXA 4RPBA 2IF0A 2D1FA 3IILA 1N32B 2RHLA 1OHHD 1XU7A 4PFQA 2CYBA 3IJPA 1BE0A 2HSDA 2C8KA 4ENQA 1W0JA 1SKYB 1GOTA 1H4QA 1FUIA 1KRWA 2BR5A 3VJRA 3MJDA 1AHIA 2LUOA 3A4TA 4JBGA 2QVGA 3BVPA 4PRYA 2D8MA 4URXR 3BX1A 4XWGA 1Z0FA 3WOHA 2GBPA 5IBCA 3LBFA 3WK4A 1JLRA 3NYIA 3OPQA 4ZQFA 1HVXA 3ONVA 3AONB 4ENRA 2WJZB 3OESA 4KUHA 4L6CA 1NFRA 2X5KO 4OHCA 3TD9A 1QHYA 4HDKB 3TWOA 4ZRMA 5J47A 1DBIA 3O8QA 4IXNA 4X0EA 2H2DA 1NQTA 4J0IA 2FGJA 5BYBA 9ABPA 5DTIA 3GRRA 4O33A 2AOUA 4YRMA 2PZJA 4MJ7A 1EIWA 3B3QA 5TGZA 1M1YA 4H7KA 3RVQA 3LDUA 4QA9A 1SELA 5JAOA 1PQWA 1LV7A 2NN3C 4B3SB 1E99A 2JHPA 5ARBA 2XB6A 3O3CA 4K9OA 3ANXA 3G9TA 2J3LA 3TCKA 4YBRA 1MP0A 3BFVA 2NV4A 1QQ5A 2ZT5A 2YVUA 3CF2A 1Z07A 2QD3A 3DZKA 3K9BA 4MVJH 4OLFA 3WKEA 4CR8A 2FN4A 1B14A 1NC1A 3F2IA 4JD5A 5IS2A 1U8UA 3TRIA 3SM9A 1H9AA 1EX6A 1A2BA 3JARA 4GSLA 2PT9A 3NUZA 3MD9A 1A8QA 4ZCSA 2V5VA 5JAMA 1X74A 3PE3A 2VNJA 2G0TA 5CLFA 3VYTB 4DLUA 3PV0A 3GGSA 4O4JB 2G70A 2ID8A 4I5FA 5IYZA 2C4VA 5K6AA 1DVRA 1OAOA 1VLYA 1A4XA 2V0CA 1ZLYA 2LR0A 1F3LA 2PL5A 3PKJA 5FHQA 3JD3A 1RI1A 1YS9A 1K0FA 2GN2A 2G82A 4GEGA 4UXJA 4QRIA 2IPNA 3WLQA 4OQMA 1YC2A 3E9MA 4LJSA 4AMZA 4DE5A 4Y7DA 5K0SA 5IM4F 2YJGA 2H63A 2Q6TA 3GDGA 4X1YB 4HDRB 2P78A 4MQFB 1XQYA 1ZUNB 1DB3A 3CUUA 3P9KA 3L41A 1SCNE 5I9BA 3A35A 3C3XA 3QKWA 2PT5A 1G21B 3LXXA 1BHSA 1GPKA 2W4IA 3ZWXA 2YHSA 3BICA 4XDGA 1OLUA 4K6GA 2VRWA 4ARZA 5FLXA 4LCBA 1Z7WA 3QXHA 2VDRB 5EXXA 2AR7A 5FT9A 4BC0A 1II8B 4QUDA 3E9RA 5LQNA 1MLDA 2RI1A 4G0XA 3MS2A 2XUGA 1X2EA 1T6ZA 1EP3B 3PC8C 1LVUA 7REQA 4YWHA 5WRFA 3UF0A 1T29A 2A9KA 2OESA 2NVOA 3WTBA 4QSHA 4AJHA 4Q6BA 3U13A 4LY3A 2DFLA 2KPOA 2CNOA 1YUBA 2WNHA 4D2IA 4EG0A 3T4EA 2HHJA 4D81A 1CWUA 2QVXX 5B12A 2OCBA 2HR1A 3LVFO 1Z4OA 2PVPA 3H0EA 4F04A 1RQ7A 2H1RA 1EFCA 4YAWA 4HZIA 1YR1A 2LIPA 1HF3A 3NTUA 3EW7A 1ABFA 5BP7A 5JT1A 1J1UA 5JXJA 4BBAA 2ONYA 2ZIUB 2QVBA 3PRKE 4JK3A 1KP3A 2TMYA 5IRCD 4WOPA 1B26A 3CKKA 4JMLA 1LPAB 1JDPA 1SA0A 5L46A 3F9RA 4HS9A 2Z3VA 2J6HA 3U19A 3NETA 3QUCA 4HYTA 1C14A 4GOOD 4R1NA 4R8RA 2AN1A 4UM7A 3TMAA 5A5EA 4PRKA 5ILOA 1KFKB 7ABPA 1KYTA 2J5QA 3EULA 4KEAA 3ABSB 3QVKA 2GJ9A 4BBPA 2XCUA 1VE9A 4PGOA 3CCSB 2PZLA 4YVFA 2B4RO 3D8RA 3EIUA 4Q4CA 2I1WA 3KJEA 2PU5A 1M2FA 3PHCA 5DV9A 1NI4B 3AUYA 3AF6A 4Y1GA 4DQUA 4K2HA 2AJ8A 2Q99A 2CFSA 2O0KA 4U9HS 1I6KA 5LZ8A 3CPXA 2IXDA 4RD4A 2IYOA 4MJ3A 3FJ1A 4LXYA 1LWOA 3KJIA 1YFLA 3AHHA 1BOFA 2C0QA 2WJWA 1KFJB 1QZXA 2GXQA 3BHIA 1XRQA 3O4GA 2GK7A 4HDNA 5AM4A 3T5GA 5K0TA 3FR7A 4YUYA 3NANA 5JU6A 4DR7B 2FRXA 3GLHA 4Y6LA 5HKKD 5HRCA 4R71A 4OB6A 1CT9A 1XQ1A 1QVZA 1PWHA 2Z5FA 1V8OA 1F5NA 1MORA 3EEIA 1BE6A 1MW9X 3QIAA 3BUSA 3EFHA 1E1MA 4UPDA 3M3DA 4YYZA 3TXXA 1Z0IA 4D6XA 2R44A 3GMSA 4D57A 4HEA6 4M1MA 1FYDA 2BEKA 5AHOA 3H0CA 2J9FA 3JYHA 1EINA 3K9CA 4NCJA 3PIIA 3RARA 4MPPA 3PB3A 4X20A 4X71A 3QEMA 1NJ2A 4W5HA 4XSHA 3X2SA 2C29D 5GP1A 3PPVA 3OG9A 1JTEA 1SUBA 3RIHA 5GOTA 4H60A 1R5NA 1APBA 3MJ4A 4Z4IA 4GW3A 2GHQA 4GZMA 1GHTA 1F0NA 3AETB 4P3OA 1JHPA 4R3NA 5HDBB 4G7XA 3BTVA 1A2KC 2I7CA 1KDRA 4LZJA 5AKLA 3REFA 5IABA 2W42A 4OBBA 5I7FA 3LP8A 3LRXA 1MEOA 4WZAB 1LW6E 4LE1A 1WVIA 3D7RA 4RS4A 4YONB 4V02A 1MB9A 3I9MA 4U7PB 3WBBA 1N2XA 4BNJA 1ZM4A 5ALDA 3S99A 4H08A 3CUKA 1VIDA 3SP1A 1VPTA 1P31A 2YYZA 4CF3A 4C22A 3KUXA 4HX2A 4CLHA 3EQ9A 3GXBA 1P29A 2CXTA 2R4UA 4AZ0A 1F0PA 1GCIA 2JRCA 3LUKA 3GVXA 2BR4A 3SX2A 1ZJYA 2VPZA 1BGWA 2EW2A 3WGIA 4TKVB 3TOCA 3IA7A 1OB0A 2AZDA 3EZ2A 5GADl 2W9XA 2OEPA 3GCXA 1GY8A 1JHUA 2HNBA 5EPEA 1BWRA 2WSSD 1AF4A 2C3MA 3W77A 5I9LA 2IU6A 2LCIA 2RGUA 3AUFA 1QHXA 3CTMA 4JEHA 1B93A 2VZLA 2WJJA 3G13A 4GECA 1DX9A 4DR3B 1VE3A 1RRKA 4GH5A 4I9GA 3I9LA 3PFKA 2LRHA 1Z5VA 2JFZA 3GLFA 3IIIA 5A04A 1QYXA 2OZEA 4PSUA 3V8PA 4DMCA 3KAPA 2X8BA 2XZTA 4Q3BA 5LOVF 1T8SA 3QF7A 5C51B 3NAMA 2KB0A 1BA2A 3AK4A 3A9RA 5AHRA 3EXIA 5FIUA 1ICEA 1E32A 4YB8A 5EIFA 2I34A 1G16A 2D0DA 3DTNA 4JLOA 5EIBD 1N5KA 5AO9A 3RS3A 3HB0A 3TEMA 3TDKA 4A26A 2WZNA 4D3DA 3ZV7A 3FRIA 3MUNA 4PNEA 2YV5A 2ILTA 4D41A 2I7XA 4EHAA 1O9HA 3O1JC 1GDDA 1W76A 1G8HA 2BEVA 5BVHB 4M7OA 1ZCJA 1UXJA 3P20A 4I19A 5TPWB 4OHVA 5KJ1A 4UHCA 3WBFA 4I3GA 5KTRA 4XNFA 3W1EA 3N2KB 1W2BB 1UAYA 1UPTA 4CKBA 5IK2D 3ZS9A 3AI1A 3MGAA 3RF6A 4N7RA 4BWVA 4GP9A 3W2HA 1NW7A 1TXGA 2WD7A 3IVRA 3PCRB 4IEIA 1TD9A 1DC6A 3PWSA 4ETNA 1VKNA 2G17A 2HTEA 2P9CA 4PIMA 1AMNA 5D00A 3Q1KA 4BX2A 4D3ZA 4X05A 3IPYA 2BFBB 1SD1A 1ODJA 2MIIA 2XD4A 4GEKA 3IQGX 4Q4HB 3RHTA 3BXZA 4D5EA 1Q14A 2N9UA 2BHLA 2Z8ZA 3Q8WA 1ZD2P 3WLKX 5AMXA 1SEVA 2NYAA 3M3PA 3NVMB 1ZGAA 3AFIA 3H5VA 5AUPB 3DAOA 1A5ZA 2WMOB 3DZJA 2Q5OA 1KKUA 1LDMA 3SQLA 2F3UA 4Q7MB 4P3PA 4QPZA 2EZTA 3OEWA 3GFPA 4KNVA 2EX1A 2VTEA 4NFHA 3G82C 1JL3A 4LMRA 3KQWA 4I9NA 2ZXIA 1AXGA 3I4LA 3KQOA 3G3EA 4EA6A 4RNCA 3HUUA 4IG4A 2I7VA 1FS4A 2B6HA 2FVGA 4EARA 3DO8A 5BSHA 5FORA 3EWSA 1R18A 2JJ1D 2YWEA 3AJ9A 4J0FA 1NNUA 4LYYA 4EHDA 4IVRA 3SLDA 1HLDA 1NC3A 3NC1C 4B3CA 1IY9A 1XVIA 2WAYA 3PENA 2X76A 4RKYA 4WOBA 3UMGA 5BWBA 1FE8A 3WLAA 5KINB 2FMIA 2HFKA 3I61A 1QF6A 1ENYA 3GLIB 3KD2A 5TNXA 2M5SA 3ZJUA 2VPXA 1HQCA 1UEJA 1OWLA 1I3NA 3QPDA 3SBDA 4B83A 4C6RA 1FDUA 3FNHA 2OV1A 2P9QA 5JTTA 3DGFC 3FPEA 5IP5A 4EA7A 3OJCA 3LLUA 3PRYA 2NYUA 1B6RA 4IDPA 1D4ZA 4LY9A 4K81B 4P7BA 4OJYA 2FDXA 2B8EA 2I29A 5F5LA 4CLRA 2OBTA 2WAMA 2ZZFA 1GSOA 3O1IC 4FXOA 5JZ9A 3GDFA 4HWPA 3B78A 1R7RA 1TKRA 1GUAA 5CT8A 2OAGA 4MV3A 4QJIA 4M89A 5AVXA 4U7DA 1VCHA 2E82A 1OU0A 2CNWD 2ZTVA 4GU5A 4JNCA 3VU8A 4K05A 5F4ZA 3MD0A 2HPZA 2ZTNA 4RVOA 1A04A 3PVCA 4Q9JA 5FUBA 3K4PA 5J4KA 3VZSA 1FP1D 1ZVJA 3OX1A 4MV8A 4O2LA 1N2EA 1H2EA 3SHFA 2SCUA 4KQGA 3VJKA 2JIDA 3AO0B 1Z8HA 4EY6A 2R3SA 1PF7E 4LRQA 4ITUA 1QTQA 3T56B 2OYNA 1DKUA 2Y2UA 4L95C 2VHXA 3G0OA 3OQPA 2XNJA 1YS4A 2HHHB 3LPCA 5F7OA 1HDEA 2BFFA 4U2CA 2WIJA 4BMYA 3P9IA 2XADA 1NBHA 4PYKA 1H42A 4UUMA 5CK4A 5TDHA 3ND8A 3CE9A 4DRXA 2Z6AA 3ROMA 2CMKA 1RHMA 2XA2A 3EZLA 4M8IA 2ZB7A 3EOBI 4ZYLA 4IPTA 5BMVF 3NTRA 1OI3A 3D59A 2ZROA 3NRBA 1PZMA 4PZLA 5EL0A 3D1JA 1BCSA 1L1QA 1LI7A 2V97A 1EGAA 1UCFA 2ZZEA 1O6ZA 4GR5A 4UC0A 3QFRA 2IV3A 5EN4A 5DI3B 4CEJA 1VE5A 1A7JA 4EPVA 2O5CA 1HEIA 2AK3A 2QLNA 4IRMA 1VBFA 4JP3A 4Y0VA 3RS2A 4ZV4A 2BM8A 5A4FS 3HTXA 4IP0A 3I1YA 3ETEA 4KIWA 2G8NA 3CX3A 3ICOA 2I99A 2AEEA 2XDYA 2CXNA 4FZ3A 4JYMA 4RF3A 3SN6A 1C4KA 5B3JC 5LMUB 1A4IA 4M36A 5IT4A 4HQNA 4H0CA 4RZXA 3BQJA 3PNKA 3CCBA 3ZU5A 4BVKA 3VO1A 3A9SA 3CJTA 2CWWA 2QRNA 1KPIA 2EJUA 3R0VA 3PWZA 4NK5A 3GNSA 1RKUA 1Z37A 1U5AA 2O0LA 3NAGA 4GL4A 4J0JA 4RZSA 3WB9A 4RMIA 4F3NA 1ZM2A 4PFSA 3BWBA 4RL4A 1ZUHA 4RAOA 3BS4A 3W5AA 3B1YA 4OATA 3SF0A 1WXFA 4EPXA 3OQ1A 4J2OA 1Y1TA 2V3VA 3ESAA 2VUIB 1RFLA 2II6A 4G9GA 4URHA 3GLQA 5B4UA 1E2KA 4MB6A 1KE2A 5HJ7A 1P4JA 1ZOLA 1ISJA 5ESWA 4UBOA 3UWPA 4EY4A 4DCGA 4NABA 3VXKA 1JEJA 4L9AA 4L0QA 2RH9B 2Z8XA 1AUXA 4BU1A 1WTAA 1AB5A 1EG2A 1ZGZA 1WSBA 4J4HA 2RGRA 3H87A 1C2TA 5EE0A 3OM9A 1SHKA 3H9GA 1KKLA 3MTGA 3R4CA 4LXUA 3TNDA 5CP8A 1SUWA 1HV8A 1QIIA 2C2KA 2BEJA 1BS9A 4B2IA 2P5TB 3VSAA 1TF7A 1UDBA 3G71B 4HP8A 5FTKA 1JLLA 3KKKA 5E9JA 3F5DA 5B7PA 3P9XA 2AQIA 3H1AA 3I5UA 4AY2A 1P2SA 1ONSA 4YR9A 5LZ5A 3UJNA 1KVTA 1D03A 1FTNA 4AMUA 4QDZA 3ONUA 3K9GA 3K0FA 4YJHA 4UASA 1QE0A 4R8LA 3U62A 4JBIA 4KE7A 4AS2A 4BV2A 4ZK6A 3REQA 1E6WA 3D2BA 5GZ1A 2PUEA 3LUPA 1TMYA 3QLUA 5LQRA 2X0RA 4HVTA 5CW1A 3ZWYA 4WDQA 4II7A 1M34A 4MRVA 1RCFA 3GJ6A 4HNHA 1NQAO 3V4OA 1YL5A 2P1RA 1EDOA 3LXUX 4EWLA 7YASA 4YHBA 4X6YA 4BLQA 4TV8F 4B09A 2JGFA 1KJZA 4N4AA 3G9QA 4ZDJA 4P8RA 4EH1A 1YZLA 1HQDA 5GPBA 4A5OA 3O8CA 1E2LA 2YMMA 1VECA 2GARA 4EDHA 3WQHA 4BECA 1HH4A 3IOEA 5LNK1 5TY0A 3W7VA 4KREA 4ZQBA 3U60B 2FYTA 1TYEB 2OGZA 1RKBA 1NVEA 5HZAA 3GBVA 3LW7A 3LFTA 4YCSA 2R1TB 1UBMS 1KERA 3E0QA 1CR4A 3MRSA 4K5QA 3UYLA 4ZEVA 1H0SA 4MV1A 1NZFA 1Z4MA 2A1IA 3BSFA 1P0QA 3KVRA 5F4BA 3FMOB 3I39X 1PWZA 3O2NA 1NKVA 1CIPA 4M0MA 3OLXA 3ZWDA 1U65A 4CLDA 5DX0A 1CQWA 3AFMA 2JIRA 3HMKA 3P45A 3YASA 2ATCA 4LF4B 1W88B 1Z74A 3BE5A 1WHSB 2JB9A 3IAEA 3A4YA 3VUFA 2F4NA 3RG8A 4AURA 4QU9A 5KYUB 2AIRA 2FWJA 1H6DA 2DY1A 1IBKB 3UKOA 1C7QA 1AGXA 2KWIA 2X8WA 3IIEA 2CJXA 4KIGA 4MVJP 1U3TA 1Q82D 4EUFA 5JH7F 1Q44A 1AXRA 1WVGA 2ICAA 1U1EA 1L8LA 2ASEA 2G5CA 2JKYA 2PZAA 1I5RA 3K2IA 3LVQE 2QT1A 2ZCVA 1XEAA 3PQFA 1BVUA 1DIRA 1MO4A 2FFAA 3WWPA 4JQOA 2VNHA 3AR7A 3HACA 4U7HA 3S3TA 1VG1A 4Q21A 1J42A 2JIZA 1EFVA 2RDMA 1GN9A 2H1IA 1NMQA 3O1HB 5THKA 2ZYRA 4E31A 2C3YA 1Z34A 2P6PA 4FYHA 2FEPA 3C1TA 3PXEA 1N3YA 1ZIDA 4I99A 2A3NA 3GVHA 4M6WA 4M1OA 2CXQA 3WICA 5C1OA 2FLWA 1GAXA 1GZVA 1HFWA 1HKUA 4F21A 5LWHA 3REOA 2QZJA 3HB7A 4F8YA 5E1OA 2UUCB 2FUG6 3GLHE 4ZHQB 1VL6A 1W8DA 2RH8A 3OU7A 4XJXA 3UT5A 3PNBA 1H1TA 2EKBA 3BIWA 4Y9UA 3ACBA 3R9KA 2P62A 4OPSA 1MB3A 1L5KA 3SIRA 1YK1A 1RI4A 2AHRA 2X7HA 4C7XA 1QLWA 3K1TA 3PC4A 4GMKA 1MIOB 3IELA 5LA6B 1JAIA 2X3FA 5AKHA 1VMKA 3E81A 1JNXX 4IMPA 1JDSA 3LBAA 4BJ3A 5JEDA 3QSGA 4BQSA 3PXBA 4DIFA 1YRBA 2Q4BA 1DOAA 1JXQA 1YRLA 3L1IA 3LKZA 4Q1BA 4Q93A 3N2YA 3I01M 1B0AA 2X6WA 4CTMA 2ZUEA 3RSZA 3TL2A 2UAGA 2QAGC 4O25A 3KQHA 3LHIA 4UVHA 3QMWA 5AUQA 4YAOA 3RC7A 3DG9A 4L2IA 2QPLA 3F8TA 3PEYA 1YBAA 3ET4A 2O2IA 1NBOA 1IEQA 1E4EA 4AL4A 3TBHA 5H7XA 3DOJA 2D5AA 1G7CA 3ONNA 4Q03A 5DSZA 3KOXA 5FX2A 5H81A 2DFKB 1TZCA 3H9BA 5C2JB 1JJAA 1DIGA 1ZC3A 3ES9A 3TLAA 2M1XA 2ZBPA 3V1YA 3WHIA 1E1DA 4HQ0A 3ZHUA 1QZTA 4MV0A 5MFZA 3U4AA 4XLZA 4ZKDA 1MNAA 3QMVA 4UZUA 3RWMB 3KJHA 3WWDA 1QVAA 3DUFA 4L72A 3NKLA 1TU4A 3T38A 1A71A 2YNMA 4P4LA 3VV2A 3RS8A 4ZN6A 1J23A 2F7SA 3A3NA 5HQ3B 5CVDA 1ESMA 2W7TA 2F1LA 4MP6A 2UU9B 2IY7A 1FF9A 2B0CA 2ZYDA 3FYHA 3MWFA 4GLJA 3GPIA 5DHUA 2J0EA 3H11A 4R6XA 4RHEA 3B12A 4CKXA 1W5EA 4JVSB 4YRSA 3BHNA 2PVCA 5MGBA 2TMGA 3EARA 3TQOA 2XRYA 3HUFA 1EVYA 4RIFA 5IZCA 4UQOA 2ROQA 3WNVA 4DYHA 4FMDF 2X6XA 3ZGXA 2QRPA 4P80A 3DLHA 1WF6A 3QKUA 5TE9A 1DP4A 3EGIA 4ZARA 2FHPA 2N1MA 1N5RA 2D0OB 3P0JA 3SYKA 3LMKA 2AWOA 3NM5A 3X1YA 1M2VB 4ZVRA 4D8VA 5J2TB 2YV1A 3T1VA 4P08A 3KYBA 3OE7A 2RHOA 3STYA 10MHA 3R9WA 2VWQA 3GAMA 3R6DA 3QXJA 2B92A 4LYDA 3UENA 1M8FA 4KYTA 3O73A 1UBSB 4RJKA 3TZQA 4CCYB 1C9DB 2LXNA 4RTSA 1PEAA 1PLKA 5BVHA 2V58A 1O5IA 4CMCA 2Z9CA 3K1ZA 4D0LB 2B99A 3BFJA 4EMBA 2P9FA 3RYCB 1CVLA 3FUVA 3GJ3A 3TK1A 3N2KA 3SZGA 2ACWA 2HA0A 5B1YA 1JT9A 5KOIA 4IMJB 4M8SA 1Y7TA 3CM0A 4WLEA 3ZY2A 3HPRA 5AFSA 4XH9B 1MC5A 3CVXA 5AOVA 3TVDA 5PNTA 4RTMA 1J0DA 3VOAA 1YB6A 2H0QA 2X2FA 2VN8A 3TCNA 1JDTA 1F9EA 2Q1TA 5TF0A 4BN4A 2DWUA 1I3MA 4QBIA 1HE3A 2Q5QA 5JJ5A 5KNBA 1FQWA 2B4TO 3IP1A 4MUXA 1A98A 3L82B 2OPBA 4GSKA 4JENA 1Q84A 4JT8A 4MVJF 5IASA 4M98A 3JPWA 5C7OO 3G0GA 1UMDA 3PUHA 1I2MA 1YBMA 4RHYA 5KW9A 4JQSA 2PZBA 1G5FA 2VRBA 5EERA 3I01A 1HEYA 3SDSA 4JI0B 3D4LA 2JLYA 4DIOA 1P1JA 3BL6A 3M6FA 3ZV4A 4PIVA 3E58A 3K30A 5F51A 4RBNA 3SIPA 4BNWA 1OHHA 1BQ4A 4AJOA 2FQXA 5TS3A 3RLIA 3ZQJA 3WGHA 2CFIA 1U5CA 3BG5A 2XWBF 3BMNA 1F6WA 1N6LA 4FZVA 4BYMA 1CRPA 3LQ1A 1CD5A 3WK7A 3FXAA 4WTOA 4KVFA 5TV2A 5IWCA 1RKXA 1EXWA 2O0JA 4OEHA 4WX2B 3VYRB 5M04A 3AY3A 2ZATA 2PBZA 5DWVA 4CL3A 3E2IA 4BNDA 2E49A 1AUPA 1EWTA 4ECEA 2P1ZA 2P2SA 4HJRA 2PIAA 4HN2A 4B44A 3HJNA 3LECA 3LDAA 4Z7NB 5LDDC 3ENVA 4GXNA 2K7FA 1TC1A 3UAVA 3DOUA 4XSVA 1Q17A 1WMDA 1IN7A 1D2CA 4K2AA 1CU1A 4HB0A 1UFQA 4HK4A 5C3UA 2PDAA 1EUCB 4HAOA 1OZ0A 1QC5A 1R74A 4FHZA 4CZ2A 1KBQA 3MLAA 3CKMA 2I4OA 5DI9A 5C32A 5LUAA 1SBZA 4ARBA 2PV0A 6REQB 2W93A 4NC9A 4FMCF 4OM8A 1A5BB 3K0HA 4G24A 1DG1G 2JASA 4YJFB 5JOQA 5LD2B 3VX3A 3SZRA 3JVIA 4C7KA 5K2OA 1RJEA 2IIPA 1LEHA 2ZW9A 2FUCA 4NWIA 1B23P 3ZVKA 4RZQA 3JQ7B 3H94A 1JHOA 3COVA 3SK0A 5B58C 5I47A 3JU4A 4JHLA 1W6RA 2XHZA 3KOZA 1FPMA 4NZYA 4Q18A 1YUMA 3G05A 5CIQA 5F1KA 3DPIA 2B8WA 3A05A 1BS1A 3NAQA 3TLYA 2BRUA 3F1KA 3PLRA 1M0SA 2XH8A 3EQ7A 3IBTA 5K8VA 2J3EA 4H9GA 1P9LA 4GX2A 5EIHA 4Q4AA 5REQA 4DGQA 2QJRA 1SVWA 2I6SA 3PGXA 3HCOA 1NPTO 3DUWA 1N5MA 2ERCA 2NUTA 3P7MA 2ZT8A 1K5GA 2CL6X 2R65A 4GPEA 2XVXA 3QVXA 2CUZA 2E89A 1ZJ6A 4JGIA 1G5RA 2DWCA 4FCWA 3DKPA 3AFGA 1Z6TA 1RPJA 1BXGA 1SHZA 2X58A 4H35A 4W99A 1KZYC 4TYYA 4OQFA 4EO9A 2X6RA 1G2QA 2YQZA 3OTWA 3Q9UA 2WWHA 1QWOA 3JQGB 1CZOA 4TM7A 2H00A 4UNSA 1XMPA 4O4HB 5CIWA 4YAJA 4U7TB 5DYIA 4E2ZA 3DLTA 4HDCA 3ZLVA 3N2GA 1UEXC 5BN3A 3GIDA 1XTBA 1I8DA 3ACDA 4BO2A 3AR2A 1NPDA 4F2DA 2N47A 3OO1A 4EZIA 2MINA 2HN9A 1HQYE 3RRYA 4D0SA 4IW3B 4RSRA 2JBAA 5JASA 5JNRA 4CM1A 2B7BA 5TRDA 1WLYA 5B2FA 4F6RA 1U0OC 8LDHA 2YH2A 2IH4A 3KXPA 3MWGA 2NNLD 5CDHA 1JI3A 2C0CA 4ADSG 3LCVB 3P5BA 4LF8B 1Y5MA 1AKEA 2PEYA 5I7RA 2O2YA 3IVCA 2OFOA 3GFVA 2ZPUA 4J49A 3U9TA 3WS7A 2J3JA 2GS9A 2XUPA 3DBLB 1O9BA 3OZRA 2J5KA 4ZICA 1O4WA 3R6LA 3NKFA 3R9IA 1YA4A 3PQ4A 2QU7A 4TKOB 3NAZA 1GZ6A 4DQLA 3QKIA 2ZRHA 4LOKA 5EIXA 1DAOA 4M4SA 1IAQA 3JAKA 4WZBA 1EVZA 2R6AA 1BMQA 4ZOAA 4B2LA 1L4YA 3MRVA 2YY7A 5SYNA 5TXGA 1O6GA 1NURA 4FYIA 5FR1A 5FPPA 1LS6A 1G38A 1HLGA 3D4PA 1UAAA 3TCXB 1T5OA 1LF0A 1DIAA 2C5EA 2QRUA 4H16A 5TMEA 1OBFO 2FUEA 5G3ZA 3SDBA 1BW9B 4S1PA 4HDMB 3KAQA 4G4IA 4UNQA 1G8GA 1W6UA 4LXGA 4OA5A 1LLFA 4Q19A 1S02A 2FWAA 4E07A 2DU8A 1VQPB 3M6IA 4M54A 2OK8A 2M32A 2P75A 4EKDA 2Q5IA 4KC0A 2V65A 3OJ0A 3UK7A 5K3OA 3KQLA 2ZG6A 1KE1A 4CIBA 1W0KD 1IHXA 4G5QA 3UMVA 4YQYA 1Q7RA 4XQEA 1MDFA 1SQ5A 3WVNA 3DB1A 1IN6A 1UAGA 2NAFA 2ZYIA 3C1UA 4P7KA 5EHIA 2XV1A 2W6JD 5FAXA 4U3JA 5BV7A 3HCAA 4G37A 4ERXA 1DU4A 2M1ZA 3GJ5A 1JKJB 1RJDA 4XQFA 1GCGA 3FJOA 1V0FA 1MMFB 3U17A 3N87A 4UEWA 5IULC 1YWGO 1ZGBA 3L5KA 4IRUB 3OICA 3UW1A 3DKRA 1JALA 3K5WA 4EY8A 3E9YA 1CP3A 3KDPA 3NWOA 4MS1B 4MVJD 5GGXA 3BQMB 5E8JA 1N6OA 1UOPA 3MPUA 1TZ2A 1D2AA 2O0HA 2B78A 3V7NA 1QGYA 1PLLA 1ZWKA 5HBRA 1NDUA 2ORED 2GAAA 3FCOA 2A9OA 3AYXB 3HVJA 1XQBA 4MUMA 2XITA 3FDZA 3H8SA 1FU4A 2HSEA 4W1SA 3TSWA 4P53A 5HKKA 2GHRA 3PFHA 3C1AA 3GRFA 4M9QA 3HGTA 1PCXA 5BSVA 3JQRA 1ST3A 2YWGA 1NJ8A 2IKSA 2Z5VA 3B5JA 3GCDA 3VYUB 5B4TA 3FNEA 3GRZA 3WAGA 3LRTA 1Y9ZA 4L0CA 4I2NA 3KJFA 3Q11A 2IFTA 4HVLA 1AS3A 4MVJI 2W2PA 2NU9B 3OAAD 4CU2A 4A92A 1WHSA 2HLPA 1DWQA 1Z28A 5H83A 1ZK3A 4PHGA 3PFCA 4RGBA 1U63A 4DGSA 1PUIA 4B87A 5F35A 3KFXA 1YJWB 1NRJB 4D9BA 2WFLB 5BSUA 5IT9A 2UXDB 1MAAA 1XWIA 3DOIA 2G0NA 3MT0A 4GOXA 5FWNA 5JNLA 3W5HA 1J56A 4M9RA 1K97A 3LPDA 1KIFA 1LPSA 4KJXA 3STVA 1KBZA 5EIEA 1JFFB 3UYKA 1UBEA 4L5CA 2JGDA 5CX4A 3VZCA 4XASA 3JZDA 3DW3X 3MS4A 5BWMA 1J5XA 1IHUA 1E3XA 2EAUA 1R6DA 3NTXA 1C7EA 1J9EA 4P4TA 3EGWA 1UD4A 2JFYA 1C3JA 2P27A 2HJSA 3B5EA 5EWLB 2EEPA 5FNVB 1EK1A 2R8EA 4K0RA 3UFBA 4C07A 4EGCB 1WQ1R 4IV0A 5CLJA 3B3FA 1D9XA 2HK7A 3G23A 3K4HA 4M99A 4ZHQA 6Q21A 1SMKA 4JROA 2A5JA 5KYGA 4C9BA 3N75A 4DJEC 3TEFA 2ACVA 4H4DA 1Q2XA 5HIMA 2NO7A 2COEA 4RC9A 1DKRA 3EY4A 2DFVA 3HFRA 1N5LA 4MZDA 5CX1B 1CUSA 1D2EA 2HB6A 2WSSA 2WKRA 3A2LA 5J59A 3TNJA 1VGQA 1JRLA 3L4SO 1NHGA 1SVUA 1IOLA 2OBBA 3TR6A 1WMEA 4UDOA 3ZDYB 1VDZA 2IOQA 2AC7A 5B1DA 1XO1A 4KOEC 2H3HA 1J70A 5E9AA 5K3FB 4N3NA 3P1JA 3QMPA 4ZMRA 2VP4A 5DM70 2ZJ7A 4OGLA 4E7PA 5SICE 4WFJA 4Z4SA 3L2OB 4NBUA 1UC4B 2BI7A 2FEAA 2HJGA 2XUDA 1FDVA 2ZAGA 3DPUA 2ATVA 1W93A 1JTVA 3KQMA 1M0EA 1GTL1 2Q4EA 4V39A 4GWGA 3T4XA 1GYQA 1JPUA 4PV7A 2JI8A 2JHCA 5IM4A 3CWCA 4YEJA 2CLMB 2O8VA 3EY9A 3K1JA 3WQBA 4BLVA 5AVUA 2OXFA 1H2RS 2WYUA 4BPRA 3N0TA 4JELA 1RHJA 1OASA 3R7WB 4DJJA 1ZD3A 4I4TB 4NYJR 4AG3A 1QP0A 3MERA 5LMZA 3C6XA 4R1UA 3ETLA 4N9WA 4WCFC 1QAOA 1Z8FA 4PVDA 2VSNA 1UANA 3PZBA 4QVKA 3W5VA 1KHHA 1QHHA 221PA 1R1DA 3G5AA 1RKVA 1ZGGA 2C5BA 1B8PA 1NIJA 5LBIA 3K0AB 4MUYA 2PV7A 4DNXA 5I7WA 4OP7A 5HE9A 1SU8A 5IK2A 5IUNC 3R0QA 5K0JA 2BSAA 3V2IA 4R51A 5GVSA 1XL0A 3ER8A 4OAQA 1L7VC 2E6UX 3HB5X 4GAEA 3A25A 1SUSA 2PMDA 1AQIA 1JR2A 1JVBA 5KVAA 3IULA 4JX8A 3ZGNA 1OTXA 5CAEA 3TNFA 4Q39A 2IOHA 1R10A 1RAAA 4CUKA 5M2QA 5A6SA 4GKJB 1IAVA 4KK4A 5T41A 3ZPNA 1JLKA 4IHJB 1OI4A 1CJTC 4EG1A 2WUGA 3C5VA 1NXVA 1U9JA 3SG0A 3TAXA 4ZVUA 2PRIA 2KW5A 3KPJA 3OC0A 1GGVA 1M2OA 4YJKA 2NP6A 4AJLA 2DQZA 2FHSA 1HYGA 4H31A 2WEKA 1JBQA 4NBVA 3ETDA 4PLFA 1N06A 2BONA 3V1NA 5CFQA 3ZCXA 1AB6A 2FPMA 3PBKA 2VP6A 2N0SA 3ELDA 4KN6A 4XXHA 4ZZ2A 2WKPA 2JJ1A 1HNZB 3R9XB 1ZESA 2QZZA 4R01A 2KLHA 5B58T 2C9YA 2UYQA 5JWOA 3I2GA 2PHZA 3SEFA 2H3EA 1ZNYA 1DCKA 4OJKA 4PBSA 4G6IA 2F2TA 1JNYA 3GHYA 1VHQA 5EUCA 4CMKA 4G4GA 2KYRA 3W6NA 4EDFA 1YRQA 5DVZA 4KE6A 3TOZA 1ORTA 1RQNA 1KZ9A 3FYUB 3ZJTA 4HNTA 4EJ6A 2M6SA 5LQJA 1N33B 2Q5LA 2WWFA 1FTQA 3VI4B 2PZGA 1FLAA 1CUUA 1DAGA 1TB4A 1E5DA 4L4ZA 2E4UA 5FPKA 4RDKA 3ZV6A 3DCIA 2YUIA 3CUSA 1WXQA 2D1RA 2I8CA 1SXJD 4JI2B 1OAKA 2H59A 2A86A 2CNWA 2XB8A 2DPXA 1AO0A 1CEQA 3SLRA 4RIHA 2WPDD 1CW2B 3INTA 4JP2A 3CX4A 3IYLW 1I1QB 1KZ4A 5F4OA 1XFAA 4I46A 4EW1A 5J4VA 1U7DA 4UNRA 3JRNA 4CLEA 1IB6A 3P71T 3B36A 1DAHA 2I55A 3QE0A 4AQ7A 2NU7B 3F7MA 4JSYA 4DF3A 3LA6A 3A1CA 4D3FA 4F5YA 4EA9A 4EHLA 4BIMA 4NAVA 1DAIA 5C35A 1G7RA 4FFOA 4I14A 2QHXA 2VA8A 4NU8X 4JSTA 1VB5A 2Z4TA 2GH1A 5JSYA 4X7FA 4WNIA 4UUOA 3UMFA 1KNXA 1I2BA 1QQ6A 4G85A 2QAIA 5EKSA 4DTCA 1P0PA 1AN0A 1QYCA 5AJVB 4YCLA 2JLUA 1Z29A 1WZCA 5G4KB 2WU8A 3OE5A 1HYEA 2QUZA 1ODFA 1V1RB 4V0QA 4BLPA 3E20A 2DPHA 1TQDA 1D2GA 4A3SA 1N6NA 1HA3A 4OFXA 1GZDA 2ID9A 1KZGB 3ORHA 3D6NB 1M7BA 2QVZX 4JUBA 4ZAGA 5L4SA 3QX3A 4P0PB 2PYZA 2G3YA 1PEDA 4IGKA 4NYMR 5EZ5A 3UNXA 5BN4A 2VOJA 5DN9A 1VOTA 2I2BA 5TPZD 3UT0A 5CGZA 5C5CA 5FD8A 5KAMA 4BKMA 5PGMA 4X1KB 4TV9B 5L9AA 3PCXA 2NXJA 4YUAA 2XX3A 1X7DA 4TX1A 1NAIA 1PT9A 1YZTA 3ZLUA 1N7JA 2RGGA 3AI2A 1T9GR 3VTFA 5AW7A 2IEIA 4RZ2A 3V7WA 2JFFA 2BOVA 3CLSC 2R68A 4YP0A 5C8VA 3L43A 3LVBA 3DM5A 4LF9B 5A7FA 5HK9A 4RLFA 1CUIA 3E1GA 1LV8A 4YGYA 1M66A 3NV7A 3PI7A 2P0YA 3K1YA 4OLJA 3K71B 3VPXA 2P8SA 3OMWA 4M0FA 4ZOLB 3ZWAA 2O05A 3B85A 3WJAA 2W37A 2X13A 1E77A 4FFDA 3G5TA 3G6EB 2VKTA 4HLCA 3I05A 4YFYA 4XRGA 2C5SA 2IX3A 2O8FA 3MQFA 2CLLB 1LRKA 1L5QA 3AU9A 3OURA 1FP7A 2VBVA 3M1AA 4O4LF 3ZDXB 3ZY5A 1EQUA 1L5YA 5H80A 1FS5A 1I4LD 2AJCA 3EZ6A 2QLTA 2XUFA 2B61A 3LT5A 4L57A 1DJOA 1O97D 3RVKA 5BSXA 3ETNA 1FEZA 2YZ2A 5D7NA 2Z3ZA 5ITZB 3I76A 3HDQA 3OBBA 4E7OA 2GPAA 4N6GA 5ICGA 3AKZA 1UK7A 2ECKA 4CR7A 3KEQA 4H6XA 3B6IA 4WA7A 4FOSA 4MCJA 4QRDA 4RNDB 1EFPA 3MMNA 5AOAA 3SKXA 2R0QC 2Q8QA 1K66A 3DE1X 2WJYA 3C6KA 4OHRA 1G6OA 3FDJA 4AJIA 1H69A 2FPKA 3PTLA 5A1TA 3VC7A 5T8KC 4KMSA 1KFCB 1HZZC 4J2HA 5BSTA 4PGFA 1C3OA 1P8AA 1KY4A 3BMOB 1SC1A 2V03A 4HZUA 4CGYA 5ABPA 3GOHA 4BFLA 1JIUA 1QH8B 2WFAA 1LUAA 2OOSA 4FMBB 2ATXA 2D3WA 3JATB 1JDNA 4NFYA 3UY4A 2GZ1A 5AW1A 1TMKA 4IH9A 2ECFA 3X1KA 4CKEB 1EB8A 2IYEA 1K7YA 2MHCA 3S5UA 4WY8A 2OSBA 3SBEA 4B74A 1DTSA 5FI1B 3KT8A 2VP2A 2P4EA 1ZIXA 1A4RA 2WHPA 4I8DA 2B9VA 4WZBE 2VRCD 3K70C 4DLWA 1PR6A 4MAAA 4BX9A 2YJ5A 1E92A 2QLLA 1M6VA 1YB7A 3PUKA 1FJ2A 1Q1AA 4BQQA 4J29A 1I7NA 2AC4A 5I4BA 4JV5B 1A9YA 3F3SA 2Q6OA 3FSRA 1VFNA 1KYYA 4LZOA 4C0LA 5HKAA 4HX5A 3C16C 3C97A 3DDHA 3PDIA 5FTNA 4G0NA 3UAOA 3WSTA 5BW4A 1SG0A 3ZTWA 5A0TA 1Y1LA 4BU0A 1TLFA 1EGQA 3EXFB 4YRDA 1SBHA 1IN4A 1FX0B 1TJYA 3VVLA 3A6JA 4LBVA 2B69A 3RS5A 3IEMA 2V0GA 2C5LA 4I4IA 4KPYA 4K9SA 2FSVA 5D1HA 3OPOA 5FBQB 3BMCB 4RVGA 3KYCA 1XZKA 1TTPB 2XT0A 2GF2A 3DJYA 4BFXA 2RC5A 4IJWA 5L53A 3A8JA 3NRJA 4HAZA 1AMUA 4WJZA 4V38A 2FPUA 3EVZA 4C5AA 3EBLA 2H4XA 4M1TA 5JY6A 4YRLA 1SOWA 3A1EA 1AO3A 2DUMA 1H65A 1T2FA 2Q07A 3CNBA 4BKQA 4ZYVA 4JLJA 4OQNA 1J0BA 1E6MA 2IVFA 3Q38A 4JU8A 2FSGA 6CHYA 2XZLA 1IZZA 3FB1A 4MS1A 4OPVA 2XMSA 3ZXUB 4C4TA 1NB0A 1XXHA 5EP3A 1ITZA 1JVNA 1RJGA 4WKBA 2ISQA 3GGOA 4LF7B 1T0BA 1W52X 2JLQA 3MN1A 2HU2A 3BQ9A 4GPBA 3CVWA 2AOXA 2CVOA 2P3QA 3CC8A 4JUFA 3S40A 4A8JB 4M8NE 1KZHA 3DFKA 3SLGA 3D3WA 5IZ4A 3KXDA 4Z0HO 2BFCB 4PAAA 4EITA 5KTMA 3LK6A 3MCWA 4P2GA 1QYVA 2EJBA 3GT7A 4O2AB 1W5BA 4P5PA 3DXYA 1LRLA 1YCGA 1WMSA 1E64A 3OE1A 2ZRKA 1HPLA 3HEAA 4BYGA 3D3EA 3HYSA 2WJVA 1PD1A 5LYJB 4G8JA 2CMFA 1ZZGA 3PKZA 3CEHA 4L8WB 3MOSA 5IFKA 5DNYB 2D1YA 4QOHA 5KTOA 4YCNA 1UKEA 1WXIA 3BZBA 4TLMB 5GAJA 3QNMA 5BMVA 1Y7LA 2E0IA 4ID9A 5CT4A 4DMFA 4CMJA 1UWVA 3ZE2B 3DXFA 3IP6A 2VTBB 2BZSA 5FRDA 5AW2A 4R41A 4GOLD 4TXLA 1J97A 1JT2A 1LCIA 2YCBA 1T3SA 3GUZA 1ZJJA 2VT3A 1L3IA 4KO8A 2QGFA 1EH5A 4ZCTA 1OXSC 5BSMA 1DTWB 2Z98A 1SUFA 3ZE6A 3UT6A 2QBYA 1GPNA 3FZYA 4AN4A 5CBPB 1A27A 1DWUA 2ZE7A 2DSTA 2WW8A 2WAXA 1GAQA 2Q7DA 2VHWA 1PWEA 2ZR8A 1IHPA 2NVUB 4QFBA 1K5PA 5ITSA 1PGQA 1RC8A 1SUDA 2IDJA 3JX9A 2XODA 2GEUA 3IUEA 3WSWA 5LR6A 1A1SA 1FP4B 4GOMD 1MXFA 3ROPA 2YFQA 1T36B 4QOJA 4W5NA 1CZUA 2Q9AA 1V9SA 3FSGD 4WI1A 5ALKA 1YJQA 5G2OA 4ZCPA 3UGTA 1M2JA 3UKJA 4KR2A 1U31A 1SZCA 2HA3A 2O7RA 4W9NC 4XDYA 5ALQA 2DSNA 4TSRA 5JUWA 4JXJA 3IURA 4NLLA 5JQGB 4RDXA 4O4IB 3NHKA 4D4HA 4JP1A 5I7OA 3LGAA 1FDRA 5EFOA 4D9GA 3RAGA 1T8PA 3FVQA 2R60A 4Q1VA 1E7RA 3BBPA 3DQQA 4Q9HA 3KT3A 4M3NA 3L0BA 3PNOA 4YRPA