2BMWA

Ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bmwA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bmwA02
4N3GA 1SKQA 2QTZA 3ZZ0A 3CRZA 2VYQA 2YWFA 2B5OA 3WBKA 1EP3B 3LO8A 4RCYA 1QH0A 1KK1A 4AF7A 3U6KA 3QFTA 2VNHA 1JNYA 1NJID 1KK3A 3I55B 4FWTA 1QUEA 1QFYA 1J9ZA 2XEXA 2YWGA 3FPKA 4LC0A 3G4SB 1BJKA 4PC3A 4ACAA 1KJZA 4BPRA 2QA4B 1D2EA 1NDHA 2CNDA 4M2LA 4PC6A 1EFUA 3AVVA 1OB5A 2CRVA 1TTTA 3CCLB 1N0UA 1I7PA 1WDTA 1U2RA 3VO2A 3WNDA 2PLFA 1QGYA 4RD2A 1M90D 3JQRA 4WQMA 4TMXA 4ACBA 4QFMA 1EWYA 3QFRA 2D74A 3WNBA 4B44A 4ZCMA 1VQLB 2AHOA 1JJ2B 3W2HA 5H59A 2C78A 1DDGA 2QEXB 4YAWA 4PC7A 2DEUA 2FX3A 3AGPA 2OK8A 1M1KD 1YI2B 1ZUNB 1QUFA 1G7RA 1VQ5B 2HMAA 4G1BA 1JA1A 1ZM3A 3CC2B 4P6VF 4Q7JB 1GR1A 2RC6A 1S72B 1R5NA 1QG0A 4RD6A 3G71B 1VQ8B 3OJWA 4RD1A 4RCZA 3ZC3A 3LRXA 4RD3A 1IB0A 3ES9A 1W34A 1K73D 1KQSB 3WYAA 3MHPA 4YAOA 1FDRA 3B82A 4ZGNB 2OK7A 2BGIA 2BMWA 1QX4A 4LBYA 2J7KA 3QE2A 2QDXA 3ZBUA 5DSZA 2BSAA 2ZITA 1ZM9A 4YAFA 1CQXA 3P26A 2VNIA 2BM1A 4N3NA 1ZM4A 3W2EA 4LBVA 5AN9A 1AIPA 4C0SA 4ZV4A 3CPWB 2BVNA 2PIAA 1W87A 3CCJB 4B48A 4B43A 1EFTA 1K9MD 3OW2B 1VQ4B 1BX0A 4RD0A 4J0QA 1XB2A 1YITB 2BGJA 1VQ6B 4RJLA 3LVBA 1JB9A 4AF6A 1G7SA 2NPFA 1VQOB 2R6HA 2EFGA 1Q7YD 1W35A 3CC7B 4ZGQB 3AVUA 1OGJA 4M1KA 1VQ9B 4FN5A 2B7BA 4TN1A 3QFCA 3JQQA 3CCEB 3WY9A 2YWEA 4DQLA 1VQKB 1VQNB 1OB2A 3AVYA 3OZVA 4F7DA 1JA0A 2VNKA 2VZLA 2C77A 1TUIA 4TMVA 3VNUA 3CXCB 2DY1A 3E20A 3AVWA 3W2GA 3U6BA 1EP1B 3U2QA 4C43A 1FNBA 4M53A 1FNDA 1R5BA 4HE5A 3OJXA 1YJWB 3CB4A 1CNEA 4YHBA 4HE6A 4ZCIA 3AVTA 3JQPA 4B3XA 4Y9UA 1H85A 1N0VC 4K1XA 4YAUA 1BQEA 3CC4B 1KK0A 3MCAA 1KTVA 2DERA 2DCUA 1QVGB 2YWHA 3CCUB 4TMTA 1BX1A 2BM0A 3CD6B 3CCVB 2GQFA 4FK8A 5TY0A 3CW2A 1F60A 1IJFA 1VQMB 3I1FA 1DG1G 4M0LA 1VQ7B 2QN6A 2OTJB 1G7CA 1B23P 2XNCA 1F20A 3WNCA 3P27A 3OZWA 2EIXA 1D8TA 4B47A 1AMOA 5HXBA 1OGIA 4NBSA 3QSYA 1HA3A 1QVFB 3ZBTA 1EXMA 1GO2A 1D1NA 5GV7A 1CNFA 2HDNB 3ZZUA 1GVHA 4NCNA 3CCRB 4MYUA 1N8RD 1R5OA 1DARA 3A1FA 5KSWB 3FJOA 3WXMA 4PGOA 3LYUA 1SM4A 3J81k 1KC8D 4AC9A 1UMKA 1TVCA 5JBQA 4RD4A 1XE1A 1E62A 1EP2B 2BV3A 3W2IA 4TMZA 1S0UA 3CMEB 5EMNA 1E63A 4UAJA 1ELOA 2DETA 4ZCLA 3W5VA 3OZUA 1QFJA 2RC5A 5THXA 5FA6A 1FRNA 4U9UA 1FNCA 1FRQA 1IJEA 1Q82D 2GPJA 1E64A 1QGZA 1TLLA 4DQKA 3VO1A 1GAQA 1H42A 4H9GA 5GV8A 1K8AD 2BPOA 1Q81D 3B8HA 4P3YA 5TV2A 1FNMA 4TMWA 3CCQB 1YHQB 4M4SA 4LBZA 2VNJA 3WBJA 1YIJB 3PENA 2X3UA 1KD1D 3ZZTA 3CCMB 3B78A 4QHYA 1KRHA 1ZM2A 1QGAA 4EH1A 3VNVA 2PMDA 4Y9RA 4R71A 1YJ9B 4PC1A 3VMFA 4G1VA 3SJZA 3CMAB 3AVXA 2B7CA 3W5UA 2BN4A 2BF4A 5H5JA 2HCJB 2QTLA 3E1YE 1KK2A 1G7TA 3MMPA 4Y7CA 3V76A 1DDIA 4YALA 4IW3B 1Q86D 3G6EB 4B4DA 1YJNB 2OTLB 1W2BB 1QFZA 3QFSA 4LBWA 1EFCA 1B2RA 1GJRA 5TR9A 2XNJA 1GAWA 1A8PA 4G5GA 3CCSB 3I56B 1VQPB 3W5HA 2QMUA 4MYTA 4PC2A 2E1RA 3AGQA 3W2FA
chains in the Genus database with same CATH superfamily
5FWXB 4BHTA 1R66A 3A4TA 3IAM1 4NQZA 2BR4A 4KIFA 5LWQA 1E99A 1USWA 3B3AA 2HRRA 5IFLA 4M55A 5DLDA 5J23A 4JJ7A 1Z33A 2WVJA 4RETA 2ZL7A 2B5OA 1TL7C 2A1TR 3LKDA 4G1CA 3RRZA 1FVXA 1NJ2A 4BUJA 1FXUA 3KVVA 4BFYA 1S3IA 4WRRA 3Q2KA 1Z38A 1FMCA 2VVTA 4FGKA 4UDOA 1QHHA 5AK5A 1XKLA 5GPBA 3CWCA 2C4HA 2W4QA 2XUZA 3IPLA 2WUDA 3QOYA 4IIYA 3DVLA 4IXNA 3HYLA 3R5FA 4UJ3A 2RHJA 4DNFA 5U9CA 2Z6QA 1ECFA 1Z83A 3RU9A 2AN5A 2XLCA 1ZBQA 1VE7A 3A28A 3ONEA 1UD5A 1RTTA 4QL3A 4RHFA 5A05A 1F0KA 4IGAA 1WHSB 4DLNA 2Z5GA 3EBOA 1VIYA 2P9EA 3CF0A 5J2TB 1E1RA 1JQJC 1VPDA 4J1SA 4KAFA 1DAOA 2HMYB 2I7DA 3QBEA 4XPIA 4YDRA 4D8XA 2E1PA 3R7AA 1IDOA 1N1GA 4KQFA 4ZHQB 2XF8A 5HF6A 1XYGA 4XOIA 1M6VA 2J3HA 4S24A 4L72A 1FE8A 4AZ0A 3K71B 2VAXA 1XMJA 1RDFA 1PR5A 1WMEA 2I29A 2KHZA 1WKVA 3CRNA 1G5IA 4ISCA 3VAYA 1TXGA 2FZLA 3AF6A 1UEJA 2EEPA 4IIFA 2NU6B 2P90A 3RKRA 2F1OA 1TTTA 2C8LA 2AW3A 4H59A 1M10A 1MF7A 1QLWA 2EZUA 3KFLA 4QAQA 5CB8A 1E79D 3HGMA 4AZSA 2YKGA 2VCEA 4DLYA 3KQMA 1K8ZB 3H5VA 4O1IA 3RUFA 2YWBA 3AESA 4RXUA 4BX0A 4ZOCA 5KWVA 4WERA 4HGNA 4CV0A 5JI2E 3TLXA 4YJ3A 3ZXIA 4Q1VA 3AJEA 3CJQA 3M3PA 3FH0A 4RHUA 4CF3A 1QSGA 3EIQA 5ALTA 3TPCA 5TIIA 4KNVA 4KRXA 4PGAA 1AMUA 2PANA 2VT7A 1Z2NX 4RF2A 3LIPA 4JLNA 3ESBA 3O4JA 2NTJA 2AUMA 2ZQZA 4M1QA 3ZWPA 3RIXA 1DDGA 4U9IS 2JEZA 3OPXA 4HRXA 4C5AA 2HTEA 2C5EA 2H9AA 3DB1A 1PJQA 2CWWA 4N4AA 5ALZA 3SQOA 3OLWA 4OXQA 3JY6A 3UTCA 3SKBA 1YAHA 2B4KA 4Q4JB 3EBLA 1LF0A 1UOOA 2P2ZA 3OM0A 4CT0A 9LDBA 2G0NA 1RZRA 4E6PA 4LCBA 4PZCA 1OWOA 5EXPA 4LGVA 1MP0A 4HDRB 3WLIA 4D4LA 3IHKA 3JZMA 4Z4SA 4LVNA 9GPBA 4G1BA 4F11A 1ZCAA 1OXSC 2AT1A 2W0SA 1ODJA 2CXHA 5H1YA 3BSSA 1J90A 1EE2A 2VJPA 4QGHA 3LY8A 5CGQB 821PA 1UK9A 4UC0A 4PZEA 4CM7A 3GFRA 4RWZA 2COKA 3A6HA 3PLRA 1VCIA 1JH8A 3UJ7A 4G5HA 1ODCA 1PD1A 4P1ZA 2JIMA 2FX2A 5K3AA 1W5EA 3GDWA 4C7KA 2B34A 2CVFA 3IVXA 4GR9A 1JDVA 5TXGA 2I6TA 4DIEA 1V11B 4IJUA 1VSUA 2E4UA 4J90A 4ZRMA 1WG8A 1CJVC 4D3YA 2R85A 3GYGA 4UVHA 1HUQA 1T34A 2OO5C 1SFRA 1M7GA 1GGMA 1IY8A 1GZ6A 2W43A 4L57A 3ZGVA 4WZAB 2FPRA 1SOVA 5D84A 4P2GA 4E5KA 2PVSA 5A5FA 4D97A 1LLCA 4M1TA 4UTZA 4BIIA 3TXYA 1E5VA 1AQIA 2QPLA 4RPHA 1FP7A 2XT6A 1K89A 4HDQB 4M76B 3TOSA 4MS4A 1L5HB 4Z7QB 4S2EA 1QRDA 2A33A 3RHZA 3VYWA 4JLWA 4IMJB 2RIRA 1LNSA 3DS8A 5CYFA 4ZANA 3TMKA 3ZV4A 3P2IA 5HG0A 2QIPA 1ZH0A 2PJZA 1ZM4A 1GA4A 3TEJA 3UV7A 5NULA 1ODFA 3VSAA 5LUAA 4YJHA 4LBVA 5CLLA 2WM9B 1Q12A 1OYWA 2PJUA 2WYIA 4C0SA 3EEIA 4RMHA 4UM9D 1RAAA 3MFQA 1P1JA 4ILKA 3CPWB 1O96B 4LJ8A 2BTEA 2ACKA 1I5OA 3M9XA 4EUFA 5FHRA 4Q19A 2LGJA 3V4ZA 3Q6NA 2BFEB 3EDMA 4KQKA 1ML4A 4MW7A 4HB0A 5BOVA 3TZQA 2XDQA 4EW1A 4EVSA 1U9YA 3GMTA 4X1IB 521PA 3ZLTA 1C0PA 4DV6B 3DTTA 4S12A 3DQQA 2RI0A 1ZCFA 2PS0A 4LVUA 4IDBA 4BFLA 5B1EA 3FDXA 3REQA 4RKYA 2IPOA 1QG2A 2XXAA 2C94A 1KO7A 1GZHB 3L79A 4UBOA 5B55A 2G9VA 2CHUA 2RAUA 2N75A 2VH5R 1JILA 2EJVA 1JSZA 2P69A 2R8RA 3COZA 3HR4A 4NX2A 4M1OA 5BUZA 1P0QA 3Q3EA 3N7TA 4ZO9A 3JZIA 5CIYA 5GP1A 1HYGA 5J1SB 1G66A 1ZBDA 1MPXA 1PJ5A 1FW8A 5TJ9A 3QWHA 2ECQA 4RHEA 4AZ3B 1TPZA 2PQ2A 3T4PA 4YV1A 5TGDA 4JVOA 4Y1FA 2YMLA 4J3FA 2I4TA 2NPFA 2XX3A 1YS4A 1RQPA 1WDLA 4WN9B 4JI1B 5D7BA 2C9ZA 1E4OA 3GFSA 1B15A 3KZCA 4HNGA 4BCDA 5JVDF 2F8TA 1GGHA 4E32A 3C8HA 2FPGB 1KOLA 3U7RA 4C4OA 4QUJA 2P9HA 4CUKA 3ABQB 5KTOA 5LFAA 4JLMA 3OE5A 4P54A 2WNSA 1CLEA 5IAOA 1DIHA 1U11A 4OJYA 3KB2A 4CMHA 2VZ9A 3QNMA 1B00A 3AVYA 4OQXA 4Q1EA 4BMXA 4F0JA 2L69A 4MKFA 3NCHA 3IQXA 3K9FC 2GUWA 1XYYA 2J5XA 1SCDA 4J03A 3BRQA 1R4NB 3JRNA 4HYTA 4P8RA 5DI9A 4HVCA 1RKBA 4EGCB 1NP3A 4C6SA 1FMTA 1YR1A 3R6DA 3GJRA 3GEPA 2PSEA 4HR7A 1XF1A 2VPXA 3D3WA 3HO6A 4XN0A 4WNCA 1UXHA 1M0SA 4M98A 5E6RB 3X43A 2JJYA 4CM4A 2XRZA 2K7ZA 2VJLA 3PWTA 1H0KA 2BFNA 1M2FA 2Q6VA 3BGWA 3JQDA 3B7GA 4U7GA 1GTSA 3V4OA 5JFOA 4C43A 3OY7A 1E18A 3WP0A 5IG2A 3IGFA 2R3SA 2QRNA 3ICQB 3QEBZ 1O54A 3P1JA 4XLHA 2JJ2A 4DCTA 2EDCA 5AUQA 5JWOA 1TK3A 5DTJA 2C2YA 1N75A 5IUJC 3A2MA 4AD8A 4D81A 4TT8A 4AG6A 1CFZA 5L9AA 4RHTA 2C97A 4BZXA 3D6UA 4HE6A 3NHJA 1R4AA 3FYCA 4FSHA 3IXQA 3UAOA 3HU5A 3EVEA 4NU5A 5EERA 1KO1A 3BEDA 3IE2A 4TM7A 4LFCB 2D1FA 1E7MA 5FBWB 4NNPA 1J2UA 2H11A 3HA5A 7ADHA 1L4HA 3HRHA 4MROA 3LS2A 3PKIA 1J2RA 4HAWA 3OTOB 1E1DA 1NFRA 4PG6A 3SIWA 2PV0A 5F35A 1C9DB 5KDOA 1QVGB 1BW9A 3QA3E 4KX3A 3PKZA 3RWBA 3L4JA 3CN7A 1QKJA 4BMSA 3M3HA 4PG5A 1ZIDA 3TNJA 3CD6B 2JFYA 4PPNA 1H1DA 3SF8B 5LMCA 2QUIA 5EIWA 4ZWNA 2WRZA 2D5CA 3DPUA 3I5XA 5FPTA 5EYPB 4FYIA 1IRIA 3H1BA 3THWA 5CT4A 2QAJA 4LNAA 4B3RB 4NENB 2OCYC 1FFEA 3BGOS 4KCGA 5FADA 5IFKA 2A8YA 3M6WA 3W5DA 4JVLA 5CDUA 3O95A 2QUKA 2QLFA 2RG1A 2AGVA 1IY1A 3TEFA 1Q7CA 4R2JA 3AWDA 2G40A 2X2PA 3PPIA 4E5UA 3FCXA 4NNJA 1H2WA 1KI8A 2OTJB 3KJNA 4HH3C 2E7ZA 5JE8A 1QVRA 4G2TA 2HA5A 1ZX1A 1JKXA 1U2PA 5C8YA 3P27A 2RHTA 4DNQA 3CS3A 2OVBA 3K05A 2WF6A 4R7ZA 3UXMA 5L3QA 4LXUA 1SPBS 3C8DA 4YPFA 4CMAA 4XWOA 4ZGWA 5EJEA 4F3TA 4KPUA 1L5RA 1GEGA 1GQOA 2FF5A 4N5MA 3SS8A 3VSEA 1S1CA 1PL8A 3ZWAA 2R8YA 4EFMA 4YXWD 4RZSA 2Z6BD 4DA0A 5A2QA 5ADWA 5FTLA 1OGIA 3U7HB 1JAHA 1OFVA 4IEFB 3KSBC 2UYYA 3G9UA 5ALJA 1PNQA 3O92A 3RUEA 2VYVD 2EL7A 5AKYA 1W19A 3CO5A 5GJWC 3RABA 4ZK6A 3HUUA 2PL3A 3H1AA 1U4NA 3D1VA 4NJMA 3RBVA 1RBMA 1RJDA 3L7MA 4FOTA 5JS8A 3AHHA 1NG9A 1A27A 1DCKA 2WUEA 2XPCA 3UT0A 1QWOA 2IOHA 3T7KA 3UMRA 4EA7A 1JXAA 1IZ7A 3F49S 1C30A 3DBLB 4HAYA 4ON9A 4ZVUA 2ZTUA 4FFOA 1P4GA 2E85A 4OOFA 1JQBA 1L5FA 4WFJA 3T3MB 3U7JA 1ULUA 4ZXPA 2VF8A 1MAAA 2G63A 2HSEA 3HE3A 3NNSA 3Q87B 1LH0A 1VBFA 4TLBA 3UXYA 1Y6GA 5KSWB 1TADA 4KTVE 5JAZA 2O7SA 5F3WB 2X8LA 3BPSA 1E6EA 1EXWA 1W0KD 2H1SA 2MDTA 3DE5X 4MUGA 5KYUA 2Y68A 3HY3A 2EC5A 1O95D 5HKAA 1UMCB 1L7VC 4MI3A 1KC8D 3T35A 3UJHA 4WZBE 5JADA 4G67A 2X2OA 1GAJA 2CXSA 2OAP1 4PPYA 3B12A 2FW7A 2BFBB 1ZMXA 3WIUA 3WS7A 4EO7A 4MQBA 3L7NA 1Z12A 4JT9A 4AU1A 1TU0A 1RLJA 4RD4A 1D1QA 4R1LA 2ZJFA 2OB1A 2WYUA 2VC2B 3EZFA 3SQDA 1EINA 3UTDA 1EX7A 1NGSA 2AL7A 4BJ3A 2N42A 2NP6A 1NJ1A 4M89A 4R3UC 4W8HA 2QTVB 2YZMA 3CCBA 1F0NA 3GEIA 4I9GA 2BFDB 2WIGA 5DNUA 5L45A 1E0JA 1Z5PA 3NNDA 5CVUA 1HDOA 4FE7A 3U1TA 1CQIB 3IE1A 3DMPA 2QD4A 4M0FA 4AI6A 1RAHA 2OBBA 4MMZB 2RJNA 3QE4A 4JFAA 3IVRA 2DXIA 4YPVA 2OGSA 1E5DA 2XCQA 4H3SA 3LNNA 4RPDA 1LJLA 1OXKB 2ZRQA 3KVOA 5BN3B 2ET6A 4WBNB 1VBNA 2I8AA 3HH8A 4QTZA 1IN6A 1ULZA 3GBVA 4Q3AA 3VOTA 1LPMA 4G0QA 1RJGA 2NQTA 3QXHA 4YXFA 3IILA 1KZHA 5I7WA 3EC7A 1N2JA 3PJEA 4Y6RA 1Z16A 4HWKA 5LQNA 2ZYIA 1M33A 1PTKA 3DNFA 2HRDA 2ZIWB 3E35A 4MR8A 1YHQB 1QRTA 1E1KA 1PL6A 1U7OA 2B69A 3JYHA 4JNKA 4Q37A 3O8CA 3QXXA 4K6GA 3H9EO 4B6EA 4DDWA 3AERB 3RCBA 3BMOA 5LYJB 4CVNA 4I14A 1A98A 3KKLA 3CPXA 4MUXA 3T12A 5G4KA 3T1HB 1YS1X 1VBMA 4GQNA 4UFPA 2GN0A 2R00A 2Z9BA 1V0JA 5AKEA 1JXMA 1L3CA 4QO7A 4HRAA 5EJMA 5KOYA 2PZBA 2XNHA 1I2BA 2RE8A 3DTVD 2AJCA 2PZAA 3C7DB 3EZXA 2WJGA 3EIFA 4P3XA 2WY2D 3CYFA 2DH5A 4W5QA 1YZYA 2OBLA 1YL6A 4EBFA 4B4UA 1SOWA 5REQA 5JDCC 4IRUB 3AUAA 3ZOZA 2MSCB 3CRVA 3H2GA 4BQSA 1SHKA 3G2OA 2PMDA 3WKBA 3U7IA 3K70C 5FL3A 1TM3E 4DC9A 4RMIA 1L8LA 1A9YA 1P0CA 2ZQYA 3AHEA 3GV0A 3BGDA 1YOVB 1UQUA 5MDHA 2HK8A 1OJ7A 4ENWA 1TCUA 1RD4A 1S89A 5EHZA 1JEAA 3VTFA 3ENKA 1RXYA 5LP6A 3DZIA 1G98A 4CGZA 3DXFA 1BVYF 2QN1A 4ZU1X 3VH1A 2Z8ZA 3GRAA 1PLJA 3GAZA 4R7TA 3HFSA 3SZUA 4CM6A 1A8SA 1EFRD 4KPFC 2QTLA 2CDCA 3AEYA 3GH1A 1IHUA 2I7CA 2QIOA 3DJYA 4AY4A 4Z7OB 5LKAA 1AT1A 4QECA 4PXSA 2OL4A 4MGYR 4RQAA 4OFWA 4CQMB 4EWLA 3QXCA 2ASVA 2H2FA 3IBYA 3T34A 1DDIA 4K9LA 2G09A 3GOHA 2DF8A 3QVUA 3EAGA 4LZJA 3T7DA 2YYYA 1UD3A 4MA0A 1SZDA 1NV9A 4MUBA 1RFGE 2QVLA 4G8DA 2A5JA 3ZIDA 2YR0A 3STVA 5CHEA 4HFMA 3KZKA 3CF2A 1W2BB 1YR9A 1SXHA 1UZNA 4ALMA 1U7XA 2B6HA 1U4SA 1WVIA 4MDEA 1KWKA 1Q20A 2PLNA 2OGUA 4Z9XA 1XRQA 5A6SB 2B8JA 2E48A 4H0NA 3V2HA 1V5EA 1YI1A 2G5TA 3V7FA 3ZHRA 5FOQA 1J22A 3IAUA 4TS3A 3WIVA 4DRXB 2CMFA 4W6ZA 2XZOA 4FZJA 4F21A 1XZMA 4G5GA 4BKOA 4Z9YA 3A14A 2AG8A 4YP9A 3UWPA 2XADA 2QMUA 1QS0A 3C5WP 5TQ0B 4XGNA 1GTRA 5DEIA 4UCQA 1QZTA 1QHGA 1JLRA 4YIKA 3SX0A 4J16C 5EUCA 1WR8A 1E0DA 4G41A 4IOLA 4DEYA 4C87A 1PSZA 5FDFA 1T9ZA 1PYGA 4EI9A 2O0LA 4R7GA 2JA1A 5JQWA 4O0LA 1PQYA 1NN0A 3QIVA 4ZCQA 3N28A 4G5RA 2ZR0A 2UYOA 4L75A 2PFSA 3CTMA 1SULA 2FUG6 5FX2A 4JLAA 3RJZA 1WEHA 1CHNA 1E2NA 2GO1A 3DLTA 1CE8A 4BEBA 4NCXA 1D09A 4FHEA 1DKQA 3CGGA 3LLSA 2ZR7A 4FEEA 4EI8A 2VCYA 1A82A 4AX8A 4C0QC 2Q8NA 3MAAC 5HFNA 3A32A 2P2CA 2OD9A 3KXPA 3QW2A 3FPGA 1CWUA 1SPXA 1QJCA 4JVNA 1W0JA 1O87A 3KJFA 4Y2PA 1YB7A 1J2EA 4KWCA 6REQA 3SXJA 1IEXA 2H06A 2XOKD 3AFGA 1AMNA 2OV8A 4D8VA 2XODA 1N33B 3RT7A 2Y6VA 1JLKA 1NQXA 2HQRA 4GPIB 4IIBA 1A71A 1OLXA 1RYMA 3INRA 4E30A 1YDHA 3T1VA 2QSYA 4UE6A 4F38A 3PYLA 3HBLA 4Q03A 3IKMB 4Q3KA 4COOA 2X22A 3H3JA 5T4EA 1PVOA 2COEA 1LX7A 4PLTA 5KB3A 1ICEA 1ISGA 4XSVA 3HABA 3NFRA 5FFNA 5IBPA 3A06A 3UG6A 2D59A 4F1KA 3AVVA 4XOPA 4F4UA 4KR2A 1IWOA 2E5FA 3Q7PA 1GGJA 5HKOA 4C01A 3OF2A 4P5PA 1N7HA 5KX5A 3VUFA 2HMUA 2GPYA 3ASRA 1JVNA 5A2GA 1Q44A 3FF1A 4U3JB 5ULLA 5FOUA 2JFPA 4QFMA 5JD6A 4J7UA 2XYGA 3F2VA 4HXFB 4B44A 4YVFA 4EJSA 1MA3A 2JIZD 3O47A 2UVQA 5A9SB 5ITZA 1JJBA 3MGCA 5BN5B 5LXTF 4BO7A 5MHTA 5BUQA 3JVVA 5GQSA 5CAEA 2BGWA 3GGOA 3NDPA 3TECE 3PEYA 3P52A 1M1KD 4MRSA 3DFZA 1EUCB 2YXEA 1RIIA 1K8YB 2A0YA 2CXXA 1MHPA 5ALXA 2G17A 5ER6A 1XLUA 2AFHB 4ZT4A 4ZO4A 1YB4A 3MYRA 3S1AB 1MHTA 2XYPA 1CJMA 2WWWA 1S9DA 2H85A 1BHQ1 1GT91 2O07A 3ED5A 3FUCA 2A6PA 2ERYA 1W85B 4H1UA 4H2DA 4C22A 7MHTA 4Y30A 2HYDA 2VBCA 1V0FA 1QIKA 2DMRA 3WB2A 3PZBA 1DWOA 2O2YA 1SD1A 3BIFA 4UHJA 1DO2A 2CLKB 1R5NA 2FW9A 3WGIA 3KT3A 1Q22A 4RD6A 3AZPA 4C2UA 2XUFA 1H2AS 5H7XA 2Z2JA 1MFZA 5CG1A 5B58T 3FMIA 2GJKA 3L6EA 3KJQA 3OIYA 4JOQA 4D8TA 2DQ4A 5FNVF 4B87A 1T6NA 1P31A 3K3PA 1JTVA 2FLKA 4YP5A 4AMVA 4CG3A 4D5EA 2XOXA 4XKJA 1FTQA 1YF3A 4QPPA 1RE0A 2GO7A 3PHGA 3PSHA 3GT4A 2Y9PB 1KVTA 4JU8A 5HBGA 1Z6PA 4MAAA 4OBBA 2GK7A 4YX9A 2CL6X 1TQ2A 3A7EA 3A3PA 1JIJA 4IS3A 3F5SA 2JGDB 3DBHA 3QEMB 3A1CA 4F2PA 5CLJA 3ZCXA 1O94A 2MMGA 3E5MA 1QWSA 1E1NA 1IJKA 1L4GA 3P2MA 1GGEA 3Q3HA 3QKUA 1IM2A 3UB4A 4M38A 3EZ6A 4IDEA 4O29A 3PA1A 2ON6A 1SU7A 2YV4A 1OXBB 2FUEA 3A4YA 3I6ZA 2IYAA 4OBXA 5BNFA 5E1BA 2RAPA 1XYVA 3RREA 1MTZA 5AI4A 5CU7A 2KWIA 2IEGA 3IUPA 4HYEA 3HKEB 3LPDA 1P2GA 3K5WA 3RYIA 2ZJ1A 1SOAA 5EJ8A 4EX7A 1OHHD 2AVDA 4Q9NA 4DY4A 5B12A 4FEGA 3E23A 3PUNA 1UBUS 4XM3A 1PZGA 2Q7XA 2BEWB 3QWIA 1F4LA 2M1ZA 8MHTA 3PEVA 1JFFA 3CE9A 5LQSA 2PWYA 3TX2A 5JSZA 4Z4WA 4RM2A 1EMDA 2AG6A 1C1DB 3EPRA 4PR3A 3VNSA 2BKVA 4JUFA 3OI7A 4BAUA 2Z5VA 5FEUA 4J0QA 1XB2A 1JHZA 3FBWA 2VS1A 2VDRB 3GLSA 1DJPA 1V0EA 1YR7A 2D2IA 2WIAA 3HNRA 3L0ZA 3MRXA 5ALSA 5EZQA 1AX9A 4KXWA 5HQ3A 5JSHA 4F4DA 5HZMA 4RPGA 1G19A 5LU8A 3AF2A 5J4LA 1C7QA 4LHZA 3QMWA 2W2MA 2WD9A 3OQNA 1P75A 1G7SA 2GVDC 4M7OA 4HDSB 1H93A 4R2IA 2NZ2A 2OXTA 1W7AA 1JS1X 2YV1A 2QUJA 4M9CA 1VDMA 5I7RA 1Z0FA 2C9DA 2DP4E 3B53X 3WY9A 3U60B 3COJA 3EOBI 4R1SA 5HJ5A 1KC3A 1VE5A 5H4HA 4YCCA 3I0NA 5ECDA 4Q4HA 4Y2HA 3RVKA 3D4OA 2HRZA 1AZTA 4IOKA 4Y1RB 3A3NA 3VYUB 3IHLA 1PUXA 1DUSA 4O4HA 1E9BA 3DFUA 3O0TA 3G23A 3OCXA 4OQ4A 4DV7B 3QMMA 4Z3OA 1XP5A 4LXTA 1QU3A 2YWRA 3VMMA 4RGQA 3KWMA 1LBSA 3VHXA 4AKTA 2QVYX 3GZ4A 3VDMA 5IT9A 4JR2A 4C3ZA 4KKSA 2J3MA 3CO0S 4OL9A 4BC1A 4UM8B 5CA0F 1FNDA 1TUGA 4AMZA 4POOA 1ZONA 4O4LA 3A6FA 2L19A 2SECE 3W8EA 1BSVA 3SQNA 1Z2CA 3SE0A 5TC4A 4JXXA 1W2HA 5DHRA 2FFAA 2CCJA 2JFOA 3UATA 2X7JA 4HGYA 3HHEA 5LDGA 2JI9A 2PNJA 1I2DA 1JU3A 1ORHA 1TIKA 3NS7A 4DYDA 5HFAA 4ARCA 4WPGA 4CF5A 4UDYX 4WZZA 1QK3A 3FMVA 3LV8A 2DBYA 1G18A 3ADOA 4FXOA 3U3DA 1M34B 3HDGA 3I3OA 4FYHA 4U7JA 2AXNA 3RAFC 3NYQA 1XTVA 4HDKB 1A04A 1H9BA 4LWOA 1PUIA 4MINA 5AOCA 3ZTYA 4QRIA 421PA 2CL7X 2AG5A 1G3IA 2BFFA 2IV2X 4G1UC 2DCUA 3QEOA 4JBNA 1IFXA 3LPNA 2EF0A 3N74A 4RK5A 4DGSA 2PWZA 2DJ5A 1IJBA 4MVCA 4QE3A 3OFVA 5CB0A 3NI2A 1B0AA 1ZVKA 4KQ1A 1MB3A 4INOA 1C41A 4NY1A 1QAMA 3T9EA 5A5DA 2BM0A 3H2IA 3CWQA 2GARA 3E7FA 4HQKA 1Y4AE 3UAWA 4B5LA 4X66B 2GLTA 3BORA 1NVEA 4G36A 1I13A 1N0WA 4N54A 1DTEA 1Y5IA 2ISCA 3AR3A 3CZ9A 3P4XA 1TJNA 4X7EA 5EZYA 2CLSA 4P9NA 3GEBA 1DXYA 3DFIA 2QD2A 1VKNA 2DJIA 2FW8A 2XDAA 1OX4B 2FPIA 2FK8A 4DV2B 4JLVA 2RB5A 3CVVA 4ZDKA 4BV8A 2A5YB 1A0OA 5JLJA 5A4MS 2JH3A 4BLOA 1UODA 3HK2A 4Q4AA 4AB1A 2WYHA 1DG1G 5TNXA 1BGVA 1FLDA 4EA6A 5IXJA 1C3JA 4N39A 1BLIA 4L0QA 1J5XA 5CJPA 2FWAA 4HH1A 2H5JA 2QROA 1X1RA 4C1NA 4GYWA 4XLTA 3TZBA 2IS4A 4NYIQ 4A8JA 3NAZA 2RGRA 4NMXB 1BDMA 2B8NA 2HA3A 4RE6A 3KVRA 4TTSA 1NXOA 5ESDA 2B2NA 4LHXA 5HTKA 5KKAA 5L4LA 1Z7EA 5FIUA 3BB1A 1GG8A 1FSPA 4NJEA 4HWSA 4TRMA 5KQRA 1X9IA 4C7JA 5E1MA 1L5WA 3A7DA 3A6KA 1DUVG 1ZJYA 2VT3A 2E87A 1A4IA 4IUCS 1GZ7A 1ST3A 1KI4A 4MVJP 3WB9A 2JLYA 5JEDA 2X42A 1ZKDA 3FTFA 2FSVC 4FC6A 4P7FA 3SDSA 1KA9H 3GUYA 5LWHA 1CRWG 5CNKA 1CUYA 4O2LA 1CNFA 1N3LA 2FZVA 3INTA 4MMYB 1AZWA 4TROA 4X6YA 2HDNB 2BR3A 3O82A 4OYLA 3EDYA 2O8CB 1J39A 2O52A 5T4HA 3UO8B 4ZCRA 3O1HB 1N6NA 4M46A 4NBWA 1RMTA 4FOPA 1OAAA 4RNCA 1UC5B 3WLTA 4FFLA 3LCRA 2YL2A 3B6IA 1M73E 4GT1A 4MYHA 5KNCA 1KDTA 3RYCA 2C8JA 1N0IA 3LVRE 5AKLA 2K2WA 4B7AA 1GLNA 3WXMA 1WSWA 1PNOA 1KMCA 3AEQA 4GI2A 4LRQA 1LBHA 3PG5A 1TJPB 3A8KA 1NRJB 5LSAA 3UAVA 3ZCPA 1SRQA 1XAIA 3OQBA 1C7FA 4KTTE 1FTSA 4CWAA 4Z49A 4H1WA 5BVHA 3NC4A 3NNNA 1D6SA 1U1EA 3HJCA 2M32A 2CMGA 1UWKA 3NPAA 4NBUA 4XA8A 2OBSA 3V1LA 4HK4A 1EVQA 1JEQB 4MK4A 2ZYRA 2C83A 3OJOA 3WQBA 2BV3A 2V7QD 2RD2A 4XX0A 3OEWA 4HTFB 3D3EA 3CURA 1T9DA 2ZI9A 4JH0A 1F7VA 1RWQA 3UXHA 3KR9A 2HBZA 2XYQA 1B73A 1Z82A 2O0HA 4Y6PA 4QD3A 1HLGA 1QYIA 1V7ZA 1RJ9A 2B8TA 5EZ5A 5LZ9A 4GZMA 4LS3A 3ZQUA 1FDWA 4A23A 2QAGA 4TTTS 2EG5A 3RSFA 3HDQA 1EWRA 2WM8A 3DT8A 1ZYUA 4OQDA 4D79A 4BQEA 1KVRA 3PFBA 3CJRA 5CB4B 2QT9A 1V2GA 4H6WA 2Q5HA 3FDZA 1BDHA 3G89A 3VAAA 2J46A 1GAQA 1N8SA 2Y9MB 1LQTA 1O9HA 1PJZA 1RKXA 3K0BA 1YZ3A 4LRXA 3KAPA 4O3MA 1YKFA 1FC0A 4EG3A 2FMUA 3A4LA 3B8HA 1RQLA 3LCJA 4TRRA 1JFVA 1CUEA 1NULA 1QMGA 3S2YA 4AO8A 3U7FB 3QITA 3W1EA 1EUYA 5T57A 1ZHHA 4BLRA 5IZCA 3O90A 3HVKA 3GXOA 3JQFA 5BSFA 2V96A 1RZRD 3DOEA 1KQ3A 2DOKA 2Q5LA 2NU7A 3I9OA 1O6ZA 3BAFA 5GZ6A 2F3UA 3TZCA 4GDFA 4JV5B 2X2EA 2XVYA 2HHHB 4UPVA 2VJJA 2IYPA 5KPDA 2XB2A 1YIJB 2OZLA 3NHSA 5FBLB 1NP6A 2QQEA 3FXAA 3HBMA 3O3CA 4NP6A 2VPQA 1XJCA 2G28A 2XB6A 2WSIA 2VIIA 3ND5A 3PJGA 2FN3A 3O6VA 4JDUA 4CUZA 5K7SA 2WU1A 1BOFA 1FS5A 2Z95A 3E53A 3DDZX 4WOPA 3C3PA 2P6OA 1KRHA 5K3FA 4BO9A 4HDCA 1OUMA 5KTRA 2OWDA 4G89A 3MOSA 3ND7A 1NI4B 4FILA 2AMLA 3C16C 4XI9A 3NT4A 5JCOC 2GRAA 4HQLA 3OBIA 1CY1A 4FQ8A 4AFNA 2QLBA 3AY7A 3GBSA 2IYRA 1J8QA 2WU0A 2VJIA 1F5NA 3WB0A 1XD9A 4P08A 4K9SA 4C05A 3B3QA 3E9DA 1HOTA 1XTPA 2BFMA 3E05A 2SCUA 1Z6QA 1E94E 4OB7A 1QVZA 2J5KA 3FHJA 2EP7A 1CP3A 2V03A 3NOOA 4DIFA 3TBFA 1C7EA 3N6VA 1CZUA 5AMXA 2O2HA 4O0MA 4B9AA 2BHRA 4QOJA 2JFNA 3EW7A 1NIPA 3MS4A 4Q6WA 5K5EA 2EKQA 4NHOA 1BS9A 1WMBA 4W7IA 3QOFA 4MNTA 1KO8A 1M7HA 4NYIR 2X41A 3NBMA 3MJSA 3ROGA 4XARA 4H31A 1HO3A 3FUVA 3GLHA 1BMDA 3PC6A 1CUGA 2ID4A 1Q86D 1P4JA 3AT1A 1I18A 1SD5A 2HAEA 1EXDA 1X9GA 3EQZA 4X92A 1PFGA 2QTGA 3O4FA 2B20A 4FEAA 4AQDA 2K6GA 4A03A 1JL3A 1Q5PA 1C3OA 1LC0A 4X8OA 3UA4A 4IV8A 2Q0SA 5JH7A 2WHXA 4I3FA 2JGIA 4INZA 2NOAA 5DBHX 1XXHB 5ALLA 4BWFB 3TRFA 2BZSA 4DCOA 3UEOA 3FTEA 4BQFA 621PA 2J59A 1CV2A 2PFGA 3DLCA 2IIQA 3HP1A 3P97A 3ANSA 4UAGA 3MF4A 3MTIA 2I7TA 4R81A 1JMVA 3I6QA 3JQ7B 3C3MA 4Q9LA 3HDVA 2ZSBA 2W4MA 5DKFA 4G26A 3DPSA 4HNVA 2FRDA 2D7CA 3QTLA 2AQKA 2BMVA 2V5VA 3EUFA 4LJAA 2ENUA 3ZWCA 1IPFA 1NXVA 3BJIC 3O8QB 2HBYA 2WAOA 5DYWA 2HJVA 4X95A 2VJKA 1CUXA 4MS3B 4LMPA 5IDXA 3AINA 4R5MA 4WKOA 3ZK7A 4WCDA 1F12A 5I9TA 1EG7A 1T8RA 3K8OE 1QOZA 3OPVA 2IUUA 3LE8A 1C0IA 4F9GA 1GT6A 1XQ1A 2XWPA 1CK4A 2G6TA 1Q6ZA 1QZXA 3AEUB 4ZU3A 1KPHA 3RSOA 4PAGA 5A3VA 3F5DA 4LTNA 3JPWA 5JTTA 3A4VA 5LLSA 4F5DA 3LBIA 3FNFA 4FFRA 4OFXA 1KAOA 3VPHA 3WGYA 4GZ6A 3IAM6 5IMSA 1JVBA 5KNDD 1L7RA 1PEAA 3T3EA 1J9GA 1M5TA 4WXMA 1Q6YA 3PI6A 4KEAA 3ONUA 1EVEA 4UQLA 1VP3A 2UXDB 5JATA 2M6SA 4CLRB 5AK6A 5AD1A 5E1DA 1IM8A 4Q7MB 3A3OA 5LD2B 2I99A 4FC7A 3FPKA 5CFZA 2HNAA 4RH0A 1XHEA 5BV2P 1HOXA 2WIBA 1BOOA 1NQWA 1TTPB 5FI3A 2BISA 2YXPX 3I8SA 4WJZA 4CCYA 3IEIA 4E1BA 4AJPA 3UCXA 1YRHA 4YTEA 1ILEA 4D9BA 1BDIA 2F7SA 3H6KA 2XTZA 1DKLA 2QTFA 2EW1A 3ACCA 5DOZA 5EIXA 1EFUA 5J5VA 3FMFA 5JEEA 1ZGAA 2W2XA 5D01A 5DLYA 1OB5A 2AD5A 3B1YA 2GRJA 4REMA 1JG6A 3HUTA 3RWMB 2HSZA 4UU7A 3W4IA 5BW4A 3NDBB 4L2IB 5DTQA 4B46A 3BF8A 1GXSB 4CTNA 1X8JA 4DUYB 5IW8A 2QLJA 5IVIA 1YRBA 3FNIA 1SCQA 2BEUB 4BGEA 2R7NA 5F76A 2ZZGA 3QFRA 2I6SA 1PBNA 3PHHA 3R3YA 1YZNA 1CJSA 2B99A 1XE3A 2H08A 4ZCMA 3CC8A 1QV6A 4WBSA 1JJ2B 1W4RA 1JTEA 2EZ4A 4WLUA 4TSFA 4A6PA 1O57A 2OHXA 5F4ZA 2DFDA 1CIVA 1YB6A 1RZUA 3A2LA 3A31A 4FINA 4LNUA 2O2JA 1SCUB 1EM8B 2FN9A 4PBSA 1V5WA 2A92A 1DBPA 4PC7A 1E3SA 2QX4A 1NT2A 3VQTA 4QXQA 4NR0A 5LQKA 3PCTA 3U3KA 2PR2A 2X4GA 3U4CA 2VP9A 5B6PA 3DL4A 4LYFA 5AJZA 3AQIA 5LL6P 2Q0XA 2ZT5A 4MW9A 3DEFA 3OQIB 5FI5A 4C14A 1IMOA 2I2FA 4UNIA 1VQ5B 4BVHA 3JATB 5EHIA 3SFZA 1PKVA 1AKTA 2DPYA 4M87A 2Q07A 1KDVA 4OQMA 3OC0A 4FDMA 3D43A 4LGYA 4PCAA 4CV1A 2JFWA 4Z3KA 2UYGA 3TTYA 2OECA 1IM5A 3CC2B 1WWKA 4P6VF 3G5TA 3EGDB 3NTOA 1HDYA 1QHNA 2W8BA 4ZC8A 3DDWA 2V7GA 2XZPA 4PCVA 1M1UA 5HIAA 3NV9A 3SQWA 2I91A 2QR5A 4HWTA 4TMFA 2GDZA 2XCIA 4LY3A 2Q7OE 1FDSA 4YRKA 3RYFB 1UKYA 2ZCUA 2HO5A 4EJFA 2GK3A 1TT5A 1V3QE 1N92A 2AJBA 2PV7A 1VLZA 3MMZA 3ONFA 1GGVA 4XVCA 4Z4TA 1PJ3A 1Y3IA 3U26A 1ADBA 5KPJA 1MX5A 1XFAA 1VMAA 2CD7A 5A06A 5AVQA 4BWVA 2FLWA 2G82A 2J3JA 3E81A 1QF7A 4W9NA 3GLIE 4HQRA 4UTRA 3ANYB 3WP1B 3GPLA 1Y81A 3MD0A 2GEDA 2VP0A 3NC0C 5EE1A 1IEQA 1YIOA 2Y92A 3HYSA 3IMCA 4K86A 1MNAA 4NOJA 1SBZA 4FSDA 5AXBA 4FHZA 3TTUA 5J58A 2HTFA 3PWKA 4NK5A 3OCCA 4F2HA 3BXHA 1CQXA 1XZCA 4NPHA 2UYQA 4FCCA 4N5DA 3HZOA 1ORIA 2NN3C 3QVGB 1N07A 1YL7A 2WSSD 3VXKA 4BZZA 4TV9B 4E09A 3GF4A 4Q1AA 4H60A 4F60A 2JI8A 3GZNA 1P91A 3QJGA 3LHIA 4ZV4A 1T36B 3HCRA 4JBXA 4RF5A 5JAPA 3W7AA 1KDZA 2VJOA 4IRXA 4B48A 3DHVA 4NBTA 5L4SA 1LPPA 3UC5A 2I4LA 2QX8A 3E1KA 3M1LA 2D5LA 5ENZA 1QCDA 2OMKA 3G8BA 4EFLA 3HCEA 4NCBA 3OAAA 3KJGA 2XMZA 5HDBB 4UFNA 1S2LA 5A5VA 1Z8NA 1K6JA 4KPYA 3O2JA 4MI1A 1QIIA 1SWWA 3H87A 2VPYA 4DK0A 1SEVA 4RD0A 1UJ4A 3H9QA 4JLBA 4A2PA 1C5KA 2Y1KA 1C3VA 4OP7A 2QM7A 3ZHYA 4B82A 1QKIA 4G56A 4PS1A 4JOCA 4MYDA 4U2CA 2QVZX 3K15A 4A92A 5L95A 4AS3A 4QOSA 4QPJC 3JU4A 1Z56C 3ASYA 2ETVA 1ZZGA 3HC7A 2NUPB 1JB9A 5AJVB 3ROMA 5DM0A 3ON5A 5KYWA 2DKFA 4HYQA 4QQ8A 4BMNA 2G77B 3R6GA 3VR3A 3NTLA 1MIOB 4KN8A 1T2UA 5I9MA 1W35A 3BBPA 4JGBA 1LSOA 3AXTA 1EX1A 3RRFA 4U5QA 4BGIA 5EY5B 1PT8A 3CVWA 1G64A 4HO1X 3VPFA 4L3OA 3LFTA 4TUYF 3VI4B 3DZJA 4D92A 1RIFA 1T4CA 4RTNA 3QE9Y 5AW9A 3UV3A 1ZNQO 2O7RA 4BVEA 5F23A 4B0OA 5I6DA 1EKXA 2BGRA 3BAZA 3HZZA 3CRRA 3OKPA 1OFGA 5A5EA 3RFXA 1GNRA 2CW5A 1JA0A 2HADA 1BN7A 3Q11A 4KVFA 3A0RB 2CXNA 1PAUA 2H00A 2RKWA 3SI7A 3UYKA 4HGOA 2XUPA 4R9SA 3KLMX 3UKDA 2GFIA 1A77A 1U1FA 1NURA 4IIJF 1JT2A 1HT2E 1Q95A 3BWXA 2AEJA 4WZEA 5BSVA 5EC8A 4QRHA 5BMOA 1KF0A 1W9HA 3DGEC 3H75A 4QXOA 4I5FA 1J06A 4X5OA 2ZKIA 3F3KA 2NW6A 2ZDQA 3N7UA 3QHPA 5J63A 3HR8A 4W1RA 1V2HE 1JPUA 2OBNA 1AHIA 1GQSA 4HXGA 4B73A 5IVHA 5C18A 3R2JA 4JI8B 1NX6A 3X44A 5KNDA 4PBRA 4JQCA 3P9QA 1CJKC 2CXRA 3WLHA 4PVCA 1E2BA 2QM0A 4NE9A 3AQ4A 3LHKA 2ZYVX 1GYQA 1V37A 3ROKA 1EG2A 4IEEA 3AOGA 1KARA 3Q3JB 3A3BA 1GZSA 3NHYA 4B3XA 1PJ4A 2A0UA 3NYRA 4X45A 5TDHA 2QDKA 4BMVA 1E5TA 3BMQA 4EJMA 4K88A 3NAMA 3NHBA 1ZOSA 5KCZA 1N5RA 4FD2A 4NDNE 4YAUA 3C87A 1G21B 1RAIA 2JIPA 2VUTA 2FPMA 2WFLB 1A95A 3I42A 4EB6B 1LCIA 2ATEA 5FPQA 2VPPA 4RX1A 1J0BA 1OOEA 3PPWA 2JIZA 3G3EA 4DHWA 3KPUA 3OE7D 3TL2A 3V3TA 4TMTA 5DH9A 4DC1A 2OKCA 2OYNA 3UJDA 4DSUA 5A0TA 4ZPXA 3LRPA 3GJXC 1DVRA 1Z2DA 1NRIA 4WZAE 3HRKA 3I5AA 1JA9A 1G6KA 1BDJA 3A2NA 4OY3A 4PHTA 2Z6VA 5LLDA 1UP6A 2O0MA 2OORA 1W30A 3GEMA 3JQAB 4BNGA 4PINA 3CEJA 2R44A 2GQFA 1Y9EA 4FK8A 2FOXA 3OTHA 3QU4A 3VVCA 1A5SB 1AC5A 3IP7A 3TQFA 1NU6A 3W5BA 2UZIR 3VC3A 3KU1A 2E21A 1RAGA 4IH4A 5LC1A 1ZD2P 1TM7E 4G5OA 1I4LD 3IESA 3N2LA 4WVFA 2WIDA 4QWWA 1LDGA 3L93A 2GN6A 1AGXA 4PNPA 1YMVA 3EXFA 1F20A 1QFMA 4L9WA 3WNCA 1PJBA 3UJPA 2BHLA 4YCAA 3KOOA 2YBDA 1FDOA 3NFYA 4XH9B 1OV6A 3DDCA 5CXXA 1DI0A 1OIXA 2COUA 3HRIA 1L1QA 3SBEA 3O8OA 4PZPA 4W9NC 4QNMA 4KBYA 4G37A 2Y0EA 1N78A 2CNLA 5SZKB 3WDKA 4F2WA 2GI4A 2GBCA 1ZUNA 2IJGX 2R6GA 2VYFA 3PUKA 4PEVA 3RTBA 4L0CA 3S2GA 1ZVVA 4R2MA 1AF4A 5DU2A 3KKMA 3IODA 3TUIC 4ENRA 2CJWA 4JHLA 1SVUA 5LBTA 3T9AA 3THOA 4R1OA 3IMEA 1QRUA 1JYEA 1SUAA 1YU6A 1ZP6A 2C4MA 2O2ZA 3FCSB 1JSCA 2FR1A 2ZM5A 4I1PA 1OILA 4ZAGA 3BK1A 4GWLA 3FLBA 2IYTA 2RHOA 4OHCA 4EQ6A 4W82A 4EVQA 1YE3A 3NBKA 3ME5A 1CRQA 1NI4A 1W52X 1KI6A 5BYBA 5T5QA 4OX9Y 4OKIA 2GZDA 5HIKA 3N9IA 5JNVA 3ZHBA 1D2RA 3ZTTA 5K0BA 1R5OA 4TT3A 1NRXA 4ALJA 3V33A 2Q6LA 2DHEA 2Q6OA 4Y18A 3RG2A 2EKPA 1RT9A 1ZICA 2V4UA 4DJEC 4ZVLA 3OBBA 1ZN2A 1FEZA 3HYNA 1M5RA 1EK5A 5AI8A 3ETLA 1I33A 3L7OA 3SHTA 3U4MA 3GG9A 4MQFA 5CCEA 4OPOA 2VF4X 2VWQA 3J81k 5IF9A 2AVNA 3CKKA 2ZI5A 3IKVA 2BC9A 1HDRA 2Z5LA 1P7WA 1IHOA 1XCOA 1UBHS 5JBQA 2A9JA 3CH4B 4JEHA 4P7JA 2HQOA 2OFXA 2VEDA 1S4MA 2W48A 4KFUA 2XQKA 3KQLA 3JVEA 1DINA 2H2WA 3H94A 1D0VA 2FA9A 1F9AA 3KDSE 3VO8A 1OT5A 4ZCLA 5JRDS 2HLNA 5ISMA 1TMOA 3BEOA 4JYZA 1J8FA 4GVXA 5JDIC 1H6AA 4W5JA 2HL6A 1I8TA 1PW5A 4W5WA 2RGCA 4D9KA 3S1LA 3KP1A 4IINA 3BA6A 4IHJA 3D6MA 4LOLA 5L46A 2B78A 5ICSA 2O5CA 2BZ1A 2IUYA 4ISBA 3TW8B 1RYNA 1IJEA 1TT7A 4F5ZA 1GUDA 4PANA 3WMGA 1E64A 1J8DA 2G9UA 2ZIVB 3JARA 4Q0MA 4TSKA 4Z0HO 2CT8A 2PVPA 4REOA 4GL2A 2G36A 1P62B 1H42A 5LB4A 1CY8A 1M0WA 3OFKA 1Q91A 3N2KB 4HQ0A 1ZN7A 4O2BF 3ZIAD 1CDOA 3HN2A 3O8DA 3ZZMA 4BO4A 1EEHA 4C4SA 1SBTA 1JKJA 3FG9A 2JBAB 4GGPA 4QPZA 1JR3E 4MPJA 1XTIA 4YI5A 3R7SA 2ADMA 1PIWA 3D0OA 3P9NA 4MR7A 2FZKA 1YJXA 3LX8A 3OEYA 4L9RA 1NMQA 2ZUBA 1KZ9A 1IZYA 4H4EA 1G4UR 4X1YA 3RY8A 4C0BA 1C29B 3ZDZB 1YE8A 2IYFA 2XCOA 4FZVA 2VNAA 3TGPA 1UC8A 2IOFA 3FYTA 1HYEA 1UDRA 2GXSA 3W8FA 1B6SA 3GJYA 5TX7A 2H48A 5C7OO 2VPZA 3GEDA 2HYIC 3QEJA 4R8KA 4DUGD 5DX8A 1UM8A 2QY6A 1NMXA 4QUBA 2JASA 2RARA 3OZBA 4DLBA 4L15A 5DZSA 3RD5A 4CMKA 5AHKA 1OI7A 4HNUA 1SCIA 3JR7A 3A37A 4HEHA 4E46A 2O8CA 1IG0A 4DZRA 4E21A 1WB4A 2ZU6A 4TS9A 2OCPA 4BVKA 3BWYA 4JELA 1ZRHA 3S3TA 4A1OA 1NG1A 4K8OA 4TSFD 4GKAA 4DCUA 3IAHA 4QBGB 2PGAA 1J49A 5LQDA 2WQ7A 2V7UA 3OZAA 3GLKA 5J59A 2J0EA 2NPOA 2BF4A 3WRWA 4BGUA 1A5ZA 2XUJA 3CF4G 2BKLA 2G1AA 2AXPA 2IHVA 1KY5A 1P8AA 3EN0A 3ITEA 3H0KA 3L06A 1N8KA 5BP7A 4FUTA 3JAKB 3ELWA 3C8UA 1X14A 3H19A 2IWRA 4CKCA 4A8JB 4IIHA 1J0EA 1Z4OA 3GY0A 3LYAA 2HOQA 4MRMA 4X8LA 2J85A 3MTAA 5CFMA 1JIQA 3RUIA 1DGQA 2YMMA 1PSDA 5IULC 1CX9B 4UOQA 1XXLA 3ZXXA 3RADC 1XMXA 1KOGA 3P4UA 5FEMA 3KDPA 3UF0A 2H8GA 4CU2A 1XNRB 1NY6A 3UGQA 1Y80A 2CFRA 5JFGA 3AO0B 4DUZB 2W9XA 3AR2A 4BBZA 4RJTA 5HOQA 4J91A 1BN6A 1NLUA 3OLZA 1JEDA 2DYKA 2H0RA 3QFFA 3RE1A 5FR2A 3AH8A 5C32A 4K9OA 4ZZ3A 3E82A 1U8YA 4MLDA 1W93A 2BGTA 3KAKA 3HVJA 3LQKA 2HRQA 1GJRA 3H2JA 3ZHTA 5JJ5A 1TVEA 3EQ2A 2Q3CA 1E96A 4QO8A 1W46A 2EARA 1LI7A 5DYGA 4D3DA 2R8EA 3ADCA 2F3PA 3VYSB 1GAWA 5FBRB 3ROFA 2PUDA 4JL5A 5BUCA 1A8PA 4O5OA 1XHLA 1R8JA 2CY0A 3LO5A 1P9NA 3N8KA 1COWD 2AJDA 3KWJA 1CQJB 3L7JA 3BSFA 1PE0A 2EV9A 4F72A 1R7RA 4EDFA 3AGQA 1W4LA 4Q9DA 3SZRA 3U9TA 4D41A 4RKWA 4R8LA 2W00A 2H1HA 1RI3A 2CLIB 4FBMA 1H2EA 1YJ8A 3MSXA 3T99A 1BXRA 2FFQA 2Y76A 1YS7A 5LP1A 3AF4A 3UCEA 4ABTA 4S35A 3G5AA 2JF0A 3C6ZA 3IP3A 3VR4D 4Z51A 5C81A 1CS0B 5LR6A 3F7NA 2BH9A 5EUBA 1XMQB 1XD2A 2JAOA 3RT1A 1LKZA 3LO8A 2BBOA 3KHUA 4QBHA 4WDQA 4QARA 4YRNA 5HOEA 1L8AA 3L8HA 3UYLA 1OLUB 1KK1A 4AF7A 2ZFUA 1O4VA 3QFTA 4OTZA 4XM1A 3AK4A 4DIMA 5JXIA 5LQCA 4UHHA 5TB5A 3WKDA 5HR5A 2YOHA 1NJID 1IBSA 2MT9A 3VSDA 1YVUA 1S3SA 4MTCA 3WHIA 4JI7B 4RY8A 4O4IB 3E4DA 3KBOA 1QUEA 4JS0A 2HPVA 4ZDWA 4P25A 3WLAA 1ZSNA 3UOGA 5ELXA 3BH6A 4D4HA 5ICGA 1J5EB 2C82A 3DHNA 3AONB 4QODA 3SS7X 1DMRA 5FUYA 2QD1A 2J9FB 3BCDA 3IQWA 4JYMA 1SWVA 4HGRA 4LY6A 5IT5A 2Z9CA 1J07A 3HJNA 1NNUA 2PUHA 3X1MA 4GS5A 1DAIA 3AM5A 4EATA 2Z2YA 1D3AA 2H2DA 4U6QA 2WP0A 5AFSA 1M0EA 3ZWVA 3QWAA 1K8XB 3K1AB 1CZHA 1Q7BA 3QPBA 1XTRA 1PWHA 1UM9A 1WCXA 2RGEA 3MGBA 1ODLA 4PYOA 2HX1A 2HJGA 3S4YA 3JVUA 2IODA 4L4UA 5AOVA 2QNBA 5HF5A 1JR3D 4B31A 2LR0A 4Q93A 1U2RA 5U4QA 3GA0A 4IQ4A 1TOAA 3P0RA 3GIRA 4WESA 3IKJA 5LQRA 1L9KA 5D3ZA 3FTDA 1H69A 1F51E 2QTMA 3L3BA 3DV2A 4PG7A 4HWPA 2FJPA 4MGZR 2C84A 2QI9C 5AXAA 3A1UA 4CKYA 2HREA 3I53A 4YRDA 3SEJA 1CEEA 1V5IA 3HVUA 4OUDB 1M7BA 1TMGE 4FKBA 2OXCA 3TR5A 5AQ1A 3AOEC 2RGXA 3CNNA 3P2YA 1JPNA 2XXJA 1LWOA 2B6NA 4CNQA 2R8XA 1YI2B 3ISJA 4HJRA 4W5TA 1OBOA 1GL3A 1P2DA 3DVQX 4FHCA 3SSNA 4YUWA 1NQOA 3W34A 2YCBA 5KSOA 1KVUA 3NBFA 2XXBA 4MUIA 4OLFA 3CZCA 1ZS9A 4MVWA 2X85A 3RROA 3WQQA 3OLXA 2VXBA 1IBMB 3ZHUA 3REOA 1W1WA 5C8YF 1F8FA 4KUHA 4MP6A 4JI0B 2GPAA 3CP2A 1NZFA 2LCIA 3WWEA 1W88B 1D04A 2GKOA 3UM9A 3ZI7A 1XQYA 1PLLA 1HI9A 1EFHA 2HA2A 3F5FA 5EVJA 5AIBA 1GR1A 4C6TA 3KXDA 2P78A 5J4YA 1N1EA 1T43A 3MWEB 1LTHR 4UMDA 4AT1A 1YO6A 2Z04A 4RCZA 1XQVA 3AB3A 5AW7A 1NM5A 1UBEA 5T64A 5J4VA 1UP7A 2PXXA 5FB3A 2XNDD 2RJ3A 2OXIA 4MAFA 3LPCA 5L3ZA 3WGKA 1K3UB 2QG9A 2VWPA 4XYGA 1BKYA 3CF6R 1UBJS 4NOMA 5ER9A 3TG2A 3MHPA 1PZXA 2A9QA 2IYOA 2DLDA 5EJ7A 5PGMA 3L6OO 3LXRA 3GFOA 4YT4A 4ZVVA 2XRMA 2QRHA 3KKQA 2I33A 3D8TA 3GJZA 4DMGA 5A62A 1YFKA 4FGLA 4BMPB 4JU9A 3GJ0A 4YB8A 5JVDB 4BFZA 3G79A 3BDIA 5JU6A 1TM2A 4YAEA 2Z1MA 2HN9A 2D3WA 1C1HA 4K0RA 1U9ZA 1DQYA 3V1UA 2HI0A 4YV0A 3QE2A 2BSAA 1A9QA 1Z0DA 1Y6ZA 1I1NA 4KQXA 3HCBA 1W88A 4EDHA 4OOEA 5EWMB 3WQHA 4II7A 4DLTA 2EHDA 3IHWA 4HC4A 4BNIA 2FW1A 2QGFA 1NJGA 3LPMA 1CJUC 3ESAA 4LJYA 1Z4QA 2IU0A 1C4WA 3ASTA 2NZWA 3V5NA 4ETIA 4B3SB 1U63A 4IXWA 3DSRA 5HKBA 3FHLA 1WSDA 3O1JC 3HFGA 1T9GS 5B4TA 4MEAA 4RIEA 4BS9A 2B25A 2E4ZA 1VXOA 1FQOA 3W05A 1SD2A 5CVDA 1BMFA 3V32A 3IH5A 4X1OA 3IP6A 3OZEA 3VU1A 5FI1B 3C3YA 1QH8A 1GN8A 2CK3D 1KXZA 4PSUA 3WGMA 1M2KA 3ZHZA 2V9ZA 2Y67A 2ZBVA 2EL9A 3G6WA 1GRQA 3R9WA 2BFCA 2VJQA 1HDIA 3L0DA 2FMXA 3O0DA 2GF2A 5DEOA 4BYMA 2QM8A 5CDSA 4ALNA 1YITB 3SC3A 3O84A 3LNCA 2P9GA 2NU8B 1N9KA 1ISPA 2JGEA 2GZ1A 1PHPA 5AJTA 1BWQA 1I1QB 1Y7PA 3QPVA 1EE9A 5DI3B 2X0DA 4XLEA 3KPJA 4KV7A 4LYHA 4ALKA 1D8AA 1MO2A 2ZPUA 3GNSA 4H4DA 3KDAA 1QFXA 4M0CA 1QP7A 1M83A 1KDRA 5DTMA 2JGFA 3ZCRA 5D5PA 4WHMA 3A26A 1NOIA 3L02A 5F12A 3CVUA 1ZINA 1JR4A 1FX1A 1GTMA 3AVQA 2J48A 3S8MA 2FSUA 1U0JA 1DBRA 1GTVA 4HUQA 1Z2OX 4KGVA 5CYOA 3JQQA 1Y4ZA 1E8MA 2X1LA 3FCAA 3L43A 3R5KA 4X85A 3W3AA 2VHCA 2AR9A 4KO1S 4GSLA 3I05A 2HLPA 4PXYA 4GBMA 1ZMTA 3B5EA 4JJZA 4RIFA 1S2NA 4W6QA 3BC1A 4UJ5A 3ZCQA 2QU8A 3CRW1 2ZUSA 3Q12A 4F7DA 3RARA 4KMSA 1E7QA 4YJ2A 1Z6ZA 1C1XA 2UAGA 2Z4SA 3LGXA 1GL6A 2C3YA 3CXCB 4ZA2A 3WYDA 4I50B 5FLKA 5I9SA 3OKFA 5J2TF 3QUQA 2Z4RA 3VGPA 5IKXA 4OPVA 1Y9DA 4R98A 3C3AA 1LPBB 1G5QA 2ZATA 3W6ZA 4MS1B 1P1CA 4ZP1A 4CNBA 4NESA 2HXSA 3ZVLA 1CDEA 4LKRA 4MPTA 4UTXA 4MV4A 1P77A 5CBPA 3PQ3A 2FG6C 4L5YA 2F67A 1BFKA 1UDXA 3OCWA 1LBIA 1YZHA 4UNNA 3YASA 4NE2A 2L2QA 2W2VA 4YQEA 3SK0A 4AWBA 3ETDA 1R0ZA 4QYWA 2I65A 5K0FA 3ZWNA 3HXQA 3ZJTA 3Q6MA 3FE2A 4DFDA 3NT2A 5BSGA 4N76A 4ZCIA 4D6XA 5EE5B 3QPDA 1J7JA 1UPCA 1JB1A 2HK7A 2FKNA 3ZS9A 2V58A 2I80A 2IVFA 5CP8A 3T5TA 2J3DA 3GRZA 1MXFA 4MWSA 4GNRA 4BVBA 4MW6A 1CQJA 2HBRA 4R2XA 4X20B 2YV2A 1OXTA 1XN1A 4Z4ZA 1RRCA 2Z8YA 1C7RA 1EFRA 3L9WA 4MV0A 2H4ZA 2ZRCA 1GGKA 2C1XA 4GO1A 3ZY5A 2FEPA 2J0UA 4RMJA 4RTOA 2FOIA 1EBUA 2HHCA 2INGX 1SVLA 3WWZA 4DJ5X 1DXHA 2ZB3A 3LUJA 4CT4B 3ELYA 4RADA 3QX8A 3W8DA 4K9QA 3EXEB 3NGMA 2ZUDA 1K75A 5EIFA 1GTJ1 4J1QA 1XKXA 1ZITA 1VG9B 4TQAA 5IYRA 2YY7A 4MB2A 4LF8B 2FH5B 1G2PA 2BBSA 2RH4A 3VNBA 2I6XA 1E58A 2G3YA 3C7KA 2VBGA 4KODA 4YP6A 3OEEA 2JKZA 2P6MA 1IJFA 3NBAA 3PGXA 3R5HA 4GPD1 5EJ4A 2WQ6A 1TZJA 1EE1A 5HEKA 1V35A 2CL0X 4IS2A 2QN6A 1ZFNA 3V1YA 1ZKMA 2FCRA 1EK1A 2PQ6A 3A8TA 3K0KA 4CKCB 5LQUA 2JGLA 3GJ8A 3JR3A 3PFWO 5CVVA 3KSUA 3BJZA 5TEWA 4DR5B 3NM4A 1SOMA 2QKYA 1KYWA 3BXPA 4QJ3A 1PGJA 3D6AA 3DAYA 2XE4A 2QJFA 4A1FA 2XE7A 4ARBA 2NQ2C 4LOAA 2GTPA 3CUSA 3OX4A 5T8KC 1DAFA 1JBQA 4Y9TA 4NK4A 1YKSA 2XSZD 1X39A 5E6SB 3T51B 3CLTC 1FVFA 2G5CA 3PXEA 4HEA1 1XTUA 3QSYA 5BSUA 3DOIA 3G8AA 5BO5A 1MEEA 2LRHA 3SICE 2IHBA 1QVFB 1SK9A 3OOYA 4IVNA 3RS7A 3ANLA 3WWCA 1M1XB 5DXJA 1KIFA 4R40A 5FWAA 4ZYLA 1D1NA 3B1KA 4G1EB 4DARA 2F4VB 4HD8A 2JVJA 1K4MA 5A88A 4MVJH 1IE3A 1U0EA 2D5AA 2UYHA 4FVTA 3EFHA 2CNNA 1FNSA 1N57A 1P4HA 2P41A 4Q3EA 2IPAB 3W04A 1W5FA 4X61A 4AY6A 2FWPA 4MV5A 3ASQA 3IOYA 3MMXA 4EGSA 3LX4A 4XVRA 4GPTA 3ER9A 1U31A 1HY3A 4C7XA 3MGAA 3FJOA 3VZSA 2F48A 2PSJA 2N47A 4F4JA 1DCTA 4UNSA 3K72B 4EPVA 4NU0A 2ZE5A 4WASA 5D87A 4AUMA 3VNAA 1T2CA 3GN2A 1RTKA 3CESA 1U0GA 5C7IO 4G0UA 2YJ5A 4DA8A 4FMDB 2OGTA 2DC1A 2NT4A 3BULA 3PHIA 1XZBA 2W6JD 4PGGA 4RV4A 1DDOA 3K1AA 4ZEVA 2FDRA 5E6TA 1AK9A 2HQSA 4Q15A 1YT5A 1XUOA 5TMBA 1PJSA 2DTDA 3ZWMA 4E13A 1JKIA 1ELOA 3QI2A 1TE2A 4RF4A 4L5BA 3NXSA 1AQYA 5CFOA 3I0ZA 3JQBC 1E6MA 1KY2A 5SZJA 1GA1A 5IN5A 2BE9A 2ZTHA 1FY2A 3MTQA 5FA6A 2JK0A 3LUGA 4DT1B 1J0XO 4MCJA 1QQBA 3GLFA 3PICA 2EW2A 2WHEA 3SMQA 3NTVA 3E70C 1EA7A 3KWLA 1DCFA 4IPTA 3U7EB 4N1AA 1W1UA 6ADHA 5HSGA 5DP2A 4O4LF 4RANA 4U7PB 3ZDYB 4CKXA 1KIAA 1F2TB 1U65A 5E3JA 1THZA 2O5RA 4CMBA 3GRRA 2D4AA 3GLTA 2DPMA 2PQMA 4QHTA 1NUQA 1AXRA 1VKHA 2ST1A 3IALA 1ZG3A 4FXUA 1WY7A 4I55F 4U8HA 4UCWA 4IX1A 4DLKA 5TV2A 1XRNA 1UZLA 2IXDA 3EIOA 4JCCA 3RBZA 1VE1A 3F7OA 1GGNA 1M34E 1XDSA 4V03A 1QX3A 1SA0A 2MSDB 4IDDA 2Q8PA 1Y3FE 4UHDA 1KP3A 2OHHA 2P65A 3L8YA 5IANA 4NCIA 2W70A 3UFXB 4N8SA 1BXRB 3T94A 3I2GA 1IQPA 2IDZA 5KYUB 4NNOA 2Y4OA 2ZU0C 3OURA 4FJ2A 1NVTA 1N2CE 4K6FA 2XTAA 3LUHA 2WU3A 1L6IA 3KCQA 3NORA 4QXAA 5EIBC 4CM9A 2IH4A 3GLFE 1NUHA 4EQ6B 1D07A 4E31A 1X19A 3UMJA 1QH1A 5CA0A 2FQYA 2JGRA 1ZW1A 2WD8A 4DS3A 1J09A 3KJZA 3AL2A 3R3JA 4I4TB 4LHSA 4B40A 4Y9RA 3FPLA 2EKZA 5AESA 1MOQA 1Q0TA 3DOFA 5CH8A 2OPBA 3PUZA 3FCOA 2BELA 1ZCJA 4L16A 1P4RA 3KZNA 2BMFA 1IATA 4R2LA 3S70A 3ZQJA 4YCSA 4JOBA 1CS4C 2H2AA 4KYUA 1CEYA 1F8XA 1NXTA 1YASA 3KTAB 3N6XA 4PX5A 5IC4A 1VJ1A 4I6GA 5CH5A 1D6MA 4RM3A 4ZCSA 5WRFA 4HPWA 3OCYA 4J1TC 2YW2A 5AOBA 5K0SA 2RHGB 4J0GA 2I78A 2C7QA 4AK9A 1C3LA 1SZJG 1ZOLA 2PX6A 3AYXB 5YASA 4EYKA 2FFHA 5FOWA 3V76A 2VTVA 1N3YA 3EEOA 3EXIA 5JS2A 4JC0A 1CRLA 4QQRA 1HE3A 2GCOB 5KVVA 4YBRA 2VWHA 5A3RA 3F67A 3JZFA 4B74A 2Y2VA 3IQDB 5CMLA 1MVNA 2QGGA 4JBLA 4JP1A 2XBLA 4QHSA 4X93A 4GUAA 1R6DA 4D45A 1EI9A 2UKDA 2H9IA 1E5LA 1NF3A 2Q3DA 4DB4A 3A4NA 3MFYA 2BGLA 4ZAYA 2OO7A 2XNJA 2N3ZA 3DGFC 2P3OA 4XYBA 4MKXA 4LHYA 5ARCA 4PHHA 3SF8A 1FW6A 1O3YA 1QRAA 2FF7A 3SP1A 3M2TA 1WEKA 1IEVA 4JBYA 4I0WB 4E94A 1QG6A 2IU3A 3PC8C 3R77A 2VSXA 4V0SA 3B20A 2JFFA 2JS7A 4MW2A 2ZZNA 1YRWA 5HW0A 3EG5A 4PNZA 3CCFA 2GHRA 1UPAA 3BE5A 4MUJA 4OI4A 4RGYA 4RK6A 4C89A 1F0PA 4PXAA 5L6MB 5B3JC 4RY2A 1J33A 1FFDA 3CONA 3FVTA 2VYQA 3DPIA 1GSHA 2H4WA 4XJVA 1U6IA 3B6MA 4N65A 4KVZA 4DG8A 3KTOA 2XKAA 4QTXA 4WEQA 4X1YB 5JV5A 1XU9A 3HQ4O 4QFCA 3VR0A 4D9IA 1T6ZA 4KG7A 4DG9A 3NWOA 5BOSB 1EVJA 1OTXA 1UWVA 3H3XA 2CUNA 3UK0A 2H18A 4X24A 2PMEA 4L9AA 2Z4TA 4YUAA 1T4BA 2C9MA 1Y1SA 1YC2A 2G08A 2ZAMA 4BO6A 3BXGA 2GN4A 1XJWA 3DMDA 1KK3A 2YZGA 3I37X 2XA1A 3A4MA 2QL7A 1GUFA 3EDQA 4ER0A 1IN5A 3NYWA 3D4BA 1T6BY 4FWTA 2G04A 2R5WA 4GHWA 5EXTA 2CFIA 2H4YA 3L8ZA 1J9ZA 1XQWA 4ESVA 1OI2A 5DXFA 1K9VF 2QNRA 2X6TA 2DBRA 3SXPA 2QI9F 1CKEA 4FBGA 4B2IA 4M1SA 3SSOA 3PD0A 1LFDB 1WXWA 3GCZA 4XEUA 4HBGA 5BPHA 1U6KA 1TEHA 2WW8A 3I09A 3IBFA 4JY7A 2JG3A 1PGOA 4FN4A 4DMUB 1MQAA 2PXHA 2C03A 2W71A 2WWHA 4KQHA 1IHDA 1X3LA 2NO1A 3AW8A 5IZCC 3D54D 4PC6A 4RTPA 1GCOA 1ACMA 2O4UX 3AR5A 3LQ2A 2GB4A 1XWFA 4MLPA 4Y0NA 4BGDA 1U4OA 2W0MA 1W0CA 1LQ2A 3NDJA 5KYWB 2V3CC 1M2NA 2VXCA 2CCGA 2J32A 3VO2A 2O7VA 4RY0A 3EX7C 1YD7A 1KERA 4J29A 4XIYA 3TLGA 5L40A 1EFDN 4WN9A 2B4RO 5ABPA 1OU4A 1UT8A 5DBOA 3U4DA 1NFFA 2XQIA 4MWCA 2BF7A 5TEVA 2FZEA 4B9EA 2OC9A 3T4EA 4CM5A 2AHOA 2GSDA 3TIIA 3KE8A 2PWBA 4J1TA 3SR4A 2YQZA 4GXTA 3C7AA 3ZWXA 4EAQA 3Q5DA 4TT3D 1G38A 4MA5A 1Z5OA 3KEMA 1H2YA 4KDRA 1IZ0A 1YVPA 3OU2A 4E2ZA 4KMRA 3CB2A 4I5EA 2FDCA 3TI7A 3K6SA 4MGKR 1BZYA 3WYNA 1VG1A 2BCJQ 2WK1A 4BJ5A 3EGXB 1NLFA 5FWYA 1QUFA 1L4FA 1P2FA 2PAAA 1G7RA 2IZ7A 5T8KA 1KQFA 1Y4UA 3QKWA 5JASA 2AFHE 1DT5A 3B9RA 2E6KA 2LXNA 1IVYA 1FFHA 3QFHA 3PNKA 5DF1A 2MJLA 2XH8A 4PYKA 5BWLA 4LTDA 3QVGA 2KVOA 1QO7A 4AZVA 2AC2A 4NYJR 5LD2C 1NTRA 1UZMA 4Q9AA 3UJAA 1JA1A 3FZYA 3BHJA 3K31A 3PNPA 1CZKA 2ORYA 3CZ4A 1ORVA 1PX0A 3IBSA 2FR8C 1B41A 3SXUB 1FOEB 4JK3A 3LWNA 3GLGE 4W5NA 3D7RA 2VDNB 3BCSA 2PL5A 3I1JA 3KUCA 3PQDA 5AJXA 5EUQB 3OJWA 1PRYA 3TLBA 4O4JF 4RD1A 1YTUA 5AVOA 4C4AA 2CLEB 4P9SA 3F9CA 3QV1A 3W9YA 2YWXA 2BE7A 4BRWA 2PA3A 3FLAA 3FROA 1ES9A 4RA6A 1K73D 1DV2A 2KM1A 4OHKA 3QXJA 4D25A 1RLOA 1T4DA 1XCPA 2YHIA 1B8UA 4ITUA 1T9KA 4ASUA 1WP6A 3EDCA 4A8PA 1DC7A 3TN7A 3NVDA 1K7EB 1J4AA 3RYFA 2R6FA 1LRJA 1CTQA 2FE4A 3A9RA 1S8NA 1E3TA 5MGNA 2G06A 1VECA 2QXUA 3KZXA 1RACA 3FUUA 3LXMA 3MEQA 4NULA 1MH1A 1YMQA 4ZEOA 3A1DA 3UUGA 3WDSA 1VYHA 1N5OX 4X9XA 1Q2XA 2OXRA 2W58A 4X00A 3BMXA 3O21A 3UJ8A 1CBUA 2FQ1A 5G1OA 5GVRA 5C37A 2ADOA 2ZYSA 1DAKA 4XB6B 1KI9A 2HMTA 1AN0A 3B48A 1G1AA 3R0VA 3MPUA 4IIJA 3A9WA 4PCUA 5CPBA 3RK4A 4NRDA 4A0GA 4BO0A 2W5UA 2BYTA 4PFSA 10MHA 4HNQA 5EJFA 2ONJA 5KEIA 5JXHA 3NHUA 4MHOA 4ONEA 3QELA 3O9ZA 2A7QA 4I9NA 3H4MA 5IM5A 1N1DA 4OHRA 3C24A 3BDAA 1OXMA 2VJMB 3EXG1 1QQ6A 2UDPA 4MWEA 4AJ4A 5F9MA 2JLXA 3EH2A 4DR3B 3K5PA 3DHYA 3AI7A 1K9MD 1K7CA 1E7WA 5CX1A 3BM5A 4Q4JA 2J08A 2QN7A 4G9GA 2EJTA 3EY9A 3LA6A 1E1RD 4QUKA 1VQ4B 5FAXA 4NCKA 8ABPA 2ONKA 3ZW9A 1HLPA 4LF7B 1WQ4A 3JXEA 1RFLA 1TGYA 2NZJA 3TXAA 2C7VA 1EZ4A 3EDOA 1UCFA 3RGWS 1VQ6B 1HL7A 5IJXA 3IQFA 4R4JA 4X63A 5KX5F 3Q8XB 3GGPA 1VHLA 1U2EA 3C4VA 3Q9SA 2M6RA 4QUAA 2VPTA 2XVZA 4L2IA 3H16A 1D1TA 4HN9A 1UJ6A 4OMCA 4OPSA 3K2QA 4WY8A 3VC2A 4F4FA 3H18A 5DIZA 3WSTA 1A76A 2Y27A 1N2HA 4N7BA 4G0OA 5T6BA 1CUBA 4Z54A 2VYCA 5IC5A 3W3AD 1N9GA 1GFSA 2NX2A 4TV8F 4GLOA 1T6YA 2VBIA 3L1JA 2Q29A 4QDKA 5ESRA 5JLAA 4KR9A 2XGMA 1J70A 4NFLA 3OSZA 3EVFA 4PAOA 1NI3A 1XRJA 2ODPA 1W9XA 1VLYA 2PGNA 4JP2A 2X6XA 4AN1A 3AFHA 4W7SA 1JI0A 3GDHA 4XB2A 1DTSA 1U8UA 4JXZA 3CLRD 3SM3A 1BD3A 1GD1O 5B57C 1YUNA 3H9CA 1AS0A 3MJHA 1N6HA 1OJLA 3M1AA 4MI6A 1T0UA 3B3JA 3V2GA 3KK0A 3QLUC 4HAOA 1UWCA 3WMEA 3ZWKA 1NNSA 2AJTA 1OT3A 1U2GC 4XPIB 1CUJA 1PZEA 3HN7A 1IC6A 4RFLA 2REQA 3LHFA 1Q7GA 4KJXA 3AVWA 5JJCA 1M3SA 2R7MA 2W6OA 4R1PA 1OF1A 1EFAA 4XLLA 5J2TA 1DIOB 4F3NA 4IILA 4YMHA 1FNBA 1E32A 3P0HA 4MCHA 1WPCA 1A69A 3GUCA 4W99A 2WAYA 5B4UA 4DLUA 4WLEA 4D82A 3F98A 3RJMA 4D26A 1IHYA 2X5NA 1NVWQ 2N1BA 3N87A 3ETGA 3MGGA 4DJJA 5C9ZA 2IH2A 2VJMA 4LRSB 1QHHB 4HGZA 3P0EA 5DGHA 3D8SA 2ZYHA 4FS8A 4G5SA 1IDN1 4IKEA 5DO9A 2Y6UA 4CCSA 1OU0A 1Y4SA 2AR0A 4IXMA 4ER7A 5KTTA 2VI5A 4MLCA 3JD3A 3NJRA 4H27A 5D5HA 4H1TA 1T0IA 2WVAA 3UFBA 3T7IA 4K40A 4EG6A 5LUBA 3HJTA 2ZTLA 3QLVA 5C1OA 1JXOA 2IYSA 1W4AA 1W36C 1NKVA 3UCFA 4FMCB 3IS3A 2V6BA 4D9NA 1W36D 1EDZA 3OZIA 3ILYA 3TW6A 4ITRC 3WMWA 4EYGA 2GD0A 2VO1A 3JD1A 3MCAA 1KTVA 1J8VA 2BRUA 3FPFA 4JGGA 4A8JC 3I23A 3PHCA 5CYGA 2JKYA 2YWHA 4YELA 1N4DA 1XROA 2AZMA 4EHHA 2F8SA 4XFJA 3ZLUA 5I7VA 3AF3A 1YQGA 3K2EA 2QX6A 2WIJA 3G0IA 3VTAA 5JH7B 3VTKA 1VYUA 1JJIA 3NKVA 1Z08A 2C98A 4MW5A 3PL5A 4WTOA 1X1DA 3A9CA 3I2HA 4MP3A 1C8LA 1KBOA 1JVSA 2HDOA 1HMPA 3BHIA 3CEAA 3I4LA 2C8VA 5AKXA 4OHMA 5EWJB 2CDAA 4B6GA 1Y3DE 2PMWB 4KQCA 3OCUA 4QG7A 3OQ1A 2VL7A 5G2OA 4V24A 3SMVA 1N2OA 4A7PA 3DWGA 3Q7IA 3HLTA 2BEVB 4PTZA 1KFKB 2BZGA 3QUCA 5BSWA 1VL8A 1HTWA 4YJ2F 3T54A 2ZR9A 2ZM6B 2VPIA 3EA0A 1ZD5A 3OPYB 2A78A 4MWOA 3R3UA 4OH7A 3DG9A 4CTKA 1UK6A 1BMFD 1PHRA 4IFEA 2A94A 3ISXA 4HWRA 2ANCA 5HF9A 3SEQA 1PI3A 2P5YA 2XGSA 2YIJA 1CUVA 1M2GA 3EVAA 4CKWA 1S8FA 4FCTA 4RSRA 3TRKA 5AHWA 3WFZA 1DOHA 4PYQA 3QOXA 5A9RA 5HXBA 4HZUB 2X3YA 3FHCB 4IIXA 4DUPA 1QV7A 2ATCA 2HDHA 4KOEC 4HN4B 4PHGA 3MXTA 1B26A 2F9MA 4MITA 2VCHA 4RMNA 2R5NA 2Z3WA 4UHBA 4NBSA 1DPFA 3DEAA 3EIXA 1ISFA 1IU9A 1XV5A 4J2OA 4RESA 3TW4A 3MWDB 2JAWA 1UOQA 2WUGA 3BIXA 1Z9BA 2G25A 2X77A 5MN5A 4PZ0A 2AZ4A 3B5IA 4P3NA 2B5VA 4URFA 4ZVKA 3BRWA 5TJHA 1SIWA 4KKUA 1ECBA 1X8KA 3TMAA 2O3TA 3MBKA 4PY2A 1H4VB 1QIMA 2X9LA 4MRAA 3L7AA 3FX2A 4U39A 3ORFA 4RJIA 1EM8A 5JHHB 1CZRA 1GDHA 4KB5A 2IEYA 1C7IA 4IF6A 4BXOB 1AJEA 2M1XA 3IPRA 4G6IA 2AOWA 1RYEA 2P9ZA 3TR0A 2BMDA 4HMOA 1DARA 4QASA 4QOEA 2H6EA 1QTNA 1HQDA 4LC9A 2W4IA 4BMOB 3RTGA 3ICWA 2BUCA 3COWA 3IA7A 3C85A 1OC2A 4IDGA 5LMNB 1E77A 4EARA 5C1PA 2IYZA 1U2GA 3M81A 1GXSA 3MT0A 2V5AA 2NYVA 2W6ZA 3GJSA 3H11A 2M6KA 4E4RA 3T1YB 1Q0SA 4AP9A 5CEEA 1NKSA 1XZAA 3GMSA 4H35A 4UUPA 4ERNA 3U16A 1NXWA 4ND8B 1ZNXA 2CGEA 1WLYA 3LHDA 4A91A 3OOCA 4M9XA 1CZNA 5BSTA 5DHPA 4TS4A 4Q18A 3DUFA 5EPEA 4J3NA 1U1IA 4EG5A 2QAGB 2IPMA 3MWJA 3RSSA 1P9RA 1D4FA 4Q9KA 4J6EA 1EEXB 2BOVA 2Q5FA 1ADJA 3RYTC 4CLRA 2YW9A 4I9FA 3ISVA 1JHOA 4KQIA 3PGLA 1BJTA 1NONA 2NO6A 3LP6A 5B1DA 4DJDC 1NSTA 3R9IA 3WIBA 4K9KA 1NVDA 3VI3B 5IWCA 2DBVO 2PRKA 3CSUA 4IYRA 1AB5A 1U3CA 2WUWE 2CYCA 4O59O 4PLGA 3DT9A 2ZRDA 3OFND 5FO1A 2HLHA 3ANMA 3FKSD 3R3WA 2AW5A 3R4VA 3AIOA 4J7XA 1RXEA 2C3UA 3R3XA 4MRNA 4QUEA 3CX7A 3GVCA 4E33A 5AW2A 4DM7A 3FUTA 1ZN9A 3NOVA 5BVHB 1TLTA 1JR3A 1Z62A 3CSSA 1IQRA 2VBTA 1QB8A 4BL5A 1QRSA 1OH7A 3AUTA 3GROA 1YQ9A 4M4SA 1XPJA 2Y1WA 3F3YA 2EVWX 3PIIA 1WPGA 4I2VA 4L22A 1IWBB 1ZK1A 3K30A 4OQZA 4PPGA 3DYBA 4RPJA 4JLKA 3AKDA 3UB3A 1WP4A 1E1CA 2PKXA 3O4VA 1YDEA 1C50A 4H7HA 4M36A 4FB5A 2ZUEA 1GRRA 2W8ZA 1G3UA 1SKYE 4FYPA 1Y8ZA 1VI6A 2GEJA 4IOJA 3OIUA 4PRZA 2WT4A 4WY5A 4PLFA 3VH3A 1VHOA 1ISHA 2WNIA 3GUVA 2OBTA 2O2CA 2F1MA 3CCMB 1J2TA 3PRJA 1P7YA 3B78A 3MW8A 4PHCA 2W6QA 4ZI7F 1TTQB 3RANA 3AM1A 4WLNA 1RM4A 2GOYA 5GGXA 2BR5A 3U40A 2BGGA 2YUIA 1X80B 5TS2A 2PK3A 1YJ9B 4RGBA 3ICPA 4IHKA 4UUOA 4OQQA 4OJNA 2Q5EA 4MW0A 1VJ5A 1ZIXA 3NTQA 1C7JA 3SSMA 3D3QA 4WCFC 2JJMA 4MJLA 2GCOA 1L7BA 4NYMR 3GRVA