2BMWA

Ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bmwA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bmwA02
3OZVA 4YAOA 1G7TA 2GPJA 1ZM3A 3P27A 2HDNB 1S0UA 2D74A 2QN6A 1GVHA 2RC5A 1VQ7B 1IJFA 2NPFA 1KJZA 1W87A 3OZWA 3OJXA 2VZLA 4N3NA 3LYUA 2BMWA 1JB9A 4MYUA 2J7KA 4PC7A 1F20A 1TVCA 1Q86D 3I1FA 5GV8A 1R5BA 1KC8D 4F7DA 1OB5A 4M1KA 2BM0A 5H59A 4Y9RA 2XNJA 1QX4A 1EFCA 2DCUA 3AVVA 4RD4A 4YHBA 1G7CA 4NBSA 2E1RA 3E20A 4LBYA 3CXCB 3CB4A 3WXMA 4BPRA 1AMOA 1G7RA 2QEXB 3CC7B 1R5NA 3MMPA 1GAQA 1VQ5B 1EFUA 3OZUA 2VNHA 3CCMB 1Q82D 1DDIA 4YAFA 3VNUA 4M2LA 3CMAB 5TV2A 1W34A 3V76A 2EFGA 1YI2B 3CD6B 5HXBA 1N8RD 2DERA 2DEUA 4G1VA 4P3YA 2QMUA 3QFTA 4K1XA 3FJOA 4DQKA 1J9ZA 1KK1A 4FN5A 1OGIA 3ZC3A 3I55B 3QE2A 4ZCIA 2PLFA 1QFYA 4HE6A 4ZCMA 4PGOA 1FNBA 2YWGA 4G1BA 2C78A 1B2RA 2BGIA 3JQPA 4ZGNB 3CPWB 1EWYA 2BGJA 1Q7YD 1XE1A 3OW2B 4NCNA 1YJ9B 1YJWB 1H42A 1TLLA 4AF7A 1EP2B 1ELOA 1G7SA 1VQ6B 4QHYA 1N0VC 2BV3A 4PC1A 3CCSB 1YIJB 1VQKB 2YWEA 1DARA 2HCJB 4B48A 3MCAA 3U2QA 5JBQA 1NDHA 1VQ8B 1VQ9B 4Y7CA 1VQLB 4IW3B 1VQOB 2QA4B 3FPKA 4HE5A 5H5JA 3CC2B 1UMKA 2BPOA 3WBKA 2XEXA 1F60A 1XB2A 2B5OA 1BX0A 3CW2A 4WQMA 1BJKA 4ACBA 3P26A 4B47A 4H9GA 1GO2A 3W2HA 2BVNA 1KK2A 3AVYA 1YJNB 2CNDA 1KK3A 3QFSA 1D1NA 3CCUB 1W35A 2B7CA 1CNFA 1DDGA 1KK0A 2GQFA 1KQSB 2OK8A 3G71B 3CCRB 4RJLA 3WYAA 1QGAA 3W2FA 5FA6A 3U6KA 4YALA 4LC0A 1QFJA 3WNDA 3VNVA 2OTLB 1QGYA 4ZGQB 1E63A 1QUEA 1N0UA 1K9MD 1FDRA 1GR1A 1ZUNB 5AN9A 2BM1A 2OTJB 1YHQB 4LBVA 3ZBUA 4M0LA 4PC3A 2X3UA 2C77A 1M1KD 3E1YE 2BSAA 1SM4A 1VQ4B 3W5VA 3ZZTA 4PC6A 3W2GA 4TMTA 1W2BB 1KTVA 5THXA 3CRZA 1BX1A 1JA0A 2XNCA 1ZM9A 1EXMA 1VQMB 5EMNA 3AGPA 3J81k 1FRNA 4B44A 3JQRA 1QH0A 3JQQA 4P6VF 3LRXA 4MYTA 3QFRA 1ZM4A 1QFZA 1ZM2A 1E64A 2OK7A 1JJ2B 4U9UA 4UAJA 3W2IA 4R71A 3SJZA 1JNYA 3I56B 1JA1A 3ZZUA 1TUIA 4LBZA 3QFCA 1CNEA 1WDTA 3PENA 3WNBA 4FWTA 2YWHA 4B4DA 1DG1G 4RD6A 3CCLB 1U2RA 3W5HA 3A1FA 3OJWA 2FX3A 2VNJA 1GAWA 4TMWA 1EP3B 1H85A 4YAWA 1FNCA 4N3GA 2YWFA 1FNMA 2PIAA 3AVUA 3ES9A 2DETA 2RC6A 4AC9A 4PC2A 3ZZ0A 4RCYA 3ZBTA 3MHPA 1TTTA 2AHOA 1EP1B 1BQEA 5TR9A 3LO8A 1OB2A 4J0QA 1QG0A 4M4SA 1QUFA 4M53A 4ACAA 3CCEB 1EFTA 1VQNB 2BN4A 2PMDA 4TN1A 4LBWA 1D8TA 1FNDA 1IJEA 1E62A 3WBJA 3QSYA 1NJID 2EIXA 3CCVB 1R5OA 4AF6A 4B3XA 1QVFB 4C0SA 4C43A 3W5UA 4FK8A 4Q7JB 4TMVA 1B23P 1I7PA 3AGQA 2VNKA 1YITB 4RD2A 4ZCLA 3VO1A 3CMEB 2BF4A 3G4SB 1M90D 3B8HA 2VYQA 3W2EA 3B78A 1GJRA 1S72B 4YAUA 4ZV4A 3AVTA 2B7BA 2ZITA 5TY0A 5DSZA 4EH1A 1VQPB 3G6EB 3VMFA 1D2EA 2HMAA 4TMXA 2CRVA 3B82A 1QVGB 3AVXA 1Q81D 5KSWB 3LVBA 3VO2A 1HA3A 3CCJB 4RD3A 3CC4B 4B43A 3AVWA 1A8PA 1AIPA 4Y9UA 1KRHA 1FRQA 2QTZA 1CQXA 4G5GA 2VNIA 1K73D 1QGZA 2DY1A 1K8AD 1IB0A 4TMZA 4RCZA 2QTLA 4RD1A 3CCQB 3WNCA 4RD0A 1OGJA 4DQLA 1KD1D 1SKQA 3WY9A 4QFMA 5GV7A 2R6HA 2QDXA 3U6BA
chains in the Genus database with same CATH superfamily
4Z3DA 2J46A 1XHFA 2OCPA 2QD1A 1FS6A 2VP0A 3EB9A 5FKJA 2P41A 1FXWA 3QJ5A 4O0LA 4ENQA 4W9MC 2HQBA 4MI9A 4ER3A 1OFTA 4DV2B 2AW5A 4QVKA 1RDFA 3K0KA 1WPQA 3SMVA 4ZCPA 1HYBA 1O3YA 4E2ZA 2I7XA 1EPUA 2V7BA 1SU6A 1S0UA 3H2YA 2CL6X 3L6OO 1PKXA 2GILA 4IJVA 1A9PA 4KN6A 1GVHA 1EZZA 2CVHA 5L9AA 1DGQA 3PFIA 1WTCA 3KP1A 1I51A 3HCPA 3PRKE 3QX9A 4POOA 4W7HA 1CY1A 1WY5A 2VL7A 5HMLA 1R6XA 5L7WA 4KDCA 4RTSA 3KQUA 3JQAB 2FB9A 4UVGA 5NULA 5IM4A 3HNPA 1JAHA 1VE1A 3EZ2A 3KT6A 4I9FA 2ZRQA 2ZRJA 5GJVC 2ZS9A 2VZLA 3FI9A 4ZGBA 5E95A 6GPBA 2OOKA 4PZCA 3M3PA 2YXDA 3NP7A 4E51A 5T64A 1G8FA 4LZNA 5BYJA 3ACDA 1IBLB 4LMBA 1MOSA 2JIDA 1GIAA 3RSCA 4V0OA 2NTVA 5CNMA 1KDYA 4BVHA 1B8NA 1TPZA 4RXTA 4D41A 6ABPA 2VUTA 2ZJ3A 3LBNA 3TPFA 4RAQA 2AB0A 1UBGA 5J47A 4W8OA 3EZYA 3RUIA 2H8GA 2O6LA 1A4RA 1PFYA 3OEHD 4R31A 2DSNA 2E6UX 4JSTA 1F0NA 2DECA 4WN9A 2QR2A 3NAZA 4UFPA 2WB4A 3B5EA 1SNYA 1II9A 1E99A 4Q24A 5HDQA 5CG1A 4Q4JA 1QRDA 4I81A 1SUAA 3Q87B 1D2CA 1GZ4A 2Q5HA 1HLDA 2WUGA 1T8RA 4ENPA 5CA1B 3KKLA 2G0NA 1QHXA 2AEMA 4HFNA 3V2HA 4M60A 3F2IA 2OHJA 3F9CA 1D6NA 5DYYA 2FWPA 3C87A 4J7AA 4EPRA 5DOVA 3F78A 4NBSA 4J1QA 5EWJA 3C1TA 2F59A 2VA9A 3LPLA 1GUDA 5G0WA 3ER6A 5JARA 1I2ZA 1BXGA 4PXSA 3TDMA 2G1KA 2ZB7A 3L7BA 4MQFA 1BHO1 2TMKA 4F45A 2V31A 1M1NA 1NGSA 2SCUA 4BAUA 1GYRA 3QSGA 2O57A 3T9BA 1I30A 1WTAA 2ZUDA 3M4NA 4L2IB 4MWTA 3GW8A 1REQA 1ZINA 1EFUA 2QJFA 4K0RA 3GJ4A 5CYPA 2ZQYA 2VQ6A 2YJ6A 3LY9A 3WQRA 3UKJA 2BISA 3CCMB 1EH5A 3W1WA 4BNNA 2QUAA 5C8DA 3ENVA 3GLGA 5ILQA 5EIFA 1R9GA 3RVMA 1HG1A 3ILHA 2A9JA 1IE3A 3GGPA 3BY2A 3F4LA 1RR6A 4P6YA 2ZXUA 2VPIA 1HDZA 3AVPA 1C4WA 1L5HB 2LDBA 2UVPA 4L7QA 4ZV7A 3NAMA 3QELB 4G07A 4EUFA 1PT7A 3SWWA 7ABPA 2VDJA 4MARA 2WWHA 4FONA 4K1XA 3BRWD 1RI2A 4D5GA 1M6WA 2CWDA 4QATA 5E6SA 5JR3A 3ONWA 2BCJQ 2NAFA 1KK1A 5DNWA 2CHGA 1Q0UA 5E3JA 4KXUA 4BNDA 1KERA 3PEUA 4HD8A 1Q0LA 3CPJB 1WB4A 4G5SA 5FV4A 4ZCIA 3R3UA 1I2MA 3D2CA 4B09A 1WF3A 4KDRA 4G5HA 5DWQA 3PZBA 1U0NA 3GPIA 5EXDA 1VJ1A 2OCLA 5AXCA 1B2RA 4M7OA 5KEIA 3CPWB 1JEDA 1SG6A 4J7UA 4NEQA 1D0SA 1VJ0A 2NVOA 3ZHYA 3UV7A 4JA2A 1Y0YA 1OLUA 4DNFA 3DCJA 3SLNA 1TLLA 4EA6A 3ER8A 1HFJA 1XCLA 5KNDD 1YS7A 5B37A 4Q16A 3IIIA 1JEYB 4ES6A 3F7TA 4BQPA 1A8HA 1N8KA 1RLTA 2X3FA 2XE4A 2ZJFA 1JXMA 3E53A 3GV0A 4BX9A 2CJWA 4D3ZA 2WRZA 3NXSA 4J16A 2H00A 2P4EA 4W82A 5EY5B 3GOQA 1QIFA 3EC2A 1J7KA 3JZMA 5CURA 2ZDQA 3ZDQA 2VRCA 4DMLA 2HMUA 3U56A 1VQ8B 3KWFA 2QV0A 1CT9A 5GZ6A 1RAFA 4FIDA 4E5KA 2VF5X 3L7AA 1DMSA 1E3JA 3WOHA 3WZMA 4L3VA 2GAAA 4NR0A 1KTIA 3EUWA 3A9VA 5D3KA 1IC6A 2QN2A 1ESNA 3UK6A 4FHDA 2GDJA 1DQPA 1L7AA 1NXWA 2HK7A 2IYYA 1WNTA 1ZGBA 3LQ2A 2LZJA 3THRA 4BP3A 1RJDA 1TRKA 5LXTA 1EI9A 3ZHVA 2P65A 2D0DA 3SKVA 3ZE7A 4G86A 1G18A 1BAPA 2IX3A 4EIWA 1HYEA 3DE1X 1GTG1 1T2FA 2D3WA 1GVNB 3PTZA 3RABA 2O7NA 5H0IA 4DCUA 3LC1O 4FD2A 3R41A 1SD2A 1TKRA 2Z5FA 1AV6A 1G42A 4LDQA 3V7WA 3LQ4A 4B3CA 2FPSA 4C76A 1KAQA 4D1YA 4BNFA 2Z30A 2NVUA 1V0JA 4I7EA 5FYDA 4XGIA 3MAJA 2OHHA 5E9QA 3OQPA 2DR2A 3AVYA 2C2MA 1FXWF 4UCXA 3X2FA 3G0DA 2RE8A 5D3QA 4QGBA 5HA5A 2BTQA 2IYOA 4PBSA 1XALA 2B4KA 3FWKA 3QA9A 3JWIA 1YCGA 2WZCA 1Z08A 2CXXA 2ORYA 2Z1DA 4MGEA 2WZQA 4TKZA 4LF7B 1O03A 4CKEB 1PR3A 4RH1A 3DTYA 4YCLA 4B31A 5AVWA 1UT6A 4P33A 1KQSB 3MSXA 3H2IA 4HH1A 2RCNA 3GMTA 3GRVA 6YASA 1X80A 2G0AA 2XDYA 3BUSA 2C84A 2YR0A 3FKSA 5F52A 3U19A 3ODPA 3TNFA 2XIJA 4KFUA 1A82A 3LJKA 2XT0A 3FN4A 4C7VA 1BEUB 1KI2A 3DZDA 2ZAMA 3WNDA 1Z7WA 2BP7A 4S35A 2OTLB 4PYLA 1DUSA 1SKUA 1F38A 2AFIA 5GONB 1KMQA 5ITWA 3EVCA 4DZZA 5IVPA 1H23A 1XL1A 2Z83A 2NU6B 2QMHA 1Z0FA 1FDRA 2PYIA 1XELA 1LDNA 1SBZA 3NWJA 5J5AA 2P3MA 2X7JA 1YZYA 1CS0A 1AKRA 3O0DA 3QM1A 2MU1A 4XUEA 3V1LA 1KF0A 4JP5A 4CWAA 3PHCA 1WXIA 2Q2VA 3B1YA 1ISSA 4C4OA 1KBQA 2G72A 1K4MA 2OECA 2CXOA 4OA5A 5C4IA 4WBSA 4FLMA 2RBEA 2ENWA 5K8JB 3OZSA 3IPXA 3LNCA 3ZIAD 3U3JA 2OZVA 5EE1A 1L8AA 2OCKA 5DYWA 3NATA 3KJXA 1J99A 3CX3A 4NECA 1GU1A 2QT0A 1O0CA 1W2BB 1ZD9A 3IP3A 4ZPXA 3L9WA 4CBVA 2WSSD 3V4RA 3UKDA 4UM9D 3I30X 4YRQA 2BT4A 5CEFA 5LA6A 1OOEA 3EQ2A 4KBFA 2RGXA 2WWGA 3AGPA 1NBEA 1Q20A 4U2FA 3IP5A 3OWHA 2OTCA 3RJ9A 5MGNA 3PUYA 4TOIA 3WKAA 1ZLXA 1W47A 3NEPX 2G5TA 3E3MA 5CPFA 1OFGA 4ZTUB 4UUBA 4WOBA 2OO5C 3I72A 3PSAA 1N2HA 1S7CA 3DZGA 3M9WA 1E9SA 3NBMA 3PRYA 4HDSA 4NCIA 1TIPA 4PR3A 1WOOA 2YQZA 1CR6A 2CF6A 3Q1KA 3ZY4A 5CLIA 1EK6A 4AZ0B 5KC8A 3SEAA 1NZJA 3CGWA 3D8TA 3N2EA 1JR6A 4U9UA 3W2IA 1VL5A 2CEKA 1I3LA 2ZBRA 1IN6A 1KHTA 4OAPA 4G37A 5EZSA 2GAOA 3TVYA 1TJYA 1NUTA 2RKWA 4WCFC 2Z2ZA 1W0JD 2AMFA 1NMXA 5IJXA 3TLYA 5IDXA 4KMRA 2AVDA 2IUUA 2CDNA 1L4BA 3K1ZA 3P4UA 4PSDA 4MS1B 2P40A 4M1MA 4BLWA 5CA0B 3A8TA 1L9KA 3EPRA 5FHQA 4J4BA 4S24A 1XZNA 1E77A 4EYSA 3E7PA 1XLVA 5D2CA 4US1R 2ZU6A 3AJDA 1JDNA 1KZYC 3A3YA 3MWFA 1TCBA 3LOQA 1JKXA 3TUIC 3IAM1 4CL2A 5JCXA 5KDDA 4TZKA 1YHYA 2P27A 1XEXB 1L7OA 2NNLD 3EJWA 3B1FA 1G9TA 3B3JA 3IEPA 1LK5A 1GAWA 1RT9A 2VQSA 3ND5A 3OIUA 3R0JA 5B6PA 1H2RS 2IUEA 3S29A 1XVVA 4NNPA 5HR5A 2QBYB 3EIXA 2WTUA 1U3CA 2XTAA 4KJZA 5HPYB 2X6YA 3KHTA 4DT1A 4LC9A 1UQTA 1K7YA 4O4HB 3WKEA 4Y1FA 3C3DA 2GNAA 3N2GA 4FCTA 3AT1A 3BGOS 3EXG2 3HDHA 1ABBA 2O5EA 1XRRA 1PX0A 2O0JA 1Z5NA 3UHAA 2C59A 2IPOA 1OI7A 4X7EA 4TXJA 5ETJA 3ROGA 3CZRA 1K08A 1NXVA 2EV9A 3FJ1A 4HGOA 4IVNA 5GJCA 3IIMA 2Y68A 2LZ0A 3CR8A 4OG2A 3RU7A 5J43A 3WICA 5TDHA 1PT9A 1CP2A 3PQ6A 3F4BA 5C4MA 4R9NA 3HU3A 3SLRA 2XMGA 3LCCA 4RV4A 4XIYA 3TWOA 4X7DA 1K5GA 3ANTA 4BCBA 4KEAA 2UU9B 3Q3AA 1LBQA 2QN9A 3S0JA 2OXFA 3DLTA 3ZHCA 2XXBA 2Q3CA 3C8HA 2V8BA 2EFYA 2JBHA 1M75A 2QQGA 4JVSB 4RZQA 1NM5C 1NF2A 3QBEA 4WY5A 3V8EA 3JQ9C 5DN6D 5B6IA 3BRCA 5JJBA 1OBOA 3K09A 4MLPA 2OM2A 4B34A 3IE1A 4NFSA 4EHJA 1G6Q1 2CYCA 4ZXFA 4IIUA 1Z26A 2Y92A 1N9GB 3WYGA 5KNDA 3UGQA 3AERA 3CTMA 3NJRA 3DV0B 4G24A 5IU6A 3Q10A 4ROTA 4D9FA 5F1YA 5KVQA 5F4BA 2OV3A 5LNK1 2G4CA 5FLEX 1M2WA 3GO4A 3OPVA 3MTEA 4I1YA 5DYIA 3O8QA 4M0DA 3OLZA 4DV6B 1QR2A 2W2KA 1HGXA 4FJ2A 1J1ZA 2NGRA 4GLOA 3DUFA 4DGQA 5AKLA 1KHHA 2C9ZA 1ZUIA 1PG0A 2HF2A 1CIVA 2IA5A 1W73A 1J97A 2VRCD 3FMGA 2WYIA 3MT9A 4MV3A 5JCPA 4F8YA 4YHHB 4WXRA 4MLCA 3R5HA 3UA3A 1RKVA 3O4FA 4XLCA 3FUCA 2BFEA 3TMKA 2CUTA 5U9CA 3JAKB 2IYNA 3AV3A 4WLEA 3DEYX 1O2DA 4YQYA 3USCS 5ITZA 3K05A 2KWIA 2Q6KA 4E70A 1N6NA 4V0RA 3HN7A 3EH1A 1FJXA 1C4XA 3CF6R 2IIPA 1DJMA 4OOXA 3AESA 1M74A 3HUEA 4KDFA 3F6PA 2AS0A 2VRWA 2ZRBA 5C81A 1O97C 1GTZA 3Q7RA 2C54A 3ZHOA 4L0CA 3FKQA 4JNCA 5IH3A 3HPQA 3QTLA 2BHRA 1Q11A 3I04A 4URYR 4FFSA 4JJAA 1RW4A 4Z99A 3HYSA 1JG6A 2FGKA 4HHEA 3GJ5A 1HQDA 5DX1A 4NDZA 2B36A 4PS1A 2ODAA 3NUQA 5DTIA 1QRRA 2DOGA 2GNPA 3JALB 3R3YA 2ID4A 4HDKB 2MSKA 4GOOD 4BMPB 5T57A 1FX1A 3P97A 4GXNA 4KXNA 1ZIDA 2B3DA 4PZDA 3PHHA 1EUYA 4YP1A 2FPGA 2BEUB 5K0EA 3NBFA 1A2OA 2N42A 3G05A 3Q3CA 1C30A 1DOZA 1OX5A 2W2LD 3CV3A 4OJNA 2FFRA 2ERCA 3R6LA 4DKJA 3F5DA 3PKIA 2IV7A 2PGAA 3U81A 5F23A 2IPXA 5LUAA 4JLUA 5B1DA 4Q6WA 4QQRA 3MJFA 5K51A 1R8SA 3VJKA 2FZKA 5C8YB 4A8JA 4FMPA 3P0JA 4X20B 3SHQA 3U4MA 4Z9YA 1ZR2A 1DQYA 4I55A 4L5JA 4AD8A 3OQ1A 2VRBA 5LBTA 4D25A 4Z0HO 5EGNA 4E03A 4Z7NB 2I8CA 2VNIA 3E23A 3P2YA 5ARDA 1YZGA 3QPDA 4BGUA 4EJSA 1SD1A 3ZG6A 4ZMRA 4N7BA 3HBLA 4TMZA 2VDLB 1HQKA 5F4MA 2FLWA 3RT7A 1E1KA 4G5RA 1U6JA 3ELWA 3O3OB 1C9NA 3ETDA 4QELA 4QWMA 4RETA 2RI1A 4NI5A 1M6VB 1K7XB 4BLQA 2JCSA 3F6SA 3HA2A 4G0XA 5JHGB 1IBKB 2V55B 2Z04A 1I5OA 1Z2NX 2DULA 2MSWA 4FFDA 1ULSA 4IMRA 5AIAA 2E0IA 4N7RA 4EFLA 4WLUA 3UFBA 1YI0A 1JQJC 1D2RA 4Z8XA 3RRXA 4W63A 3OT5A 2BFNA 3K2IA 5DGCA 3ZKWA 3O8BA 1R0LA 3CP2A 5AK0A 2ZM5A 3VR3A 1C29B 4AQ7A 3OVMA 4YPVA 4J29A 3LC7O 2V7QD 1C3LA 1FUIA 4CGZA 4CF5A 3HKBA 3BMXA 3EARA 1TZKA 4U7FA 4U2DA 1WETA 4M86A 4JYZA 3X44A 3Q9LA 1FBNA 3QA3E 4DZRA 4BDSA 2NV4A 2CK3A 1TA0A 2DU8A 2YH2A 2NZ8A 4PANA 4DA8A 2H4FA 1GKKA 3O03A 2NNWB 1Z3IX 4QUBA 3OEEA 5JZOA 1II8B 3ZI0A 4D98A 2IS1A 2X4GA 4BS9A 1NDUA 1SC9A 2G9QA 2UKDA 2Z6UA 2PGXA 1WPXA 2ZE7A 2FZLA 3V4SA 1NJFA 1Z0ZA 1FU4A 2OGSA 4BLSA 1KBOA 2HIMA 3G68A 3AEKA 2A67A 1P5ZB 3OPQA 1XZAA 4C88A 3HO1A 1VIDA 2QSUA 3IT2A 4ALKA 2Q3MA 4EGAA 2J3LA 1FP6A 1PUXA 4JLJA 3E1KA 4WDQA 3MWGA 5BVHA 3RVPA 1B2LA 1EVIA 4WXYB 5ER9A 5DMXA 4RA9A 5FLYA 1IBSA 1RWMA 3C2QA 3LQRA 3QXSA 4EA9A 3QWAA 1IONA 1CULC 3JD4A 3OZCA 2C2WA 1RM5A 2QPAA 1ES9A 2VDKB 1MO5A 3BJZA 3N8GA 3PC7A 4MA4A 5FNVB 5KBYA 4C5BA 2BKUA 4RWEA 1TVCA 2VXCA 2I71A 2ZUCA 1S2OA 2BGUA 1X42A 2JN9A 3A2KA 4OKIA 2TECE 4UQOA 1YDHA 1KC8D 4X06A 1LVGA 1S2IA 2C4MA 1DWPA 2H2IA 2PMFA 5F4JA 1FSZA 1VHJA 1XTZA 3D3EA 3GFFA 3KM0A 4FGUA 5G0SA 1U99A 3G7UA 4QTXA 2OAGA 3ADOA 2DM6A 5EE3A 1G2OA 1J4AA 5B4TA 2DR3A 3P9CA 3G0HA 1F4VA 2PKWA 2BMDA 1XTVA 1TE2A 5K09A 1N3IA 4CG2A 3NORA 3C0KA 3NEJA 1KQ3A 1P0MA 1VCHA 3SK0A 2VUSA 4HKTA 4O4JA 1EYZA 4DTCA 1IM8A 4X64B 5LP1A 1R66A 4XJXA 1K68A 1NLFA 2CW5A 2H29A 3PPYA 4EG6A 1XROA 5AJVB 2D06A 3LP5A 1M1YA 4PYOA 4XM0A 1SCAA 4AWXA 4COOA 3L07A 4YCJA 1DC5A 1YE3A 3W90A 2QD4A 2VDRB 3AVOA 3RYFA 3AL0C 5KKNB 4IJQA 4XYBA 2ZZNA 3BJIC 2OV8A 2R8BA 1YLOA 1NB0A 4R05A 4W5JA 1XMVA 3W7AA 4OQFA 1E9RA 1P5RA 1Z4MA 2PL3A 3AUSA 5E7JA 4AM8A 5A8AA 2A57A 3R7FA 3SKYA 7MHTA 1GLVA 3JAWA 1YC2A 1Q82D 3VNUA 7REQA 1M6HA 1UBTS 2ZB8A 2F8MA 4XW2A 1CD5A 1G64A 1IHOA 3NEYA 3IXLA 2HTFA 1G66A 4BQNA 2ZTNA 5B7GA 1ZQ9A 2XUIA 5COQA 1JQEA 3RPEA 4YRNA 5EJ6A 4X5OA 1ULHA 3B1WA 1YI2B 3DMRA 2H7VA 1U02A 4KLAA 4DDTA 1E4YA 5FI0B 1XXLA 2ABWA 2VXBA 3OPYI 3QFTA 3IPYA 2BUAA 3WDSA 3LF1A 1FFHA 4EY8A 1N0HA 3R77A 1NJSA 3V7YA 1UMBB 3PP8A 4LDAA 2GRAA 4ISBA 3LYAA 4EQ6B 4F6CA 1X1DA 4OMUA 1UPBA 2TMYA 4DWVA 3FYTA 2ARKA 4I1PA 1WTHD 4V0QA 4BU1A 4BLPA 2VSNA 4ZOBA 3JQPA 1JIXA 1I6LA 3QTBA 1LD3A 1QGOA 4TTRA 4ZQIA 5E6UA 4HP8A 3D59A 3LLUA 2P4HX 5LBUA 3RT1A 4MS3B 1WSRA 4NICA 3VH3A 2VSYA 5AVVA 2PR2A 4MUAA 1JDTA 3R6KA 3JAMA 5CH5A 3MIIA 3KJIA 4UKDA 2GBLC 5AXAA 1ELOA 4HQRA 1L7XA 1KQPA 5LYJB 1DLJA 5CT4A 2CZQA 4KODA 4OGGA 2O0LA 2FK7A 1EX6A 1WUJS 5IKMA 2J5XA 2DRIA 5E4FA 1OLSB 3KOWA 5EXSA 2VF4X 1K3FA 1UP4A 1XKLA 3GFTA 2VJPA 1SCQA 1N6RA 1B93A 2NO4A 2O6HA 3NHJA 4M76B 3ROTA 5JQGB 4UCQA 1ZA1A 4N0QA 1HURA 4IWXA 1DIRA 1LBEA 1PU2A 3K8ZA 3UTCA 2ZULA 3N7AA 4XCVA 4H4CA 1GQQA 1FMJA 1CQJB 5ULLA 1KEPA 3GCWA 1UK6A 4CVNA 3C7DB 5FNZA 5J35A 2GF9A 5AKHA 1O5IA 1EM6A 1EEXB 1S2DA 1MOQA 3OETA 5LIRA 4XOTA 4I19A 4KTTE 1ZO8A 2VJKA 4C4ZA 1F8UA 2DPHA 4GWGA 4IZHA 3PHLA 3JQBA 1MHTA 2GNOA 4IDPA 4RVFA 2G9VA 1HX7A 5LQMA 1W0KA 3KV1A 2X6RA 3UHPA 2GLUA 3IV9A 3KE9A 1DC6A 1ZRMA 4HNVA 1CRQA 5AK6A 5DBHX 2V0GA 2MYPA 3MGAA 3JRNA 3MCVA 4RELA 4B84A 2NQ2C 3D0OA 2YZNA 3V32A 3LX5A 4LXYA 3MD0A 2C88A 4LY6A 4JC4A 2CFOA 2PH5A 3L6EA 5DI3A 1TT5B 5AJTA 1OVMA 4ND6A 4RACA 5HUHA 2CNDA 4IWYA 1XCBA 4I4NA 2P2GA 4MRVA 1MOPA 5KWSA 2QYTA 4ZT6A 5M04A 1J5XA 1R6TA 3V1UA 2M6SA 2R1TB 4K9MA 4X66B 1JFTA 1V9CA 2GQFA 2OGZA 2WU4A 2XYQA 4EQZA 1EUQA 4DLKA 3H6HA 1UBMS 4A0GA 1Q14A 3CCRB 2C5BA 3AUAA 2W6JD 1V11B 3CNNA 4ZAWA 2C97A 2G9NA 1JMYA 3ZDEA 1QGAA 5B1SA 2OXRA 1PT8A 4UTRA 2JIRA 4JVMA 4RX1A 2VUUA 1H0RA 1QYVA 1NLZA 2EGUA 3D3WB 2VZEA 5KWEA 2JDIA 4YMTA 4MP6A 3N2YA 5EQFA 4HAZA 2GVDC 2GJ9A 4PFKA 4IJ5A 1YB6A 2B4RO 2R44A 1HT3A 2XDQA 3LCVB 3OW7A 3OTIA 2PKQO 1X19A 5JNUA 1PGQA 1QG4A 1QZXA 2ATEA 4XYMA 3V46A 1BO6A 3PIIA 1TQHA 3MMZA 3PEVA 1UPFA 4RS3A 1WCV1 1X7YB 1HEUA 4KP7A 3VKVA 5C8YA 3CZ9A 1K6IA 1XDZA 2V5VA 4RJ2A 1NRWA 3NHKA 4HFRA 4JXKA 4LZPA 3RHTA 1KDPA 4NZMA 1V4NA 4KZPA 1M8KA 2W2QA 3CBGA 3G1WA 2A9OA 4BOYA 1Y37A 2QPTA 3VPBA 1S02A 1W88A 2XY4A 3C5CA 4LPSA 5H3HA 3DR5A 4HAOA 4Q5IA 3I6QA 1YVDA 2PZMA 4H27A 5TIIA 4R1QA 4PAWA 4Z1MD 3RUCA 2RMKA 1EK2A 4QG7A 5AW4A 3T7TA 5FBWB 5BV1A 5ECGC 4PO8A 4RDKA 2C42A 4PFSA 5CD9A 3H5RA 1L4GA 1YZUA 2RHOA 4Z6KA 2ACVA 2CHFA 2I9KA 4HVAA 4JYBA 1KTVA 1WUKS 1NURA 2JGIA 2Q5IA 3E1SA 3ILXA 1I4OA 3OIWA 1DTWB 1Q95A 1XWWA 1T4DA 2OUKA 2PGNA 3CUSA 1HLPA 3KOUA 4DW8A 5A1TA 1OLUB 4C0KA 4C06A 1P1BA 1TUGA 4B85A 1XLUA 1E0SA 2XYPA 3P9SA 3W4KA 3NVKI 3J81k 5ALRA 1CLUA 3Q6NA 5I7SA 1Z4QA 1D2HA 3GT0A 3L1UA 3UHJA 3P52A 3CPEA 4WZTA 4IIJB 1UDBA 4Z4ZA 2Q1WA 4JX8A 3A9TA 3D8HA 3TD9A 4ZOEA 1J6UA 2VTEA 2HMTA 5ADHA 3QFRA 5A05A 5DVZA 3MOSA 4KLZA 4BFUA 2EERA 2DPYA 4I36A 1PS9A 2C20A 2PDAA 2PQ0A 2VG8A 1FY2A 2JGLA 4Q18A 1EB8A 3BH7A 1U6KA 4O5AA 1NAHA 3GJ0A 4FC6A 2PGOA 1L1FA 4F5YA 1PVOA 1GCOA 4X6YA 2VTKA 2P3SA 4MB2A 1BCSB 3QU7A 1AKMA 4V38A 4D92A 4WA8A 1TUIA 3G6KA 2QQEA 4DFDA 5HJ5A 5IJZA 2AF3C 5LOVA 3O3CA 3TGPA 2XMQA 2ZJBA 1E1DA 5HE9A 1JKMA 2EP5A 2VAXA 1G38A 1YWGO 2FF7A 3IAAA 1P0QA 4B4DA 3NETA 3U16A 4RD6A 1JDSA 1CRZA 1T5SA 3C6YA 2MR6A 3DKRA 3THXA 3HWX1 5LP6A 1KVRA 2GM9A 2CLFB 1NDQA 2BEWA 3U7RA 3IQHX 3PC8A 3PFWO 2WTMA 1TNDA 5BNIA 1JNXX 2X58A 5JC1A 4DA6A 4L22A 2WTBA 3OIVA 5BSUA 1VRWA 1UR5A 2XRYA 421PA 5EI5A 3U3OA 1FNMA 1YDGA 5TLSA 1UMDA 5JC8A 1PJAA 2P6RA 2RC6A 4YONB 1NVGA 2ZDGA 5JNRA 4MWSA 2VDMB 3NPMA 2J9ZB 5IYNA 3QLVC 4C2BA 4EL0A 5IT0A 2XZTA 2DFLA 2ZRAA 1E2EA 2ORWA 4XQFA 1YL7A 4LOLA 4ZHQB 3MHPA 1RMYA 4JKIA 3Q39A 3E2IA 3DA8A 1U8UA 1UK9A 4D26A 3TRFA 1QLWA 3B6KA 4LW8A 2GO7A 2ZIUB 3VSEA 3RSGA 3F7OA 3EVFA 5ESRA 4BFVA 3I9V6 3O1JC 3OZAA 2V9CA 4HPWA 4BLRA 2GUWA 3N7TA 1T2UA 1QUFA 1M1YB 1RM4A 5AK5A 3PKJA 3L9XA 2NG1A 2H1HA 1E79D 3LGAA 4OHRA 4UAUA 1JHUA 4DG5A 4EYEA 3DDHA 2M32A 1SQ6A 2Q1XA 1QH8A 3GVPA 3ZS9A 2QPOA 5EJFA 3IQWA 2FR8A 4RHUA 4S2EA 1ZRNA 4A1OA 5JS7A 4ASUA 3OKAA 3PFGA 1TYBE 1UFOA 2CCKA 5HE8A 1O57A 4XD7D 1XDBA 4B3HA 1JHOA 3VR4H 4M8NE 3VSBA 1J8DA 3H9UA 5BW4A 4MQEB 2A30A 2YCLA 4C3ZA 1C9YA 3EDMA 3A11A 4Q3AA 4Q15A 4Q7JB 3OX2A 3ZLVA 1WIWA 2FSPA 1VXOA 4DC9A 1AS2A 1A97A 1VCOA 4PX9A 4EGJA 2J32A 2QQ0A 3MINA 1A5AB 4ILKA 3VOAA 4OGLA 1Z73A 3BQ9A 1YITB 4WXPA 2Q45A 3OTQA 4MA5A 4UHHA 1AHPA 3GMSA 3KXPA 1IN1A 2J9FA 1B14A 3IH5A 1ULZA 1UBRS 2J8ZA 2ZCVA 4EJ2A 1KRWA 3OOHA 3WFZA 5JTTA 3EMDA 3EIEA 2YL2A 4KQXA 3WQSB 2C9CA 4ESVA 4M9QA 5CGZA 5LUBA 2V3VA 4PHFA 4AIRA 2UZ1A 4FQ8A 1JSLA 4LY3A 2ZR0A 2IUFA 3GJTA 3HI4A 3AR7A 1A88A 4EH1A 3RC7A 4CLEA 1H8HD 2Z2KA 4XDYA 1KJ9A 2R7KA 4Y2QA 2YWJA 3DZJA 3QQPA 1EVQA 5AM2A 1X3LA 4JMLA 1LLQA 3IELA 1OSNA 2CRVA 2RGNA 4MUYA 4OYRA 3AFIA 5D7NA 1EX7A 1RQ2A 4MWEA 4L9AA 2CE7A 2JIOA 2UYHA 1IDOA 2RHLA 4RPDA 2PCLA 4I08A 3RAPR 3GFBA 3IXMA 2C4HA 1EWQA 1J0AA 3OF2A 3F3MA 2IQIA 3ED5A 4W5NA 2IHTA 2XUAA 4INOA 2J31A 4OQQA 1GQOA 3KR0A 2BEJA 1DP4A 1YR3A 2VF2A 4H7PA 2Q46A 1YCFA 3P7MA 4J9VA 1AIPA 4Q3EA 4TKLA 5HK8A 4JI3B 4AURA 3RS0A 3H1BA 1Z0IA 1E5VA 1NULA 2EU8A 4LY9A 4QQNA 1KNXA 2VFAA 2VBCA 2RSLA 1QH1B 3GLQA 3K9FC 3KWLA 3VOTA 4FLFA 4OQMA 4G09A 1ZGGA 2QX6A 2HZBA 3B9PA 4KXVA 5GVRA 4CYMA 3HBJA 1SBYA 4EP1A 1AO0A 1L1QA 1BD3A 3JQCA 4HGPA 3RADC 1XU4A 4EK9A 4X7MA 1GFZA 4MR8A 4Z7QB 1OAKA 5GWXA 4IOMA 3ZDAA 4UCWA 4X71A 4QXOA 1XKTA 3G89A 1PX2A 2F3RA 2NT3A 1QONA 1DEKA 3N2GB 3M3DA 4HQFA 1GTSA 2C4NA 3VAAA 3HABA 2EWWA 2X3YA 5JCJD 1YRLA 1MJFA 1F5SA 3O0TA 4F2WA 1VRCA 1RHKA 2QVGA 5DNAA 1UBUS 2NXCA 3S2SA 4P0PB 3INYA 1I9GA 1GV0A 2WA2A 3MYRA 3PBKA 3TSYA 2LVBA 1DRJA 1UK7A 4J0DA 1ZGZA 3A1VA 5DOZA 4HOYA 2C57A 2JGEA 4B3GA 1SRRA 4G7WA 4AZWA 4ZI7F 5EJ4A 1A9QA 3VPSA 4JEHA 2F4VB 3VPGA 4B33A 4KPFC 2F90A 5A9SA 4JLKA 4DV1B 2WF8A 1H6DA 5DWDA 1I18A 3TOCA 1YZFA 4GXTA 5MGBA 4YAOA 3TAUA 3GARA 1E6CA 4TKVB 3RSQA 3H4TA 4DSTA 1KYQA 4XNFA 4F86A 3CZQA 3C4JA 5IBQA 2ECQA 1TM4E 3I05A 3E9ZA 3R20A 4YASA 4F3CA 3C4VA 5A3JA 1ZVJA 4AKHA 2PGLA 4LSGA 4W1QA 2SKCA 4L72A 2AX4A 3KIPA 5KAPA 1JE1A 5REQA 2EQBA 1KP2A 1DWOA 1FSFA 1I7SB 3EIQA 2O2GA 3VDXA 2CXTA 5LWHA 2V4DA 1XQ6A 5TMBA 4FHZA 4D4MA 4F92B 1YZKA 3SLDA 1RYDA 4KH1A 3ZNQA 2BDEA 3F3SA 3OMXA 3AETB 4QFBA 3ZV4A 3HUUA 1QX3A 3X1ZA 1WHSA 3OM0A 5J59A 4B0PA 2ZUSA 4MAMA 1JF8A 2ADFA 3RSLA 3DNFA 4MW7A 5A9TA 1I8DA 1ZI8A 1WF6A 1T4GA 3TOZA 5KTKA 4PLCA 1S1CA 1XRLA 4CDMA 4PC7A 2ADOA 4KX3A 4D0RA 2YS6A 1BN6A 2DUWA 2YY6A 1VL1A 4O2LA 4OB8A 1Q86D 1PGOA 2AHRA 5EP3A 4XLFA 1GL6A 3W9YA 3CCBA 1NM5A 3T3DA 3UAYA 4KCGA 3ZGOA 1L5HA 1T4MA 4KO4S 4F7DA 4RVGA 1KU0A 2JIMA 4QA9A 2QJOA 4XA8A 3QK7A 1FUUA 4OXYA 4ZAZA 3ICVA 2X23A 4XVQA 2R00A 4RABA 3I61A 4L1KA 3VR6H 3FYUA 2MIIA 5AESA 4UU8A 2X41A 3WNVA 4OXQA 1AZSC 3V7FA 5LZ4A 1JR3D 1F8XA 4WZ6A 1EDBA 1M73E 3KCQA 4PYNA 4W9NC 4D57A 1GQFA 2PHZA 8AT1A 4OBXA 3EW9A 4O4HF 3NI2A 3ORRA 4M1OA 1WZIA 2PEYA 3WISA 4IGAA 4B6SA 2FPKA 3IP6A 3R7NA 4G1MB 4UHEA 3IMCA 1HTTA 2RK3A 1S4QA 5FO1A 2OV4A 3KB8A 4B3BA 3VR1A 3PQEA 3EFBA 1Q6YA 2Q0HA 4DBVO 2JFBA 1KYYA 3AJ8A 1DPFA 4IQ4A 5F9FA 3MMNA 1DEOA 3WLRA 1NVEA 2IL1A 4A3SA 1QAQA 2EYQA 1USKA 4ITUA 5KMGA 2ODWA 1B1AA 3CUKA 3OLWA 3ZTYA 2JLAA 2V59A 3IDQA 3FROA 3NX4A 1VP3A 1S3IA 5B1IA 3ZE1B 2P6OA 2XW6A 2Q6OA 1VGQA 2WYUA 3FOAA 4I9HA 4C14A 4J1NA 4LFAB 4RMHA 3BQMB 5SY6A 5IKOA 3F8WA 2JDID 1E3MA 2BGMA 3RNLA 2JFYA 5CAEB 2DERA 2JAHA 4TL7A 1DC7A 3PRJA 3GLIE 1P1JA 4E5MA 4CU2A 4CW7A 1V41E 3HACA 3UOAB 13PKA 3DW1X 3SD7A 3SBOA 4UPEA 1ZQ1A 5I3CA 1Y8QA 1H9BA 5T3YA 4ARZB 3C24A 3CGGA 3PU6A 1IB6A 2IPAB 2ZQ5A 3RV4A 4LG1A 4IKPA 4Q3DA 3RIMA 4D9KA 1O97D 5L4LA 1N7JA 3T0FA 1P81A 3C3CA 4FFRA 5ED0A 3ZVNA 5M7EA 5FWAA 1S89A 3AZPA 3ETEA 4JSRA 4Q1AA 4KGZA 4TQAA 3WIOA 3LRTA 4OP7A 1PFQA 4Z9BA 2EARA 3K5PA 4GMGA 3O91A 5FPKA 1H3EA 1ISMA 4YT5A 4C5CA 1H42A 2QGZA 2BR5A 3CX4A 4CQLA 3BY1A 3GLHB 3G13A 4KB5A 3RUDA 2J5KA 4IV5A 3RYCB 1YULA 2JJMA 1PZMA 3HRHA 3N0XA 3QYJA 3ZWOA 4M9UA 4B6PA 2IYUA 3L6CA 3ADPA 3WIVA 3EZGA 2AQKA 3LUPA 2MHCA 3KSAC 5DTQA 4PC1A 4EO9A 1LFDB 3DV9A 4MRRA 2AUNA 3HTXA 2OQRA 2EKZA 5F35A 5AI8A 4P36A 1GGJA 3U2QA 3S99A 3DCIA 1HE4A 4YUYA 2QJTA 4X62B 1NN1A 2EBUA 5AM0A 1KFEB 1XRNA 2V4UA 3VH4A 1FXUA 4U5XA 4IW3B 1RU3A 2YV5A 3TI7A 4CG1A 4DANA 4YXFA 4GC5A 3CJQA 3HUFA 1VJRA 1DPGA 2EYUA 2Y1WA 5D6OA 5J2UA 1X38A 4JC5A 5JJ5A 2IC5A 1T4CB 2FN8A 3TLMA 1R8YA 3GELA 4PIPA 3EGCA 1Q57A 4J7XA 3SKBA 1TKCA 1X8JA 2PZAA 3O73A 4TV8F 1A4XA 3C3PA 5IP5A 2IYRA 3KKEA 2Y2UA 3L2OB 4LYDA 1LPPA 2Z6BD 2GZHA 3Q0TA 1LW7A 2FSGA 3QI2A 4Q4HB 1NY5A 1SCUB 2QPLA 3FTDA 3VR5A 1N2CB 3IUMA 3T53B 3N7UA 5L3QB 2X22A 3FCUB 1XFAA 3G2IA 4WQMA 1BJKA 1PGPA 2HLDA 1CS0B 2BKEA 2FQXA 2PU7A 3KNZA 2QTAA 5TNXA 4PAGA 4P4TA 2GXUA 3M9XA 2ZOSA 1CSEE 4E5DA 3H1EA 4O4HA 4TT8A 2HA3A 4JL5A 5KTRA 2DB3A 1UT5A 1ZSVA 2W93A 1TKBA 3KSDO 3TJMA 3MBIA 3VJLA 1I13A 4PLTA 5EWMA 4DARA 3U37A 2VCEA 3CLUD 2ZP1A 3NBUA 1DBVO 5J5CA 2ZUFA 5K4HA 2OORA 1EIZA 1VHTA 2WMDA 4KZKA 3FTNA 2P3OA 3AYZB 4X93A 5MFZA 3SDZA 1NSYA 3EC7A 4FMDF 5IEJA 3KKZA 3UBMA 3G71B 4RJLA 3U44B 1ZAYA 4NE2A 1JQDA 1P9NA 3VZSA 3WYAA 1OYYA 4M0CA 4RAOA 1CFZA 5FLKA 3ITDA 3GRCA 3COSA 1Z37A 4XN0A 1COZA 4FT4A 1DJNA 4YJGB 5DWVA 1QZTA 4XWKA 1UEIA 3M6IA 2JHAA 4FMDB 3HJTA 1XK7A 1BC5A 2R6R1 2V6FA 3TIVA 2VVTA 1NI5A 2I2XB 2RK6A 3B9RA 3DFMA 1L9XA 3VHXA 1OA0A 3TUZC 3O21A 2BFAA 4XQ9A 1GN9A 1L3BA 1UWCA 2IEGA 2QTGA 2J0VA 5IYZB 3U09A 4GXRA 2BFCA 2QNBA 4IUCS 1CUSA 2OBSA 2XVMA 3SFVA 2CNWD 2QRGA 1Z9BA 3C97A 5BV8A 4MROA 2GVNA 4NCJA 5TVGA 4RVSA 4A8TA 3DKVA 4YT8A 3ZBUA 3A3BA 5FBZA 4TS9A 4G0MA 4M0LA 3O75A 1B8PA 2AOTA 4HRYA 4U2BA 5JTUA 4LY0A 1ZIPA 4YI3A 1FVHA 3U1TA 1P2VA 3E1YE 5J5VA 3ASPA 1J20A 4JBYA 3I42A 5EIBC 3VV3A 5IVKA 4MB0A 5K3EA 4KGVA 4XLTA 2OPHA 4BCCA 1IIRA 1E1RA 1CJMA 4HYEA 3IUQA 1XP5A 4G5QA 2XSZD 3OQMA 3LVRE 2P5UA 1AKVA 3SZMA 3OKCA 2BHLA 5EQTA 3VYTB 3AI3A 3G82C 3L0CA 2ZJ8A 2BW0A 3JCZA 1VHDA 4KO1S 2IU3A 4RVCA 2HDOA 1VOTA 1KEUA 2HUNA 2NUAA 2XVAA 1IVYA 3EIHA 1VYVA 4QUIA 3KEFA 2PFSA 3LD9A 3LHFA 4HWSA 4X8LA 1WUHS 3AEQB 4IXNA 1YE8A 5I47A 3AI2A 1V25A 2DQKA 2YYZA 3AHDA 5EWJB 4E3ZA 5IBRA 3ZKAA 5A3RA 4AU1A 2Y1FA 1O0BA 1ND5A 1URPA 3OCWA 5H02A 2F8TA 2W2MA 1QZZA 4Q93A 1TF2A 3I09A 1ZM2A 1DBWA 5C3UA 4JI4B 4IQ0A 3SQLA 1IAVA 4C89A 4E3WA 2DHQA 4V39A 3WAGA 2QRUA 4K9RA 4WZLA 3HUDA 4IHJF 2VHZA 2DVMA 3M82A 1A3CA 4M83A 5LN1A 5HFJA 5TPWA 5A88A 4GWLA 3B7GA 4LAFA 1JNYA 4Y2TA 3T12A 4DC0A 1O6BA 1CU1A 3DBLB 3K0CC 5CLGA 1Z7EA 4C7KA 1YR7A 3BTVA 4R2IA 1YQWA 2ZG6A 3VU8A 1RTTA 1W8DA 4HEQA 2VJLA 1ZXXA 2A5LA 1XMJA 3DOEA 4H4EA 3JQDA 3OJLA 1M2HA 9GPBA 2A78A 3T8YA 4A8JC 4F1JA 1RP7A 4BV8A 2PTGA 4YMWA 4IOJA 3AHCA 5CIQA 1PJ5A 4XM1A 4TM7A 3LQ6A 1HZJA 2JGDB 2H0QA 5DBFA 4EW1A 3I9OA 2H9AA 4NQZA 3RS4A 1PJSA 3JD2A 4IFIA 5HRAA 1QRSA 4N9QA 5IC4A 3SHTA 3MMSA 1JQAA 2LP4Y 3JY6A 3Q88A 4OOVA 4JS0A 4CL8A 1WCIB 3GLGE 2WNHA 3A1WA 5F5NA 3MIZA 1XYVA 2EJTA 1YSCA 2QVCA 3NASA 1ZDMA 3H75A 4OFZA 3SBXA 3WGVA 3TQOA 4HBGA 2Q6VA 2D5CA 2BZ1A 4RJIA 4ZVNA 3NKFA 2DETA 5B2ZA 3DTVA 3N70A 2YW2A 2ZSBA 2A94A 4AC9A 4KYIB 4EW3A 2E87A 2QZ4A 4X95A 4CM9A 4L5AA 3JW8A 3U3DA 1MIOA 2CSUA 1UKCA 3TE6A 2C3MA 3LL4A 1EFVB 3L8FA 4KWCA 3MWYW 4KSBA 4AFNA 3JV7A 1YAJA 3RUHA 3FKJA 4RHYA 2QG9A 3I2YX 3ZHXA 3D7KA 5BUQA 5ITZB 3U4QB 1XPUA 8ATCA 2GBCA 1MNAA 4OHYA 2C2YA 3IMGA 1ICEA 1IY2A 5K0CA 1ANKA 1ORHA 2XCIA 3OUTA 4RKQA 4KH0A 2YY5A 3TMAA 1U0BB 3ILYA 3M34A 3O9ZA 3V8MA 2V5AA 2JKZA 4ALLA 1IVNA 1RM0A 4FXUA 4M8SA 1JTEA 4WHMA 1UUFA 1U0GA 3OUZA 3UMSA 3CCEB 3AR3A 2W83A 2BJHA 2E18A 5D3MA 4UM8B 5AJWA 1H2WA 4JBXA 5F77A 4UAGA 5A0FA 2DUUA 2EHJA 1G4AE 1QK5A 2C9BA 2XWQA 4MKGA 3A9UA 1T9HA 3JTMA 5AM3A 3WYDA 3DM9B 4MP3A 4YCMA 2XAAA 4NCAA 1E2NA 3HZZA 4BWGA 1XU9A 4BN5A 2K87A 3AYXB 3PGXA 1SQ5A 1EGVB 2H16A 2QYSA 2R47A 1JDZA 3G17A 3HJCA 4IJMA 4AMGA 5LKRA 1NXQA 5KYNA 5L46A 4BY9E 1DX6A 2HNAA 4C43A 4HWGA 3RTGA 5THQA 3C41J 5ADUS 2HLHA 3QVGA 3RSHA 4U8GA 4A0QA 3PGVA 1V16A 4DTIA 3TFOA 4Q9KA 2XDWA 3LZ6A 4MEJA 4V0MA 4UU0A 2DUNA 3VKWA 1JLLA 4EF4A 4HFJA 5F9MA 2J4DA 5KSZA 2QVBA 4MAAA 1M2EA 3K2EA 5ALEA 3KQPA 2G83A 4BE9A 2PRIA 2ECPA 3TAHA 3DLPX 3GA5A 2C7GA 1I36A 3FRIA 1NLMA 4TV8A 3KD2A 4FINA 4XSVA 3L0YA 2JD0A 2RHBA 1NBME 4PCUA 1IH8A 2Q0XA 4ESHA 5CA0F 2X1MA 1SG9A 4HAIA 5C51B 1DAEA 1DX9A 4BXOB 4JVNA 2ID7A 3K0CA 4LJYA 1M2OB 1XEFA 2GXQA 4RJKA 5F2KA 3I39X 4F3NA 4XDHA 4PABA 3FZEA 1J0XO 2GFIA 2ZSJA 4BQRA 3AHHA 1HI9A 4MO2A 3LDGA 4QTTB 2B8NA 3DFFA 1NTRA 4G4JA 4REMA 3B82A 3IBYA 3F8TA 3K0FB 4G1UC 1PV1A 1UD5A 3T3NA 3Q3IA 1KAMA 5MN5A 6REQB 5AM5A 5AVJA 1EAMA 1THTA 2H0AA 3TIFA 1WS6A 4R6XA 1PD0A 2VJCA 2ZLBA 3QMWA 3L4JA 3U4AA 4O8CA 1BYUA 1DO8A 1ZN2A 3D3NA 1HA3A 4ZOCA 3CC4B 3PEEA 4IMPA 4FBLA 4O08A 1N7HA 4QAQA 5FI5A 3HKBB 2Q3LA 3IQZA 3B1ZA 2PVPA 4BV3A 3ORFA 1IFXA 1PVVA 4B3FX 1R8JA 3TBKA 5L3ZA 4AN4A 3WE7A 4TRMA 5JROA 3B70A 1BE0A 1N5OX 3T3EA 1AUXA 2NU6A 4C6RA 1MABA 3BB1A 3T7DA 2XGMA 3V00A 2NZ2A 3MFQA 1JVNA 2X0NA 1KYZA 2Q5QA 2ZRIA 1K2WA 4EG4A 1WY7A 1VSVA 5J2UB 4AKTA 4EENA 4JGIA 3V9PA 3VJRA 3PFBA 2BR4A 3SEJA 1ACJA 2GD1O 2VR1A 4AIIA 2QHXA 3ZDBA 3EGDB 4UTZA 1DFHA 1YZQA 2BGLA 5TPZD 3GGOA 4QGAA 2EX4A 1ZN9A 2O0KA 3I2GA 2Y8EA 4AJHA 1IHMA 4C7OA 3LQQA 1M9NA 2C5FA 1GQ2A 1LPOA 1BSVA 4RD1A 1C3JA 3M70A 1AXGA 4JR1A 5JRDS 4PSUA 4GI2A 4Q9NA 5SYNA 4ZANA 3M5DA 3GLRA 1F2TA 2ZTMA 3KKOA 1VG1A 1PTJA 1XC7A 3UMVA 4KKXB 3V7AA 4QTZA 1ENYA 3TGWA 4DQLA 4D2IA 1QCYA 5JZSA 5A0VA 2ECKA 3ZPXA 2ATVA 1N6OA 3U5ZB 2EEZA 4GYJA 4LDRA 3TJRA 1EVYA 2G07A 5J58A 3E48A 1Y7PA 1ORWA 1PD1A 3B52X 3G2OA 4AXXA 3WQQA 1WZNA 5AUPB 2DIEA 2BGTA 3A6JA 2WILA 4MS3A 1TAHA 4ITVA 3FOBA 1OFUX 1GPUA 1U0OC 4KW7A 2P1ZA 4GP6A 3NOOA 2GM3A 4RO0A 3VPHA 3OZVA 1H0KA 3H5AA 3KVVA 2ZRKA 1LPSA 1QORA 4I4TF 4LJ7A 4QOIA 4WNAA 1NF3A 2GPJA 4AJPA 1HRKA 2UYGA 4DLRA 1V7QA 5JQWA 1NMZA 3HB5X 1G6OA 2AN9A 2IEIA 1HYHA 3N76A 4HVCA 3WLSA 3DEFA 2NSJA 3FPHA 5TF0A 1S2MA 2GBLA 1Q2UA 4XUGB 5KTTA 2IIQA 2QN6A 1H66A 4Y18A 5HM8A 3GQBA 5ICEA 2B9VA 1W1IA 2ZTVA 3U3ZA 3FMOB 3ZIAA 1XXHB 5CM2Z 4EB6A 2GBPA 1SOWA 5IYZA 2AFHB 1Z35A 2SICE 1ZGHA 2PMCA 1JHRA 4Y6RA 1VBNA 3L46A 4WOJA 1GXSB 4MVJM 2PQ6A 2DJIA 3F71A 1NPYA 3KL4A 4RF3A 1P8JA 4CTKA 3OZWA 2E3JA 1MTOA 5BWLA 1DKPA 4C9BA 2WKPA 4ZDWA 1JHYA 3L0ZA 1ONSA 4N01A 1LRKA 4UPDA 5BOSA 4LCBA 5LQJA 3PHGA 3BWEA 2ERXA 3I6IA 4Z51A 3MTDA 4HK4A 3EGIA 4RF2A 2J7KA 5E9AA 4HQOA 3DL4A 1UAGA 1W19A 2PKQP 2H7CA 4MV9A 4RFVA 4I50F 2V6GA 5EIWA 4CR6A 4LOIA 3GWGA 3KUKA 4F71A 1VDMA 3UA4A 1KFKB 1P1CA 1XX6A 2L0XA 4EY5A 3H42B 2O0HA 1Q3TA 3LBHA 4ZZ0A 4BB6A 1R5BA 3SF8A 4OQ4A 1GZSA 2ZRPA 4H0NA 1V1MB 1W1UA 4HL6A 4NX2A 5EMMA 5K03A 4OXRA 3KKMA 1RJFA 4Q00A 2ZSKA 2HA7A 1CHNA 1DI0A 2W8BA 1XA0A 3MTBA 4PLGA 5DH9A 1S3FA 1U3VA 4RJJA 5IS2A 3R5JA 4TSRA 2RKOA 2OCIA 4IGEA 2UUOA 2VHQA 2YXBA 2YY7A 3F9RA 3IRVA 4H0FA 1Z7GA 1U2ZA 3NC1C 5BSRA 3ZWXA 4DNXA 3A9SA 1RVV1 3CQ9A 2WT9A 3ZNPA 4YQFA 3LC0A 4RD4A 2PLRA 3PCRB 2W70A 5HJEA 1KP3A 4PQYA 4OD0A 1HH4A 2R1TA 5IF9A 3MWEB 1KAEA 3CPSA 3ETGA 2V6JA 3ZH2A 2ESRA 3AZOA 5K3FA 1EZ4A 1TT7A 4M7WA 5ENVA 1P9RA 5LFAA 3ESQA 2OP1A 5BQPA 2J3QA 3K4QA 3FNEA 4KI0A 2FQQA 4ZHQF 2O2HA 4MMYB 2FPIA 3H4VA 2X4IA 1OBVA 2NV2B 3AW8A 5CDSA 3OFKA 1N5LA 4IZIA 3CO0S 3QF4B 1VJCA 2UVDA 4HCJA 2JLCA 3M4JA 2V1XA 3HB9A 3X3HA 2Y67A 1HUQA 2VJBA 3C6MA 4NMLA 4I2NA 3AONB 4XCXA 4YJDA 3PD1A 1U8FO 5DE3A 4ARSA 1Q7GA 3H5NA 3O94A 3OE7D 4G1FA 4IH1A 4E08A 2ZE5A 2V58A 3NQ41 1OLOA 2GHQA 1HZEA 1Z5GA 1SZCA 3A1CA 4AF8A 3DE6X 3VU3A 1T5EA 1V26A 3HGQA 3NHUA 3SE7A 3WQHA 4ARVA 1SQFA 4E4YA 3A6PC 1E9DA 2YJ5A 3LY5A 4HYYA 1JHMA 3ZY3A 3NC4A 4G0NA 4JOQA 1EHYA 4TXHA 3VV2A 4TLBA 4PPGA 5G3YA 2GCOA 4CN9A 1LCIA 4JI6B 4RGVA 1Z6ZA 3QHPA 1IATA 1OBFO 2QLNA 3ZIDA 4DAEA 3PC3A 1AS0A 1ZOSA 1CJTC 2R1UA 1NUSA 3RIHA 1UDWA 2D0OB 1SZPA 5GY7A 1L4HA 4I55F 4BRWA 2O0MA 4JLSA 3KKNA 1JGTA 3B1VA 1BMFA 4RFSB 4JV5B 2JIZA 4OAQA 1CEYA 3OQHA 4KFCA 1L4NA 2ZI9A 3R6DA 1NY6A 4CIVA 4KHPB 1BE1A 2A1TS 4O6VA 1T91A 2C7PA 1LPAB 1G6HA 1Z2DA 5IKXA 3AM5A 3D64A 3T4EA 4WIAA 1O9HA 2E4WA 1QVZA 1QK3A 1R0SA 3W5AA 1MU0A 4IUBS 2W43A 5H81A 3TX6A 3HL4A 4MWDA 5HGJA 4BLUA 5LQRA 2AWOA 1UIRA 5AW2A 4JOBA 1BH2A 3K0SA 1UZAA 3QVXA 1FFWA 2EKLA 1YB2A 3RS3A 4REQA 3OP1A 1N5RA 1P19A 1RC8A 2P9ZA 2ZR9A 4OFXA 4Q4AB 4FDLA 4MQUA 1N1EA 2HLNA 4NKRA 3ZEAA 1PTKA 5HKLA 3DOOA 4OQYA 4LXIA 5AWFC 3VZBA 1QQ7A 1YIOA 1WQ1R 4QRHA 4RQUA 3DEHA 1V11A 4HZIA 3MM4A 2PSFA 3SEFA 5KPDA 3T5MA 5CBKA 4I8DA 5CCDA 3BH6A 5TQVA 2IPMA 5D84A 5AJUA 1WLYA 3SYNA 1M1NB 2H65A 5FPSA 4COKA 1XWIA 1UOOA 1V8DA 1NL3A 1XT6A 4LNHA 4QNMA 1B41A 1RLJA 4NU6A 3L82B 1F7UA 4JT4A 1HE8B 3AEYA 3RWOA 2QT1A 5KNCA 1WBDA 2WKWA 1PKEA 4LV8B 3WGUA 4ZEVA 2OBTA 4BP8A 3HBFA 1UDAA 1APBA 2L17A 3BXOA 5CLHA 3OZRA 4BVJA 4F4IA 4GKJB 3P2OA 4B7ZA 2GBIA 2C1ZA 3V8QA 4UBKA 4I1RA 2ZYGA 1R6VA 4DGSA 2UZIR 2K5UA 2Q27A 3NYIA 4LJ4A 3LBAA 3TEJA 5EKSA 4IG4A 1JLHA 1K63A 1VLMA 2BGWA 4UTOA 2ET6A 4ETWA 2WJ6A 1FK8A 4F8EA 1LQUA 4HNHA 1JU4A 4KQEA 1QPBA 3AKEA 5JZVA 2EW8A 1JHZA 3CZ4A 1F0KA 4C0BA 2XE8A 5JD3A 3O90A 5E6SB 1AHIA 4FGLA 4URHA 5A5FA 2WZNA 1RKBA 4MYSA 5LOVF 3W77A 3I92A 1O95D 1Y5MA 1IQRA 1Z5UA 1OA1A 4N0PA 5HIIA 3TRIA 1IWPB 3INTA 1LDGA 4YJHB 1KPGA 2O8BB 1W36D 2BBWA 2H7XA 4WCFA 2H92A 3U9SA 5IUJC 3S8MA 4DY6A 1L8XA 1W6UA 1YRWA 4OJTA 2A92A 1X87A 1RZ3A 3D3KA 3OZEA 4LE2A 2H1VA 5HQ3A 3HL0A 5ISMA 5CR9A 1RI1A 3FZQA 4LJ5A 2VPWA 3JQ8A 5IAEA 1QYCA 4WE3A 4K87A 1SUBA 3JYNA 1M7GA 3QKRA 3IR5A 3B13B 3S44A 3S55A 5DO9A 1WW3A 1QGYA 4AN0A 2DTEA 5EWLA 2PS1A 1ZD1A 3PUJA 4UJ3A 4F4CA 3P9ZA 3N0VA 4GNRA 5FCDA 3RYHA 4PLVA 4CV0A 3L7CA 3D4NA 1N0UA 1UOEA 2KM1A 2OYNA 1IG0A 3RHZA 4GC9A 3ZWYA 4C7MA 4XSGA 5BSKA 3QOFA 2V9PA 1SCIA 3P1JA 3T1OA 3P2KA 1QO9A 3KAQA 1PG5A 4P38A 2RONA 2X3UA 1PBNA 2ZTHA 3H1PA 4KOEC 3GEEA 5AIBA 1SKAA 1E2JA 1NPTO 2H4HA 4KAXA 2Z4RA 4PLHA 5I7AA 3VU9B 1SVMA 2X6QA 3QKIA 3RK4A 1E9FA 4FEEA 2WAYA 2VSFA 4MICA 1K0UA 4XOIA 1AKNA 4ECAA 5DW3A 2C03A 1F9AA 2NZWA 2AG1A 2P2ZA 3ACCA 3EQZA 3GT4A 1E1MA 4G85A 3HU2A 4LJ8A 1DBSA 1NJ6A 2I6QA 2YNMD 4TWZA 3NWOA 1PTJC 2GOYA 2Y1CA 1AK2A 3ND9A 3QLUA 4HEHA 3OD5A 4KQ6A 5B58T 2IVFA 4C4XA 4EARA 4RYLA 1IDN1 5JFGA 4ISCA 4EA7A 1ZW1A 1QV6A 2I66A 4L07A 2WJJA 2R8XA 3CUVA 1R18A 4FOLA 1QTNA 5AVSA 5EZYB 1I1QB 2ZJ4A 4M1TA 2Z57A 4L75A 4NBNA 1T36A 4QHSA 3LK7A 3BDVA 1QWOA 2YZKA 3KQLA 3S1AA 3V48A 2YQ4A 3BB3A 5EMKA 4EUSA 1GPNA 3GPDG 3DOCA 1EU1A 2JFUA 5D5PA 1ONOA 2OBNA 3SSMA 2JLVA 3OHSX 3T15A 1D9ZA 2RGNC 3MRTA 1Y3BE 1TMKA 3UHFA 4RTQA 3SY8A 3RDPA 4RH0A 1YHNA 1U7PA 4AYTA 1SVUA 2BSXA 2WHPB 4CTOA 1CF9A 3DZKA 4FGKA 4J2TA 4URUR 3RTAA 1V1RA 3WZLA 1GZUA 2VDWB 2QMYA 1G1MA 4DRZA 4TRRA 3O3MB 1CF4A 4NBUA 4F1KA 1JLSA 2RDMA 1A5BB 1YZVA 2CMDA 1A5SB 3HO6A 4CEIA 4YH1A 1CE8B 2XB6A 4ND5A 2BBTA 2HL6A 1U3DA 2Q9CA 4PRLA 4YREA 5IULC 2VOEA 2FW7A 2IOYA 1R0KA 5HW0A 4RTMA 4S3MA 1NX6A 5FB3A 2ATCA 3CTAA 1WU7A 3IVRA 4UEKA 1X39A 4Y8VA 1XZEA 4D9JA 1TM7E 5G1OA 3QVWA 5DP1A 1ZD4A 2NUTB 5JASA 1JN0A 2BC9A 3PCTA 4XDGA 4WADA 4P92A 4KV9A 4MVWA 3R23A 3C7CB 4ZVTA 2FWIA 1H5UA 4PRZA 4KIGA 4BRSA 2ZE8A 1Q15A 3ESZA 4OL9A 5IM5A 2GEUA 1JLMA 1PL8A 2P1DA 3TOSA 1GWNA 4YBZA 5T4BA 3TJZA 2Q1SA 2W90A 4K6MA 3Q12A 1AO3A 5KC9A 2O9JA 3CR3C 2J87A 3K1YA 4NBLA 4BATA 4DADA 2LPMA 4WEOA 2ZTLA 4QDTA 4B2LA 2HCBA 2VWPA 1ADFA 1WD5A 2G1PA 1LSJA 5CGQB 3H11B 2E7ZA 1OFUA 3D3QA 2ZJ5A 4ED9A 2CLLB 2ISSD 5G0VA 3TG8A 2X8WA 3K1AA 4JENA 1TYDE 2JAOA 4CMHA 2ATXA 4GICA 2Y77A 3JQGA 1NNEA 1OWNA 2A3RA 4TTJA 3J7AC 2GJ4A 2FV8A 3RIEA 4PQEA 3CONA 2XRZA 2JVKA 4FILA 2CNKA 2XNHA 3GVJA 1R0WA 4PLPA 3GBPA 5FULA 2YWXA 4M4SA 5C1OA 1P3JA 2WI8A 5EZ5A 3R9WA 3VR6D 5BMVF 2OHXA 4M53A 3A0UA 4Z8YA 1QWSA 5BUCA 1M8FA 1UBCA 2IDMA 3ND7A 3C3EA 2BN4A 2W00A 4MITA 2AMLA 4TN1A 5A03A 5JQGA 1NT2A 3PQ7A 1XEWX 2PJRA 2XBLA 2YVAA 4I1UA 1BA2A 1EP9A 1FFAA 2ZPUA 3O9MA 1TTQB 4G26A 3WB2A 1A9XA 3M1IA 1ZJJA 5CBPB 3ZCVA 3PDUA 4LPKA 2ORED 4Y2XA 1BKYA 3NWPA 5JPCA 3GZJA 3BVPA 4A4DA 2ST1A 2G76A 2Z6AA 1UFQA 4DDHA 3RRJA 4DNTB 1UEXC 2CMGA 1H4VB 2G7ZA 4Q02A 4Y98A 1V47A 3CZMA 3JWJA 3T3GA 3KB2A 4DMMA 2XE7A 4OV6B 3K4HA 2RHWA 2HBQA 1Z12A 3QJGA 1KRXA 3DYVA 4LF4B 3QWBA 4P25A 2ZQZA 3WGNA 1IN8A 4O4LA 4KLCA 1NMQA 3FNQA 2VBFA 1FX0A 4M1WA 1JG2A 4KMOA 1W48A 2VJAA 5ALHA 4BJ6A 4KREA 1LNZA 2BJVA 4PONA 4PLFA 2J67A 4KQHA 3HZHA 1TQDA 1AUOA 5I9TA 3T5TA 1MEOA 1SB9A 3ZI4A 1S72B 1RCTE 4DNRB 1XJWA 2FRVA 2OHVA 2VBVA 1X1EA 1US8A 3FLMA 3Q15C 4MPRA 1CB7A 1AGXA 4ZYLA 3O2NA 1FP4B 1U31A 2H54A 3OPNA 4K9NA 3T7RA 4NIMA 2UUBB 4FOOA 4C1NA 1UMCA 3COJA 4HDNA 2PBRA 1UXKA 1UODA 1AQYA 1VG0B 2HU2A 5E8JA 2XCOA 4OSPA 4CUZA 1AZTA 1JIUA 4P3PA 1DQNA 1WDLA 3E3OA 4ENRA 5KYYA 1WOYA 2W7TA 3NWEA 4GEKA 2X19A 4GM4A 1Z15A 3C1UA 3W5DA 4YCBA 3HCRA 2C3PA 1OZGA 3GH3A 5HG0A 1GG8A 2AC2A 3OT1A 4X85A 3C98A 2NYRA 4EELA 1HE2A 4RD3A 2FAXA 4KNWA 4DM7A 4B43A 1YB1A 4P8RA 4PNEA 3TCXB 3OTOB 3BH4A 1BU5A 1NVVR 1Q91A 1O96A 2J5BA 1BS9A 1QF7A 2R6FA 4NXNB 5IT4A 2O3TA 2VYFA 2VEOA 3TXYA 5DCLA 2CE2X 1CQIB 1ZK1A 2JFGA 4TWAA 1DT5A 1LV8A 3N6XA 4PWYA 3Q1LA 4OLFA 4RY2A 4FB4A 3GRPA 3K8OE 2VAPA 4FHCA 4U2GA 2AXPA 2Z43A 3JSXA 4UE6A 1UPXA 1FRQA 5BURA 1AMNA 4O2AB 2GESA 2WF5A 1S01A 1FFCA 3H9EO 2ZAIA 2WP8J 4B35A 2KI5A 2ZXIA 4EZEA 5DXJA 1J09A 1ZVVA 3BCFA 3KZOA 2F43A 1ILEA 3QVTA 1DIOB 1TEHA 5E3HA 2HSGA 4MZDA 4V03A 4YRIA 1YS1X 4XUCA 4UHCA 1RZRD 1H2YA 3HB0A 2A5YB 3KZKA 3ADBA 2PX5A 2LE0A 2BRUC 3ZCSA 5ELLA 2ZZQA 4B4VA 1Z63A 2OQIA 1UFRA 4PEVA 1WSAA 3ZWMA 5K3DA 2O2CA 1PNVA 3UT5B 3GSIA 1BE6A 3NM4A 2VF7A 4TUYB 3GCXA 1EVKA 2CWWA 5E7QA 1WJGA 4RV9A 3WY9A 3WWZA 2REXB 4G2TA 4CMBA 1Y48E 1TGYA 3IE0A 4AX8A 1KH2A 3VZRA 2JI4A 2G80A 3NT5A 2WJAA 1CR0A 1HRDA 3JQ7A 3K0AB 3VI3B 1OJLA 4Z54A 4L8FA 1JPNA 1EAYA 4ZIRB 2D1RA 3LQEA 4LGVA 4GYWA 1XAIA 1VCMA 5GAJA 3AY6A 5FBQB 2XMDA 3OU2A 5EPUA 3VUEA 3Q7SA 3KTAB 3X1YA 1OZAA 5BSYA 1OWOA 3ZE9A 3OZBA 5E4YA 4EMUA 3NG1A 4RVNA 4EMSA 1CY2A 4CRWB 1JRLA 1QHHA 3VZCA 2JIZD 3WFIA 5FF9A 2DH5A 1XQ1A 4CMAA 4MUHA 1G2QA 1G5FA 4WK0B 3LT5A 2P9YA 4O25A 1P0PA 3OQNA 1DINA 5EZ6B 3I6MA 1SVSA 1IEQA 3IMEA 3M81A 1QYDA 5ALUA 3T7KA 4Z4TA 4MVJP 1W87A 2B1RA 2PQ2A 4JYPA 1KE2A 3RYHB 1JDPA 3LUAA 4WOPA 5IAAA 3K1JA 2IFTA 2PKCA 1SURA 1U5CA 3QNWA 4R1SA 1O7JA 1F12A 1OH5A 1H1DA 2F00A 1TAGA 1V95A 4AT1A 4DCOA 1PFKA 5LP6B 1CX9B 1P7CA 4KRXA 1HE5A 3DMTC 1SBNE 5AH0A 1LZLA 1EUCA 1V4BA 1GRRA 1T34A 5LBIA 5ALPA 3TH5A 1YU9A 2HO4A 2I4RA 3LVFO 4JEIA 3LECA 3BH0A 2OCAA 5L4SA 3QYAA 1B76A 3ELBA 3LUHA 4MZXA 3H8SA 3A25A 2NW6A 1BHJA 2B3TA 3O4VA 3UC5A 1IWBB 4F5WA 4AKGA 4Q4AA 3ETCA 3GRUA 4OYHA 3KXIA 3VX3A 1AHHA 1S5PA 2JJ1A 2PSHA 4TV9B 1LJ8A 2R6JA 1V5GA 5FI1B 1O0SA 2H07A 1PL0A 2OGTA 3EUAA 1YRHA 3QY9A 4IDEA 5F73A 3RK0A 4BKUA 1MEEA 1RZUA 3D5EA 5FA5A 4HNAA 1RD4A 3ICQB 1I5EA 3MTGA 4ALJA 4ENWA 1DBQA 3SXPA 4B79A 2NZJA 3ZCTA 4YR9A 3IIEA 4Y9RA 3EEQA 4LSMA 2WJVA 1LVHA 3K9WA 4ZOLF 1YVRA 4KWEA 3B6MA 1T36B 1ZU4A 3TLEA 4ENVA 4LTNA 1NC1A 1P0IA 3P5SA 2ATIA 3A10A 3M5CA 1N08A 4RSMA 3WHLA 3QY0A 3CB4A 1KEEA 1H1LA 3FWYA 1N6IA 1B15A 1FUKA 2L19A 2PMEA 3WGYA 4CLHA 3MLBA 4YT4A 4FX2A 3I73A 1MEJA 2BM9A 4P82A 2QMOA 3TN7A 1EFDN 1Q1ZA 3URKA 4QBKA 4GRDA 4IIGA 1EM8A 3DNPA 4LUCA 7MDHA 2DUMA 3N0TA 3PHJA 3WZ2A 4QPDA 2J0SA 3GRAA 3HFSA 2ZUBA 1RWPA 1Z34A 4HIZA 1NBMD 4INAA 4O1IA 4LISA 4BX8A 1PUJA 4KMSA 1XVLA 1L2TA 1ZOLA 3WLIA 4CEIB 1GFWA 3WL4A 3U4GA 2PXHA 3E7FA 2HEIA 3BA1A 3CD6B 2BLNA 2NTNA 3KX2A 2P4QA 4OOSA 2WFZA 4PLYA 3WRWA 1IL0A 3OIGA 2CZCA 1ZCJA 3FR7A 1P2TA 1XZHA 5I4CA 1RAGA 1WPGA 4PYRA 2BMJA 1TRHA 2CDBA 1KWKA 3SOZA 2AOVA 3K5IA 3KSRA 3PNMA 1KORA 5FBVB 1F2TB 2D6FA 1E0AA 2IYSA 2G04A 4IS3A 1FQWA 3FBGA 5BMOA 4D9EA 3LM8A 4FW8A 4S1OA 1OIWA 2WOJA 3S2EA 4O4IF 2YWGA 4G1BA 2ILTA 4R3UC 1V6CA 1SQSA 4Q4HA 3PLRA 1ZKMA 4ECEA 1EWYA 5JNSA 1I2AA 4OBBA 1RFLA 1N3LA 1Q7CA 5FUQA 1ECCA 3H11A 3TX2A 2IHVA 1B1CA 3K0EA 4KWIA 2OVFA 4H35A 1WO8A 3GRRA 3W9BA 4QYIA 4TLDA 4B4UA 4E12A 4ZCRA 2P9EA 3LDFA 2F3PA 3BMNA 5C0OE 1YK0A 3S2UA 1DG3A 5C8ZA 1UKYA 4ME6A 5DW0A 5HHTA 1KEVA 1KI7A 1QJ4A 1L5YA 1Z4OA 1ADGA 2NM0A 3AJAA 3BWCA 3DXFA 3OEYA 3EXIB 4XFKA 3CPHA 1USUA 2OT3B 2YFQA 2I2WA 1TZCA 1UAYA 2JAXA 2DQ4A 3VNRA 4AJJA 2D0IA 3GU3A 4OH1A 3DEIA 3ETLA 2WQ7A 3ST7A 3OFSA 4Y7CA 5FL7A 1OTXA 4CNBA 3HDGA 3KPUA 5JDCC 1GM5A 2JH8A 1ZUHA 4C03A 5FX2A 2JEZA 1VI2A 2CL0X 3F0TA 3QE0A 3LBFA 3D6UA 3R0IA 3R7WA 1R0YA 1GTL1 2REQA 2B35A 5DHUA 1NSTA 4CCAA 5FPYA 1SEPA 5BOSB 2FRDC 5B3KA 4Q7QA 4PNZA 2ORVA 2GCPA 2VCYA 3PUIA 4D6PA 5CFZA 3O7WA 1Z0KA 3D6AA 1HORA 2KSQA 3BJRA 5IZ4A 1OFHA 3GP3A 2IS2A 4NH4A 2JJ1D 1H8HA 4DWOA 4Z4IA 3LHDA 2J7PD 2ODBA 3OJ0A 1JKJB 1HBJA 1UBHS 2ISCA 3HJRA 4D9GA 2HJSA 3KOOA 2OE2A 4X8MA 4CFSA 5C32A 1JIIA 3D81A 4HDMB 1OZHA 3FW1A 3O1IC 4X3PA 3SMQA 3GGCA 2PWZA 2WVJA 4PCLA 3H84A 1E3WA 1P18A 4UCFA 3HJBA 3RJTA 2GEVA 4ALMA 2D59A 3I5XA 2GN1A 1W93A 1AF4A 3QXJA 1Y1RA 2AEFA 2FOLA 3E0XA 4ZVMA 3AVQA 4RL4A 5TEVA 5TQ2A 4C07A 4WJLA 5A4KA 1C1DB 4G0VA 4LFBB 3RC8A 1GSHA 3AILA 3E84A 2H5JA 3WLKX 2V6MA 3CUEF 4KG7A 1XUOA 3GJ8A 3HFRA 3QGMA 1L5NA 3R7SA 3UW1A 1O9GA 1HKUA 1XYGA 4ZAVA 2P9CA 1PNTA 4X3OA 4JUDX 3HDVA 3F7NA 2KLBA 2C8JA 5EC8A 1HM5A 5J2TA 2XUKA 3AIOA 1G3RA 4FTWA 3A9CA 2JB9A 4P12A 1R0RE 2XMBA 4J0GA 4WNCA 2M6LA 4FKZA 1E5DA 2CFIA 4TROA 1KO5A 1ARZA 1Z2PX 4TXLA 2PR7A 1AKUA 2NO7A 3W6PA 4JBHA 1B0AA 4BC1A 3O8DA 4FE3A 1KOFA 2CVPA 2IWHA 4MK4A 3QMVA 2ONCA 3D8RA 3OBBA 4H7KA 2AE1A 2X9QA 4RPBA 3FWNA 3I9JA 1U7ZA 3WWEA 3CVVA 4H6WA 2O8CA 1J1UA 4W6QA 2GD0A 3KZXA 4UEJA 1Z5PA 4B46A 2I3ZA 4FUTA 3KXKA 1UL1X 4A92A 4BQQA 1W96A 4N1AA 1WDMA 3GMDA 1YHQB 4UULA 1D09A 1L1RA 1TMYA 4KK4A 4XWYA 3RV3A 3K32A 1Y8CA 4AJLA 5DPMA 4PC3A 3UYKA 5M5BA 3EYWA 4FOTA 4J7CA 5CU7A 4DE5A 1OW3B 4P4NA 1T3TA 5JCZA 3AUJB 5ALGA 1SOVA 3QVVA 1U1IA 3BSFA 5KX5F 5K0ZA 2B4AA 2X15A 1XMQB 4PW0A 4E5YA 4E5PA 5JLJA 2DWQA 5JPDA 4XORA 1ZH2A 1AN0A 4WW0A 4DG9A 2BRUA 1KZ9A 3EHEA 3WKCA 1JLLB 3EPPA 1OX4B 4DR3B 3P9XA 3W2GA 1WMAA 1G0OA 4QUDA 5TGTA 4ZKDA 1RHMA 1DXHA 1QAMA 2AYYA 1EXDA 5J4LA 1BE8A 2GJRA 3FPCA 3LDAA 5IN4A 3SX2A 3AHEA 1X6VA 2NAPA 1JTVA 5CK4A 2Y1GA 1I80A 1Y6QA 2UVPB 4DCNA 3QELA 2WYHA 3ZHRA 1QFSA 1EUDB 1VQMB 2GA8A 3QX7A 1N8SA 4R9SA 4RLFA 4ND3A 4YFVA 4B9AA 5JAQA 4URVR 4BNYA 5F3WB 4RK7A 2PJZA 1JYSA 3OCCA 2CHEA 4FGJA 4EMTA 6ADHA 2HDHA 2PD6A 5DV9A 3JQRA 1ECJA 4YJ2F 1DOAA 3JQQA 2LV8A 1MC4A 3JWEA 1DWQA 2C4TA 1QHEA 2XI4A 3I58A 2AC4A 4HWPA 4BFSA 4ZGWA 1P9LA 1CG6A 1GZ3A 1NUAA 2HH9A 4UEQA 3HB7A 4P3OA 1E61A 3E5RA 3GWZA 3OG9A 4ZZ1A 3LDHA 4YV7A 1QANA 2FEPA 2PJDA 1EG2A 1U9YA 3MC1A 5EJGA 4BGDA 2OUIA 4FGSA 1Y7HA 3WLNA 3JZDA 4CJXA 3VR5H 4CCYA 4F4DA 3E7XA 4CLOB 1JA1A 3GJRA 4OMFG 2J41A 4AZTA 2P9JA 3CLTD 3HXLA 2C9MA 3BEOA 2FSUA 3H2BA 3DCNA 1PJZA 3Q3EA 4YEDA 1KZ4A 3TK1A 2ZBEA 2D7CA 4BFTA 5ICMA 3QVLA 2ZVQX 2R96A 1WE2A 3PYXA 2DGDA 2CBZA 4L27A 3W5HA 4YIKA 3G5TA 4WBXC 1PR5A 4GSYA 1UBKS 4QPCA 4N48A 1I7DA 5DM2A 5AVUA 1T8UA 1F9EA 4XJVA 2O14A 1HZZA 1R6BX 1RWOA 2ODEA 4MRMA 3P8ZA 1ZAKA 4G84A 1PZHA 3GQVA 1Y5LA 5FTNA 1ZNQO 3NIGB 3VR2A 2ZR8A 2RHTA 1S3SA 3PIDA 4YRMA 3OPXA 4YAWA 5FBLB 1T0IA 2M1XA 2YTZA 2EEPA 3H2GA 4KYVA 4BBJA 3DEAA 4CM9D 2QX7A 1HR0B 3EFOB 4WRRA 1V16B 2W6JA 5ALZA 2JBAA 1RXSA 4Y1EA 4DUZB 1YBFA 5DGDA 1TC2A 1NZFA 1NYQA 1EB9A 1X7ZA 2P79A 3JD1A 3LUDA 4ZAGA 5A3VA 3SIRA 1BHSA 5CT9A 2R4QA 3LUJA 4Q21A 4YJHA 2P5SA 1HDRA 4PHGA 2P2NA 1XFOA 2WU8A 4RM3A 1YFLA 3F97A 3IUNA 3QVJA 3OEWA 2Z3VA 1NW4A 2J9RA 4OHVA 2GQ0A 4WLVA 3ZE2B 4Z2AA 1JQBA 3PXEA 2VJMA 4G8DA 3WDMA 5A6SA 3LO8A 3GVIA 4L5IA 2AH5A 2E5WA 1WP4A 2OBBA 4MDYA 5K5EA 1CLEA 1Z8NA 4F1WA 3RUEA 3TZBA 4RBNA 2OZLA 4OREX 2HSDA 1LK0A 3K3PA 1RJGA 5K0JA 4OP3A 3A2LA 2XTMA 3ND6A 3Q9NA 5E7MA 2CXRA 1XZBA 4TLMB 2DJ5A 3NO4A 1G3UA 1DV2A 2R6AA 3DAYA 1MH1A 3OICA 1E58A 3L0DA 4J43A 1UDRA 3DFUA 3V97A 2O48X 4R16A 3OKXA 1HEYA 2FWAA 2QW8A 4D7AA 2EQ5A 1XKQA 2C7VA 3NFRA 3E8SA 4FDUA 4WLOA 1GZ6A 5F1PA 2D3TA 1GCIA 3GAZA 4M89A 4Z3OA 3W06A 8ABPA 2OEPA 1ZOIA 2X5KO 1J49A 2B37A 2RGCA 4LRXA 3IGFA 1FW8A 4V02A 5ALIA 1J42A 2VJQA 4NVRA 4GOMD 1AE1A 5K3AA 3STTA 3KWJA 3W5UA 4CM4A 3DUWA 1BOOA 1N5DA 1B23P 4EHNA 4DOMA 4AY3A 3I1IA 2WV9A 4FBMA 1R6DA 3QWHA 4I6EA 5BV2P 3VH1A 2ZDHA 3RJMA 3EZFA 1NN0A 5HXAA 1LBSA 5JXGA 4NRDA 1RHJA 3QVOA 3IULA 2M2IA 2NXNA 4HJRA 2ZJ1A 2OL4A 3CMEB 1QOZA 4NG5A 4C87A 1MFZA 3Q5EA 1D6MA 1Y8AA 3PC8C 2GF2A 3QTTA 3VM6A 1U7XA 2KS6A 3L6DA 3FIUA 3QUSA 2UDPA 4JQOA 2Q6IA 5IXYA 5K6TA 3X2SA 1VZ2A 2PUTA 1S9HA 4MUMA 1FUYB 1TQ2A 4Q66C 4XH9B 1UWLA 3IYLW 1T8SA 5ALKA 4UNPA 4YVFA 5K8LA 3DEKA 2GRJA 1X14A 3T94A 1VHQA 3MRVA 2UXDB 1I4TD 4G6IA 3TZQA 4LQCA 1W36C 4ZI2A 3AF3A 221PA 4ZFNA 1PR9A 3WYNA 3COZA 4AUNA 4YLGA 1H2EA 4RVOA 1KZ7B 1RQXA 1KFBB 4IHQA 2BI7A 1T8WA 2O1EA 2QA5A 5KYVA 4DRXA 2CT8A 3F6YA 2Q1TA 4NS1A 16PKA 4FSXA 4H1VA 3PR3A 4JJGA 1WUTA 2J1LA 4UXJA 1CCWA 5CJPA 2AEEA 4OHPA 1N0IA