2BMWA

Ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bmwA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bmwA02
1DARA 1H42A 3CCEB 1ELOA 1N0VC 2C78A 1B2RA 1E62A 3AGQA 3MMPA 3WYAA 3QSYA 1YJ9B 4RD6A 2YWFA 1HA3A 1R5BA 4R71A 1FNCA 2E1RA 4P6VF 2QEXB 1KRHA 4C43A 1BX0A 3E20A 1S72B 2BV3A 1OB2A 1FNMA 5H5JA 4TMVA 1QVFB 3QFCA 3QFSA 4B3XA 4DQLA 4F7DA 1QFJA 5TY0A 3VNVA 3W5HA 1OB5A 2EIXA 1W34A 2J7KA 1QGAA 4Y9RA 3MHPA 2AHOA 2VNHA 4BPRA 1KJZA 4B4DA 4LBWA 3AGPA 1VQLB 1QG0A 1EWYA 2QN6A 3AVUA 2X3UA 3ES9A 3CB4A 1S0UA 1ZM9A 3W2GA 1Q82D 2VZLA 2DCUA 3G71B 1F20A 3W2EA 1OGIA 2BGIA 3I55B 5FA6A 4G1BA 3MCAA 5JBQA 1KK0A 1FNDA 3AVYA 3LVBA 1EFTA 4PC2A 1TLLA 1M90D 4ZV4A 3B78A 4HE6A 2ZITA 3E1YE 2QTLA 4RD1A 3W2IA 4M2LA 5AN9A 1EFCA 1OGJA 1K8AD 1JB9A 1W2BB 3QFRA 4Y7CA 2VNIA 2PMDA 1EP1B 4Y9UA 1FDRA 4PC3A 2OTLB 1G7SA 1G7TA 3SJZA 3ZZUA 1JNYA 3CW2A 3WNDA 1Q81D 4AF6A 4TMWA 1VQKB 2VNKA 4RD4A 3I56B 4MYTA 1EXMA 4PC1A 4PC6A 4YAWA 1FRQA 2NPFA 2XEXA 1G7CA 2YWEA 1A8PA 4NBSA 5THXA 1D8TA 1UMKA 1VQNB 4LC0A 1I7PA 4QFMA 4M1KA 2DERA 1YHQB 1VQOB 3J81k 1EP2B 2QA4B 1U2RA 2QTZA 3OW2B 1BX1A 1KK3A 4HE5A 3WBKA 5KSWB 3JQQA 4Q7JB 4RD3A 3WBJA 1JJ2B 1YJNB 3CD6B 5H59A 1G7RA 4PGOA 3ZC3A 2BN4A 3B82A 2CNDA 3U2QA 4FWTA 1IB0A 1VQ8B 1QH0A 1BJKA 4ZCLA 1VQ4B 4B48A 2B7CA 4YAOA 5TV2A 2RC6A 4M4SA 3WNCA 4K1XA 1CNEA 4LBYA 2BM0A 1Q7YD 4LBVA 2GQFA 3CCRB 1N0UA 2FX3A 3AVTA 1TUIA 2B5OA 4M0LA 4G1VA 2BM1A 1JA0A 1GAWA 4H9GA 1R5OA 1YI2B 2HDNB 4NCNA 1VQMB 3I1FA 4B47A 1Q86D 4QHYA 4G5GA 1QFYA 4M53A 1ZM3A 4TMZA 4N3NA 2B7BA 1VQ6B 3W2FA 1QGZA 1QFZA 2GPJA 1QVGB 4B43A 1B23P 2DY1A 4DQKA 1AIPA 3LO8A 3P26A 3CC4B 4ZGQB 3CCUB 1DDIA 4EH1A 1KTVA 1SM4A 1K73D 3WXMA 2YWGA 4YALA 3LRXA 2R6HA 3W2HA 2PIAA 1GVHA 1R5NA 2QDXA 1YJWB 4PC7A 1DDGA 4WQMA 4LBZA 1F60A 3OZVA 4C0SA 1NDHA 4U9UA 3CCLB 1J9ZA 3G6EB 5GV7A 1GJRA 1CNFA 3ZZ0A 4TMTA 1KC8D 2BF4A 1QX4A 4MYUA 3WNBA 1VQPB 2CRVA 2BSAA 3G4SB 3QE2A 1KK2A 1E63A 5HXBA 1BQEA 3OZWA 5DSZA 4P3YA 3ZZTA 2OTJB 1GO2A 3WY9A 1KK1A 4ZGNB 4ZCIA 4RJLA 3VNUA 1QUFA 2D74A 3CRZA 3OZUA 1WDTA 4YAFA 1GR1A 1YIJB 1N8RD 2BMWA 1H85A 4RD0A 3W5UA 4ACAA 3VO2A 1EP3B 1W35A 3CCJB 1ZUNB 1VQ7B 3AVWA 3CXCB 4YHBA 1QGYA 4J0QA 2BGJA 1IJFA 1KD1D 4ACBA 2EFGA 4AC9A 1M1KD 1K9MD 1FRNA 2RC5A 3OJWA 3FJOA 3AVXA 3ZBUA 3B8HA 4AF7A 3QFTA 3AVVA 4N3GA 1TTTA 2QMUA 3VO1A 3CCVB 2DETA 2XNJA 1GAQA 4FK8A 4RD2A 4TN1A 3CCMB 1TVCA 3PENA 4B44A 1AMOA 3CMAB 1QUEA 2YWHA 4TMXA 1EFUA 3U6BA 1NJID 2DEUA 1KQSB 5TR9A 2HMAA 3CCSB 1YITB 5GV8A 3CCQB 3U6KA 3A1FA 1VQ5B 3CMEB 3CC2B 4YAUA 1ZM2A 3V76A 3ZBTA 3JQPA 1E64A 3W5VA 4RCZA 1SKQA 5EMNA 2OK8A 3CC7B 4ZCMA 1XE1A 3JQRA 1XB2A 1D1NA 1ZM4A 4IW3B 3P27A 2OK7A 1VQ9B 3OJXA 1JA1A 3VMFA 2C77A 1IJEA 3FPKA 2BPOA 2PLFA 2VNJA 4RCYA 4FN5A 1DG1G 2HCJB 3CPWB 4UAJA 1D2EA 2VYQA 1FNBA 1CQXA 2XNCA 3LYUA 1W87A 2BVNA
chains in the Genus database with same CATH superfamily
1TZ2A 1W1WA 2G9QA 2WV7A 1XEWY 3E3LA 3KKOA 1OLUA 4GBED 1DC3A 4CFZA 1H4QA 1EE1A 2X8AA 1EGVB 4IMRA 4HAWA 4FE3A 5E9WA 2VAVA 3L4KA 2YWFA 4QDXA 3ZWQA 1JDUA 1RZVA 1R5BA 1CEQA 4KXUA 2OYCA 2YRXA 4M1WA 3RTCA 2ZDHA 4BEVA 3JWIA 4GL2A 5ANRB 1B6RA 1AU9A 2BFAA 3A0UA 1SPBS 1ABEA 4ZODA 1IZ0A 2VHQA 3N2IA 4UBIA 2PZEA 2CL6X 1OILA 4R1QA 4HRAA 4Q9AA 1CS0B 3LT2A 1E20A 3OURA 3L7KA 4XA8A 4YP1A 4RA6A 1TUBB 2CCKA 2PMFA 1FS5A 3NRBA 1QONA 1SB8A 3MOIA 4IYRA 3WNZA 2IRWA 3NDPA 1G8FA 5CLQA 1VSUA 2VF5X 1QYRA 2ZXIA 4J49A 2J4DA 3HL4A 1C4KA 2ZWOA 1H1DA 4NBTA 3VAZA 4JLOA 1E0SA 4C0HA 4KAFA 1XNQB 1J7KA 1JVSA 3EEQA 4MWGA 5LCXA 1QFSA 2ECFA 2DJIA 1PDWA 1S2GA 1L5HA 2J9RA 3ABSB 3LQYA 1CDOA 2OKCA 1FLDA 4RZHA 2YJTD 3A2KA 5EJ4A 3QU5A 2PAAA 5IVPA 1MN6A 4EUHA 1OVGA 1ZD9A 4NFHA 2BFCA 5LMNB 3S5JA 3VR2A 1B16A 1CB7A 1NMEA 1QIJA 2ZSKA 1E0JA 3WWEA 1A7AA 1HXHA 1XAGA 2HADA 3ZJYA 4I36A 1DCTA 4KVAA 4MWBA 5AFSA 2PT9A 3IEPA 3A8TA 3O8QB 3DEFA 3C6BA 1EDZA 3BWVA 3F6RA 3JATA 3N2KB 3ES9A 3EW7A 4HFMA 1A96A 2AWNA 4C4RA 4UPVA 4OYLA 2C5BA 2B35A 3LZCA 1Q82D 5IJXA 3W3AH 4BNFA 5C1BA 2YQ4A 3ZV6A 3KOYA 2C5SA 2BISA 4L6CA 2RGCA 2B2CA 5G53C 3KOUA 4LY6A 1NNI1 3SKVA 3ZNOA 821PA 5KMGB 4GLJA 5JS1A 1AA9A 5DTQA 2P3QA 4MYCA 1NU8A 3OUZA 2WKRA 3WV5A 3WL5A 5EP3A 4RPCA 1QJCA 2G5TA 2O1WA 1UQUA 2X7XA 3N74A 4KWIA 1QF9A 4O59O 1JEAA 1NLFA 4LOAA 3T5PA 5KC9A 3QBDA 4WFKA 4Z4FA 1DC5A 5IAKA 3R74A 4B34A 1U8XX 4C6SA 4P86A 1PNVA 3M4ZA 1PFVA 2C8KA 3A35A 1NFFA 1M2VA 3VHRA 5HKKA 3VUEA 4UMEA 1RJ9B 4ZU6X 3G2QA 1G2IA 4TVKA 1BXKA 1K08A 3DPSA 2DTXA 2I2WA 3OPYA 4GX0A 2QR5A 3WISA 1QIMA 1LPOA 4YGXB 5EFOA 4C0LA 4Z7NB 5BW8A 2ET6A 3E3OA 3L8DA 4OJQA 3SS9X 2YYZA 1EFDN 1GN9A 4Y2TA 1KFKB 3V8QA 3ODGA 5CB6A 5HNKA 1J0XO 1G63A 1MU0A 2A9RA 2P6NA 4O02B 5DH9A 1KEWA 1CFJA 4M88A 3R3JA 4IGFA 3V9PA 2R8RA 4ZO6A 5I5EA 2V45A 1U5AA 2PVPA 2V4MA 2CEKA 1PKVA 3LHDA 3ZXUB 4WJLA 2EYQA 4MW6A 3K6SB 1N36B 1UJ2A 3I01A 3EZGA 5TS2A 2BZGA 3G05A 1SC9A 2XA9A 3E61A 1GNPA 3I5MA 2F90A 4L72A 5C2JB 2Q1YA 4M0PA 1IVYA 1H1TA 4XQGA 3S2IA 3SJAA 5IU6A 4IAOA 1MENA 3HNRA 2WZNA 1IQ0A 3ILHA 4P80A 2GJPA 4RJJA 4D9GA 3C3BA 1PNQA 4Y0VA 2VATA 1MQ8B 1OBHA 2OA0A 4F71A 3LDGA 1DHRA 1RXSA 3M5DA 3DV0B 4HEA1 1U9CA 3HL0A 2JI9A 1FZTA 3OEED 3RUAA 3D4LA 3RAJA 1TD9A 3H11B 3K1AB 4IDAA 2XKJE 2PJUA 4F96A 2P79A 3RSFA 1DX6A 4TN5A 4NVRA 2MSDB 3B51X 2V7GA 4G4IA 4L73A 4WWVA 4HNAA 5D00A 1D2AA 1Z2CA 2PQ2A 3FFAA 1DG9A 3DHEA 1E1CA 1VQOB 5E7MA 2IU0A 1D0VA 3HY3A 2C2BA 4BX9A 1A8QA 1NJ2A 3A1CA 1JJVA 2A7XA 4PV7A 3DMDA 1THZA 2XITA 4PCUA 1XQYA 4Q34A 3SSNA 1M8GA 3GGPA 4LWQA 1GRRA 3RUPA 3IXLA 1IFXA 4RORA 1U3TA 4UCXA 4G9EA 3HCAA 3BUSA 1HTBA 4MAMA 2Q9UA 4KOAA 1S2IA 5B7QA 3MQFA 3G0HA 4RVUA 1YS4A 4ZAXA 1L7VC 3IMGA 2R84A 3RBXA 5E4FA 4R2HA 4CL3A 3WWCA 1MAVA 3DHYA 1GKUB 4FFSA 1M2KA 2H1WA 2E2WA 5CYPA 3CD6B 3ND6A 3OTQA 1NMYA 3MCWA 4PGOA 5IYZF 3UAOA 2CNDA 3MS7A 4LJAA 1W47A 1VL2A 3HXPA 3GLHB 3R77A 5EIAA 5IK2D 5TGTA 2OHGA 1EVJA 3EVAA 3JQAB 2AUNA 3WK9A 4I50F 5HE9A 2NQTA 3KALA 3JVDA 4OJNA 3NQ41 5E8JA 1VJCA 3IAFA 4PZPA 4QLOA 4D8XA 2XKKA 5IT0A 3UJHA 4DCSA 4A8JC 1N3YA 4US0R 5FUMA 3V7UA 1UPCA 2EL9A 1BKDR 4JZKA 2EERA 3MVEA 3OQJA 3NO4A 1JG3A 3D31A 1JSRA 3CT4A 5LDGA 3QRWA 1HVXA 1FUKA 3OIGA 4U6SA 1N0UA 1IEWA 1NUHA 1BE8A 5FO0A 1XX6A 2XT0A 3KFLA 3Q6MA 1P6UA 1SGWA 4L08A 5FAKA 4L3VA 3DBVO 5ALMA 2E82A 4YCNA 1O2DA 1H94A 4JLWA 2C07A 1GSAA 1LJLA 3S1SA 1VFNA 4KGDA 4W9MC 2IYLD 4OXNA 4TUYB 3DVAA 1CY8A 3SLGA 3EXFB 5TARA 3R5KA 1CPYA 1NASA 3MJSA 4YP9A 4A0GA 4HGOA 2BSXA 3BA1A 4FYYA 3RUCA 5TGZA 5CEFA 1XPRA 3BRWA 4DLTA 4HO1X 1U6KA 2WG2A 5KAMA 2Q50A 1N2CB 5EUBA 2D4AA 4JH0A 1RRCA 5CDTA 1H5UA 2DBQA 1MIHA 2ZGVA 3DNMA 1W75A 4LJ9A 4UEKA 2CVZA 2KS6A 2FMIA 4H6WA 3X1MA 4HGRA 3FH0A 4FYMA 1QP0A 1CUJA 2RHJA 3F3MA 1YSCA 2HK6A 2QNRA 5A05A 3TNFA 5IF3A 4GQAA 4MS3A 3D7NA 4HH3C 3B1YA 2XAUA 3ETHA 5K8VA 3FPJA 2HHLA 4HAYA 4DG5A 2VH2A 4GWKA 3EPRA 1G21E 1ORDA 2QQ5A 3NVDA 4REQA 1FMCA 2I03A 1H5NA 3QLTA 3U4IA 3CF2A 3CJRA 3GQBB 3ZDRA 5G0TA 1R88A 1I9CA 1MO6A 2CNOA 2YXLA 5LZ5A 1MHTA 2YS7A 3U40A 2VIIA 4PZEA 1DMRA 3CA8A 2ZIWB 4P7GA 4C7OB 1B0AA 1Y6JA 4FZVA 5F7JA 1I3KA 2XMGA 4L51A 4EY8A 2YWGA 1QH1A 3TZBA 4AY3A 2IV2X 3LPCA 1ZHOA 3PUNA 5EUMA 3N59A 3M2TA 3QVGA 1HO3A 4FKBA 4DMKA 3PXUA 3GP3A 4XJSA 4AJ1A 3LCUA 1UD5A 4M0UA 5A7FA 4YFVA 1DDGA 5IXJA 3J7TA 4F3KA 1OPRA 1YOVB 2O8VA 4GPZA 4MS1A 4QVKA 4YEDA 5HEKA 3VSEA 2IEZA 3CY6A 4LNAA 4YUXA 5CP8A 1PJ5A 5SICE 1DXYA 1F9AA 2I2CA 3ABQB 4W1PA 4Z9AA 2HQSA 1WXGA 3GLGB 2QMZA 4Q3OA 2X8BA 1KZ4A 2COKA 3PTLA 4WINA 1E9RA 5DP2A 3TGWA 2PR2A 5JS2A 5JAMA 2OCDA 1JR3E 2VDWA 2CLIB 4XFDA 5D7NA 5DHUA 4OB6A 2RD2A 1XBTA 3ZHXA 3FSEA 4BVLA 5IS2A 2PRKA 1M2EA 4RX1A 2P5SA 3T3HA 1CUIA 4MS4A 3CINA 3JZMA 2HIAA 1GUFA 3KQWA 3VJKA 3K1JA 3ZZ0A 4I81A 2DHDA 2WWWA 4L4SA 5ESWA 4YR9A 3DZCA 1UZUA 4TMTA 3WVNA 4C4AA 1ICIA 2EF1A 5K0TA 3QX7A 5KTSA 4UQOA 3RS0A 3OJLA 4ENQA 2VKTA 4RVCA 4A6XA 4MUKA 5LQRA 3SHQA 4JL5A 1WXEA 1HNNA 2OOKA 1B8VA 2REOA 1KK2A 5E1OA 1E5DA 2VUUA 4A0FA 4BP9A 1PQWA 4C76A 1AS3A 4JCCA 1GQ2A 1BWPA 2ZE6A 3RIMA 4CMIA 1YU9A 4E5SA 2UYYA 4U0JA 4JODA 2BJVA 4EHDA 1N75A 1OHHD 1IM5A 5DKFA 1J6UA 2CXSA 5HILA 2ES4A 2WICA 2WF7A 3JU3A 1LLDA 1B7GO 5BYJA 1NA5A 1S4QA 2YY5A 4H16A 5KUTA 4CF6A 1FP1D 1OWNA 2P4UA 3SE7A 4UTNA 3O8RA 4F1JA 5FWXA 1USIA 3I04M 5CDSA 2IKQA 3HADA 3C3YA 3HJHA 5LPNA 4ZOLF 4DMGA 1W8DA 4B3FX 2WIJA 4MDYA 4HPWA 5KVCA 1DADA 3TR5A 3U19A 1PFYA 2AL7A 4ZV9A 3JQFC 2F3UA 4C14A 1OIWA 1ZHHA 2Q4RA 3EVDA 1XD2B 3MYRA 1HT0A 3NTOA 2CNKA 3IO3A 2JFGA 5CA0A 3U3JA 4PPQA 1Y80A 4HSEA 3GA5A 3SKBA 4P7JA 3TD6A 3V4PB 2DSTA 1S8AA 1VCOA 2GFHA 3HQ4O 4G8CA 2ODAA 2GCEA 3N2GA 1C1YA 2FGKA 3K8OE 2IF2A 3L43A 1GR1A 3OQIA 3KUCA 3PU6A 3ZD9A 3AY6A 5F4BA 1ISGA 4DVJA 1RAEA 1DQZA 4DTIA 1UR5A 2Y99A 3OFJA 3VOTA 2ZJ6A 2ZBGA 3NEPX 3I0MA 2QN9A 4N18A 4OB8A 1QM5A 2NZUG 4FOSA 4U5QA 1T4CB 4QYXA 3VPAA 3W6OA 2BZ0A 5CRIA 3RJ5A 5DNUA 2QIPA 2IHKA 3OZCA 2XTJA 1UDRA 4Q9DA 4XQCA 2VC2B 5ALTA 2WPDA 2PYDA 3U48A 3WGHA 5IBRA 4HTAA 4LOLA 4X3PA 2D3TA 4D4HA 2OFFA 5KU7A 3IV9A 3CVXA 2IE8A 5LDDC 4RHEA 3WL3A 2BM8A 5ITZB 1KHTA 1WPRA 1OQAA 3PKJA 3Q11A 4UXJA 2XXBA 3LOQA 3TQRA 4MOWA 5F9MA 3LBAA 2C3UA 4KIGA 4LNUA 3RLIA 3A05A 1XCPA 3DLPX 4BGEA 2XODA 2I0FA 2PT6A 4L07A 3FHCB 3KWFA 3GPIA 4YJ2B 4DG8A 2QUKA 1XLVA 3IUYA 2PGJA 2IOHA 4ID9A 4NR0A 4F8EA 4XD7D 3I4FA 4LPSA 4TMYA 3NVMB 4JLMA 5IAOA 1EDDA 2WWIA 4HK4A 3HU2A 4DADA 3FCCA 3A2MA 5PNTA 2Q1XA 1KAGA 1FTGA 4P5DA 3SF8A 2X2OA 2YXEA 3AVVA 2FGJA 4BNUA 1CR6A 3DNPA 2H1LA 1MO2A 2B9VA 3WLNA 3I9KA 4WL0A 2NU6B 3RF7A 5HKOA 3DLHA 3CCVB 3LPMA 4CM6A 5CB4A 3KB6A 1DUSA 1J0CA 3NAZA 2RGDA 4FEYA 1F2UB 4YQEA 4ODIA 1QSGA 3OD1A 3SXUB 5DM0A 5K9ZA 2CWWA 4RD2A 3CCMB 3UQYS 3ZV7A 4F7WA 2CXUA 3KPWA 2PRZA 5BWLA 2QT1A 4MJ7A 4RADA 3PENA 1NMZA 4ALLA 2OENG 1ZSNA 2APJA 2ILTA 2NSJA 3LYLA 4KQ9A 3NXSA 3P0JA 4N6NA 4U63A 4KRXA 1WMSA 4Q00A 3RVJA 3CMAB 1DKQA 2ZB2A 5EWJB 1GDHA 2JHAA 2OXEA 3GFVA 4K3UA 5AJWA 2FR8A 4KCGA 1L1EA 1UXIA 2A8YA 2V03A 3LFTA 4LVUA 4RKWA 4ED9A 1T1IA 1UK8A 4IZ6A 1IVNA 3PUXA 3ED1A 4GZLA 3QLEA 1RYFA 3D6VA 1XC7A 1DXQA 1ZP6A 1W2WB 4CT5A 3W3AD 1U7ZA 4O2BF 4CMJA 3SQNA 3JRXA 4ZTBA 3BIJA 4XGKA 3SQMA 4O4HB 4UQPA 3JQPA 3QIAA 2BM9A 3D8HA 5HS6A 2XPCA 4A91A 4YMGA 1HBJA 3NIWA 1W6RA 3QTTA 4HS9A 5BN1A 4C0WA 3ZE8A 4P84A 4YUYA 3JYNA 2EVWX 3LFUA 2NWQA 2LCFA 4BFLA 3R3YA 5G02A 2F1LA 3HKEB 5BSFA 5L3SB 2H2HA 5B3AA 1FMJA 1HUQA 3C2QA 1XE1A 4QU0A 5C5CA 4AKGA 3T3DA 1KAQA 2QZJA 2XVAA 3FLBA 4MAFA 3F5MA 3ASTA 1CG6A 3S4YA 4ALNA 1ZA1A 1CUGA 2ZBQA 3IBSA 1FBTA 2PKRA 4OQEA 1M75A 5GONB 3RS8A 1NG1A 4XQEA 8ATCA 2WB4A 2HHHB 1VSTA 3W8FA 2VP0A 1W1IA 4KQXA 1Z7WA 3QY9A 1WQ4A 2FI1A 3T1VA 4EDFA 1NB9A 2I7CA 2NU7B 2EZ8A 3EGXA 4J90A 4WA8A 1N78A 4IIHA 4YIHA 4I2VA 4OP2A 5AM1A 2O2XA 2R7MA 5DISB 5EQDA 1CD5A 4BQOA 1TIKA 2W2LD 3F73A 1RRVA 1A04A 4EUFA 5JPIA 2GM3A 2V7QA 1NVKA 1P7WA 3AHDA 1T2DA 1DCKA 1UC4B 1NBOA 3LUFA 4J9UE 3RB8A 3CPJB 1QQBA 3CT6A 3RJ9A 1NIJA 4L57A 3RHFA 3ITEA 5JCJD 1E4VA 1QNLA 3W7BA 2CSXA 3RGGA 1FFBA 3FKJA 4OQMA 3ROQA 3RR2A 3COPA 2QZZA 2Q4TA 4YJGB 4E7OA 3FMOB 2C4UA 4BNGA 1KETA 3MFYA 1GFSA 1E62A 5FV7A 3PNQA 2O7SA 5ALOA 1CCWA 4ZI2A 2I3GA 1JFFA 1JDSA 3RJTA 2VJLA 3F5SA 1RQ7A 2M1ZA 2H6EA 3NORA 1VPVA 5IKXA 4RLHA 1KP3A 2OQVA 4Z7OB 2FUG1 1QTQA 4IGKA 4KYUA 4DPMA 4C43A 1PUXA 4BJ5A 2Z5VA 4TZ0A 2IXDA 1Q44A 2B5VA 4EKGA 3S1AB 4Z4WA 2YNMC 3AEYA 1JMYA 1NF8A 2VPIA 3H1BA 4R8SA 1HL7A 3KQMA 3STWA 1X3LA 3EZLA 5T3YA 3U56A 3SYKA 5JI2E 4FT4A 3ND5A 4IGEA 2CHVA 1UMBA 4MGEA 1DRVA 4UUBA 3TOZA 2AXQA 1KI4A 1W0JD 1YH3A 3RVDA 1SQ0A 3VPHA 4M0EA 3VR5A 3JQ6A 4B6SA 4TXMA 1W34A 1YR2A 1E9BA 1PTKA 1Y4ZA 3AMVA 4I5EA 2LE0A 3DV9A 1WSRA 2WJYA 3QLVA 2W4IA 2YDXA 3H5LA 1AGNA 4TKZA 1OMOA 3ZWKA 1A5BB 2LP4Y 2AHOA 2VNHA 3R0XA 4R9VA 3LYAA 1Z9BA 1H3EA 1F7UA 2IHZA 1G8SA 3FHLA 2JD2A 3EG5A 3QSGA 2KWIA 4AL4A 3LWDA 2V7PA 3CH4B 4GMKA 2XA2A 5FYQA 1TMOA 3DDOA 3FMPB 4JQOA 1CDDA 3LGXA 2QPTA 1RI5A 1E92A 4KKXB 2RH4A 1DWQA 1U2DA 1L4YA 1ZEJA 3FCOA 1D1QA 2QM8A 3ND9A 1NR1A 3R5SA 5A9SB 2GPSA 3OIWA 4CCYB 3B6JA 2GTIA 1X38A 2IPMA 3DOIA 1C7QA 3KO8A 2A0KA 4GLFA 3OQ1A 4IVPA 4JB3A 3GNQA 2DQ4A 4XIFA 5IVKA 3SIRA 4XDHA 3QEJA 4E2XA 1P2SA 2JLCA 5D86A 4ZAFA 4O2AB 5A4IS 1OLXA 2WWRA 2HA4A 2DKFA 3SQOA 3AHCA 2WQZA 1U2EA 2JLXA 1O0SA 5FOTA 3V4VB 2XMPA 3LP5A 4ZI7F 5JR3A 1U3FA 4RHCA 4E14A 2WU4A 3JYQA 3CUVA 3UW1A 4C78A 1PNRA 2RHHA 4JD5A 4BV2A 3DTTA 3GJ0A 4KEAA 3NBFA 3QFRA 2FJPA 2QTWB 3CKMA 5C51B 1OXXK 4BC1A 4K6MA 3LQQA 4MP3A 2BGLA 3TYXA 3BK2A 4EQ6A 3QKSA 1E3EA 2ID9A 4G1UC 4JLUA 4RFSB 2QUHA 3AF4A 4E5YA 1A9OA 3K4PA 3RO7A 3FTFA 3DC7A 1F4VA 1KJJA 2ZT8A 1MW8X 1P75A 3ZK9A 5DYYA 3AM1A 3BWBA 2VH1A 1HDZA 3OOSA 4IGAA 4BMVA 2YUIA 5LYJA 1P9OA 3U49A 3TLXA 3H05A 4XKWA 4I4CA 4NV0A 4H77A 3ETCA 5CHYA 4HWTA 2NLOA 4IY1A 5FJIA 3NVKI 1H2WA 1SXIA 3GGSA 3PF9A 4XB2A 3HACA 1M10A 3MOGA 1E7SA 3WGYA 4NZNA 4JWKA 3EQ2A 3LY8A 3IP6A 1L1RA 3KZCA 4C20A 3JQDA 1JI3A 4KACA 1Q12A 4JVNA 1KFCB 4URYR 4NAVA 2NPFA 5EJMA 1SKAA 1C7ZA 3IAAA 3PPVA 4P25A 1JG2A 1SCKA 4O63O 4YAGA 2J45A 3M81A 2F8LA 5KYUA 2H1RA 5LN1A 2ZRJA 3LUPA 1G17A 2RH5A 3K05A 4HVCA 4F6RB 2WWTA 1J5PA 4UMDA 4JI6B 1AQUA 5EHXA 3K16A 4TL7A 5J2TF 1WPXA 2PV7A 4EGJA 1JEQB 3RIXA 3A4YA 2ZDQA 3QG1A 1NN3A 4PGHA 3VKUA 2GRJA 3ZCUA 2PE3A 5F23A 2GRUA 4GYKA 1TUGA 4BLTA 3ZHVA 1GTVA 5E6TA 1AGXA 4U7GA 1VC2A 2ZETA 4NU5A 2YZ2A 1KQNA 4BNIA 4ESOA 1Q3TA 4D46A 1L5SA 2RARA 2R86A 1E9EA 2Q4BA 3B2EA 1YBFA 3T0IA 5AW2A 1FFAA 5F2NA 1IQRA 2RBGA 2I9KA 5B3KA 3EAFA 4IUBS 5BV8A 5G0VA 4JOBA 4DOMA 3BQJA 2C4KA 3HB4X 3RK4A 1JFSA 1BDHA 1JEOA 4FGWA 4OPOA 3PUHA 4HE5A 2AJTA 3N05A 4IV5A 3CVUA 3WK5A 4NU0A 1HTTA 2E9SA 2EAUA 4Q7JB 2IXGA 1JBKA 3ROKA 4ND1A 1OXBB 2WAYA 5AK3A 3CF0A 1XMOB 2GYVA 2UZ0A 1BVYF 1MO4A 1HSZA 1QYXA 2FCAA 2AKYA 3K8ZA 3HRHA 5BORA 5LXTF 2AJBA 1IPEA 3U26A 5EFZA 3THYB 3PUVA 3HXKA 1A5ZA 4TT3A 1BYUA 1QGUB 1YRLA 4HQ0A 1TCUA 3EPJA 3OM8A 3JQAD 5H16A 4XIIA 4IDDA 2YHIA 3JQGB 3ZDZB 2IIVA 4AZSA 4LFAB 3DVSX 1BCSB 4V1CB 4YAOA 1Y4UA 2Z2KA 5CM8B 2F4NA 1GGEA 1EQAA 1GPLA 3BZUA 1N1MA 3WDSA 2V65A 1CTQA 2YZGA 3ZVLA 2QD5A 4Z0HO 2AG6A 3DP9A 3ZWBA 1MAUA 4FGJA 3AKCA 3I0ZA 4JQSA 1ODTC 1FP4B 3LNNA 1UBKS 2FSFA 2FUKA 2Q6VA 2R4TA 2QMQA 4R7TA 3SMVA 1TQDA 2IX3A 3IDQA 1TW3A 1TEHA 2EX0A 2P90A 3G8YA 3RVOA 1WD7A 3UG7A 1G8HA 3OFVA 3HGTA 3P19A 1Z2EA 2H7CA 3QFHA 3T6KA 2F62A 3OAAD 3K0FB 3T94A 1WE2A 2MYUA 1DJQA 4EB3A 1NV8A 4B31A 1JA0A 4GE0A 5FPTA 3FBTA 4RANA 2MSWA 4ZKDA 2RK3A 5LA6A 4QTYA 3QVMA 2QEQA 1V37A 4BQFA 3CLTC 2CXTA 2FDXA 2ZU6A 4YJDA 1K06A 2XDYA 3MBKA 4LQDA 4PAMA 4EHIA 2ZP1A 3EIXA 3M8KA 1IZ7A 1DPFA 4MP6A 4V0OA 3EDQA 4YPFA 3V7WA 4EAQA 5IDQA 1A9QA 2E21A 3KKNA 3WIVA 4A27A 4EA7A 1NZJA 5AR1A 1Q7BA 5KS2A 2QVCA 4NMXB 4C7VA 1U9ZA 1MT0A 5FI0B 4IINA 1CYEA 1H8EA 2BGUA 3O92A 4YAJA 1T9AA 3E9EA 4PLYA 1YJ5A 3V4ZA 4XX1A 2ZIZA 2P27A 2ZROA 4ZHSA 1FXWA 3EB9A 1RYBA 4EI8A 4G0XA 4XTCS 1LJUA 3OT1B 5EEHA 1NR7A 1UKBA 3QELA 5DGTA 3TKAA 2EG5A 2BEKA 3I8OA 1SQGA 5LOVF 4PVDA 4P33A 4ZGQB 1BU8A 5D51S 1Y5NA 4EH1A 3F9IA 5KINB 1T3TA 2C7RA 2BONA 5EZYB 2GO1A 4BVGA 4E3ZA 3DFIA 4CCAA 1G9SA 1Z6GA 2XUQA 2X2PA 4K46A 1FPMA 4XLEA 3TMKA 3BH7A 1EB9A 3CZ9A 1R27A 2EFJA 1LX7A 4IIUA 3ZWCA 4Q4CA 2IX9A 2PT7A 3PNKA 4I6JA 2OBYA 2CK3D 3IAS1 4TLAA 5EJ6A 1XCMA 4PC7A 1W0KD 1JQBA 1OI3A 3IP7A 4IOKA 4RK7A 2PKCA 4C2BA 5A03A 5B55A 4QC2A 2C7OA 5DNVA 5HZMA 1F60A 4ESHA 1EFVB 4IV0A 1J8YF 5DBEX 4INPA 1SKYB 2FN4A 4IX1A 4M8SA 2SHKA 4YV1A 3HYTA 1XFAA 1KOGA 5U9CA 1JSCA 1TT7A 2IYTA 1NUQA 3DVQX 5AOAA 2JJYA 3QPUA 1WXWA 3FCUB 5HF5A 1EYZA 1JZTA 1N8KA 1T3SA 2P0YA 2XT6A 4MQLA 4ESVA 1UIMA 3TEMA 2XZTA 1L5VA 3MJHA 4TV9B 3T8YA 3D02A 3DLBA 1GJRA 1QR6A 1SU4A 4ZTUB 4L8GA 2AMJA 2RHCA 3D3KA 2ZSIA 1G1AA 4CFSA 1XJ5A 5EJ5A 4DT1A 3BGVA 1KZ6A 3WTBA 4OU5A 3VYTB 2XDQA 4FOTA 1CVLA 2SCUA 4ZP1A 2FPIA 4F9EA 3EZNA 5ALWA 2CEAA 3LUKA 2AOTB 1DAHA 4KO2S 3BWEA 2ZYDA 1W73A 2PUFA 1ZESA 3OZIA 3QPBA 2HLPA 4OHUA 4G24A 2Q3CA 3K9WA 5FAXA 3R7AA 4W5HA 5KVVA 1KRXA 1SURA 2B9EA 1BVRA 1KDTA 1GLNA 1YFZA 5FR1A 1Q84A 3HUFA 4FMCB 3LT5A 3Q39A 3OI7A 1GSHA 1KNQA 3DFFA 1ENOA 5FBRB 1G2OA 2OFWA 5L3VA 4LI0A 3BN3A 1H9CA 3MCTA 3WLTA 5C37A 5LZ2A 4XM0A 2MWMA 4D43A 3SC6A 4C05A 2GN6A 3DDNA 3VR1A 2C0CA 2C4VA 2JFWA 2DBVO 2PXAA 2WINI 4BMYA 1TM3E 2H5JA 5CK5A 1REQB 4LTMA 4E2YA 1RIFA 2IZZA 4IO0A 1PW7A 4N5LA 1I30A 1IK6A 1KK1A 1ND5A 2JCYA 3DMHA 3H42B 3NH6A 5E3HA 3QW2A 4W8OA 5KWJA 3T35A 1MFPA 1HDXA 3QNUA 4I9GA 1CE8A 4JYBA 4W7HA 3UMGA 4UFPA 5JSZB 2DPLA 1B3RA 4MQEA 2VZ8A 1GCGA 1SUEA 1UP6A 2Q5CA 3A6HA 3E3NA 1Z83A 4R3UC 4S24A 3DZGA 5CTAA 2OZPA 3U7EB 2GXQA 4AKEA 4BCDA 2F1KA 3LQ4A 2BC9A 1P19A 3F8TA 1VKJA 4RULA 2WD9A 2VPWA 3H84A 3KKPA 3MS4A 2QZ9A 4GDMA 4ZYUA 4PBSA 5BOSB 2ZI6A 4XYEA 4II7A 2D1TA 2V74B 5HF6A 4XD2A 1IHDA 4M89A 5JD3A 3TLKA 4EPXA 2WF6A 3QEBZ 1EESA 4RLQA 1SPXA 4ZQFA 4BTVA 3ZY4A 3HKCB 3PC6A 4GL4A 4MUGA 3PBKA 4NHEA 3R5XA 1KMNA 2FLVA 4ZYWA 5CDFA 1RAAA 3SK0A 5DHSA 1P5ZB 4JFRA 3UK7A 4CLDA 5AVWA 2AZDA 2I4OA 1K7EB 3GJRA 3V2IA 3I37X 3U5ZB 3IQGX 2KPOA 3SLDA 2NM0A 1LI7A 3O93A 3OUTA 4LE2A 4NSNA 3FROA 1SUBA 4KXLA 2O8FA 3MWEB 4G89A 4AG5A 1LZLA 4LF6B 4YUAA 3SIXA 3VYRB 1CU1A 2Y2UA 5A3SA 2ZM6B 4QT4A 3H5RA 5AQ1A 2H00A 3UHOA 3GD7A 3WDLA 1FC0A 3PDIA 4P0TA 1RPJA 1XKXA 2ANCA 2ZXHA 1MOZA 4YRDA 1TTTA 2ONKA 4YN3A 1MOQA 3CC8A 3CIFA 3PCRB 5KYYB 1CUDA 2P8SA 1R5JA 4QUBA 4K9RA 1NAHA 4AP5A 2YZMA 2OMEA 4JYMA 1YKFA 1R0RE 4LHSA 1OW3B 4WT7A 2CHEA 4A5SA 1FOEB 3L5KA 1H05A 3GELA 1CUAA 3QIVA 3G0OA 1RQ2A 3HDTA 1FYFA 1NW7A 4ZARA 3BB4A 5T41A 1KAOA 3E1KA 1TE2A 2O2SA 3RT1A 4DWJA 5IT9A 1RAFA 3IHKA 4HIZA 4G1EB 3CX3A 4F4FA 4EI9A 5I9SA 5JASA 1FQWA 3TZEA 4TMXA 5F5NA 1LTKA 3PX7A 2D1YA 4WXRA 2WVJA 2WABA 4GPTA 4GXQA 3A1NA 3H13A 3WR5A 2VS1A 2WWFA 4RJKA 4KJXA 5AW6A 2X0FA 2JGLA 2MSEB 2XRFA 5A88A 1SCBA 5K2MA 3WDKA 3FTQA 1YI1A 3OQPA 4E13A 1SEPA 4XTRA 3A1DA 2C94A 3FCEA 5CITA 1V1RA 1VL0A 2A88A 4X54A 2P6OA 4WK2B 2FFBA 3EPKA 1EUDB 2NQ2C 2XRMA 4F1KA 1EZ4A 3SFVA 4C22A 3B3AA 4G84A 5J3OA 3B36A 1NJFA 4MVJE 4RO0A 2F67A 2NGRA 3B7PA 2WVHA 2EWVA 1LVUA 2JFNA 3U9LA 4EECA 1RI2A 1YVRA 5DVZA 1RPAA 1YJQA 3K8QA 3Q6IA 4TS4A 2QTHA 1ZUD1 4Q24A 2B82A 2DRIA 1QRUA 5DSTA 1YONA 3HDQA 2ZUEA 1ADYA 5CFPA 2A5LA 1Y3BE 1W5EA 4D7AA 2G0AA 2PLWA 5JNUA 2GFIA 4GOLD 4GW3A 5HKBA 3TJRA 1YASA 4M99A 1WXDA 3TTWA 2G82A 1Q92A 3B6MA 2X5NA 1VG9B 1CP3A 2JASA 1ZUNA 3KXPA 2HHCA 4HPXB 4RCYA 1RP1A 4TZ6A 4YAKA 5CAEB 1WW8A 5K6TA 2WSSD 1L7BA 5BNWA 3KVVA 2REBA 5KZMB 2QJOA 1NSTA 3FNHA 4QQNA 2GD0A 2NO6A 1U9IA 4J9VA 1KBZA 2VJNA 5C8VA 4F46A 1EXDA 1Z0SA 3FYCA 2PA0A 1XJ0A 4J0HA 2I2DA 2OXCA 3QVLA 5T8KA 4LSWA 3BCFA 2FK8A 5KWEA 4IUYA 1ST3A 1Q3KA 2CNNA 3D81A 1S3GA 4RWEA 1XXHB 2VBGA 3O21A 6ADHA 3H2BA 4M1OA 4LNHA 1CR1A 2B6HA 1QIDA 2VNAA 1N06A 1ZVKA 2WTEA 4EKEA 5C5EA 1PX2A 1TMGE 3GMIA 4RM2A 3DZJA 4EBFA 2PVCA 3JAWB 5CLGA 1SHKA 3L4JA 1FCJA 3GVIA 1FNCA 4P6VF 1GFZA 2FR8C 3LY9A 4O1HA 4JLNA 1O08A 2PGDA 3N5KA 4FNAA 4MQUA 3L1JA 3NTRA 4P35A 4CM8B 2OUIA 1XLWA 1RJWA 3O5AA 3E20A 3CJTA 4GOKA 5DGXA 4TUYF 4DVGA 3K6RA 2CXOA 3KKKA 2BDUA 1NMSA 1OB2A 2C82A 2R5NA 4WLUA 4DA8A 4KR0A 3II6X 1V9CA 4ML3A 4MLZA 4CQLB 5ENVA 2OESA 4H7HA 4YI3A 3BXHA 2PXHA 4LXTA 1WUKS 2IQIA 3KK0A 3WJ1A 3MTIA 5FQNA 1PEDA 1X94A 1ZIDA 4YONB 1Z8DA 1VP9A 3ZY2A 4DLPA 2W6IA 3W5IA 4L1KA 5BUCA 3P2EA 1VI5A 2YQ5A 1U3DA 5DULA 4X7EA 4NZ9A 2GCNA 2HKIA 5FNVB 1VE1A 3ZQ6A 1Z6PA 2B37A 1IHOA 3ZWYA 2PCJA 4X6UA 1SQSA 3DCYA 4KMMA 4LV6A 2EW1A 3ZX5A 2VK4A 1Y89A 4YCSA 1IHPA 2XUOA 1UD6A 2GDZA 4F3CA 4MVJM 2CJWB 3COVA 3OH8A 2MR6A 3WL6A 4EB6A 2DLCX 4WEOA 5E1DA 1HZJA 3TIGA 2OBXA 4OPVA 4XFJA 5BYKA 1T8WA 2VZLA 2O2YA 3OF5A 4R2XA 3VPSA 5JADA 1JWLA 4M1MA 1QRRA 1KOJA 4F4IA 2VBVA 1DC7A 3NTUA 1PFQA 3QUCA 4OBBA 5LQNA 4BHTA 1SCNE 1X7YA 4KG7A 4JYZA 3MGCA 3PQ7A 3MCAA 4YXWD 4FSDA 1FP2A 2WIKA 4FDLA 4AO7A 3CR8A 1P4RA 4C01A 5BV1A 3WK8A 2W6QA 3U37A 4WDQA 4XGQA 3ZKWB 4DCNA 1DJMA 2RGBA 4U2KA 3D0OA 3HTXA 3PFIA 1M90D 3IPYA 1JB1A 4QHSA 3OU7A 1WU8A 3H3XA 4KNWA 2FR0A 2O48X 1Q0PA 4M86A 3ZCQA 3E9CA 3QWFA 3IKMB 1AXEA 4LQ4A 4Q1VA 3PUWA 1YTLA 2VBSA 1XPJA 2VQ6A 1DOZA 3DBHA 5A4AA 2GLUA 3B5JA 3KEWA 1L7MA 1EFCA 2WC1A 1LS1A 4OGLA 1LVHA 4HYYA 2B1JA 3HVHA 4YMTA 2FPSA 4KDFA 3VSDA 4RWZA 1KJQA 1W29A 4CU2A 2X8KA 1V4VA 3ANXA 3CR3C 4M46A 1KI2A 1NN1A 4MUJA 3GLGE 2IYVA 3W6ZA 4DB4A 2DFKB 3C7KA 4CNBA 4IQ4A 5J43A 5FEUA 2BIFA 4OIMA 3T99A 3WSWA 5B4UA 2NX2A 3CWZA 3DDCA 4RMGA 1Z0DA 2PHZA 1WA5A 4Q7QA 2VSQA 1CVIA 1SVOA 2OTCA 5A62A 4MP8A 2J7PA 5TLSA 1GAXA 4XDYA 1Q81D 3TFOA 3MB8A 4FZRA 4IJWA 2NXCA 3P9NA 2I91A 2RAPA 3BT7A 4KFRA 3BKWA 4A03A 1H2FA 1KC3A 4P58A 3LD9A 4GWLA 4AQYB 1AGPA 1KY5A 2FDRA 4LAFA 3DBLA 2QTRA 1YBAA 3ZQUA 1Z6ZA 2J9FA 3KQUA 5AKKA 1NBHA 3EHDA 1QIIA 3SBEA 1KYWA 4AURA 4IG4A 2AQKA 2BSQA 5A71A 3L8EA 1VHWA 5ALLA 3G9UA 4FX2A 1PJ6A 3D8SA 1J2TA 1ZG3A 1TAUA 3LWZA 2Z2XA 1SO8A 3FR7A 2XLBA 4OHMA 2ZDGA 5FTKA 4GZ3A 4P26A 4IUDS 1U2DC 4C6HA 3CQ9A 3P94A 4QOIA 4BE7B 4DCOA 3JQ7A 2GZAA 3V42A 2OLJA 3UEOA 4NBLA 1ATZA 2HK7A 3LBYA 1YRBA 1QFMA 1T1EA 2QTVB 4ME6A 4W8GA 5TB5A 2RHWA 4WCDA 1OKKD 3IOBA 2IYAA 2WVGA 4G0VA 4E5UA 1P18A 1UOEA 2MR5A 3P32A 3G59A 3EOBI 4D81A 2K4MA 1IWBB 2C0PA 2IZ6A 4Y2RA 3Q7QA 2WTBA 3UK0A 4FILA 3FLMA 2GETA 2Y1FA 4U2CA 1CKEA 4CMHA 4CGZA 1O4WA 4EHNA 1KYYA 5HKKD 1EXNA 4X7BA 5FTMA 1PSZA 2QRMA 5KSWB 5FX2A 4L7QA 3L8GA 4KU4A 2Z4TA 4Y30A 1N5JA 5FR2A 1ZH8A 1D6SA 4KWCA 2GESA 2W6OA 1YBHA 2JGNA 3OZGA 4C7XA 4ZK6A 4QDZA 1NHWA 2AQHA 3NT2A 3S3TA 4LOIA 1V4NA 1O97C 1I4WA 3EGDB 3IB6A 3EF0A 1JKFA 2VDJA 4FWTA 1CUWA 4X8MA 1F3LA 5KB3A 2EJVA 3Q8MA 1JKJA 4UBOA 3T1YB 3MAJA 1Z08A 4C5AA 1A1SA 1F8YA 2B2NA 2QIOA 1O5TA 3UJNA 1RZRA 4YJ2F 2HDOA 4HZIA 2IOFA 3R3UA 1SXJA 3AJEA 4P3KA 2NXEA 1GCOA 1WP6A 1W36B 3I04A 3IT2A 3RC2A 2ENUA 2GNPA 5LQAA 1SHJA 2FUEA 3V97A 4CLRA 3GJ8A 3O4GA 4A5OA 4BJ6A 1FRFS 2PEYA 1U9JA 4G9GA 4XVUA 4Q01A 1IJKA 3PXCX 2XBLA 1PWXA 1ZM7A 3CRMA 1P33A 4TYQA 2TRSB 1TW2A 4JCOA 4DBLE 3DD1A 3HYSA 1N34B 2RDMA 2XJ4A 3OM0A 2N1BA 2J46A 3N75A 2OD9A 3ESXA 3IH5A 4LXQA 4IGIA 2NZVG 1EJBA 4W9RA 3OCUA 1XZJA 3N3BC 4YRTA 3RTAA 3ADBA 2PQ0A 3FB1A 2WNHA 3QVWA 4G97A 4QICA 2L19A 4A1OA 4ZREA 4ERXA 2WZQA 2AYZA 1EVIA 2XB6A 3MC1A 3U3ZA 4PAQA 1CETA 4NDAA 3MMZA 1N77A 1O95A 3PD7A 1YB4A 4MI3A 4Q7EA 1A0OA 1MIOA 2CMKA 3ITKA 5F12A 3K0SA 1IZZA 1GPH1 2DC1A 3CZAA 3GQVA 4PGFA 4CEJB 3OQMA 2CZCA 2UZ4A 2WE7A 2I3DA 1L0BA 2W2QA 2ZRNA 2QN1A 4X20A 4MR9B 4MZXA 2ECOA 2P9CA 3ZOZA 4AP9A 1QFYA 3AHEA 4BAZA 1NXOA 1E4EA 2CDAA 2ENWA 1RHRA 2VJQA 3I64A 4FYWA 4O4HF 4WN3A 4EFNA 4B82A 3ERCA 1P0PA 1KJWA 3DT9A 2WF8A 5H02A 3QEMA 4OK6A 3V4FA 2VTBA 1R12A 4TS1A 5DEOA 1EHCA 1TZJA 2BTEA 2VZEA 3TLZA 3WMFA 5IWAB 1M1YE 3LO8A 1EVYA 2FSGA 1XKLA 1D09A 1NTRA 3URKA 1Z68A 5CXUA 2ZJ1A 2C58A 3ZVMA 3EWAA 4P83A 2H06A 2GDJA 4MRSA 3V2HA 3I3SR 3NYWA 5JWHA 5GONF 2IHYA 3IOMA 4DAEA 5AI9A 3SBXA 4TQ9A 4JR2A 1ZNQO 4EJMA 2Q7XA 4WXMA 2G1AA 1XMIA 2EF0A 3FBGA 3SHVA 2XNDA 4C0KA 3HC7A 5LQJA 3GP8A 5CVJA 1LV8A 1MB4A 3DDZX 3NDJA 4I55B 4JIMA 4QNMA 5AHXA 3DDWA 5BQPA 1N0WA 2OAQ1 4CF4A 1K3FA 5BMVB 1Q17A 4X8OA 5IEJA 3PGMA 4AMZA 4J1SA 1Z73A 4MYDA 4MR8B 1D1TA 4FW9A 3OZVA 2NTVA 2V9PA 3IXMA 1T2AA 1IOLA 1LFDB 5EXDA 1X9GA 4EZBA 2CV1A 1X14A 1BGVA 1J07A 1MOPA 3LM8A 4ZT5A 1MEEA 3O26A 3PNVA 3W05A 4I1SA 3C5VA 1PT6A 1PJ3A 2JFPA 4D25A 5T6BA 4EW6A 1T15A 2P40A 4HDKB 1W0CA 3FNFA 1EAMA 3NTQA 4CMKA 4H1WA 4MQBA 1KC8D 2CNBA 3H5AA 2KBFA 2F3TA 1Y7TA 2RB5A 3AIIA 3NCHA 3R5TA 5GM1A 3NV7A 3H0KA 4C7KA 3SR3A 2J32A 5A1TA 2VDVE 1PT8A 1WR8A 4BP8A 1SCIA 3BJEA 5MGBA 4RTJA 5F2EA 3L3BA 4BWFB 2VBCA 3ZGOA 5C34B 4AX4A 5JG7A 3MWGA 4GEGA 4JVMA 2NZJA 4Q21A 4CE6A 4Z4CA 3UGJA 5BSHA 1LRLA 3TE7A 2IH2A 2O3RA 2O9JA 4LRYA 4RGBA 1WNFA 4DLVA 1GO2A 1VZ2A 3PJEA 4B09A 4ER3A 1WCYA 3CFYA 5KX5A 5IJ9A 4ZMSA 3DZ8A 2GLXA 3BB3A 2UYCA 5LP6B 3QEKA 4RJLA 1VLMA 2J5KA 4JXKA 3WLAA 3KJNA 4KITB 5IAAA 1V8ZA 3NUZA 2NYUA 1C0EA 1SHLA 2RGGA 3RC3A 5M7EA 5AW7A 3S81A 4DR2B 3C7TA 3RFCA 1VKOA 1C80A 3AM4A 5MN6A 1EDBA 4G07A 3A3GA 1GPAA 4HOYA 1TEVA 5JYCA 3R20A 3QHQA 3QU4A 5JZOA 4ARCA 1ZO8A 1J7JA 1F6BA 1JIVA 2XMCA 4LZWA 1Z4JA 4PFKA 1D9XA 4V03A 1AF7A 5AK0A 3HLTA 2IW1A 1E6EA 3TJMA 4ZDKA 2I62A 2VQ3A 2ZUDA 3HB5X 1ZK4A 1QZXA 1R3UA 3MLEA 4FMDB 1BFDA 3WRWA 2O2IA 2VHXA 2UZ1B 3CO5A 4FS3A 1EA7A 3NHZA 4Y2VA 2ALJA 1AZWA 3FZYA 1W30A 5AI8A 1E2FA 3ZS9A 3M4YA 2JJ1A 4MGYR 4Z4UA 1E3JA 4Q9JA 5BSRA 5REQA 1YS1X 2HRDA 3M7IA 1KD1D 2XOKD 4I7EA 4O2AF 4PXSA 2ONCA 4FFPA 2I6UA 4CTJA 1FRNA 2GJSA 3MJTA 4QBFA 1B15A 5IAGA 3BCRA 1GR0A 1NXWA 2JLAA 3CO0S 3L6UA 1DBPA 4O1IA 4I1RA 1NVVQ 3EFBA 5AW1A 4DQVA 1DEXA 5FOXA 3PDHA 3AI2A 2A1TS 2C9MA 1G2PA 5JY6A 3WQZA 4JZYA 1VP3A 4OSOA 4NOMA 3THOA 4YY3B 4EG7A 2BGWA 2DR0A 2H1IA 4KFSA 4AY2A 2VXYA 2FMUA 4AJEA 5CB0A 1QGDA 1NQ5A 1IDN1 2B1RA 2FAXA 1LWOA 1I10A 3LU1A 4FNOA 4KZKA 1QIKA 2DR3A 3OCXA 4ZYVA 1Z56C 1R6VA 4FFDA 4ROTA 2Y0EA 1JGTA 1YIDA 1E2GA 2D1FA 3AETA 3DZBA 3CEHA 3HEAA 4I6GA 3RRZA 3WGKA 2NVUB 1LBSA 3QYJA 5KOHA 4CLOB 4UHDA 3VX4A 1RKQA 2EZTA 1KERA 3U7QB 3W2TA 3R7SA 2WAMA 5EWLB 2WB2A 3P0RA 1MQSA 4D8YA 3K71B 3NAQA 4YRBA 1XAHA 3I2KA 3AU8A 1Q0TA 3X1XA 3TPZA 1U1CA 3VKVA 1IE3A 2DMRA 1RYMA 4UASA 1J22A 2KBEA 3GFGA 1TU0A 1G8AA 1K86A 2OCYC 3DMPA 1MDFA 4RXMA 4YQZA 2EEZA 4KIJA 1YBVA 4MB6A 2ODTX 2OHHA 1VHOA 3E48A 3GLKA 3IOCA 1T0UA 3OM9A 4G0YA 4WASA 2PUEA 1NP7A 3SYRA 1JFLA 4PHTA 4GU5A 1YLOA 3UJAA 2Q5EA 3IDZA 1EUZA 5ALQA 4UEJA 5G4LA 5BSUA 2HFJA 2DBZA 3O8NA 4DPKA 1TGYA 4RTRA 3W5VA 2KLHA 2EC5A 3GVHA 4RQTA 1NQWA 3WNVA 4KREA 4BO5A 1MFZA 4KXQA 4CT0A 4YH1A 1HLPA 1H2XA 3CC7B 2ZT6A 2NYRA 2C92A 2OR3A 4Y1RB 3FIUA 3AEKB 4KP7A 4LMBA 2BFWA 4XCXA 4K6HA 2P7IA 2I1WA 1D1NA 5CFZA 2PUCA 3BTUA 1GTJ1 3IYLW 2J5BA 2ZTMA 1WHSB 3WSTA 2D9RA 2GK7A 1A3CA 5CYFA 3B2QA 3KUKA 2BI7A 2WUEA 1K98A 5L6LB 1JDZA 1S3FA 2HLHA 4X97A 2FEPA 3BMNB 2ZI9A 1Y0RA 2X13A 2DT8A 5FFMA 4DRXA 3HCNA 1YDEA 1FRVA 2VF7A 1DKLA 1FVFA 2QSZA 4WVFA 5FTJA 2M6LA 3TTXA 3K6KA 4Q39A 2NSLA 4MVJP 1BFUA 1NNSA 2RI1A 4HMPA 5D85A 1YGYA 1JX6A 4AAYA 1W7AA 3BGSA 2AFRA 3RWOA 1PVDA 3E5NA 1A4UA 2YVQA 4KR2A 1QS0B 1ZK2A 2C59A 4NDNE 4RKFA 1IXSB 3RSCA 4DSZA 3HCCA 1ZU5A 2ADFA 2OAEA 1NJ1A 1NM5A 2FP3A 2WFLA 2UXCB 5B1EA 3AOGA 3RFFA 4XXHA 5FADA 5B30A 4YHHB 1MMFB 3ICQB 2AFHB 4KPGA 3BTSA 3VR0A 3SZLA 3H97A 1ETUA 4URUR 3ZS8A 4TS9A 1EXWA 2GAAA 5ALUA 3C5CA 3ZV3A 1NULA 4E1VA 1OLSA 4FKMA 1VI6A 2DX7A 1GZ3A 1M2GA 2JBAB 2VJAA 4CHTA 5DT2A 2BI8A 2XUIA 4JN6B 3HVRA 1BX0A 2IEBA 2QGZA 4YWHA 4BQIA 3KT8A 4JQZA 4DIEA 1A7UA 1PUJA 2OUKA 3OMXA 1W1UA 3HDHA 3JWGA 4KPFC 2H4HA 4HAOA 2HPZA 4JLDA 1S02A 1XTVA 2HXYA 2EGUA 1CYDA 4W7IA 3NBMA 4PAGA 1P7YA 4XZ3A 2GZHA 4BDSA 3G2NA 2VDOB 4TWAA 2XUPA 2HO4A 1B0PA 2ZE5A 1N1DA 1ZW6A 3VNRA 3FHJA 3AI3A 1T0HB 2ZYTX 3BX1A 4DILA 4EWLA 5I3ZA 4R84A 3RVQA 3ZV4A 4F2PA 1B8NA 1OB5A 2J5QA 4MKFA 5JH7A 3EVNA 2ZB8A 3A9TA 1KEKA 3DOJA 5AVOA 5KYTA 3F3SA 3ROTA 521PA 4YQYA 1FQOA 1N2IA 4GLBA 3VTAA 2DAPA 4Y2JA 3MGGA 3GB9A 1CZKA 2HBQA 3AYXB 1C7JA 3M0EA 4YP0A 3G5MA 3C8MA 3IUMA 2Q29A 3KYCA 4KIWA 4B76A 1BJRE 3P97A 1V16A 5BUQA 1W93A 1U4OA 3PIIA 1GVNB 3G2OA 4W1RA 5FLKA 2CDNA 1JHPA 2ZATA 1CR2A 4Q1FA 4Z9XA 1Y8RA 2DUUA 1ADFA 3LS2A 1S0UA 4IVQA 3PEYA 4ANFA 3L0IB 3AX6A 1X1DA 1Y8QB 5EZYF 5K0ZA 4EX6A 1KI6B 1T6BY 2DCMA 2C4NA 5A0FA 4EMBA 3AKZA 3BH0A 1EJ6A 4J4TA 1U9IC 3NHUA 5TGDA 3A8IA 3D64A 2HEIA 2PX4A 1BROA 2HJSA 5T8KC 3WSVA 5KYWB 4CI9A 1E79D 2GXAA 4DY6A 4NECA 1JPJA 3L8YA 1AO3A 4J1TA 4QV2A 4CDNA 4JA0A 1TLLA 2ATXA 1OC4A 3C7CB 1BQ3A 3CX8A 4FR2A 3ZXXA 1AKTA 3TCNA 4OJYA 5B2ZA 3DH0A 4LYGA 1IWOA 1D9ZA 4XRGA 5MFZA 3KVOA 4DCGA 1OUMA 2A4MA 3OHPA 4IIYA 3ZV5A 2J1LA 2BI4A 5GZ3A 2HEGA 3GIDA 3OEHA 4PF1A 1QDUA 3ZU4A 4CV2A 3IKJA 5BURA 4DNTB 1RRMA 4J94A 2V6JA 4Q66C 2VK8A 2FUNB 4TV9F 3FGNA 4E12A 4HV4A 2DFPA 3MXOA 1FTNA 2P5YA 1IY0A 4OH7A 2M5SA 3R6TA 3EC2A 4PPNA 4LOHA 3TSYA 1AHIA 3HJBA 3O0DA 1DFIA 4FEEA 4MB2A 2P9YA 4RY9A 1EWRA 2O0LA 1NKSA 3WNDA 3MTDA 3TQOA 4AX8A 2ZS7A 1F0KA 5KVSA 1P3Y1 3RNLA 5JHGB 1OJ7A 3QOFA 5E9QA 5THQA 3TI9A 5IC6A 5JIBA 1P1JA 1SAYA 2JB9A 3CN9A 3LX5A 1G0NA 4UHHA 4UPEA 5BNZA 5A5VA 3WGNA 4UOQA 3KOXA 4ZPXA 4BLUA 3AM5A 4CI0B 3LVRE 2QAGB 2JCSA 2H51A 2PH5A 2FPGA 2QNBA 3R0QA 4FMCF 3OFNA 4N8SA 4R51A 5HIJA 2IUUA 1I8DA 2OBBA 4RV5A 2VRBA 3DBRA 5A2GA 3IMCA 5ADHA 1E4OA 5HKLA 3HJNA 3P20A 2EP5A 1K6MA 1YR7A 2EX1A 1NPTO 2JCBA 3FUWA 1UPXA 1V6CA 4MW1A 2R60A 4Y6LA 3PJFA 2NW6A 4NS1A 5IVDA 5JS8A 5DBFA 3V5NA 3TMYA 3GCZA 3FVWA 4FXOA 2R0QC 3CTPA 1DBIA 1WEKA 2WKSA 4HWRA 1FU7A 4JSRA 3WGZA 3GVJA 2VJBA 5K1ZA 1SD5A 4W82A 4XKJA 3PTZA 3OT4A 3PV0A 4DZRA 3T56B 3F6CA 3W6PA 2GVZC 5HUQA 3BXOA 3NM4A 2PUWA 3PG5A 4RK5A 2JIDA 2WZDA 4L5YA 1NV9A 4Z9YA 3S2EA 5J47A 5K7SA 3EVFA 2TMKA 5CM9C 5MN4A 1NJ6A 1PL7A 1TAHA 2O2ZA 2YWXA 3EDRA 3GZTB 4I46A 1NJSA 4Q19A 5CCBA 1W4ZA 2Z6BD 3BXFA 3T06B 2FZ4A 2CVPA 3X1JA 1T24A 4QPCA 5FYDA 3DE3X 3TW4A 2G1JA 2WIDA 2PRJA 1NVBA 4R8KA 3PQ2A 5A02A 1GTSA 4NXMB 5BVHA 4CLXA 4E2FA 3GL9A 4IIDA 5TMDA 2ZYUX 3RRBA 2FN9A 1OB0A 5CFQA 4LX0A 1A4XA 1F12A 1MV8A 2QRJA 3G0DA 4V38A 1C29B 1O5IA 1KSGA 2LCQA 2F3SA 2Z1NA 3B82A 2JW5A 3FGZA 4J8PA 1J49A 4UE3S 5MHTA 2AOUB 3BSYA 2WTAA 5DT9A 1XTRA 2FYTA 4UNNA 1YRWA 4ZCLA 4BLPA 4BEBA 1UKCA 4IDPA 1Q1ZA 1NBAA 1WY5A 1RHJA 1Y7HA 3VVCA 3EG9B 4L76A 4OREX 4XN3A 4NMMA 4GUDA 1N9GA 1Y3IA 2C1XA 1AGYA 1CUFA 3EGOA 4JR1A 1AD2A 3QU7A 1W36D 4H08A 3RAEC 1LK7A 3DKVA 4OI2A 1E2EA 1D1PA 1E8NA 3CWQA 4ZGBA 1JEDA 3ORRA 2VWGA 2FW7A 2X0IA 2Y4NA 1DJOA 4HDOB 3K5PA 4JJFA 5BN5B 4BAGA 5KSZA 5C1OA 4ZGGA 4XKVA 1ID1A 4M8NE 2ZJ5A 3RAGA 1OWPA 4HWGA 5JYDA 1C9JA 3IVXA 1YIAA 2KI5A 1KF0A 2W93A 5ENDA 2XVYA 3KU4A 3P2KA 4RGYA 3JQ8A 2XCQA 1GKKA 1OXKB 4XGRA 3V6LA 3QF7A 5JAZA 3GFBA 1WP9A 4ZT3A 2HHAA 4P3IA 1XDWA 2C57A 1IIRA 2PO7A 2VAPA 4II2A 2ZU0C 4IZOA 1PZEA 3H1GA 2F8TA 1KPHA 2KM1A 4A3SA 3QI7A 3UWOA 2NUTB 4RJTA 4JLVA 3I6IA 4CIVA 1GRQA 3GRRA 4H6XA 4UNIA 4QYWA 4RS4A 4EY7A 5GADl 2AFIE 3DQZA 5HGXA 3U7HB 1V8OA 2Z43A 2EBFX 3O3MB 1PG5A 2P8JA 1JI0A 1ORRA 3C15C 1MRZA 2RGNA 2JJ2A 3N6VA 4L27A 3INGA 4QVGA 3T9AA 4ZJUA 4GYJA 4JJZA 4MV3A 5AKIA 1PS0A 4MIOA 1TQ4A 4DV3B 1T5IA 4JL6A 3ONNA 1H93A 4X66B 2BBOA 2BKVA 2XCUA 3O4FA 1UBFA 1D03A 4H3VA 4QUGA 3GLFE 3C74A 3C8DA 4GI1A 4GP7A 4GWGA 1ZVMA 4H1HA 2ZTHA 2PU5A 1JSLA 2FEOA 4L9SA 4ZDIA 3AFGA 2YJ4A 1BVUA 4KAJA 1WMAA 3FGPA 3GJXC 1B1CA 3F6YA 1VXOA 3HR4A 3MUNA 3O2JA 4HAVA 3ULKA 4BQEA 1QC5B 3A28A 1XN4A 3H4IA 3EGEA 4RMHA 3HR8A 1VHTA 4LOKA 4PIPA 1E7YA 3WXMA 1W2HA 2VP4A 3F67A 4HTFA 5I45A 3GRFA 1O87A 4HVAA 3I6BA 5CGQB 1DQNA 3LRXA 3WWYA 2UUAB 3NBXX 1GVHA 4HI0E 2IWHA 1Z88A 2HAEA 1C1DA 2JGDB 2IEDA 3AEQB 3PLNA 1RPNA 1I24A 1UDAA 4ILKA 4QWWA 1SXJC 1L8OA 1UFQA 2FXIA 2Q5JA 1Z4QA 1SJ9A 3ZK7A 2XLCA 1FLVA 4QBIA 1VDZA 4DKXA 1WDLA 2ZCVA 3GLVA 1RZ3A 3Q3CA 5FBLB 2PNJA 4DRYA 4DWVA 3R9XA 1IM2A 4JXJA 1T0BA 2KW5A 4B80A 1F6WA 3AJ8A 4HL6A 1YRHA 2B0CA 1EB8A 1HFEL 4GMDA 3RY8A 4IHJB 4Z8XA 5I7UA 2P2NA 1JS1X 3CKYA 4FXPA 2HQRA 1Z35A 2RHLA 1YRQA 1N5MA 3CUYA 4R8MA 5HCUA 1ACLA 3V2GA 4JR0A 1CUVA 2WKQA 2JF0A 4Y6SA 3VFDA 3ZU2A 1VPWA 4BLRA 2Q62A 4DAOA 4WZKA 1VJGA 4K9LA 3B52X 3OCJA 4GM1A 4Y9DA 2IYFA 3VVBA 1JG1A 1PK7A 1BN6A 1Q0RA 1VG1A 2QUZA 2QN8A 2VWHA 4UAGA 5T4BA 4TGLA 3ASUA 1JR2A 1WTHD 2ZXFA 3H2HA 3LX8A 1O95C 4BIMA 4JUAA 4YMUA 1DJNA 2CRVA 5TSDA 1PQUA 1ZD3A 3P7MA 4FE7A 2J3DA 1M8PA 1RYNA 3PLAE 1Y1KE 3RYFB 1ID8A 1E63A 1KMMA 3WKCA 2EWMA 2V8BA 1Z06A 2ZSJA 1BQEA 4HB4A 4XRRA 1XZBA 3Q6QA 1ODCA 3F9RA 3CW8X 2WI8A 4LGCA 1H2AS 4D26A 3U61B 4X63A 5AMXA 4KGZA 1TYEB 1E6KA 4B4UA 4BNKA 4RSGA 1WB6A 2QA5A 4X8IA 3HA7A 4OFZA 5I7EA 2KX7A 3KV1A 1I6MA 5CBPA 5LR6A 2ZJAA 1W19A 2Y3IA 4TLCA 1H66A 1LRKA 1UBHS 3S2UA 2XHEA 4G4JA 2ZRBA 4TRJA 3GZNA 1IG0A 3O8DA 1M34E 4NAHA 1P7VA 5DGIA 5JXGA 1NUAA 3MA0A 1E99A 5F73A 1PO7A 5FNVF 4PG8A 4F6CA 3EJWA 1RLUA 1ODLA 5FTNA 3T3IA 1I2MA 1AKQA 3GJYA 4KODA 2MSKA 4F3RA 3M4XA 1V3TA 1BLIA 1J0DA 1F5NA 2LRHA 2ZYWX 1Y1PA 3F8SA 4LUCA 4PFJA 1JHRA 1IPFA 1YFJA 2AEJA 1YB6A 3I3OA 3NIDB 1NF3A 4LZNA 2XXJA 3UATA 4I3FA 1AKWA 4PIMA 2OV8A 3FDZA 4E03A 4XWAA 2HY7A 5BN4A 2G63A 1XTPA 1K89A 5JMPA 3WKDA 5BXQC 4AZWA 1XRSB 5JAUA 3VM6A 1RCTE 3FLAA 3EIEA 2J5XA 3NHKA 4QBTA 5AM0A 1TT5A 4HRXA 4EQZA 2CFRA 2HQOA 4ER5A 3DEKA 2ZUVA 4OYRA 5FBKA 4LYEA 4G9BA 3U9SA 4D0NA 1LA2A 1ZRHA 3GAZA 5BOVA 5F35A 4RTMA 2PZGA 4QUZA 1QCYA 1W5TA 5JUWA 4OBXA 4PCVA 1EUYA 1Q1EA 2G1UA 4C2AA 4OXRA 1J20A 1M3SA 2J3HA 1OLUB 2C7GA 3LC1O 3O1IC 1E2KA 2RHMA 4IIVA 4YMWA 5DLQC 4DV7B 2QTGA 3AVXA 1TF7A 3A1WA 3R3VA 1GEEA 5ADUS 2O0KA 3NFRA 2QJTA 3NYQA 4ZOQI 2FCRA 3VVMA 4DK0A 1ZOLA 2YR0A 1TYBE 3UMCA 1JKXA 2XUFA 4NX2A 3USZA 1HTWA 1KJIA 3AVPA 3MWDA 2O7VA 3A27A 2ZIXB 5FUQA 4I9FA 4PYOA 3VO1A 2C97A 3V1YA 1RI3A 4B8YA 2UUOA 4P7BA 5EI5A 2O4UX 2Q2QA 1C30A 1ZJJA 2V98A 1V96A 4D4JA 4RLZA 2I2BA 2OV4A 4MA4A 1L5QA 1W581 3WGUA 4MVJA 3HLYA 1YE5A 3KPJA 2O3TA 3KE9A 1A27A 1I1NA 2V9ZA 3AU9A 5SZJA 4JUBA 3O3CA 5EZSA 1GIAA 1KZ1A 4G5SA 5CNKA 2IVZA 1SXQA 3NJ8A 1LQ2A 2NUPA 3TSZA 1TCVA 3V7AA 1L5HB 1RHMA 2ACWA 3ED5A 3EBOA 3PHBE 2Z1DA 1N5OX 3LUCA 4YASA 4J7UA 3OJFA 3IIJA 3KKQA 3U6BA 2ZR8A 1VZ3A 5F7ZA 3RSLA 5L3QB 1TK2A 2ZIVB 1KQSB 4GHWA 4HDMB 4PY2A 3RW9A 2NO0A 2Y1WA 1GEGA 2FZKA 2JK1A 4MUAA 5I7OA 1IXRC 3G7UA 2GX6A 2BFCB 2WFZA 4YP5A 4MVYA 4BX0A 2IYNA 3INNA 4QVIA 1NKVA 4E30A 3I6MA 1TZCA 2IS1A 1M5RA 4QNRA 1P0MA 3LUBA 4PBRA 2GASA 1VRVA 2HSGA 3KKEA 1GPWB 4WK6A 4WXYB 3OCCA 1T0JB 1JPNA 4NKRA 4X3CA 3DEZA 3ETLA 4L0MA 3KSRA 4J4HA 3W79A 3HK2A 3M5WA 4ZQBA 3QW4B 4JC5A 5JZMA 1OX5A 1SRQA 3A36A 3P0HA 3ZLUA 3KQKA 1XZFA 1TMYA 5LNK6 4KDEA 4M54A 1OZ0A 2H1HA 2DFVA 2RAUA 3JVUA 2XZOA 1PBTA 2JIPA 2VPPA 3QMWA 4G81A 4H15A 3ZVRA 1ISPA 3GARA 4KV9A 2PLAA 4TRMA 1JA1A 5KNCA 2VJPA 6YASA 3AEXA 4QSHA 4BV3A 2C77A 4CM3A 1ZCFA 4ZICA 1WNTA 2GS9A 2I6XA 4N6OA 2GF9A 3K0KA 3TLCA 2C5EA 1XI2A 2PMBA 3WIDA 4GPBA 5JBIA 4KSYA 4ZQHA 5A0TA 4R5MA 1M2VB 1UM8A 4E4YA 4DTCA 2HCJB 1JYFA 4PAWA 1USGA 4JQYA 4R40A 1IM8A 1NYQA 3TNDA 3TQHA 3OPYB 3GV0A 4OI1A 3VKHA 2G80A 2VJMA 2R65A 1HK7A 4L3OA 5CG2A 3WFJA 2JA1A 4P38A 2ORWA 3LT4A 2BFEA 1N7JA 3E7PA 2BCJQ 3IVMA 4BIIA 1U3UA 1W87A 2ZL7A 4LG1A 2BVNA 5FPPA 4DSNA 1VLVA 3E70C 2A35A 3LQRA 3L1IA 3DXXA 4XQFA 3HN6A 3G23A 5JYEA 1Z25A 4WW0A 4DJJA 2SKCA 4YMSA 3RJMA 3KQVA 1PZXA 5CIWA 3GWGA 4AMUA 4DDHA 1TZMA 1SMKA 4KX3A 1JQJC 4XJVA 3ASPA 1XKQA 3BULA 3CNHA 3FVQA 4C89A 3A1UA 4BEWA 4DDVA 1LLUA 1DQYA 1QZTA 2FR1A 1OFVA 4R2LA 3ZE0B 4B3DA 1WIWA 3DE7X 3V4SA 5BW4A 3TQFA 5AW8A 3N2LA 3THXA 1M0SA 1KRHA 3UT6A 4YRMA 3GUCA 2XNKA 2Q6LA 1V4BA 2FVXA 1RI1A 3AW8A 5L46A 1HLFA 2QS9A 3LG2A 3VGPA 3ZW9A 5IH7A 5KYKA 1SELA 4N9WA 2X6TA 3QMMA 5EE1A 1ZISA 1RWWA 8OHMA 2YXDA 1QP8A 2D7CA 3CNBA 4QM6A 4B0PA 5K3BA 1LWNA 2O1XA 4QBHA 3M6MD 5H5JA 3VRHA 2NYAA 3DJYA 4P53A 2BKAA 3E82A 5DM4A 3DCJA 1FFHA 1PFUA 3IO5A 2Y1EA 4ZOBA 2R2GA 2ZVDA 4FZJA 1YB2A 3IUSA 4HT3B 2GVNA 3AR5A 1WM1A 3C48A 5BQOA 1L4LA 4HG2A 1N5RA 3WLMA 4HNAB 4CIYA 3HBAA 2WSLA 1LBHA 1Q83A 2R8EA 3PPIA 1E1CB 1CQIA 1GGKA 4LGMA 1GL9B 2BUAA 4EHKA 3H2ZA 2QG4A 3O1HB 3QKRA 4OX9Y 3OE7D 1FS6A 3IULA 2VVTA 5K3SA 1IZ9A 3ESQA 1V5WA 2WPNA 4W8HA 4Z2YA 1OTHA 5E6UA 2YY7A 1UKVY 1PD1A 3CLUC 2QN6A 4ZVSA 5B1DA 1BN7A 3BICA 1P4HA 2WJHA 4KN8A 4DIBA 2JGJA 1W5AA 2IYYA 4B33A 2ZT7A 2W9XA 4OG2A 5J9FA 4IDNA 3DOEA 2XUGA 5KCMA 4RK1A 3PJRA 1Z45A 4MUIA 5B4TA 2HZ7A 2C5FA 2VPXA 1NN0A 4RZ2A 1HURA 1KORA 2RKOA 3ECCA 4RTKA 2C5GA 5ALZA 1CY7A 3UAYA 2JNWA 2Q1SA 2C84A 4DJTA 2CLFB 3LY5A 2MU1A 3AVYA 1NM5C 1Z0AA 5DBHX 5TPZA 1YCHA 5K8TA 4Q4JA 4L95C 1DO8A 5A0VA 2RHDA 5FHRA 1BEZA 1VLHA 3TGPA 3OTHA 2KE5A 4B81A 4BWVA 1M5TA 3I34X 4I55F 2CMGA 3MGAA 1D8AA 2BHTA 4KRGA 3T9DA 4LIPD 4OL9A 5BMVF 1MX3A 3SOPA 2QTLA 1QVWA 2G9ZA 3OJOA 4K9KA 4YUZA 3IDFA 4QYIB 5HUJA 3GROA 2RFLA 1PYOA 3QXJA 3WAJA 5FPHA 4XOIA 4BO7A 3SSOA 5C9ZA 2WW8A 2ECQA 5FEMA 1ZMOA 4EGQA 3I6YA 1DPGA 3U13A 4Q1AA 3V33A 5K4HA 1DUVG 4RE5A 1PIWA 5ERGB 3TMAA 1U81A 1ZYUA 4PFQA 1G7TA 2DGDA 3L7YA 1E2HA 3CCCA 4MR7B 1E2UA 3A58B 4Q48A 3ZZUA 4PLFA 4R0NA 1E7MA 4DCTA 3ICEA 3CW2A 4JI2B 3WGJA 5SY4A 4DLAA 1J23A 3MF4A 2GXUA 3R3WA 2Q6KA 2Z6UA 4MK4A 3JXEA 5ES4B 1JPUA 3FGOA 1CK4A 3H7AA 3FVRA 3UMBA 4I9UA 2VHEA 3GFPA 3SHWA 4OI0A 4KHPB 4BNLA 3IUBA 1QYWA 4LZAA 3L0YA 1B14A 3K9NA 4ROSA 4UOEA 1R74A 4PVCA 4Q6BA 1X7XB 4QLAA 3UWKA 2MHCA 3N2YA 3UQZA 4FLFA 4GGOA 1YR3A 3G2LA 1R8YA 4RJIA 3CLRC 1VHQA 1D7AA 4LJYA 1BMDA 4JJ6A 4MEJA 4NESA 3CMMA 4BO6A 1UT8A 1SOVA 4YA6A 5JEEA 4JLPA 3P4YA 2W2NA 4MS3B 4ZWNA 4JOQA 1C9NA 3EHEA 4MV4A 1OROA 3K20A 2HXGA 5I4BA 3GDGA 4H7PA 4WDRA 3CJQA 3V3KA 5DI3B 5LP6F 3J80A 1PK8A 2Z2YA 5LJIA 3LTNC 1NQAO 5IYZA 4M1KA 4HR7A 1TYCA 2E6KA 2Q8NA 1ORTA 4D3YA 4E88A 5F78A 3PHLA 1ESZA 4POOA 4I50A 3K6JA 3RAFC 2QSYA 4I8DA 5F4OA 3AM3A 1Z6TA 5B58C 1RTTA 2H5IA 4J1TC 3ZIAA 4GS5A 5ULLA 2VEOA 5AI4A 1VPEA 2RE8A 1Y37A 3UJ6A 1G20B 1ZGGA 2GSDA 1WHTA 3QVGB 5A6SA 3GZJA 3PYXA 1OIVA 2CUKA 3CXUA 5AXAA 4A8HA 1K6JA 4XR4A 3SY8A 2YKGA 4JUFA 2FEMA 4BJ3A 3QEAZ 2ZWAA 2VPYA 1KPGA 5JVDB 3WBKA 1WBJB 4KUHA 2QX4A 4E94A 4OYHA 5E3JA 4ZVUA 4PG5A 5JNTA 4DR7B 1NE2A 2I66A 4WN9A 5KAPA 2XQVA 1VCMA 3RRXA 1J2UA 2FFJA 2FP4B 2L0XA 2ZSUA 3OJCA 4GR4A 5C1IA 2O5CA 1VE7A 2EBHX 1HSOA 4JITA 4R6WA 3AZPA 4FM9A 2PE5A 1U7OA 1NC3A 1GRVA 1YMQA 1XUOA 4H4DA 1E1RA 4C4OA 3FETA 4P4TA 2WT9A 4GNKA 1VQ8B 4N65A 4DMLA 1KDVA 2EEPA 4XW2A 1FSSA 3LBHA 1J56A 3F7NA 3NT4A 5FHQA 2LPMA 4MS4B 1FF9A 1I36A 3AQIA 5LB2A 1Q21A 1QHHA 1L7QA 5NLLA 4B48A 4CKWA 2J87A 1J2EA 4K2AA 4RKYA 4UU7A 2B7CA 2RC6A 4X1KA 2ZSAA 1CEYA 4HGNA 2PZBA 4DA9A 2UUBB 3I39X 2EX4A 2OV3A 3WLIA 4D0RA 5JMTA 3NONA 1IN8A 2ASVA 2D5IA 4H7EA 3U7IA 2GQFA 3AESA 4UDOA 1I7DA 4KXNA 2YN2A 8GPBA 3HWX1 3L93A 3LP6A 1NI4B 2O2HA 3L4SO 1TM1E 4KLCA 4ZEXA 1I4EB 2A9KA 4N03A 1YI0A 4X07A 3RVRA 1XEXB 4CMIB 4CLEA 4Z3DA 4XGIA 1O96A 5T64A 2JARA 3TR6A 1XGKA 2ZZKA 4IJMA 3TZQA 1M1YA 3ND7A 2JLYA 3EX7C 1H65A 4H9GA 1VKHA 2VDKB 1KKUA 4OH1A 5EHQA 1G8JA 1XZKA 1ZLXA 3O8OB 4HDNA 4BRWA 4W5NA 4BJ1A 1D2GA 2Q9BA 3ROZA 4YPVA 1JL3A 2PV0A 4BB5A 1QR2A 1J99A 1GNVA 1WSDA 4J16A 5L7YA 5J4LA 2Q45A 4GOMD 5H0IA 4B6FA 4B32A 3EWSA 3D6HA 1Q6YA 4P98A 3ZWXA 3IBYA 2QOEA 2LBPA 1GZVA 5C8DA 6PFKA 4FYIA 1Q1QA 3SYMA 1J5EB 3IILA 3I1FA 1IK4A 3QYFA 1PFKA 1SCQA 4XM1A 4ARZB 3PYLA 1T29A 3PDJA 1QKIA 2ZRFA 4FR0A 5JAHA 3RU2A 4JSYA 3RVNA 1U7PA 3N2GB 2Q0QA 3LDHA 2OHXA 4ZYYA 3T9FA 2RKWA 4N3NA 2B7BA 3PNPA 4H7DA 3W4JA 3OQOA 1IEVA 1FJGB 1G5PA 2KYRA 2DY1A 4ZDJA 1RCUA 3TLYA 3F0TA 1TTQB 4KTTE 4X71A 4EAAA 1KFJB 2CL0X 2N0SA 3WB0A 4PQEA 2JIZD 2XSZD 1UBMS 1P7PA 4PIVA 1DRKA 4Q1CA 1URPA 3A6LA 1FRZA 1ECLA 1A9TA 4KV7A 3KTFA 4NJOA 3ZJUA 2WWHA 3PC3A 1K73D 3T3EA 2AMFA 4HDSA 1M6WA 3KT6A 4TSFD 4EUNA 2I80A 3K09A 1YGPA 3H8JA 4WADA 1RKBA 2WM8A 3Q8XB 3R0ZA 3UMJA 2R6HA 1G8PA 5E1MA 2W6NA 4LXXA 4UNQA 4YV0A 1WOYA 3NCTA 4OJTA 2AKAB 1BCRB 1IUNA 3L1UA 4DRZA 3B70A 3TNYA 1KYQA 1WDMA 4EO4A 4LBZA 2JIBA 2FG7C 1ZSVA 5TQVA 5H9WA 2ZCJA 4HDCA 2QV0A 2Z6VA 1SOWA 5JNWA 5LU8A 3T41A 1ECBA 1W8IA 1RDFA 1NYRA 1SC4A 4ZCRA 2EFHB 4WUVA 3VI4B 1YWGO 1S8FA 2HWKA 1YE3A 2R2AA 2W6MA 3JSAA 2C7VA 3ZJ4A 1RYEA 4WX2B 3RFVA 2LVBA 4D80A 4YI5A 3DZIA 4OHYA 2I8AA 1XF1A 2ETXA 3O8CA 1EFAA 4AKTA 4HEJA 4I1OA 3P9CA 1LPBB 2WHPB 4MWCA 3H18A 3L77A 2G7MC 5CNIA 5E95A 1A7JA 4GI5A 5BW5A 7ABPA 2W2KA 1GGHA 3HU1A 3F2VA 2C61A 2B4YA 3ZBPA 3ZTWA 4ZN6A 1KEPA 3EYWA 1ULTA 4V24A 2ZYVX 2FQ1A 3R7WA 1T8PA 3ETEA 2IXAA 1ISJA 5ISMA 1MHPA 2V6FA 2VTKA 4CT4B 1ISHA 1HRKA 2HYDA 3CF4G 1R4MB 1KP2A 4QXMA 1FFDA 3RYTC 1CULC 2FPKA 2GCOB 3ESYA 2RGNC 4JLAA 4NOJA 1SUDA 4Y6RA 3BCSA 1WKCA 1Z0KA 1KQOA 5CA1B 5IASA 2P11A 1F8UA 3LC7O 5IRCD 1IUOA 1IPHA 4TWRA 3OKXA 3FPCA 3ESCA 4LFCB 2V31A 4E4TA 3P2JA 3TQTA 2XV1A 5FB3A 2OTJB 2BEUA 2H1VA 2QTAA 2ZAIA 1EEHA 4OXIA 4QXAA 2VO1A 1PVVA 3KHUA 2OZLB 2VPTA 1KQGA 2W2VA 4MX8A 1G3RA 4MW4A 5B1SA 1P2DA 3E8SA 3OJ0A 2HQBA 5KQRA 4FC7A 3T3OA 2CDBA 2AOXA 4B74A 4HVTA 3OA2A 1Y1SA 2BTOA 1I80A 3CRZA 2SNIE 3DQQA 4NZZA 3T7KA 2OECA 5B3JA 4XIJA 3ZU6A 1NB0A 1A72A 1I32A 3PR3A 2C3MA 1WUYA 2FPXA 3H5TA 4LE1A 3TTUA 5F3WB 1UKYA 3TI7A 4H6VA 5T57A 4L75A 4E0FA 4LYJA 4CL8A 4U39A 2I6QA 1XVLA 3LT1A 4N3AA 4OHOA 1G42A 3OW7A 1OXMA 2O20A 4FBLA 4LZPA 4N7MA 4C4XA 1AS2A 4MWEA 4EJ2A 5CX1A 4PPYA 1Y42X 2OSVA 3DXZA 2Y1LA 4N76A 1EQUA 1Y4SA 4HYEA 1K0FA 2B4QA 3FKQA 3LZ6A 3IP5A 3QU9A 4NEHB 4NZYA 1O9GA 3U4QA 4P0PB 3G6WA 5AJXA 3D8BA 4JI3B 2QUAA 3CXCB 6AT1A 4N7RA 2YUTA 4PX5A 3FBWA 2FZEA 2BGJA 3E35A 1O0BA 1OI7A 1DLJA 3BOSA 3KTAA 2AJCA 1VSBA 5GJCA 2F43A 1GT6A 3HU5A 4GQIA 4HUTA 3Q15C 5C18A 1GNSA 4BVJA 4H3SA 1KZ9A 3R6GA 4R1OA 1AZLA 3HYRA 1XDZA 1ZQ1A 2E87A 3Q8WA 4MNTA 4PU0A 1R4AA 2GEBA 3O90A 3OQVA 3HB7A 4AKSA 4NZMA 2IV7A 1Y7PA 4KGXA 1Z2DA 4D3FA 3IAEA 3OJWA 3OLXA 1TKAA 4OQPA 1RBMA 3ORFA 3OZRA 5FWAA 1NUTA 5AKHA 3IRVA 5BXYA 3WMGA 1TLTA 3MUFA 5TQ2A 3B8HA 3Q3EA 3K72B 3OEEA 3JD1A 4O2BA 2QRGA 2Z56A 1P62B 3TVYA 2CZQA 5LSAA 4ZTZB 4GPIB 5KPDA 1F2TB 2B7LA 4XCVA 3EC7A 1HYBA 1KYXA 3K2EA 5KTRA 2V96A 3NR2A 5F4JA 1FB5A 3TLAA 1SIOA 2JKVA 3N7AA 4CODB 3ICCA 4CR8A 4K1LA 4NJEA 3ZCRA 3TEFA 4N0MA 1WCIA 3RYIA 5JSFA 4K28A 3UIEA 2P6UA