2BMWA

Ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bmwA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bmwA02
5HXBA 2C77A 2VYQA 1VQ6B 4ACBA 1G7TA 2VNKA 5EMNA 1QVFB 1KK0A 1ZUNB 4P6VF 1AIPA 1B23P 2B7CA 3E20A 1HA3A 3CB4A 1N8RD 3LVBA 3WXMA 1KK2A 4ZCMA 4RD0A 4H9GA 1OB2A 4Y9UA 3W2HA 3I1FA 3E1YE 3AVWA 1FNBA 4PC1A 1OGJA 4PC3A 1QX4A 4FK8A 1FNDA 1IB0A 3PENA 3LRXA 2BGJA 2YWGA 4MYTA 2GQFA 4B44A 1GR1A 3WY9A 5TV2A 1YJ9B 5DSZA 3U2QA 4FN5A 1QH0A 1G7CA 1KK3A 1KD1D 3LO8A 4K1XA 4J0QA 4QHYA 3OJWA 1K73D 1FNCA 1VQNB 2XEXA 1TTTA 3JQPA 1CQXA 5TR9A 1UMKA 2B7BA 1IJFA 3AVTA 1GO2A 2RC5A 1BX1A 1GVHA 3WBKA 1YJWB 4ZCLA 3OZWA 1ZM9A 4DQKA 3MMPA 1EP1B 1EFUA 2NPFA 2X3UA 3CCLB 3OW2B 3CCEB 5AN9A 4NCNA 4RCYA 2QN6A 3U6KA 2OK7A 2PLFA 4YAFA 4AF7A 3P27A 1OB5A 1R5NA 4N3GA 4Q7JB 4M2LA 3V76A 4ZCIA 2OK8A 3CC7B 2BM0A 1EP2B 1TVCA 3ZBUA 2VNJA 1QVGB 4YAOA 2DCUA 4LC0A 5GV7A 1QUEA 1FDRA 1SM4A 1VQ8B 2OTJB 3AGPA 3ZBTA 3JQQA 1YHQB 4RD2A 1H85A 3WYAA 2B5OA 2CRVA 2BF4A 4ZGQB 3CCUB 1VQPB 2DEUA 2VZLA 1VQ9B 2J7KA 1QUFA 4TN1A 3CMAB 2QTLA 1XB2A 3J81k 2C78A 4G5GA 1U2RA 3OJXA 1DG1G 4QFMA 4NBSA 3CW2A 1YIJB 1D8TA 4RD1A 2HMAA 1R5BA 1TUIA 3VNUA 4TMWA 1N0VC 1J9ZA 3CXCB 4F7DA 3AVYA 1FRNA 2DY1A 4FWTA 1KK1A 3CCVB 3LYUA 1H42A 3B82A 1W34A 1G7SA 2BVNA 3A1FA 1TLLA 4PC7A 4U9UA 3QFRA 1Q7YD 3FPKA 1FRQA 4RD3A 2BSAA 1VQKB 3I55B 3W5VA 2YWHA 4N3NA 1BQEA 1JB9A 4WQMA 3ZZ0A 1EFTA 3AGQA 1QFYA 4RJLA 3G6EB 1KJZA 3VO2A 1FNMA 3OZUA 1QGAA 3G71B 3ES9A 1OGIA 1EXMA 2QDXA 5THXA 4AC9A 1XE1A 2QMUA 1ELOA 1NJID 1F20A 4B48A 3G4SB 1YITB 4LBZA 1KRHA 3W2IA 3CC4B 4YHBA 1JNYA 1R5OA 3W2FA 4ACAA 4ZV4A 1Q81D 2AHOA 4B43A 3CPWB 1IJEA 3W5UA 3WBJA 2QA4B 1ZM2A 4M1KA 3ZC3A 1F60A 1SKQA 1B2RA 4BPRA 2RC6A 1VQMB 1CNEA 1DDIA 1QFZA 3FJOA 5JBQA 2DERA 2FX3A 4C0SA 3JQRA 3CD6B 2BN4A 1N0UA 4HE5A 3WNCA 1QGYA 4PC2A 1KTVA 1VQ4B 3W2GA 3ZZTA 2YWEA 1I7PA 3CCSB 5H59A 2PMDA 1D2EA 1QGZA 4IW3B 3U6BA 2BGIA 1DARA 3VNVA 1VQ5B 3W2EA 2EFGA 1M90D 3VMFA 3OZVA 4B3XA 1VQ7B 1D1NA 1W35A 1E63A 3QSYA 1Q82D 4B4DA 3CCRB 3WNBA 4G1VA 1KQSB 2R6HA 1JJ2B 2E1RA 4YALA 2EIXA 4M0LA 2HCJB 1YI2B 2GPJA 3MCAA 3P26A 3VO1A 5GV8A 1EP3B 2VNHA 3B8HA 1ZM4A 4G1BA 1W2BB 4LBVA 4M53A 3CRZA 2BM1A 1WDTA 3SJZA 1AMOA 1S72B 2XNCA 2DETA 2QTZA 5KSWB 1YJNB 1K9MD 4RCZA 3AVUA 3CCQB 1A8PA 2QEXB 4RD4A 4LBWA 1Q86D 1JA1A 3ZZUA 3QFSA 4TMXA 2D74A 1E64A 1S0UA 2PIAA 1NDHA 2XNJA 2BPOA 4AF6A 2ZITA 1JA0A 1EFCA 4M4SA 4HE6A 1W87A 4UAJA 1GAQA 3CCJB 3I56B 2HDNB 4PC6A 1ZM3A 2YWFA 4ZGNB 3CCMB 4TMVA 3B78A 2BV3A 4RD6A 3WNDA 3QE2A 1GJRA 3MHPA 4EH1A 4YAWA 4Y7CA 4TMTA 3AVVA 1QG0A 5FA6A 2VNIA 1BX0A 1VQLB 4B47A 5H5JA 4R71A 3AVXA 1DDGA 1GAWA 4Y9RA 4DQLA 4C43A 1BJKA 1CNFA 1QFJA 4PGOA 1E62A 4TMZA 2OTLB 4LBYA 3QFTA 1VQOB 2BMWA 3CC2B 4YAUA 3W5HA 4P3YA 1G7RA 1EWYA 5TY0A 3CMEB 1KC8D 4MYUA 2CNDA 1M1KD 3QFCA 1K8AD
chains in the Genus database with same CATH superfamily
3L84A 4RVDA 1THTA 2GYUA 1K27A 3DCYA 1YR8A 5MN5A 2AFIA 1FTQA 2Z9BA 4HLQB 4RHYA 2X1LA 1NUAA 3BWDD 4NQZA 1B23P 1U3VA 2BUAA 2FSVA 3E48A 3E9ZA 3EVFA 3FHOA 1A5BB 1HSOA 4F72A 2Q9CA 2NUTA 4FGWA 1H1DA 1IYZA 2KS6A 3KKQA 1WP4A 3D4LA 2GREA 5JS2A 1KMNA 3THYA 1DKLA 2EHJA 3THOA 3WZLA 2QI9F 1O89A 1RLTA 2L0XA 3R3JA 4ZZ2A 1OXXK 1HDXA 1LVGA 1PF7E 2KW5A 1E6UA 2V7EA 3KE8A 4Z9XA 1ADBA 1TD1A 4ZVNA 1D4OA 1ZKDA 3HWX1 2CLLB 3N2EA 1RRGA 1FU7A 1OB2A 2HO4A 3KTAA 4KQ6A 3IBGA 3AEQA 3DZBA 4GYYA 5FLEX 5JHHB 1NW5A 4BX8A 3Q85A 5F52A 4XA8A 2JLVA 4EF5A 4M37A 2AK2A 3COPA 4G24A 2X7HA 1E3TA 1VJRA 4RFSA 5CB4B 4N3CA 2I2AA 3SXPA 1MO5A 4TGLA 1EQ2A 1RYBA 4DIKA 4RM2A 3CVXA 4YI5A 1F4LA 3MBOA 1H2HA 4ZVMA 3WZ2A 1EDBA 3LPNA 1VBMA 5HDQA 5CA1F 2PSHA 3LRXA 3DNPA 4MVYA 3ZCVA 4ARZA 3VH4A 4S1NA 2I6GA 2SICE 2H8KA 4ZD6A 5IJ9B 1OJ7A 1RIFA 3TKLA 1HNXB 4NE9A 3CNBA 5ES3A 1RXCA 4D02A 5TV2A 1XQ1A 3LXMA 4DDVA 1VG1A 1KA9H 1R5JA 3DDWA 2WVGA 1HDIA 4I2NA 1NVVR 3JD0A 4KH0A 4M8KA 4Z0NA 3TE6A 3T4EA 2W6ZA 1GFIA 2XCIA 3F78A 3KXKA 5IYZF 3IURA 3UGKA 5JATA 4UEOA 2JHGA 3Q2OA 1YB2A 3KAPA 5LPNA 2YW9A 3PXEA 1O4WA 2C57A 3AR9A 3ANXA 1GL9B 5C5EA 5TQ2A 3T0IA 2XD4A 5BNTA 5JO0A 1M8FA 3PIRA 3AFOA 3RQIA 3UG7A 4PRZA 1PL7A 1TVKA 2LUOA 4G4SP 5EUQB 3T3EA 1JDJA 1ZIXA 3QY0A 3SYRA 3RFCA 2VG8A 4UXIA 2D5IA 4X93A 5BUQA 2FDCA 1IATA 1XNQB 2B1RA 1U2QA 2VJJA 3OJEA 1A77A 1TMKA 1GCOA 3NUGA 1VMAA 3NNDA 4J91A 2B7BA 2ZYRA 4M1ZA 4N47A 1N2ZA 1RAHA 3TAUA 4EFNA 2IPAB 4ZVQA 2QLFA 2R85A 3ZPXA 3E7FA 1KE1A 3RB8A 3EGXA 3CW8X 3TF5A 1Y1QA 3QX3A 5A02A 1T9AA 2WPDD 1SIOA 4C7BA 2XRFA 3TDKA 3OTOB 3UYKA 4QPZA 2I0FA 1VKRA 3QE9Y 5FJJA 4RMGA 4KPFC 3VOSA 3HVIA 2J59A 3GJ0A 4C3ZA 1IXZA 1FP4A 3WGQA 4OUKX 1OASA 4WK0B 2R65A 2Z3WA 3H8SA 2CLKB 3T4XA 2R7MA 2FUG1 3C3JA 4GDMA 3VH1A 2JHCA 2VH2A 3HMKA 1LPSA 2UZAA 3CF4G 3VR4D 4CUJA 4TYMA 3OF2A 4WNYA 1DNPA 4LRWA 2DYKA 1H5NA 1ZLXA 5E9WA 4HQ6A 6Q21A 1DBWA 2HLDA 2G0NA 3PFFA 3RS7A 1OB5A 3NBUA 4FHEA 1IEVA 1Y3AA 2HJWA 2PFGA 2PS9A 3C1AA 3DDZX 3DR3A 1ADFA 1U7OA 3PRHA 2WZNA 1QOQB 4QJ5A 1XL1A 4R51A 1LTQA 3GJ3A 2CLCX 4PLYA 2NSDA 3RH0A 4G36A 4H1WA 3ZBUA 4YONB 2R7KA 1D4FA 3R6LA 4GVXA 2V5VA 4C04A 4EHKA 2J5BA 3FR8A 1NLMA 1KGDA 4DQXA 3NHJA 3DKRA 1KDPA 4BZQA 1GQFA 1U2GC 3CP2A 4HRVA 2ODAA 3WTBA 4F97A 5AW4A 2GKOA 2H1CA 3IIIA 3S8EA 1P62B 4L7VA 1HEIA 1WEHA 3QU5A 3FMPB 3VYTB 3AGPA 1CUEA 3T7IA 3WHPA 4OA8A 1F6WA 5IH7A 1XPRA 1USKA 2PKWA 2ZOSA 1SXQA 3UHJA 2XKJE 3BXHA 5BT8A 3KJIA 3UK6A 2JLQA 1BMFA 2BF4A 3PRKE 2WF7A 3IS3A 4J0DA 2I87A 4EECA 5IAEA 4Q4CA 2OVFA 5DGXA 5HM8A 1VQPB 1ZCZA 4G0OA 5DYIA 5IP5A 1ZL0A 2GYVA 3LT5A 4MV8A 1F9EA 4PGFA 2FWIA 4OK3A 4E09A 4E2ZA 2OCLA 2VBIA 3F7OA 1YASA 5EJ4A 5HW0A 2P3MA 2W2XA 4WNAB 3ZOZA 2AZXA 5KYYA 3H4IA 4IY1A 4LMPA 4A2QA 3GPCA 4YDHB 3AILA 3UNXA 2BFWA 1RLJA 3DFUA 3K9FC 3EXAA 4LISA 4DREA 1MF7A 3CEJA 1C7EA 3ITEA 2WF8A 2YZNA 3ASQA 5K6AA 1VIAA 3GUZA 4K9PA 1YIJB 3FUWA 4I50B 5UKDA 4RD1A 5LZ2A 4ZCPA 1KFEB 3ZTWA 1B00A 3MVEA 3Q0TA 3PUMA 1X8JA 4Q9IA 4AL4A 3BNWA 3JASA 5LQMA 2QI9C 3E82A 1Y7LA 3GEBA 2DP4E 4ZMSA 1C7FA 3L0YA 3ZEAA 4QT4A 2WTEA 3AFHA 4RJTA 1G3UA 2XH8A 2DTXA 2CXNA 1PW5A 3PS9A 2PQMA 1W5AA 1HE5A 1OFVA 1ISRA 4B6SA 4CMGA 4N48A 3TOSA 3FYUB 2J33A 3H1TA 3H5IA 1AU9A 2QMEA 3QGMA 5CVUA 4D4IA 4EBBA 5JROA 3TLJA 1Y7HA 3WWZA 5BSUA 3C15C 4UHHA 4GPZA 2W2KB 5AO9A 1WU7A 5HMLA 4RDHA 3LDAA 1G7SA 2B37A 2OV2A 2DWQA 1VC2A 2PUHA 3H17A 4HFJA 4RMJA 4FIDA 5A4FS 2HKIA 1S7CA 4X94A 3CVWA 1ZXBA 4U9UA 5I4CA 1MA3A 3FZEA 5IM5A 3SYTA 4DG9A 3Q3IA 3K15A 2G9ZA 1WZNA 4R2MA 3M4YA 3JAWB 3I6IA 2IYFA 3QELA 2BSAA 1XWFA 3Q7IA 4FYVA 1CS0B 4OL0A 1NUUA 4HGPA 4M88A 4OHOA 4LJKA 3ZWCA 2ZWIA 4OSPA 2ZJ3A 4RLHA 3SQMA 2YY5A 2JW5A 3SDZA 2OEPA 4PXSA 4EJ0A 2OL4A 3BXGA 1SRQA 3L18A 4L1KA 3X3HA 1OXBB 3CF0A 2J87A 2ORVA 2RH8A 5TF4A 3UXMA 1YIDA 1EDDA 5KOYA 1CHDA 2P6PA 3WLNA 3FN4A 1WXEA 2PTGA 3ONNA 4U2GA 4OP7A 1JKXA 1KIMA 4U1RA 4WFKA 3ZYCA 2WUEA 4MEBA 5IKXA 3PNOA 5HK8A 3SI7A 3I4LA 5B7QA 3AY3A 1GD1O 3BGOS 2WQ7A 3EBPA 2GS9A 1P80A 5ALRA 3HR7A 4YQFA 5K0JA 1REQA 2QTCA 1SHLA 3QU7A 4NCHA 1BGWA 4NC9A 1XE1A 1Y5IA 4KUEA 4NFSA 4NOLA 3RHFA 1Z0JA 4DLVA 2ZZNA 2FFJA 3HJHA 1N0WA 2FZ5A 1XA3A 1BGXT 4DMMA 5ALNA 2IP2A 1FTWA 2OLJA 4ZXPA 5FO0A 1E98A 4W8GA 5KQSA 1EFDN 3DNMA 4MS1B 3GLFA 5BNZA 1Z56C 2BBTA 1CUDA 2EKPA 2P90A 2HBRA 4AQYB 4YREA 1IN1A 2Q6KA 2XMRA 5FHQA 2ON6A 4UBJA 1W4BA 1IG3A 3AI7A 1MABB 2AHOA 1M1YB 3GLKA 1SKBA 3K32A 1T9DA 4KU4A 1R6DA 5IXJA 1P0QA 1AGYA 4HDOB 1RYEA 2OFWA 3C3WA 2B25A 2DPYA 1QX3A 2G9UA 4MH0R 1FTNA 4UUAA 4BKPA 4DYVA 1O95D 2Y9PB 3RT9A 1UJCA 4ND8A 4RNDB 3Q1KA 1FYDA 1KH1A 4GD3Q 4GKAA 1YZKA 1AHIA 1SA0A 2OBSA 3GW8A 4V24A 3F8WA 5F1KA 4DXDA 3SZUA 2RGEA 4WJKB 5HKKA 4Z99A 4EGAA 4UHKA 4F8YA 2ECKA 4KNWA 1NI4B 2P5UA 1I3NA 1MQ9A 1YUMA 2LKDA 4PX3A 2NPIA 1XKTA 3FGPA 5AK5A 1EZ1A 1UJ4A 3JQFA 4UQPA 3UH0A 4B3TB 1FNNA 4HADA 3LCVB 1Y42X 1BDHA 2J9RA 4W1PA 1X77A 2X2PA 3CD6B 4X7FA 3QG1A 1N7HA 5JOQA 2R8RA 5F5NA 1ECPA 1Z33A 2P0YA 4EVSA 2ZYVX 3F6PA 4FMCB 2AZDA 1RI1A 4L3OA 3VR5A 1FP6A 1JU4A 1PRYA 4BWYA 1N75A 1K98A 1YOVB 3GA7A 1WPQA 2PUVA 5K03A 2WJPA 1Z4JA 2M2IA 1KO7A 4J6EA 3RAGA 1T4DA 1LRKA 2W2LD 4UJ3A 5LYJB 4EF4A 4F1KA 4GIBA 2JGDA 3EBOA 5JV5A 1TX4B 2GF2A 1Y0YA 1J8MF 3DYVA 3I30X 5K4GA 2LXNA 3ZEIA 1L5RA 3FNEA 1QYVA 3CNQS 4QUAA 1N6HA 2BGIA 3T9BA 1JEQA 4BFVA 4C5AA 2EQ5A 1G2PA 1LF0A 1TPYA 2VYVD 3CZAA 2G17A 3FYUC 1JQAA 2GD1O 3OWOA 5TNXA 3SKYA 1ZAYA 1VHEA 1XZQA 1QCZA 4FEYA 2H59A 1R50A 3OM9A 1EX9A 3A6GA 4JXXA 4V3BA 1OFHA 2JAOA 2GNAA 2HBYA 4FDVA 4EKDA 4ENVA 1YCHA 1LZLA 2ZK7A 3MTDA 4FEEA 4G1EB 3S5UA 3T1TA 2CK3D 3GPIA 1J2YA 1N9KA 4YRLA 2ZWAA 3MA0A 3WK6A 4EI7A 1KY2A 3I9NA 3U4MA 5CW1A 3T51B 3TFQA 2V97A 1SWWA 3L0SA 4K9DA 4XWTA 4BQRA 2GZRA 4ZQEA 3ZE0B 2XX3A 2F1JA 2O3UA 4OPOA 4EATA 1DCTA 1QE0A 4LXHA 3CKMA 4ZIRA 3ZY4A 1NBHA 3QF4A 2VXCA 3F5MA 4MA5A 2GBIA 1J2TA 1FYEA 2XGJA 3FNHA 4NLLA 3WMWA 4ZI7B 3RSOA 3U48A 1MO4A 4HX5A 1L3CA 3HBAA 2JEYA 4E51A 1ZVJA 2B1GA 1BSVA 2ZJ7A 5ICFA 4F3KA 4UBNA 4WASA 2ACWA 3A4TA 1OZHA 2C2GA 3DP9A 3FROA 4RWZA 4X3CA 5JBNA 1Z63A 3B8HA 1GL3A 2Q3CA 3L1JA 3MS4A 3SXUA 1W75A 1USIA 5IWAB 3TJZA 1SXGA 4WFJA 5EIXA 1GPAA 3AUSA 3ZWAA 4IIVA 3THWB 3V8MA 4MKFA 1DC5A 1JFFB 1G6HA 2XNCA 3T56B 1E3IA 1NN0A 4M21A 5J9FA 3S2ZA 3PJRA 3MJFA 1RRCA 4B7ZA 1F06A 3E9MA 1NQAO 3LOUA 3JQ9A 2AWOA 3FVTA 3SLKA 5AJTA 3WLJA 1EE9A 3WL3A 3JYLA 2HGZA 1FFEA 2J9FA 3IVMA 2Y1EA 4QDUA 3RK0A 2Q5FA 1Z4OA 4OHVA 3OLVA 5D8DA 1RKVA 3FMVA 2ETXA 3HI4A 1C30B 4WX2B 5CFLA 2UYCA 1MC4A 4BOYA 3W34A 3HLKA 4FM9A 1HC7A 2OM6A 3TXYA 4GW3A 3RTDA 2QORA 1E64A 1S0UA 1MB9A 2RG7A 2UV8A 4KIFA 2X5KO 3PFGA 3GIRA 4B6FA 1P44A 3GEIA 3ZZ1A 2J4CA 3H9EO 1VCIA 4YVFA 1W73A 2FYTA 2IYVA 1K28D 3FPFA 2J8ZA 2OR3A 1N0IA 4MWGA 3TRDA 5F1YA 5FR1A 4OHZA 4RZ2A 4JBNA 1JPVA 1B3RA 2QN1A 4MP3A 3DLPX 3PJEA 4RQTA 4BNGA 2FCAA 1KQGA 4XE5A 3V6LA 2A8YA 3HUFA 3GA0A 4PYOA 3TL6A 4BLUA 2GO7A 3CESA 1DAPA 2I3AA 2NO0A 4F4UA 5M3BA 3DKKA 4JYBA 1MIOA 3Q8LA 2CMFA 4C88A 4QXPA 4MUMA 4LF6B 2OTCA 4YGYA 3HVHA 4FOOA 1FYWA 2XWQA 4N5IX 4MRMB 4Q16A 3R9WA 1QH1B 1UK7A 3A0RB 4NWIA 2AR7A 3T41A 1Y33E 3UFXB 5TPZA 5A6VA 1VZ2A 1UPUA 3D31A 1JAIA 3ZQJA 3JAMA 1Y0RA 4U00A 1JT2A 3EZ9A 3ND9A 3GDHA 3OQPA 3RUAA 3CUSA 1D2HA 3LT1A 3R5SA 2LDBA 1Y5MA 1I7NA 3Q3EA 5AI9A 1W0CA 2AG0A 2FMIA 1HLPA 3GLRA 3P4YA 4KAJA 5ALZA 4QG7A 3UC5A 3UICA 4GP7A 3LD9A 4CCSA 1KQPA 2GUWA 3G02A 3LUDA 4YP6A 1I10A 3AMVA 2R68A 3OPVA 4HAIA 1V6SA 5AXBA 4M7WA 4QVAA 1FQKA 1US8A 2WVAA 4MDYA 5TARA 4WXHA 1QU3A 4EFDA 4XR9A 1U6KA 2QENA 3UTDA 4ENUA 5AMXA 3FNBA 4P53A 5KPDA 2P1ZA 2DE0X 3WSTA 3PPVA 4LOLA 4TRJA 2RGWA 5E0OA 4LC9A 4A2WA 4GM4A 2OCXA 4IHJF 5DB4A 1O6ZA 3ENQA 3CNLA 3KB6A 4ZJPA 3D81A 1OBVA 1JH9A 3ESCA 3WGJA 3FWPA 3AONB 4E88A 1E9AA 3GFTA 5DO9A 4DLSA 3TLAA 3PFBA 3RIYA 1E7QA 4QLAA 4YQYA 2QAGC 4BU0A 1IM5A 5CVDA 5EHIA 3RI3A 3QFCA 4HD8A 4DIOA 1AN0A 1LBHA 4Q4AB 1U7TA 3VI3B 4ZOCA 1H6DA 2WU3A 2PT5A 1E3SA 2JFQA 4OBEA 4R1PA 4W8OA 3QV2A 1Q0TA 3FUCA 4CIVA 3FKQA 1SU6A 5DPMA 4LDJA 4J16C 5CDTA 3DXYA 1P75A 4HDSB 1JEAA 2C7BA 3AWDA 3EGCA 821PA 3GEPA 3GY0A 5A7GA 4K0KB 2Y0DA 4YR9A 4P6VF 3CR8A 4DV2B 3CBGA 1J2UA 1M2KA 1UDWA 3MRXA 4AZ0A 4IGKA 3LXRA 2JGNA 2NX2A 2KX7A 1G5FA 3L5OA 3P9PA 4UPVA 3WLTA 1TCUA 2H06A 2P78A 2R8XA 4TQAA 1DEXA 4EHJA 1NJGA 1XEAA 4D80A 1W19A 3MCVA 5H3LA 2MR5A 3CZRA 1RRPA 4NOMA 1G64A 2W0SA 4RESA 1C81A 2OMEA 5EQFA 2IVFA 1JHYA 1XZ8A 3PPWA 4YRIA 3L8EA 3FHTA 1QO0D 5LB2A 5AM1A 1ZO8A 2QL6A 1NNSA 4PZPA 2E4VA 2PX5A 4JL6A 4L9AA 1GTL1 4KQMA 3OOWA 5HFNA 3TBHA 3C5EA 4HV4A 3TNLA 1BFUA 4JJ4A 1XGKA 1XWIA 3DZDA 1NYTA 3ELYA 1RU3A 3SK0A 4QLBA 4M55A 3K30A 5P8WA 2MINA 2AG1A 3IJPA 1QK4A 4KMMA 4RPJA 2IV7A 1GKYA 4NZMA 4MNTA 4L4RA 3U5ZB 1HYEA 2O8BB 1JJBA 3DE6X 5BOSA 4QBGB 4CLRB 2ZDGA 4X44A 4B17A 1Z6AA 5LQKA 5K1ZA 2OQRA 2PNFA 3RVNA 3RSZA 4BNLA 3OY7A 2J5RA 3M9WA 1VF7A 1WPXA 1XU9A 1XV5A 3F90A 3WGHA 4QHSA 4AIIA 4P86A 4RDIA 3LPMA 3FOFC 1EEHA 1R0SA 2YV5A 4AZSA 4P3PA 3ZGLA 3WGIA 1OFUA 2XDQB 4K1XA 1XT6A 3OE1A 3TB4A 4RX1A 4F4IA 2AEFA 1VJTA 4W5QA 1BE8A 5DHAA 1ZFNA 2BFBA 1U7ZA 2OBXA 3VZDA 3EQ6A 1P31A 4II2A 1U0HC 1GTJ1 1P2BA 1XEXB 4LYFA 3LLMA 4U9HS 3SZLA 3W9BA 1BWQA 1X38A 3DL4A 5FOSA 3V5NA 2XNKA 4RLQA 4Q1CA 1SULA 4DNFA 1NR1A 1Y80A 2JATA 2ZXEA 1XZIA 2CLOB 3I1YA 1VPWA 1T5TA 3UAGA 4YRSA 4ND7A 5C3MA 2I4LA 1E0SA 1GZ3A 1RWXA 2H4ZA 4KVZA 4JXJA 1HM5A 1P73A 2R5WA 1YAJA 3MT7A 5T67A 4KLZA 4AX4A 2OGZA 1PSWA 4EQ6B 3OZWA 4FKZA 4X91A 4KYIB 1CB7A 1I18A 1JSXA 3BE4A 2XCRB 4M9RA 5C0OE 1GUZA 3C7AA 4Q4AA 4W1SA 3SYNA 4BBJA 3L4JA 3JYPA 3LI2A 4WZLA 3CUEF 1H9AA 2XYPA 3HCFA 3ICOA 4MW0A 5LA6B 3R8XA 4RZIA 5REQB 4A36A 2GDJA 2ECQA 4U4AA 5JNTA 5SZKB 1LV8A 4DHEA 1ZD5A 4YIKA 1ZW6A 3UJCA 3L0BA 2Q1SA 3ROKA 1DZ3A 2R4QA 2G28A 3BXXA 5F4ZA 3NHWA 1VB3A 2PBRA 2QXYA 3DOHA 3GL9A 4H59A 4MB0A 4OM7A 4YAFA 4MUNA 1P9WA 4KOEC 5TQVA 2Q7OE 3G13A 3EEQA 1J56A 4ZCIA 1M74A 2N3ZA 3AUXA 4YP0A 4ZVPA 4DIEA 2C2MA 2HA7A 2X0EA 4QPPA 4B73A 4WBNA 3BJMA 1IXSB 1P5RA 2Q2WA 3SF0A 3W7BA 4UZEA 1M2OA 2GQ0A 3OFSA 3AUTA 4U7JA 2FP4B 4QATA 2BKXA 3H7AA 3HDJA 4KWCA 2Q9AA 3ONFA 2X5XA 3UJAA 3ZDCA 2I7XA 1DKQA 1YU9A 1JVBA 3MXOA 2ZZEA 4JOSA 4AS1A 4O1HA 1K7SN 1UFRA 1PD1A 2XYRA 2H29A 5ALKA 1X2EA 5DX0A 2FR8A 2RSLA 1A8HA 3KUDA 5SY4A 5FX2A 1OVGA 3ZQ6A 5ETJA 5JAPA 3RKUA 3ZXSA 2CRVA 1G4UR 1QK5A 1FLDA 2JGJA 3UHOA 1NA5A 3WGYA 4J1TA 1GQQA 3DBHA 4DC0A 2GAAA 3NAQA 1KBOA 4CKWA 4I6GA 1T6BY 4ABTA 3OP1A 4F21A 5BSKA 3AF3A 2GTHA 2NNWB 1ADGA 1OPXA 5SZHB 2XCSB 2IPLA 2IYZA 3JWPA 5JCPA 3B7GA 5K20A 2PRSA 5CT5A 3OX1A 4YJDA 1DG1G 4NCAA 1TCVA 4AQDA 3ZNPA 2G0TA 3V7WA 4RIHA 1SH7A 4EWLA 3GLHA 1GRNA 3DO8A 3E9QA 1I6MA 1ZI6A 2HDWA 2HUNA 2R60A 2R6FA 1ACMA 1A7AA 3LLUA 3T7RA 4ZOEA 1SK8A 2JIRA 2JJMA 3ABQB 3KYDA 4EX7A 1R9GA 2PVPA 3ZDRA 3LQRA 2GD0A 3RDPA 3LYAA 1NATA 2J85A 5EUMA 2XY4A 2VDWB 3ESYA 4QTXA 2EL7A 3PXAA 1H2AS 2A35A 1JH8A 3EH1A 3NHPA 3M6UA 3HKEB 4M76B 1IUKA 4D79A 1G0OA 1TAQA 3KOYA 1PYDA 4Q7EA 4W9NC 1R3UA 2F62A 1C3VA 2NSYA 4XN3A 5D3MA 5FTWA 1MX9A 2A92A 5NLLA 3EULA 4YRTA 2PWBA 3JSAA 1Z83A 3SJAA 3ASZA 3PQ4A 4AS3A 2PT7A 5GAJA 4YX9A 4KREA 3I6YA 1OX4B 5KDLA 5JALA 1J7JA 1BE1A 2E3JA 2GF9A 4URHA 4S04A 3GSIA 3OH8A 4HK4A 3UGJA 4JZYA 4K6OA 4F2PA 2P4SA 1NY5A 1VPVA 2JD1A 1EWVA 3VM6A 2QWXA 3PIIA 2HT1A 4C1NA 2XUGA 1LX7A 3HCRA 1Z75A 4W5HA 3WNQA 4CM9D 1C14A 4OXNA 3KM0A 4PZ0A 2RK6A 2HFJA 1T6ZA 4FR0A 4I9UA 4LJ9A 3UB4A 1VJSA 3JWJA 8ADHA 5BSGA 2JJ2D 4MUJA 1Z0ZA 3DM9B 5CMLA 3ZNNA 1WXXA 3Q9LA 4BEJA 4EUKA 4RJLA 5GMOA 1CFJA 3RBXA 4ENWA 2HNKA 3RYCA 8GPBA 3HEBA 1FSPA 2AFRA 3LPLA 4NNOA 3AQIA 4ZVVA 1BTOA 3ECAA 2H5EA 5D5HA 5AM2A 4LFBB 2HQOA 1H4VB 1ZD1A 3C4QA 3WGKA 3CP8A 4RPDA 1WLYA 2W00A 4QBFA 3OTIA 3EVEA 4X3OA 2CBXA 2VQFB 2BTEA 2RKBA 5EYPB 3AJ9A 3T94A 2CXPA 3A3YA 2GYYA 3R0JA 5K3FA 3OURA 4WBXC 1IQPA 5FBLB 3A3BA 5HILA 3BY1A 4YROA 4RVGA 5J63A 3NKLA 3L43A 3X1MA 4L9WA 4LMRA 3BD9A 5K05A 3SIRA 2XMGA 3TB6A 1TAUA 3OQ6A 1NVTA 2Y27A 1KO5A 3E35A 1D1QA 1IOVA 3M0EA 3MSXA 1I2ZA 2Z2XA 2GOYA 2PX6A 4QODA 2Q41A 4PIMA 1JXQA 1ZOIA 3EIUA 1EUCB 5DYWA 4W5OA 4JJZA 1R6UA 2XRYA 2QRGA 4JR1A 4LJSA 4G2NA 2CKDA 4D41A 1KPHA 3U7FB 3STXA 3GGCA 1RKXA 3ZWDA 3HXTA 4FSXA 2DX7A 1F60A 4U0KA 2A3NA 1DWOA 2G7ZA 2YWJA 5TGDA 3TLMA 1LBIA 5IPFA 4DMUB 3RVMA 2ZYUX 2N47A 2XVYA 1ZUWA 2NW6A 4ND1A 3E03A 4DIFA 4W9RA 3DE2X 1QU2A 3H94A 2DC1A 4LJLA 3BL6A 4S1OA 3UN1A 1QFZA 3BIXA 4HUJA 4C05A 2JFHA 3I42A 3ITDA 3P1JA 4CKEB 3CCBA 1L7MA 1HDCA 2PL5A 3CX6A 3B36A 2NADA 3FBTA 4LY9A 4MW9A 4B33A 5KSPA 4B75A 1HE3A 1AA9A 3CW9A 3JQAB 2BN4A 1N0UA 5AOCA 4RA6A 1OZFA 5C7LO 4XTCS 4YUYA 4RVSA 2P2YA 3LP6A 2B82A 4DBLE 1N1MA 1X1DA 3B9RA 4MQUA 4EZBA 5MDHA 4UE2A 3R6WA 2NPOA 3BS4A 1N9ZA 5E7MA 2A5LA 2QVYX 1KP9A 3MFYA 3QUTA 4D0SA 1VLZA 1QB8A 4QXQA 3OD1A 5HKOA 3AP1A 3IE1A 4NJMA 1VRWA 2P3SA 3R24A 3SR4A 5IYZA 4BKOA 1J39A 3B1VA 2X14A 3UOWA 4TLCA 3LYHA 1JYFA 5K8UA 4PCVA 4KL8S 1HDOA 3A2KA 3WYDA 2QIPA 4XM2A 5FBZA 3UENA 4KDCA 2ZEJA 4FUQA 3RSCA 4K05A 1IMOA 4HEA1 4XDGA 2VBUA 1WW2A 2Q50A 4IJWA 5ALQA 4C20A 2Q07A 4MV7A 4V0RA 3ZDXB 1JE0A 2IIPA 2YCBA 5B6IA 3RYFB 4CIBA 4KR3A 1VQ7B 2H18A 2OSVA 2Q8PA 4G65A 3PJFA 4N5LA 5HFAA 1QTRA 5BMVA 1RQRA 4MJ3A 1NN1A 1OBCA 1U6IA 1YS6A 2GPYA 2QYSA 4QO8A 3KDPA 3HADA 1CYDA 2MIIA 1FJHA 1MRNA 1T4MA 4JKIA 1U2GA 4A6EA 1U0GA 3ZXUB 2BW0A 2OYCA 3W7VA 4KXFB 5AUOB 2VI5A 4FVTA 3C43A 5J4LA 3ONWA 1MW8X 1KR5A 5CEEA 4MPTA 5KJEA 1QWSA 2J3KA 4L51A 3UH1A 2GNOA 1QZUA 4RFLA 3KT8A 2QTWB 3WL7A 2OCAA 5KNLA 4XWAA 4L08A 4BKUA 3CJRA 2XNDA 1LY1A 2VHUA 4NBVA 2SNIE 5IJ0A 3P26A 2XTZA 3R9XB 3BC9A 4TXHA 4DWVA 4ZQCB 2BR5A 3HVJA 2BAGA 3G0GA 4CNBA 3VO1A 1GGFA 1W4ZA 1U9ZA 5IS2A 1T0HB 4Y2TA 2XGMA 3KXIA 1U1FA 5HKKD 4DLRA 1QH8A 1CIVA 3BA1A 5BXQC 2H2AA 5JDIC 2WABA 3GPLA 2OV4A 2SHKA 3REFA 4CKWB 2IL1A 1DKMA 4KTTE 3HFRA 1OWMA 3GA5A 1UOQA 3WTCA 1HQKA 1IZ8A 4O4LB 1UXJA 5HHTA 1RBZA 3EJ6A 4JEHA 2VHCA 1XLWA 5IT5A 2O8DB 1JHXA 4GMHA 4D9FA 5K8VA 2EBFX 3KJHA 4EB3A 4KMRA 2QJWA 2QMYA 3AOGA 4CQJA 3OPQA 4CKBA 1U8TA 4IV5A 4Y1FA 4J75A 1Q86D 4P81A 4QOHA 5KYTA 1X7XB 4RXTA 3D5TA 1MH1A 3DTVB 5G0WA 2FG6C 3PDIA 3ZGVA 4BVHA 1ORVA 1JSZA 2IUUA 1JHMA 1O95C 4H3VA 3IL2A 3X0DA 1K06A 4RK0A 4RXUA 2O2IA 1ACJA 3KKEA 3RYIA 5H9WA 1NJSA 1IPEA 2ZB8A 1N92A 2PIAA 3KOOA 4JC5A 4Y7DA 5DGIA 1CIPA 1HYQA 1PR0A 1HDGO 1I4LD 1T8PA 2ADOA 4UVIA 1JHOA 3V7YA 2PUEA 4BFYA 1JWBB 3ZDBA 2R6JA 4KR9A 1E5LA 2Y8EA 2R8EA 4DADA 3UV6A 1E9DA 3E5HA 3GFFA 2JHFA 3DW3X 4AP9A 4FWIB 4C89A 3Q8WA 2WYVA 3VJKA 2VTBB 3BH7A 2HM7A 3BQ9A 3MERA 4LCEA 4IX9A 2WI8A 1AUQA 4RVNA 4Z9AA 3RRMA 4C0BA 3G2IA 3GHYA 2CVZA 2JAUA 5AKHA 3IR5A 5EIOA 1ZMRA 4B84A 2O2CA 4IDEA 4AWBA 2ZRHA 4ZO4A 2HMUA 1F2UB 3NGLA 1OE0A 2W2QA 1SZPA 1ICEA 4MVJA 1KY3A 4JV5B 1MJNA 3JQBC 2OFFA 4B79A 3KZCA 1CG6A 2ZJ8A 2BR4A 2H3HA 2JAWA 3Q3JB 5F33A 3WNZA 2DPHA 3HCDA 2F6RA 4ENQA 2D8AA 1UWCA 2EKBA 5A03A 4TT3A 1GA4A 5FPHA 2PMKA 2W43A 2PT6A 3KZKA 2BBSA 2M6LA 3EEBA 4IRXA 4MUXA 1Z74A 1A69A 2J0UB 4OGKA 2V4UA 4Z4IA 4DNOA 3R5KA 3NPMA 1TFRA 1BXZA 4R71A 4KQIA 4OBBA 6REQA 1QKIA 2PK3A 1C1YA 1DLJA 1Z73A 4KN6A 3UMFA 2QSYA 3F6EX 4CMEA 2VCEA 4W5WA 4LAFA 2NO1A 4TMZA 2K2WA 4O4JA 4WNIA 3LXXA 2B8WA 1W9MA 5EZYF 3U7QA 1UKAA 1EJ0A 4E5YA 5GIPE 2IUYA 3CUYA 3OECA 1O6CA 3CRRA 4O4HA 5GJBA 1Y3BE 2O7VA 4WECA 2XUJA 4F9GA 2QX4A 5LYJF 4YJGB 4EF6A 5ALEA 2ACVA 5TY0A 1VE1A 1E8DA 3CMEB 1ZK1A 4ASUA 4MI3A 3ZWVA 2BF7A 2AD5A 5B4VA 5C8VA 1RMTA 2ZIVB 1TAGA 4JHLA 3ML1A 1PUXA 2AMVA 3D2LA 3UZUA 1WSWA 2JI6A 1UAGA 3E9NA 2OECA 5JDCA 4YJ2F 4CMKA 2HGSA 1ULBA 4CUKA 4MW6A 4PSKA 2RGNC 4ACBA 4I3FA 1YJ5A 3VR5H 5B3LA 3RT7A 5JCOA 2OYSA 4QXOA 1O5OA 3OZXA 4R1MA 4YTEA 3C45A 3EXG1 2JAPA 4HMQA 1VBFA 1WG8A 4TRMA 2OFPA 3EGXB 2GAJA 3E9CA 4NPCA 5HKLA 1TKRA 3QQPA 4C9BA 4IIBA 1B15A 5IMSA 5ALOA 1NVBA 1ZJ4A 3L8GA 5KI6A 3VV2A 2X5JO 1WO8A 1FUKA 4Q24A 2MMCA 3ZW9A 4CM4A 4CKXA 3IBSA 3UK1A 4A8JB 1L4BA 4Y6LA 3O4RA 1RNLA 2EJWA 3G23A 4L5YA 4RD0A 4HDRA 1DE0A 3V9PA 3GGGA 2A33A 1DC4A 3EMVA 2YIJA 3PFCA 1KI7A 4H7EA 3W2HA 3L82B 1BE6A 4N65A 3I1FA 1D8AA 2PWZA 1YVEI 4WXPA 2XDWA 3H2BA 3LIIA 1FDUA 3TVYA 4YBZA 3WQHA 2ZWMA 4ZN6A 1SR8A 3O84A 1K2WA 3K0HA 1QX4A 1Z45A 1R6BX 3NRJA 3V8NA 1MXFA 3KT0A 4MINA 3GP5A 3PWKA 4BV9A 5FV7A 4FZ3A 2J31A 3GNQA 1XQBA 2N9UA 1PWYE 1AKEA 1TK3A 1PGQA 2YOGA 3DVSX 3LC2O 4LVOA 4YJ2B 2DOKA 3M7IA 1A95A 1SVMA 4ZU3A 3ZHVA 2E0IA 2IF2A 3I23A 2CBZA 4E5PA 1XKQA 4DR6B 4O25A 3C5HA 2GZHA 3LT2A 4FFDA 1N3YA 2E21A 2MSEB 1V2HE 5IBPA 3UJBA 2B1QA 3COJA 2JRLA 3CEAA 4QUZA 1DJQA 1GGMA 3PVZA 4IIUA 3CZCA 2GEBA 4JLBA 2JCYA 3DF9A 3D59A 4MUYA 1CY7A 1O0CA 3MFQA 1SKYE 1V35A 4ZOLF 2ZZFA 4B4KA 4CMHA 3S81A 2G1AA 3FUVA 5BYAA 3VKWA 5IDYA 4J0QA 5AKKA 2QM3A 2SKDA 2C9MA 3OQIA 2GBGA 5CTJA 3MLBA 4U7PB 4WPGA 4AN4A 1P74A 1E8NA 2VR1A 2XEXA 2G77B 2FCRA 1JG1A 2FZCA 3CBQA 4CRWB 3HUTA 2HX1A 1E99A 2C84A 2ERXA 2H17A 3LJKA 3P2MA 3PLAE 4BKMA 1GNQA 2QR2A 4PHTA 5IH3A 5TPZD 5LN1A 2OGWA 3OC6A 2ZTVA 4LDQA 3E1SA 1U8XX 3O1JC 2HEIA 1SUFA 1IIRA 3KUKA 2GJ4A 2BDTA 2I71A 3CA8A 4OI2A 2IUTA 1S3IA 5H81A 3UM9A 2R00A 4DF3A 5KTRA 1PQWA 2Q3HA 3HACA 5K5EA 1UK9A 3GGSA 4PGHA 5KNCH 1N33B 2FWRA 1J9EA 3KVVA 3JQ9C 2HU8A 3PXGA 3I05A 4DBLC 2WNSA 3AHJA 4XD2A 1KBQA 3QQ5A 4DIBA 3G79A 3N3BC 5FTKA 2PYIA 5DM0A 3GJQA 2AR0A 3N2LA 1UJNA 2XVZA 2NZ8A 3W5IA 5A0VA 1T3TA 4LHVA 4U3JB 2O07A 4FCVA 2ZSJA 3A9VA 1RLIA 5F23A 2OXTA 5BYJA 4YCJA 4QVIA 1G2QA 1IFXA 1KI6B 4NK5A 1JDUA 1H2BA 3DMDA 4MWBA 3UPDA 5B30A 1RZRD 1JALA 4XGIA 4O33A 1UJ2A 2A94A 3JALB 5KTTA 1K63A 3OC0A 2GCOB 3UUEA 1IY8A 1U9JA 3GARA 1EVEA 3SEFA 5CA0B 4MB2A 4GZMA 4AO7A 1RZRA 3WADA 1ZZEA 1OLUA 3TTYA 5I7VA 2X8JB 4NPHA 4UZUA 3PFNA 4TLMB 1M2VB 4WJLA 1KAMA 2XCUA 3MLAA 5EHQA 5LNK6 3L1HA 4H4DA 4RTOA 3V48A 1PR4A 1XC7A 3P9XA 3AYXB 3PDHA 1FNSA 4RFSB 3VSCA 5CB4A 5E8JA 3CLSC 3I61A 1R6VA 1ONOA 3UUWA 2V7VA 1IXRC 2OFXA 2OMKA 1LVHA 4X20A 4EY5A 3SNHA 4LVNA 2DFKB 1WF3A 4TTPA 4X8HA 3TN7A 4EDFA 3HXQA 2C2OA 4O4HF 5DNEA 4LZOA 2NUBA 3F9IA 4RHUA 1X19A 2J9GA 4OQDA 1RWPA 3GG2A 2QTAA 3QBEA 2J0UA 5JD5A 5JJBA 1DOHA 1LBTA 4Q3NA 3KQUA 3QEMA 4MQMA 1VLOA 1ZINA 3GMTA 2PLRA 1NVUQ 4BRWA 1OFGA 1N77A 5JLAA 2YWCA 3LE8A 3BEDA 1UJ6A 2ZRKA 3FVWA 1LGYA 4MITA 3U60B 4E15A 1BJRE 3L7LA 3NTUA 3UATA 3K1AA 1P6QA 1X7XA 3PQ7A 5ADHA 4PO8A 1T0IA 3P45A 4J8PA 5D87A 5LQCA 5BR8B 1WHTB 2WUDA 1J8FA 1M7BA 4XTRA 5AK6A 2H08A 3TL3A 1SXPA 1DX6A 1Q14A 1V3VA 4GM1A 1N0VC 5LMNB 2QDKA 3ZKWB 3SLRA 2ZM6B 1M73E 3SD7A 4DSUA 3VKGA 3L07A 5F77A 1CR6A 1YIAA 3DV0B 1JFLA 1LPNA 2QX6A 1EVLA 4IYRA 3D9QX 3Q0EA 4DSAA 1GNTA 3IAAA 1HLFA 2A14A 3EG5A 4RF3A 3ADPA 1FRNA 5E1MA 3WR5A 1NHWA 4IH9A 4P7KA 3DBOB 4I7EA 4RA9B 4RENA 3EUAA 4PLTA 1NU8A 4MW2A 1USVA 1XN1A 5DBFA 3PFIA 1HMPA 4M8SA 1Z2DA 3RVPA 2MSKA 1OZAA 2QAIA 2Z5GA 3OTQA 4G84A 1GLNA 1PJQA 2I6FA 2X6YA 1KORA 3B82A 3CX3A 4G5YA 4JA0A 4M7RA 5DS0A 3OFKA 4PSCA 3A1FA 1JW9B 1XXHA 3OPYB 4W7SA 4OQPA 3WLIA 4D4GA 1KAGA 1QOPB 1Z0IA 5EXSA 2F9LA 2IZOA 4F5EA 2WZDA 2BEVA 4TT8A 2JLXA 1PN3A 3LUPA 4Y2HA 4TKOB 1U2DA 1BD4A 1FRQA 2C4TA 1YHZA 2V45A 3WLHA 1GY8A 4KZPA 1Z13A 2PGDA 1OFTA 3QPVA 1EK5A 1T8SA 4MB6A 1K8RA 1V7QA 2V9ZA 2Q4DA 2ZTUA 3D6HA 1JB9A 3TRFA 3TCNA 4CQLA 4Q1VA 2OC4A 4KDEA 5EZYB 5G3ZA 4RULA 3O8LA 1Z5UA 4I19A 2Y4OA 4INJA 4NJEB 3VU9B 1XMOB 3MYRA 1KJZA 4JHXA 3LC1O 4XZ3A 4X60A 1JEDA 1XF9A 2WSSD 4YMGA 1V4NA 5H80A 2XOKD 5GINE 1J2RA 4NULA 3RVOA 3VR3A 4AQ7A 2UUAB 1MGOA 4OJYA 1G21B 2HK7A 1DXHA 3P96A 1NI4A 4FFRA 2D1YA 3OIDA 4RF4A 4HAVA 3I12A 1IEQA 3EB9A 5I8PA 4JJEA 4KQFA 3LX5A 2CZGA 2J5KA 4RCVA 1UANA 4AJIA 2AN1A 3MZ0A 4JJIA 3NTRA 4PLGA 4URUR 1YITB 2ILVA 4ER6A 4UQLA 5IK2D 2CDBA 3UF0A 1W76A 2YHSA 3FWZA 1ULHA 3CSUA 4N4AA 4L5BA 4ME6A 1GG2A 2I3GA 4GMKA 2C7QA 1WXIA 4HH1A 4ND5A 3TZLA 3EXEB 4B43A 4RV4A 2I8AA 1Y8QB 3O31A 2QRKA 2AUMA 4ZAVA 4XM0A 4ZCTA 3TSYA 2QLMA 3X1DA 2QQ5A 4FYIA 1NBME 4UUPA 5FI0B 4DDKA 5I8WA 1XQYA 3ZIUA 1U90A 3IKTA 4L4ZA 4C6SA 2BFFB 2IRWA 3GAAA 3A10A 5KX5F 2C2XA 2PO7A 5EERA 4CM4B 4YAGA 3T95A 2BGWA 3OPYA 1M2FA 1IVNA 2C99A 4UULA 2GN9A 4FINA 5F76A 1TIPA 3JARB 5DP1A 4D4KA 3REQA 2WTBA 3P19A 1UQTA 5F3RA 4MYDA 3MGGA 1PNQA 3LF1A 3O4JA 1UP4A 5DLQC 1U7DA 4QUJA 5E0KB 4F3TA 2I54A 5DLEA 3UV7A 3ZU2A 1QYIA 1AKQA 2CKMA 2DXIA 3N2YA 1K86A 1CUGA 5AFSA 1ZDMA 2NYUA 5J2TB 4TMFA 1G8MA 2YDXA 1GSHA 3I37X 3I9LA 4YUAA 1BJTA 4P4UA 4RM0A 1ZJWA 2IKQA 2BEWB 3ZE1B 4NFLA 4ND3A 2XW6A 3AR5A 3PSHA 5H82A 2Q3FA 5AW9A 3U3KA 2CD7A 2HLPA 2PRYA 3MB5A 3UAZA 2ZRAA 4PR0A 3NGXA 2OE2A 2IYOA 5T41A 4CKYA 2JBWA 1PEAA 2WZQA 3R76A 4FXOA 1DG3A 4ZDWA 3A1NA 1U3FA 3K9HA 1DU4A 1U98A 3VR6D 4UNRA 1V0FA 2Q3EA 2AZTA 4PE5B 4US1R 2CSXA 4QDOA 4IW3B 2PVCA 5F3DA 2FK8A 2FZLA 3AW9A 3B6IA 3UJHA 4E22A 1GITA 3K6SB 4B4UA 2OVBA 4FE4A 4AYXA 4XYEA 3BA6A 1TIKA 3V7AA 2CUNA 5KX5B 3CF2A 4C2TA 2IW3A 2NTVA 4HDNA 2WPDA 1ADCA 4N8DA 1OHHD 4QDJA 4A8HA 4C4TA 2AN5A 4Q4DA 3UK2A 3PVDA 5B12A 4EGFA 1B4DA 3SLDA 2O2YA 2I4TA 1XR3A 3H1GA 4UBLA 2O52A 3G49A 3AIMA 3IC5A 3FPBA 3SHFA 1E6KA 4UFPA 4WA8A 4DM3A 2BEWA 1Q7GA 5LJIA 1Q11A 1FXUA 3NT4A 4G23A 3UMRA 3UOAB 4DNQA 2WTXA 1KC3A 1Y34E 3DBIA 4RZQA 5HCNA 4CODB 3IQWA 2ZWVA 5IARA 1BS9A 4F0JA 5AW8A 1CQPA 1IN4A 2IUFA 4B87A 3NMUF 2EIXA 2BZSA 3QVTA 1SZDA 3C3YA 4DVJA 3HN2A 2ZSAA 4L6CA 4O2AA 1QGDA 3GRAA 4GI2A 4JCCA 3U1VA 4MW5A 3O5AA 1RADA 3UTCA 5JJ5A 1Z06A 4DA6A 5HIKA 5FEUA 4K81B 1GG9A 4KQXA 4UVDA 4G5RA 3PEFA 1E3QA 1N9GA 5U9CA 1M10A 2JLSA 2KM1A 2BP7A 2HIHA 2Z2KA 1MTOA 1E3ZA 2GUGA 3HXKA 5AI4A 2IS2A 3D6VA 1Z6QA 1RWOA 2R62A 3IUNA 5C2JB 1JKMA 2FSUA 2FPUA 2ZE6A 3DAFA 3LNCA 3IDOA 5TVGA 3UW3A 4GKVA 4PYIA 2RFLA 4QPNA 1YR2A 2C03A 2FLVA 2O3RA 3GXOA 3VAAA 5A88A 1TDJA 1WX1A 2NV2B 1BEUB 3O1HB 1J2EA 3KKZA 5JASA 5DM70 4WNAA 3BM5A 2FKAA 3VAYA 1DOAA 4BB0A 2CFCA 2CE2X 3DFKA 1JEJA 2AKAB 2C58A 5TX7A 5CIQA 3VX3A 5A4MS 3A7EA 3DONA 4DRZA 1Y7IA 4WNCA 3O7WA 2IXDA 3HHEA 3IXQA 4LV6A 1FX0B 4MUHA 1NW8A 1TW3A 3VFDA 4B3IA 1OT3A 1TQ4A 4QEZA 4BZXA 3EDQA 1G5TA 2CXHA 4JODA 2HA2A 1FC0A 3EQZA 5ALIA 3OA0A 1VPTA 4HB0A 4QVGA 4DLWA 2GSDA 4B85A 1R12A 4O5OA 2PUCA 1ZD3A 3PI7A 4QSHA 5AJZA 3K73O 3F97A 4AJJA 4RV9A 4BVJA 4ARIA 5EVJA 4UBOA 1I3KA 1MVOA 4OATA 3WL5A 3BXFA 3ZR4B 2GERA 2EF0A 5HWSA 1VHLA 2FZWA 2VT6A 4NICA 1SKMA 1XCBA 2JHPA 1T91A 5HG0A 3ETDA 5LL6P 4FEAA 2FE4A 1YTLA 4KXUA 4UPEA 3U62A 3CRMA 3E22B 1KQFA 3ZD7A 2GZDA 4NBRA 1NC3A 3G17A 2DIEA 3T3OA 3GK3A 2PWYA 3WO1A 4C76A 3B5EA 4TX1A 1N6RA 1VL8A 2D5BA 2ZM5A 1BOOA 1K9SA 1E2JA 2V3VA 1R0ZA 5AK3A 3FDFA 3B52X 3HC7A 2H6EA 5JPCA 4YNBA 3CXRA 1BVYF 5G4KB 1QDEA 3QV1A 5KVCA 1ZM3A 1KIAA 1QGUA 2F9MA 3LAWA 2JFFA 2IZ1A 2VP6A 2A5GA 3CRW1 1XMJA 4HG2A 4BNIA 2MSCB 4Q3EA 1KFKB 3PHCA 1UDRA 4B83A 1VI2A 3DO6A 2XGSA 2OWEA 2NV0A 3CJQA 3K0CC 4I55F 4XOIA 1P61B 4YRCA 3GLHB 3GLIB 2RH5A 1W5EA 5TQ0A 5CFZA 1YDMA 4RGYA 5ICGA 5BQ5A 1ENYA 1L5NA 3DE5X 4CM6A 4OP3A 1LDNA 1IN7A 4B6QA 4BEVA 1TJNA 2OOSA 1Q44A 1M33A 2XQKA 3R09A 1E4EA 1AN9A 3CLTD 4A0FA 4DLLA 4B47A 2I2BA 5HGXA 4E3ZA 2CF5A 5I4IA 4FHFA 4QICA 1XFAA 4N7MA 4D4HA 3HCCA 5E4JA 3TOXA 1U2PA 1G6Q1 2VDQB 1O77A 2ZJ1A 4GE0A 3TWOA 1BJKA 2J6BA 3VYVA 4LA4A 1APBA 3JTMA 2GJKA 4GO1A 4LYAA 1B74A 4AJNA 2Z2JA 1ZJ5A 4V1CA 2PQ0A 3AR4A 5K0BA 1KL7A 3ZGZA 3CNNA 3IE0A 3SZOA 2EGHA 1EBFA 3QF7A 4GI3A 5AHRA 1BXGB 4YAUA 3IP1A 3KWMA 2BM8A 1ZK2A 3DDOA 5J2UA 2B21A 2PKCA 3STUA 2E85A 2EQBA 2XIJA 3LNNA 2UZIR 2XODA 1NASA 1CEYA 4G41A 4KQWA 2IE8A 2HQSA 5EJAA 2W6CX 2B2XA 2FQQA 4YT8A 1GSAA 2C9CA 1EAMA 3LW7A 1KEPA 2WY2D 3CM0A 4C0QC 4EYSA 1E59A 2ZGVA 1NXWA 4RQAA 3IO3A 4RNCA 2ZVQX 5IBRA 3RUFA 3FNFA 2QA5A 3SZRA 1XTQA 2IK8A 3QU2A 3ZJ4A 5LUBA 4ZHQA 3KZ1E 1P1JA 5DCYA 5SYAA 3BF8A 1NVAA 3ONVA 3L7AA 5G1PA 2FR0A 4UCFA 4D8WA 4P0PB 4DG8A 1DBSA 1OW3B 2VEOA 2R8PA 3PDCA 1S3SA 2HYDA 3NIDB 3Q1LA 3SAJA 2RK4A 1YB5A 4ER5A 4KN8A 4O2RA 4BNYA 1YZUA 2XCTB 1D7OA 4CF6A 2JANA 4JC0A 1G9SA 1WDLA 3F2IA 2WWRA 1OLUB 5DHUA 2EDCA 1WOPA 1LF5A 2J9FB 2JH9A 2Q1TA 1KSHA 1O87A 3EGIA 2ATVA 5ERXA 3VGPA 2F55A 5JI3E 4YT2A 2D3WA 4L9RA 4N9WA 1N5LA 3LQ4A 3FFAA 5KDOA 1KZ4A 2OQ2A 3T35A 1OKKD 3KEMA 5I3ZA 2H4HA 3S2FA 3ROPA 5K0EA 1WBDA 1ZRSA 5CK4A 4DL9A 3GI1A 2GZ2A 1IB0A 4Y6RA 3E4CA 4BO6A 1B0UA 3OM0A 5EA2A 4X6UA 1F4VA 5EKTA 4H60A 1E2KA 1ZU5A 3N8IA 3BKXA 3RU7A 1Z9BA 3DDNA 3N07A 5F9HA 5KC9A 4RS4A 2FQYA 2YWGA 4KXNA 4ALNA 4MYTA 2B3DA 2GPNA 3ZW8A 4B3GA 4BQOA 3SEJA 3FPAA 4NG4A 5DX1A 3B1KA 1E3MA 1B16A 2R7LA 5CLFA 3NAGA 1SY7A 1YCGA 3KKKA 3N70A 3O3MB 3QXCA 3TLEA 2BHRA 4G0NA 5DXFA 1X8XA 1F8UA 4XKWA 3KJQA 1NMXA 5FBRB 1JIUA 1RHMA 2FI1A 4WVLA 1M6WA 2IHZA 1COWD 2L69A 2QT9A 1ZSNA 4RTPA 4GMFA 5L3RA 2WJZB 5DLYA 3NBXX 2FDRA 3BORA 2JS7A 4GFDA 1CQIA 4JVNA 3PQ2A 1KD1D 2J9ZB 2CD9A 1Z4LA 4KV9A 1NI3A 4L22A 2G1JA 2HIMA 4I8DA 3VTAA 2XMDA 4KHPB 3CIOA 1D6MA 5DXJA 4ASUD 3Q41A 3BH4A 1AGRA 1XP5A 3G9QA 3LQEA 5U4XA 4KE9A 5E6UA 3GUUA 2HWKA 4D9BA 3O4GA 2ZBDA 4KQ1A 3S2EA 2D7DA 1CR0A 5TMBA 1UINA 2AQ8A 2CYAA 2H31A 2G1KA 2DWOA 2ZSEA 4MVJM 4RVOA 3UKJA 3Q88A 3PF9A 4EYQA 2PUBA 2FP3A 2GXUA 3II6X 1A5ZA 4R84A 4WKBA 1TE2A 1QK3A 3Q72A 5WRFA 1VE9A 1L7XA 2HRQA 3SC3A 3ZE8A 4CKBB 2HPHA 1ZM9A 1D09A 2W48A 3MMPA 5G3YA 3QOFA 4N7BA 3QG5A 2WILA 3Q9NA 4LMBA 4D9JA 4B3SB 1Y0BA 2Q6TA 4OAQA 2X2OA 4RVUA 4CWAA 4HVCA 2NTNA 3GYGA 4PSAA 1NVXQ 1RDFA 1C8KA 1BQ3A 2VJQA 2YXPX 2XCOA 3IERA 3L0PA 2IOFA 3HM2A 3Q6MA 3QTBA 4PEVA 2ORWA 5AD1A 3Q7RA 4R98A 1E1CB 1W47A 2AQKA 2P0EA 3BD7A 1YS1X 3D7SA 1W93A 1WB5A 1GV1A 3P27A 1OLXA 2XDYA 1T3ZA 3ORQA 4O4IA 4P98A 1KFBB 4RGVA 3I1JA 4K03A 4FBGA 5CM8B 1WP9A 5KKNB 1NM5C 1R0CA 4WKNA 2O2DA 5AOAA 1GGHA 5IW8A 2GM4A 2BFEA 1S2MA 2ZXFA 2O1EA 5I9SA 1AKWA 3EGWA 2NZUG 2XVAA 1KMCA 3FOEC 3N2KA 1Z2CA 2DCUA 1DSSG 1ND6A 2VN8A 4URFA 1Y8ZA 3ZDZB 3AY7A 4IIGA 1D3AA 5BW6B 2F43A 2BE9A 4BFUA 2WB2A 2F4VB 1BKYA 5AJVB 3A32A 1KS9A 3D8TA 4DANA 2PZGA 2Z83A 2YMLA 3D5QA 4NEQA 4OD0A 4Y9TA 2IY8A 5L53A 4XR4A 3ICQB 1P7YA 4HYTA 4P1VA 2XZPA 3NBQA 4AKEA 3OPYI 2ZCUA 2VZ9A 3ZI0A 5C4IA 2UU9B 1U63A 2YIVX 1AF4A 1DRKA 1EFPA 2O0HA 2R4UA 3L0CA 2YRWA 3BD8A 3NXKA 3ROQA 4MOWA 2ONCA 3QIVA 4N18A 1FLVA 1JAHA 4JDUA 3RVKA 2ZJZA 1KZHA 1XQVA 4Z8XA 4CBVA 3H5NA 1EWQA 1KNXA 3ODGA 1XB2A 2NZVG 2GRUA 4MVJP 4WBNB 4Y6QA 1I13A 4K8OA 4Q7KA 1SKAA 2BGTA 4EB6B 1W85B 3ORHA 4KO8A 2Q3MA 1E3XA 4G7WA 1ISGA 2DGDA 2OWDA 3TD2A 4A8JC 4MVCA 1U1GA 1Z5WA 3O3NB 3ZCRA 4NHEA 3VNUA 3AFIA 2JIPA 3NHAA 3ZCPA 4E1BA 3UT5A 3OSUA 2B5WA 1RI4A 2G3YA 2VP0A 3HPRA 3RTBA 4C3VA 4J2OA 5CVTA 2JPDA 1CT9A 5DIZA 1X7YB 3ZXXA 4JI1B 1UQRA 3QVVA 4ESOA 2HF2A 1YI0A 4G8DA 1JG2A 1IUNA 2YBEA 3OX3A 1NQ5A 3IDZA 4JYMA 4TV9F 3Q12A 4EHLA 1WQ3A 1XN4A 1RE0A 2HQRA 2D1SA 3Q11A 4G1UC 2D62A 2WC1A 2BT4A 2WEKA 4H6XA 4L75A 4RH0A 3WKDA 4F86A 2WT8A 1DADA 1VFPA 3HJGA 2CLFB 3JD4A 1KEEB 4V0MA 2HBZA 2K4MA 3K20A 4JVMA 4X7PA 5KNBD 1JPNA 5LKAA 2KLBA 5M29A 4LHZA 5B6PA 3HGMA 2MDTA 4RTQA 3FTDA 3I73A 3V9AA 4ENPA 2ZUUA 2VYNA 2C88A 2W5UA 3IP6A 2O2EA 1K7CA 4HXEB 4WEQA 1YX2A 3P0JA 2GXQA 2H4FA 1RQNA 4F2DA 2J3IA 5CXUA 5K8LA 2FY8A 3UT5B 3MBKA 1DAEA 4PLFA 2G8LA 2QTBA 1W4AA 2BFBB 2WJIA 3FR7A 3MJ4A 5FFNA 1L5VA 5FPSA 1M8GA 3WGZA 3TG2A 4WVFA 4LF8B 3BK2A 1J00A 1BW9A 4ZV7A 1AM4D 4DUYB 1X1EA 5AOBA 3W5AA 3D8UA 5FBQB 4IXTA 5KNDD 3F3SA 5C1DA 4YJ3F 5GZ6A 1OV6A 1TM2A 3UC9A 1WTAA 3I3SR 1GFZA 1SCBA 3OJLA 1KKUA 2F1KA 3JWIA 4X1KB 4CTOA 4KPUB 1KEEA 2ASEA 4FS3A 3DH0A 3A6KA 4G0VA 2VRCD 3ONEA 3WK4A 3O2NA 4WCFA 3J81A 1CV2A 2FDXA 5B3AA 4KVFA 4US2R 4OB7A 4RABA 4R81A 3MG9A 2QS9A 1GPMA 1Z5ZA 2X6WA 5THXA 4UZSA 4DA8A 4UDOA 5D1HA 2R751 4F60A 1C3LA 3HCNA 1JR3E 2GJSA 1GNLA 1KQOA 1NUPA 3TOZA 4YUWA 1QO7A 2ONZA 1SU4A 1UXHA 1GTMA 2QVLA 1TUEA 3HV0A 3OT5A 5CVEA 3WKCA 2EFJA 4BXOB 2Q9UA 4YJ3A 2B78A 1IULA 3OZ7A 1Z29A 2OKGA 5G0SA 3CCCA 1YNSA 1I3LA 2FMHA 2SECE 3K70B 1HK7A 3QLUA 2JLUA 4CM8B 4PQEA 1ORHA 4RAQA 5H70A 4ZVTA 3CKKA 5A4KA 3WGVA 3QYFA 5DTIA 1DV2A 4B74A 3QWBA 1A3CA 2JJQA 5DSTA 4ZAWA 4BZZA 2ZR0A 4G86A 2ATCA 1OBFO 3N28A 3SM9A 2J9XB 2WJ3A 3KIPA 3NBKA 4L5AA 4XUCA 2AKYA 1R7RA 3RARA 1XTTA 2VRCA 1JXAA 4FMBB 1HETA 1X3LA 2G5TA 4JWTA 1U0RA 5AJHA 2X77A 5K3BA 3WE7A 4DGQA 2ZCJA 1OU0A 3X1YA 1H6AA 4B4VA 3BTUA 4QBTA 1M7HA 1OH5A 4TLBA 1EEXB 2QIOA 2WWIA 1HZZC 1BC5A 4LZWA 3WAGA 1JR2A 1ZJZA 2Y1WA 2PKRA 4GMDA 1JNXX 4CIDA 4DAEA 3QH4A 1DBQA 4E2YA 1JN0A 4OX9Y 2VBSA 4LOJA 4LI0A 4RORA 2IYSA 1G55A 4LOKA 5IMBA 1N6NA 3WLPA 4LJAA 1PD0A 4PN7A 1KYQA 3X1XA 3K72B 1EBUA 1Y6JA 2XE4A 4FNOA 2ZVDA 1WUJS 4KSCA 5KJ1A 5DGCA 1EE2A 1H2WA 3HDTA 5DWVA 4IUBS 4BGIA 5G4LA 1DCKA 2RIRA 4IQ0A 2YWEA 3QOXA 4MVJG 1YE5A 1ABEA 4NQRA 1L5LA 1XYGA 3PJGA 3ZGNA 4D0RA 4FBMA 1HSZA 2WM9B 2C3UA 5AKGA 3ASRA 1OR8A 5JSYA 2HWUA 4JOCA 4YCCA 1A8SA 3GOQA 2O19A 1YVPA 4RZ3A 2DQZA 2IIBA 4FFNA 4YRRA 2XOKA 4GI5A 1F7UA 3LUKA 4J9VA 1ESNA 4IIJF 1RXWA 3DLIA 5DULA 1B0AA 2Y1FA 4G4IA 4URVR 2GZ3A 3R3ZA 4MI1A 3CX4A 3B1WA 2BI4A 1EFRD 1P45A 2VZ8A 4HR7A 4P25A 1GCAA 3OLCX 4IJQA 4BIMA 1XMQB 1ACLA 1IZZA 5TGTA 3RTAA 1U9YA 3AF4A 3TDNA 2VK8A 2OAQ1 1E7SA 4RLZA 3MUOA 5K8CA 2BWJA 2QM7A 1MOPA 3ILSA 1P1HA 4F04A 2OYNA 3ETLA 4MGEA 5CHYA 4LOHA 1PJ7A 2XDAA 2Q4OA 2CNWA 3IUEA 1B6TA 1J1IA 2V8OA 4E13A 1ECCA 2KHZA 5AM5A 2IYEA 4OGWA 1JZQA 1XXLA 1BEEA 1NQXA 1JJFA 2DVMA 4WKGA 2WFLA 1XQ9A 2DFDA 2EYUA 4YLGA 2OZPA 1UBLS 4GNKA 5B3JA 1EK0A 4RTMA 1UBGA 3D6MA 2Z4RA 3UOGA 4RTLA 3BGDA 3GEEA 2PEZA 4E07A 3E18A 3WAKA 2NXCA 2KLHA 1CJCA 1U2EA 1T5OA 1RXUA 2HZBA 1XDUA 3KJZA 1XEXA 2GCPA 3GF4A 4QFDA 5F64A 3WB1A 4JP3A 5L8VA 4CVNA 5K0LA 5EP4A 4BGVA 5I9BA 1XJWA 1OLSB 2G63A 3NHZA 5CRIA 1QHNA 2AEEA 2C3OA 3QVLA 1NBWB 2PEYA 4HDQB 1DPGA 2PKYX 2UUPA 1NMQA 1RE1A 1S72B 2WM3A 3O90A 3RKRA 2DPMA 1N8NA 1YH3A 1O97D 3A8JA 3T52A 4MW1A 1HQYE 5LMCA 3PX3A 2QAGB 2K5UA 1SBIA 3RIHA 1JIXA 1NE2A 2PZLA 5AI8A 3NBMA 3Q6QA 2ZJ5A 3OU7A 4O4IB 2BL4A 1JRLA 1L5MA 1QIJA 6REQB 2W42A 3W8EA 5I4BA 3AINA 3DHVA 2GCEA 5T7BA 2C8LA 5BR1A 1NUQA 2FF5A 1RAEA 5K4HA 3S68A 3IOYA 3IRVA 3JY6A 2GNPA 1MN6A 2RK3A 4RFVA 1BCSA 2RBKA 3DVAB 5L3QB 2I66A 3AF0A 4JA2A 4OHYA 1PT5A 1N2CB 1JMYA 1QM5A 1VGVA 2VYFA 3A04A 3DF7A 2PXHA 3I2KA 3TUZC 1WF6A 1V1MA 1UDBA 4ZT3A 2EKLA 4J07A 2VHEA 1JECA 1R0KA 1K7FB 2BBWA 4PNPA 4BTLA 1PTJA 1OTHA 2V4ZA 5FWAA 4ODIA 4N8SA 2GK7A 1NMSA 4IHJA 4XDYA 3JPYA 4KGXA 3RO7A 2YS7A 4RTJA 1U8FO 3IT2A 3EXEA 3G9XA 4FDAA 4CL3A 4JMPA 4CDRA 5GY7A 4LXGA 1CQJA 3IAS1 1IE3A 3MWDA 1HL7A 3HKBB 1EWKA 3T1QA 2QD1A 2VJNA 2VVTA 3B7WA 3V8EA 2OLKA 3DBLB 2JBAA 3CCMB 3R7BA 3ETCA 5LR6A 1CR4A 4XR6A 3UJ7A 3IAS6 5F2EA 1V39A 5CB0A 1LPMA 5IABA 1NG9A 4Y8VA 3V6MA 4WRRA 4J1NA 1T2DA 2QU8A 1S7GA 5T8KA 1PVDA 3REQB 3TQQA 2ZSBA 1SBTA 1YS4A 4JLOA 5MGNA 4QOGA 3AM4A 1GG5A 1P2VA 3I0MA 3FBGA 2H2FA 1L9KA 2X58A 2XZLA 3LUFA 1DCMA 2J3MA 3NLLA 4PAGA 1K66A 1KXZA 2X0FA 3R8CA 3QLTA 3VAZA 2XOXA 1U04A 5IN4A 1Q0LA 4GYWA 5T6BA 1JIQA 1MEOA 1KYVA 1VCOA 2HLNA 4BDTA 1N6LA 3I53A 4EPXA 4REQA 3EJWA 3SEQA 2ID9A 4DQDA 2R0QC 1NONA 4KFTA 4LE0A 4QU0A 5HS4A 5MFZA 1FS5A 3DZFA 2FRDA 3MWKA 1Z0AA 2FPGA 4X8MA 3P2YA 2VCYA 4MS4B 1E9SA 1JIKA 2FXIA 3BMOA 3VU8A 5BNWA 1GRRA 2MR6A 4NKRA 1KJIA 3CC2B 3KUXA 2WJ6A 3CF6R 3OKCA 4MUKA 1VLMA 4CGZA 4N7JA 3KNZA 4ZVRA 4BNKA 3L7BA 1PDOA 4G2TA 5L7YA 1E0DA 5JAHA 2XQIA 2L19A 5H16A 1QVRA 2FMKA 1IHDA 1MG5A 3PX2A 1UOEA 3EARA 3L0DA 3LFHA 5FI1B 1ZNWA 1JG4A 2WWXA 3VSEA 3HR8A 2IF0A 2WUFA 4JGBA 4C4PA 3NHLA 4Z4FA 5G4KA 2ZIUB 3WIVA 3T7DA 1U81A 1XQXA 3TRHA 1Z37A 3GPDG 2ZP1A 2LCIA 3KQNA 1UWKA 2AHRA 4JLJA 1EVQA 3ZY3A 4DZZA 2W83A 3ZWQA 1G18A 4ZDKA 1P4AA 3D7LA 2FPGB 4BE9A 2NACA 3BHIA 1WTCA 4HXGA 2HK9A 5AKXA 3TQHA 3TGPA 1H5QA 1GPDG 2XXJA 2DCMA 1DQRA 2FP4A 3M6FA 1VKNA 3T99A 2WU4A 4BUCA 3IDFA 1JUDA 1FW6A 3ZKAA 1KI9A 1N1DA 3F7MA 5E4FA 2YDYA 3DKVA 2V65A 4CMIB 2QUBA 4GOMD 3BIFA 4HY3A 1S6YA 2H16A 3BE6A 4YELA 4X07A 4RW0A 4GXRA 1YBAA 2EJUA 3L6DA 5BSVA 2YXBA 3ZIDA 1E1DA 3D7MA 2ZVPX 3G0DA 1BW9B 2QGZA 4FCTA 4R2WA 3ZY5A 5BRJA 2A57A 2IWHA 1U11A 2Y67A 3VDNB 2HSWA 3A6PC 1N57A 3DVQX 2Q3JA 4LZNA 3CMCO 5F12A 3GNTA 3WY9A 2DSNA 3ILYA 1UF9A 3MXTA 4NJMB 4XYBA 1QHXA 3DBLA 3GLQA 5FUXA 1JAXA 1GGNA 3OIYA 4ZKEA 3UMYA 1RC0A 3PA2A 1KQ3A 1A4XA 2ZJAA 3CYFA 4I4TF 1QH1A 1PJ6A 1V45E 5E2BA 2VXYA 1RRFA 5B1IA 4R9NA 1AA6A 5AP9A 4FN5A 1SURA 1PJ8A 7MDHA 5KINB 4LE1A 4TTTS 3ZY6A 3IJ5A 4Y2VA 1CDEA 3R0XA 1VXRA 4FFLA 1PJZA 1UKZA 1D04A 2QW1A 2WHPA 2QP4A 3EVAA 4PO3X 4Q1EA 4DMKA 2X8JA 1NVFA 2LIPA 4C2UA 1H1TA 4ZT7A 1WOYA 2C42A 1CS0A 3H5WA 3KHKA 2VRNA 4F45A 1EKXA 1WCIA 2PPVA 2HMVA 2PYDA 3AIOA 3QEMB 4WT7A 3T06B 5LU9A 5IDQA 1JDNA 3BAFA 4K9KA 2QU7A 3CH5A 4CU2A 1JEEA 2QN8A 3A1VA 3QXSA 3JU3A 1PEDA 4K46A 4BFZA 5JQGF 3DC7A 1UMKA 5ITZB 2NXJA 4KVGA 2C07A 1N08A 2J3EA 1TMYA 2P2GA 4PNZA 3UHAA 2V3WA 3ITNA 3Q87B 4X7EA 4ZTUB 2C2KA 5FIUA 1E0KA 5FA8A 4DQVA 4NCJA 4ZQGA 3QKRA 5FOTA 2XI4A 3FPHA 1T4GA 4TV9A 5CTAA 4YS6A 5BSFA 2Q5HA 1HT3A 1ULTA 1Z2AA 2IC5A 3RVJA 2CV1A 1VIMA 1OY1A 1XVAA 3G1WA 2PH7A 2QX7A 4YRPA 4LC1A 1KDTA 4F4FA 4R2LA 5I7HA 3ZV4A 4LHSA 2PYZA 4MKZA 4XM1A 1QRRA 3D5EA 2G36A 2XT9A 4QYIB 3OW2B 3R9KA 5CBPA 1C3XA 3H11A 2W2PA 1BH6A 1IQ0A 1YUNA 1BMTA 2G5CA 3NO4A 4K6CA 1E3DA 2W6IA 4OB8A 1LC0A 4P4SB 3OI7A 1J9GA 3HYNA 3ONYA 1E1KA 1EFPB 3EVGA 4BAZA 1JYEA 3TNDA 4GGPA 3V76A 2Y0BA 3HZRA 4FYXA 4GE3A 2YMMA 4BGEA 1YK1A 3TR0A 1VB5A 2OBBA 3PFKA 5A1TA 1G5IA 3MGBA 3PGKA 2GCGA 2W4QA 2BGUA 4ON9A 4WZBE 5DBOA 1PAUA 1ZGZA 5BSTA 3RUDA 4MKXA 3D1VA 4P3NA 4R2KA 1FCJA 4LGMA 4H0NA 2OG1A 4C4RA 4MIYA 3VR1A 3LF2A 2VUIB 1U6JA 4MO9A 1A96A 2A86A 3SKBA 1O4VA 1YRBA 1NF2A 4FHGA 3UMBA 3ETGA 3ROFA 1YHQB 2XA9A 3AR3A 4FU0A 2EZTA 3ZJ5A 1Z8NA 1YJQA 4MQ6A 4YJFB 5EJEA 1Q1GA 3GBSA 2C8VA 3KR0A 3LCJA 5THQA 2CDNA 4ALIA 5FAKA 4A2PA 3GLUA 3A9UA 5A5GA 1MENA 3ACDA 4WCDA 3G0IA 1YMQA 2J7KA 3H1EA 3LY8A 5E6RB 5T5QA 5E2IA 3VHXA 1HDRA 4JI6B 3AK4A 4GXTA 5CYGA 2GEDA 1BYIA 3RBZA 2MSLA 1ZHOA 5JNLA 2AD1A 2NVUA 4NJEA 1U2RA 4Y6GB 3ICPA 3BUSA 3IMGA 1KNQA 5JVDF 3GBVA 2WSYB 4L5IA 4OQYA 1YZ3A 1D8TA 3D2BA 3FWNA 4RLSA 5CFMA 3WXBA 3B85A 3BCFA 3EYAA 3JX9A 4OU4A 4TMWA 1NF3A 3CH7A 3OCUA 4D9EA 4F84A 2EJTA 4LDRA 3UVEA 1U5BB 2X15A 1NRKA 1J9ZA 4ZA2A 2BI7A 4K9OA 1ISJA 1AY0A 1RAFA 4IJVA 1ZN2A 4TWBA 4B8ZA 2TECE 5ICSA 4UAVA 3UK0A 5LDDC 3AEKA 5CXXA 3USZA 2FGKA 2YZMA 2FSIA 4X54A 1W36D 3JV7A 2AXNA 4L8LA 3C74A 3LBHA 2BGLA 4C4OA 2OP1A 3V7NA 4EL5A 1ZP6A 1V16A 3RVBA 5C5IA 2D1FA 2MYPA 2OCKA 3OOJA 3NTOA 1UBTS 1VLLA 3HKBA 4F1JA 2C2ZA 4Z4VA 1DOZA 3NHMA 4MRMA 3PA1A 4QJBA 1N8KA 3NTQA 5KIAA 4EHDA 5F7XA 2OENG 4KVAA 4FW8A 1NVVQ 2AEMA 1F6BA 3NYQA 4X1OA 4CXMA 1X42A 1B1CA 1YB4A 2YICA 1B0ZA 1I9GA 1MHPA 4V2IA 1E5DA 5FL7D 1VE5A 1DQZA 2ZRPA 3U3OA 4HAYA 3VZBA 2QZ4A 2WAXA 1TU0A 4N01A 5DHPA 5TQ2B 3A8KA 4J90A 4MI6A 3ESBA 3N0XA 4N3NA 1VKOA 1Z8HA 1KY5A 2FQWA 2IHUA 2YVKA 2ZJYA 4UCQA 4KGVA 2ZI3A 4JB3A 4FOTA 4RPKA 4U8HA 5BR4A 1IHMA 4DSZA 4OH1A 1MB2A 1ZM7A 1IAVA 4JI4B 4BB9A 3BL8A 4KO4S 4NDAA 3NM4A 4LJYA 4ITVA 3EZLA 3PQ6A 3CLUD 3MF4A 1NLZA 2XD9A 4D99A 1WB9A 2R8BA 4KWHA 4I55B 2WYWA 3OZRA 4YP7A 2ZREA 2QGFA 3DMGA 4W6ZA 4KYTA 1CRZA 2P2NA 3PJDA 4G1FA 3VYSB 2EIHA 3BF7A 3ZWPA 1ELOA 5HOQA 1C1DB 1OXTA 1CRQA 5A62A 1RPAA 1T5SA 3OQOA 4PONA 3PNVA 2CGEA 1GTG1 3BERA 4ZT6A 3NM5A 3H2GA 2V7BA 3K0SA 3BD6A 1F2TB 1L4KA 4R83A 3Q8MA 4JLMA 1RFLA 4ACAA 5KSOA 2PV7A 4ZTBA 4WI1A 4UVGA 2RIPA 3L01A 4WOCA 1NL3A 4XQFA 3VGJA 3VJMA 1UD3A 1L7BA 3LZDA 4YXFA 3IR6A 5ALMA 4DSTA 3CGWA 3JW8A 3O75A 1E61A 2TSYB 3HB0A 1K8XB 4KIGA 1R8YA 2A0WA 3OICA 2VTVA 2FWJA 3H3XA 4HAXA 4HWSA 5AW5A 4YFVA 1PFUA 1V1JA 4BNDB 4EUNA 3U0BA 5M7EA 5CLQA 3VDMA 2Y68A 4UHDA 2XUOA 4CDMA 4BLWA 4BQQA 4ZOQI 4FKBA 2WIDA 3M70A 4NJOA 3V8QA 4LHEA 4M1OA 1XZEA 4KLAA 1WZCA 3FJOA 3E2MA 2O0KA 1ZICA 4QV2A 3HNOA 1XTJA 3KPUA 3IAM6 4BJ5A 2RI1A 1ZH0A 4HEQA 2JKZA 2F7SA 4Z4CA 4INAA 1STOA 3AIIA 1EMDA 1PT9A 3HUUA 2M6RA 4IDAA 1J49A 2R2GA 3KYIB 4OOFA 4Q66C 4BVGA 4PC2A 2QVXX 5GIOE 3EF3A 4I9NA 5MFPA 3K9LA 4L0DA 1W94A 1YDFA 2IPNA 1NIJA 4KXLA 3ZDQA 1A98A 2HREA 3HWRA 5D3QA 3JZFA 5CDUA 4JOBA 4EG6A 2O8BA 3N86A 3P9NA 1MOZA 1UC8A 3DKPA 4YV1A 2PXCA 1MV5A 1TYAE 1GCUA 1EHCA 3GMIA 4D9GA 1AO0A 3T5PA 4KKTA 2H57A 3EN0A 3JVUA 1X86B 1E7YA 4N9QA 4Y67A 3KCNA 4OKIA 4XVRA 2YKGA 3VR0A 2PMBA 2FRDC 3W2EA 1AHNA 5EQJB 4AZTA 5FPKA 4JDPA 3VTZA 5B64A 1V5FA 3PZRA 1M90D 2CEKA 4KQKA 4C4YA 5KMGA 3W5SA 4D8XA 4PPQA 4FGKA 4FDTA 4ZJYA 1SBZA 2C2HA 3MJSA 2Q3BA 2OB1A 4UMEA 1TO6A 1W48A 2ZYGA 3MT0A 3SZGA 1AXEA 1KDOA 3W8RA 3IPXA 4KBYA 1KVQA 2YV2A 1F8XA 4NE2A 4R01A 5EXDA 1Q82D 1G5QA 1WMFA 3OVMA 3EISA 1U9IA 2UVQA 3E05A 5HS6A 1UKVY 1TM3E 2PSJA 1EUDB 1N7JA 1ZXXA 2XYGA 3EDMA 3ONDA 5B3KA 2JCSA 4RHXA 4BZWA 1U80A 1YZFA 2QN7A 1EXDA 1QIHA 4P4TA 2W6NA 2X0KA 2IYUA 1N2JA 1I2BA 2YC2C 3BIWA 1V9CA 2C61A 3A3OA 3G3EA 3SBDA 4RY2A 1H69A 1V9SA 2W2NA 3MSCA 1SC6A 2FMUA 4LJ5A 1NVGA 4S1PA 4U2BA 3U1TA 4AMUA 5IJ0B 1N7IA 1SWVA 4J3JA 1AMUA 1QPZA 2YVAA 4WZEA 2IYNA 1ILWA 3LSTA 4QELA 4R0MA 1UAAA 4MMXB 1WOSA 1U4SA 2A7QA 3LBIA 1EP3B 4LX0A 2F64A 4MICA 4IZ6A 5C37A 2FETA 1SBHA 1YRWA 1YL6A 2RBGA 5AKZA 5EXTA 3PQEA 1L7QA 5T4EA 3OF3A 3GVXA 4ESEA 1ZD9A 5CU7A 4CQLB 3AH8A 1H3EA 3GLFB 1GP2A 1AMOA 3R6TA 1C29B 1AE1A 2ONKA 4B6RA 4B3JA 1Q1NA 1S2IA 3K9GA 3R5JA 3I8XA 5DHQA 2R1VB 5CB8A 2Z5VA 3T3GA 1HY3A 2VHYA 1NT4A 1ESZA 4P54A 2ZQ5A 2JEZA 2IS1A 3IEVA 1CHNA 4W82A 1V71A 3ESRA 3NHSA 5AJUA 1X7WA 5H83A 2M5SA 4JI8B 2JFNA 1JHPA 1Z6PA 4GYJA 3LG2A 2RHLA 3N2GA 4HGYA 5DHFA 4GICA 3W1WA 2BJVA 3KL9A 1SCNE 1M34E 4E5KA 3IA2A 1RWKA 2HMSA 3ORSA 3L05A 2L82A 5BW8A 3LRPA 2FEOA 3SQLA 4KI7A 4OLJA 2QV7A 1J1ZA 2H00A 1LU9A 3CSSA 1NDHA 2I6UA 4OIFA 5H3CA 3LBNA 5AQEA 3U4HA 3FOBA 3OO0A 4M4SA 3EG9A 4HN4B 4Q6WA 3LCUA 5COAA 3D3EA 4BRZA 4YMIA 3NAMA 3H4MA 3KQOA 3EIFA 1JZSA 4JI7B 4ZQBA 2C59A 2J07A 1GPJA 1KSJA 2XUIA 2I4RA 2ZROA 4U6NA 4UHBA 4IVQA 4UM9D 3RREA 4JFRA 4Z4ZA 1I6WA 4O6VA 4FSHA 2XWSA 3T1NA 2FFQA 2WSIA 1J6UA 1G8YA 2HDNB 1OX6A 1EBBA 2Z57A 1R4ZA 3T61A 5YASA 2W8BA 2UYOA 5JANA 2R87A 4ZGNB 1KZGB 4FYPA 3N8DA 3PC8C 1M5RA 2ZYAA 3UJNA 1JFTA 3RNLA 2WIKA 3TYXA 3VZCA 3AY0A 3TTXA 3CZ4A 4EY8A 4FHCA 1FLNA 3KRTA 3ZWMA 3D3NA 1YFLA 2COUA 4P83A 3WQZA 2TMDA 3OESA 5DHRA 3ANYB 1SBNE 1OIVA 5EXPA 3UMCA 9ABPA 2I65A 5CG2A 3K6SA 1JR6A 3OOYA 2GHIA 1OTYA 2WMDA 3EFBA 5J58A 1AQYA 2ZI7A 3BHJA 4L8VA 4QU5A 2GF0A