3H94A

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
297
structure length
297
Chain Sequence
b'TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 39
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3h94A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h94A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3h94A01
1G291 1FYCA 5K36H 3A8KE 2ZT9C 1H9MA 1OXTA 5BN5A 1V8QA 1VF5C 3VR2A 2B8GA 1LACA 1GUNA 1A6XA 3LWUA 2CW0C 3BDOA 4JBWA 4KMUC 1Y8NB 2PCFB 1HCZA 1GHJA 3A7AB 3PUWA 3SDZA 2L5TA 5KNCA 5C0XH 3GD7A 3P20A 5KNBA 3D31A 2AUKA 1VCIA 3AB9A 3PV0A 1CTMA 3OW7A 1B9MA 4I7ZC 3ND9A 2O5IC 2A69C 2JEBI 5JEAG 2PNRC 1DXMA 3T51B 4KKUA 2A68C 2K7VA 4RCNA 4LK1C 1SMYC 3BG3A 4IQZA 2F1MA 3SE0A 4IFDH 1Q1EA 1Y8OB 3GQBA 2K32A 2EJMA 2JE6I 4KKSA 3W3AA 2DNCA 4KHZA 4L8JA 3OPOA 2YYZA 1GHKA 1GUTA 2KA7A 3U9SA 3N6RA 2R6GA 1TKWB 3OOCA 1Q12A 2E74C 2A68D 1IW7C 2D5DA 1H9KA 1O78A 4G7HC 2IT1A 4TQUS 2BA0A 1HQMC 1T5EA 3A8IE 1ZKOA 5KNDA 4KN7C 3PUVA 3VR4A 3VA7A 2BE5C 4HR7B 1PMRA 1V43A 2QF7A 3QJYA 3MXUA 3VR5A 3WDNA 1IYVA 1Q90A 3A8JE 5BN4A 4KKTA 1IW7D 1HTPA 2AUJD 4G7OC 1K8OA 2AWOA 2KCCA 1HPCA 3HGBA 3M4YA 1E2ZA 3A7LA 4LJZC 3PUZA 1Y69U 3KLRA 1GJXA 3ND8A 1OXXK 3QIAA 1EWHA 3IKJA 2NN6G 3LNNA 3FMCA 4KI0A 1GUOA 2A6EC 4BA1I 1IYUA 2A6HC 3T53B 2A69D 5BN3A 4JK1C 3M7NA 1I6VC 5K36G 1BDOA 1DCZA 1Z7TA 2EJFC 4H13C 2EVBA 4KN4C 3MFYA 4OO1H 3VR3A 1H9RA 3H94A 3TZUA 3D4RA 1DD2A 3NE5B 3IFTA 1Z6HA 3T56B 3PUXA 2DNEA 2EDGA 1QJOA 4G7ZC 2A6HD 3CRKC 5A35A 4H44C 1TU2B 5C0XG 2DN8A 2O5JC 1LABA 3QG1A 4DK0A 4H0LC 2EJGC 3FPPA 2PPBC 1O7LA 1H9JA 1CFMA 2E75C 1E2WA 3PUYA 1CI3M 2D2CC 1E2VA 1VDZA 2JEAI 4DNRB 1H9SA 2JXMB 1FR3A 3I72A 1OXUA 1ZYRC 2BE5D 4PV1C 4XTCS 4IFDG 1YNNC 1B9NA 1ONLA 2BDOA 2K33A 1OXSC 5JEAH 1H9SB 3I73A 2BA1A 2V4DA 3M85A 1GUSA 3VR6A 4GZYC 4DK1A 3I4LA 4XIGS 3L7ZC 1Q1BA 2B8FA 4DNTB 2D62A 2Q8IB 2E76C 4TKOB 1YNJC 2NN6H 2A6ED 1Y8PB 2LMCB 3RLFA 4BA2I 4OO1G 4OGQC 3DXJC 3EQLC 1GUGA 1OXVA 2NN6I 1VF7A 3CRLC 1K8MA
chains in the Genus database with same CATH superfamily
4OL7A 1PFBA 2R6HA 2UUAQ 3OZUA 3DWAA 3V7AA 3CCLA 1UEAB 2K04A 1VJSA 2EOTA 1GHJA 4B48A 5EGTA 3CRZA 1FGBD 5KNBA 1V0EA 1VQ6B 2PI2A 4JV5L 4PG3A 1N34L 3D0FA 2RHSB 4JC0A 3RZDB 1HZAA 4JI5Q 1CNFA 1IJFA 4C2MB 5AFWA 4FXKC 1JJ2B 2FXQA 5J39A 5KRUA 4RCZA 2OTLA 3V2TA 3AGQA 1W35A 2OTJB 1BBXC 4HIOA 4KKSA 1O7YA 2LXKA 4JCVE 1SYDA 4UP7A 4GOPB 3TP7A 1GUTA 1HFGA 5EBDA 1Y1WB 1EY7A 3R6KA 1HVXA 5C0XJ 2KHJA 4JI2L 2SEBD 1K8GA 4DV4L 1ET6A 2AQ3B 3OKXA 3I3CA 1FNMA 3LQEA 2M00A 3BVZA 2WKDA 3A8KA 1V43A 1BOSA 3VR5A 3M3YB 4YHBA 1EFRA 1F77A 2L12A 3M4YA 5JVH3 4LJZC 4HJ9A 3A7LA 3I8ZA 3KLRA 3G71A 4F8MA 3ND8A 1AMOA 4A93H 4FF4A 2WR8A 3QWNA 3ULPA 4PABA 1C8CA 4YAUA 4HJAA 1Q86C 1CZWA 4OWXB 2HCJB 4NXMQ 3A3GA 4M1KA 4N3GA 1XFOA 1QFZA 1UD3A 1VQKB 2ENBA 2QEXB 3WNCA 2E2HH 2C35B 2JIZA 5IYNA 2KHSA 4JPBW 5FJ8H 4BBSH 2XNAC 4IJLA 2VB3X 4K14A 5FO0A 2LXJA 3MZ5A 2VBSA 1E24A 1C9OA 4UAJA 2WB1G 2K28A 2DY1A 5C44G 4AC9A 1BCPD 5C3EH 4K8IA 5C3XA 1XJVA 1PYBA 2C5CA 2PZWA 2QDBA 1DARA 1LABA 2A5HA 4Y7CA 2YWGA 1EEID 4H0LC 2IX3A 2PPBC 1YJ9B 1VQMA 4WZEA 2I07B 1R4PB 4UPAA 2R93G 1I6HB 1CI3M 2ZXHA 5B6IA 4YWLA 1BVSA 1CUKA 2EYFA 2H1EA 3W2IA 2EYHA 5IT9L 4Z4TA 3KL9A 5KYLA 1BR9A 4CDDC 1JWSD 2B8FA 4DNTB 1UD2A 3Q3AA 2B7CA 3HZXA 5IYCH 2E2DC 4YCUA 3CC7A 2I1LA 2R7ZB 2A74C 3E20A 3T4AC 2VUMH 3J81E 3LVBA 1SMXA 4HJ7A 4G1VA 2ZT9C 2FHTA 1K83B 1H9MA 3ZC3A 4PMBA 4WJWA 4X64Q 1BO0A 1IL8A 3FKIB 1A6XA 1EP2B 3CMEA 1YHQA 2N78A 4JBWA 3CCEA 3KK7A 3T1HL 4IALA 5LL6X 1V1QA 4DR7Q 1MGSA 3PUWA 2EYLA 4ME5A 3U2QA 2F0KA 4HIMA 1ICFB 2XTIA 1CQXA 4ZK9B 1SNOA 4I7ZC 3MAQA 4P2NA 3GSIA 1JWUD 2ZJQA 3T51B 1S5ED 2C9OA 2RQXA 1DZ1A 3OW2A 2K32A 1CHPD 3CW2A 4TMXA 2BSAA 2X6LA 4FDBA 1DGSA 4KY6A 2NVYH 1TKWB 1PJ6A 1S0UA 3OOCA 5EQ0A 2E5LL 2Z6BD 4M2LA 2PQAB 3OJWA 1XYIA 3Q23A 2YTXA 4Y7NB 1Q8IA 3OFNA 4ZLTF 2XSCA 1S5DD 1STAA 1JT8A 3P26A 1TIID 3CMAB 3X3NA 2B2UA 3Q38A 2LSSA 5HGTA 2ZITA 2HDMA 4X0CA 2KCTA 3MEHA 4A75A 3ZZ0A 4R4TA 3S24A 3WDNA 4C43A 1BLIA 3CCQB 1X32A 5LMNQ 1SNMA 2G9HD 2B2YC 4IJHA 1XMOL 2AHOB 1NR2A 1VQFA 2NB0A 1D6EC 2JA8B 3WNDA 1ZXTA 2O4XA 3F2DA 3CD6A 2KECA 3VYSA 3H3VH 1I3QH 5ELOA 2KEEA 4JYAQ 2Q6KA 2ZTNA 1EY6A 2GVBA 2LY7A 2Y0SB 1HNXL 4XORA 2C5BA 1NMGA 1Q7YC 1QUQB 1UWVA 1H9RA 3S1NH 1ENAA 1JE4A 4OO1I 4HEDA 3Q8DA 2WSSA 1BMFA 1BCPF 3QO2A 2VBUA 3GTLH 3FRPB 4QUCA 4POFA 3K59A 4HMIA 2TSSA 3NENA 1QZGA 2DYIA 5E1FA 4XQQA 1X3EA 4B3MQ 1EWCA 2K52A 3KDFA 1K0SA 1E2WA 2UUCQ 4LF5Q 4A93G 4XMYA 1E22A 1N36Q 1H9SB 3CPFA 5FK9C 2YWFA 1WP6A 1LT5D 2KOLA 1E79A 4K0KQ 1N32Q 1KNEA 4O1NA 3V05A 2WINB 4RDJA 3KJPA 5FJ8G 1E3ZA 4AYBG 2MQHA 1PH6A 4A3KH 1II3A 4B3SL 3F1ZA 4B3RQ 1AH9A 4ZV4A 3KLSX 4DR6Q 2XVSA 3HG9A 1I5FA 4X3UA 3BY1A 4JI1L 5C3EG 1G91A 2CWAA 2K1BA 1C0AA 4F7XA 3A8IA 3NUCA 3CCJA 1LTBD 3SHLA 5EKLA 1QVFA 3S2HH 5D65A 1PYWD 2N88A 1E62A 3HKSA 3NEMA 5NUCA 4DAYA 5HY6A 4BBSB 3DLLA 1STNA 2W6JA 2KBNA 4X3SA 5M5XH 1I7PA 3ERQA 3Q39A 1WOPA 1VQ8A 1SMYC 3BCFA 1JORA 1CA6A 3SKBA 1Y8OB 3M4OH 1X55A 3BZKA 4A3FH 1YITB 2F0GA 3ASSA 2YTYA 1MRZA 3CCVA 1HNZQ 2F4NA 5IYCG 1Q12A 2E74C 5IYBH 1J8IA 1X3QA 2WV6D 2Z6BA 1A8VA 3UDXA 3H15A 2BN4A 3B8HA 2A68D 2VUMG 5A2QE 2WKCA 1OGIA 1ZEQX 3S1RH 1T6XA 3CCLB 1EFUA 4XD7A 3KFUA 1QILA 4KN7C 2MO1A 3TP8A 2BE5C 2DUDA 5EKKA 1VQOA 1KC8C 5AN9A 4I7AA 3A3BA 4RD4A 1G6PA 5FLMH 3ZBTA 4KKTA 2OK7A 3DMUA 2AUJD 2I46A 4MNOA 4YY3Q 4DR4L 5EMNA 5CV9A 2OEOA 5HZBA 4LUZA 1SROA 4XT3B 1EWHA 1VQDA 1K73C 2OTLB 4G4KA 2Q8TA 1TWCB 1UNSA 1XNQL 1IYUA 4RMFA 1TQOA 1BDOA 4CDEC 3S2DB 3BCDA 4KN4C 2D3LA 4DK6C 3PO3B 1XMQL 3H0GH 4ZCIA 2ASBA 2MPMA 1B50A 2VZAA 2CRVA 1KJZA 2UXDL 5KIXA 1W34A 4DR1Q 2GREA 2ZXPA 2GK7A 5I9PA 1VHOA 5AJ3L 4A3IH 5EAYA 1K8AC 1E2VA 3SVMA 1Y14B 1K28D 3JAMc 3CCMA 1XX8A 1A3UA 4PQXA 4IPHA 4LF4Q 2L0CA 3R2IA 3S16B 1CKMA 2DJGC 3A1PA 1VQIA 2V4DA 1VQGA 2BA1A 3CW2C 1JCKB 3CU7A 4PC1A 2BH2A 3O13A 3MWYW 3K80C 1OB0A 5I6WA 2A6ED 1F20A 3P7JA 3BDCA 3ONYA 3TEHB 1FDRA 3HS0C 3KJOA 3HOZH 3A8KE 4EVOA 1FVIA 3MXNB 5CC4A 1ASZA 4FF3A 4A3EH 1OXTA 3GTJH 2GJKA 1LACA 4LFBL 1KDBA 1VQMB 2F3WA 3CC4A 2ZZQA 1YHBA 1VQ6A 4U68A 3Q6RA 3SLDA 1HA6A 1D1KA 4PZ8A 2IJ0A 5C3WA 1COWA 5DN6A 4BWGB 4K8JA 4TT3A 1KIXA 4KHPQ 3JC66 3GVKA 1M8AA 3AB9A 4XLHA 4IUTA 3B78A 1JJ2A 4B3XA 4RCNA 3HOWH 1F2MA 1WTRA 5CDFA 4XQNA 4L63B 4JI6Q 3AMUA 1PH3A 1TWHH 1KD1C 4TMVA 4DF7A 2YV5A 3HOUH 4KLKA 2JJ1A 1BXTA 3ASRA 3CC7B 1PJ7A 2R6GA 3DM1A 4C1NK 2NV4A 1BCPC 1LTSD 2HHHQ 2UUAL 1SYEA 3KF6A 1QVGB 2NVXH 2D0PA 2K14A 3W2HA 3K5LA 1EL0A 3U50C 2KVMA 3OMCA 2VBTA 1KTKA 4P75A 3HOYB 1KNAA 2WP8J 4Q0FA 1QE6A 3KUPA 1G51A 3QJYA 5THXA 1IZ6A 4QFMA 2ZXOA 4LF7Q 1HTPA 3W2DA 4J0QA 2QDLA 1AE2A 1PLFA 1RODA 2EE1A 4Z4VA 1FX0A 5C44B 4R8IA 1OXXK 1UAPA 1ICWA 1KRHA 2OBRA 3LNNA 4K5VA 1IKMA 3OIPA 4X6AH 2GQFA 3I4MH 5FOBB 1Q46A 1QX4A 3M7NA 2PMZB 4A3FG 1CKNB 2R93B 1BQQT 2PZUA 3JAMi 2ZJPA 1LTTD 4IPCA 5KYIA 4XQJA 4C3JH 2QN6A 4DV1L 1IHZA 1G7SA 2B29A 2DNEA 2QDXA 5EBCA 1LUZA 5EPKA 1IBKQ 1ENFA 4FWTA 3ER0A 3I2ZA 4QV2A 4DK0A 3JAML 3C3LA 1O7IA 1WCMH 2K4KA 2UXCQ 3ZPNA 4P3IA 5FLMG 1H9JA 1SE3A 4K5XA 4GKKQ 4X06A 5LHY1 2F0OA 4X62L 5I2XA 4DNRB 1K28A 4XTCS 5IIFA 1IKLA 4DU9A 3G4SA 4NXML 2NZ1D 4XLFA 1RHPA 3J7AV 3CD6B 1E7ZA 2PMZE 2DY8A 3UI2A 4QIWB 3A56A 5C4XG 4HTHA 3BNWA 3TP6A 2XIWA 2I5MX 4YALA 1A8PA 2K5QA 3D4DA 1FNWA 4RA8A 4JBMA 3J80c 2KUMA 1LTLA 2ZTDA 3QFSA 1B44D 4APVA 2LKVA 3ULJA 1Y1VH 1VMPA 1Z9FA 2JN9A 1HZCA 1QG7A 4IPGA 4DV7Q 4B43A 1EOVA 2SDFA 4LFCQ 3GV3A 4ZGNB 4P6VF 2IL8A 3CESA 4IO9A 5CV8A 3OSOA 3GTOH 2F0WA 3BDOA 4ACBA 4A3BH 2NPFA 4RAUC 4A3IG 1Q82C 4OWTB 4MZ9A 5JPNC 2QGGA 1L1OB 1AFPA 3P20A 5IYRA 4HJ8A 3N52A 5C0XI 2KCNA 4QIWE 1JC7A 1ESFA 4YELA 2IY5B 1OHHA 1NR4A 5A88A 3HOXG 1LLRD 2QTZA 3HAGA 3J81k 4ME3A 3RD4A 2HLDA 4G57A 2PQAA 1NTGA 3M4QA 5FO9B 3S9WA 3Q22A 3CCSA 5IP7H 3K5MA 2V7VA 4Z4SA 4X64L 4TSSA 3CMAA 3AFQA 4PC6A 1ENCA 1WOSA 4DR7L 1O80A 2F0NA 5CV5A 5M3MG 2M5SA 1K3RA 2GA4B 4KY7A 4TMZA 2ZTEA 3TDQA 2K03A 3K6OA 1VQ9B 3S15B 1CM9A 2AWOA 3OZWA 1Y69U 5IOCA 4XT1B 3QIAA 1VQ8B 1YI2A 4UDUC 3HOWG 4OXPA 2K05A 4XLEA 4HE5A 2A6HC 3STBD 2B39A 3CCVB 1RF2D 3SK8A 1EQQA 2RKSA 2X53S 1IBML 4BY7G 5ISRA 2JA6H 4C3HG 3HOVG 4ZKBB 1WYDA 5CV6A 4V190 3BU2A 4A93B 1NB0A 1TS2A 3ERSX 1PZJD 3J7ZC 3A35A 1Z6HA 4CKBA 1B3AA 3CRKC 1PTOB 3IFDA 4Q5VA 2X85A 3CB4A 5J3OA 1UEBA 5C0XG 4PZ6A 4GNXA 3PF5A 3J80i 3AQQA 1VQOB 4UP8A 1N08A 4P71A 5LMNL 2FMMA 2KVOA 4RPDA 5FIUA 3U4VA 2E75C 2X69A 4OX9Q 3VNVA 1CHQD 1H9SA 1SRUA 3PUMA 3PIO3 4GOPC 1EU4A 4A3MG 1KK3A 1Y0RA 3T1YQ 2R7FA 3J80L 2F0TA 1SM4A 4A3LG 3OEHA 4JYAL 1STYA 3VR6A 2QA4A 4GS3A 3KOJA 2BVNA 4Z4RA 1KABA 1G7RA 1X6OA 2KQ3A 1FNBA 2RDHA 2NN6H 2Q2HA 4M8AA 2GK6A 1MJCA 4ZKCB 1HR0L 4X7FA 1PRTC 3CAMA 1UD5A 4U673 3DM3A 4L5QA 3BYYB 4ZGQB 1EXMA 5CV7A 4XL9A 2XWBB 2RDGA 1GM5A 4BPRA 1S5BD 4B3ML 3GTPB 1EUJA 1JA1A 5LMUQ 3TRZA 4LMQD 4YHHQ 4RKLA 3U9OA 1V1PB 1WCMG 3DDYA 1KMHA 1DM0B 1GAQA 4YAWA 4LF5L 1TLLA 3P75A 1N36L 2VUMB 4DV3Q 3PV0A 4Z9CB 4EX5A 2YU9H 5H1SE 2GN5A 1GOZA 4B9XA 4K0KL 1BX1A 5DSZA 1VQ4A 2HIVA 3OWEB 3BG3A 1X3PA 4BBRH 3E9IA 2F1MA 1F2LA 1MHWC 1PZID 1Q1EA 1WFQA 2M9VA 1VQPA 4IFDH 2XRQD 1SXTA 1V1OA 1L0WA 5IWAQ 2YYZA 2Z4IA 5M5WH 4DR6L 1STEA 3PIPA 4TSFA 1V5VA 1Y1VG 3JQPA 5KW9A 2Q2UA 4QGUA 3MFGA 1SJED 1G2SA 4B3SQ 3NXWA 3NP8A 1XTCD 4KJNA 3CC4B 1PH5A 5KNDA 1W0KA 3MHPA 2EQSA 3PUNA 4A3BG 3ZIAA 1PA6A 4MN3A 4XONA 1EYDA 4R4IA 4O42A 2VQEQ 3HKZB 5IP9G 2X8KA 4II3A 1SFOH 1S5CD 1S4ZA 1FD7D 2C5HA 2BMWA 3MVVA 2L11A 3OZVA 2A6EC 2WJVA 4BA1I 1KK1A 1HNZL 3UE0A 3PO2B 4JK1C 2XNCA 5GV7A 4KV6A 4O0AA 4HIDA 1YHAA 2JA5H 2EVBA 1QGYA 3S17B 1NBMA 3KF6B 1DOMA 2VQFQ 1TWFB 4P6YA 3RZOB 1KK0A 3T56B 3PQIA 2EDGA 3J7YW 1QJOA 1I3QB 4OP7A 1W9XA 4A3JG 4A3CH 2UXBQ 2VY3A 3Q6SA 2EY1A 2EJGC 3SK6A 3FPKA 4YY3L 3HKZE 1BBWA 5IYDH 3S1NB 1R4QB 1QUEA 4DR2L 2XOKA 2IPKD 3I90A 1HFNA 3KYHC 3TREA 3ASPA 2JA7H 4X7EA 1ONLA 3SK4A 4LF6Q 3IRBA 5GAHC 3CTAA 4CKCA 5CBEE 1PFNA 4ZCMA 4X66Q 1GUSA 3FKSA 1AZPA 1GD7A 1MBYA 4DK1A 2XZLA 3I4LA 4IUNA 3CQZB 4BY1H 1MJEA 4RPBA 3DXJC 3L9AX 2AMCB 3MXNA 1VF7A 4IZ8A 1A3VA 5CYUA 4DR1L 4RH6A 3GTMB 1M90D 4ZCKA 5BN5A 1MSHA 2F43A 2QKIC 3KBXA 2J7KA 4HIZA 3D6WA 4ZCLA 2YWHA 2VNIA 3HP3A 2ICIA 3PGZA 1WU8A 3I56B 1FNDA 1WOCA 5GAEC 4AQYQ 3G4SB 1BUVT 1IXRA 1CQFA 4CGYB 3ND9A 4FXGC 2MJ8A 2O5IC 4Z1MA 1E0BA 2D0OA 4X7CA 2MFIA 3S14B 5CMDA 3S1MB 3J81c 4MYTA 1KTVA 3PA1A 5J1ZA 1EIGA 2CBXA 1A2TA 1YNND 2PYKA 3SE0A 1STBA 3I7FA 4DUZL 4QUZA 1LT6D 3KF8A 4ABNA 1B3QA 3FJOA 1QUFA 3NSWA 1QVGA 3GTQH 3CPWA 4ACAA 3VMFA 3QOJA 4ZUIA 2X6WA 4ZQ3A 2DCUA 3Q6QA 1X9NA 2EXDA 4DV6Q 2CQOA 3UE1A 4RLZA 2NVQH 1TY2A 2DY7A 1DDGA 4A3DH 2BPOA 2E2IH 3MCAA 2OQ0A 4HSVA 1GR1A 2L1BA 4WJ3M 1BX0A 3GTKB 2E2JH 1IW7D 1ILPA 3TN2A 2B2TA 1AZQA 1AN8A 5I4DA 5H5JA 2JQOA 2V31A 2KENA 3IKJA 2Z6KC 4BBRG 4KI0A 1CKNA 1GUOA 2N55A 2O2LD 1S72A 3TS2A 3MEFA 1F2ZA 4Z4YA 2PE3A 3CCSB 2V1CC 2PO4A 3KBGA 4R4QA 1BKBA 3OAAA 3MFYA 1I50H 4HMJA 2BM0A 4Q7JB 2D74A 4CKEA 5TSSA 2B2WC 1PTOD 2MO0A 2ZJRA 2V7UA 1XTDA 1T9HA 5EJWA 1VQ7B 4K1XA 4S3SA 5KGUA 5C4XB 3E5SA 1TU2B 3VO2A 2Q2IA 2Q6IA 2VNJA 2B2VA 2EYOA 5ELCA 4LF7L 3GIRA 5JJIA 2B63H 4B3TQ 3KEWA 3FDTA 1I94L 2HD3A 4DR3Q 2HT1A 4HN7A 3V76A 3W5HA 1NE3A 1RIPA 3WOFA 1FR3A 2GJRA 2HMAA 4QL5A 4X8IA 1YI2B 3ZUGA 4QF4A 5GROA 1CKOA 1NJID 3ULLA 3A8JA 2N8NA 2VJJA 1SJHD 2XWJB 1NDHA 1J9ZA 1QH0A 5T1IA 4LBWA 3AVYA 4X65Q 1Y1WH 4GZYC 3ZYYX 1SE4A 2RCFA 4A3IB 4MHEA 1KDAA 1WSRA 4M4SA 2F4VQ 2E76C 1YNJC 3PF4A 4JW0A 1ZUNB 2CW5A 2I5HA 2EIXA 1WDTA 2UU9Q 1E63A 3MXGA 3CKIB 4OOSA 3J81i 4QCLA 5K36H 1IBKL 1TWGB 3HFZB 1VQHA 4GNXB 4DXFA 4U9UA 1XNRQ 3M3YH 4A3CG 2UXCL 3HOXB 2MGSA 1GUNA 3EROA 4GKKL 1LYLA 4CBVA 1J5EL 1L1OA 2D3NA 2IHFA 4DV0Q 3Q0AA 4N9TA 2OCEA 4C0SA 3J81L 4NDXA 5JBQA 5DLQE 1LO5D 2Y0SE 4QHYA 1JICA 3NK9A 4C3IH 5ELNA 2JA7G 2CWPA 4JOIA 2JEBI 1VQNB 4XKWA 2PNRC 3STBC 3J7AF 2QA4B 2PLFA 2R9VA 4GQNA 5M3MB 4IW3B 3C46A 1HNWL 1YJWB 2JE6I 4RHRA 4LNQA 4DN4M 1KLUD 3I55A 1XPOA 2WAQG 4LFCL 3E3XA 2ZM6Q 3R6JA 4CDFC 5C4HA 4E6IA 2E1BA 2RF4A 1N9WA 1BJKA 2F0QA 1CNEA 1HTLD 4TQUS 1TWHB 1OGJA 1DDIA 3QE2A 1FL0A 1WD0A 3D6CA 2EFGA 2QGQA 4IFDJ 4BY7B 4FVMA 4ALPA 1VQ9A 3DEPA 4IPDA 4C3HB 3HOVB 5C6AA 2CF4A 2CW0D 2NTTA 3VNUA 2R92H 1VQ4B 3GDEA 1SLJA 2PW5A 4QUFA 1VQPB 1LTID 1LV9A 1U4PA 2DJFC 4FYDA 5C4JB 5TR9A 3X3MA 1IBLQ 3H3VI 1EFID 2R7ZH 3RN2A 3MMPA 4JV5Q 1SEBD 3G6JB 3WXMA 2EJFC 4DR5L 2H5XA 5ELBA 4GLXA 1PTOF 4A3MB 2JK8A 2RA4A 4P72A 2MNAA 3FKIH 1EYCA 3SEJA 1QFJA 4JI3L 4YCVA 5A35A 3H9NA 2DN8A 4DAMA 1CT1D 4GKJQ 3JQRA 5FNZA 3TMEA 4UY8C 4JI7L 1SE8A 1PH1A 4QB4A 1CFMA 4JI2Q 4OIKA 3UDFA 4AF7A 4G7XA 2PNHA 2KEDA 5I6YA 4B47A 2F0PA 3HEJA 4HAEA 2YWEA 1B70B 1WCMB 1Q8KA 1BBUA 3FPUB 3B6YA 5D14A 1GJRA 1KRSA 2RSOA 2NUCA 3CP2A 1LTGD 2XGTA 4B4DA 2L55A 1Y8PB 2LMCB 4Y7NH 1WTXA 4OOVA 4OGQC 1OXVA 1QVCA 2ID0A 4RD6A 3SEBA 5M5YB 4G1BA 3TP5A 5CV4A 1MABA 1NSNS 2K5WA 5JJLA 1V1PA 1EWIA 3I91A 4HJ5A 3M7GA 2B63G 3PIP3 2C4TA 2Q6OA 4KMUC 4Z4UA 3SLNA 3W2GA 2I5LX 1AW7A 2JA8H 3K0YA 1TXYA 3A54A 4LUOA 3BVMA 4PNYA 3BZDB 4A4IA 2GVAA 3IL8A 3U58A 3E6ZX 5DNFA 4ROXA 4IQZA 4KJOA 1L0XB 1Y1WG 4P25A 3E9HA 4DV2L 4LWCA 1F9PA 2B2UC 1GKHA 1JA0A 1HHVA 4UHVA 1SE2A 4K2KA 2VBVA 2E8GA 2DERA 1MSGA 4JI8L 5G3LD 3K7UC 5EPJA 5LMUL 1EQRA 1H9KA 3JAME 1UD6A 1WORA 3CP0A 4G7HC 1SYBA 1HQMC 1N0UA 2CKZB 2CK3A 1JB9A 1VHEA 3SJPA 1SSOA 3CP8A 2RBMA 5LMZA 1XPUA 4DV3L 4HCEA 3GVJA 1FRNA 1Q90A 4B9WA 4G5GA 3H09A 2V7QA 2B3GA 4C3IG 5FO7B 2UUBQ 1YIJB 2QCPX 2VW9A 3CCRB 3NTHA 2RCNA 3DEOA 5JAVA 4WZLA 2ZZEA 4A3JB 2F3VA 4A3KG 1KXLA 1I8DA 3KF8B 2AQ2B 2A69D 3UDIA 2PMDA 2I0QA 2AQ1B 2HCIA 3E1YE 2CNDA 3CPWB 3P1HA 4JI0Q 3C1FA 3EJIA 2MP1A 1JB7A 3H94A 4NP5A 1M90C 1DD2A 1CA5A 5K5PA 3SR1A 2HDLA 1L1OC 1SKYB 1TY0A 1IHMA 1GO2A 4DV5Q 1EFCA 4DQLA 1J9OA 5JJKA 4JI5L 3OTOQ 1PZKD 2WB1B 4FNFA 4PMWA 4C56C 2E5LQ 1TWAB 4QMGA 3FHWA 2NZOA 4JOIC 2NVTB 1KZLA 2JEAI 1D5XC 4P12A 1WTHA 3K0XA 1I4XA 2R92G 1U5KA 1QZHA 1YNNC 3RMHA 3I73A 5GADC 5HXBA 4NNJA 1S72B 3WYAA 5E4WC 5IGBA 2F0JA 1TUIA 1DOKA 4EQPA 5IYBG 2GJPA 1Q1BA 2X6XA 3DUZA 4A76A 1XMOQ 1A62A 4DK3C 3VYUA 3RLFA 3OE7A 3EQLC 4P74A 1H85A 3A5UA 1FYCA 2UXBL 1ESRA 1CSQA 3QB3A 2XZOA 1KDCA 3WBKA 2WB1E 4FK8A 4X3TA 1HNXQ 3NTIA 1GO3E 5L37A 3I56A 3S1QB 4OELB 1QB5D 2B5OA 2F0MA 1YVCA 5KNLA 1U4LA 1Y0YA 1YX2A 2TMPA 4XN0A 4LF6L 4K2LA 2AUKA 1QFYA 3WY9A 5IYWA 1XQBA 1TWCH 1B9MA 5IGEA 1FGUA 1RTOA 1C7YA 4KKUA 1R9TH 1SAPA 3TS0A 5C4ZA 1ZYRD 3S2DH 3D4WA 4YIJA 3H0GG 4XNFA 1NB9A 1PTOC 1TVXA 3K58A 3ITPA 5DAUA 4H7BA 2YU9B 5G3LF 2BH8A 3TSSA 4RGTA 5FLXc 5J22A 1F9RA 4PC7A 4PAAA 1O78A 5D3DA 1FNVA 4HSPA 4LBVA 2PZTA 4TN1A 1EQVA 1E64A 5ELEA 3VR4A 2F4IA 3VA7A 4P9SA 5HZAA 3PVDA 3G48A 1S4MA 3NQTA 4HR7B 1UE7A 1U9RA 4X07A 3QR8A 2EZVA 1X3GA 3A8JE 1NJIC 4YAOA 4OPOA 4JI1Q 1SR3A 1ZM2A 4FN5A 1QCBD 4OPVA 3L3OC 4MYUA 3F2BA 3VA5A 2WIIB 1N06A 3WNBA 1E3PA 4Y9RA 2AWNA 2HQLA 2K75A 1D5ZC 1YEZA 3HOZG 1I6VC 3I55B 3U4ZA 3DWPA 4A3EG 4DV6L 1VQ7A 3ONUA 4GLVB 2Q6LA 4FXDA 3MC0B 4DAVA 2BCOA 2H4OA 5KSWB 3AVUA 5JPMC 4G7ZC 4H44C 3H91A 2JJ2A 2C78A 1DYQA 1HZBA 1O7LA 3CPXA 2WZPP 3BVGA 1JWMD 4HIKA 4OWWB 1MD2D 2D2CC 2F0DA 5GQOA 2P3MA 2JXMB 4DXGA 2C2WA 1WTQA 4TMWA 4B08A 2D9RA 2OBTA 3HOUG 1M1KD 4EGVA 3EBEA 4PC2A 1JOKA 4B3GA 3VYTA 4IUUA 2K5VA 4DFAA 5BSYA 1UE5A 1CSPA 5A8AA 1SYCA 5M3FH 4TKOB 5KEEA 1UD4A 4BA2I 2VZLA 4RGMA 4RWSC 1LT3D 1QGZA 4XLCA 2E2HB 3AVTA 1WPCA 1N07A 3HOYH 1XNQQ 4JG2A 4AYBB 2CHBD 3BC9A 1PHJA 3RLOA 4B3TL 1WTOA 4DR3L 5C5MA 2FMCA 3LWUA 3MA2B 2CW0C 1CQVA 1BNZA 5C3EB 5C44H 2WAQB 3BDLA 1VQNA 2E1RA 3D31A 3I4MG 1AP0A 1XXGA 4CHTB 4POGA 1WSVA 1E1OA 4X65L 3EVQA 4LBYA 4JMQA 2ZBUA 2A68C 3QFCA 5FL7A 2R93H 1K9MD 1YJWA 5AJ3Q 2F4VL 4TRDA 5GAGC 4C3JG 4L6TB 1EEFD 1TVCA 4RFBA 5FLXL 4NBSA 1T6YA 1JNYA 1NMFA 2EY5A 2G5DA 3OIQA 4YXWA 3DWQA 1KQSB 4CDCC 1U2RA 4AYBE 4RD3A 1Q9SA 1XNRL 4G6IA 1SMYD 4DQKA 5D3IB 1VQ5B 5ELFA 4IN3A 4JI4Q 2UUCL 4UP9A 2WAQE 2K5HA 4DV0L 1IJEA 3TQYA 3RN5A 2F0HA 2QF7A 1N32L 1EIYB 5CGKA 1P16A 3I4OA 1K8OA 1HA5A 5E6TA 3LO8A 5LMNW 4XR6A 2ZXIA 4P22A 1PH4A 4LFBQ 4RHSA 4B3RL 4LF9Q 1PH7A 1E43A 1SNCA 2LS01 4AH6A 1KAAA 1VMCA 1PFMA 3C1EA 3NPPA 4Z4ZA 3R2TA 3SGIA 4L5SA 4XKVA 2BF4A 2E2JB 5BSXA 2ZM6L 1QOHA 1EQTA 2B2YA 2XEXA 2ZZGA 4H13C 5T1GA 1IL2A 2OK8A 1RTNA 2L4NA 1UE6A 1K73D 1QNKA 4KD3A 2W6IA 2NVYB 2FINB 3NBIA 1SKQA 4F7DA 1HR0W 1NBWA 3FPPA 5IT9E 2OF1A 1HH2P 1I50B 2WJYA 1D7QA 1J6QA 3PENA 3BYTB 2EY6A 1W3SA 2C4UA 1MKHA 3CC2A 1OXUA 5M9OA 4CJ0B 1WI5A 1GUWA 4QQBX 1IBLL 3K7AH 3ZJYC 2B63B 2EYJA 4XQFA 1I4QA 5IP7G 3KLSA 1K8AD 2XZPA 1EYAA 1TT2A 1NCVA 2CH4A 3SK5A 5FA6A 3EFXD 1OB5A 4DKAC 3SXHA 2NN6I 3QFRA 1LT4D 2V7TA 1AE3A 1RD9D 4NXNQ 3A0JA 5IGFA 4GKJL 2CC2A 5IYPA 4FP5D 3HRZC 3R3OA 4ODGA 3S15H 2F0FA 3GTLB 2WPDA 1EIHA 1F2YA 1N0VC 1W6JA 1WTWA 1WJJA 4XYOA 4DA2A 1D8LA 1EY8A 4DV1Q 2VB2X 4J1MA 4RM0A 2GPJA 3OYYA 1PRTB 1WVLA 1V9PA 5IGCA 3K5NA 2HUGA 4UZEA 3KLWA 2NTSA 5DM73 2A69C 4KK7A 5TY0A 2F0LA 2BGIA 2K7VA 4LK1C 2YTVA 5JVG3 2JA6G 1NY4A 3VO1A 2SOBA 3U6BA 4JVZA 3RR5A 4X62Q 5M3FG 1Q3LA 1ZM9A 1U0LA 4L8JA 1TS5A 2QW7A 4IFDI 4C3IB 2K01A 4GN3B 4OONA 1PTOH 1EZ8A 1QWYA 3LWEA 5IY0A 2WZNA 3HOYG 1IYJB 1GAWA 3EA6A 1S40A 4J6HA 4ID6A 4A3KB 4IUVA 5BR8Q 1KD1D 4LF4L 5GV8A 3OWFA 1EIFA 1TTTA 1SBBB 3UDGA 3DHQA 3ISXA 3A5ZB 4LW1A 2NZHA 4MTNA 1YIJA 1XB2A 4GLAC 2KCMA 3WWVA 1RCVD 5J3BA 5DM63 3CCRA 2FVGA 3VDYA 1EP1B 3RLNA 3J7A5 1PYSB 4RD2A 4DAPA 3B82A 1VQJA 3AFPA 3S2HB 2NN6G 1L2FA 2KHIA 1B2TA 1KL9A 4A3GH 3U6KA 2F0UA 1X65A 2ALYB 3GP7A 2WYRA 5M5XB 2QE7A 4R71A 4GNXC 1E3XA 3GTGH 1DONA 3W1GA 4OO1H 2VYQA 2R92B 3VR3A 1N33Q 3M4OB 3T13A 3GTPH 3W5UA 3D4RA 2B7BA 1EY5A 3I4NH 1K3BC 3BY2A 3CXCB 4A3FB 2MHVA 4KHPL 4RDKA 1TR5A 1EU3A 2L9HA 3ASTA 2Z0SA 1KK2A 4ZRZA 2WACA 4WFN3 2O5JC 1RQRA 5CBAE 1RDPD 4UZUA 3J81j 5FKAC 3AEVA 1YNXA 2UUBL 3S1RB 1W87A 3PUYA 4LBZA 4JI6L 5F4JA 4XN3A 1HXYD 3CCUA 1JOOA 1T5XD 1ZYRC 4IFDG 1A2UA 1B9NA 2PQEA 2VNKA 5JEAH 4G7WA 2HHHL 4WZKA 2EPBA 3NBHA 5L46A 4R9WA 4C1NI 4OOXA 4XIGS 4JI0L 3L7ZC 4II2A 1JE5A 1W0JA 1D2BA 3G6EA 1P4MA 1R5OA 4WWVA 2F0VA 2VL6A 1VQLA 1NAPA 1IB0A 3L0OA 4DV5L 1K8MA 1R5NA 2JN4A 5E3FA 2DEUA 4DUYQ 3OTOL 1K0RA 5CR3A 1N8RD 2SNSA 3OMGA 3RZDH 1V8QA 4CJ1B 1HZ9A 4J15A 1UMKA 3H0GB 3PMFA 4C2MH 1IBMQ 2PIAA 1X56A 4XDXA 4ZYSA 3OP1A 1Y8NB 4N9PA 1RJTA 4PMCA 1WTVA 1SYGA 3SDZA 3GD7A 3L2PA 4X3KA 4XLAA 3W2EA 3W5OA 4LC0A 1SNPA 3PO2H 2FJ2A 4EH1A 1HJPA 1KAWA 3AYHB 2BOSA 1W2BB 2HIXA 2JA5G 3I1FA 1FJGQ 2N49A 2Z9HA 3EIVA 4B44A 1Q82D 3S17H 4AVZA 1HZEA 2Q2TA 4P2CB 1HRJA 1TWFH 3RZOH 1GHKA 3OPOA 4NW2A 2J0TD 2PW7A 3NWSA 2R61A 3FEWX 3EN2A 5IYDG 1E1TA 1YJNA 5HURA 3C2QA 2ZZFA 1ZKOA 4F88A 3HOZB 2V7XA 3IAYA 4LF8Q 2SNMA 1HR0Q 4A3EB 4RCYA 4FO2A 2A8VA 1IYVA 3GTJB 2X6YA 3G7LA 3PSIA 3T16A 5BN4A 2F0IA 1RL2A 1M1KC 1B23P 2R3ZA 3HGBA 4M0LA 3BS1A 3PUZA 4HE6A 4K6LA 1VS0A 3CQZH 3GV6A 1FNCA 1SYFA 1B1ZA 2NYZD 4BY1G 1EFWA 2CVRA 4IUQA 3F8TA 3NELA 2XN9C 4DV7L 3TBIB 4RGOS 4NCNA 1KHIA 3Q24A 3HOWB 1PVOA 3K81C 1WOOA 1JJGA 3GVLA 1S3OA 1F9QA 3GTMH 4LFAQ 3TZUA 1I6HH 1D1IA 3HOUB 4YAFA 3FP9A 4YEJA 4RCOA 3PUXA 3OJXA 2A6HD 1HUNA 2Z1CA 2EIFA 4NB3A 1GXDC 1OB2A 1VQAA 1YBYA 4L5TA 2NVXB 1I4HA 1JOQA 3GO5A 4WZTA 2K50A 4XYQA 2ZL6A 3PIOA 1JMCA 3S14H 2VS1A 3S1MH 2N3SA 3CF5A 1K9MC 3NTKA 3BJUA 4EQ5A 2QEJC 1LTRD 4EQNA 1SNDA 2OXPA 3AVWA 1PDQA 1N34Q 4RGNA 4A3GG 5H59A 4P1VA 4FF1A 1K83H 2BDNA 2F03A 1T6ZA 4IUPA 1PJ5A 4ZAIA 1U4MA 3PA2A 2EXZA 2JSOA 4OHJA 2HQEA 4OO1G 4Z4WA 3I4MB 1EY4A 2VNHA 1KRTA 3I4NG 1G291 4A3DG 4UZFA 1ET9A 1C48A 4TVAB 1LTAD 4Y52H 2QTLA 3MHBA 4C3JB 3GTKH 2JJQA 2F0SA 4DV4Q 1WTHD 1NUCA 4B3FX 1PRTD 2ICEC 2PCFB 5JJZA 3A74A 4OPSA 4TMTA 3CC2B 1A3TA 1XWEA 2L5TA 1EY9A 1G8ZD 4AIMA 2EY2A 1B7YB 3OW7A 3D26A 5JOBA 1EY0A 5JEAG 3JQQA 4H9GA 1Q81D 1CZGA 1DXMA 4LUVA 4AF6A 4KHVA 2R7DA 1E1QA 1B53A 4DR2Q 1PV4A 3GQBA 4DPGA 2BGJA 1AIPA 4LAAA 4NKLA 1KQSA 3P27A 2KA7A 1CK1A 3ES9A 3OHXC 4BS9A 5C4XH 1G6ZA 4ULLA 1VQ5A 5TV2A 2ZTCA 1R9TB 4OX9L 2D5DA 2B2TC 1UD8A 3WBJA 4E0FA 1B8AA 1Y1VB 3T1YL 2C77A 3PCOB 1I4RA 1G7TA 3HKZG 3ZBUA 1PMRA 4J8QA 3NHHA 4M53A 1DOLA 1BF4A 2PI2E 3GTOB 1A0IA 2EYPA 1WD1A 1HPCA 2JDIA 4YWKA 4A3BB 3PO2G 2QILA 1F60A 5E7NA 4NPSA 4BXXH 2ATWA 3FMCA 3G71B 2VXWA 3K57A 3LX0A 2ES2A 1UE1A 2A19A 5BN3A 4EQOA 4R4CA 3V96A 2K5NA 5K36G 3E0EA 2B2VC 2IHEA 4YHHL 1TWGH 4IOAA 3LQ6A 3ZZUA 1SN8A 1PH9A 3E0JA 1R5BA 3HOXH 3R93A 2IX0A 3IFTA 4JI4L 1HUMA 3ASQA 1STHA 2LFNA 4OEMB 4DUZQ 1UUPA 2V7WA 5A2QL 3AVXA 4YWMA 1HA3A 4F87A 4V0BA 4DNIA 5IYQA 3CMMA 3AGPA 2D9UA 2MUYA 5F2DA 4KD4A 1I18A 5IWAL 3T1HQ 1XE1A 4IURA 2Q8RE 3MTSA 4LF9L 2HCCA 3URYA 1KLGD 5M3MH 3K5OA 3AVVA 5J35A 1I4GA 1OXSC 2X6GA 3ONAB 2RC6A 2F0EA 4RDLA 2RHQB 2IW3A 2Z4HA 4ASUA 3ZZTA 4PZ7A 2D62A 1Q86D 2Q8IB 2OTJA 3FVQA 4GOPA 1S5FD 2DIEA 2RC5A 1GVPA 2RSNA 1PKVA 1DJRD 1QGAA 2DGYA 1D5MC 1VQCA 2J4XA 4QY7A 5EPLA 4IOCA 2OWOA 2XGJA 1STGA 4BY7H 2JA6B 2VQEL 4FF2A 5JEAJ 5IGDA 2IX1A 4KTAA 4C3HH 1VF5C 1WTPA 5HKKA 3HOVH 3ICEA 2B8GA 1A63A 2X3UA 4N8X1 5M3FB 1PRTF 2BM1A 2DOGA 4MTKA 3R8BA 4XOPA 5COYA 5IGGA 1NRKA 5IE8A 5F4MA 1HCZA 2CQAA 3CCUB 3CMEB 1YHQB 4FXUA 3A7AB 3M9BA 3CCEB 5C0XH 1PH2A 1CTMA 4P26A 3W5VA 3CHBD 4XOTA 5C4JH 1PH8A 3RY8A 1VQEA 2R7ZG 1X54A 2VQFL 1X3FA 1EOTA 3NBHB 1H42A 1I94Q 3F2UA 4A3MH 2XRSD 3FKIG 2EJMA 3G6EB 3W3AA 1AEXA 2DNCA 3C2PA 1VQKA 4A3LH 1VQLB 3OW2B 2A1AA 4NXNL 3BQJA 3U9SA 2QEXA 2OBSA 1OTCA 2K5DA 1SDFA 4L5RC 1ILQA 1IW7C 2WFWA 4PGOA 1PFSA 2ZL5A 1LM0A 2BA0A 3K8AA 1T5EA 3F2CA 2FX3A 1O7ZA 1VQBA 4X66L 3MXUA 1YJ9A 2K6AA 3H6MA 1EP3B 4G7OC 2AKWB 4GN4B 2X0KA 1D1NA 4RKBA 4XXEA 4YCWA 2A73B 1DG1G 1GJXA 3PO3H 3AU7A 1J5EQ 1TS4A 3VYRA 2QMUA 1V0FA 2Z8LA 3W2FA 5FO8B 1E1RA 3T53B 2RDFA 5M5YH 4R1JA 1DCZA 1RQPA 2FFKB 4R8NA 5CORA 4BBRB 3CXCA 1JQYD 2XNDA 1SNQA 1VLOA 4P3YA 4I65A 1N8RC 5BR8L 3NE5B 3BH4A 4GN5A 1YJNB 2CH4W 5FO1A 5M5WB 5TRDA 4AQYL 3QOLA 4UAIA 1TS3A 2VJIA 3S16H 1HNWQ 5E4XA 2JA8G 4WRDA 3G05A 1L0YB 1W6KA 4RJLA 1D8TA 3QG1A 3J80E 1BCPB 3TZDA 3RNUA 3QFTA 4NMZA 4CJ2C 2Y0SG 1C4QA 4JBJA 3KDFB 4X7DA 1EZ6A 3I72A 4WORA 1H95A 1VLYA 2CCZA 1PXUA 1U4RA 2K33A 4BXXG 5FLXE 3M85A 3WOEA 2EYMA 3BZCA 2F52A 5IP9H 1SFOB 1ASYA 2XNJA 1N33L 3JU4A 2NWGA 1JR0D 1B2RA 5HGQA 3D3RA 2OT2A 2OYNA 2OQKA 3K7AB 4X05A 2JA5B 1RKNA 1Q7YD 3NWTA 1HQRD 4DGZA 1BPLA 5DEHA 3VR2A 4O2DA 4DR5Q 5LL6S 1YNJD 1N05A 1H8HA 2IWHA 3CCJB 1EFTA 1Z47A 1D2EA 5KNCA 4A3JH 2HDNB 4QJFA 1QVFB 4JI3Q 3CCQA 1VCIA 5DS0A 1W2BA 5IK2A 4MIUA 1GVHA 2JA9A 4ILWA 2AHOA 4DR4Q 1QNUA 3MXPA 4JI7Q 4DAYB 2VNUD 2ZXRA 2JA7B 3D8GA 1YLOA 4QVAA 2M2LA 4KHZA 2CFMA 1EYGA 1ZM4A 5I2YA 3N6RA 4DUYL 1OO9B 4Y9UA 2NBFA 1QG0A 1QUQA 2ZBVA 3NQIA 4BY1B 1XMQQ 4BBSG 1TWAH 2IT1A 2P5ZX 4PC3A 3M4PA 3A8IE 2NVTH 1JB3A 3PUVA 4QVJA 5IODA 2UXDQ 4N8FA 1YZ6A 3A55A 4N3NA 3WQZA 1FNUA 1ML0D 4ZUJA 5A89A 2JYOA 1FRQA 1ELOA 2KCCA 1E2ZA 2L15A 1FJGL 3QSYA 4WJ4A 1A15A 2UU9L 3H3VC 1JJCB 2BV3A 3OEEA 1MI2A 3SJZA 1NNXA 3RUZA 2KJXA 4P73A 4H02A 4KY5A 1Z7TA 1EWYA 5C5LA 2Z6KA 3S1QH 3LGJA 3GTQB 4A3GB 4DV2Q 1G7CA 4LF8L 4K5WA 4CQJA 3GTGB 2RVLA 1XPRA 1BQEA 4JI8Q 2NVQB 5ELDA 2B2WA 3I4NB 1Q81C 2ZL7A 1VDZA 2JP1A 1G2TA 4A3DB 4RD1A 2BE5D 1KC8D 4PV1C 5EKIA 5I9OA 3PO3G 2E2IB 4WQMA 1MIUA 4HCSA 2BDOA 2ZTGA 4M1UB 3CCMB 4R4OA 4JBKA 2LZJA 4XM3A 1ZM3A 5F4OA 2DETA 1M4VA 4K6DA 1F9SA 3W1BA 4RG1A 2G9DA 4LFAL 1B4OA 5IT9c 3I70A 2F3IA 1H8EA 1GUGA 1I4PA 2J7ZA 4RD0A 1P8LA 1YITA 4OIJA 3CRLC 2F1LA
chains in the Genus database with same CATH topology
4OL7A 1PFBA 3DWAA 1UEAB 2K04A 1VJSA 2EOTA 1GHJA 5EGTA 1FGBD 5KNBA 1V0EA 3RZDB 4C2MB 5AFWA 4FXKC 5J39A 5KRUA 3V2TA 1BBXC 4KKSA 1O7YA 1SYDA 3TP7A 1GUTA 1HFGA 5EBDA 1Y1WB 1EY7A 1HVXA 5C0XJ 2SEBD 1ET6A 2AQ3B 3I3CA 2M00A 3BVZA 2WKDA 1V43A 1BOSA 3VR5A 3M3YB 1EFRA 1F77A 2L12A 3M4YA 5JVH3 4LJZC 3A7LA 3I8ZA 3KLRA 4F8MA 3ND8A 4FF4A 3QWNA 1C8CA 1CZWA 3A3GA 1UD3A 2ENBA 2JIZA 2KHSA 2XNAC 2VB3X 4K14A 3MZ5A 2K28A 1BCPD 4K8IA 5C3XA 2PZWA 2C5CA 2QDBA 1LABA 2A5HA 4H0LC 1EEID 2IX3A 2PPBC 2I07B 1R4PB 1I6HB 1CI3M 2ZXHA 2EYFA 2H1EA 2EYHA 5IT9L 5KYLA 1BR9A 1JWSD 2B8FA 4DNTB 1UD2A 3HZXA 2E2DC 2R7ZB 2A74C 3T4AC 3J81E 2ZT9C 2FHTA 1K83B 1H9MA 4PMBA 4WJWA 1BO0A 1IL8A 3FKIB 1A6XA 4JBWA 3KK7A 4IALA 5LL6X 1MGSA 3PUWA 2EYLA 4ME5A 2F0KA 4ZK9B 1SNOA 4I7ZC 3MAQA 1JWUD 3T51B 1S5ED 2C9OA 2RQXA 1DZ1A 2K32A 1CHPD 2X6LA 4KY6A 1TKWB 5EQ0A 3OOCA 2Z6BD 1XYIA 3Q23A 4Y7NB 1Q8IA 3OFNA 4ZLTF 2XSCA 1S5DD 1STAA 1TIID 3X3NA 2B2UA 5HGTA 2HDMA 3MEHA 3WDNA 1BLIA 1X32A 1SNMA 2G9HD 2B2YC 1NR2A 2NB0A 1D6EC 2JA8B 1ZXTA 2O4XA 2KECA 3VYSA 2KEEA 2ZTNA 1EY6A 2LY7A 2Y0SB 4XORA 1H9RA 1ENAA 1JE4A 4OO1I 4HEDA 2WSSA 1BMFA 1BCPF 3QO2A 3FRPB 4QUCA 3K59A 4HMIA 2TSSA 5E1FA 4XQQA 1EWCA 1E2WA 4XMYA 1H9SB 5FK9C 1WP6A 1LT5D 2KOLA 1E79A 1KNEA 4O1NA 3V05A 2WINB 1E3ZA 1II3A 3KLSX 2XVSA 3HG9A 4X3UA 1G91A 2K1BA 4F7XA 3NUCA 1LTBD 3SHLA 5EKLA 5D65A 1PYWD 2N88A 5NUCA 4DAYA 4BBSB 1STNA 2W6JA 4X3SA 3ERQA 1SMYC 3BCFA 1JORA 1CA6A 1Y8OB 2F0GA 1Q12A 2E74C 1J8IA 1X3QA 2WV6D 2A68D 5A2QE 2WKCA 1ZEQX 4XD7A 1QILA 4KN7C 3TP8A 2BE5C 5EKKA 3A3BA 4KKTA 3DMUA 2AUJD 2I46A 5CV9A 2OEOA 4XT3B 1EWHA 4G4KA 2Q8TA 1TWCB 1UNSA 1IYUA 1TQOA 1BDOA 3S2DB 3BCDA 4KN4C 2D3LA 3PO3B 2MPMA 1B50A 5KIXA 2ZXPA 2GK7A 5I9PA 1E2VA 3SVMA 1K28D 1XX8A 1A3UA 4PQXA 2L0CA 3R2IA 3S16B 2BA1A 2V4DA 1JCKB 3CU7A 3O13A 3MWYW 1OB0A 5I6WA 2A6ED 3P7JA 3BDCA 3HS0C 3A8KE 4EVOA 5CC4A 4FF3A 1OXTA 2GJKA 1LACA 1KDBA 2F3WA 2ZZQA 4U68A 1HA6A 1D1KA 2IJ0A 5C3WA 1COWA 5DN6A 4BWGB 4K8JA 4TT3A 3GVKA 1M8AA 3AB9A 4XLHA 4IUTA 4RCNA 1F2MA 1WTRA 5CDFA 4XQNA 4L63B 3AMUA 4DF7A 2JJ1A 1BXTA 2R6GA 3DM1A 4C1NK 1BCPC 1LTSD 1SYEA 3K5LA 1EL0A 2KVMA 3OMCA 1KTKA 3HOYB 1KNAA 2WP8J 4Q0FA 1QE6A 3KUPA 3QJYA 2ZXOA 1HTPA 3W2DA 1PLFA 1RODA 2EE1A 1FX0A 5C44B 4R8IA 1OXXK 1UAPA 1ICWA 3LNNA 4K5VA 1IKMA 3OIPA 5FOBB 3M7NA 2PMZB 2R93B 1BQQT 2PZUA 1LTTD 5KYIA 4XQJA 1IHZA 2DNEA 5EBCA 5EPKA 1ENFA 3JAML 4DK0A 3C3LA 3ZPNA 1H9JA 1SE3A 4K5XA 5LHY1 2F0OA 5I2XA 4DNRB 4XTCS 5IIFA 1IKLA 4DU9A 2NZ1D 4XLFA 1RHPA 3J7AV 2DY8A 3UI2A 4QIWB 3A56A 4HTHA 3TP6A 2XIWA 2K5QA 4RA8A 3D4DA 1FNWA 2KUMA 1B44D 2LKVA 1VMPA 1QG7A 2SDFA 3GV3A 2IL8A 3CESA 5CV8A 3OSOA 2F0WA 3BDOA 4RAUC 5JPNC 1AFPA 3P20A 3N52A 5C0XI 2KCNA 1JC7A 1ESFA 4YELA 1OHHA 1NR4A 1LLRD 3HAGA 3RD4A 2HLDA 4G57A 5FO9B 3S9WA 3Q22A 3K5MA 4TSSA 1ENCA 1O80A 2F0NA 5CV5A 2M5SA 2GA4B 4KY7A 3TDQA 2K03A 3K6OA 3S15B 1CM9A 2AWOA 1Y69U 5IOCA 4XT1B 3QIAA 4UDUC 2K05A 4XLEA 2A6HC 2B39A 1RF2D 3SK8A 2RKSA 2X53S 5ISRA 4C3HG 4ZKBB 5CV6A 4V190 4A93B 1TS2A 1PZJD 3A35A 1Z6HA 4CKBA 1B3AA 3CRKC 1PTOB 3IFDA 4Q5VA 2X85A 5C0XG 2FMMA 2KVOA 2E75C 2X69A 1CHQD 1H9SA 3PIO3 1EU4A 3J80L 2F0TA 3OEHA 1STYA 3VR6A 1KABA 2KQ3A 2RDHA 2NN6H 4M8AA 2GK6A 4ZKCB 1PRTC 1UD5A 4U673 3BYYB 5CV7A 4XL9A 2XWBB 2RDGA 1S5BD 3GTPB 4LMQD 4RKLA 3U9OA 1V1PB 3DDYA 1KMHA 1DM0B 3P75A 2VUMB 3PV0A 4Z9CB 1GOZA 4B9XA 3OWEB 3BG3A 1X3PA 2F1MA 1F2LA 1PZID 1Q1EA 2M9VA 4IFDH 2XRQD 1SXTA 1V1OA 2YYZA 2Z4IA 1STEA 4TSFA 3MFGA 1SJED 1G2SA 3NXWA 3NP8A 1XTCD 4KJNA 5KNDA 1W0KA 3ZIAA 4MN3A 4XONA 1EYDA 4O42A 3HKZB 2X8KA 4II3A 1S5CD 1S4ZA 1FD7D 3MVVA 2L11A 2A6EC 2WJVA 4BA1I 3PO2B 4JK1C 4KV6A 2EVBA 3S17B 1NBMA 1DOMA 1TWFB 3RZOB 3T56B 2EDGA 3J7YW 1QJOA 1I3QB 1W9XA 3Q6SA 2EY1A 2EJGC 3SK6A 3S1NB 1R4QB 2XOKA 2IPKD 3I90A 1HFNA 1ONLA 3SK4A 4CKCA 5CBEE 1PFNA 1AZPA 1GUSA 3FKSA 1MBYA 4DK1A 2XZLA 3I4LA 4IUNA 3CQZB 3DXJC 3L9AX 3MXNA 1VF7A 4IZ8A 1A3VA 5CYUA 4RH6A 3GTMB 5BN5A 1MSHA 2F43A 2QKIC 3KBXA 4HIZA 3D6WA 3HP3A 2ICIA 1BUVT 1CQFA 4CGYB 3ND9A 4FXGC 2MJ8A 2O5IC 4Z1MA 1E0BA 3S14B 5CMDA 3S1MB 5J1ZA 1EIGA 1A2TA 1YNND 2PYKA 3SE0A 1STBA 3KF8A 1LT6D 4ABNA 3NSWA 3QOJA 4ZUIA 2X6WA 4ZQ3A 1TY2A 2DY7A 4HSVA 2L1BA 3GTKB 1IW7D 1ILPA 3TN2A 2B2TA 1AZQA 1AN8A 5I4DA 2V31A 3IKJA 4KI0A 1GUOA 2N55A 2O2LD 1F2ZA 2PO4A 3KBGA 3MFYA 3OAAA 4HMJA 4CKEA 5TSSA 2B2WC 1PTOD 5EJWA 4S3SA 5KGUA 5C4XB 3E5SA 1TU2B 2B2VA 2EYOA 5ELCA 3KEWA 3FDTA 4HN7A 3WOFA 1FR3A 2GJRA 4QF4A 2VJJA 1SJHD 2XWJB 5T1IA 4GZYC 3ZYYX 1SE4A 4A3IB 4MHEA 1KDAA 2E76C 1YNJC 3MXGA 3CKIB 4QCLA 5K36H 1TWGB 4DXFA 3HOXB 2MGSA 1GUNA 3EROA 4CBVA 2D3NA 3Q0AA 4N9TA 3J81L 4NDXA 1LO5D 1JICA 3NK9A 2JEBI 4XKWA 2PNRC 3J7AF 2R9VA 4GQNA 5M3MB 3C46A 2JE6I 4RHRA 4DN4M 1KLUD 5C4HA 4E6IA 2E1BA 2F0QA 1HTLD 4TQUS 1TWHB 1WD0A 3D6CA 4IFDJ 4BY7B 4FVMA 3DEPA 4C3HB 3HOVB 5C6AA 2CW0D 2NTTA 2PW5A 4QUFA 1LTID 1LV9A 1U4PA 4FYDA 5C4JB 3X3MA 1EFID 1SEBD 3G6JB 2EJFC 5ELBA 1PTOF 4A3MB 2RA4A 1EYCA 5A35A 2DN8A 1CT1D 3TMEA 4QB4A 1CFMA 4OIKA 4G7XA 2KEDA 5I6YA 2F0PA 3HEJA 4HAEA 1WCMB 3FPUB 5D14A 2RSOA 2NUCA 3CP2A 1LTGD 2L55A 1Y8PB 2LMCB 1WTXA 4OGQC 1OXVA 3SEBA 2ID0A 5M5YB 3TP5A 5CV4A 1MABA 1NSNS 2K5WA 1V1PA 3I91A 3M7GA 3PIP3 4KMUC 1AW7A 3K0YA 3A54A 3BVMA 4PNYA 3BZDB 3IL8A 3E6ZX 5DNFA 4IQZA 4KJOA 1L0XB 1F9PA 2B2UC 1HHVA 1SE2A 4K2KA 1MSGA 5G3LD 5EPJA 1H9KA 3JAME 1UD6A 4G7HC 1SYBA 1HQMC 2CK3A 1SSOA 2RBMA 3CP8A 4HCEA 3GVJA 1Q90A 4B9WA 3H09A 2V7QA 4C3IG 5FO7B 2QCPX 3NTHA 3DEOA 5JAVA 4A3JB 2ZZEA 2F3VA 1I8DA 2AQ2B 2A69D 2AQ1B 2HCIA 3P1HA 3C1FA 3EJIA 2MP1A 3H94A 4NP5A 1DD2A 1CA5A 5K5PA 3SR1A 2HDLA 1SKYB 1TY0A 1J9OA 1PZKD 2WB1B 4FNFA 4PMWA 4C56C 1TWAB 4QMGA 2NVTB 1KZLA 2JEAI 1D5XC 1I4XA 1YNNC 3RMHA 3I73A 4NNJA 5E4WC 5IGBA 2F0JA 1DOKA 4EQPA 2GJPA 1Q1BA 2X6XA 3DUZA 3VYUA 3RLFA 3OE7A 3EQLC 1FYCA 1ESRA 3QB3A 2XZOA 1KDCA 4X3TA 3NTIA 3S1QB 1QB5D 2F0MA 5KNLA 1U4LA 2TMPA 4XN0A 4K2LA 2AUKA 1B9MA 5IGEA 1RTOA 4KKUA 1SAPA 5C4ZA 1ZYRD 3D4WA 4YIJA 4XNFA 1PTOC 1TVXA 3K58A 3ITPA 5DAUA 4H7BA 2YU9B 5G3LF 3TSSA 4RGTA 5J22A 1F9RA 1O78A 5D3DA 1FNVA 4HSPA 2PZTA 1EQVA 5ELEA 3VR4A 2F4IA 3VA7A 3NQTA 4HR7B 2EZVA 1U9RA 3A8JE 1QCBD 3L3OC 3VA5A 2WIIB 2AWNA 1D5ZC 1I6VC 3DWPA 4FXDA 3MC0B 4DAVA 2BCOA 2H4OA 5JPMC 4G7ZC 4H44C 3H91A 2JJ2A 1DYQA 1O7LA 2WZPP 3BVGA 1JWMD 1MD2D 2D2CC 2F0DA 2JXMB 4DXGA 1WTQA 4B08A 4EGVA 1JOKA 4B3GA 3VYTA 4IUUA 4DFAA 1SYCA 4TKOB 5KEEA 1UD4A 4BA2I 4RGMA 4RWSC 1LT3D 4XLCA 2E2HB 1WPCA 4AYBB 2CHBD 3BC9A 1WTOA 5C5MA 2FMCA 3LWUA 3MA2B 2CW0C 1CQVA 1BNZA 5C3EB 2WAQB 3BDLA 3D31A 1AP0A 1XXGA 4CHTB 3EVQA 4JMQA 2A68C 5FL7A 4TRDA 4C3JG 4L6TB 1EEFD 5FLXL 4RFBA 2EY5A 3OIQA 4YXWA 3DWQA 4G6IA 1SMYD 5D3IB 5ELFA 4IN3A 2F0HA 2QF7A 5CGKA 1K8OA 1HA5A 4XR6A 2ZXIA 4P22A 4RHSA 1E43A 1SNCA 2LS01 1KAAA 1VMCA 1PFMA 3C1EA 3NPPA 3R2TA 4XKVA 2E2JB 1QOHA 1EQTA 2B2YA 2ZZGA 4H13C 5T1GA 1RTNA 2L4NA 1QNKA 4KD3A 2W6IA 2NVYB 2FINB 3NBIA 5IT9E 3FPPA 2OF1A 1I50B 2WJYA 3BYTB 2EY6A 1OXUA 5M9OA 4CJ0B 1GUWA 2B63B 2EYJA 4XQFA 1I4QA 3KLSA 2XZPA 1EYAA 1TT2A 1NCVA 3SK5A 3EFXD 3SXHA 2NN6I 1LT4D 1RD9D 5IGFA 4FP5D 3HRZC 3R3OA 4ODGA 2F0FA 3GTLB 2WPDA 1EIHA 1F2YA 1W6JA 1WTWA 4XYOA 4DA2A 1EY8A 2VB2X 4J1MA 1PRTB 1WVLA 5IGCA 3K5NA 2HUGA 5DM73 2NTSA 2A69C 4KK7A 2F0LA 2K7VA 4LK1C 5JVG3 2SOBA 4IFDI 1Q3LA 4L8JA 1TS5A 4C3IB 2K01A 1PTOH 1EZ8A 1QWYA 3LWEA 3EA6A 4J6HA 4ID6A 4A3KB 4IUVA 3OWFA 1SBBB 3DHQA 1RCVD 5DM63 4DAPA 3S2HB 2NN6G 1B2TA 2F0UA 3GP7A 5M5XB 2QE7A 1DONA 1E3XA 4OO1H 2R92B 3VR3A 3M4OB 3T13A 3D4RA 1EY5A 4A3FB 2MHVA 1TR5A 1EU3A 2L9HA 4ZRZA 2WACA 4WFN3 2O5JC 5CBAE 1RDPD 4UZUA 5FKAC 3S1RB 3PUYA 4XN3A 1HXYD 1JOOA 1T5XD 1ZYRC 4IFDG 1A2UA 1B9NA 2PQEA 5JEAH 4G7WA 2EPBA 3NBHA 4C1NI 4R9WA 4XIGS 3L7ZC 4II2A 1W0JA 1D2BA 2F0VA 1NAPA 1K8MA 5E3FA 5CR3A 2SNSA 3OMGA 1V8QA 4CJ1B 3H0GB 3PMFA 4XDXA 4ZYSA 1Y8NB 4N9PA 1RJTA 4PMCA 1WTVA 1SYGA 3SDZA 3GD7A 4X3KA 4XLAA 1SNPA 2FJ2A 2BOSA 4AVZA 1HZEA 4P2CB 1HRJA 1GHKA 3OPOA 4NW2A 2J0TD 2PW7A 3NWSA 2R61A 3FEWX 5HURA 2ZZFA 1ZKOA 4F88A 3HOZB 3IAYA 2SNMA 4A3EB 4FO2A 1IYVA 3GTJB 2X6YA 3G7LA 3T16A 5BN4A 2F0IA 2R3ZA 3HGBA 3BS1A 3PUZA 4K6LA 3GV6A 1SYFA 1B1ZA 2NYZD 2CVRA 4IUQA 2XN9C 3TBIB 4RGOS 3Q24A 3HOWB 3GVLA 1F9QA 3TZUA 1D1IA 3HOUB 4YEJA 4RCOA 3PUXA 2A6HD 1HUNA 2Z1CA 1GXDC 2NVXB 1I4HA 1JOQA 3GO5A 4XYQA 3NTKA 2QEJC 1LTRD 4EQNA 1SNDA 2OXPA 1PDQA 4RGNA 4FF1A 2BDNA 2F03A 4IUPA 4ZAIA 1U4MA 2EXZA 2JSOA 4OHJA 2HQEA 4OO1G 3I4MB 1EY4A 1G291 1ET9A 1C48A 1LTAD 3MHBA 4C3JB 2F0SA 1WTHD 1NUCA 4B3FX 1PRTD 2ICEC 2PCFB 5JJZA 1A3TA 1XWEA 2L5TA 1EY9A 1G8ZD 2EY2A 3OW7A 5JOBA 1EY0A 5JEAG 1CZGA 1DXMA 4KHVA 1E1QA 1B53A 3GQBA 4NKLA 4LAAA 2KA7A 1CK1A 3OHXC 4BS9A 1G6ZA 4ULLA 1R9TB 2D5DA 2B2TC 1UD8A 4E0FA 1Y1VB 1I4RA 1PMRA 4J8QA 3NHHA 1DOLA 1BF4A 3GTOB 2EYPA 1WD1A 1HPCA 2JDIA 4A3BB 2QILA 3FMCA 2VXWA 3K57A 3LX0A 5BN3A 4EQOA 3V96A 5K36G 2B2VC 3E0JA 3R93A 2IX0A 3IFTA 1HUMA 1STHA 2LFNA 1UUPA 5A2QL 4F87A 4V0BA 3CMMA 2D9UA 2MUYA 5F2DA 4KD4A 1I18A 4IURA 2Q8RE 3MTSA 2HCCA 3URYA 1KLGD 3K5OA 1I4GA 1OXSC 2X6GA 3ONAB 2F0EA 2IW3A 2Z4HA 4ASUA 2D62A 2Q8IB 3FVQA 1S5FD 2DIEA 2RSNA 1PKVA 1DJRD 1D5MC 2J4XA 5EPLA 2XGJA 1STGA 2JA6B 4FF2A 5JEAJ 5IGDA 2IX1A 4KTAA 1VF5C 1WTPA 5HKKA 2B8GA 5M3FB 1PRTF 3R8BA 4XOPA 5COYA 5IGGA 1NRKA 1HCZA 2CQAA 3A7AB 4FXUA 5C0XH 1CTMA 3CHBD 4XOTA 1EOTA 3F2UA 2XRSD 2EJMA 3W3AA 1AEXA 2DNCA 3C2PA 3U9SA 2K5DA 1SDFA 1ILQA 1IW7C 2BA0A 1T5EA 1O7ZA 3MXUA 2K6AA 3H6MA 4G7OC 4RKBA 4XXEA 2A73B 1GJXA 3AU7A 1TS4A 3VYRA 1V0FA 2Z8LA 5FO8B 1E1RA 3T53B 2RDFA 1DCZA 2FFKB 4R8NA 5CORA 4BBRB 1JQYD 2XNDA 1SNQA 4I65A 3NE5B 3BH4A 5M5WB 3QOLA 4UAIA 1TS3A 2VJIA 5E4XA 4WRDA 3G05A 1L0YB 1W6KA 3QG1A 3J80E 1BCPB 3TZDA 4NMZA 4CJ2C 1C4QA 1EZ6A 3I72A 4WORA 1VLYA 1PXUA 1U4RA 2K33A 5FLXE 3M85A 3WOEA 2EYMA 1SFOB 3JU4A 2NWGA 1JR0D 3D3RA 2OT2A 3K7AB 2JA5B 1RKNA 3NWTA 1HQRD 4DGZA 1BPLA 5DEHA 3VR2A 5LL6S 1YNJD 1H8HA 2IWHA 1Z47A 5KNCA 1VCIA 5IK2A 4MIUA 4ILWA 1QNUA 3MXPA 2VNUD 2ZXRA 2JA7B 3D8GA 2M2LA 4KHZA 5I2YA 3N6RA 1OO9B 2NBFA 3NQIA 4BY1B 2IT1A 3A8IE 1JB3A 3PUVA 5IODA 3A55A 3WQZA 1FNUA 4ZUJA 1ML0D 2JYOA 2KCCA 1E2ZA 1A15A 3H3VC 3OEEA 1MI2A 3RUZA 2KJXA 4KY5A 1Z7TA 5C5LA 3GTQB 4A3GB 4K5WA 3GTGB 2RVLA 2NVQB 5ELDA 2B2WA 3I4NB 1VDZA 2JP1A 1G2TA 4A3DB 2BE5D 4PV1C 5EKIA 5I9OA 2E2IB 4HCSA 2BDOA 2ZTGA 4M1UB 2LZJA 4XM3A 1M4VA 4K6DA 1F9SA 2G9DA 1B4OA 3I70A 1H8EA 1GUGA 1I4PA 2J7ZA 4OIJA 3CRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G29 1;  1FYC A;  5K36 H;  3A8K E;  2ZT9 C;  1H9M A;  1OXT A;  5BN5 A;  1V8Q A;  1VF5 C;  3VR2 A;  2B8G A;  1LAC A;  1GUN A;  1A6X A;  3LWU A;  2CW0 C;  3BDO A;  4JBW A;  4KMU C;  1Y8N B;  2PCF B;  1HCZ A;  1GHJ A;  3A7A B;  3PUW A;  3SDZ A;  2L5T A;  5KNC A;  5C0X H;  3GD7 A;  3P20 A;  5KNB A;  3D31 A;  2AUK A;  1VCI A;  3AB9 A;  3PV0 A;  1CTM A;  3OW7 A;  1B9M A;  4I7Z C;  3ND9 A;  2O5I C;  2A69 C;  2JEB I;  5JEA G;  2PNR C;  1DXM A;  3T51 B;  4KKU A;  2A68 C;  2K7V A;  4RCN A;  4LK1 C;  1SMY C;  3BG3 A;  4IQZ A;  2F1M A;  3SE0 A;  4IFD H;  1Q1E A;  1Y8O B;  3GQB A;  2K32 A;  2EJM A;  2JE6 I;  4KKS A;  3W3A A;  2DNC A;  4KHZ A;  4L8J A;  3OPO A;  2YYZ A;  1GHK A;  1GUT A;  2KA7 A;  3U9S A;  3N6R A;  2R6G A;  1TKW B;  3OOC A;  1Q12 A;  2E74 C;  2A68 D;  1IW7 C;  2D5D A;  1H9K A;  1O78 A;  4G7H C;  2IT1 A;  4TQU S;  2BA0 A;  1HQM C;  1T5E A;  3A8I E;  1ZKO A;  5KND A;  4KN7 C;  3PUV A;  3VR4 A;  3VA7 A;  2BE5 C;  4HR7 B;  1PMR A;  1V43 A;  2QF7 A;  3QJY A;  3MXU A;  3VR5 A;  3WDN A;  1IYV A;  1Q90 A;  3A8J E;  5BN4 A;  4KKT A;  1IW7 D;  1HTP A;  2AUJ D;  4G7O C;  1K8O A;  2AWO A;  2KCC A;  1HPC A;  3HGB A;  3M4Y A;  1E2Z A;  3A7L A;  4LJZ C;  3PUZ A;  1Y69 U;  3KLR A;  1GJX A;  3ND8 A;  1OXX K;  3QIA A;  1EWH A;  3IKJ A;  2NN6 G;  3LNN A;  3FMC A;  4KI0 A;  1GUO A;  2A6E C;  4BA1 I;  1IYU A;  2A6H C;  3T53 B;  2A69 D;  5BN3 A;  4JK1 C;  3M7N A;  1I6V C;  5K36 G;  1BDO A;  1DCZ A;  1Z7T A;  2EJF C;  4H13 C;  2EVB A;  4KN4 C;  3MFY A;  4OO1 H;  3VR3 A;  1H9R A;  3H94 A;  3TZU A;  3D4R A;  1DD2 A;  3NE5 B;  3IFT A;  1Z6H A;  3T56 B;  3PUX A;  2DNE A;  2EDG A;  1QJO A;  4G7Z C;  2A6H D;  3CRK C;  5A35 A;  4H44 C;  1TU2 B;  5C0X G;  2DN8 A;  2O5J C;  1LAB A;  3QG1 A;  4DK0 A;  4H0L C;  2EJG C;  3FPP A;  2PPB C;  1O7L A;  1H9J A;  1CFM A;  2E75 C;  1E2W A;  3PUY A;  1CI3 M;  2D2C C;  1E2V A;  1VDZ A;  2JEA I;  4DNR B;  1H9S A;  2JXM B;  1FR3 A;  3I72 A;  1OXU A;  1ZYR C;  2BE5 D;  4PV1 C;  4XTC S;  4IFD G;  1YNN C;  1B9N A;  1ONL A;  2BDO A;  2K33 A;  1OXS C;  5JEA H;  1H9S B;  3I73 A;  2BA1 A;  2V4D A;  3M85 A;  1GUS A;  3VR6 A;  4GZY C;  4DK1 A;  3I4L A;  4XIG S;  3L7Z C;  1Q1B A;  2B8F A;  4DNT B;  2D62 A;  2Q8I B;  2E76 C;  4TKO B;  1YNJ C;  2NN6 H;  2A6E D;  1Y8P B;  2LMC B;  3RLF A;  4BA2 I;  4OO1 G;  4OGQ C;  3DXJ C;  3EQL C;  1GUG A;  1OXV A;  2NN6 I;  1VF7 A;  3CRL C;  1K8M A; 
#chains in the Genus database with same CATH topology
 4OL7 A;  1PFB A;  2R6H A;  2UUA Q;  3OZU A;  3DWA A;  3V7A A;  3CCL A;  1UEA B;  2K04 A;  1VJS A;  2EOT A;  1GHJ A;  4B48 A;  5EGT A;  3CRZ A;  1FGB D;  5KNB A;  1V0E A;  1VQ6 B;  2PI2 A;  4JV5 L;  4PG3 A;  1N34 L;  3D0F A;  2RHS B;  4JC0 A;  3RZD B;  1HZA A;  4JI5 Q;  1CNF A;  1IJF A;  4C2M B;  5AFW A;  4FXK C;  1JJ2 B;  2FXQ A;  5J39 A;  5KRU A;  4RCZ A;  2OTL A;  3V2T A;  3AGQ A;  1W35 A;  2OTJ B;  1BBX C;  4HIO A;  4KKS A;  1O7Y A;  2LXK A;  4JCV E;  1SYD A;  4UP7 A;  4GOP B;  3TP7 A;  1GUT A;  1HFG A;  5EBD A;  1Y1W B;  1EY7 A;  3R6K A;  1HVX A;  5C0X J;  2KHJ A;  4JI2 L;  2SEB D;  1K8G A;  4DV4 L;  1ET6 A;  2AQ3 B;  3OKX A;  3I3C A;  1FNM A;  3LQE A;  2M00 A;  3BVZ A;  2WKD A;  3A8K A;  1V43 A;  1BOS A;  3VR5 A;  3M3Y B;  4YHB A;  1EFR A;  1F77 A;  2L12 A;  3M4Y A;  5JVH 3;  4LJZ C;  4HJ9 A;  3A7L A;  3I8Z A;  3KLR A;  3G71 A;  4F8M A;  3ND8 A;  1AMO A;  4A93 H;  4FF4 A;  2WR8 A;  3QWN A;  3ULP A;  4PAB A;  1C8C A;  4YAU A;  4HJA A;  1Q86 C;  1CZW A;  4OWX B;  2HCJ B;  4NXM Q;  3A3G A;  4M1K A;  4N3G A;  1XFO A;  1QFZ A;  1UD3 A;  1VQK B;  2ENB A;  2QEX B;  3WNC A;  2E2H H;  2C35 B;  2JIZ A;  5IYN A;  2KHS A;  4JPB W;  5FJ8 H;  4BBS H;  2XNA C;  4IJL A;  2VB3 X;  4K14 A;  5FO0 A;  2LXJ A;  3MZ5 A;  2VBS A;  1E24 A;  1C9O A;  4UAJ A;  2WB1 G;  2K28 A;  2DY1 A;  5C44 G;  4AC9 A;  1BCP D;  5C3E H;  4K8I A;  5C3X A;  1XJV A;  1PYB A;  2C5C A;  2PZW A;  2QDB A;  1DAR A;  1LAB A;  2A5H A;  4Y7C A;  2YWG A;  1EEI D;  4H0L C;  2IX3 A;  2PPB C;  1YJ9 B;  1VQM A;  4WZE A;  2I07 B;  1R4P B;  4UPA A;  2R93 G;  1I6H B;  1CI3 M;  2ZXH A;  5B6I A;  4YWL A;  1BVS A;  1CUK A;  2EYF A;  2H1E A;  3W2I A;  2EYH A;  5IT9 L;  4Z4T A;  3KL9 A;  5KYL A;  1BR9 A;  4CDD C;  1JWS D;  2B8F A;  4DNT B;  1UD2 A;  3Q3A A;  2B7C A;  3HZX A;  5IYC H;  2E2D C;  4YCU A;  3CC7 A;  2I1L A;  2R7Z B;  2A74 C;  3E20 A;  3T4A C;  2VUM H;  3J81 E;  3LVB A;  1SMX A;  4HJ7 A;  4G1V A;  2ZT9 C;  2FHT A;  1K83 B;  1H9M A;  3ZC3 A;  4PMB A;  4WJW A;  4X64 Q;  1BO0 A;  1IL8 A;  3FKI B;  1A6X A;  1EP2 B;  3CME A;  1YHQ A;  2N78 A;  4JBW A;  3CCE A;  3KK7 A;  3T1H L;  4IAL A;  5LL6 X;  1V1Q A;  4DR7 Q;  1MGS A;  3PUW A;  2EYL A;  4ME5 A;  3U2Q A;  2F0K A;  4HIM A;  1ICF B;  2XTI A;  1CQX A;  4ZK9 B;  1SNO A;  4I7Z C;  3MAQ A;  4P2N A;  3GSI A;  1JWU D;  2ZJQ A;  3T51 B;  1S5E D;  2C9O A;  2RQX A;  1DZ1 A;  3OW2 A;  2K32 A;  1CHP D;  3CW2 A;  4TMX A;  2BSA A;  2X6L A;  4FDB A;  1DGS A;  4KY6 A;  2NVY H;  1TKW B;  1PJ6 A;  1S0U A;  3OOC A;  5EQ0 A;  2E5L L;  2Z6B D;  4M2L A;  2PQA B;  3OJW A;  1XYI A;  3Q23 A;  2YTX A;  4Y7N B;  1Q8I A;  3OFN A;  4ZLT F;  2XSC A;  1S5D D;  1STA A;  1JT8 A;  3P26 A;  1TII D;  3CMA B;  3X3N A;  2B2U A;  3Q38 A;  2LSS A;  5HGT A;  2ZIT A;  2HDM A;  4X0C A;  2KCT A;  3MEH A;  4A75 A;  3ZZ0 A;  4R4T A;  3S24 A;  3WDN A;  4C43 A;  1BLI A;  3CCQ B;  1X32 A;  5LMN Q;  1SNM A;  2G9H D;  2B2Y C;  4IJH A;  1XMO L;  2AHO B;  1NR2 A;  1VQF A;  2NB0 A;  1D6E C;  2JA8 B;  3WND A;  1ZXT A;  2O4X A;  3F2D A;  3CD6 A;  2KEC A;  3VYS A;  3H3V H;  1I3Q H;  5ELO A;  2KEE A;  4JYA Q;  2Q6K A;  2ZTN A;  1EY6 A;  2GVB A;  2LY7 A;  2Y0S B;  1HNX L;  4XOR A;  2C5B A;  1NMG A;  1Q7Y C;  1QUQ B;  1UWV A;  1H9R A;  3S1N H;  1ENA A;  1JE4 A;  4OO1 I;  4HED A;  3Q8D A;  2WSS A;  1BMF A;  1BCP F;  3QO2 A;  2VBU A;  3GTL H;  3FRP B;  4QUC A;  4POF A;  3K59 A;  4HMI A;  2TSS A;  3NEN A;  1QZG A;  2DYI A;  5E1F A;  4XQQ A;  1X3E A;  4B3M Q;  1EWC A;  2K52 A;  3KDF A;  1K0S A;  1E2W A;  2UUC Q;  4LF5 Q;  4A93 G;  4XMY A;  1E22 A;  1N36 Q;  1H9S B;  3CPF A;  5FK9 C;  2YWF A;  1WP6 A;  1LT5 D;  2KOL A;  1E79 A;  4K0K Q;  1N32 Q;  1KNE A;  4O1N A;  3V05 A;  2WIN B;  4RDJ A;  3KJP A;  5FJ8 G;  1E3Z A;  4AYB G;  2MQH A;  1PH6 A;  4A3K H;  1II3 A;  4B3S L;  3F1Z A;  4B3R Q;  1AH9 A;  4ZV4 A;  3KLS X;  4DR6 Q;  2XVS A;  3HG9 A;  1I5F A;  4X3U A;  3BY1 A;  4JI1 L;  5C3E G;  1G91 A;  2CWA A;  2K1B A;  1C0A A;  4F7X A;  3A8I A;  3NUC A;  3CCJ A;  1LTB D;  3SHL A;  5EKL A;  1QVF A;  3S2H H;  5D65 A;  1PYW D;  2N88 A;  1E62 A;  3HKS A;  3NEM A;  5NUC A;  4DAY A;  5HY6 A;  4BBS B;  3DLL A;  1STN A;  2W6J A;  2KBN A;  4X3S A;  5M5X H;  1I7P A;  3ERQ A;  3Q39 A;  1WOP A;  1VQ8 A;  1SMY C;  3BCF A;  1JOR A;  1CA6 A;  3SKB A;  1Y8O B;  3M4O H;  1X55 A;  3BZK A;  4A3F H;  1YIT B;  2F0G A;  3ASS A;  2YTY A;  1MRZ A;  3CCV A;  1HNZ Q;  2F4N A;  5IYC G;  1Q12 A;  2E74 C;  5IYB H;  1J8I A;  1X3Q A;  2WV6 D;  2Z6B A;  1A8V A;  3UDX A;  3H15 A;  2BN4 A;  3B8H A;  2A68 D;  2VUM G;  5A2Q E;  2WKC A;  1OGI A;  1ZEQ X;  3S1R H;  1T6X A;  3CCL B;  1EFU A;  4XD7 A;  3KFU A;  1QIL A;  4KN7 C;  2MO1 A;  3TP8 A;  2BE5 C;  2DUD A;  5EKK A;  1VQO A;  1KC8 C;  5AN9 A;  4I7A A;  3A3B A;  4RD4 A;  1G6P A;  5FLM H;  3ZBT A;  4KKT A;  2OK7 A;  3DMU A;  2AUJ D;  2I46 A;  4MNO A;  4YY3 Q;  4DR4 L;  5EMN A;  5CV9 A;  2OEO A;  5HZB A;  4LUZ A;  1SRO A;  4XT3 B;  1EWH A;  1VQD A;  1K73 C;  2OTL B;  4G4K A;  2Q8T A;  1TWC B;  1UNS A;  1XNQ L;  1IYU A;  4RMF A;  1TQO A;  1BDO A;  4CDE C;  3S2D B;  3BCD A;  4KN4 C;  2D3L A;  4DK6 C;  3PO3 B;  1XMQ L;  3H0G H;  4ZCI A;  2ASB A;  2MPM A;  1B50 A;  2VZA A;  2CRV A;  1KJZ A;  2UXD L;  5KIX A;  1W34 A;  4DR1 Q;  2GRE A;  2ZXP A;  2GK7 A;  5I9P A;  1VHO A;  5AJ3 L;  4A3I H;  5EAY A;  1K8A C;  1E2V A;  3SVM A;  1Y14 B;  1K28 D;  3JAM c;  3CCM A;  1XX8 A;  1A3U A;  4PQX A;  4IPH A;  4LF4 Q;  2L0C A;  3R2I A;  3S16 B;  1CKM A;  2DJG C;  3A1P A;  1VQI A;  2V4D A;  1VQG A;  2BA1 A;  3CW2 C;  1JCK B;  3CU7 A;  4PC1 A;  2BH2 A;  3O13 A;  3MWY W;  3K80 C;  1OB0 A;  5I6W A;  2A6E D;  1F20 A;  3P7J A;  3BDC A;  3ONY A;  3TEH B;  1FDR A;  3HS0 C;  3KJO A;  3HOZ H;  3A8K E;  4EVO A;  1FVI A;  3MXN B;  5CC4 A;  1ASZ A;  4FF3 A;  4A3E H;  1OXT A;  3GTJ H;  2GJK A;  1LAC A;  4LFB L;  1KDB A;  1VQM B;  2F3W A;  3CC4 A;  2ZZQ A;  1YHB A;  1VQ6 A;  4U68 A;  3Q6R A;  3SLD A;  1HA6 A;  1D1K A;  4PZ8 A;  2IJ0 A;  5C3W A;  1COW A;  5DN6 A;  4BWG B;  4K8J A;  4TT3 A;  1KIX A;  4KHP Q;  3JC6 6;  3GVK A;  1M8A A;  3AB9 A;  4XLH A;  4IUT A;  3B78 A;  1JJ2 A;  4B3X A;  4RCN A;  3HOW H;  1F2M A;  1WTR A;  5CDF A;  4XQN A;  4L63 B;  4JI6 Q;  3AMU A;  1PH3 A;  1TWH H;  1KD1 C;  4TMV A;  4DF7 A;  2YV5 A;  3HOU H;  4KLK A;  2JJ1 A;  1BXT A;  3ASR A;  3CC7 B;  1PJ7 A;  2R6G A;  3DM1 A;  4C1N K;  2NV4 A;  1BCP C;  1LTS D;  2HHH Q;  2UUA L;  1SYE A;  3KF6 A;  1QVG B;  2NVX H;  2D0P A;  2K14 A;  3W2H A;  3K5L A;  1EL0 A;  3U50 C;  2KVM A;  3OMC A;  2VBT A;  1KTK A;  4P75 A;  3HOY B;  1KNA A;  2WP8 J;  4Q0F A;  1QE6 A;  3KUP A;  1G51 A;  3QJY A;  5THX A;  1IZ6 A;  4QFM A;  2ZXO A;  4LF7 Q;  1HTP A;  3W2D A;  4J0Q A;  2QDL A;  1AE2 A;  1PLF A;  1ROD A;  2EE1 A;  4Z4V A;  1FX0 A;  5C44 B;  4R8I A;  1OXX K;  1UAP A;  1ICW A;  1KRH A;  2OBR A;  3LNN A;  4K5V A;  1IKM A;  3OIP A;  4X6A H;  2GQF A;  3I4M H;  5FOB B;  1Q46 A;  1QX4 A;  3M7N A;  2PMZ B;  4A3F G;  1CKN B;  2R93 B;  1BQQ T;  2PZU A;  3JAM i;  2ZJP A;  1LTT D;  4IPC A;  5KYI A;  4XQJ A;  4C3J H;  2QN6 A;  4DV1 L;  1IHZ A;  1G7S A;  2B29 A;  2DNE A;  2QDX A;  5EBC A;  1LUZ A;  5EPK A;  1IBK Q;  1ENF A;  4FWT A;  3ER0 A;  3I2Z A;  4QV2 A;  4DK0 A;  3JAM L;  3C3L A;  1O7I A;  1WCM H;  2K4K A;  2UXC Q;  3ZPN A;  4P3I A;  5FLM G;  1H9J A;  1SE3 A;  4K5X A;  4GKK Q;  4X06 A;  5LHY 1;  2F0O A;  4X62 L;  5I2X A;  4DNR B;  1K28 A;  4XTC S;  5IIF A;  1IKL A;  4DU9 A;  3G4S A;  4NXM L;  2NZ1 D;  4XLF A;  1RHP A;  3J7A V;  3CD6 B;  1E7Z A;  2PMZ E;  2DY8 A;  3UI2 A;  4QIW B;  3A56 A;  5C4X G;  4HTH A;  3BNW A;  3TP6 A;  2XIW A;  2I5M X;  4YAL A;  1A8P A;  2K5Q A;  3D4D A;  1FNW A;  4RA8 A;  4JBM A;  3J80 c;  2KUM A;  1LTL A;  2ZTD A;  3QFS A;  1B44 D;  4APV A;  2LKV A;  3ULJ A;  1Y1V H;  1VMP A;  1Z9F A;  2JN9 A;  1HZC A;  1QG7 A;  4IPG A;  4DV7 Q;  4B43 A;  1EOV A;  2SDF A;  4LFC Q;  3GV3 A;  4ZGN B;  4P6V F;  2IL8 A;  3CES A;  4IO9 A;  5CV8 A;  3OSO A;  3GTO H;  2F0W A;  3BDO A;  4ACB A;  4A3B H;  2NPF A;  4RAU C;  4A3I G;  1Q82 C;  4OWT B;  4MZ9 A;  5JPN C;  2QGG A;  1L1O B;  1AFP A;  3P20 A;  5IYR A;  4HJ8 A;  3N52 A;  5C0X I;  2KCN A;  4QIW E;  1JC7 A;  1ESF A;  4YEL A;  2IY5 B;  1OHH A;  1NR4 A;  5A88 A;  3HOX G;  1LLR D;  2QTZ A;  3HAG A;  3J81 k;  4ME3 A;  3RD4 A;  2HLD A;  4G57 A;  2PQA A;  1NTG A;  3M4Q A;  5FO9 B;  3S9W A;  3Q22 A;  3CCS A;  5IP7 H;  3K5M A;  2V7V A;  4Z4S A;  4X64 L;  4TSS A;  3CMA A;  3AFQ A;  4PC6 A;  1ENC A;  1WOS A;  4DR7 L;  1O80 A;  2F0N A;  5CV5 A;  5M3M G;  2M5S A;  1K3R A;  2GA4 B;  4KY7 A;  4TMZ A;  2ZTE A;  3TDQ A;  2K03 A;  3K6O A;  1VQ9 B;  3S15 B;  1CM9 A;  2AWO A;  3OZW A;  1Y69 U;  5IOC A;  4XT1 B;  3QIA A;  1VQ8 B;  1YI2 A;  4UDU C;  3HOW G;  4OXP A;  2K05 A;  4XLE A;  4HE5 A;  2A6H C;  3STB D;  2B39 A;  3CCV B;  1RF2 D;  3SK8 A;  1EQQ A;  2RKS A;  2X53 S;  1IBM L;  4BY7 G;  5ISR A;  2JA6 H;  4C3H G;  3HOV G;  4ZKB B;  1WYD A;  5CV6 A;  4V19 0;  3BU2 A;  4A93 B;  1NB0 A;  1TS2 A;  3ERS X;  1PZJ D;  3J7Z C;  3A35 A;  1Z6H A;  4CKB A;  1B3A A;  3CRK C;  1PTO B;  3IFD A;  4Q5V A;  2X85 A;  3CB4 A;  5J3O A;  1UEB A;  5C0X G;  4PZ6 A;  4GNX A;  3PF5 A;  3J80 i;  3AQQ A;  1VQO B;  4UP8 A;  1N08 A;  4P71 A;  5LMN L;  2FMM A;  2KVO A;  4RPD A;  5FIU A;  3U4V A;  2E75 C;  2X69 A;  4OX9 Q;  3VNV A;  1CHQ D;  1H9S A;  1SRU A;  3PUM A;  3PIO 3;  4GOP C;  1EU4 A;  4A3M G;  1KK3 A;  1Y0R A;  3T1Y Q;  2R7F A;  3J80 L;  2F0T A;  1SM4 A;  4A3L G;  3OEH A;  4JYA L;  1STY A;  3VR6 A;  2QA4 A;  4GS3 A;  3KOJ A;  2BVN A;  4Z4R A;  1KAB A;  1G7R A;  1X6O A;  2KQ3 A;  1FNB A;  2RDH A;  2NN6 H;  2Q2H A;  4M8A A;  2GK6 A;  1MJC A;  4ZKC B;  1HR0 L;  4X7F A;  1PRT C;  3CAM A;  1UD5 A;  4U67 3;  3DM3 A;  4L5Q A;  3BYY B;  4ZGQ B;  1EXM A;  5CV7 A;  4XL9 A;  2XWB B;  2RDG A;  1GM5 A;  4BPR A;  1S5B D;  4B3M L;  3GTP B;  1EUJ A;  1JA1 A;  5LMU Q;  3TRZ A;  4LMQ D;  4YHH Q;  4RKL A;  3U9O A;  1V1P B;  1WCM G;  3DDY A;  1KMH A;  1DM0 B;  1GAQ A;  4YAW A;  4LF5 L;  1TLL A;  3P75 A;  1N36 L;  2VUM B;  4DV3 Q;  3PV0 A;  4Z9C B;  4EX5 A;  2YU9 H;  5H1S E;  2GN5 A;  1GOZ A;  4B9X A;  4K0K L;  1BX1 A;  5DSZ A;  1VQ4 A;  2HIV A;  3OWE B;  3BG3 A;  1X3P A;  4BBR H;  3E9I A;  2F1M A;  1F2L A;  1MHW C;  1PZI D;  1Q1E A;  1WFQ A;  2M9V A;  1VQP A;  4IFD H;  2XRQ D;  1SXT A;  1V1O A;  1L0W A;  5IWA Q;  2YYZ A;  2Z4I A;  5M5W H;  4DR6 L;  1STE A;  3PIP A;  4TSF A;  1V5V A;  1Y1V G;  3JQP A;  5KW9 A;  2Q2U A;  4QGU A;  3MFG A;  1SJE D;  1G2S A;  4B3S Q;  3NXW A;  3NP8 A;  1XTC D;  4KJN A;  3CC4 B;  1PH5 A;  5KND A;  1W0K A;  3MHP A;  2EQS A;  3PUN A;  4A3B G;  3ZIA A;  1PA6 A;  4MN3 A;  4XON A;  1EYD A;  4R4I A;  4O42 A;  2VQE Q;  3HKZ B;  5IP9 G;  2X8K A;  4II3 A;  1SFO H;  1S5C D;  1S4Z A;  1FD7 D;  2C5H A;  2BMW A;  3MVV A;  2L11 A;  3OZV A;  2A6E C;  2WJV A;  4BA1 I;  1KK1 A;  1HNZ L;  3UE0 A;  3PO2 B;  4JK1 C;  2XNC A;  5GV7 A;  4KV6 A;  4O0A A;  4HID A;  1YHA A;  2JA5 H;  2EVB A;  1QGY A;  3S17 B;  1NBM A;  3KF6 B;  1DOM A;  2VQF Q;  1TWF B;  4P6Y A;  3RZO B;  1KK0 A;  3T56 B;  3PQI A;  2EDG A;  3J7Y W;  1QJO A;  1I3Q B;  4OP7 A;  1W9X A;  4A3J G;  4A3C H;  2UXB Q;  2VY3 A;  3Q6S A;  2EY1 A;  2EJG C;  3SK6 A;  3FPK A;  4YY3 L;  3HKZ E;  1BBW A;  5IYD H;  3S1N B;  1R4Q B;  1QUE A;  4DR2 L;  2XOK A;  2IPK D;  3I90 A;  1HFN A;  3KYH C;  3TRE A;  3ASP A;  2JA7 H;  4X7E A;  1ONL A;  3SK4 A;  4LF6 Q;  3IRB A;  5GAH C;  3CTA A;  4CKC A;  5CBE E;  1PFN A;  4ZCM A;  4X66 Q;  1GUS A;  3FKS A;  1AZP A;  1GD7 A;  1MBY A;  4DK1 A;  2XZL A;  3I4L A;  4IUN A;  3CQZ B;  4BY1 H;  1MJE A;  4RPB A;  3DXJ C;  3L9A X;  2AMC B;  3MXN A;  1VF7 A;  4IZ8 A;  1A3V A;  5CYU A;  4DR1 L;  4RH6 A;  3GTM B;  1M90 D;  4ZCK A;  5BN5 A;  1MSH A;  2F43 A;  2QKI C;  3KBX A;  2J7K A;  4HIZ A;  3D6W A;  4ZCL A;  2YWH A;  2VNI A;  3HP3 A;  2ICI A;  3PGZ A;  1WU8 A;  3I56 B;  1FND A;  1WOC A;  5GAE C;  4AQY Q;  3G4S B;  1BUV T;  1IXR A;  1CQF A;  4CGY B;  3ND9 A;  4FXG C;  2MJ8 A;  2O5I C;  4Z1M A;  1E0B A;  2D0O A;  4X7C A;  2MFI A;  3S14 B;  5CMD A;  3S1M B;  3J81 c;  4MYT A;  1KTV A;  3PA1 A;  5J1Z A;  1EIG A;  2CBX A;  1A2T A;  1YNN D;  2PYK A;  3SE0 A;  1STB A;  3I7F A;  4DUZ L;  4QUZ A;  1LT6 D;  3KF8 A;  4ABN A;  1B3Q A;  3FJO A;  1QUF A;  3NSW A;  1QVG A;  3GTQ H;  3CPW A;  4ACA A;  3VMF A;  3QOJ A;  4ZUI A;  2X6W A;  4ZQ3 A;  2DCU A;  3Q6Q A;  1X9N A;  2EXD A;  4DV6 Q;  2CQO A;  3UE1 A;  4RLZ A;  2NVQ H;  1TY2 A;  2DY7 A;  1DDG A;  4A3D H;  2BPO A;  2E2I H;  3MCA A;  2OQ0 A;  4HSV A;  1GR1 A;  2L1B A;  4WJ3 M;  1BX0 A;  3GTK B;  2E2J H;  1IW7 D;  1ILP A;  3TN2 A;  2B2T A;  1AZQ A;  1AN8 A;  5I4D A;  5H5J A;  2JQO A;  2V31 A;  2KEN A;  3IKJ A;  2Z6K C;  4BBR G;  4KI0 A;  1CKN A;  1GUO A;  2N55 A;  2O2L D;  1S72 A;  3TS2 A;  3MEF A;  1F2Z A;  4Z4Y A;  2PE3 A;  3CCS B;  2V1C C;  2PO4 A;  3KBG A;  4R4Q A;  1BKB A;  3OAA A;  3MFY A;  1I50 H;  4HMJ A;  2BM0 A;  4Q7J B;  2D74 A;  4CKE A;  5TSS A;  2B2W C;  1PTO D;  2MO0 A;  2ZJR A;  2V7U A;  1XTD A;  1T9H A;  5EJW A;  1VQ7 B;  4K1X A;  4S3S A;  5KGU A;  5C4X B;  3E5S A;  1TU2 B;  3VO2 A;  2Q2I A;  2Q6I A;  2VNJ A;  2B2V A;  2EYO A;  5ELC A;  4LF7 L;  3GIR A;  5JJI A;  2B63 H;  4B3T Q;  3KEW A;  3FDT A;  1I94 L;  2HD3 A;  4DR3 Q;  2HT1 A;  4HN7 A;  3V76 A;  3W5H A;  1NE3 A;  1RIP A;  3WOF A;  1FR3 A;  2GJR A;  2HMA A;  4QL5 A;  4X8I A;  1YI2 B;  3ZUG A;  4QF4 A;  5GRO A;  1CKO A;  1NJI D;  3ULL A;  3A8J A;  2N8N A;  2VJJ A;  1SJH D;  2XWJ B;  1NDH A;  1J9Z A;  1QH0 A;  5T1I A;  4LBW A;  3AVY A;  4X65 Q;  1Y1W H;  4GZY C;  3ZYY X;  1SE4 A;  2RCF A;  4A3I B;  4MHE A;  1KDA A;  1WSR A;  4M4S A;  2F4V Q;  2E76 C;  1YNJ C;  3PF4 A;  4JW0 A;  1ZUN B;  2CW5 A;  2I5H A;  2EIX A;  1WDT A;  2UU9 Q;  1E63 A;  3MXG A;  3CKI B;  4OOS A;  3J81 i;  4QCL A;  5K36 H;  1IBK L;  1TWG B;  3HFZ B;  1VQH A;  4GNX B;  4DXF A;  4U9U A;  1XNR Q;  3M3Y H;  4A3C G;  2UXC L;  3HOX B;  2MGS A;  1GUN A;  3ERO A;  4GKK L;  1LYL A;  4CBV A;  1J5E L;  1L1O A;  2D3N A;  2IHF A;  4DV0 Q;  3Q0A A;  4N9T A;  2OCE A;  4C0S A;  3J81 L;  4NDX A;  5JBQ A;  5DLQ E;  1LO5 D;  2Y0S E;  4QHY A;  1JIC A;  3NK9 A;  4C3I H;  5ELN A;  2JA7 G;  2CWP A;  4JOI A;  2JEB I;  1VQN B;  4XKW A;  2PNR C;  3STB C;  3J7A F;  2QA4 B;  2PLF A;  2R9V A;  4GQN A;  5M3M B;  4IW3 B;  3C46 A;  1HNW L;  1YJW B;  2JE6 I;  4RHR A;  4LNQ A;  4DN4 M;  1KLU D;  3I55 A;  1XPO A;  2WAQ G;  4LFC L;  3E3X A;  2ZM6 Q;  3R6J A;  4CDF C;  5C4H A;  4E6I A;  2E1B A;  2RF4 A;  1N9W A;  1BJK A;  2F0Q A;  1CNE A;  1HTL D;  4TQU S;  1TWH B;  1OGJ A;  1DDI A;  3QE2 A;  1FL0 A;  1WD0 A;  3D6C A;  2EFG A;  2QGQ A;  4IFD J;  4BY7 B;  4FVM A;  4ALP A;  1VQ9 A;  3DEP A;  4IPD A;  4C3H B;  3HOV B;  5C6A A;  2CF4 A;  2CW0 D;  2NTT A;  3VNU A;  2R92 H;  1VQ4 B;  3GDE A;  1SLJ A;  2PW5 A;  4QUF A;  1VQP B;  1LTI D;  1LV9 A;  1U4P A;  2DJF C;  4FYD A;  5C4J B;  5TR9 A;  3X3M A;  1IBL Q;  3H3V I;  1EFI D;  2R7Z H;  3RN2 A;  3MMP A;  4JV5 Q;  1SEB D;  3G6J B;  3WXM A;  2EJF C;  4DR5 L;  2H5X A;  5ELB A;  4GLX A;  1PTO F;  4A3M B;  2JK8 A;  2RA4 A;  4P72 A;  2MNA A;  3FKI H;  1EYC A;  3SEJ A;  1QFJ A;  4JI3 L;  4YCV A;  5A35 A;  3H9N A;  2DN8 A;  4DAM A;  1CT1 D;  4GKJ Q;  3JQR A;  5FNZ A;  3TME A;  4UY8 C;  4JI7 L;  1SE8 A;  1PH1 A;  4QB4 A;  1CFM A;  4JI2 Q;  4OIK A;  3UDF A;  4AF7 A;  4G7X A;  2PNH A;  2KED A;  5I6Y A;  4B47 A;  2F0P A;  3HEJ A;  4HAE A;  2YWE A;  1B70 B;  1WCM B;  1Q8K A;  1BBU A;  3FPU B;  3B6Y A;  5D14 A;  1GJR A;  1KRS A;  2RSO A;  2NUC A;  3CP2 A;  1LTG D;  2XGT A;  4B4D A;  2L55 A;  1Y8P B;  2LMC B;  4Y7N H;  1WTX A;  4OOV A;  4OGQ C;  1OXV A;  1QVC A;  2ID0 A;  4RD6 A;  3SEB A;  5M5Y B;  4G1B A;  3TP5 A;  5CV4 A;  1MAB A;  1NSN S;  2K5W A;  5JJL A;  1V1P A;  1EWI A;  3I91 A;  4HJ5 A;  3M7G A;  2B63 G;  3PIP 3;  2C4T A;  2Q6O A;  4KMU C;  4Z4U A;  3SLN A;  3W2G A;  2I5L X;  1AW7 A;  2JA8 H;  3K0Y A;  1TXY A;  3A54 A;  4LUO A;  3BVM A;  4PNY A;  3BZD B;  4A4I A;  2GVA A;  3IL8 A;  3U58 A;  3E6Z X;  5DNF A;  4ROX A;  4IQZ A;  4KJO A;  1L0X B;  1Y1W G;  4P25 A;  3E9H A;  4DV2 L;  4LWC A;  1F9P A;  2B2U C;  1GKH A;  1JA0 A;  1HHV A;  4UHV A;  1SE2 A;  4K2K A;  2VBV A;  2E8G A;  2DER A;  1MSG A;  4JI8 L;  5G3L D;  3K7U C;  5EPJ A;  5LMU L;  1EQR A;  1H9K A;  3JAM E;  1UD6 A;  1WOR A;  3CP0 A;  4G7H C;  1SYB A;  1HQM C;  1N0U A;  2CKZ B;  2CK3 A;  1JB9 A;  1VHE A;  3SJP A;  1SSO A;  3CP8 A;  2RBM A;  5LMZ A;  1XPU A;  4DV3 L;  4HCE A;  3GVJ A;  1FRN A;  1Q90 A;  4B9W A;  4G5G A;  3H09 A;  2V7Q A;  2B3G A;  4C3I G;  5FO7 B;  2UUB Q;  1YIJ B;  2QCP X;  2VW9 A;  3CCR B;  3NTH A;  2RCN A;  3DEO A;  5JAV A;  4WZL A;  2ZZE A;  4A3J B;  2F3V A;  4A3K G;  1KXL A;  1I8D A;  3KF8 B;  2AQ2 B;  2A69 D;  3UDI A;  2PMD A;  2I0Q A;  2AQ1 B;  2HCI A;  3E1Y E;  2CND A;  3CPW B;  3P1H A;  4JI0 Q;  3C1F A;  3EJI A;  2MP1 A;  1JB7 A;  3H94 A;  4NP5 A;  1M90 C;  1DD2 A;  1CA5 A;  5K5P A;  3SR1 A;  2HDL A;  1L1O C;  1SKY B;  1TY0 A;  1IHM A;  1GO2 A;  4DV5 Q;  1EFC A;  4DQL A;  1J9O A;  5JJK A;  4JI5 L;  3OTO Q;  1PZK D;  2WB1 B;  4FNF A;  4PMW A;  4C56 C;  2E5L Q;  1TWA B;  4QMG A;  3FHW A;  2NZO A;  4JOI C;  2NVT B;  1KZL A;  2JEA I;  1D5X C;  4P12 A;  1WTH A;  3K0X A;  1I4X A;  2R92 G;  1U5K A;  1QZH A;  1YNN C;  3RMH A;  3I73 A;  5GAD C;  5HXB A;  4NNJ A;  1S72 B;  3WYA A;  5E4W C;  5IGB A;  2F0J A;  1TUI A;  1DOK A;  4EQP A;  5IYB G;  2GJP A;  1Q1B A;  2X6X A;  3DUZ A;  4A76 A;  1XMO Q;  1A62 A;  4DK3 C;  3VYU A;  3RLF A;  3OE7 A;  3EQL C;  4P74 A;  1H85 A;  3A5U A;  1FYC A;  2UXB L;  1ESR A;  1CSQ A;  3QB3 A;  2XZO A;  1KDC A;  3WBK A;  2WB1 E;  4FK8 A;  4X3T A;  1HNX Q;  3NTI A;  1GO3 E;  5L37 A;  3I56 A;  3S1Q B;  4OEL B;  1QB5 D;  2B5O A;  2F0M A;  1YVC A;  5KNL A;  1U4L A;  1Y0Y A;  1YX2 A;  2TMP A;  4XN0 A;  4LF6 L;  4K2L A;  2AUK A;  1QFY A;  3WY9 A;  5IYW A;  1XQB A;  1TWC H;  1B9M A;  5IGE A;  1FGU A;  1RTO A;  1C7Y A;  4KKU A;  1R9T H;  1SAP A;  3TS0 A;  5C4Z A;  1ZYR D;  3S2D H;  3D4W A;  4YIJ A;  3H0G G;  4XNF A;  1NB9 A;  1PTO C;  1TVX A;  3K58 A;  3ITP A;  5DAU A;  4H7B A;  2YU9 B;  5G3L F;  2BH8 A;  3TSS A;  4RGT A;  5FLX c;  5J22 A;  1F9R A;  4PC7 A;  4PAA A;  1O78 A;  5D3D A;  1FNV A;  4HSP A;  4LBV A;  2PZT A;  4TN1 A;  1EQV A;  1E64 A;  5ELE A;  3VR4 A;  2F4I A;  3VA7 A;  4P9S A;  5HZA A;  3PVD A;  3G48 A;  1S4M A;  3NQT A;  4HR7 B;  1UE7 A;  1U9R A;  4X07 A;  3QR8 A;  2EZV A;  1X3G A;  3A8J E;  1NJI C;  4YAO A;  4OPO A;  4JI1 Q;  1SR3 A;  1ZM2 A;  4FN5 A;  1QCB D;  4OPV A;  3L3O C;  4MYU A;  3F2B A;  3VA5 A;  2WII B;  1N06 A;  3WNB A;  1E3P A;  4Y9R A;  2AWN A;  2HQL A;  2K75 A;  1D5Z C;  1YEZ A;  3HOZ G;  1I6V C;  3I55 B;  3U4Z A;  3DWP A;  4A3E G;  4DV6 L;  1VQ7 A;  3ONU A;  4GLV B;  2Q6L A;  4FXD A;  3MC0 B;  4DAV A;  2BCO A;  2H4O A;  5KSW B;  3AVU A;  5JPM C;  4G7Z C;  4H44 C;  3H91 A;  2JJ2 A;  2C78 A;  1DYQ A;  1HZB A;  1O7L A;  3CPX A;  2WZP P;  3BVG A;  1JWM D;  4HIK A;  4OWW B;  1MD2 D;  2D2C C;  2F0D A;  5GQO A;  2P3M A;  2JXM B;  4DXG A;  2C2W A;  1WTQ A;  4TMW A;  4B08 A;  2D9R A;  2OBT A;  3HOU G;  1M1K D;  4EGV A;  3EBE A;  4PC2 A;  1JOK A;  4B3G A;  3VYT A;  4IUU A;  2K5V A;  4DFA A;  5BSY A;  1UE5 A;  1CSP A;  5A8A A;  1SYC A;  5M3F H;  4TKO B;  5KEE A;  1UD4 A;  4BA2 I;  2VZL A;  4RGM A;  4RWS C;  1LT3 D;  1QGZ A;  4XLC A;  2E2H B;  3AVT A;  1WPC A;  1N07 A;  3HOY H;  1XNQ Q;  4JG2 A;  4AYB B;  2CHB D;  3BC9 A;  1PHJ A;  3RLO A;  4B3T L;  1WTO A;  4DR3 L;  5C5M A;  2FMC A;  3LWU A;  3MA2 B;  2CW0 C;  1CQV A;  1BNZ A;  5C3E B;  5C44 H;  2WAQ B;  3BDL A;  1VQN A;  2E1R A;  3D31 A;  3I4M G;  1AP0 A;  1XXG A;  4CHT B;  4POG A;  1WSV A;  1E1O A;  4X65 L;  3EVQ A;  4LBY A;  4JMQ A;  2ZBU A;  2A68 C;  3QFC A;  5FL7 A;  2R93 H;  1K9M D;  1YJW A;  5AJ3 Q;  2F4V L;  4TRD A;  5GAG C;  4C3J G;  4L6T B;  1EEF D;  1TVC A;  4RFB A;  5FLX L;  4NBS A;  1T6Y A;  1JNY A;  1NMF A;  2EY5 A;  2G5D A;  3OIQ A;  4YXW A;  3DWQ A;  1KQS B;  4CDC C;  1U2R A;  4AYB E;  4RD3 A;  1Q9S A;  1XNR L;  4G6I A;  1SMY D;  4DQK A;  5D3I B;  1VQ5 B;  5ELF A;  4IN3 A;  4JI4 Q;  2UUC L;  4UP9 A;  2WAQ E;  2K5H A;  4DV0 L;  1IJE A;  3TQY A;  3RN5 A;  2F0H A;  2QF7 A;  1N32 L;  1EIY B;  5CGK A;  1P16 A;  3I4O A;  1K8O A;  1HA5 A;  5E6T A;  3LO8 A;  5LMN W;  4XR6 A;  2ZXI A;  4P22 A;  1PH4 A;  4LFB Q;  4RHS A;  4B3R L;  4LF9 Q;  1PH7 A;  1E43 A;  1SNC A;  2LS0 1;  4AH6 A;  1KAA A;  1VMC A;  1PFM A;  3C1E A;  3NPP A;  4Z4Z A;  3R2T A;  3SGI A;  4L5S A;  4XKV A;  2BF4 A;  2E2J B;  5BSX A;  2ZM6 L;  1QOH A;  1EQT A;  2B2Y A;  2XEX A;  2ZZG A;  4H13 C;  5T1G A;  1IL2 A;  2OK8 A;  1RTN A;  2L4N A;  1UE6 A;  1K73 D;  1QNK A;  4KD3 A;  2W6I A;  2NVY B;  2FIN B;  3NBI A;  1SKQ A;  4F7D A;  1HR0 W;  1NBW A;  3FPP A;  5IT9 E;  2OF1 A;  1HH2 P;  1I50 B;  2WJY A;  1D7Q A;  1J6Q A;  3PEN A;  3BYT B;  2EY6 A;  1W3S A;  2C4U A;  1MKH A;  3CC2 A;  1OXU A;  5M9O A;  4CJ0 B;  1WI5 A;  1GUW A;  4QQB X;  1IBL L;  3K7A H;  3ZJY C;  2B63 B;  2EYJ A;  4XQF A;  1I4Q A;  5IP7 G;  3KLS A;  1K8A D;  2XZP A;  1EYA A;  1TT2 A;  1NCV A;  2CH4 A;  3SK5 A;  5FA6 A;  3EFX D;  1OB5 A;  4DKA C;  3SXH A;  2NN6 I;  3QFR A;  1LT4 D;  2V7T A;  1AE3 A;  1RD9 D;  4NXN Q;  3A0J A;  5IGF A;  4GKJ L;  2CC2 A;  5IYP A;  4FP5 D;  3HRZ C;  3R3O A;  4ODG A;  3S15 H;  2F0F A;  3GTL B;  2WPD A;  1EIH A;  1F2Y A;  1N0V C;  1W6J A;  1WTW A;  1WJJ A;  4XYO A;  4DA2 A;  1D8L A;  1EY8 A;  4DV1 Q;  2VB2 X;  4J1M A;  4RM0 A;  2GPJ A;  3OYY A;  1PRT B;  1WVL A;  1V9P A;  5IGC A;  3K5N A;  2HUG A;  4UZE A;  3KLW A;  2NTS A;  5DM7 3;  2A69 C;  4KK7 A;  5TY0 A;  2F0L A;  2BGI A;  2K7V A;  4LK1 C;  2YTV A;  5JVG 3;  2JA6 G;  1NY4 A;  3VO1 A;  2SOB A;  3U6B A;  4JVZ A;  3RR5 A;  4X62 Q;  5M3F G;  1Q3L A;  1ZM9 A;  1U0L A;  4L8J A;  1TS5 A;  2QW7 A;  4IFD I;  4C3I B;  2K01 A;  4GN3 B;  4OON A;  1PTO H;  1EZ8 A;  1QWY A;  3LWE A;  5IY0 A;  2WZN A;  3HOY G;  1IYJ B;  1GAW A;  3EA6 A;  1S40 A;  4J6H A;  4ID6 A;  4A3K B;  4IUV A;  5BR8 Q;  1KD1 D;  4LF4 L;  5GV8 A;  3OWF A;  1EIF A;  1TTT A;  1SBB B;  3UDG A;  3DHQ A;  3ISX A;  3A5Z B;  4LW1 A;  2NZH A;  4MTN A;  1YIJ A;  1XB2 A;  4GLA C;  2KCM A;  3WWV A;  1RCV D;  5J3B A;  5DM6 3;  3CCR A;  2FVG A;  3VDY A;  1EP1 B;  3RLN A;  3J7A 5;  1PYS B;  4RD2 A;  4DAP A;  3B82 A;  1VQJ A;  3AFP A;  3S2H B;  2NN6 G;  1L2F A;  2KHI A;  1B2T A;  1KL9 A;  4A3G H;  3U6K A;  2F0U A;  1X65 A;  2ALY B;  3GP7 A;  2WYR A;  5M5X B;  2QE7 A;  4R71 A;  4GNX C;  1E3X A;  3GTG H;  1DON A;  3W1G A;  4OO1 H;  2VYQ A;  2R92 B;  3VR3 A;  1N33 Q;  3M4O B;  3T13 A;  3GTP H;  3W5U A;  3D4R A;  2B7B A;  1EY5 A;  3I4N H;  1K3B C;  3BY2 A;  3CXC B;  4A3F B;  2MHV A;  4KHP L;  4RDK A;  1TR5 A;  1EU3 A;  2L9H A;  3AST A;  2Z0S A;  1KK2 A;  4ZRZ A;  2WAC A;  4WFN 3;  2O5J C;  1RQR A;  5CBA E;  1RDP D;  4UZU A;  3J81 j;  5FKA C;  3AEV A;  1YNX A;  2UUB L;  3S1R B;  1W87 A;  3PUY A;  4LBZ A;  4JI6 L;  5F4J A;  4XN3 A;  1HXY D;  3CCU A;  1JOO A;  1T5X D;  1ZYR C;  4IFD G;  1A2U A;  1B9N A;  2PQE A;  2VNK A;  5JEA H;  4G7W A;  2HHH L;  4WZK A;  2EPB A;  3NBH A;  5L46 A;  4R9W A;  4C1N I;  4OOX A;  4XIG S;  4JI0 L;  3L7Z C;  4II2 A;  1JE5 A;  1W0J A;  1D2B A;  3G6E A;  1P4M A;  1R5O A;  4WWV A;  2F0V A;  2VL6 A;  1VQL A;  1NAP A;  1IB0 A;  3L0O A;  4DV5 L;  1K8M A;  1R5N A;  2JN4 A;  5E3F A;  2DEU A;  4DUY Q;  3OTO L;  1K0R A;  5CR3 A;  1N8R D;  2SNS A;  3OMG A;  3RZD H;  1V8Q A;  4CJ1 B;  1HZ9 A;  4J15 A;  1UMK A;  3H0G B;  3PMF A;  4C2M H;  1IBM Q;  2PIA A;  1X56 A;  4XDX A;  4ZYS A;  3OP1 A;  1Y8N B;  4N9P A;  1RJT A;  4PMC A;  1WTV A;  1SYG A;  3SDZ A;  3GD7 A;  3L2P A;  4X3K A;  4XLA A;  3W2E A;  3W5O A;  4LC0 A;  1SNP A;  3PO2 H;  2FJ2 A;  4EH1 A;  1HJP A;  1KAW A;  3AYH B;  2BOS A;  1W2B B;  2HIX A;  2JA5 G;  3I1F A;  1FJG Q;  2N49 A;  2Z9H A;  3EIV A;  4B44 A;  1Q82 D;  3S17 H;  4AVZ A;  1HZE A;  2Q2T A;  4P2C B;  1HRJ A;  1TWF H;  3RZO H;  1GHK A;  3OPO A;  4NW2 A;  2J0T D;  2PW7 A;  3NWS A;  2R61 A;  3FEW X;  3EN2 A;  5IYD G;  1E1T A;  1YJN A;  5HUR A;  3C2Q A;  2ZZF A;  1ZKO A;  4F88 A;  3HOZ B;  2V7X A;  3IAY A;  4LF8 Q;  2SNM A;  1HR0 Q;  4A3E B;  4RCY A;  4FO2 A;  2A8V A;  1IYV A;  3GTJ B;  2X6Y A;  3G7L A;  3PSI A;  3T16 A;  5BN4 A;  2F0I A;  1RL2 A;  1M1K C;  1B23 P;  2R3Z A;  3HGB A;  4M0L A;  3BS1 A;  3PUZ A;  4HE6 A;  4K6L A;  1VS0 A;  3CQZ H;  3GV6 A;  1FNC A;  1SYF A;  1B1Z A;  2NYZ D;  4BY1 G;  1EFW A;  2CVR A;  4IUQ A;  3F8T A;  3NEL A;  2XN9 C;  4DV7 L;  3TBI B;  4RGO S;  4NCN A;  1KHI A;  3Q24 A;  3HOW B;  1PVO A;  3K81 C;  1WOO A;  1JJG A;  3GVL A;  1S3O A;  1F9Q A;  3GTM H;  4LFA Q;  3TZU A;  1I6H H;  1D1I A;  3HOU B;  4YAF A;  3FP9 A;  4YEJ A;  4RCO A;  3PUX A;  3OJX A;  2A6H D;  1HUN A;  2Z1C A;  2EIF A;  4NB3 A;  1GXD C;  1OB2 A;  1VQA A;  1YBY A;  4L5T A;  2NVX B;  1I4H A;  1JOQ A;  3GO5 A;  4WZT A;  2K50 A;  4XYQ A;  2ZL6 A;  3PIO A;  1JMC A;  3S14 H;  2VS1 A;  3S1M H;  2N3S A;  3CF5 A;  1K9M C;  3NTK A;  3BJU A;  4EQ5 A;  2QEJ C;  1LTR D;  4EQN A;  1SND A;  2OXP A;  3AVW A;  1PDQ A;  1N34 Q;  4RGN A;  4A3G G;  5H59 A;  4P1V A;  4FF1 A;  1K83 H;  2BDN A;  2F03 A;  1T6Z A;  4IUP A;  1PJ5 A;  4ZAI A;  1U4M A;  3PA2 A;  2EXZ A;  2JSO A;  4OHJ A;  2HQE A;  4OO1 G;  4Z4W A;  3I4M B;  1EY4 A;  2VNH A;  1KRT A;  3I4N G;  1G29 1;  4A3D G;  4UZF A;  1ET9 A;  1C48 A;  4TVA B;  1LTA D;  4Y52 H;  2QTL A;  3MHB A;  4C3J B;  3GTK H;  2JJQ A;  2F0S A;  4DV4 Q;  1WTH D;  1NUC A;  4B3F X;  1PRT D;  2ICE C;  2PCF B;  5JJZ A;  3A74 A;  4OPS A;  4TMT A;  3CC2 B;  1A3T A;  1XWE A;  2L5T A;  1EY9 A;  1G8Z D;  4AIM A;  2EY2 A;  1B7Y B;  3OW7 A;  3D26 A;  5JOB A;  1EY0 A;  5JEA G;  3JQQ A;  4H9G A;  1Q81 D;  1CZG A;  1DXM A;  4LUV A;  4AF6 A;  4KHV A;  2R7D A;  1E1Q A;  1B53 A;  4DR2 Q;  1PV4 A;  3GQB A;  4DPG A;  2BGJ A;  1AIP A;  4LAA A;  4NKL A;  1KQS A;  3P27 A;  2KA7 A;  1CK1 A;  3ES9 A;  3OHX C;  4BS9 A;  5C4X H;  1G6Z A;  4ULL A;  1VQ5 A;  5TV2 A;  2ZTC A;  1R9T B;  4OX9 L;  2D5D A;  2B2T C;  1UD8 A;  3WBJ A;  4E0F A;  1B8A A;  1Y1V B;  3T1Y L;  2C77 A;  3PCO B;  1I4R A;  1G7T A;  3HKZ G;  3ZBU A;  1PMR A;  4J8Q A;  3NHH A;  4M53 A;  1DOL A;  1BF4 A;  2PI2 E;  3GTO B;  1A0I A;  2EYP A;  1WD1 A;  1HPC A;  2JDI A;  4YWK A;  4A3B B;  3PO2 G;  2QIL A;  1F60 A;  5E7N A;  4NPS A;  4BXX H;  2ATW A;  3FMC A;  3G71 B;  2VXW A;  3K57 A;  3LX0 A;  2ES2 A;  1UE1 A;  2A19 A;  5BN3 A;  4EQO A;  4R4C A;  3V96 A;  2K5N A;  5K36 G;  3E0E A;  2B2V C;  2IHE A;  4YHH L;  1TWG H;  4IOA A;  3LQ6 A;  3ZZU A;  1SN8 A;  1PH9 A;  3E0J A;  1R5B A;  3HOX H;  3R93 A;  2IX0 A;  3IFT A;  4JI4 L;  1HUM A;  3ASQ A;  1STH A;  2LFN A;  4OEM B;  4DUZ Q;  1UUP A;  2V7W A;  5A2Q L;  3AVX A;  4YWM A;  1HA3 A;  4F87 A;  4V0B A;  4DNI A;  5IYQ A;  3CMM A;  3AGP A;  2D9U A;  2MUY A;  5F2D A;  4KD4 A;  1I18 A;  5IWA L;  3T1H Q;  1XE1 A;  4IUR A;  2Q8R E;  3MTS A;  4LF9 L;  2HCC A;  3URY A;  1KLG D;  5M3M H;  3K5O A;  3AVV A;  5J35 A;  1I4G A;  1OXS C;  2X6G A;  3ONA B;  2RC6 A;  2F0E A;  4RDL A;  2RHQ B;  2IW3 A;  2Z4H A;  4ASU A;  3ZZT A;  4PZ7 A;  2D62 A;  1Q86 D;  2Q8I B;  2OTJ A;  3FVQ A;  4GOP A;  1S5F D;  2DIE A;  2RC5 A;  1GVP A;  2RSN A;  1PKV A;  1DJR D;  1QGA A;  2DGY A;  1D5M C;  1VQC A;  2J4X A;  4QY7 A;  5EPL A;  4IOC A;  2OWO A;  2XGJ A;  1STG A;  4BY7 H;  2JA6 B;  2VQE L;  4FF2 A;  5JEA J;  5IGD A;  2IX1 A;  4KTA A;  4C3H H;  1VF5 C;  1WTP A;  5HKK A;  3HOV H;  3ICE A;  2B8G A;  1A63 A;  2X3U A;  4N8X 1;  5M3F B;  1PRT F;  2BM1 A;  2DOG A;  4MTK A;  3R8B A;  4XOP A;  5COY A;  5IGG A;  1NRK A;  5IE8 A;  5F4M A;  1HCZ A;  2CQA A;  3CCU B;  3CME B;  1YHQ B;  4FXU A;  3A7A B;  3M9B A;  3CCE B;  5C0X H;  1PH2 A;  1CTM A;  4P26 A;  3W5V A;  3CHB D;  4XOT A;  5C4J H;  1PH8 A;  3RY8 A;  1VQE A;  2R7Z G;  1X54 A;  2VQF L;  1X3F A;  1EOT A;  3NBH B;  1H42 A;  1I94 Q;  3F2U A;  4A3M H;  2XRS D;  3FKI G;  2EJM A;  3G6E B;  3W3A A;  1AEX A;  2DNC A;  3C2P A;  1VQK A;  4A3L H;  1VQL B;  3OW2 B;  2A1A A;  4NXN L;  3BQJ A;  3U9S A;  2QEX A;  2OBS A;  1OTC A;  2K5D A;  1SDF A;  4L5R C;  1ILQ A;  1IW7 C;  2WFW A;  4PGO A;  1PFS A;  2ZL5 A;  1LM0 A;  2BA0 A;  3K8A A;  1T5E A;  3F2C A;  2FX3 A;  1O7Z A;  1VQB A;  4X66 L;  3MXU A;  1YJ9 A;  2K6A A;  3H6M A;  1EP3 B;  4G7O C;  2AKW B;  4GN4 B;  2X0K A;  1D1N A;  4RKB A;  4XXE A;  4YCW A;  2A73 B;  1DG1 G;  1GJX A;  3PO3 H;  3AU7 A;  1J5E Q;  1TS4 A;  3VYR A;  2QMU A;  1V0F A;  2Z8L A;  3W2F A;  5FO8 B;  1E1R A;  3T53 B;  2RDF A;  5M5Y H;  4R1J A;  1DCZ A;  1RQP A;  2FFK B;  4R8N A;  5COR A;  4BBR B;  3CXC A;  1JQY D;  2XND A;  1SNQ A;  1VLO A;  4P3Y A;  4I65 A;  1N8R C;  5BR8 L;  3NE5 B;  3BH4 A;  4GN5 A;  1YJN B;  2CH4 W;  5FO1 A;  5M5W B;  5TRD A;  4AQY L;  3QOL A;  4UAI A;  1TS3 A;  2VJI A;  3S16 H;  1HNW Q;  5E4X A;  2JA8 G;  4WRD A;  3G05 A;  1L0Y B;  1W6K A;  4RJL A;  1D8T A;  3QG1 A;  3J80 E;  1BCP B;  3TZD A;  3RNU A;  3QFT A;  4NMZ A;  4CJ2 C;  2Y0S G;  1C4Q A;  4JBJ A;  3KDF B;  4X7D A;  1EZ6 A;  3I72 A;  4WOR A;  1H95 A;  1VLY A;  2CCZ A;  1PXU A;  1U4R A;  2K33 A;  4BXX G;  5FLX E;  3M85 A;  3WOE A;  2EYM A;  3BZC A;  2F52 A;  5IP9 H;  1SFO B;  1ASY A;  2XNJ A;  1N33 L;  3JU4 A;  2NWG A;  1JR0 D;  1B2R A;  5HGQ A;  3D3R A;  2OT2 A;  2OYN A;  2OQK A;  3K7A B;  4X05 A;  2JA5 B;  1RKN A;  1Q7Y D;  3NWT A;  1HQR D;  4DGZ A;  1BPL A;  5DEH A;  3VR2 A;  4O2D A;  4DR5 Q;  5LL6 S;  1YNJ D;  1N05 A;  1H8H A;  2IWH A;  3CCJ B;  1EFT A;  1Z47 A;  1D2E A;  5KNC A;  4A3J H;  2HDN B;  4QJF A;  1QVF B;  4JI3 Q;  3CCQ A;  1VCI A;  5DS0 A;  1W2B A;  5IK2 A;  4MIU A;  1GVH A;  2JA9 A;  4ILW A;  2AHO A;  4DR4 Q;  1QNU A;  3MXP A;  4JI7 Q;  4DAY B;  2VNU D;  2ZXR A;  2JA7 B;  3D8G A;  1YLO A;  4QVA A;  2M2L A;  4KHZ A;  2CFM A;  1EYG A;  1ZM4 A;  5I2Y A;  3N6R A;  4DUY L;  1OO9 B;  4Y9U A;  2NBF A;  1QG0 A;  1QUQ A;  2ZBV A;  3NQI A;  4BY1 B;  1XMQ Q;  4BBS G;  1TWA H;  2IT1 A;  2P5Z X;  4PC3 A;  3M4P A;  3A8I E;  2NVT H;  1JB3 A;  3PUV A;  4QVJ A;  5IOD A;  2UXD Q;  4N8F A;  1YZ6 A;  3A55 A;  4N3N A;  3WQZ A;  1FNU A;  1ML0 D;  4ZUJ A;  5A89 A;  2JYO A;  1FRQ A;  1ELO A;  2KCC A;  1E2Z A;  2L15 A;  1FJG L;  3QSY A;  4WJ4 A;  1A15 A;  2UU9 L;  3H3V C;  1JJC B;  2BV3 A;  3OEE A;  1MI2 A;  3SJZ A;  1NNX A;  3RUZ A;  2KJX A;  4P73 A;  4H02 A;  4KY5 A;  1Z7T A;  1EWY A;  5C5L A;  2Z6K A;  3S1Q H;  3LGJ A;  3GTQ B;  4A3G B;  4DV2 Q;  1G7C A;  4LF8 L;  4K5W A;  4CQJ A;  3GTG B;  2RVL A;  1XPR A;  1BQE A;  4JI8 Q;  2NVQ B;  5ELD A;  2B2W A;  3I4N B;  1Q81 C;  2ZL7 A;  1VDZ A;  2JP1 A;  1G2T A;  4A3D B;  4RD1 A;  2BE5 D;  1KC8 D;  4PV1 C;  5EKI A;  5I9O A;  3PO3 G;  2E2I B;  4WQM A;  1MIU A;  4HCS A;  2BDO A;  2ZTG A;  4M1U B;  3CCM B;  4R4O A;  4JBK A;  2LZJ A;  4XM3 A;  1ZM3 A;  5F4O A;  2DET A;  1M4V A;  4K6D A;  1F9S A;  3W1B A;  4RG1 A;  2G9D A;  4LFA L;  1B4O A;  5IT9 c;  3I70 A;  2F3I A;  1H8E A;  1GUG A;  1I4P A;  2J7Z A;  4RD0 A;  1P8L A;  1YIT A;  4OIJ A;  3CRL C;  2F1L A; 
#chains in the Genus database with same CATH homology
 4OL7 A;  1PFB A;  3DWA A;  1UEA B;  2K04 A;  1VJS A;  2EOT A;  1GHJ A;  5EGT A;  1FGB D;  5KNB A;  1V0E A;  3RZD B;  4C2M B;  5AFW A;  4FXK C;  5J39 A;  5KRU A;  3V2T A;  1BBX C;  4KKS A;  1O7Y A;  1SYD A;  3TP7 A;  1GUT A;  1HFG A;  5EBD A;  1Y1W B;  1EY7 A;  1HVX A;  5C0X J;  2SEB D;  1ET6 A;  2AQ3 B;  3I3C A;  2M00 A;  3BVZ A;  2WKD A;  1V43 A;  1BOS A;  3VR5 A;  3M3Y B;  1EFR A;  1F77 A;  2L12 A;  3M4Y A;  5JVH 3;  4LJZ C;  3A7L A;  3I8Z A;  3KLR A;  4F8M A;  3ND8 A;  4FF4 A;  3QWN A;  1C8C A;  1CZW A;  3A3G A;  1UD3 A;  2ENB A;  2JIZ A;  2KHS A;  2XNA C;  2VB3 X;  4K14 A;  3MZ5 A;  2K28 A;  1BCP D;  4K8I A;  5C3X A;  2PZW A;  2C5C A;  2QDB A;  1LAB A;  2A5H A;  4H0L C;  1EEI D;  2IX3 A;  2PPB C;  2I07 B;  1R4P B;  1I6H B;  1CI3 M;  2ZXH A;  2EYF A;  2H1E A;  2EYH A;  5IT9 L;  5KYL A;  1BR9 A;  1JWS D;  2B8F A;  4DNT B;  1UD2 A;  3HZX A;  2E2D C;  2R7Z B;  2A74 C;  3T4A C;  3J81 E;  2ZT9 C;  2FHT A;  1K83 B;  1H9M A;  4PMB A;  4WJW A;  1BO0 A;  1IL8 A;  3FKI B;  1A6X A;  4JBW A;  3KK7 A;  4IAL A;  5LL6 X;  1MGS A;  3PUW A;  2EYL A;  4ME5 A;  2F0K A;  4ZK9 B;  1SNO A;  4I7Z C;  3MAQ A;  1JWU D;  3T51 B;  1S5E D;  2C9O A;  2RQX A;  1DZ1 A;  2K32 A;  1CHP D;  2X6L A;  4KY6 A;  1TKW B;  5EQ0 A;  3OOC A;  2Z6B D;  1XYI A;  3Q23 A;  4Y7N B;  1Q8I A;  3OFN A;  4ZLT F;  2XSC A;  1S5D D;  1STA A;  1TII D;  3X3N A;  2B2U A;  5HGT A;  2HDM A;  3MEH A;  3WDN A;  1BLI A;  1X32 A;  1SNM A;  2G9H D;  2B2Y C;  1NR2 A;  2NB0 A;  1D6E C;  2JA8 B;  1ZXT A;  2O4X A;  2KEC A;  3VYS A;  2KEE A;  2ZTN A;  1EY6 A;  2LY7 A;  2Y0S B;  4XOR A;  1H9R A;  1ENA A;  1JE4 A;  4OO1 I;  4HED A;  2WSS A;  1BMF A;  1BCP F;  3QO2 A;  3FRP B;  4QUC A;  3K59 A;  4HMI A;  2TSS A;  5E1F A;  4XQQ A;  1EWC A;  1E2W A;  4XMY A;  1H9S B;  5FK9 C;  1WP6 A;  1LT5 D;  2KOL A;  1E79 A;  1KNE A;  4O1N A;  3V05 A;  2WIN B;  1E3Z A;  1II3 A;  3KLS X;  2XVS A;  3HG9 A;  4X3U A;  1G91 A;  2K1B A;  4F7X A;  3NUC A;  1LTB D;  3SHL A;  5EKL A;  5D65 A;  1PYW D;  2N88 A;  5NUC A;  4DAY A;  4BBS B;  1STN A;  2W6J A;  4X3S A;  3ERQ A;  1SMY C;  3BCF A;  1JOR A;  1CA6 A;  1Y8O B;  2F0G A;  1Q12 A;  2E74 C;  1J8I A;  1X3Q A;  2WV6 D;  2A68 D;  5A2Q E;  2WKC A;  1ZEQ X;  4XD7 A;  1QIL A;  4KN7 C;  3TP8 A;  2BE5 C;  5EKK A;  3A3B A;  4KKT A;  3DMU A;  2AUJ D;  2I46 A;  5CV9 A;  2OEO A;  4XT3 B;  1EWH A;  4G4K A;  2Q8T A;  1TWC B;  1UNS A;  1IYU A;  1TQO A;  1BDO A;  3S2D B;  3BCD A;  4KN4 C;  2D3L A;  3PO3 B;  2MPM A;  1B50 A;  5KIX A;  2ZXP A;  2GK7 A;  5I9P A;  1E2V A;  3SVM A;  1K28 D;  1XX8 A;  1A3U A;  4PQX A;  2L0C A;  3R2I A;  3S16 B;  2BA1 A;  2V4D A;  1JCK B;  3CU7 A;  3O13 A;  3MWY W;  1OB0 A;  5I6W A;  2A6E D;  3P7J A;  3BDC A;  3HS0 C;  3A8K E;  4EVO A;  5CC4 A;  4FF3 A;  1OXT A;  2GJK A;  1LAC A;  1KDB A;  2F3W A;  2ZZQ A;  4U68 A;  1HA6 A;  1D1K A;  2IJ0 A;  5C3W A;  1COW A;  5DN6 A;  4BWG B;  4K8J A;  4TT3 A;  3GVK A;  1M8A A;  3AB9 A;  4XLH A;  4IUT A;  4RCN A;  1F2M A;  1WTR A;  5CDF A;  4XQN A;  4L63 B;  3AMU A;  4DF7 A;  2JJ1 A;  1BXT A;  2R6G A;  3DM1 A;  4C1N K;  1BCP C;  1LTS D;  1SYE A;  3K5L A;  1EL0 A;  2KVM A;  3OMC A;  1KTK A;  3HOY B;  1KNA A;  2WP8 J;  4Q0F A;  1QE6 A;  3KUP A;  3QJY A;  2ZXO A;  1HTP A;  3W2D A;  1PLF A;  1ROD A;  2EE1 A;  1FX0 A;  5C44 B;  4R8I A;  1OXX K;  1UAP A;  1ICW A;  3LNN A;  4K5V A;  1IKM A;  3OIP A;  5FOB B;  3M7N A;  2PMZ B;  2R93 B;  1BQQ T;  2PZU A;  1LTT D;  5KYI A;  4XQJ A;  1IHZ A;  2DNE A;  5EBC A;  5EPK A;  1ENF A;  3JAM L;  4DK0 A;  3C3L A;  3ZPN A;  1H9J A;  1SE3 A;  4K5X A;  5LHY 1;  2F0O A;  5I2X A;  4DNR B;  4XTC S;  5IIF A;  1IKL A;  4DU9 A;  2NZ1 D;  4XLF A;  1RHP A;  3J7A V;  2DY8 A;  3UI2 A;  4QIW B;  3A56 A;  4HTH A;  3TP6 A;  2XIW A;  2K5Q A;  4RA8 A;  3D4D A;  1FNW A;  2KUM A;  1B44 D;  2LKV A;  1VMP A;  1QG7 A;  2SDF A;  3GV3 A;  2IL8 A;  3CES A;  5CV8 A;  3OSO A;  2F0W A;  3BDO A;  4RAU C;  5JPN C;  1AFP A;  3P20 A;  3N52 A;  5C0X I;  2KCN A;  1JC7 A;  1ESF A;  4YEL A;  1OHH A;  1NR4 A;  1LLR D;  3HAG A;  3RD4 A;  2HLD A;  4G57 A;  5FO9 B;  3S9W A;  3Q22 A;  3K5M A;  4TSS A;  1ENC A;  1O80 A;  2F0N A;  5CV5 A;  2M5S A;  2GA4 B;  4KY7 A;  3TDQ A;  2K03 A;  3K6O A;  3S15 B;  1CM9 A;  2AWO A;  1Y69 U;  5IOC A;  4XT1 B;  3QIA A;  4UDU C;  2K05 A;  4XLE A;  2A6H C;  2B39 A;  1RF2 D;  3SK8 A;  2RKS A;  2X53 S;  5ISR A;  4C3H G;  4ZKB B;  5CV6 A;  4V19 0;  4A93 B;  1TS2 A;  1PZJ D;  3A35 A;  1Z6H A;  4CKB A;  1B3A A;  3CRK C;  1PTO B;  3IFD A;  4Q5V A;  2X85 A;  5C0X G;  2FMM A;  2KVO A;  2E75 C;  2X69 A;  1CHQ D;  1H9S A;  3PIO 3;  1EU4 A;  3J80 L;  2F0T A;  3OEH A;  1STY A;  3VR6 A;  1KAB A;  2KQ3 A;  2RDH A;  2NN6 H;  4M8A A;  2GK6 A;  4ZKC B;  1PRT C;  1UD5 A;  4U67 3;  3BYY B;  5CV7 A;  4XL9 A;  2XWB B;  2RDG A;  1S5B D;  3GTP B;  4LMQ D;  4RKL A;  3U9O A;  1V1P B;  3DDY A;  1KMH A;  1DM0 B;  3P75 A;  2VUM B;  3PV0 A;  4Z9C B;  1GOZ A;  4B9X A;  3OWE B;  3BG3 A;  1X3P A;  2F1M A;  1F2L A;  1PZI D;  1Q1E A;  2M9V A;  4IFD H;  2XRQ D;  1SXT A;  1V1O A;  2YYZ A;  2Z4I A;  1STE A;  4TSF A;  3MFG A;  1SJE D;  1G2S A;  3NXW A;  3NP8 A;  1XTC D;  4KJN A;  5KND A;  1W0K A;  3ZIA A;  4MN3 A;  4XON A;  1EYD A;  4O42 A;  3HKZ B;  2X8K A;  4II3 A;  1S5C D;  1S4Z A;  1FD7 D;  3MVV A;  2L11 A;  2A6E C;  2WJV A;  4BA1 I;  3PO2 B;  4JK1 C;  4KV6 A;  2EVB A;  3S17 B;  1NBM A;  1DOM A;  1TWF B;  3RZO B;  3T56 B;  2EDG A;  3J7Y W;  1QJO A;  1I3Q B;  1W9X A;  3Q6S A;  2EY1 A;  2EJG C;  3SK6 A;  3S1N B;  1R4Q B;  2XOK A;  2IPK D;  3I90 A;  1HFN A;  1ONL A;  3SK4 A;  4CKC A;  5CBE E;  1PFN A;  1AZP A;  1GUS A;  3FKS A;  1MBY A;  4DK1 A;  2XZL A;  3I4L A;  4IUN A;  3CQZ B;  3DXJ C;  3L9A X;  3MXN A;  1VF7 A;  4IZ8 A;  1A3V A;  5CYU A;  4RH6 A;  3GTM B;  5BN5 A;  1MSH A;  2F43 A;  2QKI C;  3KBX A;  4HIZ A;  3D6W A;  3HP3 A;  2ICI A;  1BUV T;  1CQF A;  4CGY B;  3ND9 A;  4FXG C;  2MJ8 A;  2O5I C;  4Z1M A;  1E0B A;  3S14 B;  5CMD A;  3S1M B;  5J1Z A;  1EIG A;  1A2T A;  1YNN D;  2PYK A;  3SE0 A;  1STB A;  3KF8 A;  1LT6 D;  4ABN A;  3NSW A;  3QOJ A;  4ZUI A;  2X6W A;  4ZQ3 A;  1TY2 A;  2DY7 A;  4HSV A;  2L1B A;  3GTK B;  1IW7 D;  1ILP A;  3TN2 A;  2B2T A;  1AZQ A;  1AN8 A;  5I4D A;  2V31 A;  3IKJ A;  4KI0 A;  1GUO A;  2N55 A;  2O2L D;  1F2Z A;  2PO4 A;  3KBG A;  3MFY A;  3OAA A;  4HMJ A;  4CKE A;  5TSS A;  2B2W C;  1PTO D;  5EJW A;  4S3S A;  5KGU A;  5C4X B;  3E5S A;  1TU2 B;  2B2V A;  2EYO A;  5ELC A;  3KEW A;  3FDT A;  4HN7 A;  3WOF A;  1FR3 A;  2GJR A;  4QF4 A;  2VJJ A;  1SJH D;  2XWJ B;  5T1I A;  4GZY C;  3ZYY X;  1SE4 A;  4A3I B;  4MHE A;  1KDA A;  2E76 C;  1YNJ C;  3MXG A;  3CKI B;  4QCL A;  5K36 H;  1TWG B;  4DXF A;  3HOX B;  2MGS A;  1GUN A;  3ERO A;  4CBV A;  2D3N A;  3Q0A A;  4N9T A;  3J81 L;  4NDX A;  1LO5 D;  1JIC A;  3NK9 A;  2JEB I;  4XKW A;  2PNR C;  3J7A F;  2R9V A;  4GQN A;  5M3M B;  3C46 A;  2JE6 I;  4RHR A;  4DN4 M;  1KLU D;  5C4H A;  4E6I A;  2E1B A;  2F0Q A;  1HTL D;  4TQU S;  1TWH B;  1WD0 A;  3D6C A;  4IFD J;  4BY7 B;  4FVM A;  3DEP A;  4C3H B;  3HOV B;  5C6A A;  2CW0 D;  2NTT A;  2PW5 A;  4QUF A;  1LTI D;  1LV9 A;  1U4P A;  4FYD A;  5C4J B;  3X3M A;  1EFI D;  1SEB D;  3G6J B;  2EJF C;  5ELB A;  1PTO F;  4A3M B;  2RA4 A;  1EYC A;  5A35 A;  2DN8 A;  1CT1 D;  3TME A;  4QB4 A;  1CFM A;  4OIK A;  4G7X A;  2KED A;  5I6Y A;  2F0P A;  3HEJ A;  4HAE A;  1WCM B;  3FPU B;  5D14 A;  2RSO A;  2NUC A;  3CP2 A;  1LTG D;  2L55 A;  1Y8P B;  2LMC B;  1WTX A;  4OGQ C;  1OXV A;  3SEB A;  2ID0 A;  5M5Y B;  3TP5 A;  5CV4 A;  1MAB A;  1NSN S;  2K5W A;  1V1P A;  3I91 A;  3M7G A;  3PIP 3;  4KMU C;  1AW7 A;  3K0Y A;  3A54 A;  3BVM A;  4PNY A;  3BZD B;  3IL8 A;  3E6Z X;  5DNF A;  4IQZ A;  4KJO A;  1L0X B;  1F9P A;  2B2U C;  1HHV A;  1SE2 A;  4K2K A;  1MSG A;  5G3L D;  5EPJ A;  1H9K A;  3JAM E;  1UD6 A;  4G7H C;  1SYB A;  1HQM C;  2CK3 A;  1SSO A;  2RBM A;  3CP8 A;  4HCE A;  3GVJ A;  1Q90 A;  4B9W A;  3H09 A;  2V7Q A;  4C3I G;  5FO7 B;  2QCP X;  3NTH A;  3DEO A;  5JAV A;  4A3J B;  2ZZE A;  2F3V A;  1I8D A;  2AQ2 B;  2A69 D;  2AQ1 B;  2HCI A;  3P1H A;  3C1F A;  3EJI A;  2MP1 A;  3H94 A;  4NP5 A;  1DD2 A;  1CA5 A;  5K5P A;  3SR1 A;  2HDL A;  1SKY B;  1TY0 A;  1J9O A;  1PZK D;  2WB1 B;  4FNF A;  4PMW A;  4C56 C;  1TWA B;  4QMG A;  2NVT B;  1KZL A;  2JEA I;  1D5X C;  1I4X A;  1YNN C;  3RMH A;  3I73 A;  4NNJ A;  5E4W C;  5IGB A;  2F0J A;  1DOK A;  4EQP A;  2GJP A;  1Q1B A;  2X6X A;  3DUZ A;  3VYU A;  3RLF A;  3OE7 A;  3EQL C;  1FYC A;  1ESR A;  3QB3 A;  2XZO A;  1KDC A;  4X3T A;  3NTI A;  3S1Q B;  1QB5 D;  2F0M A;  5KNL A;  1U4L A;  2TMP A;  4XN0 A;  4K2L A;  2AUK A;  1B9M A;  5IGE A;  1RTO A;  4KKU A;  1SAP A;  5C4Z A;  1ZYR D;  3D4W A;  4YIJ A;  4XNF A;  1PTO C;  1TVX A;  3K58 A;  3ITP A;  5DAU A;  4H7B A;  2YU9 B;  5G3L F;  3TSS A;  4RGT A;  5J22 A;  1F9R A;  1O78 A;  5D3D A;  1FNV A;  4HSP A;  2PZT A;  1EQV A;  5ELE A;  3VR4 A;  2F4I A;  3VA7 A;  3NQT A;  4HR7 B;  2EZV A;  1U9R A;  3A8J E;  1QCB D;  3L3O C;  3VA5 A;  2WII B;  2AWN A;  1D5Z C;  1I6V C;  3DWP A;  4FXD A;  3MC0 B;  4DAV A;  2BCO A;  2H4O A;  5JPM C;  4G7Z C;  4H44 C;  3H91 A;  2JJ2 A;  1DYQ A;  1O7L A;  2WZP P;  3BVG A;  1JWM D;  1MD2 D;  2D2C C;  2F0D A;  2JXM B;  4DXG A;  1WTQ A;  4B08 A;  4EGV A;  1JOK A;  4B3G A;  3VYT A;  4IUU A;  4DFA A;  1SYC A;  4TKO B;  5KEE A;  1UD4 A;  4BA2 I;  4RGM A;  4RWS C;  1LT3 D;  4XLC A;  2E2H B;  1WPC A;  4AYB B;  2CHB D;  3BC9 A;  1WTO A;  5C5M A;  2FMC A;  3LWU A;  3MA2 B;  2CW0 C;  1CQV A;  1BNZ A;  5C3E B;  2WAQ B;  3BDL A;  3D31 A;  1AP0 A;  1XXG A;  4CHT B;  3EVQ A;  4JMQ A;  2A68 C;  5FL7 A;  4TRD A;  4C3J G;  4L6T B;  1EEF D;  5FLX L;  4RFB A;  2EY5 A;  3OIQ A;  4YXW A;  3DWQ A;  4G6I A;  1SMY D;  5D3I B;  5ELF A;  4IN3 A;  2F0H A;  2QF7 A;  5CGK A;  1K8O A;  1HA5 A;  4XR6 A;  2ZXI A;  4P22 A;  4RHS A;  1E43 A;  1SNC A;  2LS0 1;  1KAA A;  1VMC A;  1PFM A;  3C1E A;  3NPP A;  3R2T A;  4XKV A;  2E2J B;  1QOH A;  1EQT A;  2B2Y A;  2ZZG A;  4H13 C;  5T1G A;  1RTN A;  2L4N A;  1QNK A;  4KD3 A;  2W6I A;  2NVY B;  2FIN B;  3NBI A;  5IT9 E;  3FPP A;  2OF1 A;  1I50 B;  2WJY A;  3BYT B;  2EY6 A;  1OXU A;  5M9O A;  4CJ0 B;  1GUW A;  2B63 B;  2EYJ A;  4XQF A;  1I4Q A;  3KLS A;  2XZP A;  1EYA A;  1TT2 A;  1NCV A;  3SK5 A;  3EFX D;  3SXH A;  2NN6 I;  1LT4 D;  1RD9 D;  5IGF A;  4FP5 D;  3HRZ C;  3R3O A;  4ODG A;  2F0F A;  3GTL B;  2WPD A;  1EIH A;  1F2Y A;  1W6J A;  1WTW A;  4XYO A;  4DA2 A;  1EY8 A;  2VB2 X;  4J1M A;  1PRT B;  1WVL A;  5IGC A;  3K5N A;  2HUG A;  5DM7 3;  2NTS A;  2A69 C;  4KK7 A;  2F0L A;  2K7V A;  4LK1 C;  5JVG 3;  2SOB A;  4IFD I;  1Q3L A;  4L8J A;  1TS5 A;  4C3I B;  2K01 A;  1PTO H;  1EZ8 A;  1QWY A;  3LWE A;  3EA6 A;  4J6H A;  4ID6 A;  4A3K B;  4IUV A;  3OWF A;  1SBB B;  3DHQ A;  1RCV D;  5DM6 3;  4DAP A;  3S2H B;  2NN6 G;  1B2T A;  2F0U A;  3GP7 A;  5M5X B;  2QE7 A;  1DON A;  1E3X A;  4OO1 H;  2R92 B;  3VR3 A;  3M4O B;  3T13 A;  3D4R A;  1EY5 A;  4A3F B;  2MHV A;  1TR5 A;  1EU3 A;  2L9H A;  4ZRZ A;  2WAC A;  4WFN 3;  2O5J C;  5CBA E;  1RDP D;  4UZU A;  5FKA C;  3S1R B;  3PUY A;  4XN3 A;  1HXY D;  1JOO A;  1T5X D;  1ZYR C;  4IFD G;  1A2U A;  1B9N A;  2PQE A;  5JEA H;  4G7W A;  2EPB A;  3NBH A;  4C1N I;  4R9W A;  4XIG S;  3L7Z C;  4II2 A;  1W0J A;  1D2B A;  2F0V A;  1NAP A;  1K8M A;  5E3F A;  5CR3 A;  2SNS A;  3OMG A;  1V8Q A;  4CJ1 B;  3H0G B;  3PMF A;  4XDX A;  4ZYS A;  1Y8N B;  4N9P A;  1RJT A;  4PMC A;  1WTV A;  1SYG A;  3SDZ A;  3GD7 A;  4X3K A;  4XLA A;  1SNP A;  2FJ2 A;  2BOS A;  4AVZ A;  1HZE A;  4P2C B;  1HRJ A;  1GHK A;  3OPO A;  4NW2 A;  2J0T D;  2PW7 A;  3NWS A;  2R61 A;  3FEW X;  5HUR A;  2ZZF A;  1ZKO A;  4F88 A;  3HOZ B;  3IAY A;  2SNM A;  4A3E B;  4FO2 A;  1IYV A;  3GTJ B;  2X6Y A;  3G7L A;  3T16 A;  5BN4 A;  2F0I A;  2R3Z A;  3HGB A;  3BS1 A;  3PUZ A;  4K6L A;  3GV6 A;  1SYF A;  1B1Z A;  2NYZ D;  2CVR A;  4IUQ A;  2XN9 C;  3TBI B;  4RGO S;  3Q24 A;  3HOW B;  3GVL A;  1F9Q A;  3TZU A;  1D1I A;  3HOU B;  4YEJ A;  4RCO A;  3PUX A;  2A6H D;  1HUN A;  2Z1C A;  1GXD C;  2NVX B;  1I4H A;  1JOQ A;  3GO5 A;  4XYQ A;  3NTK A;  2QEJ C;  1LTR D;  4EQN A;  1SND A;  2OXP A;  1PDQ A;  4RGN A;  4FF1 A;  2BDN A;  2F03 A;  4IUP A;  4ZAI A;  1U4M A;  2EXZ A;  2JSO A;  4OHJ A;  2HQE A;  4OO1 G;  3I4M B;  1EY4 A;  1G29 1;  1ET9 A;  1C48 A;  1LTA D;  3MHB A;  4C3J B;  2F0S A;  1WTH D;  1NUC A;  4B3F X;  1PRT D;  2ICE C;  2PCF B;  5JJZ A;  1A3T A;  1XWE A;  2L5T A;  1EY9 A;  1G8Z D;  2EY2 A;  3OW7 A;  5JOB A;  1EY0 A;  5JEA G;  1CZG A;  1DXM A;  4KHV A;  1E1Q A;  1B53 A;  3GQB A;  4NKL A;  4LAA A;  2KA7 A;  1CK1 A;  3OHX C;  4BS9 A;  1G6Z A;  4ULL A;  1R9T B;  2D5D A;  2B2T C;  1UD8 A;  4E0F A;  1Y1V B;  1I4R A;  1PMR A;  4J8Q A;  3NHH A;  1DOL A;  1BF4 A;  3GTO B;  2EYP A;  1WD1 A;  1HPC A;  2JDI A;  4A3B B;  2QIL A;  3FMC A;  2VXW A;  3K57 A;  3LX0 A;  5BN3 A;  4EQO A;  3V96 A;  5K36 G;  2B2V C;  3E0J A;  3R93 A;  2IX0 A;  3IFT A;  1HUM A;  1STH A;  2LFN A;  1UUP A;  5A2Q L;  4F87 A;  4V0B A;  3CMM A;  2D9U A;  2MUY A;  5F2D A;  4KD4 A;  1I18 A;  4IUR A;  2Q8R E;  3MTS A;  2HCC A;  3URY A;  1KLG D;  3K5O A;  1I4G A;  1OXS C;  2X6G A;  3ONA B;  2F0E A;  2IW3 A;  2Z4H A;  4ASU A;  2D62 A;  2Q8I B;  3FVQ A;  1S5F D;  2DIE A;  2RSN A;  1PKV A;  1DJR D;  1D5M C;  2J4X A;  5EPL A;  2XGJ A;  1STG A;  2JA6 B;  4FF2 A;  5JEA J;  5IGD A;  2IX1 A;  4KTA A;  1VF5 C;  1WTP A;  5HKK A;  2B8G A;  5M3F B;  1PRT F;  3R8B A;  4XOP A;  5COY A;  5IGG A;  1NRK A;  1HCZ A;  2CQA A;  3A7A B;  4FXU A;  5C0X H;  1CTM A;  3CHB D;  4XOT A;  1EOT A;  3F2U A;  2XRS D;  2EJM A;  3W3A A;  1AEX A;  2DNC A;  3C2P A;  3U9S A;  2K5D A;  1SDF A;  1ILQ A;  1IW7 C;  2BA0 A;  1T5E A;  1O7Z A;  3MXU A;  2K6A A;  3H6M A;  4G7O C;  4RKB A;  4XXE A;  2A73 B;  1GJX A;  3AU7 A;  1TS4 A;  3VYR A;  1V0F A;  2Z8L A;  5FO8 B;  1E1R A;  3T53 B;  2RDF A;  1DCZ A;  2FFK B;  4R8N A;  5COR A;  4BBR B;  1JQY D;  2XND A;  1SNQ A;  4I65 A;  3NE5 B;  3BH4 A;  5M5W B;  3QOL A;  4UAI A;  1TS3 A;  2VJI A;  5E4X A;  4WRD A;  3G05 A;  1L0Y B;  1W6K A;  3QG1 A;  3J80 E;  1BCP B;  3TZD A;  4NMZ A;  4CJ2 C;  1C4Q A;  1EZ6 A;  3I72 A;  4WOR A;  1VLY A;  1PXU A;  1U4R A;  2K33 A;  5FLX E;  3M85 A;  3WOE A;  2EYM A;  1SFO B;  3JU4 A;  2NWG A;  1JR0 D;  3D3R A;  2OT2 A;  3K7A B;  2JA5 B;  1RKN A;  3NWT A;  1HQR D;  4DGZ A;  1BPL A;  5DEH A;  3VR2 A;  5LL6 S;  1YNJ D;  1H8H A;  2IWH A;  1Z47 A;  5KNC A;  1VCI A;  5IK2 A;  4MIU A;  4ILW A;  1QNU A;  3MXP A;  2VNU D;  2ZXR A;  2JA7 B;  3D8G A;  2M2L A;  4KHZ A;  5I2Y A;  3N6R A;  1OO9 B;  2NBF A;  3NQI A;  4BY1 B;  2IT1 A;  3A8I E;  1JB3 A;  3PUV A;  5IOD A;  3A55 A;  3WQZ A;  1FNU A;  4ZUJ A;  1ML0 D;  2JYO A;  2KCC A;  1E2Z A;  1A15 A;  3H3V C;  3OEE A;  1MI2 A;  3RUZ A;  2KJX A;  4KY5 A;  1Z7T A;  5C5L A;  3GTQ B;  4A3G B;  4K5W A;  3GTG B;  2RVL A;  2NVQ B;  5ELD A;  2B2W A;  3I4N B;  1VDZ A;  2JP1 A;  1G2T A;  4A3D B;  2BE5 D;  4PV1 C;  5EKI A;  5I9O A;  2E2I B;  4HCS A;  2BDO A;  2ZTG A;  4M1U B;  2LZJ A;  4XM3 A;  1M4V A;  4K6D A;  1F9S A;  2G9D A;  1B4O A;  3I70 A;  1H8E A;  1GUG A;  1I4P A;  2J7Z A;  4OIJ A;  3CRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...