3H94A

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 39
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3h94A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h94A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3h94A01
1H9KA 4H0LC 2A6ED 1K8MA 4G7HC 1FYCA 3GQBA 5JEAG 2A68C 4LK1C 2O5IC 5JEAH 1OXVA 2K7VA 2IT1A 4RCNA 2A69D 3IFTA 2A6EC 4JK1C 1PMRA 3RLFA 5A35A 1Y69U 2A6HC 1Q12A 3M4YA 1Y8OB 3H94A 4GZYC 2BA0A 1EWHA 3ND9A 1IW7C 1VCIA 1ZYRC 3PUWA 2D5DA 3SDZA 1IW7D 3I4LA 2L5TA 2DNCA 2EDGA 4KKUA 4OO1G 4BA1I 3GD7A 2A6HD 3D31A 4JBWA 1H9JA 3T56B 1K8OA 1Q90A 1GJXA 2A69C 3PUZA 1TU2B 3MFYA 3IKJA 3OW7A 4TKOB 2PCFB 4KI0A 2D2CC 2DN8A 3SE0A 4BA2I 5K36H 2KCCA 2BE5D 4HR7B 3PV0A 4G7ZC 2YYZA 3CRLC 3BDOA 3T53B 2AUJD 3EQLC 1Z7TA 2QF7A 5BN5A 1A6XA 1H9SA 1OXUA 2AUKA 3QG1A 2K32A 3N6RA 3FPPA 1HCZA 1IYVA 1GUNA 2PPBC 1VF5C 3P20A 1VF7A 3KLRA 1GUTA 3PUVA 1DCZA 4DNTB 1O7LA 3HGBA 2V4DA 1DXMA 1LACA 2CW0C 2JEAI 4L8JA 1LABA 1QJOA 4TQUS 2Q8IB 3M85A 4KHZA 1HTPA 2A68D 1Y8NB 1Y8PB 2EJFC 3A7LA 3VR5A 1OXTA 3MXUA 2JE6I 3WDNA 5KNBA 2EJGC 4IFDG 3LWUA 2D62A 2E75C 3QJYA 1H9SB 2E74C 5BN3A 1CFMA 2NN6H 3BG3A 3I72A 1VDZA 3NE5B 3ND8A 4OO1H 2LMCB 2BDOA 1B9MA 2R6GA 3PUXA 1B9NA 1G291 2B8FA 3LNNA 5BN4A 3A8IE 5K36G 1OXXK 1OXSC 1CI3M 2EJMA 3VA7A 3CRKC 3W3AA 3T51B 1Q1BA 4XTCS 1Q1EA 1YNNC 3VR3A 3I73A 1E2VA 4KN7C 3A8KE 3VR4A 1V43A 4KN4C 5C0XH 3U9SA 3TZUA 3A7AB 4KKTA 4DK1A 2NN6I 1GHKA 2DNEA 3PUYA 3A8JE 2F1MA 3VR6A 4KKSA 1GHJA 1CTMA 1ZKOA 2K33A 4H44C 4KMUC 3L7ZC 4IFDH 3M7NA 1T5EA 2BE5C 2PNRC 1GUOA 4LJZC 1TKWB 4PV1C 1BDOA 2BA1A 3QIAA 1E2ZA 1SMYC 3DXJC 4G7OC 1GUGA 1FR3A 2KA7A 3OPOA 1O78A 1H9MA 1I6VC 2JEBI 1E2WA 1V8QA 2E76C 4H13C 4IQZA 1DD2A 5KNDA 2AWOA 2O5JC 2JXMB 4DNRB 4XIGS 3VR2A 1HQMC 3FMCA 3OOCA 1IYUA 2NN6G 5KNCA 1H9RA 1YNJC 4OGQC 4DK0A 4I7ZC 1ONLA 2ZT9C 3D4RA 2EVBA 2B8GA 5C0XG 3AB9A 1HPCA 1Z6HA 1GUSA
chains in the Genus database with same CATH superfamily
2J7KA 1K9MD 1H9KA 2BH8A 1VQNA 5EMNA 4FF4A 2B2YC 1YI2B 1P16A 4C3JG 5DN6A 2K7VA 2M00A 4IUTA 1K9MC 3T1HQ 4HJ7A 4IPGA 2A6EC 3SHLA 2VZLA 1PJ7A 2PMDA 1KHIA 2MQHA 1YIJB 2PO4A 1JICA 2Z1CA 3D4WA 4DFAA 1KABA 3R2TA 1SJED 3T1YQ 2N55A 3SVMA 2OF1A 3EIVA 1VQMA 1ZM4A 2NVTB 2Z6BD 4P73A 5IYDG 3OEEA 3MHBA 2HHHL 1MKHA 2UXBQ 1M8AA 3M3YH 5LL6X 2WP8J 1HUNA 2F0LA 1CK1A 1IB0A 4RKLA 5T1GA 5JEAJ 2AQ3B 1TUIA 2IW3A 1OO9B 3MXNB 1RL2A 1EQRA 4P75A 1HA6A 4HMIA 4X3KA 3FPPA 2SNMA 4X65Q 4M2LA 1FGBD 3ONAB 2QE7A 3ULPA 1ASZA 3QFTA 1Q86D 2WINB 2HQLA 2ALYB 4XN0A 1SBBB 2XNAC 5LMNW 1Z9FA 4G1VA 2OT2A 3CCLB 4L5QA 2QMUA 3AMUA 4XOPA 1QB5D 3MXUA 4FO2A 5JOBA 3CXCA 3P75A 4L5TA 2KVMA 1E24A 3CRZA 2LKVA 2WZPP 5AFWA 4FF2A 2ZZFA 2XGJA 3PENA 2R93B 1OGJA 1VDZA 4RA8A 3NE5B 4G1BA 5TSSA 2KECA 2LMCB 1VJSA 3CD6B 2RHQB 3CCMA 1YHQB 1EYDA 1IBLL 3SGIA 2ZM6Q 2DOGA 3EA6A 3CCRB 3FKIB 4WFN3 4JVZA 3CCJB 1SRUA 3KF8A 4K8IA 3S9WA 3DM3A 2ZTEA 3WNCA 4LFCL 5LMNQ 4P74A 4RCZA 3AVYA 4K5WA 4ABNA 1VQ9A 2NVXB 3VR4A 2HD3A 4YAUA 5KSWB 1V43A 4WQMA 2EYPA 2GQFA 5TR9A 3AU7A 4BY7G 4JI8Q 3HOXH 4KD4A 1KRTA 3PUYA 1U5KA 4XL9A 2E1BA 4HE5A 3TDQA 5IWAQ 4KMUC 1XPUA 3KOJA 2C5BA 3Q6QA 1HNWL 3VNVA 2K52A 2EPBA 2BA1A 4DAYA 3GTKB 5C0XJ 2TMPA 3CCQA 2KHSA 3E5SA 1PH9A 1E2WA 4YWKA 3EBEA 1W6JA 3CCSA 5JPNC 2PW5A 1KAAA 1KAWA 1WYDA 3GTLH 4LF9L 1B4OA 1STGA 2F0JA 4K14A 4NMZA 5M5YB 1O7IA 3E9HA 3PUNA 2C9OA 4PG3A 4XMYA 5M3FG 3BZCA 2WZNA 3S1NB 3D26A 3C1EA 1UD3A 2EVBA 1YJNA 5IT9E 4P6YA 1Z6HA 3NWTA 1GUSA 4PMWA 4OELB 4TMTA 1HNWQ 4TMVA 2GJRA 4LK1C 2BPOA 4RDJA 2Q2HA 1PH8A 1LTTD 5HGQA 4P2CB 1C8CA 1SKYB 1JJ2B 1MHWC 1EFTA 1NRKA 1W3SA 3ND9A 4OX9L 1B70B 5H59A 2I07B 4OEMB 4OO1G 5M3FH 2WACA 2HT1A 2MO1A 1X6OA 2EE1A 4NW2A 5D65A 5GADC 3G05A 3A56A 2NVQB 3P7JA 3RLNA 3CC4B 3BYYB 5M3MB 3NEMA 4LF6L 1NJIC 5K36H 2XZPA 1TY2A 5E6TA 4NXNL 3W5UA 2ZZEA 1QUQB 2LFNA 3EJIA 2B7BA 1SJHD 1MD2D 5J39A 2RVLA 4ZV4A 2AUKA 1IJEA 3STBD 1EY7A 1QGZA 5I4DA 4C3HB 5C44B 2VBTA 4QFMA 4QHYA 5LMUQ 2PLFA 3R3OA 2CHBD 1EY8A 5IYRA 1UD2A 1QE6A 2FMCA 2EYFA 5BSYA 1OB2A 5KYIA 4B43A 4DV7L 4GN5A 3OWFA 4RKBA 3W2HA 2JA5B 1A62A 1F9QA 3S1RH 4HCSA 3VDYA 4RCYA 4HEDA 1IXRA 2OTJB 5KNBA 4IFDG 4B9XA 1WD1A 2E75C 2B5OA 1I5FA 1LT5D 2L12A 1PVOA 4LBWA 1PH4A 3S1RB 2CFMA 5GAGC 1BBWA 2BOSA 2V7VA 1I94Q 1O7ZA 4A3LH 4AYBB 4DN4M 3CC2A 4PAAA 2J7ZA 2XWBB 4BY7H 1NUCA 1N08A 3C1FA 5F4JA 1B2TA 3K5LA 5IGEA 2UXCQ 5FL7A 4QIWB 1SEBD 3TP5A 4PABA 4ILWA 3EVQA 2MO0A 4DR5Q 3PIPA 4PC2A 1WCMH 3W1GA 3ZZ0A 4X3SA 1GHKA 1BX0A 2F43A 2X3UA 2R6HA 2RHSB 4AYBG 1SYFA 2A73B 3O13A 2SNSA 3A74A 4GKJL 2K75A 3E1YE 4KJOA 1EP3B 5C4HA 4CJ0B 2HDMA 1TKWB 1HR0W 2G9DA 2EY1A 2DJFC 1EY4A 4RCOA 1DD2A 4DNRB 1HQMC 2RKSA 1HA5A 1EZ6A 3CW2A 3S1NH 4AQYQ 2LXJA 2WSSA 1KQSA 4HJ8A 5CMDA 4NBSA 4ZCKA 3Q23A 1BUVT 1CM9A 2KENA 1BVSA 3MZ5A 5J3BA 2F0HA 1JJGA 1BNZA 2KQ3A 3TBIB 1SMYD 2F0QA 5JVG3 1CNFA 4TRDA 1CSQA 3I7FA 3M9BA 4LAAA 3BY2A 2F3VA 2E2HH 4ROXA 2A6HC 4LW1A 5IGCA 3GTLB 5IP7G 3GIRA 4C2MH 3SDZA 1R5BA 2QTLA 4TSFA 2CNDA 1WOPA 1NY4A 2L15A 2F0WA 1A2UA 3H15A 2H5XA 3OSOA 1SAPA 4HIDA 4A3KH 5EAYA 2Q6KA 5C4XG 3T56B 4JV5Q 2XN9C 2JK8A 4JOIA 4J8QA 4RFBA 2RCFA 4ZLTF 1U9RA 1QX4A 1YVCA 3ZJYC 2OBRA 3NXWA 2RA4A 4HR7B 5ISRA 3CCUA 1HNXL 1X54A 1DG1G 2AUJD 1MBYA 4GN3B 1QUQA 5BN5A 1H9SA 4YWLA 3CMAA 4YALA 1G2SA 1PTOD 4O0AA 2WFWA 4ZK9B 1HCZA 1ASYA 4WZKA 1EY6A 3U4VA 3CC4A 1SYBA 1DCZA 1J5EQ 3AVWA 4AF7A 4ULLA 2A68D 4XLEA 5FOBB 2XNDA 2D9UA 4X3TA 4CHTB 2VL6A 4I65A 1AP0A 3M4PA 4OOVA 5L37A 4B3GA 4XKWA 3CMAB 3NQIA 3PA1A 1NSNS 5I2XA 3D0FA 3TRZA 1B9MA 1MSGA 1EP2B 3UDFA 5CBAE 3K57A 1TWAB 4K8JA 2V7UA 4XOTA 1MJCA 3NBHA 4A3GB 2LZJA 1VQCA 4MZ9A 1B3QA 1YHAA 1SNCA 4BXXH 4Q7JB 2P3MA 4RDLA 3MMPA 4IJHA 2QDBA 3P26A 4KN4C 1V0EA 2B2VA 4F8MA 3A7AB 1A3UA 1BJKA 2I0QA 1I50H 1KD1D 1CTMA 1M1KC 4IFDH 1BCPC 2NB0A 2X85A 3RLOA 1LT3D 3NP8A 1XNQL 2EYOA 1UD5A 5DLQE 1LT6D 3VMFA 1CQFA 5GQOA 5M9OA 4HSVA 4LF6Q 1UEAB 5F4MA 2QEXA 3RN2A 4LF7L 2C2WA 1D2BA 4R4TA 4RGMA 3DHQA 1EY9A 3ASSA 2QKIC 3V7AA 4U9UA 2VS1A 2J0TD 2K5QA 1K8MA 5FLMH 2JSOA 4KJNA 3GQBA 1KDAA 3S1QH 4P3IA 1S5BD 1VQ7A 3T13A 1X3PA 2VUMB 1Y1VB 4IPHA 3KEWA 1QCBD 2QCPX 3JC66 1DOKA 3GV3A 1LTGD 2BA0A 2V7WA 3K6OA 2BSAA 1KLUD 2ZL5A 4DR7L 3PCOB 4ID6A 1EFID 2OBSA 1W0JA 2WAQB 3Q38A 1FNBA 3D6WA 3PVDA 2JJ2A 1E63A 4C3JB 3ZZUA 1PJ6A 1V1OA 1A63A 1SROA 4O1NA 4EQOA 4ALPA 4XONA 1PH7A 1MIUA 4XYQA 4OPVA 1STNA 3T53B 2GREA 3ASTA 1ZXTA 4DV0L 1B50A 5IYBH 1K0SA 1STYA 4MHEA 2YWHA 2F1LA 1KJZA 1EWCA 1K0RA 1N32Q 4KY5A 5IYNA 3CPWA 1A3TA 2VNHA 4BBRH 5CV6A 5FLMG 1KNAA 4DNIA 4GNXC 1Q8IA 1R4QB 1EP1B 2ZXIA 4LF5Q 4YEJA 3W2DA 3QWNA 1U4RA 1WI5A 2MPMA 2VY3A 1WPCA 1AMOA 2K5HA 2K04A 4X66L 4H7BA 1UE5A 2NYZD 4NP5A 5C4XB 1QFZA 4X7CA 1CZWA 1G6PA 3H3VH 4DUZL 2F3WA 1HXYD 3RN5A 4P22A 2B8FA 1IL2A 1YNXA 1Y0YA 4B44A 3OAAA 2O2LD 5BN4A 1JOOA 3A8IE 3LGJA 4GLXA 3JAMc 2FXQA 3RY8A 2D3LA 4C3JH 5HZBA 2VNIA 4OONA 4X05A 1E22A 2YTYA 3JQQA 5IP9H 1IJFA 1HFGA 1CUKA 4DR3Q 1JJCB 1ESFA 2XRSD 3W1BA 3HOUB 1JB9A 4LUOA 4OXPA 1WTPA 2F0NA 4R71A 1JJ2A 1GUOA 1TVXA 4Y7NB 2GPJA 3I4MH 4X07A 2K5DA 1SNPA 5JAVA 2WAQE 1H9MA 4AF6A 1V8QA 4BY7B 1U0LA 3I1FA 1N06A 3KJOA 3BJUA 2A19A 4UZEA 3HOZG 4DK0A 3NTIA 4A3GG 4HIKA 1WSVA 1O7YA 2EZVA 2CVRA 5BR8Q 4C1NI 4PC6A 1FNWA 4GKKL 2NZ1D 4DR7Q 2IX0A 4FK8A 5CGKA 4RWSC 2C5HA 2B2TA 1L0WA 3WOFA 5JEAG 1BR9A 1AN8A 3TP6A 4YCVA 1BCPB 2F52A 4XDXA 4Z4TA 2ICIA 2JA6G 1PMRA 3PA2A 2KHIA 4HN7A 4QMGA 2J4XA 1I94L 1YX2A 4RGOS 4HIZA 3TEHB 5C4JB 3GTMH 2WV6D 3BDCA 4HJ5A 1C9OA 2L5TA 4UP9A 1UE7A 4Z4SA 1E0BA 1WTVA 1AIPA 1XMOQ 4C1NK 1EQQA 1G51A 4DR2Q 4RHSA 1G7TA 4FXKC 5TRDA 1NR2A 1A3VA 3TP8A 2CQOA 2RSNA 1VQ4B 5FIUA 3SE0A 2MFIA 1Q3LA 4B3TL 2JA7G 1TVCA 1HZEA 1SLJA 1QZGA 1I18A 4A3BG 3J80E 1LTAD 4PC3A 4A3GH 1WOSA 1G8ZD 3ZBUA 3HKZE 4QJFA 1F60A 4A3IH 1BBXC 2V1CC 3P20A 2I46A 4JI3L 4JC0A 2NBFA 3CP0A 4UP8A 3MVVA 1VQ6B 1EY5A 3J81L 3W2GA 1JE5A 4DUZQ 3ERQA 1QG7A 2JA7B 4KHZA 4B3RQ 3W2FA 1YITB 5I2YA 2I5LX 4PNYA 4DV6Q 5IT9L 1RF2D 5JPMC 2ZBVA 3HRZC 5D3IB 4C3HG 4DUYQ 1ET6A 2GJPA 5AN9A 2ZXPA 3NBIA 1JT8A 4KTAA 3F1ZA 4P2NA 4E6IA 1EEID 4PZ7A 4XLFA 1YHBA 4WORA 1I6HH 1K73D 2JN9A 2GK6A 4HMJA 1S5CD 4CDFC 2BM0A 4GQNA 1AFPA 3A3GA 3VR3A 2L9HA 4UHVA 4X0CA 1S40A 2K1BA 1PRTC 2Z6KC 3T1YL 4RDKA 1N9WA 4YHHL 4J1MA 4R1JA 2BM1A 4LBZA 1PFMA 1YJ9B 3LQ6A 4OO1I 2A1AA 1GHJA 2PI2E 1B8AA 3C2QA 3FP9A 3SK5A 3M7NA 3WQZA 2DJGC 2K6AA 1N0UA 2YV5A 1A8VA 2JA9A 2EXZA 1SMYC 4RPDA 1PH3A 3OPOA 2BMWA 1VQNB 1X65A 4LF8Q 4JMQA 3GTGH 5F4OA 2JDIA 4H13C 4EQPA 3BDLA 1I7PA 3SEJA 5EBDA 2AWOA 3PO3B 1XMQQ 3S15H 1SM4A 4MTKA 4X7DA 2NN6G 3GTGB 1UE6A 1DOLA 1VQOA 4OGQC 4KHPL 1VQJA 1B23P 3U9OA 4C3IG 3CCUB 5M5XH 1QZHA 2QGQA 1HA3A 3I70A 2RBMA 1UUPA 4RD6A 2HDNB 4UZUA 2UUCL 1N0VC 5IT9c 3J7ZC 2I5HA 4DV6L 5A89A 4U673 1TY0A 1VQ8A 2H1EA 5IOCA 4DV4L 2F0FA 3I4MG 1Y69U 3P27A 3H94A 4B9WA 1IBKL 1N07A 3GTMB 3SLDA 1F2MA 1VCIA 4CGYB 1LM0A 2B2WA 4PC1A 2B63H 4WJ3M 4X06A 1A2TA 4IJLA 3E20A 1PH2A 2FJ2A 2VB2X 1SNQA 3GD7A 2C5CA 2FINB 2F0PA 4UP7A 2CCZA 3CESA 1WD0A 3IKJA 4K6DA 4OIKA 3DUZA 3AGPA 5B6IA 4LFBL 1IHZA 5H5JA 3I90A 2GN5A 1CZGA 3A8JA 2F0DA 4X6AH 1LTID 5IYPA 3L9AX 1VQ5B 1KRSA 2B29A 4AIMA 2XOKA 1YNJD 1RODA 4C3IH 2OTJA 1SNDA 1QGAA 1DZ1A 4Y9RA 2JA5H 3LWEA 5J22A 1J9ZA 1GUTA 3X3NA 1KC8C 1ZM9A 5I6WA 5E4XA 3ZUGA 5CYUA 2Y0SG 1KNEA 4DXGA 2JP1A 1WOCA 3GVLA 3WBKA 2MJ8A 2EJGC 2YTXA 1QILA 2NN6H 3NWSA 3TREA 3S14B 1NMGA 4ZUIA 1NJID 2B2UC 2QEXB 1RCVD 1FX0A 2DIEA 2X6XA 1EU3A 3E6ZX 3QR8A 2JA6H 3OEHA 4F7XA 4Y9UA 3KLSX 2KEDA 4RD1A 5FA6A 1PH6A 1JWSD 1CQXA 2K28A 1FNDA 4YHBA 1ET9A 5M3MH 4KKTA 5GV7A 1NBMA 2F0TA 2A74C 2OCEA 3ISXA 4GOPC 1R9TB 1EIHA 1WCMB 5HZAA 3BS1A 4JV5L 2XVSA 2F0EA 3I91A 2WB1B 5IY0A 4GOPB 1E79A 4YY3L 2R3ZA 1EOVA 1T6ZA 3HOWB 4JBJA 1PYWD 2VQEL 3OOCA 4BY1B 4P12A 1YNJC 4A3FH 1WCMG 1XJVA 3WXMA 2Z0SA 2EQSA 1XXGA 1UWVA 4QQBX 4P3YA 3VYSA 3Q3AA 4M4SA 1PH5A 2AMCB 4K6LA 5FO7B 4XXEA 1WU8A 3R6KA 3DDYA 4JG2A 4XQQA 4DV3L 5FO0A 5H1SE 3AVUA 1EFUA 1U2RA 1VQPB 3PF4A 5A35A 2QGGA 3RZOH 1K28A 5KRUA 3Q6RA 2D5DA 5M5WB 1D5XC 1UD4A 1F2LA 3GTQH 1VQLA 3TZDA 1FRNA 4ZAIA 1L1OB 1QVFA 2JA7H 2F4IA 4N3NA 5FLXE 1HZBA 1H9JA 4OWTB 3FDTA 1LTSD 3FKSA 4N8FA 4U68A 4WJWA 4TKOB 1EY0A 2PCFB 5DEHA 4RMFA 2DN8A 1K8AD 1E64A 5D3DA 1NMFA 1SN8A 1BOSA 1FNMA 4GNXB 3TP7A 2ZBUA 2B63B 4A3FG 3A8KA 3RMHA 5KW9A 4A3EG 3Q6SA 4DQLA 5CDFA 4JI0Q 1TIID 2AWNA 4Z4RA 2NVXH 4HJAA 1O7LA 3OHXC 3W5VA 4UPAA 5HURA 4A76A 4ZRZA 2JEAI 2K01A 4L8JA 4GKJQ 3S2HB 2UXBL 4MYTA 4QGUA 1NBWA 4DV2Q 4P6VF 1EYCA 4A3EB 3S17H 3AFQA 1STAA 5BN3A 3I72A 5HXBA 4B3RL 5IGDA 5I9OA 3IAYA 3C3LA 4OWWB 4KHVA 2C35B 2OEOA 1LO5D 1E1QA 4QL5A 2EYJA 3GVKA 2KBNA 5IP7H 1VHEA 1TWHH 2Q8RE 4A93H 2Z6BA 2EY6A 1LT4D 1TS4A 5G3LD 4LBVA 3AFPA 3QFSA 4LC0A 3K5OA 3QO2A 1IBMQ 2V7QA 2IL8A 2R92H 5KYLA 3CXCB 1YJNB 1YIJA 4MN3A 3SXHA 3J7AV 1LUZA 1TLLA 1CQVA 4XLCA 3E3XA 4R8NA 1CT1D 3BCDA 1VQPA 3L7ZC 4BS9A 4PMCA 2R7ZG 2VQEQ 1TWGH 5CV7A 1B7YB 4ME5A 4JI1L 1KZLA 4YELA 1BDOA 5M5YH 4Y7NH 4AVZA 2L55A 2NUCA 1PFSA 4OIJA 2X53S 4DR6Q 3ASRA 4PMBA 1MJEA 1Q86C 1G91A 1GUWA 3MAQA 2QA4A 1I6HB 3MXPA 4TMXA 1Y14B 3OIPA 1TWCB 2NPFA 2YU9H 1JMCA 4FWTA 2M2LA 2ZL6A 2GK7A 2D0PA 4NPSA 4A3MG 3NPPA 4IFDI 5JJLA 3AB9A 4RAUC 1H42A 1M4VA 1Y1VH 4ZQ3A 3I56A 5AJ3L 1ILPA 1JOKA 3A5ZB 3J81k 1XQBA 2F0GA 4HSPA 3HAGA 4TMZA 3KDFB 1VQMB 3HOVH 2C78A 1BLIA 2F0VA 3BC9A 1TWHB 5C44H 1DONA 1JQYD 1CA5A 4FXUA 3PUWA 4Y52H 4LFAQ 4HCEA 2CQAA 4OHJA 3MFGA 2ZITA 3D4DA 2R93G 3ITPA 4DV1L 4DK3C 1OB5A 3PUZA 2CWPA 1FDRA 3LX0A 3OTOQ 3Q39A 1MSHA 1E1RA 3OJXA 2K5WA 2JIZA 4XKVA 3M3YB 4P26A 2X6YA 4MIUA 4L5RC 5M3FB 3CB4A 3S1MH 5GAEC 4A3LG 4BBRB 1S0UA 1D5MC 4DR3L 1OXUA 3G6EB 2NVQH 1P4MA 4CJ2C 2ID0A 4B3SQ 4IPCA 1KK2A 3F8TA 4DR6L 1ICWA 2IX3A 4AH6A 1A8PA 4B3FX 4Z4WA 2JJQA 2XGTA 4GS3A 1ENCA 1S5FD 5A2QE 1EYGA 1EQVA 4DV1Q 3FPKA 4BBSG 2VW9A 5FO9B 2CW5A 4IUUA 4DQKA 1I4RA 3VR5A 5M5WH 3DWQA 3J81j 2JE6I 5C0XI 4BWGB 2OK8A 1QFJA 2F3IA 3PGZA 1XYIA 1QVCA 1NCVA 3BU2A 4JI7L 1Y0RA 1WDTA 3QSYA 2LS01 3RUZA 1W87A 3H0GG 3H9NA 1G291 2E2DC 3DEPA 4HJ9A 3KBXA 4ZCIA 2ZM6L 5EJWA 1SYGA 3LQEA 4A93B 1CI3M 4LWCA 2OQ0A 2RDHA 1Q1BA 1C48A 3L0OA 4TN1A 3PUMA 4A3FB 1TS3A 1D8TA 4O2DA 2QN6A 1ZM3A 2UXDQ 3CMMA 2DY7A 3DLLA 1Q9SA 5C3EB 1M1KD 4X3UA 1AZQA 4HE6A 2Q6LA 4UZFA 4CBVA 4KKSA 3Q24A 1NNXA 2CC2A 1N36L 1FJGL 4YWMA 1G7SA 2K5VA 4LJZC 4WZTA 4PV1C 4BY1H 1VQGA 3QIAA 2E2HB 3JQRA 3U4ZA 3A1PA 1VQ9B 1LLRD 5E1FA 3QOJA 1EWYA 4C2MB 3UDXA 2WIIB 1PJ5A 4PZ6A 4XORA 5C3EG 3KJPA 1SNMA 5IODA 4A3KB 1IKLA 1NTGA 1S5ED 3F2CA 5KNCA 1IYUA 5DAUA 1NAPA 1VQLB 4R4OA 3J81i 3E0EA 2MUYA 1QOHA 2VJJA 4A3JB 2PNHA 5T1IA 1SE8A 2HHHQ 1I4PA 4OWXB 2B2UA 2A6ED 4NKLA 1I4HA 3CCLA 1AE3A 4KD3A 3K59A 4IW3B 2ZTDA 2AQ1B 2KCNA 2ZZQA 2F0SA 3M4YA 2XRQD 2WKCA 4YCUA 2JA5G 1IW7C 3A55A 1W35A 3DM1A 3T1HL 3I4LA 2MHVA 3H09A 2EDGA 2YTVA 1TXYA 2ZL7A 3HOZH 1BBUA 2OWOA 4BA1I 1UAPA 1G2TA 3UE1A 1RJTA 4FNFA 5IYCH 5ELDA 1TU2B 4IPDA 4B48A 3OW7A 2UU9L 3K80C 3SK6A 4J6HA 1S4MA 1BCPD 5D14A 4DPGA 2UUAL 2RDGA 4DV7Q 4G7ZC 1V5VA 1CKMA 3RR5A 1TWFH 2HLDA 1ZM2A 4RGTA 4A3MB 1HRJA 3ASPA 3J81E 1JB7A 1Z7TA 1WTWA 4CKCA 1B3AA 4CDEC 1PKVA 4POGA 3I4NH 1GO3E 3W5HA 3UI2A 3MA2B 1IYVA 2XIWA 4KHPQ 1XWEA 2PQEA 3HKSA 4XQFA 1UEBA 4DNTB 1F9PA 3GTPB 1Q81C 1ENFA 5IGFA 4YHHQ 2E2IH 4K0KL 1HTPA 4N9PA 4N3GA 1BXTA 5LHY1 3PO2B 5BSXA 1EIYB 4LF8L 1PTOC 2ZXRA 2RDFA 3JU4A 3VYTA 1SE3A 4ZGQB 2N88A 1WFQA 5ELFA 1RDPD 4C3HH 1XMOL 1VQEA 5LMZA 1WORA 1PZKD 4EVOA 2M9VA 1MRZA 1XNRL 1S5DD 3PUXA 3UDIA 3CQZB 4NXMQ 2Z9HA 5EGTA 1EFCA 5ELOA 2Q2UA 1YNND 3ONUA 4A3DH 1V1QA 2OBTA 3W3AA 1XNRQ 1SYCA 3FEWX 5J3OA 2Q6IA 4A3CH 1WSRA 1QVGB 1QNKA 3TN2A 2OTLA 3T16A 5C3WA 3G6JB 3OWEB 1DARA 2I5MX 3J7YW 4LUVA 1S3OA 4ZGNB 1TTTA 4JI3Q 4LBYA 3W2IA 4DV3Q 3HZXA 4HIMA 4L63B 3AYHB 3BQJA 3KL9A 1WJJA 4PC7A 4G7OC 3PSIA 2KA7A 3H91A 4EX5A 2L1BA 3L3OC 3BCFA 1YJ9A 4NB3A 4RD3A 1T6YA 4RG1A 4FXDA 3OFNA 3VR2A 1KQSB 4TMWA 5C0XG 4B3SL 4BBSH 1QNUA 3ULLA 4N9TA 3G71B 1CA6A 5CBEE 1PA6A 1K3BC 2V7XA 1UNSA 3W2EA 2CK3A 1F77A 1FYCA 2PZWA 1OXVA 1ESRA 1HNZQ 1UD8A 4ME3A 2IHEA 4BY1G 3WBJA 4AQYL 4CJ1B 2VJIA 2ZTGA 1KC8D 1L1OC 5J1ZA 2XNJA 1ZYRC 3OMCA 5FNZA 4MNOA 2HCIA 1FNVA 4KV6A 4DV4Q 4GKKQ 4Y7CA 4CDCC 4KKUA 2AKWB 3GSIA 4APVA 1R5NA 2JA8B 2VBVA 1HJPA 3SJZA 4XT3B 2F0UA 3A0JA 3RD4A 5C44G 1K8OA 1XTCD 4Z4VA 3ZZTA 2K4KA 3E9IA 3LO8A 2YWFA 2H4OA 1KRHA 1D5ZC 4JCVE 4CKEA 4DR4Q 1WTRA 5FJ8G 2L11A 2E1RA 2M5SA 4P25A 2OXPA 4ACBA 1Y1WH 3S1QB 3B6YA 4DR5L 1HHVA 3QG1A 2K32A 4M8AA 1K8GA 5EPKA 4A3IB 4LFAL 2HIVA 2BCOA 4LUZA 5KEEA 4DV0Q 1XX8A 4X62L 2A5HA 3PUVA 1EFRA 1V0FA 3S1MB 4AYBE 1EWIA 4L6TB 4PQXA 2VNUD 1QFYA 1N34L 3A8IA 3ZC3A 2R7ZH 5EKLA 3K5NA 3PMFA 3R8BA 1W2BB 3MWYW 1FNCA 4Z4ZA 1Q7YC 1STHA 1B9NA 3D3RA 5KNLA 2K14A 3K81C 3KBGA 2CBXA 4N8X1 5K36G 3WNDA 2BF4A 3AVVA 1OXXK 1PRTD 2GA4B 2GVAA 5EKIA 4FDBA 3SEBA 1H8EA 4IO9A 4NCNA 4G7XA 4WWVA 3I73A 4H9GA 4LF5L 3STBC 1W6KA 3G4SA 1D8LA 1PH1A 2VUMH 4FYDA 1L0XB 1Y1VG 2HQEA 1N33L 1I3QH 3KLSA 1N32L 3G7LA 1K3RA 1IZ6A 4ZKBB 2IWHA 4R4IA 4OPSA 2X0KA 3OZUA 3TS0A 1COWA 1CKOA 1II3A 3BYTB 3K7AH 2X6WA 2JEBI 4XM3A 2WYRA 5TV2A 1PZJD 3ES9A 4WZLA 3CW2C 4JI6Q 3V96A 2NZOA 3G6EA 4JBMA 1KK3A 4BPRA 3I4MB 4FF1A 1NE3A 2ZXHA 1BF4A 3NQTA 4RH6A 3R2IA 2PYKA 4JYAQ 3PIOA 2DYIA 3CCSB 1BO0A 3KF6B 2AHOB 3NTKA 3CKIB 2TSSA 2RF4A 1JR0D 1TWCH 3HOYB 3IFTA 2ENBA 3AEVA 4XQNA 2ASBA 1Q12A 5IYCG 2ES2A 2W6IA 4ZUJA 1EWHA 5C3XA 5KGUA 2DNCA 1DOMA 2QW7A 2QDXA 4K1XA 4J0QA 4RM0A 1F2YA 4DXFA 4GNXA 3FPUB 4R4QA 1YJWB 2BV3A 2LSSA 3KDFA 1PV4A 2OK7A 1O80A 5DM73 4QVJA 1WTHD 2VNJA 1E3XA 3B82A 3IFDA 4KY7A 3FKIG 2BE5D 4P71A 3HOZB 1E7ZA 1QUEA 1YHQA 1L1OA 3CCMB 1TT2A 1VHOA 1V1PB 1X9NA 1TS5A 4Q5VA 5CV4A 5THXA 1RD9D 3OYYA 2L4NA 4B3TQ 2V7TA 1SDFA 2QA4B 1VF7A 3D6CA 1HVXA 1CKNB 5CV9A 2IJ0A 1IHMA 2JA6B 1M90C 2V4DA 3CPXA 1DXMA 3L2PA 4YXWA 3S17B 2EY5A 1BQQT 1LABA 2LY7A 1C7YA 4B3MQ 2IY5B 5ELNA 1IBML 2EJFC 1EUJA 2EYLA 1E1TA 3IL8A 3QJYA 2D62A 2E8GA 1H9SB 3VO1A 3S14H 3BNWA 2JA8G 2WPDA 2XZLA 4QUZA 3CC7B 3ND8A 2K05A 2E2IB 4LNQA 4A3CG 1KL9A 3MXNA 4J15A 2PE3A 5M3MG 3RNUA 3VA5A 3VYRA 3D8GA 1FVIA 2ZJQA 2F0KA 3VNUA 4IFDJ 2PMZE 1SE2A 3T51B 3M4QA 5DNFA 1H95A 1TS2A 1E1OA 5IYWA 3A8KE 3TMEA 1T5XD 3NELA 3U9SA 2L0CA 1JWUD 1TWGB 1AW7A 2XNCA 5C5LA 3H0GB 1I3QB 1HZAA 2VQFQ 1DDIA 4YAFA 1FRQA 1AE2A 1ZKOA 3H3VI 3OZWA 3BZDB 4ZKCB 3BH4A 4QVAA 5TY0A 2EFGA 1UE1A 1XMQL 2DERA 2PZTA 1SXTA 1RKNA 3FHWA 3I2ZA 1GUGA 3F2BA 1JORA 2AHOA 3KYHC 1F9RA 5CV8A 1T6XA 3J7A5 1Q82D 4C0SA 4LF4Q 2JXMB 4LMQD 3SR1A 2HMAA 4X8IA 3HG9A 4OOSA 4DGZA 4JI8L 1SYDA 5LL6S 3R93A 3D4RA 1D7QA 3J80c 1C0AA 4A3BB 1LTBD 4B4DA 4Z1MA 5C6AA 1VQIA 4MTNA 3PO3H 1Q8KA 3NBHB 2F4VL 5JEAH 4RCNA 1VQFA 3HFZB 3NUCA 1R5OA 2F0IA 1E62A 4S3SA 1Y8OB 4UY8C 3S2DB 2X6GA 2D74A 3OE7A 2EXDA 4A3JG 2F0MA 4K2LA 4G4KA 3CCVA 3TS2A 2JN4A 5LMNL 4LFCQ 2ATWA 4JBWA 3D31A 2Q6OA 1Y1WB 2A69C 1E43A 1RQPA 1TQOA 2ZJPA 2UUAQ 2KCMA 3PV0A 4LF7Q 3S24A 3BDOA 4X66Q 3Q22A 3QFRA 1D1IA 1W2BA 2QTZA 2QF7A 4ASUA 3V2TA 2CF4A 4DA2A 1L2FA 2FHTA 3U2QA 2NTSA 1BCPF 1GUNA 3MC0B 3CCEA 1VF5C 2E2JB 2FX3A 4RHRA 3M4OB 2I1LA 4RD0A 5EQ0A 3HOYG 2LXKA 3HGBA 2VBUA 1VQ8B 2DY8A 3UDGA 2XEXA 1L0YB 2FVGA 4YCWA 2F0OA 2E2JH 1YEZA 3ICEA 1JCKB 4QUFA 3J80L 4DR2L 5ELBA 1CFMA 1HR0L 1QVFB 1HQRD 1OB0A 5K5PA 2BDOA 2CH4A 1EOTA 4TT3A 3F2UA 1ILQA 4QUCA 5EKKA 2RC6A 4C3IB 1HR0Q 4OOXA 1GJRA 2Z4HA 3CMEA 3HOWH 1ELOA 5L46A 1OXSC 3PO2G 3PIP3 1PTOF 1XB2A 2PQAB 1YNNC 4M1UB 4CKBA 1JE4A 2UUBQ 1KK0A 5A88A 1EIFA 1OHHA 3VO2A 1HFNA 1GO2A 1XTDA 4ODGA 2FFKB 2R92B 1B1ZA 3GO5A 1WVLA 2DGYA 4H02A 1T5EA 4KLKA 2PNRC 5NUCA 1AZPA 1N8RD 5IP9G 2QEJC 3J7AF 3MEFA 4M0LA 2G9HD 1SE4A 5E3FA 1QWYA 1VQAA 3E0JA 1I6VC 2E76C 3LVBA 4GOPA 1PFNA 1DM0B 1ICFB 1G6ZA 3GTJH 1XPRA 5COYA 3FMCA 1F20A 2VNKA 1AEXA 2B2VC 2E5LQ 2N3SA 4JI7Q 1EFWA 2B8GA 4A3BH 2SEBD 5M5XB 1XFOA 2XSCA 1K83B 1YITA 3CCQB 1KDCA 4G7HC 3PO2H 3H6MA 1EZ8A 2A68C 2KHJA 3HKZG 3HOVB 2PQAA 3RLFA 3W5OA 4G5GA 2NVYH 3H0GH 5FO1A 2Y0SB 4JI5L 1G7CA 3OW2B 2B7CA 1STBA 5GV8A 1IW7D 4EQNA 1KK1A 4C43A 4P72A 1X56A 4RD4A 1NB0A 4IUNA 4K2KA 3FKIH 5JVH3 4A75A 1SFOB 3HOUH 2NVYB 2A6HD 3HOXG 1GJXA 5C4ZA 4O42A 3HOWG 3CHBD 2D2CC 2EYMA 4X62Q 1K73C 1GM5A 4C56C 3JAMi 1KTKA 1LV9A 3CU7A 3ONYA 1PYSB 4FVMA 4RJLA 3U50C 2YYZA 4KK7A 1PRTB 2CKZB 5JJZA 4B47A 3EQLC 3EN2A 2KVOA 1A6XA 1PTOB 5CV5A 4FN5A 2ICEC 1H8HA 1YBYA 3N6RA 5BR8L 4HIOA 3GTJB 1KMHA 1RQRA 2N8NA 2XWJB 3URYA 3HEJA 2PPBC 4K0KQ 2X8KA 2V31A 3BVMA 5IGBA 5JBQA 3AVXA 4CQJA 1XPOA 2G5DA 1Y8PB 2KEEA 3K5MA 4DAVA 1JA0A 2WB1G 2B3GA 5DSZA 3CC2B 3LWUA 4A3IG 2E74C 1I4QA 2UUBL 1D1KA 3PIO3 1Y1WG 4II2A 5A2QL 4JBKA 1R9TH 1GVPA 3CCVB 1KLGD 1VLOA 1ENAA 2EIXA 3LNNA 3WOEA 4JI6L 2OYNA 4JI4L 4QB4A 1Z47A 3T4AC 3Q0AA 1SMXA 3VA7A 1VMPA 1HZCA 3GVJA 3S16H 5EPLA 4B3ML 4R9WA 4RPBA 4A3DB 2Z6KA 3SJPA 1D2EA 2VUMG 3I8ZA 2NN6I 2PI2A 4V0BA 3SK8A 4FP5D 2IX1A 4H44C 4X65L 4GLAC 4ZYSA 1X3GA 1VQBA 2UU9Q 1SSOA 1J9OA 2BE5C 2BVNA 4WJ4A 1IKMA 2JYOA 3R6JA 3OP1A 4TVAB 1O78A 3I55B 3AVTA 4FF3A 4X64L 3GTPH 4A3DG 2NZHA 4AC9A 4IQZA 4GN4B 2A8VA 3RZOB 3A35A 3GTKH 4M1KA 3BVZA 3FRPB 1PYBA 4NXNQ 1UMKA 2KCTA 2XZOA 1I8DA 1EU4A 4I7ZC 3GTQB 2OQKA 2B63G 4II3A 1W34A 3K7AB 2RC5A 4XLAA 1X3FA 1VQ4A 2IHFA 3MTSA 4NDXA 3OKXA 4DV5L 3ASQA 2KOLA 3ZPNA 2IT1A 2P5ZX 3TSSA 4XN3A 1N34Q 3HOUG 2A69D 1BMFA 4DAPA 3CPWB 2JQOA 4DKAC 3MXGA 4DU9A 4GZYC 1E3ZA 4Q0FA 1ZYRD 3A54A 1B2RA 1RTOA 1IYJB 2D3NA 4JW0A 1PLFA 4WRDA 3WWVA 1PZID 3ZBTA 1Q90A 2HUGA 3OJWA 3MFYA 4OPOA 1DDGA 1LTLA 1U4MA 4TSSA 3JAME 4XNFA 5FLXc 1TWFB 3WNBA 1B44D 2Z8LA 3GV6A 4DV5Q 4IUVA 1BX1A 1J8IA 2R61A 3GTOH 1CKNA 1EYAA 2X69A 4JI1Q 4XYOA 2HIXA 1ZEQX 4RD2A 1TR5A 2Z4IA 1RHPA 2R92G 1PXUA 3QFCA 4QY7A 1VQHA 3BY1A 2Q2IA 4DR1Q 1Q82C 1GVHA 2CH4W 2R7ZB 2WB1E 5E4WC 2Q8IB 5LMUL 2PIAA 2VQFL 3KF8B 3CCJA 4YY3Q 1Y8NB 1D1NA 3A7LA 3ZYYX 4DUYL 3I4NG 4JPBW 1CHQD 3G4SB 2NV4A 2B2YA 2RCNA 4OO1H 1CHPD 2E5LL 1SKQA 1V9PA 4YIJA 5IK2A 2BGJA 1PRTF 4QF4A 1N05A 1EIGA 1WTQA 2B39A 5C3EH 3I55A 2BGIA 2EJMA 1JWMD 4V190 3ERSX 3BVGA 4RGNA 1Q1EA 5JJKA 1ZUNB 5CORA 4BBRG 4DAYB 2MNAA 2VYQA 3A5UA 1VQKB 2C4TA 1MGSA 3QOLA 1X3EA 4F7DA 3DEOA 4POFA 4YAWA 3U58A 3K8AA 4LF4L 2O4XA 2FMMA 3BZKA 4GLVB 2K33A 3ER0A 3EFXD 4DK6C 5FJ8H 2MGSA 2VXWA 1HUMA 5FLXL 4BBSB 3NENA 1J6QA 1GKHA 3DXJC 3NHHA 1FR3A 2WKDA 4P1VA 2QILA 1FJGQ 2PMZB 2N49A 3V05A 3I56B 3C2PA 1K83H 1PFBA 1JA1A 1SFOH 4XIGS 2C77A 5HY6A 1WTXA 2YWEA 3CD6A 2CRVA 1CSPA 3K7UC 4EH1A 2XTIA 1SYEA 4DAMA 3WYAA 3WY9A 4QCLA 1HPCA 1QUFA 4WZEA 2AQ2B 3DMUA 3PQIA 3RZDH 4JI5Q 4XLHA 3KUPA 4JYAL 4IURA 2X6LA 3H3VC 3MCAA 4Z4YA 1YI2A 1IBLQ 3U6BA 4JK1C 4E0FA 1KTVA 2Q2TA 3RZDB 4LFBQ 3S15B 2K5NA 1HH2P 3S2DH 4L5SA 1TWAH 3DWPA 2EIFA 4B3XA 4I7AA 4X64Q 2OTLB 1QGYA 1SR3A 4MYUA 1V1PA 1VQ7B 3K0XA 2RQXA 2F4NA 4P9SA 1HNXQ 5C4JH 3AQQA 1FGUA 3PO3G 2GVBA 1A15A 1RTNA 1NDHA 3PF5A 2ZTNA 4BA2I 3IRBA 4K5VA 4Z4UA 4X7EA 2HDLA 4EQ5A 4G7WA 1MI2A 2DUDA 2NVTH 4ZCMA 2WAQG 1YJWA 2R7FA 1KXLA 4UAJA 4F88A 1DGSA 2B2WC 4UDUC 4HTHA 4A4IA 4JI4Q 1I4GA 1IBKQ 4ACAA 1WOOA 3N52A 4XT1B 4DR1L 1LTRD 1LACA 3F2DA 3JQPA 4EGVA 3M85A 2YU9B 4TQUS 1B53A 5CR3A 1FD7D 5KIXA 3CQZH 3KF6A 1OXTA 2MP1A 2UUCQ 5DS0A 3WDNA 5C5MA 4FXGC 1Q7YD 2N78A 1S72B 1EQTA 2IPKD 3BG3A 2K03A 2JA8H 2BH2A 1GOZA 4A3KG 3M4OH 1BQEA 3SK4A 4OL7A 1OTCA 3VYUA 1DJRD 2ZTCA 3FJOA 1Q46A 1XE1A 2WJYA 1P8LA 3CRKC 5AJ3Q 1X55A 4XTCS 3X3MA 2YWGA 4KN7C 1UD6A 3ZIAA 2NWGA 2NTTA 5C0XH 3I4OA 2F03A 5IYDH 1JOQA 2Y0SE 4F87A 1W0KA 4DK1A 3J80i 3TQYA 1HZ9A 2DNEA 3A8JE 2F1MA 3VR6A 1HTLD 2ZXOA 3OW2A 1KD1C 4DR4L 5FK9C 3J81c 1F2ZA 4B08A 2ZJRA 1MABA 2W6JA 4CDDC 2HCJB 1K8AC 3OIQA 1OGIA 3CMEB 1Q81D 3B78A 5A8AA 1QG0A 3CTAA 1FL0A 1YZ6A 1IL8A 1PHJA 2VB3X 1N33Q 1X32A 3S2HH 4Z9CB 4IOAA 4R4CA 1H85A 4PZ8A 4IALA 1LYLA 3HS0C 1RIPA 3CAMA 1GR1A 4ZCLA 2ZZGA 1U4LA 5GAHC 1HNZL 2DEUA 2VBSA 3SKBA 5F2DA 4A3JH 4G6IA 4IOCA 4OP7A 4H0LC 2EYHA 2O5IC 2RSOA 4QV2A 1QVGA 3HOYH 2WR8A 3V76A 1AH9A 4RLZA 2CW0D 4JI2Q 3KK7A 3CP8A 1EEFD 1WP6A 2F4VQ 3ULJA 2C4UA 4UAIA 1PTOH 2KJXA 2WJVA 3KLWA 1VQKA 1QH0A 4IUPA 1KDBA 3NTHA 4IZ8A 3I4NB 4DV2L 3A3BA 2DCUA 1VQOB 2VZAA 4K5XA 1WTHA 1C4QA 3P1HA 3HP3A 1XNQQ 3HKZB 3HOVG 4OX9Q 2BDNA 3QB3A 2EOTA 2R7DA 1FNUA 4R8IA 4KI0A 1STEA 3M7GA 5EPJA 5FKAC 4JI0L 5HGTA 2KCCA 1PDQA 4DF7A 3CRLC 1GAQA 1I4XA 3Q8DA 2CWAA 5HKKA 4A3MH 3OZVA 1VS0A 5E7NA 4XD7A 1VLYA 3GDEA 4QIWE 5IIFA 5JJIA 2Q8TA 3HOXB 3MHPA 3K0YA 1N36Q 1KIXA 1BKBA 3KLRA 1GXDC 1J5EL 4IN3A 3I3CA 4LF9Q 2CW0C 1GAWA 5G3LF 1QJOA 3GP7A 2UXDL 3UE0A 1VQDA 5C4XH 5DM63 1VMCA 3JAML 3AGQA 3C46A 4A3EH 5FO8B 3CCEB 1YLOA 1N8RC 2SOBA 1R4PB 3G71A 3K58A 1U4PA 2R93H 2PW7A 2UXCL 1VQ5A 5GROA 4X7FA 2R6GA 3GTOB 2K50A 3KFUA 5ELEA 4NXML 2BN4A 4HAEA 4YAOA 4BXXG 1X3QA 1K28D 1D6EC 1DYQA 2D0OA 1E2VA 2B2TC 4M53A 5I6YA 1VQ6A 3S16B 2DETA 2DY1A 5IGGA 3TZUA 2PZUA 1CNEA 5J35A 3G48A 1I50B 1NR4A 2HCCA 1GD7A 1EXMA 5IYBG 2D9RA 1S4ZA 2KUMA 4XQJA 5CC4A 5I9PA 4JI2L 5IWAL 1JNYA 4NNJA 2R9VA 3FVQA 1NB9A 2EY2A 2GJKA 2JJ1A 1SNOA 2QDLA 5IYQA 4A93G 4JOIC 3CP2A 1JB3A 1JC7A 5EBCA 1E2ZA 3NK9A 1BPLA 5IE8A 1A0IA 1W9XA 3DWAA 3CCRA 1T9HA 3U6KA 3CPFA 2SDFA 4XR6A 4G57A 5KNDA 2O5JC 4IUQA 1M90D 3EROA 3OMGA 1WTOA 5ELCA 3SLNA 3OTOL 3QE2A 1E3PA 1F9SA 4KY6A 3CC7A 1H9RA 1EL0A 3MEHA 1G7RA 1ONLA 2ZT9C 3B8HA 1ML0D 3CF5A 1S72A 4PGOA 3NSWA
chains in the Genus database with same CATH topology
1H9KA 4FF4A 2B2YC 4C3JG 5DN6A 2K7VA 2M00A 4IUTA 2A6EC 3SHLA 2PO4A 1JICA 2Z1CA 3D4WA 4DFAA 1KABA 3R2TA 1SJED 2N55A 3SVMA 2OF1A 2NVTB 2Z6BD 3OEEA 3MHBA 1M8AA 5LL6X 2WP8J 1HUNA 2F0LA 1CK1A 4RKLA 5T1GA 5JEAJ 2AQ3B 2IW3A 1OO9B 1HA6A 4HMIA 4X3KA 3FPPA 2SNMA 1FGBD 3ONAB 2QE7A 2WINB 2XNAC 4XN0A 1SBBB 2OT2A 3AMUA 4XOPA 1QB5D 3MXUA 4FO2A 5JOBA 3P75A 2KVMA 4FF2A 2LKVA 2WZPP 5AFWA 2R93B 2ZZFA 2XGJA 1VDZA 4RA8A 3NE5B 5TSSA 2KECA 2LMCB 1VJSA 1EYDA 3EA6A 3FKIB 4WFN3 3KF8A 4K8IA 3S9WA 4ABNA 4K5WA 2NVXB 3VR4A 1V43A 2EYPA 3AU7A 4KD4A 3PUYA 4XL9A 2E1BA 3TDQA 4KMUC 2EPBA 2BA1A 4DAYA 3GTKB 5C0XJ 2TMPA 2KHSA 3E5SA 1E2WA 1W6JA 5JPNC 2PW5A 1KAAA 1B4OA 1STGA 2F0JA 4K14A 4NMZA 5M5YB 2C9OA 4XMYA 3S1NB 3C1EA 1UD3A 2EVBA 5IT9E 1Z6HA 3NWTA 1GUSA 4PMWA 2GJRA 4LK1C 1LTTD 4P2CB 1C8CA 1SKYB 1NRKA 3ND9A 2I07B 4OO1G 2WACA 2EE1A 4NW2A 5D65A 3G05A 3A56A 2NVQB 3P7JA 3BYYB 5M3MB 5K36H 2XZPA 1TY2A 2LFNA 2ZZEA 3EJIA 1SJHD 1MD2D 5J39A 2RVLA 2AUKA 1EY7A 5I4DA 4C3HB 5C44B 3R3OA 2CHBD 1EY8A 1UD2A 1QE6A 2FMCA 2EYFA 5KYIA 3OWFA 4RKBA 2JA5B 1F9QA 4HCSA 4HEDA 5KNBA 4IFDG 4B9XA 1WD1A 2E75C 1LT5D 2L12A 3S1RB 2BOSA 1O7ZA 4AYBB 4DN4M 2J7ZA 2XWBB 1NUCA 3C1FA 1B2TA 3K5LA 5IGEA 5FL7A 4QIWB 1SEBD 3TP5A 4ILWA 3EVQA 4X3SA 1GHKA 2F43A 1SYFA 2A73B 3O13A 2SNSA 5C4HA 4KJOA 4CJ0B 2HDMA 1TKWB 2G9DA 2EY1A 1EY4A 4RCOA 1DD2A 4DNRB 1HQMC 2RKSA 1HA5A 1EZ6A 2WSSA 5CMDA 3Q23A 1BUVT 1CM9A 3MZ5A 2F0HA 1BNZA 2KQ3A 3TBIB 1SMYD 2F0QA 5JVG3 4TRDA 4LAAA 2F3VA 2A6HC 5IGCA 3GTLB 3SDZA 4TSFA 2F0WA 1A2UA 3OSOA 1SAPA 3T56B 2XN9C 4J8QA 4RFBA 4ZLTF 1U9RA 3NXWA 2RA4A 4HR7B 5ISRA 2AUJD 1MBYA 5BN5A 1H9SA 1G2SA 1PTOD 4ZK9B 1HCZA 1EY6A 1SYBA 1DCZA 4ULLA 2A68D 4XLEA 5FOBB 2XNDA 2D9UA 4X3TA 4CHTB 4I65A 1AP0A 4B3GA 4XKWA 3NQIA 1NSNS 5I2XA 1B9MA 1MSGA 3K57A 5CBAE 1TWAB 4K8JA 4XOTA 3NBHA 4A3GB 2LZJA 1SNCA 2QDBA 4KN4C 1V0EA 2B2VA 4F8MA 3A7AB 1A3UA 1CTMA 4IFDH 1BCPC 2NB0A 2X85A 1LT3D 3NP8A 2EYOA 1UD5A 1LT6D 1CQFA 5M9OA 4HSVA 1UEAB 1D2BA 4RGMA 3DHQA 1EY9A 2QKIC 2J0TD 2K5QA 1K8MA 2JSOA 4KJNA 3GQBA 1KDAA 1S5BD 3T13A 1X3PA 2VUMB 1Y1VB 3KEWA 1QCBD 2QCPX 1DOKA 3GV3A 1LTGD 2BA0A 3K6OA 1KLUD 4ID6A 1EFID 1W0JA 2WAQB 3D6WA 2JJ2A 4C3JB 1V1OA 4O1NA 4EQOA 4XONA 4XYQA 1STNA 3T53B 1ZXTA 1B50A 1STYA 4MHEA 1EWCA 4KY5A 1A3TA 5CV6A 1KNAA 1Q8IA 1R4QB 2ZXIA 4YEJA 3W2DA 3QWNA 1U4RA 2MPMA 1WPCA 2K04A 4H7BA 2NYZD 4NP5A 5C4XB 1CZWA 2F3WA 1HXYD 4P22A 2B8FA 5BN4A 2O2LD 3OAAA 1JOOA 3A8IE 2D3LA 1HFGA 1ESFA 2XRSD 3HOUB 1WTPA 2F0NA 1GUOA 1TVXA 4Y7NB 2K5DA 1SNPA 5JAVA 1H9MA 1V8QA 4BY7B 4DK0A 3NTIA 1O7YA 2EZVA 2CVRA 4C1NI 1FNWA 2NZ1D 2IX0A 5CGKA 4RWSC 2B2TA 3WOFA 5JEAG 1BR9A 1AN8A 3TP6A 1BCPB 4XDXA 2ICIA 1PMRA 4QMGA 4HN7A 2J4XA 4RGOS 4HIZA 5C4JB 2WV6D 3BDCA 2L5TA 1E0BA 1WTVA 4C1NK 4RHSA 4FXKC 1NR2A 3TP8A 1A3VA 2RSNA 3SE0A 1Q3LA 1HZEA 1I18A 3J80E 1LTAD 1G8ZD 1BBXC 3P20A 2I46A 2NBFA 3MVVA 1EY5A 3J81L 2JA7B 3ERQA 1QG7A 4KHZA 5I2YA 4PNYA 5IT9L 1RF2D 5JPMC 4C3HG 3HRZC 5D3IB 1ET6A 2GJPA 2ZXPA 3NBIA 4KTAA 4E6IA 1EEID 4XLFA 4WORA 2GK6A 4HMJA 1S5CD 4GQNA 1AFPA 3A3GA 3VR3A 2L9HA 2K1BA 1PRTC 4J1MA 1PFMA 4OO1I 1GHJA 3SK5A 3M7NA 3WQZA 2K6AA 2EXZA 1SMYC 3OPOA 4JMQA 2JDIA 4H13C 4EQPA 3BDLA 5EBDA 3PO3B 2AWOA 2NN6G 3GTGB 1DOLA 4OGQC 3U9OA 4C3IG 3I70A 2RBMA 1UUPA 4UZUA 4U673 1TY0A 2H1EA 5IOCA 2F0FA 1Y69U 3H94A 4B9WA 3GTMB 1F2MA 1VCIA 4CGYB 2B2WA 1A2TA 2FJ2A 2VB2X 1SNQA 3GD7A 2C5CA 2FINB 2F0PA 3CESA 1WD0A 3IKJA 4K6DA 4OIKA 3DUZA 1IHZA 3I90A 1CZGA 2F0DA 1LTID 3L9AX 2XOKA 1YNJD 1RODA 1SNDA 1DZ1A 3LWEA 5J22A 3X3NA 1GUTA 5I6WA 5E4XA 5CYUA 1KNEA 4DXGA 2JP1A 3GVLA 2MJ8A 2EJGC 1QILA 2NN6H 3NWSA 3S14B 4ZUIA 2B2UC 1RCVD 1FX0A 2DIEA 2X6XA 3E6ZX 1EU3A 3OEHA 4F7XA 3KLSX 2KEDA 1JWSD 2K28A 1ET9A 4KKTA 1NBMA 2F0TA 2A74C 1R9TB 1EIHA 1WCMB 3BS1A 2XVSA 2F0EA 3I91A 2WB1B 1E79A 2R3ZA 3HOWB 1PYWD 4BY1B 3OOCA 1YNJC 1XXGA 3VYSA 4K6LA 5FO7B 4XXEA 3DDYA 4XQQA 5A35A 5KRUA 2D5DA 5M5WB 1D5XC 1UD4A 1F2LA 3TZDA 4ZAIA 2F4IA 5FLXE 1H9JA 4U68A 3FDTA 1LTSD 3FKSA 4WJWA 4TKOB 1EY0A 2PCFB 5DEHA 2DN8A 5D3DA 1BOSA 3TP7A 2B63B 3RMHA 3Q6SA 5CDFA 1TIID 2AWNA 1O7LA 3OHXC 5HURA 4ZRZA 2JEAI 2K01A 4L8JA 3S2HB 1EYCA 4A3EB 1STAA 5BN3A 3I72A 5IGDA 5I9OA 3IAYA 3C3LA 4KHVA 2OEOA 1LO5D 1E1QA 2EYJA 3GVKA 2Q8RE 2EY6A 1LT4D 1TS4A 5G3LD 3K5OA 3QO2A 2V7QA 2IL8A 3J7AV 5KYLA 4MN3A 3SXHA 1CQVA 4XLCA 4R8NA 1CT1D 3BCDA 3L7ZC 4BS9A 4PMCA 5CV7A 4ME5A 1KZLA 4YELA 1BDOA 4AVZA 2L55A 2NUCA 4OIJA 2X53S 4PMBA 1G91A 1GUWA 3MAQA 1I6HB 3MXPA 3OIPA 1TWCB 2M2LA 2GK7A 3NPPA 4IFDI 3AB9A 4RAUC 4ZQ3A 1M4VA 1ILPA 1JOKA 2F0GA 4HSPA 3HAGA 2F0VA 1BLIA 3BC9A 1TWHB 1DONA 1JQYD 1CA5A 4FXUA 3PUWA 4HCEA 2CQAA 4OHJA 3MFGA 3D4DA 3ITPA 3PUZA 3LX0A 1MSHA 1E1RA 2K5WA 2JIZA 4XKVA 3M3YB 2X6YA 4MIUA 5M3FB 4BBRB 1D5MC 1OXUA 4CJ2C 2ID0A 1ICWA 2IX3A 4B3FX 1ENCA 1S5FD 5A2QE 1EQVA 5FO9B 4IUUA 1I4RA 3VR5A 3DWQA 2JE6I 5C0XI 4BWGB 1XYIA 1NCVA 2LS01 3RUZA 1G291 2E2DC 3DEPA 3KBXA 5EJWA 1SYGA 4A93B 1CI3M 2RDHA 1Q1BA 1C48A 4A3FB 1TS3A 3CMMA 2DY7A 5C3EB 4X3UA 1AZQA 3Q24A 4CBVA 4KKSA 4LJZC 4PV1C 2E2HB 3QIAA 1LLRD 5E1FA 3QOJA 4C2MB 2WIIB 4XORA 1SNMA 5IODA 4A3KB 1IKLA 1S5ED 5KNCA 1IYUA 5DAUA 1NAPA 2MUYA 1QOHA 2VJJA 4A3JB 5T1IA 1I4PA 2B2UA 2A6ED 4NKLA 1I4HA 4KD3A 3K59A 2AQ1B 2KCNA 2ZZQA 2F0SA 3M4YA 2XRQD 2WKCA 1IW7C 3A55A 3DM1A 3I4LA 2MHVA 3H09A 2EDGA 4BA1I 1UAPA 1G2TA 1RJTA 4FNFA 5ELDA 1TU2B 3OW7A 3SK6A 4J6HA 1BCPD 5D14A 2RDGA 4G7ZC 2HLDA 4A3MB 4RGTA 1HRJA 3J81E 1Z7TA 1WTWA 4CKCA 1B3AA 1PKVA 1IYVA 3UI2A 3MA2B 2XIWA 1XWEA 2PQEA 4XQFA 4DNTB 1F9PA 3GTPB 1ENFA 5IGFA 1HTPA 4N9PA 1BXTA 5LHY1 3PO2B 1PTOC 2ZXRA 2RDFA 3JU4A 3VYTA 1SE3A 2N88A 5ELFA 1RDPD 1PZKD 4EVOA 2M9VA 1S5DD 3PUXA 3CQZB 5EGTA 1YNND 3W3AA 1SYCA 3FEWX 1QNKA 3TN2A 3T16A 5C3WA 3G6JB 3OWEB 3J7YW 3HZXA 4L63B 4G7OC 2KA7A 3H91A 2L1BA 3L3OC 3BCFA 4FXDA 3OFNA 3VR2A 5C0XG 1QNUA 4N9TA 1CA6A 5CBEE 1UNSA 2CK3A 1F77A 1FYCA 2PZWA 1OXVA 1ESRA 1UD8A 4CJ1B 2VJIA 2ZTGA 5J1ZA 1ZYRC 3OMCA 2HCIA 1FNVA 4KV6A 4KKUA 2JA8B 4XT3B 2F0UA 3RD4A 1K8OA 1XTCD 2H4OA 1D5ZC 4CKEA 1WTRA 2L11A 2M5SA 2OXPA 3S1QB 1HHVA 3QG1A 2K32A 4M8AA 5EPKA 4A3IB 5KEEA 2BCOA 1XX8A 2A5HA 3PUVA 1EFRA 1V0FA 3S1MB 4L6TB 4PQXA 2VNUD 5EKLA 3K5NA 3PMFA 3R8BA 3MWYW 1STHA 1B9NA 3D3RA 5KNLA 3KBGA 5K36G 1OXXK 2GA4B 1PRTD 5EKIA 3SEBA 1H8EA 4G7XA 3I73A 1W6KA 4FYDA 1L0XB 2HQEA 3KLSA 3G7LA 4ZKBB 2IWHA 1COWA 1II3A 3BYTB 2X6WA 2JEBI 4XM3A 1PZJD 3V96A 3I4MB 4FF1A 2ZXHA 1BF4A 3NQTA 4RH6A 3R2IA 2PYKA 1BO0A 3NTKA 3CKIB 2TSSA 1JR0D 3HOYB 3IFTA 2ENBA 4XQNA 1Q12A 2W6IA 4ZUJA 1EWHA 5C3XA 5KGUA 2DNCA 1DOMA 1F2YA 4DXFA 3FPUB 1O80A 5DM73 1WTHD 1E3XA 3IFDA 4KY7A 2BE5D 3HOZB 1TT2A 1V1PB 1TS5A 4Q5VA 5CV4A 1RD9D 2L4NA 1SDFA 1VF7A 3D6CA 1HVXA 5CV9A 2IJ0A 2JA6B 2V4DA 1DXMA 4YXWA 3S17B 2EY5A 1BQQT 1LABA 2LY7A 2EJFC 2EYLA 3IL8A 3QJYA 2D62A 1H9SB 2WPDA 2XZLA 3ND8A 2K05A 2E2IB 3MXNA 3VA5A 3VYRA 3D8GA 2F0KA 4IFDJ 1SE2A 3T51B 5DNFA 1TS2A 3TMEA 3A8KE 1T5XD 3U9SA 2L0CA 1JWUD 1TWGB 1AW7A 5C5LA 3H0GB 1I3QB 1ZKOA 3BZDB 4ZKCB 3BH4A 2PZTA 1SXTA 1RKNA 1GUGA 1JORA 1F9RA 5CV8A 2JXMB 4LMQD 3SR1A 3HG9A 4DGZA 1SYDA 5LL6S 3R93A 3D4RA 4A3BB 1LTBD 4Z1MA 5C6AA 5JEAH 4RCNA 3NUCA 2F0IA 4S3SA 1Y8OB 3S2DB 2X6GA 3OE7A 2F0MA 4K2LA 4G4KA 4JBWA 3D31A 1Y1WB 2A69C 1E43A 1TQOA 3PV0A 3BDOA 3Q22A 1D1IA 2QF7A 4ASUA 3V2TA 4DA2A 2FHTA 2NTSA 1BCPF 1GUNA 3MC0B 1VF5C 2E2JB 4RHRA 3M4OB 5EQ0A 3HGBA 2DY8A 1L0YB 2F0OA 1JCKB 4QUFA 3J80L 5ELBA 1CFMA 1HQRD 1OB0A 5K5PA 2BDOA 1EOTA 4TT3A 3F2UA 1ILQA 5EKKA 4C3IB 4QUCA 2Z4HA 1OXSC 3PIP3 1PTOF 4M1UB 1YNNC 4CKBA 1JE4A 1OHHA 1HFNA 4ODGA 2FFKB 2R92B 1B1ZA 3GO5A 1WVLA 1T5EA 2PNRC 5NUCA 1AZPA 2QEJC 3J7AF 2G9HD 1SE4A 5E3FA 1QWYA 3E0JA 1I6VC 2E76C 1PFNA 1DM0B 1G6ZA 5COYA 3FMCA 1AEXA 2B2VC 2B8GA 2SEBD 5M5XB 2XSCA 1K83B 1KDCA 4G7HC 3H6MA 1EZ8A 2A68C 3HOVB 3RLFA 2Y0SB 1STBA 1IW7D 4EQNA 4IUNA 4K2KA 5JVH3 1SFOB 2NVYB 2A6HD 1GJXA 5C4ZA 4O42A 3CHBD 2D2CC 2EYMA 4C56C 1KTKA 1LV9A 3CU7A 4FVMA 2YYZA 4KK7A 1PRTB 5JJZA 3EQLC 2KVOA 1A6XA 1PTOB 5CV5A 2ICEC 1H8HA 3N6RA 3GTJB 1KMHA 2XWJB 3URYA 2PPBC 3HEJA 2X8KA 2V31A 3BVMA 5IGBA 1Y8PB 2KEEA 3K5MA 4DAVA 3LWUA 2E74C 1I4QA 1D1KA 3PIO3 4II2A 5A2QL 1KLGD 1ENAA 3LNNA 3WOEA 4QB4A 1Z47A 3T4AC 3Q0AA 3VA7A 1VMPA 3GVJA 5EPLA 4R9WA 4A3DB 3I8ZA 2NN6I 4V0BA 3SK8A 4FP5D 2IX1A 4H44C 4ZYSA 1SSOA 1J9OA 2BE5C 1IKMA 2JYOA 1O78A 4FF3A 4IQZA 3RZOB 3A35A 3BVZA 3FRPB 2XZOA 1I8DA 1EU4A 4I7ZC 3GTQB 4II3A 3K7AB 4XLAA 3MTSA 4NDXA 2KOLA 3ZPNA 2IT1A 3TSSA 4XN3A 2A69D 1BMFA 4DAPA 3MXGA 4DU9A 4GZYC 1E3ZA 4Q0FA 1ZYRD 3A54A 1RTOA 2D3NA 1PLFA 4WRDA 1PZID 1Q90A 2HUGA 3MFYA 1U4MA 4TSSA 3JAME 4XNFA 1TWFB 1B44D 2Z8LA 3GV6A 4IUVA 1J8IA 2R61A 1EYAA 2X69A 4XYOA 1ZEQX 1TR5A 2Z4IA 1RHPA 1PXUA 2R7ZB 5E4WC 2Q8IB 1Y8NB 3A7LA 3ZYYX 1CHQD 2B2YA 4OO1H 1CHPD 4YIJA 5IK2A 4QF4A 1PRTF 1EIGA 1WTQA 2B39A 2EJMA 1JWMD 4V190 3BVGA 4RGNA 1Q1EA 5CORA 3QOLA 1MGSA 3DEOA 2O4XA 2FMMA 2K33A 3EFXD 2MGSA 2VXWA 1HUMA 5FLXL 4BBSB 3NHHA 3DXJC 1FR3A 2WKDA 2QILA 2PMZB 3V05A 3C2PA 1PFBA 4XIGS 1WTXA 1SYEA 4QCLA 1HPCA 3DMUA 2AQ2B 4XLHA 3KUPA 4IURA 2X6LA 3H3VC 4JK1C 4E0FA 3RZDB 3S15B 3DWPA 1V1PA 2RQXA 1A15A 1RTNA 2ZTNA 4BA2I 4K5VA 2HDLA 4G7WA 1MI2A 4F88A 2B2WC 4UDUC 4HTHA 1I4GA 4XT1B 3N52A 1LTRD 1LACA 4EGVA 3M85A 2YU9B 4TQUS 1B53A 5CR3A 1FD7D 5KIXA 1OXTA 2MP1A 3WDNA 5C5MA 4FXGC 1EQTA 2IPKD 3BG3A 2K03A 1GOZA 3SK4A 4OL7A 3VYUA 1DJRD 2WJYA 3CRKC 4XTCS 3X3MA 4KN7C 1UD6A 3ZIAA 2NWGA 2NTTA 5C0XH 2F03A 1JOQA 4F87A 1W0KA 4DK1A 2DNEA 3A8JE 2F1MA 3VR6A 1HTLD 2ZXOA 5FK9C 1F2ZA 4B08A 1MABA 2W6JA 3OIQA 1IL8A 2VB3X 1X32A 4Z9CB 4IALA 3HS0C 1U4LA 2ZZGA 5F2DA 4G6IA 4H0LC 2EYHA 2O5IC 2RSOA 2CW0D 3KK7A 3CP8A 1EEFD 1WP6A 4UAIA 1PTOH 2KJXA 2WJVA 4IUPA 1KDBA 3NTHA 4IZ8A 3I4NB 3A3BA 4K5XA 1C4QA 3P1HA 3HP3A 3HKZB 2BDNA 3QB3A 2EOTA 1FNUA 4R8IA 4KI0A 1STEA 3M7GA 5EPJA 5FKAC 5HGTA 2KCCA 1PDQA 4DF7A 3CRLC 1I4XA 5HKKA 4XD7A 1VLYA 5IIFA 2Q8TA 3HOXB 3K0YA 3KLRA 1GXDC 4IN3A 3I3CA 2CW0C 5G3LF 1QJOA 3GP7A 5DM63 1VMCA 3JAML 3C46A 5FO8B 2SOBA 1R4PB 3K58A 1U4PA 2PW7A 2R6GA 3GTOB 5ELEA 4HAEA 1X3QA 1K28D 1D6EC 1DYQA 1E2VA 2B2TC 5I6YA 3S16B 5IGGA 3TZUA 2PZUA 1I50B 1NR4A 2HCCA 1S4ZA 2KUMA 4XQJA 5CC4A 5I9PA 4NNJA 2R9VA 3FVQA 2EY2A 2GJKA 2JJ1A 1SNOA 3CP2A 1JB3A 1JC7A 5EBCA 1E2ZA 3NK9A 1BPLA 1W9XA 3DWAA 2SDFA 4XR6A 4G57A 5KNDA 2O5JC 4IUQA 3EROA 3OMGA 1WTOA 5ELCA 1F9SA 4KY6A 1H9RA 1EL0A 3MEHA 1ONLA 2ZT9C 1ML0D 3NSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9K A;  4H0L C;  2A6E D;  1K8M A;  4G7H C;  1FYC A;  3GQB A;  5JEA G;  2A68 C;  4LK1 C;  2O5I C;  5JEA H;  1OXV A;  2K7V A;  2IT1 A;  4RCN A;  2A69 D;  3IFT A;  2A6E C;  4JK1 C;  1PMR A;  3RLF A;  5A35 A;  1Y69 U;  2A6H C;  1Q12 A;  3M4Y A;  1Y8O B;  3H94 A;  4GZY C;  2BA0 A;  1EWH A;  3ND9 A;  1IW7 C;  1VCI A;  1ZYR C;  3PUW A;  2D5D A;  3SDZ A;  1IW7 D;  3I4L A;  2L5T A;  2DNC A;  2EDG A;  4KKU A;  4OO1 G;  4BA1 I;  3GD7 A;  2A6H D;  3D31 A;  4JBW A;  1H9J A;  3T56 B;  1K8O A;  1Q90 A;  1GJX A;  2A69 C;  3PUZ A;  1TU2 B;  3MFY A;  3IKJ A;  3OW7 A;  4TKO B;  2PCF B;  4KI0 A;  2D2C C;  2DN8 A;  3SE0 A;  4BA2 I;  5K36 H;  2KCC A;  2BE5 D;  4HR7 B;  3PV0 A;  4G7Z C;  2YYZ A;  3CRL C;  3BDO A;  3T53 B;  2AUJ D;  3EQL C;  1Z7T A;  2QF7 A;  5BN5 A;  1A6X A;  1H9S A;  1OXU A;  2AUK A;  3QG1 A;  2K32 A;  3N6R A;  3FPP A;  1HCZ A;  1IYV A;  1GUN A;  2PPB C;  1VF5 C;  3P20 A;  1VF7 A;  3KLR A;  1GUT A;  3PUV A;  1DCZ A;  4DNT B;  1O7L A;  3HGB A;  2V4D A;  1DXM A;  1LAC A;  2CW0 C;  2JEA I;  4L8J A;  1LAB A;  1QJO A;  4TQU S;  2Q8I B;  3M85 A;  4KHZ A;  1HTP A;  2A68 D;  1Y8N B;  1Y8P B;  2EJF C;  3A7L A;  3VR5 A;  1OXT A;  3MXU A;  2JE6 I;  3WDN A;  5KNB A;  2EJG C;  4IFD G;  3LWU A;  2D62 A;  2E75 C;  3QJY A;  1H9S B;  2E74 C;  5BN3 A;  1CFM A;  2NN6 H;  3BG3 A;  3I72 A;  1VDZ A;  3NE5 B;  3ND8 A;  4OO1 H;  2LMC B;  2BDO A;  1B9M A;  2R6G A;  3PUX A;  1B9N A;  1G29 1;  2B8F A;  3LNN A;  5BN4 A;  3A8I E;  5K36 G;  1OXX K;  1OXS C;  1CI3 M;  2EJM A;  3VA7 A;  3CRK C;  3W3A A;  3T51 B;  1Q1B A;  4XTC S;  1Q1E A;  1YNN C;  3VR3 A;  3I73 A;  1E2V A;  4KN7 C;  3A8K E;  3VR4 A;  1V43 A;  4KN4 C;  5C0X H;  3U9S A;  3TZU A;  3A7A B;  4KKT A;  4DK1 A;  2NN6 I;  1GHK A;  2DNE A;  3PUY A;  3A8J E;  2F1M A;  3VR6 A;  4KKS A;  1GHJ A;  1CTM A;  1ZKO A;  2K33 A;  4H44 C;  4KMU C;  3L7Z C;  4IFD H;  3M7N A;  1T5E A;  2BE5 C;  2PNR C;  1GUO A;  4LJZ C;  1TKW B;  4PV1 C;  1BDO A;  2BA1 A;  3QIA A;  1E2Z A;  1SMY C;  3DXJ C;  4G7O C;  1GUG A;  1FR3 A;  2KA7 A;  3OPO A;  1O78 A;  1H9M A;  1I6V C;  2JEB I;  1E2W A;  1V8Q A;  2E76 C;  4H13 C;  4IQZ A;  1DD2 A;  5KND A;  2AWO A;  2O5J C;  2JXM B;  4DNR B;  4XIG S;  3VR2 A;  1HQM C;  3FMC A;  3OOC A;  1IYU A;  2NN6 G;  5KNC A;  1H9R A;  1YNJ C;  4OGQ C;  4DK0 A;  4I7Z C;  1ONL A;  2ZT9 C;  3D4R A;  2EVB A;  2B8G A;  5C0X G;  3AB9 A;  1HPC A;  1Z6H A;  1GUS A; 
#chains in the Genus database with same CATH topology
 2J7K A;  1K9M D;  1H9K A;  2BH8 A;  1VQN A;  5EMN A;  4FF4 A;  2B2Y C;  1YI2 B;  1P16 A;  4C3J G;  5DN6 A;  2K7V A;  2M00 A;  4IUT A;  1K9M C;  3T1H Q;  4HJ7 A;  4IPG A;  2A6E C;  3SHL A;  2VZL A;  1PJ7 A;  2PMD A;  1KHI A;  2MQH A;  1YIJ B;  2PO4 A;  1JIC A;  2Z1C A;  3D4W A;  4DFA A;  1KAB A;  3R2T A;  1SJE D;  3T1Y Q;  2N55 A;  3SVM A;  2OF1 A;  3EIV A;  1VQM A;  1ZM4 A;  2NVT B;  2Z6B D;  4P73 A;  5IYD G;  3OEE A;  3MHB A;  2HHH L;  1MKH A;  2UXB Q;  1M8A A;  3M3Y H;  5LL6 X;  2WP8 J;  1HUN A;  2F0L A;  1CK1 A;  1IB0 A;  4RKL A;  5T1G A;  5JEA J;  2AQ3 B;  1TUI A;  2IW3 A;  1OO9 B;  3MXN B;  1RL2 A;  1EQR A;  4P75 A;  1HA6 A;  4HMI A;  4X3K A;  3FPP A;  2SNM A;  4X65 Q;  4M2L A;  1FGB D;  3ONA B;  2QE7 A;  3ULP A;  1ASZ A;  3QFT A;  1Q86 D;  2WIN B;  2HQL A;  2ALY B;  4XN0 A;  1SBB B;  2XNA C;  5LMN W;  1Z9F A;  4G1V A;  2OT2 A;  3CCL B;  4L5Q A;  2QMU A;  3AMU A;  4XOP A;  1QB5 D;  3MXU A;  4FO2 A;  5JOB A;  3CXC A;  3P75 A;  4L5T A;  2KVM A;  1E24 A;  3CRZ A;  2LKV A;  2WZP P;  5AFW A;  4FF2 A;  2ZZF A;  2XGJ A;  3PEN A;  2R93 B;  1OGJ A;  1VDZ A;  4RA8 A;  3NE5 B;  4G1B A;  5TSS A;  2KEC A;  2LMC B;  1VJS A;  3CD6 B;  2RHQ B;  3CCM A;  1YHQ B;  1EYD A;  1IBL L;  3SGI A;  2ZM6 Q;  2DOG A;  3EA6 A;  3CCR B;  3FKI B;  4WFN 3;  4JVZ A;  3CCJ B;  1SRU A;  3KF8 A;  4K8I A;  3S9W A;  3DM3 A;  2ZTE A;  3WNC A;  4LFC L;  5LMN Q;  4P74 A;  4RCZ A;  3AVY A;  4K5W A;  4ABN A;  1VQ9 A;  2NVX B;  3VR4 A;  2HD3 A;  4YAU A;  5KSW B;  1V43 A;  4WQM A;  2EYP A;  2GQF A;  5TR9 A;  3AU7 A;  4BY7 G;  4JI8 Q;  3HOX H;  4KD4 A;  1KRT A;  3PUY A;  1U5K A;  4XL9 A;  2E1B A;  4HE5 A;  3TDQ A;  5IWA Q;  4KMU C;  1XPU A;  3KOJ A;  2C5B A;  3Q6Q A;  1HNW L;  3VNV A;  2K52 A;  2EPB A;  2BA1 A;  4DAY A;  3GTK B;  5C0X J;  2TMP A;  3CCQ A;  2KHS A;  3E5S A;  1PH9 A;  1E2W A;  4YWK A;  3EBE A;  1W6J A;  3CCS A;  5JPN C;  2PW5 A;  1KAA A;  1KAW A;  1WYD A;  3GTL H;  4LF9 L;  1B4O A;  1STG A;  2F0J A;  4K14 A;  4NMZ A;  5M5Y B;  1O7I A;  3E9H A;  3PUN A;  2C9O A;  4PG3 A;  4XMY A;  5M3F G;  3BZC A;  2WZN A;  3S1N B;  3D26 A;  3C1E A;  1UD3 A;  2EVB A;  1YJN A;  5IT9 E;  4P6Y A;  1Z6H A;  3NWT A;  1GUS A;  4PMW A;  4OEL B;  4TMT A;  1HNW Q;  4TMV A;  2GJR A;  4LK1 C;  2BPO A;  4RDJ A;  2Q2H A;  1PH8 A;  1LTT D;  5HGQ A;  4P2C B;  1C8C A;  1SKY B;  1JJ2 B;  1MHW C;  1EFT A;  1NRK A;  1W3S A;  3ND9 A;  4OX9 L;  1B70 B;  5H59 A;  2I07 B;  4OEM B;  4OO1 G;  5M3F H;  2WAC A;  2HT1 A;  2MO1 A;  1X6O A;  2EE1 A;  4NW2 A;  5D65 A;  5GAD C;  3G05 A;  3A56 A;  2NVQ B;  3P7J A;  3RLN A;  3CC4 B;  3BYY B;  5M3M B;  3NEM A;  4LF6 L;  1NJI C;  5K36 H;  2XZP A;  1TY2 A;  5E6T A;  4NXN L;  3W5U A;  2ZZE A;  1QUQ B;  2LFN A;  3EJI A;  2B7B A;  1SJH D;  1MD2 D;  5J39 A;  2RVL A;  4ZV4 A;  2AUK A;  1IJE A;  3STB D;  1EY7 A;  1QGZ A;  5I4D A;  4C3H B;  5C44 B;  2VBT A;  4QFM A;  4QHY A;  5LMU Q;  2PLF A;  3R3O A;  2CHB D;  1EY8 A;  5IYR A;  1UD2 A;  1QE6 A;  2FMC A;  2EYF A;  5BSY A;  1OB2 A;  5KYI A;  4B43 A;  4DV7 L;  4GN5 A;  3OWF A;  4RKB A;  3W2H A;  2JA5 B;  1A62 A;  1F9Q A;  3S1R H;  4HCS A;  3VDY A;  4RCY A;  4HED A;  1IXR A;  2OTJ B;  5KNB A;  4IFD G;  4B9X A;  1WD1 A;  2E75 C;  2B5O A;  1I5F A;  1LT5 D;  2L12 A;  1PVO A;  4LBW A;  1PH4 A;  3S1R B;  2CFM A;  5GAG C;  1BBW A;  2BOS A;  2V7V A;  1I94 Q;  1O7Z A;  4A3L H;  4AYB B;  4DN4 M;  3CC2 A;  4PAA A;  2J7Z A;  2XWB B;  4BY7 H;  1NUC A;  1N08 A;  3C1F A;  5F4J A;  1B2T A;  3K5L A;  5IGE A;  2UXC Q;  5FL7 A;  4QIW B;  1SEB D;  3TP5 A;  4PAB A;  4ILW A;  3EVQ A;  2MO0 A;  4DR5 Q;  3PIP A;  4PC2 A;  1WCM H;  3W1G A;  3ZZ0 A;  4X3S A;  1GHK A;  1BX0 A;  2F43 A;  2X3U A;  2R6H A;  2RHS B;  4AYB G;  1SYF A;  2A73 B;  3O13 A;  2SNS A;  3A74 A;  4GKJ L;  2K75 A;  3E1Y E;  4KJO A;  1EP3 B;  5C4H A;  4CJ0 B;  2HDM A;  1TKW B;  1HR0 W;  2G9D A;  2EY1 A;  2DJF C;  1EY4 A;  4RCO A;  1DD2 A;  4DNR B;  1HQM C;  2RKS A;  1HA5 A;  1EZ6 A;  3CW2 A;  3S1N H;  4AQY Q;  2LXJ A;  2WSS A;  1KQS A;  4HJ8 A;  5CMD A;  4NBS A;  4ZCK A;  3Q23 A;  1BUV T;  1CM9 A;  2KEN A;  1BVS A;  3MZ5 A;  5J3B A;  2F0H A;  1JJG A;  1BNZ A;  2KQ3 A;  3TBI B;  1SMY D;  2F0Q A;  5JVG 3;  1CNF A;  4TRD A;  1CSQ A;  3I7F A;  3M9B A;  4LAA A;  3BY2 A;  2F3V A;  2E2H H;  4ROX A;  2A6H C;  4LW1 A;  5IGC A;  3GTL B;  5IP7 G;  3GIR A;  4C2M H;  3SDZ A;  1R5B A;  2QTL A;  4TSF A;  2CND A;  1WOP A;  1NY4 A;  2L15 A;  2F0W A;  1A2U A;  3H15 A;  2H5X A;  3OSO A;  1SAP A;  4HID A;  4A3K H;  5EAY A;  2Q6K A;  5C4X G;  3T56 B;  4JV5 Q;  2XN9 C;  2JK8 A;  4JOI A;  4J8Q A;  4RFB A;  2RCF A;  4ZLT F;  1U9R A;  1QX4 A;  1YVC A;  3ZJY C;  2OBR A;  3NXW A;  2RA4 A;  4HR7 B;  5ISR A;  3CCU A;  1HNX L;  1X54 A;  1DG1 G;  2AUJ D;  1MBY A;  4GN3 B;  1QUQ A;  5BN5 A;  1H9S A;  4YWL A;  3CMA A;  4YAL A;  1G2S A;  1PTO D;  4O0A A;  2WFW A;  4ZK9 B;  1HCZ A;  1ASY A;  4WZK A;  1EY6 A;  3U4V A;  3CC4 A;  1SYB A;  1DCZ A;  1J5E Q;  3AVW A;  4AF7 A;  4ULL A;  2A68 D;  4XLE A;  5FOB B;  2XND A;  2D9U A;  4X3T A;  4CHT B;  2VL6 A;  4I65 A;  1AP0 A;  3M4P A;  4OOV A;  5L37 A;  4B3G A;  4XKW A;  3CMA B;  3NQI A;  3PA1 A;  1NSN S;  5I2X A;  3D0F A;  3TRZ A;  1B9M A;  1MSG A;  1EP2 B;  3UDF A;  5CBA E;  3K57 A;  1TWA B;  4K8J A;  2V7U A;  4XOT A;  1MJC A;  3NBH A;  4A3G B;  2LZJ A;  1VQC A;  4MZ9 A;  1B3Q A;  1YHA A;  1SNC A;  4BXX H;  4Q7J B;  2P3M A;  4RDL A;  3MMP A;  4IJH A;  2QDB A;  3P26 A;  4KN4 C;  1V0E A;  2B2V A;  4F8M A;  3A7A B;  1A3U A;  1BJK A;  2I0Q A;  1I50 H;  1KD1 D;  1CTM A;  1M1K C;  4IFD H;  1BCP C;  2NB0 A;  2X85 A;  3RLO A;  1LT3 D;  3NP8 A;  1XNQ L;  2EYO A;  1UD5 A;  5DLQ E;  1LT6 D;  3VMF A;  1CQF A;  5GQO A;  5M9O A;  4HSV A;  4LF6 Q;  1UEA B;  5F4M A;  2QEX A;  3RN2 A;  4LF7 L;  2C2W A;  1D2B A;  4R4T A;  4RGM A;  3DHQ A;  1EY9 A;  3ASS A;  2QKI C;  3V7A A;  4U9U A;  2VS1 A;  2J0T D;  2K5Q A;  1K8M A;  5FLM H;  2JSO A;  4KJN A;  3GQB A;  1KDA A;  3S1Q H;  4P3I A;  1S5B D;  1VQ7 A;  3T13 A;  1X3P A;  2VUM B;  1Y1V B;  4IPH A;  3KEW A;  1QCB D;  2QCP X;  3JC6 6;  1DOK A;  3GV3 A;  1LTG D;  2BA0 A;  2V7W A;  3K6O A;  2BSA A;  1KLU D;  2ZL5 A;  4DR7 L;  3PCO B;  4ID6 A;  1EFI D;  2OBS A;  1W0J A;  2WAQ B;  3Q38 A;  1FNB A;  3D6W A;  3PVD A;  2JJ2 A;  1E63 A;  4C3J B;  3ZZU A;  1PJ6 A;  1V1O A;  1A63 A;  1SRO A;  4O1N A;  4EQO A;  4ALP A;  4XON A;  1PH7 A;  1MIU A;  4XYQ A;  4OPV A;  1STN A;  3T53 B;  2GRE A;  3AST A;  1ZXT A;  4DV0 L;  1B50 A;  5IYB H;  1K0S A;  1STY A;  4MHE A;  2YWH A;  2F1L A;  1KJZ A;  1EWC A;  1K0R A;  1N32 Q;  4KY5 A;  5IYN A;  3CPW A;  1A3T A;  2VNH A;  4BBR H;  5CV6 A;  5FLM G;  1KNA A;  4DNI A;  4GNX C;  1Q8I A;  1R4Q B;  1EP1 B;  2ZXI A;  4LF5 Q;  4YEJ A;  3W2D A;  3QWN A;  1U4R A;  1WI5 A;  2MPM A;  2VY3 A;  1WPC A;  1AMO A;  2K5H A;  2K04 A;  4X66 L;  4H7B A;  1UE5 A;  2NYZ D;  4NP5 A;  5C4X B;  1QFZ A;  4X7C A;  1CZW A;  1G6P A;  3H3V H;  4DUZ L;  2F3W A;  1HXY D;  3RN5 A;  4P22 A;  2B8F A;  1IL2 A;  1YNX A;  1Y0Y A;  4B44 A;  3OAA A;  2O2L D;  5BN4 A;  1JOO A;  3A8I E;  3LGJ A;  4GLX A;  3JAM c;  2FXQ A;  3RY8 A;  2D3L A;  4C3J H;  5HZB A;  2VNI A;  4OON A;  4X05 A;  1E22 A;  2YTY A;  3JQQ A;  5IP9 H;  1IJF A;  1HFG A;  1CUK A;  4DR3 Q;  1JJC B;  1ESF A;  2XRS D;  3W1B A;  3HOU B;  1JB9 A;  4LUO A;  4OXP A;  1WTP A;  2F0N A;  4R71 A;  1JJ2 A;  1GUO A;  1TVX A;  4Y7N B;  2GPJ A;  3I4M H;  4X07 A;  2K5D A;  1SNP A;  5JAV A;  2WAQ E;  1H9M A;  4AF6 A;  1V8Q A;  4BY7 B;  1U0L A;  3I1F A;  1N06 A;  3KJO A;  3BJU A;  2A19 A;  4UZE A;  3HOZ G;  4DK0 A;  3NTI A;  4A3G G;  4HIK A;  1WSV A;  1O7Y A;  2EZV A;  2CVR A;  5BR8 Q;  4C1N I;  4PC6 A;  1FNW A;  4GKK L;  2NZ1 D;  4DR7 Q;  2IX0 A;  4FK8 A;  5CGK A;  4RWS C;  2C5H A;  2B2T A;  1L0W A;  3WOF A;  5JEA G;  1BR9 A;  1AN8 A;  3TP6 A;  4YCV A;  1BCP B;  2F52 A;  4XDX A;  4Z4T A;  2ICI A;  2JA6 G;  1PMR A;  3PA2 A;  2KHI A;  4HN7 A;  4QMG A;  2J4X A;  1I94 L;  1YX2 A;  4RGO S;  4HIZ A;  3TEH B;  5C4J B;  3GTM H;  2WV6 D;  3BDC A;  4HJ5 A;  1C9O A;  2L5T A;  4UP9 A;  1UE7 A;  4Z4S A;  1E0B A;  1WTV A;  1AIP A;  1XMO Q;  4C1N K;  1EQQ A;  1G51 A;  4DR2 Q;  4RHS A;  1G7T A;  4FXK C;  5TRD A;  1NR2 A;  1A3V A;  3TP8 A;  2CQO A;  2RSN A;  1VQ4 B;  5FIU A;  3SE0 A;  2MFI A;  1Q3L A;  4B3T L;  2JA7 G;  1TVC A;  1HZE A;  1SLJ A;  1QZG A;  1I18 A;  4A3B G;  3J80 E;  1LTA D;  4PC3 A;  4A3G H;  1WOS A;  1G8Z D;  3ZBU A;  3HKZ E;  4QJF A;  1F60 A;  4A3I H;  1BBX C;  2V1C C;  3P20 A;  2I46 A;  4JI3 L;  4JC0 A;  2NBF A;  3CP0 A;  4UP8 A;  3MVV A;  1VQ6 B;  1EY5 A;  3J81 L;  3W2G A;  1JE5 A;  4DUZ Q;  3ERQ A;  1QG7 A;  2JA7 B;  4KHZ A;  4B3R Q;  3W2F A;  1YIT B;  5I2Y A;  2I5L X;  4PNY A;  4DV6 Q;  5IT9 L;  1RF2 D;  5JPM C;  2ZBV A;  3HRZ C;  5D3I B;  4C3H G;  4DUY Q;  1ET6 A;  2GJP A;  5AN9 A;  2ZXP A;  3NBI A;  1JT8 A;  4KTA A;  3F1Z A;  4P2N A;  4E6I A;  1EEI D;  4PZ7 A;  4XLF A;  1YHB A;  4WOR A;  1I6H H;  1K73 D;  2JN9 A;  2GK6 A;  4HMJ A;  1S5C D;  4CDF C;  2BM0 A;  4GQN A;  1AFP A;  3A3G A;  3VR3 A;  2L9H A;  4UHV A;  4X0C A;  1S40 A;  2K1B A;  1PRT C;  2Z6K C;  3T1Y L;  4RDK A;  1N9W A;  4YHH L;  4J1M A;  4R1J A;  2BM1 A;  4LBZ A;  1PFM A;  1YJ9 B;  3LQ6 A;  4OO1 I;  2A1A A;  1GHJ A;  2PI2 E;  1B8A A;  3C2Q A;  3FP9 A;  3SK5 A;  3M7N A;  3WQZ A;  2DJG C;  2K6A A;  1N0U A;  2YV5 A;  1A8V A;  2JA9 A;  2EXZ A;  1SMY C;  4RPD A;  1PH3 A;  3OPO A;  2BMW A;  1VQN B;  1X65 A;  4LF8 Q;  4JMQ A;  3GTG H;  5F4O A;  2JDI A;  4H13 C;  4EQP A;  3BDL A;  1I7P A;  3SEJ A;  5EBD A;  2AWO A;  3PO3 B;  1XMQ Q;  3S15 H;  1SM4 A;  4MTK A;  4X7D A;  2NN6 G;  3GTG B;  1UE6 A;  1DOL A;  1VQO A;  4OGQ C;  4KHP L;  1VQJ A;  1B23 P;  3U9O A;  4C3I G;  3CCU B;  5M5X H;  1QZH A;  2QGQ A;  1HA3 A;  3I70 A;  2RBM A;  1UUP A;  4RD6 A;  2HDN B;  4UZU A;  2UUC L;  1N0V C;  5IT9 c;  3J7Z C;  2I5H A;  4DV6 L;  5A89 A;  4U67 3;  1TY0 A;  1VQ8 A;  2H1E A;  5IOC A;  4DV4 L;  2F0F A;  3I4M G;  1Y69 U;  3P27 A;  3H94 A;  4B9W A;  1IBK L;  1N07 A;  3GTM B;  3SLD A;  1F2M A;  1VCI A;  4CGY B;  1LM0 A;  2B2W A;  4PC1 A;  2B63 H;  4WJ3 M;  4X06 A;  1A2T A;  4IJL A;  3E20 A;  1PH2 A;  2FJ2 A;  2VB2 X;  1SNQ A;  3GD7 A;  2C5C A;  2FIN B;  2F0P A;  4UP7 A;  2CCZ A;  3CES A;  1WD0 A;  3IKJ A;  4K6D A;  4OIK A;  3DUZ A;  3AGP A;  5B6I A;  4LFB L;  1IHZ A;  5H5J A;  3I90 A;  2GN5 A;  1CZG A;  3A8J A;  2F0D A;  4X6A H;  1LTI D;  5IYP A;  3L9A X;  1VQ5 B;  1KRS A;  2B29 A;  4AIM A;  2XOK A;  1YNJ D;  1ROD A;  4C3I H;  2OTJ A;  1SND A;  1QGA A;  1DZ1 A;  4Y9R A;  2JA5 H;  3LWE A;  5J22 A;  1J9Z A;  1GUT A;  3X3N A;  1KC8 C;  1ZM9 A;  5I6W A;  5E4X A;  3ZUG A;  5CYU A;  2Y0S G;  1KNE A;  4DXG A;  2JP1 A;  1WOC A;  3GVL A;  3WBK A;  2MJ8 A;  2EJG C;  2YTX A;  1QIL A;  2NN6 H;  3NWS A;  3TRE A;  3S14 B;  1NMG A;  4ZUI A;  1NJI D;  2B2U C;  2QEX B;  1RCV D;  1FX0 A;  2DIE A;  2X6X A;  1EU3 A;  3E6Z X;  3QR8 A;  2JA6 H;  3OEH A;  4F7X A;  4Y9U A;  3KLS X;  2KED A;  4RD1 A;  5FA6 A;  1PH6 A;  1JWS D;  1CQX A;  2K28 A;  1FND A;  4YHB A;  1ET9 A;  5M3M H;  4KKT A;  5GV7 A;  1NBM A;  2F0T A;  2A74 C;  2OCE A;  3ISX A;  4GOP C;  1R9T B;  1EIH A;  1WCM B;  5HZA A;  3BS1 A;  4JV5 L;  2XVS A;  2F0E A;  3I91 A;  2WB1 B;  5IY0 A;  4GOP B;  1E79 A;  4YY3 L;  2R3Z A;  1EOV A;  1T6Z A;  3HOW B;  4JBJ A;  1PYW D;  2VQE L;  3OOC A;  4BY1 B;  4P12 A;  1YNJ C;  4A3F H;  1WCM G;  1XJV A;  3WXM A;  2Z0S A;  2EQS A;  1XXG A;  1UWV A;  4QQB X;  4P3Y A;  3VYS A;  3Q3A A;  4M4S A;  1PH5 A;  2AMC B;  4K6L A;  5FO7 B;  4XXE A;  1WU8 A;  3R6K A;  3DDY A;  4JG2 A;  4XQQ A;  4DV3 L;  5FO0 A;  5H1S E;  3AVU A;  1EFU A;  1U2R A;  1VQP B;  3PF4 A;  5A35 A;  2QGG A;  3RZO H;  1K28 A;  5KRU A;  3Q6R A;  2D5D A;  5M5W B;  1D5X C;  1UD4 A;  1F2L A;  3GTQ H;  1VQL A;  3TZD A;  1FRN A;  4ZAI A;  1L1O B;  1QVF A;  2JA7 H;  2F4I A;  4N3N A;  5FLX E;  1HZB A;  1H9J A;  4OWT B;  3FDT A;  1LTS D;  3FKS A;  4N8F A;  4U68 A;  4WJW A;  4TKO B;  1EY0 A;  2PCF B;  5DEH A;  4RMF A;  2DN8 A;  1K8A D;  1E64 A;  5D3D A;  1NMF A;  1SN8 A;  1BOS A;  1FNM A;  4GNX B;  3TP7 A;  2ZBU A;  2B63 B;  4A3F G;  3A8K A;  3RMH A;  5KW9 A;  4A3E G;  3Q6S A;  4DQL A;  5CDF A;  4JI0 Q;  1TII D;  2AWN A;  4Z4R A;  2NVX H;  4HJA A;  1O7L A;  3OHX C;  3W5V A;  4UPA A;  5HUR A;  4A76 A;  4ZRZ A;  2JEA I;  2K01 A;  4L8J A;  4GKJ Q;  3S2H B;  2UXB L;  4MYT A;  4QGU A;  1NBW A;  4DV2 Q;  4P6V F;  1EYC A;  4A3E B;  3S17 H;  3AFQ A;  1STA A;  5BN3 A;  3I72 A;  5HXB A;  4B3R L;  5IGD A;  5I9O A;  3IAY A;  3C3L A;  4OWW B;  4KHV A;  2C35 B;  2OEO A;  1LO5 D;  1E1Q A;  4QL5 A;  2EYJ A;  3GVK A;  2KBN A;  5IP7 H;  1VHE A;  1TWH H;  2Q8R E;  4A93 H;  2Z6B A;  2EY6 A;  1LT4 D;  1TS4 A;  5G3L D;  4LBV A;  3AFP A;  3QFS A;  4LC0 A;  3K5O A;  3QO2 A;  1IBM Q;  2V7Q A;  2IL8 A;  2R92 H;  5KYL A;  3CXC B;  1YJN B;  1YIJ A;  4MN3 A;  3SXH A;  3J7A V;  1LUZ A;  1TLL A;  1CQV A;  4XLC A;  3E3X A;  4R8N A;  1CT1 D;  3BCD A;  1VQP A;  3L7Z C;  4BS9 A;  4PMC A;  2R7Z G;  2VQE Q;  1TWG H;  5CV7 A;  1B7Y B;  4ME5 A;  4JI1 L;  1KZL A;  4YEL A;  1BDO A;  5M5Y H;  4Y7N H;  4AVZ A;  2L55 A;  2NUC A;  1PFS A;  4OIJ A;  2X53 S;  4DR6 Q;  3ASR A;  4PMB A;  1MJE A;  1Q86 C;  1G91 A;  1GUW A;  3MAQ A;  2QA4 A;  1I6H B;  3MXP A;  4TMX A;  1Y14 B;  3OIP A;  1TWC B;  2NPF A;  2YU9 H;  1JMC A;  4FWT A;  2M2L A;  2ZL6 A;  2GK7 A;  2D0P A;  4NPS A;  4A3M G;  3NPP A;  4IFD I;  5JJL A;  3AB9 A;  4RAU C;  1H42 A;  1M4V A;  1Y1V H;  4ZQ3 A;  3I56 A;  5AJ3 L;  1ILP A;  1JOK A;  3A5Z B;  3J81 k;  1XQB A;  2F0G A;  4HSP A;  3HAG A;  4TMZ A;  3KDF B;  1VQM B;  3HOV H;  2C78 A;  1BLI A;  2F0V A;  3BC9 A;  1TWH B;  5C44 H;  1DON A;  1JQY D;  1CA5 A;  4FXU A;  3PUW A;  4Y52 H;  4LFA Q;  4HCE A;  2CQA A;  4OHJ A;  3MFG A;  2ZIT A;  3D4D A;  2R93 G;  3ITP A;  4DV1 L;  4DK3 C;  1OB5 A;  3PUZ A;  2CWP A;  1FDR A;  3LX0 A;  3OTO Q;  3Q39 A;  1MSH A;  1E1R A;  3OJX A;  2K5W A;  2JIZ A;  4XKV A;  3M3Y B;  4P26 A;  2X6Y A;  4MIU A;  4L5R C;  5M3F B;  3CB4 A;  3S1M H;  5GAE C;  4A3L G;  4BBR B;  1S0U A;  1D5M C;  4DR3 L;  1OXU A;  3G6E B;  2NVQ H;  1P4M A;  4CJ2 C;  2ID0 A;  4B3S Q;  4IPC A;  1KK2 A;  3F8T A;  4DR6 L;  1ICW A;  2IX3 A;  4AH6 A;  1A8P A;  4B3F X;  4Z4W A;  2JJQ A;  2XGT A;  4GS3 A;  1ENC A;  1S5F D;  5A2Q E;  1EYG A;  1EQV A;  4DV1 Q;  3FPK A;  4BBS G;  2VW9 A;  5FO9 B;  2CW5 A;  4IUU A;  4DQK A;  1I4R A;  3VR5 A;  5M5W H;  3DWQ A;  3J81 j;  2JE6 I;  5C0X I;  4BWG B;  2OK8 A;  1QFJ A;  2F3I A;  3PGZ A;  1XYI A;  1QVC A;  1NCV A;  3BU2 A;  4JI7 L;  1Y0R A;  1WDT A;  3QSY A;  2LS0 1;  3RUZ A;  1W87 A;  3H0G G;  3H9N A;  1G29 1;  2E2D C;  3DEP A;  4HJ9 A;  3KBX A;  4ZCI A;  2ZM6 L;  5EJW A;  1SYG A;  3LQE A;  4A93 B;  1CI3 M;  4LWC A;  2OQ0 A;  2RDH A;  1Q1B A;  1C48 A;  3L0O A;  4TN1 A;  3PUM A;  4A3F B;  1TS3 A;  1D8T A;  4O2D A;  2QN6 A;  1ZM3 A;  2UXD Q;  3CMM A;  2DY7 A;  3DLL A;  1Q9S A;  5C3E B;  1M1K D;  4X3U A;  1AZQ A;  4HE6 A;  2Q6L A;  4UZF A;  4CBV A;  4KKS A;  3Q24 A;  1NNX A;  2CC2 A;  1N36 L;  1FJG L;  4YWM A;  1G7S A;  2K5V A;  4LJZ C;  4WZT A;  4PV1 C;  4BY1 H;  1VQG A;  3QIA A;  2E2H B;  3JQR A;  3U4Z A;  3A1P A;  1VQ9 B;  1LLR D;  5E1F A;  3QOJ A;  1EWY A;  4C2M B;  3UDX A;  2WII B;  1PJ5 A;  4PZ6 A;  4XOR A;  5C3E G;  3KJP A;  1SNM A;  5IOD A;  4A3K B;  1IKL A;  1NTG A;  1S5E D;  3F2C A;  5KNC A;  1IYU A;  5DAU A;  1NAP A;  1VQL B;  4R4O A;  3J81 i;  3E0E A;  2MUY A;  1QOH A;  2VJJ A;  4A3J B;  2PNH A;  5T1I A;  1SE8 A;  2HHH Q;  1I4P A;  4OWX B;  2B2U A;  2A6E D;  4NKL A;  1I4H A;  3CCL A;  1AE3 A;  4KD3 A;  3K59 A;  4IW3 B;  2ZTD A;  2AQ1 B;  2KCN A;  2ZZQ A;  2F0S A;  3M4Y A;  2XRQ D;  2WKC A;  4YCU A;  2JA5 G;  1IW7 C;  3A55 A;  1W35 A;  3DM1 A;  3T1H L;  3I4L A;  2MHV A;  3H09 A;  2EDG A;  2YTV A;  1TXY A;  2ZL7 A;  3HOZ H;  1BBU A;  2OWO A;  4BA1 I;  1UAP A;  1G2T A;  3UE1 A;  1RJT A;  4FNF A;  5IYC H;  5ELD A;  1TU2 B;  4IPD A;  4B48 A;  3OW7 A;  2UU9 L;  3K80 C;  3SK6 A;  4J6H A;  1S4M A;  1BCP D;  5D14 A;  4DPG A;  2UUA L;  2RDG A;  4DV7 Q;  4G7Z C;  1V5V A;  1CKM A;  3RR5 A;  1TWF H;  2HLD A;  1ZM2 A;  4RGT A;  4A3M B;  1HRJ A;  3ASP A;  3J81 E;  1JB7 A;  1Z7T A;  1WTW A;  4CKC A;  1B3A A;  4CDE C;  1PKV A;  4POG A;  3I4N H;  1GO3 E;  3W5H A;  3UI2 A;  3MA2 B;  1IYV A;  2XIW A;  4KHP Q;  1XWE A;  2PQE A;  3HKS A;  4XQF A;  1UEB A;  4DNT B;  1F9P A;  3GTP B;  1Q81 C;  1ENF A;  5IGF A;  4YHH Q;  2E2I H;  4K0K L;  1HTP A;  4N9P A;  4N3G A;  1BXT A;  5LHY 1;  3PO2 B;  5BSX A;  1EIY B;  4LF8 L;  1PTO C;  2ZXR A;  2RDF A;  3JU4 A;  3VYT A;  1SE3 A;  4ZGQ B;  2N88 A;  1WFQ A;  5ELF A;  1RDP D;  4C3H H;  1XMO L;  1VQE A;  5LMZ A;  1WOR A;  1PZK D;  4EVO A;  2M9V A;  1MRZ A;  1XNR L;  1S5D D;  3PUX A;  3UDI A;  3CQZ B;  4NXM Q;  2Z9H A;  5EGT A;  1EFC A;  5ELO A;  2Q2U A;  1YNN D;  3ONU A;  4A3D H;  1V1Q A;  2OBT A;  3W3A A;  1XNR Q;  1SYC A;  3FEW X;  5J3O A;  2Q6I A;  4A3C H;  1WSR A;  1QVG B;  1QNK A;  3TN2 A;  2OTL A;  3T16 A;  5C3W A;  3G6J B;  3OWE B;  1DAR A;  2I5M X;  3J7Y W;  4LUV A;  1S3O A;  4ZGN B;  1TTT A;  4JI3 Q;  4LBY A;  3W2I A;  4DV3 Q;  3HZX A;  4HIM A;  4L63 B;  3AYH B;  3BQJ A;  3KL9 A;  1WJJ A;  4PC7 A;  4G7O C;  3PSI A;  2KA7 A;  3H91 A;  4EX5 A;  2L1B A;  3L3O C;  3BCF A;  1YJ9 A;  4NB3 A;  4RD3 A;  1T6Y A;  4RG1 A;  4FXD A;  3OFN A;  3VR2 A;  1KQS B;  4TMW A;  5C0X G;  4B3S L;  4BBS H;  1QNU A;  3ULL A;  4N9T A;  3G71 B;  1CA6 A;  5CBE E;  1PA6 A;  1K3B C;  2V7X A;  1UNS A;  3W2E A;  2CK3 A;  1F77 A;  1FYC A;  2PZW A;  1OXV A;  1ESR A;  1HNZ Q;  1UD8 A;  4ME3 A;  2IHE A;  4BY1 G;  3WBJ A;  4AQY L;  4CJ1 B;  2VJI A;  2ZTG A;  1KC8 D;  1L1O C;  5J1Z A;  2XNJ A;  1ZYR C;  3OMC A;  5FNZ A;  4MNO A;  2HCI A;  1FNV A;  4KV6 A;  4DV4 Q;  4GKK Q;  4Y7C A;  4CDC C;  4KKU A;  2AKW B;  3GSI A;  4APV A;  1R5N A;  2JA8 B;  2VBV A;  1HJP A;  3SJZ A;  4XT3 B;  2F0U A;  3A0J A;  3RD4 A;  5C44 G;  1K8O A;  1XTC D;  4Z4V A;  3ZZT A;  2K4K A;  3E9I A;  3LO8 A;  2YWF A;  2H4O A;  1KRH A;  1D5Z C;  4JCV E;  4CKE A;  4DR4 Q;  1WTR A;  5FJ8 G;  2L11 A;  2E1R A;  2M5S A;  4P25 A;  2OXP A;  4ACB A;  1Y1W H;  3S1Q B;  3B6Y A;  4DR5 L;  1HHV A;  3QG1 A;  2K32 A;  4M8A A;  1K8G A;  5EPK A;  4A3I B;  4LFA L;  2HIV A;  2BCO A;  4LUZ A;  5KEE A;  4DV0 Q;  1XX8 A;  4X62 L;  2A5H A;  3PUV A;  1EFR A;  1V0F A;  3S1M B;  4AYB E;  1EWI A;  4L6T B;  4PQX A;  2VNU D;  1QFY A;  1N34 L;  3A8I A;  3ZC3 A;  2R7Z H;  5EKL A;  3K5N A;  3PMF A;  3R8B A;  1W2B B;  3MWY W;  1FNC A;  4Z4Z A;  1Q7Y C;  1STH A;  1B9N A;  3D3R A;  5KNL A;  2K14 A;  3K81 C;  3KBG A;  2CBX A;  4N8X 1;  5K36 G;  3WND A;  2BF4 A;  3AVV A;  1OXX K;  1PRT D;  2GA4 B;  2GVA A;  5EKI A;  4FDB A;  3SEB A;  1H8E A;  4IO9 A;  4NCN A;  4G7X A;  4WWV A;  3I73 A;  4H9G A;  4LF5 L;  3STB C;  1W6K A;  3G4S A;  1D8L A;  1PH1 A;  2VUM H;  4FYD A;  1L0X B;  1Y1V G;  2HQE A;  1N33 L;  1I3Q H;  3KLS A;  1N32 L;  3G7L A;  1K3R A;  1IZ6 A;  4ZKB B;  2IWH A;  4R4I A;  4OPS A;  2X0K A;  3OZU A;  3TS0 A;  1COW A;  1CKO A;  1II3 A;  3BYT B;  3K7A H;  2X6W A;  2JEB I;  4XM3 A;  2WYR A;  5TV2 A;  1PZJ D;  3ES9 A;  4WZL A;  3CW2 C;  4JI6 Q;  3V96 A;  2NZO A;  3G6E A;  4JBM A;  1KK3 A;  4BPR A;  3I4M B;  4FF1 A;  1NE3 A;  2ZXH A;  1BF4 A;  3NQT A;  4RH6 A;  3R2I A;  2PYK A;  4JYA Q;  3PIO A;  2DYI A;  3CCS B;  1BO0 A;  3KF6 B;  2AHO B;  3NTK A;  3CKI B;  2TSS A;  2RF4 A;  1JR0 D;  1TWC H;  3HOY B;  3IFT A;  2ENB A;  3AEV A;  4XQN A;  2ASB A;  1Q12 A;  5IYC G;  2ES2 A;  2W6I A;  4ZUJ A;  1EWH A;  5C3X A;  5KGU A;  2DNC A;  1DOM A;  2QW7 A;  2QDX A;  4K1X A;  4J0Q A;  4RM0 A;  1F2Y A;  4DXF A;  4GNX A;  3FPU B;  4R4Q A;  1YJW B;  2BV3 A;  2LSS A;  3KDF A;  1PV4 A;  2OK7 A;  1O80 A;  5DM7 3;  4QVJ A;  1WTH D;  2VNJ A;  1E3X A;  3B82 A;  3IFD A;  4KY7 A;  3FKI G;  2BE5 D;  4P71 A;  3HOZ B;  1E7Z A;  1QUE A;  1YHQ A;  1L1O A;  3CCM B;  1TT2 A;  1VHO A;  1V1P B;  1X9N A;  1TS5 A;  4Q5V A;  5CV4 A;  5THX A;  1RD9 D;  3OYY A;  2L4N A;  4B3T Q;  2V7T A;  1SDF A;  2QA4 B;  1VF7 A;  3D6C A;  1HVX A;  1CKN B;  5CV9 A;  2IJ0 A;  1IHM A;  2JA6 B;  1M90 C;  2V4D A;  3CPX A;  1DXM A;  3L2P A;  4YXW A;  3S17 B;  2EY5 A;  1BQQ T;  1LAB A;  2LY7 A;  1C7Y A;  4B3M Q;  2IY5 B;  5ELN A;  1IBM L;  2EJF C;  1EUJ A;  2EYL A;  1E1T A;  3IL8 A;  3QJY A;  2D62 A;  2E8G A;  1H9S B;  3VO1 A;  3S14 H;  3BNW A;  2JA8 G;  2WPD A;  2XZL A;  4QUZ A;  3CC7 B;  3ND8 A;  2K05 A;  2E2I B;  4LNQ A;  4A3C G;  1KL9 A;  3MXN A;  4J15 A;  2PE3 A;  5M3M G;  3RNU A;  3VA5 A;  3VYR A;  3D8G A;  1FVI A;  2ZJQ A;  2F0K A;  3VNU A;  4IFD J;  2PMZ E;  1SE2 A;  3T51 B;  3M4Q A;  5DNF A;  1H95 A;  1TS2 A;  1E1O A;  5IYW A;  3A8K E;  3TME A;  1T5X D;  3NEL A;  3U9S A;  2L0C A;  1JWU D;  1TWG B;  1AW7 A;  2XNC A;  5C5L A;  3H0G B;  1I3Q B;  1HZA A;  2VQF Q;  1DDI A;  4YAF A;  1FRQ A;  1AE2 A;  1ZKO A;  3H3V I;  3OZW A;  3BZD B;  4ZKC B;  3BH4 A;  4QVA A;  5TY0 A;  2EFG A;  1UE1 A;  1XMQ L;  2DER A;  2PZT A;  1SXT A;  1RKN A;  3FHW A;  3I2Z A;  1GUG A;  3F2B A;  1JOR A;  2AHO A;  3KYH C;  1F9R A;  5CV8 A;  1T6X A;  3J7A 5;  1Q82 D;  4C0S A;  4LF4 Q;  2JXM B;  4LMQ D;  3SR1 A;  2HMA A;  4X8I A;  3HG9 A;  4OOS A;  4DGZ A;  4JI8 L;  1SYD A;  5LL6 S;  3R93 A;  3D4R A;  1D7Q A;  3J80 c;  1C0A A;  4A3B B;  1LTB D;  4B4D A;  4Z1M A;  5C6A A;  1VQI A;  4MTN A;  3PO3 H;  1Q8K A;  3NBH B;  2F4V L;  5JEA H;  4RCN A;  1VQF A;  3HFZ B;  3NUC A;  1R5O A;  2F0I A;  1E62 A;  4S3S A;  1Y8O B;  4UY8 C;  3S2D B;  2X6G A;  2D74 A;  3OE7 A;  2EXD A;  4A3J G;  2F0M A;  4K2L A;  4G4K A;  3CCV A;  3TS2 A;  2JN4 A;  5LMN L;  4LFC Q;  2ATW A;  4JBW A;  3D31 A;  2Q6O A;  1Y1W B;  2A69 C;  1E43 A;  1RQP A;  1TQO A;  2ZJP A;  2UUA Q;  2KCM A;  3PV0 A;  4LF7 Q;  3S24 A;  3BDO A;  4X66 Q;  3Q22 A;  3QFR A;  1D1I A;  1W2B A;  2QTZ A;  2QF7 A;  4ASU A;  3V2T A;  2CF4 A;  4DA2 A;  1L2F A;  2FHT A;  3U2Q A;  2NTS A;  1BCP F;  1GUN A;  3MC0 B;  3CCE A;  1VF5 C;  2E2J B;  2FX3 A;  4RHR A;  3M4O B;  2I1L A;  4RD0 A;  5EQ0 A;  3HOY G;  2LXK A;  3HGB A;  2VBU A;  1VQ8 B;  2DY8 A;  3UDG A;  2XEX A;  1L0Y B;  2FVG A;  4YCW A;  2F0O A;  2E2J H;  1YEZ A;  3ICE A;  1JCK B;  4QUF A;  3J80 L;  4DR2 L;  5ELB A;  1CFM A;  1HR0 L;  1QVF B;  1HQR D;  1OB0 A;  5K5P A;  2BDO A;  2CH4 A;  1EOT A;  4TT3 A;  3F2U A;  1ILQ A;  4QUC A;  5EKK A;  2RC6 A;  4C3I B;  1HR0 Q;  4OOX A;  1GJR A;  2Z4H A;  3CME A;  3HOW H;  1ELO A;  5L46 A;  1OXS C;  3PO2 G;  3PIP 3;  1PTO F;  1XB2 A;  2PQA B;  1YNN C;  4M1U B;  4CKB A;  1JE4 A;  2UUB Q;  1KK0 A;  5A88 A;  1EIF A;  1OHH A;  3VO2 A;  1HFN A;  1GO2 A;  1XTD A;  4ODG A;  2FFK B;  2R92 B;  1B1Z A;  3GO5 A;  1WVL A;  2DGY A;  4H02 A;  1T5E A;  4KLK A;  2PNR C;  5NUC A;  1AZP A;  1N8R D;  5IP9 G;  2QEJ C;  3J7A F;  3MEF A;  4M0L A;  2G9H D;  1SE4 A;  5E3F A;  1QWY A;  1VQA A;  3E0J A;  1I6V C;  2E76 C;  3LVB A;  4GOP A;  1PFN A;  1DM0 B;  1ICF B;  1G6Z A;  3GTJ H;  1XPR A;  5COY A;  3FMC A;  1F20 A;  2VNK A;  1AEX A;  2B2V C;  2E5L Q;  2N3S A;  4JI7 Q;  1EFW A;  2B8G A;  4A3B H;  2SEB D;  5M5X B;  1XFO A;  2XSC A;  1K83 B;  1YIT A;  3CCQ B;  1KDC A;  4G7H C;  3PO2 H;  3H6M A;  1EZ8 A;  2A68 C;  2KHJ A;  3HKZ G;  3HOV B;  2PQA A;  3RLF A;  3W5O A;  4G5G A;  2NVY H;  3H0G H;  5FO1 A;  2Y0S B;  4JI5 L;  1G7C A;  3OW2 B;  2B7C A;  1STB A;  5GV8 A;  1IW7 D;  4EQN A;  1KK1 A;  4C43 A;  4P72 A;  1X56 A;  4RD4 A;  1NB0 A;  4IUN A;  4K2K A;  3FKI H;  5JVH 3;  4A75 A;  1SFO B;  3HOU H;  2NVY B;  2A6H D;  3HOX G;  1GJX A;  5C4Z A;  4O42 A;  3HOW G;  3CHB D;  2D2C C;  2EYM A;  4X62 Q;  1K73 C;  1GM5 A;  4C56 C;  3JAM i;  1KTK A;  1LV9 A;  3CU7 A;  3ONY A;  1PYS B;  4FVM A;  4RJL A;  3U50 C;  2YYZ A;  4KK7 A;  1PRT B;  2CKZ B;  5JJZ A;  4B47 A;  3EQL C;  3EN2 A;  2KVO A;  1A6X A;  1PTO B;  5CV5 A;  4FN5 A;  2ICE C;  1H8H A;  1YBY A;  3N6R A;  5BR8 L;  4HIO A;  3GTJ B;  1KMH A;  1RQR A;  2N8N A;  2XWJ B;  3URY A;  3HEJ A;  2PPB C;  4K0K Q;  2X8K A;  2V31 A;  3BVM A;  5IGB A;  5JBQ A;  3AVX A;  4CQJ A;  1XPO A;  2G5D A;  1Y8P B;  2KEE A;  3K5M A;  4DAV A;  1JA0 A;  2WB1 G;  2B3G A;  5DSZ A;  3CC2 B;  3LWU A;  4A3I G;  2E74 C;  1I4Q A;  2UUB L;  1D1K A;  3PIO 3;  1Y1W G;  4II2 A;  5A2Q L;  4JBK A;  1R9T H;  1GVP A;  3CCV B;  1KLG D;  1VLO A;  1ENA A;  2EIX A;  3LNN A;  3WOE A;  4JI6 L;  2OYN A;  4JI4 L;  4QB4 A;  1Z47 A;  3T4A C;  3Q0A A;  1SMX A;  3VA7 A;  1VMP A;  1HZC A;  3GVJ A;  3S16 H;  5EPL A;  4B3M L;  4R9W A;  4RPB A;  4A3D B;  2Z6K A;  3SJP A;  1D2E A;  2VUM G;  3I8Z A;  2NN6 I;  2PI2 A;  4V0B A;  3SK8 A;  4FP5 D;  2IX1 A;  4H44 C;  4X65 L;  4GLA C;  4ZYS A;  1X3G A;  1VQB A;  2UU9 Q;  1SSO A;  1J9O A;  2BE5 C;  2BVN A;  4WJ4 A;  1IKM A;  2JYO A;  3R6J A;  3OP1 A;  4TVA B;  1O78 A;  3I55 B;  3AVT A;  4FF3 A;  4X64 L;  3GTP H;  4A3D G;  2NZH A;  4AC9 A;  4IQZ A;  4GN4 B;  2A8V A;  3RZO B;  3A35 A;  3GTK H;  4M1K A;  3BVZ A;  3FRP B;  1PYB A;  4NXN Q;  1UMK A;  2KCT A;  2XZO A;  1I8D A;  1EU4 A;  4I7Z C;  3GTQ B;  2OQK A;  2B63 G;  4II3 A;  1W34 A;  3K7A B;  2RC5 A;  4XLA A;  1X3F A;  1VQ4 A;  2IHF A;  3MTS A;  4NDX A;  3OKX A;  4DV5 L;  3ASQ A;  2KOL A;  3ZPN A;  2IT1 A;  2P5Z X;  3TSS A;  4XN3 A;  1N34 Q;  3HOU G;  2A69 D;  1BMF A;  4DAP A;  3CPW B;  2JQO A;  4DKA C;  3MXG A;  4DU9 A;  4GZY C;  1E3Z A;  4Q0F A;  1ZYR D;  3A54 A;  1B2R A;  1RTO A;  1IYJ B;  2D3N A;  4JW0 A;  1PLF A;  4WRD A;  3WWV A;  1PZI D;  3ZBT A;  1Q90 A;  2HUG A;  3OJW A;  3MFY A;  4OPO A;  1DDG A;  1LTL A;  1U4M A;  4TSS A;  3JAM E;  4XNF A;  5FLX c;  1TWF B;  3WNB A;  1B44 D;  2Z8L A;  3GV6 A;  4DV5 Q;  4IUV A;  1BX1 A;  1J8I A;  2R61 A;  3GTO H;  1CKN A;  1EYA A;  2X69 A;  4JI1 Q;  4XYO A;  2HIX A;  1ZEQ X;  4RD2 A;  1TR5 A;  2Z4I A;  1RHP A;  2R92 G;  1PXU A;  3QFC A;  4QY7 A;  1VQH A;  3BY1 A;  2Q2I A;  4DR1 Q;  1Q82 C;  1GVH A;  2CH4 W;  2R7Z B;  2WB1 E;  5E4W C;  2Q8I B;  5LMU L;  2PIA A;  2VQF L;  3KF8 B;  3CCJ A;  4YY3 Q;  1Y8N B;  1D1N A;  3A7L A;  3ZYY X;  4DUY L;  3I4N G;  4JPB W;  1CHQ D;  3G4S B;  2NV4 A;  2B2Y A;  2RCN A;  4OO1 H;  1CHP D;  2E5L L;  1SKQ A;  1V9P A;  4YIJ A;  5IK2 A;  2BGJ A;  1PRT F;  4QF4 A;  1N05 A;  1EIG A;  1WTQ A;  2B39 A;  5C3E H;  3I55 A;  2BGI A;  2EJM A;  1JWM D;  4V19 0;  3ERS X;  3BVG A;  4RGN A;  1Q1E A;  5JJK A;  1ZUN B;  5COR A;  4BBR G;  4DAY B;  2MNA A;  2VYQ A;  3A5U A;  1VQK B;  2C4T A;  1MGS A;  3QOL A;  1X3E A;  4F7D A;  3DEO A;  4POF A;  4YAW A;  3U58 A;  3K8A A;  4LF4 L;  2O4X A;  2FMM A;  3BZK A;  4GLV B;  2K33 A;  3ER0 A;  3EFX D;  4DK6 C;  5FJ8 H;  2MGS A;  2VXW A;  1HUM A;  5FLX L;  4BBS B;  3NEN A;  1J6Q A;  1GKH A;  3DXJ C;  3NHH A;  1FR3 A;  2WKD A;  4P1V A;  2QIL A;  1FJG Q;  2PMZ B;  2N49 A;  3V05 A;  3I56 B;  3C2P A;  1K83 H;  1PFB A;  1JA1 A;  1SFO H;  4XIG S;  2C77 A;  5HY6 A;  1WTX A;  2YWE A;  3CD6 A;  2CRV A;  1CSP A;  3K7U C;  4EH1 A;  2XTI A;  1SYE A;  4DAM A;  3WYA A;  3WY9 A;  4QCL A;  1HPC A;  1QUF A;  4WZE A;  2AQ2 B;  3DMU A;  3PQI A;  3RZD H;  4JI5 Q;  4XLH A;  3KUP A;  4JYA L;  4IUR A;  2X6L A;  3H3V C;  3MCA A;  4Z4Y A;  1YI2 A;  1IBL Q;  3U6B A;  4JK1 C;  4E0F A;  1KTV A;  2Q2T A;  3RZD B;  4LFB Q;  3S15 B;  2K5N A;  1HH2 P;  3S2D H;  4L5S A;  1TWA H;  3DWP A;  2EIF A;  4B3X A;  4I7A A;  4X64 Q;  2OTL B;  1QGY A;  1SR3 A;  4MYU A;  1V1P A;  1VQ7 B;  3K0X A;  2RQX A;  2F4N A;  4P9S A;  1HNX Q;  5C4J H;  3AQQ A;  1FGU A;  3PO3 G;  2GVB A;  1A15 A;  1RTN A;  1NDH A;  3PF5 A;  2ZTN A;  4BA2 I;  3IRB A;  4K5V A;  4Z4U A;  4X7E A;  2HDL A;  4EQ5 A;  4G7W A;  1MI2 A;  2DUD A;  2NVT H;  4ZCM A;  2WAQ G;  1YJW A;  2R7F A;  1KXL A;  4UAJ A;  4F88 A;  1DGS A;  2B2W C;  4UDU C;  4HTH A;  4A4I A;  4JI4 Q;  1I4G A;  1IBK Q;  4ACA A;  1WOO A;  3N52 A;  4XT1 B;  4DR1 L;  1LTR D;  1LAC A;  3F2D A;  3JQP A;  4EGV A;  3M85 A;  2YU9 B;  4TQU S;  1B53 A;  5CR3 A;  1FD7 D;  5KIX A;  3CQZ H;  3KF6 A;  1OXT A;  2MP1 A;  2UUC Q;  5DS0 A;  3WDN A;  5C5M A;  4FXG C;  1Q7Y D;  2N78 A;  1S72 B;  1EQT A;  2IPK D;  3BG3 A;  2K03 A;  2JA8 H;  2BH2 A;  1GOZ A;  4A3K G;  3M4O H;  1BQE A;  3SK4 A;  4OL7 A;  1OTC A;  3VYU A;  1DJR D;  2ZTC A;  3FJO A;  1Q46 A;  1XE1 A;  2WJY A;  1P8L A;  3CRK C;  5AJ3 Q;  1X55 A;  4XTC S;  3X3M A;  2YWG A;  4KN7 C;  1UD6 A;  3ZIA A;  2NWG A;  2NTT A;  5C0X H;  3I4O A;  2F03 A;  5IYD H;  1JOQ A;  2Y0S E;  4F87 A;  1W0K A;  4DK1 A;  3J80 i;  3TQY A;  1HZ9 A;  2DNE A;  3A8J E;  2F1M A;  3VR6 A;  1HTL D;  2ZXO A;  3OW2 A;  1KD1 C;  4DR4 L;  5FK9 C;  3J81 c;  1F2Z A;  4B08 A;  2ZJR A;  1MAB A;  2W6J A;  4CDD C;  2HCJ B;  1K8A C;  3OIQ A;  1OGI A;  3CME B;  1Q81 D;  3B78 A;  5A8A A;  1QG0 A;  3CTA A;  1FL0 A;  1YZ6 A;  1IL8 A;  1PHJ A;  2VB3 X;  1N33 Q;  1X32 A;  3S2H H;  4Z9C B;  4IOA A;  4R4C A;  1H85 A;  4PZ8 A;  4IAL A;  1LYL A;  3HS0 C;  1RIP A;  3CAM A;  1GR1 A;  4ZCL A;  2ZZG A;  1U4L A;  5GAH C;  1HNZ L;  2DEU A;  2VBS A;  3SKB A;  5F2D A;  4A3J H;  4G6I A;  4IOC A;  4OP7 A;  4H0L C;  2EYH A;  2O5I C;  2RSO A;  4QV2 A;  1QVG A;  3HOY H;  2WR8 A;  3V76 A;  1AH9 A;  4RLZ A;  2CW0 D;  4JI2 Q;  3KK7 A;  3CP8 A;  1EEF D;  1WP6 A;  2F4V Q;  3ULJ A;  2C4U A;  4UAI A;  1PTO H;  2KJX A;  2WJV A;  3KLW A;  1VQK A;  1QH0 A;  4IUP A;  1KDB A;  3NTH A;  4IZ8 A;  3I4N B;  4DV2 L;  3A3B A;  2DCU A;  1VQO B;  2VZA A;  4K5X A;  1WTH A;  1C4Q A;  3P1H A;  3HP3 A;  1XNQ Q;  3HKZ B;  3HOV G;  4OX9 Q;  2BDN A;  3QB3 A;  2EOT A;  2R7D A;  1FNU A;  4R8I A;  4KI0 A;  1STE A;  3M7G A;  5EPJ A;  5FKA C;  4JI0 L;  5HGT A;  2KCC A;  1PDQ A;  4DF7 A;  3CRL C;  1GAQ A;  1I4X A;  3Q8D A;  2CWA A;  5HKK A;  4A3M H;  3OZV A;  1VS0 A;  5E7N A;  4XD7 A;  1VLY A;  3GDE A;  4QIW E;  5IIF A;  5JJI A;  2Q8T A;  3HOX B;  3MHP A;  3K0Y A;  1N36 Q;  1KIX A;  1BKB A;  3KLR A;  1GXD C;  1J5E L;  4IN3 A;  3I3C A;  4LF9 Q;  2CW0 C;  1GAW A;  5G3L F;  1QJO A;  3GP7 A;  2UXD L;  3UE0 A;  1VQD A;  5C4X H;  5DM6 3;  1VMC A;  3JAM L;  3AGQ A;  3C46 A;  4A3E H;  5FO8 B;  3CCE B;  1YLO A;  1N8R C;  2SOB A;  1R4P B;  3G71 A;  3K58 A;  1U4P A;  2R93 H;  2PW7 A;  2UXC L;  1VQ5 A;  5GRO A;  4X7F A;  2R6G A;  3GTO B;  2K50 A;  3KFU A;  5ELE A;  4NXM L;  2BN4 A;  4HAE A;  4YAO A;  4BXX G;  1X3Q A;  1K28 D;  1D6E C;  1DYQ A;  2D0O A;  1E2V A;  2B2T C;  4M53 A;  5I6Y A;  1VQ6 A;  3S16 B;  2DET A;  2DY1 A;  5IGG A;  3TZU A;  2PZU A;  1CNE A;  5J35 A;  3G48 A;  1I50 B;  1NR4 A;  2HCC A;  1GD7 A;  1EXM A;  5IYB G;  2D9R A;  1S4Z A;  2KUM A;  4XQJ A;  5CC4 A;  5I9P A;  4JI2 L;  5IWA L;  1JNY A;  4NNJ A;  2R9V A;  3FVQ A;  1NB9 A;  2EY2 A;  2GJK A;  2JJ1 A;  1SNO A;  2QDL A;  5IYQ A;  4A93 G;  4JOI C;  3CP2 A;  1JB3 A;  1JC7 A;  5EBC A;  1E2Z A;  3NK9 A;  1BPL A;  5IE8 A;  1A0I A;  1W9X A;  3DWA A;  3CCR A;  1T9H A;  3U6K A;  3CPF A;  2SDF A;  4XR6 A;  4G57 A;  5KND A;  2O5J C;  4IUQ A;  1M90 D;  3ERO A;  3OMG A;  1WTO A;  5ELC A;  3SLN A;  3OTO L;  3QE2 A;  1E3P A;  1F9S A;  4KY6 A;  3CC7 A;  1H9R A;  1EL0 A;  3MEH A;  1G7R A;  1ONL A;  2ZT9 C;  3B8H A;  1ML0 D;  3CF5 A;  1S72 A;  4PGO A;  3NSW A; 
#chains in the Genus database with same CATH homology
 1H9K A;  4FF4 A;  2B2Y C;  4C3J G;  5DN6 A;  2K7V A;  2M00 A;  4IUT A;  2A6E C;  3SHL A;  2PO4 A;  1JIC A;  2Z1C A;  3D4W A;  4DFA A;  1KAB A;  3R2T A;  1SJE D;  2N55 A;  3SVM A;  2OF1 A;  2NVT B;  2Z6B D;  3OEE A;  3MHB A;  1M8A A;  5LL6 X;  2WP8 J;  1HUN A;  2F0L A;  1CK1 A;  4RKL A;  5T1G A;  5JEA J;  2AQ3 B;  2IW3 A;  1OO9 B;  1HA6 A;  4HMI A;  4X3K A;  3FPP A;  2SNM A;  1FGB D;  3ONA B;  2QE7 A;  2WIN B;  2XNA C;  4XN0 A;  1SBB B;  2OT2 A;  3AMU A;  4XOP A;  1QB5 D;  3MXU A;  4FO2 A;  5JOB A;  3P75 A;  2KVM A;  4FF2 A;  2LKV A;  2WZP P;  5AFW A;  2R93 B;  2ZZF A;  2XGJ A;  1VDZ A;  4RA8 A;  3NE5 B;  5TSS A;  2KEC A;  2LMC B;  1VJS A;  1EYD A;  3EA6 A;  3FKI B;  4WFN 3;  3KF8 A;  4K8I A;  3S9W A;  4ABN A;  4K5W A;  2NVX B;  3VR4 A;  1V43 A;  2EYP A;  3AU7 A;  4KD4 A;  3PUY A;  4XL9 A;  2E1B A;  3TDQ A;  4KMU C;  2EPB A;  2BA1 A;  4DAY A;  3GTK B;  5C0X J;  2TMP A;  2KHS A;  3E5S A;  1E2W A;  1W6J A;  5JPN C;  2PW5 A;  1KAA A;  1B4O A;  1STG A;  2F0J A;  4K14 A;  4NMZ A;  5M5Y B;  2C9O A;  4XMY A;  3S1N B;  3C1E A;  1UD3 A;  2EVB A;  5IT9 E;  1Z6H A;  3NWT A;  1GUS A;  4PMW A;  2GJR A;  4LK1 C;  1LTT D;  4P2C B;  1C8C A;  1SKY B;  1NRK A;  3ND9 A;  2I07 B;  4OO1 G;  2WAC A;  2EE1 A;  4NW2 A;  5D65 A;  3G05 A;  3A56 A;  2NVQ B;  3P7J A;  3BYY B;  5M3M B;  5K36 H;  2XZP A;  1TY2 A;  2LFN A;  2ZZE A;  3EJI A;  1SJH D;  1MD2 D;  5J39 A;  2RVL A;  2AUK A;  1EY7 A;  5I4D A;  4C3H B;  5C44 B;  3R3O A;  2CHB D;  1EY8 A;  1UD2 A;  1QE6 A;  2FMC A;  2EYF A;  5KYI A;  3OWF A;  4RKB A;  2JA5 B;  1F9Q A;  4HCS A;  4HED A;  5KNB A;  4IFD G;  4B9X A;  1WD1 A;  2E75 C;  1LT5 D;  2L12 A;  3S1R B;  2BOS A;  1O7Z A;  4AYB B;  4DN4 M;  2J7Z A;  2XWB B;  1NUC A;  3C1F A;  1B2T A;  3K5L A;  5IGE A;  5FL7 A;  4QIW B;  1SEB D;  3TP5 A;  4ILW A;  3EVQ A;  4X3S A;  1GHK A;  2F43 A;  1SYF A;  2A73 B;  3O13 A;  2SNS A;  5C4H A;  4KJO A;  4CJ0 B;  2HDM A;  1TKW B;  2G9D A;  2EY1 A;  1EY4 A;  4RCO A;  1DD2 A;  4DNR B;  1HQM C;  2RKS A;  1HA5 A;  1EZ6 A;  2WSS A;  5CMD A;  3Q23 A;  1BUV T;  1CM9 A;  3MZ5 A;  2F0H A;  1BNZ A;  2KQ3 A;  3TBI B;  1SMY D;  2F0Q A;  5JVG 3;  4TRD A;  4LAA A;  2F3V A;  2A6H C;  5IGC A;  3GTL B;  3SDZ A;  4TSF A;  2F0W A;  1A2U A;  3OSO A;  1SAP A;  3T56 B;  2XN9 C;  4J8Q A;  4RFB A;  4ZLT F;  1U9R A;  3NXW A;  2RA4 A;  4HR7 B;  5ISR A;  2AUJ D;  1MBY A;  5BN5 A;  1H9S A;  1G2S A;  1PTO D;  4ZK9 B;  1HCZ A;  1EY6 A;  1SYB A;  1DCZ A;  4ULL A;  2A68 D;  4XLE A;  5FOB B;  2XND A;  2D9U A;  4X3T A;  4CHT B;  4I65 A;  1AP0 A;  4B3G A;  4XKW A;  3NQI A;  1NSN S;  5I2X A;  1B9M A;  1MSG A;  3K57 A;  5CBA E;  1TWA B;  4K8J A;  4XOT A;  3NBH A;  4A3G B;  2LZJ A;  1SNC A;  2QDB A;  4KN4 C;  1V0E A;  2B2V A;  4F8M A;  3A7A B;  1A3U A;  1CTM A;  4IFD H;  1BCP C;  2NB0 A;  2X85 A;  1LT3 D;  3NP8 A;  2EYO A;  1UD5 A;  1LT6 D;  1CQF A;  5M9O A;  4HSV A;  1UEA B;  1D2B A;  4RGM A;  3DHQ A;  1EY9 A;  2QKI C;  2J0T D;  2K5Q A;  1K8M A;  2JSO A;  4KJN A;  3GQB A;  1KDA A;  1S5B D;  3T13 A;  1X3P A;  2VUM B;  1Y1V B;  3KEW A;  1QCB D;  2QCP X;  1DOK A;  3GV3 A;  1LTG D;  2BA0 A;  3K6O A;  1KLU D;  4ID6 A;  1EFI D;  1W0J A;  2WAQ B;  3D6W A;  2JJ2 A;  4C3J B;  1V1O A;  4O1N A;  4EQO A;  4XON A;  4XYQ A;  1STN A;  3T53 B;  1ZXT A;  1B50 A;  1STY A;  4MHE A;  1EWC A;  4KY5 A;  1A3T A;  5CV6 A;  1KNA A;  1Q8I A;  1R4Q B;  2ZXI A;  4YEJ A;  3W2D A;  3QWN A;  1U4R A;  2MPM A;  1WPC A;  2K04 A;  4H7B A;  2NYZ D;  4NP5 A;  5C4X B;  1CZW A;  2F3W A;  1HXY D;  4P22 A;  2B8F A;  5BN4 A;  2O2L D;  3OAA A;  1JOO A;  3A8I E;  2D3L A;  1HFG A;  1ESF A;  2XRS D;  3HOU B;  1WTP A;  2F0N A;  1GUO A;  1TVX A;  4Y7N B;  2K5D A;  1SNP A;  5JAV A;  1H9M A;  1V8Q A;  4BY7 B;  4DK0 A;  3NTI A;  1O7Y A;  2EZV A;  2CVR A;  4C1N I;  1FNW A;  2NZ1 D;  2IX0 A;  5CGK A;  4RWS C;  2B2T A;  3WOF A;  5JEA G;  1BR9 A;  1AN8 A;  3TP6 A;  1BCP B;  4XDX A;  2ICI A;  1PMR A;  4QMG A;  4HN7 A;  2J4X A;  4RGO S;  4HIZ A;  5C4J B;  2WV6 D;  3BDC A;  2L5T A;  1E0B A;  1WTV A;  4C1N K;  4RHS A;  4FXK C;  1NR2 A;  3TP8 A;  1A3V A;  2RSN A;  3SE0 A;  1Q3L A;  1HZE A;  1I18 A;  3J80 E;  1LTA D;  1G8Z D;  1BBX C;  3P20 A;  2I46 A;  2NBF A;  3MVV A;  1EY5 A;  3J81 L;  2JA7 B;  3ERQ A;  1QG7 A;  4KHZ A;  5I2Y A;  4PNY A;  5IT9 L;  1RF2 D;  5JPM C;  4C3H G;  3HRZ C;  5D3I B;  1ET6 A;  2GJP A;  2ZXP A;  3NBI A;  4KTA A;  4E6I A;  1EEI D;  4XLF A;  4WOR A;  2GK6 A;  4HMJ A;  1S5C D;  4GQN A;  1AFP A;  3A3G A;  3VR3 A;  2L9H A;  2K1B A;  1PRT C;  4J1M A;  1PFM A;  4OO1 I;  1GHJ A;  3SK5 A;  3M7N A;  3WQZ A;  2K6A A;  2EXZ A;  1SMY C;  3OPO A;  4JMQ A;  2JDI A;  4H13 C;  4EQP A;  3BDL A;  5EBD A;  3PO3 B;  2AWO A;  2NN6 G;  3GTG B;  1DOL A;  4OGQ C;  3U9O A;  4C3I G;  3I70 A;  2RBM A;  1UUP A;  4UZU A;  4U67 3;  1TY0 A;  2H1E A;  5IOC A;  2F0F A;  1Y69 U;  3H94 A;  4B9W A;  3GTM B;  1F2M A;  1VCI A;  4CGY B;  2B2W A;  1A2T A;  2FJ2 A;  2VB2 X;  1SNQ A;  3GD7 A;  2C5C A;  2FIN B;  2F0P A;  3CES A;  1WD0 A;  3IKJ A;  4K6D A;  4OIK A;  3DUZ A;  1IHZ A;  3I90 A;  1CZG A;  2F0D A;  1LTI D;  3L9A X;  2XOK A;  1YNJ D;  1ROD A;  1SND A;  1DZ1 A;  3LWE A;  5J22 A;  3X3N A;  1GUT A;  5I6W A;  5E4X A;  5CYU A;  1KNE A;  4DXG A;  2JP1 A;  3GVL A;  2MJ8 A;  2EJG C;  1QIL A;  2NN6 H;  3NWS A;  3S14 B;  4ZUI A;  2B2U C;  1RCV D;  1FX0 A;  2DIE A;  2X6X A;  3E6Z X;  1EU3 A;  3OEH A;  4F7X A;  3KLS X;  2KED A;  1JWS D;  2K28 A;  1ET9 A;  4KKT A;  1NBM A;  2F0T A;  2A74 C;  1R9T B;  1EIH A;  1WCM B;  3BS1 A;  2XVS A;  2F0E A;  3I91 A;  2WB1 B;  1E79 A;  2R3Z A;  3HOW B;  1PYW D;  4BY1 B;  3OOC A;  1YNJ C;  1XXG A;  3VYS A;  4K6L A;  5FO7 B;  4XXE A;  3DDY A;  4XQQ A;  5A35 A;  5KRU A;  2D5D A;  5M5W B;  1D5X C;  1UD4 A;  1F2L A;  3TZD A;  4ZAI A;  2F4I A;  5FLX E;  1H9J A;  4U68 A;  3FDT A;  1LTS D;  3FKS A;  4WJW A;  4TKO B;  1EY0 A;  2PCF B;  5DEH A;  2DN8 A;  5D3D A;  1BOS A;  3TP7 A;  2B63 B;  3RMH A;  3Q6S A;  5CDF A;  1TII D;  2AWN A;  1O7L A;  3OHX C;  5HUR A;  4ZRZ A;  2JEA I;  2K01 A;  4L8J A;  3S2H B;  1EYC A;  4A3E B;  1STA A;  5BN3 A;  3I72 A;  5IGD A;  5I9O A;  3IAY A;  3C3L A;  4KHV A;  2OEO A;  1LO5 D;  1E1Q A;  2EYJ A;  3GVK A;  2Q8R E;  2EY6 A;  1LT4 D;  1TS4 A;  5G3L D;  3K5O A;  3QO2 A;  2V7Q A;  2IL8 A;  3J7A V;  5KYL A;  4MN3 A;  3SXH A;  1CQV A;  4XLC A;  4R8N A;  1CT1 D;  3BCD A;  3L7Z C;  4BS9 A;  4PMC A;  5CV7 A;  4ME5 A;  1KZL A;  4YEL A;  1BDO A;  4AVZ A;  2L55 A;  2NUC A;  4OIJ A;  2X53 S;  4PMB A;  1G91 A;  1GUW A;  3MAQ A;  1I6H B;  3MXP A;  3OIP A;  1TWC B;  2M2L A;  2GK7 A;  3NPP A;  4IFD I;  3AB9 A;  4RAU C;  4ZQ3 A;  1M4V A;  1ILP A;  1JOK A;  2F0G A;  4HSP A;  3HAG A;  2F0V A;  1BLI A;  3BC9 A;  1TWH B;  1DON A;  1JQY D;  1CA5 A;  4FXU A;  3PUW A;  4HCE A;  2CQA A;  4OHJ A;  3MFG A;  3D4D A;  3ITP A;  3PUZ A;  3LX0 A;  1MSH A;  1E1R A;  2K5W A;  2JIZ A;  4XKV A;  3M3Y B;  2X6Y A;  4MIU A;  5M3F B;  4BBR B;  1D5M C;  1OXU A;  4CJ2 C;  2ID0 A;  1ICW A;  2IX3 A;  4B3F X;  1ENC A;  1S5F D;  5A2Q E;  1EQV A;  5FO9 B;  4IUU A;  1I4R A;  3VR5 A;  3DWQ A;  2JE6 I;  5C0X I;  4BWG B;  1XYI A;  1NCV A;  2LS0 1;  3RUZ A;  1G29 1;  2E2D C;  3DEP A;  3KBX A;  5EJW A;  1SYG A;  4A93 B;  1CI3 M;  2RDH A;  1Q1B A;  1C48 A;  4A3F B;  1TS3 A;  3CMM A;  2DY7 A;  5C3E B;  4X3U A;  1AZQ A;  3Q24 A;  4CBV A;  4KKS A;  4LJZ C;  4PV1 C;  2E2H B;  3QIA A;  1LLR D;  5E1F A;  3QOJ A;  4C2M B;  2WII B;  4XOR A;  1SNM A;  5IOD A;  4A3K B;  1IKL A;  1S5E D;  5KNC A;  1IYU A;  5DAU A;  1NAP A;  2MUY A;  1QOH A;  2VJJ A;  4A3J B;  5T1I A;  1I4P A;  2B2U A;  2A6E D;  4NKL A;  1I4H A;  4KD3 A;  3K59 A;  2AQ1 B;  2KCN A;  2ZZQ A;  2F0S A;  3M4Y A;  2XRQ D;  2WKC A;  1IW7 C;  3A55 A;  3DM1 A;  3I4L A;  2MHV A;  3H09 A;  2EDG A;  4BA1 I;  1UAP A;  1G2T A;  1RJT A;  4FNF A;  5ELD A;  1TU2 B;  3OW7 A;  3SK6 A;  4J6H A;  1BCP D;  5D14 A;  2RDG A;  4G7Z C;  2HLD A;  4A3M B;  4RGT A;  1HRJ A;  3J81 E;  1Z7T A;  1WTW A;  4CKC A;  1B3A A;  1PKV A;  1IYV A;  3UI2 A;  3MA2 B;  2XIW A;  1XWE A;  2PQE A;  4XQF A;  4DNT B;  1F9P A;  3GTP B;  1ENF A;  5IGF A;  1HTP A;  4N9P A;  1BXT A;  5LHY 1;  3PO2 B;  1PTO C;  2ZXR A;  2RDF A;  3JU4 A;  3VYT A;  1SE3 A;  2N88 A;  5ELF A;  1RDP D;  1PZK D;  4EVO A;  2M9V A;  1S5D D;  3PUX A;  3CQZ B;  5EGT A;  1YNN D;  3W3A A;  1SYC A;  3FEW X;  1QNK A;  3TN2 A;  3T16 A;  5C3W A;  3G6J B;  3OWE B;  3J7Y W;  3HZX A;  4L63 B;  4G7O C;  2KA7 A;  3H91 A;  2L1B A;  3L3O C;  3BCF A;  4FXD A;  3OFN A;  3VR2 A;  5C0X G;  1QNU A;  4N9T A;  1CA6 A;  5CBE E;  1UNS A;  2CK3 A;  1F77 A;  1FYC A;  2PZW A;  1OXV A;  1ESR A;  1UD8 A;  4CJ1 B;  2VJI A;  2ZTG A;  5J1Z A;  1ZYR C;  3OMC A;  2HCI A;  1FNV A;  4KV6 A;  4KKU A;  2JA8 B;  4XT3 B;  2F0U A;  3RD4 A;  1K8O A;  1XTC D;  2H4O A;  1D5Z C;  4CKE A;  1WTR A;  2L11 A;  2M5S A;  2OXP A;  3S1Q B;  1HHV A;  3QG1 A;  2K32 A;  4M8A A;  5EPK A;  4A3I B;  5KEE A;  2BCO A;  1XX8 A;  2A5H A;  3PUV A;  1EFR A;  1V0F A;  3S1M B;  4L6T B;  4PQX A;  2VNU D;  5EKL A;  3K5N A;  3PMF A;  3R8B A;  3MWY W;  1STH A;  1B9N A;  3D3R A;  5KNL A;  3KBG A;  5K36 G;  1OXX K;  2GA4 B;  1PRT D;  5EKI A;  3SEB A;  1H8E A;  4G7X A;  3I73 A;  1W6K A;  4FYD A;  1L0X B;  2HQE A;  3KLS A;  3G7L A;  4ZKB B;  2IWH A;  1COW A;  1II3 A;  3BYT B;  2X6W A;  2JEB I;  4XM3 A;  1PZJ D;  3V96 A;  3I4M B;  4FF1 A;  2ZXH A;  1BF4 A;  3NQT A;  4RH6 A;  3R2I A;  2PYK A;  1BO0 A;  3NTK A;  3CKI B;  2TSS A;  1JR0 D;  3HOY B;  3IFT A;  2ENB A;  4XQN A;  1Q12 A;  2W6I A;  4ZUJ A;  1EWH A;  5C3X A;  5KGU A;  2DNC A;  1DOM A;  1F2Y A;  4DXF A;  3FPU B;  1O80 A;  5DM7 3;  1WTH D;  1E3X A;  3IFD A;  4KY7 A;  2BE5 D;  3HOZ B;  1TT2 A;  1V1P B;  1TS5 A;  4Q5V A;  5CV4 A;  1RD9 D;  2L4N A;  1SDF A;  1VF7 A;  3D6C A;  1HVX A;  5CV9 A;  2IJ0 A;  2JA6 B;  2V4D A;  1DXM A;  4YXW A;  3S17 B;  2EY5 A;  1BQQ T;  1LAB A;  2LY7 A;  2EJF C;  2EYL A;  3IL8 A;  3QJY A;  2D62 A;  1H9S B;  2WPD A;  2XZL A;  3ND8 A;  2K05 A;  2E2I B;  3MXN A;  3VA5 A;  3VYR A;  3D8G A;  2F0K A;  4IFD J;  1SE2 A;  3T51 B;  5DNF A;  1TS2 A;  3TME A;  3A8K E;  1T5X D;  3U9S A;  2L0C A;  1JWU D;  1TWG B;  1AW7 A;  5C5L A;  3H0G B;  1I3Q B;  1ZKO A;  3BZD B;  4ZKC B;  3BH4 A;  2PZT A;  1SXT A;  1RKN A;  1GUG A;  1JOR A;  1F9R A;  5CV8 A;  2JXM B;  4LMQ D;  3SR1 A;  3HG9 A;  4DGZ A;  1SYD A;  5LL6 S;  3R93 A;  3D4R A;  4A3B B;  1LTB D;  4Z1M A;  5C6A A;  5JEA H;  4RCN A;  3NUC A;  2F0I A;  4S3S A;  1Y8O B;  3S2D B;  2X6G A;  3OE7 A;  2F0M A;  4K2L A;  4G4K A;  4JBW A;  3D31 A;  1Y1W B;  2A69 C;  1E43 A;  1TQO A;  3PV0 A;  3BDO A;  3Q22 A;  1D1I A;  2QF7 A;  4ASU A;  3V2T A;  4DA2 A;  2FHT A;  2NTS A;  1BCP F;  1GUN A;  3MC0 B;  1VF5 C;  2E2J B;  4RHR A;  3M4O B;  5EQ0 A;  3HGB A;  2DY8 A;  1L0Y B;  2F0O A;  1JCK B;  4QUF A;  3J80 L;  5ELB A;  1CFM A;  1HQR D;  1OB0 A;  5K5P A;  2BDO A;  1EOT A;  4TT3 A;  3F2U A;  1ILQ A;  5EKK A;  4C3I B;  4QUC A;  2Z4H A;  1OXS C;  3PIP 3;  1PTO F;  4M1U B;  1YNN C;  4CKB A;  1JE4 A;  1OHH A;  1HFN A;  4ODG A;  2FFK B;  2R92 B;  1B1Z A;  3GO5 A;  1WVL A;  1T5E A;  2PNR C;  5NUC A;  1AZP A;  2QEJ C;  3J7A F;  2G9H D;  1SE4 A;  5E3F A;  1QWY A;  3E0J A;  1I6V C;  2E76 C;  1PFN A;  1DM0 B;  1G6Z A;  5COY A;  3FMC A;  1AEX A;  2B2V C;  2B8G A;  2SEB D;  5M5X B;  2XSC A;  1K83 B;  1KDC A;  4G7H C;  3H6M A;  1EZ8 A;  2A68 C;  3HOV B;  3RLF A;  2Y0S B;  1STB A;  1IW7 D;  4EQN A;  4IUN A;  4K2K A;  5JVH 3;  1SFO B;  2NVY B;  2A6H D;  1GJX A;  5C4Z A;  4O42 A;  3CHB D;  2D2C C;  2EYM A;  4C56 C;  1KTK A;  1LV9 A;  3CU7 A;  4FVM A;  2YYZ A;  4KK7 A;  1PRT B;  5JJZ A;  3EQL C;  2KVO A;  1A6X A;  1PTO B;  5CV5 A;  2ICE C;  1H8H A;  3N6R A;  3GTJ B;  1KMH A;  2XWJ B;  3URY A;  2PPB C;  3HEJ A;  2X8K A;  2V31 A;  3BVM A;  5IGB A;  1Y8P B;  2KEE A;  3K5M A;  4DAV A;  3LWU A;  2E74 C;  1I4Q A;  1D1K A;  3PIO 3;  4II2 A;  5A2Q L;  1KLG D;  1ENA A;  3LNN A;  3WOE A;  4QB4 A;  1Z47 A;  3T4A C;  3Q0A A;  3VA7 A;  1VMP A;  3GVJ A;  5EPL A;  4R9W A;  4A3D B;  3I8Z A;  2NN6 I;  4V0B A;  3SK8 A;  4FP5 D;  2IX1 A;  4H44 C;  4ZYS A;  1SSO A;  1J9O A;  2BE5 C;  1IKM A;  2JYO A;  1O78 A;  4FF3 A;  4IQZ A;  3RZO B;  3A35 A;  3BVZ A;  3FRP B;  2XZO A;  1I8D A;  1EU4 A;  4I7Z C;  3GTQ B;  4II3 A;  3K7A B;  4XLA A;  3MTS A;  4NDX A;  2KOL A;  3ZPN A;  2IT1 A;  3TSS A;  4XN3 A;  2A69 D;  1BMF A;  4DAP A;  3MXG A;  4DU9 A;  4GZY C;  1E3Z A;  4Q0F A;  1ZYR D;  3A54 A;  1RTO A;  2D3N A;  1PLF A;  4WRD A;  1PZI D;  1Q90 A;  2HUG A;  3MFY A;  1U4M A;  4TSS A;  3JAM E;  4XNF A;  1TWF B;  1B44 D;  2Z8L A;  3GV6 A;  4IUV A;  1J8I A;  2R61 A;  1EYA A;  2X69 A;  4XYO A;  1ZEQ X;  1TR5 A;  2Z4I A;  1RHP A;  1PXU A;  2R7Z B;  5E4W C;  2Q8I B;  1Y8N B;  3A7L A;  3ZYY X;  1CHQ D;  2B2Y A;  4OO1 H;  1CHP D;  4YIJ A;  5IK2 A;  4QF4 A;  1PRT F;  1EIG A;  1WTQ A;  2B39 A;  2EJM A;  1JWM D;  4V19 0;  3BVG A;  4RGN A;  1Q1E A;  5COR A;  3QOL A;  1MGS A;  3DEO A;  2O4X A;  2FMM A;  2K33 A;  3EFX D;  2MGS A;  2VXW A;  1HUM A;  5FLX L;  4BBS B;  3NHH A;  3DXJ C;  1FR3 A;  2WKD A;  2QIL A;  2PMZ B;  3V05 A;  3C2P A;  1PFB A;  4XIG S;  1WTX A;  1SYE A;  4QCL A;  1HPC A;  3DMU A;  2AQ2 B;  4XLH A;  3KUP A;  4IUR A;  2X6L A;  3H3V C;  4JK1 C;  4E0F A;  3RZD B;  3S15 B;  3DWP A;  1V1P A;  2RQX A;  1A15 A;  1RTN A;  2ZTN A;  4BA2 I;  4K5V A;  2HDL A;  4G7W A;  1MI2 A;  4F88 A;  2B2W C;  4UDU C;  4HTH A;  1I4G A;  4XT1 B;  3N52 A;  1LTR D;  1LAC A;  4EGV A;  3M85 A;  2YU9 B;  4TQU S;  1B53 A;  5CR3 A;  1FD7 D;  5KIX A;  1OXT A;  2MP1 A;  3WDN A;  5C5M A;  4FXG C;  1EQT A;  2IPK D;  3BG3 A;  2K03 A;  1GOZ A;  3SK4 A;  4OL7 A;  3VYU A;  1DJR D;  2WJY A;  3CRK C;  4XTC S;  3X3M A;  4KN7 C;  1UD6 A;  3ZIA A;  2NWG A;  2NTT A;  5C0X H;  2F03 A;  1JOQ A;  4F87 A;  1W0K A;  4DK1 A;  2DNE A;  3A8J E;  2F1M A;  3VR6 A;  1HTL D;  2ZXO A;  5FK9 C;  1F2Z A;  4B08 A;  1MAB A;  2W6J A;  3OIQ A;  1IL8 A;  2VB3 X;  1X32 A;  4Z9C B;  4IAL A;  3HS0 C;  1U4L A;  2ZZG A;  5F2D A;  4G6I A;  4H0L C;  2EYH A;  2O5I C;  2RSO A;  2CW0 D;  3KK7 A;  3CP8 A;  1EEF D;  1WP6 A;  4UAI A;  1PTO H;  2KJX A;  2WJV A;  4IUP A;  1KDB A;  3NTH A;  4IZ8 A;  3I4N B;  3A3B A;  4K5X A;  1C4Q A;  3P1H A;  3HP3 A;  3HKZ B;  2BDN A;  3QB3 A;  2EOT A;  1FNU A;  4R8I A;  4KI0 A;  1STE A;  3M7G A;  5EPJ A;  5FKA C;  5HGT A;  2KCC A;  1PDQ A;  4DF7 A;  3CRL C;  1I4X A;  5HKK A;  4XD7 A;  1VLY A;  5IIF A;  2Q8T A;  3HOX B;  3K0Y A;  3KLR A;  1GXD C;  4IN3 A;  3I3C A;  2CW0 C;  5G3L F;  1QJO A;  3GP7 A;  5DM6 3;  1VMC A;  3JAM L;  3C46 A;  5FO8 B;  2SOB A;  1R4P B;  3K58 A;  1U4P A;  2PW7 A;  2R6G A;  3GTO B;  5ELE A;  4HAE A;  1X3Q A;  1K28 D;  1D6E C;  1DYQ A;  1E2V A;  2B2T C;  5I6Y A;  3S16 B;  5IGG A;  3TZU A;  2PZU A;  1I50 B;  1NR4 A;  2HCC A;  1S4Z A;  2KUM A;  4XQJ A;  5CC4 A;  5I9P A;  4NNJ A;  2R9V A;  3FVQ A;  2EY2 A;  2GJK A;  2JJ1 A;  1SNO A;  3CP2 A;  1JB3 A;  1JC7 A;  5EBC A;  1E2Z A;  3NK9 A;  1BPL A;  1W9X A;  3DWA A;  2SDF A;  4XR6 A;  4G57 A;  5KND A;  2O5J C;  4IUQ A;  3ERO A;  3OMG A;  1WTO A;  5ELC A;  1F9S A;  4KY6 A;  1H9R A;  1EL0 A;  3MEH A;  1ONL A;  2ZT9 C;  1ML0 D;  3NSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...