3H94A

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 39
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3h94A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h94A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3h94A01
1CTMA 2YYZA 4JBWA 4KMUC 3WDNA 1H9SB 3H94A 1LABA 2E75C 3VR4A 3NE5B 2DNEA 2D62A 3M4YA 1T5EA 2AUJD 3A8KE 1IYUA 1OXTA 3I73A 3QIAA 2ZT9C 2AUKA 1BDOA 3SE0A 2DNCA 2JEBI 3T53B 4RCNA 3T51B 2A69D 1Y69U 2EJFC 4LJZC 1H9SA 2A6HD 3I72A 2A68C 2PCFB 4DNRB 4TQUS 1OXUA 1OXXK 2E76C 3IFTA 5BN4A 2BA1A 3LWUA 2DN8A 3CRKC 5C0XG 1GUSA 1Y8OB 1ZYRC 2Q8IB 4TKOB 2EDGA 1VF7A 1Q1BA 1VF5C 3T56B 1B9NA 1HQMC 2E74C 4JK1C 3VA7A 3GD7A 3VR6A 1Y8NB 2IT1A 3PUXA 2A69C 3TZUA 2F1MA 4HR7B 1K8MA 2A6HC 2B8FA 2K7VA 3M85A 5K36H 1Q12A 1LACA 4DK0A 3GQBA 1EWHA 1DD2A 3RLFA 1HCZA 2KCCA 4PV1C 3AB9A 4XIGS 5BN5A 2PPBC 1SMYC 1A6XA 4L8JA 3OPOA 3PUYA 2JE6I 4DK1A 2QF7A 1Z7TA 3P20A 3BG3A 1GUNA 3A7LA 1GUGA 1HTPA 2KA7A 1PMRA 2CW0C 1B9MA 4KI0A 4G7OC 1K8OA 1V8QA 1GHKA 4KKTA 3PV0A 4XTCS 4KKSA 1ZKOA 5KNBA 2K32A 2R6GA 4G7HC 3FPPA 1I6VC 3W3AA 1CI3M 1H9RA 2A6ED 1G291 2D2CC 5JEAH 3OOCA 1OXSC 1GUTA 3LNNA 4DNTB 5A35A 5K36G 2BA0A 4LK1C 3KLRA 1Q1EA 3DXJC 3A8JE 2BE5D 3I4LA 3FMCA 3A8IE 2O5JC 1DCZA 1H9KA 1V43A 4KHZA 1E2ZA 3QG1A 2V4DA 3M7NA 2B8GA 2EJMA 3L7ZC 3ND9A 1IW7D 1OXVA 2LMCB 3QJYA 4I7ZC 5BN3A 1FYCA 1E2VA 4KN7C 1Q90A 3PUZA 3VR3A 1CFMA 2PNRC 3PUWA 2A6EC 1TKWB 1H9JA 4OO1G 1E2WA 2K33A 5KNCA 5KNDA 2BDOA 3VR2A 1HPCA 4G7ZC 4OO1H 1GUOA 4GZYC 2BE5C 3A7AB 1TU2B 1YNJC 3D31A 1YNNC 5JEAG 1H9MA 1QJOA 1Y8PB 1O78A 3HGBA 3MXUA 3OW7A 1FR3A 1ONLA 3SDZA 4KKUA 3U9SA 1Z6HA 4BA1I 1IYVA 1GHJA 2JEAI 1IW7C 3CRLC 2O5IC 4H0LC 2NN6G 4IQZA 1VDZA 4OGQC 3ND8A 3D4RA 4H44C 4IFDG 1DXMA 2EVBA 2NN6H 2L5TA 2AWOA 2EJGC 3IKJA 3N6RA 4IFDH 2JXMB 3BDOA 1GJXA 3VR5A 2NN6I 3PUVA 1VCIA 1O7LA 4BA2I 2D5DA 3EQLC 5C0XH 4KN4C 4H13C 2A68D 3MFYA
chains in the Genus database with same CATH superfamily
1BCPF 3SJZA 3NBHB 2XWBB 1STNA 2K52A 5J22A 4P6VF 1K9MC 3M7GA 1CSQA 1XWEA 2X6GA 5DLQE 1NNXA 4A3EG 1L2FA 2HMAA 3Q39A 2XVSA 3TN2A 2DNCA 2PQEA 3V76A 3BYTB 3MEHA 4TMZA 3P26A 4NPSA 2C5HA 3HOYB 3Q24A 2RC5A 3HOZB 1QNKA 3U4VA 3OZWA 4K5WA 4U9UA 1VQ6B 3NEMA 3LWUA 4J1MA 1A3VA 4A76A 2F4NA 1EWCA 1VF7A 1PTOB 1C7YA 1SE3A 3D4WA 3C2QA 2XZLA 2F0PA 1DOMA 1TTTA 1VQ6A 5EQ0A 3TZUA 1YIJB 4DAVA 4B3MQ 2XEXA 5DAUA 4OHJA 1G51A 4JI2Q 2DOGA 3CCSB 2B39A 3GDEA 4K2LA 3SEJA 1N9WA 2ZZEA 2DJFC 1PYSB 4N3GA 4P74A 1YIJA 1DYQA 2IW3A 1YJWB 1R4QB 2Q2UA 3E0JA 2KA7A 3CCEA 1W9XA 4OIJA 3CCSA 4DV3Q 5C0XJ 1EU3A 3A5ZB 1QE6A 2AQ3B 4AC9A 1JB7A 1YJWA 3HOYH 3R6JA 3F1ZA 5T1IA 5FLXL 3CC7A 3HOZH 2IY5B 3HOUB 1W6KA 2BE5D 2RSOA 3H09A 4U68A 3H9NA 5IYQA 1PTOH 4DKAC 4YY3Q 3RNUA 3I4MB 2L12A 2PIAA 1EY8A 2R7DA 4JPBW 3TSSA 3M7NA 2XZPA 2B8GA 3G71A 1N33L 5BN3A 4B44A 3VR3A 1FNMA 5AJ3Q 4QQBX 2NBFA 1E2WA 5EKIA 1ZEQX 5GAHC 4LF9Q 3VYSA 5C4HA 5CV8A 4B9WA 4OO1H 1GUOA 4YAUA 2XSCA 2OTLB 5D3DA 2Z4HA 4RWSC 2VQEQ 3SDZA 4PMWA 1DDGA 2WB1E 2B29A 2F0LA 4MYTA 1GHJA 1NAPA 2DERA 3HP3A 1HFNA 1M8AA 4K5VA 2OTLA 1CZGA 4QHYA 4DK6C 4GNXB 2TMPA 3J80i 3N6RA 3IKJA 1PRTB 1GD7A 1BMFA 4V0BA 5KYLA 3CPFA 2VXWA 5C4JB 3EQLC 3PIO3 3AVYA 4JYAL 4ULLA 4GNXA 4FK8A 1K28A 3ULPA 1X9NA 2K5HA 3K59A 2F4VQ 1WCMG 3I56B 2WIIB 4APVA 2JK8A 1PH5A 5M3MH 3FVQA 4DAYA 5CMDA 1BO0A 1L0XB 5E3FA 1RCVD 3S2DB 1TS5A 4ODGA 3W2HA 4RGNA 1QGAA 2HCJB 5C44G 3I56A 2VS1A 4X3UA 5CR3A 1V9PA 3PUNA 5FL7A 3OAAA 4AYBB 5BN4A 2BGJA 1FGUA 4P71A 3HOWG 1ZYRC 1Y1WB 2EZVA 2EDGA 4CJ1B 2ZTNA 2WV6D 2GJRA 1UMKA 1EZ6A 5IGFA 2EIFA 3VYUA 4EQNA 3TDQA 3Q23A 5JPNC 2MP1A 2ZL7A 1PH1A 4QL5A 1K8MA 4B3ML 1CSPA 4JI2L 4BY1G 1N07A 3NHHA 1JWMD 3W2DA 2NVXB 2JN9A 2EYFA 4OIKA 1KD1D 1JT8A 3BVZA 3ZZUA 1CKMA 4XONA 3RY8A 2PI2E 5IYCG 1TIID 1BF4A 4DV3L 2YV5A 5JJLA 4GN5A 1PMRA 2NWGA 1WPCA 5DEHA 1MKHA 2B63H 2H5XA 4DR6Q 3CP8A 4A3LG 3DWQA 1J5EL 5CBAE 4TN1A 3RN5A 1CM9A 2I46A 2ICEC 1S4ZA 1W2BB 3LNNA 1OO9B 5K36G 3D6CA 3C3LA 2CH4A 3NPPA 2GA4B 3NWSA 2QA4B 3A8IE 1Y1WH 3KFUA 3NSWA 4YY3L 4KY7A 4A3KG 2I5MX 3J81E 3UDGA 5A2QL 2ID0A 3T4AC 1V5VA 3DLLA 4NXMQ 2NYZD 3CRZA 3DM1A 4YELA 3DEPA 1W2BA 3ASPA 3AVUA 3WXMA 1NE3A 1QUEA 4BBSB 5AJ3L 4Z4UA 4AH6A 5IGBA 3HAGA 3R2TA 4LF9L 4G7WA 3TBIB 1K8AD 3PIPA 3OFNA 5CV5A 4ME5A 5F4JA 1VQEA 5C3WA 2C4UA 3K7AB 2DGYA 2B7BA 1YNNC 2XRQD 2KCMA 2K04A 2VQEL 4KY5A 1GJRA 4OP7A 2EY2A 4JW0A 1WTRA 3TP8A 3ND8A 2JYOA 3IFDA 3QOJA 3ONAB 1VQBA 1G2SA 1WOPA 1IXRA 3D3RA 3ZYYX 1JB9A 5THXA 2V7XA 1R5BA 1VQPA 2YWGA 1YHAA 4OEMB 2Z1CA 4ZLTF 1QCBD 1YNXA 2EYPA 3HOVG 4ACAA 1BCPB 1MIUA 4A3IG 2L55A 1HRJA 2F4VL 4K8JA 5HGTA 2QDBA 4PMBA 3BZKA 4M0LA 3I7FA 4JI1Q 1V1QA 3DHQA 3VR4A 2B5OA 1RTNA 1S3OA 4K5XA 5FIUA 1YHQB 2WACA 4A3EH 5FLMG 4RDLA 4X7FA 4XM3A 2EY6A 3K7AH 1VQHA 4UZUA 4XQNA 2VL6A 4GLAC 3IFTA 1E79A 1STEA 5ELDA 3BNWA 1NB0A 1PZJD 4JBKA 4A3JB 1KLUD 5A88A 1SFOB 5EPKA 4Q5VA 5HZAA 4X64Q 1QVGA 1KHIA 2B2YA 4BY7B 1FRQA 2F0UA 1Y8NB 3CCJA 3KF8B 3ZZ0A 3S1QH 2R7ZB 3RMHA 2L1BA 5H1SE 1HZ9A 1QILA 2KCCA 4XIGS 2F0TA 5BN5A 4JI5L 4YAOA 1QVFB 3PUYA 5EAYA 3CMAA 4HIMA 5IGCA 4MYUA 3VO2A 1KDCA 2N3SA 4DAPA 4DR6L 2PLFA 3S14B 4G7OC 1L1OB 2JA6B 2IL8A 5HURA 1N8RD 4XQFA 1Q8IA 1K3RA 1BX1A 1JOKA 3SGIA 3JU4A 4HIKA 3F8TA 4G7XA 3NTKA 1VQKB 5JBQA 1L1OA 2F0QA 3PSIA 3BCDA 5TY0A 3H3VH 4RPBA 1HUNA 4L6TB 4NXML 3LO8A 1E22A 5KGUA 1SFOH 2Q6OA 4A3DB 1K8AC 3GTOH 1E2ZA 1WD0A 1SE4A 1QG0A 4EGVA 1Q82C 4WWVA 3W5OA 2KHIA 2DEUA 4KK7A 4J0QA 1KABA 2LXKA 3K58A 1IBKQ 2QGGA 1TWCB 5EBDA 1NUCA 3PIP3 3M4OB 2X69A 1BBWA 3A7AB 4B3TQ 4WFN3 1O78A 2VUMB 2VW9A 3B78A 4KKUA 1Z6HA 3SK8A 1RTOA 1SYFA 2JEAI 2NVXH 1G7CA 3S14H 2OCEA 2BMWA 2C9OA 1TQOA 2F0HA 4RG1A 4EH1A 3G7LA 5FO1A 1T6XA 1HZBA 1AE2A 1CA6A 5GV7A 2CNDA 1WTQA 1SE2A 2JJQA 4QFMA 1VQ8A 5IODA 1KTKA 1DGSA 4IUVA 3UE1A 1AH9A 4DR7Q 1JJ2B 1LT4D 2WB1B 5JPMC 5C0XH 1X3FA 2E2JB 2J4XA 1FJGQ 1AP0A 4JI1L 1PVOA 1U4RA 1KZLA 3LQ6A 2ZM6Q 4POGA 3R8BA 3NE5B 3ZC3A 1W6JA 4NXNQ 3M4YA 1TLLA 1IJEA 3HKSA 1TWCH 2WAQG 4IOCA 3OJXA 1E63A 4HJ9A 4JI3Q 1PRTC 3SR1A 3OWEB 4ZAIA 1PDQA 2VUMH 4PGOA 2X6YA 1VQ5B 1FD7D 3NP8A 4YHHQ 2XNDA 4FXUA 4HJ8A 2ATWA 1AW7A 1GM5A 4S3SA 5JVH3 1Q1BA 1I50H 2KCNA 1EYAA 3KDFB 4K14A 3ULLA 4XKWA 1UD4A 1G8ZD 1Y0YA 1HNZQ 5C4XB 4QIWB 3QFTA 1SNQA 1I8DA 3G6EB 1VQ5A 3I91A 2R93B 2B8FA 2K7VA 3B6YA 2JA7B 4CKBA 1ELOA 3A0JA 3KDFA 2VBVA 1C9OA 2E2JH 1IHZA 3QSYA 1SSOA 4PV1C 3K5MA 5EBCA 1NY4A 3G6EA 4Y9UA 1EFUA 1CHPD 1K0RA 1GVPA 5C5LA 2DUDA 1GUNA 1GUGA 1QG7A 2XGTA 1T5XD 1HA3A 4IALA 3IL8A 1KNEA 4QV2A 4A3MG 1YJNA 1UUPA 1X3EA 2XIWA 3B8HA 4DR4Q 3WNBA 1PHJA 5IY0A 1CQFA 1HNWQ 4DNIA 1U4LA 1C4QA 4KY6A 3HEJA 2PW5A 1FRNA 5FLXc 3AVVA 4GS3A 2M5SA 2V4DA 4A3KH 4DR3Q 4Q0FA 4B3SQ 3ASQA 1R5OA 4RHSA 2PI2A 2RQXA 1HUMA 1XMQQ 3ITPA 2R93H 2KUMA 2Z0SA 1IBKL 4KJNA 5JAVA 3Q8DA 1RQPA 2X6XA 4OWXB 4G7ZC 1TWGB 2G9DA 3N52A 1TU2B 2H4OA 2CQOA 3HOYG 3A3BA 3ZBUA 5ELCA 3HOZG 4TMWA 2VB3X 5M5WH 1RD9D 1OTCA 3FKIB 3J7A5 3T16A 1F2MA 2ZXOA 3A8IA 1B44D 1S5BD 3KJPA 1SN8A 2L5TA 1EP1B 2F0SA 3CC4B 2JXMB 5ELFA 2RHQB 3HRZC 1VQDA 4C56C 1AFPA 3CHBD 4DR7L 4RCYA 1V0FA 3I8ZA 2F0NA 5ELNA 4RA8A 5IP9G 3FPUB 3BVMA 1MSHA 1FJGL 1PH4A 3S24A 3J80E 2QCPX 2Z4IA 4X3SA 4E6IA 3HOVH 4A3IH 2MUYA 3CC4A 3MC0B 4G4KA 3A74A 5GAGC 1BLIA 1R9TH 1N36Q 2K14A 4B3FX 1I6HH 3E9HA 3RZDH 1W3SA 2JEBI 4RLZA 3T53B 3W5HA 1QFJA 2XGJA 4NBSA 5HY6A 2HHHQ 1VQIA 5EPLA 3U2QA 4DFAA 1PFBA 4R4TA 5C3EB 4GQNA 4YHHL 1ICFB 2ZJPA 1BCPC 1M4VA 3HOUG 1XTCD 1PLFA 4M53A 4TKOB 2Q6IA 3I4MG 1EY5A 2MO0A 1HNZL 1VHOA 4Z4YA 5C6AA 4XORA 1EOTA 1BBXC 4KHPQ 1X32A 4RGOS 2AMCB 1TT2A 5M3MG 4AYBE 1IBLL 4LWCA 4EX5A 2BOSA 3PO2B 2G9HD 3CPWA 3VYRA 2X0KA 3LX0A 4IURA 4QVJA 1JA0A 4RHRA 5E1FA 1BUVT 5FKAC 2Z6BD 5JOBA 2EXDA 1KK0A 3K0XA 1D8TA 1X54A 4LC0A 3L2PA 3LVBA 2JE6I 2RCFA 2FINB 4HAEA 3ONYA 1S0UA 2CHBD 3LGJA 1TY0A 3FJOA 3PA1A 4HIOA 2E1RA 3VO1A 2Q8TA 4LFAL 3E9IA 3VDYA 2OBSA 1GHKA 4XTCS 4DR4L 2EYOA 1F9PA 3S15B 2NZ1D 3KUPA 3AGPA 3VNUA 1H9RA 3H0GB 2OK8A 2NUCA 3FPKA 4DNTB 4KHVA 3EVQA 1Q1EA 1QWYA 3UI2A 3KLSX 1SLJA 4FNFA 3GTQB 4WJ4A 4IJLA 2ZZQA 4KHZA 2TSSA 1V1OA 1EFRA 3S1RH 4FN5A 2EJMA 1YX2A 4QUFA 2FMCA 1XMQL 1XMOL 1IW7D 4IO9A 3QJYA 1K73C 5I4DA 1JOOA 3PO2H 4KN7C 1UEAB 1A8PA 1AEXA 1EUJA 1HZAA 2A6EC 3D6WA 2ZTGA 2VZAA 3I90A 3M4QA 1HPCA 3K57A 2QGQA 3BZDB 1CKOA 2QEXB 1YNJC 3L3OC 1EXMA 4A93B 5M5XH 2VB2X 3MMPA 1Y1WG 2CH4W 4PC1A 1XNQL 2NN6G 4L5SA 1JE5A 5IYBG 3D4RA 3TREA 4LNQA 2EVBA 4M8AA 1Q8KA 3H0GH 3S2HB 2JDIA 1B4OA 1F9SA 1ZM2A 1PA6A 1YITA 3B82A 1VCIA 3F2BA 1EYGA 4PAAA 4Q7JB 2K5DA 2N49A 4ZYSA 4BA2I 1CUKA 4Z4SA 4GN3B 3TMEA 3H15A 2K5VA 1ENFA 3PMFA 4FXDA 3I2ZA 3I55A 1I7PA 1HZCA 1Q81C 3H94A 3GSIA 1KC8D 3TRZA 2VNIA 5IT9L 4WQMA 3CD6A 2ZBUA 3FEWX 3JAML 1OXTA 4B3GA 3A8JA 1GO3E 4EVOA 3K6OA 2E1BA 2HHHL 2PW7A 3T51B 5FNZA 3WBKA 3J7ZC 2R61A 2A6HD 1AZPA 2D3NA 4DNRB 3CCMB 4TQUS 1GOZA 1UE5A 2E76C 2HCIA 2F0DA 1I4HA 1EYCA 5NUCA 5DSZA 2LS01 4ZUIA 4K1XA 5CC4A 4DV5Q 4KHPL 3OJWA 4RH6A 2N55A 1EZ8A 1JNYA 1B1ZA 4BS9A 4BBSG 5IYPA 3S1MH 1JWUD 4HTHA 1WJJA 2KVMA 4QMGA 4C3IB 5BSXA 1G6ZA 3CCLB 2ES2A 3OE7A 1HCZA 3NBHA 4YEJA 5FO7B 4ALPA 1LTAD 1A6XA 1LT6D 4IFDJ 4DK1A 4XYOA 3K80C 3P20A 3SEBA 2JP1A 3CCLA 1K8OA 3BZCA 1RODA 3QB3A 5FO9B 2W6IA 4Z4VA 2OEOA 5I9OA 4DR1Q 4C3JB 5M3FB 1OGIA 4LF6Q 4X6AH 1G291 4A3MH 1G6PA 3R2IA 4A75A 3F2UA 4UPAA 1Q86D 2YWHA 2HUGA 2RKSA 5GROA 4XKVA 1V43A 4N8X1 5C3XA 2OF1A 4YHBA 4J6HA 4DV4Q 4C1NK 4HIDA 1LO5D 1A8VA 2FHTA 4JC0A 3ASTA 2YTXA 4B3SL 3PUZA 1CQXA 1CFMA 1TKWB 4G1BA 2R6HA 3ONUA 1MABA 2E2HB 4G57A 4X06A 5TR9A 2MPMA 4TMVA 4U673 4ZCLA 3HGBA 1JC7A 3AVXA 4PZ7A 2NZOA 4OO1I 3D4DA 4ZK9B 1EIFA 4PG3A 3CTAA 4YAFA 3G6JB 3BS1A 4X7CA 4A3JG 3S17B 4RPDA 1OB0A 2I0QA 4IQZA 2XOKA 1I4XA 4ZV4A 1WTOA 4IFDG 4PC2A 4BY7G 4HJAA 4JV5Q 2R9VA 3ES9A 2EJGC 5ELEA 3CCUB 2R7ZG 1JE4A 1VQLB 3PUVA 2N8NA 4CHTB 4BBRB 2L15A 3SLNA 2LXJA 4B47A 5CV9A 2RBMA 4KV6A 5IP9H 2ZL5A 4IPHA 3DUZA 5IYNA 4F8MA 2OK7A 5HKKA 3WDNA 3CB4A 1VQLA 1YZ6A 2XRSD 5K5PA 4GLXA 2QTLA 4FF1A 2DNEA 1T5EA 2RDFA 1IYUA 2JA6G 1K8GA 2ZT9C 3AU7A 1X3PA 4LUVA 1ZM9A 4RFBA 3T1YQ 3E3XA 4M4SA 2EYHA 4RM0A 1D8LA 3GTKB 3A56A 1C8CA 3TS0A 4PABA 3CCVB 3O13A 5GADC 1BQEA 3I70A 4M1UB 5C0XG 4DV6Q 3S17H 3C46A 4DV5L 3HOUH 1EY4A 2CKZB 2DYIA 3QE2A 4A3DG 3K7UC 2C4TA 3I4MH 3CCVA 1ZM4A 2CW0D 1FNWA 1N06A 2EQSA 1T9HA 1K3BC 2B3GA 2PE3A 3GIRA 1NMGA 4P9SA 4HR7B 3VMFA 3M3YB 4RD6A 5E6TA 4DF7A 1VQNB 4RCOA 1WVLA 3PUMA 5IE8A 4GOPC 3NUCA 2VUMG 4QIWE 5EKKA 1EY7A 2K05A 2BM1A 4NKLA 1KQSB 1Q3LA 1HTPA 1F2LA 1VQNA 1E62A 4DR1L 2F43A 1FNUA 3MWYW 4OXPA 1TWFB 1W87A 1WFQA 1ZKOA 3CW2C 4LF6L 2C2WA 1W35A 3E5SA 4P6YA 2UUAQ 1SKYB 1B23P 1H42A 1KQSA 1SNCA 1PZKD 2X3UA 2QDXA 2VY3A 3PO3B 1CKNB 2WB1G 4RD1A 4L63B 4Z4ZA 4DGZA 5C4JH 2VNHA 2JN4A 1B2TA 4X65Q 2C5CA 2WZNA 2XN9C 2GN5A 4DV4L 3X3MA 2E2IB 1E0BA 3JC66 1CKNA 1WTHD 5I9PA 3S1NB 4LFCQ 5J3OA 4CKEA 2KECA 4B9XA 3M3YH 2HQLA 2VQFQ 2GQFA 1HVXA 4XR6A 2A73B 3URYA 5H5JA 1NR4A 2IWHA 1KDBA 1E1OA 2MHVA 3S2DH 2BE5C 3RUZA 3CF5A 4OELB 1QJOA 1K83B 4WZTA 5IYRA 3J81L 2CF4A 4HSVA 1EWYA 4Z4RA 1D1NA 1JA1A 4KLKA 4H0LC 2C78A 2ZXHA 1B7YB 4OGQC 4GKKQ 3M9BA 2WSSA 4JV5L 1EQTA 3QFRA 2NN6H 5C4XG 1EY6A 3LWEA 5IYBH 2R93G 2YWEA 3NENA 3KBXA 2HDNB 2JA7G 5I2XA 3PO3H 2QA4A 1RF2D 4KN4C 5CYUA 4HCEA 1BX0A 3MFYA 1PTOD 3R3OA 3G4SB 4I65A 3RN2A 2E2IH 1J9OA 3U58A 4XN3A 1KK2A 4WRDA 5COYA 4XQQA 1CNEA 3S1NH 3AMUA 3I73A 3QIAA 3T1YL 2BF4A 1STYA 3K0YA 2K28A 3G4SA 4QGUA 2ALYB 1SXTA 2BV3A 4DV2Q 1XXGA 2WR8A 1A62A 2HT1A 4P26A 1K83H 1TWAB 3MAQA 1OXXK 1YLOA 4FP5D 4IUUA 4N9TA 4DV6L 3MZ5A 2NVTB 2UXCQ 1IYJB 4OPOA 1F9RA 3STBD 1VF5C 3OP1A 1A3UA 3UDFA 2A1AA 4M1KA 4B08A 2HIVA 2MQHA 2IT1A 5IGEA 4II3A 1A15A 3AYHB 4BBSH 3PVDA 3J81k 5IP7G 1UD2A 3C1EA 4ZGQB 1LTLA 1WI5A 4K2KA 3J7AF 4POFA 1YJ9B 1Y14B 3FKIG 2QF7A 3K5LA 3U9OA 3A7LA 1SBBB 4X05A 1KNAA 1TVXA 4DV1Q 2D0OA 2QILA 1YHQA 3WNDA 5IWAQ 2WINB 1XE1A 1JB3A 5KNBA 2UUAL 2Q8RE 1S5CD 4G7HC 3GTMB 2EIXA 1KD1C 4FO2A 3CCQB 1M90D 4UP8A 1LM0A 3JAMi 2CCZA 4HMIA 4LK1C 2NVTH 4B43A 2O5JC 2D3LA 4X65L 4R1JA 2QN6A 3I4NB 4XMYA 2OYNA 3H3VI 2RA4A 2B7CA 3NBIA 3KF8A 4NDXA 2NVQB 1K28D 2VBUA 3KYHC 4LFCL 4O42A 5DM73 2EY1A 4L5TA 5I6WA 3WQZA 2F0FA 2PNRC 3EIVA 3V7AA 4FXKC 1SAPA 4N3NA 1ZXTA 1PH6A 1STGA 4YAWA 3EBEA 1QVFA 5BSYA 2OTJB 5C3EG 4RD2A 3OW7A 4RD0A 4FXGC 1WOOA 1W0JA 4BA1I 2F0EA 1IYVA 4GKKL 3CRLC 5F4MA 4A3JH 5M5YB 1BNZA 1I3QB 4QUZA 2XNJA 2DETA 4IUTA 2VZLA 3PO2G 2W6JA 4BY7H 4IFDH 3OMGA 1V0EA 1E3PA 1CT1D 1VQKA 1L0WA 5L37A 1HA5A 2V7VA 1MBYA 2F0IA 2R7ZH 4TT3A 1U4MA 1EFID 1IJFA 1EEFD 5HXBA 2CK3A 4OOSA 1V1PB 1QUQB 2NTTA 2QEJC 4MTKA 5EGTA 3OTOQ 4B3XA 3JQPA 4KMUC 2DY8A 5JEAJ 5C0XI 1N32Q 1JQYD 2BGIA 2XWJB 1LTRD 1TS4A 3QFSA 5L46A 5AFWA 3OHXC 4DUZQ 1MHWC 1MGSA 4C1NI 2JA6H 1QGZA 2F0VA 5B6IA 3EJIA 1SE8A 3OW2B 3H0GG 5M9OA 1SM4A 5IT9c 4OX9Q 2FMMA 2ZXRA 3JAMc 5CV6A 1XPUA 3P1HA 4XN0A 5E4XA 3C2PA 1O7ZA 2UXCL 1ENCA 3M4PA 1NRKA 3BQJA 4C3HB 4Y7NB 3OW2A 4A3DH 1N0UA 1Y1VB 3MXPA 3AFPA 4P73A 1Z9FA 3OZVA 4ZQ3A 1JJ2A 4DK0A 4PC6A 2Y0SE 1VQOB 4YCWA 4DXGA 1EWHA 1HJPA 4PNYA 4HIZA 1JMCA 2JIZA 2C77A 1S5ED 2IPKD 3M4OH 3AVTA 4A93G 4JG2A 1EWIA 1IL2A 4L8JA 4JI0Q 4G1VA 1VS0A 1FNBA 1PYBA 2FJ2A 5GAEC 4DV1L 2YU9B 4LF5Q 3BY2A 3CXCB 1XB2A 3MXNB 2BH8A 4PC3A 4CJ0B 4X3KA 5IWAL 1WSRA 2GK7A 1F9QA 2C5BA 4X64L 4GKJQ 2L11A 1F2YA 2GJPA 2E2DC 4QF4A 4JI4Q 4ID6A 3I3CA 5LMNW 1OXSC 3EN2A 1KRSA 3CXCA 1S72B 1KAWA 4ME3A 3H6MA 3E0EA 1R5NA 2K6AA 3NK9A 3ZIAA 4NCNA 1DCZA 2KHSA 4CJ2C 1NB9A 4Y7NH 1EFWA 2DJGC 2VYQA 1LTSD 1Q7YD 3HKZE 3QG1A 4IN3A 1S72A 3MHPA 3EFXD 1N8RC 1H8EA 1A63A 1GKHA 2DCUA 3NTHA 1QZGA 3W2IA 3Q22A 1M1KD 4OONA 1S5FD 3W5VA 2IX3A 1OHHA 5EKLA 1A2TA 1D6EC 1ONLA 1RJTA 1VMCA 2F1LA 3PCOB 4M2LA 1SYEA 3MEFA 2Q2IA 2V7QA 1PFMA 4JBMA 1E3ZA 5J1ZA 1STBA 4LUOA 3ULJA 3HOXB 3PENA 1DG1G 4JVZA 1ZM3A 5C4XH 2LFNA 5JJIA 5IIFA 2OBTA 3V96A 4C3IG 1H8HA 2MGSA 1VQ7B 2JA7H 4AVZA 3F2CA 2A68D 4DV0Q 3OTOL 3J7AV 1PTOF 4A3GB 1N32L 4B3TL 4JBWA 4BXXG 1A0IA 1H9SB 1KLGD 1SMXA 3FDTA 1I4GA 1NJID 2KEEA 3CP2A 5KW9A 4F87A 2M9VA 4ZCKA 3AEVA 1DZ1A 1VLYA 3SE0A 4DUZL 4AQYQ 1P8LA 3Q0AA 2RVLA 4C3JG 1YI2B 2J7ZA 5M3FG 3X3NA 2A69D 5J35A 1H9SA 3I72A 3GTPB 4WZKA 4PQXA 3A5UA 3OEEA 1X65A 2F0KA 3TZDA 4L5RC 2GK6A 1SMYD 1YI2A 4X66Q 2F0MA 1X56A 2JA8B 2PMZE 2YTYA 1JICA 4JK1C 5BR8Q 1VQGA 3VR6A 3HOXH 4P72A 2F1MA 4OPSA 1B2RA 2ZM6L 1LT3D 2R92B 3I1FA 4NXNL 2V1CC 1G7RA 1STHA 2AQ1B 1LTTD 2V31A 4Y7CA 2B2UC 4JI3L 4B48A 3FHWA 5IP7H 1TWGH 1O80A 3JQQA 2CBXA 3OPOA 4HE5A 3W2EA 4DN4M 2EOTA 4DR5Q 4GOPB 3FKIH 1UD5A 5FJ8H 2BPOA 4GKJL 4PC7A 1STAA 5LMUQ 5EMNA 4J15A 3TEHB 1EU4A 4XLCA 4H9GA 1NBMA 4A3FB 1T6YA 1CI3M 1FNVA 4GOPA 5IGGA 3HS0C 1TVCA 4BBRG 4C2MB 3I4LA 5D3IB 3FMCA 2R7FA 4R4OA 1PXUA 2JA8H 3E6ZX 2KHJA 2HQEA 3CW2A 3ZZTA 3BJUA 1KIXA 3U50C 2VNJA 4XLHA 1JCKB 3A3GA 2C35B 2ZTCA 2RDHA 4ABNA 4NP5A 1MJEA 1YVCA 1IHMA 2GJKA 1JORA 4QB4A 3PA2A 3TP5A 1S5DD 3U9SA 5C3EH 2UU9Q 1HNWL 1OGJA 3MTSA 4HN7A 1PV4A 2MFIA 4TMTA 1K9MD 2ZL6A 5I6YA 3SKBA 3J81c 5KSWB 4A3FH 4DR3L 4R8IA 4K8IA 5G3LD 2G5DA 3ASRA 2WJYA 3KJOA 4XL9A 3DEOA 3GTLB 2PZWA 4XQJA 2F3IA 4RD3A 4LFBQ 1DDIA 1SRUA 2CRVA 3KBGA 1EQVA 4K6LA 4DV0L 1X3GA 4H13C 3JQRA 1LUZA 1DM0B 2L0CA 3WWVA 1CTMA 4YWLA 1TUIA 2B2VC 4AYBG 2RC6A 1GXDC 1PYWD 2K5QA 4AQYL 1FNDA 1Y0RA 2AUKA 4JI8Q 2FFKB 4RCNA 3CQZB 4O2DA 1SR3A 1DJRD 2QEXA 3QO2A 4RD4A 3S15H 4JOIC 4K0KQ 4WZEA 3PO3G 4O1NA 2K01A 1VHEA 2KJXA 4X66L 3WBJA 2PQAB 2PYKA 5DN6A 1O7IA 3RR5A 2EXZA 1X6OA 4X7EA 3GTQH 1HQMC 5BR8L 1HFGA 4DQLA 3U4ZA 4CDFC 3S16B 1SDFA 4WJ3M 2V7TA 2E5LQ 2ICIA 1N36L 1WOSA 1VQJA 1UD6A 1FDRA 1A3TA 3M85A 4A3BB 5LL6X 1LACA 3CC2B 3ZUGA 1UE6A 2D9RA 2V7UA 2ENBA 4TMXA 2LZJA 1K0SA 3W1GA 4XNFA 2F3VA 1LYLA 4A93H 4DR5L 3DMUA 2NPFA 1KTVA 3CC2A 3IAYA 3Q6SA 1B9MA 4HCSA 5LMUL 2K75A 4F88A 4KI0A 4EQPA 2D74A 1LV9A 1FVIA 2Y0SB 1E7ZA 3CQZH 3L0OA 3WY9A 1B53A 2D2CC 5JEAH 3CCMA 3OOCA 1QNUA 1KJZA 5J3BA 4CGYB 1XQBA 3S2HH 1IKLA 4YALA 2QTZA 4PMCA 5JJKA 4Z9CB 1EIYB 3BC9A 1PJ6A 1G7TA 2JA5B 4X3TA 5AN9A 3S16H 1OXVA 3P7JA 4XLAA 4RKBA 5IK2A 1Q90A 4A3BH 1QFZA 3ER0A 1WORA 1P4MA 4OPVA 4JYAQ 2NTSA 3MHBA 1WTHA 3BU2A 5C4ZA 4OWWB 5CV7A 3RD4A 3ISXA 4AIMA 2XZOA 4P22A 2Q2HA 3HKZB 5ELBA 5LL6S 1YHBA 2UU9L 2ZXIA 1VQ4B 2V7WA 3PGZA 1IW7C 4DUYQ 5ISRA 2ZITA 1PH2A 2B2TA 1S40A 2Q6LA 2I5HA 3I4OA 5EJWA 3WOFA 1XX8A 3NQIA 4ZKBB 2ZXPA 1VQ4A 1PFSA 4TSSA 2IX1A 4LFBL 3KL9A 1PH8A 4IW3B 2PZUA 1O7LA 1VJSA 1WDTA 4RAUC 4LF7Q 1IKMA 1BJKA 1E1QA 2D5DA 1N0VC 4C3IH 5CORA 3UDIA 2JA5H 2WZPP 2RHSB 1ZYRD 1W34A 3CPXA 1SROA 2E75C 2ZZGA 3D0FA 1WTPA 4BXXH 4OL7A 2D62A 4B4DA 4XD7A 3CCEB 3A8KE 4YWMA 3WYAA 2J7KA 4TRDA 1QVCA 4JI8L 3OIQA 2K5WA 3OIPA 3RLNA 2QDLA 1Y69U 2EJFC 1W0KA 4DU9A 1G7SA 4C3JH 4GLVB 2EYMA 5M3FH 4K0KL 3KLSA 4FF4A 3CC7B 1A2UA 3BCFA 3DDYA 4K6DA 2SNSA 3AGQA 2X8KA 4PZ6A 3ICEA 2RDGA 1KC8C 1PH9A 3I4NG 2WJVA 4DR2Q 2E74C 1J5EQ 1LTGD 2AQ2B 3BVGA 2EE1A 2E5LL 3CCUA 1XPRA 3G71B 2NVYB 4LBYA 2A6HC 3EA6A 3G48A 1KXLA 4NW2A 1GO2A 5FLXE 2E2HH 4OWTB 2ZTDA 5JJZA 4P3YA 3DWAA 1XNRQ 2F0WA 2PMZB 2AKWB 3GP7A 5M3MB 1Z7TA 2GVAA 3W1BA 4JI6Q 2NB0A 5KIXA 4DA2A 3EROA 3GV3A 5IYDG 1HTLD 2AHOB 2ZJQA 4ASUA 4DAMA 3MCAA 1IZ6A 2FXQA 4HEDA 1I6VC 2WPDA 2DY1A 4CDEC 2OWOA 1GUTA 2AHOA 3KLRA 4IZ8A 4RDJA 1YNND 2PZTA 2X6WA 2IJ0A 4BBRH 2K50A 4A4IA 3VA5A 2X6LA 3SXHA 1N34Q 1S4MA 1DONA 4N8FA 1QX4A 3QFCA 4E0FA 1NDHA 5E4WC 2NVYH 4HMJA 1E2VA 3D26A 4DAYB 4F7XA 2VJIA 2F0OA 2BVNA 3ZBTA 3CCRB 1B3AA 3C1FA 5HGQA 1RL2A 1Q86C 3MFGA 4QUCA 2YTVA 3OYYA 3SK5A 5F4OA 5IYWA 2HDMA 3NELA 3GTKH 3U6BA 2B63B 4DUYL 3Q38A 2EPBA 2BM0A 3CCRA 4C3HG 2I5LX 4ZUJA 1VLOA 1QB5D 1BXTA 1VDZA 4LBWA 1E1TA 2AWNA 3NTIA 5E7NA 4H44C 4FYDA 2M00A 1Y1VG 2OQ0A 1ET9A 2SDFA 1JOQA 5G3LF 4UZFA 1EQRA 1XTDA 4R8NA 3PF4A 2F3WA 5ELOA 2NN6I 4LF7L 4XT1B 5FA6A 4TVAB 1EIGA 2F0JA 3SK4A 4DK3C 2UUCQ 1D1KA 3A1PA 1UEBA 4HJ7A 1TS3A 2CQAA 2YYZA 4KD3A 1I4PA 1NTGA 4XT3B 2ZJRA 5FO8B 3S9WA 2XNAC 2AUJD 4RGTA 3VYTA 3CAMA 1BDOA 4UDUC 1DARA 1ILPA 2UXBQ 1E1RA 3QR8A 1TWFH 5GQOA 4JI5Q 2NV4A 5H59A 5IOCA 4YCUA 4X62Q 1I18A 4X0CA 4RJLA 3K8AA 1RDPD 4G5GA 1O7YA 2Q8IB 4DR2L 3HFZB 2YWFA 1MI2A 2HIXA 1HHVA 3J80c 4HJ5A 4AF7A 1PKVA 1MSGA 1WP6A 5EPJA 4Z1MA 1DOLA 2L9HA 2BCOA 2B2WC 4NNJA 1OB5A 4OOVA 1XNRL 1RHPA 3CMMA 4ILWA 4JI6L 4NMZA 5A2QE 1WTVA 2CW0C 3Q6QA 4UP9A 1GAWA 2LY7A 1G91A 4A3EB 4LBVA 1V8QA 4JI7Q 4KKTA 3PV0A 5LMNQ 4KKSA 1Q82D 1DOKA 3HOXG 3FPPA 4IJHA 2B2UA 1LT5D 1P16A 4XOPA 3H91A 1EFCA 2BSAA 5KNLA 5CGKA 2Q2TA 1VQPB 3TP6A 5A35A 3KOJA 3QWNA 2ZTEA 2JSOA 2KQ3A 4FDBA 4P3IA 3J7YW 3Q6RA 2XTIA 1KMHA 4A3GG 2VBTA 1N34L 3PQIA 4UAJA 1RIPA 4X8IA 3SHLA 1CZWA 3L7ZC 1HR0Q 3A55A 3S1QB 1ESFA 1E3XA 5FJ8G 1BKBA 1ICWA 3BYYB 5J39A 1QUFA 2BDOA 1KAAA 4HE6A 4GZYC 3D31A 3OWFA 1T6ZA 1X55A 3BDCA 1Y8PB 1YJ9A 1EQQA 4BPRA 2EYJA 2JJ1A 1FR3A 3T13A 4XLFA 1TY2A 1TWAH 3TP7A 1SYCA 2UUBQ 1BVSA 2PO4A 2JA8G 1I4RA 3GTGB 4LBZA 3UDXA 2OQKA 1SKQA 1QVGB 1B50A 4OOXA 3CCJB 2SNMA 3CCQA 2R92G 4QVAA 1BPLA 1GJXA 2K1BA 2NZHA 2B2TC 2UUCL 1PRTD 2VQFL 4IFDI 1GAQA 1ZUNB 3GTOB 1KK3A 4JBJA 1RKNA 4CQJA 2MO1A 2Z6KA 2RF4A 3CMAB 3KF6B 2Q6KA 2P3MA 1WOCA 1ILQA 3V05A 4P12A 2UXBL 1CNFA 4A3FG 1EP2B 3PF5A 3L9AX 4LJZC 2OTJA 4X62L 3GTMH 1AZQA 2JJ2A 3KF6A 4MTNA 1PTOC 1UWVA 1OXUA 2O4XA 1II3A 1UD8A 2BA1A 4RCZA 4ZRZA 2DN8A 1E43A 5A89A 1QH0A 1LLRD 4J8QA 2B2VA 4X07A 3GTGH 2OT2A 1WD1A 3MVVA 5TSSA 1I5FA 4A3CG 3I4NH 1HQRD 3ERSX 3VA7A 1EL0A 2NVQH 4P75A 2FVGA 1SNOA 5KRUA 1J8IA 1EY9A 1Q46A 4LUZA 4JOIA 3GQBA 2D0PA 1KRTA 3A8KA 4P1VA 1WU8A 2WAQE 4DV7Q 3K5NA 3RLFA 5T1GA 2HLDA 2X85A 1R4PB 1V1PA 1QUQA 3CU7A 4RKLA 4NB3A 4RMFA 4DV2L 2PPBC 2I07B 1J6QA 2M2LA 3STBC 4Z4WA 4XLEA 1D5XC 1WCMB 1VQ9B 5DNFA 1CA5A 3W2FA 1VMPA 3DM3A 4JI7L 5LMNL 3P27A 1YEZA 3HG9A 1QZHA 5IYDH 4JCVE 1MJCA 2R6GA 5D14A 2ZZFA 5M5YH 1I3QH 5C44B 1HH2P 1VQ9A 1LTID 1HA6A 1KRHA 3GTJB 1VQ8B 2CWPA 3SK6A 3DXJC 3A8JE 5F2DA 3HOWB 4DPGA 1GR1A 1I50B 1C48A 1FX0A 3V2TA 1TS2A 2KEDA 1GUWA 3F2DA 1MD2D 1HR0L 3ND9A 4R4IA 4FF2A 4C43A 1FYCA 4DXFA 4YXWA 1UNSA 5KEEA 4Y52H 3CP0A 5TRDA 1UD3A 3OSOA 5KNCA 1VQOA 4JMQA 2Z6BA 5KNDA 4KTAA 1GVHA 2BDNA 1M90C 4BY1B 1U5KA 4GN4B 3G05A 2MNAA 2DY7A 3FRPB 1SNPA 1YBYA 5JEAG 2J0TD 3MXUA 1ENAA 4UZEA 3P75A 1ASYA 2A8VA 1WCMH 2UUBL 1D1IA 5FO0A 2CVRA 1FGBD 4Y9RA 3MXNA 1WTWA 1H85A 1AMOA 4GNXC 2GVBA 2QW7A 1EEID 3CESA 2WKCA 5D65A 4C3HH 4DQKA 1TXYA 1D2EA 1DXMA 1SEBD 1SNMA 4UHVA 5C44H 2WFWA 3RZOB 1Y1VH 2D9UA 2JA9A 2KENA 4P2CB 3VR5A 3GTJH 1HNXQ 4A3BG 2MJ8A 1IBMQ 4II2A 1HR0W 1QFYA 2VNKA 3HOWH 4LF8Q 4MNOA 4N9PA 4YCVA 2UXDQ 4A3KB 3SLDA 1BCPD 1PJ5A 3MA2B 1UE1A 2F0GA 3BY1A 1LABA 1IBLQ 5CV4A 3E20A 1AE3A 4I7AA 2YU9H 4WJWA 4C0SA 3A35A 4BY1H 4X7DA 4R71A 2Y0SG 5KYIA 1JR0D 1PZID 2K4KA 2RSNA 1YJNB 1D5ZC 5M5WB 1NCVA 1TR5A 2WP8J 3SJPA 4B3RQ 1SJHD 2VBSA 4ROXA 2CW5A 4WORA 2PCFB 2PMDA 1SYGA 4IUPA 5IYCH 2OBRA 1NSNS 3CRKC 4FWTA 1CQVA 1Y8OB 2CFMA 4LFAQ 5DS0A 2XNCA 4ZCMA 1Z47A 3W5UA 2QE7A 2JA5G 1IB0A 3TQYA 4A3LH 1B3QA 3T1HQ 1ASZA 3AVWA 3GD7A 1RQRA 3PUXA 5CBEE 3RZOH 4WZLA 5K36H 1Q12A 1SYBA 3MXGA 4DV7L 3KEWA 1VQ7A 2PNHA 3DWPA 1DD2A 4LF4Q 3HOVB 4A3IB 2EY5A 4XDXA 4AF6A 4OX9L 3HKZG 4RGMA 1XMOQ 1R9TB 4UAIA 4EQOA 2EYLA 3J80L 1I6HB 4YWKA 3RZDB 4KD4A 1TWHB 2VNUD 1EFTA 4ACBA 5FOBB 5JVG3 5LHY1 1K73D 2E8GA 1NMFA 1U4PA 1C0AA 2Z9HA 5C5MA 3RLOA 1KDAA 2A6ED 2R3ZA 3J81i 2JQOA 1FL0A 1SJED 1XYIA 2K5NA 1KK1A 4O0AA 2BA0A 1ESRA 1VQFA 1I4QA 1YNJD 4PZ8A 2CC2A 1XNQQ 2ASBA 4CKCA 1B8AA 3KK7A 4A3GH 4XYQA 1LTBD 4IPCA 4JI0L 2KBNA 3GVLA 2A74C 2LMCB 1BQQT 4LF5L 2QKIC 4H02A 1I94Q 3PUWA 4P25A 4OO1G 2K33A 3GV6A 1QOHA 2F52A 5FK9C 3HZXA 3VR2A 3CMEB 4JI4L 1OB2A 1QGYA 1J9ZA 1CK1A 4H7BA 3WOEA 1ML0D 4Z4TA 2A19A 3GTPH 2LKVA 1D2BA 1Q7YC 1KL9A 3K5OA 2X53S 1BBUA 3AQQA 3J81j 1FNCA 3NWTA 4IPGA 1TWHH 1EY0A 1F77A 2O5IC 3CMEA 1Q81D 3LQEA 1BOSA 3OMCA 4FF3A 5HZBA 5FLMH 2AWOA 4QJFA 3IRBA 1M1KC 2DIEA 1HNXL 4RDKA 2IHFA 2GREA 1IBML 1WSVA 1PH3A 1G2TA 2ZBVA 2SOBA 3CPWB 1PRTF 2R92H 2CWAA 4LF8L 2UXDL 2K03A 4ZCIA 4TSFA 3ASSA 3S1RB 1HZEA 2P5ZX 3NXWA 2FX3A 4IUNA 4QCLA 5A8AA 2GPJA 1VQMB 4QY7A 5IGDA 1XPOA 3VNVA 1L0YB 3CKIB 1H95A 3OKXA 2WKDA 1JJGA 2B2YC 2O2LD 2Z6KC 4B3RL 2A5HA 1VQMA 1D5MC 2VJJA 3ZJYC 3FKSA 3ZPNA 2KOLA 3H3VC 5M5XB 2A68C 1SNDA 1COWA 1U9RA 1NBWA 1N05A 4L5QA 1BR9A 2OXPA 1Q9SA 1N08A 1NR2A 1GUSA 5DM63 3SVMA 4C2MH 2Z8LA 4CBVA 1NJIC 2KVOA 4ZKCB 3T1HL 3T56B 1B9NA 1PFNA 2SEBD 4R4CA 1E64A 1PH7A 3AFQA 3A54A 3FP9A 3GVKA 2BH2A 4MZ9A 1ET6A 4FVMA 2A69C 4A3CH 1E24A 4XOTA 2RCNA 1VQAA 3R6KA 4R9WA 4LF4L 1EP3B 4HSPA 1MRZA 1F20A 4V190 3AB9A 2EFGA 1SMYC 2HCCA 2F4IA 1IL8A 4IPDA 4LMQD 2B63G 1L1OC 3BG3A 1WYDA 2H1EA 4MIUA 3BDLA 5TV2A 2L4NA 1U0LA 1AN8A 4CDDC 3TS2A 3U6KA 4R4QA 1EIHA 4CDCC 1PJ7A 3WNCA 2K32A 2WAQB 2B2WA 3W3AA 4KJOA 2LSSA 1U2RA 4UY8C 3GTLH 1YITB 2PQAA 1X3QA 1H9KA 3Q3AA 3BH4A 1F2ZA 3I55B 4P2NA 1B70B 3S1MB 2KCTA 4I7ZC 2IHEA 4MHEA 1HXYD 1I94L 5LMZA 1UE7A 4BWGB 1N33Q 3UE0A 3E1YE 2HD3A 1H9JA 3CD6B 1EOVA 1SYDA 1D7QA 4LAAA 4IUQA 1H9MA 2BN4A 1EYDA 3QOLA 1XFOA 2N88A 3ERQA 3D8GA 2QMUA 3KLWA 5I2YA 5GV8A 4XXEA 1WTXA 3K81C 4F7DA 4IOAA 4YIJA 1UAPA 4G6IA 5IT9E 3GO5A 1JWSD 2HDLA 4A3MB 2I1LA 4EQ5A 4UP7A 2WYRA 3JAME 2N78A 1XJVA 2F03A 3BDOA 2IX0A 1CHQD 3R93A 4LW1A 3NQTA 1AIPA 1JJCB 3OEHA 3GVJA 3PIOA 5CDFA 3W2GA 4ZGNB 3OZUA 4MN3A 1F60A 1VQCA
chains in the Genus database with same CATH topology
1BCPF 2XWBB 1STNA 5J22A 3M7GA 1XWEA 2X6GA 2XVSA 3TN2A 2DNCA 2PQEA 3BYTB 3MEHA 3HOYB 3Q24A 3HOZB 1QNKA 4K5WA 3LWUA 4J1MA 1A3VA 1EWCA 1VF7A 1PTOB 1SE3A 3D4WA 2XZLA 2F0PA 1DOMA 5EQ0A 3TZUA 4DAVA 5DAUA 4OHJA 2B39A 4K2LA 2ZZEA 1DYQA 2IW3A 1R4QB 3E0JA 2KA7A 1W9XA 4OIJA 5C0XJ 1EU3A 1QE6A 2AQ3B 5T1IA 5FLXL 3HOUB 1W6KA 2BE5D 2RSOA 3H09A 4U68A 1PTOH 3I4MB 2L12A 1EY8A 3TSSA 3M7NA 2XZPA 2B8GA 5BN3A 3VR3A 2NBFA 1E2WA 5EKIA 1ZEQX 3VYSA 5C4HA 5CV8A 4B9WA 4OO1H 1GUOA 2XSCA 5D3DA 2Z4HA 4RWSC 3SDZA 4PMWA 2F0LA 1NAPA 1GHJA 3HP3A 1HFNA 1M8AA 4K5VA 1CZGA 2TMPA 3N6RA 3IKJA 1PRTB 1BMFA 4V0BA 5KYLA 2VXWA 5C4JB 3EQLC 3PIO3 4ULLA 3K59A 2WIIB 3FVQA 4DAYA 5CMDA 1BO0A 1L0XB 5E3FA 1RCVD 3S2DB 1TS5A 4ODGA 4RGNA 4X3UA 5CR3A 5FL7A 4AYBB 3OAAA 5BN4A 1ZYRC 1Y1WB 2EZVA 2EDGA 4CJ1B 2ZTNA 2WV6D 2GJRA 5IGFA 1EZ6A 3VYUA 4EQNA 3TDQA 3Q23A 5JPNC 2MP1A 1K8MA 3NHHA 1JWMD 3W2DA 2EYFA 4OIKA 3BVZA 4XONA 1TIID 1BF4A 1PMRA 2NWGA 1WPCA 5DEHA 3CP8A 3DWQA 5CBAE 1CM9A 2I46A 2ICEC 1S4ZA 3LNNA 1OO9B 5K36G 3D6CA 3C3LA 3NPPA 3NWSA 2GA4B 3A8IE 3NSWA 4KY7A 3J81E 5A2QL 2ID0A 3T4AC 2NYZD 3DM1A 4YELA 3DEPA 4BBSB 5IGBA 3HAGA 3R2TA 4G7WA 3TBIB 3OFNA 5CV5A 4ME5A 5C3WA 3K7AB 1YNNC 2XRQD 2K04A 4KY5A 2EY2A 1WTRA 3TP8A 3ND8A 2JYOA 3IFDA 3QOJA 3ONAB 1G2SA 3D3RA 3ZYYX 2Z1CA 4ZLTF 1QCBD 2EYPA 1BCPB 2L55A 1HRJA 4K8JA 5HGTA 2QDBA 4PMBA 3DHQA 3VR4A 1RTNA 4K5XA 2WACA 4XM3A 2EY6A 4UZUA 4XQNA 3IFTA 1E79A 1STEA 5ELDA 1PZJD 4A3JB 1KLUD 1SFOB 5EPKA 4Q5VA 2B2YA 4BY7B 2F0UA 1Y8NB 2R7ZB 3RMHA 2L1BA 1QILA 2KCCA 4XIGS 2F0TA 5BN5A 3PUYA 5IGCA 1KDCA 4DAPA 3S14B 4G7OC 2JA6B 2IL8A 5HURA 4XQFA 1Q8IA 1JOKA 3JU4A 4G7XA 3NTKA 2F0QA 1HUNA 3BCDA 4L6TB 5KGUA 4A3DB 1E2ZA 1WD0A 1SE4A 4EGVA 4KK7A 1KABA 3K58A 1TWCB 5EBDA 1NUCA 3PIP3 3M4OB 2X69A 3A7AB 4WFN3 1O78A 2VUMB 4KKUA 1Z6HA 3SK8A 1RTOA 1SYFA 2JEAI 2C9OA 1TQOA 2F0HA 3G7LA 1CA6A 1WTQA 1SE2A 5IODA 1KTKA 4IUVA 1LT4D 2WB1B 5JPMC 5C0XH 2E2JB 2J4XA 1AP0A 1U4RA 1KZLA 3R8BA 3NE5B 1W6JA 3M4YA 1PRTC 3SR1A 3OWEB 4ZAIA 1PDQA 2X6YA 1FD7D 3NP8A 2XNDA 4FXUA 1AW7A 4S3SA 5JVH3 1Q1BA 2KCNA 1EYAA 4K14A 4XKWA 1UD4A 1G8ZD 5C4XB 4QIWB 1SNQA 1I8DA 3I91A 2R93B 2B8FA 2K7VA 2JA7B 4CKBA 4PV1C 1IHZA 1SSOA 3K5MA 5EBCA 1CHPD 5C5LA 1GUNA 1GUGA 1QG7A 1T5XD 4IALA 3IL8A 1KNEA 1UUPA 2XIWA 1CQFA 1U4LA 1C4QA 4KY6A 3HEJA 2PW5A 2M5SA 2V4DA 4Q0FA 4RHSA 2RQXA 1HUMA 3ITPA 2KUMA 4KJNA 5JAVA 2X6XA 4G7ZC 1TWGB 2G9DA 3N52A 1TU2B 2H4OA 3A3BA 5ELCA 2VB3X 1RD9D 3FKIB 3T16A 1F2MA 2ZXOA 1B44D 1S5BD 2L5TA 2F0SA 2JXMB 5ELFA 3HRZC 4C56C 1AFPA 3CHBD 1V0FA 3I8ZA 2F0NA 4RA8A 3FPUB 3BVMA 1MSHA 3J80E 2QCPX 2Z4IA 4X3SA 4E6IA 2MUYA 3MC0B 4G4KA 1BLIA 4B3FX 2JEBI 3T53B 2XGJA 5EPLA 4DFAA 1PFBA 5C3EB 4GQNA 1BCPC 1M4VA 1XTCD 1PLFA 4TKOB 1EY5A 5C6AA 4XORA 1EOTA 1BBXC 1X32A 4RGOS 1TT2A 2BOSA 3PO2B 2G9HD 3VYRA 3LX0A 4IURA 4RHRA 5E1FA 1BUVT 5FKAC 2Z6BD 5JOBA 2JE6I 2FINB 4HAEA 2CHBD 1TY0A 2Q8TA 1GHKA 4XTCS 2EYOA 1F9PA 3S15B 2NZ1D 3KUPA 1H9RA 3H0GB 2NUCA 4DNTB 4KHVA 3EVQA 1Q1EA 1QWYA 3UI2A 3KLSX 4FNFA 3GTQB 2ZZQA 4KHZA 2TSSA 1V1OA 1EFRA 2EJMA 4QUFA 2FMCA 1IW7D 3QJYA 5I4DA 1JOOA 4KN7C 1UEAB 1AEXA 2A6EC 3D6WA 3I90A 2ZTGA 1HPCA 3K57A 3BZDB 1YNJC 3L3OC 4A93B 2VB2X 2NN6G 3D4RA 2EVBA 4M8AA 3S2HB 2JDIA 1B4OA 1F9SA 1VCIA 4BA2I 2K5DA 4ZYSA 3TMEA 3PMFA 1ENFA 4FXDA 3H94A 5IT9L 3FEWX 3JAML 1OXTA 4B3GA 4EVOA 3K6OA 2E1BA 2PW7A 3T51B 2R61A 2A6HD 1AZPA 2D3NA 4DNRB 4TQUS 1GOZA 2E76C 2HCIA 2F0DA 1I4HA 1EYCA 5NUCA 4ZUIA 2LS01 5CC4A 4RH6A 2N55A 1EZ8A 1B1ZA 4BS9A 1JWUD 4HTHA 2KVMA 4QMGA 4C3IB 1G6ZA 3OE7A 1HCZA 3NBHA 4YEJA 5FO7B 1A6XA 1LTAD 1LT6D 4IFDJ 4DK1A 4XYOA 3P20A 3SEBA 2JP1A 1K8OA 3QB3A 1RODA 5FO9B 2W6IA 5I9OA 2OEOA 4C3JB 5M3FB 1G291 3R2IA 3F2UA 2HUGA 2RKSA 4XKVA 1V43A 5C3XA 2OF1A 4J6HA 4C1NK 1LO5D 2FHTA 3PUZA 1CFMA 1TKWB 1MABA 2E2HB 4G57A 2MPMA 4U673 3HGBA 1JC7A 4OO1I 3D4DA 4ZK9B 3G6JB 3BS1A 3S17B 1OB0A 4IQZA 2XOKA 1I4XA 1WTOA 4IFDG 2R9VA 2EJGC 5ELEA 1JE4A 3PUVA 4CHTB 4BBRB 5CV9A 2RBMA 4KV6A 3DUZA 4F8MA 5HKKA 3WDNA 2XRSD 5K5PA 4FF1A 2DNEA 1T5EA 2RDFA 1IYUA 2ZT9C 3AU7A 1X3PA 4RFBA 2EYHA 3GTKB 3A56A 1C8CA 3O13A 3I70A 4M1UB 5C0XG 3C46A 1EY4A 2CW0D 1FNWA 4HR7B 3M3YB 4DF7A 4RCOA 1WVLA 3NUCA 5EKKA 1EY7A 2K05A 4NKLA 1Q3LA 1HTPA 1F2LA 2F43A 1FNUA 3MWYW 1TWFB 1ZKOA 3E5SA 1SKYB 1PZKD 1SNCA 3PO3B 4L63B 4DGZA 1B2TA 2C5CA 2XN9C 3X3MA 2E2IB 1E0BA 1WTHD 5I9PA 3S1NB 4CKEA 2KECA 4B9XA 1HVXA 4XR6A 2A73B 3URYA 1NR4A 2IWHA 1KDBA 2MHVA 2BE5C 3RUZA 1QJOA 1K83B 3J81L 4HSVA 4H0LC 2ZXHA 4OGQC 2WSSA 1EQTA 2NN6H 1EY6A 3LWEA 3KBXA 5I2XA 1RF2D 4KN4C 5CYUA 4HCEA 3MFYA 1PTOD 3R3OA 4I65A 1J9OA 4XN3A 4WRDA 5COYA 4XQQA 3AMUA 3I73A 3QIAA 1STYA 3K0YA 2K28A 1SXTA 1XXGA 3MAQA 1TWAB 1OXXK 4FP5D 4N9TA 4IUUA 3MZ5A 2NVTB 1F9RA 1VF5C 1A3UA 4B08A 2IT1A 5IGEA 4II3A 1A15A 1UD2A 3C1EA 4K2KA 3J7AF 2QF7A 3K5LA 3U9OA 3A7LA 1SBBB 1KNAA 1TVXA 2QILA 2WINB 1JB3A 5KNBA 2Q8RE 1S5CD 4G7HC 3GTMB 4FO2A 4HMIA 4LK1C 2O5JC 2D3LA 3I4NB 4XMYA 2RA4A 3NBIA 4NDXA 3KF8A 2NVQB 1K28D 5DM73 5I6WA 4O42A 2EY1A 3WQZA 2F0FA 2PNRC 4FXKC 1SAPA 1ZXTA 1STGA 3OW7A 4FXGC 1W0JA 4BA1I 2F0EA 1IYVA 3CRLC 5M5YB 1BNZA 1I3QB 4IUTA 4IFDH 2W6JA 3OMGA 1V0EA 1CT1D 1HA5A 2F0IA 1MBYA 4TT3A 1U4MA 1EFID 2QEJC 2NTTA 1EEFD 2CK3A 1V1PB 5EGTA 4KMUC 2DY8A 5JEAJ 5C0XI 1JQYD 2XWJB 1LTRD 1TS4A 5AFWA 3OHXC 1MGSA 4C1NI 2F0VA 3EJIA 5M9OA 2FMMA 2ZXRA 5CV6A 3P1HA 4XN0A 5E4XA 3C2PA 1O7ZA 1ENCA 1NRKA 4C3HB 4Y7NB 1Y1VB 3MXPA 4ZQ3A 4DK0A 4DXGA 1EWHA 4PNYA 4HIZA 2JIZA 1S5ED 2IPKD 4L8JA 2FJ2A 2YU9B 4CJ0B 4X3KA 2GK7A 1F9QA 2L11A 1F2YA 2GJPA 2E2DC 4QF4A 4ID6A 3I3CA 1OXSC 3H6MA 2K6AA 3NK9A 3ZIAA 1DCZA 2KHSA 4CJ2C 1LTSD 3QG1A 4IN3A 3EFXD 1H8EA 3NTHA 3Q22A 1S5FD 2IX3A 1OHHA 5EKLA 1A2TA 1D6EC 1ONLA 1RJTA 1VMCA 1SYEA 2V7QA 1PFMA 1E3ZA 5J1ZA 1STBA 3HOXB 2LFNA 5IIFA 3V96A 4C3IG 1H8HA 2MGSA 4AVZA 2A68D 4A3GB 3J7AV 1PTOF 4JBWA 1H9SB 1KLGD 3FDTA 1I4GA 2KEEA 3CP2A 4F87A 2M9VA 1DZ1A 1VLYA 3SE0A 3Q0AA 2RVLA 4C3JG 2J7ZA 3X3NA 2A69D 1H9SA 3I72A 3GTPB 4PQXA 3OEEA 2F0KA 3TZDA 2GK6A 1SMYD 2F0MA 2JA8B 1JICA 4JK1C 3VR6A 2F1MA 1LT3D 2R92B 1STHA 2AQ1B 1LTTD 2V31A 2B2UC 1O80A 3OPOA 4DN4M 2EOTA 1UD5A 1STAA 1EU4A 4XLCA 1NBMA 4A3FB 1CI3M 1FNVA 5IGGA 3HS0C 4C2MB 5D3IB 3I4LA 3FMCA 1PXUA 3E6ZX 2HQEA 4XLHA 1JCKB 3A3GA 2RDHA 4ABNA 4NP5A 1JORA 2GJKA 4QB4A 3TP5A 1S5DD 3U9SA 3MTSA 4HN7A 5I6YA 4R8IA 4K8IA 5G3LD 2WJYA 4XL9A 3DEOA 3GTLB 2PZWA 4XQJA 3KBGA 1EQVA 4K6LA 4H13C 1DM0B 2L0CA 1CTMA 2B2VC 1GXDC 1PYWD 2K5QA 2AUKA 2FFKB 4RCNA 3CQZB 1DJRD 3QO2A 4O1NA 2K01A 2KJXA 2PYKA 5DN6A 2EXZA 1HQMC 1HFGA 3S16B 1SDFA 2ICIA 1UD6A 1A3TA 3M85A 4A3BB 5LL6X 1LACA 2ENBA 2LZJA 4XNFA 2F3VA 3DMUA 3IAYA 3Q6SA 1B9MA 4HCSA 4F88A 4KI0A 4EQPA 1LV9A 2Y0SB 1B53A 2D2CC 5JEAH 3OOCA 1QNUA 4CGYB 1IKLA 4PMCA 4Z9CB 3BC9A 2JA5B 4X3TA 1OXVA 3P7JA 4XLAA 4RKBA 5IK2A 1Q90A 2NTSA 3MHBA 5C4ZA 5CV7A 3RD4A 2XZOA 4P22A 3HKZB 5ELBA 5LL6S 2ZXIA 1IW7C 5ISRA 2B2TA 5EJWA 3WOFA 1XX8A 3NQIA 4ZKBB 2ZXPA 4TSSA 2IX1A 2PZUA 1IKMA 1O7LA 1VJSA 4RAUC 1E1QA 2D5DA 5CORA 2WZPP 1ZYRD 1WTPA 2E75C 2ZZGA 4OL7A 2D62A 4XD7A 3A8KE 4TRDA 3OIQA 2K5WA 3OIPA 1Y69U 2EJFC 1W0KA 4DU9A 2EYMA 3KLSA 4FF4A 1A2UA 3BCFA 3DDYA 4K6DA 2SNSA 2X8KA 2RDGA 2WJVA 2E74C 1LTGD 2AQ2B 3BVGA 2EE1A 2NVYB 2A6HC 3EA6A 4NW2A 5FLXE 5JJZA 3DWAA 2F0WA 2PMZB 3GP7A 5M3MB 1Z7TA 2NB0A 5KIXA 4DA2A 3EROA 3GV3A 1HTLD 4ASUA 4HEDA 1I6VC 2WPDA 1GUTA 3KLRA 4IZ8A 1YNND 2PZTA 2X6WA 2IJ0A 3VA5A 2X6LA 3SXHA 1DONA 4E0FA 5E4WC 4HMJA 1E2VA 4F7XA 2VJIA 2F0OA 1B3AA 3C1FA 3MFGA 4QUCA 3SK5A 2HDMA 2B63B 2EPBA 4C3HG 4ZUJA 1QB5D 1BXTA 1VDZA 2AWNA 3NTIA 4FYDA 4H44C 2M00A 2SDFA 1ET9A 1JOQA 5G3LF 4R8NA 2F3WA 2NN6I 4XT1B 1EIGA 2F0JA 3SK4A 1D1KA 1TS3A 2CQAA 2YYZA 4KD3A 1I4PA 4XT3B 5FO8B 3S9WA 2XNAC 2AUJD 4RGTA 3VYTA 1BDOA 4UDUC 1ILPA 1E1RA 5IOCA 1I18A 1RDPD 1O7YA 2Q8IB 1MI2A 1HHVA 1PKVA 1MSGA 1WP6A 5EPJA 4Z1MA 1DOLA 2L9HA 2BCOA 2B2WC 4NNJA 1RHPA 3CMMA 4ILWA 4NMZA 5A2QE 1WTVA 2CW0C 1G91A 2LY7A 4A3EB 1V8QA 4KKTA 3PV0A 4KKSA 1DOKA 3FPPA 2B2UA 1LT5D 4XOPA 3H91A 5KNLA 5CGKA 5A35A 3TP6A 3QWNA 2JSOA 2KQ3A 3J7YW 1KMHA 3SHLA 1CZWA 3L7ZC 3A55A 3S1QB 1ESFA 1E3XA 1ICWA 3BYYB 5J39A 2BDOA 1KAAA 4GZYC 3D31A 3OWFA 3BDCA 1Y8PB 2EYJA 2JJ1A 1FR3A 3T13A 4XLFA 1TY2A 3TP7A 1SYCA 2PO4A 3GTGB 1I4RA 1B50A 2SNMA 1GJXA 1BPLA 2K1BA 2B2TC 1PRTD 4IFDI 3GTOB 1RKNA 1ILQA 3V05A 3L9AX 4LJZC 1AZQA 2JJ2A 1PTOC 1OXUA 2O4XA 1II3A 1UD8A 2BA1A 4ZRZA 2NVXB 2DN8A 1E43A 1LLRD 4J8QA 2B2VA 2OT2A 1WD1A 3MVVA 5TSSA 1HQRD 3VA7A 1EL0A 1SNOA 5KRUA 1J8IA 1EY9A 3GQBA 3K5NA 3RLFA 5T1GA 2HLDA 2X85A 1R4PB 1V1PA 4RKLA 3CU7A 2PPBC 2I07B 2M2LA 4XLEA 1D5XC 1WCMB 5DNFA 1CA5A 1VMPA 3HG9A 2R6GA 5D14A 2ZZFA 5C44B 1LTID 1HA6A 3GTJB 3SK6A 3DXJC 3A8JE 5F2DA 3HOWB 1I50B 1C48A 1FX0A 3V2TA 1TS2A 2KEDA 1GUWA 1MD2D 3ND9A 4FF2A 1FYCA 4DXFA 4YXWA 1UNSA 5KEEA 3OSOA 1UD3A 5KNCA 4JMQA 4BY1B 5KNDA 4KTAA 2BDNA 3G05A 2DY7A 3FRPB 1SNPA 5JEAG 2J0TD 3MXUA 1ENAA 3P75A 1D1IA 2CVRA 1FGBD 3MXNA 1WTWA 1EEID 3CESA 2WKCA 5D65A 1DXMA 1SEBD 1SNMA 3RZOB 2D9UA 4P2CB 3VR5A 2MJ8A 4II2A 4N9PA 4A3KB 1BCPD 3MA2B 2F0GA 1LABA 5CV4A 4WJWA 3A35A 5KYIA 1JR0D 1PZID 2RSNA 1D5ZC 5M5WB 1NCVA 1TR5A 2WP8J 1SJHD 4WORA 2PCFB 1SYGA 4IUPA 1NSNS 3CRKC 1CQVA 1Y8OB 1Z47A 2QE7A 3GD7A 3PUXA 5CBEE 5K36H 1Q12A 1SYBA 3MXGA 3KEWA 3DWPA 1DD2A 3HOVB 4A3IB 2EY5A 4XDXA 4RGMA 1R9TB 4UAIA 4EQOA 2EYLA 3J80L 1I6HB 3RZDB 4KD4A 1TWHB 2VNUD 5FOBB 5JVG3 5LHY1 1U4PA 5C5MA 1KDAA 2A6ED 2R3ZA 1SJED 1XYIA 2BA0A 1ESRA 1I4QA 1YNJD 4CKCA 3KK7A 4XYQA 1LTBD 3GVLA 2A74C 2LMCB 1BQQT 2QKIC 3PUWA 4OO1G 2K33A 3GV6A 1QOHA 5FK9C 3HZXA 3VR2A 4H7BA 1CK1A 3WOEA 1ML0D 2LKVA 1D2BA 3K5OA 2X53S 3NWTA 2O5IC 1EY0A 1F77A 1BOSA 3OMCA 4FF3A 2AWOA 2DIEA 1G2TA 2SOBA 1PRTF 2K03A 4TSFA 3S1RB 1HZEA 3NXWA 4IUNA 4QCLA 5IGDA 1L0YB 3CKIB 2WKDA 2B2YC 2O2LD 2A5HA 1D5MC 2VJJA 3FKSA 3ZPNA 2KOLA 3H3VC 5M5XB 2A68C 1SNDA 1COWA 1U9RA 1BR9A 2OXPA 1NR2A 1GUSA 5DM63 3SVMA 2Z8LA 4CBVA 2KVOA 4ZKCB 3T56B 1B9NA 1PFNA 2SEBD 3A54A 3GVKA 1ET6A 4FVMA 2A69C 4XOTA 4R9WA 4HSPA 4V190 3AB9A 1SMYC 2HCCA 2F4IA 1IL8A 4LMQD 3BG3A 2H1EA 4MIUA 3BDLA 2L4NA 1AN8A 1EIHA 2K32A 2WAQB 2B2WA 3W3AA 4KJOA 1X3QA 1H9KA 3BH4A 1F2ZA 3S1MB 4I7ZC 4MHEA 1HXYD 4BWGB 1H9JA 1SYDA 4LAAA 4IUQA 1H9MA 1EYDA 3QOLA 2N88A 3ERQA 3D8GA 5I2YA 4XXEA 1WTXA 4YIJA 1UAPA 4G6IA 5IT9E 3GO5A 1JWSD 2HDLA 4A3MB 3JAME 2F03A 3BDOA 2IX0A 1CHQD 3R93A 3NQTA 3OEHA 3GVJA 5CDFA 4MN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTM A;  2YYZ A;  4JBW A;  4KMU C;  3WDN A;  1H9S B;  3H94 A;  1LAB A;  2E75 C;  3VR4 A;  3NE5 B;  2DNE A;  2D62 A;  3M4Y A;  1T5E A;  2AUJ D;  3A8K E;  1IYU A;  1OXT A;  3I73 A;  3QIA A;  2ZT9 C;  2AUK A;  1BDO A;  3SE0 A;  2DNC A;  2JEB I;  3T53 B;  4RCN A;  3T51 B;  2A69 D;  1Y69 U;  2EJF C;  4LJZ C;  1H9S A;  2A6H D;  3I72 A;  2A68 C;  2PCF B;  4DNR B;  4TQU S;  1OXU A;  1OXX K;  2E76 C;  3IFT A;  5BN4 A;  2BA1 A;  3LWU A;  2DN8 A;  3CRK C;  5C0X G;  1GUS A;  1Y8O B;  1ZYR C;  2Q8I B;  4TKO B;  2EDG A;  1VF7 A;  1Q1B A;  1VF5 C;  3T56 B;  1B9N A;  1HQM C;  2E74 C;  4JK1 C;  3VA7 A;  3GD7 A;  3VR6 A;  1Y8N B;  2IT1 A;  3PUX A;  2A69 C;  3TZU A;  2F1M A;  4HR7 B;  1K8M A;  2A6H C;  2B8F A;  2K7V A;  3M85 A;  5K36 H;  1Q12 A;  1LAC A;  4DK0 A;  3GQB A;  1EWH A;  1DD2 A;  3RLF A;  1HCZ A;  2KCC A;  4PV1 C;  3AB9 A;  4XIG S;  5BN5 A;  2PPB C;  1SMY C;  1A6X A;  4L8J A;  3OPO A;  3PUY A;  2JE6 I;  4DK1 A;  2QF7 A;  1Z7T A;  3P20 A;  3BG3 A;  1GUN A;  3A7L A;  1GUG A;  1HTP A;  2KA7 A;  1PMR A;  2CW0 C;  1B9M A;  4KI0 A;  4G7O C;  1K8O A;  1V8Q A;  1GHK A;  4KKT A;  3PV0 A;  4XTC S;  4KKS A;  1ZKO A;  5KNB A;  2K32 A;  2R6G A;  4G7H C;  3FPP A;  1I6V C;  3W3A A;  1CI3 M;  1H9R A;  2A6E D;  1G29 1;  2D2C C;  5JEA H;  3OOC A;  1OXS C;  1GUT A;  3LNN A;  4DNT B;  5A35 A;  5K36 G;  2BA0 A;  4LK1 C;  3KLR A;  1Q1E A;  3DXJ C;  3A8J E;  2BE5 D;  3I4L A;  3FMC A;  3A8I E;  2O5J C;  1DCZ A;  1H9K A;  1V43 A;  4KHZ A;  1E2Z A;  3QG1 A;  2V4D A;  3M7N A;  2B8G A;  2EJM A;  3L7Z C;  3ND9 A;  1IW7 D;  1OXV A;  2LMC B;  3QJY A;  4I7Z C;  5BN3 A;  1FYC A;  1E2V A;  4KN7 C;  1Q90 A;  3PUZ A;  3VR3 A;  1CFM A;  2PNR C;  3PUW A;  2A6E C;  1TKW B;  1H9J A;  4OO1 G;  1E2W A;  2K33 A;  5KNC A;  5KND A;  2BDO A;  3VR2 A;  1HPC A;  4G7Z C;  4OO1 H;  1GUO A;  4GZY C;  2BE5 C;  3A7A B;  1TU2 B;  1YNJ C;  3D31 A;  1YNN C;  5JEA G;  1H9M A;  1QJO A;  1Y8P B;  1O78 A;  3HGB A;  3MXU A;  3OW7 A;  1FR3 A;  1ONL A;  3SDZ A;  4KKU A;  3U9S A;  1Z6H A;  4BA1 I;  1IYV A;  1GHJ A;  2JEA I;  1IW7 C;  3CRL C;  2O5I C;  4H0L C;  2NN6 G;  4IQZ A;  1VDZ A;  4OGQ C;  3ND8 A;  3D4R A;  4H44 C;  4IFD G;  1DXM A;  2EVB A;  2NN6 H;  2L5T A;  2AWO A;  2EJG C;  3IKJ A;  3N6R A;  4IFD H;  2JXM B;  3BDO A;  1GJX A;  3VR5 A;  2NN6 I;  3PUV A;  1VCI A;  1O7L A;  4BA2 I;  2D5D A;  3EQL C;  5C0X H;  4KN4 C;  4H13 C;  2A68 D;  3MFY A; 
#chains in the Genus database with same CATH topology
 1BCP F;  3SJZ A;  3NBH B;  2XWB B;  1STN A;  2K52 A;  5J22 A;  4P6V F;  1K9M C;  3M7G A;  1CSQ A;  1XWE A;  2X6G A;  5DLQ E;  1NNX A;  4A3E G;  1L2F A;  2HMA A;  3Q39 A;  2XVS A;  3TN2 A;  2DNC A;  2PQE A;  3V76 A;  3BYT B;  3MEH A;  4TMZ A;  3P26 A;  4NPS A;  2C5H A;  3HOY B;  3Q24 A;  2RC5 A;  3HOZ B;  1QNK A;  3U4V A;  3OZW A;  4K5W A;  4U9U A;  1VQ6 B;  3NEM A;  3LWU A;  4J1M A;  1A3V A;  4A76 A;  2F4N A;  1EWC A;  1VF7 A;  1PTO B;  1C7Y A;  1SE3 A;  3D4W A;  3C2Q A;  2XZL A;  2F0P A;  1DOM A;  1TTT A;  1VQ6 A;  5EQ0 A;  3TZU A;  1YIJ B;  4DAV A;  4B3M Q;  2XEX A;  5DAU A;  4OHJ A;  1G51 A;  4JI2 Q;  2DOG A;  3CCS B;  2B39 A;  3GDE A;  4K2L A;  3SEJ A;  1N9W A;  2ZZE A;  2DJF C;  1PYS B;  4N3G A;  4P74 A;  1YIJ A;  1DYQ A;  2IW3 A;  1YJW B;  1R4Q B;  2Q2U A;  3E0J A;  2KA7 A;  3CCE A;  1W9X A;  4OIJ A;  3CCS A;  4DV3 Q;  5C0X J;  1EU3 A;  3A5Z B;  1QE6 A;  2AQ3 B;  4AC9 A;  1JB7 A;  1YJW A;  3HOY H;  3R6J A;  3F1Z A;  5T1I A;  5FLX L;  3CC7 A;  3HOZ H;  2IY5 B;  3HOU B;  1W6K A;  2BE5 D;  2RSO A;  3H09 A;  4U68 A;  3H9N A;  5IYQ A;  1PTO H;  4DKA C;  4YY3 Q;  3RNU A;  3I4M B;  2L12 A;  2PIA A;  1EY8 A;  2R7D A;  4JPB W;  3TSS A;  3M7N A;  2XZP A;  2B8G A;  3G71 A;  1N33 L;  5BN3 A;  4B44 A;  3VR3 A;  1FNM A;  5AJ3 Q;  4QQB X;  2NBF A;  1E2W A;  5EKI A;  1ZEQ X;  5GAH C;  4LF9 Q;  3VYS A;  5C4H A;  5CV8 A;  4B9W A;  4OO1 H;  1GUO A;  4YAU A;  2XSC A;  2OTL B;  5D3D A;  2Z4H A;  4RWS C;  2VQE Q;  3SDZ A;  4PMW A;  1DDG A;  2WB1 E;  2B29 A;  2F0L A;  4MYT A;  1GHJ A;  1NAP A;  2DER A;  3HP3 A;  1HFN A;  1M8A A;  4K5V A;  2OTL A;  1CZG A;  4QHY A;  4DK6 C;  4GNX B;  2TMP A;  3J80 i;  3N6R A;  3IKJ A;  1PRT B;  1GD7 A;  1BMF A;  4V0B A;  5KYL A;  3CPF A;  2VXW A;  5C4J B;  3EQL C;  3PIO 3;  3AVY A;  4JYA L;  4ULL A;  4GNX A;  4FK8 A;  1K28 A;  3ULP A;  1X9N A;  2K5H A;  3K59 A;  2F4V Q;  1WCM G;  3I56 B;  2WII B;  4APV A;  2JK8 A;  1PH5 A;  5M3M H;  3FVQ A;  4DAY A;  5CMD A;  1BO0 A;  1L0X B;  5E3F A;  1RCV D;  3S2D B;  1TS5 A;  4ODG A;  3W2H A;  4RGN A;  1QGA A;  2HCJ B;  5C44 G;  3I56 A;  2VS1 A;  4X3U A;  5CR3 A;  1V9P A;  3PUN A;  5FL7 A;  3OAA A;  4AYB B;  5BN4 A;  2BGJ A;  1FGU A;  4P71 A;  3HOW G;  1ZYR C;  1Y1W B;  2EZV A;  2EDG A;  4CJ1 B;  2ZTN A;  2WV6 D;  2GJR A;  1UMK A;  1EZ6 A;  5IGF A;  2EIF A;  3VYU A;  4EQN A;  3TDQ A;  3Q23 A;  5JPN C;  2MP1 A;  2ZL7 A;  1PH1 A;  4QL5 A;  1K8M A;  4B3M L;  1CSP A;  4JI2 L;  4BY1 G;  1N07 A;  3NHH A;  1JWM D;  3W2D A;  2NVX B;  2JN9 A;  2EYF A;  4OIK A;  1KD1 D;  1JT8 A;  3BVZ A;  3ZZU A;  1CKM A;  4XON A;  3RY8 A;  2PI2 E;  5IYC G;  1TII D;  1BF4 A;  4DV3 L;  2YV5 A;  5JJL A;  4GN5 A;  1PMR A;  2NWG A;  1WPC A;  5DEH A;  1MKH A;  2B63 H;  2H5X A;  4DR6 Q;  3CP8 A;  4A3L G;  3DWQ A;  1J5E L;  5CBA E;  4TN1 A;  3RN5 A;  1CM9 A;  2I46 A;  2ICE C;  1S4Z A;  1W2B B;  3LNN A;  1OO9 B;  5K36 G;  3D6C A;  3C3L A;  2CH4 A;  3NPP A;  2GA4 B;  3NWS A;  2QA4 B;  3A8I E;  1Y1W H;  3KFU A;  3NSW A;  4YY3 L;  4KY7 A;  4A3K G;  2I5M X;  3J81 E;  3UDG A;  5A2Q L;  2ID0 A;  3T4A C;  1V5V A;  3DLL A;  4NXM Q;  2NYZ D;  3CRZ A;  3DM1 A;  4YEL A;  3DEP A;  1W2B A;  3ASP A;  3AVU A;  3WXM A;  1NE3 A;  1QUE A;  4BBS B;  5AJ3 L;  4Z4U A;  4AH6 A;  5IGB A;  3HAG A;  3R2T A;  4LF9 L;  4G7W A;  3TBI B;  1K8A D;  3PIP A;  3OFN A;  5CV5 A;  4ME5 A;  5F4J A;  1VQE A;  5C3W A;  2C4U A;  3K7A B;  2DGY A;  2B7B A;  1YNN C;  2XRQ D;  2KCM A;  2K04 A;  2VQE L;  4KY5 A;  1GJR A;  4OP7 A;  2EY2 A;  4JW0 A;  1WTR A;  3TP8 A;  3ND8 A;  2JYO A;  3IFD A;  3QOJ A;  3ONA B;  1VQB A;  1G2S A;  1WOP A;  1IXR A;  3D3R A;  3ZYY X;  1JB9 A;  5THX A;  2V7X A;  1R5B A;  1VQP A;  2YWG A;  1YHA A;  4OEM B;  2Z1C A;  4ZLT F;  1QCB D;  1YNX A;  2EYP A;  3HOV G;  4ACA A;  1BCP B;  1MIU A;  4A3I G;  2L55 A;  1HRJ A;  2F4V L;  4K8J A;  5HGT A;  2QDB A;  4PMB A;  3BZK A;  4M0L A;  3I7F A;  4JI1 Q;  1V1Q A;  3DHQ A;  3VR4 A;  2B5O A;  1RTN A;  1S3O A;  4K5X A;  5FIU A;  1YHQ B;  2WAC A;  4A3E H;  5FLM G;  4RDL A;  4X7F A;  4XM3 A;  2EY6 A;  3K7A H;  1VQH A;  4UZU A;  4XQN A;  2VL6 A;  4GLA C;  3IFT A;  1E79 A;  1STE A;  5ELD A;  3BNW A;  1NB0 A;  1PZJ D;  4JBK A;  4A3J B;  1KLU D;  5A88 A;  1SFO B;  5EPK A;  4Q5V A;  5HZA A;  4X64 Q;  1QVG A;  1KHI A;  2B2Y A;  4BY7 B;  1FRQ A;  2F0U A;  1Y8N B;  3CCJ A;  3KF8 B;  3ZZ0 A;  3S1Q H;  2R7Z B;  3RMH A;  2L1B A;  5H1S E;  1HZ9 A;  1QIL A;  2KCC A;  4XIG S;  2F0T A;  5BN5 A;  4JI5 L;  4YAO A;  1QVF B;  3PUY A;  5EAY A;  3CMA A;  4HIM A;  5IGC A;  4MYU A;  3VO2 A;  1KDC A;  2N3S A;  4DAP A;  4DR6 L;  2PLF A;  3S14 B;  4G7O C;  1L1O B;  2JA6 B;  2IL8 A;  5HUR A;  1N8R D;  4XQF A;  1Q8I A;  1K3R A;  1BX1 A;  1JOK A;  3SGI A;  3JU4 A;  4HIK A;  3F8T A;  4G7X A;  3NTK A;  1VQK B;  5JBQ A;  1L1O A;  2F0Q A;  3PSI A;  3BCD A;  5TY0 A;  3H3V H;  4RPB A;  1HUN A;  4L6T B;  4NXM L;  3LO8 A;  1E22 A;  5KGU A;  1SFO H;  2Q6O A;  4A3D B;  1K8A C;  3GTO H;  1E2Z A;  1WD0 A;  1SE4 A;  1QG0 A;  4EGV A;  1Q82 C;  4WWV A;  3W5O A;  2KHI A;  2DEU A;  4KK7 A;  4J0Q A;  1KAB A;  2LXK A;  3K58 A;  1IBK Q;  2QGG A;  1TWC B;  5EBD A;  1NUC A;  3PIP 3;  3M4O B;  2X69 A;  1BBW A;  3A7A B;  4B3T Q;  4WFN 3;  1O78 A;  2VUM B;  2VW9 A;  3B78 A;  4KKU A;  1Z6H A;  3SK8 A;  1RTO A;  1SYF A;  2JEA I;  2NVX H;  1G7C A;  3S14 H;  2OCE A;  2BMW A;  2C9O A;  1TQO A;  2F0H A;  4RG1 A;  4EH1 A;  3G7L A;  5FO1 A;  1T6X A;  1HZB A;  1AE2 A;  1CA6 A;  5GV7 A;  2CND A;  1WTQ A;  1SE2 A;  2JJQ A;  4QFM A;  1VQ8 A;  5IOD A;  1KTK A;  1DGS A;  4IUV A;  3UE1 A;  1AH9 A;  4DR7 Q;  1JJ2 B;  1LT4 D;  2WB1 B;  5JPM C;  5C0X H;  1X3F A;  2E2J B;  2J4X A;  1FJG Q;  1AP0 A;  4JI1 L;  1PVO A;  1U4R A;  1KZL A;  3LQ6 A;  2ZM6 Q;  4POG A;  3R8B A;  3NE5 B;  3ZC3 A;  1W6J A;  4NXN Q;  3M4Y A;  1TLL A;  1IJE A;  3HKS A;  1TWC H;  2WAQ G;  4IOC A;  3OJX A;  1E63 A;  4HJ9 A;  4JI3 Q;  1PRT C;  3SR1 A;  3OWE B;  4ZAI A;  1PDQ A;  2VUM H;  4PGO A;  2X6Y A;  1VQ5 B;  1FD7 D;  3NP8 A;  4YHH Q;  2XND A;  4FXU A;  4HJ8 A;  2ATW A;  1AW7 A;  1GM5 A;  4S3S A;  5JVH 3;  1Q1B A;  1I50 H;  2KCN A;  1EYA A;  3KDF B;  4K14 A;  3ULL A;  4XKW A;  1UD4 A;  1G8Z D;  1Y0Y A;  1HNZ Q;  5C4X B;  4QIW B;  3QFT A;  1SNQ A;  1I8D A;  3G6E B;  1VQ5 A;  3I91 A;  2R93 B;  2B8F A;  2K7V A;  3B6Y A;  2JA7 B;  4CKB A;  1ELO A;  3A0J A;  3KDF A;  2VBV A;  1C9O A;  2E2J H;  1IHZ A;  3QSY A;  1SSO A;  4PV1 C;  3K5M A;  5EBC A;  1NY4 A;  3G6E A;  4Y9U A;  1EFU A;  1CHP D;  1K0R A;  1GVP A;  5C5L A;  2DUD A;  1GUN A;  1GUG A;  1QG7 A;  2XGT A;  1T5X D;  1HA3 A;  4IAL A;  3IL8 A;  1KNE A;  4QV2 A;  4A3M G;  1YJN A;  1UUP A;  1X3E A;  2XIW A;  3B8H A;  4DR4 Q;  3WNB A;  1PHJ A;  5IY0 A;  1CQF A;  1HNW Q;  4DNI A;  1U4L A;  1C4Q A;  4KY6 A;  3HEJ A;  2PW5 A;  1FRN A;  5FLX c;  3AVV A;  4GS3 A;  2M5S A;  2V4D A;  4A3K H;  4DR3 Q;  4Q0F A;  4B3S Q;  3ASQ A;  1R5O A;  4RHS A;  2PI2 A;  2RQX A;  1HUM A;  1XMQ Q;  3ITP A;  2R93 H;  2KUM A;  2Z0S A;  1IBK L;  4KJN A;  5JAV A;  3Q8D A;  1RQP A;  2X6X A;  4OWX B;  4G7Z C;  1TWG B;  2G9D A;  3N52 A;  1TU2 B;  2H4O A;  2CQO A;  3HOY G;  3A3B A;  3ZBU A;  5ELC A;  3HOZ G;  4TMW A;  2VB3 X;  5M5W H;  1RD9 D;  1OTC A;  3FKI B;  3J7A 5;  3T16 A;  1F2M A;  2ZXO A;  3A8I A;  1B44 D;  1S5B D;  3KJP A;  1SN8 A;  2L5T A;  1EP1 B;  2F0S A;  3CC4 B;  2JXM B;  5ELF A;  2RHQ B;  3HRZ C;  1VQD A;  4C56 C;  1AFP A;  3CHB D;  4DR7 L;  4RCY A;  1V0F A;  3I8Z A;  2F0N A;  5ELN A;  4RA8 A;  5IP9 G;  3FPU B;  3BVM A;  1MSH A;  1FJG L;  1PH4 A;  3S24 A;  3J80 E;  2QCP X;  2Z4I A;  4X3S A;  4E6I A;  3HOV H;  4A3I H;  2MUY A;  3CC4 A;  3MC0 B;  4G4K A;  3A74 A;  5GAG C;  1BLI A;  1R9T H;  1N36 Q;  2K14 A;  4B3F X;  1I6H H;  3E9H A;  3RZD H;  1W3S A;  2JEB I;  4RLZ A;  3T53 B;  3W5H A;  1QFJ A;  2XGJ A;  4NBS A;  5HY6 A;  2HHH Q;  1VQI A;  5EPL A;  3U2Q A;  4DFA A;  1PFB A;  4R4T A;  5C3E B;  4GQN A;  4YHH L;  1ICF B;  2ZJP A;  1BCP C;  1M4V A;  3HOU G;  1XTC D;  1PLF A;  4M53 A;  4TKO B;  2Q6I A;  3I4M G;  1EY5 A;  2MO0 A;  1HNZ L;  1VHO A;  4Z4Y A;  5C6A A;  4XOR A;  1EOT A;  1BBX C;  4KHP Q;  1X32 A;  4RGO S;  2AMC B;  1TT2 A;  5M3M G;  4AYB E;  1IBL L;  4LWC A;  4EX5 A;  2BOS A;  3PO2 B;  2G9H D;  3CPW A;  3VYR A;  2X0K A;  3LX0 A;  4IUR A;  4QVJ A;  1JA0 A;  4RHR A;  5E1F A;  1BUV T;  5FKA C;  2Z6B D;  5JOB A;  2EXD A;  1KK0 A;  3K0X A;  1D8T A;  1X54 A;  4LC0 A;  3L2P A;  3LVB A;  2JE6 I;  2RCF A;  2FIN B;  4HAE A;  3ONY A;  1S0U A;  2CHB D;  3LGJ A;  1TY0 A;  3FJO A;  3PA1 A;  4HIO A;  2E1R A;  3VO1 A;  2Q8T A;  4LFA L;  3E9I A;  3VDY A;  2OBS A;  1GHK A;  4XTC S;  4DR4 L;  2EYO A;  1F9P A;  3S15 B;  2NZ1 D;  3KUP A;  3AGP A;  3VNU A;  1H9R A;  3H0G B;  2OK8 A;  2NUC A;  3FPK A;  4DNT B;  4KHV A;  3EVQ A;  1Q1E A;  1QWY A;  3UI2 A;  3KLS X;  1SLJ A;  4FNF A;  3GTQ B;  4WJ4 A;  4IJL A;  2ZZQ A;  4KHZ A;  2TSS A;  1V1O A;  1EFR A;  3S1R H;  4FN5 A;  2EJM A;  1YX2 A;  4QUF A;  2FMC A;  1XMQ L;  1XMO L;  1IW7 D;  4IO9 A;  3QJY A;  1K73 C;  5I4D A;  1JOO A;  3PO2 H;  4KN7 C;  1UEA B;  1A8P A;  1AEX A;  1EUJ A;  1HZA A;  2A6E C;  3D6W A;  2ZTG A;  2VZA A;  3I90 A;  3M4Q A;  1HPC A;  3K57 A;  2QGQ A;  3BZD B;  1CKO A;  2QEX B;  1YNJ C;  3L3O C;  1EXM A;  4A93 B;  5M5X H;  2VB2 X;  3MMP A;  1Y1W G;  2CH4 W;  4PC1 A;  1XNQ L;  2NN6 G;  4L5S A;  1JE5 A;  5IYB G;  3D4R A;  3TRE A;  4LNQ A;  2EVB A;  4M8A A;  1Q8K A;  3H0G H;  3S2H B;  2JDI A;  1B4O A;  1F9S A;  1ZM2 A;  1PA6 A;  1YIT A;  3B82 A;  1VCI A;  3F2B A;  1EYG A;  4PAA A;  4Q7J B;  2K5D A;  2N49 A;  4ZYS A;  4BA2 I;  1CUK A;  4Z4S A;  4GN3 B;  3TME A;  3H15 A;  2K5V A;  1ENF A;  3PMF A;  4FXD A;  3I2Z A;  3I55 A;  1I7P A;  1HZC A;  1Q81 C;  3H94 A;  3GSI A;  1KC8 D;  3TRZ A;  2VNI A;  5IT9 L;  4WQM A;  3CD6 A;  2ZBU A;  3FEW X;  3JAM L;  1OXT A;  4B3G A;  3A8J A;  1GO3 E;  4EVO A;  3K6O A;  2E1B A;  2HHH L;  2PW7 A;  3T51 B;  5FNZ A;  3WBK A;  3J7Z C;  2R61 A;  2A6H D;  1AZP A;  2D3N A;  4DNR B;  3CCM B;  4TQU S;  1GOZ A;  1UE5 A;  2E76 C;  2HCI A;  2F0D A;  1I4H A;  1EYC A;  5NUC A;  5DSZ A;  2LS0 1;  4ZUI A;  4K1X A;  5CC4 A;  4DV5 Q;  4KHP L;  3OJW A;  4RH6 A;  2N55 A;  1EZ8 A;  1JNY A;  1B1Z A;  4BS9 A;  4BBS G;  5IYP A;  3S1M H;  1JWU D;  4HTH A;  1WJJ A;  2KVM A;  4QMG A;  4C3I B;  5BSX A;  1G6Z A;  3CCL B;  2ES2 A;  3OE7 A;  1HCZ A;  3NBH A;  4YEJ A;  5FO7 B;  4ALP A;  1LTA D;  1A6X A;  1LT6 D;  4IFD J;  4DK1 A;  4XYO A;  3K80 C;  3P20 A;  3SEB A;  2JP1 A;  3CCL A;  1K8O A;  3BZC A;  1ROD A;  3QB3 A;  5FO9 B;  2W6I A;  4Z4V A;  2OEO A;  5I9O A;  4DR1 Q;  4C3J B;  5M3F B;  1OGI A;  4LF6 Q;  4X6A H;  1G29 1;  4A3M H;  1G6P A;  3R2I A;  4A75 A;  3F2U A;  4UPA A;  1Q86 D;  2YWH A;  2HUG A;  2RKS A;  5GRO A;  4XKV A;  1V43 A;  4N8X 1;  5C3X A;  2OF1 A;  4YHB A;  4J6H A;  4DV4 Q;  4C1N K;  4HID A;  1LO5 D;  1A8V A;  2FHT A;  4JC0 A;  3AST A;  2YTX A;  4B3S L;  3PUZ A;  1CQX A;  1CFM A;  1TKW B;  4G1B A;  2R6H A;  3ONU A;  1MAB A;  2E2H B;  4G57 A;  4X06 A;  5TR9 A;  2MPM A;  4TMV A;  4U67 3;  4ZCL A;  3HGB A;  1JC7 A;  3AVX A;  4PZ7 A;  2NZO A;  4OO1 I;  3D4D A;  4ZK9 B;  1EIF A;  4PG3 A;  3CTA A;  4YAF A;  3G6J B;  3BS1 A;  4X7C A;  4A3J G;  3S17 B;  4RPD A;  1OB0 A;  2I0Q A;  4IQZ A;  2XOK A;  1I4X A;  4ZV4 A;  1WTO A;  4IFD G;  4PC2 A;  4BY7 G;  4HJA A;  4JV5 Q;  2R9V A;  3ES9 A;  2EJG C;  5ELE A;  3CCU B;  2R7Z G;  1JE4 A;  1VQL B;  3PUV A;  2N8N A;  4CHT B;  4BBR B;  2L15 A;  3SLN A;  2LXJ A;  4B47 A;  5CV9 A;  2RBM A;  4KV6 A;  5IP9 H;  2ZL5 A;  4IPH A;  3DUZ A;  5IYN A;  4F8M A;  2OK7 A;  5HKK A;  3WDN A;  3CB4 A;  1VQL A;  1YZ6 A;  2XRS D;  5K5P A;  4GLX A;  2QTL A;  4FF1 A;  2DNE A;  1T5E A;  2RDF A;  1IYU A;  2JA6 G;  1K8G A;  2ZT9 C;  3AU7 A;  1X3P A;  4LUV A;  1ZM9 A;  4RFB A;  3T1Y Q;  3E3X A;  4M4S A;  2EYH A;  4RM0 A;  1D8L A;  3GTK B;  3A56 A;  1C8C A;  3TS0 A;  4PAB A;  3CCV B;  3O13 A;  5GAD C;  1BQE A;  3I70 A;  4M1U B;  5C0X G;  4DV6 Q;  3S17 H;  3C46 A;  4DV5 L;  3HOU H;  1EY4 A;  2CKZ B;  2DYI A;  3QE2 A;  4A3D G;  3K7U C;  2C4T A;  3I4M H;  3CCV A;  1ZM4 A;  2CW0 D;  1FNW A;  1N06 A;  2EQS A;  1T9H A;  1K3B C;  2B3G A;  2PE3 A;  3GIR A;  1NMG A;  4P9S A;  4HR7 B;  3VMF A;  3M3Y B;  4RD6 A;  5E6T A;  4DF7 A;  1VQN B;  4RCO A;  1WVL A;  3PUM A;  5IE8 A;  4GOP C;  3NUC A;  2VUM G;  4QIW E;  5EKK A;  1EY7 A;  2K05 A;  2BM1 A;  4NKL A;  1KQS B;  1Q3L A;  1HTP A;  1F2L A;  1VQN A;  1E62 A;  4DR1 L;  2F43 A;  1FNU A;  3MWY W;  4OXP A;  1TWF B;  1W87 A;  1WFQ A;  1ZKO A;  3CW2 C;  4LF6 L;  2C2W A;  1W35 A;  3E5S A;  4P6Y A;  2UUA Q;  1SKY B;  1B23 P;  1H42 A;  1KQS A;  1SNC A;  1PZK D;  2X3U A;  2QDX A;  2VY3 A;  3PO3 B;  1CKN B;  2WB1 G;  4RD1 A;  4L63 B;  4Z4Z A;  4DGZ A;  5C4J H;  2VNH A;  2JN4 A;  1B2T A;  4X65 Q;  2C5C A;  2WZN A;  2XN9 C;  2GN5 A;  4DV4 L;  3X3M A;  2E2I B;  1E0B A;  3JC6 6;  1CKN A;  1WTH D;  5I9P A;  3S1N B;  4LFC Q;  5J3O A;  4CKE A;  2KEC A;  4B9X A;  3M3Y H;  2HQL A;  2VQF Q;  2GQF A;  1HVX A;  4XR6 A;  2A73 B;  3URY A;  5H5J A;  1NR4 A;  2IWH A;  1KDB A;  1E1O A;  2MHV A;  3S2D H;  2BE5 C;  3RUZ A;  3CF5 A;  4OEL B;  1QJO A;  1K83 B;  4WZT A;  5IYR A;  3J81 L;  2CF4 A;  4HSV A;  1EWY A;  4Z4R A;  1D1N A;  1JA1 A;  4KLK A;  4H0L C;  2C78 A;  2ZXH A;  1B7Y B;  4OGQ C;  4GKK Q;  3M9B A;  2WSS A;  4JV5 L;  1EQT A;  3QFR A;  2NN6 H;  5C4X G;  1EY6 A;  3LWE A;  5IYB H;  2R93 G;  2YWE A;  3NEN A;  3KBX A;  2HDN B;  2JA7 G;  5I2X A;  3PO3 H;  2QA4 A;  1RF2 D;  4KN4 C;  5CYU A;  4HCE A;  1BX0 A;  3MFY A;  1PTO D;  3R3O A;  3G4S B;  4I65 A;  3RN2 A;  2E2I H;  1J9O A;  3U58 A;  4XN3 A;  1KK2 A;  4WRD A;  5COY A;  4XQQ A;  1CNE A;  3S1N H;  3AMU A;  3I73 A;  3QIA A;  3T1Y L;  2BF4 A;  1STY A;  3K0Y A;  2K28 A;  3G4S A;  4QGU A;  2ALY B;  1SXT A;  2BV3 A;  4DV2 Q;  1XXG A;  2WR8 A;  1A62 A;  2HT1 A;  4P26 A;  1K83 H;  1TWA B;  3MAQ A;  1OXX K;  1YLO A;  4FP5 D;  4IUU A;  4N9T A;  4DV6 L;  3MZ5 A;  2NVT B;  2UXC Q;  1IYJ B;  4OPO A;  1F9R A;  3STB D;  1VF5 C;  3OP1 A;  1A3U A;  3UDF A;  2A1A A;  4M1K A;  4B08 A;  2HIV A;  2MQH A;  2IT1 A;  5IGE A;  4II3 A;  1A15 A;  3AYH B;  4BBS H;  3PVD A;  3J81 k;  5IP7 G;  1UD2 A;  3C1E A;  4ZGQ B;  1LTL A;  1WI5 A;  4K2K A;  3J7A F;  4POF A;  1YJ9 B;  1Y14 B;  3FKI G;  2QF7 A;  3K5L A;  3U9O A;  3A7L A;  1SBB B;  4X05 A;  1KNA A;  1TVX A;  4DV1 Q;  2D0O A;  2QIL A;  1YHQ A;  3WND A;  5IWA Q;  2WIN B;  1XE1 A;  1JB3 A;  5KNB A;  2UUA L;  2Q8R E;  1S5C D;  4G7H C;  3GTM B;  2EIX A;  1KD1 C;  4FO2 A;  3CCQ B;  1M90 D;  4UP8 A;  1LM0 A;  3JAM i;  2CCZ A;  4HMI A;  4LK1 C;  2NVT H;  4B43 A;  2O5J C;  2D3L A;  4X65 L;  4R1J A;  2QN6 A;  3I4N B;  4XMY A;  2OYN A;  3H3V I;  2RA4 A;  2B7C A;  3NBI A;  3KF8 A;  4NDX A;  2NVQ B;  1K28 D;  2VBU A;  3KYH C;  4LFC L;  4O42 A;  5DM7 3;  2EY1 A;  4L5T A;  5I6W A;  3WQZ A;  2F0F A;  2PNR C;  3EIV A;  3V7A A;  4FXK C;  1SAP A;  4N3N A;  1ZXT A;  1PH6 A;  1STG A;  4YAW A;  3EBE A;  1QVF A;  5BSY A;  2OTJ B;  5C3E G;  4RD2 A;  3OW7 A;  4RD0 A;  4FXG C;  1WOO A;  1W0J A;  4BA1 I;  2F0E A;  1IYV A;  4GKK L;  3CRL C;  5F4M A;  4A3J H;  5M5Y B;  1BNZ A;  1I3Q B;  4QUZ A;  2XNJ A;  2DET A;  4IUT A;  2VZL A;  3PO2 G;  2W6J A;  4BY7 H;  4IFD H;  3OMG A;  1V0E A;  1E3P A;  1CT1 D;  1VQK A;  1L0W A;  5L37 A;  1HA5 A;  2V7V A;  1MBY A;  2F0I A;  2R7Z H;  4TT3 A;  1U4M A;  1EFI D;  1IJF A;  1EEF D;  5HXB A;  2CK3 A;  4OOS A;  1V1P B;  1QUQ B;  2NTT A;  2QEJ C;  4MTK A;  5EGT A;  3OTO Q;  4B3X A;  3JQP A;  4KMU C;  2DY8 A;  5JEA J;  5C0X I;  1N32 Q;  1JQY D;  2BGI A;  2XWJ B;  1LTR D;  1TS4 A;  3QFS A;  5L46 A;  5AFW A;  3OHX C;  4DUZ Q;  1MHW C;  1MGS A;  4C1N I;  2JA6 H;  1QGZ A;  2F0V A;  5B6I A;  3EJI A;  1SE8 A;  3OW2 B;  3H0G G;  5M9O A;  1SM4 A;  5IT9 c;  4OX9 Q;  2FMM A;  2ZXR A;  3JAM c;  5CV6 A;  1XPU A;  3P1H A;  4XN0 A;  5E4X A;  3C2P A;  1O7Z A;  2UXC L;  1ENC A;  3M4P A;  1NRK A;  3BQJ A;  4C3H B;  4Y7N B;  3OW2 A;  4A3D H;  1N0U A;  1Y1V B;  3MXP A;  3AFP A;  4P73 A;  1Z9F A;  3OZV A;  4ZQ3 A;  1JJ2 A;  4DK0 A;  4PC6 A;  2Y0S E;  1VQO B;  4YCW A;  4DXG A;  1EWH A;  1HJP A;  4PNY A;  4HIZ A;  1JMC A;  2JIZ A;  2C77 A;  1S5E D;  2IPK D;  3M4O H;  3AVT A;  4A93 G;  4JG2 A;  1EWI A;  1IL2 A;  4L8J A;  4JI0 Q;  4G1V A;  1VS0 A;  1FNB A;  1PYB A;  2FJ2 A;  5GAE C;  4DV1 L;  2YU9 B;  4LF5 Q;  3BY2 A;  3CXC B;  1XB2 A;  3MXN B;  2BH8 A;  4PC3 A;  4CJ0 B;  4X3K A;  5IWA L;  1WSR A;  2GK7 A;  1F9Q A;  2C5B A;  4X64 L;  4GKJ Q;  2L11 A;  1F2Y A;  2GJP A;  2E2D C;  4QF4 A;  4JI4 Q;  4ID6 A;  3I3C A;  5LMN W;  1OXS C;  3EN2 A;  1KRS A;  3CXC A;  1S72 B;  1KAW A;  4ME3 A;  3H6M A;  3E0E A;  1R5N A;  2K6A A;  3NK9 A;  3ZIA A;  4NCN A;  1DCZ A;  2KHS A;  4CJ2 C;  1NB9 A;  4Y7N H;  1EFW A;  2DJG C;  2VYQ A;  1LTS D;  1Q7Y D;  3HKZ E;  3QG1 A;  4IN3 A;  1S72 A;  3MHP A;  3EFX D;  1N8R C;  1H8E A;  1A63 A;  1GKH A;  2DCU A;  3NTH A;  1QZG A;  3W2I A;  3Q22 A;  1M1K D;  4OON A;  1S5F D;  3W5V A;  2IX3 A;  1OHH A;  5EKL A;  1A2T A;  1D6E C;  1ONL A;  1RJT A;  1VMC A;  2F1L A;  3PCO B;  4M2L A;  1SYE A;  3MEF A;  2Q2I A;  2V7Q A;  1PFM A;  4JBM A;  1E3Z A;  5J1Z A;  1STB A;  4LUO A;  3ULJ A;  3HOX B;  3PEN A;  1DG1 G;  4JVZ A;  1ZM3 A;  5C4X H;  2LFN A;  5JJI A;  5IIF A;  2OBT A;  3V96 A;  4C3I G;  1H8H A;  2MGS A;  1VQ7 B;  2JA7 H;  4AVZ A;  3F2C A;  2A68 D;  4DV0 Q;  3OTO L;  3J7A V;  1PTO F;  4A3G B;  1N32 L;  4B3T L;  4JBW A;  4BXX G;  1A0I A;  1H9S B;  1KLG D;  1SMX A;  3FDT A;  1I4G A;  1NJI D;  2KEE A;  3CP2 A;  5KW9 A;  4F87 A;  2M9V A;  4ZCK A;  3AEV A;  1DZ1 A;  1VLY A;  3SE0 A;  4DUZ L;  4AQY Q;  1P8L A;  3Q0A A;  2RVL A;  4C3J G;  1YI2 B;  2J7Z A;  5M3F G;  3X3N A;  2A69 D;  5J35 A;  1H9S A;  3I72 A;  3GTP B;  4WZK A;  4PQX A;  3A5U A;  3OEE A;  1X65 A;  2F0K A;  3TZD A;  4L5R C;  2GK6 A;  1SMY D;  1YI2 A;  4X66 Q;  2F0M A;  1X56 A;  2JA8 B;  2PMZ E;  2YTY A;  1JIC A;  4JK1 C;  5BR8 Q;  1VQG A;  3VR6 A;  3HOX H;  4P72 A;  2F1M A;  4OPS A;  1B2R A;  2ZM6 L;  1LT3 D;  2R92 B;  3I1F A;  4NXN L;  2V1C C;  1G7R A;  1STH A;  2AQ1 B;  1LTT D;  2V31 A;  4Y7C A;  2B2U C;  4JI3 L;  4B48 A;  3FHW A;  5IP7 H;  1TWG H;  1O80 A;  3JQQ A;  2CBX A;  3OPO A;  4HE5 A;  3W2E A;  4DN4 M;  2EOT A;  4DR5 Q;  4GOP B;  3FKI H;  1UD5 A;  5FJ8 H;  2BPO A;  4GKJ L;  4PC7 A;  1STA A;  5LMU Q;  5EMN A;  4J15 A;  3TEH B;  1EU4 A;  4XLC A;  4H9G A;  1NBM A;  4A3F B;  1T6Y A;  1CI3 M;  1FNV A;  4GOP A;  5IGG A;  3HS0 C;  1TVC A;  4BBR G;  4C2M B;  3I4L A;  5D3I B;  3FMC A;  2R7F A;  4R4O A;  1PXU A;  2JA8 H;  3E6Z X;  2KHJ A;  2HQE A;  3CW2 A;  3ZZT A;  3BJU A;  1KIX A;  3U50 C;  2VNJ A;  4XLH A;  1JCK B;  3A3G A;  2C35 B;  2ZTC A;  2RDH A;  4ABN A;  4NP5 A;  1MJE A;  1YVC A;  1IHM A;  2GJK A;  1JOR A;  4QB4 A;  3PA2 A;  3TP5 A;  1S5D D;  3U9S A;  5C3E H;  2UU9 Q;  1HNW L;  1OGJ A;  3MTS A;  4HN7 A;  1PV4 A;  2MFI A;  4TMT A;  1K9M D;  2ZL6 A;  5I6Y A;  3SKB A;  3J81 c;  5KSW B;  4A3F H;  4DR3 L;  4R8I A;  4K8I A;  5G3L D;  2G5D A;  3ASR A;  2WJY A;  3KJO A;  4XL9 A;  3DEO A;  3GTL B;  2PZW A;  4XQJ A;  2F3I A;  4RD3 A;  4LFB Q;  1DDI A;  1SRU A;  2CRV A;  3KBG A;  1EQV A;  4K6L A;  4DV0 L;  1X3G A;  4H13 C;  3JQR A;  1LUZ A;  1DM0 B;  2L0C A;  3WWV A;  1CTM A;  4YWL A;  1TUI A;  2B2V C;  4AYB G;  2RC6 A;  1GXD C;  1PYW D;  2K5Q A;  4AQY L;  1FND A;  1Y0R A;  2AUK A;  4JI8 Q;  2FFK B;  4RCN A;  3CQZ B;  4O2D A;  1SR3 A;  1DJR D;  2QEX A;  3QO2 A;  4RD4 A;  3S15 H;  4JOI C;  4K0K Q;  4WZE A;  3PO3 G;  4O1N A;  2K01 A;  1VHE A;  2KJX A;  4X66 L;  3WBJ A;  2PQA B;  2PYK A;  5DN6 A;  1O7I A;  3RR5 A;  2EXZ A;  1X6O A;  4X7E A;  3GTQ H;  1HQM C;  5BR8 L;  1HFG A;  4DQL A;  3U4Z A;  4CDF C;  3S16 B;  1SDF A;  4WJ3 M;  2V7T A;  2E5L Q;  2ICI A;  1N36 L;  1WOS A;  1VQJ A;  1UD6 A;  1FDR A;  1A3T A;  3M85 A;  4A3B B;  5LL6 X;  1LAC A;  3CC2 B;  3ZUG A;  1UE6 A;  2D9R A;  2V7U A;  2ENB A;  4TMX A;  2LZJ A;  1K0S A;  3W1G A;  4XNF A;  2F3V A;  1LYL A;  4A93 H;  4DR5 L;  3DMU A;  2NPF A;  1KTV A;  3CC2 A;  3IAY A;  3Q6S A;  1B9M A;  4HCS A;  5LMU L;  2K75 A;  4F88 A;  4KI0 A;  4EQP A;  2D74 A;  1LV9 A;  1FVI A;  2Y0S B;  1E7Z A;  3CQZ H;  3L0O A;  3WY9 A;  1B53 A;  2D2C C;  5JEA H;  3CCM A;  3OOC A;  1QNU A;  1KJZ A;  5J3B A;  4CGY B;  1XQB A;  3S2H H;  1IKL A;  4YAL A;  2QTZ A;  4PMC A;  5JJK A;  4Z9C B;  1EIY B;  3BC9 A;  1PJ6 A;  1G7T A;  2JA5 B;  4X3T A;  5AN9 A;  3S16 H;  1OXV A;  3P7J A;  4XLA A;  4RKB A;  5IK2 A;  1Q90 A;  4A3B H;  1QFZ A;  3ER0 A;  1WOR A;  1P4M A;  4OPV A;  4JYA Q;  2NTS A;  3MHB A;  1WTH A;  3BU2 A;  5C4Z A;  4OWW B;  5CV7 A;  3RD4 A;  3ISX A;  4AIM A;  2XZO A;  4P22 A;  2Q2H A;  3HKZ B;  5ELB A;  5LL6 S;  1YHB A;  2UU9 L;  2ZXI A;  1VQ4 B;  2V7W A;  3PGZ A;  1IW7 C;  4DUY Q;  5ISR A;  2ZIT A;  1PH2 A;  2B2T A;  1S40 A;  2Q6L A;  2I5H A;  3I4O A;  5EJW A;  3WOF A;  1XX8 A;  3NQI A;  4ZKB B;  2ZXP A;  1VQ4 A;  1PFS A;  4TSS A;  2IX1 A;  4LFB L;  3KL9 A;  1PH8 A;  4IW3 B;  2PZU A;  1O7L A;  1VJS A;  1WDT A;  4RAU C;  4LF7 Q;  1IKM A;  1BJK A;  1E1Q A;  2D5D A;  1N0V C;  4C3I H;  5COR A;  3UDI A;  2JA5 H;  2WZP P;  2RHS B;  1ZYR D;  1W34 A;  3CPX A;  1SRO A;  2E75 C;  2ZZG A;  3D0F A;  1WTP A;  4BXX H;  4OL7 A;  2D62 A;  4B4D A;  4XD7 A;  3CCE B;  3A8K E;  4YWM A;  3WYA A;  2J7K A;  4TRD A;  1QVC A;  4JI8 L;  3OIQ A;  2K5W A;  3OIP A;  3RLN A;  2QDL A;  1Y69 U;  2EJF C;  1W0K A;  4DU9 A;  1G7S A;  4C3J H;  4GLV B;  2EYM A;  5M3F H;  4K0K L;  3KLS A;  4FF4 A;  3CC7 B;  1A2U A;  3BCF A;  3DDY A;  4K6D A;  2SNS A;  3AGQ A;  2X8K A;  4PZ6 A;  3ICE A;  2RDG A;  1KC8 C;  1PH9 A;  3I4N G;  2WJV A;  4DR2 Q;  2E74 C;  1J5E Q;  1LTG D;  2AQ2 B;  3BVG A;  2EE1 A;  2E5L L;  3CCU A;  1XPR A;  3G71 B;  2NVY B;  4LBY A;  2A6H C;  3EA6 A;  3G48 A;  1KXL A;  4NW2 A;  1GO2 A;  5FLX E;  2E2H H;  4OWT B;  2ZTD A;  5JJZ A;  4P3Y A;  3DWA A;  1XNR Q;  2F0W A;  2PMZ B;  2AKW B;  3GP7 A;  5M3M B;  1Z7T A;  2GVA A;  3W1B A;  4JI6 Q;  2NB0 A;  5KIX A;  4DA2 A;  3ERO A;  3GV3 A;  5IYD G;  1HTL D;  2AHO B;  2ZJQ A;  4ASU A;  4DAM A;  3MCA A;  1IZ6 A;  2FXQ A;  4HED A;  1I6V C;  2WPD A;  2DY1 A;  4CDE C;  2OWO A;  1GUT A;  2AHO A;  3KLR A;  4IZ8 A;  4RDJ A;  1YNN D;  2PZT A;  2X6W A;  2IJ0 A;  4BBR H;  2K50 A;  4A4I A;  3VA5 A;  2X6L A;  3SXH A;  1N34 Q;  1S4M A;  1DON A;  4N8F A;  1QX4 A;  3QFC A;  4E0F A;  1NDH A;  5E4W C;  2NVY H;  4HMJ A;  1E2V A;  3D26 A;  4DAY B;  4F7X A;  2VJI A;  2F0O A;  2BVN A;  3ZBT A;  3CCR B;  1B3A A;  3C1F A;  5HGQ A;  1RL2 A;  1Q86 C;  3MFG A;  4QUC A;  2YTV A;  3OYY A;  3SK5 A;  5F4O A;  5IYW A;  2HDM A;  3NEL A;  3GTK H;  3U6B A;  2B63 B;  4DUY L;  3Q38 A;  2EPB A;  2BM0 A;  3CCR A;  4C3H G;  2I5L X;  4ZUJ A;  1VLO A;  1QB5 D;  1BXT A;  1VDZ A;  4LBW A;  1E1T A;  2AWN A;  3NTI A;  5E7N A;  4H44 C;  4FYD A;  2M00 A;  1Y1V G;  2OQ0 A;  1ET9 A;  2SDF A;  1JOQ A;  5G3L F;  4UZF A;  1EQR A;  1XTD A;  4R8N A;  3PF4 A;  2F3W A;  5ELO A;  2NN6 I;  4LF7 L;  4XT1 B;  5FA6 A;  4TVA B;  1EIG A;  2F0J A;  3SK4 A;  4DK3 C;  2UUC Q;  1D1K A;  3A1P A;  1UEB A;  4HJ7 A;  1TS3 A;  2CQA A;  2YYZ A;  4KD3 A;  1I4P A;  1NTG A;  4XT3 B;  2ZJR A;  5FO8 B;  3S9W A;  2XNA C;  2AUJ D;  4RGT A;  3VYT A;  3CAM A;  1BDO A;  4UDU C;  1DAR A;  1ILP A;  2UXB Q;  1E1R A;  3QR8 A;  1TWF H;  5GQO A;  4JI5 Q;  2NV4 A;  5H59 A;  5IOC A;  4YCU A;  4X62 Q;  1I18 A;  4X0C A;  4RJL A;  3K8A A;  1RDP D;  4G5G A;  1O7Y A;  2Q8I B;  4DR2 L;  3HFZ B;  2YWF A;  1MI2 A;  2HIX A;  1HHV A;  3J80 c;  4HJ5 A;  4AF7 A;  1PKV A;  1MSG A;  1WP6 A;  5EPJ A;  4Z1M A;  1DOL A;  2L9H A;  2BCO A;  2B2W C;  4NNJ A;  1OB5 A;  4OOV A;  1XNR L;  1RHP A;  3CMM A;  4ILW A;  4JI6 L;  4NMZ A;  5A2Q E;  1WTV A;  2CW0 C;  3Q6Q A;  4UP9 A;  1GAW A;  2LY7 A;  1G91 A;  4A3E B;  4LBV A;  1V8Q A;  4JI7 Q;  4KKT A;  3PV0 A;  5LMN Q;  4KKS A;  1Q82 D;  1DOK A;  3HOX G;  3FPP A;  4IJH A;  2B2U A;  1LT5 D;  1P16 A;  4XOP A;  3H91 A;  1EFC A;  2BSA A;  5KNL A;  5CGK A;  2Q2T A;  1VQP B;  3TP6 A;  5A35 A;  3KOJ A;  3QWN A;  2ZTE A;  2JSO A;  2KQ3 A;  4FDB A;  4P3I A;  3J7Y W;  3Q6R A;  2XTI A;  1KMH A;  4A3G G;  2VBT A;  1N34 L;  3PQI A;  4UAJ A;  1RIP A;  4X8I A;  3SHL A;  1CZW A;  3L7Z C;  1HR0 Q;  3A55 A;  3S1Q B;  1ESF A;  1E3X A;  5FJ8 G;  1BKB A;  1ICW A;  3BYY B;  5J39 A;  1QUF A;  2BDO A;  1KAA A;  4HE6 A;  4GZY C;  3D31 A;  3OWF A;  1T6Z A;  1X55 A;  3BDC A;  1Y8P B;  1YJ9 A;  1EQQ A;  4BPR A;  2EYJ A;  2JJ1 A;  1FR3 A;  3T13 A;  4XLF A;  1TY2 A;  1TWA H;  3TP7 A;  1SYC A;  2UUB Q;  1BVS A;  2PO4 A;  2JA8 G;  1I4R A;  3GTG B;  4LBZ A;  3UDX A;  2OQK A;  1SKQ A;  1QVG B;  1B50 A;  4OOX A;  3CCJ B;  2SNM A;  3CCQ A;  2R92 G;  4QVA A;  1BPL A;  1GJX A;  2K1B A;  2NZH A;  2B2T C;  2UUC L;  1PRT D;  2VQF L;  4IFD I;  1GAQ A;  1ZUN B;  3GTO B;  1KK3 A;  4JBJ A;  1RKN A;  4CQJ A;  2MO1 A;  2Z6K A;  2RF4 A;  3CMA B;  3KF6 B;  2Q6K A;  2P3M A;  1WOC A;  1ILQ A;  3V05 A;  4P12 A;  2UXB L;  1CNF A;  4A3F G;  1EP2 B;  3PF5 A;  3L9A X;  4LJZ C;  2OTJ A;  4X62 L;  3GTM H;  1AZQ A;  2JJ2 A;  3KF6 A;  4MTN A;  1PTO C;  1UWV A;  1OXU A;  2O4X A;  1II3 A;  1UD8 A;  2BA1 A;  4RCZ A;  4ZRZ A;  2DN8 A;  1E43 A;  5A89 A;  1QH0 A;  1LLR D;  4J8Q A;  2B2V A;  4X07 A;  3GTG H;  2OT2 A;  1WD1 A;  3MVV A;  5TSS A;  1I5F A;  4A3C G;  3I4N H;  1HQR D;  3ERS X;  3VA7 A;  1EL0 A;  2NVQ H;  4P75 A;  2FVG A;  1SNO A;  5KRU A;  1J8I A;  1EY9 A;  1Q46 A;  4LUZ A;  4JOI A;  3GQB A;  2D0P A;  1KRT A;  3A8K A;  4P1V A;  1WU8 A;  2WAQ E;  4DV7 Q;  3K5N A;  3RLF A;  5T1G A;  2HLD A;  2X85 A;  1R4P B;  1V1P A;  1QUQ A;  3CU7 A;  4RKL A;  4NB3 A;  4RMF A;  4DV2 L;  2PPB C;  2I07 B;  1J6Q A;  2M2L A;  3STB C;  4Z4W A;  4XLE A;  1D5X C;  1WCM B;  1VQ9 B;  5DNF A;  1CA5 A;  3W2F A;  1VMP A;  3DM3 A;  4JI7 L;  5LMN L;  3P27 A;  1YEZ A;  3HG9 A;  1QZH A;  5IYD H;  4JCV E;  1MJC A;  2R6G A;  5D14 A;  2ZZF A;  5M5Y H;  1I3Q H;  5C44 B;  1HH2 P;  1VQ9 A;  1LTI D;  1HA6 A;  1KRH A;  3GTJ B;  1VQ8 B;  2CWP A;  3SK6 A;  3DXJ C;  3A8J E;  5F2D A;  3HOW B;  4DPG A;  1GR1 A;  1I50 B;  1C48 A;  1FX0 A;  3V2T A;  1TS2 A;  2KED A;  1GUW A;  3F2D A;  1MD2 D;  1HR0 L;  3ND9 A;  4R4I A;  4FF2 A;  4C43 A;  1FYC A;  4DXF A;  4YXW A;  1UNS A;  5KEE A;  4Y52 H;  3CP0 A;  5TRD A;  1UD3 A;  3OSO A;  5KNC A;  1VQO A;  4JMQ A;  2Z6B A;  5KND A;  4KTA A;  1GVH A;  2BDN A;  1M90 C;  4BY1 B;  1U5K A;  4GN4 B;  3G05 A;  2MNA A;  2DY7 A;  3FRP B;  1SNP A;  1YBY A;  5JEA G;  2J0T D;  3MXU A;  1ENA A;  4UZE A;  3P75 A;  1ASY A;  2A8V A;  1WCM H;  2UUB L;  1D1I A;  5FO0 A;  2CVR A;  1FGB D;  4Y9R A;  3MXN A;  1WTW A;  1H85 A;  1AMO A;  4GNX C;  2GVB A;  2QW7 A;  1EEI D;  3CES A;  2WKC A;  5D65 A;  4C3H H;  4DQK A;  1TXY A;  1D2E A;  1DXM A;  1SEB D;  1SNM A;  4UHV A;  5C44 H;  2WFW A;  3RZO B;  1Y1V H;  2D9U A;  2JA9 A;  2KEN A;  4P2C B;  3VR5 A;  3GTJ H;  1HNX Q;  4A3B G;  2MJ8 A;  1IBM Q;  4II2 A;  1HR0 W;  1QFY A;  2VNK A;  3HOW H;  4LF8 Q;  4MNO A;  4N9P A;  4YCV A;  2UXD Q;  4A3K B;  3SLD A;  1BCP D;  1PJ5 A;  3MA2 B;  1UE1 A;  2F0G A;  3BY1 A;  1LAB A;  1IBL Q;  5CV4 A;  3E20 A;  1AE3 A;  4I7A A;  2YU9 H;  4WJW A;  4C0S A;  3A35 A;  4BY1 H;  4X7D A;  4R71 A;  2Y0S G;  5KYI A;  1JR0 D;  1PZI D;  2K4K A;  2RSN A;  1YJN B;  1D5Z C;  5M5W B;  1NCV A;  1TR5 A;  2WP8 J;  3SJP A;  4B3R Q;  1SJH D;  2VBS A;  4ROX A;  2CW5 A;  4WOR A;  2PCF B;  2PMD A;  1SYG A;  4IUP A;  5IYC H;  2OBR A;  1NSN S;  3CRK C;  4FWT A;  1CQV A;  1Y8O B;  2CFM A;  4LFA Q;  5DS0 A;  2XNC A;  4ZCM A;  1Z47 A;  3W5U A;  2QE7 A;  2JA5 G;  1IB0 A;  3TQY A;  4A3L H;  1B3Q A;  3T1H Q;  1ASZ A;  3AVW A;  3GD7 A;  1RQR A;  3PUX A;  5CBE E;  3RZO H;  4WZL A;  5K36 H;  1Q12 A;  1SYB A;  3MXG A;  4DV7 L;  3KEW A;  1VQ7 A;  2PNH A;  3DWP A;  1DD2 A;  4LF4 Q;  3HOV B;  4A3I B;  2EY5 A;  4XDX A;  4AF6 A;  4OX9 L;  3HKZ G;  4RGM A;  1XMO Q;  1R9T B;  4UAI A;  4EQO A;  2EYL A;  3J80 L;  1I6H B;  4YWK A;  3RZD B;  4KD4 A;  1TWH B;  2VNU D;  1EFT A;  4ACB A;  5FOB B;  5JVG 3;  5LHY 1;  1K73 D;  2E8G A;  1NMF A;  1U4P A;  1C0A A;  2Z9H A;  5C5M A;  3RLO A;  1KDA A;  2A6E D;  2R3Z A;  3J81 i;  2JQO A;  1FL0 A;  1SJE D;  1XYI A;  2K5N A;  1KK1 A;  4O0A A;  2BA0 A;  1ESR A;  1VQF A;  1I4Q A;  1YNJ D;  4PZ8 A;  2CC2 A;  1XNQ Q;  2ASB A;  4CKC A;  1B8A A;  3KK7 A;  4A3G H;  4XYQ A;  1LTB D;  4IPC A;  4JI0 L;  2KBN A;  3GVL A;  2A74 C;  2LMC B;  1BQQ T;  4LF5 L;  2QKI C;  4H02 A;  1I94 Q;  3PUW A;  4P25 A;  4OO1 G;  2K33 A;  3GV6 A;  1QOH A;  2F52 A;  5FK9 C;  3HZX A;  3VR2 A;  3CME B;  4JI4 L;  1OB2 A;  1QGY A;  1J9Z A;  1CK1 A;  4H7B A;  3WOE A;  1ML0 D;  4Z4T A;  2A19 A;  3GTP H;  2LKV A;  1D2B A;  1Q7Y C;  1KL9 A;  3K5O A;  2X53 S;  1BBU A;  3AQQ A;  3J81 j;  1FNC A;  3NWT A;  4IPG A;  1TWH H;  1EY0 A;  1F77 A;  2O5I C;  3CME A;  1Q81 D;  3LQE A;  1BOS A;  3OMC A;  4FF3 A;  5HZB A;  5FLM H;  2AWO A;  4QJF A;  3IRB A;  1M1K C;  2DIE A;  1HNX L;  4RDK A;  2IHF A;  2GRE A;  1IBM L;  1WSV A;  1PH3 A;  1G2T A;  2ZBV A;  2SOB A;  3CPW B;  1PRT F;  2R92 H;  2CWA A;  4LF8 L;  2UXD L;  2K03 A;  4ZCI A;  4TSF A;  3ASS A;  3S1R B;  1HZE A;  2P5Z X;  3NXW A;  2FX3 A;  4IUN A;  4QCL A;  5A8A A;  2GPJ A;  1VQM B;  4QY7 A;  5IGD A;  1XPO A;  3VNV A;  1L0Y B;  3CKI B;  1H95 A;  3OKX A;  2WKD A;  1JJG A;  2B2Y C;  2O2L D;  2Z6K C;  4B3R L;  2A5H A;  1VQM A;  1D5M C;  2VJJ A;  3ZJY C;  3FKS A;  3ZPN A;  2KOL A;  3H3V C;  5M5X B;  2A68 C;  1SND A;  1COW A;  1U9R A;  1NBW A;  1N05 A;  4L5Q A;  1BR9 A;  2OXP A;  1Q9S A;  1N08 A;  1NR2 A;  1GUS A;  5DM6 3;  3SVM A;  4C2M H;  2Z8L A;  4CBV A;  1NJI C;  2KVO A;  4ZKC B;  3T1H L;  3T56 B;  1B9N A;  1PFN A;  2SEB D;  4R4C A;  1E64 A;  1PH7 A;  3AFQ A;  3A54 A;  3FP9 A;  3GVK A;  2BH2 A;  4MZ9 A;  1ET6 A;  4FVM A;  2A69 C;  4A3C H;  1E24 A;  4XOT A;  2RCN A;  1VQA A;  3R6K A;  4R9W A;  4LF4 L;  1EP3 B;  4HSP A;  1MRZ A;  1F20 A;  4V19 0;  3AB9 A;  2EFG A;  1SMY C;  2HCC A;  2F4I A;  1IL8 A;  4IPD A;  4LMQ D;  2B63 G;  1L1O C;  3BG3 A;  1WYD A;  2H1E A;  4MIU A;  3BDL A;  5TV2 A;  2L4N A;  1U0L A;  1AN8 A;  4CDD C;  3TS2 A;  3U6K A;  4R4Q A;  1EIH A;  4CDC C;  1PJ7 A;  3WNC A;  2K32 A;  2WAQ B;  2B2W A;  3W3A A;  4KJO A;  2LSS A;  1U2R A;  4UY8 C;  3GTL H;  1YIT B;  2PQA A;  1X3Q A;  1H9K A;  3Q3A A;  3BH4 A;  1F2Z A;  3I55 B;  4P2N A;  1B70 B;  3S1M B;  2KCT A;  4I7Z C;  2IHE A;  4MHE A;  1HXY D;  1I94 L;  5LMZ A;  1UE7 A;  4BWG B;  1N33 Q;  3UE0 A;  3E1Y E;  2HD3 A;  1H9J A;  3CD6 B;  1EOV A;  1SYD A;  1D7Q A;  4LAA A;  4IUQ A;  1H9M A;  2BN4 A;  1EYD A;  3QOL A;  1XFO A;  2N88 A;  3ERQ A;  3D8G A;  2QMU A;  3KLW A;  5I2Y A;  5GV8 A;  4XXE A;  1WTX A;  3K81 C;  4F7D A;  4IOA A;  4YIJ A;  1UAP A;  4G6I A;  5IT9 E;  3GO5 A;  1JWS D;  2HDL A;  4A3M B;  2I1L A;  4EQ5 A;  4UP7 A;  2WYR A;  3JAM E;  2N78 A;  1XJV A;  2F03 A;  3BDO A;  2IX0 A;  1CHQ D;  3R93 A;  4LW1 A;  3NQT A;  1AIP A;  1JJC B;  3OEH A;  3GVJ A;  3PIO A;  5CDF A;  3W2G A;  4ZGN B;  3OZU A;  4MN3 A;  1F60 A;  1VQC A; 
#chains in the Genus database with same CATH homology
 1BCP F;  2XWB B;  1STN A;  5J22 A;  3M7G A;  1XWE A;  2X6G A;  2XVS A;  3TN2 A;  2DNC A;  2PQE A;  3BYT B;  3MEH A;  3HOY B;  3Q24 A;  3HOZ B;  1QNK A;  4K5W A;  3LWU A;  4J1M A;  1A3V A;  1EWC A;  1VF7 A;  1PTO B;  1SE3 A;  3D4W A;  2XZL A;  2F0P A;  1DOM A;  5EQ0 A;  3TZU A;  4DAV A;  5DAU A;  4OHJ A;  2B39 A;  4K2L A;  2ZZE A;  1DYQ A;  2IW3 A;  1R4Q B;  3E0J A;  2KA7 A;  1W9X A;  4OIJ A;  5C0X J;  1EU3 A;  1QE6 A;  2AQ3 B;  5T1I A;  5FLX L;  3HOU B;  1W6K A;  2BE5 D;  2RSO A;  3H09 A;  4U68 A;  1PTO H;  3I4M B;  2L12 A;  1EY8 A;  3TSS A;  3M7N A;  2XZP A;  2B8G A;  5BN3 A;  3VR3 A;  2NBF A;  1E2W A;  5EKI A;  1ZEQ X;  3VYS A;  5C4H A;  5CV8 A;  4B9W A;  4OO1 H;  1GUO A;  2XSC A;  5D3D A;  2Z4H A;  4RWS C;  3SDZ A;  4PMW A;  2F0L A;  1NAP A;  1GHJ A;  3HP3 A;  1HFN A;  1M8A A;  4K5V A;  1CZG A;  2TMP A;  3N6R A;  3IKJ A;  1PRT B;  1BMF A;  4V0B A;  5KYL A;  2VXW A;  5C4J B;  3EQL C;  3PIO 3;  4ULL A;  3K59 A;  2WII B;  3FVQ A;  4DAY A;  5CMD A;  1BO0 A;  1L0X B;  5E3F A;  1RCV D;  3S2D B;  1TS5 A;  4ODG A;  4RGN A;  4X3U A;  5CR3 A;  5FL7 A;  4AYB B;  3OAA A;  5BN4 A;  1ZYR C;  1Y1W B;  2EZV A;  2EDG A;  4CJ1 B;  2ZTN A;  2WV6 D;  2GJR A;  5IGF A;  1EZ6 A;  3VYU A;  4EQN A;  3TDQ A;  3Q23 A;  5JPN C;  2MP1 A;  1K8M A;  3NHH A;  1JWM D;  3W2D A;  2EYF A;  4OIK A;  3BVZ A;  4XON A;  1TII D;  1BF4 A;  1PMR A;  2NWG A;  1WPC A;  5DEH A;  3CP8 A;  3DWQ A;  5CBA E;  1CM9 A;  2I46 A;  2ICE C;  1S4Z A;  3LNN A;  1OO9 B;  5K36 G;  3D6C A;  3C3L A;  3NPP A;  3NWS A;  2GA4 B;  3A8I E;  3NSW A;  4KY7 A;  3J81 E;  5A2Q L;  2ID0 A;  3T4A C;  2NYZ D;  3DM1 A;  4YEL A;  3DEP A;  4BBS B;  5IGB A;  3HAG A;  3R2T A;  4G7W A;  3TBI B;  3OFN A;  5CV5 A;  4ME5 A;  5C3W A;  3K7A B;  1YNN C;  2XRQ D;  2K04 A;  4KY5 A;  2EY2 A;  1WTR A;  3TP8 A;  3ND8 A;  2JYO A;  3IFD A;  3QOJ A;  3ONA B;  1G2S A;  3D3R A;  3ZYY X;  2Z1C A;  4ZLT F;  1QCB D;  2EYP A;  1BCP B;  2L55 A;  1HRJ A;  4K8J A;  5HGT A;  2QDB A;  4PMB A;  3DHQ A;  3VR4 A;  1RTN A;  4K5X A;  2WAC A;  4XM3 A;  2EY6 A;  4UZU A;  4XQN A;  3IFT A;  1E79 A;  1STE A;  5ELD A;  1PZJ D;  4A3J B;  1KLU D;  1SFO B;  5EPK A;  4Q5V A;  2B2Y A;  4BY7 B;  2F0U A;  1Y8N B;  2R7Z B;  3RMH A;  2L1B A;  1QIL A;  2KCC A;  4XIG S;  2F0T A;  5BN5 A;  3PUY A;  5IGC A;  1KDC A;  4DAP A;  3S14 B;  4G7O C;  2JA6 B;  2IL8 A;  5HUR A;  4XQF A;  1Q8I A;  1JOK A;  3JU4 A;  4G7X A;  3NTK A;  2F0Q A;  1HUN A;  3BCD A;  4L6T B;  5KGU A;  4A3D B;  1E2Z A;  1WD0 A;  1SE4 A;  4EGV A;  4KK7 A;  1KAB A;  3K58 A;  1TWC B;  5EBD A;  1NUC A;  3PIP 3;  3M4O B;  2X69 A;  3A7A B;  4WFN 3;  1O78 A;  2VUM B;  4KKU A;  1Z6H A;  3SK8 A;  1RTO A;  1SYF A;  2JEA I;  2C9O A;  1TQO A;  2F0H A;  3G7L A;  1CA6 A;  1WTQ A;  1SE2 A;  5IOD A;  1KTK A;  4IUV A;  1LT4 D;  2WB1 B;  5JPM C;  5C0X H;  2E2J B;  2J4X A;  1AP0 A;  1U4R A;  1KZL A;  3R8B A;  3NE5 B;  1W6J A;  3M4Y A;  1PRT C;  3SR1 A;  3OWE B;  4ZAI A;  1PDQ A;  2X6Y A;  1FD7 D;  3NP8 A;  2XND A;  4FXU A;  1AW7 A;  4S3S A;  5JVH 3;  1Q1B A;  2KCN A;  1EYA A;  4K14 A;  4XKW A;  1UD4 A;  1G8Z D;  5C4X B;  4QIW B;  1SNQ A;  1I8D A;  3I91 A;  2R93 B;  2B8F A;  2K7V A;  2JA7 B;  4CKB A;  4PV1 C;  1IHZ A;  1SSO A;  3K5M A;  5EBC A;  1CHP D;  5C5L A;  1GUN A;  1GUG A;  1QG7 A;  1T5X D;  4IAL A;  3IL8 A;  1KNE A;  1UUP A;  2XIW A;  1CQF A;  1U4L A;  1C4Q A;  4KY6 A;  3HEJ A;  2PW5 A;  2M5S A;  2V4D A;  4Q0F A;  4RHS A;  2RQX A;  1HUM A;  3ITP A;  2KUM A;  4KJN A;  5JAV A;  2X6X A;  4G7Z C;  1TWG B;  2G9D A;  3N52 A;  1TU2 B;  2H4O A;  3A3B A;  5ELC A;  2VB3 X;  1RD9 D;  3FKI B;  3T16 A;  1F2M A;  2ZXO A;  1B44 D;  1S5B D;  2L5T A;  2F0S A;  2JXM B;  5ELF A;  3HRZ C;  4C56 C;  1AFP A;  3CHB D;  1V0F A;  3I8Z A;  2F0N A;  4RA8 A;  3FPU B;  3BVM A;  1MSH A;  3J80 E;  2QCP X;  2Z4I A;  4X3S A;  4E6I A;  2MUY A;  3MC0 B;  4G4K A;  1BLI A;  4B3F X;  2JEB I;  3T53 B;  2XGJ A;  5EPL A;  4DFA A;  1PFB A;  5C3E B;  4GQN A;  1BCP C;  1M4V A;  1XTC D;  1PLF A;  4TKO B;  1EY5 A;  5C6A A;  4XOR A;  1EOT A;  1BBX C;  1X32 A;  4RGO S;  1TT2 A;  2BOS A;  3PO2 B;  2G9H D;  3VYR A;  3LX0 A;  4IUR A;  4RHR A;  5E1F A;  1BUV T;  5FKA C;  2Z6B D;  5JOB A;  2JE6 I;  2FIN B;  4HAE A;  2CHB D;  1TY0 A;  2Q8T A;  1GHK A;  4XTC S;  2EYO A;  1F9P A;  3S15 B;  2NZ1 D;  3KUP A;  1H9R A;  3H0G B;  2NUC A;  4DNT B;  4KHV A;  3EVQ A;  1Q1E A;  1QWY A;  3UI2 A;  3KLS X;  4FNF A;  3GTQ B;  2ZZQ A;  4KHZ A;  2TSS A;  1V1O A;  1EFR A;  2EJM A;  4QUF A;  2FMC A;  1IW7 D;  3QJY A;  5I4D A;  1JOO A;  4KN7 C;  1UEA B;  1AEX A;  2A6E C;  3D6W A;  3I90 A;  2ZTG A;  1HPC A;  3K57 A;  3BZD B;  1YNJ C;  3L3O C;  4A93 B;  2VB2 X;  2NN6 G;  3D4R A;  2EVB A;  4M8A A;  3S2H B;  2JDI A;  1B4O A;  1F9S A;  1VCI A;  4BA2 I;  2K5D A;  4ZYS A;  3TME A;  3PMF A;  1ENF A;  4FXD A;  3H94 A;  5IT9 L;  3FEW X;  3JAM L;  1OXT A;  4B3G A;  4EVO A;  3K6O A;  2E1B A;  2PW7 A;  3T51 B;  2R61 A;  2A6H D;  1AZP A;  2D3N A;  4DNR B;  4TQU S;  1GOZ A;  2E76 C;  2HCI A;  2F0D A;  1I4H A;  1EYC A;  5NUC A;  4ZUI A;  2LS0 1;  5CC4 A;  4RH6 A;  2N55 A;  1EZ8 A;  1B1Z A;  4BS9 A;  1JWU D;  4HTH A;  2KVM A;  4QMG A;  4C3I B;  1G6Z A;  3OE7 A;  1HCZ A;  3NBH A;  4YEJ A;  5FO7 B;  1A6X A;  1LTA D;  1LT6 D;  4IFD J;  4DK1 A;  4XYO A;  3P20 A;  3SEB A;  2JP1 A;  1K8O A;  3QB3 A;  1ROD A;  5FO9 B;  2W6I A;  5I9O A;  2OEO A;  4C3J B;  5M3F B;  1G29 1;  3R2I A;  3F2U A;  2HUG A;  2RKS A;  4XKV A;  1V43 A;  5C3X A;  2OF1 A;  4J6H A;  4C1N K;  1LO5 D;  2FHT A;  3PUZ A;  1CFM A;  1TKW B;  1MAB A;  2E2H B;  4G57 A;  2MPM A;  4U67 3;  3HGB A;  1JC7 A;  4OO1 I;  3D4D A;  4ZK9 B;  3G6J B;  3BS1 A;  3S17 B;  1OB0 A;  4IQZ A;  2XOK A;  1I4X A;  1WTO A;  4IFD G;  2R9V A;  2EJG C;  5ELE A;  1JE4 A;  3PUV A;  4CHT B;  4BBR B;  5CV9 A;  2RBM A;  4KV6 A;  3DUZ A;  4F8M A;  5HKK A;  3WDN A;  2XRS D;  5K5P A;  4FF1 A;  2DNE A;  1T5E A;  2RDF A;  1IYU A;  2ZT9 C;  3AU7 A;  1X3P A;  4RFB A;  2EYH A;  3GTK B;  3A56 A;  1C8C A;  3O13 A;  3I70 A;  4M1U B;  5C0X G;  3C46 A;  1EY4 A;  2CW0 D;  1FNW A;  4HR7 B;  3M3Y B;  4DF7 A;  4RCO A;  1WVL A;  3NUC A;  5EKK A;  1EY7 A;  2K05 A;  4NKL A;  1Q3L A;  1HTP A;  1F2L A;  2F43 A;  1FNU A;  3MWY W;  1TWF B;  1ZKO A;  3E5S A;  1SKY B;  1PZK D;  1SNC A;  3PO3 B;  4L63 B;  4DGZ A;  1B2T A;  2C5C A;  2XN9 C;  3X3M A;  2E2I B;  1E0B A;  1WTH D;  5I9P A;  3S1N B;  4CKE A;  2KEC A;  4B9X A;  1HVX A;  4XR6 A;  2A73 B;  3URY A;  1NR4 A;  2IWH A;  1KDB A;  2MHV A;  2BE5 C;  3RUZ A;  1QJO A;  1K83 B;  3J81 L;  4HSV A;  4H0L C;  2ZXH A;  4OGQ C;  2WSS A;  1EQT A;  2NN6 H;  1EY6 A;  3LWE A;  3KBX A;  5I2X A;  1RF2 D;  4KN4 C;  5CYU A;  4HCE A;  3MFY A;  1PTO D;  3R3O A;  4I65 A;  1J9O A;  4XN3 A;  4WRD A;  5COY A;  4XQQ A;  3AMU A;  3I73 A;  3QIA A;  1STY A;  3K0Y A;  2K28 A;  1SXT A;  1XXG A;  3MAQ A;  1TWA B;  1OXX K;  4FP5 D;  4N9T A;  4IUU A;  3MZ5 A;  2NVT B;  1F9R A;  1VF5 C;  1A3U A;  4B08 A;  2IT1 A;  5IGE A;  4II3 A;  1A15 A;  1UD2 A;  3C1E A;  4K2K A;  3J7A F;  2QF7 A;  3K5L A;  3U9O A;  3A7L A;  1SBB B;  1KNA A;  1TVX A;  2QIL A;  2WIN B;  1JB3 A;  5KNB A;  2Q8R E;  1S5C D;  4G7H C;  3GTM B;  4FO2 A;  4HMI A;  4LK1 C;  2O5J C;  2D3L A;  3I4N B;  4XMY A;  2RA4 A;  3NBI A;  4NDX A;  3KF8 A;  2NVQ B;  1K28 D;  5DM7 3;  5I6W A;  4O42 A;  2EY1 A;  3WQZ A;  2F0F A;  2PNR C;  4FXK C;  1SAP A;  1ZXT A;  1STG A;  3OW7 A;  4FXG C;  1W0J A;  4BA1 I;  2F0E A;  1IYV A;  3CRL C;  5M5Y B;  1BNZ A;  1I3Q B;  4IUT A;  4IFD H;  2W6J A;  3OMG A;  1V0E A;  1CT1 D;  1HA5 A;  2F0I A;  1MBY A;  4TT3 A;  1U4M A;  1EFI D;  2QEJ C;  2NTT A;  1EEF D;  2CK3 A;  1V1P B;  5EGT A;  4KMU C;  2DY8 A;  5JEA J;  5C0X I;  1JQY D;  2XWJ B;  1LTR D;  1TS4 A;  5AFW A;  3OHX C;  1MGS A;  4C1N I;  2F0V A;  3EJI A;  5M9O A;  2FMM A;  2ZXR A;  5CV6 A;  3P1H A;  4XN0 A;  5E4X A;  3C2P A;  1O7Z A;  1ENC A;  1NRK A;  4C3H B;  4Y7N B;  1Y1V B;  3MXP A;  4ZQ3 A;  4DK0 A;  4DXG A;  1EWH A;  4PNY A;  4HIZ A;  2JIZ A;  1S5E D;  2IPK D;  4L8J A;  2FJ2 A;  2YU9 B;  4CJ0 B;  4X3K A;  2GK7 A;  1F9Q A;  2L11 A;  1F2Y A;  2GJP A;  2E2D C;  4QF4 A;  4ID6 A;  3I3C A;  1OXS C;  3H6M A;  2K6A A;  3NK9 A;  3ZIA A;  1DCZ A;  2KHS A;  4CJ2 C;  1LTS D;  3QG1 A;  4IN3 A;  3EFX D;  1H8E A;  3NTH A;  3Q22 A;  1S5F D;  2IX3 A;  1OHH A;  5EKL A;  1A2T A;  1D6E C;  1ONL A;  1RJT A;  1VMC A;  1SYE A;  2V7Q A;  1PFM A;  1E3Z A;  5J1Z A;  1STB A;  3HOX B;  2LFN A;  5IIF A;  3V96 A;  4C3I G;  1H8H A;  2MGS A;  4AVZ A;  2A68 D;  4A3G B;  3J7A V;  1PTO F;  4JBW A;  1H9S B;  1KLG D;  3FDT A;  1I4G A;  2KEE A;  3CP2 A;  4F87 A;  2M9V A;  1DZ1 A;  1VLY A;  3SE0 A;  3Q0A A;  2RVL A;  4C3J G;  2J7Z A;  3X3N A;  2A69 D;  1H9S A;  3I72 A;  3GTP B;  4PQX A;  3OEE A;  2F0K A;  3TZD A;  2GK6 A;  1SMY D;  2F0M A;  2JA8 B;  1JIC A;  4JK1 C;  3VR6 A;  2F1M A;  1LT3 D;  2R92 B;  1STH A;  2AQ1 B;  1LTT D;  2V31 A;  2B2U C;  1O80 A;  3OPO A;  4DN4 M;  2EOT A;  1UD5 A;  1STA A;  1EU4 A;  4XLC A;  1NBM A;  4A3F B;  1CI3 M;  1FNV A;  5IGG A;  3HS0 C;  4C2M B;  5D3I B;  3I4L A;  3FMC A;  1PXU A;  3E6Z X;  2HQE A;  4XLH A;  1JCK B;  3A3G A;  2RDH A;  4ABN A;  4NP5 A;  1JOR A;  2GJK A;  4QB4 A;  3TP5 A;  1S5D D;  3U9S A;  3MTS A;  4HN7 A;  5I6Y A;  4R8I A;  4K8I A;  5G3L D;  2WJY A;  4XL9 A;  3DEO A;  3GTL B;  2PZW A;  4XQJ A;  3KBG A;  1EQV A;  4K6L A;  4H13 C;  1DM0 B;  2L0C A;  1CTM A;  2B2V C;  1GXD C;  1PYW D;  2K5Q A;  2AUK A;  2FFK B;  4RCN A;  3CQZ B;  1DJR D;  3QO2 A;  4O1N A;  2K01 A;  2KJX A;  2PYK A;  5DN6 A;  2EXZ A;  1HQM C;  1HFG A;  3S16 B;  1SDF A;  2ICI A;  1UD6 A;  1A3T A;  3M85 A;  4A3B B;  5LL6 X;  1LAC A;  2ENB A;  2LZJ A;  4XNF A;  2F3V A;  3DMU A;  3IAY A;  3Q6S A;  1B9M A;  4HCS A;  4F88 A;  4KI0 A;  4EQP A;  1LV9 A;  2Y0S B;  1B53 A;  2D2C C;  5JEA H;  3OOC A;  1QNU A;  4CGY B;  1IKL A;  4PMC A;  4Z9C B;  3BC9 A;  2JA5 B;  4X3T A;  1OXV A;  3P7J A;  4XLA A;  4RKB A;  5IK2 A;  1Q90 A;  2NTS A;  3MHB A;  5C4Z A;  5CV7 A;  3RD4 A;  2XZO A;  4P22 A;  3HKZ B;  5ELB A;  5LL6 S;  2ZXI A;  1IW7 C;  5ISR A;  2B2T A;  5EJW A;  3WOF A;  1XX8 A;  3NQI A;  4ZKB B;  2ZXP A;  4TSS A;  2IX1 A;  2PZU A;  1IKM A;  1O7L A;  1VJS A;  4RAU C;  1E1Q A;  2D5D A;  5COR A;  2WZP P;  1ZYR D;  1WTP A;  2E75 C;  2ZZG A;  4OL7 A;  2D62 A;  4XD7 A;  3A8K E;  4TRD A;  3OIQ A;  2K5W A;  3OIP A;  1Y69 U;  2EJF C;  1W0K A;  4DU9 A;  2EYM A;  3KLS A;  4FF4 A;  1A2U A;  3BCF A;  3DDY A;  4K6D A;  2SNS A;  2X8K A;  2RDG A;  2WJV A;  2E74 C;  1LTG D;  2AQ2 B;  3BVG A;  2EE1 A;  2NVY B;  2A6H C;  3EA6 A;  4NW2 A;  5FLX E;  5JJZ A;  3DWA A;  2F0W A;  2PMZ B;  3GP7 A;  5M3M B;  1Z7T A;  2NB0 A;  5KIX A;  4DA2 A;  3ERO A;  3GV3 A;  1HTL D;  4ASU A;  4HED A;  1I6V C;  2WPD A;  1GUT A;  3KLR A;  4IZ8 A;  1YNN D;  2PZT A;  2X6W A;  2IJ0 A;  3VA5 A;  2X6L A;  3SXH A;  1DON A;  4E0F A;  5E4W C;  4HMJ A;  1E2V A;  4F7X A;  2VJI A;  2F0O A;  1B3A A;  3C1F A;  3MFG A;  4QUC A;  3SK5 A;  2HDM A;  2B63 B;  2EPB A;  4C3H G;  4ZUJ A;  1QB5 D;  1BXT A;  1VDZ A;  2AWN A;  3NTI A;  4FYD A;  4H44 C;  2M00 A;  2SDF A;  1ET9 A;  1JOQ A;  5G3L F;  4R8N A;  2F3W A;  2NN6 I;  4XT1 B;  1EIG A;  2F0J A;  3SK4 A;  1D1K A;  1TS3 A;  2CQA A;  2YYZ A;  4KD3 A;  1I4P A;  4XT3 B;  5FO8 B;  3S9W A;  2XNA C;  2AUJ D;  4RGT A;  3VYT A;  1BDO A;  4UDU C;  1ILP A;  1E1R A;  5IOC A;  1I18 A;  1RDP D;  1O7Y A;  2Q8I B;  1MI2 A;  1HHV A;  1PKV A;  1MSG A;  1WP6 A;  5EPJ A;  4Z1M A;  1DOL A;  2L9H A;  2BCO A;  2B2W C;  4NNJ A;  1RHP A;  3CMM A;  4ILW A;  4NMZ A;  5A2Q E;  1WTV A;  2CW0 C;  1G91 A;  2LY7 A;  4A3E B;  1V8Q A;  4KKT A;  3PV0 A;  4KKS A;  1DOK A;  3FPP A;  2B2U A;  1LT5 D;  4XOP A;  3H91 A;  5KNL A;  5CGK A;  5A35 A;  3TP6 A;  3QWN A;  2JSO A;  2KQ3 A;  3J7Y W;  1KMH A;  3SHL A;  1CZW A;  3L7Z C;  3A55 A;  3S1Q B;  1ESF A;  1E3X A;  1ICW A;  3BYY B;  5J39 A;  2BDO A;  1KAA A;  4GZY C;  3D31 A;  3OWF A;  3BDC A;  1Y8P B;  2EYJ A;  2JJ1 A;  1FR3 A;  3T13 A;  4XLF A;  1TY2 A;  3TP7 A;  1SYC A;  2PO4 A;  3GTG B;  1I4R A;  1B50 A;  2SNM A;  1GJX A;  1BPL A;  2K1B A;  2B2T C;  1PRT D;  4IFD I;  3GTO B;  1RKN A;  1ILQ A;  3V05 A;  3L9A X;  4LJZ C;  1AZQ A;  2JJ2 A;  1PTO C;  1OXU A;  2O4X A;  1II3 A;  1UD8 A;  2BA1 A;  4ZRZ A;  2NVX B;  2DN8 A;  1E43 A;  1LLR D;  4J8Q A;  2B2V A;  2OT2 A;  1WD1 A;  3MVV A;  5TSS A;  1HQR D;  3VA7 A;  1EL0 A;  1SNO A;  5KRU A;  1J8I A;  1EY9 A;  3GQB A;  3K5N A;  3RLF A;  5T1G A;  2HLD A;  2X85 A;  1R4P B;  1V1P A;  4RKL A;  3CU7 A;  2PPB C;  2I07 B;  2M2L A;  4XLE A;  1D5X C;  1WCM B;  5DNF A;  1CA5 A;  1VMP A;  3HG9 A;  2R6G A;  5D14 A;  2ZZF A;  5C44 B;  1LTI D;  1HA6 A;  3GTJ B;  3SK6 A;  3DXJ C;  3A8J E;  5F2D A;  3HOW B;  1I50 B;  1C48 A;  1FX0 A;  3V2T A;  1TS2 A;  2KED A;  1GUW A;  1MD2 D;  3ND9 A;  4FF2 A;  1FYC A;  4DXF A;  4YXW A;  1UNS A;  5KEE A;  3OSO A;  1UD3 A;  5KNC A;  4JMQ A;  4BY1 B;  5KND A;  4KTA A;  2BDN A;  3G05 A;  2DY7 A;  3FRP B;  1SNP A;  5JEA G;  2J0T D;  3MXU A;  1ENA A;  3P75 A;  1D1I A;  2CVR A;  1FGB D;  3MXN A;  1WTW A;  1EEI D;  3CES A;  2WKC A;  5D65 A;  1DXM A;  1SEB D;  1SNM A;  3RZO B;  2D9U A;  4P2C B;  3VR5 A;  2MJ8 A;  4II2 A;  4N9P A;  4A3K B;  1BCP D;  3MA2 B;  2F0G A;  1LAB A;  5CV4 A;  4WJW A;  3A35 A;  5KYI A;  1JR0 D;  1PZI D;  2RSN A;  1D5Z C;  5M5W B;  1NCV A;  1TR5 A;  2WP8 J;  1SJH D;  4WOR A;  2PCF B;  1SYG A;  4IUP A;  1NSN S;  3CRK C;  1CQV A;  1Y8O B;  1Z47 A;  2QE7 A;  3GD7 A;  3PUX A;  5CBE E;  5K36 H;  1Q12 A;  1SYB A;  3MXG A;  3KEW A;  3DWP A;  1DD2 A;  3HOV B;  4A3I B;  2EY5 A;  4XDX A;  4RGM A;  1R9T B;  4UAI A;  4EQO A;  2EYL A;  3J80 L;  1I6H B;  3RZD B;  4KD4 A;  1TWH B;  2VNU D;  5FOB B;  5JVG 3;  5LHY 1;  1U4P A;  5C5M A;  1KDA A;  2A6E D;  2R3Z A;  1SJE D;  1XYI A;  2BA0 A;  1ESR A;  1I4Q A;  1YNJ D;  4CKC A;  3KK7 A;  4XYQ A;  1LTB D;  3GVL A;  2A74 C;  2LMC B;  1BQQ T;  2QKI C;  3PUW A;  4OO1 G;  2K33 A;  3GV6 A;  1QOH A;  5FK9 C;  3HZX A;  3VR2 A;  4H7B A;  1CK1 A;  3WOE A;  1ML0 D;  2LKV A;  1D2B A;  3K5O A;  2X53 S;  3NWT A;  2O5I C;  1EY0 A;  1F77 A;  1BOS A;  3OMC A;  4FF3 A;  2AWO A;  2DIE A;  1G2T A;  2SOB A;  1PRT F;  2K03 A;  4TSF A;  3S1R B;  1HZE A;  3NXW A;  4IUN A;  4QCL A;  5IGD A;  1L0Y B;  3CKI B;  2WKD A;  2B2Y C;  2O2L D;  2A5H A;  1D5M C;  2VJJ A;  3FKS A;  3ZPN A;  2KOL A;  3H3V C;  5M5X B;  2A68 C;  1SND A;  1COW A;  1U9R A;  1BR9 A;  2OXP A;  1NR2 A;  1GUS A;  5DM6 3;  3SVM A;  2Z8L A;  4CBV A;  2KVO A;  4ZKC B;  3T56 B;  1B9N A;  1PFN A;  2SEB D;  3A54 A;  3GVK A;  1ET6 A;  4FVM A;  2A69 C;  4XOT A;  4R9W A;  4HSP A;  4V19 0;  3AB9 A;  1SMY C;  2HCC A;  2F4I A;  1IL8 A;  4LMQ D;  3BG3 A;  2H1E A;  4MIU A;  3BDL A;  2L4N A;  1AN8 A;  1EIH A;  2K32 A;  2WAQ B;  2B2W A;  3W3A A;  4KJO A;  1X3Q A;  1H9K A;  3BH4 A;  1F2Z A;  3S1M B;  4I7Z C;  4MHE A;  1HXY D;  4BWG B;  1H9J A;  1SYD A;  4LAA A;  4IUQ A;  1H9M A;  1EYD A;  3QOL A;  2N88 A;  3ERQ A;  3D8G A;  5I2Y A;  4XXE A;  1WTX A;  4YIJ A;  1UAP A;  4G6I A;  5IT9 E;  3GO5 A;  1JWS D;  2HDL A;  4A3M B;  3JAM E;  2F03 A;  3BDO A;  2IX0 A;  1CHQ D;  3R93 A;  3NQT A;  3OEH A;  3GVJ A;  5CDF A;  4MN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...