3H94A

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 39
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3h94A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h94A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3h94A01
2AUJD 4OO1G 1VF7A 1IW7C 1DCZA 3BDOA 2A69C 3LNNA 3H94A 3M7NA 1QJOA 2A6HD 3VR5A 4TQUS 3I4LA 1HCZA 1O7LA 1V43A 1OXVA 1ZYRC 1OXXK 3OW7A 3P20A 3ND8A 3A8KE 5KNBA 4HR7B 4KKTA 2V4DA 3A8JE 3CRLC 4KN7C 3CRKC 2A6ED 4KMUC 3MFYA 1FYCA 1GUTA 4I7ZC 3MXUA 5KNCA 3I73A 4DK0A 4RCNA 1GJXA 2A69D 5A35A 1T5EA 1HPCA 1GHKA 3SDZA 1E2ZA 1PMRA 2KCCA 3WDNA 1Q90A 1G291 2A68C 2EDGA 1Y8OB 2K33A 2EJMA 2K32A 4JK1C 4KKUA 2D5DA 2K7VA 3RLFA 1GHJA 5KNDA 2EJFC 2E74C 3VA7A 1CFMA 1VF5C 3IFTA 4H0LC 5BN4A 1Y8PB 3LWUA 1Q12A 1H9JA 1HQMC 2DNCA 3FMCA 3PV0A 2ZT9C 4PV1C 3T56B 1OXUA 2NN6H 3I72A 3PUYA 4OGQC 5C0XH 1CTMA 1CI3M 1H9KA 1IYVA 2NN6G 2BE5D 3W3AA 4KKSA 3OOCA 2DN8A 3VR6A 4GZYC 1YNJC 2KA7A 3TZUA 3IKJA 3DXJC 4G7HC 3QJYA 3EQLC 2R6GA 2EVBA 3N6RA 1E2WA 3FPPA 1HTPA 1K8MA 2AWOA 3PUXA 1BDOA 1Q1BA 4TKOB 5C0XG 5JEAH 1GUOA 1DD2A 2F1MA 1DXMA 2PNRC 2A6EC 1Y69U 2PCFB 4XTCS 1GUGA 2JE6I 3VR3A 5K36G 3L7ZC 2LMCB 4DK1A 3ND9A 3PUZA 2BE5C 2JEAI 3M4YA 2BA1A 3M85A 4BA1I 3HGBA 2D2CC 2O5IC 1I6VC 4DNTB 1Y8NB 3SE0A 2O5JC 2E75C 2B8GA 1K8OA 2YYZA 3A8IE 1Q1EA 1B9NA 3VR2A 4H44C 4OO1H 1H9SB 4LJZC 1VCIA 1Z7TA 3OPOA 4JBWA 1VDZA 2A6HC 3PUWA 4H13C 3VR4A 4IFDH 2NN6I 1A6XA 1H9MA 1ONLA 3A7LA 3GD7A 5BN5A 3U9SA 1OXSC 3D31A 4XIGS 1B9MA 1LABA 1V8QA 3QG1A 1ZKOA 2BDOA 5BN3A 2IT1A 2CW0C 4IQZA 5K36H 3PUVA 3A7AB 2AUKA 4LK1C 2EJGC 1IW7D 1FR3A 1GUSA 2Q8IB 4KI0A 4BA2I 3NE5B 1SMYC 2A68D 1EWHA 4G7OC 1E2VA 2JEBI 2QF7A 2E76C 1H9RA 3GQBA 2PPBC 3KLRA 4KN4C 1YNNC 3AB9A 3D4RA 1O78A 3QIAA 2D62A 4G7ZC 1GUNA 1OXTA 2BA0A 1TKWB 2L5TA 1TU2B 1H9SA 3T53B 5JEAG 2B8FA 4L8JA 3T51B 4DNRB 4KHZA 2DNEA 1IYUA 1Z6HA 3BG3A 4IFDG 1LACA 2JXMB
chains in the Genus database with same CATH superfamily
1RL2A 1UWVA 4DR3Q 4GKJL 3OP1A 3BVGA 4LF5L 1Q81C 4BPRA 2F43A 3G4SA 1PKVA 1BKBA 4QGUA 4J15A 3BC9A 4HJ5A 3S1NB 3PGZA 2C35B 4BBSB 5KNBA 4FXGC 4JI5Q 1EU4A 1LT4D 3G7LA 3MXNB 3S1QH 4BBSH 4RDJA 3GV6A 1I50B 3MFYA 1BPLA 2ZTGA 4DU9A 2PZTA 2F4NA 4GN3B 2BVNA 1ZXTA 1PHJA 4B3SQ 1OTCA 3MC0B 1YITB 1F2YA 2N8NA 4K2KA 5C0XJ 2R92B 1STGA 5IGBA 2AHOB 1AIPA 5CR3A 1A2UA 1WOOA 1BF4A 1ZUNB 3S2HB 1RF2D 2XNCA 1P8LA 3ULPA 1ELOA 3FJOA 4NPSA 4LF8Q 3W2GA 1GOZA 1X56A 4DR7Q 1K83H 3FMCA 5FO1A 1YLOA 1J9ZA 1TWAH 1K3RA 2ZT9C 4N9TA 3VYRA 4EQNA 3KFUA 3GTMB 2RDHA 3CC7A 4HIKA 3OOCA 1G2SA 4H02A 1W34A 3TZUA 2VUMH 3AVTA 4EH1A 4FP5D 4RHSA 3IRBA 4XQJA 1D5ZC 1GVHA 1XTDA 2BCOA 2F0MA 2HQEA 1STHA 1QX4A 1SROA 4JC0A 4TKOB 1D1KA 1KDCA 4NXMQ 4KJOA 4DAYA 2EYLA 5I9PA 2KBNA 4OXPA 4IUVA 2CQAA 3KL9A 4JI7Q 1NR2A 2LKVA 4DQLA 4NCNA 3OAAA 2V7TA 4AYBE 2JA5B 2JEAI 2BA1A 3MXNA 3SK6A 5IIFA 3UDIA 1OB0A 2D2CC 3JQRA 1A15A 2QMUA 1I6VC 4N3NA 3K80C 3Q0AA 1CNFA 2CK3A 1DOKA 1EOTA 3U4ZA 1SNMA 3KEWA 5A2QL 1TXYA 1Z7TA 1RQRA 3M7GA 1XMOQ 4IFDH 3CCEA 1NE3A 3I91A 3QR8A 3ZZTA 1P16A 1V1PB 3CMMA 4ROXA 4DR5Q 1KD1D 2E2DC 3S14B 4K6DA 3WY9A 4JV5L 3LGJA 2CBXA 1V8QA 3CCEB 1VHOA 3OEHA 3BCDA 1X3QA 5C4HA 4K6LA 1GVPA 1PLFA 2B29A 4MN3A 3A8IA 4TMVA 2I0QA 4F7XA 1NAPA 1DONA 2JEBI 4AC9A 2B2VA 2YV5A 3QFSA 3AVVA 5EPKA 1LTGD 2AKWB 5D3IB 1YJNA 2I46A 1IYJB 1O7IA 2R93G 2G5DA 1O78A 4P12A 1L1OC 1TKWB 5FO7B 2E2HH 3PIPA 5FO9B 4KHZA 2UXDL 3R3OA 1LTTD 3KJPA 2F0OA 3R8BA 1FGUA 3BDOA 5BSXA 2F4VQ 4WZLA 5EMNA 3EVQA 3GTGH 2HUGA 1LT6D 1A8VA 2OF1A 4UP9A 2EYHA 2SEBD 1J5EL 4DV3L 2PZWA 3QOJA 1U4MA 5M3MH 3VMFA 2WFWA 1M90C 4X3SA 4LMQD 3CRKC 4TRDA 3C1EA 1AW7A 4LF5Q 1GUTA 5M3FB 1JOOA 1QNKA 2A69D 1KMHA 5ELDA 1YNXA 3FHWA 3I7FA 1QFYA 1G291 2A68C 2KCMA 2WB1G 3HOYH 4N8FA 4GN5A 1WYDA 4AQYQ 1WTWA 1WOPA 2EJFC 1HR0Q 1WTQA 3C46A 3G48A 4JI2L 3BS1A 4R4TA 1LTRD 3BY2A 1PTOH 3G05A 1OHHA 1S5CD 3PIOA 1LTSD 1EWCA 1MSHA 1WDTA 4P73A 4YAOA 4DR7L 3UDGA 1BR9A 4X0CA 2N78A 4A3IG 1TTTA 1QUQB 1AMOA 3CC2A 2AQ1B 1K0RA 3S16H 3R6KA 2H4OA 1D5MC 2B7CA 2OTJB 1SE4A 1VQBA 4X66Q 1R5BA 2PCFB 3RLNA 4P3YA 1JB3A 2F0WA 3PO2G 4P26A 1CKMA 3W1BA 1IL2A 4P3IA 1WORA 1VLYA 2UUAL 3H15A 3I56B 5KIXA 1KNAA 3HOVG 1L0XB 1K3BC 1EY4A 3A8IE 1WU8A 2VBSA 1YVCA 4E6IA 2V7XA 2CW5A 3BCFA 2M00A 5ELFA 2E2HB 1GAQA 1YHQA 4KHVA 3W5VA 4ILWA 1PH4A 3A7LA 1A6XA 1S5ED 3CPWA 3W1GA 1Q3LA 3AU7A 1G7RA 4ZRZA 1QZGA 3I55B 1NUCA 3TS0A 3ERSX 4NP5A 2Z4IA 3DEOA 1FX0A 3TN2A 4FF2A 5J1ZA 3G71B 5ELBA 5C44H 2CW0C 3CC4A 2BF4A 4XD7A 4HCSA 4LK1C 1MABA 5CV8A 3I4MG 1EY0A 4KD4A 3CCJB 3KLSX 3VYUA 1KQSA 1HH2P 4A3IB 1HZCA 3PUMA 1PRTB 5JPNC 2L5TA 2K5NA 4A3JB 4TT3A 4ULLA 4YELA 3K7AH 2EYPA 2WAQE 1VJSA 1HA3A 3I4NH 1TIID 2QTLA 1FNCA 4XYQA 1I6HH 4JYAQ 1QJOA 1ILQA 2A6HD 4J0QA 4HCEA 4A3EG 3DUZA 1M1KC 5FOBB 3RN2A 4A3EB 1F77A 4YAWA 1IKLA 1R5OA 1DGSA 5TRDA 1PRTF 2GQFA 3A8JE 1IJFA 1UE5A 1GJRA 2Z6BD 2N49A 3UI2A 1YHQB 2RKSA 3F2UA 4A3GB 3EBEA 4V0BA 5A35A 2YWGA 1KLGD 5AJ3Q 1E2ZA 1LTBD 2BV3A 4N3GA 2NBFA 3CQZB 4JK1C 4LF7L 2RSOA 4LWCA 1JWMD 4JI8L 2LFNA 4OELB 1Y1WG 1SE8A 4XOPA 2E5LQ 2JA8H 2A8VA 1S5DD 3CKIB 4QIWE 3SR1A 1M8AA 4A3BG 4MYUA 3F8TA 2OBTA 2DNCA 4ZCMA 2CRVA 4ZCIA 5M5YB 1RODA 1BQEA 1CHPD 4DV1Q 3PUYA 5L46A 4KHPL 4DR4L 2L11A 3S16B 1ILPA 4C3HH 5F2DA 1C8CA 2X85A 2N3SA 2DN8A 4XN3A 1CT1D 1E1RA 1NRKA 2V1CC 1VQHA 5I6WA 3UDXA 1QCBD 2WACA 5CV6A 2XZOA 1QG0A 2F1MA 1HNXL 3TDQA 1SNQA 2WV6D 1T6XA 3D0FA 4DXGA 1R9TB 1CUKA 2ZXIA 1K73D 2EYMA 3MHBA 1YI2A 2F0EA 4GQNA 3T4AC 1N36L 1QGAA 2RCNA 1KL9A 5M3MG 3CF5A 2L55A 1F2ZA 4DFAA 1PTOD 3NWTA 4A3KG 2ZJQA 3VA5A 2VNKA 3WOFA 1VCIA 4KK7A 1E43A 4OHJA 3FPUB 3VR4A 2NVTH 2WIIB 2KQ3A 1QVCA 3K7UC 3GSIA 4LBVA 3GD7A 2Z6KA 4XIGS 4ZKBB 3STBD 4RKBA 4FYDA 3ER0A 5HXBA 5B6IA 4WZEA 1RTNA 4V190 3GTGB 1LT5D 5IYDG 2XOKA 5J35A 1FD7D 2H1EA 2R61A 5E1FA 3I55A 4B3SL 1SMYC 2O4XA 4A3MH 1G91A 2VBTA 1FNVA 3NSWA 1EFUA 4NB3A 4DN4M 2UUBQ 1DDGA 1ZM9A 1TR5A 4Y7NH 2D62A 1J6QA 5M5WB 1ZEQX 4KV6A 1JCKB 4A76A 4NKLA 4TMTA 3LWEA 4OOXA 3GV3A 2K1BA 2MHVA 1W35A 3ULLA 4OO1G 3E0EA 1VF7A 1B3AA 4RGOS 5TY0A 3WYAA 1PH9A 2DY8A 4A3FG 2PMZB 1I6HB 4XM3A 3A3GA 4IUPA 2DEUA 3CCSA 4ZGQB 1Y1WB 2QN6A 3QFRA 1V1PA 3K7AB 1UD4A 3HOVH 4G57A 3PO3G 1U2RA 1FYCA 3HEJA 4LNQA 1Y1VB 5EPLA 4UP8A 5KNLA 1PMRA 1MJEA 1T6ZA 2F0HA 4DR1L 1JJ2B 2EXZA 3JAMi 1F9SA 3QSYA 5IY0A 3MMPA 2C5HA 1PYSB 5IK2A 2L15A 4H0LC 5BN4A 2GA4B 3RD4A 3FDTA 1A8PA 2EE1A 4DV7Q 2IHEA 3BYTB 2K4KA 2XSCA 4OGQC 3S1MB 3CCRA 4IPDA 3WBKA 5JJZA 1X9NA 5JOBA 1SMYD 2OBSA 4JV5Q 5LMUL 1VHEA 4GZYC 3I4OA 1MBYA 1D2EA 5C3EG 1TWCH 4B3RQ 1EXMA 4M8AA 3VO2A 3OZUA 3BDLA 1N32Q 2VQEL 4CGYB 3OJWA 1DXMA 2EOTA 4PNYA 3I4MB 3AVWA 5IP7H 3NK9A 1EUJA 4A3LH 4QJFA 1EYCA 1BVSA 4XQQA 4HSVA 3U9OA 3URYA 1B2RA 1LO5D 1WJJA 2V7QA 4QB4A 1STNA 1JR0D 5JPMC 4DV2Q 2WSSA 1HJPA 3RZDB 2JA7B 2YYZA 2L0CA 3BZKA 2KHSA 4JI1L 5HGQA 4C2MB 1AZPA 4DV3Q 5IYWA 2NZOA 3KF6A 1CNEA 1K28A 5IGDA 1NJIC 2D74A 4ZV4A 5D3DA 2NTSA 5IP9H 1QGYA 1IXRA 1ET6A 1KAAA 3KLWA 4GLVB 2JJ1A 4YY3L 3MHPA 2D3LA 1V1QA 5EQ0A 2M2LA 1E1OA 4XT1B 2VNIA 2IL8A 5K36H 2EY6A 1CQVA 4FVMA 1S5BD 5IE8A 1MIUA 2DY7A 3CPXA 1SJHD 2BH2A 1HXYD 3PENA 4FN5A 1G7SA 1JWUD 5ELOA 2X6GA 4WZTA 1BUVT 3GTQB 4HE5A 4ZKCB 2BA0A 5JAVA 1ZM4A 4QUCA 1SFOB 1K8GA 3CMAB 1CQFA 5TR9A 4HAEA 3T51B 3RNUA 1WP6A 1R4PB 4WQMA 2D3NA 4C3JH 2JXMB 4P6VF 2UU9L 4OWTB 1IW7C 3AVXA 2JSOA 4ID6A 4K8IA 4KTAA 3CW2C 1XTCD 1E64A 1XPRA 4A3KH 2B2UA 1DARA 1VQNB 1SE2A 1TWFB 2AWNA 3OZVA 3A8KE 2E2IB 4CQJA 4B3ML 3ITPA 4OX9L 2CKZB 4X7EA 3CRLC 1K8AD 2PMDA 2E2IH 1VQAA 2B2TA 3HKZE 5FJ8H 4A3GH 1BJKA 1BQQT 3MVVA 3BJUA 1BOSA 3I73A 4DF7A 5GV7A 2FX3A 1ENAA 1TVXA 4YAFA 1OO9B 4G1BA 2OT2A 2DGYA 3CC7B 2HDLA 2DJGC 1BCPB 1STEA 3NQTA 3RLFA 4XKWA 4RD0A 3L2PA 5F4MA 1F9RA 2F0KA 3HKSA 2W6IA 1W87A 2DETA 3CC4B 4WRDA 4X65L 4JI6Q 4II3A 2CNDA 1SLJA 4YHHL 1X55A 4C1NK 1HTLD 4G7WA 2ZTEA 4PZ7A 2MQHA 4EVOA 2AHOA 1E79A 1YNND 3T56B 1OXUA 3KOJA 3DWAA 4RGMA 4PC2A 3I90A 1IBKQ 2V7VA 5LMZA 3H0GH 4MYTA 1PTOC 4B3GA 2LY7A 1BX0A 1H42A 3JQPA 3W5HA 3D26A 1AH9A 3U50C 2AWOA 4Z4ZA 1Q1BA 3NBIA 3ASQA 1SNCA 1GUOA 2PLFA 2RC6A 3BVMA 3KBGA 4A93G 4Y9UA 4RD4A 1PFNA 3NELA 2ZBUA 1SAPA 2QEJC 4RMFA 3V2TA 3BDCA 3OFNA 4P6YA 5IYCG 1TWHH 3M9BA 1ZM3A 3DEPA 2ZJPA 3E0JA 1J9OA 3MWYW 2G9DA 2JA7H 3C2QA 1UE1A 2MGSA 4IUNA 1WD1A 3SE0A 1XNRL 3E5SA 4JI3Q 2O5JC 5D65A 1JWSD 1QUQA 4PMCA 1EFRA 3OMGA 4C1NI 5E3FA 4DV6L 4P2NA 3HS0C 2PNHA 1W3SA 3OYYA 2KHJA 3PUWA 1VS0A 4A93B 3MA2B 1VQPA 2FFKB 3A1PA 1I4HA 2NWGA 3DLLA 1VQ7A 1HA6A 2LZJA 1BLIA 3S15H 3PIP3 5EBDA 4GKKQ 3LQ6A 3NXWA 1YHBA 3X3NA 5LMNW 2H5XA 1ZKOA 2BDOA 1VQDA 1XX8A 2AUKA 4WJ3M 3CD6B 4DUYL 1AE2A 2JJ2A 2Q8RE 1WOSA 4MHEA 4ZGNB 4UZUA 2E76C 1JA1A 1FNWA 4K5WA 3HAGA 3AB9A 2HHHQ 2YWHA 4R9WA 1KK2A 1I50H 2VS1A 4GNXA 4LC0A 1TT2A 2Z6BA 2B8FA 1KZLA 2I5HA 3C3LA 3K0YA 1E1QA 1WI5A 3M3YH 3GTPH 3GO5A 1QUFA 4IUQA 1G2TA 2MO0A 3HG9A 4DUZQ 2Y0SG 4EQ5A 3NP8A 3ND8A 1K0SA 2K5VA 4KKTA 3MFGA 1SYFA 3I3CA 5LHY1 4IALA 3J7ZC 2KEDA 1FL0A 1F2MA 3SXHA 2BM1A 4DK0A 4OONA 5J3OA 1A2TA 1BBUA 4IPHA 3LQEA 2NUCA 4CBVA 1D8TA 2GJRA 3E20A 2ES2A 2C77A 4KJNA 2EJMA 3V76A 4F8MA 4ALPA 1STAA 1E3ZA 5C5MA 4LW1A 4BBSG 1PZID 1C9OA 3HOWH 2I1LA 1HNZQ 2VY3A 1SYCA 1O7ZA 2L12A 1Y8PB 3LWUA 1VQ6B 5C3EB 4FF4A 4RD2A 2VXWA 1SNPA 4XT3B 4QIWB 4QL5A 1UEAB 4QUFA 4A3KB 4KKSA 4JOIA 3OE7A 4X64L 1E1TA 4G7HC 5ELEA 2R6GA 1W2BA 2EVBA 3OW2B 5C44G 3I8ZA 3L9AX 2I5LX 5HZAA 1Q81D 3MXPA 2HT1A 2Z8LA 1BNZA 4F87A 2RHSB 1OGJA 2F3IA 2D0PA 3RY8A 2QDXA 3KF6B 3LX0A 5CV7A 1BBXC 1T9HA 3GTQH 1JMCA 2BN4A 2LMCB 2BM0A 2JA7G 3QB3A 5ISRA 3M85A 3F2DA 4DQKA 3UE0A 1R5NA 3CRZA 1J8IA 4APVA 4JI0L 2DOGA 4YWMA 2ZTCA 3VR2A 2XEXA 4OO1H 2HLDA 4GNXB 4RCOA 4CJ1B 1A3TA 2WAQB 2WKDA 3CCQA 2R7ZB 1A3UA 1Y0YA 4XR6A 1D2BA 2NVQH 2JA9A 1JICA 4BY7G 1YEZA 2E8GA 3D4WA 1B23P 4JI3L 5JVH3 1FNUA 1FVIA 2K04A 3CD6A 1BX1A 5DSZA 3CHBD 3FKIG 4C2MH 1XJVA 3HOYB 3ZZ0A 3KK7A 1AEXA 4FNFA 5CYUA 1YBYA 2JDIA 3CCLB 3WNBA 2KVMA 2GK6A 2OK7A 1IW7D 3KF8B 5FLXL 5M3FH 2ASBA 3B82A 4OOVA 3AFPA 5C4XG 1XNQL 1RJTA 3HKZB 3ZYYX 3S15B 3NBHA 2WYRA 4M4SA 4POGA 4BWGB 3J81E 1KRHA 3FVQA 5IT9E 1TU2B 1WTPA 1QVGA 1BCPF 1EZ8A 1FNDA 2ZL6A 4L8JA 4L63B 2B3GA 5IGCA 5IYBG 4LFBQ 3JAML 4RCNA 1X65A 3Q22A 3S2DB 1NMGA 1L1OB 3QFCA 2I07B 2SOBA 4OL7A 3T13A 1TWHB 3NEMA 2R6HA 1EEFD 1HQRD 2HD3A 1SYEA 4R4CA 4B08A 1MI2A 2Z0SA 2UXDQ 3F2BA 1EY7A 1STYA 1IHZA 1TS3A 3K59A 1YJWA 1GUWA 1UEBA 1PTOF 4CKCA 2F1LA 4YALA 3AVUA 2R7ZH 5JBQA 2IPKD 1EFCA 1B8AA 3K81C 4N8X1 5L37A 2UUCL 3WDNA 1EFTA 2B2YA 1Y8OB 4A4IA 4P22A 3Q3AA 1D7QA 1ICFB 1IJEA 5KSWB 2RCFA 4PMBA 3R93A 2X8KA 4IUUA 4A3JH 3OMCA 4JI7L 4AYBG 4NXNL 1HZ9A 1EP3B 2NV4A 1SE3A 4O42A 2VNUD 4PAAA 3HOVB 1NR4A 4C3IG 1NTGA 2SNMA 2ZTDA 2K5HA 2SNSA 3S1RH 1FJGQ 5JJIA 2MJ8A 4B3XA 2CH4A 3W3AA 4ZLTF 1GO2A 1HNZL 1EP2B 3QO2A 3A5UA 2WAQG 3H91A 4LUZA 4I7AA 5IWAQ 1DD2A 4U9UA 1PH5A 3RR5A 3SVMA 1Y69U 2YU9H 1K28D 4A3MG 4A3CH 4TN1A 1GD7A 2IX3A 2DCUA 3Q6QA 1YX2A 2FHTA 2FMMA 2K14A 1YJ9A 2OWOA 2BOSA 4X7CA 3SGIA 1DJRD 2JA6G 3PUNA 1TWFH 4ABNA 1Y8NB 2QILA 1JQYD 1SYDA 5IGEA 1NY4A 1K8OA 1EIGA 3A55A 1CQXA 1S40A 1B50A 1VQ8B 3J7AV 1EYGA 3CCVB 1I4GA 3G6EB 2A74C 5LL6S 5TSSA 2WPDA 3U6KA 2A19A 4QMGA 1GM5A 1I7PA 3K58A 5M5XH 1NSNS 2LS01 5M3FG 3ZZUA 3PSIA 2C78A 3SLDA 4LUVA 5FO8B 4G7OC 4PC7A 4HIZA 2PPBC 2WB1E 4R4QA 1T6YA 4BY1H 2BSAA 4KN4C 3NTKA 3J80i 2DERA 1RD9D 5CMDA 4IO9A 1SSOA 4FXDA 3BNWA 1OGIA 1Q9SA 5GAGC 2P3MA 1R9TH 1BCPC 2EIFA 4CKEA 1PYBA 2UXCQ 1EZ6A 2AUJD 3RZDH 3H3VI 3A35A 2CC2A 2QW7A 2YTVA 1WTVA 3WXMA 2R7DA 5KYLA 2Q2HA 1V1OA 1V43A 5BSYA 3MEFA 1OXXK 4B4DA 3AVYA 1Q8KA 2F0PA 3T1HQ 5LL6X 3ZBUA 4G6IA 1S4MA 3OSOA 3TBIB 3JC66 2LXKA 1KRSA 1LTID 5IP7G 4A93H 4DR6Q 2PE3A 5C4JH 4BBRH 1AFPA 1SRUA 1UD8A 1T5EA 3K0XA 1EL0A 2HDMA 4G4KA 3HFZB 2FVGA 2B2TC 2F0DA 2GN5A 1JJGA 2LSSA 1HNXQ 3P75A 5ELNA 1SM4A 4ACAA 1IL8A 4ZYSA 3M4PA 1LUZA 2J4XA 1N0VC 2E1BA 3LO8A 1EOVA 2GPJA 4C56C 4HJAA 1WCMB 1L0YB 4RLZA 5IGGA 3RMHA 4R4OA 4YAUA 2ZTNA 2EY2A 3QJYA 5KEEA 2NZHA 2WP8J 1K8MA 5D14A 4P75A 2ATWA 4K0KQ 3A0JA 4LFCL 4J8QA 2CFMA 5M5XB 4Z4TA 1PJ6A 5AFWA 1A63A 4O1NA 2BE5C 3N52A 3MTSA 1I5FA 5AN9A 4GLXA 3R2TA 1QWYA 4JPBW 1EIYB 3PA1A 1PH2A 1Q8IA 1E62A 3CW2A 4HIOA 4DNIA 2C5CA 4CJ2C 1KTVA 2M5SA 1A3VA 1TS5A 1CK1A 1Q1EA 2TMPA 4OPVA 1KDAA 4U673 4A3BB 4P74A 1E3PA 5J22A 2ZXPA 3K5LA 4XLAA 3OPOA 4B43A 4M0LA 1EYDA 1VDZA 1X6OA 4JG2A 4OIJA 4DUZL 3J81i 3P26A 4CKBA 3P27A 4XKVA 1H9MA 1ONLA 3C1FA 4Y7NB 1XXGA 2F0VA 3FEWX 4UDUC 4YWKA 1IBLL 3CC2B 1RKNA 3RZOB 1N0UA 3E9IA 3VNUA 3ZC3A 1PDQA 2HDNB 3AGQA 2Z9HA 1HVXA 3E6ZX 1UMKA 1S72B 1M90D 1XQBA 4XLCA 4C3JB 3GQBA 2MNAA 3HZXA 5M9OA 1K83B 3NPPA 1SFOH 2RDFA 4HEDA 3RLOA 1QOHA 1VQ9B 1HNWL 4DV4Q 4NMZA 4GOPA 1WVLA 2IX0A 3ISXA 4XN0A 4IFDG 2W6JA 2ZXRA 1GJXA 1LACA 3B8HA 2F52A 2R92H 4KY6A 3BYYB 3K6OA 4DK3C 3OTOQ 1D5XC 1KK3A 3JU4A 1MRZA 3OJXA 2B2UC 3DWQA 2GVAA 3VR5A 2IWHA 1NJID 3I4LA 1EIFA 4N9PA 3BY1A 3TMEA 4CJ0B 1ZYRC 1VQOB 3MAQA 2IX1A 3GTPB 3U2QA 1HUMA 4G5GA 1RQPA 3D8GA 3CMAA 2PI2E 1COWA 3G6JB 2GK7A 3BQJA 3AQQA 4I7ZC 3NTIA 3J80L 1QFZA 4RFBA 4PGOA 3TSSA 1XMQQ 1K73C 3P7JA 3A56A 2CWAA 4JVZA 1Q90A 4IOCA 3SEBA 2ZL7A 1IHMA 4QHYA 3GTOB 1Q82C 4FF3A 4OPOA 2Y0SB 4DPGA 2YTXA 4JYAL 3IFTA 4C3HB 2XWBB 3ZIAA 4RH6A 5CV4A 1HR0W 3U6BA 4Q7JB 1BXTA 3I1FA 4QV2A 1VQCA 2PQAB 5C0XH 3KYHC 2Q6IA 4AVZA 3F2CA 4JI1Q 1XYIA 4XLEA 4H7BA 3KLSA 1X3GA 2F4IA 2VQFL 3DM1A 1MKHA 2K75A 1B4OA 1E2WA 3FPPA 5EKIA 4CDFC 3T1YQ 3GTLB 1TWGB 2WINB 2NVXH 4MZ9A 5BR8Q 4ZAIA 1YIJA 3OEEA 5A2QE 5GV8A 2MO1A 4RA8A 5C4XH 2JE6I 1W6KA 3GDEA 4YY3Q 1UD6A 3CCVA 1HR0L 2XNDA 3PCOB 4LBZA 5E4WC 1WCMG 1YNJD 3DM3A 3SK5A 4BA1I 5LMNL 3AEVA 2NVQB 1N32L 4JMQA 4R71A 2C2WA 1EYAA 4RCYA 2AQ3B 1HHVA 4ZUJA 2JA5G 4A3LG 1VQ8A 4OP7A 4A3DB 4ASUA 1Y1VH 2PW5A 2HIVA 3EN2A 1QVFB 1K9MD 1ML0D 2OBRA 5EJWA 2KECA 4ACBA 2JK8A 1IKMA 3J7A5 4YHBA 1ESRA 4IFDJ 3OHXC 2X69A 1MJCA 1Q46A 1YHAA 4QY7A 4R8IA 3ASPA 1BCPD 1BO0A 2XGTA 1OB5A 2IT1A 3G71A 4IQZA 4Z4UA 3A7AB 4A75A 4DXFA 2HCIA 1FR3A 2NB0A 1BMFA 3RUZA 2WZNA 3NE5B 4X62L 1KXLA 2GVBA 1E2VA 2Z1CA 1H9RA 4QVJA 1V0EA 1CZGA 2WJYA 2XVSA 1R4QB 1CSQA 3S24A 1VQGA 2A5HA 2NYZD 1XE1A 4ZQ3A 1FNMA 2K01A 4ODGA 3ZBTA 1VQKB 3GVKA 2JQOA 3GTLH 1B1ZA 2EYFA 1W9XA 4LF9L 3PVDA 3H94A 4ME3A 1N34L 3M7NA 1H85A 1TS2A 2R93B 1HNWQ 4YHHQ 4L5SA 5T1IA 4RCZA 5IYPA 1Y14B 1VQMB 1NDHA 2EY1A 4X3TA 1F9PA 2ICEC 1WFQA 4B9XA 1X3PA 4AF6A 3WWVA 4KMUC 4JI4Q 4A3CG 2QGGA 1G6ZA 2QEXB 1IBML 2NVTB 5DAUA 3TP5A 3GTKB 3PF4A 1HPCA 3GVLA 2KCCA 1WOCA 4IPCA 2OTJA 4EQOA 3X3MA 1PFBA 3FPKA 1N07A 4NXML 4DV0Q 3I4NG 2XIWA 3ES9A 4OWWB 1CFMA 3F1ZA 5GQOA 4HIDA 3PF5A 1FGBD 2RDGA 1E0BA 4K2LA 1Q12A 4LAAA 4A3FH 1PTOB 4BY1B 2YWFA 4K5XA 4JOIC 4BXXH 4DAVA 3WNDA 3S1NH 3KF8A 2DYIA 2BE5D 1HZAA 3IAYA 3S17H 2X6LA 1N05A 1UUPA 3PO3H 4J1MA 4H9GA 4RGTA 2DY1A 2MPMA 3PUXA 2ZL5A 4JI8Q 3ZJYC 2IJ0A 1L0WA 2DIEA 2PNRC 5HY6A 2JYOA 3EROA 2OXPA 4X3UA 5M5YH 4Z9CB 1VQLA 1CA5A 2ENBA 4UHVA 5M3MB 4GOPB 2VNJA 2Q6KA 1TY0A 2F03A 2BGIA 4AF7A 2QKIC 1KABA 4DR4Q 1VQEA 1X3FA 5GADC 3EJIA 1E22A 2X3UA 4YXWA 1KJZA 1HRJA 3NWSA 2I5MX 2O2LD 1HZEA 1YJNB 1II3A 2L9HA 1WPCA 5E4XA 4GKJQ 1A62A 3K5OA 1LABA 2F0SA 1EEID 1W2BB 3W2FA 2VZAA 2QDBA 1JB7A 5BN3A 5H5JA 1CSPA 2ALYB 2FXQA 3PUVA 1QG7A 1GUSA 3J81L 2Q8IB 3J81c 4G7XA 5DM63 2F0QA 3W5OA 4I65A 3CCUB 4PMWA 4DKAC 3S14H 4LFAQ 2VB3X 5C5LA 3TZDA 3H0GB 1XFOA 5FLXE 1QH0A 3CCMB 3EA6A 3ONUA 3FRPB 1IB0A 3AGPA 1Z6HA 1JE5A 3D4DA 2Q2UA 1KD1C 4A3DH 1G6PA 4GOPC 5EAYA 1VQ6A 1EQRA 4XONA 2KHIA 4FK8A 3SHLA 4LF8L 1NNXA 3V05A 3TREA 1WCMH 1EWYA 4K14A 2F0IA 4RAUC 2Q6LA 1G8ZD 1SR3A 4C3JG 1I94L 2V7WA 4DR5L 3NBHB 5HZBA 1Q7YC 4K0KL 2VQEQ 1IBKL 3W2IA 3CPFA 1EQQA 3I2ZA 2VUMG 2NVXB 3NTHA 5C0XI 3MXUA 3W5UA 2IHFA 2VZLA 4DV5Q 2BGJA 2K05A 2K33A 4DAYB 3GIRA 2XNAC 4KY7A 4OEMB 1V5VA 2JA6H 1G51A 3L3OC 2E74C 4QFMA 2EYJA 4J6HA 1WTHD 5FKAC 3J81k 1SEBD 3E1YE 2BMWA 2F3VA 3TP6A 4OO1I 2Z6KC 3BU2A 1B3QA 5IT9c 1FRNA 1JJCB 2MUYA 1JORA 2EY5A 3NUCA 4OX9Q 4JI5L 3CMEA 4KY5A 4X7FA 1YNJC 2K28A 2OTLA 5FJ8G 3PQIA 4A3GG 4XQNA 2VL6A 1NBMA 2QCPX 4WWVA 5EPJA 1PRTD 4AIMA 1N33L 3ZPNA 2JP1A 5THXA 2ZXOA 4X64Q 4DK1A 1SN8A 1S5FD 3PUZA 3WNCA 3S1QB 3PO2B 2HQLA 1KAWA 1U4PA 4Z1MA 3DMUA 4U68A 1QGZA 2PMZE 3HGBA 5IT9L 2F0FA 1QFJA 1UD3A 2UU9Q 3HOXH 1Q7YD 1X32A 5LMUQ 2ZZFA 3H0GG 2E2JB 2F0TA 2PI2A 4B3FX 5COYA 1U9RA 1PH7A 4B3RL 2VBVA 1X3EA 2L4NA 1B2TA 3SK8A 1OXSC 1KK0A 2F4VL 5G3LF 2R9VA 3ULJA 4XL9A 4IW3B 1SDFA 4QVAA 4BBRG 4ZK9B 1RIPA 5JJLA 2EJGC 3VNVA 2PZUA 4XOTA 1UNSA 4WJ4A 1FRQA 5I9OA 4GN4B 4MNOA 1T5XD 4X66L 4DV2L 1UE7A 1I4QA 2NTTA 3PMFA 1TS4A 4G7ZC 2XGJA 4JI6L 3HOYG 3CMEB 4FWTA 1H9SA 1XWEA 3ZUGA 3ASRA 1JNYA 4G1VA 3S1MH 4RPDA 5KW9A 2UUCQ 4DNRB 1LT3D 1B7YB 2CCZA 1H8EA 2MFIA 2ZJRA 1DYQA 2F0NA 3LNNA 2C5BA 5HGTA 4KD3A 5I6YA 2VBUA 1D8LA 1HCZA 4FXUA 4WORA 3R2IA 1VQ4B 3P20A 3T1YL 4LF6L 2R3ZA 3S1RB 1N06A 2K03A 5FK9C 4LFBL 3OIPA 2ICIA 4HMJA 4UAJA 4Z4RA 1EQVA 4KHPQ 1LTLA 2KUMA 5BR8L 4QQBX 1W6JA 2A6ED 3GVJA 4WZKA 2ZXHA 4HE6A 4A3IH 1ASYA 4RKLA 1I94Q 5IWAL 1PVOA 1VQNA 4POFA 4RG1A 2N88A 1VQ7B 3OW2A 2Q8TA 2HCJB 5C44B 1QNUA 4LBYA 1VF5C 4PC3A 3K8AA 1M1KD 1I3QB 2BH8A 2F0LA 2BPOA 1D1NA 1M4VA 5C4XB 1S0UA 5CV5A 1KC8C 1F60A 2Q2IA 1UE6A 4PV1C 3D6CA 1HZBA 5M5WH 3K5MA 3TQYA 4A3JG 1EY6A 2VJIA 1H8HA 3L0OA 2KCTA 3N6RA 2QEXA 4DR2L 2N55A 2B2YC 4YCWA 1HTPA 3ASSA 4A3MB 1BDOA 1QUEA 1SKYB 1L1OA 2KENA 5JEAH 2K52A 1PH8A 4OIKA 1I8DA 1OB2A 3BZDB 3GTMH 3J80E 4XTCS 4UP7A 3JQQA 3NQIA 3M4OH 4HN7A 3SK4A 4X65Q 3L7ZC 3FKSA 4B48A 4ZCLA 5EGTA 3S2HH 4XYOA 3ERQA 5IODA 4HIMA 3CP8A 1HA5A 1C0AA 1EY8A 4C3IB 5DLQE 2E2JH 3PA2A 2UUBL 3JAME 2M9VA 3ICEA 4IFDI 2CHBD 3H9NA 3CCLA 2UXBL 1RHPA 4Y52H 3TP8A 2QTZA 1I3QH 3OWEB 3NHHA 2NN6I 1TLLA 4II2A 1TY2A 3D6WA 5DN6A 4CDEC 4DV1L 3U9SA 5T1GA 1U4LA 1TVCA 1B9MA 1S4ZA 4L6TB 3BH4A 1PV4A 3AYHB 2C9OA 5DNFA 5H1SE 1VQLB 3VO1A 4UAIA 2GJPA 1SJED 1P4MA 2DJFC 4X05A 1Q86D 5HURA 3S9WA 4XMYA 1DOLA 1XNRQ 2UUAQ 3AFQA 2F0UA 2HIXA 4X8IA 2K6AA 3U58A 3SJZA 5KGUA 2ZZEA 3GTKH 1VQIA 1E7ZA 4DV6Q 3D4RA 4TSFA 4HMIA 5IOCA 3QIAA 3GTJB 4R1JA 2K5WA 3T53B 1I4XA 1F20A 2DNEA 3BG3A 2JA8G 4BY1G 4B44A 2EPBA 1DCZA 4EGVA 1L2FA 4BXXG 3W2DA 4UPAA 3CCMA 3CU7A 4GLAC 4QF4A 1PXUA 3KDFB 2AQ2B 2OYNA 1PZJD 3GP7A 3W2HA 5JVG3 4OOSA 4X7DA 1KC8D 4GNXC 1WTOA 1JJ2A 1V9PA 3CQZH 1EFWA 3CPWB 3TP7A 4AQYL 3CP2A 2HHHL 1LTAD 2CW0D 3FKIB 1B53A 2QA4B 3B6YA 4JI2Q 5C3XA 4MTKA 2QDLA 4M1UB 5FLMG 1KHIA 2A1AA 1SNDA 2Q6OA 3E9HA 3CCSB 4XQFA 3VYTA 3VA7A 3EIVA 4C3HG 2EXDA 2XN9C 1SBBB 2Q2TA 4RD3A 1U5KA 2ZITA 5C6AA 4UZEA 1RCVD 4FDBA 3I72A 4NNJA 5IYQA 1MGSA 1LV9A 1CTMA 1WTHA 1W0KA 4P1VA 5DS0A 3OIQA 1IYVA 4X06A 2EYOA 2HMAA 5CBAE 3D3RA 1NCVA 5I2YA 3CB4A 1LYLA 1VQ5A 2XTIA 3M3YB 2QGQA 1IBLQ 3R6JA 4LF7Q 2G9HD 1CKNA 4KLKA 2KCNA 4IJLA 2RA4A 1GUGA 2ZM6L 1GR1A 4YEJA 5E7NA 1VQOA 1RTOA 2B2WA 3P1HA 3C2PA 1E63A 3HOWG 4L5RC 4NXNQ 5IYDH 1IZ6A 2JJQA 4DR2Q 5GAHC 1F2LA 1KK1A 1AN8A 2X53S 1Y0RA 4RPBA 3FP9A 2O5IC 1V0FA 4X6AH 4LF4L 1Q82D 1QVFA 4C3IH 2E75C 2B8GA 1DG1G 2WR8A 1KLUD 2GREA 4RGNA 2LXJA 4A3DG 3OWFA 1XPUA 1EQTA 2XRSD 3KUPA 4JBWA 5I4DA 3NENA 4H13C 1PA6A 4B3TQ 5KRUA 3SJPA 3M4OB 4DGZA 1I18A 5BN5A 2EFGA 3I4MH 1BBWA 2JA8B 4QUZA 3J80c 1PH6A 2JA6B 4XLHA 1S72A 1ICWA 3OTOL 2F3WA 2J0TD 4RDLA 1PJ7A 1TWCB 2UXBQ 4K1XA 4RM0A 2WJVA 5EKKA 1N36Q 1EFID 5TV2A 3GTOH 4K8JA 4PC1A 1PZKD 2A68D 1E3XA 1EWHA 2C4TA 4OPSA 3H09A 4B3MQ 1G7TA 2WKCA 1K9MC 4RD1A 2J7ZA 4PC6A 4X3KA 4PG3A 2OQKA 3K57A 2D0OA 1UD2A 3OZWA 5C3WA 5JEAG 4P71A 2P5ZX 1SMXA 2K50A 4BY7H 4UY8C 2A69C 1VQMA 4RD6A 5DM73 2QA4A 5AJ3L 4Z4SA 3O13A 4GS3A 2OTLB 3KBXA 4AYBB 1NMFA 2R92G 3QE2A 5CBEE 4WJWA 1XPOA 1XNQQ 3KJOA 1Y1WH 2VW9A 3MEHA 3HOUH 3T16A 2X0KA 2VQFQ 4HJ7A 1A0IA 1PH1A 1GHKA 2EQSA 3SDZA 3J7AF 4C0SA 2EDGA 1UAPA 1N9WA 1HFGA 1WSVA 2C4UA 1GHJA 2EIXA 5KNDA 1EP1B 4B47A 3Q23A 2R93H 4CDCC 1DOMA 3IFDA 3HOXG 3J7YW 3W2EA 5IYNA 1ET9A 3STBC 2X6WA 5C3EH 3RZOH 3K5NA 4F88A 4RWSC 2RC5A 1GXDC 5FIUA 3SEJA 2VNHA 4DR3L 1TQOA 1SYBA 5KYIA 1XB2A 2CF4A 1WD0A 3VR6A 2A73B 4S3SA 3JAMc 3HOWB 4TMXA 1VQFA 3TS2A 3DXJC 1ASZA 3EQLC 4L5TA 1YI2B 1WTRA 1F9QA 4XORA 2OQ0A 5C0XG 2PIAA 5A88A 2HCCA 2E5LL 1C4QA 3CP0A 3RN5A 2VJJA 1FNBA 1JOQA 4OWXB 1ZYRD 3HOUB 5K36G 1ENFA 1WSRA 3E3XA 2YWEA 1PFMA 5E6TA 3OKXA 5HKKA 4IJHA 3VDYA 3J81j 1O7YA 1ESFA 1YIJB 1X54A 1AP0A 3S17B 4DNTB 1ZM2A 1UD5A 5J39A 5IP9G 3PIO3 4RDKA 2KOLA 5FA6A 4BY7B 3A54A 4YCVA 2ZM6Q 2R7FA 1C7YA 5EBCA 1Q86C 1NB0A 1PYWD 2A6HC 2B63G 3HOZG 5CC4A 3B78A 3I56A 4JBJA 4M1KA 2Z4HA 5NUCA 2PQAA 2OK8A 1PJ5A 4CHTB 3D31A 3DHQA 4HJ9A 3T1HL 1QE6A 3WBJA 2VB2X 2JA5H 4LF4Q 2MP1A 1KIXA 1GAWA 2NVYH 4PQXA 4LF9Q 3G4SB 1ENCA 1KRTA 2V7UA 5H59A 4M2LA 3I70A 4B3TL 4IOAA 2GJKA 4BA2I 3IL8A 4KI0A 1RDPD 5FLXc 4ZUIA 3BZCA 4DK6C 2IW3A 3WOEA 1E24A 2KVOA 4E0FA 1VMPA 3A8JA 5F4OA 2CWPA 3HP3A 2DUDA 1STBA 1WTXA 5J3BA 1LM0A 4Q0FA 1TWAB 1N8RC 1B70B 1IYUA 1CA6A 4B9WA 1CKOA 3TRZA 4DV0L 1S3OA 3SLNA 1YJ9B 4O2DA 1CZWA 1KTKA 2JIZA 1XMOL 3VYSA 4TQUS 4DAPA 4RJLA 1VLOA 1MD2D 1CM9A 1PFSA 1Z47A 4HR7B 4RHRA 3CCRB 4Y9RA 1CKNB 4LFCQ 1EIHA 2ZZGA 1Z9FA 3CCQB 3MXGA 1VQ4A 4Z4YA 1B44D 1JB9A 1U4RA 3M4QA 4TVAB 1VQ5B 4K5VA 5KNCA 4JBMA 2KJXA 1EU3A 1VQ9A 2FINB 3V7AA 4DUYQ 1D1IA 1HUNA 2K32A 4KKUA 2D5DA 2K7VA 4R4IA 3Q6RA 2RBMA 1MSGA 1FDRA 1O80A 2B39A 2AMCB 4HSPA 2WZPP 3A3BA 2F0JA 1JA0A 5F4JA 2VYQA 3ASTA 5IYCH 5CDFA 3CESA 1H9JA 1HQMC 4HTHA 3H3VH 1JOKA 3PV0A 5DEHA 1CI3M 3A8KA 1H9KA 2NN6G 2NZ1D 4DA2A 3Q39A 4Z4WA 2K5DA 3IKJA 4P25A 1J5EQ 2B63B 3HOZB 1XMQL 4MIUA 5CV9A 2RSNA 4FF1A 1AZQA 4DR1Q 1VQKA 1N8RD 2L1BA 4HJ8A 4P2CB 2XZPA 3KDFA 4XNFA 3QOLA 4DV4L 3M4YA 4Y7CA 4DV7L 3MCAA 1D6EC 4TSSA 1DDIA 4IPGA 5JEAJ 1KDBA 2PO4A 4O0AA 1SNOA 4LFAL 4P72A 4P9SA 2B63H 3HOZH 1CHQD 1LLRD 4TMWA 1QVGB 4A3BH 3H3VC 2X6XA 1QZHA 4TMZA 1YZ6A 3GTJH 3HKZG 3HRZC 2SDFA 3LVBA 4NBSA 4UZFA 1SYGA 3BVZA 5CORA 2EZVA 1NBWA 3CXCB 3Q8DA 1Y1VG 3DWPA 3EFXD 3QG1A 1EY5A 1JE4A 4PZ8A 3PO3B 2XWJB 3HOXB 1PRTC 3H6MA 5FLMH 1EY9A 3KLRA 3PO2H 1VQJA 1YNNC 4JI4L 4A3FB 2R7ZG 2CVRA 3CAMA 3UDFA 1DM0B 4X07A 1G7CA 4DV5L 4F7DA 3ONAB 1YITA 3Q38A 2CQOA 4IUTA 1C48A 2D9RA 4NDXA 4YCUA 2TSSA 2E1RA 4DAMA 2F0GA 1I4PA 4FXKC 1O7LA 3CXCA 1OXVA 3OW7A 3S2DH 4YIJA 2B5OA 4X62Q 2V4DA 4NW2A 4IN3A 1FJGL 5GROA 3DDYA 4KN7C 5JJKA 2XRQD 3V96A 4BBRB 5FO0A 1MHWC 5FNZA 4L5QA 2RHQB 1NB9A 4YWLA 2JN9A 4C43A 5LMNQ 4Q5VA 2OCEA 4FO2A 2ZZQA 1N33Q 2PW7A 4XDXA 1JC7A 2NVYB 5C4ZA 5IGFA 3CCUA 2QE7A 5G3LD 1KNEA 2NN6H 3QWNA 1TUIA 4XLFA 2NPFA 1EWIA 4A3EH 2Y0SE 4R8NA 2B2VC 3MZ5A 4ME5A 2XNJA 2KA7A 3U4VA 3G6EA 2BDNA 1PH3A 2YTYA 1IBMQ 3SKBA 5ELCA 1W0JA 2JN4A 5CGKA 3TEHB 3I4NB 2A6EC 5EKLA 4CDDC 2B7BA 2WB1B 2PQEA 3QFTA 2RQXA 2XZLA 1GKHA 4AH6A 4JCVE 3VR3A 3Q6SA 3ND9A 4ZCKA 2FJ2A 2FMCA 2X6YA 4XXEA 2D9UA 2ID0A 2CH4W 5A8AA 4MTNA 1KQSB 1I4RA 4PZ6A 3CCJA 4GKKL 1DZ1A 1B9NA 4H44C 2PYKA 1H9SB 4LJZC 1N34Q 3Q24A 3FKIH 3ONYA 2J7KA 1N08A 2UXCL 1U0LA 1SKQA 2RF4A 4EX5A 4QCLA 1GO3E 1TWGH 4Z4VA 4PABA 2B2WC 2KEEA 3A5ZB 2K5QA 5I2XA 2RVLA 2YU9B 2V31A 2VUMB 3AMUA 3CTAA 1QB5D 3HOUG 5FL7A 4JW0A 4LF6Q 5C4JB 2OEOA 1H95A 4EQPA 1YJWB 5IYRA 2ZBVA 2QF7A 5A89A 5K5PA 1QILA 5IYBH 4IURA 5GAEC 4IZ8A 4JI0Q 1VQPB 1JT8A 3WQZA 1HFNA 4DR6L 4WFN3 4LBWA 4BS9A 1GUNA 1OXTA 3A74A 1VMCA 1SXTA 1K8AC 4JBKA 2IY5B 4M53A 3UE1A 1AE3A 4LUOA
chains in the Genus database with same CATH topology
3BVGA 2F43A 1PKVA 3BC9A 3S1NB 4BBSB 5KNBA 4FXGC 1EU4A 1LT4D 3G7LA 3GV6A 1I50B 3MFYA 1BPLA 2ZTGA 4DU9A 2PZTA 1ZXTA 3MC0B 1F2YA 4K2KA 5C0XJ 2R92B 1STGA 5IGBA 5CR3A 1A2UA 1BF4A 3S2HB 1RF2D 1GOZA 3FMCA 4N9TA 2ZT9C 3VYRA 4EQNA 3GTMB 2RDHA 3OOCA 1G2SA 3TZUA 4RHSA 4FP5D 4XQJA 1D5ZC 2BCOA 2HQEA 2F0MA 1STHA 4TKOB 1D1KA 1KDCA 4KJOA 4DAYA 2EYLA 5I9PA 4IUVA 2CQAA 1NR2A 2LKVA 3OAAA 2JA5B 2JEAI 2BA1A 3MXNA 3SK6A 5IIFA 1OB0A 2D2CC 1A15A 1I6VC 3Q0AA 2CK3A 1DOKA 1EOTA 1SNMA 3KEWA 5A2QL 1Z7TA 3M7GA 4IFDH 3I91A 1V1PB 3CMMA 2E2DC 3S14B 4K6DA 1V8QA 3OEHA 3BCDA 1X3QA 5C4HA 4K6LA 1PLFA 4MN3A 4F7XA 1NAPA 1DONA 2JEBI 2B2VA 5EPKA 1LTGD 5D3IB 2I46A 1O78A 1TKWB 5FO7B 5FO9B 4KHZA 3R3OA 1LTTD 2F0OA 3R8BA 3BDOA 3EVQA 2HUGA 1LT6D 2OF1A 2EYHA 2SEBD 2PZWA 3QOJA 1U4MA 4X3SA 4LMQD 3CRKC 4TRDA 3C1EA 1AW7A 1GUTA 5M3FB 1JOOA 1QNKA 2A69D 1KMHA 5ELDA 1G291 2A68C 1WTWA 2EJFC 1WTQA 3C46A 3BS1A 1LTRD 1PTOH 3G05A 1OHHA 1S5CD 1LTSD 1EWCA 1MSHA 1BR9A 2AQ1B 2H4OA 1D5MC 1SE4A 2PCFB 1JB3A 2F0WA 1VLYA 5KIXA 1KNAA 1L0XB 1EY4A 3A8IE 4E6IA 3BCFA 2M00A 5ELFA 2E2HB 4KHVA 4ILWA 1A6XA 3A7LA 1S5ED 1Q3LA 3AU7A 4ZRZA 1NUCA 4NP5A 2Z4IA 3DEOA 1FX0A 3TN2A 4FF2A 5J1ZA 5ELBA 2CW0C 4XD7A 4HCSA 4LK1C 5CV8A 1MABA 1EY0A 4KD4A 3VYUA 3KLSX 4A3IB 1PRTB 5JPNC 2L5TA 4A3JB 4TT3A 4ULLA 4YELA 2EYPA 1VJSA 1TIID 4XYQA 1QJOA 1ILQA 2A6HD 4HCEA 3DUZA 5FOBB 4A3EB 1F77A 1IKLA 1PRTF 3A8JE 2Z6BD 3UI2A 2RKSA 3F2UA 4A3GB 4V0BA 5A35A 1KLGD 1E2ZA 1LTBD 2NBFA 3CQZB 4JK1C 2RSOA 1JWMD 2LFNA 4XOPA 1S5DD 3CKIB 3SR1A 1M8AA 2DNCA 5M5YB 1RODA 1CHPD 3PUYA 1ILPA 2L11A 3S16B 5F2DA 1C8CA 2X85A 2DN8A 4XN3A 1CT1D 1E1RA 1NRKA 5I6WA 1QCBD 2WACA 5CV6A 2XZOA 2F1MA 3TDQA 1SNQA 2WV6D 4DXGA 1R9TB 2ZXIA 2EYMA 3MHBA 2F0EA 4GQNA 3T4AC 2L55A 4DFAA 1F2ZA 1PTOD 3NWTA 3VA5A 3WOFA 1VCIA 4KK7A 1E43A 4OHJA 3FPUB 3VR4A 2WIIB 2KQ3A 3GD7A 4XIGS 4ZKBB 4RKBA 4FYDA 1RTNA 4V190 3GTGB 1LT5D 2XOKA 1FD7D 2H1EA 2R61A 5E1FA 1SMYC 2O4XA 1G91A 1FNVA 3NSWA 4DN4M 1TR5A 2D62A 5M5WB 1ZEQX 4KV6A 1JCKB 4NKLA 3LWEA 3GV3A 2K1BA 2MHVA 4OO1G 1VF7A 1B3AA 4RGOS 2DY8A 2PMZB 1I6HB 4XM3A 4IUPA 3A3GA 1Y1WB 1V1PA 3K7AB 1UD4A 4G57A 1FYCA 3HEJA 1Y1VB 5EPLA 5KNLA 1PMRA 2F0HA 2EXZA 1F9SA 5IK2A 4H0LC 5BN4A 2GA4B 3RD4A 3FDTA 2EE1A 3BYTB 2XSCA 4OGQC 3S1MB 5JJZA 5JOBA 1SMYD 4GZYC 1MBYA 4M8AA 3BDLA 4CGYB 1DXMA 2EOTA 4PNYA 3I4MB 3NK9A 1EYCA 4XQQA 3U9OA 3URYA 4HSVA 1LO5D 2V7QA 4QB4A 1STNA 1JR0D 5JPMC 2WSSA 3RZDB 2JA7B 2YYZA 2L0CA 2KHSA 4C2MB 1AZPA 5IGDA 5D3DA 2NTSA 1ET6A 1KAAA 2JJ1A 2D3LA 5EQ0A 2M2LA 4XT1B 2IL8A 5K36H 2EY6A 1CQVA 4FVMA 1S5BD 2DY7A 1SJHD 1HXYD 1JWUD 2X6GA 1BUVT 3GTQB 5JAVA 4ZKCB 2BA0A 4QUCA 1SFOB 1CQFA 4HAEA 3T51B 1WP6A 1R4PB 2D3NA 2JXMB 1IW7C 2JSOA 4ID6A 4K8IA 4KTAA 1XTCD 2B2UA 1TWFB 1SE2A 2AWNA 3A8KE 2E2IB 3ITPA 3CRLC 2B2TA 1BQQT 3MVVA 3I73A 1BOSA 4DF7A 1TVXA 1ENAA 1OO9B 2OT2A 2HDLA 1BCPB 1STEA 3NQTA 3RLFA 4XKWA 1F9RA 2F0KA 2W6IA 4WRDA 4II3A 4C1NK 4EVOA 1HTLD 4G7WA 1E79A 1YNND 3T56B 1OXUA 3DWAA 4RGMA 3I90A 1PTOC 4B3GA 2LY7A 2AWOA 1Q1BA 3NBIA 1SNCA 1GUOA 3BVMA 3KBGA 1PFNA 1SAPA 2QEJC 3V2TA 3BDCA 3OFNA 3DEPA 3MWYW 1J9OA 3E0JA 2G9DA 2MGSA 4IUNA 1WD1A 3SE0A 2O5JC 3E5SA 5D65A 1JWSD 4PMCA 1EFRA 3OMGA 4C1NI 5E3FA 3HS0C 3PUWA 4A93B 3MA2B 2FFKB 1I4HA 2NWGA 1HA6A 2LZJA 1BLIA 3PIP3 5EBDA 3NXWA 3X3NA 1ZKOA 2BDOA 1XX8A 2AUKA 2JJ2A 2Q8RE 4MHEA 4UZUA 2E76C 1FNWA 4K5WA 3HAGA 3AB9A 4R9WA 1TT2A 2B8FA 1KZLA 3C3LA 3K0YA 1E1QA 3GO5A 4IUQA 1G2TA 3HG9A 3NP8A 3ND8A 4KKTA 3MFGA 1SYFA 3I3CA 5LHY1 4IALA 2KEDA 1F2MA 3SXHA 4DK0A 1A2TA 2NUCA 4CBVA 2GJRA 4KJNA 2EJMA 4F8MA 1STAA 1E3ZA 5C5MA 1PZID 1SYCA 1O7ZA 2L12A 1Y8PB 3LWUA 5C3EB 4FF4A 2VXWA 1SNPA 4XT3B 4QIWB 1UEAB 4QUFA 4A3KB 4KKSA 3OE7A 4G7HC 5ELEA 2R6GA 2EVBA 3I8ZA 3L9AX 3MXPA 2Z8LA 1BNZA 4F87A 5CV7A 3LX0A 1BBXC 2LMCB 3QB3A 5ISRA 3M85A 1J8IA 3VR2A 4OO1H 2HLDA 4RCOA 4CJ1B 1A3TA 2WAQB 2WKDA 2R7ZB 1A3UA 1D2BA 4XR6A 1JICA 3D4WA 5JVH3 1FNUA 2K04A 3CHBD 3HOYB 3KK7A 1AEXA 4FNFA 5CYUA 2JDIA 2KVMA 2GK6A 1IW7D 5FLXL 1RJTA 3HKZB 3ZYYX 3S15B 3NBHA 4BWGB 3J81E 3FVQA 5IT9E 1WTPA 1TU2B 1BCPF 1EZ8A 4L63B 4L8JA 5IGCA 3JAML 4RCNA 3Q22A 3S2DB 2I07B 4OL7A 2SOBA 3T13A 1TWHB 1EEFD 1HQRD 1SYEA 4B08A 1MI2A 1EY7A 1STYA 1IHZA 1TS3A 3K59A 1GUWA 1PTOF 4CKCA 2IPKD 3WDNA 2B2YA 1Y8OB 4P22A 4PMBA 3R93A 2X8KA 4IUUA 3OMCA 1SE3A 4O42A 2VNUD 3HOVB 1NR4A 4C3IG 2SNMA 2SNSA 2MJ8A 3W3AA 4ZLTF 3QO2A 3H91A 1DD2A 3SVMA 1Y69U 1K28D 2IX3A 2FHTA 2FMMA 2BOSA 1DJRD 4ABNA 1Y8NB 2QILA 1JQYD 1SYDA 5IGEA 1K8OA 1EIGA 3A55A 1B50A 3J7AV 1I4GA 2A74C 5LL6S 5TSSA 2WPDA 4QMGA 3K58A 1NSNS 2LS01 5FO8B 4G7OC 4HIZA 2PPBC 4KN4C 3NTKA 1RD9D 5CMDA 1SSOA 4FXDA 1BCPC 4CKEA 1EZ6A 2AUJD 3A35A 1WTVA 5KYLA 1V1OA 1V43A 1OXXK 2F0PA 5LL6X 4G6IA 3TBIB 3OSOA 1LTID 1AFPA 1UD8A 1T5EA 1EL0A 2HDMA 4G4KA 2B2TC 2F0DA 3P75A 1IL8A 4ZYSA 2J4XA 2E1BA 4C56C 1WCMB 1L0YB 5IGGA 3RMHA 2ZTNA 2EY2A 3QJYA 5KEEA 2WP8J 1K8MA 5D14A 4J8QA 5M5XB 5AFWA 4O1NA 2BE5C 3N52A 3MTSA 3R2TA 1QWYA 1Q8IA 2C5CA 4CJ2C 1TS5A 2M5SA 1A3VA 2TMPA 1CK1A 1Q1EA 4U673 4A3BB 1KDAA 5J22A 3K5LA 2ZXPA 1HHVA 4XLAA 3OPOA 1EYDA 4OIJA 1VDZA 4CKBA 4XKVA 1H9MA 1ONLA 3C1FA 4Y7NB 1XXGA 2F0VA 3FEWX 4UDUC 1RKNA 3RZOB 1PDQA 3E6ZX 1HVXA 4XLCA 4C3JB 3GQBA 3HZXA 5M9OA 1K83B 3NPPA 2RDFA 4HEDA 1QOHA 4NMZA 1WVLA 2IX0A 4XN0A 4IFDG 2W6JA 2ZXRA 1GJXA 1LACA 4KY6A 3BYYB 3K6OA 1D5XC 3JU4A 3DWQA 2B2UC 3VR5A 2IWHA 4N9PA 3I4LA 3TMEA 3MAQA 3GTPB 4CJ0B 1ZYRC 2IX1A 1HUMA 3D8GA 1COWA 3G6JB 2GK7A 4I7ZC 3NTIA 3J80L 4RFBA 3TSSA 3P7JA 3A56A 1Q90A 3SEBA 3GTOB 4FF3A 2Y0SB 3IFTA 4C3HB 2XWBB 3ZIAA 4RH6A 5CV4A 1BXTA 5C0XH 4AVZA 1XYIA 4XLEA 4H7BA 3KLSA 2F4IA 3DM1A 1B4OA 1E2WA 3FPPA 5EKIA 3GTLB 1TWGB 2WINB 4ZAIA 3OEEA 5A2QE 4RA8A 2JE6I 1W6KA 1UD6A 2XNDA 5E4WC 1YNJD 3SK5A 4BA1I 2NVQB 4JMQA 1EYAA 2AQ3B 4ZUJA 4A3DB 4ASUA 2PW5A 1ML0D 5EJWA 2KECA 1IKMA 1ESRA 4IFDJ 3OHXC 2X69A 4R8IA 1BCPD 1BO0A 2IT1A 4IQZA 3A7AB 4DXFA 2HCIA 1FR3A 2NB0A 1BMFA 3RUZA 3NE5B 1E2VA 2Z1CA 1H9RA 1V0EA 1CZGA 2WJYA 2XVSA 1R4QB 2A5HA 2NYZD 4ZQ3A 2K01A 4ODGA 3GVKA 1B1ZA 2EYFA 1W9XA 3H94A 3M7NA 1TS2A 2R93B 5T1IA 2EY1A 4X3TA 1F9PA 2ICEC 4B9XA 1X3PA 4KMUC 1G6ZA 2NVTB 5DAUA 3TP5A 3GTKB 1HPCA 3GVLA 2KCCA 4EQOA 3X3MA 1PFBA 2XIWA 1CFMA 1FGBD 2RDGA 1E0BA 4K2LA 1Q12A 4LAAA 1PTOB 4BY1B 4K5XA 4DAVA 3KF8A 2BE5D 3IAYA 2X6LA 1UUPA 4J1MA 4RGTA 2MPMA 3PUXA 2IJ0A 2DIEA 2PNRC 2JYOA 3EROA 2OXPA 4X3UA 4Z9CB 1CA5A 2ENBA 5M3MB 1TY0A 2F03A 2QKIC 1KABA 3EJIA 4YXWA 1HRJA 3NWSA 2O2LD 1HZEA 1II3A 2L9HA 1WPCA 5E4XA 3K5OA 1LABA 2F0SA 1EEID 2QDBA 5BN3A 3PUVA 1QG7A 1GUSA 3J81L 2Q8IB 4G7XA 5DM63 2F0QA 4I65A 4PMWA 2VB3X 5C5LA 3TZDA 3H0GB 5FLXE 3EA6A 3FRPB 1Z6HA 3D4DA 3SHLA 4XONA 3V05A 4K14A 4RAUC 2F0IA 1G8ZD 4C3JG 2NVXB 3NTHA 5C0XI 3MXUA 2K05A 2K33A 2XNAC 4KY7A 3L3OC 2E74C 2EYJA 4J6HA 1WTHD 5FKAC 1SEBD 2F3VA 3TP6A 4OO1I 2MUYA 1JORA 2EY5A 3NUCA 4KY5A 1YNJC 2K28A 4XQNA 1NBMA 2QCPX 5EPJA 1PRTD 3ZPNA 2JP1A 2ZXOA 4DK1A 3PUZA 1S5FD 3S1QB 3PO2B 4U68A 1U4PA 4Z1MA 3DMUA 3HGBA 5IT9L 2F0FA 1UD3A 1X32A 2ZZFA 2E2JB 2F0TA 4B3FX 5COYA 1U9RA 2L4NA 1B2TA 3SK8A 1OXSC 5G3LF 2R9VA 4XL9A 1SDFA 4ZK9B 2EJGC 2PZUA 4XOTA 1UNSA 5I9OA 1T5XD 1I4QA 2NTTA 3PMFA 1TS4A 4G7ZC 2XGJA 1H9SA 1XWEA 4DNRB 1LT3D 1H8EA 1DYQA 2F0NA 3LNNA 5HGTA 4KD3A 5I6YA 4WORA 4FXUA 1HCZA 3R2IA 3P20A 2R3ZA 3S1RB 2K03A 5FK9C 3OIPA 2ICIA 4HMJA 1EQVA 2KUMA 1W6JA 2A6ED 3GVJA 2ZXHA 4RKLA 2N88A 2Q8TA 5C44B 1QNUA 1VF5C 1I3QB 2F0LA 1M4VA 5C4XB 5CV5A 4PV1C 3D6CA 3K5MA 1EY6A 2VJIA 1H8HA 3N6RA 4A3MB 2N55A 2B2YC 1HTPA 1BDOA 1SKYB 5JEAH 4OIKA 1I8DA 3BZDB 3J80E 4XTCS 3NQIA 4HN7A 3SK4A 3L7ZC 3FKSA 5EGTA 4XYOA 3ERQA 5IODA 1HA5A 3CP8A 1EY8A 4C3IB 3JAME 2M9VA 4IFDI 2CHBD 1RHPA 3TP8A 3OWEB 3NHHA 2NN6I 4II2A 1TY2A 3D6WA 5DN6A 3U9SA 5T1GA 1U4LA 1B9MA 1S4ZA 4L6TB 3BH4A 2C9OA 5DNFA 4UAIA 2GJPA 1SJED 5HURA 3S9WA 4XMYA 1DOLA 2F0UA 2K6AA 5KGUA 2ZZEA 3D4RA 4TSFA 4HMIA 5IOCA 3QIAA 3GTJB 2K5WA 3T53B 1I4XA 2DNEA 3BG3A 2EPBA 1DCZA 4EGVA 3W2DA 3CU7A 4QF4A 1PXUA 2AQ2B 1PZJD 3GP7A 5JVG3 1WTOA 3TP7A 3CP2A 1LTAD 2CW0D 3FKIB 1B53A 5C3XA 4M1UB 1SNDA 4XQFA 3VYTA 3VA7A 4C3HG 2XN9C 1SBBB 5C6AA 1RCVD 3I72A 4NNJA 1MGSA 3OIQA 1LV9A 1CTMA 1W0KA 1IYVA 2EYOA 5CBAE 3D3RA 1NCVA 5I2YA 3M3YB 2G9HD 2KCNA 2RA4A 1GUGA 4YEJA 1RTOA 2B2WA 3P1HA 3C2PA 1F2LA 1AN8A 2X53S 2O5IC 1V0FA 2E75C 2B8GA 1KLUD 4RGNA 3OWFA 1EQTA 2XRSD 3KUPA 4JBWA 5I4DA 4H13C 5KRUA 3M4OB 4DGZA 1I18A 5BN5A 2JA8B 2JA6B 4XLHA 1ICWA 2F3WA 2J0TD 1TWCB 5EKKA 2WJVA 1EFID 4K8JA 1PZKD 2A68D 1E3XA 1EWHA 3H09A 2WKCA 2J7ZA 4X3KA 3K57A 1UD2A 5C3WA 5JEAG 2A69C 5DM73 3O13A 3KBXA 4AYBB 5CBEE 4WJWA 3MEHA 3T16A 1GHKA 3SDZA 3J7AF 2EDGA 1UAPA 1HFGA 1GHJA 5KNDA 3Q23A 1DOMA 3IFDA 3J7YW 1ET9A 2X6WA 3K5NA 4F88A 4RWSC 1GXDC 1TQOA 1SYBA 5KYIA 1WD0A 3VR6A 2A73B 4S3SA 3HOWB 3DXJC 3EQLC 1WTRA 1F9QA 4XORA 5C0XG 2HCCA 1C4QA 1JOQA 2VJJA 1ZYRD 3HOUB 5K36G 1ENFA 1PFMA 5HKKA 1O7YA 1ESFA 1AP0A 3S17B 4DNTB 1UD5A 5J39A 3PIO3 4BY7B 2KOLA 3A54A 5EBCA 1PYWD 2A6HC 5CC4A 2Z4HA 5NUCA 4CHTB 3D31A 3DHQA 1QE6A 2VB2X 2MP1A 4PQXA 1ENCA 3I70A 2GJKA 4BA2I 3IL8A 4KI0A 1RDPD 4ZUIA 2IW3A 3WOEA 1VMPA 2KVOA 4E0FA 3HP3A 1STBA 1WTXA 4Q0FA 1TWAB 1IYUA 1CA6A 4B9WA 1CZWA 1KTKA 2JIZA 3VYSA 4TQUS 4DAPA 1MD2D 1CM9A 1Z47A 4HR7B 4RHRA 1EIHA 2ZZGA 3MXGA 1B44D 1U4RA 4K5VA 5KNCA 2KJXA 1EU3A 2FINB 1D1IA 1HUNA 2K32A 4KKUA 2D5DA 2K7VA 2RBMA 1MSGA 1O80A 2B39A 4HSPA 2WZPP 3A3BA 2F0JA 5CDFA 3CESA 1H9JA 1HQMC 4HTHA 1JOKA 3PV0A 5DEHA 1CI3M 1H9KA 2NN6G 2NZ1D 4DA2A 2K5DA 3IKJA 2B63B 3HOZB 4MIUA 5CV9A 2RSNA 4FF1A 1AZQA 2L1BA 4P2CB 2XZPA 4XNFA 3QOLA 3M4YA 1D6EC 4TSSA 5JEAJ 1KDBA 2PO4A 1SNOA 1CHQD 1LLRD 3H3VC 2X6XA 3HRZC 2SDFA 1SYGA 3BVZA 5CORA 2EZVA 3DWPA 3EFXD 3QG1A 1EY5A 1JE4A 3PO3B 2XWJB 3HOXB 1PRTC 3H6MA 1EY9A 3KLRA 1YNNC 4A3FB 2CVRA 1DM0B 3ONAB 4IUTA 1C48A 4NDXA 2TSSA 2F0GA 1I4PA 4FXKC 1O7LA 1OXVA 3OW7A 4YIJA 2V4DA 4NW2A 4IN3A 3DDYA 4KN7C 2XRQD 3V96A 4BBRB 4Q5VA 4FO2A 2ZZQA 2PW7A 4XDXA 1JC7A 2NVYB 5C4ZA 5IGFA 2QE7A 5G3LD 1KNEA 2NN6H 3QWNA 4XLFA 4R8NA 2B2VC 3MZ5A 4ME5A 2KA7A 2BDNA 5ELCA 1W0JA 5CGKA 3I4NB 2A6EC 5EKLA 2WB1B 2PQEA 2RQXA 2XZLA 3VR3A 3Q6SA 3ND9A 2FJ2A 2FMCA 2X6YA 4XXEA 2D9UA 2ID0A 1I4RA 1DZ1A 1B9NA 4H44C 2PYKA 1H9SB 4LJZC 3Q24A 4QCLA 2KEEA 2B2WC 2K5QA 5I2XA 2RVLA 2YU9B 2V31A 2VUMB 3AMUA 1QB5D 5FL7A 5C4JB 2OEOA 4EQPA 2QF7A 5K5PA 1QILA 4IURA 4IZ8A 3WQZA 1HFNA 4WFN3 4BS9A 1GUNA 1OXTA 1VMCA 1SXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUJ D;  4OO1 G;  1VF7 A;  1IW7 C;  1DCZ A;  3BDO A;  2A69 C;  3LNN A;  3H94 A;  3M7N A;  1QJO A;  2A6H D;  3VR5 A;  4TQU S;  3I4L A;  1HCZ A;  1O7L A;  1V43 A;  1OXV A;  1ZYR C;  1OXX K;  3OW7 A;  3P20 A;  3ND8 A;  3A8K E;  5KNB A;  4HR7 B;  4KKT A;  2V4D A;  3A8J E;  3CRL C;  4KN7 C;  3CRK C;  2A6E D;  4KMU C;  3MFY A;  1FYC A;  1GUT A;  4I7Z C;  3MXU A;  5KNC A;  3I73 A;  4DK0 A;  4RCN A;  1GJX A;  2A69 D;  5A35 A;  1T5E A;  1HPC A;  1GHK A;  3SDZ A;  1E2Z A;  1PMR A;  2KCC A;  3WDN A;  1Q90 A;  1G29 1;  2A68 C;  2EDG A;  1Y8O B;  2K33 A;  2EJM A;  2K32 A;  4JK1 C;  4KKU A;  2D5D A;  2K7V A;  3RLF A;  1GHJ A;  5KND A;  2EJF C;  2E74 C;  3VA7 A;  1CFM A;  1VF5 C;  3IFT A;  4H0L C;  5BN4 A;  1Y8P B;  3LWU A;  1Q12 A;  1H9J A;  1HQM C;  2DNC A;  3FMC A;  3PV0 A;  2ZT9 C;  4PV1 C;  3T56 B;  1OXU A;  2NN6 H;  3I72 A;  3PUY A;  4OGQ C;  5C0X H;  1CTM A;  1CI3 M;  1H9K A;  1IYV A;  2NN6 G;  2BE5 D;  3W3A A;  4KKS A;  3OOC A;  2DN8 A;  3VR6 A;  4GZY C;  1YNJ C;  2KA7 A;  3TZU A;  3IKJ A;  3DXJ C;  4G7H C;  3QJY A;  3EQL C;  2R6G A;  2EVB A;  3N6R A;  1E2W A;  3FPP A;  1HTP A;  1K8M A;  2AWO A;  3PUX A;  1BDO A;  1Q1B A;  4TKO B;  5C0X G;  5JEA H;  1GUO A;  1DD2 A;  2F1M A;  1DXM A;  2PNR C;  2A6E C;  1Y69 U;  2PCF B;  4XTC S;  1GUG A;  2JE6 I;  3VR3 A;  5K36 G;  3L7Z C;  2LMC B;  4DK1 A;  3ND9 A;  3PUZ A;  2BE5 C;  2JEA I;  3M4Y A;  2BA1 A;  3M85 A;  4BA1 I;  3HGB A;  2D2C C;  2O5I C;  1I6V C;  4DNT B;  1Y8N B;  3SE0 A;  2O5J C;  2E75 C;  2B8G A;  1K8O A;  2YYZ A;  3A8I E;  1Q1E A;  1B9N A;  3VR2 A;  4H44 C;  4OO1 H;  1H9S B;  4LJZ C;  1VCI A;  1Z7T A;  3OPO A;  4JBW A;  1VDZ A;  2A6H C;  3PUW A;  4H13 C;  3VR4 A;  4IFD H;  2NN6 I;  1A6X A;  1H9M A;  1ONL A;  3A7L A;  3GD7 A;  5BN5 A;  3U9S A;  1OXS C;  3D31 A;  4XIG S;  1B9M A;  1LAB A;  1V8Q A;  3QG1 A;  1ZKO A;  2BDO A;  5BN3 A;  2IT1 A;  2CW0 C;  4IQZ A;  5K36 H;  3PUV A;  3A7A B;  2AUK A;  4LK1 C;  2EJG C;  1IW7 D;  1FR3 A;  1GUS A;  2Q8I B;  4KI0 A;  4BA2 I;  3NE5 B;  1SMY C;  2A68 D;  1EWH A;  4G7O C;  1E2V A;  2JEB I;  2QF7 A;  2E76 C;  1H9R A;  3GQB A;  2PPB C;  3KLR A;  4KN4 C;  1YNN C;  3AB9 A;  3D4R A;  1O78 A;  3QIA A;  2D62 A;  4G7Z C;  1GUN A;  1OXT A;  2BA0 A;  1TKW B;  2L5T A;  1TU2 B;  1H9S A;  3T53 B;  5JEA G;  2B8F A;  4L8J A;  3T51 B;  4DNR B;  4KHZ A;  2DNE A;  1IYU A;  1Z6H A;  3BG3 A;  4IFD G;  1LAC A;  2JXM B; 
#chains in the Genus database with same CATH topology
 1RL2 A;  1UWV A;  4DR3 Q;  4GKJ L;  3OP1 A;  3BVG A;  4LF5 L;  1Q81 C;  4BPR A;  2F43 A;  3G4S A;  1PKV A;  1BKB A;  4QGU A;  4J15 A;  3BC9 A;  4HJ5 A;  3S1N B;  3PGZ A;  2C35 B;  4BBS B;  5KNB A;  4FXG C;  4JI5 Q;  1EU4 A;  1LT4 D;  3G7L A;  3MXN B;  3S1Q H;  4BBS H;  4RDJ A;  3GV6 A;  1I50 B;  3MFY A;  1BPL A;  2ZTG A;  4DU9 A;  2PZT A;  2F4N A;  4GN3 B;  2BVN A;  1ZXT A;  1PHJ A;  4B3S Q;  1OTC A;  3MC0 B;  1YIT B;  1F2Y A;  2N8N A;  4K2K A;  5C0X J;  2R92 B;  1STG A;  5IGB A;  2AHO B;  1AIP A;  5CR3 A;  1A2U A;  1WOO A;  1BF4 A;  1ZUN B;  3S2H B;  1RF2 D;  2XNC A;  1P8L A;  3ULP A;  1ELO A;  3FJO A;  4NPS A;  4LF8 Q;  3W2G A;  1GOZ A;  1X56 A;  4DR7 Q;  1K83 H;  3FMC A;  5FO1 A;  1YLO A;  1J9Z A;  1TWA H;  1K3R A;  2ZT9 C;  4N9T A;  3VYR A;  4EQN A;  3KFU A;  3GTM B;  2RDH A;  3CC7 A;  4HIK A;  3OOC A;  1G2S A;  4H02 A;  1W34 A;  3TZU A;  2VUM H;  3AVT A;  4EH1 A;  4FP5 D;  4RHS A;  3IRB A;  4XQJ A;  1D5Z C;  1GVH A;  1XTD A;  2BCO A;  2F0M A;  2HQE A;  1STH A;  1QX4 A;  1SRO A;  4JC0 A;  4TKO B;  1D1K A;  1KDC A;  4NXM Q;  4KJO A;  4DAY A;  2EYL A;  5I9P A;  2KBN A;  4OXP A;  4IUV A;  2CQA A;  3KL9 A;  4JI7 Q;  1NR2 A;  2LKV A;  4DQL A;  4NCN A;  3OAA A;  2V7T A;  4AYB E;  2JA5 B;  2JEA I;  2BA1 A;  3MXN A;  3SK6 A;  5IIF A;  3UDI A;  1OB0 A;  2D2C C;  3JQR A;  1A15 A;  2QMU A;  1I6V C;  4N3N A;  3K80 C;  3Q0A A;  1CNF A;  2CK3 A;  1DOK A;  1EOT A;  3U4Z A;  1SNM A;  3KEW A;  5A2Q L;  1TXY A;  1Z7T A;  1RQR A;  3M7G A;  1XMO Q;  4IFD H;  3CCE A;  1NE3 A;  3I91 A;  3QR8 A;  3ZZT A;  1P16 A;  1V1P B;  3CMM A;  4ROX A;  4DR5 Q;  1KD1 D;  2E2D C;  3S14 B;  4K6D A;  3WY9 A;  4JV5 L;  3LGJ A;  2CBX A;  1V8Q A;  3CCE B;  1VHO A;  3OEH A;  3BCD A;  1X3Q A;  5C4H A;  4K6L A;  1GVP A;  1PLF A;  2B29 A;  4MN3 A;  3A8I A;  4TMV A;  2I0Q A;  4F7X A;  1NAP A;  1DON A;  2JEB I;  4AC9 A;  2B2V A;  2YV5 A;  3QFS A;  3AVV A;  5EPK A;  1LTG D;  2AKW B;  5D3I B;  1YJN A;  2I46 A;  1IYJ B;  1O7I A;  2R93 G;  2G5D A;  1O78 A;  4P12 A;  1L1O C;  1TKW B;  5FO7 B;  2E2H H;  3PIP A;  5FO9 B;  4KHZ A;  2UXD L;  3R3O A;  1LTT D;  3KJP A;  2F0O A;  3R8B A;  1FGU A;  3BDO A;  5BSX A;  2F4V Q;  4WZL A;  5EMN A;  3EVQ A;  3GTG H;  2HUG A;  1LT6 D;  1A8V A;  2OF1 A;  4UP9 A;  2EYH A;  2SEB D;  1J5E L;  4DV3 L;  2PZW A;  3QOJ A;  1U4M A;  5M3M H;  3VMF A;  2WFW A;  1M90 C;  4X3S A;  4LMQ D;  3CRK C;  4TRD A;  3C1E A;  1AW7 A;  4LF5 Q;  1GUT A;  5M3F B;  1JOO A;  1QNK A;  2A69 D;  1KMH A;  5ELD A;  1YNX A;  3FHW A;  3I7F A;  1QFY A;  1G29 1;  2A68 C;  2KCM A;  2WB1 G;  3HOY H;  4N8F A;  4GN5 A;  1WYD A;  4AQY Q;  1WTW A;  1WOP A;  2EJF C;  1HR0 Q;  1WTQ A;  3C46 A;  3G48 A;  4JI2 L;  3BS1 A;  4R4T A;  1LTR D;  3BY2 A;  1PTO H;  3G05 A;  1OHH A;  1S5C D;  3PIO A;  1LTS D;  1EWC A;  1MSH A;  1WDT A;  4P73 A;  4YAO A;  4DR7 L;  3UDG A;  1BR9 A;  4X0C A;  2N78 A;  4A3I G;  1TTT A;  1QUQ B;  1AMO A;  3CC2 A;  2AQ1 B;  1K0R A;  3S16 H;  3R6K A;  2H4O A;  1D5M C;  2B7C A;  2OTJ B;  1SE4 A;  1VQB A;  4X66 Q;  1R5B A;  2PCF B;  3RLN A;  4P3Y A;  1JB3 A;  2F0W A;  3PO2 G;  4P26 A;  1CKM A;  3W1B A;  1IL2 A;  4P3I A;  1WOR A;  1VLY A;  2UUA L;  3H15 A;  3I56 B;  5KIX A;  1KNA A;  3HOV G;  1L0X B;  1K3B C;  1EY4 A;  3A8I E;  1WU8 A;  2VBS A;  1YVC A;  4E6I A;  2V7X A;  2CW5 A;  3BCF A;  2M00 A;  5ELF A;  2E2H B;  1GAQ A;  1YHQ A;  4KHV A;  3W5V A;  4ILW A;  1PH4 A;  3A7L A;  1A6X A;  1S5E D;  3CPW A;  3W1G A;  1Q3L A;  3AU7 A;  1G7R A;  4ZRZ A;  1QZG A;  3I55 B;  1NUC A;  3TS0 A;  3ERS X;  4NP5 A;  2Z4I A;  3DEO A;  1FX0 A;  3TN2 A;  4FF2 A;  5J1Z A;  3G71 B;  5ELB A;  5C44 H;  2CW0 C;  3CC4 A;  2BF4 A;  4XD7 A;  4HCS A;  4LK1 C;  1MAB A;  5CV8 A;  3I4M G;  1EY0 A;  4KD4 A;  3CCJ B;  3KLS X;  3VYU A;  1KQS A;  1HH2 P;  4A3I B;  1HZC A;  3PUM A;  1PRT B;  5JPN C;  2L5T A;  2K5N A;  4A3J B;  4TT3 A;  4ULL A;  4YEL A;  3K7A H;  2EYP A;  2WAQ E;  1VJS A;  1HA3 A;  3I4N H;  1TII D;  2QTL A;  1FNC A;  4XYQ A;  1I6H H;  4JYA Q;  1QJO A;  1ILQ A;  2A6H D;  4J0Q A;  4HCE A;  4A3E G;  3DUZ A;  1M1K C;  5FOB B;  3RN2 A;  4A3E B;  1F77 A;  4YAW A;  1IKL A;  1R5O A;  1DGS A;  5TRD A;  1PRT F;  2GQF A;  3A8J E;  1IJF A;  1UE5 A;  1GJR A;  2Z6B D;  2N49 A;  3UI2 A;  1YHQ B;  2RKS A;  3F2U A;  4A3G B;  3EBE A;  4V0B A;  5A35 A;  2YWG A;  1KLG D;  5AJ3 Q;  1E2Z A;  1LTB D;  2BV3 A;  4N3G A;  2NBF A;  3CQZ B;  4JK1 C;  4LF7 L;  2RSO A;  4LWC A;  1JWM D;  4JI8 L;  2LFN A;  4OEL B;  1Y1W G;  1SE8 A;  4XOP A;  2E5L Q;  2JA8 H;  2A8V A;  1S5D D;  3CKI B;  4QIW E;  3SR1 A;  1M8A A;  4A3B G;  4MYU A;  3F8T A;  2OBT A;  2DNC A;  4ZCM A;  2CRV A;  4ZCI A;  5M5Y B;  1ROD A;  1BQE A;  1CHP D;  4DV1 Q;  3PUY A;  5L46 A;  4KHP L;  4DR4 L;  2L11 A;  3S16 B;  1ILP A;  4C3H H;  5F2D A;  1C8C A;  2X85 A;  2N3S A;  2DN8 A;  4XN3 A;  1CT1 D;  1E1R A;  1NRK A;  2V1C C;  1VQH A;  5I6W A;  3UDX A;  1QCB D;  2WAC A;  5CV6 A;  2XZO A;  1QG0 A;  2F1M A;  1HNX L;  3TDQ A;  1SNQ A;  2WV6 D;  1T6X A;  3D0F A;  4DXG A;  1R9T B;  1CUK A;  2ZXI A;  1K73 D;  2EYM A;  3MHB A;  1YI2 A;  2F0E A;  4GQN A;  3T4A C;  1N36 L;  1QGA A;  2RCN A;  1KL9 A;  5M3M G;  3CF5 A;  2L55 A;  1F2Z A;  4DFA A;  1PTO D;  3NWT A;  4A3K G;  2ZJQ A;  3VA5 A;  2VNK A;  3WOF A;  1VCI A;  4KK7 A;  1E43 A;  4OHJ A;  3FPU B;  3VR4 A;  2NVT H;  2WII B;  2KQ3 A;  1QVC A;  3K7U C;  3GSI A;  4LBV A;  3GD7 A;  2Z6K A;  4XIG S;  4ZKB B;  3STB D;  4RKB A;  4FYD A;  3ER0 A;  5HXB A;  5B6I A;  4WZE A;  1RTN A;  4V19 0;  3GTG B;  1LT5 D;  5IYD G;  2XOK A;  5J35 A;  1FD7 D;  2H1E A;  2R61 A;  5E1F A;  3I55 A;  4B3S L;  1SMY C;  2O4X A;  4A3M H;  1G91 A;  2VBT A;  1FNV A;  3NSW A;  1EFU A;  4NB3 A;  4DN4 M;  2UUB Q;  1DDG A;  1ZM9 A;  1TR5 A;  4Y7N H;  2D62 A;  1J6Q A;  5M5W B;  1ZEQ X;  4KV6 A;  1JCK B;  4A76 A;  4NKL A;  4TMT A;  3LWE A;  4OOX A;  3GV3 A;  2K1B A;  2MHV A;  1W35 A;  3ULL A;  4OO1 G;  3E0E A;  1VF7 A;  1B3A A;  4RGO S;  5TY0 A;  3WYA A;  1PH9 A;  2DY8 A;  4A3F G;  2PMZ B;  1I6H B;  4XM3 A;  3A3G A;  4IUP A;  2DEU A;  3CCS A;  4ZGQ B;  1Y1W B;  2QN6 A;  3QFR A;  1V1P A;  3K7A B;  1UD4 A;  3HOV H;  4G57 A;  3PO3 G;  1U2R A;  1FYC A;  3HEJ A;  4LNQ A;  1Y1V B;  5EPL A;  4UP8 A;  5KNL A;  1PMR A;  1MJE A;  1T6Z A;  2F0H A;  4DR1 L;  1JJ2 B;  2EXZ A;  3JAM i;  1F9S A;  3QSY A;  5IY0 A;  3MMP A;  2C5H A;  1PYS B;  5IK2 A;  2L15 A;  4H0L C;  5BN4 A;  2GA4 B;  3RD4 A;  3FDT A;  1A8P A;  2EE1 A;  4DV7 Q;  2IHE A;  3BYT B;  2K4K A;  2XSC A;  4OGQ C;  3S1M B;  3CCR A;  4IPD A;  3WBK A;  5JJZ A;  1X9N A;  5JOB A;  1SMY D;  2OBS A;  4JV5 Q;  5LMU L;  1VHE A;  4GZY C;  3I4O A;  1MBY A;  1D2E A;  5C3E G;  1TWC H;  4B3R Q;  1EXM A;  4M8A A;  3VO2 A;  3OZU A;  3BDL A;  1N32 Q;  2VQE L;  4CGY B;  3OJW A;  1DXM A;  2EOT A;  4PNY A;  3I4M B;  3AVW A;  5IP7 H;  3NK9 A;  1EUJ A;  4A3L H;  4QJF A;  1EYC A;  1BVS A;  4XQQ A;  4HSV A;  3U9O A;  3URY A;  1B2R A;  1LO5 D;  1WJJ A;  2V7Q A;  4QB4 A;  1STN A;  1JR0 D;  5JPM C;  4DV2 Q;  2WSS A;  1HJP A;  3RZD B;  2JA7 B;  2YYZ A;  2L0C A;  3BZK A;  2KHS A;  4JI1 L;  5HGQ A;  4C2M B;  1AZP A;  4DV3 Q;  5IYW A;  2NZO A;  3KF6 A;  1CNE A;  1K28 A;  5IGD A;  1NJI C;  2D74 A;  4ZV4 A;  5D3D A;  2NTS A;  5IP9 H;  1QGY A;  1IXR A;  1ET6 A;  1KAA A;  3KLW A;  4GLV B;  2JJ1 A;  4YY3 L;  3MHP A;  2D3L A;  1V1Q A;  5EQ0 A;  2M2L A;  1E1O A;  4XT1 B;  2VNI A;  2IL8 A;  5K36 H;  2EY6 A;  1CQV A;  4FVM A;  1S5B D;  5IE8 A;  1MIU A;  2DY7 A;  3CPX A;  1SJH D;  2BH2 A;  1HXY D;  3PEN A;  4FN5 A;  1G7S A;  1JWU D;  5ELO A;  2X6G A;  4WZT A;  1BUV T;  3GTQ B;  4HE5 A;  4ZKC B;  2BA0 A;  5JAV A;  1ZM4 A;  4QUC A;  1SFO B;  1K8G A;  3CMA B;  1CQF A;  5TR9 A;  4HAE A;  3T51 B;  3RNU A;  1WP6 A;  1R4P B;  4WQM A;  2D3N A;  4C3J H;  2JXM B;  4P6V F;  2UU9 L;  4OWT B;  1IW7 C;  3AVX A;  2JSO A;  4ID6 A;  4K8I A;  4KTA A;  3CW2 C;  1XTC D;  1E64 A;  1XPR A;  4A3K H;  2B2U A;  1DAR A;  1VQN B;  1SE2 A;  1TWF B;  2AWN A;  3OZV A;  3A8K E;  2E2I B;  4CQJ A;  4B3M L;  3ITP A;  4OX9 L;  2CKZ B;  4X7E A;  3CRL C;  1K8A D;  2PMD A;  2E2I H;  1VQA A;  2B2T A;  3HKZ E;  5FJ8 H;  4A3G H;  1BJK A;  1BQQ T;  3MVV A;  3BJU A;  1BOS A;  3I73 A;  4DF7 A;  5GV7 A;  2FX3 A;  1ENA A;  1TVX A;  4YAF A;  1OO9 B;  4G1B A;  2OT2 A;  2DGY A;  3CC7 B;  2HDL A;  2DJG C;  1BCP B;  1STE A;  3NQT A;  3RLF A;  4XKW A;  4RD0 A;  3L2P A;  5F4M A;  1F9R A;  2F0K A;  3HKS A;  2W6I A;  1W87 A;  2DET A;  3CC4 B;  4WRD A;  4X65 L;  4JI6 Q;  4II3 A;  2CND A;  1SLJ A;  4YHH L;  1X55 A;  4C1N K;  1HTL D;  4G7W A;  2ZTE A;  4PZ7 A;  2MQH A;  4EVO A;  2AHO A;  1E79 A;  1YNN D;  3T56 B;  1OXU A;  3KOJ A;  3DWA A;  4RGM A;  4PC2 A;  3I90 A;  1IBK Q;  2V7V A;  5LMZ A;  3H0G H;  4MYT A;  1PTO C;  4B3G A;  2LY7 A;  1BX0 A;  1H42 A;  3JQP A;  3W5H A;  3D26 A;  1AH9 A;  3U50 C;  2AWO A;  4Z4Z A;  1Q1B A;  3NBI A;  3ASQ A;  1SNC A;  1GUO A;  2PLF A;  2RC6 A;  3BVM A;  3KBG A;  4A93 G;  4Y9U A;  4RD4 A;  1PFN A;  3NEL A;  2ZBU A;  1SAP A;  2QEJ C;  4RMF A;  3V2T A;  3BDC A;  3OFN A;  4P6Y A;  5IYC G;  1TWH H;  3M9B A;  1ZM3 A;  3DEP A;  2ZJP A;  3E0J A;  1J9O A;  3MWY W;  2G9D A;  2JA7 H;  3C2Q A;  1UE1 A;  2MGS A;  4IUN A;  1WD1 A;  3SE0 A;  1XNR L;  3E5S A;  4JI3 Q;  2O5J C;  5D65 A;  1JWS D;  1QUQ A;  4PMC A;  1EFR A;  3OMG A;  4C1N I;  5E3F A;  4DV6 L;  4P2N A;  3HS0 C;  2PNH A;  1W3S A;  3OYY A;  2KHJ A;  3PUW A;  1VS0 A;  4A93 B;  3MA2 B;  1VQP A;  2FFK B;  3A1P A;  1I4H A;  2NWG A;  3DLL A;  1VQ7 A;  1HA6 A;  2LZJ A;  1BLI A;  3S15 H;  3PIP 3;  5EBD A;  4GKK Q;  3LQ6 A;  3NXW A;  1YHB A;  3X3N A;  5LMN W;  2H5X A;  1ZKO A;  2BDO A;  1VQD A;  1XX8 A;  2AUK A;  4WJ3 M;  3CD6 B;  4DUY L;  1AE2 A;  2JJ2 A;  2Q8R E;  1WOS A;  4MHE A;  4ZGN B;  4UZU A;  2E76 C;  1JA1 A;  1FNW A;  4K5W A;  3HAG A;  3AB9 A;  2HHH Q;  2YWH A;  4R9W A;  1KK2 A;  1I50 H;  2VS1 A;  4GNX A;  4LC0 A;  1TT2 A;  2Z6B A;  2B8F A;  1KZL A;  2I5H A;  3C3L A;  3K0Y A;  1E1Q A;  1WI5 A;  3M3Y H;  3GTP H;  3GO5 A;  1QUF A;  4IUQ A;  1G2T A;  2MO0 A;  3HG9 A;  4DUZ Q;  2Y0S G;  4EQ5 A;  3NP8 A;  3ND8 A;  1K0S A;  2K5V A;  4KKT A;  3MFG A;  1SYF A;  3I3C A;  5LHY 1;  4IAL A;  3J7Z C;  2KED A;  1FL0 A;  1F2M A;  3SXH A;  2BM1 A;  4DK0 A;  4OON A;  5J3O A;  1A2T A;  1BBU A;  4IPH A;  3LQE A;  2NUC A;  4CBV A;  1D8T A;  2GJR A;  3E20 A;  2ES2 A;  2C77 A;  4KJN A;  2EJM A;  3V76 A;  4F8M A;  4ALP A;  1STA A;  1E3Z A;  5C5M A;  4LW1 A;  4BBS G;  1PZI D;  1C9O A;  3HOW H;  2I1L A;  1HNZ Q;  2VY3 A;  1SYC A;  1O7Z A;  2L12 A;  1Y8P B;  3LWU A;  1VQ6 B;  5C3E B;  4FF4 A;  4RD2 A;  2VXW A;  1SNP A;  4XT3 B;  4QIW B;  4QL5 A;  1UEA B;  4QUF A;  4A3K B;  4KKS A;  4JOI A;  3OE7 A;  4X64 L;  1E1T A;  4G7H C;  5ELE A;  2R6G A;  1W2B A;  2EVB A;  3OW2 B;  5C44 G;  3I8Z A;  3L9A X;  2I5L X;  5HZA A;  1Q81 D;  3MXP A;  2HT1 A;  2Z8L A;  1BNZ A;  4F87 A;  2RHS B;  1OGJ A;  2F3I A;  2D0P A;  3RY8 A;  2QDX A;  3KF6 B;  3LX0 A;  5CV7 A;  1BBX C;  1T9H A;  3GTQ H;  1JMC A;  2BN4 A;  2LMC B;  2BM0 A;  2JA7 G;  3QB3 A;  5ISR A;  3M85 A;  3F2D A;  4DQK A;  3UE0 A;  1R5N A;  3CRZ A;  1J8I A;  4APV A;  4JI0 L;  2DOG A;  4YWM A;  2ZTC A;  3VR2 A;  2XEX A;  4OO1 H;  2HLD A;  4GNX B;  4RCO A;  4CJ1 B;  1A3T A;  2WAQ B;  2WKD A;  3CCQ A;  2R7Z B;  1A3U A;  1Y0Y A;  4XR6 A;  1D2B A;  2NVQ H;  2JA9 A;  1JIC A;  4BY7 G;  1YEZ A;  2E8G A;  3D4W A;  1B23 P;  4JI3 L;  5JVH 3;  1FNU A;  1FVI A;  2K04 A;  3CD6 A;  1BX1 A;  5DSZ A;  3CHB D;  3FKI G;  4C2M H;  1XJV A;  3HOY B;  3ZZ0 A;  3KK7 A;  1AEX A;  4FNF A;  5CYU A;  1YBY A;  2JDI A;  3CCL B;  3WNB A;  2KVM A;  2GK6 A;  2OK7 A;  1IW7 D;  3KF8 B;  5FLX L;  5M3F H;  2ASB A;  3B82 A;  4OOV A;  3AFP A;  5C4X G;  1XNQ L;  1RJT A;  3HKZ B;  3ZYY X;  3S15 B;  3NBH A;  2WYR A;  4M4S A;  4POG A;  4BWG B;  3J81 E;  1KRH A;  3FVQ A;  5IT9 E;  1TU2 B;  1WTP A;  1QVG A;  1BCP F;  1EZ8 A;  1FND A;  2ZL6 A;  4L8J A;  4L63 B;  2B3G A;  5IGC A;  5IYB G;  4LFB Q;  3JAM L;  4RCN A;  1X65 A;  3Q22 A;  3S2D B;  1NMG A;  1L1O B;  3QFC A;  2I07 B;  2SOB A;  4OL7 A;  3T13 A;  1TWH B;  3NEM A;  2R6H A;  1EEF D;  1HQR D;  2HD3 A;  1SYE A;  4R4C A;  4B08 A;  1MI2 A;  2Z0S A;  2UXD Q;  3F2B A;  1EY7 A;  1STY A;  1IHZ A;  1TS3 A;  3K59 A;  1YJW A;  1GUW A;  1UEB A;  1PTO F;  4CKC A;  2F1L A;  4YAL A;  3AVU A;  2R7Z H;  5JBQ A;  2IPK D;  1EFC A;  1B8A A;  3K81 C;  4N8X 1;  5L37 A;  2UUC L;  3WDN A;  1EFT A;  2B2Y A;  1Y8O B;  4A4I A;  4P22 A;  3Q3A A;  1D7Q A;  1ICF B;  1IJE A;  5KSW B;  2RCF A;  4PMB A;  3R93 A;  2X8K A;  4IUU A;  4A3J H;  3OMC A;  4JI7 L;  4AYB G;  4NXN L;  1HZ9 A;  1EP3 B;  2NV4 A;  1SE3 A;  4O42 A;  2VNU D;  4PAA A;  3HOV B;  1NR4 A;  4C3I G;  1NTG A;  2SNM A;  2ZTD A;  2K5H A;  2SNS A;  3S1R H;  1FJG Q;  5JJI A;  2MJ8 A;  4B3X A;  2CH4 A;  3W3A A;  4ZLT F;  1GO2 A;  1HNZ L;  1EP2 B;  3QO2 A;  3A5U A;  2WAQ G;  3H91 A;  4LUZ A;  4I7A A;  5IWA Q;  1DD2 A;  4U9U A;  1PH5 A;  3RR5 A;  3SVM A;  1Y69 U;  2YU9 H;  1K28 D;  4A3M G;  4A3C H;  4TN1 A;  1GD7 A;  2IX3 A;  2DCU A;  3Q6Q A;  1YX2 A;  2FHT A;  2FMM A;  2K14 A;  1YJ9 A;  2OWO A;  2BOS A;  4X7C A;  3SGI A;  1DJR D;  2JA6 G;  3PUN A;  1TWF H;  4ABN A;  1Y8N B;  2QIL A;  1JQY D;  1SYD A;  5IGE A;  1NY4 A;  1K8O A;  1EIG A;  3A55 A;  1CQX A;  1S40 A;  1B50 A;  1VQ8 B;  3J7A V;  1EYG A;  3CCV B;  1I4G A;  3G6E B;  2A74 C;  5LL6 S;  5TSS A;  2WPD A;  3U6K A;  2A19 A;  4QMG A;  1GM5 A;  1I7P A;  3K58 A;  5M5X H;  1NSN S;  2LS0 1;  5M3F G;  3ZZU A;  3PSI A;  2C78 A;  3SLD A;  4LUV A;  5FO8 B;  4G7O C;  4PC7 A;  4HIZ A;  2PPB C;  2WB1 E;  4R4Q A;  1T6Y A;  4BY1 H;  2BSA A;  4KN4 C;  3NTK A;  3J80 i;  2DER A;  1RD9 D;  5CMD A;  4IO9 A;  1SSO A;  4FXD A;  3BNW A;  1OGI A;  1Q9S A;  5GAG C;  2P3M A;  1R9T H;  1BCP C;  2EIF A;  4CKE A;  1PYB A;  2UXC Q;  1EZ6 A;  2AUJ D;  3RZD H;  3H3V I;  3A35 A;  2CC2 A;  2QW7 A;  2YTV A;  1WTV A;  3WXM A;  2R7D A;  5KYL A;  2Q2H A;  1V1O A;  1V43 A;  5BSY A;  3MEF A;  1OXX K;  4B4D A;  3AVY A;  1Q8K A;  2F0P A;  3T1H Q;  5LL6 X;  3ZBU A;  4G6I A;  1S4M A;  3OSO A;  3TBI B;  3JC6 6;  2LXK A;  1KRS A;  1LTI D;  5IP7 G;  4A93 H;  4DR6 Q;  2PE3 A;  5C4J H;  4BBR H;  1AFP A;  1SRU A;  1UD8 A;  1T5E A;  3K0X A;  1EL0 A;  2HDM A;  4G4K A;  3HFZ B;  2FVG A;  2B2T C;  2F0D A;  2GN5 A;  1JJG A;  2LSS A;  1HNX Q;  3P75 A;  5ELN A;  1SM4 A;  4ACA A;  1IL8 A;  4ZYS A;  3M4P A;  1LUZ A;  2J4X A;  1N0V C;  2E1B A;  3LO8 A;  1EOV A;  2GPJ A;  4C56 C;  4HJA A;  1WCM B;  1L0Y B;  4RLZ A;  5IGG A;  3RMH A;  4R4O A;  4YAU A;  2ZTN A;  2EY2 A;  3QJY A;  5KEE A;  2NZH A;  2WP8 J;  1K8M A;  5D14 A;  4P75 A;  2ATW A;  4K0K Q;  3A0J A;  4LFC L;  4J8Q A;  2CFM A;  5M5X B;  4Z4T A;  1PJ6 A;  5AFW A;  1A63 A;  4O1N A;  2BE5 C;  3N52 A;  3MTS A;  1I5F A;  5AN9 A;  4GLX A;  3R2T A;  1QWY A;  4JPB W;  1EIY B;  3PA1 A;  1PH2 A;  1Q8I A;  1E62 A;  3CW2 A;  4HIO A;  4DNI A;  2C5C A;  4CJ2 C;  1KTV A;  2M5S A;  1A3V A;  1TS5 A;  1CK1 A;  1Q1E A;  2TMP A;  4OPV A;  1KDA A;  4U67 3;  4A3B B;  4P74 A;  1E3P A;  5J22 A;  2ZXP A;  3K5L A;  4XLA A;  3OPO A;  4B43 A;  4M0L A;  1EYD A;  1VDZ A;  1X6O A;  4JG2 A;  4OIJ A;  4DUZ L;  3J81 i;  3P26 A;  4CKB A;  3P27 A;  4XKV A;  1H9M A;  1ONL A;  3C1F A;  4Y7N B;  1XXG A;  2F0V A;  3FEW X;  4UDU C;  4YWK A;  1IBL L;  3CC2 B;  1RKN A;  3RZO B;  1N0U A;  3E9I A;  3VNU A;  3ZC3 A;  1PDQ A;  2HDN B;  3AGQ A;  2Z9H A;  1HVX A;  3E6Z X;  1UMK A;  1S72 B;  1M90 D;  1XQB A;  4XLC A;  4C3J B;  3GQB A;  2MNA A;  3HZX A;  5M9O A;  1K83 B;  3NPP A;  1SFO H;  2RDF A;  4HED A;  3RLO A;  1QOH A;  1VQ9 B;  1HNW L;  4DV4 Q;  4NMZ A;  4GOP A;  1WVL A;  2IX0 A;  3ISX A;  4XN0 A;  4IFD G;  2W6J A;  2ZXR A;  1GJX A;  1LAC A;  3B8H A;  2F52 A;  2R92 H;  4KY6 A;  3BYY B;  3K6O A;  4DK3 C;  3OTO Q;  1D5X C;  1KK3 A;  3JU4 A;  1MRZ A;  3OJX A;  2B2U C;  3DWQ A;  2GVA A;  3VR5 A;  2IWH A;  1NJI D;  3I4L A;  1EIF A;  4N9P A;  3BY1 A;  3TME A;  4CJ0 B;  1ZYR C;  1VQO B;  3MAQ A;  2IX1 A;  3GTP B;  3U2Q A;  1HUM A;  4G5G A;  1RQP A;  3D8G A;  3CMA A;  2PI2 E;  1COW A;  3G6J B;  2GK7 A;  3BQJ A;  3AQQ A;  4I7Z C;  3NTI A;  3J80 L;  1QFZ A;  4RFB A;  4PGO A;  3TSS A;  1XMQ Q;  1K73 C;  3P7J A;  3A56 A;  2CWA A;  4JVZ A;  1Q90 A;  4IOC A;  3SEB A;  2ZL7 A;  1IHM A;  4QHY A;  3GTO B;  1Q82 C;  4FF3 A;  4OPO A;  2Y0S B;  4DPG A;  2YTX A;  4JYA L;  3IFT A;  4C3H B;  2XWB B;  3ZIA A;  4RH6 A;  5CV4 A;  1HR0 W;  3U6B A;  4Q7J B;  1BXT A;  3I1F A;  4QV2 A;  1VQC A;  2PQA B;  5C0X H;  3KYH C;  2Q6I A;  4AVZ A;  3F2C A;  4JI1 Q;  1XYI A;  4XLE A;  4H7B A;  3KLS A;  1X3G A;  2F4I A;  2VQF L;  3DM1 A;  1MKH A;  2K75 A;  1B4O A;  1E2W A;  3FPP A;  5EKI A;  4CDF C;  3T1Y Q;  3GTL B;  1TWG B;  2WIN B;  2NVX H;  4MZ9 A;  5BR8 Q;  4ZAI A;  1YIJ A;  3OEE A;  5A2Q E;  5GV8 A;  2MO1 A;  4RA8 A;  5C4X H;  2JE6 I;  1W6K A;  3GDE A;  4YY3 Q;  1UD6 A;  3CCV A;  1HR0 L;  2XND A;  3PCO B;  4LBZ A;  5E4W C;  1WCM G;  1YNJ D;  3DM3 A;  3SK5 A;  4BA1 I;  5LMN L;  3AEV A;  2NVQ B;  1N32 L;  4JMQ A;  4R71 A;  2C2W A;  1EYA A;  4RCY A;  2AQ3 B;  1HHV A;  4ZUJ A;  2JA5 G;  4A3L G;  1VQ8 A;  4OP7 A;  4A3D B;  4ASU A;  1Y1V H;  2PW5 A;  2HIV A;  3EN2 A;  1QVF B;  1K9M D;  1ML0 D;  2OBR A;  5EJW A;  2KEC A;  4ACB A;  2JK8 A;  1IKM A;  3J7A 5;  4YHB A;  1ESR A;  4IFD J;  3OHX C;  2X69 A;  1MJC A;  1Q46 A;  1YHA A;  4QY7 A;  4R8I A;  3ASP A;  1BCP D;  1BO0 A;  2XGT A;  1OB5 A;  2IT1 A;  3G71 A;  4IQZ A;  4Z4U A;  3A7A B;  4A75 A;  4DXF A;  2HCI A;  1FR3 A;  2NB0 A;  1BMF A;  3RUZ A;  2WZN A;  3NE5 B;  4X62 L;  1KXL A;  2GVB A;  1E2V A;  2Z1C A;  1H9R A;  4QVJ A;  1V0E A;  1CZG A;  2WJY A;  2XVS A;  1R4Q B;  1CSQ A;  3S24 A;  1VQG A;  2A5H A;  2NYZ D;  1XE1 A;  4ZQ3 A;  1FNM A;  2K01 A;  4ODG A;  3ZBT A;  1VQK B;  3GVK A;  2JQO A;  3GTL H;  1B1Z A;  2EYF A;  1W9X A;  4LF9 L;  3PVD A;  3H94 A;  4ME3 A;  1N34 L;  3M7N A;  1H85 A;  1TS2 A;  2R93 B;  1HNW Q;  4YHH Q;  4L5S A;  5T1I A;  4RCZ A;  5IYP A;  1Y14 B;  1VQM B;  1NDH A;  2EY1 A;  4X3T A;  1F9P A;  2ICE C;  1WFQ A;  4B9X A;  1X3P A;  4AF6 A;  3WWV A;  4KMU C;  4JI4 Q;  4A3C G;  2QGG A;  1G6Z A;  2QEX B;  1IBM L;  2NVT B;  5DAU A;  3TP5 A;  3GTK B;  3PF4 A;  1HPC A;  3GVL A;  2KCC A;  1WOC A;  4IPC A;  2OTJ A;  4EQO A;  3X3M A;  1PFB A;  3FPK A;  1N07 A;  4NXM L;  4DV0 Q;  3I4N G;  2XIW A;  3ES9 A;  4OWW B;  1CFM A;  3F1Z A;  5GQO A;  4HID A;  3PF5 A;  1FGB D;  2RDG A;  1E0B A;  4K2L A;  1Q12 A;  4LAA A;  4A3F H;  1PTO B;  4BY1 B;  2YWF A;  4K5X A;  4JOI C;  4BXX H;  4DAV A;  3WND A;  3S1N H;  3KF8 A;  2DYI A;  2BE5 D;  1HZA A;  3IAY A;  3S17 H;  2X6L A;  1N05 A;  1UUP A;  3PO3 H;  4J1M A;  4H9G A;  4RGT A;  2DY1 A;  2MPM A;  3PUX A;  2ZL5 A;  4JI8 Q;  3ZJY C;  2IJ0 A;  1L0W A;  2DIE A;  2PNR C;  5HY6 A;  2JYO A;  3ERO A;  2OXP A;  4X3U A;  5M5Y H;  4Z9C B;  1VQL A;  1CA5 A;  2ENB A;  4UHV A;  5M3M B;  4GOP B;  2VNJ A;  2Q6K A;  1TY0 A;  2F03 A;  2BGI A;  4AF7 A;  2QKI C;  1KAB A;  4DR4 Q;  1VQE A;  1X3F A;  5GAD C;  3EJI A;  1E22 A;  2X3U A;  4YXW A;  1KJZ A;  1HRJ A;  3NWS A;  2I5M X;  2O2L D;  1HZE A;  1YJN B;  1II3 A;  2L9H A;  1WPC A;  5E4X A;  4GKJ Q;  1A62 A;  3K5O A;  1LAB A;  2F0S A;  1EEI D;  1W2B B;  3W2F A;  2VZA A;  2QDB A;  1JB7 A;  5BN3 A;  5H5J A;  1CSP A;  2ALY B;  2FXQ A;  3PUV A;  1QG7 A;  1GUS A;  3J81 L;  2Q8I B;  3J81 c;  4G7X A;  5DM6 3;  2F0Q A;  3W5O A;  4I65 A;  3CCU B;  4PMW A;  4DKA C;  3S14 H;  4LFA Q;  2VB3 X;  5C5L A;  3TZD A;  3H0G B;  1XFO A;  5FLX E;  1QH0 A;  3CCM B;  3EA6 A;  3ONU A;  3FRP B;  1IB0 A;  3AGP A;  1Z6H A;  1JE5 A;  3D4D A;  2Q2U A;  1KD1 C;  4A3D H;  1G6P A;  4GOP C;  5EAY A;  1VQ6 A;  1EQR A;  4XON A;  2KHI A;  4FK8 A;  3SHL A;  4LF8 L;  1NNX A;  3V05 A;  3TRE A;  1WCM H;  1EWY A;  4K14 A;  2F0I A;  4RAU C;  2Q6L A;  1G8Z D;  1SR3 A;  4C3J G;  1I94 L;  2V7W A;  4DR5 L;  3NBH B;  5HZB A;  1Q7Y C;  4K0K L;  2VQE Q;  1IBK L;  3W2I A;  3CPF A;  1EQQ A;  3I2Z A;  2VUM G;  2NVX B;  3NTH A;  5C0X I;  3MXU A;  3W5U A;  2IHF A;  2VZL A;  4DV5 Q;  2BGJ A;  2K05 A;  2K33 A;  4DAY B;  3GIR A;  2XNA C;  4KY7 A;  4OEM B;  1V5V A;  2JA6 H;  1G51 A;  3L3O C;  2E74 C;  4QFM A;  2EYJ A;  4J6H A;  1WTH D;  5FKA C;  3J81 k;  1SEB D;  3E1Y E;  2BMW A;  2F3V A;  3TP6 A;  4OO1 I;  2Z6K C;  3BU2 A;  1B3Q A;  5IT9 c;  1FRN A;  1JJC B;  2MUY A;  1JOR A;  2EY5 A;  3NUC A;  4OX9 Q;  4JI5 L;  3CME A;  4KY5 A;  4X7F A;  1YNJ C;  2K28 A;  2OTL A;  5FJ8 G;  3PQI A;  4A3G G;  4XQN A;  2VL6 A;  1NBM A;  2QCP X;  4WWV A;  5EPJ A;  1PRT D;  4AIM A;  1N33 L;  3ZPN A;  2JP1 A;  5THX A;  2ZXO A;  4X64 Q;  4DK1 A;  1SN8 A;  1S5F D;  3PUZ A;  3WNC A;  3S1Q B;  3PO2 B;  2HQL A;  1KAW A;  1U4P A;  4Z1M A;  3DMU A;  4U68 A;  1QGZ A;  2PMZ E;  3HGB A;  5IT9 L;  2F0F A;  1QFJ A;  1UD3 A;  2UU9 Q;  3HOX H;  1Q7Y D;  1X32 A;  5LMU Q;  2ZZF A;  3H0G G;  2E2J B;  2F0T A;  2PI2 A;  4B3F X;  5COY A;  1U9R A;  1PH7 A;  4B3R L;  2VBV A;  1X3E A;  2L4N A;  1B2T A;  3SK8 A;  1OXS C;  1KK0 A;  2F4V L;  5G3L F;  2R9V A;  3ULJ A;  4XL9 A;  4IW3 B;  1SDF A;  4QVA A;  4BBR G;  4ZK9 B;  1RIP A;  5JJL A;  2EJG C;  3VNV A;  2PZU A;  4XOT A;  1UNS A;  4WJ4 A;  1FRQ A;  5I9O A;  4GN4 B;  4MNO A;  1T5X D;  4X66 L;  4DV2 L;  1UE7 A;  1I4Q A;  2NTT A;  3PMF A;  1TS4 A;  4G7Z C;  2XGJ A;  4JI6 L;  3HOY G;  3CME B;  4FWT A;  1H9S A;  1XWE A;  3ZUG A;  3ASR A;  1JNY A;  4G1V A;  3S1M H;  4RPD A;  5KW9 A;  2UUC Q;  4DNR B;  1LT3 D;  1B7Y B;  2CCZ A;  1H8E A;  2MFI A;  2ZJR A;  1DYQ A;  2F0N A;  3LNN A;  2C5B A;  5HGT A;  4KD3 A;  5I6Y A;  2VBU A;  1D8L A;  1HCZ A;  4FXU A;  4WOR A;  3R2I A;  1VQ4 B;  3P20 A;  3T1Y L;  4LF6 L;  2R3Z A;  3S1R B;  1N06 A;  2K03 A;  5FK9 C;  4LFB L;  3OIP A;  2ICI A;  4HMJ A;  4UAJ A;  4Z4R A;  1EQV A;  4KHP Q;  1LTL A;  2KUM A;  5BR8 L;  4QQB X;  1W6J A;  2A6E D;  3GVJ A;  4WZK A;  2ZXH A;  4HE6 A;  4A3I H;  1ASY A;  4RKL A;  1I94 Q;  5IWA L;  1PVO A;  1VQN A;  4POF A;  4RG1 A;  2N88 A;  1VQ7 B;  3OW2 A;  2Q8T A;  2HCJ B;  5C44 B;  1QNU A;  4LBY A;  1VF5 C;  4PC3 A;  3K8A A;  1M1K D;  1I3Q B;  2BH8 A;  2F0L A;  2BPO A;  1D1N A;  1M4V A;  5C4X B;  1S0U A;  5CV5 A;  1KC8 C;  1F60 A;  2Q2I A;  1UE6 A;  4PV1 C;  3D6C A;  1HZB A;  5M5W H;  3K5M A;  3TQY A;  4A3J G;  1EY6 A;  2VJI A;  1H8H A;  3L0O A;  2KCT A;  3N6R A;  2QEX A;  4DR2 L;  2N55 A;  2B2Y C;  4YCW A;  1HTP A;  3ASS A;  4A3M B;  1BDO A;  1QUE A;  1SKY B;  1L1O A;  2KEN A;  5JEA H;  2K52 A;  1PH8 A;  4OIK A;  1I8D A;  1OB2 A;  3BZD B;  3GTM H;  3J80 E;  4XTC S;  4UP7 A;  3JQQ A;  3NQI A;  3M4O H;  4HN7 A;  3SK4 A;  4X65 Q;  3L7Z C;  3FKS A;  4B48 A;  4ZCL A;  5EGT A;  3S2H H;  4XYO A;  3ERQ A;  5IOD A;  4HIM A;  3CP8 A;  1HA5 A;  1C0A A;  1EY8 A;  4C3I B;  5DLQ E;  2E2J H;  3PA2 A;  2UUB L;  3JAM E;  2M9V A;  3ICE A;  4IFD I;  2CHB D;  3H9N A;  3CCL A;  2UXB L;  1RHP A;  4Y52 H;  3TP8 A;  2QTZ A;  1I3Q H;  3OWE B;  3NHH A;  2NN6 I;  1TLL A;  4II2 A;  1TY2 A;  3D6W A;  5DN6 A;  4CDE C;  4DV1 L;  3U9S A;  5T1G A;  1U4L A;  1TVC A;  1B9M A;  1S4Z A;  4L6T B;  3BH4 A;  1PV4 A;  3AYH B;  2C9O A;  5DNF A;  5H1S E;  1VQL B;  3VO1 A;  4UAI A;  2GJP A;  1SJE D;  1P4M A;  2DJF C;  4X05 A;  1Q86 D;  5HUR A;  3S9W A;  4XMY A;  1DOL A;  1XNR Q;  2UUA Q;  3AFQ A;  2F0U A;  2HIX A;  4X8I A;  2K6A A;  3U58 A;  3SJZ A;  5KGU A;  2ZZE A;  3GTK H;  1VQI A;  1E7Z A;  4DV6 Q;  3D4R A;  4TSF A;  4HMI A;  5IOC A;  3QIA A;  3GTJ B;  4R1J A;  2K5W A;  3T53 B;  1I4X A;  1F20 A;  2DNE A;  3BG3 A;  2JA8 G;  4BY1 G;  4B44 A;  2EPB A;  1DCZ A;  4EGV A;  1L2F A;  4BXX G;  3W2D A;  4UPA A;  3CCM A;  3CU7 A;  4GLA C;  4QF4 A;  1PXU A;  3KDF B;  2AQ2 B;  2OYN A;  1PZJ D;  3GP7 A;  3W2H A;  5JVG 3;  4OOS A;  4X7D A;  1KC8 D;  4GNX C;  1WTO A;  1JJ2 A;  1V9P A;  3CQZ H;  1EFW A;  3CPW B;  3TP7 A;  4AQY L;  3CP2 A;  2HHH L;  1LTA D;  2CW0 D;  3FKI B;  1B53 A;  2QA4 B;  3B6Y A;  4JI2 Q;  5C3X A;  4MTK A;  2QDL A;  4M1U B;  5FLM G;  1KHI A;  2A1A A;  1SND A;  2Q6O A;  3E9H A;  3CCS B;  4XQF A;  3VYT A;  3VA7 A;  3EIV A;  4C3H G;  2EXD A;  2XN9 C;  1SBB B;  2Q2T A;  4RD3 A;  1U5K A;  2ZIT A;  5C6A A;  4UZE A;  1RCV D;  4FDB A;  3I72 A;  4NNJ A;  5IYQ A;  1MGS A;  1LV9 A;  1CTM A;  1WTH A;  1W0K A;  4P1V A;  5DS0 A;  3OIQ A;  1IYV A;  4X06 A;  2EYO A;  2HMA A;  5CBA E;  3D3R A;  1NCV A;  5I2Y A;  3CB4 A;  1LYL A;  1VQ5 A;  2XTI A;  3M3Y B;  2QGQ A;  1IBL Q;  3R6J A;  4LF7 Q;  2G9H D;  1CKN A;  4KLK A;  2KCN A;  4IJL A;  2RA4 A;  1GUG A;  2ZM6 L;  1GR1 A;  4YEJ A;  5E7N A;  1VQO A;  1RTO A;  2B2W A;  3P1H A;  3C2P A;  1E63 A;  3HOW G;  4L5R C;  4NXN Q;  5IYD H;  1IZ6 A;  2JJQ A;  4DR2 Q;  5GAH C;  1F2L A;  1KK1 A;  1AN8 A;  2X53 S;  1Y0R A;  4RPB A;  3FP9 A;  2O5I C;  1V0F A;  4X6A H;  4LF4 L;  1Q82 D;  1QVF A;  4C3I H;  2E75 C;  2B8G A;  1DG1 G;  2WR8 A;  1KLU D;  2GRE A;  4RGN A;  2LXJ A;  4A3D G;  3OWF A;  1XPU A;  1EQT A;  2XRS D;  3KUP A;  4JBW A;  5I4D A;  3NEN A;  4H13 C;  1PA6 A;  4B3T Q;  5KRU A;  3SJP A;  3M4O B;  4DGZ A;  1I18 A;  5BN5 A;  2EFG A;  3I4M H;  1BBW A;  2JA8 B;  4QUZ A;  3J80 c;  1PH6 A;  2JA6 B;  4XLH A;  1S72 A;  1ICW A;  3OTO L;  2F3W A;  2J0T D;  4RDL A;  1PJ7 A;  1TWC B;  2UXB Q;  4K1X A;  4RM0 A;  2WJV A;  5EKK A;  1N36 Q;  1EFI D;  5TV2 A;  3GTO H;  4K8J A;  4PC1 A;  1PZK D;  2A68 D;  1E3X A;  1EWH A;  2C4T A;  4OPS A;  3H09 A;  4B3M Q;  1G7T A;  2WKC A;  1K9M C;  4RD1 A;  2J7Z A;  4PC6 A;  4X3K A;  4PG3 A;  2OQK A;  3K57 A;  2D0O A;  1UD2 A;  3OZW A;  5C3W A;  5JEA G;  4P71 A;  2P5Z X;  1SMX A;  2K50 A;  4BY7 H;  4UY8 C;  2A69 C;  1VQM A;  4RD6 A;  5DM7 3;  2QA4 A;  5AJ3 L;  4Z4S A;  3O13 A;  4GS3 A;  2OTL B;  3KBX A;  4AYB B;  1NMF A;  2R92 G;  3QE2 A;  5CBE E;  4WJW A;  1XPO A;  1XNQ Q;  3KJO A;  1Y1W H;  2VW9 A;  3MEH A;  3HOU H;  3T16 A;  2X0K A;  2VQF Q;  4HJ7 A;  1A0I A;  1PH1 A;  1GHK A;  2EQS A;  3SDZ A;  3J7A F;  4C0S A;  2EDG A;  1UAP A;  1N9W A;  1HFG A;  1WSV A;  2C4U A;  1GHJ A;  2EIX A;  5KND A;  1EP1 B;  4B47 A;  3Q23 A;  2R93 H;  4CDC C;  1DOM A;  3IFD A;  3HOX G;  3J7Y W;  3W2E A;  5IYN A;  1ET9 A;  3STB C;  2X6W A;  5C3E H;  3RZO H;  3K5N A;  4F88 A;  4RWS C;  2RC5 A;  1GXD C;  5FIU A;  3SEJ A;  2VNH A;  4DR3 L;  1TQO A;  1SYB A;  5KYI A;  1XB2 A;  2CF4 A;  1WD0 A;  3VR6 A;  2A73 B;  4S3S A;  3JAM c;  3HOW B;  4TMX A;  1VQF A;  3TS2 A;  3DXJ C;  1ASZ A;  3EQL C;  4L5T A;  1YI2 B;  1WTR A;  1F9Q A;  4XOR A;  2OQ0 A;  5C0X G;  2PIA A;  5A88 A;  2HCC A;  2E5L L;  1C4Q A;  3CP0 A;  3RN5 A;  2VJJ A;  1FNB A;  1JOQ A;  4OWX B;  1ZYR D;  3HOU B;  5K36 G;  1ENF A;  1WSR A;  3E3X A;  2YWE A;  1PFM A;  5E6T A;  3OKX A;  5HKK A;  4IJH A;  3VDY A;  3J81 j;  1O7Y A;  1ESF A;  1YIJ B;  1X54 A;  1AP0 A;  3S17 B;  4DNT B;  1ZM2 A;  1UD5 A;  5J39 A;  5IP9 G;  3PIO 3;  4RDK A;  2KOL A;  5FA6 A;  4BY7 B;  3A54 A;  4YCV A;  2ZM6 Q;  2R7F A;  1C7Y A;  5EBC A;  1Q86 C;  1NB0 A;  1PYW D;  2A6H C;  2B63 G;  3HOZ G;  5CC4 A;  3B78 A;  3I56 A;  4JBJ A;  4M1K A;  2Z4H A;  5NUC A;  2PQA A;  2OK8 A;  1PJ5 A;  4CHT B;  3D31 A;  3DHQ A;  4HJ9 A;  3T1H L;  1QE6 A;  3WBJ A;  2VB2 X;  2JA5 H;  4LF4 Q;  2MP1 A;  1KIX A;  1GAW A;  2NVY H;  4PQX A;  4LF9 Q;  3G4S B;  1ENC A;  1KRT A;  2V7U A;  5H59 A;  4M2L A;  3I70 A;  4B3T L;  4IOA A;  2GJK A;  4BA2 I;  3IL8 A;  4KI0 A;  1RDP D;  5FLX c;  4ZUI A;  3BZC A;  4DK6 C;  2IW3 A;  3WOE A;  1E24 A;  2KVO A;  4E0F A;  1VMP A;  3A8J A;  5F4O A;  2CWP A;  3HP3 A;  2DUD A;  1STB A;  1WTX A;  5J3B A;  1LM0 A;  4Q0F A;  1TWA B;  1N8R C;  1B70 B;  1IYU A;  1CA6 A;  4B9W A;  1CKO A;  3TRZ A;  4DV0 L;  1S3O A;  3SLN A;  1YJ9 B;  4O2D A;  1CZW A;  1KTK A;  2JIZ A;  1XMO L;  3VYS A;  4TQU S;  4DAP A;  4RJL A;  1VLO A;  1MD2 D;  1CM9 A;  1PFS A;  1Z47 A;  4HR7 B;  4RHR A;  3CCR B;  4Y9R A;  1CKN B;  4LFC Q;  1EIH A;  2ZZG A;  1Z9F A;  3CCQ B;  3MXG A;  1VQ4 A;  4Z4Y A;  1B44 D;  1JB9 A;  1U4R A;  3M4Q A;  4TVA B;  1VQ5 B;  4K5V A;  5KNC A;  4JBM A;  2KJX A;  1EU3 A;  1VQ9 A;  2FIN B;  3V7A A;  4DUY Q;  1D1I A;  1HUN A;  2K32 A;  4KKU A;  2D5D A;  2K7V A;  4R4I A;  3Q6R A;  2RBM A;  1MSG A;  1FDR A;  1O80 A;  2B39 A;  2AMC B;  4HSP A;  2WZP P;  3A3B A;  2F0J A;  1JA0 A;  5F4J A;  2VYQ A;  3AST A;  5IYC H;  5CDF A;  3CES A;  1H9J A;  1HQM C;  4HTH A;  3H3V H;  1JOK A;  3PV0 A;  5DEH A;  1CI3 M;  3A8K A;  1H9K A;  2NN6 G;  2NZ1 D;  4DA2 A;  3Q39 A;  4Z4W A;  2K5D A;  3IKJ A;  4P25 A;  1J5E Q;  2B63 B;  3HOZ B;  1XMQ L;  4MIU A;  5CV9 A;  2RSN A;  4FF1 A;  1AZQ A;  4DR1 Q;  1VQK A;  1N8R D;  2L1B A;  4HJ8 A;  4P2C B;  2XZP A;  3KDF A;  4XNF A;  3QOL A;  4DV4 L;  3M4Y A;  4Y7C A;  4DV7 L;  3MCA A;  1D6E C;  4TSS A;  1DDI A;  4IPG A;  5JEA J;  1KDB A;  2PO4 A;  4O0A A;  1SNO A;  4LFA L;  4P72 A;  4P9S A;  2B63 H;  3HOZ H;  1CHQ D;  1LLR D;  4TMW A;  1QVG B;  4A3B H;  3H3V C;  2X6X A;  1QZH A;  4TMZ A;  1YZ6 A;  3GTJ H;  3HKZ G;  3HRZ C;  2SDF A;  3LVB A;  4NBS A;  4UZF A;  1SYG A;  3BVZ A;  5COR A;  2EZV A;  1NBW A;  3CXC B;  3Q8D A;  1Y1V G;  3DWP A;  3EFX D;  3QG1 A;  1EY5 A;  1JE4 A;  4PZ8 A;  3PO3 B;  2XWJ B;  3HOX B;  1PRT C;  3H6M A;  5FLM H;  1EY9 A;  3KLR A;  3PO2 H;  1VQJ A;  1YNN C;  4JI4 L;  4A3F B;  2R7Z G;  2CVR A;  3CAM A;  3UDF A;  1DM0 B;  4X07 A;  1G7C A;  4DV5 L;  4F7D A;  3ONA B;  1YIT A;  3Q38 A;  2CQO A;  4IUT A;  1C48 A;  2D9R A;  4NDX A;  4YCU A;  2TSS A;  2E1R A;  4DAM A;  2F0G A;  1I4P A;  4FXK C;  1O7L A;  3CXC A;  1OXV A;  3OW7 A;  3S2D H;  4YIJ A;  2B5O A;  4X62 Q;  2V4D A;  4NW2 A;  4IN3 A;  1FJG L;  5GRO A;  3DDY A;  4KN7 C;  5JJK A;  2XRQ D;  3V96 A;  4BBR B;  5FO0 A;  1MHW C;  5FNZ A;  4L5Q A;  2RHQ B;  1NB9 A;  4YWL A;  2JN9 A;  4C43 A;  5LMN Q;  4Q5V A;  2OCE A;  4FO2 A;  2ZZQ A;  1N33 Q;  2PW7 A;  4XDX A;  1JC7 A;  2NVY B;  5C4Z A;  5IGF A;  3CCU A;  2QE7 A;  5G3L D;  1KNE A;  2NN6 H;  3QWN A;  1TUI A;  4XLF A;  2NPF A;  1EWI A;  4A3E H;  2Y0S E;  4R8N A;  2B2V C;  3MZ5 A;  4ME5 A;  2XNJ A;  2KA7 A;  3U4V A;  3G6E A;  2BDN A;  1PH3 A;  2YTY A;  1IBM Q;  3SKB A;  5ELC A;  1W0J A;  2JN4 A;  5CGK A;  3TEH B;  3I4N B;  2A6E C;  5EKL A;  4CDD C;  2B7B A;  2WB1 B;  2PQE A;  3QFT A;  2RQX A;  2XZL A;  1GKH A;  4AH6 A;  4JCV E;  3VR3 A;  3Q6S A;  3ND9 A;  4ZCK A;  2FJ2 A;  2FMC A;  2X6Y A;  4XXE A;  2D9U A;  2ID0 A;  2CH4 W;  5A8A A;  4MTN A;  1KQS B;  1I4R A;  4PZ6 A;  3CCJ A;  4GKK L;  1DZ1 A;  1B9N A;  4H44 C;  2PYK A;  1H9S B;  4LJZ C;  1N34 Q;  3Q24 A;  3FKI H;  3ONY A;  2J7K A;  1N08 A;  2UXC L;  1U0L A;  1SKQ A;  2RF4 A;  4EX5 A;  4QCL A;  1GO3 E;  1TWG H;  4Z4V A;  4PAB A;  2B2W C;  2KEE A;  3A5Z B;  2K5Q A;  5I2X A;  2RVL A;  2YU9 B;  2V31 A;  2VUM B;  3AMU A;  3CTA A;  1QB5 D;  3HOU G;  5FL7 A;  4JW0 A;  4LF6 Q;  5C4J B;  2OEO A;  1H95 A;  4EQP A;  1YJW B;  5IYR A;  2ZBV A;  2QF7 A;  5A89 A;  5K5P A;  1QIL A;  5IYB H;  4IUR A;  5GAE C;  4IZ8 A;  4JI0 Q;  1VQP B;  1JT8 A;  3WQZ A;  1HFN A;  4DR6 L;  4WFN 3;  4LBW A;  4BS9 A;  1GUN A;  1OXT A;  3A74 A;  1VMC A;  1SXT A;  1K8A C;  4JBK A;  2IY5 B;  4M53 A;  3UE1 A;  1AE3 A;  4LUO A; 
#chains in the Genus database with same CATH homology
 3BVG A;  2F43 A;  1PKV A;  3BC9 A;  3S1N B;  4BBS B;  5KNB A;  4FXG C;  1EU4 A;  1LT4 D;  3G7L A;  3GV6 A;  1I50 B;  3MFY A;  1BPL A;  2ZTG A;  4DU9 A;  2PZT A;  1ZXT A;  3MC0 B;  1F2Y A;  4K2K A;  5C0X J;  2R92 B;  1STG A;  5IGB A;  5CR3 A;  1A2U A;  1BF4 A;  3S2H B;  1RF2 D;  1GOZ A;  3FMC A;  4N9T A;  2ZT9 C;  3VYR A;  4EQN A;  3GTM B;  2RDH A;  3OOC A;  1G2S A;  3TZU A;  4RHS A;  4FP5 D;  4XQJ A;  1D5Z C;  2BCO A;  2HQE A;  2F0M A;  1STH A;  4TKO B;  1D1K A;  1KDC A;  4KJO A;  4DAY A;  2EYL A;  5I9P A;  4IUV A;  2CQA A;  1NR2 A;  2LKV A;  3OAA A;  2JA5 B;  2JEA I;  2BA1 A;  3MXN A;  3SK6 A;  5IIF A;  1OB0 A;  2D2C C;  1A15 A;  1I6V C;  3Q0A A;  2CK3 A;  1DOK A;  1EOT A;  1SNM A;  3KEW A;  5A2Q L;  1Z7T A;  3M7G A;  4IFD H;  3I91 A;  1V1P B;  3CMM A;  2E2D C;  3S14 B;  4K6D A;  1V8Q A;  3OEH A;  3BCD A;  1X3Q A;  5C4H A;  4K6L A;  1PLF A;  4MN3 A;  4F7X A;  1NAP A;  1DON A;  2JEB I;  2B2V A;  5EPK A;  1LTG D;  5D3I B;  2I46 A;  1O78 A;  1TKW B;  5FO7 B;  5FO9 B;  4KHZ A;  3R3O A;  1LTT D;  2F0O A;  3R8B A;  3BDO A;  3EVQ A;  2HUG A;  1LT6 D;  2OF1 A;  2EYH A;  2SEB D;  2PZW A;  3QOJ A;  1U4M A;  4X3S A;  4LMQ D;  3CRK C;  4TRD A;  3C1E A;  1AW7 A;  1GUT A;  5M3F B;  1JOO A;  1QNK A;  2A69 D;  1KMH A;  5ELD A;  1G29 1;  2A68 C;  1WTW A;  2EJF C;  1WTQ A;  3C46 A;  3BS1 A;  1LTR D;  1PTO H;  3G05 A;  1OHH A;  1S5C D;  1LTS D;  1EWC A;  1MSH A;  1BR9 A;  2AQ1 B;  2H4O A;  1D5M C;  1SE4 A;  2PCF B;  1JB3 A;  2F0W A;  1VLY A;  5KIX A;  1KNA A;  1L0X B;  1EY4 A;  3A8I E;  4E6I A;  3BCF A;  2M00 A;  5ELF A;  2E2H B;  4KHV A;  4ILW A;  1A6X A;  3A7L A;  1S5E D;  1Q3L A;  3AU7 A;  4ZRZ A;  1NUC A;  4NP5 A;  2Z4I A;  3DEO A;  1FX0 A;  3TN2 A;  4FF2 A;  5J1Z A;  5ELB A;  2CW0 C;  4XD7 A;  4HCS A;  4LK1 C;  5CV8 A;  1MAB A;  1EY0 A;  4KD4 A;  3VYU A;  3KLS X;  4A3I B;  1PRT B;  5JPN C;  2L5T A;  4A3J B;  4TT3 A;  4ULL A;  4YEL A;  2EYP A;  1VJS A;  1TII D;  4XYQ A;  1QJO A;  1ILQ A;  2A6H D;  4HCE A;  3DUZ A;  5FOB B;  4A3E B;  1F77 A;  1IKL A;  1PRT F;  3A8J E;  2Z6B D;  3UI2 A;  2RKS A;  3F2U A;  4A3G B;  4V0B A;  5A35 A;  1KLG D;  1E2Z A;  1LTB D;  2NBF A;  3CQZ B;  4JK1 C;  2RSO A;  1JWM D;  2LFN A;  4XOP A;  1S5D D;  3CKI B;  3SR1 A;  1M8A A;  2DNC A;  5M5Y B;  1ROD A;  1CHP D;  3PUY A;  1ILP A;  2L11 A;  3S16 B;  5F2D A;  1C8C A;  2X85 A;  2DN8 A;  4XN3 A;  1CT1 D;  1E1R A;  1NRK A;  5I6W A;  1QCB D;  2WAC A;  5CV6 A;  2XZO A;  2F1M A;  3TDQ A;  1SNQ A;  2WV6 D;  4DXG A;  1R9T B;  2ZXI A;  2EYM A;  3MHB A;  2F0E A;  4GQN A;  3T4A C;  2L55 A;  4DFA A;  1F2Z A;  1PTO D;  3NWT A;  3VA5 A;  3WOF A;  1VCI A;  4KK7 A;  1E43 A;  4OHJ A;  3FPU B;  3VR4 A;  2WII B;  2KQ3 A;  3GD7 A;  4XIG S;  4ZKB B;  4RKB A;  4FYD A;  1RTN A;  4V19 0;  3GTG B;  1LT5 D;  2XOK A;  1FD7 D;  2H1E A;  2R61 A;  5E1F A;  1SMY C;  2O4X A;  1G91 A;  1FNV A;  3NSW A;  4DN4 M;  1TR5 A;  2D62 A;  5M5W B;  1ZEQ X;  4KV6 A;  1JCK B;  4NKL A;  3LWE A;  3GV3 A;  2K1B A;  2MHV A;  4OO1 G;  1VF7 A;  1B3A A;  4RGO S;  2DY8 A;  2PMZ B;  1I6H B;  4XM3 A;  4IUP A;  3A3G A;  1Y1W B;  1V1P A;  3K7A B;  1UD4 A;  4G57 A;  1FYC A;  3HEJ A;  1Y1V B;  5EPL A;  5KNL A;  1PMR A;  2F0H A;  2EXZ A;  1F9S A;  5IK2 A;  4H0L C;  5BN4 A;  2GA4 B;  3RD4 A;  3FDT A;  2EE1 A;  3BYT B;  2XSC A;  4OGQ C;  3S1M B;  5JJZ A;  5JOB A;  1SMY D;  4GZY C;  1MBY A;  4M8A A;  3BDL A;  4CGY B;  1DXM A;  2EOT A;  4PNY A;  3I4M B;  3NK9 A;  1EYC A;  4XQQ A;  3U9O A;  3URY A;  4HSV A;  1LO5 D;  2V7Q A;  4QB4 A;  1STN A;  1JR0 D;  5JPM C;  2WSS A;  3RZD B;  2JA7 B;  2YYZ A;  2L0C A;  2KHS A;  4C2M B;  1AZP A;  5IGD A;  5D3D A;  2NTS A;  1ET6 A;  1KAA A;  2JJ1 A;  2D3L A;  5EQ0 A;  2M2L A;  4XT1 B;  2IL8 A;  5K36 H;  2EY6 A;  1CQV A;  4FVM A;  1S5B D;  2DY7 A;  1SJH D;  1HXY D;  1JWU D;  2X6G A;  1BUV T;  3GTQ B;  5JAV A;  4ZKC B;  2BA0 A;  4QUC A;  1SFO B;  1CQF A;  4HAE A;  3T51 B;  1WP6 A;  1R4P B;  2D3N A;  2JXM B;  1IW7 C;  2JSO A;  4ID6 A;  4K8I A;  4KTA A;  1XTC D;  2B2U A;  1TWF B;  1SE2 A;  2AWN A;  3A8K E;  2E2I B;  3ITP A;  3CRL C;  2B2T A;  1BQQ T;  3MVV A;  3I73 A;  1BOS A;  4DF7 A;  1TVX A;  1ENA A;  1OO9 B;  2OT2 A;  2HDL A;  1BCP B;  1STE A;  3NQT A;  3RLF A;  4XKW A;  1F9R A;  2F0K A;  2W6I A;  4WRD A;  4II3 A;  4C1N K;  4EVO A;  1HTL D;  4G7W A;  1E79 A;  1YNN D;  3T56 B;  1OXU A;  3DWA A;  4RGM A;  3I90 A;  1PTO C;  4B3G A;  2LY7 A;  2AWO A;  1Q1B A;  3NBI A;  1SNC A;  1GUO A;  3BVM A;  3KBG A;  1PFN A;  1SAP A;  2QEJ C;  3V2T A;  3BDC A;  3OFN A;  3DEP A;  3MWY W;  1J9O A;  3E0J A;  2G9D A;  2MGS A;  4IUN A;  1WD1 A;  3SE0 A;  2O5J C;  3E5S A;  5D65 A;  1JWS D;  4PMC A;  1EFR A;  3OMG A;  4C1N I;  5E3F A;  3HS0 C;  3PUW A;  4A93 B;  3MA2 B;  2FFK B;  1I4H A;  2NWG A;  1HA6 A;  2LZJ A;  1BLI A;  3PIP 3;  5EBD A;  3NXW A;  3X3N A;  1ZKO A;  2BDO A;  1XX8 A;  2AUK A;  2JJ2 A;  2Q8R E;  4MHE A;  4UZU A;  2E76 C;  1FNW A;  4K5W A;  3HAG A;  3AB9 A;  4R9W A;  1TT2 A;  2B8F A;  1KZL A;  3C3L A;  3K0Y A;  1E1Q A;  3GO5 A;  4IUQ A;  1G2T A;  3HG9 A;  3NP8 A;  3ND8 A;  4KKT A;  3MFG A;  1SYF A;  3I3C A;  5LHY 1;  4IAL A;  2KED A;  1F2M A;  3SXH A;  4DK0 A;  1A2T A;  2NUC A;  4CBV A;  2GJR A;  4KJN A;  2EJM A;  4F8M A;  1STA A;  1E3Z A;  5C5M A;  1PZI D;  1SYC A;  1O7Z A;  2L12 A;  1Y8P B;  3LWU A;  5C3E B;  4FF4 A;  2VXW A;  1SNP A;  4XT3 B;  4QIW B;  1UEA B;  4QUF A;  4A3K B;  4KKS A;  3OE7 A;  4G7H C;  5ELE A;  2R6G A;  2EVB A;  3I8Z A;  3L9A X;  3MXP A;  2Z8L A;  1BNZ A;  4F87 A;  5CV7 A;  3LX0 A;  1BBX C;  2LMC B;  3QB3 A;  5ISR A;  3M85 A;  1J8I A;  3VR2 A;  4OO1 H;  2HLD A;  4RCO A;  4CJ1 B;  1A3T A;  2WAQ B;  2WKD A;  2R7Z B;  1A3U A;  1D2B A;  4XR6 A;  1JIC A;  3D4W A;  5JVH 3;  1FNU A;  2K04 A;  3CHB D;  3HOY B;  3KK7 A;  1AEX A;  4FNF A;  5CYU A;  2JDI A;  2KVM A;  2GK6 A;  1IW7 D;  5FLX L;  1RJT A;  3HKZ B;  3ZYY X;  3S15 B;  3NBH A;  4BWG B;  3J81 E;  3FVQ A;  5IT9 E;  1WTP A;  1TU2 B;  1BCP F;  1EZ8 A;  4L63 B;  4L8J A;  5IGC A;  3JAM L;  4RCN A;  3Q22 A;  3S2D B;  2I07 B;  4OL7 A;  2SOB A;  3T13 A;  1TWH B;  1EEF D;  1HQR D;  1SYE A;  4B08 A;  1MI2 A;  1EY7 A;  1STY A;  1IHZ A;  1TS3 A;  3K59 A;  1GUW A;  1PTO F;  4CKC A;  2IPK D;  3WDN A;  2B2Y A;  1Y8O B;  4P22 A;  4PMB A;  3R93 A;  2X8K A;  4IUU A;  3OMC A;  1SE3 A;  4O42 A;  2VNU D;  3HOV B;  1NR4 A;  4C3I G;  2SNM A;  2SNS A;  2MJ8 A;  3W3A A;  4ZLT F;  3QO2 A;  3H91 A;  1DD2 A;  3SVM A;  1Y69 U;  1K28 D;  2IX3 A;  2FHT A;  2FMM A;  2BOS A;  1DJR D;  4ABN A;  1Y8N B;  2QIL A;  1JQY D;  1SYD A;  5IGE A;  1K8O A;  1EIG A;  3A55 A;  1B50 A;  3J7A V;  1I4G A;  2A74 C;  5LL6 S;  5TSS A;  2WPD A;  4QMG A;  3K58 A;  1NSN S;  2LS0 1;  5FO8 B;  4G7O C;  4HIZ A;  2PPB C;  4KN4 C;  3NTK A;  1RD9 D;  5CMD A;  1SSO A;  4FXD A;  1BCP C;  4CKE A;  1EZ6 A;  2AUJ D;  3A35 A;  1WTV A;  5KYL A;  1V1O A;  1V43 A;  1OXX K;  2F0P A;  5LL6 X;  4G6I A;  3TBI B;  3OSO A;  1LTI D;  1AFP A;  1UD8 A;  1T5E A;  1EL0 A;  2HDM A;  4G4K A;  2B2T C;  2F0D A;  3P75 A;  1IL8 A;  4ZYS A;  2J4X A;  2E1B A;  4C56 C;  1WCM B;  1L0Y B;  5IGG A;  3RMH A;  2ZTN A;  2EY2 A;  3QJY A;  5KEE A;  2WP8 J;  1K8M A;  5D14 A;  4J8Q A;  5M5X B;  5AFW A;  4O1N A;  2BE5 C;  3N52 A;  3MTS A;  3R2T A;  1QWY A;  1Q8I A;  2C5C A;  4CJ2 C;  1TS5 A;  2M5S A;  1A3V A;  2TMP A;  1CK1 A;  1Q1E A;  4U67 3;  4A3B B;  1KDA A;  5J22 A;  3K5L A;  2ZXP A;  1HHV A;  4XLA A;  3OPO A;  1EYD A;  4OIJ A;  1VDZ A;  4CKB A;  4XKV A;  1H9M A;  1ONL A;  3C1F A;  4Y7N B;  1XXG A;  2F0V A;  3FEW X;  4UDU C;  1RKN A;  3RZO B;  1PDQ A;  3E6Z X;  1HVX A;  4XLC A;  4C3J B;  3GQB A;  3HZX A;  5M9O A;  1K83 B;  3NPP A;  2RDF A;  4HED A;  1QOH A;  4NMZ A;  1WVL A;  2IX0 A;  4XN0 A;  4IFD G;  2W6J A;  2ZXR A;  1GJX A;  1LAC A;  4KY6 A;  3BYY B;  3K6O A;  1D5X C;  3JU4 A;  3DWQ A;  2B2U C;  3VR5 A;  2IWH A;  4N9P A;  3I4L A;  3TME A;  3MAQ A;  3GTP B;  4CJ0 B;  1ZYR C;  2IX1 A;  1HUM A;  3D8G A;  1COW A;  3G6J B;  2GK7 A;  4I7Z C;  3NTI A;  3J80 L;  4RFB A;  3TSS A;  3P7J A;  3A56 A;  1Q90 A;  3SEB A;  3GTO B;  4FF3 A;  2Y0S B;  3IFT A;  4C3H B;  2XWB B;  3ZIA A;  4RH6 A;  5CV4 A;  1BXT A;  5C0X H;  4AVZ A;  1XYI A;  4XLE A;  4H7B A;  3KLS A;  2F4I A;  3DM1 A;  1B4O A;  1E2W A;  3FPP A;  5EKI A;  3GTL B;  1TWG B;  2WIN B;  4ZAI A;  3OEE A;  5A2Q E;  4RA8 A;  2JE6 I;  1W6K A;  1UD6 A;  2XND A;  5E4W C;  1YNJ D;  3SK5 A;  4BA1 I;  2NVQ B;  4JMQ A;  1EYA A;  2AQ3 B;  4ZUJ A;  4A3D B;  4ASU A;  2PW5 A;  1ML0 D;  5EJW A;  2KEC A;  1IKM A;  1ESR A;  4IFD J;  3OHX C;  2X69 A;  4R8I A;  1BCP D;  1BO0 A;  2IT1 A;  4IQZ A;  3A7A B;  4DXF A;  2HCI A;  1FR3 A;  2NB0 A;  1BMF A;  3RUZ A;  3NE5 B;  1E2V A;  2Z1C A;  1H9R A;  1V0E A;  1CZG A;  2WJY A;  2XVS A;  1R4Q B;  2A5H A;  2NYZ D;  4ZQ3 A;  2K01 A;  4ODG A;  3GVK A;  1B1Z A;  2EYF A;  1W9X A;  3H94 A;  3M7N A;  1TS2 A;  2R93 B;  5T1I A;  2EY1 A;  4X3T A;  1F9P A;  2ICE C;  4B9X A;  1X3P A;  4KMU C;  1G6Z A;  2NVT B;  5DAU A;  3TP5 A;  3GTK B;  1HPC A;  3GVL A;  2KCC A;  4EQO A;  3X3M A;  1PFB A;  2XIW A;  1CFM A;  1FGB D;  2RDG A;  1E0B A;  4K2L A;  1Q12 A;  4LAA A;  1PTO B;  4BY1 B;  4K5X A;  4DAV A;  3KF8 A;  2BE5 D;  3IAY A;  2X6L A;  1UUP A;  4J1M A;  4RGT A;  2MPM A;  3PUX A;  2IJ0 A;  2DIE A;  2PNR C;  2JYO A;  3ERO A;  2OXP A;  4X3U A;  4Z9C B;  1CA5 A;  2ENB A;  5M3M B;  1TY0 A;  2F03 A;  2QKI C;  1KAB A;  3EJI A;  4YXW A;  1HRJ A;  3NWS A;  2O2L D;  1HZE A;  1II3 A;  2L9H A;  1WPC A;  5E4X A;  3K5O A;  1LAB A;  2F0S A;  1EEI D;  2QDB A;  5BN3 A;  3PUV A;  1QG7 A;  1GUS A;  3J81 L;  2Q8I B;  4G7X A;  5DM6 3;  2F0Q A;  4I65 A;  4PMW A;  2VB3 X;  5C5L A;  3TZD A;  3H0G B;  5FLX E;  3EA6 A;  3FRP B;  1Z6H A;  3D4D A;  3SHL A;  4XON A;  3V05 A;  4K14 A;  4RAU C;  2F0I A;  1G8Z D;  4C3J G;  2NVX B;  3NTH A;  5C0X I;  3MXU A;  2K05 A;  2K33 A;  2XNA C;  4KY7 A;  3L3O C;  2E74 C;  2EYJ A;  4J6H A;  1WTH D;  5FKA C;  1SEB D;  2F3V A;  3TP6 A;  4OO1 I;  2MUY A;  1JOR A;  2EY5 A;  3NUC A;  4KY5 A;  1YNJ C;  2K28 A;  4XQN A;  1NBM A;  2QCP X;  5EPJ A;  1PRT D;  3ZPN A;  2JP1 A;  2ZXO A;  4DK1 A;  3PUZ A;  1S5F D;  3S1Q B;  3PO2 B;  4U68 A;  1U4P A;  4Z1M A;  3DMU A;  3HGB A;  5IT9 L;  2F0F A;  1UD3 A;  1X32 A;  2ZZF A;  2E2J B;  2F0T A;  4B3F X;  5COY A;  1U9R A;  2L4N A;  1B2T A;  3SK8 A;  1OXS C;  5G3L F;  2R9V A;  4XL9 A;  1SDF A;  4ZK9 B;  2EJG C;  2PZU A;  4XOT A;  1UNS A;  5I9O A;  1T5X D;  1I4Q A;  2NTT A;  3PMF A;  1TS4 A;  4G7Z C;  2XGJ A;  1H9S A;  1XWE A;  4DNR B;  1LT3 D;  1H8E A;  1DYQ A;  2F0N A;  3LNN A;  5HGT A;  4KD3 A;  5I6Y A;  4WOR A;  4FXU A;  1HCZ A;  3R2I A;  3P20 A;  2R3Z A;  3S1R B;  2K03 A;  5FK9 C;  3OIP A;  2ICI A;  4HMJ A;  1EQV A;  2KUM A;  1W6J A;  2A6E D;  3GVJ A;  2ZXH A;  4RKL A;  2N88 A;  2Q8T A;  5C44 B;  1QNU A;  1VF5 C;  1I3Q B;  2F0L A;  1M4V A;  5C4X B;  5CV5 A;  4PV1 C;  3D6C A;  3K5M A;  1EY6 A;  2VJI A;  1H8H A;  3N6R A;  4A3M B;  2N55 A;  2B2Y C;  1HTP A;  1BDO A;  1SKY B;  5JEA H;  4OIK A;  1I8D A;  3BZD B;  3J80 E;  4XTC S;  3NQI A;  4HN7 A;  3SK4 A;  3L7Z C;  3FKS A;  5EGT A;  4XYO A;  3ERQ A;  5IOD A;  1HA5 A;  3CP8 A;  1EY8 A;  4C3I B;  3JAM E;  2M9V A;  4IFD I;  2CHB D;  1RHP A;  3TP8 A;  3OWE B;  3NHH A;  2NN6 I;  4II2 A;  1TY2 A;  3D6W A;  5DN6 A;  3U9S A;  5T1G A;  1U4L A;  1B9M A;  1S4Z A;  4L6T B;  3BH4 A;  2C9O A;  5DNF A;  4UAI A;  2GJP A;  1SJE D;  5HUR A;  3S9W A;  4XMY A;  1DOL A;  2F0U A;  2K6A A;  5KGU A;  2ZZE A;  3D4R A;  4TSF A;  4HMI A;  5IOC A;  3QIA A;  3GTJ B;  2K5W A;  3T53 B;  1I4X A;  2DNE A;  3BG3 A;  2EPB A;  1DCZ A;  4EGV A;  3W2D A;  3CU7 A;  4QF4 A;  1PXU A;  2AQ2 B;  1PZJ D;  3GP7 A;  5JVG 3;  1WTO A;  3TP7 A;  3CP2 A;  1LTA D;  2CW0 D;  3FKI B;  1B53 A;  5C3X A;  4M1U B;  1SND A;  4XQF A;  3VYT A;  3VA7 A;  4C3H G;  2XN9 C;  1SBB B;  5C6A A;  1RCV D;  3I72 A;  4NNJ A;  1MGS A;  3OIQ A;  1LV9 A;  1CTM A;  1W0K A;  1IYV A;  2EYO A;  5CBA E;  3D3R A;  1NCV A;  5I2Y A;  3M3Y B;  2G9H D;  2KCN A;  2RA4 A;  1GUG A;  4YEJ A;  1RTO A;  2B2W A;  3P1H A;  3C2P A;  1F2L A;  1AN8 A;  2X53 S;  2O5I C;  1V0F A;  2E75 C;  2B8G A;  1KLU D;  4RGN A;  3OWF A;  1EQT A;  2XRS D;  3KUP A;  4JBW A;  5I4D A;  4H13 C;  5KRU A;  3M4O B;  4DGZ A;  1I18 A;  5BN5 A;  2JA8 B;  2JA6 B;  4XLH A;  1ICW A;  2F3W A;  2J0T D;  1TWC B;  5EKK A;  2WJV A;  1EFI D;  4K8J A;  1PZK D;  2A68 D;  1E3X A;  1EWH A;  3H09 A;  2WKC A;  2J7Z A;  4X3K A;  3K57 A;  1UD2 A;  5C3W A;  5JEA G;  2A69 C;  5DM7 3;  3O13 A;  3KBX A;  4AYB B;  5CBE E;  4WJW A;  3MEH A;  3T16 A;  1GHK A;  3SDZ A;  3J7A F;  2EDG A;  1UAP A;  1HFG A;  1GHJ A;  5KND A;  3Q23 A;  1DOM A;  3IFD A;  3J7Y W;  1ET9 A;  2X6W A;  3K5N A;  4F88 A;  4RWS C;  1GXD C;  1TQO A;  1SYB A;  5KYI A;  1WD0 A;  3VR6 A;  2A73 B;  4S3S A;  3HOW B;  3DXJ C;  3EQL C;  1WTR A;  1F9Q A;  4XOR A;  5C0X G;  2HCC A;  1C4Q A;  1JOQ A;  2VJJ A;  1ZYR D;  3HOU B;  5K36 G;  1ENF A;  1PFM A;  5HKK A;  1O7Y A;  1ESF A;  1AP0 A;  3S17 B;  4DNT B;  1UD5 A;  5J39 A;  3PIO 3;  4BY7 B;  2KOL A;  3A54 A;  5EBC A;  1PYW D;  2A6H C;  5CC4 A;  2Z4H A;  5NUC A;  4CHT B;  3D31 A;  3DHQ A;  1QE6 A;  2VB2 X;  2MP1 A;  4PQX A;  1ENC A;  3I70 A;  2GJK A;  4BA2 I;  3IL8 A;  4KI0 A;  1RDP D;  4ZUI A;  2IW3 A;  3WOE A;  1VMP A;  2KVO A;  4E0F A;  3HP3 A;  1STB A;  1WTX A;  4Q0F A;  1TWA B;  1IYU A;  1CA6 A;  4B9W A;  1CZW A;  1KTK A;  2JIZ A;  3VYS A;  4TQU S;  4DAP A;  1MD2 D;  1CM9 A;  1Z47 A;  4HR7 B;  4RHR A;  1EIH A;  2ZZG A;  3MXG A;  1B44 D;  1U4R A;  4K5V A;  5KNC A;  2KJX A;  1EU3 A;  2FIN B;  1D1I A;  1HUN A;  2K32 A;  4KKU A;  2D5D A;  2K7V A;  2RBM A;  1MSG A;  1O80 A;  2B39 A;  4HSP A;  2WZP P;  3A3B A;  2F0J A;  5CDF A;  3CES A;  1H9J A;  1HQM C;  4HTH A;  1JOK A;  3PV0 A;  5DEH A;  1CI3 M;  1H9K A;  2NN6 G;  2NZ1 D;  4DA2 A;  2K5D A;  3IKJ A;  2B63 B;  3HOZ B;  4MIU A;  5CV9 A;  2RSN A;  4FF1 A;  1AZQ A;  2L1B A;  4P2C B;  2XZP A;  4XNF A;  3QOL A;  3M4Y A;  1D6E C;  4TSS A;  5JEA J;  1KDB A;  2PO4 A;  1SNO A;  1CHQ D;  1LLR D;  3H3V C;  2X6X A;  3HRZ C;  2SDF A;  1SYG A;  3BVZ A;  5COR A;  2EZV A;  3DWP A;  3EFX D;  3QG1 A;  1EY5 A;  1JE4 A;  3PO3 B;  2XWJ B;  3HOX B;  1PRT C;  3H6M A;  1EY9 A;  3KLR A;  1YNN C;  4A3F B;  2CVR A;  1DM0 B;  3ONA B;  4IUT A;  1C48 A;  4NDX A;  2TSS A;  2F0G A;  1I4P A;  4FXK C;  1O7L A;  1OXV A;  3OW7 A;  4YIJ A;  2V4D A;  4NW2 A;  4IN3 A;  3DDY A;  4KN7 C;  2XRQ D;  3V96 A;  4BBR B;  4Q5V A;  4FO2 A;  2ZZQ A;  2PW7 A;  4XDX A;  1JC7 A;  2NVY B;  5C4Z A;  5IGF A;  2QE7 A;  5G3L D;  1KNE A;  2NN6 H;  3QWN A;  4XLF A;  4R8N A;  2B2V C;  3MZ5 A;  4ME5 A;  2KA7 A;  2BDN A;  5ELC A;  1W0J A;  5CGK A;  3I4N B;  2A6E C;  5EKL A;  2WB1 B;  2PQE A;  2RQX A;  2XZL A;  3VR3 A;  3Q6S A;  3ND9 A;  2FJ2 A;  2FMC A;  2X6Y A;  4XXE A;  2D9U A;  2ID0 A;  1I4R A;  1DZ1 A;  1B9N A;  4H44 C;  2PYK A;  1H9S B;  4LJZ C;  3Q24 A;  4QCL A;  2KEE A;  2B2W C;  2K5Q A;  5I2X A;  2RVL A;  2YU9 B;  2V31 A;  2VUM B;  3AMU A;  1QB5 D;  5FL7 A;  5C4J B;  2OEO A;  4EQP A;  2QF7 A;  5K5P A;  1QIL A;  4IUR A;  4IZ8 A;  3WQZ A;  1HFN A;  4WFN 3;  4BS9 A;  1GUN A;  1OXT A;  1VMC A;  1SXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...