3H94A

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 39
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3h94A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h94A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3h94A01
1HTPA 2EJFC 2K7VA 2NN6I 3VR4A 1DCZA 4HR7B 4KN7C 4PV1C 3PUXA 3RLFA 3FMCA 2B8FA 2F1MA 2DNCA 2V4DA 1H9KA 3TZUA 5C0XH 1IW7C 2EJGC 2AWOA 3D4RA 1CFMA 1HPCA 1YNNC 1GUNA 3CRLC 4G7OC 2NN6G 4IQZA 4DNTB 4KN4C 1A6XA 1B9NA 3QIAA 3EQLC 4H0LC 4KMUC 1IYUA 1Y8PB 2BA0A 1B9MA 1O7LA 2LMCB 3D31A 1QJOA 3PUYA 1Q90A 3PV0A 5BN5A 2K32A 3CRKC 3I72A 1OXXK 1H9JA 4KKTA 1Z7TA 2BE5D 1BDOA 2ZT9C 2DN8A 3MXUA 1HCZA 1FR3A 1Q12A 3ND8A 4RCNA 1GHKA 1DD2A 1VCIA 3QG1A 2A6HC 5JEAH 2D5DA 4L8JA 3T51B 2EDGA 4TKOB 2PCFB 2QF7A 1OXVA 3PUZA 4G7ZC 5C0XG 1IYVA 1K8OA 2BDOA 3VR6A 3LNNA 2AUKA 2BA1A 5BN4A 3T56B 3FPPA 2E76C 3VR2A 1VF5C 3SDZA 1H9RA 2CW0C 1O78A 1Q1EA 2K33A 5A35A 1H9SA 3PUVA 4H13C 3A8KE 4KKSA 1H9SB 1Q1BA 1TKWB 2E75C 2JEBI 2D2CC 3QJYA 3M4YA 4XIGS 1I6VC 3M85A 2DNEA 3L7ZC 4IFDH 4XTCS 2A68D 1Y8NB 2A69D 1FYCA 3IKJA 2D62A 3IFTA 4KHZA 2O5IC 1OXSC 1TU2B 3WDNA 3VR5A 3BG3A 5JEAG 4GZYC 2L5TA 2PNRC 1DXMA 1H9MA 3LWUA 3GQBA 5KNCA 1CI3M 5KNBA 1E2ZA 4BA1I 3HGBA 2JE6I 1Y69U 4H44C 2A6EC 1VF7A 1IW7D 4I7ZC 1CTMA 1ZKOA 1PMRA 1Y8OB 3A8JE 5BN3A 3PUWA 2IT1A 1EWHA 3AB9A 3N6RA 2PPBC 2Q8IB 3BDOA 3OPOA 4DNRB 2BE5C 4JK1C 3OW7A 3ND9A 4KI0A 4IFDG 2AUJD 2R6GA 4OO1G 3H94A 1VDZA 4LK1C 5K36G 1E2WA 2JEAI 4OO1H 3I4LA 3W3AA 1OXUA 5K36H 3NE5B 1GUOA 1YNJC 4DK0A 3P20A 1LABA 4BA2I 1Z6HA 1K8MA 1GHJA 2EVBA 4JBWA 3GD7A 3VR3A 3A8IE 1ONLA 1LACA 4LJZC 1HQMC 2B8GA 2KCCA 3SE0A 3DXJC 3MFYA 4TQUS 3KLRA 2JXMB 2A6HD 3VA7A 1OXTA 5KNDA 3OOCA 2O5JC 3A7AB 3A7LA 1GUGA 1T5EA 1V8QA 2YYZA 1SMYC 1GUTA 2NN6H 4OGQC 3U9SA 2A6ED 2A68C 2EJMA 1V43A 1GUSA 2A69C 1G291 4G7HC 4KKUA 1GJXA 1ZYRC 3I73A 3T53B 1E2VA 2KA7A 4DK1A 3M7NA 2E74C
chains in the Genus database with same CATH superfamily
3A35A 2B2VC 2EJFC 5LL6X 3VYSA 3HOWB 4DV4Q 3CPFA 1TS4A 2DNCA 4HIMA 3BYYB 1H9KA 3GP7A 1SEBD 4DR5L 3S15B 3WOFA 4IUVA 1SYFA 4MTNA 4XLCA 2E2IB 4X7EA 3H6MA 2QDLA 3I2ZA 2YTYA 5DEHA 3T13A 4JI4L 3S1QH 4YY3L 1U4RA 4L63B 2LS01 3BC9A 2JA7H 4IALA 3GVLA 4KHVA 3ASSA 4KTAA 3AVVA 4C56C 4PAAA 4P6YA 2PO4A 5T1IA 5GAEC 1SYGA 3PO3H 2WV6D 4OX9Q 4BPRA 3FVQA 4O1NA 4AC9A 5KEEA 2QGGA 2VNUD 4WZKA 1VQBA 3H15A 3PIPA 3TS0A 2ZTNA 1VQ9B 1XXGA 3NELA 5IE8A 3HOVH 2X69A 1UAPA 2BA1A 4AYBE 3HKZB 3NTHA 2MO1A 3VR2A 5DAUA 2UXCQ 1PVOA 5C4ZA 5THXA 2ZL7A 2CW0C 1S5FD 5GV7A 1TT2A 5CGKA 5KYIA 1SE4A 4RAUC 3CCMB 3QR8A 4H9GA 4OPOA 3TN2A 2GJKA 5I6YA 4LC0A 5GAHC 2QILA 1QNUA 5E4XA 2K52A 1BX1A 3KBXA 4C0SA 1M90D 4DV2L 4QF4A 3EFXD 4KK7A 1VQKA 3GTGH 2JA9A 1LT5D 1OXSC 3JAML 2Z9HA 4C3IB 4LBWA 4XT1B 3FKIB 5FO9B 5JEAG 2YU9B 4FYDA 3BYTB 3GV6A 2GK7A 1UD4A 4JBKA 4J0QA 1B7YB 2DUDA 2J4XA 3I90A 1JNYA 1VQ5B 4EQPA 3I55A 4A3JB 3AQQA 3WNBA 4J15A 3HOXG 1IW7D 1KABA 1BCPC 1A8PA 1DZ1A 2L9HA 2MJ8A 1FNBA 2EYLA 1Q81D 1HXYD 4IJLA 3K5LA 1IBKL 1LT3D 4HE6A 2C4UA 2JA5B 1HR0Q 3W3AA 5ELNA 1DGSA 1YNJC 3IFDA 2KJXA 1B70B 2OWOA 1K8MA 1EY0A 2KHJA 3G05A 1QVFB 1CQXA 2KCCA 2L15A 3TP8A 1KAAA 3W5VA 1MBYA 2RVLA 3R2IA 5M5YH 1EFWA 1QUEA 4AF6A 3CCQA 3K58A 3CCEA 1M1KD 3CW2C 3SEBA 1YLOA 3GTPB 4ZK9B 1LTBD 4LMQD 2L1BA 3NWTA 4R8IA 2CCZA 2PE3A 4RHRA 1E3XA 2VBVA 1R5OA 4XM3A 1SNCA 1KDBA 5IP9H 1HR0W 4XN0A 1N8RC 4BBSG 4N9PA 1EYCA 1BQEA 1UE6A 2ZL5A 3HKSA 4QB4A 4B3MQ 2F0GA 4HMJA 1GUNA 3TEHB 3CRLC 1B3QA 1L0YB 5IGCA 4XLAA 4BS9A 4IPCA 3PO2B 3C2QA 1E3ZA 3SGIA 5M5XH 5JJIA 1N07A 3PV0A 1VJSA 4JI6L 3J80L 3F2DA 4RD3A 3SHLA 3ND8A 2H1EA 3A0JA 3C46A 4RDJA 2A73B 3SJZA 2QE7A 2F52A 4HJ9A 2D5DA 4XXEA 1VQ9A 2UUBQ 1VQHA 4ROXA 2DY1A 4U9UA 4Z4ZA 1IJFA 3NPPA 2PLFA 3TP7A 4HJ8A 3KLSA 1DARA 3CU7A 1JE4A 4IPGA 1BO0A 1D8LA 3W2GA 4I7AA 1O7YA 3CCMA 1TWGB 1H9SB 1XWEA 4M8AA 4B3SQ 2K6AA 3SK5A 2VB2X 3M4YA 3EA6A 4UP7A 3K0YA 2WZPP 3LO8A 1STYA 5I6WA 2DJFC 1QFJA 4PMCA 1TWCB 2R93H 2LXJA 4FNFA 4ME3A 3GTLB 4HIOA 5E7NA 3WDNA 1WU8A 4YEJA 1PRTB 2HIXA 1E43A 1FGBD 2NVQH 3RN2A 1DXMA 4ODGA 1TS5A 2EIFA 2VZLA 1CQFA 3A3GA 2F4IA 2Z6KA 1E2ZA 1M8AA 1VQ5A 4PABA 2A74C 2YWGA 4ACAA 2OF1A 4Z1MA 1JB7A 3GTKB 4G6IA 2K05A 1LM0A 3W5UA 1RQPA 2BV3A 1K8AC 1ZKOA 1NBWA 1WDTA 1CKOA 2E5LQ 3H3VH 3PUWA 3PIO3 3HOXB 4RD2A 1N36Q 1U4MA 2IJ0A 2BE5C 2CK3A 4FO2A 1RTOA 1L0WA 3A3BA 4IFDG 5EBDA 3I4LA 3OTOQ 2PZTA 2E2HB 1FX0A 1Z6HA 5FLMG 2X6YA 1QVFA 1LACA 1NB9A 1GAWA 2B2WC 3P1HA 1PRTF 4BBRH 1DDGA 1HA3A 4HMIA 1R5BA 1AW7A 2RCNA 1IBLQ 4A3IB 1VHEA 1RDPD 2B2TA 4GN4B 3U50C 1X9NA 3AEVA 4M1KA 3RNUA 1EL0A 1S5CD 3F2BA 4GKJL 1QVGB 3ZBTA 3CXCB 3E9IA 3CMEB 4O2DA 1D1IA 2YWHA 3A5UA 1IZ6A 2K5DA 2EYFA 4II3A 3AGQA 2MNAA 3ASRA 1WCMG 4DR4L 4CDDC 4QJFA 2E74C 1JR0D 2VS1A 4XN3A 4J6HA 2NN6I 1G91A 2NVTH 1U0LA 3PQIA 4DU9A 4A3MG 1PTOB 4DQLA 1FNUA 2HCCA 4DAVA 3S1MH 1RODA 3G6JB 4BBSB 1EQVA 1EP3B 3HOUB 1E0BA 5C3EB 3NQTA 3K8AA 4GKKQ 2VUMH 2QA4B 4RWSC 3K81C 4P3YA 4QMGA 1N08A 1EY4A 1I94L 1GR1A 1PFMA 1WVLA 1Y8PB 1S0UA 5EAYA 3HOYG 4XYOA 3S2HB 4WQMA 4A3KG 1JMCA 1OXXK 2WYRA 5ELFA 1I5FA 1ZXTA 3RZDB 4A3CG 2NZOA 4R4CA 1EIGA 2A6HC 1O80A 4JBMA 1TTTA 2BDOA 2FHTA 4HCSA 4DV4L 2VQEQ 1UD8A 2OK7A 2ZTEA 4K6LA 5JAVA 4UDUC 3J7A5 4OP7A 1H9SA 4H13C 1HRJA 3RY8A 2XVSA 4XR6A 4FWTA 5IYCG 4X65Q 3CHBD 3VNVA 4HSVA 3E0EA 5NUCA 1NJID 1AMOA 4LF4Q 4XNFA 1F2ZA 1UE5A 3E5SA 2A69D 4LF5Q 4XMYA 2ZXOA 1HA6A 1J9OA 1TLLA 1JICA 1IL8A 4WZTA 3TMEA 2DERA 2CC2A 4OPVA 4DAPA 3AVUA 2QW7A 3FJOA 4JV5Q 1Q82C 5DM73 3LWUA 2GPJA 4OOSA 1HZBA 3E6ZX 3A8IA 4R1JA 4OX9L 4IJHA 4OELB 1K9MC 1OHHA 1ICFB 1Q86D 5A8AA 3T16A 5DLQE 1SFOB 1AZPA 2X53S 4DK6C 2JP1A 5FL7A 5E4WC 3J81L 5IYBH 2V31A 1EY7A 1VQPB 2UXCL 5C6AA 3A74A 1HJPA 2ZXIA 4JK1C 1PHJA 2JA6G 4RCOA 4IUUA 4DV7L 2AQ2B 2JEAI 2CRVA 1QVCA 3NE5B 4O0AA 1FVIA 1LABA 4BA2I 1VQEA 1GO3E 3J80i 2XNJA 3V7AA 1VQ6B 1TQOA 3P7JA 4DK3C 2DGYA 4P72A 1WTHA 4ZCIA 2XOKA 5AJ3Q 1WSRA 1Y0YA 1QVGA 3CXCA 1K28A 2YYZA 3CMEA 2JJ1A 2O2LD 1AE2A 2J7ZA 5GV8A 1V5VA 1D5XC 1WOSA 2A6ED 3U9SA 3URYA 1JJ2B 2PMDA 3J7YW 2EZVA 2CQAA 3D0FA 1ZYRC 2SNMA 1E2VA 5A89A 1G51A 1PRTD 1BOSA 4QIWE 3QB3A 2X85A 1WCMB 1W0JA 2OT2A 4YHHQ 3VR4A 5F2DA 1KLUD 2AQ1B 2L0CA 2R3ZA 5C44H 1HR0L 2B8FA 2EFGA 2JK8A 3H0GG 1XMQQ 2QA4A 2A8VA 3P75A 5M5WB 4LBYA 1PFBA 1UWVA 2HDLA 4Y7NB 2F0MA 2BM1A 1KDCA 4WRDA 2PYKA 3CPXA 4ASUA 2FMCA 1UE1A 1CQVA 1VQ8B 3NSWA 5C4XH 4IUQA 2NBFA 1HUMA 5ELBA 1XPUA 1B3AA 5AN9A 1IHMA 5BN5A 5LL6S 3PA1A 1VQNB 3I72A 3JQQA 1TXYA 1X3EA 5FKAC 1E1QA 4X7FA 1W3SA 3HOYB 2PMZB 5IP7G 4A3KB 4NCNA 2Z8LA 4JCVE 2NVYB 1GOZA 4JI2Q 2KUMA 2PCFB 5L37A 2F3WA 5C0XG 1SNDA 2NZHA 3CD6B 4ZUJA 5FO1A 4PNYA 2BCOA 1K28D 3FPPA 3CCRB 2E76C 1VQJA 5KIXA 1HHVA 3I91A 5A35A 5CBAE 3L2PA 1I50H 5HY6A 2VQFQ 3BH4A 3S9WA 4LNQA 4LFBQ 3ES9A 5FJ8G 1UE7A 4CGYB 4TT3A 1YVCA 3UE1A 1KK1A 4B3ML 2WACA 3M85A 1KK0A 1PTOD 1B1ZA 1O7ZA 2OK8A 3IFTA 3KBGA 1IL2A 1T5XD 4Q5VA 4A3BH 2BF4A 2X6GA 1VQCA 5CV7A 2R92G 4N9TA 2F0DA 2UUBL 2A6EC 3OJWA 3H9NA 3G48A 5ELDA 5EQ0A 5LMUQ 1N9WA 1STEA 4G7XA 2K50A 3A8JE 1VQPA 4B3TQ 3RLNA 2R7ZH 4TMZA 1YNND 5GROA 3ZUGA 1WD1A 1NDHA 2K04A 2MQHA 1B50A 2EY6A 3MHPA 2ICEC 2EXZA 1MABA 4B3SL 2JA6B 3HOWH 4IO9A 1EWYA 2F4NA 1BCPB 2AQ3B 4A3EG 1L1OC 5LHY1 4NMZA 2HT1A 1S4ZA 4KV6A 3RN5A 1EYDA 3HG9A 1TIID 1VQ6A 3S15H 1QZGA 4DA2A 1PYWD 1N34Q 3M4OB 4XKVA 1VQGA 2K1BA 4TMTA 1SNPA 3OW2B 2D74A 1PH6A 2E2IH 1EIHA 1HA5A 2XSCA 2MUYA 2D9UA 3S14B 4K2KA 1K73D 1JJ2A 2VB3X 4YCVA 1X56A 1LTAD 1V43A 1G7TA 4LUVA 4RKLA 3CQZB 5L46A 1G6ZA 3BDCA 4AVZA 3A54A 2ENBA 2GN5A 3NTKA 2E5LL 4OIKA 1VQMB 1N0VC 1Y1WB 2CWPA 1N36L 3Q39A 1STBA 2E1BA 4AF7A 1A3TA 2ALYB 3OTOL 3VA5A 2B2VA 1YNXA 4UY8C 3QOJA 4RG1A 3D4RA 4Z4WA 2RDFA 1IBLL 4G7OC 4DNIA 4IUTA 5D3DA 2X3UA 2NB0A 2IWHA 1VQ8A 3ITPA 3QIAA 3MWYW 1Q9SA 1TS3A 1QE6A 3J81i 1VQNA 5EPJA 3GTOB 4LUOA 1E62A 3DWQA 1ICWA 5C5LA 4C3IH 2IX1A 3FKIH 2A19A 2YU9H 1GHKA 5LMZA 2N49A 1V1PB 4TKOB 3GVJA 4RGOS 3CD6A 1EZ6A 1EU3A 1D5MC 1WTWA 3CCRA 4FK8A 1PKVA 4YAWA 4A3JH 4G5GA 3SEJA 1RD9D 2HUGA 1BBUA 2I5LX 3PUVA 3Q6QA 1NE3A 5IYNA 4GKKL 3TP5A 2JIZA 5TV2A 1EY9A 2E1RA 1Q7YD 4XIGS 1KD1C 2JA5H 4UP9A 1MRZA 1EWIA 1Y8NB 1FYCA 2JSOA 1SKQA 4DR6Q 1S5DD 4NBSA 2D62A 1ILPA 2F0QA 2DY7A 1I3QB 4KD3A 4K0KQ 3I8ZA 2D9RA 1VLYA 4H02A 1H9MA 2IPKD 1PH3A 2B2UC 1Q46A 1RCVD 5CV8A 1J9ZA 1UMKA 5C3WA 5B6IA 3GTPH 1N06A 4DR2Q 3A1PA 2HHHQ 2VQEL 2RKSA 1H8EA 3AB9A 3CF5A 2KEEA 4DNRB 3AVTA 2B63G 4DR3Q 4X65L 4OO1H 4UZFA 1OXUA 4A76A 4LF4L 4A3EB 3J7AF 4LF5L 3PMFA 3DXJC 4C3HG 2A1AA 2XNDA 5EPLA 4JBJA 2TSSA 3OW2A 4KHPQ 3CC2B 3OOCA 2K5WA 1MGSA 4ZRZA 4JV5L 1ENAA 3OZUA 4PC7A 4HE5A 4PC3A 1NRKA 5EGTA 3PO2H 4LFAQ 1STGA 2CW0D 3OWEB 1G291 1LTGD 1GJXA 2K75A 2X6WA 3CW2A 2WB1G 1HZCA 1VQMA 3ICEA 1A2TA 1GO2A 4J1MA 4ZLTF 1STAA 2ZZGA 1CHPD 3OE7A 2V4DA 1CNFA 4NNJA 1LTRD 4XLFA 4LWCA 5M3MG 1E1RA 3NENA 4JC0A 3T1YQ 2WIIB 1TWGH 1F9RA 2YTVA 4GOPC 2XGTA 5IGEA 2Q6LA 4DNTB 4JI0Q 1N33Q 1QGZA 1PDQA 5AJ3L 1B9NA 2D0PA 3TQYA 3J7AV 1BCPD 5JJZA 1O7LA 4GQNA 1QILA 1TWCH 1TY0A 3AU7A 3SK6A 3GTLH 3CP2A 3BQJA 2DN8A 2L4NA 1JB9A 1AZQA 3SKBA 1I4HA 1V1PA 5JEAH 4HN7A 2Q8RE 3PUZA 1II3A 2EDGA 1YNJD 4G7ZC 1OXVA 4YHHL 1UEAB 3R6JA 1GVHA 2WAQG 3GTKH 1IXRA 3K59A 2W6IA 4RGNA 3S1RB 3I4MG 2ZBVA 1S4MA 1KTVA 4YAFA 3OYYA 3HOXH 4KJOA 3PUMA 1QB5D 3NTIA 1XMQL 3OEEA 2RF4A 4MTKA 5K5PA 3V76A 2K5QA 1CK1A 1GD7A 1FRNA 3CCVB 3C1EA 2KCTA 3Q3AA 1EXMA 2E2HH 3K5MA 4LF9Q 3ONUA 4P6VF 3CP0A 1UD5A 4UZUA 2V7WA 1F77A 2NTTA 1EUJA 2RQXA 4A3IH 5KGUA 5F4OA 1N8RD 1GM5A 5GAGC 2IL8A 1X3GA 2XTIA 1Y69U 3GTMB 2O4XA 4JI2L 4RD6A 1XX8A 2JA8B 1CUKA 4P74A 4EGVA 2FXQA 3MEHA 1LTSD 1MIUA 1B4OA 2I46A 2KOLA 3ISXA 3F2CA 3B78A 5CDFA 5TY0A 2VQFL 4LK1C 4X6AH 2B63B 1BX0A 2KHIA 1XTDA 2Z1CA 4LFCQ 3S16B 4LFBL 5K36H 2LY7A 3E9HA 4Z4YA 2XZPA 4B48A 1PTOH 3BCFA 4OPSA 1Z9FA 4N8FA 1WTRA 4R4TA 4LBVA 1MJEA 4WZLA 2Y0SG 4BBSH 3A8IE 3K57A 1ONLA 3I3CA 3M4QA 3HOUH 4K5WA 5C3EH 1XNQQ 1XJVA 1XYIA 1SLJA 4M53A 2CH4A 3CC2A 3EROA 4C3HB 2ZTDA 1DYQA 1EOTA 1GUGA 1W2BB 4JI1Q 2B2WA 1VQLB 3ULLA 1VS0A 1AEXA 1GUTA 4MZ9A 3D8GA 2VNIA 2V7UA 3S24A 2VNKA 4RPDA 1LYLA 4P9SA 3BJUA 3S2HH 2VBTA 1I4QA 1QX4A 3PF4A 4B3TL 1LUZA 3RZDH 4A3GB 2UXDQ 3MA2B 5FIUA 4F8MA 2F0SA 4DUYQ 1B2TA 4JI3Q 2WJYA 1TY2A 1EQRA 4PQXA 2ZZQA 1QZHA 3I4NG 3HZXA 3PVDA 3ER0A 2EYPA 4NW2A 1N32Q 1ET6A 1WFQA 1CFMA 5CC4A 3C1FA 4X7CA 4CJ1B 5M3MB 1N34L 2NN6G 2UUAQ 2JA7G 1A8VA 2R7FA 1KMHA 1SM4A 1BVSA 3UDGA 1A6XA 2OYNA 2ICIA 4EVOA 1K8AD 2VNJA 5IWAQ 2XGJA 1VHOA 2K32A 4CKEA 2BE5D 2ZTGA 1BDOA 1I8DA 4ZGQB 3KK7A 3MXUA 3HAGA 2CFMA 3QG1A 1CKNB 2H4OA 2OCEA 1KC8C 2ZXRA 3VDYA 4DF7A 4P2CB 4H7BA 1SFOH 2ES2A 2WAQB 2FINB 1WD0A 3J81k 3G6EB 2EY1A 3I4MB 1OGJA 2ZM6Q 1XE1A 1ASYA 3DM1A 3CCVA 4DV5Q 1TR5A 4IFDH 5JPMC 4QGUA 2N8NA 2I07B 4JG2A 5BR8Q 1ZM2A 1WTPA 1JJCB 1MI2A 2ZXHA 4X8IA 3MTSA 2ZJRA 1C8CA 2XRQD 2HDMA 4G1VA 3GQBA 5FO7B 1LTTD 1RL2A 1B2RA 4FF3A 5J1ZA 2JE6I 3QSYA 1VMPA 4P3IA 4DN4M 4DXFA 2ZJPA 4LF7Q 4V190 2G9HD 1EEID 1LO5D 4IW3B 1EWHA 2F0IA 4NB3A 3S17H 2C78A 1UEBA 1EFUA 3OJXA 1DM0B 2KVOA 2R6GA 4KY5A 2TMPA 1WCMH 2Z6BA 3Q22A 2KCNA 1EFTA 4GNXC 3RLOA 1HTLD 2C77A 3Q38A 3P20A 3S2DB 3FPKA 3TP6A 1GHJA 2WP8J 2XNAC 3QFSA 2C5HA 2B8GA 4YWLA 2Y0SB 2NPFA 4DR6L 2ZZEA 2IY5B 1G6PA 1A0IA 5M5WH 2F4VQ 5DNFA 3FDTA 4IUNA 2A6HD 5CORA 4K0KL 1JA1A 4Y7NH 4FP5D 2CF4A 3ULJA 4TMXA 1D7QA 1NSNS 3A7AB 3D4DA 1W2BA 1VQLA 1L1OB 4N8X1 2CHBD 1WYDA 2MFIA 1NNXA 2GREA 3MEFA 4KKUA 3AVXA 2RSOA 1MHWC 4R4QA 4DR2L 5IP9G 3HOYH 2HHHL 1Y0RA 1PA6A 4RM0A 4A3KH 4RCYA 3CCJB 1FL0A 1C9OA 4KN7C 2NVYH 1DOMA 4A3CH 3OAAA 4U68A 3RLFA 3WOEA 1KJZA 3W1BA 3SLDA 2P3MA 3UE0A 5ELCA 3QFTA 2FFKB 2KBNA 5EBCA 4PGOA 2KECA 4FXDA 3IAYA 1Q82D 2PW7A 5A2QE 1PYBA 1HPCA 1GVPA 3NP8A 1JA0A 1WI5A 1P16A 5FOBB 3ZIAA 1K3BC 4YAUA 1K9MD 3PIP3 4A3DG 4IQZA 1VQFA 3BZDB 1T6ZA 2F43A 4KN4C 5EPKA 4B47A 4DAMA 5G3LF 2Z6BD 4R9WA 4KHPL 1IYUA 1UD6A 2OXPA 2LMCB 3D31A 4DAYB 3V96A 2RHSB 3RR5A 4CBVA 4LFAL 1BJKA 4KKTA 3GV3A 4WZEA 2XRSD 2G5DA 1BF4A 5DSZA 1VQAA 1CKNA 3MMPA 4WWVA 1VCIA 3D6WA 3JQPA 4JMQA 1PH4A 3CMAB 2ASBA 5IGBA 3LNNA 3WQZA 2AUKA 3W2DA 3JAMi 1PJ6A 2YWFA 1SE3A 2IX0A 3KF8B 3G6EA 1H8HA 1L0XB 4A3FG 1F9QA 1XQBA 1AN8A 1ESFA 1JC7A 4P71A 3ASQA 4RH6A 5FA6A 3T1YL 1B8AA 1QGYA 4WORA 4OEMB 2CKZB 4GS3A 1FNCA 2PMZE 1F2YA 2JA6H 2VNHA 4RGTA 4DKAC 4JI0L 1N33L 4Z4UA 2R93G 1K83B 3BDLA 1ZYRD 3FPUB 1HZAA 1TU2B 1YHBA 3M9BA 3TRZA 3CCUB 4IPHA 5GADC 2MGSA 4CJ2C 3M4OH 1HZ9A 3RD4A 4C1NI 4XT3B 4E6IA 1CI3M 1DJRD 1KL9A 2V1CC 4XONA 1AP0A 1EYGA 3S14H 1KDAA 4DR1Q 4OONA 1FDRA 4WJ4A 4G1BA 3CQZH 1KQSB 4NKLA 4WJ3M 1SAPA 3H91A 1W6JA 4BY1G 1Y1WH 4ZQ3A 5I9PA 1GUOA 4XOTA 3OFNA 4XOPA 2VY3A 4Y9RA 3QWNA 1PZID 1DDIA 3KF6B 1X3PA 3FKSA 1HQMC 4C43A 2Q2HA 4TQUS 5AFWA 4LF9L 3KLRA 5HGQA 3K7UC 2E8GA 2XWBB 1L1OA 3A7LA 3STBC 4P2NA 1V8QA 4K1XA 1XPRA 4HIZA 2NYZD 5DN6A 1E7ZA 2ZXPA 2QEJC 3GTOH 3T53B 4Z4TA 4AQYQ 2RSNA 5CR3A 3CCJA 1D6EC 1R4PB 2PNHA 1TWAB 2J7KA 5IP7H 4TVAB 1IKLA 3FMCA 4LFCL 3QE2A 1FRQA 1OGIA 3U58A 1VMCA 2K5NA 5C0XH 2VUMG 4LUZA 3K0XA 2QTZA 3R6KA 2BSAA 2OTLB 1KRTA 4X3SA 2C2WA 1SE2A 1XNQL 4DV1Q 2RDHA 4HEDA 1YX2A 1CT1D 4A3DB 4E0FA 4DV6Q 2SDFA 4DAYA 4KY7A 2W6JA 4JI1L 4DV0Q 1TWHB 2C4TA 1KLGD 2EYJA 1JJGA 2BDNA 4C2MB 3S17B 3BZCA 1I3QH 1PZJD 4GOPB 2F03A 4NP5A 3CMAA 5M9OA 3HOZG 1K3RA 4PMBA 1JWMD 2VL6A 4A3MB 2UXDL 1A63A 1BKBA 1STHA 3ZJYC 3MXPA 3KF8A 4DUYL 2F3IA 1C0AA 4JI3L 1I4RA 5C4HA 1U4PA 3F2UA 4ILWA 2J0TD 4YCWA 4A3FB 4RCZA 3FRPB 5HGTA 3HP3A 1N32L 1KRSA 3CB4A 1I6VC 3ZBUA 4X62Q 1DONA 3L7ZC 3PENA 2UUAL 3T1HQ 1K0SA 4L6TB 3H09A 3U2QA 2P5ZX 4A3EH 5IWAL 3WWVA 3CCUA 1D1NA 1G7RA 4GZYC 4X07A 1D5ZC 2RA4A 1FJGQ 1NB0A 1ZM4A 1SN8A 2OBRA 3ONAB 2OQ0A 3QO2A 5EJWA 4B3XA 1KHIA 2WPDA 3HGBA 3IRBA 1PH5A 4FF2A 3D6CA 1HH2P 4O42A 1T6YA 1KZLA 4Z4SA 1JOOA 1PH8A 3Q6RA 5IYBG 5BN3A 2RBMA 1N0UA 3BY2A 3GIRA 5IYDH 4G4KA 2ZITA 5JOBA 1EIFA 1SDFA 4M2LA 2ZM6L 2QDXA 1I4XA 2CW5A 3QFRA 1IBMQ 2MHVA 1J8IA 2M00A 4BY1B 2YTXA 3H3VI 1QG0A 4ZYSA 4PMWA 1ASZA 4POGA 2XEXA 2EVBA 3KF6A 4DV5L 3CC7B 3WBKA 4YCUA 1F2LA 1YI2B 4ZCLA 4LJZC 1VQIA 3SE0A 3TREA 4DGZA 4HIKA 5BR8L 3Q24A 3SXHA 2I5HA 1OXTA 4CKBA 1MSGA 3VMFA 3GTJB 5IK2A 1YJWB 3SR1A 5LMNQ 4LF7L 2FVGA 3W5OA 3P26A 4JYAQ 1CZWA 2K7VA 1KD1D 2OBTA 1EU4A 5ELOA 3N52A 1W87A 1TWFB 3TSSA 1PZKD 5M3FG 1YITB 1K8GA 2BH2A 1BPLA 3TZUA 5GQOA 3S1RH 2CQOA 3WXMA 4B4DA 2OTLA 4YALA 2EPBA 2KENA 3CKIB 2AKWB 5IGFA 3HEJA 2F4VL 1RHPA 3A56A 2HLDA 2B7CA 5J35A 3BU2A 2F0OA 4Z9CB 1EQQA 3BNWA 1I4GA 4A3LG 1QFYA 5CV5A 4GOPA 1M4VA 2BGIA 4OWTB 2R7DA 4XD7A 3W2HA 4YXWA 1EY8A 1Z7TA 3IL8A 2F0LA 4HJAA 1DD2A 4A93G 2KCMA 1RQRA 3NK9A 3K5NA 3HRZC 4B3FX 3Q6SA 3HOZB 3BVGA 1BQQT 1EIYB 3GTMH 3CCLB 1Y1VG 3H0GB 4OOVA 5HKKA 2DCUA 2JA8H 1W0KA 1FD7D 2M5SA 1RTNA 1UUPA 4B3RQ 2B2YC 1TKWB 4BXXG 3QJYA 3U4VA 1I4PA 4EH1A 3M3YB 1A2UA 2B63H 1MSHA 3S16H 1RF2D 1W6KA 3OSOA 2AMCB 4FXUA 4II2A 1DOKA 4HIDA 4A3BG 3CESA 1NR2A 5I9OA 3P27A 3OIQA 3UI2A 4XLHA 4X7DA 1NAPA 4C3HH 1TS2A 3JU4A 4GN3B 2WFWA 2IX3A 1WTOA 2JJQA 5FNZA 1PMRA 1Y8OB 5D14A 1EEFD 4XQQA 4P22A 2C5CA 5F4JA 2Q8IB 3OPOA 1LT4D 4TSSA 5C5MA 4BWGB 3SK8A 1NTGA 1JOKA 1X3FA 1VDZA 3HOWG 4ZUIA 4A3GH 1I7PA 4NDXA 3BS1A 2A5HA 3MHBA 1CKMA 2VJJA 3CC7A 4JBWA 1YI2A 1EFCA 3HKZE 4K5VA 5IODA 3GTQB 5FO8B 1GKHA 3AVWA 5M3MH 4GNXB 2R92B 3NHHA 5J3BA 3DM3A 4OHJA 4X0CA 2F1LA 1SMYC 5A88A 1YJWA 4XLEA 3R93A 4QCLA 2A68C 2HQEA 1Z47A 1X6OA 4UP8A 1PH9A 1KNEA 4Y52H 1SJHD 2L11A 3M7NA 4DR1L 5H1SE 3CP8A 2SNSA 3ZZUA 4KLKA 1EQTA 4PV1C 3EVQA 3PUXA 4RKBA 3S1NB 1YITA 4BY7G 3LVBA 1EZ8A 1AE3A 4JPBW 3SK4A 1R9TB 2WINB 1MKHA 1G8ZD 5M3FB 2Z0SA 5H5JA 2AWOA 2CH4W 1BXTA 1LLRD 3I4MH 1SJED 2RC6A 2X0KA 4JW0A 3LGJA 4OWXB 3ERQA 2R9VA 2F0VA 3RMHA 2BA0A 4B9XA 2H5XA 5F4MA 1Q90A 1T6XA 3Q23A 5A2QL 2WKDA 3AFQA 3CRKC 2EOTA 1H9JA 1SROA 1V0FA 4C3JG 1G7SA 3K7AB 3E20A 1NUCA 1SRUA 3U9OA 4AQYL 2N3SA 3PA2A 1LV9A 3E1YE 4F87A 1NR4A 4A3JG 4A93B 4QQBX 3CCLA 1NMGA 3W1GA 3ZZ0A 1Y1VB 4CDEC 4IURA 4UHVA 1V1OA 2K5VA 2E75C 3I4NB 3A5ZB 2EIXA 2JA5G 3ZZTA 4QUCA 1FNDA 4HSPA 1PFNA 1B53A 2QDBA 4ZV4A 4DV1L 4RDLA 2DOGA 4KJNA 4EQOA 3S2DH 3NBIA 4KHZA 4DV6L 2O5IC 1G2SA 2PI2A 3FP9A 4UPAA 2XIWA 3VR5A 4DV0L 5JPNC 1VQ4B 2DIEA 3MZ5A 2QKIC 1IB0A 2WAQE 5BSXA 4L5SA 2EY2A 4LF6Q 3W5HA 4X3KA 4H44C 2LSSA 3V05A 1VF7A 4XQNA 4Y7CA 5IYQA 2ZJQA 3ASTA 4QVJA 1I6HB 4OL7A 4DR7Q 2R6HA 4KI0A 3ZYYX 4OO1G 1JOQA 3LQEA 3H94A 1EP2B 5E1FA 5I4DA 4A75A 1C48A 1HZEA 3A8KA 2C5BA 2PQEA 4X62L 5COYA 1V0EA 5TR9A 3T1HL 4G7WA 2MP1A 2XZOA 1P8LA 1SYEA 3PIOA 3H3VC 1EFRA 1UD2A 2F0WA 4GNXA 4ZCKA 4YWMA 3I4NH 1KC8D 1KK3A 1SNMA 1FJGL 3NUCA 3PO2G 2NN6H 4GN5A 2R61A 3PF5A 1NY4A 2OTJB 1E64A 3I73A 3CRZA 2EQSA 4X64Q 1S3OA 3NQIA 2Y0SE 1U2RA 1WP6A 4ZAIA 3O13A 2EYHA 1YJNB 1IBML 1TUIA 4V0BA 4BY7B 1ILQA 2GVBA 5CV4A 3ASPA 2QEXB 3QOLA 4JI5Q 3VYTA 4AYBG 1COWA 3FHWA 3BVZA 1CZGA 1VQDA 4DV7Q 1X55A 4RD0A 4ME5A 4POFA 1HUNA 3WBJA 3TBIB 4U673 5FLXE 3A8JA 1C4QA 4H0LC 1YIJB 2Q6IA 3ONYA 3M4PA 4F88A 1ELOA 3RZOB 4DFAA 4ZKCB 2NZ1D 3A55A 5LMUL 1K83H 2D0OA 1QWYA 3WYAA 2WKCA 2UXBQ 3GO5A 1T9HA 3Q8DA 4ULLA 2KVMA 2WB1B 1WORA 1XB2A 1A3UA 1ZEQX 1KIXA 1IKMA 5LMNL 4RHSA 2DJGC 2BH8A 4C3JB 4JYAL 4M0LA 5I2XA 2UUCQ 4IZ8A 1E1TA 4LW1A 1G2TA 4DV3Q 1S72B 2UU9Q 4MIUA 4NXNQ 2RDGA 2E2JB 1Q1BA 5E3FA 4R4OA 5CV6A 1KK2A 3B82A 3MCAA 2JEBI 2ATWA 1YJ9B 3GSIA 4RDKA 2WZNA 3UDFA 2LKVA 3MC0B 3PO3G 5EKLA 4YWKA 1GXDC 2B39A 1S40A 1VQ4A 2F0EA 2BVNA 2K5HA 3BG3A 1ML0D 1H85A 1ESRA 3R2TA 3R8BA 4A3IG 1OTCA 1BNZA 1F9PA 5C3XA 3HOVG 1H42A 4CHTB 2HD3A 5IYRA 1WTQA 1A15A 2AWNA 2PW5A 2V7VA 4RLZA 4JI7Q 1VQ7B 5TRDA 4DUZQ 1YHAA 2IT1A 1QG7A 1TVXA 2LXKA 3PUNA 1H95A 3CCSB 3VNUA 3OWFA 5IGDA 3AGPA 5K36G 4HAEA 4B3RL 1BR9A 4K5XA 1TWAH 4P75A 3T4AC 1QFZA 5HXBA 1PLFA 1SYDA 4OXPA 5I2YA 1JORA 3HOUG 4PC1A 5FLMH 5C3EG 1FNMA 2BGJA 4YAOA 2F3VA 3J81c 4GLVB 3V2TA 2GQFA 4JOIC 4OO1I 5JEAJ 3CC4B 3EBEA 3OKXA 5FO0A 3OHXC 4UAIA 2HMAA 1JB3A 1JCKB 1SSOA 3R3OA 5C4JB 3OZWA 4A3DH 4OGQC 4N3GA 1M90C 1EY5A 2OTJA 1TWHH 1CSPA 1V9PA 2I5MX 1G7CA 4P73A 4C2MH 1E1OA 4DK1A 2VJIA 4EX5A 4XL9A 2B5OA 4X3UA 1U9RA 4HR7B 1YJNA 2BPOA 3NBHB 1X3QA 2YV5A 4R4IA 2JQOA 3NWSA 4A3MH 3KJOA 2PZUA 4A4IA 4PZ8A 2QEXA 1IW7C 1PFSA 3ZPNA 2DY8A 2BMWA 3VO1A 4WJWA 1HFGA 2YWEA 4A3FH 2GJRA 4RPBA 1ENFA 4AYBB 1Q81C 2Q6OA 4CDFC 1GAQA 1YIJA 1WPCA 3WNCA 1E79A 4RD1A 2NVXB 2VBUA 5HZAA 4L5RC 1PH2A 1S5BD 5CYUA 2KQ3A 3FEWX 3I70A 2F0TA 4RCNA 4XYQA 1NBMA 4CJ0B 1HNWQ 4DR3L 4L8JA 3VO2A 3DEOA 3L3OC 1XFOA 1M1KC 4S3SA 1S72A 1EY6A 2BM0A 3VR6A 4MN3A 4R8NA 5DM63 4MHEA 2EXDA 2D3LA 5KW9A 5IT9E 4UAJA 4DXGA 4APVA 3F1ZA 3S1QB 2F0JA 1QH0A 4KKSA 1QOHA 1X32A 1DG1G 4JI8Q 2VZAA 3DHQA 3STBD 5IYCH 1YJ9A 2JA7B 4G57A 2DNEA 1GJRA 4BY1H 1FNVA 4Q7JB 3X3MA 3AFPA 3PO3B 4TMWA 3SJPA 2EYMA 2CBXA 3AMUA 2L5TA 1L2FA 1XMOQ 1XNRQ 2JYOA 2GVAA 5JBQA 1TVCA 4BA1I 3HOVB 3KL9A 1JWSD 2G9DA 4XDXA 1HNZQ 1PXUA 1VQ7A 4HCEA 3GTJH 4NXMQ 3KFUA 1CTMA 1F60A 3CCSA 3DUZA 2PPBC 3N6RA 1WSVA 5IIFA 1YHQB 3SVMA 5FLXc 1O7IA 5D65A 3ND9A 1E2WA 4K2LA 4YHBA 1K0RA 3EJIA 3GTGB 3U6BA 1RKNA 1TWFH 2QCPX 4QUZA 3D4WA 4N3NA 3NEMA 2V7TA 1RIPA 4B08A 2I0QA 3CC4A 2JDIA 1LTLA 3U4ZA 5KNDA 3X3NA 3KLWA 2M2LA 3CPWB 4LF6L 2VW9A 3KUPA 5FK9C 1GUSA 2K4KA 4X66Q 2DYIA 5H59A 2GA4B 1KNAA 1CA5A 1PJ5A 3TDQA 1HFNA 2V7XA 4IFDJ 1DCZA 3NBHA 3JQRA 4DR7L 4XKWA 2FX3A 4DQKA 1PTOF 4ABNA 1LTID 4BBRG 3HOZH 2PZWA 2F1MA 4NPSA 4YELA 4LF8Q 1MJCA 2RHQB 3H0GH 4FDBA 1YZ6A 1BBWA 3JC66 5M5YB 1Y14B 2GJPA 1F9SA 1BLIA 4Z4RA 3J81j 3MAQA 2XNCA 1U4LA 4J8QA 3M3YH 4FN5A 2PIAA 4GLXA 2ID0A 2K03A 4FXKC 1KXLA 1NCVA 4QY7A 4OOXA 1JQYD 1HNXQ 1E22A 3GVKA 1X65A 2ZT9C 1HCZA 1FR3A 1Q12A 3CAMA 5IY0A 5J3OA 1CNEA 4KD4A 2HDNB 1OB2A 1NMFA 4X3TA 1YEZA 4QV2A 2QF7A 4X64L 2B7BA 1SKYB 3BCDA 2IHFA 5KSWB 1XPOA 5BN4A 4K8IA 1J5EQ 1JT8A 3GDEA 4IN3A 2WR8A 1H9RA 2B29A 1Q1EA 3VYUA 4LAAA 3PCOB 4PZ6A 3U6KA 2L55A 3JAME 4JI5L 3WNDA 1WTVA 1HQRD 1U5KA 4PZ7A 5FJ8H 5IYPA 3G4SB 2Z6KC 1OB5A 1PJ7A 2QN6A 3IKJA 1HVXA 2HQLA 5M5XB 3I56B 1CA6A 1QUQB 1V1QA 3W2FA 2B2YA 2SEBD 3HFZB 2MPMA 4L5TA 1UNSA 1WJJA 3GTQH 3D3RA 3KLSX 4IFDI 2UXBL 1AH9A 5KNBA 2AHOB 3J7ZC 2R92H 5G3LD 3DLLA 1AFPA 1ENCA 1BUVT 1SNQA 3DEPA 4MYTA 3SLNA 4I7ZC 1IYJB 2UUCL 2IHEA 4DV3L 2CWAA 2UU9L 1EWCA 4XQJA 2NV4A 4HJ7A 1YHQA 4NXNL 4ZKBB 3C2PA 1Y1WG 5DS0A 4XQFA 2Z4IA 2PI2E 1OO9B 1D8TA 2B2TC 4K6DA 3ERSX 4HJ5A 1DOLA 4DR5Q 3S1NH 2R93B 2I1LA 2JN4A 1R9TH 2PQAB 4TN1A 2NWGA 5M3FH 4JI4Q 2NVQB 2MO0A 3MFYA 2L12A 4YY3Q 1W35A 2JXMB 1E3PA 1IHZA 5HURA 3QFCA 2N88A 3CPWA 1N05A 5IT9c 3LQ6A 5KNLA 1NJIC 2XZLA 2VXWA 2Q2TA 2A69C 2B2UA 1KQSA 1SYBA 4JI7L 4DUZL 1WTXA 1ZM3A 4B3GA 4I65A 4A3LH 3A8KE 4CDCC 2F0NA 1J6QA 1WOPA 3DWAA 3K7AH 3ULPA 2ZBUA 1CHQD 1GUWA 1B23P 1WTHD 4PC2A 2KHSA 5EMNA 5KYLA 4A93H 3I7FA 5EKIA 1Q86C 4RD4A 4BBRB 1BBXC 3UDIA 1Y1VH 3DWPA 1PH7A 2ZL6A 3CMMA 5CBEE 5ISRA 3J80E 3W2IA 4DV2Q 2CVRA 4AH6A 2KEDA 2WJVA 1QUFA 4M1UB 4BXXH 4RMFA 1QCBD 2N78A 3OMCA 4KMUC 2RCFA 1B9MA 1PV4A 4FF1A 1QJOA 1C7YA 5E6TA 4AIMA 2Z4HA 4QUFA 3LX0A 4ID6A 2HCIA 4B44A 4X06A 5FLXL 5C44G 3CTAA 2NVTB 4EQ5A 3EIVA 3MXNB 3T51B 2D3NA 2K14A 1VQOB 3MFGA 3S1MB 2CNDA 1IYVA 2M9VA 4RA8A 2VBSA 2V7QA 1E24A 4IPDA 3T56B 2BOSA 2OEOA 5IGGA 2VUMB 1S5ED 2E2DC 1IBKQ 1OB0A 4QL5A 3DDYA 1PRTC 3UDXA 5KRUA 1I6HH 2D2CC 5C4XG 3KYHC 2Q8TA 1SMYD 3G4SA 2N55A 4ZCMA 4XTCS 4K8JA 2A68D 2VYQA 3I56A 3K6OA 1Q3LA 1QUQA 5LMNW 4FXGC 2EY5A 4P12A 2QMUA 1KAWA 2K28A 1B44D 4PG3A 3AYHB 4DPGA 4MNOA 2F0UA 2PNRC 2AHOA 5KNCA 2JJ2A 2HIVA 2F0FA 3PGZA 4Q0FA 3RUZA 1HNWL 5C0XJ 3I1FA 4UZEA 4JVZA 4IOCA 1I18A 2C9OA 3L9AX 2DETA 5IYDG 3WY9A 2K01A 3OMGA 4OIJA 2X6XA 3LWEA 4GLAC 3G71B 3OW7A 1LT6D 2AUJD 2EYOA 3L0OA 3HS0C 4QHYA 4JI8L 5IYWA 4MYUA 5CV9A 4DK0A 4QVAA 5IOCA 5JVG3 2SOBA 1BCPF 3OIPA 5HZBA 2IW3A 3B8HA 3VR3A 4QIWB 4CQJA 2PQAA 4B9WA 1EYAA 1W9XA 4BY7H 3EN2A 4K14A 1R5NA 4ZGNB 1YBYA 3TS2A 3TZDA 3Q0AA 3VA7A 2FMMA 1D2BA 3OZVA 3KDFB 4Y9UA 1XTCD 1FGUA 1XMOL 2B3GA 1JWUD 4ACBA 1XNRL 4EQNA 4JI6Q 1PTOC 1F20A 4B43A 2EJMA 4RFBA 3JAMc 5JVH3 1HNZL 2R7ZG 3RZOH 4NXML 5ELEA 2RC5A 4Z4VA 1FNWA 4R71A 1SNOA 1HTPA 1QNKA 1MD2D 3E3XA 1EP1B 1E63A 1SYCA 1RJTA 3E0JA 3MXGA 4C3JH 3NXWA 1SE8A 4TMVA 3ZC3A 5BSYA 3PSIA 2XWJB 2EJGC 2QGQA 1UD3A 1Q8IA 1P4MA 2WSSA 2DEUA 2E2JH 1YNNC 2X6LA 2Q6KA 3D26A 1CSQA 1WOOA 3W2EA 1AIPA 3BVMA 5C0XI 5JJLA 4OWWB 1JE5A 3EQLC 1Q8KA 4QFMA 3PUYA 2QTLA 4X66L 1X54A 1F2MA 2OBSA 4P26A 1EOVA 3MXNA 3BZKA 1VQOA 4XORA 3HKZG 3KOJA 5C44B 2X8KA 1K8OA 1SMXA 5T1GA 2OQKA 3MVVA 4C1NK 2JA8G 5D3IB 1K73C 1SR3A 1VF5C 4HTHA 3SDZA 1WOCA 2JN9A 3KEWA 1O78A 2K33A 4F7XA 1ZM9A 1A3VA 2ZZFA 2F0PA 4LF8L 2Q2IA 2LFNA 1ET9A 1QGAA 3OP1A 1KTKA 4RJLA 2WB1E 5JJKA 5C4XB 3I4OA 5IT9L 1D2EA 4TSFA 5J39A 1VQKB 4C3IG 3FKIG 3C3LA 1VLOA 2F0HA 3BY1A 1PH1A 4IUPA 1W34A 2NUCA 3J81E 4F7DA 1A62A 3VYRA 1HNXL 4GKJQ 4FF4A 3B6YA 4FVMA 2XN9C 4CKCA 4WFN3 3F8TA 2ZTCA 5EKKA 1PYSB 1SBBB 3DMUA 5C4JH 3I55B 3K80C 2BN4A 4DR4Q 4KY6A 3J80c 1I50B 1J5EL 3BDOA 3G71A 4IOAA 4A3GG 1KRHA 4X05A 2F0KA 1STNA 3AVYA 2HCJB 1ZUNB 5J22A 1BMFA 4ALPA 4RGMA 3GD7A 1CM9A 2LZJA 1IJEA 1R4QB 5TSSA 4A3BB 4L5QA 2Q2UA 1SXTA 2FJ2A 3KDFA 1I94Q 2O5JC 2EE1A 3G7LA 3CCQB 2NTSA 1EFID 3CCEB 4P1VA 1T5EA 4LBZA 1Q7YC 3KJPA 4YIJA 2GK6A 3M7GA 3OEHA 4PC6A 2C35B 3K5OA 4JOIA 5CMDA 1D1KA 4G7HC 2NVXH 4M4SA 2R7ZB 4TRDA 2KA7A 4P25A
chains in the Genus database with same CATH topology
3A35A 2B2VC 2EJFC 5LL6X 3VYSA 3HOWB 1TS4A 2DNCA 3BYYB 1H9KA 3GP7A 1SEBD 3S15B 3WOFA 4IUVA 1SYFA 4XLCA 2E2IB 3H6MA 5DEHA 3T13A 1U4RA 4L63B 2LS01 3BC9A 4IALA 3GVLA 4KHVA 4KTAA 4C56C 2PO4A 5T1IA 1SYGA 2WV6D 3FVQA 4O1NA 5KEEA 2VNUD 2ZTNA 1XXGA 2X69A 1UAPA 2BA1A 3HKZB 3NTHA 3VR2A 5DAUA 5C4ZA 2CW0C 1S5FD 5CGKA 1TT2A 5KYIA 1SE4A 4RAUC 5I6YA 3TN2A 2GJKA 2QILA 1QNUA 5E4XA 3KBXA 4QF4A 3EFXD 4KK7A 1LT5D 1OXSC 3JAML 4C3IB 4XT1B 5FO9B 3FKIB 5JEAG 2YU9B 4FYDA 3BYTB 3GV6A 2GK7A 1UD4A 2J4XA 3I90A 4EQPA 4A3JB 1IW7D 1KABA 1BCPC 1DZ1A 2L9HA 2MJ8A 2EYLA 1HXYD 3K5LA 1LT3D 2JA5B 3W3AA 1YNJC 3IFDA 2KJXA 1K8MA 1EY0A 3G05A 2KCCA 3TP8A 1KAAA 1MBYA 2RVLA 3R2IA 3K58A 3SEBA 3GTPB 4ZK9B 1LTBD 4LMQD 2L1BA 3NWTA 4R8IA 4RHRA 1E3XA 4XM3A 1SNCA 1KDBA 4XN0A 4N9PA 1EYCA 4QB4A 2F0GA 4HMJA 1GUNA 3CRLC 1L0YB 5IGCA 4XLAA 4BS9A 3PO2B 1E3ZA 3PV0A 1VJSA 3J80L 3SHLA 3ND8A 2H1EA 3C46A 2A73B 2QE7A 2D5DA 4XXEA 3TP7A 3NPPA 3KLSA 3CU7A 1JE4A 1BO0A 1O7YA 1TWGB 1H9SB 1XWEA 4M8AA 2K6AA 3SK5A 2VB2X 3M4YA 3EA6A 3K0YA 2WZPP 1STYA 5I6WA 4PMCA 1TWCB 4FNFA 3GTLB 3WDNA 1PRTB 4YEJA 1E43A 1FGBD 1DXMA 4ODGA 1TS5A 1CQFA 3A3GA 2F4IA 1E2ZA 1M8AA 2A74C 2OF1A 4Z1MA 3GTKB 4G6IA 2K05A 1ZKOA 3PUWA 3PIO3 3HOXB 1U4MA 2IJ0A 2BE5C 2CK3A 4FO2A 1RTOA 4IFDG 3A3BA 5EBDA 3I4LA 2PZTA 2E2HB 1FX0A 1Z6HA 2X6YA 1LACA 2B2WC 3P1HA 1PRTF 4HMIA 1AW7A 4A3IB 1RDPD 2B2TA 1EL0A 1S5CD 1D1IA 2K5DA 2EYFA 2E74C 1JR0D 4XN3A 4J6HA 2NN6I 1G91A 4DU9A 1PTOB 1FNUA 2HCCA 4DAVA 1RODA 3G6JB 4BBSB 1EQVA 3HOUB 1E0BA 5C3EB 3NQTA 4RWSC 4QMGA 1EY4A 1PFMA 1WVLA 1Y8PB 4XYOA 3S2HB 1OXXK 5ELFA 1ZXTA 3RZDB 1EIGA 2A6HC 1O80A 2BDOA 2FHTA 4HCSA 1UD8A 4K6LA 5JAVA 4UDUC 1H9SA 4H13C 1HRJA 2XVSA 4XR6A 3CHBD 4HSVA 5NUCA 4XNFA 1F2ZA 3E5SA 2A69D 4XMYA 2ZXOA 1HA6A 1J9OA 1JICA 1IL8A 3TMEA 4DAPA 5DM73 3LWUA 3E6ZX 1OHHA 3T16A 1SFOB 1AZPA 2X53S 2JP1A 5FL7A 5E4WC 3J81L 2V31A 1EY7A 5C6AA 2ZXIA 4JK1C 4RCOA 4IUUA 2AQ2B 2JEAI 3NE5B 1LABA 4BA2I 1TQOA 3P7JA 2XOKA 2YYZA 2JJ1A 2O2LD 2J7ZA 3U9SA 1D5XC 2A6ED 3URYA 3J7YW 2EZVA 2CQAA 1ZYRC 2SNMA 1E2VA 1PRTD 1BOSA 3QB3A 2X85A 1WCMB 1W0JA 2OT2A 3VR4A 5F2DA 1KLUD 2AQ1B 2L0CA 2R3ZA 2B8FA 3P75A 5M5WB 1PFBA 2HDLA 4Y7NB 2F0MA 1KDCA 4WRDA 2PYKA 4ASUA 2FMCA 1CQVA 3NSWA 4IUQA 2NBFA 1HUMA 5ELBA 1B3AA 5BN5A 5LL6S 3I72A 5FKAC 3HOYB 1E1QA 2PMZB 4A3KB 2Z8LA 2NVYB 1GOZA 2KUMA 2PCFB 2F3WA 5C0XG 1SNDA 4ZUJA 4PNYA 5KIXA 2BCOA 1K28D 3FPPA 2E76C 1HHVA 3I91A 5A35A 5CBAE 3BH4A 3S9WA 4CGYB 4TT3A 2WACA 3M85A 1PTOD 1B1ZA 1O7ZA 3IFTA 3KBGA 1T5XD 4Q5VA 2X6GA 5CV7A 4N9TA 2F0DA 2A6EC 5EQ0A 5ELDA 1STEA 4G7XA 3A8JE 1YNND 1WD1A 2K04A 1B50A 2EY6A 2ICEC 2EXZA 1MABA 2JA6B 1BCPB 2AQ3B 5LHY1 4NMZA 1S4ZA 4KV6A 1EYDA 3HG9A 1TIID 4DA2A 1PYWD 3M4OB 4XKVA 2K1BA 1SNPA 1EIHA 1HA5A 2XSCA 2MUYA 2D9UA 3S14B 4K2KA 2VB3X 1LTAD 1V43A 4RKLA 3CQZB 1G6ZA 3BDCA 3A54A 4AVZA 2ENBA 3NTKA 4OIKA 1Y1WB 1STBA 2E1BA 1A3TA 3VA5A 2B2VA 3QOJA 3D4RA 2RDFA 4G7OC 4IUTA 5D3DA 2NB0A 2IWHA 3ITPA 3QIAA 3MWYW 1TS3A 1QE6A 3GTOB 5EPJA 3DWQA 1ICWA 5C5LA 2IX1A 1GHKA 1V1PB 4TKOB 3GVJA 4RGOS 1EZ6A 1EU3A 1D5MC 1WTWA 1PKVA 1RD9D 2HUGA 3PUVA 3TP5A 2JIZA 1EY9A 4XIGS 1Y8NB 1FYCA 2JSOA 1S5DD 1ILPA 2D62A 2F0QA 2DY7A 1I3QB 4KD3A 3I8ZA 1VLYA 1H9MA 2IPKD 2B2UC 1RCVD 5CV8A 5C3WA 2RKSA 1H8EA 3AB9A 2KEEA 4DNRB 4OO1H 1OXUA 4A3EB 3J7AF 3PMFA 3DXJC 4C3HG 2XNDA 5EPLA 2TSSA 3OOCA 2K5WA 1MGSA 4ZRZA 1ENAA 5EGTA 1NRKA 1STGA 2CW0D 3OWEB 1G291 1LTGD 1GJXA 2X6WA 1A2TA 4J1MA 4ZLTF 1STAA 2ZZGA 1CHPD 3OE7A 2V4DA 4NNJA 1LTRD 4XLFA 1E1RA 2WIIB 1F9RA 5IGEA 4DNTB 1PDQA 1B9NA 3J7AV 1BCPD 5JJZA 1O7LA 4GQNA 1QILA 1TY0A 3AU7A 3SK6A 3CP2A 2DN8A 2L4NA 1AZQA 1I4HA 1V1PA 5JEAH 4HN7A 2Q8RE 3PUZA 1II3A 2EDGA 1YNJD 4G7ZC 1OXVA 1UEAB 3K59A 2W6IA 4RGNA 3S1RB 4KJOA 1QB5D 3NTIA 3OEEA 5K5PA 2K5QA 1CK1A 3C1EA 3K5MA 1UD5A 4UZUA 1F77A 2NTTA 2RQXA 5KGUA 2IL8A 1Y69U 3GTMB 2O4XA 1XX8A 2JA8B 4EGVA 3MEHA 1LTSD 1B4OA 2I46A 2KOLA 5CDFA 4LK1C 2B63B 2Z1CA 3S16B 5K36H 2LY7A 2XZPA 1PTOH 3BCFA 1WTRA 3A8IE 3K57A 1ONLA 3I3CA 4K5WA 1XYIA 3EROA 4C3HB 1DYQA 1EOTA 1GUGA 2B2WA 1AEXA 1GUTA 3D8GA 1I4QA 4A3GB 3MA2B 4F8MA 2F0SA 1B2TA 2WJYA 1TY2A 4PQXA 2ZZQA 3HZXA 2EYPA 4NW2A 1ET6A 1CFMA 3C1FA 5M3MB 4CJ1B 2NN6G 1KMHA 1A6XA 2ICIA 4EVOA 2XGJA 2K32A 4CKEA 2BE5D 2ZTGA 1BDOA 1I8DA 3MXUA 3KK7A 3HAGA 3QG1A 2H4OA 2ZXRA 4DF7A 4P2CB 4H7BA 2WAQB 2FINB 1WD0A 2EY1A 3I4MB 3DM1A 1TR5A 4IFDH 5JPMC 2I07B 1WTPA 1MI2A 2ZXHA 3MTSA 1C8CA 2XRQD 2HDMA 3GQBA 5FO7B 1LTTD 4FF3A 5J1ZA 2JE6I 1VMPA 4DN4M 4DXFA 4V190 2G9HD 1EEID 1LO5D 1EWHA 2F0IA 1DM0B 2KVOA 2R6GA 4KY5A 2TMPA 3Q22A 2KCNA 1HTLD 3P20A 3S2DB 3TP6A 1GHJA 2WP8J 2XNAC 2B8GA 2Y0SB 2ZZEA 5DNFA 3FDTA 4IUNA 2A6HD 5CORA 4FP5D 1NSNS 3A7AB 3D4DA 2CHBD 4KKUA 2RSOA 4KN7C 1DOMA 3OAAA 4U68A 3RLFA 3WOEA 5ELCA 2FFKB 5EBCA 2KECA 4FXDA 3IAYA 2PW7A 5A2QE 1HPCA 3NP8A 3I4NB 5FOBB 3ZIAA 3PIP3 4IQZA 3BZDB 5CC4A 2F43A 4KN4C 5EPKA 5G3LF 2Z6BD 4R9WA 1IYUA 1UD6A 2OXPA 2LMCB 3D31A 3V96A 4CBVA 4KKTA 3GV3A 2XRSD 1BF4A 1VCIA 3D6WA 4JMQA 5IGBA 3LNNA 3WQZA 2AUKA 3W2DA 1SE3A 2IX0A 1H8HA 1L0XB 1F9QA 1AN8A 1ESFA 1JC7A 4RH6A 4WORA 1F2YA 4RGTA 1K83B 3BDLA 1ZYRD 3FPUB 1TU2B 2MGSA 4CJ2C 4C1NI 3RD4A 4XT3B 4E6IA 1CI3M 1DJRD 4XONA 1AP0A 1KDAA 4NKLA 1SAPA 3H91A 1W6JA 4ZQ3A 5I9PA 1GUOA 4XOTA 3OFNA 4XOPA 3QWNA 1PZID 1X3PA 3FKSA 1HQMC 4TQUS 5AFWA 3KLRA 2XWBB 3A7LA 1V8QA 4HIZA 2NYZD 5DN6A 2ZXPA 2QEJC 3T53B 2RSNA 5CR3A 1D6EC 1R4PB 1TWAB 1IKLA 3FMCA 1VMCA 5C0XH 4X3SA 1SE2A 2RDHA 4HEDA 1CT1D 4A3DB 4E0FA 2SDFA 4DAYA 4KY7A 2W6JA 1TWHB 2EYJA 1KLGD 2BDNA 4C2MB 3S17B 1PZJD 2F03A 4NP5A 5M9OA 4PMBA 1JWMD 4A3MB 1STHA 3MXPA 3KF8A 1I4RA 5C4HA 1U4PA 3F2UA 4ILWA 2J0TD 4A3FB 3FRPB 5HGTA 3HP3A 1I6VC 1DONA 3L7ZC 4L6TB 3H09A 4GZYC 1D5ZC 2RA4A 3ONAB 3QO2A 5EJWA 3HGBA 2WPDA 4FF2A 3D6CA 4O42A 1JOOA 1KZLA 5BN3A 2RBMA 4G4KA 5JOBA 1SDFA 1I4XA 2MHVA 1J8IA 2M00A 4BY1B 4ZYSA 4PMWA 2EVBA 1F2LA 4LJZC 4DGZA 3SE0A 3Q24A 3SXHA 1OXTA 4CKBA 1MSGA 3GTJB 5IK2A 3SR1A 1CZWA 2K7VA 1EU4A 3N52A 1TWFB 3TSSA 1PZKD 1BPLA 3TZUA 2EPBA 3CKIB 5IGFA 3HEJA 1RHPA 3A56A 2HLDA 2F0OA 4Z9CB 1I4GA 5CV5A 1M4VA 4XD7A 1Z7TA 4YXWA 1EY8A 3IL8A 2F0LA 1DD2A 3NK9A 3K5NA 3HRZC 4B3FX 3Q6SA 3HOZB 3BVGA 1BQQT 3H0GB 5HKKA 1W0KA 1FD7D 2M5SA 1RTNA 1UUPA 2B2YC 1TKWB 3QJYA 1I4PA 3M3YB 1A2UA 1MSHA 1RF2D 1W6KA 3OSOA 4FXUA 4II2A 1DOKA 3CESA 1NR2A 5I9OA 3OIQA 3UI2A 4XLHA 1NAPA 1TS2A 3JU4A 2IX3A 1WTOA 1PMRA 1Y8OB 5D14A 1EEFD 4XQQA 4P22A 2C5CA 2Q8IB 3OPOA 1LT4D 4TSSA 5C5MA 4BWGB 3SK8A 1JOKA 1VDZA 4ZUIA 4NDXA 3BS1A 2A5HA 3MHBA 2VJJA 4JBWA 4K5VA 5IODA 3GTQB 5FO8B 2R92B 3NHHA 4OHJA 1SMYC 4QCLA 4XLEA 3R93A 2A68C 2HQEA 1Z47A 1KNEA 1SJHD 2L11A 3M7NA 3CP8A 2SNSA 4PV1C 1EQTA 3EVQA 3PUXA 4RKBA 3S1NB 1EZ8A 3SK4A 1R9TB 2WINB 1G8ZD 5M3FB 2AWOA 1BXTA 1LLRD 1SJED 3ERQA 2R9VA 2F0VA 3RMHA 2BA0A 4B9XA 1Q90A 3Q23A 5A2QL 2WKDA 3CRKC 2EOTA 1H9JA 1V0FA 4C3JG 3K7AB 3U9OA 1NUCA 1LV9A 4F87A 1NR4A 4A93B 1Y1VB 4IURA 1V1OA 2E75C 4QUCA 4HSPA 1PFNA 1B53A 2QDBA 4KJNA 4EQOA 3NBIA 4KHZA 2O5IC 1G2SA 2XIWA 3VR5A 5JPNC 2DIEA 3MZ5A 2QKIC 2EY2A 4X3KA 4H44C 3V05A 1VF7A 4XQNA 1I6HB 4OL7A 3ZYYX 4KI0A 4OO1G 1JOQA 3H94A 5E1FA 5I4DA 1C48A 1HZEA 2PQEA 5COYA 1V0EA 4G7WA 2MP1A 2XZOA 1SYEA 3H3VC 1EFRA 1UD2A 2F0WA 1SNMA 3NUCA 2NN6H 2R61A 3I73A 3NQIA 1WP6A 4ZAIA 3O13A 2EYHA 4V0BA 4BY7B 1ILQA 5CV4A 3QOLA 3VYTA 1COWA 3BVZA 1CZGA 4ME5A 1HUNA 3TBIB 4U673 5FLXE 1C4QA 4H0LC 4F88A 3RZOB 4DFAA 4ZKCB 2NZ1D 3A55A 1QWYA 2WKCA 3GO5A 4ULLA 2KVMA 2WB1B 1ZEQX 1A3UA 1IKMA 4RHSA 4C3JB 5I2XA 4IZ8A 1G2TA 4MIUA 2RDGA 2E2JB 1Q1BA 5E3FA 5CV6A 2JEBI 2LKVA 3MC0B 5EKLA 1GXDC 2B39A 2F0EA 3BG3A 1ML0D 1ESRA 3R2TA 3R8BA 1BNZA 1F9PA 5C3XA 4CHTB 1WTQA 1A15A 2AWNA 2PW5A 2IT1A 1QG7A 1TVXA 3OWFA 5IGDA 5K36G 4HAEA 1BR9A 4K5XA 3T4AC 1PLFA 1SYDA 5I2YA 1JORA 2F3VA 3V2TA 4OO1I 5JEAJ 3OHXC 4UAIA 1JB3A 1JCKB 1SSOA 3R3OA 5C4JB 4OGQC 1EY5A 4DK1A 2VJIA 4XL9A 4X3UA 1U9RA 4HR7B 1X3QA 3NWSA 2PZUA 1IW7C 3ZPNA 2DY8A 4WJWA 1HFGA 2GJRA 1ENFA 4AYBB 1WPCA 1E79A 2NVXB 1S5BD 5CYUA 2KQ3A 3FEWX 3I70A 2F0TA 4RCNA 4XYQA 1NBMA 4CJ0B 4L8JA 3DEOA 3L3OC 4S3SA 1EY6A 3VR6A 5DM63 4MN3A 4R8NA 4MHEA 2D3LA 5IT9E 4DXGA 3S1QB 2F0JA 4KKSA 1QOHA 1X32A 3DHQA 2JA7B 4G57A 2DNEA 1FNVA 3X3MA 3PO3B 2EYMA 3AMUA 2L5TA 2JYOA 4BA1I 3HOVB 1JWSD 2G9DA 4XDXA 1PXUA 4HCEA 1CTMA 3DUZA 2PPBC 3N6RA 5IIFA 3SVMA 5D65A 3ND9A 1E2WA 4K2LA 3EJIA 3GTGB 1RKNA 2QCPX 3D4WA 4B08A 2JDIA 5KNDA 3X3NA 2M2LA 3KUPA 5FK9C 1GUSA 2GA4B 1KNAA 1CA5A 3TDQA 1HFNA 4IFDJ 1DCZA 3NBHA 4XKWA 1PTOF 4ABNA 1LTID 2PZWA 2F1MA 4YELA 5M5YB 2GJPA 1F9SA 1BLIA 3MAQA 1U4LA 4J8QA 2ID0A 2K03A 4FXKC 1NCVA 1JQYD 3GVKA 2ZT9C 1HCZA 1FR3A 1Q12A 4KD4A 4X3TA 2QF7A 1SKYB 3BCDA 5BN4A 4K8IA 4IN3A 1H9RA 1Q1EA 3VYUA 4LAAA 2L55A 3JAME 1WTVA 1HQRD 3IKJA 1HVXA 5M5XB 1CA6A 2B2YA 2SEBD 2MPMA 1UNSA 3D3RA 3KLSX 4IFDI 5KNBA 5G3LD 1AFPA 1ENCA 1BUVT 1SNQA 3DEPA 4I7ZC 1EWCA 4XQJA 4ZKBB 3C2PA 4XQFA 2Z4IA 1OO9B 2B2TC 4K6DA 1DOLA 2R93B 2NWGA 2NVQB 3MFYA 2L12A 2JXMB 1IHZA 5HURA 2N88A 5KNLA 2XZLA 2VXWA 2A69C 2B2UA 1SYBA 1WTXA 4B3GA 4I65A 3A8KE 2F0NA 3DWAA 1CHQD 1GUWA 1WTHD 2KHSA 5KYLA 5EKIA 4BBRB 1BBXC 3DWPA 3CMMA 5CBEE 5ISRA 3J80E 2CVRA 2KEDA 2WJVA 4M1UB 1QCBD 3OMCA 4KMUC 4FF1A 1B9MA 1QJOA 2Z4HA 4QUFA 3LX0A 4ID6A 2HCIA 5FLXL 2NVTB 3T51B 2D3NA 3MFGA 3S1MB 1IYVA 2M9VA 4RA8A 2V7QA 3T56B 2BOSA 2OEOA 5IGGA 2VUMB 1S5ED 2E2DC 1OB0A 3DDYA 1PRTC 5KRUA 2D2CC 2Q8TA 1SMYD 2N55A 4XTCS 4K8JA 2A68D 3K6OA 1Q3LA 4FXGC 2EY5A 2K28A 1B44D 2F0UA 2PNRC 5KNCA 2JJ2A 2F0FA 4Q0FA 3RUZA 5C0XJ 1I18A 2C9OA 3L9AX 2K01A 3OMGA 4OIJA 2X6XA 3LWEA 3OW7A 1LT6D 2AUJD 2EYOA 3HS0C 5CV9A 4DK0A 5IOCA 5JVG3 2SOBA 1BCPF 3OIPA 2IW3A 3VR3A 4QIWB 4B9WA 1EYAA 1W9XA 4K14A 3TZDA 3Q0AA 3VA7A 2FMMA 1D2BA 1XTCD 1JWUD 4EQNA 1PTOC 4RFBA 2EJMA 5JVH3 5ELEA 1FNWA 1SNOA 1HTPA 1QNKA 1MD2D 1SYCA 1RJTA 3E0JA 3MXGA 3NXWA 2XWJB 2EJGC 1UD3A 1Q8IA 2WSSA 1YNNC 2X6LA 3BVMA 5C0XI 3EQLC 3PUYA 1F2MA 3MXNA 4XORA 5C44B 2X8KA 1K8OA 5T1GA 3MVVA 4C1NK 5D3IB 1VF5C 4HTHA 3SDZA 3KEWA 1O78A 2K33A 4F7XA 1A3VA 2ZZFA 2F0PA 2LFNA 1ET9A 1KTKA 5C4XB 5IT9L 4TSFA 5J39A 4C3IG 3C3LA 2F0HA 4IUPA 2NUCA 3J81E 3VYRA 4FF4A 4FVMA 2XN9C 4CKCA 4WFN3 5EKKA 1SBBB 3DMUA 4KY6A 1I50B 3BDOA 2F0KA 1STNA 5J22A 1BMFA 4RGMA 3GD7A 1CM9A 2LZJA 1R4QB 5TSSA 4A3BB 1SXTA 2FJ2A 2O5JC 2EE1A 3G7LA 2NTSA 1EFID 1T5EA 4YIJA 2GK6A 3M7GA 3OEHA 5CMDA 3K5OA 1D1KA 4G7HC 2R7ZB 4TRDA 2KA7A 4II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTP A;  2EJF C;  2K7V A;  2NN6 I;  3VR4 A;  1DCZ A;  4HR7 B;  4KN7 C;  4PV1 C;  3PUX A;  3RLF A;  3FMC A;  2B8F A;  2F1M A;  2DNC A;  2V4D A;  1H9K A;  3TZU A;  5C0X H;  1IW7 C;  2EJG C;  2AWO A;  3D4R A;  1CFM A;  1HPC A;  1YNN C;  1GUN A;  3CRL C;  4G7O C;  2NN6 G;  4IQZ A;  4DNT B;  4KN4 C;  1A6X A;  1B9N A;  3QIA A;  3EQL C;  4H0L C;  4KMU C;  1IYU A;  1Y8P B;  2BA0 A;  1B9M A;  1O7L A;  2LMC B;  3D31 A;  1QJO A;  3PUY A;  1Q90 A;  3PV0 A;  5BN5 A;  2K32 A;  3CRK C;  3I72 A;  1OXX K;  1H9J A;  4KKT A;  1Z7T A;  2BE5 D;  1BDO A;  2ZT9 C;  2DN8 A;  3MXU A;  1HCZ A;  1FR3 A;  1Q12 A;  3ND8 A;  4RCN A;  1GHK A;  1DD2 A;  1VCI A;  3QG1 A;  2A6H C;  5JEA H;  2D5D A;  4L8J A;  3T51 B;  2EDG A;  4TKO B;  2PCF B;  2QF7 A;  1OXV A;  3PUZ A;  4G7Z C;  5C0X G;  1IYV A;  1K8O A;  2BDO A;  3VR6 A;  3LNN A;  2AUK A;  2BA1 A;  5BN4 A;  3T56 B;  3FPP A;  2E76 C;  3VR2 A;  1VF5 C;  3SDZ A;  1H9R A;  2CW0 C;  1O78 A;  1Q1E A;  2K33 A;  5A35 A;  1H9S A;  3PUV A;  4H13 C;  3A8K E;  4KKS A;  1H9S B;  1Q1B A;  1TKW B;  2E75 C;  2JEB I;  2D2C C;  3QJY A;  3M4Y A;  4XIG S;  1I6V C;  3M85 A;  2DNE A;  3L7Z C;  4IFD H;  4XTC S;  2A68 D;  1Y8N B;  2A69 D;  1FYC A;  3IKJ A;  2D62 A;  3IFT A;  4KHZ A;  2O5I C;  1OXS C;  1TU2 B;  3WDN A;  3VR5 A;  3BG3 A;  5JEA G;  4GZY C;  2L5T A;  2PNR C;  1DXM A;  1H9M A;  3LWU A;  3GQB A;  5KNC A;  1CI3 M;  5KNB A;  1E2Z A;  4BA1 I;  3HGB A;  2JE6 I;  1Y69 U;  4H44 C;  2A6E C;  1VF7 A;  1IW7 D;  4I7Z C;  1CTM A;  1ZKO A;  1PMR A;  1Y8O B;  3A8J E;  5BN3 A;  3PUW A;  2IT1 A;  1EWH A;  3AB9 A;  3N6R A;  2PPB C;  2Q8I B;  3BDO A;  3OPO A;  4DNR B;  2BE5 C;  4JK1 C;  3OW7 A;  3ND9 A;  4KI0 A;  4IFD G;  2AUJ D;  2R6G A;  4OO1 G;  3H94 A;  1VDZ A;  4LK1 C;  5K36 G;  1E2W A;  2JEA I;  4OO1 H;  3I4L A;  3W3A A;  1OXU A;  5K36 H;  3NE5 B;  1GUO A;  1YNJ C;  4DK0 A;  3P20 A;  1LAB A;  4BA2 I;  1Z6H A;  1K8M A;  1GHJ A;  2EVB A;  4JBW A;  3GD7 A;  3VR3 A;  3A8I E;  1ONL A;  1LAC A;  4LJZ C;  1HQM C;  2B8G A;  2KCC A;  3SE0 A;  3DXJ C;  3MFY A;  4TQU S;  3KLR A;  2JXM B;  2A6H D;  3VA7 A;  1OXT A;  5KND A;  3OOC A;  2O5J C;  3A7A B;  3A7L A;  1GUG A;  1T5E A;  1V8Q A;  2YYZ A;  1SMY C;  1GUT A;  2NN6 H;  4OGQ C;  3U9S A;  2A6E D;  2A68 C;  2EJM A;  1V43 A;  1GUS A;  2A69 C;  1G29 1;  4G7H C;  4KKU A;  1GJX A;  1ZYR C;  3I73 A;  3T53 B;  1E2V A;  2KA7 A;  4DK1 A;  3M7N A;  2E74 C; 
#chains in the Genus database with same CATH topology
 3A35 A;  2B2V C;  2EJF C;  5LL6 X;  3VYS A;  3HOW B;  4DV4 Q;  3CPF A;  1TS4 A;  2DNC A;  4HIM A;  3BYY B;  1H9K A;  3GP7 A;  1SEB D;  4DR5 L;  3S15 B;  3WOF A;  4IUV A;  1SYF A;  4MTN A;  4XLC A;  2E2I B;  4X7E A;  3H6M A;  2QDL A;  3I2Z A;  2YTY A;  5DEH A;  3T13 A;  4JI4 L;  3S1Q H;  4YY3 L;  1U4R A;  4L63 B;  2LS0 1;  3BC9 A;  2JA7 H;  4IAL A;  3GVL A;  4KHV A;  3ASS A;  4KTA A;  3AVV A;  4C56 C;  4PAA A;  4P6Y A;  2PO4 A;  5T1I A;  5GAE C;  1SYG A;  3PO3 H;  2WV6 D;  4OX9 Q;  4BPR A;  3FVQ A;  4O1N A;  4AC9 A;  5KEE A;  2QGG A;  2VNU D;  4WZK A;  1VQB A;  3H15 A;  3PIP A;  3TS0 A;  2ZTN A;  1VQ9 B;  1XXG A;  3NEL A;  5IE8 A;  3HOV H;  2X69 A;  1UAP A;  2BA1 A;  4AYB E;  3HKZ B;  3NTH A;  2MO1 A;  3VR2 A;  5DAU A;  2UXC Q;  1PVO A;  5C4Z A;  5THX A;  2ZL7 A;  2CW0 C;  1S5F D;  5GV7 A;  1TT2 A;  5CGK A;  5KYI A;  1SE4 A;  4RAU C;  3CCM B;  3QR8 A;  4H9G A;  4OPO A;  3TN2 A;  2GJK A;  5I6Y A;  4LC0 A;  5GAH C;  2QIL A;  1QNU A;  5E4X A;  2K52 A;  1BX1 A;  3KBX A;  4C0S A;  1M90 D;  4DV2 L;  4QF4 A;  3EFX D;  4KK7 A;  1VQK A;  3GTG H;  2JA9 A;  1LT5 D;  1OXS C;  3JAM L;  2Z9H A;  4C3I B;  4LBW A;  4XT1 B;  3FKI B;  5FO9 B;  5JEA G;  2YU9 B;  4FYD A;  3BYT B;  3GV6 A;  2GK7 A;  1UD4 A;  4JBK A;  4J0Q A;  1B7Y B;  2DUD A;  2J4X A;  3I90 A;  1JNY A;  1VQ5 B;  4EQP A;  3I55 A;  4A3J B;  3AQQ A;  3WNB A;  4J15 A;  3HOX G;  1IW7 D;  1KAB A;  1BCP C;  1A8P A;  1DZ1 A;  2L9H A;  2MJ8 A;  1FNB A;  2EYL A;  1Q81 D;  1HXY D;  4IJL A;  3K5L A;  1IBK L;  1LT3 D;  4HE6 A;  2C4U A;  2JA5 B;  1HR0 Q;  3W3A A;  5ELN A;  1DGS A;  1YNJ C;  3IFD A;  2KJX A;  1B70 B;  2OWO A;  1K8M A;  1EY0 A;  2KHJ A;  3G05 A;  1QVF B;  1CQX A;  2KCC A;  2L15 A;  3TP8 A;  1KAA A;  3W5V A;  1MBY A;  2RVL A;  3R2I A;  5M5Y H;  1EFW A;  1QUE A;  4AF6 A;  3CCQ A;  3K58 A;  3CCE A;  1M1K D;  3CW2 C;  3SEB A;  1YLO A;  3GTP B;  4ZK9 B;  1LTB D;  4LMQ D;  2L1B A;  3NWT A;  4R8I A;  2CCZ A;  2PE3 A;  4RHR A;  1E3X A;  2VBV A;  1R5O A;  4XM3 A;  1SNC A;  1KDB A;  5IP9 H;  1HR0 W;  4XN0 A;  1N8R C;  4BBS G;  4N9P A;  1EYC A;  1BQE A;  1UE6 A;  2ZL5 A;  3HKS A;  4QB4 A;  4B3M Q;  2F0G A;  4HMJ A;  1GUN A;  3TEH B;  3CRL C;  1B3Q A;  1L0Y B;  5IGC A;  4XLA A;  4BS9 A;  4IPC A;  3PO2 B;  3C2Q A;  1E3Z A;  3SGI A;  5M5X H;  5JJI A;  1N07 A;  3PV0 A;  1VJS A;  4JI6 L;  3J80 L;  3F2D A;  4RD3 A;  3SHL A;  3ND8 A;  2H1E A;  3A0J A;  3C46 A;  4RDJ A;  2A73 B;  3SJZ A;  2QE7 A;  2F52 A;  4HJ9 A;  2D5D A;  4XXE A;  1VQ9 A;  2UUB Q;  1VQH A;  4ROX A;  2DY1 A;  4U9U A;  4Z4Z A;  1IJF A;  3NPP A;  2PLF A;  3TP7 A;  4HJ8 A;  3KLS A;  1DAR A;  3CU7 A;  1JE4 A;  4IPG A;  1BO0 A;  1D8L A;  3W2G A;  4I7A A;  1O7Y A;  3CCM A;  1TWG B;  1H9S B;  1XWE A;  4M8A A;  4B3S Q;  2K6A A;  3SK5 A;  2VB2 X;  3M4Y A;  3EA6 A;  4UP7 A;  3K0Y A;  2WZP P;  3LO8 A;  1STY A;  5I6W A;  2DJF C;  1QFJ A;  4PMC A;  1TWC B;  2R93 H;  2LXJ A;  4FNF A;  4ME3 A;  3GTL B;  4HIO A;  5E7N A;  3WDN A;  1WU8 A;  4YEJ A;  1PRT B;  2HIX A;  1E43 A;  1FGB D;  2NVQ H;  3RN2 A;  1DXM A;  4ODG A;  1TS5 A;  2EIF A;  2VZL A;  1CQF A;  3A3G A;  2F4I A;  2Z6K A;  1E2Z A;  1M8A A;  1VQ5 A;  4PAB A;  2A74 C;  2YWG A;  4ACA A;  2OF1 A;  4Z1M A;  1JB7 A;  3GTK B;  4G6I A;  2K05 A;  1LM0 A;  3W5U A;  1RQP A;  2BV3 A;  1K8A C;  1ZKO A;  1NBW A;  1WDT A;  1CKO A;  2E5L Q;  3H3V H;  3PUW A;  3PIO 3;  3HOX B;  4RD2 A;  1N36 Q;  1U4M A;  2IJ0 A;  2BE5 C;  2CK3 A;  4FO2 A;  1RTO A;  1L0W A;  3A3B A;  4IFD G;  5EBD A;  3I4L A;  3OTO Q;  2PZT A;  2E2H B;  1FX0 A;  1Z6H A;  5FLM G;  2X6Y A;  1QVF A;  1LAC A;  1NB9 A;  1GAW A;  2B2W C;  3P1H A;  1PRT F;  4BBR H;  1DDG A;  1HA3 A;  4HMI A;  1R5B A;  1AW7 A;  2RCN A;  1IBL Q;  4A3I B;  1VHE A;  1RDP D;  2B2T A;  4GN4 B;  3U50 C;  1X9N A;  3AEV A;  4M1K A;  3RNU A;  1EL0 A;  1S5C D;  3F2B A;  4GKJ L;  1QVG B;  3ZBT A;  3CXC B;  3E9I A;  3CME B;  4O2D A;  1D1I A;  2YWH A;  3A5U A;  1IZ6 A;  2K5D A;  2EYF A;  4II3 A;  3AGQ A;  2MNA A;  3ASR A;  1WCM G;  4DR4 L;  4CDD C;  4QJF A;  2E74 C;  1JR0 D;  2VS1 A;  4XN3 A;  4J6H A;  2NN6 I;  1G91 A;  2NVT H;  1U0L A;  3PQI A;  4DU9 A;  4A3M G;  1PTO B;  4DQL A;  1FNU A;  2HCC A;  4DAV A;  3S1M H;  1ROD A;  3G6J B;  4BBS B;  1EQV A;  1EP3 B;  3HOU B;  1E0B A;  5C3E B;  3NQT A;  3K8A A;  4GKK Q;  2VUM H;  2QA4 B;  4RWS C;  3K81 C;  4P3Y A;  4QMG A;  1N08 A;  1EY4 A;  1I94 L;  1GR1 A;  1PFM A;  1WVL A;  1Y8P B;  1S0U A;  5EAY A;  3HOY G;  4XYO A;  3S2H B;  4WQM A;  4A3K G;  1JMC A;  1OXX K;  2WYR A;  5ELF A;  1I5F A;  1ZXT A;  3RZD B;  4A3C G;  2NZO A;  4R4C A;  1EIG A;  2A6H C;  1O80 A;  4JBM A;  1TTT A;  2BDO A;  2FHT A;  4HCS A;  4DV4 L;  2VQE Q;  1UD8 A;  2OK7 A;  2ZTE A;  4K6L A;  5JAV A;  4UDU C;  3J7A 5;  4OP7 A;  1H9S A;  4H13 C;  1HRJ A;  3RY8 A;  2XVS A;  4XR6 A;  4FWT A;  5IYC G;  4X65 Q;  3CHB D;  3VNV A;  4HSV A;  3E0E A;  5NUC A;  1NJI D;  1AMO A;  4LF4 Q;  4XNF A;  1F2Z A;  1UE5 A;  3E5S A;  2A69 D;  4LF5 Q;  4XMY A;  2ZXO A;  1HA6 A;  1J9O A;  1TLL A;  1JIC A;  1IL8 A;  4WZT A;  3TME A;  2DER A;  2CC2 A;  4OPV A;  4DAP A;  3AVU A;  2QW7 A;  3FJO A;  4JV5 Q;  1Q82 C;  5DM7 3;  3LWU A;  2GPJ A;  4OOS A;  1HZB A;  3E6Z X;  3A8I A;  4R1J A;  4OX9 L;  4IJH A;  4OEL B;  1K9M C;  1OHH A;  1ICF B;  1Q86 D;  5A8A A;  3T16 A;  5DLQ E;  1SFO B;  1AZP A;  2X53 S;  4DK6 C;  2JP1 A;  5FL7 A;  5E4W C;  3J81 L;  5IYB H;  2V31 A;  1EY7 A;  1VQP B;  2UXC L;  5C6A A;  3A74 A;  1HJP A;  2ZXI A;  4JK1 C;  1PHJ A;  2JA6 G;  4RCO A;  4IUU A;  4DV7 L;  2AQ2 B;  2JEA I;  2CRV A;  1QVC A;  3NE5 B;  4O0A A;  1FVI A;  1LAB A;  4BA2 I;  1VQE A;  1GO3 E;  3J80 i;  2XNJ A;  3V7A A;  1VQ6 B;  1TQO A;  3P7J A;  4DK3 C;  2DGY A;  4P72 A;  1WTH A;  4ZCI A;  2XOK A;  5AJ3 Q;  1WSR A;  1Y0Y A;  1QVG A;  3CXC A;  1K28 A;  2YYZ A;  3CME A;  2JJ1 A;  2O2L D;  1AE2 A;  2J7Z A;  5GV8 A;  1V5V A;  1D5X C;  1WOS A;  2A6E D;  3U9S A;  3URY A;  1JJ2 B;  2PMD A;  3J7Y W;  2EZV A;  2CQA A;  3D0F A;  1ZYR C;  2SNM A;  1E2V A;  5A89 A;  1G51 A;  1PRT D;  1BOS A;  4QIW E;  3QB3 A;  2X85 A;  1WCM B;  1W0J A;  2OT2 A;  4YHH Q;  3VR4 A;  5F2D A;  1KLU D;  2AQ1 B;  2L0C A;  2R3Z A;  5C44 H;  1HR0 L;  2B8F A;  2EFG A;  2JK8 A;  3H0G G;  1XMQ Q;  2QA4 A;  2A8V A;  3P75 A;  5M5W B;  4LBY A;  1PFB A;  1UWV A;  2HDL A;  4Y7N B;  2F0M A;  2BM1 A;  1KDC A;  4WRD A;  2PYK A;  3CPX A;  4ASU A;  2FMC A;  1UE1 A;  1CQV A;  1VQ8 B;  3NSW A;  5C4X H;  4IUQ A;  2NBF A;  1HUM A;  5ELB A;  1XPU A;  1B3A A;  5AN9 A;  1IHM A;  5BN5 A;  5LL6 S;  3PA1 A;  1VQN B;  3I72 A;  3JQQ A;  1TXY A;  1X3E A;  5FKA C;  1E1Q A;  4X7F A;  1W3S A;  3HOY B;  2PMZ B;  5IP7 G;  4A3K B;  4NCN A;  2Z8L A;  4JCV E;  2NVY B;  1GOZ A;  4JI2 Q;  2KUM A;  2PCF B;  5L37 A;  2F3W A;  5C0X G;  1SND A;  2NZH A;  3CD6 B;  4ZUJ A;  5FO1 A;  4PNY A;  2BCO A;  1K28 D;  3FPP A;  3CCR B;  2E76 C;  1VQJ A;  5KIX A;  1HHV A;  3I91 A;  5A35 A;  5CBA E;  3L2P A;  1I50 H;  5HY6 A;  2VQF Q;  3BH4 A;  3S9W A;  4LNQ A;  4LFB Q;  3ES9 A;  5FJ8 G;  1UE7 A;  4CGY B;  4TT3 A;  1YVC A;  3UE1 A;  1KK1 A;  4B3M L;  2WAC A;  3M85 A;  1KK0 A;  1PTO D;  1B1Z A;  1O7Z A;  2OK8 A;  3IFT A;  3KBG A;  1IL2 A;  1T5X D;  4Q5V A;  4A3B H;  2BF4 A;  2X6G A;  1VQC A;  5CV7 A;  2R92 G;  4N9T A;  2F0D A;  2UUB L;  2A6E C;  3OJW A;  3H9N A;  3G48 A;  5ELD A;  5EQ0 A;  5LMU Q;  1N9W A;  1STE A;  4G7X A;  2K50 A;  3A8J E;  1VQP A;  4B3T Q;  3RLN A;  2R7Z H;  4TMZ A;  1YNN D;  5GRO A;  3ZUG A;  1WD1 A;  1NDH A;  2K04 A;  2MQH A;  1B50 A;  2EY6 A;  3MHP A;  2ICE C;  2EXZ A;  1MAB A;  4B3S L;  2JA6 B;  3HOW H;  4IO9 A;  1EWY A;  2F4N A;  1BCP B;  2AQ3 B;  4A3E G;  1L1O C;  5LHY 1;  4NMZ A;  2HT1 A;  1S4Z A;  4KV6 A;  3RN5 A;  1EYD A;  3HG9 A;  1TII D;  1VQ6 A;  3S15 H;  1QZG A;  4DA2 A;  1PYW D;  1N34 Q;  3M4O B;  4XKV A;  1VQG A;  2K1B A;  4TMT A;  1SNP A;  3OW2 B;  2D74 A;  1PH6 A;  2E2I H;  1EIH A;  1HA5 A;  2XSC A;  2MUY A;  2D9U A;  3S14 B;  4K2K A;  1K73 D;  1JJ2 A;  2VB3 X;  4YCV A;  1X56 A;  1LTA D;  1V43 A;  1G7T A;  4LUV A;  4RKL A;  3CQZ B;  5L46 A;  1G6Z A;  3BDC A;  4AVZ A;  3A54 A;  2ENB A;  2GN5 A;  3NTK A;  2E5L L;  4OIK A;  1VQM B;  1N0V C;  1Y1W B;  2CWP A;  1N36 L;  3Q39 A;  1STB A;  2E1B A;  4AF7 A;  1A3T A;  2ALY B;  3OTO L;  3VA5 A;  2B2V A;  1YNX A;  4UY8 C;  3QOJ A;  4RG1 A;  3D4R A;  4Z4W A;  2RDF A;  1IBL L;  4G7O C;  4DNI A;  4IUT A;  5D3D A;  2X3U A;  2NB0 A;  2IWH A;  1VQ8 A;  3ITP A;  3QIA A;  3MWY W;  1Q9S A;  1TS3 A;  1QE6 A;  3J81 i;  1VQN A;  5EPJ A;  3GTO B;  4LUO A;  1E62 A;  3DWQ A;  1ICW A;  5C5L A;  4C3I H;  2IX1 A;  3FKI H;  2A19 A;  2YU9 H;  1GHK A;  5LMZ A;  2N49 A;  1V1P B;  4TKO B;  3GVJ A;  4RGO S;  3CD6 A;  1EZ6 A;  1EU3 A;  1D5M C;  1WTW A;  3CCR A;  4FK8 A;  1PKV A;  4YAW A;  4A3J H;  4G5G A;  3SEJ A;  1RD9 D;  2HUG A;  1BBU A;  2I5L X;  3PUV A;  3Q6Q A;  1NE3 A;  5IYN A;  4GKK L;  3TP5 A;  2JIZ A;  5TV2 A;  1EY9 A;  2E1R A;  1Q7Y D;  4XIG S;  1KD1 C;  2JA5 H;  4UP9 A;  1MRZ A;  1EWI A;  1Y8N B;  1FYC A;  2JSO A;  1SKQ A;  4DR6 Q;  1S5D D;  4NBS A;  2D62 A;  1ILP A;  2F0Q A;  2DY7 A;  1I3Q B;  4KD3 A;  4K0K Q;  3I8Z A;  2D9R A;  1VLY A;  4H02 A;  1H9M A;  2IPK D;  1PH3 A;  2B2U C;  1Q46 A;  1RCV D;  5CV8 A;  1J9Z A;  1UMK A;  5C3W A;  5B6I A;  3GTP H;  1N06 A;  4DR2 Q;  3A1P A;  2HHH Q;  2VQE L;  2RKS A;  1H8E A;  3AB9 A;  3CF5 A;  2KEE A;  4DNR B;  3AVT A;  2B63 G;  4DR3 Q;  4X65 L;  4OO1 H;  4UZF A;  1OXU A;  4A76 A;  4LF4 L;  4A3E B;  3J7A F;  4LF5 L;  3PMF A;  3DXJ C;  4C3H G;  2A1A A;  2XND A;  5EPL A;  4JBJ A;  2TSS A;  3OW2 A;  4KHP Q;  3CC2 B;  3OOC A;  2K5W A;  1MGS A;  4ZRZ A;  4JV5 L;  1ENA A;  3OZU A;  4PC7 A;  4HE5 A;  4PC3 A;  1NRK A;  5EGT A;  3PO2 H;  4LFA Q;  1STG A;  2CW0 D;  3OWE B;  1G29 1;  1LTG D;  1GJX A;  2K75 A;  2X6W A;  3CW2 A;  2WB1 G;  1HZC A;  1VQM A;  3ICE A;  1A2T A;  1GO2 A;  4J1M A;  4ZLT F;  1STA A;  2ZZG A;  1CHP D;  3OE7 A;  2V4D A;  1CNF A;  4NNJ A;  1LTR D;  4XLF A;  4LWC A;  5M3M G;  1E1R A;  3NEN A;  4JC0 A;  3T1Y Q;  2WII B;  1TWG H;  1F9R A;  2YTV A;  4GOP C;  2XGT A;  5IGE A;  2Q6L A;  4DNT B;  4JI0 Q;  1N33 Q;  1QGZ A;  1PDQ A;  5AJ3 L;  1B9N A;  2D0P A;  3TQY A;  3J7A V;  1BCP D;  5JJZ A;  1O7L A;  4GQN A;  1QIL A;  1TWC H;  1TY0 A;  3AU7 A;  3SK6 A;  3GTL H;  3CP2 A;  3BQJ A;  2DN8 A;  2L4N A;  1JB9 A;  1AZQ A;  3SKB A;  1I4H A;  1V1P A;  5JEA H;  4HN7 A;  2Q8R E;  3PUZ A;  1II3 A;  2EDG A;  1YNJ D;  4G7Z C;  1OXV A;  4YHH L;  1UEA B;  3R6J A;  1GVH A;  2WAQ G;  3GTK H;  1IXR A;  3K59 A;  2W6I A;  4RGN A;  3S1R B;  3I4M G;  2ZBV A;  1S4M A;  1KTV A;  4YAF A;  3OYY A;  3HOX H;  4KJO A;  3PUM A;  1QB5 D;  3NTI A;  1XMQ L;  3OEE A;  2RF4 A;  4MTK A;  5K5P A;  3V76 A;  2K5Q A;  1CK1 A;  1GD7 A;  1FRN A;  3CCV B;  3C1E A;  2KCT A;  3Q3A A;  1EXM A;  2E2H H;  3K5M A;  4LF9 Q;  3ONU A;  4P6V F;  3CP0 A;  1UD5 A;  4UZU A;  2V7W A;  1F77 A;  2NTT A;  1EUJ A;  2RQX A;  4A3I H;  5KGU A;  5F4O A;  1N8R D;  1GM5 A;  5GAG C;  2IL8 A;  1X3G A;  2XTI A;  1Y69 U;  3GTM B;  2O4X A;  4JI2 L;  4RD6 A;  1XX8 A;  2JA8 B;  1CUK A;  4P74 A;  4EGV A;  2FXQ A;  3MEH A;  1LTS D;  1MIU A;  1B4O A;  2I46 A;  2KOL A;  3ISX A;  3F2C A;  3B78 A;  5CDF A;  5TY0 A;  2VQF L;  4LK1 C;  4X6A H;  2B63 B;  1BX0 A;  2KHI A;  1XTD A;  2Z1C A;  4LFC Q;  3S16 B;  4LFB L;  5K36 H;  2LY7 A;  3E9H A;  4Z4Y A;  2XZP A;  4B48 A;  1PTO H;  3BCF A;  4OPS A;  1Z9F A;  4N8F A;  1WTR A;  4R4T A;  4LBV A;  1MJE A;  4WZL A;  2Y0S G;  4BBS H;  3A8I E;  3K57 A;  1ONL A;  3I3C A;  3M4Q A;  3HOU H;  4K5W A;  5C3E H;  1XNQ Q;  1XJV A;  1XYI A;  1SLJ A;  4M53 A;  2CH4 A;  3CC2 A;  3ERO A;  4C3H B;  2ZTD A;  1DYQ A;  1EOT A;  1GUG A;  1W2B B;  4JI1 Q;  2B2W A;  1VQL B;  3ULL A;  1VS0 A;  1AEX A;  1GUT A;  4MZ9 A;  3D8G A;  2VNI A;  2V7U A;  3S24 A;  2VNK A;  4RPD A;  1LYL A;  4P9S A;  3BJU A;  3S2H H;  2VBT A;  1I4Q A;  1QX4 A;  3PF4 A;  4B3T L;  1LUZ A;  3RZD H;  4A3G B;  2UXD Q;  3MA2 B;  5FIU A;  4F8M A;  2F0S A;  4DUY Q;  1B2T A;  4JI3 Q;  2WJY A;  1TY2 A;  1EQR A;  4PQX A;  2ZZQ A;  1QZH A;  3I4N G;  3HZX A;  3PVD A;  3ER0 A;  2EYP A;  4NW2 A;  1N32 Q;  1ET6 A;  1WFQ A;  1CFM A;  5CC4 A;  3C1F A;  4X7C A;  4CJ1 B;  5M3M B;  1N34 L;  2NN6 G;  2UUA Q;  2JA7 G;  1A8V A;  2R7F A;  1KMH A;  1SM4 A;  1BVS A;  3UDG A;  1A6X A;  2OYN A;  2ICI A;  4EVO A;  1K8A D;  2VNJ A;  5IWA Q;  2XGJ A;  1VHO A;  2K32 A;  4CKE A;  2BE5 D;  2ZTG A;  1BDO A;  1I8D A;  4ZGQ B;  3KK7 A;  3MXU A;  3HAG A;  2CFM A;  3QG1 A;  1CKN B;  2H4O A;  2OCE A;  1KC8 C;  2ZXR A;  3VDY A;  4DF7 A;  4P2C B;  4H7B A;  1SFO H;  2ES2 A;  2WAQ B;  2FIN B;  1WD0 A;  3J81 k;  3G6E B;  2EY1 A;  3I4M B;  1OGJ A;  2ZM6 Q;  1XE1 A;  1ASY A;  3DM1 A;  3CCV A;  4DV5 Q;  1TR5 A;  4IFD H;  5JPM C;  4QGU A;  2N8N A;  2I07 B;  4JG2 A;  5BR8 Q;  1ZM2 A;  1WTP A;  1JJC B;  1MI2 A;  2ZXH A;  4X8I A;  3MTS A;  2ZJR A;  1C8C A;  2XRQ D;  2HDM A;  4G1V A;  3GQB A;  5FO7 B;  1LTT D;  1RL2 A;  1B2R A;  4FF3 A;  5J1Z A;  2JE6 I;  3QSY A;  1VMP A;  4P3I A;  4DN4 M;  4DXF A;  2ZJP A;  4LF7 Q;  4V19 0;  2G9H D;  1EEI D;  1LO5 D;  4IW3 B;  1EWH A;  2F0I A;  4NB3 A;  3S17 H;  2C78 A;  1UEB A;  1EFU A;  3OJX A;  1DM0 B;  2KVO A;  2R6G A;  4KY5 A;  2TMP A;  1WCM H;  2Z6B A;  3Q22 A;  2KCN A;  1EFT A;  4GNX C;  3RLO A;  1HTL D;  2C77 A;  3Q38 A;  3P20 A;  3S2D B;  3FPK A;  3TP6 A;  1GHJ A;  2WP8 J;  2XNA C;  3QFS A;  2C5H A;  2B8G A;  4YWL A;  2Y0S B;  2NPF A;  4DR6 L;  2ZZE A;  2IY5 B;  1G6P A;  1A0I A;  5M5W H;  2F4V Q;  5DNF A;  3FDT A;  4IUN A;  2A6H D;  5COR A;  4K0K L;  1JA1 A;  4Y7N H;  4FP5 D;  2CF4 A;  3ULJ A;  4TMX A;  1D7Q A;  1NSN S;  3A7A B;  3D4D A;  1W2B A;  1VQL A;  1L1O B;  4N8X 1;  2CHB D;  1WYD A;  2MFI A;  1NNX A;  2GRE A;  3MEF A;  4KKU A;  3AVX A;  2RSO A;  1MHW C;  4R4Q A;  4DR2 L;  5IP9 G;  3HOY H;  2HHH L;  1Y0R A;  1PA6 A;  4RM0 A;  4A3K H;  4RCY A;  3CCJ B;  1FL0 A;  1C9O A;  4KN7 C;  2NVY H;  1DOM A;  4A3C H;  3OAA A;  4U68 A;  3RLF A;  3WOE A;  1KJZ A;  3W1B A;  3SLD A;  2P3M A;  3UE0 A;  5ELC A;  3QFT A;  2FFK B;  2KBN A;  5EBC A;  4PGO A;  2KEC A;  4FXD A;  3IAY A;  1Q82 D;  2PW7 A;  5A2Q E;  1PYB A;  1HPC A;  1GVP A;  3NP8 A;  1JA0 A;  1WI5 A;  1P16 A;  5FOB B;  3ZIA A;  1K3B C;  4YAU A;  1K9M D;  3PIP 3;  4A3D G;  4IQZ A;  1VQF A;  3BZD B;  1T6Z A;  2F43 A;  4KN4 C;  5EPK A;  4B47 A;  4DAM A;  5G3L F;  2Z6B D;  4R9W A;  4KHP L;  1IYU A;  1UD6 A;  2OXP A;  2LMC B;  3D31 A;  4DAY B;  3V96 A;  2RHS B;  3RR5 A;  4CBV A;  4LFA L;  1BJK A;  4KKT A;  3GV3 A;  4WZE A;  2XRS D;  2G5D A;  1BF4 A;  5DSZ A;  1VQA A;  1CKN A;  3MMP A;  4WWV A;  1VCI A;  3D6W A;  3JQP A;  4JMQ A;  1PH4 A;  3CMA B;  2ASB A;  5IGB A;  3LNN A;  3WQZ A;  2AUK A;  3W2D A;  3JAM i;  1PJ6 A;  2YWF A;  1SE3 A;  2IX0 A;  3KF8 B;  3G6E A;  1H8H A;  1L0X B;  4A3F G;  1F9Q A;  1XQB A;  1AN8 A;  1ESF A;  1JC7 A;  4P71 A;  3ASQ A;  4RH6 A;  5FA6 A;  3T1Y L;  1B8A A;  1QGY A;  4WOR A;  4OEM B;  2CKZ B;  4GS3 A;  1FNC A;  2PMZ E;  1F2Y A;  2JA6 H;  2VNH A;  4RGT A;  4DKA C;  4JI0 L;  1N33 L;  4Z4U A;  2R93 G;  1K83 B;  3BDL A;  1ZYR D;  3FPU B;  1HZA A;  1TU2 B;  1YHB A;  3M9B A;  3TRZ A;  3CCU B;  4IPH A;  5GAD C;  2MGS A;  4CJ2 C;  3M4O H;  1HZ9 A;  3RD4 A;  4C1N I;  4XT3 B;  4E6I A;  1CI3 M;  1DJR D;  1KL9 A;  2V1C C;  4XON A;  1AP0 A;  1EYG A;  3S14 H;  1KDA A;  4DR1 Q;  4OON A;  1FDR A;  4WJ4 A;  4G1B A;  3CQZ H;  1KQS B;  4NKL A;  4WJ3 M;  1SAP A;  3H91 A;  1W6J A;  4BY1 G;  1Y1W H;  4ZQ3 A;  5I9P A;  1GUO A;  4XOT A;  3OFN A;  4XOP A;  2VY3 A;  4Y9R A;  3QWN A;  1PZI D;  1DDI A;  3KF6 B;  1X3P A;  3FKS A;  1HQM C;  4C43 A;  2Q2H A;  4TQU S;  5AFW A;  4LF9 L;  3KLR A;  5HGQ A;  3K7U C;  2E8G A;  2XWB B;  1L1O A;  3A7L A;  3STB C;  4P2N A;  1V8Q A;  4K1X A;  1XPR A;  4HIZ A;  2NYZ D;  5DN6 A;  1E7Z A;  2ZXP A;  2QEJ C;  3GTO H;  3T53 B;  4Z4T A;  4AQY Q;  2RSN A;  5CR3 A;  3CCJ A;  1D6E C;  1R4P B;  2PNH A;  1TWA B;  2J7K A;  5IP7 H;  4TVA B;  1IKL A;  3FMC A;  4LFC L;  3QE2 A;  1FRQ A;  1OGI A;  3U58 A;  1VMC A;  2K5N A;  5C0X H;  2VUM G;  4LUZ A;  3K0X A;  2QTZ A;  3R6K A;  2BSA A;  2OTL B;  1KRT A;  4X3S A;  2C2W A;  1SE2 A;  1XNQ L;  4DV1 Q;  2RDH A;  4HED A;  1YX2 A;  1CT1 D;  4A3D B;  4E0F A;  4DV6 Q;  2SDF A;  4DAY A;  4KY7 A;  2W6J A;  4JI1 L;  4DV0 Q;  1TWH B;  2C4T A;  1KLG D;  2EYJ A;  1JJG A;  2BDN A;  4C2M B;  3S17 B;  3BZC A;  1I3Q H;  1PZJ D;  4GOP B;  2F03 A;  4NP5 A;  3CMA A;  5M9O A;  3HOZ G;  1K3R A;  4PMB A;  1JWM D;  2VL6 A;  4A3M B;  2UXD L;  1A63 A;  1BKB A;  1STH A;  3ZJY C;  3MXP A;  3KF8 A;  4DUY L;  2F3I A;  1C0A A;  4JI3 L;  1I4R A;  5C4H A;  1U4P A;  3F2U A;  4ILW A;  2J0T D;  4YCW A;  4A3F B;  4RCZ A;  3FRP B;  5HGT A;  3HP3 A;  1N32 L;  1KRS A;  3CB4 A;  1I6V C;  3ZBU A;  4X62 Q;  1DON A;  3L7Z C;  3PEN A;  2UUA L;  3T1H Q;  1K0S A;  4L6T B;  3H09 A;  3U2Q A;  2P5Z X;  4A3E H;  5IWA L;  3WWV A;  3CCU A;  1D1N A;  1G7R A;  4GZY C;  4X07 A;  1D5Z C;  2RA4 A;  1FJG Q;  1NB0 A;  1ZM4 A;  1SN8 A;  2OBR A;  3ONA B;  2OQ0 A;  3QO2 A;  5EJW A;  4B3X A;  1KHI A;  2WPD A;  3HGB A;  3IRB A;  1PH5 A;  4FF2 A;  3D6C A;  1HH2 P;  4O42 A;  1T6Y A;  1KZL A;  4Z4S A;  1JOO A;  1PH8 A;  3Q6R A;  5IYB G;  5BN3 A;  2RBM A;  1N0U A;  3BY2 A;  3GIR A;  5IYD H;  4G4K A;  2ZIT A;  5JOB A;  1EIF A;  1SDF A;  4M2L A;  2ZM6 L;  2QDX A;  1I4X A;  2CW5 A;  3QFR A;  1IBM Q;  2MHV A;  1J8I A;  2M00 A;  4BY1 B;  2YTX A;  3H3V I;  1QG0 A;  4ZYS A;  4PMW A;  1ASZ A;  4POG A;  2XEX A;  2EVB A;  3KF6 A;  4DV5 L;  3CC7 B;  3WBK A;  4YCU A;  1F2L A;  1YI2 B;  4ZCL A;  4LJZ C;  1VQI A;  3SE0 A;  3TRE A;  4DGZ A;  4HIK A;  5BR8 L;  3Q24 A;  3SXH A;  2I5H A;  1OXT A;  4CKB A;  1MSG A;  3VMF A;  3GTJ B;  5IK2 A;  1YJW B;  3SR1 A;  5LMN Q;  4LF7 L;  2FVG A;  3W5O A;  3P26 A;  4JYA Q;  1CZW A;  2K7V A;  1KD1 D;  2OBT A;  1EU4 A;  5ELO A;  3N52 A;  1W87 A;  1TWF B;  3TSS A;  1PZK D;  5M3F G;  1YIT B;  1K8G A;  2BH2 A;  1BPL A;  3TZU A;  5GQO A;  3S1R H;  2CQO A;  3WXM A;  4B4D A;  2OTL A;  4YAL A;  2EPB A;  2KEN A;  3CKI B;  2AKW B;  5IGF A;  3HEJ A;  2F4V L;  1RHP A;  3A56 A;  2HLD A;  2B7C A;  5J35 A;  3BU2 A;  2F0O A;  4Z9C B;  1EQQ A;  3BNW A;  1I4G A;  4A3L G;  1QFY A;  5CV5 A;  4GOP A;  1M4V A;  2BGI A;  4OWT B;  2R7D A;  4XD7 A;  3W2H A;  4YXW A;  1EY8 A;  1Z7T A;  3IL8 A;  2F0L A;  4HJA A;  1DD2 A;  4A93 G;  2KCM A;  1RQR A;  3NK9 A;  3K5N A;  3HRZ C;  4B3F X;  3Q6S A;  3HOZ B;  3BVG A;  1BQQ T;  1EIY B;  3GTM H;  3CCL B;  1Y1V G;  3H0G B;  4OOV A;  5HKK A;  2DCU A;  2JA8 H;  1W0K A;  1FD7 D;  2M5S A;  1RTN A;  1UUP A;  4B3R Q;  2B2Y C;  1TKW B;  4BXX G;  3QJY A;  3U4V A;  1I4P A;  4EH1 A;  3M3Y B;  1A2U A;  2B63 H;  1MSH A;  3S16 H;  1RF2 D;  1W6K A;  3OSO A;  2AMC B;  4FXU A;  4II2 A;  1DOK A;  4HID A;  4A3B G;  3CES A;  1NR2 A;  5I9O A;  3P27 A;  3OIQ A;  3UI2 A;  4XLH A;  4X7D A;  1NAP A;  4C3H H;  1TS2 A;  3JU4 A;  4GN3 B;  2WFW A;  2IX3 A;  1WTO A;  2JJQ A;  5FNZ A;  1PMR A;  1Y8O B;  5D14 A;  1EEF D;  4XQQ A;  4P22 A;  2C5C A;  5F4J A;  2Q8I B;  3OPO A;  1LT4 D;  4TSS A;  5C5M A;  4BWG B;  3SK8 A;  1NTG A;  1JOK A;  1X3F A;  1VDZ A;  3HOW G;  4ZUI A;  4A3G H;  1I7P A;  4NDX A;  3BS1 A;  2A5H A;  3MHB A;  1CKM A;  2VJJ A;  3CC7 A;  4JBW A;  1YI2 A;  1EFC A;  3HKZ E;  4K5V A;  5IOD A;  3GTQ B;  5FO8 B;  1GKH A;  3AVW A;  5M3M H;  4GNX B;  2R92 B;  3NHH A;  5J3B A;  3DM3 A;  4OHJ A;  4X0C A;  2F1L A;  1SMY C;  5A88 A;  1YJW A;  4XLE A;  3R93 A;  4QCL A;  2A68 C;  2HQE A;  1Z47 A;  1X6O A;  4UP8 A;  1PH9 A;  1KNE A;  4Y52 H;  1SJH D;  2L11 A;  3M7N A;  4DR1 L;  5H1S E;  3CP8 A;  2SNS A;  3ZZU A;  4KLK A;  1EQT A;  4PV1 C;  3EVQ A;  3PUX A;  4RKB A;  3S1N B;  1YIT A;  4BY7 G;  3LVB A;  1EZ8 A;  1AE3 A;  4JPB W;  3SK4 A;  1R9T B;  2WIN B;  1MKH A;  1G8Z D;  5M3F B;  2Z0S A;  5H5J A;  2AWO A;  2CH4 W;  1BXT A;  1LLR D;  3I4M H;  1SJE D;  2RC6 A;  2X0K A;  4JW0 A;  3LGJ A;  4OWX B;  3ERQ A;  2R9V A;  2F0V A;  3RMH A;  2BA0 A;  4B9X A;  2H5X A;  5F4M A;  1Q90 A;  1T6X A;  3Q23 A;  5A2Q L;  2WKD A;  3AFQ A;  3CRK C;  2EOT A;  1H9J A;  1SRO A;  1V0F A;  4C3J G;  1G7S A;  3K7A B;  3E20 A;  1NUC A;  1SRU A;  3U9O A;  4AQY L;  2N3S A;  3PA2 A;  1LV9 A;  3E1Y E;  4F87 A;  1NR4 A;  4A3J G;  4A93 B;  4QQB X;  3CCL A;  1NMG A;  3W1G A;  3ZZ0 A;  1Y1V B;  4CDE C;  4IUR A;  4UHV A;  1V1O A;  2K5V A;  2E75 C;  3I4N B;  3A5Z B;  2EIX A;  2JA5 G;  3ZZT A;  4QUC A;  1FND A;  4HSP A;  1PFN A;  1B53 A;  2QDB A;  4ZV4 A;  4DV1 L;  4RDL A;  2DOG A;  4KJN A;  4EQO A;  3S2D H;  3NBI A;  4KHZ A;  4DV6 L;  2O5I C;  1G2S A;  2PI2 A;  3FP9 A;  4UPA A;  2XIW A;  3VR5 A;  4DV0 L;  5JPN C;  1VQ4 B;  2DIE A;  3MZ5 A;  2QKI C;  1IB0 A;  2WAQ E;  5BSX A;  4L5S A;  2EY2 A;  4LF6 Q;  3W5H A;  4X3K A;  4H44 C;  2LSS A;  3V05 A;  1VF7 A;  4XQN A;  4Y7C A;  5IYQ A;  2ZJQ A;  3AST A;  4QVJ A;  1I6H B;  4OL7 A;  4DR7 Q;  2R6H A;  4KI0 A;  3ZYY X;  4OO1 G;  1JOQ A;  3LQE A;  3H94 A;  1EP2 B;  5E1F A;  5I4D A;  4A75 A;  1C48 A;  1HZE A;  3A8K A;  2C5B A;  2PQE A;  4X62 L;  5COY A;  1V0E A;  5TR9 A;  3T1H L;  4G7W A;  2MP1 A;  2XZO A;  1P8L A;  1SYE A;  3PIO A;  3H3V C;  1EFR A;  1UD2 A;  2F0W A;  4GNX A;  4ZCK A;  4YWM A;  3I4N H;  1KC8 D;  1KK3 A;  1SNM A;  1FJG L;  3NUC A;  3PO2 G;  2NN6 H;  4GN5 A;  2R61 A;  3PF5 A;  1NY4 A;  2OTJ B;  1E64 A;  3I73 A;  3CRZ A;  2EQS A;  4X64 Q;  1S3O A;  3NQI A;  2Y0S E;  1U2R A;  1WP6 A;  4ZAI A;  3O13 A;  2EYH A;  1YJN B;  1IBM L;  1TUI A;  4V0B A;  4BY7 B;  1ILQ A;  2GVB A;  5CV4 A;  3ASP A;  2QEX B;  3QOL A;  4JI5 Q;  3VYT A;  4AYB G;  1COW A;  3FHW A;  3BVZ A;  1CZG A;  1VQD A;  4DV7 Q;  1X55 A;  4RD0 A;  4ME5 A;  4POF A;  1HUN A;  3WBJ A;  3TBI B;  4U67 3;  5FLX E;  3A8J A;  1C4Q A;  4H0L C;  1YIJ B;  2Q6I A;  3ONY A;  3M4P A;  4F88 A;  1ELO A;  3RZO B;  4DFA A;  4ZKC B;  2NZ1 D;  3A55 A;  5LMU L;  1K83 H;  2D0O A;  1QWY A;  3WYA A;  2WKC A;  2UXB Q;  3GO5 A;  1T9H A;  3Q8D A;  4ULL A;  2KVM A;  2WB1 B;  1WOR A;  1XB2 A;  1A3U A;  1ZEQ X;  1KIX A;  1IKM A;  5LMN L;  4RHS A;  2DJG C;  2BH8 A;  4C3J B;  4JYA L;  4M0L A;  5I2X A;  2UUC Q;  4IZ8 A;  1E1T A;  4LW1 A;  1G2T A;  4DV3 Q;  1S72 B;  2UU9 Q;  4MIU A;  4NXN Q;  2RDG A;  2E2J B;  1Q1B A;  5E3F A;  4R4O A;  5CV6 A;  1KK2 A;  3B82 A;  3MCA A;  2JEB I;  2ATW A;  1YJ9 B;  3GSI A;  4RDK A;  2WZN A;  3UDF A;  2LKV A;  3MC0 B;  3PO3 G;  5EKL A;  4YWK A;  1GXD C;  2B39 A;  1S40 A;  1VQ4 A;  2F0E A;  2BVN A;  2K5H A;  3BG3 A;  1ML0 D;  1H85 A;  1ESR A;  3R2T A;  3R8B A;  4A3I G;  1OTC A;  1BNZ A;  1F9P A;  5C3X A;  3HOV G;  1H42 A;  4CHT B;  2HD3 A;  5IYR A;  1WTQ A;  1A15 A;  2AWN A;  2PW5 A;  2V7V A;  4RLZ A;  4JI7 Q;  1VQ7 B;  5TRD A;  4DUZ Q;  1YHA A;  2IT1 A;  1QG7 A;  1TVX A;  2LXK A;  3PUN A;  1H95 A;  3CCS B;  3VNU A;  3OWF A;  5IGD A;  3AGP A;  5K36 G;  4HAE A;  4B3R L;  1BR9 A;  4K5X A;  1TWA H;  4P75 A;  3T4A C;  1QFZ A;  5HXB A;  1PLF A;  1SYD A;  4OXP A;  5I2Y A;  1JOR A;  3HOU G;  4PC1 A;  5FLM H;  5C3E G;  1FNM A;  2BGJ A;  4YAO A;  2F3V A;  3J81 c;  4GLV B;  3V2T A;  2GQF A;  4JOI C;  4OO1 I;  5JEA J;  3CC4 B;  3EBE A;  3OKX A;  5FO0 A;  3OHX C;  4UAI A;  2HMA A;  1JB3 A;  1JCK B;  1SSO A;  3R3O A;  5C4J B;  3OZW A;  4A3D H;  4OGQ C;  4N3G A;  1M90 C;  1EY5 A;  2OTJ A;  1TWH H;  1CSP A;  1V9P A;  2I5M X;  1G7C A;  4P73 A;  4C2M H;  1E1O A;  4DK1 A;  2VJI A;  4EX5 A;  4XL9 A;  2B5O A;  4X3U A;  1U9R A;  4HR7 B;  1YJN A;  2BPO A;  3NBH B;  1X3Q A;  2YV5 A;  4R4I A;  2JQO A;  3NWS A;  4A3M H;  3KJO A;  2PZU A;  4A4I A;  4PZ8 A;  2QEX A;  1IW7 C;  1PFS A;  3ZPN A;  2DY8 A;  2BMW A;  3VO1 A;  4WJW A;  1HFG A;  2YWE A;  4A3F H;  2GJR A;  4RPB A;  1ENF A;  4AYB B;  1Q81 C;  2Q6O A;  4CDF C;  1GAQ A;  1YIJ A;  1WPC A;  3WNC A;  1E79 A;  4RD1 A;  2NVX B;  2VBU A;  5HZA A;  4L5R C;  1PH2 A;  1S5B D;  5CYU A;  2KQ3 A;  3FEW X;  3I70 A;  2F0T A;  4RCN A;  4XYQ A;  1NBM A;  4CJ0 B;  1HNW Q;  4DR3 L;  4L8J A;  3VO2 A;  3DEO A;  3L3O C;  1XFO A;  1M1K C;  4S3S A;  1S72 A;  1EY6 A;  2BM0 A;  3VR6 A;  4MN3 A;  4R8N A;  5DM6 3;  4MHE A;  2EXD A;  2D3L A;  5KW9 A;  5IT9 E;  4UAJ A;  4DXG A;  4APV A;  3F1Z A;  3S1Q B;  2F0J A;  1QH0 A;  4KKS A;  1QOH A;  1X32 A;  1DG1 G;  4JI8 Q;  2VZA A;  3DHQ A;  3STB D;  5IYC H;  1YJ9 A;  2JA7 B;  4G57 A;  2DNE A;  1GJR A;  4BY1 H;  1FNV A;  4Q7J B;  3X3M A;  3AFP A;  3PO3 B;  4TMW A;  3SJP A;  2EYM A;  2CBX A;  3AMU A;  2L5T A;  1L2F A;  1XMO Q;  1XNR Q;  2JYO A;  2GVA A;  5JBQ A;  1TVC A;  4BA1 I;  3HOV B;  3KL9 A;  1JWS D;  2G9D A;  4XDX A;  1HNZ Q;  1PXU A;  1VQ7 A;  4HCE A;  3GTJ H;  4NXM Q;  3KFU A;  1CTM A;  1F60 A;  3CCS A;  3DUZ A;  2PPB C;  3N6R A;  1WSV A;  5IIF A;  1YHQ B;  3SVM A;  5FLX c;  1O7I A;  5D65 A;  3ND9 A;  1E2W A;  4K2L A;  4YHB A;  1K0R A;  3EJI A;  3GTG B;  3U6B A;  1RKN A;  1TWF H;  2QCP X;  4QUZ A;  3D4W A;  4N3N A;  3NEM A;  2V7T A;  1RIP A;  4B08 A;  2I0Q A;  3CC4 A;  2JDI A;  1LTL A;  3U4Z A;  5KND A;  3X3N A;  3KLW A;  2M2L A;  3CPW B;  4LF6 L;  2VW9 A;  3KUP A;  5FK9 C;  1GUS A;  2K4K A;  4X66 Q;  2DYI A;  5H59 A;  2GA4 B;  1KNA A;  1CA5 A;  1PJ5 A;  3TDQ A;  1HFN A;  2V7X A;  4IFD J;  1DCZ A;  3NBH A;  3JQR A;  4DR7 L;  4XKW A;  2FX3 A;  4DQK A;  1PTO F;  4ABN A;  1LTI D;  4BBR G;  3HOZ H;  2PZW A;  2F1M A;  4NPS A;  4YEL A;  4LF8 Q;  1MJC A;  2RHQ B;  3H0G H;  4FDB A;  1YZ6 A;  1BBW A;  3JC6 6;  5M5Y B;  1Y14 B;  2GJP A;  1F9S A;  1BLI A;  4Z4R A;  3J81 j;  3MAQ A;  2XNC A;  1U4L A;  4J8Q A;  3M3Y H;  4FN5 A;  2PIA A;  4GLX A;  2ID0 A;  2K03 A;  4FXK C;  1KXL A;  1NCV A;  4QY7 A;  4OOX A;  1JQY D;  1HNX Q;  1E22 A;  3GVK A;  1X65 A;  2ZT9 C;  1HCZ A;  1FR3 A;  1Q12 A;  3CAM A;  5IY0 A;  5J3O A;  1CNE A;  4KD4 A;  2HDN B;  1OB2 A;  1NMF A;  4X3T A;  1YEZ A;  4QV2 A;  2QF7 A;  4X64 L;  2B7B A;  1SKY B;  3BCD A;  2IHF A;  5KSW B;  1XPO A;  5BN4 A;  4K8I A;  1J5E Q;  1JT8 A;  3GDE A;  4IN3 A;  2WR8 A;  1H9R A;  2B29 A;  1Q1E A;  3VYU A;  4LAA A;  3PCO B;  4PZ6 A;  3U6K A;  2L55 A;  3JAM E;  4JI5 L;  3WND A;  1WTV A;  1HQR D;  1U5K A;  4PZ7 A;  5FJ8 H;  5IYP A;  3G4S B;  2Z6K C;  1OB5 A;  1PJ7 A;  2QN6 A;  3IKJ A;  1HVX A;  2HQL A;  5M5X B;  3I56 B;  1CA6 A;  1QUQ B;  1V1Q A;  3W2F A;  2B2Y A;  2SEB D;  3HFZ B;  2MPM A;  4L5T A;  1UNS A;  1WJJ A;  3GTQ H;  3D3R A;  3KLS X;  4IFD I;  2UXB L;  1AH9 A;  5KNB A;  2AHO B;  3J7Z C;  2R92 H;  5G3L D;  3DLL A;  1AFP A;  1ENC A;  1BUV T;  1SNQ A;  3DEP A;  4MYT A;  3SLN A;  4I7Z C;  1IYJ B;  2UUC L;  2IHE A;  4DV3 L;  2CWA A;  2UU9 L;  1EWC A;  4XQJ A;  2NV4 A;  4HJ7 A;  1YHQ A;  4NXN L;  4ZKB B;  3C2P A;  1Y1W G;  5DS0 A;  4XQF A;  2Z4I A;  2PI2 E;  1OO9 B;  1D8T A;  2B2T C;  4K6D A;  3ERS X;  4HJ5 A;  1DOL A;  4DR5 Q;  3S1N H;  2R93 B;  2I1L A;  2JN4 A;  1R9T H;  2PQA B;  4TN1 A;  2NWG A;  5M3F H;  4JI4 Q;  2NVQ B;  2MO0 A;  3MFY A;  2L12 A;  4YY3 Q;  1W35 A;  2JXM B;  1E3P A;  1IHZ A;  5HUR A;  3QFC A;  2N88 A;  3CPW A;  1N05 A;  5IT9 c;  3LQ6 A;  5KNL A;  1NJI C;  2XZL A;  2VXW A;  2Q2T A;  2A69 C;  2B2U A;  1KQS A;  1SYB A;  4JI7 L;  4DUZ L;  1WTX A;  1ZM3 A;  4B3G A;  4I65 A;  4A3L H;  3A8K E;  4CDC C;  2F0N A;  1J6Q A;  1WOP A;  3DWA A;  3K7A H;  3ULP A;  2ZBU A;  1CHQ D;  1GUW A;  1B23 P;  1WTH D;  4PC2 A;  2KHS A;  5EMN A;  5KYL A;  4A93 H;  3I7F A;  5EKI A;  1Q86 C;  4RD4 A;  4BBR B;  1BBX C;  3UDI A;  1Y1V H;  3DWP A;  1PH7 A;  2ZL6 A;  3CMM A;  5CBE E;  5ISR A;  3J80 E;  3W2I A;  4DV2 Q;  2CVR A;  4AH6 A;  2KED A;  2WJV A;  1QUF A;  4M1U B;  4BXX H;  4RMF A;  1QCB D;  2N78 A;  3OMC A;  4KMU C;  2RCF A;  1B9M A;  1PV4 A;  4FF1 A;  1QJO A;  1C7Y A;  5E6T A;  4AIM A;  2Z4H A;  4QUF A;  3LX0 A;  4ID6 A;  2HCI A;  4B44 A;  4X06 A;  5FLX L;  5C44 G;  3CTA A;  2NVT B;  4EQ5 A;  3EIV A;  3MXN B;  3T51 B;  2D3N A;  2K14 A;  1VQO B;  3MFG A;  3S1M B;  2CND A;  1IYV A;  2M9V A;  4RA8 A;  2VBS A;  2V7Q A;  1E24 A;  4IPD A;  3T56 B;  2BOS A;  2OEO A;  5IGG A;  2VUM B;  1S5E D;  2E2D C;  1IBK Q;  1OB0 A;  4QL5 A;  3DDY A;  1PRT C;  3UDX A;  5KRU A;  1I6H H;  2D2C C;  5C4X G;  3KYH C;  2Q8T A;  1SMY D;  3G4S A;  2N55 A;  4ZCM A;  4XTC S;  4K8J A;  2A68 D;  2VYQ A;  3I56 A;  3K6O A;  1Q3L A;  1QUQ A;  5LMN W;  4FXG C;  2EY5 A;  4P12 A;  2QMU A;  1KAW A;  2K28 A;  1B44 D;  4PG3 A;  3AYH B;  4DPG A;  4MNO A;  2F0U A;  2PNR C;  2AHO A;  5KNC A;  2JJ2 A;  2HIV A;  2F0F A;  3PGZ A;  4Q0F A;  3RUZ A;  1HNW L;  5C0X J;  3I1F A;  4UZE A;  4JVZ A;  4IOC A;  1I18 A;  2C9O A;  3L9A X;  2DET A;  5IYD G;  3WY9 A;  2K01 A;  3OMG A;  4OIJ A;  2X6X A;  3LWE A;  4GLA C;  3G71 B;  3OW7 A;  1LT6 D;  2AUJ D;  2EYO A;  3L0O A;  3HS0 C;  4QHY A;  4JI8 L;  5IYW A;  4MYU A;  5CV9 A;  4DK0 A;  4QVA A;  5IOC A;  5JVG 3;  2SOB A;  1BCP F;  3OIP A;  5HZB A;  2IW3 A;  3B8H A;  3VR3 A;  4QIW B;  4CQJ A;  2PQA A;  4B9W A;  1EYA A;  1W9X A;  4BY7 H;  3EN2 A;  4K14 A;  1R5N A;  4ZGN B;  1YBY A;  3TS2 A;  3TZD A;  3Q0A A;  3VA7 A;  2FMM A;  1D2B A;  3OZV A;  3KDF B;  4Y9U A;  1XTC D;  1FGU A;  1XMO L;  2B3G A;  1JWU D;  4ACB A;  1XNR L;  4EQN A;  4JI6 Q;  1PTO C;  1F20 A;  4B43 A;  2EJM A;  4RFB A;  3JAM c;  5JVH 3;  1HNZ L;  2R7Z G;  3RZO H;  4NXM L;  5ELE A;  2RC5 A;  4Z4V A;  1FNW A;  4R71 A;  1SNO A;  1HTP A;  1QNK A;  1MD2 D;  3E3X A;  1EP1 B;  1E63 A;  1SYC A;  1RJT A;  3E0J A;  3MXG A;  4C3J H;  3NXW A;  1SE8 A;  4TMV A;  3ZC3 A;  5BSY A;  3PSI A;  2XWJ B;  2EJG C;  2QGQ A;  1UD3 A;  1Q8I A;  1P4M A;  2WSS A;  2DEU A;  2E2J H;  1YNN C;  2X6L A;  2Q6K A;  3D26 A;  1CSQ A;  1WOO A;  3W2E A;  1AIP A;  3BVM A;  5C0X I;  5JJL A;  4OWW B;  1JE5 A;  3EQL C;  1Q8K A;  4QFM A;  3PUY A;  2QTL A;  4X66 L;  1X54 A;  1F2M A;  2OBS A;  4P26 A;  1EOV A;  3MXN A;  3BZK A;  1VQO A;  4XOR A;  3HKZ G;  3KOJ A;  5C44 B;  2X8K A;  1K8O A;  1SMX A;  5T1G A;  2OQK A;  3MVV A;  4C1N K;  2JA8 G;  5D3I B;  1K73 C;  1SR3 A;  1VF5 C;  4HTH A;  3SDZ A;  1WOC A;  2JN9 A;  3KEW A;  1O78 A;  2K33 A;  4F7X A;  1ZM9 A;  1A3V A;  2ZZF A;  2F0P A;  4LF8 L;  2Q2I A;  2LFN A;  1ET9 A;  1QGA A;  3OP1 A;  1KTK A;  4RJL A;  2WB1 E;  5JJK A;  5C4X B;  3I4O A;  5IT9 L;  1D2E A;  4TSF A;  5J39 A;  1VQK B;  4C3I G;  3FKI G;  3C3L A;  1VLO A;  2F0H A;  3BY1 A;  1PH1 A;  4IUP A;  1W34 A;  2NUC A;  3J81 E;  4F7D A;  1A62 A;  3VYR A;  1HNX L;  4GKJ Q;  4FF4 A;  3B6Y A;  4FVM A;  2XN9 C;  4CKC A;  4WFN 3;  3F8T A;  2ZTC A;  5EKK A;  1PYS B;  1SBB B;  3DMU A;  5C4J H;  3I55 B;  3K80 C;  2BN4 A;  4DR4 Q;  4KY6 A;  3J80 c;  1I50 B;  1J5E L;  3BDO A;  3G71 A;  4IOA A;  4A3G G;  1KRH A;  4X05 A;  2F0K A;  1STN A;  3AVY A;  2HCJ B;  1ZUN B;  5J22 A;  1BMF A;  4ALP A;  4RGM A;  3GD7 A;  1CM9 A;  2LZJ A;  1IJE A;  1R4Q B;  5TSS A;  4A3B B;  4L5Q A;  2Q2U A;  1SXT A;  2FJ2 A;  3KDF A;  1I94 Q;  2O5J C;  2EE1 A;  3G7L A;  3CCQ B;  2NTS A;  1EFI D;  3CCE B;  4P1V A;  1T5E A;  4LBZ A;  1Q7Y C;  3KJP A;  4YIJ A;  2GK6 A;  3M7G A;  3OEH A;  4PC6 A;  2C35 B;  3K5O A;  4JOI A;  5CMD A;  1D1K A;  4G7H C;  2NVX H;  4M4S A;  2R7Z B;  4TRD A;  2KA7 A;  4P25 A; 
#chains in the Genus database with same CATH homology
 3A35 A;  2B2V C;  2EJF C;  5LL6 X;  3VYS A;  3HOW B;  1TS4 A;  2DNC A;  3BYY B;  1H9K A;  3GP7 A;  1SEB D;  3S15 B;  3WOF A;  4IUV A;  1SYF A;  4XLC A;  2E2I B;  3H6M A;  5DEH A;  3T13 A;  1U4R A;  4L63 B;  2LS0 1;  3BC9 A;  4IAL A;  3GVL A;  4KHV A;  4KTA A;  4C56 C;  2PO4 A;  5T1I A;  1SYG A;  2WV6 D;  3FVQ A;  4O1N A;  5KEE A;  2VNU D;  2ZTN A;  1XXG A;  2X69 A;  1UAP A;  2BA1 A;  3HKZ B;  3NTH A;  3VR2 A;  5DAU A;  5C4Z A;  2CW0 C;  1S5F D;  5CGK A;  1TT2 A;  5KYI A;  1SE4 A;  4RAU C;  5I6Y A;  3TN2 A;  2GJK A;  2QIL A;  1QNU A;  5E4X A;  3KBX A;  4QF4 A;  3EFX D;  4KK7 A;  1LT5 D;  1OXS C;  3JAM L;  4C3I B;  4XT1 B;  5FO9 B;  3FKI B;  5JEA G;  2YU9 B;  4FYD A;  3BYT B;  3GV6 A;  2GK7 A;  1UD4 A;  2J4X A;  3I90 A;  4EQP A;  4A3J B;  1IW7 D;  1KAB A;  1BCP C;  1DZ1 A;  2L9H A;  2MJ8 A;  2EYL A;  1HXY D;  3K5L A;  1LT3 D;  2JA5 B;  3W3A A;  1YNJ C;  3IFD A;  2KJX A;  1K8M A;  1EY0 A;  3G05 A;  2KCC A;  3TP8 A;  1KAA A;  1MBY A;  2RVL A;  3R2I A;  3K58 A;  3SEB A;  3GTP B;  4ZK9 B;  1LTB D;  4LMQ D;  2L1B A;  3NWT A;  4R8I A;  4RHR A;  1E3X A;  4XM3 A;  1SNC A;  1KDB A;  4XN0 A;  4N9P A;  1EYC A;  4QB4 A;  2F0G A;  4HMJ A;  1GUN A;  3CRL C;  1L0Y B;  5IGC A;  4XLA A;  4BS9 A;  3PO2 B;  1E3Z A;  3PV0 A;  1VJS A;  3J80 L;  3SHL A;  3ND8 A;  2H1E A;  3C46 A;  2A73 B;  2QE7 A;  2D5D A;  4XXE A;  3TP7 A;  3NPP A;  3KLS A;  3CU7 A;  1JE4 A;  1BO0 A;  1O7Y A;  1TWG B;  1H9S B;  1XWE A;  4M8A A;  2K6A A;  3SK5 A;  2VB2 X;  3M4Y A;  3EA6 A;  3K0Y A;  2WZP P;  1STY A;  5I6W A;  4PMC A;  1TWC B;  4FNF A;  3GTL B;  3WDN A;  1PRT B;  4YEJ A;  1E43 A;  1FGB D;  1DXM A;  4ODG A;  1TS5 A;  1CQF A;  3A3G A;  2F4I A;  1E2Z A;  1M8A A;  2A74 C;  2OF1 A;  4Z1M A;  3GTK B;  4G6I A;  2K05 A;  1ZKO A;  3PUW A;  3PIO 3;  3HOX B;  1U4M A;  2IJ0 A;  2BE5 C;  2CK3 A;  4FO2 A;  1RTO A;  4IFD G;  3A3B A;  5EBD A;  3I4L A;  2PZT A;  2E2H B;  1FX0 A;  1Z6H A;  2X6Y A;  1LAC A;  2B2W C;  3P1H A;  1PRT F;  4HMI A;  1AW7 A;  4A3I B;  1RDP D;  2B2T A;  1EL0 A;  1S5C D;  1D1I A;  2K5D A;  2EYF A;  2E74 C;  1JR0 D;  4XN3 A;  4J6H A;  2NN6 I;  1G91 A;  4DU9 A;  1PTO B;  1FNU A;  2HCC A;  4DAV A;  1ROD A;  3G6J B;  4BBS B;  1EQV A;  3HOU B;  1E0B A;  5C3E B;  3NQT A;  4RWS C;  4QMG A;  1EY4 A;  1PFM A;  1WVL A;  1Y8P B;  4XYO A;  3S2H B;  1OXX K;  5ELF A;  1ZXT A;  3RZD B;  1EIG A;  2A6H C;  1O80 A;  2BDO A;  2FHT A;  4HCS A;  1UD8 A;  4K6L A;  5JAV A;  4UDU C;  1H9S A;  4H13 C;  1HRJ A;  2XVS A;  4XR6 A;  3CHB D;  4HSV A;  5NUC A;  4XNF A;  1F2Z A;  3E5S A;  2A69 D;  4XMY A;  2ZXO A;  1HA6 A;  1J9O A;  1JIC A;  1IL8 A;  3TME A;  4DAP A;  5DM7 3;  3LWU A;  3E6Z X;  1OHH A;  3T16 A;  1SFO B;  1AZP A;  2X53 S;  2JP1 A;  5FL7 A;  5E4W C;  3J81 L;  2V31 A;  1EY7 A;  5C6A A;  2ZXI A;  4JK1 C;  4RCO A;  4IUU A;  2AQ2 B;  2JEA I;  3NE5 B;  1LAB A;  4BA2 I;  1TQO A;  3P7J A;  2XOK A;  2YYZ A;  2JJ1 A;  2O2L D;  2J7Z A;  3U9S A;  1D5X C;  2A6E D;  3URY A;  3J7Y W;  2EZV A;  2CQA A;  1ZYR C;  2SNM A;  1E2V A;  1PRT D;  1BOS A;  3QB3 A;  2X85 A;  1WCM B;  1W0J A;  2OT2 A;  3VR4 A;  5F2D A;  1KLU D;  2AQ1 B;  2L0C A;  2R3Z A;  2B8F A;  3P75 A;  5M5W B;  1PFB A;  2HDL A;  4Y7N B;  2F0M A;  1KDC A;  4WRD A;  2PYK A;  4ASU A;  2FMC A;  1CQV A;  3NSW A;  4IUQ A;  2NBF A;  1HUM A;  5ELB A;  1B3A A;  5BN5 A;  5LL6 S;  3I72 A;  5FKA C;  3HOY B;  1E1Q A;  2PMZ B;  4A3K B;  2Z8L A;  2NVY B;  1GOZ A;  2KUM A;  2PCF B;  2F3W A;  5C0X G;  1SND A;  4ZUJ A;  4PNY A;  5KIX A;  2BCO A;  1K28 D;  3FPP A;  2E76 C;  1HHV A;  3I91 A;  5A35 A;  5CBA E;  3BH4 A;  3S9W A;  4CGY B;  4TT3 A;  2WAC A;  3M85 A;  1PTO D;  1B1Z A;  1O7Z A;  3IFT A;  3KBG A;  1T5X D;  4Q5V A;  2X6G A;  5CV7 A;  4N9T A;  2F0D A;  2A6E C;  5EQ0 A;  5ELD A;  1STE A;  4G7X A;  3A8J E;  1YNN D;  1WD1 A;  2K04 A;  1B50 A;  2EY6 A;  2ICE C;  2EXZ A;  1MAB A;  2JA6 B;  1BCP B;  2AQ3 B;  5LHY 1;  4NMZ A;  1S4Z A;  4KV6 A;  1EYD A;  3HG9 A;  1TII D;  4DA2 A;  1PYW D;  3M4O B;  4XKV A;  2K1B A;  1SNP A;  1EIH A;  1HA5 A;  2XSC A;  2MUY A;  2D9U A;  3S14 B;  4K2K A;  2VB3 X;  1LTA D;  1V43 A;  4RKL A;  3CQZ B;  1G6Z A;  3BDC A;  3A54 A;  4AVZ A;  2ENB A;  3NTK A;  4OIK A;  1Y1W B;  1STB A;  2E1B A;  1A3T A;  3VA5 A;  2B2V A;  3QOJ A;  3D4R A;  2RDF A;  4G7O C;  4IUT A;  5D3D A;  2NB0 A;  2IWH A;  3ITP A;  3QIA A;  3MWY W;  1TS3 A;  1QE6 A;  3GTO B;  5EPJ A;  3DWQ A;  1ICW A;  5C5L A;  2IX1 A;  1GHK A;  1V1P B;  4TKO B;  3GVJ A;  4RGO S;  1EZ6 A;  1EU3 A;  1D5M C;  1WTW A;  1PKV A;  1RD9 D;  2HUG A;  3PUV A;  3TP5 A;  2JIZ A;  1EY9 A;  4XIG S;  1Y8N B;  1FYC A;  2JSO A;  1S5D D;  1ILP A;  2D62 A;  2F0Q A;  2DY7 A;  1I3Q B;  4KD3 A;  3I8Z A;  1VLY A;  1H9M A;  2IPK D;  2B2U C;  1RCV D;  5CV8 A;  5C3W A;  2RKS A;  1H8E A;  3AB9 A;  2KEE A;  4DNR B;  4OO1 H;  1OXU A;  4A3E B;  3J7A F;  3PMF A;  3DXJ C;  4C3H G;  2XND A;  5EPL A;  2TSS A;  3OOC A;  2K5W A;  1MGS A;  4ZRZ A;  1ENA A;  5EGT A;  1NRK A;  1STG A;  2CW0 D;  3OWE B;  1G29 1;  1LTG D;  1GJX A;  2X6W A;  1A2T A;  4J1M A;  4ZLT F;  1STA A;  2ZZG A;  1CHP D;  3OE7 A;  2V4D A;  4NNJ A;  1LTR D;  4XLF A;  1E1R A;  2WII B;  1F9R A;  5IGE A;  4DNT B;  1PDQ A;  1B9N A;  3J7A V;  1BCP D;  5JJZ A;  1O7L A;  4GQN A;  1QIL A;  1TY0 A;  3AU7 A;  3SK6 A;  3CP2 A;  2DN8 A;  2L4N A;  1AZQ A;  1I4H A;  1V1P A;  5JEA H;  4HN7 A;  2Q8R E;  3PUZ A;  1II3 A;  2EDG A;  1YNJ D;  4G7Z C;  1OXV A;  1UEA B;  3K59 A;  2W6I A;  4RGN A;  3S1R B;  4KJO A;  1QB5 D;  3NTI A;  3OEE A;  5K5P A;  2K5Q A;  1CK1 A;  3C1E A;  3K5M A;  1UD5 A;  4UZU A;  1F77 A;  2NTT A;  2RQX A;  5KGU A;  2IL8 A;  1Y69 U;  3GTM B;  2O4X A;  1XX8 A;  2JA8 B;  4EGV A;  3MEH A;  1LTS D;  1B4O A;  2I46 A;  2KOL A;  5CDF A;  4LK1 C;  2B63 B;  2Z1C A;  3S16 B;  5K36 H;  2LY7 A;  2XZP A;  1PTO H;  3BCF A;  1WTR A;  3A8I E;  3K57 A;  1ONL A;  3I3C A;  4K5W A;  1XYI A;  3ERO A;  4C3H B;  1DYQ A;  1EOT A;  1GUG A;  2B2W A;  1AEX A;  1GUT A;  3D8G A;  1I4Q A;  4A3G B;  3MA2 B;  4F8M A;  2F0S A;  1B2T A;  2WJY A;  1TY2 A;  4PQX A;  2ZZQ A;  3HZX A;  2EYP A;  4NW2 A;  1ET6 A;  1CFM A;  3C1F A;  5M3M B;  4CJ1 B;  2NN6 G;  1KMH A;  1A6X A;  2ICI A;  4EVO A;  2XGJ A;  2K32 A;  4CKE A;  2BE5 D;  2ZTG A;  1BDO A;  1I8D A;  3MXU A;  3KK7 A;  3HAG A;  3QG1 A;  2H4O A;  2ZXR A;  4DF7 A;  4P2C B;  4H7B A;  2WAQ B;  2FIN B;  1WD0 A;  2EY1 A;  3I4M B;  3DM1 A;  1TR5 A;  4IFD H;  5JPM C;  2I07 B;  1WTP A;  1MI2 A;  2ZXH A;  3MTS A;  1C8C A;  2XRQ D;  2HDM A;  3GQB A;  5FO7 B;  1LTT D;  4FF3 A;  5J1Z A;  2JE6 I;  1VMP A;  4DN4 M;  4DXF A;  4V19 0;  2G9H D;  1EEI D;  1LO5 D;  1EWH A;  2F0I A;  1DM0 B;  2KVO A;  2R6G A;  4KY5 A;  2TMP A;  3Q22 A;  2KCN A;  1HTL D;  3P20 A;  3S2D B;  3TP6 A;  1GHJ A;  2WP8 J;  2XNA C;  2B8G A;  2Y0S B;  2ZZE A;  5DNF A;  3FDT A;  4IUN A;  2A6H D;  5COR A;  4FP5 D;  1NSN S;  3A7A B;  3D4D A;  2CHB D;  4KKU A;  2RSO A;  4KN7 C;  1DOM A;  3OAA A;  4U68 A;  3RLF A;  3WOE A;  5ELC A;  2FFK B;  5EBC A;  2KEC A;  4FXD A;  3IAY A;  2PW7 A;  5A2Q E;  1HPC A;  3NP8 A;  3I4N B;  5FOB B;  3ZIA A;  3PIP 3;  4IQZ A;  3BZD B;  5CC4 A;  2F43 A;  4KN4 C;  5EPK A;  5G3L F;  2Z6B D;  4R9W A;  1IYU A;  1UD6 A;  2OXP A;  2LMC B;  3D31 A;  3V96 A;  4CBV A;  4KKT A;  3GV3 A;  2XRS D;  1BF4 A;  1VCI A;  3D6W A;  4JMQ A;  5IGB A;  3LNN A;  3WQZ A;  2AUK A;  3W2D A;  1SE3 A;  2IX0 A;  1H8H A;  1L0X B;  1F9Q A;  1AN8 A;  1ESF A;  1JC7 A;  4RH6 A;  4WOR A;  1F2Y A;  4RGT A;  1K83 B;  3BDL A;  1ZYR D;  3FPU B;  1TU2 B;  2MGS A;  4CJ2 C;  4C1N I;  3RD4 A;  4XT3 B;  4E6I A;  1CI3 M;  1DJR D;  4XON A;  1AP0 A;  1KDA A;  4NKL A;  1SAP A;  3H91 A;  1W6J A;  4ZQ3 A;  5I9P A;  1GUO A;  4XOT A;  3OFN A;  4XOP A;  3QWN A;  1PZI D;  1X3P A;  3FKS A;  1HQM C;  4TQU S;  5AFW A;  3KLR A;  2XWB B;  3A7L A;  1V8Q A;  4HIZ A;  2NYZ D;  5DN6 A;  2ZXP A;  2QEJ C;  3T53 B;  2RSN A;  5CR3 A;  1D6E C;  1R4P B;  1TWA B;  1IKL A;  3FMC A;  1VMC A;  5C0X H;  4X3S A;  1SE2 A;  2RDH A;  4HED A;  1CT1 D;  4A3D B;  4E0F A;  2SDF A;  4DAY A;  4KY7 A;  2W6J A;  1TWH B;  2EYJ A;  1KLG D;  2BDN A;  4C2M B;  3S17 B;  1PZJ D;  2F03 A;  4NP5 A;  5M9O A;  4PMB A;  1JWM D;  4A3M B;  1STH A;  3MXP A;  3KF8 A;  1I4R A;  5C4H A;  1U4P A;  3F2U A;  4ILW A;  2J0T D;  4A3F B;  3FRP B;  5HGT A;  3HP3 A;  1I6V C;  1DON A;  3L7Z C;  4L6T B;  3H09 A;  4GZY C;  1D5Z C;  2RA4 A;  3ONA B;  3QO2 A;  5EJW A;  3HGB A;  2WPD A;  4FF2 A;  3D6C A;  4O42 A;  1JOO A;  1KZL A;  5BN3 A;  2RBM A;  4G4K A;  5JOB A;  1SDF A;  1I4X A;  2MHV A;  1J8I A;  2M00 A;  4BY1 B;  4ZYS A;  4PMW A;  2EVB A;  1F2L A;  4LJZ C;  4DGZ A;  3SE0 A;  3Q24 A;  3SXH A;  1OXT A;  4CKB A;  1MSG A;  3GTJ B;  5IK2 A;  3SR1 A;  1CZW A;  2K7V A;  1EU4 A;  3N52 A;  1TWF B;  3TSS A;  1PZK D;  1BPL A;  3TZU A;  2EPB A;  3CKI B;  5IGF A;  3HEJ A;  1RHP A;  3A56 A;  2HLD A;  2F0O A;  4Z9C B;  1I4G A;  5CV5 A;  1M4V A;  4XD7 A;  1Z7T A;  4YXW A;  1EY8 A;  3IL8 A;  2F0L A;  1DD2 A;  3NK9 A;  3K5N A;  3HRZ C;  4B3F X;  3Q6S A;  3HOZ B;  3BVG A;  1BQQ T;  3H0G B;  5HKK A;  1W0K A;  1FD7 D;  2M5S A;  1RTN A;  1UUP A;  2B2Y C;  1TKW B;  3QJY A;  1I4P A;  3M3Y B;  1A2U A;  1MSH A;  1RF2 D;  1W6K A;  3OSO A;  4FXU A;  4II2 A;  1DOK A;  3CES A;  1NR2 A;  5I9O A;  3OIQ A;  3UI2 A;  4XLH A;  1NAP A;  1TS2 A;  3JU4 A;  2IX3 A;  1WTO A;  1PMR A;  1Y8O B;  5D14 A;  1EEF D;  4XQQ A;  4P22 A;  2C5C A;  2Q8I B;  3OPO A;  1LT4 D;  4TSS A;  5C5M A;  4BWG B;  3SK8 A;  1JOK A;  1VDZ A;  4ZUI A;  4NDX A;  3BS1 A;  2A5H A;  3MHB A;  2VJJ A;  4JBW A;  4K5V A;  5IOD A;  3GTQ B;  5FO8 B;  2R92 B;  3NHH A;  4OHJ A;  1SMY C;  4QCL A;  4XLE A;  3R93 A;  2A68 C;  2HQE A;  1Z47 A;  1KNE A;  1SJH D;  2L11 A;  3M7N A;  3CP8 A;  2SNS A;  4PV1 C;  1EQT A;  3EVQ A;  3PUX A;  4RKB A;  3S1N B;  1EZ8 A;  3SK4 A;  1R9T B;  2WIN B;  1G8Z D;  5M3F B;  2AWO A;  1BXT A;  1LLR D;  1SJE D;  3ERQ A;  2R9V A;  2F0V A;  3RMH A;  2BA0 A;  4B9X A;  1Q90 A;  3Q23 A;  5A2Q L;  2WKD A;  3CRK C;  2EOT A;  1H9J A;  1V0F A;  4C3J G;  3K7A B;  3U9O A;  1NUC A;  1LV9 A;  4F87 A;  1NR4 A;  4A93 B;  1Y1V B;  4IUR A;  1V1O A;  2E75 C;  4QUC A;  4HSP A;  1PFN A;  1B53 A;  2QDB A;  4KJN A;  4EQO A;  3NBI A;  4KHZ A;  2O5I C;  1G2S A;  2XIW A;  3VR5 A;  5JPN C;  2DIE A;  3MZ5 A;  2QKI C;  2EY2 A;  4X3K A;  4H44 C;  3V05 A;  1VF7 A;  4XQN A;  1I6H B;  4OL7 A;  3ZYY X;  4KI0 A;  4OO1 G;  1JOQ A;  3H94 A;  5E1F A;  5I4D A;  1C48 A;  1HZE A;  2PQE A;  5COY A;  1V0E A;  4G7W A;  2MP1 A;  2XZO A;  1SYE A;  3H3V C;  1EFR A;  1UD2 A;  2F0W A;  1SNM A;  3NUC A;  2NN6 H;  2R61 A;  3I73 A;  3NQI A;  1WP6 A;  4ZAI A;  3O13 A;  2EYH A;  4V0B A;  4BY7 B;  1ILQ A;  5CV4 A;  3QOL A;  3VYT A;  1COW A;  3BVZ A;  1CZG A;  4ME5 A;  1HUN A;  3TBI B;  4U67 3;  5FLX E;  1C4Q A;  4H0L C;  4F88 A;  3RZO B;  4DFA A;  4ZKC B;  2NZ1 D;  3A55 A;  1QWY A;  2WKC A;  3GO5 A;  4ULL A;  2KVM A;  2WB1 B;  1ZEQ X;  1A3U A;  1IKM A;  4RHS A;  4C3J B;  5I2X A;  4IZ8 A;  1G2T A;  4MIU A;  2RDG A;  2E2J B;  1Q1B A;  5E3F A;  5CV6 A;  2JEB I;  2LKV A;  3MC0 B;  5EKL A;  1GXD C;  2B39 A;  2F0E A;  3BG3 A;  1ML0 D;  1ESR A;  3R2T A;  3R8B A;  1BNZ A;  1F9P A;  5C3X A;  4CHT B;  1WTQ A;  1A15 A;  2AWN A;  2PW5 A;  2IT1 A;  1QG7 A;  1TVX A;  3OWF A;  5IGD A;  5K36 G;  4HAE A;  1BR9 A;  4K5X A;  3T4A C;  1PLF A;  1SYD A;  5I2Y A;  1JOR A;  2F3V A;  3V2T A;  4OO1 I;  5JEA J;  3OHX C;  4UAI A;  1JB3 A;  1JCK B;  1SSO A;  3R3O A;  5C4J B;  4OGQ C;  1EY5 A;  4DK1 A;  2VJI A;  4XL9 A;  4X3U A;  1U9R A;  4HR7 B;  1X3Q A;  3NWS A;  2PZU A;  1IW7 C;  3ZPN A;  2DY8 A;  4WJW A;  1HFG A;  2GJR A;  1ENF A;  4AYB B;  1WPC A;  1E79 A;  2NVX B;  1S5B D;  5CYU A;  2KQ3 A;  3FEW X;  3I70 A;  2F0T A;  4RCN A;  4XYQ A;  1NBM A;  4CJ0 B;  4L8J A;  3DEO A;  3L3O C;  4S3S A;  1EY6 A;  3VR6 A;  5DM6 3;  4MN3 A;  4R8N A;  4MHE A;  2D3L A;  5IT9 E;  4DXG A;  3S1Q B;  2F0J A;  4KKS A;  1QOH A;  1X32 A;  3DHQ A;  2JA7 B;  4G57 A;  2DNE A;  1FNV A;  3X3M A;  3PO3 B;  2EYM A;  3AMU A;  2L5T A;  2JYO A;  4BA1 I;  3HOV B;  1JWS D;  2G9D A;  4XDX A;  1PXU A;  4HCE A;  1CTM A;  3DUZ A;  2PPB C;  3N6R A;  5IIF A;  3SVM A;  5D65 A;  3ND9 A;  1E2W A;  4K2L A;  3EJI A;  3GTG B;  1RKN A;  2QCP X;  3D4W A;  4B08 A;  2JDI A;  5KND A;  3X3N A;  2M2L A;  3KUP A;  5FK9 C;  1GUS A;  2GA4 B;  1KNA A;  1CA5 A;  3TDQ A;  1HFN A;  4IFD J;  1DCZ A;  3NBH A;  4XKW A;  1PTO F;  4ABN A;  1LTI D;  2PZW A;  2F1M A;  4YEL A;  5M5Y B;  2GJP A;  1F9S A;  1BLI A;  3MAQ A;  1U4L A;  4J8Q A;  2ID0 A;  2K03 A;  4FXK C;  1NCV A;  1JQY D;  3GVK A;  2ZT9 C;  1HCZ A;  1FR3 A;  1Q12 A;  4KD4 A;  4X3T A;  2QF7 A;  1SKY B;  3BCD A;  5BN4 A;  4K8I A;  4IN3 A;  1H9R A;  1Q1E A;  3VYU A;  4LAA A;  2L55 A;  3JAM E;  1WTV A;  1HQR D;  3IKJ A;  1HVX A;  5M5X B;  1CA6 A;  2B2Y A;  2SEB D;  2MPM A;  1UNS A;  3D3R A;  3KLS X;  4IFD I;  5KNB A;  5G3L D;  1AFP A;  1ENC A;  1BUV T;  1SNQ A;  3DEP A;  4I7Z C;  1EWC A;  4XQJ A;  4ZKB B;  3C2P A;  4XQF A;  2Z4I A;  1OO9 B;  2B2T C;  4K6D A;  1DOL A;  2R93 B;  2NWG A;  2NVQ B;  3MFY A;  2L12 A;  2JXM B;  1IHZ A;  5HUR A;  2N88 A;  5KNL A;  2XZL A;  2VXW A;  2A69 C;  2B2U A;  1SYB A;  1WTX A;  4B3G A;  4I65 A;  3A8K E;  2F0N A;  3DWA A;  1CHQ D;  1GUW A;  1WTH D;  2KHS A;  5KYL A;  5EKI A;  4BBR B;  1BBX C;  3DWP A;  3CMM A;  5CBE E;  5ISR A;  3J80 E;  2CVR A;  2KED A;  2WJV A;  4M1U B;  1QCB D;  3OMC A;  4KMU C;  4FF1 A;  1B9M A;  1QJO A;  2Z4H A;  4QUF A;  3LX0 A;  4ID6 A;  2HCI A;  5FLX L;  2NVT B;  3T51 B;  2D3N A;  3MFG A;  3S1M B;  1IYV A;  2M9V A;  4RA8 A;  2V7Q A;  3T56 B;  2BOS A;  2OEO A;  5IGG A;  2VUM B;  1S5E D;  2E2D C;  1OB0 A;  3DDY A;  1PRT C;  5KRU A;  2D2C C;  2Q8T A;  1SMY D;  2N55 A;  4XTC S;  4K8J A;  2A68 D;  3K6O A;  1Q3L A;  4FXG C;  2EY5 A;  2K28 A;  1B44 D;  2F0U A;  2PNR C;  5KNC A;  2JJ2 A;  2F0F A;  4Q0F A;  3RUZ A;  5C0X J;  1I18 A;  2C9O A;  3L9A X;  2K01 A;  3OMG A;  4OIJ A;  2X6X A;  3LWE A;  3OW7 A;  1LT6 D;  2AUJ D;  2EYO A;  3HS0 C;  5CV9 A;  4DK0 A;  5IOC A;  5JVG 3;  2SOB A;  1BCP F;  3OIP A;  2IW3 A;  3VR3 A;  4QIW B;  4B9W A;  1EYA A;  1W9X A;  4K14 A;  3TZD A;  3Q0A A;  3VA7 A;  2FMM A;  1D2B A;  1XTC D;  1JWU D;  4EQN A;  1PTO C;  4RFB A;  2EJM A;  5JVH 3;  5ELE A;  1FNW A;  1SNO A;  1HTP A;  1QNK A;  1MD2 D;  1SYC A;  1RJT A;  3E0J A;  3MXG A;  3NXW A;  2XWJ B;  2EJG C;  1UD3 A;  1Q8I A;  2WSS A;  1YNN C;  2X6L A;  3BVM A;  5C0X I;  3EQL C;  3PUY A;  1F2M A;  3MXN A;  4XOR A;  5C44 B;  2X8K A;  1K8O A;  5T1G A;  3MVV A;  4C1N K;  5D3I B;  1VF5 C;  4HTH A;  3SDZ A;  3KEW A;  1O78 A;  2K33 A;  4F7X A;  1A3V A;  2ZZF A;  2F0P A;  2LFN A;  1ET9 A;  1KTK A;  5C4X B;  5IT9 L;  4TSF A;  5J39 A;  4C3I G;  3C3L A;  2F0H A;  4IUP A;  2NUC A;  3J81 E;  3VYR A;  4FF4 A;  4FVM A;  2XN9 C;  4CKC A;  4WFN 3;  5EKK A;  1SBB B;  3DMU A;  4KY6 A;  1I50 B;  3BDO A;  2F0K A;  1STN A;  5J22 A;  1BMF A;  4RGM A;  3GD7 A;  1CM9 A;  2LZJ A;  1R4Q B;  5TSS A;  4A3B B;  1SXT A;  2FJ2 A;  2O5J C;  2EE1 A;  3G7L A;  2NTS A;  1EFI D;  1T5E A;  4YIJ A;  2GK6 A;  3M7G A;  3OEH A;  5CMD A;  3K5O A;  1D1K A;  4G7H C;  2R7Z B;  4TRD A;  2KA7 A;  4II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...