3H94A

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 39
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3h94A02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h94A03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3h94A01
2EJGC 4PV1C 1TKWB 1Z7TA 1GUSA 3ND9A 2AUJD 4H13C 2JXMB 1GJXA 1OXUA 2DNCA 1Y69U 3A8JE 3BG3A 2KA7A 5A35A 3FMCA 1GHJA 4XTCS 3TZUA 1K8OA 1VF7A 3IFTA 3PV0A 3PUZA 1CI3M 1TU2B 3VR3A 3L7ZC 1OXVA 3QG1A 3M4YA 2V4DA 1HQMC 1CTMA 1VF5C 4HR7B 1FYCA 2JEBI 5JEAG 4GZYC 1FR3A 3BDOA 1LABA 3I72A 2K7VA 4TKOB 1GUOA 2BA0A 2E74C 3I4LA 3LWUA 5K36H 2R6GA 1H9RA 1LACA 2B8GA 2E76C 2NN6G 3AB9A 1YNJC 4G7HC 3OPOA 1HPCA 1G291 3U9SA 3LNNA 1E2VA 1OXXK 2QF7A 2B8FA 2ZT9C 1Y8PB 4IFDG 2PNRC 3PUVA 3A7AB 3GQBA 1E2WA 1DXMA 4JBWA 1K8MA 3MFYA 5BN4A 4KKTA 2EJFC 2A6ED 4OGQC 3PUWA 4G7OC 4BA2I 4DNRB 1Z6HA 1SMYC 1OXTA 1Q1BA 1V43A 1BDOA 2JEAI 1O7LA 5C0XG 4KN7C 1YNNC 1EWHA 2E75C 2EVBA 3KLRA 1ZYRC 1H9SA 1GHKA 3T53B 1Y8NB 1CFMA 2F1MA 2A68D 4KMUC 3OOCA 1H9KA 3P20A 2EJMA 3PUXA 2AUKA 3CRLC 3VR6A 3D31A 1Q1EA 4DK0A 2EDGA 4LJZC 5C0XH 3M7NA 4JK1C 1HCZA 5BN5A 1OXSC 4OO1G 4IQZA 3GD7A 3A8KE 3EQLC 2JE6I 3MXUA 1Q12A 3I73A 5KNDA 2DN8A 4LK1C 2BDOA 3RLFA 1A6XA 1H9SB 1IW7C 3HGBA 4L8JA 3T56B 1IW7D 2KCCA 3SDZA 4XIGS 1HTPA 2D2CC 4OO1H 2LMCB 1IYVA 1GUTA 1O78A 4IFDH 3A8IE 1T5EA 4KI0A 2A6EC 1I6VC 1B9MA 2A6HC 2YYZA 1Q90A 2NN6H 2D5DA 3DXJC 5KNBA 2PPBC 5K36G 1QJOA 1GUGA 2AWOA 3W3AA 3VR5A 4RCNA 1VCIA 2CW0C 2BA1A 2L5TA 4KKUA 2PCFB 2A69C 3QJYA 5JEAH 5BN3A 4DK1A 1V8QA 3M85A 2DNEA 3VR4A 4KKSA 3D4RA 3VA7A 1VDZA 3T51B 1DCZA 3N6RA 2K33A 2Q8IB 2K32A 3H94A 1ZKOA 2A68C 4H0LC 4DNTB 2NN6I 2BE5D 3QIAA 4H44C 3WDNA 2O5IC 3IKJA 1DD2A 3ND8A 2D62A 4G7ZC 1B9NA 4I7ZC 5KNCA 1ONLA 3CRKC 4KHZA 1IYUA 3OW7A 3VR2A 2O5JC 3PUYA 2A6HD 2A69D 3A7LA 1GUNA 2BE5C 1PMRA 1H9MA 1H9JA 4TQUS 3SE0A 2IT1A 4BA1I 1Y8OB 3FPPA 3NE5B 1E2ZA 4KN4C
chains in the Genus database with same CATH superfamily
4XDXA 1GJRA 4WZEA 4RLZA 4H13C 4LF7L 2B7CA 1JOKA 1Q8IA 3DWQA 3I90A 3BG3A 4A3BG 5A2QE 3HOYH 1TWAB 2J0TD 1E63A 3TZUA 1K8OA 1IBLL 3PUZA 3PV0A 3A55A 2B63G 1L1OA 3HOZH 1C9OA 5I6YA 1OXVA 4DV0Q 1ICWA 3S1MH 4A3BH 4X7EA 2Q6IA 1VQDA 1YNXA 1JOOA 2JA5H 3A3BA 4GN3B 1W0JA 3GTQH 2NN6G 2E76C 3BYYB 3W1GA 3CCRB 3NWTA 4A3JB 2EYHA 4ZGQB 1NE3A 1ET9A 1CQXA 1N33Q 1VQ9B 2KUMA 3G6EA 2NVXH 3PCOB 3GTMH 1QFYA 1T6YA 4WORA 2KHSA 3WOFA 3PMFA 4ACBA 1OGJA 4R8NA 1BCPD 1BCPF 3K6OA 3R2TA 1YJNA 5GADC 3OMCA 1S5BD 2HLDA 1ZYRC 3BY1A 3F2CA 4HN7A 3CC7A 2XZOA 1X54A 3P20A 4OHJA 2G9DA 4A3MG 3GTKB 1L0WA 4DR3L 1B4OA 3D31A 1EXMA 1F9PA 4XL9A 4KD3A 1LYLA 1JB9A 5J3BA 1XPUA 4HJ8A 4CQJA 2QDBA 2R7ZG 2F4IA 2AHOB 2FHTA 3HGBA 3K0XA 5HXBA 2CQOA 2D9UA 1K0SA 1EL0A 4PZ6A 4Z4SA 1NBWA 4NB3A 1CA5A 4BBRH 1HA5A 4G7WA 4JPBW 4RM0A 5A8AA 3T1HQ 3MXNA 3S1NB 1OB5A 4R4TA 4OP7A 3GV6A 1W87A 1K3BC 2A69C 1U9RA 5IP9H 3KOJA 1CT1D 1PRTF 3TS0A 1Q8KA 1B3QA 4M0LA 2BPOA 1NB9A 3J80c 1ENFA 4H9GA 3SKBA 4ZCMA 2X69A 4X62L 4LF9L 2A68C 1JCKB 1MABA 2QKIC 1DD2A 4H44C 2EE1A 5J39A 1PDQA 4M4SA 4GOPC 3OAAA 2EZVA 1C8CA 4DR6Q 1UNSA 2QGGA 3K57A 1H8HA 1GVPA 1PRTB 3NTIA 4V190 1N05A 2IT1A 5NUCA 4X7CA 2KCMA 2RKSA 1CSPA 3AYHB 4F87A 1Z7TA 3MXNB 5EPKA 2ZTNA 4MTKA 1Y1VH 4LF4Q 1DG1G 1A2UA 2LXKA 2KA7A 1WTVA 1II3A 3CXCA 3PA1A 3CCEA 1AFPA 3WXMA 3HOWG 4OX9L 1VQPA 4XKWA 1QUEA 2K03A 3IAYA 1S3OA 2R93G 1Y1WH 3Q0AA 1PZID 2P5ZX 4ZAIA 3JQRA 1Y1VG 3C3LA 5M5WB 1SNPA 1M1KD 3OHXC 1PH3A 2CH4W 1SFOB 2F03A 1XNQQ 2WJYA 3W2HA 4A76A 1IBLQ 1MKHA 4LNQA 1I7PA 1B3AA 3F2BA 2X3UA 1P4MA 3NTHA 4Z4RA 1PFMA 1SJED 1PJ5A 2C78A 2VNIA 2QF7A 4A3DH 2Z0SA 3Q6QA 3QB3A 3A7AB 5IGCA 5JAVA 1TWHB 1YVCA 3GQBA 2GJPA 3H0GG 1KK2A 4DR7Q 1DGSA 3Q39A 2WINB 3NUCA 1QFZA 3U4ZA 2A6ED 5JJKA 1VQLB 4BA2I 5ELFA 3NP8A 4B08A 5C3EB 3D4DA 1V43A 1ASYA 1Q82D 1HXYD 1MGSA 2PYKA 2SNMA 1EY4A 1WFQA 4ZUIA 1KAAA 2JA8H 4DPGA 3HAGA 1S0UA 4IUPA 1VQ9A 4NMZA 5KEEA 1F60A 2EJMA 4PC3A 1VHOA 2AUKA 5LL6X 2EDGA 1GR1A 5HZAA 1EY8A 4M1UB 1W2BA 3BH4A 4PNYA 1EFTA 3GD7A 1JWSD 3O13A 1F77A 5D14A 3CW2A 4WZLA 5CV5A 4DR2Q 2Z8LA 4XT3B 2R7ZB 1XTCD 3K8AA 5GQOA 2EYLA 2ZXOA 4R4OA 3K5NA 3S16H 2X0KA 1W3SA 3CP8A 1SMXA 4XLHA 1K9MD 1NB0A 1PFSA 3FDTA 4C1NI 2ENBA 1O78A 4QB4A 4RA8A 2F4VQ 1T5EA 4HE6A 5CDFA 1PH1A 2PPBC 3TEHB 4U673 2PI2A 1LM0A 5I4DA 2QE7A 4B3MQ 3G48A 1HNZQ 2V31A 3GVJA 5FO0A 1ZEQX 4JI2L 4QHYA 3M85A 4WFN3 4P26A 5GV7A 4HE5A 5IYWA 1KABA 3CC7B 1W9XA 4G1VA 3FRPB 4JI3L 1N08A 1I18A 1UE1A 2FXQA 2SEBD 5FJ8G 3HOVG 4PC2A 4DXGA 3S1QB 3CCMB 2F0SA 2E2IH 4APVA 3H3VC 4UAIA 4ME5A 4Z4TA 4EVOA 2B39A 3C2QA 4DAVA 4X7DA 2W6IA 1W0KA 1EFCA 2P3MA 3P75A 1MSGA 3S2DH 5EPJA 3KJOA 3GSIA 3I7FA 4XQNA 1I6HH 3ND9A 4Z4ZA 2JXMB 5C6AA 2OF1A 1KAWA 5M5XH 5LMNW 2HHHL 3A8JA 5TY0A 4P75A 3HP3A 1WD0A 1SXTA 1WOSA 5EQ0A 1AMOA 1EUJA 3HOWH 1WVLA 1MJCA 1UAPA 2MGSA 3I8ZA 3W2FA 1I5FA 4C3JG 4MNOA 1KXLA 5IYCG 1UMKA 1LABA 5FJ8H 1WOOA 2QTLA 1KC8C 4KK7A 5KSWB 2R6GA 3CPWA 2NTSA 2EIFA 1YI2B 2R7DA 4AIMA 1N8RC 4JOIC 3FKIG 1KTKA 4DF7A 5BN4A 1Q7YD 1VQHA 1KC8D 1K73D 2ZL5A 4NXNQ 4J15A 1I50B 3J7A5 3QOJA 1HNWQ 1D1NA 1SMYC 1SYEA 1YJ9A 3GP7A 3TQYA 4ZV4A 3MVVA 5ELBA 3I55B 4LMQD 3ULJA 4C2MH 4GNXB 1VQMA 3W2GA 1OO9B 4YALA 3MXGA 2MJ8A 2VBSA 2F1MA 5GAGC 3CESA 1H9KA 4R9WA 4YWLA 4EQNA 3RN5A 4PMWA 4OL7A 1E64A 1KDCA 4DR2L 2NVQH 4IUQA 2L4NA 4IZ8A 2ZITA 2QGQA 5BN5A 3I56A 2VL6A 5IWAQ 5KIXA 4X3KA 5BR8Q 3FVQA 1IXRA 2OWOA 3WYAA 1A62A 1T9HA 2D3LA 2XZLA 4UP8A 2ZZFA 3E9HA 4UAJA 1J9OA 3SLDA 2Q6KA 1HQRD 3HOXH 4FYDA 4CDFC 2ZXPA 2PW5A 4NCNA 2PLFA 1VQ4A 2WKCA 5IODA 3OTOL 1PRTC 3S24A 4JI5Q 2YWFA 1YJWA 3ZJYC 3PF4A 4C0SA 1VQNB 1J5EL 4OIJA 3OJXA 1EY9A 1RTNA 2BA1A 4YAUA 4O1NA 1TS4A 3MC0B 3I4MB 1VQ7B 2Q2TA 1EWCA 2F0GA 4AQYQ 3R2IA 1NUCA 1X6OA 2ALYB 2M9VA 3FHWA 2NVTH 4MTNA 3S17B 5T1IA 3OJWA 3FPUB 4G57A 1ONLA 5BSXA 3R8BA 3OW7A 2HIVA 2ZM6Q 4WRDA 5EKLA 2DEUA 2ZM6L 1CNEA 1WORA 3RN2A 4RDKA 1IKLA 1JB3A 1XXGA 2UU9Q 1YNJD 1GJXA 5IYCH 4F8MA 1E2ZA 1U0LA 4KN4C 5FLMG 4PV1C 2BH8A 2VBTA 1E3XA 1TVCA 1TKWB 4DV7Q 5GAHC 3P7JA 1Q86C 3UE0A 1BXTA 3JU4A 4B3GA 4PMBA 1TWAH 4O42A 1NDHA 3SXHA 5FKAC 4FNFA 3HOZB 5JVG3 2X6WA 1WTRA 4K2LA 4GQNA 4C43A 1YITB 3S1MB 4A3BB 5JBQA 1VHEA 2JA7G 5IOCA 3AGPA 2WB1E 4B47A 4JV5Q 4TT3A 2MNAA 2JA5B 2BA0A 4IURA 4DQLA 1DM0B 3EIVA 4BY7G 3KDFA 5D65A 5JJZA 5M3MG 3OPOA 2FVGA 2HDMA 4A3JH 1WU8A 4JI4Q 5E6TA 1TQOA 3HOVB 2WKDA 2VQFL 1WI5A 3BVGA 1L0YB 1E2WA 4FVMA 3PUNA 4B48A 1BBWA 3NELA 1S5FD 1R4PB 2NVXB 2YWEA 3GTMB 3GTOH 3A1PA 3W2EA 3T1HL 2KBNA 3J80L 4B3FX 1XNRL 2A73B 1M1KC 1M8AA 4IOCA 4ZCKA 2ZTDA 1BX1A 4R1JA 4Y9UA 1AP0A 2C35B 4JI4L 4LF5L 3OZUA 5T1GA 4QIWE 3OEEA 2F1LA 3CHBD 4HMIA 4NKLA 3SEBA 4X64L 1EQQA 5JJLA 1WTOA 1SJHD 1VQBA 4IFDJ 2R92G 4TVAB 1E3ZA 3U50C 1HCZA 3DM1A 5C3XA 4BY1B 4OO1G 4P1VA 2D9RA 1PKVA 1IJFA 3MEFA 2ZTGA 1XMQL 3HOUB 2UXCQ 3CCJB 4S3SA 2Y0SE 1QVFB 1A0IA 4HSPA 4N8FA 2H5XA 3G71A 4Q0FA 4HCEA 1SE2A 3QR8A 2J7ZA 2O2LD 4J1MA 4AF7A 1PV4A 4II3A 1SMYD 3NWSA 5C0XJ 3ZIAA 1C4QA 1B23P 3WNCA 5CV7A 3TP5A 2ES2A 3NQTA 4DQKA 1I8DA 2F0WA 4RD4A 3MFGA 3PIP3 3MAQA 1D5XC 4A3IB 4UHVA 1Q7YC 2YU9H 2FINB 3S1NH 2XIWA 2CW0C 4ZQ3A 3P27A 4GN5A 1R5OA 5C3EG 3ITPA 3VNVA 4DR1Q 4K5XA 3DHQA 5FO1A 1V1PA 5I9PA 1BX0A 3JAML 2UUAQ 1WOPA 2WB1B 1WCMH 2V7UA 3TN2A 3ZZ0A 3WQZA 1QGAA 4RDJA 4TN1A 4G7ZC 1KZLA 4BS9A 2ZJRA 4A3DG 4RH6A 4FP5D 3RR5A 1GUNA 4DV0L 1H9MA 1TR5A 4CBVA 1SNOA 3BC9A 2QW7A 2XRQD 3GDEA 4I7AA 4X65Q 4JI5L 1BKBA 2EQSA 4B3TL 2VUMB 1Y1VB 1AW7A 4JOIA 3ASQA 1PLFA 1TWCB 5JOBA 1Y1WG 1O7ZA 1VQJA 3CP0A 5FIUA 4A3LG 4XTCS 1G8ZD 2VB3X 3OYYA 3SLNA 4XQQA 2UXCL 3S15B 3D4WA 4YCWA 3CCUA 1HQMC 2OTLB 2VS1A 3STBD 3PO3B 1MBYA 1QOHA 1GM5A 1P8LA 1D7QA 1SYGA 4OOSA 2PMZB 4E6IA 3HKZB 5I2XA 2F0KA 1ZM4A 1QFJA 2ZBUA 1DARA 1Q46A 1D8LA 1M4VA 4YHHL 3V96A 1Y0RA 5A2QL 1G7SA 3S14B 2CH4A 2HD3A 1HZBA 1K8MA 4X66L 3MFYA 5THXA 4KKTA 1PZJD 2HT1A 4NNJA 3OEHA 4A3EG 1QVCA 4XKVA 2OTLA 4CJ0B 2CF4A 3ER0A 5IGDA 2UUBQ 3AFPA 2C9OA 1YBYA 1SN8A 2MP1A 3H91A 4N8X1 5CBEE 1VLOA 1YNNC 3CPWB 2JA8B 1UUPA 1S5DD 1KMHA 1LTTD 3KF6B 4J0QA 1AEXA 5FLXc 1NAPA 2FFKB 4R4IA 3WWVA 3S9WA 1LTID 3RZDH 1SLJA 2DCUA 1DYQA 1TTTA 3M7NA 4HEDA 3RD4A 1KLUD 2TSSA 4NBSA 3I3CA 3EQLC 1ILQA 1UE7A 4FXUA 4IPGA 1XMOQ 3G4SA 2UXBL 3UDFA 1LTAD 5EJWA 3U9OA 1O7YA 1BPLA 3LQEA 4L63B 3ZZTA 3FJOA 4EQPA 1B2RA 1Q82C 2B2VA 3KUPA 4HJ5A 2KECA 4P2NA 5DS0A 1V1PB 3A8IE 2XWJB 4CKEA 2A6EC 3BCFA 3AVUA 1BF4A 4OPOA 2L11A 3K7AB 1GUGA 2WAQG 3HKZG 1NMGA 1BBXC 1HR0Q 1UD3A 3OTOQ 5JEAH 4RPDA 4DK1A 1V8QA 2VNHA 3CC4B 2F0UA 2EY1A 1LTBD 1IBKL 3ASTA 2BOSA 1DCZA 2I5MX 2L1BA 2MFIA 1WJJA 4KTAA 2Q8IB 4LF4L 1KRHA 1DDIA 3ASSA 3QFCA 2F0IA 2GVBA 3S1QH 4KJOA 5KNCA 1ELOA 2I1LA 1EYAA 2CW5A 3CCJA 2A6HD 3NBHA 1EEFD 4Y7CA 2NB0A 1KQSB 2OYNA 4QUCA 3S2DB 1TS5A 4P12A 1EOTA 3MXPA 2L15A 2KCNA 1F9SA 2AUJD 4XXEA 2YTVA 3ONAB 5M5XB 2A19A 4RD0A 1C48A 2B2WA 3A74A 4KY7A 4Z1MA 3ZUGA 1STNA 3LGJA 4TMXA 3HOYG 3GVLA 1RODA 5IE8A 1L1OC 1W2BB 3H0GH 3T13A 4K2KA 3KBGA 3LQ6A 1N32Q 2JEBI 3ICEA 1EP2B 4RD1A 1EZ8A 1HZ9A 1UWVA 3KLSX 1IL2A 1W6KA 5IT9E 4TRDA 3R93A 3SR1A 1LV9A 1EIGA 1KNEA 2EXDA 1QVGA 2YTYA 3G05A 4UZEA 2ZT9C 1Y14B 4FDBA 1STHA 4ABNA 1KJZA 1HH2P 3ZZUA 2GA4B 4ZK9B 3CC2A 2E2DC 2XGTA 4XM3A 2EOTA 1I4QA 4OGQC 1I50H 2IW3A 2OEOA 1OXTA 1N33L 1VQKB 4B3SL 4DK6C 3TSSA 2F0MA 2HHHQ 4C2MB 1EWHA 3S1RB 2ZTEA 4DV7L 4DV6L 5C44G 4RCZA 2GK6A 3A8KA 4X05A 3T16A 1YX2A 3Q3AA 1HZCA 4B3TQ 2K05A 2BVNA 1BQEA 3IL8A 2JA6H 4G1BA 1OXSC 1RF2D 1SR3A 4P9SA 3RLOA 3OKXA 2C5BA 2GREA 2BMWA 2PI2E 3MHPA 2XVSA 2QCPX 1H9SB 4ZCLA 2KENA 3BZDB 2VJJA 5HY6A 2CQAA 4L5QA 1KRTA 3VYRA 4DV3Q 4DV2L 1IW7D 1STBA 2YWGA 3QWNA 3NBIA 3HOXB 3VMFA 4N9TA 4AF6A 4IOAA 2TMPA 2H4OA 1BCPC 4QUFA 4DR5Q 5C0XI 1AIPA 1RD9D 4A3IG 1JC7A 2A6HC 3ONYA 3DXJC 5KNBA 1X3QA 1OB0A 4DV5L 1CSQA 3PF5A 2PNHA 2BN4A 3UI2A 4X07A 3J80E 2FMMA 4DR6L 4RGMA 4P2CB 3OIPA 2JN9A 1FJGL 1JR0D 3C1FA 4IFDI 1GXDC 2DY7A 4HSVA 1UD8A 4A3GB 3K7UC 5FL7A 1SE4A 4Z4VA 1QG7A 1VQ4B 3ZBTA 4POGA 5IWAL 1YIJA 4L5SA 4BPRA 3M7GA 4GOPA 1LTSD 1YZ6A 5H5JA 2MO1A 3CCQA 3HRZC 2RDFA 1YHBA 4YCVA 4BBSB 5TR9A 2OXPA 4OO1I 3M3YH 3RZOH 3QFRA 3BVZA 3M4PA 1KIXA 5FLXE 3ONUA 1ENAA 4C3HB 5A35A 3CMAB 5C5LA 1S72A 1QNUA 4AYBE 2BH2A 5M5YB 1D8TA 2UXDQ 3VR3A 1XTDA 4DA2A 4Q7JB 1B50A 3BYTB 3I4MG 1HNXL 2DYIA 2VQEL 2JA9A 5M3MH 3U58A 4BY7B 3J81j 2F43A 3D0FA 1UD4A 2VXWA 4N9PA 3WY9A 3U9SA 1A8PA 4P22A 1E2VA 2JSOA 4RG1A 3PIO3 3KJPA 3I4NB 2V7TA 1JE5A 3HOVH 3TBIB 1YNND 3TZDA 1ICFB 2RDHA 4IJHA 1P16A 4DV5Q 4YWKA 3GTOB 3S2HB 1Z6HA 3J7YW 3PUMA 4LF6Q 1WOCA 1Q1BA 3AQQA 1E1OA 4U9UA 5EKIA 1HFNA 1FRNA 2Q8RE 4P3YA 4KN7C 4DU9A 1Z9FA 1CNFA 3V05A 4BBSG 5IK2A 4I65A 5ISRA 4DAPA 5I2YA 2R61A 2OK8A 3ISXA 3OOCA 3PUXA 1EFWA 3CRLC 4P3IA 5IP7H 1Q1EA 2EY5A 5EBDA 5CYUA 4X64Q 2K5NA 4BY1H 1J5EQ 1MSHA 2K5VA 3IRBA 3WBKA 4NP5A 2D74A 2CWAA 2BGJA 1YHAA 3HOUH 4RKLA 5AFWA 4Y7NB 5CV9A 1IW7C 3Q24A 4UPAA 1QNKA 3CCMA 2OK7A 2I07B 3AFQA 1N0VC 2HDNB 3URYA 3SEJA 2AHOA 1U4LA 3FPKA 1DOMA 2ZTCA 4B9WA 4KY6A 1YITA 4R4QA 2OTJB 4GS3A 4A3IH 3CCLA 1Q90A 3WOEA 2YU9B 2VY3A 2IY5B 1M90D 4XN0A 4B9XA 4KHPQ 4RCNA 2NWGA 1NNXA 1JA0A 3W2IA 2G5DA 1SKQA 2EIXA 4C3JB 5L46A 1VQEA 4FK8A 1O80A 4IW3B 1LO5D 2DNEA 3D4RA 2NZHA 4RAUC 4YAOA 1G7TA 2K32A 3H94A 2PQEA 3CXCB 2DUDA 1WCMB 3T4AC 1B2TA 2B7BA 1LUZA 2PZUA 4EX5A 5HZBA 3ND8A 3W2DA 1TVXA 3G6EB 1IYUA 5KRUA 2O5JC 1SNDA 5LMNQ 3BNWA 1TS2A 1IYJB 2CWPA 3HS0C 1R5NA 3QSYA 4DUZL 3QFTA 4XLEA 1U5KA 3AVTA 2M2LA 2VUMH 4TMZA 4XYQA 1TWCH 1UE6A 3P26A 3VO1A 2ID0A 3KYHC 1I4HA 4MN3A 1STAA 1PJ6A 2V7VA 3FKIB 2MQHA 3S15H 2V4DA 4LBZA 1RJTA 4KHPL 2PO4A 3PO3H 4C3IH 4WZKA 5KYIA 1A63A 4FWTA 3I72A 2JIZA 3L9AX 4DR5L 4XOTA 1JWMD 3MZ5A 4OPVA 4RGNA 1WSVA 1HPCA 2Q2IA 1VQ8B 2OQKA 3F8TA 5LMZA 3ULPA 1WTPA 1PZKD 3UE1A 4GNXC 2CCZA 5C4XG 3K5OA 2EYPA 5IGFA 1PH6A 3S14H 4DNIA 1S5ED 2KVOA 1FNMA 3QE2A 1BQQT 3ZPNA 3GTLB 1SYFA 2K04A 3J80i 1OB2A 4IPDA 3H9NA 3CMAA 2FJ2A 4JI7Q 2BDNA 5IY0A 4J6HA 2DOGA 1U4RA 2K01A 1SNMA 4KLKA 5GROA 4P73A 1F2ZA 1YLOA 2CNDA 1HNXQ 1EFRA 2Z6BA 2L9HA 2KEDA 3NEMA 3RZDB 1BO0A 1B70B 1TY0A 2C5CA 4RGTA 4LJZC 5IYBG 1VS0A 1GAQA 4LUVA 4CGYB 1SYDA 1YI2A 2ZZEA 2JE6I 4XQFA 3CPFA 5KNDA 3BY2A 1CQVA 3FKSA 4QY7A 3GTPB 1S4MA 2WAQE 4RJLA 4XLAA 2F52A 2FMCA 2JN4A 4XIGS 2D2CC 5IYBH 4WQMA 1LT4D 3HZXA 1ZM2A 2ASBA 4DGZA 1R9TH 1MI2A 4DAMA 1HNWL 1PTOH 5CGKA 4OOVA 4PMCA 4RFBA 5IYPA 4HIZA 4X8IA 3KK7A 3K7AH 1QJOA 3W3AA 5C44H 1U2RA 3D8GA 1MJEA 3EVQA 3PSIA 3QOLA 4GLXA 1PH4A 4BWGB 2NPFA 1KK3A 1VMPA 5E3FA 4YHHQ 1UEAB 2NVYB 4PZ8A 4OEMB 4PAAA 1PJ7A 1F2LA 4N3NA 2XNJA 2K5DA 2QILA 5C5MA 5DAUA 1J6QA 2Z4HA 4CDDC 1VQ5B 1PVOA 2Y0SB 2JQOA 3VR2A 4RD3A 1UD5A 2ZXIA 2BE5C 4BXXG 4EH1A 3QFSA 2LFNA 3ERQA 4TQUS 4BA1I 2JA8G 3A5ZB 3FPPA 2UUAL 5F4JA 2RCFA 1RIPA 1E22A 1WTQA 2OTJA 3DEOA 1G51A 4ZUJA 4MYTA 1VQCA 1OXUA 2DNCA 1Y69U 1STYA 1IKMA 4GKJQ 2V7WA 3JAME 2D3NA 5IGEA 1VF7A 3C2PA 3JAMi 1YJNB 1AN8A 1C7YA 3H0GB 3L7ZC 4ME3A 4ZYSA 3ZC3A 3B78A 1EU3A 2XTIA 1FR3A 1W35A 1FNWA 4B3XA 1QILA 4CDCC 4XN3A 2O4XA 4OWWB 2Z4IA 2VZAA 4DK3C 4JBMA 4G7HC 3G4SB 1XJVA 3T1YQ 2B8FA 4YELA 1XMQQ 4IFDG 2PNRC 2Y0SG 3F2DA 2K14A 3MTSA 2SOBA 4LUOA 2ZJQA 1NJID 5DM73 4J8QA 2E1BA 2XNAC 3KDFB 4K0KQ 3BDLA 3FP9A 2F0JA 2V1CC 4LFCQ 3W5VA 1N8RD 2CK3A 5CV6A 3KF8A 2AQ3B 1BDOA 1IJEA 4X3TA 1G6ZA 1UEBA 5C0XG 5E7NA 4DKAC 1Q3LA 3S1RH 2CHBD 1CZWA 2CFMA 2CW0D 1HJPA 4Y9RA 2B2YC 1HUNA 4HAEA 2PZTA 2BSAA 2VYQA 4P6YA 2XRSD 5CV8A 2LKVA 2UXDL 1DOKA 3I1FA 4XYOA 2JA6B 1VLYA 2I46A 5DN6A 2B2TA 3A8KE 1BCPB 2PIAA 4DAYA 1WTHD 1LLRD 3X3MA 4RKBA 4A3CG 2HQLA 4YCUA 3GVKA 1IZ6A 3CC4A 4H7BA 4IUUA 1K8GA 1VQ8A 2IX3A 3L2PA 4JV5L 5CMDA 1XYIA 2ICIA 1J8IA 2RBMA 1AE2A 3U4VA 4YY3Q 5C4JH 2F4NA 4POFA 2E2HH 4DUZQ 4M1KA 3AEVA 4KI0A 2C5HA 3DM3A 1X3PA 3OW2B 2NN6H 3CRZA 1N9WA 3VR5A 1VQFA 3CCQB 3E5SA 1JMCA 3I4OA 4X06A 1V0FA 4KJNA 3B8HA 5DM63 3VYTA 1Z47A 3D3RA 2B29A 1N34L 4XT1B 2DY1A 2B63H 1QGZA 3A56A 4A3GH 4UP7A 1XPOA 4RGOS 2NN6I 2FX3A 2BE5D 3PENA 3QIAA 1KTVA 1QH0A 1QVGB 1SAPA 4CKCA 4FF1A 5I9OA 3TRZA 4FXDA 3U2QA 3DEPA 2ZBVA 1X56A 5BSYA 2HDLA 4K1XA 4A4IA 1W34A 2DGYA 1SDFA 4BBSH 3LO8A 3SK5A 1ESRA 5JJIA 3M3YB 1QUFA 1FVIA 3RZOB 3J81i 1GUSA 1KK1A 4FXGC 4C3HH 5F4OA 3RY8A 4DUYL 3V76A 1EY0A 1A3UA 3CQZB 1GHJA 2JYOA 1G7RA 5H1SE 5M5YH 4ACAA 4ZLTF 4A3LH 1HR0L 5F4MA 5EPLA 1KQSA 1BUVT 2K4KA 4HR7B 3NSWA 3AVXA 4ID6A 4X62Q 4OX9Q 4WJ4A 5M3MB 4BY7H 4FF2A 3SK6A 2E8GA 1I94L 3I4LA 2R6HA 2JA5G 1YNJC 2EFGA 1JJ2B 1AH9A 4R8IA 5EAYA 3A0JA 3I4NH 1EP3B 1D1IA 3K5MA 2QN6A 1XPRA 4LFBQ 1HHVA 4AVZA 3H3VH 1WCMG 3R6JA 1VQKA 1G2SA 2AQ1B 2Z9HA 1V9PA 3PUWA 4CKBA 3S2HH 3OP1A 1D2EA 4LC0A 4XMYA 2X6YA 5KYLA 5IYRA 2MO0A 2CKZB 2RSOA 2JEAI 1D5ZC 1K28D 3L0OA 3RNUA 3A8IA 2GK7A 2E75C 1Q9SA 3AVVA 2WJVA 5IGGA 1CFMA 3HEJA 1KHIA 3CAMA 2OT2A 2XOKA 4NDXA 1JNYA 3K81C 2E2JB 1N32L 2IX0A 4YAFA 3EBEA 1VQOB 2RCNA 2L0CA 1EOVA 3NQIA 5C4HA 4IO9A 3MXUA 1KNAA 1KL9A 5D3DA 4PABA 4Y7NH 5A89A 3J81E 2M00A 1U4MA 2PMDA 3VNUA 2N3SA 1SYCA 3F2UA 4PZ7A 1EYGA 5EGTA 1CHQD 3KBXA 2LMCB 2JA6G 2WZPP 2GN5A 2LXJA 2L12A 4AH6A 4K0KL 1B9MA 4B43A 2J4XA 4ASUA 4O0AA 3AVYA 1HZEA 3R3OA 3C46A 2VB2X 4C3JH 3E0EA 5CR3A 1GAWA 1UD6A 1ZXTA 3G71B 1XB2A 3BQJA 3E3XA 4F7XA 2QTZA 2K28A 3BU2A 2CBXA 1DJRD 1EFID 3E20A 2QEJC 4NW2A 5DSZA 4Z9CB 1K73C 4ZGNB 2CC2A 4RPBA 5TRDA 2QDLA 4OOXA 5G3LD 1UE5A 3E0JA 2RQXA 3NK9A 5FO8B 2A69D 2NYZD 4IPHA 3JQPA 2A74C 1E3PA 3ASPA 1TWFB 4PGOA 3OZWA 3CTAA 3D6CA 5IYNA 4K8IA 4Q5VA 3CCVB 1XFOA 1A3TA 2JA7H 3NTKA 4X3UA 4B3ML 2W6JA 2OBTA 3SJZA 1M90C 4OONA 1CI3M 4A93B 1MD2D 3FKIH 1QB5D 3QG1A 2WIIB 2ATWA 2F4VL 5E4WC 5F2DA 5JEAG 1LTRD 4C3IB 5ELNA 2DETA 1CA6A 3CMEB 4JI3Q 4JBKA 1HZAA 1PFNA 1ZYRD 4LAAA 1X32A 5K36H 2XEXA 2ZXRA 2BM0A 3KEWA 4RHSA 5HURA 4A75A 5JPNC 3LNNA 3KF6A 4OWTB 1VQAA 4FF4A 4DV4Q 4M8AA 5ELEA 2EYJA 1PH5A 5DNFA 1DXMA 1K83H 1PYSB 4JBWA 2E5LL 4HCSA 1B53A 4KV6A 2ZJPA 3GTLH 3J7AF 4ILWA 1L0XB 4CJ1B 1AZPA 4ZKBB 4H02A 2KJXA 1LTGD 1K28A 1H8EA 1V1OA 1EY7A 3LX0A 5KW9A 2JP1A 3T53B 3AGQA 1MRZA 4QMGA 4HIOA 1PH9A 3TMEA 1I4XA 1ML0D 5M3FB 2EXZA 4NXMQ 3CCEB 4LBWA 3U6KA 3VR6A 4F7DA 3MCAA 2EYFA 1FL0A 5E1FA 1Y0YA 3CMMA 2Z1CA 3J81c 2VJIA 4QIWB 1EFUA 2K1BA 1KRSA 3I73A 1JOQA 4B3RL 1A6XA 1NTGA 3CD6B 3RLFA 3CW2C 3GTPH 2OBSA 2JJQA 3W5UA 2VQFQ 2KCCA 4MHEA 1YHQA 4B44A 2IHFA 4MIUA 4DV4L 1H42A 2C2WA 4EQ5A 1IYVA 1R9TB 1FRQA 1PTOB 5K5PA 2KEEA 4HIKA 4A3KH 2V7XA 2B2YA 2OCEA 3L3OC 2QDXA 4AC9A 4JI1Q 5C44B 1RQPA 4IJLA 2XGJA 4G5GA 2I5HA 2L5TA 5IT9c 4KKUA 1SNQA 4GN4B 4OXPA 3W1BA 1JE4A 1IHMA 1PH7A 4KKSA 4KY5A 4Z4YA 3T51B 1WTXA 5ELOA 2NVYH 4Z4UA 2NTTA 4YIJA 1JB7A 2HIXA 3U6BA 2R93B 1ZKOA 4JYAQ 4H0LC 2K5WA 4X0CA 2O5IC 5C4XB 3OSOA 2WFWA 4IUTA 2F0OA 4MZ9A 4JI8Q 5JEAJ 5IIFA 4LF6L 4JI1L 4PQXA 1V5VA 1B44D 3OZVA 1F9QA 1EWIA 2F0HA 1SE3A 1GD7A 3SE0A 1D1KA 4X6AH 3D26A 2ZZQA 4C3IG 2PZWA 1PTOC 1PTOD 1O7IA 4JG2A 4GKJL 2NZ1D 1IHZA 4QQBX 4A93G 3T1YL 3CPXA 2M5SA 3VYSA 5GV8A 1SNCA 4QVJA 2RA4A 3EJIA 3OWEB 4WJWA 1H95A 1L2FA 4P72A 1TS3A 2F3WA 4Y52H 1LT5D 4QJFA 4GZYC 3STBC 1CKNB 3H6MA 5FK9C 4YXWA 3OIQA 1H9RA 4LF9Q 2B8GA 3KF8B 3BZCA 5AN9A 3DWAA 3H09A 3GTGB 4YEJA 2IHEA 1FGUA 1HFGA 1NR4A 4YAWA 2OQ0A 4LFAL 1VQ6A 3DLLA 4RCOA 3CCRA 1PH8A 2UUBL 2Q6LA 1DOLA 2VBVA 2X6LA 3WNBA 4KD4A 4N3GA 1EZ6A 1E1QA 3VO2A 2R3ZA 3A54A 2B5OA 1K3RA 1MHWC 3RLNA 2G9HD 2Z6BD 3LVBA 3ZBUA 3KLRA 3UDIA 3CB4A 3E6ZX 1F20A 4A3MB 3FEWX 4HJ9A 1X9NA 2YTXA 5J3OA 3C1EA 2KHJA 3NBHB 4JK1C 4ROXA 1BLIA 1A15A 1Q12A 3UDGA 3R6KA 3HG9A 4LK1C 4PG3A 3I56B 1FNUA 4CHTB 4DR3Q 4NPSA 4DN4M 1EQTA 2DERA 2B2UC 4FXKC 4DR7L 1FX0A 3CCLB 4M2LA 2CVRA 5CC4A 4UZUA 4QL5A 2R92H 2DJGC 1JJ2A 3BJUA 1ZM9A 1VMCA 3PA2A 1S72B 1G2TA 4FN5A 2HQEA 5C4JB 2N49A 4A3JG 3A3GA 4X65L 1F2YA 2E2HB 1B1ZA 1F9RA 1I6VC 3HFZB 1PYBA 4LFCL 1GO2A 1OGIA 1XNQL 1VQPB 3D6WA 2IPKD 2VW9A 1BMFA 1EIHA 1QUQA 3Q6SA 2SNSA 5LMUQ 4JYAL 3K5LA 5J35A 4EQOA 2C77A 1STGA 2B63B 4DV6Q 3NENA 4ALPA 1GUWA 2KHIA 2VQEQ 4A3EH 1SBBB 3JQQA 4UP9A 4ZRZA 3I4NG 3CRKC 1TUIA 4JCVE 3PUYA 2MHVA 1AZQA 1T5XD 4RD6A 4X7FA 1PMRA 1R5BA 2QMUA 2VNJA 2HUGA 1JICA 3NE5B 4QFMA 1SM4A 1BNZA 2F3VA 4JMQA 1PH2A 4RMFA 2XNDA 2D0PA 3A8JE 4DFAA 1JQYD 3AU7A 3FMCA 3CQZH 2X53S 1KD1D 1N0UA 2F0EA 1I3QH 3G7LA 1A8VA 4A3FG 1IBMQ 5EBCA 3M4OH 3CCSB 4DR4Q 1VF5C 2BV3A 3GIRA 3DWPA 4GLVB 1FYCA 4L6TB 5FLMH 1QUQB 3OW2A 1X3GA 3J7AV 5C4ZA 2GVAA 3LWUA 1A3VA 1NJIC 4YY3L 1FD7D 1G291 4DV1Q 2L55A 2KVMA 2WPDA 3KL9A 2WZNA 1VQMB 4GNXA 1EY6A 1KK0A 3I55A 3K0YA 2F3IA 2WB1G 4LF8Q 1C0AA 4DNRB 1N36Q 4LFBL 5HKKA 2F0LA 4QGUA 1Q81C 1FNCA 4Z4WA 3TP8A 1R4QB 2K5HA 4JI0Q 1IL8A 1BBUA 4U68A 1OHHA 2QA4B 1U4PA 4K14A 2QEXA 3PO2H 3TREA 1K8AD 2XZPA 2E2JH 1EWYA 4IUNA 2WR8A 2K52A 1TWGB 1B7YB 2WV6D 2RF4A 2X6XA 4JI6L 5B6IA 4F88A 1S5CD 1SEBD 3MWYW 1S40A 4DUYQ 1HR0W 3GTJB 4L8JA 3T56B 5KGUA 1EQRA 2F0QA 2B2UA 5EKKA 2BM1A 3MMPA 3EN2A 2AKWB 3K59A 2WYRA 3J81k 1FNDA 1GUTA 3BVMA 2BCOA 1V0EA 4TSSA 1E43A 2RSNA 3NPPA 3CP2A 4CDEC 1SKYB 2XNCA 3I70A 1X3FA 4QVAA 1VCIA 3P1HA 4QCLA 2R7FA 3DDYA 2LSSA 3EROA 1E24A 2N8NA 3VR4A 3H15A 5M9OA 4TMVA 5EMNA 2IJ0A 1ASZA 4KHVA 2K33A 3WNDA 4QF4A 4A3FH 2RHSB 1E62A 2ZL6A 5ELCA 2D62A 4OIKA 2IWHA 1HNZL 1T6ZA 1N36L 1EIFA 2RC5A 2EY2A 2F0PA 4OWXB 4JI6Q 2RDGA 3PO2G 3PIPA 4TMTA 1JA1A 4HIMA 1Y8OB 1TWFH 1VQ5A 4JW0A 2A5HA 3NHHA 2I0QA 2F0NA 2RVLA 1NY4A 2JA7B 1I4PA 2KQ3A 4K5VA 2LS01 5CV4A 3HOYB 1DONA 1G91A 2NUCA 4G6IA 3KFUA 1J9ZA 3X3NA 2PMZE 3VDYA 3K80C 1HA3A 4A93H 2RHQB 2N55A 3ZYYX 4LFAQ 1ZM3A 4AYBB 2A8VA 1WTWA 4JC0A 5L37A 3GTQB 2PW7A 3F1ZA 1LACA 1TLLA 3AB9A 2XSCA 2JK8A 2IX1A 2HCCA 4OELB 1UD2A 1QZHA 4XQJA 3PGZA 1D6EC 1WPCA 1K83B 4QV2A 3JAMc 1PHJA 3ERSX 1S4ZA 3CU7A 4G7OC 2Q2HA 1CKOA 3DUZA 4A3GG 1QCBD 1WYDA 2QEXB 4WJ3M 4A3CH 3OWFA 1VQLA 3J81L 2QA4A 4JVZA 1O7LA 2WAQB 1H9SA 5C3WA 3WBJA 2X8KA 4KMUC 5AJ3Q 5M3FH 3GTKH 3VA5A 2F0DA 2K50A 1I94Q 3E1YE 5C0XH 1X3EA 2D0OA 1RHPA 2GQFA 1QE6A 2EYMA 4RWSC 4JI8L 3SVMA 3HOXG 4JI7L 1YEZA 4QUZA 2VNKA 1KDAA 4L5RC 4R71A 3PIOA 4ULLA 2WSSA 1QX4A 1CK1A 2J7KA 2K6AA 3LWEA 3PVDA 2CRVA 3CCSA 1K9MC 4IFDH 2JJ1A 2C4UA 4BBRB 1LTLA 2IL8A 1YIJB 4A3KB 1HRJA 4X66Q 3I2ZA 1ESFA 2ZL7A 4DV2Q 4DXFA 3CMEA 1YJWB 2PQAB 3I91A 5FNZA 2PCFB 4UDUC 5FOBB 4DV1L 1Q86D 1EY5A 2Z6KA 1QG0A 4ODGA 2PQAA 3GV3A 4HJ7A 3IFDA 3DMUA 1LT3D 4K6LA 4LF5Q 4XNFA 2JDIA 3TDQA 3N6RA 2R93H 4JI0L 1N07A 2X6GA 2Q6OA 5D3IB 3SK8A 2VBUA 4K5WA 2UUCL 5BR8L 2BF4A 1ZUNB 1TT2A 2K5QA 1SROA 5C4XH 1N34Q 1STEA 4KHZA 2ZXHA 1RTOA 1A2TA 3W5HA 1NBMA 2RC6A 3CD6A 1BJKA 2KOLA 1IBML 1G7CA 2V7QA 2GPJA 1EP1B 4WWVA 4IN3A 4BXXH 2EPBA 3MA2B 3PO3G 1L1OB 3M9BA 2Q2UA 1FNBA 5TSSA 1HA6A 5A88A 1B8AA 4K8JA 1W6JA 4YWMA 2B2WC 1WP6A 2LZJA 3IFTA 4OPSA 1AE3A 4HJAA 1Y1WB 2AWNA 2I5LX 1BOSA 3PQIA 1E1RA 1NSNS 5M5WH 4PC7A 1PRTD 2F0VA 2LY7A 2WACA 1CTMA 1SFOH 5IP9G 2BGIA 1K8AC 1WD1A 3Q6RA 5GAEC 1CQFA 4XLFA 2HCIA 3CCUB 1VQGA 2JJ2A 2K7VA 5G3LF 1JT8A 1GUOA 2DY8A 1T6XA 2DJFC 4B4DA 1KLGD 1F2MA 1CM9A 1XX8A 3QO2A 4A3KG 3GTGH 4TMWA 1OXXK 4A3DB 4L5TA 1GO3E 1Y8PB 1XE1A 1FJGQ 3AMUA 3PUVA 1TWHH 1RQRA 1N06A 1BR9A 2UU9L 3MHBA 2B2TC 2EJFC 3ASRA 2NZOA 4G4KA 1CKMA 4K6DA 5JVH3 4LUZA 1Q81D 4XORA 4JBJA 1NMFA 1PFBA 5C3EH 4RDLA 1X55A 4PC1A 1GHKA 1FDRA 1XWEA 4A3MH 5COYA 2A68D 5M3FG 4PC6A 4DV3L 1DZ1A 3CCVA 2A1AA 1VQ6B 1ENCA 2NBFA 3K58A 4DK0A 1ILPA 1JORA 2H1EA 5DLQE 5TV2A 3BZKA 5FO7B 3MEHA 5CBAE 1TIID 2R7ZH 4C1NK 4II2A 4WZTA 5AJ3L 4M53A 1CKNA 3S16B 4MYUA 1KD1C 1OTCA 4XR6A 1HTPA 4GKKL 2R92B 1XQBA 3V2TA 1HUMA 1SYBA 2VZLA 5FA6A 4G7XA 1TXYA 4V0BA 2XN9C 4RHRA 3Q23A 2GJKA 3KLSA 5K36G 4BBRG 2UXBQ 3EFXD 3OE7A 4IUVA 1SRUA 3SHLA 4AYBG 4P6VF 5BN3A 3B82A 1SSOA 4P25A 2YV5A 1VDZA 4UY8C 4FO2A 2KCTA 1G6PA 5ELDA 3EA6A 4A3EB 2HMAA 1NRKA 1SE8A 1QWYA 3WDNA 1FNVA 3IKJA 5I6WA 1KDBA 3SK4A 1B9NA 2E2IB 2DIEA 3E9IA 3A7LA 4XD7A 1WTHA 3Q22A 2MUYA 2HCJB 3W5OA 1VQ7A 4HIDA 4IALA 1TY2A 1PA6A 4ZKCB 4GOPB 4LBVA 1LT6D 4LWCA 1VQOA 1BVSA 3TS2A 2EJGC 4GKKQ 1PXUA 1IBKQ 1I6HB 1VQNA 5HGTA 1EQVA 3Q8DA 1EYDA 3HOZG 5IYDH 3OMGA 1VQIA 1I3QB 3RUZA 3M4OB 3HOWB 4C3HG 1TU2B 3A35A 3M4YA 4UZFA 4P74A 1GKHA 3A5UA 2B3GA 2ICEC 1WSRA 2N78A 4LW1A 2VUMG 4HTHA 1YHQB 3BDOA 4XOPA 1JWUD 4TKOB 2E74C 2E5LQ 4AQYL 3BDCA 4IPCA 5E4XA 1WDTA 3ULLA 2F0FA 1EIYB 2ZZGA 5FLXL 1HTLD 1RL2A 4DR1L 1I4GA 1NCVA 1E1TA 2PE3A 1RDPD 3M4QA 1RKNA 5LMUL 1COWA 1CZGA 2Q8TA 3SGIA 3TP7A 1CHPD 4HMJA 1PTOF 2AQ2B 4XLCA 2WP8J 4LBYA 4DAYB 3BS1A 5J1ZA 1E0BA 1E7ZA 2NV4A 1HVXA 5IYQA 1QVFA 5LL6S 3J7ZC 2EVBA 3TP6A 2E1RA 4LF7Q 1VJSA 3JC66 1Y8NB 3CF5A 2F0TA 4FF3A 3PO2B 4B3RQ 1H85A 1QGYA 4GLAC 5IGBA 3RMHA 1IB0A 1XMOL 2NVQB 4O2DA 2SDFA 4LF8L 4B3SQ 3N52A 1TWGH 1ET6A 2YWHA 4IQZA 4RD2A 5H59A 2Z6KC 3B6YA 4NXML 1E79A 1PYWD 1CUKA 2DN8A 2GJRA 1NR2A 2BDOA 2K75A 3CC2B 2C4TA 3BCDA 3Q38A 3AVWA 5IT9L 3GTJH 3SDZA 3HOUG 4ZCIA 1JJCB 5JPMC 2B2VC 2AMCB 4XONA 4OO1H 2EYOA 4BY1G 3H3VI 2R9VA 1X65A 5IP7G 3CKIB 1JJGA 5KNLA 1GOZA 3HKSA 4X3SA 2YYZA 1EEID 4JI2Q 2D5DA 3KLWA 3ES9A 4C56C 2AWOA 1EU4A 2MPMA 5LMNL 3OFNA 1GVHA 2UUCQ 3QJYA 3UDXA 3G6JB 3I4MH 1RCVD 2X85A 1D5MC 4TSFA 1I4RA 1K0RA 1QZGA 3VA7A 2VNUD 3SJPA 2EY6A 5CORA 4A3FB 3S17H 2NVTB 3V7AA 4P71A 4EGVA 4DNTB 3VYUA 2OBRA 5IYDG 5LHY1 3HKZE 1DDGA 4I7ZC 5FO9B 1D2BA 3GO5A 4NXNL 5HGQA 5J22A 3NXWA 4CJ2C 4YHBA 4DR4L 4RCYA 1EYCA 1XNRQ 1YJ9B 1MIUA 4R4CA 1FGBD 1H9JA 5DEHA 2XWBB 1V1QA 4E0FA 2N88A
chains in the Genus database with same CATH topology
4XDXA 4H13C 1JOKA 1Q8IA 3DWQA 3I90A 3BG3A 5A2QE 1TWAB 2J0TD 3TZUA 1K8OA 3PUZA 3PV0A 3A55A 5I6YA 1OXVA 1ICWA 1JOOA 3A3BA 1W0JA 2NN6G 2E76C 3BYYB 3NWTA 4A3JB 2EYHA 1ET9A 2KUMA 4WORA 2KHSA 3WOFA 3PMFA 4R8NA 1BCPD 1BCPF 3K6OA 3R2TA 3OMCA 1S5BD 2HLDA 1ZYRC 4HN7A 2XZOA 3P20A 4OHJA 2G9DA 3GTKB 1B4OA 3D31A 1F9PA 4XL9A 4KD3A 2QDBA 2F4IA 2FHTA 3HGBA 2D9UA 1EL0A 1CA5A 1HA5A 4G7WA 3MXNA 3S1NB 3GV6A 2A69C 1U9RA 1CT1D 1PRTF 1ENFA 2X69A 2A68C 1JCKB 1MABA 2QKIC 1DD2A 4H44C 2EE1A 5J39A 1PDQA 3OAAA 2EZVA 1C8CA 1UNSA 3K57A 1H8HA 4V190 1PRTB 3NTIA 2IT1A 5NUCA 2RKSA 4F87A 1Z7TA 5EPKA 2ZTNA 1A2UA 2KA7A 1WTVA 1II3A 1AFPA 4XKWA 2K03A 3IAYA 3Q0AA 1PZID 4ZAIA 3C3LA 5M5WB 1SNPA 3OHXC 1SFOB 2F03A 2WJYA 1B3AA 3NTHA 1PFMA 1SJED 2QF7A 3QB3A 3A7AB 5IGCA 5JAVA 1TWHB 3GQBA 2GJPA 2WINB 3NUCA 2A6ED 4BA2I 5ELFA 3NP8A 4B08A 5C3EB 3D4DA 1V43A 1HXYD 1MGSA 2PYKA 2SNMA 1EY4A 4ZUIA 1KAAA 3HAGA 4IUPA 4NMZA 5KEEA 2EJMA 2AUKA 5LL6X 2EDGA 4M1UB 1EY8A 3BH4A 4PNYA 3GD7A 1JWSD 3O13A 1F77A 5D14A 5CV5A 2Z8LA 4XT3B 2R7ZB 1XTCD 2EYLA 2ZXOA 3K5NA 3CP8A 4XLHA 3FDTA 4C1NI 2ENBA 1O78A 4QB4A 4RA8A 1T5EA 5CDFA 2PPBC 4U673 5I4DA 2QE7A 2V31A 3GVJA 1ZEQX 3M85A 4WFN3 1KABA 1W9XA 3FRPB 1I18A 2SEBD 4DXGA 3S1QB 2F0SA 3H3VC 4UAIA 4ME5A 4EVOA 2B39A 4DAVA 2W6IA 1W0KA 3P75A 1MSGA 5EPJA 4XQNA 3ND9A 2JXMB 5C6AA 2OF1A 3HP3A 1WD0A 1SXTA 5EQ0A 1WVLA 1UAPA 2MGSA 3I8ZA 4C3JG 1LABA 4KK7A 2R6GA 2NTSA 1KTKA 4DF7A 5BN4A 1I50B 3QOJA 1SMYC 1SYEA 3GP7A 3MVVA 5ELBA 4LMQD 1OO9B 3MXGA 2MJ8A 2F1MA 3CESA 1H9KA 4R9WA 4EQNA 4PMWA 4OL7A 1KDCA 4IUQA 2L4NA 4IZ8A 5BN5A 5KIXA 4X3KA 3FVQA 2D3LA 2XZLA 2ZZFA 1J9OA 1HQRD 4FYDA 2ZXPA 2PW5A 2WKCA 5IODA 1PRTC 4OIJA 1EY9A 1RTNA 2BA1A 4O1NA 1TS4A 3MC0B 3I4MB 1EWCA 2F0GA 3R2IA 1NUCA 2M9VA 3S17B 5T1IA 3FPUB 4G57A 1ONLA 3R8BA 3OW7A 4WRDA 5EKLA 1IKLA 1JB3A 1XXGA 1YNJD 1GJXA 4F8MA 1E2ZA 4KN4C 4PV1C 1E3XA 1TKWB 3P7JA 1BXTA 3JU4A 4B3GA 4PMBA 4O42A 3SXHA 5FKAC 4FNFA 3HOZB 5JVG3 2X6WA 1WTRA 4K2LA 4GQNA 3S1MB 4A3BB 5IOCA 2JA5B 4TT3A 2BA0A 4IURA 1DM0B 5JJZA 5D65A 3OPOA 2HDMA 1TQOA 3HOVB 2WKDA 3BVGA 1L0YB 1E2WA 4FVMA 1S5FD 1R4PB 2NVXB 3GTMB 3J80L 4B3FX 2A73B 1M8AA 1AP0A 5T1GA 3OEEA 3CHBD 4HMIA 4NKLA 3SEBA 1WTOA 1SJHD 4IFDJ 1E3ZA 1HCZA 3DM1A 5C3XA 4BY1B 4OO1G 1PKVA 2ZTGA 3HOUB 4S3SA 4HSPA 4Q0FA 4HCEA 1SE2A 2J7ZA 2O2LD 4J1MA 3NWSA 4II3A 1SMYD 5C0XJ 3ZIAA 1C4QA 5CV7A 3TP5A 3NQTA 1I8DA 2F0WA 3MFGA 3MAQA 3PIP3 4A3IB 1D5XC 2FINB 2XIWA 2CW0C 4ZQ3A 3ITPA 4K5XA 3DHQA 1V1PA 5I9PA 3JAML 2WB1B 3TN2A 3WQZA 4G7ZC 1KZLA 4BS9A 4RH6A 4FP5D 1GUNA 1H9MA 1TR5A 4CBVA 1SNOA 2XRQD 3BC9A 2VUMB 1Y1VB 1AW7A 1PLFA 1TWCB 5JOBA 1O7ZA 4XTCS 1G8ZD 2VB3X 4XQQA 3S15B 3D4WA 1HQMC 3PO3B 1MBYA 1QOHA 1SYGA 4E6IA 2PMZB 3HKZB 5I2XA 2F0KA 1M4VA 3V96A 5A2QL 3S14B 1K8MA 3MFYA 4KKTA 1PZJD 4NNJA 3OEHA 4XKVA 4CJ0B 5IGDA 2C9OA 2MP1A 3H91A 5CBEE 1YNNC 2JA8B 1UUPA 1S5DD 1KMHA 1LTTD 1AEXA 1NAPA 2FFKB 3S9WA 1LTID 1DYQA 3M7NA 4HEDA 3RD4A 1KLUD 2TSSA 3I3CA 3EQLC 1ILQA 4FXUA 1LTAD 5EJWA 3U9OA 1O7YA 1BPLA 4L63B 4EQPA 2B2VA 3KUPA 2KECA 1V1PB 3A8IE 2XWJB 4CKEA 2A6EC 3BCFA 1BF4A 2L11A 3K7AB 1GUGA 1BBXC 1UD3A 5JEAH 4DK1A 1V8QA 2F0UA 2EY1A 1LTBD 2L1BA 2BOSA 1DCZA 4KTAA 2Q8IB 2F0IA 4KJOA 5KNCA 1EYAA 2A6HD 3NBHA 1EEFD 2NB0A 4QUCA 3S2DB 1TS5A 1EOTA 3MXPA 2KCNA 1F9SA 2AUJD 4XXEA 3ONAB 5M5XB 1C48A 4KY7A 2B2WA 4Z1MA 1STNA 3GVLA 1RODA 3T13A 4K2KA 3KBGA 2JEBI 1EZ8A 3KLSX 1W6KA 5IT9E 4TRDA 3R93A 3SR1A 1LV9A 1EIGA 1KNEA 3G05A 2ZT9C 1STHA 4ABNA 2GA4B 4ZK9B 2E2DC 4XM3A 2EOTA 1I4QA 4OGQC 2IW3A 2OEOA 1OXTA 3TSSA 2F0MA 4C2MB 1EWHA 3S1RB 2GK6A 3T16A 2K05A 3IL8A 1OXSC 1RF2D 2XVSA 2QCPX 1H9SB 3VYRA 3BZDB 2VJJA 2CQAA 1IW7D 1STBA 3QWNA 3NBIA 3HOXB 4N9TA 2TMPA 2H4OA 1BCPC 4QUFA 5C0XI 1RD9D 1JC7A 2A6HC 3DXJC 5KNBA 1X3QA 1OB0A 3UI2A 3J80E 2FMMA 4RGMA 4P2CB 3OIPA 1JR0D 3C1FA 4IFDI 1GXDC 2DY7A 4HSVA 1UD8A 4A3GB 5FL7A 1SE4A 1QG7A 3M7GA 1LTSD 3HRZC 2RDFA 4BBSB 2OXPA 4OO1I 3BVZA 5FLXE 1ENAA 4C3HB 5A35A 5C5LA 1QNUA 5M5YB 3VR3A 4DA2A 1B50A 3BYTB 4BY7B 2F43A 1UD4A 2VXWA 4N9PA 3U9SA 4P22A 1E2VA 2JSOA 3PIO3 3I4NB 3TBIB 1YNND 3TZDA 2RDHA 3GTOB 3S2HB 1Z6HA 3J7YW 1Q1BA 5EKIA 1HFNA 2Q8RE 4KN7C 4DU9A 3V05A 5IK2A 4I65A 5ISRA 4DAPA 5I2YA 2R61A 3OOCA 3PUXA 3CRLC 1Q1EA 2EY5A 5EBDA 5CYUA 1MSHA 4NP5A 4RKLA 5AFWA 4Y7NB 5CV9A 1IW7C 3Q24A 1QNKA 2I07B 3URYA 1U4LA 1DOMA 4B9WA 4KY6A 1Q90A 3WOEA 2YU9B 4XN0A 4B9XA 4RCNA 2NWGA 4C3JB 1O80A 1LO5D 2DNEA 3D4RA 4RAUC 2K32A 3H94A 2PQEA 1WCMB 3T4AC 1B2TA 2PZUA 3ND8A 3W2DA 1TVXA 1IYUA 5KRUA 2O5JC 1SNDA 1TS2A 3HS0C 4XLEA 2M2LA 4XYQA 2ID0A 1I4HA 4MN3A 1STAA 3FKIB 2V4DA 1RJTA 2PO4A 5KYIA 3I72A 2JIZA 3L9AX 4XOTA 1JWMD 3MZ5A 4RGNA 1HPCA 1WTPA 1PZKD 3K5OA 2EYPA 5IGFA 1S5ED 2KVOA 1BQQT 3ZPNA 3GTLB 1SYFA 2K04A 2FJ2A 2BDNA 4J6HA 2K01A 1U4RA 1SNMA 1F2ZA 1EFRA 2L9HA 2KEDA 3RZDB 1BO0A 1TY0A 2C5CA 4RGTA 4LJZC 4CGYB 1SYDA 2ZZEA 2JE6I 4XQFA 5KNDA 1CQVA 3FKSA 3GTPB 4XLAA 2FMCA 4XIGS 2D2CC 1LT4D 3HZXA 4DGZA 1MI2A 1PTOH 5CGKA 4PMCA 4RFBA 4HIZA 3KK7A 1QJOA 3W3AA 3D8GA 3EVQA 3QOLA 4BWGB 1VMPA 5E3FA 1UEAB 2NVYB 1F2LA 2QILA 2K5DA 5C5MA 5DAUA 2Z4HA 2Y0SB 3VR2A 1UD5A 2ZXIA 2BE5C 2LFNA 3ERQA 4TQUS 4BA1I 3FPPA 1WTQA 3DEOA 4ZUJA 1OXUA 2DNCA 1Y69U 1STYA 1IKMA 3JAME 2D3NA 5IGEA 1VF7A 3C2PA 1AN8A 3H0GB 3L7ZC 4ZYSA 1EU3A 1FR3A 1FNWA 1QILA 4XN3A 2O4XA 2Z4IA 4G7HC 2B8FA 4YELA 4IFDG 2PNRC 3MTSA 2SOBA 5DM73 4J8QA 2E1BA 2XNAC 3BDLA 2F0JA 2CK3A 5CV6A 3KF8A 2AQ3B 1BDOA 4X3TA 1G6ZA 5C0XG 1Q3LA 2CHBD 1CZWA 2CW0D 2B2YC 1HUNA 4HAEA 2PZTA 2XRSD 5CV8A 2LKVA 1DOKA 4XYOA 2JA6B 1VLYA 2I46A 5DN6A 2B2TA 3A8KE 1BCPB 4DAYA 1WTHD 1LLRD 3X3MA 4RKBA 3GVKA 4H7BA 4IUUA 2IX3A 5CMDA 1XYIA 2ICIA 1J8IA 2RBMA 4KI0A 1X3PA 2NN6H 3VR5A 3E5SA 1V0FA 4KJNA 5DM63 3VYTA 1Z47A 3D3RA 4XT1B 3A56A 4RGOS 2NN6I 2BE5D 3QIAA 4CKCA 1SAPA 4FF1A 5I9OA 4FXDA 3DEPA 2HDLA 1SDFA 3SK5A 1ESRA 3M3YB 3RZOB 1GUSA 4FXGC 1EY0A 1A3UA 3CQZB 1GHJA 2JYOA 4ZLTF 5EPLA 1BUVT 4HR7B 3NSWA 4ID6A 5M3MB 4FF2A 3SK6A 3I4LA 1YNJC 4R8IA 1D1IA 3K5MA 1HHVA 4AVZA 1G2SA 2AQ1B 3PUWA 4CKBA 4XMYA 2X6YA 5KYLA 2RSOA 2JEAI 1D5ZC 1K28D 2GK7A 2E75C 2WJVA 5IGGA 1CFMA 3HEJA 2OT2A 2XOKA 4NDXA 2E2JB 2IX0A 3NQIA 2L0CA 5C4HA 3MXUA 1KNAA 5D3DA 3J81E 2M00A 1U4MA 1SYCA 3F2UA 5EGTA 1CHQD 3KBXA 2LMCB 2WZPP 2L12A 1B9MA 2J4XA 4ASUA 1HZEA 3R3OA 3C46A 2VB2X 5CR3A 1ZXTA 1UD6A 4F7XA 2K28A 1DJRD 1EFID 2QEJC 4NW2A 4Z9CB 5G3LD 3E0JA 2RQXA 3NK9A 5FO8B 2A69D 2NYZD 2A74C 1TWFB 3D6CA 4K8IA 4Q5VA 1A3TA 3NTKA 4X3UA 2W6JA 1CI3M 4A93B 1MD2D 3QG1A 1QB5D 2WIIB 5E4WC 5F2DA 5JEAG 1LTRD 4C3IB 1CA6A 1ZYRD 1PFNA 4LAAA 5K36H 1X32A 2ZXRA 3KEWA 4RHSA 5HURA 5JPNC 3LNNA 4FF4A 4M8AA 5ELEA 2EYJA 5DNFA 1DXMA 4JBWA 4HCSA 1B53A 4KV6A 3J7AF 4ILWA 1L0XB 4CJ1B 1AZPA 4ZKBB 2KJXA 1LTGD 1H8EA 1V1OA 1EY7A 3LX0A 2JP1A 3T53B 4QMGA 3TMEA 1I4XA 1ML0D 5M3FB 2EXZA 3VR6A 2EYFA 5E1FA 3CMMA 2Z1CA 2VJIA 4QIWB 2K1BA 3I73A 1JOQA 1A6XA 3RLFA 2KCCA 4MHEA 4MIUA 1IYVA 1R9TB 1PTOB 5K5PA 2KEEA 2B2YA 3L3OC 5C44B 2XGJA 2L5TA 4KKUA 1SNQA 1JE4A 4KKSA 4KY5A 3T51B 1WTXA 2NTTA 4YIJA 2R93B 1ZKOA 4H0LC 2K5WA 2O5IC 5C4XB 3OSOA 4IUTA 2F0OA 5JEAJ 5IIFA 4PQXA 1B44D 1F9QA 2F0HA 1SE3A 3SE0A 1D1KA 2ZZQA 4C3IG 2PZWA 1PTOC 1PTOD 2NZ1D 1IHZA 2M5SA 3VYSA 1SNCA 2RA4A 3EJIA 3OWEB 4WJWA 1TS3A 2F3WA 1LT5D 4GZYC 3H6MA 5FK9C 4YXWA 3OIQA 1H9RA 2B8GA 3DWAA 3H09A 3GTGB 4YEJA 1HFGA 1NR4A 4RCOA 1DOLA 2X6LA 4KD4A 1EZ6A 1E1QA 2R3ZA 3A54A 2G9HD 2Z6BD 3KLRA 3E6ZX 4A3MB 3FEWX 3C1EA 4JK1C 1BLIA 1A15A 1Q12A 3HG9A 4LK1C 4CHTB 1FNUA 4DN4M 1EQTA 2B2UC 4FXKC 1FX0A 2CVRA 5CC4A 4UZUA 1G2TA 1VMCA 2HQEA 5C4JB 2E2HB 3A3GA 1F2YA 1B1ZA 1F9RA 1I6VC 3D6WA 2IPKD 1EIHA 1BMFA 3Q6SA 2SNSA 3K5LA 4EQOA 1STGA 2B63B 1GUWA 1SBBB 4ZRZA 3CRKC 3PUYA 2MHVA 1AZQA 1T5XD 1PMRA 2HUGA 3NE5B 1JICA 1BNZA 2F3VA 4JMQA 2XNDA 3A8JE 4DFAA 1JQYD 3AU7A 3FMCA 2X53S 2F0EA 3G7LA 5EBCA 1VF5C 3DWPA 4L6TB 1FYCA 3J7AV 5C4ZA 3LWUA 1A3VA 1FD7D 1G291 2L55A 2KVMA 2WPDA 1EY6A 3K0YA 4DNRB 5HKKA 2F0LA 3TP8A 1R4QB 1IL8A 4U68A 1OHHA 1U4PA 4K14A 2XZPA 4IUNA 1TWGB 2WV6D 2X6XA 4F88A 1S5CD 1SEBD 3MWYW 3GTJB 4L8JA 3T56B 5KGUA 2F0QA 2B2UA 5EKKA 3K59A 1GUTA 3BVMA 2BCOA 1V0EA 4TSSA 1E43A 2RSNA 3NPPA 3CP2A 1SKYB 3I70A 1VCIA 3P1HA 4QCLA 3EROA 3DDYA 3VR4A 5M9OA 2IJ0A 4KHVA 2K33A 4QF4A 5ELCA 2D62A 4OIKA 2IWHA 2EY2A 2F0PA 2RDGA 1Y8OB 2A5HA 3NHHA 2F0NA 2RVLA 2JA7B 1I4PA 2KQ3A 5CV4A 2LS01 4K5VA 3HOYB 1DONA 1G91A 2NUCA 4G6IA 3X3NA 2N55A 3ZYYX 4AYBB 1WTWA 3GTQB 2PW7A 1LACA 3AB9A 2XSCA 2IX1A 2HCCA 1UD2A 4XQJA 1D6EC 1WPCA 1K83B 1S4ZA 3CU7A 4G7OC 3DUZA 1QCBD 3OWFA 3J81L 1O7LA 2WAQB 1H9SA 5C3WA 2X8KA 4KMUC 3VA5A 2F0DA 5C0XH 2EYMA 1RHPA 1QE6A 4RWSC 3SVMA 1KDAA 4ULLA 2WSSA 1CK1A 2K6AA 3LWEA 4IFDH 2JJ1A 4BBRB 2IL8A 1HRJA 4A3KB 1ESFA 4DXFA 3I91A 2PCFB 4UDUC 5FOBB 1EY5A 4ODGA 3GV3A 3IFDA 3DMUA 1LT3D 4K6LA 4XNFA 2JDIA 3TDQA 3N6RA 3SK8A 2X6GA 5D3IB 4K5WA 1TT2A 2K5QA 1STEA 4KHZA 2ZXHA 1RTOA 1A2TA 1NBMA 2KOLA 4IN3A 2V7QA 2EPBA 3MA2B 5TSSA 1HA6A 4K8JA 1W6JA 2B2WC 1WP6A 2LZJA 3IFTA 1Y1WB 2AWNA 1BOSA 1E1RA 1NSNS 1PRTD 2F0VA 2LY7A 2WACA 1CTMA 1WD1A 1CQFA 4XLFA 2HCIA 5G3LF 2JJ2A 2K7VA 1GUOA 2DY8A 1KLGD 1F2MA 1CM9A 1XX8A 3QO2A 1OXXK 4A3DB 1Y8PB 3AMUA 3PUVA 1BR9A 3MHBA 2B2TC 2EJFC 4G4KA 4K6DA 5JVH3 4XORA 1PFBA 1GHKA 1XWEA 5COYA 2A68D 1DZ1A 1ENCA 2NBFA 3K58A 4DK0A 1ILPA 1JORA 2H1EA 5FO7B 3MEHA 5CBAE 1TIID 4C1NK 4II2A 3S16B 4XR6A 1HTPA 2R92B 3V2TA 1HUMA 1SYBA 4G7XA 4V0BA 2XN9C 4RHRA 3Q23A 2GJKA 3KLSA 5K36G 3EFXD 3OE7A 4IUVA 3SHLA 5BN3A 1SSOA 1VDZA 4FO2A 5ELDA 3EA6A 4A3EB 1NRKA 1QWYA 3WDNA 1FNVA 3IKJA 5I6WA 1KDBA 3SK4A 1B9NA 2E2IB 2DIEA 3A7LA 4XD7A 3Q22A 2MUYA 4IALA 1TY2A 4ZKCB 1LT6D 2EJGC 1PXUA 1I6HB 5HGTA 1EQVA 1EYDA 3OMGA 1I3QB 3RUZA 3M4OB 3HOWB 4C3HG 1TU2B 3A35A 3M4YA 2ICEC 4HTHA 3BDOA 4XOPA 1JWUD 4TKOB 2E74C 3BDCA 5E4XA 2F0FA 2ZZGA 5FLXL 1HTLD 1I4GA 1NCVA 1RDPD 1RKNA 1COWA 1CZGA 2Q8TA 3TP7A 1CHPD 4HMJA 1PTOF 2AQ2B 4XLCA 2WP8J 3BS1A 5J1ZA 1E0BA 1HVXA 5LL6S 2EVBA 3TP6A 1VJSA 1Y8NB 3PO2B 2F0TA 4FF3A 5IGBA 3RMHA 2NVQB 2SDFA 3N52A 1ET6A 4IQZA 1E79A 1PYWD 2DN8A 2GJRA 1NR2A 2BDOA 3BCDA 5IT9L 3SDZA 5JPMC 2B2VC 4XONA 4OO1H 2EYOA 2R9VA 3CKIB 5KNLA 1GOZA 4X3SA 2YYZA 1EEID 2D5DA 4C56C 2AWOA 1EU4A 2MPMA 3OFNA 3QJYA 3G6JB 1RCVD 2X85A 1D5MC 4TSFA 1I4RA 2VNUD 3VA7A 2EY6A 5CORA 4A3FB 2NVTB 4EGVA 4DNTB 3VYUA 5LHY1 4I7ZC 5FO9B 1D2BA 3GO5A 5J22A 3NXWA 4CJ2C 1EYCA 1FGBD 1H9JA 5DEHA 2XWBB 4E0FA 2N88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJG C;  4PV1 C;  1TKW B;  1Z7T A;  1GUS A;  3ND9 A;  2AUJ D;  4H13 C;  2JXM B;  1GJX A;  1OXU A;  2DNC A;  1Y69 U;  3A8J E;  3BG3 A;  2KA7 A;  5A35 A;  3FMC A;  1GHJ A;  4XTC S;  3TZU A;  1K8O A;  1VF7 A;  3IFT A;  3PV0 A;  3PUZ A;  1CI3 M;  1TU2 B;  3VR3 A;  3L7Z C;  1OXV A;  3QG1 A;  3M4Y A;  2V4D A;  1HQM C;  1CTM A;  1VF5 C;  4HR7 B;  1FYC A;  2JEB I;  5JEA G;  4GZY C;  1FR3 A;  3BDO A;  1LAB A;  3I72 A;  2K7V A;  4TKO B;  1GUO A;  2BA0 A;  2E74 C;  3I4L A;  3LWU A;  5K36 H;  2R6G A;  1H9R A;  1LAC A;  2B8G A;  2E76 C;  2NN6 G;  3AB9 A;  1YNJ C;  4G7H C;  3OPO A;  1HPC A;  1G29 1;  3U9S A;  3LNN A;  1E2V A;  1OXX K;  2QF7 A;  2B8F A;  2ZT9 C;  1Y8P B;  4IFD G;  2PNR C;  3PUV A;  3A7A B;  3GQB A;  1E2W A;  1DXM A;  4JBW A;  1K8M A;  3MFY A;  5BN4 A;  4KKT A;  2EJF C;  2A6E D;  4OGQ C;  3PUW A;  4G7O C;  4BA2 I;  4DNR B;  1Z6H A;  1SMY C;  1OXT A;  1Q1B A;  1V43 A;  1BDO A;  2JEA I;  1O7L A;  5C0X G;  4KN7 C;  1YNN C;  1EWH A;  2E75 C;  2EVB A;  3KLR A;  1ZYR C;  1H9S A;  1GHK A;  3T53 B;  1Y8N B;  1CFM A;  2F1M A;  2A68 D;  4KMU C;  3OOC A;  1H9K A;  3P20 A;  2EJM A;  3PUX A;  2AUK A;  3CRL C;  3VR6 A;  3D31 A;  1Q1E A;  4DK0 A;  2EDG A;  4LJZ C;  5C0X H;  3M7N A;  4JK1 C;  1HCZ A;  5BN5 A;  1OXS C;  4OO1 G;  4IQZ A;  3GD7 A;  3A8K E;  3EQL C;  2JE6 I;  3MXU A;  1Q12 A;  3I73 A;  5KND A;  2DN8 A;  4LK1 C;  2BDO A;  3RLF A;  1A6X A;  1H9S B;  1IW7 C;  3HGB A;  4L8J A;  3T56 B;  1IW7 D;  2KCC A;  3SDZ A;  4XIG S;  1HTP A;  2D2C C;  4OO1 H;  2LMC B;  1IYV A;  1GUT A;  1O78 A;  4IFD H;  3A8I E;  1T5E A;  4KI0 A;  2A6E C;  1I6V C;  1B9M A;  2A6H C;  2YYZ A;  1Q90 A;  2NN6 H;  2D5D A;  3DXJ C;  5KNB A;  2PPB C;  5K36 G;  1QJO A;  1GUG A;  2AWO A;  3W3A A;  3VR5 A;  4RCN A;  1VCI A;  2CW0 C;  2BA1 A;  2L5T A;  4KKU A;  2PCF B;  2A69 C;  3QJY A;  5JEA H;  5BN3 A;  4DK1 A;  1V8Q A;  3M85 A;  2DNE A;  3VR4 A;  4KKS A;  3D4R A;  3VA7 A;  1VDZ A;  3T51 B;  1DCZ A;  3N6R A;  2K33 A;  2Q8I B;  2K32 A;  3H94 A;  1ZKO A;  2A68 C;  4H0L C;  4DNT B;  2NN6 I;  2BE5 D;  3QIA A;  4H44 C;  3WDN A;  2O5I C;  3IKJ A;  1DD2 A;  3ND8 A;  2D62 A;  4G7Z C;  1B9N A;  4I7Z C;  5KNC A;  1ONL A;  3CRK C;  4KHZ A;  1IYU A;  3OW7 A;  3VR2 A;  2O5J C;  3PUY A;  2A6H D;  2A69 D;  3A7L A;  1GUN A;  2BE5 C;  1PMR A;  1H9M A;  1H9J A;  4TQU S;  3SE0 A;  2IT1 A;  4BA1 I;  1Y8O B;  3FPP A;  3NE5 B;  1E2Z A;  4KN4 C; 
#chains in the Genus database with same CATH topology
 4XDX A;  1GJR A;  4WZE A;  4RLZ A;  4H13 C;  4LF7 L;  2B7C A;  1JOK A;  1Q8I A;  3DWQ A;  3I90 A;  3BG3 A;  4A3B G;  5A2Q E;  3HOY H;  1TWA B;  2J0T D;  1E63 A;  3TZU A;  1K8O A;  1IBL L;  3PUZ A;  3PV0 A;  3A55 A;  2B63 G;  1L1O A;  3HOZ H;  1C9O A;  5I6Y A;  1OXV A;  4DV0 Q;  1ICW A;  3S1M H;  4A3B H;  4X7E A;  2Q6I A;  1VQD A;  1YNX A;  1JOO A;  2JA5 H;  3A3B A;  4GN3 B;  1W0J A;  3GTQ H;  2NN6 G;  2E76 C;  3BYY B;  3W1G A;  3CCR B;  3NWT A;  4A3J B;  2EYH A;  4ZGQ B;  1NE3 A;  1ET9 A;  1CQX A;  1N33 Q;  1VQ9 B;  2KUM A;  3G6E A;  2NVX H;  3PCO B;  3GTM H;  1QFY A;  1T6Y A;  4WOR A;  2KHS A;  3WOF A;  3PMF A;  4ACB A;  1OGJ A;  4R8N A;  1BCP D;  1BCP F;  3K6O A;  3R2T A;  1YJN A;  5GAD C;  3OMC A;  1S5B D;  2HLD A;  1ZYR C;  3BY1 A;  3F2C A;  4HN7 A;  3CC7 A;  2XZO A;  1X54 A;  3P20 A;  4OHJ A;  2G9D A;  4A3M G;  3GTK B;  1L0W A;  4DR3 L;  1B4O A;  3D31 A;  1EXM A;  1F9P A;  4XL9 A;  4KD3 A;  1LYL A;  1JB9 A;  5J3B A;  1XPU A;  4HJ8 A;  4CQJ A;  2QDB A;  2R7Z G;  2F4I A;  2AHO B;  2FHT A;  3HGB A;  3K0X A;  5HXB A;  2CQO A;  2D9U A;  1K0S A;  1EL0 A;  4PZ6 A;  4Z4S A;  1NBW A;  4NB3 A;  1CA5 A;  4BBR H;  1HA5 A;  4G7W A;  4JPB W;  4RM0 A;  5A8A A;  3T1H Q;  3MXN A;  3S1N B;  1OB5 A;  4R4T A;  4OP7 A;  3GV6 A;  1W87 A;  1K3B C;  2A69 C;  1U9R A;  5IP9 H;  3KOJ A;  1CT1 D;  1PRT F;  3TS0 A;  1Q8K A;  1B3Q A;  4M0L A;  2BPO A;  1NB9 A;  3J80 c;  1ENF A;  4H9G A;  3SKB A;  4ZCM A;  2X69 A;  4X62 L;  4LF9 L;  2A68 C;  1JCK B;  1MAB A;  2QKI C;  1DD2 A;  4H44 C;  2EE1 A;  5J39 A;  1PDQ A;  4M4S A;  4GOP C;  3OAA A;  2EZV A;  1C8C A;  4DR6 Q;  1UNS A;  2QGG A;  3K57 A;  1H8H A;  1GVP A;  1PRT B;  3NTI A;  4V19 0;  1N05 A;  2IT1 A;  5NUC A;  4X7C A;  2KCM A;  2RKS A;  1CSP A;  3AYH B;  4F87 A;  1Z7T A;  3MXN B;  5EPK A;  2ZTN A;  4MTK A;  1Y1V H;  4LF4 Q;  1DG1 G;  1A2U A;  2LXK A;  2KA7 A;  1WTV A;  1II3 A;  3CXC A;  3PA1 A;  3CCE A;  1AFP A;  3WXM A;  3HOW G;  4OX9 L;  1VQP A;  4XKW A;  1QUE A;  2K03 A;  3IAY A;  1S3O A;  2R93 G;  1Y1W H;  3Q0A A;  1PZI D;  2P5Z X;  4ZAI A;  3JQR A;  1Y1V G;  3C3L A;  5M5W B;  1SNP A;  1M1K D;  3OHX C;  1PH3 A;  2CH4 W;  1SFO B;  2F03 A;  1XNQ Q;  2WJY A;  3W2H A;  4A76 A;  1IBL Q;  1MKH A;  4LNQ A;  1I7P A;  1B3A A;  3F2B A;  2X3U A;  1P4M A;  3NTH A;  4Z4R A;  1PFM A;  1SJE D;  1PJ5 A;  2C78 A;  2VNI A;  2QF7 A;  4A3D H;  2Z0S A;  3Q6Q A;  3QB3 A;  3A7A B;  5IGC A;  5JAV A;  1TWH B;  1YVC A;  3GQB A;  2GJP A;  3H0G G;  1KK2 A;  4DR7 Q;  1DGS A;  3Q39 A;  2WIN B;  3NUC A;  1QFZ A;  3U4Z A;  2A6E D;  5JJK A;  1VQL B;  4BA2 I;  5ELF A;  3NP8 A;  4B08 A;  5C3E B;  3D4D A;  1V43 A;  1ASY A;  1Q82 D;  1HXY D;  1MGS A;  2PYK A;  2SNM A;  1EY4 A;  1WFQ A;  4ZUI A;  1KAA A;  2JA8 H;  4DPG A;  3HAG A;  1S0U A;  4IUP A;  1VQ9 A;  4NMZ A;  5KEE A;  1F60 A;  2EJM A;  4PC3 A;  1VHO A;  2AUK A;  5LL6 X;  2EDG A;  1GR1 A;  5HZA A;  1EY8 A;  4M1U B;  1W2B A;  3BH4 A;  4PNY A;  1EFT A;  3GD7 A;  1JWS D;  3O13 A;  1F77 A;  5D14 A;  3CW2 A;  4WZL A;  5CV5 A;  4DR2 Q;  2Z8L A;  4XT3 B;  2R7Z B;  1XTC D;  3K8A A;  5GQO A;  2EYL A;  2ZXO A;  4R4O A;  3K5N A;  3S16 H;  2X0K A;  1W3S A;  3CP8 A;  1SMX A;  4XLH A;  1K9M D;  1NB0 A;  1PFS A;  3FDT A;  4C1N I;  2ENB A;  1O78 A;  4QB4 A;  4RA8 A;  2F4V Q;  1T5E A;  4HE6 A;  5CDF A;  1PH1 A;  2PPB C;  3TEH B;  4U67 3;  2PI2 A;  1LM0 A;  5I4D A;  2QE7 A;  4B3M Q;  3G48 A;  1HNZ Q;  2V31 A;  3GVJ A;  5FO0 A;  1ZEQ X;  4JI2 L;  4QHY A;  3M85 A;  4WFN 3;  4P26 A;  5GV7 A;  4HE5 A;  5IYW A;  1KAB A;  3CC7 B;  1W9X A;  4G1V A;  3FRP B;  4JI3 L;  1N08 A;  1I18 A;  1UE1 A;  2FXQ A;  2SEB D;  5FJ8 G;  3HOV G;  4PC2 A;  4DXG A;  3S1Q B;  3CCM B;  2F0S A;  2E2I H;  4APV A;  3H3V C;  4UAI A;  4ME5 A;  4Z4T A;  4EVO A;  2B39 A;  3C2Q A;  4DAV A;  4X7D A;  2W6I A;  1W0K A;  1EFC A;  2P3M A;  3P75 A;  1MSG A;  3S2D H;  5EPJ A;  3KJO A;  3GSI A;  3I7F A;  4XQN A;  1I6H H;  3ND9 A;  4Z4Z A;  2JXM B;  5C6A A;  2OF1 A;  1KAW A;  5M5X H;  5LMN W;  2HHH L;  3A8J A;  5TY0 A;  4P75 A;  3HP3 A;  1WD0 A;  1SXT A;  1WOS A;  5EQ0 A;  1AMO A;  1EUJ A;  3HOW H;  1WVL A;  1MJC A;  1UAP A;  2MGS A;  3I8Z A;  3W2F A;  1I5F A;  4C3J G;  4MNO A;  1KXL A;  5IYC G;  1UMK A;  1LAB A;  5FJ8 H;  1WOO A;  2QTL A;  1KC8 C;  4KK7 A;  5KSW B;  2R6G A;  3CPW A;  2NTS A;  2EIF A;  1YI2 B;  2R7D A;  4AIM A;  1N8R C;  4JOI C;  3FKI G;  1KTK A;  4DF7 A;  5BN4 A;  1Q7Y D;  1VQH A;  1KC8 D;  1K73 D;  2ZL5 A;  4NXN Q;  4J15 A;  1I50 B;  3J7A 5;  3QOJ A;  1HNW Q;  1D1N A;  1SMY C;  1SYE A;  1YJ9 A;  3GP7 A;  3TQY A;  4ZV4 A;  3MVV A;  5ELB A;  3I55 B;  4LMQ D;  3ULJ A;  4C2M H;  4GNX B;  1VQM A;  3W2G A;  1OO9 B;  4YAL A;  3MXG A;  2MJ8 A;  2VBS A;  2F1M A;  5GAG C;  3CES A;  1H9K A;  4R9W A;  4YWL A;  4EQN A;  3RN5 A;  4PMW A;  4OL7 A;  1E64 A;  1KDC A;  4DR2 L;  2NVQ H;  4IUQ A;  2L4N A;  4IZ8 A;  2ZIT A;  2QGQ A;  5BN5 A;  3I56 A;  2VL6 A;  5IWA Q;  5KIX A;  4X3K A;  5BR8 Q;  3FVQ A;  1IXR A;  2OWO A;  3WYA A;  1A62 A;  1T9H A;  2D3L A;  2XZL A;  4UP8 A;  2ZZF A;  3E9H A;  4UAJ A;  1J9O A;  3SLD A;  2Q6K A;  1HQR D;  3HOX H;  4FYD A;  4CDF C;  2ZXP A;  2PW5 A;  4NCN A;  2PLF A;  1VQ4 A;  2WKC A;  5IOD A;  3OTO L;  1PRT C;  3S24 A;  4JI5 Q;  2YWF A;  1YJW A;  3ZJY C;  3PF4 A;  4C0S A;  1VQN B;  1J5E L;  4OIJ A;  3OJX A;  1EY9 A;  1RTN A;  2BA1 A;  4YAU A;  4O1N A;  1TS4 A;  3MC0 B;  3I4M B;  1VQ7 B;  2Q2T A;  1EWC A;  2F0G A;  4AQY Q;  3R2I A;  1NUC A;  1X6O A;  2ALY B;  2M9V A;  3FHW A;  2NVT H;  4MTN A;  3S17 B;  5T1I A;  3OJW A;  3FPU B;  4G57 A;  1ONL A;  5BSX A;  3R8B A;  3OW7 A;  2HIV A;  2ZM6 Q;  4WRD A;  5EKL A;  2DEU A;  2ZM6 L;  1CNE A;  1WOR A;  3RN2 A;  4RDK A;  1IKL A;  1JB3 A;  1XXG A;  2UU9 Q;  1YNJ D;  1GJX A;  5IYC H;  4F8M A;  1E2Z A;  1U0L A;  4KN4 C;  5FLM G;  4PV1 C;  2BH8 A;  2VBT A;  1E3X A;  1TVC A;  1TKW B;  4DV7 Q;  5GAH C;  3P7J A;  1Q86 C;  3UE0 A;  1BXT A;  3JU4 A;  4B3G A;  4PMB A;  1TWA H;  4O42 A;  1NDH A;  3SXH A;  5FKA C;  4FNF A;  3HOZ B;  5JVG 3;  2X6W A;  1WTR A;  4K2L A;  4GQN A;  4C43 A;  1YIT B;  3S1M B;  4A3B B;  5JBQ A;  1VHE A;  2JA7 G;  5IOC A;  3AGP A;  2WB1 E;  4B47 A;  4JV5 Q;  4TT3 A;  2MNA A;  2JA5 B;  2BA0 A;  4IUR A;  4DQL A;  1DM0 B;  3EIV A;  4BY7 G;  3KDF A;  5D65 A;  5JJZ A;  5M3M G;  3OPO A;  2FVG A;  2HDM A;  4A3J H;  1WU8 A;  4JI4 Q;  5E6T A;  1TQO A;  3HOV B;  2WKD A;  2VQF L;  1WI5 A;  3BVG A;  1L0Y B;  1E2W A;  4FVM A;  3PUN A;  4B48 A;  1BBW A;  3NEL A;  1S5F D;  1R4P B;  2NVX B;  2YWE A;  3GTM B;  3GTO H;  3A1P A;  3W2E A;  3T1H L;  2KBN A;  3J80 L;  4B3F X;  1XNR L;  2A73 B;  1M1K C;  1M8A A;  4IOC A;  4ZCK A;  2ZTD A;  1BX1 A;  4R1J A;  4Y9U A;  1AP0 A;  2C35 B;  4JI4 L;  4LF5 L;  3OZU A;  5T1G A;  4QIW E;  3OEE A;  2F1L A;  3CHB D;  4HMI A;  4NKL A;  3SEB A;  4X64 L;  1EQQ A;  5JJL A;  1WTO A;  1SJH D;  1VQB A;  4IFD J;  2R92 G;  4TVA B;  1E3Z A;  3U50 C;  1HCZ A;  3DM1 A;  5C3X A;  4BY1 B;  4OO1 G;  4P1V A;  2D9R A;  1PKV A;  1IJF A;  3MEF A;  2ZTG A;  1XMQ L;  3HOU B;  2UXC Q;  3CCJ B;  4S3S A;  2Y0S E;  1QVF B;  1A0I A;  4HSP A;  4N8F A;  2H5X A;  3G71 A;  4Q0F A;  4HCE A;  1SE2 A;  3QR8 A;  2J7Z A;  2O2L D;  4J1M A;  4AF7 A;  1PV4 A;  4II3 A;  1SMY D;  3NWS A;  5C0X J;  3ZIA A;  1C4Q A;  1B23 P;  3WNC A;  5CV7 A;  3TP5 A;  2ES2 A;  3NQT A;  4DQK A;  1I8D A;  2F0W A;  4RD4 A;  3MFG A;  3PIP 3;  3MAQ A;  1D5X C;  4A3I B;  4UHV A;  1Q7Y C;  2YU9 H;  2FIN B;  3S1N H;  2XIW A;  2CW0 C;  4ZQ3 A;  3P27 A;  4GN5 A;  1R5O A;  5C3E G;  3ITP A;  3VNV A;  4DR1 Q;  4K5X A;  3DHQ A;  5FO1 A;  1V1P A;  5I9P A;  1BX0 A;  3JAM L;  2UUA Q;  1WOP A;  2WB1 B;  1WCM H;  2V7U A;  3TN2 A;  3ZZ0 A;  3WQZ A;  1QGA A;  4RDJ A;  4TN1 A;  4G7Z C;  1KZL A;  4BS9 A;  2ZJR A;  4A3D G;  4RH6 A;  4FP5 D;  3RR5 A;  1GUN A;  4DV0 L;  1H9M A;  1TR5 A;  4CBV A;  1SNO A;  3BC9 A;  2QW7 A;  2XRQ D;  3GDE A;  4I7A A;  4X65 Q;  4JI5 L;  1BKB A;  2EQS A;  4B3T L;  2VUM B;  1Y1V B;  1AW7 A;  4JOI A;  3ASQ A;  1PLF A;  1TWC B;  5JOB A;  1Y1W G;  1O7Z A;  1VQJ A;  3CP0 A;  5FIU A;  4A3L G;  4XTC S;  1G8Z D;  2VB3 X;  3OYY A;  3SLN A;  4XQQ A;  2UXC L;  3S15 B;  3D4W A;  4YCW A;  3CCU A;  1HQM C;  2OTL B;  2VS1 A;  3STB D;  3PO3 B;  1MBY A;  1QOH A;  1GM5 A;  1P8L A;  1D7Q A;  1SYG A;  4OOS A;  2PMZ B;  4E6I A;  3HKZ B;  5I2X A;  2F0K A;  1ZM4 A;  1QFJ A;  2ZBU A;  1DAR A;  1Q46 A;  1D8L A;  1M4V A;  4YHH L;  3V96 A;  1Y0R A;  5A2Q L;  1G7S A;  3S14 B;  2CH4 A;  2HD3 A;  1HZB A;  1K8M A;  4X66 L;  3MFY A;  5THX A;  4KKT A;  1PZJ D;  2HT1 A;  4NNJ A;  3OEH A;  4A3E G;  1QVC A;  4XKV A;  2OTL A;  4CJ0 B;  2CF4 A;  3ER0 A;  5IGD A;  2UUB Q;  3AFP A;  2C9O A;  1YBY A;  1SN8 A;  2MP1 A;  3H91 A;  4N8X 1;  5CBE E;  1VLO A;  1YNN C;  3CPW B;  2JA8 B;  1UUP A;  1S5D D;  1KMH A;  1LTT D;  3KF6 B;  4J0Q A;  1AEX A;  5FLX c;  1NAP A;  2FFK B;  4R4I A;  3WWV A;  3S9W A;  1LTI D;  3RZD H;  1SLJ A;  2DCU A;  1DYQ A;  1TTT A;  3M7N A;  4HED A;  3RD4 A;  1KLU D;  2TSS A;  4NBS A;  3I3C A;  3EQL C;  1ILQ A;  1UE7 A;  4FXU A;  4IPG A;  1XMO Q;  3G4S A;  2UXB L;  3UDF A;  1LTA D;  5EJW A;  3U9O A;  1O7Y A;  1BPL A;  3LQE A;  4L63 B;  3ZZT A;  3FJO A;  4EQP A;  1B2R A;  1Q82 C;  2B2V A;  3KUP A;  4HJ5 A;  2KEC A;  4P2N A;  5DS0 A;  1V1P B;  3A8I E;  2XWJ B;  4CKE A;  2A6E C;  3BCF A;  3AVU A;  1BF4 A;  4OPO A;  2L11 A;  3K7A B;  1GUG A;  2WAQ G;  3HKZ G;  1NMG A;  1BBX C;  1HR0 Q;  1UD3 A;  3OTO Q;  5JEA H;  4RPD A;  4DK1 A;  1V8Q A;  2VNH A;  3CC4 B;  2F0U A;  2EY1 A;  1LTB D;  1IBK L;  3AST A;  2BOS A;  1DCZ A;  2I5M X;  2L1B A;  2MFI A;  1WJJ A;  4KTA A;  2Q8I B;  4LF4 L;  1KRH A;  1DDI A;  3ASS A;  3QFC A;  2F0I A;  2GVB A;  3S1Q H;  4KJO A;  5KNC A;  1ELO A;  2I1L A;  1EYA A;  2CW5 A;  3CCJ A;  2A6H D;  3NBH A;  1EEF D;  4Y7C A;  2NB0 A;  1KQS B;  2OYN A;  4QUC A;  3S2D B;  1TS5 A;  4P12 A;  1EOT A;  3MXP A;  2L15 A;  2KCN A;  1F9S A;  2AUJ D;  4XXE A;  2YTV A;  3ONA B;  5M5X B;  2A19 A;  4RD0 A;  1C48 A;  2B2W A;  3A74 A;  4KY7 A;  4Z1M A;  3ZUG A;  1STN A;  3LGJ A;  4TMX A;  3HOY G;  3GVL A;  1ROD A;  5IE8 A;  1L1O C;  1W2B B;  3H0G H;  3T13 A;  4K2K A;  3KBG A;  3LQ6 A;  1N32 Q;  2JEB I;  3ICE A;  1EP2 B;  4RD1 A;  1EZ8 A;  1HZ9 A;  1UWV A;  3KLS X;  1IL2 A;  1W6K A;  5IT9 E;  4TRD A;  3R93 A;  3SR1 A;  1LV9 A;  1EIG A;  1KNE A;  2EXD A;  1QVG A;  2YTY A;  3G05 A;  4UZE A;  2ZT9 C;  1Y14 B;  4FDB A;  1STH A;  4ABN A;  1KJZ A;  1HH2 P;  3ZZU A;  2GA4 B;  4ZK9 B;  3CC2 A;  2E2D C;  2XGT A;  4XM3 A;  2EOT A;  1I4Q A;  4OGQ C;  1I50 H;  2IW3 A;  2OEO A;  1OXT A;  1N33 L;  1VQK B;  4B3S L;  4DK6 C;  3TSS A;  2F0M A;  2HHH Q;  4C2M B;  1EWH A;  3S1R B;  2ZTE A;  4DV7 L;  4DV6 L;  5C44 G;  4RCZ A;  2GK6 A;  3A8K A;  4X05 A;  3T16 A;  1YX2 A;  3Q3A A;  1HZC A;  4B3T Q;  2K05 A;  2BVN A;  1BQE A;  3IL8 A;  2JA6 H;  4G1B A;  1OXS C;  1RF2 D;  1SR3 A;  4P9S A;  3RLO A;  3OKX A;  2C5B A;  2GRE A;  2BMW A;  2PI2 E;  3MHP A;  2XVS A;  2QCP X;  1H9S B;  4ZCL A;  2KEN A;  3BZD B;  2VJJ A;  5HY6 A;  2CQA A;  4L5Q A;  1KRT A;  3VYR A;  4DV3 Q;  4DV2 L;  1IW7 D;  1STB A;  2YWG A;  3QWN A;  3NBI A;  3HOX B;  3VMF A;  4N9T A;  4AF6 A;  4IOA A;  2TMP A;  2H4O A;  1BCP C;  4QUF A;  4DR5 Q;  5C0X I;  1AIP A;  1RD9 D;  4A3I G;  1JC7 A;  2A6H C;  3ONY A;  3DXJ C;  5KNB A;  1X3Q A;  1OB0 A;  4DV5 L;  1CSQ A;  3PF5 A;  2PNH A;  2BN4 A;  3UI2 A;  4X07 A;  3J80 E;  2FMM A;  4DR6 L;  4RGM A;  4P2C B;  3OIP A;  2JN9 A;  1FJG L;  1JR0 D;  3C1F A;  4IFD I;  1GXD C;  2DY7 A;  4HSV A;  1UD8 A;  4A3G B;  3K7U C;  5FL7 A;  1SE4 A;  4Z4V A;  1QG7 A;  1VQ4 B;  3ZBT A;  4POG A;  5IWA L;  1YIJ A;  4L5S A;  4BPR A;  3M7G A;  4GOP A;  1LTS D;  1YZ6 A;  5H5J A;  2MO1 A;  3CCQ A;  3HRZ C;  2RDF A;  1YHB A;  4YCV A;  4BBS B;  5TR9 A;  2OXP A;  4OO1 I;  3M3Y H;  3RZO H;  3QFR A;  3BVZ A;  3M4P A;  1KIX A;  5FLX E;  3ONU A;  1ENA A;  4C3H B;  5A35 A;  3CMA B;  5C5L A;  1S72 A;  1QNU A;  4AYB E;  2BH2 A;  5M5Y B;  1D8T A;  2UXD Q;  3VR3 A;  1XTD A;  4DA2 A;  4Q7J B;  1B50 A;  3BYT B;  3I4M G;  1HNX L;  2DYI A;  2VQE L;  2JA9 A;  5M3M H;  3U58 A;  4BY7 B;  3J81 j;  2F43 A;  3D0F A;  1UD4 A;  2VXW A;  4N9P A;  3WY9 A;  3U9S A;  1A8P A;  4P22 A;  1E2V A;  2JSO A;  4RG1 A;  3PIO 3;  3KJP A;  3I4N B;  2V7T A;  1JE5 A;  3HOV H;  3TBI B;  1YNN D;  3TZD A;  1ICF B;  2RDH A;  4IJH A;  1P16 A;  4DV5 Q;  4YWK A;  3GTO B;  3S2H B;  1Z6H A;  3J7Y W;  3PUM A;  4LF6 Q;  1WOC A;  1Q1B A;  3AQQ A;  1E1O A;  4U9U A;  5EKI A;  1HFN A;  1FRN A;  2Q8R E;  4P3Y A;  4KN7 C;  4DU9 A;  1Z9F A;  1CNF A;  3V05 A;  4BBS G;  5IK2 A;  4I65 A;  5ISR A;  4DAP A;  5I2Y A;  2R61 A;  2OK8 A;  3ISX A;  3OOC A;  3PUX A;  1EFW A;  3CRL C;  4P3I A;  5IP7 H;  1Q1E A;  2EY5 A;  5EBD A;  5CYU A;  4X64 Q;  2K5N A;  4BY1 H;  1J5E Q;  1MSH A;  2K5V A;  3IRB A;  3WBK A;  4NP5 A;  2D74 A;  2CWA A;  2BGJ A;  1YHA A;  3HOU H;  4RKL A;  5AFW A;  4Y7N B;  5CV9 A;  1IW7 C;  3Q24 A;  4UPA A;  1QNK A;  3CCM A;  2OK7 A;  2I07 B;  3AFQ A;  1N0V C;  2HDN B;  3URY A;  3SEJ A;  2AHO A;  1U4L A;  3FPK A;  1DOM A;  2ZTC A;  4B9W A;  4KY6 A;  1YIT A;  4R4Q A;  2OTJ B;  4GS3 A;  4A3I H;  3CCL A;  1Q90 A;  3WOE A;  2YU9 B;  2VY3 A;  2IY5 B;  1M90 D;  4XN0 A;  4B9X A;  4KHP Q;  4RCN A;  2NWG A;  1NNX A;  1JA0 A;  3W2I A;  2G5D A;  1SKQ A;  2EIX A;  4C3J B;  5L46 A;  1VQE A;  4FK8 A;  1O80 A;  4IW3 B;  1LO5 D;  2DNE A;  3D4R A;  2NZH A;  4RAU C;  4YAO A;  1G7T A;  2K32 A;  3H94 A;  2PQE A;  3CXC B;  2DUD A;  1WCM B;  3T4A C;  1B2T A;  2B7B A;  1LUZ A;  2PZU A;  4EX5 A;  5HZB A;  3ND8 A;  3W2D A;  1TVX A;  3G6E B;  1IYU A;  5KRU A;  2O5J C;  1SND A;  5LMN Q;  3BNW A;  1TS2 A;  1IYJ B;  2CWP A;  3HS0 C;  1R5N A;  3QSY A;  4DUZ L;  3QFT A;  4XLE A;  1U5K A;  3AVT A;  2M2L A;  2VUM H;  4TMZ A;  4XYQ A;  1TWC H;  1UE6 A;  3P26 A;  3VO1 A;  2ID0 A;  3KYH C;  1I4H A;  4MN3 A;  1STA A;  1PJ6 A;  2V7V A;  3FKI B;  2MQH A;  3S15 H;  2V4D A;  4LBZ A;  1RJT A;  4KHP L;  2PO4 A;  3PO3 H;  4C3I H;  4WZK A;  5KYI A;  1A63 A;  4FWT A;  3I72 A;  2JIZ A;  3L9A X;  4DR5 L;  4XOT A;  1JWM D;  3MZ5 A;  4OPV A;  4RGN A;  1WSV A;  1HPC A;  2Q2I A;  1VQ8 B;  2OQK A;  3F8T A;  5LMZ A;  3ULP A;  1WTP A;  1PZK D;  3UE1 A;  4GNX C;  2CCZ A;  5C4X G;  3K5O A;  2EYP A;  5IGF A;  1PH6 A;  3S14 H;  4DNI A;  1S5E D;  2KVO A;  1FNM A;  3QE2 A;  1BQQ T;  3ZPN A;  3GTL B;  1SYF A;  2K04 A;  3J80 i;  1OB2 A;  4IPD A;  3H9N A;  3CMA A;  2FJ2 A;  4JI7 Q;  2BDN A;  5IY0 A;  4J6H A;  2DOG A;  1U4R A;  2K01 A;  1SNM A;  4KLK A;  5GRO A;  4P73 A;  1F2Z A;  1YLO A;  2CND A;  1HNX Q;  1EFR A;  2Z6B A;  2L9H A;  2KED A;  3NEM A;  3RZD B;  1BO0 A;  1B70 B;  1TY0 A;  2C5C A;  4RGT A;  4LJZ C;  5IYB G;  1VS0 A;  1GAQ A;  4LUV A;  4CGY B;  1SYD A;  1YI2 A;  2ZZE A;  2JE6 I;  4XQF A;  3CPF A;  5KND A;  3BY2 A;  1CQV A;  3FKS A;  4QY7 A;  3GTP B;  1S4M A;  2WAQ E;  4RJL A;  4XLA A;  2F52 A;  2FMC A;  2JN4 A;  4XIG S;  2D2C C;  5IYB H;  4WQM A;  1LT4 D;  3HZX A;  1ZM2 A;  2ASB A;  4DGZ A;  1R9T H;  1MI2 A;  4DAM A;  1HNW L;  1PTO H;  5CGK A;  4OOV A;  4PMC A;  4RFB A;  5IYP A;  4HIZ A;  4X8I A;  3KK7 A;  3K7A H;  1QJO A;  3W3A A;  5C44 H;  1U2R A;  3D8G A;  1MJE A;  3EVQ A;  3PSI A;  3QOL A;  4GLX A;  1PH4 A;  4BWG B;  2NPF A;  1KK3 A;  1VMP A;  5E3F A;  4YHH Q;  1UEA B;  2NVY B;  4PZ8 A;  4OEM B;  4PAA A;  1PJ7 A;  1F2L A;  4N3N A;  2XNJ A;  2K5D A;  2QIL A;  5C5M A;  5DAU A;  1J6Q A;  2Z4H A;  4CDD C;  1VQ5 B;  1PVO A;  2Y0S B;  2JQO A;  3VR2 A;  4RD3 A;  1UD5 A;  2ZXI A;  2BE5 C;  4BXX G;  4EH1 A;  3QFS A;  2LFN A;  3ERQ A;  4TQU S;  4BA1 I;  2JA8 G;  3A5Z B;  3FPP A;  2UUA L;  5F4J A;  2RCF A;  1RIP A;  1E22 A;  1WTQ A;  2OTJ A;  3DEO A;  1G51 A;  4ZUJ A;  4MYT A;  1VQC A;  1OXU A;  2DNC A;  1Y69 U;  1STY A;  1IKM A;  4GKJ Q;  2V7W A;  3JAM E;  2D3N A;  5IGE A;  1VF7 A;  3C2P A;  3JAM i;  1YJN B;  1AN8 A;  1C7Y A;  3H0G B;  3L7Z C;  4ME3 A;  4ZYS A;  3ZC3 A;  3B78 A;  1EU3 A;  2XTI A;  1FR3 A;  1W35 A;  1FNW A;  4B3X A;  1QIL A;  4CDC C;  4XN3 A;  2O4X A;  4OWW B;  2Z4I A;  2VZA A;  4DK3 C;  4JBM A;  4G7H C;  3G4S B;  1XJV A;  3T1Y Q;  2B8F A;  4YEL A;  1XMQ Q;  4IFD G;  2PNR C;  2Y0S G;  3F2D A;  2K14 A;  3MTS A;  2SOB A;  4LUO A;  2ZJQ A;  1NJI D;  5DM7 3;  4J8Q A;  2E1B A;  2XNA C;  3KDF B;  4K0K Q;  3BDL A;  3FP9 A;  2F0J A;  2V1C C;  4LFC Q;  3W5V A;  1N8R D;  2CK3 A;  5CV6 A;  3KF8 A;  2AQ3 B;  1BDO A;  1IJE A;  4X3T A;  1G6Z A;  1UEB A;  5C0X G;  5E7N A;  4DKA C;  1Q3L A;  3S1R H;  2CHB D;  1CZW A;  2CFM A;  2CW0 D;  1HJP A;  4Y9R A;  2B2Y C;  1HUN A;  4HAE A;  2PZT A;  2BSA A;  2VYQ A;  4P6Y A;  2XRS D;  5CV8 A;  2LKV A;  2UXD L;  1DOK A;  3I1F A;  4XYO A;  2JA6 B;  1VLY A;  2I46 A;  5DN6 A;  2B2T A;  3A8K E;  1BCP B;  2PIA A;  4DAY A;  1WTH D;  1LLR D;  3X3M A;  4RKB A;  4A3C G;  2HQL A;  4YCU A;  3GVK A;  1IZ6 A;  3CC4 A;  4H7B A;  4IUU A;  1K8G A;  1VQ8 A;  2IX3 A;  3L2P A;  4JV5 L;  5CMD A;  1XYI A;  2ICI A;  1J8I A;  2RBM A;  1AE2 A;  3U4V A;  4YY3 Q;  5C4J H;  2F4N A;  4POF A;  2E2H H;  4DUZ Q;  4M1K A;  3AEV A;  4KI0 A;  2C5H A;  3DM3 A;  1X3P A;  3OW2 B;  2NN6 H;  3CRZ A;  1N9W A;  3VR5 A;  1VQF A;  3CCQ B;  3E5S A;  1JMC A;  3I4O A;  4X06 A;  1V0F A;  4KJN A;  3B8H A;  5DM6 3;  3VYT A;  1Z47 A;  3D3R A;  2B29 A;  1N34 L;  4XT1 B;  2DY1 A;  2B63 H;  1QGZ A;  3A56 A;  4A3G H;  4UP7 A;  1XPO A;  4RGO S;  2NN6 I;  2FX3 A;  2BE5 D;  3PEN A;  3QIA A;  1KTV A;  1QH0 A;  1QVG B;  1SAP A;  4CKC A;  4FF1 A;  5I9O A;  3TRZ A;  4FXD A;  3U2Q A;  3DEP A;  2ZBV A;  1X56 A;  5BSY A;  2HDL A;  4K1X A;  4A4I A;  1W34 A;  2DGY A;  1SDF A;  4BBS H;  3LO8 A;  3SK5 A;  1ESR A;  5JJI A;  3M3Y B;  1QUF A;  1FVI A;  3RZO B;  3J81 i;  1GUS A;  1KK1 A;  4FXG C;  4C3H H;  5F4O A;  3RY8 A;  4DUY L;  3V76 A;  1EY0 A;  1A3U A;  3CQZ B;  1GHJ A;  2JYO A;  1G7R A;  5H1S E;  5M5Y H;  4ACA A;  4ZLT F;  4A3L H;  1HR0 L;  5F4M A;  5EPL A;  1KQS A;  1BUV T;  2K4K A;  4HR7 B;  3NSW A;  3AVX A;  4ID6 A;  4X62 Q;  4OX9 Q;  4WJ4 A;  5M3M B;  4BY7 H;  4FF2 A;  3SK6 A;  2E8G A;  1I94 L;  3I4L A;  2R6H A;  2JA5 G;  1YNJ C;  2EFG A;  1JJ2 B;  1AH9 A;  4R8I A;  5EAY A;  3A0J A;  3I4N H;  1EP3 B;  1D1I A;  3K5M A;  2QN6 A;  1XPR A;  4LFB Q;  1HHV A;  4AVZ A;  3H3V H;  1WCM G;  3R6J A;  1VQK A;  1G2S A;  2AQ1 B;  2Z9H A;  1V9P A;  3PUW A;  4CKB A;  3S2H H;  3OP1 A;  1D2E A;  4LC0 A;  4XMY A;  2X6Y A;  5KYL A;  5IYR A;  2MO0 A;  2CKZ B;  2RSO A;  2JEA I;  1D5Z C;  1K28 D;  3L0O A;  3RNU A;  3A8I A;  2GK7 A;  2E75 C;  1Q9S A;  3AVV A;  2WJV A;  5IGG A;  1CFM A;  3HEJ A;  1KHI A;  3CAM A;  2OT2 A;  2XOK A;  4NDX A;  1JNY A;  3K81 C;  2E2J B;  1N32 L;  2IX0 A;  4YAF A;  3EBE A;  1VQO B;  2RCN A;  2L0C A;  1EOV A;  3NQI A;  5C4H A;  4IO9 A;  3MXU A;  1KNA A;  1KL9 A;  5D3D A;  4PAB A;  4Y7N H;  5A89 A;  3J81 E;  2M00 A;  1U4M A;  2PMD A;  3VNU A;  2N3S A;  1SYC A;  3F2U A;  4PZ7 A;  1EYG A;  5EGT A;  1CHQ D;  3KBX A;  2LMC B;  2JA6 G;  2WZP P;  2GN5 A;  2LXJ A;  2L12 A;  4AH6 A;  4K0K L;  1B9M A;  4B43 A;  2J4X A;  4ASU A;  4O0A A;  3AVY A;  1HZE A;  3R3O A;  3C46 A;  2VB2 X;  4C3J H;  3E0E A;  5CR3 A;  1GAW A;  1UD6 A;  1ZXT A;  3G71 B;  1XB2 A;  3BQJ A;  3E3X A;  4F7X A;  2QTZ A;  2K28 A;  3BU2 A;  2CBX A;  1DJR D;  1EFI D;  3E20 A;  2QEJ C;  4NW2 A;  5DSZ A;  4Z9C B;  1K73 C;  4ZGN B;  2CC2 A;  4RPB A;  5TRD A;  2QDL A;  4OOX A;  5G3L D;  1UE5 A;  3E0J A;  2RQX A;  3NK9 A;  5FO8 B;  2A69 D;  2NYZ D;  4IPH A;  3JQP A;  2A74 C;  1E3P A;  3ASP A;  1TWF B;  4PGO A;  3OZW A;  3CTA A;  3D6C A;  5IYN A;  4K8I A;  4Q5V A;  3CCV B;  1XFO A;  1A3T A;  2JA7 H;  3NTK A;  4X3U A;  4B3M L;  2W6J A;  2OBT A;  3SJZ A;  1M90 C;  4OON A;  1CI3 M;  4A93 B;  1MD2 D;  3FKI H;  1QB5 D;  3QG1 A;  2WII B;  2ATW A;  2F4V L;  5E4W C;  5F2D A;  5JEA G;  1LTR D;  4C3I B;  5ELN A;  2DET A;  1CA6 A;  3CME B;  4JI3 Q;  4JBK A;  1HZA A;  1PFN A;  1ZYR D;  4LAA A;  1X32 A;  5K36 H;  2XEX A;  2ZXR A;  2BM0 A;  3KEW A;  4RHS A;  5HUR A;  4A75 A;  5JPN C;  3LNN A;  3KF6 A;  4OWT B;  1VQA A;  4FF4 A;  4DV4 Q;  4M8A A;  5ELE A;  2EYJ A;  1PH5 A;  5DNF A;  1DXM A;  1K83 H;  1PYS B;  4JBW A;  2E5L L;  4HCS A;  1B53 A;  4KV6 A;  2ZJP A;  3GTL H;  3J7A F;  4ILW A;  1L0X B;  4CJ1 B;  1AZP A;  4ZKB B;  4H02 A;  2KJX A;  1LTG D;  1K28 A;  1H8E A;  1V1O A;  1EY7 A;  3LX0 A;  5KW9 A;  2JP1 A;  3T53 B;  3AGQ A;  1MRZ A;  4QMG A;  4HIO A;  1PH9 A;  3TME A;  1I4X A;  1ML0 D;  5M3F B;  2EXZ A;  4NXM Q;  3CCE B;  4LBW A;  3U6K A;  3VR6 A;  4F7D A;  3MCA A;  2EYF A;  1FL0 A;  5E1F A;  1Y0Y A;  3CMM A;  2Z1C A;  3J81 c;  2VJI A;  4QIW B;  1EFU A;  2K1B A;  1KRS A;  3I73 A;  1JOQ A;  4B3R L;  1A6X A;  1NTG A;  3CD6 B;  3RLF A;  3CW2 C;  3GTP H;  2OBS A;  2JJQ A;  3W5U A;  2VQF Q;  2KCC A;  4MHE A;  1YHQ A;  4B44 A;  2IHF A;  4MIU A;  4DV4 L;  1H42 A;  2C2W A;  4EQ5 A;  1IYV A;  1R9T B;  1FRQ A;  1PTO B;  5K5P A;  2KEE A;  4HIK A;  4A3K H;  2V7X A;  2B2Y A;  2OCE A;  3L3O C;  2QDX A;  4AC9 A;  4JI1 Q;  5C44 B;  1RQP A;  4IJL A;  2XGJ A;  4G5G A;  2I5H A;  2L5T A;  5IT9 c;  4KKU A;  1SNQ A;  4GN4 B;  4OXP A;  3W1B A;  1JE4 A;  1IHM A;  1PH7 A;  4KKS A;  4KY5 A;  4Z4Y A;  3T51 B;  1WTX A;  5ELO A;  2NVY H;  4Z4U A;  2NTT A;  4YIJ A;  1JB7 A;  2HIX A;  3U6B A;  2R93 B;  1ZKO A;  4JYA Q;  4H0L C;  2K5W A;  4X0C A;  2O5I C;  5C4X B;  3OSO A;  2WFW A;  4IUT A;  2F0O A;  4MZ9 A;  4JI8 Q;  5JEA J;  5IIF A;  4LF6 L;  4JI1 L;  4PQX A;  1V5V A;  1B44 D;  3OZV A;  1F9Q A;  1EWI A;  2F0H A;  1SE3 A;  1GD7 A;  3SE0 A;  1D1K A;  4X6A H;  3D26 A;  2ZZQ A;  4C3I G;  2PZW A;  1PTO C;  1PTO D;  1O7I A;  4JG2 A;  4GKJ L;  2NZ1 D;  1IHZ A;  4QQB X;  4A93 G;  3T1Y L;  3CPX A;  2M5S A;  3VYS A;  5GV8 A;  1SNC A;  4QVJ A;  2RA4 A;  3EJI A;  3OWE B;  4WJW A;  1H95 A;  1L2F A;  4P72 A;  1TS3 A;  2F3W A;  4Y52 H;  1LT5 D;  4QJF A;  4GZY C;  3STB C;  1CKN B;  3H6M A;  5FK9 C;  4YXW A;  3OIQ A;  1H9R A;  4LF9 Q;  2B8G A;  3KF8 B;  3BZC A;  5AN9 A;  3DWA A;  3H09 A;  3GTG B;  4YEJ A;  2IHE A;  1FGU A;  1HFG A;  1NR4 A;  4YAW A;  2OQ0 A;  4LFA L;  1VQ6 A;  3DLL A;  4RCO A;  3CCR A;  1PH8 A;  2UUB L;  2Q6L A;  1DOL A;  2VBV A;  2X6L A;  3WNB A;  4KD4 A;  4N3G A;  1EZ6 A;  1E1Q A;  3VO2 A;  2R3Z A;  3A54 A;  2B5O A;  1K3R A;  1MHW C;  3RLN A;  2G9H D;  2Z6B D;  3LVB A;  3ZBU A;  3KLR A;  3UDI A;  3CB4 A;  3E6Z X;  1F20 A;  4A3M B;  3FEW X;  4HJ9 A;  1X9N A;  2YTX A;  5J3O A;  3C1E A;  2KHJ A;  3NBH B;  4JK1 C;  4ROX A;  1BLI A;  1A15 A;  1Q12 A;  3UDG A;  3R6K A;  3HG9 A;  4LK1 C;  4PG3 A;  3I56 B;  1FNU A;  4CHT B;  4DR3 Q;  4NPS A;  4DN4 M;  1EQT A;  2DER A;  2B2U C;  4FXK C;  4DR7 L;  1FX0 A;  3CCL B;  4M2L A;  2CVR A;  5CC4 A;  4UZU A;  4QL5 A;  2R92 H;  2DJG C;  1JJ2 A;  3BJU A;  1ZM9 A;  1VMC A;  3PA2 A;  1S72 B;  1G2T A;  4FN5 A;  2HQE A;  5C4J B;  2N49 A;  4A3J G;  3A3G A;  4X65 L;  1F2Y A;  2E2H B;  1B1Z A;  1F9R A;  1I6V C;  3HFZ B;  1PYB A;  4LFC L;  1GO2 A;  1OGI A;  1XNQ L;  1VQP B;  3D6W A;  2IPK D;  2VW9 A;  1BMF A;  1EIH A;  1QUQ A;  3Q6S A;  2SNS A;  5LMU Q;  4JYA L;  3K5L A;  5J35 A;  4EQO A;  2C77 A;  1STG A;  2B63 B;  4DV6 Q;  3NEN A;  4ALP A;  1GUW A;  2KHI A;  2VQE Q;  4A3E H;  1SBB B;  3JQQ A;  4UP9 A;  4ZRZ A;  3I4N G;  3CRK C;  1TUI A;  4JCV E;  3PUY A;  2MHV A;  1AZQ A;  1T5X D;  4RD6 A;  4X7F A;  1PMR A;  1R5B A;  2QMU A;  2VNJ A;  2HUG A;  1JIC A;  3NE5 B;  4QFM A;  1SM4 A;  1BNZ A;  2F3V A;  4JMQ A;  1PH2 A;  4RMF A;  2XND A;  2D0P A;  3A8J E;  4DFA A;  1JQY D;  3AU7 A;  3FMC A;  3CQZ H;  2X53 S;  1KD1 D;  1N0U A;  2F0E A;  1I3Q H;  3G7L A;  1A8V A;  4A3F G;  1IBM Q;  5EBC A;  3M4O H;  3CCS B;  4DR4 Q;  1VF5 C;  2BV3 A;  3GIR A;  3DWP A;  4GLV B;  1FYC A;  4L6T B;  5FLM H;  1QUQ B;  3OW2 A;  1X3G A;  3J7A V;  5C4Z A;  2GVA A;  3LWU A;  1A3V A;  1NJI C;  4YY3 L;  1FD7 D;  1G29 1;  4DV1 Q;  2L55 A;  2KVM A;  2WPD A;  3KL9 A;  2WZN A;  1VQM B;  4GNX A;  1EY6 A;  1KK0 A;  3I55 A;  3K0Y A;  2F3I A;  2WB1 G;  4LF8 Q;  1C0A A;  4DNR B;  1N36 Q;  4LFB L;  5HKK A;  2F0L A;  4QGU A;  1Q81 C;  1FNC A;  4Z4W A;  3TP8 A;  1R4Q B;  2K5H A;  4JI0 Q;  1IL8 A;  1BBU A;  4U68 A;  1OHH A;  2QA4 B;  1U4P A;  4K14 A;  2QEX A;  3PO2 H;  3TRE A;  1K8A D;  2XZP A;  2E2J H;  1EWY A;  4IUN A;  2WR8 A;  2K52 A;  1TWG B;  1B7Y B;  2WV6 D;  2RF4 A;  2X6X A;  4JI6 L;  5B6I A;  4F88 A;  1S5C D;  1SEB D;  3MWY W;  1S40 A;  4DUY Q;  1HR0 W;  3GTJ B;  4L8J A;  3T56 B;  5KGU A;  1EQR A;  2F0Q A;  2B2U A;  5EKK A;  2BM1 A;  3MMP A;  3EN2 A;  2AKW B;  3K59 A;  2WYR A;  3J81 k;  1FND A;  1GUT A;  3BVM A;  2BCO A;  1V0E A;  4TSS A;  1E43 A;  2RSN A;  3NPP A;  3CP2 A;  4CDE C;  1SKY B;  2XNC A;  3I70 A;  1X3F A;  4QVA A;  1VCI A;  3P1H A;  4QCL A;  2R7F A;  3DDY A;  2LSS A;  3ERO A;  1E24 A;  2N8N A;  3VR4 A;  3H15 A;  5M9O A;  4TMV A;  5EMN A;  2IJ0 A;  1ASZ A;  4KHV A;  2K33 A;  3WND A;  4QF4 A;  4A3F H;  2RHS B;  1E62 A;  2ZL6 A;  5ELC A;  2D62 A;  4OIK A;  2IWH A;  1HNZ L;  1T6Z A;  1N36 L;  1EIF A;  2RC5 A;  2EY2 A;  2F0P A;  4OWX B;  4JI6 Q;  2RDG A;  3PO2 G;  3PIP A;  4TMT A;  1JA1 A;  4HIM A;  1Y8O B;  1TWF H;  1VQ5 A;  4JW0 A;  2A5H A;  3NHH A;  2I0Q A;  2F0N A;  2RVL A;  1NY4 A;  2JA7 B;  1I4P A;  2KQ3 A;  4K5V A;  2LS0 1;  5CV4 A;  3HOY B;  1DON A;  1G91 A;  2NUC A;  4G6I A;  3KFU A;  1J9Z A;  3X3N A;  2PMZ E;  3VDY A;  3K80 C;  1HA3 A;  4A93 H;  2RHQ B;  2N55 A;  3ZYY X;  4LFA Q;  1ZM3 A;  4AYB B;  2A8V A;  1WTW A;  4JC0 A;  5L37 A;  3GTQ B;  2PW7 A;  3F1Z A;  1LAC A;  1TLL A;  3AB9 A;  2XSC A;  2JK8 A;  2IX1 A;  2HCC A;  4OEL B;  1UD2 A;  1QZH A;  4XQJ A;  3PGZ A;  1D6E C;  1WPC A;  1K83 B;  4QV2 A;  3JAM c;  1PHJ A;  3ERS X;  1S4Z A;  3CU7 A;  4G7O C;  2Q2H A;  1CKO A;  3DUZ A;  4A3G G;  1QCB D;  1WYD A;  2QEX B;  4WJ3 M;  4A3C H;  3OWF A;  1VQL A;  3J81 L;  2QA4 A;  4JVZ A;  1O7L A;  2WAQ B;  1H9S A;  5C3W A;  3WBJ A;  2X8K A;  4KMU C;  5AJ3 Q;  5M3F H;  3GTK H;  3VA5 A;  2F0D A;  2K50 A;  1I94 Q;  3E1Y E;  5C0X H;  1X3E A;  2D0O A;  1RHP A;  2GQF A;  1QE6 A;  2EYM A;  4RWS C;  4JI8 L;  3SVM A;  3HOX G;  4JI7 L;  1YEZ A;  4QUZ A;  2VNK A;  1KDA A;  4L5R C;  4R71 A;  3PIO A;  4ULL A;  2WSS A;  1QX4 A;  1CK1 A;  2J7K A;  2K6A A;  3LWE A;  3PVD A;  2CRV A;  3CCS A;  1K9M C;  4IFD H;  2JJ1 A;  2C4U A;  4BBR B;  1LTL A;  2IL8 A;  1YIJ B;  4A3K B;  1HRJ A;  4X66 Q;  3I2Z A;  1ESF A;  2ZL7 A;  4DV2 Q;  4DXF A;  3CME A;  1YJW B;  2PQA B;  3I91 A;  5FNZ A;  2PCF B;  4UDU C;  5FOB B;  4DV1 L;  1Q86 D;  1EY5 A;  2Z6K A;  1QG0 A;  4ODG A;  2PQA A;  3GV3 A;  4HJ7 A;  3IFD A;  3DMU A;  1LT3 D;  4K6L A;  4LF5 Q;  4XNF A;  2JDI A;  3TDQ A;  3N6R A;  2R93 H;  4JI0 L;  1N07 A;  2X6G A;  2Q6O A;  5D3I B;  3SK8 A;  2VBU A;  4K5W A;  2UUC L;  5BR8 L;  2BF4 A;  1ZUN B;  1TT2 A;  2K5Q A;  1SRO A;  5C4X H;  1N34 Q;  1STE A;  4KHZ A;  2ZXH A;  1RTO A;  1A2T A;  3W5H A;  1NBM A;  2RC6 A;  3CD6 A;  1BJK A;  2KOL A;  1IBM L;  1G7C A;  2V7Q A;  2GPJ A;  1EP1 B;  4WWV A;  4IN3 A;  4BXX H;  2EPB A;  3MA2 B;  3PO3 G;  1L1O B;  3M9B A;  2Q2U A;  1FNB A;  5TSS A;  1HA6 A;  5A88 A;  1B8A A;  4K8J A;  1W6J A;  4YWM A;  2B2W C;  1WP6 A;  2LZJ A;  3IFT A;  4OPS A;  1AE3 A;  4HJA A;  1Y1W B;  2AWN A;  2I5L X;  1BOS A;  3PQI A;  1E1R A;  1NSN S;  5M5W H;  4PC7 A;  1PRT D;  2F0V A;  2LY7 A;  2WAC A;  1CTM A;  1SFO H;  5IP9 G;  2BGI A;  1K8A C;  1WD1 A;  3Q6R A;  5GAE C;  1CQF A;  4XLF A;  2HCI A;  3CCU B;  1VQG A;  2JJ2 A;  2K7V A;  5G3L F;  1JT8 A;  1GUO A;  2DY8 A;  1T6X A;  2DJF C;  4B4D A;  1KLG D;  1F2M A;  1CM9 A;  1XX8 A;  3QO2 A;  4A3K G;  3GTG H;  4TMW A;  1OXX K;  4A3D B;  4L5T A;  1GO3 E;  1Y8P B;  1XE1 A;  1FJG Q;  3AMU A;  3PUV A;  1TWH H;  1RQR A;  1N06 A;  1BR9 A;  2UU9 L;  3MHB A;  2B2T C;  2EJF C;  3ASR A;  2NZO A;  4G4K A;  1CKM A;  4K6D A;  5JVH 3;  4LUZ A;  1Q81 D;  4XOR A;  4JBJ A;  1NMF A;  1PFB A;  5C3E H;  4RDL A;  1X55 A;  4PC1 A;  1GHK A;  1FDR A;  1XWE A;  4A3M H;  5COY A;  2A68 D;  5M3F G;  4PC6 A;  4DV3 L;  1DZ1 A;  3CCV A;  2A1A A;  1VQ6 B;  1ENC A;  2NBF A;  3K58 A;  4DK0 A;  1ILP A;  1JOR A;  2H1E A;  5DLQ E;  5TV2 A;  3BZK A;  5FO7 B;  3MEH A;  5CBA E;  1TII D;  2R7Z H;  4C1N K;  4II2 A;  4WZT A;  5AJ3 L;  4M53 A;  1CKN A;  3S16 B;  4MYU A;  1KD1 C;  1OTC A;  4XR6 A;  1HTP A;  4GKK L;  2R92 B;  1XQB A;  3V2T A;  1HUM A;  1SYB A;  2VZL A;  5FA6 A;  4G7X A;  1TXY A;  4V0B A;  2XN9 C;  4RHR A;  3Q23 A;  2GJK A;  3KLS A;  5K36 G;  4BBR G;  2UXB Q;  3EFX D;  3OE7 A;  4IUV A;  1SRU A;  3SHL A;  4AYB G;  4P6V F;  5BN3 A;  3B82 A;  1SSO A;  4P25 A;  2YV5 A;  1VDZ A;  4UY8 C;  4FO2 A;  2KCT A;  1G6P A;  5ELD A;  3EA6 A;  4A3E B;  2HMA A;  1NRK A;  1SE8 A;  1QWY A;  3WDN A;  1FNV A;  3IKJ A;  5I6W A;  1KDB A;  3SK4 A;  1B9N A;  2E2I B;  2DIE A;  3E9I A;  3A7L A;  4XD7 A;  1WTH A;  3Q22 A;  2MUY A;  2HCJ B;  3W5O A;  1VQ7 A;  4HID A;  4IAL A;  1TY2 A;  1PA6 A;  4ZKC B;  4GOP B;  4LBV A;  1LT6 D;  4LWC A;  1VQO A;  1BVS A;  3TS2 A;  2EJG C;  4GKK Q;  1PXU A;  1IBK Q;  1I6H B;  1VQN A;  5HGT A;  1EQV A;  3Q8D A;  1EYD A;  3HOZ G;  5IYD H;  3OMG A;  1VQI A;  1I3Q B;  3RUZ A;  3M4O B;  3HOW B;  4C3H G;  1TU2 B;  3A35 A;  3M4Y A;  4UZF A;  4P74 A;  1GKH A;  3A5U A;  2B3G A;  2ICE C;  1WSR A;  2N78 A;  4LW1 A;  2VUM G;  4HTH A;  1YHQ B;  3BDO A;  4XOP A;  1JWU D;  4TKO B;  2E74 C;  2E5L Q;  4AQY L;  3BDC A;  4IPC A;  5E4X A;  1WDT A;  3ULL A;  2F0F A;  1EIY B;  2ZZG A;  5FLX L;  1HTL D;  1RL2 A;  4DR1 L;  1I4G A;  1NCV A;  1E1T A;  2PE3 A;  1RDP D;  3M4Q A;  1RKN A;  5LMU L;  1COW A;  1CZG A;  2Q8T A;  3SGI A;  3TP7 A;  1CHP D;  4HMJ A;  1PTO F;  2AQ2 B;  4XLC A;  2WP8 J;  4LBY A;  4DAY B;  3BS1 A;  5J1Z A;  1E0B A;  1E7Z A;  2NV4 A;  1HVX A;  5IYQ A;  1QVF A;  5LL6 S;  3J7Z C;  2EVB A;  3TP6 A;  2E1R A;  4LF7 Q;  1VJS A;  3JC6 6;  1Y8N B;  3CF5 A;  2F0T A;  4FF3 A;  3PO2 B;  4B3R Q;  1H85 A;  1QGY A;  4GLA C;  5IGB A;  3RMH A;  1IB0 A;  1XMO L;  2NVQ B;  4O2D A;  2SDF A;  4LF8 L;  4B3S Q;  3N52 A;  1TWG H;  1ET6 A;  2YWH A;  4IQZ A;  4RD2 A;  5H59 A;  2Z6K C;  3B6Y A;  4NXM L;  1E79 A;  1PYW D;  1CUK A;  2DN8 A;  2GJR A;  1NR2 A;  2BDO A;  2K75 A;  3CC2 B;  2C4T A;  3BCD A;  3Q38 A;  3AVW A;  5IT9 L;  3GTJ H;  3SDZ A;  3HOU G;  4ZCI A;  1JJC B;  5JPM C;  2B2V C;  2AMC B;  4XON A;  4OO1 H;  2EYO A;  4BY1 G;  3H3V I;  2R9V A;  1X65 A;  5IP7 G;  3CKI B;  1JJG A;  5KNL A;  1GOZ A;  3HKS A;  4X3S A;  2YYZ A;  1EEI D;  4JI2 Q;  2D5D A;  3KLW A;  3ES9 A;  4C56 C;  2AWO A;  1EU4 A;  2MPM A;  5LMN L;  3OFN A;  1GVH A;  2UUC Q;  3QJY A;  3UDX A;  3G6J B;  3I4M H;  1RCV D;  2X85 A;  1D5M C;  4TSF A;  1I4R A;  1K0R A;  1QZG A;  3VA7 A;  2VNU D;  3SJP A;  2EY6 A;  5COR A;  4A3F B;  3S17 H;  2NVT B;  3V7A A;  4P71 A;  4EGV A;  4DNT B;  3VYU A;  2OBR A;  5IYD G;  5LHY 1;  3HKZ E;  1DDG A;  4I7Z C;  5FO9 B;  1D2B A;  3GO5 A;  4NXN L;  5HGQ A;  5J22 A;  3NXW A;  4CJ2 C;  4YHB A;  4DR4 L;  4RCY A;  1EYC A;  1XNR Q;  1YJ9 B;  1MIU A;  4R4C A;  1FGB D;  1H9J A;  5DEH A;  2XWB B;  1V1Q A;  4E0F A;  2N88 A; 
#chains in the Genus database with same CATH homology
 4XDX A;  4H13 C;  1JOK A;  1Q8I A;  3DWQ A;  3I90 A;  3BG3 A;  5A2Q E;  1TWA B;  2J0T D;  3TZU A;  1K8O A;  3PUZ A;  3PV0 A;  3A55 A;  5I6Y A;  1OXV A;  1ICW A;  1JOO A;  3A3B A;  1W0J A;  2NN6 G;  2E76 C;  3BYY B;  3NWT A;  4A3J B;  2EYH A;  1ET9 A;  2KUM A;  4WOR A;  2KHS A;  3WOF A;  3PMF A;  4R8N A;  1BCP D;  1BCP F;  3K6O A;  3R2T A;  3OMC A;  1S5B D;  2HLD A;  1ZYR C;  4HN7 A;  2XZO A;  3P20 A;  4OHJ A;  2G9D A;  3GTK B;  1B4O A;  3D31 A;  1F9P A;  4XL9 A;  4KD3 A;  2QDB A;  2F4I A;  2FHT A;  3HGB A;  2D9U A;  1EL0 A;  1CA5 A;  1HA5 A;  4G7W A;  3MXN A;  3S1N B;  3GV6 A;  2A69 C;  1U9R A;  1CT1 D;  1PRT F;  1ENF A;  2X69 A;  2A68 C;  1JCK B;  1MAB A;  2QKI C;  1DD2 A;  4H44 C;  2EE1 A;  5J39 A;  1PDQ A;  3OAA A;  2EZV A;  1C8C A;  1UNS A;  3K57 A;  1H8H A;  4V19 0;  1PRT B;  3NTI A;  2IT1 A;  5NUC A;  2RKS A;  4F87 A;  1Z7T A;  5EPK A;  2ZTN A;  1A2U A;  2KA7 A;  1WTV A;  1II3 A;  1AFP A;  4XKW A;  2K03 A;  3IAY A;  3Q0A A;  1PZI D;  4ZAI A;  3C3L A;  5M5W B;  1SNP A;  3OHX C;  1SFO B;  2F03 A;  2WJY A;  1B3A A;  3NTH A;  1PFM A;  1SJE D;  2QF7 A;  3QB3 A;  3A7A B;  5IGC A;  5JAV A;  1TWH B;  3GQB A;  2GJP A;  2WIN B;  3NUC A;  2A6E D;  4BA2 I;  5ELF A;  3NP8 A;  4B08 A;  5C3E B;  3D4D A;  1V43 A;  1HXY D;  1MGS A;  2PYK A;  2SNM A;  1EY4 A;  4ZUI A;  1KAA A;  3HAG A;  4IUP A;  4NMZ A;  5KEE A;  2EJM A;  2AUK A;  5LL6 X;  2EDG A;  4M1U B;  1EY8 A;  3BH4 A;  4PNY A;  3GD7 A;  1JWS D;  3O13 A;  1F77 A;  5D14 A;  5CV5 A;  2Z8L A;  4XT3 B;  2R7Z B;  1XTC D;  2EYL A;  2ZXO A;  3K5N A;  3CP8 A;  4XLH A;  3FDT A;  4C1N I;  2ENB A;  1O78 A;  4QB4 A;  4RA8 A;  1T5E A;  5CDF A;  2PPB C;  4U67 3;  5I4D A;  2QE7 A;  2V31 A;  3GVJ A;  1ZEQ X;  3M85 A;  4WFN 3;  1KAB A;  1W9X A;  3FRP B;  1I18 A;  2SEB D;  4DXG A;  3S1Q B;  2F0S A;  3H3V C;  4UAI A;  4ME5 A;  4EVO A;  2B39 A;  4DAV A;  2W6I A;  1W0K A;  3P75 A;  1MSG A;  5EPJ A;  4XQN A;  3ND9 A;  2JXM B;  5C6A A;  2OF1 A;  3HP3 A;  1WD0 A;  1SXT A;  5EQ0 A;  1WVL A;  1UAP A;  2MGS A;  3I8Z A;  4C3J G;  1LAB A;  4KK7 A;  2R6G A;  2NTS A;  1KTK A;  4DF7 A;  5BN4 A;  1I50 B;  3QOJ A;  1SMY C;  1SYE A;  3GP7 A;  3MVV A;  5ELB A;  4LMQ D;  1OO9 B;  3MXG A;  2MJ8 A;  2F1M A;  3CES A;  1H9K A;  4R9W A;  4EQN A;  4PMW A;  4OL7 A;  1KDC A;  4IUQ A;  2L4N A;  4IZ8 A;  5BN5 A;  5KIX A;  4X3K A;  3FVQ A;  2D3L A;  2XZL A;  2ZZF A;  1J9O A;  1HQR D;  4FYD A;  2ZXP A;  2PW5 A;  2WKC A;  5IOD A;  1PRT C;  4OIJ A;  1EY9 A;  1RTN A;  2BA1 A;  4O1N A;  1TS4 A;  3MC0 B;  3I4M B;  1EWC A;  2F0G A;  3R2I A;  1NUC A;  2M9V A;  3S17 B;  5T1I A;  3FPU B;  4G57 A;  1ONL A;  3R8B A;  3OW7 A;  4WRD A;  5EKL A;  1IKL A;  1JB3 A;  1XXG A;  1YNJ D;  1GJX A;  4F8M A;  1E2Z A;  4KN4 C;  4PV1 C;  1E3X A;  1TKW B;  3P7J A;  1BXT A;  3JU4 A;  4B3G A;  4PMB A;  4O42 A;  3SXH A;  5FKA C;  4FNF A;  3HOZ B;  5JVG 3;  2X6W A;  1WTR A;  4K2L A;  4GQN A;  3S1M B;  4A3B B;  5IOC A;  2JA5 B;  4TT3 A;  2BA0 A;  4IUR A;  1DM0 B;  5JJZ A;  5D65 A;  3OPO A;  2HDM A;  1TQO A;  3HOV B;  2WKD A;  3BVG A;  1L0Y B;  1E2W A;  4FVM A;  1S5F D;  1R4P B;  2NVX B;  3GTM B;  3J80 L;  4B3F X;  2A73 B;  1M8A A;  1AP0 A;  5T1G A;  3OEE A;  3CHB D;  4HMI A;  4NKL A;  3SEB A;  1WTO A;  1SJH D;  4IFD J;  1E3Z A;  1HCZ A;  3DM1 A;  5C3X A;  4BY1 B;  4OO1 G;  1PKV A;  2ZTG A;  3HOU B;  4S3S A;  4HSP A;  4Q0F A;  4HCE A;  1SE2 A;  2J7Z A;  2O2L D;  4J1M A;  3NWS A;  4II3 A;  1SMY D;  5C0X J;  3ZIA A;  1C4Q A;  5CV7 A;  3TP5 A;  3NQT A;  1I8D A;  2F0W A;  3MFG A;  3MAQ A;  3PIP 3;  4A3I B;  1D5X C;  2FIN B;  2XIW A;  2CW0 C;  4ZQ3 A;  3ITP A;  4K5X A;  3DHQ A;  1V1P A;  5I9P A;  3JAM L;  2WB1 B;  3TN2 A;  3WQZ A;  4G7Z C;  1KZL A;  4BS9 A;  4RH6 A;  4FP5 D;  1GUN A;  1H9M A;  1TR5 A;  4CBV A;  1SNO A;  2XRQ D;  3BC9 A;  2VUM B;  1Y1V B;  1AW7 A;  1PLF A;  1TWC B;  5JOB A;  1O7Z A;  4XTC S;  1G8Z D;  2VB3 X;  4XQQ A;  3S15 B;  3D4W A;  1HQM C;  3PO3 B;  1MBY A;  1QOH A;  1SYG A;  4E6I A;  2PMZ B;  3HKZ B;  5I2X A;  2F0K A;  1M4V A;  3V96 A;  5A2Q L;  3S14 B;  1K8M A;  3MFY A;  4KKT A;  1PZJ D;  4NNJ A;  3OEH A;  4XKV A;  4CJ0 B;  5IGD A;  2C9O A;  2MP1 A;  3H91 A;  5CBE E;  1YNN C;  2JA8 B;  1UUP A;  1S5D D;  1KMH A;  1LTT D;  1AEX A;  1NAP A;  2FFK B;  3S9W A;  1LTI D;  1DYQ A;  3M7N A;  4HED A;  3RD4 A;  1KLU D;  2TSS A;  3I3C A;  3EQL C;  1ILQ A;  4FXU A;  1LTA D;  5EJW A;  3U9O A;  1O7Y A;  1BPL A;  4L63 B;  4EQP A;  2B2V A;  3KUP A;  2KEC A;  1V1P B;  3A8I E;  2XWJ B;  4CKE A;  2A6E C;  3BCF A;  1BF4 A;  2L11 A;  3K7A B;  1GUG A;  1BBX C;  1UD3 A;  5JEA H;  4DK1 A;  1V8Q A;  2F0U A;  2EY1 A;  1LTB D;  2L1B A;  2BOS A;  1DCZ A;  4KTA A;  2Q8I B;  2F0I A;  4KJO A;  5KNC A;  1EYA A;  2A6H D;  3NBH A;  1EEF D;  2NB0 A;  4QUC A;  3S2D B;  1TS5 A;  1EOT A;  3MXP A;  2KCN A;  1F9S A;  2AUJ D;  4XXE A;  3ONA B;  5M5X B;  1C48 A;  4KY7 A;  2B2W A;  4Z1M A;  1STN A;  3GVL A;  1ROD A;  3T13 A;  4K2K A;  3KBG A;  2JEB I;  1EZ8 A;  3KLS X;  1W6K A;  5IT9 E;  4TRD A;  3R93 A;  3SR1 A;  1LV9 A;  1EIG A;  1KNE A;  3G05 A;  2ZT9 C;  1STH A;  4ABN A;  2GA4 B;  4ZK9 B;  2E2D C;  4XM3 A;  2EOT A;  1I4Q A;  4OGQ C;  2IW3 A;  2OEO A;  1OXT A;  3TSS A;  2F0M A;  4C2M B;  1EWH A;  3S1R B;  2GK6 A;  3T16 A;  2K05 A;  3IL8 A;  1OXS C;  1RF2 D;  2XVS A;  2QCP X;  1H9S B;  3VYR A;  3BZD B;  2VJJ A;  2CQA A;  1IW7 D;  1STB A;  3QWN A;  3NBI A;  3HOX B;  4N9T A;  2TMP A;  2H4O A;  1BCP C;  4QUF A;  5C0X I;  1RD9 D;  1JC7 A;  2A6H C;  3DXJ C;  5KNB A;  1X3Q A;  1OB0 A;  3UI2 A;  3J80 E;  2FMM A;  4RGM A;  4P2C B;  3OIP A;  1JR0 D;  3C1F A;  4IFD I;  1GXD C;  2DY7 A;  4HSV A;  1UD8 A;  4A3G B;  5FL7 A;  1SE4 A;  1QG7 A;  3M7G A;  1LTS D;  3HRZ C;  2RDF A;  4BBS B;  2OXP A;  4OO1 I;  3BVZ A;  5FLX E;  1ENA A;  4C3H B;  5A35 A;  5C5L A;  1QNU A;  5M5Y B;  3VR3 A;  4DA2 A;  1B50 A;  3BYT B;  4BY7 B;  2F43 A;  1UD4 A;  2VXW A;  4N9P A;  3U9S A;  4P22 A;  1E2V A;  2JSO A;  3PIO 3;  3I4N B;  3TBI B;  1YNN D;  3TZD A;  2RDH A;  3GTO B;  3S2H B;  1Z6H A;  3J7Y W;  1Q1B A;  5EKI A;  1HFN A;  2Q8R E;  4KN7 C;  4DU9 A;  3V05 A;  5IK2 A;  4I65 A;  5ISR A;  4DAP A;  5I2Y A;  2R61 A;  3OOC A;  3PUX A;  3CRL C;  1Q1E A;  2EY5 A;  5EBD A;  5CYU A;  1MSH A;  4NP5 A;  4RKL A;  5AFW A;  4Y7N B;  5CV9 A;  1IW7 C;  3Q24 A;  1QNK A;  2I07 B;  3URY A;  1U4L A;  1DOM A;  4B9W A;  4KY6 A;  1Q90 A;  3WOE A;  2YU9 B;  4XN0 A;  4B9X A;  4RCN A;  2NWG A;  4C3J B;  1O80 A;  1LO5 D;  2DNE A;  3D4R A;  4RAU C;  2K32 A;  3H94 A;  2PQE A;  1WCM B;  3T4A C;  1B2T A;  2PZU A;  3ND8 A;  3W2D A;  1TVX A;  1IYU A;  5KRU A;  2O5J C;  1SND A;  1TS2 A;  3HS0 C;  4XLE A;  2M2L A;  4XYQ A;  2ID0 A;  1I4H A;  4MN3 A;  1STA A;  3FKI B;  2V4D A;  1RJT A;  2PO4 A;  5KYI A;  3I72 A;  2JIZ A;  3L9A X;  4XOT A;  1JWM D;  3MZ5 A;  4RGN A;  1HPC A;  1WTP A;  1PZK D;  3K5O A;  2EYP A;  5IGF A;  1S5E D;  2KVO A;  1BQQ T;  3ZPN A;  3GTL B;  1SYF A;  2K04 A;  2FJ2 A;  2BDN A;  4J6H A;  2K01 A;  1U4R A;  1SNM A;  1F2Z A;  1EFR A;  2L9H A;  2KED A;  3RZD B;  1BO0 A;  1TY0 A;  2C5C A;  4RGT A;  4LJZ C;  4CGY B;  1SYD A;  2ZZE A;  2JE6 I;  4XQF A;  5KND A;  1CQV A;  3FKS A;  3GTP B;  4XLA A;  2FMC A;  4XIG S;  2D2C C;  1LT4 D;  3HZX A;  4DGZ A;  1MI2 A;  1PTO H;  5CGK A;  4PMC A;  4RFB A;  4HIZ A;  3KK7 A;  1QJO A;  3W3A A;  3D8G A;  3EVQ A;  3QOL A;  4BWG B;  1VMP A;  5E3F A;  1UEA B;  2NVY B;  1F2L A;  2QIL A;  2K5D A;  5C5M A;  5DAU A;  2Z4H A;  2Y0S B;  3VR2 A;  1UD5 A;  2ZXI A;  2BE5 C;  2LFN A;  3ERQ A;  4TQU S;  4BA1 I;  3FPP A;  1WTQ A;  3DEO A;  4ZUJ A;  1OXU A;  2DNC A;  1Y69 U;  1STY A;  1IKM A;  3JAM E;  2D3N A;  5IGE A;  1VF7 A;  3C2P A;  1AN8 A;  3H0G B;  3L7Z C;  4ZYS A;  1EU3 A;  1FR3 A;  1FNW A;  1QIL A;  4XN3 A;  2O4X A;  2Z4I A;  4G7H C;  2B8F A;  4YEL A;  4IFD G;  2PNR C;  3MTS A;  2SOB A;  5DM7 3;  4J8Q A;  2E1B A;  2XNA C;  3BDL A;  2F0J A;  2CK3 A;  5CV6 A;  3KF8 A;  2AQ3 B;  1BDO A;  4X3T A;  1G6Z A;  5C0X G;  1Q3L A;  2CHB D;  1CZW A;  2CW0 D;  2B2Y C;  1HUN A;  4HAE A;  2PZT A;  2XRS D;  5CV8 A;  2LKV A;  1DOK A;  4XYO A;  2JA6 B;  1VLY A;  2I46 A;  5DN6 A;  2B2T A;  3A8K E;  1BCP B;  4DAY A;  1WTH D;  1LLR D;  3X3M A;  4RKB A;  3GVK A;  4H7B A;  4IUU A;  2IX3 A;  5CMD A;  1XYI A;  2ICI A;  1J8I A;  2RBM A;  4KI0 A;  1X3P A;  2NN6 H;  3VR5 A;  3E5S A;  1V0F A;  4KJN A;  5DM6 3;  3VYT A;  1Z47 A;  3D3R A;  4XT1 B;  3A56 A;  4RGO S;  2NN6 I;  2BE5 D;  3QIA A;  4CKC A;  1SAP A;  4FF1 A;  5I9O A;  4FXD A;  3DEP A;  2HDL A;  1SDF A;  3SK5 A;  1ESR A;  3M3Y B;  3RZO B;  1GUS A;  4FXG C;  1EY0 A;  1A3U A;  3CQZ B;  1GHJ A;  2JYO A;  4ZLT F;  5EPL A;  1BUV T;  4HR7 B;  3NSW A;  4ID6 A;  5M3M B;  4FF2 A;  3SK6 A;  3I4L A;  1YNJ C;  4R8I A;  1D1I A;  3K5M A;  1HHV A;  4AVZ A;  1G2S A;  2AQ1 B;  3PUW A;  4CKB A;  4XMY A;  2X6Y A;  5KYL A;  2RSO A;  2JEA I;  1D5Z C;  1K28 D;  2GK7 A;  2E75 C;  2WJV A;  5IGG A;  1CFM A;  3HEJ A;  2OT2 A;  2XOK A;  4NDX A;  2E2J B;  2IX0 A;  3NQI A;  2L0C A;  5C4H A;  3MXU A;  1KNA A;  5D3D A;  3J81 E;  2M00 A;  1U4M A;  1SYC A;  3F2U A;  5EGT A;  1CHQ D;  3KBX A;  2LMC B;  2WZP P;  2L12 A;  1B9M A;  2J4X A;  4ASU A;  1HZE A;  3R3O A;  3C46 A;  2VB2 X;  5CR3 A;  1ZXT A;  1UD6 A;  4F7X A;  2K28 A;  1DJR D;  1EFI D;  2QEJ C;  4NW2 A;  4Z9C B;  5G3L D;  3E0J A;  2RQX A;  3NK9 A;  5FO8 B;  2A69 D;  2NYZ D;  2A74 C;  1TWF B;  3D6C A;  4K8I A;  4Q5V A;  1A3T A;  3NTK A;  4X3U A;  2W6J A;  1CI3 M;  4A93 B;  1MD2 D;  3QG1 A;  1QB5 D;  2WII B;  5E4W C;  5F2D A;  5JEA G;  1LTR D;  4C3I B;  1CA6 A;  1ZYR D;  1PFN A;  4LAA A;  5K36 H;  1X32 A;  2ZXR A;  3KEW A;  4RHS A;  5HUR A;  5JPN C;  3LNN A;  4FF4 A;  4M8A A;  5ELE A;  2EYJ A;  5DNF A;  1DXM A;  4JBW A;  4HCS A;  1B53 A;  4KV6 A;  3J7A F;  4ILW A;  1L0X B;  4CJ1 B;  1AZP A;  4ZKB B;  2KJX A;  1LTG D;  1H8E A;  1V1O A;  1EY7 A;  3LX0 A;  2JP1 A;  3T53 B;  4QMG A;  3TME A;  1I4X A;  1ML0 D;  5M3F B;  2EXZ A;  3VR6 A;  2EYF A;  5E1F A;  3CMM A;  2Z1C A;  2VJI A;  4QIW B;  2K1B A;  3I73 A;  1JOQ A;  1A6X A;  3RLF A;  2KCC A;  4MHE A;  4MIU A;  1IYV A;  1R9T B;  1PTO B;  5K5P A;  2KEE A;  2B2Y A;  3L3O C;  5C44 B;  2XGJ A;  2L5T A;  4KKU A;  1SNQ A;  1JE4 A;  4KKS A;  4KY5 A;  3T51 B;  1WTX A;  2NTT A;  4YIJ A;  2R93 B;  1ZKO A;  4H0L C;  2K5W A;  2O5I C;  5C4X B;  3OSO A;  4IUT A;  2F0O A;  5JEA J;  5IIF A;  4PQX A;  1B44 D;  1F9Q A;  2F0H A;  1SE3 A;  3SE0 A;  1D1K A;  2ZZQ A;  4C3I G;  2PZW A;  1PTO C;  1PTO D;  2NZ1 D;  1IHZ A;  2M5S A;  3VYS A;  1SNC A;  2RA4 A;  3EJI A;  3OWE B;  4WJW A;  1TS3 A;  2F3W A;  1LT5 D;  4GZY C;  3H6M A;  5FK9 C;  4YXW A;  3OIQ A;  1H9R A;  2B8G A;  3DWA A;  3H09 A;  3GTG B;  4YEJ A;  1HFG A;  1NR4 A;  4RCO A;  1DOL A;  2X6L A;  4KD4 A;  1EZ6 A;  1E1Q A;  2R3Z A;  3A54 A;  2G9H D;  2Z6B D;  3KLR A;  3E6Z X;  4A3M B;  3FEW X;  3C1E A;  4JK1 C;  1BLI A;  1A15 A;  1Q12 A;  3HG9 A;  4LK1 C;  4CHT B;  1FNU A;  4DN4 M;  1EQT A;  2B2U C;  4FXK C;  1FX0 A;  2CVR A;  5CC4 A;  4UZU A;  1G2T A;  1VMC A;  2HQE A;  5C4J B;  2E2H B;  3A3G A;  1F2Y A;  1B1Z A;  1F9R A;  1I6V C;  3D6W A;  2IPK D;  1EIH A;  1BMF A;  3Q6S A;  2SNS A;  3K5L A;  4EQO A;  1STG A;  2B63 B;  1GUW A;  1SBB B;  4ZRZ A;  3CRK C;  3PUY A;  2MHV A;  1AZQ A;  1T5X D;  1PMR A;  2HUG A;  3NE5 B;  1JIC A;  1BNZ A;  2F3V A;  4JMQ A;  2XND A;  3A8J E;  4DFA A;  1JQY D;  3AU7 A;  3FMC A;  2X53 S;  2F0E A;  3G7L A;  5EBC A;  1VF5 C;  3DWP A;  4L6T B;  1FYC A;  3J7A V;  5C4Z A;  3LWU A;  1A3V A;  1FD7 D;  1G29 1;  2L55 A;  2KVM A;  2WPD A;  1EY6 A;  3K0Y A;  4DNR B;  5HKK A;  2F0L A;  3TP8 A;  1R4Q B;  1IL8 A;  4U68 A;  1OHH A;  1U4P A;  4K14 A;  2XZP A;  4IUN A;  1TWG B;  2WV6 D;  2X6X A;  4F88 A;  1S5C D;  1SEB D;  3MWY W;  3GTJ B;  4L8J A;  3T56 B;  5KGU A;  2F0Q A;  2B2U A;  5EKK A;  3K59 A;  1GUT A;  3BVM A;  2BCO A;  1V0E A;  4TSS A;  1E43 A;  2RSN A;  3NPP A;  3CP2 A;  1SKY B;  3I70 A;  1VCI A;  3P1H A;  4QCL A;  3ERO A;  3DDY A;  3VR4 A;  5M9O A;  2IJ0 A;  4KHV A;  2K33 A;  4QF4 A;  5ELC A;  2D62 A;  4OIK A;  2IWH A;  2EY2 A;  2F0P A;  2RDG A;  1Y8O B;  2A5H A;  3NHH A;  2F0N A;  2RVL A;  2JA7 B;  1I4P A;  2KQ3 A;  5CV4 A;  2LS0 1;  4K5V A;  3HOY B;  1DON A;  1G91 A;  2NUC A;  4G6I A;  3X3N A;  2N55 A;  3ZYY X;  4AYB B;  1WTW A;  3GTQ B;  2PW7 A;  1LAC A;  3AB9 A;  2XSC A;  2IX1 A;  2HCC A;  1UD2 A;  4XQJ A;  1D6E C;  1WPC A;  1K83 B;  1S4Z A;  3CU7 A;  4G7O C;  3DUZ A;  1QCB D;  3OWF A;  3J81 L;  1O7L A;  2WAQ B;  1H9S A;  5C3W A;  2X8K A;  4KMU C;  3VA5 A;  2F0D A;  5C0X H;  2EYM A;  1RHP A;  1QE6 A;  4RWS C;  3SVM A;  1KDA A;  4ULL A;  2WSS A;  1CK1 A;  2K6A A;  3LWE A;  4IFD H;  2JJ1 A;  4BBR B;  2IL8 A;  1HRJ A;  4A3K B;  1ESF A;  4DXF A;  3I91 A;  2PCF B;  4UDU C;  5FOB B;  1EY5 A;  4ODG A;  3GV3 A;  3IFD A;  3DMU A;  1LT3 D;  4K6L A;  4XNF A;  2JDI A;  3TDQ A;  3N6R A;  3SK8 A;  2X6G A;  5D3I B;  4K5W A;  1TT2 A;  2K5Q A;  1STE A;  4KHZ A;  2ZXH A;  1RTO A;  1A2T A;  1NBM A;  2KOL A;  4IN3 A;  2V7Q A;  2EPB A;  3MA2 B;  5TSS A;  1HA6 A;  4K8J A;  1W6J A;  2B2W C;  1WP6 A;  2LZJ A;  3IFT A;  1Y1W B;  2AWN A;  1BOS A;  1E1R A;  1NSN S;  1PRT D;  2F0V A;  2LY7 A;  2WAC A;  1CTM A;  1WD1 A;  1CQF A;  4XLF A;  2HCI A;  5G3L F;  2JJ2 A;  2K7V A;  1GUO A;  2DY8 A;  1KLG D;  1F2M A;  1CM9 A;  1XX8 A;  3QO2 A;  1OXX K;  4A3D B;  1Y8P B;  3AMU A;  3PUV A;  1BR9 A;  3MHB A;  2B2T C;  2EJF C;  4G4K A;  4K6D A;  5JVH 3;  4XOR A;  1PFB A;  1GHK A;  1XWE A;  5COY A;  2A68 D;  1DZ1 A;  1ENC A;  2NBF A;  3K58 A;  4DK0 A;  1ILP A;  1JOR A;  2H1E A;  5FO7 B;  3MEH A;  5CBA E;  1TII D;  4C1N K;  4II2 A;  3S16 B;  4XR6 A;  1HTP A;  2R92 B;  3V2T A;  1HUM A;  1SYB A;  4G7X A;  4V0B A;  2XN9 C;  4RHR A;  3Q23 A;  2GJK A;  3KLS A;  5K36 G;  3EFX D;  3OE7 A;  4IUV A;  3SHL A;  5BN3 A;  1SSO A;  1VDZ A;  4FO2 A;  5ELD A;  3EA6 A;  4A3E B;  1NRK A;  1QWY A;  3WDN A;  1FNV A;  3IKJ A;  5I6W A;  1KDB A;  3SK4 A;  1B9N A;  2E2I B;  2DIE A;  3A7L A;  4XD7 A;  3Q22 A;  2MUY A;  4IAL A;  1TY2 A;  4ZKC B;  1LT6 D;  2EJG C;  1PXU A;  1I6H B;  5HGT A;  1EQV A;  1EYD A;  3OMG A;  1I3Q B;  3RUZ A;  3M4O B;  3HOW B;  4C3H G;  1TU2 B;  3A35 A;  3M4Y A;  2ICE C;  4HTH A;  3BDO A;  4XOP A;  1JWU D;  4TKO B;  2E74 C;  3BDC A;  5E4X A;  2F0F A;  2ZZG A;  5FLX L;  1HTL D;  1I4G A;  1NCV A;  1RDP D;  1RKN A;  1COW A;  1CZG A;  2Q8T A;  3TP7 A;  1CHP D;  4HMJ A;  1PTO F;  2AQ2 B;  4XLC A;  2WP8 J;  3BS1 A;  5J1Z A;  1E0B A;  1HVX A;  5LL6 S;  2EVB A;  3TP6 A;  1VJS A;  1Y8N B;  3PO2 B;  2F0T A;  4FF3 A;  5IGB A;  3RMH A;  2NVQ B;  2SDF A;  3N52 A;  1ET6 A;  4IQZ A;  1E79 A;  1PYW D;  2DN8 A;  2GJR A;  1NR2 A;  2BDO A;  3BCD A;  5IT9 L;  3SDZ A;  5JPM C;  2B2V C;  4XON A;  4OO1 H;  2EYO A;  2R9V A;  3CKI B;  5KNL A;  1GOZ A;  4X3S A;  2YYZ A;  1EEI D;  2D5D A;  4C56 C;  2AWO A;  1EU4 A;  2MPM A;  3OFN A;  3QJY A;  3G6J B;  1RCV D;  2X85 A;  1D5M C;  4TSF A;  1I4R A;  2VNU D;  3VA7 A;  2EY6 A;  5COR A;  4A3F B;  2NVT B;  4EGV A;  4DNT B;  3VYU A;  5LHY 1;  4I7Z C;  5FO9 B;  1D2B A;  3GO5 A;  5J22 A;  3NXW A;  4CJ2 C;  1EYC A;  1FGB D;  1H9J A;  5DEH A;  2XWB B;  4E0F A;  2N88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...