2NV4A

Crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
133
structure length
133
Chain Sequence
MILKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWMDKASRDKLRVVPPGETEERGVFTTRSPSRPNPIGLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEIDCVNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0066 protein AF_0241
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 20
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01980 TrmO tRNA-methyltransferase O
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.70 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YaeB-like 2nv4A00
2NV4A 1XQBA 3OKXA
chains in the Genus database with same CATH superfamily
3Q6RA 1UD5A 5TY0A 2WJVA 2C78A 1FNDA 3SLDA 3VO2A 1R5BA 1GAQA 4BPRA 2ZL7A 4B44A 3CPWB 4N3GA 2ZZEA 1Q82D 4OP7A 5FIUA 3AGQA 2V7UA 4TSFA 4G7XA 3QFTA 1B2RA 2C4UA 4ZCLA 3U6BA 2Q6KA 4PC6A 3MMPA 3Q3AA 3ASRA 1E62A 5KSWB 3JU4A 3I56B 4YALA 3ISXA 4UZFA 2JJ1A 4ZCMA 3ASQA 4X05A 2GJRA 3NE5B 4B43A 4RLZA 4QUZA 1WSVA 2CRVA 1CNEA 1GR1A 2YWFA 2XOKA 5KNLA 2GJKA 4AF6A 4RDKA 2W6IA 2XNJA 1QGZA 3A3GA 4XKVA 4TT3A 2E1RA 1HA3A 1BX0A 5BSYA 2V4DA 2CBXA 1RQRA 4OOSA 4FWTA 2J7KA 2VBTA 1A8PA 1NB0A 2C4TA 3CTAA 4XONA 2VNJA 3GVKA 1NRKA 5H59A 2ZZFA 4LC0A 2OTJB 3LVBA 1H8HA 1T6ZA 2C5HA 4AVZA 2C2WA 3BC9A 5A88A 1MABA 1SM4A 1SKYB 1E1RA 1D2EA 4NNJA 2VZLA 1PKVA 5DS0A 5B6IA 2LZJA 1K73D 5JBQA 1QGAA 3OEEA 1D8TA 3CCJB 2NV4A 2D3NA 2V7WA 1H8EA 2HDNB 4JMQA 2OBTA 3FKSA 4XD7A 5FA6A 2VNIA 2I1LA 1KQSB 3A8JA 4Z4ZA 1W2BB 2ZXIA 4X07A 4RCYA 4AC9A 3QFCA 3QSYA 1KZLA 4L8JA 3R6JA 4NBSA 3W5VA 4G1BA 4X7EA 3R6KA 3OEHA 3ZIAA 1WP6A 1NBMA 2JN9A 5FNZA 2V31A 5IYRA 2X6WA 3D26A 2AHOA 3WYAA 4B4DA 2D3LA 1XB2A 2BPOA 2V7QA 2NPFA 4RD2A 1S72B 1UD3A 4NCNA 3T56B 1N8RD 3G71B 2OBRA 1TLLA 3BCFA 2OK8A 2X6YA 4XLEA 3W2IA 2E1BA 2OK7A 1ELOA 2BF4A 2DY1A 2V7XA 1CQXA 1PJ5A 2BN4A 4YAFA 4E0FA 3GVJA 3I55B 3SEJA 4P22A 1V5VA 4MYTA 1R5NA 4RD3A 1T6XA 3B8HA 1VQKB 1N0VC 2X6XA 4UAJA 4XM3A 1OGJA 5DN6A 4XOTA 1YHQB 1WPCA 2CC2A 1BJKA 4FXUA 2QTZA 2F1LA 2X8KA 1T5EA 4Q7JB 3ZZ0A 1IB0A 2RC6A 1KK1A 4P12A 5A89A 3OFNA 4YAWA 3PENA 4KKUA 3GIRA 3FPPA 1YI2B 2PMDA 1E79A 4ZV4A 3AVUA 1RQPA 5AN9A 4XLAA 3CD6B 2JJ2A 1D1NA 1BQEA 2VNHA 2X0KA 2ZBVA 4DQLA 4IW3B 2F1MA 1EFRA 2DOGA 3LNNA 1N06A 1WOPA 4Y7CA 2XZPA 2BMWA 2VJJA 3HAGA 3AVVA 3VNVA 2BGJA 4PC1A 2QTLA 1K8AD 4H9GA 2X3UA 2KVOA 2JIZA 4DNRB 3CESA 4B48A 4X0CA 5LMZA 1KJZA 3CCLB 2CNDA 2D9RA 4TMWA 2YWGA 5IYQA 3E20A 4ACBA 2B5OA 4Z4WA 1G7RA 1VF7A 2GK7A 1QG0A 5GV7A 1VHEA 2R9VA 3JQQA 3WQZA 1WTHD 4M4SA 4ZCIA 1KTVA 4X7DA 4G7WA 5IK2A 1QVFB 2DERA 1KC8D 2GJPA 3GVLA 4K1XA 4Z4SA 2HMAA 3DDYA 4ROXA 1KK2A 2XNDA 4WZKA 4B3XA 4U9UA 1XQBA 4WZLA 4C0SA 3BCDA 1K28D 2GQFA 4AF7A 5DSZA 1G7TA 1W0KA 1W9XA 4DNTB 3A35A 2VYQA 4RPBA 4TKOB 4EH1A 4PC7A 3CC2B 3OP1A 4PAAA 2QDXA 4XLFA 1BMFA 2QE7A 4YEJA 5FO1A 2DETA 1T6YA 2RC5A 4RM0A 2QGGA 2XEXA 2C5BA 2D74A 5HZAA 3ZC3A 2ZTNA 1QUFA 1QGYA 2OBSA 1EXMA 1EP1B 4M0LA 3BNWA 4LBVA 4RCZA 2HCJB 1E64A 4N3NA 4DK1A 1PJ6A 2W6JA 1WOOA 1KK0A 2XZOA 3CPXA 4PABA 4XN3A 4YAUA 3CMEB 3CCMB 3CCSB 1KRHA 4XLCA 5E6TA 4LBWA 1KK3A 2VBVA 3H94A 4DQKA 4XOPA 3PA1A 1WDTA 1NJID 4QFMA 5HKKA 3FPKA 3Q6QA 2ZL5A 1FNBA 3CW2A 4LBZA 2ZITA 5FL7A 3LQEA 1TVCA 1EP2B 3OPOA 1HZEA 2QEXB 3A8IA 1VQ6B 4G5GA 3CCEB 4P26A 3J81k 2F4NA 1Y0YA 5H5JA 5IYPA 1UD8A 4TMZA 2QA4B 1KD1D 2VBUA 1KMHA 5FO0A 5EMNA 2WR8A 1QFYA 1I8DA 3ONUA 4YELA 3OW2B 3OOCA 4XR6A 3OW7A 4XQFA 4YHBA 2CW5A 1G7CA 2V7VA 1OHHA 2WJYA 4FN5A 4B3FX 1VQPB 2CK3A 4B3GA 1GJRA 3W5HA 1VQLB 1YLOA 1DG1G 3U6KA 3A1PA 4RDLA 1VHOA 3JQPA 1VLOA 4XKWA 1I7PA 4HE6A 4Y9RA 4WZEA 2OYNA 4M53A 3BQJA 1R5OA 3MCAA 2WZPP 3W5UA 3B78A 4XNFA 5L46A 2Z6BD 2ZBUA 3OAAA 1S0UA 3RY8A 3Q38A 2XNCA 1OB2A 1NDHA 2B7CA 1GAWA 3W2EA 3ASSA 3WNDA 1BX1A 1WU8A 3I1FA 2V7TA 3KEWA 5KW9A 1IJEA 1TUIA 3GQBA 4QHYA 1PJ7A 4RJLA 1M90D 3V76A 4X7FA 1W0JA 2BV3A 1V0EA 1ZM4A 4II3A 2C77A 4OPSA 1WORA 3WXMA 1W87A 1HVXA 1F60A 1FRNA 1FNMA 2WSSA 4G6IA 3PUMA 5IYNA 2ZTGA 3ONYA 1E43A 2BVNA 5BSXA 3LQ6A 3V7AA 5J35A 2VBSA 2DCUA 4OOVA 4Y9UA 3ZBTA 4TMXA 4QVAA 4II2A 1N0UA 3BY1A 3ZZTA 2JDIA 3OZWA 4TMTA 4XMYA 5IYWA 2ZXHA 1VQ8B 2WZNA 3CRZA 2X85A 1DDGA 5TV2A 4P9SA 3OKXA 4RDJA 3OJXA 3CP8A 4YAOA 3W2FA 1Q81D 1QVGB 2CF4A 3OZVA 1ZM9A 3A3BA 3ZUGA 1W34A 1Q7YD 1GO2A 5F4OA 2WPDA 4HE5A 4KKSA 2GPJA 3WNBA 1Y0RA 2FX3A 4HIZA 4PC3A 4ZGQB 3GSIA 3T51B 1UD4A 3VO1A 1VJSA 4Z4YA 1E1QA 3OE7A 4RD6A 2ZZQA 5F4MA 3CXCB 3ZPNA 4ZGNB 2DYIA 2FVGA 1VQOB 3G6EB 1AMOA 1COWA 1VLYA 3ASPA 5TR9A 3CMAB 1QX4A 4LBYA 1DARA 4CQJA 2XZLA 1W35A 3WY9A 2BM1A 1YJNB 1SKQA 4X7CA 2PE3A 4WQMA 4RPDA 3OZUA 1EFUA 2X53S 4MYUA 1VQ5B 4OPOA 1K9MD 4WZTA 3CC7B 4WWVA 1MRZA 4XLHA 1EFTA 1OGIA 2BGIA 1NB9A 5F4JA 3AVXA 1UMKA 4Z4VA 5J3OA 4C43A 2PIAA 1P4MA 2B7BA 4OPVA 4XL9A 1EFCA 1EP3B 4X8IA 1VQ4B 1DDIA 1B23P 2EFGA 5A8AA 2OTLB 4Z4UA 3CB4A 3A8KA 3SKBA 1FRQA 1XFOA 2DIEA 4B47A 3T53B 1JA0A 1G7SA 3SJPA 3WBKA 2EIXA 3JQRA 4P3IA 1N05A 3VR6A 3SJZA 3QE2A 3ES9A 3CMMA 2QN6A 1CNFA 1TTTA 4ASUA 1QUEA 4F7DA 2BSAA 4UZUA 4DK0A 2QMUA 1ZM3A 3PUNA 3P26A 4Z1MA 3H9NA 1H85A 1ZUNB 3P27A 4RD4A 1IJFA 4TMVA 4Z4RA 1XE1A 1N07A 4P1VA 1FX0A 4Z4TA 1J9ZA 4RD1A 1FNCA 2ZZGA 4P6VF 1VQ7B 4P25A 3CCVB 4FK8A 4OOXA 3CCRB 4QV2A 3ASTA 1YITB 1OB5A 5GV8A 1YX2A 3OJWA 4M1KA 2F43A 2XGJA 3CCUB 2R6HA 1OB0A 3MHPA 3G4SB 1GVHA 1V0FA 1JB9A 2YWHA 3W2HA 3CP2A 1F20A 2M5SA 3B82A 3ZZUA 2DEUA 3SLNA 1EWYA 2YWEA 3BH4A 1QFJA 2Q6OA 2VJIA 5HZBA 1BLIA 3VMFA 4TN1A 1IHMA 2Q6IA 3BY2A 2VNKA 1S4MA 3KL9A 1VQNB 1QH0A 2ZL6A 3QFSA 3G05A 3QFRA 3CC4B 4PGOA 1ZM2A 5TRDA 1YJ9B 3WBJA 1JA1A 4R71A 4P2NA 3ZBUA 5CDFA 4XORA 3AVWA 1UD6A 1WOSA 2PLFA 4YXWA 1Q86D 1Q9SA 2WYRA 2GK6A 4UZEA 1H42A 1YIJB 3FJOA 1QFZA 1E63A 3WNCA 2HLDA 3AGPA 3AVYA 3Q39A 1E3XA 3VNUA 3CCQB 1JNYA 1WSRA 4GQNA 4QVJA 3E1YE 5HXBA 2P3MA 4ACAA 1M1KD 1BPLA 2BM0A 2GREA 1JJ2B 1I18A 4X06A 1U2RA 4J0QA 4P6YA 1N08A 1AIPA 3W2GA 3PA2A 4XN0A 1FDRA 4RD0A 1VQMB 3LO8A 4KKTA 4PC2A 4P3YA 1VQ9B 1E3ZA 3PVDA 4G1VA 4M2LA 5THXA 1UD2A 2Q6LA 1YJWB 3AVTA 3U2QA
chains in the Genus database with same CATH topology
2NV4A 1XQBA 3OKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NV4 A;  1XQB A;  3OKX A; 
#chains in the Genus database with same CATH topology
 3Q6R A;  1UD5 A;  5TY0 A;  2WJV A;  2C78 A;  1FND A;  3SLD A;  3VO2 A;  1R5B A;  1GAQ A;  4BPR A;  2ZL7 A;  4B44 A;  3CPW B;  4N3G A;  2ZZE A;  1Q82 D;  4OP7 A;  5FIU A;  3AGQ A;  2V7U A;  4TSF A;  4G7X A;  3QFT A;  1B2R A;  2C4U A;  4ZCL A;  3U6B A;  2Q6K A;  4PC6 A;  3MMP A;  3Q3A A;  3ASR A;  1E62 A;  5KSW B;  3JU4 A;  3I56 B;  4YAL A;  3ISX A;  4UZF A;  2JJ1 A;  4ZCM A;  3ASQ A;  4X05 A;  2GJR A;  3NE5 B;  4B43 A;  4RLZ A;  4QUZ A;  1WSV A;  2CRV A;  1CNE A;  1GR1 A;  2YWF A;  2XOK A;  5KNL A;  2GJK A;  4AF6 A;  4RDK A;  2W6I A;  2XNJ A;  1QGZ A;  3A3G A;  4XKV A;  4TT3 A;  2E1R A;  1HA3 A;  1BX0 A;  5BSY A;  2V4D A;  2CBX A;  1RQR A;  4OOS A;  4FWT A;  2J7K A;  2VBT A;  1A8P A;  1NB0 A;  2C4T A;  3CTA A;  4XON A;  2VNJ A;  3GVK A;  1NRK A;  5H59 A;  2ZZF A;  4LC0 A;  2OTJ B;  3LVB A;  1H8H A;  1T6Z A;  2C5H A;  4AVZ A;  2C2W A;  3BC9 A;  5A88 A;  1MAB A;  1SM4 A;  1SKY B;  1E1R A;  1D2E A;  4NNJ A;  2VZL A;  1PKV A;  5DS0 A;  5B6I A;  2LZJ A;  1K73 D;  5JBQ A;  1QGA A;  3OEE A;  1D8T A;  3CCJ B;  2NV4 A;  2D3N A;  2V7W A;  1H8E A;  2HDN B;  4JMQ A;  2OBT A;  3FKS A;  4XD7 A;  5FA6 A;  2VNI A;  2I1L A;  1KQS B;  3A8J A;  4Z4Z A;  1W2B B;  2ZXI A;  4X07 A;  4RCY A;  4AC9 A;  3QFC A;  3QSY A;  1KZL A;  4L8J A;  3R6J A;  4NBS A;  3W5V A;  4G1B A;  4X7E A;  3R6K A;  3OEH A;  3ZIA A;  1WP6 A;  1NBM A;  2JN9 A;  5FNZ A;  2V31 A;  5IYR A;  2X6W A;  3D26 A;  2AHO A;  3WYA A;  4B4D A;  2D3L A;  1XB2 A;  2BPO A;  2V7Q A;  2NPF A;  4RD2 A;  1S72 B;  1UD3 A;  4NCN A;  3T56 B;  1N8R D;  3G71 B;  2OBR A;  1TLL A;  3BCF A;  2OK8 A;  2X6Y A;  4XLE A;  3W2I A;  2E1B A;  2OK7 A;  1ELO A;  2BF4 A;  2DY1 A;  2V7X A;  1CQX A;  1PJ5 A;  2BN4 A;  4YAF A;  4E0F A;  3GVJ A;  3I55 B;  3SEJ A;  4P22 A;  1V5V A;  4MYT A;  1R5N A;  4RD3 A;  1T6X A;  3B8H A;  1VQK B;  1N0V C;  2X6X A;  4UAJ A;  4XM3 A;  1OGJ A;  5DN6 A;  4XOT A;  1YHQ B;  1WPC A;  2CC2 A;  1BJK A;  4FXU A;  2QTZ A;  2F1L A;  2X8K A;  1T5E A;  4Q7J B;  3ZZ0 A;  1IB0 A;  2RC6 A;  1KK1 A;  4P12 A;  5A89 A;  3OFN A;  4YAW A;  3PEN A;  4KKU A;  3GIR A;  3FPP A;  1YI2 B;  2PMD A;  1E79 A;  4ZV4 A;  3AVU A;  1RQP A;  5AN9 A;  4XLA A;  3CD6 B;  2JJ2 A;  1D1N A;  1BQE A;  2VNH A;  2X0K A;  2ZBV A;  4DQL A;  4IW3 B;  2F1M A;  1EFR A;  2DOG A;  3LNN A;  1N06 A;  1WOP A;  4Y7C A;  2XZP A;  2BMW A;  2VJJ A;  3HAG A;  3AVV A;  3VNV A;  2BGJ A;  4PC1 A;  2QTL A;  1K8A D;  4H9G A;  2X3U A;  2KVO A;  2JIZ A;  4DNR B;  3CES A;  4B48 A;  4X0C A;  5LMZ A;  1KJZ A;  3CCL B;  2CND A;  2D9R A;  4TMW A;  2YWG A;  5IYQ A;  3E20 A;  4ACB A;  2B5O A;  4Z4W A;  1G7R A;  1VF7 A;  2GK7 A;  1QG0 A;  5GV7 A;  1VHE A;  2R9V A;  3JQQ A;  3WQZ A;  1WTH D;  4M4S A;  4ZCI A;  1KTV A;  4X7D A;  4G7W A;  5IK2 A;  1QVF B;  2DER A;  1KC8 D;  2GJP A;  3GVL A;  4K1X A;  4Z4S A;  2HMA A;  3DDY A;  4ROX A;  1KK2 A;  2XND A;  4WZK A;  4B3X A;  4U9U A;  1XQB A;  4WZL A;  4C0S A;  3BCD A;  1K28 D;  2GQF A;  4AF7 A;  5DSZ A;  1G7T A;  1W0K A;  1W9X A;  4DNT B;  3A35 A;  2VYQ A;  4RPB A;  4TKO B;  4EH1 A;  4PC7 A;  3CC2 B;  3OP1 A;  4PAA A;  2QDX A;  4XLF A;  1BMF A;  2QE7 A;  4YEJ A;  5FO1 A;  2DET A;  1T6Y A;  2RC5 A;  4RM0 A;  2QGG A;  2XEX A;  2C5B A;  2D74 A;  5HZA A;  3ZC3 A;  2ZTN A;  1QUF A;  1QGY A;  2OBS A;  1EXM A;  1EP1 B;  4M0L A;  3BNW A;  4LBV A;  4RCZ A;  2HCJ B;  1E64 A;  4N3N A;  4DK1 A;  1PJ6 A;  2W6J A;  1WOO A;  1KK0 A;  2XZO A;  3CPX A;  4PAB A;  4XN3 A;  4YAU A;  3CME B;  3CCM B;  3CCS B;  1KRH A;  4XLC A;  5E6T A;  4LBW A;  1KK3 A;  2VBV A;  3H94 A;  4DQK A;  4XOP A;  3PA1 A;  1WDT A;  1NJI D;  4QFM A;  5HKK A;  3FPK A;  3Q6Q A;  2ZL5 A;  1FNB A;  3CW2 A;  4LBZ A;  2ZIT A;  5FL7 A;  3LQE A;  1TVC A;  1EP2 B;  3OPO A;  1HZE A;  2QEX B;  3A8I A;  1VQ6 B;  4G5G A;  3CCE B;  4P26 A;  3J81 k;  2F4N A;  1Y0Y A;  5H5J A;  5IYP A;  1UD8 A;  4TMZ A;  2QA4 B;  1KD1 D;  2VBU A;  1KMH A;  5FO0 A;  5EMN A;  2WR8 A;  1QFY A;  1I8D A;  3ONU A;  4YEL A;  3OW2 B;  3OOC A;  4XR6 A;  3OW7 A;  4XQF A;  4YHB A;  2CW5 A;  1G7C A;  2V7V A;  1OHH A;  2WJY A;  4FN5 A;  4B3F X;  1VQP B;  2CK3 A;  4B3G A;  1GJR A;  3W5H A;  1VQL B;  1YLO A;  1DG1 G;  3U6K A;  3A1P A;  4RDL A;  1VHO A;  3JQP A;  1VLO A;  4XKW A;  1I7P A;  4HE6 A;  4Y9R A;  4WZE A;  2OYN A;  4M53 A;  3BQJ A;  1R5O A;  3MCA A;  2WZP P;  3W5U A;  3B78 A;  4XNF A;  5L46 A;  2Z6B D;  2ZBU A;  3OAA A;  1S0U A;  3RY8 A;  3Q38 A;  2XNC A;  1OB2 A;  1NDH A;  2B7C A;  1GAW A;  3W2E A;  3ASS A;  3WND A;  1BX1 A;  1WU8 A;  3I1F A;  2V7T A;  3KEW A;  5KW9 A;  1IJE A;  1TUI A;  3GQB A;  4QHY A;  1PJ7 A;  4RJL A;  1M90 D;  3V76 A;  4X7F A;  1W0J A;  2BV3 A;  1V0E A;  1ZM4 A;  4II3 A;  2C77 A;  4OPS A;  1WOR A;  3WXM A;  1W87 A;  1HVX A;  1F60 A;  1FRN A;  1FNM A;  2WSS A;  4G6I A;  3PUM A;  5IYN A;  2ZTG A;  3ONY A;  1E43 A;  2BVN A;  5BSX A;  3LQ6 A;  3V7A A;  5J35 A;  2VBS A;  2DCU A;  4OOV A;  4Y9U A;  3ZBT A;  4TMX A;  4QVA A;  4II2 A;  1N0U A;  3BY1 A;  3ZZT A;  2JDI A;  3OZW A;  4TMT A;  4XMY A;  5IYW A;  2ZXH A;  1VQ8 B;  2WZN A;  3CRZ A;  2X85 A;  1DDG A;  5TV2 A;  4P9S A;  3OKX A;  4RDJ A;  3OJX A;  3CP8 A;  4YAO A;  3W2F A;  1Q81 D;  1QVG B;  2CF4 A;  3OZV A;  1ZM9 A;  3A3B A;  3ZUG A;  1W34 A;  1Q7Y D;  1GO2 A;  5F4O A;  2WPD A;  4HE5 A;  4KKS A;  2GPJ A;  3WNB A;  1Y0R A;  2FX3 A;  4HIZ A;  4PC3 A;  4ZGQ B;  3GSI A;  3T51 B;  1UD4 A;  3VO1 A;  1VJS A;  4Z4Y A;  1E1Q A;  3OE7 A;  4RD6 A;  2ZZQ A;  5F4M A;  3CXC B;  3ZPN A;  4ZGN B;  2DYI A;  2FVG A;  1VQO B;  3G6E B;  1AMO A;  1COW A;  1VLY A;  3ASP A;  5TR9 A;  3CMA B;  1QX4 A;  4LBY A;  1DAR A;  4CQJ A;  2XZL A;  1W35 A;  3WY9 A;  2BM1 A;  1YJN B;  1SKQ A;  4X7C A;  2PE3 A;  4WQM A;  4RPD A;  3OZU A;  1EFU A;  2X53 S;  4MYU A;  1VQ5 B;  4OPO A;  1K9M D;  4WZT A;  3CC7 B;  4WWV A;  1MRZ A;  4XLH A;  1EFT A;  1OGI A;  2BGI A;  1NB9 A;  5F4J A;  3AVX A;  1UMK A;  4Z4V A;  5J3O A;  4C43 A;  2PIA A;  1P4M A;  2B7B A;  4OPV A;  4XL9 A;  1EFC A;  1EP3 B;  4X8I A;  1VQ4 B;  1DDI A;  1B23 P;  2EFG A;  5A8A A;  2OTL B;  4Z4U A;  3CB4 A;  3A8K A;  3SKB A;  1FRQ A;  1XFO A;  2DIE A;  4B47 A;  3T53 B;  1JA0 A;  1G7S A;  3SJP A;  3WBK A;  2EIX A;  3JQR A;  4P3I A;  1N05 A;  3VR6 A;  3SJZ A;  3QE2 A;  3ES9 A;  3CMM A;  2QN6 A;  1CNF A;  1TTT A;  4ASU A;  1QUE A;  4F7D A;  2BSA A;  4UZU A;  4DK0 A;  2QMU A;  1ZM3 A;  3PUN A;  3P26 A;  4Z1M A;  3H9N A;  1H85 A;  1ZUN B;  3P27 A;  4RD4 A;  1IJF A;  4TMV A;  4Z4R A;  1XE1 A;  1N07 A;  4P1V A;  1FX0 A;  4Z4T A;  1J9Z A;  4RD1 A;  1FNC A;  2ZZG A;  4P6V F;  1VQ7 B;  4P25 A;  3CCV B;  4FK8 A;  4OOX A;  3CCR B;  4QV2 A;  3AST A;  1YIT B;  1OB5 A;  5GV8 A;  1YX2 A;  3OJW A;  4M1K A;  2F43 A;  2XGJ A;  3CCU B;  2R6H A;  1OB0 A;  3MHP A;  3G4S B;  1GVH A;  1V0F A;  1JB9 A;  2YWH A;  3W2H A;  3CP2 A;  1F20 A;  2M5S A;  3B82 A;  3ZZU A;  2DEU A;  3SLN A;  1EWY A;  2YWE A;  3BH4 A;  1QFJ A;  2Q6O A;  2VJI A;  5HZB A;  1BLI A;  3VMF A;  4TN1 A;  1IHM A;  2Q6I A;  3BY2 A;  2VNK A;  1S4M A;  3KL9 A;  1VQN B;  1QH0 A;  2ZL6 A;  3QFS A;  3G05 A;  3QFR A;  3CC4 B;  4PGO A;  1ZM2 A;  5TRD A;  1YJ9 B;  3WBJ A;  1JA1 A;  4R71 A;  4P2N A;  3ZBU A;  5CDF A;  4XOR A;  3AVW A;  1UD6 A;  1WOS A;  2PLF A;  4YXW A;  1Q86 D;  1Q9S A;  2WYR A;  2GK6 A;  4UZE A;  1H42 A;  1YIJ B;  3FJO A;  1QFZ A;  1E63 A;  3WNC A;  2HLD A;  3AGP A;  3AVY A;  3Q39 A;  1E3X A;  3VNU A;  3CCQ B;  1JNY A;  1WSR A;  4GQN A;  4QVJ A;  3E1Y E;  5HXB A;  2P3M A;  4ACA A;  1M1K D;  1BPL A;  2BM0 A;  2GRE A;  1JJ2 B;  1I18 A;  4X06 A;  1U2R A;  4J0Q A;  4P6Y A;  1N08 A;  1AIP A;  3W2G A;  3PA2 A;  4XN0 A;  1FDR A;  4RD0 A;  1VQM B;  3LO8 A;  4KKT A;  4PC2 A;  4P3Y A;  1VQ9 B;  1E3Z A;  3PVD A;  4G1V A;  4M2L A;  5THX A;  1UD2 A;  2Q6L A;  1YJW B;  3AVT A;  3U2Q A; 
#chains in the Genus database with same CATH homology
 2NV4 A;  1XQB A;  3OKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...