2NV4A

Crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
133
structure length
133
Chain Sequence
MILKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWMDKASRDKLRVVPPGETEERGVFTTRSPSRPNPIGLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEIDCVNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0066 protein AF_0241
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 20
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01980 TrmO tRNA-methyltransferase O
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.70 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YaeB-like 2nv4A00
2NV4A 1XQBA 3OKXA
chains in the Genus database with same CATH superfamily
4YXWA 1S4MA 1SM4A 4QFMA 2ZL5A 4YALA 1NBMA 1G7TA 2C2WA 2J7KA 2ZTNA 1UMKA 2W6IA 4Q7JB 3MHPA 4RD3A 4PC6A 1WU8A 1VQ8B 2QDXA 4HE6A 4P2NA 3CXCB 4X8IA 1QX4A 1YHQB 4II3A 3LO8A 2VBUA 3ONUA 1VJSA 5LMZA 4EH1A 5TRDA 4XLFA 1VLYA 2I1LA 2VBTA 3R6KA 4HIZA 1WDTA 1TTTA 1E1QA 5TY0A 2QA4B 2QTZA 3AVYA 1EFTA 2F4NA 1OHHA 3B8HA 1GAQA 1KQSB 1IHMA 3CESA 3GSIA 4PC2A 1N07A 2VBSA 1QUEA 2GK7A 3W2GA 4ZV4A 1KZLA 2JDIA 4H9GA 3CMEB 1I8DA 4QVAA 4XLHA 2Q6LA 3T51B 1QGYA 1G7SA 1VLOA 4JMQA 1XQBA 1B23P 1ZM2A 2Q6KA 1VQMB 4G7XA 4DNRB 5H59A 5A89A 1W0JA 1FNBA 4B3FX 2D74A 1UD6A 3Q38A 2F43A 4TT3A 3U2QA 1EP3B 3MMPA 1Y0RA 4LBWA 4X7CA 3G6EB 3JU4A 3ASTA 4QV2A 1VQOB 3LNNA 2ZBVA 1H42A 4TSFA 3CW2A 2YWGA 3ZUGA 2GJRA 3JQQA 1ZUNB 3V76A 4G7WA 4X7FA 3U6BA 1MABA 1E3ZA 3OZUA 1UD4A 3LVBA 4KKUA 2V7UA 3KEWA 4Y9RA 4DQLA 4E0FA 4QVJA 5FO1A 1TUIA 4KKTA 2ZXHA 1DARA 1W0KA 3B78A 3I1FA 3A3BA 4Z4ZA 4C43A 3G4SB 1KC8D 1QVFB 1YITB 3OPOA 3VO2A 4XQFA 2GQFA 2VYQA 4LBYA 1R5BA 3HAGA 2GREA 2YWEA 1RQRA 4PABA 1N0VC 1T5EA 2QN6A 3SEJA 1IB0A 3RY8A 1EXMA 3A1PA 4YAFA 5BSXA 3WNDA 3VO1A 4WWVA 3CCMB 4X0CA 2Z6BD 2DCUA 1K28D 1FNCA 3BC9A 3CCSB 3PA2A 3W2IA 1W35A 1K8AD 5J3OA 4OPOA 3ZZUA 5DN6A 2ZTGA 4LC0A 1XFOA 5HKKA 4XM3A 1PJ5A 1V0FA 4RD4A 3CC4B 3QFSA 1E64A 5B6IA 4RPDA 3ONYA 3ZPNA 5KNLA 3ZBUA 4N3NA 2VJIA 4XLAA 4P25A 1BQEA 3A8IA 4XMYA 3V7AA 4UZFA 1BX1A 3KL9A 4FK8A 3BCDA 4P6VF 4UZEA 3H9NA 1WOOA 2WJVA 1OB5A 1VQ7B 1OB0A 5H5JA 1JA0A 1BPLA 1KK3A 2HMAA 3AVVA 3ISXA 1FRQA 1OB2A 2V7TA 1EP1B 3GQBA 4AF6A 3CCVB 3BY1A 3CD6B 3AVUA 2OK7A 1SKQA 4B44A 2EFGA 3OOCA 4ROXA 1VQ9B 4YAUA 3P26A 2GPJA 4AVZA 2VNJA 2BVNA 3Q3AA 4LBZA 4M1KA 2QMUA 2WR8A 2RC5A 3BCFA 5GV7A 2V7QA 2ZL6A 4N3GA 4RDJA 5FIUA 4RD0A 2BM1A 2LZJA 4LBVA 5F4OA 5IYQA 1SKYB 3A3GA 3ZZ0A 4TKOB 2V4DA 3WQZA 1WTHD 4ACBA 3SJZA 3PA1A 3ASPA 1T6ZA 4AF7A 1JA1A 2E1BA 1P4MA 4Z4VA 1T6YA 1EP2B 1VHEA 3QFCA 4G5GA 4YHBA 2QEXB 2Q6IA 3T53B 2DYIA 3W2HA 4P1VA 2X0KA 4DK1A 3G71B 2BM0A 3A35A 2C5BA 2BMWA 2JJ2A 3W5HA 4B43A 1BJKA 1KK0A 4TN1A 2JIZA 3SJPA 4P12A 4ZGQB 1N0UA 1QUFA 2HLDA 3BQJA 3OE7A 1FX0A 4XKVA 3J81k 3Q6RA 4MYUA 2C77A 1FDRA 2BN4A 4XOTA 2C5HA 1U2RA 5A88A 4BPRA 4HE5A 1UD3A 2QTLA 2X6XA 2ZBUA 3OEHA 4MYTA 5TR9A 3U6KA 1YX2A 1PKVA 3W2FA 1K9MD 2DERA 1QFYA 2BV3A 2ZZEA 1YIJB 1VQLB 4Z1MA 3AVTA 2ZL7A 1A8PA 3JQPA 4TMZA 1H85A 2CRVA 2ZITA 4M2LA 2BF4A 2NV4A 4X7DA 1FNDA 3ZC3A 4XOPA 1NRKA 4G6IA 5AN9A 4F7DA 2BPOA 4NCNA 4DQKA 1N05A 2OTJB 3VNVA 1VHOA 2JN9A 1ZM9A 2GK6A 4PGOA 2OK8A 4Z4TA 4Z4RA 1HVXA 4TMTA 3SLDA 1Y0YA 4R71A 2V7WA 3WYAA 3CCLB 3OEEA 5FNZA 1COWA 2ZZFA 3GVKA 4WZKA 2XZLA 1ZM4A 4UAJA 3LQ6A 3AVXA 1N06A 4RJLA 4ZCLA 3DDYA 1NB0A 1EFCA 3FPPA 3CMMA 1QFZA 4P9SA 2OBTA 5FA6A 3WY9A 1GAWA 3CCQB 2OBSA 1VQKB 3OFNA 3Q6QA 3H94A 4DNTB 5EMNA 1CNEA 1AIPA 2R6HA 3PVDA 4L8JA 2VNHA 1W34A 2XOKA 1W9XA 3VR6A 3ASSA 2OTLB 1V5VA 5FO0A 1H8EA 4B3XA 1BMFA 1DDGA 2XNJA 4QUZA 4WZEA 5BSYA 1HZEA 3R6JA 1M90D 1BX0A 3BNWA 3FPKA 3OW2B 3WBKA 4PAAA 4P3IA 3FJOA 3ZBTA 3CCJB 4XLCA 2P3MA 3ZZTA 1E63A 1QFJA 3GVLA 2X53S 4OPSA 4PC1A 4X06A 3AGQA 3LQEA 3AVWA 4B3GA 1RQPA 3OAAA 4XNFA 2X3UA 3JQRA 3B82A 3Q39A 1TLLA 4B4DA 1UD2A 3OJXA 3QFRA 1QGAA 1M1KD 3ES9A 3ASQA 5HZBA 2XGJA 3CCEB 1VQ4B 4RD1A 3PUNA 2W6JA 2B7BA 2DIEA 3W5UA 2CF4A 5JBQA 1D2EA 2EIXA 2ZXIA 5F4MA 2AHOA 1Q81D 1KTVA 4Z4WA 1NDHA 1F60A 1JB9A 4DK0A 3OW7A 2QGGA 3ASRA 5IYWA 1OGJA 1NJID 4X7EA 4J0QA 3VNUA 4ZGNB 4XD7A 1DDIA 2M5SA 4WQMA 4ASUA 4C0SA 3CB4A 2WYRA 4XONA 4YEJA 1VQ5B 2KVOA 2PMDA 4M4SA 1S72B 2XZOA 4PC3A 5DS0A 2DY1A 2WSSA 1NB9A 1XB2A 2PIAA 2VZLA 2XZPA 3CTAA 4OPVA 3E20A 4G1VA 4YAWA 1ZM3A 1N8RD 3CPWB 4XN3A 2Q6OA 2WJYA 4RD6A 3CRZA 3OZVA 2B7CA 4B47A 1CNFA 1N08A 1EFUA 2YWFA 4B48A 3OZWA 1FRNA 2X6WA 3BY2A 3WBJA 2OBRA 4K1XA 5CDFA 3A8KA 1E3XA 3PUMA 3QE2A 5HXBA 4NNJA 5TV2A 5E6TA 3CC2B 2E1RA 1T6XA 4KKSA 4XR6A 2XNCA 3BH4A 4XKWA 1GR1A 2GJKA 2CBXA 3CMAB 1V0EA 2WZNA 4XN0A 5KSWB 1GJRA 1MRZA 1JNYA 1IJFA 1E62A 4OOSA 3WNCA 2D9RA 4XORA 4TMVA 4U9UA 2D3NA 3VMFA 4QHYA 4Z4SA 1Q86D 2CNDA 1QVGB 1UD8A 2F1MA 4TMWA 1AMOA 3CCRB 3D26A 4RCZA 5THXA 4P26A 1R5OA 1E79A 1B2RA 4P22A 3AGPA 2F1LA 4UZUA 2V31A 4AC9A 2DEUA 2WZPP 4RD2A 1WP6A 1K73D 1YLOA 2BGIA 2VNKA 2CC2A 5DSZA 1W2BB 1KD1D 1YI2B 2BSAA 4RPBA 1J9ZA 1GVHA 4TMXA 4P6YA 4ZCMA 1Q9SA 1YJNB 2HDNB 2JJ1A 1E43A 1Q7YD 3FKSA 1YJWB 2XEXA 1GO2A 4PC7A 3SKBA 1WPCA 4OP7A 1EWYA 2D3LA 3GIRA 4II2A 4YAOA 3T56B 3ZIAA 1ELOA 1Q82D 4WZTA 1H8HA 4RCYA 2V7VA 2C78A 4OOXA 1KJZA 1KK1A 4RM0A 1PJ6A 2CK3A 4OOVA 3G05A 5IK2A 1OGIA 2C4UA 1UD5A 4RDKA 2QE7A 2HCJB 1D8TA 4Z4UA 3I56B 1WSRA 5FL7A 5IYNA 1WSVA 3PENA 4CQJA 4M53A 1R5NA 2GJPA 4G1BA 3SLNA 3I55B 5F4JA 4X05A 2OYNA 2PE3A 2VJJA 3A8JA 3OKXA 5GV8A 4X07A 2PLFA 3CPXA 3P27A 1DG1G 2C4TA 4Y7CA 1VQNB 1WORA 1EFRA 2WPDA 1I7PA 2X8KA 1I18A 2DOGA 2FVGA 4FWTA 1W87A 4WZLA 3QFTA 3OJWA 2XNDA 4Y9UA 4RLZA 3QSYA 4XL9A 3OP1A 4FXUA 3E1YE 1F20A 3W2EA 4FN5A 5A8AA 4Z4YA 1XE1A 2VBVA 5HZAA 2VNIA 3CCUB 2DETA 5IYRA 2NPFA 3NE5B 3CC7B 4RDLA 1QG0A 3CP2A 4P3YA 2V7XA 1KMHA 1QGZA 5IYPA 2X85A 1IJEA 1G7RA 3CP8A 3WNBA 3MCAA 4GQNA 1WOSA 1VF7A 2YWHA 1PJ7A 1G7CA 1CQXA 4YELA 2RC6A 3GVJA 2FX3A 2ZZGA 5KW9A 1JJ2B 1VQPB 1QH0A 2ZZQA 1TVCA 3W5VA 2CW5A 1KK2A 5L46A 3WXMA 1VQ6B 1D1NA 4ACAA 4M0LA 4XLEA 2R9VA 1KRHA 4NBSA 1BLIA 2BGJA 1FNMA 1HA3A 4IW3B 1YJ9B 5J35A 1WOPA 2X6YA 1E1RA 1S0UA 4ZCIA 2B5OA
chains in the Genus database with same CATH topology
2NV4A 1XQBA 3OKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NV4 A;  1XQB A;  3OKX A; 
#chains in the Genus database with same CATH topology
 4YXW A;  1S4M A;  1SM4 A;  4QFM A;  2ZL5 A;  4YAL A;  1NBM A;  1G7T A;  2C2W A;  2J7K A;  2ZTN A;  1UMK A;  2W6I A;  4Q7J B;  3MHP A;  4RD3 A;  4PC6 A;  1WU8 A;  1VQ8 B;  2QDX A;  4HE6 A;  4P2N A;  3CXC B;  4X8I A;  1QX4 A;  1YHQ B;  4II3 A;  3LO8 A;  2VBU A;  3ONU A;  1VJS A;  5LMZ A;  4EH1 A;  5TRD A;  4XLF A;  1VLY A;  2I1L A;  2VBT A;  3R6K A;  4HIZ A;  1WDT A;  1TTT A;  1E1Q A;  5TY0 A;  2QA4 B;  2QTZ A;  3AVY A;  1EFT A;  2F4N A;  1OHH A;  3B8H A;  1GAQ A;  1KQS B;  1IHM A;  3CES A;  3GSI A;  4PC2 A;  1N07 A;  2VBS A;  1QUE A;  2GK7 A;  3W2G A;  4ZV4 A;  1KZL A;  2JDI A;  4H9G A;  3CME B;  1I8D A;  4QVA A;  4XLH A;  2Q6L A;  3T51 B;  1QGY A;  1G7S A;  1VLO A;  4JMQ A;  1XQB A;  1B23 P;  1ZM2 A;  2Q6K A;  1VQM B;  4G7X A;  4DNR B;  5H59 A;  5A89 A;  1W0J A;  1FNB A;  4B3F X;  2D74 A;  1UD6 A;  3Q38 A;  2F43 A;  4TT3 A;  3U2Q A;  1EP3 B;  3MMP A;  1Y0R A;  4LBW A;  4X7C A;  3G6E B;  3JU4 A;  3AST A;  4QV2 A;  1VQO B;  3LNN A;  2ZBV A;  1H42 A;  4TSF A;  3CW2 A;  2YWG A;  3ZUG A;  2GJR A;  3JQQ A;  1ZUN B;  3V76 A;  4G7W A;  4X7F A;  3U6B A;  1MAB A;  1E3Z A;  3OZU A;  1UD4 A;  3LVB A;  4KKU A;  2V7U A;  3KEW A;  4Y9R A;  4DQL A;  4E0F A;  4QVJ A;  5FO1 A;  1TUI A;  4KKT A;  2ZXH A;  1DAR A;  1W0K A;  3B78 A;  3I1F A;  3A3B A;  4Z4Z A;  4C43 A;  3G4S B;  1KC8 D;  1QVF B;  1YIT B;  3OPO A;  3VO2 A;  4XQF A;  2GQF A;  2VYQ A;  4LBY A;  1R5B A;  3HAG A;  2GRE A;  2YWE A;  1RQR A;  4PAB A;  1N0V C;  1T5E A;  2QN6 A;  3SEJ A;  1IB0 A;  3RY8 A;  1EXM A;  3A1P A;  4YAF A;  5BSX A;  3WND A;  3VO1 A;  4WWV A;  3CCM B;  4X0C A;  2Z6B D;  2DCU A;  1K28 D;  1FNC A;  3BC9 A;  3CCS B;  3PA2 A;  3W2I A;  1W35 A;  1K8A D;  5J3O A;  4OPO A;  3ZZU A;  5DN6 A;  2ZTG A;  4LC0 A;  1XFO A;  5HKK A;  4XM3 A;  1PJ5 A;  1V0F A;  4RD4 A;  3CC4 B;  3QFS A;  1E64 A;  5B6I A;  4RPD A;  3ONY A;  3ZPN A;  5KNL A;  3ZBU A;  4N3N A;  2VJI A;  4XLA A;  4P25 A;  1BQE A;  3A8I A;  4XMY A;  3V7A A;  4UZF A;  1BX1 A;  3KL9 A;  4FK8 A;  3BCD A;  4P6V F;  4UZE A;  3H9N A;  1WOO A;  2WJV A;  1OB5 A;  1VQ7 B;  1OB0 A;  5H5J A;  1JA0 A;  1BPL A;  1KK3 A;  2HMA A;  3AVV A;  3ISX A;  1FRQ A;  1OB2 A;  2V7T A;  1EP1 B;  3GQB A;  4AF6 A;  3CCV B;  3BY1 A;  3CD6 B;  3AVU A;  2OK7 A;  1SKQ A;  4B44 A;  2EFG A;  3OOC A;  4ROX A;  1VQ9 B;  4YAU A;  3P26 A;  2GPJ A;  4AVZ A;  2VNJ A;  2BVN A;  3Q3A A;  4LBZ A;  4M1K A;  2QMU A;  2WR8 A;  2RC5 A;  3BCF A;  5GV7 A;  2V7Q A;  2ZL6 A;  4N3G A;  4RDJ A;  5FIU A;  4RD0 A;  2BM1 A;  2LZJ A;  4LBV A;  5F4O A;  5IYQ A;  1SKY B;  3A3G A;  3ZZ0 A;  4TKO B;  2V4D A;  3WQZ A;  1WTH D;  4ACB A;  3SJZ A;  3PA1 A;  3ASP A;  1T6Z A;  4AF7 A;  1JA1 A;  2E1B A;  1P4M A;  4Z4V A;  1T6Y A;  1EP2 B;  1VHE A;  3QFC A;  4G5G A;  4YHB A;  2QEX B;  2Q6I A;  3T53 B;  2DYI A;  3W2H A;  4P1V A;  2X0K A;  4DK1 A;  3G71 B;  2BM0 A;  3A35 A;  2C5B A;  2BMW A;  2JJ2 A;  3W5H A;  4B43 A;  1BJK A;  1KK0 A;  4TN1 A;  2JIZ A;  3SJP A;  4P12 A;  4ZGQ B;  1N0U A;  1QUF A;  2HLD A;  3BQJ A;  3OE7 A;  1FX0 A;  4XKV A;  3J81 k;  3Q6R A;  4MYU A;  2C77 A;  1FDR A;  2BN4 A;  4XOT A;  2C5H A;  1U2R A;  5A88 A;  4BPR A;  4HE5 A;  1UD3 A;  2QTL A;  2X6X A;  2ZBU A;  3OEH A;  4MYT A;  5TR9 A;  3U6K A;  1YX2 A;  1PKV A;  3W2F A;  1K9M D;  2DER A;  1QFY A;  2BV3 A;  2ZZE A;  1YIJ B;  1VQL B;  4Z1M A;  3AVT A;  2ZL7 A;  1A8P A;  3JQP A;  4TMZ A;  1H85 A;  2CRV A;  2ZIT A;  4M2L A;  2BF4 A;  2NV4 A;  4X7D A;  1FND A;  3ZC3 A;  4XOP A;  1NRK A;  4G6I A;  5AN9 A;  4F7D A;  2BPO A;  4NCN A;  4DQK A;  1N05 A;  2OTJ B;  3VNV A;  1VHO A;  2JN9 A;  1ZM9 A;  2GK6 A;  4PGO A;  2OK8 A;  4Z4T A;  4Z4R A;  1HVX A;  4TMT A;  3SLD A;  1Y0Y A;  4R71 A;  2V7W A;  3WYA A;  3CCL B;  3OEE A;  5FNZ A;  1COW A;  2ZZF A;  3GVK A;  4WZK A;  2XZL A;  1ZM4 A;  4UAJ A;  3LQ6 A;  3AVX A;  1N06 A;  4RJL A;  4ZCL A;  3DDY A;  1NB0 A;  1EFC A;  3FPP A;  3CMM A;  1QFZ A;  4P9S A;  2OBT A;  5FA6 A;  3WY9 A;  1GAW A;  3CCQ B;  2OBS A;  1VQK B;  3OFN A;  3Q6Q A;  3H94 A;  4DNT B;  5EMN A;  1CNE A;  1AIP A;  2R6H A;  3PVD A;  4L8J A;  2VNH A;  1W34 A;  2XOK A;  1W9X A;  3VR6 A;  3ASS A;  2OTL B;  1V5V A;  5FO0 A;  1H8E A;  4B3X A;  1BMF A;  1DDG A;  2XNJ A;  4QUZ A;  4WZE A;  5BSY A;  1HZE A;  3R6J A;  1M90 D;  1BX0 A;  3BNW A;  3FPK A;  3OW2 B;  3WBK A;  4PAA A;  4P3I A;  3FJO A;  3ZBT A;  3CCJ B;  4XLC A;  2P3M A;  3ZZT A;  1E63 A;  1QFJ A;  3GVL A;  2X53 S;  4OPS A;  4PC1 A;  4X06 A;  3AGQ A;  3LQE A;  3AVW A;  4B3G A;  1RQP A;  3OAA A;  4XNF A;  2X3U A;  3JQR A;  3B82 A;  3Q39 A;  1TLL A;  4B4D A;  1UD2 A;  3OJX A;  3QFR A;  1QGA A;  1M1K D;  3ES9 A;  3ASQ A;  5HZB A;  2XGJ A;  3CCE B;  1VQ4 B;  4RD1 A;  3PUN A;  2W6J A;  2B7B A;  2DIE A;  3W5U A;  2CF4 A;  5JBQ A;  1D2E A;  2EIX A;  2ZXI A;  5F4M A;  2AHO A;  1Q81 D;  1KTV A;  4Z4W A;  1NDH A;  1F60 A;  1JB9 A;  4DK0 A;  3OW7 A;  2QGG A;  3ASR A;  5IYW A;  1OGJ A;  1NJI D;  4X7E A;  4J0Q A;  3VNU A;  4ZGN B;  4XD7 A;  1DDI A;  2M5S A;  4WQM A;  4ASU A;  4C0S A;  3CB4 A;  2WYR A;  4XON A;  4YEJ A;  1VQ5 B;  2KVO A;  2PMD A;  4M4S A;  1S72 B;  2XZO A;  4PC3 A;  5DS0 A;  2DY1 A;  2WSS A;  1NB9 A;  1XB2 A;  2PIA A;  2VZL A;  2XZP A;  3CTA A;  4OPV A;  3E20 A;  4G1V A;  4YAW A;  1ZM3 A;  1N8R D;  3CPW B;  4XN3 A;  2Q6O A;  2WJY A;  4RD6 A;  3CRZ A;  3OZV A;  2B7C A;  4B47 A;  1CNF A;  1N08 A;  1EFU A;  2YWF A;  4B48 A;  3OZW A;  1FRN A;  2X6W A;  3BY2 A;  3WBJ A;  2OBR A;  4K1X A;  5CDF A;  3A8K A;  1E3X A;  3PUM A;  3QE2 A;  5HXB A;  4NNJ A;  5TV2 A;  5E6T A;  3CC2 B;  2E1R A;  1T6X A;  4KKS A;  4XR6 A;  2XNC A;  3BH4 A;  4XKW A;  1GR1 A;  2GJK A;  2CBX A;  3CMA B;  1V0E A;  2WZN A;  4XN0 A;  5KSW B;  1GJR A;  1MRZ A;  1JNY A;  1IJF A;  1E62 A;  4OOS A;  3WNC A;  2D9R A;  4XOR A;  4TMV A;  4U9U A;  2D3N A;  3VMF A;  4QHY A;  4Z4S A;  1Q86 D;  2CND A;  1QVG B;  1UD8 A;  2F1M A;  4TMW A;  1AMO A;  3CCR B;  3D26 A;  4RCZ A;  5THX A;  4P26 A;  1R5O A;  1E79 A;  1B2R A;  4P22 A;  3AGP A;  2F1L A;  4UZU A;  2V31 A;  4AC9 A;  2DEU A;  2WZP P;  4RD2 A;  1WP6 A;  1K73 D;  1YLO A;  2BGI A;  2VNK A;  2CC2 A;  5DSZ A;  1W2B B;  1KD1 D;  1YI2 B;  2BSA A;  4RPB A;  1J9Z A;  1GVH A;  4TMX A;  4P6Y A;  4ZCM A;  1Q9S A;  1YJN B;  2HDN B;  2JJ1 A;  1E43 A;  1Q7Y D;  3FKS A;  1YJW B;  2XEX A;  1GO2 A;  4PC7 A;  3SKB A;  1WPC A;  4OP7 A;  1EWY A;  2D3L A;  3GIR A;  4II2 A;  4YAO A;  3T56 B;  3ZIA A;  1ELO A;  1Q82 D;  4WZT A;  1H8H A;  4RCY A;  2V7V A;  2C78 A;  4OOX A;  1KJZ A;  1KK1 A;  4RM0 A;  1PJ6 A;  2CK3 A;  4OOV A;  3G05 A;  5IK2 A;  1OGI A;  2C4U A;  1UD5 A;  4RDK A;  2QE7 A;  2HCJ B;  1D8T A;  4Z4U A;  3I56 B;  1WSR A;  5FL7 A;  5IYN A;  1WSV A;  3PEN A;  4CQJ A;  4M53 A;  1R5N A;  2GJP A;  4G1B A;  3SLN A;  3I55 B;  5F4J A;  4X05 A;  2OYN A;  2PE3 A;  2VJJ A;  3A8J A;  3OKX A;  5GV8 A;  4X07 A;  2PLF A;  3CPX A;  3P27 A;  1DG1 G;  2C4T A;  4Y7C A;  1VQN B;  1WOR A;  1EFR A;  2WPD A;  1I7P A;  2X8K A;  1I18 A;  2DOG A;  2FVG A;  4FWT A;  1W87 A;  4WZL A;  3QFT A;  3OJW A;  2XND A;  4Y9U A;  4RLZ A;  3QSY A;  4XL9 A;  3OP1 A;  4FXU A;  3E1Y E;  1F20 A;  3W2E A;  4FN5 A;  5A8A A;  4Z4Y A;  1XE1 A;  2VBV A;  5HZA A;  2VNI A;  3CCU B;  2DET A;  5IYR A;  2NPF A;  3NE5 B;  3CC7 B;  4RDL A;  1QG0 A;  3CP2 A;  4P3Y A;  2V7X A;  1KMH A;  1QGZ A;  5IYP A;  2X85 A;  1IJE A;  1G7R A;  3CP8 A;  3WNB A;  3MCA A;  4GQN A;  1WOS A;  1VF7 A;  2YWH A;  1PJ7 A;  1G7C A;  1CQX A;  4YEL A;  2RC6 A;  3GVJ A;  2FX3 A;  2ZZG A;  5KW9 A;  1JJ2 B;  1VQP B;  1QH0 A;  2ZZQ A;  1TVC A;  3W5V A;  2CW5 A;  1KK2 A;  5L46 A;  3WXM A;  1VQ6 B;  1D1N A;  4ACA A;  4M0L A;  4XLE A;  2R9V A;  1KRH A;  4NBS A;  1BLI A;  2BGJ A;  1FNM A;  1HA3 A;  4IW3 B;  1YJ9 B;  5J35 A;  1WOP A;  2X6Y A;  1E1R A;  1S0U A;  4ZCI A;  2B5O A; 
#chains in the Genus database with same CATH homology
 2NV4 A;  1XQB A;  3OKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...