2NV4A

Crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
133
structure length
133
Chain Sequence
MILKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWMDKASRDKLRVVPPGETEERGVFTTRSPSRPNPIGLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEIDCVNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0066 protein AF_0241
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 20
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01980 TrmO tRNA-methyltransferase O
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.70 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YaeB-like 2nv4A00
3OKXA 2NV4A 1XQBA
chains in the Genus database with same CATH superfamily
3GIRA 1CNFA 4PC1A 2YWFA 1TVCA 2GK7A 1N8RD 1G7CA 4Q7JB 1F60A 4UZFA 2W6JA 4LC0A 2YWHA 2HLDA 3ASRA 3CRZA 2OYNA 1DDIA 5F4OA 2XEXA 2ZL5A 4DQKA 2CRVA 3BY1A 3ZZUA 3CESA 4B3FX 1Q86D 4H9GA 2XZOA 3ONYA 4Z4WA 1NB0A 4P26A 3AVVA 4X7DA 1T6ZA 2M5SA 3KEWA 4DK1A 3G05A 3JQRA 2YWEA 4ZCLA 2CBXA 4XLFA 4YAUA 3ZPNA 4B47A 2XNCA 4QHYA 2XZPA 4OPOA 2C5BA 5J3OA 1W2BB 1VLYA 1VQPB 2EIXA 3Q6QA 3G71B 1SKYB 2VBTA 3VO1A 2DERA 5HKKA 4KKUA 1QG0A 2JN9A 4RD0A 3ZZ0A 2C4TA 1TLLA 1IB0A 2FX3A 4XOPA 1V0FA 1COWA 1E3ZA 3A8IA 3MMPA 3A3BA 4NCNA 1ELOA 3AGQA 5IYWA 2D3NA 3ZBUA 1FX0A 3BQJA 1I18A 1D8TA 3CCUB 4LBWA 4XOTA 2FVGA 1WORA 1JA0A 4X06A 1F20A 3WNCA 3CC4B 3GQBA 1KC8D 3G4SB 5L46A 5TRDA 1E1RA 1GR1A 2ZZGA 4FK8A 5FIUA 4WZTA 1GJRA 2B7BA 1JA1A 3OPOA 3ES9A 5JBQA 1BX1A 1SKQA 4M1KA 3I56B 1V0EA 3OOCA 3WY9A 1NRKA 1KD1D 4X07A 3ISXA 5LMZA 3ZC3A 2JIZA 1VQ4B 3ASPA 4B48A 5H5JA 3WNBA 2C2WA 3FJOA 2VBSA 3CTAA 4PC3A 3SKBA 3GVJA 1A8PA 4ZCIA 4EH1A 3BCDA 1YIJB 1VQ9B 4OOXA 2V7TA 3W5VA 5HZBA 4TKOB 2C4UA 2GREA 1EWYA 3AGPA 2GK6A 4G1BA 3PA1A 4LBZA 4Z4TA 1R5OA 3FPPA 3HAGA 3A35A 1YITB 1FNMA 2X85A 4WZEA 4N3NA 1FRNA 3BC9A 2ZZQA 3A8JA 3ONUA 4XD7A 4TMTA 4ACAA 3CCEB 1BLIA 2R9VA 3VR6A 4QVAA 3SJZA 4F7DA 1YJ9B 5A8AA 1UMKA 4HE6A 4XLCA 1WTHD 1D1NA 5CDFA 4QV2A 1NDHA 1JB9A 4B4DA 2Q6OA 2V31A 1I7PA 2Q6IA 1QVGB 3SJPA 2V7WA 1Y0YA 5EMNA 1IJFA 4ZV4A 2ZXIA 1YHQB 2F1MA 1YLOA 2Q6LA 4HE5A 2CC2A 2XNDA 4HIZA 2DOGA 1UD6A 4B3XA 4Z4ZA 3I55B 2RC6A 1ZM2A 2EFGA 3CW2A 2D74A 4XN3A 2ZXHA 3AVXA 3W5HA 4Y9RA 1KJZA 1E1QA 3LO8A 1Q82D 1EFCA 3CXCB 4P6VF 1EFTA 4XONA 1W34A 4G7XA 1R5NA 3B8HA 1N0VC 3PA2A 4P22A 5TV2A 4ZGNB 1EFRA 4XNFA 2QTLA 4DNRB 2X0KA 5FO0A 4LBVA 5KNLA 4TMVA 2WPDA 2DIEA 5BSYA 1KTVA 1M90D 4RPBA 1QVFB 3RY8A 1VQOB 4LBYA 5E6TA 1IHMA 5HXBA 2OTLB 4M53A 1UD5A 1BQEA 1UD3A 3OEEA 2C77A 3CD6B 4XKWA 3Q38A 1TUIA 2F1LA 1QFJA 5DN6A 4YAWA 1ZUNB 4BPRA 4L8JA 3H94A 4ZGQB 1VQKB 1KZLA 3ZBTA 1VLOA 1OB2A 2B7CA 2E1BA 1G7RA 1GAQA 2VNIA 3PUNA 4CQJA 3CC2B 2V7XA 3P27A 1S72B 3FPKA 3PVDA 4J0QA 2KVOA 5B6IA 2YWGA 1QGAA 1OHHA 3GVKA 3W2HA 5HZAA 5TY0A 4YELA 4QUZA 4AVZA 5J35A 4OP7A 4RM0A 1HVXA 3BY2A 3OJXA 3U2QA 3CMAB 2VNKA 1CQXA 3ZZTA 4C0SA 3T56B 1KRHA 2PMDA 2X8KA 4RPDA 2BM1A 1I8DA 5IYRA 3DDYA 3P26A 4KKSA 4RD6A 3WYAA 4MYUA 1BMFA 3Q39A 4MYTA 1T6XA 4TN1A 3OW7A 3OEHA 1XE1A 4KKTA 2F43A 4E0FA 1E62A 3CMEB 1CNEA 5H59A 1PJ6A 4XLAA 2ZTNA 3Q6RA 4RDLA 4X05A 4PABA 3SLNA 3W2IA 2X3UA 4OOVA 3OW2B 1SM4A 1YJNB 1XB2A 2ZL7A 4G6IA 3KL9A 4X0CA 1H8EA 2I1LA 2AHOA 1WOPA 4II2A 2V4DA 2QN6A 4QVJA 1T5EA 4UAJA 1KK1A 5IYPA 1YI2B 4II3A 4WZLA 1B2RA 2PIAA 1E64A 2VYQA 2D9RA 3U6BA 4N3GA 4G7WA 3ASTA 2NPFA 1QUEA 1Q9SA 3CCVB 3QE2A 3VNUA 2B5OA 4X7FA 1VQ5B 2VJJA 4XMYA 4AF6A 4XORA 3GVLA 5FO1A 4WZKA 3CCLB 3R6JA 1VQ7B 1KK3A 1VQ6B 3QFTA 4XR6A 3CC7B 2R6HA 4YXWA 1WOOA 2OBRA 2HCJB 1FRQA 5KW9A 1B23P 4FWTA 3AVUA 3JQPA 4Z1MA 1WSRA 1VHEA 2WZNA 1VQ8B 4RDKA 3CCMB 4Y9UA 2X53S 2LZJA 3W2EA 5IYNA 1E63A 4TMZA 3B82A 4XN0A 2QDXA 4TT3A 3H9NA 4R71A 2VBVA 2HMAA 1K73D 4P3IA 1KQSB 4P25A 5FNZA 2WYRA 4PC6A 4UZUA 2NV4A 1DARA 2GQFA 4OPVA 3CPWB 3WXMA 2ZBUA 3PENA 3V76A 2DEUA 1GAWA 1QFYA 1OGIA 1PJ7A 4K1XA 3AVYA 5GV7A 1EP1B 1H42A 3A3GA 1DG1G 3E1YE 3U6KA 2P3MA 3WBJA 3VNVA 4RDJA 1QH0A 2BM0A 3ASQA 3OKXA 1VHOA 2QA4B 3QSYA 1K28D 2BVNA 1EP3B 2V7QA 2OK8A 5GV8A 1W0JA 3QFRA 4P6YA 1AIPA 2ZBVA 5DSZA 5A88A 3CCSB 2CNDA 2ZZFA 4PAAA 5KSWB 1W35A 1Q7YD 4Z4YA 3PUMA 3V7AA 1OGJA 3FKSA 3CP8A 4B43A 3D26A 3MCAA 3CPXA 1V5VA 1QFZA 1Y0RA 1S4MA 3JU4A 2WZPP 1FNCA 1RQPA 1XQBA 1Q81D 4Z4RA 2Q6KA 2CK3A 1W9XA 2HDNB 2BSAA 4GQNA 1GVHA 1KK0A 1KK2A 2GPJA 5AN9A 3B78A 2OBTA 3A1PA 5IK2A 3A8KA 1XFOA 1YJWB 1PJ5A 3OZUA 1T6YA 3JQQA 1NJID 2WSSA 1W0KA 3WNDA 2F4NA 4X8IA 3CCJB 2W6IA 2DCUA 3OE7A 2GJPA 4XKVA 1H8HA 3CP2A 2JJ2A 2VZLA 4PC2A 5THXA 4X7CA 2ZTGA 2CW5A 4X7EA 4XLHA 1S0UA 3CCQB 2ZITA 4WWVA 1N05A 3R6KA 3BCFA 4NNJA 1VJSA 4IW3B 1BPLA 3OFNA 2BGJA 1FNDA 1JNYA 1QGYA 4PC7A 4QFMA 1R5BA 2WJYA 2VBUA 5DS0A 3LVBA 3QFSA 1P4MA 1UD4A 5BSXA 2JJ1A 2XGJA 1VQLB 1K8AD 4RD1A 4M2LA 1E3XA 1HA3A 1PKVA 1M1KD 1WDTA 3CB4A 4OPSA 4Y7CA 1ZM4A 2WJVA 4WQMA 2J7KA 4Z4SA 1N07A 1GO2A 1WU8A 1WPCA 3MHPA 3CCRB 1WP6A 2QTZA 4P12A 3VO2A 2ZZEA 4TMWA 5F4JA 3SLDA 4RD3A 4XL9A 2JDIA 3CMMA 3LNNA 1MRZA 4FN5A 2XZLA 2QEXB 3T51B 2VJIA 4M4SA 2GJRA 2Z6BD 1QUFA 1G7TA 2XNJA 3OZWA 1D2EA 3G6EB 1HZEA 1JJ2B 1VQNB 3ASSA 1W87A 3W5UA 2BPOA 4TSFA 3E20A 1H85A 4P9SA 2RC5A 3Q3AA 4C43A 1UD8A 5TR9A 4YALA 1E43A 1OB0A 1DDGA 3BH4A 1BJKA 1EFUA 3OJWA 4P2NA 1UD2A 3I1FA 4TMXA 4FXUA 1U2RA 4Z4VA 1MABA 1N0UA 1WSVA 4ROXA 2DETA 4XM3A 4AC9A 4ACBA 2OK7A 3LQ6A 2DY1A 1EXMA 1NBMA 1E79A 3VMFA 4G5GA 1VQMB 2C78A 1J9ZA 4U9UA 1AMOA 3AVTA 4P3YA 1EP2B 2VNHA 2VNJA 2BMWA 5A89A 5F4MA 3GSIA 4UZEA 3OAAA 1FNBA 1VF7A 4DK0A 1TTTA 2WR8A 3QFCA 1K9MD 3OP1A 2QE7A 4AF7A 4YAOA 2D3LA 5IYQA 4ASUA 4P1VA 4YHBA 2DYIA 3LQEA 4PGOA 1QGZA 3WQZA 4OOSA 5FL7A 4XQFA 1OB5A 1QX4A 1KMHA 2V7UA 4ZCMA 2PLFA 2CF4A 4G1VA 3T53B 3AVWA 2PE3A 4RCYA 3W2GA 4Z4UA 4DQLA 4NBSA 2X6YA 2ZL6A 4M0LA 2C5HA 2OTJB 1N08A 4DNTB 1N06A 2GJKA 2OBSA 1ZM9A 2BGIA 3NE5B 1BX0A 3BNWA 4RJLA 2BN4A 4RCZA 3SEJA 3W2FA 3OZVA 1FDRA 2X6WA 2XOKA 4YEJA 1IJEA 3ZUGA 2BF4A 3J81k 2BV3A 1NB9A 2QMUA 4JMQA 4B3GA 1ZM3A 3ZIAA 4RLZA 2X6XA 2V7VA 4RD2A 4XLEA 1RQRA 1YX2A 4RD4A 1WOSA 2QGGA 3WBKA 2E1RA 1G7SA 4B44A 5FA6A 4YAFA
chains in the Genus database with same CATH topology
3OKXA 2NV4A 1XQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKX A;  2NV4 A;  1XQB A; 
#chains in the Genus database with same CATH topology
 3GIR A;  1CNF A;  4PC1 A;  2YWF A;  1TVC A;  2GK7 A;  1N8R D;  1G7C A;  4Q7J B;  1F60 A;  4UZF A;  2W6J A;  4LC0 A;  2YWH A;  2HLD A;  3ASR A;  3CRZ A;  2OYN A;  1DDI A;  5F4O A;  2XEX A;  2ZL5 A;  4DQK A;  2CRV A;  3BY1 A;  3ZZU A;  3CES A;  4B3F X;  1Q86 D;  4H9G A;  2XZO A;  3ONY A;  4Z4W A;  1NB0 A;  4P26 A;  3AVV A;  4X7D A;  1T6Z A;  2M5S A;  3KEW A;  4DK1 A;  3G05 A;  3JQR A;  2YWE A;  4ZCL A;  2CBX A;  4XLF A;  4YAU A;  3ZPN A;  4B47 A;  2XNC A;  4QHY A;  2XZP A;  4OPO A;  2C5B A;  5J3O A;  1W2B B;  1VLY A;  1VQP B;  2EIX A;  3Q6Q A;  3G71 B;  1SKY B;  2VBT A;  3VO1 A;  2DER A;  5HKK A;  4KKU A;  1QG0 A;  2JN9 A;  4RD0 A;  3ZZ0 A;  2C4T A;  1TLL A;  1IB0 A;  2FX3 A;  4XOP A;  1V0F A;  1COW A;  1E3Z A;  3A8I A;  3MMP A;  3A3B A;  4NCN A;  1ELO A;  3AGQ A;  5IYW A;  2D3N A;  3ZBU A;  1FX0 A;  3BQJ A;  1I18 A;  1D8T A;  3CCU B;  4LBW A;  4XOT A;  2FVG A;  1WOR A;  1JA0 A;  4X06 A;  1F20 A;  3WNC A;  3CC4 B;  3GQB A;  1KC8 D;  3G4S B;  5L46 A;  5TRD A;  1E1R A;  1GR1 A;  2ZZG A;  4FK8 A;  5FIU A;  4WZT A;  1GJR A;  2B7B A;  1JA1 A;  3OPO A;  3ES9 A;  5JBQ A;  1BX1 A;  1SKQ A;  4M1K A;  3I56 B;  1V0E A;  3OOC A;  3WY9 A;  1NRK A;  1KD1 D;  4X07 A;  3ISX A;  5LMZ A;  3ZC3 A;  2JIZ A;  1VQ4 B;  3ASP A;  4B48 A;  5H5J A;  3WNB A;  2C2W A;  3FJO A;  2VBS A;  3CTA A;  4PC3 A;  3SKB A;  3GVJ A;  1A8P A;  4ZCI A;  4EH1 A;  3BCD A;  1YIJ B;  1VQ9 B;  4OOX A;  2V7T A;  3W5V A;  5HZB A;  4TKO B;  2C4U A;  2GRE A;  1EWY A;  3AGP A;  2GK6 A;  4G1B A;  3PA1 A;  4LBZ A;  4Z4T A;  1R5O A;  3FPP A;  3HAG A;  3A35 A;  1YIT B;  1FNM A;  2X85 A;  4WZE A;  4N3N A;  1FRN A;  3BC9 A;  2ZZQ A;  3A8J A;  3ONU A;  4XD7 A;  4TMT A;  4ACA A;  3CCE B;  1BLI A;  2R9V A;  3VR6 A;  4QVA A;  3SJZ A;  4F7D A;  1YJ9 B;  5A8A A;  1UMK A;  4HE6 A;  4XLC A;  1WTH D;  1D1N A;  5CDF A;  4QV2 A;  1NDH A;  1JB9 A;  4B4D A;  2Q6O A;  2V31 A;  1I7P A;  2Q6I A;  1QVG B;  3SJP A;  2V7W A;  1Y0Y A;  5EMN A;  1IJF A;  4ZV4 A;  2ZXI A;  1YHQ B;  2F1M A;  1YLO A;  2Q6L A;  4HE5 A;  2CC2 A;  2XND A;  4HIZ A;  2DOG A;  1UD6 A;  4B3X A;  4Z4Z A;  3I55 B;  2RC6 A;  1ZM2 A;  2EFG A;  3CW2 A;  2D74 A;  4XN3 A;  2ZXH A;  3AVX A;  3W5H A;  4Y9R A;  1KJZ A;  1E1Q A;  3LO8 A;  1Q82 D;  1EFC A;  3CXC B;  4P6V F;  1EFT A;  4XON A;  1W34 A;  4G7X A;  1R5N A;  3B8H A;  1N0V C;  3PA2 A;  4P22 A;  5TV2 A;  4ZGN B;  1EFR A;  4XNF A;  2QTL A;  4DNR B;  2X0K A;  5FO0 A;  4LBV A;  5KNL A;  4TMV A;  2WPD A;  2DIE A;  5BSY A;  1KTV A;  1M90 D;  4RPB A;  1QVF B;  3RY8 A;  1VQO B;  4LBY A;  5E6T A;  1IHM A;  5HXB A;  2OTL B;  4M53 A;  1UD5 A;  1BQE A;  1UD3 A;  3OEE A;  2C77 A;  3CD6 B;  4XKW A;  3Q38 A;  1TUI A;  2F1L A;  1QFJ A;  5DN6 A;  4YAW A;  1ZUN B;  4BPR A;  4L8J A;  3H94 A;  4ZGQ B;  1VQK B;  1KZL A;  3ZBT A;  1VLO A;  1OB2 A;  2B7C A;  2E1B A;  1G7R A;  1GAQ A;  2VNI A;  3PUN A;  4CQJ A;  3CC2 B;  2V7X A;  3P27 A;  1S72 B;  3FPK A;  3PVD A;  4J0Q A;  2KVO A;  5B6I A;  2YWG A;  1QGA A;  1OHH A;  3GVK A;  3W2H A;  5HZA A;  5TY0 A;  4YEL A;  4QUZ A;  4AVZ A;  5J35 A;  4OP7 A;  4RM0 A;  1HVX A;  3BY2 A;  3OJX A;  3U2Q A;  3CMA B;  2VNK A;  1CQX A;  3ZZT A;  4C0S A;  3T56 B;  1KRH A;  2PMD A;  2X8K A;  4RPD A;  2BM1 A;  1I8D A;  5IYR A;  3DDY A;  3P26 A;  4KKS A;  4RD6 A;  3WYA A;  4MYU A;  1BMF A;  3Q39 A;  4MYT A;  1T6X A;  4TN1 A;  3OW7 A;  3OEH A;  1XE1 A;  4KKT A;  2F43 A;  4E0F A;  1E62 A;  3CME B;  1CNE A;  5H59 A;  1PJ6 A;  4XLA A;  2ZTN A;  3Q6R A;  4RDL A;  4X05 A;  4PAB A;  3SLN A;  3W2I A;  2X3U A;  4OOV A;  3OW2 B;  1SM4 A;  1YJN B;  1XB2 A;  2ZL7 A;  4G6I A;  3KL9 A;  4X0C A;  1H8E A;  2I1L A;  2AHO A;  1WOP A;  4II2 A;  2V4D A;  2QN6 A;  4QVJ A;  1T5E A;  4UAJ A;  1KK1 A;  5IYP A;  1YI2 B;  4II3 A;  4WZL A;  1B2R A;  2PIA A;  1E64 A;  2VYQ A;  2D9R A;  3U6B A;  4N3G A;  4G7W A;  3AST A;  2NPF A;  1QUE A;  1Q9S A;  3CCV B;  3QE2 A;  3VNU A;  2B5O A;  4X7F A;  1VQ5 B;  2VJJ A;  4XMY A;  4AF6 A;  4XOR A;  3GVL A;  5FO1 A;  4WZK A;  3CCL B;  3R6J A;  1VQ7 B;  1KK3 A;  1VQ6 B;  3QFT A;  4XR6 A;  3CC7 B;  2R6H A;  4YXW A;  1WOO A;  2OBR A;  2HCJ B;  1FRQ A;  5KW9 A;  1B23 P;  4FWT A;  3AVU A;  3JQP A;  4Z1M A;  1WSR A;  1VHE A;  2WZN A;  1VQ8 B;  4RDK A;  3CCM B;  4Y9U A;  2X53 S;  2LZJ A;  3W2E A;  5IYN A;  1E63 A;  4TMZ A;  3B82 A;  4XN0 A;  2QDX A;  4TT3 A;  3H9N A;  4R71 A;  2VBV A;  2HMA A;  1K73 D;  4P3I A;  1KQS B;  4P25 A;  5FNZ A;  2WYR A;  4PC6 A;  4UZU A;  2NV4 A;  1DAR A;  2GQF A;  4OPV A;  3CPW B;  3WXM A;  2ZBU A;  3PEN A;  3V76 A;  2DEU A;  1GAW A;  1QFY A;  1OGI A;  1PJ7 A;  4K1X A;  3AVY A;  5GV7 A;  1EP1 B;  1H42 A;  3A3G A;  1DG1 G;  3E1Y E;  3U6K A;  2P3M A;  3WBJ A;  3VNV A;  4RDJ A;  1QH0 A;  2BM0 A;  3ASQ A;  3OKX A;  1VHO A;  2QA4 B;  3QSY A;  1K28 D;  2BVN A;  1EP3 B;  2V7Q A;  2OK8 A;  5GV8 A;  1W0J A;  3QFR A;  4P6Y A;  1AIP A;  2ZBV A;  5DSZ A;  5A88 A;  3CCS B;  2CND A;  2ZZF A;  4PAA A;  5KSW B;  1W35 A;  1Q7Y D;  4Z4Y A;  3PUM A;  3V7A A;  1OGJ A;  3FKS A;  3CP8 A;  4B43 A;  3D26 A;  3MCA A;  3CPX A;  1V5V A;  1QFZ A;  1Y0R A;  1S4M A;  3JU4 A;  2WZP P;  1FNC A;  1RQP A;  1XQB A;  1Q81 D;  4Z4R A;  2Q6K A;  2CK3 A;  1W9X A;  2HDN B;  2BSA A;  4GQN A;  1GVH A;  1KK0 A;  1KK2 A;  2GPJ A;  5AN9 A;  3B78 A;  2OBT A;  3A1P A;  5IK2 A;  3A8K A;  1XFO A;  1YJW B;  1PJ5 A;  3OZU A;  1T6Y A;  3JQQ A;  1NJI D;  2WSS A;  1W0K A;  3WND A;  2F4N A;  4X8I A;  3CCJ B;  2W6I A;  2DCU A;  3OE7 A;  2GJP A;  4XKV A;  1H8H A;  3CP2 A;  2JJ2 A;  2VZL A;  4PC2 A;  5THX A;  4X7C A;  2ZTG A;  2CW5 A;  4X7E A;  4XLH A;  1S0U A;  3CCQ B;  2ZIT A;  4WWV A;  1N05 A;  3R6K A;  3BCF A;  4NNJ A;  1VJS A;  4IW3 B;  1BPL A;  3OFN A;  2BGJ A;  1FND A;  1JNY A;  1QGY A;  4PC7 A;  4QFM A;  1R5B A;  2WJY A;  2VBU A;  5DS0 A;  3LVB A;  3QFS A;  1P4M A;  1UD4 A;  5BSX A;  2JJ1 A;  2XGJ A;  1VQL B;  1K8A D;  4RD1 A;  4M2L A;  1E3X A;  1HA3 A;  1PKV A;  1M1K D;  1WDT A;  3CB4 A;  4OPS A;  4Y7C A;  1ZM4 A;  2WJV A;  4WQM A;  2J7K A;  4Z4S A;  1N07 A;  1GO2 A;  1WU8 A;  1WPC A;  3MHP A;  3CCR B;  1WP6 A;  2QTZ A;  4P12 A;  3VO2 A;  2ZZE A;  4TMW A;  5F4J A;  3SLD A;  4RD3 A;  4XL9 A;  2JDI A;  3CMM A;  3LNN A;  1MRZ A;  4FN5 A;  2XZL A;  2QEX B;  3T51 B;  2VJI A;  4M4S A;  2GJR A;  2Z6B D;  1QUF A;  1G7T A;  2XNJ A;  3OZW A;  1D2E A;  3G6E B;  1HZE A;  1JJ2 B;  1VQN B;  3ASS A;  1W87 A;  3W5U A;  2BPO A;  4TSF A;  3E20 A;  1H85 A;  4P9S A;  2RC5 A;  3Q3A A;  4C43 A;  1UD8 A;  5TR9 A;  4YAL A;  1E43 A;  1OB0 A;  1DDG A;  3BH4 A;  1BJK A;  1EFU A;  3OJW A;  4P2N A;  1UD2 A;  3I1F A;  4TMX A;  4FXU A;  1U2R A;  4Z4V A;  1MAB A;  1N0U A;  1WSV A;  4ROX A;  2DET A;  4XM3 A;  4AC9 A;  4ACB A;  2OK7 A;  3LQ6 A;  2DY1 A;  1EXM A;  1NBM A;  1E79 A;  3VMF A;  4G5G A;  1VQM B;  2C78 A;  1J9Z A;  4U9U A;  1AMO A;  3AVT A;  4P3Y A;  1EP2 B;  2VNH A;  2VNJ A;  2BMW A;  5A89 A;  5F4M A;  3GSI A;  4UZE A;  3OAA A;  1FNB A;  1VF7 A;  4DK0 A;  1TTT A;  2WR8 A;  3QFC A;  1K9M D;  3OP1 A;  2QE7 A;  4AF7 A;  4YAO A;  2D3L A;  5IYQ A;  4ASU A;  4P1V A;  4YHB A;  2DYI A;  3LQE A;  4PGO A;  1QGZ A;  3WQZ A;  4OOS A;  5FL7 A;  4XQF A;  1OB5 A;  1QX4 A;  1KMH A;  2V7U A;  4ZCM A;  2PLF A;  2CF4 A;  4G1V A;  3T53 B;  3AVW A;  2PE3 A;  4RCY A;  3W2G A;  4Z4U A;  4DQL A;  4NBS A;  2X6Y A;  2ZL6 A;  4M0L A;  2C5H A;  2OTJ B;  1N08 A;  4DNT B;  1N06 A;  2GJK A;  2OBS A;  1ZM9 A;  2BGI A;  3NE5 B;  1BX0 A;  3BNW A;  4RJL A;  2BN4 A;  4RCZ A;  3SEJ A;  3W2F A;  3OZV A;  1FDR A;  2X6W A;  2XOK A;  4YEJ A;  1IJE A;  3ZUG A;  2BF4 A;  3J81 k;  2BV3 A;  1NB9 A;  2QMU A;  4JMQ A;  4B3G A;  1ZM3 A;  3ZIA A;  4RLZ A;  2X6X A;  2V7V A;  4RD2 A;  4XLE A;  1RQR A;  1YX2 A;  4RD4 A;  1WOS A;  2QGG A;  3WBK A;  2E1R A;  1G7S A;  4B44 A;  5FA6 A;  4YAF A; 
#chains in the Genus database with same CATH homology
 3OKX A;  2NV4 A;  1XQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...