2F1MA

Conformational flexibility in the multidrug efflux system protein acra
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
246
structure length
229
Chain Sequence
TTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDMKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTMMPGMFVRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility in the Multidrug Efflux System Protein AcrA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Acriflavine resistance protein A
total genus 57
structure length 229
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f1mA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2f1mA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f1mA02
3VR6A 4KN7C 2V4DA 3FMCA 3T51B 2JEBI 1O78A 1TU2B 4H13C 2JEAI 2E76C 4IQZA 3OOCA 1OXTA 2E75C 2K32A 4RCNA 4KKUA 4DNRB 1IYUA 2D62A 3DXJC 2EDGA 4KKTA 1K8OA 1FR3A 1Q1BA 1Y8NB 1OXXK 2D5DA 3A7AB 1Q12A 3ND9A 3VR2A 3P20A 5KNCA 4DK1A 1LACA 3LNNA 1H9JA 2PNRC 3PUZA 4LK1C 1B9NA 1OXVA 5K36G 1ONLA 4GYCB 3IFTA 2AUJD 3D4RA 3D31A 4KHZA 3M7NA 1E2WA 2DNCA 2BE5D 2EJGC 3QIAA 4G7ZC 3EQLC 3T56B 2PPBC 1RSOA 1Q90A 1Q1EA 1SMYC 4KKSA 3M4YA 2CW0C 3BG3A 3WB1A 4KN4C 2EVBA 3U9SA 4DK0A 4XIGS 3SDZA 1V8QA 2F93B 1I6VC 2NN6I 2LMCB 4XTCS 1VCIA 2BA0A 3ND8A 2A6ED 4L8JA 1QJOA 1Z7TA 5JJNB 3LWUA 5JJEB 2O5JC 2EJFC 2A6HC 3BDOA 3BRCA 2YYZA 1HQMC 1OXUA 1VDZA 2A69C 3RLFA 1DD2A 2BE5C 1G291 4JK1C 3VR5A 3PUXA 1IW7C 2AUKA 4JBWA 2O5IC 3NE5B 5D5QA 1HPCA 4H44C 1GHKA 3MFYA 4BA2I 3PUYA 1GUGA 1B9MA 1EWHA 1ZYRC 3H94A 3VR3A 3WDNA 1T5EA 3WB0A 4TKOB 4KMUC 1E2ZA 1YNJC 1H9KA 2A69D 2JXMB 3PUVA 4HR7B 3OPOA 2BA1A 1IYVA 2Q8IB 3WB2A 2EJMA 1Y8OB 2NN6G 1Z6HA 2F1MA 2L5TA 1GJXA 4OO1H 3CRLC 3T53B 5C0XG 3FPPA 5JEAG 1GUSA 1V43A 5K36H 2A6HD 4PV1C 3A7LA 1HTPA 1O7LA 1H9SA 3IKJA 3N6RA 1CTMA 2KCCA 1TKWB 4OO1G 2AWOA 3I73A 2A68C 3VR4A 3MXUA 4G7OC 4I7ZC 2B8GA 5BN5A 1IW7D 3L7ZC 3W3AA 1GUNA 1HCZA 2IT1A 2NN6H 3PV0A 2E74C 1VF7A 1DXMA 3AB9A 2KA7A 4GZYC 1LABA 1FYCA 2PCFB 5KNBA 3I72A 1YNNC 5BN3A 1Y8PB 4DNTB 2R6GA 4IFDG 3OW7A 2F95B 4LJZC 5C0XH 5A35A 1H9MA 5JEAH 3A8JE 1DCZA 2QF7A 3A8KE 1GUTA 1VF5C 3I4LA 2ZT9C 5JJJB 1Y69U 1E2VA 4OGQC 1A6XA 2B8FA 1PMRA 3PUWA 1CFMA 3M85A 1GUOA 4KI0A 3TZUA 1GHJA 4BA1I 3KLRA 1H9RA 4H0LC 4G7HC 1H2SB 3QJYA 5KNDA 4TQUS 2BDOA 1K8MA 3CRKC 1H9SB 2A68D 3VA7A 2K7VA 3GD7A 1OXSC 3A8IE 2A6EC 2D2CC 5BN4A 5D5PA 3HGBA 2K33A 3SE0A 4IFDH 1BDOA 3GQBA 2DNEA 1CI3M 3QG1A 1ZKOA 2JE6I 2DN8A
chains in the Genus database with same CATH superfamily
3LSSA 3ISXA 1PH8A 4JGSA 2Q2UA 1VQIA 1L0NH 2YWFA 1FXKA 2YI8A 3HKCA 1KC8D 2E75C 1IL8A 1TR5A 4WBNA 2QILA 1TLLA 3G6EB 1X6OA 1S5FD 3FP9A 3I8ZA 4NTXA 1E24A 3SYAA 1KMHA 3W1BA 2OTJA 5LXTB 1JFFA 4NTYA 3A2FA 5B3SB 1WCMH 5I6WA 2AUJD 2FYUH 5LMNW 2HDNB 4FJCC 3NTIA 5IWAB 4A3DH 2ZIOA 4TMWA 1DOKA 2IM9A 1SMYC 5IY5B 3BY2A 3M4YA 3G6EA 1GM5A 4BIZA 2ADPA 4K0KO 2X53S 1A63A 4DAMA 3TCUA 4XQNA 3SDZA 4BW9A 2BGJA 5LMUO 2B2VC 5A88A 3BZKA 4B9WA 3GTGH 3QFRA 5J1ZA 1C9OA 1X9NA 3K0DA 4RWSC 2XHBA 1M1KC 4DPGA 4BY1H 2QTOA 1LT5D 3M4OH 4P9SA 2KSDA 2YTXA 2KECA 3DLLA 4J9ZB 4LF4O 4JV5L 2F0EA 2UXBO 1KZLA 1HZ9A 3SYQA 1LTGD 2BE5C 3RLFA 3ZX6A 1VQ4V 5IP9H 2JVDA 4A3KH 1JNYA 3UQ8A 4ZCMA 3ONUA 1TS5A 3M7GA 2O57A 1EOVA 3TP8A 2B2TC 4LAAA 1XMOQ 3Q23A 3T1YQ 2LFRA 5KEEA 3CYOA 3NHHA 3P26A 4UZUA 5TV2A 2HCIA 3LO8A 1ZYRC 3WB0A 4EX5A 2A69D 3K81C 4X88A 2KHIA 5GAEC 1XNRO 4LC0A 1JVMA 2CWAA 1GKFA 3NELA 3HKBB 1IYVA 2VS0A 2PUSA 4XBFA 1X3PA 1KDCA 3OIQA 1VQEA 2EJMA 5IGCA 1H2NA 4IN3A 4TMTA 5LMNL 1R3KC 3AYHB 1PTOB 1ENVA 1B23P 1NUCA 3CRLC 2BGIA 4JTCB 4FM2A 3RR5A 2XAJA 1ESFA 1EFID 1RKNA 2W0FC 1VQ8V 2B2UA 3AU7A 4WORA 5KRUA 1BNZA 3U6KA 1XNRQ 3CJHA 4LF5Q 5LHHA 1S72V 3I73A 4DU9A 4K6DA 2ZJRA 4DW1A 1KDBA 1IW7D 4L63B 1R4QB 2CDYA 3K08A 2E74C 4OPSA 1X65A 3AB9A 1RIPA 4DV6L 3TETA 2AZ2A 4NXNB 5TR9A 2F3WA 4LWCA 4XQJA 3CE2A 4X7DA 3A56A 1D7QA 4JYBA 1YTFB 4P25A 5IYZB 3CCMB 2BPOA 1E2VA 2K14A 1E1OA 3NBHA 4MTFA 4CHTB 1PMRA 3T1YL 2JA8B 3G4SB 2H8PC 3ICXA 1CFMA 1AP0A 4JZ2A 2P4VA 3ER0A 4LF8B 2XEXA 3EIVA 5M5WB 4A3DB 1WSVA 3PA2A 1TVKA 4F6RB 1H2SB 1BQQT 4TUYB 5KUMA 2MJ8A 3MXPA 4TQUS 1STGA 4DV7B 3L2PA 4TSSA 1OTCA 4BBSH 3HOXB 3S1QB 4R1JA 1SAPA 2ZNJA 4P30A 3B77A 3HOVG 2CW5A 3K6OA 4J11A 2WSSA 1WU8A 2RF4A 5JPMC 1T6ZA 1KNAA 4Y9RA 2V4DA 2QE7A 2A9HA 1VQOA 3AMUA 5M3MH 2R9IA 1K83H 2PQAB 2VQEL 4A3IH 2HKOA 1DTOA 1ZTEA 4DV3B 1I94O 2CBXA 3OP1A 2VQEB 4CH5A 4PAAA 1O7ZA 4IPCA 5HZBA 1E7ZA 2X69A 5IP7G 4IYHA 4OXPA 1T5XD 4A3EG 5HKKA 4JPBW 3I1FA 2HJFC 4ZCKA 4MT8A 3SDLA 4Z4RA 5IYRA 4K6LA 1N32O 4HCSA 3AVYA 4FXUA 5C3EH 4KD3A 3W2GA 5IP7H 1EL0A 2PYJA 3MC0B 1BGYH 1NU1H 2DETA 3CCLV 2NZOA 2NLJC 3CCSV 1P4RA 5M3FG 1PV4A 1I6HB 2D0OA 1H8EA 2F3IA 2Q2HA 4UPAA 5C3WA 4G7WA 5C44H 1F2MA 2PZTA 4K8IA 5JBQA 1DLBA 2DIEA 2F0SA 2CE4A 1XX8A 1B2TA 4BWGB 1AJQA 4XLHA 1B06A 2GJPA 1D1IA 1S5BD 1GN3A 2X8KA 1VLYA 2LXKA 2V1CC 2PI2E 5IYBH 4IYIA 4DV4Q 1YJNB 2XGJA 1VCIA 2C2WA 2BA0A 2NB0A 1AB3A 1K73W 5I2YA 2DWEC 4O2DA 3BQJA 3AG7A 3ZRWA 3FDTA 1LTSD 3SK6A 1K9MC 1URFA 3BDOA 3TP5A 1XMQO 1V55B 5IYQA 3CC7A 1Y74A 4U3FH 3PUXA 4DR1Q 3S2HH 1HNZL 2AKWB 3N2KB 2M5SA 2PE3A 3NE5B 2MHVA 1AR1B 2O4XA 3KCXA 4UHVA 1KU9A 1ZSPA 4YEJA 3KUPA 2NVXH 1NJID 1SJHD 5AJ3L 1YHQA 3W5UA 2DE0X 1GHKA 3WBKA 3L73H 1WTHA 4X64Q 3VR3A 2AW9A 1T5EA 4X06A 1M4UA 3B8NA 4LFCQ 1EZ6A 5EC2C 1HNWL 3W7SA 2CK3G 3J81E 3ASPA 2TMPA 4TV8B 2D2CB 3HOZH 4AHCA 4X65B 2FHTA 2K5VA 2QTZA 3O13A 1BX0A 1W9XA 4A3CH 2NV4A 1MSGA 1AI6A 3L72H 4DR6B 1SZXA 2JJ1A 4CDFC 3NTHA 1IXBA 1PM9A 4B3MO 1HA3A 1BBWA 2R93B 2IJHA 2MK3A 3H1HH 4O4IA 3JQPA 2J7KA 3LDEA 1GTOA 4TMXA 1JCKB 1K73C 1N33L 3BA8A 1VF5B 4NTWA 2EIKC 1G2SA 3OEHG 1L0YB 3N6RA 4APVA 4BY1B 1PLFA 1DF4A 2KCCA 5JJLA 5H2FZ 2CTWA 1CHQD 2A68C 1MGSA 3E9HA 4PI0A 2N04A 3E8FA 1EWCA 3HKSA 1S5LZ 1STYA 3OEEG 1LUVA 5K1PA 2YWEA 1IXMA 1SC5B 1R5OA 3CP8A 3CP0A 4DAYB 2I0QA 5CV7A 2UU9Q 3K06A 2WLIA 2KA7A 1HDJA 4X07A 1LABA 1JQYD 1UE7A 1AP5A 2F43A 3T4AC 2XNDA 2I1LA 5E7NA 3G48A 1R5NA 2GPJA 4OEMB 2JA6G 4DR1L 5TISZ 1FPOA 3SXHA 2QEXV 3J7AV 5JJJB 1KKDA 4NKLA 3BABA 5EAYA 3F7VC 2HR3A 2K5NA 3AG2B 2PW7A 3AK2A 3LSQA 4JC0A 4ROXA 2XZLA 4JI1O 1XL4A 1CQFA 1B6QA 2K9PA 3FEWX 2DOSA 4LFCL 3M99B 2WKDA 3OJWA 2RN9A 1LTLA 3R6KA 1LUWA 1CKMA 5LMNO 2VWKA 2I5MX 5IDJA 4CS2A 2QDBA 3MXNA 2QR4A 1N8RD 2K7VA 3SEJA 3M9BA 1OXSC 1JOYA 3DXRB 1WB7A 4A3LH 3HGBA 2DN9A 1Q3LA 4R8NA 3U58A 4OXSA 1BBXC 1AW7A 3ZJZA 1EM1A 1CI3M 4GKKO 4A3FH 1NKDA 1ZKOA 2I5LX 2I07B 4EFEA 1QZGA 3AFQA 3FD9A 4IOCA 1HR0B 4IO9A 3WFVA 3E0JA 1P7BA 3E9IA 4RH6A 1RTOA 3OMGA 4B3RL 4A3FG 2K32A 1TVKB 3KZIZ 4X20A 4YHHL 4P9PA 1NMFA 2JA6H 3CD6B 5CA3A 4X1IB 2WB1G 4LFBL 1BO0A 1PTOF 2NVXB 4P72A 4UCOA 4JV5O 4B48A 4NXMB 4XN3A 1STNA 2KEDA 4DK1A 2K1BA 2YWHA 4GN5A 4DV6B 1M93A 5L37A 2G5DA 5TSSA 4LR3A 2N55A 4DV5B 4R8CA 1N05A 1CT1D 1E2WA 3C2PA 4HSVA 1YHAA 3J81j 4ZOLA 1WP6A 3T56B 2ZTNA 1Q1EA 5EBWC 4FPPA 1I08A 3BG3A 4M53A 3ZMUA 5DEDA 3U9SA 2ODMA 5IYDO 2VS1A 2EIKB 4R4CA 3J80E 5GV8A 1PH1A 2JJQA 4FFBA 2ATKC 4GN4B 5GV7A 2PW5A 5B1OA 2XNCA 1SBBB 3JSLA 4JTAB 1PZID 2NVTH 3E8BA 2FB5A 3K5NA 1Q7YW 4LBYA 3C90A 3FKIH 1YCIA 5JJNB 2K04A 2GN5A 2RVLA 3LWUA 4OX9O 4UP7A 1EIHA 3BRCA 2X6WA 2IX0A 3CCUA 2ETNA 3GB7C 2XUMA 2F4VB 4B3FX 4GKJQ 1EU4A 2EYLA 5E3FA 1Y76A 2Y48A 3WG7C 3HOWG 4F7DA 1T6XA 2CF4A 2F4VL 1GK9A 1FD7D 1NBWA 1W34A 4P74A 2X3UA 3F7YC 4F4LA 4JYAL 2P90A 1YZ6A 4A3KG 1EFCA 4JYAB 3PUYA 3WDNA 3AG4C 3STBD 3CRMA 1VQ8B 4JI8B 1QGYA 4KMUC 3OJXA 2K1EA 3PUVA 1G4YB 1K8AD 2GTSA 2VB3X 5GW7A 1L1FA 5L3GA 2PI2A 1E1QG 2M6YA 4GX2A 1DDGA 2WA4A 1NR1A 1RQRA 2VNKA 1XPUA 1XILA 5LL6X 4JV5B 2QKSA 1Y0RA 4DRXA 2Q6KA 2VWJA 3JCUZ 2C5CA 2JDIG 5FO1A 4S3SA 5JEAG 2QWPB 1G51A 3D8CA 2ES2A 1U4PA 3P32A 4YAWA 3RY8A 1TWFB 4LF4L 3R93A 1HTPA 4L87A 1CNEA 2BMWA 2LXJA 1V54B 2W6IG 3DUZA 4RGNA 5M5YH 4DR5Q 3HP3A 4GLVB 4JI3Q 5GTHZ 1NH2B 1VQKA 1Y66A 2QM7A 3VQXA 2LS01 2RDHA 3VR4A 1D2BA 4XNFA 2CH4W 3ABMC 2A19A 1SNDA 1YVWA 1F4MA 5L3CA 2KVMA 1GUNA 3A5ZB 3ASOC 3CRZA 1Q46A 2NTSA 4YY3L 3S2HB 5IYCG 4C3HH 1MRZA 2KUMA 1OZ0A 1O7IA 4DR2O 1N34O 3QR8A 4IOAA 4X6AH 4LFCO 1ZL8A 2YC0A 2VUMH 2VNUD 1QG7A 3AFPA 1DCZA 3GP7A 4DR6O 4PV1B 2F66C 3PVDA 4OGQC 5IP9G 2YIBD 1OB0A 3H3VI 1GUWA 3CHXA 5FL7G 3CCSB 1ENAA 3FRPB 1KB9F 4DR5O 1MMMA 5E1FA 2OBSA 1KQSA 2DMXA 1E1QA 2F43G 1R1BA 2VZLA 3I91A 1N36L 4H44C 2EPBA 4F6EA 4CDCC 3SJCC 4POGA 5HFLA 1G7CA 3SPCA 1IBKL 2N8NA 4AH6A 2JDIA 1EFUA 1RQPA 4MTKA 3U0ZA 2L1BA 2BCOA 5CYUA 4GUNA 1VMCA 2HDMA 1S5CD 4G28B 1G6ZA 3BDCA 3A5UA 2Q68A 4MYUA 5CBGA 4LF4Q 2RDGA 3JATA 4H0LB 5BXZA 3T51B 1MI2A 4X1IA 1UMKA 3CCVB 1TU2B 4K14A 4JI3L 4LF6O 3GTKH 3OOCA 5FIUA 2ASBA 3E20A 5GTIZ 1UE5A 1OO9B 4X3SA 4LF8Q 4DNRB 4RWUA 1IYUA 1RPOA 3RYFA 4UCTA 1SF9A 3STZC 2UUAB 3T2MA 1YJ9V 1AR4A 2MFIA 1SFOH 2E2HH 2EYOA 1FRQA 4X1YA 1LACA 1OXVA 4P6YA 1B53A 4YJ3A 2ZJQA 3CMAV 4FFKA 3W1GA 3K57A 3JC66 1NNXA 5GAHC 1W6KA 1VQ7A 2Q2TA 4JI7L 4HE6A 5FL7A 3UDXA 3G7LA 2B63B 5HXBA 3IC9A 5C3EG 2DEUA 1EFRG 2HLDA 1K73D 1YBYA 4KN4C 1GKHA 5DAUA 2OT2A 5HGTA 3F8TA 4B3SQ 4JOIC 2HDLA 1WLEA 1VQOB 3QFTA 2PMZE 4X8IA 3HKZG 1N36Q 4Y9UA 2WKCA 3ETEA 5C5LA 5LMUL 3H0GB 5IOCA 1S5HC 2GUZB 1QCBD 1WCMB 4JZGA 3HOUG 4U673 5C0XI 2JA7G 1F9PA 2XTAA 4RGTA 1HNXQ 1KBHA 3PO3G 1DD2A 3JAMc 1BXTA 2CC2A 4A93H 1MG1A 4ACBA 4PA7A 1STHA 1YHBA 4R4TA 4E0FA 2DJGC 3CC7V 1HPCA 1Z47A 1W0KA 1QOHA 3KLSA 5F2DA 4JI2L 1UNSA 2UXDL 1STAA 1GUGA 4IGGA 1EEFD 3LUTB 3BPZA 3D3IA 1WOOA 2V7VA 4DV5O 3NBHB 2WINB 4HMIA 5ELBA 2WB1E 1AROP 3RFRA 1IBLB 4O4IB 2MP1A 3TZDA 5IGFA 1WTHD 2Q6AA 1FRNA 3LGJA 3L9DA 4DV0O 4B3TL 4LBZA 4DR7B 5A2QN 3OTOQ 3CPWA 4R4IA 2OQKA 2BVNA 4OP7A 1SYFA 4YIPA 4H44B 1K4CC 4FZ1A 1TS4A 2LSSA 4OO1H 4QV2A 3Q6RA 4J8QA 1IDSA 2VQEO 1DF5A 1G6UA 4EEQA 1NR2A 4JI7Q 1EFRA 4DXFA 2JA8H 1KK2A 3SK5A 3K80C 1DYQA 5D65A 5H1SE 2ZNIA 4X7CA 1VQAA 3NWTA 1IVSA 4IPHA 2JA8G 1OCCB 1S5JA 2X85A 3QWNA 3HS0C 4U3JB 1W2BA 3WOFA 2NVQH 4A3MG 2FX3A 1SNPA 2P6JA 2CNDA 5F4MA 3VNUA 3G80A 2TSSA 3D0FA 3KF6B 1YJ9A 2L0CA 4JI0B 2DJVA 3NSWA 2IW3A 2QM4A 3ASTA 1FYCA 2ICEC 4A5UB 3JD4A 4NCNA 4WFHA 1O9GA 2PMDA 3ZC3A 2HUGA 1L0WA 3OW7A 2RSNA 3CB4A 2DY7A 3Q24A 1YI2A 4AQYB 4ZBMA 4TMVA 3CCUV 2RDFA 4F87A 1EN6A 1QILA 5A35A 4X0CA 1FJGQ 3J7AF 2UXCO 4LF8O 4II2A 4M0LA 1ICFB 5M9OA 3S14H 3SJQC 1TWAB 1OHHA 3CQZB 2R93G 2XAHA 4I7ZB 4XN0A 4NXNQ 3NBIA 2ZITA 4G7HC 4KI0A 3T1HL 1I5YA 1ORQC 1MSWD 2E1BA 1EY8A 1RHPA 5EBLC 3BVZA 4RQEA 3QOJA 2QGNA 3APQA 1VQ7V 4HN7A 3H1LH 5EZYB 3Q38A 2BDOA 4K5XA 1JJ2A 3E6ZX 1QUEA 4P22A 4UCSA 2DYSB 1H42A 1QR9A 3ETQA 2OTLB 4RCOA 1VQMA 1R6NA 1NH2D 3P30A 1IZ3A 1PFSA 1P4MA 1RCVD 1WD1A 1S77D 4DR6L 1BDOA 4PJ0Z 2DNEA 5CC4A 3ZRVA 1IURA 4DR7O 1THZA 1KMIZ 3K7UC 2BOBC 5JH7A 1N0VC 2Q7GA 4Z1MG 1F77A 4DN4M 4B3TQ 4UFZA 2XNAC 3BU2A 4B9XA 4B4DA 1O80A 1YJWV 2GV9A 2F0GA 2HQLA 4RDLA 2H94A 2DWDC 1OCOB 2LFSA 1G1XB 2RQXA 4YCUA 1A3VA 3HOZB 3JARA 2HEPA 4KKTA 2EDGA 1G7TA 3K3WA 2Y0SG 4WJWA 3D26A 2YI9A 3CRCA 1CZGA 1Q82W 2B2TA 3L3OC 3J7YW 1YJWA 4FF4A 4FZ0A 3G05A 1YEZA 2KQ3A 4KHPB 1AJPA 4MSWC 4OELB 1K97A 2DOGA 2ZT9B 1JOOA 1ONLA 4ZUIA 2P22C 2EJGC 2KG7B 4TV9A 4JI5B 4ACAA 2VJIA 1FGBD 2EY2A 4P1VA 1L1OB 1RL2A 5CMUA 4DUYQ 4B7KA 3OZUA 5JPNC 2BDNA 4TMZA 5C8YB 1BX1A 4JI0Q 1PFMA 4I4TB 1CPYA 3N2GB 3G67A 3ABMB 1AP6A 4I0XB 3RT3C 4JI8Q 2XIWA 1DK1A 3FKSG 1MA1A 3CCRV 2BTQA 2EJFC 4JI7O 1HQRD 4P2NA 1PDQA 2D9UA 3PUMA 2QEXA 2UUBL 1N32Q 1JOQA 4X64B 3HFZB 1ZYRD 1FDRA 3AGPA 1B7YB 4MS2A 1BQZA 1PYWD 5LYJA 2I5HA 3CCQV 1QNKA 1WA8B 1TAEA 4PHZA 3K79A 2PZWA 4RM0A 4K8XA 1KTVA 1IJEA 1XDCA 4Z4VA 1CHPD 1XI1A 1RSOB 1VQ7B 1QVGU 5EIBD 3KF8A 4QUFA 4A75A 4JYYA 4A3GB 3SK4A 4MTOA 4XKVA 1HUMA 4ZAIA 1Y74B 4KJNA 4LFAO 4DXWA 4XD7A 3CCMV 1Y1VB 1TVXA 4ICGA 1XJVA 1PL4A 1E1TA 4FLYA 3DXRA 1Y8OB 3TEHB 1CSPA 3S24A 4IALA 3OWEB 1C8CA 3CRQA 3UT5B 1EQVA 4EQ5A 3CCUB 3MVVA 2CCZA 4I7AA 4X65Q 4OPOA 1LTTD 3M8AA 4TN1A 4YHBA 3WNCA 2A6HD 3K5OA 2YTYA 4OX9L 1VF6C 1W59A 5KHGA 3FB5C 5E79Z 1W2BB 1K83B 1SEBD 1ZXTA 3C1FA 4AYBB 2X6AA 2EXDA 4L6TB 1N36O 4TSFG 1XE1A 4DR5B 1FNUA 3CCRB 2AWOA 4QF4A 4V0BA 4ABNA 3TK1A 4JI8L 1K8AC 2CGNA 3FKSA 1JWSD 5CR3A 4KV6A 2M00A 1KTKA 3GSIA 5H5JA 3E3XA 1AE2A 1PFBA 2GDSA 1I3QH 4N8X1 4ULLA 4JI5Q 4LC1A 2R6GA 4LFAB 2CQOA 2CHBD 1SQQH 5FPRA 5LMNQ 3EN2A 3R2TA 1HW7A 1VF5C 4CZZA 5FJ8G 5H5NA 3C3TA 3ABUA 3DC5A 4K1XA 2JQOA 2PQAA 4K5VA 4GN3B 3U4ZA 4O2BA 1A6XA 3N2GA 1T9HA 1QVFB 3PF5A 4ILWA 5A89A 4IUPA 3LNMB 1AMOA 3B8MA 1L8DA 4LF5L 2B63H 3HOYG 3QJYA 1GM9A 1VQJA 4ZYSA 3QTCA 1BCCH 3MWYW 1SS3A 3S1NB 5BR8O 4B08A 4FLVA 2HMAA 4X66B 3H09A 3TP7A 3VYTA 2VUMB 2DQ3A 2R3ZA 4A93G 2Q2IA 2C5BA 3GV6A 4EB6A 4FLZA 1VQNA 3PUNA 2Z8LA 4TUYA 1QE6A 1N0NA 1EY6A 3JAME 4X7EA 1PL0A 2AGAA 4OX9Q 1FS0G 4R50A 3VR6A 3KCYA 4N23A 3E8GA 4HIDA 2RQ6A 4EFBA 1YHQB 4RCNA 5F4OA 4D7TA 1K92A 1EXMA 4UV8A 1FJGO 3WXMA 2QJ1A 4XQFA 3I56V 1VQOV 2RC5A 1PRTC 4DK3C 3K9SA 1BCPC 3DEPA 1Q12A 2OXPA 1U4RA 2OIEA 3QE2A 1QVGA 3DEOA 1UAPA 2IJJA 1EN4A 4LUOA 1GN2A 1AVMA 5JWPA 4BBRG 2UXBQ 2XRSD 4A3GH 4GYCB 4LF9B 4YWMA 1Y14B 3PQIA 5LA6A 1HNXB 3LWEA 3I7FA 2BOCC 2V7XA 1BS3A 1F2ZA 2AHZA 2HHHL 2BCCH 2JJ2G 4IIJA 2BE3A 1KUQA 3BVMA 4FWTA 3CCQB 2HHHB 1GR1A 2V31A 1L1OC 4R4QA 1EOTA 2CH4A 3VYUA 4HAMA 4R4OA 4W4KA 1KRTA 3CMEA 2JS5A 2MQHA 2PNHA 1I50B 3CTAA 2WA3A 1EYGA 3DHQA 2VQEQ 4QCLA 1PJ7A 2ZZQA 1HA5A 1EEID 2EXZA 2RHSB 3I4MG 1W0JG 3PGZA 1EY4A 4ABMA 3CCVV 4TRDA 1RDPD 5JJZA 1NVPD 2Q69A 1YZBA 4ZOLB 4CGYB 2YYZA 3RZDH 1YNJD 5B6IA 1S0VA 3URYA 4AILC 1NQTA 5FLMH 4DR1B 3AEIA 1HNZO 2UUBO 4ZLTF 1YIJA 1EY9A 3J80i 2ITCC 4YJ2A 2AUKA 1OCZC 4MVRA 1KL9A 1TIID 3BCDA 3JALA 4B3TO 3GTGB 4CDDC 1NCVA 1SYDA 3ZS8C 1GN6A 1FAFA 3RVZA 1DZ1A 4I4TA 1EWHA 3H94A 1HNWB 2EYFA 3NK9A 1JE4A 1A2UA 1CZWA 2HVKC 4FLUA 2R7FA 4X66Q 3I4OA 4H13B 4HJ8A 1QX4A 3B6YA 4B3RO 3CS5A 4EB6B 1VQNB 2BA1A 5L46A 4O1NA 1YEWA 1GO2A 3H0GG 2UXCQ 4TQDA 1H2KA 3GDEA 2KG7A 1A3TA 1ZX3A 3TRZA 4JI6Q 4XLAA 1GOZA 4RAUC 3CC2B 4PDVA 3MEHA 3ASRA 4C3IG 4F8MA 1DGSA 1PYSB 1WP8A 1HR0W 2AHOB 3VNVA 3PO2H 4F6RA 3BYTB 3FPUB 1P49A 2Q6LA 4I55A 4GZRB 1X32A 3TXQA 3IKJA 4UXNA 2KB1A 4BPRA 3NXWA 1SQBH 1OGJA 1RFYA 3CRRA 3MCAA 3MZ5A 1AEXA 2EQSA 3ZCCA 1QNMA 4UB8Z 1QG0A 3QFSA 4GQNA 4JI4B 1S76D 4IUVA 4UVAA 2RJZA 4KFMA 1I4HA 2ZXPA 2XNJA 4G2KA 1KECA 2B2WA 1RPRA 3LX0A 1JFFB 1D5ZC 1QLNA 2R9VA 4A3BG 4GZYC 1CNFA 1R3IC 3DC6A 1W35A 2LP7A 2R9AA 1VQ9B 4JG2A 2IBZH 4DR7L 3B40A 3P7JA 2F0FA 5CA1A 3OTOO 2PGGA 1D1NA 4DV4L 3F5TA 1BF4A 1DONA 3GV3A 2NWGA 2R70A 1MSHA 5M5XH 2B8FA 3FJOA 4JI1L 2IU3A 4MIUA 2XOKA 3P75A 2E8GA 1EWYA 3MA2B 4OPVA 1GUOA 3AG3B 3QOLA 4PA3A 4XONA 5JH7B 2Z9HA 3RLNA 4FM1A 1M1KD 5H59A 4UAIA 3U6BA 5I2XA 1W2BU 1D8TA 1HXYD 2KENA 1AN8A 1S40A 4IFDJ 3ZMTA 2OCEA 2AXTZ 5BSXA 4CH4A 2NR5A 4E4EA 1XNQB 2X6YA 2CQAA 5E4XA 1SYEA 4DR4O 4DR2Q 1N34Q 3E2EA 2CTRA 1YTFD 4AQYQ 1E1RA 3D3QA 1TS2A 3HOXH 2F03A 2UUAQ 2JE6I 4OO1G 4AVZA 3OE7G 3AG3C 4PELA 1Q7YC 4PDRA 2JEBI 2WWWA 2EY5A 3E1YE 1XTDA 1TGOA 1QUFA 5C5MA 1V1QA 2PY5A 1F60A 5M5YB 3F2CA 1N9WA 2ATWA 2UXNA 4WCEV 2JN4A 3EA6A 1K8OA 2A79B 5KA6A 1SLJA 1RP3B 1NT2B 1KRSA 4P3YA 1Q1BA 2Z1CA 3ND9A 3K59A 5G3LF 2ZJPA 4LH6A 3RZOH 1KC8W 4K2LA 5IGGA 1HVXA 2Y0IA 5LP6B 1D1KA 5GROA 1YJ9B 4DR4B 1UUPA 2ADQB 2EZPA 3FAVA 2YDEA 3FB8C 2BE5D 3TQYA 1XNQO 2BM0A 1UE1A 1D8LA 5DECA 3CXCU 3HEJA 2JA5G 1W87A 1SKQA 1U96A 4A3JB 1Q8IA 4JI4Q 1V54C 1JB3A 4PC7A 3FYIB 4N3GA 1YXBA 4OPHA 3GTPH 2HCCA 2Z4IA 5B3SC 5C44B 4YHHQ 2F52A 4RHSA 2UUCB 2V7WA 2ZR2A 3HOZG 4K8ZA 1SNCA 1ZUNB 1QJOA 1JR0D 4WZLA 4PZ8A 2IWHA 4BBRH 1AE3A 2F0UA 5IJ0B 1E1RG 2OTJB 1HQMC 3KLWA 5IE8A 4U7NA 5FPOA 4ZCLA 1EY0A 2ZDIC 2F0KA 1G291 3MHBA 2WR8A 3X3NA 3SR2C 2XZPA 4AQYL 3WNBA 1RJTA 1G7RA 3FKIB 5GONA 1Y0YA 4J1MA 1QVGB 1HZEA 4WFGA 5M3FB 3AG4B 1KC8C 1UD3A 3GTMH 4JI4O 1TWFH 1B9MA 2IL8A 3CW2A 4HSPA 3TP6A 5KGUA 4DV1B 2CWPA 4JVZA 5EPLA 1P7GA 1H9KA 5J3BA 2CW0D 4QPKA 5JVDB 1KABA 3WG7B 3JSNA 2Q9LA 4PG3A 4DV1L 5CV5A 4DR2B 4YIOA 1N34B 1XQ8A 4DV3Q 4PC1A 3U4VA 3J81N 1QWYA 1A8PA 4GKJB 1CM9A 2EYJA 4EQNA 4YXWG 2F1MA 5DS0A 5FO7B 1NB0A 2BSKB 4UP9A 1R73A 3CP1A 2ZINA 3K03A 4DAYA 3FPPA 1SMYD 5E4WC 3S1NH 1MHWC 3L75H 4LNQA 5THXA 4K35A 4OWTB 1V1OA 3GTOH 5KW9A 1H8HA 3AVWA 3TGUH 4OX9B 2FKXA 1SQGA 3K0GA 1F2YA 1SYGA 1BMFG 1UD6A 4DQKA 4P9OA 2F0HA 4JYAQ 2Z6BD 3SJZA 1XXGA 2K5QA 5D3IB 2HFEC 2KJXA 2XN9C 2OTJV 2PYLA 4DR4Q 5J39A 1XL6A 4POFA 2QDLA 3JAKA 5KA5A 1YLOA 2Z6KC 5EC1C 5EIBC 5BN3A 1Y1VG 1YNNC 4LUVA 1WTPA 1Y8PB 4HZ3A 2F0LA 2QKIC 2RNBA 4BIUA 3PO2G 3NP8A 2NNUA 2QF7A 4XDKA 1PVOA 2XGTA 1SA0A 1V0FA 4XR6A 3ZMSA 1CKOA 4JI3B 2UU9O 2B39A 4JBMA 2VQFQ 5IYDH 2NVQB 1EYCA 4J6HA 2YSUB 3G71A 4DR5L 4QGPA 4WF9V 1MOFA 3N2KA 4YJ2B 4MNOA 3SR1A 1JJOA 3VA7A 3HKEB 5KX5A 1KQSU 1EYDA 3UE1A 3EXAA 3A8IE 2A6EC 3HKZE 2L9HA 4PMCA 5BN4A 2ZBUA 3FAVB 4IL6Z 4FLXA 1RODA 1VQGA 1N4CA 1ZL8B 3IGAC 3BFRA 2FMCA 3J7ZC 1S3JA 5BMVA 1HNWO 3RN2A 4LF6Q 1J8IA 2ZTCA 3PIP3 1M8AA 5G3LD 2JA6B 4P3IA 1MZFA 5IY0A 5FNZA 5ISRA 1NI8A 5TY0A 3H9NA 2DY1A 4ZUJA 1ASYA 5EZYA 1JJ2B 2E76C 2NZ1D 3T1YO 1AIPA 4P26A 3AG2C 1SQPH 3E22B 2RKSA 1YI2V 4FF3A 1VQLA 2ZD9A 3D36A 2N74A 2JEXA 3OKXA 5FA6A 1F9SA 3RYCB 2DJFC 3S16B 2Y0SE 4CQJA 3A7AB 1OXXK 2D5DA 2B2VA 3ML0A 4XMYA 5K1XA 2CK3A 1FFXB 3KL9A 3ZEDA 3RYHB 2K6AA 3ICEA 1WNSA 3W7TA 4DUYB 2V7QA 1H9JA 2PZUA 2UUAO 2UXBB 1ELOA 4J10A 1OB2A 4FXGC 4NMZA 2ZM6B 4DA2A 4KK7A 1WOSA 5C0XJ 5CBHA 2BN4A 4X66O 4RO2A 2QEXB 1ICWA 3VYRA 1FXKC 1Q90A 3HOWH 2LQTA 4A3CG 1HUNA 1VLOA 2VQFL 5CGKA 3WB1A 1ILQA 3E35A 2VBVA 4YY3Q 2MO0A 5M3FH 5EGTA 3HKDA 1X3FA 5IJ9A 4UZEA 5LYJB 3WYAA 1TWGB 3L9AX 3K7AB 2JA7H 1XHXA 2OCCC 4Z4YA 3GTOB 3G4SV 1QVCA 3ND8A 1LV9A 2A6ED 1QUQB 1VQPV 2OYQA 4R7CA 4K0KL 3K58A 3O9OA 1NR4A 3W5OA 2BTQB 3U10A 1DOMA 4JTDB 2A69C 4LFAL 2J4XA 3UM7A 3CXCA 2NVTB 5IGBA 1Q9SA 3H3VH 1IW7C 2E76B 4F88A 4IZ8A 4JBWA 2A0LA 3RYFB 1W0JA 4OONA 1X55A 1NR7A 1KHIA 1PRTB 1WTWA 2JGDA 4XOPA 5KAFZ 4BA2I 1K9MW 4Q7JB 4EQPA 4B7EA 1J5EO 1XB2A 1B04A 2JRIA 1NMGA 2QTSA 4GOPA 1QFJA 1B44D 1QHTA 1UEAB 1VQPA 1IBLL 4QB4A 1Q5OA 3H1IH 4ZK9B 4ASUA 4BY1G 2BH2A 1SE3A 3C46A 4NW2A 3B4SA 5BMVB 1GVPA 2X6CA 2XSCA 1LTID 3TS2A 5DLQE 3I4MB 2HJDA 5FK9C 2WJYA 5IK2A 1Z6HA 3P1HA 4N9PA 4O4JB 4NXMQ 2IX1A 4ZI7A 3FHWA 1HNXL 3WQZA 1Z2GA 1X3GA 4A3JH 1KQSB 2N78A 3SKBA 4RCYA 3G71B 4DV6Q 4G6IA 1SDFA 5I9OA 4RKBA 1D5AA 2QSAA 1F7YA 4ZGNB 3C1EA 3CMAA 1MSDA 2QTLA 1SESA 2ZXHA 5C4XH 5DM6V 1OCRB 4A3IB 4RDJA 5IJ9B 5LGNA 1S3OA 4DW0A 2KCMA 4LF7O 2ICIA 2ZCEA 1K4DC 3JALB 1WPBA 2C78A 1NTGA 1GJRA 1PKVA 4AYBE 4NYKA 2PI4A 2R7DA 3BZCA 3MXGA 1X54A 4UVCA 5FLXN 1Q81W 3KLSX 4OO1I 4DNTB 4H33A 3ZRXA 5I6YA 4B3SL 4IFDG 2OQ0A 3BVGA 1I6HH 4MVZA 4X9QA 3CD6V 1Q7YD 1R3JC 4JI7B 3QVNA 3A8JE 4QY7A 3RZOB 4CBCA 5FOBB 2WPDA 3I4LA 4LUZA 5IE9A 4CJ1B 2C77A 2NN4A 3W2HA 3ZBTA 1OCOC 4Y7NH 4CKBA 3M85A 4X3TA 4FLWA 1IBLQ 3C3SA 4FVMA 3F2UA 4O0AA 1KK0A 2FJ2A 2LFNA 3K9AA 1VQFA 3EHBB 2A7WA 3JAWA 4NBSA 3CCQA 2UUCL 1H9SB 4A3FB 4MTXA 3M4PA 2GJRA 3G6EV 3PN1A 3T13A 4O4LA 5B1BC 1I4GA 1X56A 1SE4A 2D2CC 3RZDB 1M56B 5D5PA 4JI5O 4KP4A 4G27B 2B3GA 2WB1B 3A0BZ 4WJ3M 5ITZA 3Q6QA 2DYSC 1A32A 3ABTA 1QB5D 4EGVA 1XMQQ 3F2DA 1C48A 1TY0A 1WTRA 1JC7A 2IPKD 5KX5B 3FMCA 4TVAB 2CRVA 3RN4A 1A3UA 5C8YA 4KXRA 4UZFA 1LUZA 4IQZA 3E89A 2K75A 1DOLA 2DGYA 2KCNA 3A54A 3UDGA 4X64O 2D3NA 2EE1A 4IJLA 5KMGA 3KEWA 1S5ED 4YHHB 2GTAA 2ZE6A 3SYCA 4LF6B 2V7UA 1JICA 1YF2A 1Y8NB 4O4JA 2JA9A 1OV9A 1P8LA 3L0OA 1TQOA 5C4HA 2G9HD 2F0WA 2XNDG 1KAAA 2M9VA 2SOBA 2N3SA 4YIJA 3SJPA 4KKSA 5KMGB 3QO8A 3H1JH 4GOPB 1FKAO 3JU4A 3P3PA 3CPXA 3A8IA 2W6JG 3W5VA 1WB8A 2HIVA 4A3EB 1VQKB 2Q7EA 3FYEB 5EMNA 2JA5H 2LMCB 1J9ZA 1ROPA 3OAAA 3S1RH 1B8AA 5EQ0A 4QE9A 5DM63 3D36C 3S1QH 3CXCB 5IODA 1MJCA 4R71A 1YITA 1M90C 4Q20A 2PLFA 2DY8A 1HNWQ 3C3LA 4NXNL 1XPOA 3R3OA 3ZIAG 1PA6A 4M2LA 2FINB 1E3XA 4WZEA 4RPBA 5J2UA 3RWRD 4BXXG 3M4OB 2X0LA 1DG1G 3A0RA 3OFNG 1PZKD 4WFAV 4QE7A 3W7UA 3IFDA 2B63G 4PGOA 2JA5B 1KYOF 1NRKA 1GMGA 2ZL7A 3GTJH 1VQ5A 4F7XA 1VQ8A 1D2EA 4JAAA 3SEBA 1SERA 4DR6Q 4HNAB 1XNRB 2MW2B 1U97A 4U7OA 1EYAA 4PZ7A 1PH5A 1IBMQ 3WB2A 2RSOA 5LA6B 5J3OA 1TUEB 1ET9A 2MO1A 1Z9FA 5KAIZ 4MYTA 4ME3A 2VW9A 3HOUB 1KLUD 5IJ0A 1DARA 3T53B 2WLLB 4J7JA 1VP7A 2JIZG 3ZBHA 3RYCA 3CCJV 1V0EA 3W2FA 1HFGA 2KEEA 2KOLA 4XT1B 5KYLA 2W6JA 3A7LA 3HKEA 2ARHA 1X3EA 4JW0A 2EILB 4LF4B 1TVCA 1Q6IA 2VNJA 4JBKA 1GAXA 5E6TA 4GLAC 2HHHO 3UDIA 5KHKA 4B43A 2BV3A 3MXUA 1VHOA 4I7ZC 3ASQA 2Y69C 4D6TH 1RD9D 3L7ZC 2P5OA 2EJRA 4LH7A 1GXDC 1H8HG 5B1AB 4LF9O 4UAJA 2MPMA 2QGGA 2ZZFA 2FVGA 5GQOA 3KFUA 2VXWA 1BR9A 4DUYL 1L0LH 4X65O 1V1PB 4GX5A 4K8JA 5IYCO 2YU9H 5M5WH 1NB9A 1LTRD 2QEJC 1Y69U 2WAQE 2ZM6Q 1SYBA 4BY7G 1I5FA 3H91A 2ZXIA 5JCOA 3NQTA 3CD6A 4LF5O 3A35A 2EIMC 1SA0B 1VQCA 5JQGA 1NDHA 2KHSA 2EILC 3B09A 2H4OA 1CEZA 2YS8A 2YIBA 3AGQA 4BR6A 4IHJB 3H15A 1SRUA 2SNSA 5FLMG 4DV0L 2E5LO 1YDXA 2QDXA 3J80N 3SE0A 3KJOA 3VO1A 1C0AA 2XAGA 2E3CA 2Y0PA 5B1BB 3GQBA 3Q3AA 1PTOC 1EQQA 3SLDA 3UI2A 4J41A 1ZLZA 4N21A 4RUFA 5L3EA 1FL0A 4FMTA 4PA4A 5IT9L 4BBSB 2DN8A 4YCVA 4HIMA 1EQTA 1S4MA 1L0XB 3D3RA 1YNXA 2B2UC 3DWAA 2JEAI 3JQQA 3M4QA 3ZHTA 3FPKA 2NVYH 4JCVE 4ZRZA 3PO3H 4KKUA 4PD4F 1QGZA 1K5SA 2WSSG 3VQVA 3DXJC 4IW3B 2BTOA 3V2TA 4C3JB 1PH4A 1FR3A 4X65L 3D4WA 4CC6A 3KK7A 4C7UA 3HKZB 2O2LD 5HFMA 3SLNA 3KKYA 4X1YB 4JBJA 4A3JG 3PUZA 2ZTGA 1Y76B 3T1CA 3I55V 1DDIA 1V5VA 4CBVA 4CKEA 1YNND 3LDDA 1GH6A 5BR8Q 1AI7A 3VQYA 4CS4A 2RC6A 2ZM6L 1YIJV 3I4NH 5BY1A 1CKNB 2Q5ZA 2WLKA 1HZCA 4OIJA 1IL2A 3E8HA 4CH3A 1BCPF 1NSNS 2EZOA 3UKMA 3OWFA 1GVHA 1PD3A 3B78A 1K28A 1Q86C 1V8QA 4QIWE 4C3IH 3CCVA 5T1IA 1LLRD 2FXQA 4I9WA 3E5SA 1CSQA 1I6VC 5IYDG 4HIKA 1B1ZA 4Z9CB 2Q8TA 4MTNA 4FF1A 1SKYB 3A8KA 2Q73A 3ZHSA 1E62A 1ZM4A 5D14A 4N8FA 1J5EL 3ABKB 3CMEV 4PZ6A 2O5JC 4QPJA 1B3AA 1QFYA 1VQ6A 1YI2B 1FNVA 2UXBL 2R7ZB 5C4JB 1AJNA 1OJHA 2QN6A 3KF8B 3PIO3 3HOUH 3CCLA 4M1UB 1SNMA 1VQ5B 5FLXL 1XYIA 2RMKB 4I65A 4XXEA 1ML0D 2HHHQ 2AQ2B 5B1NA 1DM0B 3S9WA 4GX1A 3LDCA 3GTPB 3N52A 1CA6A 1N0UA 3MHPA 4M1KA 1SJED 2B2YA 2JJ1G 1GM8A 1M56C 1ILPA 3SPHA 1YVCA 4NXNO 1PNMA 2F0QA 1WTOA 4JAUA 1TWCH 3CKIB 4IFDI 3HOWB 2R93H 1C4QA 4AIMA 4JI2O 1M90W 1MJEA 1XNQL 1YIJB 2X6BA 3OFNA 2H3OA 5KLVH 1J9OA 1M4VA 4WFN3 1BL8A 4HJAA 2E2HB 1GJXA 5C0XG 1VQBA 5ELFA 1N06A 1VHEA 4JMQA 3ZRWB 2AQ3B 3HAGA 2EYPA 3OE7A 2KCTA 3X2QB 4XM3A 3E0EA 2HLDG 4J42A 3W2EA 4ZGQB 2BH8A 4MHEA 5D3DA 1LR1A 3D8GA 4DNIA 1JT8A 1V9PA 1EWIA 2OCHA 1FFTB 1FXKB 3HKCB 1QVFU 1F51A 3IAYA 3A55A 3GTQB 3FFQA 4FNFA 1J5EQ 2D3LA 3CWBH 4G4KA 1V1PA 2FFKB 1R5BA 3PV0A 1VMPA 3GVLA 1DXMA 3ZUGA 4EVOA 2PCFB 1X3QA 1NE3A 4TWKA 1TWAH 3I72A 2WLNA 4JI6B 4DUZB 1AZQA 1NVPB 1NTMH 1XFOA 2P5ZX 3MXNB 4C3JH 4JI6L 2FMLA 5JEAH 2Q6IA 2QGQA 1XMQB 1LYLA 4DV2O 2OK8A 3ASOB 3HOVB 4WZKA 3QSYA 4W4LA 4RGMA 1N8RW 3V96A 2E5LL 1SNOA 2IJ0A 1XHZA 3DMUA 3VBBA 3PUWA 4GNXA 3HKDB 3IFXA 2XAQA 4TT3A 1WI5A 1F4NA 1OCRC 2F0NA 3GTLB 2XASA 4AYBG 3S1MH 1PHJA 1QR8A 2PTMA 1FVIA 4DUYO 1H2GA 1PJ5A 5C4ZA 1MABG 5LOVA 4WFBV 2K50A 5FLXc 3EFFK 1B4OA 1VQ9A 1XNQQ 4ZQ3A 1SSOA 2VZAA 2XWBB 4YJ3B 3K0XA 4UP8A 5EKLA 5EK0A 1WN7A 4JI8O 1BZKA 2MNAA 4XQQA 1F20A 2EY6A 1FFXA 3EVQA 4HNAA 3OUFA 4YELA 4JOIA 4DR3Q 1AFPA 3OT7A 2VYQA 3DSQA 2JGUA 3NWSA 4PI2A 5J2TA 3RD4A 3OIPA 3OGCC 1E43A 3TDQA 2QKCA 4JI1Q 3E22A 2XAFA 1TTTA 3I55B 3SJAC 4U68A 3K5MA 3KBXA 4AC9A 5KHHA 3CMAB 3Q8DA 1JOKA 4O2BB 2YU9B 1SE8A 5A2QL 1KD1C 3F5WC 4ALPA 5LMZA 3I4MH 2IY5B 4QL5A 1SR3A 3RVYA 2PNRC 2ZTDA 2A3QA 4KJOA 3SHLA 3Q39A 5E1AC 4TV8A 1HRJA 2JK8A 3X3MA 1Q82D 2F0VA 3QB3A 5DNFA 3A8JA 5EPKA 3U50C 3NPPA 2E5LQ 2Z4HA 2XT9A 5JJIA 1SQVH 4DGZA 3CC4A 4DK0A 2C2AA 4B3RB 1TWHB 2RA4A 1MABA 3CCRA 2GK6A 3OTOB 2PF4E 2IW5A 4DV1O 1H2LA 4X1KA 2ZL6A 5CDFA 5JOBA 4DR7Q 3ZN0A 2JGDB 1Z5VA 2OYNA 4LFBB 2UXDQ 4NXMO 1VJSA 1I5XA 2ZZGA 4XLFA 1PXUA 1WPXA 5IT9N 4LCUC 5IT9c 3JCZA 3OM3B 3ZMZA 1IKMA 1EIGA 4A3GG 2BSAA 4LFBO 4AF7A 4EKWA 2WACA 5CV4A 2F0DA 2DERA 1UPGA 5COYA 4DV4B 2HVJC 2UUBB 2B29A 3K0YA 4C56C 2D74A 5LL6Y 3CC4V 1VQMV 5HZAA 4QMGA 3R8BA 2CGOA 1M1KW 2FL4A 5JJKA 4XLCA 2KQXA 2UXDO 3IC7A 1HP8A 1TWHH 3MFYA 4LF9Q 2E1RA 1AR5A 1GO3F 4NB3A 2GJKA 1WOPA 2VQFO 2OK7A 4NVPA 3LSUA 1N08A 3TXSA 2GQFA 1PYBA 3J81k 1WCMG 4IIJB 4PC3A 1E2ZA 1U9RA 2VL6A 1JB9A 1G7SA 4Z4ZA 2OIGA 4GKJO 3OPOA 4HR7B 5EBDA 2ZE5A 3WBJA 4LWSA 5LL6S 4MVMA 4YY3B 3U11A 1PZJD 4J15A 1M90D 4D7SA 5EJWA 2UUAL 4NP5A 1E64A 1AH9A 1EFTA 2WAQB 5HURA 5CV8A 3ABKC 3L70H 3QF7A 1VQMB 4I50B 5FNVA 2Q6OA 2WP8J 3RNUA 4GX0A 2QW7A 3OR6C 2WJVA 4WZTA 5KSWB 1I4QA 4X64L 3V76A 1YITB 1I94L 1JPXA 2QE7G 2P06A 2RDCA 2QA4B 3HG9A 1V55C 4DYLA 1O7LA 1LM0A 1TUBA 1R4PB 3F2BA 3AVVA 1TKWB 1O7YA 3K5LA 5IT9E 4DR1O 3ZHRA 4EH1A 2KHJA 4LF6L 4DF7A 3BH4A 2SEBD 5DM73 1VQ9V 2QCPX 1HCZA 4YALA 5IYPA 2NN6H 3A3GA 2A74C 3EBEA 1IBMB 4C43A 4ZKBB 3HOYB 4TV9B 2UUCO 1QZHA 1EN5A 2E2IB 4H37A 1VF6A 2IU0A 1U2RA 4N3NA 4TQFA 5B5EZ 1D2DA 1H8EG 2X7RB 2YUAA 1VQLB 4CDEC 4HE5A 3GVKA 2ZT9C 4RGOS 3Q22A 3GWKC 3THOA 3D6CA 1K28D 2RBMA 1PPJH 4JI2B 3G4SA 1WFQA 1WSRA 3GVMA 3SVMA 2UU9L 1QVFA 4IT5A 3B2EE 2ZQMA 1IHMA 2IJIA 4MVUA 1ASZA 3ZRSA 3EVKA 3HOVH 5F2VO 4KHPQ 4XDLA 1K8MA 1Q6UA 2EYHA 4OWWB 4Z4UA 4A4IA 4A3BH 4K0KB 3ZBUA 1NBMA 2EIJB 1JR9A 4U9UA 4JYCA 4QFMA 1JWMD 5ITZB 1UD4A 5EKIA 4YAUA 1YX2A 5M3MG 2L6LA 3ASNC 4PC2A 2LW1A 2R7ZG 2LZJA 1VQPB 1NTKH 4DV1Q 3OMNB 5IGEA 4CC5A 1KK1A 4IUNA 1N8RC 2ZZEA 4DV3L 1P16A 5FO8B 1LNQA 4TSFA 5CA0A 2C4TA 4RUEA 1VQHA 2HT1A 2YV5A 4XYQA 3T4DA 1N36B 1EZVH 4MW8A 3UT5A 3LQ6A 2A06H 3H9VA 3STLC 1WJZA 1YJNV 3A1PA 3UCSC 1D5NA 5M5XB 3EFXD 2F23A 1BQEA 1B9NA 4K5WA 4LNUB 3D4RA 3ABLC 4MVQA 1JE5A 1BVSA 1EU3A 1WJJA 1R3LC 1SM4A 2DNCA 3JASB 2OEOA 3EQLC 2VQFB 3QIAA 4ZV4A 1RTNA 3BDLA 4GT1A 1FNWA 4BAYA 3H0GH 2VRZA 4H02A 4KHVA 3ES9A 2UXDB 3OEHA 4BBSG 4L5RC 2Y0SB 4WWVA 1E3PA 2Z6BA 4XIGS 4A3MH 1L2FA 4Q6GA 5B1AC 1WOCA 2OF1A 2XZOA 4MTGA 3OZVA 2R6HA 1B50A 4R8IA 3MHHC 5FKAC 2BSKA 3NXSA 3QNEA 4LNUA 4KY7A 1WAZA 4PC6A 4DQLA 2AQ1B 2PYKA 2B9ZA 5JJEB 2E2DC 3TS0A 1FX0A 2HCJB 4O42A 4ZI7B 1ZM9A 2EY1A 5ELDA 4X62L 3JD3A 3QO7A 1I18A 4B3ML 1HNZB 5DN6G 3OR7C 5LP6C 2J7ZA 1HJPA 4QUCA 3VR5A 3BA9A 4R6ZA 1E22A 3R66A 1IX9A 2P7TC 1SETA 3S3XA 5LXTA 1N33B 4XORA 4FLTA 2OWOA 4KL1A 1XQBA 5J35A 1I4XA 1UE6A 3CB2A 1GAWA 1YJWB 1PFNA 3ASNB 4JYAO 2ZR3A 4C3IB 5JVH3 2ZE7A 3OMAB 4NKGB 4KHPL 3S1RB 2LY7A 3ZHQA 1PRTD 3DM3A 4CS3A 3ZJYC 1K8GA 4Q5VA 1Q82C 4RD3A 4GS3A 3BY6A 2ZXWC 3MDSA 1QFZA 3B8HA 1IKLA 3WWVA 1GRJA 3BC9A 4IUTA 5IYCH 3Q0AA 1BHAA 2N49A 2B7BA 4DV2B 4IJHA 2HD3A 1W3SA 2L5TA 2MUYA 1B3QA 2QM8A 3I2ZA 4A3BB 3ZZTA 3A8TA 4JI5L 1H38A 5FO9B 4LMQD 3U9OA 3ZPNA 4X62O 4OGQB 4PV1C 1EUJA 1KIXA 5CBAE 2AMCB 3H1KH 1H9SA 5KUKA 1XMOO 2P3MA 4B3RQ 1CTMA 1FNCA 3TN2A 2EIMB 2L4NA 2B2WC 2M7WA 4E2LA 2EOTA 2YTVA 3HOXG 4G1BA 1K5QA 1Y1WB 1BLIA 3ULJA 2Q0AA 3W2DA 3M3YH 4YAOA 1W6JA 4Q0FA 4RD2A 1YSCA 4ZHQA 4X62Q 5EYPA 4UUJC 1KDAA 1M5IA 4FM0A 3CC7B 1A0IA 5IY5C 2EBOA 4LBWA 2H1EA 4HAEA 4LJZC 4DUZQ 4G57A 1SXTA 1SKVA 4V190 3GVJA 3B82A 1LT4D 4B47A 4JV5Q 2IHFA 1FYJA 4X7FA 4K0KQ 4L5QA 4PQXA 5CA0B 3CXHF 3WNDA 2LW7A 2IHEA 3TZUA 3S15H 2PQEA 1H9RA 1LT6D 3ZHVA 1XMOB 1TS3A 2JK5C 2BF4A 1PTOH 4O2AA 2AZ0A 3RGBA 3CRKC 4FXDA 3CQZH 1XMOL 4I50A 5FNVB 3GD7A 4OWXB 4Y7NB 2E2JH 3CCEB 1K33A 1KLGD 5IWAO 2WIIB 4TT3G 2NTTA 3GTJB 2AHYA 4LBVA 3ZIAA 1OGIA 4C2MH 3J81L 3KF6A 3QG1A 1HR0L 3JYCA 3UO2A 4L5TA 1J6QA 1AILA 4Y52H 3ZN1A 3RUZA 4H13C 1O78A 4JI1B 3RW0A 3SYPA 1BHBA 1K3RA 4YCWA 3GTLH 4G7XA 2VBUA 4XOTA 2F0MA 4P2ZA 5GONB 4P2CB 2CTQA 2PMZB 4Z1MA 4P6VF 1JB7A 3CRAA 1QH0A 1N33O 4X89A 2GREA 1I4RA 1Q3EA 1OCZB 1F2LA 2UUCQ 2N05A 2WLIB 4WFFA 2VB2X 1O9HA 2AHOA 5IYNA 4BS9A 5ELNA 4CJ0B 5IIFA 3PSIA 4DUZL 1UFIA 1N07A 3M7NA 2EIFA 4GLXA 3HR0A 2GSMB 1TWGH 4KLKA 4G7ZC 3S3WA 4HIOA 1XMQL 2PPBC 4BY7H 2JA7B 3JARB 3IL8A 1MZEA 4FP5D 1ZEQX 2CW0C 1J95A 3PO3B 3TBIB 1A62A 3N27A 4I55B 1IBLO 2UXCB 2GK7A 4KY5A 1YITV 2QMUA 3FKIG 2F93B 1GN4A 4AQYO 3J7AU 2B5OA 2F0PA 1XNRL 1KXLA 1B70B 1Q90D 2A73B 4XLEA 2CKZB 4GOPC 4L8JA 5IYZA 3ITPA 3KYHC 4HMJA 3AK3A 3CMMA 1R6TA 4NPSA 3CCMA 3H01A 3SJBC 2JJ2A 1SQXH 4UCUA 2A6HC 4X3UA 4C1NI 4X66L 1PP9H 1JJGA 4B3SB 2X6XA 1HR0Q 5J9PC 1KD1D 4JK1C 3OUSA 3JAMN 2JN9A 1BKBA 4PMWA 2F3VA 3AEVA 3JAWB 4Z4TA 3RYHA 1IYJB 4ODGA 3CW2C 4GCZA 1FNMA 5LMUQ 2E5LB 3S16H 2AWNA 5EBCA 2YEVA 4NNJA 2D0PA 1Y1VH 4QVAA 2R9RB 2ZL5A 1XTCD 1VQ4A 4HYOA 3GTKB 2B7CA 1K9MD 2BOSA 1D6EC 2B1GA 2E75B 5GAGC 2Z5UA 1FXHA 3GO5A 3GWOA 2DQ0A 1BQ0A 5DN6A 1EBOA 5B66Z 2Q8RE 4XYOA 3UDFA 4DV0B 3J80L 4RD4A 4RPDA 3PIOA 2Q8IB 1GM7A 2OTLA 1EY5A 2YXLA 4FYDA 1S4ZA 5CN0A 2EYMA 2ALYB 5LOVB 4YHHO 2Z3YA 2YWGA 1Q8KA 3MFGA 3PA1A 4HJ5A 4DR3L 4KHPO 3ULPA 5CBEE 3S2DB 2VBSA 1MBYA 2F4IA 2NVYB 1SMXA 5DEHA 2OBRA 1FXVA 4LP8A 4J0QA 4WQMA 1PH2A 2EULA 4JF3A 4QIWF 5CB4B 3R2IA 5KIXA 1WTVA 1VQ4B 2RCVA 3OTOL 1X59A 1BT8A 4UVBA 5IYBO 3OW2U 1B2RA 3VO2A 3CC4B 1QLEB 4C3HG 2QKAA 3JD0A 5KHIA 5BN5A 1JX9A 2CAZC 1E79G 1K0RA 1LTBD 2X6LA 3W3AA 1SFOB 5J2UB 3CEIA 3FB6C 4II3A 1FNBA 1QLEC 1BCPD 3KBGA 5KNBA 3TREA 3CPWB 1IBML 2K05A 3CC2V 2PIAA 1BPLA 4C0SA 2JYOA 1KKCA 2WAQG 5LP6A 2ITDC 4RHRA 5C3XA 1IBMO 2GHYA 3CHBD 2EIXA 1IBKO 4UV9A 1I0HA 3O65A 4IUUA 2C4UA 1WP7A 4DV3O 4RQFA 1I94B 2X6GA 3SK8A 3SPGA 4NDXA 3FB7C 1U0LA 1M9NA 2EJ7A 1K3EA 2QWQB 4BIOA 1XOUA 1KRHA 2HQEA 3A0JA 1QNUA 2KBNA 2ZIMA 4C1NK 1TT2A 5KNDA 3NUCA 5J2TB 2QDOA 1YHQV 2ID0A 1JQ0A 4DV7Q 1WD0A 1Y4MA 2FTKA 2JSOA 2L35A 2K28A 2VY3A 1K7DA 2EX3A 1PH9A 4IFDH 1Q81C 2PI5A 3AVUA 1EQRA 2L55A 3ERQA 1QCEA 4DRXB 1IBKQ 1QUQA 2P67A 3MMPA 1WYDA 1US6A 4WFEA 4BWAA 3T1HQ 5CORA 1G91A 2NUCA 4YY3O 3APOA 4Z2WA 3CCEV 3GTMB 4JI0O 2WLHA 4OPAA 1PV0A 1WORA 5NUCA 3M7MX 2KVOA 3OMCA 1HZBA 4L5SA 1R6KA 1E79A 3OSOA 3OHXC 2E2IH 4QQBX 1SZTA 1XUQA 3CJHB 5C93A 5LHIA 1ZM2A 2DYIA 2V1DA 2L15A 5ELEA 4JI4L 1PNLA 3VR2A 5KNCA 1VQ6B 1U5KA 3CAMA 3P20A 4P73A 2V7TA 1EZ8A 4J7ZA 3LNNA 4LK1C 4DV2L 4ME5A 1HNZQ 4G5GA 3PENA 3D31A 4JAVA 2EINB 4KHZA 1SE2A 5JCOC 3K7AH 3V05A 1YJNA 4O4LB 3RYIB 5AJ3Q 4A3KB 5M3MB 1Q81D 4QVJA 2Y4TA 1M57C 5FLXE 1I8DA 4R9WA 3F1ZA 4PNYA 2LJ2A 3WY9A 5HGQA 4LFCB 3MAQA 3P3NA 1QU7A 1BUVT 4XTCS 3I4NB 4RMFA 4DV7L 3FVQA 1G8ZD 1I7FA 2RCFA 1U4MA 4M8AA 2G9DA 1S0UA 3KDFB 4GNXC 4MW3A 3J81i 4XDJA 5LHGA 1OXUA 1VDZA 1MIUA 3ETGA 4X62B 1AI4A 3M3YB 3VOUA 2D3OW 2ZDIA 4QJFB 1XREA 1EP2B 3ZZUA 1EY7A 4HCEA 4WRDA 1N33Q 2O5IC 1ZWIC 5D5QA 1RM1B 1OHHG 1U4LA 1R9TB 4A3EH 1Z5WA 1CXZB 1WA8A 2VBTA 3KOJA 2WPDG 2CH7A 4PA9A 4U3JA 1T6YA 2JS3A 4DK6C 1PH3A 2R7ZH 1SN8A 3VYSA 1HFNA 3OMIB 1C7YA 3I55A 1S5DD 4DKAC 2VNIA 1MKHA 3BHPA 1NAPA 2GVBA 1RF2D 4MN3A 2UUBQ 1N32L 1QBZA 3AG1C 1NJIC 4A3IG 2K52A 1VQDA 2BM1A 4M4SA 3K8AA 4P75A 1IXRA 3BVOA 3T4ZA 2XRQD 4FK8A 3W7XA 4DV2Q 1JJCB 2V7QG 4N9TA 1CUKA 4LFBQ 3VA5A 1BSMA 4DR4L 2WLMA 3DWPA 4IUQA 4KTAA 5HY6A 4IPDA 1SYCA 3ERSX 1F9QA 1ESRA 3ASSA 5K36H 1Y1WH 3P27A 2HP8A 3CSXA 2CVRA 3T16A 1HA6A 4X05A 4J80A 1CQXA 3CCJB 2I46A 1XPRA 3BJUA 1TUBB 3LQEA 3KG2A 1L1OA 3Q4HB 3PIPA 2Q7HA 1H85A 4AF6A 4HEDA 4LF7B 3HB3B 1D5MC 4IPGA 3Q6SA 2DW4A 3SGIA 3MD0A 4YXWA 2B8GA 2YICA 1DJRD 3JAMi 5BR8L 3ABLB 1NTZH 1QQCA 1AZPA 2GBOA 2IT1A 4X3KA 1FD9A 3NQIA 1VF7A 3L71H 4OHJA 2NYZD 3CF5A 2XOKG 1HR0O 2ZBVA 3ZZ0A 4GKKL 3CPWU 4JI6O 3FX7A 4H9GA 2F95B 1Y67A 2F0JA 3AQQA 2H5XA 3IRBA 4GKKB 1CQVA 3QO2A 4B3GA 2Z6KA 3J7A5 4HTHA 3W7WA 4WBNB 1NJIW 5I9PA 5IWAL 3I3CA 3CCEA 2GUZA 1JA1A 3AVXA 1I4PA 3OYYA 3EROA 4DV5Q 4RA8A 1XEQA 4A3MB 5A2QE 2QWNB 3BEHA 4MVSA 4O4HB 1ZM3A 3OW2B 2YIDA 3AVTA 1I50H 4OOSA 1PTOD 4CJ2C 3OW2A 4FK5C 4DO2A 1JA0A 1E3ZA 3W5HA 1GHJA 2GA4B 4H0LC 1BOSA 2WYRA 1OCCC 3Q4HA 4TOIA 4MZ9A 2P4KA 3SYOA 2Z0SA 4DV6O 5KNLA 2IH1C 1J5EB 4ASUG 2E2JB 4B3SO 1GO3E 5H6QA 1Y1WG 3PO2B 3S2DH 1LT3D 2WAMA 4FN5A 2PZSA 3ULLA 2IH3C 1VQKV 2PO4A 3DGEA 1EIYB 3OD4A 1UD2A 5C3EB 3R65A 1WPCA 3PCOB 1P84F 4RG1A 2ZXWB 4ZHQB 1Q6HA 3PF4A 1IHZA 3GIRA 4X1KB 4BBRB 2F4NA 4UB6Z 3WU2Z 3TSSA 1WDTA 2M2LA 4X8AA 4PDLA 1EP3B 5BSYA 3CCJA 1IB0A 3ETDA 5EBMC 4G1VA 5EPJA 3CX5F 1COWA 2D62A 1EFWA 4BXXH 3U2QA 4K2KA 1UD5A 1R9TH 2L12A 1S72A 3J81c 3OGIB 2SNMA 2J0TD 3G6JB 2LGQA 4GKKQ 5CBFA 4GKJL 1I3QB 1TXYA 1JMKC 3SPIA 4QJFA 1TA8A 2CTPA 2F4VQ 4G7OC 3I56A 2B2YC 5IWAQ 3JD2A 3S1MB 1JMCA 4QIWB 1CA5A 5IGDA 2HIXA 4DV5L 2W0XA 3UE0A 3RN5A 4LFAQ 1IZ6A 3H3VC 4LBEC 2VNHA 2VJJA 2RCNA 2EVBA 5LGTA 1FGUA 2E74B 4K3AA 5AG2A 4Z4SA 4OIKA 2Y69B 1UEBA 2ENBA 1IJFA 3A74A 5JAVA 1ZUQA 4NXML 4ZKCB 1IBKB 3I90A 4IURA 5JEAJ 5L3BA 2F4VO 2HG5C 3STBC 4Y7CA 3MEFA 1K3BC 2K4KA 3NENA 4RFBA 4EQOA 5CV9A 1PJ6A 3K04A 5A9GA 4UCRA 1COWG 1WVLA 2QWRB 1EP1B 2WZPP 3DDYA 1Q86W 5C4JH 3VMFA 2MGSA 2WV6D 2XTIA 2ZM6O 1YNJC 5LGUA 1H95A 4QHYA 4I5SA 1BBUA 2B5UA 2YIAA 1I7PA 1NBMG 3LVBA 1BE3H 4QGUA 1MNGA 1WTXA 2JP1A 1A8VA 3NEMA 4QNHB 1NY4A 1RM1C 3D4DA 5AN9A 3HOYH 4OL7A 2EIJC 5ELCA 1GUSA 2Q67A 3T1YB 1VIBA 2CUGA 1V43A 3NR7A 2IX3A 5JVDA 4XKWA 4RCZA 4A3DG 2DYRB 4FF2A 1HTLD 4J7KA 2A1AA 2UXCL 2QWOB 4LF5B 1NS1A 3BCCH 2WLJA 2ZE8A 1FNDA 2LKVA 2R92H 2R92B 4BY7B 2OBTA 2EINC 1CP9A 4PDMA 2OTLV 1BJKA 3S14B 1SQFA 1EZJA 3VQWA 3I5DA 5EYPB 1BMFA 3V7AA 1M57B 2C5HA 5F4JA 4PA6A 3E83A 4IHJA 1BCPB 5C0XH 2EZVA 3ZMVA 1H9MA 3BZDB 3JD1A 2G38A 4DR3B 2Q4PA 3A8KE 4E6IA 4GNXB 1GUTA 2DUDA 3J80c 4DAVA 4JI3O 2UU9B 2F0IA 1Q86D 5IYBG 1PH7A 3SPJA 5ELOA 1I94Q 4LF8L 5C4XG 4P71A 2K03A 2XWJB 1PKXA 3E86A 1VS0A 5CB4A 3CCLB 4XL9A 1N32B 1SRYA 1STEA 2K5HA 4C3HB 4XT3B 5KHJA 4KD4A 3PJSK 4RAIA 4PABA 3ZYYX 5CV6A 1WTQA 2ILMA 1HWYA 3I56B 4YWKA 2A5HA 4RD6A 4LF9L 2WLLA 1KK3A 4RJLA 1II3A 1VARA 4C3JG 5H9CA 1SROA 4CKCA 5LHY1 2JIZA 1KAWA 3JAKB 3PMFA 2R92G 2IJKA 3HPLC 4HJ7A 4KN7C 3AG1B 3S15B 4OOVA 3TMEA 4RDKA 4O2AB 3CMEB 4DAPA 4JASA 1AI5A 1QGAA 1OXTA 2W6IA 5EKKA 4X20B 1F23A 3QFCA 2CFMA 4NR1A 1ENCA 1CKNA 2NZHA 4B44A 4LF7L 2VUMG 3RYIA 4DR3O 4DR2L 1N34L 2YEVB 2XVSA 2QA4A 4UY8C 5IYWA 2WZNA 4RLZA 4AI8A 5LMNB 1ENFA 2LO1A 2OCCB 4B3MB 3BY1A 4DV7O 4OOXA 2FMMA 5C44G 5K36G 3IFTA 2D9RA 2SDFA 1OB5A 1K34A 1HNXO 4XDXA 4JI2Q 2EFGA 4BW5A 1RSOA 2YXYA 2K01A 1UWVA 3EJIA 2C35B 4UDUC 3CP2A 1HZAA 5GADC 1PH6A 4LWSB 1Q43A 2R72A 1JWUD 3BYYB 3AK1A 3ONYA 3CPFA 3WOEA 2K5WA 3QO5A 2NN6I 3JASA 3ONAB 3ZHUA 1A15A 5DSZA 5KYIA 1A2TA 2B1IA 1D5XC 4HJ9A 1CK1A 5J22A 5C4XB 5H6RA 1Z7TA 1K0SA 2X0KA 1KP2A 3UO3A 5LBQA 1VEWA 2RHQB 1Y6XA 3R6JA 3TJTA 3HRZC 4I0XA 1KP3A 3MTSA 4KY6A 3OZWA 1TUIA 4WJ4A 5AFWA 4RKLA 5JQGB 3OAAG 1TWCB 2UXXA 1SNQA 2GVAA 4FXKC 4DXGA 4CH6A 2ZKOA 4MVOA 4ZCIA 3JATB 2DCUA 5TRDA 1JORA 4TKOB 4LF7Q 1K8AW 1EIFA 3BNWA 3JQRA 5LMUB 3IJ4A 4DUZO 3I4NG 5K5PA 2OT5A 2NN6G 1E0BA 4HBNA 3CESA 2WFWA 3I70A 4C2MB 1GD7A 4A76A 3CC2A 4YAFA 3QG5A 1FJGL 3MHSC 4P12A 3CU7A 2K5DA 1FJGB 1G6PA 4FFBB 2ZTEA 2Z0AA 3DTUB 4FIPC 4J9YB 5L3FA 3OEEA 3RMHA 4B3XA 1X4TA 5FJ8H 3GTQH 5I4DA 1PNKA 4Z4WA 3CCSA 5JVG3 3H6MA 5C6AA 3G6BA 1G2TA 2C9OA 4RD1A 2QA4V 2NBFA 5BZBA 3OTFA 1XWEA 2CH7B 1HH2P 5FO0A 4LW1A 1VMGA 1HHVA 2N88A 4QUZA 3DWQA 2ZXRA 3NTKA 4PMBA 4ZIBA 3HZXA 4A93B 1PRTF 5BR8B 1KNEA 2F1LA 1LO5D 1JCHA 4FDBA 2YXHA 4JI0L 1MD2D 3BAAA 1VQLV 1S72B 4JPRA 1NZ6A 4KUMA 4ZKIA 1ET6A 3RLOA 4Z1VA 3S17H 3HKBA 4UCVA 3KDFA 1JA8A 2JEUA 2DYRC 1E63A 4DV0Q 3X2QC 4ID6A 4DFAA 1VQNV 5A8AA 3RBZA 4FO2A 3VDYA 2NPFA 1W0KG 2KKWA 2R61A 4I9QA 3BCFA 3DM1A 3KJPA 1N0JA 1JJ2U 4BA1I 1G8MA 1VQ5V 1F9RA 1STBA 1XBLA 3KLRA 3T1HO 1GAQA 1LTAD 2ZXOA 3T1HB 1UD8A 3L74H 1UJWB 4O4HA 4DV4O 3D6WA 4HIZA 4H7BA 4B3MQ 2A68D 3BS1A 2F0TA 2Y4UA 1VQ6V 4YWLA 4NB5A 2F0OA 4B3TB 2L11A 3G71V 2K33A 1H2MA 5CA1B 2LGWA 3JAML 3S17B 5CMDA 5L3DA 5T1GA 4A3LG 3A3BA 2Q0OC 3A0HZ 3W2IA 1KJZA 2A8VA 1ZAUA 4RD0A 1KD1W 2Q8VA 2JXMB 1TY2A
chains in the Genus database with same CATH topology
2YI8A 3HKCA 2E75C 1IL8A 1TR5A 4WBNA 2QILA 1S5FD 3I8ZA 1KMHA 5LXTB 1JFFA 3A2FA 5I6WA 2AUJD 3NTIA 5IWAB 2ZIOA 1DOKA 2IM9A 1SMYC 3M4YA 2X53S 4XQNA 3SDZA 4BW9A 2B2VC 4B9WA 5J1ZA 4RWSC 2XHBA 1LT5D 2KECA 2F0EA 1KZLA 1LTGD 3RLFA 2BE5C 2JVDA 3UQ8A 1TS5A 3M7GA 3TP8A 2B2TC 4LAAA 3Q23A 5KEEA 3NHHA 2HCIA 4UZUA 1ZYRC 3WB0A 2A69D 3HKBB 1IYVA 2PUSA 1X3PA 1KDCA 3OIQA 2EJMA 5IGCA 4IN3A 1PTOB 3CRLC 1NUCA 4FM2A 1ESFA 1EFID 1RKNA 3AU7A 2B2UA 4WORA 5KRUA 1BNZA 3I73A 4DU9A 4K6DA 1KDBA 1IW7D 4L63B 1R4QB 2E74C 3AB9A 4NXNB 2F3WA 4XQJA 3A56A 3NBHA 5IYZB 1E2VA 4CHTB 1PMRA 3ICXA 1CFMA 1AP0A 4LF8B 5M5WB 4A3DB 1TVKA 4F6RB 1H2SB 1BQQT 4TUYB 2MJ8A 3MXPA 4TQUS 1STGA 4DV7B 4TSSA 3HOXB 1SAPA 2ZNJA 3K6OA 2WSSA 5JPMC 1KNAA 2V4DA 2QE7A 3AMUA 5C4XB 2PW7A 4DV3B 1O7ZA 2VQEB 4CH5A 2X69A 1T5XD 5HKKA 4K6LA 4HCSA 4FXUA 4KD3A 1EL0A 2PYJA 3MC0B 1I6HB 1H8EA 5C3WA 4G7WA 1F2MA 2PZTA 4K8IA 2DIEA 2F0SA 1XX8A 1B2TA 4BWGB 4XLHA 2GJPA 1D1IA 1S5BD 2X8KA 1VLYA 2XGJA 1VCIA 2BA0A 2NB0A 5I2YA 3FDTA 1LTSD 3SK6A 3BDOA 3TP5A 3PUXA 3N2KB 2M5SA 3NE5B 2MHVA 2O4XA 1KU9A 4YEJA 3KUPA 1SJHD 1GHKA 3VR3A 1T5EA 1M4UA 1EZ6A 3J81E 2TMPA 4TV8B 4AHCA 4X65B 2FHTA 3O13A 1W9XA 1MSGA 4DR6B 2JJ1A 3NTHA 2R93B 4O4IA 1JCKB 3BA8A 1G2SA 1L0YB 4BY1B 3N6RA 1PLFA 2KCCA 2A68C 1CHQD 1MGSA 4PI0A 1EWCA 1STYA 3CP8A 5K1PA 5CV7A 2KA7A 1LABA 1JQYD 3T4AC 2F43A 2XNDA 3SXHA 3J7AV 5JJJB 4NKLA 3BABA 2XZLA 1CQFA 3FEWX 2WKDA 2VWKA 3MXNA 4CS2A 2QDBA 2K7VA 1OXSC 3HGBA 1Q3LA 4R8NA 1BBXC 1AW7A 1CI3M 1ZKOA 2I07B 4EFEA 1HR0B 3E0JA 4RH6A 1RTOA 3OMGA 2K32A 1TVKB 4X20A 4X1IB 1BO0A 1PTOF 2NVXB 4UCOA 1STNA 4NXMB 4XN3A 2KEDA 4DK1A 2K1BA 4DV6B 1M93A 5TSSA 4LR3A 2N55A 4DV5B 3C2PA 1CT1D 1E2WA 4HSVA 4ZOLA 1WP6A 3T56B 2ZTNA 1Q1EA 3BG3A 3U9SA 3J80E 4FFBA 2PW5A 1SBBB 3JSLA 1PZID 3K5NA 2K04A 5JJNB 3LWUA 2RVLA 1EIHA 3BRCA 2X6WA 2IX0A 2F4VB 4B3FX 1EU4A 2EYLA 5E3FA 1FD7D 3PUYA 4JYAB 3WDNA 4JI8B 4KMUC 3PUVA 2VB3X 5LL6X 4JV5B 4DRXA 2VWJA 2C5CA 4S3SA 5JEAG 1U4PA 1TWFB 3R93A 1HTPA 3DUZA 4RGNA 3HP3A 3VQXA 2LS01 3VR4A 2RDHA 1D2BA 4XNFA 1SNDA 2KVMA 1GUNA 3S2HB 2NTSA 2KUMA 2VNUD 1QG7A 1DCZA 3GP7A 4OGQC 2F66C 2YIBD 1OB0A 1GUWA 3CHXA 1ENAA 3FRPB 5E1FA 1E1QA 3I91A 2EPBA 3SJCC 2JDIA 3U0ZA 2L1BA 2BCOA 5CYUA 2HDMA 1VMCA 1S5CD 1G6ZA 3BDCA 2RDGA 3JATA 3T51B 1MI2A 4X1IA 1TU2B 4K14A 3OOCA 1OO9B 4X3SA 4DNRB 1IYUA 3RYFA 4UCTA 2UUAB 2EYOA 4X1YA 1LACA 1OXVA 1B53A 4YJ3A 3K57A 1W6KA 2B63B 5FL7A 3G7LA 4KN4C 2HLDA 5DAUA 2OT2A 5HGTA 2HDLA 2WKCA 5C5LA 3H0GB 5IOCA 1QCBD 1WCMB 4U673 5C0XI 1F9PA 4RGTA 1DD2A 1BXTA 1STHA 4E0FA 5F2DA 1Z47A 1HPCA 1W0KA 1QOHA 3KLSA 1UNSA 1STAA 1GUGA 1EEFD 3BPZA 2WINB 4HMIA 5ELBA 3RFRA 1IBLB 4O4IB 2MP1A 3TZDA 5IGFA 1WTHD 4DR7B 1SYFA 1TS4A 4OO1H 4J8QA 4EEQA 1G6UA 1NR2A 1EFRA 4DXFA 3SK5A 1DYQA 5D65A 2ZNIA 3NWTA 1S5JA 2X85A 3QWNA 3HS0C 4U3JB 3WOFA 1SNPA 2TSSA 2L0CA 4JI0B 3NSWA 2IW3A 2QM4A 1FYCA 2ICEC 1O9GA 2HUGA 3OW7A 2RSNA 3Q24A 2DY7A 4AQYB 5A35A 3J7AF 2RDFA 4F87A 1QILA 4II2A 5M9OA 1TWAB 3CQZB 1OHHA 4XN0A 3NBIA 4G7HC 4KI0A 2E1BA 3QOJA 1EY8A 1RHPA 2R7ZB 3BVZA 4HN7A 4K5XA 5EZYB 2BDOA 3E6ZX 4P22A 4UCSA 4RCOA 3ETQA 1WD1A 1RCVD 1BDOA 2DNEA 5CC4A 1KMIZ 5JH7A 2Q7GA 1F77A 4DN4M 4UFZA 2XNAC 1O80A 2GV9A 2F0GA 2RQXA 1A3VA 3HOZB 3JARA 2HEPA 4KKTA 2EDGA 4WJWA 2B2TA 2YI9A 1CZGA 4FF4A 3L3OC 3J7YW 3G05A 2KQ3A 4KHPB 1ONLA 1JOOA 4ZUIA 2P22C 2EJGC 4JI5B 4TV9A 1FGBD 2EY2A 2VJIA 5JPNC 2BDNA 5C8YB 1PFMA 4I4TB 3N2GB 2XIWA 2BTQA 2EJFC 1HQRD 1PDQA 2D9UA 4X64B 1ZYRD 1PYWD 5LYJA 1QNKA 1TAEA 4PHZA 2PZWA 4K8XA 1CHPD 1XI1A 3KF8A 5EIBD 4QUFA 4A3GB 3SK4A 4XKVA 1HUMA 4ZAIA 4KJNA 4XD7A 1Y1VB 1TVXA 4FLYA 1Y8OB 4IALA 3OWEB 1C8CA 1EQVA 3UT5B 3MVVA 1LTTD 2A6HD 3K5OA 5KHGA 1ZXTA 1SEBD 1K83B 3C1FA 4AYBB 4L6TB 1FNUA 4QF4A 4V0BA 4DR5B 2AWOA 4ABNA 3FKSA 1JWSD 5CR3A 4KV6A 2M00A 1KTKA 1PFBA 4ULLA 2R6GA 4LFAB 2CHBD 5FPRA 3R2TA 1HW7A 1VF5C 4K5VA 1A6XA 4O2BA 3N2GA 4ILWA 4IUPA 1L8DA 3QJYA 4ZYSA 3QTCA 3MWYW 3S1NB 4B08A 4FLVA 3H09A 4X66B 3TP7A 3VYTA 2VUMB 2R3ZA 3GV6A 4EB6A 4FLZA 2Z8LA 4TUYA 1QE6A 3JAME 1EY6A 3VR6A 2RQ6A 4EFBA 4RCNA 4D7TA 2QJ1A 4XQFA 1PRTC 1BCPC 3DEPA 1Q12A 2OXPA 1U4RA 3DEOA 1UAPA 2XRSD 4GYCB 4LF9B 5LA6A 1HNXB 3LWEA 1F2ZA 4IIJA 3BVMA 2HHHB 2V31A 1EOTA 3VYUA 2JS5A 1I50B 3DHQA 4QCLA 2ZZQA 2EXZA 1HA5A 1EEID 1EY4A 4TRDA 1RDPD 5JJZA 4CGYB 4ZOLB 2YYZA 1YNJD 3URYA 4AILC 4DR1B 4ZLTF 1EY9A 4YJ2A 2AUKA 1TIID 3BCDA 3JALA 3GTGB 1NCVA 1SYDA 3ZS8C 1DZ1A 4I4TA 1EWHA 3H94A 1HNWB 2EYFA 3NK9A 1JE4A 1A2UA 1CZWA 4FLUA 2BA1A 4EB6B 4O1NA 1YEWA 4TQDA 1A3TA 4XLAA 1GOZA 4RAUC 3MEHA 4C3IG 4F8MA 1DGSA 4F6RA 3FPUB 1P49A 4I55A 1X32A 3IKJA 3NXWA 3MZ5A 1AEXA 4GQNA 4JI4B 4IUVA 2RJZA 1I4HA 2ZXPA 2B2WA 3LX0A 1JFFB 1D5ZC 4GZYC 2R9VA 1JOQA 2R9AA 3P7JA 2F0FA 5CA1A 2PGGA 1BF4A 1DONA 3GV3A 2NWGA 2R70A 1MSHA 2B8FA 4MIUA 2XOKA 3P75A 3MA2B 1GUOA 3QOLA 4XONA 5JH7B 4FM1A 4UAIA 5I2XA 1HXYD 1AN8A 4IFDJ 4CH4A 2X6YA 1XNQB 2CQAA 5E4XA 1SYEA 1E1RA 1TS2A 2F03A 2JE6I 4OO1G 4AVZA 2JEBI 2EY5A 1TGOA 5C5MA 2PY5A 5M5YB 3EA6A 1K8OA 1NT2B 1Q1BA 2Z1CA 3ND9A 3K59A 5G3LF 4LH6A 4K2LA 5IGGA 1HVXA 5LP6B 1D1KA 4DR4B 1UUPA 2BE5D 3HEJA 1Q8IA 1JB3A 2HCCA 2Z4IA 5C44B 4RHSA 2UUCB 4K8ZA 1SNCA 1QJOA 1JR0D 2IWHA 2F0UA 5IJ0B 1HQMC 3MHBA 5FPOA 3X3NA 1EY0A 2F0KA 1G291 3SR2C 2XZPA 1RJTA 3FKIB 4J1MA 5GONA 1HZEA 5M3FB 1UD3A 1B9MA 2IL8A 4HSPA 3TP6A 5KGUA 4DV1B 5EPLA 1H9KA 2CW0D 5JVDB 1KABA 3JSNA 5CV5A 4DR2B 1N34B 1XQ8A 4EQNA 1QWYA 2EYJA 4GKJB 1CM9A 2F1MA 5FO7B 2ZINA 4DAYA 3FPPA 1SMYD 5E4WC 1V1OA 1H8HA 4OX9B 1SQGA 1F2YA 1SYGA 2F0HA 1UD6A 2Z6BD 1XXGA 2K5QA 5D3IB 2KJXA 2XN9C 2PYLA 5J39A 3JAKA 5EIBC 5BN3A 1YNNC 1WTPA 1Y8PB 2QKIC 2F0LA 3NP8A 2QF7A 1SA0A 1V0FA 4XR6A 2B39A 4JI3B 2NVQB 1EYCA 4J6HA 3N2KA 4YJ2B 3SR1A 1JJOA 3VA7A 3HKEB 5KX5A 1EYDA 4A3JB 3A8IE 2A6EC 2L9HA 4PMCA 5BN4A 4FLXA 1RODA 2FMCA 5BMVA 1J8IA 3PIP3 1M8AA 5G3LD 2JA6B 5ISRA 4ZUJA 5EZYA 2NZ1D 2E76C 2RKSA 3E22B 4FF3A 1F9SA 3RYC