2F1MA

Conformational flexibility in the multidrug efflux system protein acra
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
246
structure length
229
Chain Sequence
TTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDMKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTMMPGMFVRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acriflavine resistance protein A
publication title Conformational Flexibility in the Multidrug Efflux System Protein AcrA.
pubmed doi rcsb
source organism Escherichia coli
total genus 57
structure length 229
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f1mA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2f1mA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f1mA02
3WB2A 2JEBI 2KA7A 5BN5A 4GYCB 3FMCA 5JJJB 3T51B 1GUTA 1GUOA 2AUJD 1FR3A 1Z6HA 2D5DA 2DNEA 2EJGC 1RSOA 4IQZA 1HCZA 1OXVA 1K8MA 1GUSA 1OXTA 4OGQC 1O78A 5C0XG 3A8JE 4KMUC 2E75C 4OO1H 2NN6H 3PUZA 5A35A 2A6HC 3H94A 1H2SB 2PPBC 4JK1C 4RCNA 1IYUA 3TZUA 3EQLC 4DK0A 2V4DA 1B9NA 3D31A 1ZKOA 1H9SB 2BDOA 2NN6I 4H44C 2BA0A 3ND9A 3L7ZC 4JBWA 2E74C 1H9JA 1DD2A 3OPOA 2EVBA 1YNNC 3LNNA 1B9MA 1V8QA 1VCIA 3A8IE 4I7ZC 3W3AA 1GHKA 2D2CC 4KI0A 2B8FA 2JEAI 1Y8OB 3SE0A 3OOCA 2K33A 4IFDH 1OXXK 3D4RA 2O5IC 1HPCA 3RLFA 4L8JA 2DN8A 4LK1C 4DNRB 4OO1G 1G291 2EDGA 1DXMA 3GD7A 3MFYA 4TKOB 1Q90A 1Q1EA 2A68D 2QF7A 3VR4A 3I73A 1E2WA 4GZYC 1I6VC 1TU2B 1ONLA 3QG1A 1V43A 3M85A 4KKSA 1H9SA 2A6ED 5D5QA 1CI3M 1OXSC 1O7LA 4KHZA 1IW7D 3IFTA 3BDOA 3I72A 5D5PA 1VF7A 1CTMA 4KN4C 5KNDA 1Y8PB 3HGBA 5K36H 1K8OA 5JEAH 3CRLC 2EJFC 4G7HC 4IFDG 1VDZA 4DNTB 1CFMA 1LABA 1IYVA 3NE5B 2L5TA 2BA1A 2K7VA 1Q1BA 1Y69U 3A7LA 4KKUA 2A69D 4H13C 2IT1A 2F95B 2YYZA 3MXUA 4G7ZC 4H0LC 3CRKC 2A68C 4PV1C 5C0XH 2NN6G 2R6GA 1H9RA 3VA7A 2KCCA 2BE5D 1Q12A 3LWUA 3DXJC 3M7NA 1QJOA 2PNRC 3FPPA 3OW7A 2D62A 2A6EC 1FYCA 3I4LA 3PUXA 3QIAA 1IW7C 4XTCS 1H9KA 1GUGA 1A6XA 3IKJA 3VR3A 4KN7C 3PV0A 3VR5A 2F1MA 1VF5C 3T53B 3PUVA 4TQUS 3U9SA 1TKWB 2JE6I 5JEAG 2O5JC 2Q8IB 3VR2A 1E2ZA 1BDOA 1GHJA 1HQMC 2B8GA 2CW0C 1E2VA 4XIGS 5BN4A 2DNCA 4DK1A 1HTPA 3WB0A 3VR6A 2A69C 5KNBA 2ZT9C 3ND8A 4KKTA 2PCFB 2F93B 3QJYA 5BN3A 3T56B 1OXUA 2BE5C 3BRCA 4G7OC 1GUNA 1Y8NB 1T5EA 2E76C 3P20A 3WB1A 1EWHA 2AUKA 1ZYRC 2EJMA 5JJNB 5KNCA 2A6HD 3PUWA 3N6RA 3KLRA 2LMCB 1YNJC 1LACA 3PUYA 3BG3A 3SDZA 1SMYC 2JXMB 4LJZC 5JJEB 3M4YA 1H9MA 4BA1I 2K32A 3GQBA 1PMRA 4HR7B 5K36G 3A7AB 1GJXA 4BA2I 1DCZA 3AB9A 1Z7TA 2AWOA 3WDNA 3A8KE
chains in the Genus database with same CATH superfamily
3HKSA 1PXUA 4JI6B 2EFGA 4K0KL 4PMBA 1EZVH 4JG2A 3OR6C 4R4QA 5AN9A 2WLLB 1CT1D 5HFMA 4JBWA 3WWVA 1Q5OA 1S0VA 3ZHQA 1ZL8A 1X9NA 2V7VA 4B3RQ 1R6KA 2O5IC 2HD3A 2AMCB 1M57C 1WB7A 1YI2V 4EGVA 2RA4A 3GWKC 5HZBA 4IURA 2BCOA 1TU2B 2KVOA 1U4PA 3QO8A 3Q6QA 3HOZH 2EJFC 4U7NA 1G7SA 1QX4A 1K4DC 1D5AA 1S3JA 2NV4A 4C56C 3R65A 1ZM9A 1VQCA 4NXNB 4EX5A 1J95A 2WLJA 1PVOA 5BR8L 5M5WB 3WB0A 1SNPA 4B3TL 1VQ8B 3FKSA 4FMTA 2Y69B 1Y8NB 4IW3B 4YALA 1WTVA 3TETA 4DW1A 2M6YA 4O1NA 2FTKA 3GTGB 3D0FA 1FR3A 4DKAC 3OTOL 5LMUQ 2ZD9A 1PH7A 4BS9A 2H3OA 1ESFA 5A35A 3I4NH 1SYGA 4GN4B 3OE7A 1MABA 1AR1B 1B9NA 5FO7B 4OO1I 3ZMZA 3TXSA 1COWA 1RKNA 4CS2A 2OK7A 5E79Z 2EBOA 2F1LA 3D36A 2DN8A 3MHSC 2LZJA 2P06A 2Z0SA 3I73A 1ZYRD 3CC7V 2LFRA 2NLJC 4DU9A 5CBGA 4IZ8A 4LF5L 1Y8PB 1N34O 3UDFA 2K75A 3PUNA 3CCSV 3HKDA 4IL6Z 4H7BA 2Q7GA 2VQEL 4WBNB 1AJNA 4K3AA 2GUZA 4M53A 4UZUA 1GN4A 1GHJA 2PW5A 1P16A 2B2VA 3ZPNA 1XHZA 1NMFA 1K33A 3HOXB 1UE7A 4B43A 4X1KB 3A8KE 4GUNA 1VQAA 2FVGA 2NTTA 1US6A 3BY2A 4XDXA 4LCUC 4Z1VA 4B3MB 2M7WA 4B9WA 5EKIA 5F4MA 3NTKA 1XNQO 4LF9L 4JYAO 4GOPB 3CC2V 3ABLC 3K5OA 1VQKB 5KHGA 3TP8A 2Q67A 4ZCIA 2HR3A 1JFFB 1HNZO 5IWAQ 4KY7A 2RHSB 1LABA 1R73A 4B3SO 4GNXB 1BQZA 4DR5Q 3CCLB 3RVZA 2UXCO 1AMOA 1VJSA 2JA6B 3HG9A 5IYDH 4JI5B 4OPAA 4KD4A 5IP7H 1MIUA 2OTJB 5C4XB 3HOZG 4IUUA 2ZXPA 5BN4A 4DAVA 1EQTA 4LFBO 1XMQB 1AH9A 4XOPA 3ERSX 3QFRA 3JAML 1FRQA 3N6RA 1YJWV 1V54C 5GTIZ 3A7AB 3C3TA 3I2ZA 3KJOA 2JEBI 1ZM3A 4TMXA 2K05A 2ZTCA 3UE0A 4XDJA 4UCOA 1B6QA 2XAGA 3R6JA 4R6ZA 2PPBC 4K5VA 1VQNB 1TWFH 2NN6I 3CXCU 1JICA 3GTOB 2HVJC 3GB7C 3F5TA 4BBSB 4B7EA 1OB5A 1Y1WG 3I5DA 1PDQA 2WLHA 3PQIA 2EJRA 3Q39A 4K8JA 1KHIA 4GQNA 2N78A 4ACBA 2KQXA 3J81k 1Y1VB 4UCUA 5H6QA 4JI6O 5ITZB 5G3LF 2X69A 3BU2A 3ASPA 3G6EB 1Y69U 4A3FH 4MVQA 4RQFA 5KNLA 1QVGU 3E22B 2Q6OA 2G5DA 3KEWA 1K9MD 1J5EQ 5FPOA 3OT7A 4GT1A 5IYWA 2KECA 4ZOLB 3TQYA 2F4VO 3G6JB 1K9MW 4C3JB 2L15A 2F93B 3B09A 4CH4A 2FMLA 3T4DA 3CRAA 3P20A 1BBWA 2XN9C 3ASNB 2PYKA 4JTDB 2BH8A 3G6BA 4NW2A 1SE3A 3H91A 1RSOA 1NKDA 5LP6B 4ME3A 1JVMA 2IPKD 1WOOA 1WP6A 2JJ1A 1JQ0A 2GN5A 3J80i 4LF6O 1OB2A 2DY1A 2Q6IA 5T1GA 4O4HB 2CK3G 3RYFB 4WWVA 2JGUA 1EEFD 3JCUZ 4I5SA 5ELFA 5JCOA 3ABMB 4A3JG 4LF4B 1YHQA 4QB4A 4O4LB 4ASUG 1Q6HA 3WU2Z 1VQFA 1U5KA 1YIJA 2ZT9B 3CW2A 2LXJA 1BJKA 2PE3A 1YITB 1SE8A 3I4LA 2YXYA 2HVKC 1QLNA 1QU7A 4CKCA 3QO7A 3E9IA 1I94L 1HFGA 1H8EA 4WFN3 2NVYB 2FL4A 4GN3B 2K5VA 3MFGA 4LF8L 5CV7A 3HOVG 1NY4A 3G67A 5FNZA 3D8CA 2PQAB 1B7YB 3TJTA 3O65A 4IN3A 1SC5B 1QR9A 2H94A 3NPPA 4ID6A 4YJ3A 4JI0B 1B06A 4JI7L 2OT5A 5LA6B 3HAGA 3QG5A 4ZRZA 3PA2A 1EIFA 1N36O 3H3VI 1IKLA 4AQYO 4X62L 1GO2A 1P49A 2F0TA 1T6YA 3CCJB 3OOCA 4NTXA 4DNRB 4DV3B 3CMMA 3GO5A 4PV1B 3VO1A 2E2IB 3M8AA 2JIZG 3DC6A 1C9OA 1I5XA 3NUCA 1HA6A 1K3RA 3D3RA 3FFQA 3PO2H 2A06H 2R6HA 2F23A 1PRTF 5IT9L 2HT1A 3SJAC 4KY6A 1TWCB 5ELNA 3RYIA 3H6MA 3RZOH 2VWJA 5I6YA 5IGFA 3GTJH 1X32A 3CCEB 1CZGA 1PH4A 1A8VA 4QVAA 3VR2A 4DUZQ 1ILQA 1QVCA 2WB1E 4A3FG 3ZUGA 5KYIA 3ZMVA 3RYCB 4DV4L 2WA3A 2XOKG 3S2HH 1TUIA 4JBJA 3TK1A 4CS3A 4M1KA 2EX3A 4AYBB 5FO1A 1WPCA 4IQZA 4W4KA 3LQEA 1RCVD 3E9HA 4LBEC 2Y69C 1T6XA 3CRCA 2UUBQ 1K73W 1IBLL 1HZEA 5GROA 4YWKA 3BCFA 2XAQA 3OPOA 4PJ0Z 4PNYA 5HY6A 2ZL7A 4OONA 2UUAB 3W7SA 3RMHA 4TV8A 3CJHA 4GZYC 4RWSC 2QGQA 1VQOV 3A3BA 1BX0A 1CTMA 1K8OA 3SR1A 5IYCO 5IT9c 1Q6IA 2WB1B 4GKKB 2YUAA 4X7DA 1VQLA 4B3RB 3CHBD 4MHEA 2G38A 4DUYL 3CB2A 1DONA 2X0LA 2P90A 5C93A 5IYPA 2KQ3A 2O5JC 1PH8A 4PGOA 2EPBA 3L2PA 3EJIA 3BCDA 5IT9E 3OW2A 1W0KG 3CSXA 4DV1Q 1BUVT 4OPHA 3SKBA 4Z4SA 2JA8B 2YDEA 3N27A 4LF5O 3E20A 3TRZA 4RD6A 2CE4A 4NBSA 1VQ6B 2DJGC 2MP1A 4CGYB 3I55A 3OM3B 2ZM6L 2VQEO 5H59A 1KKDA 1Q86W 3B82A 2XSCA 4ABMA 2H8PC 1SRYA 4OX9O 1B04A 3UCSC 5C8YB 4DAYA 4DV6Q 3VQVA 5KX5B 4MVOA 1N33Q 2QTZA 1BCCH 2MHVA 2LFSA 1DXMA 4J15A 1PFNA 1M9NA 4D7TA 3LSUA 2VNUD 5LMUB 1P8LA 3KOJA 1XDCA 2CC2A 1KP3A 3L75H 4GOPC 2MFIA 2ITCC 2K7VA 5M5WH 1I50H 1PL4A 4L5TA 1PYSB 1VQMV 5C3EB 3VQXA 1XTDA 4LF9O 2JE6I 3PO2G 4GNXC 2AKWB 4X64O 5LXTB 4O4JB 2VWKA 2F52A 4LF4O 1KUQA 1E1QG 4UP8A 4JI3Q 1JJGA 1TWAB 2OQ0A 3CCUB 4QY7A 2F43A 4L5QA 2Q0OC 4QIWF 2QILA 3EVQA 4APVA 1GJXA 4FJCC 5FLXL 2K5QA 1EFID 2OEOA 1V1OA 4P3IA 1PJ6A 2CAZC 3CMEB 4KMUC 2F0HA 3P7JA 5LHIA 2B2TC 3W2FA 3B8HA 2NB0A 2F0EA 3T1HO 2IJHA 4JI4B 5H6RA 3GTQH 3SE0A 3MXGA 4JGSA 5EKKA 2Y0SE 1Q82D 1CEZA 1MZFA 5EYPA 2ES2A 1QGAA 3L73H 3JQPA 1AIPA 2DERA 4PDVA 4JI0O 1KK1A 2DQ0A 4RMFA 4O2BB 2WIIB 2GTAA 2BE5D 3JAWA 3ERQA 1U0LA 1H9KA 4KJOA 4NNJA 1NTMH 2C35B 4UP7A 4HJ8A 1IJEA 5M3MG 3CP0A 3LDCA 4K2LA 4A3IB 1YX2A 4PZ6A 5KNCA 1PFSA 4RHRA 1NQTA 1K97A 2B2WA 2B9ZA 1PMRA 5IYBH 3LDDA 3K9AA 3GVLA 1ASYA 1JCKB 4PA6A 2ENBA 1JWSD 4DV7L 1PYBA 1KRSA 4JZGA 3UDIA 5IYNA 1PPJH 3ASNC 1KNEA 4FK8A 3TBIB 1SM4A 2V7WA 3H3VC 4NB5A 3SK8A 4TV9A 5LP6C 4QUCA 4JV5L 4DR3Q 3WQZA 2QDLA 4Y7CA 3TS0A 4WQMA 4X07A 1BXTA 4GX5A 1ET9A 5C4XH 1Q82C 2WLIA 1Q12A 3ABMC 5A2QL 5CB4A 2QJ1A 1ICWA 3WG7B 4ZHQB 3MA2B 3PUVA 2A74C 1LT4D 3BJUA 2UUAO 1QVFB 3MHPA 2ZT9C 2BE5C 1W34A 2OIEA 2ZNIA 3JD2A 2VNIA 4Z4VA 1QGZA 4QHYA 2BGIA 1SNMA 1KK2A 2CGOA 5D14A 1J5EB 1JOYA 4ABNA 3K7AB 2DETA 1SFOB 1WTHD 1NU1H 2EIMB 4I55B 3TZUA 4C3IG 5DM63 3OIPA 4X66B 1HA5A 2W6JG 5J39A 2VUMH 2M00A 2F0IA 1FGUA 2YXLA 2YC0A 4OPSA 1Y1VH 4CKBA 4L8JA 4TUYA 1HNWL 1O9HA 4A3DG 5TR9A 1H9SA 4QVJA 4YY3Q 4BY7H 3N2KB 5J2TA 2F0WA 4Z4TA 5FO9B 3OUSA 3A0BZ 2ZXOA 4JI7O 1BR9A 4PV1C 2XT9A 3Q4HB 2QEXA 2WAQE 1U4LA 2PYLA 3CPWB 2Z6KC 5GAGC 1XMOQ 2CTWA 3OZUA 4L6TB 1NBWA 5A2QE 4U3JA 1YJNA 5BSXA 1AW7A 3JARB 4IYIA 3C1EA 3G48A 1M93A 1XREA 4HJ7A 3MXPA 1Y76A 1HR0L 2N05A 1D8LA 2AUJD 4UCVA 3EFXD 3OAAG 2J4XA 1VQ9B 3PCOB 3ML0A 3OSOA 3MD0A 4U9UA 3AG1B 1UD8A 3FB5C 4MTOA 1GN2A 1C8CA 5ELOA 4POGA 5KHIA 4Z1MA 3CD6B 2BOSA 1X55A 4A5UB 4AI8A 4HCEA 4UVAA 1WCMB 5LHHA 2IM9A 4DV4O 2KSDA 3S17B 3ZZTA 1Q7YC 2WAQB 1VP7A 3KF8B 1VQGA 2UXBL 5KGUA 2MGSA 4I4TB 1W2BA 1R6TA 2E2JH 4XDLA 4PQXA 1B4OA 1NBMA 1VMCA 4MNOA 1IBLO 1GUGA 1LT6D 4MTNA 1B3AA 3MVVA 2N88A 3ZMTA 4LWSA 3CCRB 4KTAA 3K8AA 2W6IG 3A0RA 5BXZA 1FS0G 1KLGD 1EY9A 5CR3A 1PTOB 2D5DA 3AG7A 1MSHA 1G8ZD 3G4SV 4CC5A 4C7UA 4DV0B 4DUZB 3CXCA 1IYUA 1RL2A 2JA5G 2E2IH 1VCIA 4AILC 5IWAO 2NZOA 4N23A 3UO2A 3K5NA 1VQ7V 3K79A 1NB0A 3QFSA 3MFYA 4DR5O 2ADQB 4XDKA 1XNRL 1TWCH 2XGJA 2VUMG 1KAAA 1N32B 3FAVA 4PC7A 1PYWD 5E1FA 5IY5B 2DEUA 2UUBB 2XRSD 1OJHA 2KBNA 2M5SA 4I0XA 4FK5C 4JOIA 3KF6A 1BQ0A 1KD1D 4PZ8A 1TWGB 1BMFG 4X65Q 4YELA 2DCUA 5L3DA 4BY7G 2YTVA 2WPDA 1JORA 4XIGS 1UEBA 5DNFA 3CESA 3A8TA 4FFBA 1HRJA 5CV5A 2Z4HA 3KLSA 3I1FA 1NR7A 2I5MX 1Z5VA 4L87A 1HZBA 1Y6XA 4HN7A 4O42A 2B7BA 3WDNA 2KUMA 1Y74A 5C0XG 3VO2A 3CP8A 4P1VA 4ZI7A 1IB0A 2R93B 1HH2P 1AP6A 4DV1B 2VS0A 2PZWA 3VYUA 2A73B 2EYHA 2WKDA 4OOVA 2RQ6A 1VQ5A 1E0BA 5EBDA 4GZRB 3A54A 1STNA 2F3IA 4AHCA 4B3TB 4FM0A 5D5QA 2K1EA 4HE5A 2CGNA 5K36H 4CDEC 1J5EO 1MGSA 4AC9A 1JA8A 4HYOA 3CC7B 1QUQB 4X9QA 4DV6B 3OTOB 1YHAA 3A8JA 3BVZA 4X20A 1EBOA 3BNWA 4GN5A 2PGGA 3CCSB 1TXYA 1IXMA 1KL9A 2OCHA 1KD1C 1BGYH 4JI1Q 4UZEA 3DM3A 2ZCEA 5JJEB 3J7AF 4BBRH 5EGTA 4DV2L 1HZCA 4D7SA 3H0GB 5LL6Y 1O78A 1XE1A 3GV6A 2ZIOA 1B2RA 3L71H 3H94A 1NCVA 2AQ3B 1R3IC 2V4DA 1PFMA 1Q9SA 4FXKC 1E3XA 4JI3B 5I4DA 1HQRD 3G71V 5C44H 4IFDH 4DO2A 4II2A 2XASA 2EDGA 3ICEA 2ZE7A 3OMCA 3QG1A 1K8AD 3U4VA 3NBHA 5FO8B 2WACA 4RH6A 3CC2B 3LO8A 2XZPA 5C3EH 2MUYA 4DNTB 1K8AW 3UDGA 4ZYSA 2X6YA 2ZDIA 3I56A 1V1PB 2VQFQ 4DV7O 3S3WA 1L0LH 4YAUA 1K3BC 2WKCA 3C2PA 1CQVA 3SJZA 2K14A 3T1YQ 1S77D 1O7YA 4CHTB 4XLEA 1E2VA 3ZIAG 4WFHA 2E5LL 1UD4A 4LBVA 4JV5O 1W59A 2RSNA 1E22A 5LYJB 3WG7C 5LMNQ 4JPRA 4MTXA 4I7ZB 1QHTA 5LBQA 2D2CB 3BFRA 2N8NA 4H02A 3SK4A 1YJWB 2HKOA 4KP4A 5IJ0B 1IBKQ 1DD2A 1V8QA 5CA0A 3IL8A 3ULLA 2WAMA 4YAOA 2CH7B 2OBTA 1MG1A 3WNBA 2B5UA 3FHWA 2L55A 2EIMC 1TS4A 1ZUQA 3H9NA 1FJGL 1WTOA 2KKWA 3BHPA 3A7LA 2RBMA 1O9GA 2ZZFA 2F0FA 2WLLA 4Z2WA 3HKZG 4HJAA 1SNQA 5JVDB 4DR3B 1L2FA 1CHQD 3ZX6A 4EQOA 5CORA 1GK9A 3H15A 1HNWO 1UWVA 4IUQA 3H1JH 4X8AA 3FB7C 2HCIA 4XMYA 1ELOA 1PTOD 1VIBA 1BS3A 1YXBA 3PIO3 1V0EA 2DW4A 1F2LA 5H9CA 4BBRG 5IE8A 1LV9A 3HKEB 5IOCA 5D3DA 3IFXA 4A93B 3ZYYX 1Q81W 4R8NA 2KOLA 3DEOA 4P22A 1VQ8A 4LUVA 3AG4B 4TKOB 2VYQA 2QF7A 2WFWA 2JK5C 3AG1C 3M85A 1ONLA 3IRBA 3NENA 4K35A 3GTMB 4M8AA 1A3TA 5C44G 1PKXA 4IFDG 4HMIA 4KL1A 3OWEB 4D6TH 3OJWA 1F4MA 2IBZH 1WA8B 1K83B 4ZQ3A 1SYBA 2JDIG 3KFUA 4HAEA 1XXGA 3HB3B 4UAIA 1BKBA 3D26A 4DV1O 1SQFA 2W6JA 3WYAA 1FXKB 3CMAV 4Z4YA 3AK2A 4W4LA 1V9PA 4J11A 2QWNB 1ET6A 4YY3B 3SPJA 3CKIB 1UD5A 2O4XA 4JVZA 3K7AH 5CBFA 1SFOH 2F0JA 3CX5F 1VQKV 1AE2A 1CUKA 2UU9B 4CH3A 1CA5A 3QFCA 2Z6BD 5KSWB 2EJGC 4DV6O 4QFMA 3FVQA 2BTOA 1N33O 1OB0A 4WBNA 4A76A 1F9SA 2JGDB 1XMOB 5L46A 3AFPA 1PTOC 1JJ2B 1SQGA 3W5UA 2QA4V 1IBML 5EZYB 1QZHA 3LWEA 1D5XC 1O7LA 4LF8B 1KK0A 4WORA 4MSWC 1PH6A 4PC6A 4X1KA 2JYOA 2EJ7A 5FL7G 4L5SA 2F0KA 3MHBA 1SJED 4X3SA 2RDHA 3IKJA 3WXMA 5IY5C 3OFNA 4NKLA 2EINB 1ZAUA 4P3YA 5JOBA 5IODA 1STGA 1CK1A 4GOPA 4TMWA 5CV8A 1WTRA 4TMVA 2ODMA 1XNRO 3RN5A 4LJZC 3I4OA 2C5HA 1JFFA 1XFOA 2K6AA 1RPOA 1K3EA 5J2UB 1G91A 3JD3A 4RKLA 2RNBA 4LFAL 4YWMA 2WR8A 4GNXA 4GKJQ 2Q5ZA 3BPZA 3CCLA 1Q8IA 2BE3A 1LR1A 4UVCA 1IL8A 3F7YC 1WCMH 3F2DA 4Q0FA 2OTJA 1JR0D 1VF5B 3S17H 1SESA 1GHKA 3W7TA 3JU4A 4IHJB 4JI8L 4LK1C 2Q8TA 2RHQB 5B1AB 3R6KA 1EN6A 2B2TA 3FX7A 3J7YW 4B3FX 4G27B 2YU9B 3OEEA 3KDFB 2X0KA 1HW7A 2IX0A 3W2EA 3OD4A 3OMIB 2ETNA 2L9HA 1KMHA 1VQOB 2JQOA 2LKVA 1VQNA 2GREA 3G05A 3FPKA 4HJ5A 3E0EA 4UHVA 4UPAA 1BPLA 1AP5A 2Q2HA 1JA1A 1LT5D 4O2AB 5HXBA 1L0YB 1FYJA 1TIID 3ABTA 5IT9N 3T56B 2ZBUA 5FA6A 2EY2A 1T5EA 1YVWA 2VQFL 4IUVA 2XVSA 3P1HA 1KDAA 3Q23A 2GJKA 4X65B 5ITZA 3QFTA 4NTYA 5EBCA 4LF7L 3G6EA 4XLFA 3W2GA 4ME5A 1VQHA 2C77A 3E22A 4PD4F 1F51A 1FNBA 2BDOA 1MNGA 2GBOA 2YIAA 4ZOLA 3K0GA 2R9RB 3OZVA 2ZTDA 5GAHC 3NHHA 2GQFA 4ZV4A 4C2MB 4KHZA 2YIBD 3S1NH 1TWGH 4X3TA 4R8IA 4DV2O 1SYDA 2L5TA 1Q1BA 5LP6A 1SSOA 5FIUA 4TMTA 2KCCA 3M3YB 1WVLA 1WOSA 3WBKA 4ZKIA 2DJVA 1HQMC 1K5QA 4JYBA 1TVKB 3ETEA 2ZR3A 4O4HA 4FF4A 1HNXL 1VQMB 5FLMG 4R50A 3RYFA 2D0PA 3M4QA 3K5MA 4DR6L 4B3XA 1WOCA 1AP0A 4H44B 2R93H 3WY9A 2XAJA 2L12A 2HHHQ 3MTSA 4O4LA 2YS8A 1YBYA 2DE0X 1URFA 3GVMA 1H2SB 1YITA 2CTQA 1NB9A 1WOPA 5EK0A 2XTAA 3EQLC 3RW0A 5KYLA 2B63G 1HWYA 4L63B 1I7PA 3LGJA 4I7ZC 4JI1B 1D8TA 2HDMA 2D2CC 3VYSA 2E1RA 2QN6A 1S5CD 1QNKA 3I4MH 2E5LO 3JQRA 3ZJYC 1F20A 4OP7A 3OUFA 3HOZB 1JA0A 4Z9CB 2PQAA 3E8BA 1LTTD 2DY8A 1JB7A 4C3HB 1S0UA 5LA6A 3CRKC 1XMOO 1V55B 2VW9A 5F2DA 4X7EA 3EBEA 4XYOA 1BDOA 2XWJB 3CCJA 4X1IB 2DMXA 3H0GH 1FJGO 3BG3A 4CJ0B 1U97A 1K0RA 2FXQA 1Y1WB 2H5XA 1G6ZA 2Z6KA 4G6IA 4NXNQ 3BC9A 1Z9FA 3GTPH 2QWPB 5KMGB 3NEMA 4CH5A 3AYHB 2BM0A 1BQQT 1JB3A 3CCEA 4UP9A 2JA7G 3SYOA 4XBFA 3FB8C 3A0HZ 3SJCC 3WNCA 5LMNB 2R9AA 2O2LD 3RYCA 5CGKA 1EQQA 1WI5A 4JCVE 4QIWE 2E8GA 3J80E 4MZ9A 1Y14B 1S5JA 2R9IA 1IBKB 3AG4C 1ZUNB 2NN6G 1WTHA 3B8MA 2B2UC 5TY0A 3TREA 4FLYA 1GUWA 2VB2X 2YSUB 1YNJD 2Q7EA 2Q2UA 5DAUA 5NUCA 1F9RA 3L74H 2PCFB 1RODA 4IYHA 5EBLC 5B3SB 4DV5Q 1FXKC 1CM9A 1GRJA 3VMFA 4HIZA 4LUZA 4YHHQ 2AWOA 4CJ1B 4YXWA 3L70H 5JJJB 3OTFA 1M4UA 2VNHA 4DXGA 1UUPA 1SZXA 4A3JB 4Q5VA 4EFEA 5DLQE 3KG2A 3E8HA 1W0JA 3UE1A 2R93G 3ND9A 2QKSA 1AVMA 3P30A 2RVLA 3TP5A 1I08A 1FDRA 4QIWB 2JS5A 3R2IA 3AEVA 1ML0D 2CF4A 1D7QA 5C4ZA 4CBVA 4YAWA 3IFTA 4X65O 5EQ0A 3HPLC 2RQXA 5JQGB 3V76A 4B3MQ 1EP3B 1VQ6A 4MVRA 3I4MG 1GAQA 4KKUA 3HOVB 4A3CH 5FPRA 5IYCG 2D0OA 1SS3A 2PI4A 5C8YA 3GVJA 4Q7JB 5KX5A 3STLC 2A3QA 5LMZA 3BA8A 3ZC3A 5A2QN 1YNJC 1WP8A 1X54A 2JXMB 2EINC 4YHBA 1SQXH 1SQPH 4JI5Q 5HKKA 4A93H 1HFNA 4MVZA 1FRNA 1TWFB 3BY6A 2LS01 3KCYA 3NELA 5M3FB 3DSQA 1EN4A 1X3PA 4NXML 2DOSA 2ZXWB 4FLUA 2VY3A 3GTMH 4O4JA 1EWYA 4XLHA 2VZLA 3CCUA 2GTSA 1K83H 3E83A 1TUBA 1QCEA 4A3FB 1PH5A 4X7FA 5M9OA 1FD7D 4P6VF 3NXSA 4NR1A 4UB6Z 5B1AC 3CMEA 1BT8A 5K5PA 4OELB 5CV9A 1PH1A 1UPGA 4JI1O 5TRDA 3PV0A 4CDCC 2BPOA 3ZZUA 4GLVB 2RMKB 3ZRSA 2LJ2A 2HUGA 4GX0A 2YV5A 2UXCL 2LQTA 2ZL5A 2RC6A 3C3SA 2AUKA 2OK8A 4IIJB 1M1KC 1WTPA 1NR4A 4HAMA 4JW0A 4DR7L 4XKWA 1L1OB 5C5LA 1E7ZA 4DR1Q 1QB5D 2RKSA 3A8JE 3K58A 4O2BA 2IWHA 3JAMi 1EQVA 1R3JC 2V31A 4HTHA 3G4SB 3C90A 3CCMV 2CW5A 1GM5A 4FIPC 1N0VC 4E0FA 1LTGD 2PIAA 1Q1EA 1DF5A 4J80A 2VQFO 1YEZA 2RN9A 1WSVA 3Q6SA 5IJ9B 1PTOF 3E86A 3T1YO 1VQ7B 5AG2A 5L3FA 2HIXA 1VQBA 2Z8LA 1S5DD 1VLYA 5ELBA 3IGAC 1KZLA 1EZ6A 3K0XA 1YVCA 1HXYD 1M56B 2VNKA 5DN6A 1UD3A 1F2YA 3CCVV 3BYTB 4JI6L 2B8GA 1E43A 4EEQA 5LMNO 3QOJA 4FF2A 3DEPA 3W2DA 3PUWA 2F0SA 4PI0A 3FB6C 1QH0A 3V96A 4FXDA 4LAAA 2F0MA 3AB9A 2GJPA 2F4VL 2CQOA 3V05A 3K04A 2I1LA 4XR6A 4ODGA 1F60A 2QWRB 4H44C 1D5NA 4ZHQA 3Q6RA 4RAUC 4XYQA 2WZNA 1QVFA 2C9OA 3JATB 2Z9HA 4NXNL 2Q2TA 4IPGA 2R7FA 3VR4A 1F7YA 2ALYB 2A6ED 4RAIA 5IDJA 1SMYD 5LMNW 1CNFA 1PV4A 2ZE8A 5ELCA 5KNDA 3EHBB 1SNCA 3DWQA 2L35A 1PNKA 1NJIW 1FNWA 1L8DA 1THZA 3DXJC 4UV8A 4I55A 4CZZA 4I50B 4PDLA 3SLDA 2EY6A 5D65A 1KLUD 4B3GA 2QKAA 3S1QH 3M4PA 1EYCA 2HG5C 4PMWA 1BQEA 2BN4A 3BYYB 1V55C 3S2HB 4IUTA 2R9VA 4QUZA 3MHHC 1HZAA 1W87A 2WA4A 4TSFG 1I4RA 3QSYA 5IYDO 1RHPA 3N2KA 1RQRA 4PA3A 2QEJC 3ZCCA 3JYCA 1FL0A 4G2KA 3QVNA 3QF7A 4ALPA 5LOVB 3M4OB 2Z4IA 3F2UA 4WFEA 3Q4HA 4RD2A 3HZXA 4QUFA 3GTKB 2ATKC 1ENVA 2V7QA 3CP1A 3JASB 3CPWA 3L9AX 1N08A 3B8NA 4F88A 3RLFA 3PN1A 1N36L 2YI9A 2PTMA 3ZHVA 3G71B 3M3YH 5M3MB 3JARA 1FAFA 1R5OA 1VQIA 4IPDA 4XORA 5E4WC 1KDBA 2BCCH 3AK1A 2UXDB 1QILA 2K5NA 3ONAB 1V1QA 5C5MA 2FINB 1TS5A 1SDFA 5KLVH 2WZPP 5IGGA 4J1MA 1M4VA 1VQ9A 1JWUD 2A6EC 2LP7A 3PENA 3CS5A 5JJLA 3ZRWB 1RJTA 5J35A 3SPGA 5BZBA 4DR2Q 1OCOB 1ESRA 2IU0A 3CYOA 1H2MA 4B3ML 3CD6A 4KKTA 4FXUA 4O0AA 1AB3A 5LHY1 1IX9A 1B23P 4JZ2A 3CF5A 3OMGA 1UJWB 5H1SE 2XNAC 1D1NA 4GKKQ 2RCNA 1KU9A 3KF8A 5B66Z 2K28A 2CDYA 5EC2C 1NVPB 1SA0B 3NQTA 3FYEB 3C1FA 3KLSX 5B3SC 5B1OA 4TMZA 2X53S 3DGEA 5JJKA 5A8AA 1GTOA 2QTLA 1CPYA 2P5ZX 3CCRA 1TT2A 3T4AC 4C3HH 1L0WA 1EXMA 2ZNJA 2JS3A 2QTSA 1XPRA 3H9VA 1EFRG 4KY5A 1I50B 5I9OA 1SR3A 1XMQL 3APOA 2JN9A 4XQFA 1JOKA 4DAPA 2G9HD 3PUXA 4QQBX 2DYRB 1OHHG 3HOWG 1E1TA 2P6JA 5JVH3 1SLJA 4YEJA 1IL2A 1Y1WH 1S5HC 5CC4A 4P75A 3JCZA 1X3GA 5KUKA 4C3IB 4GKJO 3BRCA 3AVWA 3SPIA 4P2NA 3WB1A 4FF1A 2HLDA 3LVBA 2M2LA 1E63A 3ASOB 3HOUH 4JTCB 3MDSA 2F4NA 3HOYG 1K8GA 1KTVA 2LW7A 1YI2A 4CJ2C 4LFCQ 3KBGA 4A3DB 1AI7A 2I5LX 2N04A 1A62A 1P4MA 2QR4A 1A2TA 2X8KA 1FXHA 2JJ2G 1XWEA 3GTQB 4DGZA 2SDFA 3FKIB 2GVBA 4DV5B 2DUDA 2C78A 4A3BH 1H8HA 2KHSA 2VXWA 4YHHB 4XXEA 1KTKA 1LTLA 2Q9LA 4MTKA 4WFBV 2PI2E 4OX9L 2ZXWC 4TT3A 5GAEC 1PZKD 4YJ2B 2Z6BA 1EN5A 1EY8A 2N74A 3K57A 4JI4Q 5TSSA 1E1RG 3NWSA 2J7ZA 4PI2A 3FPPA 1CSPA 3AMUA 2Y0SG 1QE6A 3W5VA 4HE6A 3N52A 4NXMO 4X1YB 1X3QA 1QCBD 1F77A 1QWYA 2EULA 2OCCB 1T5XD 4IJLA 3NQIA 4OGQB 3CMAB 1EU3A 3KLRA 2EY5A 4A3JH 4BA1I 5KEEA 2XZLA 3U50C 5CA1B 4X64L 1QR8A 4M4SA 1K8MA 3SLNA 4LF4L 3CC7A 3Q3AA 4HNAB 3B6YA 1QUQA 4HBNA 4C43A 3IC7A 3W7XA 4MVSA 3OJXA 1B1ZA 4RPDA 1L1OC 3CCSA 3BDCA 1W2BU 5ISRA 3PSIA 2HDNB 2IH1C 2Q8RE 2UXNA 3T1HL 3HOVH 2R92H 2DY7A 2I0QA 4QGPA 2XIWA 2H1EA 4DR7O 4IPCA 4F6RA 2QA4B 2R7ZG 2VBVA 2DOGA 4C3HG 3S15B 2DYIA 2WLMA 2YTYA 4JI0L 1E79A 3CPXA 3GP7A 2HHHO 1KQSB 5F4JA 3A8IA 4WJWA 2GK6A 1M56C 1K7DA 3K9SA 1KC8D 1HZ9A 1SE2A 1HNZQ 2JA5B 1E3ZA 4F8MA 1AZPA 2EYLA 5HGQA 2BM1A 1LO5D 5M3FH 1YNND 4B3SQ 3CC2A 1KC8W 2QW7A 2QE7G 4DV3L 3SJBC 2XNJA 1BBUA 1MA1A 1V1PA 1EP2B 3J81i 3WBJA 1UE6A 2VUMB 4FNFA 1AROP 1XI1A 3D31A 3GIRA 3A5UA 3NK9A 4YCWA 4DR4Q 3HOUG 4K2KA 3T1CA 3JALB 5D3IB 3W3AA 2IH3C 2L11A 5F2VO 4LFBQ 2DWEC 4LC1A 1SEBD 1FXVA 4BY7B 1H85A 3DDYA 4DRXB 3N2GB 4DR1B 5LYJA 3ZMSA 2EZOA 3W1GA 1UEAB 2BSKB 4F7XA 4A3BG 4X66Q 4WZTA 4XQQA 1SNDA 4JYCA 1YJWA 4LFAB 2K1BA 2QKIC 5IJ0A 4POFA 1K5SA 1H42A 4G1BA 2XNDG 3OGIB 2Z1CA 1B53A 2DNCA 1QFJA 1B2TA 2CH7A 1A32A 4NXNO 1R5BA 1GO3F 3ES9A 5JAVA 5FKAC 1ZTEA 4JI8B 1Y4MA 2YIBA 3SK6A 1AN8A 2UUAL 4IUNA 1VMGA 3BZKA 1NVPD 2E3CA 4GLAC 1B50A 3OEHA 1KC8C 2PO4A 2BDNA 3ZBUA 2N3SA 4JK1C 1EWCA 3OMNB 3PIOA 4MW3A 2XUMA 1UNSA 1YNNC 5JVDA 2DJFC 4GKKL 2GK7A 3TP6A 4B3RL 4H13B 1RM1C 1A3UA 2UUCQ 3CCQV 4Z4UA 2WLIB 4JBKA 5CB4B 3QE2A 1ZEQX 3KJPA 4DF7A 4JAAA 2EYOA 1TS2A 1AI4A 2E2JB 4RA8A 1JCHA 1EYAA 1XUQA 5CDFA 2X6LA 2QWQB 3CW2C 4LF7B 2R92G 3FKSG 4XOTA 3E0JA 4LF6Q 5DEHA 1GR1A 1NRKA 3KZIZ 1BZKA 1I3QB 5KNBA 4YWLA 4HEDA 3SJPA 2B2UA 4FDBA 1SROA 4AYBE 3OE7G 1EIHA 3A56A 1MABG 4G5GA 4NVPA 2ILMA 4BXXG 4LH6A 3NBIA 1OCOC 3P26A 1G6PA 2F0OA 1GUTA 1COWG 3VQYA 1PV0A 3APQA 3KL9A 4TUYB 2CTPA 1BCPC 5LMUL 1WA8A 4Q20A 3VYTA 1H9SB 3W5OA 5M3FG 4TWKA 1FFTB 1FXKA 4H33A 1I18A 4U68A 2OTLV 1WTWA 4B9XA 1DM0B 4B3MO 3UM7A 2RCVA 5IYBO 3RD4A 3TGUH 4C1NI 2WLKA 4KHPB 5AJ3Q 2CKZB 3I90A 4ZCMA 1A2UA 4KHVA 4DV0Q 1BL8A 4DR6B 1YTFB 5LGTA 5KAFZ 3HKZE 2OWOA 2BTQA 2P5OA 1DG1G 4LBYA 2HQLA 4N9TA 2Q6LA 3JSNA 2JGDA 5JVG3 4P26A 4AQYQ 1FX0A 2OBSA 5FJ8G 2EE1A 1GN6A 4JI2Q 1RP3B 1JJ2A 4QJFB 1Q3LA 5EJWA 4JI5O 1N32Q 2EQSA 2DYRC 5EZYA 4JI4L 1E64A 4U3FH 1KAWA 1QUFA 3M4OH 1R3LC 1JMKC 2ZZGA 2WSSA 3B77A 4EQ5A 2P4VA 2NZHA 2NPFA 3VNVA 3IJ4A 3ZHUA 3GTKH 5CBHA 5JJIA 3SEBA 1XMQO 4K0KQ 4A3EG 3E89A 3KBXA 3HFZB 4DR2B 1G2TA 4X0CA 1GM8A 1SMXA 3ASOC 1J6QA 1S76D 3RLOA 1SNOA 1WP7A 1YHBA 4KI0A 5M3MH 2ZTGA 1GH6A 2Q6KA 3HKZB 1TGOA 3CRQA 3ONUA 2KB1A 1LLRD 4OHJA 5IWAL 5J2UA 2TMPA 3J80N 1VDZA 4JTAB 5GADC 5IGEA 1YJ9V 1TY0A 2IX3A 3MXUA 3ABUA 4DR5L 2JVDA 3HKCB 5J22A 4XLAA 5BR8Q 2XTIA 4MYUA 3M99B 1FKAO 2D3NA 2A9HA 4B3TQ 2IW3A 3NWTA 5JEAJ 1WU8A 3SDLA 4IHJA 4QCLA 3OMAB 4RWUA 1GN3A 4BBRB 3DXRB 4JAUA 3HEJA 3M4YA 3F2CA 4HR7B 4QPKA 1JOOA 4BPRA 1EUJA 3KDFA 3OTOQ 3ER0A 1KB9F 2OCCC 2VS1A 4OGQC 4R1JA 3MWYW 3PUZA 1VQOA 1LTSD 4LP8A 1LYLA 5KA5A 1U2RA 1XOUA 3I7FA 5C44B 4FZ0A 3J7ZC 2IJKA 3S1MB 1MZEA 2GSMB 1SYCA 1R3KC 4J42A 2ZZEA 1M5IA 1G51A 1QVGB 3S1RH 1AJPA 1T6ZA 4O2AA 1OZ0A 4XQJA 4YIOA 1I6VC 2Z0AA 4LFCB 5JPMC 2KCNA 4C1NK 1IW7D 3IC9A 1STAA 2FKXA 1XX8A 1CZWA 3B78A 2BH2A 1XL6A 2QGNA 2VQEQ 3T2MA 1RFYA 4C3IH 3ASTA 1K34A 1QLEB 1J5EL 3PVDA 5J3OA 1I8DA 3J7AU 5F4OA 4UB8Z 4MVMA 1EWHA 4A3DH 2E75B 4I9QA 4TSSA 4BWGB 2RJZA 3H09A 2JJ1G 2K32A 3CC4V 2Y0PA 1N8RC 3FKIH 1YDXA 1CHPD 2F0NA 2WP8J 1VQPV 4JYYA 2ZE6A 3A55A 4LF9Q 1BHAA 1RPRA 1Q82W 3FRPB 1PD3A 3F7VC 2A7WA 1TVKA 2G9DA 5CBEE 3ZN0A 1N34B 3H1IH 1VQMA 4IFDI 2CBXA 1E2WA 4PA7A 4BY1H 3THOA 3NTHA 1HP8A 1SRUA 3CRLC 1H8EG 1D2BA 1W6KA 5EMNA 4DV3O 4M0LA 2EXDA 2A19A 1KECA 5M5YH 3QIAA 1IW7C 3EIVA 4G7WA 1K0SA 1FPOA 4ZCKA 2LW1A 1J8IA 3JD1A 3CTAA 1UE5A 1PA6A 1VQ4V 4B4DA 3DTUB 3ZBTA 3D3IA 5IP9G 3DLLA 2WWWA 5H2FZ 2KA7A 1S72V 5ELDA 1XNQB 4JYAB 3MMPA 1OXTA 4OOSA 2P22C 5GQOA 1HJPA 4RFBA 1OGIA 3H1KH 3H1HH 2Y4UA 2EYPA 3JAKB 1HNZB 1RIPA 4G4KA 1X6OA 1S5LZ 3D4RA 2OCEA 2Q8VA 4B3SB 2UXCB 1KNAA 3S15H 3QOLA 2DGYA 3LQ6A 1ZM2A 3CCMB 4H37A 1YTFD 3SHLA 4K5WA 4DR4B 4H13C 1EZJA 4MYTA 3SYPA 1LT3D 2F0DA 4A3KH 3B4SA 3QWNA 4LFBB 2B3GA 1F9QA 2PMZB 5KMGA 1GM9A 2MJ8A 4KN7C 2IHFA 2JA5H 2QGGA 4KV6A 1MOFA 2YI8A 2OXPA 4GKKO 1GAXA 2YXHA 4DUZL 5JH7B 3CXHF 4B3RO 1Y67A 4P9SA 1V5VA 3CCVB 4K5XA 3W5HA 1XQ8A 1Q7YD 1I4HA 1KK3A 1Z7TA 5KA6A 4ILWA 4CKEA 3C3LA 1R1BA 1GUOA 2C5BA 4JF3A 2IL8A 1Q7YW 1FNMA 4PMCA 2ZJPA 3Q24A 2UUBL 4A3GH 2CTRA 3FKIG 1B9MA 2BVNA 2LXKA 2UU9Q 2JN4A 5IIFA 1QG7A 2B39A 4KKSA 1OXSC 1S4MA 1X4TA 1Y0YA 4ZCLA 2CK3A 1A8PA 1BHBA 3E2EA 3TZDA 5C0XH 2F4VB 5LMUO 4OL7A 1FYCA 4BY1G 1S3OA 4A3MG 1I94Q 4DQLA 3VOUA 2LSSA 1AJQA 2UUCB 4ASUA 1TS3A 2QDXA 1M8AA 4YIPA 5FK9C 2PZTA 1JT8A 2OF1A 1VQJA 5HURA 2VZAA 5FNVB 4LF8Q 5KAIZ 2CFMA 4FP5D 4A3LG 1JQYD 2ZXIA 3E3XA 4LFCO 1QNMA 4XD7A 2B63B 2E2HB 4DV1L 2K04A 4F6EA 1H9MA 2L0CA 1OCRB 5GONB 4JASA 3GTLH 2EZPA 3B2EE 2N49A 5JQGA 4JI7Q 3HP3A 3J7A5 1OCZB 2YWEA 4LF6B 1OCCB 1WYDA 2BOBC 2CH4A 2B7CA 1EYGA 4X62Q 4JBMA 2CHBD 4BIUA 4TN1A 2KEEA 3R3OA 4DV6L 1OXXK 1YEWA 1N33L 4XLCA 1X3EA 4JI4O 3ITPA 1SZTA 3ABKB 3T16A 3F5WC 1H2LA 4B47A 3Q22A 1EU4A 1WSRA 1SAPA 2F3WA 1WAZA 3IFDA 4PZ7A 2IT1A 4FXGC 1D6EC 1I3QH 2JIZA 1EL0A 3GWOA 2F43G 1EQRA 1EP1B 3BABA 4DK1A 3BAAA 2D74A 5CMDA 1ENCA 4NP5A 3OGCC 4A3KG 4DV4Q 4RDJA 4RDLA 3DM1A 4JI3L 3CQZH 2JA7B 4X7CA 1N36B 4WZLA 1O7ZA 5E7NA 4FPPA 4A75A 4AQYB 3EXAA 4TRDA 3FEWX 4JI2B 3PO3G 1IBLQ 2XOKA 1N0NA 1MRZA 2JP1A 4JMQA 4O4IB 5HFLA 2AQ2B 5I2XA 2PW7A 1IVSA 1BCPF 3ETDA 1BE3H 4DK3C 2WV6D 2I07B 1G291 4ZK9B 3LUTB 3S1NB 1WN7A 2DN9A 4K0KB 2OYNA 4A3GG 2NVQH 4IIJA 4FO2A 3KK7A 5D5PA 1IXRA 1KD1W 1DDGA 1L1OA 5CYUA 1BNZA 4JOIC 2I46A 4O2DA 5JJZA 4DUYQ 3EN2A 5L37A 1IZ3A 2F1MA 1LUVA 4K8IA 4NPSA 3G4SA 3ND8A 1PLFA 4G7XA 2AHOB 2ZL6A 2OQKA 1ZYRC 2JJQA 2IX1A 1VHOA 1SETA 1QLEC 4QPJA 1M90D 5IJ9A 2BSAA 1SE4A 4N8FA 1XBLA 4DR4O 3UO3A 1VQ7A 4IO9A 2YEVB 4IJHA 5BR8B 1W0KA 1M90W 2K5DA 2ZM6Q 3PJSK 2E75C 4CQJA 2WINB 3A8IE 2VNJA 2QM4A 3I4MB 2B1IA 2K33A 3D4WA 1NAPA 1KIXA 2Q6AA 4X66O 4DR3L 1F2MA 1ZXTA 4LW1A 5B1BB 4P25A 4A4IA 4MTFA 3QO2A 1RQPA 1MJEA 1EFWA 1GOZA 5EKLA 3STBD 5K1PA 3U9OA 5DECA 3I4NG 2B5OA 3W7WA 4EH1A 5KW9A 2PI5A 4NTWA 1YHQV 4LF5B 3JATA 1EY6A 1YZ6A 1CQFA 1MMMA 2ARHA 1GD7A 4P12A 1YIJV 2X6WA 1CSQA 2R3ZA 2VQEB 3HR0A 2J7KA 4FLTA 1V0FA 3S1MH 4OX9B 1AE3A 3GTPB 1E1QA 4DW0A 4LBZA 3W1BA 3R66A 5CN0A 4RKBA 3JAMc 1XL4A 3U6KA 1M90C 2UUCO 1XTCD 1XB2A 2EYMA 3KKYA 4I50A 2NVTB 2VBUA 2NVXH 3OZWA 1WPBA 2K4KA 1TY2A 1UD6A 4P74A 3JAME 3JC66 2PZUA 1HVXA 5CV4A 4YY3L 2CWPA 2H4OA 1E1OA 4LF9B 2ZDIC 4Q6GA 1HA3A 4FVMA 2C2AA 2Q0AA 4HSVA 4G7ZC 5LOVA 1DZ1A 4GCZA 1FD9A 4X64B 1SKQA 3E35A 4DXWA 3SYQA 4KLKA 2UU9L 2R70A 2VJJA 4RJLA 2GJRA 3RYHB 3JASA 1GM7A 4M2LA 5LGNA 1WJJA 1EEID 3STBC 3CHXA 2PQEA 1XMOL 1BF4A 2PUSA 2QSAA 3NTIA 4YCUA 1OGJA 1AI6A 3G71A 1NTGA 4MTGA 1PNLA 1R4QB 3LX0A 3T1HB 2PF4E 1DCZA 4GYCB 4K8XA 2LY7A 3S14H 1EOTA 4DV7Q 4Z1MG 3HRZC 5IYDG 2HJFC 2VBTA 1ZLZA 4K6LA 3O9OA 1LNQA 1K9MC 5IP7G 3I3CA 4N9PA 4PA4A 3ZRWA 1WORA 4NB3A 3BVMA 5C3WA 2K50A 2EYFA 4DV0O 4DUZO 4JV5Q 1NTZH 3ULPA 2DYSB 1STEA 4MT8A 3PMFA 5IGBA 2AHZA 3BZCA 2ZQMA 1NBMG 4DPGA 2TSSA 2OBRA 2ZTEA 4FWTA 1EFUA 3PIP3 1S5ED 4JI2O 1SA0A 3A0JA 4XT3B 4U7OA 3FD9A 1KKCA 5EIBD 1UMKA 1N32O 1D2DA 2UUBO 1PHJA 3U9SA 4F4LA 4XT1B 1PH2A 4K0KO 1Z47A 3BY1A 3QO5A 3U11A 3EROA 2CNDA 1VQLV 3AGQA 4S3SA 3O13A 5LGUA 3RZDB 4KFMA 4J7KA 1QVFU 2Z3YA 4YAFA 1TVXA 1OCRC 3R93A 2B8FA 1OCZC 4QF4A 1K73D 1OCCC 2MQHA 1HNWQ 2ZKOA 1MJCA 3M7MX 4H0LB 4BW5A 4I9WA 4EQPA 3I55V 1Q46A 2MK3A 3OIQA 3ZMUA 3ZHRA 5BR8O 4UDUC 4QGUA 2ZJQA 2WPDG 3DUZA 3CCQB 1FNDA 4B3TO 4FFKA 4EFBA 1JOQA 3JD4A 3RN2A 2YWGA 4HSPA 1T9HA 1TA8A 5IYZB 1PL0A 2MO0A 1N05A 4K8ZA 4RLZA 4B08A 4X65L 3ABKC 2NN4A 2HP8A 4LNQA 3K3WA 2Q8IB 4LNUB 1OTCA 3Q38A 1XQBA 5EIBC 3OTOO 4AF7A 2BV3A 1N0JA 1LTID 1I4GA 4P30A 1UE1A 1HR0Q 2V7TA 3CPWU 1I94B 4YJ2A 1HCZA 3K03A 2PNHA 1J9OA 2GVAA 1EOVA 4OO1H 2BA0A 1I0HA 2X6XA 4X1YA 2A1AA 2C4TA 3OAAA 1Q86D 5FO0A 5FLMH 3CMAA 4JI7B 2GDSA 2OTLB 4RD4A 1GO3E 2A79B 4JI3O 3BDOA 2UXBQ 1VLOA 4R4TA 1K73C 5CA1A 1JE5A 4PC3A 4X62B 5I2YA 3DHQA 4HNAA 1VQKA 2P4KA 2PNRC 1N06A 2B63H 2KHIA 2E2HH 4P2ZA 2D9RA 3CU7A 2PI2A 1E2ZA 4JC0A 1RD9D 4X3UA 2ICEC 4N8X1 4WFAV 1SN8A 1YF2A 1OXUA 4G57A 3KYHC 1AZQA 3MXNB 4JI1L 4XKVA 5TV2A 1TR5A 1NR2A 3CP2A 5BN5A 4OPVA 2YIDA 2QA4A 1Z6HA 2W6IA 1OXVA 3S9WA 2CCZA 3GTGH 1NNXA 3NR7A 1FFXB 5JWPA 1TUBB 4DV4B 1DOMA 5A88A 2AWNA 4J7JA 4CDFC 3BVOA 2NTSA 3U58A 1KQSA 2K5WA 2KG7B 3UI2A 1XNRQ 2A8VA 3HOWB 3GSIA 4RGTA 2EIKB 1IBLB 3HGBA 4L5RC 1Q86C 1H38A 3K5LA 1EWIA 4UCTA 1PH3A 1KXLA 4NYKA 1NZ6A 3Q0AA 3VA5A 5B1BC 3HOYB 3QB3A 1YJ9B 3AVXA 4CBCA 3S1QB 3T1YL 2EYJA 4PG3A 3JALA 1DTOA 4DNIA 2JA7H 1CKNB 5T1IA 1BMFA 2XAHA 2KEDA 4PAAA 2ZBVA 1ENAA 1UD2A 4DR3O 4DRXA 3U6BA 3N2GA 1W6JA 4WFGA 4CC6A 3ASRA 3G7LA 1KRTA 2BSKA 5DEDA 4DUYB 4ZGQB 5LMNL 5KIXA 3HOXH 1QFZA 3J81L 3E5SA 1LTBD 5IWAB 2NN6H 4WJ4A 2A5HA 2ZR2A 2NUCA 4DR5B 1FNUA 2FJ2A 4DFAA 4II3A 1SKYB 1FGBD 1U9RA 1IBKL 3WOFA 5FLXc 2XAFA 4OO1G 3T13A 2Y0SB 1MSGA 1V43A 3SYCA 1MHWC 5DSZA 2ZM6B 1BX1A 3ZBHA 1VQDA 3AVYA 5FLXE 1GAWA 1SQVH 1IYVA 4FN5A 2A69D 3Q8DA 2K52A 2ZTNA 1QJOA 1O80A 3M7GA 2HFEC 2IJIA 2B2YC 2NYZD 2JA6H 1MI2A 5TISZ 1DOLA 3RT3C 3SPHA 2ZINA 3MEHA 3GVKA 4Y9RA 4P73A 3A3GA 1CA6A 2X6BA 2LGWA 2SNMA 1L0NH 4K6DA 1P7GA 2UXDQ 4DYLA 4DV2Q 3TCUA 4UY8C 2QEXV 4YY3O 3J80L 1TVCA 1PP9H 4WZKA 5EAYA 1G8MA 3J81c 3OR7C 2KCMA 2R7DA 3B40A 4QMGA 3CC4B 4OWTB 3QTCA 2UU9O 2I5HA 5IYCH 1TQOA 3L7ZC 1B70B 1Y66A 2AZ0A 2XRQD 2R7ZB 1YJNV 1VQPB 5GV7A 3GTOH 4BBSH 3LSSA 1L0XB 3J81E 3VDYA 4RGMA 5K1XA 4B44A 1IHMA 1IJFA 3P32A 1I94O 4FZ1A 1VARA 3URYA 2DYSC 3VA7A 4Y9UA 1DLBA 4LF8O 2K03A 3MEFA 1AI5A 2UXXA 3S16B 1ICFB 2HJDA 4J9ZB 1TLLA 2E5LQ 2A69C 3HKBB 3LNMB 1C48A 5EPLA 1Q90D 1JC7A 4C3JH 3TDQA 3HOUB 2DWDC 2EIJB 4JAVA 5C4JB 4PABA 1K28A 1G7RA 3J80c 3ZIAA 5IK2A 4ZKBB 4X62O 3WB2A 3W7UA 1VQ4B 2NVTH 1PZID 2DNEA 4X05A 3L9DA 2DIEA 1A63A 3H3VH 4TQFA 3JD0A 5I9PA 3ZRXA 1S72B 3MCAA 1EY0A 5BMVB 4EB6B 4A3BB 3LNNA 3AQQA 3HOXG 3FP9A 4QJFA 3P75A 4HIDA 2BF4A 3GD7A 1FJGQ 3A1PA 4ROXA 4DV7B 3ZJZA 5IYBG 1B44D 4IALA 1E3PA 3UT5B 4ZKCB 3OFNG 1Q3EA 4X06A 1MKHA 2QWOB 4OIJA 4H0LC 1H9RA 4YCVA 1EZ8A 1NE3A 2D62A 1P7BA 4JV5B 2FX3A 1ZL8B 2QTOA 1SERA 3UDXA 3ZHTA 2BMWA 2B1GA 3ZEDA 2NVYH 4X8IA 5E6TA 4Y7NB 4DN4M 2JA6G 5HZAA 2LMCB 1I5YA 3KUPA 4ICGA 1VEWA 3GQBA 4ZLTF 1YSCA 4OWWB 2FB5A 4OPOA 2J0TD 3QR8A 5C4XG 1KYOF 4LWCA 1JWMD 1R4PB 4GKJL 1W3SA 3E1YE 3HKCA 5A89A 2CVRA 5C0XJ 1A0IA 4IPHA 3L72H 2F0VA 3WOEA 4DQKA 1CQXA 3TP7A 3OEEG 1FNVA 4HJ9A 2BOCC 1SYEA 2EILB 2EIXA 4LUOA 2R92B 1WTXA 2NWGA 3DXRA 2V1DA 1M1KD 1ENFA 4DUYO 3GDEA 1PNMA 4XONA 4BBSG 5IGCA 5IYQA 1M1KW 2BA1A 3K81C 2EY1A 3K80C 4FYDA 1NTKH 1VQ5V 3X3MA 4MN3A 5CBAE 1PKVA 1DK1A 1N4CA 1HNWB 1QG0A 5KRUA 4R7CA 1VF6C 1Y1VG 3AEIA 5M5XB 2R61A 2N55A 2AZ2A 2JA9A 1YI2B 1QVGA 1D1IA 2JDIA 1STBA 2RCFA 5JBQA 3RZDH 2ZM6O 5JJNB 2X3UA 2EXZA 4BWAA 2E74B 1MBYA 4N21A 2XWBB 3SVMA 2ZXHA 1J9ZA 5LXTA 2BGJA 3BQJA 4ZGNB 3HKDB 5DS0A 4C3JG 3I8ZA 2R72A 1TAEA 2GUZB 3X2QB 4HMJA 3VYRA 1I4XA 1F2ZA 1H2GA 3T4ZA 4AF6A 3AK3A 1NH2B 1HPCA 3RR5A 3BVGA 1IBMQ 4AVZA 1HR0B 2NZ1D 1WFQA 4R9WA 3A2FA 4YIJA 3D4DA 1CNEA 3ISXA 1I4PA 2KJXA 1JJ2U 4Y52H 3M7NA 5LHGA 4V190 5EPKA 4XTCS 3C46A 2EIKC 4RD1A 4AIMA 3VR5A 4TQUS 3JQQA 4A3EB 4IOAA 3UQ8A 4DAMA 5FL7A 3ZHSA 2UXBB 1O7IA 2OIGA 2ZZQA 2SNSA 2IW5A 1A15A 1E62A 1QNUA 3I56V 1U96A 1II3A 3PUYA 1N33B 3ASQA 4HCSA 4UCSA 1GVPA 3RLNA 1OO9B 2QM7A 4LFAQ 1TTTA 2HHHL 2JA8H 4F87A 1NI8A 1Z2GA 1BOSA 1JNYA 3SYAA 4J9YB 3RVYA 5J3BA 1STYA 2AGAA 1WPXA 3F2BA 2UXDL 1ZSPA 3RFRA 1W9XA 3AG2B 4Z4WA 4WCEV 1SKVA 1QFYA 4F6RB 4JI8Q 3F8TA 4IOCA 2VJIA 1AILA 2A68D 1A3VA 1JR9A 4U673 3J81j 1Q43A 2PMDA 3VQWA 5E4XA 1R9TB 4IUPA 1Q6UA 3AVUA 1I5FA 3RGBA 3PF4A 1PJ5A 1A6XA 1GKFA 4RHSA 2EZVA 2HEPA 1X3FA 1XNRB 2D9UA 3JAKA 3CAMA 1IBKO 2X85A 4R71A 1JE4A 2FMCA 3E8FA 1EFCA 2FFKB 1S4ZA 1XPUA 1OV9A 2VRZA 4P9OA 4I7AA 3RBZA 1DARA 2Y48A 3P27A 1D1KA 1TWAH 3CCMA 4XM3A 1WD1A 4K1XA 4LF7Q 4J8QA 3FMCA 3FJOA 4OIKA 2P3MA 3TN2A 1SXTA 3HOWH 1U4MA 4PC2A 4ZUIA 3ASSA 4AYBG 1JX9A 3M9BA 2F0PA 1P4RA 5JH7A 1C7YA 3BEHA 1IXBA 5EPJA 3CCVA 4X3KA 1QUEA 4JPBW 1HHVA 1LTAD 3HOYH 4AH6A 1RSOB 5EC1C 4RM0A 4IFDJ 4R4OA 2A68C 1XPOA 3V2TA 3OW7A 1YNXA 1VQ8V 1DGSA 3VR3A 5L3CA 1Y0RA 3AFQA 1CKMA 4XN3A 4DA2A 4KHPQ 4P6YA 1VMPA 1HNXQ 4YXWG 3PF5A 5BN3A 2W0FC 2F0LA 1RM1B 4P2CB 4DR6Q 2WB1G 2RC5A 1K8AC 1YHQB 4A3IH 4G28B 1W0JG 4DV5L 3LSQA 2XHBA 5K36G 4RCOA 3KLWA 1SQBH 3T51B 4YHHL 3FDTA 3STZC 1YIJB 3WNDA 1KMIZ 3NSWA 1IHZA 2Q2IA 5GV8A 2EIJC 4MW8A 4UV9A 4LH7A 2JA8G 4NDXA 1SQQH 5CMUA 2JEAI 1DDIA 4DV2B 5FNVA 3J7AV 2XEXA 5IE9A 4MS2A 1Q81D 5KHJA 3JAMN 1SF9A 5GONA 2Y0IA 3BZDB 1ORQC 4YJ3B 2CH4W 5COYA 4KJNA 2K9PA 3CRMA 2OYQA 1BCPB 4OWXB 1IKMA 2Z5UA 1JPXA 2AW9A 1YZBA 3E8GA 4P72A 3NP8A 4I4TA 4QE9A 4RCYA 4UUJC 4WFFA 1HR0O 1QZGA 4OXSA 4V0BA 2XNCA 2WYRA 1I4QA 2NNUA 3ZS8C 3NXWA 5C3EG 1G7CA 2SOBA 3K7UC 2R7ZH 1VS0A 4JI5L 4FLZA 2CRVA 1UFIA 3RYIB 2E5LB 3RWRD 1WTQA 4CDDC 2K01A 2NBFA 3S1RB 4X6AH 2UXBO 1DOKA 2MW2B 2Q7HA 1NH2D 4XL9A 1HTLD 3WFVA 2BTQB 3K06A 2RDFA 4FF3A 4PA9A 4FLVA 1R5NA 2YWHA 3CCLV 1DF4A 2YWFA 1I6HB 1HR0W 2QKCA 5L3GA 3S16H 2LO1A 2OTJV 4KD3A 3NE5B 2EILC 1Q81C 4TVAB 1CP9A 4O4IA 1FJGB 5C4JH 1JMCA 3BS1A 3EA6A 4LR3A 1PH9A 1SJHD 1WJZA 2A0LA 3A5ZB 4TV8B 3CJHB 3K08A 2KHJA 3K59A 1ASZA 1HDJA 2EOTA 4IGGA 3FPUB 4OOXA 2D3LA 1S5BD 1VQNV 4BA2I 3CWBH 4Z4ZA 1QQCA 2ITDC 4HIOA 3D36C 3K6OA 4RD3A 3G80A 4DR1L 1G6UA 1ROPA 1VQLB 2PZSA 4A3IG 5E3FA 3S24A 3K0YA 2E74C 4N3GA 1SBBB 2F4IA 2Y4TA 5BSYA 1BVSA 4P9PA 5LL6X 4K14A 2F0GA 4HIMA 3OW2B 4BY1B 1G1XB 4A3MB 1TWHB 2AHOA 2F03A 1YCIA 3X2QC 3G6EV 4RD0A 1HUMA 2QMUA 4UCRA 4PDMA 5DN6G 1IZ6A 2KVMA 2B2VC 3OYYA 1ZWIC 5M5YB 2AXTZ 2YEVA 5GTHZ 1H2NA 2IHEA 4XQNA 3A8KA 2JK8A 3I55B 3S3XA 3MC0B 4HZ3A 2RDGA 2HMAA 1MSDA 4Y7NH 4R8CA 4RPBA 1JB9A 4RQEA 5E1AC 3T53B 1N34Q 4Z4RA 4DAYB 3AU7A 1HTPA 3S2DB 4B7KA 2X6CA 3SDZA 1KDCA 1ILPA 2L6LA 2QM8A 1QGYA 5A9GA 2V7UA 3E6ZX 4M1UB 2E2DC 5H5NA 4WJ3M 1PTOH 1HUNA 3D3QA 3OKXA 2AHYA 2GV9A 1C4QA 4NXMQ 2LFNA 3BCCH 3P3PA 1JJCB 2YICA 1X65A 5C3XA 4LC0A 2IJJA 4TOIA 1CKOA 3A35A 3SXHA 3SEJA 4H9GA 4DK6C 1XNQQ 1LTRD 5B1NA 1Z5WA 4ZIBA 4JYAQ 1TUEB 1YITV 3AG2C 2F66C 3EVKA 3FYIB 3ETQA 4BXXH 4DXFA 1AR4A 4A3KB 5J1ZA 5M5XH 2C5CA 2R6GA 2PYJA 2YTXA 1U4RA 4EKWA 2E76B 1IBMB 1AFPA 2Q68A 4BR6A 2UXDO 1NDHA 3L0OA 2UXCQ 3PO3B 4MVUA 5I6WA 5EYPB 1NR1A 4DR7Q 2FHTA 2B2YA 1E24A 2V7QG 4EVOA 4KHPL 1NT2B 1WDTA 5KHHA 4A3GB 3CCJV 1MSWD 1FVIA 3JAWB 4RGOS 1PRTB 4RCNA 3AG3B 2B29A 4RO2A 4MIUA 1H9JA 3L3OC 3RYHA 4G1VA 1WB8A 4R4IA 5FJ8H 1PZJD 1Y8OB 4XNFA 3DWPA 1RTNA 3CRRA 4QV2A 2RDCA 1ZX3A 1CFMA 3H01A 4A3EH 3CCEV 3DC5A 3PIPA 4UAJA 1BCPD 3TMEA 1WCMG 4JI6Q 3DWAA 2ZE5A 2IY5B 4BW9A 1R6NA 3QNEA 2WAQG 3I91A 3AVVA 3BA9A 4TV9B 4DR2L 5L3BA 2LGQA 4NKGB 1EY4A 4G7OC 4HIKA 3GTLB 5LL6S 5JPNC 3GV3A 1F23A 2F4VQ 3U10A 4OXPA 3RUZA 3W2IA 1BLIA 3PA1A 4QNHB 2RF4A 5JCOC 4GX2A 4E2LA 2VQFB 4J41A 4PHZA 2CWAA 1R9TH 1GMGA 2HCJB 3I4NB 3T1YB 4OEMB 2Q4PA 3HKEA 3I72A 4DV5O 4J6HA 3AGPA 1NS1A 3KCXA 5IY0A 3W2HA 4YHHO 1WD0A 5FLXN 1KRHA 2D3OW 1RF2D 1QBZA 4J0QA 1K92A 3A74A 3SPCA 3ONYA 1G2SA 5C0XI 1KBHA 1DJRD 3EFFK 2X6GA 2HLDG 1BBXC 4B48A 3ZN1A 1VQ6V 3CQZB 2GHYA 2EJMA 2XZOA 4PELA 1IURA 2V7XA 4X89A 5J2TB 1Q8KA 3LDEA 2JEUA 3U4ZA 4KXRA 3CCQA 4UFZA 2GPJA 2ZJRA 5G3LD 4LFCL 3R2TA 1H8HG 5IYZA 3RY8A 1M57B 2QEXB 2CQAA 1HNXB 4TSFA 1XHXA 4RCZA 3SK5A 4FLWA 1NMGA 4LNUA 2DQ3A 4TT3G 5KHKA 2NVQB 3TS2A 4J7ZA 1XILA 3D6WA 1N36Q 3J81N 1Q90A 4U3JB 1YJNB 1CI3M 1JJOA 1GVHA 4F7DA 4KN4C 1VQEA 5JEAH 1Y76B 4UZFA 2F95B 5L3EA 1RTOA 3BH4A 4EQNA 1L1FA 2XGTA 1IYJB 1EY7A 5EBMC 5IYRA 3CCUV 1KJZA 1AEXA 2HDLA 3TEHB 1B8AA 2WJYA 4FLXA 4FM1A 4GS3A 2A6HD 2OTLA 1VHEA 2V1CC 3CMEV 4ACAA 2KCTA 5CV6A 4WZEA 2L4NA 1C0AA 1W2BB 1VF6A 4NMZA 1N34L 1G7TA 2ADPA 1GJRA 3VNUA 4QL5A 2NR5A 1IBMO 3JSLA 3PUMA 4X88A 2OT2A 2VB3X 3RN4A 2Q73A 4UVBA 2O57A 3OWFA 4LWSB 1X59A 2MPMA 3CEIA 1X56A 3H0GG 2MO1A 3MXNA 4RG1A 5IP9H 1LUWA 1KP2A 3SR2C 1XMQQ 3K0DA 1N8RD 2F3VA 2CW0D 1E79G 4UXNA 1IDSA 5B6IA 5C6AA 2IU3A 4DR1O 2ZITA 3CXCB 2M9VA 1N8RW 1FFXA 3MAQA 2Q69A 1EM1A 2QDOA 1N9WA 4R4CA 1EFRA 1XNQL 5EBWC 2ZXRA 1VF5C 1WNSA 4JYAL 4LBWA 3BDLA 3VR6A 4LFAO 3TXQA 3HS0C 3QJYA 2KG7A 5THXA 2JEXA 3PGZA 1OHHA 4CH6A 4WRDA 1PFBA 4KK7A 2ZIMA 1HNZL 3FAVB 2GA4B 5FOBB 3MZ5A 2MNAA 3OP1A 4B3SL 2ATWA 4I0XB 1EFTA 3KF6B 3DMUA 1LUZA 1H95A 1GUSA 1W35A 2WJVA 1FNCA 1B3QA 2ICIA 4JI8O 5H5JA 2EIFA 3ABLB 2A6HC 1PRTD 4LF5Q 4PDRA 3ULJA 2NVXB 1YJ9A 1WLEA 4DR4L 4BIOA 1I6HH 5BY1A 1CKNA 4LFBL 4FFBB 2JJ2A 4OX9Q 2IJ0A 1UAPA 3D6CA 4E4EA 5B5EZ 1XJVA 4G7HC 2PY5A 1D2EA 3VBBA 5DM6V 1Y74B 4LMQD 1S40A 4X66L 1XEQA 3LWUA 4ZI7B 3RNUA 3AVTA 4PC1A 1BO0A 1EYDA 4GKJB 4I65A 1D5ZC 5IGDA 5JEAG 1V54B 1EIYB 1G4YB 1NSNS 1RDPD 2CW0C 1N0UA 2W0XA 1VQ5B 5AFWA 4LF7O 1E1RA 4XN0A 2P67A 2E76C 3OW2U 3OEHG 2VBSA 1LACA 1LM0A 2P7TC 3S14B 1H2KA 4CS4A 4X64Q 5C4HA 1P84F 4LF4Q 3CRZA 2ID0A 5GW7A 2RSOA 3I70A 4RUEA 2X7RB 4A3CG 2KENA 1N07A 4DK0A 3TSSA 4X20B 5CA3A 1ZKOA 4A3MH 1TWHH 2F0QA 4GX1A 4WF9V 2F0UA 1PM9A 2C2WA 3SGIA 4P71A 3ZZ0A 2VL6A 3X3NA 4ZBMA 4A3LH 1PRTC 3T1HQ 4BAYA 3AG3C 2UUCL 2E1BA 1EIGA 4E6IA 1BSMA 5HGTA 5KUMA 4A93G 3CPFA 4NXMB 1QOHA 2FYUH 2QDBA 3R8BA 2SEBD 2YU9H 2X6AA 4KHPO 2ASBA 1HNXO 2PMZE 1S5FD 3S2DH 3CC4A 1EY5A 2B2WC 4DR6O 1XYIA 4JI0Q 1NJID 3U2QA 3PO2B 1TKWB 4IT5A 4KUMA 1VQPA 4LF6L 3CB4A 2WLNA 2QCPX 3RZOB 3GTJB 4FM2A 1AR5A 3NBHB 2K5HA 4RGNA 1VQ9V 1D5MC 2JSOA 4DV3Q 3U0ZA 1MD2D 3F1ZA 5ELEA 5DM73 3I56B 4X1IA 2JRIA 1KQSU 3OHXC 3ETGA 1YLOA 1ZM4A 2CUGA 3CD6V 2PLFA 1K28D 3D8GA 2EVBA 1STHA 2L1BA 2AQ1B 2QE7A 1NUCA 1F9PA 4DR7B 2FMMA 3HKBA 4BIZA 4DR2O 4RUFA 2C4UA 1DYQA 3H1LH 1GKHA 4ZUJA 5AJ3L 1VF7A 4C2MH 3CE2A 1CXZB 4RDKA 3UKMA 1PJ7A 1GXDC 1I7FA 3ICXA 4N3NA 2HIVA 4DV0L 1VQ4A 4ZAIA 2YYZA 4GLXA 3SJQC 1K4CC 4J10A 2HHHB 3ZRVA 1KABA 3PO3H 3CCRV 1S72A 2HQEA 2WSSG 5BMVA 5CA0B 4EB6A 4AQYL 4TQDA 4JI2L 4QE7A 4ULLA 4NCNA 2HCCA 1SYFA 1N32L 3P3NA 1GUNA 3V7AA 3IAYA 2XNDA 1NJIC 1SMYC 5J9PC 4C0SA 1F4NA 2UUAQ 3UT5A
chains in the Genus database with same CATH topology
3WB2A 1PXUA 1PTOD 2F0OA 1GUTA 3VQYA 4JI6B 1PZID 2DNEA 4PMBA 4TUYB 1BCPC 2DIEA 3PIO3 1V0EA 4TQFA 5I9PA 1F2LA 3VYTA 1CT1D 1H9SB 1LV9A 3HKEB 4JBWA 5D3DA 5IOCA 1EY0A 4A93B 5BMVB 1I18A 4EB6B 4A3BB 3LNNA 4U68A 3ZYYX 1WTWA 1Q5OA 4B9XA 4R8NA 2KOLA 1DM0B 2O5IC 3DEOA 3P75A 4P22A 3RD4A 3GD7A 4C1NI 4TKOB 2QF7A 4EGVA 2RA4A 4IURA 4KHPB 2BCOA 3M85A 1TU2B 1ONLA 2KVOA 1U4PA 4DV7B 3I90A 1B44D 4IALA 1A2UA 4M8AA 3GTMB 4KHVA 1A3TA 3UT5B 4ZKCB 4DR6B 2EJFC 1Q3EA 4IFDG 4HMIA 4KL1A 1D5AA 2OWOA 2BTQA 2P5OA 3OWEB 4OIJA 4H0LC 4C56C 1H9RA 1K83B 1EZ8A 1SYBA 4ZQ3A 4HAEA 1XXGA 2D62A 4N9TA 4UAIA 3JSNA 4NXNB 5JVG3 1SQFA 2W6JA 4JV5B 1FX0A 2EE1A 5M5WB 1V9PA 3WB0A 1SNPA 1ET6A 4YY3B 1Q3LA 3CKIB 1UD5A 3ZEDA 5EJWA 2O4XA 4Y7NB 3FKSA 4DN4M 1Y8NB 5EZYA 2F0JA 1WTVA 2LMCB 1JMKC 2ZZGA 2WSSA 3KUPA 3GQBA 4ZLTF 4O1NA 2UU9B 4CH3A 1CA5A 2J0TD 3GTGB 2Z6BD 3SEBA 1FR3A 2EJGC 1JWMD 3FVQA 1R4PB 4BS9A 2BTOA 1ESFA 3KBXA 1OB0A 5A35A 4WBNA 4DR2B 1F9SA 3HKCA 2CVRA 1SYGA 1G2TA 3OE7A 5C0XJ 1MABA 1B9NA 1XMOB 5FO7B 4OO1I 3WOEA 2F0VA 1SNOA 1COWA 1PTOC 1RKNA 4KI0A 3TP7A 4CS2A 1FNVA 1SQGA 2ZTGA 1SYEA 2DN8A 2R92B 2LZJA 1WTXA 3HKZB 2NWGA 5EZYB 3I73A 1TGOA 1ZYRD 3LWEA 1D5XC 1ENFA 1O7LA 4LF8B 4DU9A 4WORA 4IZ8A 1Y8PB 1LLRD 4XONA 4OHJA 4X1KA 5J2UA 2TMPA 1VDZA 5IGCA 2JYOA 5IGEA 2BA1A 1TY0A 2EY1A 2F0KA 2IX3A 3MXUA 3HKDA 4FYDA 4H7BA 2JVDA 2Q7GA 4WBNB 3MHBA 3X3MA 4MN3A 3HKCB 1SJED 5J22A 4X3SA 4XLAA 5CBAE 2RDHA 3IKJA 1PKVA 1HNWB 3OFNA 4NKLA 2D3NA 4UZUA 5KRUA 1ZAUA 1GHJA 5JOBA 2IW3A 3NWTA 5M5XB 5IODA 2R61A 1STGA 2N55A 2PW5A 5JEAJ 4IHJA 2B2VA 1CK1A 3ZPNA 1D1IA 4QCLA 2JDIA 1XHZA 1STBA 5CV8A 1WTRA 4BBRB 5JJNB 3HEJA 4LJZC 3M4YA 2EXZA 4BWAA 1JFFA 3HOXB 4HR7B 1JOOA 2K6AA 1MBYA 4X1KB 5J2UB 3A8KE 1G91A 2XWBB 3SVMA 2ZXHA 4RKLA 5LXTA 3BPZA 2NTTA 4OGQC 1Q8IA 3HKDB 4XDXA 3MWYW 4C3JG 3I8ZA 2R72A 4B3MB 1TAEA 3PUZA 4B9WA 1IL8A 1LTSD 5EKIA 4HMJA 4Q0FA 5C44B 3NTKA 3VYRA 1JR0D 1I4XA 1F2ZA 3S1MB 1SYCA 1GHKA 3JU4A 2ZZEA 1M5IA 4IHJB 1HPCA 3BVGA 4AVZA 4O2AA 4LK1C 2Q8TA 1HR0B 3K5OA 5KHGA 4XQJA 1I6VC 4LFCB 2NZ1D 5JPMC 2KCNA 3TP8A 2B2TA 4C1NK 3J7YW 1IW7D 4R9WA 1JFFB 1STAA 3A2FA 4B3FX 4YIJA 3D4DA 2YU9B 3OEEA 1I4PA 1XX8A 2KJXA 4KY7A 1HW7A 1CZWA 1LABA 2IX0A 1VJSA 2L9HA 2JA6B 3HG9A 1KMHA 3M7NA 4JI5B 2LKVA 4V190 5EPKA 4XTCS 3C46A 3G05A 4KD4A 3VR5A 5C4XB 4TQUS 4A3EB 4IUUA 2ZXPA 3UQ8A 5BN4A 1BPLA 5FL7A 1I8DA 4DAVA 2UXBB 1LT5D 4O2AB 1EQTA 1L0YB 1TIID 3T56B 1XMQB 2ZZQA 2SNSA 2EY2A 4XOPA 1T5EA 1EWHA 1A15A 1QNUA 3JAML 4I9QA 1II3A 4IUVA 3N6RA 3PUYA 2XVSA 4TSSA 1N33B 4HCSA 4BWGB 2RJZA 4UCSA 3P1HA 3H09A 2K32A 1KDAA 1OO9B 3Q23A 3A7AB 2GJKA 4X65B 5ITZA 2JEBI 1CHPD 4F87A 5EBCA 1BOSA 4XLFA 2F0NA 2K05A 2WP8J 4UCOA 4ME5A 2PPBC 3E22A 4K5VA 3A55A 2BDOA 2NN6I 1JICA 3GTOB 1STYA 3FRPB 2YIAA 4BBSB 3RFRA 1W9XA 4ZOLA 1SKVA 1PDQA 4F6RB 1TVKA 2G9DA 5CBEE 4K8JA 1N34B 3NHHA 4IFDI 2VJIA 2A68D 4GQNA 1A3VA 4U673 1E2WA 4C2MB 1Q43A 2YIBD 4KHZA 3THOA 3VQWA 1Y1VB 3NTHA 5E4XA 1R9TB 4IUPA 4X3TA 4UCUA 4R8IA 5ITZB 5G3LF 3CRLC 2X69A 1D2BA 1W6KA 1SYDA 2L5TA 1Q1BA 1Y69U 5LP6A 5KNLA 1SSOA 3RGBA 2KCCA 3M3YB 3E22B 3KEWA 3QIAA 1IW7C 1WVLA 1A6XA 4G7WA 4RHSA 2EZVA 2HEPA 5FPOA 1XNRB 2D9UA 3JAKA 2KECA 4ZOLB 1HQMC 2X85A 3G6JB 1TVKB 4C3JB 1J8IA 1JE4A 2F93B 2FMCA 4O4HA 4FF4A 4CH4A 3RYFA 2FFKB 1S4ZA 3K5MA 3P20A 2XN9C 1AP0A 1D1KA 2PYKA 4XM3A 2L12A 1WD1A 3MTSA 4NW2A 2KA7A 1SE3A 4J8QA 4O4LA 3FMCA 5ELDA 1XNQB 3H91A 4OIKA 1RSOA 4JYAB 1OXTA 5LP6B 3TN2A 1SXTA 2P22C 2IPKD 1H2SB 1WP6A 4RFBA 3EQLC 2JJ1A 5KYLA 4L63B 1U4MA 2EYPA 4I7ZC 4JI1B 3JAKB 2HDMA 1HNZB 2D2CC 4G4KA 3VYSA 4ZUIA 5T1GA 3D4RA 1S5CD 2F0PA 5JH7A 4O4HB 1QNKA 3RYFB 4B3SB 2JGUA 1EEFD 2UXCB 5EPJA 5ELFA 5JCOA 4LF4B 1KNAA 3HOZB 3QOLA 4Z9CB 4X3KA 1LTTD 4QB4A 1HHVA 2DY8A 1LTAD 4C3HB 4O4LB 3SHLA 4K5WA 4DR4B 4H13C 4IFDJ 5LA6A 2A68C 3CRKC 3V2TA 1LT3D 2F0DA 3I4LA 3OW7A 5F2DA 3QWNA 4LFBB 2PMZB 1F9QA 4CKCA 5KMGA 1DGSA 3VR3A 2MJ8A 4KN7C 1HFGA 1H8EA 4XYOA 4KV6A 2NVYB 4XN3A 4DA2A 4WFN3 1BDOA 2XWJB 2YI8A 2OXPA 1VMPA 5JH7B 4X1IB 5BN3A 3MFGA 2F0LA 4P2CB 5CV7A 4K5XA 3BG3A 1XQ8A 4CJ0B 2XHBA 1Y1WB 1I4HA 5K36G 4RCOA 4IN3A 1Z7TA 1G6ZA 3NPPA 4ILWA 4ID6A 4G6IA 3T51B 4CKEA 4YJ3A 1GUOA 3C3LA 3FDTA 4JI0B 3BC9A 2IL8A 1KMIZ 5LA6B 3NSWA 3HAGA 3QG5A 4PMCA 1IHZA 4ZRZA 3Q24A 5KMGB 4CH5A 1BQQT 4LH7A 1JB3A 1IKLA 1B9MA 1P49A 4NDXA 2F0TA 2JEAI 3OOCA 4DV2B 3SJCC 5FNVA 5LMNB 4DNRB 2R9AA 4DV3B 3CMMA 3J7AV 3GO5A 5IIFA 2O2LD 1QG7A 3RYCA 5CGKA 2E2IB 2B39A 4KKSA 1OXSC 5KHJA 1X4TA 5GONA 3BZDB 3NUCA 1HA6A 3D3RA 3FFQA 3J80E 4YJ3B 5COYA 2CK3A 4KJNA 1PRTF 5IT9L 1S5JA 3SJAC 1IBKB 4KY6A 2OYQA 3TZDA 5C0XH 2F4VB 1BCPB 2NN6G 1TWCB 2B2UC 4OL7A 3RYIA 1IKMA 4FLYA 1FYCA 1GUWA 2VB2X 3H6MA 2VWJA 5I6YA 1YNJD 5IGFA 2Q7EA 5DAUA 1X32A 3NP8A 2UUCB 4ASUA 1CZGA 1TS3A 3VR2A 4I4TA 5NUCA 1M8AA 5FK9C 1ILQA 2PZTA 1F9RA 2OF1A 5HURA 5FNVB 2PCFB 1RODA 4FP5D 1JQYD 2ZXIA 4V0BA 4XD7A 5KYIA 2B63B 3RYCB 2E2HB 2K04A 1CM9A 1I4QA 1H9MA 3ZS8C 2L0CA 5GONB 3NXWA 4CS3A 4HIZA 3B2EE 2EX3A 4AYBB 5JQGA 2AWOA 4CJ1B 2SOBA 4YXWA 1WPCA 5JJJB 3HP3A 3OTFA 4IQZA 4FLZA 1RCVD 1M4UA 4LF6B 4DXGA 1UUPA 4A3JB 4Q5VA 4EFEA 3RYIB 1W0JA 2E5LB 3RWRD 1HZEA 1WTQA 3ND9A 3BCFA 3OPOA 2RVLA 2K01A 2NBFA 2CHBD 4PNYA 3TP5A 3S1RB 2KEEA 1DOKA 2Q7HA 4QIWB 3R3OA 2JS5A 3R2IA 1OXXK 4XL9A 1YEWA 1HTLD 2BTQB 1ML0D 2UUAB 4XLCA 2RDFA 3RMHA 4FF3A 4FLVA 4TV8A 5C4ZA 4GZYC 4CBVA 4RWSC 3ITPA 3IFTA 5EQ0A 3A3BA 3T16A 1I6HB 1CTMA 2RQXA 1K8OA 5JQGB 3SR1A 3Q22A 1EU4A 4KD3A 3NE5B 1SAPA 2F3WA 4KKUA 3IFDA 2IT1A 2WB1B 4FXGC 3HOVB 4GKKB 1D6EC 5FPRA 4B3RB 2JIZA 3CHBD 4MHEA 4O4IA 1EL0A 1DONA 3CB2A 2KQ3A 1FJGB 2O5JC 5C8YA 2EPBA 3GVJA 3BABA 4DK1A 3BS1A 3BAAA 5CMDA 3EA6A 5KX5A 3EJIA 4LR3A 3BCDA 1SJHD 1ENCA 5IT9E 4NP5A 3CSXA 4TV8B 1BUVT 3BA8A 3K59A 3DM1A 1YNJC 2JXMB 2EOTA 2JA8B 3FPUB 2JA7B 2D3LA 1S5BD 1N36B 4BA2I 5HKKA 1O7ZA 1QQCA 1HFNA 4AQYB 2MP1A 3K6OA 4CGYB 1TWFB 4TRDA 3FEWX 2LS01 4JI2B