2F1MA

Conformational flexibility in the multidrug efflux system protein acra
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
246
structure length
229
Chain Sequence
TTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDMKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTMMPGMFVRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility in the Multidrug Efflux System Protein AcrA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Acriflavine resistance protein A
total genus 57
structure length 229
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f1mA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2f1mA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f1mA02
1GUOA 1VCIA 4TQUS 4OO1G 4DNTB 3L7ZC 2QF7A 1Z7TA 1BDOA 2D5DA 2PPBC 3T53B 2DN8A 3A7AB 3NE5B 5BN5A 1OXVA 4OO1H 3IKJA 3GQBA 4HR7B 4JK1C 2EVBA 4KN4C 3WB1A 1E2ZA 2A68C 3I4LA 3M7NA 1TKWB 1Q1BA 4KMUC 2E76C 1GUSA 1PMRA 1GHKA 1Y8OB 3N6RA 1I6VC 1QJOA 3VR3A 1GJXA 2CW0C 4BA2I 2E75C 3W3AA 4KKTA 1ONLA 3D4RA 1OXSC 3GD7A 3P20A 1HCZA 2A6EC 3EQLC 3QIAA 3VR6A 3VR5A 2NN6I 3PUXA 1T5EA 2A6ED 3A7LA 3BDOA 1DXMA 4H0LC 1IYVA 2F1MA 3PUWA 3FMCA 1OXTA 3PUZA 4DK0A 2K33A 3FPPA 2IT1A 1K8OA 3KLRA 4GZYC 1GHJA 2NN6G 2Q8IB 1CI3M 3PV0A 1CFMA 3ND8A 3PUVA 3CRLC 3T56B 1CTMA 1Y8PB 1GUNA 3IFTA 4XTCS 5A35A 1Y69U 1H9RA 1VDZA 2AUJD 4H44C 2O5IC 2AUKA 2PCFB 5KNDA 2A6HC 3HGBA 4DK1A 4TKOB 4KN7C 1GUGA 2AWOA 3RLFA 1ZKOA 2A6HD 2D2CC 1YNJC 2K7VA 2LMCB 3U9SA 5D5PA 3WB0A 4H13C 3SDZA 5KNCA 5JEAH 4LJZC 2O5JC 1TU2B 1ZYRC 1RSOA 1Q90A 4IQZA 4XIGS 2JE6I 3BRCA 4IFDH 4DNRB 2B8GA 1OXUA 3LNNA 3TZUA 2EDGA 1H9KA 1E2VA 1A6XA 3VR2A 2YYZA 4BA1I 3D31A 1EWHA 2E74C 1Z6HA 2BDOA 5D5QA 3T51B 1YNNC 2D62A 3PUYA 3AB9A 4RCNA 1B9MA 3MXUA 4KKSA 1G291 5C0XH 2KA7A 2ZT9C 5JJNB 4IFDG 3OOCA 4G7OC 1VF7A 4KHZA 1SMYC 1V8QA 5JEAG 2JEBI 5JJEB 2PNRC 3I73A 1FYCA 2EJFC 1FR3A 3BG3A 1B9NA 1OXXK 3MFYA 4OGQC 3WDNA 4G7ZC 3A8JE 1HPCA 4JBWA 4I7ZC 5C0XG 2L5TA 1LABA 1H9JA 1HQMC 3A8IE 2A69C 4KKUA 2BE5C 3ND9A 3SE0A 3CRKC 2A69D 2BE5D 2B8FA 2A68D 2F95B 4GYCB 3LWUA 4LK1C 1IYUA 3QG1A 1IW7D 1K8MA 5BN4A 2K32A 3WB2A 1H9SA 2DNEA 1LACA 1DCZA 2EJGC 2JXMB 1E2WA 3OW7A 2DNCA 3A8KE 5BN3A 3VA7A 3M85A 3VR4A 2NN6H 2JEAI 5K36H 2F93B 2R6GA 3I72A 5JJJB 2KCCA 4L8JA 3QJYA 1H2SB 2BA0A 1Y8NB 4KI0A 1Q1EA 1H9SB 1VF5C 1O78A 1O7LA 3DXJC 5K36G 1DD2A 1IW7C 3H94A 1V43A 2EJMA 4G7HC 1H9MA 1HTPA 2BA1A 4PV1C 1Q12A 2V4DA 3OPOA 5KNBA 3M4YA 1GUTA
chains in the Genus database with same CATH superfamily
3X2QB 3SPJA 3CPWU 4DNTB 1Y76A 2R9VA 5FLMG 2YUAA 5IGGA 4DKAC 3RGBA 5KHKA 4ZCLA 5FO0A 1J5EB 1CQVA 3ICXA 3RYHA 1QNUA 4GS3A 2F66C 3LSUA 1NI8A 3L3OC 4MTGA 4JV5B 5IWAQ 1GAXA 4K2LA 3LUTB 2N49A 2E2IH 1H42A 2ZZFA 4YXWA 3H0GG 3B77A 2E74B 1DG1G 3OHXC 1L8DA 1OCCC 3CRQA 3Q39A 1TIID 3S1RB 1I6HH 4UZFA 4DXWA 4TUYA 5C93A 5IYZA 5KUKA 1UD8A 1G8MA 1CP9A 4I55B 4N3NA 1G6UA 1HQRD 1STHA 1ONLA 3CQZH 3NTKA 4OELB 2KG7A 1EXMA 3GTJH 1XNQQ 3TRZA 2IY5B 2X6AA 2Z0SA 2F43A 4M1UB 1QCBD 4IIJB 1HZ9A 4CH3A 4DR1B 1B1ZA 1HUMA 4PC1A 3Q4HA 4DK0A 4KHVA 2JIZG 3KZIZ 4X8AA 4LF6B 3CTAA 1CK1A 2R3ZA 3QWNA 3UE1A 4BBRH 4KHPL 1EIFA 1B06A 1DF5A 5TRDA 3GTMH 1BUVT 1GHJA 2NN4A 4DRXA 1FL0A 2RDHA 2ZXPA 2Q8IB 4KK7A 4DV5O 4FF4A 2FTKA 4A3BH 3TEHB 2YXHA 4MW8A 2DY1A 5COYA 2Z9HA 1AI6A 1GUNA 3FEWX 4XTCS 4C2MB 1FNBA 2KCNA 4LWSB 4ZV4A 4R4QA 2UUCL 5KNDA 2JA8H 4TSFA 2D9UA 4ME5A 1IJFA 1MJCA 4P2CB 4P73A 2YWFA 2AWOA 5KEEA 3AVVA 1PJ7A 4B3MB 2UUAQ 2MHVA 1P4RA 4K0KL 5CORA 3A0JA 5A9GA 5AN9A 4DV6O 4WJ4A 2UUCO 3NXWA 1BMFA 2DOGA 1RP3B 3UT5A 1TGOA 2KHSA 1AP6A 3MEFA 4FVMA 3R2IA 5J9PC 3S2DB 4J6HA 4HIZA 2PY5A 4D6TH 2WYRA 2Q6LA 4B48A 1XL6A 3IC7A 4O2AB 5D5QA 4FXUA 5IT9L 2BE3A 1KAAA 1S40A 3PA2A 4OOVA 3E20A 2QDOA 1XNQB 3FHWA 1JC7A 2IW5A 3B78A 4Z4UA 1RDPD 1XMOQ 3K57A 1XNRO 3J7A5 3T1YL 1C0AA 1WFQA 2B2YC 5LP6C 4JTAB 1N36B 1BCPC 3OTOL 1Q86C 3CCUA 4FF2A 2UU9Q 4HSVA 2Y0PA 5LXTA 3ZN1A 1B8AA 1YJ9A 5GV8A 2KSDA 4DV4Q 4CC5A 4LFAO 3K81C 4I7ZC 3GWOA 3ZMSA 2DN9A 3H1LH 3HOYH 5C44G 4JBKA 4OIJA 2XAFA 1YIJV 2A69D 1PYBA 4R50A 3FB8C 5I2XA 1U2RA 4A3FH 1T5XD 1PH9A 5E1FA 3CMAV 2RKSA 2XWJB 4A4IA 5L37A 4YIPA 1JJ2B 2K1EA 3N2GB 3TK1A 4FLZA 1KD1W 1KKDA 4DV6B 1XB2A 1SE4A 2B2WC 2R7DA 3OWEB 2D2CB 1VQKA 2LP7A 2PW5A 3A8KE 4CJ0B 5C3EH 2P4VA 3J7YW 4OPSA 4RDLA 3SR1A 4C1NI 4MYTA 3K8AA 5C3EB 2WPDG 2CQAA 1AN8A 1PNMA 3UM7A 2WACA 4X06A 2EY2A 1FJGQ 3I2ZA 2NVTB 1DD2A 3OEEA 5CB4A 3FRPB 1SNQA 1PH4A 2RDCA 4TMXA 5A2QN 1VQKB 1D5XC 4A93H 1WJJA 2NBFA 2JDIA 4IUNA 1Q12A 1VQ7A 3S2HH 3WBKA 3ABMC 4IHJA 3HOWG 4JV5Q 3CCEB 1U4LA 2NVXH 3DGEA 3IFXA 4XN3A 2EIMC 4EH1A 3L74H 3ASNC 3HZXA 2KHIA 1GTOA 1K4DC 5CB4B 4X66Q 1M1KC 4M4SA 1IBKQ 2UU9B 3NWTA 1P49A 2AKWB 2OCEA 5C0XJ 3LNMB 2H3OA 5LA6A 3ASQA 2VRZA 1SROA 4BY1B 2PI2A 3ERSX 4F88A 2YEVB 2A68C 2HDLA 3K0YA 3CMMA 3CX5F 5L46A 3ULPA 4BY1H 3ULJA 4A3EG 1PMRA 2Y4UA 2M9VA 4LF7Q 3ABUA 1YITV 4KHPO 3KJOA 1G7RA 2F52A 4CZZA 4QJFB 2PF4E 1NNXA 1BE3H 3FFQA 2YI8A 2A6EC 3CCSV 2VUMB 1JORA 4FXKC 3S1NH 1NS1A 1QCEA 1D6EC 2AQ1B 4K2KA 4DV6Q 3BY1A 4H0LC 3GTOB 5KNLA 3PUWA 3NEMA 2HG5C 4UCVA 4E2LA 3I55V 2JA8B 4I55A 2DJVA 1UD2A 2KJXA 4IURA 4L5QA 2R7ZG 3IL8A 5KX5A 5LMZA 2RQXA 4OPOA 1AR4A 3VBBA 2D0PA 1E62A 1FJGB 3OT7A 1JOOA 1Y1VB 2HHHB 5C6AA 2PZUA 3SK6A 2NVYB 1FFXB 3S17H 1VQ7V 4JASA 4TN1A 1EFUA 1CQXA 4IOCA 4IUUA 2PLFA 1H9RA 3NTIA 3LSQA 1Y69U 1XPOA 1Q9SA 2OBSA 2VQEL 3D4WA 5HY6A 4PZ8A 1XJVA 1VQIA 4DAYB 2J0TD 3AG2B 5IYDO 3FB7C 1GR1A 4BIZA 3HR0A 2QGGA 4BBSG 2QJ1A 3ZS8C 5IWAO 1VQ8A 4QV2A 1YITB 4LJZC 1ZYRC 5H5NA 4UV8A 2P7TC 4IFDJ 2OWOA 5FLXE 2O5JC 3CC7V 1S76D 2NPFA 2N88A 1OXUA 1O9HA 1Z5WA 3JU4A 2DY7A 3V96A 1MSGA 1HNXQ 1KNAA 3TZUA 1VQ5A 5FNVA 4DV3B 2P06A 1N36Q 2NVQB 4ODGA 1J5EQ 1US6A 1EZ8A 4DK6C 1QNMA 4LF8O 3I70A 1NU1H 3BYYB 2JJ2G 3VA5A 3E9HA 3AQQA 1YITA 4QCLA 4LFCB 1FXHA 3AGPA 1R5BA 5IJ0B 3AG4C 1L1OC 5BR8O 5EMNA 1SS3A 5BMVB 4K0KB 1XWEA 1U9RA 5C4JB 3EVKA 1JX9A 4XN0A 4Z4SA 2GJPA 2PIAA 3CCMB 1MOFA 2EIKC 3SK4A 3OTFA 5M9OA 2UXBL 4QQBX 2WJVA 5J39A 2JA6G 3HOZH 1GN2A 3W2IA 1A3TA 4KV6A 2F3WA 4QUCA 5FPOA 4Q5VA 4GOPC 1C7YA 5GADC 3AK2A 1WP8A 1FXKC 4G7WA 5F4JA 1KQSB 4JYYA 1A0IA 1TVKB 1GN4A 2Z6KA 1LUZA 3E35A 5K1XA 4HIOA 3JARB 2BE5D 5LGNA 4TMVA 3S1QH 2N05A 4JF3A 4N3GA 1JCKB 2HUGA 1BX0A 4N8X1 1L0NH 1BBUA 5NUCA 4GYCB 2F0QA 3J7ZC 1K5QA 5BN4A 2H5XA 4LF9L 1HP8A 3GTMB 1XMQB 1D5ZC 5IOCA 2EINC 1IVSA 3ZZTA 5C4XG 3T1HB 3OW7A 1SESA 2PMZB 2SNSA 4RG1A 2JEAI 1KZLA 2RBMA 3CCLA 1H2LA 4X1KB 4PGOA 5GROA 1R1BA 4B3MQ 4LF5Q 2H1EA 1H2SB 1EY0A 2VB3X 4LMQD 4LF5O 1S5BD 3DXJC 4LFCO 3GP7A 3T13A 3J7AF 1VQ9V 4NR1A 3ER0A 2QWRB 2CHBD 2CRVA 3OW2A 4L5SA 1BO0A 5A2QL 1X3GA 1GO3F 2B5UA 4F6RB 1ZM3A 1W2BB 1G2SA 3C3SA 1LTRD 4IALA 1IZ6A 1FGBD 2D3LA 2PE3A 5AJ3L 2IJKA 1GUOA 4UFZA 4X9QA 3GTKH 3L7ZC 2D74A 4PC6A 1UUPA 3OFNG 2CTRA 2DY8A 2YICA 3APOA 1Q7YC 1M90C 4RM0A 1EYGA 3RVZA 3FKSA 4HTHA 2AGAA 1WSRA 2JA5H 4TUYB 1R5OA 2DYSC 2VNHA 2X8KA 2E2IB 1GO2A 1JCHA 1DM0B 3E6ZX 2QGQA 1F4MA 1RF2D 3M7GA 1E2ZA 4O2BA 5J3BA 2KQXA 4OPHA 5J2UA 1I4PA 1LTLA 2ES2A 4A3LH 2IH1C 1ASZA 1EEFD 1Y8OB 4DV1Q 1XQ8A 5LL6Y 4NB5A 1GN6A 2RMKB 3FD9A 4DV0B 2ZTCA 5IGDA 4QF4A 1MGSA 4BS9A 4ASUG 1N9WA 2B7CA 3H3VH 1A2TA 1WTHD 2WKCA 4X65O 3ETQA 4RQEA 1F2MA 1XMQQ 4HE6A 1DXMA 4LF9B 3LQEA 2VQEQ 4RDKA 1QWYA 4I9WA 3R66A 3SPCA 3QG5A 3E22B 3G05A 1E79G 1D8LA 5EGTA 4XQNA 2ZE6A 4LF7O 4RH6A 4AYBB 3S16B 1UD3A 2JDIG 2XNCA 1M90D 1PH1A 1AILA 1G7SA 1EWCA 4POFA 1VQ9A 1NTKH 3K80C 2F0OA 3TP5A 3F2CA 4WWVA 2VYQA 2LY7A 4MHEA 4OHJA 4BWGB 1NTGA 5IP9G 2HCCA 2JK8A 2XSCA 3IFTA 1KDCA 1XL4A 1BNZA 1VDZA 1F60A 1WOOA 4ASUA 2AUJD 1YHQV 1OHHG 2BOBC 2EIJB 5ITZB 1LT3D 2IJIA 2AUKA 2C35B 3MXGA 4DR6Q 2ZXIA 2HR3A 4OOSA 4K5WA 4MN3A 2OBRA 2QA4B 3U9SA 4Z9CB 2QM7A 2BGJA 3ZBUA 3G6EB 1QUFA 3K0GA 2A1AA 1RSOA 1X55A 3PO2B 1N34L 1HFNA 2YXLA 4JPBW 2HKOA 2BTQA 3K9AA 2XNDG 4NVPA 3KCXA 2FL4A 4DV0O 2ZTNA 2A0LA 1H9KA 4IUTA 1CKNB 1JJCB 4HBNA 2L0CA 4X7EA 4AYBE 1OCCB 1HR0B 4HE5A 2RSNA 5IYDH 1M4UA 4JG2A 3L2PA 4PMCA 1QZHA 2J7KA 2IU0A 1VIBA 3HKCA 1IURA 1NBWA 1QR9A 1WD1A 1ENFA 5JCOC 2M7WA 4DUZL 3CXHF 5IGEA 3K58A 1MSHA 4X7DA 2ZKOA 5EYPA 4H0LB 2Z8LA 1TY0A 1AP5A 1F4NA 2OTLV 5JJEB 2B1GA 2F3IA 3S1RH 4LF8Q 1IBLO 1E43A 3SJQC 2BDNA 3TMEA 2ADPA 1B9NA 4U7OA 5KMGB 1HFGA 1YZ6A 4RFBA 1LR1A 1CSQA 4DGZA 2RQ6A 1TWCB 1HNZL 2VB2X 1XE1A 1D1NA 4C3JB 2UXNA 2QN6A 3W7XA 1FJGL 1OCRC 1TWHB 4GX1A 5ELCA 5E1AC 2ZQMA 3L71H 5EBWC 2BM1A 3QFCA 4NBSA 4ABNA 3CXCU 3FAVA 3FX7A 4XL9A 1JQ0A 2H94A 4CDFC 3CC2A 1P4MA 1K8MA 4JI8O 4J8QA 1WA8A 4U9UA 1S5ED 4RGNA 4UUJC 1VQLB 3T4DA 4CBCA 3VA7A 2F0IA 4NP5A 2Q9LA 1TWAB 4J80A 3BCFA 5HXBA 4F7DA 1E1QG 2R6HA 3DWPA 3TJTA 1YX2A 4GX5A 4RCZA 3GO5A 2UXBO 1RODA 1KC8D 3CCSB 3CCEA 3PIOA 1VLYA 3S1MB 5EIBC 3CMEV 1IW7C 3S17B 4UHVA 1Y1WB 1CA6A 1NR2A 1RM1B 3CCLB 2E2DC 2AXTZ 2HFEC 3JD2A 2UU9L 2XNAC 3QOJA 2PPBC 2QTLA 2WFWA 1CXZB 4IW3B 1J95A 1LV9A 5IP7G 4K8XA 2R92G 1SYEA 2F0HA 4OO1G 2ADQB 3GDEA 5IYBG 4DV0Q 3AU7A 2QKCA 3JQRA 1ZX3A 5KLVH 3CCVV 1NB9A 3T53B 1WCMB 3QFRA 3DM1A 3NTHA 1OXVA 1JWSD 1JR9A 4AC9A 2WKDA 3QO7A 2IJ0A 3NQTA 4IJHA 2F0TA 5IWAL 3LGJA 4DXGA 2QR4A 3OW2U 2ZTGA 3SYAA 1STAA 4R4TA 1FNUA 3D36C 1Q6HA 2FKXA 1I6VC 3EN2A 1BJKA 4P9OA 1F9SA 4QPJA 3EROA 1Q81W 5EBCA 3ASOB 1K8AW 4NKGB 1VQNV 4A3MH 1WB7A 4JI5B 4HCEA 3VR6A 5DAUA 5JJIA 2ITDC 2NN6I 1ET6A 2YC0A 1N33Q 1BCPB 1IYVA 3FKSG 3LDDA 3VNVA 1Q82D 3GV3A 4PI2A 2F0LA 2GTAA 1B04A 1KK3A 5E3FA 4P1VA 4A3KG 3WYAA 2PMZE 3C1FA 4ZYSA 1CHQD 1X3QA 2BTOA 3E83A 1KHIA 5CV8A 2AMCB 3JD4A 4Z4WA 1Y1VG 1KDBA 3DWQA 3RYHB 3VYSA 4A93B 5CBGA 1EM1A 2GHYA 1F77A 2C2AA 1SJED 4IYHA 3T4ZA 2F0NA 4HIMA 4M2LA 2UXCO 2QE7G 2A6HC 2J4XA 2XGTA 4B3TL 1DJRD 4A3JG 2Q8RE 4CKBA 1R3LC 2JJ1G 4O4IA 1J5EO 2Q67A 2B2UC 2F0DA 4KJOA 1EFCA 1HA5A 4UP8A 1G91A 5JVH3 1AROP 1K97A 5B1AC 4K1XA 1SDFA 1E3ZA 4PA4A 1KABA 2F0JA 3D3QA 4NW2A 1PNKA 1TU2B 3K9SA 3K0XA 5C5MA 1HZCA 4A3GG 1LM0A 4C3HG 5ITZA 1K28A 4DNRB 1EN6A 3CP1A 4F6EA 1EP2B 5THXA 4U3JA 1NKDA 3NQIA 2XTIA 4GN3B 5G3LF 2CK3A 1A6XA 1V55B 4DR6O 3CCVB 3QVNA 4MZ9A 1VQHA 3HOVH 1K92A 3I5DA 5IWAB 2E74C 1QGAA 1EFTA 4DR5Q 3KDFB 3WOEA 1TWCH 2CVRA 2NV4A 1UEBA 1NCVA 1VQNA 4BY7B 1OCZB 1FXVA 1G8ZD 4LFCL 3PIPA 3UCSC 1H95A 4ZK9B 1VQOV 3JALB 4A3MB 3DC5A 3CD6V 5EC1C 4DV2B 1FD7D 1QLEB 2EJRA 2PGGA 4WFHA 4PABA 2KVMA 4NPSA 3GTLB 2LXJA 2K5WA 3H3VI 3DSQA 3HKCB 4DV5B 1VQPB 2EILB 2YU9H 4JBWA 5BR8B 3N2GA 4P25A 5C0XG 2JA7H 4A3GH 1LT5D 3ND9A 3GVLA 3CP8A 3VNUA 4A93G 3AGQA 4DR2Q 4Q7JB 1VQLV 1QUQA 1EY8A 4ACAA 1I7FA 5HKKA 1B70B 3HOUG 1PRTB 1WTWA 3CRZA 2K05A 4BPRA 4FPPA 2BSKB 3W1GA 3ZC3A 4JI7B 3D6WA 2Q8VA 3I56B 1S72A 4Y52H 4QIWB 3AK1A 1AB3A 4CH4A 4C3IB 4DW0A 2B63G 3EFXD 4DR6B 1GD7A 3I72A 5KYLA 1KK0A 3I4NG 3E8BA 1K5SA 1I4QA 1QQCA 3NHHA 1HA3A 4C3IG 3RD4A 2OTLB 2ZJPA 1PH5A 3KFUA 4G7HC 2QSAA 3W2EA 4B9WA 4KJNA 2GTSA 2A5HA 2ID0A 5IDJA 2ETNA 3E22A 5H6QA 2GPJA 4AVZA 3U4VA 1EFWA 1GAWA 3U58A 3CW2C 3K7UC 4WJ3M 3HOUH 5IE9A 3SVMA 4J7ZA 2QF7A 3WNDA 3CRRA 3ZIAG 1XMOB 1N06A 1EOVA 3OJXA 4D7SA 3U6KA 4TVAB 1W2BU 4X64O 1O7YA 4YY3B 3FKIH 1AJNA 1GN3A 3G80A 1N33B 3SKBA 2LXKA 4N23A 2Y0SG 5IE8A 2ZM6B 4FM1A 1PYWD 4DR1O 2HT1A 1XREA 3HP3A 1I4GA 3N6RA 4P12A 2UUBO 5EK0A 1GKFA 2NLJC 1MSWD 4JI3L 1XNRQ 4X62B 1F9RA 4DUZB 5CC4A 1XYIA 3SYQA 2B63H 1OGIA 3NPPA 1K8AD 2MPMA 1R73A 1C8CA 1RJTA 1UE6A 1Y14B 3FMCA 1SZXA 1E24A 4ZI7A 1QVFB 1KTKA 2ZDIA 4TOIA 4LF8L 3H09A 1Q82C 4FLYA 1V0EA 1SZTA 4XBFA 2ZR3A 2UXCB 1VS0A 4ZOLB 2JIZA 1CKMA 2V7TA 1K83H 1YNND 3HFZB 4DV7Q 3ITPA 1VF5B 2Y69C 1HR0W 1WP7A 4I65A 5LGTA 2JJQA 2HIXA 1J6QA 3O13A 1E1RG 4UCTA 1YSCA 2NR5A 4HMJA 2VL6A 1GAQA 3KLSX 1XMQL 2HMAA 3HGBA 4UVAA 1EIHA 4S3SA 1SQBH 2UXXA 5HZAA 4K5VA 1IX9A 5L3BA 1ZKOA 2EYMA 3RZOH 3OZWA 3EVQA 1AJPA 1PKXA 2RDGA 1MJEA 4NXMQ 2LGQA 5C4XB 3K79A 1TS4A 2NVYH 4EQ5A 3J81L 4R4IA 5M5WB 1SERA 3OSOA 3IRBA 3IFDA 5CV7A 2Y0IA 1T6YA 1BL8A 1KBHA 4DV2Q 5E6TA 4DUYO 1BZKA 2GA4B 2C77A 4DUZQ 2V1DA 3B2EE 2X6BA 1PDQA 2BDOA 2R9AA 2DW4A 5B1BC 3SPGA 3CPFA 3FPKA 1I6HB 2I5HA 1SBBB 4A3MG 3IC9A 4B08A 3CAMA 1PH6A 1T6XA 1VF6C 1A8PA 3CMEB 5D3IB 4C3HH 1VF7A 1SNDA 4CS4A 2ZE8A 4DR7B 3GB7C 2XZPA 4II2A 4XONA 2BM0A 1V8QA 4YCWA 5FLMH 2W6JG 1KXLA 4LUVA 3A0BZ 3KDFA 1XILA 1Q86W 1TA8A 2X53S 1B7YB 4JVZA 3BDLA 4MT8A 1AIPA 2IU3A 3CQZB 2QCPX 4PDMA 4IUQA 4OGQC 3EFFK 1IHMA 4R4OA 4NXNB 1EN5A 4N21A 4O2DA 4DR4Q 1JFFA 3ZEDA 3T1CA 1JJGA 3SJZA 1ZSPA 2BVNA 4ZCIA 1VQ6B 2BE5C 1ZWIC 4I7AA 3KLSA 2VXWA 1PVOA 2BH8A 1PTOB 4JAUA 4LBYA 1YJWA 4YAOA 3SEBA 4CDCC 4LF4O 1FAFA 2MP1A 1Q81D 5AG2A 3NR7A 5IP7H 1I3QB 2GJRA 3HKZE 4L6TB 3K08A 3OAAG 2MNAA 3GTPB 1EQVA 3EBEA 4BXXG 2YIBD 3OTOB 4HJ7A 3T1YB 4I5SA 1LACA 1DCZA 2EOTA 4JI2L 2QEXB 3RZOB 1KAWA 5M5YB 2PZSA 1SQFA 4DR5O 1I18A 4JCVE 3X3MA 5M3FB 2WA4A 3I55A 1AH9A 2V1CC 3TREA 5M5WH 1K8AC 3I56A 3BZCA 3RYFA 1OV9A 1Y8NB 4Z4ZA 1QVGA 3M3YB 4X6AH 3H1JH 5IYRA 3A0HZ 3NBIA 2E1BA 1F20A 4EFBA 4K0KO 3ASRA 4B4DA 4JI1B 1OCOC 4DR7O 3CRCA 1F2YA 3AFPA 4LWCA 4DV4O 2CH4A 2RHSB 1OTCA 4UZEA 3W2GA 4LNUA 3ML0A 1GUTA 3LDCA 1UAPA 2CKZB 3MWYW 1SFOH 1RTNA 1SF9A 5J2UB 3F5WC 1KC8W 4U7NA 3OMAB 2IHEA 5EIBD 5IYBH 2X6CA 1RL2A 3BCCH 3RLNA 4JI4L 4OO1H 5LHY1 3J81N 3K04A 1HH2P 3VOUA 3M7MX 4OGQB 4X62O 2EILC 4O42A 4HR7B 3S24A 4WBNA 2F4IA 2QA4V 5C3XA 2LKVA 5C4JH 4GOPB 1VJSA 1Q1BA 4KMUC 2E76C 1R6KA 1KRTA 1SRUA 3HOVG 4YCUA 4JI8L 4PJ0Z 4B3TB 3VO1A 4XLEA 1STGA 3OTOO 4YXWG 2DWDC 4FK8A 2Y0SE 2E3CA 3ULLA 3CCJA 4BA2I 4HNAA 1AR5A 5J22A 3MHPA 3GD7A 1SSOA 3SR2C 3BZDB 2GK6A 3FKIG 3W2DA 3J7AV 4P71A 2F0MA 3A7LA 3BDOA 1F51A 4X65Q 4XLHA 1A63A 4YY3L 4MVRA 1KQSA 3GTLH 4QPKA 5H6RA 4JI0B 2YV5A 1KRSA 2WLLB 4PA7A 3ZZUA 2ZIMA 3A2FA 4JI7Q 3O9OA 3K5LA 1BCPD 1NBMA 2ZBUA 5ELDA 1GRJA 1QE6A 3CKIB 4ZKCB 4I50A 1B2RA 1CPYA 4JYAL 2Q6IA 1M56B 4NXMB 1WORA 2NTTA 4Q0FA 2GUZB 1VQPV 3T56B 4JI4Q 1PRTC 2LSSA 4MVQA 2XAGA 1VQ4B 4I0XA 4C3HB 5JPNC 2KOLA 1EZVH 2KB1A 4IO9A 2O5IC 5JAVA 4QGPA 1THZA 2K5DA 1SRYA 5CA3A 2N74A 1NTZH 1GJRA 4DUYB 4O4JB 1DTOA 2IH3C 2ZNIA 1WTHA 4YCVA 5M3MG 1YI2A 4DQKA 3MMPA 2WLHA 4YIJA 4IQZA 5EZYB 1G7CA 1ML0D 2JE6I 3JSLA 1YBYA 3AVTA 4E6IA 1UMKA 5EPJA 4R71A 2ZE7A 4GZRB 1OO9B 1VQAA 3H1IH 5J2TA 4DAVA 1XUQA 4A3IH 3VO2A 5C44B 3PUYA 3PO2G 4YAFA 1U5KA 1ZL8B 2EBOA 4PZ6A 3A8IA 4NXNQ 1TS3A 2FFKB 3MHHC 4LFAQ 2CE4A 1QG0A 1VQ9B 4JI0O 1S72B 2K28A 1PTOF 2VUMH 5J2TB 2OF1A 1L0WA 4ILWA 5I9OA 2EIFA 3R6KA 1YLOA 4O2BB 1IXRA 4N8FA 3JAWA 4LF6L 4LF4L 2TSSA 5BXZA 1FR3A 4FLTA 1COWA 4APVA 2C4UA 2QDBA 1DDGA 2A3QA 4UB6Z 4DR4L 3T1YQ 2QTZA 2ZL7A 4XORA 1H9JA 2GJKA 3T1YO 4X05A 2A69C 2KEDA 5IP9H 2I0QA 3J81c 2VZAA 1K8OA 4A3GB 3BFRA 1RSOB 2YI9A 1AE2A 2A68D 1VARA 1N34Q 3ASOC 1AI7A 3ZMUA 1E3PA 1UE5A 4UXNA 2XNDA 2W6IG 2HDMA 1AJQA 2Q6KA 1FFXA 1YTFD 1PXUA 4G7XA 3OAAA 3A55A 4OO1I 5IYPA 1QU7A 4L87A 2DNEA 2Q6AA 3CCQV 5BN3A 2QA4A 1I94Q 3ICEA 1EY5A 4UCOA 1ZUQA 5H2FZ 3KUPA 3W5VA 1WOCA 4CH6A 1QVGU 1ELOA 1N0VC 2VNKA 2K4KA 2NZ1D 1JOYA 3AYHB 3WOFA 1FKAO 3QR8A 3CCMV 1D1KA 2LFSA 1VQJA 4DYLA 4QIWF 4B3RB 1KYOF 4XR6A 5DM73 3H94A 4YWKA 3V2TA 2RNBA 1VQEA 5C4XH 2A8VA 3HKSA 3CC4A 4FXGC 4J42A 4DF7A 1Q6IA 4P3YA 4QNHB 2PMDA 5KAFZ 3K06A 1RQRA 1L1OB 1VCIA 1IBLB 1TWAH 3I1FA 5KGUA 2YS8A 4JYAO 5IYCG 4MVMA 1WYDA 2QKIC 5FKAC 1BDOA 3C2PA 2D5DA 5IT9N 1TVXA 1X65A 4U673 4LR3A 3H1KH 3G48A 5IJ9A 4LNUB 3HB3B 1A2UA 2KECA 4DR7Q 4JI2O 4JAVA 2HQEA 1SNMA 3J81i 5EBDA 1SKQA 5CMUA 2C5HA 1YJNB 4JZGA 4WFBV 4LF9O 3SEJA 4W4KA 1SE8A 3B6YA 4KY7A 3Q22A 1GHKA 2C5BA 4JI8B 1VQ8B 1L0XB 4A3JH 1X56A 2UUAL 1R3IC 1FDRA 1PH8A 3DUZA 1EIGA 2K5VA 2BOSA 3HOWH 4MTKA 4ZOLA 1HNWQ 4F87A 2OIEA 4GNXB 1T5EA 3KG2A 4JI4B 3CJHA 4PDVA 3EHBB 4N9TA 1I94B 1S3OA 2F1MA 3OM3B 2RA4A 3GTQB 4FF1A 1FYJA 3STBC 1YDXA 1KLUD 2O2LD 1NR7A 3OTOQ 1MNGA 3ONYA 4UB8Z 3CPWA 2C5CA 2WJYA 4CKCA 4GZYC 1BVSA 2F4NA 2VNJA 1YNJD 4JI0L 3CC2B 1W0KA 1YNXA 5JJZA 2N04A 1ASYA 2Z6BD 1SJHD 1A32A 1WA8B 4LC1A 2E5LB 2GVAA 4X1KA 1CA5A 5E79Z 4B43A 3MXNB 4P2NA 1SMYD 1YIJA 3B82A 1L0LH 1ET9A 2JJ1A 3NELA 3PN1A 1H8EG 4U3JB 2WLIA 5BSYA 1SNOA 2GN5A 4QUZA 1I5XA 3OW2B 3SGIA 2MO1A 2YTVA 3M3YH 3S1MH 2WZNA 4XLCA 3WB0A 1VQ6A 5BY1A 5M3FH 4JV5O 2OEOA 2XOKG 1Q6UA 1YZBA 3JARA 4G28B 1W35A 1F2LA 2QILA 1LTTD 3F2DA 4ALPA 2R61A 2HHHL 2EZVA 3KF8B 3AEVA 3CW2A 3R3OA 3PO2H 4MTOA 2UXDL 4O4JA 2NZOA 5FL7A 4ULLA 1EEID 1KJZA 2L15A 3Q6QA 1SLJA 4DPGA 2GV9A 4A3IG 3T51B 1B3AA 2D62A 4NTYA 3M4PA 5EPLA 2P5ZX 3S15H 3NENA 4UY8C 4Q20A 5IK2A 4J11A 1JVMA 2CCZA 1SYBA 1EL0A 2DE0X 4GCZA 5KYIA 2IX3A 1SMYC 3CE2A 1AI4A 3FB5C 2QKAA 3ZRWB 1BQEA 1QNKA 1N0JA 5LMNW 5TISZ 4KHPQ 1E7ZA 3PO3G 3ETGA 2YTXA 4EQNA 3WDNA 4LAAA 3MFYA 2QKSA 1Q7YD 4XM3A 4JAAA 4X20B 1EU3A 4NB3A 1EZJA 1OHHA 3NK9A 4KKUA 3ONAB 1K34A 4QE7A 2JJ2A 4P9SA 4IIJA 1EYCA 5ISRA 1R6TA 3KCYA 5CBFA 1I8DA 2QDXA 2VZLA 1YJ9B 2E75C 2R70A 1HR0L 3C3TA 2F95B 5B1OA 2P3MA 1ZEQX 2NNUA 3LWUA 4O1NA 1OB0A 3CXCB 2BV3A 4WRDA 4AF7A 2C2WA 3RY8A 4DRXB 4DR3O 3ZBTA 1M8AA 2JXMB 5M3FG 2CBXA 1GOZA 2JRIA 3A8KA 4DW1A 2HCIA 2R6GA 4O0AA 5JJJB 4FLXA 3A56A 2UUBL 4BBRG 1KTVA 4YAWA 2IW3A 4LF6O 2LJ2A 2IJJA 3ETEA 4B7EA 2V7QG 4PDLA 3P1HA 2F0WA 5FK9C 5GW7A 5LBQA 4CQJA 4QMGA 1V9PA 1H9MA 3CPXA 4BY1G 1UWVA 3KF6B 4A75A 3R8BA 5LMUB 2Q0OC 3VQYA 1IBMO 1K9MC 4X64L 2ZXRA 4L63B 3NSWA 1PKVA 1HZAA 1AP0A 1DARA 3WG7C 1R4QB 2LW7A 3CC4B 3ZBHA 2Y0SB 3A7AB 4LFAB 3JAMc 2QGNA 1YJ9V 4AF6A 4H37A 3Q6SA 1PV4A 2GVBA 2VUMG 4NXML 2P6JA 5EKIA 5CDFA 4P2ZA 5FNZA 1IDSA 3OIQA 3WB1A 1HNXL 4GKKL 3JASA 1Z9FA 4XDLA 2B2YA 4X1YB 1M57B 3G6BA 2JVDA 5CV5A 1PTOH 1SQPH 2VS1A 1BHBA 5B6IA 3K0DA 4LF7L 3CMAA 4ZAIA 3RWRD 2FMMA 5EAYA 3BVZA 3H91A 2EYPA 3GTPH 3QFSA 1N32Q 3QIAA 1H8EA 5CBEE 2ZXWB 4Z2WA 4OPVA 3SPIA 1PRTF 3PUXA 3QB3A 1VQOA 4GN4B 2CK3G 3SYOA 2HCJB 3WNCA 3TS2A 2E5LO 3PUZA 4IUVA 4RHSA 1Q7YW 1N05A 4P26A 2OYNA 1BQQT 4FNFA 2YU9B 1NT2B 3DXRA 3AG3C 2XRSD 3I4MB 2AHOB 2CQOA 5KA5A 4I0XB 1RTOA 4HN7A 4I7ZB 2VQFL 5IIFA 5DM6V 1C9OA 5T1IA 4A3JB 3J80i 1EFID 5DECA 1SYGA 3RBZA 1AW7A 4H9GA 3MZ5A 4JV5L 2DEUA 1VQGA 1XTDA 1WNSA 1TUBB 3JAWB 2KKWA 3L9DA 2UUCB 3DXRB 4IPHA 1J8IA 5DNFA 4H44C 3SK8A 1MABG 4TV9A 2H4OA 3RMHA 4EQPA 3F2UA 2XNJA 3BU2A 3F5TA 4X64B 4A5UB 2VJIA 3MCAA 1DOMA 2ZBVA 4KXRA 2K7VA 2VY3A 4EKWA 3PIP3 5KNCA 1AZPA 3PGZA 2A7WA 1VF6A 1XNQO 1NH2D 2GQFA 4RGTA 3LNNA 4X07A 2CWAA 3W7UA 1QR8A 4DFAA 4KHPB 1NMGA 2DMXA 1IXMA 1E3XA 3N27A 3RT3C 4DV2O 5F2DA 3PO3H 3GVKA 1D8TA 3MTSA 1FNDA 5I6YA 1QVFU 3E8GA 4K35A 1O80A 4ZLTF 2EYFA 1F2ZA 1D2BA 4WZEA 4LC0A 2K1BA 4XDJA 2KQ3A 1B6QA 2Q7HA 2ZXOA 4OONA 2K50A 4UPAA 5GTHZ 3U50C 4PG3A 2EYLA 4GN5A 2JA6H 3HOZG 4JBMA 1E64A 3QO8A 5IYCO 2K9PA 3QO5A 2CW5A 2PNRC 1FJGO 3O65A 2M2LA 4MTXA 1TR5A 4FK5C 3E2EA 1Y4MA 2DQ0A 1MRZA 1SYDA 4J10A 3HOZB 4GNXA 3KJPA 4DAYA 2PQAA 1R6NA 3Q23A 1SA0B 2Q2IA 5EYPB 4DV7B 3DC6A 1XEQA 2B8FA 3I7FA 3SYPA 3I55B 1P84F 2EZPA 4X66O 5ELOA 1Q82W 5JPMC 2R93B 3L70H 4X7FA 5CV9A 1HNZB 4Z4VA 2B63B 3RYFB 4LFBB 2E5LQ 2DOSA 1N32L 5C3EG 2EJGC 2CH7B 3NWSA 5LMUQ 4BBSH 3MVVA 4KL1A 1WB8A 3QE2A 1VQ5V 3FAVB 4ZRZA 4A3EB 4O4HA 4DAMA 4YJ3B 2IM9A 3I4NH 1WU8A 1Q1EA 2KUMA 3NUCA 4FFBA 4YJ2B 4AQYQ 1S4ZA 3HOYG 1U97A 4TT3A 4B3SB 1XMOO 3JD3A 4XOPA 1HTPA 2HHHO 3OP1A 2XHBA 4JZ2A 4YAUA 2PYJA 4K0KQ 4RD1A 2EFGA 4O4HB 2YWGA 1JFFB 3U2QA 2WLMA 1VQDA 4OP7A 2DIEA 3M9BA 3AG2C 2K01A 3WWVA 3BCDA 4B3RO 4P30A 1MSDA 4AIMA 2ZZGA 4JYCA 2ALYB 3NE5B 3PF5A 2VNUD 1EZ6A 4PELA 3VQXA 4DR2O 4WZTA 1X54A 1H85A 5LMNL 4CS2A 4DUZO 4JK1C 3RFRA 3GVJA 2EYJA 1V55C 1PHJA 2YIAA 3I4LA 2O57A 4B47A 2JYOA 1TKWB 2K52A 5BMVA 2L6LA 3MHSC 3OD4A 4A3EH 1LLRD 1SE3A 3CS5A 5IYCH 1PH3A 2JS5A 3VR3A 4POGA 3H01A 3OMIB 1ZTEA 3JD0A 2ZL5A 1S5JA 2J7ZA 2XWBB 4LCUC 1BR9A 1HCZA 2MJ8A 3T1HQ 2Q2UA 2JA7B 4Z4YA 4AQYL 1XHXA 3G71A 2PYLA 2A6ED 3D4DA 1VMGA 3OE7A 2DUDA 3DTUB 1DDIA 1KMIZ 2GUZA 4F6RA 1QLNA 5A2QE 1KC8C 4LF5B 1LTAD 1YIJB 2K5NA 1VQNB 4TMWA 2HVKC 3J81E 2WB1E 4G4KA 3TP8A 2N8NA 1N33L 4JI1O 5EC2C 4XOTA 4JI4O 1K9MD 2SDFA 3OMCA 3N2KA 3SJAC 4DV4B 1SE2A 4XYQA 3KBGA 4BR6A 1NR4A 1Z5VA 1PJ6A 3JCUZ 2F4VB 5M3MB 4GKJB 3J80N 2PCFB 1B4OA 4DK1A 5IYQA 1VQ5B 4OEMB 4ZGQB 1HW7A 4X20A 3M8AA 1AR1B 2D2CC 4FLWA 2RVLA 4XYOA 4FDBA 3RYIA 4LF8B 2EYOA 1X32A 3ONUA 2LMCB 5JEAH 4DV2L 4O2AA 4XNFA 4DQLA 5E4WC 1WJZA 4UAIA 5CBAE 1KD1C 2WR8A 4TV9B 4A3KH 4B3TO 3SK5A 1SFOB 3I56V 3UO2A 4DV1B 1K73D 2YYZA 1ZM4A 2A9HA 4GT1A 4O4LA 3RYIB 3E3XA 3SYCA 3G6EA 3ABLB 1F23A 2OCCB 4IJLA 2B2VA 2RJZA 2XTAA 1YNNC 1GM7A 1IJEA 2HD3A 4RCNA 2DWEC 2R7FA 3P26A 3F1ZA 3HG9A 4IZ8A 3SHLA 4QY7A 2XVSA 3G71V 3OZVA 5J3OA 1CKNA 2BCCH 3CCRB 5FA6A 1ICFB 1WTVA 2DJGC 4RHRA 4DV7O 1CUKA 3FYIB 1NUCA 3QTCA 4YHBA 2X6GA 1JA0A 1SETA 1H38A 3I3CA 3I73A 5E4XA 2BH2A 2ARHA 2DYSB 4X66B 1WPCA 4P6YA 1Y74A 3A5ZB 2L11A 3T16A 4LFAL 2R72A 2QE7A 2QWOB 5C8YA 2PUSA 5KHJA 3Q6RA 4P3IA 3OWFA 5GTIZ 3T1HO 3SE0A 5FLXL 4ZI7B 1QVFA 3SJPA 5L3EA 4GUNA 1K33A 1EIYB 1BMFG 1EWIA 4ICGA 2UUAB 4DR2L 1Y74B 1K8GA 4OX9L 4XQJA 4BXXH 2WP8J 3BS1A 4X1IB 3PVDA 3BAAA 5J35A 1BLIA 3ZYYX 4GNXC 4YIOA 4RGMA 4B3SQ 2VBTA 4YALA 3OGCC 1PFMA 4DR7L 3W1BA 4TQFA 4IL6Z 4BIUA 1NJIW 2C78A 3R2TA 2XIWA 2VWJA 3CHXA 1MD2D 4NXNL 1COWG 3OEEG 4UV9A 2A79B 2JSOA 4RMFA 4PMWA 3KOJA 3V05A 5IGCA 4B3FX 2F0VA 5KHIA 1SNCA 5EPKA 4FP5D 1FFTB 1WTPA 3HS0C 3MFGA 4RWSC 2CTPA 1QFJA 5LL6X 3G6EV 2IX0A 3W2HA 5L3FA 4L5TA 5FOBB 3S2DH 2N78A 3CCQB 3B8NA 3BVMA 2JEUA 1FNWA 2CC2A 1C4QA 1ENCA 2KHJA 3JATA 2PW7A 4XXEA 3BY2A 5IYNA 4A76A 4JI3B 3OPOA 1W0JA 3CSXA 4K8ZA 3S9WA 4DV5Q 1OCZC 4IPCA 4ZKBB 1OZ0A 4UP9A 4PD4F 1VP7A 4TQUS 2LFRA 3KKYA 1CKOA 3K3WA 2EXDA 1JMKC 4UDUC 3ZPNA 1EYDA 4WFN3 4F7XA 5GAEC 5GAHC 2OTLA 1UFIA 4HAMA 4X1YA 3SLNA 2WINB 3VQVA 1V0FA 3WQZA 1EP1B 5I4DA 3CMAB 3J81j 1YHQB 1SYCA 2EVBA 2IX1A 1VHEA 2OYQA 2BMWA 3W7SA 4FWTA 1WDTA 1N0NA 1IL2A 1OCRB 3H0GH 1IHZA 2Q6OA 1TTTA 1STBA 3K7AB 3CHBD 3UDFA 1K73C 1X3PA 2EJ7A 5LA6B 4YHHB 3W3AA 3H6MA 2PI4A 4DR5L 3S14H 5K1PA 2MK3A 3H1HH 3H9NA 3FVQA 5DN6A 3VR5A 2JP1A 1TWHH 1JMCA 3I4MH 1G51A 3RLOA 1C48A 5IYZB 1S3JA 1XXGA 2MO0A 1NVPD 4GKJQ 4R9WA 4LFBQ 1SQXH 3A0RA 2IT1A 4OL7A 2F0SA 5ELBA 2EX3A 1UE7A 4DV3L 3PF4A 4KUMA 3CMEA 4I4TB 4LNQA 3JYCA 3ND8A 1PTOC 1STYA 3Q4HB 4NTWA 4MS2A 1CSPA 1SQGA 1VQLA 3ABKB 4JC0A 4C1NK 1QH0A 1OCOB 2FYUH 1X3EA 4MVOA 4JYAB 5KX5B 2AWNA 3MD0A 3W5OA 4DV0L 2X85A 3ASNB 3VYUA 3APQA 4M53A 2K04A 2UXDO 4X89A 4C3JG 1N36L 4G27B 1Q3LA 1STNA 1U96A 4H13C 2ZTDA 5CR3A 1E1TA 5LOVA 5BR8L 1BBWA 2XRQD 4JI6Q 1DLBA 1ILQA 4A3BB 1NJID 1PZJD 3J80E 4A3IB 1YHAA 1BOSA 2F3VA 3C1EA 1KD1D 2JGDA 3Q8DA 3VR2A 1HZEA 3CCMA 1A3UA 3D31A 3ZX6A 1EWHA 3AVUA 3EJIA 4QB4A 1S5HC 2QEXA 4G5GA 1N4CA 1QVCA 4R4CA 1EQTA 5C0XH 2JA7G 1QILA 2EY6A 2Z6BA 5B1NA 3TGUH 4Y9UA 1I94O 2ZT9C 4JI8Q 3TBIB 1XDCA 1B50A 2WV6D 3RR5A 5JVG3 3SXHA 3R65A 3JAKB 2JQOA 3ZCCA 1Z2GA 1D2DA 4FLUA 4KP4A 2WIIB 2B39A 4KY5A 3I4OA 1CNEA 4X65L 2B2WA 4V190 3AK3A 1DK1A 4J0QA 1JNYA 1PFNA 2HJFC 2MUYA 4NKLA 1V1OA 1K7DA 1N07A 5JJKA 2KCMA 2MGSA 1V1PA 5L3DA 1XQBA 1JT8A 2D9RA 4X7CA 1HTLD 2OQ0A 3JAKA 2CAZC 3F2BA 4FJCC 4R6ZA 4B3MO 3ZJYC 4I50B 4F4LA 4JYAQ 1Y66A 1M9NA 3QG1A 1PNLA 4JTDB 4HSPA 1JJOA 2CW0D 4RD3A 1PFBA 2V31A 4UAJA 3RN2A 1ENAA 1TAEA 2ILMA 2YWHA 1LTGD 3QJYA 1PP9H 4QHYA 3W2FA 3PUMA 1R9TH 1JJ2A 2EXZA 3MEHA 3J80L 4UVBA 2ZM6Q 1N8RW 4RUEA 5LMNO 4QIWE 3G67A 2QEXV 2GSMB 3AG1C 3HOVB 4A3LG 4GLVB 1L0YB 1DOKA 2Q69A 3B8HA 2BA1A 1XNRB 1HNWO 2G38A 2WSSA 2K75A 4IN3A 4X62Q 4CDEC 4B3RL 4JI1L 4DK3C 3WNBA 2Q8TA 3N52A 3AG4B 1NBMG 1WOSA 5FLXc 3D3IA 4G6IA 5I2YA 5DN6G 5TR9A 1M90W 3G4SB 1EOTA 1Z7TA 3BHPA 5KHGA 3N2KB 1VQ6V 3A74A 3HOUB 3DM3A 1HUNA 5BR8Q 3OFNA 3MA2B 4JI6L 3H9VA 4MVSA 3K6OA 5DLQE 1VQ4A 1Y1WH 3T4AC 3CC7A 1SQVH 1D7QA 1RHPA 3K59A 3PUNA 5C0XI 1Q81C 5IYDG 3CB2A 4HYOA 3U11A 5JH7A 1H2GA 3G71B 1EUJA 4KLKA 5M5XB 5LL6S 1ILPA 1YI2B 2X0LA 4JI7O 4PC2A 1S5CD 2N55A 2HJDA 1DGSA 2Z4IA 1GJXA 1BQZA 1XHZA 4LBZA 4RLZA 3VQWA 1IBMQ 1E1OA 2DYRC 4CBVA 3T1HL 2WAQE 2RCFA 5HGTA 4JPRA 3UKMA 5JH7B 5LYJB 2V7XA 5D65A 4FZ0A 1K4CC 3CEIA 1TUBA 4YWMA 4P72A 4X3UA 4QJFA 3FPPA 4BBSB 4HNAB 1SEBD 3QOLA 5JJLA 4LWSA 1UNSA 3KLRA 5JBQA 5IT9c 1KP2A 1ORQC 1FX0A 4DV7L 1I94L 1MI2A 3ZJZA 4KD4A 3DWAA 3TP7A 4O4IB 2FVGA 2OTJV 3KL9A 1CFMA 2AQ3B 2GK7A 3CXCA 3CCRA 3OZUA 2G9HD 4N9PA 1I50B 1Y8PB 2OK7A 4OXSA 1PZID 4PV1B 1YJWV 1OB2A 2F0KA 3LWEA 1M5IA 3E8HA 3ZHTA 1KECA 2R7ZB 4PQXA 4X3SA 3D8GA 2UU9O 2EIMB 4X8IA 3D6CA 3VDYA 2A6HD 2ODMA 4O4LB 1VQKV 2FJ2A 4J15A 3ZMVA 5AJ3Q 2Q4PA 2Z0AA 2GDSA 3OMGA 4OXPA 1Q90A 1GK9A 1W6KA 4XIGS 3E9IA 2F4VO 4MNOA 2WB1G 2X6XA 1STEA 4DUYL 1VQMV 1RFYA 1UJWB 4DR4B 4ACBA 2JA6B 2I46A 4CH5A 4B44A 1MIUA 4AI8A 2JN9A 3HKDB 2R9IA 5HZBA 4DXFA 1H8HG 3TCUA 4UCSA 3AB9A 3VYRA 2Q2TA 2JA9A 1P8LA 1TT2A 1VQMB 1I5FA 3BC9A 5CA1A 4ZKIA 2HDNB 5JJNB 1VLOA 1TWFB 3V7AA 1MMMA 2DYRB 3GWKC 4KHZA 4FF3A 5FLXN 3ZHVA 2QTOA 5TY0A 4JTCB 3W7TA 2EJFC 3I91A 3KBXA 1I4HA 1MG1A 3A8JE 5JOBA 3RW0A 5KIXA 4R1JA 2BSKA 1XFOA 2FB5A 1UD4A 2AHZA 4YY3O 5FIUA 1K83B 2C9OA 2L5TA 2PZTA 1UPGA 2DGYA 1M57C 4MVUA 1H8HA 1SMXA 2E8GA 3TZDA 1TUIA 4PA9A 1CZWA 5I6WA 3CYOA 4FFKA 3HKEB 1O9GA 3CCJV 4CHTB 1P7GA 1YF2A 2DQ3A 1LO5D 4KFMA 3S1NB 1U4PA 1IW7D 2R7ZH 2Q7EA 3CCSA 4FLVA 1NVPB 2V7QA 1HA6A 3QFTA 2AQ2B 3C90A 3VR4A 1X6OA 1JJ2U 5FO8B 1PH2A 4K3AA 5TV2A 2F0UA 2KCCA 1WD0A 3UDXA 1OGJA 2CNDA 4IHJB 2X3UA 4RPBA 1TQOA 1AI5A 1WLEA 1AVMA 2B2UA 1S77D 1M56C 1O7LA 2Y69B 2V7UA 3PQIA 3RZDH 4M8AA 5LOVB 4B3TQ 2VWKA 5DSZA 3WBJA 4DV4L 2PI2E 3A8JA 4RA8A 4ZUIA 4ZGNB 2V4DA 3QNEA 3ES9A 5KNBA 2K5QA 4HJAA 3SJBC 4X3TA 4WQMA 5C3WA 4JI5L 1FRNA 3S2HB 2HLDA 3DHQA 5JWPA 2ZM6O 1IBML 1W3SA 3CCUV 1W9XA 2ZNJA 3PO3B 5C44H 2HLDG 3ZZ0A 5IJ0A 1XTCD 3HEJA 1VQ8V 5LGUA 2L1BA 5H1SE 3MXNA 3GVMA 3KEWA 2LQTA 2Z3YA 4ZHQA 2LS01 4CJ1B 3M7NA 4K6LA 2CH7A 3A8TA 4H02A 2CFMA 4AQYO 1GUSA 4KD3A 4DV3Q 1M93A 2UXDQ 1H2MA 3PCOB 4P9PA 1H2NA 4DV3O 3ZMZA 3FB6C 2CW0C 2X69A 5KHHA 1LTBD 2EPBA 2B2TA 2X6LA 1OXSC 3TS0A 1KNEA 4DR5B 1V1QA 2EY5A 5FL7G 4BW9A 1RQPA 3Q3AA 2D0OA 1HNZQ 1UD5A 5H5JA 5M3MH 3P3NA 1BXTA 5DS0A 1XI1A 4M1KA 4OX9O 1LYLA 2E2JH 4TMZA 2OIGA 1M1KD 1BCCH 5EBLC 3JAMN 3SLDA 4XQFA 1Q86D 3KK7A 5EQ0A 2NN6G 3LVBA 3ISXA 1LTSD 2KCTA 4UP7A 4ZCKA 3SDZA 3HKZG 4QGUA 1WTRA 2ATWA 1K0SA 4JI6O 3RYCB 1JWUD 4OPAA 3C3LA 1RM1C 4LF7B 1EWYA 1EQRA 4W4LA 2UXBQ 2JA8G 2ZDIC 1QGYA 4B3XA 4RAUC 3X2QC 3LDEA 2A06H 2JS3A 3RLFA 4AILC 2KBNA 3RZDB 2OBTA 3I4MG 2B2VC 1RCVD 1BQ0A 2XAJA 2JGUA 2VQEO 1T9HA 2EZOA 3QO2A 2CTWA 1XMQO 2B7BA 3JD1A 4HEDA 3ERQA 1GM5A 4YELA 3BABA 2YDEA 3HKBB 3FJOA 5JEAJ 3JSNA 3RNUA 2JA5G 2L35A 2EIXA 4Q6GA 3UDGA 3CRAA 2UXDB 1JQYD 2A73B 4H7BA 2PZWA 2YIDA 1YHBA 1PD3A 3CCUB 5C4ZA 4AH6A 1S5DD 1YVWA 2F03A 5DEHA 3L0OA 4L5RC 3K7AH 3CC4V 3AVWA 4JI2Q 2KA7A 3TN2A 4NXNO 1HWYA 3U6BA 4IFDG 3OOCA 3STBD 1VQBA 1P7BA 5L3CA 3KYHC 1FNMA 3WG7B 3ZHUA 1K28D 1W87A 2XZOA 3FP9A 1PPJH 4B3ML 4ZQ3A 2JEBI 2XOKA 1ENVA 4CGYB 4DNIA 1HR0O 4JI7L 4DO2A 4Y7NB 3M4OH 1KB9F 4TT3G 2NZHA 3X3NA 4NMZA 4HJ5A 4X1IA 4U3FH 2GBOA 1MZFA 2RN9A 1ZYRD 3A8IE 1HQMC 1Q5OA 4HZ3A 2CUGA 3CF5A 4CDDC 4NTXA 2JN4A 1II3A 1BGYH 4QUFA 4F8MA 5FO9B 3U0ZA 4MIUA 3GTJB 3S16H 3ASTA 3BQJA 4LK1C 2PYKA 4DR1L 3W5HA 1KQSU 2F4VQ 1HNXO 1P16A 3ZHQA 1NDHA 2VS0A 1JB7A 1E2WA 4XDXA 3HOXH 3RN4A 1QUQB 2XGJA 2NN6H 5K36H 1ZL8A 5KAIZ 3BEHA 3L73H 1S0VA 5JVDA 1BBXC 1I08A 2HEPA 3U10A 2Z4HA 3I90A 5T1GA 1A3VA 1D1IA 2UXCL 2VQFQ 5LHGA 1SR3A 1G7TA 1AZQA 3F7YC 2BOCC 1WP6A 3B09A 3OKXA 3E0EA 2CH4W 1QFYA 4PV1C 2NTSA 1EFRG 3E86A 1DOLA 1MBYA 4H44B 4NXMO 1JA1A 1DYQA 1BF4A 3PJSK 3OUSA 4AYBG 1YHQA 3EIVA 5C4HA 1J9ZA 4IGGA 4MSWC 3J7AU 2B3GA 4HJ8A 1N8RD 1EQQA 5HURA 4DR6L 2DJFC 1IKLA 2DN8A 3R93A 3GTKB 1JICA 4JOIC 4FZ1A 1XX8A 1WTQA 4IT5A 3S3XA 4RQFA 2AZ2A 2P4KA 1CHPD 3TDQA 3PIO3 1X4TA 1CQFA 1O7ZA 2Q2HA 4R7CA 1N08A 4KN4C 4GX2A 4XLAA 4B3SL 4DR3L 2UUAO 2OT5A 1MZEA 5H9CA 4ROXA 3D8CA 2GREA 5B1BB 5EBMC 5BZBA 1S4MA 4ZCMA 1QJOA 1NSNS 2A74C 3FPUB 4IPDA 2WLLA 1HNXB 3EXAA 2WPDA 5LHIA 4JYBA 3ZRVA 2LZJA 1XOUA 4KKTA 1SA0A 2LFNA 1TWGB 1MABA 3GV6A 1QGZA 1YJNA 1BT8A 2HVJC 2ZTEA 4GKKO 2EIKB 3A3BA 3CCQA 3HOXG 4PA6A 3TXSA 3KLWA 1DONA 1R4PB 3OEHG 2ZIOA 2UXBB 2ZZEA 1Q43A 4LBWA 3MHBA 3ASPA 4LP8A 4GKJO 1WVLA 1I3QH 4TRDA 2IBZH 2LO1A 1QHTA 3FDTA 4JI3O 3OE7G 1G1XB 3PUVA 4A3BG 4JGSA 4X62L 5GV7A 5LMNQ 1WN7A 1SAPA 1F7YA 2D3NA 4RD4A 1R9TB 1TVCA 4B3GA 4XDKA 3CU7A 3GIRA 1IL8A 5FNVB 3CC2V 4K8IA 2FINB 1XPUA 4V0BA 1WPXA 1Z47A 1YNJC 4LF5L 2F4VL 5D5PA 5CBHA 4A3DH 2Z5UA 1JR0D 1NJIC 4Z4RA 1YVCA 4JI2B 3NBHB 3JQPA 2F0PA 5EKKA 4IFDH 4XT3B 3UI2A 1L1FA 3IJ4A 3LQ6A 4LBVA 3WXMA 4HIDA 4QE9A 2RDFA 2WLJA 2EDGA 3TSSA 1N34O 4EB6B 3DEOA 2E76B 2K5HA 2L12A 3G4SV 4GQNA 4AHCA 1Z6HA 2NVTH 3NBHA 3A3GA 3UDIA 3B40A 1SXTA 1JB9A 4Z1MA 2SOBA 2OT2A 2BCOA 1NB0A 3AVXA 2F0FA 3BJUA 3P75A 3ZRSA 2V7WA 3S15B 4DR4O 3DMUA 1FVIA 1YJNV 3BPZA 2KVOA 2ZXHA 3E0JA 3HOWB 4JI1Q 2ZXWC 3ETDA 4PMBA 2TMPA 3BDCA 4EB6A 1NY4A 1TXYA 1V1PB 2UUBQ 1R3KC 3OGIB 2YWEA 4DU9A 3L72H 5JQGA 1YEWA 5IYWA 4OOXA 3BG3A 1OXXK 1S5FD 4RDJA 3PSIA 4CC6A 5CA0B 3P3PA 1LTID 3BA9A 3SJCC 1HPCA 1TWGH 4EEQA 3HAGA 3E8FA 2ZCEA 2HQLA 1CT1D 4X64Q 2WZPP 1AFPA 4A3FB 4IOAA 5K5PA 1JA8A 5JQGB 1YEZA 2EQSA 4BBRB 1JE4A 1HR0Q 3ABKC 4FO2A 4HJ9A 4FM2A 4G57A 4RGOS 4HMIA 4LUZA 4DR1Q 2M6YA 3E5SA 1VQCA 5CGKA 4A3FG 4ZHQB 3JAMi 2K32A 3WB2A 2RF4A 4K5XA 4JI5Q 1FXKA 3IAYA 3CB4A 4CJ2C 2DNCA 4H13B 4JI5O 1A62A 4WF9V 2F93B 2EE1A 1J9OA 2NWGA 3D3RA 2EULA 2BA0A 2I07B 1NQTA 4KI0A 2CTQA 4QFMA 1VF5C 1O78A 4QL5A 2W6JA 1AE3A 5E7NA 3G4SA 2YIBA 4OWXB 3K5NA 3V76A 4RPDA 4P74A 3A5UA 3FYEB 5ELNA 1N32B 1CM9A 1BHAA 3B8MA 1ESFA 1WOPA 4P22A 1EU4A 2L55A 1GMGA 3CRMA 1Q3EA 1BKBA 4EX5A 3F7VC 4ZBMA 4JW0A 3STZC 1QX4A 2RHQB 2VBUA 3MC0B 1W0JG 2F23A 4YHHO 1K9MW 2Y48A 1Y1WG 4HIKA 4FN5A 5HFMA 3Q24A 5H59A 1KU9A 4MVZA 1S72V 4CKEA 4A3DG 2F0GA 2YSUB 2OXPA 2YTYA 2FMLA 2PNHA 1U4RA 2MFIA 3RN5A 4GKJL 1Y67A 4DR3B 1LNQA 1RKNA 3D4RA 3H0GB 4JOIA 2R92B 3CPWB 1N33O 4RD6A 4TSFG 3HKBA 1B3QA 1VMCA 3HOYB 2FXQA 2E2HB 4AQYB 1AEXA 2FMCA 1PRTD 4Y7NH 3KF6A 1IBKO 1TVKA 2VQFO 1BX1A 2ENBA 2K33A 4WFAV 1URFA 3STLC 5IYBO 4BWAA 2ZITA 5F4MA 1MHWC 2WA3A 2KG7B 1KDAA 4UZUA 2JK5C 1VQFA 2SEBD 5LMUO 3Q38A 1CI3M 1L2FA 3P30A 5D3DA 3CP2A 2BPOA 1OB5A 1Y1VH 2KENA 3I8ZA 1YCIA 2QM4A 1D5AA 1CTMA 2I5MX 1WI5A 2VNIA 1IB0A 3GTQH 4A3CG 2WAQB 1E1RA 4GX0A 3AVYA 2F43G 1D2EA 3D0FA 4C43A 2OQKA 1MKHA 1X3FA 1D5NA 4TQDA 1ROPA 1N34B 2K14A 5M5YH 5CV4A 3A1PA 4RKLA 3K5MA 3CCVA 1WTOA 1I4RA 3SDLA 4E4EA 1DZ1A 1Y6XA 5GONA 5G3LD 3THOA 1I50H 2X6WA 2NYZD 1W2BA 2R9RB 1EY6A 1HZBA 3NXSA 1S5LZ 2UUBB 2MW2B 1E2VA 5LYJA 2QM8A 3JALA 1TS2A 3MAQA 1WCMH 4PA3A 2QDLA 3EA6A 4NYKA 5HGQA 1KRHA 1JB3A 1G4YB 1B9MA 5KMGA 1G291 2E75B 1KKCA 4DR3Q 1IBKB 1NZ6A 1SNPA 1Y0RA 2QW7A 4QVAA 4OWWB 3S14B 4G7OC 3ASSA 2W0FC 1IBMB 1E63A 2K03A 2ZR2A 5M5XH 4LH7A 3TQYA 4FYDA 3OR6C 2CWPA 1IYJB 4MTNA 1U4MA 2NB0A 4DV1L 4ZIBA 2R92H 3M4OB 1Q8KA 4YY3Q 1Q90D 1E1QA 1ZLZA 1LABA 3U9OA 1TWFH 2Q73A 3BVGA 4X66L 3OIPA 1NE3A 3UE0A 2VW9A 2IWHA 5C5LA 1BCPF 4DUYQ 1FD9A 2WSSG 2VJJA 3JAML 2MQHA 3TETA 1ICWA 4KY6A 1HRJA 2SNMA 3S1QB 2QWQB 4WJWA 3HKDA 5LMNB 4XKVA 3C46A 2G9DA 1NR1A 1BPLA 1N0UA 3ZN0A 1FRQA 1D5MC 1F9QA 1AMOA 1HNWB 1OJHA 3AG3B 3BY6A 4L8JA 4RUFA 2IHFA 2DERA 3OR7C 1QUEA 1KIXA 4MW3A 2I1LA 3ZHSA 5A88A 3AG7A 2RCVA 1H9SB 1TS5A 2NUCA 3L9AX 4PZ7A 4YWLA 2UXCQ 4RKBA 3QSYA 3K03A 1E0BA 2OTJA 1FPOA 2ZD9A 3CCRV 2OCCC 2B5OA 4RCOA 1NRKA 5KUMA 1A8VA 5KSWB 5J1ZA 3MDSA 4D7TA 5CN0A 1PYSB 3HRZC 4YHHL 1JOQA 3PENA 2W6IA 1VMPA 4XMYA 2QTSA 1G6ZA 4WORA 3CD6A 5F2VO 1SQQH 4A3DB 2AZ0A 1WAZA 3J81k 2YXYA 2DETA 1SM4A 2L9HA 5IGFA 2R93G 4PC3A 3K5OA 3OMNB 5F4OA 5A89A 3UQ8A 1EYAA 1QB5D 2B2TC 3IKJA 5D14A 5BN5A 4BY7H 1PL4A 1G6PA 4C7UA 1VHOA 2E2HH 2ZJRA 5FO1A 3F8TA 1VQMA 5CA1B 4OIKA 5LP6A 4LFCQ 3R6JA 1G2TA 4J1MA 4XT1B 1JPXA 4HAEA 4KTAA 1N8RC 5EJWA 5CA0A 1EBOA 4LFBO 5CV6A 5FJ8G 2X0KA 2XAQA 3J80c 4WZKA 3W5UA 4YEJA 1EY7A 4TSSA 2ZT9B 3GSIA 1TY2A 1CZGA 1RPRA 1JOKA 2CGOA 2G5DA 1SKYB 2ICIA 2IL8A 3BYTB 3EQLC 4BAYA 3HKZB 2XAHA 4LW1A 5LP6B 1ZAUA 2JGDB 1R5NA 4WFGA 2FHTA 2PQAB 4X88A 4WCEV 4XQQA 4PI0A 1B53A 3CCJB 2B1IA 1TUEB 2Y4TA 2B9ZA 1R3JC 1OXTA 3CCLV 1UEAB 4C3IH 4B3RQ 1HHVA 3UO3A 1A15A 4PC7A 5KRUA 3G6JB 4UVCA 1FXKB 4K14A 1SYFA 3AFQA 2PTMA 1KLGD 5CMDA 4GKKB 1JWMD 1H2KA 3CRLC 4K6DA 2WAMA 1MA1A 1QFZA 2N3SA 5IY5B 4G1BA 3QF7A 1PZKD 2HP8A 4A3CH 3PMFA 1GXDC 4LF4B 1KK1A 2D3OW 1PL0A 1IZ3A 2EINB 3M99B 1W0KG 2AHYA 4DR2B 2XZLA 1GUGA 1GO3E 3D26A 1HNZO 4YJ2A 3NP8A 4PDRA 2BN4A 2XN9C 4Y7CA 1RIPA 1IKMA 3BRCA 4TWKA 2XEXA 2EY1A 4R8IA 3FKIB 2LGWA 1E22A 4J9ZB 4IYIA 3A35A 3L75H 3OYYA 1LT6D 1XBLA 1LT4D 1SKVA 2P90A 3LSSA 4WFFA 5L3GA 1N36O 1GM9A 3AG1B 4BA1I 3URYA 1EP3B 4U68A 1CEZA 4ZUJA 5FJ8H 5DEDA 1XNQL 3ABMB 3MXUA 2NVXB 4KKSA 1V54B 1GUWA 2ZZQA 4ID6A 2OCHA 2XASA 5LMUL 3KF8A 1BS3A 4IFDI 3A54A 1XPRA 4BY7G 4RD0A 4OX9B 2Q7GA 2X7RB 3LO8A 1EFRA 2NVQH 2VBVA 1GVPA 1UE1A 1K0RA 3WY9A 1YJWB 4DA2A 1I5YA 2WWWA 4G7ZC 4EQOA 4X0CA 1W59A 5FO7B 4I9QA 4EGVA 3DLLA 1LUVA 1HDJA 2QMUA 4B9XA 4P6VF 5B3SC 2ITCC 3GTGB 5AFWA 2P67A 4BIOA 1U0LA 4MYUA 3CRKC 5LXTB 4E0FA 4J7KA 2DCUA 2WAQG 1GM8A 1B23P 2W0XA 2WLNA 2E2JB 4PAAA 4LBEC 5JVDB 4CS3A 2O4XA 3CESA 2VQEB 1FNVA 4TV8A 3CC7B 1IBLL 4LF9Q 4Y9RA 4YJ3A 4GOPA 2QWNB 1QVGB 4HCSA 1Q8IA 2Q68A 2JEXA 2IPKD 2PI5A 3M85A 4B3SO 3VMFA 4J41A 3DDYA 2Z6KC 4X65B 3G7LA 2I5LX 5CYUA 4GLXA 4NCNA 3H15A 3RYCA 2RC5A 2DYIA 4J9YB 2AW9A 1FS0G 3RVYA 3W7WA 4M0LA 4R8NA 1K73W 2HIVA 1J5EL 3HPLC 4RD2A 2X6YA 4A3KB 1FGUA 1IXBA 2P5OA 1FNCA 2EJMA 5I9PA 1EY4A 1I4XA 3ABLC 1UD6A 2LW1A 1VQPA 2CGNA 2BTQB 4YHHQ 5IY5C 1ZM2A 2Q5ZA 2P22C 4XKWA 5TSSA 5IY0A 3JAME 3M4YA 3S3WA 1TLLA 1BSMA 3B4SA 1V5VA 4J7JA 3ZIAA 3BA8A 3ZUGA 4OX9Q 1M1KW 5B1AB 1SC5B 4B7KA 1WTXA 3P27A 1QLEC 2ATKC 4BW5A 3GQBA 3ZHRA 1W6JA 4EVOA 3P32A 1QOHA 1N32O 1L1OA 2E5LL 3BH4A 3CD6B 1WSVA 2C4TA 1QBZA 4FMTA 4ABMA 3WU2Z 4TMTA 1ZUNB 5BSXA 1PM9A 1VQOB 1QG7A 2RCNA 4WFEA 2CDYA 3IGAC 1WCMG 1PFSA 2V7VA 1X9NA 2L4NA 4DV1O 1Q46A 1V54C 3E1YE 4G2KA 2ZL6A 5GONB 1W34A 5FPRA 3P20A 2F0EA 3SPHA 4JBJA 4LUOA 2RC6A 4P75A 3TP6A 4DAPA 1IBKL 4GKKQ 3JASB 4H33A 3GTGH 1KL9A 4II3A 2BF4A 1NTMH 2CF4A 4JI6B 5B5EZ 3JATB 2EYHA 1PH7A 1JE5A 3ZRXA 2WLKA 4UCRA 3P7JA 3GTOH 4LF4Q 3CCEV 1KUQA 2QWPB 1E79A 1M4VA 1PLFA 2WB1B 4IUPA 3VYTA 4PNYA 5KA6A 1GVHA 2ASBA 4G1VA 4EFEA 4C56C 5B3SB 3PV0A 1NAPA 2A19A 5EKLA 5KW9A 4JI3Q 1S0UA 1XNRL 1ZM9A 3HOXB 5A35A 2VQFB 5LHHA 3TXQA 1ESRA 1WPBA 5EZYA 2VBSA 2AHOA 5GAGC 4DV6L 4LF6Q 1EN4A 2YEVA 4TKOB 3UT5B 3JQQA 4QVJA 4KN7C 2Q0AA 2E1RA 1K3EA 4MTFA 3H3VC 3MXPA 4NDXA 2B8GA 3HKEA 1KK2A 2WLIB 2M00A 2Z1CA 2ICEC 4FIPC 4R8CA 1I0HA 4X3KA 4RWUA 1B44D 4Z1MG 4XLFA 4IPGA 2QEJC 3U4ZA 3ABTA 3OUFA 1KMHA 2IJHA 3JC66 1T6ZA 2PO4A 3RUZA 1GH6A 3DEPA 1PTOD 2XUMA 5ELFA 1Y0YA 5DM63 3CP0A 1F9PA 4DV5L 5C8YB 4RJLA 1GKHA 1IBLQ 4Z1VA 1PJ5A 5JEAG 4LFBL 2RSOA 4ME3A 3D36A 4RAIA 2OTJB 3Q0AA 1FYCA 2JA5B 3CWBH 3E89A 3T2MA 4GLAC 1X59A 1HNWL 4FM0A 3AMUA 3BNWA 1CNFA 1QZGA 1VQ4V 4C0SA 3CJHB 2K6AA 2ZINA 2H8PC 3ZRWA 1HXYD 5JCOA 5HFLA 2UUCQ 1RPOA 4RCYA 3OJWA 4RO2A 3BVOA 1EY9A 2R93H 3JCZA 1K3RA 4JMQA 1SN8A 2BGIA 3WFVA 2BSAA 1ZXTA 1VEWA 1NH2B 1NMFA 4DN4M 5GQOA 2FX3A 3M4QA 4UCUA 1DF4A 5IJ9B 1IYUA 4FFBB 2F1LA 1H9SA 5IT9E 1YI2V 5ELEA 1PA6A 4XD7A 4I4TA 2HHHQ 4C3JH 2B29A 1LUWA 5B66Z 3LX0A 4K8JA 2M5SA 4C2MH 2OK8A 1VQ7B 1RD9D 2KEEA 1YXBA 4TV8B 1B2TA 2ZE5A 1HJPA 5IGBA 1PV0A 2PQEA 1KP3A 2XT9A 4Z4TA 1Y76B 2ZM6L 5K36G 1I7PA 2ZJQA 1V43A 1HVXA 4WZLA 5A8AA 4JI0Q 3BZKA 1K3BC 3I4NB 4FXDA 1YTFB 4PHZA 3ZMTA 4NNJA 4OWTB 3AEIA 2EIJC 4LH6A 3OEHA 3PA1A 1O7IA 1XMOL 5IODA 4WBNB
chains in the Genus database with same CATH topology
4DNTB 2R9VA 5IGGA 3RGBA 5KHKA 1QNUA 1CQVA 1J5EB 3ICXA 3RYHA 2F66C 3L3OC 4JV5B 4K2LA 2ZZFA 4YXWA 3OHXC 1L8DA 1TIID 3S1RB 1M4VA 1UD8A 4TUYA 5IYZA 1U4PA 2F0OA 4HSPA 1STHA 3NTKA 4I55B 1G6UA 1HQRD 1ONLA 2F43A 4M1UB 1QCBD 4IIJB 4CH3A 4DR1B 1B1ZA 1HUMA 4DK0A 4KHVA 4LF6B 1CK1A 3QWNA 2R3ZA 1BUVT 1GHJA 2ZXPA 4DRXA 2RDHA 2Q8IB 4KK7A 4FF4A 5COYA 3FEWX 4XTCS 1GUNA 4C2MB 2KCNA 5KNDA 4TSFA 2D9UA 4ME5A 5KEEA 4P2CB 2AWOA 4B3MB 2MHVA 5CORA 3NXWA 1BMFA 3UT5A 1TGOA 2KHSA 4FVMA 3R2IA 3S2DB 4J6HA 4HIZA 2PY5A 4O2AB 5D5QA 4FXUA 5IT9L 1KAAA 1XNQB 1JC7A 1RDPD 3K57A 2B2YC 5LP6C 1N36B 1BCPC 4FF2A 4HSVA 5LXTA 4CC5A 4I7ZC 4OIJA 2A69D 5I2XA 1T5XD 5E1FA 2XWJB 2RKSA 3N2GB 4FLZA 2B2WC 1SE4A 4DV6B 3OWEB 2PW5A 3A8KE 4CJ0B 3J7YW 3SR1A 4C1NI 5C3EB 2CQAA 1AN8A 2WACA 2NVTB 2EY2A 1DD2A 3OEEA 5CB4A 3FRPB 1SNQA 1D5XC 2NBFA 2JDIA 4IUNA 1Q12A 4IHJA 1U4LA 4XN3A 3HZXA 5CB4B 2UU9B 3NWTA 1P49A 5C0XJ 5LA6A 4BY1B 4F88A 2A68C 2HDLA 3K0YA 3CMMA 1PMRA 2M9VA 3FFQA 2YI8A 2A6EC 2VUMB 1JORA 4FXKC 2AQ1B 1D6EC 4K2KA 4H0LC 3GTOB 5KNLA 3PUWA 4UCVA 2JA8B 4I55A 1UD2A 2KJXA 4IURA 3IL8A 5KX5A 2RQXA 1JOOA 1FJGB 1Y1VB 5C6AA 2HHHB 2PZUA 3SK6A 2NVYB 1FFXB 1Y69U 4IUUA 1H9RA 3NTIA 3D4WA 2J0TD 2QJ1A 3ZS8C 4LJZC 2O5JC 1ZYRC 4IFDJ 2OWOA 5FLXE 2N88A 1OXUA 2DY7A 1O9HA 1Z5WA 3JU4A 3V96A 1MSGA 1KNAA 3TZUA 5FNVA 4DV3B 2NVQB 4ODGA 1EZ8A 3I70A 3BYYB 3VA5A 4QCLA 4LFCB 5IJ0B 5C4JB 1XWEA 5BMVB 4K0KB 1U9RA 4XN0A 2GJPA 3SK4A 5M9OA 3OTFA 2WJVA 5J39A 1A3TA 4KV6A 2F3WA 4QUCA 5FPOA 4Q5VA 4G7WA 1TVKB 5K1XA 3JARB 2BE5D 1JCKB 2HUGA 5NUCA 4GYCB 2F0QA 3GTMB 5BN4A 1XMQB 1D5ZC 5IOCA 3T1HB 3OW7A 2SNSA 2PMZB 2JEAI 1KZLA 2RBMA 4X1KB 2H1EA 1H2SB 1EY0A 2VB3X 4LMQD 1S5BD 3DXJC 3GP7A 3T13A 3J7AF 2CHBD 1BO0A 5A2QL 4F6RB 1G2SA 1LTRD 4IALA 1FGBD 2D3LA 1GUOA 4UFZA 3L7ZC 1UUPA 2DY8A 3FKSA 4HTHA 4TUYB 2X8KA 2E2IB 1DM0B 3E6ZX 3M7GA 1RF2D 1E2ZA 4O2BA 5J2UA 1I4PA 1EEFD 1Y8OB 1XQ8A 5IGDA 4DV0B 4QF4A 1MGSA 4BS9A 1A2TA 1WTHD 2WKCA 3ETQA 1F2MA 1DXMA 4LF9B 1QWYA 5EGTA 3QG5A 4XQNA 3E22B 3G05A 4RH6A 4AYBB 3S16B 1UD3A 1EWCA 3TP5A 2LY7A 4BWGB 4MHEA 4OHJA 2HCCA 2XSCA 3IFTA 1KDCA 1BNZA 1VDZA 4ASUA 2AUJD 3MXGA 2AUKA 5ITZB 1LT3D 2ZXIA 4K5WA 4MN3A 3U9SA 4Z9CB 1RSOA 3PO2B 1HFNA 2YXLA 2BTQA 4NVPA 4IUTA 2ZTNA 1H9KA 4HBNA 2L0CA 1HR0B 2RSNA 1M4UA 4PMCA 1WD1A 3HKCA 1ENFA 5JCOC 5IGEA 3K58A 1MSHA 5EYPA 2Z8LA 1TY0A 5JJEB 1E43A 2BDNA 3TMEA 1B9NA 1HFGA 5KMGB 4RFBA 4DGZA 2RQ6A 1TWCB 2VB2X 4C3JB 1TWHB 5ELCA 4ABNA 4XL9A 1K8MA 4J8QA 1S5ED 4RGNA 3VA7A 2F0IA 4NP5A 1TWAB 3BCFA 3DWPA 3GO5A 4ID6A 1RODA 3S1MB 1VLYA 5EIBC 1IW7C 3S17B 1Y1WB 1CA6A 1NR2A 2E2DC 2XNAC 3QOJA 2PPBC 1LV9A 4OO1G 4K8XA 1SYEA 2F0HA 3DM1A 1WCMB 3NTHA 3T53B 1OXVA 1JWSD 2WKDA 2IJ0A 3NQTA 2F0TA 4DXGA 2ZTGA 1STAA 1FNUA 1I6VC 1F9SA 3EROA 5EBCA 4JI5B 4HCEA 3VR6A 5DAUA 2NN6I 1ET6A 1BCPB 1IYVA 3GV3A 4PI2A 2F0LA 5E3FA 1B04A 3C1FA 4ZYSA 1CHQD 1X3QA 2BTOA 5CV8A 1KDBA 3DWQA 3RYHB 3VYSA 4A93B 2F0NA 1F77A 1SJED 2J4XA 2A6HC 1DJRD 2Q8RE 4CKBA 4O4IA 2F0DA 4KJOA 2B2UC 1G91A 1HA5A 5JVH3 1SDFA 2F0JA 4NW2A 1E3ZA 1KABA 3SDZA 1TU2B 5C5MA 4C3HG 5ITZA 4DNRB 4U3JA 3NQIA 5G3LF 2CK3A 1A6XA 5IWAB 2E74C 3WOEA 2CVRA 1NCVA 4BY7B 1G8ZD 4ZK9B 3JALB 4A3MB 4DV2B 1FD7D 2PGGA 2KVMA 3GTLB 2K5WA 3DSQA 3HKCB 4DV5B 4JBWA 5BR8B 3N2GA 5C0XG 1LT5D 3ND9A 3GVLA 3CP8A 1EY8A 1I7FA 5HKKA 1PRTB 1WTWA 2K05A 3D6WA 4JI7B 4QIWB 4CH4A 4C3IB 3EFXD 4DR6B 3I72A 5KYLA 1I4QA 1QQCA 3NHHA 4C3IG 3RD4A 4G7HC 4B9WA 4KJNA 2ID0A 2A5HA 4AVZA 3E22A 3SVMA 2QF7A 1XMOB 4D7SA 1O7YA 4YY3B 1N33B 2ZM6B 4FM1A 1PYWD 3HP3A 1I4GA 3N6RA 4X62B 1F9RA 4DUZB 5CC4A 1XYIA 3NPPA 2MPMA 1C8CA 1RJTA 3FMCA 1KTKA 4ZI7A 4TOIA 3H09A 4FLYA 1V0EA 2UXCB 4ZOLB 2JIZA 1YNND 3ITPA 4I65A 3O13A 4UCTA 4HMJA 3KLSX 1EIHA 3HGBA 4S3SA 4K5VA 1ZKOA 2EYMA 3EVQA 2RDGA 5C4XB 1TS4A 5M5WB 3J81L 3OSOA 3IFDA 5CV7A 2GA4B 3B2EE 1PDQA 2BDOA 2R9AA 1I6HB 1SBBB 4B08A 5D3IB 1VF7A 1SNDA 4CS4A 4DR7B 2XZPA 4II2A 1V8QA 4XONA 2X53S 1TA8A 3BDLA 3CQZB 4IUQA 2QCPX 4OGQC 4NXNB 1JFFA 3ZEDA 2BE5C 3KLSA 2VXWA 1PTOB 3SEBA 2MP1A 1I3QB 2GJRA 4L6TB 3GTPB 1EQVA 2YIBD 3OTOB 3T1YB 1LACA 1DCZA 2EOTA 5M5YB 2PZSA 1SQFA 1I18A 3X3MA 5M3FB 3M3YB 3RYFA 1Y8NB 3NBIA 2E1BA 4EFBA 4JI1B 1F2YA 4G7OC 1GUTA 4LNUA 1UAPA 3MWYW 1RTNA 5J2UB 5EIBD 4OO1H 5LHY1 4O42A 3M7MX 4HR7B 4WBNA 2F4IA 5C3XA 2LKVA 1VJSA 1Q1BA 4KMUC 2E76C 4B3TB 4XLEA 1STGA 2E3CA 4BA2I 4HNAA 5J22A 3GD7A 1SSOA 3SR2C 3BZDB 2GK6A 3W2DA 3J7AV 2F0MA 3A7LA 3BDOA 4XLHA 4JI0B 2ZIMA 3A2FA 3K5LA 1BCPD 1NBMA 5ELDA 1QE6A 3CKIB 4ZKCB 4I50A 4NXMB 2NTTA 4Q0FA 3T56B 1PRTC 5JPNC 2KOLA 2O5IC 5JAVA 2K5DA 4DUYB 4O4JB 2ZNIA 4YIJA 4IQZA 5EZYB 1ML0D 2JE6I 3JSLA 4E6IA 5EPJA 1OO9B 5J2TA 4DAVA 5C44B 3PUYA 1TS3A 2FFKB 2K28A 1PTOF 5J2TB 2OF1A 4ILWA 5I9OA 4O2BB 3JAWA 2TSSA 1FR3A 4FLTA 1COWA 2QDBA 4XORA 1H9JA 2GJKA 2A69C 2KEDA 4A3GB 2YI9A 2A68D 2XNDA 2HDMA 1FFXA 1PXUA 4G7XA 3OAAA 3A55A 4OO1I 2DNEA 5BN3A 1EY5A 4UCOA 3KUPA 4CH6A 2NZ1D 3WOFA 1D1KA 4B3RB 4XR6A 5DM73 3H94A 3V2TA 4FXGC 4DF7A 1VCIA 1IBLB 5KGUA 5FKAC 3C2PA 2QKIC 1BDOA 2D5DA 1TVXA 4U673 4LR3A 5IJ9A 4LNUB 1A2UA 2KECA 2HQEA 1SNMA 5EBDA 1GHKA 4KY7A 3Q22A 4JI8B 1L0XB 3DUZA 1EIGA 2BOSA 4ZOLA 4F87A 1T5EA 4JI4B 4N9TA 1I94B 2F1MA 2RA4A 3GTQB 4FF1A 1KLUD 2O2LD 2C5CA 2WJYA 4CKCA 4GZYC 1YNJD 1W0KA 5JJZA 2Z6BD 1SJHD 2E5LB 4X1KA 1CA5A 1SMYD 1ET9A 2JJ1A 3PN1A 4U3JB 1SNOA 3SGIA 4XLCA 3WB0A 2OEOA 3JARA 1F2LA 2QILA 1LTTD 2R61A 2EZVA 3R3OA 4O4JA 5FL7A 4ULLA 1EEID 2GV9A 3T51B 1B3AA 2D62A 5EPLA 5IK2A 1SYBA 1EL0A 5KYIA 2IX3A 1SMYC 1QNKA 4EQNA 3WDNA 4LAAA 3MFYA 4XM3A 4X20B 1EU3A 1OHHA 3NK9A 4KKUA 3ONAB 5ISRA 2JJ2A 1EYCA 4IIJA 1I8DA 2R70A 2F95B 1ZEQX 3LWUA 4O1NA 1OB0A 4WRDA 4DRXB 1M8AA 2JXMB 1GOZA 2HCIA 2R6GA 5JJJB 4FLXA 3A56A 2IW3A 3P1HA 2F0WA 5FK9C 4QMGA 1V9PA 1H9MA 3R8BA 5LMUB 3VQYA 2ZXRA 4L63B 3NSWA 1PKVA 1AP0A 1R4QB 2Y0SB 3A7AB 4LFAB 3Q6SA 5EKIA 5CDFA 3OIQA 3WB1A 3JASA 2B2YA 4X1YB 5CV5A 2JVDA 1PTO