2F1MA

Conformational flexibility in the multidrug efflux system protein acra
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
246
structure length
229
Chain Sequence
TTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDMKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTMMPGMFVRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein A
publication title Conformational Flexibility in the Multidrug Efflux System Protein AcrA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 57
structure length 229
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f1mA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2f1mA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f1mA02
1CTMA 2O5JC 3PUVA 2BA0A 3A8IE 2PPBC 2EVBA 2LMCB 4DNRB 3OOCA 2R6GA 3WB1A 2DNCA 3A7LA 2JE6I 2PCFB 2DN8A 1YNJC 3EQLC 4KKTA 4H13C 2ZT9C 4BA1I 1PMRA 1TU2B 3T56B 4XIGS 4DK0A 2E75C 2D5DA 4I7ZC 2A68D 4XTCS 3VR3A 3P20A 1H9JA 5A35A 1FR3A 4IQZA 2E74C 1GUOA 1H9RA 2V4DA 1GUTA 1H9MA 2A6HD 2BE5D 2EDGA 2B8GA 1OXSC 3PUXA 5KNBA 4DK1A 3FMCA 4OO1G 5D5QA 2F93B 3A8JE 1IW7C 4BA2I 3MXUA 3SDZA 4KI0A 5KNCA 3OW7A 3PUYA 2K32A 1EWHA 4JBWA 3A7AB 1BDOA 1CFMA 3DXJC 1RSOA 1LABA 1VCIA 1Y8OB 3T53B 2EJFC 4OO1H 4TKOB 2NN6I 2NN6G 1HPCA 3PV0A 2F95B 3CRLC 4KMUC 2QF7A 4DNTB 3GD7A 2EJGC 3W3AA 4H0LC 1K8OA 3BDOA 1B9NA 2EJMA 3L7ZC 3I73A 2D62A 2L5TA 2BDOA 1E2VA 2AUJD 3T51B 1OXTA 3D31A 4TQUS 5JEAH 1DD2A 2NN6H 1Q1BA 1ZKOA 1H2SB 1OXXK 1Q90A 3MFYA 4H44C 2JEBI 2A69D 3RLFA 4KN4C 3HGBA 1T5EA 5K36G 3QIAA 4KKSA 3H94A 1HQMC 5C0XG 4GYCB 4L8JA 1GUSA 3LNNA 3D4RA 4KN7C 2E76C 2KCCA 4OGQC 4G7OC 3PUWA 3OPOA 1GUGA 3BG3A 3ND9A 2YYZA 2A68C 5BN3A 5JEAG 3BRCA 4JK1C 3ND8A 4RCNA 3WDNA 5K36H 1IYVA 1O7LA 5JJEB 3FPPA 1ONLA 2A6EC 2CW0C 4PV1C 3GQBA 5C0XH 2A6HC 3IFTA 2BE5C 2KA7A 2K33A 3VR2A 3I72A 1Z6HA 1GHJA 2IT1A 3VR6A 4IFDG 1I6VC 1Y8PB 1FYCA 1Q12A 4G7ZC 3NE5B 4LK1C 1VF7A 2DNEA 3QJYA 1E2ZA 3VA7A 3M7NA 1TKWB 4GZYC 1VDZA 1H9SB 5KNDA 1E2WA 1QJOA 3KLRA 2F1MA 3VR5A 4IFDH 1HTPA 2Q8IB 3WB0A 1YNNC 1GUNA 2PNRC 5D5PA 3M4YA 3PUZA 1Q1EA 1DXMA 3QG1A 1G291 3VR4A 5BN5A 3SE0A 3AB9A 1IW7D 2JEAI 5JJNB 1HCZA 4LJZC 1V8QA 1H9KA 2K7VA 1V43A 4KHZA 1CI3M 3WB2A 2D2CC 1B9MA 4G7HC 1A6XA 3TZUA 2BA1A 3CRKC 3N6RA 1Y8NB 4HR7B 1Y69U 3I4LA 1VF5C 1IYUA 1GHKA 2A69C 1H9SA 1Z7TA 1SMYC 2B8FA 5BN4A 1ZYRC 2A6ED 3M85A 2O5IC 1GJXA 1LACA 3IKJA 1OXVA 3U9SA 3A8KE 5JJJB 2JXMB 1OXUA 4KKUA 1DCZA 2AUKA 2AWOA 1K8MA 3LWUA 1O78A
chains in the Genus database with same CATH superfamily
3D8CA 4ZLTF 1R6KA 1V55B 2EY5A 2ZE8A 1PTOB 3ZUGA 2BE3A 3UE1A 2KEEA 1M1KW 4ZKCB 1W0KA 2BM0A 4A3CH 1KQSB 5KNCA 1VQLV 1N36Q 3CMEA 5ELDA 4XQJA 2EJ7A 4II3A 1HDJA 2QDXA 1D5NA 4R8NA 3N52A 1VQLB 4RH6A 1OXXK 2V7WA 5T1IA 2CUGA 3JASA 1CKMA 1SE4A 1M1KD 4DK3C 3PCOB 4OGQC 3A3BA 1ILQA 4XD7A 5IYBH 4KJNA 2ZR3A 1IBMO 2CWAA 2N04A 1M8AA 3R3OA 5LMNQ 3QFTA 2OYQA 1BX0A 2QA4A 2FMCA 4X65Q 4CH6A 4DV1Q 4MVRA 2XASA 1SQXH 4R50A 2LSSA 1AP5A 1F51A 3UE0A 3AK3A 3T4DA 2CTQA 5GV7A 4OWXB 3M85A 5KHHA 2Y0SB 3CW2C 2X85A 4PNYA 4DAYB 2CWPA 4QQBX 3CSXA 2V1DA 2Q9LA 4L5RC 3ZRSA 1FRQA 1VQ5V 5LP6A 2K5VA 2VW9A 2PMZB 4J7KA 2DN9A 2D9RA 3B09A 5FPOA 1FX0A 3SEBA 2X6BA 1B9NA 2UUCQ 3EVKA 1JR0D 2N55A 3PVDA 1VQ8V 4B3RQ 3H0GB 4LFCQ 3ZMUA 3SK5A 1D1KA 1ESRA 2PI2E 2BMWA 3OAAA 3WNBA 1F9RA 3CC4A 5A88A 4A3LG 1F23A 3QO5A 3KK7A 1Y6XA 2AZ2A 4DR6L 1SNCA 2RA4A 3CF5A 4B47A 2NVYH 4LR3A 1XL4A 2WACA 1E1RA 1KKCA 3A8TA 2W6IA 1FNWA 3A35A 1NB0A 3RR5A 3CCEA 1EIFA 3CC2B 4IHJB 1DCZA 2EILB 2O5JC 4JI6B 4O4JB 4YALA 1ASZA 1PVOA 2JA5G 3CC7A 1ZM4A 4HN7A 5EC1C 2D3LA 1UD5A 4PC7A 4UPAA 1GUOA 4P12A 2WB1G 1R6TA 4O1NA 1XEQA 1K0RA 4IJLA 4CBCA 1HPCA 2IX0A 1KD1C 4LF4B 3ZMSA 3TP7A 1AR1B 1YZ6A 3W5OA 4HJ8A 1NTMH 4DR6O 4LBZA 3QR8A 1NZ6A 1IB0A 4R4CA 3KLSX 5JEAG 5M3FG 1VQ7A 1HNWL 2EULA 3D0FA 1ZUQA 2R3ZA 2ITDC 1MIUA 1PKXA 3PA2A 3S16B 4B4DA 2R7FA 4U673 5EIBD 1XNQB 2B2TA 3I5DA 5IYCO 2LKVA 2VNUD 1PXUA 4MTGA 5IWAB 4WBNB 1A6XA 1P49A 3CRKC 1JOOA 1Y8NB 4CC5A 1SQQH 4IFDI 1JX9A 1ZL8A 4P25A 5JPNC 4X1KB 4LF6L 1ZSPA 4B7EA 1O78A 4LW1A 3QOLA 3J7AV 4FM0A 4DNRB 4E0FA 1EZVH 4K5WA 1U4LA 1U96A 3DXRB 3CXCU 3ASNC 1H9JA 1E1QA 4XQNA 1H9MA 2E2IB 2HQLA 1BKBA 2KBNA 3OE7A 4RD1A 4X62L 2HJDA 4Y9RA 1QWYA 1HNWO 3S1RB 3OW2B 5TR9A 3L7ZC 2BH2A 2PW7A 3M4PA 1DLBA 1TGOA 2EJRA 4YAOA 5AG2A 2OBTA 4JTDB 1FXKB 3ZBHA 1KTVA 1JJ2A 3ASQA 1FJGB 4JI5Q 1TXYA 2A6HC 3SLNA 1HHVA 3JU4A 3TN2A 1EZJA 2ZXPA 4LF6O 4LC0A 3A54A 1GUNA 3BVMA 1F4NA 4A3LH 3SEJA 1JB7A 4ZI7A 2JGDB 4C3JB 1TWGH 1PDQA 4PMBA 2VYQA 2E2JH 1RM1B 4CH5A 2O2LD 4AF6A 2BA0A 1AROP 1GKFA 4X62O 2EFGA 4IL6Z 2CTWA 2C4UA 4BAYA 1EY4A 2RHSB 3I91A 2JA5H 1QR9A 5EPLA 2Y4UA 4YCWA 3JSLA 4GLVB 1STNA 4K1XA 4C2MB 2ZXOA 1NMFA 2VL6A 2VUMG 2UXNA 2CRVA 4R1JA 4U3FH 2OQKA 4JPBW 1S3OA 4ZGNB 1WVLA 3U6BA 1KC8D 2DYRB 4IPCA 4X6AH 3APOA 2E5LQ 4FM1A 2J0TD 4L5TA 4BBRB 2M9VA 1D5AA 3AVWA 4RCNA 5LGTA 4G1VA 4GOPA 1O7IA 4WORA 2X6GA 5LMNW 3SLDA 5M3FH 2QE7G 3F7VC 1BUVT 4RAIA 1F2LA 4II2A 2RDFA 2F4VL 3PF5A 4B3TL 2XSCA 4I9QA 4QMGA 2K5HA 5FO0A 1K73D 4JG2A 3ABMC 4LFBQ 4YY3L 2R6HA 4X8AA 4UCOA 4O2AB 4H13C 1TS3A 2ADQB 1US6A 1KDCA 2DQ3A 3PUXA 3B4SA 3EJIA 3J81c 3IFXA 4DNTB 3H0GG 1I4GA 1DD2A 1BQEA 4DF7A 1I50H 1K7DA 2BN4A 5B66Z 4C1NI 1PHJA 4LF8Q 1VQPV 2DQ0A 3IFDA 4WF9V 1DTOA 2F4VO 2IW3A 4B3TO 1E1OA 3CCVV 2BM1A 4CBVA 5KAIZ 1VF7A 1RCVD 3QJYA 2HHHQ 3SJCC 5JOBA 1YX2A 1IBKQ 3S1QB 1JE5A 4YY3O 1YEWA 1IL2A 3RYHA 2UXDL 1V0EA 3SXHA 4MVUA 1C8CA 4OP7A 1EFUA 4ALPA 2FJ2A 1KJZA 2NVTH 1LUWA 3ABUA 2WSSA 4TV8B 5B1NA 3FKSA 3JQQA 5CA0A 3ZRXA 1SROA 2DNCA 4P9PA 5LXTA 1GXDC 3CJHA 1PTOH 5FKAC 1LYLA 2A68D 5KLVH 4DR7B 4RA8A 2ILMA 1YITB 2ZNIA 4HCSA 2D0OA 1Q86W 4C7UA 3T16A 4XDLA 2M6YA 4YCUA 1G1XB 1GN3A 2ASBA 2BDOA 5IYBO 3OFNA 2NNUA 5J9PC 2A9HA 1G51A 2VUMH 3DEOA 4E6IA 2DWEC 3BZDB 4LUZA 5KHIA 2F43A 3AFPA 1HR0L 2UXDO 1O7LA 3GQBA 1AJNA 2KA7A 2XAGA 4H44B 3E22B 2HDLA 1YI2A 1BBUA 1XMOB 4ASUA 5IY5B 3D6CA 4DV6Q 5LA6A 3L3OC 4X66L 4FF3A 1KK0A 4LNQA 1KBHA 4EQNA 3VOUA 2QGGA 4X07A 1QNMA 2ZZEA 1SQFA 3I3CA 1SYBA 4MVZA 1PH8A 3SJZA 2D2CB 3JCUZ 4ZCLA 1D7QA 1U4PA 3QO7A 4KKTA 1TU2B 2GPJA 2JRIA 1YJNB 2PYKA 4OXSA 3AVXA 1LNQA 4X64B 2GK6A 4ZCIA 2B2YA 5GONA 2QWOB 4I4TA 2G5DA 1C7YA 3JALB 1CFMA 2P5ZX 3HFZB 1HR0O 1AI5A 1VQBA 4QIWB 1TIID 1SKVA 3G80A 4E2LA 3H0GH 3A1PA 2OCCB 3ZBUA 3H3VH 5FO7B 2Z9HA 3SDLA 3G6JB 2FHTA 2YIAA 4X66O 1GH6A 1MJEA 4YIOA 1NCVA 2NVQB 3R6KA 4IIJB 3EN2A 1N32B 4KD4A 4UCUA 3NBIA 4R4IA 4KUMA 3RZDB 3ZMZA 2UUBQ 4LH7A 3JSNA 4UCSA 4UZUA 4RGNA 2C78A 4JI4B 1JB9A 5FLXc 4GQNA 4C3JG 1VQ4A 2F3WA 5LMUQ 1YZBA 4DR2Q 4O4LB 1R6NA 4DV0L 1WP7A 4RD6A 4Y7CA 1YIJA 2Y69B 1LV9A 2CH7B 3CCMB 1LTTD 1YJ9B 1EQQA 3OD4A 4ZUJA 2PE3A 5AJ3Q 1VF5B 4WZTA 4GT1A 1WP8A 4K3AA 3H9NA 2CE4A 1PLFA 1OXSC 4HIKA 3ZIAG 3NP8A 1G7TA 4FO2A 3B2EE 3BY2A 4EB6B 1YTFD 1I94L 4FMTA 3AVYA 1R73A 4KHPL 4FK5C 3C3LA 1X9NA 2NB0A 3KJOA 1FDRA 1PYWD 1J8IA 3AK2A 1NBWA 3U11A 1NS1A 1LT4D 4BBRG 1NDHA 1AMOA 1K8AW 1PPJH 1K34A 5C3WA 3B6YA 1H42A 1G6PA 4DV0O 3S16H 2H3OA 1S5JA 3KBGA 4K5VA 4XKWA 3D4DA 2X6LA 2O4XA 1K5SA 5C6AA 2HMAA 2X6CA 5ELFA 5CDFA 5DEHA 1VQKA 4XKVA 2LO1A 2OXPA 4O0AA 1OV9A 4W4KA 1UE5A 1I94O 1YF2A 4KHPO 4YWLA 1FS0G 1L1FA 1TVCA 1Y1WG 4UAJA 3HKCB 4HIZA 4ID6A 2E2IH 1W2BU 3PUYA 3S15H 1Z5WA 5LL6S 1VQHA 1N0NA 1DONA 1B2TA 1NH2D 1J5EQ 4WJWA 4J41A 1IL8A 1H2LA 4ZKIA 2Y48A 3AMUA 4H33A 4D7TA 3VA5A 3UQ8A 5JJIA 4BY7B 4EX5A 1RHPA 4DUYQ 1A15A 3RN2A 3JAMc 2AHZA 1FFXB 3Q0AA 3AQQA 1JQYD 1FYCA 5GQOA 2ZXRA 4GUNA 2GHYA 3VO2A 5EKIA 4DK6C 1XILA 1FNMA 5A2QE 3MMPA 4NXML 3AB9A 3Q38A 3G6EA 4GLXA 2F1LA 2B7CA 2OBRA 3CHBD 5CA3A 2O57A 4GKKL 1P8LA 4C3JH 4QUZA 4OXPA 1HNXQ 3CMEV 1SJED 2ODMA 1M1KC 3J7A5 3ZS8C 2FX3A 4HZ3A 4P2NA 2ZE7A 2B5OA 1TWFB 1WORA 3K06A 3BY1A 1PH1A 2XNCA 5IJ9A 1EQVA 2NR5A 1XUQA 1JVMA 5E7NA 3UDXA 4JYAQ 2XAQA 5KEEA 3MD0A 1I8DA 2XN9C 3OEEG 4PZ7A 3JYCA 1E1TA 4B3ML 2QF7A 4C2MH 2EX3A 4HMIA 2QA4V 4YELA 1OO9B 4NXNB 4ZIBA 3DC5A 5IE9A 1HWYA 5DN6G 5CBGA 4CS2A 2Z6BD 1HQMC 2VQEL 3FAVA 3VQYA 4NXMO 3PUWA 3IJ4A 4X89A 4GKJL 4BBRH 1QUFA 2Z4HA 2B2WC 5FK9C 4JI0Q 1LTAD 3W7UA 4GKKO 5ITZA 1NJIW 1VMGA 1OCOB 1EFRG 1OCRB 1MSWD 1A32A 2PNRC 1BT8A 4JYYA 1VQEA 3SE0A 1H9KA 4AI8A 1ENAA 3RLOA 1TWHB 5IT9N 4A3BB 1P7BA 3O65A 1EFTA 3JATB 1NJID 4DV2L 5CA1A 2LQTA 3N2GB 1OB5A 1XBLA 1VQNA 4TQDA 3NR7A 3GWKC 3WOFA 2VBVA 3EQLC 4B3MO 1AW7A 1ICWA 2B2VC 1HTLD 4QVJA 2D74A 2DJGC 3HKZE 2EPBA 3OTOL 5J35A 2Q68A 1Y1WH 4KY7A 2VQEO 3CC4V 5CV4A 1XX8A 4L87A 1QH0A 2WAQE 1KUQA 3G7LA 3PV0A 3H15A 2GTAA 4GKJO 3G71A 3D31A 3E8FA 2NTSA 4NTYA 3CC4B 4JW0A 2VWKA 5EKLA 4LF7Q 3CCEV 3R93A 4PMWA 3TP8A 3OZUA 1YVWA 1QZHA 3K6OA 1K4CC 4R71A 1OCZB 2CFMA 3CC7V 3CCEB 3HZXA 4DV2O 4LWCA 1QBZA 1RTOA 1YNNC 5FPRA 4Q6GA 4GNXA 2GVAA 4DR3B 2X6YA 3KYHC 4LF5L 2EINB 2BA1A 1X6OA 3QOJA 1MJCA 1N36B 1V9PA 1PRTD 3OTOO 3R2IA 3E89A 2ATWA 2D3NA 1BSMA 3CRMA 2R6GA 5EQ0A 1AH9A 4M0LA 3CCQB 1HFNA 4FXDA 4LBYA 4Z1VA 2PQEA 1H38A 2HDNB 4PZ6A 4NKGB 5K1XA 4NKLA 1VQ7V 3U2QA 2P3MA 2SNSA 3ZEDA 2JN9A 2IL8A 5KMGA 4XYQA 4Q0FA 5LHGA 2JP1A 4I9WA 5L3CA 4X65B 4UP7A 4K0KL 1EFCA 1Q5OA 1QGAA 5C0XG 1V54C 1AJPA 2LFRA 2IJKA 4B9XA 2DCUA 4LF5O 4QE7A 4DA2A 2N8NA 2K33A 1VQOA 1QUQA 4IUTA 4DAVA 4WCEV 4XOTA 4RG1A 3PO3B 2NV4A 4Z4WA 2FMLA 4AF7A 2WV6D 2B5UA 4ZYSA 3LQEA 4HYOA 3GSIA 4MVOA 5GROA 4UFZA 2IW5A 1Y67A 3FHWA 1U9RA 2MUYA 3SPIA 2ARHA 3E8HA 1W59A 3D3QA 2Q0OC 5LP6C 3S1NB 1XE1A 3BVGA 5F4OA 4B3RB 4K0KO 4BXXG 3SYCA 1IX9A 2V31A 5B3SB 4Q7JB 1AFPA 2ZCEA 5CYUA 4GX0A 1FNCA 1JICA 1DOMA 3MHBA 4JF3A 4LF4L 4BY7G 2TMPA 1BCPD 2XAFA 3GWOA 5FNVB 3Q3AA 2F03A 2GN5A 1EZ6A 4XM3A 4HSVA 2P5OA 1OZ0A 2OCEA 4RCZA 3A56A 2B3GA 2CF4A 4I55B 2TSSA 1MG1A 2W0FC 3RZDH 4IT5A 4XDJA 4IUQA 1IJFA 5C4JH 1X3GA 1BQ0A 4C3HB 5LOVB 1R9TH 1IBLQ 1H85A 1KNEA 1CKNA 2AWOA 3LWUA 2WLKA 2IJHA 3I8ZA 4KXRA 4IO9A 3AG2B 3PUMA 3DGEA 1D2DA 2D5DA 3IC9A 3NXWA 4DV4Q 1ENCA 2JEUA 2OQ0A 2VQFQ 2Q4PA 4JC0A 2QM4A 4LF4O 3V7AA 1DK1A 4DR1L 3HOVG 1DZ1A 1NVPD 3DEPA 4OPOA 2L12A 1MSDA 3P3NA 4TKOB 3OMCA 1W87A 1JA8A 4QNHB 1IKMA 4JTCB 3DHQA 1GTOA 4ZK9B 4XQFA 1QLNA 3M7MX 4AQYQ 2WA4A 2XAHA 3QB3A 3X3MA 4J1MA 1WD1A 2RCVA 3B82A 1G2TA 4PAAA 5C0XH 2B2TC 1BLIA 3I72A 1WTRA 1Q12A 4WZEA 2ZDIA 3K7AB 4LF9B 2GSMB 1JMKC 1N34Q 1YSCA 2QILA 5JEAJ 3C90A 4A3BG 1S5DD 3K0DA 3W1BA 5J22A 2R9VA 3BAAA 4DR1O 1QFYA 3UM7A 2QKSA 2K9PA 4C56C 3GDEA 3ASOB 3KF6B 4AYBE 2CGNA 2X53S 5IDJA 3J81N 4XTCS 4RHSA 4EFBA 1WYDA 4X7CA 4RKLA 2BPOA 5AFWA 2QKCA 4I7ZB 4IURA 5CV8A 4DR4B 1EY9A 1S4MA 3WG7B 2EQSA 2JSOA 4DV3Q 1ZYRD 3LSSA 4IW3B 4BY7H 2EIKC 1FYJA 1ZLZA 2A68C 4CGYB 3DC6A 3FDTA 2OT2A 3RYHB 1XNRL 1STGA 3G4SB 3PJSK 4ICGA 1WOPA 5JPMC 3VMFA 3F5TA 2L0CA 4ME3A 1UAPA 3ULLA 5CA0B 3BYYB 3A74A 1PL4A 1SYFA 2M2LA 5JVDA 4JI2L 4PC2A 4WFBV 1H8EG 2N88A 1Q86C 4OPSA 3FVQA 4RQEA 4DRXA 2IHEA 1TWFH 1GO2A 1SESA 5JJZA 3BCDA 2EBOA 1SA0B 4WFFA 4R4QA 2OTJA 3CRLC 3HOVH 1M90D 1YI2V 4X8IA 3MEHA 4IPDA 2F0NA 1XNRO 5EAYA 4QCLA 4GOPC 2XHBA 2AWNA 1TUEB 1Q3EA 3IFTA 5LA6B 4JI8L 1VQGA 2VRZA 3PO3G 1Q90D 3PGZA 5C3XA 1SM4A 4JI2O 3EROA 2F0WA 3MEFA 2GUZB 5G3LF 1NI8A 3AG4B 4ZRZA 3N6RA 1KMIZ 5HFLA 1H9SA 3QWNA 5H2FZ 1TWHH 1D8TA 1Q46A 4A3BH 3GTJB 1NTGA 2Q7HA 4DXFA 2F0PA 2JQOA 3CMAB 3AU7A 1H8HG 4JZ2A 4QGUA 3NELA 4I4TB 2JE6I 4JI6Q 4R4TA 3R6JA 2GBOA 2QWQB 2XAJA 4FLYA 3ASOC 4OONA 4ULLA 1PA6A 4P73A 1CA6A 2BOCC 4P75A 1KLUD 3A8IA 4MZ9A 4OX9B 1E7ZA 2QJ1A 5IK2A 3ABTA 5B1BC 5IP9G 4JI8O 2HCJB 1L1OB 1IBKB 1VQ4V 3TGUH 2Q2IA 4ZOLB 5DAUA 4HBNA 1EY5A 1FXHA 1YIJV 2NZOA 3NEMA 3RT3C 2F0OA 3P26A 1A2TA 3P75A 5FLXN 2QM7A 2B7BA 1T6ZA 2QE7A 4DPGA 4RGTA 4C3HG 2I0QA 4L5QA 2N49A 3FP9A 1WTQA 1XNQQ 1XMOL 1SRUA 3APQA 2OK8A 2EOTA 5A8AA 5KA5A 4DAYA 5IWAQ 2HR3A 3UDFA 4JI3Q 4I65A 1W0JG 1Q6IA 4DV5Q 4BIOA 5JJJB 3F2UA 1ZTEA 2AW9A 3RN5A 1P4RA 3ZN0A 2G38A 2Z0AA 3JAWB 1GVHA 1KK3A 1K0SA 5ELCA 3GTMB 5IJ0B 2ZXWB 4X64L 4XQQA 1BDOA 2VNJA 3ZRWB 2K6AA 3EIVA 3ABLB 1K8AC 1UJWB 1Q8KA 4X3TA 2YTYA 3D36A 5KHKA 1M56B 3ICEA 1LT3D 4DV6B 2A69D 5EPJA 5M5YH 1DDGA 1GN6A 1XMOO 4RD2A 1VQKV 1YDXA 2HVJC 2NPFA 1GOZA 4IFDG 1FJGQ 4M1UB 2EYJA 1VDZA 2KCTA 1I7FA 4NVPA 3F2BA 3PO3H 1VQKB 5J1ZA 4AILC 5FO8B 3CC2A 2X7RB 4TMVA 4IHJA 4FIPC 2JGUA 4UCTA 4O4JA 1MZEA 2E8GA 5ELOA 1QU7A 1E3ZA 1E62A 4X64O 5EBLC 3W5HA 3UI2A 2H1EA 4DV7B 3S1NH 2YXYA 2WIIB 5DECA 1LTGD 1STAA 5F2VO 4GN4B 1BHAA 2QW7A 4O4IB 1O9HA 1K8GA 1EEID 1SNMA 4UVCA 4NTWA 2A73B 2UUBB 2H8PC 2MGSA 4RPDA 3OUSA 5IP9H 3G6EV 3JAMN 1T5XD 1PTOD 3SJAC 1II3A 5M5XB 4ZKBB 1I08A 1M57B 1WN7A 3ONUA 4JK1C 4AIMA 3VNUA 2A6EC 1D8LA 3U50C 4TSFG 2AMCB 1YNJD 5IGFA 2MO0A 2K1EA 2RDGA 2UXBL 4JI7L 1WFQA 1PH2A 1RF2D 1TY0A 3Q4HB 3EHBB 2QDBA 3DUZA 4EQOA 4XOPA 4WBNA 4QPKA 5BN5A 2V7TA 1AI6A 3ZX6A 4MN3A 4C3HH 4X1KA 1BGYH 3M7GA 5IJ9B 3AVUA 3W2IA 3DXRA 4Q5VA 5IOCA 1SYDA 1IURA 3PIPA 3LWEA 3G48A 1Y74A 1XPUA 1I4RA 5FO1A 1FR3A 4MVQA 2YWFA 2QDOA 5EC2C 3MXUA 1WLEA 4K8ZA 3Q39A 3D3RA 4I50B 3SKBA 2DWDC 4JI1B 3FAVB 1QVGU 3CP2A 1BBXC 1NJIC 4HE6A 5F2DA 1HZAA 2UXBO 4JI7O 4QJFA 4PZ8A 2QTSA 1M56C 4PA9A 4H0LB 5FL7G 1ZEQX 2R70A 4YHHL 3A0HZ 5DM63 2K04A 1R5OA 2YDEA 2BV3A 1I6VC 2EIMC 2HG5C 4OOSA 1VQNV 2KQ3A 4CDDC 3K7AH 1CP9A 4IFDH 4FM2A 1XFOA 4ACAA 2M5SA 5CC4A 3CS5A 3N2KA 4LBWA 5CA1B 3MZ5A 2WPDA 2BH8A 3U4ZA 3J80N 1W9XA 1NY4A 2AUKA 4LC1A 5E1AC 3G71V 1PKVA 3K9AA 3RYIB 3CHXA 1QHTA 3GP7A 4PC3A 1NBMG 1X55A 3ZIAA 3SDZA 4DR7Q 5GAGC 3L70H 2MP1A 1B7YB 1XQBA 4YHHO 1YLOA 1SNOA 3BFRA 3CCSB 1RIPA 3CX5F 2EXZA 1EP1B 1SNPA 1WTPA 1RODA 2K5DA 1K83B 5LL6X 1D2BA 1HNXB 4RO2A 1FNVA 2Q6OA 3VR6A 5DLQE 4CC6A 1TQOA 4FXKC 4A4IA 1BZKA 3OGCC 2ZE5A 5EBMC 3BZKA 1N06A 4A3KB 4LUOA 4MVSA 5IGGA 4KFMA 4G28B 4DO2A 4O2AA 4NNJA 3HOUB 5CGKA 5BR8B 1OB0A 2X6WA 3BQJA 2ZT9C 3STZC 1XTCD 3AG1C 3ZHQA 1SZXA 3GB7C 4OO1G 1LUZA 3M4QA 3T13A 1I5XA 2PI4A 3O13A 1VQOV 1VCIA 2GVBA 5ELBA 4BIZA 1LM0A 1PH5A 1VQOB 1QUQB 2KHJA 3HKZB 4R9WA 3ONYA 3LNNA 4MS2A 4YIJA 1ET6A 1RL2A 3U6KA 1ZM2A 4FNFA 2RCFA 4RQFA 2WAQB 3KF8A 1LTBD 1TT2A 1N32Q 4KV6A 3H6MA 1SMXA 3I4NG 5BXZA 1JNYA 3AK1A 1B53A 4B43A 4JI4Q 1BCPC 5KNLA 2YWEA 1KABA 3GTJH 1KXLA 1UNSA 4CH3A 2PIAA 2YU9B 1HVXA 1N36L 1TUIA 2VXWA 5J3BA 4ACBA 1IZ3A 1YITA 5CBHA 4GN3B 4TVAB 1F9PA 1EP3B 2Q5ZA 1W3SA 3TQYA 4LF7B 1Y0RA 1YHQB 2QCPX 4LNUB 4PDMA 1HA6A 5M3MB 1WPXA 3I1FA 3OEEA 5JJKA 4UVBA 4D7SA 2WFWA 1HZ9A 3L72H 4PHZA 2JA8B 2UXCB 1Q82W 1QCEA 5LMNL 2F4IA 4NPSA 4B3GA 5DN6A 3GTLB 4X65L 1HH2P 4DV1L 2XZPA 4MW8A 3R8BA 2PNHA 2LJ2A 1JE4A 3E22A 1VQAA 3FPPA 1ZXTA 2JJ2G 1CSPA 1NAPA 1EFRA 4GNXC 4G4KA 4MTXA 4K8XA 5J2UB 1N36O 1I0HA 1CKNB 1NSNS 3W7XA 1EU4A 4MTKA 1GKHA 1I3QB 1I6HB 2GQFA 1PJ7A 3L9AX 1V5VA 1N4CA 1OXUA 3WWVA 3SK4A 4RFBA 3SR2C 1RKNA 1YJNA 3A7LA 1RPRA 3OEHG 3I2ZA 2UUCL 2PZSA 5IYPA 3ZCCA 5LMNO 4B3RL 2E74C 3JALA 4LFCL 4DK1A 3GTMH 4X65O 3V76A 4DV1O 5DS0A 1N07A 2K03A 2IPKD 4OO1H 1Y14B 3OHXC 2VS0A 2GV9A 4QB4A 5HURA 1OXTA 2YI8A 3VQWA 2R9IA 3SYAA 3A8JA 3C3TA 4DR5B 3STBD 2JS5A 3DMUA 1N05A 2F0DA 2ZBVA 1TR5A 2E2JB 1WOCA 4NBSA 4HJ9A 2YICA 1VQ9A 1NR2A 1SRYA 1E0BA 5C0XJ 4O4LA 1HCZA 4TT3G 3T1HB 3I4NH 4XMYA 2UUCO 2CH7A 3ETGA 2UU9B 3CCMA 1ZYRC 4HEDA 2JA5B 4KK7A 3RN4A 1YJ9A 4B3RO 1OCCB 5CV7A 3LSUA 4LFCO 1ESFA 2WB1B 1PFNA 4DQLA 1VQMB 3CTAA 2OWOA 3ETQA 5AN9A 4AC9A 2CW0D 2F0SA 4EB6A 2RHQB 2QWPB 4ZQ3A 2PF4E 3CESA 3H91A 2YIBD 2F23A 4PGOA 3HOYB 1XYIA 2RBMA 1MRZA 5I4DA 4NXNQ 1YVCA 2Q8TA 3S9WA 3S17B 1UD2A 4N8FA 5M5XH 1HW7A 3TMEA 1KDBA 1DF5A 4RMFA 1MZFA 3IGAC 1UD8A 3VA7A 2YXHA 3AG3B 3H1KH 3VR5A 4O4HB 5JVDB 1KNAA 1M90C 1UFIA 4A3KG 3TJTA 4DV4B 3JCZA 2W0XA 2R93B 3P27A 1G7SA 4DRXB 1GHKA 3HOUG 3C2PA 2B1GA 2OTJV 2WLIB 1EQTA 1VHEA 2E1BA 1HUMA 3R66A 1IBMB 2Z4IA 5JWPA 3HKCA 2OCHA 3K0GA 4AQYB 3URYA 2XNDG 3HKSA 1SE8A 2PQAB 4P72A 4EFEA 3VDYA 2OYNA 5FJ8G 1GAQA 2HJFC 2IH3C 4JI5L 1IHMA 2AXTZ 3I73A 3HKZG 5E79Z 4X3KA 2YIDA 2KUMA 2Y4TA 1N34B 3TXQA 4R4OA 3WY9A 4X05A 1SMYD 2EYHA 1FFXA 1Z9FA 4YWKA 1H2GA 3I90A 1J9ZA 5KSWB 4KN7C 2E76C 2WAQG 3I4MB 2ZDIC 5KW9A 3TEHB 4MSWC 3KL9A 4N9PA 2NVTB 1A2UA 3OJWA 2KEDA 3HKEB 4DGZA 1B6QA 3BA9A 1H9SB 1LTID 5KA6A 3HAGA 2IY5B 4ABMA 1S77D 4GCZA 1WTHA 4X1IB 1CI3M 1EXMA 2Y0SE 1STYA 5L3GA 1NU1H 2A3QA 4LP8A 3ZRVA 4DR3Q 4XN3A 1FRNA 1PM9A 5IYDG 2F0UA 1DOKA 1N33L 1QQCA 4XLFA 2XIWA 1W2BA 2Z6KA 4RAUC 1U4RA 4JI5O 1EBOA 3MXNB 4DV3B 2PMZE 1E43A 3ASRA 1VQ6V 1B4OA 2VUMB 1Q43A 5M3MG 2R92G 2E5LL 3KEWA 4P2ZA 2JA8G 2A74C 1VQ6B 2JJ1G 5CV9A 3ABKC 3B8NA 3K5LA 4CDCC 3CPWB 2DJFC 3A0JA 4IGGA 2QGQA 1K83H 4A76A 1JT8A 1RJTA 3F2CA 3F5WC 2EYOA 4LFBL 1NT2B 1N33O 3M4YA 1HZCA 1RD9D 3JATA 4A3KH 2A69C 4FJCC 1Y66A 3N2GA 2G9DA 4DR6B 5F4JA 3GTGB 2L1BA 1CTMA 1RQRA 2ZJPA 3HOUH 2PPBC 2E5LO 1KZLA 2NZ1D 1CUKA 4B3SQ 2OIGA 4JBKA 4C1NK 4N23A 2WA3A 4HIDA 4LF8L 3PN1A 3L73H 4G6IA 3QTCA 3RYCB 3DXJC 2R72A 2EXDA 3QO8A 5FJ8H 5KUKA 4J9YB 4J42A 1BVSA 1SYCA 2HHHL 1XHZA 2AHOB 4ZGQB 1WPCA 3OM3B 4CJ2C 1IBKL 4IYHA 3CC2V 4LFBO 3UDGA 4X20A 3L2PA 3OWFA 2DOSA 3HP3A 2C2WA 1WCMG 3FFQA 5JJEB 3K81C 3DSQA 2PTMA 5EZYB 3SGIA 1E79A 1FD9A 4UAIA 2KG7A 1F2MA 2NN4A 1HNWB 1W35A 2FFKB 2ZXHA 4KHZA 4RCYA 2YWGA 1Y4MA 1SDFA 1THZA 2GDSA 1V55C 4OOXA 2EZOA 1PTOC 4J10A 2NZHA 1Y76B 1H8EA 2HT1A 1EUJA 3CCQA 2YU9H 4LF8O 5IYDH 3FPUB 4EQ5A 1TS5A 4K8JA 1JMCA 3RYFB 1YNND 1YNJC 3CRCA 2ZM6Q 3I55B 1XMQQ 2EIJB 4PDRA 2HHHO 3JD4A 1IBKO 1L2FA 4J0QA 1J6QA 3HOYG 1HQRD 1WTHD 1EU3A 5M3MH 1X3FA 2R92H 1PFMA 2BCCH 3BJUA 2JA8H 1QZGA 4NMZA 1M9NA 4JMQA 3GTLH 3H01A 4YHBA 4FLWA 4RHRA 3H94A 2GJRA 4DV6L 1AI4A 3RD4A 2F0LA 3P3PA 3W5VA 2HD3A 4JI3B 4DV5B 1W34A 1GHJA 5KYIA 1Y8PB 2ZR2A 2LW7A 4QE9A 2R93G 4CS3A 1VF6A 1NR4A 1MOFA 1E3PA 1TVXA 3PIO3 2JEAI 4LF9Q 1EIHA 1QVCA 2PI2A 4R6ZA 2A0LA 4XLEA 5IT9L 3E9IA 1Y74B 1O7YA 1D1NA 2I07B 1I3QH 2DERA 1I6HH 4I5SA 3AGQA 2YUAA 4KKUA 3S15B 3PUVA 3CU7A 1H8HA 3OOCA 3QSYA 2VZAA 1DF4A 4OPHA 3P20A 1ROPA 2VBTA 3SK8A 2IJ0A 1BE3H 3FB8C 5M5WB 1LT5D 4B48A 4DV6O 1A3VA 4CZZA 4JZGA 4QJFB 1L0NH 4AYBG 3D36C 4QPJA 3H3VC 4TMXA 5FNVA 2AUJD 2UUBL 4DR4Q 3MFYA 3I4MG 4WZKA 4U9UA 3QO2A 4P30A 2KQXA 4ROXA 2K5NA 5LMUL 4KJOA 5F4MA 4I55A 3S3XA 4DR2L 4P74A 3N2KB 2DE0X 4WQMA 1S72A 3ITPA 1HZBA 3CXCB 4GZRB 1E2WA 4BBSB 3E5SA 2EILC 5LOVA 5AJ3L 4UB8Z 1VMPA 4MIUA 3R2TA 4IFDJ 4X7FA 1QVFU 1W0JA 2DMXA 1SYGA 3MWYW 2ZL7A 3GTQB 1QILA 1MABG 1AP0A 4JV5Q 4LUVA 4TV9A 4CS4A 4XL9A 2F4VB 4B3TB 2PCFB 1WTVA 1TUBA 1NKDA 2MHVA 3G67A 2UUBO 2DIEA 2QEXB 3JQPA 1EYDA 2AKWB 4BA2I 2Q0AA 2RN9A 2KJXA 5LMUO 2JN4A 4IUVA 2XOKG 1LABA 4DR2O 1KMHA 2H5XA 4XR6A 3HOYH 5JEAH 4X1YB 1CQXA 1YNXA 2SOBA 1VJSA 1C9OA 3RLFA 2VWJA 2C77A 4DXGA 4KKSA 3S17H 2EIFA 5LMZA 4UZEA 3HPLC 4JYBA 3HOXB 1L8DA 1A0IA 1JFFB 3ZHRA 2VJJA 4FN5A 4FLZA 2F0MA 2NLJC 1XXGA 3Q6QA 5D5PA 3PF4A 5CR3A 5B6IA 3KCYA 1QVFB 2R93H 2YXLA 4G7HC 2RMKB 3ZMTA 2O5IC 2EY1A 4DUZQ 1KK2A 1LACA 3D6WA 1Y1WB 3KF6A 2ENBA 2UXDB 1YHBA 3CYOA 5D14A 1J5EL 2WLLB 5IYCG 4RDKA 1PMRA 1PV4A 1NVPB 3VR3A 4IQZA 3FB5C 2KKWA 1GRJA 2DY8A 1VARA 1GVPA 2HLDG 1WI5A 4BWAA 3RBZA 4DUYL 3E6ZX 2BVNA 1B8AA 4OX9Q 2NN6G 4QL5A 1KRTA 2R7ZB 1FXKC 2RNBA 1SBBB 3W5UA 3F1ZA 3ULJA 1F20A 2Q73A 3KF8B 2YWHA 1IHZA 1OGJA 4CHTB 4DN4M 1VHOA 3EFFK 4P6VF 3I4MH 1GUGA 2EZVA 2I5MX 3BS1A 3GVMA 2PUSA 1K33A 3OZWA 1I5FA 3G4SA 4TSFA 4DW1A 1HNXL 1KK1A 1Y0YA 3L74H 3MA2B 4P3IA 4XORA 3ULPA 5HGQA 1K5QA 1YITV 1RM1C 1HR0B 1TS2A 4J6HA 1J5EO 2K01A 3TZUA 2ZZFA 4JYAL 1XTDA 3W7TA 3A8KE 2B63B 1PFSA 3D8GA 1UEAB 4X66B 4DUYO 5GV8A 2OTLV 4PI0A 4HAMA 1Q82C 3LSQA 1SA0A 4MHEA 1XWEA 4KTAA 4OO1I 1SEBD 5LHHA 1U4MA 1I4PA 1R5NA 2OTLB 1OGIA 4IPHA 5DM73 2DYRC 3TS2A 3HOWB 4NW2A 4IN3A 1Q86D 1A8PA 4JI0L 3T1YQ 3HKDB 1YBYA 4DW0A 2L5TA 1BJKA 1HNXO 3UO3A 4PMCA 5FL7A 2VNKA 1I18A 1M4UA 4L5SA 1PZID 2GUZA 4JYAO 5TSSA 4FYDA 1YJNV 2WZPP 5KNDA 4JAAA 2VZLA 4TQFA 2P67A 1GUWA 1QLEB 2LP7A 4F6RB 1SAPA 3CMAA 3CKIB 1XL6A 1QNKA 1NUCA 1L0WA 4K5XA 4HTHA 3GTGH 3STBC 3BCFA 5E4WC 2LMCB 3CAMA 2FYUH 4FZ0A 2ICIA 3J81L 4JI0O 4DV0B 1G91A 4DV7Q 3K5NA 2EY6A 1MSGA 5HZBA 5IYCH 3BNWA 1NBMA 2YS8A 3OMIB 4S3SA 1UE1A 1EOTA 4LF7L 1CZWA 1L1OA 1VQ9V 2IX3A 1I7PA 4ZOLA 2NN6H 3U0ZA 1S76D 1GO3E 4LFAQ 5C4HA 3CPXA 1VQ9B 5C4JB 3CCMV 4KHPB 1Y1VB 4HNAB 1YJ9V 2CW0C 1R9TB 1IXBA 2IT1A 1PRTF 3UT5A 4BBSG 3NE5B 4MTNA 5B1AB 1BR9A 1B1ZA 1QJOA 3A0BZ 4P26A 4X7EA 2UUAQ 1QR8A 4U3JB 1ZM9A 2JK8A 1FNUA 4K2KA 3AVVA 4ZCKA 3PIP3 1IYUA 2CBXA 4ODGA 4X3UA 2RQ6A 2BGIA 2XEXA 2D9UA 1JOYA 3F8TA 3S2DB 4BS9A 4N21A 4LF7O 3JAWA 3FEWX 2BTQA 2ES2A 2DYIA 2CVRA 3W2DA 5IJ0A 5I6WA 3ML0A 4PG3A 3ZRWA 3KCXA 1AEXA 2FL4A 4YJ2B 4FK8A 2J7ZA 4JCVE 5JH7B 3J81k 4WFN3 4UHVA 4IALA 1LT6D 3ASSA 3QNEA 4JI1Q 2HVKC 1FGUA 4H44C 3HOXG 5ELNA 3QIAA 5L3EA 3ND9A 1JCKB 5IY5C 2FKXA 3MFGA 2C9OA 5HGTA 1E3XA 3GV6A 2OBSA 2JDIG 1K8AD 1SSOA 4CDFC 2QTOA 1E2ZA 1IKLA 4JPRA 3JD1A 2NBFA 2YTVA 3JD2A 4OGQB 2LGQA 3WQZA 5IYBG 2SDFA 4NCNA 2YEVB 2D2CC 4QF4A 3ZHSA 2BGJA 1Z7TA 1SMYC 1H95A 4HE5A 2PZTA 2JA6B 4KY5A 4XLHA 4Z4VA 3SK6A 5M9OA 2LFSA 1BL8A 2QN6A 2WR8A 4XDXA 2XZLA 5BSXA 4CKBA 1BCPF 4O4IA 4D6TH 2K1BA 2KENA 4EKWA 1QGYA 1K97A 3H09A 2R7ZG 5M5WH 4JOIA 3A7AB 4MVMA 2OCCC 1XPOA 1U97A 3SVMA 4PQXA 2CQOA 3CCRB 2V7QG 4B3MB 4PELA 5BN3A 4O42A 3ND8A 5FLXL 1KQSU 1IVSA 4P2CB 1WOSA 1LTLA 1IBLL 3Q4HA 2JJ2A 1F2YA 5IGBA 4N9TA 2Y69C 3MXPA 4BBSH 4K35A 3N27A 1MNGA 5LHY1 2F66C 1WB7A 1T6YA 1IW7D 2X0LA 4P9OA 2K7VA 2VS1A 3EBEA 4DV4L 2B63G 3LQ6A 1W2BB 1G8MA 1VLYA 1VF5C 2VQFL 1KU9A 1UD4A 1K9MW 2A6ED 4KY6A 3K79A 4QUCA 1LTRD 1K3EA 3OT7A 2L35A 3GTQH 2RJZA 4YJ3A 3HB3B 3HOVB 1XB2A 3OEHA 1X3EA 5HY6A 5BR8Q 2X8KA 3TBIB 3KG2A 4DV2B 4AQYL 2EDGA 3HOWG 1BHBA 1K9MD 4IPGA 4I50A 1GAWA 4P22A 5IYZB 1AR5A 1JA0A 5EPKA 3SPJA 2ZJRA 4TN1A 1S40A 1UUPA 2J7KA 5IE8A 1PNKA 1S5FD 4X06A 2MNAA 2ZL6A 3A55A 2F3VA 1IBLO 4TQUS 5KGUA 3OTOB 2VBSA 3MVVA 1T5EA 1N34L 2X3UA 1Q81W 4FXUA 2DGYA 3HOXH 1JPXA 2IM9A 4DV4O 5HFMA 2VQFO 2RSNA 3UDIA 3S1MB 3U58A 2Q8IB 1S5BD 2F0HA 2P6JA 5D3DA 4TT3A 1TS4A 3KZIZ 2RC6A 1Q81D 2K52A 3C1EA 4EH1A 2BDNA 1A63A 2I1LA 2C35B 1JWSD 1COWG 1SLJA 5L3FA 3TRZA 4AQYO 3FYIB 3RYIA 2QDLA 5IGDA 1X59A 2OK7A 3NHHA 4LF5B 3J81i 4UY8C 2Q2HA 3SPHA 1JQ0A 1DOLA 4F87A 3S2HB 4B08A 1RQPA 1QG7A 2DEUA 1QVGA 3THOA 2B8GA 4DV3L 4PA6A 5J2TB 1N34O 5IT9c 3ASNB 3CCSA 3F7YC 3M99B 4X20B 4JAVA 1HNZQ 4XLCA 2R7ZH 2BF4A 3OMAB 3JAML 4A3MB 1E2VA 4BW5A 3QFSA 3U10A 1EZ8A 3M3YH 2UXCQ 1C48A 1Y1VG 2EE1A 2JYOA 3BCCH 2XRQD 5C3EB 5DSZA 3OP1A 4OOVA 2YYZA 2KG7B 1R3KC 4K0KB 1VQ5B 5LYJB 3OZVA 4DXWA 2XGJA 3CCQV 5CBEE 3NQIA 3CWBH 2L11A 3CE2A 3ASPA 1A62A 3BDLA 1M5IA 2Q8RE 4TRDA 1SQPH 4I0XB 5CBFA 3MXGA 1EY8A 2PLFA 4YAFA 5D3IB 3EXAA 4OEMB 2QSAA 2IJJA 4UV9A 1EWCA 3D3IA 1KLGD 2EYLA 2RF4A 1VQ8B 1BPLA 4KL1A 5JBQA 3MC0B 5LL6Y 2Z6KC 4DV3O 1NTKH 2B63H 4POFA 2CH4A 3VQXA 4F8MA 3FD9A 4MYUA 4A3IG 3LDEA 4LH6A 3DM1A 5DEDA 2XNDA 1GUTA 3L0OA 4WFHA 4NP5A 5M5YB 3OW7A 3MTSA 5C5LA 5JQGB 1QFJA 3HOWH 3MAQA 5IYWA 1EOVA 4FF1A 4RUFA 2K14A 4A93B 2Q6IA 3K03A 2CTRA 3KLSA 1OCOC 5E1FA 1AP6A 1OCRC 3TS0A 2EZPA 5THXA 3J7AU 5T1GA 4WJ3M 4GLAC 4DR5Q 4RWUA 3OR7C 1T9HA 2X69A 5IP7G 4K6DA 1SKQA 3ZYYX 3OYYA 3OW2U 3PMFA 1HFGA 1PH4A 4B3SB 3HS0C 4L6TB 4G27B 4JI6L 5JJNB 1FAFA 4X7DA 3J80L 2Z3YA 2JA6G 4QVAA 3T1HQ 1HP8A 5A2QN 3E0EA 1K8MA 2UU9Q 4A3JB 2PZWA 1WDTA 2IBZH 1RPOA 2XT9A 3W2FA 3OUFA 1S4ZA 1EFWA 3T56B 1YHQA 4LNUA 4RDJA 2PO4A 4NYKA 2Q8VA 5EYPB 3ABMB 3QFRA 1VQDA 1MHWC 1GMGA 4BR6A 1EWHA 4GN5A 2K28A 2WLHA 4H13B 2F4NA 2KVOA 1S72V 4QHYA 1B23P 5H5NA 2JJ1A 3NSWA 4DR1B 1H2SB 2FMMA 4CKCA 4P3YA 1S72B 2QM8A 2A5HA 4TWKA 1XNQL 1OCZC 1RDPD 2LZJA 1PFBA 2ID0A 4JI6O 1Y1VH 1WJZA 1AJQA 4A3EG 5IWAL 3JAKA 2KOLA 2EINC 4UUJC 3AVTA 4JI3L 5J2UA 4DV5L 4P9SA 1DGSA 3SJPA 1HTPA 3WU2Z 3W2EA 5IYRA 1PV0A 2RCNA 2ZM6B 1MKHA 4G2KA 1F60A 1XMQB 3VBBA 4LJZC 3VYTA 1V43A 2WLMA 4TMTA 4XBFA 4TV9B 3NK9A 2M7WA 4XNFA 2MFIA 4JASA 1TUBB 3SR1A 4F7XA 1KKDA 3KUPA 5E6TA 3VYSA 3S2DH 3S24A 3LX0A 4U7OA 2CH4W 1IBMQ 2QKIC 4A3IH 3CRQA 2Q67A 1SFOB 4POGA 4UXNA 1XNQO 3PENA 5TISZ 3V2TA 2C5BA 5EMNA 1XPRA 2Q2UA 1FJGL 5IWAO 3P30A 1CEZA 1KC8W 4JI3O 4DV5O 4QY7A 5KYLA 3K08A 1YEZA 1L0YB 3FPKA 1N33Q 1KAAA 1N08A 3WOEA 1TWCB 2HIXA 3NXSA 3V96A 1VQIA 1VF6C 4FWTA 1EFID 3KDFB 3QG5A 3PIOA 1V1PB 1GN4A 1TKWB 3KLRA 4DFAA 1AVMA 5L46A 4GX2A 5IP7H 4YCVA 1DXMA 3VR4A 1XNRB 1UE7A 1X65A 1AN8A 4OWWB 3AEVA 4A3FB 1PYSB 5C44B 4TMZA 1K73W 2B2UA 1GM9A 1BOSA 2JA6H 3I70A 4HAEA 1MBYA 1VQMA 4BXXH 1YXBA 2Z5UA 5B3SC 2Y0SG 4DAPA 2JVDA 1TAEA 3M4OB 1C0AA 3T1CA 1FJGO 1PZJD 4JI2B 5DM6V 1PTOF 4XT3B 1HXYD 1GD7A 1ORQC 2UXXA 3G4SV 4YXWG 4FPPA 3AYHB 1P84F 1RSOA 4A3MG 4XONA 4Z1MG 3NUCA 2C5CA 3JAMi 3TP6A 4JGSA 2MPMA 3T51B 5C3EG 4OIKA 3T4AC 1EYGA 4V190 3W7WA 2HUGA 4LBEC 1DM0B 2E3CA 4LWSB 3GVJA 3ISXA 2ZZGA 2P06A 3LUTB 4OHJA 4A3GB 4WFAV 4O4HA 4JV5B 4A3EH 2NVXB 1N0UA 1PNLA 3ERQA 1PH3A 3MCAA 2ICEC 2BSKB 3JARB 4IUNA 4JI8B 1YJWA 1G6UA 2WLIA 2QR4A 1QX4A 3AG2C 5CMUA 4H9GA 5KAFZ 1OXVA 2F3IA 3U9SA 5NUCA 2K5QA 1EM1A 5CB4B 5LHIA 1VQPB 1SNQA 4DR6Q 4B9WA 1SJHD 3CCVB 2PQAA 5C8YA 1SQVH 1PD3A 3NBHB 3U9OA 2F0GA 3KOJA 4Z4TA 1RP3B 3CRAA 2V7VA 2K32A 4TUYB 4TSSA 5HKKA 4A93G 1PL0A 2NN6I 2ZTEA 4M2LA 3HOZB 3E9HA 3NQTA 4XDKA 5H59A 1V0FA 4FZ1A 3I7FA 2FB5A 3Q22A 3CCUV 3NWTA 1ZM3A 1VQCA 4IYIA 3CMAV 4C0SA 3BA8A 1FPOA 2WKDA 1B44D 3HKEA 4DUZB 5KX5B 1B04A 4RCOA 4PA4A 3CCUB 1PH6A 1G2SA 5GTHZ 4X1IA 3S1MH 2WJYA 2LXJA 1U0LA 1X54A 1FNBA 4Z2WA 3J80i 4F4LA 1HNWQ 1GM5A 2IH1C 1SE3A 3C3SA 4A3JG 2B8FA 1ML0D 1GJXA 4RGOS 2WKCA 1NRKA 4DR7L 2L9HA 3DTUB 2KVMA 1STEA 4DQKA 1MABA 4PD4F 1B50A 3MXNA 1GM8A 2QWRB 1D6EC 4P71A 1PZKD 4DK0A 3S2HH 4I7ZC 5C5MA 1OHHG 2VJIA 3T2MA 3WG7C 2L15A 4LF6Q 1VQ6A 2XOKA 1WA8B 1XOUA 4A3MH 3CPWA 1ZAUA 3RGBA 1DYQA 3GTOB 3UT5B 5JCOA 4TMWA 5JVH3 2WAMA 1I4HA 4G7XA 5C3EH 3Q24A 1EYCA 3BYTB 4X62Q 2ZBUA 3LVBA 2MK3A 3LDDA 1VLOA 2JA7B 4G7ZC 4GS3A 5H6RA 2H94A 4EGVA 4QUFA 5IT9E 4DR7O 3K5MA 3SPGA 1DG1G 5K1PA 5I6YA 5LGNA 1CQFA 1B9MA 4PDVA 5JVG3 2BTQB 4OL7A 3CCJA 3OWEB 3T1YB 1F2ZA 1BO0A 3VYUA 1E22A 2GTSA 2WJVA 2WPDG 4J7ZA 3QE2A 1WAZA 4NDXA 4MYTA 3RYCA 1AZQA 2HLDA 2ZKOA 3H1HH 4FFBA 3J7AF 3WFVA 2Z6BA 5IGCA 3A5UA 2YV5A 2DY7A 2AHOA 1N0JA 2D62A 4A93H 1N32L 2YC0A 2PMDA 1NR7A 4L8JA 1Z2GA 4JI4L 3RZOB 3I4NB 2PW5A 3BRCA 4A75A 5I9OA 3RWRD 5EZYA 3Q23A 3AG4C 1SR3A 1U2RA 1SS3A 4RD0A 1GR1A 2JIZG 3QF7A 4JTAB 2NTTA 2PGGA 1SERA 2F0TA 4A3FG 4UVAA 2DOGA 4L63B 3AFQA 3D4WA 5C44G 3CD6A 2LS01 2B2YC 1Y76A 1R3IC 1HA3A 1SYEA 3I4LA 2UXBB 4JI7B 3L9DA 2AZ0A 2B29A 3OMGA 3B40A 5TV2A 3RYFA 4A3JH 4Y7NB 3TK1A 2J4XA 1ILPA 1SQBH 3I55A 4E4EA 4LFAB 2XTIA 2QEJC 2F4VQ 3ZC3A 4B3TQ 2WWWA 2FTKA 1N32O 1L1OC 5C4ZA 1IW7C 1VS0A 1TVKB 1ZUNB 4YY3Q 1Y8OB 4JI4O 1CNFA 1AIPA 4PA7A 4HSPA 2H4OA 2Q6KA 2UUAB 2PYLA 3BVOA 4KN4C 3JD3A 5EBDA 1GUSA 4A3GG 2ZITA 2CQAA 3FRPB 1M93A 4P6YA 3S1RH 4MNOA 1K9MC 2CNDA 3H1IH 1JOKA 2WZNA 1HJPA 4MW3A 4YHHB 1ZX3A 3SPCA 4YJ3B 4O2BB 1LO5D 1WP6A 4AVZA 2LGWA 3PQIA 1G6ZA 3IC7A 4HIOA 3K0YA 2ZXWC 2I46A 4APVA 3ETDA 2DN8A 2UXDQ 1PJ6A 3E8BA 3P7JA 2P4VA 3ABLC 3EA6A 1SC5B 4UB6Z 1ICFB 1J95A 1H9RA 2V4DA 2V7XA 3CPFA 1SFOH 3HOZG 1B70B 2A79B 1Q81C 4XXEA 1G4YB 1FFTB 2CK3G 2F95B 3NENA 3V05A 3L71H 1R1BA 1E24A 2LFNA 5LGUA 3CMEB 3RFRA 1CQVA 1Q9SA 1WTXA 2A8VA 5EKKA 5I2YA 2B1IA 3ZMVA 3NTKA 2ZTNA 3JASB 2Q2TA 1GN2A 1TWCH 3E20A 3AGPA 3GVKA 3CXCA 4M8AA 1MD2D 3TDQA 3Q6SA 1GM7A 5KUMA 1V54B 2M00A 1HA5A 3S14B 2MJ8A 2W6JG 2QA4B 1ELOA 3GV3A 2ZZQA 1HR0Q 2E2DC 4A3FH 5BN4A 2A06H 3AEIA 2L4NA 5C44H 3CCSV 1CSQA 1UE6A 3MHHC 4KHVA 1QVGB 1F77A 4OPAA 3G6BA 4I7AA 4CDEC 5GTIZ 1AI7A 3WXMA 3EVQA 4X66Q 1NMGA 2XWBB 2QEXA 2VB3X 2RC5A 1N9WA 3M4OH 3ZZTA 4JOIC 4NXNL 2HIVA 2F93B 4YAUA 5LP6B 2CC2A 3J80c 2Q6LA 4X1YA 2V1CC 1M57C 4IUPA 1S5LZ 2GJKA 1XREA 1EL0A 5EBWC 2SNMA 3LNMB 1FNDA 1JFFA 4HJAA 1QB5D 2JA7G 3BG3A 1IYVA 4NR1A 1BQZA 4NB3A 4XN0A 3K57A 2KECA 2JDIA 2DNEA 4A3GH 2GJPA 1GK9A 3O9OA 1QVFA 3TP5A 2NVXH 1KTKA 1VP7A 3BC9A 3RUZA 3QFCA 2N74A 3NTHA 1ASYA 4NXNO 1FL0A 3J81E 1N0VC 4ZCMA 5IODA 2WLLA 4PDLA 3S1QH 3JQRA 3K8AA 3WNCA 3L75H 4B44A 1FXVA 2D3OW 3ZZ0A 2XZOA 1PP9H 1Q8IA 3SJQC 3CC7B 4DV0Q 2F0EA 3FMCA 3HRZC 2OT5A 2Z8LA 5L37A 4J8QA 3FKIB 4RM0A 4UCVA 4H0LC 3HOZH 1SNDA 4N3GA 1SZTA 3SYOA 1AILA 5EIBC 4QIWF 3RMHA 4WJ4A 1WSVA 5GADC 1CA5A 1B3QA 2V7QA 2RSOA 1V1QA 4JVZA 4UDUC 3CQZB 4Q20A 4QV2A 1I94Q 2K4KA 5HXBA 1ZWIC 5LMNB 4KHPQ 3SYPA 4DR3L 1KAWA 2ZTGA 3HKBA 2NWGA 1BMFG 1P4MA 4DV1B 2N05A 1VQ7B 3H9VA 1SKYB 2F1MA 1JJ2U 1QUEA 1YHQV 1I4QA 4ZAIA 2R7DA 5CBAE 3ER0A 1DDIA 1GAXA 1O80A 4A3DB 1IZ6A 1C4QA 3HEJA 4C43A 2ZTCA 4FDBA 5BY1A 1TWAB 1ZL8B 2RDHA 1HNZB 2R92B 1LUVA 3G05A 4PV1B 1S0UA 2WYRA 1KRHA 5A35A 2OTLA 3HKDA 2UUCB 3UO2A 1NE3A 2F0VA 1PH9A 1JORA 3CCLA 2KHIA 5GAEC 4DR3O 4LFCB 2AGAA 5B1OA 1Q7YW 1Q82D 1B2RA 2XWJB 2YSUB 3JAKB 3HG9A 3GTOH 1V1OA 1K3BC 4ABNA 3I56A 1D5MC 1KL9A 1EQRA 2RKSA 1GO3F 5EBCA 3KLWA 1TLLA 2ATKC 1JJ2B 4LK1C 2JA7H 3ES9A 4K6LA 2ITCC 1AR4A 4LAAA 4QGPA 2EIKB 1F7YA 1Q7YD 4KD3A 4F6RA 2JK5C 4B3SL 4WFGA 1DJRD 2NVQH 1VQJA 1MSHA 4CH4A 4ZI7B 1COWA 1SQGA 3LGJA 2WB1E 4G7OC 3WNDA 3CRRA 4NXMQ 1CT1D 4GKKQ 3ERSX 1KC8C 5I9PA 1W0KG 1SF9A 4HCEA 3PA1A 3T4ZA 2CW5A 4YWMA 2E2HB 4RD4A 3CEIA 1UD3A 3R65A 2EYFA 2OEOA 2X6XA 1WPBA 1JJOA 5A89A 1WCMB 2DUDA 1UMKA 3W2HA 1DARA 2BOBC 5IYQA 1Q90A 5FLXE 4HNAA 5BMVA 4H02A 3TZDA 3B77A 4IOAA 3RZOH 4B3SO 2K50A 4B3MQ 1O9GA 3H1JH 4NB5A 1S5ED 1PNMA 1VQMV 3E83A 1K73C 1EWIA 4GOPB 3KKYA 4U3JA 5IYNA 2IJIA 1K28A 2VQEQ 3LDCA 1SN8A 4G57A 1P16A 1HR0W 4YIPA 2ZM6L 4GKJQ 1XMQL 1CK1A 4K2LA 4J9ZB 5L3BA 3QVNA 2NYZD 1D2EA 4G5GA 4EEQA 2HCCA 3K3WA 4Y7NH 1WOOA 1WNSA 5FNZA 4BPRA 4EVOA 4KLKA 1RSOB 1K92A 3CXHF 3BH4A 4RWSC 2RDCA 4PV1C 2IU0A 4YJ2A 1LLRD 1R4QB 4KI0A 2ZIMA 1CHQD 5JH7A 4DV2Q 2DW4A 1KECA 2K5WA 3BDOA 5CN0A 1AB3A 3Q8DA 2CGOA 2C4TA 3RVYA 3B8HA 5DNFA 2AQ2B 1XDCA 1YJWV 4J11A 3OTOQ 5B1BB 3K04A 4LF9L 4JI5B 1R3LC 2XNAC 1JR9A 2ZM6O 3OAAG 5BSYA 1YJWB 1XMQO 4RKBA 3C1FA 2ZINA 2XTAA 1XHXA 3ZBTA 2R9AA 1KP2A 4GZYC 2YEVA 5IIFA 1GJRA 4C3IB 1QOHA 2ZTDA 4UP9A 1E1RG 3MDSA 2W6IG 1TA8A 3OSOA 1NNXA 1YTFB 3J81j 1PH7A 4ME5A 5C8YB 3F2DA 4PC6A 4FLUA 1W6JA 3I4OA 2B39A 4RLZA 3OR6C 5KHJA 1E79G 3A8IE 3ZHVA 4OELB 3CW2A 2CKZB 2IX1A 3SHLA 3TCUA 4LF5Q 3OJXA 4AYBB 1KB9F 1N8RW 5LXTB 1N33B 4DR4L 3CJHB 1CXZB 3FKIG 5ELEA 1K3RA 3BVZA 2GREA 2DY1A 1JA1A 1FVIA 1JJGA 3JAME 3K58A 1M90W 4LF9O 5D65A 5GAHC 1BQQT 3TREA 3ICXA 4IUUA 2HFEC 1CM9A 1EWYA 3CRZA 3FB6C 3CCRA 3ZZUA 2E5LB 1IYJB 2JEBI 1N8RD 1QG0A 3HR0A 1ENVA 3K0XA 1I5YA 3RY8A 4ZUIA 4ZV4A 1CNEA 2IHFA 4JAUA 2BTOA 1NR1A 4K0KQ 5J39A 3H3VI 5TRDA 3B78A 1OCCC 4JV5L 1Z47A 3S14H 4A3DG 1YI2B 2B2UC 1SXTA 3ETEA 4FVMA 1NQTA 4LFBB 4DR4O 2F0FA 1NH2B 4V0BA 5LBQA 4M1KA 4YAWA 4G1BA 4ZHQA 1E1QG 5IYZA 2ALYB 2BE5D 1QFZA 4CKEA 2JS3A 1K28D 4KP4A 1QCBD 3OE7G 3PSIA 4N8X1 2AQ3B 5GONB 4KMUC 3W3AA 1KHIA 2PI5A 1KQSA 4LF8B 1ENFA 5K36G 1P7GA 5KRUA 4RJLA 2I5HA 4PABA 3ZJYC 4JV5O 3AG3C 1X4TA 5FOBB 2P4KA 2Z0SA 3WDNA 4Z4YA 3LO8A 1Q3LA 2RVLA 2HDMA 3CCJV 4Z4ZA 1VQLA 4Y9UA 2HHHB 3VYRA 1PYBA 1F4MA 4DUZL 3M9BA 4LF4Q 2EIXA 2X0KA 3NPPA 3J80E 3CCJB 1W6KA 2N78A 3GTKB 1STHA 3BZCA 1VQ4B 4FF4A 1G8ZD 2L6LA 3DM3A 3JD0A 5JAVA 3IKJA 4LCUC 2PY5A 4R8CA 4PC1A 4JBMA 4Z9CB 1X56A 1YIJB 1D1IA 1EY0A 2QGNA 4OX9L 4FFBB 3PO2B 4XIGS 5C4XB 5J2TA 1H2MA 4X88A 1L0XB 3K5OA 2VY3A 1E63A 4YXWA 3FKIH 3MHPA 3BY6A 4Z1MA 3GD7A 3OGIB 5JJLA 1EEFD 2Q6AA 3SJBC 1E64A 4IOCA 4DUZO 1ET9A 3OIPA 3CD6V 4DR1Q 3KJPA 3D4RA 3AG7A 1VQ5A 5LYJA 2VBUA 3CQZH 3OPOA 3DWQA 4H37A 3VO1A 4FLTA 4XT1B 5ISRA 2CTPA 1K4DC 3VQVA 3CD6B 4I0XA 4R8IA 1VIBA 3I55V 1QNUA 2L55A 4X9QA 2ZIOA 1JJCB 1VQ8A 4OX9O 5H6QA 3ZJZA 2EIMB 4R7CA 1TTTA 4LF6B 4A3DH 2VNHA 1BXTA 2IU3A 2R61A 3CP8A 3ZPNA 1TWAH 2CHBD 1BF4A 2KCNA 2JEXA 3K59A 2VNIA 1JC7A 5E3FA 3T1YL 4DYLA 2KHSA 5JQGA 2OF1A 5FA6A 2WINB 3H1LH 4X62B 3GIRA 3J7YW 2A7WA 5JCOC 3BU2A 3ZHTA 4BY1B 2DYSB 4HJ7A 3ONAB 1PJ5A 1UEBA 2ZD9A 4FFKA 3CP0A 5GW7A 1PRTB 5K36H 1KD1W 4RGMA 4HMJA 1VQFA 1U5KA 4FXGC 4C3IG 1CHPD 2PZUA 1L0LH 4YEJA 5LMUB 2FINB 1JWUD 5H5JA 1EIYB 1QGZA 4DR2B 3T1YO 3E35A 4DV7L 1Y69U 3G6EB 1KD1D 1XNRQ 1VEWA 4J7JA 4M4SA 2WSSG 1NTZH 1X32A 4IJHA 3FKSG 4K8IA 1D5ZC 1BCCH 3FX7A 5EYPA 1Q6UA 5K5PA 5H1SE 1UD6A 4X0CA 1OHHA 4LFAL 1RFYA 4JI2Q 2G9HD 4H7BA 4IZ8A 4ILWA 4PI2A 2ZT9B 1S0VA 2B9ZA 1J9OA 2Z1CA 2E2HH 1Z5VA 1H2KA 5J3OA 1OB2A 3AG1B 3BEHA 3BABA 3OFNG 1WCMH 5COYA 4BWGB 2UUAL 2WP8J 3OW2A 2F43G 2XRSD 4UV8A 4J80A 2Q69A 2MO1A 4OIJA 1NB9A 4Z4SA 4DV7O 3PUNA 1B06A 4B3FX 1YHAA 1S5CD 4DAMA 1FXKA 3GTPB 5ITZB 3CB2A 2A1AA 2QEXV 3CP1A 4Y52H 4ASUG 3PUZA 2C2AA 1BBWA 2JJQA 1WU8A 2YTXA 2RQXA 2NUCA 2F52A 4JI8Q 4YY3B 4LFAO 2DETA 4G7WA 3W7SA 4F6EA 2EIJC 1OTCA 5FO9B 2EVBA 2JGDA 3ZHUA 1EY7A 1BCPB 3J7ZC 5G3LD 3UKMA 4AH6A 2F0KA 4U68A 2F0QA 3UCSC 4BA1I 1VQNB 4JI1L 4UCRA 4DNIA 3E3XA 2A6HD 1M4VA 5KNBA 3MHSC 2VB2X 3IAYA 1TY2A 4PJ0Z 2UUAO 4JBWA 1J5EB 5FIUA 2Y0IA 2AHYA 2EJFC 3BDCA 3S3WA 1F9QA 3EFXD 4WZLA 3GO5A 2C5HA 1ZKOA 1KP3A 1EP2B 4DUYB 5KHGA 3OMNB 2AQ1B 3G71B 1WJJA 2P7TC 1SE2A 3KBXA 2DYSC 3K9SA 3KDFA 2Y0PA 1BNZA 1V1PA 4P1VA 1PRTC 2JIZA 5CMDA 1WB8A 3D26A 1AE3A 3WB0A 1RTNA 5TY0A 1Q1EA 4C3IH 3GVLA 4GNXB 4JI1O 5A2QL 4RPBA 3JC66 4F7DA 2ZL5A 4FP5D 2D0PA 3NTIA 3PO2G 4N3NA 4MTOA 2E75B 4RUEA 1MA1A 5C4XG 1XMOQ 4JYAB 4QFMA 4B7KA 3U4VA 2OIEA 3M3YB 2MW2B 3DWPA 5FLMG 2Q7GA 3A2FA 3W2GA 2K05A 1IDSA 4FLVA 3E86A 4CJ0B 1T6XA 4EQPA 5EK0A 1VMCA 2E74B 5KMGB 4LWSA 3FJOA 3A3GA 3HKBB 4FLXA 2XUMA 2SEBD 4X64Q 4JI0B 1HRJA 2KCCA 3RLNA 3X2QB 1UWVA 4MT8A 2HCIA 2XVSA 1G7CA 4HJ5A 1WSRA 2BSKA 3JARA 4LMQD 3CMMA 2NVYB 3QG1A 1IXRA 1V8QA 4BIUA 2BOSA 3WB2A 5BR8L 4HIMA 2A19A 2KSDA 5H9CA 5CB4A 1VQPA 1IJEA 2P90A 2E1RA 4CQJA 2WLJA 2K75A 3E0JA 3CCLV 3CCVA 4M53A 2QKAA 1FGBD 3NBHA 4QIWE 5E4XA 2YIBA 3I56V 3WYAA 2JA9A 1Q7YC 2GA4B 4TUYA 4TV8A 3CCLB 4PA3A 5C93A 3K80C 3A8JE 5BZBA 2I5LX 4DKAC 1R5BA 3Q6RA 3RNUA 2X6AA 1KRSA 3I56B 2CK3A 2EJGC 2EJMA 4BY1G 1X3QA 2DJVA 4XLAA 1MMMA 2V7UA 3CB4A 3K7UC 4GX1A 1Q1BA 5KIXA 3OIQA 2LY7A 5CV5A 5KX5A 2FXQA 4BW9A 4GX5A 4WRDA 3CCUA 1EN4A 1I4XA 4WFEA 5BR8O 2CCZA 1HUNA 3KFUA 2YI9A 3TXSA 5C0XI 1YCIA 1WTWA 2W6JA 4UZFA 1STBA 2N3SA 3GTKH 2LW1A 2P22C 2BSAA 4TOIA 1D5XC 1MI2A 1X3PA 1URFA 5CORA 2UXBQ 4JI7Q 1F9SA 5IY0A 4WWVA 3WB1A 1HNZL 3TSSA 2HEPA 3E2EA 1FD7D 2E75C 2MQHA 3PO2H 3DDYA 5C4XH 2UXCL 3A8KA 1KDAA 4OPVA 1R3JC 3ZN1A 1I94B 3STLC 2ETNA 1WA8A 1KIXA 5FLMH 5BMVB 1CPYA 3T53B 4CJ1B 1XQ8A 3WBKA 3ASTA 2ZXIA 1FKAO 1K8OA 2QMUA 4JBJA 5L3DA 3FYEB 5I2XA 1AZPA 3HGBA 3M8AA 5EJWA 4NTXA 3DLLA 4Z4UA 1HZEA 5IYDO 3VNVA 1QE6A 1EN6A 2KCMA 2Q7EA 2ZQMA 3VR2A 3X2QC 3M7NA 1B3AA 4FF2A 2E76B 3WBJA 1XI1A 4ZBMA 4IIJA 4YHHQ 1HNZO 1TWGB 1S5HC 3A5ZB 4A3IB 2UXCO 3OTFA 1KYOF 2ZNJA 3DWAA 1MGSA 4LBVA 1A8VA 3P1HA 2QTZA 3P32A 3X3NA 2WLNA 1G7RA 4A3CG 5EGTA 3A0RA 4OWTB 1SETA 1JWMD 1EY6A 1BS3A 4K14A 2EY2A 1EN5A 1S3JA 2XNJA 1WTOA 2PYJA 4DR5L 2EYMA 4W4LA 4BY1H 3B8MA 3NWSA 3TETA 2ADPA 1ONLA 3ABKB 1Z6HA 1QLEC 3T1HL 1BMFA 5M3FB 1AE2A 2UU9L 4AHCA 2B2WA 4NXMB 1H2NA 1A3TA 5B5EZ 4O2DA 1EIGA 4GKKB 1CZGA 1IBLB 1BX1A 4HR7B 1N8RC 1CKOA 4J15A 4XYOA 4UP8A 2IWHA 2JXMB 4RD3A 1JB3A 3BPZA 2F0JA 1LR1A 3C46A 3CCRV 1EYAA 2VQFB 1JOQA 2ZJQA 3OKXA 4DR5O 3BHPA 3SYQA 3W1GA 3IL8A 1LTSD 4F88A 1TVKA 5D5QA 2R9RB 2HP8A 2GK7A 2BCOA 2B2VA 2EYPA 2FVGA 1WD0A 1UPGA 2OTJB 1I50B 3T1HO 4Z4RA 2HQEA 5CV6A 4A3EB 1XJVA 2VQEB 5IGEA 1O7ZA 4DU9A 2UU9O 5B1AC 4X3SA 4GYCB 2LXKA 4GKJB 1Q6HA 2HKOA 2XGTA 3E8GA 3RW0A 2BE5C 2CAZC 4RDLA 1A3UA 4U7NA 1JCHA 5A9GA 1R4PB 3E1YE 3RVZA 3GTPH 4A5UB 2KB1A 2F0IA 1G291 4JYCA 4O2BA 1IXMA 2ZE6A 1OJHA 1IBML 3CPWU 4B3XA 2QTLA 5HZAA 3IRBA 3FB7C 2CDYA 4MTFA 2QWNB 4ZHQB
chains in the Genus database with same CATH topology
2N88A 1Y1WB 1F77A 2ENBA 4ZLTF 2UXDB 3FVQA 3EVQA 4DRXA 5D14A 2EY5A 2XWBB 1PTOB 1PMRA 2VB3X 3VR3A 4IQZA 2KKWA 2DY8A 2KEEA 4ZKCB 5JJZA 1W0KA 2F93B 3BCDA 4BWAA 5KNCA 1SA0B 5LP6B 3E6ZX 5ELDA 2NN6G 4X1YA 4XQJA 3CRLC 2R7ZB 4IUPA 2GJKA 4II3A 3MEHA 1SBBB 1EL0A 2F0NA 4R8NA 3N52A 4QCLA 4RH6A 1OXXK 5T1IA 3JASA 1IHZA 2SNMA 1SE4A 4CHTB 4DN4M 2XHBA 1JFFA 4OGQC 3A3BA 1QB5D 1ILQA 2AWNA 1GUGA 3BG3A 1Q3EA 4XD7A 2EZVA 3BS1A 2PUSA 1IYVA 4KJNA 3IFTA 5LA6B 4XN0A 3K57A 4TSFA 2KECA 3R3OA 1M8AA 2JDIA 2DNEA 2GJPA 5C3XA 3MA2B 2OYQA 4XORA 3EROA 2FMCA 2F0WA 5G3LF 4CH6A 3TP5A 1KTKA 1HR0B 3BC9A 1TS2A 4J6HA 3RUZA 2K01A 3TZUA 4ZRZA 3N6RA 1KMIZ 2ZZFA 3NTHA 1H9SA 3QWNA 3M85A 5KHHA 2Y0SB 3GTJB 2X85A 3A8KE 2B63B 3D8GA 3J81E 2Q7HA 4PNYA 4DXFA 1UEAB 2F0PA 5IODA 3AU7A 3CSXA 4X66B 4I4TB 2JE6I 4PI0A 4FLYA 2XZOA 4ULLA 1SA0A 1Q8IA 4MHEA 5LP6A 1XWEA 4KTAA 1CA6A 4OO1I 2PMZB 1SEBD 2F0EA 3FMCA 1KLUD 1U4MA 3HRZC 1I4PA 4OX9B 1FX0A 5FPOA 2QJ1A 2Z8LA 5IK2A 3SEBA 4J8QA 3FKIB 5DM73 3HOWB 4NW2A 4IN3A 4UCVA 3HKDB 4H0LC 1B9NA 1SNDA 1JR0D 2L5TA 2N55A 1IBKB 5EIBC 3RMHA 3H0GB 1CA5A 4ZOLB 2V7QA 5DAUA 4HBNA 2RSOA 1EY5A 3SK5A 4PMCA 4UDUC 3CQZB 5FL7A 1I18A 1D1KA 1ESRA 1M4UA 5LMNB 3OAAA 1PZID 2F0OA 3P75A 1A2TA 1F9RA 2ZTGA 3HKBA 2NWGA 5TSSA 4FYDA 4DV1B 2WZPP 1SKYB 5KNDA 3KK7A 2QE7A 2F1MA 4RGTA 1SNCA 2RA4A 4C3HG 4TQFA 4LR3A 1GUWA 1WTQA 2WACA 1E1RA 1I4QA 2W6IA 4ZAIA 5CBAE 2EOTA 1FNWA 1O80A 4F6RB 4A3DB 3A35A 4DAYA 1SAPA 3CKIB 1C4QA 1QNKA 4I65A 3HEJA 1NUCA 5JJJB 4IHJB 1DCZA 4K5XA 1TWAB 4HTHA 3F2UA 2O5JC 4JI6B 3BCFA 4O4JB 5E4WC 2RDHA 1HNZB 2LMCB 2R92B 2ICIA 3G05A 3J81L 4DV0B 1G91A 4HN7A 3JAWB 2D3LA 3K5NA 5A35A 1UD5A 5ELCA 2EY6A 1GUOA 1MSGA 3GTMB 1NBMA 5IJ0B 4S3SA 4O1NA 1EOTA 3HKDA 1CZWA 4XQQA 1BDOA 2UUCB 2K6AA 1HPCA 2F0VA 2IX0A 2IX3A 1JORA 4LF4B 4LFCB 4ZOLA 3TP7A 4X3TA 2NN6H 5KHKA 3U0ZA 2XWJB 3JAKB 1LT3D 4DV6B 5C4HA 3HG9A 2A69D 1V1OA 4ABNA 5EPJA 1D5MC 5C4JB 4KHPB 2RKSA 1Y1VB 4HNAB 3KLSX 5JEAG 5EBCA 2CW0C 1R9TB 2R3ZA 1GOZA 2IT1A 1PRTF 4IFDG 3UT5A 4M1UB 3NE5B 4LK1C 3S16B 2EYJA 4K6LA 1BR9A 1B1ZA 1VDZA 4LAAA 1QJOA 4U673 5EIBD 1XNQB 2B2TA 2LKVA 2VNUD 1I7FA 4NVPA 1PXUA 4KD3A 4U3JB 5J1ZA 4F6RA 5IWAB 4AILC 5FO8B 1FNUA 4K2KA 4WBNB 1A6XA 1P49A 1DJRD 3PIP3 3CRKC 4IHJA 1Y8NB 1JOOA 4CC5A 2JGUA 1IYUA 4UCTA 4IFDI 1MSHA 4CH4A 4O4JA 4ZI7B 1COWA 4ODGA 1SQGA 5JPNC 4X1KB 4X3UA 2RQ6A 2D9UA 1E3ZA 4G7OC 1O78A 3QOLA 3S2DB 4BS9A 3J7AV 4FM0A 4DNRB 4E0FA 4K5WA 1U4LA 3JAWA 3UI2A 2H1EA 4DV7B 1CT1D 3FEWX 2BTQA 2WIIB 2CVRA 1H9JA 1LTGD 5IJ0A 3W2DA 1STAA 5I6WA 1E1QA 4XQNA 1H9MA 5I9PA 2E2IB 4O4IB 1O9HA 4HCEA 3OE7A 1AEXA 1EEID 4YJ2B 1SNMA 2E2HB 2J7ZA 2A73B 5JH7B 1UD3A 2UUBB 1QWYA 2EYFA 2OEOA 3S1RB 4WFN3 2X6XA 3L7ZC 1WPBA 2MGSA 4IALA 1LT6D 1JJOA 2PW7A 1WCMB 1TGOA 1T5XD 1Q90A 4H44C 5FLXE 4HNAA 5BMVA 1PTOD 3QIAA 3TZDA 3SJAC 1II3A 5M5XB 4ZKBB 1WN7A 3ND9A 1JCKB 1FJGB 4JK1C 3MFGA 2A6EC 2C9OA 5HGTA 1O9GA 2A6HC 1S5ED 1E3XA 3GV6A 1YNJD 5IGFA 1SSOA 1HHVA 3JU4A 3TN2A 2RDGA 1E2ZA 1IKLA 4U3JA 2ZXPA 2NBFA 1RF2D 1TY0A 3A54A 3WQZA 2QDBA 3DUZA 4EQOA 2SDFA 4XOPA 1GUNA 4WBNA 3BVMA 5BN5A 4G57A 4MN3A 4ZI7A 2D2CC 4C3JB 4X1KA 4QF4A 1PDQA 1CK1A 4K2LA 4PMBA 1Z7TA 1SMYC 3M7GA 5IJ9B 2NYZD 2PZTA 4CH5A 4EEQA 2JA6B 4KY5A 4XLHA 2HCCA 2O2LD 3SK6A 4Q5VA 2BA0A 5IOCA 1SYDA 5M9OA 1WNSA 4XDXA 3LWEA 2XZLA 4EVOA 4CKBA 1BCPF 1I4RA 3BH4A 1EY4A 4RWSC 1FR3A 4O4IA 3I91A 2K1BA 4PV1C 4YJ2A 1LLRD 5EPLA 3MXUA 1R4QB 4KI0A 2ZIMA 1CHQD 3JSLA 5JH7A 3H09A 4K8ZA 1STNA 3A7AB 3D3RA 4I50B 4C2MB 4JI1B 2ZXOA 2K5WA 3BDOA 3CP2A 1BBXC 3SVMA 4PQXA 5F2DA 1WVLA 5DNFA 2AQ2B 4FM1A 2J0TD 4JI5B 4B3MB 1ZEQX 5BN3A 4O42A 2R70A 4BBRB 2M9VA 1D5AA 2XNAC 4RCNA 3ND8A 5FLXL 4P2CB 5DM63 2K04A 1I6VC 4RKBA 2JJ2A 2ZINA 1F2YA 3C1FA 4WORA 2X6GA 5IGBA 1XHXA 2KQ3A 2R9AA 4GZYC 4N9TA 5IIFA 3MXPA 4IFDH 4FM2A 1BUVT 2M5SA 4C3IB 5LHY1 2F66C 1QOHA 1F2LA 1IW7D 5CC4A 4II2A 3N2KA 2K7VA 5CA1B 3MZ5A 1TA8A 2RDFA 3OSOA 2WPDA 2XSCA 1VLYA 4I9QA 1VF5C 1KU9A 1UD4A 2A6ED 4KY6A 4QMGA 1W9XA 4QUCA 4ME5A 5C8YB 4FLUA 1W6JA 2B39A 2AUKA 1LTRD 5KHJA 3A8IE 2RJZA 1PKVA 4UCOA 4YJ3A 3HOVB 4O2AB 3RYIB 2IX1A 3CHXA 1QHTA 3OEHA 3GP7A 3SHLA 4H13C 1TS3A 4AYBB 2X8KA 3TBIB 5LXTB 1KDCA 1N33B 4DV2B 2EDGA 3PUXA 5ELEA 3EJIA 3BVZA 3ZIAA 4I50A 3SDZA 4P22A 5IYZB 5EPKA 3JAME 2MP1A 3K58A 5D65A 1UUPA 1BQQT 3ICXA 4IUUA 4DNTB 1CM9A 1S5FD 1SNOA 3A55A 2F3VA 1I4GA 5KGUA 4TQUS 3OTOB 1DD2A 4DF7A 2E5LB 2EXZA 2JEBI 3MVVA 1T5EA 1SNPA 1WTPA 4C1NI 1RODA 2K5DA 4FXUA 3IFDA 1K83B 5LL6X 1D2BA 1HNXB 4ZUIA 1FNVA 2IM9A 2BTOA 2IW3A 3VR6A 4CC6A 1TQOA 4CBVA 4FXKC 1VF7A 2RSNA 5J39A 1RCVD 3QJYA 3SJCC 5JOBA 3S1MB 2Q8IB 3S1QB 1S5BD 1YEWA 1Z47A 2F0HA 2B2UC 5D3DA 3RYHA 4TT3A 1V0EA 1TS4A 3SXHA 1C8CA 1SXTA 3C1EA 4A3KB 2BDNA 2FJ2A 4FVMA 1JWSD 5IGGA 4LFBB 2F0FA 2WSSA 4O2AA 3RYIA 4NNJA 3HOUB 5IGDA 4V0BA 5CGKA 4TV8B 3FKSA 3NHHA 4LF5B 5CA0A 5BR8B 1OB0A 2DNCA 2X6WA 5LXTA 1GXDC 2ZT9C 1DOLA 4F87A 1PTOH 3S2HB 5FKAC 4B08A 2A68D 1XTCD 1QG7A 4ZHQA 3THOA 5IYZA 4DR7B 4RA8A 2BE5D 2ZNIA 2B8GA 4OO1G 3T13A 4HCSA 4CKEA 3O13A 1K28D 5J2TB 1QCBD 3T16A 1VCIA 2AQ3B 5GONB 4X20B 4KMUC 3W3AA 4XLCA 5ELBA 3JAML 4A3MB 2BDOA 1E2VA 3OFNA 3U10A 1EZ8A 4LF8B 1C48A 1ENFA 2EE1A 2JYOA 5K36G 2XRQD 3HKZB 5KRUA 5C3EB 3DEOA 4R9WA 4E6IA 3LNNA 3BZDB 1X4TA 5KHIA 2F43A 5FOBB 4YIJA 1ET6A 2YYZA 4FNFA 3WDNA 1O7LA 4K0KB 1Q3LA 2RVLA 3GQBA 2HDMA 2KA7A 5LYJB 2WAQB 2HHHB 2XGJA 3VYRA 3KF8A 1LTBD 5CBEE 1TT2A 3E22B 3NQIA 2L11A 4KV6A 3H6MA 2HDLA 3BDLA 1M5IA 1XMOB 2Q8RE 3NPPA 3J80E 4TRDA 4ASUA 3D6CA 3MXGA 1EY8A 1W6KA 5LA6A 3L3OC 5D3IB 4FF3A 1B53A 3GTKB 1STHA 1EWCA 1BCPC 4FF4A 2EYLA 1G8ZD 1KLGD 5KNLA 4EQNA 1BPLA 4KL1A 3MC0B 5JAVA 3IKJA 1KABA 2PY5A 2ZZEA 1SQFA 1UNSA 4CH3A 4Z9CB 2YU9B 3I3CA 1SYBA 1HVXA 1D1IA 3VQXA 1EY0A 4F8MA 4LH6A 4FFBB 1U4PA 2VXWA 4KKTA 1TU2B 3PO2B 4XIGS 3DM1A 1F9PA 5C4XB 2PYKA 5J2TA 2XNDA 4X64B 2GK6A 1GUTA 3K5OA 1L0XB 4LF7B 2QCPX 4LNUB 2B2YA