2F1MA

Conformational flexibility in the multidrug efflux system protein acra
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
246
structure length
229
Chain Sequence
TTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDMKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTMMPGMFVRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility in the Multidrug Efflux System Protein AcrA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Acriflavine resistance protein A
total genus 57
structure length 229
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f1mA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2f1mA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f1mA02
1K8MA 4I7ZC 1OXVA 3VR3A 5A35A 1T5EA 1GUGA 1LACA 1Q12A 4DNRB 2AWOA 4OGQC 2LMCB 3A8IE 4JBWA 4H44C 2CW0C 3HGBA 2ZT9C 1B9NA 4L8JA 2A68D 3VR2A 2DNEA 3QG1A 3NE5B 2KA7A 1H2SB 2B8GA 2A6HD 3MXUA 3VR6A 1ZKOA 3WB2A 1Y8NB 4RCNA 1B9MA 1QJOA 2BA1A 4OO1G 3SE0A 3LWUA 1OXSC 1G291 4LJZC 1LABA 5BN3A 4BA2I 3WB1A 4KHZA 3D31A 2Q8IB 5K36G 4DK0A 3P20A 1CI3M 2D62A 1H9SA 4G7OC 2NN6I 3KLRA 2F93B 2A6HC 4KI0A 4KKTA 2K7VA 5C0XG 1Q1BA 2K33A 2NN6H 4DK1A 2K32A 3A8KE 2F1MA 5JJJB 4HR7B 5C0XH 1Y69U 2BA0A 1TKWB 1H9SB 1H9KA 1VCIA 5JJEB 1E2ZA 3I73A 4XIGS 1HPCA 3PUVA 3T56B 1Q1EA 1Q90A 5BN4A 1Z6HA 3QJYA 2EJFC 1GHJA 1TU2B 1V8QA 3A8JE 1CTMA 1E2WA 3IKJA 3PUYA 3M85A 1YNNC 1IW7C 3PUZA 3CRLC 3PUWA 3WB0A 1O7LA 1DXMA 2B8FA 1DD2A 3ND9A 4PV1C 3TZUA 4GYCB 2YYZA 1Z7TA 3U9SA 2V4DA 1RSOA 4OO1H 1HTPA 1HQMC 1BDOA 1K8OA 4KMUC 2IT1A 3FMCA 2PNRC 1GUNA 3GD7A 4KN7C 2O5JC 4G7HC 1SMYC 5JEAG 3T51B 4H13C 2JE6I 1O78A 2F95B 1GUTA 3T53B 1H9JA 2BE5D 1IW7D 4TQUS 1OXTA 5KNBA 5JJNB 3LNNA 1IYUA 2A69C 2AUKA 3WDNA 4BA1I 1V43A 3EQLC 4JK1C 3DXJC 3VA7A 1GHKA 1VF5C 1YNJC 3N6RA 3BDOA 3BG3A 2DNCA 5BN5A 1FYCA 3IFTA 3W3AA 5JEAH 2DN8A 4GZYC 1A6XA 1GJXA 3AB9A 4KN4C 2D5DA 2A6ED 4KKUA 2JXMB 3A7LA 1GUSA 1VDZA 5D5PA 3I72A 4DNTB 3M7NA 3VR5A 2QF7A 2E74C 1HCZA 4KKSA 2JEBI 1ZYRC 4IFDG 3RLFA 1I6VC 1Y8PB 2R6GA 3D4RA 3PV0A 5D5QA 1H9MA 4XTCS 3H94A 4G7ZC 1E2VA 2BDOA 3I4LA 1IYVA 2AUJD 3GQBA 2JEAI 2BE5C 2PCFB 2L5TA 4TKOB 1DCZA 2E75C 2NN6G 3MFYA 2A68C 2A69D 3SDZA 1H9RA 3OPOA 5KNCA 4LK1C 4IFDH 3L7ZC 4IQZA 3BRCA 3ND8A 2E76C 5K36H 1VF7A 2KCCA 3FPPA 1EWHA 1FR3A 3A7AB 3PUXA 2EJMA 3OW7A 1OXUA 3M4YA 2O5IC 1GUOA 1Y8OB 2EVBA 1CFMA 3VR4A 4H0LC 2EJGC 1PMRA 2PPBC 1OXXK 3QIAA 2A6EC 2EDGA 1ONLA 5KNDA 3CRKC 3OOCA 2D2CC
chains in the Genus database with same CATH superfamily
4LC0A 2ZE8A 2OYNA 5J2TB 5GTHZ 4NXMB 1K92A 4WFBV 3JAWB 1Q12A 1QOHA 2KBNA 5BMVA 5F4MA 3FB6C 2N88A 3Q8DA 4OONA 3CD6A 1Q7YW 2VWKA 2V31A 2YEVB 3BA8A 3CB4A 3MVVA 3AG3B 2CW5A 2A9HA 4PHZA 4B3TO 3QFTA 3CC2B 2QKIC 4B3TQ 3PO3G 1I5FA 3JARA 3ABKB 4A3GH 4K0KO 2IBZH 4EKWA 4JVZA 2EINB 2YU9H 1MIUA 3VR6A 2PZUA 2R7FA 3B78A 3AFPA 4KHPB 1Q81C 2UUBQ 2WPDA 3PVDA 2XZPA 3AK3A 4A4IA 1Q86W 4Z9CB 4MTKA 3K0GA 2ZDIA 4LF6O 2P4KA 3JQRA 1OXSC 1X55A 2B2YC 4DR1Q 1G1XB 4CC6A 5E79Z 3AK1A 1G7CA 1W0KG 3KF8A 4A3IG 3K0DA 5JVDB 2CTWA 5BMVB 2VWJA 4WFGA 3ETEA 3CD6B 2V7UA 2JQOA 2QMUA 1DJRD 1IKMA 3MAQA 1IHMA 1VQEA 2IY5B 2EYHA 3B09A 4PQXA 4DV4B 4IIJA 1TWGH 4A3MB 2JJ2A 3AK2A 1FX0A 2PLFA 2F0FA 4P2CB 3S9WA 4FLYA 3A0RA 3CPWU 1N34O 4FF2A 1SNQA 3ULLA 4PDRA 3RVYA 2NBFA 4QF4A 2DGYA 2R93B 3CCRV 4K5VA 3T56B 2YICA 1K33A 2WB1G 3QJYA 5KGUA 3MZ5A 5LL6X 4NBSA 4X66Q 4Y52H 3D3IA 1NBMG 4F6RA 1S5ED 1KC8C 2WLIA 1BVSA 1JOKA 4GLVB 2YWFA 2HCCA 1D7QA 1UMKA 5LYJB 2UU9O 2R93G 2ICIA 1BDOA 3UT5A 1V1QA 3OUFA 5JJZA 4LCUC 5CBHA 1BQZA 1GJRA 4FZ0A 1Q81W 4PZ8A 4UB6Z 4KN7C 2BF4A 3OZUA 4I0XA 4IPGA 3K6OA 1FJGL 4JI8B 1E7ZA 2HJFC 3SJBC 1FNBA 3WBJA 3F5WC 4CDCC 5C44G 3JD2A 4ACBA 5CV7A 1MNGA 1HNWB 3T53B 1LT4D 4GKKO 4X3TA 2Y69B 4WJ4A 5J2UA 1F9PA 2JGUA 1FNMA 4OOSA 1AP5A 5FO1A 2Y0SE 2AUKA 4BIOA 5KX5A 4UCRA 2WWWA 5BR8B 4NCNA 3I56B 2XAHA 1SQVH 2XOKG 2D3LA 2Z8LA 4B9WA 1HZAA 1RFYA 4C43A 1PPJH 2DOSA 4UB8Z 2LKVA 4RMFA 2XNDG 5LP6B 5B1BB 5GROA 3CC7A 4DR1O 5EC1C 3LSQA 2E5LB 1DK1A 2BGIA 3SLDA 5HZBA 1D5XC 2GVBA 2N49A 4DNTB 3A0HZ 5AJ3Q 1JWMD 3CMAA 4NXML 3VR5A 1EFCA 2QSAA 1PYSB 1S4MA 4KL1A 2QWOB 5LGUA 1VJSA 1HCZA 1QCBD 4C56C 4DR2Q 1XMQL 2CK3G 4XTCS 1HR0W 4JI5Q 3V05A 1SQFA 1PRTF 1US6A 3E83A 3FAVA 4LF8B 4MTNA 4G1VA 4G1BA 1FKAO 1ELOA 4RWUA 5FNVB 3FPUB 2NN6G 4XQNA 4KJNA 4JYCA 4QE7A 3W2HA 3UE0A 1YNND 1PJ5A 3TRZA 2Y4UA 4NXNQ 2QDLA 1H9RA 1EFRA 1SJED 1K8AC 4MYTA 5JPNC 2PNHA 2UXCB 1A0IA 3L7ZC 4IFDH 1K34A 3UDIA 4YHHO 4JCVE 4RA8A 4ALPA 3ZUGA 1HWYA 4DF7A 1KJZA 4MHEA 2QDXA 2B2TA 1N0VC 2PPBC 4L6TB 1DGSA 5KHIA 3J80E 4A3KB 2EYPA 5IYWA 1SMYD 2SEBD 4PV1C 4YAWA 1JOQA 4CGYB 1PH2A 2VRZA 1XE1A 3S16H 2VQFO 1LLRD 2KCNA 2FYUH 5CV6A 2VQEO 1CKNB 1IDSA 5KAIZ 2XSCA 3DM3A 3ZJYC 5T1IA 4MNOA 3X3NA 3MD0A 2HKOA 2FINB 1YJWV 2XOKA 4L5TA 5GADC 2VW9A 2WSSG 1M4UA 3ZMZA 2HIXA 1YIJV 1TUBB 1EUJA 4O4HA 1YBYA 4JI7O 1NJIC 1C7YA 1NB9A 2Z6BA 4LUOA 3K5LA 3THOA 5DEHA 3NENA 2BVNA 5J2UB 4P2NA 5LXTB 5LHY1 4RAIA 5B1AB 3DLLA 4HIDA 3G6EB 1L1OB 1I4PA 2IW3A 2CF4A 3KOJA 2IX0A 1K73D 1G291 3TK1A 4K1XA 3E8HA 1PH7A 1XEQA 1VQOA 1VQ4B 4DK3C 1A32A 5LL6Y 1VLYA 2EILB 1AE2A 2E2DC 2QILA 4RUFA 2RC5A 4IFDG 1YJ9A 5I9OA 4GKJQ 1OCRC 1EQQA 4JMQA 1PH3A 3C3TA 4AF6A 4IYHA 4KI0A 4QUCA 1TUEB 2D0PA 2VBVA 4RJLA 4UAIA 1NBMA 1JC7A 1ET9A 2NYZD 3MA2B 4B47A 4IPHA 4PMWA 4YY3L 3GTQH 4JI1B 2YWEA 3PENA 4KK7A 5JJEB 3OW2A 3J81N 3GVLA 4A3DB 2B7CA 3ZEDA 5JQGB 1DM0B 1LNQA 1J9OA 4X1IB 5L3CA 1Z6HA 1WTHD 2MUYA 4BBRB 5M3MB 2YU9B 3RN5A 3E0JA 5KMGA 4PA6A 2R3ZA 2GVAA 1DF5A 4HCEA 2I07B 1L1FA 4B3SO 4OX9Q 1JFFA 4LF8Q 1SESA 3F2CA 2BMWA 2OCEA 1YEWA 4GUNA 1KTVA 1ENFA 3S2DH 4LFCO 4LFAB 4MVSA 1BUVT 4X65Q 2RMKB 5LBQA 4B3RB 1EIGA 5L46A 3EROA 4KMUC 2C9OA 3LWEA 1UE6A 3KJOA 5GV7A 1VMCA 3U4ZA 3STLC 3BZKA 1OXTA 2WPDG 1DDGA 4GLXA 5M3MH 2IH3C 3FYIB 5ITZA 3LDEA 1XB2A 1EY6A 3ZZTA 4LFBB 1SNCA 1N36B 4RG1A 5TRDA 1BX0A 3DXJC 3CXCA 4C2MB 3I4NB 2IH1C 3BCFA 1K83H 3K3WA 4IUVA 4GX2A 2DCUA 1H2LA 1M5IA 2DIEA 3BY2A 3QOJA 5IODA 4AQYQ 2CHBD 3GTQB 1CKOA 4DV2L 1CQVA 2ZXWB 4M1KA 4I4TB 2V7VA 1JA1A 3TDQA 1L1OA 3F2UA 1JVMA 1SYGA 2HHHO 1QVFB 4Y7NB 3G6EA 2A73B 3GTPH 3KDFA 2BCOA 4BBSB 1WCMB 1YHQB 3QG5A 4PA9A 2FMMA 1MSHA 3NP8A 4AYBE 4BBSG 1B2TA 3SJQC 1OCZB 4JTAB 1U2RA 1LTAD 2PCFB 4LH6A 3CQZH 3L9AX 4NXNL 5CBEE 2DYSB 4LF5B 3RVZA 5C4HA 4UXNA 5IYQA 4BS9A 3CJHB 4CH4A 1NAPA 4IUTA 1I94O 1SRUA 3ITPA 1N32B 1PHJA 1C4QA 5IYCO 2CE4A 2B2WC 1VQ9B 4GCZA 1U4MA 4X62L 3CQZB 2XWBB 2IJ0A 4I4TA 2WFWA 4H0LC 3T1YL 2V7XA 4JYAQ 5FPOA 4RHRA 1MOFA 1V55B 3ZHVA 4U68A 4U7OA 1IX9A 1K8MA 4RD3A 3M4PA 4QFMA 1P4RA 4RHSA 1OO9B 4JI4Q 3S16B 4J11A 4JBMA 3T2MA 4A93H 5JWPA 4JI2B 3ER0A 2EINC 4BXXG 1J95A 4DAMA 4RGTA 3JALA 3PIO3 5HGTA 5JAVA 2UUCO 3O13A 4PZ7A 1KAAA 2Y0IA 2X7RB 3Q6SA 4R8IA 5D3DA 3OZVA 2Z0SA 1G6ZA 1ZKOA 3KF8B 3AVTA 5FK9C 3NBIA 5GQOA 4FO2A 2JA8G 2PUSA 3SE0A 4GT1A 1RM1B 3OWFA 3C2PA 1BR9A 2QDBA 4J10A 1DDIA 4ABMA 5IY5B 1LTID 3CE2A 3CCMA 3OR6C 3UT5B 1U5KA 1QU7A 4C1NI 4CKBA 1EIHA 3DXRA 4B3XA 1FFTB 1V9PA 3W7XA 4DR2B 5C8YA 1SKQA 2CCZA 1XPUA 2DERA 3S2DB 3O9OA 2A6HC 1HNZB 1E63A 4BY7B 2DW4A 2NN6H 1QE6A 4J9YB 5ELBA 1F2MA 2N8NA 1VF5B 3CMEA 3VO1A 4JF3A 4B9XA 3N2KA 1K4CC 4J7KA 1HNZL 2VBTA 1RPRA 2ZBVA 4O2DA 4HNAB 1XNRB 2C2WA 3QWNA 2ZJRA 2YUAA 2IWHA 4X20A 1QUFA 1Q1EA 5BXZA 4RDJA 4JTCB 1ROPA 5IJ0A 1FYJA 4GQNA 2B2UC 2NWGA 3RWRD 3JQQA 4GZYC 1YIJB 2ETNA 4XORA 3I56V 5EKLA 1WTRA 3AMUA 1HNWQ 4KHVA 3PCOB 2WSSA 1XWEA 1SZXA 2Q5ZA 2YYZA 1FXKA 3GTLB 1S5HC 1EOVA 3U6BA 3ERSX 2AW9A 4U9UA 4ZAIA 5FLXE 4N9PA 5J35A 1ICFB 4PG3A 2XEXA 1AFPA 1TWHB 4DV6O 3OTOQ 1EFTA 1QCEA 1NJIW 2GUZA 4JI3Q 1W35A 2Y69C 2O5JC 1R6TA 4C3JG 4TSSA 3QFSA 3T51B 1AIPA 4DV0Q 3RBZA 2RC6A 3AVVA 2D0OA 4Q5VA 1GUTA 2ZE6A 5IWAQ 1B06A 2Q4PA 1X9NA 1WYDA 2IHEA 4L87A 2HFEC 3FB5C 4CDEC 3P7JA 3CC4V 3ZRSA 2LGWA 2Q69A 5LP6C 4P9SA 4DR7Q 1N0UA 1X59A 1S76D 5J3OA 2I5LX 4KJOA 5LA6B 3VOUA 5A2QE 5JJIA 3QO5A 1GO2A 2XGTA 1R73A 5J2TA 1SM4A 1QFZA 4WZEA 3PA1A 1UNSA 1GR1A 1EFRG 5ELEA 3AB9A 1QVFA 3I4NG 3JAME 4FM1A 2F43A 5I6YA 5E4WC 3A7LA 3P1HA 4DGZA 4RAUC 2X6AA 5EC2C 3SK5A 4MTXA 4CS3A 2VNIA 4LF8L 1FJGB 4R71A 1FNWA 5B1NA 4X06A 1KL9A 1ZYRC 1KUQA 2F0NA 3Q6QA 4D6TH 1RPOA 2AWNA 2ZDIC 3GIRA 2RDGA 4O4JA 3I4LA 1XMOQ 1N36L 4B3MB 2L5TA 3S2HH 2C77A 5BR8L 1SNPA 1N07A 2LXJA 4LFCL 2KB1A 2F0OA 4RFBA 2VL6A 5J39A 1AJNA 2BGJA 1K97A 2WYRA 2F3WA 2XNAC 3BRCA 5DEDA 1WAZA 2WLMA 2W6JA 2QKCA 2PMZE 2DMXA 4GOPB 4MW3A 1I5XA 1JB9A 3N52A 5IYDH 1LT5D 2WB1E 2QJ1A 3ZRXA 1OXUA 1J5EB 1BQ0A 2EVBA 1VEWA 4DAVA 4B3SQ 4LNQA 3DUZA 2WACA 4UCTA 1ONLA 2N55A 5FLXc 3CRMA 4A3FG 1VHOA 4OL7A 3VYRA 2KQ3A 5IGGA 4DV4L 2A79B 3HS0C 4LF4B 4DV6B 1GVHA 3C46A 2SOBA 5EBLC 2BTQA 2EIFA 4DNRB 4FXDA 2H1EA 3GTKH 2JS3A 3CCQV 2QA4V 1VQ7B 3QO7A 3JATB 1LTLA 3PUNA 3I2ZA 4A3JG 1H2SB 4F6RB 1WORA 4GX5A 3CYOA 2ES2A 1LT6D 1I5YA 3BVGA 1R6KA 4YWKA 3E3XA 1L1OC 1MKHA 4POGA 2DEUA 1NKDA 5EPLA 3GTOB 4CS4A 4X1KB 3LO8A 1FNUA 4DR6L 4HJ5A 3FX7A 2GBOA 1YVWA 2PE3A 3D6WA 4MW8A 5D65A 4HE5A 2SDFA 4APVA 4XLCA 1EQTA 5EBCA 2H3OA 1LABA 4NKLA 4XXEA 1S72A 1HNZO 2PI5A 5F4JA 3D31A 3AVXA 3K80C 2JJ2G 1TVKA 1JQ0A 1W3SA 5C4XG 4R6ZA 1X3EA 1PD3A 3HOZB 4ZUIA 5BSXA 2PYJA 3JATA 1K3EA 2NR5A 3ZMUA 1GN6A 1HNXL 2DE0X 3TP7A 2CGNA 3KK7A 2VS0A 2XWJB 3CXCB 2F0QA 3U58A 4WFFA 4XIGS 2F1LA 2BOCC 5DSZA 2E5LL 1NMFA 4X3UA 1Q90A 3DHQA 3W5OA 3ABTA 1KD1W 1KAWA 2PQAB 4P3IA 2RBMA 3EJIA 3PUYA 1MMMA 1E1OA 3QO2A 1B4OA 4K3AA 3CRZA 1XMQB 3PO3B 4XDJA 3ZC3A 2WKDA 4DXFA 1L0LH 4KXRA 1STAA 3ND9A 3OM3B 1TWCH 3TZUA 2HIVA 4GN5A 3FAVB 5HURA 4JI2O 1V1OA 5M5YH 4R8CA 2OWOA 4ZGQB 1BCPC 1RD9D 3TZDA 2IJIA 4YY3B 2NZHA 4WJWA 1QUEA 1HUMA 1JJOA 1GO3E 4F4LA 2D9UA 4B48A 2VQEQ 2CGOA 3HOWB 4WFAV 3X2QC 1LTGD 1T5XD 3U50C 2ZNJA 1JB3A 2ZTCA 1N33L 1XMQO 5CA0A 1SYBA 2P5ZX 2RQXA 2JA9A 1I3QH 4BIUA 1QQCA 4B7EA 1F60A 2FXQA 3LX0A 5DNFA 1TWAB 3T4DA 1B04A 1JQYD 1Z2GA 4BA1I 4A3EG 1EZVH 2GK6A 3CW2A 4YIPA 4LF5O 4YJ2B 4U3FH 3U9OA 4JV5Q 4UVAA 1CEZA 1Q82C 1COWG 4DV0O 2M00A 4OOVA 2DWDC 3ES9A 2VY3A 2X6GA 1IBLL 4IFDI 3I72A 2PMZB 1CQXA 2EIMB 2JIZA 4IOCA 1Q86D 2RHQB 4J80A 1JOOA 4X05A 1BXTA 3ETDA 1VQJA 5LHHA 3MXPA 4JI0L 1YITV 4ZI7A 2DN9A 4PA4A 5L3FA 1YTFB 1EZ8A 1H8EG 3OMAB 2A5HA 2FFKB 3IRBA 3H9VA 3VYUA 3OMGA 1Y1WG 2R7ZB 2ZINA 1C0AA 3E8FA 4DNIA 3OFNA 4XN0A 4LF9O 3PIPA 4B7KA 2Q2UA 3K7AB 1L0YB 4P71A 2O2LD 5M3FG 4ME5A 1HR0B 1E62A 1UJWB 1ESRA 1Y0YA 2MO1A 1LUZA 4O2AB 4QE9A 2WLLA 2GREA 2Q0OC 2XRQD 1EN4A 1XILA 1A8PA 5FLMH 5DM63 1OB5A 3M3YB 3EXAA 1STYA 1B8AA 1EWHA 3LQEA 1BHAA 4UCUA 4HSVA 1YJ9B 2F3VA 3VR4A 3AVWA 1FNVA 1PMRA 4OPSA 1OXXK 3NBHA 1OJHA 1AR5A 2PQAA 3S1RB 5KNDA 2J0TD 4HJ8A 5JEAG 1K7DA 4P3YA 2NTSA 2Q6OA 1KLUD 2VZAA 2QE7G 2HDLA 1A2TA 2WP8J 1GRJA 1EYCA 2QTZA 3QFCA 2XTIA 4GLAC 4QIWE 1CA5A 4ACAA 3AQQA 4LUVA 4IHJA 4DV0L 5J22A 4MVOA 3ASOB 1RP3B 3EIVA 4IT5A 2LSSA 2ZIOA 2K4KA 2X6BA 1S0UA 1JE4A 1GKHA 4L5QA 1WD0A 4LF5L 4B3SB 1VQMB 5KLVH 3DTUB 3RYCA 4UVCA 4R4QA 4XDKA 1EY8A 5COYA 4DKAC 1YNJD 3CCLA 3W1BA 4B3SL 1N8RC 4LFCQ 2P06A 1SKVA 3H3VH 4RCNA 4X65O 3CESA 4OP7A 3EHBB 4BWAA 2GTAA 1KKDA 4Y9UA 2RDCA 2WJVA 1BQEA 3A8KA 1VMPA 1WI5A 5K5PA 1XPOA 1QZHA 3C3SA 2ZZFA 4A3MG 4BXXH 1KU9A 2E1RA 2WAQE 2IU3A 3CP8A 3BABA 2RSNA 5EZYA 2YEVA 3AG1C 2EY1A 2NPFA 1SMXA 1WPCA 3BQJA 3HOVH 2UUBO 1UPGA 4A3IB 2K1EA 2OCCB 2RSOA 5J3BA 4JI6Q 3RW0A 1CXZB 1S5CD 3T1HB 2WB1B 1YLOA 5ITZB 3C90A 1XX8A 3SXHA 2UXDB 4TMVA 1I0HA 2KG7B 5FKAC 3AGQA 4I55B 2NN4A 1MRZA 1CHQD 4KY5A 1IZ6A 1FL0A 5DECA 5EYPA 5C3EG 3BH4A 2MQHA 2Q8VA 1VCIA 3M4OH 3FJOA 3JAMN 3VQWA 1AZPA 3J7AF 2PTMA 4FFBA 1J9ZA 1Y76A 2F4VL 1ILQA 2V1DA 1VF6A 1W0JA 3GVKA 1VQNB 3IKJA 1G7RA 3SK6A 3HOWG 4GN3B 2QW7A 2ITDC 1F4NA 5AN9A 5EBDA 3AFQA 1BE3H 2GA4B 4DV5O 3H9NA 4PDMA 5EQ0A 5H59A 2ZTDA 1Z7TA 2KEEA 3CCSA 1X3PA 1JR9A 1HTPA 3X3MA 5I2XA 5BN4A 4A3BB 3DC6A 4L5RC 4G7WA 5KNLA 4R4CA 3VQVA 3GD7A 4R1JA 4FFKA 2VQFL 2PW7A 2EX3A 2IJHA 1P49A 4PMCA 1ZXTA 2IJKA 5B3SB 2X85A 5B1OA 1I8DA 2HUGA 3I8ZA 1QVGA 1I50H 1AE3A 3B82A 5GTIZ 4BW5A 1QH0A 1JWUD 1XPRA 2NVYB 4PA3A 3ZMTA 2EZVA 3K57A 4FK8A 2M2LA 3FEWX 5JCOC 4HJ9A 4X7FA 1VQMA 3EQLC 2UUAQ 1A8VA 2BCCH 5F2VO 1E22A 1VF5C 2VQFQ 4A3JH 3FKSA 1QZGA 4JV5L 3ONYA 1O7IA 4YHHL 1Z5VA 1OCCC 2R92H 1GJXA 4F88A 4X8IA 1N9WA 2EYOA 1PVOA 3CF5A 3EVQA 1SROA 2NUCA 4RDLA 2KSDA 2I0QA 2FB5A 4RGOS 1M1KC 2BTOA 1QVCA 4F8MA 4KFMA 5B3SC 1W6KA 3IC9A 1UD4A 4KKSA 4PC6A 1HTLD 1QNKA 5IY5C 1I6VC 2QCPX 2V1CC 5FLMG 1BL8A 1CNFA 3VMFA 2A19A 3F2BA 4PAAA 4NKGB 1WD1A 1WLEA 4PV1B 2JEAI 4B3MQ 4DV7B 1PKVA 5HZAA 2GQFA 1DCZA 2WLLB 4GX1A 4XKVA 1EU3A 4IUUA 4MS2A 1AN8A 1MI2A 3GTGH 2A69D 4K2KA 1BNZA 1FGBD 1IBML 3OSOA 4LK1C 1IBLQ 3C3LA 4OX9L 5FL7G 4PA7A 4E4EA 5BR8O 5G3LF 1HA3A 1E1RA 4J15A 4U3JA 4JTDB 3H0GG 3HKZB 3PUXA 3HR0A 1NVPB 2C2AA 3N27A 2UUCB 4IO9A 3RYHB 2JEXA 1LTTD 2EJGC 1EWYA 3NK9A 5JOBA 1XJVA 4FMTA 4JI8O 3ABMC 3CRKC 4HN7A 3NXSA 1S3OA 3E86A 1DG1G 2ZTNA 1DLBA 4RCOA 1Q3LA 4JI4O 4OXPA 2XAGA 2QM4A 4X3KA 5CORA 1K8AD 1KK2A 1SZTA 1Q6IA 3K03A 4X1YA 4X1KA 5IWAB 3S14B 2BN4A 1Q7YC 3H91A 5IOCA 2MFIA 3PGZA 2QKSA 3P3PA 2F66C 2JK8A 3K0YA 3MDSA 3CCUV 1B50A 3NWTA 4X07A 2AQ3B 2A6HD 3BPZA 1EBOA 4K2LA 1KABA 4TRDA 3U0ZA 4ZYSA 2V7QA 2NVTB 1N8RD 2RHSB 1NI8A 5DN6A 3OEHA 3M4OB 2WA3A 1DOMA 2JJQA 2UXBL 1N34B 2ZE7A 2VJJA 5ELNA 3AVYA 1U9RA 1K9MW 2RQ6A 4LJZC 4DV6L 3ZIAG 2HJDA 1OHHA 4FM2A 4FLTA 2A3QA 1PFBA 3H0GH 3HOXH 4OO1I 5K36G 1BJKA 3NUCA 1JORA 5G3LD 3WY9A 2IU0A 1OV9A 3VNUA 2EQSA 3AG1B 4I55A 2RNBA 1VARA 2QGGA 3WFVA 2P4VA 1YTFD 1R4PB 1VQ5A 3TMEA 1VQOB 2ZJPA 3ZHRA 2F0MA 3T16A 1BSMA 2X53S 1W0JG 4LF6B 4P2ZA 1HR0L 5E6TA 2PY5A 3A3GA 1ICWA 1E79G 3CWBH 3SJZA 3T1HQ 2YIDA 3I73A 4LH7A 2K1BA 1JR0D 5FLXN 4JZ2A 4JYAL 1VQFA 3P32A 4TMZA 1UE5A 2ZM6O 3A8JE 3R2TA 1I6HB 1NZ6A 1E1QG 4K0KB 2EY2A 3CCSB 5L3DA 4GOPC 3G4SV 1N34Q 4UCSA 3B2EE 2YIBA 3CXCU 4B3RO 1GM5A 4OO1H 2ID0A 2F0PA 3RYIA 2ZIMA 4MSWC 4LFAO 1ZEQX 4LFCB 5CA1A 3HOXG 1Q46A 1PNKA 3OW2B 2Y48A 2GN5A 1SMYC 3H15A 1R3IC 2C5HA 3M8AA 2JRIA 2JE6I 2CBXA 3QSYA 2R92G 1L8DA 1SSOA 1D1KA 3OMCA 4OX9B 2VNJA 5IYZB 2F23A 4TQUS 3CAMA 2XAJA 5C5MA 4X66B 1QVFU 1TQOA 3LNNA 4IALA 1K73C 3MFGA 1JICA 3M3YH 4DRXA 2W6IG 1RTNA 1KRTA 3BDOA 4RWSC 3L0OA 3NBHB 1PFNA 2BTQB 2RF4A 1EP1B 1E0BA 4HJ7A 2UXDQ 4OGQB 3I55B 1PTOF 2N04A 1SR3A 1PL0A 4A76A 4CBCA 2AGAA 2QE7A 2Q9LA 5CA1B 4Q6GA 4GKJO 1RIPA 2UXCQ 2ARHA 4MN3A 4N8FA 1YEZA 1WOCA 3WNDA 4X20B 3SPJA 4UY8C 2YSUB 1E2VA 4X62O 2JN9A 4BY1B 2NVQH 1R9TB 2F0DA 2F0KA 2H94A 1BCPB 1B6QA 2E75C 3RNUA 1NTMH 1S5BD 2ZNIA 5HFLA 4U3JB 1WA8A 4J42A 4TQDA 2VNUD 3CCUA 4TMWA 5I4DA 1MJEA 1WP8A 3X2QB 4QPJA 1W2BA 1O9HA 3G6BA 4TV8B 2OBTA 5F4OA 2YV5A 2CWPA 4CHTB 1M57C 3OFNG 5CGKA 4Z4ZA 4QV2A 1WSRA 3CP1A 4MTOA 4X64L 4XN3A 1YI2A 3QIAA 3E0EA 3OIQA 4JI0B 1FGUA 4N23A 1SNDA 3HOUB 1H38A 3STBC 2HHHL 2K50A 5C4XH 1PDQA 1NR1A 1T6YA 4I7ZC 2VQFB 3MHPA 4R4TA 4V190 3ZBUA 1T5EA 3W7WA 4EGVA 2UUAB 2VJIA 5A9GA 1HRJA 1BZKA 3OEEG 4MYUA 5CC4A 1HQRD 3R65A 2WLHA 2YIBD 1PZKD 3RYIB 2PIAA 2ZT9C 3VR2A 4DR7L 4ID6A 3OP1A 3NE5B 3CHXA 1W34A 4OWTB 1SQPH 2PI2E 1E1QA 1BO0A 3F5TA 5IYPA 1EWIA 3KF6A 2YIAA 5LMUB 3RZOB 1H2GA 4ASUA 1TUBA 4DAPA 5FJ8G 1XNQL 2G9HD 3E20A 5CA0B 3LWUA 2F0IA 1D1NA 2FL4A 1E79A 2VUMG 1XNQB 2EPBA 3WB1A 3SDLA 4LF8O 3PIP3 4XDXA 1TXYA 5ELFA 4DK0A 2OT2A 3C1FA 1EFID 3HKSA 1AJPA 3CCJV 4K6DA 4DR7O 2K04A 2Z4IA 5H6RA 5EIBD 5E4XA 2ODMA 4DV7L 2WZPP 2CRVA 1I18A 4KKTA 3NQTA 3RD4A 4DUZQ 1UEAB 4GOPA 3H3VC 3R6KA 3HKCB 1P7GA 1PM9A 1Q9SA 1RCVD 2E8GA 2KECA 5THXA 4HR7B 2KCMA 4YCWA 4CJ2C 5A2QL 4QIWB 5B1BC 1SYEA 3MEFA 1VQKV 3BYYB 2N05A 3T4AC 4HIMA 2WLKA 3MXNB 3UM7A 4WBNB 1Z47A 5DN6G 4QL5A 5KUMA 1H2KA 2V7QG 3CCUB 5M3MG 1Y1VG 2DWEC 2FJ2A 5T1GA 4X89A 2C5BA 2F03A 3H3VI 5C8YB 1DD2A 2JA6G 2E2JB 4TT3A 1OCOB 2YTXA 3QB3A 1M9NA 5GV8A 3BZDB 1N32L 2MJ8A 1V54C 1M93A 1YI2B 4CH5A 2BM1A 4DR4Q 3FRPB 5IWAL 1BLIA 4F7XA 1MSWD 3OKXA 4IIJB 2UU9B 5BY1A 3JSNA 4BY1G 3HKCA 4ZKCB 4CZZA 5BZBA 2EY6A 1YJWB 2Z6KA 2CAZC 1JCKB 1MJCA 1UE1A 1H9JA 3PA2A 1WTXA 3A8IA 4II3A 2QGQA 4QB4A 3CRQA 4H44B 3NSWA 2B9ZA 2P90A 4H37A 3WWVA 3ASRA 1BQQT 2NVTH 1WB7A 3PO2G 4YJ3A 1E1RG 1NH2D 5EIBC 3N6RA 1BPLA 5FL7A 3IC7A 1G7TA 1QNUA 1JJ2A 2E74B 3S2HB 5EBMC 1FXKC 3Q24A 3CCLB 1IL8A 1GM9A 1EIYB 3OD4A 3M99B 4GNXC 2F0LA 2QF7A 4EH1A 1UAPA 3T13A 5E3FA 1ZAUA 5L37A 3L70H 3HPLC 1WPBA 1BT8A 2NZ1D 2F0SA 2ZBUA 1YZ6A 3ZYYX 3KDFB 5FPRA 1SRYA 3CCJB 3TREA 2DYRC 1TR5A 2Z0AA 4DR2L 1PXUA 3A55A 1XMOB 4B3RL 2W6JG 5HFMA 3D6CA 5FO8B 1PZID 1VQ8V 5FO7B 4Y7CA 1SJHD 3PMFA 5IGFA 4KHPQ 1CSPA 1PNMA 1DOLA 2F0WA 3CHBD 3KBGA 4R4OA 3KJPA 5IYDO 1KECA 1FJGQ 3Q4HA 3GTGB 2X6YA 4DV1B 2X6WA 1NUCA 3ERQA 2UXCL 1WP7A 3HP3A 1WOPA 5C3XA 1K0RA 3NQIA 1GAXA 2YTYA 2Y0SB 4Z4YA 1QLEB 3F1ZA 3T1YO 1LO5D 4NXMO 4QUFA 3HOZG 3LSUA 1TTTA 1KC8W 5JVH3 4LF4Q 1IXMA 3CMEV 4J7JA 5LYJA 2LMCB 3A8IE 4NPSA 5DAUA 3CCRB 1I4RA 2A68D 1CKMA 4WRDA 5AJ3L 3BDLA 1R6NA 3K8AA 5KHJA 1VQLB 1BKBA 3J7A5 3JAKB 4UZFA 1VP7A 2L12A 5CV5A 2UU9Q 1PZJD 1RQRA 2RDFA 1PYWD 5GW7A 2F0TA 2JN4A 3CCVV 3W2GA 2VS1A 2AMCB 2ZL7A 3E9IA 4C3HB 4OO1G 3O65A 4R7CA 1V1PA 4MT8A 5IK2A 4YIJA 2XZLA 1GTOA 3STZC 3N2GA 4O4LA 2OTLB 4YJ3B 2K52A 3UDGA 2ZL5A 4FLUA 2QTLA 1PTOC 4A93G 4CC5A 2R7ZH 4KHZA 4QJFA 4H13B 3TSSA 2HP8A 3D3RA 4A75A 1PKXA 1CSQA 1JMKC 5TISZ 4QMGA 3ICEA 3DWQA 4H0LB 1GO3F 4C3JB 2YXLA 3I91A 4X7DA 4UHVA 3MHSC 1GD7A 1S72B 3A8KE 4ZOLA 4XQFA 5KA5A 1JMCA 4WJ3M 5C0XH 1ZM9A 1IBKB 4R4IA 4YAOA 3J81i 4GNXA 1HNZQ 4JI6B 4A3EB 1ESFA 3S1QH 2Z3YA 4LBWA 2Z5UA 3NTKA 1B3QA 1GUWA 2DQ0A 4MVUA 2IW5A 3T1CA 4C0SA 1VQHA 1FXHA 1WCMG 4NMZA 2CH4W 1K5SA 1ZLZA 1I3QB 4I7AA 3QTCA 3UKMA 4TQFA 1FD9A 1CPYA 1O7LA 3Q23A 5IJ0B 1X54A 1RQPA 1WOOA 2QWQB 4QHYA 4I9QA 2WKCA 3J7YW 2ILMA 1T6ZA 3J81k 2IPKD 1O80A 1GM8A 3OR7C 4OEMB 5LGNA 5LMUQ 3I4MG 2R93H 2JK5C 1W59A 3ZBTA 4A3IH 2A0LA 2IT1A 1Y1WB 2R7ZG 2PI2A 1TAEA 2DJGC 2ZXOA 3KLWA 4G7HC 2E1BA 3BEHA 1GAQA 2W0FC 1LTBD 2C35B 2RCVA 2E2IB 1SA0B 4NNJA 1O78A 4GNXB 4FN5A 4PDLA 2BE5D 1II3A 1KC8D 2CDYA 4DUYQ 2BE3A 5H5NA 2K5VA 4G28B 1NE3A 3E89A 3V96A 4WFEA 1WNSA 3TETA 2K28A 4EQ5A 2VBUA 2B63H 1IJEA 3R6JA 4A3GG 5GAEC 2KOLA 3BG3A 4N21A 4JV5O 3FKIH 1EY9A 4FF3A 4JI0Q 4HIKA 4Z1MA 5KYIA 3L73H 3ABLC 4A5UB 3W1GA 2JXMB 4RD0A 1JA0A 2Q2HA 2OF1A 3OZWA 1I4HA 1QBZA 1N32Q 2HLDA 3ZHUA 1H8EA 2LZJA 2B2TC 1SYCA 4AQYL 3CCVA 1RDPD 1FVIA 2K14A 2EBOA 2XIWA 1HZBA 5D14A 5C3WA 1H8HA 5FLXL 4G57A 3GTJH 2FVGA 4M8AA 1V54B 5IT9N 4JI7L 4CS2A 3W2IA 3B8HA 1NVPD 5JEAJ 4RDKA 4B3GA 1SFOB 2QEXA 1COWA 1Q7YD 3I4NH 2JSOA 2Q6LA 2WR8A 2MPMA 4XM3A 5KNCA 1LYLA 1NTGA 4O0AA 2PO4A 1QUQA 4IFDJ 3FPPA 2N74A 2OIEA 2E2HH 2P22C 3QOLA 3CP0A 2K5HA 1Y8OB 4DV3Q 5IYBH 1PV0A 1F7YA 2A6EC 2E76B 4RPBA 2EDGA 3GVJA 4QY7A 1ASYA 3ETGA 1VQ6B 3FKIG 3TQYA 1QVGB 1X3GA 3OUSA 1FAFA 3RZDB 1A62A 4DR7B 1EEFD 2AXTZ 4QVAA 2DY8A 1NMGA 2K5DA 1WTOA 5CA3A 1KQSB 2AWOA 4LFAL 2JGDB 4P73A 1OGJA 2FX3A 2R72A 3AG2B 3SYOA 4JYAB 4A3FH 1EEID 2NTTA 2MNAA 3ASNB 4TMTA 2K03A 3CCMV 1YJNV 4DW1A 1TS3A 5LMUO 2F4IA 3SR1A 4B3RQ 5K1XA 1AP0A 3MEHA 1Y8NB 3S24A 4LFAQ 2ZM6L 2YDEA 1B9MA 4AYBB 2XVSA 1VF6C 3QVNA 5C0XJ 4S3SA 1VS0A 3RYCB 2I5HA 2JA5G 2CWAA 5AFWA 3CCEV 5CYUA 3B8NA 5IYCG 1P84F 3A74A 2LY7A 4A93B 1TWFH 3QO8A 1YIJA 3CEIA 1KMHA 4P26A 4ZUJA 4RQEA 3A5UA 4F6EA 1O7YA 1TUIA 3SR2C 3WBKA 3WYAA 3CRRA 5C44B 1PA6A 1TWCB 3OHXC 4P72A 3GTMH 4DK1A 3JASA 2F4VQ 2WLNA 1FS0G 4KY7A 1Q82D 4AHCA 1R5OA 2WLJA 2A8VA 4HJAA 2VUMH 3E22A 1C48A 1TKWB 2TSSA 1H9KA 4RO2A 3F8TA 4QNHB 1NQTA 2JS5A 1Q8IA 2GJKA 4FLXA 1JPXA 4FLZA 3AGPA 2L15A 1AB3A 5LOVA 5LP6A 1VQLV 2PZTA 3RYFB 2I46A 4B08A 1MBYA 3CRLC 3L71H 3PUWA 4DUYL 3CMAB 4JOIA 1G2TA 1FFXB 1QNMA 1K0SA 4DR5B 1W2BB 2RJZA 2CKZB 1TWHH 2OTLV 4LUZA 5EKKA 1YHAA 2Q2TA 1K8OA 2R9VA 3BCCH 4Z4RA 5KA6A 4DR5L 4Y7NH 2JA8B 1JA8A 3E6ZX 1RF2D 2JDIA 4K14A 2D3OW 1T9HA 1S40A 1YHBA 4TV8A 1ZX3A 1Q5OA 3JU4A 1D1IA 4Q20A 4ZRZA 1DZ1A 5M5XH 1XQBA 2CH7B 1AI5A 1VQ9V 2LW1A 4X64B 1CNEA 1IYUA 3WDNA 3SVMA 1Q3EA 4O4JB 1B1ZA 4ZCLA 2B2UA 4DV6Q 3GTOH 2XNCA 4JBJA 5IJ9B 4WWVA 1IHZA 1VQ4V 3ZCCA 3G67A 1G8ZD 1NS1A 3RT3C 3LVBA 5FOBB 5JEAH 4OX9O 3A0JA 1GMGA 3JAWA 2D5DA 3S3WA 4JYYA 2ZTGA 2EIKC 3CCJA 2OIGA 3I3CA 2I5MX 3DWAA 4A3MH 1NJID 1TS4A 1KKCA 1MD2D 1VQCA 2AQ1B 2QTSA 4H7BA 1ENCA 4LF6L 3JARB 1N33O 2LQTA 3FPKA 2XGJA 2F52A 4HIZA 2P7TC 4LF5Q 1NTZH 3H94A 3ASQA 3JSLA 2WA4A 4A3KH 3GQBA 4P6YA 4E6IA 3VBBA 3HRZC 1VQIA 4UFZA 4H33A 3BNWA 3R8BA 1VQPB 2ZM6B 4K0KL 5JJKA 1EZJA 4EFEA 3JASB 3E1YE 4ZV4A 3GO5A 5LA6A 4BBRH 4U7NA 1PRTC 2CTRA 4B3TL 2ZXWC 1MHWC 3VQXA 3WG7B 2L1BA 5JJLA 2RCNA 4PELA 2EJMA 3ISXA 3M4YA 2O5IC 1GUOA 4EB6A 1CFMA 1QR8A 1XQ8A 1RSOB 4ZCIA 1A3VA 1D5MC 4UAJA 4AQYB 4DR3Q 1AJQA 2C4TA 5EMNA 3NTHA 4FVMA 1HP8A 1QGZA 4Z4UA 1CM9A 1B23P 2A6ED 3MXNA 5GONA 4R9WA 2VUMB 4JI7Q 1TS5A 4P1VA 2NLJC 3OTFA 1XXGA 2B63G 4AIMA 2ATWA 3UI2A 1YI2V 3AYHB 2IX3A 4DR6Q 4JPBW 4J7ZA 1S5JA 4QVJA 1ZWIC 1KLGD 1I7FA 3BAAA 1GK9A 2G9DA 2AZ2A 2KA7A 3NXWA 4UP8A 2FKXA 3MXUA 3T1YQ 3CS5A 3VQYA 3QE2A 2Q7GA 3V76A 1EZ6A 1W6JA 2B2WA 4MTGA 4N3GA 3VYSA 4WFN3 4ZKBB 1M1KD 1QJOA 3ZHTA 3I4MH 1HFNA 1LV9A 1UFIA 1BGYH 2IM9A 3HKBB 1NH2B 1XL6A 4KP4A 3R2IA 4IZ8A 5KHGA 1SE3A 4OIJA 2UXXA 5IWAO 4DR6B 2L9HA 5JVG3 3GTMB 2Q8IB 5ELCA 1OZ0A 2F4NA 3BA9A 4XD7A 4XONA 3CCLV 2KJXA 4JI4B 3AG4B 1PJ6A 1H9SA 1R3LC 3BY6A 4GZRB 1XNRQ 4G7OC 2H5XA 5J9PC 3E2EA 3OJXA 2F93B 1SA0A 1VQ6V 1I08A 5CR3A 4JI1L 5C0XG 2P5OA 1K8GA 3NPPA 4JI6L 4DR3B 5KW9A 3LNMB 3E5SA 5K1PA 3SHLA 1JB7A 4O2BA 1OB0A 5JJJB 2CTPA 1URFA 1SQBH 4GKKQ 2B2YA 1UD8A 4PABA 4DU9A 4K5WA 4C2MH 5C3EB 4JPRA 3PUVA 3EVKA 5JPMC 3STBD 1ENAA 1TU2B 5C4JB 4LBZA 3ABKC 3M85A 2KCTA 4PI0A 4JGSA 4IGGA 4ZHQA 2GV9A 3W7TA 4DV7O 4YAUA 2Z4HA 2A7WA 3ZBHA 4BY7H 2MGSA 1A63A 1BCPD 4XR6A 4MIUA 5IGCA 1Q6HA 2V4DA 4NR1A 1W9XA 1MG1A 4M2LA 4YCVA 1W0KA 4YXWG 5IP9G 4ME3A 3RN4A 4IN3A 5IGEA 1YHQA 4IJHA 4EQOA 2MHVA 1SEBD 3P3NA 3OAAA 5GONB 3K04A 3OMIB 2KVMA 4X9QA 4A3LG 4C3IG 1XNQO 4H13C 4OIKA 4DAYA 1F23A 2G5DA 3QF7A 3JAML 3SPIA 3J7AV 2HHHQ 3JCUZ 5B1AC 2A69C 4LFBQ 1WTHA 4XOTA 4RH6A 3HKDA 3OMNB 1M8AA 4JK1C 4ABNA 5GAGC 4PDVA 2OXPA 1D5AA 1OGIA 3W3AA 2NVXB 2XRSD 5M5XB 2DN8A 3CCVB 5F2DA 1KRHA 3BYTB 2EYMA 1AI7A 1TIID 2AHZA 4FYDA 2UUCQ 3FDTA 1CKNA 1X6OA 1D5NA 1PV4A 3ZMVA 4RPDA 3F2DA 3KKYA 1JJCB 1XHXA 2UUAO 4DR4O 2B39A 3BZCA 3ASNC 1IBLB 1ENVA 1V5VA 1WP6A 1NCVA 3TBIB 3OT7A 3A0BZ 4JZGA 3J7AU 3M9BA 4NXNB 4G7ZC 4JI0O 2ZCEA 1EP2B 4J1MA 2LFSA 2NNUA 4JBKA 2LS01 2ZR2A 1JOYA 5EBWC 2VB2X 3KUPA 3S17H 3CC2A 2A68C 4K0KQ 2LFRA 4JI5B 2ZQMA 2N78A 2L4NA 1WJJA 1YSCA 1C9OA 4EB6B 1KNAA 2OBRA 4B44A 2E76C 3M7GA 4TVAB 3TS0A 2OCHA 1GOZA 4TOIA 4LF6Q 3MHBA 3VA5A 4YALA 4XOPA 2UXDO 3U10A 2Q68A 2RVLA 1K9MC 2HLDG 1YITB 1X3FA 3HOUG 3JCZA 5C6AA 2XAQA 4GKJB 1N36Q 3HOYH 5BR8Q 3I7FA 1M90W 3ETQA 1K5QA 3OAAG 4RLZA 2ZJQA 1TWFB 2R9IA 2HT1A 3PF4A 2ITCC 4YXWA 2OTJV 4J6HA 2X6CA 3CC4B 1SBBB 1S77D 5JH7A 4A3BG 1FXVA 2Q7HA 2P3MA 4CH3A 3LQ6A 3NTIA 3T1HL 1YF2A 1EN5A 4PC7A 2NVXH 4ZK9B 1HW7A 1K83B 4XBFA 2PGGA 2QEXV 2FMLA 4X65B 1A3UA 3OYYA 1MZEA 5KIXA 2Q73A 4YY3Q 2YWGA 4UP9A 2KG7A 1FRNA 5GAHC 3CSXA 4X66O 1VQPV 2B3GA 1NNXA 1RHPA 4LF7O 2D9RA 4LBVA 5KHKA 2XHBA 3W5HA 1FFXA 4D7SA 4M4SA 2EY5A 2KENA 4ZQ3A 5IYBG 1Y76B 1KRSA 5IT9L 3TXSA 3CMAV 1HNXO 1CI3M 2OQ0A 1SS3A 2Z9HA 1D8TA 3F7VC 3RZDH 2NN6I 3U6KA 1Q82W 4KY6A 3A8TA 1SQQH 1VQMV 3BC9A 2KEDA 1H2MA 2PYLA 2CH7A 1SYDA 1DOKA 1E3XA 1NTKH 4OWXB 2JA6B 1A2UA 2MK3A 5C4JH 4J8QA 1O7ZA 3RLNA 1H42A 3TS2A 4C3HH 1K9MD 2QEJC 3APQA 3LDCA 1ML0D 4A3DH 5TSSA 4EVOA 3H01A 1HR0O 2Q2IA 4X6AH 1KTKA 5JVDA 1QG0A 3Q38A 3CW2C 4I5SA 2ZXRA 5IDJA 1UEBA 5M5WH 3GWKC 5ELOA 4M53A 1QX4A 2SNMA 1I7PA 2X6LA 3C1EA 2JA8H 4JAAA 4Z1VA 2QA4B 3B77A 1WFQA 1ZTEA 3UO3A 3ULPA 1HJPA 2O57A 1PRTB 2UXBO 3CJHA 3P75A 1LTRD 3J80c 3K7UC 2E5LQ 1HXYD 1ET6A 3D36A 4UV8A 4DYLA 4DPGA 4ILWA 1ORQC 1VQPA 1TVCA 3H1LH 4LAAA 2AKWB 2YWHA 3G48A 3UQ8A 3BVZA 3I4MB 1EY7A 1EQRA 3QR8A 2WAMA 1F9SA 4J9ZB 2ALYB 4JC0A 4DV2O 1NB0A 5CV9A 5LGTA 2ZXPA 2LO1A 1YZBA 4UZUA 5HKKA 1F20A 2VBSA 2B1GA 1V43A 1YNJC 2FHTA 3VA7A 5LMNQ 2DNCA 2K6AA 4K8XA 5B6IA 1STGA 3B8MA 4JI8Q 1GXDC 1GUSA 1S3JA 4RUEA 1TWGB 1KQSA 1UWVA 1XI1A 1KIXA 3TCUA 2K5NA 3W7SA 2DJFC 3ULJA 5LHGA 1V0FA 1CZWA 2Q0AA 5A88A 4ZCMA 2CK3A 3D0FA 3FVQA 4MTFA 1Y6XA 3DEOA 3VYTA 4DXGA 1F9RA 1D2BA 1KP3A 4IYIA 1KQSU 5EJWA 5EPJA 1IYVA 5KX5B 4P25A 1E1TA 2AUJD 1R4QB 3GTLH 5EGTA 3J81j 4TKOB 3L2PA 1XREA 5FA6A 2B29A 2A74C 3ZX6A 1QVGU 2CW0D 4AH6A 1G6UA 2XNDA 3L3OC 1IBMO 2BDNA 4C3HG 3ZRWA 1F4MA 1AEXA 2ICEC 4AC9A 1EY4A 4ICGA 1HZCA 1VF7A 5CB4A 1FNDA 4EQNA 3A7AB 4A3EH 3S1QB 1QGAA 2JVDA 4PJ0Z 1M4VA 5E7NA 3DXRB 1LM0A 1SYFA 4A3FB 4K35A 2CTQA 4TWKA 1VQNA 1ZM4A 4P6VF 4OPHA 4WCEV 2Z1CA 1S5FD 4C1NK 1GH6A 1U4LA 4C3JH 4YJ2A 1WTWA 2JP1A 2JDIG 3UO2A 4RKBA 5A35A 3RYFA 1LACA 2BSAA 5JH7B 1OB2A 3KL9A 4FP5D 4FM0A 4UCOA 5JBQA 1RJTA 4DUZO 1K4DC 2CW0C 4OGQC 3HGBA 2K5WA 3D8CA 2HR3A 3HKBA 2LXKA 3SPHA 4LFBL 4I50A 2A1AA 4K6LA 4A3LH 2B8GA 1JJGA 5EAYA 1ZYRD 3UDXA 1GKFA 1VQ5B 3LGJA 1G91A 2EZOA 1OCZC 1Q90D 5IT9E 2UUCL 1FXKB 1G8MA 1N4CA 3S1MB 2BA1A 1B7YB 3SYQA 5IE8A 5IP9H 1SFOH 1Y14B 4FLWA 4ROXA 1EYGA 1STEA 2X69A 4GKJL 1VHEA 4LNUA 4F7DA 3DSQA 1JJ2U 4G7XA 5M3FB 1UUPA 4PMBA 3KCXA 4FLVA 2XASA 4G5GA 3CB2A 5IYDG 5C0XI 4K8IA 3G71A 5I2YA 3S1MH 2X6XA 1EU4A 2OK7A 1UD2A 2GJRA 4JI3O 3CRCA 3K5OA 4TT3G 5IE9A 3OTOO 4RGNA 3S15H 2EIJB 1D2DA 1Q1BA 3FFQA 4JW0A 4P9OA 2WZNA 3CXHF 4NYKA 4DV5B 3CCQA 3J80L 1M1KW 1J5EO 4LF7B 3FKIB 4IHJB 4P75A 4AI8A 4KLKA 3SJAC 2OTJB 3PUMA 1N05A 5C4ZA 1HA5A 2CQOA 5CV8A 3RN2A 1PH8A 3RZOH 3PO2B 1XUQA 2WLIB 4LF7L 3S15B 4RD4A 1X4TA 2QTOA 3EFXD 4X66L 1HR0Q 1CP9A 2EZPA 1V8QA 5IYZA 4WZTA 1NR2A 1LUVA 4CKEA 4IUPA 1B2RA 4B3MO 1E3ZA 1A15A 2B8FA 1DYQA 2F0GA 4GYCB 4DRXB 5C44H 2QDOA 3ZN1A 3ICXA 1FD7D 5I9PA 2D74A 3T1HO 4A3CG 2PZWA 2JA7G 2WAQG 2HDNB 3AVUA 4KV6A 1KK0A 3S1NH 2UUBB 1WVLA 4DR3L 1TVKB 1WDTA 2QN6A 1KDAA 5C4XB 5KAFZ 2X8KA 1XBLA 1GUNA 1KNEA 1VQBA 3DDYA 3OE7A 4DQLA 4X62Q 3HOUH 4IURA 2PMDA 2DETA 1WTPA 1CA6A 5H9CA 4ASUG 1B70B 3D26A 1CK1A 1KD1D 1PJ7A 2UXNA 1BOSA 3J81E 5FIUA 1G2SA 2UXDL 4TSFG 5HXBA 3HKEB 4PC2A 5IT9c 1EY0A 4EX5A 4TV9A 5IGDA 3R93A 4KUMA 3CCSV 2K75A 5H6QA 4EEQA 1BMFG 4JI5O 1I94L 4NP5A 4A3GB 2WINB 3SK8A 4W4LA 5L3GA 1IBKQ 4WZKA 2N3SA 3F7YC 1F9QA 5A2QN 3OEEA 1PFMA 1ASZA 4I9WA 1N8RW 4BY1H 4BW9A 4MVMA 4NXNO 2CNDA 1Y1VH 2XZOA 2IX1A 1SQXH 2YC0A 4JI3B 4DXWA 3OTOB 1DONA 1H8HG 4QGUA 3K06A 5FNZA 3K9SA 4DR4B 3BVMA 2R6GA 2O4XA 3D4RA 4FDBA 3PV0A 3WNCA 3RLFA 4XQQA 5DS0A 2VXWA 3J7ZC 1I94Q 5JCOA 4LBYA 4C7UA 1R1BA 4PGOA 1EFWA 2D2CB 2UUAL 2Q8TA 2E2JH 4UZEA 1KD1C 1SAPA 1XNRL 2QWPB 3ZPNA 3M7MX 3M4QA 2F0UA 5IY0A 2UU9L 2E2HB 3SDZA 1CUKA 1RTOA 3ASTA 4Z1MG 2DY7A 4PC3A 3W7UA 4HTHA 4YEJA 5HGQA 4CDFC 1F77A 4LF9L 2EIMC 1XNRO 5IIFA 5KUKA 4XMYA 2JA5B 3ZRVA 1N08A 2EYFA 4JI4L 3G80A 4LF9B 2OBSA 5IYBO 1SQGA 1EFUA 1MABA 4ZGNB 4DUZB 3Q6RA 1ZUQA 1M90D 3GTJB 2DOGA 4JI8L 3A3BA 3GDEA 3L75H 4H02A 1DTOA 1GUGA 1ZL8A 2M5SA 1U4PA 1EYDA 3H6MA 2G38A 5EKIA 1NDHA 3W2EA 4I7ZB 4ZI7B 4LWSB 1XNQQ 2HVJC 4E0FA 3CU7A 3JD1A 4O4HB 2KHSA 4JI5L 4DV0B 1YXBA 5EYPB 1K8AW 1XTCD 3FB8C 4EQPA 4TUYB 1BCPF 2PF4E 5TR9A 2X0KA 4YWMA 2B63B 3E8GA 3ZMSA 3VO2A 3CRAA 2WIIB 3OIPA 3ZZUA 5H2FZ 3JQPA 1IBMB 1F2YA 1K3RA 3WQZA 4YWLA 1VQAA 3K79A 4AYBG 1R3KC 2QR4A 4TV9B 3UCSC 2Q6IA 1KBHA 1XFOA 5CBFA 4DR3O 4HAEA 4BA2I 1BHBA 5LMUL 1IZ3A 1THZA 2E2IH 3IFXA 3T4ZA 2ZZQA 2F0VA 1P16A 1Y1WH 2OTLA 4JI2L 1RL2A 5ISRA 4YY3O 3Q0AA 4UVBA 2ASBA 1NR7A 1B44D 2R70A 4NB5A 2PYKA 3D8GA 1LR1A 1W87A 2ZXIA 3KLRA 4B3ML 2K7VA 1XOUA 5TY0A 3H1KH 2Y4TA 4U673 2OTJA 2K32A 2B1IA 3SYPA 3WU2Z 3W5VA 2CQAA 4TUYA 3CPFA 1S4ZA 3SYCA 1VQ8B 3TN2A 2CFMA 1J5EQ 1Y69U 3BHPA 4A3DG 1FPOA 3H1IH 4OPOA 4B43A 1CQFA 1HPCA 2AQ2B 3UE1A 4DV2B 1HZEA 3PJSK 4XL9A 5IYNA 3R3OA 1N33Q 1JFFB 3OJWA 4G6IA 1YNNC 4TN1A 2L35A 1SDFA 5FO9B 3RGBA 3CC7V 1QLEC 1VQ5V 3WB0A 4IW3B 3I1FA 1DXMA 4L63B 5D3IB 4JI3L 1AW7A 4F87A 3OTOL 1R9TH 2UXBB 1AVMA 1YDXA 1TGOA 2RCFA 4K5XA 2XUMA 2DYRB 4BIZA 4HE6A 3CMEB 4XQJA 1VQ7A 3H09A 4LWCA 2HG5C 2A06H 1OHHG 1NY4A 3ZIAA 4O42A 2W0XA 2CC2A 2PNRC 4UDUC 4HSPA 5IGBA 4HNAA 2ZE5A 3I56A 4O2AA 1N0NA 4NVPA 1KDBA 4AQYO 4K8ZA 3HKEA 4XNFA 2XN9C 1ILPA 3OEHG 5CBGA 2PI4A 1SETA 1KK3A 4FXGC 3A56A 1HHVA 1RODA 2OT5A 3K5NA 1EM1A 1B53A 5CB4B 2CVRA 1BF4A 4LFBO 1I4GA 1PTOH 3HZXA 5FNVA 3JYCA 3BFRA 5B5EZ 1BBWA 1IBKL 1IXRA 5BN5A 4C3IB 4DUZL 3IFTA 3PSIA 3TEHB 4XLAA 2UUBL 5FO0A 1WB8A 3FHWA 3ZZ0A 3S3XA 2ZZEA 3SKBA 3DMUA 1SNMA 4R8NA 1SE8A 2EIJC 3Q4HB 2PZSA 1IURA 1HDJA 2E74C 1VQOV 4UPAA 4NTXA 2JEBI 2ZKOA 2F0JA 4KTAA 1Y8PB 4J0QA 4LF4O 5CMUA 1UD5A 1HNXB 3U4VA 2QKAA 1OCOC 1XHZA 4X8AA 4X65L 5IP7G 2DYIA 4ZLTF 2XTAA 2JJ1G 3K9AA 1VQ7V 3CPWB 3CCQB 3WXMA 2TMPA 4RD1A 1O9GA 1QWYA 2GJPA 3ONAB 3Q22A 1I6HH 1Y66A 2X3UA 1FRQA 4HAMA 3CKIB 3AG3C 2Q8RE 3G7LA 3ND8A 1JJ2B 4O1NA 1PH1A 2NVYH 2KCCA 5K36H 1FDRA 3ZJZA 1XL4A 1M56B 3D4WA 3OW7A 4JI1Q 1HA6A 1WU8A 3WNBA 4HEDA 2B2VA 2LFNA 3RR5A 1QUQB 5CN0A 3J81c 3GV6A 4BBSH 4AF7A 1VQNV 4O4IA 1I4XA 3I90A 4GKKL 5L3BA 3CX5F 2B7BA 3HOVG 4I50B 2GHYA 1KMIZ 2I1LA 2R9AA 1U0LA 3I70A 1JT8A 3OGIB 3HEJA 1FJGO 3RY8A 1X3QA 4KD3A 4DR5O 4FF4A 1VQ6A 3I55A 4QJFB 2ZL6A 1KZLA 1EOTA 1SXTA 4FFBB 4NW2A 2QGNA 3FKSG 1KK1A 2WV6D 1X32A 2DNEA 3QG1A 3WOFA 4LNUB 2AHYA 2ZXHA 2HCJB 4N9TA 4DFAA 2JEUA 1AZQA 4PNYA 2HMAA 4WFHA 1MSGA 2EFGA 1DF4A 3WB2A 4I65A 1TT2A 3A8JA 1PH5A 4A3CH 1TLLA 3DM1A 2JA7H 4AILC 4FXUA 3BU2A 1F51A 4E2LA 1EXMA 3W5UA 2ZM6Q 4P22A 1Q86C 1HUNA 1X65A 1BBXC 3MXGA 3S14H 3Q39A 1E24A 4X1IA 1STBA 4MVQA 2HDMA 4JI2Q 1EQVA 2RN9A 4OPAA 1HNXQ 1IBLO 2XNJA 4Z4VA 1X56A 4ZBMA 3SEBA 1E43A 1AILA 4ULLA 5JQGA 1TVXA 1VQ8A 5IP7H 2ATKC 4B3FX 4DK6C 2F1MA 4A3KG 1VQLA 4UP7A 2YTVA 5H5JA 1MA1A 4GN4B 4HMJA 4XT1B 2Y0SG 1T6XA 4YAFA 3J80N 1H9SB 1L0NH 1JCHA 2RKSA 2E3CA 1F2LA 4BBRG 1PH6A 1YITA 2UXCO 4FWTA 3BDCA 5TV2A 4X64Q 3GTKB 1CTMA 1E2WA 3PUZA 2PQEA 5J1ZA 4DV7Q 2RA4A 4HCSA 2B5OA 2LP7A 1YX2A 2BM0A 4P74A 2VNKA 2YXYA 1XYIA 4XLHA 3TP6A 4NDXA 3U9SA 4ZCKA 1SLJA 1NU1H 1Q6UA 4O2BB 4DR2O 3DGEA 1QLNA 1Q43A 2Z6BD 4AVZA 1HZ9A 1AROP 3AG2C 1HQMC 3MWYW 5EPKA 3TP8A 3FMCA 4RCZA 1QR9A 1UE7A 4HBNA 2R7DA 4LW1A 4DR5Q 3SJCC 2E5LO 1YNXA 1WA8B 4FPPA 1R5NA 3PIOA 1IW7D 4P30A 4C3IH 3GB7C 4QCLA 4XLFA 5C3EH 1J5EL 1BCCH 1BS3A 4UUJC 1EP3B 4YIOA 2V7WA 1DARA 2P67A 1STNA 4CDDC 1FNCA 1QG7A 5L3EA 1YJNA 1K3BC 1GVPA 3KG2A 4JYBA 2OYQA 2L0CA 2OEOA 2QWNB 5CBAE 3ZS8C 4X88A 3K7AH 4GKKB 1Z9FA 2EULA 1HNWO 2K01A 3SYAA 2ZD9A 3K0XA 4KN4C 3AG4C 3DC5A 3MC0B 3ZHQA 4FIPC 4LP8A 1SF9A 4WBNA 4X1YB 1YJ9V 1UD6A 2OQKA 2OK8A 2MP1A 4CJ0B 1PH9A 1L0XB 3HKDB 4LBEC 4QIWF 1ZL8B 2ZITA 3IFDA 3RMHA 1J6QA 1VQ9A 5LXTA 4MVZA 3ASPA 2J4XA 1PP9H 1R3JC 5D5QA 1LTSD 2CH4A 3KFUA 1SE2A 2H8PC 1Y1VB 4DR6O 5CMDA 1U97A 3JAMc 3HOXB 3MTSA 1VQKB 4WF9V 4ZKIA 1D2EA 2VZLA 5CV4A 1AMOA 3IGAC 1D5ZC 1L2FA 3MFYA 3GP7A 1XDCA 3A54A 2PW5A 2GDSA 1N32O 3H1HH 3A2FA 1I94B 2KUMA 1GM7A 2DY1A 4P12A 3G6JB 1YJWA 5CDFA 4WZLA 4QUZA 1AI4A 1KHIA 2W6IA 2YXHA 1FR3A 1TWAH 1F2ZA 1XTDA 4DQKA 5IYCH 3FB7C 3U2QA 3G71B 3RUZA 2J7KA 3APOA 3JD0A 1GAWA 3ZN0A 1WJZA 3P27A 2BPOA 4LWSA 1QB5D 5KEEA 2NVQB 1TY0A 1U4RA 4WORA 4DV4O 3HAGA 3NHHA 5LL6S 4YCUA 4DV4Q 4DR4L 1B3AA 4IUQA 4FXKC 4ODGA 3VR3A 1OTCA 3TXQA 4Z4SA 2JIZG 2F3IA 3RFRA 5KMGB 4DV3L 3ONUA 3HOVB 2HHHB 3A5ZB 1EL0A 1CZGA 1Z5WA 2C78A 4JBWA 1PL4A 2KHJA 1H2NA 3K08A 3KCYA 3IL8A 3TP5A 3B40A 4IQZA 3OGCC 1WPXA 4L8JA 1BMFA 2BV3A 3BCDA 3P26A 5IYRA 1B9NA 5I6WA 2VNHA 1LT3D 1RKNA 1HH2P 3NR7A 1N36O 2B5UA 4LC1A 3BVOA 4QGPA 4KHPO 4TSFA 2ZTEA 3SJPA 3AU7A 3D3QA 2EIKB 3K59A 1J8IA 1WSVA 2MW2B 2ADQB 1NSNS 1N06A 4OPVA 3OE7G 4XLEA 1PYBA 2L11A 3MHHC 3SPCA 4B3TB 4II2A 5BN3A 2EIXA 2BOBC 3UDFA 1CT1D 3N2KB 2ZT9B 1GN3A 1SN8A 3P20A 2D62A 3ML0A 1N33B 4Q7JB 4LR3A 2HEPA 4MVRA 4DV2Q 3CPXA 4IPDA 4N3NA 1I4QA 5LMNL 4OXSA 4CH6A 2XT9A 2FTKA 5LHIA 1YVCA 1OCRB 3AG7A 4YHBA 2F4VB 2EE1A 1GN4A 1EN6A 2R61A 3ZHSA 2KVOA 1Q81D 3JD3A 1VIBA 2ADPA 4H9GA 1E2ZA 2MO0A 5M9OA 4A3JB 1VQKA 1QFYA 2V7TA 2R6HA 2QM7A 1PTOB 4HMIA 1KDCA 4XDLA 3FP9A 4YELA 1TA8A 5EZYB 5C93A 4X64O 3OW2U 4TMXA 4Z4TA 4BAYA 1EYAA 4GX0A 2BH8A 2BOSA 2EJFC 3KBXA 1IW7C 4JI1O 1I50B 4BR6A 3KF6B 1G4YB 1SC5B 4UCVA 2VYQA 2EYJA 5EK0A 2M9VA 1WTVA 2M6YA 1L0WA 3B4SA 3D4DA 5C5LA 3CMMA 1GN2A 1IBMQ 3SK4A 3V2TA 2C4UA 1QHTA 2P6JA 4JAUA 1VQGA 3T1YB 3N2GB 4O4LB 4ZIBA 4D7TA 1BX1A 3BY1A 1PRTD 2ENBA 1H85A 2HQLA 4GS3A 3TGUH 4CKCA 4X0CA 3H0GB 1NBWA 3HKZG 1A3TA 3KYHC 2K05A 4K8JA 3E22B 2XAFA 1TS2A 3NEMA 2F95B 4BY7G 4DV1O 4X7CA 2SNSA 3FYEB 4JASA 1UD3A 4M1UB 1HVXA 2JA7B 1VMGA 3KEWA 1ZSPA 1RM1C 4FNFA 4RQFA 4DAYB 2DQ3A 3FD9A 4IJLA 4HIOA 3HOYG 1AR1B 4JI7B 4P9PA 4OWWB 4IOAA 1GHKA 1U96A 2J7ZA 2NZOA 4NTYA 2HD3A 3RLOA 2E75B 3PF5A 3MMPA 3NELA 2BH2A 1XMOO 2AZ0A 4OELB 1STHA 2QA4A 4LMQD 4RD6A 4O4IB 3A1PA 2X0LA 1WOSA 2JJ1A 1AP6A 4KKUA 1VDZA 4DV3B 5D5PA 3RYHA 4DV5Q 2VQEB 3TJTA 3LDDA 1VLOA 3HOWH 3HFZB 3GWOA 1S72V 3G4SB 2EXZA 1IYJB 3HG9A 1KXLA 4YHHQ 1H9MA 2Z6KC 5M5YB 3E35A 1VQDA 4PI2A 3K81C 1JWSD 5DM73 1WTQA 1M90C 1EWCA 2UXBQ 1V55C 2HCIA 1S5LZ 2EOTA 4I0XB 1KP2A 2YI8A 1JNYA 2Q67A 5LMZA 2NB0A 4JG2A 1JE5A 4DUYO 1SKYB 2BSKA 1PLFA 1KYOF 3OPOA 3IJ4A 3SEJA 2D3NA 4YHHB 5IJ9A 4XYQA 1XMOL 3L9DA 3CCEB 2GK7A 3LUTB 4FJCC 3PO2H 2DYSC 1Y74A 2WJYA 3BS1A 4XT3B 3VNVA 2OCCC 3CD6V 5B66Z 4JYAO 5BSYA 1Y0RA 2LW7A 5LOVB 4HZ3A 3BJUA 3EA6A 3D36C 1M56C 3OOCA 3QNEA 1MSDA 2KQXA 3ZRWB 3CC7B 2D2CC 4UV9A 4DV1L 5LMNB 3OWEB 5KHHA 1OXVA 3HB3B 1K73W 1MZFA 2LJ2A 2GPJA 2Q6KA 4DR1L 1EY5A 2F43G 2QM8A 4FZ1A 4ZOLB 5H1SE 2YI9A 4WQMA 4H44C 4N8X1 2H4OA 1P4MA 4DR1B 1ZM3A 4B4DA 3JC66 2HQEA 5NUCA 1IVSA 1PNLA 5FJ8H 2GSMB 4Z2WA 1YCIA 4DV1Q 3A35A 3AEVA 2K9PA 1ZM2A 3G05A 3PN1A 2Q7EA 3CCEA 4RGMA 1QFJA 3CC4A 3EFFK 4PZ6A 3P30A 1P7BA 2VB3X 2KKWA 2RDHA 1C8CA 1S0VA 4RM0A 2B2VC 4G2KA 2IL8A 1S5DD 2JA6H 4MZ9A 4BPRA 3ASOC 3Q3AA 1LUWA 3AEIA 1Q8KA 2C5CA 1AI6A 4PC1A 3DWPA 4JOIC 4DA2A 4X7EA 3LSSA 4IL6Z 1YHQV 4NXMQ 3ABLB 4DO2A 4KD4A 3IAYA 2M7WA 4A3BH 4QQBX 1G6PA 4ZHQB 1D8LA 5LMNO 1P8LA 1Y67A 2IHFA 1H95A 1NR4A 1K28D 2EJ7A 4V0BA 2K33A 5A8AA 4LF7Q 3CPWA 2ZR3A 3W2FA 2LGQA 3URYA 4LF9Q 1TY2A 2EXDA 4NTWA 2R9RB 5HY6A 3E8BA 4M0LA 4JV5B 1R5BA 2BA0A 4NB3A 3CP2A 1KB9F 2Y0PA 1N0JA 2Q6AA 2WAQB 1IJFA 1N34L 4DW0A 2EJRA 3JALB 3KZIZ 3G6EV 1GHJA 3J81L 3I5DA 1V0EA 4RCYA 5E1FA 4DUYB 4EFBA 2GTSA 4KHPL 1IXBA 5KSWB 3WG7C 1V1PB 2NV4A 4R50A 1Y74B 4X3SA 1EIFA 3B6YA 3K58A 2IJJA 5DLQE 1IKLA 4OOXA 1PFSA 4DN4M 3JD4A 3KLSX 3WOEA 1RSOA 3ABUA 3GVMA 4FK5C 1SE4A 3I55V 2L55A 1MGSA 4IPCA 3CC2V 1VQ4A 1PH4A 3HOYB 5KYLA 3S1NB 3ABMB 1HFGA 3SPGA 3L74H 3CCMB 1YJNB 2FMCA 3HKZE 4DV3O 4Z4WA 4CBVA 3H1JH 2EILC 4LF4L 3K5MA 4OHJA 2EYLA 5A89A 1NT2B 1E3PA 5DM6V 2QEXB 1NRKA 1XMQQ 3MCAA 4G4KA 1IL2A 3PO3H 3VDYA 1MABG 4W4KA 1PTOD 4BWGB 5KNBA 5JJNB 2QWRB 5E1AC 1W2BU 1SNOA 2AHOB 3GV3A 4JI6O 1SERA 3ASSA 4HYOA 2K5QA 3DEPA 1IBKO 1FYCA 1A6XA 4CJ1B 3S17B 3EN2A 3EBEA 5AG2A 3SGIA 2HVKC 3G4SA 3J80i 3PQIA 3NWSA 4X62B 3G71V 1Y4MA 3L72H 2F0HA 3M7NA 3HOZH 3V7AA 3U11A 1WCMH 1QGYA 3CCRA 4L5SA 4QPKA 4XKWA 3GSIA 4POFA 3GTPB 2JGDA 3W2DA 4CQJA 4Q0FA 4FF1A 1E64A 3JAKA 2BDOA 5ELDA 5M3FH 2BSKB 2DJVA 3E9HA 5KRUA 3S1RH 2ZZGA 1BBUA 2L6LA 4G27B 3CTAA 1QILA 2BE5C 5M5WB 2JYOA 2DUDA 1OCCB 1ZUNB 2JA5H 3SLNA 1K28A 1CHPD 2AHOA 3KLSA 1HNWL 4XYOA 1G7SA 4PD4F 1G51A 2YS8A 3R66A 4DV5L 1AH9A 1IB0A 3QFRA 2F0EA 4J41A 2CUGA 4IUNA 2VQEL 1JX9A 1WN7A 2R92B 2KHIA 3I4OA 2GUZB 2F4VO 4RKLA 3JAMi 5LMNW 4Y9RA 1AR4A 4JAVA 4RD2A 1M57B 1D6EC
chains in the Genus database with same CATH topology
5J2TB 4NXMB 1QOHA 4I65A 3JAWB 1Q12A 2N88A 5BMVA 2VWKA 2V31A 3BA8A 3MVVA 2QKIC 4PHZA 3JARA 3VR6A 2PZUA 4KHPB 2WPDA 2XZPA 4Z9CB 1OXSC 2B2YC 4CC6A 3KF8A 5JVDB 2VWJA 5BMVB 1IKMA 1DJRD 3MAQA 2EYHA 4PQXA 4DV4B 4IIJA 4A3MB 2JJ2A 1FX0A 2F0FA 4P2CB 3S9WA 4FLYA 4FF2A 1SNQA 2NBFA 4QF4A 2R93B 4K5VA 3T56B 3QJYA 5KGUA 3MZ5A 5LL6X 4F6RA 1S5ED 1JOKA 2HCCA 5LYJB 2ICIA 1BDOA 3UT5A 5JJZA 3S1MB 4KN7C 3K6OA 4JI8B 3SJBC 5CV7A 4X3TA 1HNWB 3T53B 1LT4D 5J2UA 1F9PA 2JGUA 2AUKA 5KX5A 5BR8B 4UCRA 2Z8LA 1I4HA 4B9WA 2D3LA 2LKVA 5LP6B 2E5LB 1D5XC 4DNTB 1JWMD 3VR5A 1VJSA 4KL1A 1HCZA 1QCBD 4C56C 4XTCS 3V05A 1SQFA 1PRTF 4LF8B 5FNVB 3FPUB 2NN6G 4XQNA 4KJNA 1YNND 1H9RA 1EFRA 1SJED 4IFDH 5JPNC 2UXCB 3L7ZC 4RA8A 4DF7A 4MHEA 2B2TA 2PPBC 4L6TB 1DGSA 5KHIA 3J80E 2EYPA 1SMYD 2SEBD 4PV1C 1JOQA 4CGYB 1LLRD 2KCNA 5CV6A 2XSCA 5T1IA 3X3NA 2FINB 2XOKA 1M4UA 1TUBB 4O4HA 3K5LA 3THOA 5DEHA 5J2UB 5LHY1 5LXTB 2VUMB 1I4PA 2IW3A 2IX0A 1G291 1VLYA 2E2DC 2QILA 5I9OA 4JMQA 4KI0A 4QUCA 4PMWA 4UAIA 1NBMA 1JC7A 1ET9A 2NYZD 3MA2B 4JI1B 4KK7A 5JJEB 3GVLA 4A3DB 3ZEDA 5JQGB 1DM0B 1J9OA 4X1IB 1Z6HA 2MUYA 1WTHD 4BBRB 5M3MB 2YU9B 3E0JA 5KMGA 2R3ZA 4HCEA 2I07B 1JFFA 1YEWA 1ENFA 4LFAB 1BUVT 3EROA 4B3RB 1EIGA 4KMUC 2C9OA 3LWEA 1VMCA 1OXTA 4GLXA 5ITZA 1EY6A 1SNCA 4LFBB 1N36B 3DXJC 4C2MB 3I4NB 3BCFA 4IUVA 2DIEA 1M5IA 3QOJA 5IODA 3GTQB 2CHBD 1CQVA 4I4TB 3TDQA 3F2UA 4Y7NB 1SYGA 2A73B 2BCOA 1WCMB 2FMMA 3QG5A 3NP8A 1B2TA 1MSHA 1LTAD 2PCFB 4LH6A 3L9AX 5CBEE 4LF5B 5C4HA 4BS9A 4CH4A 1NAPA 4IUTA 3ITPA 1N32B 1C4QA 2B2WC 1U4MA 3CQZB 2XWBB 2IJ0A 4I4TA 4H0LC 5FPOA 4RHRA 4U68A 1K8MA 4RHSA 1OO9B 3S16B 4JI2B 4RGTA 3JALA 5HGTA 5JAVA 3O13A 1KAAA 3Q6SA 4R8IA 5D3DA 1G6ZA 1ZKOA 5FK9C 3NBIA 4FO2A 2PUSA 3SE0A 3OWFA 3C2PA 1BR9A 2QDBA 1LTID 3UT5B 4C1NI 4CKBA 1EIHA 1V9PA 4DR2B 5C8YA 3S2DB 2A6HC 1HNZB 4BY7B 2NN6H 1QE6A 5ELBA 1F2MA 4B9XA 3N2KA 4HNAB 1XNRB 3QWNA 2IWHA 4X20A 1Q1EA 5IJ0A 4GQNA 2B2UC 4GZYC 2NWGA 3RWRD 4XORA 5EKLA 3AMUA 1WTRA 4KHVA 2WSSA 1XWEA 2YYZA 3GTLB 5FLXE 4ZAIA 1AFPA 1TWHB 2O5JC 4C3JG 4TSSA 3T51B 4Q5VA 1GUTA 3P7JA 5LP6C 4KJOA 5A2QE 5LA6B 5J2TA 1UNSA 5ELEA 3AB9A 3JAME 4FM1A 2F43A 5I6YA 5E4WC 3A7LA 3P1HA 4DGZA 4RAUC 3SK5A 4CS3A 1FJGB 1FNWA 2F0NA 1ZYRC 2AWNA 2RDGA 3I4LA 4O4JA 4B3MB 2L5TA 1SNPA 2F0OA 4RFBA 5J39A 2F3WA 2XNAC 3BRCA 2W6JA 3N52A 1LT5D 2QJ1A 1OXUA 1J5EB 2EVBA 4DAVA 3DUZA 2WACA 4UCTA 1ONLA 2N55A 4A3KB 4OL7A 3VYRA 5IGGA 2KQ3A 3HS0C 4LF4B 4DV6B 3C46A 2SOBA 2BTQA 4DNRB 4FXDA 2H1EA 3JATB 1H2SB 4F6RB 1LT6D 3BVGA 3GTOB 5EPLA 4CS4A 4X1KB 1FNUA 3D6WA 5D65A 2SDFA 4XLCA 1EQTA 5EBCA 1LABA 4NKLA 4XXEA 3D31A 1TVKA 3HOZB 4ZUIA 2PYJA 3JATA 3TP7A 3KK7A 2XWJB 2F0QA 4XIGS 4X3UA 1Q90A 3DHQA 2RBMA 3EJIA 3PUYA 3QO2A 1B4OA 1XMQB 3PO3B 4DXFA 2WKDA 3ND9A 1STAA 3TZUA 5HURA 1V1OA 2OWOA 1RD9D 1BCPC 3TZDA 4YY3B 4WJWA 1HUMA 1JJOA 2D9UA 3HOWB 1LTGD 1T5XD 2ZNJA 1JB3A 1SYBA 5CA0A 2RQXA 1QQCA 5DNFA 3LX0A 1TWAB 1B04A 1JQYD 4BA1I 2GK6A 4YJ2B 3U9OA 2X6GA 2M00A 4IFDI 3I72A 2PMZB 2JIZA 1JOOA 1BXTA 3MXPA 1EZ8A 4ZI7A 2FFKB 4CKCA 2A5HA 3VYUA 3OMGA 2R7ZB 2ZINA 3OFNA 4XN0A 3K7AB 1L0YB 2O2LD 4ME5A 1HR0B 1ESRA 4IQZA 4O2AB 2XRQD 3M3YB 5DM63 1STYA 1EWHA 4UCUA 4HSVA 2F3VA 3VR4A 1FNVA 1PMRA 1OXXK 3NBHA 3S1RB 5KNDA 2J0TD 5JEAG 2NTSA 1KLUD 2HDLA 1A2TA 2WP8J 1EYCA 1CA5A 4IHJA 5J22A 2ZIOA 1WD0A 1JE4A 4B3SB 3RYCA 5COYA 1EY8A 1YNJD 1SKVA 4RCNA 3CESA 4BWAA 1VMPA 4N9PA 2WJVA 5K5PA 2ZZFA 1KU9A 3CP8A 3BABA 2RSNA 5EZYA 2EY1A 1WPCA 4A3IB 2RSOA 1S5CD 3T1HB 2WB1B 5ITZB 1XX8A 3SXHA 2UXDB 5FKAC 4I55B 1CHQD 4KY5A 5EYPA 3BH4A 1VCIA 3VQWA 1AZPA 3J7AF 2PTMA 4FFBA 1ILQA 3GVKA 3IKJA 1W0JA 3SK6A 5EBDA 2GA4B 5EQ0A 1Z7TA 2KEEA 1X3PA 1HTPA 3X3MA 5I2XA 4A3BB 4G7WA 5KNLA 3VQVA 3GD7A 2PW7A 2EX3A 1P49A 4PMCA 1ZXTA 2X85A 3I8ZA 1I8DA 2HUGA 1JWUD 2NVYB 2EZVA 3K57A 2M2LA 3FEWX 5JCOC 3EQLC 1VF5C 3FKSA 1Z5VA 1GJXA 4F88A 2EYOA 3EVQA 2NUCA 4RGOS 2BTOA 4F8MA 1W6KA 1UD4A 2QCPX 4KKSA 1QNKA 1HTLD 1I6VC 1WD1A 2JEAI 4DV7B 1PKVA 1DCZA 4XKVA 1EU3A 4IUUA 1AN8A 2R92B 1MI2A 2A69D 4K2KA 1BNZA 1FGBD 3OSOA 4LK1C 3C3LA 5G3LF 1E1RA 4U3JA 3HKZB 3PUXA 2UUCB 3RYHB 2EJGC 1LTTD 3NK9A 5JOBA 3CRKC 4HN7A 2ZTNA 4RCOA 1Q3LA 4X3KA 2QM4A 5CORA 4X1YA 4X1KA 5IWAB 3S14B 3H91A 5IOCA 2F66C 3K0YA 1B50A 3NWTA 2AQ3B 4K2LA 2A6HD 3BPZA 4TRDA 4ZYSA 1KABA 3U0ZA 2V7QA 2NVTB 5DN6A 3OEHA 3M4OB 1DOMA 1N34B 2VJJA 1U9RA 2RQ6A 4LJZC 1OHHA 4FM2A 4FLTA 1PFBA 4OO1I 5K36G 3NUCA 1JORA 5G3LD 4I55A 1R4PB 3TMEA 2F0MA 3T16A 2X53S 4LF6B 2PY5A 3A3GA 1ICWA 3I73A 4LH7A 2K1BA 1JR0D 3A8JE 3R2TA 1I6HB 4K0KB 2EY2A 4UCSA 3B2EE 2YIBA 4OO1H 2ID0A 2F0PA 3RYIA 2ZIMA 1ZEQX 4LFCB 5CA1A 1SMYC 2JE6I 1L8DA 1SSOA 1D1KA 3OMCA 4OX9B 5IYZB 4TQUS 5C5MA 4X66B 1TQOA 3LNNA 4IALA 3MFGA 1JICA 4DRXA 1RTNA 3BDOA 4RWSC 1PFNA 2BTQB 1E0BA 1PTOF 2QE7A 5CA1B 4Q6GA 4MN3A 4X20B 1E2VA 4BY1B 1R9TB 2F0DA 2F0KA 1BCPB 2E75C 1S5BD 2ZNIA 4U3JB 2VNUD 4TQDA 5I4DA 1O9HA 4TV8B 4CHTB 5CGKA 4XN3A 3QIAA 3OIQA 4JI0B 1SNDA 3HOUB 1PDQA 4I7ZC 4V190 2VQFB 1T5EA 4EGVA 2UUAB 2VJIA 1HRJA 5CC4A 1HQRD 2YIBD 1PZKD 3RYIB 2ZT9C 3VR2A 4ID6A 3NE5B 3CHXA 1E1QA 1BO0A 3RZOB 2YIAA 5LMUB 4ASUA 1TUBA 4DAPA 2G9HD 5CA0B 3LWUA 2F0IA 1E79A 1XNQB 2EPBA 3WB1A 3PIP3 4XDXA 5ELFA 4DK0A 2OT2A 3C1FA 1EFID 4K6DA 5E4XA 2K04A 2Z4IA 5EIBD 2WZPP 1I18A 4KKTA 3NQTA 3RD4A 3H3VC 1UEAB 3HKCB 1RCVD 2KECA 4HR7B 4CJ2C 5A2QL 4QIWB 1SYEA 3BYYB 3T4AC 4WBNB 1Z47A 5T1GA 2FJ2A 2F03A 5C8YB 1DD2A 2E2JB 4TT3A 3QB3A 3BZDB 2MJ8A 1M93A 4CH5A 3FRPB 1BLIA 4F7XA 4IIJB 2UU9B 3JSNA 3HKCA 4ZKCB 2EY6A 2CAZC 1JCKB 1H9JA 1WTXA 4II3A 4QB4A 3NSWA 1BQQT 4YJ3A 5EIBC 3N6RA 1BPLA 5FL7A 1QNUA 3S2HB 3Q24A 1IL8A 2F0LA 2QF7A 1UAPA 3T13A 5E3FA 1ZAUA 1WPBA 2NZ1D 2F0SA 3ZYYX 5FPRA 1TR5A 1PXUA 3A55A 1XMOB 3D6CA 5FO8B 1PZID 5FO7B 1SJHD 3PMFA 5IGFA 1DOLA 3CHBD 2F0WA 3KBGA 3GTGB 2X6YA 4DV1B 2X6WA 1NUCA 3ERQA 3HP3A 5C3XA 3NQIA 2Y0SB 1LO5D 4QUFA 5JVH3 5LYJA 2LMCB 3A8IE 5DAUA 1I4RA 2A68