2F1MA

Conformational flexibility in the multidrug efflux system protein acra
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
246
structure length
229
Chain Sequence
TTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDMKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTMMPGMFVRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility in the Multidrug Efflux System Protein AcrA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Acriflavine resistance protein A
total genus 57
structure length 229
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f1mA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2f1mA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f1mA02
1K8OA 4DNTB 1VDZA 3A7LA 1GUOA 3MFYA 3WB2A 3NE5B 1Q1BA 1OXVA 2B8FA 1DD2A 2LMCB 1FR3A 3A8IE 3T51B 1Q12A 3PUXA 1RSOA 1ONLA 1TU2B 3HGBA 1GHJA 4H44C 4PV1C 2PNRC 3A8JE 1LABA 2DNCA 2K33A 2B8GA 2EJGC 3VR4A 5C0XH 1HPCA 1H9KA 2EDGA 4TQUS 5K36H 1CI3M 2BA0A 1H9RA 1EWHA 4KKUA 1CTMA 1H9MA 1B9NA 1Z7TA 3D31A 4G7ZC 3BRCA 2F93B 1H9JA 2D62A 1E2WA 2F95B 1DXMA 3ND9A 4XIGS 3LWUA 4OO1H 3WB1A 2E74C 2CW0C 1GUGA 4BA1I 1YNJC 4G7HC 2EJMA 4IFDH 1O78A 3W3AA 1IW7D 3MXUA 5D5PA 4JBWA 3CRLC 2AUKA 3VR6A 1CFMA 1K8MA 3VR2A 2JEBI 3T56B 4DNRB 4KN4C 2A68C 2E75C 5BN3A 5K36G 1GUTA 3U9SA 1Q1EA 1E2ZA 4BA2I 2A69C 1OXUA 1IYVA 3QG1A 2A6EC 2BA1A 4H13C 5KNDA 3DXJC 2AUJD 4DK0A 1VF5C 3M85A 2JE6I 1Y69U 2NN6H 4LJZC 1ZYRC 2BE5C 1V43A 4OO1G 2A6ED 2Q8IB 4L8JA 4IFDG 3H94A 3A7AB 4IQZA 2R6GA 3TZUA 1IYUA 2KCCA 3PUZA 3ND8A 4OGQC 4KHZA 1TKWB 1SMYC 1ZKOA 5JEAH 2F1MA 4GZYC 1YNNC 2JEAI 5KNCA 4H0LC 5A35A 1B9MA 3AB9A 3VR5A 3BDOA 2L5TA 3KLRA 1DCZA 1HQMC 5JJJB 3WDNA 4DK1A 2BE5D 2K32A 4KKTA 2NN6G 2QF7A 3BG3A 3I73A 2A6HD 1I6VC 1VF7A 1PMRA 3I4LA 1LACA 3GQBA 4G7OC 2PPBC 1GJXA 3FMCA 3IKJA 4RCNA 2NN6I 2KA7A 3M4YA 4XTCS 3SDZA 2AWOA 1FYCA 1OXSC 1QJOA 5KNBA 5JEAG 2A6HC 2EJFC 3FPPA 3QIAA 4LK1C 1G291 3EQLC 1H9SB 1HTPA 3WB0A 1OXTA 1Y8NB 2K7VA 4HR7B 5BN4A 3VA7A 1IW7C 1O7LA 1GUNA 3OPOA 3VR3A 2PCFB 1HCZA 3T53B 1H9SA 3D4RA 5D5QA 4TKOB 1OXXK 2A68D 5BN5A 2V4DA 3IFTA 3N6RA 2A69D 3I72A 1Z6HA 4GYCB 3PV0A 1H2SB 2O5IC 3A8KE 1GUSA 2JXMB 1Y8PB 3PUYA 1GHKA 3GD7A 1E2VA 2DNEA 4JK1C 1Q90A 3SE0A 3PUWA 3OOCA 2DN8A 4KI0A 3PUVA 4KMUC 2D5DA 1VCIA 3P20A 2E76C 1T5EA 2IT1A 3L7ZC 4I7ZC 5JJEB 5JJNB 3RLFA 2ZT9C 3M7NA 3OW7A 3CRKC 5C0XG 2D2CC 1A6XA 1V8QA 1BDOA 2O5JC 3QJYA 4KN7C 2YYZA 4KKSA 1Y8OB 2BDOA 2EVBA 3LNNA
chains in the Genus database with same CATH superfamily
3RUZA 1YZ6A 2E3CA 4GZRB 2ZM6L 4JI8Q 3SK6A 4GNXA 1WTPA 1VQ8B 4NXML 2EJRA 5LXTB 3T1HL 1XMOO 4DV4O 1NJID 2LMCB 4FP5D 4TWKA 1OB5A 2KHIA 2UU9O 2QCPX 3OIQA 3FYIB 3K57A 4DV6B 1QUQB 4B47A 2OQ0A 3FDTA 1SF9A 2C5BA 4ME5A 5LGTA 2VY3A 2PO4A 3ASSA 1OCCB 3EROA 2OTLB 3HOWH 4G1VA 4IOAA 2G9DA 1YSCA 2AGAA 1LO5D 3MVVA 4UAIA 3CW2C 4AYBB 1SMYD 5IIFA 2DCUA 1YJ9A 1AR5A 2M5SA 4XQFA 2F0SA 2RQXA 3D31A 2ODMA 4FFKA 4XN3A 4RD1A 1FXHA 4FLUA 3ZUGA 1SE4A 3A8TA 3KYHC 2F0TA 3RGBA 1PM9A 1UWVA 3TREA 1COWA 3BS1A 4G7HC 4UZUA 1AW7A 1NDHA 1GUGA 2X53S 1R5NA 2EJMA 5J2UB 3QWNA 5C44H 4DR5B 5FO0A 2WAMA 4O2BB 3CRMA 3K59A 1M4VA 1JCKB 3DMUA 2Q0AA 5C3EH 4IO9A 4B48A 4OWWB 2CK3A 2SEBD 3NXWA 1VQ8A 1EYAA 1SQPH 4LFAB 4IUNA 2BM0A 4KN4C 2TMPA 1FJGB 2E2IH 2LW7A 4JI8B 3QFRA 1L2FA 1HR0Q 3SXHA 4AVZA 5KA5A 3W7UA 4FYDA 4RD3A 1N34O 2FB5A 1AIPA 1TS2A 2MHVA 3JALB 3ASOB 1I94L 1IX9A 1GH6A 1FXVA 3PA1A 2F3WA 1J5EL 1SRYA 1QR8A 1EFUA 2R61A 2KUMA 3TZUA 1IYUA 2ZXWB 2NWGA 5EKIA 2EE1A 4FZ1A 1LTRD 5HURA 1KDAA 1CKNB 1KNEA 1O7YA 1RKNA 1VMPA 1YTFB 4LF4O 1RD9D 3CMAB 3CQZH 1VQ4V 5KIXA 4FFBA 4DR3Q 3I56A 4IFDI 5LMNB 2IX1A 1SQGA 4G1BA 3SJZA 5IT9L 3J7ZC 1PH5A 3CEIA 1SS3A 1QLEB 3E20A 3RYIA 1MKHA 3VYTA 2HG5C 3HOUH 3NWTA 4OGQC 2E2HH 2GPJA 2EYMA 2BVNA 1LACA 2PYJA 5CMUA 3CCVV 4XMYA 3WNCA 1CHQD 1NCVA 1BF4A 1IJEA 4CDCC 1CPYA 5EBWC 4JI4O 1VARA 3MHPA 5HZBA 2Z6BA 3B2EE 1QNUA 3BNWA 1JVMA 5H2FZ 2PW5A 1IBMQ 1DZ1A 2WLLB 4J9ZB 2PQAA 3CMEV 1QQCA 3W7TA 5FNZA 1CQFA 1QILA 1T5XD 3W5HA 1QCEA 3VA7A 4X62O 1K83H 3OPOA 3APQA 3IJ4A 1HCZA 1L0XB 3L75H 3K58A 4HNAA 1W0JA 3BJUA 3BDLA 4UVAA 4X1IA 3ERQA 4LF6L 1R5BA 3HKZG 2KHJA 4JV5O 4QVJA 2JP1A 2O5IC 5A2QL 4POFA 1P4MA 2QGQA 5IYNA 4WZKA 3D26A 3CD6A 1CQVA 1GHKA 5EBCA 3T1HQ 1TR5A 2DNEA 3SE0A 2JJ1G 3OOCA 2XZOA 3JAMN 3HOXB 4B3SQ 3JASA 1M9NA 1US6A 3L71H 2V7WA 1G6UA 1RPRA 4X7DA 4KHPO 1T5EA 2Z0AA 5LP6C 1Z5WA 4HE5A 2R9IA 2ZE5A 4X0CA 1QVFB 3HKCA 3ZHTA 1BQ0A 1LLRD 1RHPA 2ZT9C 4LAAA 2Q2TA 2HIXA 5D14A 4DR3L 2YXYA 3TK1A 1FGBD 3H0GB 1Y8OB 1CKMA 2NVYH 4MTKA 3I4MB 4HIZA 3QOLA 5L3DA 1E63A 1HZAA 2Q4PA 2JGDB 3DM1A 4JC0A 4KHVA 4YWMA 1QUEA 1GOZA 1K73C 1QCBD 1UEAB 2L4NA 1COWG 5M5YB 4PHZA 2ADQB 3MHSC 2B1IA 4JI3B 4CC6A 3ZJZA 1DDGA 4O2AB 1TLLA 4CDEC 3GTLB 2OF1A 1UD2A 3I4NH 2P5ZX 1JORA 3T4ZA 4QIWE 3CCQA 1EL0A 2R70A 1SR3A 4JI0B 2FVGA 1KUQA 1EIFA 1WJJA 2DYRB 1WNSA 1SETA 3E89A 2H5XA 3R8BA 2UUBL 2BF4A 1H2NA 3CW2A 3DWQA 5JPMC 5FNVB 1BMFG 4I9WA 1GTOA 5FLXN 3V76A 1EWHA 3CC7V 4DR7O 5IT9c 2VYQA 4BXXG 5CDFA 4IZ8A 1ZUQA 3CQZB 1W35A 3ZRWB 1F7YA 3UI2A 4FLZA 1S4MA 1YVWA 2KKWA 4A93G 1M1KC 1G4YB 1I0HA 1YJNB 2E8GA 1TVCA 4L5QA 2BH2A 1KNAA 5IYQA 4HJ9A 3ABLB 4X1KB 4DUYB 1KD1W 3VR6A 5LHGA 1CFMA 2NBFA 1N8RC 1K9MC 4GX2A 3S16B 4A76A 2VS1A 1HNZO 1NI8A 2HP8A 3OE7G 4JF3A 1XE1A 2D3LA 4XKWA 4GX1A 1VQLB 1K3BC 4HCSA 3K7AB 3RLOA 2KSDA 3LUTB 3OGCC 3LDCA 5TISZ 2ZL6A 4B4DA 1QGYA 1B1ZA 3DXJC 2ZIOA 4PZ7A 5IK2A 4ID6A 1R3KC 1JMKC 2XZLA 2B2TC 2DYIA 2AHYA 1OB0A 4F6EA 3MHBA 2NYZD 4RAUC 2VBTA 4OO1G 5LMUL 1K83B 3J81c 1KC8D 4NXMQ 5J1ZA 5BMVA 3B8HA 1KKCA 4JAVA 4PELA 4WFFA 5CA3A 3ONYA 1LYLA 1PV4A 1KP2A 2QGNA 1HZEA 1TXYA 2QSAA 3KEWA 1VHEA 4IUTA 4QUFA 1K3EA 1OCOB 4K8XA 1XMOQ 3DGEA 1OCZC 1VQOA 4JI8O 2R9RB 1VHOA 2D9RA 2QWRB 1HUMA 3WNDA 2DGYA 4H13B 2EIFA 4N8X1 1N33Q 2MUYA 1OHHA 4CJ1B 1IDSA 3FB6C 3AFPA 2OTJA 3UDIA 1NRKA 4DV5B 3RZOH 3S15H 1VF6A 4K1XA 3JCZA 1V55B 4FZ0A 4A3LG 5JH7A 2K5VA 3K9AA 3OMAB 4NR1A 2A0LA 4EFEA 2CH7A 1VQLA 1DOLA 5E7NA 4LNUB 3VYSA 2A3QA 2ZINA 3OSOA 4G7XA 2O5JC 3QNEA 1OTCA 5IYBO 4WFBV 5J2TB 2JA7H 1CXZB 3BY6A 3VYUA 2UXCB 4LW1A 3ZJYC 1C48A 2EINB 4Z4TA 1OXTA 4OIKA 3ABTA 2H8PC 1R6NA 4R4TA 1GUNA 2YUAA 5C8YB 2B2UC 2K5DA 3E0EA 4HIOA 3HG9A 1D8LA 2XZPA 5M5XB 4BY1H 1QFZA 3AVYA 3ZS8C 3TJTA 1I4QA 1RTOA 1K8AC 1JJ2U 5C3WA 5JJIA 3AQQA 2JEUA 2TSSA 3NPPA 1Q86C 2DW4A 4N21A 5AFWA 2GQFA 3CCVA 3APOA 3A8KE 4FF1A 2AW9A 4H02A 4Z4WA 4LBEC 4J80A 3J7A5 1QVCA 1PV0A 2KQXA 1V1PB 5M3MH 1HVXA 1E2VA 4X20B 2GBOA 4NBSA 2NVXB 2YICA 2M2LA 2WLIB 1XMOB 4H0LC 4O42A 3UE0A 3HOWB 2D5DA 3X2QB 1YLOA 3JQPA 1PDQA 3PUNA 1Q7YW 4R7CA 1M93A 4X9QA 5FK9C 4CDDC 2DOGA 2R92H 4QGUA 1ENAA 1N34L 2ITDC 3EFFK 2IBZH 2HDLA 2XNAC 1N8RD 1VQ5A 2VUMG 4GUNA 2Q6AA 2AZ2A 3ZN1A 2EVBA 4DK6C 1G1XB 2Z1CA 4FMTA 5ELOA 1JPXA 4MVRA 4E4EA 3GWKC 4PZ8A 3CCRB 3NXSA 1Q1BA 4BW5A 3CWBH 1UD6A 5KAFZ 4KY5A 3J81j 3K0YA 1O80A 3MXGA 2V7QG 3LNMB 5GAHC 1RJTA 1WN7A 1BS3A 3RYFA 2UUBB 1M90W 2XEXA 2OXPA 2Q2IA 4LF7B 1PRTB 2PZTA 3MXPA 5DM63 4PMWA 5C0XH 3G67A 1VQHA 3AVTA 5LYJB 3LGJA 2L35A 4AYBG 2IL8A 5ITZB 1H9MA 4WFHA 3CYOA 4DRXB 5KLVH 1ICWA 2FYUH 2QKIC 1E0BA 3LDDA 1DXMA 2XWJB 4XIGS 3W7WA 1XNQO 3B78A 4YY3O 4C3JH 4DA2A 3PIO3 4PI2A 3GTKH 1DM0B 1BT8A 3ZMTA 1P7BA 2OK7A 4F88A 4H0LB 3KFUA 4IFDH 1I4HA 1AVMA 1YJ9V 4HIDA 4YCWA 3OMGA 4ZRZA 3AVXA 3P32A 1NH2B 3ZZTA 3SYPA 2HCIA 3CRLC 1PJ5A 5FLXE 5H6QA 2EZVA 1JOQA 2GSMB 3CCRA 1SZXA 2QEXA 2B2WC 4DNRB 1GN6A 5IYPA 2E75C 2W6IG 1GUTA 1N08A 3HFZB 4DK3C 3A5UA 2WPDA 1STAA 4BA2I 3SJQC 2UXXA 1I94B 4M1KA 1NMGA 2A6EC 1KQSB 1JWMD 2N8NA 4KLKA 3TEHB 3CCLB 4DXWA 1HP8A 3E8GA 2JE6I 1XPUA 5LHHA 3GTJH 1XMQQ 4P2ZA 2JA5H 4UY8C 4DR6Q 2JA6B 1Y67A 2VRZA 3S9WA 1VQ5V 1K9MW 4K14A 4FM0A 1AP6A 4BY1B 3H94A 4AYBE 3OD4A 3VYRA 4DV7Q 2EJ7A 2DN9A 5GAEC 1SYEA 4CKEA 1MGSA 4DAYB 4Z2WA 3J7AV 5C3EB 4A3MB 3J80L 4AH6A 2WB1B 2KHSA 4O4HB 4K5XA 4LF8O 3H09A 3K5LA 5KMGB 3B8NA 1HR0O 4HTHA 1L1OA 1B23P 2ZL7A 3TN2A 4JBMA 2ZBVA 5CBAE 1JR9A 2IX0A 2WJVA 2A06H 1I94O 1NBWA 4KTAA 3OZVA 1XPRA 3U4ZA 4EGVA 3E1YE 4DV1O 2DY8A 3JQQA 3DWPA 4RUFA 2QEXB 1G8ZD 3SPJA 2UUCO 4XLAA 5EJWA 1Y74A 2XUMA 3P27A 1TIID 5KW9A 5EZYB 4D6TH 2DEUA 1Y1VH 3BZDB 1OXSC 1D2BA 1Q82C 4BPRA 1KQSA 2UXDQ 3W7XA 4OX9O 3H9VA 4UP8A 3HKDA 2RC5A 4DN4M 4PC2A 1B2TA 4C3HH 3I4NB 3R93A 1IZ3A 3EQLC 2QA4V 1GN2A 3CRAA 4B3TB 2P6JA 3OE7A 2BTQA 1QU7A 2XAJA 5TY0A 1IW7C 4OXPA 3D6WA 4PNYA 1C8CA 1B06A 3GVKA 1KQSU 1H9SA 1VQ7V 1XNRL 3D3RA 1EZJA 3IFTA 5D65A 1TA8A 3ASOC 3K08A 4Q7JB 2LZJA 1SLJA 3CC4A 1GVPA 3CX5F 1XNRO 3K8AA 1VMCA 3ULLA 2YXLA 3KBGA 3I55A 3ZC3A 2BCCH 3IAYA 3S1RH 1TWCH 1KU9A 2Q69A 2XAFA 2AHOA 1J8IA 1KAWA 1Z5VA 1TT2A 1LTSD 4UFZA 2ICIA 1H8EG 2L0CA 1EU4A 3RFRA 3FB7C 1S5DD 3NHHA 2IT1A 4S3SA 4C3HB 4DV5Q 1AP0A 3W2EA 3T1YL 1J6QA 4ROXA 5E4XA 2CWAA 3LSSA 1CSQA 3URYA 2Y0SE 1HNZQ 1SMXA 2E75B 4NXMO 2WINB 1PTOF 2M6YA 1DYQA 1TWFH 1A3UA 2XOKG 1KJZA 4MT8A 3OTOB 1IKLA 1VQJA 1TVKB 4X06A 2ZXRA 1OV9A 4HCEA 1DOMA 2WV6D 2NLJC 3E35A 4R4IA 3R2IA 2HVKC 1DOKA 3GDEA 1W9XA 2LSSA 4UUJC 3A0BZ 4YJ3B 1FR3A 2EPBA 4IURA 3B4SA 2EINC 1RIPA 1X3PA 3CC4B 4PC3A 3IRBA 1RFYA 1F2MA 1O7ZA 3ERSX 3ZRXA 1STEA 3S2DB 4PDRA 4DV7B 4L63B 3EFXD 1AEXA 2R93B 5C4XG 3CC4V 3ZMSA 5KUMA 5LGNA 2RCVA 3JASB 1CI3M 1QE6A 2KJXA 3QFSA 3CC2B 2VQFL 4B3GA 2OYNA 3BY2A 4TMTA 3OMNB 5JQGA 5LMNO 2PI4A 1IHZA 2C35B 2QDOA 2NVYB 3I4MH 2F95B 1JJGA 3Q22A 4FIPC 4OHJA 3ZBUA 3E3XA 2E74C 2Y69B 2J4XA 4XDXA 3WQZA 1BHBA 4LR3A 2OBTA 4DR7Q 1PRTF 5KNLA 5IYZA 2E1RA 5A8AA 1EP3B 1X3QA 1QZHA 1VQ7A 3TQYA 1XUQA 1FNBA 4BWGB 4O4LA 3H15A 4GNXB 1SEBD 2YIBA 1QVGA 3B09A 3TSSA 3U9SA 3A54A 1XOUA 5EYPB 3FKSG 1KDCA 1OXUA 1EYCA 3FYEB 3RW0A 3S3XA 3CCQB 1XTCD 4DV1Q 2Y4TA 3PO3B 1TQOA 4IPGA 5F2VO 1VQEA 4NVPA 3OW2U 1QUQA 2KEEA 3BVGA 1IBLL 4K0KO 3SR1A 1Q86W 2A5HA 4WFGA 2HQLA 5B1AC 1EYDA 1X55A 2ZR2A 3Q0AA 5JEAH 4EQOA 2WJYA 2JSOA 4OELB 5HFMA 1VQMB 3TETA 4I50B 3A3BA 4A75A 4PI0A 1PH2A 4ZKCB 5CR3A 3S14B 4DV0Q 1B7YB 1XMQB 3AB9A 4XT1B 2VNUD 1XL4A 4ZUIA 3SYCA 4KV6A 2RDHA 4K8ZA 4X6AH 5IYCG 4RUEA 1HQMC 3QR8A 1EZVH 4DR2B 2EIJC 1VQ7B 3I4LA 1WCMH 4YWLA 2GJKA 3RMHA 2UUCQ 2K01A 2PF4E 5KHJA 1VQBA 1ORQC 5KHGA 4CC5A 3PCOB 3SGIA 4ZV4A 4M1UB 2RCNA 4J8QA 5KNBA 1E1QG 2A6HC 2EJFC 2K5NA 1NH2D 4C3IB 2WLNA 1EBOA 4LBWA 4P2CB 5IWAL 3SDLA 1ILQA 1H8HG 1HTPA 3AEIA 1XNRB 5IE8A 1FNMA 3JU4A 1SSOA 2QDXA 2EYFA 4NW2A 1Y1WG 3R66A 3T2MA 3OEHA 3K5MA 1VQLV 3F2UA 4DF7A 2JRIA 4DNIA 1HNWQ 2ILMA 5IP7H 2IW5A 1P84F 2YDEA 3W5UA 5JVG3 1NT2B 3PO3G 5JCOC 1N33O 1K8AW 4YAOA 4DU9A 4I55B 1IHMA 1Q43A 1SYBA 4N9PA 4A3MH 1VQMA 1AI5A 3SPGA 1NY4A 1HNXL 1GXDC 3AK2A 2HHHB 3UT5B 3NR7A 2QTSA 3NENA 3ZCCA 5KEEA 1SYCA 4LF9L 4AQYO 4OPSA 3L7ZC 4II2A 2ZM6Q 1HNWL 1NTMH 2DOSA 3RLFA 5FJ8G 3ABKC 4Z1MA 5B5EZ 3BZKA 4JTAB 3ZZUA 1VQIA 1WA8A 1EP1B 4DQLA 2IH3C 4QPJA 1QNKA 2YYZA 2EIMB 4KN7C 2ALYB 4JMQA 5COYA 5HKKA 4A3IH 4DR4L 1M8AA 3TDQA 2CC2A 1SROA 3S16H 3QO8A 4V190 4CS2A 3BA9A 3W7SA 2VBUA 1VQ9B 1W6JA 3W1GA 1D5AA 3I2ZA 4B3SB 3ZRWA 3QO2A 2QM7A 1HR0L 4LFCO 5KHKA 1EIGA 2DNCA 1FS0G 1CT1D 3VQXA 1DARA 4GT1A 4IN3A 3J81N 1I18A 1IZ6A 1WTVA 3UM7A 4OX9B 1BR9A 1W0JG 4X1KA 5GV8A 3W2HA 2GHYA 3ZHRA 2WYRA 4X3KA 4JI0O 1K4DC 1A3TA 1UE1A 3UDGA 3TS0A 5IYDH 1WOOA 1Z2GA 4JI7Q 2J7KA 2QTLA 5E4WC 1EU3A 4RMFA 5IGEA 2PYLA 1G7SA 4I7AA 3C2PA 1B8AA 5HFLA 4P2NA 2KBNA 1FXKC 4BA1I 1NBMG 4B9WA 1ZTEA 3AU7A 3X2QC 1I4XA 4DXFA 3SJAC 3S1MH 1S5JA 4A3BG 1YBYA 3EVQA 4MVZA 4LWCA 5IJ0A 2CH4W 3KBXA 1U9RA 2UXBL 3A8JE 4PA6A 3WG7B 2VNIA 5DN6G 4Z4VA 1VQ4B 4P73A 5I2XA 5FLMG 1OO9B 2UXCL 4BBRH 4Z1VA 4DR7L 3GV6A 4QE9A 1I50H 4A3DH 1LT6D 4JI2Q 1BGYH 4NB3A 4DK0A 4XDLA 3U10A 1VS0A 2VBSA 1ZYRC 4XT3B 5IY5C 1QWYA 1HA6A 1JE4A 5FPRA 3PO2B 2IHEA 3CCJV 1N0UA 3I56B 3RYHB 2MO0A 2GA4B 5C5MA 3FB5C 3GTQB 4YHHL 2C9OA 1Y76B 2ASBA 2B3GA 2VQFQ 3AK1A 4CJ2C 4U7NA 3RYIB 1ZKOA 1WTXA 4JYYA 2F1MA 4BBSH 2WLKA 4R8CA 1XMQO 5L3CA 2CBXA 4OL7A 1L0LH 5CB4A 1EZ6A 1WTHA 2H94A 2JIZA 3S17B 1D5MC 4WJ4A 3ZX6A 1FNDA 3DSQA 4JI1O 4B3RL 1N8RW 3R6KA 4QB4A 2CDYA 2QM8A 3JYCA 3HOYG 1W87A 1KABA 4JOIC 1N32O 1YHBA 2CK3G 3ZRVA 1ZXTA 2DYSB 4X3TA 2PQAB 1N34B 1RQPA 1LTBD 2R93G 4IYIA 4WZEA 2GJRA 2KVOA 2VNJA 3DEOA 2HD3A 2YIDA 5BXZA 3VQWA 4FM2A 3ASQA 4Z4UA 4PC7A 5IWAB 4A3KB 2V31A 2MP1A 4B3TL 2EIJB 3BABA 4OPAA 5JVDB 2L9HA 1Q82W 4PD4F 5M3FB 4R1JA 4JI3L 1BMFA 1YITA 3ZMVA 4B7EA 3FPUB 3CRCA 3G05A 4FVMA 2JN9A 4DR5O 3VNUA 1VQAA 1HNWO 1QLEC 2NZHA 4AQYL 3U6BA 2UU9L 2QW7A 3H0GH 4WBNA 3DDYA 4ZOLA 1KMHA 3R6JA 2Z6KC 1E7ZA 3AYHB 4DR2O 3SHLA 4J10A 3TCUA 1V55C 1PP9H 2BGJA 4XM3A 1L1OB 1KDBA 3ZIAG 4CKBA 1Q7YC 3Q6QA 4LF4L 2VZAA 4GN3B 2OK8A 1SQBH 3LVBA 1EQRA 2MNAA 4LF8L 5G3LF 4BW9A 4LP8A 4PMCA 1M57B 4CS4A 2BOCC 5L3FA 4GKKL 1EIHA 2FFKB 4KI0A 2M00A 3DUZA 3P20A 4UCOA 3CCUV 1NR4A 3HOXG 3I91A 1VF6C 2L11A 1VQPA 2IJKA 5JCOA 4DV6O 4OPOA 5LHY1 3CPWA 4FK5C 2JGDA 4UB6Z 4XTCS 4C3JB 2CCZA 5C6AA 3HOYH 4DV4B 2CTQA 4F6RB 3OTOL 2V7QA 1SE2A 3CU7A 1JB3A 4XL9A 5AJ3Q 3D3QA 1PL0A 3CRRA 2JIZG 3JAKA 4K0KL 3CPWU 3ASTA 4J41A 3B82A 1Z9FA 3I8ZA 1MJCA 1Q9SA 2NTTA 5L3BA 2R9AA 3FX7A 3KDFA 2F4IA 1MMMA 1TWCB 3NBHB 3V05A 3T51B 2Y69C 3PUXA 3SVMA 1MG1A 1KK2A 1VQFA 2ZJQA 3ZRSA 2B2VC 1U5KA 3ETQA 4CBCA 1YJNV 4WZLA 1LUWA 3QO5A 2D3NA 1SM4A 2QEXV 2C4TA 1BQQT 1K3RA 3TXSA 2JK8A 3GSIA 2F0JA 1IBKL 3PO2H 1JT8A 4RPBA 2HT1A 1X3GA 4GN4B 2JA8G 1JOYA 3AVVA 1JICA 2NPFA 2HKOA 2PZWA 4X20A 1QGZA 1WAZA 1PZJD 4EB6B 1NZ6A 2M7WA 3PSIA 4BS9A 3NQTA 2UU9B 4TQFA 1YXBA 1KIXA 4PGOA 1LV9A 1BOSA 3N2KB 3SEBA 3F2BA 3DC6A 3WNBA 4R9WA 2A79B 4UV8A 1HJPA 1HNZL 2WZNA 1S4ZA 3MMPA 4YEJA 4B9XA 3JAML 1QHTA 2Q7GA 1NTZH 2EX3A 1UMKA 3K03A 4J11A 2ZE7A 3P30A 1VQ5B 1W3SA 5IGDA 4LUVA 2A68C 1PH8A 5IYDO 4LUOA 3NBHA 1D1NA 3C3TA 3S17H 1EFRA 4YIOA 1P49A 3ES9A 2I07B 5C0XJ 2XASA 3L72H 4K35A 4PABA 3L9DA 2CF4A 4YCVA 1IL8A 3A7AB 2ZM6O 4K5VA 1FPOA 2XAQA 3PUZA 1K0RA 2P7TC 3QSYA 3AG3C 2B2YA 4DR4B 2BSKA 1N36B 1PNLA 5HY6A 1YHQA 1I08A 2BE3A 4JI6B 1H85A 4F4LA 1QVGU 2QA4A 1MABA 2Y0PA 1B9MA 3OW2B 4HZ3A 2YTYA 3KLRA 1IXMA 3ONUA 2FTKA 5HXBA 2BTQB 2ITCC 4A3KH 4P9PA 1I5YA 3HKSA 3KJPA 1D7QA 5GADC 4O4LB 4TSSA 5J2TA 3W2IA 1QVGB 1Q82D 1SYGA 2C4UA 4CQJA 4JW0A 1STHA 4F7XA 2KEDA 1XPOA 4A3FH 2P5OA 1SA0B 3SJPA 1LM0A 4FNFA 5M5WH 4K0KQ 1W59A 3I5DA 5EPLA 2KOLA 2YS8A 2LFSA 4UXNA 2DYSC 2GUZA 2JJ2G 2HLDA 2HCCA 2K28A 2PZUA 1JJ2A 3E22B 2ID0A 3TP8A 5BN4A 4DUYQ 1V0FA 3CCVB 1Y6XA 1BPLA 4Q20A 4P26A 1EY6A 3M3YH 1F9RA 4MVQA 5GONB 4GOPA 3CE2A 3CXCB 2F43G 2P22C 1L0WA 2QWQB 4AHCA 3UKMA 2EIXA 4M8AA 1JE5A 1EWIA 3D4WA 4YIJA 1XNQB 4R8NA 3QO7A 4CBVA 4GKKQ 1S5FD 4H7BA 1A62A 3H1IH 1X3FA 5IP9G 3OW2A 3CMAV 4A3FB 5KMGA 3PJSK 4LWSB 2LKVA 2FHTA 2K04A 3PUVA 4W4LA 1VCIA 2EOTA 3TP6A 1CNFA 2I0QA 1AJPA 1KLUD 4XQJA 4QHYA 4X3UA 2UU9Q 1Q5OA 5LXTA 1FJGL 1ZLZA 1A6XA 3CCUB 1H2LA 4RQEA 2Q7HA 4PC6A 1K73D 1A15A 1LT5D 3E5SA 1WD0A 4IT5A 1NU1H 1AZPA 2QMUA 5FO8B 4Y7NB 2PIAA 1EY9A 1IXRA 2Z8LA 1JWSD 2VQFO 5IDJA 3S24A 1E1RA 1YF2A 4JCVE 3UCSC 2ZTGA 1OXVA 2B8FA 3W2GA 3CJHA 3E8HA 4P30A 3OAAA 1SNCA 3A8IE 4ZK9B 5GONA 5C44B 2MW2B 1TU2B 4B3MO 2F0FA 2IHFA 3RR5A 3CS5A 4OOSA 2YI9A 1LABA 4LFBL 1TWHB 3ZPNA 3AVUA 2OTLV 3THOA 2NZ1D 1Y1WB 1R3LC 2KB1A 1KBHA 2XSCA 3N6RA 3UT5A 2PTMA 3G6JB 2LQTA 4XD7A 4TQUS 4WRDA 5J2UA 2X7RB 3STBC 4X64L 4JBKA 3HS0C 4C3IG 3Q24A 2F0DA 3X3MA 4A3DB 4A3GG 5IJ9B 1SNMA 5H5NA 1UD8A 2UUAO 4LF9Q 2F93B 5E3FA 4YIPA 5H59A 1SXTA 2BSAA 2EYJA 3NTIA 1S77D 3S1QH 2EILB 2VWKA 4EFBA 1IBML 2W0XA 3Q4HA 4HBNA 1AH9A 4DW0A 3G6EV 1T6XA 3W1BA 4TV8A 1MNGA 2E76B 2ZM6B 1MRZA 4B7KA 2BV3A 3A0HZ 4HEDA 4PZ6A 1YNJD 3V7AA 4CH5A 2XT9A 2OBRA 2Q8VA 4AC9A 1Y66A 1MZEA 3P3NA 4OP7A 1LTTD 2Z6KA 3MCAA 4KHPL 3OWEB 1F51A 1S72B 3CCEV 4X7EA 2A69C 4Z4YA 3J80i 4JYAB 1G7CA 2R7ZB 4H13C 3I55V 4LF8Q 3HEJA 4Y9RA 3CMAA 4DR3O 4LF4Q 2KCMA 3QF7A 3I56V 2MFIA 1SC5B 1CQXA 4MYUA 5JBQA 1KD1C 2ZJPA 3L74H 2RF4A 1U0LA 4IQZA 1WOPA 4IOCA 1SKQA 1M90D 2KCCA 2OQKA 4QJFB 5A89A 4G6IA 4JI6L 3GTGB 4K0KB 5C3EG 3JATB 3CF5A 4TUYA 4GZYC 2CHBD 4RAIA 4B3RB 2MPMA 1EIYB 5C4JB 3PA2A 4OPHA 1J5EB 3JQRA 4BAYA 3STZC 3LQ6A 4G5GA 1VQKB 1ZX3A 1WTHD 3DXRA 2K1BA 1X9NA 2R7DA 5C5LA 4LF9B 1EQTA 1I50B 3GVMA 5JJJB 1ZYRD 5B6IA 3PIOA 1BXTA 1NR2A 4CJ0B 2F0NA 3CP0A 5KYIA 3RVZA 1VQ4A 4IFDJ 1A8PA 4QUCA 4ZQ3A 5KNCA 4X66Q 4ZCMA 3L2PA 4YHHO 3ETGA 4B08A 1PXUA 1JC7A 1VQCA 1X56A 4W4KA 2KA7A 3FKIG 4I55A 2B7CA 4E0FA 1FYCA 1X4TA 5CN0A 3NP8A 4MHEA 2UUCL 2FXQA 4DR4Q 1JQ0A 3H01A 4J42A 3B77A 1JB9A 4B3FX 3CTAA 3HOVG 1M4UA 3H3VI 5M3FG 3SK4A 4QL5A 1PH4A 1GO3E 4C2MH 2N05A 5IWAO 1VMGA 2QE7G 4O2BA 1FJGO 4A4IA 1SQXH 3E83A 4UVBA 2UXBO 3HOUG 4Q5VA 5K1PA 5HZAA 4FLXA 3HPLC 1FNCA 2YXHA 4IGGA 1B3AA 3FJOA 1P8LA 2MGSA 3SYAA 1TUIA 3OMIB 3PUYA 5FLXc 3JARA 4UVCA 2QILA 4J7ZA 3ZHSA 4UCUA 2DJGC 2K5HA 2BM1A 2PQEA 4A3CH 3S15B 3RZOB 1TUBA 3BCCH 4JI5O 1M56C 3BYTB 4JYCA 5J3BA 3WFVA 4KY7A 4IJLA 1R9TB 4L5TA 1TVKA 2F23A 1YJWV 1LUZA 1I4RA 1UE5A 2XNCA 5CBFA 1YI2B 3T16A 3KLSA 4YJ3A 3JSNA 1MHWC 3CCSA 4ZGNB 3ULPA 2ICEC 4LF7Q 4PC1A 4KJNA 1QNMA 3U6KA 3OZWA 3E8FA 3WB2A 2VJIA 1OGIA 4P22A 1WB7A 3P75A 3W5OA 3E9IA 3CB4A 1K33A 1SZTA 3ABMC 4WJWA 2K5WA 4XLFA 1I4PA 3U58A 1MA1A 3ZHUA 1ESRA 4P75A 1I5XA 2JA8H 2K9PA 1U4RA 2EJGC 1HQRD 4XR6A 2VNHA 2WWWA 5DEHA 3M9BA 1Q81W 1EXMA 1R3IC 1FD7D 4MW8A 2N88A 2M9VA 4J6HA 5D3DA 3SK5A 4A3EG 4A3JB 2Z3YA 3HOYB 2HJDA 4WCEV 4FXKC 4MVMA 2I5LX 3A1PA 5KHHA 5J35A 2WKCA 3ND9A 1SYFA 2OT5A 1IYJB 2Q6KA 1FX0A 2D0OA 1Q8IA 2Q5ZA 4X88A 3J81k 1PTOB 3EJIA 2PI2A 2AXTZ 2NV4A 2X6YA 1Z47A 2HHHO 3ZMZA 3AEVA 5L46A 5LA6B 4GS3A 4GKJB 2VQFB 2AUKA 3PQIA 1D2DA 2ZXHA 2EIKC 3ITPA 2SOBA 3BVOA 1X59A 4IJHA 2ENBA 4FDBA 2CTWA 1SNPA 4A5UB 1Q1EA 3C1FA 4B3SO 1HR0W 4U3FH 4A3JH 1WORA 4LF7L 1K73W 2P90A 3A55A 3C1EA 4TRDA 5IE9A 2K52A 4ODGA 4V0BA 4BXXH 4UV9A 2IW3A 3JC66 4R4CA 2F4NA 1QVFA 5E79Z 3ICXA 1K97A 4GLXA 3PUMA 2KECA 1H2GA 3DEPA 2Q8IB 2FKXA 4FM1A 2WA3A 5CA1A 1I3QB 2AWNA 2WB1E 1SE8A 2WAQE 1GD7A 1QR9A 5GW7A 4FXUA 2HQEA 2V1CC 1BBUA 3ND8A 1E1TA 5KNDA 3CCEA 3JAWA 4DR1Q 2ZZEA 3K80C 1GO2A 4B3TO 1FNUA 1TS4A 3LX0A 2JQOA 1V9PA 3QG5A 1B4OA 2RNBA 4PA7A 5IWAQ 2Y4UA 2R6HA 4QIWB 1HA5A 3OM3B 1SBBB 1KYOF 1VEWA 1ZM3A 4X8AA 2HMAA 1UD4A 3K7AH 2JDIG 2Z6BD 3H3VC 4BIOA 5JJZA 1S5ED 3H1KH 3CMMA 4YHHB 1WP7A 1GVHA 2C2AA 2ZL5A 2FL4A 3W5VA 3SYQA 2AKWB 4DKAC 1Y4MA 1G91A 4ZOLB 5A2QE 3G80A 2AWOA 5I9PA 4RJLA 2PMZB 1WP6A 2DE0X 2IJJA 1OJHA 3QIAA 4JZ2A 1W0KA 1PVOA 3L0OA 4LK1C 4DV0L 3STLC 2R7ZG 1AJNA 1AILA 4B3RO 1X54A 3T1YO 4DYLA 4X1IB 1N4CA 3NQIA 4JI1L 1D5XC 1SJHD 1A63A 2GK7A 4TMWA 1CM9A 1OXXK 4DPGA 2F0PA 4P1VA 2E2JH 4JI4Q 4LC0A 2Y48A 2ZTCA 2QA4B 3SJCC 4X1YA 1AR1B 5LP6A 1HNXO 5EC1C 3KF8A 3CC7B 2N49A 3KCXA 4X65Q 1H2SB 3GTOH 3GTPH 4YELA 4XLCA 2A7WA 1HXYD 3RY8A 2ZXWC 4X64O 1B04A 2MK3A 3BQJA 3H1LH 5I6WA 5IGFA 1I94Q 3S2DH 3HOZH 3UQ8A 1LTID 3LQEA 2JS5A 2AZ0A 1CKOA 3CESA 2DN8A 2MQHA 1PLFA 4QIWF 4P6VF 4RD6A 1Q8KA 2DY7A 4Z1MG 1WP8A 5J39A 4YAFA 4OEMB 2CUGA 3NELA 5JJEB 2UXDO 4MVSA 4UCSA 2CE4A 4Z4SA 3F5TA 1UPGA 2H4OA 2O57A 1BDOA 1EUJA 4JYAQ 3K9SA 1Y0YA 4KKSA 1DG1G 3EXAA 3Q38A 1YNXA 3DHQA 4GLAC 4RGTA 2UXDL 3MHHC 2E2JB 1J5EO 1E43A 5GTHZ 2ZNIA 2Q6OA 2WSSG 2YEVA 1NSNS 1KC8C 1VQOB 4O4IB 4DV5O 1HRJA 3ZBHA 5TSSA 3NE5B 5M3MG 2UUAB 1VLYA 3F5WC 2ARHA 1WTRA 1JQYD 1BLIA 1X65A 4OO1I 2NVXH 5AN9A 3HGBA 3A0RA 4L5RC 2VNKA 3CC7A 2K33A 4QCLA 4RHSA 3CCLV 5A9GA 2ZTNA 3ABKB 4GX0A 5CBHA 3Q39A 5L3GA 4MW3A 1M1KW 2CTPA 1TTTA 3G7LA 5GAGC 3ABMB 1XQBA 3OTOQ 4Z4RA 2R92G 4GX5A 2W6JA 3QE2A 4DAVA 1M90C 2Y0SB 2ZXPA 3N52A 1AE3A 2R7ZH 1WI5A 3P3PA 4HJAA 5EPKA 4RLZA 4F7DA 2K75A 1PYWD 2ZKOA 1KRSA 2ZTDA 4Y7NH 4CH3A 4HAMA 1H95A 4HE6A 5EIBD 5EBLC 2VQEQ 3TRZA 3ABUA 4DV7L 3OKXA 4NMZA 1ROPA 4DAMA 3UO2A 2OEOA 3W3AA 1ET9A 2HHHQ 1M56B 2H1EA 1PJ7A 3U2QA 4DV7O 1F60A 1LTGD 3C3LA 3K5OA 1CK1A 3FRPB 2XNDA 2XHBA 4DR1O 1EEID 3H6MA 1N36Q 1VQNB 4JI5L 1DJRD 4RDLA 1GKHA 2PUSA 5BR8B 3EN2A 4DAPA 1SQVH 1U4LA 1XJVA 2E5LO 3A5ZB 3J7AU 4RA8A 1EFWA 1THZA 3JD1A 1V43A 2B63B 4QGPA 5KAIZ 1FKAO 2YWFA 1WJZA 4RO2A 5DEDA 1FVIA 5CA0A 2RMKB 1SJED 4LBYA 1BBWA 3N27A 2XRSD 2PMZE 1FXKA 4JVZA 4XQQA 4ZHQA 5B1BB 1HZ9A 5GTIZ 4JZGA 4DUZO 5EQ0A 4ZUJA 3LSUA 4GKKB 4GN5A 4DV3L 1AZQA 4R4QA 2UUAL 4LFBO 3Q4HB 4B44A 2F0HA 3Q8DA 3ASNB 2X6LA 3E9HA 4FK8A 3LO8A 4OPVA 1SQQH 5E1AC 5B1BC 2A68D 4JI0L 2D2CB 1PZKD 1QOHA 5DM6V 1GJRA 1WTQA 3IFXA 3VO2A 3I73A 2C2WA 2A6HD 4DV4L 1PH1A 3UDXA 1ASYA 3S2HB 1LT3D 3CP8A 3F2DA 2V7TA 2LXJA 2XNJA 1GR1A 2E5LQ 4LUZA 2EZOA 1B2RA 1EN4A 4TSFG 5ITZA 2VQEL 2L6LA 4DV0B 4XXEA 1WYDA 5CGKA 1S5HC 4GQNA 3B6YA 2K7VA 3PGZA 5H6RA 1VQPV 1WSVA 3I55B 1PTOD 3G4SB 2K4KA 2KCNA 4IUQA 4ME3A 4XYQA 4BBRB 1FNWA 2GTAA 3SPIA 2JGUA 4WFAV 4NXMB 4U3JB 4GKJO 2BPOA 3G71V 1K9MD 1PRTC 1E79A 5A2QN 1R6KA 1DK1A 3CPFA 5LL6X 2QWNB 5J22A 3HOUB 3PF4A 2UXBQ 1OCRB 3OR7C 1IURA 3WOFA 3M4OH 1VQ6B 1VQKA 3ZHVA 1YHQB 4UHVA 1O9HA 4Z4ZA 4HJ5A 3G6EB 1XMQL 2BDNA 4WWVA 3BFRA 3KL9A 4YXWA 3CRQA 1BKBA 1DDIA 4MNOA 2IH1C 5GROA 4XKVA 4DGZA 4HJ8A 5BY1A 3T1CA 3B40A 1K5SA 4C3HG 1WOSA 3I3CA 2DMXA 3OFNA 5IY0A 1L1FA 3CHBD 1MOFA 4C43A 2ZIMA 3ASPA 1YHQV 2NTSA 4DV3Q 4GLVB 3M7NA 3NEMA 4F8MA 2QDBA 3KK7A 1IBKO 1EEFD 4DAYA 4PJ0Z 3G71B 1PYSB 4ACBA 4ACAA 3RN4A 2CW0C 2PYKA 4CDFC 3FFQA 3HAGA 3OEEG 2DERA 3CKIB 5IYCO 1S5BD 2V7VA 5IYBG 3MDSA 2XVSA 2RDFA 1S3JA 2AMCB 1YIJV 1P7GA 1JFFB 3J81i 1NR1A 3A56A 4LBVA 1XQ8A 4QF4A 3I4NG 1PD3A 3BAAA 3STBD 1G2SA 3F7YC 1UE7A 4JBJA 3JARB 2CKZB 5FO7B 3CXCA 1K5QA 4HIMA 1N33L 2L55A 2JA6H 4EB6A 4TV8B 3ETEA 4HN7A 1VQDA 1KRTA 3HOZB 5EC2C 2IU0A 2A19A 1LNQA 3W2DA 3SPHA 2BA0A 3VOUA 4KKUA 4X62B 3CC2V 1Z7TA 5TV2A 1HR0B 1KP3A 5IYZB 4FN5A 3MA2B 5EBDA 1H9JA 2D62A 1E2WA 1TVXA 3FD9A 2GV9A 4HMIA 3TGUH 3LWUA 4N3GA 2GDSA 2ZITA 1IBKB 1J9ZA 1I7PA 1YNJC 3PMFA 4JTCB 5LMUQ 1HNXQ 2RDCA 4KL1A 3GTLH 1KK3A 1JOKA 2F4VQ 4RKLA 1AJQA 4LF5O 1WPCA 4YY3L 3HKBA 4D7SA 1TAEA 5B3SB 4ASUA 1IL2A 3S14H 4P9SA 3AVWA 1F4MA 5B66Z 5K36G 3IC7A 1SFOH 3MD0A 3AMUA 4RGOS 3ETDA 4HSPA 1JFFA 2R72A 4IW3B 1EQQA 1ZAUA 3IL8A 5B1NA 2XAHA 4I0XB 1IYVA 3CJHB 3L9AX 3AG1C 2Q8RE 2NN6H 3DXRB 3F8TA 1GM7A 4DUZB 4I50A 2WFWA 1AMOA 1C9OA 3HP3A 3G48A 5CV9A 5I4DA 1G51A 1SDFA 2YV5A 1NTGA 5M5YH 2OCCC 1BJKA 5IODA 4DV3B 2NVQH 4NPSA 3DWAA 5FL7G 1VP7A 2Q8TA 1PHJA 2MJ8A 4JYAL 2IM9A 4UP9A 2JEAI 1YCIA 2Q67A 1C7YA 1UD5A 3GTKB 5C93A 5IGGA 1ESFA 5DLQE 3RYCB 2YWGA 4EQPA 5CBGA 2GVAA 2BE5D 1W0KG 2B9ZA 2V7XA 4KKTA 1D1IA 2F0UA 2JJQA 3V2TA 2GUZB 2PI2E 1DF4A 1BCCH 1HDJA 1WFQA 3QB3A 4GOPC 1TS3A 2PPBC 1N0NA 3TS2A 2EZPA 1QH0A 1F2YA 4M2LA 1RP3B 3KG2A 4E2LA 5KSWB 4I0XA 1B53A 1F9QA 2F1LA 3E6ZX 1NB9A 3NTKA 2Q7EA 5CORA 2KVMA 1S72A 3GIRA 3KOJA 3M7GA 1RF2D 1KECA 1H9SB 1UUPA 3T4DA 4HR7B 4RG1A 4CKCA 1GN4A 1H2MA 3AG4C 1K7DA 1O7LA 3X3NA 4XDKA 1BX1A 3KUPA 4H33A 5KYLA 3JD3A 1UE6A 1WPBA 2F0QA 2N3SA 3MZ5A 1S5CD 2V4DA 1Q6IA 2P3MA 1QFJA 3CCJA 4TSFA 1TWAB 1LR1A 4HNAB 3CCSV 1WCMG 4GYCB 1DGSA 2A69D 1PH3A 1B6QA 1CA6A 3T1YQ 5F4OA 1JA0A 1YDXA 2N04A 4DUYO 1F9SA 2X69A 1W2BB 4ALPA 1QFYA 3GD7A 1JA1A 4K8JA 1U2RA 4P71A 4RH6A 4DR1B 4QVAA 4TT3G 2F0KA 1TWHH 2CGNA 3K3WA 4CHTB 1YITV 2CFMA 3F2CA 4FLYA 1Y1WH 4FXDA 1AB3A 1AROP 3DM3A 2CW5A 2LGQA 1ENFA 2QGGA 1BQEA 3SYOA 1H2KA 3CB2A 2RC6A 2JK5C 4YAWA 1PTOH 2D2CC 2RBMA 5T1IA 2F66C 1PJ6A 5GQOA 5THXA 2G38A 3Q3AA 1STNA 4WQMA 3VNVA 1V1OA 4LBZA 3D3IA 1CKNA 1D5ZC 3E0JA 4C1NK 1SQFA 3JAME 1Q81C 1KRHA 1HZCA 3OWFA 4FFBB 4BR6A 3WOEA 4O4JA 1KKDA 4LFAL 4X1YB 3KF8B 1FYJA 1RPOA 4NYKA 1SE3A 1RSOA 1FDRA 1ONLA 3JAMi 3WBJA 3K5NA 5C44G 4HJ7A 5B1AB 1JR0D 2UUBQ 4JI8L 4LC1A 2F4VB 2DJFC 3OUSA 1A3VA 3D4DA 1UFIA 2N55A 1E79G 4XOPA 1HNXB 2O2LD 2HFEC 4LFCB 3CXHF 2Y0SG 5JQGB 3U50C 4X65B 1WTWA 3F7VC 2RSNA 4DXGA 4A3IG 1V5VA 1MJEA 2K1EA 2QDLA 3T1YB 4TT3A 1QG0A 4HYOA 3HR0A 1EOVA 5IJ0B 4A3IB 1W6KA 2H3OA 1MI2A 3CCQV 2VQEO 4M0LA 4XNFA 4CGYB 1HUNA 3WB1A 4OX9L 3RVYA 1ZL8B 2IWHA 3H9NA 2V7UA 2QKCA 5LMNL 3ICEA 3J7AF 1FFXB 1NTKH 3FAVB 4MTGA 3OTOO 1YJNA 1VF5B 1E22A 5LL6S 4NTYA 3VR2A 4OGQB 2FMCA 5M9OA 4BY7H 4AQYB 3T56B 5EKKA 1FRNA 3QVNA 4IHJA 1E3XA 4O4JB 4YALA 3I70A 3CCMB 2F0GA 2NUCA 3FVQA 1WDTA 1RSOB 1MBYA 3ML0A 4QJFA 2R9VA 3A35A 1VF5C 2I46A 4JI6Q 4XBFA 2C5HA 1PFBA 2WAQB 1Y69U 4XOTA 4TUYB 5CB4B 2EILC 3SEJA 2HJFC 4P74A 2IX3A 5D3IB 3R3OA 1ZWIC 4LF8B 5KUKA 1EY8A 3RZDH 2WSSA 2F0EA 5EMNA 3HKCB 4ABMA 1Y1VB 4EKWA 4LF6Q 1PH6A 3VQYA 2ZZQA 2WR8A 1TKWB 2CQAA 2KENA 4ZYSA 3KF6A 1KXLA 4LF6B 3GTOB 3ZMUA 2VB3X 2EY6A 1NKDA 4K2LA 3C46A 1K34A 2J0TD 5LOVB 5A35A 1ZL8A 5FLMH 4MTXA 2XGJA 1CZGA 1IB0A 1EOTA 1STBA 1N36O 4LMQD 3MC0B 1YJWA 3CSXA 3BG3A 4II3A 4DUZQ 4G7OC 1I6VC 1PMRA 4QE7A 5LA6A 5CV6A 1ENVA 3AGQA 4UPAA 4BWAA 5K1XA 5LP6B 3M4YA 1CNEA 2R92B 4JI3O 2UXCQ 2D3OW 1OGJA 2EY5A 2JYOA 4WBNB 2LFRA 5E6TA 4RFBA 4BBSG 4WZTA 5J3OA 3Q23A 4MVOA 5F4MA 4DR6L 4FPPA 4P9OA 1Y8NB 2Q6IA 5CV4A 4PV1B 2WACA 1QGAA 1ILPA 3VR3A 2KCTA 2E5LB 2PCFB 2HLDG 3K0GA 2JJ2A 2HEPA 4RD2A 4DV0O 3D4RA 5CMDA 1YI2V 3NTHA 4YY3B 1JJOA 1CP9A 1UD3A 3BDCA 5DECA 3KLSX 5G3LD 5FO9B 2B5UA 2WAQG 4X66L 4WORA 2C77A 5BZBA 4JI7B 2OCCB 3GWOA 1GUSA 3A2FA 1SRUA 4X62Q 4KY6A 3WWVA 1BBXC 5LHIA 1PKXA 2ZTEA 1M5IA 3K79A 4O4IA 3PUWA 1KK1A 2QM4A 2ZCEA 2EULA 2IJ0A 5EKLA 1F4NA 1T6ZA 1KHIA 2VXWA 4N8FA 4GKKO 3KDFB 4WJ3M 2E1BA 3S1QB 2E2DC 1KL9A 1E1OA 1FGUA 2Z4HA 3WBKA 2JJ1A 4JASA 2V1DA 3MAQA 1XI1A 1IJFA 1V54B 2ZXIA 3CP2A 2LXKA 3OTFA 3TBIB 1G7TA 3BC9A 1N05A 5BSXA 4C3IH 3KJOA 4XQNA 3J81E 1VQ9A 5IOCA 1K8OA 5JPNC 5BR8L 4FF4A 3A7LA 4P72A 4RQFA 2ZZFA 3OEEA 4A93H 1ML0D 1I7FA 1XL6A 5BR8O 5I2YA 3OIPA 2IU3A 2MO1A 3HOXH 2YU9B 3S1NB 1GAXA 1QG7A 1GM5A 4FLTA 1H8HA 1TWGH 1HFGA 1YEWA 5LMNQ 2EDGA 5IY5B 4A3EB 2ZZGA 3N2KA 3QOJA 1LTLA 3RNUA 4X05A 4R50A 3Q6RA 1N34Q 2CW0D 1PZID 4YWKA 4H9GA 2J7ZA 4DR2Q 4Z9CB 4LFBB 1YITB 4G7ZC 3BRCA 1VQNA 1F2LA 2Z9HA 4ZIBA 3M8AA 2E5LL 3H3VH 4OO1H 4DRXA 2IJHA 1FD9A 1E64A 2RCFA 3D8GA 3ONAB 4P25A 1IW7D 2ZR3A 5T1GA 4UB8Z 4X89A 3D6CA 3AG1B 1OCCC 2VZLA 4HIKA 1RM1C 5LGUA 4P6YA 2XN9C 3PO2G 2JEBI 2B39A 5BN3A 2DUDA 1PH9A 4PQXA 4ZCLA 4BIZA 4LF9O 3OZUA 2RA4A 1N0JA 5CA1B 4NCNA 1ENCA 2UUAQ 3RWRD 2BA1A 3CCEB 3L73H 3M85A 1W2BA 4Q6GA 1JOOA 1KTKA 2Q2UA 3RYHA 1WCMB 3E8BA 1H42A 3A3GA 1I4GA 3FEWX 3I4MG 1OCOC 3SK8A 1H38A 2FINB 1DONA 4F6RA 3AG4B 1Q3EA 2R6GA 1HWYA 2XWBB 3AG7A 3ISXA 3VMFA 5DS0A 5AG2A 2QEJC 2VL6A 5LMUO 3CD6V 1XWEA 2G5DA 2RQ6A 2F43A 4AF6A 2JA7G 2DQ3A 1U4MA 1NUCA 3K0XA 4ZLTF 2L12A 4HAEA 4ZKBB 1R4PB 4JI5Q 1XILA 1PH7A 1IBMB 3CRKC 1I6HH 1EN5A 1B70B 4BY1G 3SKBA 1DLBA 5BMVB 3AG3B 1UNSA 4NB5A 4NXNB 1Q3LA 3VR5A 5HGQA 2I5HA 1MSGA 4UCVA 1IBMO 2LY7A 5DAUA 2K03A 3U9OA 1NS1A 3MFGA 1XMOL 2QF7A 3HOVB 3AG2C 4JI2O 2HHHL 2RKSA 4UCTA 1L0YB 3ASNC 4RCNA 1R9TH 4QPKA 4JV5Q 2DIEA 5JAVA 1HNWB 4C0SA 1BUVT 1XXGA 3UO3A 2YIAA 1QJOA 4GKJQ 4FWTA 2Q2HA 1XNRQ 5F4JA 1TWFB 3M99B 1EWYA 1I5FA 3H91A 2D74A 4H37A 1GN3A 2Y0IA 5L3EA 3K6OA 2XNDG 4AILC 2DWEC 2VB2X 1Q46A 4B3XA 2CH7B 3HKEB 4TKOB 4X07A 4K8IA 4X66B 5H1SE 5IT9E 1E1QA 3VA5A 3N2GA 1PPJH 1N32B 2JVDA 4ZHQB 3H1JH 4JYAO 1Y8PB 2YI8A 4JI1B 3RYCA 1AE2A 2Z4IA 3TMEA 4DV2Q 1GM9A 4IPDA 2ES2A 2B63H 4TVAB 1Q90A 1XX8A 4BIUA 4DR5Q 1G2TA 1HHVA 2GVBA 2Q73A 4QFMA 3IGAC 1X3EA 4ILWA 4MIUA 4KMUC 2EFGA 2WZPP 2WLJA 5IGBA 1PFSA 2XTAA 4XLHA 4PG3A 3CCLA 4YAUA 2JA7B 1TUEB 3CP1A 2YEVB 4U9UA 1ICFB 1PYBA 2PNHA 4FO2A 4NP5A 3VBBA 3D0FA 5C0XG 1V1PA 4JAUA 1NAPA 3IFDA 2BSKB 1I8DA 2KG7B 1SKVA 1K8AD 3M3YB 3AK3A 2QWPB 2VUMB 1IXBA 5KX5B 1TWAH 3LNNA 5KRUA 2PZSA 3VO1A 4LF5B 3CCMV 1VQGA 5CYUA 3RN5A 1EFCA 3K06A 1GUOA 3OMCA 4DR6O 3PF5A 4O4HA 3WU2Z 1G6ZA 1YIJB 1EN6A 4C3JG 1VQ6V 2X6WA 1S0VA 1VLOA 4NNJA 5H9CA 1KZLA 2CAZC 3CCJB 1Q12A 1F9PA 3NBIA 4G2KA 2PNRC 3N2GB 1SERA 4D7TA 4G27B 1BSMA 1LUVA 1R73A 1NVPB 4FLWA 4DR7B 4LF7O 1HA3A 1ZUNB 4TMXA 3WXMA 1BCPC 2B8GA 3BU2A 2VWJA 1WSRA 3BPZA 1EQVA 5IT9N 2O4XA 1SA0A 3FKIB 1HPCA 1CA5A 1VJSA 3HKBB 3D36A 2HVJC 4P12A 3NSWA 2D0PA 1FNVA 1KLGD 1KAAA 4IALA 4WFEA 3J81L 3G6EA 1WD1A 1EP2B 1B9NA 1WU8A 4C56C 3CAMA 3HKDB 4G57A 2OTLA 4RDJA 2BCOA 5I9OA 2JA5G 4YCUA 4FLVA 3RZDB 1NJIC 3I1FA 3GB7C 1JA8A 1N33B 1HW7A 1Q7YD 1X6OA 4PDLA 4YJ2B 5FPOA 2D9UA 2WP8J 3MEFA 4MTNA 2EQSA 2A8VA 4RWUA 3OJWA 4TV9A 1ZM4A 5D5PA 3MXUA 4JBWA 3GTMH 3JD4A 2LS01 1B50A 2VQEB 1D2EA 3V96A 2NNUA 2E74B 5NUCA 3HZXA 3K81C 5EGTA 4I65A 3S3WA 4H44B 1N32Q 5K5PA 1T6YA 4PA9A 1UEBA 4A93B 1NR7A 4FJCC 3GP7A 4DR6B 4A3GH 2N78A 3QG1A 5E1FA 3OGIB 1N07A 3NWSA 3OR6C 4DQKA 1Q90D 1CHPD 2F4VL 4OIJA 4KD3A 4JI6O 2RJZA 4YHHQ 1A8VA 2LGWA 4KJOA 2NVTH 5GV7A 4DR4O 5M5XH 3JAMc 1Y0RA 1K28A 3HKZE 3R65A 1O9GA 1Y1VG 3S1MB 2WPDG 1IBLO 3SPCA 2GJPA 2YWHA 1RM1B 2PGGA 4OOVA 2F03A 4JV5B 2K50A 4BY7G 1YNNC 2K5QA 2P67A 3K0DA 1PFMA 3PVDA 1C0AA 2BTOA 1GM8A 4WFN3 3D36C 1RL2A 2ZNJA 4IIJB 3RT3C 4ZI7B 5JWPA 3PIP3 4A3GB 1DCZA 5JJKA 1S0UA 2XTIA 3FB8C 2OWOA 4RD0A 2K32A 3A8KA 4O2DA 5ELFA 3WDNA 4GKJL 1VF7A 2GK6A 3GTJB 3GQBA 4I5SA 2F0WA 4FXGC 5C4ZA 1GAWA 5CBEE 1T9HA 3SDZA 4MSWC 4POGA 3I4OA 5ELCA 4MVUA 1VIBA 3GTGH 3LWEA 5ISRA 4OX9Q 2P06A 3GVJA 1PNKA 4TMVA 1ZEQX 3ZYYX 4AQYQ 4JI4L 1SYDA 1OHHG 4U68A 4GNXC 1S5LZ 1BO0A 1JNYA 1QX4A 3T4AC 2QKSA 4NTWA 4CZZA 5LL6Y 4QUZA 2W6JG 1XDCA 2P4VA 5EZYA 4UZFA 2WLLA 3BHPA 2PE3A 4NXNO 1CZWA 2OCEA 1BCPD 2AQ3B 1IVSA 5C3XA 1GMGA 1BQZA 4I4TB 4IUPA 4Y52H 2NZOA 3R2TA 4B3SL 3Q6SA 2B63G 2DY1A 4PA3A 1QVFU 4RPDA 1YJ9B 3OAAG 4ICGA 2YWEA 2K05A 3FKIH 4O1NA 4IIJA 4ZI7A 5EK0A 4ULLA 4E6IA 1G6PA 3A8JA 2SDFA 1XFOA 4LFAQ 1YI2A 4B3RQ 4DFAA 1R3JC 3HOVH 1A0IA 1URFA 5M3FH 2E76C 4B3ML 3A74A 1MZFA 4LH6A 4RD4A 3SJBC 3OUFA 4X7CA 2QKAA 4PDVA 1PNMA 1OZ0A 5TRDA 4X65O 1V8QA 2RHSB 2EIKB 4R6ZA 4KD4A 5C4XH 3AFQA 3CCRV 5I6YA 2JS3A 4QNHB 1Q81D 1R6TA 1WB8A 4J7KA 3KZIZ 1C4QA 1V0EA 1VQMV 2BDOA 1DF5A 3OFNG 1SNDA 1WA8B 2KQ3A 1XB2A 2QN6A 2CQOA 2LP7A 2EY1A 1P4RA 3ZZ0A 2X6CA 4DNTB 4DR1L 3MFYA 2LFNA 4NXNQ 1NBMA 2OTJV 4JI2L 3U4VA 1CSPA 1Q6UA 4DV3O 2X85A 1EFTA 4DUZL 4H44C 2ZDIC 4RGMA 4ZCKA 2F0IA 1BNZA 1GHJA 4A3CG 2E2IB 2UXDB 3GO5A 1VQOV 4I4TA 2B2UA 4MZ9A 4PV1C 3A8IA 3B8MA 1SNQA 5FA6A 2JA5B 4UAJA 1FFXA 3VR4A 2NN4A 3FAVA 3BY1A 1GKFA 1EZ8A 4NDXA 1IBLB 2YSUB 1MSWD 3OT7A 1XNQQ 2JA8B 1AI7A 4EQNA 2R7FA 4IPHA 1RTNA 1A32A 1ASZA 2B1GA 2AQ1B 3CXCU 1BL8A 1YNND 1BCPB 2K6AA 4JTDB 3L3OC 3CCMA 4ASUG 1K8GA 5BR8Q 1G7RA 4M4SA 4DV6L 1XEQA 3EHBB 5DSZA 1S72V 4DO2A 2PY5A 4ZGQB 2EBOA 2QTZA 5FNVA 1HFNA 3C3SA 4RM0A 1F20A 2YU9H 4DV2B 3S1NH 1S40A 2L15A 3BVMA 1U96A 4DR3B 4K6LA 1MIUA 3FP9A 3O9OA 2LW1A 1V54C 4A3LH 1YZBA 2CNDA 4A3EH 3LSQA 1E2ZA 4RWSC 3JD2A 4G28B 2B7BA 5F2DA 1XREA 3H1HH 3U0ZA 5IYCH 5LOVA 3CRZA 4LJZC 5B1OA 4OOXA 2BE5C 4RCOA 1AI6A 1E1RG 2RDGA 3HRZC 4L8JA 2B2VA 1N06A 1F2ZA 1WPXA 4U7OA 1FFTB 4LNQA 3D8CA 4C2MB 2YTVA 2AHZA 2HDNB 1KD1D 5EYPA 2X3UA 1CUKA 1JWUD 2BOSA 4JI7L 2A73B 1G8MA 3M4OB 2P4KA 4KFMA 4WF9V 2ZBUA 4PAAA 3CD6B 1A2UA 1ELOA 2QJ1A 1EFRG 1L0NH 4JI7O 4KHPQ 4C7UA 5IYWA 1K0SA 3NK9A 2IPKD 1PFNA 2EYHA 1E24A 4A3JG 2CGOA 2CTRA 5DN6A 2L5TA 1XNQL 2NVTB 4XORA 3ZEDA 5FL7A 1YVCA 5IP7G 4KUMA 1AN8A 3PO3H 2DJVA 1NNXA 2GN5A 4PMBA 4L6TB 4A3MG 4BBRG 1JB7A 1GRJA 4KHPB 2EY2A 3EIVA 4J9YB 3BCFA 3ZIAA 2NN6I 3IKJA 4R4OA 1BVSA 5FIUA 1UJWB 5LMZA 1Y14B 2B29A 1JJCB 3RBZA 4IHJB 1ZM2A 1EFID 1TY2A 3DC5A 2F0MA 2JEXA 3E2EA 3U11A 3MWYW 5FO1A 1G291 3WB0A 2UUCB 4IUVA 2VJJA 5EPJA 3J80E 5JVDA 1II3A 3SLNA 4X64Q 2IY5B 5FJ8H 3VDYA 3T53B 2ZE6A 4ZCIA 1X32A 1GAQA 1N32L 5BN5A 1LT4D 3K7UC 5LMNW 1QZGA 3TP5A 4XLEA 3FPKA 4ZKIA 4LH7A 4J7JA 2K14A 1FRQA 2JA9A 3GV3A 3PIPA 5C8YA 1QLNA 2PMDA 1U4PA 4G4KA 4ZBMA 1WVLA 4NTXA 2PW7A 4LF6O 4Y9UA 2F0VA 1PRTD 1SNOA 2A9HA 1WOCA 3I90A 4X66O 4JK1C 2F0LA 1NMFA 1YEZA 4HMJA 4HSVA 1AR4A 3SR2C 1NJIW 4QV2A 4RCZA 3RN2A 2Z0SA 3T13A 4I7ZC 4JAAA 1YJWB 1BCPF 1QBZA 4I9QA 1YHAA 5JJNB 4RHRA 5KHIA 3OW7A 3CCSB 1M57C 5A88A 2ATWA 4AF7A 4DV5L 3QJYA 2ZXOA 4KXRA 3CPWB 3BZCA 4LF5L 1WLEA 2Q6LA 1FJGQ 1J5EQ 5IYDG 1IBLQ 1VQNV 2Q9LA 3GTPB 4JI2B 1VDZA 3EA6A 2Q68A 3HOZG 3L70H 4EX5A 1S76D 4DV1L 1MSDA 2EYPA 2XGTA 1DD2A 1XYIA 2FMMA 2ZDIA 4A3BH 1GK9A 2C5CA 3J80N 1EY5A 2HCJB 3A0JA 4N3NA 2WB1G 2Q0OC 5B3SC 2HUGA 1RCVD 1Q6HA 5EBMC 1IKMA 3JALA 2OYQA 2QE7A 5H5JA 2F3IA 2HDMA 4QMGA 3S1RB 5K36H 1XHXA 2R3ZA 2CVRA 4TOIA 2RN9A 2CWPA 5ELNA 5HGTA 4JI4B 1CTMA 1HH2P 2FX3A 4DUYL 4K3AA 4A3DG 1O7IA 1NQTA 2UUBO 3UE1A 2ETNA 4YXWG 3GVLA 4CH4A 4NXNL 2UXBB 2XAGA 2UXNA 5KGUA 5J9PC 2A74C 3MXNB 3W2FA 3WY9A 2NB0A 4JG2A 4DV2L 3QFCA 3MTSA 4Q0FA 4JI0Q 2WIIB 3PENA 2QR4A 3J7YW 3BEHA 4BBSB 1RQRA 4O0AA 3CMEB 1M1KD 3ASRA 1FL0A 2YIBD 5CV5A 1AFPA 4B3MQ 1F77A 4N23A 5CA0B 2OCHA 2PI5A 1EY7A 5JOBA 4KP4A 1KC8W 1CEZA 1Q86D 3KKYA 1KTVA 3FHWA 4YY3Q 3ZHQA 1RODA 4LFBQ 4M53A 2OT2A 1MSHA 2E2HB 1BZKA 1KB9F 4X64B 2BN4A 3KF6B 4X3SA 3JAWB 4EEQA 2R93H 5DNFA 3BVZA 3OJXA 1E3PA 2F52A 4IFDG 4JV5L 1JMCA 1PA6A 4MTOA 4RCYA 5TR9A 3BCDA 4QQBX 3MEHA 4LFAO 2OIEA 3GTMB 3JAKB 1A2TA 4BY7B 1BHAA 1QUFA 2A1AA 3CPXA 1PTOC 4YJ2A 4OWXB 2QWOB 1D1KA 3MXNA 4CS3A 2B2YC 1JCHA 3BDOA 4C1NI 3WYAA 1Y76A 2HR3A 3BH4A 3H0GG 2XRQD 4EQ5A 5CC4A 3CMEA 1V1QA 1K92A 2WLHA 1EWCA 2SNSA 1ET6A 2EXZA 3I7FA 4R8IA 1GJXA 3FMCA 1ZSPA 2BMWA 1N9WA 2FMLA 4I7ZB 4X7FA 1XHZA 2DETA 1OB2A 3CHXA 4G7WA 1EY4A 4J15A 1R5OA 4UP7A 1DTOA 1HTLD 5ELDA 4K6DA 3FPPA 3AG2B 3T1HO 1B44D 4IUUA 1VQ6A 3SLDA 2WA4A 2X6GA 5C4JH 4XN0A 1P16A 2Z5UA 2OBSA 1JJ2B 4K2KA 3E22A 3M7MX 2I1LA 4FF3A 5D5QA 2NVQB 3HB3B 3HKZB 4A3BB 1FAFA 5EIBC 4DR5L 3I72A 1Z6HA 4UDUC 3PV0A 1WTOA 3S2HH 5JJLA 4O2AA 2ZD9A 4PDMA 4EH1A 2OIGA 2JN4A 1I6HB 2JXMB 5KX5A 2C78A 2QTOA 1N0VC 2GTSA 1YTFD 5FKAC 5L37A 4B3MB 3G71A 4FF2A 3DTUB 4J0QA 1MD2D 1XTDA 2RSOA 3IC9A 3M4QA 5CV8A 1ZM9A 5AJ3L 2XOKA 2LO1A 2ADPA 2W6IA 4JYBA 2F0OA 2JDIA 5ELEA 1AP5A 5M5WB 5JVH3 1VQ8V 1U97A 1TY0A 1STYA 2B2WA 1HNZB 5CV7A 3JSLA 4IYHA 4LCUC 3CCUA 3G4SV 4LFCQ 2WLIA 4DV1B 1VQPB 5FOBB 3RD4A 2ZQMA 4P3IA 2WKDA 1TGOA 4GOPB 4U673 4DV4Q 3OP1A 1J95A 4ZAIA 3OYYA 3EBEA 4RGNA 3DLLA 4R71A 1E3ZA 2SNMA 3EVKA 1SN8A 4RDKA 2YTXA 3OHXC 1W2BU 5DM73 5IYRA 5JEAJ 3TXQA 4TQDA 2DQ0A 1H9KA 5M3MB 3OEHG 4LF5Q 2LJ2A 1OCZB 5BSYA 3GTQH 1W34A 1H9RA 4MS2A 1KK0A 2G9HD 4OONA 1GO3F 1BX0A 3ULJA 3G4SA 2DWDC 2CRVA 3P26A 5EAYA 5IYBH 1LTAD 1I3QH 4JPBW 3J80c 4U3JA 4J1MA 2GREA 1TS5A 3TP7A 1O78A 4B3TQ 4YHBA 5C0XI 1JX9A 1AI4A 3BA8A 3RYFB 1NVPD 2X6XA 4X62L 2ZJRA 2I5MX 4EVOA 4PA4A 1GUWA 1Y74B 2JA6G 1UAPA 4P3YA 1K8MA 4K5WA 4GCZA 2OTJB 1TWGB 3TZDA 4MYTA 1S3OA 4L5SA 2RVLA 4MTFA 1QB5D 4DW1A 3PN1A 1IBKQ 1EYGA 2WLMA 3LDEA 2YC0A 1YX2A 2VBVA 2RHQB 1STGA 5JH7B 3ABLC 1MABG 2AUJD 4LNUA 4A3KG 4JPRA 2DYRC 4B43A 2HIVA 3QFTA 5ELBA 1FXKB 1K28D 2A6ED 4N9TA 4LFCL 4JOIA 4RKBA 1D5NA 1EM1A 5C4HA 1SFOB 3ER0A 1B3QA 2BGIA 4AI8A 4A3FG 4DR2L 1R1BA 2VS0A 1SMYC 4KHZA 1NE3A 1XBLA 2X0KA 4X8IA 4F87A 4MN3A 3KCYA 5FLXL 1OCRC 3JATA 2N74A 3E86A 3FKSA 2NR5A 3P7JA 3T1HB 3RLNA 2AHOB 1L8DA 3K04A 5KA6A 4LF4B 3UDFA 1H8EA 2ATKC 1VQ9V 2W0FC 1E62A 2BH8A 2X0LA 1J9OA 3ZBTA 1D6EC 1F23A 1PKVA 2ZE8A 4DK1A 4XONA 2NN6G 1SAPA 2VUMH 4IL6Z 1SKYB 2X8KA 2XIWA 4JI5B 4TV9B 1D8TA 4KK7A 3G6BA 4XDJA 4AIMA 3KLWA 4NKGB 3F1ZA 5C4XB 3BYYB 5IP9H 2CH4A 1RDPD 5JEAG 4UZEA 3NUCA 4DV6Q 3HKEA 2BOBC 2PLFA 2X6AA 3C90A 2EIMC 1HZBA 2EYLA 5IJ9A 1VQKV 2X6BA 4DV2O 5IGCA 4OXSA 3P1HA 1KMIZ 4JI3Q 2ZT9B 4Y7CA 4QY7A 4IPCA 3ZN0A 4XYOA 2AQ2B 4UCRA 2F4VO 4CH6A 1EY0A 4OWTB 3CC2A 4APVA 3JD0A 3HOWG 1K4CC 1BE3H 4TMZA 1NB0A 4L87A 4ABNA 2KG7A 3JCUZ 5LBQA 4TN1A 5LYJA 4JGSA 1N36L 2EXDA 2UXCO 1PL4A 4NKLA 3QTCA 2B2TA 3VQVA 2FJ2A 3M4PA 2EYOA 2B5OA 3O13A 4JI1Q 1TUBB 4X65L 1SESA 5LMUB 2F3VA 1YIJA 4LWSA 3WG7C 2VW9A 1R4QB 3AGPA 1L1OC 3O65A 2IJIA 2L1BA
chains in the Genus database with same CATH topology
2E3CA 3SK6A 1WTPA 5LXTB 2LMCB 4FP5D 2QCPX 3OIQA 4DV6B 3K57A 3FDTA 4ME5A 2PO4A 3EROA 2G9DA 3MVVA 1LO5D 4UAIA 4AYBB 1SMYD 5IIFA 4XQFA 2M5SA 2F0SA 2RQXA 3D31A 4XN3A 4FLUA 1SE4A 2F0TA 3RGBA 1COWA 3BS1A 4G7HC 4UZUA 1AW7A 1GUGA 2X53S 2EJMA 5J2UB 3QWNA 4DR5B 3DMUA 4O2BB 1M4VA 3K59A 1JCKB 2Q0AA 2CK3A 2SEBD 3NXWA 1EYAA 4LFAB 4IUNA 4KN4C 2TMPA 1FJGB 4JI8B 4FYDA 3SXHA 4AVZA 1TS2A 2MHVA 3JALB 2F3WA 3TZUA 2R61A 2KUMA 1IYUA 2NWGA 5EKIA 2EE1A 1LTRD 5HURA 1KDAA 1KNEA 1O7YA 1RKNA 1VMPA 1RD9D 5KIXA 4IFDI 4FFBA 5LMNB 2IX1A 1SQGA 5IT9L 3RYIA 3VYTA 3NWTA 4OGQC 2EYMA 1LACA 2PYJA 1CHQD 4XMYA 1NCVA 1BF4A 3B2EE 1QNUA 2PW5A 1DZ1A 1QQCA 1QILA 1T5XD 1CQFA 3VA7A 3OPOA 1HCZA 1L0XB 3K58A 1W0JA 4HNAA 3BDLA 4X1IA 3ERQA 2JP1A 2O5IC 5A2QL 1CQVA 1GHKA 1TR5A 2DNEA 3SE0A 3OOCA 2XZOA 3HOXB 3JASA 1G6UA 1T5EA 5LP6C 1Z5WA 1RHPA 5EPKA 3HKCA 1LLRD 2ZT9C 4LAAA 5D14A 1FGBD 3H0GB 1Y8OB 3I4MB 4HIZA 3QOLA 3DM1A 4KHVA 1GOZA 1QCBD 1UEAB 2L4NA 4PHZA 4JI3B 4CC6A 4O2AB 3GTLB 2OF1A 1UD2A 1JORA 1EL0A 2R70A 4JI0B 1WNSA 3R8BA 3DWQA 5JPMC 5FNVB 1EWHA 5CDFA 4IZ8A 3CQZB 3UI2A 4FLZA 2KKWA 1KNAA 4X1KB 4DUYB 3VR6A 1CFMA 2NBFA 3S16B 4XKWA 2D3LA 4HCSA 3K7AB 1B1ZA 3DXJC 2ZIOA 5IK2A 4ID6A 1JMKC 2XZLA 2B2TC 1OB0A 3MHBA 2NYZD 4RAUC 4OO1G 1K83B 5J1ZA 5BMVA 1HZEA 4IUTA 3KEWA 4QUFA 4K8XA 1HUMA 2MUYA 1OHHA 4CJ1B 1NRKA 4DV5B 5JH7A 4EFEA 1DOLA 4LNUB 3VYSA 2ZINA 3OSOA 4G7XA 5J2TB 3VYUA 2UXCB 1C48A 1OXTA 4OIKA 1GUNA 5C8YB 2B2UC 2K5DA 5M5XB 3HG9A 2XZPA 3ZS8C 1I4QA 1RTOA 5C3WA 2TSSA 3NPPA 5AFWA 4FF1A 3A8KE 1V1PB 1HVXA 1E2VA 4X20B 2NVXB 3HOWB 2M2LA 1XMOB 4O42A 2D5DA 1PDQA 1M93A 5FK9C 1ENAA 2HDLA 2XNAC 2EVBA 2Z1CA 1Q1BA 1UD6A 4KY5A 3K0YA 1O80A 3MXGA 1RJTA 1WN7A 3RYFA 1B2TA 2UUBB 2OXPA 3MXPA 5DM63 5C0XH 1PRTB 2PZTA 4LF7B 4PMWA 5LYJB 2IL8A 5ITZB 1H9MA 4DRXB 1ICWA 2QKIC 1E0BA 1DXMA 2XWJB 4XIGS 4DA2A 3PIO3 4PI2A 1DM0B 4IFDH 4F88A 1I4HA 3OMGA 4ZRZA 2HCIA 3CRLC 5FLXE 2EZVA 1JOQA 2B2WC 4DNRB 2E75C 1GUTA 2WPDA 1STAA 4BA2I 1I94B 2A6EC 5KNDA 1JWMD 3J7AV 2JE6I 2JA6B 3S9WA 4K14A 4FM0A 4BY1B 3H94A 3VYRA 1SYEA 4CKEA 1MGSA 5C3EB 4A3MB 3J80L 2WB1B 2KHSA 4O4HB 4K5XA 3H09A 3K5LA 5KMGB 4HTHA 3TN2A 5CBAE 2IX0A 2WJVA 4KTAA 4EGVA 2DY8A 3DWPA 1G8ZD 4XLAA 1TIID 3BZDB 5EZYB 1D2BA 1OXSC 3HKDA 4DN4M 3I4NB 3R93A 3EQLC 4B3TB 3OE7A 2BTQA 1IW7C 3D6WA 4PNYA 1C8CA 3GVKA 1H9SA 3D3RA 5D65A 3IFTA 1TA8A 2LZJA 1VMCA 2YXLA 3KBGA 3IAYA 1KU9A 1J8IA 1Z5VA 1TT2A 1LTSD 4UFZA 2ICIA 2L0CA 1EU4A 3RFRA 1S5DD 3NHHA 4C3HB 2IT1A 4S3SA 1AP0A 5E4XA 3URYA 2WINB 1PTOF 1DYQA 1A3UA 3OTOB 1IKLA 1TVKB 2ZXRA 4HCEA 1DOMA 2WV6D 3R2IA 1DOKA 1W9XA 4IURA 1FR3A 2EPBA 4YJ3B 1X3PA 1F2MA 1O7ZA 3S2DB 1STEA 4DV7B 4L63B 2R93B 3EFXD 1AEXA 1CI3M 2KJXA 3JASB 1QE6A 4B3GA 2NVYB 5JQGA 1IHZA 2F95B 3Q22A 4OHJA 2E74C 2J4XA 4XDXA 3WQZA 4LR3A 1PRTF 5KNLA 5IYZA 1X3QA 4BWGB 4O4LA 1SEBD 2YIBA 3TSSA 3U9SA 3A54A 5EYPB 1KDCA 1OXUA 1EYCA 1XTCD 3PO3B 1TQOA 4NVPA 2KEEA 3BVGA 3SR1A 2A5HA 1EYDA 3Q0AA 5JEAH 4EQOA 2WJYA 2JSOA 3A3BA 4I50B 4PI0A 3S14B 4ZKCB 5CR3A 1XMQB 3AB9A 4XT1B 2VNUD 4ZUIA 4KV6A 2RDHA 4K8ZA 1HQMC 4DR2B 3I4LA 2GJKA 3RMHA 2K01A 5KHJA 5KHGA 4CC5A 3SGIA 4M1UB 4J8QA 5KNBA 2A6HC 2EJFC 4C3IB 4P2CB 1HTPA 1ILQA 1XNRB 3JU4A 1SSOA 2EYFA 4NW2A 3OEHA 4DF7A 3K5MA 3F2UA 5JVG3 1NT2B 5JCOC 4DU9A 4I55B 1SYBA 1Q43A 4N9PA 1GXDC 2HHHB 3UT5B 5KEEA 1SYCA 3L7ZC 4II2A 3RLFA 4Z1MA 3NWSA 1QNKA 4KN7C 2YYZA 5COYA 4JMQA 5HKKA 1M8AA 3TDQA 4V190 4CS2A 3BA9A 1W6JA 1D5AA 4B3SB 3QO2A 2DNCA 5KHKA 1EIGA 1CT1D 3VQXA 4IN3A 1I18A 1WTVA 4OX9B 1BR9A 4X1KA 4X3KA 1A3TA 5E4WC 1EU3A 5IGEA 2PYLA 3C2PA 4BA1I 4B9WA 3AU7A 1I4XA 4DXFA 3SJAC 1S5JA 3EVQA 5IJ0A 3KBXA 1U9RA 5K36G 5I2XA 1OO9B 3GV6A 1LT6D 4DK0A 3U10A 4XT3B 1ZYRC 1QWYA 1HA6A 1JE4A 5FPRA 3PO2B 3RYHB 2GA4B 5C5MA 3GTQB 2C9OA 1WTXA 4CJ2C 3RYIB 1ZKOA 2F1MA 4OL7A 5CB4A 1EZ6A 2JIZA 1D5MC 3DSQA 4QB4A 1KABA 1ZXTA 4X3TA 1N34B 1LTBD 2GJRA 2KVOA 3DEOA 3VQWA 4FM2A 5IWAB 2V31A 2MP1A 5JVDB 3BABA 2L9HA 5M3FB 1BMFA 3FPUB 3G05A 4FVMA 4WBNA 3DDYA 4ZOLA 1KMHA 3SHLA 4C3IG 4CKBA 4XM3A 1KDBA 5G3LF 4BW9A 4PMCA 4CS4A 1EIHA 2FFKB 4KI0A 2M00A 3DUZA 3P20A 4UCOA 1NR4A 3I91A 2L11A 5JCOA 5LHY1 4C3JB 5C6AA 4DV4B 4F6RB 2V7QA 1SE2A 3CU7A 1JB3A 4XL9A 3JAKA 3I8ZA 2NTTA 2R9AA 2F4IA 1TWCB 3V05A 3T51B 3PUXA 3SVMA 2B2VC 3ETQA 2D3NA 1BQQT 2F0JA 1JICA 2PZWA 4X20A 1PZJD 4EB6B 4BS9A 3NQTA 2UU9B 4TQFA 1LV9A 1BOSA 3N2KB 3SEBA 4R9WA 1S4ZA 3JAML 4YEJA 4B9XA 1QHTA 2Q7GA 1B44D 2EX3A 5IGDA 2A68C 3NBHA 1EFRA 1P49A 2I07B 5C0XJ 1IL8A 3A7AB 4K5VA 3PUZA 2B2YA 4DR4B 1N36B 4JI6B 1MABA 1B9MA 3KLRA 2BTQB 4O4LB 4TSSA 5J2TA 1SYGA 1STHA 4F7XA 2KEDA 2P5OA 1SA0B 4FNFA 5EPLA 2KOLA 2HLDA 2HCCA 2K28A 2PZUA 3E22B 2ID0A 3TP8A 5BN4A 1V0FA 1BPLA 1EY6A 1F9RA 5GONB 2P22C 4AHCA 4M8AA 3D4WA 4YIJA 1XNQB 4R8NA 4CBVA 1S5FD 4H7BA 4A3FB 5KMGA 2FHTA 2K04A 3PUVA 1VCIA 2EOTA 3TP6A 1KLUD 4XQJA 4X3UA 1Q5OA 5LXTA 1A6XA 3E5SA 2Q7HA 1A15A 1LT5D 1WD0A 1AZPA 5FO8B 4Y7NB 1EY9A 2Z8LA 1JWSD 1E1RA 2ZTGA 1OXVA 2B8FA 1SNCA 3OAAA 3A8IE 4ZK9B 5GONA 5C44B 1TU2B 2F0FA 2YI9A 1LABA 1TWHB 3ZPNA 3THOA 2NZ1D 1Y1WB 2XSCA 3UT5A 2PTMA 3G6JB 4TQUS 4XD7A 4WRDA 5J2UA 3HS0C 3Q24A 2F0DA 3X3MA 4A3DB 5IJ9B 1SNMA 1UD8A 2F93B 5E3FA 1SXTA 2EYJA 3NTIA 2VWKA 4EFBA 4HBNA 4TV8A 2ZM6B 4HEDA 1YNJD 4CH5A 1LTTD 3OWEB 2A69C 2R7ZB 4JYAB 4H13C 3HEJA 3QF7A 4IQZA 2KCCA 4G6IA 3GTGB 4K0KB 3JATB 4TUYA 4GZYC 2CHBD 4B3RB 2MPMA 5C4JB 1J5EB 2LKVA 4H0LC 2K1BA 1WTHD 5C5LA 4LF9B 1EQTA 1I50B 5JJJB 1ZYRD 1BXTA 1NR2A 4CJ0B 2F0NA 4IFDJ 5KYIA 4QUCA 4ZQ3A 3T13A 4B08A 2KA7A 1JC7A 4XTCS 1SFOB 4I55A 4E0FA 1FYCA 3NP8A 1X4TA 4MHEA 4B3FX 1M4UA 3SK4A 4O2BA 4Q5VA 5K1PA 4FLXA 1B3AA 2MGSA 3PUYA 3JARA 2QILA 4UCUA 2PQEA 3S15B 3RZOB 1TUBA 3BYTB 4KY7A 1R9TB 1TVKA 1I4RA 3T16A 3KLSA 4YJ3A 3JSNA 2ICEC 4KJNA 3P75A 3WB2A 2VJIA 4P22A 4WJWA 2K5WA 4XLFA 1I4PA 1ESRA 1U4RA 2EJGC 1HQRD 4XR6A 5DEHA 4J6HA 1FD7D 3SK5A 2N88A 2M9VA 5D3DA 3HOYB 3S17B 4A3JB 4FXK