3W5VA

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
297
structure length
297
Chain Sequence
KCSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
total genus 86
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5vA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5vA02
4PC3A 1VQKB 1R5NA 2DCUA 4RD0A 1AIPA 3CC7B 3VO1A 3CC2B 1BQEA 1FNBA 4RD1A 4ZCIA 1W35A 2D74A 3WYAA 4FN5A 4H9GA 2FX3A 1YJ9B 2BV3A 4FWTA 1QVGB 1OB5A 1H42A 3E1YE 1QG0A 1ZUNB 4ZCLA 2C78A 1IJEA 3AVWA 3AVTA 3CCQB 2EIXA 4RD3A 3ZZ0A 1XE1A 4M0LA 3VO2A 1B2RA 3G6EB 2BSAA 3WXMA 3QFSA 1WDTA 3OZUA 5THXA 2ZITA 4WQMA 4M4SA 3LRXA 2BMWA 4B4DA 1VQ6B 4NBSA 2BF4A 1VQNB 5JBQA 1YJNB 3G71B 3W2HA 4MYUA 4J0QA 4B47A 3B82A 3CCJB 4M2LA 1D1NA 1K73D 4G5GA 2BM1A 3CCSB 3WNCA 4B44A 4B48A 1FNCA 1K9MD 1VQ5B 2CNDA 2QN6A 2VYQA 1TTTA 5TR9A 4U9UA 1Q7YD 2VNIA 4TMWA 2B7CA 3WBKA 1VQ8B 2OTJB 1M1KD 1N0VC 1YI2B 2VNHA 1NDHA 1Q82D 1E64A 1G7RA 2BGJA 3JQPA 3OJWA 2YWFA 1E62A 3CCEB 1CNFA 1FNMA 1W2BB 1VQMB 1XB2A 2J7KA 4YAWA 1EWYA 3AGPA 2B7BA 3AVVA 3VMFA 3AVXA 4F7DA 2XEXA 2HDNB 2YWHA 1YHQB 4AC9A 1YIJB 1QUEA 4B3XA 1M90D 1J9ZA 2GQFA 2XNCA 3CMAB 1FDRA 1KJZA 1QGYA 3ZBTA 4YHBA 4ZGNB 5H59A 4RD4A 4RCYA 3OZVA 2QA4B 3LVBA 5EMNA 3WNDA 5KSWB 3CCLB 2PIAA 3QFTA 4LBZA 1KK3A 4YAFA 4R71A 3CXCB 1KK1A 1A8PA 1U2RA 4M53A 1QGAA 3QFRA 2NPFA 1KQSB 2HMAA 3CC4B 3MCAA 4AF7A 1GR1A 1ZM4A 4YALA 3W2GA 4RCZA 2QEXB 3I55B 4HE5A 4QFMA 3OJXA 1VQPB 2DERA 1DG1G 1VQ4B 4HE6A 4EH1A 2GPJA 1EP1B 4B43A 1FRNA 1ZM9A 1VQ9B 3W5HA 4Y7CA 1QFZA 1DARA 1N0UA 2EFGA 1QFJA 1SM4A 4TMTA 2BM0A 1TVCA 4RD6A 5TY0A 1JJ2B 1G7CA 3W2FA 3E20A 1F20A 2QTZA 5HXBA 2PLFA 3JQRA 1JA0A 3SJZA 3W5UA 5GV8A 1Q81D 1FNDA 1D8TA 3U6KA 1KRHA 3LO8A 4C43A 3W5VA 2AHOA 4Q7JB 2BGIA 4Y9RA 3WNBA 2OK8A 3CCVB 1UMKA 5H5JA 2HCJB 2YWEA 4QHYA 3CMEB 1IJFA 4N3NA 3AGQA 3PENA 3QSYA 2DEUA 2R6HA 1IB0A 3P26A 3I56B 1N8RD 2PMDA 1VQLB 4ZGQB 4DQKA 2VZLA 5TV2A 4ZCMA 1EXMA 2RC5A 3ZZTA 1TLLA 1QH0A 2DY1A 1QVFB 4LC0A 4IW3B 2OK7A 1CNEA 1EP3B 4P3YA 1KTVA 5AN9A 1KK0A 4G1VA 1W34A 1DDIA 3P27A 1QUFA 4C0SA 3I1FA 3CD6B 1ZM3A 4PC1A 3FJOA 2XNJA 4FK8A 5GV7A 1EFTA 3QE2A 1R5OA 4PC7A 3CB4A 4YAOA 4TN1A 4P6VF 3MHPA 1QX4A 4TMVA 3ZZUA 2C77A 1S0UA 1BJKA 1B23P 3VNVA 2BVNA 1GO2A 1JNYA 3FPKA 4ZV4A 3CCRB 3ZC3A 2QMUA 1BX1A 4PGOA 1BX0A 4PC6A 4LBVA 1JB9A 1GVHA 1R5BA 4LBWA 3LYUA 4RJLA 1TUIA 4LBYA 3OW2B 4M1KA 3U6BA 4TMZA 3B78A 1D2EA 4MYTA 1HA3A 3WY9A 2QTLA 2VNKA 1S72B 3A1FA 1G7SA 4UAJA 2VNJA 4TMXA 1F60A 3CPWB 1VQ7B 1E63A 3W2EA 2YWGA 4NCNA 2X3UA 1KD1D 2DETA 3AVUA 1EP2B 4Y9UA 1OB2A 4YAUA 1QFYA 2RC6A 1OGJA 3W2IA 3CW2A 4ACAA 2QDXA 1GAQA 1W87A 3WBJA 2E1RA 1DDGA 3G4SB 1G7TA 1SKQA 4N3GA 5DSZA 3ES9A 3CCUB 1H85A 1EFUA 3V76A 1FRQA 2B5OA 1YJWB 3J81k 1ZM2A 2BPOA 2OTLB 4PC2A 1YITB 5FA6A 3B8HA 3CRZA 1KC8D 3MMPA 1AMOA 1K8AD 1GAWA 3CCMB 1JA1A 1OGIA 1I7PA 1EFCA 4K1XA 4RD2A 1VQOB 1NJID 4G1BA 4DQLA 3JQQA 1KK2A 1QGZA 4AF6A 1ELOA 4ACBA 2CRVA 1CQXA 3U2QA 1GJRA 3VNUA 1Q86D 3AVYA 3OZWA 4BPRA 3QFCA 2BN4A 3ZBUA
chains in the Genus database with same CATH superfamily
1E7SA 2VDNB 4ZOEA 2P9CA 4EEKA 4BKRA 4RF3A 1SKUA 1AS0A 1CHDA 3WGNA 3JAMA 3NWJA 3OE4A 1U31A 5BUCA 1PK8A 2D5BA 1NUQA 2ZPAA 3UH0A 1UKBA 5LU9A 1C8BA 1F3OA 1U0NA 4ZZ2A 3N2IA 5CRIA 1FUKA 1QIIA 1WZCA 1U7TA 2H1RA 3IIKA 2IUEA 2VUUA 3KJQA 2BKAA 4MKHA 4C0BA 2WZPP 4F6LA 2BI4A 1Y42X 3AIIA 2Y1OA 1AKEA 3KT6A 1AXEA 1GV0A 4UATA 5GM2A 1X8XA 4REQA 2Z09A 3LL7A 3HZHA 2CVHA 3L8YA 2XDQB 1GG8A 1WV1A 4BO6A 1O95A 1A1VA 1DU4A 3G0GA 4D45A 1FMFA 3COJA 2ZJ1A 1TUGA 1WO8A 2MYPA 4ITVA 3O8NA 4ID3A 3E1YE 1BROA 2ZZFA 1FUEA 3QHQA 4Q9JA 1KP3A 1IG3A 1TLTA 3M70A 1KOLA 4K9SA 1L8AA 2NQ8A 4PSVA 4R1SA 3M6VA 1B15A 4UDOA 4YXWA 3MCTA 4PABA 4FCCA 4EKDA 4AKIA 1Q19A 1VHOA 3A8KA 3I04M 3F6PA 2Z6BD 4MUNA 2XMBA 5B2EA 4PQEA 3LX5A 3G6EB 4S1TA 4YV2A 5TS3A 4KN9S 2GO1A 2P4UA 4RMGA 4X66B 1I3CA 3RGGA 3W6UA 3HYNA 2BGKA 1HDCA 1U3WA 4A6DA 4WQMA 3D0QA 1Y0YA 3CPSA 2BCEA 3PPIA 4K88A 4LZNA 3HO1A 4DQ0A 2E82A 3FUUA 2YV1A 3KYDB 4NVRA 1RVV1 2C0PA 3OIWA 3WA6A 2JGAA 5F73A 3G79A 5LP1A 1VA5A 4KWTA 4QYMA 4BMPB 1MAAA 3ASVA 3I01M 3ZJ4A 4B7CA 2AXQA 4N49A 4J0QA 3AHEA 3O0DA 4BNUA 3C97A 3DBHB 4FSXA 2WD9A 3KC2A 1T9GS 4BO7A 3GDFA 4RK6A 1R6BX 2FPPB 3TSCA 3P2YA 4BJ6A 3HP1A 2QGZA 4JSYA 3VPAA 2R6JA 3A10A 3C16C 4R1TA 5DULA 5JSZB 2BZGA 2X6QA 4RL6A 1GAEO 4Q24A 1B0PA 3W9BA 5BOSA 2VFAA 2P0AA 2KQUA 1RMYA 4Z5XA 5EWMA 1HZZC 2IYVA 3QIVA 2W6MA 2WMOB 4JOQA 1T6YA 4EGFA 4LAFA 1NR5A 1O6CA 4GICA 2IPOA 2VHZA 5FB3A 3AEUA 5D7BA 3V8RA 1JW9B 3PNVA 4DLPA 5SYNA 5JYBA 4G0XA 3KUXA 3PKZA 4FBGA 3EZ9A 1JILA 4F60A 1F8UA 3H5LA 1HYBA 1C29B 5K8JB 3ICQB 3DTVA 2FPLA 1EB8A 3BMOB 2BFEB 4TMWA 3PJFA 4MUHA 4PZAA 1QYRA 1RNLA 2HLHA 4EHAA 1O2DA 1QFMA 1M1KD 5BSXA 1R1DA 1SC9A 3QWIA 3GBPA 4ZI5A 4TLAA 4Q9LA 2HQRA 3W9UA 3OX2A 1T3ZA 4HWKA 5U4QA 4B4KA 3F73A 4N01A 4UEJA 1M6EX 2ZRJA 2WOOA 2FKAA 2F2TA 2H1SA 2GPAA 3D6UA 1E4YA 5JAHA 3DL7A 3MYRA 3OX1A 3EVTA 1V96A 1P77A 3CONA 2Y1KA 3EDRA 3AEYA 3RYFA 3TNDA 3U4DA 4F96A 3KHTA 4YAEA 5G53C 2IOHA 1F9EA 5CLIA 1J42A 1Z0DA 4A9AA 2O1EA 2VK1A 3SXPA 1OLUB 3G8DA 3GEPA 1PV4A 1Y33E 4KN5A 2W2VA 3NIWA 3AGPA 1WW2A 5CM8B 1SZJG 2O3SA 4MI9A 4QBIA 4Y2TA 3AVXA 2PXXA 4LK2A 2I76A 1ZN9A 3N7TA 4J91A 2C7VA 4JITA 3CLRD 1HTTA 3QM1A 4I50B 4MKGA 5CA1A 3U3KA 2X5JO 5BYBA 1O95D 5KCMA 4DNFA 3D6NB 4AKTA 2D06A 3BT7A 3W5JA 2BUBA 2XNCA 2VHJA 1E2NA 1X7XA 2XWSA 3EFOA 2ID4A 4HUTA 3JAWB 3F5DA 3IEUA 3IUPA 1FDRA 1TT5A 4E4TA 2GB4A 4YXWD 4LV5B 1UFRA 4N8EA 4RUKA 4TXJA 1OOEA 1TA4A 4BIIA 4AZ3B 1J22A 4NV3A 3UFXA 2B82A 5KJ6A 1UFQA 3UBTA 1WOSA 1EE2A 2ORIA 2HU8A 2QA4B 2ZXHA 2HNAA 1SB9A 3D4LA 3H9QA 2PZLA 4FR2A 3OA0A 4PZCA 5J43A 2FFJA 2OB2A 2R79A 1K68A 5K3FA 1PUJA 2IHBA 1WRBA 5ALNA 1SHZA 2JI9A 3QU5A 2GAJA 2BI7A 4PE5B 1Q6YA 3D5EA 4I55F 1OCEA 1XLTC 1SQSA 4GM1A 2Q6IA 1VCMA 3EFHA 5KYVA 3IV6A 5JJCA 1EQ2A 4LHWA 2RIPA 3HYRA 4K6HA 2WINI 3SQMA 4M36A 1EWTA 2B61A 2RJNA 3BA6A 4ND4A 4RDXA 3MRVA 3G9UA 5JSKA 1C7ZA 4Q4AA 1W0KA 1E60A 1NC3A 3ONDA 5L40A 1IC6A 5F4BA 3UYLA 4OX9Y 2CDNA 4RKWA 4KR0A 2JRLA 4S24A 4AW9A 1P1RA 2DLCX 1JDBC 1NNSA 3CH7A 3TXAA 3CRVA 1V26A 2ODTX 1XIVA 1E59A 1ZM4A 3ASTA 1IZYA 1Z2DA 2LR0A 3C7TA 4G5SA 4IQGA 1DUIA 3MGAA 3RFXA 4EMSA 4AM8A 5B30A 4M3NA 1FE8A 3C7DB 3PQDA 3ZXSA 3I55B 1BCSA 1ZS9A 1CJMA 4CUZA 1V8DA 5BQ3A 3U09A 5JAIA 4QFMA 1P18A 3AOEC 4JJKA 1WSVA 4M1QA 2W2KB 2Y3IA 5AKGA 4ZVOA 4AROA 3GNTA 4BKQA 4PQRA 5EXDA 4BNYA 4KO1S 1O96B 1XKXA 2CHFA 1AC5A 3CF6R 3IDOA 1FQOA 2EF1A 5AK6A 2R8EA 5A7HA 3DTVD 2VAWA 3JASA 3DMYA 4I1YA 1O5IA 4HVCA 2CLOB 3T5MA 1RCFA 5AUNB 1X1DA 5DV9A 5JJBA 2BFDA 3LPAA 4AB1A 4MS3A 4YRSA 4UBMA 5E9AA 4D96A 1SM4A 5LZ7A 1ZQ1A 3RS9A 1G66A 1RKVA 4H60A 4CLRB 4GI1A 3I64A 2GT1A 1WEHA 2VQ3A 4MP3A 1NE2A 5LA6F 1IUPA 3ZGVA 4LQ4A 4ZHSA 2B3TA 1DQYA 2QVYX 2OPBA 2HF7A 5JH7F 3DFZA 1TB4A 2W5UA 1VLVA 4PHCA 4MUEA 3UV7A 3PP8A 3FUXA 3J7TA 3WLEA 4E2WA 3EUFA 5EWLB 5AHKA 1L5OA 4ZZIA 5LQKA 2QPLA 3TOXA 3ZD6A 1Y5NA 3FH0A 3P0JA 2PLFA 1MGPA 3L06A 1DXHA 1GQRA 3GRUA 4H2DA 4G0WA 1N5OX 1VLJA 2GTPA 3QPUA 4IMRA 3AHDA 4JNCA 2WKWA 3SJZA 4QATA 3AF4A 1ZJ6A 4EJ6A 4EB6A 2HMTA 2X5KO 1AGYA 1SPBS 1TECE 2WF8A 4N41A 1PGNA 2ENWA 3FFTA 4JLUA 1ZA2A 1XPJA 4KLCA 4Q7QA 1QRRA 4ZHQB 4HTFB 1IB6A 2IEZA 3R74A 4MJLA 4EG1A 4YAGA 2RARA 3LHKA 2DFTA 1LWOA 1TUBB 2UYGA 2YXNA 3DDNA 3HBLA 4QLOA 5HBGA 3WHLA 1EUYA 2YUTA 3DL2A 3DZFA 2HYIC 1B8OA 4Q7JB 2AG0A 2HRRA 1NLUA 3L6CA 3NALA 2GO7A 4IAOA 3VQTA 3A1PA 4WCFB 4HDMA 4Q9IA 5I7VA 1U0OC 4NK5A 5DH9A 1NZDA 3PIIA 2D3NA 3G49A 1NFQA 2K7FA 2XCIA 4F5EA 1JTEA 4CM8A 2GH1A 2AG8A 5KI6A 4E2FA 1WSRA 1VB3A 4J6EA 2NUBA 1WAMA 1QYIA 4GH5A 5JO9A 5HMMA 5KNCA 1SU4A 4LY9A 4MYCA 2ZQ5A 3V46A 1HVXA 3ZWMA 2V8OA 2H18A 1GPAA 1R8YA 3ZY6A 5MGNA 1AA6A 3ND9A 4I5EA 2F17A 2ZQZA 4ZYVA 1LLUA 1YXMA 5DYNA 2UV8A 3A25A 1UFVA 2YRXA 3KLPX 3VZQA 1EUQA 3AR5A 1UWCA 3DBOB 4ZGQB 3V4VB 4E11A 2FFQA 5K0JA 4JC8A 3CZMA 5AKJA 1K1EA 4JLSA 1SG0A 1V1MB 5I7SA 2EFYA 2HQBA 1PQ4A 2JF0A 4Y2HA 4ZAXA 3BEOA 1EJ0A 2WTUA 1Y5MA 4XD2A 3ABZA 1DRUA 2QL6A 2B9EA 1CQWA 1ZIXA 3SCZA 4U9HS 1V9LA 3WLSA 3F0TA 4XPIB 2IBSA 4YT2A 1T91A 1CNEA 2XEDA 1LSUA 4FYHA 4GKKB 3CKKA 1SKAA 3KJXA 3PQ5A 2K7ZA 3R8XA 4FXOA 4KRGA 1CJBA 1KK0A 1DIHA 3IMGA 2E89A 3CLTD 3FJ1A 4NPAA 4BNMA 5K45A 4OXKA 1WNFA 3B1KA 5M34A 5BT9A 2C88A 1BU8A 4R2WA 4A0GA 1XWIA 4EI9A 4QJBA 5J2UB 3MJTA 1RWPA 4DA9A 1KQ3A 4YRMA 5AJUA 2A57A 1H0HA 5JJ5A 1TVKA 1DAOA 2F64A 2VPTA 5E0KB 1CS4C 1TD9A 3BWVA 3FJOA 4B7ZA 2CJWB 1T8PA 5IVKA 1VDMA 4LJ9A 3QA9A 3ZS8A 1VMEA 2VJKA 4P98A 5CB0A 1J9EA 2PRZA 4NJEB 3N5CA 3IYLW 4JV5B 1G1AA 3KZOA 4JKIA 3M1IA 4Y9SA 3LDFA 4MLPA 5J23A 2GKOA 3JQCA 3QHAA 4HN2A 4CIBA 3CISA 2XRMA 4FFLA 3ZDQA 2G7MC 2H5IA 2WU4A 3R8CA 5KWIA 1W19A 2XZDA 3UAVA 2PQ0A 3A3PA 1KJIA 5A5FA 2FJPA 3DMTC 3GPDG 4NU6A 4IDFA 2EKLA 2IUFA 4KH1A 1GQSA 5T4FA 1RHKA 3AB7A 2KI5A 3EIXA 3GLHB 1OMOA 1YNOA 4DB2A 5A62A 4DREA 4BQIA 3AJEA 3K20A 3OEYA 1X13A 2CVOA 2LDXA 2XWPA 2IVFA 3RKSA 3HWX1 3C7AA 4CLOA 3R7LA 1NTOA 3CS3A 1J00A 4O8ZA 5JWHA 3PDUA 3VTFA 4ZDIA 5FEUA 2PUVA 3E70C 2PYIA 3GVJA 3D6JA 3AZOA 3NHBA 3TUIC 3HRIA 5P8WA 5K3SA 1FRVA 2R7LA 3HXLA 2MR5A 1E96A 5K0EA 3TDNA 2BFCA 1JLMA 3UGQA 3RANA 3KQOA 1CX9B 1REQA 3B78A 2BKLA 2EZUA 3IE0A 4FU0A 3V4OA 4G8BA 1HA3A 1FX0B 1OI2A 5EJ5A 5F4MA 3OPMA 3I3OA 2HCRA 2UZ1A 2ZQYA 4JQZA 4EUEA 3K32A 1NSFA 3O4JA 4XSHA 3ZTTA 3ZVRA 1PZNA 1N05A 1N2CE 2Q3LA 4OHMA 4QYIB 4CMBA 3QPBA 1GCOA 5T3UA 4M1WA 2DJ5A 1TLFA 2F1RA 2ZAIA 1TOAA 3K0EA 3WTCA 2CC2A 2IH4A 4NMLA 2CFIA 1YASA 2ZB4A 3QK7A 4PYQA 1NWCA 4RANA 3UUGA 4KR2A 1SA0A 2VWQA 3G8CA 4GGOA 1F2UA 3U7QB 2H9AA 3GQVA 4CHGA 1V3UA 4X3PA 3ZZ1A 1TRHA 4FDLA 4O6VA 2JW5A 3ZZMA 3T51B 1EIZA 2I67A 4DAOA 1PJ4A 4WXMA 4EHKA 2RGNA 4ENTA 2C4NA 3DBIA 3GH3A 5FUXA 3H1EA 4X85A 1QCZA 3D2LA 5BRNA 1JAHA 1K7XB 3DO6A 4KYUA 4DLBA 4Q16A 1KZ4A 4OXIA 4RTPA 4Z4QA 4JXZA 1UDRA 1OB2A 1MO4A 2PH5A 4ZQCB 4PXAA 3IQWA 4JELA 1NXVA 3I9NA 1BHO1 3O1HB 4L6AA 1G38A 4XOTA 2FMIA 3G5LA 3TXXA 3K05A 2FE4A 2BONA 3NXKA 4LZAA 3RJ9A 2XGOA 3KTDA 5IFKA 3WYBA 4HDNA 1U5AA 4KUHA 1NVUQ 4FMPA 3U62A 5BWLA 5K6RA 1QTNA 5JZSA 2QDXA 3MUNA 5KPDA 4UBKA 4DV1B 4TLEA 3P96A 4NCXA 4RA9A 1YU6A 4KRYA 3TBKA 1GL6A 4MO9A 2GXQA 5IWAB 1NXPA 2ZI7A 4OQMA 2ZDGA 5C8VA 1GZ5A 2PJRA 1NRXA 2E48A 1C0IA 2JK1A 1Y8QA 1VP9A 3BFXA 5GMOA 1G9SA 1KP2A 2I4OA 2FSHA 1Y8AA 3EXHC 3GP5A 3JATA 4NV0A 1BVHA 1SFRA 4JU9A 3LYAA 1GSOA 2AYZA 2QXUA 2NT3A 4FQ8A 1EFUA 3UQZA 4DXHA 1TFUA 2VSNA 4A23A 3T7TA 3PC4A 2GD0A 4DIDA 1CZNA 2QUIA 3KTAA 1U4SA 3OHSX 4JR0A 1HRKA 4L73A 2JATA 4PM4A 4Y67A 5JDCC 5E4YA 3GY0A 4G8DA 1IN8A 5FOVA 3EN0A 1LDBA 1I7LA 1GPKA 2D8MA 2HSWA 3LC2O 3B6ZA 3V1YA 1Q1NA 2I0FA 4Z1MA 1CFZA 3HA5A 4J1TC 3CM0A 5FHRA 2IYLD 2VTEA 2AG1A 5SY9A 3ST7A 3TBFA 3W3AA 4IGEA 5B58C 2KVOA 2YZNA 4DCOA 5C80A 3LW7A 2ZPUA 2CJYA 3H2JA 4FMBB 4J0GA 4KQCA 4B9AA 5EPUA 1XFDA 2JLZA 3SP1A 5A4AA 5AVRA 4X60A 3RY8A 1T4MA 2CXNA 3FMGA 3I32A 4YDSA 2Q3CA 5D2CA 4Y2YA 3NP9A 3V8BA 2IPXA 2R1VB 2CDCA 1G3RA 2PDAA 5FNVA 4G5HA 2XD9A 4M9CA 5IDVA 2MSDB 5LLDA 2BL4A 1ZKDA 1SY7A 2ECOA 2O4CA 1FP4B 3ZPXA 3KLNA 2IODA 1J9GA 4BNFA 1XRLA 2VP3A 3AVYA 2H1CA 2VQDA 1R50A 3VNQA 4LNUB 4KPUB 1EA5A 5TMDA 4J3NA 2Y76A 4EZIA 5A03A 2BN4A 3PFKA 5EXTA 4OA8A 5SZHB 5EYPA 2AEFA 2EFDB 2VF8A 2X8JA 1YONA 4A4DA 4RD0A 4V0LA 1H2FA 3T35A 2I29A 5CVEA 1BX3A 3IEVA 2PLWA 1DINA 1IVYA 4X41A 1NQOA 1OI7A 5ALZA 5JMPA 2C57A 2VTKA 3JVIA 3VR0A 4FCWA 4URHA 3G1UA 4DQXA 1MKYA 1YQ9A 1Y3DE 2ZXEA 4JBHA 3WYAA 3HN6A 3WL6A 3CHYA 1W2WB 3B6MA 4P3XA 4ZDJA 2YWDA 5ICGA 5BVHB 2ECPA 2FX3A 2YICA 4KKUA 121PA 1IY0A 1NY5A 2APJA 2KW5A 3ADKA 5AHWA 2AWOA 1WDLA 2N47A 2XMQA 3GDOA 5CYOA 421PA 1QP0A 2MYUA 3I42A 1RD4A 1TQ8A 2GPTA 5F7XA 4ZCLA 2HRDA 1PD0A 4OI1A 3AVWA 1M73E 2JFOA 4IXWA 1G20A 1E2UA 1UBSB 3GLFB 4MVXA 2C29D 5IMBA 4E03A 4P3IA 4LS3A 4U7GA 2ETXA 1XCGB 1L5NA 2NYUA 4Z4EA 2QLJA 4L9RA 4INJA 3ADPA 1JLLB 5AHRA 4PSCA 4EW3A 2DR2A 2A9QA 1O97D 2ZCJA 1EEXB 5E9WA 5KNDA 3LOUA 2H7YA 2XNSA 1JJIA 2Q7XA 2R4UA 4R68A 4V1CB 5EG5A 1EUCB 1OUMA 3D02A 3LBYA 3NPMA 4QTUB 4UTZA 1VQ6B 4WBNA 4ZK6A 2XA1A 5I5GA 5EJFA 4Q1DA 2IYWA 3I5MA 2X6XA 2SECE 1FYVA 1Z2AA 2AE2A 3FY4A 2HPAA 1N3IA 3PHIA 3VC1A 4CTKA 3HCWA 4B83A 4G3XA 1O7JA 4CGYA 3SBEA 2UXCB 1RWBA 2XBMA 3ONYA 1K73D 4NV1A 4K9KA 5HGJA 2GDJA 5BSUA 3LVQE 2G7ZA 5CAEB 4YP5A 3ROGA 1SQ0A 4B76A 4DRXA 4U8GA 5CBKA 4KUGA 4ITUA 2IITA 1JVBA 4GYKA 1CERA 1QO9A 1FQJA 4G0OA 4X64B 4N7JA 1WSBA 2G5GX 3ETCA 1YBFA 4LY6A 1W4RA 4CCYA 3OO1A 4HH1A 3HJCA 3HADA 1KFBB 5C4GB 1NXWA 5CFLA 3IL2A 1PWEA 1YE8A 2Z4SA 2EKZA 2V0GA 4BMYA 2FMKA 2PRYA 1WUIS 3K4PA 4EF5A 2F1JA 4M46A 3MMXA 3SHFA 2A7QA 3EGEA 1R0YA 3EIQA 3LZDA 4H35A 2BFPA 4QGSA 5AUQA 3A9TA 3TW6A 3MBIA 2W58A 1QHEA 4CQNA 3WBKA 1PAUA 4YN3A 4ZI7A 3QPAA 3RVNA 4ES6A 1OYWA 2VNSA 5ECDA 3WLNA 3R3SA 3B2QA 4DNOA 1AUVA 1V37A 1MZVA 1TZMA 2QLTA 3BQ9A 2NUAB 1MUUA 4B6EA 1E8NA 4KQMA 4GMHA 4PO3X 4ZT6A 4EG6A 5JNLA 3KSRA 5FT9A 3KZXA 4C3OB 3FGOA 4C4OA 4EJSC 3VZBA 2PBRA 2VCEA 4P4NA 2P0YA 2IV3A 1CNMA 1GPDG 1K6IA 5AW0A 1NAIA 3ZIAD 3KSAC 3BAZA 3SJBA 3B1XA 1VQMB 1W36C 1R88A 2N3ZA 1OV4A 4TV9F 1Q91A 2QTHA 1G41A 2QZPA 1QB8A 1N4DA 2ZRDA 5HILA 2HA4A 4CEJB 4FT2A 5JLAA 4JL5A 2IPNA 2F62A 3VMFA 3ENVA 4JVNA 3F97A 4F7DA 4GBGA 4M1ZA 1DBPA 4FS3A 4RAQA 5U1PA 2JJMA 1CR1A 5FFMA 5KVAA 2VQFB 1Z15A 2Z98A 2CLHB 1P5HA 3ZS9A 3AUYA 2YTZA 4X1OA 3V8VA 4P5EA 2K87A 4DIOA 2EBFX 3VYRB 2PS1A 4MK4A 4RKQA 2JFZA 4TRRA 1BE1A 2Y67A 3Q9LA 2GRJA 5B1DA 2IIPA 4KREA 1CQJA 2DQZA 3MT7A 3GPLA 1JJ7A 1U3CA 2V96A 1LTQA 4P08A 4J76A 3KD2A 1YJ5A 5ELLA 1YOVA 1Q1GA 2ZI9A 4OJQA 4S2UA 5F7ZA 1ZMBA 2G0NA 2R4TA 4CM7A 3U7IA 4ZT7A 3FLEA 4RIGA 4K2AA 5ESRA 4AJPA 4ETMA 1AQJA 2QTVB 1WMEA 4NPHA 3R77A 1GTRA 1CZKA 3O8LA 2JHPA 4PSDA 3VU3A 2ATXA 4CMIB 3OEWA 4L50A 5DN9A 3SE0A 3THRA 3VOSA 2G88A 4KDFA 2OA0A 5FV4A 3CCLB 5AI6A 2WICA 4ZAVA 2IDJA 3PXDA 4NEHB 2CV2A 4X65B 5DHUA 4R71A 4X0CA 4GD3Q 2ZIAA 4UC0A 4CI9A 1JT9A 4NEQA 1XD8A 4PGFA 4BGUA 1PRYA 5DHTA 3P45A 1T8RA 1Y5IA 3ZGOA 4H7DA 4ARAA 2BSXA 4BNLA 1U2RA 1G4AE 3NWOA 5HR5A 4CKBB 1ETHA 2I2FA 1LZLA 2PKXA 2OCBA 3Q88A 1A9RA 2PMEA 4C4TA 4ZMBA 1KQSB 4KN8A 2O8VA 1T2DA 4KQIA 4Y9TA 5D01A 1T0IA 5HMLA 3UT5A 1U6JA 3VX3A 3BRCA 2A9VA 3T5DA 2WHPA 3GJSA 4IFIA 2X4LA 1W29A 4BBAA 4CM9D 3Q0TA 2GVDC 1IMOA 4MPRA 3TM5A 2BBWA 4I1IA 4CM6A 5CFNA 4UXJA 4HHEA 1EFDN 1GPYA 2KWIA 3KM0A 3VFDA 3C8MA 4R2LA 1JUDA 1KSJA 3I05A 5LP6A 3EXFA 4D0RA 5C52B 1FVHA 2IZ1A 4CIYA 4PAWA 3ITEA 4WKOA 4CDRA 4EYGA 2O23A 4REQB 4RTQA 5HOEA 4QDXA 2JKYA 4EH1A 1P60A 1UPCA 4MPDA 1E9EA 2GWRA 3KYBA 4HAXA 2J59A 3DEJA 4BYGA 2Z04A 4ND6A 2H65A 2OHXA 3D7MA 4OG2A 4U00A 1H0KA 3TQOA 4OK3A 2B4YA 3TX6A 3T9CA 3VR5H 1TF7A 2RHTA 3KVYA 4H0FA 2VG8A 5JAUA 3ASSA 1BU5A 2DJIA 2D2XA 2QYTA 4JJ8A 1OXSC 1NJ8A 2KLHA 2LIVA 5I47A 3F8SA 5IAEA 1TM1E 4E3ZA 1DZ3A 5D5PA 2A1TS 2I6SA 1RPJA 2CE7A 1E5DA 1FPQA 3FZYA 3GFGA 1GRNA 1VE6A 3PD0A 2C7GA 3VC7A 5E9QA 1IUOA 2R4QA 2PUBA 1OLXA 3RC2A 2AD1A 4XEHA 1P0QA 1UF9A 2FUCA 3LC7O 4B2LA 2W43A 4JP1A 5IAOA 1CY1A 4Q34A 4J2OA 5AVXA 5AMXA 1YBAA 3SVLA 1LI4A 1S02A 1SHKA 2R7AA 3NBZC 3VU0A 1OU0A 5LWHA 1JL3A 3OT5A 3OC6A 4MXDA 1MPXA 3CLSC 3ILYA 1KRHA 2QRHA 1H5UA 3G7SA 3IESA 3CG4A 3IXLA 4J0CA 2V9PA 4Z4ZA 5DW3A 5B37A 3RJZA 4UHCA 4D5EA 5TPZA 4B5LA 1PJ6A 1SHJA 5CFZA 5DK4A 3ZDEA 1AKMA 1SELA 4JFRA 3RKUA 5HYVA 4EP1A 1VL2A 1F06A 5BOSB 1HF3A 1KFJB 2WZCA 5EWMB 4E09A 5F2NA 2WM3A 1FS5A 1L4HA 3UHFA 1Z26A 2P41A 5D3QA 1TF2A 3BXXA 1NBOA 3CR3C 4XQFA 4BO5A 3K70B 4X7MA 3KPUA 3IQFA 4OQ4A 5DEIA 3NKFA 5E4FA 4TKVA 3AEUB 4Q21A 4KW7A 1D9XA 3ND8A 3RJTA 3U4IA 4PO8A 4O5OA 1U1EA 1GQYA 4N65A 2HIGA 1M5RA 1XMOB 1YI8A 1DBVO 4EB3A 3QSYA 2E5FA 1N6IA 3DTVB 4UQOA 1OWPA 3NRCA 4UQPA 1I5RA 4WY5A 5CTAA 2ZATA 5FHQA 5A3VA 3KAKA 1C7IA 4UAUA 1K0UA 3DGFC 5DYWA 2N42A 2QN3A 4Q1VA 3BGSA 3G89A 3F74A 2VO1A 4P80A 2B25A 3RTBA 4DMGA 1JG6A 2Y0BA 3N2KA 4JLNA 1S2IA 2JH3A 1LVHA 1N9ZA 4NBRA 4WWVA 3AM3A 4OUDA 5KDDA 4AWAA 1YE5A 3KV1A 4IJVA 3PCRB 1OTYA 3E3NA 1E2QA 1HUQA 4W5TA 3IEMA 5KWSA 2FQYA 2J08A 1NKTA 2JGDA 3G05A 3A3KA 3GRYA 3COVA 3G6WA 5GONF 4Q9HA 2C9YA 4BVKA 2V7BA 3RYFB 4OQNA 4UTPA 2P6MA 4IIHA 3T7SA 1E1QA 4FQ5A 2JFNA 4I66A 4JLOA 3JQGA 4PZLA 4MKRA 4B6RA 3W3ZB 1P9WA 3L8DA 3UWMA 3OFNA 1RYEA 2RGWA 2GREA 3V80A 1P4GA 5K01A 4W5OA 1XXHA 4KFCA 1DBRA 3LT4A 1LLCA 4QUGA 1YZYA 4J16C 4IHKA 5BR8B 2JLSA 3VVMA 1BFUA 1YVRA 3CZRA 1IY1A 2PVCA 3ECSA 5C1OA 3DE4X 3FCEA 1O6FA 4QQKA 2XWQA 2OHHA 1TZCA 1LZKA 3C5EA 3EARA 3F46A 3OF3A 1VLQA 1Y1SA 3QVGA 4RPDA 4QPDA 3P2IA 4WERA 4P6VF 4G24A 1WP4A 3OZEA 3IUSA 1TT5B 4B3SB 3FCAA 4NNOA 5EJ7A 1CTQA 3E3AA 4R98A 3RSZA 1FDIA 3AI1A 1CUCA 5DASA 2FN4A 3T7IA 3TNJA 2CT8A 3OMWA 5D3KA 3W7BA 2W8ZA 3A4TA 4FJ2A 2C77A 1UANA 1IZZA 2JD2A 1NVVQ 3B20A 4LJSA 3UFXB 1I7QB 4IV0A 1KTIA 4JOBA 4B80A 4DUPA 2DR3A 3GLKA 3AF3A 4V02A 4CEIA 1JZQA 4BJHB 2HHJA 2YYAA 3BFPA 4Z86A 1NI5A 1PI3A 4MHOA 4ZVUA 4D26A 5K3FB 3LQ2A 5K7SA 1LH0A 5FL7A 2JA1A 3FB1A 2ZCVA 5SV2A 1PYGA 3WOHA 1X80A 1G17A 2P9JA 4QUIA 4EG4A 5LYYA 2QRNA 1BCRA 3JYLA 2XCRB 3DCYA 5C1BA 1AY0A 2VZ8A 1P3JA 2CDRA 4GBED 4UOQA 1Z7GA 2UXBB 4TYMA 1HLFA 4Q4AB 2YNMC 2F90A 3PNYA 1RQ2A 3FSGA 4F84A 1DTEA 2ZYRA 1CR0A 1IDN1 1KY3A 4RSHA 1FYEA 2OKCA 2HYDA 4U5XA 1DFHA 4ARCA 3LUFA 3I2JA 2WIFA 5J40A 3MSCA 3UOGA 3EZYA 3RRXA 2R47A 1JAIA 2QRGA 1ZK3A 3BXFA 1I3OA 3LF2A 4EFKA 2CVQA 5BV2P 3KHSA 3UJNA 2XF8A 1F4PA 4QUDA 1OQAA 3IR6A 4ZA2A 1OYYA 1J8DA 3PS9A 2PQ6A 1BCSB 1JSZA 1LI5A 1X38A 2NADA 3R76A 4BV2A 3ZLUA 1JAYA 2Q8QA 5LDGA 2IK8A 1LS1A 3ON5A 5YASA 4EOGA 3GG9A 3O2SB 5IC5A 3UOWA 2QR2A 2E4AA 2B1IA 2J6CA 4J9UE 2IF0A 1Q2XA 3A1TA 4NMWA 1MMFB 2PVSA 1MO3A 1FSSA 4UCWA 1LBQA 4D99A 4LFAB 4BVEA 4TMXA 3ABRB 3AL0C 3CPWB 2GBLC 3JASB 3PEFA 2YX1A 3A1NA 1R4ZA 4JS0A 2XVZA 2IA5A 4G0NA 2YWGA 1KO4A 1XTJA 2QGGA 3ZV7A 1X87A 2B0CA 2B3DA 2BFDB 4LJRA 4I9UA 4RHUA 1N32B 2BMEA 4OD0A 2O8DA 2C9CA 3K30A 4GC9A 3H3FA 4UVDA 3W9SA 2IYPA 4MROA 2O9JA 2NXJA 3JAKA 4II3A 1EI9A 3OM8A 3UJAA 1M0EA 3JZMA 3VPFA 1LSSA 1NQWA 2VJMA 2WR8A 1KYWA 2BFBA 2C4HA 1DKQA 3M9XA 4LOHA 2X3YA 4MWBA 5DNEA 2YN4A 4AO6A 5CFRA 4GLLA 1N34B 3F5SA 2H9IA 1W52X 4AQ7A 1ORDA 2DU8A 2PUTA 3KKNA 4AI6A 3DUWA 1IHPA 5CP8A 2VHEA 5F51A 1U2DA 2VF2A 4WXPA 3W1WA 4EPWA 2WTMA 3D7RA 3EK2A 3RI3A 3GJ8A 3GIDA 4M9SA 3E81A 4MPPA 4D5GA 1H4TA 1QR2A 5JS2A 3KL4A 4EB6B 1IG0A 1JEJA 1JDZA 3HJNA 4CXMA 3PE6A 1J2RA 1XEWX 1P9LA 4DMCA 2AOWA 1U0BB 3WGUA 1WHTA 3ABOB 2QS9A 2D3LA 1WCWA 1ZXBA 4IGFA 1J1IA 4BKPA 5JS7A 3RU9A 1SQ6A 2XTMA 1N07A 4XORA 4L5BA 3WKDA 3ZY4A 2A5GA 3FVRA 3BB3A 4IL5A 4P5DA 3W5CA 2WWHA 3H1AA 2FQXA 1DO8A 4GYJA 4HDMB 1TX4B 1L7PA 4RF5A 1LW7A 2ES4A 3DVQX 2P4EA 4BN4A 1ZXLA 2CHVA 3WZLA 3DTYA 4PG8A 3LAWA 1DKNA 1U3TA 3D3EA 4C0AC 3IR7A 4OOFA 4RPCA 4H27A 3RRJA 5L4NA 1OGIA 2XGMA 3P2KA 4PPGA 3RC3A 5CPBA 3GQBA 2C8LA 1J24A 9GPBA 5HZHA 2D1SA 3GFPA 2VAXA 3KQPA 2BAGA 3ZNOA 4D2IA 2P9QA 4EGQA 4FUTA 6CHYA 3IUNA 4PZZA 3VYUB 3ZLVA 4RNCA 2O2GA 4MDHA 4PGMA 5H70A 4ZI2A 4FVTA 4EA6A 4RTJA 4HMOA 2C83A 1JKFA 3PICA 3THWA 1K3UB 2R68A 2FE1A 4OQLA 2C5EA 4PG7A 3VR6H 4CV0A 4JUFA 2HWKA 4ERNA 1EX1A 1K7SN 1FQKA 2B4RO 2FB9A 4YRPA 1XDGA 3HPQA 3LO5A 4IV5A 1XZIA 2GM3A 1JSRA 3QLVC 4PYIA 5CIQA 5HQTA 2GJ4A 1JR4A 4MLZA 2VSYA 3TQRA 4BQOA 4BB0A 1DPGA 4KH0A 1YDHA 1Y1RA 3NYQA 3ZYZA 5DN6D 3E9MA 2Z8YM 4OLHA 5AVOA 2XRZA 2QY6A 3V4SA 1L3BA 5PGMA 4FM9A 1NRJB 3IP1A 1UAYA 4EJ0A 5FTLA 2EQBA 3GEGA 2HA6A 1D03A 2HQ1A 3DYVA 4NENA 1DKMA 1Q20A 3PXXA 4JEHA 1W35A 4IRMA 4MAFA 3RS2A 1TVKB 3L7LA 4G5RA 2IP1A 4YJKA 2P27A 1EG2A 2DWCA 1NVKA 5KNBH 1N8KA 4X94A 1VTKA 4R9VA 2RI0A 2OO7A 2ERXA 3W5SA 3IH5A 5FO0A 4MJXA 1WMFA 3S27A 1FJXA 1I6KA 2HT1A 1ZRNA 1YULA 3EEBA 1G64A 2BGLA 1LW6E 1HPLA 4HX5A 2DH6A 2ZXFA 1XE1A 3KQMA 4HDKA 4OGLA 2I2WA 2X42A 3IKLA 3FWHA 2X8LA 4F3CA 4LNHA 2ZM6B 3B48A 1XTKA 3NDJA 3FPGA 5LWQA 4UCXA 3Q7IA 2H07A 4RY2A 4L02A 2QSZA 4DC9A 1ARZA 1JYSA 1ULTA 4RADA 5FUWA 2OYNA 2DRIA 4XAQA 4CLOB 1P9RA 1DLJA 1KFEB 1R0XA 1ZD3A 2I55A 4G37A 5ANRB 4Z9YA 1JG3A 1YB5A 2EATA 1YO6A 4NAHA 4WACA 3ZWNA 4CTNA 1QIKA 4WMLA 4UZUA 4BZPA 2Z56A 3DZHA 1XLWA 4QPNA 1XMSA 2PBFA 4QVJA 3A0UA 3MTEA 5EI5A 2I03A 5ALIA 2Q5IA 5FKJA 3AFGA 4B47A 2XSZD 3C3PA 2BFCB 1MOZA 1IAVA 4A73A 1N8SA 3B82A 1KFKB 1REQB 1G8KA 5T4EA 5LQUA 4MJ3A 1SRQA 1WB5A 3I76A 4LC1A 1FDVA 4LK3A 4QXOA 4OHBA 5AM3A 4G5GA 2QK4A 2UZ1B 3RB8A 3WK7A 1EXVA 2CXXA 4B44A 3UEOA 4CLHA 5MHTA 1OFTA 5HIKA 3A11A 1SC4A 3KQYA 5ALTA 5G4LA 3STWA 5HWSA 4GLOA 4KGDA 2QTMA 5IULC 4PLPA 1PT8A 2M1XA 4LSGA 4EG7A 3NKLA 1Y5RA 2Q8NA 3UJ3X 3INNA 4M49A 1AB5A 1HQCA 2ADFA 2FSPA 2GEDA 3P0IA 4UREA 4EF4A 1FS6A 1JJFA 4MVJP 5ALLA 1SCKA 3UKDA 1SA0B 2LZ0A 3T3MB 5I4IA 4O25A 3UHPA 5K3AA 3C8DA 3DMGA 4AN4A 4D02A 1SVSA 4U9UA 2GPBA 3O2NA 3VZPA 2JAUA 4DIEA 3E03A 4DPLA 2ZTVA 2VNIA 4D9IA 1TQDA 3OTIA 2YWRA 4JCOA 1W25A 2D7CA 3BOSA 4KP7A 1KDTA 4IH9A 2PV0A 4F1JA 3PJGA 2QRMA 2C7QA 4I8XA 5KUTA 1E5VA 4LDAA 5EJ2A 2VJOA 4Y30A 1YTLA 3MRSA 2UVPA 3R0JA 3C8UA 1YIOA 2X6WA 3D7KA 4R6WA 2EU8A 4U1RA 3TOVA 3WFJA 5LN1A 2JCVA 3TJRA 3LIIA 2BGJA 2GLTA 2LCIA 2ZT6A 3K15A 4KXXA 4ZRMA 1VRWA 2ZJYA 2PNFA 2ZWMA 4HDNB 3K1YA 1E1RA 1IVNA 1UD8A 4MP6A 2ZJ8A 2JVIA 3RSHA 1Y1PA 3U31A 1VIDA 2GFQA 3SY8A 3MOSA 1BN7A 5DOVA 4HNHA 4PO1A 4DLRA 4E08A 2CNKA 4ZKDA 3MT0A 2VPXA 4RA9B 5FTNA 4WFJA 1V11B 1WETA 2FVGA 3WWOA 3HCCA 4WOCA 1XWWA 1E7WA 5JD6A 4RIEA 4E46A 2Z3ZA 2AN3A 2ODPA 1Y8QB 3CH6A 2IVZA 2PUHA 2W70A 4PGAA 1TTHA 4Z99A 1KZ1A 5F77A 4D3YA 2VDLB 4ITRC 4UULA 1Y3BE 4AC9A 1L4YA 2XKJE 4YMHA 2XB9A 1DT3A 5FPYA 1VRVA 3EW7A 2GHQA 3DCNA 3IAS1 1SEPA 2H0RA 2QTFA 3KTAB 2IXAA 3DG9A 1Y7LA 1XLTA 4CG0A 1HYQA 2W2NA 4BMSA 2AZTA 3A9WA 2NSLA 3H6GA 4KVFA 4LE2A 1UADA 4TT3A 1RQNA 1UCFA 1QV7A 1U2EA 2Q5QA 3LLUA 4LJKA 1MAVA 4V0OA 1H1DA 3T99A 4BO9A 3ER6A 4ZGNB 5EKTA 5FTKA 4ZPXA 1G8SA 4B3HA 1V8PA 2JC3A 3FSEA 2YV4A 3DDUA 3E7XA 3DDCA 4J1QA 2QBYA 3BJEA 4UUPA 5K8VA 3TF5A 1EESA 1A9TA 3ASUA 1HYHA 2XTZA 4RBNA 4BE9A 1IQUA 3KT0A 4AY3A 2PIAA 1QKJA 3FPPA 4DPMA 4KKXB 1N0IA 1AHNA 4WKCA 5AXCA 3G2KA 1CIJA 2QMEA 5GOTA 3SVZA 5KC9A 3HYTA 4KLNA 5FNVB 2QAIA 1V5FA 4AURA 4JI2B 1GYRA 2XNDA 3IUEA 1UPFA 1DSSG 2ODNA 5I7AA 3ZY2A 4CYMA 4MVJA 3BKXA 3AOEA 5F4ZA 4GECA 3AILA 1FMLA 3H8JA 3DZJA 4HGPA 1MJ5A 2ZRCA 5B1IA 2R7KA 4COOA 3Q2IA 4L5CA 1IAQA 2FUNB 3FNEA 3GW8A 1PX0A 3HU1A 4PONA 3K73O 4QJIA 3NJ4A 1P1IA 2ZWAA 5EYPB 1XK7A 2Z9CA 3X1KA 5L7TA 1C1DA 1EE9A 5KREA 3ZD9A 4D8VA 2W6IA 2X8JB 3B38A 4HDOB 4OLAA 1BVUA 1E69A 3QI2A 4DMUB 3PGLA 2EC5A 3T1TA 1MCZA 1Y4DE 1EHYA 1VP3A 4I50F 4E4RA 1ZD2P 1GUYA 4YUAA 5L4LA 1YFZA 3D6MA 4DJJA 3NVKI 2CLSA 1NR7A 3K92A 2B8JA 2BH2A 4RC9A 2YY6A 3DBLA 4G7WA 5CW1A 1KVRA 2OHGA 1ADCA 1W0CA 1JAZA 4GNRA 1R9GA 1XZFA 3GCXA 4OIMA 1P6XA 2X13A 3K8OE 3RWMB 3DONA 1QPZA 2WB2A 1DXOA 1NGSA 1G20B 3T3NA 1ACJA 1E4OA 1GPLA 2RI6A 1QRAA 1T9BA 4KXUA 4TTIA 3H0KA 5BVGA 4CTMA 5MGBA 4W5WA 4RU1A 5HKKA 3HN7A 5DLYA 4OP2A 2IIVA 1G7CA 4BQPA 2WU1A 4HZIA 4Z3KA 5DX8A 1PFVA 1Z16A 2B8NA 1EWQA 4AY2A 4IIJA 1WMAA 4OY3A 5HXBA 4AZTA 5D85A 2FEMA 4EW2A 4KPYA 2AB0A 1QU2A 4WKGA 1OSNA 3MT9A 5EIBC 1E3LA 3OP4A 4WBNB 2A9PA 2VQEB 3P94A 4R2HA 4B09A 1JA0A 4LMAA 1P6UA 1GRVA 2PZMA 1GKIA 2H8GA 3ZH2A 3GT7A 1XJCA 1O0CA 3NEAA 2I99A 5ADUS 1V9SA 1PNOA 3HFJA 4LF9B 3LO8A 2GUWA 2OV2A 2JAWA 3OOEA 4NZNA 5HE8A 2HT6A 3VDRA 2DWQA 4KODA 3FCOA 3PLRA 3Q5GA 4KOAA 2B8WA 3CA8A 3ASPA 1UZLA 2ZKIA 3KELA 5DT2A 5EP3A 2C92A 3LHSA 4C22A 4DRXB 2H59A 1X9IA 4OH1A 4BNJA 1QIGA 4XVQA 4HB2A 5DHAA 5C4MA 1Q0UA 3A2LA 3NWEA 4WK2B 2I4IA 3OUZA 1H2WA 2ZBGA 5DFAA 3N5KA 3T52A 3W8DA 1WXDA 3T0IA 1K4YA 4CCYB 2HCJB 3AZPA 3IEXA 3FBTA 3UWOA 3R0QA 1SXJE 2NM0A 2ZREA 5ELXA 3USZA 2QD5A 1GXSA 4GL4A 2HKIA 4GPEA 4CV2A 1N9GB 2CXUA 2PXAA 2VQ6A 5IP5A 4F5YA 1A5ZA 4JOSA 4G63A 5FP0A 3S2SA 3ZQ6A 1ZYUA 1GL3A 2XY4A 1VZ2A 5FUBA 4DEYA 1I4LD 4JCCA 3IT2A 3ZDFA 4MZXA 1WBDA 2XNDD 3HDQA 1WTAA 3M2PA 3QITA 4ESVA 3Q8KA 5KYNA 3VKVA 2QKYA 2FZLA 1T5DX 2YVQA 1NUHA 3CWQA 2WJHA 5EJ9A 4O1IA 5LYJF 2IDKA 5CHEA 4B4UA 3A0RB 2ZL5A 1H2BA 2VF4X 5BN5A 4XOPA 4WESA 5F3DA 1WUTA 5HZMA 3DXXA 4FZ3A 2XYQA 4XVRA 2BR3A 1UJ2A 4OHOA 3H84A 1PL7A 3I1YA 2AC2A 2G5TA 1PYDA 1Z6ZA 1E6CA 2RKOA 3K1ZA 3TKAA 2X6TA 4PYJA 4UEOA 3OTOB 1W1IA 3ET5A 2Q7OE 1NL3A 3PTAA 4CMGA 1WLYA 1XJWA 4Z54A 3A4VA 1ZOIA 1YZGA 2R48A 5AO9A 1SXHA 2WJPA 3DHVA 3DMTA 4ZHQF 5EPOA 3B1FA 3JSAA 1Q0QA 3D0RA 4B3IA 2J5XA 1I2AA 1GTG1 3IQIX 4ND2A 4EAQA 3CZ9A 3RM3A 2A9KA 3WX0A 4D9JA 3K72B 1H6BA 5L3ZA 4KGVA 3WMGA 2CW5A 1B14A 1G5IA 4ROXA 3I2IA 1ZVMA 2ZYSA 5EIEA 1NUAA 2DHRA 4A0QA 3TB4A 2RONA 3WG9A 3RDPA 1CQJB 4YAOA 3LLCA 1KI6A 2PSJA 4QJ5A 4RJTA 1LLQA 3H9GA 3L7CA 3DWGA 3M3DA 4QLBA 5LKRA 4W5NA 2MR6A 1YOVB 4QBTA 4K46A 3TAUA 2NSJA 5CYFA 1OREA 2IYUA 2VLBA 4GU5A 2VZ0A 4JJFA 4RDJA 1PDOA 3HB5X 2VHXA 1VL6A 2INGX 3Q2OA 4YJHA 1APBA 1NFFA 4IX1A 4FYXA 2C2BA 3L6OO 4XCXA 4DT1A 3U56A 1ZR2A 3D54D 2DBRA 3NAMA 4NBUA 2QVCA 4H1UA 4D8YA 1NOIA 4D9CA 4EO9A 3KEFA 4ZV4A 1SXJD 2TMYA 3KU4A 1J7JA 3NHSA 3SQOA 4HNVA 3ZC3A 1N75A 4LZPA 5E6RA 4X6XA 5THQA 1RAFA 3ANNA 5C8ZA 4PGOA 5AJVB 1BX0A 2JIOA 1EDZA 1NT4A 3EOZA 1NG1A 3HDJA 1TTQB 4HH3C 1E92A 3PHJA 6PFKA 1JIQA 1OYVA 3IPAA 3BWEA 4WKNA 1ISSA 2B1RA 1BE8A 1E58A 2JCSA 3DULA 3PWZA 5TRDA 4MWCA 5BR1A 1ZJYA 4QYXA 5JASA 3GA7A 5F9MA 3L07A 1Y1TA 1GCUA 2K5UA 3DNPA 5AJYA 4C07A 4D98A 3RUAA 5LQRA 5E38A 2CXOA 3UT5B 1LF5A 1KMQA 3R3VA 1HH4A 2ZTGA 1LJLA 1IE3A 2P9HA 2WHPB 3PXEA 4N3AA 4FI3F 4H7JA 4KIGA 2N1MA 4IMIB 1E1CA 1YK0A 5E3JA 3DOFA 2WP8J 1YDEA 3I4LA 4GUDA 2FW7A 3KLBA 1S2MA 4IOLA 1L0BA 2CEAA 3KPVA 4BQNA 4XIYA 4CZ2A 5LP6B 3EXFB 7YASA 1SUPA 2QVGA 3EXAA 3KHKA 4DCGA 3TMYA 4ESOA 3GLVA 5BQOA 1NURA 2I2CA 2WU0A 2Q45A 1DS6A 5DI3A 3TR5A 1EVIA 2NW6A 3R8FA 2FZEA 4P32A 1RXUA 4RVFA 1HLDA 3KOZA 4XLHA 4A36A 5K03A 4L0MA 2OGTA 5GJBA 4NI5A 4D56A 5CNJA 1VECA 3KPWA 4EFLA 2X8WA 2Z1DA 2ZROA 2QLFA 4FZJA 1XHFA 1HZEA 4HQLA 3AP3A 5LQMA 1PSWA 2GZRA 4L72A 3W79A 5BV0A 5J2TA 2Y1DA 5FADA 2BDUA 3Q38A 3FWKA 3QXHA 2WHYA 1Q1EA 4L3OA 4YRDA 1LQ2A 1AUQA 4ALJA 3EXHA 3LVFO 3U0BA 2OAP1 5CG1A 5CU7A 3SSMA 1X3LA 5HX7A 1SC6A 1K7EB 2AEMA 3O4RA 3NM5A 2KE5A 3OOWA 4G4SO 2A3NA 1DVRA 3H18A 3HB1A 2NO0A 1JKIA 1QDEA 2JJ1D 4U2CA 1D09A 1OLXB 1SXIA 3RHTA 4AXXA 3TLAA 1PGQA 3F5QA 1AZLA 3BJMA 5JDCA 4K9OA 4G9BA 1DIOB 4RENA 3PA1A 5ENVA 3SBDA 5C8DA 2Z6AA 3WL3A 1AK9A 2E1RA 2HMYB 2D7DA 4DSTA 1GQ2A 1UM9A 1LY1A 4NJMA 3U40A 3HJBA 1UD3A 4BCBA 2BW0A 5B55A 2VJDA 4YIKA 2HXSA 1ZCFA 2DB3A 2NOAA 1YR1A 1SNYA 1TZ2A 3LDHA 3IAFA 3UCXA 5IYZA 4JLDA 1V7CA 3A6LA 1BJTA 2VH1A 2BGRA 4EDHA 3KT8A 2P5UA 4PZPA 1QDLB 7ADHA 5AW4A 4ROTA 2AQ8A 4FFOA 3VH4A 4BVLA 1Z0IA 2OBBA 1T5LA 2TMDA 1VYTA 3GRVA 4H16A 1K89A 2PUFA 4P4UA 3PKIA 2IC5A 1SIUA 1KEWA 4KQEA 3PE4A 2I8LA 1RBYA 1SURA 2Q28A 4TKVB 2YC2C 3WRYC 1JMVA 4L95C 4QXMA 1D1PA 4EHLA 1KERA 4HQNA 1D1QA 1GAWA 1PWYE 3VVCA 5FBVB 4ETIA 3TGPA 2JCXA 3A3YA 4QDOA 1V7QA 1EFCA 2BKEA 2MTBA 4UNRA 4F3KA 1JFTA 1U3GA 2OFPA 4QOEA 2PUCA 5GP1A 2V9ZA 521PA 2IYSA 3E15A 1DCFA 4B8YA 4CFYA 1R3UA 3A1WA 3B2EA 3EVDA 4QPZA 1ND6A 4ASUA 3C3CA 4RELA 4Q3CA 2O1WA 4ZPJA 2O8BA 2GCIA 4ALIA 4BBPA 1ONNA 2ZYIA 3GXOA 5IWCA 1CF9A 2JZCA 5KQPA 5BPFA 5L7WA 3FOFC 3N2KB 3BDVA 1VHJA 3PNSA 4WOBA 3Q6QA 2VH5R 4OI0A 1G8PA 1FC0A 2FZCA 3FMOB 3X2FA 5JV5A 4OUDB 3M3HA 4R1MA 3FJYA 3VNUA 2XCUA 4CBVA 1OROA 4UHEA 4TLLB 4BPRA 4QIHA 4TTRA 4YTEA 1JVSA 2JGDB 4RAOA 3QFCA 1Q77A 5B2FA 1E2KA 4BRZA 2PH7A 3A9SA 3SJ7A 1OGYA 2YASA 3PPVA 4BTLA 3TK1A 1Y6FA 1DC7A 1CZUA 4N0QA 4RVCA 4QV2A 4TWIA 4EELA 1X7YA 3TN7A 5GJCA 2DCUA 2V45A 3CJTA 3JQGB 1XZDA 3ULKA 2FSVC 5GIOE 2COKA 1I4WA 2CDBA 1BDMA 3OE7D 1CF2O 1I1NA 1XQ9A 1XXHB 4WN9A 3RTAA 5AVTA 2QLMA 5I7WA 4C4PA 2OD7A 3NV9A 4YMUA 2QL7A 2IYFA 2OT3B 5K0GA 2HRCA 3OIDA 3CVJA 4KFSA 2NWQA 4BNNA 4BQSA 3RIMA 3OUUA 1DNPA 5FR2A 1GU7A 4WGGA 5D3MA 4I14A 2OLKA 2HLDA 1Q0SA 4F2HA 1ONPA 4EY6A 1YJ9B 4LXQA 1WV0A 2G3YA 4BFTA 4FN4A 2FR1A 3L18A 3QVGB 3OCWA 4RHXA 4W9NC 4LI0A 5GVRA 3ZWQA 1JHYA 3BWCA 3F8TA 1IJEA 3L77A 4URWR 4AJOA 5JUWA 3MWDA 3FAKA 3NEJA 3TJMA 4MWGA 3QQPA 3QVWA 3SYKA 2OQIA 2ZK7A 1GT91 4C29A 4H31A 4L3VA 1L7QA 2V65A 3LP5A 3NBFA 3HCEA 1N33B 3BMCA 3LQRA 4IVQA 1ZK2A 4CEIB 1AQ6A 5BWOA 1Q95A 1X74A 3E3MA 2QI9C 4MV3A 1RZRA 3DDYA 3QFSA 1FDSA 1HV8A 1UR5A 4IV8A 4W1QA 4X54A 4AO8A 2CVZA 2ZBPA 3PHHA 3JQ9C 1UKVY 1Y4SA 4GMKA 4TL8A 1KF0A 1O1YA 3AR8A 3IELA 3ZHRA 3NT2A 4NYMR 1X80B 3CCFA 3VR6D 4HX9A 4J1SA 4HRVA 2PWYA 1E61A 3FX2A 2JHGA 1BCRB 3ENWA 4HRYA 3RNOA 3RVMA 4ALKA 2HO5A 1RACA 4BE4A 5IDXA 1S8FA 2CXTA 4Q7KA 3Q7PA 1DJPA 1ODFA 1MB4A 1YB6A 1TK9A 1XRQA 2QW1A 5M3BA 4CDMA 5KU7A 1MX3A 1V47A 1ZVJA 1C0PA 5E6UA 4TZ6A 4FHDA 3RPEA 2RH5A 3ILXA 1D1NA 1UBKS 1UPBA 2B94A 1JYEA 3I6BA 3MXTA 1FU8A 4FONA 1U2ZA 2OGWA 1V1JA 1DRJA 2UUOA 4B48A 4DQVA 4LRXA 3CTPA 3GB9A 3KUKA 4V0KA 4AMYA 5K8TA 2FN8A 2I4LA 2NXWA 4V39A 1Z12A 1WCYA 3BY1A 2OFWA 2YS7A 2X9GA 4CM1A 4R2MA 3R6TA 1ECPA 1C9NA 1FP7A 1Y9ZA 4A16A 5KNBD 3AETA 4XQ0A 1R6XA 3HAGA 1NSTA 2EGHA 4L2IA 1ZLXA 5J5VA 4EJSA 1XCJA 4XL9A 1COWA 1PNRA 1P91A 4GZMA 5TR9A 1RJWA 4ASUD 4M1EA 5B4VA 1QJCA 1ULSA 1IZ0A 3WGVA 4Y1RA 1MX1A 1XAHA 1ZM7A 2B7CA 2Y66A 3VDXA 1VQ8B 5KOYA 2GPWA 5F3RA 5T41A 2O8DB 4FC7A 3RQSA 3WC4A 4F1WA 3G0OA 3JAKB 1DEAA 5A5GA 1JEAA 4YRGA 2LKDA 2W6OA 5JPIA 1KJ8A 1K88A 2BFBB 2H16A 5AVQA 1C4WA 3F78A 3FKSD 4XD7A 4OK5A 5BR7A 2WZBA 1JQJC 5IAKA 2BKVA 3EVFA 4ZO8A 3SM9A 3W5IA 4GFDA 3HWRA 3MWEA 3EVBA 3GUZA 2C5FA 2C5GA 2HRBA 2WSYB 3BC9A 1XQBA 2XRFA 4DWOA 2C4TA 4EBFA 5CB6A 5K0ZA 5SY4A 1QBKC 4DGSA 3QJGA 4MGEA 4Q48A 4M83A 4DZRA 1VYHA 2CZQA 2QTGA 4CM4A 1WHTB 2C2XA 4RZUA 4M88A 2WDZA 5C32A 3JTEA 1NBHA 4X05A 2HLDD 4G09A 3OJOA 4BWVA 3M89A 3GVCA 1VJSA 2XHEA 3BPSA 4TVBA 2BLLA 3SIPA 5L3VA 4X8LA 2JCGA 5ISMA 3RBVA 3KQVA 4GZ5A 2IHZA 2GN2A 1J70A 1RRKA 2Q29A 2RIRA 3FNGA 3E5RA 4CKXA 3DKIA 3EVEA 1RHJA 1E3MA 4RE6A 2PUGA 1TFRA 1U3FA 1KO7A 1Z18A 5IT9A 1Z2OX 1RFLA 4AL4A 4OPSA 2YYZA 4RCYA 2CYAA 4PLVA 1Z5VA 2NUPA 4AJHA 2OCKA 2BGTA 2VTVA 4TN5A 3ZDDA 4WINA 4EUNA 3GQBB 4GQNA 1XTPA 3WNDA 1WULS 4G8JA 4C0LA 5L9AA 4Q15A 1AH2A 1SUCA 2FZ4A 1N3YA 4U2FA 1U7PA 4LJ7A 1CUIA 4QGBA 1X0VA 4GBMA 4KBFA 3TR0A 4C4YA 4EMUA 5ITWA 5I7OA 1AJEA 1KVTA 4HIZA 2Z1MA 2BUCA 1XTUA 3DAFA 4OFZA 1G19A 4KR9A 1RAAA 3EGDA 3THWB 1QHSA 1XQWA 3AV3A 4LZJA 3OEED 4P82A 4HAIA 1PL8A 4GLJA 1LXCA 1KQPA 2AUMA 2M2IA 1VYVA 3N8DA 1BTOA 1T1IA 2HJSA 4JUCA 5BSFA 3Q41A 2AEJA 1BVRA 1ST2A 3MJEA 4L7QA 4S12A 3CC4B 3DKKA 4WXEA 4XXHA 3SQDA 1PGPA 3AFHA 2I2BA 1AF4A 4U7JA 4C4ZA 3F4KA 3OCCA 4RGQA 4TWBA 1MG0A 1EJBA 3E5HA 1Z0SA 2FWJA 4BNZA 1OTXA 3HR4A 4NG5A 1EFHA 1TMYA 1C1YA 2GXUA 3MJDA 1Q84A 4UASA 4WK0B 3RABA 3BULA 1FVFA 2PX4A 2HB6A 3SVTA 3SLKA 1HLGA 2XUIA 3FYUC 2CXSA 2QRQA 4NENB 3WV4A 1PJ7A 1AZWA 2DPYA 3N2GA 4KQJA 2A84A 2HU5A 3MGCA 3C5HA 4NH0A 4BNXA 2QE6A 4KPGA 3DNMA 1QPGA 2NN3C 4BLOA 4G2TA 1VXOA 3N39C 1UODA 2QR5A 3V6MA 4Q1CA 4Z6KA 5I51A 2J3DA 5TGDA 3KZKA 2ZE8A 3BH0A 2H1VA 2P9FA 4DDUA 1EP9A 1ES9A 1WVMA 3THXB 1R4NA 3CX4A 3M34A 1QH9A 4HDKB 4OSEA 4P3KA 4URFA 5THKA 5HKBA 2RHJA 1Y7HA 4IYJA 1GQQA 1UL1X 1RXIA 4ZYZA 4GXNA 5CEEA 3M8KA 2W6QA 1U8TA 1LFDB 2BD0A 4I46A 3QY9A 4NE7A 4PVCA 1NN1A 4BP9A 2WUGA 4JT8A 4WZTA 4IGAA 4MS1A 1NA5A 1VBFA 4FFVA 4LXTA 2ZAYA 1TJYA 1X14A 1QO0A 1G3IA 3REOA 4F1KA 1OXUA 1U7DA 2IXEA 1WDMA 1T2UA 4XWTA 3FNHA 3O92A 2PJDA 3T12A 4F86A 3UUFA 1W9MA 2V3VA 1SWVA 4I1UA 4MIEA 5C7IO 1M2EA 2EKBA 5AWFC 1HG1A 1GGJA 4DQUA 3UFBA 4GSLA 1GADO 3WADA 1NQVA 3Q39A 4R41A 5HBRA 2V7PA 2NO5A 3ZHOA 4JN6B 3VR4A 2V5VA 3N9IA 5JNSA 3HK2A 4MUKA 4Q02A 1HURA 1YMUA 3D3QA 5COQA 4ENPA 1BDHA 1PT7A 3ZHCA 1BS1A 5B6IA 2W4IA 4W4TA 1XVIA 4KVZA 3Q8MA 4U4AA 1JZSA 4ZXFA 3F7NA 4P35A 4TM7A 4TTPA 5DS0A 2OSVA 1NMEA 1B8PA 4Z4RA 2XWBF 3QUTA 1GDHA 4AG3A 2Y0CA 2SICE 4JUDX 4OLJA 4PQYA 4IQ8A 2ZJ7A 3HKEA 4HGZA 5CLHA 1Z2NX 2XE4A 3TRJA 3HSKA 4R01A 4BX8A 3QPWA 5EFZA 4N9WA 4PCVA 3WK6A 3GRFA 2IXFA 4N48A 2IEAA 2JHCA 1L7MA 1Z29A 3DE3X 3HEMA 3RVJA 4C3UA 1E1MA 1NVFA 4HYEA 1J0CA 1JR3A 1ZK4A 3GCWA 4PHFA 4BQQA 5J4YA 3UW1A 3WMXA 3N86A 3IQXA 1TM3E 1OBVA 1J06A 1RPAA 1Z22A 3G59A 2UVPB 3L8CA 4J16A 4IXMA 4HB0A 2VBUA 3DKVA 4JR1A 4KAXA 4N8SA 3ZUPA 5BXQC 4H4DA 4KQGA 3BWXA 2DY1A 1IN1A 1D4FA 3OFKA 5JISA 1G4UR 3FMIA 4UPEA 4IGIA 5K0TA 4Y1FA 1C9KA 2JRCA 1VL1A 3KDAA 1SRRA 1BA2A 1L1QA 2PXCA 1ZEMA 3UPTA 5DTMA 3STXA 4B4WA 2BCGY 4OXYA 3ZY3A 4EYQA 3EZGA 5LA6A 4UOZA 1TXGA 2YBDA 1W34A 1T8YA 2IYOA 3T94A 3UWPA 4XLAA 3UC9A 5DM60 2QORA 1PS0A 4YYZA 1VB5A 4Q6WA 4Z7OB 2WVJA 4GMDA 4H6VA 4PNZA 3O4VA 5IJ0A 4G97A 3ZXXA 2HIAA 3HTXA 2WKSA 1N5IA 1RRVA 4GDMA 4MWZA 4D9NA 4YPVA 3L7AA 5IYWA 1K8QA 1L5MA 4ZDKA 4PC1A 5G0VA 4ZICA 2HL6A 1JI0A 4IDEA 5K3CA 3Q7EA 3VDQA 1W73A 4INOA 4OA5A 5BO5A 2QSYA 3WSTA 1LPAB 1RQ7A 1Y5LA 3JQ7A 3LT2A 3VYSB 4CIVA 2ZGVA 1T5HX 1T2FA 3LZ6A 4X7DA 5I6DA 4I3FA 3TVYA 3CJQA 1C0EA 3BYZA 3VOTA 1ZEJA 4LDNA 2ZS7A 1F51E 4UEQA 4WNYA 3MUFA 3CLSD 2YNMA 1XCBA 3M4YA 4MWTA 4XLZA 5LQJA 1PJSA 1PR4A 3I6IA 2ZRPA 1RRFA 1UAAA 3DH0A 4RDCA 3SNKA 1YA4A 2ILVA 1W9XA 1EK5A 4DY4A 1LBEA 4YWJA 5CW2A 4D0GA 4PLCA 3ZPNA 3QW4B 1LPSA 1TJ4A 3DB2A 3COWA 5DNDA 1O8BA 4A2PA 4UHHA 4ARBA 1H4QA 2AOTA 5ADWA 3JV7A 3OZAA 1EEHA 5GY7A 3LWZA 2B8EA 4MV8A 3P9ZA 2FPIA 2EJVA 2W8BA 2DXIA 2NV6A 3MELA 3EDCA 4LBWA 1M76A 1ZU5A 5CGQB 4RJLA 3ZH9B 1N77A 1YJBA 1BD3A 2XMDA 3FPSA 5DSXA 2RHBA 3JZIA 4FIDA 4K6FA 5FI3A 4J03A 3ZHYA 3EVZA 4C0QC 5AVYA 2BMVA 1Z75A 2HM7A 3A27A 1DT5A 3BGVA 2AJLI 1F0YA 1H2HA 1H23A 1VIVA 2GN0A 2ZVQX 2GBLA 3ZCSA 2YRFA 1MABA 1C1DB 2C2YA 3IKMB 3VGJA 3TZEA 3IP3A 3WY9A 2HGSA 3L46A 2ODBA 3KEGA 4GPD1 4OSPA 1WD5A 4RY9A 2DC1A 1ZH0A 2HF8A 4Q3AA 4BNDB 2CHEA 3AHIA 1A2KC 3B3GA 4UZEA 3IUJA 3L01A 4AUKA 4BZXA 1QGOA 4R83A 3U7EB 3FDJA 5F21A 4OFXA 3S28A 1ZOOA 2ZSAA 3R0XA 1VLMA 2GEUA 2I6TA 5ESXA 3C3EA 3ZI7A 3V4RA 2GJPA 5FLYA 5FO1A 3L49A 1N6OA 2O2DA 1QGUA 2GASA 3O93A 1SBZA 3DBLB 4RGVA 4QGAA 3BE8A 5K99A 4MDFA 2VNJA 1FFEA 1ZC4A 2QZJA 5K6AC 1E63A 3I45A 5A5VA 5ARDA 1OV6A 3C6YA 1VG9B 1XVUA 3TOCA 5MDHA 3U4AA 4H1WA 1VI5A 2IL1A 3KAPA 1U02A 1ICEA 3J80A 1A97A 2AFHE 3KYCA 1U1FA 3PJDA 5BVGB 1LNQA 2VA8A 4EA8A 4YUXA 1SUAA 3G5UA 5JEDA 1IUNA 2ZBVA 4KQ6A 4D9HA 1W1UA 4A27A 4PSAA 2A9RA 3WKEA 2YN2A 4IIJB 4A0SA 4BQRA 4JYMA 4DZTA 3SQNA 2P2CA 3FCCA 3FPHA 3LDGA 4CUJA 4HATA 4P34A 2EJWA 3GJ3A 2FHSA 2G82A 4HBZA 4BV8A 2XQIA 4L16A 3ABSB 2F55A 2QX6A 3WBJA 2RBEA 4NICA 3VC2A 5HZGA 4RNDB 4FNAA 5HPYB 2GK3A 2XHZA 2FETA 3T9BA 1G5TA 4J0HA 3JX9A 3VHXA 4WBSA 5KJFA 3MWGA 2H00A 3I6YA 3GXBA 5FUYA 4OOVA 5G0UA 3J7AC 4HEA1 1DIAA 2GVNA 4JK3A 1RAIA 3RHSA 3LGXA 1LC0A 5ENDA 3TUJC 2XYVA 3ZJUA 2FFHA 3T06B 2FMTA 5TF0A 3BK2A 3AR3A 4U2DA 1OI4A 1FFAA 5KAMA 5LL6P 4ZODA 2W9XA 2W0SA 5PNTA 4PFSA 3GLIA 2QN8A 3O4IA 4XM0A 3PA2A 2WG2A 3L1VA 3E58A 4QDTA 2YJZA 3ZWKA 1ONBA 2VH2A 1G8YA 4MI1A 2JFXA 2R86A 3FPAA 2O3UA 5JVDB 4GIBA 3B8HA 2EBWA 3HDVA 3URMA 3EIFA 2ZEJA 3ND6A 5KYXA 4LG1A 3AHGA 2BCJQ 1LBTA 4AP6A 3QU9A 2Q2QA 2B2XA 2PH1A 3TZHA 1GXSB 4OIFA 2O54A 1GKLA 1YK1A 3QLVA 1WL8A 1QYXA 4WTOA 1GUAA 1NJID 2PBZA 3DGEC 4AU1A 5JCPA 1WHSA 3IDZA 4OL9A 4EG0A 2EDCA 3ONNA 3O8QA 1U4NA 4I3HA 4Q3KA 4US2R 3I72A 3GJRA 5FYQA 5IEJA 1THGA 4UHBA 1OVMA 4WOPA 1OF1A 1ZD9A 2Q1WA 1GUFA 4ND3A 2VUIB 4ZO9A 4NNPA 2A35A 1AM4D 2NO6A 3AUJB 4WESB 4GW3A 4J4TA 4FI3C 5A05A 2PH3A 1ISGA 1RHRA 2H5EA 3NHWA 4M9ZA 4BQFA 4F56A 5DU2A 4BC1A 3GLIE 3DD1A 3PUYA 4BLPA 5BV7A 1JHDA 5BNZA 4U7DA 1QVZA 2GZAA 4DAEA 3LS2A 3UTCA 1JBKA 1PEAA 2O0JA 4NABA 3WGOA 1CP3A 4KIWA 1YOBA 2ZZEA 5CNKA 3HUFA 2OC4A 4R7TA 3ZEIA 4ZJUA 2ZSDA 5F52A 1E3EA 4CF5A 2M5SA 3QVUA 3S2IA 5JS8A 1HI9A 4JI7B 1G0NA 1BQEA 1VI6A 3CF0A 3WB2A 2H1OA 1RZ3A 5EIWA 1M1XB 2ILTA 2CLMB 1PQUA 3CPEA 4Z4UA 2CF6A 3DLIA 4RTNA 4Y2SA 1F1JA 2OBYA 3E8MA 2AWNA 4KMMA 4TSKA 4AO7A 3TH5A 4B45A 4EMBA 3LL4A 4CF3A 3OKAA 2RHLA 1KI6B 1XTBA 3EULA 3LBIA 3OUTA 1RAGA 4AJKA 5IBCA 5SYAA 2UYCA 1OH8A 4DA0A 4G84A 1NMQA 3A6JA 4GQIA 1A4UA 4MKFA 5SZIA 3AQIA 4RD3A 1KJQA 3LT0A 3I73A 3WMWA 3IT3A 1VCOA 1KVUA 4PR0A 4YJHB 3BCUA 2OZKA 4OP1A 4DT1B 1S1MA 2I91A 3NM6B 2R00C 1EXDA 1MO2A 3A14A 5ERYA 4BEWA 5LQNA 4DCSA 4XSVA 3CUVA 3PI6A 4HAUA 3F3KA 3JYOA 5A1JA 1XF1A 2JKVA 5HRCA 1T5TA 2ZYHA 5E6RB 2ZITA 3GFSA 4LFBB 5DBOA 1C2TA 2Q1SA 2BGMA 1PF7E 4B4DA 4MQ5A 3MWLA 1JHPA 2HSEA 5TSDA 3I39X 5LQCA 3Q3JB 3LWDA 3PC8A 4BATA 2PFSA 1XYVA 1P0CA 2WMNB 3ED1A 4I08A 5ARBA 2JLYA 1W5EA 3U3ZA 5G2OA 4NLLA 2O1XA 3L84A 4FDMA 4FGZA 3LW8A 4UBLA 1ABBA 1VDZA 3H42B 2NYVA 4NYJQ 3ZX4A 1E89A 3RYHA 1E9SA 3C24A 3R09A 2DOKA 5G4KA 4C3ZA 2G0AA 2EJTA 2IUTA 5AM4A 1EHCA 1SULA 3MGGA 3NBAA 4ALLA 1XAJA 3FLAA 4JYPA 3VZDA 1E1CB 4B75A 4BU1A 1D2RA 1WORA 1UT8A 1OPXA 5GQSA 1YZKA 3DEYX 4C4SA 3FCUB 4GI3A 3NJRA 3MCWA 3EEFA 1C9MA 5HZBA 5BORA 2HHHB 2JI7A 3R3WA 4HN9A 2QM7A 3AR4A 3M5PA 4MARA 4QUJA 1O4VA 2GYWA 2G5PA 4JP2A 3VBCA 4A2CA 1BE6A 5DI3B 2ZU6A 4ND8A 1Z35A 4HZGA 4IRXA 4PTLA 4OXRA 2I65A 1ZNXA 3SZMA 3LFTA 2YZ2A 3BB4A 5KOHA 4XYMA 3P7MA 4PLFA 2OGZA 2QDKA 3K31A 1WEKA 5J2TB 1Y4AE 2PNJA 4QM7A 1P6QA 1W2GA 1RMTA 1W88A 4KXWA 4E5YA 3EXHB 3HLTA 4JFAA 5BYJA 3I34X 5CEFA 1NQ5A 1PQYA 3DSRA 2VDPB 1T1GA 1YI0A 1XVTA 2JGFA 3FYCA 4QPCA 3LNNA 3CCEB 4BDSA 4DS3A 1NUTA 1NM5C 1N8NA 2FZGA 1CR2A 1PK9A 1SUWA 3BILA 3HCNA 3UJCA 4CF7A 3H2SA 2WJIA 4UD2A 2VJJA 1E1LA 1KI3A 3DAPA 4YPFA 3K9BA 1UM9B 2RBGA 2GN1A 3JZFA 2D2IA 3A6PC 1ZI9A 2ONCA 4YMLA 1EHIA 1OXVA 3JWPA 3KCQA 2C5AA 3WSVA 3A6FA 3O8BA 3H8SA 2WSSD 3BIWA 1G291 2JAOA 1TIKA 1V95A 3SLRA 5IYZB 3DOUA 4KKSA 2XITA 4BN0A 1U7HA 3IJRA 3N8KA 1C41A 3Q3CA 5EMMA 3WP1B 4CFZA 2B30A 3CNHA 2FFBA 1FFGA 2WQ7A 1EWKA 2WKPA 3CPJB 3MS7A 5D84A 3N75A 3LM8A 2B36A 3EAFA 3JQAD 4IUBS 1MV8A 3PE3A 1ZNWA 3LLVA 4AJNA 4P3PA 1HDIA 3ESAA 1AO3A 3LF1A 3L7KA 1EFPA 3L6UA 4IDDA 3SX4A 1X86B 4HFJA 2O20A 4OQFA 3PQ2A 2PRJA 1GA1A 4Q4DA 3N05A 3LY7A 5A2QA 1J2YA 3NJ8A 2FW0A 4ZJZA 5GZ6A 4ZYLA 4M1MA 3GGSA 1PBTA 3NHAA 4JYZA 3DW1X 4ED9A 3GJ7A 3QPVA 2O8BB 1DQRA 1UQRA 1T5SA 4EJMA 5HZKA 5A1TA 5KIAA 4EZEA 4BP8A 3P19A 5DI9A 1L7XA 2X85A 4R7ZA 1N5JA 3WV5A 2RHWA 5JEEA 4TYQA 3H3XA 4XSGA 4O1HA 10MHA 3G7NA 2IWHA 2C4UA 2G08A 1DX6A 2OM6A 3LPMA 3K1JA 4EHDA 4JI6B 3D8TA 3FNQA 5DLPA 3L1UA 1QYDA 3TSZA 1ZZGA 3MB5A 5D1NA 2FXIA 1Z6XA 1W5FA 3JSXA 1X7YB 1JKMA 4TQUS 3DT9A 3AK4A 4OM7A 4OU5A 5IN5A 1T4BA 3ZWAA 4AZWA 4GI7A 4CU5A 3LH5A 4WN9B 1VYUA 4FZRA 1L4EA 1KR2A 1ZESA 1RI2A 4IWYA 2A9JA 3GV0A 2VBGA 4Y1GA 2JH8A 3CNLA 3OKCA 4EYEA 5JBNA 3FFBA 3F6CA 3GRPA 3UGJA 1I9CA 2EFEB 5D3MB 4OAOA 4C4XA 4CKEA 1AMUA 4BAGA 3KSBC 3OY2A 4LJ6A 4RQTA 1U4OA 1I7DA 4HMQA 1Q7TA 3FR8A 4QEDA 3I09A 5A7GA 3KZVA 1ZK1A 2GFIA 2X8AA 4RM0A 4HEJA 1P4HA 3X0DA 1N0UA 4JKYA 4C6TA 1NZJA 1R9NA 3VJLA 3AJAA 4IGKA 1GUDA 1ZNZA 2DFPA 4HQFA 4RK4A 3DPUA 4HJRA 4MW0A 4Q03A 2F3UA 5BNFA 3RLFA 3BMCB 1Q7GA 1RXWA 5AW8A 4QQNA 1ZIDA 1YJQA 1XU7A 3CT6A 3HFGA 1XWFA 3FPBA 4D0LB 4BMCA 5EEHA 1R0CA 2GFHA 2FPOA 3RSLA 5CX4A 3LRTA 4HEQA 4B3RB 2AR7A 2M98A 2PR2A 1JU3A 4QHTA 3SKXA 2IUUA 3TIVA 4C3VA 4ARIA 5SZKB 1KJ9A 3UMVA 2OCLA 2H06A 2O2EA 3IEPA 4GGMX 721PA 3HCOA 2J0SA 4EHNA 4GSYA 4RXMA 1UDAA 1NMXA 3D1JA 3EGWA 5GV8A 1N6RA 1ODIA 4WEOA 1DJNA 3RS0A 1RM3A 2CD7A 5LB2A 3T7KA 3U6KA 3K6RA 1ZISA 2H31A 1S01A 1XA3A 3KWLA 1T2EA 4Y6PA 4FBLA 1VFPA 3GEBA 3ET4A 1B1CA 5E6UB 1PW5A 3SNHA 1WPGA 1ZRSA 5CLLA 1AS2A 4FLEA 1IPFA 4YUWA 4GT1A 2ZTMA 5DTJA 1T5EA 3WLHA 3A35A 2C2ZA 2BGIA 3JWIA 1V0JA 1N5DA 2X77A 1TAHA 1TYEB 4F2WA 1X42A 4IZOA 1Z34A 2VBFA 3CN9A 2Q9CA 3QLJA 1UXHA 2GCNA 2PGLA 5ALEA 1N36B 3HWWA 3KQWA 5AK5A 3HXTA 1O58A 1OH6A 3I2KA 1EZ1A 1W5TA 2WWGA 1ZP6A 3AETB 2KMLA 1JP7A 2HRQA 4J6FA 4RVHA 2V0CA 3T7CA 5KJ1A 1WTCA 4QE3A 3OFVA 3UBMA 4TSFA 4HXGA 4WNCA 3VU9A 4EJSB 4KDRA 4KNYA 1TO6A 4FPXA 1GPUA 2H48A 1JR6A 3GG2A 1PG0A 5JMWA 4C0KA 3C0KA 4Y1RB 1W36B 3P20A 1JQEA 4FWBA 1LDMA 3MFQA 1IQPA 2J5KA 3WAKA 4US1R 1XPOA 2JGMA 1D07A 4HNTA 3B2NA 1NBMA 3CUKA 3STUA 4E5SA 5AD1A 2P2YA 3JALA 2Q9BA 1UZNA 3AZQA 3R5JA 3L3BA 1MA0A 1IBSA 1J49A 4EITA 1XMVA 3EIWA 3KB2A 1UXOA 3NP7A 2A0XA 1QH0A 4CMEC 2GR9A 2GRAA 3GFFA 2Y1GA 3TMAA 3NVAA 4QAQA 1KBQA 3VKUA 1O3YA 3PDCA 4YJGA 5DNCA 2KX7A 3MWEB 2PBLA 1R18A 3OECA 3N28A 2DMRA 2I1WA 3U7HB 2GBIA 1VSUA 2XVYA 4HLDA 3FBGA 1R15A 3G5TA 4LF6B 4EFMA 2CF4A 1GPH1 1P7PA 2NPIA 4BNDA 4C01A 4C0SA 1Z07A 1F2TA 4KV7A 3W78A 1NVWQ 4KSBA 1DZIA 2O7VA 2V55B 3AEKA 5C5IA 2PVPA 4CM4B 3IV7A 1Q3HA 1ISHA 5J63A 2JBHA 3H1TA 1BD4A 4MYSA 2DVMA 4PAOA 2MSCB 4XWWA 4KPEC 4KQWA 1CF4A 4OK6A 1Y6GA 2P65A 2PZ8A 1PR0A 3UGKA 5FLEX 3QE2A 3KBOA 5BV1A 3A8TA 1SVLA 1U5BA 2RDMA 3CB4A 2VRCD 2VHCA 4HUJA 5I4CA 3H5TA 1NBME 1W46A 4X7PA 8ADHA 4AVYA 2OXFA 2PG3A 2NZJA 1TTPB 1NQAO 2VHWA 3ZU5A 5J58A 1PDVA 3DZ8A 3WJ1A 4X3OA 1S96A 3H6HA 3LT1A 3ZZUA 1B2LA 3AEXA 2QXTA 2NUPB 1L3IA 2J32A 2O50A 3IBTA 5BSMA 3RC8A 5JC1A 1ZLYA 1BG6A 3T0GA 4L6CA 2ZSUA 1BLIA 3ONWA 5AVKA 2BUAA 1NNI1 1ECCA 3FPCA 4U02A 1Z08A 1RWOA 2I66A 1MC1A 2VP4A 3EXG2 3RVQA 3H8WA 3OESA 4EKNB 1X1RA 4JT9A 2O05A 2P2LA 1T25A 1ORVA 2FRDC 3MT8A 4LMPA 1EBUA 3AF6A 1DRWA 1XAGA 1UKZA 2V7VA 3K0FA 3EGDB 1JB9A 2W6JD 4A6EA 3A2KA 1OFVA 1CS0A 3K7EA 5I3ZA 4LRWA 1KI8A 3OW2B 2CXPA 4Q5IA 4OQZA 2REQA 5M04A 4RFLA 2G4VA 4M8LA 4NF2A 3ZGXA 3AVOA 3K2IA 2OESA 3IAXA 2ZXIA 1VHQA 4M0MA 2O3TA 4OP3A