3W5VA

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
297
structure length
297
Chain Sequence
KCSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 86
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5vA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5vA02
2HCJB 4ZCLA 2B5OA 1K8AD 2QMUA 4YHBA 4PGOA 2BN4A 1QVGB 1SKQA 1DARA 2DETA 1QUFA 1BX0A 2C78A 4TMXA 3W2GA 4K1XA 4N3NA 3CC7B 3JQRA 3W2EA 4AF7A 1VQ8B 1IJFA 4F7DA 3MHPA 3CPWB 1VQ7B 1GAWA 1Q86D 1K73D 3CD6B 4HE6A 3WY9A 3WXMA 1FNCA 1Q81D 4Y7CA 3JQQA 3MMPA 4J0QA 1VQMB 3P26A 1E63A 1I7PA 3W2IA 3LO8A 3VNUA 2PIAA 1YJNB 4TMTA 3FJOA 1D1NA 4NCNA 1U2RA 4PC3A 1D8TA 1EXMA 1Q7YD 5THXA 4YAFA 3CMEB 1DG1G 3AVYA 1ZM3A 3J81k 3AVTA 1W2BB 4RD6A 4RD1A 1NJID 1EFCA 1S0UA 4PC7A 1AIPA 3W2FA 2XNCA 1XE1A 4TMVA 4QFMA 3CCRB 3W5UA 3G71B 3AVXA 4ZGNB 4TN1A 3QE2A 4G5GA 3AVUA 3VMFA 2VNIA 4EH1A 2BM0A 4WQMA 2CRVA 3CMAB 4FWTA 2X3UA 4PC1A 4R71A 2DEUA 3W5HA 2BSAA 1KK1A 3ZZTA 3OZVA 3FPKA 1EWYA 2C77A 1FRQA 1W34A 3WBJA 1VQ6B 3VO1A 1J9ZA 1BX1A 3VNVA 1M90D 2FX3A 4HE5A 3AVVA 1A8PA 3ZZUA 5KSWB 1QH0A 3CCUB 3V76A 1QGYA 1W35A 4B44A 1IB0A 4Y9RA 4C0SA 1KK0A 1BQEA 1ZM4A 4RD3A 3AVWA 1B2RA 1QVFB 2J7KA 2DY1A 3G4SB 3OZUA 1CNEA 4ZGQB 5H59A 2EIXA 4B47A 4TMZA 4M0LA 4UAJA 1FRNA 1S72B 2QEXB 5DSZA 3CXCB 1ZM2A 1JNYA 3B82A 3AGPA 1KJZA 1WDTA 1YITB 1QUEA 3I1FA 4MYTA 2B7CA 4RD4A 4C43A 4MYUA 1YJWB 3CCVB 3ZC3A 4FN5A 1F60A 2OK7A 4RD2A 1B23P 2DCUA 1G7RA 2YWGA 3CCEB 1D2EA 2QA4B 1E62A 3QFSA 1QFZA 3CC2B 4RD0A 1QGZA 1QX4A 4PC2A 4U9UA 4YAUA 3W2HA 4LBVA 4M53A 2QTZA 4AC9A 1JB9A 2BV3A 3ZZ0A 1YJ9B 2PLFA 1N0VC 1JJ2B 2E1RA 1KD1D 1GVHA 2R6HA 3QFRA 4NBSA 5GV8A 1VQLB 1H85A 2PMDA 2DERA 4N3GA 2BM1A 1VQ4B 3ZBTA 1OGIA 2VYQA 2BMWA 4ACAA 4B3XA 4RCZA 3OZWA 3E1YE 2HDNB 4P3YA 1GAQA 2GPJA 2B7BA 4LBZA 1TTTA 4IW3B 2YWEA 4FK8A 1FNDA 3OW2B 1E64A 4M1KA 1UMKA 2YWFA 1EFTA 1EP1B 3CB4A 1EFUA 4ACBA 3ES9A 3SJZA 3JQPA 4RCYA 4ZV4A 1G7TA 4LBYA 1CQXA 3QFTA 3U2QA 5H5JA 3WNDA 2QN6A 2AHOA 2OK8A 3G6EB 5TV2A 3WNCA 4QHYA 4LC0A 1VQOB 4H9GA 1FNMA 5FA6A 1KRHA 3CCQB 1XB2A 1Q82D 1EP3B 4TMWA 4G1VA 4DQKA 1R5NA 4BPRA 2BPOA 5TY0A 3ZBUA 2GQFA 1HA3A 1KTVA 4B4DA 1KC8D 1GR1A 1ELOA 3CCLB 1G7SA 1ZM9A 1QG0A 3CW2A 5AN9A 3A1FA 1EP2B 5TR9A 2OTJB 5HXBA 1VQNB 4ZCIA 1N8RD 4P6VF 3OJXA 3VO2A 1NDHA 1JA1A 2EFGA 2XNJA 2BGIA 4ZCMA 1KK3A 2YWHA 2BVNA 4RJLA 1OB5A 1FNBA 1JA0A 2BF4A 3CCMB 2VZLA 1OGJA 5GV7A 1OB2A 1CNFA 3CCJB 2VNHA 1GJRA 1N0UA 1H42A 1R5OA 2ZITA 1R5BA 2RC5A 5JBQA 1YI2B 3WYAA 3CC4B 3E20A 3CCSB 3I55B 4YALA 1VQPB 3LVBA 3OJWA 1AMOA 2RC6A 1DDGA 3AGQA 1YHQB 5EMNA 3QSYA 2D74A 1TLLA 3WBKA 3LYUA 1FDRA 1VQ5B 4B43A 1M1KD 1BJKA 4YAOA 4YAWA 3P27A 1ZUNB 3MCAA 2NPFA 3LRXA 1DDIA 1K9MD 1GO2A 1QFYA 3U6KA 2CNDA 2HMAA 4B48A 1KQSB 4M4SA 2QTLA 1QFJA 2VNJA 1YIJB 4G1BA 1TUIA 4Y9UA 3B8HA 1VQKB 2BGJA 1F20A 1TVCA 2XEXA 4DQLA 1SM4A 3W5VA 1VQ9B 3QFCA 4LBWA 3PENA 4PC6A 3WNBA 3CRZA 4AF6A 1W87A 4Q7JB 1QGAA 2OTLB 1IJEA 1KK2A 3U6BA 3B78A 4M2LA 2VNKA 1G7CA 2QDXA 3I56B
chains in the Genus database with same CATH superfamily
3B2EA 3FWNA 3L4BA 3NKVA 5KIAA 5JU6A 4HLQB 3L1IA 4B4KA 1PR2A 4B5KA 3ZWOA 1PNOA 5LYJF 4DSOA 1SUDA 2XODA 4E12A 4UVHA 2XV1A 4NH0A 1WCIB 3G2PA 3K9GA 4C4TA 4K86A 4KTTE 3IHTA 4JEIA 5CH5A 3TAXA 4N7JA 4FFBB 4UQOA 4DL9A 1GPMA 5I9IA 4ZN6A 4G9BA 4FQ8A 4L8WB 1BWPA 1XZJA 1BX0A 4FOOA 3VYSB 3DUFA 1P6XA 3LX4A 4Q1CA 3UAVA 3V1UA 4Q9NA 1WXEA 3F90A 3DZKA 2NSDA 1Z74A 2ZSIA 4L8VA 1QP8A 2PZ8A 4L3OA 4MMYB 3HP7A 4PG6A 2PFKA 2NP7A 5ANRB 3CNEA 1P9WA 5K0EA 4X54A 3LCVB 2BRUC 4NDZA 3MHPA 4PLFA 5CYFA 5FUXA 3IKLA 3OQ1A 4N01A 3STWA 5AQ1A 3FLBA 3NI2A 2BC9A 1TZKA 2OO5A 2ZUDA 3A8TA 3F7OA 2G1AA 1CERA 3QQPA 3ZHCA 1YQGA 3NCTA 1Q86D 1C8LA 4B8ZA 4TVSA 2C84A 1K73D 5DM1A 4RDCA 4EA8A 4G0UA 1SOWA 3GDWA 1QFMA 2B4RO 4KBYA 5EJGA 3RSGA 4GOLD 5K3EA 5FBVB 2X5JO 3AVPA 5KO2A 5J2TF 3S4YA 2J59A 5B1IA 4TSFA 1E0SA 1INLA 2CFCA 1N2CA 3ZY3A 4RK0A 3GT7A 5B1EA 3EX7C 1QXSA 1UDBA 1X87A 4PLCA 4BTLA 1QKJA 2Z9DA 1V41E 1L4YA 2FZLA 3NC4A 4X8HA 5EWLA 1SHKA 3WLEA 3NC1C 1GZUA 4RTLA 2F4NA 4ZVMA 5SV2A 3RYCA 3CKYA 3K5IA 3S27A 5JC8A 1RXSA 1X7DA 5ALRA 2X5KO 4C3OB 3CNNA 4OJMX 2YS6A 3BL8A 4PVCA 5EE3A 5KNBH 3VRHA 2IBMA 4CIAA 3MJFA 4CZ2A 5EJ6A 1NDUA 1PTKA 1XD8A 2GM3A 2WNHA 3ED5A 3K0FA 4PLTA 2C54A 3FH0A 3KQLA 5KYYB 3PZBA 2CLKB 1HZEA 4AZ0B 3QXHA 4IIFA 4BV8A 5FEMA 3TR0A 4WNYA 4NBTA 4X66B 4OY3A 1XTQA 4EYQA 4B3SB 2PWZA 4U00A 1RC0A 2VFAA 2WZCA 1CC1S 1W5AA 1AH2A 4EYEA 3OIYA 2HPAA 2BFFA 3OEED 4TL6A 2O0JA 2C9ZA 4E15A 4PC7A 4MZXA 5ESDA 5F76A 3RBVA 3UXHA 3BAZA 3F78A 2YW2A 4K6MA 3A3GA 1ODFA 1Z6QA 3RUFA 1G59A 4JJZA 3HB0A 4ZGNB 4GM4A 3LLUA 3LJKA 4YH1A 1XMXA 1BO6A 3L7LA 3NAGA 4FTWA 4NYJQ 3C45A 4U2EA 5E7IA 5DGCA 1WY5A 3ZDZB 4PYJA 4WJKB 2HRBA 3VDMA 4RK1A 1XNRB 4AY2A 4EH1A 1JWAB 4WESA 1NW8A 4G0PA 4WQMA 1DRJA 1CQIB 3TI7A 3U3MA 5I7UA 2H1SA 2Z8XA 2P75A 3M4JA 4CMEC 1WXDA 4HB3A 2FSPA 3KZ1E 1OWOA 4HWTA 3WYBA 5JADA 1S96A 3IHLA 4JI1B 1ECFA 3OM9A 3U7IA 3EQ8A 2WIGA 2J3IA 5YASA 2ZJFA 3CX3A 3W5HA 3S2ZA 1NWHA 1IOLA 2HBRA 3HBMA 2AV6A 1KK1A 1EM6A 1JEAA 4GBGA 2Q4EA 1XQ1A 3UA4A 3KKLA 4YN3A 2IP4A 3KAQA 2QM0A 4DXHA 1WSAA 2VI5A 4XFJA 3SYMA 2H1WA 3P8ZA 5HIMA 1W581 4LXTA 2PFGA 4R9VA 1V9SA 5FA8A 4NIMA 1UXOA 1E8NA 3JALB 3K94A 3QZUA 4UNNA 5JVDB 1A0OA 3GK3A 3VYWA 4HI0E 5JMPA 3P9KA 4TL9A 2EG9A 3AIMA 4BNUA 1VB3A 1N36B 4PXSA 5DTIA 2ASEA 1ZN7A 7ADHA 2GYWA 1T91A 5CDFE 5LR6A 1QLJA 2RGGA 2XE8A 3C3XA 3D6UA 4E4RA 2RE8A 1MX3A 4ZTZB 4DSTA 4CM8B 3WGOA 4L5IA 5AI9A 4JL5A 2QRJA 4LPSA 1YNOA 1S2LA 3C8UA 5CDYA 2QORA 4F4CA 2QR2A 3A36A 1CDZA 1GPJA 3CUSA 1ECJA 3CCUB 1RI1A 3EXHA 1LTHR 3DXFA 1Z45A 4Z1MD 4OBBA 1W35A 3O83A 2PNJA 5KREA 3PD7A 3BDAA 3GUHA 4MQEA 5CT8A 2C5AA 4IZIA 4K5QA 4PY2A 4IJQA 3LZCA 4WE3A 1GCUA 4LYFA 1Q1BA 1R4MA 2I8CA 4WLNA 4P92A 1CJTC 1AN0A 2BBWA 3NDIA 1T0JB 5NLLA 1GKKA 1X39A 1DKRA 2BFCA 1DVRA 2X9GA 4LMRA 3U3KA 5JSHA 4FHEA 5G41A 1AS3A 2LIVA 4HTAA 2Q07A 4F5YA 2OCIA 4MVCA 1YJ8A 2QD3A 2VRCA 5AUQA 4ZZIA 2PX2A 2ATEA 5CB4A 2XQVA 5FPHA 5LQSA 3ZPNA 2BDTA 1DKOA 3P97A 5L7TA 2GMWA 1N3YA 4KWHA 1RAAA 4RESA 4KQEA 1F2UB 1UBTS 1GV1A 5KJEA 4DOMA 4EUNA 2AYXA 4JJIA 1Q92A 1LC3A 2PSFA 4O2AF 3C39A 3NOXA 4M8NE 4LRWA 5DNVA 1AKEA 1QO9A 4ZOBA 1SG9A 2BWJA 3SF8A 3ZU3A 4E1VA 1AKWA 4MVJA 1FFXB 2PTGA 3K2QA 2OPBA 1NOIA 4NV0A 4XLAA 5GGYA 4ZDIA 4ZU6X 1XC7A 3NWJA 3O0DA 5KVSA 4GE0A 4H3VA 1OH5A 2PVSA 3HDHA 3L0SA 3SHQA 1NM5A 1A9ZA 4G0XA 4HDAA 3AR8A 3AKYA 2P1ZA 1CUFA 3QXCA 1FDVA 5KYWB 1NXWA 5KYYA 1ISRA 3FCSB 4P35A 5JXGA 2F62A 3ROKA 4GGOA 3WL6A 3KLOA 1O03A 3ON5A 4F4IA 4TKZA 3VU8A 4UTOA 1EAMA 2FF5A 1NF3A 2Y77A 3SEQA 5HKKA 4QXRA 3P7MA 3V7NA 1NF2A 1VZ2A 2X8WA 3GFOA 3HCCA 2PRIA 5K0GA 2RKBA 3JV7A 4I66A 4KO4S 4PC2A 4MOWA 4MUBA 4QDJA 4FGWA 1CJVC 4AM8A 1WXWA 4LBVA 4JHXA 5BRNA 5TLSA 1JB9A 4D26A 1H93A 8GPBA 3FVVA 3NM4A 1N1EA 1JDTA 4NH4A 3UWPA 3G5LA 3HJAA 1YD7A 2RG7A 4OPMA 2ZJ3A 3OWXA 5IXJA 3O6VA 3N2KA 4BN5A 3TLXA 3EXFB 4OUKX 4QRDA 1U7DA 3R1IA 1B41A 2GKGA 3Q11A 5KNBA 1WX1A 4BO2A 3OH8A 4C7VA 1E89A 1JHXA 4R41A 3T5MA 4EARA 5JJCA 5DGHA 2W2OA 3RUDA 2X5XA 3PQ8A 4HWOA 4KQFA 1EX7A 2PUJA 2HMSA 2IC5A 3AL3A 3C3YA 3OJFA 4XTRA 4ER6A 4EVQA 3G9ZA 3VV2A 1LNSA 4AP6A 1Z5GA 4B4WA 1S6YA 3DULA 2YKGA 5TRDA 3E9DA 3O4HA 4Y1FA 3TTTA 1MVNA 2E3JA 2HIGA 2XYGA 1KWKA 2LGJA 1Y9DA 1VXRA 3EUAA 2DX7A 4IGFA 4HAOA 4PFJA 4PZYA 2R00A 4ZANA 1BWSA 4PU0A 5B2ZA 2ZJZA 5MGNA 3WLRA 1UC5B 1IL0A 1LK7A 1TIPA 3IALA 4GVPA 2OD2A 4AMYA 1K97A 2X1LA 4F45A 4PBTA 2OVFA 1FLVA 4LVCA 2NNWB 3CNOA 5HZHA 3ZWMA 4Q6WA 3DH0A 1T26A 2CVPA 3IDOA 4IXDA 2FXIA 1IZYA 2GCOA 2JEZA 3LX5A 1ZHOA 3WK8A 4TTSA 5BYBA 1J6UA 1OSNA 4NS4A 2O20A 2XTJA 5B64A 5AP9A 3PXGA 3GFRA 4IJWA 1OBCA 2FP3A 2CFTA 3OPQA 4H35A 4DHWA 4AN1A 3CRW1 1R6XA 4HGQA 4DV5B 3K0HA 3CTAA 2WU1A 3CNQS 4H1UA 3KPVA 4F2WA 1GTSA 1QV7A 3DXZA 1VLVA 1JHRA 1R0BA 1H66A 3I52A 2QW8A 2QGGA 4HMOA 4RW0A 5FBQB 3CTMA 4KXYA 2B8NA 4IXWA 3PC8C 1VRVA 3H1EA 3K1TA 5A7GA 2OCGA 3IPAA 5IK2A 3MMXA 2CKDA 3NTXA 2M9MA 2Q4RA 1ENPA 5AXDA 5LDGA 3TX6A 1NXTA 2QLTA 5C8YB 4B3IA 3ETGA 1L5ZA 1M2OA 3HA2A 1MB2A 3OZ7A 1XG5A 1Y3CE 2J0UB 3P9RA 1N6NA 4QSMA 4C08A 4EG3A 2VQ3A 3Q5DA 1HE2A 3IEIA 3KVVA 1KRHA 3HO1A 4IIJB 4PYIA 3WHIA 4CNBA 2ZJ4A 2ZYUX 1P75A 3JXEA 3QU7A 2XX3A 1EP3B 2XJ9A 3AY6A 4PNEA 1N2IA 1A8QA 1N8TA 4L1KA 4DQKA 2EGGA 3QTLA 5AJWA 2PPVA 4XZ3A 1UEJA 3HR4A 4JP1A 2H17A 4L57A 4TUYA 4DBZA 2PBZA 1RHMA 1SBCA 2H1FA 3CH6A 1KTVA 4DNTB 1O6GA 3KT3A 4P4GA 1P31A 2G72A 3LVFO 3OT4A 3RWOA 4ZI2A 4UTVA 5KX5A 1VCNA 1HQDA 1GPH1 4ENSA 3H1FA 3I6ZA 2LDBA 2KE5A 2BKXA 1I0ZA 4HGPA 1GT91 4JOBA 1RP7A 3KEQA 4W1PA 2OXIA 5F2NA 2VJPA 3FFAA 2P8SA 3IGFA 4D4KA 2DWOA 2C7QA 2CSXA 1XXHA 1P5ZB 2D0DA 4TS9A 3GXOA 4EB0A 1E99A 2C0QA 2D1SA 1K0FA 4MKZA 4C0WA 5FTWA 1M2EA 3W06A 1YI0A 4RJ2A 2ZRFA 5MGBA 4EYKA 3J81A 2MYUA 1J9EA 3AEQB 4HAIA 3Q1LA 2P0AA 2Q5EA 1ULSA 3EOBI 4RH3A 1VL1A 4QODA 3WISA 2PMWB 1AHIA 3JYLA 2B2NA 5K0TA 2UKDA 3BRSA 2JHCA 3R9IA 4N82A 5IH3A 1X1DA 4GP7A 2IODA 2QBYB 1ZNQO 5JEDA 2M2IA 4FEAA 4HYQA 4EELA 1P0PA 1PK9A 3N8GA 3BB3A 1NULA 1A7KA 1HYEA 1Q20A 2FMKA 4YREA 5HWSA 3U44B 4WZAB 1FK8A 1GA6A 4Y2QA 5TJHA 3PC7A 1ZRSA 1NW5A 1T2DA 2GSDA 3IBFA 2PSSA 4AB1A 2BF4A 1WQ3A 1NATA 2REQB 3NYQA 1R3UA 3D4LA 4G37A 4X7MA 2N1BA 4LZLA 2D7CA 4I0WB 3W9UA 1QH9A 1KI8A 4G5XA 3NEJA 4U2DA 4E5KA 2C98A 5I51A 1G8HA 3G7NA 3LVRE 4YRZA 3E22B 1SA0A 1Q44A 3CUVA 2NQTA 3PUWA 3ROQA 1E96A 3UATA 4YQEA 1YH3A 2AB0A 1IN8A 1V6CA 2Q7XA 1M33A 1K27A 4WIAA 4MUYA 4ARUA 2FJUA 5A3JA 2COKA 1DBIA 2XHEA 4KN6A 3TPFA 5CNIA 1P1BA 2DCMA 3ADPA 1W25A 3OCYA 2QR3A 3K9LA 4YALA 3NHYA 4KXLA 1YA8A 3P9SA 4RY8A 1E0AA 3IR7A 2PXXA 1DDGA 3GLHE 5I7SA 3O84A 3BMQB 4X0EA 5HKBA 5BXQC 1D2HA 1P0IA 1UC4B 4MKRA 1LI5A 2WJ6A 3TKYA 5B1YA 1MIHA 4UFPA 1F2UA 1YL5A 4YCCA 1KKLA 2VKQA 1IY8A 2NZUG 2O52A 2QMEA 2AC7A 2OO7A 2D9RA 1H0KA 4H6XA 4ZT7A 3OMXA 5HCUA 1JAXA 1AXEA 3ID6C 2BKLA 4I4IA 3SXJA 3H9CA 3PUJA 3JALA 5FUWA 4LRUA 1XRRA 4GWLA 2FE4A 5I7AA 2HF2A 4D25A 1MRZA 2DAPA 4PZ9A 4C7XA 4DEVA 1U1EA 1UJ4A 4NJMB 4P5PA 1SCJA 2CHFA 2CNBA 2AF4C 3AUTA 4M55A 3R9WA 3SDSA 4M7WA 3TH5A 3JYOA 4B6PA 1Z8FA 3LM8A 4DRXB 2IY7A 2Y3IA 2HADA 1GPKA 1IMOA 4UNSA 2YCLA 5E4YA 1NVWQ 2XUGA 3KD2A 1DFHA 1HC7A 2VJKA 3VJLA 1ZFNA 1C1DB 4CLDA 4CG2A 2Y1FA 4JCOA 3V6MA 2PD4A 2C0PA 2QN3A 4DNPA 5LSAA 3QU9A 4DLZA 4DNRB 1X1QA 3EODA 3ELWA 5IHXA 5DP1A 2Y9MB 3H18A 1DO2A 4BMNA 1VBNA 2QD4A 4A0GA 2FW9A 5DN6D 3HUDA 1N4DA 1DEKA 3C6KA 2HIMA 2CZGA 3SS8A 2GR9A 3GPCA 3EE6A 1T10A 3M81A 3IO3A 2OMKA 1RYNA 2OBYA 3WYFA 4F21A 4A8JA 1OHHD 3KKZA 2VDWA 5MN4A 3I5YA 3ZJUA 1U9CA 3HY4A 4HFJA 4ID9A 4KC0A 1Y6FA 5JD5A 2BDUA 1T34A 4NMHA 1BU8A 2VCEA 1QAQA 2J5BA 2ATXA 1R9MA 3G6KA 4RPGA 1KZYC 3DGEC 3DLIA 1EIZA 2QVLA 2Q3LA 5G2OA 4OYYA 1PZXA 2Z56A 1OH6A 1UP6A 3HN2A 2VNSA 3JQ8B 1JEOA 1WABA 4AZWA 4YMHA 5A62A 1RPJA 1U04A 3O73A 4IM7A 4DDUA 3K05A 2BFFB 3RSHA 4LWQA 4Z3OA 1FDOA 1SXGA 2B4AA 1VM6A 4LI3X 5CB4F 3KETA 4MB6A 1LF5A 4K0RA 3T41A 2VJYA 2BJWA 3OW7A 2YYYA 1NLZA 1IHMA 2XMBA 1T9AA 3AFIA 1VRCA 4AZ0A 3I9NA 4YUZA 5M34A 3GELA 3V2UA 3WP1B 4NULA 5FOUA 4QTYA 5FQNA 2AYYA 2EGHA 1H9CA 5BN5B 5LPNA 4W8OA 3EF1A 3GLFB 2ZSEA 4TRRA 2PZJA 3QP9A 1ZZGA 2VP0A 4ZTUB 3K0FB 2WK1A 1U6IA 3IV9A 4W7HA 4W5NA 4HKTA 3TLMA 1NBME 2W2PA 4U7JA 4FSXA 5JSYA 5GPBA 5TARA 9GPBA 1TKRA 1G5QA 5CVUA 1PV4A 4YWJA 5BQPA 2EJCA 4I6EA 5EZ6B 4KZPA 4ZO9A 3WMWA 3E23A 1IY9A 4C05A 3U7RA 2WKPA 3ZD9A 1XTTA 1Y3BE 3QPWA 2P5YA 1BS9A 1I6LA 2CZCA 2Q4DA 5L7WA 3FOFC 5IAKA 5J5AA 2X0DA 2MSLA 3A6GA 2EFHB 2OGWA 4JOSA 3UNXA 2FWRA 4L5AA 5HVNA 1IBKB 4FFOA 3NYRA 3A06A 3NBMA 5C53B 1NKSA 2ZWOA 4HL6A 4BCCA 2WM8A 3JQ6A 4BVJA 3UJ7A 1VBMA 5CURA 1UK7A 2VZ9A 3GCWA 1G21A 2IYZA 3M5CA 3OX3A 4LZAA 4RHUA 3H5WA 4YRKA 3EXHC 4YQYA 3EAQA 3BHIA 3WY9A 2H63A 3G1UA 2QTVB 1BE0A 2DKFA 3FCEA 2GM9A 3FTNA 4L3WA 4OQYA 5C0OE 4WZEA 1PDWA 2WUWE 1SHZA 2ZVDA 3DYBA 3UT0A 2FI1A 4CIXA 3PUNA 4Z53A 3P2OA 6GPBA 4MVJH 1O94A 2O5CA 5ENZA 1GQFA 1EQUA 2FRDC 2HEGA 3BDIA 5D5HA 2B98A 3GLQA 3OKCA 5EQFA 1OLUB 2JZNA 3ROZA 1ETHA 2ZK7A 4G65A 5LL6P 4I46A 4UU0A 4YGYA 2IJGX 1DMSA 1ZQ1A 1JDVA 1O58A 5EIBD 1OYOA 2CL0X 2ORWA 3IOYA 3OJLA 5KB3A 3V2GA 3FJOA 4NTZA 1KEWA 1XELA 5DGTA 2DPXA 1RPNA 1I5RA 1R8XA 1XZAA 2WKRA 3TAHA 2CEAA 2CE7A 3PDHA 1IHXA 5CVVA 1YIDA 3DJYA 3OQBA 3R6LA 4KQGA 1ZGAA 1ZL2A 2HXYA 3NRJA 5IYZF 2J0UA 4BB0A 3QNWA 3HS3A 1WRBA 4FN4A 1JEJA 3MTEA 5C5DA 3S2YA 1CG6A 3DL0A 4E70A 3DLTA 1RLMA 2NZ8A 4F5ZA 3I6IA 1XE1A 4DCNA 4OI4A 2PLWA 3FPGA 4E07A 3H5IA 4CIDA 3QSGA 2YCBA 2EEPA 4RHTA 3VJMA 4LSMA 5C18A 1EM8A 3TWOA 5J47A 5K8LA 3BRWD 3A27A 4BO9A 4ZKEA 1Z2OX 1YQXA 3FDZA 4G09A 1BE1A 2GCGA 4WCVA 4JB2A 2GYVA 5AKEA 2O9JA 4RIFA 4DQUA 3QEMB 3HO8A 1JG4A 2BMAA 3GJ6A 4EKEA 1WCV1 3DHVA 2O3QA 3KVYA 5HMLA 2G4LA 3DBHB 1FRZA 2G7ZA 1G5TA 4NFHA 2CVFA 2C5SA 1DG3A 3ECCA 3LWDA 4BMCA 3UT5B 4DA0A 2X3YA 2I76A 2Q41A 1KO1A 3OKAA 1UZUA 3Q2KA 4HYYA 3BERA 5JPDA 5GJBA 4QNRA 4GL2A 3PCXA 1GRQA 2LW7A 4UNIA 1QTIA 1SCUB 2JJ1A 1CDDA 3C6MA 4FDVA 4NG5A 5AI6A 5DWQA 1I3NA 3STYA 2XZLA 1A82A 3RR2A 5JS1A 1FRFS 2C7PA 4RLQA 5FA5A 5FQOA 1H6DA 1FRQA 3HADA 2JDIA 2HO4A 2HHAA 3ENWA 2CBZA 4UTPA 1N05A 3AP3A 3IS3A 4J43A 1EFPB 4O4HB 2A0KA 4F5DA 3RU7A 2IBTA 1Q17A 4BNIA 1GZDA 3WA7A 4XKWA 1BX1A 4Q93A 4MP6A 5JBNA 2XZOA 2J9FA 3QWFA 3QXSA 4ZK2A 4UUAA 1RQNA 3MB5A 4G1UC 2PV7A 4O4JA 1E1CB 3INTA 1X2EA 4C29A 2R1VB 1RLUA 3CR7A 2EX0A 4LISA 1Z2AA 4CL3A 1WW3A 1M1YB 4JXJA 1FZTA 1AVTA 4HLDA 1CX9B 1U2DC 1EVLA 1JBEA 1UBJS 2DP4E 3ESXA 4DIBA 3HZOA 1GNRA 2BRUA 4DLNA 3TX2A 5JYCA 4G23A 4WWHA 4Y30A 5DMXA 2PUDA 3QXJA 5EVCA 4WVFA 4AG3A 3L93A 5JAUA 4JA2A 5CFNA 2R7AA 4LV8B 2A78A 2EL7A 5DT2A 5JJLA 1TYEB 3HWSA 3K70C 5P8WA 3K9CA 4CN8A 4WY5A 4PZZA 5AXCA 3D6HA 1QSGA 1J25A 1WMEA 1ZL0A 4MV1A 4QM6A 3CINA 2R47A 3CX6A 4W4TA 3RFVA 4RZHA 1S72B 4RDLA 1ESCA 3BKXA 1YMQA 2CZQA 4CMIA 4JC4A 2Z58A 1MPXA 3FXAA 3N0XA 1M5TA 2KJQA 4LUCA 5E9QA 1SBTA 2HU8A 1RLTA 4K9NA 4LHSA 3RRYA 1Z35A 4XCVA 1VPDA 2WJWA 1KGSA 2PRYA 3PF8A 4KGVA 5KKAA 6NULA 1V7QA 3P2YA 3ZVRA 4D0NA 4K2AA 4CHGA 2AQKA 3IVXA 1BNCA 4NEHB 1V11A 2LCFA 2EEZA 2VVTA 3IVCA 1AQYA 3Q0EA 3LLCA 13PKA 3LQ6A 1W75A 4UW9A 1RCUA 4QFDA 3B7GA 4NR0A 1X8JA 1N2JA 2WHPA 1TOAA 4GX2A 2QWXA 5F51A 2B94A 5CT6A 2A6PA 2V3WA 5DHFA 3MGBA 2QQFA 3WI7A 2IZ0A 4I5EA 4TXNA 3NXKA 4YIKA 3SQOA 1ABBA 3JYNA 3O3CA 2OO3A 1E9EA 1WORA 4JZKA 1TK9A 3QFSA 5SZIA 2C4HA 5ALKA 4KE6A 5A1JA 2OCYC 2OKGA 3B3JA 3LKZA 3OE7A 4EHJA 4C7OA 4FC7A 1EXDA 2HB6A 2NPOA 4E14A 3MIZA 4AL4A 3C6QA 1R15A 4I6GA 4L9WA 3DE3X 3N87A 1DAOA 1BS1A 2YXLA 2FSVA 3L2OB 3KO8A 4ABTA 1FTGA 4IHQA 3TRDA 1K6XA 5GY7A 1X7GA 2IDKA 4R84A 2E1RA 3CA8A 3N0TA 3RM3A 3TLKA 5KNBD 3KUDA 4FGJA 4JI0B 1W5FA 1AK1A 1XDWA 4GKKB 4X1KA 4OQPA 2YXDA 3I2YX 4E30A 1TQHA 1I10A 4PG5A 2C58A 5IP5A 1LLUA 1DRWA 3VAYA 1LPBB 2M6RA 5IEBA 5LB4A 4Y6RA 1E9AA 1EX9A 3RW9A 4CL8A 3CLUC 4X1IA 4CJXA 3UHJA 2JBAA 2ZB7A 4WNCA 1M2VA 3U9SA 1N8SA 1N6HA 1TAQA 5FPTA 3RV4A 1PG5A 3OURA 3HHEA 5EXTA 2FPLA 4TKVA 5KJ1A 5T4EA 8OHMA 4BNLA 2J08A 3AOEA 3IESA 2Z8YM 5HIKA 2WYVA 2ZP1A 2R1TA 5C52B 3PNMA 2O59A 3SHTA 5ARBA 5K3FB 3HB4X 3A8IA 5JD6A 3VHXB 2F1OA 1A5SB 3RYIA 3FSJX 4RWZA 3ROXA 4YRIA 3ZZMA 4BUZA 2REQA 4GXRA 3LPCA 4GYYA 3NOQA 1NLMA 4UUPA 3WYDA 4DG9A 5AOVA 5M5BA 3IAAA 4MWSA 1NMEA 3AMVA 3AEKB 5HFJA 3HUTA 1E64A 1AQUA 1IQ0A 4NG4A 4P81A 4RHYA 3M3PA 2CLSA 2PQ2A 3ES9A 1LUAA 3UV3A 3O3NB 4QVAA 5F2EA 4AXXA 4LE1A 2HLDA 1X1RA 3A9SA 2KPOA 5BURA 3KT8A 3DFUA 1J2JA 1N2OA 2AN4A 3O8OA 5EAIA 5LQJA 3E35A 2ZXHA 1XTSA 2XTMA 4X7EA 1Q95A 4WCFB 3ACDA 1ZCAA 4FLEA 1G9SA 3QFTA 3U2QA 2D8AA 3KLMX 4JR1A 2RH9B 4NPAA 1R50A 3U4AA 4G89A 3K71B 4J1TA 3UMRA 3UBTA 5HJ5A 2HPHA 4ND5A 2YFQA 4CKCB 3DMTC 3F8SA 2WZDA 3I0NA 2MJLA 3L4KA 1Z7BA 4F5WA 4ZYYA 3OPOA 1H69A 3D8BA 1R4NB 1OXSC 2J5QA 2P1RA 3NIWA 5FPSA 3HCAA 2OXTA 4ZJZA 2WMOB 1A5BB 3L8YA 4J1QA 2BEKA 3HCBA 2CC2A 5L3SB 2IYOA 2AEEA 2AMVA 3ELUA 1Z7EA 3RTGA 5IM4F 3OWOA 4P0PB 3L8MA 3OIGA 4GX5A 1E1DA 4OV6B 4C30A 1AKVA 1XEXA 4OOVA 4KCGA 1UD8A 3B1FA 4MO2A 1SHTX 4YLGA 3W04A 4EHAA 1EFPA 4O4HA 2OHIA 2MR5A 2ZQ5A 4LRSB 1KP2A 1PRYA 3S7ZA 2XRYA 3LKBA 3TCNA 2DQSA 1GGJA 2OL4A 2IYLD 4HLUA 5T7BA 1G7SA 4KKTA 1JKJB 3SD7A 1XNGA 1E7RA 1ZD8A 3FPPA 1ZJJA 1XEFA 2XAUA 3EZYA 3Q2OA 1E9BA 2HTFA 1D6NA 3BREA 3EVTA 1ZZEA 3NT5A 1KKMA 3L07A 3QUSA 1I6KA 1Z16A 2Q0SA 1F3OA 3QU2A 1KAGA 2JIMA 3DR3A 5EJ2A 3RYIB 4AKEA 3H5RA 4CV1A 3EPLA 1EP2B 2MT9A 1M1YA 3NVAA 4QJ5A 2AXQA 5BR7A 3JPWA 2ZYRA 3PR1A 2NV0A 2G1PA 2NLOA 4QUEA 1IQPA 3ITNA 5KX5B 3DMYA 2CHUA 5ITWA 4KREA 3J7TA 5G0UA 1ODIA 2DWPA 3SQWA 3TRHA 4BCBA 4AY4A 1D4FA 3ZI4A 4G8CA 1JSXA 3MT9A 1R7RA 5BOVA 3K2IA 3RLIA 4Z4EA 2FFHA 4YV1A 1R8SA 4RKFA 3SSNA 2AX3A 3EQ6A 4YMLA 1GUAA 1QM5A 1S2OA 2VF7A 3L9WA 1U2TA 2DF8A 3C4JA 3ZV3A 4N49A 4NKRA 4AMZA 3GO4A 5E3IA 4E5VA 3F6YA 4BE9A 4L9RA 4YMWA 4YDRA 5A04A 2QB5A 3BT7A 1ZHHA 1NBHA 2P2DA 4BRUA 4F85A 3BWMA 2F43A 1JQJC 1QZTA 1RRVA 1QF9A 4U39A 1TW2A 3U7JA 4O4IF 1YF3A 2F8TA 1N0UA 4OJKA 5JCPA 1P61B 3OX4A 4H4CA 4JH0A 3PE6A 4FBLA 1YJ5A 5A0VA 5FF9A 2FRXA 2I3ZA 1DU4A 2QTGA 1QIJA 3CC4B 4Q9HA 5DEIA 3QENA 5DTRA 2O8EB 3B3QA 3CONA 1DUIA 5SY9A 2V96A 1MAAA 1E7YA 4A8HA 4FEYA 3U80A 1VQPB 4ENVA 4YCSA 5AVXA 2H4HA 2XCTB 5DNCA 2LXNA 1BEUB 1FYWA 1Y4DE 1MF7A 4XDYA 3WMRA 4TX1A 2XEDA 3CH5A 1A95A 2CB0A 3GAZA 4YI5A 4BLWA 2FDRA 3EIXA 3EBOA 3DZDA 3NWEA 4JSRA 3AVOA 3P19A 3K1YA 3A6KA 4UDYX 4CGYA 3F0TA 2ZLBA 3AFNA 5F7JA 2EQBA 3UN1A 4R9RA 3N2GA 5C35A 4LTNA 5KNDH 3CESA 3A9RA 1F1JA 1W9MA 2WKSA 2LWIA 2ZIWB 5IKPA 4ED9A 2Q7DA 5EE9A 1JXMA 1R16A 4MJLA 3SZ3A 1L4UA 4PZCA 3P0JA 4US0R 3WADA 1GZ5A 1Y42X 3LRXA 4EY4A 3WR5A 2Z6AA 3OZFA 1OPXA 2HFKA 1H4TA 3DM9B 3JW8A 2ZI7A 5CITA 1E60A 1HDXA 5KQMA 3LXXA 5F2KA 1ZNZA 1SRQA 3RRFA 1B14A 3OOYA 3H2YA 2FR0A 3C2QA 1VC2A 5AM2A 4A8PA 3T7AA 2DHCA 1L5VA 1QZ3A 3C3BA 3G1TA 4Z7QB 3Q7IA 1Q91A 1EJ2A 2OCPA 3JQEA 1Q21A 3EMKA 3HYSA 2AFIB 1OFHA 2FMXA 3U1BA 1W19A 4GU5A 2R6DA 3FRHA 1V35A 2YIMA 3HSYA 5FO1A 4IDPA 4M76B 2XBUA 2HCFA 4NBKA 4Z9FA 3GARA 5DI3A 3AT1A 3N1UA 3A28A 3WK5A 5JCJD 4ESOA 4D43A 4A1OA 3A1SA 1Q3KA 4I4LA 5HR5A 1V6SA 4J8PA 3KWLA 1YBHA 2BKEA 3L0IB 4XOUA 5DHAA 3EG9A 5M3BA 4GZ3A 3M4ZA 3O31A 4W9RA 2P7HA 4LZZA 4D97A 3CBGA 2V7WA 2G09A 3KPYA 1FX1A 2PS0A 3SHWA 2BE9A 4D79A 5U1PA 2OOKA 2EXXA 2OCKA 1JKFA 2QENA 2VQSA 3BYZA 4ZALA 1Z5NA 3FPJA 3SFVA 4X95A 1OLXA 2GAAA 1N3IA 2PWYA 4B7ZA 1IBCA 3EYWA 1PR0A 3J80A 4ENPA 2O2JA 2W6PA 3QKSA 5DM4A 3DPIA 3SK0A 4CKZA 3K96A 1QV6A 3AJ9A 1SD2A 1XWWA 2V4UA 4RHXA 1G8SA 2HTEA 2YXEA 3MG9A 2VTBB 3OSUA 4RIIA 4DMGA 4DWOA 4LNUB 1I2DA 2AJ8A 1NBWB 2R84A 2AXPA 3L0ZA 4D44A 4G0WA 1TF2A 5T57A 5U9CA 1TVKA 2QD2A 1BVUA 3I56B 1KY3A 3FWZA 2FR1A 2A1TR 3TLJA 3ZWYA 5CBPA 6PFKA 2B5OA 2QMUA 2HBQA 4GD3Q 3OZRA 2JLCA 2F9LA 4OYLA 5AMXA 3VNRA 2QW0X 3PI7A 2CNLA 4C3ZA 4KIFA 3FMFA 2FWJA 4X7BA 4HOYA 2IK8A 1Z17A 3IR6A 4JVSB 5F77A 2O4CA 4ERNA 3Q7SA 2W6IA 1YE8A 1T8RA 1JTFA 5CB4B 4L78A 3A3OA 5AHOA 4LXQA 1AUVA 4P84A 1ZXBA 5FWXB 4ZI3A 5ALUA 4D4MA 2PIDA 3OO0A 1XDDA 3SEJA 4NAVA 1UMDA 3ZJ5A 1RKQA 4D3XA 1PEKE 3A0UA 3BZWA 4MQEB 4FHFA 1DB3A 5D85A 4HN2A 2Q1TA 2QS9A 1CJBA 1WZUA 5KQGA 5BW8A 4FT4A 2P79A 3Q88A 5BMVB 1GAWA 1X92A 2EFJA 3HZZA 2CF5A 4DK1A 4CTNA 3GRRA 3CD6B 2Q4OA 1SIBE 3TM5A 1HNWB 4EF6A 2QN9A 2ET6A 2C4TA 2O2YA 2VHYA 3GJ4A 4MCHA 3TG2A 5H80A 3H4IA 2G40A 3M4NA 4LGMA 2G9NA 3WLNA 3IJPA 2OD9A 4R16A 1MOZA 1EA5A 2C5BA 1JGTA 1P7VA 1ORVA 1UBOS 3OZBA 1WZEA 4IWXA 5CXUA 2RB5A 3PJEA 3M5WA 4JROA 1SKYB 4CQLA 2GXQA 1Q7CA 3DHNA 4HNHA 4Q47A 4BP1A 2O6LA 4PX2A 4LY3A 4UEWA 5DISB 3RYFA 2FWIA 1WDKA 1W0KD 1PJ3A 3DDOA 4EKGA 5A3QA 2VPQA 1JFTA 2Y67A 4KJXA 2IHJA 4LOIA 3V8RA 3EXEA 3T5GA 4M7RA 4PSVA 3RYTC 1PL0A 1TADA 2HX1A 3SDBA 4BJ6A 1GPBA 1YBAA 2WD9A 3GPLA 4YRAA 1IWPB 5FBKA 4PC3A 1D8TA 4JI5B 2NZVG 1P4AA 1I36A 2A1IA 1WXIA 3IIKA 4CU5A 1STOA 1YZLA 3IO5A 5DK6A 4CW7A 1VJTA 1WCYA 3OJEA 2I1LA 2VJBA 4IICA 5AJXA 5F73A 4WBNF 5A7FA 5I7HA 1TEHA 1HZZA 2DSNA 1X2BA 4YAFA 2OD7A 1B8NA 1S8OA 2BR3A 3ZYZA 1T6NA 3MC1A 2AJLI 3AVYA 2XB2A 5J40A 5D3MB 3ZIAA 5LC1A 5A4KA 1X1TA 3TBHA 1IWOA 5HRUA 5FBWB 4NL4H 5ERYA 4IDNA 4F4DA 3OA2A 2PKEA 1MGOA 2JJ8A 3L7KA 4WNAA 2XNHA 5IBCA 1IUPA 3MUNA 4WKGA 2OXCA 2A2ZA 3IUPA 1H94A 1U3VA 3UG7A 5IN4A 3EA5A 4M1EA 1VPWA 1WKVA 1B26A 1TUGA 3H65A 1M6EX 1A7AA 2EDCA 2LIPA 3AFMA 1ABFA 3HJCA 3WNZA 2IYRA 4OLHA 4MGKR 4REQA 1E5DA 2ID9A 2ZSKA 4P3KA 1H2YA 4B4VA 3OFSA 1Q1QA 4MP3A 3MWDB 1XCLA 4YRCA 2VL7A 2VSNA 4AO8A 5C7LO 3G17A 4YRDA 3MJHA 1CHDA 1SUCA 2BFEB 4G67A 5CTAA 4MQFA 3TFWA 1T35A 1NQTA 2J09A 3PYXA 2PAFA 2WIJA 4WK2B 4MYSA 5E1MA 1WPGA 2NSYA 2IX9A 1XDSA 3DEZA 4YDQA 1RWKA 4R5HA 3VSDA 3Q6IA 4XOPA 1LU9A 5JH7F 3TZQA 5KS2A 1AKTA 4IFIA 5LD2C 1ML3A 3BCRA 1SIOA 5IXSA 5BR8B 3ZLVA 7YASA 2B7LA 3LDUA 4P4SA 3RVKA 3W5AA 1GPUA 1KO8A 4RA9A 3IRVA 4EG8A 2PX3A 3TQOA 1YVUA 1WMAA 1TF7A 3ASVA 1IG3A 1MNAA 3H11B 1NL3A 3WBJA 5H16A 2UZ1A 1PUXA 3CW9A 3H9BA 2QD1A 1CR4A 4QTXA 1OY1A 4JDPA 5E6SB 3W3AH 5I9NA 1UDAA 3DZCA 3N3BC 4DJ5X 1J9ZA 3KSDO 4ER3A 1Y5IA 4TUYB 3M7IA 3SS9X 4CQMA 4DV7B 5TPZA 4FUTA 3E9YA 4QHSA 4OJYA 1N7GA 2PT6A 3D31A 1ADGA 3D8SA 3LECA 3EVFA 3F2IA 1FNNA 3SC4A 3DBHA 5KCMA 5H7XA 2EJUA 3JZDA 1YZYA 4GH5A 1WLYA 4IIJA 1U8AA 3N74A 3DV9A 4PIMA 2X7XA 4IMPA 3U49A 1UWCA 2GN1A 4E94A 3GQVA 4FFNA 3O3MB 4OKSA 1SVWA 1X13A 3FDZB 4EAQA 2H48A 3OUZA 2TYSB 3BSWA 5B3JA 1VL5A 4Y9RA 1COZA 1COWD 1G66A 2GN4A 2WIDA 4ZXPA 5HQTA 4KNVA 4FCWA 5AM4A 4ZAVA 1IHYA 2JW5A 3N2YA 4WASA 3PVCA 1B2RA 1SIUA 4RXTA 1JH8A 2ZPUA 2IDZA 1WSBA 1II8A 2JGDA 2OZPA 2Y0CA 1KOLA 2P0YA 5IT9A 2PZAA 5C8YA 5HMMA 2WA1A 3GGJA 3IQXA 4XX1A 5EKTA 4B87A 2G6BA 3TL3A 4MVJP 4WY8A 1NP6A 4G4SO 4H0FA 4HGOA 5FADA 3M1AA 4GT1A 3OY2A 4Z0TA 1DWPA 1YUMA 3T34A 3IEPA 5G40A 5G0SA 4YUWA 5IF3A 2AOWA 5I9MA 1FW8A 4DA8A 5A5VA 2X0RA 4K03A 3TFOA 2O8EA 1BXRA 3ZCRA 5LZ7A 3C6YA 3GJ5A 5F9FA 5EJMA 3ZIDA 4YROA 4IINA 1BKSB 3TXXA 2I9KA 3D5QA 3F3SA 3N8IA 4C43A 2C83A 2FG5A 1MC4A 4ZOQI 5KYGA 2J6HA 1JHUA 1F4LA 3SKBA 1OFIA 1P2DA 1RXEA 3F9RA 4U8HA 2WZNA 2IT1A 3E4DA 3H17A 4Y0NA 3X1WA 2FUEA 1AHHA 1WW2A 4HH3C 1A1SA 2FOLA 3ED1A 4Q66C 4LJLA 2IYVA 2W6MA 2XIJA 4JP3A 3RH0A 1GARA 2A59A 1T5BA 1T8YA 2GD6A 3E3OA 1DC3A 1V95A 3QBVA 5BUQA 4W9NA 5HJ7A 4ROSA 3TOXA 4LG1A 5KTTA 1KEEA 3DBLA 2JH8A 3CGGA 2ZSFA 1B15A 1R6TA 1UOQA 3QBTA 1FYXA 5B1HA 2W8ZA 3MA0A 4Z7NB 4IEIA 2DHQA 1CJSA 1O6ZA 2Q6OA 1ISPA 3LC2O 1YQUA 2YVQA 4DMHA 5JLJA 5DTEA 4FLFA 3R77A 4EB8A 1U9YA 3JARB 4A36A 1C7FA 3L49A 1K68A 1PLJA 1FRVA 3OF2A 1UZLA 1ISFA 2PLFA 1N2CE 1P7ZA 2W90A 4CKXA 1N0VC 3CUUA 1GFWA 3G49A 2Z0MA 1S3FA 3HFSA 1E6UA 1EHYA 4N5IX 1U2PA 2PFSA 3VTZA 1Z5UA 1O6BA 3V34A 2ZFUA 5E4FA 5BOSA 2JK0A 5KSOA 2FLKA 2AZXA 4L4UA 2A9VA 2K6GA 4GUAA 1JDUA 5E0OA 4NZ9A 5KU7A 2UV8A 4U8GA 2D2IA 4BNDB 4N3GA 1FYVA 1FU7A 4DPLA 4FDTA 3ZDDA 5EJFA 3UMJA 1W85A 1E3ZA 1IY1A 1PIWA 4KVFA 1TM5E 1PX2A 2ZU6A 1XZEA 2AOXA 2XZDA 2C5EA 2XAAA 4CT0A 2WM3A 1DZ3A 2IPLA 5E1BA 3PDUA 1GQ2A 4DTCA 2FOIA 4L27A 1EAYA 4MGIR 4E2YA 1FOEB 3U17A 2WFLA 3HACA 1ZMTA 4ZAXA 3T1QA 5E0KB 3ZQ4A 2DQKA 1G5IA 2QQ5A 4EL5A 2YJTD 4YQFA 1P3Y1 3OQPA 3ZLJA 1B1AA 3GF4A 3LOQA 3VGJA 4OQFA 2QX6A 3IJEB 1VYHA 3L6DA 3QMVA 4FFDA 5L8VA 3LD9A 5AM0A 2V9ZA 4F60A 4AW9A 4IIVA 4BWYA 4EI7A 4WFKA 2YWFA 2YHBA 5EPUA 1SCNE 5BRAA 5C8XA 2JIDA 4DWJA 1TEZA 5IYQA 2CUZA 2HLDD 4GM0A 1X7ZA 3VH4A 1SKBA 5LXTF 3WIBA 2YW9A 4LDJA 1I1QB 4OO3A 3L1UA 3IMKA 3VHXA 3WL5A 3PVZA 2Z2KA 4XARA 3QNUA 1EFRD 4NZYA 4ZDKA 1WDMA 3R3JA 5F9MA 4G1CA 4P8RA 5FJIA 4ZI7F 3KSRA 1X74A 3QMMA 4X85A 2ZUCA 1EVQA 3AI2A 5H5JA 3WNDA 5AVWA 3B52X 3JQ9C 5EIHA 3LBFA 2QVBA 3G6EB 3V8NA 1MGPA 3AEXA 3FR7A 3LCJA 3TRIA 2IGBA 1OYYA 3EEIA 2WQ7A 4HAYA 1C7EA 2WAXA 2VPYA 2HDWA 2WRZA 1XJWA 2UYYA 3DVSX 2I3GA 4CG3A 2Z98A 3U4QB 2EBFX 3IPCA 1MNQA 3C5VA 3FZNA 3H0EA 4KLAA 4QICA 2IL1A 4URZR 3V1KA 1PV2A 5E7MA 4BVFA 2FMIA 1KHHA 3KJQA 3NRBA 3V4SA 2YRFA 3X1YA 2GK6A 5FHRA 1E2KA 4URYR 1SU8A 3ZDBA 5HXAA 2NU8A 1QIMA 1QIDA 4WZ6A 4TVKA 5TY0A 4QPPA 5FI5A 3HXMA 2PUFA 4H0CA 4QOSA 5IAAA 3GGDA 2HLHA 4XWWA 1W7AA 3R20A 4ZO4A 1IBLB 1E2DA 2O07A 2OV3A 3I9V6 1YHNA 4L4RA 4P7KA 1BHJA 3OOCA 1VSTA 3E53A 1RHJA 3KKNA 3LT5A 2CFIA 2N3ZA 3NWPA 3SC2B 2CL5A 2DT8A 1KI4A 3KE9A 3QLVC 2EP5A 3WRYC 3WLSA 4BMYA 1M75A 1XHFA 2V54A 1M0SA 2FN8A 4EPWA 3EVCA 3REOA 1B0AA 1LDGA 2F9FA 2XLBA 4C5CA 3U7GA 4A2WA 1QGUA 2JIPA 3F47A 4J76A 1NUPA 1N1GA 5F52A 2R4TA 3LA8A 3P0RA 4S1WA 2PVCA 1DFIA 1K7XB 3D3WB 4TYNA 3D6JA 1U0NA 4AZ3A 1XD9A 4FGKA 1F38A 4QT0A 3FUWA 2IS6A 4QGFA 2GREA 5BY2A 1KFKB 5DYGA 5AM1A 4HMPA 3LAWA 4ZRNA 3TTYA 1OB0A 4ZCMA 1DIBA 1ZCBA 4ERXA 1E6KA 1LRJA 4C6SA 2DWUA 3BTSA 3EAFA 2YWHA 3M4XA 4JITA 4P2GA 4UQLA 3F74A 1LDMA 1LKZA 4RE6A 5K03A 2H54A 1N2BA 2XYQA 5ALQA 4XM1A 1W9XA 4Q4HA 1HTTA 5K20A 2QX8A 5D8DA 2G71A 1QVZA 2E4WA 2XKJE 3H83A 4QJBA 3CPHA 1VHOA 1OASA 2XE7A 3F8TA 4R3UC 2NADA 3AQ4A 5B37A 4HRVA 2CT8A 4MMZB 5CH8A 5JYEA 3B1WA 4LNUA 2OP0A 1T3LA 1V11B 4R7GA 4IQ8A 3ZGVA 3O0TA 4ZJYA 1ORTA 3DCIA 4HY3A 3CLSD 3VR5A 5GZ1A 1A7JA 1UBHS 4FHZA 3V4PB 3HVKA 4JEMA 1THTA 1LDEA 4IPTA 1VP3A 1NQOA 2SKDA 3UM9A 2PKXA 1G18A 1BA3A 2ZT5A 2JI4A 2OCAA 3D6MA 2OQIA 2UXCB 2HK6A 4FGZA 4OVKA 1C30A 5E1DA 5EUBA 1BH6A 2UYHA 4UTZA 1FFDA 4OJTA 1WHTA 3ABOB 3BEDA 1JE1A 3ISVA 5AJVB 2OBLA 5HKKD 1FVHA 1AGRA 1X7XA 2AJDA 3ODPA 2VP9A 5DE3A 5JS8A 1JTVA 2VP4A 3PNYA 4QGGA 4U0JA 1SY7A 1G8FA 4RJKA 3ANTA 4Z4GA 1M5UA 1WP9A 1RYDA 2PG3A 5A3VA 1PTJC 1JEYB 2X9QA 2X8JB 4B43A 2Y2VA 3P4YA 3C87A 5KHAA 1Y81A 5KI6A 3KCQA 4PTYA 4EYOA 3H3JA 4H08A 1XRPA 2YBEA 2FVGA 1Y7IA 2JGJA 2FETA 2R48A 1KJ8A 3FOZA 2FAXA 4OU5A 5JSQA 2QKYA 4B6EA 4CNQA 2YIDA 4K6OA 4R81A 1Z8HA 1RBYA 3GFTA 2YXNA 1WF3A 2BFDA 1QH1B 3GD5A 4Q5IA 4HFMA 4W5TA 2FW1A 4YEJA 3GL9A 4U4AA 4TWJA 4ZAYA 3URMA 1NVDA 3KLPX 4AAYA 1JN0A 3D26A 1GQSA 3ONYA 3BBLA 1NF9A 2OLKA 2GPTA 2H18A 2WWRA 1KJJA 3AHHA 4NMLA 3VZCA 3EB9A 4KWEA 4LXUA 1GG8A 4RXMA 4GC9A 1TUBB 5BYJA 3IAEA 2OWDA 3W8DA 4GOJA 2FWNA 3KJFA 5DIFA 1K9VF 3LXMA 1HT3A 2H1CA 1GSIA 3FROA 3OETA 4MEAA 4PEVA 3ZGLA 1U2GA 4B71A 1R66A 4MYDA 1VB5A 1AB6A 2YOFA 3T3MB 4EL0A 2FP4B 4D41A 3GJ7A 2PPLA 4PG4A 1KDYA 3EEYA 4HQ6A 2GDZA 4BNDA 3ER6A 3PUZA 5DXJA 5BVHB 5DHPA 1VOTA 1YZKA 2J3MA 3AR3A 1ADBA 4YP6A 4EY7A 1YUBA 4MCJA 4R8KA 3R09A 4EUFA 1VJGA 2IHVA 3RAGA 1X80A 3DBVO 3W8NA 3QEOA 1IZ0A 3BXOA 3D2LA 4FC6A 5HZGA 1QAMA 2C61A 3KZKA 5CMLA 2ZJ0A 2D7DA 1EDEA 3T99A 1O9HA 2DFDA 4BE7B 5DW0A 5IDYA 3SJUA 1LPSA 2IP1A 1PCXA 1KI6A 1ILWA 1BLIA 1S5PA 1Q0HA 4KR2A 4YVFA 1L5RA 1PGPA 1XLTA 1G5FA 4MKHA 1ZHFA 3R2JA 4EGAA 5FEUA 1IZ8A 3K0SA 1DCTA 1IG0A 2F8SA 1WO8A 4ALJA 4YJFA 3N7TA 4CMKA 4KI0A 1FB5A 1BXGA 5IZCC 4OBWA 1R3DA 1V47A 3BIXA 5AI0A 1RMTA 1X77A 2YWXA 4U9HS 4PZDA 4C7KA 2PUCA 1ZLYA 3QWAA 1RJWA 4BBAA 4LJRA 2F9MA 3EIEA 4KK4A 2RK6A 5JFTA 4YMTA 1H8HD 1Y1PA 2QPOA 2J07A 3OPXA 1XWIA 3HEBA 3UK7A 1M1YE 3G8CA 3R8FA 1OA1A 2IITA 3MWKA 4Q1VA 3EWIA 4R40A 3ZNQA 4KXXA 1CF2O 5CD9A 1XZKA 1RQXA 2FSFA 4UTNA 1ZGZA 4O1MA 4ZU1X 1QUFA 2Y6VA 3H97A 3AEZA 3KBOA 4TV8F 3LT1A 2EOAA 4Q1AA 3T3OA 1Q3HA 4I4NA 1J0CA 2O5VA 4G2TA 3IB3A 3O7WA 4XQCA 4E6PA 3AJRA 3DV0B 1Z06A 3AKEA 4Q3DA 3GLGE 3W2EA 3D8TA 4QGHA 4AJKA 3FY4A 1XX6A 4KR0A 2VWPA 2XUDA 1RT9A 1GU0A 2ZRCA 1NPDA 1ZIXA 3I53A 3EXG1 1UKYA 1I32A 1A2QA 3N2KB 3OCJA 3VI3B 2PUBA 3I28A 3ND5A 3GRCA 3PTAA 2X0NA 1T4MA 1WD5A 4IGAA 5F21A 1XXHE 5GZ3A 3EW9A 4ZQGA 2X41A 5ILOA 4RZ2A 1YULA 4LV6A 1OD6A 1EXNA 4RVOA 2H4YA 5LXTB 2FZEA 2JK1A 2V31A 4IXMA 1TW3A 4BATA 3E9RA 3K70D 3ZWVA 3OCXA 6LDHA 1L5WA 3IBTA 1XJQA 5KOHB 3L0CA 3E81A 4QRHA 1FNCA 2ZU0C 2W2VA 1E7WA 4QVGA 3HRKA 4PPNA 2J3HA 2GXUA 4N1AA 1OI7A 1Z0AA 4KR3A 5DHRA 4ICIA 2D13A 1NUUA 2GBLA 4JYZA 1E2LA 2A94A 2I4RA 3EEQA 2HA2A 2DB3A 4NAHA 3Q0IA 5I8PA 1D1QA 1VQ1A 1Z34A 4BCDA 4PGGA 1XAJA 4QYTA 4L07A 1QDUA 5CHYA 3ILXA 4PSDA 2AEMA 2VH5R 4PHTA 5B1DA 2DFTA 2GERA 3A3NA 1XAGA 3KQPA 1CRLA 4JBYA 4WCDA 2C88A 2AGVA 1GFSA 3EC7A 1JPUA 3KOZA 1LQ2A 4YJ3A 5F5LA 3CH4B 3H11A 4J90A 4R9NA 1MXFA 3OU6A 4TYQA 4OP3A 3TD9A 5JANA 3AHGA 3JD4A 1U3GA 4PBRA 1NTRA 3PHIA 2ORED 4LVOA 3SF8B 4UEQA 3TS1A 1NIPA 1GGEA 3BK2A 1I4WA 2XB6A 3WIEA 2AE2A 1HL3A 1UBNA 4TXHA 1W2BB 4XYGA 4PN3A 4AMUA 3Q38A 2C3UA 1K3UB 4YJ2A 3K3PA 1RBZA 4JVNA 3BGDA 4XOIA 2VWQA 3GG2A 3GROA 3NX4A 1ISIA 4LHZA 2GVDC 1M7GA 2H65A 3FVQA 1A9PA 3HKBA 4ILKA 4G5OA 4KRGA 3C7KA 3P2MA 3QVOA 1EFAA 2FMTA 1QOZA 3O92A 4KOAA 1ND5A 3EH1A 4ZO7A 1OUMA 1ORHA 3A4MA 4JYAB 3QGMA 2QRNA 3GLFE 5G3YA 1P9NA 3KYBA 3FLAA 1PEYA 1I9CA 1RVDA 3GD7A 2YOHA 4JJEA 3BRWA 3A05A 2Q3MA 1DCMA 3RAJA 2JHFA 2ZXEA 4N9QA 1O95D 3KTOA 1H8HA 1JFRA 1SFRA 2GD2A 2O3JA 2G08A 3GGCA 4M36A 4MR8A 2QTFA 3SZUA 3ZNPA 4KN9S 2ZT6A 4JL6A 2JLAA 4M46A 1YUNA 2ZYHA 5E4TA 1L6IA 2VUHB 3QEJA 4KG7A 4LXXA 4R68A 2GWRA 2NZJA 3AERB 5JI2E 4ZO6A 4P7JA 1YX2A 2FPIB 3PCRB 4I1SA 2IYEA 1BGWA 2DEUA 5EMJA 4LPKA 2X5NA 2VDMB 1JECA 2ZPTX 3Q2IA 4N3CA 3SFZA 2WPDA 2ZATA 2XRFA 1PWYE 3RVMA 2Y0DA 4NFSA 3C7AA 3QPBA 1I2CA 2GASA 2PS3A 5CXSA 5BN3B 4I36A 1ZVVA 4J91A 4N9WA 621PA 2R0QC 2JAQA 4KV7A 4HN9A 3AZQA 3N2EA 3BAFA 1BWQA 1XVTA 1CY4A 1UBLS 1FX0B 2J30A 4H7HA 3COWA 1U1CA 1MOSA 2MMCA 2QLMA 5FWNA 1L3CA 1MN6A 3GV0A 5ICCA 3HA7A 1VDZA 2VCHA 3LLSA 4DY4A 4V1CB 1J1IA 2VCYA 1O96B 4YAGA 2H1OA 2TRSB 2HWUA 4I14A 4LHEA 5BPFA 1C1XA 1A98A 2HJ9A 1RKXA 1NYQA 1KZ9A 1SU6A 1WNFA 2TS1A 3SBEA 1X15A 4J0EA 3EDYA 4AO7A 4DN6A 5BWOA 5CFOA 4I1IA 5JS6A 1AV6A 2YUTA 2HIAA 2VT3A 4L02A 1SBIA 1ZOOA 2E37A 5EHGA 4HVCA 1X3SA 2DG2A 4QPZA 3G02A 1Y1LA 1M8PA 2BH9A 2HJSA 1V8OA 2Q9BA 4J2HA 4IDFA 4WUTA 5CLHA 5KMGB 5KWVA 2QY9A 3AEUA 1H3EA 4KXUA 4C0SA 4QFBA 1NWCA 2J7PA 1T6XA 1T0IA 4MWTA 5BN4B 1DAFA 1HM5A 1QBKC 3PSAA 4D96A 1IQRA 1P2BA 2BJVA 4RTNA 2B5VA 3AM5A 3AEUB 1SRRA 3GNLA 3GT4A 1KYZA 2EIXA 1E79A 2O8NA 4IF4A 2DUNA 2MINA 4R3WA 4YXFA 4M3NA 4BB6A 4CLXA 2R7NA 1OZFA 4PGFA 3W5IA 4AJ1A 3R3SA 5DSZA 5B7NA 3PVDA 2QIPA 4IEFB 1E1KA 1DBVO 2DOKA 4KQHA 1GP2A 2CK3D 3EPHA 4G5YA 5LOVA 5BRJA 4N0PA 4S04A 3KDPA 3B48A 4NBUA 4LECA 3IILA 1GTL1 2CMDA 3P9CA 1H1TA 4O2BA 4B32A 5DH9A 4MGEA 5REQB 5TC4A 3IXLA 1HQYE 4LQ4A 4BFCA 3WFIA 1EB9A 1XCGB 1VLYA 2WZBA 3HMQA 4MQUA 5J3OA 1QC5A 1SZPA 1LGYA 1YCGA 4AZSA 4BYMA 4F04A 3TGLA 3OTQA 4ZOLB 2JFQA 4QUKA 1CSEE 4ARVA 1XQYA 4DR7B 4BMVA 2OHGA 1G7RA 4OHXA 3HQ4O 1IXRC 2YHIB 2YNMA 4YMUA 4A73A 4W5RA 1L4LA 3MBKA 3CZRA 1E2GA 5JE8A 5A6SB 4BFWA 1H1DA 2XMQA 2YWBA 5C1OA 1JYEA 3H0KA 2YFYA 2Z1NA 3S2UA 2HJWA 1GA4A 2J87A 2JIRA 2PEZA 2WMDA 3EVNA 3G7SA 4IHJA 2O0LA 3F5DA 4WLEA 1HURA 2XUIA 3E9MA 5CG2A 5JYDA 4EGSA 4X20A 1MORA 4OQMA 3C3AA 1LWNA 3VSBA 3MFYA 4CKWB 2FWMX 3GZJA 3T95A 4Z54A 4V1CI 1MRSA 4J0FA 4PICA 5HOEA 3LU1A 1ZISA 2IXAA 5LCXA 4AKTA 2GZHA 3DWGA 4IS3A 2ZG6A 2E4YA 1JAIA 4EJ2A 3QFRA 4NNPA 3UPTA 4DWVA 1RQ2A 5AWFC 5IJWA 2GUWA 3OZAA 3WP0A 2A9OA 1IDN1 3BFVA 3PKJA 4Q3OA 3ZKWA 1M2OB 5JXHA 1G6OA 3O94A 3NM6B 5BSRA 1MZPA 4YCLA 1A2KC 2VTVA 2O2HA 3B1YA 1IVSA 2IGTA 5I5EA 4QZVA 3KR1A 1QWOA 1CPYA 1TM4E 4M83A 3ORQA 2ZIFA 3KKPA 1XKQA 4H31A 4LJ9A 4X63A 1YACA 4Z8XA 2HHCA 2P2GA 4URUR 3UMCA 3VV3A 5GP1A 1J97A 1X7WA 2R1VA 3MMSA 1YZHA 3GH3A 2WJVA 2FPSA 4LMAA 4H6PA 4RCZA 2JIBA 1Z4PX 2H8GA 4QUJA 4B7UA 4UREA 1QIIA 2ZM6B 1GAQA 2B4QA 3TKLA 1N2SA 4FNMA 4EKYA 3B7PA 5EL0A 3K0EA 1Y48E 3OLXA 4AYXA 3IT2A 1OXKB 4KBFA 5LDDC 3PJDA 1QRTA 2NU6B 2V1XA 3TD6A 3H1AA 5THQA 3II6X 4DHEA 1P1KA 3E5MA 1C9JA 3L6EA 1SQ0A 5C4GB 3IELA 4HV4A 3ZVMA 4HS4A 5DFAA 4PLWA 3R24A 4GO1A 1DTEA 2RONA 2WW8A 4BTVA 3LC1O 4ENRA 3ECSA 1JT9A 4D0RA 1BIFA 3X0DA 2WT8A 1TU4A 3I09A 4FVTA 5LP1A 2QAGA 2PWBA 5FR1A 1BCSA 1C3VA 1I33A 1KBQA 1X8LA 4WLVA 4BNHA 4RMNA 3K8YA 4JXKA 3DAGA 3KYDB 1W52X 1DC6A 2CYCA 4P7FA 2WZPP 4DE5A 3Q3GE 2W93A 2WJHA 2JGMA 4PAGA 3I83A 4R0NA 3WNCA 4F2PA 5IANA 3HVRA 4LC0A 1MHPA 3FTPA 4OB7A 1JIQA 1ZH0A 3S1SA 1ZH2A 3GEBA 5IG2A 4CG0A 4WKPA 1QVRA 1TL7C 5AW7A 1KEEB 1DX4A 2JD1A 1WUIS 3Q7RA 3R40A 1O8CA 5IAJA 3V8BA 4W6QA 4EO7A 1EMDA 2N42A 3VYRB 5K8TA 3QEKA 5J2UB 1AUXA 4Z4YA 1D2GA 3GFVA 1RHQA 5G0VA 1E2JA 2X7JA 3UYKA 2A33A 3TCKA 4HT3B 2Y1OA 3RREA 1PVVA 1QR6A 3L40A 5BW6B 3JVEA 4GRAA 2BPOA 5TT1A 3ZY5A 4FMDB 1FVFA 1K4KA 2XMDA 4DIKA 4DQ0A 1AK9A 1PZGA 2ECKA 4UHFA 5JHGB 5FUMA 2BGKA 1SG0A 5KOHA 2VHVA 1AGPA 2JFGA 2DMRA 3H7AA 3D6NB 16PKA 3NNSA 4KOEC 3HPQA 3FUVA 2P68A 3KVNA 3NHSA 2AUNA 1Z6ZA 4C0KA 1E5VA 4IUYA 4MDFA 1UPCA 4IZOA 4MJ7A 1FE8A 1B76A 4LF4B 3OM8A 2BH2A 4BBJA 5B4UA 1EWVA 5CYGA 2LTAA 1Y3HA 3EY9A 3I5MA 4PYKA 1UP4A 4QUBA 4G0VA 1OHHA 4YRQA 3RO7A 3EXFA 3SPXA 4F11A 3OI7A 3HGTA 1ZKMA 2R60A 2GVNA 4FI3F 1JA1A 1WEKA 5D1NA 2G6TA 3VUFA 1ZWLA 5H68A 4PPGA 2BEUA 2IEYA 4M9QA 4UXJA 4D9JA 5DN9A 2UZ4A 2WYRA 4FYKA 3BWCA 1XMJA 3GUYA 5BN1A 5HPYB 3SX0A 2VP6A 1GXSB 1JR3A 4HQNA 1V3TA 1J42A 3CWQA 2EKZA 2HJVA 3M49A 4IV5A 4LQCA 2FN7A 3HU2A 2X8KA 1EUCB 1LSUA 1VCOA 4OBEA 2NQ8A 4UD2A 3K6RA 5EOVA 4M9RA 3QVGA 2HHJA 1QP7A 3CCMB 3CEPB 4TM7A 1NKVA 3V3KA 4AXBA 4DPMA 3OLCX 4G97A 1ILEA 1UPAA 2R751 1BFDA 1BXGB 1JDZA 3HXTA 4JIMA 4M1QA 1YKGA 2HGSA 1YIOA 4XFKA 2M6LA 3STHA 2QQEA 2P3SA 1QCYA 1T4GA 1UFOA 1FP4A 2ASVA 4TWBA 4EKDA 1IN5A 4UD6A 5K3AA 1ZC3A 4K9SA 2I5PO 5TE9A 4D3SA 4Z7OB 1KI6B 1YI2B 4Q4JA 4EUSA 1E3WA 4OXYA 4PONA 2Q50A 5TPWB 1U8YA 3A3KA 3RYHB 5FULA 2HN9A 1JBQA 1YOVA 4DMMA 1MO3A 3BZBA 2D3LA 3FHLA 4WNAB 1XEAA 3PFGA 3Q3EA 1JAZA 5ICEA 5K5EA 3RU2A 4HGYA 4QEDA 4ALMA 1KOGA 2XE4A 1P62B 2OGUA 3IQFA 4NPCA 5AVOA 5IMBA 4XKJA 3ADCA 1ZD3A 4YRPA 2ISQA 1G6KA 2ZDGA 3QSYA 1PJ6A 1VHJA 5G3ZA 5C3UA 3S2FA 1XNQB 1SOUA 1MFPA 4O4LF 1LW6E 1WOOA 5F1PA 1M2VB 2VAMA 3CZ9A 4RMGA 1EIWA 1HDRA 2HCTA 1VQ5B 2GF0A 3UFXA 1JALA 1R0YA 4P2NA 1CUBA 2IUUA 4LC1A 5BUCA 1NQWA 2BI8A 4H7FA 5AOBA 5A71A 3PUIA 2YV3A 3TM4A 2JANA 1EXVA 2ZSDA 4JWKA 1XQ6A 4J4BA 1Y1SA 1AXGA 2RAPA 3WQBA 5AT1A 4KFCA 4S05A 3D8RA 4KLNA 1XU4A 1P5RA 1S2GA 1GO2A 2JKVA 3OEWA 3IQEA 4BNXA 4E08A 3VPSA 3KKMA 1GG9A 1N9GB 4WA7A 4XDHA 4NOJA 4EX7A 4JR2A 5JDIA 3WAKA 4D6YA 4JXZA 1Y1QA 1F8XA 3EEFA 3NTOA 3GW8A 1C29B 3IAHA 1F1BA 3IAUA 3ACBA 4D56A 3J7AC 4CEHA 3COYA 4JI7B 4A8JB 1B4DA 3C16C 1JZSA 4FCCA 5A0TA 3F9IA 1H9BA 4J1NA 2O1XA 3TLBA 4CPDA 4I55A 2B4KA 2J9RA 4HWKA 4RGVA 1TUIA 1C41A 1YLOA 3H2SA 4H7DA 1G0NA 4LRTB 1NP7A 1U2ZA 4NK5A 1I01A 1DAKA 1IXYA 3D0OA 3I4LA 3SQXA 1XA4A 3L7DA 4MVJI 5CA0F 1DLIA 1WP6A 1Z82A 3OTWA 4JGGA 3R9XB 4XCQA 5AD1A 1RZ3A 1CQPA 1N0WA 3HZRA 4NICA 1E6WA 1GL9B 3CG0A 4OK5A 5ALFA 5L3RA 3RVNA 2YDXA 3U4MA 3FYDA 1CY8A 4QXQA 2DWCA 4TMFA 4LYEA 3UKJA 1GNSA 2WIAA 2ZUBA 2JJ2D 1F2TB 3HJUA 3UFBA 3T7CA 5BV2P 3UW3A 2V5AA 5EHQA 5HS6A 1G60A 1H6CA 2IEDA 3GOQA 2XUKA 4IOJA 4QUAA 2FUG1 2FQXA 2FX5A 4GFDA 6Q21A 4X71A 5FLEX 3VR5H 5I48A 4MWZA 3F71A 1GHTA 1PR1A 1YS7A 4LF8B 1MFZA 1QTRA 2OXRA 1IC6A 4E51A 1T36B 2QUHA 1Z0ZA 1EWKA 2CK3A 4KQ9A 2WA2A 4JMLA 1DBSA 1AXRA 1X1BA 4Q21A 4AP5A 3ETJA 4EHNA 1RQGA 4BQIA 4LVUA 1F9EA 4RPKA 4HNSA 4PQGA 3LZDA 2BN4A 3GBVA 4AKGA 2P6MA 2BEWB 2QQ0A 3PUXA 3S70A 3ZCXA 3DO5A 3U44A 4HB2A 1SUWA 1SUEA 4RPIA 3VSEA 4KB5A 4MRVA 3S1AB 2XB8A 2EP7A 3G2KA 4Q6BA 2O8FB 3MRVA 1OLXB 4PXAA 3C6BA 3RVDA 1E1CA 2ZJYA 3GCZA 1OTXA 3RIXA 2GCNA 4QEZA 4TLDA 2PA0A 1NN5A 2YRXA 3FIUA 1IAQA 2J6IA 3JYHA 1N8NA 2ODQA 4FWIB 4RL4A 1SA0B 2GEKA 4HWGA 1TT5A 2M6SA 3ZVKA 1IJKA 3QVLA 3CZAA 4DYDA 1JDBC 5KJFA 5JQWA 1GSAA 2C94A 2QRGA 4RWEA 1LBSA 3TSOA 4EA7A 3D4OA 2VBSA 4J16C 2IYPA 3ET4A 4X06A 3SC3A 1FQKA 2VDVE 1G8KA 1I4OA 1L8QA 3LY8A 5T3YA 1JLLA 1HGXA 1Z22A 3VPXA 5FJJA 3WJ2A 4BFUA 4F91B 3GMTA 3WAGA 2RGNA 4PYOA 5K0BA 3R7BA 5JAZA 1BVHA 3MUFA 1HLGA 4BLSA 1E9VA 1UK9A 4BRSA 1TYAE 5BNWA 1A9QA 1A9OA 1MUUA 1SB8A 2EJBA 3GB9A 4FFBA 3SVLA 4XWAA 2BBTA 4KGZA 3I1YA 4TOIA 3U13A 4B6FA 5BSFA 4JJAA 4AK9A 2XYHA 2IU3A 4MCIA 2G77B 1EB8A 4CIVA 2O2GA 2HDOA 5GADl 2VS1A 3GNQA 4S2UA 3W2IA 2PQ6A 5FDFA 2HREA 2DYKA 3MVEA 2WZQA 4LZNA 5IPFA 1JPJA 2WPDD 4L0DA 4FE4A 1JZTA 3ZU6A 2JB9A 1NQ5A 1PP4A 1YZ3A 1ZN9A 5DWDA 2DULA 5C51B 3IKTA 2W0MA 5C4MA 1EXMA 3VJRA 2Y1WA 4X84A 2P3QA 4YLEA 6REQA 8ABPA 1UKVY 1T0BA 3MB8A 3KJGA 2FB9A 4QXOA 4R1OA 3T9CA 1YC2A 3HY6A 4DK0A 4E5SA 1CUZA 5CR9A 5CDGA 1KEPA 3FKSA 1E8DA 4NBRA 3TTUA 3BWBA 1C8BA 3VR6D 5A5EA 5B7GA 4LFAB 3QPDA 1RJDA 1TMOA 1B43A 3PC2A 5I9LA 3K70B 5AO9A 2G67A 1P8AA 5K7SA 4JLAA 1KFJB 3RVSA 3E9NA 1VLZA 4YDSA 5EPOA 5CG1A 4CIWA 4FU0A 3VZRA 3I3SR 1B16A 2OHVA 4KHZA 1ZUIA 3UJDA 3RYHA 4HYEA 2R6JA 2GJAA 4MWGA 1G5PA 1UJ5A 2AMJA 3G0CA 2X4IA 1QIGA 3DJFA 4KRFA 1PYDA 1U2SA 2ILTA 5AI4A 4HADA 3P32A 3VUEA 4EB6B 3CCRB 2PX6A 2YC4C 3ADDA 4F3TA 1QLWA 4YJHB 4BNKA 3P2KA 3TSCA 3JQBA 4Q19A 3BQ9A 5I4CA 4KTVE 3R8XA 4PM4A 3K35A 4G5FA 4RADA 1OWMA 2Y1EA 3AYZB 4Q3LA 3ZHSA 4DNXA 1CJUC 2R6CA 3UVEA 3NPAA 2DTEA 4UDNA 5HKLA 1DIAA 5ALMA 1KETA 2LCQA 2X3UA 2CLHB 2FDXA 3WK9A 4R8SA 3R0XA 1UKAA 3MT7A 4FMPA 2IIVA 1F9AA 1NGSA 1PT8A 2FEXA 1L7QA 1D4AA 1P1FA 3N8KA 2D5CA 4N8DA 5FI3A 3X1MA 4ARBA 1U0EA 3NAQA 4AUMA 4PW0A 2PSJA 2VYND 1JDPA 1L4HA 4F71A 821PA 1EX6A 1T2AA 2Q1YA 2OECA 1O2DA 2QL7A 2I6UA 2WUEA 3Q5EA 3PX2A 4K3UA 2BFBB 2M98A 4S24A 4E1BA 1GTRA 5EWJB 3DTVD 1FUIA 1CJCA 1ZA1A 1P73A 3PXUA 1DJLA 2OM6A 1F48A 2Q6LA 1Z3CA 5CFMA 3FZGA 4LFCB 2O50A 4QE3A 3CUEF 1MG0A 3IBCA 1XRNA 1PHPA 1ULUA 2A9PA 3GRZA 1U81A 1PT9A 2BKVA 3CEHA 3Q4GA 4GPAA 4B0PA 1NU6A 3TLEA 4BMZA 4OGLA 1C7RA 2QLJA 2L42A 2BGRA 2J4FA 4LC9A 4RFSB 5TPZD 3TGPA 1GTZA 4MLCA 3E05A 4ARSA 2ODPA 1DINA 1H05A 2P6RA 4JK3A 4BMPB 2UXDB 4OGGA 1I8TA 2EFCB 1TDJA 2JFZA 2RDMA 2WYIA 3JASA 1T8PA 3PQEA 4KN8A 4RJTA 1MABB 2X5OA 3AIOA 1J23A 2FN4A 4QTZA 5D00A 3RS8A 1TT7A 1WDLA 4JSYA 3U1TA 1RAIA 2FLWA 1T8WA 1C9EA 4MW4A 5CJ2A 3NS7A 2C04A 4UE6A 4Z0PA 2YQ4A 3VZBA 1E4EA 2ZJAA 1CR6A 1OQAA 4IG9A 2O6HA 1Z0FA 4GBMA 2J7KA 2HD4A 4XCXA 3GLIE 2JHPA 2XY4A 4CI9A 1QQ7A 2OFXA 2EC5A 2BHSA 4Z6KA 1C3OB 1LRKA 2VBVA 2JGIA 1BDIA 1TMKA 4M0LA 3BXEA 3CMCO 2I80A 4KQWA 4D8WA 2D7JA 1KDPA 5HM8A 4CL2A 1LSOA 1O0BA 4G9EA 1WXGA 1CEYA 3C7DB 3HO6A 4FUQA 3TF5A 2Y66A 5JCOC 3PEUA 1IQUA 3EIUA 1VMAA 3BF8A 2BAGA 4OU4A 1PN3A 1BCSB 3IV7A 4UEKA 5KNDA 3NATA 3L46A 5G53C 1YRAA 1YITB 4LKRA 4NU8X 4WX2B 5F5XA 3I1FA 4IFEA 1NJ6A 4MS1A 4YJ3F 3UWSA 1O8BA 5IAEA 1AZLA 1YJWB 3FJYA 1L5KA 2WTAA 4OLJA 3RGWS 1OAOA 3DZGA 1B0PA 4YCBA 1G41A 3EWNA 2VHWA 5JCJA 1Z7WA 2R2AA 2WWVD 5CXQA 5EN4A 2BHLA 1WVIA 1C3JA 2Z30A 1F60A 4P12A 2DH6A 2JVIA 4G4JA 3VR6H 1JS1X 3CCEB 2NU6A 2FFJA 1HT0A 2VRBA 2VSXA 5L3QA 5BV7A 4UHBA 4F0JA 4WN9A 3OFVA 4OOXA 1CVLA 2NTYC 4QPNA 4BQQA 4UMFA 2QYOA 4JS0A 5L7YA 2VSYA 1YC5A 1G20E 3DOJA 3BJZA 3IVRA 4ZDJA 5ESRA 3W2HA 1SQ6A 3SYLA 5K4HA 2PWPA 1ZGGA 3GEEA 4DRXA 2KLHA 3QIAA 2RMKA 4IIEA 4GI2A 4KMSA 1IXSB 4CQMB 5JNWA 1HV8A 1VECA 3HRHA 4IOLA 5LZ4A 1GNTA 2F64A 1IN7A 1KO4A 1MG5A 2O1WA 4OHPA 2OQ2A 4QYXA 1I7QB 5MHTA 1P3DA 1KD1D 1NFRA 1DC7A 1ZIOA 2HM7A 1Y33E 3CXUA 4YP0A 1ZS9A 2B9EA 4QIHA 4CF6A 1M1XB 4D9EA 4UOEA 4YAIA 1IJBA 3O1LA 3O03A 3W3AA 3SQNA 3WDMA 1T6BY 1JSRA 3DTTA 5I8WA 3EGIA 4U2CA 2O8DB 2AT1A 4UU7A 4ZICA 5JRDS 2GBFA 3ENQA 4XTCS 4A7PA 4HNTA 4BPBA 4K3VA 1E3IA 3EGCA 2CF4A 1YS6A 1H9AA 1YMVA 3T4XA 4BO8A 1THGA 3K0AA 5CCEA 3FWHA 4TQ9A 2YVLA 5CX4A 1Z12A 5ULLA 1TYZA 2GX6A 4RJIA 4TXLA 2BD0A 1XO1A 3PYMA 4NZZA 1KDTA 5EPEA 4RM0A 3WLLA 1SUAA 2D0IA 3OCZA 1LSSA 4HYTA 2Q2WA 2VK2A 1NXVA 3MT0A 5DN6A 1Q11A 1RCFA 1XVLA 2ATVA 4YONB 4JOCA 5ADUS 3EUWA 5JTUA 3NO4A 1I80A 4P53A 1LV8A 4MV9A 3IQDB 3RSOA 3OLVA 4ADSG 4P3YA 3RJMA 1U0JA 3C98A 2B7BA 3BGIA 3COZA 3F1LA 4LBZA 2CSUA 4EW3A 2CLIB 1PR5A 1R9NA 2WG1A 1KGDA 2ZROA 3LY7A 1K6JA 2OESA 4DCVA 1MW9X 3RUIA 1ZXXA 3KL9A 2QVYX 1XSEA 1DOAA 2H2AA 3GVKA 2E4ZA 3MIIA 3W5CA 1O57A 3KR0A 5EJIA 1Z88A 3N0VA 4RETA 4BO1A 2UVQA 3IP7A 3ZHUA 2OCBA 3JQPA 5CB8A 1GKIA 1C8KA 4ZV4A 5J2TB 4RAOA 1E1RD 2FSUA 2W4MA 3QVUA 3D3JA 3OQOA 2UZ3A 3RARA 1U0TA 1VA5A 5HIAA 3G85A 3G79A 4TLLB 3CU5A 5FAKA 2Q4TA 3WB0A 3QF4A 1WOYA 4O29A 5LJIA 4JI4B 4B3HA 2EZTA 1LBEA 2PL3A 4OOFA 4D4IA 3KQKA 3V1MA 4Y67A 1IH8A 5TV2A 2QZZA 9ATCA 4KNWA 2IDJA 3MCTA 3UUFA 3B1KA 2WC1A 4L7VA 3LCMA 4JV5B 1VMIA 2SCUA 2OHXA 4L51A 2MINB 4A2QA 4LDZA 2AF3C 4WZZA 5FA6A 2QJOA 2D5LA 3CJTA 4FONA 4X3CA 1SXJE 3NORA 3H2KA 5EERA 2Y0PA 1DTSA 4N7RA 4DV2B 2X77A 1QF6A 3UV6A 3GFSA 1MJGA 1DADA 1TAHA 2V7EA 3AY0A 2G1KA 4OP2A 2ZBFA 1WTHD 4OATA 5TGZA 1V4NA 2FPUA 1ZCJA 2CLLB 2FR8C 3CG4A 1GADO 2GAFA 3GLIB 3CC8A 3QQ5A 4YJ3B 1CE8B 2Q28A 3QOYA 4N03A 2QZJA 2AUMA 5EFOA 1C0EA 2BGMA 5EIBC 1VKZA 1LJUA 3U4DA 2QRKA 5CB6A 4LXHA 3OD5A 3W8RA 1NXQA 3W1EA 1S01A 1NHGA 3D6FA 1T8UA 2DPMA 1ARZA 1RWPA 1Z4NA 4P3NA 4NXMB 4R1SA 1G9XA 4JOQA 5BV0A 6CHYA 1MCZA 3BMNA 4ASUD 2XIQA 3NGXA 4JJKA 4HB4A 1GZ4A 3BC9A 4G8DA 3UJ3X 5BSTA 2ZUFA 2X14A 3HXLA 1OH7A 2OTJB 2GJ8A 4CTOA 1VP9A 2AMLA 3L0YA 3O4IA 2A5FA 3QY0A 4E5MA 5B7QA 4P6VF 1T24A 1WB6A 4LCEA 4D9KA 5C7YA 1T3ZA 5JAIA 1I24A 2BF7A 4U7PB 5AVVA 1TO6A 5IAGA 1JI0A 1F5NA 4KODA 1ODLA 1TRHA 1FMFA 5I7FA 2HV9A 4OG2A 1HRKA 3EHEA 5K0CA 3OPYA 4XD7A 5LQNA 1I3KA 3SMQA 1Q1NA 4RJLA 2BZ0A 2IHUA 4ZREA 4FNOA 3FOCA 1IK4A 4ISCA 4BLOA 1UZMA 1JJIA 2Q6TA 5BV8A 3WTBA 1UPBA 3DB1A 4YR7A 5EINA 4QWMA 4ZAZA 3U3XA 4HATA 4QPCA 2VNHA 2AFIA 3ODGA 1FP7A 4RGQA 1IY2A 1C3OA 5AHWA 2B6NA 2GEBA 3CO0S 4ND1A 3S5UA 1CEEA 3EIOA 3QKRB 3S8EA 1HNZB 1EBUA 2BBOA 4RF2A 2A0WA 1BFKA 5JBQA 3QI2A 2A5JA 4CRWB 3OKPA 3U9TA 1W4RA