3W5VA

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
297
structure length
297
Chain Sequence
b'KCSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
total genus 86
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5vA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5vA02
1QGYA 4LC0A 3WBKA 3W2IA 4TN1A 3I1FA 1U2RA 1Q86D 1VQ4B 5FA6A 4B48A 1EP1B 4IW3B 1AMOA 1JA1A 4M1KA 2CNDA 3JQRA 1ZM4A 1QFJA 4AF6A 3B82A 1Q82D 3G71B 1QFYA 3WNCA 5TV2A 2BM0A 2B7BA 4Y9UA 5AN9A 2QN6A 4M2LA 1QUEA 1FRQA 5H5JA 3LYUA 4FK8A 3CCMB 1NJID 3E1YE 2VNIA 3AVUA 4Y9RA 3B8HA 1S0UA 3CCJB 1QGAA 4QHYA 3AGQA 3QFCA 1DDGA 2OK8A 3CMEB 2YWGA 1OGIA 1NDHA 3QE2A 2OTJB 3B78A 3CXCB 1EWYA 4YALA 1QGZA 2FX3A 1K73D 3CCQB 3VO2A 2R6HA 1QX4A 1XB2A 3CCSB 4RJLA 1DARA 3VO1A 1CQXA 3AVWA 1OB2A 4B47A 3CPWB 3ZZTA 1VQNB 4MYUA 4RD6A 2BGJA 4C43A 1H85A 3CRZA 3LRXA 1G7SA 2VNKA 1JA0A 2B7CA 3LO8A 3MHPA 2X3UA 4RD1A 4Q7JB 4PGOA 1N8RD 2AHOA 1HA3A 4PC7A 2RC6A 3U6KA 5H59A 1D2EA 1FNCA 1XE1A 4N3NA 3SJZA 4BPRA 2GQFA 2DY1A 3G6EB 1CNFA 3AVTA 3FPKA 3W2EA 3OZVA 2PMDA 1QUFA 4YAOA 4LBVA 4TMTA 1GAWA 1YITB 1QH0A 1E64A 4NBSA 1DDIA 1EFTA 1VQ5B 1N0VC 4TMVA 3W2FA 1R5NA 1Q7YD 4RD4A 2QTLA 3WNDA 1YI2B 1GAQA 2OTLB 1BQEA 2C78A 2YWEA 2QDXA 1KK3A 4PC6A 1VQMB 1KRHA 1ZUNB 5DSZA 3J81k 1CNEA 4LBYA 3AVVA 1M90D 3W2GA 1KC8D 4TMWA 1IJEA 1GR1A 2B5OA 1W2BB 4AC9A 4Y7CA 4ZCLA 4MYTA 4U9UA 1YJNB 1J9ZA 3W5VA 2RC5A 1TLLA 4B3XA 1BX1A 3OZWA 3W5UA 1KD1D 4PC2A 4TMZA 4RCYA 2BPOA 4NCNA 3CC4B 1VQPB 4UAJA 2DETA 1JB9A 1W87A 3OJWA 4QFMA 5GV7A 1TTTA 3G4SB 1B2RA 2BF4A 1ZM2A 2E1RA 1EXMA 1S72B 2EIXA 1DG1G 2QA4B 3OJXA 4ZV4A 3VMFA 3I55B 5JBQA 4M0LA 3A1FA 1KK1A 2BVNA 4RD3A 2YWFA 4C0SA 3ZC3A 1BX0A 1JNYA 1VQ7B 2EFGA 1IB0A 4H9GA 3U6BA 1QVFB 4ZCMA 3CCRB 1YJ9B 4YHBA 2D74A 3E20A 5THXA 3WYAA 4AF7A 3JQQA 1YJWB 2VNHA 3W2HA 4DQLA 3QSYA 1I7PA 1QFZA 1R5BA 1G7TA 3I56B 1QVGB 2CRVA 2BN4A 4RD2A 1Q81D 4F7DA 1D8TA 1F20A 1KTVA 1IJFA 1TUIA 4P6VF 1TVCA 2BV3A 5TR9A 3QFTA 1FDRA 3VNVA 2QMUA 1R5OA 4EH1A 2QTZA 3AVXA 2VZLA 4B43A 2BSAA 4RD0A 3JQPA 3ZBTA 3P27A 4K1XA 2HMAA 3CC7B 5EMNA 3CMAB 1FRNA 4LBZA 2BM1A 3QFSA 4HE5A 3ZZ0A 3CW2A 1K9MD 1EFCA 4YAWA 1KQSB 1KK2A 1WDTA 1ELOA 4YAUA 2ZITA 4N3GA 2J7KA 1ZM3A 1YHQB 1G7RA 1W35A 1FNMA 5TY0A 2OK7A 4LBWA 1E63A 1GO2A 2VNJA 2HDNB 3U2QA 1AIPA 3WXMA 5KSWB 1K8AD 4RCZA 3ES9A 3CD6B 1VQKB 4ACBA 1FNDA 4P3YA 4FWTA 1H42A 1A8PA 3ZZUA 1ZM9A 3OW2B 4J0QA 1SM4A 1BJKA 1QG0A 4DQKA 1D1NA 4G1VA 2DCUA 3OZUA 2BGIA 1EFUA 2BMWA 1E62A 2YWHA 4M4SA 3CB4A 2DERA 2PLFA 3CCEB 1OB5A 3WNBA 2XNJA 3CCLB 1VQLB 3WY9A 2XNCA 3QFRA 1VQ6B 1OGJA 4ZGNB 1VQ9B 1FNBA 5GV8A 1KK0A 4PC1A 4PC3A 4ACAA 2DEUA 3P26A 1GJRA 4ZCIA 1VQOB 1W34A 4G5GA 1M1KD 1UMKA 3MMPA 3W5HA 3ZBUA 1EP2B 3WBJA 4B44A 3CCUB 1F60A 2PIAA 1N0UA 2NPFA 3CC2B 1KJZA 3AGPA 2C77A 4M53A 4FN5A 3LVBA 3MCAA 1B23P 2GPJA 3FJOA 2XEXA 2VYQA 3VNUA 3PENA 4HE6A 5HXBA 1JJ2B 2QEXB 1GVHA 4TMXA 4R71A 3AVYA 1G7CA 4WQMA 4YAFA 1YIJB 4ZGQB 1EP3B 3V76A 2HCJB 1SKQA 1VQ8B 4B4DA 3CCVB 4G1BA
chains in the Genus database with same CATH superfamily
1X7HA 3OTQA 4ENVA 1YNSA 5BVHA 16PKA 2GLTA 1NOKA 2OZKA 5AVXA 5J4VA 1RWMA 3NM6B 4B09A 1ND5A 1BXZA 2R751 3IQEA 4CV0A 4Z4CA 1G2OA 3CLRD 3BMXA 4OYHA 2GBLC 4KVAA 1UAAA 4M86A 1Z39A 4JBYA 4PX3A 1NXWA 4WEQA 5LVAA 1YI0A 2DULA 1ZJ5A 1M8KA 3ETCA 3QX7A 4HZUA 4PFSA 5GZ3A 2TMDA 3G05A 1PJ5A 2Z8XA 1U0HC 4G7WA 3CF0A 3LDAA 4MVJA 3IAEA 4HAVA 1MV8A 2BDTA 3DZ8A 1QH8B 3IDFA 3WKEA 5KCZA 1O6BA 1WXDA 3VOAA 4EO7A 3G71B 3U7EB 4JEIA 4Z3OA 1J2JA 3G0BA 2N1BA 5AKIA 5F1YA 1LI5A 4BBPA 1DV2A 2CLIB 2E49A 3DYBA 4BGEA 2C5FA 2XDYA 3VI4B 2Z6AA 1G5IA 3O7MA 1SXJD 4WXHA 4DB2A 2E87A 1GT6A 2HO4A 3PVCA 2OWDA 1MT0A 4QXOA 4C89A 4RSRA 4E03A 4IDPA 2X77A 3UXMA 3CWZA 4GBJA 4LHEA 3G5MA 1U2EA 2H51A 2YMMA 3DHYA 1XD9A 2BSXA 4OFXA 4D9JA 4MUHA 3D1JA 5FLEX 5H7XA 2WVJA 3WLSA 1UD2A 1TB4A 1XTVA 2CDRA 4JOSA 4ZRDA 1TJNA 5IVDA 1F3OA 1XLWA 1N36B 5EQJB 3WMFA 3H18A 4TWBA 4XWOA 4XE5A 1P2SA 3QWBA 1A71A 4O2AF 4P5EA 4XX0A 5FA8A 2RHBA 3X1KA 2C0CA 1IHYA 4MGKR 2H18A 1DDGA 1DKRA 1PYDA 2HT6A 2PXXA 2R6FA 2Y0BA 1U28C 2P4SA 5FLYA 2HEGA 2Q2QA 4L2IA 3T12A 3GC6A 2E55A 4PXSA 2ZSIA 4JC4A 5ICMA 4R5HA 2ZE6A 1IWPB 2FMHA 2OTJB 1KYXA 3L2OB 1TQDA 3IJRA 4DZRA 1JQKA 2CL5A 2ACKA 4AU1A 4B3BA 3BTSA 4NENA 4Q3EA 1QHFA 1GA4A 1K8ZB 3AP2A 1BW9A 3S2GA 2D1FA 3HCPA 2VQDA 3WS7A 4OM7A 1H9CA 4HRVA 1T2DA 4MGYR 4RIFA 2DYIA 3P4XA 3KKKA 3WK9A 3ORFA 4BVEA 1P2BA 2J87A 2IEAA 4NBTA 1B0ZA 3RIEA 1AGNA 5ALQA 1VC2A 2X8JB 3CHYA 5ALMA 3AILA 4B6RA 4Q01A 1CQXA 4L27A 2WJYA 1T5IA 3R0QA 4HADA 4N47A 1XU4A 3BS4A 2ZTLA 2A92A 2HPHA 3I9MA 1OYVA 4JQZA 5AK5A 2FG7C 5IPFA 4ID9A 5IVPA 4ZO7A 2X0RA 2C96A 4IDOA 1JHPA 2GUGA 2XUJA 2VBUA 2VP3A 1USWA 2PUTA 2JATA 2GPYA 2GJRA 5BV8A 5GM2A 1CP2A 2C2BA 5AVKA 5GP1A 2J6CA 1R37A 5I48A 3IEVA 1Y9DA 2D62A 2I4TA 1LBHA 2EX1A 1K6IA 4NYJQ 1Z4MA 1VA4A 4BO3A 2GAJA 3CRQA 5AVUA 1R6XA 2WHXA 2R25B 3G7SA 1A8SA 4OQPA 4XWTA 3OZFA 3QFFA 4WGGA 4G4SO 3ESCA 5EXDA 4JI5B 3D4IA 4QGGA 2OZLB 5IWCA 1A9PA 2FR0A 3TVYA 2FSPA 3QVWA 1D0VA 4LRSB 4NK4A 2WJ3A 3FJ1A 4CLOB 2G77B 4KAXA 4PC7A 1PX0A 1Z5VA 2C97A 2XXJA 2XYRA 1OZ0A 4L6CA 5EGSA 3X0DA 1NPTO 1T5LA 2AI3A 2XUDA 1CETA 3U31A 4KI0A 3ANSA 3WK7A 4AZ3B 5HJ7A 5L4LA 3X1ZA 4X6UA 4EG5A 4MUBA 5EIWA 5MGBA 3U7GA 1H23A 3MK31 1K9SA 3KBBA 1SBCA 5TRDA 3G2JA 3L7IA 1BCRA 1H6DA 3EXIA 4LZOA 2WSMA 4HAXA 1EGHA 4LCEA 2JZCA 4CODB 3T4UA 3QEMB 1KJJA 1FSGA 1ONPA 1CXZA 1EVEA 3OKFA 2J09A 2PGNA 3AFGA 2XB4A 4MEBA 4RY9A 4ER7A 1IG3A 1NLMA 1MX9A 2C54A 4I2VA 1BH2A 5EP3A 1MJHA 3VH2A 4LBVA 2ZE8A 2ZR8A 1GAWA 3EXG1 3TLKA 3W1EA 3JZDA 4BY9E 2HHJA 4MAAA 2FOLA 2XZTA 5DIZA 4ARAA 2AOXA 4YMHA 1V0EA 1N9ZA 3D4BA 3P2YA 1Z6YA 2O6HA 2DM6A 1EGQA 4OHRA 3N8NA 1UPXA 4Z7JA 3NDIA 4OVKA 3SICE 4MW7A 4D46A 3G6WA 4ZYXA 10MHA 1PBTA 1B3RA 1IZYA 3T3GA 3ELBA 4QPZA 4DNFA 5CB4A 3PFBA 1Y1PA 2IYYA 3HUTA 4LRUA 1V2GA 2X2EA 3QRWA 5DV9A 1DAMA 4FP9A 2OUIA 3RUAA 1SC1A 2GLXA 4RVGA 1G8PA 2DCMA 4NBLA 5SYAA 2DHEA 3BQMB 4P53A 4RKFA 4BKRA 2A9RA 2QSUA 2AG8A 4E5MA 1OLXB 1CIVA 5E1OA 1KDVA 3CFYA 5DHSA 5L40A 1N7JA 2H4WA 4GAEA 1IJEA 4IDQA 4CMBA 1YONA 1LWNA 1QV9A 1HEUA 3EVFA 1EFHA 3THWA 1XEXA 3KETA 4Z8YA 2BZGA 4ZOLA 1B1CA 2IHBA 3LSTA 4ZIRA 3HZRA 3SYTA 4P0PB 2JL1A 3RJTA 3A6LA 2WTXA 3WJAA 3DONA 4YPVA 3ASUA 1LFAA 3UCFA 1P2DA 1OLSA 1XC7A 2VYCA 3KLNA 3R20A 4HS4A 4MUXA 2OCYC 3HEMA 4W8GA 4ZO8A 3SFVA 1GPDG 3WK8A 4DILA 5KYVA 3KSZO 1XTTA 2XW6A 3FB4A 4HFNA 5HJEA 2X9QA 1G59A 3OZWA 4UUNA 2NU8A 3WTCA 3VO8A 5TNXA 5FBHA 4NS4A 5B1IA 1C8KA 3OJOA 3PKZA 1H65A 1US8B 4J0DA 4YRTA 5L95A 4QC2A 4PC2A 5HQTA 1R15A 2DH5A 3NC1C 3V8EA 5B6IA 1AGYA 1E3ZA 4J29A 3DV0B 4N82A 4PLZA 4TSFA 4C03A 1YGPA 4FDAA 4FPXA 5DHQA 1J8MF 3TQTA 2PV7A 4BLOA 1FFXA 2AN9A 3N39C 3RVQA 4YBRA 3CJRA 1T34A 4Q4JA 1J0BA 1JPNA 3N2ZB 2A1TS 3K31A 4QAJA 4K9SA 1A2OA 3ED5A 1CE8B 4XYEA 3BERA 3KPJA 4K46A 5F2KA 1U3GA 1LFDB 3NUZA 2O8VA 4KN8A 1EBBA 3A9CA 4MIYA 5DLQC 4MKHA 4YT8A 1G6Q1 3BULA 1A9RA 4MQLA 1NVUQ 1DT3A 1TLFA 4LY3A 5M04A 4ME6A 1TC1A 4NFSA 2JBAB 3BGIA 3ZV5A 4CF4A 2X5KO 2H7XA 4OREX 8OHMA 4RK5A 1TPZA 3DYVA 3PQEA 1GKKA 1LQ2A 2BI4A 3KVRA 3T06B 1NXXA 3RAFC 1KO5A 2FPSA 2F4NA 4EHLA 4GC5A 1BX0A 1EA7A 2C07A 4M1WA 4QYWA 5KNBH 4BBZA 3BE4A 3I83A 2EG9A 3N2KA 2F1KA 2SHKA 3KPWA 1IB0A 4BNHA 5J1SB 4LSZA 5IC5A 1Z4NA 4LX8A 4TKOB 3WYCA 5KPDA 1V5GA 2E18A 2YMLA 1M2GA 5UKDA 2FWAA 1PD1A 3MSCA 3M3DA 3NTXA 4LF8B 5L4SA 3MT0A 4P0TA 4ZQBA 1VFNA 5IW8A 3F47A 5EUQB 1OZHA 4ZCMA 2EP8A 3OUTA 3P1JA 2IOFK 3H9QA 5FV7A 4DSNA 1CJSA 3A70A 3MQFA 4G4GA 7ABPA 2FI1A 5IXYA 1JEYA 4C7OB 3BZUA 4KFCA 1Z0SA 2V7XA 5TQ0B 4AF7A 4P92A 4RPGA 2O23A 5HZHA 4KLCA 3GPLA 4INZA 3RTEA 2V03A 3NZEA 3LCJA 1Z2NX 4YXWD 3W5AA 3KQTA 2HJVA 4DQLA 4AYTA 1JMKC 3DMPA 1KVUA 1E5QA 2LRHA 1JDPA 1XVIA 5AM5A 1QVGB 2I4NA 4LE0A 1S9DA 2O07A 2F3QA 2CD9A 1E3QA 3D3WA 2OHOA 2FFHA 4O2AA 1GOTA 1UKEA 3GBVA 4M6WA 3IQWA 1QJ4A 1TKRA 5FQOA 1D8TA 4F6RA 2IWRA 4YP0A 4EL0A 4X7EA 1E2EA 1JR3A 5J2TB 4BZQA 2SKDA 2INGX 1XCOA 2BV3A 1NZJA 2JEYA 4HBZA 1IWOA 5LU8A 1ZEJA 1XNHA 3KT8A 3ORSA 2O5CA 4PWZA 1HFJA 1YBHA 2YV1A 4ZI5A 3DZFA 4GUAA 1ZCZA 2YFYA 3FTEA 1AE1A 3N5CA 2I6QA 2CLEB 2ZUDA 3EAGA 1ZJ4A 1D2GA 1KAMA 2PH1A 4UU0A 1JAHA 3LC0A 4YUWA 2AW3A 1DTEA 2OBYA 4M1QA 3C15C 1IVSA 5ECYA 3H65A 2GMWA 2YYYA 4QREA 3ZW9A 3WQSB 2ZZEA 2EWWA 3JASB 4IZHA 2NUBA 1I9CA 1HFWA 5GWXA 3WWYA 1NVDA 1SKMA 1NG9A 1JXAA 1VE1A 3OJCA 1P4SA 4BZZA 1OFVA 1II8A 5CM8B 4C0JA 1IATA 1V2HE 1BWPA 5K0BA 3ZD8A 3B6EA 4D7AA 3E9DA 1QGUB 1D03A 2C9CA 2A14A 3NH9A 4WNAB 3W06A 1C0PA 4DWOA 4IG9A 4PAQA 4QVKA 3D43A 5DLDA 5L3ZA 4CM7A 5JY1A 5JYEA 2VHTA 3C7TA 3L9WA 1SHZA 1W88A 3ESRA 3I2IA 4G01B 4O08A 3QLVC 4BX9A 1R6DA 1FP4A 5G1PA 3SC4A 4BE9A 1H6CA 4D96A 1SCUA 4GC9A 2YASA 3GNQA 2GEUA 5CJ2A 1XBTA 2ODTX 3BGWA 1P31A 4C08A 1JQLB 5C31A 3KUCA 1UXGA 2HSWA 1GQFA 4NVRA 1OJLA 5KYYB 1T1RA 1LC0A 1PT7A 4PFJA 4QUIA 4H3VA 3WGYA 3ME5A 3ZNQA 1FUEA 3RU7A 3H6GA 4RCZA 1S6YA 4HJXA 5DHTA 4M1SA 5LA6F 3ST7A 1QIFA 3LBAA 2XOEA 2QMEA 1MO3A 4US0R 4G7XA 1WXHA 1EXWA 4HH1A 5A04A 3GAZA 2P9YA 2YHAA 1CFJA 3A9RA 4KRGA 4MQEA 4XQ0A 4OI1A 1IHPA 4GF5A 4NBWA 2IFTA 1E9BA 4FGSA 1R88A 2Q1WA 3PE6A 4QELA 2PVSA 1WXFA 3NDBB 2JJYA 3OOWA 1JYEA 2NO7A 2IYOA 4TKZA 4UJ3A 2HB6A 4HUJA 4KBYA 1WBBA 3MUFA 3CLSC 4NZYA 4U0KA 4J7XA 3T51B 2NO0A 2FEOA 4ER5A 4IGIA 2VK4A 2VN8A 3HGMA 1RWBA 5D3MA 3SEZA 1O2DA 1WR8A 4XGQA 4MQ6A 4TL8A 1CEQA 3HYSA 1U1DA 4M4SA 5JNUA 5D85A 3TOSA 5CG1A 2D0IA 3IOYA 5SV2A 1DAKA 2E5FA 2NZUG 3FNEA 2DERA 4X6YA 1ZUNA 1IJKA 3WNBA 1OT3A 2JZNA 3BGDA 1ILEA 1RRMA 3QOXA 2BGMA 3GEEA 2ATCA 5C51B 1AD2A 1YRQA 3NWJA 1I6KA 4FFSA 4HFJA 4NDNE 5CFNA 5I8PA 3OQOA 1HG1A 1Z0IA 5ED4A 5JEDA 5BRJA 3I92A 2BKEA 4FOLA 1E3EA 1FDIA 3DW1X 4DCOA 4B7UA 3EOAI 4DSOA 5JXGA 2GJ8A 4R1NA 5KVVA 4DLLA 3FG9A 1KSJA 3DHWC 1RAGA 2L18A 3MWDA 4UHEA 4ARIA 3ZY4A 4ENRA 4D81A 2XVMA 3U4MA 2BHTA 1C2YA 1QO0A 2A94A 5IF9A 2JNWA 3PGKA 3LU1A 3JS5A 1MW8X 4AJHA 3KTDA 3WOVA 2JD0A 3TW6A 4IRXA 4FZJA 1K08A 2AEMA 3DE5X 3I2JA 4HAIA 5T6BA 5AUOB 3TE7A 4LCBA 4D3ZA 2FQYA 2JFFA 5FUBA 2XCTB 1SVIA 5K0GA 1ZCAA 1REQB 3HRKA 4X8HA 4XYMA 3FLAA 2C8JA 2OCAA 4QEKA 2LIPA 1LBIA 2K2WA 3WHPA 2E1BA 3TUZC 4R2XA 2XMDA 3WLJA 1DQSA 1TKBA 5K6AC 3ZQ4A 1VLOA 3DVLA 1RQRA 2PJDA 4IXNA 4BMDA 2CHUA 2ZYHA 4WLEA 3K0FA 5FI0B 3VHXB 2EP5A 1G1AA 1FDSA 1GL7A 2I76A 4IVRA 4FZRA 4CR6A 4KP7A 4AB1A 2A5GA 5EEHA 1KJNA 4PXYA 5GONB 1NLUA 3GFTA 3OLQA 1JIQA 3LZ6A 1I4WA 3CSSA 4TKLA 1KZYC 2P5UA 4O2BF 5AJVB 2Q7XA 1NV8A 3EBLA 4R31A 3GGGA 3R74A 3IUYA 5T4BA 3NS7A 1AQJA 4K9DA 3DUFA 4O2RA 4MI6A 4YJFA 2P9TA 2LIVA 4LF4B 5FLKA 3RYHA 3MW8A 2KI5A 5E1BA 1W19A 4YV2A 4MJLA 1UXJA 4TMXA 5ERGB 1MRSA 5LSAA 3I37X 5JUWA 1ORHA 1U8UA 3GCXA 2Q41A 3D59A 2EW2A 4S24A 4CI9A 3E7XA 2IDMA 5DTEA 3GPBA 3IMEA 2R1VA 4LWZA 4NBRA 5CVDA 5AOVA 5SZHB 2HKIA 1O9BA 4AN1A 1BROA 5HM6A 3WBBA 4FQ7A 3TUIC 2BTQA 2Q4EA 2HYIC 2OAEA 3OF2A 1UXIA 4YAGA 1W5FA 4CKCA 2QM3A 3HU3A 5TXGA 4ZCPA 2H1RA 4MHOA 1JXOA 4LOKA 1Q86D 3UJ9A 2O5VA 3HR8A 4DB4A 3EXFB 1VQ4B 1C80A 1KC1A 2A0YA 3D3QA 1NZFA 5F77A 3X44A 1D2HA 2YZ2A 3TFQA 3PNSA 4M1ZA 4R2IA 3QE9Y 4XLLA 3G89A 1R9GA 3AEXA 2FOXA 3UWDA 4PHFA 4LZZA 4PLFA 4DRYA 1XZJA 3QKRB 4NOMA 5JDCC 2JF0A 1Y89A 4UM5A 3K3PA 3QPAA 1YQUA 4KACA 4YI3A 4BB9A 4M1YA 1G5HA 5E6RA 1Q82D 1OLUB 4G9EA 4I1RA 3RWBA 3HJRA 2VHVA 4EEXA 2R47A 4IF6A 4TV9B 3WNCA 4JA0A 2HMTA 2BM0A 3QF7A 4GGMX 4B8WA 3ZWPA 2CBZA 2CFRA 1WX1A 1BJTA 2G0NA 4HQ0A 3QELA 1EGVB 3QLUA 2GFHA 1EUDA 1NJID 5ALHA 1UJ4A 5MFZA 3V4RA 4UHHA 4FC6A 5EE1A 2BYTA 1SHKA 3H17A 3TN7A 1O95C 5JSQA 3QKWA 1T8YA 2JGIA 3IESA 2I2WA 4GX1A 4HYTA 4TRMA 1XTSA 3B8HA 3GGOA 4X0CA 1UMBB 2QN3A 2O06A 4IR7A 5AJWA 3MCTA 1FNNA 1UKBA 2P65A 4YDHB 1L7XA 2OVBA 1NB0A 2VHJA 3IQXA 3NFYA 4TWIA 2WWXA 3F7MA 4WXEA 3D7NA 2BKLA 1QVAA 3IELA 4IQ4A 3K4PA 3IO5A 5CLQA 1DKMA 2Q5CA 4MULA 4BMZA 4ZCTA 2Y0CA 1CPYA 4ADSG 3IVRA 3T7KA 4ZQFA 4Q7QA 2IYAA 3IBSA 2ZIFA 1TYCA 3SYNA 3ZWKA 4RPKA 4Q9JA 4F2GA 3QE2A 4PF1A 2PZMA 2DF8A 3OESA 2GAFA 3OOEA 3GJSA 1ESEA 3WGLA 4C4YA 2X6RA 1W6RA 2OAP1 4OOVA 1ACJA 2DBYA 4D0NA 2V6BA 1PDOA 3JATA 1CZHA 3LXXA 3VYTB 3CP2A 3SJAA 4PIPA 1R6BX 2B69A 1Z8HA 4MTCA 4WBSA 4MV5A 4AXBA 2VJMA 3GI1A 2A5FA 2B4YA 2O2GA 3ZXXA 4YQFA 5IJ9A 1GYQA 1QAQA 5HS6A 1DCKA 1WZCA 1GPKA 2VT6A 2ZB8A 5C3MA 1FTWA 1WDMA 3OOCA 1P9LA 2JKZA 2RGNC 4GMXA 4WBNF 4GX5A 4P7JA 3LQYA 2OHFA 1C3OB 4JASB 1ZH4A 4QG7A 1DKPA 4RORA 4GM0A 1TU0A 4G25A 5FV4A 3AIMA 5IK2D 1JR6A 1P9RA 2HO5A 2ZAIA 3H1AA 3K53A 2ZFUA 4YCJA 3LOQA 4C21A 5ADUS 3Q9SA 3WIVA 4HH4A 4Z1MD 1KSHA 3C87A 4D82A 3ZWOA 1ODCA 1Q11A 1PV2A 2IXEA 2XUIA 3AR5A 3IMCA 3IRUA 4P7KA 5K6TA 3W34A 3GK3A 1QOPB 2CHQA 4FMDB 5AOBA 2YOGA 4BRSA 4Y2JA 5IDQA 1A72A 3DT8A 3RI3A 3WKCA 4EPRA 1Q3HA 1Q0TA 2FW8A 3FCXA 4B0PA 4ZYWA 4FSXA 2FWMX 5EKSA 1QP8A 1N8RD 4ZV9A 2FQXA 5WRFA 2G09A 1MX3A 2OXCA 1DBWA 1Y3AA 3OCXA 3QXJA 1QWSA 4MS4B 5EXSA 1Q77A 4GPAA 2XSZA 2CF5A 2X0EA 5I7HA 4R9UC 3KR9A 4I3GA 1VJGA 2A7XA 3NEPX 5LA6A 4Z99A 2FPOA 2NXCA 1G21E 2QRGA 4JUFA 5I8ZA 1TAGA 4DUGA 5C18A 3RJ5A 4J1SA 5E4FA 3O90A 2AK2A 4BRZA 1DJPA 2DU8A 1OXVA 4JB0A 2Y9PB 4RK1A 5EVCA 1IRIA 3T6KA 3ZJ5A 4FYHA 3X2EA 4WZ6A 3C8HA 3HFJA 1YS1X 3GMIA 1IULA 3JXEA 4PRYA 4A73A 5IZ4A 2XYQA 3IAS1 1AHNA 3GJ3A 5A0FA 3DAFA 3TJMA 1O97C 3IXLA 1IUNA 1OU4A 4PBRA 4YFVA 1CUYA 2XYGA 3HU1A 5HTOA 1PZNA 3K9GA 1CR4A 3K7EA 3I1YA 3RVPA 2VO1A 1L3IA 1N92A 1QK5A 1UUFA 3MOSA 2Q3HA 1AGRA 3GEGA 4FNOA 2QTLA 2OKCA 3FUWA 4EI7A 2PWAA 4IIYA 2QTVB 3HXPA 1R16A 4LDRA 1GAQA 1WZEA 3MUOA 4ND4A 5C7IO 2Y2VA 3H2HA 3N7UA 1B00A 3VDRA 2O7QA 1JDUA 2VSXA 3CNBA 4Y9DA 3CVVA 3THXA 1G4AE 2WFLB 4PYRA 1L5HA 3TD2A 1P6XA 4G1UC 1RZUA 4B9EA 4RPHA 2HIMA 2GZSA 3ZVMA 5JWRA 4P2BA 1QG2A 3B1YA 4OP3A 1P8AA 1YBVA 4E70A 1EDBA 3CJTA 2UUBB 5EJEA 1E79D 4IEFB 4D6YA 4MV6A 4YY3B 1M1NA 1W2BB 4HDOB 1GPAA 5TVKA 1BO6A 1TZJA 3DB2A 3M6LA 2CVZA 2IUYA 3B7PA 121PA 3GXOA 3WI7A 4UD6A 4EUHA 3D02A 3GFVA 4RTSA 3LY5A 5CK5A 4KR0A 1AF7A 3IAFA 5D3KA 1WA5A 5E2BA 2YY5A 3QV2A 3SIPA 4GPBA 1WPXA 1JZTA 4ESVA 1JPUA 1K8YB 1V6CA 3JD2A 2ZDGA 2VBFA 3MS4A 5JSUA 2GJKA 1DRJA 4LJ8A 2DOGA 3U48A 1AU9A 1DAHA 1BOFA 1EFPA 2G71A 4II3A 1DOAA 3WYFA 5EE0A 4AG3A 3TLEA 4MWOA 3C8DA 4RETA 2OPHA 2H63A 1R12A 2DAPA 3MMZA 4Q4AB 4TL7A 4X1IA 3RVRA 4H35A 1HOXA 2A5YB 1AXGA 1KRWA 2BPOA 2F9FA 2JANA 2PU5A 2WWFA 3MTQA 4P5DA 3C24A 1T9BA 2GUWA 3LOUA 2ICAA 1BCSA 2IBMA 3NG1A 1E5XA 2I9KA 2DETA 1S7GA 2VATA 3HCDA 3IS3A 3L0IB 3K5WA 4EQ6A 4U02A 1EVQA 5LZ5A 5H0IA 1KDTA 3NLLA 1XZQA 5E9QA 4KPYA 4CKBB 4F92B 1FVHA 5FWYA 1S3IA 2UZ4A 3WLLA 2GILA 4QVAA 1ML3A 1T9GR 4RK4A 1IBLB 3DKVA 2EAUA 1T2VA 3ZI7A 3DOFA 3ITNA 1Y48E 2AQIA 1ULTA 3ILSA 3Q6IA 5F1KA 1GPH1 1EXMA 3OU2A 1LBSA 1SZDA 2W43A 3BREA 4H1VA 3HBLA 3RKRA 5BOVA 4JI3B 4J0KA 4OSOA 3HU2A 1T8UA 4EA9A 4G5FA 1Q9SA 2PJRA 1XTQA 2PKWA 5A9RA 4EJ0A 1PJ4A 4Z0HO 3THRA 4ZTUB 1YF3A 221PA 1VP3A 2ETXA 3QVGB 4U1RA 1QDEA 5BOSB 3IJPA 2VS1A 4KR2A 4XGKA 4RD3A 1ISJA 1IHUA 3B6KA 3GJXC 3OZCA 5J3JA 1NULA 2PRJA 3OJ0A 4MR9B 3V4SA 2BGWA 2RHJA 4BVKA 4D79A 5I4KA 5IVHA 5IYPA 3QX9A 1PGNA 2LE0A 2PZEA 4YASA 2YJNA 4DR5B 2B25A 2C7QA 4C0AC 3IEKA 5EJ2A 1WOOA 1PEYA 1J24A 1PWHA 2P4QA 3AYZB 1WQ1R 3DE4X 1L5RA 1NBMA 3OOHA 3KD3A 2I34A 1R27A 4UD2A 4ZQIA 2Q6VA 3D6TB 2R85A 3DZCA 1J09A 3OQPA 2QRUA 3TLGA 2WUDA 1NRJB 5D84A 1GGJA 4AMBA 1G8KA 1RIFA 1XLUA 3S2EA 2RMKA 2GBPA 2BLLA 2C5LA 2ZRGA 3BWXA 2ZROA 3D0RA 3IOEA 4WY5A 2A9QA 2RKOA 1POWA 4EITA 4J1NA 5J5AA 3MT9A 5E38A 3URMA 3A9SA 4M0PA 4BATA 5KQPA 3N6VA 3PNKA 5G40A 3DE6X 3GP5A 4MWCA 1DRUA 4LHXA 4KRFA 5FTNA 4Z7OB 1P91A 4S12A 2ONJA 2PX0A 2Z3ZA 1OILA 3UUFA 1N6PA 1G2IA 2VK8A 2WZNA 3FSJX 3KU4A 2O9JA 4TZTA 5LZ8A 5C7OO 2G25A 3ESZA 2H0AA 2PKQO 1CF9A 3JYHA 2WD9A 3P0HA 4FFBA 1QC5B 1RRGA 3V2UA 4F12A 4KGVA 1HQCA 3QNMA 4JHLA 4HNVA 1UKVY 5KNBA 3TD6A 4JP3A 2OESA 2CBXA 3OX1A 2WQ6A 1UBEA 5BUCA 3NC0C 4CL0A 1O95D 3B38A 3H04A 1YCDA 2P9EA 2H00A 1W9XA 3RFXA 1PLJA 3QWHA 3PJRA 1VL8A 2D7CA 2WFMA 5CD9A 2HX1A 5KSOA 4AQYB 1PVOA 4R5MA 2X6TA 4A26A 1SWWA 4OLHA 3K16A 1AY0A 1YFZA 1E1CB 4KXFB 1DB3A 1UBHS 2A5JA 4NX2A 1DJNA 2DBZA 4L4XA 4NXNB 2FUG1 1SH7A 2ZBFA 2QMUA 3ITEA 3P0IA 2FDRA 3K32A 4Q1CA 3NONA 3O4GA 2VZLA 4FOSA 4RZUA 5GM1A 1D0SA 2VH5R 3WRXA 1EZ4A 2YWRA 3OLWA 3QPVA 3OX2A 4YUZA 3ETJA 3QX3A 1E20A 3P0JA 1Y34E 3OO0A 3VX4A 1MJGM 5TGTA 4W9RA 5A2GA 3OUUA 4R2WA 5B6JA 1V8OA 4RHCA 4ZHSA 4WBNA 4L9WA 1X8JA 2PKQP 1YU6A 5KYUB 1D4ZA 3CUSA 4BAGA 1FVFA 3TZBA 2ZVDA 5TX7A 2PMWB 1AUPA 3RABA 2RK3A 2RCYA 1N6HA 4I4TF 1YT5A 2AB0A 2GF2A 3DVAA 3HP7A 4J7CA 1K9MD 4LNAA 5AKZA 3ZGLA 4WBXC 4A8TA 4MR7B 4PABA 1OXMA 2IW3A 1YGYA 3FAZA 4IAOA 1DWUA 4KXNA 5JVDA 1AVTA 4JQYA 2NXWA 2YVLA 4IILA 3TG2A 1ELOA 2ZREA 2BEVB 4PO8A 5JTUA 5CX1B 5JECA 1YHQB 2OV2A 2FPXA 2J8ZA 3PIDA 3JQGA 3DBLA 4EGSA 3R5HA 4IV8A 4U2BA 4RZXA 4ZCQA 3A9UA 1N8TA 2O3QA 3HPRA 1IU9A 2QMZA 3EQ6A 1LJUA 1OWLA 3FOAA 1BX3A 2O2EA 3LWBA 3QUAA 4QAQA 4TV8F 3WXMA 1C81A 2HTFA 3TYXA 1Z0DA 3BCSA 4KX5A 2X19A 4PVDA 2ECFA 3LPLA 5AQEA 1CR2A 5JBIA 4GS5A 3OT4A 1LI4A 4UQPA 4D99A 2GX6A 1L7BA 3R5FA 4FINA 3G3EA 4Z4EA 4R1OA 3OPMA 1T4MA 3DBIA 5FCDA 4Z0TA 3TTWA 4AJ2A 1DIAA 4I99A 3K6SB 1DS6A 1LKZA 3THOA 3VPCA 4H1TA 2RGDA 5EUCA 1VCNA 3OZ7A 4FFRA 1ETUA 2YXPX 5A7FA 3F46A 4YS6A 3IALA 4AKHA 3MIIA 4CUZA 3UW1A 4YAIA 2GJAA 5ANRB 4G89A 1NUQA 1ZP6A 2QTFA 5H4GA 3BAZA 2ADMA 1JYFA 1ODFA 1QHNA 3HR7A 5JH7B 2HREA 4DWVA 1XO1A 2XRMA 3RG2A 1JIXA 2NW6A 2A84A 3BEDA 5GJWC 5M34A 4XPIA 2H2DA 5D7BA 3KKEA 1PW7A 3Q2OA 3O1IC 3OKCA 1ZMOA 2AMYA 4GPZA 2PLFA 2JIMA 4XLFA 1MB4A 1BU5A 1NJSA 2ERCA 2EF0A 3HO8A 4NYIQ 4QPJC 2AHRA 1YFKA 4MKFA 2XBMA 2D8MA 3UICA 1JBKA 5DPMA 5FFFA 4R4JA 1U2GC 4NQZA 3R4VA 1W85A 2DJIA 4QA9A 2B61A 2R96A 3MZ0A 1TMOA 1ZC4A 4P33A 4EW6A 2AF4C 5CXQA 1UIRA 4L7VA 4ON9A 5DCUA 1TM7E 3P71T 3UVEA 3I6YA 2GZMA 4CTKA 3OCJA 3LWNA 4R05A 5LYJB 3LTNC 3VU9A 5IANA 5C80A 1G19A 1Y1TA 4I4CA 3K1AA 1W5BA 2Z2IA 2RHMA 2A9OA 2VOEA 2NNLD 2Y1OA 1AZWA 2J6BA 3IFSA 1QIHA 2ECPA 2H1CA 2OKGA 4PAWA 2QYOA 5EE5B 4GH5A 5TEWA 2VDPB 3E22B 2ZU0C 1PQUA 1UKCA 3L7MA 1L6IA 1KJYA 3LMKA 4ZYYA 2PIAA 1IL0A 4KOAA 1H2FA 4E0FA 2ZRAA 4LNUA 3MJCA 3V1UA 3GRYA 3W78A 4FBGA 2KQUA 2XOKA 4MRRA 4YMTA 4KE8A 3EQ7A 4JSRA 2F9LA 4EY3A 3B51X 1I2MA 4M53A 2VWGA 1XN1A 4OMDA 3WIBA 3RIMA 2UZ3A 4UUBA 3V1NA 2EDCA 4Z49A 2G3YA 3RROA 2QMYA 4CQLB 1O8BA 2JLCA 2Z2JA 2ZSFA 4RC9A 2VBIA 3UAXA 1U8XX 3PDCA 1U0TA 3HV2A 3HWSA 3DPSA 4OXXA 1EG7A 4J7UA 1QH1A 4LZJA 1JR3E 4B7ZA 5CU7A 1MBZA 3CX8A 3PXGA 4HG2A 4H7PA 5AVQA 5FL7D 4PSKA 2PO7A 3RGGA 5DULA 4R8VA 2BFWA 1CDOA 2LTAA 4XR6A 4Q15A 3HLKA 1HI9A 3V4OA 4BASA 2VZ0A 3RV3A 3E9EA 5E7IA 3VR2A 4NE2A 1OWOA 1VBMA 3SLRA 2QQ0A 3N9IA 4FDLA 1S2OA 3VOSA 4PGGA 3Q7EA 1SKQA 1UFQA 2FZGA 3NTLA 3IT2A 4P26A 3K70D 2JLUA 2FZEA 3GCGA 1VECA 4WUVA 4Y2UA 2PT6A 4ASUD 1W48A 3R3YA 3NHKA 1YRHA 1FA9A 2JFPA 2RH8A 4WCVA 4HPJB 3PA1A 1AMOA 2R1ZA 1Z4JA 2PLWA 1ESMA 2TMGA 3EDOA 2RK6A 2NXNA 4I6EA 1GUFA 2XECA 3N8HA 3GUCA 1U81A 3H86A 1UEJA 3FOWA 3I42A 2YKGA 2RGYA 2IF0A 1ENYA 3NTUA 4Q1VA 4GZ5A 2G1JA 1P17A 3SF8B 3T8YA 4AJ9A 1DHRA 4EZEA 1V4BA 5IBPA 3EY4A 3KB2A 2AE1A 4CCWA 4G4IA 2C1ZA 1TYAE 1ZMTA 4PSCA 1GA1A 2IIPA 3TIFA 3QVSA 3RAGA 3TTUA 4EJSA 2V4UA 4I66A 4Z8XA 3JWEA 3U5ZB 3A8IA 3D8NA 1MA0A 3TAUA 4LXQA 1SCAA 5D7NA 1EK1A 1XDZA 1T29A 3RH0A 2CKMA 2OFOA 3L5OA 1G9SA 3IE1A 4HWSA 1N34B 2V8OA 3K9NA 2V58A 5KTNA 1NF8A 1ZHFA 2GCOA 4NPCA 4D9EA 1Q74A 4XH9B 5FUYA 2WINI 4LIPD 1H4SA 4O6VA 2PGJA 2PUWA 3LW7A 1WOPA 3RCBA 5IJZA 2RD2A 2XXAA 2FWPA 1PZMA 2EW8A 2PBRA 3EXEB 4JLVA 1YH3A 4X6XA 1T0IA 2EFYA 1VJSA 2XUKA 4WZAE 5KREA 1OROA 3E5HA 2YN2A 5DF1A 1JTEA 2CNBA 4CLXA 1T13A 1E2DA 1JW9B 3H7IA 1B8UA 2PE5A 4YROA 3GEBA 4EMSA 2QVCA 3MS2A 3VH1A 3ZIUA 4BQPA 5LJLA 4JYPA 4RIGA 4C6RA 3CCQB 3UF0A 3AL0C 4I1SA 2IYTA 3A2LA 3CCSB 3QBDA 3AU8A 4F5DA 3EF1A 3M5DA 3I8OA 1KJIA 4GKAA 4MHSA 5FHRA 1LPSA 2RB5A 3K09C 4G2TA 3AVWA 3TW8B 1K0FA 5KB3A 5EIBD 5J2UB 4L5JA 4NICA 8ATCA 5KC8A 3R7AA 2QL9A 4NJMB 3UMCA 3TJRA 2UVPB 3L93A 4RTQA 1YKGA 4M22A 1WHTA 4ZAFA 4BNYA 2XCOA 3EUFA 1R4NA 3EQ2A 5FR1A 3VSEA 3RC8A 2IE0A 3PICA 1XMXA 2H9IA 5BT9A 4RFSB 2EZTA 1YKFA 3DR3A 1UZNA 1S2NA 4RDCA 4I2NA 4ZDJA 1H85A 1G6HA 1BRMA 2B1GA 3G49A 3UBTA 3LUAA 1KO1A 4D5EA 2A86A 3UWPA 1IZ7A 5CDYA 1VSVA 3JYLA 1ZYUA 4O4IB 4YI5A 1CUEA 4K8OA 4C7MA 1SZJG 2ODNA 1DBIA 1XQVA 2DJ5A 3B1WA 3L7DA 4HGPA 3ZXYA 2Q5HA 2MHCA 3U16A 2AR7A 3N3AC 1TEHA 3ZE2B 1UD8A 4PGOA 1U0GA 2P9JA 2FXVA 1K88A 3DNPA 3E9CA 3NYWA 3PEUA 4K87A 4PPYA 4DJ5X 5C7YA 1PVDA 3ODGA 4FYKA 3VZSA 1ONBA 5LUAA 2Y93A 1O94D 3A9WA 4UNIA 3LKVA 1KBOA 5AKGA 1X9IA 3KR2A 1U3FA 1UMCB 2ZQZA 3DVRX 3JQ7B 1FNCA 2WM8A 3PQ4A 5G0TA 1JALA 1JHAA 4LFCB 4CL3A 2W6JA 2XEDA 4DOMA 3LGAA 2MMCA 3LX5A 5F7OA 5DNVA 4BPRA 4P4GA 4XRRA 1AXEA 1L5MA 4HWOA 2H85A 5JFTA 5LNK6 1BKYA 5GZ6A 1S4MA 4U9HS 1C0KA 4YR7A 1Y4UA 2P68A 1NF9A 2XOXA 3PLRA 1Z6GA 1ZVQA 4MGIR 4YACA 5CT5A 1C4KA 1OUMA 4YCMA 4FBLA 1T5TA 2GXQA 3ZKAA 4LTMA 3LDHA 1QHEA 1LLCA 1ZD8A 3ZUGA 1W0JD 3U3ZA 4NBSA 4G4JA 4J0JA 5CVVA 2WSSA 2GK7A 2IZ6A 3RTCA 4JB8A 1N0VC 4ZAXA 4MV8A 3DFKA 1A5ZA 5F1OA 3SZOA 3W3AH 4BIIA 3WNDA 1TU4A 2PYZA 3CNLA 2Z04A 3B2QA 3NBQA 3QTBA 4MUMA 5DK4A 5FKJA 2OSBA 2OTLB 1VGRA 2XD4A 4DABA 1N8NA 4NATA 5KNCH 5JS1A 1P3Y1 2QGNA 5JAZA 3P4UA 1CYEA 4GM4A 2X7HA 3LUJA 4AO6A 3CE6A 1XFAA 1D6NA 2BP7B 3D54D 2MMGA 4HWGA 4IUBS 1T1EA 4ZQGA 4Q5IA 4FZ3A 1HM5A 4BP9A 4FE7A 2PKRA 4ESEA 1NQXA 3ILYA 4FI3F 4BEVA 2DUMA 1O57A 2GGSA 2I2AA 4YDSA 3TIXB 2VDWA 5DEOA 1JKJB 1EXDA 1M90D 3I2FA 3ETDA 4RENA 4FDVA 4DG5A 4UVIA 1LC3A 1K5GA 1E5TA 2E0IA 4GO1A 3ONFA 4JOBA 4QX6A 1YZNA 3OPQA 4K88A 4EJ2A 1ECFA 3O26A 2R2GA 1OREA 2FPIA 2GERA 4OYLA 5LLSA 1OTHA 2JKVA 5IVKA 4AC9A 3BL8A 4NG4A 3ZXSA 5NLLA 1BGVA 3FHJA 3VR6A 3TNLA 4UVHA 4P83A 4JR1A 1USVA 1I6MA 4ZVSA 3GZTB 4JLUA 3OFJA 3SC2B 5H3CA 3N2IA 5FAXA 2Z8YM 2DBRA 3H19A 4FCTA 4E1BA 1SCIA 2CYBA 5EMLA 3SZGA 4MA0A 2ZSHA 2O3RA 1CQIA 2F3UA 4MPJA 5TJ9A 2G04A 1UBSB 2VPZA 1GGVA 2C94A 4QPPA 4EM6A 4S1TA 4F11A 5IFKA 2NWQA 1MFPA 2QRJA 3TSCA 3IPYA 5KWJA 5FOTA 3ZLUA 1SUEA 5EAIA 3IEPA 4TKVB 1HXHA 1FRFS 5CA1B 1JHYA 3MQ2A 1LUAA 4UBKA 4C0KA 2FE1A 5BYJA 4IFIA 2O3SA 2QPLA 4CEHB 3IB3A 4JC0A 1TTHA 4CM8B 3V55A 4YEDA 3A3YA 2W2XA 2JVIA 4LJ5A 1P9WA 1D04A 1TTTA 2YYAA 1BNCA 1GZ7A 1B2RA 4CKEA 4JGIA 2NVOA 3ZQKA 1PHRA 1W9HA 2YX1A 3HKEB 4JLNA 4CGZA 3HJUA 5HK9A 4XMYA 1LK7A 2EV9A 4DK0A 4ZKDA 2XRFA 3IERA 1L8OA 1K5HA 1WCV1 3JV7A 4NNPA 4NCBA 4MMZB 1AJEA 3OTIA 1GIAA 1Q83A 3GDFA 3OQIA 3RADC 2WWWA 3NM5A 4X7RA 2QK4A 1RVDA 3SEQA 1HT0A 4MHTA 5EC8A 4RY0A 5JBQA 1SUFA 2BISA 2FPGB 2AG1A 2MSEB 2TMYA 3KT6A 3OWXA 3RSHA 4L9RA 4DPLA 1AKMA 1V5FA 3CKKA 4FKBA 4KUGA 1GTJ1 4IKOA 4KSCA 2F1IA 5ESWA 3U37A 3WHKA 3PDHA 3WWEA 4DIDA 2P9HA 4XEHA 3UMVA 1MG0A 1ZK3A 3ANNA 4Q82A 1ABEA 2RK4A 4FKMA 3ILHA 4NF2A 2J30A 2OL4A 1KF0A 3CA8A 4N4AA 3A6GA 3I62A 1JNXX 2KPOA 3KXPA 3IC5A 3BX1A 1CR1A 3GLKA 4KO4S 2HCRA 2P62A 2BR5A 1TRHA 1U2PA 2FSVC 3I5UA 3MINB 4NZPA 3TLAA 4DM4A 1XVVA 3HKCB 1QK4A 4PLGA 4DV3B 1DL5A 2IHJA 4S1PA 4P35A 2WJVA 4PG6A 1XRPA 5ALSA 5BMVB 4JP8A 4AQDA 5CEFA 1KAQA 3DE0X 1E6MA 3UMGA 4OLAA 1ZJYA 2H54A 4TSRA 4X44A 5T3UA 3HVKA 4F3KA 2O3JA 2WIAA 5KDOA 1INLA 2VNSA 5CDHA 2W2KA 2O8CB 1E61A 1X7ZA 2YWBA 5FI1B 3IEIA 1A9YA 1SXIA 5IARA 3EPHA 1QQ7A 2H1OA 1B6GA 2EYQA 1HE3A 2PY6A 1G38A 1JJFA 2AUMA 1OX5A 2WZBA 2Z2YA 1Z22A 1JEQA 3D7KA 5EXPA 3JSXA 3PXUA 4AJNA 4UMDA 4Z4VA 2X8WA 3C3KA 3F74A 4CG2A 1UWLA 2EL9A 5DNUA 5ALXA 3ROFA 2XD9A 1PGOA 5K9ZA 1VRWA 5EIEA 4DHWA 2HMSA 3GP8A 3F5SA 5K03A 1J1UA 4ZU1X 3ZCPA 4WRRA 1D5CA 1OFGA 1XCLA 3BB1A 5FI3A 1MEEA 2UYGA 4XQGA 3ZU5A 5C1OA 3ESXA 5EESA 1Z63A 1FDRA 3CWCA 2FQQA 3KTFA 2WF9A 2O7RA 1W49A 4L16A 4QGFA 1GEGA 1E7YA 2X0NA 4L72A 5U1PA 1NHWA 4MVJI 2QTZA 3QPCA 3RVDA 3OM1A 4IHKA 3V4LA 2D1RA 4HVLA 3PE4A 1K28D 5CT8A 5J35A 4N7JA 4KB5A 1E7SA 3UV3A 2OD2A 1N5JA 4WGFA 4B2IA 2Q2VA 1SKYE 4LJAA 4DR1B 4CIBA 3LF2A 2CFTA 2XLBA 3GIWA 5JXJA 4LV6A 3F96A 4TXLA 4ZODA 2DMRA 2EHJA 3L0DA 2ZYAA 1A69A 3H9CA 5DYIA 1V9SA 1T5OA 1YB2A 3NHYA 4HR7A 4DKJA 3BWEA 4U4AA 2IGTA 4IXWA 1GV1A 2QROA 2A8YA 4JZYA 3R7WA 1ZNWA 4RVHA 2YXDA 1I30A 3ZU3A 5B5SA 3DEKA 3MF4A 1I6LA 1XTBA 2PMFA 2QTNA 3E18A 4KX3A 3UJ8A 1KI9A 1S1CA 1WUTA 1DQPA 4N3GA 3FVWA 3HA5A 4INJA 2G40A 4JL8A 5CPBA 1DSSG 1NVGA 3B12A 2FOIA 2HPZA 2PWZA 3H8SA 3KO8A 1YL6A 1FNMA 2QAIA 3NWEA 3VNBA 2GJPA 3WLRA 2WE7A 4O33A 1J25A 3R1IA 3RNOA 5AJZA 4JXJA 2NYVA 3ECSA 3NRJA 2H92A 1A2BA 1GZVA 2KW5A 4CFSA 3F73A 2P2DA 2JC3A 1Q7EA 2OO3A 1PYOA 4IJUA 5BNWA 2IOFA 2OXEA 1RHRA 2G9QA 2QRPA 4U2DA 2F43B 3RAJA 5HGXA 2FSUA 2XE4A 1A8HA 4R1QA 1NNUA 2FMUA 2YMPA 2OTCA 2VPQA 3DJFA 4IHJF 4IYRA 3LQKA 3E5NA 5IJ0A 2VDJA 2OXIA 4Q93A 4HKTA 4KXMA 3T7JA 1GADO 3UENA 3CEAA 4U6SA 3PPIA 4V3CA 3JU3A 1Y8QA 3WLIA 2PGXA 2UYCA 5CRIA 3ICOA 5CVCA 1E4VA 5JFGA 3CRW1 4KV7A 4FN4A 4RU1A 3VKWA 1A96A 4EI9A 1MABB 4L07A 3GY0A 5E0OA 5EOVA 5FJJA 5K8UA 3H6HA 2I62A 4EDFA 3WIEA 4DQKA 3CG4A 3DE2X 5E7MA 5AVSA 4KRYA 5B7GA 3PQ5A 1GSHA 3BMOB 5SY4A 2WAYA 3G1UA 2J3IA 5DTIA 5A06A 1P7CA 3HI4A 3M4ZA 2I2FA 1BH6A 5BN3B 3QKSB 3ZU2A 2CJXA 2ZVPX 1RJ9A 1YU9A 1PS9A 4IKEA 3TCNA 2OD7A 3HCWA 1QBKC 2HEIA 2Y76A 4J9VA 5DGHA 5AKHA 5BVHB 4CETA 1CJTC 2EBWA 2CCJA 3UPDA 1DX6A 1NJ1A 1SFRA 4W5OA 3BD6A 2XKBA 1MW9X 4WLVA 5HKKD 4EG3A 3IP3A 1WG8A 1FQJA 4P84A 1V1RB 1AKRA 3H5IA 2WJ4A 1WTAA 2NTNA 3STUA 1XRMA 1SKUA 5HIJA 3URKA 3BFVA 2D0PB 4GKBA 4AO7A 2JLYA 1FJXA 3V8QA 3GOQA 1IIBA 1L7VC 4DSZA 1GTZA 1VCIA 1CG6A 1IHDA 1USIA 1NI4B 1NBME 2IOYA 3MTIA 3CVWA 2XRZA 4E51A 1OOEA 3KJIA 5GV8A 1LSSA 3EW7A 4AICA 1XPOA 3BWYA 2QE7A 5DGDA 3P26A 2QIPA 3LRTA 4YRSA 4Q3BA 1U0SY 1WB5A 4MR8A 2FZWA 2QLMA 4RA6A 2W6ZA 3FI0A 4TTTS 2ZYDA 1BE0A 3DH0A 3DPIA 2HLDA 3F4KA 4FMPA 4RF3A 3UGTA 1ODLA 3AI3A 5SZKB 3DL2A 1MNQA 1YQ9A 2IUEA 3N53A 4NPAA 4GYWA 4J07A 1ZVVA 2EF1A 1AUXA 1HQYE 3HSSA 5GPBA 3E7FA 3RBAA 4CG3A 3BG5A 1YVEI 3AUYA 3I64A 4GPIB 4H18A 4MICA 5H80A 2RH9B 3CC2B 5HXAA 4K05A 2D9RA 3IIJA 4PSAA 2ZK7A 1GGKA 4N0MA 4DQDA 1R50A 1C7ZA 2QVGA 3LKZA 3RSFA 3U80A 4RK0A 1GRQA 4XX0B 1E0AA 1UKZA 3MGGA 5F2OA 1GZHB 2H4HA 3C6XA 3HJNA 3HKDA 3DXZA 3LT4A 3X3HA 5KYGA 1FBTA 3A04A 2OV3A 5LQSA 2LDXA 3KTAA 1IXSB 4GD3Q 1L9XA 4L2IB 3UA3A 1JLHA 2ZL5A 3LUHA 4E1VA 5HXBA 1P62B 1Y98A 4P80A 2WT9A 1Q2UA 1FFGA 1XA3A 1I94B 1GVHA 5J9FA 1RPAA 5BWBA 5KUTA 3R9XA 5ENZA 5F64A 1VHDA 2O2SA 3ZDEA 1BW9B 1B43A 2JH3A 5BSHA 1AKEA 2XSZD 2XT0A 4OHMA 1L4LA 1E9FA 4CIAA 3HKBA 3KE8A 1M73E 2YNMC 3UEOA 2J3HA 2ISCA 2ACVA 2GKSA 3RU2A 1FUIA 1EWVA 2O7SA 1J06A 1N5MA 2J0EA 2I2BA 3NFRA 3KJXA 1U2DC 4X06A 1VHTA 4WXMA 4S1WA 1QGYA 1M6YA 4DLPA 4LC0A 5CLFA 4QOIA 2GPSA 2I91A 5LKAA 1YVPA 1H8HD 1XMPA 5JG7A 1GYPA 3H4MA 1SUAA 2DG2A 2GYYA 3VU3A 2Y05A 3C70A 1N9KA 4PLCA 3F6CA 2D06A 2A1TR 4HXYA 4C4ZA 4DNRB 1GP2A 2PLRA 4H1UA 4BBAA 4E21A 2IPXA 4HAYA 4QPNA 5EIAA 3WV4A 4EF5A 3S5UA 1FLDA 3LQ4A 2BZ0A 3RHZA 5H3LA 1TYZA 4NZOA 2BTOA 1HOTA 1KYQA 1ZBQA 3BWCA 4PLYA 4B6EA 5TPWA 4BZWA 4WK4B 3D6NB 3TTTA 4PHTA 2NO4A 2FHSA 1DAGA 4NESA 3ZGYA 3FDFA 4M2LA 2C7VA 4V0NA 2IIQA 4QO8A 5H5JA 3JALB 5IJWA 1D9ZA 1P1CA 1Z07A 2C59A 1XV5A 3LP6A 5FWDA 3ABRB 4DIBA 4S04A 3E1SA 3PB3A 5ALOA 4CDMA 4NH4A 4Y9RA 3F5DA 2AFIE 4ARSA 2VTEA 1E3WB 1ZH0A 3EXIB 1KS9A 1S5PA 3IX7A 3DLHA 1HE1C 1THMA 4Q3OA 4C4TA 4XIJA 5BSMA 4LZNA 4HH0A 2BD0A 3EMDA 1FQOA 1WEHA 2M5SA 4KMRA 2PLAA 4FC7A 3GLGA 2QW1A 5CB0A 1SK9A 4XQEA 3V3KA 1UC4B 1WAMA 3FGZA 3CCBA 3RU9A 3VH4A 1JLLA 2AJBA 3NYIA 4R6WA 3USZA 3ZHCA 4EPTA 2Q3CA 2GK6A 4X3CA 1E2HA 3D7SA 5CP8A 1N5DA 3KP1A 1EPUA 3DZBA 4HYQA 1NI5A 1BMFD 3E03A 2PQMA 1RXIA 4MRPA 3B1VA 3NOXA 2JI8A 1YFLA 4E5DA 4HRAA 3HZHA 2GCPA 4HLCA 4JS0A 5KJEA 6PFKA 4BNWA 2PSEA 2OCKA 3OZTA 3NX4A 4JXKA 4D41A 1F14A 5JNLA 4GBED 4MPTA 1EDZA 1J8VA 4E5VA 2DHDA 2HSDA 3VOBA 1XRRA 3BKXA 5EMHA 3I09A 1SG6A 5L9AA 3WICA 3FTPA 3Q3EA 1CRWG 3GEHA 1D2AA 3UAVA 2O8EA 1XELA 4A8HA 3OF5A 2YH2A 4BJ3A 4M8LA 1Q19A 3QPBA 1KDZA 4WLFA 1T6YA 2IYNA 4R0VA 4ND3A 1MGOA 1NU8A 5GGXA 1C30B 2QSJA 3M89A 3ONNA 1VQNB 1RI3A 3I3SR 2MR5A 1AUVA 1WVGA 2Q3DA 4N6OA 3HBMA 4E5YA 1CQWA 2PWBA 3THWB 2E2WA 5B1HA 5ADWA 2QRMA 1XEXB 2IEDA 1F7VA 2OO5A 3KQWA 4ZOLB 4WZBA 3QGMA 1NP6A 2KM1A 3IMFA 4IG4A 1FSSA 4JJZA 5LBIA 1W2HA 1JG4A 1NBIA 1GPNA 2AJ8A 4Y2YA 3PIRA 1E96A 1I3LA 1OLSB 4UHCA 4LGVA 2X3UA 5LC1A 3GZJA 5L4NA 2I99A 1WJGA 2Y1WA 3R6GA 4TLDA 2QRLA 4DVJA 4ZP1A 4HGRA 3C5WP 1C50A 1X1QA 5BSYA 1HA3A 1MOZA 2BFPA 3ADPA 3KJHA 3SMVA 3UJNA 2GA9A 5HZKA 3GNTA 4FEAA 5AW1A 5FUQA 4AY6A 1C7RA 4IHJA 3SC6A 3QW2A 3WK6A 1ML4A 3LX8A 4H31A 3SOZA 2FRXA 3JYPA 5M5BA 4IIDA 4BNDA 3TQRA 1I2DA 3RKSA 1YXMA 4TKMA 4OPSA 1NXSA 4K7JA 2OG2A 4ZQCB 5ALIA 1FFXB 4C2TA 1YJXA 4P34A 2DUUA 1K7SN 5ENVA 3L07A 2IYSA 4Q4JB 2PT7A 2DR0A 1BWQA 1XZMA 1L5ZA 5I7UA 2WU1A 3V4ZA 3MGCA 4GVXA 4PHCA 1PFGA 4DL9A 1II0A 3C4VA 4HWPA 4RLHA 1X1EA 4TMTA 2Z5LA 5LOVA 1WETA 2YIJA 1N7HA 4EATA 4FNMA 1MB2A 1SQ0A 1P1HA 3ZUPA 3OJLA 3U9TA 3A0UA 1Y7IA 1BHJA 1DC4A 2IX9A 5AP9A 1ODTC 2RHLA 3VJLA 4AUNA 1P0QA 1NJ8A 3IO3A 2ZRCA 5HEKA 5CDFA 3UG7A 2YJ4A 4GU5A 2A35A 2RFLA 1NQ5A 1P77A 3R3HA 4QBTA 4GQAA 3SS9X 3TNYA 4LY6A 2ZIVB 5CT6A 2IZ7A 4PC6A 2PL5A 2Y71A 1VXRA 4QULA 3IYLW 4WK2B 5ARDA 1GG9A 2JARA 5DLEA 5K8JB 1J8YF 5F98A 4TKUA 3J81k 3TH5A 4OK6A 3AVVA 3T56B 1SCNE 2HZ7A 5FUVA 2G83A 4MWZA 2ZUSA 3F7TA 1L1RA 3DLIA 3HM2A 3PITA 4HL6A 4LWOA 4O1MA 4BKPA 2A1UA 3KAQA 2YVQA 1C9NA 1X86B 2ZJZA 3G8BA 3PS9A 3RUHA 4HDRB 1JEYB 3SNHA 3JWHA 5SY6A 4JUDX 4B34A 4BQQA 5AJYA 4DA4A 1EFKA 2LVBA 3NU1A 3PXBA 3QUCA 3JU4A 2QBYB 4KQIA 2QJOA 3OLYA 4DZZA 3KR0A 3T5TA 3SQWA 3TZEA 2CF4A 3KZOA 2C2KA 4RTNA 2GM4A 1WDWB 3TL2A 4DLRA 1SURA 2VDOB 1PG0A 4PNEA 2FCAA 5I7AA 1J39A 1JAYA 1JSCA 3T3IA 5ECDA 4DNQA 4Y0VA 3K1ZA 1QTIA 3JWJA 4B2YA 3PUMA 4O2AB 1T36A 2HD4A 1EQAA 2ZRNA 4TMZA 3GUZA 3H5RA 4M6WB 4N0DA 1IM8A 1X1DA 4F6RB 1NR7A 3L0PA 1M54A 1H2HA 1TTQB 2VF8A 4I6GA 3D4PA 3T4PA 3WB1A 3ZLVA 3FSGD 2QQFA 5EQFA 2WYHA 5C8ZA 4QDZA 4AKIA 3KEWA 2C57A 2PM8A 2E3JA 5G0UA 2QMOA 2XMPA 3Q1KA 1QYRA 2JCVA 2VCYA 1KARA 1LA2A 2CHFA 2PQ6A 3ND6A 3U3JA 3WMGA 3AOGA 2AYYA 1F2TA 5KTSA 4BQEA 3L7NA 1BPLA 4LOHA 1ETHA 5I4IA 3D7MA 3ONYA 1CYDA 3O3OB 4G85A 1ZQ9A 4X07A 4YV0A 2GZ2A 2DX7A 1Q91A 4WKPA 3I53A 2C0QA 3A1SA 5H82A 5JRZA 1D5WA 5FHQA 2O54A 3EVEA 3IT0A 1G3UA 1W75A 2H4XA 4LWPA 4Q9IA 4BNZA 3LDFA 1YS4A 3H5LA 4JI0B 3KZ1E 2FFRA 1TT7A 1WB9A 4AG5A 1FP7A 2Q6TA 4M0FA 3VI3B 4C0SA 4QWMA 3OT5A 3B5IA 1II8B 1OZFA 1JEOA 1PF7E 2HIGA 1RCUA 3K9BA 1R8XA 2OFPA 3FE2A 3A37A 4QICA 5EWJA 3KR1A 2P91A 2O2CA 1DIHA 3FVTA 5AI5A 4YRQA 3GDWA 4B83A 3VMMA 3EA5A 3O7WA 1Q20A 2EJVA 1TUEA 1PBNA 2VK1A 1LF0A 1PI3A 5JR3A 1MT3A 4JMLA 5BV0A 4FYIA 1W88B 2DPYA 4GP6A 3W9SA 3BVPA 1YKSA 2ECOA 2OLKA 4B32A 1W73A 1V7CA 5F3RA 1SCUB 5M29A 4NR0A 2E5LB 4JWTA 1OAOC 5JCOC 2BDEA 3U60B 3E20A 2QL6A 3PC6A 5JARA 5EERA 2ZCUA 3F6PA 1EFVA 4WWHA 1EK6A 1X9HA 3NGXA 2ZUEA 1W5SA 1WW8A 1MH1A 1R0XA 4GOJA 2V55B 4MGZR 3EQ9A 1R6VA 2G6TA 4NECA 4PG5A 1LRKA 1E6WA 2PFKA 3G8AA 4TMYA 1UFVA 3D2LA 3T5DA 3VU8A 4QJ3A 1VE3A 3NIBA 5I7EA 4M9QA 3VNSA 3WMEA 2WPDA 1Z2OX 3I0MA 2YOFA 3L8YA 1EQUA 5IEBA 3UOAB 4GL2A 2NP7A 2WSIA 2XHZA 1UM9A 1X15A 4D4LA 4ETMA 4AJPA 4UTVA 4JBGA 1G2PA 1MKYA 1DXHA 1TA9A 1JWLA 3UMFA 5EUMA 3I04M 4G26A 1ZA1A 2X53S 2VT3A 1AK2A 3MTGA 3UJHA 4YMGA 2BGNA 3OU6A 1IPFA 4CTMA 4LSWA 4WZAB 1UPBA 2XMCA 1IJFA 3CF2A 2PMKA 3EEIA 4V39A 2Q6IA 1Q16A 4P6VF 2WHPA 1YCHA 3RIYA 4B8ZA 4B84A 2PL9A 1W36B 1VLJA 2ZI7A 3LPNA 1ZOSA 2GKGA 3MTEA 3TMAA 1QOQB 3EVGA 1R74A 3MYYA 3EZ7A 1OSNA 1BXRA 1SC3A 1FW6A 1MX1A 1Y7LA 2PMBA 1EZ1A 5BV1A 1P0IA 2NZ2A 2E4WA 4ENWA 4JVSB 2YN0A 3T7AA 4C0XA 5JI2E 1S2GA 3UJBA 3GPIA 4YGXB 1FYXA 1Y4DE 4I9GA 1XWWA 2G88A 4B71A 4B3MB 1PNTA 4KBGA 5HBRA 3CZCA 3MJDA 1JMYA 2ZS8A 3KQOA 1O6FA 1IQRA 1MPXA 1IY2A 3VYUB 4H0FA 5JROA 4QUAA 4N03A 4Z4FA 1XPUA 4DLUA 1JZQA 2G1AA 1EESA 1JFVA 1WCIB 3P45A 4P3NA 3TSAA 2PUGA 4ROTA 1U8AA 3JVDA 4LOJA 3CS3A 3WSWA 2I03A 3I5XA 1IB6A 5KOHB 2WICA 4X8OA 3QE3A 4I8XA 2BJHA 4N40A 1I3KA 1U98A 3MWDB 4K6MA 3BY2A 4C29A 4QUGA 5AW7A 3ZG6A 4EUEA 5KAPA 3VR2D 2RGXA 2J59A 6NULA 4MCIA 3UB2A 1DUSA 1E5VA 1QB8A 2ZI6A 1ZM3A 2C2OA 3E3LA 4M49A 2NUPA 3UO8B 2VAVA 3NBXX 3VU0A 3EPPA 3PCXA 4C07A 4Y7DA 2EX4A 3SU8A 4DFDA 2NPIA 2X9VA 4AS2A 4P08A 5AK6A 3TWOA 3FUXA 3PT9A 1IMJA 3O83A 4TLLB 2HDNB 1KSGA 4CMCA 2BMJA 3FETA 2VZ9A 4IHQA 1I32A 4X24A 1ZGHA 3HCOA 5EIHA 3RUIA 3PFFA 3MSXA 2XDWA 2YINC 2IL1A 3QWFA 1TOAA 3PHLA 4UAUA 2XJ4A 2WI8A 2CYAA 3G9UA 4L85A 3PNPA 4U6QA 1L0BA 1M10A 1G4UR 1WD5A 2IIVA 4A16A 1O0BA 2VWQA 2EJTA 1E1DA 3RFTA 2ZATA 3ZCTA 5DBOA 4IDCA 1GHTA 2SICE 1H42A 1TNDA 1A8PA 1U99A 1WMBA 2FE4A 3VHLB 3EEYA 2ZE5A 4PS0A 1AQUA 1CHDA 3DUFB 1URPA 4YJFB 1KS2A 2Z8ZA 3PC8C 2AWOA 3DZGA 1VHJA 4OLBA 3RSQA 1RXYA 4UHBA 1BJKA 2JA1A 2DCUA 2FEXA 1PWXA 3OLXA 5IC6A 1E1YA 3SXPA 3U7JA 3ZWXA 3SG0A 5AVWA 4V3BA 1MG5A 2R1VB 2XNDA 3AQIA 4G6IA 3OOJA 5JS2A 4C3ZA 1NUHA 2B98A 2GARA 3GFQA 2VTBB 4CE6A 1SA0A 1OH6A 1Q7BA 2PVPA 2N9UA 4CKCB 2XRYA 4WZZA 1ISIA 2ZRBA 3R7SA 4TQ9A 1W0KD 1VJRA 3VR5A 1HZZA 1PJZA 4ESHA 5B37A 1O4WA 3L1KA 5IX8A 1AHIA 3GQBB 2E89A 4XWKA 1TRKA 3OPNA 4NXMB 5FADA 1VPWA 4EGFA 3DVSX 5JSFA 5G0SA 3ZDBA 4IBOA 5L7TA 1VQ6B 2WNHA 5KKAA 4JP5A 4B6QA 1H3EA 2FK8A 5G4LA 2C4TA 4PGHA 4EKNB 5B7PA 3A32A 3E3OA 2H2HA 5CT9A 1PJAA 3DEJA 2IYZA 3RLIA 4OJQA 3VDXA 1OX6A 1GJRA 4DKXA 2R00A 3FCYA 1YIAA 2XTMA 3OIFA 4TS9A 3V3TA 4AJOA 3IJ5A 4OGKA 5BN5A 4G5GA 1VPVA 3GN1A 3IVGA 4RF5A 3ZBUA 4K6CA 5A0VA 4CV2A 2FPRA 3CPHA 2PD6A 1RU3A 2EBUA 2D5LA 3Q5GA 2GM5A 1E4EB 1VE5A 4IWXA 4UNPA 3QYAA 2PBZA 4BFYA 3KPVA 2O1XA 5JATA 1T15A 2W4MA 4JU8A 3ZQJA 2I8AA 1TVKA 3ICEA 1HKHA 1KAGA 3CONA 3ZE7A 1OV4A 3JRXA 4NYMQ 2TS1A 4YPOA 2JFNA 4EA8A 1BG6A 1ZRNA 1FB5A 3H4VA 3TPZA 4F4DA 4QLBA 4K86A 1LK0A 1NOIA 1IBRA 2VYQA 3PXXA 3CNNA 3BCFA 2QX9A 3DE7X 2O50A 3FB1A 4HQFA 4A0HA 3CTMA 3LG2A 1XPRA 3N07A 3EPJA 3CH7A 2EKDA 1M67A 3KLOA 1TCAA 3O4JA 2ZM6B 4NEGA 4Y2GA 2I2DA 1XCPA 1JDNA 3VC3A 2I71A 1CULC 4G5OA 2Z6VA 3QMPA 1NVKA 3WADA 1SUBA 2WG2A 3WK4A 2FPUA 3SLDA 3BDIA 3PX7A 2WK1A 4R68A 1E2BA 4EX7A 4WQMA 1UK7A 1XZCA 4BNNA 3KOMA 1D8AA 1QHSA 2MYUA 5ITSA 2W6JD 3EZGA 3BTVA 1Q1GA 2VJMB 4GI7A 1WM1A 1N7GA 2YUIA 2P4HX 3NV7A 4J0GA 3EUAA 1CBUA 3IUSA 2WSBA 4MRAA 1VQ8B 4A6PA 3ZHVA 1C1YA 4DA6A 2PNFA 2ZSDA 4YDRA 3FWYA 3WYDA 1YDGA 3A2NA 2GZAA 1NWCA 5FQNA 1NX9A 2NZXA 2PGDA 4U2FA 3G0CA 3VPAA 3FYDA 1XZKA 2VPTA 1Y5IA 4WECA 2IXTA 1IWBB 1FNSA 2YDYA 3JQ8A 4DBLE 2BGLA 2ZRFA 5JV5A 4UM8B 2JGNA 3ISJA 2XDQA 3GNLA 4RKWA 3NIFB 2V6FA 1L1QA 2G0TA 4V0RA 4G8JA 4P4UA 1DU4A 3KB8A 1D2CA 3BUSA 4G5SA 3SX2A 3WDKA 1JTVA 2OHVA 5JSZB 4LF7B 1WUJS 1E2JA 5AIBA 1T5HX 2H2AA 3T7CA 4LFBB 4OYYA 3UKJA 2PRZA 3H1TA 4JENA 2B1RA 4LQDA 1W4CA 3UM9A 3USCS 4LK3A 3DP7A 2A3NA 4BUZA 3D7LA 3L8ZA 5A3RA 3SP1A 3YASA 4DR6B 3Q11A 4Y9UA 2Q4RA 5ALRA 4L8VA 4KQJA 4B3GA 1NY5A 1ECJA 4TGLA 4L8WB 3A6PC 3B9QA 1GUZA 4H59A 1TM3E 5ALGA 2FMKA 1WL8A 2VWPA 2WJZB 1J1ZA 3CZ5A 2IH5A 2RI6A 2V7EA 2VT2A 4KSBA 4RZ3A 4LJ7A 3IULA 2Z1MA 1KO8A 2GYWA 1ZK0A 3X2FA 2RG7A 5EJIA 1GNPA 5IJXA 1J23A 1Q1BA 3E9YA 3NUGA 1VZ2A 1EINA 5FWAA 3L8HA 3BY1A 1NG1A 3A1UA 2HRDA 3O94A 1AN9A 4TRNA 4KUHA 5FPYA 4OIFA 4EPWA 5LIPA 5AXCA 5FBLB 1H4QA 3A2MA 1EB8A 1ZK1A 2XAAA 5C0OE 3DF7A 2CV0A 2XNSA 3LVRE 4UQLA 2B1JA 3LQRA 4A8JC 3BWBA 3FDZA 5LQJA 2DPXA 4BE4A 5A5FA 2Q4TA 1QFSA 5AW3A 4JUCA 521PA 3IH5A 3UAGA 4YP1A 1S8NA 4LVNA 3GJ0A 4IDFA 1GAJA 2JI6A 2P4UA 1PJTA 3CXCB 3NYRA 4EG6A 3JPWA 2EX0A 4HTFB 3EIXA 3U1TA 4RTRA 3SZMA 1XTUA 5FBWB 1N75A 1LTHR 3CLTD 3JR3A 3HVUA 5CUQA 4C30A 4CMIA 1T1JA 4ZN6A 3W5BA 1MJGA 2B2NA 2I3GA 1SKYB 3LHFA 2HHAA 5EKUA 3Q40A 4K3UA 3E3AA 4X65B 4M1EA 4AJEA 2Q5FA 1QSGA 3H1FA 1K4KA 5G53C 3QMWA 2WRZA 1TL7C 5DK6A 2HHLA 4PINA 1NN0A 3O0DA 5K20A 1KO7A 1LNZA 4KKTA 1LW7A 4CUKA 3BOSA 5DM60 1JT2A 1H93A 2D13A 4QVIA 2W48A 2GM9A 1LPBB 1K98A 4AJKA 3O74A 2OBTA 2EDAA 3J80A 1ZLYA 1BHSA 1M1NB 1L7NA 2IJGX 2PSHA 2WB2A 2CE2X 2VBVA 3NR2A 5HQJA 2R8PA 4QECA 3WE7A 1FMJA 3KAKA 5ALLA 3H5TA 2Z1NA 2XQGA 3RYIB 2GRUA 4ZIRB 4ZDKA 3PGXA 3FKSA 4ZMRA 2V54A 3GMDA 3LNTA 1NM5C 1EZZA 3L82B 3WGMA 2FWJA 4AMZA 4W9NA 2C29D 3RC3A 1W47A 4RACA 3NDRA 1ULBA 1BXKA 1BAPA 3ABZA 2XGOA 2A5LA 3GF4A 3OFVA 1EFPB 3LY9A 3PXAA 4X3PA 1U7WA 1NF3A 2WC1A 2IP2A 3MOGA 1QE0A 2WB4A 4N3NA 1W1UA 2IHVA 1DIOB 2WJGA 3P0RA 4HAWA 4HX9A 4PBTA 3R75A 3R0VA 1FX0A 5K8IA 1K4YA 1BCSB 2GFIA 4BQFA 4JXZA 4UOEA 1IHMA 1KO4A 3CBGA 5J5VA 3VYVA 2I7TA 4B33A 4DYVA 4EQ6B 4HNHA 2ZW9A 1QIIA 3QTLA 3F6YA 3ORQA 2OORA 4BU1A 2C3PA 3OU7A 2IPMA 3BJIC 1AS2A 4S1VA 3WWCA 1NVAA 2IPLA 4EP1A 4IVQA 4FGJA 4RVDA 5G0WA 3HM9A 1GFIA 2ATIA 2H7VA 2JHFA 1ORRA 4ROSA 1A50B 4L3VA 3ZCSA 2V31A 1DG9A 3PUNA 3AR4A 4FJ2A 1Q7GA 2X8AA 1PL8A 1PZFA 1XDSA 3SLGA 3N0VA 8GPBA 1Q1EA 1H0KA 1V5WA 4Z9FA 5IYRA 4RDJA 5AUPB 1SD5A 5EJMA 1PT9A 3R8CA 3ZLTA 5DH9A 3UB3A 4UULA 4ES6A 1T6BY 4PIVA 4QVGA 3ZTWA 1UBMS 1DWOA 3WRYC 1VPLA 2V1UA 3PGA1 3F7NA 1V41E 3C6ZA 1R4MA 3H13A 3H9EO 3KOXA 3OHMA 4RABA 1RJGA 4PTLA 1G20E 4TTQA 2B8WA 5AIAA 3MBIA 1XKLA 3AV3A 3ILXA 4M1TA 1E6UA 4PQRA 3LT1A 4UC0A 5FA5A 3IOBA 5I9IA 2ENWA 1ZL0A 2DZDA 2C4NA 4QDJA 4H1HA 4UE6A 3TLGB 2B5OA 2GEJA 4OQXA 4BP1A 1E1RD 4EKEA 2FFBA 4DIEA 4PV7A 3WGQA 4MDEA 1EVYA 4NYJR 3EEOA 4ZCLA 1M2OB 2GB4A 2QORA 2SKEA 3FDXA 2A4MA 2H07A 3Q7RA 4OLFA 5EPUA 1ACLA 5DGTA 1RXWA 4CIWA 2D3WA 1J0CA 3ZWMA 3TE6A 4ND8A 5CFLA 1MDBA 4U2KA 5MN5A 4Q37A 1KZ4A 3ZTTA 1YJBA 2VRBA 3E8MA 3SAJA 3RK1A 3JVVA 2RDMA 3UGQA 2WZQA 3WL4A 2HZBA 2HSZA 1QTNA 4B3XA 2VTDA 3SYKA 4BKQA 4ZJYA 2WDPA 1YVDA 2IE8A 5C7LO 4H7FA 4FFBB 2PMEA 4XTRA 3RS7A 3UUWA 1G2QA 1HEIA 1XYVA 3NOVA 2G1UA 3ZX4A 1JFRA 2CSUA 5JMOA 3AHJA 4WEOA 4F91B 2C9DA 1JDJA 2NSLA 2VUIB 1QHYA 2I4OA 4KW7A 1S02A 4KXVA 5E7QA 4M89A 4EUKA 4UVDA 3X1DA 5H8WA 2X9LA 2EWMA 2AI2A 4ZOAA 3GLGE 1V8BA 4GMHA 3RR2A 5TRTA 1WSRA 1TJ3A 2JGDA 3F8WA 2B8EA 3CTAA 1QHHA 3JAWA 4U63A 5T41A 1SVLA 4WAUA 4M8NE 1JN0A 4UZFA 3MXTA 4JLKA 5CA0F 1C29B 1JB9A 3FWPA 5C8YA 1RHMA 3G4SB 1F2UA 1A97A 1YIOA 2YWXA 3LOPA 5KWSA 5KYTA 5A0TA 4QYXA 2X3YA 3BK7A 2UZAA 1I6WA 1F1JA 1XAIA 3KJEA 2XGMA 2VP5A 5EZQA 1AURA 4RPBA 1YR9A 3H0KA 3LLVA 3UTCA 1N57A 4FTWA 1FFCA 1GLNA 3GBSA 4BNVA 1BA2A 1MQ8B 4Y6RA 2VT7A 1EFDN 4NV0A 4IVNA 1JMVA 3HDHA 1DG1G 4K9QA 4DRXA 1Y33E 3DB1A 3DDWA 3LS2A 3SLKA 2P8JA 5HIAA 2EATA 3BB4A 3MERA 4YUYA 3BH6A 1P7VA 4F45A 3QWAA 3IKVA 3CKLA 5TPZD 3CT6A 4REOA 2PUJA 4R1LA 3ACCA 2P90A 4KK3A 4PG8A 3G0HA 3ECAA 2BVNA 4RX1A 2OC4A 2E4YA 3AOEA 4WVFA 3DVAB 2RI0A 3HWX1 4DUZB 2DSTA 1M0WA 1EI9A 1T9CA 4B74A 5EJ8A 2H0RA 3IR7A 2NO1A 4QJ5A 3IBTA 3T4EA 3DMTA 5JVDB 2J4DA 3B1KA 1GDDA 4TMKA 4KYTA 4MVYA 2HA5A 3ACBA 3FUVA 1TIKA 2ZJBA 4W9MC 1XWFA 3DC2A 4KC0A 2X7JA 4Z3DA 1RJDA 2OUKA 3JQGB 2BKVA 2W71A 1GRCA 3COVA 3D8BA 3S27A 4QXAA 1Q1NA 3HBJA 1NJ5A 1Y4SA 1G6KA 2H4FA 1UOOA 4JB3A 3VNQA 3RYCA 1BWRA 4OHWA 2XTZA 4CBVA 6GPBA 4KQFA 1TD9A 3S70A 3HFSA 3DTYA 4DUYB 5FBVB 2J3MA 4AG6A 5B3AA 2J4FA 4DJAA 2AFIB 1RQGA 2VDRB 3MGKA 5I7VA 3ZHBA 3CVUA 3C1AA 4D8WA 4E2WA 2RGEA 2OCLA 5LFAA 2DWUA 2F1MA 2VXOA 1YRWA 2H8GA 5D8DA 4KXYA 4P6YA 1IUPA 3K6JA 1JFFA 5AVOA 4OPMA 3V32A 1E7WA 3T15A 3RT7A 4JU9A 2J9FA 4L0CA 4RV9A 4BL5A 1U7UA 1D2NA 2IF2A 4QGAA 4DAEA 4EG0A 2VSNA 3L0YA 4Z7NB 4W5TA 1WD7A 3H1BA 2HLDD 3NBYC 3QH4A 4PGFA 5K0ZA 2XZOA 1RDFA 3FMOB 3DEHA 3H99A 3TR0A 4B3HA 4BX8A 1W36C 1U0OC 2IZ0A 4DR4B 2XPCA 1LW6E 3C7AA 3DV2A 5AW9A 1U9IA 4G5YA 3TG8A 2P6NA 3HV0A 3OIGA 3OO1A 4X85A 3BRWA 5DTJA 5TEVA 3PDUA 3WGOA 3BC1A 5GAJA 1LU9A 3G5TA 4F8EA 5JJ5A 2H5EA 4XPIB 1AKNA 1JSXA 4HNUA 5I7OA 1XE3A 4UVGA 3HVHA 5DB4A 2C8VA 3WGVA 5L7WA 1K3TA 1TE2A 1JVNA 2WUFA 4G41A 4GOOD 3P27A 2BHSA 4M9ZA 3HXKA 1G1MA 1BFUA 1P44A 2AI1A 2V98A 2WAAA 2W8ZA 2X5NA 4FGKA 4MQFA 4ER3A 4P32A 4TLAA 4TZ6A 1ZKDA 5ESXA 1W85B 3EJWA 3DDSA 1SEVA 4HB0A 4YRMA 2R1TA 4JUIA 3WAGA 3OURA 5E6UB 3WA7A 3M70A 5ALFA 4QBFA 1U7TA 4TS4A 3G2HA 2HSJA 5MN6A 4COKA 3VU9B 5G4KA 2D2FA 2IXDA 2A30A 3K1AB 4KQGA 3WRVA 1PJCA 2WABA 5CT4A 4ODIA 2ZITA 3SZ3A 3GVKA 4XORA 2J7KA 3AUTA 4NAVA 3ZCRA 5CMLA 5G3ZA 5LZ7A 1D6MA 3RC7A 1QOZA 4GM1A 1AKWA 4ND1A 3MBKA 2YJ5A 3GIDA 3JQFC 4JBLA 3KK0A 2VRCD 3G02A 3GO4A 4L9SA 5CM2Z 5LN1A 1R0CA 4DCVA 4Z4GA 3G59A 3I6ZA 4LNUB 4AECA 3B3GA 5K3BA 1Z15A 3TBHA 4NBNA 5JWOA 2PPLA 3U61B 4TM7A 2TECE 3WSVA 3I28A 2LP4Y 3STYA 1ADFA 1E43A 1UXOA 2QZ9A 2RHGB 4Q12A 3ZV6A 3A6JA 1M7GA 4H08A 3KV1A 3M1LA 4R9SA 1OZAA 2IKQA 3ENZA 1XCMA 3RHSA 1CY1A 4IIVA 2JIQA 2G63A 1XAJA 4P3YA 5A88A 4JX9A 4Y0AA 4ZVMA 3SF0A 1QH1B 3OQJA 4O4JF 4B4WA 1E1QA 5T8KA 4HN2A 2UVQA 1VL1A 2VH2A 1KPHA 3ZZUA 3ETHA 5U9CA 2VPPA 1TA4A 3E0XA 3GCZA 1V48A 1GZSA 3AWIA 3LBHA 4MS1A 4RH1A 4TYMA 2GHQA 4EB6A 3R7NA 3WTBA 4OUDA 2FYTA 1Z29A 4GI1A 1BEEA 1JR4A 3BH0A 2QW0X 3DCJA 3JD4A 4I1UA 1EFUA 5A4KA 1E62A 3VZDA 1IBMB 3VSCA 4GP9A 1JEAA 2J9XB 3DWFA 4TYPA 1D0IA 2H6EA 4I46A 4LSGA 4R3WA 9LDBA 3ADCA 2LUOA 1KOJA 3DM9B 4MWDA 2NSDA 3P9XA 4GGOA 4TS3A 4MP6A 2CL7X 2C3YA 4IFTA 2R5FA 1U65A 3LQEA 3BHJA 3GHHA 4F71A 2XNJA 3Q8MA 1UDAA 3TQIA 1DJLA 1VBFA 1C9KA 4LMBA 4OBBA 3ZCXA 1AGPA 3WIDA 2ZYWX 1QMGA 3WZ2A 1QTQA 1CJKC 4GEKA 1TKCA 2I66A 2X76A 4PBSA 2X0DA 3FHLA 4ZT3A 1C7JA 3LYHA 3U40A 4BLSA 2W6ID