3W5VA

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
297
structure length
297
Chain Sequence
KCSKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
total genus 86
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5vA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5vA02
4P3YA 2BGIA 4Q7JB 3AVYA 4LBWA 4F7DA 3I55B 1B23P 3MCAA 3CC4B 5H59A 4M4SA 1KC8D 3CCJB 2YWHA 3ZZTA 2OK8A 3OZWA 4G1BA 1AIPA 3ZBUA 3CW2A 3WBKA 3CRZA 1Q7YD 3AGQA 4PC7A 4FWTA 1NJID 3W5HA 1VQPB 1FNCA 1J9ZA 3JQRA 2YWEA 2DCUA 1TLLA 1S72B 4ZGNB 3LYUA 1CNEA 4LBVA 3CCMB 3I1FA 1KJZA 4N3GA 3P27A 5AN9A 4BPRA 3CCLB 1KQSB 2ZITA 3W5VA 1YJNB 1VQ9B 1FRNA 3W2EA 4IW3B 2FX3A 4RD3A 1F60A 3WNBA 3V76A 1QVGB 3OJXA 1VQ8B 4B4DA 1KK2A 1QG0A 4MYUA 2XNJA 1R5OA 3FPKA 1FRQA 3AVWA 1H42A 3QFSA 2XNCA 2QEXB 1EP3B 1W87A 4M2LA 1YITB 3SJZA 4H9GA 1JJ2B 2NPFA 4YAUA 3VNVA 2DY1A 4ACAA 3CD6B 1QGAA 3G4SB 1G7RA 1EFUA 2VNKA 3G6EB 2CRVA 3FJOA 4RJLA 3U6BA 1VQ6B 3U6KA 1M1KD 1DDGA 1KRHA 4RCYA 4G1VA 2QN6A 4PC1A 3WNDA 4YHBA 1TTTA 1YJWB 1QGYA 1BX1A 4YAFA 3VO1A 3WXMA 4ZGQB 1U2RA 1N0UA 1HA3A 4FN5A 1ELOA 1D1NA 3CCRB 5JBQA 3QE2A 1VQ7B 3WNCA 4RD0A 1GO2A 3B8HA 1QX4A 3CPWB 1Q86D 3B82A 1FNBA 4TMTA 3CMAB 4Y9UA 4Y9RA 2XEXA 1VQMB 1K8AD 1G7CA 1CNFA 1IB0A 4R71A 1KD1D 2VNJA 2DETA 4DQLA 4LBYA 1GAWA 1D2EA 1N0VC 4TMWA 1KK1A 4B48A 3E1YE 3CB4A 4ZCLA 2DERA 2VNHA 1GR1A 1QVFB 3LRXA 1G7TA 2YWGA 1W2BB 2HCJB 4TMZA 1VQ4B 4PC6A 3AVTA 2RC5A 1TUIA 1GVHA 2C78A 3LO8A 4K1XA 5EMNA 3VNUA 1E64A 1BJKA 1F20A 4Y7CA 3ZBTA 5TY0A 2BMWA 2BF4A 2BVNA 1KK0A 1I7PA 1KK3A 1OGJA 1FNDA 3B78A 2BV3A 1JNYA 1EFCA 4ZCIA 5HXBA 3OJWA 3WYAA 1VQ5B 1TVCA 4PGOA 1JA0A 2BM0A 4QHYA 2J7KA 1EWYA 3CCSB 3MMPA 1FDRA 1EP1B 3ES9A 5DSZA 1ZUNB 3VO2A 3CXCB 1M90D 3VMFA 4B44A 3J81k 1WDTA 2VNIA 1GJRA 4B47A 4HE6A 3ZZ0A 3JQPA 4RD6A 2EIXA 1DDIA 3ZZUA 2VZLA 1CQXA 3W2FA 1Q81D 3LVBA 4J0QA 1IJFA 3G71B 1W34A 3OZUA 2QA4B 4RD4A 4NCNA 2PMDA 4RD2A 1XE1A 1S0UA 2OTJB 1QFYA 1SM4A 5GV7A 4U9UA 1N8RD 1VQOB 1OGIA 2R6HA 3AVXA 1YIJB 3OZVA 1OB5A 4NBSA 4YALA 1EFTA 2AHOA 3CC7B 1ZM3A 4N3NA 1R5BA 2CNDA 1D8TA 1K9MD 3PENA 2VYQA 2HMAA 4LBZA 5THXA 2GPJA 4YAWA 1E62A 3JQQA 1QFZA 3QFCA 5GV8A 1QUFA 2PLFA 4WQMA 4M53A 1QGZA 2QTLA 1A8PA 1QUEA 1W35A 2RC6A 4QFMA 3CC2B 1IJEA 1YJ9B 1YHQB 2OK7A 4DQKA 3W2HA 3WBJA 2QDXA 3W2GA 3W2IA 1SKQA 2EFGA 1H85A 3AVUA 2GQFA 5TR9A 4P6VF 4C0SA 1VQKB 1DARA 3QFTA 1JA1A 3CCUB 2BN4A 3OW2B 1EXMA 3I56B 4RD1A 4C43A 1R5NA 2BGJA 4ACBA 4AC9A 3AVVA 4MYTA 2X3UA 4FK8A 4TMVA 1VQNB 2C77A 4ZV4A 2BPOA 1Q82D 3WY9A 1QH0A 2OTLB 1E63A 3A1FA 4G5GA 3E20A 1G7SA 3W5UA 1GAQA 2DEUA 5FA6A 2B7CA 1FNMA 4RCZA 3ZC3A 1EP2B 3U2QA 1BX0A 2QTZA 1VQLB 2BSAA 2YWFA 4YAOA 4AF7A 4TN1A 3P26A 1DG1G 3QSYA 4ZCMA 4M1KA 1B2RA 3CCEB 1BQEA 4TMXA 1QFJA 4UAJA 2B5OA 1NDHA 4EH1A 3CMEB 4M0LA 1XB2A 3CCQB 1AMOA 2B7BA 4HE5A 5KSWB 1OB2A 3AGPA 2BM1A 2D74A 4LC0A 1JB9A 3CCVB 4PC3A 4B3XA 3QFRA 5H5JA 2E1RA 1UMKA 1YI2B 1ZM9A 1ZM4A 5TV2A 1K73D 2HDNB 1ZM2A 2PIAA 4B43A 3MHPA 1KTVA 4AF6A 2QMUA 4PC2A
chains in the Genus database with same CATH superfamily
4QO8A 5KNBA 3Q12A 2BFFA 3Q72A 1SNYA 4MYRA 3GN1A 5JNWA 2F7SA 5LZ9A 2FPWA 4HDCA 5AKYA 5EZYB 1HETA 4QJIA 1B8PA 3AETB 5CYOA 2R65A 5IXJA 2NO7A 4IDHA 3WGKA 4YMGA 2JLWA 1USUA 3ZIAD 1QTQA 4O5OA 1YC2A 5JY1A 1T0PA 2C2KA 4K2AA 2C61A 1QF7A 1Y89A 1Z6GA 5DBFA 1GZ6A 4DJEC 4M4SA 1D0IA 4GXRA 1G6KA 3TZ6A 3E3LA 3KJGA 4NMXB 4Z8XA 5K5EA 3WGTA 4G1BA 1MO5A 2XQKA 2WK1A 1KZHA 1P8JA 1SCAA 2HMVA 1U9ZA 1E3WA 3THXB 2W2VA 2YHUA 3HA2A 2Q9CA 3AUTA 2YBEA 2A9QA 4S1PA 3O47A 1PFVA 4NPAA 3IAAA 1RQPA 4WCFA 3UF0A 4AS1A 1F9EA 2VWPA 3E15A 1Q11A 1DBVO 4FWTA 2VZ9A 3L6UA 3DDHA 4HNHA 1WWKA 2VQ6A 1BG6A 2R2GA 2UV8A 3E7PA 4H0FA 3T1OA 4OQZA 2C5HA 3HV2A 1RZVA 2GPYA 2DCUA 1YUMA 2E4UA 2HO5A 3P0JA 4JMLA 1TIBA 2ZQ5A 4ZC8A 5BWNA 1Z56C 1YE5A 4G5OA 4OI4A 1LPMA 1KDTA 4HYYA 2RCYA 4J0KA 2WD9A 4NCHA 4XGRA 2Y05A 3RIHA 2IOYA 1KZ4A 3P27A 2OR3A 4NBVA 5BYAA 4M38A 4QBHA 4A27A 5G53C 4EI9A 2P0YA 1N08A 3WL4A 1GQYA 3PPVA 1KQSB 1DUVG 2I4LA 1HE2A 3GJQA 3MWEB 3P94A 3M0EA 4FYXA 1YJNB 1VQ9B 3SQXA 1M72A 3ZVLA 4UTOA 1H2EA 2PVSA 3BICA 1ZXLA 4G81A 4J0FA 1MG0A 4N9WA 2Q4TA 3ZPNA 5HGXA 4M0EA 1QTNA 3CNHA 3TSZA 3MB8A 5HBGA 3R7WA 1VP9A 2UXBB 3G7UA 2O5CA 3IE0A 4Q16A 3VO8A 2IUEA 3MGKA 5HP4A 1MW8X 2P77A 5IYZF 3DMYA 2JBAB 1XVLA 1QVGB 3IT2A 1I7DA 4BPBA 5BV8A 1P0PA 1NVGA 1VQ8B 1C0IA 2OBSA 2BFCA 3QMWA 4TUYF 4V39A 1YZQA 1R6DA 4L2IB 3UYKA 1XRPA 2WZQA 3F97A 2XODA 4RKQA 1V37A 3ZJ5A 3ER9A 1NYTA 5H1YA 1FLDA 1KIFA 2HRRA 5K3AA 1B6SA 2NU8B 4K28A 3MJTA 1FX0B 4W4TA 3RJ9A 4DLKA 4L4SA 3KSZO 1ZUD1 2ZT8A 5I8ZA 2F8LA 4QJ5A 4B82A 2QEXB 3RU2A 2YVAA 3KYBA 2O3TA 1C50A 2EBFX 3F6RA 4N03A 5AM4A 1AKVA 1QHFA 1RMTA 3PDIA 2GRUA 2O2SA 5LOVB 1X8KA 3H2IA 3H5AA 1LZKA 3CSDA 3KOZA 4ILKA 5SYMA 5IEJA 4FIDA 4LCBA 5DN9A 1WP9A 4WLUA 1NBEA 4NESA 2HT1A 1NMYA 3B12A 3NHPA 4KN5A 1KORA 1J0DA 2Q8NA 4KXLA 1Z2CA 3K9WA 4KE9A 5G41A 4C76A 5FBQB 3L8FA 4DG8A 1KO4A 5CVVA 2C1XA 2W8BA 3BAZA 4LCJA 4UPDA 4CT4B 2IX3A 1H6AA 1Q20A 1B76A 1XZCA 3HNRA 1ZM7A 5DGTA 1WXWA 3ZU4A 3O94A 3AP1A 3QUQA 4C5CA 2XZLA 1J39A 3K09A 2EHJA 2REQB 5BQFA 1TYDE 1W94A 2QNIA 1OV6A 3C3EA 3GYGA 4JLAA 2FSUA 2C9OA 4MS4A 3LQRA 3P20A 1DAOA 2I1VB 2AR9A 4MIYA 1DDGA 2QQGA 2WNSA 4O1MA 5HX7A 2HJWA 1L5RA 2JFWA 1K1EA 2WIFA 3BSFA 1ZH2A 4B09A 1I2DA 3FDIA 1PJ2A 3I1JA 4FZJA 1T4CB 2Q1XA 2RJOA 2NSHA 1QGYA 5AICA 4TTRA 4YONB 2BUCA 2B35A 4JBLA 3L5KA 3QVTA 3A0RB 3STHA 1QP7A 4C4OA 5JLAA 3CUYA 2XMPA 3MCWA 4BVJA 5JO0A 4H4CA 4J16C 3JTEA 4F84A 3K9QO 4L75A 4B8YA 5K09A 2A88A 5J2TF 1UD5A 3WZ2A 1P74A 4RD0A 2IYVA 5J2UF 1J8VA 3PXAA 4G3XA 3WKEA 3BMXA 1NWCA 4D0SA 4GDMA 1L2TA 4AX8A 2IK8A 5F3WB 3QEBZ 2QR2A 4BO6A 3QYJA 3TFWA 1Z36A 4ID9A 4ONEA 3N2GA 4QVJA 3E5MA 3CPWB 2NV4A 3G5MA 3QV1A 4TTIA 1NB0A 4A7PA 3S4YA 2OYSA 1PL0A 1XMJA 2HJ9A 4CYMA 4QTYA 4FD2A 3VR4D 4UXIA 4Y0NA 1PNTA 4EA6A 1XQ1A 4C7OB 3KJFA 5IBQA 4KBFA 1QQAA 3QU2A 4X07A 1H8HA 1PEYA 1P1JA 2AEFA 1HV8A 4J3JA 5KYUA 4MA5A 5G0TA 1OYOA 3HGMA 1J1IA 2VK2A 4LS3A 3AY3A 1OSNA 4AS3A 1GL6A 1E89A 4POOA 5J2TA 2QX6A 2X41A 4JD5A 5G3ZA 3B7WA 3SDBA 3TOZA 1IBKB 1I3MA 2PYIA 2YYSA 4BBPA 1DCKA 3L6BA 1FPMA 5F12A 4GOLD 1IMOA 1TYEB 2I8CA 2VL7A 3ZWCA 1WPCA 1J09A 1NM5C 1D2EA 2PN1A 4R2LA 4ZRMA 2QUJA 2O1XA 4HS9A 3DD5A 3RS7A 1JSCA 3TQHA 3LUAA 3VR1A 5LDGA 3B36A 1FDOA 1RD4A 5HEKA 4HO1X 5I9TA 1J4AA 1F4LA 2Q5OA 2IP2A 3P9XA 1XG5A 2OQRA 1QF6A 3SVZA 1A2OA 2JK1A 2ENUA 2PY6A 2OAGA 2JGIA 2M2IA 2ZPUA 4FFMA 3ZE8A 1SA0B 2D0DA 2EVWX 4Q3DA 3VSDA 1VQ4B 4GLLA 4YI5A 4B3SB 2PQ2A 2ZB3A 5AW2A 4GMXA 2P4UA 3UBMA 3AI1A 4UM5A 3WGZA 1FVOA 1XPUA 4BLTA 3LWNA 4GLOA 1WV0A 3JZAA 1V3TA 3W3ZB 5C37A 4E1AA 2IEAA 4RTPA 4MW9A 1SQ6A 3FTQA 2R0QC 5KJEA 1Z4QA 1Y34E 1XRMA 4GOKA 4IG9A 4I8DA 1O5TA 5JI2E 4RPDA 3TO5A 4CIBA 1GD1O 1K7SN 2IXEA 3VAAA 1X39A 3WGMA 4H27A 3AR7A 3NFYA 1C1XA 5J4VA 2VJNA 3MBKA 4GOXA 3OIVA 1FMLA 3HVRA 1I1NA 4K0KB 1J25A 1I5OA 1O97C 4U4AA 3K3PA 2JAXA 4BMPB 4YUWA 2ONYA 5ADUS 1HLFA 1VPWA 1W1WA 4IJ6A 5EG5A 1V11A 4US1R 3T06B 3U17A 1Z33A 4LSGA 5KYWB 1YDGA 2AT1A 5BWBA 2HSGA 4RPBA 3PUIA 4DVGA 4XUDA 4XYBA 3VU0A 4PLWA 4BNDA 1MNQA 3GEBA 4ZU6X 3OCXA 2JLAA 1FUIA 4DHEA 4UASA 1KZ7B 4TKVB 3RSQA 2ECFA 5JJCA 1YB7A 3OSUA 4NICA 4J4BA 3VV2A 3OBBA 1XZLA 2X0IA 3W5DA 1GPLA 2GHRA 5JD6A 1W1IA 2IXAA 3EZFA 1A1SA 1Z13A 1XLWA 2D2XA 3QM1A 3FPBA 1LX7A 4Q05A 5FNVB 1IEVA 3GGDA 2FSVA 4OHFA 1YE3A 1DJLA 1EGMB 1LUAA 2RHHA 4JCCA 4QYWA 5ALNA 1RHKA 3GLIB 2ZIGA 4B47A 1ITZA 4Q00A 3T3DA 3R3JA 4CKBB 1R64A 3KVRA 1F2DA 2RB4A 4ZARA 1XRRA 1GG8A 1VJRA 1MOSA 3JQPA 1RADA 4A8PA 1A5ZA 1XCJA 4EG4A 2CJWA 3UWMA 1PWZA 1RABA 2PX4A 2HKIA 3G5LA 3NAZA 1H2ZA 2F48A 4HNUA 2FX5A 1U8UA 2GXQA 4TQAA 5FULA 4TVBA 3D6MA 5FAXA 5CDHA 1J00A 1I6LA 3LCJA 2C9YA 2XUKA 4INOA 4KQ2A 4LTNA 1NDQA 4PQGA 5FI0B 2ZYIA 5CEEA 1IEQA 1MC4A 3M33A 3WV5A 1Y5LA 4PM4A 3LZ6A 2OVBA 1QKJA 1THMA 3M6XA 4O2BF 4EFMA 5C7LO 1YTLA 1D6NA 4CMBA 1N1GA 4F91B 3DDNA 5ICEA 5KTMA 1E1NA 4X0EA 4GH5A 4BIIA 4D4IA 5ARCA 3O84A 3BGWA 2JIMA 4HD8A 4C21A 2EL7A 2WYOA 1CJTC 1VJ0A 2HGSA 2JD2A 4UHBA 4BTLA 2DHRA 3QKRA 3L0CA 5KOYA 1KY4A 1E0AA 3NRBA 3G05A 5IZCA 2A1IA 3Q1KA 2J3JA 1U6JA 4UJ5A 3WB1A 1T1SA 4R0VA 1W0CA 4IUYA 2QI9F 1IATA 1NZJA 1A0OA 1Q0PA 2YWXA 3L2OB 3VNSA 3KFLA 2HNBA 2E5FA 3G9QA 4R84A 1OZ0A 3H6KA 4ID3A 4V0SA 3RS2A 2OSVA 4Z0HO 3SF8B 3WQSB 4A0FA 2I78A 3UJ7A 2GJ8A 3UO8B 3OQIA 4LDAA 4UUAA 3AVPA 1XJWA 2Z2KA 1EFKA 4XIJA 3C3JA 1YONA 1BDMA 3ZJTA 3SHTA 1ODSA 3WYDA 3TPFA 4C6TA 3PLRA 2JATA 3T95A 1W85A 1U99A 2X5XA 5A2GA 5AVYA 1QRSA 5CLFA 3B2EA 1G0NA 3AHJA 2PHZA 3NNSA 4AJ9A 2BGMA 4BMCA 3W90A 1QONA 1QH8A 1HDXA 2M9MA 2ACWA 2ZI9A 3G8DA 3N1UA 4OSPA 4WLEA 3U49A 4BZQA 5H4GA 5KKNB 4LTDA 2XZOA 3VSEA 3NEJA 4MQ4A 4XX0B 2FUKA 2DBYA 2H5EA 4DNRB 4FCWA 3MS4A 1NXTA 4ZI7F 3QFCA 1ZRMA 2R44A 2ZPAA 3ZV7A 4Z4WA 1RP1A 1JV2B 2B5WA 3R3SA 2OCYC 4RTOA 3EH2A 3FFWA 2Q2VA 1SCNE 3QUTA 5EZYF 2FYTA 3RAEC 1ESZA 2PJDA 3UK1A 1OUMA 2ZAOA 4J94A 4OM8A 5FXMA 5I7RA 4TT3D 4Q1VA 1YQWA 4LPKA 1H2YA 1TD1A 3H1FA 3BZBA 4DSZA 4F3YA 1A8PA 2LKDA 5IN5A 1TEVA 4U7WA 5KC8A 1W35A 2RK3A 4KO4S 3HA5A 2W6JD 3G6WA 3QKUA 1Y0RA 1TAGA 4DQKA 1P6QA 1SXIA 2J3EA 3FMGA 4KVZA 3ZKWA 4XJXA 4IX1A 3F96A 2OO5A 5EIOA 4PZLA 1WD5A 4XWYA 5EZQA 3AP3A 2ZS9A 4Q93A 5LDDC 2WP0A 4GPTA 2UUPA 1VPTA 3PSHA 1KSFX 1FTGA 1MEEA 2J48A 4QBGB 1RRKA 3SC2B 4MVYA 1D07A 2FZ4A 3QEMB 5KMGB 1QIDA 2B30A 2R7AA 2HPZA 4M86A 1BJRE 4DMRA 5FYQA 1UPAA 2AYYA 3MRTA 4IQ8A 4Q4HB 4GI3A 4UEOA 5EZYA 1M1YB 3GLVA 4AMBA 3R2JA 3LT4A 5CJ2A 2JGAA 3IEVA 1VBFA 1VMEA 1QCDA 2FQWA 2FKAA 2V7BA 1R4NA 1R5NA 3B52X 4N8SA 5EJ4A 3PRYA 4B73A 2ZIZA 2HH9A 1M34A 3BMCB 4DG5A 2WUEA 1BFDA 3KHKA 4H1VA 3TTTA 1A5SB 1ZOLA 3DQQA 3K35A 3MTIA 3P71T 1N6RA 3I0ZA 1KIAA 1W76A 3HBJA 3IQDB 2Q4EA 4LXUA 5E3IA 5KWVA 2JLXA 1N4DA 1BXGB 4GF5A 4ND7A 5BT9A 2ONZA 4H1WA 2WLSA 2WE7A 1OH8A 2FP4A 3O0DA 2XWBF 3DB1A 1MHPA 3V7AA 1MD9A 5TVGA 2L82A 3T38A 1L3IA 2AFIE 2VJQA 1E6WA 4DLSA 2AG8A 1O4VA 5K8UA 2IGBA 2MWMA 3DHVA 1BX0A 1TC1A 2I1QA 4QTZA 5IPFA 4PO9A 1O6BA 1XAGA 2WIGA 3KLNA 4LHWA 4MPJA 1AF7A 1HEYA 1RBMA 4BLOA 1ZR2A 1I8DA 1GV0A 4FYMA 1DG1G 2P4HX 3UCEA 1G1MA 1BHQ1 1K97A 3NHZA 1KMHB 3F6CA 5JD3A 1FP4A 1UBMS 2CFCA 1P4HA 2CVQA 2TSYB 4BMZA 5DW3A 1ESMA 3PE6A 3U48A 3R76A 4XIFA 2XA9A 1VL6A 1V4NA 5CVDA 1T25A 3MFYA 1DC8A 1PGOA 3EW7A 1E6CA 3RVRA 4EH1A 4UOQA 3E3NA 1G3MA 3P2IA 1V5IA 3W5SA 1CEQA 2GNPA 2P6MA 3L07A 3OFKA 3T5TA 1LBEA 4AROA 3UJ9A 1L7XA 3IQHX 4M9UA 2JKZA 4YCBA 2VSXA 1JEYA 4QRIA 3UT5A 4MPPA 3DO8A 3D3WB 1WSDA 5L3SB 2VSFA 1GARA 1ZKMA 2I2AA 2ENWA 4XN0A 3KBOA 3NTQA 1M7GA 3QX8A 2UYYA 2XHZA 4JU8A 2NUTB 2VRCD 1BVUA 4M8LA 3TL6A 2X23A 3DZKA 3I9OA 3ZCTA 4C29A 1CVIA 2AFIB 2P35A 4FHDA 5ALYA 1KDZA 3UCXA 3VR5H 4Y2UA 5HQTA 4JI4B 3FCEA 1V9LA 3S27A 3TLXA 2WMYA 2Q50A 2DBRA 2NSDA 3E9YA 4GGPA 4DJ5X 1CF2O 1QHNA 3Q98A 2ZIVB 1YC5A 4RWZA 4RBNA 5JVDB 1UJBA 5IG2A 3P7MA 3FNEA 1KHTA 2PU7A 1SY7A 2Q5QA 3QWFA 2WWGA 3AHEA 1G3QA 1G6HA 4RLHA 3ANXA 4YC7A 2A57A 1TMKA 3E4CA 3JYLA 2P1ZA 3OT1A 5BQXA 5LOVA 1BYUA 3EXEB 1WTCA 3LD9A 4UCXA 4CQLA 5AKKA 4MVXA 4YRZA 2XMBA 3MAJA 4K9MA 4RSGA 1H2BA 1X13A 1AO0A 1XO1A 2JAPA 2G9NA 2OB1A 1W8DA 1U9IC 2NZXA 3SR3A 5EUQB 3T5DA 2ZJZA 1RYZA 3H9GA 2WVHA 1QORA 1EK1A 2HSWA 3CGGA 3KQVA 3QI2A 3VBCA 5AI6A 3IELA 3OY2A 1I4TD 2REQA 4PIMA 3ABQB 3GJZA 5FQOA 1ISIA 3A8IA 1U2EA 2WP8J 3FWNA 3Q7RA 3A9TA 3EDCA 5DTRA 4Z4RA 1HG0A 1XTJA 4Z7NB 1U0JA 3OUUA 4RTJA 1L7AA 3FLEA 2FXIA 4BJ6A 5KPJA 3MGBA 2O0JA 1WB4A 3VXKA 3WRXC 1PWHA 4DIFA 3EBLA 1P60A 1V9CA 1T4CA 5AW7A 4L0QA 3A1EA 2B61A 2PTHA 4JR1A 2OUIA 4EHAA 3T53B 2XGSA 3FW1A 1K28D 1Q91A 3MAGA 2ZJ5A 5JCJD 1TGYA 4M9RA 1TLLA 2UVDA 4J3FA 4KQFA 2H3EA 1K66A 2ZB7A 3LXMA 2PBFA 3LZCA 4M46A 4MYSA 5IYRA 3T9BA 5CDYA 5KSZA 1OX4A 1XD8A 4LBVA 2NXNA 4QU9A 1PZXA 5CYFA 4WLOA 2QUHA 3TD9A 3VOTA 2WJ6A 3C7AA 1DAIA 1XU7A 2Z0MA 4FCCA 1A50B 1E2FA 1JTEA 1T9GR 3CLSC 4WFIA 4MKXA 5BQ5A 3WB0A 3FSGD 1PZEA 4GZ6A 4ZV7A 5BSTA 4YXWD 2XTAA 3HKBB 2BGGA 3MM4A 1KS9A 1XQYA 1AS2A 1Q0ZA 2WOOA 5H68A 4E6PA 1Z9BA 1N2EA 3ZDFA 2HOQA 4K9DA 4ZAFA 2Q7XA 4Q3NA 4FS3A 5LLTA 4MI6A 4FFRA 4NY1A 5B55A 2O8FB 3TIFA 3HU1A 4I4IA 1PFQA 2QNRA 4XOTA 4Q66C 2VDMB 2PT6A 2FX3A 3ET4A 1QRTA 2XWPA 1U5AA 1O58A 1YCGA 3E1KA 4N12A 3EHEA 3PHIA 4CG1A 4H18A 3QXXA 5SY4A 2BF7A 2Q6KA 2DFKB 2DPYA 3OQHA 5EWJA 5F64A 3TBFA 1NVMB 3IB6A 5HZHA 1II8B 1RYYA 3C39A 5K7SA 1VDMA 2PT9A 1Z0DA 1QSGA 2Y1WA 1E1RA 1XE3A 3SKYA 4AMVA 4Q34A 2ZCUA 1DXHA 4FE4A 4R2IA 4UZSA 3BK7A 4WERA 3NHKA 4QM6A 3HGQA 1D6JA 1P4AA 5BUCA 1WNFA 2GNAA 3LX4A 2F43A 4XUCA 4KOEC 1TQDA 1BX3A 1UZNA 1VMAA 1ZH8A 3QP9A 3OA0A 4M83A 4QASA 4XR9A 1PW5A 4UKDA 1GRNA 3OQJA 3ZE9A 5BPFA 5EJ9A 5CXXA 3EXIB 5AVZA 3L0YA 1EFUA 5BMOA 1W9MA 1W30A 3Q9NA 4JKOA 2EKDA 2JDID 4QWMA 4U3JB 3R8CA 3X1ZA 4OPVA 2VHEA 4EQZA 4KE8A 3U62A 3GRZA 1AZWA 4Q9IA 4E31A 3M1YA 4QFBA 3N39C 1QMGA 2G8NA 2WM8A 2WY2D 1WMDA 1XRLA 4ALIA 2QD3A 2NG1A 4C89A 2J0QA 2Q5EA 1MT0A 2C9CA 1JT9A 1NU6A 1XZ8A 2X0NA 3Q6IA 5FNVF 1TQ2A 4X85A 5GGYA 2IOFK 2FLKA 3JSAA 1Y6FA 1S2OA 2GPSA 4XWGA 3VBEA 2OHFA 2VBFA 1SXGA 2W6NA 4KQJA 4LX0A 4QVGA 3UHFA 3TEJA 3VVCA 1Z2NX 3FDZB 3L84A 2ZBPA 4G65A 3BNWA 2XHEA 5KYWA 2NYRA 3TQTA 5EKXA 4RLSA 3LUHA 3FNBA 4EAQA 3ESDA 1ZRNA 3HYLA 4XM3A 2CHFA 4P4LA 5K8VA 4S12A 2WPDA 1WPXA 1RWMA 3C85A 2XEDA 3C5WP 2ZS7A 2BDUA 4TKVA 2VBTA 3OEYA 2CSXA 3RTDA 1J2TA 3H94A 1GUAA 3R74A 4JEUA 2QY9A 2GAFA 3W3AH 5JLJA 5KYKA 1W59A 3FPJA 2GBCA 5CBPA 2PL9A 4BV9A 2H08A 1R4MA 3CMAB 3TXXA 1NJ6A 2JL1A 3BH0A 4C4TA 1FIUA 1QNLA 4DKJA 2AJCA 1W29A 2FZ5A 4FFBB 1FQKA 1KE1A 1QHIA 4Z4QA 4WDRA 2RGXA 4CKBA 4Q7KA 2H2DA 5BMVA 2OM6A 2E55A 4EJMA 5A3QA 3L4SO 3OUTA 4PYLA 3PA2A 2R84A 1EVIA 2NU9B 2F8TA 4XMYA 3UKDA 1XTPA 1ENPA 1N5RA 5DBHX 1LRKA 4CMGA 2NYVA 1F38A 4PLVA 1UOEA 1U81A 2VNJA 5JXJA 4KRFA 5L46A 4RKFA 4R7ZA 2ZSUA 3PQCA 1AUPA 1E1LA 3RVMA 5A89A 1JEDA 1U98A 2J09A 4GEKA 5CCBA 3LA8A 4ZGBA 4FC7A 2JBHA 2V6MA 1N0VC 1VHTA 1KK1A 2QMEA 2VPIA 5NLLA 1Z5ZA 4NQZA 3Q8WA 5TJHA 5EHGA 1PS9A 3BH6A 3NM6B 3QF7A 4JENA 5KU1A 5E2BA 3EVBA 3WTCA 1YGYA 2HWKA 3BCRA 1K4MA 1Z4NA 3DVSX 1SAYA 3N8NA 2X5KO 3BILA 3PKIA 1K08A 1Q95A 1T5TA 1QDEA 1UXJA 4RGVA 5M7EA 1QE3A 4ABTA 2Z95A 2O4UX 1RCFA 2CMGA 1FXWF 4X7FA 1M1ZA 4OU5A 2J0UB 1K27A 3PIRA 1RQ2A 2XITA 2AJBA 1QQ7A 2V97A 3FTCA 1Z15A 3E0QA 4TROA 1NF9A 3ROXA 2E7ZA 1IE3A 2JGKA 1P45A 2O3UA 3CUWA 3FWZA 4P84A 1W9XA 4IHJB 3M3DA 4RPIA 1XYGA 4ZVSA 4GKBA 1V2GA 3NYIA 5DYWA 1HDGO 3LY7A 1W96A 3I12A 2JD0A 1IQPA 2G09A 2IA5A 3B1JA 2H1CA 3JQ9C 1ZVKA 2BUAA 3IQZA 4MB6A 2ZUWA 3BX1A 1M0SA 1Q0UA 4HFRA 2OCLA 1VLVA 3ZCSA 3QLVA 2YOFA 1WZEA 2E82A 3DUFB 3PE3A 3TLYA 2W11A 4YCDA 2H6EA 4US2R 1W4ZA 2QQ5A 2QSZA 4RIEA 3VZBA 1B73A 3KUXA 5C5IA 3ID6C 4LK3A 2RD2A 5DP1A 1X7ZB 4ME6A 5EINA 4Q9AA 3LPLA 4KYTA 3OO0A 4GZ5A 1ZZGA 4QSHA 2PCJA 4ZTZB 1T5LA 2CBZA 3AG5A 1KMCA 4GHWA 2XECA 3NBQA 4IPTA 4NJOA 4XX0A 3RS5A 1KP2A 1VM6A 5DM60 2B36A 2GESA 1SEPA 3C1OA 2HF2A 4NE9A 3H8WA 4LZWA 3RM3A 3SICE 4CIWA 1N2XA 1KJQA 2FE4A 3HHPA 3PRJA 1CUJA 1M0WA 2IZOA 4MVJD 3U4HA 3VU8A 3PNLA 4UOEA 4G2NA 1GQRA 1HE4A 2P2CA 2D5LA 3A1TA 1OU0A 1ZUNB 1G63A 1QYCA 2AN1A 1GL3A 2NO6A 3ESCA 4OGKA 4FXOA 4YGXB 3TQRA 5EY5B 4DNQA 1XRSB 5KZMB 3QVVA 3RVQA 1NXQA 1OJ7A 4AJPA 5AO9A 3GOHA 4QOHA 2HNKA 4AUNA 1Z0ZA 2Z4SA 3MPOA 4YMSA 3S7ZA 1IHXA 4JYMA 4ZCSA 3SFVA 1X7YB 1VKJA 2AN3A 1FRFS 2EZTA 4HE6A 1IFXA 1NOKA 4NAHA 4DA6A 3OOEA 2MINA 1ZN8A 2F90A 3CLTD 5FTKA 1PJLA 5FUBA 3NVAA 4PZEA 3W2TA 3TI9A 2YC2C 4TZ6A 1E5DA 1RYMA 1FPQA 2FAXA 2FEMA 1RACA 1MTZA 3DUWA 1B00A 4MRVA 4LISA 2IPAB 2WILA 5DK6A 1KEEB 3FFXA 2LVBA 1OVMA 2YHAA 1RXUA 2J7PA 2VJKA 3KKKA 3M6AA 2XQFA 4NEGA 3WQRA 1H3EA 3ROZA 3IQGX 1ZGCA 1S02A 4OHPA 4WNIA 1AZSC 4C0HA 2WJYA 2XNKA 3U4MA 5K6AA 4UATA 5BPHA 2OWEA 1UXHA 2QM0A 3L41A 4UBNA 2H7CA 1VHLA 4K7JA 1J6UA 1QPBA 2EJTA 2VNAA 2V3CC 4B6FA 1C7ZA 1XR3A 1J8FA 1N7GA 1II0A 2P75A 5KQLA 3R9XA 2RIPA 2VDPB 2XGMA 2KW5A 4MROA 4IZIA 2FZCA 4J7AA 5TSDA 2AZDA 5CDTA 3C6ZA 3C8DA 4LEIA 4X7RA 3UWOA 3K70B 4PAAA 3MQFA 4ADSG 1WMSA 3RWBA 3VA7A 4TXHA 1R6XA 3P4UA 4Z0NA 2R6HA 2DH6A 4GQBA 2ONKA 1YRYE 2FWIA 2GN9A 1OROA 3JQGB 3OEHD 4LHZA 3R7NA 1V0FA 3U31A 4B17A 2VPZA 4C1NA 3E9EA 3PX7A 5JHGB 4IXTA 1XQVA 3AY0A 1XAIA 1KFCB 2YVUA 1OH5A 7YASA 1HM5A 2WIJA 5DX0A 3E05A 2CV2A 1ZD8A 2J08A 2A14A 5AJYA 4XQFA 3N2KB 1ZI6A 1TFUA 4RULA 4R01A 1ODIA 4KI7A 3U7FB 4EGJA 3GR6A 3GUCA 2FMXA 2GPAA 4CL2A 1UKZA 2OGZA 3CX4A 4B3JA 5JVDF 4CCAA 2EGGA 2GVZC 2GZSA 3FGPA 1CZLA 3LDUA 4JN6B 1QFZA 1GGJA 1FSZA 1GPH1 2ZANA 4TRMA 3TMKA 3S2GA 4HX2A 5LM3A 2OILA 2O19A 2OLJA 4BMOB 1L4GA 4Z4CA 2YN4A 1NI4B 4HPXB 3K0AB 2EQAA 3OCWA 2QRJA 2QYOA 4C04A 4Y6OA 2BTQB 4NBLA 5FADA 4XWOA 1C8VB 4BLSA 1O94C 1MT3A 1MRZA 2EKPA 1T9GS 2A30A 2NTJA 3IH5A 3CC2B 3E70C 4XPIB 4LRUA 3K9CA 4CM9D 1KEWA 2G08A 5AIBA 1NV9A 2ZRNA 1QCZA 3C7TA 1E2EA 2QZZA 1YRLA 3HZZA 1DCFA 4FGWA 1HDIA 1OU4A 1RWVA 2F3SA 1SKQA 1C9MA 3GD5A 3JAMA 4S35A 1ML4A 1QTIA 1DXQA 2CUKA 4N1AA 1MOZA 1GFZA 1EZZA 1Q2XA 1Z2DA 1MAAA 2ERXA 1P91A 3GFBA 3LG2A 1JHVA 4JC5A 2JI7A 5DYNA 1ISSA 4RTKA 4UNPA 1X8JA 3KSAC 5C1BA 4ZXPA 4LSMA 3H05A 5LKRA 3MN1A 4M22A 3UJHA 2DE0X 2OFOA 2ZZGA 3OJEA 4NATA 5B1HA 4D3SA 3AEQA 5I45A 3EEOA 3ZD8A 2CHQA 4B7CA 3DYVA 5HQJA 1O7JA 1CJUC 3HO8A 5SYNA 3S0JA 3ZWPA 2J0EA 4L76A 4MYTA 4UAGA 4YMVA 4XXHA 4DREA 5DNUA 1NVFA 1CX9B 1EBFA 2RAVA 1XPRA 1G8KA 1JILA 4M54A 4CIXA 4R68A 3H1EA 1W0KA 4N5NA 2ZJ8A 3QY0A 4XFDA 1LY1A 4JJGA 2X6RA 1VPVA 4HPJB 5TQJA 2R6GA 5H3HA 2FB9A 5TDHA 3SD7A 3JR7A 1C7QA 3WE7A 4EATA 4F85A 1OWOA 1ILEA 2X9VA 3EWNA 4JNKA 1QGUA 2XCQA 3L7IA 2OO7A 4H7PA 3G0OA 3UQZA 3ZVRA 4CIAA 1EP2B 4L72A 3DZ8A 4MKZA 1OD6A 3D81A 2I67A 4RVCA 4XYGA 2VHTA 1J06A 4TTAA 4AJEA 3DR3A 2V1XA 4E2FA 2QD2A 2ZRDA 3MERA 4UZFA 4L74A 6NULA 3A2NA 4NP6A 1YJCA 4QUIA 3CZQA 3W1WA 3MTEA 4BKPA 1M2GA 1TYBE 1VLZA 2BKAA 2G9VA 3TEFA 1IG3A 4FDTA 3K92A 2R7NA 4L0CA 1A9YA 4IF6A 2D5BA 1T9BA 5IT5A 3JXEA 4HK4A 3GNLA 1JSXA 2I3AA 5EE3A 1OBOA 3QKSA 4I7EA 4AP5A 1XMOB 4RHUA 5A3SA 2PH3A 4DCTA 1MPTA 2I4TA 4TYPA 3FOFC 4CI9A 4OHKA 1XWIA 5IFKA 3WK6A 2ZUBA 1CUHA 4J0EA 5KHOC 2O8FA 4LE1A 1J0BA 1Z6TA 5I48A 1IQRA 2BTOA 1GYQA 3PWSA 4G4JA 4D9IA 2YZKA 3RUFA 5BW4A 5EIEA 1FXSA 4CHGA 3QFRA 1M0TA 1NKSA 1ARZA 4B3TB 1GCIA 2D1YA 3MW8A 1L8AA 5GQSA 1IB6A 2YXLA 3OIFA 4GYYA 1GUYA 1TEXA 4R7TA 2FVGA 3NWEA 1ZOIA 1Y81A 2VAWA 4JCOA 2XDQB 4FZVA 2QRPA 4LRYA 1QYRA 3GCGA 4XUGB 1II8A 2WJZB 4A0HA 3B8EA 2PIAA 1K86A 3BRWA 2AXQA 4E0FA 5FNZA 2EKLA 2H57A 4RPHA 3TMAA 2F00A 3R24A 4FFDA 3VAZA 5JXGA 4LWQA 2JGRA 4Q4DA 1POXA 3TZKA 2X2FA 1HZJA 2NZJA 2P2ZA 4IUBS 4YR7A 1FFCA 1YZGA 4K88A 3FZYA 5JANA 4B32A 5AR1A 3HJBA 1GN9A 4ROTA 3R0VA 3H1TA 2O7NA 5FEUA 2PLWA 4OB6A 1JPNA 1K06A 3A3OA 5BQ3A 4DB4A 3EGWA 4GMFA 2Z56A 4MLPA 4NCIA 1HBJA 5T7BA 4EHHA 3ABIA 4YVFA 4P22A 1FX1A 1SIOA 2IXTA 3EXIA 2XDYA 1BE6A 2ZIWB 3H17A 3PUWA 4GOMD 3W8DA 1UDCA 3WA7A 2JHGA 3DVRX 4U3JA 1SULA 5KOIA 4BO4A 1E9CA 1H6CA 1OIWA 2JAQA 3LGXA 4HTAA 3FUUA 4QDZA 4PSUA 1ZUWA 4TXNA 4DLXA 4M88A 4HDMA 2A35A 2WWXA 3IHLA 1AIPA 3NAMA 4YJKA 4B74A 1EGAA 2LIPA 4NCBA 5E4JA 2R00C 3HKEB 1EINA 1DEAA 4M36A 4HG2A 3R41A 3GZJA 3UW1A 1Q7YD 4EYEA 5DWDA 2POCA 2VTKA 1PKEA 2WUGA 3OIYA 1XDGA 5AJTA 3QVOA 1K89A 3KB8A 4YRQA 2VHJA 1DQYA 4F8YA 2CV0A 4FVTA 4EM6A 3E5RA 3IJRA 3HN2A 3K9LA 1E6MA 4KHPB 3QWBA 3J80A 3WGIA 5B7QA 2HLNA 1L7BA 4MX8A 4KR9A 5C8XA 4ZTUB 4AP9A 4C7VA 1GTZA 4ED9A 2PGAA 3I2GA 3NWOA 3GVHA 3PYXA 2PFKA 4GM4A 2CFOA 5ANRB 3FGNA 3HAGA 1SQGA 5DNWA 1NOIA 3TZLA 1NULA 1B0ZA 2QOEA 3D9QX 1IZZA 2ZSBA 1P5JA 4G1MB 2PTGA 2F6RA 4GGMX 4Z4GA 4G4SO 1JKXA 3CF4A 3GLFE 3CCLB 4R05A 4DLVA 5CCDA 4WRRA 1YOVB 3KXDA 3WGYA 2RGNA 4OQ4A 2PMCA 2ISCA 4URUR 1LF5A 1MQ9A 1XEWY 1GZ4A 2FPOA 3E9QA 3H6HA 1SUDA 4U5XA 3W6UA 2JZCA 4GMKA 4C3OB 4DMGA 3LHFA 5ED4A 5AKZA 4IV8A 1DKPA 1DTEA 4TV9B 4ZYWA 1J2YA 3KETA 4UDYX 2IY7A 2QVXX 4IQ4A 1FS6A 3SK0A 4DS3A 3EPHA 4FFBA 3FVVA 1RJGA 2G70A 3K1TA 1A4IA 3QLUC 4YPVA 5C8YB 4RC9A 4UUNA 3RYIA 4GT1A 1FF9A 4EKYA 5HSGA 2DGDA 1FZQA 2WJIA 4EVIA 1T6XA 3OJXA 3H2KA 2NU9A 2OKGA 1QYXA 2IJGX 1IXYA 2DP4E 2GKGA 2ORIA 3QXGA 4CKEB 4YAIA 2I03A 4EW1A 3GCWA 4BVBA 1IAQA 3K8OE 4OMFG 4QG3A 4IHJF 3NBXX 2P3MA 1GT91 3TR5A 2Y0PA 3KC2A 2F4VB 4XYMA 1VB5A 3AVWA 4KLAA 4CFZA 4KQ6A 2W5UA 3I83A 2DOKA 1IWPB 1JXMA 2ZEJA 4CTOA 1G8PA 2H4HA 4YJHA 1UDAA 2DLDA 2C9MA 1EP3B 1TF7A 2C3OA 2RHOA 3JQBA 3OLXA 4ON9A 4OH1A 4B81A 3MLEA 1DQNA 4NZOA 4DT1A 2FMTA 1B8OA 3NKFA 1CSEE 3CG4A 2C2GA 3HUEA 3NG1A 2H63A 3IX7A 4O63O 2W6CX 3KU4A 5CVCA 4F11A 5TNXA 2WQZA 4WESA 1Z5GA 1N4AA 2H5JA 2ES4A 1UWKA 2SNIE 3L06A 2ZBEA 3ASTA 3X3HA 1EFAA 5K05A 3ZJUA 4NK5A 1OXKB 3FJOA 2BHRA 2R8XA 2UVPA 1AZLA 4RJLA 1L5FA 3KDAA 3LT1A 1GGKA 4OFXA 3DC7A 3JQAB 3TUJC 4AWBA 3I09A 4BEVA 4UBLA 1M1KD 1RWNA 1T8RA 1WG8A 2D0OB 3PGLA 3CWCA 4L8YA 3VKHA 5CK4A 2J3MA 2OD2A 4MLDA 3CP8A 3UJ6A 5JD5A 1OLSB 2VR1A 4NENA 1YQ9A 3E8XA 1FC0A 4OJTA 1G21E 2QN6A 2GCGA 2H4YA 2LP4Y 2VF8A 4JLVA 4N0EA 1UK7A 4U2GA 1S2NA 5FJJA 5L95A 1NBOA 1Z5OA 1TQHA 3A8KA 1WB6A 4TTVA 3LC7O 4EEZA 5C7YA 1Y3HA 4TSKA 3L4JA 1VE9A 2ONJA 5LJIA 4IVPA 1DADA 4NEHB 3KTDA 2CMKA 1Q1BA 3FPCA 3G59A 4PO8A 4XLTA 4E88A 2UUBB 4IDFA 1HRKA 2JLCA 4DL9A 4N41A 3N7AA 4GWGA 5MFPA 3RKUA 3WLTA 3HVKA 4F4HA 1LDBA 3MZ0A 3HYNA 4NYIR 3V3KA 1J2JA 4U02A 1XYVA 1FFXA 2Y27A 1T5BA 4OOVA 1WDLA 2YNMC 3INTA 2QJOA 4JLUA 1PFYA 4DABA 3B8HA 3ZJ4A 1O57A 1I4DD 2PYZA 4JU9A 1M7HA 5CM2Z 1JMVA 1Y0YA 2XTMA 4ASUD 3PV0A 4OSEA 4C2AA 1LU9A 4CTNA 3OM0A 2JBWA 2F3RA 3W9BA 2FZVA 1E1QA 1WXGA 2DCMA 3GUUA 1G8FA 4Y9RA 2HK9A 2C1EA 5BRNA 2X4IA 5JAOA 4LV8B 5EQTA 3GX1A 4YP5A 4CCWA 3GGSA 1I3NA 1TEZA 4LZPA 3ADKA 4PHFA 3O2SB 1JFLA 4BC1A 3GNTA 3D26A 1QHGA 4MTCA 1I33A 3CEMA 4KAJA 1G21B 1GTG1 1NUUA 4J9UE 4V0NA 2FFHA 5CU7A 4MP6A 3SVLA 2CB0A 3HMQA 4KQEA 5EJIA 3KYIB 3E23A 4HX9A 2QE6A 1AE1A 4E5YA 2EDCA 2ODPA 4CRWB 1DPFA 4D02A 1R3DA 5CT5A 1KEEA 621PA 3TB4A 3FAZA 2NGRA 2EJBA 1CRQA 3FTNA 2WSLA 4FIZA 4PG4A 3UGQA 3ZLTA 5ALGA 5DMXA 1E3IA 4BJHB 1BDHA 4TMWA 3COVA 1D7OA 1QMPA 3GFFA 6CHYA 1JWLA 4ARIA 3DM5A 3G2QA 3ISJA 3GDOA 3MBIA 3DNMA 3WYBA 2BZ0A 4M8SA 4ZN6A 4DV1B 1U1EA 3SEQA 5AIAA 1G7TA 4PICA 3L01A 2WF5A 3TH5A 3MTAA 1RE0A 4LUCA 2R6DA 1UKYA 3G9XA 3L1HA 4EKEA 5C8VA 1AH2A 1XZAA 2V9ZA 1P2DA 3D3EA 5FR1A 5HILA 1O87A 3DV0B 1KMQA 2FWPA 1KFEB 1OWNA 3LQQA 1SZCA 3PT5A 1Z0FA 3PUKA 1UOPA 3IP1A 3FCUB 3VR3A 3B3FA 3BD6A 4KQHA 1BXRB 1E0JA 5EMNA 3PUNA 4JEIA 4WCFC 5EYPA 2Q5HA 5D84A 5CW1A 1O95A 1K6IA 4YGYA 4X1IA 2I8LA 4RKWA 2RAFA 2FOLA 2XE4A 2OPHA 3JQGA 3PE4A 3JATB 1F8YA 3FHOA 3FRHA 3UGTA 4CL0A 1P18A 3OCJA 4MKGA 3FZEA 4IFTA 3NI2A 4CE6A 4FGZA 3K1AB 5KREA 1YDHA 5LZ7A 5EHNA 3UHOA 4AXXA 2OENG 1KJWA 3VH1A 1QU3A 1UFOA 4MQFB 4P58A 3ZI0A 3ZHUA 4JV5B 1E2DA 1ORIA 3TZQA 3N2KA 2WT8A 4M0KA 5FTNA 2EJCA 4QGBA 1THTA 1Y33E 4UFOA 3T4UA 4AJNA 1BQ4A 3T3OA 1NNEA 2WTUA 1ZN2A 2XRYA 3ND6A 1JA0A 3O73A 4E94A 2UZ4A 2J7KA 1K63A 4DDKA 1IUPA 1I0LA 2B8EA 1TM1E 3KIPA 4FMCB 1T4MA 2RK6A 3QBTA 4LOIA 3QMMA 1QIJA 4UQOA 4CU5A 2ZM5A 4HZIA 3CCSB 1GAEO 1A04A 1EFRD 1EZ4A 1MABB 2NAPA 1K8XB 3R7BA 2R8ZA 3GJ8A 1NYQA 1HXHA 4RHTA 3LUBA 1NI4A 1EP1B 3AZQA 2Y99A 3PNSA 3Q6QA 3ZTWA 3TXYA 5K4GA 1LCIA 3VMFA 2I4OA 4HTFA 4UE6A 1YQDA 1G8GA 2VN8A 3IC5A 4XPIA 4YLGA 2C04A 1QM5A 2ZTLA 2Z6QA 2PSSA 4EL0A 3ANNA 2JI8A 4MOWA 4P4SB 5F3RA 4WK2B 1JIXA 1DXOA 3WI7A 1PDWA 4BJ5A 4ALLA 5CG2A 4OFWA 3A3GA 2O07A 1GQSA 4FYIA 1AGXA 4ITRC 4TX1A 5HE8A 4QHTA 2B1QA 4S1WA 3ROFA 2V7VA 1H1TA 5JAUA 4O8CA 2O5VA 5FLYA 2GZ2A 5HMLA 3EVDA 3LUGA 1P0CA 3HJAA 4FT2A 4DMCA 1HNNA 1RPAA 2APJA 3IIJA 3MLBA 2OB2A 3PQ2A 3X1KA 3N59A 4E22A 5JFTA 4WX2B 1E6EA 3LBNA 4J75A 3L8GA 4EO9A 4ZZIA 2FN3A 4BNGA 2AOTB 1IY9A 1HMYA 2ZUDA 3JZMA 1W34A 4Q1DA 2X53S 2ZWAA 4LQLA 2OOSA 5TPWB 4DN6A 3TFOA 3NEAA 2NNWB 1IQ0A 2JJ1A 4NCNA 3H75A 4EK9A 1EUQA 2VG8A 3FKSA 2QL5A 2JLBA 2NLOA 2PZFA 4L9WA 3NDIA 1NVWQ 5C5EA 3RVLA 4MQEB 5AUOB 4HDRB 5H7XA 4AN4A 4QLOA 4YMWA 3I64A 3WKAA 4LV6A 5G0WA 4CDNA 4IBOA 1TTPB 3L9XA 1Y1KE 4N5IX 2OESA 1W1UA 4JB8A 3ZU2A 1KKLA 1PLJA 3JD1A 3U44A 5BSMA 4DPKA 1SZDA 5JJBA 1N5DA 1MRSA 1SBZA 2VCHA 1OB5A 3OZ7A 2FP3A 3JD0A 1TKCA 3P5BA 2ZIFA 3CZMA 4NAUA 2DSTA 2W2QA 521PA 2JI4A 3A4IA 2ZM6B 3D43A 3DDOA 2LIVA 4I1PA 4YP7A 3IPYA 2W7TA 2CNDA 4XRGA 3CVXA 3BM5A 2HRCA 1QR6A 5T4HA 2C99A 3P0EA 2ZBVA 1K9MD 3L7OA 4DMUB 4EB6B 1MB9A 3KSMA 1CS0B 4FLFA 4XGIA 1I1HA 3O9ZA 5D87A 3WICA 4EHKA 3NHFA 3K0SA 2ZQZA 1UWVA 2R86A 3D6VA 5ILOA 4G85A 5EHQA 3W06A 4D9KA 3QVKA 3SX2A 1FRZA 2AOWA 3D8TA 3OECA 4ZAXA 1HYGA 4RVGA 1EUZA 1UIRA 1JKMA 2YXEA 3KQQA 4S3MA 4WZBB 1NF2A 4DTCA 1QK3A 1INLA 2BHNA 3RSCA 3PHBE 2TMKA 4GICA 4HQRA 5LYJA 2Q3JA 3UXEA 1ZJJA 2BFEB 1I32A 1MORA 4M53A 2P5SA 3MEQA 4R3WA 3S99A 1WTHD 1YNSA 2QX4A 3C0KA 5IXSA 3GC6A 1P7WA 4BQFA 2BFOA 1R4ZA 1Y1PA 4GVPA 3HC7A 3CNOA 3UKOA 1CUVA 4YCSA 1K4YA 1LS1A 1UK9A 4JUAA 1Y6ZA 2WSBA 5F1KA 1GPWB 3RH0A 3TCXB 1NJGA 1RLIA 3IDZA 221PA 2DFVA 1L5HB 1U0FA 2QD5A 4H7KA 3R8XA 3TNLA 3UMBA 1NPYA 3TKYA 2QRGA 5E6RB 1OAOA 3AL3A 2I1LA 1M6HA 3ECAA 3OKPA 4JYBA 3N0RA 5FWNA 1DKNA 3PUVA 3VPGA 3DOCA 2IKSA 5AW6A 4W1RA 3IURA 3K8ZA 3OTGA 5A3JA 2I6QA 2ZRQA 4LYEA 4XR4A 1IRIA 2PGXA 3E8SA 1YB1A 1ZMBA 2CJFA 3A9CA 3RS0A 1TK2A 4R1OA 4NVRA 4LXIA 3D1LA 3SZUA 3WXBA 2H2IA 5KAMA 2G5TA 3NLLA 2BBSA 1T8SA 3LQFA 3V9AA 2CFTA 3K5PA 4TWAA 2OBXA 1ESDA 3C24A 3OFJA 1EMDA 2WMDA 1TU3A 5ER9A 4IHKA 5IJZA 1G60A 1BGXT 4UBIA 3UMRA 2VJMB 2HUNA 4PLGA 3ICOA 2CZGA 1G8YA 2VP6A 3BOSA 4TMVA 2WE8A 2YXPX 3G8CA 4FONA 4QXPA 2JGLA 4CL8A 4FGLA 1RYFA 4OLAA 5ELLA 5IK2D 1CTQA 5A1JA 3JU3A 5K3OA 4MUBA 4RVOA 1B74A 1SUAA 5K0ZA 2ZBRA 1YHZA 3I2IA 3H7IA 2YICA 4W63A 2GKSA 5EWLA 1CUXA 4YRCA 4P98A 2QE7A 4ZANA 2QBYB 4K87A 3GJXC 4L5JA 3IVGA 3HCBA 3HR8A 2YFKA 2X5JO 4MAMA 4QUAA 1D4ZA 4TV9F 2YS7A 4U00A 1Q0RA 2GPWA 1B43A 4FYHA 1PHRA 1PQ4A 4WASA 1UANA 2PS0A 4JJAA 5C8YF 2JIBA 1U2SA 2HF7A 4J29A 2FA9A 3CVOA 1OFUA 3DNFA 2WF8A 3QJ5A 3SQMA 1OXXK 1YBMA 4PZPA 1KYTA 3E84A 3FMFA 4LGYA 1JDNA 3O4IA 4C0XA 2CNBA 3AV0B 3NRJA 1BQEA 1OA1A 1TA4A 1E98A 3DT9A 3IOEA 3V8PA 3AFOA 2PGJA 3S1LA 1YUBA 1RZRA 1BD3A 1E2KA 2FFBA 4E1BA 4RELA 3WLIA 3OF3A 1KQNA 4CLEA 2BKEA 2EQBA 2HLDD 1FYDA 3W4IA 1VIVA 1PJBA 2QLFA 1MF7A 2OAP1 5C53B 1KJNA 3T15A 5B36A 1XB2A 1WLYA 1JIIA 3BB4A 2P9ZA 4JA2A 4DR5B 5B6IA 3JD4A 3BY2A 1TJNA 2G76A 4LC0A 2XPCA 2BCEA 5C8YA 2GZHA 3FM9A 3N6XA 2AKYA 3A28A 4WZEA 1Z4OA 4I5GA 2E1RA 1UMKA 3JRNA 4MA4A 4OO3A 3V1YA 4QLBA 1R8JA 3Q3AA 1EFVB 1G42A 3WK9A 4CKEA 3BMQB 1HFJA 2J6HA 1GQQA 2XUFA 1TTQB 1UP4A 3LX6A 3OFND 2IUTA 2Q5IA 1HI9A 2O2HA 3CINA 4RL4A 1ID8A 1NRXA 1YL6A 5DNEA 1J0CA 4UPVA 5CG1A 2QM7A 5TB5A 3KYJB 3C3DA 4K9PA 3H1GA 4PC2A 1II9A 1QIEA 4DLRA 4BCBA 1HYHA 1UDXA 2P5YA 5BUZA 2AQHA 2Y6UA 3N8IA 1YS7A 3DMRA 1O6CA 3ER6A 2YMLA 4GIBA 2Q62A 1X14A 4IINA 2F1IA 2XT0A 1EX9A 4DYVA 1BE1A 1SKBA 2GO7A 3NXSA 5HF9A 1TUBA 1DIHA 1Q2UA 4B6JA 1C9EA 1HTWA 3CC4B 4RJIA 5AKXA 3G0CA 2JVKA 2BGUA 3FBGA 2NV2B 1ZA2A 2WHYA 3SYRA 5B2ZA 3UG6A 3IV9A 4BATA 1RPJA 2IE8A 3COWA 2IZ6A 2LDXA 4PPQA 1XZBA 2PMKA 4RANA 3RJTA 3EZXA 2OCDA 5DRTA 1YL5A 2Y93A 4CLXA 4EB0A 4JZKA 3MYRA 1VFNA 1XAHA 1R0ZA 3WBKA 1LDYA 2QGFA 3EMKA 3A04A 3P4YA 5FWXB 3QLEA 1OLSA 2H2AA 4CLRB 1E2PA 1V25A 3HPQA 3IKJA 4ISBA 4HB4A 3D6FA 2E4ZA 2R6FA 4WZAE 2PYDA 1D1QA 1MH1A 1NVVR 2I91A 3L8YA 4GLBA 1VQPB 1X9IA 3FE2A 4I2VA 4PO1A 2G0AA 4FGJA 3L7JA 2K7ZA 3BXGA 4H60A 4KVGA 5CVTA 2M6LA 1WBBA 5IVIA 2ZYAA 5CBPB 2F1JA 4JMPA 5TRDA 2PD6A 3KCNA 4L78A 1PNVA 5BN1A 3O0TA 5AJWA 3LYUA 3JYNA 5EN4A 4A0RA 1KDPA 2DKFA 2X6TA 2C3PA 4YJFA 5A7HA 3MWYW 1HE5A 5EE1A 5KNBH 5D5PA 4Z5XA 4PV7A 3I2JA 1GL9B 2PUBA 4BTVA 2QI9C 3X2EA 4J3NA 2NTEA 3KKLA 3LP5A 5FI3A 2I6GA 4WT7A 1N3IA 3AB8A 3CH5A 4MULA 3T5MA 1Z82A 4EF5A 1QBGA 1MZPA 4RDIA 2ZZKA 3KEWA 1HLDA 3HFJA 3WMFA 1UAGA 4BE9A 4F5YA 3AL2A 4TV8A 1SVWA 2IHUA 2QLMA 4LHYA 3ZCVA 5IJXA 3OT4A 4EYGA 5CB4B 3GWZA 1H1LA 5ALPA 3SFZA 4B5LA 3KE9A 4R9RA 1LSUA 1L7PA 4YAJA 4PFKA 2JRLA 1HTTA 2VHCA 1NJ5A 3STUA 4G0PA 1NVAA 3CJRA 4MW1A 5DLYA 3V9PA 3O7WA 4ZZ0A 2DY0A 3JASB 4E46A 1XD2B 5CNMA 5A4DA 1KWGA 1J90A 3PNMA 4PLCA 2GEUA 4WZAB 5AQEA 2OWDA 3KPUA 3PLAE 1WMFA 3L6CA 4H6PA 1WULS 4ZQHA 4BL5A 3FPKA 4I50A 4WK0B 1IPEA 5KB3A 3L6OO 3Q41A 1FRQA 4LVNA 1ZH0A 1PT5A 4TRRA 3FCAA 3ILYA 4I4LA 4KTTE 5EIBD 1Q14A 3FUXA 2XNCA 2WZPP 2EZUA 1M6WA 3BGSA 3D4IA 3GJ6A 7REQB 2DBZA 2F1KA 1PV4A 4GDFA 3BFVA 2CMHA 3UMCA 4RTQA 3WIDA 2HWYA 4BO1A 1ML3A 1C8KA 3VPDA 1G3RA 2UAGA 3DS8A 3HKDB 5DHQA 1X80B 4UHHA 3A3NA 3S5UA 3TNYA 4IJ5A 3DKVA 3UJ3X 1BU5A 2BYTA 3L49A 5BN3B 1WMEA 3ZBQA 4RENA 2WYWA 2Y92A 3SC4A 1Z26A 9GPBA 1M2HA 3NUZA 4PGMA 2PKYX 4MCHA 3CH4B 1YDEA 4YQYA 3DV0A 4US0R 4ALJA 1OFIA 2QPOA 2HHLA 5ALMA 2HCTA 4CCYA 4Y9TA 5EXEA 3ZXXA 4B7UA 1N7HA 4FMCF 4RZ2A 1QO0D 1GUFA 5CEJA 2W9XA 3DL0A 2QMHA 1ZRSA 4N3CA 2H5LA 5K3FB 5A03A 2P9TA 5LMNB 4C03A 1TW3A 1FK8A 2IDKA 3I2YX 4PGAA 3WDMA 3DEYX 1NY5A 1XEXB 4HWTA 4P86A 2WOJA 3JATA 4ROXA 4ZVRA 2CE7A 3NBAA 4IQGA 2B3TA 4TSFD 3LX5A 4ZDIA 3T34A 4Y2VA 1B8VA 3VO1A 3HP1A 3ISVA 3PXBA 1DKMA 5DYIA 1U2RA 4YRIA 4CIDA 2VDRB 1N0UA 3GYBA 1Z18A 3T6KA 2QXTA 4MQFA 2NWQA 1D1NA 1E7WA 2NOAA 3FF1A 1Q0HA 3OLCX 5CITA 3LE8A 2BP7B 2PPVA 3IILA 4QLAA 1OC4A 3H2ZA 5CYPA 3EF3A 1P1CA 5FUVA 2AX4A 4XFKA 4ZVMA 4CL3A 1TZCA 3AMVA 3EZ2A 3KOOA 4GI2A 3EXHB 1KPGA 1ZI9A 3R5TA 4Q12A 4EB8A 5KNDA 2QW0X 1ZSYA 2EYUA 3WHPA 4OHUA 1JEAA 5K0SA 1J1ZA 2FY8A 3IP3A 3IL2A 5KO2A 1NONA 5AVWA 2W2LD 4U8GA 3L0SA 5JECA 5L45A 3KPVA 4MWBA 1DEXA 3N28A 2XBUA 1BCRB 2A1TR 3ONNA 5CHYA 4UVDA 2I66A 4IDBA 5D3KA 2F62A 3AJ8A 2GSDA 3OU7A 3KSRA 5AHOA 3DOUA 3CF4G 3KKPA 1P1BA 4HHEA 5CLIA 1Y7TA 3D3QA 4BDTA 2AQ8A 1VE7A 2YZ7A 1AHPA 3EQ9A 4PHCA 3DE2X 4LZNA 4EFNA 3C70A 4JP2A 5BXQC 4DV0B 1J2UA 1ECFA 2IYYA 3TUIC 1V26A 2WU4A 3AR2A 1W6UA 2Y3IA 1SVOA 2G40A 3ELDA 4IL5A 3GA0A 4MVJM 2AYZA 1N32B 3UB3A 2G9UA 2X9QA 4I5IA 4MEJA 2DETA 2IYRA 4J8PA 1IY0A 4Q1FA 2ZZNA 2HA0A 2HBYA 2ODNA 3DBIA 2P9QA 1Z6QA 4LX8A 4OX9Y 2ZJ4A 3QVGA 4GLJA 2J5KA 4C22A 1CDEA 1W2HA 3OJFA 1GRRA 4B48A 1RAIA 4BFYA 1NRIA 4C5BA 2IYAA 4INJA 4RE6A 2YS6A 1MKYA 2BRUA 1D8AA 2Q1TA 2IH2A 4KFCA 1QOPB 3LQEA 2PRJA 2FWAA 1Q19A 3CLRC 1T36B 5DO9A 2G72A 2JEYA 3KKMA 3LDGA 2X40A 3CRMA 2XH8A 3I2HA 1BGVA 1W2BB 1HQDA 3OTOB 1QRRA 5TF0A 4X7CA 4PN7A 1KQ3A 4JT8A 4PGFA 1OXMA 5MF6A 2Q9AA 3K0FB 4ARSA 3MMNA 1JBQA 3TDNA 2OY0A 3ZDEA 4YRMA 3R4CA 1QDUA 4BVKA 1O0SA 1D6SA 1DBPA 4RDLA 2HPVA 3LO8A 3WK4A 2EBUA 3ZDDA 5HA5A 2RCNA 1C7FA 3AJAA 1CR0A 4Y7CA 2PE5A 1UC4B 4NS1A 4DBVO 3F73A 2ZIUB 1KVUA 1YVDA 2XF8A 3CJQA 4JVMA 5IJ0B 5LXTB 3N6VA 1FSGA 2ZSDA 4FDAA 4PQEA 4F04A 1KYZA 4EQ6B 4GX1A 4COKA 2JF0A 2VTVA 4JXJA 1TVKA 2X42A 3W4JA 5E3JA 2ZT5A 3HDVA 4IH1A 2QTCA 4JBXA 4QPNA 1UAYA 5ILGA 4DHWA 1SCQA 5C32A 1BYIA 3CKKA 3C8MA 3NO4A 5KNCA 5FWAA 2A94A 3TAXA 2J3IA 4E15A 3GOQA 4YX9A 4B3MB 1KIMA 1JNYA 2V55B 2B1GA 3LYAA 2OMKA 5BYBA 3P0IA 1I9GA 4ZT2A 4EB6A 2QTMA 4EI8A 3ASVA 4MARA 2QLNA 4DZTA 3N07A 1KI7A 1XYYA 3HACA 5HRAA 1PQPA 1D2GA 2I2CA 3WFJA 2AE2A 3ZQUA 1Q83A 1PQUA 3MWKA 1GTSA 1KZ9A 1FTSA 3R3UA 1GKIA 4KSCA 2W4MA 3HBAA 1P4GA 2PAFA 2VUUA 3C3WA 3EXG1 2OFPA 2HCBA 4XW2A 5GJVC 2ZJFA 5FLEX 4S1NA 4RX1A 4INZA 2W48A 4Q18A 2Q3LA 2AVDA 2BFEA 3RASA 4FBLA 4XAQA 2Q3HA 4NBRA 3LOUA 2UYQA 1U0SY 3M5PA 2C9ZA 5J40A 4GNRA 3CISA 5F7JA 4TOIA 4J2OA 5FTJA 5U4QA 3TIIA 4BU1A 4LF7B 4UAVA 3IMGA 4OHVA 4ARVA 3I28A 4XKJA 2DX7A 3MK31 1LB1B 3C3XA 3IP9A 3P97A 4JR0A 1I2AA 3NWBA 4ZC1A 2ZRKA 2X4DA 4YIKA 3KLPX 3LQ2A 1DJNA 3KB6A 4ZAZA 4RD6A 4EUSA 5B7PA 2J07A 1NQTA 2O5EA 1CCWA 1HGXA 2W4QA 3H0EA 1CUCA 2KS6A 2P6UA 3GRPA 3LKVA 3PWKA 3A4NA 4BN5A 4O4LF 2W0MA 3LVBA 2Z5VA 2IYNA 4ZQCB 4D74A 2GBIA 2LBPA 1IXSB 4LYJA 5SZKB 3EC7A 1SBCA 1Y6RA 2BFDA 3CKLA 1C3LA 3N5CA 4JFAA 2B34A 5KSYA 1C8LA 4LN1A 1O4WA 2OXCA 1NOJA 5AVOA 1ZK0A 3PR1A 2VJMA 2WVAA 4IHQA 4RLQA 3BJEA 4OP2A 5FQNA 3QVXA 1W44A 3O31A 1WXFA 4IH4A 1XTVA 3HWSA 3VV3A 1PV1A 2D0IA 2PMDA 4EJSA 4RMJA 1ZWKA 3DO5A 3H86A 3DNPA 1GL7A 2PJZA 2BEJA 2BONA 3IE2A 2FR8C 3K4PA 3GVKA 2VJYA 3I04M 1SCUA 3CMMA 1V5WA 5GV7A 2IEYA 2DH5A 2X2OA 3NANA 4RAOA 1XJ0A 2Z83A 2V8OA 3DO6A 4DSNA 3R5HA 3ZX4A 4OJNA 1K9VF 3W8FA 1VQOB 1SCIA 3N76A 4PLZA 1MXFA 5L3QB 4ZRDA 2EZ8A 4YV1A 4CMEC 5IF3A 4ML3A 5LIPA 10MHA 1PT6A 1BRTA 5IKMA 2C4UA 3BE6A 3HJCA 2CXXA 4LGVA 5G1NA 1FA9A 2QRZA 4I6GA 1F48A 1CQIA 3BF8A 3AR9A 3BCUA 4R8SA 1KQOA 2PZMA 1PBNA 3SYKA 4NBSA 1CJCA 2Q0XA 4EFKA 4DAOA 4IS3A 1QC5B 4MVJI 3C7KA 2P8SA 3NOQA 4MMZB 1P7YA 4QDKA 2UU9B 2C96A 5FV7A 2VTDA 1U0TA 3QPUA 3DZGA 3U5TA 1XIVA 3WX0A 1IONA 2ZUEA 4EW6A 3N8GA 3ZNOA 1MMFB 2XCUA 2BH9A 1JA9A 1JAZA 3HBLA 1L7NA 2QS9A 1Z5PA 3E3MA 4YACA 4ARUA 2A58A 4Q19A 3JQ8A 5EJ2A 1XA4A 4YCMA 4HLQB 3M7IA 2F3QA 3PD7A 5D86A 4J7CA 3RUPA 1RXIA 1QS0B 5GZ6A 1X1DA 3ZNPA 1E2JA 2BHSA 3EJ6A 3CPSA 3EG9A 1CJVC 1WE2A 2Q4BA 2ZTMA 4K81B 3UUGA 5AKHA 4FHGA 1ISPA 4KGDA 4NMHA 1VLYA 3VR4A 4AJ1A 5AVUA 1PHPA 4RHYA 2JASA 2QTLA 2J6IA 1SPXA 2YWJA 2IWRA 5KVAA 1K6MA 1QWOA 4AUMA 1JQEA 1UP7A 2X5OA 3R5SA 2ORED 3CC8A 5TS2A 5L9AA 3E3AA 4Z4TA 1DQPA 2QL9A 3MJFA 5JADA 3MELA 3LUCA 4EG8A 1KO8A 4BLPA 5GP1A 3KQSA 5B3AA 3Q3IA 1JZSA 2NACA 2ZPTX 4KGVA 2V4MA 2VPPA 3TD2A 2IHTA 2R85A 3E3OA 1RWWA 1WKBA 3R0ZA 1Z2OX 3W5BA 4KMSA 5L40A 1OPXA 4I9UA 3PXGA 4FSXA 2HF8A 5CP8A 2R87A 1DC5A 4IMRA 5TJ9A 1IZ9A 5TR9A 2PGLA 5KINB 4C0SA 2LPMA 5JCPA 1ZIOA 2HK7A 5TLSA 2ZIEA 3Q9SA 3O3NB 1N6NA 2OG2A 3EVAA 1VJ5A 1JG2A 3OMWA 2SICE 1BROA 1E79A 3L4EA 1F8UA 3P9IA 4OP1A 2FW9A 2WU8A 3FB1A 5LWHA 1UM9A 1Q7EA 3FIJA 3IVXA 4EA7A 4XCXA 1ISFA 2PQ6A 1MJFA 1AXRA 4N3AA 4RFSA 1NTOA 2YN2A 1JZQA 3M82A 4OGLA 1A1VA 2DUUA 2GM5A 2Q7OE 3GLGE 4FILA 2C3YA 8ABPA 1FUYB 1QKKA 1L7VC 3G2MA 4W5HA 1L5NA 3NBYC 4R8RA 3IMFA 3MF4A 3EA0A 4HOYA 1ZAKA 2FQYA 4TTSA 3VR2A 1KO7A 2F64A 3EQ6A 5JBNA 3T7DA 5CLQA 2RSLA 4BVHA 2X76A 2FFRA 3IBGA 4RHCA 4K8RB 1DLJA 2RBKA 3VHRA 1O6GA 3BMOB 1I5EA 4LW8A 4LMAA 3BH4A 2QAIA 5HOQA 4RM0A 4HUQB 3UANA 1KY3A 5E9WA 4DJTA 3A1PA 4CLRA 3CYFA 1JMYA 2FZEA 1GZDA 1EM8B 4DCGA 5KTKA 1IHDA 4BKMA 1NP6A 4LJ5A 4X95A 1GYRA 5CB4F 2PGNA 2ZRCA 3JAWB 3QLVC 3ECSA 3EVCA 1FDSA 3JSXA 5LBIA 4DV5B 2FLVA 5JNSA 5JZVA 3T12A 3CESA 4LKRA 3UAVA 2BCJQ 1WZUA 2ZRGA 1XN4A 5EPEA 5I7OA 3G2JA 4QBTA 2FW1A 2W43A 1NUQA 2VWGA 2YIVX 3W7BA 3QSYA 5H80A 1PW7A 5AW8A 5JFGA 2D4AA 3AU9A 4HJRA 1HDYA 1IULA 4F1WA 1AX9A 1V4BA 3KQWA 3WJ2A 3UG7A 3GT7A 3ZWNA 4FPXA 1EK0A 3ZV3A 1ACLA 1PG0A 5C5DA 5EQDA 4D4JA 3D6NB 1KP9A 2NAFA 1TZMA 1GOTA 2J5RA 4FC6A 1W52X 4ZZ3A 1PEDA 5A9RA 1I6KA 1EVQA 2OV8A 3ZQJA 3RRMA 1L3BA 3CRQA 3EVTA 5ADVA 5FKJA 5C46F 1PTJA 3KSUA 4MGHA 4NOJA 3OTIA 5C1IA 2A9RA 3RHTA 4ND8A 3VFDA 4ZMBA 1DQRA 2ATEA 1JB9A 3L05A 3RVOA 4BB5A 3RG8A 1IN1A 1WVIA 4KPGA 2I3GA 4O2RA 3B1KA 2WG0A 3JASA 4P08A 3ROPA 5B7NA 3ZD7A 1DAGA 1ZM4A 1WXIA 4XVCA 1UH5A 3K05A 4R3UC 1D2RA 1A4RA 3RSHA 1QLJA 3REFA 1FE8A 2GZDA 8MHTA 5EERA 2IEZA 3ENNA 4F38A 1U0BB 5T41A 4G8BA 2JFOA 4Z49A 1E58A 5COAA 1OLUA 3L8DA 5CHEA 1UBEA 1FTYA 3A4VA 3IKMB 2PQ0A 4PZCA 1MJGM 1UPTA 4MGZR 4F5DA 1Y6QA 5DOZA 2IS6A 3D1JA 3UW3A 4AJHA 2HU5A 4BO9A 1H5QA 3KT6A 1VYUA 1JX6A 1KGDA 2YINC 3FI0A 3IESA 5TMBA 4ER7A 5K6AC 4L3OA 3G2KA 2ZKIA 4QOFA 4C07A 1G20E 4D3YA 3TDKA 2POQX 2NADA 4ZREA 1JRLA 2YMQA 5BN5B 1OFGA 1OYYA 4EB3A 2XNSA 4BXOB 4F7DA 3A2KA 4DB2A 4MVJE 1BKYA 2VHZA 1B23P 1VMIA 4R83A 2G1AA 2Y6VA 4QE3A 1N9GB 2AV6A 2C7RA 1OTYA 1I3OA 2FSGA 4E3ZA 1NP7A 1GZVA 1H65A 5DWQA 4ETNA 1UK8A 3UJBA 2ZZMA 4A8TA 2XDAA 2ZRAA 1ZJ5A 1ODFA 2FCRA 2P9EA 3PDHA 3AI7A 4NULA 4RVFA 4AJ2A 3KCQA 1W36C 4NTZA 2FPKA 5K3FA 3OZGA 4KAFA 4E32A 2PWPA 4I4TB 2V59A 3JY6A 3OPXA 1QGED 4Y2XA 2VI5A 3TUZC 2GN2A 4HRYA 4J2HA 3E8MA 3JQRA 4O4JA 3ICQB 4BB6A 2B83A 4PSDA 2HA2A 5E7MA 4NBWA 5CAEB 1H8EA 3O3CA 1MW9X 3OIDA 4M0DA 1SU4A 3NHBA 3ZS8A 3H84A 2A3NA 2DT5A 5H82A 4F7WA 1U0HC 4YJ2A 1XI2A 2ZR0A 3JYHA 2HLPA 4Z4EA 4LZOA 5EC8A 5H81A 3RVPA 1FUUA 2W58A 2VTBA 1G20B 2AD5A 5CFQA 1FDTA 1WVGA 1MOQA 2WHPB 3PPYA 3LPMA 3ZK7A 4E2ZA 2JCXA 5LQMA 2JA1A 2ATCA 1MEOA 3CRVA 4MW4A 3W9SA 4ECAA 4XB6B 1X8XA 2HUPA 1NAIA 5H4HA 1R74A 1BCRA 5AJHA 4LZZA 3AY6A 1YK0A 4ENQA 4X8IA 1W4AA 2EFCB 2Q0QA 4IIVA 2FUEA 4INAA 2CDAA 4J90A 4KIFA 3L7KA 4RSHA 3ZEAA 4YCLA 1YR3A 3A27A 1QG2A 3W3AD 1Z16A 1RI2A 3BWVA 1E4EB 1UEXC 2J85A 3U7RA 2O2IA 4D9MA 2RGWA 3U4IA 4FQ7A 4DR7B 1BGWA 4U7HA 4HZUA 1JW9B 3ZW8A 3BGDA 1JU4A 3WGVA 5AHKA 1MX9A 2XT6A 1ZJ4A 3MUNA 4MQLA 4WTOA 3G9UA 4Y1FA 5C51B 3C1AA 5CTAA 4M89A 2QTNA 1Z7BA 3G1WA 3T7TA 2P6RA 1DBWA 3P0RA 1ZNXA 2P2YA 3EEIA 3P9RA 4NBNA 1WMBA 5LXTF 2XUIA 1YB6A 4RWEA 1XTTA 3QNUA 4XE5A 2ZTSA 1V48A 1G2OA 4Y1RA 1YITB 1P0QA 4GSYA 1N5MA 3HFRA 4FD3A 2DOGA 4ZODA 2VRBA 4F60A 1BFKA 1AQNA 3DV9A 3PI7A 2W93A 4KV9A 5DP2A 1CR6A 3QKTA 4J7XA 4QU8A 4WNAB 4PYOA 2XB4A 1WXDA 2VF7A 5D51S 3W6NA 1ZJYA 2ZTGA 5HCNA 2IQ5A 3IERA 4BFXA 4JBGA 4FM9A 3HB0A 3RC8A 1YR9A 3OZSA 4KACA 3WV4A 4RZ3A 4P2BA 4QBKA 5FWYB 4B7ZA 2ZW9A 5FORA 5FH9A 4NFHA 3V8RA 5DX8A 5ICCA 4P3KA 1RLTA 3DKIA 4XDZA 2K6GA 1U3UA 2G88A 3E58A 3V4ZA 2GD6A 2EZ4A 4X3PA 1KNQA 4YDRA 1KVSA 1N2CB 1S96A 5AVVA 2NU6B 4DEVA 1CDOA 1G8JA 4Y18A 3EHDA 3EJWA 3HDYA 4FW9A 5ECGC 2C54A 1SD2A 2B37A 2PH5A 2OHXA 1NURA 5JI3E 3TZBA 3LCMA 2C0CA 2BMVA 1V8BA 3E22A 3WA6A 1Q84A 1TJYA 3QITA 2PZKA 5I9IA 1R0WA 2Y71A 3ZWDA 4ER5A 3VDNB 4YRKA 1AKEA 1H6BA 1JNXX 2Z98A 5EWMB 3HB9A 4J1TC 4OXXA 3GZTB 2WD8A 1MQAA 1V7ZA 1KI2A 2B3DA 7GPBA 1FFEA 3K73O 5LC1A 2C03A 1DMSA 2BGWA 2Z1DA 3HEBA 1VI6A 3HNPA 1D09A 1E9FA 1X0XA 1N5KA 2ZR7A 3PA8A 3SEJA 4ZD6A 1U04A 3R7FA 1VCNA 1ZNWA 2HMSA 3IXQA 3B1ZA 1N06A 3TXAA 3B82A 1HNWB 1G55A 1OIVA 2GCPA 4FFNA 3K2BA 1TA9A 4F9GA 3JQEA 4BVFA 4G8CA 3L8EA 2AI3A 3H2GA 3ZNNA 5F9FA 2HA3A 4I9NA 4M9SA 2EKZA 4KPUA 3LUFA 4RQTA 4RETA 3KUCA 5JUWA 4LAFA 4TSRA 2I4MA 3BFKA 4BV2A 3S8MA 4QOSA 2Z9BA 3B3GA 1F1BA 2Q21A 1XRQA 3PC8C 1KXJA 3QOXA 3INGA 3W8RA 2ASVA 3HG7A 3HEMA 1L4YA 3GMDA 4XOUA 3X1YA 1BMFA 1ZD4A 1QPZA 2L42A 1MENA 4JFRA 4KV7A 1LKZA 1H4SA 1V7PC 3P2MA 4KX5A 3R9IA 1YA8A 3HI6A 3ZBPA 3BERA 4P0TA 4LTMA 4UCQA 4FN4A 3T1VA 5TQVA 2PGOA 4ZCLA 1RAEA 3I72A 2VSNA 1XALA 3QXCA 4B33A 5BNZA 4KREA 4FR0A 2DERA 1KO5A 4GPZA 3OQNA 2JD1A 5EI5A 4BQIA 1ZW1A 4EENA 2AK3A 2CMDA 2DTEA 2AXNA 4UUBA 1W2GA 1MO4A 2IU6A 2VYND 3LSYA 4NK4A 4EW3A 5LLSA 1EXVA 1N5JA 3AVTA 1RBQA 2A9PA 4DLNA 1YFJA 1GVHA 3IMEA 3O5AA 3I32A 3KS9A 6ABPA 2VJOA 3OJ0A 2Q0SA 1KQFA 3GP5A 5DSTA 3UHPA 1ZNZA 4JI8B 1YBAA 4KQGA 4HDSA 4DCJA 2YFHA 5L3QA 2Y2UA 3WWYA 5H9VA 3IDAA 3NGMA 3X43A 4TYNA 2OQIA 2REXB 3WMXA 1QE0A 4Y2TA 2AWNA 1OGJA 1T2UA 4N0DA 3OI7A 4MCJA 5F3DA 1NVEA 1QC5A 1XHEA 2I6FA 2O8NA 3IQIX 4TLBA 4ZKDA 5LP6B 2XZDA 1G4AE 3CHYA 2QTVA 4MAAA 4YWJA 4LPSA 3CTAA 1VJDA 1MB3A 1U1DA 4V24A 1V8ZA 1FDVA 5LQSA 3H8VA 4B71A 3FSGA 4DWJA 1SOAA 1NQUA 3JRXA 3KLMX 2QVLA 1OT3A 4GE3A 4D82A 1R50A 5FA5A 4HDNB 5F35A 1EHYA 4QHYA 1CK4A 2E2WA 2XF2A 5BV0A 4V2UA 3F1LA 1FMJA 2H0AA 3PC3A 4YP9A 1UJCA 1IPFA 4KVAA 3U3DA 1WZ2A 5IDYA 4P2NA 3GRUA 4PBSA 3PNQA 5IBCA 2FEPA 2VH2A 3L7YA 4BNXA 2BM8A 1YRHA 1XBTA 3AJ9A 1RRVA 1M2OB 1ZCBA 3FOZA 1Z3IX 2DWQA 3H87A 3AI2A 3JTMA 3DTNA 4HEA6 4NMMA 3VR5A 1M90D 2X6YA 5KQPA 1RXCA 3ASPA 1NLYA 2AN9A 2VJCA 4PHHA 2B9EA 4RAQA 4RHEA 1Q5PA 3UTCA 3D7RA 1Y7IA 4DMFA 5KTOA 5DM2A 1GNLA 3EGEA 5C3UA 2XDWA 3RWOA 4MWDA 4ZZ2A 5DLPA 1UZUA 4P83A 1TKAA 4YO7A 5KQMA 1KSGA 2J3LA 3SIXA 1GTMA 1IZ7A 2W22A 1K75A 1CE8A 3DULA 3GFPA 3WHKA 3VC1A 5BVGA 2G04A 1S4QA 3PQ5A 1SOMA 4Z86A 1L7DA 2XKBA 1J9GA 5FPPA 2BDEA 3PPIA 1UPXA 4D0GA 5I7HA 3PG5A 4IJUA 4DV4B 1DPGA 3GMTA 1ESNA 4M1TA 4FHZA 2I4IA 4E4TA 3U4QB 1PJTA 5CXSA 3FWKA 2KBFA 1VB3A 1XDBA 4BP9A 5AMXA 5JS6A 3EIQA 4RORA 3RFXA 3LQ1A 1KPIA 4RGQA 3BTSA 4MQ6A 3WKBA 2VF4X 2M1XA 4W6QA 1G5HA 3V2HA 3VHXB 4D5EA 3V4FA 2H0RA 3QFFA 4GRDA 2EX4A 4EA9A 4ZQFA 4C4YA 4XVRA 3ONYA 1S1CA 1SOWA 4GX0A 3H5OA 2QLLA 1AT1A 1WP4A 4R4JA 4R1NA 4O08A 3JWPA 2PZEA 4BRSA 4KSBA 1I10A 3DT6A 4PSKA 3V8QA 1EUYA 3PC7A 4PSCA 5KEIA 4GL2A 2R8YA 1T3TA 4NR0A 1YZ3A 5BWOA 4PG5A 3E53A 5CVUA 3ADDA 4MUIA 4BJ3A 2E48A 1DOHA 4P5EA 3JAWA 3ASRA 2C83A 4S2UA 1T6ZA 2VXCA 4H7IA 3WQBA 1XXHA 2O20A 3LBIA 3QVUA 1ZXBA 3EQ2A 4PINA 3SIWA 2PVPA 3UMVA 3PNYA 2JZOA 4YMTA 4MUJA 4LRQA 1YJAA 4YUYA 1NM5A 2CJPA 5NULA 3VPHA 1QAOA 2XE6A 4QEZA 3VTZA 4P81A 2QN9A 2UZ1B 3OM9A 3UUEA 4KFUA 4DJJA 5KJ1A 1U94A 3G2HA 2R79A 5J35A 2N9UA 1N92A 1D4OA 3IBTA 4LYYA 3K15A 3EMVA 4YV7A 4QL3A 5GM2A 1DBIA 3D4BA 2JHFA 4MXDA 4ZOCA 1E62A 3GLGA 1MHTA 4M49A 2GEJA 2AWOA 1OFTA 4A36A 2P9BA 2QD1A 1DFGA 3ADPA 2ZUFA 3H5RA 4K9KA 2J3DA 1JJFA 2PLFA 1E9RA 3HHEA 3OCVA 3DMDA 1UFQA 1JSZA 4LECA 4ARBA 4PLFA 4DVJA 4UHDA 1G8MA 4LV5B 4UMEA 4N76A 3B3JA 3EZGA 1VXRA 3TK1A 2O9JA 4EPWA 1P2BA 1E3MA 3LFHA 1A27A 5A9SB 3JARA 5ESWA 5LA6B 1IJEA 1DTWB 1Z8HA 2VAXA 4UJ3A 5IAJA 4LY3A 3HFGA 4IF4A 2C4TA 3PI6A 2P6NA 4I1VA 4HVTA 2Z3WA 4QWWA 1YE8A 4HNTA 2R8RA 4NCJA 3UV7A 3W2IA 1G8HA 2OYRA 3RC9A 4ZI3A 3WLLA 3KHUA 1SC4A 1NUSA 4I4TF 2CXNA 3U19A 4BO8A 2FLWA 2I6XA 4IFBA 4S2EA 5AVJA 4GPEA 1WA5A 2I76A 1RHRA 3RLIA 4FOOA 1XZJA 2GA8A 2HU7A 1KEUA 4KX3A 1CY7A 4MR9A 2FPIB 1IAVA 3IIIA 1ZCJA 4E5SA 3A4LA 5EP3A 2PMWB 5FUXA 1GHTA 1V5FA 1Q3TA 1ZY2A 2E87A 3AHDA 3Q7PA 5IAEA 3S68A 4E70A 4F21A 3H1PA 1YJ5A 1G291 2A84A