4C43A

Ferredoxin nadp reductase mutant with glu 103 replaced by tyr, tyr 104 replaced by phe, ser 109 replaced by phe and gly 110 replaced by pro (e103y-y104f-s109f-g110p)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLYFKHPEFPETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title External Loops at the Ferredoxin-Nadp(+) Reductase Protein-Partner Binding Cavity Contribute to Substrates Allocation.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4c43A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4c43A02
3ZZUA 4YHBA 1ZM2A 2VNHA 4RD2A 1ZM4A 1JA0A 2BV3A 2BN4A 3ZBTA 1KD1D 1EFCA 3CB4A 1GJRA 1E64A 2BPOA 2E1RA 1QVFB 4NCNA 1CNFA 3E1YE 3ZBUA 1G7SA 1FNDA 4PC3A 2PIAA 1B2RA 3VO2A 3LO8A 3JQQA 3I56B 2HMAA 1B23P 5TR9A 5GV8A 1HA3A 2B7BA 1U2RA 3G71B 2D74A 4LBZA 2YWHA 2B7CA 3VNUA 1Q7YD 4BPRA 4G1BA 2PLFA 4J0QA 1D2EA 1XE1A 3AVWA 2QN6A 3E20A 3FJOA 1EP1B 3W2EA 1QGYA 4K1XA 1VQLB 1FNCA 1KK1A 4YALA 3U2QA 2BSAA 2QDXA 4B47A 5JBQA 3LYUA 2VYQA 3OJXA 1TTTA 4IW3B 1DDGA 1GO2A 1SM4A 4Y7CA 4RCZA 4G5GA 1IJEA 1QG0A 5TV2A 4EH1A 2X3UA 4ACBA 1H42A 2YWGA 1DARA 3AVVA 3QFRA 4TN1A 3W2FA 3W5UA 2OK7A 1TLLA 3VO1A 3CCLB 3AVUA 2VZLA 4LC0A 1W34A 4C43A 4YAUA 2RC6A 4TMXA 1YITB 4ZCLA 1QX4A 2CNDA 4TMWA 4Y9UA 1VQ7B 4PC7A 1G7TA 1VQ9B 3CCRB 1FDRA 1N0VC 2BMWA 4AF7A 3AGPA 3OZWA 4HE6A 3WXMA 3W2GA 3WY9A 4UAJA 1VQ8B 3CCMB 3CW2A 1OGIA 3AVYA 2VNIA 3JQPA 2BM1A 3P26A 3QFCA 1XB2A 3SJZA 4RD6A 1OB2A 1AMOA 1VQ6B 4TMZA 2XNCA 1ZUNB 4YAOA 5AN9A 3CD6B 3U6KA 1K8AD 2EFGA 1NJID 1Q82D 2FX3A 1QVGB 2QTZA 5H5JA 4FN5A 3W2HA 1A8PA 1DG1G 3W5HA 3QSYA 3CCQB 3WNCA 4M1KA 1OB5A 1EP2B 2ZITA 2B5OA 4HE5A 5FA6A 1YIJB 3CPWB 1YJWB 3ZZTA 3A1FA 4QFMA 2BVNA 1QFYA 2VNJA 4AF6A 3MMPA 2DERA 4G1VA 2YWEA 4M53A 4TMVA 1N0UA 1TVCA 3JQRA 4ACAA 3CMEB 1ZM3A 3LRXA 1VQPB 1G7CA 1I7PA 1QH0A 2HDNB 4DQKA 2C77A 4DQLA 1ELOA 3W2IA 1D1NA 3B8HA 1FRQA 2BGJA 2C78A 4RJLA 1G7RA 3LVBA 1KJZA 1JB9A 1QUFA 3CCVB 2OTLB 1ZM9A 1SKQA 1N8RD 1M1KD 2QA4B 1FRNA 4NBSA 1Q86D 4Y9RA 4LBWA 5GV7A 4RD4A 4N3GA 3WBKA 3OW2B 1KK0A 1WDTA 3WBJA 4AC9A 1OGJA 1YHQB 1YJNB 1EFUA 4ZV4A 3I55B 1H85A 1IB0A 4WQMA 5THXA 1VQ5B 4R71A 1K73D 1NDHA 2EIXA 4ZCIA 2YWFA 3CC4B 3WNBA 4PC2A 3B78A 3VMFA 4Q7JB 4P6VF 3ZZ0A 1VQKB 1D8TA 5H59A 1FNMA 3OZUA 3CCSB 1QFJA 1Q81D 3G4SB 1KK3A 1F60A 4PC1A 3FPKA 4YAWA 4B43A 1EXMA 1E62A 1W2BB 1JA1A 2DEUA 1CQXA 1J9ZA 1JJ2B 1AIPA 1GAQA 4MYTA 2HCJB 1YI2B 3QE2A 3CC7B 1R5NA 1KC8D 2OTJB 4RD3A 2XEXA 1GVHA 1W35A 4B3XA 1BJKA 1S0UA 1KQSB 4M0LA 1YJ9B 2BGIA 1JNYA 1BX1A 2R6HA 3G6EB 5EMNA 1M90D 3AGQA 5HXBA 2GQFA 1QFZA 4QHYA 5KSWB 3OJWA 4B4DA 2CRVA 4RCYA 4PC6A 1UMKA 1QGZA 2XNJA 4RD0A 1EWYA 3WNDA 1DDIA 1R5BA 2RC5A 1BX0A 3CCUB 4PGOA 3P27A 4FK8A 2AHOA 3V76A 1IJFA 1VQ4B 3OZVA 1R5OA 3U6BA 3ES9A 1VQOB 3QFTA 4U9UA 1EP3B 1CNEA 1EFTA 1GR1A 2QMUA 3CRZA 2BM0A 4YAFA 2PMDA 3CXCB 3WYAA 4B48A 3CMAB 3J81k 4LBVA 3VNVA 3B82A 4LBYA 1F20A 1FNBA 2BF4A 1K9MD 4TMTA 1KTVA 3PENA 4F7DA 3AVTA 2NPFA 3CCJB 2GPJA 3I1FA 2DY1A 3QFSA 1S72B 4MYUA 5TY0A 3W5VA 4ZCMA 2DETA 1BQEA 4M2LA 4H9GA 1KK2A 1QGAA 4C0SA 2QEXB 4P3YA 3ZC3A 4FWTA 3CC2B 2VNKA 2OK8A 3CCEB 3MHPA 4M4SA 4ZGNB 3AVXA 4RD1A 1W87A 1GAWA 1VQNB 2QTLA 1TUIA 4ZGQB 2J7KA 3MCAA 4N3NA 5DSZA 1E63A 1VQMB 4B44A 1KRHA 2DCUA 1QUEA
chains in the Genus database with same CATH superfamily
3ECSA 1XG5A 2PWAA 3L0YA 2CDNA 1OX4A 1TZCA 2D0IA 1V16B 2NG1A 2QXUA 2DKFA 1ZM4A 5IT0A 2NU7B 4IJ6A 5LQMA 1FYEA 4KTVE 4L3OA 2HBYA 2IRWA 2F1MA 3SZGA 1KD1D 1XVLA 5CDHA 1Y4SA 2VP4A 1PKVA 2Y0CA 4UUOA 3ZTYA 5L3SA 3DOFA 5ALZA 1TB4A 5ALOA 4WT7A 1JAYA 3K6JA 3RC7A 2NQ2C 3E1YE 5JV5A 1ZJ5A 3WGJA 3PUIA 5DM2A 4GQBA 4OLJA 1V5FA 4Z7JA 1ULUA 2WWWA 4QYIA 4DSOA 4YECA 3TD6A 3U3DA 1PT5A 1NKTA 1SCKA 1TL7C 3SVTA 1DXOA 1QYCA 1X1DA 4GG1A 1G9XA 2ECOA 1G9TA 5EHNA 1KRWA 4PXYA 1UXJA 4CKEA 4LQLA 2GBLA 5EJ7A 2CXSA 1B8PA 2C0PA 3ABRB 3BRQA 3CXUA 4BAZA 3WRYC 3WLQA 3AL2A 3KT3A 3LKZA 1WXFA 3BE5A 4ZAFA 1BWPA 1C0EA 3HU5A 4FEYA 2Y2VA 1JIJA 5CXUA 3WGZA 5K99A 2J67A 3KJIA 4KMRA 4NE7A 1BD4A 1WEKA 3G71B 4U2DA 3WDKA 4HV4A 4D0RA 4WDRA 4DV1B 5EJ5A 4ADSG 4MA4A 2NVWA 1Q1ZA 5JC1A 3NPAA 5BPHA 1TX4B 3FKSA 2A9OA 3G0HA 2C2OA 3L0BA 5FORA 3TTTA 5CA0B 2GA9A 4RVOA 5BW4A 1UBLS 3HJHA 1BLIA 4HYEA 4PGFA 4AN0A 1TM1E 1WMEA 4WGGA 4G1BA 2QRLA 3B2QA 2FR1A 3C8UA 3AJRA 5ALHA 5F3DA 4EQ6B 3ZWMA 1LX7A 1V7ZA 4S1TA 1AQYA 2V4MA 3U4MA 3IXLA 5BWCA 3CX4A 4KDCA 4ZT3A 1LKZA 1GZVA 1TU3A 2K7ZA 2XUGA 2Q3DA 2YIJA 2WF8A 3LC1O 2O7SA 1B3BA 1PJ8A 1WLYA 3B89A 4UW9A 3LT2A 2XCOA 4XASA 3P1JA 3SHQA 3T9AA 4CNQA 1EINA 3ET4A 4EGFA 4EB8A 2OORA 1LJUA 3DDZX 4CQMD 1WSBA 2BFAA 3NRCA 4U6QA 3N3BC 3UUEA 4RVNA 3VJRA 3FR8A 3PHIA 3X1KA 2Z3ZA 4KQ2A 1U1IA 4KXWA 1V9SA 3V2UA 1PJAA 4YCMA 1Z4OA 3WQQA 3BGIA 4E2FA 2C4UA 2QTRA 3O47A 5JUWA 5AI5A 1VHTA 3TXXA 3I9V6 5TGTA 4C5BA 1D8AA 1LVGA 1VCOA 1GOTA 1I5OA 5IFKA 1XMQB 3LY7A 3RC1A 3E0XA 2GXQA 3GEEA 3Q0EA 4BNUA 4J0CA 3E6AA 3TEFA 4BU1A 3IVAA 1XCMA 5LDHA 5HCUA 5GONF 2BCGY 3DP9A 3FPSA 3WADA 1L4BA 2BEUA 1Z34A 5CH5A 4XYLA 5CR9A 2O2DA 2F9FA 4Y7CA 1A50B 2W6MA 3PJEA 3K6SB 2HXSA 2QL9A 1AMNA 4G5GA 4L75A 1GFIA 1R6UA 2CXHA 2J85A 1U81A 4U2GA 3A0RB 5CA1B 5KPJA 1BS9A 3H5TA 2B3DA 2TMDA 3OFND 3EZXA 4HDSB 4Q9JA 4S05A 4HRVA 3G7NA 3GP5A 4FZVA 4TPKA 3RYFB 1N77A 2FMTA 1O08A 5LU8A 4L95C 2O1SA 3D6TB 5HQJA 1YOVA 4I3HA 2VDNB 2ZYAA 3I0NA 1CV2A 4G5SA 3TTWA 1X87A 4D8TA 2PMKA 3DYIA 4AKEA 3UK2A 1KJ9A 2QSYA 1HE1C 1IONA 1Y6JA 1NJGA 1TNDA 4QA9A 1U7TA 1QU2A 4UD2A 5G1PA 1MIOA 1GPJA 1HT3A 4L8VA 5L4LA 2C3YA 2YFQA 3GHHA 3DXYA 2F1HA 4ME6A 4BTLA 1CS0A 4UZFA 1MQSA 1JA9A 2QJWA 2V6FA 2ZI7A 3PC7A 4B6JA 4ZQIA 1Y82A 1WZNA 1ZUNA 2BR5A 3GFBA 4XTRA 5MN4A 3QEMB 1FP2A 1R4NB 2CE2X 5ELLA 2ZSHA 3EEIA 5K0TA 4MDEA 3C6MA 3CCRB 2SBTA 1D1SA 1XYVA 1C1DA 3RY8A 3A9UA 4RQUA 3ZTTA 3QBEA 4RC9A 4DUPA 1U3UA 3K9WA 1JMYA 3AF6A 1Y8QB 1Y3AA 2OP0A 2Y0EA 4G4GA 2HLPA 4UE2A 2V7QD 2J6IA 4RPGA 5F78A 2ZB2A 4BMOB 4BX0A 3ZLJA 3GP3A 1M8KA 3ON5A 4UAJA 5CT6A 1R4MA 2H2WA 2NO9A 1UBGA 2ZSDA 3K5WA 3LQFA 4OU4A 3FVRA 2PAAA 4PLHA 3Q6NA 2C5GA 4UBKA 3ZCUA 4BQEA 4I4TA 2OCLA 3L0DA 1PVDA 2BKLA 3SKVA 4QTXA 1CUEA 2ZSKA 2FF5A 4I1YA 3U3MA 3FPPA 3RVOA 5JTTA 1X1TA 1ZZEA 1E9VA 1CUVA 2O0HA 3C14C 4IIGA 8ATCA 3DBRA 3A36A 5AM4A 2BKEA 5GM2A 4I55F 4M7OA 3INYA 3OHPA 4BUCA 3R7AA 2F6RA 2D8MA 3AR4A 4WKBA 4RTSA 3OTQA 1VYVA 3OLYA 4KIJA 5FP0A 3T0IA 3ZQ4A 2H17A 3T7SA 1ZONA 3CUSA 4QFDA 3RVRA 2VRBA 1QH8B 4WXMA 5AVJA 2DPGA 4DAOA 5BXYA 3DFUA 1S6YA 2QRJA 5BOVA 1T6ZA 1AT1A 1XALA 5E2AA 2ZM6B 1HEUA 1Q2UA 1W0JD 2RAUA 1VXOA 1FFAA 2GD1O 3L4EA 4FYMA 4QOJA 4FGUA 1AZLA 3PEFA 1FDTA 3HAGA 5AWFC 5ILGA 1BVUA 1NQTA 1W1UA 5GOTA 2XNKA 3OEHA 2ZULA 1RM5A 2H1LA 3LPMA 1OC4A 4FC7A 1ZGBA 3SYTA 3TBFA 4HXGA 5F51A 3UJHA 3WP0A 3CX3A 3MYRA 3M7IA 2R6ZA 2YX1A 1XMJA 1AA6A 1ONPA 4MYDA 3W8RA 2HRDA 2IIBA 4OXYA 1Z8HA 3PWZA 2VZ9A 4MPJA 4HQLA 1JV2B 2PL1A 1G16A 2YWRA 3IJEB 3TCKA 2OHVA 2AA3A 5FPHA 2RARA 3PXGA 2GX6A 4IMIB 3VC2A 1JTVA 3WLPA 2Z4TA 2YWBA 3VXKA 3A1FA 2XWSA 2F8SA 2OHGA 5EG5A 4C1BA 3TDNA 1G5QA 3B48A 4KKXB 3OAAA 2ZT8A 4LTDA 2ADMA 4QELA 2IZ5A 1YHNA 3LTNC 2J9RA 1EIWA 4QGBA 3GNLA 4B3GA 5ER9A 3TIIA 1NWCA 5KWEA 4OFBA 2C7RA 1VB5A 2CN1A 1NMZA 2HJGA 3R5JA 3HKEA 5BYBA 2O8DB 3V4PB 2MINB 2B2CA 3TL2A 2OSVA 3ZK8A 4DGQA 5BWBA 4ACAA 1E43A 1RM3A 2RJOA 3FWZA 1O7JA 5FAXA 2JAWA 4WI1A 2ZTHA 4H7FA 3OBBA 1V3TA 4XQGA 5CYGA 1T9ZA 3F6SA 3CNOA 4MKHA 2BAGA 1AK2A 3OIGA 2H1WA 3D4OA 5KQRA 1MU0A 4TWAA 2Q6KA 4W7IA 4EGQA 1T5LA 1L7AA 2CNNA 3P32A 3RFFA 3E8MA 4DIOA 2H4JA 1R0SA 2HMTA 4OQLA 3AHFA 5FRDA 4ENVA 1PJCA 3DTVD 5JI3E 3LVBA 4RZXA 3CVOA 3TTSA 3CGWA 5L40A 1P81A 1H6BA 2ZUUA 2PAFA 1U5CA 4GBED 4RL6A 1BHSA 2NYVA 4R1LA 4X3OA 5FWXA 1KR2A 1YASA 3DOOA 3W4KA 4CG2A 3O73A 4XGRA 4G25A 3ZHXA 1K1EA 2CBXA 1QVVA 3KSUA 4BVAA 1YVPA 3EA5A 4KLCA 1YQTA 1V2GA 3MYYA 4R01A 3ZE0B 4OHWA 3R4CA 3N7TA 1YCFA 1TIPA 4JC5A 3PC8A 3JZIA 4QD3A 2HAEA 1CC1S 1P39A 2J0VA 4K6CA 5AICA 2WM2A 1DAHA 4N3GA 3ZI0A 1NSFA 1LNQA 1BWSA 3WV4A 3H1PA 2QVCA 5CIWA 3U7JA 2Q4BA 5CM9C 1DRKA 1BMDA 2NTJA 4BXOA 4F11A 1KZHA 2C99A 4KO1S 5BSFA 3GJXC 2AFHE 2MMGA 4AM8A 5IULC 1XNQB 5HK9A 5EMMA 4ZVLA 2B83A 1C7FA 3EHEA 4PXSA 4EJ0A 1MOPA 4C0JA 1RAEA 3RBXA 1WO8A 3PLNA 3HLKA 1NVVR 5J23A 2AI3A 4BN4A 5C7YA 3NTLA 3DOUA 4ZCIA 4LXIA 5A0FA 1C4WA 3ASUA 5JD6A 3FZGA 3PEVA 3M6UA 4BP8A 1UD3A 4RTNA 1PL6A 1ISRA 4MAAA 2GJ4A 3WLLA 1N2ZA 4LJKA 3FPAA 1YR7A 1Y7PA 2CXRA 4NCBA 1YJAA 5TGZA 1P3JA 2AR0A 3G5AA 5D1HA 5CG2A 4CIBA 3H1EA 5I8WA 1T3LA 2ZTNA 1CTQA 4LE1A 2EZUA 2G1AA 4OUDA 4X3PA 4Z2AA 1L6IA 2CJFA 3FGOA 4BQOA 3W5BA 2PXHA 2Y1XA 1K7XB 4CMJA 5KTPA 1ZHFA 4JY7A 4WZBA 1SXHA 5ARBA 2IPNA 1L8OA 2VTVA 1K2VN 1E5VA 2G8NA 2VSOA 2AKAB 4NPAA 2F62A 1I1QB 3V8VA 3W78A 2EDAA 1JLRA 1KQPA 1E8NA 5A4JA 1GAXA 3I05A 3QLEA 2PSEA 3GGJA 3M2TA 4G0OA 1P60A 5DM60 2DQSA 4BZPA 1W2BB 2EEZA 4G65A 3D43A 3EMKA 4HWSA 3ZU2A 4DA6A 5IKMA 1YMQA 1NIPA 4U5XA 1CQXA 1ZJZA 4Z9XA 1Q0SA 1QE3A 4MQFA 2PHZA 2V6MA 2Q8PA 3NGMA 5KYKA 2XMCA 4Y2TA 4DXDA 1PS8A 3AI7A 5G4KA 1HZJA 3RS2A 3JYQA 1LBEA 2OTJB 4O4LB 1E3IA 3LOUA 3FTPA 4M0EA 3RSZA 4LXXA 4OPSA 1L7BA 1PR1A 2CJXA 2HEIA 3IV9A 4I50A 2FF7A 3JQ6A 3SQNA 4ATNA 1RKUA 4CKWA 1VPLA 2AKEA 1XXHA 1Z0UA 1AZTA 4OCZA 1ZG3A 5EKSA 1Q95A 2CJWA 3A8JA 3EUWA 3IUEA 3VSBA 3MSXA 3VVBA 2DF8A 1OU4A 2IHTA 4I9HA 4H77A 3WMXA 4GEKA 4Q4HB 4PZZA 2VPPA 1YQWA 1WG8A 2IHUA 2VK8A 3DEAA 2GOYA 3C8ZA 3PQ5A 5FUVA 4D8YA 2F3PA 2C9CA 4YJ3B 4HFMA 2Z1DA 1VKHA 5TS3A 1EDBA 1ZSYA 4D80A 3I61A 1KP3A 2J6CA 4OFXA 4Z86A 5F7JA 1EUDA 2QTWB 4PFJA 4BNFA 1ZOIA 4JJ4A 3LT1A 4RIGA 1QBKC 5ESXA 2BISA 2CUNA 3WGYA 5JLAA 1CY0A 1V96A 3OM8A 3U4IA 2GAOA 1CYDA 1Z74A 3D0OA 3ASZA 1KAEA 4C21A 5CFQA 3R3UA 4FR2A 2FK7A 1IJFA 2Z4SA 2KI5A 4LG1A 3UENA 4E33A 4FP9A 2P9HA 2MSKA 2W6PA 2YY6A 3LUKA 4M1QA 2PH1A 1JEYA 3B70A 5JJBA 2I71A 4OUKX 4F5ZA 3KK0A 4W9MC 3QVUA 2AI1A 1RQRA 1MT0A 1SXJC 2REOA 3UWSA 2ZRAA 3STYA 1J07A 1M6EX 1QTNA 4JB2A 1EG2A 5ALIA 4URHA 1U1GA 3IO5A 4KSCA 5KVCA 2O59A 3DVQX 5KQGA 4A73A 2AMVA 1JG4A 1FTNA 1CY8A 2OM2A 4LV6A 2I2WA 4ZQEA 5NULA 2PMEA 3VR2A 1UK9A 2WKWA 5CVCA 4ZRDA 2C3PA 1U9IC 4L85A 5JANA 4BBAA 4LBYA 1W2WB 2ZCJA 3MUFA 2D3LA 1DBSA 2JGDB 2AS0A 2ZI4A 1YWGO 2A6PA 3RUIA 3KVOA 4O4HB 4K3UA 4XUDA 2JFGA 5BQFA 4QX6A 3VMMA 2XX3A 3KUKA 4MTCA 3LRTA 2MHCA 4Z9AA 3LBNA 3GQVA 4EEZA 2IY9A 2DY1A 2QU7A 4KPYA 1R0LA 1YZQA 5AW2A 3WIBA 5EIBD 5TY0A 4GKAA 5JAPA 4OHUA 4PZ0A 5HE8A 1VSTA 1TF7A 2BCJQ 3CC8A 3H04A 1XKLA 4XFKA 5HKAA 4N39A 5CVUA 1FVOA 1P0CA 1I4LD 2IK8A 3EC7A 4QDUA 1T6XA 1L4YA 1P4GA 1IIRA 4KQ1A 1FSPA 4HGQA 1YJBA 3NHLA 1GCAA 2FPXA 4QZVA 1V1JA 2WTAA 1BHQ1 4X8OA 2OD2A 2IGBA 2WYIA 1ZWLA 1U7HA 1V8PA 4RPJA 3GDGA 4BMNA 2SCUA 1XDDA 4DQ0A 3GLQA 1X1AA 4Z99A 4Y2PA 2HADA 3JYNA 3WGMA 2QRVA 4NE9A 2CVHA 1NB9A 2YW9A 4NCAA 3DEKA 4Z4FA 4IDBA 5THKA 2UVPA 4D3DA 2QQFA 3OZBA 5DF1A 1CDEA 1DOZA 1N3YA 3IR5A 4L5YA 3ZHYA 2XUKA 4TXMA 2FX5A 4WPGA 4LWPA 3RS8A 3ZWNA 5KNDA 1NVDA 4ESHA 3HJNA 3T52A 2GEVA 1Q12A 5JMPA 2IE0A 5LLTA 5DSZA 1E63A 2BFBA 4V0ME 5FFMA 1QKJA 2R87A 4NEQA 2GVNA 2FSHA 5EZQA 5HIKA 3FXAA 4HLUA 3T1YB 5KSZA 2AQHA 2CSXA 5JJLA 5TJHA 1O9HA 3JX9A 1BU8A 3P9IA 3QMWA 3QX9A 2AFVA 3FX2A 4J1SA 4IICA 4MGIR 3UAGA 2OOSA 3FLBA 3GRPA 4PGMA 3GLFA 4L4YA 1NJ2A 2JJ2A 3QV1A 1YB7A 3LTEA 4V39A 4DIBA 5GGYA 3U3OA 5JXHA 4JI5B 1G1MA 5DLYA 1SXJE 1QBGA 1QVFB 1RFGE 2XGOA 1HLDA 2BZSA 4HB2A 1DJOA 1EUCB 1SQFA 2ZJFA 3UF0A 3JQAA 3V32A 2OFWA 3EXHB 5BRNA 1FNDA 5I7VA 3Q7PA 1JJFA 2DQ4A 5JAHA 1H0RA 3G5MA 1E4VA 5DDIP 4B3HA 2NYAA 1MF7A 2PIAA 4S1NA 3QOFA 4WERA 4A5OA 4EQ6A 4ZYTA 3AV0B 4UHKA 2W2NA 3SYMA 3DGFC 3C15C 3RG8A 3SYNA 2GF2A 3OE1A 4GGMX 2AD1A 4JLKA 4TSRA 5F4BA 1JFFA 4MUNA 4CGYA 4P26A 3B85A 2CVZA 5AJYA 5BVGA 3W06A 2NM0A 3UHFA 4U7PB 3CGGA 4QNRA 2BDTA 3IIIA 4C3VA 5BMVF 1XJQA 5IYPA 4ENQA 5IASA 4OH1A 2W8ZA 4BGEA 3SLRA 2Z6UA 2J4DA 3VNAA 4RWEA 4TKVA 1XAJA 3L6CA 2B20A 4LBZA 1EE9A 1EJ2A 3CZ4A 5CT4A 1EMDA 1JHAA 1HEYA 1ZICA 3ESQA 4M1ZA 3DUFB 1IJKA 2B7CA 3H84A 4JX8A 5BNWA 5C5IA 4UVEA 4IKOA 3PRYA 3ZDQA 3ZV6A 3EAQA 2X22A 1TCUA 3HDGA 4K40A 4JUAA 3NOQA 4C7XA 5J58A 2J33A 1EAYA 4XSHA 1FDWA 2OGSA 5IVKA 2NXEA 5EP4A 4KHPB 2QB5A 2PT7A 1KMMA 3T7RA 1VGVA 1E0DA 1NUHA 1TQ4A 1GPYA 1ZCFA 1JFRA 3BWXA 4F1JA 4Z1OA 1GAJA 4BNDA 4BV9A 2QZ9A 2ZL6A 1ZPDA 2BOVA 3FWHA 4IMPA 2HB6A 2NV0A 2QN6A 3CR3C 3GJRA 1I3LA 4R2IA 1MIHA 3PQDA 3STXA 1KO1A 5JNLA 3FJOA 4OATA 1ZMBA 1OJLA 5EGSA 1HQYE 3L7NA 1W44A 1T4CB 2NWQA 2NLOA 3SHOA 4WXHA 3VGJA 4F85A 2FZVA 1ZX1A 4X65B 5BSYA 2Q7DA 2PZAA 2ID8A 4L0MA 3R5FA 2XIQA 1E2HA 4BBZA 1KKLA 3KETA 4YALA 2NZVG 1T9GS 2I6GA 3I9FA 3PTLA 5FUXA 3NX4A 4RCVA 1FL9A 1WQ4A 2O52A 3AF3A 2ZYVX 5IRCD 2IY8A 3A6ZA 3TGPA 3KYIB 1TEZA 5AKEA 4QTTB 4XWOA 1RQ2A 1JKMA 2HMVA 2E6KA 3LD9A 3D26A 4H17A 5H68A 3IQXA 3JTEA 1F2VA 3HP1A 2P3SA 3LPDA 1QAQA 3QV2A 4W1RA 1CQIB 2VUIB 1ISFA 2HI0A 1BE0A 2V6GA 4UCWA 2IXFA 4A15A 1IATA 1OT3A 1B14A 4Y2GA 1E61A 1NU8A 5HFNA 1U8CB 4KXMA 2PX5A 3GLHB 3GLIE 4LCJA 1PX2A 1Y9EA 1AKTA 1ADFA 4QRHA 2C2KA 1FF9A 1IZYA 5U4QA 1BDIA 1RAFA 2H2IA 1WEHA 4J03A 2X0EA 4F9FA 1O77A 3PFCA 1J2JA 3VRHA 4P2BA 4GLLA 2H3EA 3L7MA 3MWJA 4HGOA 3EDCA 4JBYA 2FJPA 4KDEA 1G20E 1UD6A 1WTAA 2JIPA 1VB3A 2YMPA 4G0ZA 3HR8A 1PJSA 5LZ4A 4YAUA 4CM4B 2VDOB 4NU6A 4JOSA 4OJYA 4BKUA 3PQEA 4X64B 3G85A 4KLNA 4YJ2F 1IY0A 3VTFA 1H0SA 2FPIA 3KR9A 4RVUA 1L4EA 2QW0X 3I4FA 4E30A 3E4CA 1FDRA 1BJRE 1IQRA 1XTTA 2VEOA 3SLNA 2WIAA 2PM8A 2D0PB 3GLVA 4X95A 2HRCA 3RHZA 3BWYA 2EVWX 3H7AA 1Z33A 2FPMA 1PJ3A 3CRW1 2YYSA 2ZIXA 3KHSA 4E7PA 3DDUA 3W5IA 1YCGA 4UBOA 3RCBA 4ZHQB 1N32B 3QRWA 2R60A 1RHUA 1WPXA 3P45A 1OZGA 4QGHA 2ZVQX 3IP5A 2OBBA 1B00A 1CIPA 2VRWA 4CLHA 4W99A 1ENOA 3KVRA 3ORRA 4L5JA 5BQXA 3I0MA 3JYHA 5LQRA 2ZPAA 2WZNA 3P26A 2QQ0A 4U8HA 1P9NA 4WCFC 3W6NA 3WYNA 4B17A 4F91B 1OH5A 3LDUA 1U7DA 2OYRA 5ALNA 5HFJA 3CNHA 5C4GB 3TRJA 5FTLA 1KJIA 2DWUA 3DV0B 4O2BF 1VQ6B 3H1FA 2GR9A 2Y4NA 2Z1MA 3ISVA 2JAHA 4A0RA 4U2KA 3VR5H 4BV8A 4HNVA 4CIWA 4QUEA 1B76A 1BJTA 4IH1A 1LPAB 4IFTA 1N7JA 4TQGA 4UZSA 1DU4A 2VVTA 1NQAO 2O8DA 2CYCA 3KE8A 5BNZA 3COZA 5H5JA 3BWEA 3JS5A 3NBQA 2DAPA 1A8PA 4Z3OA 1DEOA 4UBNA 3SKXA 4FFNA 3IBFA 1IL0A 4NYMR 3BXXA 4YJGA 3U7QB 4KR2A 4WGFA 5EP2A 2R48A 1N6LA 3LC2O 5BMOA 2ORIA 5FO0A 4NS1A 2Q9AA 3M2PA 4PZLA 3WMGA 2ZIEA 4AP6A 3O9MA 4DB2A 1FFGA 2XGMA 5HIAA 3CVYA 1ZJYA 2V1XA 1SBNE 3K0AB 4AO8A 2C96A 4IEIA 3D8BA 1VRWA 2IBMA 3GEGA 1FUIA 3D6AA 4FI3F 4NKRA 4I5FA 5FWXB 2FAXA 5ULLA 3QVVA 4AYTA 2YOHA 2IXTA 1K6MA 3BF7A 4ZT5A 4ZIRA 2O2ZA 1Q5PA 5K05A 5KWIA 3BMNA 3TLBA 3MA0A 2P4QA 1ML4A 1Q0ZA 1GTZA 4IV0A 4E94A 1N0UA 1K66A 2QJFA 5A5FA 4AG6A 1KIMA 1PGOA 5CLIA 1EK5A 3K09A 2GSDA 2MSWA 2ZWAA 4RDCA 1PV2A 2A7QA 2CYBA 2VDRB 4S0XA 2I87A 4CF6A 5KJ6A 3FSGA 1VQPB 3C48A 3TB4A 3USES 2A5YB 4IUBS 4UEJA 4CCYA 4KO2S 4CM9A 4BEVA 3OZ7A 5IDYA 2O5EA 2ZP1A 2I33A 3VHXB 1MABA 4LWQA 1R88A 1GGKA 4WEQA 2J5KA 2WM3A 4LY9A 1TZJA 4DLVA 5AQ1A 3RYCB 3IKMB 1JQAA 4RHUA 4RJLA 3FYUC 4C0BA 1FSZA 1XVUA 2QVXX 2RGUA 4CMIB 2PMFA 3UGTA 1P44A 3F2IA 1W5AA 4UPEA 4UEWA 2FUNB 4KREA 2OBXA 3GFQA 2NQTA 1T9KA 3ZE6A 1I2ZA 3NIFB 4L22A 5EOVA 3D8HA 4JR1A 1YGYA 2E55A 1ZUHA 2PIDA 1J7KA 1LU9A 2G5TA 4MPTA 4FLFA 3FDJA 4PIVA 3STHA 4U7JA 2OTLB 2GLTA 1F2TB 3V3TA 4GOOD 4U3JB 5FJIA 3RR2A 1XV5A 3N75A 4X24A 3V1UA 2VCHA 4X3CA 1ZNYA 2C4TA 3A7EA 2QA4B 2FW0A 2YFYA 2QLFA 3HSSA 1QHFA 4O5AA 1N9ZA 4LBWA 4Q1AA 3O31A 1EXNA 2HIMA 3EG5A 1IBRA 3WQBA 3I28A 2IOQA 3WE7A 4NY1A 4DR3B 1JIUA 1TO6A 4HAZA 1X15A 2FTKE 2XNDD 2NT3A 1ZCAA 1LTHR 3KAJA 4FXOA 4JU8A 4NH4A 4BRUA 4C2UA 4MARA 5DTJA 4NEGA 4D43A 1WZIA 2UZIR 4HDQB 2VH1A 2ZKLA 3PKIA 1S96A 4HNGA 1BH2A 2HK8A 3K0FB 5ECWA 5BUQA 5CH3A 1OGJA 1IOVA 2Y1CA 1A5ZA 3CNLA 4CTJA 4KE7A 1X77A 1YCDA 2OO5A 3S28A 2P1ZA 3OQVA 4ZZ0A 4UOQA 3ZR4B 5L45A 3QE3A 1KC1A 1PS0A 4OQPA 3SNKA 5DNCA 1E60A 1XEWX 1SU7A 1Y3BE 2OY0A 4KBFA 5K6RA 1IHPA 4MVCA 2I3BA 1KYYA 1XZIA 3U3RA 3R41A 3H86A 3CLTC 2ZI6A 4NFSA 4WESA 4BO0A 2ENWA 3OU2A 1B3RA 3VR4H 3DGEC 2W6JA 2XIJA 2ZAOA 4ZHSA 3NVMB 1GNLA 2XNHA 2EIHA 2HMWA 3QQPA 2ZCUA 4GUAA 3D3WB 1WXEA 4L27A 1J8YF 3HN6A 1I2BA 1IK4A 4TM7A 3PCRB 3VSEA 3UA3A 4CKWB 5A4AA 1STOA 2ZJ6A 4UBIA 1II8B 2YN0A 5FPKA 2QRQA 1XRJA 1CZUA 2PGXA 2YCLA 1F60A 3E61A 4XEHA 1E0KA 3PCTA 4OTZA 1CUDA 2ZVJA 3L6EA 2GZ2A 5EIHA 4YAWA 3H5LA 1KSHA 1FDIA 5IVIA 1FS6A 1F4LA 3U4DA 5LXTF 1PZXA 4WZLA 2Q5FA 3WMRA 2CXTA 2ZS8A 4IFBA 4FHEA 1MAVA 3BQ9A 5T4HA 4YCLA 3HCFA 4H59A 4QQFA 4JHXA 3R8XA 2Q5IA 5DS0A 4F97A 3I34X 1CQZA 3KQUA 4G8DA 1W36B 2FP3A 3RRJA 5IJZA 2BJWA 3C5VA 3I76A 2V9CA 4JEHA 4FHCA 4BQQA 2XVZA 1DO2A 2J87A 5KNCD 4S2UA 4ZZ2A 4RMJA 3DLBA 4AJIA 1U63A 3GRCA 4NE2A 3K35A 3LC0A 2WK1A 2JGLA 2NV6A 2QP3A 2VAVA 3AETA 3IERA 3K1ZA 4DVJA 1G38A 1DX4A 1V8OA 2W5UA 2P9BA 4G0MA 5B1EA 3OZAA 1JNYA 1MR3F 2AK3A 1IY2A 2Q1WA 2XOEA 1VLQA 4DLPA 4EVRA 4XRGA 3V3KA 3X3HA 4P6YA 4X71A 3AUXA 3E2IA 1H5NA 3IT1A 3CF4G 1EHYA 3FSRA 4TWJA 4DDKA 4FHGA 3JQGB 1T0UA 1UD4A 1IM5A 1RBQA 3K4PA 1H4QA 4Y6OA 4EUEA 1ACLA 9ATCA 2VBCA 4QNMA 1DXQA 3GPBA 5G0SA 3AOEC 3L0OA 3HDJA 3L8ZA 3LQ1A 3IQFA 5DWDA 4U63A 1K97A 2RHHA 3VYWA 1WQ1R 1QDEA 1AS0A 2E4UA 5LDGA 1T36B 4LTMA 1Z73A 1VA4A 1L5KA 4MI9A 3TJMA 2QY6A 4FK8A 3PVZA 4DWJA 4MIKA 3CO0S 5CFOA 2UXCB 5K3FB 4K6FA 2J6HA 4WN9A 3UNXA 5K4GA 4OBBA 1GCUA 2K4MA 4PX3A 1XUOA 1W76A 4DLSA 3NANA 3TI7A 1AUPA 4QFBA 5HW0A 3AILA 2VG8A 1XMIA 2P91A 1C30B 1Q0LA 2PUJA 4LNUA 2YVUA 4OG2A 4B9EA 3TXAA 3I39X 3LUHA 4EBBA 3IP6A 1GLGA 4KUGA 3C1UA 2VJIA 2E4YA 3AKCA 4BKMA 1V8DA 4IHJA 1FTGA 1VLZA 2Q3JA 4M7WA 3UHJA 2Z57A 1M2OA 3OC0A 3MWKA 5ICFA 2QR2A 1VL6A 1WD5A 2OAQ1 1WU7A 4PAQA 4ZD6A 5JVDF 2WD7A 4HAYA 3QLUA 3UHAA 3ZU4A 2XCRB 4ARBA 2V7UA 3A6DA 4OXKA 2EARA 2QUZA 4ZYXA 3S2YA 5FEUA 5B6IA 2PK3A 3B6MA 4IOKA 2QL5A 2KSQA 4OJMX 2C2YA 2WJ3A 4RLFA 2DUUA 3WDSA 1XU9A 2JJ2D 1I8TA 4MRRA 4QBHA 3BKXA 2P35A 5K8CA 5IKEA 1U0LA 3HYCA 1F0KA 2ZRNA 3ER8A 1AE1A 3CA8A 2GKGA 3FLAA 2QLMA 4LTNA 2BEVB 4DC9A 4NNJA 4OYRA 1JEAA 1JBQA 1SG9A 3NAQA 4AVYA 3MGKA 4JR2A 2BMVA 4RMGA 5CK4A 3UJDA 4QT4A 4QARA 4DM4A 2P90A 1H1LB 3ASQA 2VBGA 3BMQA 4FFRA 3BKWA 2BFBB 4UNRA 3HQ4O 2LW7A 2RAFA 2O9JA 3CEAA 3JD0A 4I6GA 2PUDA 2XXAA 2A0YA 1ZOSA 4NV1A 2IWHA 3V00A 3BL6A 3BJMA 1QP7A 1YI8A 2IW1A 3NWBA 1OQAA 4F7WA 1Y7LA 2HA7A 4QPDA 1BEZA 1RI2A 4BQFA 2AFHA 1T29A 4CKBA 2OCBA 5AW6A 1LGYA 4X6YA 1CY7A 2YJTD 2ZIWB 3MHPA 4OBWA 3QKUA 4LRXA 3OCYA 4JHLA 2M2IA 4PNHA 2GCGA 2GHTA 2JIZD 3RNLA 4IOJA 4DNQA 1W87A 2OXTA 3HY3A 2NACA 1XQ6A 4TL6A 1N5IA 2CHFA 4XVQA 5IVHA 1SU4A 4C0WA 3Q88A 2FKAA 3PP8A 4E46A 5IFLA 4KVFA 5CFMA 2LXNA 2PFKA 3N86A 2PT9A 3D1LA 4MOWA 3TVDA 1U2QA 4LRSB 3M4NA 1X7YB 2BWJA 2DRIA 1VJ1A 2FYTA 2OXCA 4OHMA 5TT1A 2B61A 3H16A 4QUKA 4AJHA 4BFWA 4RKFA 1S3SA 5GZ6A 2MIIA 1XXLA 1QQ7A 2ZR9A 4B46A 4DR4B 4BV3A 4EUSA 1ODFA 4XX0B 4XLCA 3IOEA 4QODA 4LMAA 3WNQA 1NXSA 2GN1A 1XQ9A 2QNIA 3NASA 4D3SA 1M2JA 2VWGA 3TQCA 4AMGA 1GM5A 5H8WA 1JFFB 4TZ0A 1PLKA 2ESRA 4EGCB 1GKIA 1TADA 4V0SA 3UW1A 5JWOA 2FWRA 1XYYA 3CG0A 3SDBA 3TZQA 2BLNA 2CDCA 2VPWA 3TR0A 3RIGA 2I67A 1PNOA 1CCWA 1W88B 2QK4A 3CH7A 1XPOA 2D5LA 4Z4IA 3VH4A 4IXNA 2AOUA 3HYLA 4Y2SA 3UZUA 4LHVA 3BAFA 1BCRA 5IWAB 1Q57A 1T0PA 2ZS7A 1T2UA 3OMWA 4Q37A 3WRXC 2PJRA 3RF6A 2FCAA 2IVZA 2D0OB 3GJ5A 3ZZMA 4B2PA 1MDBA 2FW8A 4NCNA 3FFXA 1U28A 2B8NA 5LNK6 3TSOA 2B1IA 1LDMA 3CUTA 4YRZA 1G7SA 1V8BA 1QS0B 1GNVA 4QIHA 5KW9A 6LDHA 2W6NA 5FNVF 4GUDA 4HADA 1BGVA 2JIZA 1PNVA 2FDXA 4HAWA 1J70A 4E3WA 2VHUA 1YV9A 2QIPA 3GJ8A 4FKMA 4MW7A 2JA1A 3SJ7A 2XQFA 1HYGA 3DLPX 2AWOA 4D3ZA 4EB3A 3LU1A 1T34A 4I1VA 1QGED 4KK4A 3QI2A 3M9XA 2C5HA 4DRXB 5JSQA 2IYAA 1ULBA 2VA8A 3K8QA 4W5WA 3SQMA 3HUDA 1U5BA 5TMEA 1AO0A 2QZPA 1RIFA 2Y1WA 2IYNA 5JRZA 5GV8A 2YVLA 2YZMA 2LKCA 3B9QA 5K0NA 3C6YA 3UYKA 3THXA 4R1SA 2PFSA 421PA 1TQHA 4IWNA 3G2NA 1DTWB 3CFYA 1O8BA 2NP6A 3ZE7A 4AKIA 4XUEA 1XAHA 3MNFA 1TD1A 4P0QB 3DE5X 4EBFA 1GU0A 1TM3E 3U5ZB 1W96A 2HC9A 4X9XA 5DLDA 1M33A 1N07A 3W79A 5EEGA 3FOBA 4AZVA 5CDFA 1EBFA 2CD9A 3FBGA 2PVCA 1YB6A 2WSLA 2ODWA 2QZZA 3K4QA 1PYOA 2YJ6A 4HAOA 1PVVA 3CRVA 4LXUA 3GA0A 4MPDA 4QDXA 2GB4A 3C3AA 4DM7A 4TYMA 1F4VA 1U4NA 1QDUA 2FEMA 2RHLA 3AO0B 4ZRNA 4OGFA 5I7WA 1NBWB 2CF6A 1A8HA 2OCXA 1T13A 2DFKB 4JJGA 3M9WA 2PGLA 3T7IA 3NTUA 2ZAIA 4CKEB 4AROA 4IJQA 2WWVD 4XWYA 4TYNA 4DMCA 4KI0A 2A9FA 4PSCA 1MEOA 4XUGB 4EHBA 3FVVA 3GAZA 1DV1A 1P7ZA 3F3SA 4QLAA 1XEXB 5AJZA 2XQVA 2WG0A 3ML1A 3OICA 4ZO6A 3HYTA 4YCJA 1BMFD 4NPHA 2WYHA 3RB8A 4QGSA 1PR2A 4H60A 3KLOA 4WASA 4Y2XA 2WIDA 3HACA 4XSVA 4TLCA 1LDYA 3MJFA 5FPTA 3KWMA 4ZYWA 2CY0A 5HQTA 3K0BA 4KMSA 5EJFA 4DR2B 3WOVA 2PX2A 3DC2A 3IRVA 3N2GB 4ZAZA 3SZUA 1P62B 2H1FA 2L69A 4A8PA 3NOXA 3DEFA 4DHWA 2O7VA 5HX7A 1IAQA 2XZDA 4CU2A 3RRBA 1JBEA 3ZVMA 4WX2B 4A8HA 4MINA 2R62A 4IQ0A 3RARA 1CERA 4PLFA 1QP4A 4D0SA 1SBTA 3T9DA 1W4RA 3O7WA 1N0IA 3DC7A 3H1GA 1XZDA 3I8XA 1Z2EA 4IM7A 1OXXK 1YBFA 4UBJA 4ZXFA 3GROA 4TUYB 3FHOA 4EJMA 1L7EA 3MMZA 5ALKA 5AVUA 4DYHA 1X0XA 2XTMA 4H7KA 4I6EA 4YYZA 1P61B 3RLFA 4X7MA 1ID1A 2R6DA 5FI1B 1Y8RA 3N8IA 1ULZA 5K0ZA 1FMCA 1QF7A 2PQ2A 2QNBA 3D81A 3WFZA 5LVAA 1H42A 1YX2A 5G40A 3O82A 1CJBA 2PMWB 4HQ0A 1DWQA 1LY1A 1REQB 3KO8A 3LCJA 4DW8A 3ETEA 1SOWA 2XUOA 3N0TA 1QLWA 3W2FA 1EZ1A 3B1JA 2QD5A 1V5IA 1O96A 4XR9A 1TLLA 1OHHD 1QWSA 2NZUG 4HAIA 1FFDA 4QOSA 4ROXA 4OO3A 3QVMA 1ZD3A 1F8UA 2RK6A 4IJVA 1XK6A 4GGPA 1OH7A 1BMQA 2FNAA 1G5FA 1ZXXA 4TMXA 2IXAA 3Q7QA 3JARB 3SC3A 4CM1A 2X6XA 3TSZA 3UCEA 1A7AA 1T3GA 4HNTA 5FA5A 1NP6A 1PG2A 5BT8A 1A71A 1NXWA 4H4CA 4NJMA 1I1HA 4AL4A 1T5TA 1UPBA 3H18A 4PINA 4UNQA 1E3XA 1XMXA 5IUKC 4EKGA 5LYYA 5AVSA 3AGPA 4JDUA 1B43A 1MA0A 2QXTA 4NSNA 4YXWA 1KC3A 1RYMA 2XD4A 2WD9A 3QGMA 4KR7A 5IW8A 1E1RA 2VJPA 1OB0A 3WXMA 3RVQA 3IILA 4ETMA 4BVBA 1J5XA 3Q87B 1N2CA 2VNIA 2GZRA 3E7DA 3MN1A 3KWFA 3T3HA 4ZU3A 4LXGA 1G8AA 3U26A 2VRNA 3GVJA 3DJFA 2IKSA 4F3RA 2HLNA 1ZD5A 3PCXA 4D4GA 5HKBA 2ZJ1A 1SUBA 1FBTA 5IVDA 1PL8A 2V0NA 1XR3A 4LC1A 2D13A 4W6ZA 3WYCA 4OXNA 1O5OA 2HSGA 4XR6A 4N7MA 4QL3A 2QD3A 3I6IA 3A26A 4M49A 1PQUA 1KOGA 3FOAA 1PU2A 2W2OA 3H4MA 3MMNA 1ZUNB 2VTKA 2YY7A 5AW5A 4ZIRB 3ZDCA 3BFVA 4DIUA 2VHCA 1YUNA 3WV5A 4KIUA 2BMEA 4B6EA 1L1QA 4OOFA 3QNUA 1C5KA 4LE0A 4S24A 1QVGB 3VO9A 3K8ZA 1S1MA 1M8PA 3LF1A 4HNAB 3GJSA 4AQDA 3UMMA 2C5EA 3PSAA 4ND4A 4M9QA 1HG1A 3W5HA 2QV7A 1VHLA 1TW3A 2O5VA 3CCQB 3ER6A 4L8WB 2GT1A 2MTBA 4B5LA 3PA2A 1YS2X 3QVWA 1AB6A 1AS2A 3OEHD 5GWXA 2VPQA 3K71B 4RMHA 2NW6A 4MKRA 1YZNA 3RYCA 1X7ZB 2C3MA 2EQBA 2H4ZA 1Q17A 4GOKA 4RSGA 4LKRA 3K7EA 4QYSA 3VGPA 5A0TA 3FB4A 4YP5A 3FCEA 2ZRLA 3DBRB 3PJGA 4F4DA 2G9UA 4GZ5A 3DWEX 1EXWA 3CQ9A 1WSRA 3V33A 2X0DA 4A2WA 3ZD8A 1C4OA 2K2WA 2HXGA 5IAJA 5K7SA 1LD3A 2VNJA 3HEMA 5DXFA 3UO8B 4CUKA 5EPEA 3A6HA 3IXQA 3PNKA 3A25A 3FVTA 4E07A 1KU6A 4U3JA 5JD5A 2VJMA 4V0OA 5F12A 1TVMA 2H16A 3W9UA 5HJ5A 3UTCA 2BE9A 2QT0A 4WINA 5CM8B 3RIMA 1I10A 4CG1A 5ALJA 2WAMA 1PEKE 1C7JA 1PSWA 2Q3BA 2E18A 5KINB 3ECAA 4LF7B 3OJCA 3MCTA 4IQGA 4MHTA 2DTEA 3AY6A 3JALA 3ZDRA 3E9YA 3RE1A 1E20A 2P9CA 2JGNA 4MV5A 3K73O 1NM5C 4JASB 1JIVA 3ICWA 2DYKA 3UFXB 1PDWA 2B21A 2J9XB 6ABPA 4HRXA 1K7CA 5E7MA 1QYXA 4BV2A 1BU5A 4MEJA 4E7OA 5B3KA 3PBKA 1VLVA 4D6YA 1S2NA 1U1EA 2OZVA 1BN7A 2WSSD 3BK1A 4UFOA 1J0BA 1Q0RA 2RAVA 2JLQA 2YR0A 5KKAA 3S44A 5JH7A 1P1KA 5HF5A 1Q16A 1Z4LA 2VHYA 1CUAA 1WORA 1TZ2A 1M1KD 1D03A 1VRCA 4B4WA 1I7SB 1UBNA 3BCDA 3M34A 1KEVA 4R1OA 2O3UA 2RGGA 2VA9A 3EVTA 1KH2A 4FS3A 5DCWA 4YRNA 3ADDA 2WUFA 2Q1UA 3KJGA 3QF4B 4RD4A 5BSEA 1KK0A 1G3UA 3ITEA 2WWIA 3JQFC 3K15A 3K9FC 4PSDA 2Y1GA 3NAMA 4FMDB 2PSHA 3AP1A 1WTCA 5DBIA 2V55B 1T2VA 1ZIXA 1XD2A 1AGPA 2JA2A 2K5UA 4B74A 5HYVA 1Y0BA 2V7XA 1HDEA 5TQ0A 1LLFA 1WXHA 1U2DA 3JSXA 4V38A 4D02A 4CQMB 2VJAA 1ZYUA 2PE3A 1ZIYA 3NFRA 5ICCA 2QTTA 5CLFA 5CNKA 3MOSA 1IYZA 4ISCA 2JDIA 2P4EA 3NNNA 4A2QA 4C5CA 1OZ0A 4ZEVA 3RWMB 2FRDC 4ZEMA 2PYZA 3P9ZA 4QUZA 3PUMA 4J75A 4P3OA 2VATA 4BNLA 1Y6GA 1RHRA 3WTCA 2J9FB 4AMUA 3UXHA 2GO7A 2GS9A 2BM9A 2FMKA 1OYVA 4IHQA 1SIOA 2P9JA 3FYUA 3SHVA 4DJDC 4DLXA 1HTTA 1E1QD 4M0CA 1V35A 3FD8A 3WYBA 3T9CA 3UAZA 1NXQA 3B5IA 4N3CA 5BURA 3D5EA 1DFGA 1KYXA 4URUR 3GZNA 1NB0A 2DHRA 2WJZB 2XVMA 4WA7A 3FWYA 3VHQA 5HSGA 3OQIA 3U5TA 4EVIA 2NUAA 4PANA 1E3TA 4BXOB 4YONB 1A72A 3KFXA 5GY7A 1T2AA 3ROEA 1J0EA 1FUYB 1NMEA 5ARDA 1GTSA 1HRDA 1F17A 3NRJA 1Z12A 1KL7A 3JVDA 1MV8A 3QEAZ 1D1QA 5B2FA 1EXMA 3QEKA 2BTQB 2HLDD 4M36A 1U7OA 1FP1D 3F6YA 1YD7A 3KKPA 4GYWA 4DCTA 4Z4RA 1EK2A 1JHRA 1MW9X 1NNSA 2PL5A 3JAWA 1KERA 4WTOA 1KWKA 2VLBA 3FUTA 1RPJA 4EPXA 1POWA 1TAUA 3KT0A 3D4PA 3QXCA 1KZ1A 1GSIA 5GZ3A 4LW8A 3IB6A 2Y0BA 4QAJA 3MW8A 5I7UA 3ZD6A 5EJ2A 1LFDB 2YTZA 3ONWA 1RCFA 1PGNA 2INGX 3CURA 1RLMA 3U7IA 5CEJA 5LYJF 1LI7A 4FBLA 4AQ7A 2WF9A 3A28A 3L7LA 3PGMA 4TV8B 2HBQA 2XEXA 1GUBA 4YRAA 3GN1A 5EXEA 4IYJA 1UOQA 3SE0A 1DT3A 4QPJC 4P2NA 3M3HA 1ZD1A 2RG1A 3QBJA 4XSGA 3HBAA 1XJ0A 3LGAA 4GRAA 1PNQA 1GN9A 1R15A 2GBGA 1I9CA 2AFRA 1MO2A 5AOBA 5A9TA 4PG4A 4TYYA 2CUKA 1ZD9A 2PD6A 1D5WA 1BDBA 2CNOA 3IE1A 2CUTA 4Y9DA 1FQJA 3HM9A 3PFKA 4BVHA 4CL3A 3DL7A 4BO3A 3QU5A 5BUSA 2V3VA 3HC7A 4NZMA 1BE8A 4EATA 2ZB3A 5H9WA 6ADHA 1PFGA 2JH9A 2AG8A 1K28D 2X4DA 1GNRA 5KDOA 3T1HB 3LPCA 3T56B 3QBTA 4N0EA 5FI3A 1E79D 1HR0B 1NBIA 2OORC 4BFXA 2QW8A 3ZXXA 2X13A 1MA3A 1PWEA 4AB1A 2ERXA 2JCBA 1QIHA 4LZOA 2VBVA 1EI9A 3WYGA 1J2EA 3VZPA 3D2AA 1O97D 3F1KA 4LDRA 4BS9A 2BTOA 3MJSA 4BECA 3JASB 3QA3E 2WNHA 2AXPA 3O2QB 4ARIA 5B57C 5CXSA 3FTDA 3IH5A 1E9EA 3CNEA 1ZNZA 1II0A 1L5HB 3H2GA 4DA0A 1ZR4A 1EWQA 5FBLB 1KJJA 5CG1A 3QIAA 2UYCA 1MW8X 1EA7A 3E2PA 1EP3B 3F1LA 4F3CA 3V4SA 3GF4A 5DGXA 5F23A 1UIRA 5CVDA 4OREX 3RUFA 4PX5A 3S2UA 2CMGA 1ZDMA 1YNSA 4OJTA 1WXDA 1ARZA 2EHJA 2QMUA 3O8OB 5K8LA 1VKRA 3H0CA 1DQRA 4KWHA 2OMEA 3D8TA 3H3XA 2HJ9A 3OIDA 4N48A 3RNOA 5T64A 2V6IA 5IH3A 2EP8A 3BQNB 3FCSB 5EXSA 3FCCA 1JH8A 1QTIA 4P3KA 4YJKA 3NRBA 3CLVA 1PDVA 1UC5B 1XKQA 3TMAA 1HDRA 3B82A 1E2PA 1NW5A 3H4IA 2NSDA 4HXEB 3PDWA 2DKOA 2BF4A 4NV3A 5DB4A 3OOEA 3KKNA 5FLEX 4GLFA 5HZKA 3G82C 4CGZA 3LUGA 5TPWA 3QM1A 4XCQA 3UUGA 1BXZA 2I7TA 3PRHA 4KACA 4UHHA 1JEYB 2AQKA 2NXCA 1DC6A 1BE6A 2C4VA 3CCJB 3JQ9A 1TFRA 3FNBA 5JEEA 3WLKX 4MGKR 3GEBA 3QVGB 1FQWA 4KUHA 1JMKC 2QTFA 2IHBA 3G9ZA 3USCS 4OHRA 5BSVA 1IBMB 2OV4A 2AFIE 4XX0A 4RK6A 2JD0A 4FCVA 1PUIA 2JBWA 4EAQA 3OE4A 3QENA 1NXTA 2J41A 3L0CA 3ONDA 2RGAA 3UT5B 5EXPA 1SKBA 1YIDA 4GHWA 3BS4A 3F97A 1E3LA 2X6WA 3QFFA 4YFVA 2P5TB 1OAOC 4FWTA 4JBGA 1EK1A 3ZC3A 2ZREA 2ZW9A 3B36A 5KVQA 1A4RA 4YBZA 2JIOA 2VJBA 1E9CA 3CCEB 1EU1A 1HI9A 2V98A 5TSDA 3VTZA 1CUYA 4KWEA 4M6WB 4Z8XA 2XWPA 1U2EA 4I5EA 4WK0B 3BGDA 3L1HA 3QPCA 3JQ7A 4KNWA 2Y9PB 3UCFA 3BPSA 3N0XA 1JYEA 3H9GA 2Q5OA 3K96A 3QG5A 3QOYA 4XM1A 3SVZA 5JXJA 5K5EA 4K0KB 3GWZA 4V0KA 3B6EA 1LK7A 5CUQA 5J2UF 3RUCA 1XDGA 2QLBA 3KSDO 3PGKA 3O26A 2WR8A 3BXHA 1QS0A 3L43A 2F3SA 3PPYA 1DNPA 1YRYE 4YRSA 2EFJA 1XDWA 5C9ZA 2YY5A 4F3KA 4C4YA 3TJRA 2FPPB 1MP0A 4HWKA 2YL2A 3BE8A 4PR3A 1RJ9A 4JLAA 5ICMA 4BLTA 4DRXA 2ZZEA 1NRWA 3PHJA 1HYEA 2NVUA 2R85A 2DCUA 3PFNA 1WHSB 1JG7A 3AZOA 3GNQA 3WR5A 4JQYA 4XVUA 2QN2A 4TYQA 3DD5A 4YDHB 3GH1A 3HB4X 3LF2A 4B8ZA 3LOPA 4XCXA 1ZJJA 1UOPA 4XDZA 1SOUA 1WCV1 2HO4A 3DZBA 3OFVA 4ZQBA 4K6KA 4ZWNA 3T34A 5DLEA 1MB9A 2R6AA 4BQIA 4Y1EA 3OWXA 4BO7A 5ADUS 5AKYA 3UBMA 2B1GA 1DINA 4BGDA 4ITRC 3RUPA 4JI6B 1J8QA 1Z68A 10MHA 5C8VA 4JIGA 2BKUA 3NHZA 5ER6A 3AUAA 5FV4A 4U0JA 3VNRA 4N7JA 4FC6A 4HVTA 1W4BA 1CVRA 1WCIA 4L50A 4JC0A 1F51E 4PYJA 2VC2B 2VDUE 3DMYA 4HNRA 1G6OA 5AQEA 4MHSA 1UIMA 1J1ZA 2QVYX 3Q2IA 1YF3A 3P19A 1HXHA 1EBUA 4CFYA 4QUIA 5BQ3A 1SVNA 4YCBA 3ENKA 4JENA 4EF4A 4CM7A 3BIJA 5JECA 3B9RA 1I4OA 4JGGA 4TT8A 4YV7A 1MPXA 4LRYA 1J39A 2D6FA 2EXXA 4I9UA 3SM3A 3TQTA 1H2RS 2E82A 3M81A 4P3XA 3CE9A 4ZDWA 5DGIA 5ALFA 3T41A 3TLCA 1VHQA 5F5LA 1YQEA 5IF3A 3W5JA 3WVNA 3QHQA 3IAHA 4G84A 3H83A 2WIFA 4GPIB 4A03A 4FFWA 3HA5A 3EPKA 1AXGA 3Q3VA 5DBGA 4ZC1A 5PGMA 3P0RA 4BP9A 3N2GA 3JQAB 4M9XA 2BEWA 4QAQA 3WQHA 3B1XA 5CD1A 4QWMA 2AW5A 3BJEA 3HKDB 4AZTA 4DUGA 4AULA 1KI6B 3PYLA 1C1XA 4AWBA 4MKGA 2DP4E 1OTXA 3R40A 3MLBA 3PXDA 3P2EA 3QYFA 1TAHA 1WRBA 1GNTA 5IG2A 3CWCA 5LIPA 3PE4A 4AJ2A 3WHPA 1FP4A 4EG4A 2BH2A 3AM4A 2XUHA 2C5SA 5HMLA 1DRUA 4RHFA 5G0UA 2ZM5A 1XA3A 4RENA 2YJ5A 1PT9A 5G02A 5AYVA 3DTNA 1BAPA 4F4IA 1T1JA 2J8ZA 1SO8A 2HK7A 4JBNA 3U0VA 3SVLA 5AW8A 1OIWA 3F8SA 1DGQA 1H4VB 2O1EA 1WTHD 1NV9A 3W2EA 1QCCA 4K1XA 1Z0JA 2QI9F 3SIRA 1CJCA 4LJSA 4C5AA 3KB1A 2GN0A 3TIXB 4GR4A 1KPIA 2X6QA 2O57A 1E2QA 1T3TA 2ZTSA 3ONNA 4L6IA 4XWKA 4C03A 4M8SA 1UAGA 3M8KA 1QPGA 2KW5A 3UV6A 2IELA 4D9IA 5AO9A 4D7AA 3LWBA 3AF0A 1KI8A 3I73A 3A1WA 2P69A 5KNLA 2I4LA 3LX8A 3LYUA 4MVJG 1TF5A 4QXAA 3BAZA 1ISSA 4JCOA 4LECA 4XDYA 3ANMA 3O8BA 3L84A 1K08A 5TVGA 5JZBA 1V48A 1G66A 2AG5A 1G8SA 1P31A 2XBLA 2WOOA 4J8PA 4NJMB 5F52A 2WHXA 1EDDA 1LW7A 1WZEA 5LQKA 2RGDA 1T6BY 4KWIA 4HNSA 1SIUA 1E69A 2WTXA 2F1JA 3ZE2B 3A9WA 3RS4A 3EZ6A 3QVJA 3ZWPA 5JS8A 3JD4A 3ZGLA 1S8OA 1L5SA 4EH1A 3BF8A 3HE3A 4YMLA 1M5RA 2DQKA 4M1SA 2IP1A 5SYAA 5HTOA 5KYVA 3FRIA 1GPBA 1T4BA 4UZUA 3O9ZA 4X00A 4JQSA 1QIEA 4GM1A 2FZLA 1GFWA 4CR7A 4B2YA 4KH0A 1N5LA 4IF6A 4OAPA 2Q41A 1SC1A 1XTUA 5ERYA 5HM8A 3DCYA 5ITVA 2AOXA 4RSHA 1V2HE 2PX4A 1CFJA 3TLEA 3VU9B 3LRPA 3SPXA 4NAHA 5CNIA 4M0DA 5JAUA 2NAFA 3OQHA 4MH0R 3OOJA 4MDYA 3S68A 4RH0A 4GW3A 3GEDA 4G3XA 4YDQA 2CNDA 3KLMX 5F98A 2BHNA 3EQZA 4MI3A 1F8XA 2ID7A 2BFFB 2G4CA 1WE2A 2QAJA 4CIYA 4L74A 3RADC 2AX4A 4JA0A 2F43B 4P08A 4XH9B 2OGWA 1SZPA 3BERA 1X80A 4MWBA 4R2XA 1M34B 3JWEA 4BX2A 1T9CA 3IKJA 4DCVA 4DILA 3EMVA 1A97A 3L7OA 2NUTB 4MUYA 2NT4A 1DV2A 3M1IA 1XLWA 5KUTA 4WLNA 1CEEA 5BP7A 2ODEA 4MVYA 2VBSA 1T5SA 1NXXA 2ZDGA 4Q1DA 5IBQA 2MJLA 2V03A 1G64A 2OQ2A 5AVOA 3W9YA 5KNBH 3QY9A 4EG0A 4M98A 1F3LA 3QKRA 2YXNA 3G8YA 2WD8A 4O63O 4C1NA 4DSZA 2VDVE 5CVTA 1UPAA 3QX3A 4TX1A 3ZZ1A 5T41A 1Z5VA 1HNWB 1V4VA 1HBJA 1VKJA 2ZRHA 4CM4A 5TC4A 4C3UA 5JCOC 5JSHA 4DJ5X 1IG3A 3ND8A 4XLLA 2V59A 1IIBA 4JX9A 4G8JA 5FOQA 3I6ZA 3D6MA 1BC5A 4MWEA 5B7PA 1NW3A 2JB9A 2ZTLA 4MV9A 4NEHB 4DCPA 5IZCC 4AQYB 3HJAA 3LSYA 2BKAA 2CCJA 1T8WA 5I9IA 2QBYB 1W52X 1B6SA 4QPCA 1NA5A 4AKTA 5HOEA 3MS7A 1A27A 5I45A 3CO5A 5I5GA 1OB5A 3JALB 3FNHA 1XA4A 5IH7A 3RGGA 2ZJ2A 5E1MA 3SC2B 4JWTA 4AJJA 2C9OA 3IUNA 2EU8A 2YRWA 2H9IA 4J2HA 2EX1A 1YDFA 1E4EB 4RIFA 4K8RB 4X92A 2O8NA 4U5QA 2FN7A 3VZQA 1X6VA 2P5UA 4F8JA 1OYYA 3IAEA 3QE4A 3VVMA 2YWCA 5A4FS 3JAKB 2O8BA 2Z58A 2M1XA 3FJYA 3LDGA 4A7PA 5DBOA 2P3LA 3FUWA 3CF6R 3GFGA 3BNWA 5LYJA 1H22A 3RJTA 1WB5A 3OQBA 3KPJA 4HAVA 4M54A 3ODPA 4J7AA 2IUEA 3C3DA 4F56A 4XX1A 4LGVA 3NYWA 3EGDA 1Z63A 1KI9A 3EWIA 4LNAA 3DA8A 1PRYA 4ZYVA 2C77A 2AG6A 1QRUA 1T4DA 3FGPA 1T9AA 3O4GA 4KUEA 4ZU6X 3VNSA 1FLAA 1U9CA 1FRQA 1KJQA 2Q3FA 1KORA 5COBA 4BNWA 5B3JC 1XD2B 1B0ZA 1GP2A 1JSCA 1M1YE 3F4KA 1Z6YA 4M0UA 4R6XA 1KJZA 3L8FA 3QW4B 4TLEA 3SYRA 5JSKA 1DC8A 3WYEA 2V7PA 4KFSA 5DTEA 2XRFA 1FJHA 3GU3A 3P97A 3ZD9A 1KS2A 5K0LA 3TB6A 3TK1A 4MLDA 4QHSA 1WY7A 3WL8A 1E58A 1E1QA 1FRNA 4HVLA 4R41A 4MROA 2IX9A 2OHJA 1RWVA 5B6PA 2WYOA 3KEMA 2XSZD 3RI3A 1FX1A 2R3SA 4CNBA 4EDFA 2AXEA 1C7ZA 3KZMA 4CCYB 1W73A 3IE0A 1UBHS 2JKYA 2IUUA 3OW2B 2IVFA 3SJBA 4A92A 1YAJA 3JQBC 4CCAA 4F0JA 5JBIA 1BCSA 1TTQB 2HT6A 1G4UR 3OQIB 3D3EA 4QGGA 3TRHA 2W8BA 3CF4A 3SU8A 3H11B 3L7KA 4MHOA 4KKUA 3RFXA 4Q48A 1VLMA 2H18A 1DO0A 1KHTA 1KKMA 2POCA 2YWJA 4HWGA 4MKIA 2Q2NA 2VWHA 2NGRA 4WKOA 3DW3X 4ZEXA 3TZHA 3ZVKA 3SNHA 2G4LA 2IEIA 2P67A 3F47A 4HGNA 2FEXA 1USGA 2HIHA 5ALGA 2IV2X 4OM8A 3VR6H 1VZ3A 1SURA 5AXCA 5T3YA 4WHMA 4MSUA 4UASA 3LE8A 1WKCA 2HPHA 3EQ9A 5AKLA 1P2SA 3ROXA 3ZU3A 4ID3A 3L4JA 1XZJA 4MIEA 1XROA 1YBAA 4X1IB 3V2HA 3VMFA 1EX7A 4RULA 1K92A 1SB8A 3BIWA 1Y80A 3LFUA 4KGDA 4R9SA 1KEPA 3FMGA 1RRVA 4KVAA 4C78A 2K7FA 1TYZA 2B6HA 5KTTA 3CY6A 2RGYA 3UY4A 4OMDA 4K0RA 1KFBB 3E22A 1Z36A 3FBWA 3E1SA 1XNHA 4EELA 3PV0A 4ICIA 4WNYA 2CZCA 4ECEA 1R12A 4ONEA 1Z38A 2QE7D 4Q7KA 1WMAA 1WCYA 1DB3A 3QPWA 2XV1A 4W8OA 2O1XA 2OV6A 4BKPA 4IIJB 4O0LA 3ZJTA 4CFSA 1L5NA 3R09A 3NNDA 3BZWA 3KPUA 5HZAA 1DEHA 2G17A 1BMTA 2GN6A 2JGIA 3HNOA 1UJ5A 3MIZA 1N3LA 3ND7A 4H1UA 2NV2B 3R5TA 4ZDJA 5DNYB 3AERB 3MJRA 3H87A 3KKLA 3GCZA 3WLRA 1Z88A 2RBEA 2WF5A 1U3TA 4QC2A 4GX2A 4WNCA 4XGIA 1ULTA 5JSZA 3B8EA 1VMDA 2NN3C 5DHQA 3DVAA 4CV1A 4WESB 1GTG1 1KAOA 4IHKA 1SN7A 1KC8D 1PJQA 5BWOA 1UJNA 1UKEA 1Z0DA 3KU1A 4IX9A 4ZVNA 4JU9A 4X97A 5KTMA 4DNPA 2V0GA 2XF2A 2XH8A 3UMCA 2G63A 4B0OA 4ZJZA 5LZ9A 1YS6A 4LZWA 4P34A 4QATA 2EF0A 2OUKA 3V7NA 2GFQA 5LZ5A 1A9XB 2FLWA 2G06A 2PL3A 2WVJA 2WTBA 4OXRA 4E6PA 1EQAA 1QYIA 1UD8A 1L5HA 5C8XA 5K6AA 4WUTA 5B53A 3G6EB 1Q1QA 1DX9A 2CDRA 3CCBA 1GYQA 3CRQA 1CJKC 3KKQA 3C3YA 3L7CA 5JCOA 1JDVA 5EVJA 3NHFA 4TKOB 4YA6A 5HIJA 3Q5DA 2VHEA 1QFZA 4ZVOA 4ETIA 2CRVA 5KSWB 3E05A 1S2OA 3HBMA 4B7ZA 4AYXA 3MHTA 4RDJA 3DFMA 1DMRA 2YHIA 1USVA 4LE2A 4RKYA 1QGZA 3KBOA 3EIHA 3W04A 4BMSA 3HWRA 2R96A 2XQJA 3VH2A 5JMTA 4MP8A 4AZ0B 4L3WA 2ZZQA 1NW6A 4GNRA 3T7KA 2LV8A 3KAKA 3MTBA 1KMHA 4OLBA 3NHBA 1RWQA 1IN4A 1QMGA 2AHOA 1YOBA 3IKLA 3OD5A 4H2DA 2FR8A 3DWGA 3ZGVA 4OYYA 1JQ3A 3HKBB 4XORA 3MIIA 3RVBA 4YY3B 4E4TA 2ZYIA 4UUBA 2WFLB 4QOGA 5IABA 1SRQA 2N9UA 2I7VA 3PL5A 1CUSA 4QOIA 4A82A 1WZ2A 3G59A 1Z4MA 3TQOA 3QSGA 2B8WA 3X2EA 3LY8A 3O1IC 3UV3A 4MYHA 3NH9A 3VX3A 2OZPA 5EUMA 1AGNA 1JG1A 2JZNA 5DYTA 1JE0A 2ZRIA 3HU2A 3ZHRA 3DDHA 1XHFA 2H31A 5EZSA 4O33A 1GDTA 3X2FA 5DYNA 1WCXA 3DEIA 2GBFA 4L5CA 3W34A 1H3EA 1M1YB 3CZAA 3U09A 3W4IA 1G9SA 1KEZA 2IQIA 3NM6B 1IHMA 1U8EA 2XY4A 3I23A 4KXNA 4JKIA 1XVIA 4WXRA 3KQVA 2XT0A 1SVWA 2BM0A 1JPUA 1UKBA 3L1VA 4YAFA 3AZPA 4Q16A 5TARA 1ST2A 1Z7WA 3OIVA 3SJAA 4Y6QA 4RHXA 8LDHA 3EVEA 5KOIA 1ZEJA 3H1TA 3GXOA 4M6WA 2DGDA 1XJWA 1EQUA 4BGUA 1J8DA 2X23A 1X74A 3WIDA 2BKXA 3SIPA 1IQ0A 3R5HA 5CEEA 2B0JA 3SFTA 4EHJA 5DISB 3MT8A 2Y71A 2HIAA 4MVJP 1R3UA 2QN1A 1E9SA 4MCIA 4Z51A 3I37X 3GMSA 4FFLA 2RIRA 3KUXA 4HDMB 3WDLA 2YMQA 4BJ3A 2X3YA 3G68A 4JYMA 2WF7A 4FOOA 5DCYA 2Q5EA 3I1IA 4HD8A 4MYUA 3E48A 1CRZA 2GF0A 1YZ3A 3ECCA 4KO8A 4LI3X 3WLOA 3DHEA 4YIHA 3SF8B 5U1PA 4OP3A 2ZAMA 3WRVA 1MFPA 1VLYA 1RJ9B 4KQJA 4LYEA 3K0CC 2WZBA 3EF1A 4XB6B 5IN4A 2JW5A 2NO5A 1A0OA 3ETLA 1WAMA 1J33A 2FZEA 1LDBA 3VR6A 2FLKA 3LY9A 3NOOA 1EH5A 3GDOA 3QPVA 4KPGA 1OX4B 3CG4A 3IPRA 3KOWA 5CLJA 4Y9SA 1FSSA 4EY7A 1KDRA 4D9MA 1M5UA 5B4UA 5LQNA 3L7YA 4FDMA 4LYHA 1LRLA 2Z2YA 3G5UA 4RHEA 4G1UC 4UNPA 4GYYA 3SSAA 4D8WA 1D0IA 2O7RA 4HEHA 1R10A 3C6QA 5JCXA 1JI0A 2I22A 2GK3A 3T4UA 2G0NA 3USZA 4QTZA 3CJQA 1TTHA 1VL8A 3WJ1A 1C8BA 1IBSA 4KE9A 4ZDIA 2P5YA 1O4WA 2VT7A 3EY9A 6CHYA 1P2TA 4KXLA 3LQEA 2HY7A 1YE8A 2P78A 1H1LA 1OV4A 4RS3A 1I33A 1O5TA 3FPLA 5GM1A 1H6CA 3KTOA 3EZNA 5DRTA 5BO5A 5KMGB 5A6SB 5KYGA 1KI1A 3KEQA 2IDKA 4OHXA 4DANA 2X76A 4B80A 5DKFA 2L19A 4BFVA 5IM4A 4MDHA 1XTPA 2ZIVB 1ZGCA 3OCWA 1FFYA 2SKDA 1QC5A 4P7JA 2DOGA 2L2QA 4WFQA 1HDOA 2C7GA 1ZM2A 1ECGA 1GT6A 2FQYA 3IDOA 3KDSE 3ZWKA 1AA9A 3NBAA 1EZ4A 1N92A 3HHPA 4NMMA 4ZYLA 4N54A 2OFPA 3HDVA 4D42A 2E3JA 2IXEA 1IN5A 3I4CA 1EFCA 1QK3A 4GPEA 3RVMA 4DMLA 2PKQP 1K7EB 3ZU6A 4RQAA 3Q98A 3DHVA 2BEWB 4QPZA 3T12A 4INAA 2PLNA 2WT4A 3HKDA 3K30A 2VP2A 3MXOA 3KOUA 1ODTC 3LDAA 3OZIA 4IIXA 4G41A 4M3NA 4DLUA 5JOQA 1I94B 5C52B 1ORVA 3NE5B 1XTKA 1QIMA 3NCTA 4PSAA 2Q0XA 5LP6A 3B3AA 4JJ8A 1D5CA 1QO9A 3PQ3A 4AURA 3B1WA 3EBPA 4LXTA 2ST1A 5KSPA 5A03A 3J7TA 3WNZA 3WWYA 1FP4B 2XAUA 1J1IA 4CI0B 1V6CA 3KPYA 1M2HA 3D2LA 1VBNA 5FUMA 3S2SA 4ZCQA 4EJSA 2FEKA 1AUOA 2F1OA 4CKCB 2FR0A 4YIKA 3T3GA 2Y99A 3NHJA 5BSUA 2K2QB 3CRMA 3OTHA 3F3YA 2O2GA 1JJVA 1Q7EA 4RXUA 1PJ6A 5FB3A 4ZJUA 2X53S 1CP3A 1OLUB 3Q9LA 4PYQA 4RYDA 4IEEA 4E31A 5IWCA 4EHIA 2ETVA 1GSOA 1EWKA 2ZJBA 1GL9B 2I2DA 3TMYA 4E09A 3PITA 5NLLA 4Z53A 1D4ZA 1KIFA 2BBWA 3P4YA 1X7HA 1M83A 4MWTA 3OTOB 1IDOA 1ISIA 3CU5A 3ONYA 1CUBA 1NUSA 2KPOA 2M6RA 3KU4A 3MINA 1D3AA 3DT8A 3ROFA 1KEKA 4X8HA 1Y8CA 2BR3A 2RFLA 4XGNA 1HUQA 3HS3A 3I52A 3ORSA 4JQCA 3I9OA 4OHOA 2XKAA 1M0WA 1G8FA 3PA1A 1GZDA 4XARA 3SDZA 4B2LA 2OHIA 1N8SA 4CMEA 3EGWA 4YWJA 1UOEA 3FWNA 3JVVA 2ZRCA 3ZKWA 4GZ6A 1K27A 4HQ6A 1U5BB 1W85B 3CXRA 1SCQA 4X05A 1O6GA 3COVA 3KEFA 3L8MA 2PXXA 3H6GA 4N1AA 3MFYA 3PDIB 4TS4A 4HDSA 3JTMA 5ESRA 5C5EA 5LU9A 3SEQA 4D98A 3DMTC 3DMGA 3T7CA 4JJ7A 4RTQA 3Q0IA 3CF2A 5TEWA 4WBNA 1Q19A 4IDDA 1ZRHA 5C8YB 2JASA 1BXRB 2ZUTA 4K9OA 2R6CA 3UC5A 1WCWA 4MUGA 4URZR 2VXBA 2H5EA 1RE0A 3MSCA 5DN9A 3GG9A 3JPWA 3FYTA 3ZVNA 3OX3A 3PR3A 4YP9A 1K5HA 4ARAA 2ZUFA 4LA4A 4E2XA 4I1SA 5IN5A 5IPFA 3IDSA 2EJBA 4YMSA 2HMSA 3CZMA 4L8YA 4MIOA 3JQAD 1SPXA 3QE0A 3R3JA 3CNNA 4TV8F 5IJXA 3RAFC 1CQJA 4IDQA 1LPMA 4O4IF 1CE8B 3GLHE 4CZ2A 2C7OA 1HYHA 3P2OA 4NAVA 2VKQA 1BQ4A 4NBTA 1CDDA 1KDVA 5JDIC 1XZPA 1ZRMA 2QKYA 3BSWA 1VLJA 3T5MA 5T57A 4DBVO 2RHOA 3E9DA 4KFUA 3GELA 4E51A 5BOSA 1OKKD 2QPTA 4ISBA 2G1KA 1J06A 2CEAA 3GFSA 3RFUA 1RAGA 3UBTA 3H2KA 1HQDA 4ESVA 3NC0C 4MCAA 1ESNA 1MUUA 4QSMA 1N36B 4BNTA 4G56A 2WI8A 1U0TA 2ZYWX 4I4TB 1DP4A 4NBKA 1VI5A 2OCPA 4X6XA 4HPWA 3A9RA 3WIOA 4D3FA 2OG1A 2YBDA 4RETA 2VS1A 1KQFA 3PQCA 1IOWA 3JY6A 4DDMA 3KYDA 4E5VA 3AVUA 3PFWO 3QYAA 4KQIA 4I3GA 2PTHA 4JI8B 4OOSA 2OUIA 1Z28A 3FFWA 4RFLA 4RE6A 3PJDA 4RHCA 4LF9B 4HL6A 2JL1A 2QP4A 1Y5LA 3QX8A 2WMDA 1SXIA 3WB0A 5LMCA 2QAGA 5E6SB 2XQGA 4AO7A 1NKVA 3A32A 3A2LA 3BWDD 3DF9A 1QANA 2AVDA 2JARA 2O05A 4ZAXA 2XT6A 2EX4A 1K7FB 4D9BA 2P2GA 1G0OA 2VTDA 4N65A 5J1TB 5K3DA 5JDCA 1E5QA 1PD0A 1VCIA 3RS0A 5FWAA 3C3WA 3ZUGA 2HA4A 3P9YA 3R7FA 4EUKA 2DBQA 3UJ3X 2BUBA 4WZBE 4D41A 5BN4B 2A30A 2GZMA 4FOTA 2OA0A 2ZXEA 3WMEA 3SYKA 1Q7CA 4ZJYA 2A78A 1JEEA 1QO7A 4YI3A 5DOVA 1U3DA 2F9MA 3P2MA 4W5HA 4ZFNA 2CMFA 1DQZA 3ZJYA 3JATB 5T8KC 2O0JA 2YV1A 2WMOB 1ZMOA 3K92A 4PZDA 4J0FA 1EFPB 4RZ2A 4XXHA 4TMFA 4YWHA 3H9CA 1H93A 5KJEA 5K0CA 3KJFA 3RPEA 1ZNQO 3IT0A 1GRQA 4HY3A 4JJAA 3UXYA 3OD1A 1M1NA 3G2JA 3N59A 5G1OA 3GPCA 4CEHA 3T51B 1CY2A 4HUJA 1JZSA 4F5YA 4P54A 1QIFA 3E9ZA 4ARZA 1ZS9A 6REQA 2CXXA 4A23A 4DR6B 1NBOA 3B7PA 4KN6A 5KYNA 1D2RA 1TUEA 1SBIA 1ZVQA 4JLBA 1XWWA 4OYLA 4CLDA 4D9NA 1M6HA 4JLVA 4RESA 1IY9A 1RI3A 1Q3KA 2EWMA 2DBYA 4G0PA 3TAHA 4BE7B 4RQBA 3GCWA 4Y1GA 4Y67A 1Q82D 3HKEB 4LKOA 4MRSA 3S27A 4AZWA 1WXWA 1Z6AA 3PQFA 1NIJA 4DREA 2R00A 3N8DA 5EAIA 1YDMA 3N87A 5B58C 4DM3A 2HT1A 3IHLA 1E4YA 4X41A 5LR6A 2B37A 4IL5A 1KY4A 3FG9A 4MUBA 5TMPA 3ESCA 3NHPA 4UM9B 1O9BA 5EE9A 3NG1A 1VMKA 1N2SA 4DCSA 1LW6E 1N0WA 3OZCA 3VR4A 3D02A 3UPTA 4FVTA 1XFOA 3FFTA 3B13B 1IY8A 3IEPA 3WK9A 5HS4A 2C58A 1SH7A 2DLNA 4N6OA 1ZRNA 1R9NA 2XZTA 3HSKA 4W5QA 1K98A 2B0CA 3KYCA 1QHGA 1WDMA 2HRRA 3VM6A 1DADA 4WACA 4LHZA 5C34B 5L8VA 4Y7DA 3TVYA 4BNYA 4FQ5A 4NDAA 1N5RA 3RBZA 4DEXA 1MB0A 2FRXA 4JKOA 1DZ3A 4RM0A 4A1FA 4MS3B 1JDJA 3A8IA 3KUDA 4OH7A 4QECA 4DWOA 4J7CA 3QQ5A 4FNGA 3LK7A 3W8DA 4G1VA 2V7QA 3S55A 4KO4S 5IUNC 1ZM7A 1A3CA 4F3NA 1O6CA 2HWKA 4X5OA 3CH4B 2VZ8A 1XPUA 4TXLA 3EBOA 2HWUA 2GASA 3LQ6A 2AOVA 2BKVA 1Z5PA 1T9GR 2QUHA 5KEIA 5ALYA 3I2HA 1U9JA 4F2WA 1X0VA 3BQMB 3WBBA 3G0IA 2EF1A 1OUMA 2OBYA 3DFKA 3GN2A 4LVUA 5EJAA 2R7MA 1S7CA 2C0CA 3W2IA 1IOZA 2X0NA 1BCSB 3KAPA 2PRIA 4RH1A 4YUVA 3EDYA 3TI9A 3FHJA 4LI0A 3B52X 1NRKA 1U0GA 1C8LA 2AZMA 3URKA 4QTUB 2A4KA 1EDEA 4XZ3A 2Q2OA 2JEOA 3EWNA 2QWXA 4FUQA 4RGYA 5JO0A 1B4DA 2V7WA 2W6ZA 4JOQA 4CMKA 3MJHA 3CVJA 1TVKA 1H05A 4H3SA 2QRKA 1NQOA 1FTSA 3TTUA 3T3NA 4LWZA 4OA5A 5ERXA 3VSCA 1ULAA 1M3SA 1Q1BA 2CCKA 3P4XA 1G59A 2I6QA 1V5WA 1SKQA 1X42A 4KGZA 4QEDA 1GUDA 1NGSA 1Y1QA 2IYSA 2N42A 3G2HA 4MYCA 1VE3A 2H4FA 3TD2A 3UMJA 1QSGA 3GCGA 4IG4A 4Y6SA 2ZBEA 1GIAA 5B7NA 2H1HA 4FFSA 3NHAA 4J4BA 4I3FA 3WWOA 3Q11A 7YASA 3T54A 2G1JA 4TZKA 3WZ2A 3ULKA 2YQ4A 3OZSA 3ZEAA 1GL7A 2J0EA 3L82B 4US1R 1US8B 1CK4A 1SKYB 1JEOA 1MO6A 3JZDA 4OHCA 3W6UA 4CMEC 4Z4TA 1ULSA 4BX3A 1SVUA 2BHSA 1ZK3A 3BY2A 2X9VA 2KYRA 1E98A 3MWDA 3VZRA 5ED4A 4W6QA 2KHZA 1EGHA 4ERXA 3FDZB 4R81A 2R8PA 2FN9A 4ZEWA 3ZGYA 1BKSB 4UHCA 4BKQA 1FZQA 3FROA 3S1LA 3FOEC 1EA5A 3IX7A 3R3YA 5ECYA 4KB5A 1IJBA 3O8DA 4HP8A 4B8WA 1Y4DE 3K20A 5EN4A 1T8SA 4MQFB 4R3UC 1JTEA 5AP9A 3D0QA 4X7RA 1TK3A 1ADCA 1UDWA 1QRSA 1KAMA 2R00C 1YA8A 4P31A 2DSTA 2ARKA 1KGSA 1G17A 1NW7A 2XJ9A 1XD9A 4TSKA 4DNTB 5K2MA 5LA6B 2B5WA 3L4SO 2AZ4A 1B6RA 3MCUA 4TTRA 5JS6A 3FAKA 4CDGA 4W8GA 5GJBA 1PVOA 1B0AA 2GVDC 2A2ZA 3CN7A 2CJWB 4PS1A 5B5SA 4PHCA 2A3RA 2ORVA 2Q0HA 2ON6A 3PC4A 4YS6A 4UAUA 5TQ0B 3BHMA 3LPNA 3EFEA 3WK5A 1T1GA 5LSAA 2R0QC 5BWMA 1PG5A 1Y6RA 4TL9A 3HXMA 3ZWWA 3CCFA 2H5IA 2YXBA 5IEJA 2JBAA 3X2SA 5FX2A 3HYNA 1M1ZA 4WKNA 4OK6A 4D57A 5IC5A 4E1AA 4TRRA 5LWQA 1K8XB 1Z0KA 1NVMB 2KB0A 5AK5A 1G5IA 1IEQA 2WAAA 5AM5A 3AM3A 3K5IA 2QORA 3NHMA 3RM3A 3L7AA 1PJ5A 2OTCA 3PUVA 1GSHA 4KFTA 3QE2A 1YI1A 1R00A 4B09A 1R5NA 3P96A 4ZOCA 2XGJA 1Q20A 2NSLA 3QYPA 2G07A 1NXVA 2QVBA 2VJQA 3Q40A 1J0DA 2C59A 3MM4A 2VK2A 1E6MA 2VK1A 3GZNB 4RKEA 5K3OA 5KKCA 1HNZB 1S8FA 2PO5A 1Z5WA 1DBWA 1NU6A 1YO6A 4JJKA 4LVNA 5E1DA 3ZWBA 2PRKA 3REOA 4FILA 3OOCA 2DJ5A 5EEHA 1KQSB 4QASA 1DXYA 1M2VA 2PZFA 4LCBA 4M9UA 4OF4A 3ZW7A 4EHLA 2NU9B 3AU8A 2WZCA 7MHTA 4IGEA 1BX1A 3P5SA 4H27A 2WFAA 1Z4NA 3KOOA 4LXHA 2NZ2A 3NAGA 2BTQA 5AK0A 1W4CA 3O93A 2Q6OA 2HA6A 3HGTA 2FKNA 2XZLA 4K3VA 5GP1A 5HIMA 2BI4A 2WLSA 4EFNA 3RWBA 1PL0A 1VL0A 2PGAA 4NYJR 3STUA 3T0GA 4CPDA 2VI5A 2A4MA 3MEQA 2JFNA 2Q1TA 3CEPB 4G23A 3L5OA 3PGXA 1YS9A 1KP9A 1NATA 4I8DA 4KQGA 1E8DA 1Z39A