4C43A

Ferredoxin nadp reductase mutant with glu 103 replaced by tyr, tyr 104 replaced by phe, ser 109 replaced by phe and gly 110 replaced by pro (e103y-y104f-s109f-g110p)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLYFKHPEFPETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title External Loops at the Ferredoxin-Nadp(+) Reductase Protein-Partner Binding Cavity Contribute to Substrates Allocation.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4c43A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4c43A02
5DSZA 3JQQA 1F60A 1BQEA 3W5VA 4U9UA 4M53A 1W34A 3CC4B 3W2EA 1VQMB 3WNDA 4B43A 3QFRA 4DQLA 4G1BA 1JB9A 2B7BA 4LBYA 1HA3A 4FK8A 4DQKA 4N3GA 4HE5A 4LBZA 3I55B 1OB5A 5AN9A 1SKQA 1W2BB 1KD1D 4J0QA 1YJ9B 1G7SA 4RD3A 2B7CA 3I56B 3OJWA 4ZCIA 2XEXA 1CNEA 2OK8A 2RC5A 3CMEB 1OGIA 3CPWB 1B2RA 1M90D 5EMNA 1VQKB 2D74A 4M0LA 4QFMA 4EH1A 4ZGQB 1F20A 1J9ZA 1EP3B 4G5GA 2OTLB 1D2EA 1SM4A 3CCLB 1VQPB 1YIJB 5TR9A 3CC7B 4FWTA 3WBJA 1FRQA 1S72B 3P27A 1FNCA 1S0UA 3CC2B 3AGQA 3OJXA 1EP1B 4RJLA 2BPOA 3G6EB 4P3YA 1W87A 1YHQB 3B8HA 2VYQA 1TTTA 1VQNB 2FX3A 3CCQB 3OZUA 1QUFA 3SJZA 2HCJB 4Q7JB 4PC3A 4B47A 1D8TA 2C77A 1JA1A 1ELOA 2YWGA 1XB2A 2VNHA 2QMUA 2QA4B 3WBKA 1FDRA 4R71A 3AGPA 1QG0A 1Q82D 2RC6A 1QGYA 1EFCA 4RD6A 1GO2A 4RD0A 5GV8A 2BV3A 1GAQA 2QDXA 1N8RD 1KK2A 1QFZA 1K9MD 4WQMA 1YITB 3OW2B 1EFTA 1Q81D 2PMDA 3CCSB 1Q7YD 4RD1A 1H85A 1KTVA 1GR1A 4TMVA 3G71B 4ZGNB 2J7KA 1FRNA 4PC7A 1G7TA 1YI2B 2CRVA 4NBSA 4ZCLA 3CXCB 3E1YE 3MHPA 4M1KA 1K8AD 1ZM3A 2VZLA 4YAWA 1ZUNB 3W5HA 4N3NA 1EP2B 1EWYA 3CMAB 2NPFA 1ZM2A 3CCJB 3AVUA 4RCZA 1EFUA 1G7RA 4M2LA 4AF7A 1FNBA 3ZZTA 1H42A 1YJWB 1QH0A 2YWEA 2VNJA 3LRXA 4C0SA 5GV7A 3JQRA 3I1FA 1DARA 3CCUB 1VQ4B 1CQXA 4M4SA 2C78A 2BF4A 1N0VC 2ZITA 5TY0A 3VO1A 3W2HA 4ZCMA 1GAWA 4LC0A 3ZC3A 2GPJA 3CCEB 4B44A 1K73D 1GVHA 1QVGB 3QFSA 4QHYA 5TV2A 1R5BA 1GJRA 4PC1A 1TVCA 3V76A 1IJFA 2B5OA 1QUEA 2DCUA 1KRHA 1NJID 5H59A 3WNCA 4NCNA 1W35A 4B4DA 2CNDA 1QX4A 1IB0A 2EIXA 4YAFA 2QTZA 1TLLA 4AC9A 3A1FA 3ZZUA 1EXMA 4RCYA 3MCAA 1QVFB 4PGOA 1NDHA 3CB4A 3VMFA 3AVWA 4P6VF 3WNBA 4H9GA 1KK1A 1BX0A 2PLFA 4ACBA 2E1RA 4LBVA 2VNIA 3PENA 4B3XA 1Q86D 4G1VA 3LVBA 5KSWB 3CCRB 4RD2A 4UAJA 2AHOA 3OZVA 1VQ5B 1VQOB 3WYAA 1BJKA 1XE1A 1VQ8B 4TMXA 2X3UA 5HXBA 3J81k 3FPKA 3G4SB 4PC6A 1D1NA 4TMWA 3B82A 1R5OA 4Y7CA 2YWHA 4Y9RA 3FJOA 3MMPA 3WXMA 2OTJB 3VNUA 3U6BA 4AF6A 2DETA 4FN5A 3W2GA 4YALA 3CCVB 1FNDA 1KK3A 1M1KD 1JJ2B 4TMZA 4LBWA 4PC2A 1I7PA 3B78A 2PIAA 3QE2A 5JBQA 4YAOA 3CD6B 1KQSB 4TMTA 4MYTA 3JQPA 3VO2A 1KK0A 3QSYA 4C43A 1WDTA 3WY9A 1FNMA 5FA6A 3ZZ0A 4HE6A 1ZM4A 3CCMB 4YAUA 3OZWA 1E64A 1QGAA 4ZV4A 2QEXB 2QN6A 2EFGA 1KC8D 4Y9UA 1VQLB 2XNCA 5H5JA 1JNYA 1DDGA 4F7DA 3CW2A 2DERA 1B23P 4YHBA 3AVXA 4RD4A 2HMAA 3ES9A 4K1XA 2BGJA 2BMWA 1QGZA 2XNJA 2HDNB 3U2QA 3E20A 1A8PA 1N0UA 3QFCA 3W5UA 1VQ7B 2BSAA 1JA0A 1UMKA 1DDIA 1OGJA 2BVNA 3QFTA 1AMOA 1G7CA 3P26A 3ZBUA 1DG1G 3U6KA 2BGIA 2OK7A 4IW3B 3LO8A 2BM1A 1E62A 3ZBTA 3CRZA 3AVVA 4B48A 4BPRA 3LYUA 1BX1A 4TN1A 1E63A 1ZM9A 1QFJA 2DEUA 2R6HA 2VNKA 2GQFA 2YWFA 3AVTA 1AIPA 3AVYA 1OB2A 2DY1A 2QTLA 1CNFA 3W2IA 3W2FA 2BN4A 1VQ9B 1R5NA 1QFYA 1VQ6B 1YJNB 1KJZA 1U2RA 1TUIA 3VNVA 5THXA 4MYUA 2BM0A 1IJEA 4ACAA
chains in the Genus database with same CATH superfamily
4UVIA 3SCZA 1ODFA 1N2CB 2ZJZA 1USKA 1IUNA 2EDAA 3CUYA 3DMHA 3GGJA 3PKJA 2XUZA 1LI7A 1RP7A 4I55B 4NCIA 4BQOA 2Q4BA 3D0QA 4F5EA 1JSRA 1Z2DA 1JF8A 3PUWA 2XECA 4GG1A 3RVRA 2PQ6A 3FYUB 1RRVA 2IIQA 3D0KA 5H3LA 4ETMA 4G0NA 2UDPA 3ETLA 1ZQ1A 3I3OA 3OTGA 4FZ5A 4G1BA 3CEPB 4WTOA 1GG2A 4XOUA 4ARAA 3QELA 4HNAB 3BHNA 5IUJC 4WOBA 5CIWA 3WL6A 2XNDA 1NZDA 4RDJA 1YKGA 1RXIA 2QM7A 4KI0A 3T4PA 3UMRA 2NGRA 2QX4A 2XZDA 5E6RB 1XDDA 1CSEE 1FU4A 4EKEA 5KWJA 4BFCA 5F5LA 3QWIA 4KN9S 4D42A 1AUVA 5C8DA 4WRRA 1CRLA 2EHDA 1JXMA 2FAXA 3BRQA 3F9RA 2RG1A 4GLFA 1KE2A 1USVA 3FUCA 1P9OA 3B70A 1SKQA 1X38A 4I5FA 2V7TA 1JHRA 1X1QA 2CDCA 1W2BB 3BIJA 3L0YA 4MJ7A 5AQEA 1M6EX 2ASVA 1E2MA 3BD9A 4OQFA 5EXTA 4DNPA 3PC2A 1Y5IA 1JU9A 3K1YA 3E9YA 2YYYA 3H1TA 3E3LA 5AHWA 4IH4A 2E4WA 2IVZA 4QTUB 1BVRA 2IYSA 5MF6A 5JXJA 1V8OA 1GQOA 1OOEA 2QN9A 3IJRA 5EWLA 1GM5A 1FJ2A 2FI1A 3BHJA 4GPAA 1MCZA 5E7MA 2R9VA 5CURA 1RRMA 3U49A 3R6WA 2AMYA 5LMCA 2DTDA 1T4CB 3U3XA 3ZDAA 1OYVA 3HU2A 3I1YA 3HY6A 4F2HA 2JRCA 1FP2A 3FJ1A 1HPLA 2LCFA 1NNSA 1MMFB 2IOFK 4IBOA 1HG1A 4U39A 1P2DA 3EHDA 4GI7A 4WXEA 1NFFA 4BJ3A 4BVKA 3RGWS 3COZA 1YRHA 4DBVO 1E60A 2D74A 3B6JA 3L05A 4OGWA 2BHTA 4ZGQB 2BGKA 5K3FA 3LPDA 2YUIA 2GCIA 2W0MA 3R7LA 4UM9B 4UHKA 1K6MA 2VYVA 2C5GA 1P1KA 4ZC1A 4GGOA 3HCFA 2QY6A 2BI8A 3DZBA 4IVRA 1MQAA 1VQPB 3RAFC 4U7JA 4XDZA 1C8VB 1YZFA 3LWBA 2QPLA 3LLMA 1FNCA 5AJYA 4AMZA 3SZRA 4PHTA 2UUCB 1IN1A 2ZBUA 3IUSA 3R3YA 4OH1A 4YDHB 4EBBA 2VYVD 2IX9A 3ORRA 1KSFX 3G6EB 4DDMA 2VCYA 3HUDA 1UQUA 3ZI0A 4OJKA 1XHLA 4DLAA 2G4VA 3WRYC 4NCKA 3WLRA 4LECA 1RIIA 2CFTA 4O59O 4KR9A 1OZAA 5LA6F 4RTKA 4IG4A 1J99A 1B14A 3KOWA 4J4BA 4LGVA 3RD5A 4Q9HA 5K8VA 2JLCA 3PPVA 3VPDA 1W47A 1VPWA 2C5FA 1UDBA 3RVMA 5K0TA 2OCAA 1SJ9A 2MYUA 1IOZA 1FMJA 3CF2A 4GMGA 5DZSA 5JPCA 1N36B 4PO8A 4F38A 1TU4A 1WTCA 1AK1A 1YL5A 1WG8A 1C3OB 2K87A 3QTLA 1QZZA 2VDNB 3FXAA 3UK0A 4CLHA 2R6GA 2OAEA 3BZWA 3G89A 4MCAA 1FBNA 3M5DA 4G9EA 3MILA 3P45A 4LOAA 4DRXB 2JBAA 4ER7A 1YLOA 1MNAA 3Q3IA 2AXPA 1NRXA 2HM7A 3OIWA 2X1LA 4GMKA 4MQUA 1NI5A 1F14A 1NYQA 3WB0A 1W0CA 3IL2A 4DGSA 3U19A 5F52A 3HQ4O 5LNK6 5GMOA 2B3DA 2QGZA 2R00A 3A2MA 3QFFA 3ST7A 4LTNA 1OFIA 3OJOA 1F1BA 3ZLUA 4ZOLF 4R71A 4N48A 4AUNA 4RTMA 1UJMA 2VJDA 3Q38A 4MP3A 1EUCA 2ZS8A 1HDZA 3L6RA 1U81A 1MABB 4OQLA 1QGYA 4X1IB 5K03A 4QJBA 5HZGA 3TG2A 4OM7A 4RXTA 3Q1LA 3SNHA 3WFJA 4YCSA 3KYCB 2E89A 1E7YA 2FWMX 1HRKA 3LSYA 3PUJA 3BDVA 2L0XA 3OEHA 2NU7A 5KCZA 1VI5A 1VP3A 2CWWA 5FHRA 3KUDA 5KQMA 1EK0A 4XDHA 3F8WA 4FDAA 3I2HA 3PUKA 4P2BA 1HQYE 3L0BA 4TV9A 1I1QB 4NAHA 5KYWB 4WNAB 1FYEA 4ER0A 3DOFA 4NCHA 4G5SA 3RK4A 4XCVA 5IAGA 4MUXA 4B9AA 3IAM6 2QZ9A 1Q1GA 2Q1WA 2PXCA 3K2BA 5LA6A 2BH9A 4CG1A 1GXSA 1EWRA 1G21E 1ONBA 3OEHD 4LFCB 3P94A 4MLDA 4F4DA 1W59A 2I2CA 1SCNE 1EFTA 3H5WA 1WPGA 1L4EA 4PYLA 2WAAA 4LY6A 3MWDB 4OQNA 5TDHA 1KOGA 2Q45A 3NDJA 4U5XA 3RVPA 1E0JA 1K7YA 4NECA 3KJGA 1G0NA 4DIDA 3LGSA 4ND3A 1RAEA 3CKKA 1WBJB 1E7SA 4MR7B 4N12A 4JAVC 5CLIA 2F1RA 1X1CA 5B58T 3MB8A 4ROXA 4BMCA 4R1QA 4NBSA 2LUOA 1C8BA 2DUWA 5GJCA 3BILA 2ZRAA 5JQGF 3VHRA 2G1KA 2JIMA 3G5MA 1Q44A 2WUDA 3D8NA 1QKKA 1JLKA 2NZWA 4N3BA 5EP1A 5HGJA 5L7WA 4QOFA 4ZCTA 4ZOLA 1ICEA 1RI2A 4EA7A 3ZXYA 3P52A 1ZKMA 4ZMBA 4BGVA 4KWTA 3TN7A 5B55A 5F4JA 2NUTA 1P4JA 3TRDA 1LGYA 1KR5A 3G1WA 4LCBA 2IS6A 1PS9A 5AM1A 2DQKA 2EKDA 2XE7A 2BHLA 1IZYA 1L7XA 1P19A 1Y6ZA 4NCJA 4RDXA 3OZIA 2F1IA 3BWVA 2LW7A 4EKYA 5A1TA 2ABWA 4ZHQF 2O6LA 1T8WA 3QW4B 4JQOA 4O3FA 5AVSA 1O89A 5JMPA 4Z3KA 5LR6A 2PUCA 4MW7A 1OWPA 1EFKA 1XSEA 4P4TA 3R6KA 1QE5A 3DVSX 2EZ8A 2OKCA 4U6NA 4YAKA 1H42A 4QKQA 3ORQA 2WIGA 1E3ZA 3R7BA 1YGYA 2I8AA 2EL9A 4PSAA 4XFKA 5ALNA 1SCQA 2CLFB 2DUUA 4QWMA 1Y6JA 3NNNA 1A9PA 1F5SA 3DDCA 1KC3A 3AFNA 3EDCA 4Y6SA 3WHLA 3GFOA 4G26A 1GDHA 2H0RA 5ABPA 1H93A 3GFFA 1ODJA 1R6VA 4OQQA 2BZ1A 3K09A 4PONA 3L01A 4J1QA 2GM5A 2HYDA 2ZRQA 3RI3A 1KZLA 3AHJA 1VQ1A 4TS4A 1L8QA 2OCIA 4JLPA 1JIUA 3Q88A 4N40A 1EWVA 2D6FA 3ELDA 3H9QA 1JGTA 1K7EB 3GHHA 4LK2A 2XGSA 5K0GA 3JQ7B 3TAXA 3G13A 3VO1A 1LLFA 1KERA 2AI2A 2J9RA 3MJHA 5AOBA 5KYVA 4JEHA 4LY3A 1BLIA 1K3FA 2YMPA 3AXTA 1S8FA 5J47A 4PIMA 1WX1A 3R5KA 1WOPA 3BGOS 4BLUA 4PLCA 1A9XB 5JQGA 2J9YB 4PC1A 1VC2A 2I3DA 4XKWA 1Q7BA 3V8EA 1IJFA 5HIMA 3B6ZA 5BRAA 2VNAA 1PQ4A 4L51A 3HB5X 5EVCA 3D2LA 3ZKAA 5J9FA 4D8XA 4DUGA 1K5HA 2CNDA 1NW9B 1F6DA 2C31A 3PD7A 5CNKA 2G63A 4HQRA 4Y1GA 4ZAGA 1RM5A 4DM4A 1M7HA 3JARA 3MJDA 4R9VA 1GUBA 2QVGA 4JUDX 4TRRA 4D0GA 3QQPA 4MW6A 3S2YA 1Z0KA 2BD0A 3WMEA 2XCOA 3AUFA 4CM8A 5HQTA 5AI6A 3H6KA 2W2MA 1FSZA 4ZHQA 3BERA 3ESRA 4TWZA 5JSKA 2QY9A 1E4YA 3ZH9B 3FUVA 3GN2A 5K3BA 2X9GA 1IXYA 2PKXA 3ER8A 5JADA 3VPCA 4DUGD 1H2ZA 1T9DA 3HJCA 1WPCA 2IYZA 2RGBA 4WL0A 3ZVNA 2P30A 2GPYA 2AG1A 4I8IA 4WLFA 2BFCB 5G4KB 3SKYA 1Y7IA 2ATVA 1TD1A 3OPYB 2QG4A 1CUEA 1JE1A 1VHEA 2JJQA 2AJCA 4WI1A 4KLZA 3JZMA 2F8MA 2OAQ1 4CQNA 5AM0A 1CUCA 1VMKA 3IVGA 1KS2A 1G8YA 1PV2A 1XZPA 3R5SA 3EQ7A 1AHIA 1SC3A 1W5TA 2BGUA 2IC5A 2YVLA 3DGFC 4IOJA 4MV9A 4PLPA 2WI8A 2ZXEA 4BX3A 1Z15A 4H08A 1KJJA 3ETJA 2WT8A 2W6JA 3RSLA 1M1ZA 3ZDDA 2YYSA 1HG0A 3IDOA 3ROPA 5A6VA 4L4SA 3G2IA 1PS0A 2R7MA 3GVIA 1WDWB 2HSWA 1IIRA 3I9KA 4QHSA 5EG5A 3RHFA 3RJTA 2M6LA 2FY8A 2N3ZA 1A4IA 2G67A 3C98A 4Q3BA 3RUPA 1XOIA 3SJUA 4P98A 1FUKA 3PC3A 3VGJA 4ZT2A 2J85A 5JNLA 3TD9A 3AR9A 4MIYA 4JP3A 4RE5A 2R4TA 2W6JD 2W2LA 2IDMA 3B6IA 5K0ZA 1M66A 1RRFA 2JCVA 1A77A 1BCRB 2E5FA 3R6DA 2O8EA 2DJ5A 5DLDA 4KKTA 4PPGA 4XSHA 4ND4A 5CVVA 4AJ2A 3Q10A 1QTQA 2CBXA 3VJMA 2WWVD 1X19A 4KL8S 1VKNA 3KB1A 1NAHA 3LYLA 3VKUA 4KHPB 1U1DA 2W2LD 2J3LA 1O08A 2ZZEA 3GC6A 3K0HA 2QK4A 2V54A 4PPNA 2P2ZA 2F1MA 4DLUA 1Y48E 2QJRA 2Z1NA 4L6IA 3TSYA 5JISA 3E9ZA 1YQGA 4I1IA 1QC5A 4F3NA 3BL6A 3RHTA 1EVYA 2B1IA 3DV9A 4EAAA 5C8VA 4D9IA 5CBPA 4F2WA 4P7FA 4GUAA 4YALA 2PY6A 2BKUA 4PPYA 1XKTA 5HKLA 4LF6B 3AEZA 3DS8A 3NBZC 4ZAZA 2LZJA 1ICIA 4FDMA 1QO9A 3EWSA 4MUNA 5BW4A 4CTKA 2J9FB 2ZAMA 3A2LA 5BRJA 3PYXA 1U5CA 2JCSA 1E3JA 1ONNA 3EIQA 3K31A 4JLMA 4RHYA 3WLFA 1RRPA 2QN8A 1YJ5A 1TVEA 2UZ1B 1NKSA 4PF1A 3D8BA 2HZ7A 2XUQA 4W6ZA 4BE9A 4PRYA 4MCHA 1NVTA 4CKZA 2B9EA 4PC2A 1WDLA 2EG9A 1AQUA 2VJNA 2C82A 3ILXA 2WA1A 2GPNA 2O0KA 3HSSA 1YB1A 3PC8C 3BXGA 4RACA 2Q8NA 3I3SR 4TL9A 3RF6A 3E15A 2C9ZA 4ENPA 3CHYA 3P96A 1AUPA 3E0XA 4IDBA 3SZ3A 3I42A 4EHNA 2DPGA 2JC3A 2IOHA 1QF9A 4GW3A 3CD6B 2ZI9A 4JC4A 1Y9ZA 4UNSA 1D6MA 4GWLA 5AD1A 1PGOA 2DFLA 1D4OA 3R6TA 4LYFA 5AJHA 4D6XA 2I2WA 3Q3JB 3DXFA 4M1TA 4HWGA 4MUFA 4QXQA 3S2UA 1G63A 3GN1A 1Q95A 4ZK6A 3HRKA 3FHLA 4BFUA 4PN7A 1Z16A 1MO3A 2BRUC 2FWAA 2DWQA 3BWCA 1SOAA 3FCOA 5DSTA 1OGYA 5LQRA 1CHNA 3TSWA 1YO6A 4TUYF 2XF8A 5JO9A 5K1ZA 3C8ZA 2D8AA 1OMOA 4L6CA 2JFNA 2JASA 2R7LA 3DXZA 3RK0A 1Y5LA 1MQ9A 1NVEA 3PDIB 4OHZA 1F0YA 2P7IA 2GFHA 4Z4GA 3WYBA 3VC7A 3JXEA 2CVZA 1IBLB 4ZI7B 1T1GA 4RX1A 2R6CA 4UZUA 4BCCA 1L4UA 5ALWA 4C6RA 3FPCA 3CUEF 4GUDA 3R9IA 4OMCA 2VJIA 3M83A 2HNBA 2IZ5A 5LUBA 4B2LA 3EIEA 1WCYA 1JPJA 1SCAA 3CEAA 3EC2A 3EBPA 3I9NA 5K8IA 4RVCA 2ZRNA 1B0ZA 3UW1A 1W0JA 1AKQA 3HKEA 3QW2A 4P38A 3VKVA 1TUBA 4ZP1A 1X42A 3ZGOA 1TNDA 3EXEB 4P7GA 2VRNA 1SA0B 3NZEA 1ENPA 4ZVLA 1LNQA 3ZTYA 1JH9A 2QM3A 3FCXA 1J22A 1W9XA 1SIOA 2ZULA 5LZ5A 3SDBA 1ZA1A 3TLCA 1THTA 1V71A 2DULA 1U1FA 2VF5X 1TL7C 4ZFNA 1J42A 4JVSB 1KOLA 1DAEA 3KUCA 4FGSA 1W0JD 3ICPA 5KKNB 3W1VA 2BONA 2VK1A 3MVEA 3GA0A 3M3PA 2IH2A 1T2UA 4I4NA 4ME6A 1M6VA 1ZH8A 1QCZA 3ZBTA 5C1IA 3ZHBA 3OCWA 1L7PA 3UPUA 2GGSA 2W2KA 1P31A 1Q21A 2JVKA 3AF1A 2C8KA 1ST2A 1GGKA 2HK6A 2BIFA 2QEQA 3O47A 4TGLA 5A3SA 4UPEA 1EPUA 1PJ7A 4YMUA 2XRYA 4RGBA 1Z5NA 3RRBA 1HYBA 3ANYB 2WP0A 3RABA 4Q39A 4DA4A 5L7TA 4ZI5A 2DY0A 3U09A 5TMBA 1HMPA 3EH2A 3L7YA 4Q02A 4G1FA 5CK5A 3DP7A 1LI5A 2XT9A 1ZUD1 5DXJA 4PNPA 1UPCA 3LQQA 1V1RA 4OFWA 2V7BA 2VNKA 1H6DA 3L6BA 4IO1A 1RKUA 4QX6A 3TBFA 4Q4CA 4L9WA 3SZLA 3U62A 4BATA 1N6NA 5BNIA 2ZIWB 1T29A 4R2MA 5CVEA 1GQSA 3DZKA 1L7MA 4ZAVA 2INGX 5FOWA 3G0GA 5T6BA 4BFLA 3BFKA 2ICAA 5BXYA 4ITVA 3DL4A 1GG9A 3OWOA 3ZWAA 4F5ZA 1U2RA 2O14A 1TUIA 4LOHA 1E7QA 1TEHA 2BKAA 1IZ9A 1VRWA 5T3UA 5AVXA 1S2NA 4GKAA 2C3YA 3ZXUB 4W9NC 2VHJA 5ARBA 1THMA 2LIPA 1NOKA 1BDIA 2MR5A 1F60A 4DTCA 1EE2A 3V8MA 5I9TA 1CWUA 1D6NA 1U04A 4JMPA 1QK3A 1EVEA 1IVYA 3HP1A 4LGMA 3GLFA 5M29A 1FFXA 1H2HA 4QV2A 1WXGA 2QJWA 3CW8X 5C80A 2H9YA 2XMQA 2D5IA 4OY3A 3INNA 3KEOA 5CLGA 2QM8A 1WF6A 1ZD3A 2PO5A 5IN4A 3PHBE 1TJ3A 3AG6A 2EKBA 2VHCA 2PD3A 4GHWA 4RZHA 1SQFA 3GA7A 1INLA 1OB5A 1DELA 1H5NA 1OV4A 2FWPA 3ICVA 1CJSA 2H59A 1XZCA 3IUNA 2GMWA 2CVQA 4L6AA 4LKOA 2FE1A 2QW0X 5CPBA 3O8LA 3ZYZA 5MN6A 3OE1A 2POCA 2Y1WA 4L22A 4D5GA 1XVUA 4EG8A 3GROA 1CVLA 1ZD9A 3O82A 5JFGA 3ZE6A 1N4AA 1RMYA 2NZYA 5E9AA 2GEFA 4UBMA 4F1WA 4INJA 4JSYA 3WZMA 5JDCA 4TS3A 3HJNA 4L5BA 1CY4A 1AS0A 1IHPA 4ZIRA 1KYZA 3DJYA 4CM4B 2CB9A 2XGOA 2PUBA 1ZXXA 2JGIA 4FWIB 5IJ0A 4L8YA 2AX3A 4YWJA 1P9WA 4FB5A 1N33B 4TV8B 2JLQA 2VZ8A 4O8ZA 1NT2A 4N7BA 3U7EB 1T0HB 1U8FO 4Q1FA 3AKCA 1JR3A 2IDJA 2J6BA 2IUTA 1TAGA 1XMSA 4HAZA 3PEEA 4LK3A 3W04A 1LPNA 4B8WA 3CRW1 4KWIA 5LB2A 4X1OA 2OAGA 4HAYA 1YCGA 1WSRA 2WZBA 3IMFA 4M0LA 2YBDA 1DAFA 1MB0A 1VMIA 1XVLA 2RFLA 2AC2A 2C4VA 1XQ9A 3ELYA 3GW8A 4Q4HA 3VR4A 4WESB 5IDQA 5JTTA 2C2KA 1E4EB 1Z0AA 2GBFA 4NQRA 4URXR 2IEDA 1Y6GA 1M54A 1H4QA 3Q7SA 3UA3A 1EK1A 3FSJX 3CIFA 4FFNA 4F4UA 3G5LA 4CEIA 1ZRMA 3TINA 3HAGA 5ALEA 1UJ2A 1E43A 3ZZ1A 4EPRA 1M33A 3UOAB 3B20A 3T5PA 2IPMA 3SLNA 3ETNA 4UHCA 4K2HA 2C4NA 4FHCA 5T4HA 2JHAA 1HT2E 1O8CA 2G5GX 4R2WA 3FVVA 4B2YA 5SY4A 4K81B 2Z4SA 4WACA 4BNIA 4R3WA 2BTEA 1MC8A 5DX1A 5MFPA 1W36D 1M1XB 3DZ8A 4HDSA 2PZMA 3L1IA 4WFJA 3QOXA 5GJWC 5FPYA 1KJYA 4XWYA 1EVLA 1IXKA 3FOZA 1C14A 1KZ1A 3CLVA 3HYSA 1XCJA 2V97A 3KUKA 3ODPA 3RYIB 5EZ6B 4XVUA 3PXBA 1LBQA 4MVJH 2QMQA 2BFMA 1JRLA 2XRFA 4RENA 5A3VA 4EKIA 3IHLA 3B9PA 1E3SA 3ETCA 4RVDA 2ALJA 2VDQB 5ALXA 2FPKA 3QKIA 1G4HA 3RFCA 2PR2A 2ODBA 2Y99A 1UBMS 3RIEA 3T7EA 2C7RA 4BGEA 1J0CA 2I1VB 2VJCA 4MITA 2XMPA 4C0LA 3F97A 2MHCA 2ZQYA 4RXUA 1EX1A 2E2WA 4MINA 4YUAA 4XWKA 3I73A 4GQBA 3R0QA 5JFOA 4FNGA 4XKVA 2CYAA 1QH1B 4C4OA 4DJDC 3ZQ6A 1A9OA 5EE9A 1PTKA 3R77A 3BIFA 4RDIA 3RJZA 3O6VA 3TB6A 4AUMA 4P3KA 2BE9A 2QA4B 1L3IA 1BN6A 2C1ZA 4US1R 5DGIA 2AN1A 4NICA 3WLEA 5JCPA 4QUZA 4J90A 2BMVA 3M5PA 3LVRE 1NC1A 2AIRA 4M8KA 1FUEA 1K7SN 4KOAA 4EX6A 1NDUA 1RKBA 1SIBE 2ZDQA 3RG2A 4C05A 1S3SA 2V7GA 3WKDA 1UBRS 2A6PA 3UK2A 4BV2A 2R47A 3VR2A 4CETA 1QP7A 3RVKA 4CRWB 4BECA 2XUKA 2YVUA 4BO9A 3QOFA 4X8HA 2E21A 1Q83A 4RMJA 5ITZB 4CPDA 3ILYA 1ZBQA 1VBNA 1QCCA 1WMSA 3HXLA 5GZ6A 3DG9A 3MCZA 2D3NA 4IL5A 5FDFA 1KO7A 2BHRA 3I30X 4TQ9A 4UTZA 4YT5A 4HFRA 1VHDA 2BV3A 3B89A 3MGKA 1V9SA 4HX9A 3WGUA 3ZLTA 1A9RA 1EK2A 2GAOA 4EW2A 4KDCA 4RK5A 5BMVF 1UMBB 3H0KA 3O90A 1RAFA 3LBAA 3IQXA 4XUEA 1FMFA 3G6WA 4H60A 3VUEA 4OEHA 1XEWX 1EQAA 4PHHA 4R7ZA 3HXOA 3OZGA 3H9CA 3NVMB 3HR7A 5EXDA 2PTGA 3KRTA 3U4QB 2CVPA 1ZCZA 3I9V1 4EB3A 1VIYA 3GEEA 4GLLA 2MDTA 4FXOA 4H7DA 1U3VA 4PG6A 2O2EA 1YHYA 1KDPA 4NVRA 5BSXA 2CHVA 5D00A 5I7UA 1G5HA 4OUDB 4XFDA 2HADA 3DHEA 3HM9A 4P36A 2FW6A 1RM3A 4BX8A 5E1DA 4K6MA 4TLBA 4MRNA 1GQ2A 3I28A 2OYCA 2C98A 4XONA 2R1VA 2OC9A 2OLKA 1UBKS 1E6CA 2VLIA 3CRNA 4C76A 2ZTUA 4DSTA 3DDOA 2VUIB 2WY2D 1ZIOA 1R0KA 2Q4TA 3EY9A 3KWJA 4G89A 5U4QA 1TO6A 4O4IB 3CX8A 1N5JA 4N49A 4RNCA 4II2A 1NC3A 2O8NA 3BMNB 3NAQA 4JLUA 4S1VA 4KLNA 5TQ0B 4AF8A 1GTG1 3WMRA 1ADCA 1AMUA 5KAMA 1L4BA 5JNSA 2FXVA 1D7AA 4ZQHA 3FZQA 4ZVSA 2QT1A 1WLYA 2VQEB 1OUMA 1HNXB 2JNWA 3AHIA 5CYFA 3U3JA 1V3QE 1JBEA 4FQ7A 3AYXB 3FMPB 2XQVA 3KVYA 4EJSA 1HH4A 4H7FA 1VZ2A 4RCZA 2H6EA 1YVUA 3JQBC 2CSXA 3L41A 3SX2A 4IDAA 5AT1A 4B8YA 4UW9A 1D9XA 1NW5A 3EZGA 2ZQ5A 3IEXA 5ALRA 1YB7A 1R00A 2VQSA 5DNUA 4QA9A 2DSTA 2EQBA 2FSVA 3ABIA 3B52X 4LHWA 4QJ4A 4YAJA 4DDUA 1DIGA 3LDAA 3T0FA 5BMVA 3RYCA 2YWEA 4BMPB 1Y34E 5BT8A 1O9HA 5C46F 2DKNA 3RRNA 5IXJA 1C3XA 4IV0A 5LBUA 4E5PA 2BH2A 4AX8A 4C0SA 1YS4A 2COKA 2FLVA 3KQNA 1PX2A 3GGPA 1TM3E 1LSJA 1CRZA 2FYTA 2QRHA 2Z2YA 4MUHA 1N2CE 4G41A 5CXXA 3OJFA 5TE9A 4QSHA 3UJHA 1W6UA 3N2KB 3GA5A 4K9DA 3V4VB 4EHFA 4PN3A 5JNUA 2F8TA 3U56A 3A3YA 4F8JA 2PD4A 5HR5A 1BN7A 4FU0A 4BRWA 2J0UB 1LFAA 1GAWA 3V4RA 2EHJA 4F4JA 3CV3A 3OZSA 2O2XA 3PKZA 2CF4A 3JZFA 5HCNA 4NAUA 3TFOA 4AY4A 3QFSA 4QHYA 1O96A 1XNQB 4RK0A 4EZEA 3L7CA 1N0IA 1TVCA 2HLHA 2JKZA 3GZNA 4AJNA 1WKVA 2QPTA 2ZUFA 1DRKA 1GSOA 1TKRA 3H86A 1VJSA 2JLAA 1Q5PA 1RJ9B 1RJWA 4ZICA 1NW8A 4I2VA 4CNBA 1ZIPA 3H42B 4LW8A 4YRFA 2DPMA 5A4FS 4CKCB 1ANKA 1P5RA 1ZOOA 2Q29A 3EK2A 4GDMA 4ZYWA 1G6KA 1TGVA 2ZB2A 3QUBA 4MVWA 3O4RA 2GBLA 3DWEX 2GO7A 4C78A 3F9IA 3ZI7A 2FFJA 3O4VA 1J9GA 2HHJA 2P6PA 4YEDA 4RYDA 4LNUB 4B3RB 3BEOA 1Y1SA 3F3KA 4HWTA 4CN9A 1QQBA 1M6WA 2FW7A 4MWCA 5AKXA 5BN4B 4AMBA 1QR6A 1TRKA 3AV0B 3VFDA 2VJYA 9LDTA 2MMCA 5CYPA 3VR0A 4DLVA 5HRCA 3GRFA 5JZOA 4H9GA 1GADO 2KLBA 1ADFA 2D00A 3EXHA 3SIWA 4ND2A 4CIYA 1W2GA 2DYIA 3TNFA 1DV1A 1CIJA 5IFKA 1FLDA 4CV1A 2HMYB 5BSYA 3OA0A 2EP5A 5IXSA 3N0RA 3NYRA 1L1FA 3DD1A 1A9QA 3IURA 4JDUA 1Z4JA 4IPTA 1T0BA 4CF4A 1OAOC 4ACBA 3KKEA 4E21A 2P9BA 5COQA 3HKBA 1J24A 2EVWX 2OHFA 4IIYA 1TVKB 4WZ6A 1R9MA 2EJVA 4HH0A 4A0QA 2Q46A 5HOEA 2BGWA 4JASB 3GVLA 3KQYA 5CDYA 1JKIA 1GTJ1 3E2IA 4GYJA 4TVOA 5JZSA 3K7EA 4P1VA 2IHUA 3QBVA 5JJLA 2TMGA 3PD1A 1TM5E 1SKBA 1VE9A 5EWMA 1SZPA 2ZSKA 2LBPA 4QQ8A 3IIMA 1E69A 2JLBA 1I5EA 2GCOA 2PCLA 2F48A 2XKAA 3ECSA 3QVTA 4R41A 4JZYA 4RKEA 3CLUD 2YS6A 4BKOA 3SQXA 1EE9A 3DHWC 3DZGA 3UMMA 3IC5A 4U2DA 1UPTA 2JFHA 2Q5CA 4FWBA 1OB0A 1R0SA 2HWYA 1D03A 4O4LF 1UMCA 3IUMA 1LSSA 4C20A 4TS1A 3AR7A 5HG0A 3B82A 5D3ZA 5IVDA 4EW6A 5GOTA 1TZKA 3AEKA 1E2BA 1OTXA 1W25A 2GEBA 3NM6B 1ZJJA 1I51A 4E70A 1SVLA 1XK6A 2JH3A 1BXGB 3SQOA 2ZIXB 2KHZA 2PVCA 2QL7A 3M49A 4DXHA 1FFBA 3L7NA 2O8DB 4D4IA 4GECA 3ORHA 1AG9A 4IX9A 4JKIA 2YCBA 3P0EA 5BVHB 5HM6A 3ZY2A 3P9IA 5G40A 3RC2A 3EEFA 4PPFA 4XRRA 2PKWA 2Y1FA 4XLLA 5KINB 1C1XA 5ALUA 5ESWA 5BQFA 2FZ4A 5DT9A 3PU6A 1GTSA 2OFPA 2BMEA 1YZVA 2ZIVB 4NJEA 4QGSA 2NVUB 2WVJA 4MEAA 3P9YA 5JT1A 3ETEA 3RF7A 4L2IA 5HDBB 3WKAA 4G8DA 3A1UA 3KJFA 1DBSA 3HP4A 2QUAA 1YE3A 2IE0A 3OX3A 2RKOA 3B78A 1WB6A 3WQHA 4P26A 4EA9A 3PQ3A 4K9PA 3DDNA 1JMVA 1XQYA 2QM0A 3PGMA 1CQIB 2CE2X 2X86A 5E3IA 4E15A 2EP7A 5F4ZA 1IMOA 1D3AA 2JHGA 2RIRA 3AESA 2VZ9A 1SRRA 1Q16A 4QEKA 4TTQA 3QV2A 4JJIA 3N6RA 4KPUB 5TLSA 3EPRA 1R6TA 2YS7A 4TT8A 4XW2A 4BMZA 3GJSA 1NASA 2FRDA 3RIHA 5MHTA 4E3ZA 3A36A 3RSGA 4BWFB 5FA6A 2VDOB 2P4UA 3WSTA 2AI1A 2WOOA 4CL2A 3W8EA 1AA6A 2ASEA 3DDUA 5EHIA 3USES 2GFQA 3K92A 2DPXA 2R3SA 2JGDA 4O4LA 2FFQA 2WJHA 4JVLA 3OLQA 4K6GA 3BJZA 2IYQA 1ZR4A 1R0CA 4RTJA 5DU2A 1KQ3A 3WRWA 3ENVA 3NVDA 4QJIA 5EERA 3RYFB 1YL7A 3TLXA 1OXUA 5CAEA 2IH5A 3KD3A 3CZQA 3DFMA 3GJQA 5K05A 1HE2A 1AURA 2IYTA 5IBQA 3OOJA 2LXNA 2QQEA 1W4BA 2BCEA 4HVTA 4HH1A 2B4QA 4DIBA 3CBGA 1V2GA 4HAXA 1GG5A 1FU7A 1NY5A 4IOLA 2BGJA 4LY0A 3C8HA 4UHEA 2OB2A 1QG6A 4DMCA 2QD2A 4OLFA 5P21A 1SUAA 4MQMA 4AFNA 5JATA 1P9NA 3D02A 3LNNA 3ROFA 1A8PA 4D1YA 4OL9A 5JWHA 5I8WA 2V7UA 2VBCA 1YQQA 4YV7A 1U3TA 4CQLA 3UHFA 1L6IA 1F2DA 1OGJA 1R9NA 3QU4A 3H1EA 4M9UA 1WXEA 3DXYA 2AX4A 3JVUA 2Q2OA 5TRDA 1AKMA 2P3MA 3ESXA 2WG1A 4M1WA 4A5OA 4BNZA 1OPXA 5FWYA 3ASZA 3D6AA 1EBBA 5MGBA 2PL9A 4EYGA 3WQZA 1J8YF 4PZDA 5LU8A 1QHHB 2FKNA 4M1OA 1OZ0A 3GVPA 4DMHA 3CRZA 3SFZA 4BC0A 4OIMA 2N1BA 2OORA 3H5IA 3B6MA 2IY8A 3DBRA 3IXLA 4GEKA 1XV5A 4HNQA 1UIRA 4XM3A 1JHVA 4IZ6A 1F8UA 3EGXA 4HEA6 3I23A 4GKJB 1Q0PA 2ZSUA 1GT91 3HYRA 1O5OA 3Q7QA 4H77A 2VJAA 1N2XA 1OU0A 4FEYA 5A8AA 1ZN2A 3A8JA 1QIHA 1TB4A 2DSNA 2XA9A 5DNDA 3HO6A 3UHPA 3FVRA 1GPDG 1V5EA 4Q0MA 3UXEA 3I8SA 4KO8A 3WWCA 5L4NA 1G17A 2J5KA 4XN3A 1E0DA 3ICWA 2APJA 5JC8A 3K5WA 3LC2O 3A6FA 3RS9A 2O3QA 3WWZA 3AUYA 3C3JA 4LRSB 3ZDXB 3AIMA 3FYDA 5KW9A 4ZAYA 3K16A 2A86A 2OCYC 3BEDA 3GP5A 3K0KA 2NVOA 5IAKA 1A5TA 1E1CB 1EEHA 4RFSA 4ZD6A 4L15A 4AZ0B 1ZN7A 2WT9A 3TUIC 4Z9FA 4CKYA 3U60B 1YJNB 4X7RA 1TQHA 3X1XA 4TKOB 4ECAA 4UBJA 4REOA 4DC1A 2FUKA 5THXA 3QBDA 2IHZA 3T56B 4IDHA 5JVDA 4MYUA 4KE7A 4Q9IA 3C70A 4LXHA 1Z07A 2A0WA 2G25A 3O2JA 4PQGA 3SZOA 1JG3A 4B73A 4K8RB 4M0KA 1GNQA 1R0ZA 4U9UA 4M53A 1MX9A 1QV7A 2XUDA 2Y92A 5I9BA 3V42A 1NL3A 1B93A 2ZUDA 4GSLA 2WIBA 5KSPA 3WYNA 4DZZA 3AKEA 1EM8A 1I5RA 1QLJA 2QN1A 3BXZA 1EEXB 1U8ZA 1QJ4A 2J59A 1THZA 3KBBA 1I10A 2A84A 4GWKA 4RPIA 5C34B 3JD3A 2OENG 3ADDA 3IHWA 3QELB 5EAIA 4Z0TA 2IF0A 3CU5A 2B7BA 3FSRA 3AR2A 4GKKB 5K0EA 3OMWA 3SZGA 5F4BA 4HLDA 1MPXA 2RI1A 4MULA 5KU1A 2VHQA 1TJ4A 2JHPA 4FD2A 5IFLA 3I55B 1ACLA 3TLMA 3BTSA 5DT2A 2ODTX 2EW1A 2L42A 1EJ0A 1N32B 4LZLA 1E6EA 3FHCB 1OE0A 2O54A 2XKJE 2L17A 1KZ6A 1TYBE 2HRBA 2JA1A 2ORYA 2D0PB 5CVUA 2QR5A 4HB3A 2COEA 5TPZA 1ZU5A 1NBOA 3O83A 3OD5A 4PZYA 2HF8A 5JNWA 3PX3A 4H6VA 1YK0A 2QN7A 5HIAA 3I0ZA 5AJUA 3ED1A 4WZTA 4DV1B 1PR6A 4JH0A 1RWXA 5EWLB 5G0TA 1UD2A 1W94A 1ZUNA 4PTZA 1GSHA 1GPYA 2UZIR 3EEYA 2F90A 2HHAA 3FMFA 3LUCA 5EI5A 4BMVA 4HFMA 2OO5A 1RAIA 4WLNA 4AJ1A 5TPZD 1M34E 2QRZA 2GASA 2JD0A 3DCIA 4ISBA 5HZHA 2GK3A 3D5QA 3G5TA 4DM3A 4LX0A 4EBFA 4WY8A 4KRFA 3IPYA 4NATA 3E58A 2EFYA 4AYXA 3SR0A 2GXAA 4H7KA 3QVXA 1L7EA 4O2BA 4R8KA 4U1RA 1Z2EA 1ZVMA 4K1LA 1LDBA 2GESA 1CDOA 2Z5LA 3ASYA 3NM5A 1JR4A 4RDHA 5FP0A 4R81A 3D1LA 3K94A 3ZJTA 2ORED 4MUKA 4W9MC 3N05A 4Z4CA 621PA 2RKBA 4RAOA 2Q21A 4OF4A 3LECA 3SEFA 3EAGA 5C3MA 1NRWA 1T5TA 3SEJA 2FR1A 1NJGA 1DIHA 2BCGY 1JHZA 3FOFC 2PLNA 3MJCA 3QY0A 4M38A 2FV8A 3HDYA 5C52B 4S0XA 2ZSJA 5KAPA 4RFLA 1FRQA 2HF7A 4NAVA 1O5IA 3UTCA 3P27A 2I7VA 3FNRA 4YC7A 5ISMA 3AZOA 4BZWA 3PXGA 2HQBA 4N4AA 5FTNA 3V1KA 2XCLA 1C0IA 1Q2UA 2Y1LA 1NAIA 3KR2A 3W5IA 1ZH6A 5IKOA 2PEYA 4FJ2A 3GLIA 4GICA 3GLTA 4B31A 3IMCA 2O3JA 2X14A 3OECA 4MS4A 4HNUA 1PJ3A 3CPJB 3KQHA 3FPEA 2H7VA 2GAIA 4JS0A 1MO6A 3GGGA 4N0PA 3KKZA 1Q1NA 3RFXA 3TR6A 4MAMA 2OB1A 3NPMA 1V41E 2ZI7A 4G8BA 2M6SA 4E2WA 3G5AA 4J9VA 4OREX 3LM8A 4MEBA 2HCJB 2XPCA 4TRNA 1AM4D 2CL7X 3EN0A 1IBCA 4BB6A 1RNLA 4BU1A 5CT6A 2NU8B 1ZHOA 5EIEA 3UGQA 3CZRA 2OV2A 4JYPA 3U37A 4WXPA 1ECLA 3LF1A 2CW5A 2XUJA 1Z25A 4YA6A 4DDHA 1KC1A 1XB2A 1ORIA 3BMOB 5F7XA 3OHPA 1XAIA 3DTYA 1ESEA 4RLSA 3VZCA 4M1EA 3SIRA 1I7SB 3SHVA 1UKAA 1XHFA 2OBFA 3PI6A 4X1YA 3JV7A 3SHTA 3BK2A 1Z7BA 1KJWA 1VPTA 3HWWA 3PEVA 3Q0IA 2G08A 2VXCA 5KYXB 1J06A 3FTEA 1O8BA 3LO5A 1JMYA 5C81A 2HWKA 3LVQE 1FTYA 2XXJA 3HA2A 5JARA 3ZPNA 1CZNA 4D3YA 1RZUA 1VLHA 2NU7B 4YMSA 2VPTA 4UTPA 3DVAB 3K9LA 1EFCA 3R7SA 1HDIA 2VAVA 4TV9B 3MTEA 1W9HA 2C04A 3T15A 2AD1A 3JAWA 4L5JA 3L8ZA 2REOA 1T9BA 2IOFA 5FORA 1QIFA 4JC0A 5F98A 2GARA 2HMVA 2XYRA 4KE9A 4CG3A 1Q19A 3MYYA 3H9EO 5D5PA 2LTAA 5AKJA 4WBNF 1XTUA 2ORVA 3E27A 3IUYA 2J87A 2JFWA 1U8CB 3CPXA 3TQCA 4MMYB 3GOQA 4Y2UA 1X77A 4RVNA 3SKVA 1G2PA 1CW2B 1FVFA 4X54A 4A0GA 4DG8A 4B46A 2HXGA 1PJ6A 1CJTC 1QG2A 3WIBA 3E7PA 5BV2P 2I4NA 3A11A 3DC2A 4J6FA 2P5UA 3GGCA 3UQZA 2VDWA 3F46A 2ZRPA 4X85A 1UPUA 1LFDB 3F49S 2I99A 2OCLA 4QYMA 1V0FA 2FZVA 4NFSA 2O19A 1G7TA 2FPUA 2YJ6A 4XA8A 3DA8A 1CRPA 4UFNA 5I7EA 1VSVA 1XYVA 5K8LA 2XB6A 1P2VA 3GNLA 4KGZA 1Z68A 2C29D 2AJTA 5ELXA 2CHUA 3PL5A 2AZTA 2R87A 3LLVA 1UKZA 3H19A 4Z8XA 3SJCA 4UTNA 4FFWA 3PR3A 2VZLA 1NU8A 3BJRA 3HVKA 3SICE 3TLEA 1G38A 5HMMA 4QBHA 5DASA 1SU7A 1LDMA 3GHYA 4Q1DA 1TXGA 2WWWA 4B7CA 4B6GA 1FJHA 5C0OE 2FPXA 2GCEA 3ZKWA 5K8UA 1A3CA 3N8GA 4BNDA 2I6FA 3UWKA 3L8CA 1P3JA 5GADl 1E5XA 5GVSA 3CVUA 1HOTA 5U1PA 4KH1A 3HDGA 2DP4E 2HJ9A 1KPIA 5L45A 1XK7A 3FE2A 1CUSA 5KTSA 3QU7A 3OQPA 3I05A 4M22A 2B36A 1WO8A 1QOZA 1KI3A 3CZ4A 2O2GA 1YOBA 1EFPA 1O0CA 1WOMA 3N0WA 4J03A 821PA 1Y98A 2O8BB 1RW4A 1JHYA 3C3PA 4WBNA 2VNJA 3IAFA 3K9GA 1ZBDA 2FWRA 1BXRB 1NQOA 1KFJB 1EE1A 1KOFA 2PH3A 3HSYA 2RD2A 4TYYA 1DEAA 5SICE 3DKRA 4QREA 4I19A 5CM2Z 3IP8A 2I66A 4BX2A 5BWCA 3IUBA 1PNRA 1XU9A 1VE5A 1UFRA 4GMXA 4EL5A 1KFCB 3F7NA 5E7IA 2BF4A 2H16A 2G83A 4F7WA 2IHVA 4LPSA 3LP6A 1OFTA 1RWWA 1E20A 2G1AA 1GYPA 4BC1A 5JIBA 3CESA 2IYRA 4DJFC 1J2YA 5IU6A 3FTFA 2GBPA 4LZPA 2XRMA 3B7PA 4NMXB 3KEQA 1DKQA 4G0UA 2OGWA 2IGTA 1R5BA 5AVYA 2Z6UA 1TKBA 2HL6A 4GO1A 4M36A 2Q62A 2B5OA 1NXVA 3NUZA 3LA8A 4NH0A 3STVA 3KXPA 2B94A 4JBXA 3EDRA 1W35A 2BELA 5I01A 2ZUUA 3JARB 1DJLA 1UKBA 1Z4NA 2C83A 2RGEA 1KO4A 4JIGA 3SSAA 3TLAA 1V16A 4JXKA 3EPLA 4QUJA 4XWGA 2EFDB 3OQOA 3UANA 2R5NA 1FSSA 5ITVA 2AWNA 1R74A 3AEQB 4A8JA 3BBPA 2QTZA 4X20B 1MEEA 1QKJA 3K20A 3ZZUA 3C0KA 4LRYA 3BJIC 3IAXA 4P4SA 5C31A 3SXJA 3N3BC 4AYWA 3MWGA 4C04A 5J40A 1OREA 3W5DA 3LZDA 4IQ4A 4NX2A 1YZUA 4NYMQ 4AXXA 4OD0A 3HA5A 1P3DA 5CDFA 2R6JA 3ODGA 1X7XA 3LC0A 5EUBA 5FPSA 2OXTA 2C95A 3TIVA 4AZSA 1JKXA 4MW9A 2ZR0A 3RRZA 5C51B 1LLDA 5DBIA 3VTFA 4ONEA 1LZLA 3L2OB 2XXAA 4Q5IA 4NDAA 1IBKB 4DMMA 2IPLA 3MTGA 3Q72A 4HEQA 1GGVA 3M6UA 5LLSA 5EUMA 1FSPA 3R23A 4TSRA 2AZMA 2X58A 4YJGA 3UK6A 2QGFA 2Y77A 2ZT6A 3G6KA 4YMGA 1E2UA 1QYXA 3DFZA 5J4LA 2XTJA 2BFFA 1TW3A 1Z3IX 2NZ2A 3T1NA 1WUIS 2BEWA 5EE1A 1JEQA 4KXLA 4LBVA 2FLWA 3INRA 1QLWA 3THWA 5T4EA 3S28A 4CLEA 4DLPA 1FYXA 5ECDA 2LNDA 1PVOA 5IM4F 2I9PA 3U9SA 1Y8QB 1U8XX 2V7PA 3N6VA 1AOXA 4B3IA 4HYQA 1NP7A 1H0KA 5EJIA 4INAA 4HK4A 5LFAA 5DNYB 1RE0A 1U1CA 4UEQA 5F3DA 3WDKA 5BSRA 2QTMA 1X94A 2NO4A 4RY0A 4DNXA 3KHTA 1NQWA 4C21A 1X8XA 5B2FA 1Z83A 2BAGA 3FCCA 3KTDA 5PGMA 1HTWA 2O3UA 2WAOA 2ZDGA 1XXHE 2OZPA 4MA4A 1ZZEA 4MJXA 3ADBA 4OBXA 2V6MA 3OAAA 2I65A 2WIFA 4MKZA 1KI6B 3LCVB 4IH9A 1TIPA 3C3BA 2DECA 4HZUA 1I14A 2WKPA 2H5LA 3CQ9A 3NXSA 4QASA 5LBIA 3ZHZA 5JEDA 1JYEA 5AKHA 1AB6A 1NN1A 3FMIA 5A7GA 3L40A 4Q1AA 1FDSA 4NWIA 1WXXA 1XI2A 4UJ5A 4K9SA 1TIKA 2NYVA 2JFZA 5EHNA 4M8IA 3HDTA 3PGA1 4CG0A 1RYZA 2YR0A 3DJFA 3JWEA 1L5HA 3P1JA 3FWKA 3SOPA 5BV1A 3CCVB 2C2GA 3RHZA 3TJRA 5AI9A 1BIFA 1BVUA 1U99A 3I9MA 4IIBA 2VWPA 2Q9BA 3R7FA 5C8XA 3U61B 2VBFA 1ZD1A 3NGLA 1JJ2B 3QNUA 4FMCF 3ABSB 1MKYA 4XLZA 3V8QA 4BRZA 4F2GA 1L5YA 4G2TA 2P8SA 1M0TA 5KYUA 4D3DA 5D86A 1LCIA 3OUUA 5FPTA 1QTRA 3BAZA 5D85A 3KAJA 1FTGA 2BTQA 4MVCA 1Z28A 2XJ4A 4IIHA 4EARA 2ORWA 1PNOA 2N1MA 3BGWA 3RRJA 2J67A 1CE8A 5J4HA 4BP9A 3EFOA 2Z2JA 1R3UA 3VOSA 4UU0A 4G4GA 2K5UA 2V6BA 4XOTA 1WHTA 3E7XA 3AJ9A 5JBQA 3PZRA 4RMIA 5IM4A 1BTOA 4MYSA 5TJHA 3THYA 3COJA 1WSVA 1E92A 4GH5A 4ID9A 1QHIA 4H7HA 4XUDA 1IN4A 4M6WB 5CTJA 1P4MA 5IF3A 2GBIA 3P0JA 1FTWA 3EDMA 1TO2E 5K5EA 3GIRA 3LY5A 2QVXX 2YFQA 4IUYA 3G8BA 1ZGBA 4OOXA 1SG0A 3ZQUA 1GZVA 1S2OA 1KEWA 1SUBA 1W7AA 3KB6A 1XPUA 4DE5A 2KMLA 4UCXA 2R6AA 3VJRA 4YAUA 4GX0A 3DZDA 4IVQA 3RFTA 3UHJA 1X1BA 2PSSA 3I2FA 4TKLA 4ZV4A 1E77A 2FMXA 2L69A 4KQ9A 2Z3ZA 3NT2A 3JQCA 4W5WA 1B8PA 2B0JA 2OFXA 5IARA 4YQFA 3EMDA 1Z7GA 1P6UA 5EJMA 5KYKA 2FJPA 3KFLA 1TC2A 3REGA 4KVZA 3BFPA 1YQWA 2VUTA 4B6PA 3HBAA 4CTJA 1KYVA 4XUGB 1C4OA 1J5XA 5ILOA 4WOCA 1RWMA 3SC6A 1EVKA 1ZD5A 3R09A 5EXPA 2WIJA 3T94A 2WF5A 4TVSA 4KHZA 4L02A 3W5BA 5J3JA 3N70A 3SBOA 1ZUIA 3QVJA 1TUBB 2WHYA 4TMFA 3Q1KA 2YHBA 2E4VA 2UUOA 4HGPA 1Z5WA 2OBLA 3Q7TA 3TZLA 5ADVA 4MQFA 3V4PB 1OH8A 3OP1A 4W82A 4MJLA 2N0SA 1YDHA 1C7QA 1VQ7B 4G5YA 4XVHA 1JA0A 5DO9A 1C3LA 5K0NA 3TF5A 4M88A 1EDEA 1F3LA 1HE8B 3M4JA 1RPNA 1TIBA 4P08A 1NB9A 1T5BA 1B8UA 2OK7A 2QV0A 2VXYA 3TAUA 3WICA 2I2XB 3AWIA 3BJEA 3DVQX 1DAOA 2FMKA 1Z5GA 5ERGB 2Y1GA 2Q7OE 2YY5A 2W2KB 3F8SA 3VKGA 3U48A 3A2NA 4GD3Q 4BKRA 4AJHA 1E9FA 3D2AA 4J1TA 2GREA 3AXSA 3VA7A 2D0OB 2QI9F 2V0CA 5MN4A 4WMLA 3TTTA 1K75A 3RRFA 3A10A 4Y1FA 2X0DA 1E63A 4CF3A 3MQFA 5DYWA 5E4YA 2XOXA 3NG1A 1P1FA 5JE8A 4M1QA 1V1RB 1OJ7A 2J9GA 2O2DA 2VSFA 3AJRA 1YR9A 2KYRA 3IEUA 1TZCA 3AZPA 2Q9AA 2WPDA 3AKYA 1EUDB 3MLEA 3D6JA 4MVJA 3AVYA 2EC5A 4OOSA 2IZ7A 4YO7A 1N5IA 2MJLA 5BSFA 1C9DB 3L7KA 4XE5A 4D9KA 1Q0TA 3A8IA 1USWA 1CNFA 5GM2A 1E2PA 3KJZA 1TT5A 3W2FA 2PU7A 1MOZA 4FFBA 3HO1A 4G1EB 1PR9A 1FTSA 3CNHA 3FF4A 3TMAA 4D9MA 1QFYA 3H2ZA 3EVGA 1L5ZA 4LRUA 4L3VA 4WNYA 4IGKA 4L72A 1XKQA 1RU3A 1KIAA 1U5BA 4E1VA 1XMOB 4KN8A 4MVJD 3OQBA 1XZGA 4W5NA 3NWBA 4HDKA 3M3DA 4FHFA 2KX7A 3V6MA 2BGNA 5DWDA 3OUTA 2EP8A 4UATA 1S4MA 4J0FA 1GVNB 2H57A 2ZPTX 5ARCA 3GLFB 4O5OA 2QTBA 1Y42X 1QIMA 1DFHA 2AN9A 4UTVA 1HKUA 2WC1A 4Z4VA 1R9JA 4JLKA 4MVJP 1W5BA 1ORTA 4LYGA 5GGXA 1C4XA 2HA7A 4PAGA 2MSEB 5JRZA 3KOUA 2WAMA 2Z2IA 2FX5A 1U63A 1QHYA 3QFRA 2V3VA 3JVVA 4OI1A 2SKCA 3DH0A 3M6LA 4LZAA 1JJIA 2KB0A 3B1JA 3PR1A 3TOSA 3K70C 2D3WA 2C97A 3T35A 3TL3A 2P6MA 4DG5A 4C0KA 2Z56A 1NLUA 3M2PA 2B34A 4CHTA 5GTDA 1JVNA 4XUCA 4L7QA 3I2GA 3HNPA 2W8ZA 4S1TA 1FVXA 3HJGA 1SKUA 5CA1B 2PQMA 4JP2A 3G0CA 4X9XA 2PKQO 3DE3X 2QXYA 3OLYA 4JUAA 2W9XA 1I4WA 2CXUA 2UVPB 1XCMA 3DEZA 2FPPA 2M2IA 1AHNA 4NSNA 4UE3S 3WSWA 4ARUA 1XF1A 4GLBA 3H75A 4OHWA 4RVHA 4DZTA 4BIIA 4GE3A 4HV4A 3UQYS 4DQVA 4B3BA 4OJMX 5IJ0B 2HT1A 3WTCA 2IYYA 1I3LA 1OZGA 3HCCA 1GGNA 4JHXA 2GAJA 2FVGA 2RGNA 3REQA 4OX9B 4QGFA 3QXCA 3CMEB 1X0VA 3MD0A 4ENWA 4D9GA 5LXTF 2C96A 1CUFA 1OROA 4RKYA 5LQCA 1YA6A 3IQHX 5ERXA 3CLSC 2ZJ3A 1Y9AA 4Q4HB 3P9PA 3TE6A 1U2SA 4BN4A 3V1YA 1EAYA 7REQB 2H07A 3KYIB 4N76A 4Q9JA 1G4UR 4EPWA 3EXG1 1ECFA 3D3KA 3OBIA 2I3ZA 2P0AA 2WHPB 5ESRA 1W36B 5K3DA 1ZJZA 2HI0A 2WU3A 2D4AA 4L0MA 4CEIB 3FLEA 3KSBC 1B3RA 4RCVA 1YRLA 5GOZA 2HCTA 5JSHA 1T0JB 3WLIA 1Y4UA 3MHTA 2ZZMA 1L5LA 3U5ZB 3NHYA 2MINA 3BD8A 3TW4A 3P8ZA 3V3TA 3KELA 4F84A 3AF3A 3HO8A 2UUAB 1PHPA 1MIOA 3MSXA 2OXRA 3IALA 2YMMA 3KX2A 4IMPA 5FUVA 1J2JA 4I5DA 1RMTA 5ALJA 3SDZA 2J5RA 1JHUA 2OD2A 3Q8LA 3UWSA 1YC5A 1NBEA 5IYRA 3DQPA 4CMBA 1K8XB 1ISFA 4ZT5A 2H2IA 2P91A 5DBEX 2G5CA 5HUQA 2VYQA 3ESAA 4N5IX 4L9RA 1RBYA 5ED0A 1E1KA 3BQJA 4DIKA 1L1QA 1WR8A 3BE8A 1GRRA 3FI9A 1KWGA 5CCBA 2QL6A 1DBIA 1M5TA 1TAQA 3MUNA 4CL0A 4R16A 1QUFA 2PL5A 1URPA 3VZRA 5THKA 2WNSA 1G16A 2VDVE 5FFNA 4QOGA 4BUCA 4LE2A 3PFKA 4RF5A 1OXVA 3R75A 3DQQA 4Y2YA 4J0HA 1N1DA 1GT6A 3TZCA 4X45A 1JIVA 4OSPA 3KSUA 3OWXA 4J29A 3GCGA 4RLHA 5CNMA 3FH0A 4CT5A 5CH3A 1ZGAA 2XYPA 5BN1A 5DYIA 5CDGA 2PLAA 1H3NA 1G5QA 3N8NA 1X80B 4U6SA 4ZVQA 5ES4B 5IJWA 3KFXA 5CIYA 1GDDA 1LPSA 1GZ4A 1H6AA 1Q74A 4FOTA 2ISQA 3SJBA 2XYVA 3NIWA 2PZGA 5D2CA 4CFZA 5KYGA 2GVZC 2A0YA 3K8YA 2CB0A 4MMXB 2Z9DA 4C3VA 1XQBA 4M21A 5B37A 4OFBA 3GYBA 3N8DA 3TSAA 2QYSA 5DTMA 1JEAA 5HS6A 1UK8A 1YZQA 4NBRA 3AUJB 2KS6A 2XB8A 3AJAA 4ZVPA 3V8NA 3IUPA 4BVFA 4B3JA 1W19A 1RYMA 4HN9A 3IPXA 1KHHA 2CXRA 4ZYLA 3EMBA 4QATA 4DLZA 2BW0A 2PS3A 1B1CA 5DM1A 2QDXA 5A04A 4DJJA 3MINA 2IZOA 4EQ6A 3EWNA 2RHOA 3Q4GA 1RPJA 2WJIA 3NLLA 4KAJA 1L8OA 4NU0A 5LU9A 2F17A 3OHMA 3T06B 4EB6A 3JTEA 3ZXIA 5EMKA 4YRJA 1N1GA 5A03A 3MTAA 2V5VA 5DM70 1YBHA 3DR5A 3EH1A 1YJQA 3VJLA 1RHUA 2ZUVA 1O58A 1PDOA 1VLLA 3L5OA 4QDJA 1ATIA 3NTOA 2ZUTA 3EIUA 2IUEA 3CF4A 3VSDA 2JCGA 5T57A 1ZLYA 4TMVA 2F3UA 1UOEA 3DB2A 3PUIA 1RVV1 2WFAA 2GSDA 3FFTA 4KACA 4PSCA 2O2SA 1CG6A 3IQWA 5E95A 3V2IA 2R1VB 2IBSA 1O6ZA 2OG2A 3RVNA 4ZARA 3DBHB 3UWOA 4RTRA 4R1LA 1OLSA 1TRHA 3TW6A 2QX7A 1F2VA 4LDNA 5C8YF 3NIFB 5LCXA 5H3HA 4LJKA 3OPVA 4CKXA 3CLTC 4M1KA 2C84A 3K9NA 4DA9A 3ELBA 1YVEI 5D3QA 3HZRA 5KNCH 3KE9A 1YS6A 1J90A 2J30A 2WD8A 2G72A 5EN4A 1T3GA 5JCXA 5KYTA 3IA7A 1VB5A 1RPTA 1R0YA 2JGJA 2PKEA 2Q1YA 4RSRA 3WYDA 2Q4RA 5JMWA 4NCAA 4AZ3A 4B45A 2I87A 3KAKA 5AO9A 4FILA 2W70A 4QXRA 1AMNA 3RT7A 1GZSA 1PJ4A 4M7RA 2OV3A 2IYLD 5IDWA 4EJ0A 4MEJA 2GNPA 5TQ2A 1M2VA 1P7ZA 4X8IA 2GFIA 3M5CA 5F5NA 2WM3A 5D5HA 4BQSA 4RSHA 5BUZA 5KYYA 1Y6QA 4CDRA 3L6CA 4O2AB 3GQVA 5EZYB 2B8NA 3QJ5A 1UD8A 2CLCX 2QMHA 3D6HA 3G0OA 5TXGA 5AVZA 3T8YA 3BCUA 5LDDC 1OVMA 2BBTA 3HUFA 1E9DA 2Q27A 3M6WA 1UAAA 1HF3A 1ZWKA 1F17A 2PKCA 4MI1A 3ISJA 1W36C 1CNMA 1UOQA 5FOQA 4H31A 3QHAA 3EHEA 2QQFA 4QBIA 4MW4A 3NIDB 4FX5A 5GV7A 2UU9B 4DSUA 2X4GA 2HD4A 5H80A 4HDAA 1GCAA 2GVDC 5CGQB 4R9UC 3CCUB 4AURA 3NTUA 1ZGZA 1CQXA 5CJPA 3VH4A 4NMWA 4KSBA 4XDYA 3JQ6A 2C7GA 1N2JA 5A9TA 1GGFA 1VHJA 2XIQA 1HBJA 2P4EA 2VRWA 1KDYA 4E46A 3UUEA 1JQKA 2X5OA 5JSYA 5A9SA 4J3NA 5KJ1A 2Y0DA 2GPJA 1O96B 2A9FA 2AK2A 1M1YB 5C8YA 3RE1A 2ACVA 3FJYA 4FI3C 4QC2A 2G9NA 3NHLA 2DHCA 1L4YA 3GZNB 4DLTA 2XKKA 4G0WA 4HRAA 3AUKA 3DM9B 4P4NA 3AZQA 3J81A 2B21A 3HVUA 4V0ME 5C32A 1YTUA 3Q8MA 4L16A 3E5NA 4BFSA 3B9QA 3SJ7A 1R64A 2DPLA 4A15A 3GJ0A 4GX1A 4HQ6A 1AKNA 1FQWA 5EIWA 2ZJ4A 5DM60 3ENZA 3F5DA 3LUPA 1NA5A 4FOOA 4FFVA 1PZFA 4YS6A 2JFFA 4X05A 1U7UA 2DBVO 1RCFA 2R7NA 3ENKA 4MCJA 2AS0A 2R62A 1A7KA 1G21A 2VQFB 4X6YA 4HAVA 5A7HA 1A7UA 5HQJA 2MIIA 4R68A 3CIOA 1Z7YA 4LF7B 3NWEA 2EL7A 4IH1A 4M7WA 4BY9E 1CUDA 5CW2A 5BQOA 3HADA 4PWZA 4GZLA 4HNGA 1K27A 3EXHB 1ULTA 1UFKA 1P8JA 4YRGA 4EO9A 1UFQA 1TE2A 3DMRA 1YBVA 2BM8A 3PS9A 5AKYA 1WKBA 3I5AA 3KQPA 1P75A 1TLFA 1SKYE 1Z06A 2B8EA 3PUYA 3VU3A 3ZI4A 4BLSA 4M1YA 4LOIA 4V0RA 2ZTMA 1GQRA 1UMDA 5CHYA 3MWJA 2DVMA 4JUFA 4MQ5A 4UC0A 2BWJA 1UZNA 3M70A 3L7BA 2FFBA 5FPKA 4U0JA 4UUNA 3UC9A 2TECE 1THGA 1VG0B 2EX0A 4CMEA 4K0KB 1E5DA 3D4LA 2R8XA 2JK0A 3NHMA 3QLEA 4I36A 2GA9A 4J49A 2D3LA 5EP2A 5BV8A 3HKDB 3ZIAA 4F8EA 3LQ6A 4B3XA 3FNQA 3MBIA 2B2NA 5KJFA 2ZYUX 1EQUA 1HE1C 3EUAA 4WAUA 5EWMB 4DIFA 4ERNA 5KSWB 1M1NB 2F3QA 3G2QA 2PD6A 1LRJA 3ENWA 3L0SA 5DHTA 5GONB 1I4OA 4G25A 4Z4IA 4IUBS 3BVPA 1ZK1A 3UXMA 1WUTA 1Y33E 1YRQA 4HVAA 2B35A 4OU4A 1WU8A 3K15A 3GG9A 2WZQA 3ZIAD 3OZFA 3WFZA 1UMCB 1BCSA 5IM5A 2EFCB 3DMDA 4X06A 1GGJA 2W90A 4WW0A 3TLJA 3BFJA 3NM4A 4N9QA 1N78A 1BKYA 1GL3A 2HRCA 3RREA 2NO5A 2ATXA 3AEKB 4JLNA 3A31A 4RHXA 3H9UA 3O1IC 4OSEA 1XJQA 1HRDA 1ZOLA 4WFKA 1KO5A 1DPFA 2RHWA 5FX2A 2WFMA 5LWQA 1X1TA 2PSDA 3NV9A 4AF6A 1C7FA 4Y2XA 2W2PA 3CSUA 3BL8A 5IMSA 2VAMA 3S8EA 3U4DA 2QNBA 5A06A 1KAHA 4R8VA 3CMMA 3R0VA 3NDRA 1JXAA 3H3JA 3NX4A 4MWZA 3QH4A 4RY9A 1M75A 3JQFC 4NJEB 4QUGA 2F3RA 3WGTA 3QMWA 1TO1E 2P27A 3P2OA 3RKUA 3BH4A 5JJBA 1M1UA 3K6SA 4MPRA 4RHFA 2XDQA 3JQAA 1MLDA 1MA3A 2XQFA 4DXDA 1D2AA 4OPSA 1G20E 5CX1B 1EGAA 5BXQC 5JNVA 4BQIA 3AOEA 1ZIYA 1ZICA 4HN4B 4LOLA 2GA8A 2VTKA 3F5FA 3KBOA 2VP9A 3A28A 4YV2A 4DGQA 3L93A 3Q0EA 5LZ4A 3K6JA 1NF2A 1UD4A 4Z4SA 2WE7A 3JQAD 3OU7A 3RSZA 1NJSA 4EEXA 4FYMA 4JI6B 4C43A 3D54D 3L5KA 4R9NA 1QMPA 2BL4A 4PY2A 2CDRA 3CG4A 5K20A 3DKIA 3SXUB 2JGDB 3KZKA 3GGSA 2UZAA 2QENA 2Z3WA 2BMJA 5TPWA 1VFPA 2D1QA 3F96A 4HFNA 3C7AA 5M34A 2B4YA 2H65A 1KY4A 4F04A 4NOMA 2VF7A 5IHPA 1CK4A 1RLOA 1Z0FA 3DO8A 4HY3A 3VBEA 4CM5A 3GP8A 4XVQA 4HBZA 1A9SA 3W3AH 5KOHA 3O91A 5K4AA 3OQNA 3M34A 3FFBA 5ALVA 5A2GA 1DDGA 1TJ5A 5EGSA 5JQWA 1CVIA 2Q3FA 4Y30A 1A96A 3M1AA 4KN6A 4YP9A 4CMAA 5F2NA 3K71B 5KJCA 2ACKA 2X5JO 5AESA 4BMXA 2NYAA 1JDZA 4F9GA 5H9WA 4Z53A 4PG5A 4L0DA 1PQUA 4BNWA 3JU3A 3AONB 1V4VA 4B6JA 3U2QA 5IK2A 4CQLB 1B3BA 5SZIA 4XYBA 3I5YA 5AUNB 4YO8A 3OFNA 4HXYA 4ZKDA 4EMUA 4TX1A 4C1NA 2HEGA 1WY7A 1DQZA 1E4VA 2H8GA 3GLUA 3M6XA 3RUCA 3SKXA 1OT3A 3F6YA 2AF4C 4QUDA 5FWYB 3ZBUA 3EVDA 4KKSA 4Y0AA 2EJUA 1VYUA 1ESZA 4HD8A 5HDQA 3SE0A 4ALLA 5ADUS 2I8LA 5FYDA 4QULA 3HEBA 4IW3B 4LGYA 2KE5A 3ADPA 3BMXA 2B99A 4X24A 5IK2D 3IULA 4HLQB 4IIJA 3DBRB 2Z0MA 3LPMA 3OFND 4A0SA 4B2IA 1UJ5A 1QJCA 3I04A 5CYGA 4NZNA 4D45A 1OX6A 3F1LA 3R7WB 5FNVB 5G1NA 3FBWA 2R96A 3JVIA 2QE7A 4J43A 1HTTA 1VSTA 5GINE 3I6MA 1OLUB 2X3YA 1BX1A 4TN1A 4RHTA 3T7IA 3X0DA 3LUAA 2PRIA 2ZAYA 1UJ4A 1XROA 4NCXA 4NONA 5IUKC 3E03A 5J1SB 3ISXA 2BEVA 4HPJB 4PX2A 4DCNA 4JZKA 5B6PA 4FE4A 5C7LO 2XA1A 5AVOA 3Q85A 2DEUA 4F2PA 5SY9A 1E18A 2NU6A 4IKEA 3B2NA 5HIJA 3Q7PA 1LTKA 3IQZA 5BWOA 2YWFA 1AE1A 2QE7D 3IV7A 1DQSA 1E32A 1T2NA 2O23A 2YN4A 4AJPA 3PFBA 4S1OA 4C4TA 2QTLA 4WCFA 3JZAA 4RFSB 2ZRMA 2QAGA 1TQDA 4D8VA 1HOXA 5CVDA 1FUIA 2RAPA 3T7KA 2NTYC 2IW1A 1DKRA 4DPLA 3RUDA 4HPWA 1NF3A 1SRQA 1KJZA 4IHJF 1WSWA 4IXDA 2FWBA 2P9CA 3ZWVA 2WYOA 2YQ5A 1MUUA 1A4UA 5EJ7A 1OC2A 2J3HA 3NOOA 4TWIA 3ZWKA 5EIAA 1XD9A 1Y8RA 4PO9A 2ZVPX 4OKIA 3LQFA 3LYAA 2I76A 3P9XA 5K99A 5DI3A 2ZE8A 1D4AA 2V7EA 3DWGA 3OQIA 2HPZA 1AQIA 1EM8B 4V1CA 3C4QA 3ZIUA 3PVDA 3IVMA 1H8HA 4PYKA 3IOBA 3HH8A 3IRVA 1IHYA 2OYNA 2X6XA 3SU8A 3EF0A 1BW9A 3E70C 3D4BA 5K4HA 2WKSA 2FMTA 4JFRA 4I8XA 2Q6OA 1Z5UA 2I6XA 5I4IA 3L7IA 1P39A 5F1YA 4LCEA 4E1BA 4FK8A 3U3RA 3NXKA 2B6NA 5B3JC 5JD5A 4LF9B 1O94A 5KREA 1W76A 3RKSA 2PBZA 4XI9A 3T12A 3EF1A 3GT4A 3IJPA 3PUXA 4AO6A 2W71A 2JB9A 4RE6A 5FPPA 1J56A 1GLVA 1KEVA 1FLNA 2HREA 2OSBA 4X0EA 4E13A 1YL6A 4S12A 4XYLA 1Q7CA 4K9OA 1RZVA 3O2QB 1ISHA 2BFDB 1D2GA 2VPPA 3AEUB 3KJQA 2ZBQA 1N0HA 2W43A 3LUFA 3ND7A 3NOVA 4J9UE 4MROA 4Q9NA 2K6GA 2OPHA 1Q0RA 4NYJR 4NBKA 3KR1A 3SIPA 1Y1QA 4GM1A 3T7SA 1TUGA 3QWBA 1LI4A 1O94D 1QU3A 2IZ0A 4BBPA 1VHQA 2H08A 4CUJA 2QRVA 5DYTA 3IBTA 4DWOA 3BWMA 3HB7A 2A3NA 2ATIA 1GTVA 1PVVA 3O93A 1U8AA 1ODSA 3WLAA 3ZOZA 2YH2A 3EYWA 4PGAA 2ZM5A 5E7JA 1XZ8A 2YBEA 4C7OA 5FLEX 1NULA 3A3KA 4XJVA 5B4VA 1ZI8A 4G5RA 4IHJA 5ES3A 4Z6KA 1U28C 4O2BB 3DONA 1JECA 3LCCA 4AP5A 2XX3A 3FIUA 1Z5PA 3FNIA 4ZCSA 1B42A 1FX0B 3FI0A 4P84A 1JB1A 2ZIGA 3T5TA 4J1NA 2Q6LA 4H4DA 5DNVA 4EH1A 2OGSA 3DZHA 4MUIA 1LBSA 1O54A 4MGEA 4BNFA 5LIRA 1V6SA 1YQXA 2BFWA 2HTEA 2D1SA 4EF4A 4KV7A 2QD4A 5CT4A 4GRAA 2O4CA 5FQOA 4U7HA 4D7AA 2V55B 2XMZA 2GN6A 1IZ7A 2PWAA 3PFWO 3PPXA 1SM4A 2D54A 3EVBA 3FNHA 2ONKA 4EUKA 5IASA 3NC1C 3MBKA 4FFPA 4KQFA 3CC7B 4BQPA 2GJRA 1IG0A 1T4MA 2M32A 4JBGA 4IQ0A 4HUTA 5K01A 1DTWA 3BORA 3GDGA 4RS3A 4CWAA 4ZU6X 2ADMA 2GJAA 3BMCA 2GN9A 3N1UA 4KXYA 4M55A 4CKWA 4S05A 1I94B 1JIQA 3EJ6A 3H65A 2O8BA 3ZGZA 3NAGA 3SF8B 4MS4B 3R3HA 2EG5A 4R1NA 3VDXA 4HNTA 2QTTA 1CERA 1NGSA 4HKTA 4LRTB 3C3CA 4XX0A 1N6KA 1XAGA 4LS3A 1YT5A 1TFRA 3E8MA 2PRZA 1E5TA 4B40A 3QLVC 1E61A 1XZMA 3TE7A 1C9KA 4Q6BA 3BMQA 3O8QA 2P90A 2B30A 1Q50A 3BL5A 3LFUA 3PZBA 4H4EA 5IW8A 5KTKA 3SJZA 4YCNA 2ZANA 5DHRA 4D2IA 4QOHA 3NHUA 1GPMA 1YDEA 4UMFA 3SLRA 1Z33A 2W0SA 1V95A 3G3EA 3G8YA 4N03A 2HV9A 5KWSA 5FBRB 1BS2A 2NNLD 2JZCA 1G8SA 1LQUA 2Q50A 4GSKA 1G8JA 4N54A 5KTOA 2AZDA 1NUPA 1XZQA 5KTYA 3GAMA 4FIDA 4Q4LA 5AXBA 3CRRA 3T38A 1LSUA 1P4AA 1H66A 1U9CA 1W88A 3HDHA 3C6KA 1W5FA 1FDRA 1IQ0A 3T99A 2FN8A 1NXSA 1WXHA 3GDOA 3RNLA 3S40A 4DSOA 4EVIA 6REQA 4OHRA 2FSFA 4J16C 1J25A 5BSTA 1Q82D 5JS1A 1DHRA 1NHWA 1T9KA 4POAA 3O4IA 1U0GA 3A9WA 1JG7A 1U2DC 3IEKA 4MIOA 2SHKA 1CULC 4W6QA 3LG2A 5EKDA 4NZPA 3UOWA 1B76A 2HN9A 5IBRA 3V8RA 2G1JA 2OXFA 1U0FA 2CEKA 3FPHA 4A8PA 2P3OA 3LGXA 2WMYA 4CTMA 5EWJA 3MTQA 2D9RA 3A06A 2Y1EA 4I50A 4KO1S 3IRUA 4DA7A 1YBAA 1CY6A 1GPAA 3CLRC 1UH5A 4YACA 3PLRA 4FBMA 2R2GA 4FHEA 1YMUA 4GX5A 2GEVA 4NJMA 3NHWA 4WKNA 2VA8A 3L0ZA 1QPBA 1RLJA 1RXYA 2NXNA 2DKOA 1IOLA 3JQ8A 2FR8A 1QF6A 3WRVA 5DP2A 5LN1A 2WHXA 1AUXA 4JOSA 2ANBA 4B4WA 2QGGA 4QZVA 4YMWA 4KNYA 3T3IA 1N1MA 3PQEA 3AP2A 4U3JA 3OW2B 3A70A 1C1DA 4K88A 3PIIA 3CCSB 3AHGA 3ONDA 4C4ZA 4E22A 4OP7A 1RE1A 2VDWB 2F6RA 2ZDHA 3JPYA 4IIUA 3COPA 4RETA 1IWOA 1LRLA 3M5WA 1H2BA 3JS5A 2XNSA 2I7DA 5H4HA 2FW1A 4DUZB 2OCPA 4JJFA 5JXHA 3TLZA 1Z17A 1U7XA 3VU9A 2GX6A 1PR5A 5F9MA 1EGVB 1WNFA 2ONYA 4G37A 3RU7A 3GCWA 2V6GA 3FRJA 4DV3B 3FCAA 3QE9Y 4GYKA 1OX4A 4DR1B 4EKGA 3MMXA 3DW1X 3NKLA 3R6LA 4MPJA 5BQ5A 3OJCA 3IAS6 4R1PA 2O0MA 2AQHA 1TX4B 2DLNA 1QIJA 3DULA 2J8ZA 4A4DA 3B2QA 3IIIA 3G8CA 3EAFA 4WBXC 3A0RB 2YDXA 3UAVA 1PKEA 3WIOA 3ZKWB 4KPYA 3NBMA 2HRZA 1K3UB 1U9YA 3ROGA 5A0TA 4IVPA 4NQZA 2PA0A 1TA0A 1OT5A 1Z6AA 4X44A 2MYNA 3E9DA 4RJKA 4C7BA 4XLFA 4BJ1A 3DFFA 1DG3A 5D87A 1OILA 4KGDA 4A1FA 4EGQA 3CX6A 3G2OA 2WAYA 5GGYA 3Q8WA 4HH3C 1PKXA 3KQWA 3PVZA 1O97D 3ZZTA 1ZC3A 4NFYA 3DEHA 3RYHA 1GL7A 2NUBA 2NV4A 3TQTA 4OOVA 3HPQA 3K9HA 4LSWA 4BU0A 3G68A 5AVKA 5HX7A 4ARSA 3IUEA 4RY8A 1LZKA 2X41A 3HUEA 1FDWA 1QOQB 3NH9A 2X4IA 4Z0NA 1PFYA 4OBWA 4DKJA 3LNCA 4U8HA 1U0EA 4RW0A 4O4JB 3P9NA 5B53A 1JLLA 2P7HA 2F59A 2QAJA 1L8AA 4YLYA 2IHNA 3Q11A 3P9QA 1GFIA 4NOJA 5GM1A 4C7VA 8GPBA 4WY5A 4P5DA 2ZWAA 1VCNA 3TIGA 2HBRA 5DN6A 5KWEA 5TB5A 1QONA 2JVIA 3T7JA 4MMZB 1MXHA 1QV6A 5TY0A 4C5CA 4D9CA 2ZBGA 1PR1A 2FN7A 4KR6A 1P61B 1PZMA 1IM5A 1XFDA 2IW3A 2VTEA 4R05A 3T3GA 4CEHB 4X7MA 1UPXA 5TNXA 4GBGA 3VI4B 2XE6A 3VC3A 4OHKA 2J5BA 1KPGA 4R2KA 2CC2A 4ESOA 5B2EA 3IS3A 5NULA 5FBQB 3TDMA 3B53X 3P4YA 2E49A 2X9VA 4KO2S 5DN6D 5KS2A 1AJEA 3RY8A 3IP1A 1RXWA 2DCUA 2ECOA 1CS0A 3LHSA 1SBTA 4NZZA 4LJ6A 1T3HA 2OVFA 1V16B 5IC6A 2CVOA 4ES6A 4O25A 1SVKA 2C4UA 1N2GA 3MXOA 4LXXA 2EIXA 1LXCA 2PRKA 5AOVA 2J3JA 3C3MA 4BNTA 2B1QA 2D5BA 2W93A 5KOIA 2OZVA 3GMDA 4UREA 5AK0A 4ZOAA 1N3IA 3ZG6A 3PGKA 4JB3A 3NALA 4KQJA 5LYYA 2RGYA 5CH5A 1BVHA 3UY4A 3D3WA 5FUMA 3C5EA 3PTLA 2QORA 1JZQA 1K6JA 4ROTA 3GLRA 4I55F 4CYMA 3PFCA 1F4PA 3Q6RA 1AKUA 2IGBA 4MRRA 2ZTNA 3E23A 4LY9A 3WRYA 3ZWMA 5DMHA 3BX1A 2PJRA 5A6SA 4H0CA 2WWHA 3BQNB 3LPNA 4EABA 2DHQA 4DN6A 2QP3A 2YV3A 3KZCA 3VJKA 1QHSA 1P2SA 4NOKA 2I9KA 4D3FA 1RLIA 2BFFB 3HVRA 2VTBA 2FP4A 4AN0A 4KXXA 4Z3OA 5EJAA 2BEWB 4FFMA 3THWB 4RTQA 2BEKA 3WBBA 2E1RA 2E3JA 2FK8A 1LPBB 1HGXA 1ZCAA 1D2RA 2I4MA 3JQGA 4GOKA 2VNIA 1YE5A 4KWCA 3W3ZB 4P2GA 4B4VA 4TKZA 4JEMA 4Z9BA 3ND9A 2EKLA 3AHFA 3UMBA 2V3CC 2OO3A 1YB4A 2Z9BA 3P0HA 4Z4TA 4Z4RA 1FS4A 2IYEA 4MARA 3WLJA 2WE8A 4HDMA 4UAJA 1JL3A 3F2VA 5CNIA 3PJRA 2IKSA 2R8YA 2R6DA 4TYPA 5J4KA 4PM4A 1WF3A 4I2NA 4NP6A 4DMUB 2CJWB 2CNOA 4P83A 5LUAA 2YIDA 2BFBB 4WZAA 5DH9A 3TW8A 2IIPA 4HWRA 2GAAA 3Q87B 4BPBA 5IXYA 4YLGA 1GLNA 1NDQA 2NZUG 2EX4A 3C6QA 1PT7A 3RVDA 2A4KA 4P31A 5DM4A 3VRHA 4IDOA 3RWMB 3GDFA 2QLBA 1N2CA 2P65A 5AK3A 5BW6B 1M2EA 2CMDA 2DUNA 3ZS8A 4YX9A 3MMPA 2IE8A 4P34A 1NUHA 3VNUA 1L5HB 3U6BA 3QI2A 3AUTA 3ZGVA 4YMVA 5KU7A 4P5EA 3W2GA 4TTJA 4Q15A 3S5UA 3CKLA 4MW2A 4Q66C 2AOXA 1T2EA 2BKLA 2WU0A 3O0TA 3KPUA 1MBZA 4HNAA 3W6ZA 4F60A 5E2AA 2QAIA 2JCYA 5E6RA 3RUAA 2GEKA 4JOCA 3BKXA 2BTQB 2E5LB 5CX4A 4V0LA 1D04A 3OQHA 2NV2B 3EFOB 2CYBA 4RH1A 4ND6A 1F06A 2P67A 4ODIA 3ZHTA 3AKDA 2XVYA 3B12A 3RSCA 3UOGA 1DJPA 1WHTB 4B0PA 3A6HA 1MGOA 4X97A 3THYB 2AJDA 1V0JA 5JAPA 4ZT7A 3Q6IA 3CVOA 4MDFA 2RHLA 4X07A 3QBJA 1U1EA 3KEFA 4HQLA 3FKSA 2R751 3BSFA 3QM1A 2JAOA 3GAZA 4KAAA 3VH3A 3C3WA 4GZMA 1BA2A 4NE9A 1Q7RA 4XIIA 1CJCA 3JQPA 4BMSA 4I46A 4WD3A 1E1QA 4YRCA 1UXKA 3QSYA 2ETXA 3H5RA 2CBGA 4DSAA 1TK2A 2W6QA 5NLLA 4C6HA 1Q3KA 2LP4Y 2ENWA 4C7MA 1KYTA 4XGRA 1CEQA 1KFBB 5LYJB 3GFSA 4GLOA 5KPJA 2FCAA 2R85A 1KIFA 1RHKA 4ARVA