4C43A

Ferredoxin nadp reductase mutant with glu 103 replaced by tyr, tyr 104 replaced by phe, ser 109 replaced by phe and gly 110 replaced by pro (e103y-y104f-s109f-g110p)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLYFKHPEFPETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title External Loops at the Ferredoxin-Nadp(+) Reductase Protein-Partner Binding Cavity Contribute to Substrates Allocation.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4c43A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4c43A02
1EFTA 2VNKA 4M0LA 1I7PA 1B23P 1GAWA 1Q86D 4QHYA 1KJZA 2OTJB 1QG0A 5DSZA 4N3GA 4J0QA 4PC7A 5GV7A 1YJNB 2BN4A 3ZC3A 4B44A 1N8RD 3JQQA 5TR9A 1G7RA 1QFZA 4LBVA 4LC0A 4YAOA 1E63A 4C0SA 2J7KA 4R71A 3ZZ0A 3CMAB 1AIPA 2B7BA 4K1XA 3VO2A 1EP3B 1CNFA 4M1KA 1VQNB 1DG1G 1IB0A 2HMAA 3I1FA 3CCVB 2QTLA 1JB9A 2EFGA 3ZBUA 3VNUA 1OB5A 4NBSA 3G6EB 1KK0A 3ZZTA 3G71B 1AMOA 4TN1A 2DEUA 3WBJA 1U2RA 1GJRA 1SKQA 1TTTA 4RJLA 4ZGQB 3OJXA 1NJID 3W5VA 1DDIA 4G1BA 3U6KA 1KK2A 4ACBA 1VQ9B 4MYUA 1VQLB 4B48A 1FRNA 3CCRB 1ZM2A 4G5GA 2CRVA 1BQEA 3CC7B 1TVCA 1BX0A 1YITB 2B7CA 3FPKA 2DCUA 1D2EA 2YWFA 1KQSB 1TLLA 1EFCA 1GO2A 2PMDA 3LVBA 4NCNA 3WNCA 1VQ4B 4C43A 4AF6A 3CC2B 4F7DA 1Q82D 3QFSA 3WBKA 1XE1A 4HE6A 1D1NA 1G7SA 5THXA 3CB4A 1IJFA 3AVVA 1UMKA 1KK3A 1W2BB 1N0VC 3FJOA 4FWTA 3W5HA 2X3UA 1DARA 1FNDA 1W35A 1OB2A 2QDXA 1YIJB 2EIXA 2D74A 1KTVA 3ES9A 3AGPA 2R6HA 2DY1A 3CCLB 4ZCIA 3W2FA 3U2QA 1FNMA 3MHPA 4N3NA 1EFUA 4RD0A 1F20A 2XNJA 1Q81D 1GAQA 1K73D 1ZM3A 1M90D 2VNIA 4UAJA 1G7TA 4LBZA 3I55B 3MCAA 2B5OA 4B3XA 4PC1A 1S72B 5KSWB 4TMXA 3MMPA 3ZZUA 1YHQB 3VMFA 1CQXA 2OK7A 3I56B 4ZGNB 1VQKB 2CNDA 2XNCA 1NDHA 3AVYA 1QGAA 3SJZA 4YAUA 1VQ7B 3A1FA 4PC2A 4FK8A 1EP1B 3W2IA 3OJWA 3ZBTA 1YJ9B 1KC8D 3B78A 1VQOB 5HXBA 1DDGA 1FNCA 3P27A 1XB2A 1D8TA 4RD3A 1EWYA 1GVHA 1QUFA 4LBYA 2XEXA 5AN9A 1QGZA 3W5UA 1WDTA 3QE2A 2FX3A 4Q7JB 2QA4B 1BX1A 5FA6A 1H85A 2NPFA 1EP2B 1CNEA 3OZUA 2DERA 3CC4B 2HDNB 2QEXB 4QFMA 2RC5A 4B4DA 3U6BA 3W2EA 3CCQB 1QH0A 1FNBA 1J9ZA 3PENA 2VZLA 3OZVA 4BPRA 4EH1A 1F60A 1R5NA 4ZV4A 4PC6A 1HA3A 1QFJA 1ZM4A 3OW2B 3B82A 1R5OA 3JQPA 4ZCMA 1OGIA 2DETA 1E64A 4MYTA 3WYAA 1KK1A 1JA1A 1JNYA 5TV2A 2HCJB 2YWEA 3E1YE 4LBWA 3CCEB 3QFTA 1VQ5B 2VNHA 2GPJA 3CCSB 2BSAA 4TMTA 3AGQA 1R5BA 4P6VF 1EXMA 3LRXA 1ZM9A 2AHOA 4DQLA 4M2LA 1FRQA 1S0UA 2QTZA 2BM1A 1JA0A 3CD6B 1YI2B 1VQMB 2RC6A 4M53A 4H9GA 5TY0A 3E20A 2BGIA 3G4SB 5H59A 3WXMA 2ZITA 3AVWA 3WNBA 3CCMB 3CCJB 1E62A 3WNDA 3B8HA 4RD4A 4TMZA 4RD2A 3WY9A 3CMEB 4Y9UA 2VYQA 1IJEA 3W2HA 1QVGB 1M1KD 1QGYA 2QMUA 1YJWB 3P26A 3QSYA 1ZUNB 4U9UA 3AVTA 4YALA 5GV8A 2OTLB 1KD1D 2BVNA 1BJKA 1B2RA 1FDRA 3CW2A 4YAFA 2C77A 2BMWA 3W2GA 4AF7A 4YHBA 4RCYA 4B43A 4B47A 4RD6A 1A8PA 2BGJA 1KRHA 3OZWA 1ELOA 2BV3A 1Q7YD 1W34A 3QFRA 4TMWA 1VQ8B 4IW3B 4P3YA 2C78A 1W87A 3VNVA 2BF4A 1VQ6B 2BM0A 4RD1A 1JJ2B 2PLFA 1OGJA 4ACAA 3LO8A 3QFCA 3CXCB 1TUIA 2E1RA 1SM4A 4Y7CA 4DQKA 5JBQA 1H42A 2VNJA 1K9MD 4FN5A 5EMNA 2YWHA 4PC3A 3CCUB 3CPWB 3JQRA 4YAWA 4M4SA 4Y9RA 3AVUA 3VO1A 4WQMA 4G1VA 2QN6A 2PIAA 1N0UA 1GR1A 4RCZA 2GQFA 3LYUA 3AVXA 1QVFB 1QUEA 3J81k 1G7CA 2BPOA 4TMVA 4ZCLA 2YWGA 2OK8A 1QX4A 3CRZA 1QFYA 1VQPB 4HE5A 4AC9A 3V76A 4PGOA 1K8AD 5H5JA
chains in the Genus database with same CATH superfamily
2C3YA 2P2NA 1JU4A 2OQVA 2V6JA 4KDEA 2QAGC 2MSEB 2RMKA 4MVJG 1RBZA 1LWOA 1QVAA 4MS1A 2CDAA 1OREA 4FKZA 2FE4A 1XEAA 1CZRA 1KAEA 3AI7A 1RLMA 3M83A 5KSOA 1TIKA 1GZDA 4OQLA 1HYGA 3AESB 3DO5A 1C80A 1O6BA 4A0GA 5AW6A 5I7HA 1YJNB 1WUHS 1P4RA 2NXNA 1TW3A 5ALIA 3RRXA 2OUKA 2QGNA 1LW7A 3K5HA 2WBLC 1V9LA 2Z30A 3UJCA 4C6TB 3KWMA 3Q12A 2VLBA 1FUEA 1Z7WA 2DAPA 1Q19A 1I36A 4O4JA 2WF5A 5LA6F 4PICA 4XCQA 3ZTTA 5HR5A 1JHYA 3JZDA 3H04A 4Q05A 1OC4A 2GZ1A 3H5LA 2JVKA 3PGXA 4FX2A 3OD1A 2GZDA 4F4UA 2OBSA 3AZPA 5FBWB 1CF2O 3B1ZA 1T5OA 2HWKA 2XAUA 4OMCA 5FDFA 2VF4X 1RYZA 4E12A 3LLVA 3GZJA 3K16A 4H35A 2Q0HA 2IEBA 5BQOA 3IAXA 3JQAA 1PFYA 1CE8A 1GL7A 1SQ0A 4RL4A 8MHTA 3JQBC 3A25A 3OEWA 3TW0A 5B64A 3TSYA 3QX3A 1U0BB 1ODLA 1NMSA 3G88A 4RMIA 4YHHB 4F93B 5B58C 2PVSA 2M6KA 2NU9B 3DCJA 3VI3B 2WILA 4XRGA 2XCTB 1CUSA 1RQNA 3QKSA 1ZHHA 2CVQA 4WGGA 1GZ3A 4BWYA 5AK5A 1GTSA 4FONA 2D1SA 3Q7RA 2O8VA 5HJEA 1OPXA 1BCSA 3EEQA 1O3YA 4P7KA 4YUAA 3T5AA 1K4KA 1VJ5A 1K08A 3HP1A 5HTKA 1I7SB 1YQTA 2PUVA 4NV0A 2JFWA 4UUNA 5JVDB 3OIFA 3DYBA 5EESA 3E35A 4LF5B 4EA6A 2WKWA 3L6UA 3OLXA 1DBWA 2ZULA 4JJAA 4UZUA 5CYOA 2C84A 2RH9B 3ZHOA 5EXDA 5HJ7A 4J2OA 4UTNA 4HATA 3AM5A 3O0TA 1ODFA 4KQJA 1L8AA 2R4TA 1NSFA 3EB9A 3KV1A 2C4TA 1BXGA 2QTRA 3KVOA 1YJ5A 3D6UA 1TIPA 3KT3A 3AF1A 3L7YA 1EVJA 1XG5A 4JBYA 4UVEA 5C1DA 2O0KA 3LG2A 1NW6A 3U6KA 4V0LA 4X7RA 1SVIA 3VM6A 4PRKA 3W5SA 4LEIA 5KYXB 2Y1LA 5CJPA 3QMWA 1EP9A 1L7XA 1EFKA 3BUSA 4HF7A 4X95A 4DA7A 4F9TA 2LR0A 1UD6A 4H6XA 4WK2B 1A76A 4Z9FA 2PSSA 1DWOA 1W2WB 1Z07A 1VYUA 2H5IA 1QLWA 1X7ZB 3KOUA 3PCXA 2PLNA 4MUXA 3FOBA 2Q46A 2IU6A 3HCRA 3MCUA 4TKUB 3I12A 2EGHA 3MJVA 5IF3A 2VBTA 3HJRA 2LDBA 3DTNA 3NBMA 3S0JA 4WINA 3L43A 3E0XA 4I3GA 5EIBC 1T8PA 3MBOA 4R9SA 3SX0A 3R8CA 1XZNA 1P80A 1YA8A 2ZWMA 4TRRA 3JAKB 3L8CA 1TVCA 3ZH9B 3D6VA 1MB9A 3NRCA 4P3NA 2IHZA 3HY6A 5PGMA 2F3SA 2HPVA 3ZGNA 4XD7A 2R47A 2IHBA 3SKXA 1GPDG 5LDGA 3WL5A 1G41A 2GH1A 3ANSA 4QUZA 4WLOA 5TXGA 1EDOA 2JKYA 5F9HA 3FRJA 1AKQA 2J0UB 3A6HA 3HKCB 3JY6A 4B6OA 1JI0A 3KKQA 3V80A 4YQFA 1VE5A 5KOHB 1H5QA 4IDNA 2YIVX 3VH2A 1H2YA 3JATB 4RADA 3R9XB 1N6LA 1MO3A 2QRLA 4M7PA 3HVIA 2OZKA 2OFXA 2NQTA 2FG7C 5I9NA 1XRRA 1W5EA 4JL5A 1QPGA 3PB3A 4F7DA 4MVYA 1WP4A 1T5IA 2XWQA 2A5LA 3N2GA 2IV7A 1ZICA 1DJOA 2TMDA 2VPIA 2C88A 5K0TA 1FVFA 3EOBI 4M21A 2E2WA 1GLNA 1CP3A 3EQZA 1WY5A 5JCXA 1UF9A 1A4IA 3CVJA 3CONA 1RYMA 3P4UA 4OQMA 4EL0A 2J67A 3KDSE 4JV5B 1J0DA 3NR2A 1RQPA 1NPTO 3M6AA 1NQVA 2VEOA 4HH1A 2O8FB 1DLIA 3AR9A 5B1SA 1FY2A 5AQ1A 4NCJA 4AYXA 2WWFA 4ANFA 3GBVA 1HV8A 2P6RA 3RVDA 5JWRA 3GRVA 4DCPA 2OECA 4KQXA 1T2UA 4L0QA 2H4FA 4NRDA 2D59A 3EAQA 4WXRA 2C5AA 2FX2A 3I9LA 1HDXA 3QA3E 4EO4A 2VPZA 4LHVA 4LKOA 5CM2Z 1SHUX 3NYQA 3UC5A 2QXYA 3LRTA 4M1YA 2O52A 3GRPA 3T1VA 1FFGA 3D7KA 4J16C 1W8IA 4UNPA 5A62A 1QS0A 3WQZA 2XE6A 3C6KA 3ZE9A 4G1UC 1ODTC 2B2NA 3MT9A 3C3JA 1TK2A 1YVRA 2GCEA 5KVSA 4N3NA 3MTJA 3ZHBA 1C7IA 2IYRA 5IG2A 3PQFA 2LZ0A 2I66A 4PAOA 2ZCVA 4QOGA 4N7RA 1JJVA 2PVPA 3V2GA 3R74A 2ZU0C 3F7OA 2A94A 2ZRQA 4YCDA 4BB0A 2J31A 5LSAA 3KFVA 4PABA 1YZYA 2QYHA 1G5HA 4G97A 5E6TA 1WMBA 3PHIA 4KX3A 4FHGA 4EHLA 3DQQA 3TIXB 3MBIA 3OPNA 3E7XA 3CLRD 4JLWA 3NX4A 4B71A 2NXJA 2NYAA 2RDMA 3KJGA 1QF6A 1F1JA 1UKZA 3EXG1 4TMXA 3RC2A 1QDEA 2CNWD 5FBHA 3IIMA 4A15A 3CLTC 4P3IA 4K5QA 2A6PA 4MQEA 1AK1A 1RTTA 3D31A 4HNRA 1D9XA 3D4LA 1QKJA 5DP1A 2H17A 3ZWNA 5IANA 4G4IA 4CQNA 4ZGNB 3LCCA 1UDCA 1B2LA 4C3VA 4ZIRB 2AG8A 4Q03A 2P1DA 1ZN8A 3WSWA 4ZVQA 3MUEA 2WA2A 1NM5A 2WU3A 3AFHA 4E3WA 1KZHA 4JENA 1M2FA 1ZH4A 3OPYA 4ESHA 3IBYA 5CFZA 5JDIA 1MRNA 2I3GA 4BFZA 1J9EA 1SVSA 1NUPA 3GO4A 4RVCA 1K9VF 1RKQA 2O2GA 2VTVA 3E8XA 3N2ZB 4IKOA 4X9XA 2IOFK 2X2OA 4L76A 2YKGA 1L4GA 1X74A 4D4JA 2W37A 3R7DA 4HXYA 2NMVA 2AZMA 1KSJA 1TQHA 4V24A 2Q5JA 4PLFA 3HA2A 4OAQA 1WIWA 2PA3A 3BL5A 5JMWA 1F4LA 4MNTA 3CUWA 2X14A 1E79D 4LPSA 5LZ9A 1KYQA 2GFHA 3BRSA 4ES6A 1Q3TA 2GB4A 2I03A 3F9RA 3WMEA 4CIYA 2ICAA 1YKGA 5C7YA 4AVZA 5G1NA 4LQLA 2UZ1B 3EFEA 3OE7A 2XMRA 7REQA 1JEYA 1N6IA 4KAXA 3RVSA 3QRWA 3CX6A 4EW2A 4PHTA 4M7WA 2OBFA 1L4NA 1HL7A 1ZA2A 1BDJA 3LX5A 4LRXA 1L4EA 3DE3X 3H2HA 4V02A 2XZLA 2F8MA 1MCZA 3RPEA 3V1MA 4E2ZA 4X62B 2FMUA 1AB5A 2CJYA 2NPFA 2YYSA 1C7ZA 2I6SA 2QX4A 4G8DA 3LUPA 4KXNA 3EEYA 3RS7A 5EZSA 5C8DA 1IUPA 3SI7A 4EVRA 2PFSA 3OM9A 3GQBA 2UYCA 4ZJPA 4CLDA 1U2GC 4YQZA 4J16A 3KEOA 2J08A 3IV9A 3TTTA 5DFAA 2P1ZA 3UMMA 3GNLA 5FL3A 4FYMA 4XEUA 3VAYA 3E82A 3WRYA 2AR9A 5CIYA 3OP1A 2PGIA 2YS6A 4I50B 3O4JA 1V3UA 4PBRA 3TLZA 2GD6A 4L5IA 1E8NA 1EQ2A 1MXHA 3PJDA 4DCCA 4PSCA 4QGAA 2HIGA 4WPGA 4V0OA 1Z2PX 3BC1A 3EXEB 1KI4A 2EKZA 4JC0A 4L9RA 1REQB 2FP4A 4TT3D 2FZWA 1U3DA 2C99A 1II8B 4LFAB 3BRWD 1K2WA 2XUDA 2GT1A 3OY7A 1UM9B 4IHJF 4PN3A 5HQ3B 4C29A 2IUFA 5HXAA 4Q4HB 4I6GA 3A35A 1KMNA 4LXIA 3VNSA 1DMSA 2J9FA 2MR6A 3OHMA 5I9TA 3CRNA 5C7OO 2ZIVB 4ZXFA 3WLLA 3ONYA 2W2MA 4LY6A 1XDZA 3F6PA 2CFIA 3MERA 1NX9A 1RYYA 1U2SA 1V3VA 2UUOA 3U3OA 1TM2A 5JFTA 1UBUS 4O5OA 1BCRA 5K0LA 3WOVA 1VKNA 1RQXA 3PVSA 4EY6A 1P2SA 3CNOA 4FFWA 2YWEA 4DUYB 3MGGA 3RFFA 1YD7A 3E1YE 2CCJA 4FDVA 4NMXB 3TZEA 4UTVA 4ZI7F 3N28A 3RSHA 2OV2A 1K6MA 5BVGB 3CVXA 4S1NA 1OAAA 2HHHB 5JROA 4BWGA 3USES 4BU1A 4Z0HO 5KYKA 1CC1S 1LTHR 4UBMA 4UKDA 3UWKA 4E5YA 2BUBA 3LDGA 2Q2VA 5EQJB 4A2QA 2UAGA 5SICE 2BEWB 4MWDA 1IN1A 3EFOA 4OFZA 2BT4A 4MR9A 1DCMA 3H1FA 5TQ2A 3W1EA 5G3YA 2ZZGA 1ZM9A 1VL5A 1XX6A 1TO2E 2C4KA 2ID7A 2P79A 1GQOA 2PT9A 3FSGD 3K5WA 4KPUA 1TF5A 1PUJA 2VDPB 4HADA 5CM8B 3BD8A 3DD1A 1FC0A 1HX7A 3CD6B 4H27A 3D64A 3IAM1 1F7VA 2Q6OA 2JFVA 2OENG 4S3MA 3UPTA 3D4PA 4XYMA 4ML3A 2IEDA 1GDDA 1GFSA 1LPMA 3NBKA 3QPAA 4GX2A 3CJTA 5DULA 3TX6A 5FNVA 5DM60 5BP7A 1ABBA 2ZITA 3BXZA 5SZKB 4AJOA 1E9RA 1RM4A 2WHRA 3UAGA 3CB2A 4XB2A 3RF7A 1II8A 3R5FA 4TMZA 2F1IA 2FK8A 3H2ZA 4L4XA 4PHCA 2V59A 3WY9A 4KKSA 1RYHA 3W3AD 1NE2A 4FDMA 2ZDGA 4LZWA 1CVIA 1DTWB 1KO4A 3FNFA 4KV9A 4QO8A 2PGXA 3SC4A 1LQ2A 2WSYB 2B3TA 3ZCSA 4ER5A 5JZVA 3SQLA 2QRVB 4AJ1A 5FJIA 5IZCA 4WWVA 4POAA 2EFCB 1QYVA 3GJ7A 3HNOA 4IEEA 3ACCA 1M9NA 2K4MA 1WW3A 2PZKA 1GTL1 2H1VA 2QLFA 3DW3X 3ANXA 4B17A 1KGSA 1SKYE 3D5EA 4FWBA 3L9XA 4EVIA 3O91A 4FOLA 3TUIC 2YZ7A 3CZAA 4IVPA 4NBUA 3KL9A 4IIDA 1S8OA 1FMJA 3MT0A 2GARA 1CU1A 3NBXX 4J1TC 4P3PA 1PSZA 4QLOA 2YMQA 4RPCA 2I4MA 3ROMA 1GM5A 4P7GA 1FDRA 2F1LA 2BMJA 3IPXA 4FUQA 4C6RA 1H3EA 4OPMA 3ST7A 3ASQA 5ECDA 4OUDA 1XZIA 1J0XO 5KNBD 5ED0A 1XZLA 1KQPA 2PGNA 4G0ZA 1SCKA 5H7XA 2BGJA 1PX0A 3A6ZA 3EXIB 4Y1EA 2HA7A 2AUNA 1XA0A 4WVFA 3UYLA 2GKGA 3KXPA 4ER0A 5LNK6 2ORVA 2B1JA 5JC8A 2G9RA 5ALYA 1Q0TA 2GMWA 1WCV1 1ZWLA 3GRYA 3AHDA 3PQ6A 4N6OA 4XVUA 5KX5F 1KSGA 3F6YA 2M32A 1OI7A 3OA2A 3VSEA 1E9CA 1FSPA 1CD5A 2C3UA 2GK4A 2IUYA 3SHTA 5F2NA 2C42A 1DKOA 1TI7A 5B2ZA 1PFGA 4GM1A 4P3YA 1YNOA 4MQFB 4RZUA 4MWOA 3WAGA 1NRIA 3OX3A 3GRAA 1P9OA 3FLMA 3R9WA 3M89A 4NBTA 1K4MA 2EGGA 2FX5A 4NI5A 1AX9A 4U7DA 5KC8A 1OC2A 5AHWA 4ONEA 4QBHA 3AZQA 4EBFA 4MKFA 1E1LA 3EGXB 4P98A 1RJ9A 4L3WA 1M7GA 1I8DA 1O94C 2HBZA 4DAEA 3SF8B 4JQCA 1RMTA 3DZ8A 5KOIA 1UKYA 2EJTA 1JG2A 1PVVA 3RIYA 4EYKA 3R8FA 4BXOA 4B35A 1NJGA 3N3AC 4DDHA 4RK1A 4Y7CA 3FPAA 5CUQA 3F5FA 3VQTA 4MJ7A 1TZJA 3IC5A 1AKVA 4B6GA 5JBQA 2H5EA 3DCYA 1NY6A 2C2GA 3DOCA 2Q62A 3UA4A 5DDIP 3KHSA 4R8LA 5KTPA 5IJ0B 3FA2A 3KYBA 5SV2A 2IYOA 5A71A 5FPSA 1JYEA 5LA6B 1FMCA 4IDPA 3IERA 2R8BA 3WK6A 3GVIA 4CM4A 4N3BA 3EUEA 4UPEA 1ZJYA 2FZLA 4HMOA 5FTLA 4M83A 5DTMA 3L1JA 5U4QA 3KQHA 2W0SA 3ZD9A 4HQOA 4X7FA 3EYWA 2G07A 4FBMA 2GJPA 1Q7EA 1DAIA 4FHZA 4KI7A 4L4YA 1OX6A 3HDGA 2R6JA 4HAOA 3NANA 4JP3A 3GX1A 3PUXA 5FPHA 4EP1A 3LCRA 1B8OA 1T3ZA 2W4QA 3KZCA 1R4NA 4RWEA 3Q39A 4JGBA 1EA7A 1EXNA 1G2IA 4M1ZA 4WXHA 1UOQA 4NF2A 3P45A 5DLPA 2HA2A 1NIJA 3CR7A 4LTNA 5CA1A 4KIJA 2J48A 4UQOA 1UEXC 1FNSA 1VKRA 3EAGA 3QXHA 5BSMA 3FDJA 2GSWA 2PV0A 4D92A 2KI5A 4RGVA 1GTRA 2RHWA 2ZIXA 4W8HA 4UNIA 4MP6A 2Q27A 1EG7A 3RTDA 1V0JA 4AC9A 2PKEA 3MUOA 3NYRA 1P2BA 4GRIA 5A4AA 1T35A 3MC1A 5I7VA 4ZOEA 4FX5A 5KCZA 1XU4A 3FGZA 4TMFA 4RE6A 1AUQA 1R9JA 1KOJA 1I7PA 4LOAA 4DANA 2P62A 4EO9A 1G5FA 2P2LA 3IDQA 3P96A 3MMSA 4NPHA 1JFFA 4GSKA 2XTZA 3AL0C 1CDEA 2FPIA 2IEYA 1D4ZA 3D2BA 2Q1WA 3OQHA 4E7OA 4ZAVA 1RIFA 4DG9A 4MI9A 2AQHA 3QHPA 4HUJA 5JY1A 4WKGA 4BIMA 2H16A 3GEDA 3DGEC 1F14A 4H7FA 5GV7A 4FFRA 4TLMB 4ZVRA 1GT91 4H1UA 1K27A 4OP1A 4UHCA 5DK4A 3KG2A 2IKQA 1PTJC 3LGSA 1YXMA 4XZ3A 1OH6A 1IATA 4EGJA 3NWJA 5DEIA 3W6ZA 2WUGA 1QIEA 3F49S 4KBFA 1G7RA 1QFZA 3GDWA 2OFWA 5EWMB 5E2IA 3HCAA 3NHLA 1CQJB 3AOEA 3R3VA 3VVCA 3D7RA 5CT9A 4R1TA 2JARA 1YCFA 3UGQA 2DT8A 3AFMA 1L3BA 4IKEA 1FVXA 3SP1A 4DEXA 2PCLA 4I4TB 3CXUA 4ZVTA 5EMHA 4H2DA 1WHSA 2H1WA 3A2NA 3PF9A 2FEMA 3BREA 2H06A 1Z0ZA 3BBLA 4NSNA 2P9YA 5FLEX 2QTTA 4HN9A 3ACDA 1E20A 2QTFA 1DKNA 2WJGA 2XHZA 2ZR0A 5CIQA 5ENZA 3KXKA 5TMEA 3SZOA 1UH5A 3PXGA 4L28A 4P1ZA 4BS9A 2OB2A 1NSTA 2EBWA 4IDOA 5FF9A 5FUYA 5DYYA 4LTMA 2C31A 4JT8A 4HQLA 4Y2RA 1YFKA 3CXRA 4WXYB 1D03A 1MVNA 4RDCA 5D6OA 3DPSA 2ZANA 3TAHA 2DQSA 3BGOS 4KN6A 3RV4A 3VUEA 3ZBUA 1M5RA 3C7AA 3WGLA 2HU2A 1LSOA 2R11A 4MRPA 1P1FA 4B8ZA 1IZ9A 3D4IA 3RG2A 4C0XA 1XDDA 2REXB 5G4LA 1H5NA 3DMDA 4M1TA 1BHQ1 1LW6E 5EJFA 4DB2A 5JAZA 5FPYA 3UMVA 1WMAA 2XHEA 3PNLA 2BYTA 4M76B 4QRHA 1ISRA 1QC5A 1T6YA 4YO7A 5EOVA 1N6HA 3AP1A 1YZTA 2PGOA 3QBEA 5ALPA 2FPUA 4RVNA 1CIVA 2XQJA 1L5HA 4DMCA 1JUDA 2PRYA 3PYMA 3DE0X 3T4UA 4CG3A 1PHPA 2ZI3A 2CLDX 1ZK2A 4LRSB 1TECE 3VZQA 3WK9A 3ZI4A 5IM4F 2PE5A 3I4FA 1BA3A 2Y0BA 2IY9A 1DDIA 3PUHA 4C2BA 3VNRA 5DT2A 3GLFE 1U7ZA 3PUZA 2FWBA 5E7IA 1VCOA 1FFDA 1W49A 1RM3A 2ZDHA 5C5EA 2QU7A 4C05A 4R81A 3GGCA 2IPAB 3KYCB 5FOQA 4Z99A 3CO0S 4FJ1A 4R41A 1F1BA 1QRUA 3D2AA 4P9SA 1U8CB 1TQ4A 1UK9A 3LGXA 1E0AA 4OQPA 3SJ7A 1C9YA 1N5DA 2YV4A 2WJJA 1THTA 2JIZD 1PJAA 3GAAA 1PJLA 4FKBA 4L57A 4QQRA 4TZKA 5DGTA 4DY6A 1WETA 2EXXA 4OEHA 5C3UA 1T9DA 2GAOA 3C6YA 5D01A 1AHNA 2IY8A 3AY6A 3C2QA 1GZ4A 3IHWA 2PR2A 4IRUB 2ENWA 3TD6A 2GD0A 4YUWA 2D0OB 3H2IA 2B61A 1P4JA 3GR6A 3B1FA 1BVUA 5CK5A 1K3UB 4GE3A 5ALWA 4NP6A 5IHPA 2V65A 5KJCA 3CQ9A 2YWFA 2X6XA 1V8PA 3TLAA 3PGVA 3FGNA 1GRRA 4UQPA 2AC7A 4BBPA 4ENPA 5HTOA 2JCSA 2Y6VA 1Q1GA 3Q3HA 1IN5A 1GO2A 4ITUA 4CLOB 3LVBA 3PXEA 3IJ5A 4TL9A 4KITB 1G55A 1LLUA 3O4VA 4PCVA 1DC4A 3WNZA 1R18A 1DXQA 4L3VA 1JHRA 4Y6OA 1P7YA 1G9XA 3K0EA 1PDWA 3AILA 2QBYA 1WP6A 4V3BA 2H1CA 2XUPA 1C7EA 1D1NA 3CZQA 4JYZA 2DBQA 3IDOA 2NUTA 2FN4A 2D0PB 2G63A 3R9XA 5GMOA 3CB4A 2Z83A 3AVVA 3GZ4A 5DSXA 2DWOA 4D8VA 2FEOA 3HKCA 3T7JA 1SEVA 3PWSA 3A1CA 4KQFA 5TEWA 2CD7A 3D1VA 3FPHA 3QE4A 4Y6QA 5T6MA 4KOEC 2A9KA 1UJBA 4EI9A 2XUZA 3QWBA 1ZGZA 3C5CA 2R7LA 3D59A 4TL6A 1CT9A 5EUBA 3INNA 5B4TA 5DNCA 5EHZA 2XCQA 4GLBA 3H18A 1DARA 4FYKA 1QWSA 3JALA 4MWTA 4LOIA 2IH5A 1PWZA 4G1EB 1X1QA 2HMSA 3QE3A 3GCWA 2VBUA 3I92A 3SFTA 1COZA 3GARA 3KV3O 4TSKA 3WXBA 1CVRA 1C3OB 4LRTB 5JMTA 5JPIA 4IGFA 5KTNA 4CKBB 2XOEA 3Q10A 3W2FA 2PU5A 2R65A 3NCTA 5F4OA 2A30A 1FNMA 2V7UA 4GEGA 1ORDA 4A23A 1GPWB 1LQUA 2XADA 3P2MA 5DLYA 3VPHA 5EY5B 4WCDA 5GADl 1M8GA 1HWYA 3C5VA 3H3XA 4IHJA 4ZVMA 3KB1A 1YI0A 3DE5X 3F1KA 5BN3A 4DKXA 3JVEA 1K7FB 1US8A 1Q9SA 2AI2A 1PIWA 1V5WA 2FZKA 2WT8A 4GWKA 4IUYA 4JLJA 1LS1A 2FG6C 1RLTA 3C41J 4HZIA 3UAOA 2GO1A 3I42A 3FWZA 3WTCA 1NF8A 3SIWA 3I55B 1U3WA 4KAAA 3TKYA 3SS9X 4EY3A 1TQ6A 3ZXUB 3Q4GA 3UGJA 2Q3MA 1E3JA 5BN1A 5SZHB 1PBTA 4DDUA 5A7GA 1BIFA 1UBKS 3ICVA 3QUTA 3NZEA 3C87A 2DBYA 3PFFA 1IQPA 4GKBA 3I76A 3ZK7A 3CPHA 1CF9A 4XGRA 4YNBA 2GPAA 1YGYA 1FYVA 4FE4A 2WJZB 3S8MA 4E46A 2COEA 1KH1A 1M2JA 4TS9A 3D7MA 3LLMA 2OK7A 3VU9A 1HQYE 3AIMA 1UC4B 3IA7A 3PNYA 3PEYA 2KM1A 3L7KA 5IJ9A 1L7PA 5LYJF 3TH5A 5JJ5A 1JAXA 1ZD5A 2VCEA 3QPDA 4TLDA 3K9WA 5AKKA 2VLIA 2ZB3A 1NG1A 1C7JA 3OMXA 2EVWX 3H83A 3EH2A 4RV5A 1R5JA 2CLOB 1HT3A 1C2YA 1D2CA 4W8OA 1D2RA 5CVVA 4RTJA 4ZALA 1MEOA 1Z0SA 4YRKA 3LBYA 1K7YA 2DKNA 4D79A 1EGVB 1WRBA 2XT0A 4CTJA 1L7VC 3IBFA 1YHYA 3R41A 3EXFB 4TTVA 5AYVA 3ADPA 4JLOA 3GBSA 2QTAA 3OBBA 2WSSA 1QB7A 3LQ4A 4ZEWA 3SEJA 4MVJD 4ZAWA 5T41A 3VZCA 1V2GA 2I1WA 5ECGC 4PTLA 1NVVQ 5EE9A 5FAXA 5HKLA 1YTUA 2FSUA 4OIMA 4RTPA 2W11A 4W5HA 1I32A 1T24A 1SVKA 3NDPA 4MICA 4PAQA 4BX3A 5A9SB 2VHUA 1EIWA 1BYIA 2RG1A 2RHMA 2CF6A 5JAQA 1KY5A 2CBGA 4LHSA 2CMGA 2PLWA 1WDTA 2JK1A 5ITWA 2J9ZB 3LBNA 2GZAA 3ZS9A 4BO9A 1ECBA 3P2JA 4XFDA 3U3KA 1GRNA 2AC4A 2XV1A 1O5IA 4Q24A 1KYWA 3AEQB 4RPDA 1FB5A 1Y4ZA 4TS4A 4WSOA 3DAOA 5E6SB 2PEYA 2X19A 4H0FA 1SIOA 3O4HA 2JHPA 5DK6A 2FVXA 5LMUB 3OZUA 5I3CA 4AMGA 1JDPA 4NZNA 1VIYA 2P3MA 1X70A 2XKBA 2YMPA 2F64A 4I19A 4I8XA 4PPYA 5HFJA 5F9MA 3OP4A 1XN1A 3W8NA 3SQXA 1Y3CE 1LKZA 4MLCA 2PWYA 2XCLA 4LZPA 3JYLA 4GR5A 1XJ0A 3FYUB 3QKWA 4JD5A 3ZWPA 4D3XA 4KTTE 1UWLA 4AUEA 1SXPA 1XZEA 2C07A 4KKVA 2F1RA 1FNBA 3GGJA 4LOHA 1FP1D 4HBZA 3EQ7A 3LE8A 1EUCB 2O8EB 2BRUA 3EVAA 4QOEA 3U13A 5KX5A 1IQRA 4P25A 1U7HA 2H08A 2QNBA 2C9CA 1WUKS 3PC4A 1Q3KA 2B8NA 2ONCA 1ZCAA 4O4JF 4J4TA 4KLRA 5LA6A 1DELA 4WNCA 3PQDA 1ZUD1 2Y2VA 4N82A 2FPRA 2WWHA 3TVYA 2GJRA 5T3UA 3EDMA 2J0QA 1G8KA 2IELA 4XR6A 2OWDA 1SCUB 2X6RA 3NT2A 5MN5A 4JMPA 3LTNC 1VMAA 3PC7A 1HDGO 3LDUA 3LQ2A 2JD2A 1EMDA 2OUIA 2PS3A 3GRZA 3MFQA 1BEUB 4KBYA 2YVUA 2ZUVA 4LQ4A 1KERA 1SCBA 1TKAA 4DLSA 2ZREA 4FLFA 3SYKA 3WHKA 3A1VA 1M34E 1JA1A 2O7VA 3H9CA 3NTVA 4WFKA 5FHRA 1A27A 4GLJA 3VDXA 2WKRA 3EGXA 2O57A 3OPVA 2BJHA 1GNLA 4NZ9A 3DT9A 5J59A 3WKBA 4BMOB 5KNCD 3TTXA 3L7BA 3TPCA 3NB0A 2FOXA 3MWDB 2HK6A 1CZLA 3ELYA 1XYYA 3KLNA 5FWYB 1PQYA 3N70A 1CZOA 1B43A 2BSAA 1ZY2A 3AGQA 4G8BA 4AZ3B 4R3WA 1BS2A 4CKCB 4IDHA 3FDZA 4XX0A 5HOEA 3ZLJA 1JQEA 2LP4Y 1VLVA 3O83A 3P9IA 4ZQEA 1GIAA 1H2BA 1F5SA 3NHJA 3C8DA 4ZPJA 5JHGB 5L45A 1U4NA 4P4TA 5AVYA 2ZVQX 4DREA 3TQIA 4Y0AA 4QJ3A 2R8YA 1YI2B 2Q9AA 2YJ4A 3M6WA 1UZNA 2HSGA 4XJTA 4BLUA 3Q0IA 4I3FA 4BYGA 4IRXA 4OXYA 1E3EA 3ZX4A 5EXTA 3G0IA 4ZO4A 2GCGA 2WSBA 1SUIA 1BU8A 1LPPA 2C5GA 3R5XA 1MZVA 1EE9A 4FFNA 3EAFA 4E13A 3ZD6A 4JLBA 4QDZA 1GWNA 4B75A 3CYFA 4NENB 3K70B 4JLPA 2NV6A 1XE3A 3AVPA 4GOKA 3NJRA 4ZD6A 2HEGA 4EW6A 1SOMA 2X5XA 3FROA 4CI0B 4RPGA 3M5WA 2F43A 1XVTA 3GN2A 4HNUA 1XPOA 4G0UA 2HT1A 3FDIA 1BVRA 1JIJA 5EINA 3WR5A 2OXFA 2VSXA 2QNRA 4L4UA 5DNVA 5A05A 5LDDC 4LS3A 4R8VA 1HM5A 1OLSB 4ZVVA 3TNLA 4G09A 1R4MB 1EUDB 3C43A 4KYTA 3NAMA 3UYKA 2Z1NA 1ZW6A 3B3AA 3DEAA 1FQJA 1DZIA 3DEFA 3HBFA 5KWJA 5GV8A 3KKZA 4LJRA 5EMLA 1E0SA 1V43A 1WL8A 3E53A 3IPRA 4J1QA 2QVZX 1OROA 3G05A 1U4SA 3BMOB 3H65A 3OO1A 3ENQA 1HQKA 4FEYA 4HQNA 5L7YA 4W7HA 3WGTA 4I9HA 4IDEA 1EK5A 4N8DA 4CCAA 1RVDA 4HBGA 5DTIA 5DYWA 3IB3A 3OEEA 2X5OA 3K0CA 1EBUA 3H5RA 5EKXA 5LQKA 3C5HA 4WN9A 5LIPA 4PY2A 5ABPA 4ALIA 2J3JA 3C3BA 3HM2A 3TB6A 3NMUF 4YROA 4CE6A 4FXOA 1RKXA 5BSXA 1L7EA 4CIDA 1KZ9A 2BEWA 3G2PA 1DPGA 1E1QD 4DQ0A 1DBSA 3HU5A 3GCXA 1LBEA 1F7UA 4YRMA 5KDOA 4IFBA 1II0A 4QELA 5GZ3A 5B37A 1YBHA 2XQVA 5KQLA 1XMJA 2O0MA 1W87A 1M2KA 1Q1ZA 2EWWA 1ZJ5A 4WKCA 5L3ZA 1MIHA 1E96A 4RM2A 4ENRA 5LMCA 1CXZA 3DZDA 4LJAA 2FPWA 3FKJA 3EMKA 1G3QA 1OFVA 2JAHA 3OLVA 4IJUA 4FDUA 3LL4A 5I7AA 4ROXA 2OLJA 2Z2XA 1EI9A 3BZWA 1RAGA 2G25A 2ZVJA 2AHRA 4Z1MD 3FPBA 4FKMA 4W99A 4BGUA 1F8UA 4FGWA 2J5KA 1HBJA 3MTEA 3VC1A 4Q7LA 4PG6A 1FUIA 4B0OA 4EB3A 4MWGA 4L6AA 4EJFA 2E1RA 3ESXA 5EVCA 421PA 2V9CA 4DLWA 1B0UA 5ALNA 1UXOA 3WGMA 4DYVA 3LK6A 4F2HA 1PJ4A 1VBKA 1G66A 4X06A 2WA1A 3G0BA 3LHKA 4HDSB 4V38A 2VTBA 3OFND 4L5AA 4OLJA 3A4LA 4KR6A 4PC3A 3FZQA 2JAWA 4CTMA 1IFXA 1PVOA 1UMDA 3O21A 2JJQA 4V2IA 1WZIA 1RI2A 2A5JA 2W8ZA 3DBHB 3RS5A 3GAZA 3HWWA 2EBUA 5I9BA 3TZHA 1FTNA 2DUWA 1DBRA 2OCDA 3VO1A 1ZU5A 1MC4A 4FT4A 4PZDA 5AVJA 3WL8A 1WABA 2OAGA 3ABZA 1FJHA 5IM4A 3NOVA 5KTOA 3AVXA 4Y7DA 3SFZA 3U4CA 5B4UA 1M2VA 3F6CA 1TGYA 5J3OA 3VPDA 2QT9A 3VOSA 3ZW7A 3RBZA 4MA0A 2B8WA 2OGTA 5B53A 4OLFA 2X8AA 3IP9A 2AJDA 1VHOA 1UP6A 1OZAA 2GZHA 1QDUA 3ELDA 3K0HA 4XSVA 4Y67A 3SDBA 1PZFA 4N01A 3SIXA 3V6MA 2PH5A 1EDEA 1NBEA 1E2UA 2Z6AA 3IR5A 4RXMA 4GL2A 7REQB 2PCJA 3O6VA 2A5GA 2CFSA 2REBA 2BJVA 3I8SA 1OLUA 1XWIA 4MS3B 3DHWC 5F35A 1PV4A 2QM3A 2WZCA 1JAZA 2VDKB 1W94A 2FSIA 2VP5A 3CT6A 4QOFA 1QAOA 4DEVA 2EJWA 2QNIA 2BSXA 2C2ZA 1UPBA 1IULA 3AFOA 4IR7A 2ORIA 4JUIA 2OFFA 3L77A 3F98A 1BDMA 3EVFA 1KKUA 4CKXA 1E18A 2NP7A 3CESA 1UBRS 1VG9B 3QQPA 3VRHA 4Q9AA 4HMPA 5AUQA 5EERA 4OQEA 1SVNA 5TRDA 2HNBA 2ZZNA 3G7UA 3B36A 3S5JA 3HJUA 3B70A 2YVAA 5F5NA 4Q4AB 4Q6BA 2GBLC 4X90A 2J5BA 4HZGA 1L4KA 1PFKA 3MB8A 3NHRA 1CHNA 3PD1A 1KQ3A 1YL5A 1JHXA 2I4OA 2QS9A 5KNDA 2HRCA 3NOXA 3HL0A 3ONFA 3C5WP 1VLYA 2OHIA 2B34A 2ZRJA 4W63A 1Z4QA 3C6QA 4FYVA 3H94A 4MSUA 2HZ7A 5BQFA 2IXAA 3HTXA 4EVSA 2CL0X 2J7KA 3OKCA 5KVQA 2H3EA 2OCLA 5EP3A 3TSAA 4EPTA 3FBWA 1HE2A 4F85A 1YONA 1OJLA 2IL1A 3ZZNA 5BORA 1X1EA 4CGZA 3HV0A 4O2BA 3K1JA 1NBHA 2D2IA 1I1NA 3NEAA 4EJSA 3SKBA 3ITNA 2EFEB 5CA0F 3Q3EA 4PSUA 2XSZA 4JK3A 5KS2A 5BQ5A 3FUTA 3N0TA 2QTGA 3LT2A 1YHNA 4C3OB 2VKTA 3SHVA 3M4XA 4M9RA 4X8HA 1MX9A 4TRNA 4Y30A 1GTVA 5AKEA 2G8LA 5CDFE 4Y2GA 1SZCA 2DECA 5JSUA 4ZEVA 3THRA 1O0BA 5BSEA 5MDHA 2WG0A 1YK1A 2WMYA 3A4TA 1U2RA 3FNEA 3WQSB 4XIYA 3CUUA 2G77B 3AWIA 1YRBA 1NXPA 1Y7HA 2VF7A 1QJ4A 3LZDA 4UEOA 1RBYA 3GLTA 1USGA 4L8JA 2J30A 2G5GX 3IPYA 4N03A 3U56A 1ML3A 3O3OB 4I9NA 5DM1A 2ZK7A 3A1TA 2NW6A 3LU1A 1XTQA 2A1IA 2IDKA 2PQ2A 1NJ8A 2JW5A 4IRMA 5CVJA 5G0UA 3L49A 1FYEA 5B57C 3PT5A 1PLKA 5JQGF 2Q3CA 4K8OA 1VQ9B 3GP3A 4K81B 4CT0A 5CT5A 1VMDA 4KN9S 4YMIA 4ZAGA 4AJIA 1NLMA 1ZI8A 5BSYA 1AK9A 1I2BA 1DRJA 1MDFA 4ZOAA 1SUEA 2VJPA 2YNMD 3GA5A 3NJ4A 3AY0A 3IT0A 4Q9NA 5CM9C 5FI3A 3S2GA 3GEGA 4LN1A 1GCOA 3MXOA 3C3EA 4RLZA 1M75A 4PXYA 2GD1O 1OLXB 3R6KA 2PY6A 2YS7A 3EIQA 4QFDA 5COAA 2ROQA 4EGAA 4Q9KA 1XCLA 2XMDA 4D82A 1O6FA 3N2GB 1ONPA 3BL6A 1KGDA 3GD5A 1GL9B 4M8LA 5AK6A 3A14A 4DA6A 1M1YA 3IXLA 4FDLA 2ODTX 1YITB 3LFHA 5BWOA 8OHMA 4N41A 3AEZA 3E7PA 1NU8A 2IKSA 5I4BA 1HE1C 3REQA 6REQB 1G2OA 1UDXA 5AK4A 2BR5A 4HGOA 5E6SA 3SEZA 1MT3A 1K0UA 4B87A 2EC5A 4R2HA 4WA8A 2R60A 3F4KA 2AE1A 5G0TA 1KS9A 2Y3IA 2Q7DA 4DRYA 1YRYE 4OPOA 5G4KA 3I0ZA 1PF7E 2H1HA 1PJTA 4MW9A 4PHFA 4ROSA 3CC2B 2QQ5A 2FSGA 3G68A 1ISIA 3A58B 2A0YA 3C7KA 1WWKA 1M3SA 4HN2A 1VJ0A 4LDZA 4GSYA 3R76A 3AY7A 3TNJA 5CH5A 1T4BA 1YA4A 1EFVB 2XI4A 1GQRA 1TEHA 2H00A 1MO6A 1GUDA 4HXFB 4IIHA 2DH5A 1SC1A 3K2IA 1JEDA 3VISA 3EBLA 3EARA 1U1FA 3RB8A 3RIEA 5KHLB 2JL1A 1GDTA 1XTKA 2BGMA 1UDBA 4KXVA 4MYRA 1UD2A 3C7CB 4XA8A 4II3A 5EIOA 4B7CA 4C3ZA 5ETJA 4IJKA 4CV3A 2ZTHA 3WB9A 4EB0A 5FEUA 1VC2A 2B4YA 3FMVA 3MWLA 3IE1A 5AW5A 1ID1A 2A33A 1W0JD 3RTAA 4I1PA 2A1UB 1M6WA 4IV8A 4J0CA 4J0DA 4EYQA 1KJIA 2LRHA 1K8XB 4EECA 1V8BA 1AS2A 4EBBA 4J0GA 1ZOLA 3CN7A 1ENOA 1T2FA 2WMDA 3CSSA 1AD2A 4LY0A 4MITA 4Z3KA 4KQKA 5ALSA 4YV2A 3T5PA 3W2TA 4HNGA 3B6ZA 3ROPA 3U3XA 3FPGA 1XKLA 4JGGA 1O6GA 3DXXA 4QXAA 2XWJI 1THGA 4W1PA 1R0XA 4XIJA 1B6SA 3RYIB 2FMKA 5DZSA 1XTSA 2W2LA 1E9BA 2WD8A 5HE8A 5BQXA 1CYEA 5L7WA 2VWQA 5JEEA 5CP8A 2P8JA 4RHCA 5E6RB 2H07A 3HUTA 3RARA 1OBCA 4AY6A 1TZKA 3ASVA 5JV5A 2QTVB 4CVNA 1L9KA 1AKRA 2AYZA 2WT4A 3TECE 2VNIA 4DDWA 3JX9A 1EFRA 1B8NA 1CS0A 4IHKA 4QU8A 3FNIA 1NZFA 3II6X 3TGPA 1U7XA 5F4MA 3DL7A 4U3JB 1O8BA 4JT9A 3RRZA 1X1RA 3GFTA 4J0KA 5LBTA 4FE7A 2OA0A 1L6RA 2X86A 1XQXA 4NULA 1WPQA 3V4ZA 1U8XX 2ECKA 4XD7D 1M6NA 4D0RA 2POCA 4MWBA 3L05A 2UUAB 3EGOA 3KKMA 2ET6A 1DINA 1DUVG 1MA0A 4U00A 2PNJA 1K5HA 2NUAB 3VTAA 3MK31 4RVUA 2J3IA 4PX2A 3U7QB 4EA7A 4BLRA 1UKVY 1P17A 4X94A 1Z2DA 2WDZA 3QEMA 3NXKA 4KVAA 4DR7B 3SC3A 4B3IA 1KFCB 3FSEA 5JO0A 3O8QA 3T95A 4AQDA 4DLVA 3ZVMA 4GZ3A 4D3FA 4DY4A 1QGAA 4EDFA 4JBWA 1E5VA 1Z5UA 2NTVA 5DM4A 2B1QA 3U4DA 2EF1A 3EPHA 1H1DA 2PL1A 2Z56A 4AKEA 2IBMA 5FA5A 3KE9A 3TUZC 4CEHB 1W30A 1BGVA 3D8TA 3DCNA 3DFIA 4I99A 2HWUA 1NJ6A 3GUZA 3TW4A 3CLSC 3VZRA 1IN7A 1T6ZA 3OZCA 4NOMA 3TDKA 2LIPA 3PNMA 5FOWA 3HLKA 5B3AA 1F8GA 2W6OA 2B7LA 1QIGA 3HYLA 3D8UA 4W1QA 1JVSA 4DKJA 1OFUX 3N9IA 2WJYA 1QUFA 1I24A 4U6NA 3UMSA 3K73O 3D4NA 2YXBA 4QOJA 2R751 4B9AA 4G24A 1BMFA 4YRPA 4QXQA 2R6AA 3W5UA 5CTJA 2J4DA 3CUSA 5BO5A 4LXHA 4BNKA 1D4AA 2C83A 4DXDA 3QE2A 1AZTA 1N8TA 2WFZA 3SYTA 2OHVA 2D3WA 3LL7A 3BDVA 4ISBA 1M6VB 4FFPA 2JJ2D 3H1TA 1CVLA 4UHJA 5ANRB 5BRNA 4BQSA 1UINA 2PUHA 4OOVA 3OC6A 4MVXA 2VDVE 1EPUA 4LRYA 1PJCA 3LDAA 4Z9AA 4ITRC 2A1TR 1FMTA 1UM8A 3H0KA 4R1PA 4UMDA 2M5SA 2DERA 2O07A 1M2EA 2FGJA 1N3LA 4WE3A 1HI9A 1N9GA 2WT9A 1C1XA 2X7JA 3CZPA 4GAEA 2QD3A 2VQEB 3UWPA 3QIAA 2UU9B 3ICEA 4OXIA 1QGED 3R6LA 3LX8A 3JR3A 3AJAA 5L46A 1XAJA 3KBBA 1JWAB 4I14A 3K2QA 1YRLA 3O1JC 3ICCA 3RADC 3Q9LA 2JJ1A 5IX8A 5JU6A 5JRJA 4D02A 4OKNA 1C3EA 3QMPA 1XEWX 3BHNA 4WBXC 3OF3A 2PRIA 3UOWA 2AOVA 1JE1A 1KEWA 1W581 1AHHA 1HDOA 2PRKA 1ISMA 1XTZA 4MTLA 4RK7A 2E3JA 4TTRA 3E48A 1IZ0A 1SAYA 3JQAD 5JD3A 2ADMA 1TOAA 5BNWA 4IJQA 2O5EA 3G1TA 4UFPA 2ONKA 5J63A 4RABA 4AUKA 4RJTA 3BFXA 1R5OA 4BRSA 1EGQA 3N7TA 1UBJS 4BJ3A 2YHSA 4BB9A 3ZY3A 1DHRA 4WJZA 4EPWA 5JCPA 5KB3A 5IEJA 1FFYA 2XLBA 5DN6A 4RA9B 2CHVA 1NIPA 3EWAA 4DIFA 1LDEA 4PG8A 1US8B 3COWA 4O2LA 1NURA 2F59A 4HCJA 4OHPA 4OA5A 3ZWKA 1BE0A 4MYTA 1GUBA 5GONA 1QC5B 4QVIA 5BN3B 5JXWA 2BWJA 4P2GA 5CDTA 2RCNA 4MVWA 1RAEA 2ORED 1UP7A 2AW5A 4IS3A 1G3IA 1G21B 1MX1A 3MLBA 4WZAE 5MN4A 1Z15A 1PJ2A 2XGOA 2XE4A 5BOSB 1V6CA 5H8WA 5ALGA 2OAQ1 3IB6A 4QAQA 4Y2HA 2HCJB 4YRSA 1ZD2P 1YX2A 2R97A 4OQNA 2X9QA 3MNFA 4NG4A 2AQKA 1NKTA 2DY0A 3HYNA 4UXJA 4I55F 5JS6A 3ZDBA 3G9UA 2V7XA 4B0PA 4G37A 5B7NA 3AT1A 3A7EA 1TQ2A 1XFDA 3QWAA 3OZXA 4ZAYA 1NHGA 1N33B 2ZUSA 4JR1A 3M9WA 5DO9A 5ALKA 4XVHA 4TSFD 5EP2A 1J21A 3L5KA 1BROA 5FFFA 3EEIA 5HDQA 3ZCTA 4BE9A 2Q3LA 1Q1AA 2BM1A 4LJSA 2WLTA 1T3GA 1NY5A 4C07A 4EYSA 5BUSA 3K70D 3UY4A 2X22A 4TTIA 3TBHA 3AI3A 2JZOA 4WFQA 1T34A 5AVSA 1P39A 1VDMA 2P77A 16PKA 2IVZA 2BGIA 4G0XA 1FS6A 4UDNA 2C0CA 2XYPA 3LW7A 2NUTB 4A2PA 2PFGA 1Y3FE 1ZSYA 3R0VA 1J6UA 1C8KA 1K8QA 3WNDA 1M34A 1V2HE 2C3PA 3LV8A 2ZQZA 3M1YA 4QARA 3FFAA 3U1BA 4YRGA 3HSSA 3TR6A 1O4VA 1XEXA 2C4NA 2Q4TA 3P71T 3FMGA 3N2LA 1HY3A 3EG9A 3THYA 4H60A 1V5EA 1N2GA 4F21A 1IVSA 1QVGB 3LZCA 1DB3A 4MRMA 5LP1A 4HZUA 3OPOA 3CWQA 3ICWA 5ED4A 1FU8A 1PTJA 4OXNA 3F3SA 1M6VA 4F8YA 5KWSA 1NXTA 1OZ0A 1AUVA 3IOMA 4URHA 5ERGB 3A1PA 2OKCA 5J5AA 2HK7A 3EA4A 2PBZA 2P2GA 5EFZA 3DE7X 4GI7A 2A78A 4CM5A 1ZQ9A 3TXYA 1X7YB 4DEYA 1IHYA 3WYEA 2JIMA 4HDRA 4RL6A 1Z63A 2IPOA 1R0CA 1DMRA 1LDBA 1V6SA 4HYYA 3T0IA 5CURA 1J1UA 2DU8A 1NR1A 2QRKA 2UVDA 4EKEA 4HO1X 4EITA 2W2XA 3IEKA 2IP2A 1Y7TA 2CXHA 1CR1A 4FYIA 1W0CA 3DOUA 4OCZA 2DR3A 2X4GA 1FNNA 1P7WA 1RM5A 4C7KA 5AHKA 2GM4A 4QBKA 2NO1A 4XKJA 2JDID 1U2QA 2IF0A 1SBIA 1LVUA 3I53A 2DKOA 1LLCA 1ZC3A 3KEMA 5EZYB 5BVHB 4RF3A 5IYZB 2VDOB 2D1FA 1MXFA 2HU7A 3Q72A 4QGBA 1W5BA 1PKEA 1RLIA 1OKKD 3CX8A 3K1AB 2BZ1A 4KVZA 4S12A 5M5BA 5BYKA 3FOAA 3OZBA 5CLFA 1U3UA 2ZYWX 4OBEA 3KEGA 3FKSA 1TCCA 1N8KA 1FUKA 3EDOA 5KNDH 5CNKA 4C9BA 1GSHA 2E9SA 3D3NA 1NN0A 1SG0A 4YRDA 4DAOA 5DEOA 1ZRHA 3BGIA 4F1WA 1TUIA 4CNQA 4MOWA 4S04A 1LDMA 3KQNA 1H6CA 1LK5A 2Y1DA 1VIAA 1YR2A 3BCSA 3M4NA 5AOBA 4ZU1X 3P9XA 4DL9A 3G5LA 5ELXA 2SKDA 2VNJA 2R6R1 2YFYA 4P2BA 3E4DA 1G38A 4WCFC 3LUJA 3U44A 1W36D 2YWHA 4P26A 2WVHA 1RPJA 2P7HA 3GPBA 5JRDS 5MGBA 5FO1A 3CCUB 3U16A 1VPTA 1JSCA 3VYVA 1X1DA 1JF8A 2G72A 3Q9UA 3VVBA 1F2DA 4LTDA 4YRAA 3QEAZ 4K9QA 4TS1A 5LOVA 1RVV1 1CLUA 5A9SA 1ZK0A 3EUWA 4TXNA 3I37X 3QNWA 2IYTA 5I8WA 4WQMA 2J32A 3LF1A 4G1VA 5L3QA 3M6VA 4AYTA 4YCBA 2IY7A 1GR1A 2X8JA 4YCSA 3OU6A 3UJ8A 1H8EA 5FUWA 3DOIA 2X6YA 1OW3B 1XT6A 5AKHA 2BPOA 4NZZA 4CIVA 3O3NB 1S3IA 4LNUB 1A5ZA 1IN8A 2IW1A 3HA7A 4GC9A 2SHKA 3SAJA 2IYWA 2JFZA 2ZJ6A 1L7OA 3DAPA 5EPEA 5H1YA 1LZKA 1U0RA 2PX4A 4WA7A 5A3VA 1K8RA 4B3HA 4E5KA 1QU3A 5AJZA 1E9VA 1UQRA 1PO7A 1V7QA 2Z04A 2PSJA 3NDIA 1N0HA 2C8LA 3GJ6A 3NI2A 2BE9A 4G9EA 1KE1A 3TL2A 3R0IA 4HVAA 3F4LA 1I5RA 3H1BA 1NXVA 3IVCA 4CIXA 4DPMA 3N1UA 1TRKA 1WB4A 4R9VA 5IJWA 2IZ1A 2OBXA 2H6EA 4KC0A 5ALVA 2IS2A 3KFXA 4YJHB 1TZBA 4GPAA 2PUFA 5IFKA 1G6Q1 1XDGA 1XHLA 3AHJA 4PO3X 4JAVC 1HPLA 2GXAA 4OYYA 1B0PA 1QG0A 1XN4A 4ZXPA 5FORA 3GZNA 2H7VA 4MYSA 2DIEA 3OETA 5CBPA 4YMTA 4IVQA 3HV2A 3KT6A 3RSCA 3PF8A 2R85A 1Y6RA 3IQIX 4N4AA 1RHUA 3REQB 4OXQA 3SFVA 4W4TA 1YOBA 3GJXC 4DTCA 1W4LA 3TRDA 5MF6A 2J9XB 4ZODA 2F1JA 5DE3A 2FKAA 1ADBA 3IIKA 1QWOA 3RSFA 3R4CA 4OJYA 2JFFA 3JQ7B 2NVUA 3RUIA 2Q6LA 4MDHA 2VTBB 1K7EB 2AUMA 4INPA 2GPNA 3B6IA 2HIMA 4KSBA 4EKIA 3HO6A 2H2IA 4G4SP 4R16A 2L42A 3SSOA 3S4YA 1GKUB 1KO7A 1SULA 2I3DA 5IVIA 1P9NA 3OKFA 5C5CA 3NEJA 2IOQA 1GGJA 3BK2A 1R8XA 3GUHA 3W5JA 3KCQA 3TN7A 2PUCA 2W90A 3UEOA 3G02A 4IDDA 2HSZA 3IVAA 1HFKA 5B1DA 3GVLA 5CFOA 5C1IA 3AFIA 2WMNB 5F7OA 3H9JA 3PFWO 2QAJA 2FUKA 1WB5A 2BTQB 1RBQA 2Q6KA 4FMDF 4RK4A 1XZJA 3ELWA 4K1XA 1CR6A 1TAGA 2H85A 3FR8A 3VO2A 1B4DA 3T9BA 5L3SB 3L4SO 1K89A 3O9VA 1SUCA 4KO8A 2G04A 3ZWDA 1UK8A 4CZ2A 1JG3A 3SMQA 3TO5A 3LKVA 3PJFA 3UMJA 4BVEA 1LV8A 5GP1A 1PUIA 3WWPA 2EFGA 4MQ5A 2ID9A 3PDJA 1CYDA 3AVOA 3EPPA 5CLHA 2YWRA 5DYNA 3BMCB 4EGCB 4DJJA 2JAQA 4BFUA 1OB5A 8ATCA 1X7YA 4EELA 3LQ6A 2BI8A 2CSXA 1SRRA 4GOXA 1N9KA 5FTJA 4LY9A 4OOXA 3LXUX 4HGQA 4NHOA 3ZZTA 4UUAA 4YA6A 2ZRHA 4I81A 5E6UA 3VYUB 4Z49A 2XYRA 2Y4OA 2LWIA 1BH2A 1C0PA 2R8ZA 1CK4A 2ZKIA 4COKA 4MR7B 2C92A 1SKQA 2J5XA 4FD3A 1JZSA 2Z1DA 3KZMA 1UR5A 3OY2A 3C4QA 4NQZA 5JAMA 1DOZA 2GPBA 3SZUA 1AE1A 4GYWA 3N5CA 4O25A 4HEJA 3OZTA 3UWSA 4F3TA 1KC3A 2OXTA 2ZT5A 1NP3A 2DH6A 3EDQA 1ZMXA 3VH1A 2FJ0A 4BIIA 4IMRA 1Q15A 4CIWA 2OHFA 2CB9A 4YEDA 1R8YA 1WXDA 1RYDA 4WNAA 3C6ZA 5TDHA 3ONNA 1YO6A 4C2UA 1G20B 1FRNA 1QKIA 3CCRB 3BSYA 3WZLA 4EARA 5A1TA 3G2MA 2ZZFA 3CU5A 4MWZA 3WWEA 3KWLA 4MQUA 4YEJA 2X76A 3H8JA 1YZHA 4B83A 4TT3A 3OQMA 2V6GA 3ZN2A 1ADYA 4NEGA 3SWWA 1O4WA 4BB5A 4BGDA 5AQEA 1U2ZA 3WYNA 1V45E 2VEDA 1Y8QB 1S8AA 4E4RA 1M1UA 1HZZA 1QR2A 1K63A 2YY5A 2E4UA 3SIPA 3KAKA 1K6JA 1WSVA 1PYDA 1HRDA 3FF4A 1Z7YA 1XA3A 4KQIA 4AECA 5AW7A 5JNUA 1Z4IA 4JL8A 2REQA 1I3OA 4YIKA 5A4KA 1JV2B 3GH1A 1J23A 5B1IA 5FPTA 2FPKA 4AY5A 1JR3E 1QE3A 2OZPA 1DJPA 4DR2B 2IH4A 1EFCA 5F4ZA 4BQRA 1KI6B 1ZM7A 2AZTA 4INAA 3NBFA 4JKIA 2H92A 1A69A 1DXYA 2A5DA 1WEKA 3F71A 3O8DA 1DBIA 1T1EA 2G5PA 2Y71A 2O4UX 5IC6A 1SBHA 3T1YB 3DLTA 2PSDA 1JFVA 3JASA 2Q21A 2VWHA 1IONA 3FDZB 4XX0B 3A1UA 3D1JA 3MG9A 5H0IA 4OYLA 1GOTA 3ZXYA 5ALRA 3NDRA 4PCAA 3TFOA 2BEVA 1A97A 3HB9A 4ZQFA 2KLHA 4BMNA 2PKQP 1NUHA 2VJLA 3GV0A 3NOOA 4RKYA 1ZUIA 1JPNA 3SLRA 2JASA 5CLLA 4TLBA 4W6ZA 4BRWA 5LJIA 1ESNA 5BMOA 2O4CA 2Y93A 9ATCA 3T7IA 3JQGA 1X1CA 1R15A 1J1IA 1M8FA 3V8MA 4OOSA 3H1EA 5K8CA 1FP2A 4MR9B 2AMVA 4Z4VA 5CGZA 5F76A 4GVLA 3PUNA 1BC5A 1T0IA 1VQ1A 3IMCA 5GWXA 4PTZA 1E3SA 1QZZA 2GYUA 2AEEA 4M1QA 1TVMA 1W2HA 3TXAA 1NNEA 2XQFA 4MCAA 4UBJA 2CV2A 1VE6A 5U4XA 1IM5A 2R8EA 5FOXA 4M9ZA 1TZMA 1YBVA 3OFJA 3ISTA 1LSSA 1R66A 1SJ9A 2OYNA 2I6UA 3JD4A 4GOOD 5K45A 4G1CA 2ZT8A 4IIJB 2FSVA 5TRTA 3G2LA 2G5CA 2PD6A 4ARIA 3H0EA 4UE6A 1M76A 2H1LA 3ZDYB 3MHPA 4A8JA 4R7TA 1O58A 4HDKB 1HTBA 1Y8CA 3C7DB 1IEWA 2IXBA 2PHZA 4WZTA 5EIBD 3Q98A 2IP1A 2QX6A 2VDJA 4O4IB 1P2GA 2BCJQ 4NCKA 1Q81D 1UBFA 4PEVA 4PM4A 4MQMA 3RAGA 2XD9A 1GCGA 4NFSA 5AK3A 2GCOB 3UJPA 3HM9A 1S2DA 3CEAA 3FWKA 4OJKA 1DBQA 1KYVA 1RP1A 3KAJA 2A92A 5D86A 1RLOA 4UAJA 1Q0RA 3DAHA 3DDUA 4F5ZA 2ODEA 2Q41A 5FWDA 4UUMA 5BSKA 4AXXA 1OBFO 4I5FA 1OI4A 2V0NA 4NTZA 2PD4A 2VJMA 2O2XA 2ZAMA 5I51A 3CE6A 2PEZA 4FCVA 5J35A 4O59O 1GLVA 1I14A 1PAUA 2QJFA 2QQ0A 1Z4MA 2VDRB 2XXBA 3KD2A 3QI2A 4HLUC 1NW9B 2D1RA 5AOVA 3UW1A 4TKVB 4PLWA 4Z7NB 4CDRA 2FF7A 1IY8A 3EYAA 1U3VA 2FA9A 4HQFA 4E5UA 4R31A 5A06A 1KAHA 2OPHA 1IY9A 2JHGA 3OTGA 4L02A 2W00A 3DC2A 4HWRA 4DN6A 4Z1OA 1HG0A 1ZMOA 3IQXA 3LY7A 4Q3LA 4PLTA 3LT4A 1M72A 5BN4B 3WLPA 1ZAYA 3ORRA 4GQBA 2ZATA 2WJPA 4B7XA 3T3EA 2JGFA 4NBKA 4BO6A 2JJ8A 1VB3A 1KC8D 5JZMA 1C3VA 1D4FA 2WM2A 1XMSA 3LK7A 1QG6A 2EZ4A 2ZBDA 1WY7A 3V7YA 5BMVF 1YIOA 4ZEMA 3OFVA 1ZJ6A 3NP9A 2YIMA 4NIMA 1MTZA 2NSLA 2VZEA 1ZESA 2BP7B 4GNRA 4HV4A 1W1UA 4LZJA 5EJ9A 1EWYA 3R7LA 1CJVC 2HSDA 3HJCA 4GMXA 4RW0A 4HYTA 2QYTA 4XUGB 1FFSA 4D8XA 3I64A 3KR1A 3JZMA 2ZUWA 3G89A 4LGVA 1N08A 1Y5NA 1F2VA 1W47A 4MW7A 3G7SA 3M34A 5BT9A 5LD2B 2AOUB 2BL4A 3T7EA 1HRKA 1QJCA 3UTCA 2EBFX 4B09A 4YRLA 2NTYC 3DZJA 1HMPA 5JSZA 4DPLA 4I55B 2ASVA 3HEAA 4YB8A 5GIOE 5C8YA 1I4OA 1BFDA 4DK1A 1R6UA 3OSZA 3IO3A 2Z58A 4PFJA 2YN4A 1IK4A 3VDQA 3DDCA 3GPIA 4P92A 5JMOA 2VP9A 4JI6B 3T4EA 1YJQA 2I7XA 3WAJA 3OPYI 4ZTBA 1CNEA 4PX5A 1EFPA 2ZB8A 4HQKA 4E4YA 3QGMA 2HDNB 4GRAA 3D3KA 4BQOA 5KMGA 2F9LA 2WAXA 4DIMA 4QYTA 2Z2ZA 5ALZA 1F3LA 1U6IA 3RLIA 4YMHA 2ACWA 5HF5A 2Q50A 4HFNA 4L8VA 2WYIA 3HDTA 3VSAA 1JLMA 5AM3A 3T9AA 3CCQB 1Q1BA 3AKDA 1U8AA 2EWMA 3BEDA 3HUDA 2BI4A 4HEA6 1ZEMA 2G5TA 1WZNA 1A04A 4JITA 1GYQA 3PE3A 4DCGA 1G4UR 5JECA 3MMZA 2WZNA 4BPRA 3OE5A 1YHZA 5E95A 1EM6A 5D7NA 1F60A 2RHGB 2PGJA 2RGWA 3USCS 2XF2A 3OKPA 4I5DA 2WPDD 4F06A 4F0JA 1AHPA 3R09A 4YV0A 5EVJA 5FR2A 2SKEA 5A3QA 3IAFA 2H2GA 2PSHA 1YE8A 3DO6A 4PZ0A 2YVKA 1O87A 2EKQA 3IIJA 5BUQA 4E7PA 1Y1TA 2ZB2A 3SU8A 1NA5A 4F5DA 4D9CA 1HT0A 1NG9A 3VZSA 1OH7A 2O3SA 4QGHA 1GZ5A 3IUYA 1OILA 5KPDA 2HAEA 3MGAA 2OBRA 5I7OA 3DJFA 1M54A 3CR3C 1F4PA 2A9VA 2EEZA 4DIEA 3DTVD 3HXOA 1N2CE 2A9PA 2F9FA 1T4MA 1PS8A 3DLCA 4QTXA 3TVTA 5LQJA 1X0XA 1ULSA 3V4OA 5I7FA 5DM0A 2H1RA 3K5IA 2J6BA 4K9RA 4TV8F 5G4KB 4MHTA 1AA9A 2BONA 1KZ7B 4CQMA 4WOBA 3FJYA 1BWSA 1T5SA 4CNBA 4EHKA 2NO6A 4W5WA 1WV1A 4QRIA 2ZBFA 3GPLA 3BXFA 3MQFA 5I7UA 3IDAA 2PNFA 2JGJA 3T3NA 3PQ5A 1Z13A 2QZ9A 1M2NA 1OXBB 2B8EA 1XVLA 2RIRA 3H5IA 2VF5X 4Q48A 4YP7A 4CIAA 1Z37A 3CINA 4AMZA 4DQLA 3H5AA 4LK3A 1OVGA 3YASA 4BQIA 4FPXA 2PX6A 3H5TA 4MCIA 5AH0A 5HVNA 4CKWA 5DHPA 4UCFA 5L40A 1G9SA 2VBFA 4L72A 2HR1A 1YH3A 4KW7A 4HK4A 1JG1A 1GNVA 4M53A 2C9YA 3BJMA 1HOTA 5K8VA 2EDCA 4R2KA 2FFJA 2YXDA 1XELA 3X44A 2I2DA 5DHRA 3Q6QA 4EHBA 4IIGA 1GPJA 2HDWA 1J8MF 4V0KA 2FVGA 4A2CA 4N12A 4ENQA 1V0EA 3HVRA 1IEVA 4UBKA 1V7PC 2G3YA 4U7HA 1HDCA 3GP5A 2ZJBA 3OEED 3I2HA 1L7NA 2XB8A 5CB4A 5JQGA 3RKRA 4E51A 4J75A 3OJOA 1TTQB 5AVXA 1AQYA 4RD2A 5K0GA 1UCFA 1TYCA 5ADWA 1A9PA 1IYZA 5F73A 1KZLA 4UMEA 3VR0A 3WIDA 1I2MA 4A2WA 2AEFA 1OUMA 2CDCA 4KU4A 2VJJA 1LGYA 4J0IA 4UOQA 3R7SA 5LB2A 3OMLA 4HD8A 2DX7A 3O95A 1NJ2A 4R68A 2XW6A 2Q29A 3N8DA 4M8KA 5KUTA 2CF4A 4A03A 5CFMA 4U9UA 1UUFA 2RFLA 4PLVA 1H1LA 3AERA 4HAUA 3PQ4A 1RXWA 3OQOA 2OTLB 1C7FA 4P7BA 4KCGA 4QX6A 3RYFA 3GLIB 2PZGA 1H2FA 4W5QA 2ZDQA 5BSGA 2GJ9A 1YZGA 2GN8A 4FHFA 2WF7A 4IWYA 4PQRA 2HK9A 5CCDA 3S27A 1LPBB 2YJZA 2C77A 4FWIB 2EG5A 2H2FA 1S1MA 3HHPA 4W82A 3L0CA 5KOJB 1OAKA 4W9NC 4YK7A 3WMRA 2Q3BA 1IHPA 4PV7A 1BE8A 1Y1KE 2VOEA 3T7SA 3ZU5A 4FFLA 2GN6A 1ZH2A 2H65A 3KAPA 2VHTA 4QT0A 2V45A 4Y3UA 2CEKA 3DV0A 4RV9A 2XKJE 4MVJE 2E0IA 3D81A 3QVJA 4IVRA 5K4HA 2Y0CA 3OEHD 1QIFA 4G36A 3SE0A 5DP2A 1A9ZA 1JQ5A 4N0DA 1UPAA 1XCJA 3Q40A 4DSNA 1RPZA 4ENWA 2X23A 3DVQX 3I9V1 1ADCA 3QFRA 3KU4A 5INTA 4C0KA 4LJ8A 5LKAA 5GIPE 2EIHA 1MV5A 1SUWA 4IW3B 1KDOA 2R5FA 3LSYA 1K06A 3ODGA 2IWHA 3RS0A 4G0OA 1AQ6A 5EKSA 4Z4QA 3VNVA 4I2NA 4IOJA 3K9LA 5I8ZA 2XPCA 2X9VA 1A8HA 1KPGA 2AH5A 2BKEA 2VP3A 3S7ZA 2YWCA 4GF5A 3VU9B 1FTYA 5ESDA 2Z5VA 4E1AA 3L6CA 1FU7A 2XUKA 1E6LA 1ZBDA 3UMYA 2GILA 3G17A 5DS0A 2P68A 1TB4A 3EC1A 3ONWA 3G1WA 2PWAA 3H4VA 3DG9A 2IHJA 1UT8A 4YUYA 3WK8A 4HTFB 4TVOA 4W5OA 1GQQA 3A3BA 1Q74A 1JT2A 3GQBB 3I30X 5AKGA 2ZM6B 4QDJA 2D2FA 3EZNA 5CXUA 3EPJA 4KX5A 1V1JA 4MVJP 1C3LA 1RWWA 4FE3A 2VUHB 4L2IA 1NN5A 5EMKA 1EWQA 1B8PA 3QKSB 5D1HA 2O8DA 2YNMC 2AUTA 4XM1A 1H93A 1T91A 5DNDA 3VR6A 3AKCA 1XALA 4MW1A 5U1PA 4ZU6X 2VTKA 1Q1NA 1ULHA 2TMYA 2GO7A 3KQUA 2Q5LA 2DM6A 3L1IA 5D85A 3X1JA 4ZYZA 3PUVA 1P4GA 1W4CA 3U4IA 5CK4A 5F33A 5KZMB 4Z4IA 1G8SA 3TBFA 4CKEB 4WESB 4UAGA 2EZUA 5BPHA 4G5RA 4BASA 2QP9X 2O3JA 1Y6JA 3AJDA 4G41A 2J7PA 1SO8A 2GEUA 5I45A 2G0TA 2ZU6A 4YELA 1P5RA 3IE2A 2A9QA 3OAAD 4OP3A 3QPBA 4BVKA 2DQ4A 1EXVA 3PEVA 4RCZA 4II7A 1A9YA 2CKDA 1IZZA 1YFLA 4J7XA 3RRFA 5JSQA 4LI3X 5LQDA 3IUSA 1M2OB 3H2YA 3H4TA 1UMBA 3ROQA 1ZFNA 3HN6A 4IF4A 5J2TA 3GJZA 4XTCS 3MB5A 2RGNA 3WV5A 1TK9A 4YO8A 1I3NA 1Z0KA 1WXWA 1WE2A 1MQSA 1Q0QA 4YT5A 2AOTA 3QENA 2A4KA 1DOAA 5AR1A 1Q0HA 1NBIA 1U31A 3HBLA 4R51A 2HY7A 1YQWA 3WB2A 5I5EA 1YQGA 3HZZA 4OGWA 4X1IB 4XJSA 2YHUA 3KBOA 4EHHA 4UATA 4FFSA 3UCFA 4L5BA 3HACA 1ZIOA 2QD4A 3OJEA 2GAIA 4L0MA 5UKDA 3TZ6A 2WB4A 5K8JB 3NHKA 4M6WA 3VA7A 3VVMA 4J6FA 1KIFA 2AE2A 1XCGB 3UCEA 3MJHA 2JIRA 4P9NA 4JI7B 3ZOKA 4XEHA 5DSZA 1P18A 1FW8A 2NUAA 4XJVA 1XLTA 4JS0A 1WUTA 3C3XA 4HWTA 1V8ZA 4BQEA 2H18A 3PQCA 1XQ6A 3KETA 3ZX5A 3B20A 1GADO 3SR3A 4KWHA 4ED9A 2G08A 1IB6A 1BEZA 1MJFA 3BH0A 3H2JA 3VU8A 4CM4B 4IFEA 2O1WA 4OI0A 2GF9A 2VO1A 4JJZA 1FDWA 3NBZC 1JAIA 3GEBA 1E5TA 4Y1RB 4A0HA 5JSHA 4LC0A 1U8ZA 4LSGA 3UV3A 3RE1A 3WNQA 2E21A 3ZH2A 4Q4DA 2JZNA 4DR6B 1QIJA 3DC7A 1DAOA 1OY1A 1RKUA 3EASA 2C8VA 2H31A 3HJHA 2WIBA 1CUCA 2W70A 1AS0A 4NU6A 3EZ6A 5JH7A 4KFTA 3DKPA 2EWVA 3EWIA 1KFJB 1GG8A 2GA8A 3LNNA 3L6OO 5B7GA 3RTGA 5F7JA 1JIUA 1JH8A 3CRVA 2C5LA 3RS8A 3AIIA 4Q1FA 1U0LA 1V3QE 4AO8A 1VQNB 1M33A 4GBMA 1ZUWA 2SKCA 3MT8A 1POXA 4U2CA 3CCVB 2PIDA 2VSQA 2IHNA 2H0AA 2VRCA 5DTEA 5JMPA 4F84A 1OU0A 4MAAA 3TAUA 3AG5A 5FO0A 5F2OA 2OBMA 2D5LA 2HF2A 2H4JA 3IMEA 2JJYA 4QDKA 2A7QA 2OG1A 2X4IA 1XNQB 4LGMA 1JMYA 3O38A 2BBOA 5LZ8A 4M60A 4QJIA 5A0VA 3ER8A 5CR9A 2O7RA 4EKDA 4KR3A 1WUJS 1VM6A 2OAEA 1TAQA 2W9XA 5EUMA 3I05A 2DF8A 4KZPA 1AZLA 1IHDA 5DRTA 3UVEA 1GJRA 1A9XB 4BKPA 1DIAA 2XWBF 3NIBA 4YV7A 3TRHA 5IXYA 3DP7A 1RQRA 1K98A 4XVRA 2Q28A 3GLQA 1JECA 1P3JA 1XDUA 3L02A 4B4WA 4BMDA 3KO8A 1J8VA 1SK9A 1W4BA 4G1BA 1RYNA 4LZLA 4TWRA 4XXHA 2ZSIA 5L3VA 1KK2A 1F12A 5TQ0A 4ACBA 1XJWA 3K53A 1T2DA 4TZ0A 4HLQB 3BIOA 2IPNA 2DLDA 1KQOA 5JC1A 4PAWA 1YDWA 4UXIA 2V9ZA 1N1MA 4EZIA 3NKFA 5CXXA 2OORA 5AUOB 3OOCA 1CQZA 2KBEA 3C85A 3NQ41 3L8GA 4D4KA 1DUSA 3AZOA 2GNAA 1OYVA 3EVEA 3PEUA 2VYVA 4WK4B 3U4AA 4CETA 1DHTA 4XYBA 1DRKA 1J5XA 4X7EA 2C2YA 1YR8A 3I6MA 5F5LA 3UG6A 4Z7QB 5KTYA 5BOSA 4HWOA 3W06A 3HO1A 2XB6A 4LXGA 2Q4OA 3K0FB 3QKRA 3DV0B 1YZQA 4WN3A 2O2IA 4K40A 2I80A 3IEXA 4DLZA 2ZBEA 4Y2QA 4C88A 1FU4A 1WXQA 2WF6A 5DCYA 3LF2A 5FTMA 1KY2A 1NR5A 1V5IA 3U7FB 2WINI 4D3YA 4GXTA 2QQGA 4RVSA 2Q0SA 4YGXB 1KI7A 1QHFA 4OK6A 2BFFB 4W6QA 2XJ4A 5DH9A 4PZEA 1N77A 4ME6A 4HE6A 2C29D 5HZBA 1OA0A 1NM5C 2V98A 1J2JA 4WLNA 4F2DA 3SVLA 2C59A 5D7BA 5BSVA 2H1OA 3QEJA 2OP0A 3T5TA 2X6TA 3A0RB 4NDAA 2NZ2A 1TZCA 2JS7A 4AZSA 2KS6A 3IMKA 4JP5A 1ESCA 5JLAA 3IPLA 2H2DA 4ZC1A 2D9RA 5IU6A 2VUTA 4O3MA 1WP9A 1EK0A 3CUVA 4G5QA 4JKOA 3TIFA 4AIIA 4CFSA 1W9HA 5CA1B 1V39A 2HQRA 1CETA 5FL7A 3BY1A 2YBEA 5DHUA 3L9WA 1NLZA 3TLGA 3X1YA 4G0PA 4M54A 3NBYC 4EUSA 1OB2A 4LHYA 1CULC 1YWGO 1JKIA 2F9MA 4KWCA 5TQVA 5CX1B 1TUGA 3SQOA 3PL5A 1T0BA 4BCDA 1VSQA 4IVNA 4DWVA 5CCEA 4R9UC 2O8EA 1WMEA 3ES9A 2EX4A 2KPOA 2ZYUX 5ALOA 4DOMA 1TF7A 5MFZA 1RRCA 1WVGA 2DY1A 3Q11A 2V4DA 1NVKA 1BXRB 2BFPA 3AHEA 1XP8A 3O2NA 1W0JA 4LK2A 5EKDA 3UENA 3VH3A 3BNWA 2W71A 3PZBA 4TOIA 4MGZR 5LVAA 3DBRB 4X65B 3QH4A 3P2YA 4I3HA 2QUZA 2IYFA 3L04A 5I9MA 1NZDA 2LBPA 4XE5A 2Q1YA 3OOEA 1BMQA 3P20A 4ZI5A 3QYJA 2QA5A 2D8AA 2SCUB 4BP1A 4CBVA 2ZSEA 2M2IA 4PZYA 2EFDB 1T0HB 4RDKA 3AEQA 4A82A 4ZT5A 1FX0B 3I5XA 1DCFA 2C8JA 3CNEA 4UZSA 2CXUA 1ZNWA 4MAMA 3GLGB 3D3QA 2WAOA 1AXEA 1AXRA 2OO7A 4C4XA 5KSWB 3BWDD 1WCYA 1SXJB 2OORC 2PZLA 2WHPA 3H11A 4HXEB 4KTVE 4AG3A 3ZZUA 4QJ4A 3QLJA 2VHXA 4BQPA 1XR3A 5J40A 1EJ0A 5JXIA 4NH4A 5KTSA 2AC2A 3CCFA 1Y6FA 3ND9A 3PDUA 4B80A 1LJLA 3K0KA 2GEVA 3K9FC 1VXOA 5EIWA 3GVPA 3W05A 1KZ6A 4FZ5A 1X42A 4JJIA 2ECFA 2QMYA 4KE6A 2ZS9A 3ZHVA 1XVUA 5CA0B 1ND6A 1VHQA 5EEGA 5A5VA 3E3OA 2ZIWB 4IFIA 1CP2A 2XIJA 3D7NA 4G6ZA 6YASA 2WWGA 1J9GA 4FK8A 1EP1B 5F1YA 2QSZA 5KHAA 1GNQA 3R23A 5BV2P 1E5XA 2RB5A 2G8NA 1JQBA 1P73A 4I8IA 4LI0A 4LHZA 5IT4A 2XBMA 4RNCA 2I7DA 2O8DB 2FW9A 3B1XA 3BIFA 3NRBA 3I9NA 3CRRA 4F1KA 1R3UA 3FY4A 1GVHA 3PDIB 4U8GA 4UHFA 2R00A 3SZGA 2NSHA 2ATVA 3LY5A 1P0CA 121PA 1TM5E 4DSTA 4WX2B 2CK3A 4ZIRA 4JYPA 2ZYAA 1NVAA 5DB4A 1QHNA 2JZCA 1JEQA 3CLTD 4D9JA 5GTDA 3I83A 2OO5A 2TMKA 2FCRA 2R8RA 4IJ6A 2SCUA 1RR6A 3X0DA 3HXKA 2I1QA 5CVCA 5DI3A 3AR5A 1XZPA 5HEKA 2IUUA 2YMMA 3SHFA 3AV0B 4E94A 1TEVA 2OFOA 4PWYA 4KXLA 4N7JA 1E3WA 2XKAA 3DVAB 1AZSC 4AM8A 2CE2X 3AFGA 4HOYA 4LXUA 1N1DA 4NU0A 1W8DA 4M46A 2RC5A 3FETA 1IBLB 4QVGA 3O4RA 5TPZD 3Q3CA 1NVTA 3QBTA 1WCXA 1GITA 4U1RA 4EKYA 4O2BF 4BNNA 3I45A 4YCAA 4X20A 5C80A 1D0IA 4K26A 4QPDA 4RWZA 3VC7A 1QG4A 4J7CA 1TAHA 3TZQA 2PKCA 2ZR7A 4H6PA 3GLHB 4X1YB 3EULA 3EIOA 2OBTA 3E61A 5LPNA 1YS2X 2X5KO 5K3CA 1QANA 3FZNA 2H5LA 3EC2A 3MJRA 2IU0A 1Z4PX 4QOIA 3T53B 1N2CB 5LP6C 4FDAA 4KIFA 4DLUA 1VCIA 2P0EA 4NMWA 2QIPA 5JTUA 4BKOA 1EFVA 1R2QA 3DZIA 1DQSA 1L7BA 3PVDA 5AVTA 3E15A 1DFIA 3EE6A 1VMEA 3B82A 1IOZA 4P5DA 3CV3A 1LDGA 1A8QA 1OASA 4F60A 1DO2A 2CL5A 5IDQA 3FYHA 4XM3A 4V0RA 2PR7A 2X0NA 3Q3GE 4P22A 1SVUA 4BO3A 4NNJA 3FPSA 1ZWKA 2RGCA 3HLYA 2FZEA 4HPWA 4UMFA 1J2UA 1A5TA 5L7TA 1GXSA 3DOFA 5CDHA 2V31A 3GRCA 1B42A 3KSZO 2O2EA 3GHHA 3AI1A 3UWMA 3OM8A 1AZWA 1PQUA 4GR4A 1VPLA 2ZPAA 4CR6A 3CVYA 4IICA 4RS4A 4RZIA 3IAS6 5IAKA 5IDWA 4J76A 1OWOA 4KLZA 3J80A 4W8GA 1VQ5B 4ZANA 2J9FB 3DHEA 3P9PA 1T10A 1WUYA 2JBHA 4P5EA 1HDRA 3ND7A 2PQ0A 4HYQA 1EXMA 1QYCA 3AXSA 1UM9A 3EQ8A 3N6XA 5GM1A 3OEYA 3RYTC 1U3TA 5HQ3A 5KTTA 1UZMA 1Z8NA 3AQIA 4HIZA 1QOQB 3S55A 2WW8A 4D0NA 4A92A 2KJQA 1H0KA 2QZZA 5JO9A 1UFKA 1M10A 3CMCO 4ZRMA 4B32A 2PLAA 4H9GA 4XDGA 4BGVA 3BWEA 4UTZA 2GBLA 3RU7A 1NLYA 4DNQA 4R1MA 3BFVA 3PCRB 5HKKD 3HL4A 2IYZA 1H69A 3DDWA 1LPSA 1WU7A 3JRNA 3U9TA 2VH5R 4JWKA 2ZLBA 3WO1A 3O73A 1QR6A 2JGAA 3N2YA 2PWBA 2Q5IA 3LT0A 3TI7A 4NDNE 1T1RA 3RR2A 3KTOA 5J2TF 1EK2A 2WWRA 3OURA 5ALEA 1XKTA 4QG3A 2DQYA 1IZ8A 2G4LA 3BIWA 3BK1A 4NENA 5C1OA 2WUDA 4GEKA 4B6EA 2XUIA 3C8ZA 4JB0A 1ND5A 1VI5A 4QZVA 2PUAA 3ENKA 2MSCB 4F91B 3EODA 5EXPA 4GLFA 2RKBA 4LYYA 2VDWA 3W2HA 3QVOA 2RIPA 2VIIA 4BTVA 1YB7A 4P54A 4CG2A 3B1YA 1Y42X 2EV9A 3A6KA 4H7IA 4ASUD 1RLUA 1ZUNB 1RXYA 1ZCJA