4C43A

Ferredoxin nadp reductase mutant with glu 103 replaced by tyr, tyr 104 replaced by phe, ser 109 replaced by phe and gly 110 replaced by pro (e103y-y104f-s109f-g110p)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLYFKHPEFPETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title External Loops at the Ferredoxin-Nadp(+) Reductase Protein-Partner Binding Cavity Contribute to Substrates Allocation.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4c43A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4c43A02
1G7CA 2HCJB 4TMTA 1TTTA 1F20A 2R6HA 4B48A 1QUEA 3CCQB 4YHBA 4YAFA 3QSYA 4HE5A 4MYUA 3OW2B 1VQ5B 4G5GA 1QGZA 3V76A 3JQRA 1W35A 1N0VC 1IJEA 4PC7A 3QFSA 4B43A 1OGJA 1EP3B 1EFUA 2QTLA 2B7CA 1ZUNB 2BM0A 3JQQA 1FNCA 1Q81D 4MYTA 5JBQA 4K1XA 3WNDA 3QFRA 2GPJA 4TN1A 3P26A 3CCJB 1QFZA 4YAUA 1YI2B 1AIPA 1GO2A 3LYUA 3CMAB 3CCSB 3I56B 1HA3A 3OZWA 3G4SB 4RD2A 1VQKB 4M2LA 4M1KA 2YWGA 3G71B 2BVNA 1CNFA 4AF6A 1EP1B 1KC8D 1K9MD 1F60A 1TLLA 4B3XA 3J81k 1YIJB 2PIAA 3VNVA 4ZCMA 3I55B 1SKQA 3MHPA 4C43A 1KK2A 1VQOB 1QGYA 3W2HA 3AVXA 4DQKA 2DERA 3E20A 4TMVA 1VQ7B 3VO2A 2ZITA 3WXMA 4LBWA 5FA6A 3AVYA 2YWFA 4RJLA 2VNIA 5TY0A 1H85A 4M4SA 2RC6A 2QN6A 4ZCIA 3CW2A 1Q82D 3ZZUA 5GV8A 2B7BA 1IB0A 3OJXA 3OJWA 3WBKA 1JJ2B 3B82A 1JA1A 1QGAA 4ACAA 5HXBA 2DEUA 1FDRA 4B47A 1G7RA 1YJNB 1NDHA 3AVTA 4G1BA 1VQLB 1KK3A 3WYAA 2VNJA 2VNKA 1B23P 1ZM2A 2XEXA 1GJRA 4ZGNB 1BQEA 2FX3A 1QUFA 3U6BA 1W87A 2NPFA 4YAWA 2HDNB 1CQXA 1K8AD 3CCEB 2PMDA 1Q86D 4ZGQB 2VZLA 4PC3A 3MCAA 1JA0A 1FRNA 1H42A 4FN5A 1UMKA 2C77A 4AC9A 1J9ZA 2AHOA 4RCYA 3CCVB 3CC4B 5AN9A 3JQPA 3VO1A 4LBZA 4ZV4A 4RD0A 5EMNA 1S72B 1EFTA 1XB2A 5THXA 4U9UA 3CCMB 1NJID 1QX4A 1U2RA 2QTZA 3AGPA 4PC6A 1VQ9B 4PC1A 2XNCA 4IW3B 2PLFA 1EP2B 1W2BB 3W5UA 1WDTA 1D1NA 2BMWA 1ELOA 4RD1A 2BGIA 1DDIA 4Y7CA 1ZM3A 2J7KA 5KSWB 1KK1A 3CRZA 2XNJA 2EFGA 3VMFA 1YJWB 3W5VA 3VNUA 3I1FA 1A8PA 4UAJA 2BN4A 1OGIA 2BGJA 2C78A 3QE2A 2D74A 1TUIA 2GQFA 1QH0A 4PGOA 2VNHA 2EIXA 1EWYA 4ACBA 1DG1G 3AVWA 4TMWA 2OK8A 5GV7A 1I7PA 3P27A 3QFTA 1M90D 3G6EB 4B4DA 3WBJA 3CCRB 1B2RA 4B44A 1KD1D 1W34A 3W2IA 2OK7A 4P6VF 4NBSA 3WNBA 3B8HA 3OZVA 4M53A 3AVUA 1VQNB 4LBYA 3PENA 2YWEA 4H9GA 1GAQA 1KRHA 4YAOA 4QHYA 4R71A 2BSAA 3ZBTA 1OB5A 1VQ8B 3CB4A 5TV2A 3CC7B 1VQMB 3MMPA 4HE6A 1GVHA 1CNEA 2QA4B 1R5OA 2B5OA 1GR1A 4FK8A 5TR9A 1YJ9B 3W2FA 2RC5A 3ZZTA 3CD6B 5H59A 4DQLA 1IJFA 4C0SA 3CPWB 1ZM9A 2OTJB 3LVBA 1QFYA 3ZBUA 3A1FA 1BX1A 4G1VA 2BF4A 1S0UA 1N0UA 4AF7A 3WY9A 1FNDA 4ZCLA 1E62A 4EH1A 1BJKA 1KQSB 1D2EA 1M1KD 1EXMA 1YITB 2QMUA 4N3GA 1AMOA 3CCLB 3SJZA 5H5JA 3E1YE 3W5HA 1D8TA 4BPRA 1FNMA 3FPKA 1DARA 3U2QA 4PC2A 1FRQA 4LC0A 4LBVA 3CXCB 1N8RD 3AGQA 3OZUA 2BM1A 4N3NA 4RCZA 1QG0A 4Y9UA 3U6KA 1Q7YD 1YHQB 1VQ6B 1TVCA 1QVGB 4WQMA 1G7TA 4F7DA 3AVVA 1JB9A 3FJOA 2HMAA 1VQPB 1EFCA 2X3UA 3LRXA 4TMZA 1E63A 1ZM4A 3QFCA 3ES9A 4FWTA 4Y9RA 1XE1A 1QFJA 4J0QA 2E1RA 2CNDA 2YWHA 3LO8A 1JNYA 4Q7JB 1DDGA 3ZZ0A 2BV3A 2DCUA 1E64A 2VYQA 1KK0A 1FNBA 2QEXB 2DY1A 2OTLB 2BPOA 4TMXA 2QDXA 1R5BA 2CRVA 4YALA 3W2EA 1K73D 1BX0A 1KTVA 3CCUB 1KJZA 4M0LA 1R5NA 2DETA 3ZC3A 4RD4A 4P3YA 4NCNA 4RD3A 1QVFB 1OB2A 1VQ4B 1SM4A 1G7SA 3CMEB 3B78A 4RD6A 1GAWA 4QFMA 3CC2B 3W2GA 3WNCA 5DSZA
chains in the Genus database with same CATH superfamily
2QI9C 1Z8NA 1R4ZA 4CM5A 4WOCA 1ULSA 3GNQA 4MMZB 3NR2A 1T9GR 1WJGA 1XMJA 1DQSA 4N49A 1UMCA 1XF9A 3A6ZA 3NTOA 5EZQA 1DKNA 1Z7GA 2DPYA 2IOFA 2HH9A 3R3WA 4GMHA 3ZWPA 3KP1A 2PGXA 3BCSA 4KXWA 5ERYA 1P19A 2PD4A 3GD7A 4DUGD 5AW0A 2IH5A 1LLFA 3BH6A 3AFHA 4YHBA 2B7LA 3P5BA 3F78A 1DWOA 1UAGA 4YNBA 4DEXA 3SE7A 1XZKA 3F5SA 3NHZA 4MCAA 4TYNA 3SSOA 1IC6A 5JJLA 2Y66A 2J41A 1NN3A 2DQ4A 2JAWA 4MB6A 1X80A 2CJXA 1Y8QB 4YAEA 1PJBA 3PCTA 3F6CA 1GGFA 1BCSA 3ENKA 1Z0FA 3B48A 2XT9A 5K0GA 1JEQB 1PI3A 2WEKA 5IT5A 4HDRA 1E2PA 4M87A 4RVHA 1BCRB 1JEEA 1HTWA 2EJWA 3H2IA 4O3FA 4PC7A 4X85A 5DHUA 2R2AA 4N5IX 4ZQBA 2H18A 3ADOA 2HPZA 3KV1A 4YREA 3VTZA 2FZKA 4Y3UA 3INNA 1V0JA 5SZKB 3ABSB 1V39A 1KI2A 3PEEA 3RU2A 2Y93A 1CDZA 1EX9A 4PYNA 3NHWA 1DG3A 1MPXA 4ZQEA 2W6PA 4E70A 4IGFA 1NRKA 4GFDA 2WABA 1WNTA 4L3VA 4NU5A 1S2GA 3PFIA 2HJGA 2OV1A 3BORA 4FW8A 5M2QA 3RV3A 2LIVA 4F4HA 2NU7B 5BUCA 4LZPA 3M70A 1SB9A 1X14A 2NU6A 1GCOA 3QVWA 3NIFB 4JWTA 2YS7A 3TZEA 3AIKA 3IEKA 2YHIB 2O52A 3FM9A 4AZSA 1E2DA 1HDIA 1BS2A 5LP6C 4F85A 3IBFA 3AM5A 3IKMB 3H1TA 3G2PA 3T4UA 3UQYS 1AVTA 1E3QA 5KEIA 1Q0ZA 3NHUA 3GLFB 2A7XA 3RBAA 1HA3A 3MB8A 2EARA 4HR7A 1GIAA 1NRJB 5B4VA 4MDEA 1E92A 4IDAA 1RWNA 2BCGY 1J25A 1OC4A 1R18A 2NQ8A 4C7MA 2I03A 4C3VA 3FGNA 2Q50A 2ZBGA 3K0FB 3RF6A 2OQRA 3LHSA 1PWXA 4EYGA 1KC8D 1F2UB 1GRNA 2V7QD 3HA3A 3K8YA 2HV8A 4XLLA 4NBNA 4PAQA 1R66A 4A8JC 4B3XA 5FLKA 1KERA 2AJTA 4KN9S 5A7HA 3RASA 5K03A 1XA4A 2AMJA 3WMRA 2ESRA 3F8WA 3KDAA 5TVGA 2PIAA 1L5WA 4B9AA 3IOYA 5A02A 2W0SA 2GGSA 5J5CA 1ZRMA 3G0CA 4RACA 1GNQA 2YS6A 1OXUA 2V59A 1HE8B 1EK0A 3C5VA 5C0OE 2PL5A 3X1DA 3IT3A 4GI3A 4MTCA 1NVBA 1BQ3A 2YWDA 1PCXA 3W5AA 2Q46A 1T29A 3KUUA 2Q9BA 3HI6A 1PUIA 3OW7A 1GVNB 1C14A 2LR0A 4TMVA 3QPBA 1M7BA 3VO2A 2XXJA 5G0UA 4JHLA 1V9SA 5LQMA 1UMBA 1M2EA 1RIIA 2SKCA 3BK1A 3ONVA 2CMGA 3ZZMA 4RE5A 4MKHA 5KWJA 3Q5DA 5TPWA 2OZPA 4XYLA 2YC4C 3RF7A 1YR9A 1DAGA 1RZVA 3W79A 1MFPA 2HWUA 1KS2A 2E82A 1ISMA 1O8CA 2JEZA 2VP6A 4FZRA 2WUFA 4HPWA 4MO2A 3G9ZA 2G1JA 2QN2A 3VSDA 4YRSA 4DDVA 2K7ZA 3QLTA 2FWRA 1UOOA 3DPUA 1YR1A 1OXMA 3L7OA 1PHPA 4FBLA 4YFVA 4M4SA 2W4IA 4EPXA 2RC6A 1GILA 3KETA 4KAAA 3F96A 1MP0A 3NX4A 1TQ6A 1ZUWA 2TMDA 4PSUA 1H2FA 1VFPA 4U2EA 2GN9A 1WTHD 4U7TB 2D1TA 5J5AA 5AVVA 4GOJA 4CV0A 3H8WA 5ICGA 1HFJA 2J33A 3BGWA 3ZZUA 4DT1B 5C1DA 1JHMA 4LQ4A 3Q6QA 1M1NA 2O3UA 2WZBA 1TTHA 3SQLA 1CFZA 5FH9A 1E7RA 4JXKA 4HDOB 2I67A 1BWPA 1OAOC 2W2KA 3E81A 3PF8A 3FR7A 3GEIA 3TLGA 3WGHA 2WR8A 4NATA 4RPLA 2B4YA 4DDTA 4P86A 1CHNA 4EL5A 2DEUA 4CCSA 1UJ5A 5EMKA 3L8EA 4CL8A 1C7IA 5C1OA 1IOLA 3LA8A 1QOPB 4D0SA 5DTIA 3SVZA 1ECGA 2M2IA 4HH4A 1PLKA 3AEUB 1SRRA 5IK2A 3FLMA 2PGNA 2R4TA 3O1LA 3ZYCA 3EWSA 4LMBA 1B23P 2H4ZA 5EESA 4AMUA 1PFQA 1NSTA 3EVZA 4C05A 2P35A 2X14A 2X5OA 2ZDHA 3AP3A 2Z08A 1H0KA 1CJTC 1XCGB 4EK9A 1JG3A 4LJRA 3PNQA 3NBZC 2YJTD 4UHFA 3RRYA 1PR9A 3WGIA 2Q9AA 4CETA 1XEWY 1GGNA 4G3XA 4QASA 4HN9A 2VQ3A 2JK0A 3IOBA 1DXHA 4WJZA 5F2NA 2IYFA 2P2CA 1YI0A 3FWKA 1X77A 3PSAA 4UMFA 4RPCA 1FX0B 2VAXA 1VBMA 5SZHB 4ZGQB 4NICA 4HGRA 4JT8A 2HJWA 2HX1A 3GEPA 3ZNPA 3CIOA 5KCZA 1TQDA 1B8UA 4B2YA 2WIJA 1DMSA 3I61A 1NQUA 2PLNA 2H85A 5JR3A 1R5JA 1WPCA 3K0AA 3OKCA 2BC9A 4Q1CA 4M0EA 4BFWA 1IRXA 4Z2AA 5AM3A 3LD9A 5L3QA 3O4GA 5L9AA 4I1YA 3PITA 4L8GA 5JSZA 2E5LB 2YW2A 1NSYA 2AXEA 3OM8A 7MDHA 2IWHA 2XDQA 5JASA 2QPTA 3C6QA 5BR8B 5T4HA 4AP6A 1EM8B 2I2CA 3PUMA 3K7EA 3U3ZA 1L5QA 2RK3A 1LSOA 1KE2A 3W2TA 3C15C 1EB8A 3O6VA 1EZZA 1Z29A 1ZR4A 1X86B 4J29A 4P81A 1PVOA 3AQ4A 4MRNA 4RVUA 2IC5A 1CR2A 2P11A 2VBIA 2XUIA 1CUHA 4TKUB 5BRNA 4UTVA 3DYVA 5IM4A 3KYDA 5G0TA 3N6RA 1ZL0A 1VG9B 1H9AA 1WD5A 2VP3A 3QE4A 4OSEA 2AK2A 2RHMA 3G9TA 3QKRA 1W581 1QO9A 2PX2A 3THXB 1ECCA 2OPHA 1KKMA 3KQSA 4D3SA 2F4NA 1EUYA 3CH5A 2KB0A 3GN2A 3EZXA 3K2BA 5FJIA 5L7TA 1SC9A 4WJLA 4IDNA 3U4GA 4EVIA 4WGFA 3TGWA 1D4AA 4CT0A 2OBMA 4QYIB 4POOA 3AR4A 1BVRA 5JWHA 1WSWA 4UATA 3AL0C 3N3AC 4NMWA 3B20A 4Z0TA 3OLXA 4AJOA 5C4MA 4MMYB 5AW6A 4FGKA 4XIJA 3PF9A 2BIFA 3TMAA 3EXG2 4XX0A 3WGUA 4I99A 1M74A 1N8KA 2QD2A 4FT2A 1ZIDA 3P2KA 1WXXA 2V03A 4W6QA 3REGA 4QLAA 5HHTA 1T3SA 5KU7A 1EFPB 4CXMA 4WNAB 1RZRD 1V5GA 1T24A 1WZIA 4LE0A 1V48A 3Q7QA 2LPMA 3CWQA 1GU0A 3IV6A 5KTTA 2ZE7A 2E5FA 1TCBA 1PJ3A 1IJBA 4UAJA 2WKWA 2WJ3A 1DXYA 4PVCA 1EAMA 5AK5A 1NJ8A 1QSGA 3HKEB 4JROA 4DPKA 1M2JA 3SAJA 4Z7NB 4L0DA 1OXSC 4BZZA 3B89A 4LJ7A 3ZWOA 5JDCC 4M7WA 4WHMA 3S0JA 1RC0A 2F59A 2WTAA 3IDFA 3MJDA 4U9HS 4JN6B 5H7XA 2R7AA 3T1OA 2R84A 5LQRA 1EQUA 1TU3A 5DCWA 3S29A 4ZJPA 1RJGA 2H92A 2CUNA 1GM5A 1RXIA 2BKAA 5IM5A 4F5ZA 5AJZA 3AWDA 2ZJAA 3R0JA 3ELYA 4BX8A 3PUNA 3AVWA 4EGAA 1TUBB 4ZO9A 2PRYA 2EC5A 4NMHA 4JYAB 3P27A 2RHGB 5DTJA 2AG0A 5JCJA 1QHNA 1WR8A 1ULTA 4EF4A 2NYUA 5AW5A 3T56B 1O0SA 3AUXA 1BNCA 4XDGA 4DAEA 4K6OA 4YAIA 4RZHA 1QGED 4P6VF 3IP8A 1P9LA 4EI9A 1QAQA 2BJHA 3VZBA 1NNUA 3WNBA 5K8TA 3S81A 1OH7A 4GL2A 1E5QA 4Y2SA 3PENA 1J6UA 3A1TA 4MOWA 1EXDA 4I4IA 1Q95A 3SF8A 5GVSA 1QZZA 3OECA 4JA2A 5FFFA 1MVNA 1WVIA 4HB4A 2ZAYA 3KT8A 3IQDB 1F9EA 5AIBA 4ES6A 2FR8A 2HA6A 3GLHB 4YX9A 2CJPA 3GP8A 5CYFA 4MS4B 2MYNA 3R5XA 3AP1A 2PQ6A 4PX2A 1U0LA 3WXBA 4AYWA 2VDLB 4B74A 1SCIA 4FHZA 1MTZA 4FVTA 3RKUA 3G79A 1WF3A 4JI3B 5TV2A 1J1ZA 1Z36A 2PCJA 1L7NA 1TXGA 3D0QA 2QAGC 4PZ9A 1W2GA 4MUYA 1KNQA 2WZPP 4OGGA 4V03A 4QD3A 3JX9A 3N76A 4XARA 1CUEA 1UL1X 2FF7A 3D3WB 4DLVA 1K97A 3PDWA 3C8UA 1G4HA 3WIBA 5CM8B 4EPYA 1QHFA 4IFIA 4W5OA 1VE7A 2B21A 2GJPA 4ISBA 1X1QA 4FGSA 1DFHA 1AF4A 2F43A 3RY8A 3L0ZA 1CVLA 2C0PA 4O3MA 2J0SA 1UC9A 3C6KA 5H16A 1IJFA 2O23A 4B6SA 3WKDA 3KXIA 1QQTA 1V5WA 5E38A 4D2IA 1E1YA 2M5SA 2OGTA 2CFCA 2Q27A 3LL7A 4JI7B 1EVJA 2PL1A 3QU9A 1MJ5A 2H8GA 2VZEA 1U11A 3PE6A 1SHUX 2XYHA 1QRRA 2AXNA 3HCPA 4JC4A 5M3BA 2ZB8A 3A6JA 4RSRA 5FI0B 3VDXA 3WHKA 2HMYB 4YRQA 3GK3A 1QIHA 3EWIA 3AC0A 3QENA 1N77A 1S3FA 1OTHA 3SX4A 4MZDA 2HLHA 4BGUA 2VDJA 1KVUA 2OXEA 4N6GA 1H5UA 3T06B 4Q3DA 3ZOZA 1EXMA 1JQJC 4GC5A 4L9WA 2P41A 3SGLA 1O8BA 5EWJB 4D3ZA 4YUXA 2VDOB 3ENNA 4YJ2A 2UYHA 3TLKA 2BTOA 2PFSA 3AIMA 3WLRA 3ZI0A 1J0DA 3LPMA 4LK2A 1IUOA 1JECA 1VE9A 3GWZA 1ISJA 1N8SA 4LG1A 4RHYA 2IDJA 1WWKA 3UJ7A 3LQ6A 3UK6A 4CM1A 3I52A 2PZ8A 3PC2A 2VATA 3WL3A 1O6BA 1KSHA 1ZGBA 5KO2A 3NKLA 5LQSA 2PJUA 1FTNA 5CK4A 2VPTA 4OQFA 2J0UA 2J1LA 4PLHA 4PO9A 4LUCA 3CXCB 3QTTA 2FPRA 5KTMA 3U26A 1K6JA 1T2DA 2XE8A 4WESA 1JIXA 1G8HA 1ZGHA 3WJ7A 5C80A 2GA8A 1ZIPA 4QICA 2GT1A 3L6OO 1DP4A 1KXJA 1U0GA 3RKRA 3AHIA 3ENVA 5C31A 3ZWVA 3ZXYA 3C8ZA 4BQSA 2VDVE 2A78A 3THRA 4RHXA 1ZC4A 5EXPA 3PXBA 1ZK0A 2X9VA 1LVHA 1Z2AA 3PGMA 4LTNA 4KSBA 4TS4A 4G8DA 2PKQP 3DZKA 3FETA 1VLLA 1G8YA 2HM7A 4LSWA 4A2PA 3F7OA 1SQ0A 4AXXA 1YJQA 1EINA 1L7MA 3R1IA 4EPRA 4RJ2A 3PR1A 4IPTA 1JKFA 4PFQA 3FOAA 1BOOA 1Z28A 4TMZA 3KCNA 3P9CA 2EJCA 1HOXA 4KAXA 5M29A 1YL7A 2LZ0A 4O6VA 1H2AS 1SU6A 3MLBA 3BXFA 5T67A 3UNXA 3HFSA 1O95C 1XD9A 4ZJUA 1H1DA 2FPPB 2ZZEA 4LWOA 4B4KA 3L4KA 3TH5A 5KDDA 1NTRA 3BQMB 1CLEA 2JI8A 4MRRA 5T57A 1Y7LA 3X1YA 2QLBA 2FRDC 2RJOA 3L06A 4LDQA 4E5SA 1GKLA 2PGOA 1X70A 2VYFA 3BBLA 5FHQA 2YTZA 3DDZX 4EDFA 4EKYA 3RS7A 4ESVA 2FEMA 3S70A 1WMAA 3T7IA 1Y3FE 4GYYA 3TLMA 2AN5A 5FTJA 4YCMA 3ISXA 3EVFA 3FPLA 4CN9A 2QVGA 1SJ9A 3LA6A 3NDPA 2R1UA 3ECSA 1EJBA 3GVXA 1UDWA 2NQTA 5KU1A 2P69A 3A9TA 3FJYA 1VYHA 1YSCA 4MS3A 4K9DA 1BTOA 5F4MA 2ATVA 3KIPA 4NZZA 4BLWA 4M22A 1P7YA 3MTEA 4YJGA 1ZCFA 1K8RA 1L5HA 4UHHA 2PWBA 3CX3A 3R4CA 4IWXA 4S1OA 1BHO1 3Q5GA 4I5GA 2X3FA 1WNFA 4DLNA 1WDWB 3QJ5A 3QX9A 5HR5A 1BE8A 2O8CA 3EXG1 2AOUB 3OJEA 3Q8XB 3EZYA 1RR6A 3VI3B 3ZWWA 2YJZA 3FDZA 2FP3A 2X77A 5GZ3A 1UKZA 1FQOA 4N40A 4BMXA 5B6IA 1E2GA 2D1RA 5H0IA 1N07A 1UBLS 5LIPA 4G0VA 4HDKA 3NALA 5M5BA 2X1LA 3DDSA 4ALKA 3VR5A 1E6MA 1NW7A 3FCAA 1X6VA 3H99A 3TYXA 3QXSA 2IEIA 4M1YA 3TQOA 4F60A 1U8ZA 1MLDA 3EDCA 5KYKA 4KO2S 2DFKB 3A1UA 1BX3A 4J0JA 3AJRA 5GVRA 4QUBA 2RHTA 4C6TA 1AA9A 5T5QA 1AGYA 1PGJA 5IEBA 4CLHA 5B37A 3OVMA 4O4LA 4C4XA 3R20A 1Z15A 1PGNA 1YASA 4G07A 1RP1A 2WSBA 4MKIA 1TTTA 3S8EA 2CCJA 3AYXB 2MYUA 4W9MC 4CGZA 1E94E 1UBMS 4ZRDA 2CJWA 1EU1A 2NO4A 2RKOA 4TKVA 4G5GA 1G1MA 4GLLA 4OLHA 2A1IA 4BVJA 5LSAA 4IDHA 1UKYA 4QQKA 2GN2A 3VC7A 5BMVB 1T2EA 3OX2A 3PJFA 1IAQA 2B3TA 4XX1A 5DX0A 3ND5A 3P0IA 1SVLA 4FFWA 4QRDA 2PRJA 2YHUA 3ZE6A 5LLTA 4LWQA 2V3VA 5SICE 3AK4A 1BDIA 3JQBA 2FUNB 2V1UA 1FU4A 3CZMA 4QXRA 5B1HA 4Z4UA 4ZEWA 2DWPA 4K03A 5CLJA 1RWWA 3CNLA 2QVCA 3KWLA 1EP3B 3RIMA 3ZLUA 1OYWA 4B9EA 1H2ZA 2VAMA 1L0BA 3VI4B 3KQOA 1G6KA 1RXVA 2W6ID 4BZQA 3I6IA 3RSZA 1H8EA 2BLLA 4LXHA 4O5OA 3RSGA 1NMSA 4RH3A 4OLJA 4ZHSA 3KLMX 1PT5A 1K7EB 3D4PA 5GQSA 3KEQA 5AXAA 4CTKA 1VXOA 4ZZ2A 1S8OA 2WM3A 1XVAA 2WWVD 1DKRA 3HVHA 1Q6YA 4NV0A 4HWSA 1U4SA 3W1EA 8ATCA 5ALNA 4PLCA 1Y4AE 3CCJB 3CX6A 8OHMA 3SQNA 2IPOA 1ZZGA 2JA1A 1FU8A 2CVZA 4NL4H 5DLQC 1YI2B 4Q12A 3RI3A 3S99A 4TXJA 3KFXA 1RWVA 2G06A 5FUBA 3L6CA 3QU7A 2DQKA 4LQDA 2Q4RA 2XRMA 1QOZA 2YXPX 5EFZA 2IH4A 5F77A 1TQ2A 4WWHA 4RM0A 1MGOA 3AF0A 4CPDA 3DUFA 2B4QA 4GZ5A 1C7JA 1WXFA 1ZXBA 4KX5A 4HRYA 4CFZA 5ADWA 1C7QA 1G3QA 1HR0B 1CNFA 1ONBA 1RQGA 4DK0A 1ZCAA 3P45A 2CL7X 1SXHA 5G02A 5G3YA 5J1TB 3TW4A 4CMJA 1NONA 2O7RA 1TLLA 3B1XA 4W5HA 5EXXA 4OHYA 4FHCA 3I83A 2HIAA 4OUDB 3WAGA 5FOQA 5BSEA 4OEHA 1OFTA 2PUHA 4N1AA 5F2KA 1ZMBA 3VNVA 1G20A 4EPWA 1C81A 2P6RA 2QJOA 1R6UA 3FCYA 1AC5A 2DCMA 4JBYA 3COWA 3UENA 2Q0QA 3MHPA 4C43A 3HDHA 5SZJA 3UB4A 2VRCA 1YCGA 4MITA 3ZQ4A 3DQPA 5WRFA 2I1WA 4G63A 2FMHA 4RFSB 3Q41A 2D8AA 1VQ7B 1CQWA 1JG1A 1F48A 3E8XA 3QW4B 5FPPA 4NDNE 4EABA 1IDOA 3RRXA 1A8SA 3IUBA 4BGIA 3GG2A 3RT9A 3I62A 1FFCA 1I4EB 3F74A 2PMBA 1TA0A 3JQ7A 3M6LA 3A4TA 4O2AB 1UM9A 3LP8A 5AI6A 4L15A 5FWNA 1HZJA 1FIUA 4EHHA 1XNJA 4RJLA 4PYIA 3RS4A 1E3IA 1GT91 1ZAKA 3DFMA 3DEZA 1PL6A 5JQGB 2B9VA 1V5IA 4R8SA 1BZYA 3GT3A 1UDCA 2C0CA 2XVXA 3BCUA 1F51E 2JVJA 4KXXA 3IODA 3WWPA 3AU9A 4OXIA 4P38A 3EIEA 3SEAA 1JS1X 2AQIA 1JIVA 2HHCA 3T53B 1NHGA 1ZW1A 2AVDA 2I3BA 3DZGA 2HRCA 3EIUA 3LWDA 3SQXA 2NGRA 3AI7A 1AO3A 2CWWA 4UCWA 2HMUA 2EF1A 3GMTA 3L01A 4K1LA 4XCQA 1WUTA 3WGOA 1B7GO 1JA1A 3CR3C 2YOFA 4HWOA 3PFBA 3AR6A 1NI5A 1W2HA 2QMZA 2X0JA 5EIOA 1SHLA 4M1TA 4URZR 2LCFA 2IUUA 1V7ZA 3BUSA 2IXAA 3M5CA 5E8RA 2FNAA 4A0FA 1PLLA 2D1FA 2YY6A 1T1EA 3FHJA 4YHHB 1U7DA 3A7DA 1ZM2A 1N9KA 2PGAA 4XOIA 1PBTA 2QMHA 1GGEA 3QVTA 4IIJF 4JL6A 3TQQA 2PRZA 5CDFE 1J2UA 1NVEA 5FOSA 3FBGA 6YASA 1UPBA 1V3VA 4IOKA 1UT8A 2PX8A 3RFVA 2NUBA 5JEDA 2VHWA 5BVGB 1QYIA 3UZUA 5L3RA 2Y0EA 2IY7A 4DPLA 3LY9A 2O2ZA 3Q3IA 1EFLA 4WDRA 4CKWA 1ISFA 5IVHA 4S1PA 2PUGA 3O4HA 2DFNA 1NDUA 1DGQA 5G3ZA 3R5KA 1CR4A 3QKUA 1UMCB 2JFWA 2KI5A 3TR0A 1NBMD 4K46A 1PFGA 3ESDA 1PEAA 1K0FA 2E6KA 3QI7A 3E7XA 1K8QA 3KCQA 4IDCA 2RHWA 4OJKA 3H65A 2PS0A 5EERA 2Z09A 2ODBA 1JA0A 2XGGA 4HYTA 1JMKC 3BXGA 4I8DA 2WVJA 2JAPA 2ZDGA 3DMFA 3WGGA 4G5OA 2OQ2A 4AC9A 3K2EA 2C88A 3K9QO 5EAIA 1XTJA 3PGA1 3K1JA 1IG0A 1MO4A 4R3UC 1X2EA 1PE0A 2JBAA 3A11A 4FN4A 4FUQA 4CTMA 3ZDBA 1BCSB 3EA5A 1RWKA 4DMUB 2OOSA 3B6KA 1G8GA 4HDRB 4EFDA 3R4VA 4O2BF 3NHFA 4ZREA 5CW1A 2JH8A 2BI8A 1ZH0A 2XIQA 2XE6A 1F8UA 5BN3A 1U0FA 1YDWA 3DMPA 2M6SA 2XTMA 2C83A 3BE5A 1V26A 3MB5A 1Y4DE 4J4HA 4BLQA 4Y1RA 2LWIA 1KGSA 1VI2A 3GGJA 3I76A 1IMJA 3CLTD 3NM6B 4KYVA 4Q3EA 4L0MA 2VRNA 3ZHUA 1KZ9A 4HSEA 1ZA1A 2UDPA 3FDJA 4QX6A 1QX4A 3PIIA 3EXIA 4AJ2A 1KYWA 1G8JA 2ZJ6A 3H1GA 5H8WA 4DLLA 1LI7A 2ZRQA 1M2HA 2QPAA 3QY0A 3KSAC 4F91B 4AQYB 4PEVA 1G21A 2QYHA 4YDSA 2PYDA 3RTCA 5AMXA 3ZQUA 2NU6B 4EO7A 4ZMSA 2H31A 1E2NA 2MHCA 1ZRSA 2XYPA 4HFJA 1TO6A 3HBJA 4PS0A 4TQAA 2XCUA 1LBEA 2Q8NA 1A5ZA 1V3TA 2OOKA 1JJVA 2NZ8A 3C3JA 3GVLA 3D43A 3MGCA 4L76A 4LGVA 1YE8A 1XX6A 3LZDA 4QNNA 4ITRC 4ZVLA 1SKAA 1N2EA 2DFLA 2J9ZB 2R87A 3GVCA 2GSDA 1VSTA 1JAYA 3PQEA 3PRJA 1DDIA 3AV0B 1VKRA 1Z0UA 4HXYA 4OJYA 3TN7A 4B17A 3KQKA 3OQBA 1XTUA 3HCCA 4UUNA 4BBAA 1ULUA 4C88A 4CIYA 2ZVPX 4GBGA 1VIAA 1ORIA 1NXSA 3EDRA 4G0YA 4GR5A 2XNJA 1P5FA 1AQIA 1EVIA 2A9VA 2HSDA 2OHJA 1H22A 3BTUA 1HYQA 2VA8A 3CLHA 2O14A 1DRJA 4KBFA 1G19A 3CSUA 4DCOA 2P78A 3HUFA 4WOJA 2RAVA 1JDZA 3KE9A 4ZOBA 5CMLA 3OO1A 4KFSA 3NWBA 4YBZA 4AO6A 2IX3A 2IHTA 1WMFA 3WJ2A 3BXXA 4D0GA 3BRSA 4X6XA 1XYYA 2XUJA 3ASUA 3KKOA 4WK0B 5AI8A 1CUIA 2V9CA 1P0PA 5B7NA 1T8TA 1N7HA 1R8XA 5CFZA 3QEMB 3C98A 1J99A 3ELUA 3Q7RA 4G0PA 4HC4A 4JK3A 4KN6A 3IILA 3WK4A 4BB9A 1V6AA 3QKWA 2IKQA 1EFAA 2UZIR 1ND5A 4GI2A 4IGKA 1LD3A 4R8LA 3AM4A 2GI4A 4U7PB 3G82C 2DHDA 3Q7EA 4MR8A 1WDLA 4RHFA 2QGFA 2P67A 1UMBB 4IFTA 1A0OA 2VNHA 1FMJA 1L8QA 2C07A 1DWPA 2Z2XA 1FY2A 2ZCVA 3A9CA 5FKJA 3L7NA 2IA5A 3FFWA 1KC1A 1GAEO 2DHEA 5GV7A 3NYIA 3EGIA 4U6QA 4AF8A 1TECE 4B8YA 2VAVA 1XC7A 3AI3A 1PNOA 3HY6A 5CA1B 3GX1A 5HKKA 1A71A 3M9LA 3OF3A 4PLVA 1X87A 3BE8A 4ZOAA 1Z06A 4W9RA 3WYEA 1E9CA 4OMUA 1CXZA 1LSSA 2A35A 3MWYW 5E3IA 4IQGA 1FSGA 3EC7A 1Q91A 2ZTSA 4UU1A 5DB4A 1BWRA 3WP1B 3CMMA 4NBWA 3TO5A 3ZLJA 3ESYA 2I4NA 3MJ4A 4XIYA 3OC0A 3I1JA 4HEA1 4TT8A 5TGZA 3ZHSA 1C3XA 1Y0YA 5DX1A 1M1NB 1XZGA 2NTEA 2OCAA 5CLLA 1AKNA 4IDBA 1TC1A 3R3YA 4RF3A 4C3UA 4D46A 4H9GA 5EZ6B 5HA5A 1J33A 2W2KB 1XMIA 1KHTA 3O3CA 2OV2A 1CEQA 1JZQA 3CKLA 3TLGB 1Z4QA 4ZJYA 3PZBA 5KOYA 3TIVA 2JGEA 2ZZKA 3NP9A 5G1OA 3UUEA 4A0SA 2JLAA 2R8XA 2GEDA 3MRXA 1XAIA 3EG9A 3DDOA 1ES9A 4YRJA 1ZXLA 1UP4A 3NQ41 3GEMA 4IH4A 3NFYA 1WM1A 4G0QA 1E2IA 4S1NA 4KQMA 4QSHA 3N1UA 1JDBB 5H3CA 4K28A 4XCVA 1J5XA 4IRUB 4GLFA 3A1NA 3ZGYA 4DMLA 1U8AA 1M0WA 1PD0A 3ZE0B 2PG3A 2KHZA 1HTTA 1GVHA 3W4JA 4AZ3B 1MTOA 4G0MA 1GQFA 4L95C 3S8MA 2HT6A 3JYPA 3NV9A 1JAIA 5E6UA 3EZLA 1KQFA 3N2ZB 4EELA 1UPAA 2OV4A 3ACDA 3ANXA 4U39A 5TR9A 1RQLA 1JTFA 4Q21A 3VO9A 1RYFA 4P4NA 2PA0A 3KALA 1Q1QA 3WLTA 3W2FA 2RC5A 3ZVRA 2YV1A 5JFOA 5GJBA 2FXIA 1XEXA 1K8ZB 1XSEA 1WV1A 2E37A 2PNFA 3BGVA 4U7FA 5HCNA 1C41A 1T34A 1LJ8A 3NWOA 5CW2A 5DN9A 5FFNA 3CPWB 4NOMA 1O6GA 1BVYF 5DM70 5KNCH 3JVUA 5LP6A 2Q28A 5DISB 3N86A 4ETIA 4PG8A 2BFCA 4UTNA 4FIZA 3KYJB 1M7GA 4G5SA 5J4VA 5L3QB 1IZZA 2CB0A 5IMBA 5IX8A 4J6FA 2Q3MA 4I55A 2EG5A 3C14C 2XE7A 2WIDA 3AI2A 4G1VA 3CJQA 3SP1A 1AS3A 2OA0A 1GNVA 2HZBA 4LFBB 4LRTB 3WY9A 1D4FA 4XD7A 3IH5A 3KPJA 5CA0B 1OVMA 1QZUA 2XNHA 5E1MA 1A4IA 3L7LA 4FOSA 1BJKA 5CX1A 2JC3A 4XGRA 3VO8A 4LDPA 4IXDA 2RBEA 1GFZA 2PZKA 3HFGA 3LH5A 5CP8A 1DRVA 3HEBA 3WL5A 1U9JA 4B6JA 2GYWA 2DKOA 3RANA 3RG8A 1GZ5A 7AT1A 4A8JA 5MGNA 2ZVJA 4N18A 1FDVA 3ASTA 1MC8A 2B8EA 2BFBA 1NYQA 4Q4LA 3BULA 2PRKA 3TQSA 2C5GA 3KYDB 2UYOA 4LCBA 3UPTA 4BATA 4Z9AA 2VJQA 4FWBA 4MRAA 4BNVA 1H2RS 3QKRB 3VVMA 4OHMA 3AKYA 5LU9A 1IONA 1XZEA 2WZDA 5AKLA 1OREA 3R24A 1QJCA 4OB7A 4X97A 4DV0B 2PUJA 4RMJA 4ABYA 2M9MA 2Z4RA 3HB9A 3WB1A 4Q37A 4DY4A 3DBHA 4TV9A 1N8RD 1Y1RA 4NYJR 4ZQIA 5J58A 2NO9A 3QJYA 1RXEA 2CFTA 1GSOA 4XGIA 4KEAA 1J9GA 3D3EA 4XLTA 2XVZA 3L7KA 3D6AA 9MHTA 3F7TA 3V3KA 4U3JA 2C2ZA 3HBAA 4XX0B 3BWMA 4F7DA 3GP3A 1NQAO 3S1AA 5I3ZA 3I9JA 1PDOA 5B1EA 5CEEA 5EWMA 2I55A 4F4UA 4CDGA 1VM6A 3OE4A 1I0IA 3S55A 5ALYA 2QL9A 4D9KA 2OECA 1YRLA 3OEYA 3M2PA 4Z4GA 1A8QA 2ZYDA 4KC0A 3H1PA 4N9WA 5F3RA 2FU5C 4Z0NA 3IC5A 1I3MA 3LUPA 3IP6A 2GESA 4B7CA 2GBLC 2PMKA 3WK9A 2YWBA 1RWQA 4OL9A 1OT5A 1OAOA 3B5EA 3C5EA 4UOQA 1GLNA 1H4VB 3BE6A 3QKSB 2VYVD 4GQAA 4MQLA 4Q34A 3RVKA 5EP2A 4F9EA 5C1BA 5KYNA 5LUAA 2VTBA 2HRQA 1TCAA 2J6HA 2Q0HA 3ED1A 2B94A 2ZYVX 3CVJA 3H6GA 5GJCA 1L5LA 1DDGA 2Q7DA 5C34B 4C76A 2OVFA 4RIEA 1E98A 1V8PA 1KK0A 4G6IA 621PA 1Q0UA 3HACA 2I66A 2IUSA 1N2OA 3AFNA 2QEXB 3BREA 3HLTA 1OSNA 2GSWA 1ZH6A 4FW9A 4OATA 4Y0AA 1E3JA 1R9JA 3OLQA 3OQNA 2QX7A 1WB4A 1P80A 3LRPA 4DMCA 1TE2A 2DF8A 4L5BA 4BZWA 2DC1A 3DTTA 4LFCB 3W6ZA 4MVYA 2G82A 5TF0A 1IBSA 3AG6A 1U5CA 1FLDA 2DBQA 3AH8A 1JIUA 1KJZA 3A1PA 1TF7A 1ZEMA 2SNIE 3ETLA 1BKSB 1VL2A 1HZZC 1ORTA 5FF9A 4CF3A 3R6GA 3OLVA 4V0ME 4F6CA 4BGDA 5LFAA 5HKBA 5F1PA 4HZGA 1DCKA 3DP7A 2IUEA 3BMQA 2Q0SA 4OJMX 3O95A 2R00C 1DC7A 1YRQA 2Q1WA 4U6SA 4X91A 3PTAA 3TG8A 4JQYA 2A0WA 1B3RA 3F5MA 1G7SA 2BAGA 4ILEA 3SF8B 4CL2A 5ECGC 3OSUA 1FTGA 3NGLA 3RT7A 3ADPA 4HPXB 3FH0A 7MHTA 3UOAB 1K4YA 3O0TA 4BRUA 1TMGE 5FIUA 1NYLA 4YCJA 1MJFA 2VTDA 4O4HF 1CUBA 1TO2E 4FFDA 4KHZA 4DNOA 2PY6A 1A9OA 5CFMA 3P97A 1S1CA 4C07A 2DFVA 4PRZA 4DYDA 2BKUA 2WHPA 4URYR 5I4BA 3WZ2A 1W96A 2VBTA 1UF9A 4X41A 3AG5A 2NVWA 3IURA 4AL4A 5HNKA 1PSWA 1KI8A 3ESAA 5G41A 4HDMB 4X84A 4BE7B 2R6HA 5C7IO 3C7KA 2C7QA 1P73A 5E9WA 5K0LA 3O8BA 3O1HB 2ZWPA 3ZWDA 1N7GA 2GAFA 4TLBA 1XXLA 3WDLA 4PIPA 1FMLA 1CUFA 4M8IA 2I7VA 4WVFA 1HPLA 3O2JA 5LPNA 3FF4A 2QMYA 5AVKA 4ZT5A 4MARA 5A71A 3T3IA 4UPEA 1Z16A 3FAKA 2P5YA 4Q39A 1RLMA 4AKSA 3QLEA 3MMNA 4ZAXA 4YUZA 5AQEA 4TL9A 4INZA 1ISGA 1I0LA 4V0QA 4DLRA 2FUKA 1NJ1A 3KZNA 4HKTA 1Z6QA 1QH1A 2FSVC 4TQGA 5DF1A 2JD0A 1QONA 1MO3A 4XLCA 4JH0A 3GUYA 1UINA 4HX2A 3DE3X 3ID6C 4FOPA 4JASB 2RHCA 1CY2A 2Z8XA 1HNNA 2BRUC 4KO1S 3NEAA 4XQ9A 1S9HA 2O5CA 2D06A 4HEHA 1MNQA 2PO7A 2ZL5A 2XYRA 3U44A 4KGXA 1JQAA 4FKZA 3RJ9A 4FMCF 4L4RA 2VJOA 4P54A 1NPDA 1IN5A 3PK0A 3ZUPA 1A9XA 2PS3A 3SVLA 4UHBA 2JGJA 2H7YA 3TLJA 2O54A 4LOAA 4IJ6A 4LPKA 2GPJA 2IEGA 1G4AE 2C3MA 3PDIA 4WKGA 4Y1FA 1H8HA 4BMCA 1X7HA 1CWUA 5LOVF 4ZI7F 1J06A 1TIBA 3JVEA 4WTOA 3SZLA 4D43A 5HXAA 1A5BB 1N1GA 2NPOA 1B6TA 1NF2A 1RYYA 2PGLA 4N5HX 5JDCA 3FPSA 2CE2X 1M3SA 3BMNA 2B5VA 5DM2A 2IZOA 2J0UB 3CWCA 3R8FA 1XP5A 4YA6A 1R6XA 3C97A 2RHBA 4MW1A 2B92A 2P6OA 1YJBA 1FSFA 2ZKLA 2GXSA 3CLUC 4I4NA 1DV2A 3LECA 4X00A 8MHTA 4KWTA 1GU7A 3FYHA 5HUHA 4P4SB 1J0AA 2DYIA 4F5DA 1T5TA 5AW4A 1ZOOA 4J1SA 4CHTA 3EEIA 5E9AA 5H70A 1Z45A 4OFXA 4UTXA 4W1QA 1TT5A 3EGOA 4OSPA 3IOMA 1WY7A 4DVJA 4X3OA 3W8RA 3A35A 3IKJA 5ENZA 4CG2A 4DBLE 5HRCA 2AEFA 3P4XA 4K6GA 3FKSD 1ULAA 2CDAA 3ASVA 1ZJ4A 3UG7A 3ZX5A 4F2HA 3CNHA 1CP2A 4N0MA 5AK0A 1DQYA 5F7OA 3UG6A 2DVMA 4L51A 4RK4A 4F3YA 2XVAA 3ZU3A 5JVDA 3F6RA 4W1RA 5EEGA 5IJXA 1AUVA 2XCTB 3AIIA 2EKZA 4DG5A 4ZQFA 5JARA 5KX5A 3Q98A 4J7XA 2P2ZA 4DUZB 2NV4A 2X19A 3BF7A 1YQUA 2LNDA 4OP3A 1XZDA 2JD1A 3RIYA 4B7ZA 5FA6A 3L4EA 1EFRA 1BS1A 2J59A 1B6GA 3ZCXA 2AUTA 1BROA 3WLKX 1A4UA 2HU8A 3GGGA 3AUUA 2PKXA 3ZV7A 3DR3A 1DLJA 1O96B 1IPHA 3RU9A 1IULA 3PVZA 4UJ3A 5IVIA 3G7NA 4AKHA 3NKFA 2QN6A 1V5FA 4H59A 3KO8A 2VPYA 3I28A 4LKOA 3S2SA 3T5GA 2QAGA 1YS9A 4KWHA 3TWOA 2IIPA 2EZUA 1EX6A 3UV3A 5F9MA 5IYRA 4FEAA 5ALTA 4MS3B 5I9LA 3T9CA 2OC4A 1AGPA 2J87A 1Q22A 3DC7A 3MOSA 1CIVA 2IH2A 1O9GA 2QRQA 4R0VA 1L5HB 4DT1A 2WA2A 1TF2A 4RX1A 4UMDA 1EVLA 3FD8A 2NXEA 4MH0R 2FZVA 4XYGA 4DQDA 5LBUA 5C5CA 3PQ7A 1NPYA 2XUHA 4WFJA 1YB6A 2V7BA 1AN9A 3KFVA 1ODKA 3E3OA 4R81A 1XG5A 3RM3A 2J0EA 3KKKA 2OGWA 1YZYA 2POQX 5ALOA 3RHSA 4PBSA 3C0KA 2GXUA 4EKDA 2R60A 1ZVQA 2Y68A 4ND7A 3S6JA 3U49A 4BJHB 1NTOA 3GJ0A 1IYZA 3ZDZB 2H7XA 4JUDX 2JI9A 5LQDA 4HDKB 1E9EA 1FPQA 3FSGD 3NGXA 3KL4A 5EQTA 2YN4A 5TGDA 4B6RA 3LCVB 1HT1E 1KFEB 3SR4A 4B87A 2QROA 5JY6A 5A4KA 2FX3A 3SS8A 4RELA 1EK6A 2FZ4A 3CY6A 4EJSC 1ZCJA 4U4AA 5CK5A 3SOZA 3Q2KA 4DNQA 1LDYA 3FPFA 6CHYA 4C6TB 1NXPA 3WS7A 4DDKA 2QRUA 4O4LB 1S2MA 1T2UA 1BWQA 2PMDA 1SNYA 3OTHA 5JAZA 1YR8A 1HGXA 2FWJA 2YIVX 4XRGA 2PMCA 5DPMA 1MIOA 2W5UA 2ZRMA 2Q4BA 3PX3A 5FBKA 4CDNA 4NEHB 1Z5OA 2YN2A 5A4IS 5A9RA 4U0JA 1H42A 5FA5A 2CJWB 1VJ1A 3P9KA 4GXTA 1HKHA 3H16A 2GF0A 4PCLA 3RFXA 4TKVB 3BIFA 3JYLA 2YYAA 3DT8A 5LYJA 1QYVA 3I9V6 3R8XA 3SKXA 3UK0A 2FW6A 2WSSD 3DL4A 3UXYA 3CCVB 2G9VA 2SECE 3AM3A 4GXRA 4KRXA 4Q7MB 3D26A 1N0WA 3C87A 4LK3A 5ED4A 1W4CA 4DNPA 2FUCA 4IWYA 4AUMA 2MSNA 4NK4A 4NQZA 1WPXA 2C95A 4HAZA 3IALA 2XZTA 4YI5A 3PJGA 1GL3A 5EJIA 4PW0A 2ZIXA 2VK1A 2XTNA 1HO3A 2R7MA 3KJEA 4Q1FA 1U63A 4A26A 1ZITA 4GICA 4TWIA 1A3CA 3VOTA 4ZYUA 1TCCA 3ZCTA 3BWCA 1IY1A 5DXJA 3CX7A 3LRTA 3LTNC 1YI1A 1U2RA 3FROA 4PC6A 3SR0A 5NLLA 2WUWE 2D59A 1XCMA 4HWRA 1U5AA 4Z0PA 2QG6A 3GDWA 4BJ1A 1D0SA 3GH3A 4U02A 5CYPA 3KVNA 1IHMA 1O95A 2OCLA 4I9HA 4CU2A 2M32A 1WABA 1RBQA 1S89A 3BA6A 3NVMB 4ZEXA 1OWNA 3DWIA 5C81A 3ILHA 3U09A 4HH3C 4DWJA 1I4OA 1PTJC 2Q5EA 1E1CB 1UBHS 4X7CA 2FRDA 5U4QA 3TBKA 4Z6KA 1ZM3A 2CUKA 3PUZA 3VTAA 1GPMA 5DM1A 4WNYA 5LJLA 3SPXA 1XDSA 4XIIA 2C7OA 3DUFB 2V96A 4OQMA 1HRKA 5JCZA 4LJ5A 4UHDA 5A7FA 3R44A 2RHLA 1M8PA 2XKKA 4YAJA 2ZRAA 3GQBA 1DBSA 4PGGA 5AK4A 1QVAA 1UXGA 5AK6A 3R0QA 3TVTA 4C04A 4PV7A 4W82A 3WSWA 3KKPA 1TI7A 4HTFA 2XUFA 3H9QA 4B83A 3A0RB 3K31A 3TL3A 2J67A 4OJTA 1QV9A 2JLBA 5A9TA 2XECA 2GVZC 4C21A 4PYMA 3LVQE 4OG2A 3A8KA 3F98A 2JIZA 1D2AA 1C9DB 1FFSA 3FXAA 5C53B 3RRZA 2ZQZA 2QG4A 4QWWA 5IRCD 1N34B 3A10A 2ZBEA 4GDFA 5CD1A 3KUDA 4KMMA 2YNMC 4DFDA 2J5XA 1M9NA 2RG1A 1UOQA 2FAXA 4GX5A 2X5JO 2LGJA 1P39A 2D1QA 2VBVA 5FL7A 5DLYA 5HEKA 5FO1A 4J7CA 3VUEA 3JQ7B 2OM2A 3SC2A 1E1MA 2PWZA 3A9VA 3MGGA 4KMOA 4H31A 3A32A 4M8KA 3PNBA 4AO8A 3FB4A 4A73A 2F9FA 3AU8A 1MW9X 1O03A 3EN0A 3EVTA 3FDXA 2C4VA 2CMHA 2HK6A 4PYLA 4N3BA 3X1KA 1O6ZA 4D96A 3WZMA 4TYQA 3IMEA 4JQCA 1L1QA 2H16A 4NEGA 2EL9A 1PJ2A 4MUXA 1DAIA 2XSZD 2X0FA 1N2BA 3BA1A 4D42A 4KR7A 3QWFA 3OZVA 1I2ZA 5AH0A 5J3JA 1AXEA 1NNI1 1QGUA 3QPUA 4IXTA 4EGSA 4HQ0A 4MV0A 5KQSA 3PVDA 3IUSA 5ED0A 3HJFA 4YJHB 3H2JA 4R98A 1WZEA 3VTKA 2I3ZA 4MPDA 4NH4A 1L7EA 1LK5A 1V4BA 2IJGX 3U61B 3GJ3A 3LT1A 2HJHA 1OXXK 4AWXA 1XDDA 3L02A 1AXRA 2Q3EA 5K3EA 4WSOA 5H3LA 3K5HA 1K8YB 2QAIA 4LRSB 4Q6WA 4MQFA 1NP7A 2ISSD 3GIWA 3MOGA 3NV7A 1IQ0A 5LM3A 4M98A 3W5SA 4TRJA 1C1DA 1A7KA 2V0CA 5BOSA 1X13A 4DR3B 2HA5A 1IQPA 1YR7A 2JKVA 2DPXA 2IU0A 4ESHA 1D04A 1OH5A 5JT1A 4YMUA 1T9GS 5I8PA 2FCRA 4DBZA 1VHWA 1BEEA 1DXOA 2YL2A 3LUFA 1N5RA 1PL0A 1TVEA 1UXOA 3ORYA 3TPFA 5DNVA 3ICEA 2XR1A 2R3SA 3HY3A 2MWMA 3KXKA 3KOXA 4G1EB 3DE6X 4F84A 3EVNA 1SBTA 4CG0A 1E0SA 4XGNA 2DKFA 2CHFA 2GJRA 3OIDA 1K9SA 5JCOC 1AKTA 1L5GB 1L4HA 1T9ZA 1SD1A 1ZWKA 5AM2A 3K70C 1TYAE 2H1OA 2TMKA 4P9SA 1G8SA 3O3OB 1O89A 4RORA 3M6MD 3RK0A 2FMTA 3F3MA 3HZZA 3I0ZA 3IESA 3JQEA 2FZWA 4ZOLF 1X1TA 4R3WA 3WOHA 1XPRA 2JF0A 3EAFA 3T12A 5CDHA 4WCFC 1Q11A 1RMTA 4KGVA 2YXBA 4MKZA 1I32A 3VR4A 4G89A 1P5HA 1FXWF 3S2ZA 2JBAB 3EF0A 3IUMA 3ONDA 1SELA 1UBFA 1Q7CA 4YEJA 1MR3F 1RC1A 1HG0A 4FDTA 3TLYA 3NAMA 3M3DA 3UGQA 3WI7A 5JIBA 1G1AA 1NX9A 2NVUA 3HK2A 2CLOB 4RPJA 4TVSA 2NUAA 1ULHA 3TXAA 2X6WA 4XJSA 2IBSA 5JPCA 2WPNA 1V5VA 4LHZA 4CKBA 2RGWA 1WY5A 2ST1A 4Y1RB 1MNAA 4OV6B 4B2IA 4WH0A 1T8SA 5CXXA 4DJFC 3U19A 4EA7A 4JKOA 1EMDA 4L50A 5K3SA 1H3FA 4FHDA 4K3VA 3EXIB 4M9QA 3WIUA 1JHUA 1FQWA 1D8TA 4FYPA 3SFZA 4C89A 1VKZA 4RPKA 1G21B 2Q5JA 3PDUA 5I3CA 2QSUA 1DC3A 3G2NA 1TIPA 1AXGA 1L9XA 1Q6ZA 3RVLA 2A92A 1W0KA 3PKZA 4X71A 5KYWB 3OUUA 4MUIA 2IDZA 3DAFA 4X1OA 3AOEC 3OQHA 1XRPA 2ZYSA 3OOEA 3MWDA 4RNCA 2H08A 1B43A 4ZVNA 3IEVA 3BEDA 3EEBA 4QXOA 3EVGA 2L19A 1LV7A 521PA 3ROXA 1ADFA 3V80A 4A1FA 4G2NA 4OXRA 1EESA 1UADA 1MX1A 2VJLA 3UMJA 2WKPA 2NXNA 4Z4HA 5B1SA 2CYAA 4GBJA 1EFCA 1KQPA 3TRJA 5AW3A 4J16C 1J39A 3JQ9C 3ZHCA 4B81A 2GM4A 2P30A 2Q3DA 2VPXA 2J85A 1D1SA 3GU3A 2ZI6A 5DCYA 3DULA 3HPRA 1NC1A 4H6VA 3OJLA 3GFVA 3OETA 3P20A 3UAWA 1IDN1 2J3QA 3AEKB 3A9WA 5DTEA 3GJQA 4GKBA 4NF2A 4PYQA 1DBIA 2J7PA 3AW8A 1MO5A 1XBTA 5AKGA 4ZMRA 4H1WA 1JPUA 3BSYA 5ALIA 2VEDA 5FUYA 4I8XA 4M9ZA 3H9NA 2ZUWA 1HETA 1MQSA 2PRSA 5C8YA 1K4MA 1C0IA 1I9GA 1DX9A 2BEWA 421PA 2B99A 3H6KA 2XKBA 3N05A 4J43A 5KHOC 1FCJA 5HKAA 4U2GA 4CKXA 3ORSA 5JNSA 1NKVA 5GJVC 1DKQA 4M54A 3O93A 4HNAA 4MVJD 3T9FA 4BCDA 2FH5B 4EKEA 3A6LA 2ZWVA 1DEKA 1PJ4A 4B6GA 2BEJA 5A6VA 1LVGA 1PFYA 3N0WA 1P29A 2VDWA 4ARZA 2I9KA 2Z98A 4DJAA 2WJJA 2G9ZA 1P17A 1Z13A 1V9CA 3VPCA 4YB8A 4OYRA 3L3BA 3LFUA 5C2JB 4W7IA 5J2UB 4ZU6X 4P3YA 1T9KA 2DUWA 2IK8A 5FPQA 1AK1A 3WSVA 2F1JA 3IVAA 3O9MA 4JFRA 2OVBA 1TJYA 2Z2ZA 3KL9A 3WGQA 4ZDKA 1N4DA 2VS1A 3FYSA 1VE1A 5F9HA 3G49A 5KYGA 3LYHA 4NABA 4XVQA 4XCXA 3WGJA 3ETHA 1KEUA 2JI6A 1SXJC 3BJIC 4JAVC 3KNZA 2Y6UA 4PSKA 1LCIA 3WL6A 3EG9B 2JN9A 2XNSA 3CRRA 4BP9A 2FPWA 1U7HA 4EAQA 1BDBA 1WORA 1JR3E 3IP5A 5HJ2A 4B80A 4GSLA 2G5CA 1Z25A 1JXOA 2JDID 3E58A 1E2QA 4A82A 4ERNA 1DIAA 3HNRA 2ZBDA 4BGEA 4E51A 2B4AA 4GOXA 2O8FA 2HCJB 3F5QA 3IDSA 3MMZA 3C3CA 1C0EA 3NUZA 1E3TA 5CEJA 4AVYA 2XTAA 3F5DA 1KMMA 4JMQA 1F3LA 1R4NA 3D4NA 3GCZA 3NBUA 2H1LA 4V1CB 5FPTA 2IE8A 2EJBA 3HNOA 4MLZA 4MUEA 3M1YA 1T3HA 1K3UB 1LKZA 4OFWA 4Z7QB 3AFGA 5B4TA 3CH6A 2QZPA 4BO8A 1P81A 3IVCA 3B1JA 1ENPA 3CZ9A 4J07A 4K9KA 1XXHA 2VRWA 4UBNA 4ZVMA 1NXQA 3Q10A 3IMGA 3GLKA 1IJEA 5ICEA 5LP6B 1KJWA 1U0HC 2ZE8A 4ZGGA 2BFCB 2UYYA 3UAGA 2OFPA 1ZGAA 5DCUA 2Y1WA 3A9SA 4L2IA 3OU6A 2V1XA 5EPEA 2NZWA 1MT0A 3GUCA 1AB6A 5FOTA 4I55B 1Y7TA 3GG9A 1XTIA 4XB2A 4WKCA 1X2BA 1Y6QA 1FFHA 5J59A 3F67A 5FTNA 5AKHA 5IDYA 1LLDA 3MT0A 3PFFA 1NDQA 2E18A 4YV7A 2ZLBA 5EKDA 1DT5A 5D8DA 5GZ6A 2EX4A 2HQ1A 4MUFA 2VPIA 2C3OA 5CX1B 3SU8A 4B75A 3GEHA 2PGJA 3PIRA 2BZGA 4I81A 1IJKA 3P9QA 2X15A 2GWHA 4NOLA 3OHSX 2UU9B 5DN6A 3FZEA 3PT5A 2PXAA 1YZTA 4QM7A 2O7QA 4KX3A 1NQOA 4TN1A 3MW8A 3OEWA 3PGLA 4B76A 5A4MS 5IZCC 5DNYB 2VH5R 2YDXA 4ZHQF 3GCGA 4ALMA 2VSNA 3ORRA 3ILVA 4MVXA 1W88B 1Z5WA 1FYEA 4XUDA 4XGKA 1G3MA 4Q3KA 3T5MA 1UJMA 2P1DA 3D5TA 4L5YA 4M2LA 4YCCA 1XK7A 3DV9A 1L8OA 4INAA 3QF7A 3DBHB 4TV9B 1Y63A 3ZE2B 2XZDA 2YV3A 2A3NA 3C3AA 5TNXA 3ABOB 3J80A 3PQ2A 4PIMA 1JH8A 3VR3D 4A2QA 3VR6H 3DOIA 2XB6A 3QEOA 1E2MA 3JD4A 2NZ2A 4OHRA 4URWR 2X4LA 3KKEA 5BV2P 4NZOA 1EHCA 3K9HA 2PL3A 2W2OA 3ET5A 3WFIA 3PG5A 2MOKA 3GOHA 1ETUA 2K5UA 3O94A 2CBXA 2OR3A 5EWMB 5HX7A 1NQVA 1TQHA 1T6XA 1IUNA 2XPCA 4H60A 1ORDA 2FJ0A 3LBIA 1KMHA 1ANKA 2WJZB 3PQ6A 5ALLA 6REQA 3HEAA 1N5JA 3K6SA 5CVCA 1NG1A 4NE2A 1ZMTA 2FZEA 4M83A 5DOZA 8AT1A 5FQOA 2GJ8A 4DQKA 2VHQA 4D41A 4YXWA 3E27A 3UPUA 4UVIA 3QYJA 5FD8A 1ZUHA 1JTEA 4R2WA 3KQMA 4M36A 2H5JA 2WJ4A 3L46A 3RS0A 4ZOEA 1SUAA 2VTBB 1S2NA 1W4BA 5HKLA 3GWGA 2YR0A 1N2IA 3BMOA 1DKUA 1B73A 2PZEA 3VYVA 5I9NA 4TS9A 4MWDA 2PXHA 4HDNA 3KVRA 1G9SA 2QTFA 4R51A 3DWEX 4H77A 5L6MB 2YW9A 2QLTA 2W6JD 1VI5A 4KVGA 2Y6VA 2AB0A 3RC9A 3ZDQA 4OFBA 4EFKA 2I62A 2WPDD 3P4UA 5IEJA 1ESEA 3JQCA 3CW2A 4QOEA 5AJHA 3R3XA 3IBGA 4PM4A 4PSVA 1YK0A 3FTNA 2VXYA 3RYHA 1WP4A 4CZ2A 4DKJA 3A26A 1ZI9A 3M4NA 5FAXA 5JO9A 2G9UA 4WOBA 3JVIA 3R6TA 4CM9D 1HG1A 3DBVO 4P1ZA 5BV7A 4P83A 2IIBA 3BFVA 3EGXB 5KBYA 2EZ8A 3I3OA 3CKKA 4ENSA 2GZ1A 2OFFA 3BJZA 3PSHA 1V0FA 2CMDA 2J9RA 3BMQB 4HK4A 3JQFA 4JJEA 3BB3A 4KE7A 2BSXA 2J5BA 4G67A 2PXXA 2F1IA 5KNLA 3UJ3X 2GUWA 4R2HA 3NWJA 2PYIA 2ZL7A 4H7PA 3HYLA 4EB8A 3CHYA 1UDBA 3K9GA 3B3GA 1NNSA 2FOLA 5DK6A 2CUTA 1M1YE 4BAZA 2XEXA 5C5DA 3DKIA 1M10A 1X9IA 3BXOA 4A15A 1DJOA 3H7AA 3QXJA 1PJSA 3I01M 3IGFA 3OJ0A 3D1JA 3QA3E 4I4TA 2JK1A 4C06A 5JJCA 4I14A 4NCKA 2QTHA 4X20A 2NPFA 1MV5A 1Z7EA 2H3EA 2OZVA 2F8SA 1NZJA 3AY3A 1YAJA 3OFND 1TVMA 1XKTA 2EBFX 4NCAA 4UTRA 4ARVA 2HOQA 1T2CA 4HX9A 1EWTA 2D3LA 4UQOA 1MORA 2QM0A 5K01A 2O8VA 1N2SA 3NHYA 5LL6P 2W93A 4RE6A 5KYYA 2QA5A 3RSOA 4OTZA 4DMGA 1UMKA 4TLLB 2I8AA 1DHRA 1H2HA 3Q7TA 3OD1A 3AF6A 3M1LA 3ZV3A 1R9MA 2WG1A 3R9XA 3OKXA 3OZTA 2HQSA 4F2DA 3BL5A 3WSTA 1GUDA 1MQ8B 1SVIA 4PHFA 4WT7A 5KWEA 3HBMA 2D13A 3VO1A 2JH9A 5HRAA 4AWAA 2R5WA 3H0KA 2C5LA 1E9FA 2LV8A 4BB0A 2CLIB 5DI3A 3VYWA 4EHIA 2NT3A 3C3EA 3DLAA 1QH1B 2XCIA 5EXDA 2CCKA 1JJ7A 1KP9A 5KYVA 4EKNB 3QVJA 3CS3A 5L7YA 5JW6A 3PEUA 4TXLA 1XR3A 1I24A 1Y9JA 4GRDA 1TVKA 5THXA 1CU1A 5L8VA 5EP4A 3RC1A 5BN1A 4LWPA 4CF5A 5JXGA 1QBKC 5TB5A 3U44B 3FFXA 5H9VA 1H2EA 3U1VA 1FDOA 4G24A 5IDVA 1OH6A 4TQUS 4PQGA 3RFUA 5FNZA 1M72A 1MJHA 3OOWA 2ABWA 3LLVA 4KXNA 3W78A 1A9XB 2DBZA 1BPLA 1L4LA 1LJUA 2NZXA 1CV2A 1R6AA 1U0RA 2OP0A 2GBLA 3FTPA 3K0KA 3OURA 4II2A 4QXPA 5A5GA 1CT9A 1U3UA 3E5NA 5KS2A 3G2LA 4HJRA 1UCFA 1UJ2A 3NC0C 1OE0A 1F8GA 4GWLA 4RW0A 4YUWA 5IN5A 1N7IA 1JMVA 1W9HA 4DCTA 4HQLA 1TM7E 3C3KA 4IG4A 4Z9XA 1ZX1A 1T26A 4C14A 2XMQA 4O4JA 4AU1A 1BD4A 1SOMA 1TMKA 2E5WA 1BSVA 2N1MA 2OE2A 4Z4WA 2TECE 2H17A 1EFKA 2Z1MA 3BMNB 3DD5A 3EVCA 3F1KA 3PNOA 3RTBA 3ZLTA 1BGWA 3HCBA 1FUUA 3QGMA 1CY0A 3DXXA 1Z47A 3OZRA 4ENRA 3QVVA 4ALIA 3II6X 1FVXA 4BO5A 1VJ0A 3BGDA 1D1PA 3OTOB 3LOUA 5D7BA 2GBCA 3CXRA 5LIRA 2AQHA 2XVYA 1MB0A 2AR0A 3C6MA 3HCFA 5AHXA 4DZTA 4IS3A 4AJKA 1N2JA 4WZAA 2X6YA 2FEWB 2BN4A 3I0MA 4Y67A 1KIMA 1G3RA 1U7OA 1EBFA 3LSTA 2R6R1 1HZZA 2VA9A 3TX2A 2V7UA 4A91A 1ADJA 4R05A 4JWKA 1HVXA 2R00A 2VEOA 3BL6A 1MMFB 2BY4A 2QLLA 1SK8A 1USUA 2I71A 3UTCA 1FQJA 1TCVA 3SM9A 3G68A 3GJ7A 5KX5B 10MHA 3RSHA 1T3GA 3K0CC 4XL9A 4D45A 5AKJA 2PT6A 5FV7A 5HIIA 3IR7A 3QEKA 1SA0B 1UBTS 1LI4A 3GRYA 3VSEA 3QH4A 1YTUA 1ID1A 3E48A 3ZS8A 1Z12A 5H82A 2HMSA 3FPEA 4KIJA 2Z3WA 1HL7A 3B2NA 3G2IA 3RARA 5LLDA 1IN1A 3G6EB 5IKXA 4K86A 3NVDA 1P77A 3WBJA 2EV9A 2QW1A 3L04A 4PPFA 1BE6A 3Q6RA 1W5AA 2FMIA 1A2OA 4P3IA 2AJ8A 2GEVA 2QAGB 3VM6A 1ZAYA 1Z5UA 4RF5A 4NBSA 1WMEA 1QF6A 3K8QA 2QT0A 2ACVA 4AMYA 2Q3LA 1B8VA 4WW0A 4MLPA 4NBTA 4WZLA 4TLAA 3ZHRA 2GLXA 4MKRA 5JS1A 1F06A 3RHZA 2D2XA 3EQ7A 4IFBA 4P3NA 2NVOA 2ZATA 3RC7A 3TXXA 3VVLA 1RKVA 1DFIA 3HO1A 2BGTA 3KAKA 3RBXA 4DSAA 1ODFA 3GBSA 4G9GA 4AYXA 5B7PA 1E8NA 2F67A 2NT4A 4TWZA 3PHJA 1TM4E 3IELA 2WILA 3OPYA 3Q2IA 4LX0A 4R8MA 3Q15C 1X1DA 1PDWA 2KQUA 4DDUA 4YRKA 2DP4E 2FSVA 3AESA 3ND7A 2Q1SA 3CB4A 1AA6A 3IIJA 3NGMA 1NV8A 1ADYA 2VP0A 1WSAA 5JJBA 4NR0A 4GM4A 5EZYA 1KDYA 1ZJZA 3TQHA 3U3OA 3GJZA 1YXMA 2AJLI 1GR1A 4YLEA 4RXMA 1PVVA 1M34E 1Z0IA 4YJ3F 2OXIA 1E5XA 4P4LA 3UFBA 2QNIA 1MEOA 1OKKA 2AEMA 2FF5A 3LGSA 3NNNA 4QUKA 4TS1A 3PLAE 4M49A 3H9UA 4QNMA 1JZTA 4CLDA 3AEYA 1NN5A 2GJ9A 4EF5A 4C0SA 1MIOB 2XADA 4TQ9A 4B85A 4Z3KA 1L8XA 3MPOA 5IK2D 1E4OA 2ZXHA 1W49A 3I8OA 5KYTA 1JE0A 3MAGA 1JLLB 4JJ7A 1K92A 4IFEA 2G70A 2PQ2A 1OZFA 4JJAA 2X40A 5EYPA 4YVFA 4F3KA 3Q8KA 1JSCA 1T43A 1YQXA 4PYRA 2OYNA 4TN5A 1C0KA 4ZPJA 4F4CA 4N7RA 1Z74A 1XN1A 1FVFA 4OKIA 2WF5A 2X0RA 1VL8A 3HS3A 1MFZA 1Z8FA 3TL2A 1KQSB 1NL3A 3DM9B 1Y42X 4RFLA 5HK9A 3G9XA 1EI9A 2CXNA 4H4DA 4R9RA 1NJFA 4K88A 3OU2A 1AMOA 4ZTBA 2I2XB 1UC8A 2ZIXB 3LI2A 1H1TA 4EHLA 4OO3A 1ZN8A 2ZB7A 3CUEF 4XJTA 4AMBA 3GARA 3PFNA 1C3OB 2LDXA 5BNZA 3DZFA 2PZGA 3HVJA 1N78A 2PFKA 4P0PB 1CJSA 1BXRA 2K87A 2Q41A 2OEPA 3GGSA 4H17A 4F38A 2G0AA 4JIMA 1NB0A 4PQFA 1PG5A 1UK7A 3GROA 3NAZA 4BRWA 4RHCA 1L7XA 1GL9B 4HB2A 2WJWA 5CAEA 3V00A 1HV8A 1R16A 3BAZA 3T0FA 4RLZA 4JVOA 4EB0A 1UKBA 5JC1A 5IS2A 1SUPA 2O6LA 2XCOA 4DK1A 4PZAA 4C7VA 2F1LA 4RCZA 2Q2OA 5CBKA 3EZ2A 2J4CA 2XB8A 2IDKA 1Q7YD 2NWQA 4KW7A 1OIXA 4KG7A 1ZIXA 1GSAA 1DOAA 2D0IA 3E15A 4XI9A 1JSXA 5IAAA 1E6WA 4MVJP 3HU3A 2XXAB 4D0LB 4OA5A 3DTVA 3DOEA 3Q4GA 4I5FA 2X3UA 2YY7A 3N6VA 4FSHA 4I2NA 1PSDA 3GQBB 1TRKA 2XUZA 4HCJA 3WL4A 5U1PA 2RHDA 1FZTA 2GEKA 4FYIA 3LHIA 4X05A 5IT4A 4HZUA 5EJFA 5JD6A 5JNVA 1WRBA 1XTZA 3Q40A 5J4KA 1QFJA 2Q4OA 1Z6GA 2G8NA 4M46A 5L3VA 3BB1A 3VX4A 4F45A 2HQRA 4JYPA 3A2LA 1ZO8A 1MQAA 2E55A 4CKCA 1CK4A 5FEUA 1EFDN 2PGDA 1YONA 3Q3JB 1Y1LA 4MYSA 2DCUA 3PJRA 1Y1QA 2IS4A 3MM4A 3PPVA 3FCEA 2REOA 1WHSA 3IMKA 5ALGA 4TWBA 2O0HA 4F8YA 4PX9A 1FS5A 4RXTA 4WERA 4WE3A 2WY2D 3W9YA 3ZW7A 1WCV1 1XQWA 5EUCA 5T3YA 3C7CB 3SC2B 4XLFA 2QM8A 3VJKA 1RLUA 4FUTA 4UZUA 4M1OA 6GPBA 1T0BA 2Z1NA 2PKQO 4KK3A 4BMPB 1U1FA 2VI5A 1EAYA 4EJSA 1K73D 3WA6A 1BH2A 2YIDA 2X8AA 3GRZA 2BM8A 3RYFA 1YS6A 4JB8A 3DHWC 2CDCA 3NEJA 4G0OA 5FPSA 4M0LA 3GUUA 4JBIA 4WK4B 5D86A 4B7AA 2XCRB 1OI2A 1NRXA 4CEHA 3L2OB 3HN7A 5MDHA 2IXTA 1KY2A 2QRJA 4OB8A 4P0QB 1J49A 4ARIA 4MUMA 4O4IA 1EWQA 2P75A 4OOSA 4EB3A 4UTOA 3OX4A 3G02A 5AJXA 3TQTA 4BEWA 3QVGA 4K9MA 4ZAFA 4TKLA 2I76A 4X7DA 3AETA 3C3XA 3CX8A 4LJAA 1RYMA 2WWYA 2FN3A 3A4LA 4LISA 1D5CA 4BMDA 1EUQA 3O73A 1IXZA 5HZBA 3GFBA 3SDSA 3DQQA 4G1UC 2A59A 1JWLA 1P9WA 2RI0A 3D6VA 4UXIA 1SULA 3DSRA 3UICA 1VHEA 3PLNA 4FYKA 4L1KA 1OI3A 4MQFB 5JCJD 1VLQA 1DADA 2EP8A 2O0KA 1FYWA 4Y9SA 1OQAA 3P9PA 3IERA 1C1DB 5BOSB 3IYLW 4REMA 1G7CA 3Q0EA 1P0QA 4Q1DA 2O2DA 1D2HA 3AL3A 3C7TA 1UJ6A 3MGAA 4QREA 4DZZA 2NTNA 2UUPA 1M8GA 1MQ9A 2ZAIA 3KJIA 3TUZC 2JFOA 2H07A 1JILA 2JHFA 5D01A 4JV5B 1P4HA 1KO4A 4PSAA 2JGNA 2O2JA 2V55B 1ITZA 2ZETA 4ENTA 4I08A 1Z38A 4K9QA 5ECWA 2ONZA 1W29A 2JA2A 5FUXA 1UDRA 4FEEA 4WKPA 3BCHA 4DLKA 4Z51A 2Q1TA 3G17A 4C0JA 4EW6A 1CUAA 1QHGA 2NXWA 3AP2A 5THKA 2MIIA 4UAVA 4DXDA 1MHTA 3U31A 2SKEA 4XLHA 2BFOA 4CQMA 3V2UA 1J21A 5EJ5A 1DZIA 3E7DA 3NLLA 4LRWA 4LHVA 3VX3A 2AZDA 3GYGA 1CY4A 2VH2A 1B3BA 3SKVA 4F1KA 2XV1A 4FYWA 3CCCA 1F6WA 2OGUA 3BDAA 4WJKB 2H6EA 4IINA 3BRCA 1QYWA 2ZJOA 1Y37A 3RAPR 1ACMA 1HT2E 1JHOA 3ODGA 4QYMA 4Q16A 3N2LA 4WGGA 1ZGZA 2NVUB 4ARBA 5JNUA 4NNJA 1EKXA 1Q0QA 1FNCA 2CNWA 2JFGA 5AK3A 4CMEC 5B64A 4G5RA 3KZVA 3FCUB 4LSGA 3KD2A 4UZEA 1ZVKA 4CKBB 2IVZA 3H4VA 1UFKA 3I32A 2PUBA 5LB4A 1RZ3A 3WDMA 2JL1A 5BWMA 5GAJA 1VCMA 2ZIUB 3K1YA 2OBTA 3C1TA 1RI1A 2FG7C 3FMPB 5LB2A 4EECA 4Q9JA 3RUPA 3K20A 1J90A 1AIPA 1PWHA 4XOUA 4KE8A 4NG5A 1B8PA 1N2XA 1V6SA 3TSAA 3FCXA 3WFZA 3I5XA 4HQNA 1A2KC 4O1HA 5DI9A 2H0AA 3UMCA 1PZFA 3I9MA 2D4AA 5IBCA 4AROA 2YNMA 3D0OA 3CX4A 1TL7C 3H17A 3QVKA 3OCWA 3NAGA 3A4NA 4I9FA 4ZVQA 2YWGA 3G2JA 1ID8A 3LNNA 3TIIA 4QKQA 1O0CA 4EG0A 1ZHFA 3CPHA 1CHDA 4IVQA 1K9MD 1D0VA 2XA2A 3H2GA 4CLEA 3H5LA 5A5EA 3EARA 3GJ8A 3I05A 1SOWA 3KT6A 4L6IA 1U6KA 2BFDA 2DUUA 3L93A 4OQPA 4R1MA 3SMVA 3I1IA 1NM5C 3I01A 4ZYVA 1MX9A 3UJDA 2F8TA 3T9EA 1PIWA 3ZWQA 1OU4A 4NYMQ 1S6YA 1UEXC 3R7NA 1ETHA 3MBOA 3Q38A 1L5KA 3F6BX 5JSQA 2FQXA 2VHTA 3AUJB 5AI9A 4JJGA 4EY7A 3GAFA 3BAFA 3I4FA 3AF5A 5IKOA 3T52A 4BO7A 5JMWA 1PWEA 1BDHA 2QRMA 4GECA 2VT3A 1W94A 1O97D 5B2ZA 1SCBA 3RQIA 4EY4A 2O4CA 3LKVA 5SY9A 2WHEA 2P9JA 3WXMA 2BTQA 3HSSA 1NP6A 4HBZA 1WKCA 5BMVF 3HRIA 3DFIA 3WNQA 5CDUA 4KRFA 2AOVA 5J47A 3OJCA 5AHWA 1DRWA 2V7XA 3SIPA 1J5EB 5EHNA 4BECA 1N32B 1YCDA 1HLPA 2XAAA 3H11B 3QYAA 1Z0SA 4X45A 5HIJA 4XTCS 3C4QA 3HLKA 4LF7B 2D2IA 3GVHA 3HA5A 1VG0B 1X15A 1H9BA 2AI2A 3IVRA 4HNAB 3L7BA 5FBZA 1YC2A 5T6MA 3CP2A 4EOGA 4OBBA 2P9QA 4QQNA 1VKHA 3GUVA 4TVBA 2X0KA 3EULA 1BGXT 4H7FA 4EG6A 2OCGA 3IKVA 2ZULA 4MYCA 1G0NA 3UPDA 4NVRA 2W11A 1MOQA 4H3HB 1CUUA 3UYKA 4ARZB 2H3HA 3OJWA 2I6GA 2IHYA 4H1UA 5BR4A 4EHBA 5IAGA 4PAAA 3FYUC 1RM4A 3IPLA 2QAJA 3QWHA 4TKMA 3L82B 2JFQA 4MW6A 1FDRA 5DGDA 5JCOA 2ZRLA 5I7UA 2I22A 3TFQA 1UKCA 4GW3A 1WBJB 5FBLB 1BLIA 4DQ0A 4BIIA 4QIHA 1HBJA 2OCBA 2ZYGA 3HBLA 4ZWNA 3RS3A 1XAGA 4GOMD 1TKCA 1QYDA 1ICIA 3IP9A 3HU2A 1ZZEA 2YVKA 4CR8A 1WZCA 2I29A 3NCTA 3FUTA 4LX8A 3V7UA 1JFFB 2CSXA 3PNLA 2I7CA 2BR3A 3ZHXA 1TU0A 1S2OA 3HRHA 3ER6A 3I58A 4RDJA 3L49A 1DL5A 3ZV4A 5CVUA 1E96A 4ERXA 4OM7A 1QP4A 1QE3A 2WFMA 3NOOA 2O8FB 1PS8A 3HKBA 5G40A 3SJBA 4KWCA 2XXBA 5CURA 4MJ3A 2REXB 3OD5A 1NLUA 1R4NB 3SDZA 5BW8A 5A7GA 2W4MA 2GNPA 3QFHA 3FWNA 4OOXA 2HIGA 2AI1A 2C4UA 3IT2A 2P3OA 3JVVA 3KB2A 3QQ5A 3TTXA 3HVUA 3PXGA 1WW2A 2BH9A 3GLTA 3VR5D 4RCYA 5E2BA 4DMHA 1XJQA 4Y2GA 3B1VA 1W5SA 1R3UA 1XXHB 4FOTA 4HEQA 2ZAMA 4L7VA 1YD7A 2DTDA 1TLTA 1G5TA 1UD8A 1XAJA 2G88A 2PVSA 3QUTA 4O2AF 4RKEA 3G23A 3H9BA 3W3ZB 1IUKA 2C8JA 5EMNA 4L2IB 4M89A 2PDAA 3JARA 3EH2A 4LGCA 1DO8A 1YJCA 5JQGF 1E2JA 3O21A 4PBTA 4RTKA 2ZT6A 3O4VA 3SS9X 1NATA 3D4LA 1SKYE 4U9UA 4UM9B 2Y1OA 4JBXA 4BE9A 2PHZA 4J16A 4A1OA 3JQ9A 3QI2A 3T15A 2GX6A 4EJ2A 1IWPB 2VK4A 1U28C 1U3GA 1Z6AA 3HJAA 5IP5A 2XCSB 1ZR2A 4QULA 4C0LA 1E5DA 4D9CA 5H9WA 1L3IA 5A06A 3ZI7A 1YHZA 3CGWA 3KJQA 3G2QA 4W99A 4GZ3A 2FR1A 4MHSA 5KDLA 5ALMA 1MABA 2BL4A 4GBMA 3HHPA 4B5LA 4HJXA 1V95A 2GEUA 1S7GA 1UEIA 2VBSA 3EZ9A 1KYYA 1PUJA 1WPRA 3P9ZA 5FWXA 3ZGLA 1EBUA 2EBWA 1B2LA 3X1MA 1PNTA 4YC7A 2C98A 3VPSA 4BBZA 3H4TA 2FSSA 2ZJBA 5F4JA 3ILYA 1EBBA 1H8ED 1DHTA 3DV0A 3IQZA 4X94A 2MMGA 1A98A 1PJZA 3LXXA 1WUYA 2Z4TA 1MOPA 3ZCSA 1V7CA 3K1AA 3MJSA 3ZCVA 2OWEA 3IIIA 2OCPA 3DMRA 3KQTA 3EEYA 4PHTA 3CTAA 1SEPA 3H3XA 1PVDA 3W3AA 2X8KA 2FSIA 1E2LA 2GD1O 4RGVA 4IXNA 3H8JA 3JQAA 5LNK6 3CZ5A 4XUGB 4MQ4A 5TEWA 2GTPA 4YMGA 3C43A 1FFAA 1KMHB 2Y0DA 3NTQA 4KIGA 4DNXA 1A2QA 1E18A 3QE2A 1MIHA 4Q1AA 1IH8A 3RTAA 3K6SB 1ONNA 2F6RA 4PIVA 3GVJA 5E6SA 5BSYA 4ZAYA 6LDHA 3VH1A 2NLOA 3PICA 1NVTA 2O6HA 1VHLA 5K4AA 1U2QA 4LHWA 4GE0A 3UUWA 4CHGA 1SXJA 3NRJA 1U1EA 3W6OA 2XBLA 3DWFA 2FEXA 3N58A 4C78A 1QCYA 2B1RA 1BXGB 1OI7A 1W48A 3BMOB 5CM2Z 4C2BA 2KBEA 3GLIE 1IVSA 3WLQA 4BX2A 4DWVA 2J09A 4AY6A 2W8BA 4QRHA 4HDNB 3V4FA 1Z4MA 4XWOA 4S1VA 3JQDA 4B44A 2EX0A 4JVNA 4P4UA 3SC3A 3M1IA 1D6NA 4TXNA 4P7GA 3W2IA 4OGKA 2OK7A 1KYVA 3ABRB 5DBGA 4DA7A 4B4OA 3EGWA 2VRCD 2OO3A 4EUSA 4IIXA 3B8HA 3LT4A 2P5SA 4Q02A 1XLUA 2P1RA 3ST7A 2JJ2A 3FPCA 5AKYA 5JNTA 5KOJA 1WXQA 3MF4A 3U3MA 1H66A 3UBTA 3RBZA 5IPFA 3ER8A 2QOEA 2F3UA 1U8CB 3X2SA 3FYCA 1KOJA 1T4MA 4MCIA 2PLAA 2ZBRA 3GMIA 1VC2A 2GM5A 3TD9A 5A5VA 5JCPA 2UXCB 2HDWA 4DV4B 3KTDA 3I4CA 4NY1A 3GCXA 3L7MA 5IBRA 2PX0A 1IHYA 5BUQA 1DAMA 1KU0A 3ZDFA 1XZPA 1OXVA 5FYDA 1T8YA 3BFJA 3GJ4A 3QXHA 4URHA 5UKDA 4ZVRA 1VKOA 2Z5VA 4NAHA 4RJIA 1MRZA 4Y2QA 5EJ7A 1E3MA 3I9KA 3GJSA 4BNMA 1U94A 4ZVVA 2EXXA 4LVOA 3SXPA 5CB8A 2BGWA 4D5GA 1NURA 1RACA 2HJVA 3ROTA 1RRMA 4YQZA 4ZEMA 1XRMA 1JQBA 4I4TB 3VU8A 4QOJA 2W2PA 5F5NA 3EXHC 3UJ9A 1NIPA 2FDXA 1TU4A 1KZ1A 2D6FA 3FNEA 3JSAA 2XWQA 2XDAA 5H59A 4DSTA 1KI1A 3NM5A 3UMGA 2DB3A 3O82A 4Y6QA 4X06A 3NWPA 1TJNA 4RS3A 4R9VA 1S5PA 5IZCA 4NXMB 3OC6A 1R8SA 2DJ5A 5JXJA 1VHTA 4JBNA 5IXSA 1GD1O 5F76A 2QX4A 5BR7A 2P3SA 5KYYB 3I2IA 1GFWA 2WAYA 2YV4A 4OAOA 3VJLA 4AS2A 1W2WB 1JHDA 5DNEA 1AGXA 2HN9A 1HKUA 3G5UA 3NCHA 2Q5LA 3CPEA 3R9XB 1RYNA 5IFKA 2ATXA 4M8SA 1R37A 3G7UA 2BF4A 5D5HA 3ISTA 1KQGA 4FGUA 1PQ4A 2VSXA 1TEZA 1WPGA 3DMNA 5JD4A 4F4IA 1WCWA 2Q3FA 3MAAC 3FAZA 5SZIA 1Y8AA 3UMRA 3RVSA 5I47A 3IE1A 1NAHA 2NU9A 5BSXA 4JB0A 4C1BA 4CV3A 5CA1F 4DZRA 1GLGA 2HU7A 3PUKA 4UUBA 3H8VA 5DWDA 3UH0A 1NBEA 1C4WA 1CW2B 1XWIA 1YMUA 2VL7A 2P9HA 4MJLA 3USZA 3I04M 1TVKB 1JBQA 4TWRA 3PR2B 4X7MA 1DBRA 1R6TA 3EBPA 4A23A 3CEMA 5CHYA 3ZDYB 2PZMA 1B14A 2I2BA 4XQFA 2GCPA 5AM5A 3JD2A 1E2KA 2VHUA 2ZJYA 4KWIA 3RVPA 3U7QB 3A37A 3WK5A 2M6RA 3TINA 3V9AA 5I4CA 4O63O 2WYRA 4IUYA 2ID9A 3F8SA 3ZDDA 4LC0A 5JXWA 1F5NA 2CJFA 2GDZA 2ZCUA 3PNSA 4FFPA 3R5FA 4RDCA 4C4TA 1LSUA 1Z7YA 1PNVA 4QPNA 1RJEA 1N1EA 1WXDA 1XZHA 2R7KA 1QE5A 1C1HA 2PAFA 4K81B 3NJRA 1XMPA 1YHQB 4NMLA 5AVSA 3ICOA 3N6XA 4O4JB 3WWEA 4Q6BA 1YR3A 4M7OA 1QQ7A