4C43A

Ferredoxin nadp reductase mutant with glu 103 replaced by tyr, tyr 104 replaced by phe, ser 109 replaced by phe and gly 110 replaced by pro (e103y-y104f-s109f-g110p)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLYFKHPEFPETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title External Loops at the Ferredoxin-Nadp(+) Reductase Protein-Partner Binding Cavity Contribute to Substrates Allocation.
pubmed doi rcsb
source organism Anabaena sp.
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4c43A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4c43A02
2BV3A 1CQXA 3I1FA 1W2BB 3CCLB 4U9UA 4HE5A 2QEXB 1IB0A 3E20A 1A8PA 3AVVA 4UAJA 1EFTA 3AVUA 1TVCA 5GV8A 4G1VA 3LRXA 4ZCIA 1YI2B 1KK3A 1GJRA 1D8TA 1IJEA 3CPWB 4DQLA 1VQ6B 1NDHA 3CD6B 5DSZA 1WDTA 5THXA 1K8AD 4P6VF 2DETA 1YIJB 4B47A 1KK1A 2BN4A 4PC6A 1DDGA 5GV7A 1TUIA 3A1FA 1BX1A 4RD6A 4M1KA 4M2LA 3G4SB 1OGIA 5JBQA 4PC1A 3VO2A 4PC2A 1CNEA 3WNCA 4B3XA 1FNCA 1HA3A 1BX0A 1KC8D 4G5GA 4H9GA 2OTJB 2C77A 3W2GA 3WBKA 3CB4A 3OJWA 2GPJA 5TV2A 1M1KD 4ACAA 2BVNA 4FWTA 2AHOA 3MCAA 4NCNA 4ZCMA 3CC4B 3W2HA 2VZLA 2BGJA 3CCRB 2RC5A 1GR1A 1VQ9B 4IW3B 3CCJB 1E64A 2FX3A 1N0VC 4B4DA 4MYUA 1OGJA 2DY1A 3VNVA 3W5HA 3CCUB 1Q7YD 3QFRA 2DERA 4RD3A 3CXCB 3J81k 2PMDA 2PIAA 3WXMA 1YJNB 4NBSA 1Q86D 1UMKA 1W34A 2B7BA 1S72B 4M4SA 1EP3B 1G7RA 1CNFA 2QN6A 1I7PA 3CMAB 2OK7A 3P27A 4YAUA 1FNMA 3QFSA 3ZBUA 2NPFA 1GVHA 4ZGQB 1TLLA 2BM1A 3E1YE 4M0LA 3W2FA 1D1NA 4FN5A 3JQQA 3WYAA 3QFTA 4AC9A 3OJXA 1VQ4B 1R5OA 1F60A 4RD0A 2X3UA 3WY9A 1B2RA 2QTZA 3OZVA 1QFJA 2VNKA 2OTLB 3CRZA 1ZUNB 3LYUA 1BJKA 1FNDA 2HCJB 1QX4A 1ZM4A 4QFMA 4ACBA 1QFZA 4RJLA 4TN1A 1KJZA 1QVGB 4RCYA 1VQ7B 1IJFA 1QUEA 4MYTA 1G7CA 3SJZA 3AVXA 3ZZUA 5AN9A 4YALA 1QVFB 3AGQA 1H42A 3AGPA 3CCSB 2XNCA 1JJ2B 4PC3A 1YITB 2VNJA 2BF4A 4FK8A 1VQNB 5FA6A 4RD4A 3W2IA 3VNUA 4B48A 5HXBA 5H59A 4G1BA 2PLFA 1GO2A 3G71B 4Y7CA 1VQ8B 1YHQB 4HE6A 4WQMA 1M90D 1SM4A 1OB2A 1YJ9B 4TMTA 1XE1A 1W87A 4ZCLA 4B44A 4P3YA 1VQKB 3FPKA 3U2QA 3QSYA 1SKQA 3G6EB 3U6KA 2CRVA 2YWFA 1ELOA 4EH1A 1YJWB 1KK2A 3LO8A 3CCVB 2EIXA 2J7KA 1QGYA 1KD1D 4YHBA 2EFGA 4TMXA 1N0UA 1EFUA 2HDNB 1W35A 1QGZA 3MMPA 3WNDA 1K73D 1ZM3A 3AVTA 4YAOA 3U6BA 3LVBA 1GAQA 2QMUA 1DARA 1FDRA 4ZV4A 2D74A 3AVWA 2C78A 2GQFA 1Q82D 3ZBTA 3MHPA 1JA1A 3PENA 3I55B 4R71A 1KK0A 5TY0A 3W2EA 2B7CA 4LBWA 4ZGNB 4RD1A 1R5BA 2YWGA 1KQSB 2YWHA 4RD2A 4BPRA 2CNDA 2QTLA 1QUFA 1FRQA 1E62A 1F20A 2YWEA 1JNYA 1Q81D 1NJID 3VMFA 1G7SA 2OK8A 3CCEB 5EMNA 3CC2B 1VQ5B 1OB5A 4PGOA 2B5OA 4YAWA 1VQLB 1H85A 1R5NA 4QHYA 1AMOA 4K1XA 4YAFA 3QFCA 4J0QA 3W5VA 3W5UA 3FJOA 1VQPB 1EXMA 2E1RA 3V76A 3B78A 3P26A 2DCUA 3I56B 1N8RD 4B43A 2QA4B 1S0UA 4TMZA 4TMWA 2R6HA 1J9ZA 4LBZA 4AF6A 2VYQA 1XB2A 3WBJA 3CCQB 4LBVA 2BSAA 4M53A 4Y9UA 4C43A 3ZZ0A 4LBYA 2XEXA 4C0SA 1FNBA 1G7TA 1KTVA 1FRNA 1EP2B 4PC7A 2HMAA 2DEUA 1VQMB 2BMWA 3ZZTA 3B82A 1BQEA 1QH0A 1VQOB 2VNIA 4TMVA 4RCZA 2QDXA 3JQPA 3CCMB 1EFCA 1D2EA 2XNJA 1B23P 1DDIA 1EP1B 1AIPA 1JA0A 1ZM9A 1K9MD 3CC7B 1U2RA 3QE2A 1QFYA 3B8HA 4AF7A 1QGAA 2BM0A 3WNBA 2BPOA 3JQRA 1DG1G 3CMEB 4DQKA 4LC0A 1GAWA 1QG0A 3VO1A 5H5JA 3ES9A 3AVYA 4N3GA 3OZUA 1JB9A 2RC6A 1EWYA 2ZITA 4N3NA 3OW2B 4Y9RA 5KSWB 3CW2A 2BGIA 1TTTA 1E63A 5TR9A 3ZC3A 1ZM2A 4F7DA 2VNHA 4Q7JB 3OZWA 1KRHA
chains in the Genus database with same CATH superfamily
1DWPA 3L0BA 3I1FA 1HE2A 3G5TA 4QQRA 4BZXA 4EYSA 3AK4A 2E9SA 3ZK7A 1E2EA 4RPDA 2QVGA 3KEOA 1E3QA 2OECA 3BQMB 2NZUG 4FFOA 4PPQA 2FHPA 5ELLA 5J4VA 3E48A 2VDMB 1H2WA 4JQOA 4BKQA 1CLUA 2XDQB 1FDIA 3R9WA 3KQWA 3NC4A 4JC5A 3IOBA 1G3QA 2QVZX 5DBIA 1DAEA 2CLSA 5AK6A 2KJQA 3UANA 3HL0A 4D8XA 1GTG1 2AKYA 5DULA 1M6VA 2D2IA 4KLRA 1VHOA 1SXJC 1NPYA 2MU1A 1X1SA 5DYWA 3AVUA 1UANA 4OH7A 3IX7A 5BUZA 1IHDA 5L8VA 4YY3B 1JIXA 3O9MA 1HTBA 1Z18A 1T91A 1BOFA 1ZHFA 1MJGA 2QBYB 4HXGA 1T13A 3DFIA 3KL4A 5DHQA 1IBRA 1P9OA 4OLJA 4DL9A 4EA6A 3K9FC 5KYUA 4QPZA 1BGVA 2O3SA 4LRTB 2BJHA 1TLFA 5B2ZA 5FEMA 5F7OA 3NXKA 4Z7NB 4IUYA 2QGNA 1UIRA 2N47A 2VK8A 2F9LA 3WADA 1HEYA 3DP7A 1E5LA 2VTKA 5DTJA 1EHIA 1WG8A 3L05A 3LLMA 3R3XA 3WXBA 3ZHZA 1PEKE 4HEJA 1NNEA 3PUHA 1J9GA 3TQIA 3D7RA 1F0KA 1QIHA 3AM5A 1DRWA 2Q9CA 3GQBA 3P52A 3CLUC 3DR3A 4A03A 5CFRA 2F1LA 1WOYA 1RZ3A 1BX1A 1ECBA 4JBYA 4U2EA 2PM8A 2V7PA 5FUWA 4M2LA 3C48A 3CGGA 5M3BA 3RC7A 3E7PA 2IHBA 1P9WA 1PKVA 3DHWC 5JAQA 3CLTD 1IG3A 2RG1A 4GXQA 3ZS8A 3D0OA 2ID8A 2X9GA 3QY9A 5BV7A 2QD3A 4UBMA 3ROEA 4BJ5A 4N76A 4H7DA 3PUZA 3G7NA 2C2YA 3AONB 4II2A 2J30A 3W4JA 1K0UA 1JIVA 4UC0A 3B5JA 4KQWA 2IH2A 4QBHA 3OOSA 2QG6A 1GKLA 4NENA 4QU5A 1RTKA 4RM2A 1O8BA 5J4KA 1QRDA 5DX0A 1KJWA 2Q3MA 3GEBA 4HNVA 1PIWA 2PXCA 3AHDA 2RGNA 3LT0A 2AG5A 4XEUA 1X7YA 1LNZA 4OP7A 3JZIA 1GFWA 1WHTB 4GKVA 5CLGA 3VC2A 5JCJA 4CHTA 2Q4OA 3IP6A 1I0IA 3DC2A 3FIUA 4BFZA 2FEXA 4YR9A 8ABPA 4Y6OA 3CQ9A 3K09C 4O2RA 4CG2A 3QNUA 2AHOA 2ZKLA 3VUEA 1U3TA 4NCNA 3M9WA 1VIAA 3N75A 1AJEA 2WIGA 3Q88A 2L17A 2PKWA 4KWIA 4ZIRB 2A5LA 4Q18A 1O94D 4XM3A 3N7TA 3PNLA 4W8HA 2FFQA 1NKSA 2HKIA 2FQXA 2ROQA 2SKEA 3ANTA 1EZ1A 3PXDA 1SY7A 3U16A 2NV4A 5ALIA 1CG6A 1R0RE 3TD6A 2XUZA 3HN2A 4KE6A 3EXG1 1P6XA 4HRYA 2GHIA 1P2VA 3O95A 4ZVUA 4G25A 1GTSA 3EZ6A 4FZ3A 1C4XA 3F4KA 1N3BA 3QI7A 2J07A 1UOPA 4BN4A 2FB9A 4OQQA 1E9CA 3C0KA 3GJ7A 2FOIA 1IM8A 1IVYA 1VQ1A 4X1KB 4R83A 1XCMA 5KAPA 1EAYA 5FWXB 2XGSA 4A9AA 3VVLA 5A1TA 1Q86D 2XDQA 5C7OO 2FJPA 2VAXA 4OMCA 1UMBB 4A0QA 4E0BA 1VG9B 2YC4C 3WK5A 3JQFC 3C6ZA 1NN5A 1YZYA 4ROXA 3IYLW 2WHRA 3HABA 4MO2A 5EPUA 4ZXFA 4ARUA 221PA 1P5RA 2BR5A 2Z2JA 5LQUA 1C1HA 1IHUA 2PY6A 3VH1A 5DP2A 2ZG6A 3FVWA 1G7RA 3CZPA 3VOBA 5K8TA 1RHMA 2AE1A 5U9CA 1DOHA 3KNZA 3UK7A 1OGYA 4LVCA 5AR1A 3WWZA 3PX3A 3L6CA 4J75A 2ZTUA 2P2LA 1LLQA 1K1EA 3BMQB 3GWZA 3BRCA 1FYDA 2DY0A 4IVRA 4J1TA 4TXJA 5JPIA 2QBYA 3QFSA 1KI2A 3ZBUA 4X24A 4Y98A 2HHJA 4FFPA 5FO1A 1TD1A 1WXDA 1TM4E 3WYEA 2BM1A 3NTRA 4A2CA 1LI4A 4HX9A 4L4ZA 3SXUB 4W5OA 1Q15A 2J6HA 5KDDA 1JDBB 1LDGA 2CEKA 2OQ2A 4H1TA 2Q5HA 3BTSA 4KQFA 1S8AA 4WZBB 3JZMA 4GE0A 3RSSA 3WRYC 4MA0A 1R0KA 4BHTA 5K0CA 5C9ZA 4CBVA 4B85A 4Z1MA 2FN4A 4AS3A 4C7OB 2PKRA 3RG8A 2YFQA 5HXAA 3I64A 1EXWA 4MRAA 2Z5LA 3X43A 3ADDA 2EYUA 2ZRHA 3HZHA 1OJLA 2M98A 3B9BA 4NCBA 4BN0A 4R1MA 3U80A 1U0RA 3PFNA 3KTFA 4NZPA 3PX7A 5L46A 1N6PA 2QN1A 4TV9A 4MAAA 1I2ZA 4UFOA 1PUIA 1F2VA 3OQIB 2ETVA 1R2QA 1KYYA 4JOQA 5BQOA 2PZJA 3GFPA 2HMTA 5YASA 4X1YB 3OFVA 3WA6A 1YQTA 2DQSA 2Y71A 1UDCA 3BULA 4EDFA 3ZCTA 3T52A 1BW9B 4G1MB 3RNLA 1EJ0A 4RY0A 2EGUA 1JTVA 3PNKA 4LQDA 4QOFA 4RO0A 3NTUA 2JLRA 3GWGA 2CDNA 4J3JA 2COKA 2CNBA 3KXIA 1L5YA 3AV0B 1YQDA 1U9YA 1FTYA 5D1HA 1ZH4A 5K1ZA 3ZK8A 5C37A 1NN3A 2UZIR 3UBMA 1EM6A 3M1YA 4GHWA 4C87A 5JADA 5M04A 3V33A 2AUNA 1WHTA 3INNA 4BMCA 2A0XA 4ANFA 4YUWA 3AOGA 2QRMA 1U2GC 1G1AA 2BF7A 1S2GA 3EEYA 3FA2A 1H42A 1E9AA 4MPRA 1JTFA 4D8VA 1X8JA 2HNAA 3RIGA 4PWZA 1RLMA 5C5EA 1Y9ZA 4HLNA 2IHTA 5EINA 1JJ2B 1VI2A 3FLBA 1H2FA 3PCXA 3VHXB 4EMTA 2WYWA 1JKFA 1IHPA 1Q0ZA 1LF5A 1UZNA 2IXTA 2WJ3A 2AMYA 4ZIRA 1P91A 3A3NA 3MCUA 3SK0A 4Z4HA 1NUTA 1EG2A 4OIMA 2DGDA 4RWZA 4U7FA 1P2TA 2GM5A 5AI4A 4ESVA 3G0HA 4C3ZA 5I9IA 2VDWB 4G86A 4NHEA 5IMBA 2JJ1D 5I7RA 5MF6A 1ICIA 3RSZA 2Z6UA 1GPNA 3UJDA 1B6GA 2W2XA 5A9RA 2XHZA 4UQLA 3MNFA 3COJA 4DVGA 2C4UA 1HNNA 1KP3A 1H2AS 2B37A 3BFVA 3GBVA 4P25A 4Y7CA 4FYIA 1MP0A 4WGFA 2GI4A 3ISJA 1CIJA 2R6CA 1Z0ZA 4ZZIA 2PH7A 1KQNA 1F8UA 1CUAA 1KO1A 2VR1A 5BW8A 1U3GA 1UXKA 2GYVA 1XZLA 2GAFA 4WFKA 4DJTA 5HDQA 3L2OB 1XE1A 2MHCA 2PR2A 4X1KA 5LC1A 1Q0TA 4ISBA 2Z3ZA 3A1EA 2WY2D 3DR5A 5FWXA 3GIWA 4V0SA 4WXPA 5SZIA 4V0NA 4EDHA 5HX7A 3D0KA 2ZB4A 5FLXA 5THKA 1UMBA 2WVJA 2BGRA 3KKKA 3GVXA 5ALKA 4AQDA 4H1WA 3ADBA 3QKRB 2PGXA 3HGTA 3C85A 3M1AA 4R54A 4MTLA 3HZRA 1D2RA 5E2AA 2JFGA 1KORA 4Z86A 1PZMA 4ASUD 2XT0A 4UUPA 1EE2A 3OBIA 2IVZA 1VJSA 3QBEA 4TVBA 1GGEA 1EP9A 3NDPA 1LRLA 1K8YB 3BMQA 4PPYA 1EBBA 1X94A 2Z2KA 1TADA 4B3BA 5IBQA 1H0SA 2OILA 3CLUD 2QHXA 2GBLC 4HBZA 5CXXA 2DKNA 3CTPA 1KAHA 3SXUA 1BMQA 2CXSA 1E0JA 4IH9A 2Q7XA 2ZE6A 5TQVA 3ZCVA 2J7PD 1YDEA 3P0JA 4WZBA 1T8PA 2P4SA 2FWRA 1JJVA 2QP4A 2BMJA 1ZM3A 2I91A 4JYPA 2NYAA 3QNWA 3WRXA 4C7BA 4KHZA 2C5GA 3SFTA 1Z28A 5T6BA 1WLYA 4C7OA 3AJAA 2WD7B 5GJCA 1CF4A 1WZIA 4KYTA 3HNOA 3LVBA 1GL7A 1QYIA 1UKBA 4P08A 1RMTA 3T1HB 4EFMA 4QBFA 1WCV1 4CXMA 3FDFA 3WDLA 3LBYA 1NW9B 1POXA 1RP7A 2O7NA 3IPXA 1LW6E 1NV9A 4HYYA 4X93A 4DCPA 5LP6B 2CMDA 3OQIA 1A4XA 4BVEA 4BQRA 3CRNA 1F6WA 1HBJA 1SRQA 4R1UA 5JJ5A 1Z63A 1K27A 4IDOA 2QAIA 3IO3A 4X1YA 1H5UA 3RK1A 1H4TA 4IYJA 4A7PA 4J90A 2GM4A 4PZUA 2BFMA 1I6WA 2ZWVA 4MUMA 1BW9A 4X8HA 2H1RA 3FPBA 4XM1A 3MUFA 2LP4Y 4G5RA 4P8RA 5AQ1A 5AVWA 4HNQA 3R7LA 4BMXA 1AS2A 2ZETA 4HC4A 2YWEA 4BBZA 1OH7A 1OHHD 3AW9A 4BTEA 4E2FA 3AXSA 4C78A 5EMNA 2JFVA 3CNQS 2C7GA 2QQGA 4DDTA 3QKUA 3MHTA 4DREA 1OB5A 5I9TA 1K97A 5JR3A 3GJ8A 1VQLB 2XMSA 1H85A 9ATCA 3MSCA 2WU4A 1Y8AA 3LQ4A 2GDZA 2O2IA 4MWDA 3T7JA 1CZRA 2EAUA 3VHXA 4QDOA 1GYQA 2ONCA 3FSJX 5BUSA 2FW9A 3TZEA 5BSHA 4NICA 2VDQB 3TVYA 1N0HA 2ENWA 4KL8S 2QL6A 1AB6A 3RF7A 2VDWA 3WQSB 3NP7A 4ZVRA 3E3LA 2IHVA 2UVDA 5JNSA 4O2AB 2EOAA 1NGSA 1MQ9A 4IO1A 4TROA 2ZRFA 4D1YA 3L49A 3CW9A 4X9XA 4HADA 3BHNA 3KTOA 4AJEA 3Q3IA 1EFKA 4DUPA 1C7RA 3OKFA 5EESA 5CT5A 3JYPA 4ZEXA 3TMKA 4J2HA 2RDMA 1HG0A 1P1FA 4B3TB 3L7IA 4IGAA 4KODA 2BGGA 1JKJB 3D5TA 1IUNA 1WMSA 2A35A 2DUUA 2WYVA 4KMRA 2P1RA 1AUPA 1X8XA 3N6RA 4Q3BA 1MIHA 2GETA 1JP7A 1TTHA 5AICA 1K7CA 1K63A 1QHEA 2PX6A 1XL0A 3WYFA 1IG0A 4Q34A 3EEFA 2LIPA 1W8DA 5EERA 2QUHA 3QKRA 5COAA 1GARA 1QZTA 1QE5A 1KXJA 2XVMA 1ZOOA 3L18A 2YXLA 3ZG6A 4X0CA 1JDNA 2O0HA 3A14A 3HSYA 3P9XA 3WGYA 3PQ5A 3WK8A 4E31A 5KVAA 3VZQA 4GSKA 3PHBE 1RHUA 2MYNA 1Z3IX 2EEPA 4OHFA 4PAGA 4U7PB 1A27A 2DEUA 4ZV7A 2VF2A 3EDQA 2VTBB 3N2LA 4N7RA 1U3DA 1O8CA 2PG3A 3QEMB 5B5SA 1AGXA 2R8OA 3EF1A 1W9HA 4KH0A 4N3AA 1WD7A 4M0CA 2QM8A 3WMXA 3FPEA 3S2SA 5CNJA 2ZI5A 1JR3E 2VNIA 4GVXA 3KO8A 3TSWA 3L7DA 2UUPA 2LV8A 2W11A 4PFQA 3CCMB 3PR2B 3LF2A 3OZCA 4RMNA 2ZRJA 2QYSA 2WP8J 2VXCA 2X2EA 4OSEA 4OUDB 3ZHUA 3NWEA 3QZUA 4UMVA 1I3MA 4JB2A 2I6TA 2VO1A 3TYXA 3V2GA 4AP9A 4JLJA 5JFTA 1VJRA 5AVYA 1U2RA 1W4BA 2WD7A 1NPTO 1KR2A 3HN6A 3DNFA 4KK4A 4EFNA 4MK4A 3I04M 2C8LA 4OK6A 4AKTA 1ESEA 3K9NA 2H4WA 3BHJA 1I2BA 1U8XX 2B61A 5DO9A 1PNVA 5JCXA 3MJFA 1EVQA 3D43A 2BPOA 2G7ZA 3PYLA 4BJ6A 2DG2A 2GMWA 3CZ5A 3EXAA 3NWBA 1XTIA 1EXNA 2JDIA 4J0GA 4OXQA 1R3UA 3ROKA 4G3XA 3B48A 4PIMA 4LC0A 4M37A 3A0UA 2HZBA 2AMVA 3H3JA 3RG2A 3VNQA 3G2KA 3H5TA 1ADJA 4AULA 4CODB 4LDAA 3GIDA 1GPYA 4P81A 1D6NA 2JAHA 2ZR0A 1U7TA 2C07A 1K75A 3KQMA 1QMPA 1UQTA 2RGXA 3LBHA 3MT7A 3NYQA 3T7CA 4CF7A 3G5MA 2H54A 2WIJA 2HK7A 2NU7B 1NW3A 2HY7A 2OSVA 4BGEA 1Z33A 4K6HA 2CMHA 2FEAA 1CEXA 5FL3A 1KDVA 4CTNA 2JFNA 2IXFA 5L51A 1XWFA 2A1TR 4PNHA 2YZ2A 4Q7LA 3C3XA 4JQCA 1OXBB 5LUAA 4RTPA 2OHFA 4W4TA 3M2TA 3R23A 4QHSA 1ZM2A 3TVDA 4M38A 3BGIA 4P82A 5I8WA 5U4QA 8OHMA 3DQQA 3NVKI 3G2JA 2JRLA 4FIDA 3MJRA 4OAQA 3GRUA 3TZHA 4F45A 4K9RA 4Q82A 3QVGB 1A0OA 1KEWA 3K6RA 4ZT2A 1XZQA 3SJAA 4H7JA 3ZOZA 5AVZA 5LZ2A 3WR5A 4HK4A 3OLYA 4O2AA 2EEZA 3V8RA 5CX4A 5HKOA 4DTIA 4E08A 1MC5A 5I3CA 5CAEA 3QOFA 1BROA 2CMKA 2ZWOA 3WA7A 4UHJA 4ZT5A 2GN0A 4NEHB 3ZIDA 1Q57A 1G20E 4P22A 2YJTD 4LY6A 1KO8A 5TVKA 3VHRA 1WOMA 1I4OA 2RSLA 4N47A 1MT3A 3L1VA 4A6EA 3MLBA 1JKJA 1CP2A 3PX2A 3SQXA 2OCBA 1DX9A 1Q12A 2IQ5A 4ICIA 1P2GA 3R0ZA 3QLEA 1CZKA 2YJ4A 1MJHA 4K26A 1QQTA 4WCDA 4HSGA 4MQBA 2H07A 4NYIR 4PU0A 5EJ6A 1N32B 2N1MA 3RJ9A 3HB7A 4LRWA 4XOIA 1H9BA 5BV2P 2FWBA 4XTRA 4OXNA 2HUNA 1F8FA 1HEUA 1KU0A 1Z2PX 4BNJA 1NQAO 4PLVA 3T5BA 2C4TA 1T43A 3PPXA 4UCWA 1TA9A 5FBKA 2PFSA 3GG9A 4BIIA 2J4CA 1QRTA 2CL5A 3N8NA 4DMCA 1UDXA 1SK8A 3FOCA 2Q29A 1YBAA 2H85A 4D99A 1HQDA 1WABA 4DM3A 4ZCPA 5THXA 1MO2A 2ATXA 3JQAB 4NMMA 3M4ZA 2COUA 1ZD5A 4IIYA 2VTBA 1EU1A 1V4NA 1EGAA 4HV4A 1RLTA 4PICA 3QEMA 1J39A 4DMRA 2HJVA 1AGYA 4A6XA 2ZAOA 2I1QA 3IQHX 3V5NA 3SZ3A 2V6GA 3EGDB 5DTMA 1VJGA 4I8DA 3HLKA 2APJA 3QTBA 1XFOA 4DBLC 3M6WA 3HY6A 1ZK2A 3ZVNA 3DMHA 2UUBB 1J1UA 3ZWDA 2PXHA 1JGTA 3ZGVA 2LVBA 2D0PB 2O8EA 2GXUA 4DE5A 5FD8A 2FLVA 2QY6A 2RHHA 4OUDA 2IZ1A 3I2FA 1I1OA 3K0EA 4Q9HA 2Y6UA 2YIMA 1CNEA 4JB0A 3T95A 4B3XA 1LTQA 2C94A 3T94A 3VJKA 1E1QD 2XSZD 3VPBA 3OAAD 5JMPA 2WP0A 1E0AA 4ZCTA 5IKEA 1OU0A 4E13A 1KJQA 4M7OA 1OC2A 5CBKA 2IKQA 3X1WA 2TSYB 4EO7A 4EPVA 3ZE2B 1JB1A 1GSHA 3ONEA 3QELB 4DJFC 5CM8B 4RBNA 2OB2A 3V7AA 1W29A 3O4HA 5HFJA 2BR3A 3TB6A 4F84A 5KKCA 4U3JB 3IULA 2P9JA 2VQ3A 1I30A 2J3KA 3GRCA 2ORYA 2D2VA 3NHRA 2HT6A 1RJDA 5FV4A 1QG6A 1Z26A 3MBOA 2IYQA 4GMKA 4LMAA 3KU4A 3KJHA 1H2ZA 2H0RA 4G1UC 4OQFA 4F8EA 4JGGA 4DMLA 2BGKA 3ZZ1A 2BMDA 3DVSX 1KDZA 1HDXA 3COWA 1PWYE 1UJ6A 3CC4B 1K7XB 5EN4A 1MXFA 2CHVA 4J16C 1R5JA 1YNOA 1TLTA 2NU7A 2WHPB 3Q6NA 2I0FA 2XOEA 1IXKA 3AVOA 3DUFB 3TRHA 3UJHA 5CDHA 2QENA 4COOA 1U7HA 1Y9EA 5CUQA 3T3HA 1Q1QA 1OASA 2XF2A 1X39A 4WCFC 3THXB 2J0SA 4KWTA 1CRPA 3R3ZA 1N3IA 2WWYA 4MYUA 3MMNA 3IQGX 4AQ7A 3OX2A 1VMIA 3R75A 4DV0B 3WAGA 3EPPA 3E23A 1PNTA 1F06A 3QHQA 1GXSB 4HXEB 5FTKA 5K3BA 1SXHA 3U62A 3QFRA 4XUGB 3ORQA 4LK3A 3UUFA 3G7UA 1Z39A 3B1JA 3A2NA 1AQJA 1QLHA 4C3UA 3LCMA 3FOFC 7MHTA 2ZSIA 1QYCA 3HHEA 4A16A 1GSIA 2PAFA 3CNLA 4RVCA 3C3CA 1C41A 4P38A 3G59A 3V4ZA 3R8XA 5DGTA 1ZZEA 3DW1X 3HQ4O 1U3CA 1WL8A 1ZJWA 4F60A 3HH8A 5JEEA 4GI2A 4DA9A 3ONDA 4YJ3F 2WLTA 3P0FA 3GT3A 4BQOA 1CD5A 3CMAB 5JY6A 1J5XA 5IXYA 1NQWA 1UDWA 3IUNA 4Y2XA 1O9BA 1LB1B 1ODSA 3M6XA 1HL3A 2HBQA 5F4OA 3HXPA 1NBOA 2OWDA 2ZJ5A 2HRQA 3ENWA 1TLLA 1SKYE 5CD9A 2W42A 3AF0A 4V02A 4N3CA 1NXWA 1ZNZA 3JD4A 2EV9A 3N8IA 1IEQA 5EGSA 1FNNA 1LQUA 3W3AD 4G0PA 4D44A 2RBEA 3JQAA 3L4SO 4ZQEA 1M8PA 1A9OA 3WICA 5KNDH 3IQIX 4DWJA 2PE3A 3ORFA 1EPUA 1QFJA 3G02A 2ZBPA 1Z0IA 2EKPA 3HRIA 4RF2A 5G0WA 4BRZA 1PCXA 1J1IA 3JARB 3CRZA 3EGDA 3EQ9A 5SICE 1KI3A 4NTZA 1K92A 3K0CC 1OVGA 1JFLA 5HKLA 1GQOA 2ZI4A 2HCJB 3W5DA 1FUKA 1UBOS 4G0MA 4KKSA 3VTAA 3UM9A 3OF3A 3EUEA 3WGTA 4OU5A 4NS4A 3H97A 4QEKA 4TV9F 3ORYA 4LDQA 2DJIA 4KZPA 4WOCA 3TQHA 1WUYA 1HYHA 4AKIA 1Z73A 4K28A 4RXUA 2D1SA 2JIOA 4A0RA 4CI9A 4DIKA 3SC4A 2HRCA 3FWZA 1XDDA 3IPLA 2BFPA 3FUTA 1S6YA 3DFKA 1G5IA 3OY2A 4M1TA 4UAUA 5AVKA 3ZE8A 5IYZA 1WPRA 4BE9A 1YV9A 5B55A 3SJZA 3D4NA 2UYQA 2W37A 1N7HA 3QELA 4L4XA 3MWEB 4YCBA 3AVQA 2Q6KA 3HL4A 4CFYA 4U3JA 4IUCS 4WNYA 3JSXA 1MKYA 4MUNA 2PUDA 1XP8A 2Z56A 3F5DA 4Z3KA 4GQBA 4LECA 5JLAA 5JWOA 1PAUA 1MDBA 3G0OA 1KFCB 2P7IA 4ZI5A 3P8ZA 3L7BA 4DLXA 2DSNA 1Z34A 2ZZKA 3AKCA 3GFQA 4X6XA 4ZVKA 2CLIB 3A4TA 3I6YA 421PA 2HSZA 2W2LD 3OQJA 2C1XA 5FX2A 4TL6A 3GA7A 5IK2D 1MQ8B 3K1ZA 1E9BA 3M6VA 3NTOA 2WHPA 5IVKA 2WFLB 4AVYA 1TM5E 2BM8A 2EX1A 4RETA 2Q6LA 2R6R1 3BQNB 3DUFA 4EHDA 4FI3F 1OROA 2EHJA 3AC0A 5E4TA 1ZC4A 2CF6A 4F4CA 2ERXA 1DCTA 3QWFA 2OZPA 2G08A 2CHGA 3THXA 3QE0A 1XVLA 3RF6A 4NMWA 4AJIA 3QIVA 2I2DA 4XSGA 3G71B 1CKEA 3WIBA 1JEAA 4XLHA 1HE8B 2DJ5A 2GDJA 2FXVA 3JZDA 4O5AA 1SM4A 4Y2YA 4D41A 4MUXA 1CUUA 3ETCA 1GXSA 1ZK0A 4MHSA 1EHYA 4Q47A 5IEJA 3U09A 4ZO8A 4FINA 3WYDA 1UWLA 2QLTA 1DQNA 3LXRA 2VZEA 5EP1A 1UBJS 3C3KA 3KB8A 4CV2A 3O83A 3I42A 4F6RB 3ZDDA 1OKKD 5M34A 4BIMA 4P3YA 1NUAA 3FGNA 4ZYZA 1XLTA 1NRKA 1Q77A 5CP8A 3S4YA 3ASYA 1P4HA 3PUYA 4IZIA 3CRRA 4C76A 2P27A 2DBVO 5JZMA 4JUDX 3ZDAA 4ENTA 5G4LA 3UOGA 2HWXA 5BORA 2JLXA 3ME5A 4A2PA 3GUCA 4JROA 3P9PA 3WMEA 4XWOA 1XTSA 4GH5A 3ONVA 2GF9A 2WEKA 5FFFA 3ROXA 3TKYA 3TMAA 3G3EA 2A0WA 2CDRA 3H2KA 2D5AA 4LJ9A 4YASA 4QQFA 3UHFA 3E1KA 4PM4A 3TTUA 2J7KA 3PWTA 1CR4A 2C2XA 4Z53A 1GCUA 2QKYA 3BREA 2O1WA 3AO0B 3CBGA 3H1AA 4W9NC 4Y2RA 4P54A 4EHIA 3KZKA 1JS1X 3PGMA 4HWSA 2EFGA 2JLCA 3RADC 2JBHA 1J97A 2O20A 3A9VA 5BR4A 2WF8A 1RIIA 4GM0A 1VL5A 2GVZC 3VH4A 5B4TA 4DUZB 1IBCA 2AI3A 6Q21A 3G05A 3H1EA 3L7AA 2VDUE 1B16A 4Q3CA 3TOSA 1LV8A 1UQUA 3V32A 3X1KA 4YP7A 5A3RA 1QF7A 1E1DA 1KSFX 4P0QB 1U63A 4UBIA 4XI9A 3WJ1A 2I7DA 3KJXA 2C2ZA 3DOIA 4QT0A 4I5GA 5LDGA 1ONBA 5C5CA 2W2VA 4MI9A 2BJVA 3BUSA 3Q40A 4NYJR 3V4OA 3TQFA 2F8LA 3CGWA 3O4GA 2BLLA 2IYXA 4GZMA 4KFSA 5EFZA 3JARA 5J5VA 2GHTA 2HWUA 1MA0A 3DOHA 2E21A 5A6VA 3T3NA 3BCFA 2Z5FA 3K15A 4MW9A 4O63O 3A32A 5SZHB 3X1MA 4D0NA 1E9RA 4WNCA 3QEAZ 2IY7A 4O29A 1REQB 3VKVA 2DR3A 2H7VA 3M9LA 4XWWA 1XQBA 1M2HA 5HKAA 5KNCA 1RHKA 3MHPA 3U61B 4AY3A 1YE8A 3G0DA 1EUQA 4CM8B 5FTMA 5BNIA 4JXXA 1PHRA 4QUDA 3RRFA 1FFHA 3IT0A 5K0BA 1DTEA 3H8WA 5IS2A 2PR7A 1P1JA 3A9SA 2C2GA 1F20A 4D4KA 2CJYA 4DNTB 4NI5A 4YMWA 2G1KA 3CT6A 3CNNA 3MVEA 3MWEA 1ZOIA 4QJIA 4I0WB 5HQJA 3UIEA 5IN4A 1G21E 1G41A 3HDQA 5LCXA 2R6JA 4LQCA 4MLDA 1E2JA 4PGOA 2NNLD 1HE3A 2HAEA 3T3EA 4ALLA 3G79A 3C16C 2GK4A 2AFHB 1ZMRA 4P12A 1SH7A 2OLEA 1JSXA 4YR7A 3IUMA 4MB6A 2OP1A 3NIFB 1N36B 1JLHA 3ILXA 4Q66C 3FJOA 2BKVA 1V5WA 2YWRA 4AECA 4DJAA 2WFLA 1Z4QA 5JDIA 5AKKA 2F67A 3LQRA 3OHMA 3FKQA 5E6RB 3X1XA 4G2NA 1NW5A 1THGA 1SU4A 2DIEA 3UFXB 2JJQA 1NUUA 2ZB3A 3C3AA 4FNOA 2YMLA 3UUWA 2J41A 1KPIA 2HPHA 3O8LA 4XGKA 3R6GA 5EIBC 2JLQA 4CTJA 4GUDA 1XTKA 5JQGB 3E0XA 1CQJB 2DCUA 3ESDA 1SCDA 4OI4A 1X87A 3QFHA 3U3RA 4ZDKA 5HUJA 2O8FB 5FPTA 3F3YA 3NFYA 4RU1A 2WK1A 4EJ2A 2FSUA 3KSZO 1U8AA 2CB0A 2W6CX 3D4LA 4M49A 4QAQA 1NU6A 2D13A 4DLSA 3KXDA 2XMGA 4PF1A 1WS6A 3FX2A 5HIKA 5EXEA 4KYUA 3RW9A 5CEFA 4DV5B 4ABTA 3UXHA 1YDMA 4F6RA 1N5LA 2JB9A 3M6AA 2E4WA 2BFAA 1KBZA 3RCBA 3RSCA 4LYEA 3W8EA 3I61A 2CLKB 3LGXA 4LW8A 2CW5A 2DHCA 3V7UA 3MQ2A 3QM1A 4S12A 1DTWB 3LQQA 3L7OA 4YV7A 4RDKA 1L4KA 2QSJA 3OT4A 3M5PA 4F91B 3BDIA 1LUAA 1KTVA 3IE0A 4TKVB 5AW6A 2EC5A 3KKZA 5IG2A 1BNCA 1U9ZA 5AJZA 1KMNA 2QP3A 2WHEA 2C42A 4LV6A 4CMAA 5EOVA 5DMXA 4B3FX 1KYQA 4O1HA 3T7EA 1YULA 2YRXA 3DG9A 3FE2A 4MW5A 3Q39A 3T7AA 2LRHA 4ZQBA 4DW8A 2HLDA 5CCBA 3B82A 4OX9Y 2JHGA 1IQRA 1WKBA 2R79A 5EMKA 1K3TA 1RWOA 2HDHA 1E5VA 2X2FA 1M1YB 2X53S 2HHCA 3ZV7A 3DV0B 3RI3A 1H8HD 4NC9A 3N0XA 1GZDA 2XD9A 4GR5A 5IAOA 4UNPA 3FWKA 1GQYA 3N2YA 3HB5X 3THWB 5H4GA 1T8RA 2ZSAA 1O87A 1X7DA 1L5SA 5CDTA 5EZYB 2I6FA 3KT6A 3QE2A 5EJEA 2QZSA 2IV3A 3B8HA 1QP7A 2JI4A 2GZ3A 1JKXA 4HB0A 4NFYA 5ETJA 5FBZA 3UK1A 1YB1A 1YJAA 1EFRD 2X8JB 1M1NB 2JGDB 5E3JA 1XTBA 3ICPA 1ZOSA 4IMIB 2H4HA 4GD3Q 4Q19A 1XD8A 1FJXA 4F4FA 3TINA 1HWYA 2D1YA 2O2ZA 3BH7A 2WSSD 4ZVNA 1RFGE 1BXKA 2QX7A 2O06A 2XPCA 4K81B 3TWOA 3LD9A 3ZCSA 4CM8A 2CT8A 3S8YA 3OURA 5D8DA 1XZFA 2DYIA 1Q19A 4S1TA 3AEUA 3EQ7A 5EMHA 1XWWA 4ZFNA 1RVV1 3MIIA 4UVEA 4ZVSA 1KYVA 1U3WA 4OA5A 2ABWA 2P6RA 3T9CA 1SUCA 2O3JA 5E1DA 5LBUA 1IATA 3GD5A 3M6FA 2GREA 5C53B 2BEWB 2G83A 4FEAA 2PZFA 3RVSA 2CVQA 2RD2A 4D2IA 3CY6A 4JX8A 3RS5A 1LSOA 3KJQA 1KMCA 1W4ZA 2ZIVB 4REMA 5TPZA 3ENZA 1Z6YA 2R8XA 2ZJ0A 3DCNA 5BV1A 3O75A 1HPLA 3A70A 4KO3S 1MA3A 1H94A 5FP0A 1RAFA 2QIPA 2GRAA 2QAGB 3LP5A 2BGIA 3FNHA 3OO0A 4KVZA 3ANLA 2AFHA 3E9QA 4FFNA 5D1NA 1A1VA 2XA2A 5FI1B 4DRYA 1BAPA 4XLEA 3O2SB 5SY4A 4PAOA 1U31A 2BUAA 3S44A 1GPWB 2EW2A 1NP7A 5EL0A 3PC8A 4K9PA 3ZR4B 1L6IA 3IAM1 4NONA 2PQ2A 1QCCA 1QHGA 1Y6RA 2GJ4A 2OXIA 5E6RA 2VJKA 1G8KA 2I80A 5FWYB 5GIOE 1T9KA 1KYWA 2AYYA 3Q98A 3E53A 5E4YA 4W5RA 1MW8X 4N5MA 4ZP1A 3UFXA 1E2MA 1NQ5A 1QX3A 4AL4A 1FTNA 1U28A 4BZPA 1XE3A 1OLOA 5DGDA 1SIWA 4MPTA 1E1NA 4O2AF 1TRKA 1CQJA 1UODA 4Z9BA 4BX2A 5JQGA 3C24A 2O8FA 1DE0A 1QIJA 1MHTA 2FX2A 3U26A 2B83A 1SVNA 3T9EA 1IDN1 1V8DA 4Y9TA 5AM1A 1EVJA 5HNKA 4D3ZA 1A3CA 5ALYA 3U7HB 2IYFA 4EY6A 1O5IA 5FUQA 3LGSA 1G38A 4H1VA 3RU2A 3IESA 1TMOA 3TCNA 3I2JA 3R3VA 4XVRA 1RZVA 1VKHA 2DUMA 4QOIA 1V0FA 1EQUA 2F1KA 3RUIA 1YI2B 1RCUA 2B1RA 3IDQA 3TJZA 3HAGA 3KYCB 3QW4B 1KAMA 1ZS9A 3JD2A 4HY3A 3W9SA 1GJRA 3WGHA 1DTWA 3M1IA 2UZ0A 2P2SA 1NN0A 3HWRA 5DWVA 3R3YA 3W6PA 5IDWA 3GD7A 4ZZ3A 4RTJA 1GLGA 5T4FA 3V8PA 5CXSA 4TKVA 5JALA 2A94A 2NACA 5FYDA 1GG8A 1BD3A 2PWYA 3ZCPA 4F8JA 4WH0A 3SDSA 5IWCA 2PWPA 1GA4A 5P8WA 1LJ8A 3AEYA 4JASB 4OM8A 2VYVA 3LU1A 4JIGA 4GEKA 3TD2A 3C4VA 3R6KA 4L0QA 4R1QA 2IBSA 2XJ4A 1VPWA 3A6LA 5A4MS 2XADA 2ENUA 3QVUA 4TLDA 3VH3A 3HCWA 3T5DA 3NHYA 4HXFB 1E0KA 1M1YA 3DV0A 2K2WA 5JRDS 2PGLA 3K8ZA 4RD6A 1GOTA 1PWXA 1KYTA 2WM9B 5TRTA 5CA1B 1SMKA 3LDGA 2EKLA 3NEJA 5FFNA 3RTGA 3D54D 3SC6A 4YRIA 3THWA 2A1IA 3EVZA 2VSXA 4PG8A 1R9JA 1HT0A 2PYZA 1P61B 1ZEMA 5K51A 3U7GA 5EZYA 2W2NA 3ASSA 5ILOA 3MOIA 3EWAA 2I6XA 1FEZA 5TDHA 3ZHCA 4QTZA 4QU9A 2X8JA 1JHDA 1M1NA 1BXGB 1ZMOA 2JGDA 3F6EX 4UW9A 3QKTA 4Y6RA 5G0SA 1WSRA 2RK6A 5CW2A 4D3YA 3U4MA 3M4NA 1IN5A 4QUJA 1U4OA 1EBUA 2YN0A 3P19A 1RYEA 2FK7A 2ZB7A 1JEJA 2XVZA 2PIDA 2XAUA 7MDHA 4PG7A 3DMTA 2VWGA 4HQFA 4TT3D 2OENG 4XIGS 3PEFA 5K2MA 3ULKA 4CT5A 1OZGA 2XNDA 5K7SA 2YMQA 5EIHA 3LIIA 4DDVA 4IF6A 4JT9A 5HHTA 1CEYA 3NBXX 5B6PA 4EJSA 4UNQA 4XUCA 5HJ2A 3LYLA 3GLVA 2GSDA 2C59A 1PJ8A 4O4LB 5FH9A 3O2QB 3OEHA 2BEWA 3R5TA 1UBTS 4QUBA 3CURA 1Q95A 2RH9B 3BXFA 3H8SA 3O0DA 1WUTA 3GFBA 5GVSA 3IL2A 1IQ0A 4C04A 4DMMA 1VCHA 1WQ1R 3EF0A 3KFXA 4XH9B 1HX7A 5LMCA 1L8LA 2A33A 4LJ6A 5AVUA 3EK2A 2QAGA 2VWHA 1EUZA 3LX8A 4G5YA 4N1AA 5HK9A 2R6ZA 4OQYA 3CMMA 1BD4A 2W90A 1OAOA 2C95A 5EIBD 1SOWA 3KQKA 3OPXA 1CSEE 2Z8ZA 2H1LA 4LVOA 4BB9A 2PX5A 1D04A 1V6CA 4XSHA 2J9FB 1Y6QA 3GJ0A 4FE3A 1YL7A 4LDRA 4XZ3A 5FWYA 1LC0A 3HCCA 1GUBA 4ETNA 1VHEA 1OSNA 2HLPA 3KUDA 4JAVC 4LNUB 3GLIE 1F8YA 1TEHA 3UJ8A 3R7WB 3W78A 4K9QA 4ER6A 1IXRC 2JKVA 3DOOA 2W71A 2X0NA 4B2LA 3D7SA 1UXJA 5FTJA 1QANA 1IOZA 3C3YA 3LBIA 4CQLB 2WTXA 1C0KA 1L7RA 1KJYA 3A6PC 3V2UA 1ODFA 3GCDA 5GOZA 2JAUA 4FHEA 3FG9A 5F9FA 1ESZA 1LI5A 4AJ2A 5HBRA 2LDXA 4US1R 3EG5A 3H8JA 4S1OA 3PKZA 3I6ZA 4M4SA 1ENPA 1EP3B 2RIRA 1Y4SA 4MCHA 2O8DB 1OYOA 4ZT7A 3AX6A 2IIVA 3PFIA 1DG3A 2CBZA 2FGKA 5CX1B 3RIYA 3S1LA 3MRSA 3KZCA 2MYUA 2C0CA 1XQXA 3C8HA 2QSYA 3ESAA 3L9XA 3U1VA 4C01A 4F06A 2QUZA 1DC4A 2XE8A 4PLGA 5HFAA 2IX3A 3KYCA 1FNMA 1H8ED 1PK8A 2DUWA 2PJZA 2C83A 3L92A 3OZXA 3ELWA 1QH1B 1IEXA 4DJEC 4RTRA 4EG8A 2QTVB 1Q91A 1NKTA 5JS7A 1SBYA 1IN8A 4BY9E 3MWLA 1VQ4B 1FTWA 1NX9A 1SVOA 4K9SA 1S02A 3BJEA 3I73A 4EI8A 4N5LA 1B76A 3OM9A 1D7OA 4V0ME 2ZJ8A 2Q7DA 2I9PA 3ASZA 3D6FA 3LKDA 4I55B 1EAMA 1FVXA 3FCYA 4MKXA 2O0JA 2ZB2A 1PTJC 3TTWA 1CF9A 4Y67A 3MN1A 3PGA1 3TLGB 3AETB 3VZPA 3T4EA 3V2IA 2ZL6A 3CNEA 2FZ5A 3PNQA 2DMRA 4INPA 4HCJA 3S3TA 2JH3A 5AVVA 1DBWA 4P6YA 5CT6A 5CA1A 3I4LA 1ZM4A 2QS9A 4W5JA 4TZ0A 1E6KA 3IPRA 3C7CB 2D5IA 4KFCA 4KNYA 1EJBA 4V1CB 1D0IA 1C80A 3G89A 2E18A 3OZ7A 3NIGB 3NKFA 3RBXA 4LHWA 1R4ZA 4P4NA 5EMJA 3ZBPA 1NBIA 3GPBA 3QLUA 4ENSA 2Q50A 2OCYC 1BXGA 1GAJA 5K8IA 1KAGA 3LHSA 3PPWA 5IYZF 1Y48E 1XZIA 4G5QA 3RVPA 3AHGA 2R1UA 1YVEI 2VUHB 3PEWA 3F74A 2HSGA 4S1WA 3NBMA 2WFMA 4B6OA 3AY3A 5JI3E 3QTLA 2VHUA 3TQTA 4YALA 1UFOA 3NRBA 4KXNA 4OO3A 5E7IA 3ZNPA 8LDHA 2FH5B 3HEMA 1W1WA 3ND7A 1K8ZB 4I5FA 4WPGA 1CUWA 2QUAA 3T3MB 1WZ2A 3IEMA 4O4LA 2QYOA 1FQKA 2W2KB 3ONUA 2F9FA 1Q92A 1JPUA 2QTMA 1E7QA 1QRRA 1ODIA 2R8RA 4C4XA 2PZLA 1I3KA 1MN6A 1R12A 3O2JA 4L0MA 5FCDA 4AMZA 4HS9A 1TT7A 4ZEVA 1IBLB 3RGWS 3PA1A 5T64A 2GTPA 1KI6B 1A7JA 3AFIA 1T9CA 1I5EA 3DLPX 2MSKA 3LFTA 4RJ2A 1SCIA 5KQRA 4G1BA 4N8SA 5J4YA 1R50A 2JGLA 1Z35A 4YECA 3TSZA 5F4ZA 3IEIA 4BNDB 1AZTA 1XNGA 3E0QA 4MAFA 5JD5A 1JXOA 3WDSA 4H3HB 2J9FA 5BSYA 2ZIXB 2I2WA 1ZY2A 4JBHA 4B7UA 5MN5A 1DRVA 1FDOA 2X41A 5CMLA 2B35A 4NBUA 3LYHA 2MMGA 4LNUA 2ZM6B 1FXUA 1PN3A 4Q1VA 4EL0A 1SOMA 1VQKB 4B44A 2X2PA 3K0SA 2GGSA 4JMLA 4MGHA 2MSNA 1CE8B 2GKOA 2IQIA 1SNYA 3QI2A 3HA2A 3BSYA 4CQLA 2WOOA 1Y33E 3U3MA 3RT1A 4EUNA 2I4TA 1Y1SA 5EUBA 1P9RA 4UDOA 3WP1B 4JLMA 3OPOA 2ZRQA 4BJHB 1SKMA 4L8GA 1TEVA 2B30A 2IPAB 3I32A 3KTDA 1KYXA 4AS2A 1HOXA 2I99A 1GITA 3OI7A 3CCBA 4HBGA 2H11A 4PZAA 3SZGA 5K0EA 4B3DA 1EVLA 2AEEA 1V5VA 3AR6A 2O8DA 2HJWA 1AH2A 3U5TA 1O94A 4Z4CA 1CDDA 1TQ6A 5LQDA 5CX1A 1JKIA 4GXTA 4PW0A 3W7AA 1IUOA 4LQ4A 4QJ3A 1P4JA 2R1VB 3C6BA 3CX8A 1QR6A 3ZJ5A 1WXWA 4ND6A 1XLWA 1ZD1A 4C4PA 2IHYA 1QH1A 4J91A 2W8ZA 4CMJA 2QTVA 5B4VA 2GESA 1TZKA 3FGZA 2ZKIA 3LG2A 3WLTA 4E6EA 2R1TB 4ZYUA 5ANRB 2WABA 3JQ9A 4ZAVA 4NHOA 1PWZA 1XYYA 3AFNA 4HG2A 5INTA 5IXSA 1WHSA 1ZA1A 4N7JA 3S68A 5B64A 2O5EA 1JR3D 2PUBA 4I55A 4YAOA 3TLZA 5C5DA 2X5KO 1N1DA 3ZHQA 3TLGA 3AETA 1XZJA 1B6TA 2FN9A 3FCXA 4H6WA 1V11B 4D02A 1SUWA 2O1EA 5T57A 2LZJA 1QBGA 3AEXA 3FFTA 2V7WA 3IHKA 3KTAB 4I8IA 4FDTA 4YMIA 1HDYA 5KJEA 1PYGA 3HZZA 1IN7A 3NFRA 1L4LA 3SJCA 1MO3A 1WE2A 1OWNA 3IKTA 3PUXA 4AZ0B 3SKXA 3FDJA 4JOCA 2F1RA 3BY2A 3Q3JB 4C89A 1XALA 4E7PA 2ZPTX 5HR5A 4ZGGA 4BGIA 2PKCA 4DCOA 2G4CA 5CFNA 1K0FA 3SS8A 2ATIA 2M5SA 4BPRA 1IB6A 4B9EA 4E03A 1N8KA 1EVEA 1ZGZA 4PO8A 1UKAA 5J58A 2F1JA 3QYFA 4N3BA 3EDCA 1ZMTA 1JMYA 1ZW1A 1UKYA 2UYGA 4CCSA 2I1WA 1MENA 2VPXA 3PXBA 2A14A 1BVHA 4KXFB 1Z4IA 2XIQA 5E6UB 4LC9A 5TS2A 5CB4B 4RKYA 4I50F 4WESB 4AJNA 3P71T 1EK5A 1BDBA 1PSWA 2QMYA 2YY5A 3AJDA 1E7YA 1U0JA 3DM5A 3FR7A 3OE1A 1MEOA 2VP6A 3PT5A 1XU4A 3PQ3A 4IJ5A 2WWIA 2Z5GA 5JPCA 2EIHA 1B15A 3W5AA 1Q7GA 1EK2A 4CFSA 1JPVA 2O5VA 4XFJA 4J1SA 2E1RA 3HN7A 5LKRA 1MB9A 3GARA 1PDVA 3DHYA 2F48A 1KI6A 4YRGA 3ASQA 2BMEA 4GQIA 4HGRA 4U0JA 2XOKD 1RPAA 4R9UC 3ZE1B 1EX1A 3Q3CA 1XTJA 4BTVA 1ZKMA 1GPDG 1PT6A 5IN5A 1C7EA 4O1MA 2EW8A 2WOJA 4LRUA 3E8XA 4L4RA 4RQBA 4BNDA 3DAOA 4KI7A 2KMLA 2Z2XA 3I01M 1XAIA 3R3SA 3TQQA 5AVSA 3IAM6 4D98A 2CLFB 2AFVA 5U1PA 2AYXA 3L8YA 2F4VB 4BVFA 3UH1A 2RAPA 3EVFA 4CL3A 5SYNA 2AB0A 3DGEC 3ONNA 3GJXC 5GM1A 1VMAA 3EHDA 2QTCA 1HDZA 1AA9A 1YHNA 4P26A 1N2JA 1CE8A 1WMBA 4OQXA 4AW9A 3H1PA 4BNXA 2Y1KA 4JQYA 4W6ZA 2WVHA 1Z29A 2IXGA 2QTFA 5LWHA 1RLIA 1O3YA 4DJJA 1YNSA 3N3AC 5MDHA 1E2DA 1QIIA 1R7RA 1TO6A 3LMKA 1AGPA 1YGPA 1WNTA 4ZQGA 1EGHA 2IEBA 1TEZA 2PLWA 3AERB 1RJFA 2WUVA 4P4TA 2FN3A 5SYAA 4B9AA 3SVTA 2X8WA 2XLCA 1SB9A 3DDUA 2JJ1A 5ALOA 3E9YA 4NDZA 2I1LA 2H6EA 2R1VA 1GL9B 4XWTA 4OI2A 2GKSA 1KIFA 2IYAA 1QH0A 2WZCA 1SAYA 3JWEA 5HZMA 1X3SA 4AJJA 1M8GA 3TLEA 4GGMX 4RPLA 4J76A 3U13A 5D5HA 3HU5A 2R1TA 3EASA 3GNSA 2HSWA 1EFCA 1A97A 3D3KA 2OZKA 3E6AA 4I5DA 5T3YA 3WIOA 3PF9A 1GYRA 3ZY5A 3V8EA 2AXPA 3HDJA 4FHCA 3RC8A 3ESRA 3T54A 1NULA 2XTZA 3C6XA 1AIPA 1JIQA 4MEAA 3EZYA 4LZJA 1F3LA 4DMUB 4G09A 1QDUA 3ZJUA 4PG4A 5CDFA 10MHA 3EIWA 5B3LA 4EGJA 2D0OB 3DD5A 1EK1A 1UZUA 5L6LB 3MD9A 2G1AA 2JAOA 2W2QA 4X91A 1WBBA 3G8AA 3HU2A 1GG5A 3LXMA 3ER6A 4KKUA 4TTQA 1IPHA 3PYXA 4AZ0A 3FKJA 2GFQA 3ICCA 3O4FA 2Z43A 4ASUA 4HWGA 3C2QA 2VQDA 4MYHA 1CUYA 3Q10A 3D6JA 1MXHA 3PQ6A 2V74B 3NHUA 5BSEA 3CPJB 3WLMA 4AZVA 1DEAA 3V97A 1V3UA 3W5CA 4ARBA 2NU6B 4KQHA 3CR8A 1N1GA 1BH2A 4F56A 4Q3DA 3CTAA 1YRYE 1G63A 4IGIA 3WNVA 2ERCA 2DC1A 3KYBA 1QH8A 1LK0A 3OOJA 4LISA 3FWHA 3RIEA 3CH5A 3OW2B 2NYUA 1Q3HA 1O6ZA 2K7ZA 2J7PA 2GNAA 3DE7X 4JLVA 2IYSA 4JV5B 3PJDA 4RDLA 4AMVA 2ZUVA 5A2GA 4DLKA 5TT1A 3WC4A 1TJ3A 2HK6A 3NORA 3GDGA 3IKLA 4YMGA 5HQ3B 4ZV9A 3OPMA 1KRXA 3DAYA 3G1TA 3GGGA 3R74A 1TAUA 3RFCA 4EA9A 3LNNA 4Y3UA 1G8PA 1HYGA 3QEJA 1NNLA 3ROMA 2XUPA 3K1AB 4UPVA 1E1MA 2BMFA 2AI1A 1W2BB 2D2EA 3NHZA 2IYUA 1V2GA 3L0CA 2H3HA 1SBNE 2BC9A 1AS3A 4ZHQB 2X5JO 2OHIA 1A2BA 2XOXA 2QQ0A 3R0XA 2PUAA 4FZ5A 4JUCA 4M22A 3ZKAA 4R0MA 5JQGF 2FAXA 4I1OA 2A1TS 2XWBF 3FNGA 4BOYA 2CDCA 1ADFA 2YYZA 1KOJA 1LXCA 5C8ZA 4MLPA 5JRZA 4GMXA 3LSYA 3CZQA 4MVJF 4B09A 4P3NA 1OHHA 3I3OA 1YQWA 2BUBA 4IMJB 3UPUA 1NP6A 1AKUA 3CVYA 2ZWIA 4JYAB 3P5SA 3UC5A 4BLVA 1TKBA 4Q15A 4QC2A 2CVFA 1DGQA 1BRTA 1MH1A 1VHDA 3COZA 4C0XA 2P9YA 5F5XA 1DAHA 1EZ4A 3IP1A 4BUCA 4K6KA 1ZJ6A 1I9CA 4HUQB 1XKQA 1FMFA 1Z62A 3RFVA 1KKLA 3UICA 4N6NA 3RUCA 3CD6B 2X7JA 5DSZA 1RADA 2J09A 3AERA 3H4TA 4RDXA 2IUFA 5IF3A 1XSEA 2VCYA 4NCIA 4XEHA 8ATCA 2JG3A 1UADA 3IPAA 1KK1A 2CGEA 5EPOA 5IUJC 4PC6A 4XLZA 2GPTA 4H3SA 4H4DA 4XDHA 4YLGA 1D4OA 4IX9A 1CS0B 4HFJA 1DO8A 1DKUA 2TRSB 2QRQA 1Z6GA 4RPJA 4K3VA 1EQ2A 4CHGA 2CYCA 3W7VA 4EKEA 5JJCA 1Q3TA 3OFND 4A0SA 1JEYB 4DNRB 1UBMS 4FOSA 1BIFA 3JQFA 3RWMB 3S2ZA 3GJRA 3CWCA 4OTZA 2F3PA 1V37A 4UNIA 2X4GA 1U3VA 1JAYA 4OJQA 3WL5A 1B74A 4EBFA 5CDGA 1TKCA 3WNCA 5F52A 3VKGA 1BX0A 1BHO1 1RE1A 5ESRA 3ZWCA 4MRMA 3PWSA 1LX6A 2NUPB 3ECAA 3U5ZB 1ORRA 2JANA 3LNTA 4Q9AA 4WOJA 5JTTA 4LNHA 4HNUA 3VKHA 1PR2A 3CV3A 5LU9A 3E3OA 3GLGE 5LBIA 2IWRA 1DOZA 3CG4A 1EFAA 4IRMA 4EFKA 2XYHA 3TR5A 3JASB 3QXHA 1Y5RA 3PB3A 1T9ZA 5FYQA 3CNOA 1PK7A 3I6BA 4TYMA 5ESXA 3WP0A 2W6JD 3D59A 1WF3A 3NVDA 2YBEA 5FOVA 3QBJA 3X0DA 4DLWA 4WNIA 4ZAZA 2IYYA 2NU6A 3ER9A 1I4DD 3LLCA 5AI8A 3ZE9A 1KEKA 3J81A 1A69A 3BT7A 2AJDA 2O6LA 4RMHA 5DI3B 4WY8A 3O7MA 4ALNA 4U1RA 4WY5A 5B3JC 1PR6A 3ABIA 5DNUA 1TQ2A 3MOSA 2FR1A 4C05A 4XCXA 2C0PA 1D5WA 1D4FA 3U1TA 1EHCA 4URYR 3ZVLA 1QP8A 4RA6B 2H2WA 1OBHA 1E6MA 4RUKA 5B1IA 3DMGA 1F0PA 1W0JD 3NBQA 3R6DA 5KWEA 2VDLB 1F6DA 3KDPA 4X66B 3KHTA 2GRUA 3L07A 1M34B 2JLYA 5BYBA 2YXDA 3P0RA 4LYHA 5DX8A 4UUQA 1NFQA 3NU1A 5D7NA 4RY8A 4WMLA 4UM9D 3WLRA 3HM9A 3DT6A 1E6CA 5A9TA 3K1AA 2GO7A 2AX3A 2ALJA 5FNVA 5A71A 4GNKA 2O7QA 3ACBA 5J4HA 1RRKA 4N5DA 1KC3A 1Y8RB 4RZQA 4ZHQA 2V3CC 3RKRA 2DB3A 2INGX 4D45A 4R31A 4U2FA 3OHPA 1R37A 4WHMA 1BE6A 2WZQA 2WSMA 1WY7A 2SKCA 2X15A 2VJBA 3K3PA 1M6YA 3J7TA 3V8MA 3LP6A 1T15A 2PH1A 3Q8XB 1T2UA 3S27A 3HB9A 3TMYA 1U2GA 3VNSA 4DGQA 5A4IS 5EZSA 1FPMA 2JD0A 4KQXA 4DR7B 2C61A 2WJYA 3EJWA 4GICA 3COSA 5TMDA 4EG1A 3EXHC 1W85B 4KH1A 3CX6A 3MYRA 2PKEA 4TYWA 4RQUA 4YJ2B 5KNCH 1Z2AA 1JWBB 2I7XA 5K0ZA 5D86A 5JD6A 3GEGA 1ND5A 4ITRC 4ZOAA 3K31A 3TAHA 4BO4A 4MARA 1DZIA 3RIHA 5B12A 4JL5A 1J7JA 4P53A 4DLRA 3B6KA 3USCS 4YCNA 4REQB 2QW1A 4OFWA 1LWOA 1MAUA 3K9BA 4GZLA 4F4DA 2XYGA 4HUQA 2ISQA 1SCUB 3OP4A 1LX7A 4PYNA 4EVIA 5IVDA 4D9JA 3P9YA 4FSXA 2OLKA 2IBMA 1JQDA 1XVIA 2A9VA 2GN6A 1L7EA 4X61A 1R27A 1WUJS 4RLFA 3PEYA 1NR1A 3KM0A 2DKOA 1B2RA 1U0HC 3K4PA 3PQ8A 4M1WA 2H4JA 1ZK1A 1R8XA 3OX3A 3A8JA 5IW8A 3AH8A 4FOLA 2DSTA 2R4UA 1CS0A 1BJKA 2Q6IA 1KSHA 1QOZA 2R2GA 2WZNA 2XECA 3F0TA 4IXWA 4U6NA 4CM4B 2HMUA 4MQFB 4CTOA 2CNNA 1T4BA 1EA5A 2ORWA 3CXRA 1GQQA 1T1RA 2IFTA 3SICE 3QX7A 1Q0PA 3OLQA 2ZU6A 1NKVA 3KR2A 4F1WA 4J0KA 1NFFA 4GOLD 5A5FA 1NOIA 2AG6A 2E5FA 4M9CA 1FSZA 2VCHA 4XQ9A 4HNRA 1A72A 4YAGA 3H11A 4RJLA 3RU9A 2WDZA 3RVBA 3VI4B 4RHTA 4BNKA 1IWOA 3W5JA 3V7YA 5HM6A 3BWYA 2A84A 4H59A 3WGMA 2KPOA 2RGGA 2NUPA 2AJLI 4PGAA 5MFPA 2PS9A 3EMKA 1Z7WA 2OWEA 2IK8A 3EXEB 4JLNA 1VYHA 1BX3A 3KLNA 2H2GA 1J09A 1R0LA 3DLTA 1XEWX 2BKUA 2CWWA 1JQAA 1RCTE 1CUFA 1L7VC 2GBLA 4XLAA 3JASA 2C84A 5IARA 4CRWB 4Y1EA 4IMPA 1GUZA 5J63A 3RO7A 3SLNA 5KJ1A 3IIIA 1S4MA 1E2IA 1S2NA 3E9EA 4TKMA 3VR6H 3O3OB 3ZV6A 1XNRB 1QF9A 1TKRA 4Q93A 1EXVA 3IEUA 3IJ5A 1IIRA 2Q6OA 4JELA 5CFPA 1G64A 3ESYA 1I2MA 2FSSA 3WWYA 1PGJA 2OORC 1Y37A 2Y9PB 2DE0X 4HFMA 4MI3A 4RA6A 4YAKA 3OVMA 2GBPA 3MJDA 4Y2TA 3RYHB 4B17A 3K35A 5IDQA 3W8FA 3W2IA 4JYBA 2PVSA 2OESA 2QMZA 1GZ3A 4HQNA 3AR4A 4OB7A 5MFZA 2PGDA 3QTTA 5HXBA 5C1PA 1M34A 3KQTA 5EWMB 2ZXFA 1E1QA 2XSZA 3M6IA 3OAAA 2YR0A 4EJ6A 1N1MA 3P1JA 1W5AA 1CJMA 3BB3A 4QARA 1M90D 1V3QE 4WQMA 4YJGB 4DEVA 4EABA 3KAQA 4RENA 2HR1A 1OI2A 3H7AA 3ELBA 4JYCA 1GZHB 4QSMA 1UC4B 1Y8RA 1CDZA 1J4AA 2JLBA 2X5XA 3RR2A 3SG0A 2XZTA 5KCZA 1OLSB 3L06A 4XGNA 1R6AA 1UBHS 1MFZA 1LSUA 2CHUA 2Q5OA 4NR0A 1E3JA 4Q7EA 5GJWC 1Q7EA 4D6XA 3ZYZA 2CRVA 1AO0A 3EC2A 2PBZA 1JMVA 1W85A 3LO8A 2AMFA 2AN9A 2HCFA 2UYYA 3H2ZA 4G4GA 4B2PA 4TS3A 4YJ2A 1L4FA 1GRRA 4E2WA 2XDAA 3KWLA 1JDPA 3CPHA 4R1LA 4D96A 4KOEC 2Q4RA 1M0TA 2II6A 4LTDA 2FSGA 1JJ7A 1HF3A 2V9CA 3OC0A 1WEHA 1SZDA 4OP3A 3AUYA 3OQ6A 4REQA 4CIDA 3TUIC 4MW0A 4L9RA 1ST3A 1SCUA 4NULA 1NF3A 2ZYGA 3O47A 3E9MA 3HP7A 4WY2A 4Z2YA 1ZBDA 3F5FA 2F1HA 3FBGA 3LAWA 3NEPX 5L4LA 4F5EA 3NOVA 5FAKA 2IGBA 1IPFA 2VDPB 2Z9CA 3W9BA 1Z7EA 5CVVA 5KTRA 3O3CA 3HLTA 2NU9B 2A5FA 2R7MA 4LFCB 3F46A 4POAA 3O1HB 3MBIA 4N0MA 3RVOA 1VCMA 3ZDBA 5AKGA 4GBJA 1TIBA 3ZI7A 3ISTA 1YTLA 3NAGA 4HMPA 3ZW9A 1U2DC 2ST1A 1ZC3A 1K8XB 2GXSA 2HBRA 4MQFA 4Q5IA 1PT7A 1M6EX 2ZREA 3DF9A 4BC0A 4G9EA 1UJMA 1WDWB 4KRXA 1US8B 2PH5A 3K30A 1UIMA 4N5IX 5BQ5A 2AHRA 4QBKA 1LLDA 1J0AA 4M1MA 2ZJ7A 2WWGA 3V3TA 1JMKC 1XVAA 4YCAA 4ZU1X 2R0QC 4AQYB 3BCHA 4YRLA 1AKTA 4HH0A 1DCMA 2NAPA 2Q5CA 4BUJA 2QQEA 3D4BA 3EWIA 3OG9A 3QW2A 2C2HA 4J0FA 1OA1A 3IMKA 4MVJP 4UXHA 3HGQA 2CFRA 1F5NA 2CHFA 2CJWB 1UUFA 4KAFA 3HCRA 4MVJH 4JI6B 1RP1A 4MR7B 4CLXA 2NUTB 4LY3A 3PA8A 3GU3A 3X1DA 4WWVA 2P6PA 2ZAGA 3QE3A 2B1IA 3W3AA 1E8MA 3KETA 3TO5A 1GD1O 2F1IA 2RHCA 4CF6A 2H8KA 1IM2A 3LBFA 4RVOA 5KEIA 2BYTA 1A9XB 2ZUWA 4YAFA 4WK2B 4BYGA 2HXSA 1Q7RA 3QA9A 5C4GB 1N5IA 1JTEA 3FPSA 4M99A 3ZPXA 1XQ1A 4Q6BA 1CB0A 2NT4A 4WLOA 2WKQA 4QDZA 3CE6A 3FWYA 3JYNA 1YX2A 4S0XA 4QGFA 2GCGA 1Q14A 4DRXB 4YAIA 1NP3A 2BFBB 3OY7A 1XR3A 1ZUHA 3NOXA 3ZN2A 1P1HA 3RYHA 3E3AA 1BFUA 3DCJA 1L7BA 2OHOA 4YLEA 1OX6A 2FV8A 1KMMA 4N01A 4BBPA 1X15A 2AR0A 4OYYA 4OP1A 2Y9MB 5CVDA 3HUUA 4KOAA 1JQJC 2IXBA 3C3JA 3ZJ4A 5KWVA 3L8DA 2VHQA 3GPDG 1FFCA 4PX3A 1LK7A 4R3NA 4YJGA 3UA3A 2HQRA 1NVWQ 3R3JA 1R1DA 2G40A 4AF6A 4OPSA 1IZYA 1XEAA 3LBAA 4X8OA 3VR2D 3UMFA 4CIVA 2PFGA 3CT4A 3PPIA 4R0VA 1STOA 3H9BA 3CR7A 4RNDB 4ZXPA 4R6XA 1OLSA 5AHRA 1SIBE 2H08A 3EIEA 4QUHA 2I6GA 1BHSA 4NV1A 5G53C 3Q8LA 2J0VA 3SS9X 1BRMA 5ICSA 2JN9A 4M1OA 3BIJA 3W3ZB 4C0SA 1GRVA 3SMQA 2P2ZA 2LIVA 2W2LA 3AI3A 3KZXA 5FTLA 1N06A 1SCAA 1QK5A 5IK2A 1P9LA 3IALA 1D0VA 4W8OA 2Z98A 3E8SA 5FPHA 2VP0A 4CKYA 1S3SA 5HOQA 1R0ZA 1XCOA 4ZI7B 2DKFA 3WJ7A 2QW8A 1VQMB 2XCLA 1PT9A 5LM3A 5AHWA 5DYGA 3C8DA 4H6PA 4OP2A 4D3XA 3AUAA 1VIDA 1U7OA 1XTRA 3G7SA 3K53A 2XVAA 3FTPA 1ZWLA 5IJ0B 4AYWA 4FHDA 4HL6A 4BLSA 3B7PA 4N4AA 1P4MA 1K89A 2IHKA 2JEYA 4DV6B 1WCXA 2AXQA 4QYWA 1Z74A 4C20A 2EZ9A 4HI0E 1JWLA 3OEYA 3B6ZA 4MGIR 4P7JA 2NU9A 3OA0A 4RH0A 4Z0HO 3WBFA 1ZSYA 4DQDA 1OU4A 2Q8NA 2XGJA 2ZBQA 3RC2A 1K9MD 4F5YA 1UBLS 2R96A 2OTCA 2ZATA 1VE5A 1OKKA 4RPIA 2O1SA 5BURA 2O2SA 4P5EA 2GERA 4X90A 3W6UA 4BEVA 3KSUA 4C0QC 4F12A 1BFKA 4JLKA 4Y2HA 4DZRA 2H5IA 4BYMA 1NMQA 3VVMA 4B79A 1MC1A 1US8A 2NVUB 3FUVA 4JITA 1NBAA 3MF4A 4DADA 4MKGA 2PT9A 1SBTA 3CFYA 5KWIA 2B8NA 1GG9A 3FVVA 1E3TA 1V8FA 3SJUA 3L7CA 3KSMA 4ATNA 2JGAA 3TR0A 1WSBA 4TQAA 1AKNA 2BTOA 1XO1A 3FJ1A 1PTKA 2YV1A 5IHXA 2X8KA 5ICFA 4IJVA 5A2QA 3QEKA 2JFZA 1F2DA 1XDWA 1J21A 2CJWA 4PVCA 5D3MB 1HMYA 2RC6A 2Q99A 1F6BA 3GDFA 4MR7A 3LQ6A 4OHBA 2NUTA 4W8GA 4C7XA 2P9CA 1UEIA 3DAGA 3KHKA 3IAS1 1F2UB 2EL7A 3OLVA 1MV5A 3PFGA 4JY7A 5DGXA 1M5UA 2LKDA 1A9XA 2IC5A 4BVAA 2C2WA 3COVA 1A4RA 1SQ5A 1T3ZA 1UPXA 2X4IA 4M9XA 4P4GA 4P98A 4XQGA 4ZT3A 2AJTA 3VTFA 3DFFA 3WSWA 4D9GA 2W6NA 2PKQP 3A1TA 1J2RA 4BMYA 1BVUA 2FSFA 2YYAA 3F6BX 1DG9A 1LPPA 3HEAA 3IDZA 1NQVA 4ZOEA 4DRXA 2OG1A 2BFBA 3LTNC 3LECA 1Y6GA 1Y82A 3ETGA 3GJ4A 3F8SA 3BYZA 5IT5A 1PZFA 4BLWA 1FS5A 3QOYA 2GH1A 4INJA 4HNSA 2GR9A 4G8JA 1ZK3A 4I9GA 3F6RA 4IHQA 2YBDA 3GJ3A 1L5VA 2QMOA 3EGXA 5FADA 2QRGA 2R751 4OV6B 5J3JA 3R5FA 1CUGA 1Y3BE 1I10A 4CIYA 5GZ3A 3TCKA 3EC7A 5HRAA 1N78A 1XKLA 2GJPA 1YQ9A 2A0KA 4AP6A 3PGJA 4P32A 4GOKA 4B46A 4EB3A 4OPMA 3SPXA 3TQOA 4JU9A 1TK9A 4GPAA 1F3OA 4J16A 2P79A 3OD1A 4G4JA 4DIFA 4Z4EA 3OOCA 3R3HA 2FCAA 2GJKA 1Y3FE 3E03A 1CY8A 4TV8B 1YONA 4GOND 3WK4A 3KQSA 1PJCA 1Y7PA 2P0AA 3W9UA 1Z8FA 2HA7A 1Y6ZA 4LSGA 1UEJA 4GLFA 1E3ZA 3RY8A 4G24A 1D8TA 2BGUA 4CMEA 4OQ4A 3ANMA 4Z9YA 3I58A 3T5AA 2CJXA 2NQTA 4V0KA 2DRIA 4L7QA 1SQFA 2AFIE 5E1MA 1L5LA 1SXPA 1YRQA 1K66A 4PHTA 3ZOKA 1SWWA 1K5DA 2XB8A 2QUIA 5TRDA 1H6BA 1QNLA 5G02A 4ZI7A 4O33A 4Y1FA 1YIJB 3GLHE 2J0EA 3TUJC 4XJSA 3WLHA 1U7ZA 2QLFA 1UP6A 1IHMA 5K6AC 5IBCA 1J33A 5BSKA 3P9SA 4RHCA 1K9SA 4KP7A 2COEA 1T9HA 4IV5A 4V1CI 1H4QA 2P5SA 3SCZA 2GJ8A 4RTQA 1YQEA 1YHYA 3KQYA 4M1KA 1Z5NA 3FVQA 4UU0A 4HLDA 4TS1A 1IULA 4PHCA 4I4TB 1VJDA 4WN3A 4ZO7A 1T8WA 4YPOA 4PC2A 2OBBA 1A7UA 1H6DA 4H1UA 1LJUA 3VDXA 3KKPA 2J6IA 3ITNA 2ZJAA 3W6NA 4CMHA 2CFIA 4AJHA 1N6NA 1NUSA 1OMOA 1NW4A 4X3OA 3KOYA 4QYTA 3F1LA 4A1FA 1Z16A 5EIWA 2VLBA 2GM9A 1WB4A 3P2YA 3FMFA 3K0BA 4EUSA 2NVUA 3GK3A 1W0CA 4D25A 2HB6A 2Q5EA 3AIMA 5EJMA 2TMYA 3H6KA 1G9TA 4FCCA 1KC1A 4UFPA 3QE9Y 2BVNA 4GYYA 2ZANA 2Z9BA 5BSFA 4WK0B 4HEHA 4LWPA 3ICEA 2NXJA 3WK9A 1GCOA 2HYDA 3IO5A 2NTVA 3TLCA 3WB0A 5IJZA 2ISCA 1MX1A 1YR2A 4E6PA 1FTSA 1H3NA 4RLQA 1ESDA 4O4JF 1P8AA 3K5WA 1QJ4A 1EX9A 3G0CA 5D3MA 4FYKA 4UE3S 4YFVA 1IZ0A 1VBFA 1YB5A 3AB3A 4XX0B 1TM1E 1VBKA 3OU2A 4I5EA 3V8BA 3AIKA 3VC7A 3K0CA 5CNIA 1H8HA 2W6ZA 3H86A 4QZVA 4I2NA 1JJBA 1QCDA 1IZZA 1SUPA 2F3UA 2WKSA 4KQIA 4IR7A 1T1GA 3SE0A 4DMGA 5I7SA 4CEHB 2ACEA 5F1KA 1F2UA 2JJ2D 4JS0A 1UWCA 3JYLA 2VDRB 1KEEB 3NRCA 4PQRA 1DRJA 5C0OE 3H99A 3D81A 4FCWA 4L5CA 3VZRA 4DDMA 4RS4A 5AW1A 1UJCA 4BGUA 3UUEA 4GM4A 5L7WA 4Z0TA 4NWIA 1UPBA 2VAVA 4KEAA 3NBAA 4R2JA 1UJ2A 4D9CA 3FPJA 3RAEC 4GX2A 2WSSA 5D85A 1SBCA 5FNVF 1Z88A 5IEBA 4BE7B 3NS7A 4HYEA 2OCAA 2PMDA 3EC1A 2EBUA 2ID9A 3W4IA 1I4EB 2F1OA 3HNRA 5FULA 2RKWA 1E2FA 3NE5B 1YJNB 2VNSA 4TZTA 5EQTA 4MHTA 4GI5A 3T9DA 2KLHA 5DLYA 2N0SA 5JHGB 3EDMA 4A0FA 3L41A 3K0KA 1PJ5A 3NM6B 4FDMA 4JT2A 5ALZA 1N4DA 1XC7A 2KX7A 3CWZA 1S72B 2PGAA 3ZGLA 3CUYA 4HT3B 1UAYA 1B73A 3ID6C 3LX6A 4OHUA 4GQAA 2X0FA 4C4SA 2C7QA 4BVKA 1VP9A 3QXSA 1CR6A 3V34A 4D80A 1HSZA 4JI1B 3FTEA 2J3IA 2M6LA 1RWBA 4E5SA 1FFYA 2NV6A 1ETHA 3IBYA 4TV8A 2ZSJA 5AW3A 1W5EA 4MICA 1D2NA 2CXQA 1EX7A 1OFUA 3S2FA 4D3SA 1UBEA 1DC6A 5A3SA 4BMSA 4ZCRA 5IASA 2ON6A 4LGCA 2E89A 6LDHA 3ICOA 3IEVA 3U7EB 3LL7A 4P3KA 1Y6JA 4M0LA 3I9LA 3EB9A 5BSRA 1ACMA 5JJBA 3EFBA 3AKDA 1XX6A 2OQRA 2OV2A 3BRWD 2R9VA 1MAAA 3HRHA 3Q3GE 1CEQA 3LY7A 1OBOA 4X1IB 2B0JA 1ABFA 2CUZA 3AEQB 2VBVA 3C97A 3NI2A 1BU5A 3OZEA 4WJKB 4R7GA 1F0NA 3FXAA 1GNTA 2CXPA 4J94A 3R8FA 5FHQA 3PC7A 3EDRA 3EZLA 2ZYRA 3LYUA 3PUWA 5BQPA 4B3CA 3GBPA 3N28A 4BFTA 4MIYA 1QX4A 2ZZQA 3EQ6A 3SXPA 1KVTA 3IILA 3CPEA 2RONA 1ZI8A 5CXQA 3FVRA 4XVQA 2EWWA 2NWQA 4I4TA 1LFDB 1F48A 2ECKA 2MSEB 5CYOA 2QRNA 2YW2A 3CVOA 4ZCQA 1OXVA 3E9ZA 2IU6A 4GX5A 2RCYA 4OHVA 1I13A 3UG7A 1AB5A 4C2BA 2XUOA 1ENYA 2AK2A 2ONKA 2W9XA 4W9NA 3V4PB 4AWAA 4OBEA 2HRBA 2WAAA 1NLZA 2CVZA 4ZJYA 1ORIA 1XQYA 5BSGA 2FMTA 4AROA 4M36A 4DS3A 3Q38A 2P0EA 1Q11A 2HNKA 1MJNA 4FR0A 1H2BA 3DEJA 2YZ7A 4G1CA 2JCSA 4TVOA 3QXXA 4C3OB 4JJIA 3FFAA 2VSFA 4L57A 4MA5A 2DAPA 4R8VA 1QR2A 1WTCA 3HMQA 5ICCA 2HLHA 2VFAA 1D07A 3V9AA 3AGQA 3WO0A 5KTPA 5LXTB 3UFBA 3BY1A 2BIFA 3FRJA 4TXLA 1OT3A 5G3YA 4DVJA 4GAEA 3I92A 4E1BA 4X6UA 1YITB 4YB8A 4MDHA 4WRRA 3GF4A 2PL9A 3D1VA 2DUJA 2AD5A 1YAHA 2P78A 4QYIB 1DFIA 3ADOA 1U8EA 4D56A 3K32A 4XX0A 1PS9A 2NNWB 4GKJB 1SCBA 3SZLA 3TE7A 1SKAA 2QB5A 2VHCA 3CS3A 1ML4A 3MWYW 4MSUA 4D8YA 4XR6A 5FA6A 3M3PA 3WLKX 2OYNA 3AHHA 2OBSA 4PCLA 5T67A 4ESEA 2XMPA 1XQ9A 2PSEA 2YH2A 3AM3A 4PGHA 4AS1A 3ONFA 1BKYA 1FXWA 3JSAA 3CP2A 2DOKA 3JQ8B 4D3FA 1KEEA 1J42A 1PJ4A 5KHLB 2XV1A 1DAFA 4FSDA 4CU5A 5CXUA 1PF7E 2FUCA 2OCKA 3H2HA 1A95A 2CVHA 4IEFB 1Z5VA 2PGJA 4L5JA 4X7BA 3TBFA 5ITWA 4EJMA 5AH0A 5EMLA 5ILQA 3JPYA 4UU1A 4OA8A 2OQIA 1FFGA 3PVDA 2GBIA 4RSGA 1GFIA 4AY5A 3U60B 3ZWVA 2QJTA 1LKZA 4URXR 1GSAA 5LIRA 4JP1A 4TT3A 3U2QA 4D4GA 1C7IA 4MKFA 2P2DA 2OO5C 3KPVA 3G6EB 1Q1BA 1U7PA 1U4NA 1KQGA 3GX1A 3CMCO 3WLSA 3L0SA 4RZHA 3USZA 3ASTA 3HU3A 3JY6A 4A10A 3PEEA 1HT1E 3LPAA 2Q4TA 4P36A 3EGEA 3HA3A 1DNPA 1TOAA 3DHNA 2H48A 3UMYA 2QN8A 3HE3A 3O94A 4M8SA 4NU8X 5DF1A 2GQ0A 5BSWA 5DRYA 5HUQA 2O8CB 4YJ2F 2FZGA 3N87A 3WYCA 4F7WA 1PUJA 1QVZA 3BHIA 4S3MA 2ZRPA 3K9GA 5DGHA 4LXIA 4ED9A 4DUGD 4EUHA 4RJIA 2R4TA 4FE7A 4G01B 4IZHA 4W1RA 1T4DA 2QJOA 4FYXA 4LDNA 3URMA 4WDQA 3ZQ6A 3PD1A 4PWYA 3FUCA 2VHVA 4DILA 2ZIFA 1UPCA 3E27A 4PLZA 4QBGB 1BG6A 2G07A 3IHTA 4P4SB 4WSOA 1T0UA 3WWEA 3QPBA 1KVQA 3IA2A 3KEFA 4X1IA 2EGGA 3IP9A 3AEQA 2REBA 4R6WA 16PKA 2D3WA 4RVNA 2OFFA 1LDMA 2LGJA 3H5OA 1K7SN 4JMPA 2Q0SA 3ZIAD 4NCAA 1IOVA 4KAAA 5F4JA 4LMRA 1WW3A 4UUNA 1QWOA 2D7CA 2IZ6A 3BIWA 3ZJYA 4RV9A 3CUKA 3MB5A 2PQ6A 5A05A 2OYSA 3DFUA 2P67A 4NYMQ 4BQEA 1NOKA 1JJFA 4HDKA 3BSSA 4LJRA 3BWVA 1SHLA 1P2UA 4QDUA 3ESBA 4JVOA 4BCBA 1L4MA 2VPZA 3PDCA 3ZEIA 4CEIA 4RKQA 5KAMA 4X7DA 1T10A 4H3VA 2AR9A 1DV1A 1IRIA 1VIMA 1L5NA 4IFIA 1N6KA 4XVUA 2SHKA 5JAPA 2QNRA 3HSKA 2HW8A 1RM5A 1C50A 2O52A 3MM4A 1KEPA 1UBNA 1ZINA 3PUKA 4H7FA 2GN2A 2ODPA 3A0RB 3CEJA 3A3GA 3O6VA 5GADl 3O31A 2XE4A 1PU2A 4PBRA 1EJ2A 3CC2B 3G5LA 3WB2A 1JDJA 1DO0A 4JWKA 4DC0A 1O0BA 1D2AA 3NAQA 1PV2A 3D6MA 4K9NA 1KKUA 1Z2NX 2EKZA 4E5YA 4EKGA 4NV0A 4Y6GB 1TUBB 2FWAA 3DO5A 1M83A 4LXHA 1R5NA 3OQVA 4MUYA 5C8VA 5LXTA 1J8MF 1RYYA 2ILVA 2DVMA 3MJTA 3MXOA 3HXTA 3FOAA 4FX2A 1PW5A 4LTMA 4NZYA 4WW0A 1WMAA 4J0QA 4HLCA 4QYIA 3GUUA 5KQLA 3DKPA 2D00A 2OOKA 4BX0A 4ITVA 2BWJA 4IFBA 3RV4A 4YACA 2ZYVX 3PGLA 4PSAA 1S5PA 1UR5A 4E21A 5JZBA 1KJNA 3AF2A 5LMZA 1Z2OX 5EJAA 4L73A 4XIYA 4HB4A 4WV3A 1VHJA 2MDTA 3IAS6 2CLCX 3KAJA 3L8HA 4WE3A 3S0JA 5DSXA 1GRNA 3ELYA 4J7XA 3KFVA 3JQ8A 3LDAA 4D6YA 1IUKA 2QR2A 3I5AA 4TWJA 2QA4B 4BECA 4YQZA 1P7YA 3DEFA 3OOEA 3H0KA 1ODCA 3DE6X 3I37X 4YK7A 4YV2A 5ARBA 4W1PA 3UAGA 1P4RA 4PR3A 3ZCXA 2IUUA 1E5XA 5JYEA 5JU6A 2HJHA 3EEOA 1Q1GA 7YASA 2IUTA 4N0QA 4NNPA 3WGLA 2JFYA 5EJGA 4A23A 3WNZA 3CF4G 1QVWA 3L40A 2BSAA 2YL2A 1OQAA 2EZTA 2NADA 3KLBA 4R51A 4MJLA 3VDNB 3FNQA 2FUNB 1GZ7A 4TGLA 1CF2O 3TIVA 3SEJA 3WYBA 3X1JA 4Q3LA 2YFHA 2YV3A 4GMGA 4NX2A 4BV8A 4CT4B 4JN6B 4H08A 2VP4A 3MLAA 4I14A 1TCUA 2NTYC 3ICWA 3L8FA 4GC5A 1Z8NA 2XBLA 3QMWA 2YHIB 4DZTA 1DT3A 2EDCA 4DIEA 4EI7A 2EFDB 3W1VA 4PYOA 2GZHA 2I66A 5BWLA 5ES4B 3OJ0A 4A8JC 1N77A 2O8CA 1GDDA 3HJBA 1M2FA 3G5AA 4GSYA 5KC8A 2QYTA 3ZZTA 3ESQA 5JH7F 1HZZC 2O2HA 2QDKA 3HJTA 3ETJA 1WEKA 5ALNA 3U4GA 4EY7A 2H1IA 4RACA 1PQWA 4BX3A 3E7WA 2YRWA 1RJ9B 1WDLA