1W34A

Ferredoxin-nadp reductase (mutation: y 303 s)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w34A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w34A02
1QVFB 1EFUA 3CRZA 1KTVA 2PMDA 1JA0A 4ZV4A 3W5UA 3G6EB 1D1NA 1VQ8B 1F20A 1W35A 2BGIA 3B82A 1QH0A 4K1XA 4TMTA 4ZGNB 4AF7A 1Q81D 4B3XA 4FK8A 2FX3A 5H5JA 1VQ7B 1TTTA 3W2GA 3QE2A 3WY9A 4LBWA 3ZZUA 1FNBA 1YIJB 1M90D 4N3GA 3QFSA 4C0SA 3CC4B 5EMNA 3W5VA 1VQNB 4ACBA 1ELOA 3AGQA 1KQSB 3E1YE 3AVYA 4N3NA 2QTLA 1EFCA 1ZUNB 2GPJA 4TMZA 4FWTA 1TVCA 2HCJB 3VNUA 1AIPA 4R71A 4LC0A 1KD1D 4H9GA 1FNMA 1WDTA 4PC1A 3ZZ0A 4DQLA 1D2EA 2BPOA 4Y7CA 2BM1A 1DG1G 4AF6A 3AVUA 1G7SA 3W5HA 1QVGB 2OTJB 3B8HA 4YALA 4MYUA 3MCAA 1KK3A 4LBYA 5TY0A 4PC6A 1BQEA 4RD2A 4B47A 3I1FA 3MHPA 1IJFA 3CCUB 4WQMA 5GV7A 3QFCA 2VZLA 3JQQA 3I55B 3CMEB 1N0UA 4BPRA 1QG0A 1A8PA 1H85A 2VYQA 1EWYA 2OTLB 1ZM3A 4QFMA 1YI2B 4C43A 3ZBTA 1I7PA 1GR1A 2HMAA 1BJKA 3LVBA 1XB2A 1VQMB 1AMOA 3AVTA 4YAWA 4RD3A 1IJEA 1EP3B 1W2BB 3OZVA 3CCLB 1W34A 2QEXB 1DARA 1QUEA 1F60A 4M53A 2XEXA 3CD6B 4PGOA 3CCSB 1EXMA 2HDNB 5JBQA 3OJWA 3P26A 4ZCMA 1G7CA 2CRVA 4G1VA 1CNEA 1K8AD 3LRXA 4PC3A 4NCNA 1GAWA 1YJWB 4U9UA 3LO8A 2RC6A 1KK0A 4LBZA 1VQ6B 1OB5A 5KSWB 1Q82D 4B44A 1GVHA 4LBVA 1JA1A 3MMPA 4RD4A 1EP1B 3G4SB 2DERA 4ZCIA 1S0UA 3ZC3A 4ZCLA 4B43A 3A1FA 2DEUA 1N8RD 1YJ9B 5HXBA 5AN9A 2XNCA 3QSYA 1Q7YD 3CCQB 1VQ5B 1K73D 5TV2A 4DQKA 1B23P 1R5NA 3I56B 3WNBA 1NJID 2YWEA 4G5GA 4B4DA 4M4SA 2OK7A 1EP2B 2GQFA 1QFYA 2RC5A 3G71B 1YHQB 4TMXA 3E20A 2VNHA 1FNDA 2EIXA 4TN1A 4RCZA 4YAOA 1U2RA 5FA6A 2X3UA 2E1RA 2YWFA 2AHOA 4QHYA 3ES9A 1W87A 3SJZA 2J7KA 3AVWA 4ACAA 1KRHA 1ZM4A 4EH1A 1H42A 1GJRA 3LYUA 4PC7A 3VNVA 1DDGA 4RD0A 4Y9UA 2QA4B 1XE1A 3V76A 2BF4A 3WBJA 3WNDA 3OZWA 1E62A 2BVNA 2YWHA 1NDHA 1EFTA 1K9MD 2YWGA 2OK8A 1FRNA 3CCRB 1J9ZA 1G7RA 3VO2A 5H59A 1KJZA 1CNFA 4J0QA 1VQPB 2BN4A 3CXCB 1D8TA 4HE6A 2QTZA 1VQKB 1FRQA 1Q86D 2BMWA 4FN5A 4Q7JB 4MYTA 3ZBUA 4TMWA 3W2FA 1OGJA 4TMVA 1E63A 4ZGQB 1FNCA 3W2EA 3QFRA 1R5OA 1QGZA 1GAQA 4B48A 3CW2A 1R5BA 1JNYA 2VNIA 1ZM2A 3U6KA 1VQ4B 2NPFA 4M2LA 4P3YA 2PLFA 2DY1A 1SM4A 2B7BA 3CPWB 2BSAA 2VNJA 1E64A 1B2RA 3JQPA 3VO1A 1S72B 3VMFA 1GO2A 1IB0A 4RD6A 2QMUA 3AGPA 1QFZA 1VQ9B 1KK1A 2CNDA 4NBSA 1OGIA 1YJNB 1G7TA 3CCMB 3FJOA 2VNKA 3B78A 1ZM9A 2B7CA 2PIAA 1QUFA 1QX4A 3WYAA 1M1KD 1QGAA 4YAFA 4F7DA 3JQRA 3W2IA 3OW2B 2QN6A 4HE5A 4YHBA 2BV3A 1VQLB 1YITB 3CMAB 4AC9A 3FPKA 1BX0A 3WBKA 5DSZA 1FDRA 2D74A 4RCYA 1TLLA 3AVXA 4UAJA 4YAUA 1BX1A 4G1BA 1JJ2B 1DDIA 1HA3A 3QFTA 1QFJA 2XNJA 1UMKA 3U2QA 3CCVB 3U6BA 3AVVA 1OB2A 1QGYA 1TUIA 4RJLA 3WXMA 3CC7B 4M0LA 2QDXA 3PENA 5TR9A 3CC2B 4Y9RA 2C77A 3P27A 3CB4A 4M1KA 4PC2A 1SKQA 2R6HA 2EFGA 2ZITA 4IW3B 2DETA 3OJXA 3ZZTA 2C78A 2BGJA 1KK2A 5THXA 1KC8D 2B5OA 2BM0A 4RD1A 4P6VF 3CCEB 3W2HA 3CCJB 1N0VC 5GV8A 1JB9A 3WNCA 3J81k 1CQXA 2DCUA 1VQOB 3OZUA
chains in the Genus database with same CATH superfamily
2ZJYA 3ZLBA 3UB3A 1LSJA 4MVJP 5DULA 2RHRA 3GA5A 1PZFA 3UAWA 6NULA 4KQ6A 1JQ5A 1SA0A 4GSLA 3TX2A 3THWA 2AKAB 2MMGA 4ILKA 4RUKA 4G0UA 4RYDA 3LBNA 5HUJA 3F2IA 3B82A 2AH5A 1Y3FE 1EIZA 4IFTA 4J1QA 2ZAIA 3G5TA 3MAJA 4NBKA 2LCFA 1N6KA 4DA6A 4QDOA 2V5VA 3EBOA 4FSXA 4GF5A 3HXTA 2NU9B 1WUJS 2E87A 1Z7YA 4QYWA 3FNHA 2OBBA 1Q50A 3LGAA 5IANA 3V7WA 1H66A 3HB4X 1DIHA 4BASA 4EIWA 3UHFA 3WMWA 2R84A 5B3JC 4P9SA 3LF2A 4HNGA 4JB2A 4M55A 1K7YA 4KUEA 2H3HA 4P12A 3T7AA 5JMOA 4M1QA 1C7JA 3PITA 3TAXA 4MUIA 3O2SB 2FN4A 1QS0A 3B7WA 1JR3A 1H3FA 2EX1A 2WK1A 1K4KA 3BXZA 3D2LA 3K73O 4MAAA 2N0SA 3WYNA 5BOSA 3U37A 2G8LA 3W5DA 2XOKA 3PDWA 4HRXA 1O4WA 4GIBA 2GB4A 5DOVA 2BM9A 2LE0A 1KR2A 5ICMA 3GJZA 3TM5A 5DLPA 3SIWA 5FLEX 1SWWA 4BV9A 2CBGA 5L9AA 4ACBA 2R6CA 4F5EA 2WTEA 3FKSA 1RRVA 1LTKA 1ZD1A 4H15A 4JU9A 1KOJA 4BWYA 1U2EA 3C70A 4D9HA 1UDWA 2JJQA 3L0YA 5F7JA 2ENWA 2W8BB 3F6EX 3E22A 1XZEA 2EC5A 4V0RA 3HNRA 5EVJA 1G4AE 2NTJA 2FSIA 3D64A 5A71A 2O8CA 5KX5A 2ASVA 4ZMSA 4HQ0A 1NOKA 1RTTA 3SYMA 4RHTA 4LFCB 3FUTA 4ETMA 3U1TA 4LYGA 3JY6A 4B3IA 3L41A 4K9SA 4OJKA 2XYVA 1UD5A 3T7IA 9LDTA 3OQNA 4AKIA 3MLAA 3FBGA 2HA4A 2ZTUA 2IZ1A 4IJQA 1MGPA 3L7LA 3QMMA 1DQPA 1LF0A 4A8PA 4YV7A 2ZSJA 3DZGA 1IY9A 1FX1A 1YR1A 2BFOA 3P20A 3PFKA 4KRGA 3HJFA 3QPWA 1B6SA 3DBLB 3EQ2A 1ZX1A 4HB0A 2VTBA 1GARA 1AE1A 2I87A 4BZXA 3IMGA 1JEOA 1ZDMA 5ANRB 1XZQA 1XLWA 3OX3A 1W2GA 3BHIA 1AZSC 3F74A 3F3MA 3HBLA 1K5PA 3R75A 1DFGA 1UODA 3H11B 3K9QO 3THRA 1HKUA 2Z2XA 1G0OA 3K20A 2YHIA 3BFXA 3UOWA 3MGAA 3FWNA 4QYTA 2WYOA 2CMGA 1TDJA 4J9VA 4UZUA 3SIRA 4RDXA 2Z5LA 4QVJA 4P34A 2ZT8A 2PL5A 1M8KA 1A8IA 4AMBA 2WT8A 3T0FA 2UAGA 3ZCXA 3SZUA 4QDUA 4LKRA 3T3DA 4G5OA 5ALTA 3D3JA 3OFJA 3KYJB 1GKIA 3NC1C 3NI2A 2AOVA 3PNKA 2EFYA 1THMA 3VV3A 4P3IA 1WVMA 2AC7A 4DMGA 2BEJA 2Y0CA 1CF4A 1W75A 3H9CA 1WTHD 2OVBA 2QGZA 1N5IA 2VBTA 2CY0A 4OMCA 5FBWB 1WVIA 5E3JA 3IFSA 4V38A 1L7EA 2A94A 2XI4A 4ZPJA 3WLNA 1G5FA 1VHDA 4R54A 3G2IA 3WA6A 3NZEA 4RC9A 1NBOA 1VMKA 3EEQA 3RUFA 3STWA 4X6UA 1AGRA 2JATA 4K7JA 2O8DA 4X7FA 1KU6A 1NQUA 1QFSA 2P4QA 4F4FA 2W4IA 4L3WA 1MW9X 2YZNA 1AKWA 1X1EA 2ZRHA 3CU5A 1KZYC 4OUDB 5ICCA 1EVYA 1JEAA 3W1VA 1DBVO 2AEMA 4CF5A 2OTLB 1C0PA 1GZVA 1MFZA 1R6XA 1ZVKA 2QRLA 3WYEA 2G6TA 4Y30A 1Y1TA 3SDSA 3BDIA 2SCUA 1ZJ4A 2XUDA 3B85A 1GR1A 3E22B 3ESAA 4H1VA 5JBIA 2WJWA 2UKDA 1YAJA 3CX4A 1YQWA 5TMDA 2DUWA 4EM6A 1NIPA 5AYVA 2E7ZA 1YQTA 3H5OA 5DPMA 5GQSA 2D0PB 2FPRA 4RTSA 3E15A 4FOOA 4GKAA 2AG6A 4KWEA 4WLOA 2YRFA 3S6JA 4LSGA 3KKNA 1A72A 1EFPA 1C30A 2GCPA 1MEJA 2GJ9A 2HGSA 2M1ZA 2YZ2A 3LIPA 3OEYA 4RACA 5FYDA 1S7GA 3WB9A 4GOMD 1CF9A 1JPJA 4L8GA 2ISQA 2GFHA 2O2XA 3K8YA 2QV0A 4V0SA 3TMKA 2X40A 3ICQB 4ZD6A 1N77A 4ZTZB 2AI1A 1MRNA 3OZVA 1QHXA 2VUIB 5AKEA 1I7SB 3EVBA 2GAFA 2XB9A 3IQHX 5C31A 1JIUA 1U8XX 5CYGA 2FW7A 4NVRA 2XEXA 2GEJA 3PPVA 1QZUA 4GP7A 2V9ZA 1NVXQ 3LMKA 4JL5A 4JNKA 2VJNA 2O5RA 3I8OA 2A30A 3QU9A 5HFNA 1N8SA 3H2ZA 4KBYA 2AF3C 2JL1A 3D4PA 1N7IA 4I4TA 3ASQA 4G8DA 2YJ5A 3B3GA 5LZ9A 3EY4A 1ZGHA 4H35A 4EPTA 3I8XA 1WSWA 1TFRA 1ZLYA 1W0JA 2EHJA 4BNDA 1UINA 4I50F 4KVAA 3A1PA 5LBTA 2WM9B 2Q5LA 3VTZA 1U0LA 3AH8A 3ZX4A 5DHPA 2QR5A 3UKJA 4IOJA 2RC6A 1G8PA 4PBTA 3OTGA 2ZEJA 3SIXA 2YIMA 1PJCA 1V95A 2N1BA 3HZHA 3TVTA 4RSMA 2HIHA 3QVXA 1JE0A 1MT3A 1SXJB 2XQIA 3SZMA 5IYNA 1PFWA 3NHRA 3RS3A 4OXIA 4BQOA 4YUXA 1QRAA 3UM9A 2D06A 3C5HA 1D8AA 2J30A 3H1BA 3V7YA 5DASA 1V16A 2H1VA 3H8WA 2Q1YA 2DERA 1SUAA 2NTEA 3A11A 3ONEA 1ULAA 4K26A 3FFBA 3X1WA 4A8JB 2RSLA 4PAGA 4EO7A 1CK4A 2D2XA 4GWKA 1MAWA 1UPUA 2W8ZA 5HKBA 2IYNA 3KWMA 3P2OA 5K0EA 1GN8A 1SD5A 2WMDA 3EDCA 2ASEA 2ZROA 3G7NA 5IUKC 4D4GA 4EPYA 2QN2A 5IZ4A 4I1PA 1U1IA 4G4SP 5JVDB 1Y8RA 1J0XO 2JA2A 3BAFA 2CT8A 2ZYAA 4B3SB 5LNK1 4XOIA 4ZOAA 2VHCA 3GUCA 5ALNA 2D9RA 2ZYWX 3OY2A 4XVHA 4EJ0A 4FB5A 5LYYA 4EKYA 2W2KA 1H3NA 3CKYA 2XRFA 3HLYA 3UXMA 3O9ZA 2F1RA 1Q12A 5K0FA 4DCNA 1RQGA 5HP4A 4CM3A 1T5HX 2B78A 1GWNA 3A2LA 1Y1SA 2A5FA 4QM6A 2I2CA 1E2QA 1FYWA 2D0OB 2LDXA 5G3ZA 4CHTA 1TT5B 2Q3MA 3PNLA 4WNAB 1RYZA 3S7TA 4CT5A 1EFHA 4WCVA 1TMKA 1VI2A 3OAAD 3B1FA 3CF4A 2Z1MA 3LQ6A 3GRPA 1YO6A 4M49A 4MHSA 3TW8B 1SC1A 3R2JA 1V5EA 3C4VA 1D2RA 2YUTA 3ZXSA 4TMXA 4R5HA 5IXSA 3WC4A 5DEIA 4ROXA 1ZIXA 2RI0A 1B0UA 2TMYA 2QUIA 2WW8A 4G36A 4PYRA 3U7EB 3ZHBA 1RHRA 4BS9A 2IKQA 4ENRA 3RTEA 5KNDD 3CBQA 3LOUA 3T9DA 2JFQA 4CIDA 2DFTA 4DR7B 1JTFA 3DXFA 3G82C 2QUAA 3WGLA 1MDFA 1NTOA 4WZAA 5IEBA 2Q45A 1XNRB 3HACA 2X7JA 3I6YA 4RLHA 3TRJA 1M76A 4FR0A 2PLWA 1KAMA 1XAHA 2YCBA 3GGJA 3DMYA 4WJZA 5SV2A 1ZM4A 4TXMA 3JYHA 3R7WA 1JHVA 3HV2A 4O5AA 2B98A 2PT6A 4IIJA 3F9CA 5MN6A 1X2BA 2PQ6A 2D13A 1E79D 2LVBA 4YXFA 5JMTA 2AFHE 3FSRA 4RA6B 5ILOA 3O8OA 2HQBA 3C3BA 4CQJA 5T4EA 3M2TA 4QYIB 1UC8A 2ZUDA 2XA2A 3DQQA 9LDBA 2FPOA 3OZWA 2I34A 3HWSA 2E0IA 3B20A 4M0CA 3RQIA 1U5CA 1RZRD 1UJNA 4F4DA 5BRAA 2IEIA 5C1IA 1FRVA 1RW4A 3UXHA 3K0KA 5BSVA 1CVLA 4OHYA 5CFOA 1Z4QA 1JHDA 4PLVA 5AM1A 1CZLA 4IQFA 1E58A 3BJIC 1O58A 3E7PA 1SBHA 3CE9A 2AFIB 3QJGA 1T1GA 1X2EA 4J7CA 4TKUB 5CIWA 3PTAA 2GMWA 3UAZA 3EVGA 2Y4OA 1VHWA 2WWHA 3VO2A 2XNDD 4PAQA 3ZTTA 4M0EA 2YDYA 3GJRA 4FNMA 1KF0A 1M6VA 4L4RA 5T4BA 2HSZA 4CTNA 3TI7A 1YZFA 3ICVA 5D7BA 4HE6A 4BFTA 4XD7D 4D3DA 2EZUA 3RJMA 4Q9KA 5IULC 4K9MA 2OHJA 4FI3C 2CYBA 4QVAA 2QY6A 2WAMA 3S44A 4TTPA 3CESA 4F21A 2PMFA 1VL0A 3O6VA 3K05A 3OBBA 5ADUS 4XIIA 4RK0A 3LUPA 4WA8A 4B4VA 2E1BA 1KETA 3BBPA 1S2OA 1JQJC 3DV0B 4B0PA 4B3HA 1NHGA 2C5LA 4R2WA 1JKXA 1Z6PA 1A8SA 4RVDA 2PFGA 3OCCA 2RKBA 3U81A 3RYCB 2C4UA 3CNNA 1PGPA 5HQ3B 1QDEA 1YBFA 1WMSA 5YASA 2A86A 1APBA 4KQEA 2V59A 1PKXA 1YR2A 4EA7A 4HNUA 4QYMA 4BUJA 1HNXB 2WDZA 1YR6A 4I1SA 1SQGA 3WLJA 3A31A 2D2EA 4XFJA 4D9IA 1OZFA 3GLKA 3QLEA 4E5VA 1DO8A 3GMDA 4CLOB 2XR1A 3OUZA 1X7YB 3L6RA 5K2MA 3LNCA 4E08A 1H6CA 1USVA 1WPXA 2JAWA 2YXDA 4M46A 4AZ3B 4CR7A 3HXLA 4BX3A 1B2RA 1LSSA 5FBQB 1T4MA 3QLVC 4R6WA 2K87A 1SBTA 2WIKA 1S72B 1Z5VA 4II7A 4KHZA 2VH2A 1GPDG 5IS2A 4YNBA 1IB0A 1WBDA 4Q4AA 4BXOB 1PL0A 3TW4A 5JALA 4AQDA 4EYQA 5DCUA 4HAWA 5L8VA 4RVNA 4N4AA 5KDOA 5AW7A 5JI2E 3I5UA 1BMDA 4XJVA 1SKUA 2I76A 1QQ7A 1L7OA 3ZHQA 3DZDA 3TOSA 3ZDEA 2BFFB 1XNJA 2GJSA 2PJUA 2B6HA 5DNWA 5G02A 1M2VA 1C8BA 1YVRA 2GAOA 3DFIA 3P71T 4G56A 3BQ9A 5EUCA 3RVQA 5IHPA 4D0SA 2LIVA 4IR7A 4DT1A 5K6TA 4X6YA 2AW5A 2X6XA 1SZPA 3CLUD 3V8MA 5KSZA 2HHCA 1KY3A 1Y1QA 2PO5A 1FQKA 2QIOA 3MJVA 2W6PA 4EI8A 5KOIA 1EVJA 3FYHA 4Z0TA 2QM7A 5FIUA 1F06A 1N0HA 2IU3A 3BE8A 5F1OA 4KFCA 2YRXA 1TYBE 4CG0A 4ZAGA 1NUSA 3R3UA 2ZU6A 2BGUA 4I3HA 1VQLB 5CFQA 1OX4B 4UTZA 4NZ9A 4E2ZA 2GKOA 4LMAA 4XEHA 1Y6RA 1OKKD 3BMOA 4D74A 5LJLA 2O8BA 1KS2A 2XKJE 2VDLB 4DPKA 4EA8A 5KMGA 4FFLA 2XCOA 5LIPA 2F3QA 1TC2A 3ROZA 3WLTA 1YL7A 4JUAA 1FDRA 3GN1A 2H0QA 2B2NA 1ICEA 3AVXA 3WX0A 3DZKA 3EG9A 3W6UA 2ECQA 5FBHA 1JQAA 4CMAA 3GFGA 3I58A 4NQRA 2QQFA 4E5DA 2ZUCA 2IUFA 3T7EA 4G1BA 3OIUA 4U2EA 1QE3A 3GT4A 1O94D 4G1UC 2FLWA 2QEQA 3NHWA 4D42A 5CW2A 4ZV9A 4UM9D 3KT6A 4U5QA 4BEJA 1QB7A 1QOQB 1SVNA 5E4FA 5GPBA 3CCVB 2ZXEA 4C7JA 1IQ0A 4GM0A 2NZ2A 2ODWA 3P94A 4YLGA 5FULA 3TMAA 4DSTA 4RKRA 1CUZA 1MB2A 4X1IB 4RH1A 1QGYA 2Q27A 4DNRB 1L5KA 3MSCA 3GEPA 1AKUA 1D2CA 1B16A 2Q2OA 5TPZD 1AGPA 2XSZA 3JQ9C 4RADA 3CC7B 4X20A 3T61A 2F55A 4ALKA 3AFMA 1A8QA 2QNBA 3IBTA 3OZIA 3OD5A 4CM1A 3BXOA 3KQNA 1KFCB 1K92A 4BEBA 4QOJA 2F43B 2WC1A 5SY4A 2YYYA 5AVJA 3SHTA 5EMJA 2V7BA 4NE9A 4JFAA 5J2TF 1VYVA 3TBFA 1ISPA 1YFZA 3U7JA 1ARZA 4MJXA 4DCGA 3SJPA 3GFBA 4L5CA 4FWIB 5JSKA 2XKKA 3JVUA 3HYCA 3K35A 2NO0A 2HTFA 4GYYA 4QBIA 5AKGA 3D8NA 1NRJB 2C7BA 1WCIA 2CLCX 3PKZA 2NUAA 4NZOA 1KZ9A 2ZZFA 2HA2A 5T8KA 2I91A 4NOJA 1NFQA 2G5CA 1D9ZA 5B58T 5KHOC 2C88A 3MQ4A 3WGKA 5AVZA 4MKGA 1P2FA 1NI5A 4XCVA 1HDIA 1S9HA 2ZI7A 4Z4IA 4LRUA 1ODSA 4M8NE 3SQMA 3U3ZA 4O2LA 3PEVA 4KXLA 2F90A 5F4OA 3QKWA 4LI3X 4RK7A 1A7UA 1FDSA 4MRRA 1UF9A 2L19A 2YMPA 3DOIA 3MG9A 3OCYA 5FTKA 1S3FA 3SZRA 3TEJA 1TB4A 4H18A 4PHHA 3ZW7A 3SKBA 2J3DA 4F38A 2ZSEA 3CVXA 1ZBQA 1FZTA 3QX8A 3KPWA 4RTPA 1AV7A 5C2JB 3MUEA 3E6AA 3LVRE 2D3NA 4DDWA 1KTVA 2DPYA 1TKRA 2JAOA 3H0EA 3I0ZA 4N5IX 2QW8A 1KJ9A 4BGVA 5B1EA 1JBQA 1P7CA 1YULA 4Y1RA 3KAJA 1YFJA 1KXZA 1E2JA 1RWKA 4F11A 4JP5A 4REQA 2G76A 3DD1A 3Q8LA 1P74A 2X22A 3HR7A 5I8WA 4EB6A 4RULA 2VYVA 2GBFA 4DIKA 2IE8A 3AYZB 4L4UA 5JU6A 4LXYA 3PIRA 1KJYA 4FFRA 3ZZ1A 1OFIA 2VRBA 3RASA 5IYWA 1UM9B 2HL6A 3KTDA 2QJTA 4UCFA 3I0MA 4BO9A 2I8CA 1A9YA 4GBGA 2OD2A 3VOAA 4EQ6A 3DDCA 4PHTA 3MRSA 1ZIYA 3QE2A 3WY9A 1S96A 3CHYA 1DAFA 1MABB 4UBJA 3NHKA 5HMLA 4EW2A 5EHGA 3D3WA 4X90A 1P5ZB 1W36C 3GQBA 3BZUA 3AXSA 5DCYA 1EFVB 1EX9A 2NZ8A 1ZL2A 4NESA 5FI0B 1OJLA 1OLXB 4GVLA 4XB2A 4Z0PA 1ZK1A 3NUGA 3G0HA 3A37A 2VA8A 3QFSA 3BC9A 4L15A 5T6BA 2GEVA 4MR7B 3QX7A 3KOMA 4Z4WA 2HDWA 2ZI4A 3O4JA 3RO7A 4XKWA 1LPSA 1RHMA 2FEXA 4TXNA 1V16B 2PH3A 3QY0A 1NE2A 5EKTA 4YA6A 2QM8A 1JG3A 3M6AA 5JNTA 3QEMA 3CNHA 4GEKA 4HN2A 3X1DA 4MVJH 5K0TA 3HTXA 3QKIA 3BFVA 10MHA 2IV7A 3ZEIA 2FEPA 3ZHRA 2HRCA 4HL6A 5CLLA 1C9EA 1KH3A 3UG6A 1FFAA 2CNBA 2H52A 4G7XA 4IINA 3FTEA 1XROA 3U7GA 2YFKA 1GL7A 1ULTA 3K0EA 4BMXA 1GTZA 1QQ5A 3WFJA 3AM1A 4AZVA 4G7WA 2HB6A 5E2IA 4ARVA 4ZOCA 5LP1A 2VQFB 3KKOA 1QK5A 3DO5A 2GFIA 4FUTA 5DX1A 4TMZA 4XWKA 2IXEA 1O3YA 1RQ7A 2W6CX 4XASA 3ZE8A 5A9RA 5JFGA 1N2OA 4L8WB 1HY3A 3GC6A 1PDVA 2ZL5A 1IHDA 1ZW1A 3H8SA 5FBRB 5K0LA 1UFOA 2RCNA 5E6SB 3WAJA 1RKBA 1PL6A 1VQ1A 3IR7A 4I4TF 4AO7A 1Z0IA 1V9CA 2ZRAA 1AO0A 1F2TA 2A7XA 3MTGA 4LXIA 4XPIB 3KUUA 4NTZA 4IO1A 3EOBI 3LXXA 2BCJQ 2RHBA 5A6VA 2ZXUA 4KH0A 3JQDA 5MFPA 3ZWDA 2XZTA 3G1WA 1BIFA 1IG3A 1OYOA 4NFSA 4EB6B 5KQPA 2O2HA 1CVIA 3O4RA 4E94A 2G82A 4ZGGA 3CX7A 5AUPB 1GPLA 5L4NA 2FZCA 2JW5A 1UKEA 1G98A 3PCTA 3RYTC 2X8BA 4ZZ1A 4M99A 4ARZA 2DQSA 4RHUA 5A3SA 2HA5A 3AZOA 3DC7A 4CLEA 3A28A 3LFTA 4RD2A 1IN7A 1HV8A 3LKBA 4AMUA 5JRDS 4G4GA 4UVEA 1ZJJA 5DBHX 4D25A 4WNIA 3KQQA 5EOVA 1SUWA 3MHPA 3CONA 1J07A 1OV6A 5K3FB 1GU0A 3DH0A 3DDWA 5LXTB 5K3BA 5E9WA 3THXA 4EHAA 3F6BX 2ONKA 5D87A 1PJ4A 2R2GA 3KL4A 1ZW6A 3Q4GA 2CF6A 3DVAA 1QNFA 2PX3A 2YN4A 3U5ZB 4N39A 3ONYA 4KZKA 3EDYA 3ZH9B 5E4YA 2Y0PA 4J7AA 1RADA 1OIVA 2IDJA 2XUPA 4Q34A 4RFVA 4TVOA 2K6GA 4HX9A 1XDZA 4X7BA 3VC3A 4CMKA 5K0CA 2LUOA 1GNQA 3LZ6A 3I8SA 3E0QA 4A03A 1A1SA 4HZGA 1KWGA 3DE4X 5E7QA 1JLMA 4B35A 5I47A 1YVEI 5IPFA 3I6QA 3GB9A 2YJ6A 2AN3A 5INTA 1GLNA 2GRAA 2G1JA 2R6ZA 4BO1A 3CJRA 1AMOA 4OXYA 1C9NA 2J5RA 3W0LB 4IPTA 3L4JA 4G09A 5ED0A 4XQFA 3IIEA 4Z7NB 1BWQA 1V3QE 3OEED 1IJEA 3A6GA 3PXEA 4OXNA 1L5NA 1Q92A 4AY3A 3P2JA 2REQA 4N0PA 4RAOA 3TO5A 4UD2A 2FPPB 3EY9A 3VQTA 3HZZA 4B83A 2FPIA 3DFMA 2IHZA 3WV4A 1ZUHA 5LN1A 4PIMA 5F64A 3GFVA 1B3RA 3HS3A 4O2AF 4XGIA 1J7JA 5D01A 2NO6A 4RTLA 1UK7A 4IZIA 3ETGA 1D4OA 1ZR4A 1SCUA 1VG8A 3KKLA 3LRTA 1P81A 4XOPA 1D04A 1NF8A 2G0AA 4I2NA 3FCEA 5E8JA 5FWYA 4PX9A 8LDHA 4MEJA 3HA3A 2HK8A 5BSKA 3L0SA 3WWDA 1EZ1A 1GVNB 4S1PA 3HK2A 4IG4A 2O7NA 1TZCA 2XUZA 3NT5A 4J3FA 3TLMA 4EITA 1WXIA 4JJ7A 4IUYA 1RAEA 3K16A 4ZZIA 3D5QA 3EMKA 2FSGA 1GAWA 4RH0A 1JVNA 1YJWB 1N2HA 2YV2A 3LX5A 3AJ8A 2VSXA 2QGGA 1A77A 1M10A 4JMPA 4Y1FA 5EAIA 4D2IA 2C5SA 4WNAA 3N2ZB 1D0SA 3C6KA 2ONCA 2BEWA 3GLVA 5JSHA 1PLJA 4JMQA 4J0FA 1U0NA 3P9CA 3SFTA 2D3TA 2LBPA 3QBEA 3K0SA 4RKQA 3EUAA 2D7JA 2F8LA 2GLUA 5J40A 1KFEB 2WIDA 3G4SB 1B1AA 3CINA 1AUVA 4TROA 5F1PA 3PQEA 1ZA2A 1D3AA 3CMMA 1DC6A 2YMQA 2V74B 4CCWA 1PCXA 1K63A 2G83A 2A58A 4BNKA 1RLTA 2JJ1D 4MW2A 4N82A 4BKUA 3RYIB 3UBMA 2GAIA 1U8TA 3OETA 1IWOA 3PS9A 1W49A 4KVFA 4OBEA 1T9GS 2PL3A 3REFA 3P4YA 4BCBA 1ONSA 4NBNA 4C08A 1NVGA 3O0DA 2QAGB 1AQ6A 1N5DA 2R7KA 2YDXA 5KTPA 2ST1A 3NTVA 5I51A 1R5NA 3I56B 2WNHA 3O93A 5HE8A 3ROXA 5I4CA 3M6MD 4B32A 1IEXA 1SHZA 3KXLA 4Q9HA 4F56A 1M1ZA 1UBUS 1ZBDA 1AXGA 4IHAA 2VBSA 2GKGA 4WNCA 4RANA 2EEZA 1A69A 1ZESA 1PEYA 1IPHA 1SB9A 1XL0A 4ZQFA 3B2NA 3U3KA 4Q7QA 3M4ZA 2DH6A 1IMOA 2PNFA 5GADl 1GDDA 2CF4A 5SYAA 4G8CA 5U4QA 2RJOA 2OP0A 3A4NA 3C6BA 1N1MA 3GK3A 3HKCB 1JHMA 3AIMA 3AFOA 2GJRA 2Z58A 3B13B 1EXWA 5C80A 4MTCA 3EYAA 4OHXA 4RKEA 2XLCA 4QUGA 2W00A 3BM5A 1RBZA 4QHYA 2DTDA 4NJEB 2D1QA 2F8TA 1P5JA 1YB6A 3EVNA 1A98A 1NR7A 2C54A 1DAHA 1KBZA 1ZRSA 2I2BA 3QUAA 4IDEA 4LZAA 4PE5B 4R51A 4AN1A 5ALYA 1YB2A 5C3MA 1ZCZA 1KI2A 4PZYA 4CKZA 1Q7RA 5CH3A 3T3EA 1H4VB 1N6LA 2FZEA 1H1LA 4P3OA 1O54A 5BN5A 1PQPA 2QMEA 1H42A 4DAOA 1T3SA 4KI0A 2AQKA 3BD6A 2PWBA 1N6HA 2VBGA 3WGTA 5HF9A 1XYGA 3I2GA 1G8SA 2PYDA 4P84A 2XCIA 4H4CA 1UD2A 3OPYA 2FOXA 3IXQA 3WNDA 4LRWA 4LWPA 2WKQA 1VLLA 4WCFC 4EDHA 5CBPA 1FBNA 1P39A 1NP3A 3IOMA 3VU9B 3AIIA 3ANTA 3BWDD 3ENKA 4DXDA 2YWGA 3KPUA 1ZWLA 4IICA 3ETCA 1NZJA 3HVJA 4E6PA 3DZHA 4I1YA 3H2GA 3PV0A 4MO9A 4EY7A 3QVVA 1S8FA 2XNSA 3AR5A 1JHUA 3IL2A 5AXDA 1KYTA 4FNAA 5ES3A 4X9XA 1ORIA 5LA6B 4IDPA 5IYZA 1UT6A 1FNSA 1RI4A 2G5GX 4Q39A 5K9ZA 1UKVY 4FW8A 4EX7A 4FYPA 16PKA 4NCHA 4EVSA 4P35A 1YZHA 3SGLA 2OORA 1ZXXA 5F76A 1OC2A 4C5BA 1P0CA 2FQYA 2QTTA 2ZB4A 3M6FA 4DMKA 2BDEA 1A5TA 1YDHA 1COWA 2GHTA 2UZ1A 3T5DA 1GA1A 4MYTA 1TQDA 3JYOA 3TOZA 6Q21A 1A7KA 1CR1A 2FY8A 2NNLD 1N7JA 3QJYA 4PO9A 1J8YF 3CB2A 4J1TC 4B6OA 1KZ7B 5J4YA 1OU0A 1K08A 1UXJA 1WXWA 2MT9A 1QRRA 2O7RA 1F6DA 2RGBA 2QZ4A 3HUUA 4GQBA 1I13A 5JJBA 3WVNA 1X7HA 5KINB 4QQKA 5HCUA 2C7PA 4UBNA 1DOAA 2W8BA 2IHBA 2P2LA 4OA5A 4B4UA 2B1JA 4YRMA 1VBNA 5C35A 1FUEA 3QVMA 2XHEA 3MFYA 1DEOA 5AKZA 5CA0A 3ORHA 4K9KA 3VPHA 3CO5A 5EP2A 3VA7A 4G0VA 2HC9A 4IOKA 4X3PA 6CHYA 4P3YA 1M1UA 1UD6A 1GNVA 1GPH1 2COUA 3OM0A 4D99A 1ODIA 4JOCA 3LPDA 5CM2Z 5CRIA 1WXXA 1JVSA 1XR3A 3N0XA 4FMBB 4JBIA 3AR9A 2JFNA 5E95A 4N3CA 4OLBA 3PEYA 1JV2B 5EQFA 3WR5A 2B8TA 2H1RA 5JC1A 5H82A 1JE1A 1GZSA 1LK5A 2Q3LA 1KNQA 1WSAA 5CVJA 5ULLA 3WLKX 5EWJB 1AN9A 1ODJA 1UMBB 2ZSFA 4D98A 1JMYA 1DKPA 1YHNA 1O95D 3FOAA 4IJUA 1ONBA 4R69A 1BDHA 5EMKA 4XA8A 2YOFA 5FQNA 3R6GA 4WPGA 2XCRB 2PRJA 5K05A 1S3GA 4YJHA 1DNPA 3VR3D 1JEQA 3UMCA 3MN1A 2WJGA 1EFVA 4RU1A 1KK1A 2PZLA 4R2HA 3Q1LA 4OI4A 4NH4A 1MTZA 1Z2NX 1S6YA 3PHLA 4NK5A 3RFXA 5D5HA 1L8QA 1U3TA 3G6WA 4R6XA 1XRNA 3LWZA 4B40A 3HJUA 2GGSA 4BO4A 4F3TA 4EAQA 1P0QA 4R1TA 4Y2YA 4YJ3B 3KTAB 2Z09A 3O91A 2KHZA 1GGFA 1YIAA 2JLQA 3R1IA 2ORYA 2QMYA 2RHOA 3FNGA 1UBGA 4ZVNA 1SCBA 1X1TA 1QYCA 2L17A 3PHGA 5A9SA 2PIAA 4I5DA 1QUFA 2CXSA 1NB0A 3AR2A 3AZPA 1Z0FA 2ZRDA 3F78A 4TT3A 3HKEA 4GKVA 1P80A 4EI9A 1B14A 5JPIA 5K01A 1H2AS 3I9KA 3GNSA 3GLIA 2FWAA 4N7RA 1M1NB 1KRXA 3V4PB 3UICA 3N2YA 3QLVA 2ZTVA 3RWBA 3N28A 4OB6A 1WNTA 1POXA 5DTEA 1FS5A 2EJCA 1DQSA 3Q7TA 2FUCA 4JJGA 4YP7A 2X0DA 3DAHA 4LYFA 4QOEA 2PMWB 3FCYA 3RVPA 1J7KA 3SR0A 2UVDA 4XM2A 5CM9C 2ABWA 2VJDA 3KXDA 3L07A 1U7DA 1KI8A 1XLUA 2XUQA 3TIVA 4YMLA 2BFBA 4AS3A 4EL5A 3ZD6A 3WISA 1E2HA 2P5TB 3RSLA 1I51A 1P2VA 1VE3A 1BX1A 4P81A 3IVRA 1DDIA 4TLBA 1U7OA 3HXQA 1YS9A 2PGXA 2QENA 3AETB 2JAHA 1J8VA 2WILA 3E18A 3OIGA 1OY1A 3UJ8A 1KJQA 2F9FA 4WWHA 1E3XA 1R15A 1WXQA 2DT5A 3O3CA 1YNOA 3AUAA 5KSPA 3EEYA 1Z4MA 3AOEA 1DFHA 1K8QA 4OOVA 3KZKA 3ND8A 4EYKA 5J4HA 5LQDA 3A9TA 1YQDA 1CP3A 3SS8A 3OIYA 2GT1A 2JLBA 3VSAA 3QPDA 3UJNA 4BGUA 2IIVA 1I4LD 1RJGA 3KDPA 5DYTA 2VHVA 2UZ3A 3LT0A 3UXYA 5KMGB 1E2BA 4QDZA 2GJPA 4HTAA 5LQRA 4C6HA 5CR9A 2BMEA 3QFHA 3R8FA 3O2QB 3MOIA 3BH4A 4FXPA 4TWJA 1V8DA 4HHEA 4XWAA 4OI0A 1KDVA 5BW5A 2W6ZA 2O4UX 3JARA 2QN1A 4IEIA 5HRAA 3EMVA 2PYZA 5K0NA 3VXKA 4P3NA 2AVDA 1MC1A 1LTQA 3DOOA 3N2KB 4ND8A 3DFZA 4GBMA 5A2GA 2RHDA 3VJKA 2IHYA 2PGLA 1P17A 4CN8A 1T2FA 4JBHA 4I50A 4M1SA 4DCSA 3UT5A 5BR4A 3QWBA 3P2MA 3JYQA 4KXNA 3A3PA 1L7PA 3CWQA 5THXA 1TLTA 5F51A 3DT8A 2IIBA 4OHCA 3GGGA 5JJCA 1G42A 3BE5A 1GDHA 4CCYB 2Z4RA 4UOZA 4D3XA 3DYIA 4MYRA 2OFWA 3NBUA 4MTLA 1MX1A 1KJNA 3FLAA 3D4LA 4K6FA 5ER6A 2H06A 3W8DA 4E7PA 3FHOA 5AMXA 3K0HA 2GK4A 1YOVA 1WSDA 3SU8A 4NU0A 1XTQA 2VK4A 5EKDA 3IPRA 2X42A 4V1CA 1PG2A 4HTFA 1TLFA 5H1YA 5FLKA 2R8OA 5BV7A 2E37A 2X8JA 4W1PA 4LI0A 3UUWA 2X5OA 4N8DA 1T4CB 2Z08A 2YCLA 5EJEA 1EHIA 4EBFA 4ZV4A 5J2UA 1TCAA 4W9RA 4WGFA 2O1XA 3COVA 3DW1X 5H8WA 5BN3A 2AN1A 5FWYB 4BUCA 1T8UA 3B6KA 4PIPA 4GAEA 2A9QA 3BQMB 3DMFA 3HDTA 2O19A 4K1XA 3DT6A 1HBJA 4MOWA 3RIMA 3VTFA 1PFQA 3GGCA 3H5VA 4NAUA 2DC1A 4PCVA 2HW8A 4FK8A 2B4QA 3AEZA 5LQSA 2BI7A 1HLGA 1OT3A 4Q3KA 3WOVA 4F5ZA 1SBZA 4DZZA 3ZD7A 1BCSB 2FPGA 2Q8NA 2VCEA 3KSUA 5K8TA 1YJXA 1D2MA 2WJJA 1SUPA 2WLSA 3FOBA 3DMGA 4HATA 3SJAA 3C24A 5KYTA 4KWHA 3N2LA 3TPFA 5B36A 4BQFA 2O0HA 4HLDA 3SYNA 4HX2A 1NW3A 3WQHA 1R4MA 2YVKA 3HN7A 3LLVA 2BE9A 4KGXA 4QFBA 2Z2KA 2ANCA 4YI3A 4KQFA 2FRDC 2CXHA 1Z2PX 5BMVF 1ZOPA 3ZHVA 3DEFA 3HB1A 1W1IA 1CDEA 5F12A 4N48A 1CF2O 1ZL0A 3QLTA 121PA 2EQ5A 1ZUWA 4JVMA 1W47A 2H0RA 4JB3A 4B80A 4Z4FA 3T8YA 4RWEA 3EGEA 3H17A 3MELA 4UKDA 3DA8A 1T8RA 4P2GA 1FLVA 3RAFC 1AS2A 2ZE5A 3SD7A 4HWRA 4L4ZA 4TLMB 4A8JC 1DTWA 4Y0AA 4ZAVA 3E1YE 3G5UA 5CDHA 5CDYA 3C87A 1WZIA 2Q0XA 3GLQA 4OH7A 2IV2X 4EQ6B 1TU4A 4D9FA 2J4FA 1O89A 3LDUA 3M3HA 2W11A 1FDWA 3DE5X 5JIBA 4JLSA 5IN5A 3ZE1B 1E0AA 4NULA 2TMGA 3NJ8A 2JI9A 5ICSA 4L74A 5ES4B 3TEMA 2VG8A 4CQLB 3QV1A 2AE1A 4JYMA 2VP6A 3VH3A 1NZDA 4B74A 1XHEA 3KFVA 2I4NA 2ORED 4GP9A 4Q48A 4DKJA 4JT8A 2YZMA 4E70A 1OXVA 4LC0A 1UC9A 2HN9A 2PTGA 3MGKA 5CPFA 4NS1A 3HA7A 4BP9A 1KJJA 3V1LA 1OVMA 4BQPA 2W0MA 2HFKA 4I8XA 4Q6WA 2QV7A 2QNIA 3S5UA 2BM1A 1DG1G 1N2JA 3HKCA 3LX4A 1HR0B 2NP6A 4MS1A 4QGGA 1SUCA 4KXUA 4BJ5A 1J0EA 3IMKA 4DDTA 4DM3A 2ZI9A 2HD4A 2L18A 1PJZA 2ORVA 2X4GA 3C45A 5FBZA 1QIJA 2J7PD 3V4FA 6REQA 5IJ9A 1XZAA 1R0BA 4D0NA 1O8CA 3PKJA 1BYIA 5FPTA 4BMYA 1IZ8A 1KJ8A 1ID1A 3DKPA 1Q1ZA 1SVOA 4NBWA 4U39A 3TYXA 4BE4A 1M5RA 3T1HB 3FHCB 1BCSA 3SFZA 1AC5A 3O7WA 1NMSA 2P79A 4HB2A 1NP7A 5A4KA 2HSGA 1QX3A 4Q66C 1DV2A 5T6MA 1U94A 2CMKA 2JCSA 1BMTA 4LTMA 4AJHA 1HTBA 1HSOA 2J9XB 2IODA 5CNIA 1K28D 4U7GA 1XE3A 3RTDA 1TO1E 3DF9A 3HJAA 1A2QA 4RXTA 5D6OA 5DSTA 2D3LA 1FTQA 3BMNB 2WM8A 3JQQA 2BM8A 3DDSA 3OU7A 3ETEA 1B41A 1RYNA 3PE4A 4HGYA 2YJTD 5BQPA 1S1MA 2CFOA 1U7XA 2OHGA 2WZBA 1V2GA 2I8AA 1IN4A 3AOEC 4L5JA 1Z6YA 1U7HA 2QRJA 1JR3E 1OLSA 2B82A 4QTZA 1Z0KA 3KEOA 5K20A 2ZJ8A 1VMIA 1JS1X 3EGOA 3VH2A 5IUNC 3BK2A 3E9MA 3D1JA 3SZOA 3WAKA 3U56A 2FXVA 2JGMA 4FFBA 5JO9A 4CCAA 3ICEA 2B2XA 1J09A 2GO7A 4H7IA 4RLSA 1W581 2GCOA 3PFHA 3LVBA 3QWAA 4ZQGA 3TSCA 1O97D 4BNHA 1YBVA 4DUYB 2GDJA 5FTNA 3WYCA 4YAIA 2GILA 2VHTA 3VPFA 3T34A 1I10A 2Z6BD 1ZQ9A 3VSCA 1NASA 3DWEX 4CI0B 5IK2A 5DP1A 1SHJA 3PE3A 1G5QA 2UYYA 1KMHB 3VO9A 4BY9E 4WECA 1U81A 5DM1A 4CMIA 1M2OB 4MPDA 4PZLA 1DXYA 1EFDN 2QF7A 1F60A 3CA8A 1V43A 1F4LA 2G28A 1HVXA 3GRYA 5D5QA 1DC5A 4H17A 1CZHA 4MQBA 1EXMA 1TT7A 4UHDA 1FFCA 2HDOA 1JAZA 1E5QA 4G97A 4ZKDA 4UQLA 5I4KA 5DS0A 1UP7A 2ZTHA 1XU7A 2A3RA 2H2DA 2HLDD 3D0KA 5IDWA 5DB4A 1M8PA 3OJFA 4B6RA 1HF3A 2R00C 4TYQA 4X8MA 1ZOOA 3TUJC 1YQQA 2NZYA 4H6WA 2Q4DA 2QG6A 3A35A 1H5QA 2P2NA 4MVCA 4GFDA 3ZIUA 2EYQA 5C8YA 4Y2PA 2QU7A 3VSBA 1E9AA 1N5OX 1Y81A 2BBSA 3QSGA 3RYFA 4DADA 2BFWA 4IGFA 1RAAA 4WSOA 2PMKA 2OP1A 2VTEA 2IY8A 3NDJA 4U9UA 4TQ9A 4HLCA 4KFRA 3AUJB 3SZLA 2V0NA 3QKRA 5EJGA 4TWAA 3QU2A 5BR7A 3WWYA 1OB5A 1RCFA 4U7PB 1JHXA 2WOJA 4ZANA 4IMIB 4B44A 4XLCA 1ZJZA 4X1KB 3BSYA 4KE9A 4ZYWA 4E5NA 1UMBA 1B00A 3KS9A 1JJ7A 3FF1A 1MB0A 4N01A 5F5LA 5A3VA 3SF8A 3SHQA 1LFDB 2BKXA 1EP1B 3CYFA 4XVRA 2O3UA 5LOVA 2JD1A 1TGVA 2UDPA 1G5PA 4F04A 4UUPA 5KNDH 1M0EA 1WW8A 1LC3A 2O52A 2YJGA 4RY0A 1E5XA 2PUBA 2YN0A 3AEUB 4NYJQ 5GY7A 3GJ8A 2C2XA 3O3OB 5DXFA 2FZVA 4E11A 4DB2A 5JRJA 1G5HA 1R4NB 1TMOA 3RTGA 5ESXA 1L7BA 4F1KA 1L7RA 4EUFA 3DULA 4WLFA 3PVSA 1JR3D 1ZYUA 2V6GA 3O2JA 3DJYA 3KWFA 1JFSA 3A3OA 2VIIA 4Q1AA 1TTHA 1VKJA 1ZIPA 3CCCA 3D02A 3SNHA 4FQ7A 4X1KA 2PMBA 3KEFA 2PK3A 1G66A 2RHJA 3IKVA 3P0FA 4HMOA 4DMRA 5KOJB 5TIIA 5L53A 4Y6QA 3D5TA 4HIZA 2BL4A 4AXBA 1HO3A 2I4TA 1W8DA 2X2OA 4QZVA 4O1MA 2OK7A 1KNXA 2BJWA 3BVPA 4MKXA 1TEVA 5IARA 4BC0A 1OBCA 3KT3A 5IT4A 3FTNA 1A9XA 1ISGA 1EK1A 2D5CA 2DE0X 2IP4A 4UHFA 4WLVA 1V11A 2XDQB 1U4NA 4FZ5A 4HBZA 4OFZA 5EUMA 3NWJA 4FINA 4HDQB 1BAPA 4JVOA 1IBCA 5H0IA 1I33A 4C0JA 4RJTA 4DV2B 2IOHA 2O8EB 5B1SA 1R0XA 2G70A 4NE2A 1XJCA 4NU6A 3VKHA 1QIEA 4TUYF 3FYUA 2C96A 3KJGA 2IF2A 2KE5A 3GT0A 1JLSA 1WHSB 2M6RA 3GCXA 4K6GA 4Q1VA 2BF7A 3TTYA 5IDXA 3LFHA 3ZVNA 4P86A 1VCOA 4GGPA 3PFNA 2CBZA 4KPYA 3H05A 3SOZA 2OLKA 3B53X 2WNIA 2P9YA 3TE7A 4DV1B 1T0HB 3WGZA 4POOA 4JVLA 5J59A 4L4SA 4UTPA 1XALA 4F4CA 1NI3A 1SG0A 1XE1A 2R85A 2FUKA 3KJFA 1WHTA 2PVSA 2ZJOA 3SVZA 3EPKA 1C1YA 2IXDA 4ZZ3A 3LCRA 3VDMA 2OG2A 1V1MA 3P9SA 1QV7A 1EFTA 1G4HA 3FDIA 3FSGD 4O2BF 2ZE8A 1MF7A 2F3UA 1GILA 2V45A 1YR9A 3ASPA 3QELA 1KDYA 3SSMA 3ZCQA 3W9SA 3KZOA 3P2KA 1FRNA 1XZLA 3HJGA 4ZHQB 3DE3X 1W52X 4BNWA 4X91A 4BGEA 5KVQA 5EZYF 3JAMA 1V0EA 3I52A 1PU2A 2G4CA 4LE1A 3X3HA 3IHTA 2ZTNA 1RYFA 3OWXA 1CNFA 3MNFA 2BN4A 2PEYA 1OLXA 2O6HA 3ABSB 2DB3A 3LQ2A 2WUEA 3ETLA 3MCVA 4BNIA 5I7UA 5CJJA 1AD2A 2IOFA 1RJWA 3LT5A 2XVXA 4QFDA 1QFMA 4FN5A 3JASB 5JAIA 1Q0PA 3V34A 4GLFA 2DMRA 4TV9B 1GPBA 4Z4QA 4X62B 1P1HA 2VP0A 3FVWA 4TMVA 1NW7A 1SUIA 4FOTA 3TTWA 2FV8A 5D3KA 5AK5A 1H05A 3TW6A 4B31A 1W88B 5D5PA 3FPFA 2PKRA 4ZP1A 1CDOA 4LCJA 4FIDA 4YI5A 2J9YB 4XZ3A 2WWWA 3ROTA 3FYSA 1X13A 2V7PA 1L8LA 2P6RA 2HBZA 5TT1A 1QBKC 1NXQA 4RELA 2XQFA 8GPBA 4G2NA 1KEZA 1B0ZA 5HOQA 4TYMA 4Z4TA 621PA 3DC2A 2QE6A 5EGNA 5TMEA 3QF4A 1DJOA 2XOEA 1LPPA 5F3WB 2QI9C 5AJWA 4FBMA 3ZHYA 1W0JD 2OM2A 1QQTA 1HQCA 1EGQA 1U1EA 4WK6A 3S28A 1F14A 13PKA 1P5HA 5CT9A 5DI9A 2OYRA 2PUGA 1WU8A 2MINA 3B1JA 1O5OA 1IY0A 2Q5QA 1JH9A 5AKIA 4YMVA 2QUJA 1WABA 3ZK8A 3L7AA 1U0RA 4I1OA 5CLFA 1VSBA 1GPMA 3R4CA 2FZGA 4GPZA 5FLXA 3AHCA 4QTXA 5LLSA 5KDDA 2FZ4A 1KYIA 3M9LA 1QK3A 1NJ6A 2O1WA 1EBBA 3OHSX 2OXIA 5DGCA 4MVJD 1ZXLA 2GXQA 4U2DA 3WDMA 3ZR4B 3HDYA 4DM7A 4W82A 1B7GO 1E60A 4LF7B 1V9LA 1BZYA 4JK3A 4I1IA 4URZR 4BNGA 5EGSA 4G3XA 2FSVC 1PQWA 4OCZA 5HFJA 4ARSA 1FTSA 5JD4A 4BX8A 4X7DA 4KB5A 3JQ8B 3NKLA 1YJQA 2NYVA 4CG2A 2QVGA 4PG7A 1IN8A 1FVHA 2AG0A 4EPWA 3VRHA 3NV7A 4RDLA 1DC7A 2ZUBA 4ZDJA 3IJ5A 4EHKA 4LMRA 1PEDA 1Q1AA 2GPBA 1CTQA 2CXXA 3F7OA 4TT8A 3W6NA 3WMRA 5IBCA 4UNIA 4PQGA 2D8AA 4BX2A 3EC7A 3HBJA 1H6DA 2IXBA 1NWCA 1PR2A 3NAMA 1Q83A 2IELA 4HXEB 4WLEA 5F5NA 1MX3A 1E0KA 1U1DA 3GPDG 1XAIA 3VU8A 5ESRA 1DAIA 1P45A 3DNPA 3E3NA 3GLUA 4ZREA 2J5BA 1Z63A 1KBQA 2JLUA 2QLTA 4LYEA 1U4OA 1SXGA 3KHSA 4NI5A 2OHVA 2R8EA 4IX1A 3FPKA 2OVFA 1DIOB 4URVR 3NAQA 1UP6A 4WXPA 4WZBE 1IAQA 3WBKA 4TKVB 4F5WA 3KXKA 1IIBA 1D09A 1QVRA 5HRUA 4J1NA 1V5WA 4CRWB 2C4HA 2HX1A 1JHYA 4B3BA 4MIEA 4RCYA 3DD5A 3T5CA 3ZWQA 1H2XA 3CY6A 4PHGA 4F6LA 2H16A 1MO6A 3JAKA 4R1PA 2ZIWB 5JCOC 4CGZA 3CLKA 4G5QA 2P4UA 1CQIB 3LPAA 2M98A 5EE1A 1YR3A 3D59A 3WHLA 1ENPA 1J9EA 1N6PA 1OH8A 1OC4A 5KC8A 2PU5A 1EXNA 5CB0A 3NOXA 4CE6A 1P5FA 5BNTA 2QQ0A 4ZPXA 2C4MA 2P11A 5EIAA 1JIXA 3I3OA 3NO4A 5UKDA 4BVJA 3U4IA 4LY3A 5ALRA 1GRQA 1JG6A 2XEDA 4UNNA 1Q1EA 2HNKA 4E3WA 1SIBE 1CT9A 4IV8A 3HM2A 1OV4A 4EYEA 1HE5A 4J4BA 3RI3A 2PKWA 3WSVA 3NTRA 1KPIA 4C6RA 3BPSA 5D86A 1OBOA 3WL7A 3CVVA 2VC2B 5EPUA 4KRXA 1R6DA 4O33A 3LHFA 3ZVKA 3BGSA 1LPAB 3IA7A 4ZIRB 1KYZA 3OQBA 2PUWA 4R0MA 3GEDA 4PW0A 4GVXA 3P27A 1P4JA 2QORA 1CQIA 1JDUA 3ADPA 3A9UA 1R66A 1OLOA 2A0XA 2JGDB 3JYNA 4UE6A 3TNDA 4A0QA 4LXHA 1XGKA 2VWGA 1VJDA 3F98A 1UK9A 5AK4A 3WLHA 3OW7A 3HFGA 1M1YA 4G0WA 4PY2A 3VYRB 1TVKA 1FVFA 1NW4A 3QPCA 4BZZA 3GRVA 3TOCA 5EA2A 2DBVO 1FQOA 1V41E 1FYXA 1U5BA 2Q7OE 1UMCB 1E1MA 4Z3DA 2D54A 3JQAD 3JQ9A 3H2HA 1P1CA 4XMYA 1ZP6A 4ZC1A 2OO5A 3ZG6A 3COPA 5HZMA 2XBMA 4IGIA 1P9RA 2OXCA 3KCQA 4JEIA 4OREX 5DXJA 5ECYA 2QVLA 1TMGE 2DPMA 2Z3VA 1N0VC 3PA2A 1TEHA 3HZOA 5DBGA 5GWXA 3WNCA 1XF9A 5HKOA 1P6QA 2JBHA 3UJDA 5JYCA 1PZGA 1Q44A 1G5IA 2A57A 3GMIA 4ZVKA 4PF1A 1RJ9A 4YJGB 1DXOA 1QVWA 3IVXA 1HTTA 1Q2XA 5CCBA 4QM7A 4A4DA 1I4OA 1TJ4A 1F2UB 2HLHA 4R8RA 3SIPA 1GUBA 4BB5A 3KZXA 4EAAA 4GOND 1M74A 2IXFA 3TD2A 1TF5A 3RABA 4R1NA 1J24A 1DKLA 3KR0A 5CLQA 4IJ5A 2C9DA 4UASA 1AK9A 1CB7A 1PD1A 4P4LA 3V46A 2VRCD 3L84A 3T99A 1E1NA 2C8KA 1CEXA 2QRGA 3G9XA 3CEAA 5KQLA 4MQUA 4OJMX 4KKSA 2LKCA 5JQWA 1DRUA 1VF7A 5CFPA 4LVOA 4HMPA 1XN4A 4HKTA 1NA5A 4B3XA 4BUZA 2IBSA 3DZJA 1E96A 4CKCB 4EJ6A 4HDRA 2EX4A 4Y2HA 4J2OA 4Q5IA 4H1WA 3KLNA 4LBWA 4L0QA 3T3OA 5U4XA 1YCGA 3REOA 4X0CA 2IYYA 1E59A 4GDMA 2CJXA 1LLDA 1Z2AA 4MP6A 2XADA 3H5IA 2CNWA 1CW2B 2B30A 5T41A 4B3RB 2OCYC 3EFEA 4C0SA 3G79A 5DW0A 2BKLA 3UMSA 4K0KB 3NCHA 3S27A 1UWVA 2XLBA 5IHXA 4JS0A 4D41A 3RRJA 3K9BA 1JG1A 3BCSA 4HH1A 2DKOA 2XYRA 1M1YE 4Q7KA 1PL7A 5B6PA 1J2JA 1N8NA 2AFHA 3KAPA 3TBHA 2I03A 1H4QA 6ADHA 3M1LA 4GICA 2P6OA 3PGVA 4PSDA 4Q93A 4EFKA 1GNLA 3KOWA 4FJ2A 5CVEA 1Z34A 3M3PA 2AZXA 2Y8EA 3PWKA 1Q3HA 2RK3A 3UJPA 3CH5A 4OQNA 1E79A 2I2AA 3L8DA 5CGZA 4MUMA 4N8EA 2Q5CA 2R96A 4ZEXA 5AW0A 1E9BA 1ADGA 2DBQA 4GX1A 1UJBA 3ZXIA 4BB6A 1QZTA 3I37X 4NK4A 2KPOA 1E9RA 2GBLC 2QOEA 2CCKA 1JDBB 1NXSA 3I76A 2QAGC 5DVZA 5EQJB 2ZUEA 1Q15A 3MVEA 1AIPA 1S8AA 1SVWA 3ORRA 2BFDB 3GPCA 5JFTA 2V98A 2GD1O 1IVNA 1C4WA 3ACBA 3KKMA 4LJ5A 4QO7A 2GZSA 3PNOA 2XMCA 5DRTA 2X9LA 1FNMA 3GGDA 4YPVA 4AAYA 5BYBA 4DQLA 1E8DA 3RVKA 3HHPA 1W19A 5FFFA 4B82A 4BB9A 3QY9A 1VP3A 1NUAA 4ZI5A 2E2WA 3ILXA 3HADA 3DMNA 1U0SY 1KEVA 2DUJA 1M6WA 1Y3DE 1NF9A 3PFIA 1XG5A 2BFEA 1TQHA 4CEIA 2EP5A 2QB5A 2JGJA 3ZHZA 2WU8A 1F8UA 1G8JA 2DTEA 3C8HA 2GK6A 3C43A 3ED5A 4MVJG 4ND7A 4Y0NA 5LQCA 4WZEA 1XRJA 4CKCA 2B99A 4C7MA 5FOWA 1YCHA 2OORC 3L1IA 1XXLA 3UXEA 2BZSA 4B47A 1MXHA 4RQBA 1XXHB 1KARA 2G0TA 2SBTA 4L02A 5LB2A 1L8XA 4CM5A 3D7RA 2FVGA 2EBFX 1SK9A 1O6BA 2B5WA 3SC2B 3RC8A 1X77A 2H17A 3EZYA 5KOHA 4RPIA 1N2CA 4L3VA 1XL1A 4RX1A 3RUHA 4Y18A 2OA0A 4OFXA 1LPNA 3LYLA 5IVPA 1IHXA 2EL9A 2NO4A 3M2PA 3HU5A 1UAAA 1R3DA 4GPIB 3ZV7A 1E4YA 4LJKA 1C7RA 1XTPA 1IUKA 4KI7A 5IC6A 2PKYX 3KJQA 1OLUB 1YGPA 3I42A 1YZYA 2GJ4A 2Y1XA 3BN3A 1EWYA 1AHNA 3DT9A 3IYLW 5JS1A 2A5YB 2IYFA 2Y2VA 2Y68A 5ER9A 3SBOA 1CY1A 1V71A 3W3AA 4B85A 3UT5B 3LTNC 2H63A 3N8HA 2QXTA 4J6FA 3KR2A 3WMEA 4O0LA 4QL3A 1IVSA 1F2DA 4EG4A 3M0EA 4EG1A 3QXCA 1BJKA 4P7KA 2AF4C 4CCYA 3VYUB 4E5YA 1YQUA 4HDSA 3A3YA 3FMOB 1U63A 4OB7A 1OXKB 2OGSA 2XJ4A 4BAUA 1MDBA 3TZ6A 1SXJC 1FS4A 1K8RA 1KP2A 4CT0A 4H31A 4GVPA 5K5EA 5IFLA 4B75A 2DPXA 3RWOA 4MRAA 2JD0A 3QU7A 4EHLA 3WI7A 4LWOA 3KVYA 1W2BB 3WQZA 5DHQA 4G9BA 1I2MA 3WLRA 5A88A 2BTEA 3C5CA 4M53A 1UAGA 3BEOA 2ZRMA 3Q7RA 1ZO8A 1XEAA 2ZBFA 4BVKA 5GOZA 4FCWA 2D1RA 1NF2A 4FI3F 2Z95A 2OAP1 1PWEA 1RPTA 4B33A 4RPDA 2RI1A 4AYXA 2HNAA 5CT6A 3RYHB 3IUSA 2XZLA 1R0ZA 3I2YX 5AK0A 3SG0A 2DP4E 2PUJA 4ALLA 4RHFA 1CNEA 2OV3A 3DOHA 2WHPB 4F60A 1XMJA 2QTRA 2QSZA 1R9MA 2TMDA 3F96A 3RNOA 1HLFA 4ZVMA 1XEWY 1TJPB 1M75A 4ZJYA 1WUYA 4QQ8A 1IZ0A 2HPZA 2QTWB 5E0OA 4L4YA 3T15A 1N07A 3WTBA 3VNQA 1ISFA 5HQ3A 3GDFA 2XVYA 5DFAA 3D7NA 1B2LA 1TYAE 3G02A 1G9XA 3PYXA 3OQPA 4O2BA 3QA9A 2OMEA 4OJQA 4L5IA 3RS0A 4DE5A 5JEEA 2ECFA 1E5VA 2ZJFA 3CUTA 4F8YA 3C7KA 4DRXB 2P5YA 3PJRA 2PSEA 2CSXA 2A5DA 3GELA 2IHTA 2OMKA 4HI0E 4RD4A 1WU7A 2I54A 2FSVA 2EJUA 5BSUA 2GAJA 5A89A 4KNVA 5AOAA 4DIDA 2JLXA 2O8CB 2Y1CA 4ZCLA 1NU8A 3RYHA 4AY2A 2CXPA 3DB2A 1N8RD 3PYLA 1L6IA 3RLIA 4DA4A 5IDVA 4DJDC 3HCPA 1G6Q1 5AN9A 3OZBA 4X1IA 4YJFA 3RU9A 5FTMA 2EF1A 2Q9AA 1WRBA 3E1GA 3JZFA 3B3QA 3ZXXA 3TLAA 2FF5A 4ILEA 4JB0A 1Q91A 4FHCA 1NJ1A 5IKEA 5TF4A 2I3AA 1T91A 2SHKA 2QRMA 4XKJA 3VR6D 4D6PA 2XCTB 3RRNA 3BFKA 1VMDA 3C3JA 2FWNA 1E0SA 2ALJA 4XM3A 1IL0A 4H59A 3AW9A 2WAXA 2ZT6A 5J1SB 3GBSA 3IPXA 1CY6A 1H0RA 4BAGA 5A03A 3ND5A 1JDSA 1NN0A 4C30A 4CV2A 4KOEC 1N36B 1K9VF 2R68A 3BRCA 1QFYA 4OHUA 4QPDA 3F3KA 3MWKA 3H83A 2GM3A 4BDSA 1FYEA 1KI7A 2OO5C 2QYTA 2CZCA 4C4TA 4GC9A 5LFAA 3DAGA 3PJDA 1X6VA 2CVZA 3IDZA 1IJKA 4OPOA 3ZWXA 3MM4A 1IBSA 1X15A 1QZZA 2E1RA 2QW0X 3A9WA 3KKKA 3NORA 2OYNA 3PA8A 3RUEA 5ITSA 3O4GA 5CX1B 4A2QA 2ZE7A 1P2SA 4WZAE 2EGGA 4TL8A 4LDRA 2IYWA 1EESA 3JWPA 4MYHA 4ACAA 3O21A 1W4LA 3KJEA 2N47A 2C84A 3EUEA 2ONJA 2POQX 1UT5A 5AJYA 4D5GA 1UC4B 3RRYA 2G9QA 1DDOA 4BVAA 4HT3B 3JASA 5AW6A 3GI1A 3NEAA 3EODA 2WF7A 2ZSHA 1DDGA 4RD0A 2GTIA 2IZ6A 2JIDA 4YP6A 3C2QA 2ZJ4A 1JPNA 3SXJA 5JS2A 3WMGA 2ERYA 2IKSA 3QXHA 4FHGA 3QHPA 3RDPA 5TQVA 2V4UA 3HB7A 4R31A 2EJVA 2WM3A 4BKOA 4ZJUA 4K86A 1XHLA 3SM9A 1OE0A 3E2IA 3L79A 1KI6A 4JQCA 4MWGA 4G85A 4HF7A 3AEKA 1C3JA 3LU1A 4PAMA 4YGXB 5BN4B 3C3WA 5EIXA 4XGNA 1Y6FA 4G23A 4KIJA 1KH1A 4IIVA 4LE2A 3IEPA 4I1RA 1XC7A 3RFTA 1VG1A 4C0XA 2C4WA 1N6RA 3D7KA 2QGFA 2AFIE 3RSQA 4IDDA 3O8BA 1UJCA 3QWFA 4XDHA 2IA5A 4C1NA 4H27A 4K5QA 4QG3A 1XQBA 2ZS8A 4EJ2A 1SKMA 3W9BA 1LBSA 1LRJA 2IEAA 3GIRA 1JSLA 2R86A 5DGHA 3AVQA 4AUMA 1I94B 4LX8A 5D3MA 5I9LA 1Q86D 3KQUA 1KU0A 2JBAA 2Q3CA 4K9DA 1BWPA 1JDBC 4Q7JB 2CV2A 1UKBA 4URHA 3R8CA 4JL8A 1X9GA 4AKGA 1JHAA 1JSCA 1M1NA 1R6UA 3PDHA 1C9DB 1R2QA 1UIMA 4NX2A 4QJBA 1QG6A 3M4YA 3NJRA 4GLJA 4GS5A 5EZSA 3VU9A 4DANA 2E4XA 3S99A 1Q95A 4UUBA 4Z2AA 2F3SA 2HF2A 1VL5A 3B3AA 5EXPA 1XCGB 4A0GA 4XYMA 3VOTA 1SGWA 4INJA 3CN7A 3TOVA 4Z7QB 1K0FA 2VWHA 4B3FX 5B6IA 3CZAA 3GEGA 2E21A 3OCVA 2EF0A 4BC1A 1E77A 3CP8A 2XD9A 2DOGA 3K32A 1VQ4B 3DKIA 1RM3A 4WVFA 2WB4A 1AMNA 4ZTUB 1X8JA 1A5ZA 2IITA 3UHAA 3NWPA 1GQRA 2C29D 2FVYA 1PP4A 2WSBA 3AHDA 3KD3A 4K1LA 1LLCA 4YP9A 2I3ZA 1OI4A 2A1UA 3R5XA 2ODPA 1ZN2A 1M6HA 3FDFA 2ONYA 2IQIA 4P6YA 3C7DB 3GRUA 4X07A 3NIBA 3PJFA 1RXCA 1RHQA 2D1FA 1Z68A 2EG9A 2NOAA 4JQSA 4BRZA 4P4GA 4QDXA 1I24A 4L2IB 5BQOA 1V25A 4HAZA 4Q7LA 4XB6B 4NNJA 5I9BA 4A6PA 2BFCB 4R68A 5FI5A 1KGDA 5C1DA 1YR7A 4OMDA 3RFCA 4UEQA 1K68A 2YICA 4JCCA 1N9KA 1X1QA 3DLBA 3ENVA 1N06A 2F1LA 1RLUA 2FG5A 2GEBA 1N5LA 2TRSB 1AUPA 1DL5A 1OQAA 4OOXA 4NBSA 2JRLA 1PNTA 5BORA 2R6DA 1I01A 5EHIA 2C3OA 1KVUA 1FDTA 1EIWA 3KVOA 4UTXA 1GXSA 3IQFA 3V4VB 4YLYA 3ETJA 1G21E 1OAOA 3D3NA 2WOOA 3U4MA 2CGEA 2VRCA 2YW9A 1OGYA 2CK3D 4A92A 3CUUA 4WDQA 2EZ4A 2CVOA 2C59A 2IYUA 3VNSA 4CETA 5BW4A 2XE4A 5IH7A 2R1VB 3NXSA 3BCDA 2GWRA 1BXZA 1E3ZA 1MO5A 4XONA 3WYAA 3DAFA 3FUXA 5AVSA 1IBRA 4JJIA 4BNXA 1Z4JA 1Z6ZA 2WSSA 1VJ1A 4YYZA 2VJCA 1EGHA 4IMPA 4O5OA 4YT2A 3OJ0A 3OOYA 4X63A 3ABZA 3PI6A 4K28A 4ZHQF 3N2IA 4BRSA 3BB3A 1PYOA 2V7QA 3GA7A 3JRWA 5B3JA 1EG7A 2VTDA 2FCAA 4LCEA 3TLKA 3U4AA 4RE5A 1GL3A 1PT9A 1QYRA 2WSLA 2WD7B 5CDTA 4NATA 2O2CA 4P1VA 1E8MA 4ND1A 4IH9A 1R37A 4K87A 4HNAA 4NMWA 1RP7A 1O0CA 1UDCA 1YTUA 5IKMA 3V1UA 3HB9A 3ZHUA 2F1IA 4JQZA 2DZDA 5FUXA 3NEPX 4I8IA 5DWQA 3R9KA 4QUJA 1KL7A 2JGDA 4UAJA 3CSDA 5DLEA 5AM3A 3ZV3A 3EVAA 3J80A 4M83A 4XLAA 3H6KA 4CLHA 3U31A 4EQZA 1MAHA 2F1KA 1B0AA 4PYLA 4URUR 1TJ3A 3H8JA 3TMYA 1Y9JA 1TM3E 4J0EA 1ZR2A 4MB2A 1ODKA 3UY4A 1BH2A 3GVCA 3QP9A 4KG7A 5HF5A 4JV5B 4JC5A 2JLWA 3RK4A 1YSCA 4M9CA 1I5OA 3RKRA 3RU2A 3EPJA 1ISHA 2ZYUX 3R6TA 4B9EA 2FMIA 1HRDA 3R7AA 1VYTA 4ZDKA 3T9BA 2Q21A 3TLYA 4BU1A 3C3XA 3E7WA 1DLIA 3DLCA 3VDNB 4K8RB 4ALNA 3PPIA 1KKUA 2HO4A 2GDZA 4OGGA 1E92A 4U8GA 3RF6A 1YU6A 1GZDA 3IC5A 2WAYA 4P54A 3DS8A 2F67A 3JD4A 1GFZA 3QELB 3RT9A 4N76A 1ZSVA 3U16A 1OXUA 4QWMA 3S2GA 1EHCA 2C77A 4ZQIA 3B6MA 1CUHA 3TVYA 4Z4HA 1SBQA 4GPEA 4O4JB 3A4VA 2WP0A 3NPAA 3K30A 3ISJA 4GPAA 1PQYA 1Z5PA 3GBPA 4NBTA 4L78A 2ZM5A 2A92A 3NT4A 4O08A 2JRCA 2WE8A 4GXQA 4UDOA 5DNUA 1TA9A 4GKKB 2I1QA 2C5FA 3OJXA 4XRRA 1HZZA 2WWVD 5ALVA 2YXPX 3CPJB 5FDFA 2Z3ZA 1CUFA 4GT1A 3VPBA 5FRDA 4CDGA 1PR1A 4DSUA 7GPBA 5KPJA 2QY9A 1GZ7A 1W4BA 4H77A 4TZ6A 4UREA 5KHAA 2GBGA 3ZGOA 4D45A 1U7ZA 1PDWA 1UK6A 4NZNA 3QXJA 1RXUA 2I7VA 1MPXA 4M1MA 1FDOA 3NKFA 4UNSA 5H3LA 1DWQA 1W88A 1WD7A 2C58A 2ZSKA 3NRJA 4I46A 4KYTA 4OQ4A 5JJ5A 5M7EA 5J4LA 2M1XA 4A91A 1NUUA 4RKWA 1VSUA 2EDCA 2QT0A 2B2CA 4C7VA 2YV1A 4XPZA 2W2TA 3ZHSA 4C0HA 3Q88A 4E7OA 1E7QA 2FN7A 1JZTA 3UKDA 5ARDA 1G5TA 3EGXB 3GYBA 5KKNB 4DBZA 1W29A 3BICA 3BCUA 2O54A 1MHPA 3BE6A 2ILVA 1FUUA 3INRA 1YC5A 2P4EA 4NARA 4DCCA 1QSGA 2AMJA 3GLGE 3E4CA 5IVHA 4FBLA 1W9XA 3W5UA 2VP9A 4JN6B 1VQ8B 1Q5PA 4RDHA 1XWWA 1SD1A 1WOOA 1FU7A 3R3YA 1GSOA 1TT5A 2BFPA 4FFSA 2HXSA 1T0JB 2NZXA 2QM3A 4K81B 3V8NA 2F4VB 5F21A 4UZFA 2YWXA 4YRSA 1D4ZA 1OXXK 1VQ7B 3DF7A 5DTJA 3ZWMA 1TTTA 5JYEA 3WGUA 3AHIA 3Q6QA 1YZVA 4JXJA 4E4TA 4MVJA 2QW1A 1CIPA 3AY3A 1GAJA 1Y8QB 4D8XA 5KTMA 1LQ2A 4WRRA 1T26A 5CH5A 1W5SA 4OOEA 1GQQA 1Y4AE 1EZZA 4ABYA 3L1KA 4ZODA 7REQA 3HYNA 3S81A 4OATA 5G4LA 3WV5A 2D3WA 3PNQA 1II8A 2D00A 3WGNA 2BRUC 3EQ6A 5EMNA 3QEJA 2C7VA 1IIRA 2ZBEA 4DLZA 4JLWA 1P1BA 1MJGM 4RORA 3LLSA 1VQNB 7YASA 4CF7A 3QMWA 4Z4CA 3H94A 2G1PA 5HF6A 3KR9A 2DHEA 4W5NA 2E4AA 1E9CA 1YB5A 3G8AA 3T38A 5JDIC 4LV5B 1VE5A 5FPSA 3EAFA 4MI1A 2C3PA 3TSAA 3E23A 1U3UA 3CCBA 2DYKA 3D3EA 1U2TA 5IKOA 1Z4NA 5TPZA 4ZVVA 2OBXA 3VAZA 4DG9A 4EUKA 2QTLA 4MHTA 1AKEA 1YB4A 1ESEA 5H9WA 4HQFA 1VLHA 1QIHA 1YKSA 1ID8A 3B1VA 4P3XA 3BJZA 1Z3CA 3HJCA 1A4RA 5CD1A 2O8FA 4FWTA 1UKCA 2QLBA 3G8DA 1XFDA 1XQ1A 2IZZA 4D4LA 3D4BA 3VNUA 1C4KA 1OCEA 1ADBA 1ZQ1A 3WIOA 5K6AA 1ZHOA 3DFUA 1YFKA 2QJOA 3LT4A 2BC9A 4BLVA 3NMUF 5HCIA 2OBMA 5AJXA 3N74A 4ZVPA 2P9FA 2JANA 2OENG 3AHHA 2ZI6A 4UBOA 1ZICA 3DPUA 1EUDB 2AOUA 2YHAA 3LDHA 3UH1A 1I0ZA 1KBOA 5BSTA 1PEKE 2PUCA 4YY3B 2CFTA 1DC4A 4FILA 3AHJA 5FOQA 5CT8A 4CIWA 1BVHA 3TGPA 3ZLTA 2J3LA 3TSWA 5H9VA 1X7WB 2KLHA 3EF0A 4M8IA 2JH3A 2CYCA 2AOTB 2VJKA 3K6KA 3MINB 2HSJA 4DLBA 5BSEA 3PUWA 1TF2A 1KDRA 4CDNA 5EJAA 1H1DA 1DX6A 3B5IA 3M6VA 3IQGX 4OG2A 4Q12A 4P32A 3UJ7A 2PHZA 5GONF 5TF0A 1P60A 3WO0A 2GYUA 5TGZA 5HBGA 1V5IA 3R9XB 4MGEA 3OQJA 4UVDA 3ADKA 3SVTA 2FFAA 3ILHA 3G5AA 1UFKA 2C97A 2WYWA 4LFBB 4Z1OA 3CMEB 3C1OA 1N57A 3EC1A 3DHEA 3KR1A 4XLFA 1GU1A 1JSXA 3E1SA 2X0IA 3DZCA 3PGKA 3S1AB 3EB9A 2PFKA 4R8SA 3KSAC 2WU0A 3U9TA 2NXEA 3ER9A 4J7UA 5DISB 4LDAA 2FSHA 5GJCA 4IIUA 2W6NA 4YXWD 2R7AA 4EFLA 2K2WA 1A2KC 2VSFA 2O7QA 2OOKA 5I5EA 3GZJA 5FPHA 4ZO8A 5F4ZA 2RH8A 3O1IC 5DJ5A 3FPEA 4DQUA 1DOHA 2OCIA 3GNQA 4LW8A 2OGUA 3FF4A 4OOFA 3IQEA 4UCWA 4KRYA 5EC8A 5HNKA 4RD3A 2HWUA 3CZCA 1PSZA 4L3OA 2ZI3A 3BTSA 4BP1A 7ADHA 2JA1A 3E7FA 4EUNA 4EG8A 1IZ9A 2JLZA 1QUEA 4IKOA 4PLCA 1PE0A 3IULA 5F9MA 4DPLA 4PGOA 1A9PA 1FP7A 4RPJA 3EIXA 1EH5A 2VNSA 4XFKA 1U1GA 2QTGA 5GJVC 5KQMA 1V7ZA 1POWA 2LRHA 3DUWA 4BLUA 1TPYA 2HDNB 3BHNA 2J3JA 1J25A 4FSDA 4MVYA 1Q22A 1V7CA 3L06A 1ILEA 1K6IA 1UZAA 3AVOA 2XGSA 3M1IA 4XX0A 4DGSA 4A6EA 3SEZA 3EFBA 4OL0A 2DFPA 2GA9A 3OY7A 4FYIA 4XDYA 1XZBA 1XRSB 1IXZA 1J0DA 3I34X 1KPHA 1L7XA 2W2LA 4U7JA 4E22A 2I2FA 4H3KB 4E3ZA 1UJ6A 3FAZA 4HNHA 5AVRA 3I04M 1YAHA 2ZQ5A 1PYGA 2IX9A 5DNVA 1M33A 4LY9A 3ND6A 5HIJA 5DHAA 2CZQA 3Q8MA 5LC1A 4JY7A 4LRSB 3L1UA 2O05A 4YLEA 5JNSA 4ZA2A 4QJ4A 4BMDA 1JA1A 3G2QA 4JC8A 4ZI3A 4EKIA 3MWFA 5AIBA 4EA6A 3CZ9A 2O0MA 2ORWA 5JXJA 1MC4A 1R0KA 4MGHA 4WEQA 4ERXA 3WK7A 3E8XA 3VYSB 2F4NA 2P0AA 5JAHA 2BGNA 3B9PA 5L3VA 5FWDA 1B8PA 1WUHS 1X1AA 2NXCA 4X3CA 1RXYA 1LDBA 2GXSA 3AJAA 2VJIA 1O6FA 1MVOA 2YR0A 4KTVE 5EZYB 4BV3A 1K0UA 2Q46A 4ECAA 4EA9A 4RGBA 2PZAA 5AM0A 1DU4A 5ALSA 3ZDYB 1RQ2A 5BW8A 4U02A 2A14A 1W5BA 1I1HA 1OREA 3ENZA 5AI0A 1K73D 5BWMA 1WAMA 4JI2B 4X5OA 1HNWB 3G9TA 1ZITA 3EVZA 4OJYA 5TMPA 4U2BA 1VIYA 5CFMA 4FS8A 3D0RA 5D84A 3Q10A 4FS3A 2FP4B 3OA0A 3Q3VA 3JZIA 3ZWCA 4ON9A 1WPQA 4FGZA 4DUGA 4HWOA 3Q3IA 2VT7A 4OHMA 2XBLA 2B6NA 2OQRA 3LT2A 3G0IA 4O1IA 3PQ5A 3SBEA 4B4DA 2NZVG 2OXFA 1NNUA 2PSSA 2R6JA 3BCFA 2BZGA 2RGGA 3A4TA 3CH4B 5ALGA 4LZNA 4P4SB 5KNCA 2C0PA 4MRMB 1WCYA 4MR8A 4AY5A 2OQVA 1AZWA 2BI8A 4RFSB 1BXKA 1YMQA 2VOEA 1QYIA 2VNHA 2EIXA 1BDMA 1C0EA 2EARA 1CY2A 4OAOA 4Z4GA 3BGVA 1Z6AA 1XU9A 2BUBA 2PXCA 4BLOA 1WZNA 2AV6A 3UT0A 2OFPA 1FOEB 3IO3A 5E2AA 4HMQA 1NBMD 2N75A 2X0NA 2IF0A 2WYUA 3ZHXA 3O4IA 3O8CA 3MCZA 4NH0A 3DV2A 1EKXA 3G88A 4HXYA 3BUSA 2HK9A 3WYGA 4WE3A 2HY7A 1OMOA 3JQGA 1NPDA 3MPOA 4FE7A 2NT3A 3H1PA 2G67A 3C6YA 1W4ZA 1DAPA 4C29A 5BQXA 5HKKA 3FE2A 5JTUA 2P78A 4LN1A 4GSYA 5AW3A 5F9FA 1IM5A 3NU1A 4PR0A 4IUDS 1L4FA 3TQQA 2CHFA 1ZSYA 4UE3S 2BP7A 2IYQA 4OQYA 2KS6A 4RBNA 2MYPA 3EGCA 3MJFA 3NOQA 2AN9A 4BRWA 1E9SA 1UBMS 2PX6A 3F9RA 2GM4A 4I6JA 3FLBA 3N7AA 1NDHA 1EUZA 1LW6E 1XSEA 3PKIA 1QH1A 2X6YA 2ADOA 2Z57A 3CLSC 2A9OA 3N2GA 5E4TA 1U3GA 4Q24A 4ZQBA 3T7DA 3UMFA 1AKVA 2EWVA 5KEIA 1QH9A 2XGJA 2Y27A 3IESA 1V3TA 1Z4IA 2C98A 4INOA 5B4TA 4ZU6X 4FUQA 1V5FA 3FYUB 2ZRNA 4JI5B 5E8RA 2OKCA 1HYEA 2W71A 1JDJA 3HB0A 4W5TA 1B6RA 1Q57A 3EZNA 3VJMA 3IBSA 1F7VA 3FWHA 2FWIA 5LB4A 4EHHA 1REQA 4IIFA 4R1UA 2GZRA 4KQ1A 4XSHA 1UANA 2HMSA 5FWNA 1EFLA 1DJQA 3GT3A 4EYGA 4M9ZA 3CO0S 2ECPA 2Q29A 1HDEA 5IYRA 4DIFA 3D8BA 2YHIB 5FR2A 4AG6A 2AUNA 4KK3A 1B6TA 4KFTA 1V96A 3IBCA 4GG1A 2FFHA 3FCCA 1G8YA 2DX7A 3N59A 1U3DA 1E63A 1PG0A 4ZGQB 2I33A 5T3UA 1GEGA 3K3PA 5ISMA 1YUNA 5ECGC 2IVFA 4FMCF 1A4IA 4LSMA 4G5FA 3X0DA 2FCRA 4KQCA 3ZWVA 1E69A 4JLKA 1E2UA 1ZH8A 2G3YA 3WL3A 1H2BA 1S2GA 4PG4A 1U80A 3WKDA 2C2KA 5ICFA 1XJ5A 3KZCA 4LF9B 2GYWA 3QYJA 3O7MA 1D1QA 4HQ6A 3ZHTA 4ERNA 1I9GA 1JILA 4WKGA 1AQLA 4O3FA 4G25A 3L6DA 2P3LA 221PA 4N0QA 1TA4A 4AU1A 3K9CA 4KYUA 3I1JA 5A5VA 1MNQA 1LY1A 3G8BA 4YWJA 3TL6A 3T53B 3B6JA 3VU1A 1BTOA 4JOSA 4B0OA 1QHEA 5DBFA 4YBZA 4W9MC 1C1DB 3ONWA 2ZAMA 4DA8A 2QE7D 2J1LA 1NULA 2X8JB 3MILA 3NONA 1O03A 1N5JA 3ESCA 4JB8A 3ZDBA 1PV4A 4AYTA 5KC9A 5JYBA 3NWOA 4YPFA 4OI1A 4CKYA 3O1JC 1FMJA 3NCTA 1SHUX 4QPCA 4R8LA 5SZHB 3O75A 2IUEA 1N33B 4IWNA 3STVA 4AL4A 1YT5A 4G5HA 2EKZA 4YQEA 2HPAA 2QIPA 3CCMB 3VBCA 4BO2A 1U3CA 3IELA 1HNZB 5G2OA 4Q16A 4UTRA 3NB0A 1GRNA 1Y3IA 2XTAA 3NM4A 4IVQA 2JI6A 5B5SA 4FEYA 4YRAA 5BVHB 4YO8A 5G4KB 4L4XA 4PN3A 3QHAA 1WQ4A 1NU6A 4M1EA 3OKFA 3Q2IA 1G20E 5CTAA 3W8RA 1ZK0A 1HEYA 4TLDA 1SKBA 2KYRA 3R23A 4KL8S 2O1SA 4Z1MD 3CX8A 4F7DA 5F5XA 1V35A 1EK2A 1X94A 1SCUB 4WZTA 1LI7A 2UVPB 3ELDA 4MI9A 2IYTA 2ZETA 4RMHA 3JQRA 5IJZA 3OPOA 1XCOA 3N58A 3UMBA 3PXUA 5J35A 4GI3A 1PFYA 5KVAA 4YHBA 3P9RA 4YJDA 2H7CA 3JD1A 1E2PA 5BSYA 5EJIA 2VO1A 1AH2A 1IK4A 4X8OA 5AD1A 4V0NA 1XMOB 4JJZA 3Q5DA 1M5UA 2PUTA 5J1TB 4PV7A 1G17A 1O95C 2B9VA 5IBPA 1WSRA 2Y71A 3PFFA 3HAGA 2PH5A 3WO1A 3HXPA 3KKQA 3NTLA 3ESRA 1BCRA 1IXKA 1R8YA 3K96A 4UU8A 2CLDX 4NZMA 4RJIA 4AZTA 1M1XB 4TYWA 4XH9B 3RIEA 2CLHB 3DONA 3STUA 5AHXA 4Z0HO 4B46A 1QTRA 1S8OA 1LDGA 2E89A 1SKYE 3S8EA 1F12A