1W34A

Ferredoxin-nadp reductase (mutation: y 303 s)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena sp.
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w34A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w34A02
4TMXA 4HE6A 5TR9A 2HDNB 3CCMB 4ACBA 1CQXA 2VYQA 4YALA 3AGPA 1B23P 1WDTA 2QDXA 4J0QA 1IB0A 3W5HA 4B43A 2GQFA 1R5OA 2VZLA 1CNEA 1ZM2A 2YWHA 4G1VA 3V76A 4P3YA 2B7BA 1KK0A 1JA1A 4M53A 3JQRA 4H9GA 1ZUNB 1QGAA 3W2HA 1GVHA 3OJXA 1ZM3A 1K73D 1EXMA 4B44A 1JJ2B 3AGQA 4AF6A 1XE1A 4B4DA 2QMUA 3CW2A 3G4SB 1S72B 4DQKA 3VNVA 3LRXA 2VNKA 3QSYA 3VO1A 1W35A 4IW3B 4MYUA 3VO2A 5TV2A 1ELOA 1Q82D 1EP3B 1KQSB 3W5VA 5AN9A 2OK8A 2ZITA 3QFSA 1KTVA 4U9UA 3MCAA 2VNHA 1OB2A 2XNCA 4PC3A 1TVCA 5HXBA 1HA3A 2YWEA 1FNBA 1QGYA 4M2LA 3OJWA 4QFMA 1VQNB 2YWFA 3CCSB 2R6HA 2RC5A 4YAWA 1JA0A 1EP2B 1F60A 2CNDA 1TTTA 1QFZA 2E1RA 1NDHA 4F7DA 1Q86D 4RCZA 4RJLA 1FDRA 2PLFA 2RC6A 4HE5A 1DDGA 3WBKA 5EMNA 4MYTA 3LYUA 3I1FA 1BQEA 2X3UA 2DERA 3ZC3A 1QVGB 1ZM4A 1NJID 1QUFA 4P6VF 3B78A 5GV7A 3VNUA 2EFGA 3CRZA 3QE2A 1EWYA 1Q7YD 3E20A 1QFYA 1TUIA 1OGIA 1VQ9B 4Y7CA 1H42A 5DSZA 4BPRA 1CNFA 1W34A 3ZBTA 4ACAA 1A8PA 3QFTA 1G7SA 3MHPA 2C78A 3WNCA 3JQPA 2CRVA 1DDIA 1I7PA 1VQOB 3CC4B 3CD6B 3ES9A 4NCNA 4TMWA 1VQ6B 1UMKA 1KK2A 3CCJB 4EH1A 1FNMA 2J7KA 4TMVA 5FA6A 1D1NA 1N0VC 5H59A 3ZZTA 4Y9RA 1AMOA 3W2IA 1R5BA 3WXMA 2DCUA 3CPWB 1FRNA 3AVTA 1YHQB 1SM4A 4TMZA 1BX0A 3SJZA 1QVFB 3AVXA 1GJRA 2BN4A 2OTJB 3W5UA 3FPKA 4YAOA 3CCUB 4FN5A 3OZWA 1W2BB 1QH0A 4M0LA 3B8HA 1E62A 3FJOA 2PIAA 1OGJA 2YWGA 5H5JA 1GO2A 3WYAA 1N8RD 2VNJA 2HMAA 1KJZA 2QA4B 4K1XA 1J9ZA 3LVBA 1VQ5B 3W2GA 2BGJA 1QUEA 2XEXA 1B2RA 4ZGNB 4RD3A 1DG1G 2OTLB 1YIJB 4LBZA 4DQLA 1E63A 3OZVA 3I55B 1SKQA 4AC9A 1QGZA 4PC1A 1N0UA 1GAWA 1VQKB 3B82A 4LBYA 4QHYA 3MMPA 2BSAA 1DARA 4FWTA 3JQQA 4LC0A 4FK8A 3AVVA 1ZM9A 3OW2B 3CCVB 4RCYA 4B47A 1D8TA 2BVNA 4TN1A 4RD4A 2VNIA 3WNBA 3CCEB 1M90D 1G7TA 2DETA 3CB4A 4UAJA 5KSWB 1M1KD 1YJWB 3AVUA 4C0SA 1IJEA 2QTLA 1R5NA 4R71A 4ZGQB 3P27A 1EFUA 2B7CA 2DEUA 3CCLB 4NBSA 1JB9A 4PC6A 4ZCIA 4PGOA 1KD1D 4RD1A 1GR1A 4C43A 1VQ8B 4PC2A 1JNYA 1E64A 1KK1A 4Q7JB 4ZCMA 2QEXB 4B3XA 4M4SA 4G1BA 2AHOA 4TMTA 3U6KA 1OB5A 1KC8D 4B48A 2EIXA 3QFRA 1GAQA 3WBJA 4ZCLA 3P26A 4M1KA 4RD2A 2B5OA 4ZV4A 1VQLB 3CC7B 1EFTA 1F20A 4N3GA 4LBVA 3WY9A 1YJNB 3CCRB 1FNDA 1BJKA 3QFCA 2BM1A 2BM0A 3VMFA 3U2QA 4AF7A 4RD6A 1K8AD 2DY1A 2HCJB 1YI2B 4N3NA 2XNJA 3G6EB 2QTZA 3CMEB 1H85A 1G7RA 5THXA 2BPOA 2NPFA 2BMWA 1YJ9B 4PC7A 3AVYA 5JBQA 1TLLA 4G5GA 1BX1A 1VQMB 2PMDA 3G71B 1Q81D 1VQPB 1KK3A 1QFJA 2BF4A 5TY0A 1D2EA 3WNDA 1S0UA 1K9MD 3CCQB 3J81k 1EP1B 4WQMA 2FX3A 1EFCA 1VQ7B 2QN6A 3OZUA 3W2FA 1IJFA 1FRQA 2BV3A 3E1YE 3U6BA 3A1FA 4YAFA 4RD0A 3ZBUA 3CXCB 1KRHA 4YAUA 1FNCA 4LBWA 5GV8A 4YHBA 1VQ4B 1YITB 1QX4A 3ZZUA 3PENA 3CC2B 4Y9UA 3AVWA 3CMAB 2C77A 3W2EA 3ZZ0A 2D74A 2OK7A 3I56B 2BGIA 1AIPA 3LO8A 1QG0A 2GPJA 1U2RA 1XB2A 1G7CA 1W87A
chains in the Genus database with same CATH superfamily
1ULTA 4IS2A 3VX3A 5BQ3A 3RYCA 1ZR4A 1Y4AE 2DE0X 3HB5X 5TR9A 1RRKA 1UK8A 2HJHA 2B5WA 1PTKA 4NYJR 4JBLA 3SXUA 2P5UA 1BWSA 2Z9CA 3FNHA 2D2EA 3QPBA 3O8QA 1ODSA 3L40A 3FSEA 3N05A 4D1YA 1DOAA 1F51E 3KWFA 2W00A 1V71A 1B23P 4EMTA 1IWBB 2RCYA 3WLEA 1P5ZB 2AN4A 4BRSA 2G83A 1NE2A 1DB3A 2BKAA 4LFCB 1IBSA 2Y6VA 2ACKA 3EYWA 2X7HA 2R84A 3OO1A 1I2AA 3OJEA 3ZW9A 3I23A 4CG3A 4BNJA 3G9QA 2QZPA 1REQB 3DMYA 1QQAA 2FCAA 2O59A 2QRJA 3AF4A 3PVZA 1ZM2A 3BIOA 3RVBA 4EB8A 2HLDD 2Y1WA 1JMVA 4EL5A 5E8JA 1RBYA 3CUEF 5DNVA 4G2TA 1NBWB 4PO3X 2JLBA 1NNEA 2L0XA 3HDYA 3SM9A 2GEJA 1O1YA 4GZ6A 4QRIA 4BVEA 3LHFA 4FXPA 3M8KA 2WB2A 3V4FA 2BHNA 2RHJA 3D3WA 4DBVO 5H1YA 4DIMA 5B3KA 4KRYA 5EXXA 4IIYA 4ZEMA 3GD7A 1TM4E 1U11A 1G9XA 4WNIA 1E1MA 2A6PA 4LJ7A 1PJ2A 4XFDA 3V48A 1OWNA 4C5CA 1AF7A 4Z4WA 3IJPA 3MJCA 3QU5A 4YA6A 3AKEA 5JSZA 3R0VA 3K9LA 4PZPA 4X05A 3P0IA 3BJRA 4QJIA 5E6TA 5ER6A 2P5YA 5KKCA 2J07A 4K0RA 4F3NA 5DLQC 3LRXA 1PK7A 3L8CA 3TGPA 2WHRA 2H63A 3F47A 3IOCA 5LM3A 1C0IA 4RO0A 1NQAO 1RVDA 1CUGA 1XHFA 1OQAA 1Z22A 2V9PA 2A35A 2YJ4A 3FM9A 2VPIA 3CZRA 4I2NA 4QVGA 3RYCB 1KRXA 4ZOBA 1LBHA 4XQ0A 4YAIA 1ELOA 4IEIA 3KD2A 3H1GA 4KX3A 3SXUB 4EKYA 4ER3A 1KY5A 2EOAA 2QLTA 4BVGA 4DR4B 5KSZA 1QFSA 3IVRA 3V8RA 3O8QB 2IPOA 4DR3B 4UU8A 2R751 1RAIA 1XZAA 4KRGA 4MKHA 4ZEOA 4MUJA 4P36A 3COPA 3P2IA 3HUEA 5CX1A 4BFTA 4V0MA 5DO9A 1JKJA 1SHTX 2JH3A 3N6VA 4KLNA 2OR3A 4XLAA 1YJ5A 2A7XA 3FUVA 4N12A 4BBAA 4E21A 2FP3A 2X7XA 3P0EA 1Y4UA 4WBNB 2HHCA 1TK3A 1Z6AA 1D5WA 3RSLA 4EIWA 5HXBA 1CJKC 1U98A 4DLAA 4E2XA 1SPXA 4RZXA 3CUKA 1XF1A 2O7RA 1UKBA 2ZBGA 3GJRA 4N82A 1H66A 5AK6A 3GLIE 3WIUA 2EKZA 1E98A 2IZZA 4IJWA 4DK1A 4OQ4A 4N8EA 4XGNA 4ZJZA 2ZJ0A 1EDOA 4B09A 1C3JA 4EQ6A 2C7VA 2EBWA 2ZRFA 5C8VA 1W96A 2ZU0C 3RASA 3D3WB 5EUCA 3R3JA 1CUXA 1W47A 4ZI3A 3KSAC 1BS2A 1MA3A 3SZGA 3DB2A 4IHQA 1OFVA 1M54A 3OOWA 1UFVA 4IRXA 1RZRA 4KAXA 4OP1A 3ZR4B 1ID8A 3PNPA 4ZYLA 1SBQA 5JSZB 4YMWA 1UZMA 3B9RA 1QRUA 3AK4A 3MPUA 3AP3A 1DFGA 2R4TA 1PFKA 2YOHA 1L7DA 3PIIA 3V3TA 4OM7A 2FYTA 1RQRA 4NECA 1Y7LA 2A8YA 2JZOA 2FUEA 2J7PA 2JHGA 1QQ5A 2VQ3A 3MBKA 3JVEA 3QQ5A 3DD1A 4B4VA 5AVUA 2CLIB 4OBBA 5IAKA 2FFBA 3DBVO 3KQTA 3ZVMA 3L07A 2CCJA 2PUEA 2GJKA 1GFWA 1DCFA 4GX5A 1GZHB 4S12A 1YXMA 4BAUA 1JG2A 3STHA 5A9SB 2V7UA 1TGYA 4OREX 2O4CA 5KTOA 5CHEA 2GJPA 3M5PA 2W2MA 1Z4KA 4J6EA 2Q7DA 3ZWVA 3HM2A 3ZCQA 4GDMA 2HTFA 1NN0A 5IHPA 2FETA 1BN7A 4BPRA 3THYA 2C3UA 3SBDA 5CX1B 1P2SA 4IMIB 4FB5A 2VJMA 1JKJB 3U4HA 4RY0A 5C4IA 4M36A 4JC5A 2CJXA 1SCBA 4KWHA 1RHQA 2BELA 2WA1A 3W4KA 3NVMB 4PF1A 3PUWA 2NU6A 4ESVA 1QIFA 3MHPA 1QORA 3KNZA 4NABA 3WNCA 3H2HA 3NXSA 3AJ8A 2Q2VA 1U0GA 3LGAA 4D42A 1Z8HA 4Q9DA 5FULA 1RCUA 3RTAA 2I1WA 4EQ6B 5IKPA 5JNTA 5DNAA 1I36A 1T3LA 2V31A 1G42A 4FCWA 2VHUA 5I01A 3C97A 2X4DA 1QHIA 4F6RA 1M8KA 1QQ7A 3W8NA 2O3SA 3D5TA 3L5KA 5G02A 2Q2NA 2FMXA 1EEXB 1FX0A 3CT4A 3LTEA 2QB5A 3IQXA 5AJXA 4CL8A 3IEMA 2XKBA 2HJRA 3NEJA 4JLWA 1P9OA 3GCXA 3BT7A 1TA4A 3AXTA 3QPDA 4EYKA 2C5SA 4G1FA 3BZWA 2BE9A 4YN3A 1L8LA 1K7EB 2CY0A 1BXZA 2XJ9A 2XEDA 5L4NA 4DKXA 5LYJA 2JFQA 3U3OA 2QGZA 3LPLA 1V45E 1XZCA 2EF1A 2XRYA 3C7KA 5IBCA 3BPSA 3EIEA 2AN3A 1TOAA 4KG7A 4XQGA 4NU6A 4CKEA 5M04A 3QF4B 5C5DA 1RVV1 2JJQA 1UWLA 2ZCUA 3D02A 3ORFA 4LECA 4PSCA 4EABA 4IY1A 2RGNA 3MXTA 2GARA 2O1EA 4F5ZA 2FSVA 5F78A 5L3RA 1WUHS 4JR1A 5HQ3A 1EG2A 1Q5PA 4NMWA 5CXXA 1MKYA 3B6KA 1DI0A 3EEQA 4G26A 5EIFA 3ROGA 4D8TA 1DT3A 3GRZA 3JTMA 4BKUA 5FO1A 3UJ6A 3C3WA 1DAKA 4C04A 3OF2A 3DGFC 3THYB 3UG7A 2CGEA 3S28A 2VJMB 2AEMA 2I2WA 2RI1A 2VHWA 2YHUA 4JGGA 1ZOOA 4QOHA 2WD9A 2L2QA 3T95A 1RAGA 3NI2A 4F4HA 1QOZA 3CVWA 2RAUA 3GAZA 1OHHD 3I6MA 3NP7A 3W1VA 4DEXA 1R2QA 3SOZA 5IH7A 3JQFC 4DZRA 2HLNA 2NU6B 5ARBA 2G08A 1Z7YA 1XCOA 1YZQA 3A32A 1EJ0A 2FEOA 3AIOA 2E1BA 4IJKA 4W5JA 1Q3HA 3LY9A 1YRLA 4BNVA 3DE4X 4JXXA 2DHQA 3BNWA 1N8RD 2VJLA 1GSOA 1DBQA 1GG5A 2OTCA 4LMRA 4R2XA 4BEVA 1UXJA 5DN6D 4DA7A 4HNVA 2X1MA 4CV3A 4K9LA 4F6RB 1CE8A 4TZTA 1IHUA 1L7VC 4LKOA 5J23A 1JPNA 4LKRA 5ALHA 1D09A 5THKA 4ECAA 1FX0B 1XXHA 4X20A 2Y3IA 1ICEA 4NDAA 5TNXA 4Z4ZA 1I10A 1Z25A 3MJ4A 4YGXB 4B31A 5EIEA 1CIVA 1B2RA 4XOUA 4CCAA 4CTJA 5IVDA 4P83A 5LYJB 2WWFA 3IPCA 2D5BA 4DXHA 2ZBRA 3F6RA 4DOMA 3AEKA 3M6WA 4WUVA 4PHFA 4DCVA 2CXSA 4R1SA 2VF7A 3F67A 4EY8A 2WC1A 4FZVA 4CODB 5JS2A 1UZUA 3LSTA 4B4OA 5SY4A 2FSGA 2RJ3A 3RHSA 4DQLA 5FPTA 3DE1X 5TMEA 5ELLA 5HQ3B 5JAHA 3W5AA 2H7CA 2QW8A 2ZJ7A 3F6YA 1W29A 2EYQA 4J03A 5FKJA 3I6IA 3PPIA 1OR8A 2GNPA 2ICAA 4DDUA 5DISB 5JAUA 1B0PA 1YB5A 2WTMA 3OJFA 1NXOA 3EEFA 5U1PA 5JYBA 5C9ZA 3FI0A 4KR7A 1CRPA 2PY6A 4QQNA 2H0QA 3T7JA 4YV0A 1MO3A 3TYXA 2GVDC 4JLKA 1SRQA 4UVHA 3PTAA 3K8ZA 2DG2A 3H5OA 3T06B 3ONYA 4TWAA 4HP8A 1VCOA 1WUYA 1ZK3A 3G2PA 2JZCA 3DUFA 1I13A 4CM9A 1UC4B 3WNBA 1EWKA 1DO0A 2GFIA 2R44A 2C88A 5DYNA 3M0EA 3CNOA 1WXWA 2NO0A 2C54A 3IOEA 3PHHA 4O2BA 1E4EA 1LW6E 4X8HA 5HM6A 5DGCA 4UAJA 4MIOA 3UA4A 3WLSA 1S9DA 3HG7A 3VPCA 4BNNA 3EXG1 1WOYA 2PJZA 2QUKA 1XAIA 1CE8B 2B8TA 3DSRA 4D8YA 4ZC8A 2VYND 1X1BA 4XW2A 5EHZA 4X60A 1XXHB 4X20B 4PG5A 3A3OA 5HSGA 4JQOA 3WGLA 3MN1A 3LJKA 4EJMA 1OXTA 2W83A 2ZTUA 1GIAA 2QSYA 4LJAA 3OEWA 2DKNA 1VL8A 2I99A 4R1NA 4CIYA 3KOOA 2FZGA 5FO0A 2F3QA 2CNOA 5CURA 2V4DA 1RRMA 3ROFA 1JB9A 3HJNA 2H1FA 3D4PA 3EZNA 3PB3A 3BHNA 3AEKB 4X0CA 3FNBA 4MO9A 2Q4DA 3M5DA 4HQ0A 4R9RA 4UAUA 3RRFA 1M0EA 1GR1A 2GK7A 4S35A 3DUWA 1M2GA 3OPQA 3HNPA 2DUUA 4RIGA 4QYTA 3KTDA 4W7SA 1YB4A 4XGRA 1TEXA 4FCVA 1L5WA 2C00A 2IDKA 3WGKA 3H5VA 2NOAA 4OJTA 3U6KA 3NJRA 4YXWA 1GZUA 4EG4A 3VU1A 2YS6A 4NPAA 5JJIA 4M7PA 1Q84A 2BMVA 4RS4A 3AEQA 4MDHA 3IOYA 3MIIA 1ZC3A 2QHXA 4I1YA 2OZLA 4I1IA 1DC4A 3IQFA 2G8NA 2Y1XA 4E88A 2A57A 1HUQA 2GCIA 4R84A 3HA2A 4G4IA 4KPUA 4C7VA 1ZN2A 3ITDA 1PV1A 2AEEA 1RPNA 1TYCA 3R7BA 1SCDA 3WLNA 2CNBA 2COUA 3BC9A 1VQLB 1DC7A 2NXJA 3COZA 4QBGB 1W5SA 4GYKA 3DUFB 5EHXA 3HCPA 3IUNA 4RVFA 1F20A 2Q5EA 3HGMA 4ER7A 4LBVA 4UHJA 1AZTA 3NE5B 3ZWXA 4GRAA 2JGDA 1DU4A 4LHWA 1SVLA 3H16A 1RFGE 1Z4MA 3O8DA 1YJNB 4J91A 4O2BB 4TWZA 1SOMA 1VCHA 4QATA 3D2CA 3BF8A 2TMYA 3KS9A 2R6ZA 4ER6A 1L5FA 4REOA 3UJCA 3RFVA 1UKCA 2X9GA 3P2JA 1SHZA 4V2IA 2FA9A 1GGHA 3HDQA 4FNMA 4MWCA 1HH4A 2A1TR 5IX8A 3F5DA 1K8AD 2I71A 4CTOA 1KPGA 4R2WA 4ARCA 1UDWA 4WV3A 4XCXA 1D4OA 2CFOA 4G5QA 4URUR 1YB1A 1MEOA 3ZHQA 2V6MA 3QLEA 4QAQA 1L5NA 4QU9A 4XWAA 4DFDA 3LIPA 4B6RA 3GEIA 3RKRA 1A4UA 4BMPB 5B55A 4MVJP 4XM1A 1VF7A 1EEHA 1CFJA 1G7RA 4N3CA 4L8JA 2AXNA 4WWHA 4S0XA 4DC0A 1F06A 1DKRA 2X6TA 4XA8A 4CTNA 1E3MA 4FE4A 3UUEA 4AS3A 5ALTA 4RHCA 1L4EA 4EMBA 4XNFA 4OEHA 4HL6A 1BSVA 4IHKA 2WF6A 4FKBA 4JI0B 4DSUA 4J75A 3UWSA 1DWPA 6GPBA 5BNFA 5J4KA 4W5QA 2OC4A 4H2DA 2OFPA 2OHFA 1KI6A 1CY0A 1U3FA 3ONUA 1EINA 4S1WA 1E2BA 4BS9A 3AEQB 4CLOB 5A5EA 1ZD4A 1Y8QA 2OZLB 3UV6A 3EH2A 3HVKA 3IUJA 1J06A 2JHPA 3AXSA 2VK2A 3A8IA 4KPUB 2JW5A 2HSWA 3IVGA 3QE3A 3UA3A 2VPZA 4F9TA 1AURA 2X6YA 3OOSA 4KL8S 4OM8A 2XOKD 3GUVA 5COAA 3RUEA 3AI1A 2F1IA 3HU1A 2BBWA 2BOVA 4HDQB 4JBHA 4LGMA 4RLZA 2MHCA 1YJAA 5AW5A 4M49A 1K89A 1VHDA 1QPZA 4RJIA 2PXCA 4JH0A 3C3JA 2FDCA 2QVGA 3FPLA 2JGDB 2MT9A 4M7OA 1SELA 4A5SA 3WAKA 1MB2A 4X8IA 2DH5A 2W6QA 3EVDA 1DRJA 4QNRA 3IKTA 5TMPA 3TZCA 4I9NA 2P6UA 1M33A 2VBVA 1EFPA 1YIDA 1QTIA 4Y2VA 3DMPA 1Z34A 2CD9A 1FUYB 3GFQA 3W6ZA 3WS7A 2MJLA 1LPAB 4CL3A 2HLDA 1JILA 4WGFA 2C84A 1VBKA 2R4QA 5U4XA 3W6PA 1TYBE 4TLDA 5JAPA 4YAUA 1YQTA 3NFRA 5GONA 3IXMA 4GXNA 3P4UA 1ORTA 4O5AA 1AKQA 4Z51A 5AHRA 4AL4A 3IKLA 1N2GA 2PXAA 2ZAIA 1O9HA 3OKCA 2NO6A 1KHHA 4Q3CA 3K31A 3DZJA 3ZCVA 5A4FS 5L6MB 4Q1BA 3L8YA 4ONEA 1Z0AA 3A37A 3PFFA 4MUKA 1K97A 4N0QA 2GZ3A 3OFSA 2BGIA 1SXJE 4UHHA 2IZ7A 3JR3A 1CVRA 2P9ZA 4B80A 3NDPA 4TTIA 1IJBA 4YMLA 2W48A 3ZOZA 2CEKA 5T4BA 2ZVJA 3VV3A 5EKUA 3B7GA 1U8TA 3PXAA 1MNAA 4B2PA 3VPBA 3M33A 1A7AA 2I4NA 1Y8QB 4V03A 1UK9A 4XLZA 4XGQA 3Q7RA 2FPOA 3FFWA 4F2DA 2PV7A 1V0FA 2V5UA 4BWYA 5DNUA 4TMFA 1J6UA 2EBHX 1A96A 1W48A 2B82A 2PL3A 2JAOA 1ZK0A 2ZRCA 1BHQ1 2MSEB 2VYQA 4V0OA 5GIOE 2ECQA 2NAPA 2W2QA 4C0KA 1EVKA 4TN5A 4P0TA 5FBZA 4HFJA 4IQ4A 4HNAA 1O03A 1WG8A 4R9SA 2XHZA 5AHXA 3T4EA 3W5HA 4B43A 2HA5A 4BMSA 3STWA 2N1BA 2D06A 4OLHA 5JPDA 1EFPB 1X0XA 3IHTA 3LP5A 2GA9A 1Y0RA 3ZE1B 4R8LA 2BSXA 1XG5A 2GVNA 1CDEA 4O2AA 2PWYA 1E58A 4TLAA 2OBLA 2QGNA 5EWJA 3U7JA 5DASA 1NIPA 3T99A 2FVXA 5IEBA 3IQZA 4AJHA 2X9VA 4HT3B 3ENZA 4D8VA 1D7OA 5GONB 1T2UA 4BIMA 2HBQA 1E1LA 3TMKA 4HZUA 3PXCX 4F8JA 1NJ1A 3LBAA 4M8IA 2GJAA 3GR6A 4MR9A 4ENUA 3DFIA 4P4LA 2Y93A 4Q7EA 3HCWA 1F2VA 5CB4A 4A6EA 1HI9A 5T4EA 3W5BA 3D6AA 1GPYA 4Q9AA 2C20A 5L3QA 2D5AA 5KJ6A 4BO3A 2V5VA 3VOSA 3HWSA 4MLCA 3WLIA 1LJ8A 1PFQA 2PR7A 2X13A 5FYDA 3CW2A 1BOFA 2JJ1D 3ZI0A 1Z4PX 3P2KA 3FWYA 4E4TA 3VNVA 1XNRB 1U0FA 3HADA 2H11A 2Z5GA 2OGWA 1Q1BA 2YVLA 3ME5A 1B6GA 1FFSA 4GMGA 4IO0A 1NI5A 5DV9A 1TM5E 3IBCA 4GE3A 4I3HA 3RIYA 4XOPA 3KXIA 4IW3B 1TCBA 4PSUA 4JUFA 4A0RA 1UK6A 2XCQA 3U62A 3UICA 5H3HA 1SU8A 3MCTA 1GFSA 4BWFB 1A9YA 3DOFA 1FCJA 2A0YA 4DMGA 4O4HA 2RG7A 3H04A 1DJQA 1PR5A 3O2JA 2O3QA 2G0AA 1ODJA 2ZRIA 4QJBA 1IK4A 4EY5A 4AZSA 2VP4A 1II8A 3ICVA 3NIDB 3DC7A 3BK7A 1CUIA 4MVJD 4P8RA 1EDDA 4UUNA 2Q1WA 1XV5A 1OB2A 1GPMA 3SSNA 1ZDMA 3AF3A 5CVUA 4Q3KA 5C4GB 2JJYA 4HNAB 4B7CA 1WPXA 1Y9JA 2DBVO 2IT1A 3N87A 3KZVA 1V96A 4GRIA 5B58T 1U8EA 1TVCA 3OZIA 1VMAA 4M2LA 4BVKA 2PE3A 1UJBA 1DXHA 3PL5A 5C18A 5IYZA 4OU4A 5I4KA 3DBLA 1ODTC 2K87A 4O2AB 3CCSB 2X3YA 3LE8A 3I52A 4KR9A 1GYPA 3BA6A 5EWJB 5FOUA 4AP5A 2PRJA 3GMIA 3PC4A 4QBKA 5E9AA 3BQMB 3OLXA 3TIVA 2VVTA 4IDNA 3Q0TA 2J3DA 4EKDA 3QEAZ 1TTTA 1AMNA 3U4AA 4HZUB 4C2BA 3DDUA 4XLHA 1R4ZA 5CB4B 4MR9B 1OLUA 2VPWA 3DLAA 4FXOA 2GKGA 4RCZA 4PGMA 1VP9A 5L3QB 3F8SA 1FQKA 3UH1A 1ZG3A 2GA8A 2QTHA 3F8WA 3TJRA 3T15A 4RDXA 3CZ4A 2YHIA 2X3UA 3EG9A 1BVUA 1U6IA 3LP6A 2IH2A 4ITRC 2JG3A 4KC0A 1UT6A 4B2LA 5HFNA 2ZIUB 3SS7X 4QQFA 4IHJF 5JLAA 4D4HA 2HGSA 1NJID 1Q1ZA 1LC0A 1EG7A 3QMWA 5B5SA 1RC0A 4MWBA 4TTPA 5BUSA 4Q9NA 3RIHA 1QIDA 1H2FA 4ATNA 3TNLA 3WMFA 4B35A 3SQOA 3IYLW 1ZCBA 3QVKA 4O4HB 1QFYA 3OP1A 5FFFA 1QPBA 3K0AB 4CR8A 4I36A 2IU4A 3KO8A 4L6IA 1SUSA 2NZ8A 5GVRA 1II8B 1AGXA 5ALPA 1AKWA 4Q6WA 2ZYVX 2CLOB 1HQYE 3JQFA 2Q9BA 1CNFA 5EKTA 2WV9A 3P0JA 4PG6A 4ACAA 1NN5A 3JQBC 3W0LB 3HYSA 3L1KA 4BX8A 4OPSA 3RS4A 1L3BA 1YU9A 2FUG6 2AJBA 3CRMA 3OPNA 3RSGA 4WJKB 5BQPA 4FYJA 4AJLA 2WT4A 1OHHA 4HXEB 5IYZB 3F78A 1GAXA 1K63A 3GO4A 1VHWA 3DBLB 1A9QA 3GRAA 4UKDA 3IAHA 1ML4A 2BHLA 4WFQA 5DOVA 2R5WA 5KJEA 3SNHA 1S8OA 2W6MA 1XBTA 4RABA 3LCRA 5KNCD 2C59A 3BXOA 4CDGA 4UBIA 3J81A 5F5LA 4ZCRA 3LSYA 2YWDA 4P3IA 4L72A 1MQ9A 4K9NA 4C0BA 4U7GA 5EE3A 1KJQA 5DN6A 4HJRA 4WCFB 4XYMA 3T51B 1ZMOA 3S40A 3WWPA 3L06A 1JHRA 4P3PA 1OLUB 5KHOC 1FUIA 3EUWA 2J1LA 1QR6A 3HGTA 3HV0A 3I9MA 4QXOA 1B3RA 1NSTA 3AFHA 4EVQA 4FJ1A 3OPOA 1XQWA 1NXSA 1O6GA 3A2NA 4HMQA 5CNKA 1V6CA 1E9SA 3SXJA 3OCXA 1CUBA 1ZHFA 2YHIB 1L5LA 4RZQA 3EG9B 2UVPA 4DT1A 2QAGC 5BSFA 4DLUA 2HSEA 1E8NA 3O8LA 1CUVA 3MWFA 3DKVA 4WZBE 4R54A 1G20E 4J7XA 1BWQA 1SZJG 5IYPA 1ZH6A 3BD9A 3LPNA 4NYJQ 1RWKA 5J40A 3DQQA 4XRRA 4ZRNA 4E7OA 1RLUA 1DOHA 4O3FA 1GR0A 1YJQA 1PGNA 4RF4A 1UCFA 2XNHA 5C8XA 2G1UA 2PUBA 4DLBA 2V6JA 2XUQA 1N2ZA 4I4TA 1DIAA 3SE7A 1W8DA 4KLCA 2D9RA 4KE8A 4Z86A 4Y3UA 3AUSA 3D7SA 3NDRA 3CA8A 5EWMA 5JXWA 4FXUA 1XTJA 3M34A 1KMNA 3LWDA 4RZUA 4B8YA 3E9EA 3OA0A 1C9EA 4B3GA 4FUTA 5DBOA 3SZMA 1P1KA 1HM5A 3IMEA 4OAPA 3WA6A 2Q3HA 5ELXA 3VR6D 1Z83A 5HUHA 4E4RA 5C4MA 2KS6A 4XR9A 2AI3A 4J3FA 5AW6A 3RTDA 5K8LA 2HREA 2ZIVB 3OZWA 2F1RA 3PA6A 4G1CA 2FK7A 4X0EA 3TSYA 1SXQA 5ECYA 3WQHA 4JODA 1O9BA 1QO7A 2QUHA 4UTXA 3UAXA 1AHPA 4KHPB 4XFJA 3QNMA 2IQIA 4O6VA 1V8OA 3NC4A 4QUBA 3ZW8A 1QGOA 2P9EA 1Z2OX 3KWMA 2NV4A 5ADHA 1Z5GA 1NBME 3GT0A 1JDSA 2NZ2A 4HDSA 3UK0A 1XWFA 5AW0A 2EGUA 4ZTUB 3HB7A 2K4MA 3F6BX 3KQUA 4K1XA 2HT6A 3T5BA 4PAAA 2QRZA 5DH9A 1N2SA 1VLQA 4D6YA 3Q11A 4KH0A 4MVJI 1AU9A 3HXLA 1GRVA 2OYSA 3W2GA 4BE7B 2VYNA 1ECBA 4Y2SA 1EJBA 4HWKA 3BX1A 4ROXA 1OXMA 3RBVA 4JJ8A 4DLPA 2H8GA 4G24A 1G3RA 2WM2A 4HEHA 4DT1B 5DGTA 3T7AA 2FOXA 4GZMA 2UVPB 1FMLA 2LDXA 1EXVA 3U4MA 3P20A 4PPYA 2F59A 1E2KA 3IAM6 1XROA 1T9GS 4ND6A 1ZHOA 2SNIE 4JUAA 3D7KA 3GEEA 1WNTA 4QVAA 3HFJA 5K2OA 1WEHA 5DTJA 2WYWA 1I6WA 1NR5A 2B4AA 3ILYA 4JT9A 3I5XA 2FPIA 3C3AA 2G70A 4HK4A 1OA1A 1AZSC 3RUIA 4QDZA 3ZE7A 4R6XA 4C21A 2CWWA 1A76A 1LCIA 2FUKA 5EWMB 1PLJA 1SBTA 4FMDB 3I39X 3V7FA 2FFQA 1EX9A 2CLCX 3ZY4A 4N0EA 5LQJA 1LY1A 3EZYA 2A4KA 3LHDA 3TJMA 5J2UF 1U9ZA 1SKYB 2C9ZA 1OV4A 2IYSA 1RT9A 3WGVA 3IX7A 1DARA 3L0DA 5SZJA 1KWKA 2V5AA 1HDZA 2V4MA 3ULKA 2V6IA 2IYPA 3ZWMA 1E6WA 1JW9B 4XB6B 4AKEA 1FXUA 1NJFA 1Y8RA 2OAQ1 1NF2A 2B4YA 2FFHA 2YMQA 3B7PA 3HU5A 1USUA 4MP6A 2WWVD 4OOFA 4BN5A 5B30A 3LWBA 4B47A 2ZAGA 3U7IA 1FS5A 2JCSA 2WKSA 3C1TA 2CXQA 3JTEA 3N7UA 3TLEA 1UC8A 2H1RA 4F84A 1MC8A 1BGXT 3ENVA 4CG2A 4KK4A 4WVFA 5FD8A 2FEWB 2AZXA 4LV5B 4NBTA 1WOPA 4HDSB 4I1VA 4UVIA 1AZLA 5CB8A 1WLYA 1K6IA 2QV7A 4E51A 1GU0A 1VC2A 2MTBA 2PWPA 2A9KA 2ZPTX 3G9ZA 4D9IA 4DM4A 3H5TA 2GN1A 2IW3A 2VUUA 3QWBA 1XC7A 2PO7A 4AJEA 1WETA 5BV0A 3FUTA 3LMKA 2OM2A 4X1IA 3AVQA 1I2DA 1TIBA 4ZEXA 2I6GA 3U4DA 4IVRA 1KDOA 1PQ4A 4MO2A 2GLTA 1AGNA 1OLXA 1RCFA 2QN8A 4FD3A 1PR0A 1FLNA 1ZISA 2WUWE 3FCSB 5B3AA 3F1KA 2CHQA 3ONNA 4L2IA 3ROEA 3IT3A 1XQ6A 2G6BA 2PJDA 1IJKA 2OCXA 3CPHA 3GQVA 3K2EA 4NE7A 4MVJG 3EVZA 1E64A 2FWPA 3G7NA 3JZMA 4NFHA 3ETNA 1XT6A 5K0NA 2GTPA 5KYNA 3V4RA 3AR4A 2WTBA 1NXPA 3QZUA 1OFUX 1TZ2A 2FPIB 1O57A 2KPOA 3KKPA 5AK4A 1IEVA 1K8XB 3TFOA 4B3XA 1AKVA 4QV2A 1DIHA 1RQ7A 4YRSA 3BTUA 2IEIA 1N05A 3KR1A 4QPCA 4WZZA 1TPZA 5BMVF 2ADFA 2VBUA 2MWMA 1T24A 3BZUA 3CR7A 1XMSA 2HIAA 5DSTA 4Z99A 3WBJA 1J25A 4EUKA 5LNK6 1GXSA 4BTEA 5BOSA 3EBOA 1NMSA 3FWNA 4K9OA 1J8MF 2V7QA 4Y2QA 1XMXA 5EQJB 3ZHZA 5A4DA 1AC5A 1JMKC 3SFTA 4BE9A 1Y8RB 1N33B 2J6HA 3QUTA 1T2VA 3OPMA 4EVIA 3V7AA 1JLKA 4YCLA 2CW5A 3OF5A 5JYCA 1K8QA 4E7PA 2XOKA 1JE0A 1GILA 5CJPA 1JQDA 1KC3A 3BFKA 4IV0A 4YONB 3A4YA 1Z5VA 4I3FA 1DMRA 5H3CA 4UMEA 1X9HA 2QNBA 1TMKA 2DWQA 4HGPA 2V97A 1JALA 1RBQA 4QLOA 1XN4A 1V3TA 4EGQA 4XEHA 2O8VA 2CVFA 4C2TA 5J3OA 2D0PB 2JA2A 1STOA 1FFEA 2HBZA 3HB0A 3I0MA 2HHAA 1J0AA 4KOEC 4BHTA 1FF9A 2RHMA 5FPSA 3MOGA 4JHLA 1YCHA 1R4MA 3BD6A 3M1LA 1JAZA 2BL4A 2P9YA 3M2TA 1BEZA 1TD1A 3TG8A 4QXPA 4GSKA 4JOSA 3MD9A 1X1AA 4J3JA 4X1IB 3R76A 5K99A 2WTUA 1CQZA 1B6RA 1E9RA 2WAMA 4BMNA 4F3RA 1RMYA 1VE1A 1EUCA 4KR2A 3VM6A 4G0YA 5KIAA 4WXYB 1OLXB 1Q1AA 4F3TA 1KIFA 1J33A 3LT4A 3MPOA 1B1CA 4L2IB 1DINA 5H3LA 1O95D 2B5VA 1EBFA 5JWHA 3UGTA 2I6UA 2DSTA 2JAXA 1Q7GA 2BUCA 4QX6A 4Q3DA 1HOTA 1DXYA 3EVCA 4KXWA 5BNWA 5AQEA 2FSHA 4ZVMA 3CEAA 2RONA 4MW4A 1V7CA 2HCFA 4ML3A 4N7MA 1NW3A 1X8XA 3V1KA 1L4YA 4K6HA 1R16A 2WQZA 3IT1A 2GZMA 3IDAA 1O95C 2C07A 3PGLA 1Q95A 1QR2A 3AB8A 3NAQA 4Z9FA 3HN2A 5A89A 4MWDA 4E3WA 4EG7A 4FUQA 4OLJA 4QULA 1GXSB 3KSMA 1JHVA 5BOSB 1GLGA 4A0SA 3U4GA 3D7LA 1J8YF 4HGQA 1P0IA 1PJRA 4NICA 5I7OA 4XRGA 4NNOA 3GG2A 4GLLA 3KCQA 3LLSA 3AFMA 3L18A 3KOUA 4RZ2A 2AUNA 2PUHA 3M6AA 4K8OA 5GPBA 4EA6A 3CT6A 1IWOA 4YLGA 1WD7A 5A4JA 1ZH8A 1XIVA 1Z5PA 1SH7A 1RPAA 1OH8A 4JLOA 1SXGA 3FDIA 1NC1A 2QOEA 2VJCA 3GPBA 4KFUA 4DJ5X 4DLXA 3CM0A 2D13A 1GGVA 1RJEA 4JYMA 4CMJA 4OHCA 3ZDBA 3Q8KA 2VDQB 2AG8A 3P9IA 2CV0A 1GKKA 1XVAA 1R4MB 1VSBA 3PQ6A 4YPFA 1IJFA 3AV3A 5C7YA 3LBNA 1TC1A 4IMJB 3ISTA 3WL3A 2GS9A 1O0CA 2F9MA 1MIHA 3UM9A 4I50A 2P79A 4MZDA 4D8XA 3ON5A 3RSQA 4B8WA 4COKA 1EUCB 1U80A 3TTWA 4C0XA 3HBMA 5DW0A 1RI3A 1QX4A 2OD9A 1PD1A 1S2NA 1N2XA 3ABQB 2RE8A 1JSZA 1QCCA 2FGKA 3O47A 3R6GA 3UC5A 4DJFC 4KREA 3S4YA 2YYYA 1UM9A 1RS0A 2I8CA 1CEYA 2IOFA 3KOMA 3U26A 2BEJA 1W4AA 3UWPA 3H0EA 3GRUA 1R7RA 1XQXA 4GYYA 2P3LA 1J49A 3MM4A 3S2ZA 3KQOA 2JJ1A 4F5EA 3P19A 4IVPA 4DV2B 4ZKEA 4KSYA 2FPMA 4ARIA 1NNLA 1KDPA 2OEPA 621PA 1W87A 4M3NA 2GQ0A 3WWZA 2OHOA 2ODNA 4AIRA 3ER8A 1LSSA 1WJGA 2I8LA 4MRRA 4QECA 5CCDA 1DC6A 1Z26A 1CQIA 3K1JA 1DHTA 1KF0A 5T6MA 2ODEA 3WJAA 3BL8A 3MG9A 3TKYA 5DP2A 1D4AA 4LDNA 4LX0A 4KQHA 4RLQA 3SCZA 2R1ZA 2C5HA 2X1VA 1TKBA 5IUNC 2W6PA 5EN4A 3RUDA 5IRCD 1KJWA 3D7MA 3SM3A 4MVJA 4NESA 1LQ2A 2QRQA 3ZBQA 1DEHA 2NYVA 1GPKA 2EU8A 3DQZA 5E6RA 1YE5A 3SQLA 1KY4A 1JEQA 3GRVA 1UAGA 2ORIA 5FPPA 1EAYA 6PFKA 4PG7A 4UDYX 1TGVA 5K20A 3RRJA 2YXLA 3PDCA 3PX3A 4UPVA 2G76A 1HURA 2HFKA 4JJAA 3IRUA 4Q93A 4RZ3A 2PNJA 4EJ6A 5IULC 5LQDA 4I50B 1MOSA 2BFWA 5HILA 4H0CA 1M2OA 1ZH4A 3RS2A 1J2YA 1E7MA 2B3DA 1W76A 3H9UA 5DK6A 3GJTA 4AO6A 5CEFA 2Q6OA 2Z3WA 5I45A 1XDWA 2BGRA 3Q3AA 3OJXA 2PZ8A 2WE7A 1MV5A 2MYNA 3C4JA 2FZKA 3C6XA 3H2YA 3HMQA 3PCTA 3JSAA 3R40A 4MW5A 4BGVA 2MYPA 5FA5A 3M6LA 1UM9B 3VO8A 4H7KA 4CU2A 2J0QA 4D5EA 4YDSA 4AF6A 2W43A 1YZHA 3B1JA 2GD6A 1Y4SA 4FC7A 2XAAA 4KVZA 4Y2TA 4DQKA 1BNCA 2VNKA 2ZR0A 4FDTA 1ZI9A 4OXNA 5A4AA 1BHJA 4H3SA 1J0BA 1ZKDA 5CB6A 4V38A 1YASA 1OILA 3ZEIA 2CXHA 3H1EA 5G2OA 3OJ0A 4E1VA 2PXXA 2VUHB 1UXIA 2X8LA 3A6EA 3A1TA 1QYCA 2ZKLA 3JPWA 4CNBA 5IT0A 3G5UA 5AN9A 1W581 4C29A 1CQIB 3SICE 2EW2A 3DB1A 3JQBA 4HWRA 1L1QA 2F3SA 3HUUA 1XDZA 1IDOA 3IQGX 3OTGA 1Z4NA 4P4UA 5FBWB 2NT3A 4DJDC 4DPLA 3UBTA 3K1YA 1DXOA 2VF4X 3FPPA 1U65A 3MXOA 3B9PA 3ZJ5A 4Z4YA 2JGNA 3EXAA 2BKVA 3F46A 4CLRA 2QW0X 3T5GA 4IGKA 3ADBA 1Z4OA 2Q0XA 5E6RB 1YGYA 1T2FA 3WISA 3OLZA 4GDFA 1QGYA 3PQ7A 1IQRA 1JEQB 4QDJA 1P9LA 3M3DA 4QFMA 3OCVA 4PN7A 3ZVKA 3CKYA 3DL7A 1HR0B 2QI9F 1JXOA 1Q11A 3FGZA 3DZKA 3KEGA 1ZA1A 3KTFA 3N2KA 4KBGA 3T1NA 4UCFA 1PS0A 4WFKA 3T7IA 5DBEX 3BY2A 1J0DA 4HB3A 1II9A 4KIGA 3RVRA 3SYKA 2W11A 4IX1A 4YCNA 1GDTA 1LA2A 4XKWA 1Z7BA 4PPGA 1M2OB 3EFHA 1UAYA 4CV1A 2MMGA 5KNCA 2P2GA 1FFHA 2E55A 2DFNA 3LY7A 4ZARA 2QDKA 2E1RA 3R6KA 1P4AA 3ECSA 3ENNA 2AEJA 1W2WB 4L0QA 4IMPA 4WADA 5B64A 1DKPA 2QAGA 1TJ5A 2FN8A 3GFPA 4OJQA 5IF9A 1J4AA 1SCUA 2UXBB 1L4HA 4YACA 3H05A 1W2GA 2Y66A 3K8YA 4F04A 1YDEA 2CSXA 2VZ9A 1GNQA 3O8CA 4II2A 1H6BA 5EOVA 3TF5A 4M7RA 4YBRA 1IATA 1JVSA 1RXEA 2ORED 1QGDA 4LYHA 2KLBA 4PYLA 3P9YA 1YR3A 4K2AA 1ECCA 3MAAC 3QX7A 2ZS8A 1NPYA 4R4JA 4D99A 1ZM4A 4TM7A 4IXDA 5LOVF 4J0EA 3INTA 1GU1A 1LX7A 3L4BC 4JOCA 1E6LA 1KO7A 2X5KO 4PN3A 3SEJA 1DLJA 3VNUA 1WQ4A 2QTAA 1LBEA 3H9JA 4JP5A 1PSDA 3M9WA 4LYYA 3EDCA 5TDHA 4DMFA 2TSYB 1PFVA 1Y42X 2ID9A 4J0KA 4XTRA 1EK0A 2DQZA 3HABA 3JQCA 1JIUA 1MV8A 2WIKA 4QKQA 2H51A 2VF5X 1ONBA 1SCAA 4F60A 4ZDJA 1BZYA 2EBUA 2B1RA 3GW8A 4OL0A 3CNQS 4LV6A 4MV1A 3PQ5A 3FOCA 1JJVA 3G2OA 4CN8A 5B7GA 1C1YA 3IHLA 5DLPA 3VR6A 1LPOA 1W5TA 2X1HA 4NMMA 1O0BA 1A8PA 4CLRB 4MUBA 2XUHA 4KQKA 2PKXA 3M4JA 1GFIA 3BDIA 2C78A 1YTLA 4RSMA 1RWVA 2I91A 4NL4H 1YZFA 3O4HA 5H9VA 3N2KB 3EWNA 2VP5A 1T3GA 2A1IA 4L9SA 1ZBDA 1TZMA 4EVSA 2V98A 1XEWX 5HUJA 2X2EA 3CP8A 1ZIDA 1VE9A 4XKJA 3HBJA 4DY6A 1RQLA 5EP4A 4FCTA 1N5DA 5IU6A 3VVLA 1GG9A 2C7QA 4L4SA 4TKMA 2P4SA 2H00A 3MRTA 3T34A 4D3DA 4RTNA 1ORDA 1TW3A 4LOLA 2QAGB 1JVBA 2E2WA 3E9MA 3BG5A 2W0MA 5EQFA 5JPIA 1SCUB 5FLXA 4ITUA 2GAAA 4HN9A 3KDPA 2YFHA 5HM8A 1XZIA 2AOTA 1ACMA 1ZNXA 4IDQA 2GYWA 3TDNA 1D1NA 1U3DA 5C80A 1NV8A 4A3SA 3DQPA 4RTMA 2PS3A 4KTVE 2OD7A 3K05A 4RESA 1QLJA 3A04A 4MPPA 4Q12A 4CI0B 3UC9A 1Z35A 4EW1A 1FFYA 3PUKA 2XE6A 2F3RA 3PU6A 4QXMA 3THRA 4KITB 3EDYA 1W75A 2DCUA 3MGCA 1DV1A 1QKKA 3HSKA 4KJZA 4P34A 3NBKA 1U9YA 1N7IA 3AVTA 1YHQB 1W9MA 1HE1C 3PUJA 3F9CA 3SZ3A 2PGJA 1P4MA 4L6CA 1IY1A 1QVFB 2ZCVA 1K66A 3ABOB 4C08A 1USKA 4DG5A 2OG2A 5K0ZA 5TT1A 2CHVA 3COWA 4J0DA 4PYOA 4YUVA 5CTAA 3VJKA 1BWPA 3R5HA 4NS1A 4GH5A 1LZLA 5ESWA 2GRUA 3BHIA 2H29A 3N0TA 3R0JA 4RHYA 4Q9HA 3E7PA 1SCJA 5J2TF 4EOGA 3TXYA 3A8TA 3SS8A 1FTNA 1OSNA 4G7XA 1UADA 2FW8A 1B0UA 1G2OA 1VMEA 2F3PA 1P8JA 3LT2A 2WICA 5IAEA 2GFHA 2TYSB 2VNJA 4KFCA 3RVOA 2WFMA 1NU6A 2O0KA 2X4GA 4JIMA 4ZAGA 3WO0A 4BNTA 5AFSA 5IWAB 1A50B 1TKRA 1YR9A 2NZJA 1CLEA 2RJNA 5AK3A 4F9GA 3GMTA 1U0NA 2Q1SA 1HGXA 2R2AA 1HNNA 3GPLA 1DTWA 5HOEA 1LB1B 2O2ZA 4DXDA 4XEUA 2P4UA 3WRWA 2X6WA 4M1QA 3E3AA 5JH7A 1LD3A 1EU1A 2P9GA 1E0SA 3CLHA 1AQUA 4R8KA 3NW9A 1T0JB 4KVGA 3FB4A 1ZJYA 1E1DA 5FT9A 3HYNA 5JPCA 3V6MA 1RJ9A 1N77A 4OIMA 3BMXA 4ZOLA 5DK4A 1GTG1 3CFYA 3FLBA 4HDCA 3TQHA 3OMXA 4IS3A 5TS2A 3V8NA 3GLGE 1IN7A 1FY2A 3OPYI 5CCXA 4X7FA 1RZVA 4BO8A 5B2FA 4LBZA 1CUAA 3A26A 3GRPA 4ZQCB 3QXXA 3LG2A 1MD9A 4OCZA 4OJMX 3PLNA 3U81A 3OZVA 1RXIA 3VGPA 2FPRA 2V3WA 5F4MA 2LW7A 3PEEA 4UEJA 5E7MA 2YZMA 2W6NA 3GFSA 4PGAA 1G21E 4QOEA 1JQLB 2QZZA 5LZ8A 5JMTA 1F2DA 1P75A 2ZJYA 1WV1A 1JHPA 3CS3A 1VJ5A 1GHTA 2F3UA 2HZ7A 2IH4A 5LBIA 4BN0A 4BQNA 3K15A 3PD0A 1DZ3A 2C2BA 4UQOA 2ZRJA 4ZAWA 4DF3A 3VU9A 5CTJA 3RVKA 2ANBA 3CCVB 3TM4A 4ENRA 1ML3A 3DHVA 1IRXA 1O5OA 2IWRA 1V48A 4HDMA 2Q5FA 4K6FA 5T6BA 5I9IA 2ZI6A 4A4DA 4AKTA 3G8YA 2RBGA 2C7PA 5EEGA 2W71A 4EGSA 4LJ8A 5DBFA 3VFDA 1ZEJA 5EUMA 1Z18A 2BLLA 4MJLA 1KGSA 2J8ZA 3WB2A 2G63A 4ZGBA 2PCJA 1YR7A 1SBCA 5LR6A 1NVKA 5KSWB 1V4VA 3EEYA 4PLZA 2XTAA 4U2KA 5EJGA 3JYPA 1T3SA 3MT7A 3F4KA 3D2BA 5JAQA 1GP2A 4ZGQB 2Z30A 3OJOA 1L5YA 3OCWA 3QEBZ 1Y7TA 5JFGA 1I7LA 4MNTA 5JH7B 1UDBA 3EXFA 3EFBA 1F4VA 1G55A 8LDHA 2B0JA 4R1LA 4XLTA 5AVSA 3Q12A 4R83A 1RJ9B 2I78A 4EHNA 1GKUB 2FQ1A 5AXDA 3G0DA 2CHFA 2QMEA 4ZOLB 2Y8EA 3AERB 4BLPA 2I87A 1ZP6A 5I4CA 2DOGA 1NVFA 3R5FA 1JNYA 1QDLB 3OWXA 1O95A 4TQGA 4BJ1A 4KXXA 1SQ6A 1G8SA 1WF6A 1QHGA 1PZNA 3MT8A 1YS2X 3DCJA 2HH9A 3OTOB 1G8YA 4JASB 1S8NA 3DS8A 4HLUA 1UH5A 2Q8PA 4MICA 3D1JA 2V7XA 3GJXC 4U4AA 4YY3B 4H1HA 4UJ3A 2A4MA 2Y68A 2DQKA 4G1BA 2RKOA 4RMNA 1U1GA 4FFDA 2AN1A 4P22A 3GH1A 3H84A 5CH8A 2Z2YA 4UHFA 1JTVA 1IUPA 1UBNA 4YMVA 4NI5A 3DWGA 4LOKA 4BBPA 3S68A 4KUGA 1MVNA 1H1LA 5AUQA 3TWOA 1BWRA 3AIIA 3C4QA 2PCLA 4GSYA 4HAOA 1PW5A 3VU9B 3T94A 2CMKA 3KYBA 3ZOKA 4UXHA 3DBRA 5K2MA 5DBGA 1VL5A 3HMKA 5GTDA 4HDMB 3RGGA 4EFLA 3NHYA 1UJMA 1Z47A 4P7FA 2DHCA 1IB6A 2DR3A 4C3UA 4LHEA 2R6GA 4ZYTA 2D8MA 3EAFA 1UC9A 2NUPA 5CFMA 5K09A 4JKOA 3GLVA 2G88A 2VT3A 3ZTTA 4RKFA 5F7XA 1V2HE 1KJNA 1MX3A 2QX7A 3UV3A 4YCDA 1F0YA 2J9YB 1ZZEA 2A92A 4ZO6A 3HSSA 3VPHA 2WLSA 3N6RA 3G1UA 1YU6A 1PR2A 3EXFB 3S44A 1NP7A 3D9QX 1Z2DA 4P80A 4HVLA 5AR1A 1NUUA 1PI3A 2JFUA 1W94A 2ZJ4A 1T4GA 2PVPA 2ZIEA 1ODLA 1Y5RA 1VKHA 3L6CA 2ONYA 3Q6QA 1N08A 1ONPA 3C1AA 3KZMA 2JFVA 4C88A 2ZI5A 2QL6A 1P3Y1 5THXA 1VL6A 3MRSA 4IXNA 1TCUA 1BFUA 3WAGA 1HT3A 5AM4A 1EE1A 1QZUA 2PWBA 4W5OA 1P0PA 1NKSA 3BCRA 4H7IA 2C82A 2EDAA 3TRIA 4UFNA 1QM5A 3U16A 2DWOA 4EJSB 1AXEA 1JHMA 2CYAA 3HJGA 4XDHA 2IYEA 4KPFC 3NWPA 1F2UA 3BIWA 4JYCA 4ZI7F 5AM1A 4FI3F 4PLYA 3QV2A 5KNDD 2WJVA 1Z6GA 3RYHB 2AV6A 3DHNA 4S1NA 5K8VA 5JRJA 2FX2A 4MUFA 1H1LB 3K9GA 4PPNA 3ZDYB 3ZWBA 5CCEA 2NT4A 4FHCA 4N76A 1GU7A 1UFRA 3NIWA 2V96A 4L8VA 2A1UA 3I8XA 3DMRA 3INYA 3LQRA 3PXBA 3U4IA 4LNUA 4QU5A 2PTGA 4QUDA 3UPUA 1GCIA 1T5SA 3MWLA 2JLUA 3E81A 2YKGA 5T64A 5C7LO 2FJPA 2RARA 3DPUA 4G4JA 4C4RA 1EGQA 1TQ2A 2CJWA 2VSNA 4P5DA 1VHJA 2OFFA 4ALKA 2WU3A 1XZ8A 1VKNA 4IRUB 2XV1A 2ONZA 4EHIA 3ZWPA 1CJBA 1E3TA 4B3MB 3NANA 1N3YA 1O7JA 1O87A 2NUPB 3VTKA 4BFWA 2XYHA 3KPWA 2QUAA 3DR5A 1T4CA 1JEOA 4JI8B 4W8OA 3QKSA 1P7WA 3ZBUA 5A3SA 2UVDA 4RPDA 3TMAA 2VBCA 1TMOA 2YS7A 1Q0QA 4H3VA 5IAGA 3O0TA 4CF4A 3SYLA 5IPFA 3QEJA 4XWOA 2VJDA 3KHTA 2FY8A 1PKVA 2R0QC 2P41A 3EIHA 1KOJA 2VYVD 3GPDG 3AUTA 4U0KA 2BGKA 4BC1A 1RSZA 1K68A 1Z0UA 1RYNA 2EL7A 5K0LA 2NQ2C 3HFSA 1EZZA 3LUBA 4IIJF 5EFZA 4CM7A 4ZYWA 1I94B 3CX6A 4AZTA 3B51X 5JFTA 4L4RA 3GOHA 2GI4A 2Z8YM 3DAYA 7MHTA 2J0EA 4FYYA 2VKTA 3NYWA 1U0TA 1QG0A 3OESA 4ZFNA 5KWVA 2XCSB 3PDUA 4BMZA 3K7EA 1I1HA 3DO5A 4IUYA 5ICEA 2YN0A 1F2UB 3NX4A 5IF3A 1DC5A 3UCFA 1G7CA 1ENOA 1S9HA 1D0VA 1DTEA 4LDRA 2R4UA 5KQGA 2Z2XA 2EFCB 3ZGZA 2BFBA 3HH8A 1A82A 4F3KA 3ADCA 1HDXA 1X15A 2AFIA 2HXSA 4CM8A 4HE6A 2E89A 2HDNB 2A1UB 4PV7A 4GPTA 1SN7A 4LNUB 5FI3A 3FMPB 2YWXA 4FGJA 3WWEA 1M76A 4R2JA 3RSFA 4YUAA 1PYOA 4BIIA 2LBPA 2FLKA 1KL7A 4JL6A 1JFSA 1NIJA 3BMCB 1FYWA 2FKNA 3AESA 3CF4G 4JSRA 1WR8A 1ZMXA 4NONA 3KQVA 4Y6SA 1Y5NA 3RUAA 1ACLA 4YP7A 2HNBA 3UKJA 3VOAA 3W7AA 4ARAA 3BH4A 4AMYA 4EY3A 1XX6A 5INTA 3AR9A 4MPRA 5KPJA 1N78A 1R4AA 4GZ3A 2RCNA 1W5BA 4Q7MB 3IB3A 1U3GA 1AA9A 2XXBA 5G53C 1BXKA 4ZYVA 1N6NA 1IG0A 2CZGA 2J3MA 1TNDA 3PNSA 5JZ9A 3QKSB 2GK4A 1ZD9A 1M1ZA 1CDZA 4GC5A 3RW9A 3UENA 2BJWA 4KMRA 1Y33E 2HPZA 4E5DA 4EENA 5F76A 3H2IA 2W6JD 3OPYA 3QHQA 3SDSA 1CJVC 1I2BA 2J6BA 3IFSA 1IDN1 1Q1NA 3ANNA 4M0KA 4Z4IA 3PGMA 1GVHA 1GRCA 3NTOA 4E5MA 3GT4A 4IWNA 5T4HA 3A6LA 1DG9A 3U3KA 1Q2UA 4CV0A 4B44A 2R6DA 1G8KA 4OXXA 2NTNA 1XGKA 5KTRA 1AN0A 2ASVA 1P7CA 4ZAFA 3CWZA 3I5MA 3IQWA 3JD1A 3KZOA 4C2UA 4D80A 3WNVA 1PBNA 4DSNA 2DFDA 2YINC 3G4SB 1A77A 3L4BA 2IX9A 4RLFA 4Q3EA 4CF3A 3X3HA 1KERA 3V2GA 3U44A 4KDEA 2DPMA 1I9CA 2ZJAA 3TTVA 5H9WA 3IIKA 1ISRA 4XCVA 4XN3A 4F97A 1P77A 2BFBB 1OI3A 1AQIA 3GGSA 4HNGA 4Y9TA 2AR7A 1OXUA 5EE0A 3IUYA 4D7AA 2YCBA 2AFIB 4CM8B 1YF3A 4NK5A 2P0AA 1L5VA 4EFMA 3GRCA 1R0LA 4BFSA 1LUAA 4U7WA 2GN2A 2WVJA 1P4GA 3PX2A 4W99A 3MB8A 1K86A 4WAUA 1DV2A 3ESDA 3BTVA 2JCBA 2QQEA 1AXGA 2Q21A 3I9V6 4RV4A 2BZ0A 4HAIA 3AESB 1FLAA 1DX9A 2FWIA 2P6MA 4U6QA 5DWQA 2XMSA 3ESXA 3LCJA 1ZMTA 4C06A 1MLDA 5D1HA 1HA3A 1U8FO 1TRKA 2HSGA 2PA0A 2WTNA 3IPAA 2HIHA 3OJWA 4R1MA 4KN9S 1VQNB 2I3ZA 1IHOA 2HWYA 1JZTA 5ALSA 3QEOA 1THMA 4E5KA 4EBBA 4LE1A 1FFWA 4MUGA 2BGUA 2RC5A 2D1RA 2Z1NA 3RYHA 2OAGA 3GZJA 4DCTA 3OPYB 3EZ2A 1QC5A 4KNWA 5CVDA 2XIJA 4O29A 1AK9A 4P58A 4BC0A 3IV7A 3W3AH 1H2WA 2FZEA 4P4GA 3ZY5A 4HYEA 2N47A 1OZ0A 2XYVA 4D92A 3ZD7A 4KV7A 3M6UA 1C3VA 3PJGA 4HXYA 4Y2HA 3N86A 3LYUA 4L3WA 1ZN8A 3BXZA 4C01A 1LQTA 1L3CA 3V9PA 2PHZA 3FCCA 3O38A 4KQCA 4DPKA 1HPLA 1VYVA 1GPLA 3H0KA 5AW7A 3NZEA 3VDRA 1KI8A 3N59A 1E5XA 4WCDA 4Y8VA 5FLKA 1DRVA 1DWUA 3DNPA 3LHSA 4YROA 3U44B 1QUFA 4YRMA 3JD0A 1K2WA 1WSVA 3AZQA 4P6VF 2DXIA 2ZETA 3NM6B 3CPJB 3KLNA 2ISCA 3WLKX 4AX8A 5H70A 2QMOA 1JBEA 2FWNA 2WG1A 3N7AA 2HQ1A 3IP1A 4I5FA 3W4IA 1RI2A 1RU3A 1Y82A 2Z2KA 4JA2A 5I9SA 2R79A 3GYBA 3UJNA 1X7XA 3HHPA 4EHAA 2JD2A 2NYUA 1NBEA 3O03A 1NUPA 2JANA 4Z4QA 5DNDA 2D5LA 4WCVA 3ZGNA 5DSZA 3IAS1 1YOBA 2NV2B 1JP7A 2OA0A 4C7OA 1OX5A 1RXCA 1ZW6A 2EAUA 2OZKA 2XVZA 1GSIA 3OOEA 3KEQA 1S6YA 2K5UA 3IT2A 2O2DA 4HEA6 1KWGA 1U02A 5E6SA 2GAOA 2A30A 5F3RA 5JAMA 1OX4A 3G79A 3EVTA 3I8OA 1GQ2A 2A3NA 1RDFA 2J45A 3V6LA 5HX7A 3DAGA 1LPSA 3IMKA 4P7KA 4RZIA 4A36A 3ASQA 2P40A 1DX4A 4GMFA 3SFZA 1M2JA 1I7PA 1RE0A 1Z7WA 3ASVA 1KS2A 3AETA 3BGSA 3O9ZA 4JVLA 2ENUA 2COKA 4R68A 5CYFA 5TMDA 4KKTA 1FXSA 1MQAA 2NZUG 1OVGA 1QC5B 4ZVLA 4CKCA 1THGA 2C3PA 4DQXA 5BMOA 4S05A 1DUVG 2DGDA 4R2IA 3WGMA 4KQIA 2F9FA 1JLRA 2NO1A 2LR0A 2ZUDA 4MW2A 3I42A 1NF8A 3BRQA 1YDGA 4JJ4A 1K98A 3L8FA 3TLXA 2FZ4A 4B84A 9GPBA 1Q0RA 4Y2JA 4EH1A 3OW7A 2UZ1A 2W4MA 4JOQA 1J1ZA 3O4IA 5LJIA 4UEOA 1P2VA 2Y1GA 4G0QA 1N2CB 4GNRA 3U3MA 1R0BA 2DPGA 1AUQA 3BHMA 1X1DA 1TF5A 3Q3CA 3O2NA 2W98A 3IA2A 3GFFA 3JAWA 4IM7A 2D1FA 1YBFA 2JL1A 2V6BA 1E2HA 3KJEA 4GD3Q 1GGJA 1TL7C 3C85A 3ITNA 3FTEA 2FN9A 2WWRA 3LP8A 4M9XA 2LZ0A 1I0IA 1WY5A 3DVAA 3AC0A 2RHRA 5CVVA 5AI6A 1OX6A 1N5OX 1WMEA 2ZUBA 2FPLA 3HZOA 1SGWA 4TSKA 1XTIA 3KBOA 3PGJA 2X15A 1X7GA 3K0CC 1XYGA 4OFWA 4RLHA 1C8KA 2HU7A 1HNZB 1G98A 4OOVA 4QWMA 4RK6A 3T1QA 5JCPA 2UYCA 3LA8A 2WJZB 4DM7A 4EFNA 3E03A 4HI0E 2FDXA 3UTDA 4H3KB 1OMOA 4MQEA 4C7OB 3GFBA 3KJQA 1PK9A 2EQAA 2VUTA 4QGHA 4EK9A 2YJNA 1SHLA 2PKYX 5E6SB 3IESA 3LVRE 4MW1A 4C5AA 1OX4B 2AX4A 1E2MA 4ZI7A 2H92A 3NM4A 4CDRA 2IHYA 2PIAA 1YIOA 5H5JA 3IP9A 4RA9A 5FTWA 4K9DA 1NSYA 2QX8A 2ZB7A 4YXFA 3G1TA 3AETB 2HMAA 2W93A 3X1JA 5JASA 1A8QA 2X1LA 3FFXA 3TOCA 3WOHA 1KGDA 1MW9X 1NOJA 3TIGA 2QGFA 2YJ6A 3I0NA 3ORYA 1ENYA 1Y1RA 2YV2A 1I24A 2J08A 3ACCA 3U49A 2V7WA 3RU3A 1IOLA 2NXNA 1V41E 1BHO1 2B92A 4WBSA 5F9MA 2BGJA 4M0UA 2QT0A 4V0LA 3VSDA 4BNFA 3UBMA 4HOYA 4JGIA 1V37A 4DLYA 3AMVA 1NFQA 3G2IA 2WJAA 1DBPA 221PA 2BW0A 1KEPA 3JAWB 1QRAA 1MFPA 4L5CA 4WDRA 5D87A 5M5BA 4OI1A 2JCYA 5EJEA 2RD2A 1KI7A 1RTTA 2AZ4A 3GJ6A 4G56A 5FL7D 3G17A 4JHXA 5DI9A 1SQ0A 3C74A 1W19A 3FVQA 1H2ZA 3O2SB 4LZZA 1JB1A 4QOFA 4Z2YA 4ZVSA 4F3YA 4ZZ0A 3MLEA 5HG0A 3SU8A 3PI6A 4Q4AA 2PU5A 4GUAA 2H2WA 2PXHA 4H7FA 5FTMA 2Q4OA 3Q3JB 5ALYA 3ROKA 3ZTYA 1IXKA 1T9GR 2EJBA 1RLIA 3EUEA 4HS9A 4IIJA 5ULLA 3VPDA 4DJAA 3HK2A 4MQEB 1U0BB 4LC0A 2UUBB 2C58A 4NQZA 2CYBA 2RHDA 4HSGA 4X94A 2PZAA 2EV9A 2HXYA 3GHHA 3JPYA 3UMVA 1AGPA 2YDYA 2FEPA 2PX4A 4HB2A 5HTOA 3AUUA 1JFVA 1FFAA 2KQUA 2RBEA 2IA5A 3ETDA 1WSAA 3R3ZA 4MUIA 3VU8A 1PN3A 3L7OA 5AKIA 2C3MA 3LXRA 3T7KA 1G17A 2ZB2A 3P7MA 4DDVA 4G1UC 5C1DA 2C5LA 1JAIA 2ZSHA 5B2ZA 2HCRA 13PKA 1VLJA 4RGVA 1IPFA 1T1RA 5DCWA 2QWXA 2WNSA 4L5JA 5M29A 4PS0A 5F2KA 1DBVO 1Y9AA 4MKFA 5AOAA 1E2JA 3VNQA 3PA8A 5K3EA 3IE1A 3OO0A 4YQFA 2IF2A 2BKUA 3HWWA 2Q6LA 1UUFA 3ZHOA 4IUBS 1RNLA 1NX6A 4N0MA 3ZVLA 2H85A 3MB5A 4RIFA 3WAJA 4R1OA 2R62A 3O1JC 1J22A 5G0TA 3NU1A 1PX2A 2XUDA 2B7CA 1LLQA 8AT1A 3ZWWA 4KACA 2C1ZA 2CSUA 4OP3A 4Z1MD 5FXMA 4IYRA 5DFAA 1DQPA 3E2IA 5HBGA 3SSAA 3PI7A 1L5OA 1IZ7A 3A4NA 4JP2A 2ZIZA 4QLAA 3E48A 5CDFE 2M6LA 1UBOS 4PGOA 1G8MA 4KAAA 3DMHA 1U0JA 2EKQA 3DDZX 5I9TA 1ULBA 5FOVA 2PJRA 4PZAA 3D4OA 2UYQA 3H5LA 4Q7JB 1J70A 3C8ZA 1U0EA 2GEBA 3E3NA 1FSPA 4PONA 2ZXIA 3PR3A 3WKBA 4X54A 1P4RA 5AVOA 3THWA 1A5SB 1F4LA 1ECLA 3G5AA 3ASZA 3BHJA 2P11A 4Q4AB 4Y9DA 3SLGA 1NMEA 1OY1A 1Z45A 3KJGA 3KCNA 2YZKA 4G5FA 3OEHD 2GESA 4ND1A 1NP6A 1E3EA 2FRXA 3PRKE 2H5JA 5A71A 3I5AA 1BOOA 2PLWA 2AZDA 3N3AC 4LISA 4FYXA 2XUJA 5KNDA 1QYDA 3EAQA 3QY9A 4QL3A 2OMEA 2V6GA 1KHTA 2Y99A 3GA5A 5JE8A 3SQNA 1QP4A 4GI1A 1PJSA 4D3FA 3V8MA 3TBFA 4DQUA 4S2EA 2IBTA 2MSKA 1NNI1 1RLTA 2UVQA 1U99A 2C2WA 5NULA 5KYUA 3WRXC 4ENTA 2DECA 3CONA 4LJSA 2VDWA 2J3LA 3H5AA 3A4LA 4MUHA 4YEDA 1QB7A 4EZBA 3T7EA 1RRGA 1H5UA 2VOJA 4KMSA 4O4IF 3RSSA 1XRNA 4MTLA 3WC4A 2BM1A 1M83A 1CUDA 1XVVA 3TQSA 4QFCA 1TKCA 4ZDKA 1Z82A 3E05A 4OO3A 4IH9A 2VJQA 5JVDF 3RABA 5AKLA 1II0A 2PRKA 2I54A 4Q1VA 3WNZA 3C5VA 1WBDA 1BMDA 4N5DA 4DL9A 5A2GA 4D46A 3KVNA 1H85A 2GEKA 1L1FA 2VYVA 4G0XA 1UEXC 1TCCA 3CH5A 3KAJA 4V0QA 1P2TA 4E14A 4Z6KA 2ZRPA 5HF8A 5ERGB 5J4HA 4G7WA 2XMDA 5J4LA 1E32A 4NG4A 5A06A 1SK8A 1SURA 1X13A 1QIKA 3FPGA 4O1HA 3QLTA 2V7BA 3THWB 4Y0NA 1YHNA 3HYLA 1HEYA 1PNVA 2BWJA 3QMMA 3ZZ1A 1R8YA 2EF0A 1UBRS 1PSWA 1TO6A 2A94A 3DOCA 3LCUA 1J0CA 2QQ5A 5KMGA 2BEWA 2EYUA 4D44A 2PZBA 1YB7A 5G3ZA 2NVWA 2QMZA 4ARVA 3BDVA 4H59A 5L7WA 4ALMA 4KBYA 1U2SA 1JQ3A 1VQPB 1Q3KA 2VRWA 2BF4A 1I8TA 1E1QD 2PVCA 2Z83A 4P82A 1JKIA 2J5XA 4MYSA 1LU9A 3PKJA 1AQLA 1WCWA 2OLJA 3DFUA 3H86A 4V0NA 1DKMA 3T9AA 4BBJA 4OXRA 5KYUB 4IG4A 3CR8A 2HMTA 3HA3A 1K8ZB 1HDOA 1YUMA 2Y6UA 2VDWB 1NA5A 1V8ZA 3OKXA 3ETJA 1XA0A 4NBUA 5LLSA 2QN7A 1QB8A 4EW3A 4R81A 3KKKA 1F6WA 3A4TA 2AKYA 2OCKA 3U0VA 3WMEA 1AX9A 1KVRA 5JQWA 4CM6A 5ER9A 3RRBA 5FUVA 3AKDA 5AKJA 3RF6A 3IPYA 3TXAA 4DWWA 2HXGA 4BLRA 1MA0A 3N7TA 2WKRA 1Z5ZA 2QD3A 4GI7A 3UGJA 1YL5A 1FQOA 1J2EA 2QQ0A 4L74A 1IWPB 2O5RA 4C9BA 3LPCA 3KFXA 4HX9A 2H5LA 3N2LA 1KDYA 2QQFA 2GGSA 1L1EA 4YRRA 4BX2A 1DADA 2GD1O 3AUJB 4JXKA 2BMFA 2WOOA 2Q5QA 4JQZA 1PHRA 2JHAA 2R60A 2W6JA 4P7BA 1CR0A 1QIGA 3C3CA 5JTTA 4DIDA 1C8LA 2R25B 3LDFA 1YITB 3CINA 4L73A 4U7TB 3TZKA 4Z1OA 1WEKA 4P3NA 3CC2B 2ZBDA 3DBIA 4ZAVA 4UBMA 1E1CA 3OU7A 4HEQA 3ZZ0A 3PNKA 4IZIA 3I73A 2C97A 4DE5A 4X8LA 2FPPA 2IYFA 1XEWY 4LF7B 2P2SA 1DIOB 2HRBA 3PLAE 2WWWA 2Z6BD 5HMMA 1K5GA 3WYFA 1E2GA 1E2PA 1TAHA 5IN5A 3WXBA 1X19A 3I9OA 1IPEA 4PPQA 4XD2A 5ALMA 1ZMRA 2C4VA 1Z73A 1U2RA 3WLFA 5KMGB 1TVKA 5GOZA 4MV7A 2BEWB 1E5DA 2PANA 2VHEA 3U4CA 3MCZA 1SHKA 2HU2A 3CNNA 5EPEA 2OWDA 3I6YA 1YRYE 3H5RA 3WYGA 2DJ5A 2WILA 4CIDA 3ND6A 3OI7A 2B78A 1W6RA 2B4QA 3IQDB 4YRJA 2R9VA 2ZI4A 4D9CA 3MZ0A 3QHPA 2CF5A 4FN4A 4LF4B 3TRDA 1A72A 3M3PA 5ALJA 3OTQA 1RHMA 3PVSA 1XQ9A 5M34A 3UY4A 1SVIA 1GZ4A 2H52A 2CMFA 1EUDA 3E5RA 2QDXA 2GYYA 5KTMA 4C03A 4AYXA 2WUFA 1CJSA 3BUSA 1AUOA 2O0LA 1XTPA 4UD6A 1ISMA 2AJ8A 2IP2A 4TYPA 4YVFA 2Y1OA 3C7TA 1IN4A 3OD5A 2IELA 1T5IA 1EM6A 4MPJA 3VZCA 4WOBA 1YACA 3PA1A 1J0EA 4I55A 4HLQB 3LUCA 2Q0QA 2HRZA 2OBMA 2XE4A 4FS8A 4EYEA 3INRA 1LI4A 3KP1A 1WTHD 5F4BA 5LZ7A 1V6SA 1DUIA 2CUZA 2V0NA 3JS5A 3W78A 4ZI5A 3ESYA 4JJ6A 4A73A 5K6AC 3TNFA 2PUJA 1XTUA 4OB6A 3UAWA 4BKOA 3H2BA 2IIPA 1VSQA 1L5QA 1VHEA 2EXXA 2J09A 5IBPA 2FXVA 1H22A 2LIVA 1OTHA 4YCBA 1NYRA 1B73A 1E1CB 3K0KA 2QRLA 4P7JA 3L7BA 2FPPB 4ARZA 1Y3FE 3HFGA 5CXUA 3ZGLA 2ODQA 2QMUA 4S0ZA 1X7ZA 1XEXA 2VK8A 1BLIA 5EVCA 3BGOS 4MVYA 2VP2A 3QOXA 3QYJA 5FQOA 1J2TA 2W0SA 4CHTA 4OGLA 1ZRMA 2VPQA 3LQ2A 6NULA 1OCEA 3DMDA 1TAGA 2ZS7A 1DRWA 1E89A 3NM5A 2OYRA 3X1KA 1Z4QA 2C03A 4ZRDA 2IEBA 2ORYA 1GCOA 4NMHA 1KAEA 3M1IA 1EZ4A 4TYMA 2XB2A 1HZZC 4MCHA 4YR7A 2QR5A 2DQSA 4W1RA 4XR6A 1KIAA 2C42A 4QVKA 4BPBA 3CUUA 1L4FA 2W90A 3NAMA 4GZ5A 1BCSA 3S1AA 2BJHA 1TT7A 2HWWA 4IDFA 1JIJA 1RCTE 1IY8A 4JX9A 1MHPA 2GH1A 2QN2A 4RU1A 3WLOA 2AUTA 2MSCB 2GBIA 2POQX 4HJXA 4U8GA 4CQLB 4XVCA 1EFHA 1BW9A 3BM5A 2GEDA 4GMHA 3BF7A 1E5QA 1ZJJA 1S7CA 5HJ7A 5AOVA 2RHWA 3H9CA 1T2NA 2H3HA 2NQ8A 821PA 5KX5A 3QYAA 2BDTA 3L7JA 3QX9A 5CLGA 3L43A 4I55B 5EPOA 4IJ6A 2BR3A 4EKEA 3Q8LA 4Z4EA 3WWCA 4QUKA 3JRNA 3OFKA 1GPDG 3L0PA 1BFKA 1LK5A 3FRJA 3VX4A 2ZIGA 3D3JA 3WLTA 4WMLA 4XUCA 1ZUHA 2WZQA 3HHEA 4WTOA 3UW3A 1LF5A 4PM4A 5C52B 2HCBA 4MINA 4E3ZA 1QFZA 3UPTA 2VZ0A 2GN4A 4N5HX 4HNRA 2XMCA 3TS1A 3PUHA 2WDZA 1NDHA 2XRZA 5CJJA 1Q2XA 4AXXA 2ZQZA 2IHJA 4HE5A 2NU9A 1UANA 3OUUA 3N9IA 2H4ZA 1ZL2A 2FLVA 4QODA 5A0TA 1EI9A 5JSKA 3K70D 4KJXA 521PA 4JIGA 4ROSA 1X7ZB 1OH6A 2LPMA 2P8JA 3GBPA 3WSWA 1POXA 3TN7A 1C1DA 3THOA 4FGUA 2JHCA 1POWA 1NBAA 2WFZA 3GDFA 4GXRA 4J0FA 4PAGA 5FHQA 5IMBA 4RVCA 4ETMA 5CYPA 2PTHA 2ZI9A 4IILA 3R7SA 3T9BA 3LGXA 3K0CA 4E31A 1H0RA 4URXR 2QG9A 4LSWA 3K70C 4KPEC 1U8XX 2NZVG 4I99A 2ZXHA 1VI6A 1TUIA 3OX3A 1Y3IA 4TTAA 5DNWA 3T3EA 3B5IA 3NBUA 1CF2O 3RS3A 2HGZA 3GAAA 2EKBA 1BCSB 2G7ZA 2XMGA 3L6UA 3S1AB 1G291 2H48A 1H05A 1M2NA 4P4TA 3KETA 1E18A 4EX6A 3G82C 3TFQA 4C7JA 1B42A 3SC2A 4ISBA 1BYUA 1TJNA 2X19A 3I01M 2OESA 3K9CA 4MW7A 1JL3A 4O4JF 1VE3A 1N2BA 1NT2A 2H3EA 2D2VA 1BW9B 4DJTA 2DH6A 3RR2A 4LVOA 3T35A 4W5NA 1YFLA 1QG6A 1SC6A 2PPLA 4LF5B 3NTRA 5KX5B 5ETJA 1G5PA 2P3MA 2WUVA 1H3EA 4BQOA 3RWMB 4WT7A 4JJFA 3F74A 4GGMX 3W7BA 3OT5A 5I9LA 4D57A 2APJA 3N75A 1VQOB 3W9YA 3V8QA 3L02A 3QFFA 4EECA 4DUZB 3Q6RA 4KUHA 3KUXA 3D6MA 4EJ0A 3PHBE 1B0ZA 1UPTA 3O5AA 1B8VA 1CFZA 1XDBA 3EW9A 3C7CB 2CF6A 2PZKA 1VIDA 4PVDA 3TLZA 1KK2A 3IMFA 2ZBVA 3K9HA 3OLWA 3ITEA 3V2HA 4O4LF 1EVIA 2ZDQA 1QF9A 2JRCA 1XE3A 1BMTA 1XNQB 1M6HA 4NS4A 1KMIY 2GN8A 4TV8F 2OXEA 2WPDD 3VR1A 4DV5B 1BH6A 1BE0A 4X97A 1YQDA 4HMPA 4BRZA 4ZMSA 4DV1B 4G0VA 4YP5A 1MZPA 2XCRB 3WYEA 1QO0D 3NOXA 3TBHA 4CFSA 4QARA 5KWJA 1OE0A 4N5IX 5HKBA 3RHZA 1OFGA 2NAFA 3WG9A 1C1DB 3LUKA 1KZHA 4II7A 1LTKA 1BD3A 2AKAB 1MR3F 3QOYA 2PQ2A 3N0WA 1XMJA 1S2LA 4RPHA 2VBGA 3WLQA 5FIUA 2C7RA 4H27A 2C4NA 3CPWB 3UYLA 3EZXA 4DLNA 1W36D 4U2CA 2RKBA 2VL7A 4KMMA 1XA4A 5FL7A 3OQMA 1YQEA 1UZAA 4AZ3A 2XHEA 3V4ZA 4WNAA 3TZQA 1R0KA 3W7VA 5I7FA 1AKNA 4BV8A 1YTUA 2J5BA 1OUMA 4LK3A 4RK7A 5KTSA 2QJOA 3SC2B 4BP1A 4DDHA 2WYVA 1W36C 1AKMA 4IUDS 2XRMA 3KHKA 5IJXA 2G9UA 2BN4A 4PSVA 5CLQA 3DNMA 3EIQA 1DWQA 4FN5A 4AVZA 1QG4A 1HMPA 4MIKA 1DT5A 5DCYA 5A5DA 3FHOA 3LKBA 3DOUA 3AOEC 4A7PA 5LBUA 5KTYA 2WJJA 1E62A 3GFRA 3DMGA 3OFND 3QWIA 4GQIA 1GOTA 4Z4HA 2I4IA 3EW7A 4RGBA 2WIAA 3SC6A 3JW8A 4ARSA 4BLSA 1V4BA 1OFTA 5EIAA 5HXAA 2VPTA 2E48A 2FPSA 3L6RA 4FP9A 4PBSA 1J2JA 5EZ5A 3CZPA 2JDID 2F67A 3L6DA 1HKUA 5T67A 1HL7A 3MILA 4DA9A 2ZJ6A 2VHZA 3UJ3X 3ASYA 4F6CA 1E2NA 4KU4A 1L7AA 2HLPA 5DWDA 4D9KA 3ZH2A 1F8YA 2P90A 2HSDA 3FCXA 1XNJA 3QF7A 1OFUA 2HF8A 3NBFA 2QQGA 4MDFA 4F5DA 1E60A 4Q48A 2GB4A 1P1HA 2Q3LA 5GY7A 1J90A 4Z1MA 3HRIA 3VKGA 4FOTA 1QF6A 3DTVD 3LDAA 1T0PA 2CXNA 4ZO7A 1DG1G 4WK0B 1AS0A 1MMFB 4ND8A 1K2VN 3RAEC 4ZAXA 1CR6A 2FX5A 1SCQA 2ZAYA 4JOBA 2ST1A 4CLEA 3MWEA 2G6TA 2VDMB 4WI1A 4G0UA 2Y05A 4GM4A 4U2FA 1NFFA 2ANCA 2ERYA 2JGJA 3ABIA 1ZIYA 1E63A 1CS0A 3EIXA 3I01A 4WXRA 5ESRA 4PXSA 4D3XA 4NULA 3GGGA 2H8KA 3UMFA 4AZ3B 5BUCA 5KCZA 2NLOA 1KIMA 4JJIA 4WNAB 2A9OA 2RK6A 3ITKA 1GPNA 3KB6A 4PXYA 3ZQ6A 1UPAA 2ALJA 1EPUA 2QAIA 4JBXA 1BE6A 1P8AA 3OEHA 1ZWKA 1DJLA 2CNLA 2BEUA 1FQJA 3QUSA 3A3PA 2IWHA 5FWDA 3ONDA 5GM1A 2TECE 3GN1A 4FX5A 3SNKA 3GBSA 3LC1O 3WRXA 1U7OA 3PCXA 1TYDE 3BEOA 1KNXA 1YRAA 3FB1A 1R12A 1GGMA 4XGIA 4Y1FA 2CLLB 2QMYA 4RCYA 3FHCB 3WGHA 3X2SA 4ZHQF 1A95A 2ACVA 3KJXA 4UUPA 4E1BA 1FMFA 1LPPA 3TW0A 3UWKA 5KC9A 1H2BA 3A6HA 4M9SA 3ICQB 1IHPA 4WECA 1CWUA 3DEJA 2DIEA 3PF8A 4OBEA 1AKUA 4V0RA 1DC3A 5G40A 1A4IA 3AKYA 2PN1A 3CB4A 3D6HA 3FNGA 4K46A 5E0OA 1MBZA 2IPLA 4HG2A 3DPIA 3LHKA 1ZSVA 3LL4A 2WD8A 1SK9A 1OT3A 4H18A 2GF9A 4WK2B 3DJYA 2BFCA 3G8AA 5HIJA 4MYCA 3ND8A 3PEUA 5F51A 2PBFA 5HCUA 3OKPA 4PHGA 5DW3A 4ZTZB 2IEYA 1DRUA 3QVXA 4RSHA 1K4MA 4L95C 3GCDA 2Z1DA 3IVAA 5K51A 4IDCA 5SYAA 4TRRA 2B8JA 4CFYA 2UZ4A 3AIKA 2GETA 3LK7A 4AMUA 1KR5A 4BNDB 3BGVA 3EF0A 4YT2A 2YBDA 4QU0A 1E94E 4RD1A 3ZXYA 4ND8B 4PC2A 4DRXA 1L4NA 1TEVA 2IEZA 1TLTA 2WJ3A 1MAHA 3EXG2 3WL4A 4AK9A 3MWEB 4FYWA 4MIYA 4X61A 3KK0A 2R2GA 1P0QA 1O6ZA 2CE2X 1CS0B 2I34A 2ORWA 2QEXB 2PO5A 2B6HA 3LT1A 3O8BA 4RMHA 5CCBA 1OD6A 3BE6A 3ZJYA 1UP6A 1J7KA 3Q2OA 1MT3A 2WM8A 3CJQA 4IO1A 5K45A 1P7PA 3FZQA 2P8SA 2OCIA 4RJJA 1YI1A 3JX9A 5FJJA 3RS9A 2V4ZA 2W2PA 2BEUB 3QG1A 3IULA 4HRVA 3AEUA 1Z5NA 2W22A 3EQ9A 4YLEA 5KNCH 3TRFA 3CESA 1ZUIA 4OHMA 3WGYA 4PFSA 2D5IA 4ZDWA 2JK0A 1U4OA 3AFGA 1E1QA 1F5NA 1S01A 5BQXA 4M99A 3VR3D 2BFOA 1DPGA 4A1OA 2GXQA 1QAOA 1RRPA 3PGVA 4OSEA 4LOHA 1CVIA 4X3CA 4B2IA 4JC8A 4KAFA 3R5XA 3CCRB 2ZUTA 2XMPA 5LXTF 1W30A 3P9NA 5JRDS 3JALB 3DVLA 3V4LA 3DAOA 1HE2A 5JCJD 4MB6A 5CD1A 5HDQA 5BO5A 4WNCA 4GBMA 1J8DA 1RLMA 3QW2A 6LDHA 3Q1LA 5EJ6A 5JS8A 4C1BA 1G64A 4EY6A 4EAAA 3PXUA 3HRKA 5H82A 2BFCB 1JAYA 3GGDA 4IL5A 1XYVA 4LNHA 2BIFA 1NT4A 1J1IA 3OOJA 5JFOA 5FPHA 4JA0A 3HJFA 5CDSA 3DLIA 2IHUA 3DW3X 1P2GA 1ZD5A 1C3OA 4L9RA 1YGPA 2Q0HA 4WZBA 1G20A 5CT4A 2XOEA 4Q1AA 2DHEA 2H2HA 1NRJB 2ZTGA 1VGQA 4HDRA 2FKAA 4QDOA </