1W34A

Ferredoxin-nadp reductase (mutation: y 303 s)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w34A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w34A02
3WYAA 4RD4A 1VQLB 3OJWA 3SJZA 2BGJA 1VQ6B 1N0UA 4TN1A 4B44A 1K73D 3B8HA 3MHPA 1EXMA 2HCJB 4BPRA 1NJID 3JQPA 3B78A 1D2EA 3MMPA 3A1FA 1NDHA 4G1VA 4AF6A 5FA6A 1EFTA 3E20A 1TLLA 4M0LA 4ZV4A 4ZCLA 1ZM9A 3QFRA 4HE5A 4P3YA 3G71B 1Q82D 1JNYA 5TV2A 1BX0A 2E1RA 4WQMA 1YITB 2XNJA 2FX3A 3AGPA 3W2IA 3W5UA 1IJEA 4YAFA 5TR9A 3FPKA 5H5JA 4RCZA 4NBSA 4AC9A 3PENA 3W2HA 2BMWA 1JA1A 3CCEB 4FWTA 3AVXA 4Q7JB 4RD1A 1IJFA 1KK2A 1KK1A 1YJNB 2GPJA 4LBWA 2QA4B 3U6BA 3CCMB 1G7TA 2CNDA 4YHBA 4B3XA 3CCVB 2YWEA 3MCAA 3WBKA 2DY1A 2RC5A 3G4SB 1M1KD 1G7SA 3ZZ0A 2PIAA 3CCQB 4RJLA 1B2RA 1R5BA 3JQQA 1KRHA 1S0UA 1VQPB 1VQ8B 1W34A 4F7DA 3VO1A 1E64A 3LYUA 4TMZA 1SM4A 4P6VF 2BGIA 1EFUA 4B43A 3U6KA 1FRQA 1EP2B 3LRXA 1KC8D 4B4DA 2BN4A 4ZGQB 2BSAA 1FRNA 1QX4A 3VMFA 4PC1A 2RC6A 1BX1A 2XNCA 4MYUA 2DERA 1Q81D 1DARA 3OZWA 2DETA 2C77A 1VQ7B 1QVGB 1D8TA 1YIJB 3J81k 3AGQA 3CC4B 2OTLB 4TMXA 2EFGA 4G5GA 3P27A 5EMNA 1CNEA 4G1BA 3AVYA 2VNIA 4TMVA 2D74A 1VQ5B 1OB5A 2EIXA 2VYQA 1M90D 4LC0A 1YHQB 3CMAB 1EWYA 3WNCA 4IW3B 3W2FA 2QDXA 2B5OA 4DQKA 1OGIA 1FNMA 2B7BA 1QGYA 4J0QA 3WY9A 1VQMB 2BM0A 1JB9A 2J7KA 2OK8A 1U2RA 1AIPA 1EFCA 1XE1A 1JJ2B 3ZZTA 2QMUA 3CC7B 1JA0A 4Y9RA 1BJKA 4Y9UA 3WNBA 1FNCA 1K8AD 1F20A 4RD3A 3CCJB 3QFTA 2B7CA 3ZBUA 2HMAA 1QGAA 4M4SA 1AMOA 1DDIA 4MYTA 4ZCMA 3QFSA 4RCYA 4B48A 1CNFA 1CQXA 3I1FA 3JQRA 1ZM4A 4HE6A 3ZZUA 3I55B 4U9UA 3G6EB 5DSZA 1DG1G 2VNKA 4M53A 3CD6B 1TTTA 1GJRA 4M2LA 4B47A 1TUIA 3CCLB 1TVCA 1YJWB 1GAQA 1GAWA 1N0VC 1QUFA 2QN6A 4K1XA 4FN5A 3QFCA 3B82A 4TMTA 4ACAA 2BM1A 1W2BB 1S72B 3CB4A 3CCRB 1BQEA 3CCUB 1HA3A 5JBQA 1KD1D 2QTZA 3AVTA 4PC3A 1GR1A 3WBJA 2YWFA 1QFJA 1VQOB 1Q7YD 2OTJB 3ZBTA 5GV8A 4RD2A 3OZVA 3CC2B 4ACBA 4LBYA 1K9MD 1QUEA 1VQ9B 4Y7CA 2PMDA 5AN9A 3E1YE 2BF4A 4EH1A 1G7RA 4RD0A 3AVVA 1OB2A 1KJZA 4TMWA 3QSYA 4C0SA 3W5HA 5HXBA 3CPWB 5KSWB 4M1KA 2DCUA 4PGOA 3CMEB 4LBVA 3I56B 1VQKB 1FNDA 1ZUNB 1B23P 2VNJA 1H42A 1VQ4B 4N3GA 2BPOA 1YJ9B 1VQNB 3QE2A 4QHYA 1A8PA 1W35A 1QFYA 1EP1B 3CW2A 1QFZA 2VNHA 3AVUA 4PC6A 3OZUA 3WNDA 3ZC3A 4ZGNB 1R5OA 1QH0A 1R5NA 1QVFB 1N8RD 3VO2A 1QGZA 1GO2A 1SKQA 1KQSB 3W5VA 5H59A 1W87A 2BVNA 3VNUA 1XB2A 2BV3A 2GQFA 4PC2A 2XEXA 1J9ZA 3OJXA 1EP3B 1E62A 2OK7A 2X3UA 3FJOA 4YAWA 5TY0A 1YI2B 2AHOA 5THXA 1ELOA 4ZCIA 1E63A 1KK3A 2CRVA 4FK8A 4PC7A 2C78A 2YWGA 2QEXB 2ZITA 4LBZA 1KTVA 3P26A 3LO8A 3ES9A 2VZLA 2YWHA 1ZM2A 3U2QA 4QFMA 1GVHA 3WXMA 1ZM3A 2R6HA 1UMKA 3LVBA 4RD6A 2DEUA 4H9GA 1FDRA 1F60A 5GV7A 1H85A 3W2EA 3AVWA 4YAOA 1IB0A 4YALA 1DDGA 1Q86D 3W2GA 4N3NA 2QTLA 2PLFA 1OGJA 4AF7A 4UAJA 3V76A 1G7CA 3VNVA 1KK0A 3CXCB 3CRZA 3CCSB 2HDNB 1I7PA 4YAUA 1WDTA 1D1NA 3OW2B 4DQLA 1FNBA 1QG0A 4R71A 2NPFA 4C43A 4NCNA
chains in the Genus database with same CATH superfamily
4QBFA 3IMEA 4OGFA 1F38A 3CH4B 1E0SA 2YINC 3JRXA 4FNMA 4C0QC 3H2JA 4OOFA 2XUOA 3GCZA 1GL9B 5FUBA 3PKJA 3ZEAA 3BFVA 3PPWA 3BJZA 1DBSA 1QLWA 2MINB 1EB8A 4AJ9A 4WXHA 4C5CA 3WFIA 5CAEA 3F0TA 4N0MA 2Q8NA 3HADA 1K73D 1DBVO 1LLFA 4IDGA 1KFBB 3PEVA 3P9YA 5IJAA 2J3HA 3EZ9A 3FYHA 5JV5A 3CX4A 4B3HA 4UULA 1Q0QA 3DZDA 3ECSA 4H1HA 4B82A 2IOYA 5JQWA 1ECFA 3FDFA 2EF1A 1OTYA 1FLNA 3IAHA 3OFKA 4FFOA 1NDHA 2FWPA 2PBLA 3L2OB 5A2QA 1C8KA 1UADA 4G1VA 2E7ZA 5IAEA 4CN9A 4JGIA 5TQ2B 1AGPA 1I2ZA 1TQHA 2OBFA 3KJHA 3QIAA 3QELA 5KIAA 4BLVA 5CM2Z 2C59A 2ZBEA 3CWQA 5IABA 3LECA 1P5FA 4YQEA 4A0SA 1Y8RA 1ZVMA 1XL0A 2GCGA 4JL8A 5H80A 4IV8A 4XM1A 3MF4A 1PGPA 4I8XA 2D0OB 5FX2A 1YAHA 5CBPB 5AVTA 5E1BA 1LDBA 4LAFA 1WXIA 3K5PA 3G9QA 4PSAA 3PFWO 1PZXA 3ENQA 4TLCA 1I3CA 2IA5A 2B99A 4CIAA 5K0NA 1ZAKA 1LBQA 4LTNA 1U2GC 4UUAA 5AK0A 1E6WA 5I8WA 2UVPA 3KKQA 1JI3A 3FPKA 2FG7C 1K6JA 1BDHA 2NQ2C 2O1SA 1RWPA 4FP9A 1YVEI 3E9ZA 1ZJZA 4IHAA 1RC1A 3EMVA 2FMUA 4GM0A 4Z7NB 1K5GA 5EIBD 4L4YA 4E13A 5HJEA 2AZ4A 3G59A 2CL7X 4D6PA 1M76A 3KUDA 2JS7A 1Y5NA 4L5IA 1AURA 2JKZA 3S7ZA 2ZRIA 2PUAA 1PJ4A 1G21B 4PM4A 4BASA 1KWKA 5HWSA 1UDBA 2IS6A 2XBUA 4TT3D 4WN9A 4D9FA 2PT9A 5C7IO 2QA4B 3QXHA 4C2BA 2HT1A 4RACA 5EWJB 2IZZA 1N36B 1EVZA 4EF4A 1QBGA 2DFTA 3A31A 3I52A 4YHBA 2GD2A 1W5BA 5DNVA 1T9ZA 1Z39A 3RYCB 1MB4A 3KXKA 3NHJA 3ADBA 1M8GA 3NGLA 4I8DA 3TLXA 3TW4A 4DRZA 4UHBA 3HVIA 3HLKA 4G0PA 1XDUA 3RVLA 1UXGA 3G7NA 1VKZA 1QDUA 4FZJA 3L6OO 1PVOA 3DLCA 1V11A 1Y81A 4IGIA 2OECA 3GJ3A 5C8DA 2A0WA 1VGQA 3RT9A 3BXPA 3GFBA 1XTSA 3QBEA 5C1OA 2V7XA 4LXGA 3T4UA 3AJ8A 1LPMA 3IB3A 3L4JA 4ZO4A 2J9ZB 3JQQA 3LVRE 1DKNA 4MDHA 1AQLA 1PGJA 2H51A 2D5LA 3C1TA 5EKXA 4DEYA 3BRCA 1KSHA 4RKEA 1V16B 5ADWA 3BYZA 2L17A 2HF7A 1JHPA 1PDOA 3KQOA 4R8MA 4UW9A 5DX1A 4LRXA 3S2YA 3UXHA 2Q0QA 4IMIB 4BMSA 2XRZA 1V9CA 2JHPA 5GGXA 4DWWA 3UQYS 3PQ6A 4II3A 4W7HA 1NR7A 4BMOB 2BEJA 4CBVA 1TYEB 2B25A 3H9JA 3C5VA 2XRFA 3LRXA 1N5OX 3F46A 2C5AA 3GUHA 3GDHA 4IDDA 5G0SA 1FVOA 2CXHA 3D7NA 3FZGA 1ULZA 5BSFA 1SBNE 1PV1A 1N92A 5KDDA 4N3AA 2I2WA 4OQZA 4J16A 4Q47A 1TK3A 3LCCA 4GQAA 4PNHA 2IYRA 3TZKA 3PWZA 5A4FS 1GPUA 2RC6A 4MLDA 3AXSA 3DOIA 1PLKA 2OV8A 2F1MA 4MVWA 3VKFA 2WY2D 3JY6A 1M6WA 4BVFA 3T15A 1RWOA 4HWSA 1GN9A 4YUWA 4B75A 1SVSA 1ZONA 3OZWA 2Q5LA 1DGQA 1F2UA 1GQRA 4IQGA 1SD1A 1K0UA 3LDUA 4I5FA 1WWKA 2OZVA 2FX5A 5ICFA 5J5CA 3ZV3A 4MS1B 3IOEA 4M0UA 3Q3GE 1KRXA 3QM1A 3AKYA 3PGA1 2IBSA 4XJXA 5C1PA 1HZJA 1SQ6A 3TBFA 3UB2A 4F4FA 2W2VA 2PY6A 5EIFA 3Q7PA 1GG9A 3CC4B 1GADO 3WR5A 2P5SA 3QG1A 5JARA 4YUAA 3ORRA 1K5HA 1MZVA 4F3TA 5BO5A 3SEJA 2AYXA 1QH8A 2FWNA 4AMYA 1RTKA 4WY5A 4ZTZB 3GVXA 2PT7A 1EFHA 1C1XA 4K9OA 3AK4A 3HFGA 3BPSA 1P5HA 2NO9A 3COZA 3EGXB 1JDBB 2FUNB 3LUAA 3EZ7A 5EMNA 2IGTA 3FIJA 1LJ8A 2Z43A 4LNHA 4MA4A 4UTXA 4NBUA 3ZWWA 2W70A 2A33A 3R3JA 2A1IA 3KTAB 4IRUB 3E7FA 5IARA 2ZR0A 3N6VA 2YKGA 2HBZA 3E8SA 4RLSA 1JQKA 3QEKA 1DX9A 1KY3A 2WAXA 3HMQA 5A5VA 2H7CA 1NW6A 1VHQA 3FVWA 5ALKA 5LIRA 2VYQA 2B0JA 2ECQA 5T4EA 4B34A 1GDTA 4Y6QA 3MCZA 2M9MA 3T7TA 3BL8A 3CCCA 5KYWA 1QIEA 1MQ9A 1OWPA 4LWZA 1ECGA 1J8FA 4HEJA 4WLEA 1RPNA 3CVWA 2OV3A 4IW3B 2JFHA 3ORSA 2GK4A 1CETA 4UNIA 3H3FA 3OIFA 1YDMA 1KQFA 1Z28A 2PBFA 2R79A 2X5OA 2W2LA 2ZJ0A 4GOND 4RYDA 3IDQA 2Q5IA 4Y8VA 1JKJA 3C3MA 4W9NA 4MRSA 4REQA 1JZSA 4DJFC 3ZCXA 4EPVA 2C9ZA 4C9BA 3HGQA 1ONNA 2VP9A 2VJYA 4OXQA 4UHDA 5CNMA 3L8FA 5CG2A 1E5DA 4YP5A 2NPOA 3QU5A 3K09A 4IWNA 4M9UA 2ZRDA 3B7PA 1NMQA 3B6EA 4DNFA 1EYZA 4ZXFA 4JC5A 1SOWA 1KH1A 3Q87B 1MEOA 1TRKA 3HKCA 4NC9A 5EXPA 4TRJA 5K0LA 1RHUA 3ZNOA 2C2BA 5AICA 4GT1A 4NICA 4BYGA 1AH2A 1PQUA 1Q0SA 5M7EA 1I2DA 2WSSA 2X7XA 3GFTA 4F1JA 5F77A 1CRLA 2GNPA 3NUGA 3BOSA 3AFOA 1HFJA 2QRHA 1OBCA 1VLYA 2V45A 4A6EA 1MXFA 4S1PA 3MGGA 2IYVA 2CNWD 2O07A 3HSYA 5CR9A 4XGIA 4ER3A 1ZINA 4ZHQB 2CLDX 4KAXA 4D4HA 1W2HA 3FFAA 1DOAA 2EKZA 4QYTA 4MYTA 1AGRA 5FL3A 2CNWA 4V02A 4WZLA 1T5TA 3CEMA 2F3TA 4IY1A 5E9WA 5FJIA 1ZLXA 1TB4A 1N5KA 3C0KA 5AIBA 4BQQA 1XD9A 3VUFA 3HXMA 5SV2A 4HAXA 1PK8A 2QM7A 1XO1A 1L5HA 1YIDA 4E15A 4KJZA 2QVBA 1FYXA 3T95A 5DTEA 1Y9DA 4G8CA 3ZZUA 1RHKA 2VA8A 2VUIB 1KETA 2O3RA 1FFDA 2XNDA 2PXCA 3C3BA 4YYEA 3C3EA 1SJ9A 5BWCA 2CDNA 1TTTA 4EGQA 2IIBA 2PZJA 2VNSA 4DCCA 1L4GA 3LS2A 5L3VA 1N07A 2EU8A 4AO6A 2P4SA 2QQFA 5BSKA 3A9UA 1H1DA 1W5EA 2YJ3A 3ZE9A 1E3XA 2ZDHA 3NYRA 3GOQA 3GFVA 4PLCA 1N0VC 1VIYA 4TWRA 2X0RA 2ZSAA 2GD1O 2ODBA 4A03A 3AOEA 4DTIA 1KP9A 1E79D 4QUJA 1DPGA 4IIGA 2OAGA 5EEGA 2IUUA 4CCYA 4EW2A 5CA0A 1YASA 1W2BB 2XIQA 5LNK1 3THRA 4EL5A 3K7EA 1MVNA 1YQWA 2HY7A 3NUQA 4C1NA 2JHGA 3F98A 2GFIA 1E79A 4QGAA 5ENVA 3NPAA 2Z1MA 2G17A 3PCRB 4MR7A 3EWIA 3LHSA 3WZ2A 4EY5A 4V0OA 2H2IA 2I2CA 2IP1A 2J5QA 2PYZA 3G82C 3SZGA 4MP3A 5DZSA 2DQ4A 1NTOA 4E30A 3QH4A 4KXFB 2RGUA 4WNCA 4XX0B 4D3ZA 4JBNA 3JQ7A 4QYIA 4FFBA 3RFFA 5HUJA 4WLUA 3E6AA 2F3QA 2OTJB 2H85A 2UAGA 5L40A 5JPCA 1BDMA 2PKYX 1THGA 4B6GA 3TKAA 1B2LA 4XCXA 1BO6A 1E92A 1P0QA 4KLRA 1NULA 2QE6A 1XWWA 4QZVA 2X0EA 1QUEA 5IDQA 1Q92A 2JEOA 1MHPA 3ENZA 1WV0A 4ISBA 3RUIA 1P8AA 1GG8A 1QGOA 2GFQA 2X40A 1XDSA 2AG6A 4EYEA 4PN7A 3KSBC 3FOWA 2ZAMA 5FHQA 1JXOA 1NBMD 4TTIA 3AVVA 4JB2A 2DWUA 1YL5A 2YVQA 3BFXA 2Y6VA 1C14A 4KI7A 1TM7E 2DH5A 4LY0A 1ICEA 3L6UA 1O1YA 1Y5MA 4F06A 1KP2A 4XYMA 5JS7A 2O05A 3BRWA 2HQRA 4F2WA 2HEGA 2CVZA 3D7RA 2L18A 4OFXA 2FJPA 3KBBA 3DCNA 3ZGLA 4TVBA 3IAM1 5BSYA 3IOYA 2GPTA 1W46A 2J08A 1IZ9A 2Q3EA 3RS9A 3GAMA 1GFSA 2YV4A 3TTVA 1TK2A 5A71A 3CMEB 2H9YA 3U7JA 1VQKB 4BFCA 4J1QA 1MOQA 2YUTA 1PR5A 4YY3B 3HC7A 1P75A 2EKPA 4IJ5A 4YGXB 1NQXA 1VQ4B 3WIUA 1FFXB 2XYRA 5EXSA 3ANYB 4GMHA 4PZUA 1Q1EA 2QE7D 5EJFA 3CRQA 1TFUA 1Y37A 2GJ9A 3EARA 4ZVKA 1MDBA 3QE2A 3FGNA 1NFRA 4LZPA 2H52A 3CW2A 1IZZA 4F5YA 3ILXA 5JALA 1V3VA 2OHIA 3VPGA 4FHCA 3HBJA 4GE0A 3FYDA 4PSDA 3Q7RA 4NZOA 2QV0A 1DC5A 5FADA 2VTDA 5KYNA 5ALJA 5JH7F 3ZK9A 4YAKA 4ITRC 4Z5XA 5ALOA 1W88A 5GY7A 1ATIA 3ZNPA 4FYPA 1MG0A 1TPZA 4D43A 5KNBH 2C07A 4GI3A 5DHPA 2Y4NA 3AUXA 3OPNA 5TARA 2YC4C 3BZUA 2VDVE 3EIFA 3ROPA 3RSQA 3ZV7A 4BUZA 2PUDA 5ADVA 4FOTA 4IXNA 3HJAA 2C2OA 3W7AA 2P9YA 1DMSA 4RABA 1Q12A 1IN8A 5F2KA 2Z6BD 4XNFA 3A6JA 3CYFA 3F74A 1P2BA 3PPYA 4N5NA 4QBHA 4RETA 4ARZA 2IYEA 2FPSA 1TIPA 3TTTA 2OK7A 1WUIS 1K98A 3PLRA 2ERXA 4JYMA 2SCUB 2VUUA 4I1UA 5DXAA 1J2UA 1U11A 3GG2A 3L0DA 1GARA 4UHHA 5DGTA 4A15A 5EP4A 4HOYA 5AHWA 5THXA 4YR9A 1DJLA 1N2JA 1X7DA 4W1SA 1EK1A 1I4TD 4PZPA 4Y2YA 3K8ZA 1MU0A 3EXG2 4IFIA 3N76A 4PFSA 8MHTA 3OJCA 2J33A 3OHPA 1XZIA 4Z3DA 2ZYGA 4B5KA 1XVIA 3FOEC 4IFBA 2A84A 1H1TA 2H2WA 4BEJA 4ND8B 3SYMA 2R1TA 4OXIA 1WBDA 1GVHA 2MMCA 4RPHA 1HC7A 1OPRA 2FZEA 5ECGC 1CJSA 2ZE7A 2ZT5A 1ABFA 2I8LA 4UDXX 3ZWBA 2BP7B 1WRBA 2IF0A 1SCAA 3LZDA 3MK31 4MS4B 2DTXA 3AUJB 4JMLA 2WNHA 2CFIA 3LPCA 2DP4E 3N07A 5JAUA 3FMFA 2XE4A 3K5WA 1FDRA 2QTRA 1F60A 4C2TA 3R5JA 5FA5A 4ZI7F 2D6FA 5DYIA 4QPZA 1H85A 3IBTA 2J7PD 4Z0PA 3DPIA 2C4VA 3SD7A 2XVMA 3AEUB 2C4KA 1QYWA 4BDSA 3Q12A 3DDOA 2GT1A 3HY3A 1YJBA 2J7PA 3IV7A 4E5VA 3N70A 4FZVA 3KB2A 5HE8A 2NNWB 5JS2A 2H0AA 5BMVF 5K0EA 3IE1A 5E2IA 2W2QA 3I64A 1M75A 3SX4A 2GPNA 2QTLA 4DJ5X 2YMQA 4BZXA 2V3VA 3WQHA 1S2LA 3NHMA 4IMJB 1YR7A 3UXEA 3ZGNA 3DP7A 1TUBA 2VBGA 1G7CA 2QJOA 5C9ZA 2A9JA 4BNZA 3TRFA 2BBTA 2IHBA 4A26A 3GARA 2ZDQA 4EMUA 2QN3A 1HKHA 3CCSB 4C6RA 1HQYE 1UBFA 2HPZA 3ZHCA 1FFWA 2ZR8A 2WTXA 4GECA 4I1SA 5EINA 1Y6ZA 2BHLA 5A4DA 4EA9A 2Q28A 3G7SA 2QTVA 3DT6A 4GS5A 3OY2A 5K6TA 3LDAA 4Z9XA 3U60B 1E1RD 1LLDA 2YV2A 1YB4A 3WBFA 1FP1D 1HE4A 1QGUB 3D81A 4KOEC 2V5AA 2E6KA 4JS0A 1GSOA 4ROTA 1MH9A 1KL7A 2VDLB 2IZOA 3RIMA 5ILGA 2ETVA 4CF6A 5M29A 2P67A 2VWHA 3UWSA 2J5BA 3E7XA 1WHSB 3LIIA 2EBFX 2P2SA 4KQGA 1A72A 3HCPA 3U3MA 1RJ9A 2IBMA 5BWNA 1Q1ZA 3CLSC 4NQZA 5BW8A 4PAQA 3A6ZA 3P2MA 4J0DA 3UK2A 1SXJD 3WLOA 1YZGA 2WG2A 2ZXFA 2ZZGA 4KOAA 5A9TA 4G0VA 1YRLA 1N0UA 1P74A 2FG6C 3SS9X 4GR5A 1NI4B 1UKAA 1ABBA 3MHPA 1MEEA 2QM8A 2E87A 3TNLA 2HX1A 4A6DA 3CRRA 3VX3A 3NVKI 2V6MA 3PA2A 4A5OA 4PHCA 3PUMA 1NXSA 4E5MA 3GLGA 4BPBA 4ZO9A 1DRVA 2JLAA 4WESA 4WZTA 3DBVO 3STVA 2EW2A 1P81A 3IILA 4MRMB 3ICPA 4I2VA 5H3CA 1HVXA 2JGLA 1M0TA 2G72A 5JNVA 1KKLA 2A7XA 2C04A 2JFQA 5I9IA 1G98A 2HW8A 3CT6A 2I3ZA 2OXFA 1PLLA 1PZNA 4AF6A 5BY2A 3GP5A 5JSUA 4P9SA 4GPIB 4Z1OA 5HXAA 1NMXA 4LZZA 1J7KA 2ZYTX 4ZHSA 4ZV4A 4ZQCB 3V2IA 4BNMA 3ZIAA 1KOJA 1WLYA 1SIBE 2ZUBA 1JLHA 5ILQA 2UUPA 5KVAA 2GDZA 3IIMA 4RMIA 3ZPNA 2HIGA 4BAZA 1MENA 2H4WA 2ZAIA 2UUBB 4AW9A 1CDDA 1ESNA 3LKVA 1O5IA 3UQZA 1XZMA 4HB3A 3ZHVA 2X4DA 4IFTA 2QP9X 3E3LA 3H16A 3PQ8A 2QT1A 2GN2A 2MYPA 3EYAA 1I5OA 5FPPA 4Z2YA 4ARUA 1PV4A 2J0SA 1QMGA 3EN0A 5K3CA 1UD4A 5TR9A 4N3BA 4BP1A 1NN3A 2DZDA 3VJLA 5JWHA 4WKGA 3U49A 3AF0A 1NB0A 5HZBA 2HWKA 3N58A 2BMWA 1I51A 3Q2KA 4IWYA 2X1MA 3OA0A 4U6NA 1UXKA 4EUNA 4L8FA 4W1QA 5I7AA 4QT4A 4QL3A 1CQIB 1TYAE 1UDWA 1CC1S 3OX4A 4G2TA 4WK4B 5EJMA 5AXCA 1A77A 1WA5A 1U6JA 5J2TA 3GEHA 3X3HA 4R9VA 1Y7IA 4LXHA 1YJNB 2WWRA 3B5JA 5ABPA 1PO7A 5I4IA 1TGYA 3EK2A 5AP9A 4AZTA 2HC9A 5J2UA 1DFGA 1GZ7A 1P3JA 4PPQA 5GJWC 4OKIA 3SBEA 1CUHA 3NWEA 4X1YB 3MJRA 1T9HA 1QVVA 1G3UA 4MVJH 4EGFA 2YWEA 3SLNA 1I5EA 2X0NA 1CPYA 3OFND 2O8EB 4EI7A 4H08A 3QY0A 1G9SA 5IBRA 1HG0A 1I7NA 5IJ9B 4ZMSA 3R7WB 2L82A 1MJHA 1W44A 3TZEA 4MW6A 1I0IA 1ECBA 2OSVA 2TMKA 3OFNA 1BE1A 3GL9A 4NBLA 4PIMA 1EFPB 2HFKA 3NP7A 1AB5A 3NUZA 3BXHA 2GKSA 3HCNA 3ZXSA 3LHIA 4NFLA 3KVNA 1XPRA 3N2YA 1HLGA 3B2EA 4MVJM 1YZLA 3LMKA 3GFPA 1EFDN 5DBIA 2YV1A 2G08A 2JLZA 3D8BA 4RM0A 2DT8A 4GOMD 5KSPA 1J2RA 2XQKA 3QW2A 4Q15A 5ISMA 4JQYA 5TT0A 2QX8A 3I62A 4IQFA 4E2XA 4WLFA 2D00A 3V8EA 4MV5A 2Q4BA 3ZUGA 2NGRA 1RBMA 2QW0X 4LGCA 3X2FA 7ADHA 4A8JC 3L6EA 5AXDA 4TMZA 1ZO8A 4RQUA 1DBRA 3TRIA 3NX4A 1CUEA 4URWR 3UBTA 4G0UA 3M83A 4CCSA 4S05A 3L7BA 4NU0A 3QX7A 3C3XA 3A4IA 2O7VA 1AKUA 2ZUUA 4ZGQB 3O8CA 4C7JA 1TEVA 2V96A 2V97A 3LTEA 4TSKA 4YJ3A 4G9EA 4TZKA 3T4XA 1K8RA 2ZYDA 3E7DA 2GETA 4EVIA 2PCJA 2WF9A 2DKNA 4OMCA 1AOXA 3ICVA 1J49A 1PRYA 5TPWA 1YUMA 2D0PB 2E4ZA 3W4KA 2QAGB 1V3UA 3L7NA 3DLTA 4WDRA 1F2TA 1KZ7B 1YRHA 1V0JA 2BKLA 5ERXA 1M0SA 2D1SA 1KYYA 4OBXA 3WLNA 3ZU5A 4ER0A 2QTBA 2QD2A 2C00A 1HZEA 2I6XA 2W8BA 4L76A 4XJVA 1VQ7B 1N2HA 3SF8B 1V7CA 2WJ3A 3MOSA 4KWHA 3T1TA 1UP4A 2A8YA 4QX6A 2GN4A 4XYGA 1GDHA 3TMAA 1HQKA 3EG5A 3OEHA 1RLMA 2DCMA 4ED9A 4FQ8A 5DNWA 2HMWA 4BFSA 3WK8A 4DCNA 1Z4MA 5E6RA 3L3BA 1IQ0A 1K97A 3HNRA 1OT5A 3OM0A 4ESHA 4PX5A 6LDHA 2FRDC 2FR8A 2OD9A 1XU4A 2ZS8A 1DT5A 1V39A 2V5VA 3G0OA 2XSZD 2LCIA 2OBNA 2OXEA 2Q5OA 3PXDA 1C4XA 2AE2A 2OEPA 4GM1A 3FCOA 4JL6A 4RIFA 4Y1RB 4F8JA 4G5GA 1Z6XA 3WWOA 4WUVA 1W93A 2VYNA 3U81A 2VNAA 3U26A 5KMGA 2ZTUA 4CRWB 1I32A 4GZLA 2BHSA 4C4PA 4EG7A 2IHVA 3OZGA 3JYPA 3K70C 2W4QA 4OBBA 3F6SA 4KODA 3MLEA 1EIWA 3IDSA 3EUFA 3L5OA 3RFVA 2QUIA 4HADA 4HH0A 4E4RA 2OGUA 4Z53A 1XNRB 3L43A 1VDZA 3QBDA 4RFSA 3R76A 2ZFUA 4RWEA 4BMVA 2E4UA 5EWMA 5JYEA 5LYJB 3FWHA 4ZCSA 4EY4A 1KIAA 3MMZA 5TGDA 1FOEB 1HYQA 3CKMA 4I5GA 1NJ1A 4JUIA 3BCRA 3OPYB 4CFSA 2WFLB 1H5UA 1G2OA 3L6CA 3ZXIA 1G5RA 5GADl 2B5WA 2C84A 2JRLA 3EF0A 3QXCA 3NDPA 3ZWOA 4L3VA 4UUPA 5ALMA 5EVCA 1Q83A 1US8B 2FUEA 2GBCA 3D4BA 3O92A 3U4CA 4BMPB 4ZEMA 1ZQ1A 4AT1A 1DBPA 1EVJA 4CKWB 2NSLA 3AF3A 1E5VA 3EDYA 1HNZB 3SZRA 2QX7A 4G23A 3ZGVA 2X2PA 3QWFA 4KMSA 1NE7A 2G83A 1QRRA 3AHJA 3O90A 4LJKA 2NXJA 4ZTUB 1N2BA 1KO1A 4PZAA 2O20A 2BFPA 3OOCA 5DW3A 3JAWB 4JGGA 5FPSA 3UPDA 1G20E 5G1OA 3SS8A 3U4QA 5JJIA 1Q1QA 2D7JA 2NZYA 4BRSA 3J7TA 4D9IA 5DTQA 3KPYA 4MEAA 3TINA 3QBJA 1C3LA 2G09A 3CO5A 5LA6A 4HKTA 2WJGA 4BRWA 3ANNA 3ABOB 1WULS 3Q98A 4R3UC 5HIAA 4IS2A 3D26A 3A1UA 3TIVA 2QX9A 1K7FB 4MKXA 1L6IA 1I1HA 1YTUA 2D4HA 1TNDA 5ESWA 4IOLA 5KYXB 2YN2A 4WOJA 5B1DA 3TJZA 3OKAA 2OKGA 2WUVA 3THOA 4B48A 2XLBA 4FKZA 1CNFA 3UM9A 1YA6A 5A02A 3HR7A 1ZI6A 3NB0A 4G4GA 5E2AA 2ZXEA 4Q4AA 3C5WP 3DD1A 4AMZA 3QVLA 2XBLA 3JQRA 2CHGA 2YWBA 1I3NA 3DEJA 3EDQA 4NCJA 4OD0A 4RIIA 4F04A 2B92A 5HX7A 2GH1A 4XEUA 3ZHBA 5FBRB 1SUAA 1TOAA 2JKVA 2RIPA 1V47A 1XXHA 5DYTA 3WV5A 1A3CA 1SHLA 3BF8A 3G9UA 3PFCA 4G0YA 5SICE 2X0FA 1CW2B 3GEMA 5CPFA 5DS0A 1IK4A 1E4OA 2RHBA 1DXOA 2ZI9A 3NAZA 4TGLA 3TD6A 1EJ6A 4FGSA 3GVLA 4HQOA 3C6BA 3EG9B 3A4YA 2K87A 5ALTA 1ZFNA 4BE9A 4BZZA 2WTUA 4LJ9A 3UB4A 3RS8A 2R1VA 3LRPA 4WK0B 3ZW7A 1WQ1R 4J9UE 1ODCA 4UBOA 3VHRA 3IMCA 2ZUVA 1RLIA 2WOJA 1SIWA 5IJZA 3KOWA 1M1YE 4XVQA 4V1CI 1NKVA 4W5NA 2CMKA 2BMJA 4WRRA 3RUAA 2HF9A 5EKSA 1YS1X 4UBIA 3CCRB 3SYLA 1Z0SA 1GKUB 2Z1DA 3K0AA 4L2IB 1ES9A 4J1TA 3LXUX 3U09A 1M2OA 1K2WA 1R0YA 3SQDA 3TRJA 2DMRA 2QLJA 1NNLA 3I39X 1A7KA 4JX8A 3NETA 4GYYA 4YUYA 3Q5DA 1ENOA 1JL3A 5F9MA 3RHSA 2IYQA 2I6FA 4L0DA 4LK2A 1GU1A 4MIOA 3SNHA 2R8RA 2D1TA 2OKCA 5A7HA 4X45A 1PG5A 3M34A 4JT9A 5F35A 4HN2A 2CF4A 1BTOA 1G5IA 1GTMA 5DHTA 1VC2A 3EPRA 3V1KA 1ISFA 5C3UA 1QE0A 2DHRA 4LJ7A 5I3CA 3UC9A 1DTWA 2PS3A 3WHIA 1I33A 3LP8A 5DM60 1HRKA 5AUPB 2RK3A 4BFYA 2GBGA 5CT4A 2J3KA 2O2ZA 3IVAA 1HZZC 4X7EA 4OMFG 2PMDA 1N2CB 4LS3A 2UZ1B 4HH3C 2OMEA 2Z2IA 4LUCA 3VSBA 1GZ6A 1JSLA 4DIFA 4N48A 1B1CA 5K51A 2FEPA 2Q07A 3QW4B 4JJZA 2XZOA 3G5LA 5K4HA 3U0BA 5EYPB 3TOSA 5KVCA 4FMDF 5EZQA 2PWBA 4FW9A 4GI2A 1KYZA 1R0KA 3IIIA 2CXQA 3RSOA 3C7CB 1V71A 4CHGA 1VJRA 4PLGA 5FH9A 3OI7A 1UAGA 3NOVA 1R15A 4GWKA 4OX9B 4OQ4A 3TJRA 5HXBA 2EYQA 2JPDA 1WD5A 2YZNA 2P3QA 4IM7A 1MB9A 4RPCA 4TRRA 5J59A 1RIFA 1FIUA 2YHIA 4LNAA 3A2MA 2A0UA 4RVSA 1S5PA 1MT0A 1HTTA 4BC1A 1DAFA 1F17A 1LWOA 2FQWA 4BQIA 3MBOA 5LLTA 3TG8A 2ZI5A 1U8ZA 1ZEMA 4DAEA 5JNWA 3CMMA 1UKEA 4XGQA 1QC5A 3ELDA 3FZQA 4L4UA 4EB8A 3RNLA 2YWDA 1FP4B 5B7GA 1SBIA 4XCVA 5CRIA 2I91A 1AKWA 3WLKX 1Q14A 4ZDWA 2XWBF 3IURA 1FSPA 2IITA 2IZ7A 3DXFA 3G5TA 2RGYA 4HR7A 2KLHA 3Q15C 4JKOA 2GREA 2OCXA 5KI6A 1NGSA 1E7WA 1SVIA 1TLTA 1V8ZA 2LDBA 1U99A 3BORA 3K73O 4AP9A 1EQAA 4E5NA 4RTNA 2XMZA 5KQLA 1L0BA 1E2KA 1FW8A 2CLHB 2VH2A 2EJUA 3N28A 1ZJJA 4DV1B 1TJPB 4I1PA 1UP7A 4E2ZA 1D6MA 4UDYX 2GYYA 3FGOA 1Q95A 4MV6A 2AXNA 5IK2D 1LPSA 4M54A 5DDIP 3MBIA 1KAOA 2I7DA 2C4WA 2O0KA 2VJPA 1O77A 1VPTA 2NPIA 3B20A 3I45A 3DTTA 4NCIA 4AICA 2E4AA 3ZHUA 4W5HA 4RJKA 4I81A 1XEWY 5IK2A 1F0NA 4BJHB 2ZE8A 4WAUA 1VI6A 4GQIA 1XMPA 4I50B 5CT5A 4E70A 1W36C 2HD4A 3RVBA 4JBYA 1TD1A 4JOCA 3BJMA 4UU8A 3VFDA 4EGSA 2QTHA 3PEWA 2C1EA 3Q85A 4Y3UA 3ULKA 1I9GA 4YLEA 1U7HA 1JU3A 2C5BA 3CSDA 5CK5A 2FMHA 4YDHB 2Q2QA 5TF4A 3RSZA 5CCBA 2KPOA 3U4IA 2WZNA 3Q3IA 2DUMA 3PD7A 2LP4Y 5JROA 5BN3A 2C7PA 1KP3A 4F2GA 1XGKA 4CVNA 2R60A 3A2NA 1EINA 2XTJA 1L8OA 4L15A 1DS6A 4TXHA 4EKYA 3R2JA 4JLJA 1N34B 4G5FA 2J9RA 1IM5A 4QO8A 3P26A 1WXXA 4RH1A 3FVQA 5H68A 1X1CA 1C8VB 5KDOA 4MGEA 4RL6A 1L7DA 3DZGA 2VT3A 4MQ5A 4YECA 1ZM2A 3RQIA 3KR9A 1V5GA 3OESA 3L0ZA 2CL5A 3DBLB 3FHJA 3V3TA 1QKJA 3U2QA 3BNWA 3LQRA 3HFRA 4XCQA 4BOYA 3OKCA 5SZHB 1WOPA 1B93A 1EZ1A 5B1EA 5FWDA 1OBOA 3REQB 1G6OA 4DR7B 3PR1A 1JHOA 4P7GA 1NF2A 2G3YA 1V7PC 2H5JA 4OQLA 4UTVA 2YN4A 1LNZA 1P1FA 2Y71A 1GCOA 1GPLA 4N7BA 2IODA 1J8VA 4Q4CA 4HAZA 2LZJA 2LNDA 4GKBA 1QCCA 3I4FA 4CR8A 1H1LA 4RS3A 3GJZA 3SQXA 1ZA1A 3PE3A 3PEYA 3PGLA 5LXTB 1GPMA 4RVDA 5LWHA 1C0IA 3DAGA 2EZUA 1ZY2A 3AKCA 2D2XA 4FLFA 3PXCX 3Q8WA 4P58A 3IV6A 5F2NA 5JHGB 2IDMA 2VF8A 4PZCA 2OXTA 2FRDA 3VI4B 3RK1A 1UZLA 3L7AA 2GX6A 2OM6A 4WIAA 5IN5A 1KXJA 3DO5A 3ZK7A 4DDKA 4BFZA 4DZZA 1FCJA 5SZKB 3SC2A 5CLJA 4JJ8A 3GIRA 3GGGA 4UU1A 1AQIA 2K7ZA 1EE9A 4BP8A 4ZK2A 2BGGA 2P90A 4LHVA 2PUBA 2II6A 4C3VA 4V38A 5IAJA 2Z9CA 3A1SA 5E6UB 3WGZA 1ULHA 2G4VA 1K68A 3LY9A 4MUGA 3K9LA 4MYHA 2CMHA 3C8ZA 2I4TA 1QO9A 2HU5A 4DB2A 4G8JA 3O8LA 3R5XA 1MVOA 3ZV6A 5K5EA 2I80A 4MSUA 1L7RA 1WB6A 1WKCA 5CLIA 5A89A 4E32A 1DJNA 2PGJA 4LWOA 4JLKA 2E89A 3LVQE 3T1NA 3EWNA 1D1NA 3U7QB 3V4PB 2V0CA 4Q9LA 1IWBB 3QFFA 1QHGA 4KBFA 1JEYA 3EDMA 1KR5A 4DSOA 4DXAA 3STUA 5GTDA 3U5ZB 2FTKE 3P71T 4KYIB 5HF5A 4EMSA 5KNDD 2C5EA 3ND8A 2IOFK 5IKOA 1VCOA 3UAWA 3WJ1A 4E14A 1E4VA 1VPEA 3L6DA 2QZJA 3R8FA 1LQ2A 1FF9A 1K1EA 3CSUA 3V8QA 4ERNA 5KNDA 1H5QA 3SK0A 5I7FA 2H9AA 1O6BA 2DWCA 2YZ7A 3JVVA 4LHXA 4C08A 4EB6A 1AGNA 1T5LA 2GEFA 4PX9A 4Q4JB 1XL1A 4JJ6A 3CF6R 1VE1A 2N1MA 3M9WA 1NVAA 2QRVB 2BEUA 3MWYW 5DYNA 3WRXA 2YDXA 3TQSA 3VMMA 4AD8A 2FW0A 3KCNA 4LDPA 3ZGYA 3OPYI 4MVJF 5JH7B 2ABWA 2X8JB 4KQ9A 4UVHA 1T0IA 2Z8ZA 2QR3A 1W4AA 4G4SO 4DVJA 4MR9A 1NYTA 4DR2B 3G8BA 2F8MA 4PR3A 5K99A 5CFMA 1C7FA 2OCYC 2Z6AA 3NV9A 1HOTA 1I24A 3PGKA 5K01A 3IODA 5EHIA 1IB6A 4IGAA 3EGWA 3H17A 4MRNA 4O4IF 4WXRA 3L84A 5DIFA 1H2YA 3JZIA 1FS6A 4X0CA 3G8AA 3H4IA 1FUYB 2VRNA 4YDSA 4WOKA 3SE7A 2G40A 2XCIA 3K20A 3NALA 4Q37A 5DLDA 2CLLB 4G67A 1B14A 3GLFB 1UK8A 1SHKA 4F9TA 4DV4B 3IUMA 4MEBA 4CNBA 4EYGA 3GA7A 4F6CA 1JNYA 1W9HA 3E8MA 2XITA 4DA6A 4RANA 1UPUA 2CY0A 4BXOA 3QHQA 5LZ2A 2HLDD 1ZUD1 4QT0A 4N54A 1L5VA 2FPWA 1EX1A 1KNXA 5H5JA 1OBHA 4J0EA 2XF2A 4ZFNA 2JLQA 2CZQA 2CNNA 3O8RA 5DV9A 4BN5A 3LHDA 1BA3A 4CUJA 3HYTA 1NYRA 1SVMA 5AVOA 3DKVA 1OZFA 3DDZX 4QVJA 2FUG6 2CEKA 2X86A 2ZSFA 5FBQB 3SBDA 1D4OA 5EL0A 1S3FA 1T5DX 1U3FA 2GPWA 1ZG3A 2Q5HA 2G0AA 1P6XA 1XQ6A 1RXEA 3GROA 3MWDB 3BZWA 1SB8A 3IEIA 2GPJA 3HJGA 1IUPA 3RRYA 1I6LA 4OXRA 4TN5A 4IIJB 4U8HA 3BEOA 1ZH4A 5D6OA 3TZLA 1V9SA 1OLXB 2CZCA 1Q57A 5EHGA 4YRBA 5JVDF 5HMLA 5LB2A 5BVGA 2IWRA 4OLBA 3I04M 3PG5A 4N7JA 3DBIA 5F4JA 1EX9A 3CX8A 5FJJA 2EEPA 2VTEA 3CPHA 3SDZA 1FB5A 3ZVRA 1UPFA 2R84A 2O8DA 3A7DA 5D7NA 3COJA 3EISA 1M1KD 3D59A 3BE8A 3SSOA 4E1BA 4OPSA 2WZBA 4B3FX 4TXNA 3WB1A 1JKFA 2IXDA 1S2IA 2R6R1 3A4TA 4IUBS 3WG9A 1XF9A 4BGUA 1N6HA 4CLHA 4HX5A 5BT8A 5K8JB 2FPGB 4RJLA 1B2RA 4RENA 4JEIA 3O8QB 3SMQA 5CVTA 5ED0A 2FJUA 3AY0A 3HDGA 3KEGA 4CMBA 4HGPA 4JT2A 3FAKA 3FUUA 5AW9A 3ZJ4A 4F7DA 1VCMA 3HDHA 3RANA 1IJBA 1ID8A 1AUVA 4IJWA 2QPOA 5AMXA 4N8SA 1XA4A 3B48A 3GA0A 1VPVA 5NLLA 2RK6A 2POQX 4V0KA 5JQGF 4UCFA 1E4YA 1ZD9A 3SQNA 2W0SA 3PWKA 4CGYA 4JEHA 5FOSA 1D0SA 4TYWA 4IJVA 2O23A 4C5AA 3JCZA 1SWVA 5AESA 4MP6A 1QX4A 2GOYA 4C29A 4LOKA 3NTQA 5FLYA 2FSGA 3C6QA 1THMA 2FDXA 3UZUA 3RS3A 2FF5A 5HF6A 5FI3A 3GFFA 2WM2A 5AW4A 3Q6NA 4M8LA 1VRCA 2Z9DA 2W90A 1V0EA 3A1NA 1UMBB 4D4LA 2O8CA 3IDOA 4KFCA 1UD3A 4Z4YA 3ZJVA 4ALMA 1A2KC 3PNSA 1ABEA 1XA3A 2Q0HA 3A3NA 3CISA 3LQYA 1BCRA 2PKQO 3Q41A 4JXKA 1RI4A 4H17A 4KN9S 4MNTA 1GUAA 3Q3AA 2OORA 3G1UA 1JIVA 4NDZA 4Z7JA 3JAMA 1KBQA 1RJGA 5ALXA 1W7AA 2OZEA 2ZIUB 1EK5A 4YYZA 1X74A 1AV7A 3PTLA 4U9HS 3X1XA 2EX0A 5LD2C 4E46A 3VU9A 1TA9A 4UE3S 4Q3DA 1J90A 4D99A 5EJ9A 4DIOA 4BVBA 3ZIUA 4PCLA 1H3FA 1U7XA 3OEYA 2AFIB 3EH2A 1CHDA 4A2PA 1IN1A 5A5EA 2RCYA 1PJ5A 4HQRA 4BATA 3H5VA 4RC9A 1SU7A 1A9ZA 1QCZA 4F38A 2EFGA 2FB9A 2M6RA 1TK9A 2DECA 4S1OA 1X1EA 3KFVA 5JIBA 2W6JD 5KKNB 1AU9A 1ZVKA 4H1VA 2VJBA 4I0WB 4X8MA 2HQBA 2WQ7A 4G1BA 1GNVA 5LZ7A 2C54A 3EH1A 3JVIA 4O8CA 5GAJA 1HE2A 3WLAA 3GYBA 1M5UA 5A8AA 1TW2A 1WMDA 4MV8A 1WUJS 1XWFA 2C0QA 3KB8A 3OQPA 3ZY4A 5BV2P 4AZVA 2RBEA 4ZI3A 2P3MA 1VP3A 1RJEA 3PT9A 3DLIA 3BHJA 4JQCA 4WZAA 5KJ1A 3I34X 3SP1A 3NBXX 2OCKA 3DE6X 2ODPA 2ZIAA 3ZQ6A 3NMUF 5CXSA 5ALNA 3W2FA 3HUTA 2HJVA 4WZBB 1CZOA 1XTTA 2I6QA 5EPEA 1NUQA 2MU1A 2IUEA 3FGPA 4LOIA 4AJNA 1R6XA 4C05A 2FWMX 3KWJA 2OPHA 3RWOA 4WNAB 1WNFA 3CIFA 3IPXA 3BMNB 4K9RA 3P9SA 3JWGA 1K7EB 3H5WA 3SLDA 4RA6A 4GP6A 1Z33A 3DEFA 3GLHA 3OURA 3EZXA 3OETA 5LDGA 3VH4A 5BXYA 3O2NA 1FSGA 1EFLA 2IHYA 3NC0C 1RR6A 2J7KA 1Z18A 4NK4A 3RB8A 3V7NA 3G2HA 4MUFA 4P84A 1XEFA 1JXMA 1QAQA 1AIPA 4JSTA 2B2CA 3EJ6A 1JJ2B 3ER9A 7AT1A 3SU8A 4MHTA 1JA0A 3UJ8A 3DS8A 1C7JA 4BYMA 4G8BA 1M10A 3K31A 4DPKA 1BZYA 3WC4A 3TG2A 3TVTA 4BKQA 1C4OA 4RX1A 2V8OA 5IP5A 3GEBA 4RDHA 1D07A 1N0HA 2JGAA 2GJAA 4ZCTA 4HWTA 1ORWA 4KQKA 3ZLTA 3SOZA 2GF2A 4LN1A 1HEYA 3GZNB 3ZBUA 3LQQA 4MUBA 4W99A 1CUJA 3QUSA 5E7MA 1N78A 3ADKA 1UKZA 1RRKA 2JGMA 3GRFA 4XLTA 3HKDA 2E37A 2CFSA 1R0BA 1Z7GA 3K16A 4JJIA 4ENSA 3JQ8A 2VP0A 1BD3A 3DL2A 4L57A 5T4HA 1SBTA 1AMOA 4HATA 4G5HA 4QU0A 4NZ9A 4J1NA 3REFA 5FB3A 3T8YA 1G60A 4AO8A 5BSUA 4ABTA 3BILA 2YV3A 1L5GB 4NE9A 3UFXB 3MRSA 5JJKA 4RCYA 2UKDA 1KQGA 3I1IA 2G1PA 1ENYA 3UMVA 4RQTA 3K3PA 3R24A 3A8KA 1H65A 1OD6A 5DK6A 1M8JA 1XD8A 5BPFA 4ZVTA 3QUTA 2ZL7A 1RYHA 1X15A 3PXXA 5CMLA 2ZSDA 1AA6A 1GUZA 2FV8A 5LZ4A 4IIDA 3MHTA 4C7OA 2GN9A 1DG1G 2Q29A 2VNKA 3IQIX 1TE2A 2FSVC 2HWXA 2YFQA 4LSZA 1XOIA 3UJ9A 3ZU2A 4HNSA 1DRWA 1CZKA 1GJRA 1ZCAA 1JXAA 2ACKA 1GGMA 3OOSA 4OI4A 1I2BA 4QUIA 4XARA 1NNUA 3TRDA 5LJLA 4WOBA 3PDUA 3GLIB 5C8ZA 3ONEA 1MIOA 1TAHA 1FVFA 4NU5A 1TVCA 2Z04A 3KWFA 4ZYWA 1FPMA 2BWJA 5HGJA 3R0QA 3R5TA 1Z47A 4J4HA 3GBPA 4P6YA 3UA4A 4OYHA 1OXXK 3WWYA 2OHOA 4IX1A 1KEEA 2ZE6A 4AZ3A 2OQRA 1C7ZA 1E6EA 1FXWA 1FFYA 1GUBA 5G02A 2V59A 4MPTA 3AI3A 4A73A 3CT4A 4B81A 4YRRA 3NFYA 2GK6A 3HN2A 2HRDA 3VHXB 2H29A 3KEFA 3THWB 4NP6A 2C5FA 2NT3A 1UR5A 2W22A 3KAKA 1KD1D 3FLMA 5HRAA 2QTZA 3C8DA 3NXKA 3RSHA 4BBAA 1E4EA 3M1YA 3AO0B 1P72A 5IBQA 1GR1A 1G8MA 1RMYA 4B6JA 2NZWA 1HLDA 2GBPA 3NKLA 1PJCA 4RSRA 5LMCA 2F62A 4DT1B 2ZBDA 1YJXA 2BMAA 3QKSB 5JCJD 4PY2A 1PK9A 3C8HA 3UJNA 3MUEA 2GF0A 4DIDA 4JOBA 3SJ7A 2A9VA 3VGJA 3VV2A 3UENA 5JI2E 1QZTA 3S1LA 2C82A 4A8PA 5BR8B 4RA9A 4LK3A 3UMRA 4D3SA 3P2EA 1D1SA 4MWBA 5JCJA 2DFPA 4GBGA 5AW1A 3FPLA 4HGQA 2BMDA 2O2IA 3IHWA 2EZ9A 3V48A 3ESZA 2H2DA 1R9GA 4J07A 5DX0A 3VC7A 1GGHA 1M34E 1J9GA 2C5GA 1FW6A 1NQUA 4FMCF 3UICA 3FCEA 4RLHA 3N2KA 1W4CA 2WAAA 2Y93A 2X9NA 1CUCA 3VNAA 2OLJA 4TL9A 4CM6A 4M9SA 4JB0A 6REQA 3H5LA 4HDCA 3IH5A 1SC9A 1KJZA 3K8OE 3RYHB 1CUSA 1FFBA 2RHJA 3EJWA 1J1UA 2FOLA 4UEJA 1H6CA 3KM0A 2BHRA 4DMUB 2Z5GA 3R9KA 5JTTA 3M9LA 4R0MA 5HM8A 4J0KA 4RK7A 4OFWA 1YJ8A 4UBMA 3KT8A 1DAPA 5KB3A 1J25A 1M2EA 2RBGA 2Y27A 1NQAO 3M9XA 3QVXA 4WFIA 5FTNA 4BTEA 1EH5A 1UBJS 3ABIA 3RTBA 2AMVA 2WVJA 3EFHA 3RF7A 5I8PA 2FN8A 3VKHA 2CHUA 3WA7A 4V0LA 2WJ6A 1YDFA 3SIXA 3FWKA 4TS3A 1RKQA 2FMTA 1DE0A 1QV7A 1VQNB 4J29A 5EJ2A 4ADSG 4CR6A 5EE1A 4NYJQ 3FOAA 1W35A 1ZK2A 2GB4A 2IW3A 4CG0A 4NJMA 2WD8A 4V0QA 1YRWA 4ZC1A 4B3JA 4FYHA 5FKJA 3AVUA 1T4CA 3SFZA 4HDSA 5AD1A 5I9NA 1V4NA 3FYSA 2QM0A 4JROA 3ZY3A 1TCBA 3ZC3A 3AM1A 4B71A 2Y1DA 1A2QA 1LD3A 1ACJA 1SKBA 2YOHA 4GXQA 3CIOA 1HR0B 4Q3BA 3M4XA 3ZCPA 1TVKB 1RPAA 2PLNA 2GWHA 4RNCA 1K6MA 1E8DA 1CJTC 4R83A 5AJVB 1I9CA 2EC5A 2AOVA 1Y5LA 2CSXA 3U40A 3F6YA 4TV9A 3M1AA 1EUCB 2Q4TA 3Q4GA 1ESZA 2ZWAA 4LDJA 5FI1B 1NXPA 2WIJA 1L5OA 4KRXA 1W87A 1NE2A 1G2IA 1S2DA 2Z2YA 5CW2A 1O58A 3P45A 5E95A 1R2QA 1Y0RA 4W5TA 4AMUA 1BVHA 2ZRCA 4D92A 2WZCA 3A32A 2FEWB 2PX3A 1FZQA 4TROA 4L85A 4DHEA 3NYWA 5TMDA 3VYSB 3ZWYA 2GM3A 2QP4A 1A98A 3BD8A 4RKQA 4RVGA 1J2YA 3D2AA 1E2DA 3K1TA 3MXOA 1QIKA 4CF7A 2Y6UA 2BTQB 2MTBA 2QLMA 3KKOA 4K9SA 5TXGA 1RS0A 2F9LA 2ORVA 2REOA 4IGFA 1P2TA 2V9PA 2ZJBA 1YTLA 1ESEA 1DJOA 1JI0A 5JSZB 4PZDA 5I45A 3R0JA 4XASA 3LC0A 3CF0A 3HGMA 5KSYA 2ZSHA 4NPAA 4QFMA 1B6TA 1EBFA 3EXIA 4KQJA 3E5HA 3W3ZB 2CJPA 4ZJYA 4M0FA 3PXEA 3K9BA 4WBNA 3BDVA 2P6RA 4YAIA 4ZIRB 3ZVMA 1Z63A 4PTYA 2X5KO 4L51A 1GTVA 4DSTA 4KWCA 4LJSA 1SBZA 3OVMA 4JDUA 2B3TA 1PEKE 3PGJA 1Y7PA 1QB8A 1BMFD 3AVWA 4X7BA 1NVEA 4CFZA 1WABA 1U31A 2RGAA 3HO6A 3C4JA 2M1XA 3HCAA 4GXRA 5B12A 1IG3A 2B4RO 1JIXA 1RAHA 1T13A 5DULA 5AR1A 1RRMA 3SCZA 3EBPA 3RTEA 2A35A 3QF7A 4J2HA 2D59A 2XODA 1WMEA 3VPXA 2XCSB 3CXRA 4PX2A 5TMPA 3L46A 3L7YA 3ONDA 1Y4UA 2A0KA 1JDVA 1Y8ZA 3GLQA 4DMFA 1II8A 1KFJB 1VBMA 2G76A 2QVLA 1TGVA 1FXSA 2PRSA 1NLUA 1L5WA 2FNAA 5FT9A 2J4DA 1JAYA 3C87A 3AUKA 1JBQA 2R25B 2RHHA 3E9QA 5A9SB 4Q1BA 1UBRS 1G9XA 1NMSA 2HSJA 4GOJA 1G8SA 4FW8A 4M87A 2O3SA 1S8AA 1KQPA 5CA1B 3D6HA 4UM5A 4A9AA 3NU1A 1NSFA 2P6NA 5DM1A 2ATCA 2WUEA 2Z0MA 1N0WA 3PUWA 3SN6A 4D96A 4DRXA 1WHTB 3LFHA 2FPIB 3KB6A 4X3CA 3AEZA 4UU7A 1MAWA 4Z4VA 4RJJA 1HMPA 4KQEA 2EEZA 4N9WA 2VHUA 3U3KA 4XJSA 1XELA 4O4JB 5LC1A 2CFOA 3B85A 3FUXA 3KHTA 4GX5A 1GCAA 4BV9A 1ENPA 3A6LA 4I1OA 4M1TA 1YL6A 2GBLC 3G1WA 1QU2A 3H6KA 2GEUA 4IO1A 1RQRA 1SC3A 4K9MA 3IP8A 4HAOA 1OYOA 3EA0A 1GA1A 4J0IA 2FPPB 1XAGA 3JWIA 3KJQA 4I9HA 4PHHA 3K35A 5E9QA 1QG2A 3HJUA 4PPFA 4QYXA 1V43A 4OOSA 5EE0A 3ZEIA 1Y5IA 4HDRB 1C0PA 2PM8A 2NO0A 4B2IA 2G5PA 3JW8A 4XIFA 5FAXA 5I7WA 3FPCA 5TEVA 3ZVNA 4PO3X 4MQLA 1N9ZA 2HCJB 1V41E 4EJ0A 3ZJUA 4JVLA 3M8KA 3NRCA 1W4LA 3I2YX 3DMGA 2FGKA 2FZ5A 4KKTA 4QHTA 4XRRA 3UWPA 2ICAA 4CM9D 1E98A 1ECLA 2JDIA 1KJ8A 1C9EA 3LDFA 1FP2A 3A1FA 1DADA 3KSMA 2IOFA 4RDLA 5GWXA 1TMYA 4M0KA 3VJKA 4A4DA 1LA2A 4BL5A 1I10A 5BVHA 2MSEB 2H1FA 4XDYA 4ZANA 1ANKA 4ARVA 1UJMA 1X19A 4AY2A 1NATA 2EBUA 4QSHA 4MOWA 4CKCB 5F4ZA 2ZCVA 4S0XA 2GK7A 1JQDA 5LFAA 3B3JA 3E0XA 4ZP1A 1ZAYA 2X1VA 1WXWA 2W2MA 1DG9A 1ZIYA 1NRIA 5BWLA 1RHMA 4YBRA 2FN9A 3C6KA 5C7LO 4ZI7B 1R8JA 4KRFA 3OZIA 1NLFA 2AUNA 3D8RA 3ESCA 2FSVA 1IQPA 1XEXB 5LCXA 1WQ3A 3VTAA 2G70A 2QR2A 3BX1A 3AGPA 3W2IA 1J8YF 2QMOA 3BCUA 3ND6A 4BLRA 3SQMA 3ZHYA 4BV8A 4UNRA 5DN6D 3RU3A 4GYJA 5ELXA 4RCZA 1JAZA 2N46A 4C0LA 4CR7A 2QLLA 3FVRA 3CZ4A 5AHRA 3RV4A 4YRKA 4LSMA 5JD4A 1ZQ9A 1VJCA 4Q82A 2H9IA 4FDMA 1E1QA 1SH7A 4GYKA 4QSMA 3JQ9A 4KITB 4ZAGA 4I9NA 2C2GA 5AJWA 4TS4A 3W1EA 3ZDAA 5K1ZA 4W5RA 3OAAD 4IHJB 5HDBB 1I1NA 1QQBA 1PW5A 3LL4A 4DNOA 5IBCA 3DNFA 4S04A 1UMDB 3L4BC 5JMWA 3KL9A 5IVKA 1OAKA 3KDSE 4N1AA 3TE6A 4ILKA 4N18A 1QYIA 1PQWA 3EQ8A 4R16A 1B00A 5CPBA 3U7IA 3WV4A 3I6ZA 3ZLBA 4ENUA 5E7JA 2H1OA 1U65A 1GQYA 2PSHA 4MICA 4TM7A 4D8XA 3OICA 5J63A 4NJOA 4DXDA 4RCVA 5LUAA 4R2LA 4GI1A 1U9ZA 1Z5WA 2ZRKA 4ZODA 4OXNA 3LUKA 1C3EA 1OCEA 3TEFA 5J4VA 3HCRA 4NMWA 3SKVA 3RVPA 2A2ZA 3NFRA 2RBKA 3UNXA 4BNKA 1VYHA 4P0PB 1YU6A 1CTQA 3EEIA 4LX0A 1Y3AA 3DLPX 4P98A 1JWLA 3W7BA 4ZYTA 5J1SB 3KEWA 3MB8A 5IJWA 4H1UA 1N6RA 3ECCA 3QV1A 3RDPA 5AI0A 3CJRA 1UPCA 4EF6A 5HW0A 3LQ4A 4XM0A 3KQLA 1GNTA 5JJLA 3E7PA 3HP4A 5JCPA 2NTNA 3IAAA 4TL7A 2PD4A 3IS3A 3FSEA 5HUHA 1XRPA 1PN3A 5AM4A 4EABA 3R5KA 4GH5A 3QE3A 1TQDA 4PYQA 4Y0NA 1NLZA 4AU1A 4IJUA 1TYCA 2ZZFA 1MJ5A 1OBFO 2Q49A 2QPAA 4P32A 1Z4PX 4Q1DA 4FBLA 3N6RA 4RY0A 4UVIA 2Z6VA 5ECYA 5IWAB 5EAIA 3WLEA 1M2VA 1E66A 2FSIA 2JW5A 4NIMA 4K9DA 5FF9A 4FYIA 1G63A 2V7GA 2WFZA 4IILA 1KXZA 1FRQA 4QNRA 4Y2UA 5C31A 2JL1A 4O2AB 4B4DA 5IAOA 4DCSA 2XUFA 1HURA 1GQFA 4AJ4A 4XB6B 1Z4KA 5GGYA 1YHZA 2JIMA 2N0SA 3MWEB 1KAEA 2OESA 4DS3A 1DBWA 5DRTA 4FJ2A 5INTA 1X6VA 2GHQA 3PUZA 3EZ2A 4K9KA 3IUPA 4XGRA 1NM5C 3JZFA 3TM5A 4XIGS 1CUZA 2H0RA 3ETGA 1YR9A 1DC7A 5FUWA 4EG5A 1ZICA 5JAMA 5B2EA 3THXB 2IPNA 13PKA 1DHRA 2VP4A 1FFSA 3MUFA 3RFCA 3WKAA 4MUEA 2QTMA 1OQAA 4K6OA 2D8AA 1RXUA 4N5DA 4CG2A 2GZAA 5FI0B 2AZTA 3NHLA 1A9QA 3TX2A 3BFKA 1EG7A 2XA2A 5MN6A 4DLNA 1OUMA 3QLTA 4WINA 2R66A 3DOHA 1C3VA 5ANRB 4DJAA 5DWDA 5FPTA 2QJTA 3NYQA 1R66A 1VA5A 1VL0A 3T99A 4DLPA 4KQXA 3WK9A 3E70C 1CVIA 3A6PC 2VBCA 1NJ5A 4C14A 3P9QA 1YB7A 3GY0A 1Z8DA 1N6IA 2PPVA 1P17A 4JXXA 1LI4A 1FQOA 2VDMB 5TT1A 1JDTA 4Z4FA 3LRTA 3O0TA 4DG5A 4Q7KA 5MN5A 1A8IA 2ZPTX 4MGKR 1JVNA 4J4TA 2ZU6A 3AVYA 4MV9A 3SZMA 3ZHRA 2UXBB 1D9ZA 1VKRA 1KJQA 3GJRA 1OX4A 2ZTVA 1BH6A 1U0RA 4HXYA 5LZ5A 3JQGB 2EGGA 4HG2A 2JN9A 2OXRA 3ZHTA 3PJEA 4G97A 3F90A 4BU0A 2ZW9A 3ICCA 3ZWDA 5A3SA 5K3FA 4F3NA 2D0DA 1RAAA 5I9MA 4NZZA 5DE3A 1HRDA 5E9AA 4RMNA 1B7GO 2GHRA 4X7DA 1Z07A 2ZIZA 3WLSA 3ROFA 3N7AA 2F3RA 3FBTA 3F3SA 4CXMA 1V1MA 2GQ0A 2WJHA 1G8GA 4DIKA 1CEXA 3EC7A 1MNAA 4IOJA 5FI5A 2NZUG 5CA0F 1FZTA 1EWKA 1EA5A 3I9KA 1G66A 4FEEA 6YASA 2UYCA 3AJRA 3HB5X 4GR4A 1C4WA 3QENA 4KVAA 1R5JA 1W0JD 1HLFA 1ZOPA 2QN9A 3G0DA 4M7WA 5AI8A 3OPMA 1XRRA 4UE2A 3D31A 1B6SA 1BU8A 1Q7TA 1AKMA 1T2CA 3CLUC 1T9CA 2JEZA 5TDHA 2Y05A 1FSSA 3QU4A 4CL2A 1QNLA 1ZNZA 3QF4B 2PFSA 2XHZA 4OOEA 1X80B 1EJ2A 4FHEA 1P18A 3K1ZA 4FOSA 3VHQA 4AKHA 1GQOA 1AZWA 1PNVA 1W73A 3NOQA 4FFNA 4P4LA 4ZEXA 3CESA 3V2HA 1ORTA 1YZKA 2HRQA 2BGLA 3KE8A 2ECOA 2YOFA 3HY6A 1VLQA 2AOTA 1GAEO 2F1IA 4EKDA 4B17A 3WE7A 1NJ6A 3SEQA 4L5BA 3QU9A 3TW8A 4Z51A 3GK3A 2Y68A 4AK9A 5BVGB 4EGCB 4FKBA 3D3KA 4Q9IA 3SKBA 1NJ8A 3C24A 5L45A 3HA2A 2DFNA 2BUBA 3EXG1 2BFDB 3EZLA 4ZN6A 4S12A 1WPRA 2HLHA 1GR0A 1Q84A 3FNEA 5KAMA 3R0ZA 1P1CA 4G81A 4LQ4A 1BXGB 5IF3A 3TDMA 4D0GA 4CCWA 2ADFA 3L9WA 5CH5A 2NU8A 4YXWD 1GU0A 3KRTA 4KPYA 3KZXA 2V6FA 3D6FA 1Z5GA 3QJYA 3FPEA 2IQ5A 4WLNA 2R11A 2FZVA 3AX6A 4HEA6 3AI7A 3LBAA 1DIGA 1GRRA 3PKZA 4M2LA 4IDCA 5EXTA 2VJLA 3DMDA 4BVJA 1JHQA 1HYGA 1Q3HA 4Z4EA 2I34A 3CCLB 1VQ1A 4QOSA 4ZVMA 5F3DA 2WLSA 1QYXA 1C1DA 4HRVA 3KBOA 2RFLA 2ZTGA 5KYYB 4OQQA 5FWXA 5FO1A 4RK6A 1JIQA 1XMJA 4G9BA 4MQBA 4QYWA 3S44A 1USUA 3DL7A 3QFCA 3L41A 3E3NA 2W2TA 2IYPA 3Q3HA 1KYWA 3TBHA 4KC0A 2W6IA 1N7GA 4US1R 5IYRA 2VP5A 1AK2A 4BO0A 1OVGA 2PFGA 1DBIA 3FPBA 4L4RA 5HOQA 3CCUB 2B35A 2P79A 3KV3O 4Z4WA 3NM6B 4GMXA 1GQ2A 2AD1A 2P3LA 3HJRA 4XYLA 1DRJA 4PC3A 4NOMA 5L7YA 4QTXA 3R7FA 1O97C 1XRNA 4QBGB 4O63O 1FS4A 3MCUA 5LOVA 5JAOA 1SK8A 1EZZA 4ZCQA 1P44A 5B5SA 1B1AA 5HK9A 3F67A 1Q0RA 1T0BA 2P2DA 1XZEA 3B6KA 3HRIA 4P54A 3WDSA 2ZUWA 3CP2A 3DEHA 1FNSA 1II0A 3IRUA 4Z4HA 1CD5A 2OBRA 3WAGA 2DG2A 3LY7A 4O1HA 3RHFA 2ZT8A 3RS2A 2PGAA 2QTTA 4ID9A 1O9HA 4FR0A 1FEZA 3UMCA 3GD5A 3NWBA 4LBYA 1KYQA 4I36A 4I4TB 4NYIR 3CRMA 4NCBA 3MINA 4JQOA 4D81A 3U37A 3AR5A 5EQTA 4EH1A 3K6JA 4P3PA 4KKSA 2XBMA 3PDIB 2VT6A 1TT7A 2WA2A 2G77B 1ID1A 1L5RA 2VXYA 1E3WA 1Y48E 3BGIA 3L7OA 4G26A 4NR0A 4W4TA 5IUKC 3D8NA 1ZEJA 3IVXA 3OIWA 4FT2A 1SQFA 1IE3A 2OD2A 3NIWA 5I4KA 1HV8A 3OX1A 3T0IA 3WMFA 3AKZA 4FYVA 4OLHA 5JECA 4TMWA 2QBYB 1G3RA 4QPCA 3SZOA 1KVQA 5C8YA 1FA9A 1SBCA 4OJTA 1JLMA 1M7BA 1XZKA 2D0IA 4KTTE 2IH5A 3GU3A 4WADA 5DBEX 4RZQA 1OXMA 2G1AA 3H8SA 4AKEA 1WDKA 2C2ZA 1T9KA 5HEKA 2XNHA 4FJ1A 4HDKA 1A4RA 1XX6A 3IELA 1R0SA 4RFVA 3AUTA 2O48X 5JY1A 4D98A 3L7KA 2OBYA 2X8BA 4XONA 2QIOA 4FC7A 3GRRA 3OQIA 2NXNA 1KI6B 4ZVRA 1ZSYA 4WLOA 4M86A 1JP7A 3WJ7A 3LSYA 1Z6QA 1AXGA 3ET4A 3BB4A 4LG1A 1L5NA 1E0AA 1PW7A 3EHDA 4R6WA 4N3GA 4IEIA 3FNQA 4QREA 3GIWA 5EHNA 4UOZA 1T1SA 3TB4A 3TPCA 1AO0A 2XOKA 2AI3A 1NVVR 3L4BA 2OOKA 5G3ZA 5H8WA 1V5VA 4XORA 5ALYA 5IW8A 5FO0A 1T15A 2EFDB 4EA7A 1F06A 2RARA 1VCHA 4QA9A 3TR0A 1PGOA 3AF2A 1JT9A 4D26A 2GCIA 2C42A 4NS4A 1JH8A 1FK8A 1A9SA 3EDOA 5TE9A 3TR5A 2PTHA 2IXTA 1O5OA 4JLNA 1YB5A 4PG5A 4YUZA 3EXAA 1BN7A 1XLVA 3UF0A 1R0CA 4BNYA 5CDGA 5C1IA 1RBZA 4Q00A 1NKTA 3UJ6A 1YACA 4K6HA 4BGDA 2V7VA 1Z73A 2PHZA 2HNBA 2RI0A 3DHWC 3WNVA 2BYTA 1SOAA 3LHFA 1QZUA 4LF4B 4UHEA 2CDCA 4ZVQA 2O5EA 3LWBA 2CDAA 5LB4A 3PFHA 2XCUA 1SG6A 4L73A 3SBOA 3ZXYA 1S2MA 3NJ8A 5M3BA 3RAGA 3ADCA 3JQAA 5C5DA 1KS9A 1W49A 1ESDA 4QVIA 4XL9A 3K9WA 3IYLW 4DMHA 1PE0A 1QG4A 4RDCA 3PEEA 3BY1A 1OIVA 4OUKX 2OHGA 2J4CA 3SHOA 3WZMA 4D45A 2C95A 4MZXA 3OMXA 5TJHA 3WGHA 4X7MA 3K8YA 1BJRE 3D2LA 2Y76A 3PHCA 4X00A 3TQHA 4EY7A 1YRQA 4DDUA 4MUYA 4OHMA 3OY7A 5C32A 1WXHA 2ID4A 3OWXA 2QTAA 1OH6A 3M82A 3CUUA 2AFHA 4EKEA 4G8DA 3JXEA 4N6GA 3AERA 3ITKA 2EP5A 4YBZA 1W5FA 4EB0A 1DZIA 1SC4A 1Y1RA 1ODJA 3KWMA 3U4DA 5ALPA 1PAUA 2YWHA 2DQZA 1ZGCA 3FMVA 2D5BA 1MGOA 4NBWA 2XUZA 4JT4A 2DBYA 4MYDA 5THKA 4N47A 3RABA 3UV6A 3A7EA 5F21A 1U8TA 2QZSA 3BS4A 3CCFA 2YICA 4Y67A 2QLBA 2JFVA 4Q21A 5JZBA 5E3JA 5KQGA 1U3VA 4RAQA 2XW6A 2PE3A 5JYBA 1ZCFA 2QF7A 3QNUA 4RD6A 4IIUA 3KFXA 3H8WA 5IVHA 3KWLA 4RH0A 4FINA 4B40A 3BK7A 3ZNNA 5KNBD 1EUDB 1UC5B 4EI9A 3VAAA 1UCFA 4EVSA 5A7FA 4H3HB 4L78A 5FUYA 3JALB 4XI9A 3O4HA 1ZITA 3R9XB 1QHNA 1ZJWA 1E20A 4IJQA 2JCVA 1YR2A 3MFYA 4P93A 4L9AA 3F5SA 4YO7A 2PX4A 5EVJA 1Z0KA 4UUNA 5FQOA 1L4FA 2P2LA 2BH2A 1QS0B 5B3AA 2B9EA 3II6X 5L9AA 1QH9A 5H9VA 4F71A 3S29A 3ZDBA 1R8XA 3ASUA 3EAGA 5DBFA 3VR0A 2PUFA 1GEEA 3DDWA 5GOTA 1ADCA 3SJUA 1I3LA 4JA0A 3HUFA 4INPA 3QNWA 1I6MA 3OE7D 1Z2OX 4MW9A 1UQRA 1I5RA 1KH3A 4B6OA 3HKEA 4BDTA 5KQMA 3MTJA 1JHVA 4JUBA 4D42A 2GCPA 3SI7A 5K8IA 2F6RA 3PHLA 3PD1A 4ZRNA 4ECEA 1KI3A 3HN7A 2DY0A 2JLXA 1KHHA 3NAQA 2J6CA 1VA4A 3LZ6A 3NHAA 4RWZA 4DJTA 1UDAA 3OCWA 2P9JA 5TX7A 1VE7A 4DV5B 3NAMA 4YRZA 2HRBA 4QJ3A 2DHDA 1BX3A 1GL3A 1TA4A 2ZAOA 3NLLA 3DTVD 1SZJG 3EFOA 4RPJA 2PMBA 1I4LD 1P4HA 4J90A 4NDAA 1OH8A 1XNQB 1YRAA 1T3TA 4DC1A 3U7GA 2HYDA 4ARAA 4PBSA 3L8MA 1AG9A 1KZLA 2JLBA 2C9BA 4OXKA 1VJ1A 1EWVA 2HT6A 4KEAA 4Q01A 5J2TF 5AVQA 1DCKA 3DCJA 2A9FA 1HT2E 1OFUA 4AZ0B 5HZKA 3SJZA 2PK3A 4GVXA 3THYA 5J2UF 2GJ4A 2XKKA 3CR8A 2O5CA 1U8CB 1S89A 3CX6A 4J6FA 1JHYA 2VKQA 2ZI6A 4DUGD 4CQLB 4M60A 4PLFA 1V5IA 3QU2A 4TN1A 1TADA 2BH9A 4R1LA 1AK9A 3RBAA 4IIYA 2GK3A 3RTAA 3DBRA 3SC3A 3A05A 1JDBC 3I01A 5ARCA 3OP1A 2B6HA 2WYIA 2JI8A 2CLCX 3P20A 4RMGA 1U3GA 4X3OA 3WTBA 4BNIA 4JI5B 3A27A 3DMHA 3FFXA 3Q9UA 4XPIA 4EX6A 3Q0EA 3PJDA 1Z9BA 4OGGA 3GNTA 5HQTA 2YMLA 3BN3A 3KHKA 1WKBA 3CQ9A 3LT4A 4R9UC 5HKBA 5F9HA 4KO3S 2FPMA 3IUQA 3EBOA 3AFNA 3HA7A 4X71A 5KZMB 5FA6A 1P4MA 2HL6A 3PDHA 1XNJA 3ZDXB 3IUEA 1AA9A 2V7WA 2BHNA 1SUSA 2QZPA 4M0LA 1ZCJA 3IQHX 3IXMA 3SY8A 3HWWA 3FTEA 4ZCLA 2XMGA 1OWOA 1Z6ZA 2A3NA 4JBIA 4KIGA 4XUGB 4CQMB 4F3RA 4UTRA 5DT9A 5B58T 3ZBPA 3SICE 2F8LA 3K0CC 3V2UA 2PKEA 3KT0A 4TMFA 1BGWA 1X7WB 2C1XA 1BX0A 4OGLA 2ZUFA 1QVWA 3R3UA 4MQ6A 2ZS7A 2Y0EA 5CLQA 3SF0A 2WUWE 2VP2A 3DHEA 2VVTA 5HZAA 1R7RA 1N57A 3BAZA 3A1PA 1KZYC 3I32A 1Q7RA 4P0TA 4I55A 2JA2A 3URKA 4DWVA 5IKMA 2VSFA 3INRA 2AVNA 3LUJA 4AC9A 1A27A 1A8HA 3RJTA 3CKYA 5KTSA 1DO2A 2P7IA 2HK7A 3VR2D 4U3JB 2C2KA 4PLWA 3S2EA 4B09A 4BVKA 1RI2A 4EENA 3D6JA 5IWCA 2GYWA 1Y1KE 3WSTA 1A2BA 3DZ8A 3VR2A 1B8PA 3GD7A 3KTFA 3PFIA 3H1PA 4RNDB 2OB2A 2P40A 2XB2A 1S01A 2VBFA 1X0VA 1ZXLA 1X86B 1YZFA 4K3UA 2C0CA 1Y4ZA 2W5UA 4Y2VA 2ZUDA 2Q1TA 3NEYA 4RF2A 4EFLA 2ZYVX 4R0VA 4CMIA 2YNMC 3CCBA 4WZ6A 3CLTD 4XVHA 1XPOA 1ND5A 1WTAA 4WD3A 4WWVA 2ZE5A 4PQEA 4O02B 1G3IA 4UASA 1U5BB 2NV0A 3QLEA 2C3PA 1DQNA 2RC5A 2FI1A 3QKRB 1BLIA 2G0TA 2RGCA 1PJRA 4YDRA 5JHHB 3WQQA 4KKUA 3LHKA 1NV8A 5HBRA 3N8GA 1F8GA 4ALJA 2WQ6A 2IUSA 2MDTA 2WHPA 4OCZA 2B1IA 5H7XA 4ZJUA 1Z29A 4Z4SA 1X1DA 1XZCA 1T6BY 3SHVA 1UQUA 3OZSA 1EXWA 4OVKA 3PZRA 4P2NA 2LUOA 2IYNA 4FE4A 3F71A 4J1SA 3HZZA 3P9IA 3W1WA 4F3KA 3COSA 1VJGA 2F1LA 2EHDA 1HDGO 2A5FA 2G4LA 2HA4A 2VXCA 3WMRA 4A8JB 2R6JA 5JZ9A 3EXFA 3C39A 4JWTA 3VO1A 1KIFA 4R2HA 3BQJA 4EHDA 4EJFA 4MAAA 5HJ5A 1F8XA 1L5SA 2NVUA 3UGJA 5B4TA 1KDRA 4RO0A 1W25A 3SDSA 2QPTA 3O8NA 4UREA 4XD2A 1Z2NX 1CQZA 3HFJA 3SBXA 3LLCA 2PSSA 1OLSA 4URHA 1Y0YA 5PGMA 1I18A 1SOUA 4ONEA 2R6CA 4Z0HO 2ZBUA 1JKIA 2QUKA 2ZP1A 2CHEA 5ECDA 1UP6A 4YJHB 3T34A 3T9DA 3VVCA 1AK1A 2YXLA 3MCVA 4QFBA 2G8LA 3CE6A 1NA5A 1P4GA 4ZZ2A 3A3GA 2QY9A 1RYDA 2PZLA 5AKLA 2QR5A 4J91A 3JQCA 4RIGA 4XWWA 2OB1A 4OK3A 1CCWA 3B1XA 5DM0A 5JNRA 4L8WB 2MINA 3JS5A 1Q81D 2C8LA 1O94D 2MR6A 5JAQA 3WHLA 2OAEA 2R85A 3EXEB 4H7IA 2JJ1D 3SYTA 2VC2B 2XXJA 2OHHA 4EG1A 1BVRA 1EVQA 5LA6F 1YXMA 4F0JA 4JELA 1L7QA 5EI5A 3ZQKA 2VBTA 5KYGA 4ZT2A 3ROXA 2AG8A 1YDEA 2HWUA 5HCNA 3V8VA 3Q8KA 2PV0A 1Y6GA 1NSYA 4YMSA 3B9PA 5K20A 1J23A 1LV8A 2QT0A 5TQ2A 1NZDA 2VDWB 4IDEA 3CF2A 1PR1A 4K87A 1G0NA 3D54D 3EWAA 4N49A 1XHEA 4MHSA 4R41A 2EV9A 3MTIA 2GHTA 2E4WA 1PT6A 3K32A 4B79A 3P2IA 1K9VF 4TUYB 3CLRD 3ELYA 4R8LA 4CLEA 1N32B 5CBPA 4IVRA 1HT1E 2XB8A 1FX0B 4QQRA 2VJDA 4ALIA 4ZA2A 1BOFA 1L8XA 2A1UA 3BMOB 4C5BA 4RULA 1G4UR 5JAZA 4OO3A 3V9PA 1XTIA 3F4BA 1B6GA 3I05A 1RABA 4MGZR 2BELA 3PT5A 3VJRA 4PXAA 5BOVA 2J8ZA 5JVDB 1KOLA 1ST2A 3DVQX 2QV7A 1RHQA 2VDNB 1N2ZA 2AMLA 4DJJA 4D0SA 1P3DA 5K0GA 3QKWA 3FNHA 1HDEA 1CKEA 4AWXA 5BNZA 5KPJA 1F7VA 4OGKA 1Y63A 2FLVA 2WJZB 3MTDA 1EFVB 4FD2A 1QRUA 3A2KA 1XXHE 2WKRA 4PRZA 1J06A 2X6TA 3ESYA 2AN5A 5I7VA 2NTEA 2PGXA 2CXNA 4JEUA 3P2OA 1G21A 3WY9A 4FC6A 5DNEA 2BM0A 1JYFA 1ZYUA 4MWTA 1RU3A 3WMWA 1LI5A 2O2XA 5AKEA 4AAYA 1U2RA 4INOA 1ZK0A 3ESRA 5EWJA 5GPBA 2KW5A 2COUA 2IU4A 4PIPA 1Y3IA 4S35A 1QDLB 2NU6B 4GVLA 2CHVA 4P25A 2VYVD 3O2JA 3ZE8A 2CUKA 1O0CA 3VU1A 2D54A 2FQ1A 1VTKA 4HWKA 2QAIA 5BPHA 5DGCA 3RYCA 2GUWA 4MVYA 3V4RA 4IF4A 1Y4SA 4B3RB 4WZKA 4EHHA 4BIMA 4RD3A 2VYVA 4UAGA 4PSKA 3U3XA 4NESA 1GLGA 3VVLA 5F7OA 1R3UA 3I6MA 2VK8A 3O1LA 2ODTX 4HIZA 2VHWA 3F9CA 1MO2A 3KOZA 2Y67A 4L74A 1C0EA 4MRAA 3ZK8A 3BJIC 3HWRA 5CFNA 1USVA 2KVOA 2Y0CA 3JATB 4FUQA 1WETA 5LMUB 5GMOA 4OKSA 3SSMA 5F1PA 1J99A 4C0AC 1EM8B 1OY1A 3ORFA 3RJMA 3P9PA 1HYBA 1V2HE 4RSGA 3R09A 5D8DA 1CQPA 1X92A 5HF9A 5HK8A 4BO9A 1V16A 4BN4A 4E5KA 5JRDS 2BCJQ 3N1UA 2QGGA 2A59A 1E3MA 4ENRA 1O4WA 1CS4C 4WECA 1ZM4A 2HJSA 1URPA 3OECA 4RHXA 2PN1A 4HFJA 3WJAA 3AL2A 4QYSA 3OPXA 4FFVA 4KGDA 3S2ZA 4MI9A 2OP1A 1WB9A 3OP4A 3TLAA 3L8GA 5F12A 4NV1A 1ZL2A 2OFOA 3VC3A 2GASA 4BUJA 4PTLA 3WK6A 2AFRA 2ZRBA 3CV3A 3CM0A 1AZSC 4WXPA 2O2HA 3E03A 2I76A 3KHUA 3JARB 3KPUA 4Q12A 3EIEA 2QNRA 2VHEA 4AF8A 3WGVA 1XHLA 4PFQA 1RPZA 3IOMA 2CUNA 1CE8B 1U7TA 4QEKA 2PS0A 4UVEA 4ZAVA 2WMOB 2XEDA 4N76A 1R4NB 4IIFA 3QBVA 3PUYA 5CJJA 3DD5A 4L9SA 2BM1A 2ZUCA 5EKTA 4C6TB 2AG1A 1JJBA 1JMYA 5B6IA 2FXIA 1OYVA 3C8UA 4JUFA 1FXUA 1NN1A 2DHQA 3A1WA 3Q5EA 4FEYA 3FSGA 3N5CA 3QX8A 1TKRA 1BYIA 1AY0A 3EY4A 2H54A 4EJSB 2W2KA 2JGJA 2R86A 3GJ4A 5D3QA 4ARSA 2WD7A 3T3OA 3FRJA 5IYQA 3AUAA 2OO3A 2CK3D 3N2EA 3P4YA 4IR7A 2XXAB 2YWFA 5IULC 4QE3A 1PL0A 1WX1A 1IMJA 1AUQA 2M2IA 4YASA 1Z38A 1G4AE 3W78A 4A16A 2PQ2A 3DKRA 5SYAA 1N08A 1YD7A 3EGXA 1ZJ6A 2AKYA 3NOOA 3S5UA 4KR3A 3VPBA 1BFKA 3QVMA 2FCAA 1JAIA 3DV2A 4RD2A 3WB9A 1UZAA 2KQUA 3X43A 4EGAA 3GVPA 3VBEA 2CF5A 1V5EA 4ZQHA 1S3IA 1BA2A 1CZUA 2NTJA 1U0EA 1LK7A 5FUQA 3PQ7A 2W6PA 1E0JA 1OF1A 3V4FA 3UUEA 3AR3A 5ELMA 2ZXIA 1PWYE 4NZNA 1NFQA 5EIAA 4MUMA 4XSGA 2ZUTA 2VK1A 5DHSA 1E1KA 1XNGA 3GT4A 3K0CA 1LC0A 2OOSA 4FYJA 2R5WA 1SRRA 3OX3A 2A5DA 2HIMA 1OYWA 3FR8A 2I71A 1VFPA 2I6UA 5KNDH 5AJUA 2KMLA 3D0RA 2RGRA 2PL1A 2WQZA 2YJTD 3ZWMA 1UBTS 5JEDA 1G1AA 5EKUA 3AM5A 2X0DA 3P7MA 1W6RA 3QUQA 3T0FA 1Z0IA 3VR5D 1S7CA 2FN4A 3LXRA 1M2GA 2DCUA 4P9NA 1W5AA 2DQYA 2WWTA 2Q4EA 4II7A 3PPVA 5B3JC 1ZZEA 4LX8A 4CE6A 2HMUA 2QMEA 3W7VA 1U28C 1QHFA 2DBZA 2E55A 3VR5A 4BGEA 4DLSA 4BQEA 2YASA 1H4SA 4GKAA 5IZ4A 5D3MB 3AFGA 1Y8CA 3O26A 1U90A 1QG6A 3OBIA 2Q3DA 2HK8A 1IWPB 1QIMA 1P9LA 1J09A 4IUYA 2YZKA 1DIOB 3RRJA 1EP1B 5LPNA 1T2NA 4ZHQA 1LDNA 1Y4DE 2FR0A 2OT3B 1U3WA 2ZJ1A 2WIGA 3TLYA 1GGKA 2YNMA 3WNDA 2FA9A 3LT0A 3T3NA 3D7LA 3H83A 1WBBA 5DISB 1YVPA 5FWYB 2X3FA 2RKWA 1D0IA 3K2IA 2XE7A 3MGAA 5AIAA 4EEZA 4RUKA