5BSYA

Crystal structure of gii.10 p domain in complex with lemon juice
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
total genus 71
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsyA01
5HZAA 5F4JA 5IYPA 5IYQA 2OBSA 4RM0A 4RDJA 5IYNA 3Q6QA 4OOXA 5J3OA 4OPVA 3SJPA 5IYRA 4QV2A 4X7FA 4WZEA 3SKBA 4OPOA 4RPBA 5HZBA 4X7CA 4P25A 3ASPA 3V7AA 3ASSA 4P26A 3ONUA 4P2NA 4OP7A 2OBTA 4X7DA 4RPDA 3SLDA 4Z4YA 5BSYA 4P12A 3RY8A 4Z4TA 5IYWA 4P3IA 1IHMA 4QUZA 4Z4SA 3PA2A 4RDKA 5F4OA 4X0CA 3Q3AA 4Z4VA 4Z4WA 4Z4ZA 3Q6RA 4OOVA 4QVJA 3LQEA 3D26A 5E6TA 3PVDA 4QVAA 4WZLA 3Q38A 3LQ6A 4RDLA 4WZTA 3BQJA 3R6KA 4Z4UA 3BY2A 2OBRA 5KW9A 3PUMA 4OPSA 4X06A 3ONYA 5BSXA 4X07A 5F4MA 3ASRA 4X7EA 3ASTA 3R6JA 4RLZA 2ZL5A 2ZL7A 3BY1A 4WZKA 4X05A 3SLNA 4OOSA 3Q39A 4Z4RA 3ASQA 3PA1A 3PUNA 5J35A 4ROXA 2ZL6A 3SEJA 4P1VA
chains in the Genus database with same CATH superfamily
3W2EA 4E0FA 5HZAA 1VQ6B 1A8PA 1OB5A 2BVNA 4B43A 5IYQA 2OBSA 3MMPA 3W5UA 1BMFA 3WQZA 2GK7A 4MYTA 2ZZGA 2X0KA 1ZM9A 3MHPA 4QV2A 3ZZ0A 1P4MA 2BF4A 4M2LA 2J7KA 2PMDA 1KMHA 4RD3A 4RD1A 4XN0A 3WNBA 1QFZA 4WZEA 2BPOA 4XLAA 1KK0A 3GVLA 1E63A 2VBVA 3CRZA 2QEXB 1COWA 4ACBA 2XZLA 4N3NA 1YHQB 3ASSA 1KTVA 2P3MA 3ONUA 3FJOA 4P2NA 4Y9UA 5TRDA 3G71B 1E3XA 2QA4B 1IJFA 1WSRA 1UD2A 4TSFA 2WYRA 4LBWA 1VLYA 4P12A 5KNLA 3GIRA 2JN9A 3RY8A 1G7CA 3A8JA 4EH1A 1GJRA 3GVJA 1G7TA 1OB0A 1NRKA 2ZZQA 3AVUA 3LNNA 2DCUA 4RDKA 1N0VC 3P26A 2GK6A 3E20A 3Q3AA 3VMFA 1QG0A 1QX4A 2DOGA 1IJEA 4Z4WA 3Q6RA 1EWYA 1OHHA 5FO0A 4DQKA 4Z1MA 3JU4A 3CB4A 1E1QA 1V5VA 3G05A 4XOPA 5GV8A 1FNMA 4WZLA 3ZPNA 2X6YA 3LQ6A 3FPPA 1EFUA 5GV7A 4RD6A 5B6IA 1VQLB 3BQJA 3R6KA 3GQBA 2XOKA 1VLOA 4P9SA 1WSVA 2V7QA 2JJ1A 4B47A 4LBYA 1R5OA 4B3GA 4XMYA 4LBZA 1XQBA 2BGIA 3ONYA 1VHOA 3OOCA 2XNJA 4HE6A 3W2GA 4AF6A 3MCAA 1OB2A 1T6ZA 4ZGNB 2C5HA 2V7WA 3CCVB 1SKYB 1EP1B 4G7XA 1K28D 3H9NA 1BX0A 3NE5B 2XNCA 3I1FA 2ZTGA 3BY1A 1YX2A 3CW2A 4X05A 3CC7B 1Q82D 5KSWB 2F4NA 1W87A 3ZC3A 4NNJA 5HXBA 5IK2A 2X85A 2DERA 3BNWA 3CTAA 2OYNA 1D2EA 2C78A 1EFRA 1Q81D 4XKWA 1BJKA 4PC1A 1HA3A 4HIZA 1KK1A 5TV2A 3DDYA 1WTHD 3A8KA 1DDIA 3BCFA 1FRQA 4TMWA 4ROXA 2WZNA 1N08A 2RC5A 4UZFA 2WSSA 1H85A 4K1XA 4QFMA 2BSAA 1BLIA 2VNJA 4KKUA 2QTZA 2Q6LA 3I55B 5DSZA 4RM0A 4PGOA 2V4DA 2VNIA 2QMUA 3OFNA 4ZV4A 2GQFA 2GJRA 4OOXA 4BPRA 1VQ9B 4FWTA 2R6HA 4G1VA 4YEJA 4YXWA 2I1LA 2B7CA 3CCSB 1YJ9B 2YWEA 5H5JA 2BGJA 3CCMB 2ZTNA 4R71A 3U2QA 3CPWB 1PJ6A 4OPOA 5DN6A 3FPKA 1ZM4A 5HZBA 3ASPA 2V31A 3W5HA 1ZM2A 4II2A 1FNDA 1WP6A 4P26A 4AVZA 2CC2A 2VNHA 4TKOB 1KJZA 4GQNA 3SJZA 2OBTA 3VR6A 4X7DA 2BM0A 2C77A 1BPLA 1DARA 2B5OA 4TMXA 2PIAA 4G7WA 3ZIAA 2C4UA 4YAWA 2DY1A 4U9UA 3GSIA 2X8KA 3KL9A 1OGJA 1B2RA 4QUZA 1YIJB 1ELOA 1DDGA 1H42A 4XL9A 4XORA 3PA2A 4WWVA 4RCYA 4XLHA 1VHEA 1NJID 3WBKA 1BX1A 1SM4A 4OOVA 1KD1D 1VQKB 4QVJA 2XZOA 1QGYA 2CF4A 4NBSA 4Q7JB 5E6TA 3W5VA 2B7BA 4TMVA 3W2IA 4J0QA 3OEEA 2QGGA 2PE3A 3CMAB 1JNYA 2VBUA 1T6XA 2XNDA 1E43A 1N07A 4RDLA 3QSYA 1VQNB 1GR1A 2ZXHA 2C5BA 4WZTA 3HAGA 4YALA 1T6YA 4B44A 3CP8A 1KQSB 1GAQA 3KEWA 5KW9A 2X53S 2X3UA 2QN6A 3CP2A 1EXMA 2E1BA 4OPSA 1UD4A 1Y0YA 2ZZEA 2VBSA 1AIPA 3A3GA 4UZEA 2NV4A 2CRVA 1G7SA 4P6VF 1WDTA 2GPJA 5HKKA 3JQRA 1H8EA 4X7EA 3WYAA 3CCUB 4RLZA 4C43A 2CBXA 2W6JA 5THXA 3ZUGA 2VYQA 1W0JA 2FX3A 3OP1A 3OW2B 1UD6A 4WZKA 4TMTA 2WJVA 4ZCLA 1HZEA 5CDFA 1MRZA 1QFYA 3OJWA 2VNKA 1BQEA 3G6EB 2OTJB 3CCLB 3P27A 1TLLA 4L8JA 1FDRA 3QFCA 4II3A 1I7PA 1VQ5B 5A88A 2XEXA 1WU8A 3PUNA 3CMMA 2LZJA 2WJYA 1E62A 1YI2B 5FIUA 3CCJB 1T5EA 2DYIA 4XLEA 5L46A 1S0UA 1D1NA 1AMOA 2D3NA 3BCDA 1GVHA 5AN9A 4DNTB 2DIEA 3T53B 1QVGB 4TN1A 4B3XA 4WQMA 1UD3A 5FNZA 3WBJA 4PAAA 4XONA 1EP3B 5H59A 1UMKA 4YELA 4RDJA 4RCZA 1WPCA 3AVXA 1D8TA 3Q6QA 5J3OA 4OPVA 1NDHA 1IB0A 2Q6OA 1E1RA 2ZBVA 1YITB 3SJPA 3VO1A 4JMQA 3CESA 3U6BA 1DG1G 3VNUA 2WPDA 1VQMB 4X7FA 1MABA 2JJ2A 3JQPA 4Y9RA 2QTLA 2XZPA 1W2BB 1TTTA 4P25A 1G7RA 4X7CA 3T51B 1EP2B 3V76A 1FRNA 2GJPA 4XLFA 4Y7CA 1E79A 3CXCB 3VNVA 1CNEA 2EFGA 4C0SA 4DQLA 4RPDA 3SLDA 2JIZA 3OW7A 5FL7A 2VJJA 1PKVA 1WOOA 2GREA 4Z4TA 1K73D 2BMWA 1OGIA 2HLDA 1IHMA 4P3IA 3CCQB 2V7UA 1JB9A 4M53A 4B4DA 1Q7YD 2PLFA 3AGPA 4FN5A 3W2FA 3JQQA 1I8DA 2HMAA 3BH4A 1XB2A 1V0EA 1TUIA 4RD0A 1N06A 1K8AD 3AVYA 4X0CA 3WNCA 4Z4ZA 3W2HA 4XM3A 2Z6BD 3I56B 2RC6A 4XD7A 3LQEA 3AGQA 1Q86D 4LC0A 1W35A 2Q6IA 3AVVA 3U6KA 3CMEB 1EFCA 2QDXA 2ZBUA 4XLCA 1PJ5A 4XKVA 3Q38A 4YAUA 4ASUA 2X6XA 1N05A 4XR6A 3A8IA 2BN4A 3OPOA 2GJKA 1S4MA 3LO8A 3BY2A 1B23P 2OBRA 1I18A 2WZPP 4DK0A 3PUMA 5FA6A 4UZUA 4X06A 3ISXA 2YWGA 4YAOA 2ZITA 4X07A 1XE1A 2F43A 4FK8A 4CQJA 5FO1A 3AVTA 4M4SA 3B82A 3ASTA 1F60A 5EMNA 1H8HA 1QGAA 1R5BA 4FXUA 1EFTA 5A8AA 2ZL5A 3CCEB 5A89A 1KK2A 3ZBTA 3OAAA 2R9VA 3SLNA 1WOPA 2AHOA 3B8HA 4G1BA 1M90D 1YLOA 3ZZUA 4OOSA 2VBTA 1WORA 4RJLA 3OE7A 1N8RD 1JA1A 3A35A 3ASQA 4PC7A 4Z4RA 1QUEA 4H9GA 4NCNA 4UAJA 2YWFA 2OK8A 2ZL6A 2X6WA 1W9XA 1J9ZA 1SKQA 1RQPA 2VJIA 4P1VA 1GAWA 1KC8D 3AVWA 1RQRA 4YHBA 3OZWA 4X8IA 5F4JA 5IYPA 1QUFA 1R5NA 3CCRB 2E1RA 1W34A 2Q6KA 5IYNA 2YWHA 3H94A 4PC6A 1JA0A 2KVOA 2HDNB 1Y0RA 5DS0A 3QFTA 5IYRA 2ZXIA 3CC2B 1N0UA 3E1YE 1ZM3A 1U2RA 4DNRB 1F20A 1JJ2B 4P6YA 3OKXA 4B3FX 3WXMA 2WR8A 3SKBA 1K9MD 1FX0A 1KRHA 4RPBA 3WY9A 1VJSA 2NPFA 2CW5A 3V7AA 4M0LA 4AC9A 3BC9A 1FNCA 2F1LA 4OP7A 4P3YA 1NB0A 4Z4YA 1UD5A 2C2WA 1VQOB 1ZUNB 1E3ZA 2BV3A 4XN3A 1UD8A 5BSYA 1M1KD 1Q9SA 3FKSA 5TR9A 5IYWA 4P22A 3CD6B 1VQ7B 2D9RA 1KK3A 4N3GA 4Z4SA 3OZUA 1XFOA 1TVCA 4YAFA 2V7VA 2EIXA 4TMZA 4RD2A 1QH0A 5F4OA 1V0FA 4Z4VA 2JDIA 1GO2A 2QE7A 5TY0A 1PJ7A 4QHYA 3ZBUA 1VF7A 3D26A 1S72B 1QGZA 4DK1A 3PVDA 4M1KA 3A1PA 4PC3A 1FNBA 2FVGA 4QVAA 4ACAA 2ZZFA 2D74A 2OTLB 4PABA 3J81k 4MYUA 3ES9A 3GVKA 4Z4UA 1VQPB 4G5GA 1VQ8B 4ZCMA 3OJXA 4XNFA 1NB9A 2VZLA 3CPXA 3VO2A 1KZLA 2CNDA 4PC2A 1E64A 2DEUA 4ZCIA 2OK7A 2W6IA 1CNFA 4AF7A 3CC4B 4XOTA 4F7DA 5BSXA 3QFSA 3A3BA 3WNDA 5F4MA 1CQXA 3ASRA 3R6JA 1QFJA 1W0KA 1WOSA 4KKSA 2V7XA 1VQ4B 3T56B 2XGJA 3G4SB 3LVBA 2ZL7A 1HVXA 4IW3B 3QE2A 4LBVA 4HE5A 2DETA 4G6IA 3Q39A 3PENA 4RD4A 5JBQA 4TT3A 4KKTA 3B78A 2C4TA 3PA1A 2F1MA 4B48A 2BM1A 5J35A 1NBMA 2HCJB 4XQFA 1YJWB 3OEHA 2D3LA 1YJNB 2M5SA 3QFRA 2CK3A 2V7TA 3SEJA 1QVFB 3OZVA 5LMZA 4ZGQB 3ZZTA
chains in the Genus database with same CATH topology
5HZAA 5F4JA 5IYPA 5IYQA 2OBSA 4RM0A 4RDJA 5IYNA 3Q6QA 4OOXA 5J3OA 4OPVA 3SJPA 5IYRA 4QV2A 4X7FA 4WZEA 3SKBA 4OPOA 4RPBA 5HZBA 4X7CA 4P25A 3ASPA 3V7AA 3ASSA 4P26A 3ONUA 4P2NA 4OP7A 2OBTA 4X7DA 4RPDA 3SLDA 4Z4YA 5BSYA 4P12A 3RY8A 4Z4TA 5IYWA 4P3IA 1IHMA 4QUZA 4Z4SA 3PA2A 4RDKA 5F4OA 4X0CA 3Q3AA 4Z4VA 4Z4WA 4Z4ZA 3Q6RA 4OOVA 4QVJA 3LQEA 3D26A 5E6TA 3PVDA 4QVAA 4WZLA 3Q38A 3LQ6A 4RDLA 4WZTA 3BQJA 3R6KA 4Z4UA 3BY2A 2OBRA 5KW9A 3PUMA 4OPSA 4X06A 3ONYA 5BSXA 4X07A 5F4MA 3ASRA 4X7EA 3ASTA 3R6JA 4RLZA 2ZL5A 2ZL7A 3BY1A 4WZKA 4X05A 3SLNA 4OOSA 3Q39A 4Z4RA 3ASQA 3PA1A 3PUNA 5J35A 4ROXA 2ZL6A 3SEJA 4P1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HZA A;  5F4J A;  5IYP A;  5IYQ A;  2OBS A;  4RM0 A;  4RDJ A;  5IYN A;  3Q6Q A;  4OOX A;  5J3O A;  4OPV A;  3SJP A;  5IYR A;  4QV2 A;  4X7F A;  4WZE A;  3SKB A;  4OPO A;  4RPB A;  5HZB A;  4X7C A;  4P25 A;  3ASP A;  3V7A A;  3ASS A;  4P26 A;  3ONU A;  4P2N A;  4OP7 A;  2OBT A;  4X7D A;  4RPD A;  3SLD A;  4Z4Y A;  5BSY A;  4P12 A;  3RY8 A;  4Z4T A;  5IYW A;  4P3I A;  1IHM A;  4QUZ A;  4Z4S A;  3PA2 A;  4RDK A;  5F4O A;  4X0C A;  3Q3A A;  4Z4V A;  4Z4W A;  4Z4Z A;  3Q6R A;  4OOV A;  4QVJ A;  3LQE A;  3D26 A;  5E6T A;  3PVD A;  4QVA A;  4WZL A;  3Q38 A;  3LQ6 A;  4RDL A;  4WZT A;  3BQJ A;  3R6K A;  4Z4U A;  3BY2 A;  2OBR A;  5KW9 A;  3PUM A;  4OPS A;  4X06 A;  3ONY A;  5BSX A;  4X07 A;  5F4M A;  3ASR A;  4X7E A;  3AST A;  3R6J A;  4RLZ A;  2ZL5 A;  2ZL7 A;  3BY1 A;  4WZK A;  4X05 A;  3SLN A;  4OOS A;  3Q39 A;  4Z4R A;  3ASQ A;  3PA1 A;  3PUN A;  5J35 A;  4ROX A;  2ZL6 A;  3SEJ A;  4P1V A; 
#chains in the Genus database with same CATH topology
 3W2E A;  4E0F A;  5HZA A;  1VQ6 B;  1A8P A;  1OB5 A;  2BVN A;  4B43 A;  5IYQ A;  2OBS A;  3MMP A;  3W5U A;  1BMF A;  3WQZ A;  2GK7 A;  4MYT A;  2ZZG A;  2X0K A;  1ZM9 A;  3MHP A;  4QV2 A;  3ZZ0 A;  1P4M A;  2BF4 A;  4M2L A;  2J7K A;  2PMD A;  1KMH A;  4RD3 A;  4RD1 A;  4XN0 A;  3WNB A;  1QFZ A;  4WZE A;  2BPO A;  4XLA A;  1KK0 A;  3GVL A;  1E63 A;  2VBV A;  3CRZ A;  2QEX B;  1COW A;  4ACB A;  2XZL A;  4N3N A;  1YHQ B;  3ASS A;  1KTV A;  2P3M A;  3ONU A;  3FJO A;  4P2N A;  4Y9U A;  5TRD A;  3G71 B;  1E3X A;  2QA4 B;  1IJF A;  1WSR A;  1UD2 A;  4TSF A;  2WYR A;  4LBW A;  1VLY A;  4P12 A;  5KNL A;  3GIR A;  2JN9 A;  3RY8 A;  1G7C A;  3A8J A;  4EH1 A;  1GJR A;  3GVJ A;  1G7T A;  1OB0 A;  1NRK A;  2ZZQ A;  3AVU A;  3LNN A;  2DCU A;  4RDK A;  1N0V C;  3P26 A;  2GK6 A;  3E20 A;  3Q3A A;  3VMF A;  1QG0 A;  1QX4 A;  2DOG A;  1IJE A;  4Z4W A;  3Q6R A;  1EWY A;  1OHH A;  5FO0 A;  4DQK A;  4Z1M A;  3JU4 A;  3CB4 A;  1E1Q A;  1V5V A;  3G05 A;  4XOP A;  5GV8 A;  1FNM A;  4WZL A;  3ZPN A;  2X6Y A;  3LQ6 A;  3FPP A;  1EFU A;  5GV7 A;  4RD6 A;  5B6I A;  1VQL B;  3BQJ A;  3R6K A;  3GQB A;  2XOK A;  1VLO A;  4P9S A;  1WSV A;  2V7Q A;  2JJ1 A;  4B47 A;  4LBY A;  1R5O A;  4B3G A;  4XMY A;  4LBZ A;  1XQB A;  2BGI A;  3ONY A;  1VHO A;  3OOC A;  2XNJ A;  4HE6 A;  3W2G A;  4AF6 A;  3MCA A;  1OB2 A;  1T6Z A;  4ZGN B;  2C5H A;  2V7W A;  3CCV B;  1SKY B;  1EP1 B;  4G7X A;  1K28 D;  3H9N A;  1BX0 A;  3NE5 B;  2XNC A;  3I1F A;  2ZTG A;  3BY1 A;  1YX2 A;  3CW2 A;  4X05 A;  3CC7 B;  1Q82 D;  5KSW B;  2F4N A;  1W87 A;  3ZC3 A;  4NNJ A;  5HXB A;  5IK2 A;  2X85 A;  2DER A;  3BNW A;  3CTA A;  2OYN A;  1D2E A;  2C78 A;  1EFR A;  1Q81 D;  4XKW A;  1BJK A;  4PC1 A;  1HA3 A;  4HIZ A;  1KK1 A;  5TV2 A;  3DDY A;  1WTH D;  3A8K A;  1DDI A;  3BCF A;  1FRQ A;  4TMW A;  4ROX A;  2WZN A;  1N08 A;  2RC5 A;  4UZF A;  2WSS A;  1H85 A;  4K1X A;  4QFM A;  2BSA A;  1BLI A;  2VNJ A;  4KKU A;  2QTZ A;  2Q6L A;  3I55 B;  5DSZ A;  4RM0 A;  4PGO A;  2V4D A;  2VNI A;  2QMU A;  3OFN A;  4ZV4 A;  2GQF A;  2GJR A;  4OOX A;  4BPR A;  1VQ9 B;  4FWT A;  2R6H A;  4G1V A;  4YEJ A;  4YXW A;  2I1L A;  2B7C A;  3CCS B;  1YJ9 B;  2YWE A;  5H5J A;  2BGJ A;  3CCM B;  2ZTN A;  4R71 A;  3U2Q A;  3CPW B;  1PJ6 A;  4OPO A;  5DN6 A;  3FPK A;  1ZM4 A;  5HZB A;  3ASP A;  2V31 A;  3W5H A;  1ZM2 A;  4II2 A;  1FND A;  1WP6 A;  4P26 A;  4AVZ A;  2CC2 A;  2VNH A;  4TKO B;  1KJZ A;  4GQN A;  3SJZ A;  2OBT A;  3VR6 A;  4X7D A;  2BM0 A;  2C77 A;  1BPL A;  1DAR A;  2B5O A;  4TMX A;  2PIA A;  4G7W A;  3ZIA A;  2C4U A;  4YAW A;  2DY1 A;  4U9U A;  3GSI A;  2X8K A;  3KL9 A;  1OGJ A;  1B2R A;  4QUZ A;  1YIJ B;  1ELO A;  1DDG A;  1H42 A;  4XL9 A;  4XOR A;  3PA2 A;  4WWV A;  4RCY A;  4XLH A;  1VHE A;  1NJI D;  3WBK A;  1BX1 A;  1SM4 A;  4OOV A;  1KD1 D;  1VQK B;  4QVJ A;  2XZO A;  1QGY A;  2CF4 A;  4NBS A;  4Q7J B;  5E6T A;  3W5V A;  2B7B A;  4TMV A;  3W2I A;  4J0Q A;  3OEE A;  2QGG A;  2PE3 A;  3CMA B;  1JNY A;  2VBU A;  1T6X A;  2XND A;  1E43 A;  1N07 A;  4RDL A;  3QSY A;  1VQN B;  1GR1 A;  2ZXH A;  2C5B A;  4WZT A;  3HAG A;  4YAL A;  1T6Y A;  4B44 A;  3CP8 A;  1KQS B;  1GAQ A;  3KEW A;  5KW9 A;  2X53 S;  2X3U A;  2QN6 A;  3CP2 A;  1EXM A;  2E1B A;  4OPS A;  1UD4 A;  1Y0Y A;  2ZZE A;  2VBS A;  1AIP A;  3A3G A;  4UZE A;  2NV4 A;  2CRV A;  1G7S A;  4P6V F;  1WDT A;  2GPJ A;  5HKK A;  3JQR A;  1H8E A;  4X7E A;  3WYA A;  3CCU B;  4RLZ A;  4C43 A;  2CBX A;  2W6J A;  5THX A;  3ZUG A;  2VYQ A;  1W0J A;  2FX3 A;  3OP1 A;  3OW2 B;  1UD6 A;  4WZK A;  4TMT A;  2WJV A;  4ZCL A;  1HZE A;  5CDF A;  1MRZ A;  1QFY A;  3OJW A;  2VNK A;  1BQE A;  3G6E B;  2OTJ B;  3CCL B;  3P27 A;  1TLL A;  4L8J A;  1FDR A;  3QFC A;  4II3 A;  1I7P A;  1VQ5 B;  5A88 A;  2XEX A;  1WU8 A;  3PUN A;  3CMM A;  2LZJ A;  2WJY A;  1E62 A;  1YI2 B;  5FIU A;  3CCJ B;  1T5E A;  2DYI A;  4XLE A;  5L46 A;  1S0U A;  1D1N A;  1AMO A;  2D3N A;  3BCD A;  1GVH A;  5AN9 A;  4DNT B;  2DIE A;  3T53 B;  1QVG B;  4TN1 A;  4B3X A;  4WQM A;  1UD3 A;  5FNZ A;  3WBJ A;  4PAA A;  4XON A;  1EP3 B;  5H59 A;  1UMK A;  4YEL A;  4RDJ A;  4RCZ A;  1WPC A;  3AVX A;  1D8T A;  3Q6Q A;  5J3O A;  4OPV A;  1NDH A;  1IB0 A;  2Q6O A;  1E1R A;  2ZBV A;  1YIT B;  3SJP A;  3VO1 A;  4JMQ A;  3CES A;  3U6B A;  1DG1 G;  3VNU A;  2WPD A;  1VQM B;  4X7F A;  1MAB A;  2JJ2 A;  3JQP A;  4Y9R A;  2QTL A;  2XZP A;  1W2B B;  1TTT A;  4P25 A;  1G7R A;  4X7C A;  3T51 B;  1EP2 B;  3V76 A;  1FRN A;  2GJP A;  4XLF A;  4Y7C A;  1E79 A;  3CXC B;  3VNV A;  1CNE A;  2EFG A;  4C0S A;  4DQL A;  4RPD A;  3SLD A;  2JIZ A;  3OW7 A;  5FL7 A;  2VJJ A;  1PKV A;  1WOO A;  2GRE A;  4Z4T A;  1K73 D;  2BMW A;  1OGI A;  2HLD A;  1IHM A;  4P3I A;  3CCQ B;  2V7U A;  1JB9 A;  4M53 A;  4B4D A;  1Q7Y D;  2PLF A;  3AGP A;  4FN5 A;  3W2F A;  3JQQ A;  1I8D A;  2HMA A;  3BH4 A;  1XB2 A;  1V0E A;  1TUI A;  4RD0 A;  1N06 A;  1K8A D;  3AVY A;  4X0C A;  3WNC A;  4Z4Z A;  3W2H A;  4XM3 A;  2Z6B D;  3I56 B;  2RC6 A;  4XD7 A;  3LQE A;  3AGQ A;  1Q86 D;  4LC0 A;  1W35 A;  2Q6I A;  3AVV A;  3U6K A;  3CME B;  1EFC A;  2QDX A;  2ZBU A;  4XLC A;  1PJ5 A;  4XKV A;  3Q38 A;  4YAU A;  4ASU A;  2X6X A;  1N05 A;  4XR6 A;  3A8I A;  2BN4 A;  3OPO A;  2GJK A;  1S4M A;  3LO8 A;  3BY2 A;  1B23 P;  2OBR A;  1I18 A;  2WZP P;  4DK0 A;  3PUM A;  5FA6 A;  4UZU A;  4X06 A;  3ISX A;  2YWG A;  4YAO A;  2ZIT A;  4X07 A;  1XE1 A;  2F43 A;  4FK8 A;  4CQJ A;  5FO1 A;  3AVT A;  4M4S A;  3B82 A;  3AST A;  1F60 A;  5EMN A;  1H8H A;  1QGA A;  1R5B A;  4FXU A;  1EFT A;  5A8A A;  2ZL5 A;  3CCE B;  5A89 A;  1KK2 A;  3ZBT A;  3OAA A;  2R9V A;  3SLN A;  1WOP A;  2AHO A;  3B8H A;  4G1B A;  1M90 D;  1YLO A;  3ZZU A;  4OOS A;  2VBT A;  1WOR A;  4RJL A;  3OE7 A;  1N8R D;  1JA1 A;  3A35 A;  3ASQ A;  4PC7 A;  4Z4R A;  1QUE A;  4H9G A;  4NCN A;  4UAJ A;  2YWF A;  2OK8 A;  2ZL6 A;  2X6W A;  1W9X A;  1J9Z A;  1SKQ A;  1RQP A;  2VJI A;  4P1V A;  1GAW A;  1KC8 D;  3AVW A;  1RQR A;  4YHB A;  3OZW A;  4X8I A;  5F4J A;  5IYP A;  1QUF A;  1R5N A;  3CCR B;  2E1R A;  1W34 A;  2Q6K A;  5IYN A;  2YWH A;  3H94 A;  4PC6 A;  1JA0 A;  2KVO A;  2HDN B;  1Y0R A;  5DS0 A;  3QFT A;  5IYR A;  2ZXI A;  3CC2 B;  1N0U A;  3E1Y E;  1ZM3 A;  1U2R A;  4DNR B;  1F20 A;  1JJ2 B;  4P6Y A;  3OKX A;  4B3F X;  3WXM A;  2WR8 A;  3SKB A;  1K9M D;  1FX0 A;  1KRH A;  4RPB A;  3WY9 A;  1VJS A;  2NPF A;  2CW5 A;  3V7A A;  4M0L A;  4AC9 A;  3BC9 A;  1FNC A;  2F1L A;  4OP7 A;  4P3Y A;  1NB0 A;  4Z4Y A;  1UD5 A;  2C2W A;  1VQO B;  1ZUN B;  1E3Z A;  2BV3 A;  4XN3 A;  1UD8 A;  5BSY A;  1M1K D;  1Q9S A;  3FKS A;  5TR9 A;  5IYW A;  4P22 A;  3CD6 B;  1VQ7 B;  2D9R A;  1KK3 A;  4N3G A;  4Z4S A;  3OZU A;  1XFO A;  1TVC A;  4YAF A;  2V7V A;  2EIX A;  4TMZ A;  4RD2 A;  1QH0 A;  5F4O A;  1V0F A;  4Z4V A;  2JDI A;  1GO2 A;  2QE7 A;  5TY0 A;  1PJ7 A;  4QHY A;  3ZBU A;  1VF7 A;  3D26 A;  1S72 B;  1QGZ A;  4DK1 A;  3PVD A;  4M1K A;  3A1P A;  4PC3 A;  1FNB A;  2FVG A;  4QVA A;  4ACA A;  2ZZF A;  2D74 A;  2OTL B;  4PAB A;  3J81 k;  4MYU A;  3ES9 A;  3GVK A;  4Z4U A;  1VQP B;  4G5G A;  1VQ8 B;  4ZCM A;  3OJX A;  4XNF A;  1NB9 A;  2VZL A;  3CPX A;  3VO2 A;  1KZL A;  2CND A;  4PC2 A;  1E64 A;  2DEU A;  4ZCI A;  2OK7 A;  2W6I A;  1CNF A;  4AF7 A;  3CC4 B;  4XOT A;  4F7D A;  5BSX A;  3QFS A;  3A3B A;  3WND A;  5F4M A;  1CQX A;  3ASR A;  3R6J A;  1QFJ A;  1W0K A;  1WOS A;  4KKS A;  2V7X A;  1VQ4 B;  3T56 B;  2XGJ A;  3G4S B;  3LVB A;  2ZL7 A;  1HVX A;  4IW3 B;  3QE2 A;  4LBV A;  4HE5 A;  2DET A;  4G6I A;  3Q39 A;  3PEN A;  4RD4 A;  5JBQ A;  4TT3 A;  4KKT A;  3B78 A;  2C4T A;  3PA1 A;  2F1M A;  4B48 A;  2BM1 A;  5J35 A;  1NBM A;  2HCJ B;  4XQF A;  1YJW B;  3OEH A;  2D3L A;  1YJN B;  2M5S A;  3QFR A;  2CK3 A;  2V7T A;  3SEJ A;  1QVF B;  3OZV A;  5LMZ A;  4ZGQ B;  3ZZT A; 
#chains in the Genus database with same CATH homology
 5HZA A;  5F4J A;  5IYP A;  5IYQ A;  2OBS A;  4RM0 A;  4RDJ A;  5IYN A;  3Q6Q A;  4OOX A;  5J3O A;  4OPV A;  3SJP A;  5IYR A;  4QV2 A;  4X7F A;  4WZE A;  3SKB A;  4OPO A;  4RPB A;  5HZB A;  4X7C A;  4P25 A;  3ASP A;  3V7A A;  3ASS A;  4P26 A;  3ONU A;  4P2N A;  4OP7 A;  2OBT A;  4X7D A;  4RPD A;  3SLD A;  4Z4Y A;  5BSY A;  4P12 A;  3RY8 A;  4Z4T A;  5IYW A;  4P3I A;  1IHM A;  4QUZ A;  4Z4S A;  3PA2 A;  4RDK A;  5F4O A;  4X0C A;  3Q3A A;  4Z4V A;  4Z4W A;  4Z4Z A;  3Q6R A;  4OOV A;  4QVJ A;  3LQE A;  3D26 A;  5E6T A;  3PVD A;  4QVA A;  4WZL A;  3Q38 A;  3LQ6 A;  4RDL A;  4WZT A;  3BQJ A;  3R6K A;  4Z4U A;  3BY2 A;  2OBR A;  5KW9 A;  3PUM A;  4OPS A;  4X06 A;  3ONY A;  5BSX A;  4X07 A;  5F4M A;  3ASR A;  4X7E A;  3AST A;  3R6J A;  4RLZ A;  2ZL5 A;  2ZL7 A;  3BY1 A;  4WZK A;  4X05 A;  3SLN A;  4OOS A;  3Q39 A;  4Z4R A;  3ASQ A;  3PA1 A;  3PUN A;  5J35 A;  4ROX A;  2ZL6 A;  3SEJ A;  4P1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...