5BSYA

Crystal structure of gii.10 p domain in complex with lemon juice
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
310
Chain Sequence
b'KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 71
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsyA01
4OOVA 4WZEA 5IYRA 4Z4WA 4X06A 4X0CA 3SLDA 5J3OA 5IYNA 4P3IA 4P25A 3SJPA 5F4OA 1IHMA 4QVAA 3ASSA 4Z4RA 4Z4SA 3PUNA 3BY1A 3D26A 3ONUA 5IYQA 5BSYA 3ASQA 4X7DA 3R6JA 4OP7A 5E6TA 4Z4TA 5BSXA 2OBSA 3Q3AA 5HZBA 4P2NA 4OPOA 5J35A 3ASTA 3PA1A 5IYPA 4RDJA 4Z4UA 4QVJA 2ZL7A 5KW9A 4P12A 4X07A 4QUZA 4OOSA 2OBRA 4RDLA 4RLZA 4ROXA 4RPDA 4X7FA 4OOXA 3BY2A 4X05A 4P26A 4X7CA 3SLNA 3R6KA 4OPVA 4WZTA 5HZAA 3PUMA 3Q38A 3Q6RA 4X7EA 5F4MA 3V7AA 3LQ6A 3ONYA 4QV2A 4Z4ZA 4WZKA 5IYWA 3LQEA 3SKBA 4WZLA 3Q39A 4OPSA 2ZL6A 3PVDA 4Z4VA 3SEJA 4RPBA 5F4JA 4RM0A 3RY8A 3Q6QA 3ASRA 3PA2A 4RDKA 3BQJA 2ZL5A 2OBTA 4Z4YA 4P1VA 3ASPA
chains in the Genus database with same CATH superfamily
1WOSA 2ZTGA 2X53S 2GPJA 2V7WA 4OOVA 1UD6A 2QTZA 2JJ1A 1VQ4B 2GK6A 1N08A 1M90D 5GV8A 4QHYA 1NB9A 4YEJA 3QSYA 5KSWB 3WXMA 4FWTA 1CNEA 1KZLA 4X06A 4RD4A 3ZUGA 2X8KA 1HZEA 4XKVA 1EP2B 1T6ZA 1XFOA 4AVZA 2QEXB 3SJPA 2VJJA 3W2FA 2D74A 3OPOA 1FRQA 2BN4A 1EP1B 3AVXA 4P9SA 3W5UA 3CMEB 1GAQA 4TMTA 3CXCB 2D3LA 2HCJB 5HXBA 2R9VA 3CPXA 3JU4A 3W5HA 1OGJA 1V0EA 2X6YA 3ZBTA 4R71A 2JN9A 3ONUA 1Y0YA 5BSYA 4X7DA 1Q86D 1YJWB 2DERA 5EMNA 1BLIA 1FNCA 4B3FX 3W2EA 4C43A 3DDYA 4AF6A 4TSFA 2BVNA 5A89A 4KKTA 4P22A 2OBSA 3QFRA 5TY0A 4ZV4A 5HZBA 3FPKA 4N3GA 4P2NA 4K1XA 1J9ZA 1EP3B 4OPOA 5J35A 1Q9SA 2CW5A 2QN6A 3ASTA 3JQRA 4M1KA 1OHHA 4FK8A 4LBVA 4Y9RA 1QVGB 4RD3A 4G6IA 5DN6A 3VR6A 1DDGA 3CMAB 1BX1A 2BM1A 3AGQA 5LMZA 5A88A 2ZZQA 2XZOA 3CCRB 3CC4B 3A8IA 5H5JA 4KKSA 1QUEA 4GQNA 2CC2A 4RDLA 2WR8A 3BNWA 3CCEB 1T5EA 2C5HA 4ROXA 3GVKA 2Q6OA 3OJXA 1WDTA 3H94A 3OEHA 4OOXA 4P26A 1UD8A 3OFNA 3CCMB 1AIPA 1WOPA 4YHBA 4ACAA 3AVWA 1E3XA 2WJYA 4X7EA 3OEEA 3CC2B 4N3NA 4RD1A 4CQJA 1E3ZA 5FL7A 1K9MD 1NBMA 1R5NA 3MMPA 4XORA 4Z4ZA 1EFUA 2PLFA 5AN9A 2C77A 2JDIA 3LQEA 4YALA 3SJZA 4XKWA 1UD3A 3Q39A 3W2GA 1S0UA 4OPSA 3OZWA 2J7KA 5THXA 5F4JA 2B5OA 1UMKA 2F4NA 1GJRA 1A8PA 3ASRA 5CDFA 2GJPA 1W9XA 4YAUA 3OE7A 4PC7A 2ZL5A 2DOGA 2XGJA 3WBKA 3CB4A 3CMMA 4P1VA 1CQXA 4II3A 2E1BA 1QX4A 4PC3A 3ZPNA 1WPCA 4DQKA 1QUFA 1B2RA 3ZC3A 1S72B 3H9NA 1N07A 1QFYA 3KEWA 1EFTA 3AVUA 2PMDA 4Y9UA 2DY1A 3ZBUA 4ASUA 2FVGA 3B8HA 1QGYA 2F1LA 2B7BA 1UD5A 4XLEA 5IYRA 1H8HA 1MRZA 1FNMA 3CD6B 2XNCA 4TT3A 1N0UA 5J3OA 3OJWA 4XQFA 4PC6A 1DARA 3CP2A 1Y0RA 5FO0A 4QVAA 2BMWA 3WYAA 3WNDA 2XZLA 4Z4RA 3AVVA 3T56B 3QFTA 3FJOA 4M0LA 4RD0A 4M2LA 4TMZA 3G6EB 2NV4A 3NE5B 3VO1A 5IYQA 3ASQA 2F43A 1WORA 1HVXA 4WWVA 3GVLA 1E62A 4G1BA 3QFCA 4OP7A 1SM4A 1I8DA 3CW2A 5L46A 1IJEA 4UZUA 3BCDA 3OW2B 2V7UA 1H42A 4DNTB 4B47A 3I55B 3Q3AA 4TKOB 2QDXA 1GAWA 3PA1A 5IYPA 1WU8A 3BCFA 2JIZA 4Z4UA 4J0QA 2CBXA 1BQEA 1E79A 1KK2A 4RCYA 3I1FA 1QGZA 1KC8D 4Z1MA 1GVHA 4DNRB 2W6IA 3OZUA 1NRKA 1EFCA 1R5BA 1GR1A 1NB0A 1DDIA 1E43A 4XONA 1YI2B 3CCVB 3GSIA 4RLZA 1EWYA 1B23P 1JNYA 3JQPA 1IB0A 3VMFA 2OTLB 1E1QA 2XNJA 1GO2A 3SLNA 1BX0A 1T6YA 2YWHA 4B3GA 3CCUB 3PUMA 3Q6RA 1VQKB 4C0SA 2ZZGA 2X3UA 1G7SA 1F60A 2PE3A 3V7AA 1KD1D 3MCAA 3LQ6A 3PENA 2DCUA 2DETA 3ONYA 3U6BA 4WQMA 3LNNA 1N8RD 2C5BA 2EIXA 2QTLA 3OAAA 4TMXA 1Q81D 2C4TA 2WSSA 1Q82D 4WZKA 2D3NA 4PC2A 2DYIA 4P3YA 1Q7YD 1KQSB 2RC6A 1D1NA 2M5SA 3T53B 4XN0A 3LO8A 1ZM4A 4Z4VA 4KKUA 2OK7A 2GREA 3BC9A 4RCZA 4XOPA 3G4SB 1NDHA 1RQPA 4UZFA 3CCQB 1ZM9A 4RDKA 2OYNA 4PGOA 3OZVA 1W87A 1VQ9B 2HLDA 3G71B 3BQJA 3CCJB 4G1VA 1ZUNB 2QMUA 1K28D 3I56B 2XEXA 1V5VA 2QA4B 4DK1A 1P4MA 4TMVA 2OBTA 3T51B 1VQMB 1FX0A 1VLYA 4P6YA 3AVTA 1VQNB 2YWGA 1FRNA 4XLAA 1YJ9B 4NCNA 4E0FA 3CC7B 4X8IA 1VQ5B 1SKQA 1E64A 1YLOA 4H9GA 2JJ2A 4WZEA 1PJ7A 4Z4WA 1E1RA 2CK3A 1KMHA 4YAWA 1N05A 2P3MA 2HDNB 3SLDA 5IYNA 2X6WA 4P3IA 3ISXA 1D8TA 1D2EA 3WNCA 2EFGA 1AMOA 4XN3A 4B4DA 2Z6BD 3W2IA 3ZIAA 1VQ8B 4G5GA 3PUNA 1W34A 1ELOA 2VBVA 3BY1A 3OOCA 3CESA 1G7CA 3A8JA 4XD7A 3ZZTA 1FNBA 1S4MA 3R6JA 4XLFA 2X6XA 1G7TA 1XE1A 4Z4TA 2GQFA 5BSXA 5KNLA 2BV3A 1XQBA 1BPLA 3U6KA 3GVJA 3KL9A 1V0FA 4U9UA 2CF4A 3BH4A 2CNDA 5FNZA 2XOKA 2VBUA 1KRHA 1QH0A 5DS0A 1VQ7B 4RDJA 2X85A 1PJ5A 1UD2A 3E20A 2BF4A 2YWEA 4B43A 4P12A 1YHQB 1VQPB 4B44A 2WYRA 1JA0A 4P6VF 4TN1A 1OB2A 2OBRA 4TMWA 4UZEA 4ZCLA 5H59A 1F20A 3A3BA 3OP1A 4FN5A 1VHOA 2V31A 2NPFA 1TUIA 2DIEA 4X05A 1QGAA 3LVBA 3R6KA 1WTHD 3QE2A 5HKKA 4WZTA 1XB2A 4NBSA 3Q38A 1I7PA 4XOTA 1KK0A 2BGJA 1IJFA 4MYUA 5FO1A 5FA6A 1H8EA 5GV7A 4AC9A 2I1LA 4FXUA 4M53A 4BPRA 4QV2A 2VNJA 2Q6KA 4YELA 4B48A 2DEUA 4II2A 4LBWA 2C4UA 1KK3A 2F1MA 2VBSA 5IYWA 1YIJB 4WZLA 4HIZA 2ZXIA 4RD6A 2ZL6A 1VF7A 2BGIA 5JBQA 4RPBA 3WBJA 3GIRA 3AVYA 1BMFA 3WQZA 3RY8A 2V7TA 2VNKA 3Q6QA 1WSRA 1W35A 4RJLA 1WSVA 2WJVA 3PA2A 4NNJA 3VNVA 3AGPA 4B3XA 3E1YE 3CPWB 1N06A 4M4SA 3WNBA 3A8KA 2BPOA 1KTVA 1PJ6A 4Z4YA 1SKYB 2GJRA 3CRZA 1VQLB 1JB9A 1JA1A 5TV2A 2XZPA 3ZZUA 1W0JA 4EH1A 5DSZA 4XNFA 3A3GA 4ZCMA 4YXWA 2WZPP 4ACBA 1WP6A 2V7QA 1W2BB 4AF7A 3HAGA 4HE5A 3A1PA 1HA3A 1CNFA 4X0CA 1QG0A 2ZXHA 2GK7A 2QGGA 3G05A 4P25A 2YWFA 1QFZA 2LZJA 1NJID 1N0VC 2VJIA 2V4DA 2ZBUA 5F4OA 3MHPA 4PAAA 5TR9A 1ZM2A 1IHMA 1COWA 1FNDA 3ASSA 1YX2A 4Z4SA 4DQLA 2ZBVA 5TRDA 3W2HA 1YITB 3D26A 1TLLA 2VBTA 1K73D 1T6XA 3P27A 3U2QA 3CCLB 1MABA 4G7WA 1I18A 5E6TA 3A35A 4HE6A 2E1RA 4ZGQB 2OTJB 3FPPA 4G7XA 4RD2A 2Q6LA 5B6IA 1JJ2B 3CTAA 3VO2A 1W0KA 1BJKA 3CP8A 2XNDA 3ES9A 2V7VA 2BSAA 2VYQA 4MYTA 1KK1A 1TVCA 4QVJA 2D9RA 2ZL7A 2KVOA 4UAJA 4L8JA 4XR6A 4F7DA 1RQRA 3ZZ0A 5KW9A 4PC1A 1M1KD 4X07A 4XLCA 1VHEA 3OW7A 4QUZA 1OGIA 4LBZA 2VNHA 3J81k 4XL9A 4OOSA 1EFRA 2HMAA 2C78A 4IW3B 5FIUA 4LBYA 3CCSB 2VZLA 2AHOA 1OB0A 1PKVA 1VJSA 2Q6IA 4RPDA 4X7FA 1VQ6B 2B7CA 3W5VA 4XLHA 1OB5A 3BY2A 4X7CA 1E63A 1EXMA 4OPVA 3V76A 1YJNB 4ZGNB 2ZZFA 5HZAA 1ZM3A 2W6JA 1G7RA 5F4MA 1DG1G 1U2RA 1QVFB 2BM0A 2C2WA 2X0KA 2GJKA 2FX3A 4LC0A 4QFMA 4ZCIA 3QFSA 4Y7CA 1VQOB 1FDRA 3GQBA 3SKBA 4DK0A 2R6HA 2OK8A 3PVDA 1TTTA 1QFJA 2RC5A 3SEJA 2WZNA 2WPDA 4YAOA 1R5OA 1H85A 4RM0A 3B78A 4PABA 2ZZEA 3FKSA 3WY9A 2V7XA 4JMQA 3OKXA 3P26A 4XMYA 1UD4A 1K8AD 2PIAA 2QE7A 2CRVA 1VLOA 2ZITA 1KJZA 5IK2A 3ASPA 3JQQA 4Q7JB 5A8AA 1WOOA 3VNUA 2ZTNA 4XM3A 2VNIA 4YAFA 3B82A
chains in the Genus database with same CATH topology
4OOVA 4WZEA 5IYRA 4Z4WA 4X06A 4X0CA 3SLDA 5J3OA 5IYNA 4P3IA 4P25A 3SJPA 5F4OA 1IHMA 4QVAA 3ASSA 4Z4RA 4Z4SA 3PUNA 3BY1A 3D26A 3ONUA 5IYQA 5BSYA 3ASQA 4X7DA 3R6JA 4OP7A 5E6TA 4Z4TA 5BSXA 2OBSA 3Q3AA 5HZBA 4P2NA 4OPOA 5J35A 3ASTA 3PA1A 5IYPA 4RDJA 4Z4UA 4QVJA 2ZL7A 5KW9A 4P12A 4X07A 4QUZA 4OOSA 2OBRA 4RDLA 4RLZA 4ROXA 4RPDA 4X7FA 4OOXA 3BY2A 4X05A 4P26A 4X7CA 3SLNA 3R6KA 4OPVA 4WZTA 5HZAA 3PUMA 3Q38A 3Q6RA 4X7EA 5F4MA 3V7AA 3LQ6A 3ONYA 4QV2A 4Z4ZA 4WZKA 5IYWA 3LQEA 3SKBA 4WZLA 3Q39A 4OPSA 2ZL6A 3PVDA 4Z4VA 3SEJA 4RPBA 5F4JA 4RM0A 3RY8A 3Q6QA 3ASRA 3PA2A 4RDKA 3BQJA 2ZL5A 2OBTA 4Z4YA 4P1VA 3ASPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOV A;  4WZE A;  5IYR A;  4Z4W A;  4X06 A;  4X0C A;  3SLD A;  5J3O A;  5IYN A;  4P3I A;  4P25 A;  3SJP A;  5F4O A;  1IHM A;  4QVA A;  3ASS A;  4Z4R A;  4Z4S A;  3PUN A;  3BY1 A;  3D26 A;  3ONU A;  5IYQ A;  5BSY A;  3ASQ A;  4X7D A;  3R6J A;  4OP7 A;  5E6T A;  4Z4T A;  5BSX A;  2OBS A;  3Q3A A;  5HZB A;  4P2N A;  4OPO A;  5J35 A;  3AST A;  3PA1 A;  5IYP A;  4RDJ A;  4Z4U A;  4QVJ A;  2ZL7 A;  5KW9 A;  4P12 A;  4X07 A;  4QUZ A;  4OOS A;  2OBR A;  4RDL A;  4RLZ A;  4ROX A;  4RPD A;  4X7F A;  4OOX A;  3BY2 A;  4X05 A;  4P26 A;  4X7C A;  3SLN A;  3R6K A;  4OPV A;  4WZT A;  5HZA A;  3PUM A;  3Q38 A;  3Q6R A;  4X7E A;  5F4M A;  3V7A A;  3LQ6 A;  3ONY A;  4QV2 A;  4Z4Z A;  4WZK A;  5IYW A;  3LQE A;  3SKB A;  4WZL A;  3Q39 A;  4OPS A;  2ZL6 A;  3PVD A;  4Z4V A;  3SEJ A;  4RPB A;  5F4J A;  4RM0 A;  3RY8 A;  3Q6Q A;  3ASR A;  3PA2 A;  4RDK A;  3BQJ A;  2ZL5 A;  2OBT A;  4Z4Y A;  4P1V A;  3ASP A; 
#chains in the Genus database with same CATH topology
 1WOS A;  2ZTG A;  2X53 S;  2GPJ A;  2V7W A;  4OOV A;  1UD6 A;  2QTZ A;  2JJ1 A;  1VQ4 B;  2GK6 A;  1N08 A;  1M90 D;  5GV8 A;  4QHY A;  1NB9 A;  4YEJ A;  3QSY A;  5KSW B;  3WXM A;  4FWT A;  1CNE A;  1KZL A;  4X06 A;  4RD4 A;  3ZUG A;  2X8K A;  1HZE A;  4XKV A;  1EP2 B;  1T6Z A;  1XFO A;  4AVZ A;  2QEX B;  3SJP A;  2VJJ A;  3W2F A;  2D74 A;  3OPO A;  1FRQ A;  2BN4 A;  1EP1 B;  3AVX A;  4P9S A;  3W5U A;  3CME B;  1GAQ A;  4TMT A;  3CXC B;  2D3L A;  2HCJ B;  5HXB A;  2R9V A;  3CPX A;  3JU4 A;  3W5H A;  1OGJ A;  1V0E A;  2X6Y A;  3ZBT A;  4R71 A;  2JN9 A;  3ONU A;  1Y0Y A;  5BSY A;  4X7D A;  1Q86 D;  1YJW B;  2DER A;  5EMN A;  1BLI A;  1FNC A;  4B3F X;  3W2E A;  4C43 A;  3DDY A;  4AF6 A;  4TSF A;  2BVN A;  5A89 A;  4KKT A;  4P22 A;  2OBS A;  3QFR A;  5TY0 A;  4ZV4 A;  5HZB A;  3FPK A;  4N3G A;  4P2N A;  4K1X A;  1J9Z A;  1EP3 B;  4OPO A;  5J35 A;  1Q9S A;  2CW5 A;  2QN6 A;  3AST A;  3JQR A;  4M1K A;  1OHH A;  4FK8 A;  4LBV A;  4Y9R A;  1QVG B;  4RD3 A;  4G6I A;  5DN6 A;  3VR6 A;  1DDG A;  3CMA B;  1BX1 A;  2BM1 A;  3AGQ A;  5LMZ A;  5A88 A;  2ZZQ A;  2XZO A;  3CCR B;  3CC4 B;  3A8I A;  5H5J A;  4KKS A;  1QUE A;  4GQN A;  2CC2 A;  4RDL A;  2WR8 A;  3BNW A;  3CCE B;  1T5E A;  2C5H A;  4ROX A;  3GVK A;  2Q6O A;  3OJX A;  1WDT A;  3H94 A;  3OEH A;  4OOX A;  4P26 A;  1UD8 A;  3OFN A;  3CCM B;  1AIP A;  1WOP A;  4YHB A;  4ACA A;  3AVW A;  1E3X A;  2WJY A;  4X7E A;  3OEE A;  3CC2 B;  4N3N A;  4RD1 A;  4CQJ A;  1E3Z A;  5FL7 A;  1K9M D;  1NBM A;  1R5N A;  3MMP A;  4XOR A;  4Z4Z A;  1EFU A;  2PLF A;  5AN9 A;  2C77 A;  2JDI A;  3LQE A;  4YAL A;  3SJZ A;  4XKW A;  1UD3 A;  3Q39 A;  3W2G A;  1S0U A;  4OPS A;  3OZW A;  2J7K A;  5THX A;  5F4J A;  2B5O A;  1UMK A;  2F4N A;  1GJR A;  1A8P A;  3ASR A;  5CDF A;  2GJP A;  1W9X A;  4YAU A;  3OE7 A;  4PC7 A;  2ZL5 A;  2DOG A;  2XGJ A;  3WBK A;  3CB4 A;  3CMM A;  4P1V A;  1CQX A;  4II3 A;  2E1B A;  1QX4 A;  4PC3 A;  3ZPN A;  1WPC A;  4DQK A;  1QUF A;  1B2R A;  3ZC3 A;  1S72 B;  3H9N A;  1N07 A;  1QFY A;  3KEW A;  1EFT A;  3AVU A;  2PMD A;  4Y9U A;  2DY1 A;  3ZBU A;  4ASU A;  2FVG A;  3B8H A;  1QGY A;  2F1L A;  2B7B A;  1UD5 A;  4XLE A;  5IYR A;  1H8H A;  1MRZ A;  1FNM A;  3CD6 B;  2XNC A;  4TT3 A;  1N0U A;  5J3O A;  3OJW A;  4XQF A;  4PC6 A;  1DAR A;  3CP2 A;  1Y0R A;  5FO0 A;  4QVA A;  2BMW A;  3WYA A;  3WND A;  2XZL A;  4Z4R A;  3AVV A;  3T56 B;  3QFT A;  3FJO A;  4M0L A;  4RD0 A;  4M2L A;  4TMZ A;  3G6E B;  2NV4 A;  3NE5 B;  3VO1 A;  5IYQ A;  3ASQ A;  2F43 A;  1WOR A;  1HVX A;  4WWV A;  3GVL A;  1E62 A;  4G1B A;  3QFC A;  4OP7 A;  1SM4 A;  1I8D A;  3CW2 A;  5L46 A;  1IJE A;  4UZU A;  3BCD A;  3OW2 B;  2V7U A;  1H42 A;  4DNT B;  4B47 A;  3I55 B;  3Q3A A;  4TKO B;  2QDX A;  1GAW A;  3PA1 A;  5IYP A;  1WU8 A;  3BCF A;  2JIZ A;  4Z4U A;  4J0Q A;  2CBX A;  1BQE A;  1E79 A;  1KK2 A;  4RCY A;  3I1F A;  1QGZ A;  1KC8 D;  4Z1M A;  1GVH A;  4DNR B;  2W6I A;  3OZU A;  1NRK A;  1EFC A;  1R5B A;  1GR1 A;  1NB0 A;  1DDI A;  1E43 A;  4XON A;  1YI2 B;  3CCV B;  3GSI A;  4RLZ A;  1EWY A;  1B23 P;  1JNY A;  3JQP A;  1IB0 A;  3VMF A;  2OTL B;  1E1Q A;  2XNJ A;  1GO2 A;  3SLN A;  1BX0 A;  1T6Y A;  2YWH A;  4B3G A;  3CCU B;  3PUM A;  3Q6R A;  1VQK B;  4C0S A;  2ZZG A;  2X3U A;  1G7S A;  1F60 A;  2PE3 A;  3V7A A;  1KD1 D;  3MCA A;  3LQ6 A;  3PEN A;  2DCU A;  2DET A;  3ONY A;  3U6B A;  4WQM A;  3LNN A;  1N8R D;  2C5B A;  2EIX A;  2QTL A;  3OAA A;  4TMX A;  1Q81 D;  2C4T A;  2WSS A;  1Q82 D;  4WZK A;  2D3N A;  4PC2 A;  2DYI A;  4P3Y A;  1Q7Y D;  1KQS B;  2RC6 A;  1D1N A;  2M5S A;  3T53 B;  4XN0 A;  3LO8 A;  1ZM4 A;  4Z4V A;  4KKU A;  2OK7 A;  2GRE A;  3BC9 A;  4RCZ A;  4XOP A;  3G4S B;  1NDH A;  1RQP A;  4UZF A;  3CCQ B;  1ZM9 A;  4RDK A;  2OYN A;  4PGO A;  3OZV A;  1W87 A;  1VQ9 B;  2HLD A;  3G71 B;  3BQJ A;  3CCJ B;  4G1V A;  1ZUN B;  2QMU A;  1K28 D;  3I56 B;  2XEX A;  1V5V A;  2QA4 B;  4DK1 A;  1P4M A;  4TMV A;  2OBT A;  3T51 B;  1VQM B;  1FX0 A;  1VLY A;  4P6Y A;  3AVT A;  1VQN B;  2YWG A;  1FRN A;  4XLA A;  1YJ9 B;  4NCN A;  4E0F A;  3CC7 B;  4X8I A;  1VQ5 B;  1SKQ A;  1E64 A;  1YLO A;  4H9G A;  2JJ2 A;  4WZE A;  1PJ7 A;  4Z4W A;  1E1R A;  2CK3 A;  1KMH A;  4YAW A;  1N05 A;  2P3M A;  2HDN B;  3SLD A;  5IYN A;  2X6W A;  4P3I A;  3ISX A;  1D8T A;  1D2E A;  3WNC A;  2EFG A;  1AMO A;  4XN3 A;  4B4D A;  2Z6B D;  3W2I A;  3ZIA A;  1VQ8 B;  4G5G A;  3PUN A;  1W34 A;  1ELO A;  2VBV A;  3BY1 A;  3OOC A;  3CES A;  1G7C A;  3A8J A;  4XD7 A;  3ZZT A;  1FNB A;  1S4M A;  3R6J A;  4XLF A;  2X6X A;  1G7T A;  1XE1 A;  4Z4T A;  2GQF A;  5BSX A;  5KNL A;  2BV3 A;  1XQB A;  1BPL A;  3U6K A;  3GVJ A;  3KL9 A;  1V0F A;  4U9U A;  2CF4 A;  3BH4 A;  2CND A;  5FNZ A;  2XOK A;  2VBU A;  1KRH A;  1QH0 A;  5DS0 A;  1VQ7 B;  4RDJ A;  2X85 A;  1PJ5 A;  1UD2 A;  3E20 A;  2BF4 A;  2YWE A;  4B43 A;  4P12 A;  1YHQ B;  1VQP B;  4B44 A;  2WYR A;  1JA0 A;  4P6V F;  4TN1 A;  1OB2 A;  2OBR A;  4TMW A;  4UZE A;  4ZCL A;  5H59 A;  1F20 A;  3A3B A;  3OP1 A;  4FN5 A;  1VHO A;  2V31 A;  2NPF A;  1TUI A;  2DIE A;  4X05 A;  1QGA A;  3LVB A;  3R6K A;  1WTH D;  3QE2 A;  5HKK A;  4WZT A;  1XB2 A;  4NBS A;  3Q38 A;  1I7P A;  4XOT A;  1KK0 A;  2BGJ A;  1IJF A;  4MYU A;  5FO1 A;  5FA6 A;  1H8E A;  5GV7 A;  4AC9 A;  2I1L A;  4FXU A;  4M53 A;  4BPR A;  4QV2 A;  2VNJ A;  2Q6K A;  4YEL A;  4B48 A;  2DEU A;  4II2 A;  4LBW A;  2C4U A;  1KK3 A;  2F1M A;  2VBS A;  5IYW A;  1YIJ B;  4WZL A;  4HIZ A;  2ZXI A;  4RD6 A;  2ZL6 A;  1VF7 A;  2BGI A;  5JBQ A;  4RPB A;  3WBJ A;  3GIR A;  3AVY A;  1BMF A;  3WQZ A;  3RY8 A;  2V7T A;  2VNK A;  3Q6Q A;  1WSR A;  1W35 A;  4RJL A;  1WSV A;  2WJV A;  3PA2 A;  4NNJ A;  3VNV A;  3AGP A;  4B3X A;  3E1Y E;  3CPW B;  1N06 A;  4M4S A;  3WNB A;  3A8K A;  2BPO A;  1KTV A;  1PJ6 A;  4Z4Y A;  1SKY B;  2GJR A;  3CRZ A;  1VQL B;  1JB9 A;  1JA1 A;  5TV2 A;  2XZP A;  3ZZU A;  1W0J A;  4EH1 A;  5DSZ A;  4XNF A;  3A3G A;  4ZCM A;  4YXW A;  2WZP P;  4ACB A;  1WP6 A;  2V7Q A;  1W2B B;  4AF7 A;  3HAG A;  4HE5 A;  3A1P A;  1HA3 A;  1CNF A;  4X0C A;  1QG0 A;  2ZXH A;  2GK7 A;  2QGG A;  3G05 A;  4P25 A;  2YWF A;  1QFZ A;  2LZJ A;  1NJI D;  1N0V C;  2VJI A;  2V4D A;  2ZBU A;  5F4O A;  3MHP A;  4PAA A;  5TR9 A;  1ZM2 A;  1IHM A;  1COW A;  1FND A;  3ASS A;  1YX2 A;  4Z4S A;  4DQL A;  2ZBV A;  5TRD A;  3W2H A;  1YIT B;  3D26 A;  1TLL A;  2VBT A;  1K73 D;  1T6X A;  3P27 A;  3U2Q A;  3CCL B;  1MAB A;  4G7W A;  1I18 A;  5E6T A;  3A35 A;  4HE6 A;  2E1R A;  4ZGQ B;  2OTJ B;  3FPP A;  4G7X A;  4RD2 A;  2Q6L A;  5B6I A;  1JJ2 B;  3CTA A;  3VO2 A;  1W0K A;  1BJK A;  3CP8 A;  2XND A;  3ES9 A;  2V7V A;  2BSA A;  2VYQ A;  4MYT A;  1KK1 A;  1TVC A;  4QVJ A;  2D9R A;  2ZL7 A;  2KVO A;  4UAJ A;  4L8J A;  4XR6 A;  4F7D A;  1RQR A;  3ZZ0 A;  5KW9 A;  4PC1 A;  1M1K D;  4X07 A;  4XLC A;  1VHE A;  3OW7 A;  4QUZ A;  1OGI A;  4LBZ A;  2VNH A;  3J81 k;  4XL9 A;  4OOS A;  1EFR A;  2HMA A;  2C78 A;  4IW3 B;  5FIU A;  4LBY A;  3CCS B;  2VZL A;  2AHO A;  1OB0 A;  1PKV A;  1VJS A;  2Q6I A;  4RPD A;  4X7F A;  1VQ6 B;  2B7C A;  3W5V A;  4XLH A;  1OB5 A;  3BY2 A;  4X7C A;  1E63 A;  1EXM A;  4OPV A;  3V76 A;  1YJN B;  4ZGN B;  2ZZF A;  5HZA A;  1ZM3 A;  2W6J A;  1G7R A;  5F4M A;  1DG1 G;  1U2R A;  1QVF B;  2BM0 A;  2C2W A;  2X0K A;  2GJK A;  2FX3 A;  4LC0 A;  4QFM A;  4ZCI A;  3QFS A;  4Y7C A;  1VQO B;  1FDR A;  3GQB A;  3SKB A;  4DK0 A;  2R6H A;  2OK8 A;  3PVD A;  1TTT A;  1QFJ A;  2RC5 A;  3SEJ A;  2WZN A;  2WPD A;  4YAO A;  1R5O A;  1H85 A;  4RM0 A;  3B78 A;  4PAB A;  2ZZE A;  3FKS A;  3WY9 A;  2V7X A;  4JMQ A;  3OKX A;  3P26 A;  4XMY A;  1UD4 A;  1K8A D;  2PIA A;  2QE7 A;  2CRV A;  1VLO A;  2ZIT A;  1KJZ A;  5IK2 A;  3ASP A;  3JQQ A;  4Q7J B;  5A8A A;  1WOO A;  3VNU A;  2ZTN A;  4XM3 A;  2VNI A;  4YAF A;  3B82 A; 
#chains in the Genus database with same CATH homology
 4OOV A;  4WZE A;  5IYR A;  4Z4W A;  4X06 A;  4X0C A;  3SLD A;  5J3O A;  5IYN A;  4P3I A;  4P25 A;  3SJP A;  5F4O A;  1IHM A;  4QVA A;  3ASS A;  4Z4R A;  4Z4S A;  3PUN A;  3BY1 A;  3D26 A;  3ONU A;  5IYQ A;  5BSY A;  3ASQ A;  4X7D A;  3R6J A;  4OP7 A;  5E6T A;  4Z4T A;  5BSX A;  2OBS A;  3Q3A A;  5HZB A;  4P2N A;  4OPO A;  5J35 A;  3AST A;  3PA1 A;  5IYP A;  4RDJ A;  4Z4U A;  4QVJ A;  2ZL7 A;  5KW9 A;  4P12 A;  4X07 A;  4QUZ A;  4OOS A;  2OBR A;  4RDL A;  4RLZ A;  4ROX A;  4RPD A;  4X7F A;  4OOX A;  3BY2 A;  4X05 A;  4P26 A;  4X7C A;  3SLN A;  3R6K A;  4OPV A;  4WZT A;  5HZA A;  3PUM A;  3Q38 A;  3Q6R A;  4X7E A;  5F4M A;  3V7A A;  3LQ6 A;  3ONY A;  4QV2 A;  4Z4Z A;  4WZK A;  5IYW A;  3LQE A;  3SKB A;  4WZL A;  3Q39 A;  4OPS A;  2ZL6 A;  3PVD A;  4Z4V A;  3SEJ A;  4RPB A;  5F4J A;  4RM0 A;  3RY8 A;  3Q6Q A;  3ASR A;  3PA2 A;  4RDK A;  3BQJ A;  2ZL5 A;  2OBT A;  4Z4Y A;  4P1V A;  3ASP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...