5BSYA

Crystal structure of gii.10 p domain in complex with lemon juice
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 71
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsyA01
2OBSA 4Z4TA 4OPOA 3SEJA 3PUNA 4X7CA 4P1VA 2ZL6A 5IYRA 3LQ6A 4P25A 3V7AA 3ASPA 4OOXA 4WZLA 4ROXA 4OP7A 4X7FA 3ONUA 5J3OA 3R6KA 3ASSA 4Z4ZA 4X0CA 3ASRA 3D26A 5IYQA 3ASTA 4RLZA 4QV2A 4RDJA 5IYWA 3PVDA 3Q38A 4Z4YA 5F4OA 4Z4VA 5IYNA 5IYPA 3PUMA 3BQJA 4WZKA 4P12A 2ZL7A 2OBTA 4P26A 3SJPA 4OPSA 3Q3AA 3SLNA 4OOVA 4Z4UA 4RPBA 4QVAA 3R6JA 4P3IA 4WZEA 3PA1A 4RDLA 4P2NA 4RM0A 4QVJA 3Q39A 3PA2A 3ASQA 3Q6QA 3RY8A 2OBRA 4OPVA 3SKBA 5F4MA 4QUZA 5KW9A 3SLDA 4RDKA 2ZL5A 4X7EA 4Z4WA 5BSXA 4X07A 1IHMA 3BY1A 4X7DA 5HZBA 3BY2A 5J35A 4X06A 5HZAA 4Z4SA 3Q6RA 5F4JA 3ONYA 4Z4RA 3LQEA 4WZTA 5E6TA 4X05A 4OOSA 5BSYA 4RPDA
chains in the Genus database with same CATH superfamily
2I1LA 2OBSA 2OTLB 1VQ4B 2JDIA 4XR6A 4KKUA 3QE2A 1OGIA 3A3GA 1UD6A 4X7CA 2XZOA 2QEXB 3SJZA 4XLCA 4XLEA 1PJ5A 1T6XA 2ZBVA 1B23P 1NRKA 3CP2A 3ASPA 2NPFA 3V76A 1DARA 4G7XA 3GVKA 2XOKA 4HIZA 3G05A 5KSWB 3P26A 2FVGA 4QHYA 4TKOB 1N06A 3WY9A 1KJZA 1IJFA 2WR8A 5L46A 2GJPA 3I56B 2V7TA 2DEUA 4ZV4A 4RD0A 1KTVA 3ASTA 4GQNA 4QV2A 5TRDA 4RDJA 1PJ7A 2Q6IA 3MMPA 5IYWA 1AIPA 1WSRA 1GAQA 5HKKA 2VYQA 4XKVA 2YWFA 4XOPA 3JQRA 4XLHA 5F4OA 1N0VC 4KKTA 4TMVA 3QSYA 5IYPA 5FO0A 5JBQA 3CMEB 2BGIA 1G7SA 1W35A 3BQJA 4P12A 2C2WA 4F7DA 2X0KA 2OBTA 3WNDA 2CBXA 4RD1A 1YJNB 3CD6B 1XQBA 2CW5A 4DNTB 1KK2A 2XZPA 2CRVA 2PIAA 4U9UA 3SJPA 1VQKB 4YELA 2F4NA 3GVJA 2WPDA 1KK1A 2HMAA 3Q3AA 4RD4A 3SLNA 4RD6A 3NE5B 4TN1A 4YHBA 4Z4UA 3QFCA 1QG0A 1CNEA 2M5SA 3CCJB 3CP8A 4QVAA 3R6JA 3PA1A 4XN3A 3OFNA 4RDLA 2X6YA 4P9SA 4QVJA 5DS0A 2JJ2A 1E1RA 1VF7A 1GAWA 1VQMB 4N3GA 1N05A 2CK3A 2HLDA 1T6YA 3B8HA 1CNFA 1W0JA 5DN6A 3OW7A 4J0QA 2XNDA 4TSFA 1T6ZA 1VQ9B 4RDKA 4ZCIA 2HDNB 2ZITA 2WSSA 3CCQB 3BY1A 1PJ6A 2C5HA 4RD2A 2V31A 4X7DA 3VMFA 5A88A 1V0FA 5J35A 3FPKA 4EH1A 1N07A 4YAWA 5H5JA 2CNDA 4FXUA 1VHEA 3Q6RA 1D1NA 5F4JA 1EWYA 2NV4A 3LO8A 1N08A 1RQRA 1GR1A 3ONYA 2BPOA 2QTLA 3LQEA 2OK7A 1J9ZA 2VBTA 1YJWB 2J7KA 4HE5A 4L8JA 3ZZTA 4LBZA 1JA0A 1KMHA 1ZM9A 4XL9A 5KNLA 1EP3B 4XONA 2QN6A 3CPXA 2DY1A 3SEJA 3E1YE 5TV2A 1SKYB 4XQFA 4AF6A 4FK8A 1K8AD 3WBJA 2CC2A 2KVOA 1KK3A 3A8KA 1K73D 5CDFA 1BJKA 4AVZA 3ZC3A 1QGZA 4P25A 3CMAB 3CCUB 2R9VA 4WZLA 4LBWA 5FNZA 3E20A 2ZZGA 3FKSA 4P3YA 4X7FA 5J3OA 4QFMA 1E63A 4X0CA 2VZLA 4B44A 2RC6A 1TUIA 4ZGQB 4G1BA 4LC0A 1WU8A 2ZZEA 4RCYA 4B3XA 1HA3A 3W2GA 1WTHD 1QGYA 2BF4A 3GIRA 1VQ5B 2V4DA 2C5BA 3QFTA 4Z4VA 1W0KA 1TLLA 2CF4A 1UD4A 3OAAA 3OJXA 3PUMA 3LNNA 4M0LA 3U6BA 4UZFA 2ZL7A 4MYTA 1XFOA 2DOGA 1VLOA 3QFSA 4P26A 4DK1A 2XEXA 1WOPA 3QFRA 1BPLA 4UZEA 1EP2B 1Q9SA 2DIEA 3WNBA 3DDYA 1FNDA 5GV7A 2EIXA 4C0SA 3BCDA 3CMMA 4OOVA 1DG1G 1F60A 2JIZA 2LZJA 4B43A 1YIJB 2X85A 3WXMA 3H9NA 4XOTA 4AF7A 1IJEA 3U6KA 1OB2A 4RPBA 2GPJA 1QVFB 1QH0A 3ES9A 1Q82D 2QMUA 1MRZA 2D9RA 3FPPA 2GJRA 1EXMA 4RM0A 1M1KD 3BNWA 3JQPA 1KRHA 2V7UA 4ZCLA 3KL9A 2WZPP 3RY8A 4M1KA 3W2FA 2ZTNA 4G1VA 4WQMA 5F4MA 4Z1MA 1WORA 5KW9A 2C78A 3JQQA 4XORA 3T51B 3VO2A 1ZM2A 3CB4A 4NNJA 4B47A 1KZLA 1BMFA 4M53A 4Y7CA 5BSXA 3G4SB 2BM1A 1VQ7B 2DCUA 2F43A 5HZBA 3BY2A 2PMDA 3W5HA 2V7WA 4DK0A 1FX0A 4DQLA 1YI2B 4XKWA 2DERA 4Z4SA 1G7RA 2VBSA 1OB5A 1WDTA 1DDIA 3HAGA 1S72B 1VQNB 4Z4RA 1G7TA 4XLAA 2P3MA 4IW3B 1QFZA 4WZTA 1VHOA 3CC4B 5FL7A 2VNHA 2PE3A 3CRZA 3T53B 2XNJA 2X8KA 1R5BA 3AVXA 3OE7A 2YWGA 4Z4TA 4OPOA 3AGPA 1GVHA 3B78A 4PC1A 1QUEA 1W87A 2VJJA 2V7QA 4P1VA 2ZL6A 4ACBA 1Q81D 1WP6A 1YJ9B 2ZBUA 1Q7YD 1ZUNB 1NJID 3LQ6A 2V7VA 3A8JA 3U2QA 3ZPNA 2X6XA 3CW2A 2V7XA 4XNFA 3W2HA 2ZXIA 1VQOB 2WZNA 1GO2A 4OP7A 5H59A 2RC5A 1VQPB 1B2RA 1D2EA 4PAAA 3CC2B 3ASSA 4DNRB 1FRNA 1YX2A 1KC8D 1XB2A 2VNIA 1MABA 1BX0A 1FNBA 5IYQA 1NDHA 4RLZA 1FNCA 4C43A 1EFTA 1NB0A 1W2BB 4NBSA 4Q7JB 2W6IA 1SKQA 1NBMA 3OEHA 3PENA 3PVDA 4MYUA 1FDRA 3CESA 1KD1D 1VQ6B 4RCZA 4DQKA 4XD7A 1EFRA 3BC9A 2E1RA 3WYAA 1ZM3A 4PABA 1DDGA 4WZKA 5DSZA 2BV3A 3AVYA 3I55B 1COWA 2X3UA 4TT3A 1JNYA 4RPDA 4ASUA 1YITB 1JJ2B 2BMWA 2Z6BD 2GREA 2YWHA 1I7PA 1E43A 1VQ8B 4B3GA 4OPSA 1ZM4A 3OZUA 1H42A 1UMKA 4Y9UA 2BSAA 1QFYA 4PC3A 1W9XA 2X6WA 1I18A 1K9MD 2AHOA 2ZXHA 2D3LA 4P6YA 1D8TA 1EFCA 4TMXA 4M2LA 1S4MA 2BN4A 3WBKA 4WZEA 3W2EA 3W2IA 1FRQA 3OP1A 3CC7B 1QUFA 2WJYA 3OJWA 4YALA 2B7BA 4XM3A 3CXCB 4UZUA 4YAOA 4NCNA 1U2RA 1E79A 3B82A 3Q39A 3G71B 3VNUA 1P4MA 3OZWA 3PA2A 4ZCMA 3Q6QA 2GK7A 2ZZFA 1E64A 2F1MA 1TTTA 4OPVA 4PC6A 2GQFA 4RD3A 3T56B 3CCMB 2VNKA 1JA1A 5B6IA 3SLDA 2Q6LA 4YAFA 4YEJA 2PLFA 4Z4WA 2ZZQA 4WWVA 4X07A 1IHMA 3CCRB 4RJLA 4AC9A 1N8RD 3A35A 3W5VA 3VR6A 1E62A 4Y9RA 1YHQB 1E3ZA 1WOOA 2FX3A 2VBUA 5FIUA 4TMWA 5HZAA 3G6EB 3GVLA 2JJ1A 3OPOA 3CCSB 2X53S 2QA4B 1IB0A 2GJKA 3W5UA 2YWEA 4ACAA 3VO1A 3OW2B 1OHHA 3MHPA 5E6TA 4X05A 3KEWA 4B3FX 4OOSA 4FWTA 2VNJA 4B48A 5BSYA 3OZVA 3BH4A 5IK2A 4B4DA 1H85A 3PUNA 3A1PA 3CCEB 3CCVB 1H8HA 4PGOA 3OEEA 5GV8A 3BCFA 2C4TA 4X8IA 1E3XA 5LMZA 2B7CA 5IYRA 3V7AA 1XE1A 1S0UA 4OOXA 1V0EA 1I8DA 2ZTGA 1K28D 1N0UA 2BGJA 4G6IA 3VNVA 3OKXA 4ROXA 4H9GA 3ONUA 3WQZA 3LVBA 3R6KA 1RQPA 4N3NA 5EMNA 3CPWB 4Z4ZA 2DETA 3ZUGA 3AVTA 3ASRA 3D26A 1QVGB 4XLFA 1CQXA 4FN5A 2OTJB 1R5NA 4HE6A 1A8PA 4CQJA 1FNMA 2R6HA 1QGAA 3ZBTA 2BM0A 3Q38A 3JU4A 4Z4YA 3WNCA 3P27A 2E1BA 1SM4A 5A8AA 5TR9A 1Y0YA 5A89A 4UAJA 5IYNA 1KK0A 3ZZ0A 4E0FA 1EP1B 1F20A 1EFUA 2QGGA 4P6VF 4BPRA 2OYNA 2WYRA 4JMQA 3AVUA 4PC2A 3ZBUA 3ZIAA 1G7CA 1VLYA 2VBVA 1E1QA 1UD2A 1ELOA 3H94A 2C77A 1VJSA 1VQLB 3AVWA 4M4SA 1AMOA 2C4UA 2QDXA 2QTZA 5TY0A 5AN9A 2EFGA 2VJIA 3ISXA 2XNCA 1UD3A 5FA6A 1UD8A 3MCAA 4G7WA 5THXA 1UD5A 2F1LA 4II2A 4R71A 3GSIA 4TMTA 1Y0RA 4G5GA 4P3IA 1T5EA 4YAUA 1OB0A 1M90D 2B5OA 2QE7A 2BVNA 1WOSA 4P2NA 3GQBA 3A8IA 5FO1A 3ASQA 2GK6A 2OK8A 2OBRA 4II3A 3SKBA 4KKSA 5HXBA 4QUZA 1PKVA 1R5OA 1BLIA 1OGJA 1TVCA 3CCLB 2DYIA 4ZGNB 1YLOA 1QFJA 2ZL5A 4X7EA 4XN0A 1BX1A 4PC7A 1WPCA 4YXWA 2D3NA 4X06A 1JB9A 4TMZA 2XZLA 1QX4A 4LBYA 3J81k 2Q6KA 3CTAA 4P22A 1Q86D 1WSVA 4XMYA 2Q6OA 2W6JA 1BQEA 1GJRA 4K1XA 1HZEA 4LBVA 3ZZUA 3AGQA 2HCJB 2XGJA 1KQSB 2WJVA 3A3BA 1V5VA 2D74A 3OOCA 3AVVA 1H8EA 1W34A 3FJOA 2JN9A 1HVXA 3I1FA 1NB9A
chains in the Genus database with same CATH topology
2OBSA 4Z4TA 4OPOA 3SEJA 3PUNA 4X7CA 4P1VA 2ZL6A 5IYRA 3LQ6A 4P25A 3V7AA 3ASPA 4OOXA 4WZLA 4ROXA 4OP7A 4X7FA 3ONUA 5J3OA 3R6KA 3ASSA 4Z4ZA 4X0CA 3ASRA 3D26A 5IYQA 3ASTA 4RLZA 4QV2A 4RDJA 5IYWA 3PVDA 3Q38A 4Z4YA 5F4OA 4Z4VA 5IYNA 5IYPA 3PUMA 3BQJA 4WZKA 4P12A 2ZL7A 2OBTA 4P26A 3SJPA 4OPSA 3Q3AA 3SLNA 4OOVA 4Z4UA 4RPBA 4QVAA 3R6JA 4P3IA 4WZEA 3PA1A 4RDLA 4P2NA 4RM0A 4QVJA 3Q39A 3PA2A 3ASQA 3Q6QA 3RY8A 2OBRA 4OPVA 3SKBA 5F4MA 4QUZA 5KW9A 3SLDA 4RDKA 2ZL5A 4X7EA 4Z4WA 5BSXA 4X07A 1IHMA 3BY1A 4X7DA 5HZBA 3BY2A 5J35A 4X06A 5HZAA 4Z4SA 3Q6RA 5F4JA 3ONYA 4Z4RA 3LQEA 4WZTA 5E6TA 4X05A 4OOSA 5BSYA 4RPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBS A;  4Z4T A;  4OPO A;  3SEJ A;  3PUN A;  4X7C A;  4P1V A;  2ZL6 A;  5IYR A;  3LQ6 A;  4P25 A;  3V7A A;  3ASP A;  4OOX A;  4WZL A;  4ROX A;  4OP7 A;  4X7F A;  3ONU A;  5J3O A;  3R6K A;  3ASS A;  4Z4Z A;  4X0C A;  3ASR A;  3D26 A;  5IYQ A;  3AST A;  4RLZ A;  4QV2 A;  4RDJ A;  5IYW A;  3PVD A;  3Q38 A;  4Z4Y A;  5F4O A;  4Z4V A;  5IYN A;  5IYP A;  3PUM A;  3BQJ A;  4WZK A;  4P12 A;  2ZL7 A;  2OBT A;  4P26 A;  3SJP A;  4OPS A;  3Q3A A;  3SLN A;  4OOV A;  4Z4U A;  4RPB A;  4QVA A;  3R6J A;  4P3I A;  4WZE A;  3PA1 A;  4RDL A;  4P2N A;  4RM0 A;  4QVJ A;  3Q39 A;  3PA2 A;  3ASQ A;  3Q6Q A;  3RY8 A;  2OBR A;  4OPV A;  3SKB A;  5F4M A;  4QUZ A;  5KW9 A;  3SLD A;  4RDK A;  2ZL5 A;  4X7E A;  4Z4W A;  5BSX A;  4X07 A;  1IHM A;  3BY1 A;  4X7D A;  5HZB A;  3BY2 A;  5J35 A;  4X06 A;  5HZA A;  4Z4S A;  3Q6R A;  5F4J A;  3ONY A;  4Z4R A;  3LQE A;  4WZT A;  5E6T A;  4X05 A;  4OOS A;  5BSY A;  4RPD A; 
#chains in the Genus database with same CATH topology
 2I1L A;  2OBS A;  2OTL B;  1VQ4 B;  2JDI A;  4XR6 A;  4KKU A;  3QE2 A;  1OGI A;  3A3G A;  1UD6 A;  4X7C A;  2XZO A;  2QEX B;  3SJZ A;  4XLC A;  4XLE A;  1PJ5 A;  1T6X A;  2ZBV A;  1B23 P;  1NRK A;  3CP2 A;  3ASP A;  2NPF A;  3V76 A;  1DAR A;  4G7X A;  3GVK A;  2XOK A;  4HIZ A;  3G05 A;  5KSW B;  3P26 A;  2FVG A;  4QHY A;  4TKO B;  1N06 A;  3WY9 A;  1KJZ A;  1IJF A;  2WR8 A;  5L46 A;  2GJP A;  3I56 B;  2V7T A;  2DEU A;  4ZV4 A;  4RD0 A;  1KTV A;  3AST A;  4GQN A;  4QV2 A;  5TRD A;  4RDJ A;  1PJ7 A;  2Q6I A;  3MMP A;  5IYW A;  1AIP A;  1WSR A;  1GAQ A;  5HKK A;  2VYQ A;  4XKV A;  2YWF A;  4XOP A;  3JQR A;  4XLH A;  5F4O A;  1N0V C;  4KKT A;  4TMV A;  3QSY A;  5IYP A;  5FO0 A;  5JBQ A;  3CME B;  2BGI A;  1G7S A;  1W35 A;  3BQJ A;  4P12 A;  2C2W A;  4F7D A;  2X0K A;  2OBT A;  3WND A;  2CBX A;  4RD1 A;  1YJN B;  3CD6 B;  1XQB A;  2CW5 A;  4DNT B;  1KK2 A;  2XZP A;  2CRV A;  2PIA A;  4U9U A;  3SJP A;  1VQK B;  4YEL A;  2F4N A;  3GVJ A;  2WPD A;  1KK1 A;  2HMA A;  3Q3A A;  4RD4 A;  3SLN A;  4RD6 A;  3NE5 B;  4TN1 A;  4YHB A;  4Z4U A;  3QFC A;  1QG0 A;  1CNE A;  2M5S A;  3CCJ B;  3CP8 A;  4QVA A;  3R6J A;  3PA1 A;  4XN3 A;  3OFN A;  4RDL A;  2X6Y A;  4P9S A;  4QVJ A;  5DS0 A;  2JJ2 A;  1E1R A;  1VF7 A;  1GAW A;  1VQM B;  4N3G A;  1N05 A;  2CK3 A;  2HLD A;  1T6Y A;  3B8H A;  1CNF A;  1W0J A;  5DN6 A;  3OW7 A;  4J0Q A;  2XND A;  4TSF A;  1T6Z A;  1VQ9 B;  4RDK A;  4ZCI A;  2HDN B;  2ZIT A;  2WSS A;  3CCQ B;  3BY1 A;  1PJ6 A;  2C5H A;  4RD2 A;  2V31 A;  4X7D A;  3VMF A;  5A88 A;  1V0F A;  5J35 A;  3FPK A;  4EH1 A;  1N07 A;  4YAW A;  5H5J A;  2CND A;  4FXU A;  1VHE A;  3Q6R A;  1D1N A;  5F4J A;  1EWY A;  2NV4 A;  3LO8 A;  1N08 A;  1RQR A;  1GR1 A;  3ONY A;  2BPO A;  2QTL A;  3LQE A;  2OK7 A;  1J9Z A;  2VBT A;  1YJW B;  2J7K A;  4HE5 A;  4L8J A;  3ZZT A;  4LBZ A;  1JA0 A;  1KMH A;  1ZM9 A;  4XL9 A;  5KNL A;  1EP3 B;  4XON A;  2QN6 A;  3CPX A;  2DY1 A;  3SEJ A;  3E1Y E;  5TV2 A;  1SKY B;  4XQF A;  4AF6 A;  4FK8 A;  1K8A D;  3WBJ A;  2CC2 A;  2KVO A;  1KK3 A;  3A8K A;  1K73 D;  5CDF A;  1BJK A;  4AVZ A;  3ZC3 A;  1QGZ A;  4P25 A;  3CMA B;  3CCU B;  2R9V A;  4WZL A;  4LBW A;  5FNZ A;  3E20 A;  2ZZG A;  3FKS A;  4P3Y A;  4X7F A;  5J3O A;  4QFM A;  1E63 A;  4X0C A;  2VZL A;  4B44 A;  2RC6 A;  1TUI A;  4ZGQ B;  4G1B A;  4LC0 A;  1WU8 A;  2ZZE A;  4RCY A;  4B3X A;  1HA3 A;  3W2G A;  1WTH D;  1QGY A;  2BF4 A;  3GIR A;  1VQ5 B;  2V4D A;  2C5B A;  3QFT A;  4Z4V A;  1W0K A;  1TLL A;  2CF4 A;  1UD4 A;  3OAA A;  3OJX A;  3PUM A;  3LNN A;  4M0L A;  3U6B A;  4UZF A;  2ZL7 A;  4MYT A;  1XFO A;  2DOG A;  1VLO A;  3QFS A;  4P26 A;  4DK1 A;  2XEX A;  1WOP A;  3QFR A;  1BPL A;  4UZE A;  1EP2 B;  1Q9S A;  2DIE A;  3WNB A;  3DDY A;  1FND A;  5GV7 A;  2EIX A;  4C0S A;  3BCD A;  3CMM A;  4OOV A;  1DG1 G;  1F60 A;  2JIZ A;  2LZJ A;  4B43 A;  1YIJ B;  2X85 A;  3WXM A;  3H9N A;  4XOT A;  4AF7 A;  1IJE A;  3U6K A;  1OB2 A;  4RPB A;  2GPJ A;  1QVF B;  1QH0 A;  3ES9 A;  1Q82 D;  2QMU A;  1MRZ A;  2D9R A;  3FPP A;  2GJR A;  1EXM A;  4RM0 A;  1M1K D;  3BNW A;  3JQP A;  1KRH A;  2V7U A;  4ZCL A;  3KL9 A;  2WZP P;  3RY8 A;  4M1K A;  3W2F A;  2ZTN A;  4G1V A;  4WQM A;  5F4M A;  4Z1M A;  1WOR A;  5KW9 A;  2C78 A;  3JQQ A;  4XOR A;  3T51 B;  3VO2 A;  1ZM2 A;  3CB4 A;  4NNJ A;  4B47 A;  1KZL A;  1BMF A;  4M53 A;  4Y7C A;  5BSX A;  3G4S B;  2BM1 A;  1VQ7 B;  2DCU A;  2F43 A;  5HZB A;  3BY2 A;  2PMD A;  3W5H A;  2V7W A;  4DK0 A;  1FX0 A;  4DQL A;  1YI2 B;  4XKW A;  2DER A;  4Z4S A;  1G7R A;  2VBS A;  1OB5 A;  1WDT A;  1DDI A;  3HAG A;  1S72 B;  1VQN B;  4Z4R A;  1G7T A;  4XLA A;  2P3M A;  4IW3 B;  1QFZ A;  4WZT A;  1VHO A;  3CC4 B;  5FL7 A;  2VNH A;  2PE3 A;  3CRZ A;  3T53 B;  2XNJ A;  2X8K A;  1R5B A;  3AVX A;  3OE7 A;  2YWG A;  4Z4T A;  4OPO A;  3AGP A;  1GVH A;  3B78 A;  4PC1 A;  1QUE A;  1W87 A;  2VJJ A;  2V7Q A;  4P1V A;  2ZL6 A;  4ACB A;  1Q81 D;  1WP6 A;  1YJ9 B;  2ZBU A;  1Q7Y D;  1ZUN B;  1NJI D;  3LQ6 A;  2V7V A;  3A8J A;  3U2Q A;  3ZPN A;  2X6X A;  3CW2 A;  2V7X A;  4XNF A;  3W2H A;  2ZXI A;  1VQO B;  2WZN A;  1GO2 A;  4OP7 A;  5H59 A;  2RC5 A;  1VQP B;  1B2R A;  1D2E A;  4PAA A;  3CC2 B;  3ASS A;  4DNR B;  1FRN A;  1YX2 A;  1KC8 D;  1XB2 A;  2VNI A;  1MAB A;  1BX0 A;  1FNB A;  5IYQ A;  1NDH A;  4RLZ A;  1FNC A;  4C43 A;  1EFT A;  1NB0 A;  1W2B B;  4NBS A;  4Q7J B;  2W6I A;  1SKQ A;  1NBM A;  3OEH A;  3PEN A;  3PVD A;  4MYU A;  1FDR A;  3CES A;  1KD1 D;  1VQ6 B;  4RCZ A;  4DQK A;  4XD7 A;  1EFR A;  3BC9 A;  2E1R A;  3WYA A;  1ZM3 A;  4PAB A;  1DDG A;  4WZK A;  5DSZ A;  2BV3 A;  3AVY A;  3I55 B;  1COW A;  2X3U A;  4TT3 A;  1JNY A;  4RPD A;  4ASU A;  1YIT B;  1JJ2 B;  2BMW A;  2Z6B D;  2GRE A;  2YWH A;  1I7P A;  1E43 A;  1VQ8 B;  4B3G A;  4OPS A;  1ZM4 A;  3OZU A;  1H42 A;  1UMK A;  4Y9U A;  2BSA A;  1QFY A;  4PC3 A;  1W9X A;  2X6W A;  1I18 A;  1K9M D;  2AHO A;  2ZXH A;  2D3L A;  4P6Y A;  1D8T A;  1EFC A;  4TMX A;  4M2L A;  1S4M A;  2BN4 A;  3WBK A;  4WZE A;  3W2E A;  3W2I A;  1FRQ A;  3OP1 A;  3CC7 B;  1QUF A;  2WJY A;  3OJW A;  4YAL A;  2B7B A;  4XM3 A;  3CXC B;  4UZU A;  4YAO A;  4NCN A;  1U2R A;  1E79 A;  3B82 A;  3Q39 A;  3G71 B;  3VNU A;  1P4M A;  3OZW A;  3PA2 A;  4ZCM A;  3Q6Q A;  2GK7 A;  2ZZF A;  1E64 A;  2F1M A;  1TTT A;  4OPV A;  4PC6 A;  2GQF A;  4RD3 A;  3T56 B;  3CCM B;  2VNK A;  1JA1 A;  5B6I A;  3SLD A;  2Q6L A;  4YAF A;  4YEJ A;  2PLF A;  4Z4W A;  2ZZQ A;  4WWV A;  4X07 A;  1IHM A;  3CCR B;  4RJL A;  4AC9 A;  1N8R D;  3A35 A;  3W5V A;  3VR6 A;  1E62 A;  4Y9R A;  1YHQ B;  1E3Z A;  1WOO A;  2FX3 A;  2VBU A;  5FIU A;  4TMW A;  5HZA A;  3G6E B;  3GVL A;  2JJ1 A;  3OPO A;  3CCS B;  2X53 S;  2QA4 B;  1IB0 A;  2GJK A;  3W5U A;  2YWE A;  4ACA A;  3VO1 A;  3OW2 B;  1OHH A;  3MHP A;  5E6T A;  4X05 A;  3KEW A;  4B3F X;  4OOS A;  4FWT A;  2VNJ A;  4B48 A;  5BSY A;  3OZV A;  3BH4 A;  5IK2 A;  4B4D A;  1H85 A;  3PUN A;  3A1P A;  3CCE B;  3CCV B;  1H8H A;  4PGO A;  3OEE A;  5GV8 A;  3BCF A;  2C4T A;  4X8I A;  1E3X A;  5LMZ A;  2B7C A;  5IYR A;  3V7A A;  1XE1 A;  1S0U A;  4OOX A;  1V0E A;  1I8D A;  2ZTG A;  1K28 D;  1N0U A;  2BGJ A;  4G6I A;  3VNV A;  3OKX A;  4ROX A;  4H9G A;  3ONU A;  3WQZ A;  3LVB A;  3R6K A;  1RQP A;  4N3N A;  5EMN A;  3CPW B;  4Z4Z A;  2DET A;  3ZUG A;  3AVT A;  3ASR A;  3D26 A;  1QVG B;  4XLF A;  1CQX A;  4FN5 A;  2OTJ B;  1R5N A;  4HE6 A;  1A8P A;  4CQJ A;  1FNM A;  2R6H A;  1QGA A;  3ZBT A;  2BM0 A;  3Q38 A;  3JU4 A;  4Z4Y A;  3WNC A;  3P27 A;  2E1B A;  1SM4 A;  5A8A A;  5TR9 A;  1Y0Y A;  5A89 A;  4UAJ A;  5IYN A;  1KK0 A;  3ZZ0 A;  4E0F A;  1EP1 B;  1F20 A;  1EFU A;  2QGG A;  4P6V F;  4BPR A;  2OYN A;  2WYR A;  4JMQ A;  3AVU A;  4PC2 A;  3ZBU A;  3ZIA A;  1G7C A;  1VLY A;  2VBV A;  1E1Q A;  1UD2 A;  1ELO A;  3H94 A;  2C77 A;  1VJS A;  1VQL B;  3AVW A;  4M4S A;  1AMO A;  2C4U A;  2QDX A;  2QTZ A;  5TY0 A;  5AN9 A;  2EFG A;  2VJI A;  3ISX A;  2XNC A;  1UD3 A;  5FA6 A;  1UD8 A;  3MCA A;  4G7W A;  5THX A;  1UD5 A;  2F1L A;  4II2 A;  4R71 A;  3GSI A;  4TMT A;  1Y0R A;  4G5G A;  4P3I A;  1T5E A;  4YAU A;  1OB0 A;  1M90 D;  2B5O A;  2QE7 A;  2BVN A;  1WOS A;  4P2N A;  3GQB A;  3A8I A;  5FO1 A;  3ASQ A;  2GK6 A;  2OK8 A;  2OBR A;  4II3 A;  3SKB A;  4KKS A;  5HXB A;  4QUZ A;  1PKV A;  1R5O A;  1BLI A;  1OGJ A;  1TVC A;  3CCL B;  2DYI A;  4ZGN B;  1YLO A;  1QFJ A;  2ZL5 A;  4X7E A;  4XN0 A;  1BX1 A;  4PC7 A;  1WPC A;  4YXW A;  2D3N A;  4X06 A;  1JB9 A;  4TMZ A;  2XZL A;  1QX4 A;  4LBY A;  3J81 k;  2Q6K A;  3CTA A;  4P22 A;  1Q86 D;  1WSV A;  4XMY A;  2Q6O A;  2W6J A;  1BQE A;  1GJR A;  4K1X A;  1HZE A;  4LBV A;  3ZZU A;  3AGQ A;  2HCJ B;  2XGJ A;  1KQS B;  2WJV A;  3A3B A;  1V5V A;  2D74 A;  3OOC A;  3AVV A;  1H8E A;  1W34 A;  3FJO A;  2JN9 A;  1HVX A;  3I1F A;  1NB9 A; 
#chains in the Genus database with same CATH homology
 2OBS A;  4Z4T A;  4OPO A;  3SEJ A;  3PUN A;  4X7C A;  4P1V A;  2ZL6 A;  5IYR A;  3LQ6 A;  4P25 A;  3V7A A;  3ASP A;  4OOX A;  4WZL A;  4ROX A;  4OP7 A;  4X7F A;  3ONU A;  5J3O A;  3R6K A;  3ASS A;  4Z4Z A;  4X0C A;  3ASR A;  3D26 A;  5IYQ A;  3AST A;  4RLZ A;  4QV2 A;  4RDJ A;  5IYW A;  3PVD A;  3Q38 A;  4Z4Y A;  5F4O A;  4Z4V A;  5IYN A;  5IYP A;  3PUM A;  3BQJ A;  4WZK A;  4P12 A;  2ZL7 A;  2OBT A;  4P26 A;  3SJP A;  4OPS A;  3Q3A A;  3SLN A;  4OOV A;  4Z4U A;  4RPB A;  4QVA A;  3R6J A;  4P3I A;  4WZE A;  3PA1 A;  4RDL A;  4P2N A;  4RM0 A;  4QVJ A;  3Q39 A;  3PA2 A;  3ASQ A;  3Q6Q A;  3RY8 A;  2OBR A;  4OPV A;  3SKB A;  5F4M A;  4QUZ A;  5KW9 A;  3SLD A;  4RDK A;  2ZL5 A;  4X7E A;  4Z4W A;  5BSX A;  4X07 A;  1IHM A;  3BY1 A;  4X7D A;  5HZB A;  3BY2 A;  5J35 A;  4X06 A;  5HZA A;  4Z4S A;  3Q6R A;  5F4J A;  3ONY A;  4Z4R A;  3LQE A;  4WZT A;  5E6T A;  4X05 A;  4OOS A;  5BSY A;  4RPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...