5BSYA

Crystal structure of gii.10 p domain in complex with lemon juice
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Treatment of norovirus particles with citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 71
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5bsyA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5bsyA01
2ZL6A 4QUZA 4Z4RA 4Z4TA 4WZKA 3SKBA 5E6TA 3PA2A 4X7EA 3R6JA 4Z4SA 4Z4UA 3PA1A 3R6KA 4X7CA 5HZBA 3ASRA 4X07A 3ONUA 4Z4YA 4RDLA 5IYNA 4X06A 4WZTA 5IYWA 4RDJA 3PUMA 3SEJA 3ASSA 3Q39A 1IHMA 2OBSA 3Q6QA 3PVDA 4X0CA 4WZEA 3BQJA 3LQ6A 4QVJA 5J3OA 5KW9A 4P1VA 4P26A 2OBTA 5BSYA 3D26A 3BY2A 4OP7A 4X05A 4RDKA 5HZAA 3Q6RA 4OOXA 5F4JA 4RPDA 5BSXA 4X7FA 3ONYA 4OOSA 3RY8A 3Q3AA 4P3IA 4Z4WA 4QVAA 5F4MA 4RPBA 5J35A 3Q38A 5IYPA 3ASTA 4ROXA 2ZL5A 4P2NA 5IYRA 4RM0A 4OPVA 4Z4ZA 4OPSA 3LQEA 4RLZA 3BY1A 3ASPA 4OOVA 4P25A 3SLNA 3V7AA 2OBRA 3SJPA 4P12A 5IYQA 4WZLA 2ZL7A 4OPOA 4X7DA 4Z4VA 3SLDA 3PUNA 3ASQA 5F4OA 4QV2A
chains in the Genus database with same CATH superfamily
4FWTA 4HE6A 4XORA 2DETA 1BPLA 5E6TA 2CBXA 2CC2A 4X7EA 4K1XA 4Z4SA 2GJRA 4XKWA 1W9XA 4FK8A 5TV2A 3B8HA 4YAFA 2GK7A 3KEWA 2VNKA 3VMFA 3CW2A 4HIZA 3ISXA 2HDNB 1EP2B 4G7WA 2JDIA 1Q82D 5AN9A 3QFSA 3E20A 3MCAA 1BX0A 1QUFA 4TMZA 2X6YA 1JA1A 1EFUA 4YALA 4AF7A 2HMAA 4X06A 3ZPNA 1ZM3A 4G5GA 1TTTA 3HAGA 2Q6LA 4UAJA 3QSYA 4ACAA 5IYWA 4LBYA 2F1MA 2X6XA 3GVKA 3W5UA 2RC6A 3Q39A 1KQSB 3JQQA 1R5BA 2AHOA 2B7BA 2X8KA 2PMDA 5A8AA 1SKYB 2CW5A 1E3ZA 1QFJA 4KKSA 2I1LA 2EFGA 3WNBA 1Q81D 3OPOA 5IK2A 2BV3A 2XNJA 4DQKA 3VNVA 3W2FA 3BCDA 3ZC3A 3GSIA 4U9UA 3VNUA 1G7SA 2ZZQA 3NE5B 4B3XA 5TR9A 1TLLA 4P26A 2OBTA 4FN5A 2P3MA 2X85A 1G7RA 1WTHD 3VO2A 1OHHA 3JQPA 4H9GA 2BGIA 3SJZA 4E0FA 1JA0A 4RCZA 5HXBA 1QFZA 1V5VA 3CP2A 2VBTA 4PC3A 5KSWB 4DQLA 5DS0A 2BSAA 2F43A 3JU4A 3G71B 4XOPA 5EMNA 2B7CA 5A89A 1UD2A 2M5SA 2ZZGA 4XNFA 2F4NA 1D8TA 3OZVA 4Y9UA 4ZGQB 5DSZA 3ZBUA 4DNRB 2E1BA 2QTLA 2QN6A 1VQLB 4QFMA 2C4UA 3Q3AA 2VNHA 2ZZEA 3OOCA 4Z4WA 1K73D 5F4MA 4YELA 2ZXIA 3Q38A 1UD8A 1QUEA 1FDRA 4GQNA 2GJPA 1TUIA 1UD6A 4RM0A 2QGGA 4Z4ZA 1WPCA 1E3XA 3G6EB 3OJXA 2ZTGA 1UD5A 2VNIA 2C78A 3SLNA 3FKSA 2YWGA 1QFYA 4YAWA 3AVTA 4P12A 4G6IA 1T5EA 2Z6BD 4B4DA 3T53B 4ZGNB 4TSFA 1D1NA 3ZZUA 1F60A 2WYRA 4XN3A 1KMHA 1H8HA 3J81k 4Y7CA 1QX4A 2BN4A 3WYAA 3P27A 3SLDA 1GO2A 4ZCLA 1BX1A 2GJKA 2BVNA 4II2A 3CCVB 3ASQA 1RQPA 5GV8A 3AVWA 4Z4RA 4WZKA 2BMWA 2NPFA 2XZOA 3OP1A 3CC7B 2DY1A 2BGJA 4P6VF 4XLFA 4Z4UA 2C77A 1KC8D 3OZWA 2X6WA 4XLCA 3WNDA 1XB2A 3PA1A 4M4SA 1KK2A 1VQ4B 3ASRA 1E64A 1QGYA 3OEEA 2KVOA 2GPJA 1I7PA 1H42A 1H85A 4AF6A 3ONUA 1N07A 3A8IA 1VLOA 4LBWA 3AGQA 3CCLB 3WNCA 1N06A 2DOGA 1FRNA 1U2RA 3B78A 4WZTA 1ZM9A 2VNJA 4P6YA 2PIAA 2OK7A 4ZV4A 1YJ9B 3OFNA 2Q6OA 4XM3A 2W6IA 1YIJB 1VQ5B 4TMWA 2R6HA 3FPPA 3T56B 3U6BA 4B48A 4M53A 1QGAA 2OBSA 1GAWA 1VQMB 4Q7JB 1FNCA 1GAQA 3CRZA 4YHBA 4C43A 2VBVA 1PJ7A 3CMMA 1G7TA 5FO1A 2QA4B 1VQ8B 2D9RA 3BQJA 2C5HA 1V0FA 4LC0A 1FNBA 2V7UA 2PE3A 3FPKA 1D2EA 5KW9A 3CPWB 4P1VA 3T51B 1Y0RA 2NV4A 2XNDA 5GV7A 1H8EA 1ELOA 1KJZA 2X53S 4XLAA 3BY2A 2ZTNA 1FRQA 1GJRA 1PJ6A 1QGZA 4OP7A 4ACBA 4RDKA 2DIEA 2PLFA 1YITB 3OE7A 1DDIA 3LNNA 2ZBUA 2GK6A 3OKXA 4NBSA 3CPXA 2OYNA 5TY0A 3CCEB 2W6JA 3MMPA 4RPDA 2VZLA 4LBZA 1QH0A 1EXMA 1J9ZA 2WSSA 4X7FA 3W2EA 2CRVA 3ONYA 5A88A 4YAUA 3BNWA 1NB9A 3WXMA 4TN1A 2BPOA 4QVAA 4RPBA 5J35A 2YWFA 5IYPA 5FNZA 2QDXA 1VQOB 3CC2B 2ZL5A 1XE1A 3WQZA 3ZBTA 2X0KA 3ZIAA 4RLZA 3BY1A 4YEJA 4JMQA 4OOVA 5KNLA 4ZCMA 3LVBA 4P25A 4B47A 3ES9A 2V7XA 4XONA 3ZZ0A 2WPDA 2OBRA 1E79A 2JIZA 1OGIA 4IW3B 3CCMB 1W0KA 3QFRA 3SJPA 3W5VA 4CQJA 1EFTA 4G1VA 3U2QA 4XMYA 4PC7A 4QHYA 1YI2B 4KKTA 4XQFA 3ZUGA 3G4SB 4OPOA 1W2BB 4Z4VA 3V76A 4XLHA 2V31A 2C5BA 2R9VA 2ZBVA 1K8AD 1I18A 3WBJA 2F1LA 3DDYA 2D74A 4PABA 4QUZA 4Z4TA 1N05A 4AVZA 4C0SA 4R71A 1WOSA 3PA2A 4RJLA 3R6JA 4PC6A 2CF4A 1DG1G 1BMFA 2Q6KA 4UZUA 3KL9A 3R6KA 4X7CA 5HZBA 3BCFA 3JQRA 3CTAA 1EWYA 1NDHA 1AMOA 2WZNA 4PC1A 1AIPA 4X07A 2QEXB 1HA3A 4N3NA 1P4MA 2XOKA 1BLIA 1Y0YA 2C4TA 2DYIA 4B3GA 3W2GA 3A3BA 2XZPA 3U6KA 2QE7A 1FNMA 1V0EA 5JBQA 2C2WA 1IB0A 1VHOA 3VO1A 4RDJA 3A35A 2BM0A 3PUMA 3SEJA 2XZLA 4WQMA 1W87A 1BQEA 3ASSA 1Q86D 3CC4B 2B5OA 4DK0A 1JJ2B 1QG0A 3ZZTA 2BM1A 4TMXA 4Y9RA 3Q6QA 5TRDA 2JN9A 2OK8A 4Z1MA 4AC9A 4M0LA 5DN6A 2V7QA 4WZEA 1JNYA 4F7DA 1W34A 4WWVA 1W0JA 2EIXA 3MHPA 5L46A 5H59A 4RCYA 3LQ6A 1TVCA 1DARA 5J3OA 1VJSA 2WJVA 1K28D 4XR6A 2QTZA 3GQBA 5B6IA 2GQFA 1ZM2A 1VHEA 1VLYA 4UZFA 4X05A 3CCJB 1VQ9B 3OW2B 2V4DA 3CXCB 1SKQA 2ZITA 3OJWA 1MRZA 2VJJA 4OOXA 2DEUA 4X8IA 3CB4A 3CMAB 4PC2A 5F4JA 5FL7A 3FJOA 3E1YE 3P26A 5BSXA 4TMTA 2YWHA 5FIUA 3B82A 1E1RA 3RY8A 3OAAA 1IJFA 3PENA 4P3IA 1WSVA 3GVJA 1W35A 1B2RA 1UD3A 4P3YA 3OEHA 1VQKB 3ASTA 2CNDA 1VQ7B 1FNDA 2WR8A 3BC9A 4P2NA 5IYRA 3AVVA 4P9SA 4OPVA 2OTLB 2GREA 3QE2A 4PGOA 4OPSA 1E62A 4L8JA 4RD4A 1OB5A 3ASPA 4ASUA 1NB0A 1EFCA 4PAAA 1VQ6B 4G7XA 4TKOB 1S4MA 3QFCA 3V7AA 1HZEA 2BF4A 4RD0A 4RD1A 1GVHA 4XKVA 3GIRA 4YXWA 1N08A 2ZZFA 2E1RA 4NNJA 5FO0A 1NRKA 2V7TA 2FX3A 2J7KA 5IYQA 2ZL7A 4X7DA 1WP6A 3CESA 3H9NA 5HKKA 4B3FX 2XNCA 1HVXA 2JJ2A 3AVXA 1E43A 3A1PA 3AGPA 4LBVA 4QV2A 3I55B 1YHQB 2ZL6A 1RQRA 2HLDA 3SKBA 3CCQB 4KKUA 1K9MD 1G7CA 1UD4A 3W5HA 4MYUA 2LZJA 3OW7A 5THXA 3OZUA 5LMZA 2XGJA 2OTJB 4YAOA 1EP1B 1R5OA 1VQPB 3W2HA 1E1QA 1KRHA 1COWA 1SM4A 4Z4YA 4XN0A 3WBKA 1KTVA 5FA6A 1N0UA 1XQBA 2V7VA 4RDLA 4RD2A 5IYNA 4G1BA 1NBMA 3WY9A 1F20A 2DCUA 1YLOA 1S0UA 2XEXA 3A8KA 3QFTA 1B23P 3I56B 4XLEA 2X3UA 4II3A 1S72B 2VYQA 1ZUNB 4NCNA 1A8PA 1IHMA 1EP3B 4ZCIA 1IJEA 3CCUB 1MABA 4M1KA 4XD7A 1E63A 3PVDA 1KZLA 4X0CA 1WOPA 1QVFB 1EFRA 1Q7YD 3BH4A 2QMUA 3VR6A 5H5JA 1XFOA 1NJID 2VJIA 1KD1D 4QVJA 2V7WA 3A8JA 1PJ5A 1T6ZA 2Q6IA 1KK0A 3A3GA 5BSYA 1CNFA 1YJNB 3AVUA 3D26A 3I1FA 4B43A 1WSRA 1N8RD 3LO8A 3AVYA 1WDTA 1VQNB 1FX0A 1UMKA 3CP8A 5HZAA 3Q6RA 4M2LA 1YJWB 1WOOA 1OB2A 1BJKA 4HE5A 4RD6A 2D3LA 4TMVA 3CD6B 2FVGA 1KK1A 4OOSA 2WJYA 1N0VC 1CQXA 3H94A 2YWEA 3CMEB 3G05A 3GVLA 4BPRA 4TT3A 3CCSB 1Q9SA 1PKVA 4ROXA 1JB9A 3CCRB 2VBUA 1T6YA 4J0QA 1DDGA 3LQEA 4MYTA 1ZM4A 4XOTA 1OGJA 5CDFA 1WORA 4FXUA 4XL9A 1M1KD 2JJ1A 2WZPP 1YX2A 1OB0A 2RC5A 4N3GA 4B44A 3W2IA 1M90D 4EH1A 2DERA 4WZLA 1GR1A 4RD3A 4DK1A 2HCJB 1T6XA 1R5NA 2CK3A 3PUNA 2D3NA 1QVGB 1I8DA 4DNTB 1WU8A 1VF7A 1KK3A 2VBSA 4UZEA 4P22A 5F4OA 2ZXHA 1CNEA
chains in the Genus database with same CATH topology
2ZL6A 4QUZA 4Z4RA 4Z4TA 4WZKA 3SKBA 5E6TA 3PA2A 4X7EA 3R6JA 4Z4SA 4Z4UA 3PA1A 3R6KA 4X7CA 5HZBA 3ASRA 4X07A 3ONUA 4Z4YA 4RDLA 5IYNA 4X06A 4WZTA 5IYWA 4RDJA 3PUMA 3SEJA 3ASSA 3Q39A 1IHMA 2OBSA 3Q6QA 3PVDA 4X0CA 4WZEA 3BQJA 3LQ6A 4QVJA 5J3OA 5KW9A 4P1VA 4P26A 2OBTA 5BSYA 3D26A 3BY2A 4OP7A 4X05A 4RDKA 5HZAA 3Q6RA 4OOXA 5F4JA 4RPDA 5BSXA 4X7FA 3ONYA 4OOSA 3RY8A 3Q3AA 4P3IA 4Z4WA 4QVAA 5F4MA 4RPBA 5J35A 3Q38A 5IYPA 3ASTA 4ROXA 2ZL5A 4P2NA 5IYRA 4RM0A 4OPVA 4Z4ZA 4OPSA 3LQEA 4RLZA 3BY1A 3ASPA 4OOVA 4P25A 3SLNA 3V7AA 2OBRA 3SJPA 4P12A 5IYQA 4WZLA 2ZL7A 4OPOA 4X7DA 4Z4VA 3SLDA 3PUNA 3ASQA 5F4OA 4QV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL6 A;  4QUZ A;  4Z4R A;  4Z4T A;  4WZK A;  3SKB A;  5E6T A;  3PA2 A;  4X7E A;  3R6J A;  4Z4S A;  4Z4U A;  3PA1 A;  3R6K A;  4X7C A;  5HZB A;  3ASR A;  4X07 A;  3ONU A;  4Z4Y A;  4RDL A;  5IYN A;  4X06 A;  4WZT A;  5IYW A;  4RDJ A;  3PUM A;  3SEJ A;  3ASS A;  3Q39 A;  1IHM A;  2OBS A;  3Q6Q A;  3PVD A;  4X0C A;  4WZE A;  3BQJ A;  3LQ6 A;  4QVJ A;  5J3O A;  5KW9 A;  4P1V A;  4P26 A;  2OBT A;  5BSY A;  3D26 A;  3BY2 A;  4OP7 A;  4X05 A;  4RDK A;  5HZA A;  3Q6R A;  4OOX A;  5F4J A;  4RPD A;  5BSX A;  4X7F A;  3ONY A;  4OOS A;  3RY8 A;  3Q3A A;  4P3I A;  4Z4W A;  4QVA A;  5F4M A;  4RPB A;  5J35 A;  3Q38 A;  5IYP A;  3AST A;  4ROX A;  2ZL5 A;  4P2N A;  5IYR A;  4RM0 A;  4OPV A;  4Z4Z A;  4OPS A;  3LQE A;  4RLZ A;  3BY1 A;  3ASP A;  4OOV A;  4P25 A;  3SLN A;  3V7A A;  2OBR A;  3SJP A;  4P12 A;  5IYQ A;  4WZL A;  2ZL7 A;  4OPO A;  4X7D A;  4Z4V A;  3SLD A;  3PUN A;  3ASQ A;  5F4O A;  4QV2 A; 
#chains in the Genus database with same CATH topology
 4FWT A;  4HE6 A;  4XOR A;  2DET A;  1BPL A;  5E6T A;  2CBX A;  2CC2 A;  4X7E A;  4K1X A;  4Z4S A;  2GJR A;  4XKW A;  1W9X A;  4FK8 A;  5TV2 A;  3B8H A;  4YAF A;  2GK7 A;  3KEW A;  2VNK A;  3VMF A;  3CW2 A;  4HIZ A;  3ISX A;  2HDN B;  1EP2 B;  4G7W A;  2JDI A;  1Q82 D;  5AN9 A;  3QFS A;  3E20 A;  3MCA A;  1BX0 A;  1QUF A;  4TMZ A;  2X6Y A;  1JA1 A;  1EFU A;  4YAL A;  4AF7 A;  2HMA A;  4X06 A;  3ZPN A;  1ZM3 A;  4G5G A;  1TTT A;  3HAG A;  2Q6L A;  4UAJ A;  3QSY A;  4ACA A;  5IYW A;  4LBY A;  2F1M A;  2X6X A;  3GVK A;  3W5U A;  2RC6 A;  3Q39 A;  1KQS B;  3JQQ A;  1R5B A;  2AHO A;  2B7B A;  2X8K A;  2PMD A;  5A8A A;  1SKY B;  2CW5 A;  1E3Z A;  1QFJ A;  4KKS A;  2I1L A;  2EFG A;  3WNB A;  1Q81 D;  3OPO A;  5IK2 A;  2BV3 A;  2XNJ A;  4DQK A;  3VNV A;  3W2F A;  3BCD A;  3ZC3 A;  3GSI A;  4U9U A;  3VNU A;  1G7S A;  2ZZQ A;  3NE5 B;  4B3X A;  5TR9 A;  1TLL A;  4P26 A;  2OBT A;  4FN5 A;  2P3M A;  2X85 A;  1G7R A;  1WTH D;  3VO2 A;  1OHH A;  3JQP A;  4H9G A;  2BGI A;  3SJZ A;  4E0F A;  1JA0 A;  4RCZ A;  5HXB A;  1QFZ A;  1V5V A;  3CP2 A;  2VBT A;  4PC3 A;  5KSW B;  4DQL A;  5DS0 A;  2BSA A;  2F43 A;  3JU4 A;  3G71 B;  4XOP A;  5EMN A;  2B7C A;  5A89 A;  1UD2 A;  2M5S A;  2ZZG A;  4XNF A;  2F4N A;  1D8T A;  3OZV A;  4Y9U A;  4ZGQ B;  5DSZ A;  3ZBU A;  4DNR B;  2E1B A;  2QTL A;  2QN6 A;  1VQL B;  4QFM A;  2C4U A;  3Q3A A;  2VNH A;  2ZZE A;  3OOC A;  4Z4W A;  1K73 D;  5F4M A;  4YEL A;  2ZXI A;  3Q38 A;  1UD8 A;  1QUE A;  1FDR A;  4GQN A;  2GJP A;  1TUI A;  1UD6 A;  4RM0 A;  2QGG A;  4Z4Z A;  1WPC A;  1E3X A;  3G6E B;  3OJX A;  2ZTG A;  1UD5 A;  2VNI A;  2C78 A;  3SLN A;  3FKS A;  2YWG A;  1QFY A;  4YAW A;  3AVT A;  4P12 A;  4G6I A;  1T5E A;  2Z6B D;  4B4D A;  3T53 B;  4ZGN B;  4TSF A;  1D1N A;  3ZZU A;  1F60 A;  2WYR A;  4XN3 A;  1KMH A;  1H8H A;  3J81 k;  4Y7C A;  1QX4 A;  2BN4 A;  3WYA A;  3P27 A;  3SLD A;  1GO2 A;  4ZCL A;  1BX1 A;  2GJK A;  2BVN A;  4II2 A;  3CCV B;  3ASQ A;  1RQP A;  5GV8 A;  3AVW A;  4Z4R A;  4WZK A;  2BMW A;  2NPF A;  2XZO A;  3OP1 A;  3CC7 B;  2DY1 A;  2BGJ A;  4P6V F;  4XLF A;  4Z4U A;  2C77 A;  1KC8 D;  3OZW A;  2X6W A;  4XLC A;  3WND A;  1XB2 A;  3PA1 A;  4M4S A;  1KK2 A;  1VQ4 B;  3ASR A;  1E64 A;  1QGY A;  3OEE A;  2KVO A;  2GPJ A;  1I7P A;  1H42 A;  1H85 A;  4AF6 A;  3ONU A;  1N07 A;  3A8I A;  1VLO A;  4LBW A;  3AGQ A;  3CCL B;  3WNC A;  1N06 A;  2DOG A;  1FRN A;  1U2R A;  3B78 A;  4WZT A;  1ZM9 A;  2VNJ A;  4P6Y A;  2PIA A;  2OK7 A;  4ZV4 A;  1YJ9 B;  3OFN A;  2Q6O A;  4XM3 A;  2W6I A;  1YIJ B;  1VQ5 B;  4TMW A;  2R6H A;  3FPP A;  3T56 B;  3U6B A;  4B48 A;  4M53 A;  1QGA A;  2OBS A;  1GAW A;  1VQM B;  4Q7J B;  1FNC A;  1GAQ A;  3CRZ A;  4YHB A;  4C43 A;  2VBV A;  1PJ7 A;  3CMM A;  1G7T A;  5FO1 A;  2QA4 B;  1VQ8 B;  2D9R A;  3BQJ A;  2C5H A;  1V0F A;  4LC0 A;  1FNB A;  2V7U A;  2PE3 A;  3FPK A;  1D2E A;  5KW9 A;  3CPW B;  4P1V A;  3T51 B;  1Y0R A;  2NV4 A;  2XND A;  5GV7 A;  1H8E A;  1ELO A;  1KJZ A;  2X53 S;  4XLA A;  3BY2 A;  2ZTN A;  1FRQ A;  1GJR A;  1PJ6 A;  1QGZ A;  4OP7 A;  4ACB A;  4RDK A;  2DIE A;  2PLF A;  1YIT B;  3OE7 A;  1DDI A;  3LNN A;  2ZBU A;  2GK6 A;  3OKX A;  4NBS A;  3CPX A;  2OYN A;  5TY0 A;  3CCE B;  2W6J A;  3MMP A;  4RPD A;  2VZL A;  4LBZ A;  1QH0 A;  1EXM A;  1J9Z A;  2WSS A;  4X7F A;  3W2E A;  2CRV A;  3ONY A;  5A88 A;  4YAU A;  3BNW A;  1NB9 A;  3WXM A;  4TN1 A;  2BPO A;  4QVA A;  4RPB A;  5J35 A;  2YWF A;  5IYP A;  5FNZ A;  2QDX A;  1VQO B;  3CC2 B;  2ZL5 A;  1XE1 A;  3WQZ A;  3ZBT A;  2X0K A;  3ZIA A;  4RLZ A;  3BY1 A;  4YEJ A;  4JMQ A;  4OOV A;  5KNL A;  4ZCM A;  3LVB A;  4P25 A;  4B47 A;  3ES9 A;  2V7X A;  4XON A;  3ZZ0 A;  2WPD A;  2OBR A;  1E79 A;  2JIZ A;  1OGI A;  4IW3 B;  3CCM B;  1W0K A;  3QFR A;  3SJP A;  3W5V A;  4CQJ A;  1EFT A;  4G1V A;  3U2Q A;  4XMY A;  4PC7 A;  4QHY A;  1YI2 B;  4KKT A;  4XQF A;  3ZUG A;  3G4S B;  4OPO A;  1W2B B;  4Z4V A;  3V76 A;  4XLH A;  2V31 A;  2C5B A;  2R9V A;  2ZBV A;  1K8A D;  1I18 A;  3WBJ A;  2F1L A;  3DDY A;  2D74 A;  4PAB A;  4QUZ A;  4Z4T A;  1N05 A;  4AVZ A;  4C0S A;  4R71 A;  1WOS A;  3PA2 A;  4RJL A;  3R6J A;  4PC6 A;  2CF4 A;  1DG1 G;  1BMF A;  2Q6K A;  4UZU A;  3KL9 A;  3R6K A;  4X7C A;  5HZB A;  3BCF A;  3JQR A;  3CTA A;  1EWY A;  1NDH A;  1AMO A;  2WZN A;  4PC1 A;  1AIP A;  4X07 A;  2QEX B;  1HA3 A;  4N3N A;  1P4M A;  2XOK A;  1BLI A;  1Y0Y A;  2C4T A;  2DYI A;  4B3G A;  3W2G A;  3A3B A;  2XZP A;  3U6K A;  2QE7 A;  1FNM A;  1V0E A;  5JBQ A;  2C2W A;  1IB0 A;  1VHO A;  3VO1 A;  4RDJ A;  3A35 A;  2BM0 A;  3PUM A;  3SEJ A;  2XZL A;  4WQM A;  1W87 A;  1BQE A;  3ASS A;  1Q86 D;  3CC4 B;  2B5O A;  4DK0 A;  1JJ2 B;  1QG0 A;  3ZZT A;  2BM1 A;  4TMX A;  4Y9R A;  3Q6Q A;  5TRD A;  2JN9 A;  2OK8 A;  4Z1M A;  4AC9 A;  4M0L A;  5DN6 A;  2V7Q A;  4WZE A;  1JNY A;  4F7D A;  1W34 A;  4WWV A;  1W0J A;  2EIX A;  3MHP A;  5L46 A;  5H59 A;  4RCY A;  3LQ6 A;  1TVC A;  1DAR A;  5J3O A;  1VJS A;  2WJV A;  1K28 D;  4XR6 A;  2QTZ A;  3GQB A;  5B6I A;  2GQF A;  1ZM2 A;  1VHE A;  1VLY A;  4UZF A;  4X05 A;  3CCJ B;  1VQ9 B;  3OW2 B;  2V4D A;  3CXC B;  1SKQ A;  2ZIT A;  3OJW A;  1MRZ A;  2VJJ A;  4OOX A;  2DEU A;  4X8I A;  3CB4 A;  3CMA B;  4PC2 A;  5F4J A;  5FL7 A;  3FJO A;  3E1Y E;  3P26 A;  5BSX A;  4TMT A;  2YWH A;  5FIU A;  3B82 A;  1E1R A;  3RY8 A;  3OAA A;  1IJF A;  3PEN A;  4P3I A;  1WSV A;  3GVJ A;  1W35 A;  1B2R A;  1UD3 A;  4P3Y A;  3OEH A;  1VQK B;  3AST A;  2CND A;  1VQ7 B;  1FND A;  2WR8 A;  3BC9 A;  4P2N A;  5IYR A;  3AVV A;  4P9S A;  4OPV A;  2OTL B;  2GRE A;  3QE2 A;  4PGO A;  4OPS A;  1E62 A;  4L8J A;  4RD4 A;  1OB5 A;  3ASP A;  4ASU A;  1NB0 A;  1EFC A;  4PAA A;  1VQ6 B;  4G7X A;  4TKO B;  1S4M A;  3QFC A;  3V7A A;  1HZE A;  2BF4 A;  4RD0 A;  4RD1 A;  1GVH A;  4XKV A;  3GIR A;  4YXW A;  1N08 A;  2ZZF A;  2E1R A;  4NNJ A;  5FO0 A;  1NRK A;  2V7T A;  2FX3 A;  2J7K A;  5IYQ A;  2ZL7 A;  4X7D A;  1WP6 A;  3CES A;  3H9N A;  5HKK A;  4B3F X;  2XNC A;  1HVX A;  2JJ2 A;  3AVX A;  1E43 A;  3A1P A;  3AGP A;  4LBV A;  4QV2 A;  3I55 B;  1YHQ B;  2ZL6 A;  1RQR A;  2HLD A;  3SKB A;  3CCQ B;  4KKU A;  1K9M D;  1G7C A;  1UD4 A;  3W5H A;  4MYU A;  2LZJ A;  3OW7 A;  5THX A;  3OZU A;  5LMZ A;  2XGJ A;  2OTJ B;  4YAO A;  1EP1 B;  1R5O A;  1VQP B;  3W2H A;  1E1Q A;  1KRH A;  1COW A;  1SM4 A;  4Z4Y A;  4XN0 A;  3WBK A;  1KTV A;  5FA6 A;  1N0U A;  1XQB A;  2V7V A;  4RDL A;  4RD2 A;  5IYN A;  4G1B A;  1NBM A;  3WY9 A;  1F20 A;  2DCU A;  1YLO A;  1S0U A;  2XEX A;  3A8K A;  3QFT A;  1B23 P;  3I56 B;  4XLE A;  2X3U A;  4II3 A;  1S72 B;  2VYQ A;  1ZUN B;  4NCN A;  1A8P A;  1IHM A;  1EP3 B;  4ZCI A;  1IJE A;  3CCU B;  1MAB A;  4M1K A;  4XD7 A;  1E63 A;  3PVD A;  1KZL A;  4X0C A;  1WOP A;  1QVF B;  1EFR A;  1Q7Y D;  3BH4 A;  2QMU A;  3VR6 A;  5H5J A;  1XFO A;  1NJI D;  2VJI A;  1KD1 D;  4QVJ A;  2V7W A;  3A8J A;  1PJ5 A;  1T6Z A;  2Q6I A;  1KK0 A;  3A3G A;  5BSY A;  1CNF A;  1YJN B;  3AVU A;  3D26 A;  3I1F A;  4B43 A;  1WSR A;  1N8R D;  3LO8 A;  3AVY A;  1WDT A;  1VQN B;  1FX0 A;  1UMK A;  3CP8 A;  5HZA A;  3Q6R A;  4M2L A;  1YJW B;  1WOO A;  1OB2 A;  1BJK A;  4HE5 A;  4RD6 A;  2D3L A;  4TMV A;  3CD6 B;  2FVG A;  1KK1 A;  4OOS A;  2WJY A;  1N0V C;  1CQX A;  3H94 A;  2YWE A;  3CME B;  3G05 A;  3GVL A;  4BPR A;  4TT3 A;  3CCS B;  1Q9S A;  1PKV A;  4ROX A;  1JB9 A;  3CCR B;  2VBU A;  1T6Y A;  4J0Q A;  1DDG A;  3LQE A;  4MYT A;  1ZM4 A;  4XOT A;  1OGJ A;  5CDF A;  1WOR A;  4FXU A;  4XL9 A;  1M1K D;  2JJ1 A;  2WZP P;  1YX2 A;  1OB0 A;  2RC5 A;  4N3G A;  4B44 A;  3W2I A;  1M90 D;  4EH1 A;  2DER A;  4WZL A;  1GR1 A;  4RD3 A;  4DK1 A;  2HCJ B;  1T6X A;  1R5N A;  2CK3 A;  3PUN A;  2D3N A;  1QVG B;  1I8D A;  4DNT B;  1WU8 A;  1VF7 A;  1KK3 A;  2VBS A;  4UZE A;  4P22 A;  5F4O A;  2ZXH A;  1CNE A; 
#chains in the Genus database with same CATH homology
 2ZL6 A;  4QUZ A;  4Z4R A;  4Z4T A;  4WZK A;  3SKB A;  5E6T A;  3PA2 A;  4X7E A;  3R6J A;  4Z4S A;  4Z4U A;  3PA1 A;  3R6K A;  4X7C A;  5HZB A;  3ASR A;  4X07 A;  3ONU A;  4Z4Y A;  4RDL A;  5IYN A;  4X06 A;  4WZT A;  5IYW A;  4RDJ A;  3PUM A;  3SEJ A;  3ASS A;  3Q39 A;  1IHM A;  2OBS A;  3Q6Q A;  3PVD A;  4X0C A;  4WZE A;  3BQJ A;  3LQ6 A;  4QVJ A;  5J3O A;  5KW9 A;  4P1V A;  4P26 A;  2OBT A;  5BSY A;  3D26 A;  3BY2 A;  4OP7 A;  4X05 A;  4RDK A;  5HZA A;  3Q6R A;  4OOX A;  5F4J A;  4RPD A;  5BSX A;  4X7F A;  3ONY A;  4OOS A;  3RY8 A;  3Q3A A;  4P3I A;  4Z4W A;  4QVA A;  5F4M A;  4RPB A;  5J35 A;  3Q38 A;  5IYP A;  3AST A;  4ROX A;  2ZL5 A;  4P2N A;  5IYR A;  4RM0 A;  4OPV A;  4Z4Z A;  4OPS A;  3LQE A;  4RLZ A;  3BY1 A;  3ASP A;  4OOV A;  4P25 A;  3SLN A;  3V7A A;  2OBR A;  3SJP A;  4P12 A;  5IYQ A;  4WZL A;  2ZL7 A;  4OPO A;  4X7D A;  4Z4V A;  3SLD A;  3PUN A;  3ASQ A;  5F4O A;  4QV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...