4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
molecule keywords eIF5B
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
4XH9B 4JVNA 5KO2A 2V6JA 3KTAB 3M1IA 2AHOA 2VHQA 1U9IC 4TYWA 4DLRA 1G19A 2VIIA 1U9IA 1LY1A 5LDDC 1J7KA 5GJCA 4NL4H 4LHWA 1YU9A 1JQLB 2TMKA 2NO1A 2P6UA 2OAQ1 3W34A 1R7RA 4FXPA 3CCQB 1LS1A 2GZDA 3LX8A 4OQFA 2QP3A 3THXA 5AJYA 1RPZA 1DDIA 5E7MA 1J2JA 1W0KA 2WSSA 3CONA 4LPKA 3FDIA 2VEDA 3AF4A 4GFDA 1ZU5A 3AUXA 5HKKD 2AFIE 2PH1A 1WQ1R 2BCJQ 5JWRA 3GFTA 4UQOA 5FTJA 2G3YA 1FMJA 1LTQA 1XCMA 5KHOC 2GXQA 3VR3A 2KBEA 1FNCA 2C9YA 4TMTA 1KK2A 1PV4A 3A1UA 2P65A 3UK6A 4JBYA 2CHGA 3QKSB 4C0QC 3UXMA 1YQTA 1EP1B 1KI2A 2VBCA 4P0TA 1XEWY 1YHQB 1Q1BA 1Z08A 1U0HC 2SHKA 1TU3A 2F3TA 1N0VC 4B71A 1E3MA 4NYMQ 3AV0B 1EWQA 3CRW1 1F2UB 1IJFA 2P67A 1E9DA 5D3MA 2D2FA 4BLTA 1TEVA 4B47A 3KJIA 2W58A 1F3OA 2VRWA 2XTZA 3D6TB 5KDLA 4IXNA 4GZMA 4MYHA 3B60A 4GPTA 5AR1A 3ZDQA 2RGAA 1OHHD 4UXIA 4U00A 1YRBA 5KOYA 1WRBA 2J45A 2A5JA 3K70B 4URXR 1TTTA 2F1JA 3KJHA 4GBMA 4OQNA 3ZIAD 4DLTA 4A36A 2NMVA 4FK8A 2IL1A 3F3YA 1NY5A 3H2YA 4Q1FA 4G5QA 2IT1A 4LHZA 2EVWX 3ZQJA 3FYHA 1N6KA 1Z0JA 1OIXA 2A5DA 5AUQA 2QBYB 4M1MA 3CH5A 4URVR 4B33A 1HE8B 1D8TA 1OJLA 3VR5A 1W1WA 3DZDA 3IILA 2EFHB 2IA5A 1KJWA 2J9RA 4NDZA 1OE0A 5AJXA 2Z4RA 3IGFA 4HLDA 1E9SA 1MR3F 4KAXA 4OL0A 1M74A 1Z28A 4Q1CA 5DIFA 2UZIR 4Q5IA 5FL7D 1KGDA 1OF1A 3SE0A 4JLBA 1QUFA 1BYUA 4LBYA 1L2TA 3EPHA 4GI7A 1VG9B 1FPMA 5FOWA 1XB2A 3HYTA 4PX9A 1A5TA 1TAGA 2B6HA 2QORA 1U90A 4IVRA 1W2BB 1JJVA 4HE5A 3AVUA 1NN0A 1WCV1 2R6DA 3UMFA 4DLWA 1I4TD 4W5JA 4CIDA 1NMXA 1XTJA 3MCAA 2C98A 2EWVA 4KHZA 4BRUA 1SKYB 1FMLA 2DY1A 1ONBA 1SKYE 1N5KA 3WRYC 2GF0A 3QIAA 1TEXA 4KVGA 5BN4A 5J4YA 2O8EB 2AL7A 3E1SA 4AKHA 4ARZB 3MGCA 3AEZA 2O0KA 4Z51A 2R6CA 2REOA 3MMPA 2RGBA 5JI2E 1DG1G 2GILA 3PV0A 4KJZA 2XB4A 1GNPA 2AKYA 3ZD7A 4O0MA 1G8PA 4C7OA 1EFUA 2YVUA 1CQXA 2WOOA 2G6BA 5HCIA 1FRQA 1AQYA 4V0KA 4DLXA 2ZRDA 3PG5A 4ZCLA 2ZI3A 3HU2A 1M34E 2JDIA 4AK9A 1Z0DA 3Q85A 3ZS9A 4K1XA 5IK2D 3THYB 2LKDA 3MWKA 1AS3A 1NMYA 5FI1B 4M8NE 2CRVA 1FNNA 3CF6R 3W5HA 4M9ZA 4LBZA 4D81A 1FQJA 2YOFA 2F3RA 5B2ZA 3A1SA 1F2TB 4JMPA 2EFGA 1CR2A 2Q0HA 2IYQA 5SZIA 3IQWA 2X3UA 4LJ8A 5FOVA 1KO4A 3S1AB 3W5IA 4RKFA 4DUGD 2J59A 4DVGA 2PBRA 3PCRB 5H68A 4G5SA 5EP1A 2C78A 4CZ2A 4IKEA 2BKUA 1N6RA 3VMFA 2CMKA 1LB1B 3GJ7A 4YONB 1T0HB 2REXB 5DSZA 1HQCA 4F93B 1EP3B 2AN9A 2BIFA 1XTSA 4CEHA 1KDOA 2IS2A 4NU0A 2CLSA 3WYAA 1E69A 4B34A 1SVIA 3BB4A 1ZJ6A 2QAGC 2V55B 2KB0A 4XWOA 1J8MF 3NWJA 1E0JA 2P6NA 1W5TA 1Q22A 2IF0A 4NZYA 2HLDA 4MUAA 2XX3A 4C2TA 4YAWA 2VYQA 3CCJB 1NL3A 3Q9LA 1ZVQA 2O8CA 1TQ4A 1S2MA 2BPOA 1O3YA 1TPZA 1KK3A 1A2BA 4PZYA 1EWYA 3ZBUA 4A2PA 1CF4A 3UKDA 1DEKA 4NYJQ 2QPTA 1Z2AA 2CXXA 4EJSA 4URUR 3OE7A 4G3XA 3T15A 2JJ8A 3QFTA 1YJNB 4G01B 4B2IA 2W6JD 4IEEA 5B30A 4C3ZA 4U5XA 1F60A 1NF3A 1TF2A 1KYIA 2R6HA 5GV7A 1HA3A 3U44B 3BJIC 3W3ZB 3ND9A 4JL8A 1G8FA 3GJ0A 3CRRA 2CJWA 2X77A 4UJ5A 4OI1A 3OZWA 1VMAA 3CX6A 2WVJA 3P32A 3TKLA 4U02A 3OE7D 3AF3A 3LXXA 3CLVA 3P1JA 4Z54A 3Q5EA 2PT5A 1YHNA 4PO9A 5KDOA 3C8UA 3QVVA 1QVFB 1XPUA 4Q21A 2NQ2C 3PEUA 1ZM3A 4KSCA 1N6OA 1FW6A 3FE2A 3LVBA 1MH1A 1GP2A 4KFRA 2XNDD 4Q9IA 2H7VA 1AMOA 4DSTA 1DPFA 2CL7X 4OK3A 1W36D 1P7CA 3TSWA 2LKCA 4KITB 1M90D 3VX3A 4A2QA 2DFNA 3FJOA 1AZTA 5CIQA 3QI2A 1ZU4A 2IWHA 1YR6A 2FMXA 4PHTA 3A4MA 3RNLA 1E4YA 4G5OA 1A4RA 4O25A 2ZYTX 1M6NA 3QG1A 3ES9A 2NIPA 2A5GA 1UF9A 3RS3A 4JKYA 3GLIE 3WBJA 1OFUX 3C4JA 2JLSA 2QDXA 1UFQA 4BEBA 1D9XA 1N8RD 2FNAA 3GCGA 3IIKA 2CCJA 5FFMA 4PC1A 3FMOB 3FKQA 3BFXA 4QM7A 2QTVB 5DE3A 1RRGA 4LHVA 4Q9HA 3TQCA 1CU1A 3V4RA 3BH0A 3IO3A 4JLNA 4DDUA 2QI9C 3U2QA 1RRCA 2ZRAA 3THOA 2J0QA 2ZI5A 4BLRA 3I5YA 2OTLB 4ZCMA 2EWWA 2XZLA 2GZAA 2I1QA 1FX0B 1LV7A 2FSIA 3RS4A 1K5GA 5GJWC 4GOKA 3ZBTA 4DZZA 1FP6A 2QQ0A 4HB4A 4F4IA 3C5CA 1GL9B 3U7EB 4Z1MA 5GVSA 3ADBA 2CL6X 3I73A 5JFGA 3SHWA 4ERNA 2N42A 1JPJA 3F8TA 1XMIA 4DRZA 2FSFA 2XAUA 2V1XA 2IUTA 3TW8B 4TL9A 1MOZA 1XDBA 3EWSA 2XSZA 1AKEA 1MKYA 4TWZA 1LFDB 5JRZA 2X8AA 3C14C 3IO5A 2GXAA 1JR3D 1X3SA 5JS8A 4E03A 2BBOA 3NG1A 1M7BA 3LFUA 4JLKA 2J7PD 3LAWA 1K6MA 2NG1A 5JHHB 2BM0A 4YAOA 3ZVLA 1D2MA 3LBHA 1KQSB 2X2FA 1AZSC 1X1SA 4Q02A 1H42A 3VO2A 3E70C 2FDCA 1ZNZA 2XZPA 2O52A 4MKGA 1XBTA 1EK0A 2D62A 2BM1A 4W7SA 3EXAA 2VHUA 1XPOA 1TUEA 4LYHA 1F20A 1ZM7A 3K70C 2Q6TA 2FSGA 2VYFA 3CCVB 3RRMA 4ZDIA 4D4KA 3U3MA 3EA5A 3QBTA 5JMTA 1W4BA 4B6FA 4RD6A 1M1YE 4M1SA 1UKYA 4NCHA 4X8HA 4Q7LA 3IBGA 1QVRA 2A5YB 3C41J 3VU9B 3PXGA 1GUAA 4EPXA 1DO2A 1VECA 2ZETA 2F1IA 3ZZTA 4B3BA 4M4SA 4TSFA 2RB4A 3QSYA 4HUQB 2ZJOA 4I81A 1Q3HA 1QHNA 4LV8B 1JQJC 4DEXA 1W0JD 1FTNA 1OLOA 4GNKA 1DAIA 1VHLA 2D7DA 5TR9A 3UPUA 4BE7B 3H4MA 4OHXA 1XJCA 2BN4A 4TLBA 2HEIA 3UWKA 4TT3A 1VCIA 4XTRA 3GFOA 5FUVA 1UBFA 2ZJBA 1E98A 3EZFA 1BX0A 2OCYC 3CR8A 4D25A 1VKJA 1E9CA 1XTKA 1YR8A 1G21E 1HT2E 4WAUA 2F43B 2RGDA 2AFHE 3IBYA 1VDZA 5EXPA 3RRYA 3THXB 1KRHA 2EFEB 1NRJB 3QF7A 3H84A 3SDZA 3L0SA 3OEED 4HB2A 1GVHA 2GESA 4M1OA 2VH5R 5FUXA 2HYIC 3FGNA 2BSAA 2CNWD 2J46A 1R5OA 1QFZA 2BMWA 2JATA 5CLLA 3RWMB 1W4CA 1X86B 2YNMA 2ZM5A 3O8CA 2ZI7A 4CEHB 1HURA 3QXJA 2P3SA 1R5NA 4MYTA 3GJ6A 4LJAA 1ZIPA 1U8AA 1SVOA 4L5BA 3GLFE 4FIDA 2W83A 1YJWB 2JLUA 4DCNA 1CJVC 1XEFA 4DKXA 2GJSA 5BXQC 2XNCA 1BIFA 1Z5ZA 2GBLA 2VP6A 4TLEA 3FHTA 3QXHA 2IWRA 4TL6A 4HAYA 1ZAKA 2IYUA 5IDVA 5J47A 4Q1AA 4Z1MD 4GDFA 3EPJA 4GSYA 4C2UA 1GSIA 2MSDB 3CC7B 5E7IA 3VX4A 5L3SB 4UNQA 1KHTA 2WIAA 5C1BA 1MO3A 5KTYA 3IIJA 3TAHA 1VQNB 4KLNA 3BOSA 2QY9A 2YYZA 2V7QD 3BK7A 4JL6A 721PA 1P61B 2QU8A 3LDAA 2QG6A 1Q82D 3WNBA 1OYWA 4DLUA 2GQFA 1PUJA 3QBVA 2ZEJA 1SXJC 4TLDA 2WWXA 1SVKA 2FPLA 4A6XA 2VSXA 2DB3A 2HXSA 4DSNA 2BBSA 1W7AA 2JLRA 3K9NA 1CNEA 3MUFA 3CCRB 2OCPA 1II0A 2YWFA 1D9ZA 2J0VA 2IYLD 1N3BA 5HXBA 1G18A 1VYTA 3N2IA 3P4YA 4WZBE 2JAQA 1PZNA 2XOKA 5CK5A 3S1AA 1X8KA 3TH5A 4BLOA 3RYTC 2WWGA 2WWWA 4V0LA 2W6JA 3QFRA 4OHYA 2GEVA 2Z43A 1Q7YD 4YMTA 3ZC3A 4PZLA 1T8UA 2CE2X 4GT1A 4P4SA 3IHLA 2ZUCA 2C77A 1T9HA 2OBMA 1G7SA 3ZZUA 1COWD 3AUYA 4MRPA 2GCOA 4IFBA 4BZXA 2WJIA 3Q7PA 2H8KA 3P4XA 2FFAA 3ETLA 3CWQA 1TMKA 4WIAA 4DB4A 2CK3A 4G5RA 2GWHA 5JLJA 3JQQA 4LV6A 1ZW6A 2PT7A 3KKQA 2QZ4A 1KO1A 4Q4AB 1KZ7B 2CVHA 3GJ8A 4LCBA 1E2KA 1D6JA 2ODEA 3MLEA 4XSHA 2J7KA 4J0QA 3EC2A 1E1RA 2ZJZA 1TQDA 4M53A 5G53C 3OAAA 1Q21A 2A9KA 4MQBA 5HTKA 3PQCA 2PMDA 3CPWB 3SJCA 2FX3A 4OQXA 5SZKB 4EIWA 1NSTA 4Q4LA 4AY2A 2CCGA 2RGXA 3REGA 2Z0MA 4PC6A 1P75A 2KBFA 2VLIA 5FA6A 4GOXA 4DDTA 4YAFA 3AVXA 1SXJD 1II8B 4TQUS 2GVZC 1MO6A 3WRXC 3ZGXA 2V9PA 3PEVA 1R4AA 2NO9A 1EFTA 1Q0UA 3REFA 2BOVA 3OEHD 4HATA 4CRWB 2XTNA 1YZNA 2KE5A 1W34A 4XVRA 4DCSA 1UKZA 5FOXA 1F5NA 2JJ1D 1CS4C 5J4VA 2E9SA 2R6AA 1XFAA 4PHHA 4RZ2A 1IN6A 4LWZA 1OH8A 2QM7A 4QHYA 5AUNB 1M2OB 4PPNA 1T3LA 1SHZA 4B4DA 3FFBA 1E2LA 1NG9A 2V8OA 3P27A 3U6KA 3DZ8A 3MFYA 4KFUA 5IHPA 1DARA 2PX0A 2KI5A 1E1RD 4OBEA 3CRQA 2EU8A 1EFCA 2YC2C 3KUCA 4NBSA 1N5LA 2OT3B 4GMXA 5F3WB 1GDDA 4HSEA 4XSGA 3VQTA 3AKCA 2WPDA 2D2EA 3B1VA 1WP9A 2AWOA 3U6BA 4OHZA 1GM5A 1KSHA 3AVTA 1XE1A 3W2GA 4XJXA 2OK7A 4LYJA 1XU4A 4B44A 3GJ5A 5DO9A 3VR4A 1U8YA 5BQ5A 3WY9A 4HDQB 1W5SA 2GCOB 2QMOA 1IONA 4G1VA 3IDQA 4MGYR 4LJ7A 3W90A 4C0SA 4BPBA 1UEJA 2PMKA 3DMDA 5FBQB 3RS7A 4BLPA 5IT5A 2FOLA 2O0JA 2GF9A 2ZREA 2N46A 2WHXA 1W2HA 1IN4A 1OSNA 5BYJA 4IDNA 4WQMA 2D7CA 4DDWA 3DOEA 1ELOA 1TADA 2D06A 1F2UA 2GHIA 3DVLA 1Z83A 2QL6A 2DWQA 1GRRA 1E6CA 4KSBA 2MMCA 3DHWC 1G5RA 3LLMA 4CYMA 5D3MB 5EE9A 5A0FA 5F98A 1B0UA 4IXMA 5K8LA 4Y7CA 1H8HD 3UIEA 2F55A 2ZE8A 2BC9A 3LBIA 1K9MD 5CIWA 5G41A 2B7CA 3MWLA 3CX7A 3HDTA 4GMDA 4KXFB 1Z6AA 4TT3D 3B1WA 5L3SA 2IEYA 521PA 1E2JA 1TUIA 4TYNA 2O8CB 3LO8A 2VP0A 1K73D 1IY2A 1HUQA 1J9ZA 1KOFA 2NO0A 2QQEA 3AKEA 4PHFA 1VQPB 3SJBA 1XJQA 4N3GA 3RWOA 2IF2A 4EFLA 5CYOA 4UAJA 4NHOA 1EFRA 1IXZA 3I4LA 1K8AD 2WAYA 1VG0B 5HR5A 1AGRA 2Q9BA 2XNDA 2CLCX 4P3YA 1MRSA 1E1QA 2GZHA 2ONKA 4RSGA 5THXA 3WBKA 1KTVA 3PITA 2BEJA 4FCVA 2Y8EA 3C5HA 2G77B 2XITA 2RGNC 2CEAA 3SEAA 3BAFA 2WJYA 3AVQA 4B2LA 2IHYA 2CHQA 5FUWA 1OFHA 2ZYUX 5EP3A 4B3GA 4BFWA 2REBA 2FPMA 3MRSA 1A8PA 2HJVA 1CXZA 1QBKC 1P9RA 3A36A 4MRSA 1KO8A 4DCVA 3E20A 4JS0A 3BH6A 3FB4A 2BMEA 1R0WA 1DTSA 1XTQA 4L9WA 1T5LA 1UPTA 2DWPA 4RVCA 2JLXA 3HYRA 3ZVNA 2ATXA 2F43A 3EWAA 3SNHA 4DT1A 3HR8A 4HLUA 1LF5A 2ZRJA 2HJGA 1KK0A 3DOFA 4RD4A 4HYYA 4M0LA 1G3RA 4A2WA 1OV4A 3L8YA 5G3YA 4A92A 1KI3A 2QUZA 4XIGS 2QROA 2YWHA 4QFMA 1QG0A 5KSWB 1W46A 1II9A 1R0ZA 3VR1A 2DFKB 3NKVA 1FFHA 4C9BA 2NOAA 3LA6A 5TDHA 2HCBA 3HPQA 2G1KA 1D2EA 3FFAA 2PCJA 2JLQA 4A0GA 2HT1A 1S0UA 2X19A 4OI2A 1NJFA 4KVAA 3TMKA 3O8BA 4WOPA 5J5CA 3IHWA 3CM0A 2C95A 4A1FA 3LQRA 2XNJA 1ZIOA 1CP2A 3K70D 1Z29A 3OEEA 5IF9A 4YMWA 5AUPB 3KUDA 3B1YA 4B43A 4YLGA 4ESHA 3CW2A 1S72B 2VL7A 5FTLA 5KYKA 2QTZA 3OIUA 5B64A 4PSAA 4KI0A 5KU1A 4DUGA 4OJQA 3GLFA 1Z63A 1Z07A 1QZXA 2J0UA 4M9XA 3U44A 2QRZA 2ZSDA 2DETA 2R44A 1KI7A 4JKIA 1DADA 2J7PA 5JSZA 2H17A 3R8FA 2OBNA 5FPYA 2QMHA 1XMVA 3JZAA 1GL6A 2AD1A 3TGPA 2ZI4A 4TTPA 3R9IA 2CCKA 1QHYA 1BMFD 4Q01A 2ZU0C 4CEJB 2RMKA 3K09C 1T3SA 4D82A 1HH4A 1KJZA 1KJYA 2Q3HA 2H1LA 3K09A 4JBWA 1Y3AA 2AWNA 4KFSA 2EFCB 2ZPTX 3SS8A 2B7BA 3BC1A 1G5PA 4JSYA 3NBFA 1DE0A 3TAUA 4GP6A 2QTLA 5FL3A 4US2R 5SZJA 5JZVA 5GJVC 2N1BA 4D0GA 2PEYA 1GAWA 1ZM2A 3KQNA 2G83A 1UADA 2VHTA 4P4TA 4Q9KA 3X1YA 1XMSA 4OQLA 4BECA 4E07A 4DSUA 5EMNA 3WMEA 3I56B 5FOSA 2ZXUA 3B13B 1J8YF 3QPUA 2C99A 3SOPA 2PX3A 3CUEF 1NDHA 2VA8A 4C0AC 3T1VA 2P6RA 3BIFA 4V03A 1XX6A 4XVQA 2HCJB 4E22A 2EIXA 2MSEB 2ZJAA 4IOMA 1G7CA 4DC9A 5FPKA 2FV8A 1Z8FA 2WIBA 5EUQB 1CJKC 2XGJA 1JPNA 1AM4D 1HV8A 1BOFA 2OXCA 4WBSA 5FBWB 1DAFA 4BZQA 2VZLA 3VNVA 5FOUA 3LW8A 1Z06A 3AB3A 4IEIA 4QXAA 3GLGA 3UMSA 3QKTA 4EPRA 2R6FA 4HLUC 4LV5B 5FOTA 4M1KA 4PXAA 4B6EA 2OLJA 1J90A 4ZKEA 3LV8A 1RZ3A 2VF8A 4DLSA 4BQSA 1YR9A 4DJTA 2X2EA 2ODWA 1KMQA 3ICEA 1MO5A 5H5JA 3BWDD 3FPAA 4JLVA 4Z8XA 4AKEA 1ETUA 4DT1B 4XD7A 5B57C 4EKDA 3CR7A 4R9UC 4NPHA 1H85A 4AG6A 2C04A 1BMFA 3L0PA 3IKJA 2XJ4A 2IBMA 3G6EB 3CKLA 4A8JB 1NN3A 3L2OB 3QPVA 3KXLA 4TL8A 1BJKA 4OQMA 1ZYUA 221PA 4ON9A 3SJZA 2JJ2D 1OXXK 1RYHA 3GD7A 4EJSC 5KPJA 4LHXA 4DIEA 1OKKD 4OI0A 1E79D 1OH7A 4II7A 1QG2A 3SYNA 3AGQA 4ZV4A 1KNQA 4V0ME 2WTUA 1EESA 5DGXA 3SBDA 3KKOA 4Y9RA 3CC4B 4UNNA 2WV9A 1BYIA 2OG2A 3DL0A 3GMTA 1V5WA 1M8PA 2OM2A 1Z0IA 4RD3A 2JJ2A 4FWIB 421PA 3QEJA 3FPKA 3K0FB 3SBEA 3LVQE 2ATVA 5AJZA 4UKDA 2BCGY 1X1RA 4A8JA 4TYYA 1SULA 1KO7A 2G0TA 2W0SA 1ZP6A 4RFSA 3FKSD 3TE6A 1O87A 5K8UA 1P73A 2QT0A 1S9HA 1HQYE 1P2SA 1KY2A 2ZI6A 2ZSFA 4A0RA 2ECKA 5EQTA 5KPDA 2GCNA 1IN8A 4OK5A 2WOJA 3B5JA 3CMAB 3AF1A 2OK8A 4TN1A 2ZE7A 3NDPA 4QBGB 1IB0A 1KY3A 4EUNA 1NKTA 4BFUA 4LI0A 2QP9X 4A82A 1QDEA 3BD9A 1EFHA 2R62A 1BKDR 4ZDWA 3EIQA 1EXMA 1KI1A 3LO5A 4C30A 3DPUA 4PPQA 1QGAA 2ZANA 4AYXA 1GAJA 2RCNA 3SZRA 2ZJYA 1B23P 2AXNA 3SJAA 3TUZC 1JI0A 4LC1A 1JAHA 1V43A 4TQ9A 5DI9A 3B6EA 1I7PA 3GEIA 4I1SA 3UG7A 5D3QA 1N6NA 1QX4A 2JIZA 5J4LA 3U61B 3T5GA 3ZVRA 2AX4A 2WMOB 4CW7A 4PC3A 2IYTA 5CYPA 1U94A 4JLJA 4MGIR 1N6IA 3I55B 4G5GA 4MYUA 1M7GA 2CJWB 4QNRA 4NCNA 1CJMA 4ZO4A 4HDCA 4MRRA 2HDNB 1GNRA 1NIJA 2ZJ2A 4AI6A 3QE2A 5UKDA 3VTKA 3LXRA 3OZUA 5EXXA 2OAP1 2XTMA 3E5HA 2RGCA 4JT4A 3CNLA 3IEVA 1OH6A 1NLYA 2IYRA 2AK3A 3HPRA 4KBFA 3TW4A 4KBGA 3W6PA 3I62A 2J1LA 1XWIA 2A3RA 2FF7A 1JALA 2LCFA 3IIMA 3OIWA 4A8JC 4K46A 2BWJA 1EGAA 1TU4A 3NHBA 4JVSB 3GFPA 1OGJA 2GTPA 3EZ2A 4AYWA 3CO5A 1W36C 1DOAA 2FH5B 4M9SA 3VKHA 1NSFA 5L3QA 1BX1A 3H86A 4XVUA 3J81k 1CR0A 2A5FA 2A78A 2LWIA 2QTHA 3I61A 4B3DA 3HP1A 1W0JA 1KC8D 4QKQA 3QEOA 4RY2A 2QTFA 3I32A 1GRQA 5FTNA 3U7GA 2VSOA 3ASYA 8OHMA 4AKGA 3NH6A 1KNXA 1RC8A 2NZJA 3TBKA 2OBLA 5EJEA 2IS6A 2BBTA 2XB2A 1F48A 4HE6A 5TY0A 2DYKA 3E1YE 1E2GA 1GWNA 2C9CA 2OHFA 5JBQA 4AWXA 4EFMA 1WA5A 1X8JA 2V6IA 1Z22A 2ZQ5A 2L0XA 4PAQA 2O0HA 3QJYA 4FMCB 3X1WA 2QSZA 4D4LA 4B3FX 1YZUA 3W6NA 4QJ3A 1D5CA 5JI3E 1KK1A 2V4ZA 2B21A 5CM8B 3RLFA 1QGZA 1VIAA 1ZNYA 1UDXA 2BVNA 4HAXA 3TSOA 3I5XA 2ZJ5A 1H8EA 3CPHA 3QUSA 1E2IA 5LB2A 2CE7A 1R2QA 4YXWA 4Q4JB 4TYPA 4P33A 4DLZA 1OB2A 1AGPA 2WKQA 3GEEA 4NP6A 4R71A 3FTQA 4FMDB 3Q7QA 3GLHB 5BW8A 2ZJ8A 4TL7A 2H57A 1VQKB 1KI8A 2JEOA 4LYFA 1E2MA 3B78A 3VKGA 4NCIA 4POAA 1T0JB 2RKOA 3RS5A 3VU9A 4Q9LA 2GJKA 3PIRA 4C0LA 1W35A 4C7OB 1UKVY 1ZM4A 2FZLA 2IYYA 2XEXA 4ZGQB 1OYYA 5AN9A 3CB4A 1DAGA 1QFJA 2GAAA 3AP3A 3CF2A 1TQ6A 1SXJE 1IM2A 1JR6A 4ITRC 3CD6B 4LC0A 3TUIC 2Q9CA 1JXMA 1DDGA 1J70A 3GPLA 2W2VA 5EP2A 3WYGA 3PENA 1RRPA 5EP4A 2W2TA 4Q48A 4AKIA 1ZINA 1YZLA 2RHMA 2IS4A 1S1MA 4I1OA 2QT1A 4BEJA 2F9MA 3MWYW 1HE1C 4DLYA 1E0AA 4FN5A 2QGNA 2WKPA 5ANRB 4E5UA 2Q9AA 1PUIA 1R10A 2YOHA 2WJVA 4QBIA 5FPTA 3W9YA 4TMVA 1LF0A 2OE2A 4V02A 3I3SR 4D4JA 2F7SA 3GLGB 1SXJA 3KKMA 3MHPA 4KYIB 4S2EA 1KZGB 1US8A 3AF0A 2VNKA 4WXPA 121PA 3SQWA 4G1UC 3FMFA 4LPSA 3ECCA 4DSOA 1GKYA 4RD0A 2V7QA 3HWSA 5FBVB 4HLQB 4YQFA 2GRJA 1GO2A 4IDPA 3K8YA 1ZD8A 1Z2CA 4TYQA 4EJSB 3KL4A 1XP8A 1UDWA 3EG5A 1S4QA 3PJRA 1ZBDA 5J4KA 1U81A 4H1UA 4YMUA 2QN6A 2AKAB 5F9FA 3LW7A 1Z0AA 4RCZA 5TARA 1HY3A 5CJPA 2QBYA 5E4FA 1P60A 1RFLA 1T8TA 2HT6A 3CH4B 3KFVA 5DISB 1E2NA 2VNIA 1FOEB 1JXOA 1Q44A 2YC4C 4NYMR 5J40A 3NDBB 4MKHA 4DQLA 4N0EA 3QVUA 4K81B 3NEJA 2IYZA 4MDFA 2VP5A 2ZRMA 2NGRA 3ZVMA 4MYCA 1A2KC 4C4PA 1W49A 1XD8A 2ZIAA 1VCNA 1FNMA 2Z83A 4IVQA 5AWFC 5CM9C 2BEKA 1NBMD 3FHCB 1UAAA 3AVYA 2GDJA 1Z6GA 3B9PA 3WP0A 1CKEA 1QF9A 1N25A 3QG5A 3JQPA 1KKMA 1ZNXA 3GJ3A 4TMZA 3O8DA 2XXAA 2XJ9A 3AVOA 4IDHA 1YZGA 5G40A 2QENA 3U3JA 1LS6A 1E32A 2WMNB 1F2TA 1N6LA 2YZ2A 2FE4A 1OT3A 4ZGNB 2QNRA 1E9AA 1GG2A 1JA0A 5FI0B 1E94E 2FFHA 1I4LD 3EASA 4PAOA 3CIOA 4HZUB 4TMKA 3QKRA 1NBMA 5HZHA 4N0DA 3K1JA 1P2UA 4U9UA 2Z6VA 4B75A 1YI2B 4DHEA 3MWJA 3TVTA 3ZS8A 3ZD6A 4WXRA 1Q86D 2KSQA 2QA4B 2B92A 3W2FA 2XSZD 4L15A 3CNNA 3NBXX 4LJ6A 3OHMA 4XD7D 5DHFA 3A37A 4P4UA 1GKUB 1VYUA 2VO1A 3X1XA 4TSFD 2CLDX 2VP4A 3I72A 3SYKA 2ZS9A 2GK6A 1COWA 1JBKA 5GVRA 1G7TA 3ICQB 4EPWA 3KXIA 1NJID 4Q7MB 4W5WA 1SVMA 1ESMA 2QE7D 3PFIA 1NNEA 4LRWA 3D8BA 2BGJA 3QFCA 1NI3A 3HR7A 1QHXA 4HAUA 4PZZA 1L7VC 2WZQA 3B82A 3T5DA 4EFNA 1OXUA 1QFYA 3Q3JB 1VQOB 1JB1A 1E62A 4JLMA 2PJRA 3R7WB 2YWEA 4JLDA 2ORVA 4EQ6A 5TV2A 1CR1A 3AVVA 3Q5DA 1ZUNB 2NPIA 1XF9A 1E0SA 3KXKA 4UNSA 4CT5A 5LD2C 1DAMA 5F2EA 3CX8A 4IFEA 1HT1E 4BLQA 1FQKA 1LVGA 3NEYA 3T61A 4QM6A 2PCLA 1XZQA 4CF7A 2CL0X 1SM4A 2IXFA 1NBME 1XEXB 4MITA 1N6HA 3CZQA 3GQBA 3KQUA 3RDPA 4HAWA 4RFSB 2ZSBA 1R8SA 2ANBA 2ZR0A 2JLWA 1M7HA 3C7KA 5FBLB 5JECA 1FNBA 3R9WA 4C0JA 1KAOA 1ZM9A 1KDTA 1NP6A 5JWOA 4Q47A 2KWIA 3ADKA 4BFSA 2IUUA 1G3UA 1K8RA 1XXHA 3CZPA 3K0AA 3BGWA 3LQQA 1QUEA 3F0TA 4DQKA 1NIPA 2WJJA 4LUCA 2J0UB 5CJ2A 4F7WA 1CR4A 5H8WA 2QAGB 4CT4B 1QHHB 3U3OA 3M6AA 2GETA 3SYLA 3AVWA 1EWRA 1G6HA 4P4SB 1SVSA 2FEMA 3KX2A 3K9HA 3JQRA 4TTQA 5HZKA 3QF4A 4PPFA 5B58C 3N70A 1G291 5KNCA 3KJGA 5DI3B 2YKGA 5F9HA 1X8LA 2GNOA 4PTLA 2JA1A 4OK6A 1QGYA 1JJ2B 4BWYA 1EX6A 3I1FA 2ZVQX 4M22A 2A2ZA 4LJ5A 3UWOA 1UJ2A 1Z0FA 3QPWA 4PQRA 4Q1EA 4M1TA 4QHTA 3ZYCA 4Q03A 4ZDJA 3ADDA 1GRNA 1KDPA 3PEWA 3SFZA 4NKRA 1DBSA 1S3SA 3SR0A 5AUOB 1FNDA 1VCOA 5JCZA 4NCKA 2W2XA 4CEIB 1QHSA 1N0UA 5DNYB 5JEEA 3VKWA 3BS4A 4LX0A 4RJLA 3EIHA 4BFYA 1KI6A 5BYKA 4MDEA 5EE0A 2B8TA 3BERA 3RS2A 2OFOA 2CNDA 1GKIA 4KODA 4UXJA 3A1TA 1GTVA 4WZ6A 4ZPXA 1W4AA 3PUZA 3NBZC 5JJKA 2DEUA 2ZRKA 3T06B 2ASEA 3GLGE 1N5IA 3U4QB 1XRJA 1XD9A 5HPYB 1ZNWA 2PLRA 4A0FA 2ZYWX 5C46F 4CEJA 1WE2A 2BV3A 3P20A 2QGZA 1ZUIA 1OHHA 5KSOA 2G1JA 4NYIR 1G4AE 4BASA 2BDTA 5FR1A 4ZKDA 1OW3B 3LD9A 2AXPA 6Q21A 1NJGA 4IVPA 3CCSB 4QHSA 4BGDA 2IXEA 2QA5A 4HAZA 4RKEA 4TTRA 2J3EA 1FP7A 1G41A 1JB9A 2IXGA 5DN6D 2GK7A 4ACBA 1RIFA 1NN5A 4JYBA 3FMIA 5GJBA 1CRQA 2HF8A 4A0HA 3TR0A 3KQHA 1NN1A 4G1BA 4C0KA 4QGFA 3B85A 2A7QA 5JJIA 3H0KA 2GKSA 3DMNA 3CNOA 2FN4A 1KSFX 4NYIQ 2OV2A 1OPXA 5LB4A 1PLLA 4ACAA 1QVGB 4C43A 1WBBA 3DO6A 2F1RA 2V1UA 1XTIA 1PVOA 1ZD9A 2FEOA 4PR0A 1W48A 4Q19A 5SZHB 3VAAA 1SHKA 4QNMA 1KD1D 3SQXA 3V00A 3T12A 1GFIA 3NH9A 3A1VA 1AKYA 5KDDA 2CDNA 4Z8YA 3OJWA 2PZEA 1ZRHA 1WB9A 2PEZA 4MH0R 3RABA 4B35A 4DCUA 4B73A 1YVDA 3OFND 4NMMA 1G64A 1Q3TA 1SQ5A 4L16A 1G5TA 2XNSA 3VR6A 2QE7A 5C4GB 4FW9A 4I1UA 3W6OA 4OJKA 1YITB 2ZAMA 4ZIRA 1YE8A 5LBIA 4WZAE 3TVDA 4Y0VA 4LBWA 1G3IA 1YJ5A 3BE4A 4RD1A 4ZCIA 1U0LA 1MV5A 1UEIA 2I4IA 2J87A 4JJZA 2RH5A 5TB5A 1Z0KA 5ELXA 3FWYA 2BJVA 4QGGA 5FTKA 4DBLC 4QOSA 1VG1A 1S8FA 1GL7A 3LLUA 4M1WA 2QSYA 3T1TA 1NY6A 1RE0A 4DCTA 4TZ6A 3GJ4A 2CNWA 5E7JA 5K8TA 1RRFA 3T1OA 4BZPA 1IQPA 2ZU6A 4AF6A 4CGZA 4L8GA 2DPXA 4TMWA 4FMDF 3ZJYA 1B2RA 1E9RA 5EXTA 1UM8A 2OXRA 2IC5A 1VQ9B 2DCUA 3CXCB 1YZQA 5HKKA 5GADl 1JAIA 3KZ1E 4Q66C 2O8FB 2HMAA 4BFXA 1GR1A 1TLLA 4HI0E 4XTCS 2YV5A 1OIWA 3JZMA 3KQKA 821PA 5JCPA 2R9VA 5EE3A 4ZDKA 4FINA 3SI7A 3IEUA 4V0OA 3EARA 1KI4A 3T35A 2HUPA 3D7MA 3OW2B 1Y63A 4EPTA 3O8RA 1VQ7B 3RRNA 1KAGA 2ZI9A 3EAQA 1G8HA 3QNUA 4WW0A 3Q72A 1JEEA 4PGOA 4NTZA 3MSXA 3HJNA 4QJ4A 4D4MA 1EP2B 1R0YA 4D6PA 4Q18A 4LY6A 1KSJA 1VYVA 3R7WA 3NTUA 3WMFA 4YXWD 4F38A 3OF5A 2J5XA 3GEHA 1GAQA 1DELA 3THWA 1G17A 3BXZA 1FTSA 4HB0A 1WBDA 1R6BX 1G6OA 4O3MA 2VSFA 2HXYA 2GXSA 1N6PA 5KUTA 3K9LA 3G4SB 4Q4HA 2RC6A 1EX7A 2ZRCA 1X6VA 1E2HA 2V54A 4TMXA 1E0KA 3IPXA 3EPLA 2UVQA 1MO4A 2WJGA 1TNDA 3WNDA 4M21A 2VP2A 1C4OA 1KI6B 3WMGA 2ZRLA 1VIYA 2ORWA 2J41A 2CVFA 5IK2A 4TLAA 2WPDD 1S9DA 4ESVA 5JRJA 2JCSA 1OKKA 3K0EA 3N2EA 1HEIA 3WHLA 2ZVPX 3RHFA 3OZVA 3RVBA 2QP4A 3CF0A 2WWYA 2I3BA 4PO1A 4HUQA 4B76A 1CIPA 1FUUA 3EA0A 2CHVA 2ZROA 3KJEA 3LNCA 4ARZA 1CRPA 2BKEA 2GEDA 1IOZA 3SN6A 1M1KD 2Z4SA 1E99A 2O8BB 3ZZ0A 2W6IA 1T3HA 1XEWX 3K53A 3NIBA 1ESNA 4QGAA 3TQFA 4A15A 3W5VA 2FWRA 2GVDC 3K0AB 3THWB 3CBQA 5FPHA 5E95A 1ZUHA 3KFXA 3VR2A 5JWHA 1JEDA 2WWHA 1QG4A 2WJHA 2XZOA 2KJQA 1H8ED 4PO8A 4PC7A 4XWAA 1QHHA 2Z5FA 3V9PA 3X2SA 2O8DB 4RD2A 5DH9A 1G20E 4FD2A 1DAKA 4NCJA 4V0NA 3TR5A 1II8A 3CMEB 3HU3A 5G3ZA 1NVXQ 1VHTA 1A7JA 4IOJA 3U60B 1YJ9B 3I8XA 3BRWD 2IK8A 3I8SA 3W3AA 4F92B 3FOZA 1YRAA 2WWFA 4GL2A 2WSMA 4JT2A 3N5CA 2C8VA 4D80A 1Q1QA 3RC3A 4D2IA 2P0EA 3AH8A 2OILA 5EE5B 1UBCA 4UNRA 2F9LA 3W2IA 2BMJA 1VQ8B 1IY1A 3NVAA 4YDHB 2EQBA 3CPJB 3K0CA 1KIMA 1CBUA 2W0MA 4D0NA 3P26A 3K0CC 4JYCA 1KO5A 2GBLC 1TVCA 2IYWA 1S3GA 4DEYA 3U3RA 3C15C 4WVFA 1T4GA 1DAEA 4YHBA 1U8ZA 1UBEA 1G8GA 2EYUA 3MD0A 3RAPR 5DLQC 1SVLA 1YZTA 1XMJA 3ZIAA 1AQUA 3U3KA 4ZI3A 4AC9A 1H8HA 5JHGB 2B8WA 3TLXA 4DLVA 2QPOA 4M9QA 2O8BA 1T5IA 4FMBB 5BWMA 4TQAA 3K0SA 1FL9A 4PPGA 2NO7A 4KYUA 3QXCA 4IDOA 2AK2A 1Q12A 4ABYA 1FX0A 4KO8A 3G5UA 1ZC4A 2IS1A 3ZQ6A 3CCEB 1CULC 1T6NA 1SGWA 1RW4A 3SFVA 4FMCF 1P2TA 3QXSA 4DDVA 1DO0A 1Z6XA 4L4UA 3VO1A 5CDFA 4OHWA 3FHOA 5BN5A 2YWGA 3UATA 4WA7A 4YALA 3SU8A 3U5ZB 3L43A 4DIDA 2NO6A 4QG7A 4X8MA 3LH5A 4EDHA 3IQXA 1UBGA 1I2DA 4Q7JB 1NVUQ 1Q1EA 1Z6TA 4AIIA 5LPNA 3BB1A 2OSBA 3M4YA 1IXRC 1VQ5B 1I2MA 4FI3C 1QHIA 1NVWQ 2ZAOA 1Q81D 2FG5A 4Q4HB 5FPSA 2JLVA 3KB1A 2H16A 1MT0A 3WNCA 2FPKA 3I92A 2D74A 2QEXB 2AD5A 2C5LA 1P72A 3BFKA 4CDGA 1U99A 3K0FA 1EFRD 1NVVQ 1TQ2A 1VQ4B 4H9GA 3FVQA 4NH0A 1GJRA 4UJ3A 3OAAD 2I1VB 1KMHA 1G1MA 4JL5A 5A5GA 1W2GA 1R0XA 3CCMB 3B2EA 2QPAA 1KKLA 4W9MC 3DKVA 4EQ6B 1A82A 4B3XA 1DAHA 2ZE5A 1G16A 2BMFA 1L4YA 1P3JA 1E63A 4HEJA 4YC7A 5A4JA 4R7ZA 3NBYC 4F4CA 3GLIB 1CTQA 2EYQA 2BBWA 2PZGA 4F91B 3R20A 2VNHA 3V4FA 4FCWA 4MUBA 4O2RA 3KKPA 2RHDA 1E9EA 1GVNB 2GAOA 5FBRB 4IDQA 4ZI2A 4ZIRB 1OB5A 3TSZA 2ZRPA 1RYFA 3PUWA 3U7FB 2JASA 3WP1B 4BFTA 2C96A 1W4RA 2YHSA 1L8QA 1G3MA 4I4LA 2DR3A 2HV8A 1E9FA 5DHAA 1TF5A 3ASZA 1WXQA 3PR1A 5CITA 2RAPA 2NTYC 4R98A 1YKSA 1GNQA 1Z3IX 1E2PA 4I99A 1UKEA 4LJ9A 5J4HA 4PHGA 1U2RA 1DVRA 1LW7A 2WKRA 2OEPA 4LZZA 1MABA 2G9NA 4NONA 1IXSB 3ZH9B 3GLHA 3NC1C 4RCYA 5FTMA 3LVRE 4HDOB 2Q21A 1UMKA 2ZRHA 4URYR 3TJZA 1AS2A 2GJ8A 4JJKA 4QC2A 3CC2B 2R6GA 2BMDA 2PJZA 2ODBA 1FDRA 3AP2A 5EE1A 1AN0A 2VTKA 4HZIA 3PEYA 4IHQA 5DN6A 1E2QA 2VQSA 3CCUB 4IJMA 5DI3A 1L4UA 1VG8A 4MKFA 1P4SA 4N1AA 2F6RA 1Z47A 2YOGA 2D3WA 2R65A 3QY0A 1CNFA 3OFNA 2W6ID 4IW3B 1C9KA 2HLDD 3BFVA 4F7DA 3AF2A 4GRAA 4P31A 4S35A 3AM1A 2GEUA 1NLFA 4QBFA 4RZUA 3PUVA 1G8YA 5KNDA 1D1NA 2IW3A 1PLJA 2BHRA 2FZ4A 4BFVA 3U4QA 4OYHA 2IYXA 3MG9A 4EPVA 1OXSC 5CDFE 3DM5A 1ODFA 3DKPA 3W5UA 5L3RA 2ZRGA 3MJRA 3W8RA 4JIMA 1CJUC 2F1HA 3W2EA 2QMUA 1WDTA 3LBNA 1XCPA 2ZRBA 3L82B 3CRMA 4QGHA 3TUJC 4EH1A 1XXHB 5FUYA 3PVSA 4R2HA 3MAAC 2FA9A 1QHGA 1FZQA 1LNZA 4ILEA 4YAUA 2ZSEA 3X1ZA 1GIAA 2ZYVX 3THYA 1BQEA 1F6BA 4CEIA 5KNBA 5EZ6B 4URZR 5FR2A 1IY0A 4QBHA 4BUJA 2ZITA 3E2IA 4A6PA 2FSHA 4RZXA 2WAXA 1J99A 2UKDA 3SHFA 1TF7A 4Q4JA 1Q57A 2GJ9A 2C2HA 3DDCA 5CB8A 3CPEA 4AG5A 1XCGB 3EW9A 2DFTA 5JSZB 4TLCA 1P5ZB 2IHBA 5K8IA 4JBXA 3KKNA 2EW1A 3PUYA 4LJ4A 4U7DA 4B2PA 3L0OA 4LJYA 5M04A 3VHLB 1NKSA 2X1VA 4LDJA 1CEEA 2QEQA 4FCTA 5HE8A 1NMZA 3PUXA 3RC8A 1N2CE 3CRVA 2FU5C 2ONJA 2H5EA 1JR3A 2FFQA 2VP9A 4JLOA 5KSYA 2OUKA 1CJTC 1E4VA 3KDSE 1YR7A 4KU4A 4QJ5A 3M0EA 4D26A 4V0MA 1KMHB 3H1TA 3D31A 1IJEA 1JA1A 2QAJA 2FGJA 2OZEA 4RZ3A 1KSGA 4X8LA 1VTKA 3OIYA 4MKIA 2YINC 1W87A 4JZKA 3C16C 4OI4A 1XJ0A 2NZ8A 1MRNA 2ZR7A 3VNUA 4P32A 2R8RA 1A1VA 1XZPA 2R2AA 3B1ZA 4URWR 4CVNA 3EPKA 4BFZA 1U98A 2VHCA 2OFXA 2O8FA 4QL3A 5KSZA 1E1QD 4XOIA 4JVLA 3T34A 1G9XA 2ZE6A 4Q1DA 4JSTA 4GOJA 1OGIA 1CLUA 5LD2B 1E64A 1TX4B 4NE2A 3AKYA 3W8NA 4Y9UA 4LSGA 4TZ0A 1XEXA 1AS0A 2G0NA 2E1RA 3UANA 4MGZR 1BO6A 2RGGA 2VNJA 3RRZA 2P2LA 4K8OA 2NPFA 2P5SA 1BH2A 1AJEA 1SKQA 3BBPA 2OCBA 5P21A 2B5OA 4MGKR 1IN5A 2W00A 1BS1A 3F5FA 4PSKA 1XTRA 4C0HA 4GP7A 4Q9JA 4XWKA 1Q20A 4DB2A 4LHYA 3BORA 3WXMA 1FUKA 4PANA 1W44A 2ZRIA 5H1YA 2ZRFA 3BH7A 2JLZA 1G7RA 2XXAB 3W2HA 2VHJA 4Y0AA 1QRAA 3IPYA 4O2LA 4JLAA 3RS0A 3SC3A 4OHVA 5GV8A 1OFIA 1OXVA 2MSCB 1XXHE 3WHKA 4LK2A 1R8QA 2PZFA 5BN3A 2QM8A 3ZLJA 3GJXC 3QFSA 1AA9A 4AYTA 2IYSA 2DFLA 3A1WA 3EZ6A 4JVMA 1E2DA 4P6VF 2FFBA 1VQMB 2RC5A 4E09A 1S1CA 4G0NA 3ND8A 4OKSA 1RJ9B 3QOFA 5C4MA 4I1VA 4GZLA 2P5TB 2ZTSA 1ANKA 3RSLA 1KI9A 2GPJA 2RGNA 2E87A 1ZC3A 3DEFA 3G82C 1JNYA 5EZ5A 1R5BA 1EG7A 5TXGA 1OFTA 2OLKA 4UNPA 4KCGA 2OO7A 2ZRNA 1GILA 3B8HA 1SZPA 2UZ3A 1P9NA 1VPLA 4PQYA 2IEZA 1SXJB 3W5JA 5CB6A 5IRCD 2O8DA 4FWTA 3JVVA 3A8TA 4B48A 3TK1A 1W0KD 2JDID 2WSSD 1E2FA 1AIPA 4BPRA 2OFWA 2WWIA 3KB2A 2OESA 4W5HA 5EXSA 1G4UR 1YIJB 3LY5A 2CBZA 4N3NA 3AKDA 2DWOA 1IAQA 2D4HA 1GOTA 1P9WA 2YJTD 4ASUA 4BRWA 1HTWA 5AK0A 1Z6YA 1IHUA 1XD2B 1ZCBA 3AQ4A 5KSPA 3T1QA 2H92A 2IUSA 3QENA 2OTJB 1P6XA 2O5VA 2Q3FA 2ZR9A 5TVKA 4DWJA 3EX7C 2JJ1A 2GJAA 2GA8A 2VF7A 4JLPA 2ZS7A 3EZ7A 3DM9B 1NVVR 2HYDA 4PAMA 4LOAA 1PJRA 2J0SA 2GXUA 2ANCA 1GITA 4KFTA 5HE9A 3EZ9A 1OIVA 4HAVA 1JR3E 1MABB 3TIFA 3A58B 4HZUA 2XOKD 4Q4AA 5TMPA 3A4NA 3GLHE 3OESA 3TRFA 4PC2A 5H70A 2QMEA 5C2JB 1US8B 4M2LA 1U0JA 2VPPA 2ERXA 3CCLB 4AURA 4B3CA 3LX5A 3RANA 5AJWA 2FJUA 4MA4A 3NC0C 5CK4A 4IOLA 1E9BA 2EFDB 2ZUBA 3TNFA 1D2NA 1YZKA 3U7HB 4MRVA 3QQ5A 2H18A 4US1R 4EPYA 2IX3A 5EUMA 3VFDA 5JS7A 2ERYA 2BGIA 3AVPA 3LWNA 3VHXA 4HB3A 4L9SA 4HUTA 2PIAA 1PLKA 3AGPA 2ZUDA 5JEDA 1OH5A 1NG1A 2Q3MA 2QAGA 1VQ6B 1QVAA 1SVWA 5DYGA 4HLCA 3B9QA 1GZSA 1I4DD 3O47A 3FMPB 1JECA 2ORIA 3HU1A 4AD8A 2DBYA 3BB3A 3EIEA 3QKSA 3LRPA 4B74A 5JJLA 3EC1A 4LGMA 3UG6A 4EAQA 1XPRA 1DG3A 2V3CC 3G0HA 2BF4A 1E2EA 3OEHA 3UMRA 3G71B 5AJVB 2AR7A 4YMVA 1N0WA 5FH9A 5FL7A 1C1YA 4Q7KA 1TL7C 1WMSA 3D3QA 4R2IA 2DHRA 1VQLB 4KV9A 3GP8A 1RJ9A 2WICA 3V76A 1S96A 2QRNA 2A30A 2IYVA 3ONWA 3A6PC 1E96A 3X1DA 5C18A 3IUYA 3WYFA 4H1VA 1K5DA 1P2VA 4NYJR 2ZSAA 5H59A 1NLZA 1T91A 1XD2A 3MJHA 1G3QA 3GLIA 4IRUB 4M1YA 2PL3A 3R8CA 1ZD1A 2K5UA 4YDSA 1H65A 1IBRA 4PQFA 2ODNA 4BLSA 2CK3D 1XNJA 2ZS8A 4C0BA 2GCPA 2OCAA 3NHAA 2FGKA 2MMGA 4Q1BA 4Q00A 5L3VA 3K9GA 3JVUA 3KQLA 2C03A 1RVDA 2PLFA 2WM9B 3B7GA 4US0R 4D0LB 1W36B 4LBVA 4KLZA 5L3QB 1DS6A 4ASUD 1JJ7A 4RFVA 1Q1ZA 5HCNA 4X8OA 1AK2A 1QH0A 3FKSA 3B1XA 1ZMXA 1P62B 3QKUA 1IN7A 4F4JA 3A4LA 1W47A 4B32A 4AF7A 1N5JA 2WBLC 3RSOA 3OJXA 2BJWA 5L8VA 2HF9A 2JGNA 1FRNA 3NXSA 3OIVA 1WF3A 4A9AA 3L8ZA 4PSVA 3QKRB 3CWZA 2JIZD 4LYAA 1OXTA 4MRNA 2C9OA 3Q8XB 4PFSA 3L0IB 2DERA 4QRHA 3R9XA 1VCMA 4YMSA 1KDRA 2RGEA 5DYIA 4DXAA 3QE0A 4UXHA 1RKBA 1ZCAA 4IOKA 3AP1A 2O8EA 2G88A 1E79A 4A4DA 3CRZA 3KTAA 1HYQA 3GLFB 3ADCA 5CLQA 5E3HA 2JLYA 621PA 3QXXA 3QF4B 3OZXA
chains in the Genus database with same CATH superfamily
4YUZA 3E18A 4XH9B 1GZVA 1YR3A 3MCVA 3I6MA 5KO2A 2D5AA 4HL6A 4YUWA 2CFTA 3M1IA 2HO5A 3GSIA 4AUMA 4RPDA 4DLRA 3GXOA 1IOVA 2PM8A 2FUG6 5T3YA 4PX2A 5LDDC 3UHJA 1J7KA 5J63A 3H11B 4LHWA 1YU9A 3BF7A 5FRDA 1ZEJA 1KMMA 2OAQ1 2P6UA 3S2YA 1HDYA 4PAGA 2AW5A 1RPZA 4ENPA 3BGSA 5E7MA 5F5LA 2AX3A 4H7FA 5AHKA 1W30A 1GLNA 2MT9A 3AUXA 4KL8S 3AR7A 2BCJQ 2YHIB 1P0CA 4KDRA 2IHVA 2KMLA 3X3HA 2I66A 1FFYA 1Y4SA 4GF5A 1N3LA 4WDQA 5I9NA 1RP1A 3G6WA 2OWDA 3BRQA 1VLLA 2IW1A 5KHOC 2KBEA 4CL0A 4ESEA 3C97A 1C81A 2JBAB 5KNCH 3IAHA 4FN4A 1IK4A 3FPJA 4H7HA 3SIRA 2QNBA 3DCYA 3UXMA 1EP1B 1OQAA 2VBCA 3GCZA 1Z08A 3ISVA 3WDKA 2HGZA 4F4DA 2SHKA 4OUDB 1N0VC 4G8JA 4L4RA 1VHEA 1GPNA 3I37X 2YYYA 3Q6IA 4MIOA 4I66A 3DEKA 4CLDA 5JRDS 4C21A 5LWQA 4XQ9A 3WMXA 4WLNA 4WD3A 4MLCA 2W2PA 1E9DA 1KC1A 1ZHHA 2D2FA 4BLTA 5EUCA 3OPYA 1WZCA 1F3OA 4E31A 3PNMA 2XTZA 2HBQA 3D6TB 3TO5A 5AW7A 2B9EA 1RQGA 4RF2A 4MYHA 3B60A 4GPTA 4IH4A 1MXHA 5CGQB 3G2HA 4ZT3A 4W99A 2P9EA 5MN4A 4CCSA 4DNTB 3ZJUA 5CA0F 5ED4A 4WUVA 4HS4A 3COYA 5KB3A 3T95A 3DF9A 3DD5A 2PUVA 3IDZA 3U4AA 1BMQA 3F5DA 3EEFA 4O2AB 3Q2IA 3STWA 1U28A 4Q1FA 4G5QA 4LQCA 4E88A 1EFKA 3DULA 2EVWX 3P7MA 3OZCA 5AUQA 3AZOA 2FR8A 1ZJ4A 3CH5A 2JCGA 3D3WA 3PGXA 1OJLA 4NMWA 2WZDA 1W1WA 2AT1A 1OREA 2QV0A 3MMSA 2FMIA 5IBRA 3GR6A 3DE4X 1GZ5A 1OE0A 4C20A 4UDYX 5E4YA 1HL7A 1QJ4A 4N7RA 2Z4RA 4W82A 3T4XA 3WLOA 2C94A 1JL3A 4KAXA 1MR3F 4G5FA 4UUQA 3T5AA 3V6MA 1NVMB 4JASB 3ELDA 3U3ZA 5JISA 5LMNB 3H2GA 4WZAB 1CZOA 3SE0A 4LRQA 4CN8A 1P5FA 2NU9A 1PI3A 2Q8NA 3R6GA 2YWDA 4JNKA 1VG9B 1JKMA 5DOZA 1LEHA 2IYNA 5ENVA 2OV1A 2H1OA 1U90A 2C2OA 2VDRB 2XDAA 2XZTA 3AHIA 2R85A 3HN7A 4IVRA 4UM9D 4HE5A 1WCV1 2ACKA 2HSDA 2R6DA 3A6FA 5HMMA 3UMFA 4M0MA 1VRCA 5A04A 3MCAA 2C98A 4D42A 3LLSA 1FMLA 1ND5A 3HUFA 3R3HA 3MS2A 1P4HA 1SKYE 4NAHA 4ENTA 1L1QA 1V3UA 3IAEA 1BD3A 1YONA 4GECA 3W06A 3JAWB 1TEXA 5BN4A 4G6ZA 4YRGA 2NU7A 1DEXA 3PDJA 2WUWE 4AUKA 1N1MA 4HV4A 4R0VA 5I7FA 4ARZB 1E92A 4NDNE 3VZPA 5LQKA 1QMPA 1VPWA 2FQ1A 1LRLA 3U3XA 4IX9A 1BFUA 1U0OC 1L5SA 2REOA 1T3TA 4M1ZA 4QXOA 3E7PA 3GJTA 5JI2E 2GILA 4KKTA 1ZXXA 2XB4A 2AKYA 5DYYA 4C4SA 2YFYA 4F21A 1A1SA 2NAFA 2AI1A 3D3JA 3U31A 1OA0A 3WHPA 2QJRA 4Z5XA 3BIJA 1RPTA 1EFUA 1CQXA 2ZJ6A 3UO8B 1PWXA 4ZP1A 5DLDA 5HCIA 4F5EA 3ETDA 1MBZA 3NIGB 4P3KA 3DMHA 4DLXA 1Z56C 4F12A 4AK9A 3EDYA 3HU2A 2JDIA 4L76A 1Z0DA 1W85B 3GRRA 4N9WA 4K1XA 1H22A 1X77A 2Q4RA 2LKDA 2OV3A 3CSUA 3FRIA 4F6RB 1AS3A 3LT2A 3MXTA 4M8NE 3ZY5A 2ZIXA 3W5HA 2D5IA 4LBZA 1RHMA 1T9GS 1RWPA 2AFHA 2HL6A 2QMYA 3LUFA 4QJBA 5A1JA 3A1SA 1CR2A 1BGWA 3LK7A 3PU6A 4L57A 3ZW8A 2IYQA 4HQ0A 1RLTA 2I4LA 2P2NA 3FA2A 4BL5A 1GNSA 3IQWA 3LIIA 5ICSA 2JJYA 3GGCA 3OCJA 1GTMA 3S1AB 3I4CA 1KEZA 4GXQA 4RKFA 3OICA 4WHMA 4JC8A 4GPIB 2X15A 2ZOSA 2QL5A 3IBTA 3SKVA 2J32A 3AQIA 4IKEA 1ETHA 2GBIA 1UJ5A 2CMKA 2DH6A 3QE9Y 5CJJA 2DU8A 5JNRA 1NB9A 1FP1D 4MRMB 2BIFA 4R1OA 2J3LA 1XTSA 2VJLA 2X9LA 3Q7IA 4CL8A 3L1KA 5AT1A 3UK0A 4NU0A 1EXDA 2G17A 2HWUA 2I4NA 3BSFA 3K05A 1H6CA 3UB2A 2ODPA 4CU2A 1THGA 3I8OA 2QJOA 1R66A 2V55B 3LK6A 3PNYA 2KB0A 4LQ4A 5FHQA 2PU5A 1QRDA 2QTGA 4EATA 4IMRA 3ODPA 5A9RA 2P6NA 4NZYA 1A7AA 2HLDA 4MUAA 3CLRC 1OLXA 3UJDA 3FYTA 2XX3A 4MRAA 3CCJB 1CJSA 1NL3A 1ZVQA 4HQ6A 1WVGA 4WZLA 1K6XA 1GUDA 2XKBA 3HA5A 4ZYVA 5AVOA 3WO1A 1XQBA 4PZYA 4E2YA 4HX2A 4CMAA 1Z7BA 1CF4A 1FXUA 4XLLA 1XO1A 1DEKA 4NYJQ 1WD5A 1LV8A 1Z2AA 3ROPA 4URUR 3G5LA 4MMYB 1LCIA 4PICA 4TVOA 1E3JA 1YJNB 3DDUA 3V8MA 1L4LA 1Q0TA 1DO8A 4IEEA 1KFEB 2OD2A 2Q49A 3F90A 3T0FA 1A4UA 1F60A 1WHSA 3AJRA 1L5YA 1F5SA 4BKPA 1NPYA 4BVEA 5AVZA 3TLGA 3LCVB 5HCUA 3BJIC 4RS4A 1EDOA 3RUDA 3NBQA 5FWNA 4ZJZA 3ZDEA 1KVSA 1YASA 3PPWA 1YQEA 5TQ2B 5KW9A 3WGVA 1SKMA 1X1AA 4R5HA 1BXGA 4EI8A 3CX6A 2PIDA 1JSXA 3TKLA 4S1OA 1ULHA 4U02A 3OE7D 5FT9A 1JILA 3P1JA 3TZEA 1GCAA 2ZULA 5EQFA 2XGGA 3I01M 4PO9A 4F46A 3G2KA 2HDWA 3PEUA 1YBFA 2XLBA 1M1YA 4FZJA 1YFKA 4KSCA 1FW6A 3B7PA 1LH0A 3ILVA 1MH1A 4R1NA 4R1UA 2DVMA 3GY0A 4V0QA 3HJHA 4M0UA 5AVVA 4CKCB 2VAWA 3TPFA 1GDTA 1KYXA 3NM4A 4DSTA 1Z5PA 1B74A 4MHTA 4FZ5A 4OK3A 1N78A 2QW8A 1P7CA 1WABA 3AUAA 3TSWA 1DKNA 1M90D 1E6EA 3FJOA 1AZTA 3MMXA 3QI2A 3DAGA 2EIHA 4KQCA 4ID9A 1U3TA 2QD4A 3G8DA 3PI6A 3RNLA 3UA3A 1IQ0A 4IILA 3U39A 4B46A 4CTOA 1XQ9A 3ZCRA 5AW1A 1M6NA 3QG1A 3ES9A 2NIPA 3EGDB 5K6AC 1N06A 1KEUA 2CBXA 1LBTA 1UF9A 2ZBQA 4HQLA 4QPDA 1T6YA 1UMBB 1Y42X 3T52A 5CFOA 1T8SA 5KNDH 2Z2YA 4RVNA 4BEBA 1GFWA 1XK7A 1PJQA 3COJA 1N8RD 2XB9A 2CCJA 4YUXA 4E5DA 3AR5A 1EQ2A 2QRJA 4D97A 9ATCA 1WU7A 2W93A 5C1PA 2WIJA 3QITA 1VMEA 5F4OA 1H4TA 1OLSA 1QIIA 4LHVA 4D9NA 5MF6A 4PGAA 5F73A 4BO5A 3JQFA 1FDWA 4RTMA 4X7CA 3LM8A 3U4CA 1OD6A 2PKEA 3B9BA 1W0CA 1Q3KA 3VBCA 5M2QA 4L0MA 3U2QA 2AVDA 3ZK9A 3ZNPA 1XWFA 5ADUS 2AMLA 2ZRAA 1RRCA 2J0QA 3CG4A 5CR9A 2IYFA 2QX6A 4IUCS 2HK9A 3I5YA 4MB6A 1XA4A 5KYYA 3H97A 3KYCB 4GYJA 2GZAA 1LV7A 1N2SA 3SVTA 1SVNA 2AZ4A 4DZZA 1DU4A 2QQ0A 4F4IA 5JXGA 2Y1WA 3UPTA 4XQEA 3NJRA 2BGGA 3IBCA 2JIOA 1FSFA 3MJVA 3W1EA 3ZCUA 8GPBA 2IZ1A 4MVJD 4WLEA 3TL3A 2Y1LA 3C24A 5CLJA 3M9WA 5JFGA 3H9EO 3H9QA 2XMCA 4L28A 1PR9A 4DMGA 5DLEA 4QOJA 2FSFA 2XAUA 3H5LA 2G9VA 3U7QB 4OMFG 3TW8B 4WXHA 3K8OE 1XDBA 4UPDA 1MKYA 1JFLA 3DFIA 1X7ZA 2R8BA 2Q3BA 2XNKA 2X8AA 4RJJA 4S04A 2GXAA 3LF1A 3QWBA 5JS8A 3QTBA 3M3DA 1IHOA 2WF9A 1C3VA 4UHJA 1TVMA 3IJEB 4JLKA 3LAWA 1AD2A 3AOGA 5JHHB 3ZGYA 1FFXA 1ZL0A 3OM0A 1IM5A 4RGVA 1PS9A 4J07A 4U2DA 4Q02A 3RTDA 3VO2A 3E70C 2FDCA 2O52A 3DP7A 2NVUA 2IYAA 3PE3A 2D62A 1EK0A 4BRZA 3NETA 4G7XA 1XZEA 3EXAA 2VAPA 2DG2A 2RB5A 2VHUA 2WIKA 3IAM6 4UE3S 4NEHB 2NSYA 4PY2A 1QS0B 1H1DA 1LJLA 4I36A 4RQUA 2P41A 4U7FA 3W6ZA 3HA2A 3T7TA 3A1PA 3O9ZA 2DHDA 5EJIA 1EHYA 3D1JA 5D86A 3RRMA 2GNPA 3U3MA 3DE6X 1A9TA 1IMOA 3EA5A 1WCIA 3I9V6 2YN2A 3OP4A 4B6FA 5F4JA 3TF5A 2QUKA 2RHRA 1RJEA 1IPEA 2IHTA 4RTJA 3IBGA 5FBZA 1BSVA 4EG0A 4L1KA 3LBFA 1RQRA 2XYPA 3MB8A 1GUAA 2NT4A 4EPXA 3N2LA 3NXKA 5HJ5A 5DHUA 1Z33A 3AUTA 1GU7A 4MSUA 5HFAA 3BHIA 3DVAA 1MPTA 2RB4A 4A26A 8ATCA 3LI2A 3Q3AA 1G20B 3O26A 1QHNA 4LV8B 3X2EA 1N2EA 3AEUB 3JQAD 2MSNA 1Z25A 1UK6A 2I6SA 1MDFA 1W0JD 4MPJA 4MW1A 1Z17A 1UWKA 1YBHA 3U81A 3ZEAA 2VQFB 3Q7SA 2WABA 2D7DA 5TR9A 3SS9X 4OOXA 1A5SB 2PGIA 1F0YA 1RRMA 4TLBA 3OW7A 3QELA 2Q8PA 4M7OA 2QX4A 4EYGA 2GQ0A 2M6RA 3RIGA 1EAYA 1SPXA 2IOFK 3JQ8B 1HRDA 2AYYA 4B81A 1NI5A 2V7WA 3CEHA 1U7HA 2NVOA 2OCYC 3CR8A 3DWIA 3FI0A 3OIFA 5AIAA 1G21E 1POXA 2QTTA 2F43B 4O08A 4WAUA 3TTSA 2RGDA 4XWTA 1IXKA 1MGOA 4BFCA 2DQYA 2KHZA 3V2IA 3I2GA 4BNDA 3VNRA 1RRKA 2EFEB 3HJTA 4BMOB 3FNEA 4C6TA 4LZLA 5J1TB 4DLAA 3JY6A 3TG8A 2VYVD 5FUXA 2YVAA 3S8MA 3HVRA 4IPTA 1U5BA 4QFDA 4EHNA 3FGNA 3BX1A 1KPGA 1HE4A 4DYDA 1H2FA 1VJSA 4K9NA 1BDHA 1R5OA 3P0HA 2BMWA 2JATA 5CLLA 4H1WA 3OQMA 1CPYA 3K6KA 1X86B 2F48A 4NZNA 4G65A 1ADYA 3ASSA 2XD9A 3WO0A 2UUBB 1U6KA 1R5NA 2P3SA 4GLLA 4HRYA 3ZE9A 1ZIYA 4LJAA 1ECJA 1Y8QA 3ABQB 5BSVA 5HGXA 1SVOA 1AURA 2VJQA 4L5BA 1U0TA 4ER7A 2PGAA 4FIDA 3H6GA 1GTSA 3KOYA 3RU2A 2JLUA 1XEFA 3QKWA 4MW0A 3G9XA 3NYIA 4A03A 4ZVQA 4EHBA 1BIFA 3EMVA 3FHTA 1W8DA 3A2KA 1M75A 4HPWA 4HAYA 5DMXA 5I7VA 2X3YA 4C7XA 3TIXB 1UODA 4GDFA 4C2UA 2UVDA 5BNZA 3CC7B 5E7IA 1UT8A 1E89A 1RHQA 3OLVA 3QGMA 5K3FA 1ZGGA 3VX4A 4AU1A 1HE2A 4ETIA 4MARA 1RXEA 5AKGA 2Q5CA 3IIJA 2QQ5A 1JYFA 1FFGA 1LA2A 4BBJA 2FK7A 3AFHA 2QY9A 2HC9A 2II6A 2VXCA 3ED5A 1P61B 13PKA 2QU8A 3EBOA 3BT7A 3LDAA 2VJKA 3HVHA 4CMIB 2F1OA 4DLLA 2HFKA 2VPQA 2SKDA 4DLUA 4JGGA 3ZBPA 2PUEA 1JLLB 1PUJA 2ZEJA 1RE1A 3MK31 4MQMA 5JO9A 2G5PA 3INGA 1SVKA 2PKYX 1P81A 3PL5A 2VSXA 4MK4A 5BW5A 2DB3A 1F9AA 2HXSA 2BBSA 1D2HA 3PA6A 5AK4A 2OBXA 1Z7EA 2JANA 2PYZA 3HHEA 4GOLD 3CVWA 1CNEA 2X7JA 3TECE 4M0EA 3RNOA 4A0SA 4PIPA 4NOJA 1YL5A 3UH0A 1OTYA 1YS9A 2XRMA 1M1YB 2BY4A 3AB7A 1E1MA 3ZKWA 1PZNA 5KOJB 2EBUA 4Q9NA 4BLOA 2PKQO 1RVV1 2CVOA 2J07A 3RYTC 5EJ9A 4WLFA 4EY8A 5I7OA 2J6BA 3VVBA 4OHYA 2GEVA 2RHJA 2VJNA 4MJXA 3ZC3A 3O6VA 2CE2X 1EU1A 4B6SA 2JGIA 3Q40A 4KPYA 5JYBA 3AESB 3AUYA 1GXSA 2EHJA 3WMRA 1Y81A 2MIIA 1OX4B 2QLMA 3L4BC 3AZPA 4Y3UA 1TA9A 4DB4A 3O7MA 4ZAWA 4G5RA 3TNJA 1M6WA 2BEUA 3JQQA 1SJ9A 4WZAA 3ENQA 4YECA 3OBBA 2QZ4A 4HDNB 2CVHA 2RH4A 3RT7A 4EOGA 2ODEA 3IMFA 4G09A 2JH3A 1GSOA 3OFJA 1VL5A 2BM8A 5F3RA 1J2TA 1TQDA 2AQIA 3OAAA 2IFTA 5IYQA 3HLYA 2WIGA 4MQBA 4R41A 3PQCA 3CPWB 1R6XA 2H1FA 3DP9A 3SJCA 4JGBA 1F06A 4K40A 1HLPA 2OO3A 3AIMA 4D82A 5AD1A 3OKAA 4Q4LA 5CLHA 1QWOA 4V3BA 1Y7LA 3PNQA 4J6FA 1V5FA 4AT1A 2ECOA 2JHPA 2XADA 2H7XA 1IWBB 2CLOB 2IE0A 2ZTNA 3BQNB 1SXJD 3L77A 4K26A 4KB5A 5LL6P 3BHMA 1XDSA 2GVZC 1MO6A 1TYEB 1Z4JA 2NO9A 1Q0UA 3REFA 2BOVA 2Q2QA 3MINA 3RYFA 3WL6A 3GT7A 5EKUA 1B6TA 1R64A 2D0DA 3GGJA 4KQIA 4OHFA 3F5SA 4GQNA 4PHHA 1XFAA 4W5RA 1CUWA 2XLCA 4EF6A 5CHEA 5L7YA 1OH8A 3ZLBA 2JBWA 4QHYA 2IDZA 1M2OB 2PWZA 2Q5QA 4P5EA 1T3LA 2X4IA 3BL6A 5AUNB 4WN9A 5EFOA 5DNDA 1Q0PA 3EDRA 3P27A 2W4IA 1SXGA 1DARA 2PX0A 3W4JA 2EP8A 1ZY2A 1R5JA 1QVWA 5EHQA 2EU8A 3G0OA 3ZWDA 4NBSA 3PCXA 2OT3B 4GMXA 4X9XA 1GDDA 4XSGA 2Y1FA 1D4ZA 4FM9A 3CGGA 3AKCA 3FDZA 2WPDA 3QHAA 4BGIA 3B1VA 3B8EA 1H2WA 3EGXB 1ADJA 1C1DB 2AHRA 1MDBA 2FUKA 2OGWA 2YDXA 2H5IA 2GM4A 1SIOA 2NW6A 3M5PA 4ZTUB 3AVTA 1XE1A 3W2GA 3C7CB 2OK7A 1JHZA 3PA8A 4DRXA 1EUQA 1GU1A 1OA1A 3V1YA 1V9CA 2ZCUA 5BQ5A 1SKAA 2WUGA 2ZB4A 4HDQB 2JIRA 1BX3A 2GCOB 1GTG1 4HDMB 4G1VA 4KVZA 4MGYR 4LJ7A 3W90A 4C0SA 1KAHA 2JBHA 2QXUA 3DMDA 5FBQB 4RNCA 5IT5A 2O0JA 4GOOD 1IIBA 5KVVA 4X65B 3I23A 5A4MS 3I64A 1IN4A 1DTEA 3BICA 3DMTA 5AJTA 5JBIA 3TOCA 5J3JA 3FPBA 2ZQZA 4WQMA 4O33A 1PT8A 4B7AA 4MWBA 3GG9A 1QU2A 1Q19A 3DOEA 1CVLA 1ELOA 1TADA 2IU3A 1LW6E 3AIIA 3HC7A 5B2FA 5EXDA 1GYRA 5J2UF 4HK4A 4D8TA 1F2UA 2GHIA 3Q98A 3RFVA 2DUMA 4QFCA 1RXVA 3OFVA 5TMEA 1VGVA 1GRRA 4U6SA 3BGOS 4EKEA 1QDUA 3CY6A 2MMCA 2G25A 1G5RA 3C1UA 3Q7EA 4QQKA 2UYGA 3K30A 4O2BB 1V5GA 1A0OA 1KPHA 4OAPA 4Q39A 3IUPA 3DMYA 2QY6A 4MGEA 2P79A 3HFRA 4IJQA 4X91A 4Y9DA 3WK5A 4DNQA 1WDLA 5F1KA 2VUUA 2TRSB 4IXMA 4DXDA 2G40A 4PRLA 3QWHA 1UQUA 4Y7CA 1DCKA 1K7CA 1H8HD 2UYOA 3FRJA 2BTOA 3HKEB 2Z3WA 3UIEA 4X7EA 5KWEA 1APBA 3A9TA 3CUTA 2I71A 2I9KA 1G42A 2Y67A 2V97A 5CIWA 3FR7A 3UHFA 3NIDB 5EIHA 2B7CA 1F9EA 1WHSB 3CX7A 3DVSX 3WXBA 4BP8A 2F3QA 3B1WA 1ZA1A 3FTFA 3ANMA 1TUIA 4K9DA 4FU0A 1XN1A 1W1UA 2HMSA 1J9ZA 4PHFA 3AKEA 1VQPB 1AUQA 3KOMA 4M3NA 4N3GA 1WZUA 3Q0EA 1E3LA 4EFLA 4UAJA 1UBRS 3ID6C 3RK1A 1O8CA 2ISQA 1ZSVA 3I4LA 4EYOA 5BMVB 1ZJYA 3IXQA 3RYHB 5KOHA 3VBEA 4FGLA 2NN3C 2XVYA 1X7XB 3CYFA 4JJ7A 5BV8A 4P3YA 5CX1B 1WW8A 1E1QA 2DULA 2ONKA 5THXA 2XPCA 4B83A 3PITA 4C3VA 2ZBVA 4FCVA 2Y8EA 3ER6A 2C1XA 2J3DA 2QVXX 1EVIA 3SEAA 2RHGB 3BAFA 2O05A 1DAPA 2XDWA 4QO8A 1OFHA 2ZYUX 4B3GA 2N3ZA 1RAEA 3UNXA 2EW8A 4BFWA 3T9AA 3NPMA 3VNBA 4MX8A 4IICA 5HX7A 1PWHA 2FPMA 4RDHA 1A8PA 4H08A 1UOQA 1WXIA 3D2CA 4WI1A 1EUDB 4HCJA 5IKOA 3WKEA 1V1RA 1KO8A 1WXWA 4JHXA 1J1IA 1TM4E 2J4CA 3HCWA 3FB4A 4JS0A 4YJHB 5BT8A 4U9HS 1MHTA 1LXCA 1R0WA 4LYYA 2HR1A 3ZCVA 2DWPA 3ONFA 1SUWA 3HYRA 2JLXA 1AF4A 2WG1A 3EWAA 1S6YA 2I67A 4HFMA 4XGRA 4ZI5A 3RBXA 2OGUA 1PHRA 3S70A 1DG9A 2BFAA 3KKKA 2OLEA 1G3RA 2P8SA 3PPXA 1ZSYA 5DM0A 4AJ4A 3DNFA 3C6XA 4A92A 1AHIA 2W6NA 3PJEA 3PT5A 3DE2X 5JFOA 2QW0X 3GROA 5G1PA 3GX1A 4UHCA 1A9XB 2O50A 2QUZA 4EY3A 1GQOA 3AR6A 2GTIA 4YTEA 5K0LA 2QROA 2V0GA 5KSWB 1H2AS 3DFKA 3VR1A 4NBNA 4QELA 2R5WA 3BMOA 3LA6A 5KVAA 1DZ3A 1JT2A 1P1CA 1D2EA 1WVMA 2G1KA 2XB6A 3FFAA 3G17A 1OY1A 2JLQA 3I9MA 3OBIA 5DEOA 1ESCA 2HT1A 3RVOA 1C7EA 2RD2A 1DTWB 2E55A 1KDYA 2HQBA 4I9HA 1MIOA 2CLMB 4MO9A 4MROA 2H1CA 4AY4A 1JIKA 4XOUA 2YMLA 3A05A 4IO0A 3LQRA 2XNJA 4J7XA 1ZIOA 3S0JA 2E6UX 1NVKA 1UWLA 5FDFA 2XQFA 2Z2KA 3DUFA 3KM0A 3QMPA 1WZEA 3EYWA 4O5OA 3G89A 3AM3A 3GRVA 3AETA 2FE1A 2C88A 2I03A 2ZIUB 3KUDA 3SX2A 3ETJA 1JKXA 2C2BA 3BZUA 2Z2ZA 4TZTA 2QTZA 4BGDA 5FTLA 5M7EA 2JKZA 4Q15A 2HPAA 4E5YA 1OU4A 3INTA 5KU1A 1W73A 4D9IA 1QZXA 2J0UA 2ZSDA 1J6UA 2R44A 3NWEA 4YFVA 1OVMA 3R4CA 1E61A 3BGDA 1ODIA 3ND5A 3O7WA 3OCXA 4EB0A 3KD2A 3E7FA 4MQEA 1Q7EA 1XMVA 2DOKA 3RC1A 2AD1A 5K9ZA 4KR3A 4OXQA 4TTPA 3RUPA 3PFHA 4FT2A 1VIMA 3H5TA 1J97A 3IR5A 4JQCA 1T3SA 1UM9A 3B3AA 2DAPA 4KG7A 1D6MA 3USZA 2Q3HA 2AI2A 3K09A 4JBWA 3ZEIA 4ZHQF 1Y3AA 4E21A 2FSVC 4XPZA 1M2NA 1ZRNA 5C7LO 3R7NA 4UTPA 2PX5A 3EZLA 4JSYA 3NBFA 3ELBA 3SXJA 4GP6A 3GIRA 3G5MA 4ETMA 1YS1X 1OX4A 3DLCA 5A4KA 3AUFA 4QU8A 3OT1B 1WR8A 1SUPA 3PQFA 4WXEA 5JZVA 4K0KB 1R9MA 1TJ4A 2MU1A 1LQUA 2N1BA 5LP6C 1NWHA 3CVVA 1ZM2A 4F8YA 1B42A 1SPBS 2GAIA 1F2DA 1XMSA 2H1VA 3WJAA 4E5KA 1V2GA 5M29A 5EMNA 3I56B 2OQVA 2PJDA 3DTVA 3RHSA 2ZXUA 4P98A 5CNIA 2FFJA 1KZHA 3PDCA 1Y80A 3T5TA 4JQSA 3AFMA 1A9SA 4XEUA 5GONB 3SOPA 4RHEA 3UOGA 4RMJA 3NWPA 2XWJI 4V03A 3AK4A 5KX5B 2HCJB 5D01A 2JL1A 2R4QA 3P9RA 3NUQA 4QDUA 5KQGA 3U19A 4DC9A 5FPKA 1P29A 4I9UA 1RHRA 3ZXXA 1QPGA 4CMBA 5EUQB 4DKJA 2H0QA 1MORA 1P4RA 3ZY3A 1EGHA 4S1TA 5EUBA 2Z30A 2JFBA 4G8DA 3RRFA 5EIXA 2CHFA 1T9DA 3EBPA 3VNVA 4PZPA 1DEOA 4D4HA 4ZZ0A 1BCSB 3QI7A 4LVOA 1CF9A 4QAQA 3ZDRA 3AB3A 3IVXA 2QD1A 4BO7A 1N2HA 2ZYGA 1ZW1A 2CFSA 4ITUA 4LV5B 1XF1A 4ZJPA 1MD9A 1F7UA 1J90A 2Z8YM 3LV8A 2VF8A 1UT5A 5K3FB 5JH7B 5K3EA 4DJTA 2X2EA 3QFHA 2IKSA 4S1PA 1SUCA 5ICFA 2IVZA 2D0OB 2X42A 2XV1A 3B6IA 1MO5A 3Q15C 4QT0A 2B5WA 3HYLA 4QDTA 2LD4A 3HWWA 3CR7A 1I7QB 4LYGA 1ZVVA 1CEXA 4NBTA 4QVIA 1N33B 1TCVA 1U28C 3CKLA 3A3BA 1NN3A 3HSKA 3L8MA 3UCFA 3QPVA 4DV3B 3O9VA 2PXCA 4JT9A 1BJKA 5EIAA 3PIDA 1JIQA 1ZYUA 221PA 3U4MA 2E4XA 4DV1B 1LPAB 3SJZA 1VYHA 3ZHZA 2Z8YA 3CCFA 1SBTA 1VKZA 3JZIA 3Q1KA 1Z45A 4X60A 5U9CA 1VE7A 1X39A 1E79D 1Z8HA 4FFSA 4IWXA 2ZDQA 4MKZA 4C4XA 4C6RA 2HF7A 1LC3A 1NM5A 2PL1A 3MQ2A 4ZV4A 3DQPA 4MV3A 1A98A 1RP7A 1YS6A 2FP4B 3CZ5A 4TX1A 4UTXA 4V0ME 3T0IA 2ATEA 2AOTA 5CVEA 1NVBA 3E3AA 3O3OB 2FY8A 3KKOA 4HNUA 2QB5A 4IHJF 2H9IA 1ORRA 1V5WA 4LE1A 5KOIA 5L53A 1QQ7A 2BFOA 1IEXA 1RXWA 2UZ0A 1PR5A 1WSWA 3M2TA 5ES3A 421PA 4RMNA 4B8WA 5KOHB 3FPKA 3GJYA 3K0FB 3SBEA 3LVQE 3RQSA 1FFSA 4CMHA 2BCGY 5D2CA 1L4EA 2QRVA 3NWOA 1UBTS 1KO7A 2W0SA 2H3HA 5REQB 4CIVA 3U1BA 4GO1A 2NXEA 1O87A 3EIUA 3PX7A 4DA6A 5JJBA 1LI7A 3GI1A 4ZVPA 1FUYB 1S9HA 2ZSFA 3OUTA 3PHLA 4BX2A 3B5JA 5B7QA 3CMAB 3STXA 4EJ2A 2ONYA 4TN1A 4Z4VA 2NP6A 4QBGB 4W63A 4KPFC 3T3EA 4DVJA 4R1PA 3UENA 2BFWA 3MJTA 3TXAA 5KTPA 3QNMA 2C2KA 3TTUA 5L3ZA 3E3OA 2QGFA 4WCFC 1MH9A 3CT4A 1YMUA 5BSEA 2Z5VA 1LU9A 1KR5A 1V45E 1I18A 4ZRDA 3MVEA 2RHLA 2AXNA 4CM3A 2VHWA 2OCXA 3AEQA 5FJIA 4CN9A 1EB8A 2WRZA 1JAHA 1V43A 4KKVA 4TQ9A 3WHIA 5B1YA 5J4LA 1J33A 3M1YA 4FYYA 3R24A 1N6NA 1SHLA 2JIZA 4I1SA 5DSXA 2ID9A 1HFJA 1Q17A 2AX4A 4M8SA 4CW7A 1CY6A 3TLCA 4CLRA 1U94A 2X7HA 5TJHA 1CUVA 2IYPA 3EEYA 4MGIR 3TZCA 3NIWA 3JQGA 3K20A 5EEHA 3I55B 3PXCX 1U3VA 1T2VA 2PGXA 3AY3A 4MYUA 3Q38A 1N0HA 4MDYA 4NCNA 1CJMA 3H42B 4N49A 4ZCRA 3IAS1 5LP6F 1GNRA 2O7VA 1NIJA 2JCVA 4HH0A 1D4OA 1TVKA 3NKFA 3FNGA 4KN8A 4TV8A 3T3PB 3OKCA 4NZOA 4J91A 2XTMA 4IIEA 3SIPA 3EISA 1QO0D 4XDGA 1PQUA 5B3JA 3RIYA 5KQRA 4RVSA 4CM9D 1NLYA 2IYRA 2AK3A 2PKQP 3HPRA 4KBGA 3JD2A 4BMVA 5ULLA 4F85A 3VDXA 3TCNA 1XWIA 3I62A 2VDOB 1JALA 3OIWA 4HD8A 4Y9TA 5D1NA 5BQOA 2CT8A 2G1AA 3NHBA 2BFNA 3H87A 1OGJA 2K2WA 1Q91A 3CO5A 1FFBA 2HCFA 2OHIA 1RACA 3SICE 1GDHA 4CM1A 2JZCA 1R8JA 4MZXA 2I7TA 2OQRA 3H86A 4XLZA 3S28A 4PYIA 3F47A 1CR0A 3FWZA 2LWIA 4HG2A 3T7KA 3VI4B 1B00A 4YXFA 4K9SA 2EBHX 4O4JF 4AS3A 5LZ7A 4L3VA 2Z2IA 4IRMA 5CA1A 3I32A 3ITKA 5FTNA 5T5QA 4DANA 1H3EA 2DHEA 1B93A 4RV9A 3G79A 1JRLA 1KH3A 1UK8A 1RKVA 2F2TA 2XYGA 3QX8A 4IH1A 4ER3A 4YPVA 3RQIA 2XB2A 1Y8CA 5BUSA 1QHFA 2DYKA 1U7WA 2OHFA 4NOKA 4PFQA 1COZA 1G2QA 1FX1A 2R6JA 4OLAA 4OXXA 2V6IA 3AHCA 4DJAA 3MS7A 3QJYA 2H4ZA 4FMCB 1MT3A 4D4LA 5LZ9A 1QGUB 3AW8A 5HDBB 1YZUA 5COQA 2NM0A 3LDHA 1DUIA 1D5CA 3JXEA 1U8UA 4ZI7B 2B21A 2OGZA 1KBZA 4QBTA 4GMKA 5JALA 4TS3A 1ZNYA 4KE9A 3UB4A 4HAXA 4LYDA 3STTA 5JD6A 1E2IA 4CGYA 4GLJA 6REQB 1J2EA 3O8OB 2E4AA 4GS5A 4JH0A 4Q4JB 3MWEA 2Z58A 4DLZA 1O0SA 4ECEA 4L7QA 5AW4A 3FTQA 3I45A 4FMDB 1Y6FA 1M2JA 1JF8A 2VFAA 3L0CA 4QUHA 3GLHB 2OECA 2L19A 4EHAA 1Y1RA 4FYHA 2GASA 1KI8A 2JEOA 3DPSA 4OHCA 3AMVA 3VKGA 4NCIA 4POAA 1T0JB 2NUAA 2RKOA 4CWAA 1XOIA 3E9NA 4TLMB 1UKVY 1ZM4A 1Q0QA 1QCDA 1XQYA 2FZLA 1NBWB 4HDSA 4OFZA 4D98A 5JCJA 5JSHA 5JAMA 5KWSA 1Z75A 1NGSA 1UM9B 1P8AA 3A9CA 5IC6A 4NCAA 8AT1A 5IVKA 3QVGA 3DBHA 4ITRC 3TBFA 4II3A 1DBIA 2VJPA 4KOAA 2Q9CA 1JXMA 1DDGA 1J70A 4NJEB 4Y2GA 5EP2A 5INTA 5TIIA 3GPLA 1RRPA 5I5GA 3AY6A 1NATA 1JLKA 1MEEA 5IXSA 2PFSA 2QN2A 3KR1A 4QICA 2Q3EA 4TTVA 3EVAA 4Y2XA