4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords eIF5B
publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
2ORVA 3U3OA 1G41A 1GNRA 1L4UA 3X1XA 4WW0A 2VQSA 2GF0A 1BO6A 3SN6A 1DG1G 4TN1A 3IHWA 2ZRLA 2VIIA 3QPUA 4JKYA 1AZTA 3NDPA 5BXQC 3PUZA 2CCGA 4RZXA 1JECA 2OAP1 4TZ6A 4FMDB 3MHPA 1COWA 3AKYA 4LJYA 3ZQJA 3W2HA 2ZM5A 1KMHB 2BJWA 1X1RA 4KVAA 3AP1A 3PITA 4AG6A 2CHGA 4CF7A 2VHQA 2CBZA 2RGBA 1N6RA 4Q9IA 1W0JD 1OKKD 2L0XA 5HKKA 3RWMB 2GCOA 1XCMA 3NHBA 3U3RA 3U7HB 1NN1A 3SJAA 1XP8A 3OZUA 4JIMA 4B3DA 5E95A 3CX8A 1YJNB 3B8HA 3BORA 4BGDA 3K70B 4LBYA 3Q8XB 4OK6A 4Z1MD 2A5DA 4DLSA 2OXCA 1FL9A 4TZ0A 3PG5A 2VRWA 1TQ6A 3LH5A 1NY5A 3GLIB 1J90A 2C99A 3GJ5A 1H85A 3L8ZA 3PQCA 2VNIA 1Z6XA 5CK4A 1O3YA 5AJVB 2A5FA 3EZ9A 4IDOA 3CF0A 1XFAA 5EUQB 3SJBA 3CR8A 4JLJA 2BWJA 2MMGA 1E9SA 3DKPA 3REFA 5TY0A 4RFVA 2XTMA 4NZYA 4C0JA 1U0LA 4KVGA 2P6NA 3DZ8A 1CRQA 2RGGA 1EK0A 4RVCA 3MJRA 3WNDA 1FUKA 1RJ9B 2WMOB 1KMQA 1XE1A 4IVRA 5BN3A 2RGDA 2WWIA 2RC5A 4KHZA 4IVPA 3W8NA 4DZZA 1MKYA 4B3CA 2VA8A 1IXZA 1K6MA 4HAXA 4GZLA 2OE2A 1VDZA 1Q0UA 3ZVLA 2REOA 1N2CE 1PJRA 1FX0A 2OK8A 4P3YA 4FMBB 1WP9A 3GFTA 3N2EA 1KJZA 1US8B 1N6KA 5EZ5A 3AVYA 5FBLB 2JIZA 1DG3A 3WP1B 3L8YA 1Q1QA 3M0EA 5CIWA 4DLYA 3P4YA 2HT1A 3OHMA 4TWZA 4XTCS 4WXRA 5KSWB 4H1VA 1TU4A 1Z0KA 2J7KA 1KJYA 1KDPA 3CIOA 1LNZA 4L9WA 4BLPA 3W90A 1ZUNB 4IEIA 4A9AA 1KO5A 1KI8A 3WBJA 1ZMXA 2FSFA 2ZYTX 4O3MA 1CP2A 5CDFE 4OI4A 1YZGA 2PH1A 1G8HA 4BFXA 2H17A 2BMJA 3V00A 1KDOA 5CM9C 4YDSA 1AIPA 1EX6A 4BZPA 1RYHA 3OIUA 5KHOC 3AKDA 4JS0A 1G4UR 5KSPA 2JJ1D 1YQTA 2K5UA 5TV2A 2V7QD 4MITA 4PX9A 2SHKA 4A2WA 1FNCA 1E3MA 3CMAB 1KI4A 1E2HA 1W4BA 4NHOA 2WJYA 3ND9A 2VNHA 2PEYA 4KSCA 2XB4A 3F3YA 4IJMA 4RKEA 2YOHA 1ZNYA 3REGA 3DOFA 1E79D 4HZUB 2GILA 4GL2A 1II0A 3MRSA 2P6UA 1H42A 2IYQA 1XD2A 2MSDB 2ZYUX 4G5SA 4Y0VA 5KDLA 4PPNA 3TIFA 2F55A 1KAGA 1FX0B 1IY2A 2GEUA 3GJXC 3RC3A 2A30A 2E1RA 1UADA 4JJZA 1K8AD 2J5XA 3U7EB 3UATA 4B48A 3K9NA 2PJRA 4QHYA 4UAJA 3ZYCA 2VHUA 5DNYB 6Q21A 3B1WA 5G53C 2IYSA 1OIVA 2F43A 1GL6A 3CPEA 2HF8A 3FMOB 2RC6A 1FMLA 2J0UA 3QPVA 4KO8A 5TB5A 1G20E 3CWZA 3ZZUA 4JL8A 4NL4H 4U02A 4JMPA 4OQNA 3UMFA 3WY9A 2MSCB 5JHHB 2QI9C 1W7AA 3ZZTA 4HB2A 4DQLA 1X8JA 1W0KA 4WOPA 3OIYA 3CRMA 3GMTA 3BFXA 4MKFA 4ERNA 521PA 1GNPA 3CRRA 2JLXA 2QBYA 3AVTA 5LD2C 3ND8A 3RS4A 1P6XA 4URUR 4HLUC 5IRCD 5BQ5A 1KI1A 4Q03A 4LRWA 1QHHB 3T61A 4II7A 4TYWA 5AJYA 4QM6A 4M1SA 3IDQA 4ARZA 1R6BX 1W4RA 1SVLA 5JS8A 1EGAA 2V6IA 3E70C 1ZVQA 3AUYA 4YDHB 4OQFA 2JLRA 2GQFA 1XCGB 2ZI3A 3RDPA 3H0KA 1ODFA 3D7MA 1G3MA 2C9CA 4LHXA 2F43B 4U00A 1NJID 1QHXA 4XSHA 1A5TA 3ASZA 2QAGC 3RVBA 2IT1A 4EJSB 5DYIA 1E2PA 5AUPB 1R10A 3B60A 4PR0A 1OH7A 4EPYA 3GP8A 1KKMA 2FH5B 4ESHA 3BD9A 4IDPA 2FNAA 1R0ZA 3THOA 1VQLB 1C9KA 2HJVA 1DDGA 4OI0A 1N6PA 1Z6GA 4LGMA 2CE2X 2QRNA 3X2SA 3X1YA 1W0JA 1OKKA 1X6VA 1ELOA 1GSIA 3KTAB 5FBQB 4B4DA 2QGZA 3WHKA 3OJWA 3GFPA 1UKEA 2IYYA 2R6HA 3BH0A 3CNLA 2O8CA 3K9GA 3BWDD 5FBRB 1KK0A 5THXA 4Q4AA 4NONA 4LPSA 3A1VA 1HV8A 5KYKA 4Z1MA 2ZRNA 1E69A 1IN8A 3VAAA 3ADCA 3VNVA 1KNQA 4LYAA 4U5XA 3TSZA 2P2LA 1UDXA 3QXSA 1QGAA 4PPQA 3VKHA 3G71B 2IYVA 1D9ZA 2WWGA 3QBVA 1ZM9A 1DAGA 1SKQA 2ZJ5A 3MWLA 2KBEA 3IHLA 2WWWA 3N70A 4HZIA 4DSOA 2JJ8A 5EXXA 2OCBA 1W4AA 4TYQA 4CDGA 1U99A 3RNLA 3R9IA 4DRZA 5M04A 1QHSA 1IN7A 4GMXA 1SVWA 1DEKA 1VIAA 4LHZA 1OXXK 3KFXA 3U3KA 3IO5A 4GMDA 3HJNA 4XWAA 5CYPA 3ADBA 2OCPA 2PZGA 4BLRA 4EKDA 3G82C 1E2QA 1VQ4B 1Y63A 2ZJAA 4PANA 4Z8YA 2CNDA 1CULC 5E4FA 4JT4A 2JATA 4TYYA 3UXMA 1Z63A 2IYTA 1IN5A 3HU2A 1YHNA 3SE0A 3Q72A 4M0LA 4HDQB 3VR6A 4HDOB 4MYHA 3OE7D 4N3GA 4WA7A 1ZUHA 5FTLA 2D2EA 4LV8B 2BC9A 3UKDA 5FOTA 4UKDA 1Z6AA 2Z5FA 1YIJB 3E5HA 3R20A 4GDFA 3KJIA 3CMEB 3B5JA 3U60B 1F20A 1CEEA 2KJQA 1Q81D 3WNCA 1KO1A 4UNQA 2A78A 2IUSA 3KZ1E 3DEFA 3THWA 2F3TA 4Q1CA 1NN5A 1L7VC 2GETA 4GI7A 3SOPA 1NI3A 1LS1A 4CZ2A 5B57C 3B78A 1K73D 3T1TA 1D5CA 1HURA 4QBGB 1VQMB 3VTKA 2JJ1A 2NO6A 2YWHA 1Z2CA 1RE0A 3QKSB 3U4QB 1XZPA 1OGJA 3OESA 2GPJA 3K0FB 2YV5A 1JB9A 2PL3A 3KQLA 3OZVA 3EXAA 2MSEB 1KI7A 1OB5A 2AKYA 2WWYA 1E79A 2PJZA 4Q1BA 2QRZA 2Q9AA 3CZQA 1D6JA 1T9HA 1M34E 3TR5A 3I1FA 4OHYA 4BLQA 1ZD9A 1IN6A 4QHSA 1TVCA 1R0WA 2UZ3A 5GV8A 2ZYVX 2X2EA 4QL3A 3EWAA 1J70A 2D7CA 2NG1A 3PEVA 2ZRDA 1S3GA 1KHTA 1N5KA 2WSMA 4B3XA 2QDXA 4L9SA 2YHSA 3JZMA 4PAMA 3TRFA 1ZW6A 4PHGA 4C3ZA 3EARA 4R71A 1IQPA 5AR1A 1Q1EA 4GOJA 3THWB 4D2IA 4ZDIA 3AP2A 3VR4A 1PLLA 4A8JC 2ZI5A 1GRNA 5EE9A 2GK6A 5FL7A 5CB8A 1OIWA 1W36D 1H65A 3FMFA 1S0UA 4M1KA 2HJGA 2VHTA 1Z0IA 1E2JA 1QHIA 1QHGA 2FGKA 2JGNA 2O52A 2WKRA 2ZI4A 3NEJA 1G8GA 3Q5DA 1CJVC 1YJ9B 1KI3A 1G3IA 3HR7A 4AKIA 1QX4A 1Q86D 1CU1A 5DSZA 4OQLA 1PLJA 2QM8A 4P33A 4BLTA 3PCRB 1G21E 3W34A 4P4TA 1G5TA 2Q3HA 3NBZC 2V9PA 3DVLA 1N0VC 4B3GA 1T3LA 1Z0FA 5JBQA 2ASEA 1GRQA 3V4FA 1M1YE 1N6IA 3ZDQA 5EP4A 4L4UA 3IGFA 4IDNA 1RPZA 1KY2A 5EE1A 1OYWA 4A6PA 4HE5A 1Q3HA 5B58C 3RWOA 5L8VA 2H57A 3FOZA 4UXHA 1E2KA 5GJBA 1J7KA 3EIEA 1GOTA 1YZQA 1NMXA 1NSFA 3BS4A 1MT0A 4DLXA 1QHYA 4IW3B 5KNDA 3AF4A 3VX3A 4YXWD 5CLLA 1OXUA 3F0TA 3GLFA 1XTKA 2FFAA 2VPPA 4YLGA 4HB0A 1N6LA 1OHHD 2V1UA 3Q9LA 1BX1A 1FNDA 4ZCIA 5AWFC 2EW1A 3BRWD 3EZFA 5DI9A 3QEOA 2GCNA 4HLQB 4Q48A 4OI1A 4O0MA 4DBLC 4D81A 2I1VB 3NHAA 1GJRA 3WYGA 2Q3MA 2O8FB 2H7VA 1VCMA 1G4AE 5HR5A 1IOZA 1R0YA 2G77B 1W34A 4Q9LA 1HTWA 4KFSA 3QNUA 5AJWA 1FZQA 1A1VA 3R8FA 1NSTA 4NKRA 1OH8A 3L43A 1CJMA 1P5ZB 4D4KA 2ZU0C 3O8BA 2RGNC 5FPHA 1NBME 2QTFA 3TQCA 3SS8A 4AY2A 2ZRAA 5JEEA 2XTNA 3VNUA 2J45A 1CNFA 4LZZA 2QPOA 2QY9A 1KSHA 2CL6X 1T5IA 2G88A 2ZU6A 4OHWA 4AG5A 3K70D 1JR3E 1CJUC 1MRSA 2CK3D 4CYMA 1T6NA 2GXUA 2OFOA 3B1ZA 3GEIA 4PZYA 4HE6A 2O8DA 3O8DA 1Z8FA 1VYUA 1XJQA 1AA9A 1MO6A 2Q6TA 4TQUS 3BBPA 1FQJA 2IA5A 2OV2A 2ZRIA 5CITA 3K8YA 4F4CA 4L16A 5GADl 3KXLA 3NC1C 5G40A 2G1KA 5J4VA 3ZC3A 1PUJA 1FW6A 3C4JA 4B47A 1Z2AA 4NCIA 5JEDA 3LLMA 3SC3A 3QOFA 1UF9A 3SHFA 4ZI2A 3RYTC 2VZLA 1UBCA 1UPTA 3CM0A 4LX0A 1COWD 1VIYA 3VHLB 2FSIA 3ZVNA 2VHCA 2CDNA 5FTJA 3NH6A 4EJSC 3AF0A 3GFOA 5EP2A 2GDJA 4X8MA 3QKTA 2D2FA 5SZKB 3OE7A 1PV4A 2QPTA 3MJHA 2WOJA 4MDFA 2RGEA 4DSNA 4C0LA 3QUSA 4RZ2A 3C7KA 4HLUA 5JJLA 2PLFA 3JQQA 3SDZA 3T12A 2R6CA 2Z43A 4I99A 4Z54A 2XXAB 3HYTA 1FNNA 1P61B 1AQUA 4XOIA 4LHVA 1E9DA 4I4LA 5FPTA 1G1MA 1XMSA 2XTZA 2ZIAA 4XIGS 5K8IA 2AWOA 1G18A 2HCBA 1XNJA 4BPRA 4KFUA 4XWKA 2BGJA 3AVVA 2JLVA 1DPFA 2BBOA 4J0QA 3EZ2A 3MMPA 3U61B 3TQFA 1TL7C 4BZQA 1KSGA 4G1BA 2QMHA 2IYXA 1KNXA 2HCJB 4ABYA 3PXGA 2IWHA 3E1YE 3QSYA 3LVBA 2P5TB 2CHQA 2ZUBA 1KSJA 1VQPB 1QRAA 3CZPA 3CC2B 2OBNA 3A1TA 2RGCA 1Z22A 4MRVA 3UK6A 4R98A 4DKXA 3GJ7A 4QGFA 3QVUA 1OGIA 1P73A 4C2TA 3LLUA 3IIJA 4JJKA 5G3YA 5FBVB 3AP3A 1J99A 2QAJA 1MO3A 1RRPA 4BLOA 4YQFA 4U7DA 3RHFA 2J59A 4M9SA 3DOEA 2BEKA 2Q21A 4OYHA 4DCNA 4OQMA 2QUZA 5LD2B 5G3ZA 2W0MA 1D2NA 3U5ZB 3ZVMA 5P21A 1T91A 1YR8A 1VCNA 3RS7A 3F8TA 4MRRA 1BMFA 4PQRA 2H8KA 4KXFB 4C30A 1GO2A 3K9LA 1GIAA 3GLHA 3ES9A 1N6OA 3EA5A 1DS6A 1UKVY 2HXSA 2ZRJA 3BK7A 1A8PA 2IYUA 3R8CA 1OPXA 1TQ2A 4F4JA 1SVKA 1TQDA 2PMDA 4ZO4A 1OE0A 3P20A 3QKRB 2GHIA 5GV7A 1E2MA 3ZD7A 1Z6TA 2FU5C 1FNMA 3GPLA 3C16C 5HE9A 4GOXA 1PVOA 4EPTA 1OW3B 4CEHB 4C0KA 1GNQA 4P31A 3RRNA 4ZIRB 4MKHA 4D0LB 1UEJA 4K8OA 5F3WB 4PC6A 3VKGA 2GF9A 4E5UA 2QAGB 4GZMA 1PLKA 2EYUA 3CLVA 5JRZA 4NBSA 2NPFA 5HPYB 3EAQA 4Q19A 1RKBA 5KPJA 1VYTA 2ZQ5A 3KX2A 1U94A 4Q9JA 1YITB 4LYHA 1K8RA 2RKOA 3AH8A 1XPUA 1U90A 1KO8A 3U6KA 1OHHA 2OFXA 4KV9A 4MKGA 4PPGA 2YWEA 4LJ4A 2REXB 3AKCA 4WBSA 2OM2A 5JFGA 4A82A 5J4LA 1G7RA 2WICA 1TLLA 2IK8A 1KI6B 2QROA 4XSGA 4E03A 5GJCA 4HI0E 2Q3FA 1R0XA 1FUUA 1VPLA 2FPKA 1PUIA 2ANCA 3W2FA 3HU3A 3V76A 3OW2B 2EFCB 3MWJA 2BVNA 2QN6A 4Q7MB 1LB1B 2NMVA 3SBEA 4HAZA 2F9MA 5FOWA 3BXZA 1OXVA 4FCWA 2HMAA 5J4YA 2CCJA 4JLBA 2OCAA 1E64A 3GLGB 1Z0DA 3JVUA 4E22A 1NY6A 3K0CA 2X8AA 3DMDA 2ZTSA 4FN5A 4JSYA 4BE7B 5D3QA 1D1NA 5DHFA 2LKDA 4HB3A 2BM0A 3WXMA 1AK2A 4DQKA 4FCTA 2CK3A 4CRWB 2F9LA 5J5CA 1F6BA 1WA5A 4ZCMA 2G6BA 1XEXB 3W5VA 1TQ4A 2GNOA 3QXCA 2GXQA 2NO7A 3VHXA 1OT3A 5JJKA 4FWTA 4BUJA 5ELXA 4PC1A 1V43A 1OB2A 2QP9X 2ECKA 2FFBA 4PQFA 2XAUA 3MLEA 3EASA 5D3MB 1RFLA 1QVRA 1JEEA 3FFBA 1NJFA 3G6EB 1XD9A 4JKIA 5TVKA 2OAQ1 3I55B 1KGDA 4NPHA 4TLBA 5FI0B 1W2BB 3RS2A 1U2RA 3DMNA 4I81A 3ADDA 3PUWA 1RJ9A 1CF4A 1ZD8A 2OESA 3I5XA 5DN6A 5J4HA 4FXPA 1W49A 2ZJZA 3VU9B 3R9WA 2B21A 1Z0AA 3KKPA 2EWWA 4AYTA 4LJ8A 3ZVRA 3NH9A 1TEVA 4IDQA 4TL6A 5FUWA 4JLDA 3I62A 4HAYA 3IUYA 5EQTA 1QBKC 2GAOA 5FOVA 2Q9BA 4NTZA 3RRMA 4W5HA 5FBWB 2NZ8A 1US8A 2WWXA 4Q1EA 3ZH9B 1XBTA 5TDHA 2ANBA 2F1JA 2XNDD 4HAWA 1ETUA 3O47A 1JPJA 3QFTA 2CLDX 3B6EA 4L5BA 5TR9A 2HUPA 3X1ZA 5CJPA 2PIAA 2W0SA 2JLQA 3I72A 4F4IA 5DGXA 1BQEA 4MA4A 3QFSA 4TSFD 1EFTA 5IT5A 3LAWA 2ZAMA 2AKAB 1NF3A 3E2IA 1E4VA 2GESA 3LO5A 2PZFA 1VQNB 1T0JB 1XTRA 1S9HA 4R2HA 1WXQA 2ZR0A 3PV0A 1I2DA 3SBDA 1AN0A 1F60A 1GILA 3CH5A 5K8LA 1NG1A 2QTLA 2R8RA 1JJ7A 2IS4A 1QVAA 3AM1A 1R5NA 2ZUCA 2X2FA 4DCSA 2ATVA 1S72B 4HZUA 1Z0JA 4O2RA 1GTVA 2WJJA 4LJ7A 1IXRC 4ZKEA 4M53A 3X1DA 4ZI3A 3W2GA 1ZD1A 3KXKA 1E0SA 4QGAA 1S96A 1GG2A 4Q4HA 3H1TA 4ZV4A 4V0ME 2CL7X 1D2EA 4F92B 2AFHE 4NCJA 2F1RA 4LJ9A 3A4NA 1CBUA 4TTRA 3FKSD 2DPXA 4XJXA 1JI0A 4A8JB 4Y9RA 2F1HA 5IK2D 3MUFA 5L3RA 5H5JA 5KSYA 1U0HC 2A9KA 3AV0B 2ERXA 2J0SA 4IOKA 3IIKA 1KTVA 1TF7A 4PHTA 1I2MA 5J47A 3KB1A 4HYYA 4CEIA 1YE8A 4IOJA 2RGNA 1J8MF 4URZR 2ZE6A 4DVGA 3M6AA 4YMVA 1SXJC 4KITB 3NIBA 3HP1A 2VF7A 3SJCA 4UJ5A 4PQYA 2EIXA 2ODBA 2EWVA 1G8FA 3MWYW 1P2UA 4JT2A 4D26A 4JBYA 3T1OA 1T3HA 1OXTA 2CJWA 2E87A 3TW4A 1ZUIA 1QHHA 2EVWX 3T5DA 4I1UA 4FW9A 3QFRA 2IEZA 1MR3F 1OV4A 4MGKR 4MGYR 2QMUA 1YKSA 3EPJA 4QRHA 1J8YF 2H16A 4D4MA 4Q4HB 1HE8B 4RZ3A 1JQLB 2G0NA 1SGWA 4LI0A 1DAEA 3UWOA 4US2R 2OBMA 2W6JA 4LPKA 1VECA 5BWMA 2C77A 2R6FA 2A2ZA 2AXPA 5BW8A 5K8TA 2J3EA 3NWJA 1QGYA 4RD6A 2D4HA 2ZPTX 2CMKA 3AQ4A 2W83A 4MRPA 4URYR 4CEIB 1JPNA 3AB3A 2VP4A 4EJSA 3A6PC 2ZJBA 3FWYA 5GJVC 4MYCA 5J40A 3DHWC 1NNEA 3FMPB 3LD9A 2ZROA 3MG9A 4Q9KA 2BMFA 1X8KA 4Y9UA 4LWZA 3ICEA 5DH9A 4QKQA 5H59A 1P4SA 1X3SA 5FL7D 5E3HA 5FPYA 2OK7A 1NVWQ 2JLZA 2BM1A 1ZIPA 4LC1A 5DISB 2JLYA 2CJWB 5F2EA 3BH6A 3EIQA 4Q66C 2CVFA 3KTAA 4XD7D 1IM2A 1H8EA 2QSZA 3GQBA 2CEAA 2OZEA 3LQRA 2WPDD 5FPSA 4KFTA 5CDFA 3LWNA 4UJ3A 1ZM3A 3QG5A 4NMMA 4ZDKA 5B64A 2FWRA 1Z08A 1U9IC 4QJ5A 4PHHA 4EFNA 5DI3A 1CR4A 2CVHA 2WKQA 4UNNA 1EXMA 2H92A 1W2GA 2QNRA 2ZI6A 4D6PA 4E07A 4EFLA 1TADA 2ZJYA 1DBSA 2C2HA 3SU8A 2BHRA 5KDOA 2W2VA 2ZETA 1KSFX 4PSVA 5JHGB 3L2OB 3QKUA 3TUZC 1P3JA 1P9NA 1BIFA 2BKEA 3ICQB 2RCNA 2BIFA 1GL7A 3AUXA 4FK8A 3AVPA 3IILA 3BE4A 1BKDR 1HUQA 1NVUQ 4BFVA 4Q00A 2V3CC 3OZWA 4M1MA 3B1XA 5TARA 2P6RA 2ZI7A 4D0GA 1U98A 2RHDA 3B85A 3RAPR 2GZAA 3MCAA 3QF4A 2YJTD 1G6OA 1T4GA 2PCLA 4P0TA 4IXMA 3CF2A 5LBIA 1GITA 3AF3A 4PO1A 5DE3A 4Z8XA 5L3SB 1MRNA 2C5LA 3DDCA 5JJIA 1EFUA 3H84A 3VR2A 2BGIA 2XNDA 4Q7LA 3LRPA 4TMWA 4H9GA 2ZXUA 1GAJA 2ZRGA 2VTKA 4AF7A 1HEIA 2REBA 4TLDA 1DAFA 4N0EA 3U44A 4WZAE 1VQ7B 5DI3B 4BWYA 1I4LD 2ZRBA 3PIRA 1G5PA 4TSFA 4NCHA 3B7GA 4HSEA 4M4SA 2W2XA 2ZE7A 3QPWA 5FUYA 4BLSA 5JMTA 1M90D 4FIDA 3S1AB 4QM7A 3AVQA 3ZJYA 2HDNB 1JALA 1Q1BA 3IEUA 1FQKA 4D80A 1II9A 4FWIB 3QKSA 4G5QA 3U4QA 1JQJC 1E94E 1ZC4A 2BBSA 2C96A 1N25A 3K0FA 2X77A 3KB2A 4GOKA 1SVIA 2ODEA 2KI5A 3C41J 2G83A 1I7PA 1Z07A 2QM7A 1EESA 3QF4B 1XDBA 4OK3A 4JLAA 1HT2E 1XX6A 2G0TA 1G7TA 2BEJA 4A0HA 3JQRA 1VHTA 3VR5A 4Y0AA 2GZHA 5JCZA 1XEWX 3CCEB 3SZRA 2DERA 4MH0R 1NRJB 2IHYA 2WSSD 2RGAA 3FKSA 1I4DD 3CCSB 1S4QA 2OFWA 4HDCA 3EZ7A 3TVDA 3BH7A 2BSAA 3N2IA 1Z83A 5IK2A 2P5SA 1NVXQ 3B2EA 3KKQA 2FFQA 4AIIA 3BOSA 5DYGA 5JWRA 1X8LA 1LFDB 3NDBB 4EDHA 3U44B 1VHLA 1BJKA 4FINA 1R7RA 1BS1A 2XEXA 3LW7A 2DR3A 2WWFA 3WMFA 4LJAA 3KUCA 2FZLA 2ZI9A 1OFUX 3QE0A 4MRSA 4TQAA 2P3SA 2YVUA 1G291 1C1YA 3BIFA 5CLQA 2UZIR 3LA6A 2OLJA 3VO1A 4N1AA 2N46A 1OXSC 2B8WA 1YR7A 3HWSA 2QA5A 2DEUA 4X8HA 2RB4A 4I1OA 5HZKA 1P2SA 4EFMA 2DFNA 3ZQ6A 1SHZA 2GXSA 2XGJA 3NXSA 1GRRA 1HYQA 1N5IA 1XEFA 2NTYC 3OF5A 5EXSA 3QXHA 5G41A 4DT1A 4YAOA 1WQ1R 2HYDA 4MGZR 4EPWA 2WTUA 1P2TA 3UG7A 1TTTA 1KDRA 2D7DA 5CB6A 1XJCA 4DIEA 4KLNA 3G0HA 1VG0B 1KJWA 1LY1A 4HLDA 4B44A 4IVQA 2LKCA 4NP6A 4M9XA 5GVRA 2WKPA 4DEXA 4XVQA 5KOYA 1CJTC 3B9PA 3NEYA 1ZCAA 3SQWA 1U8ZA 2O0KA 2CRVA 1Q22A 2WHXA 4D82A 4DCTA 1AGPA 1P7CA 2LWIA 4IEEA 1BMFD 1UJ2A 5C18A 4ACBA 1Z29A 2R6GA 3PVSA 4M1OA 4NDZA 5KTYA 3U6BA 2ZJ2A 4GSYA 4RD1A 5CK5A 2O8FA 4JL5A 4BFZA 1SXJE 2R44A 3IPXA 4A6XA 4HUTA 1LF5A 4DDTA 1B23P 3LQQA 4QBFA 3A4LA 3OZXA 2FX3A 4DSUA 4GNKA 4N0DA 4GP6A 1LF0A 4A36A 4GFDA 2O8BA 421PA 1ONBA 4QOSA 1AZSC 3TKLA 3VKWA 3IEVA 1ZU5A 2V6JA 4XD7A 3WBKA 3A1SA 1OFHA 5FTKA 3CONA 4DT1B 5JWHA 2WPDA 4NE2A 4QBHA 3FGNA 2ODNA 2ZJ8A 3SYNA 3VO2A 1F5NA 3CO5A 1UAAA 2A3RA 4YHBA 1W48A 2IC5A 3GJ8A 4IFEA 3KJHA 2IS1A 2JCSA 3AKEA 1FDRA 4PTLA 4W5JA 2G1JA 1ZJ6A 3ONWA 3PR1A 1DE0A 5JSZB 3ZZ0A 1TPZA 3DM9B 4V0LA 2OILA 1TAGA 2NOAA 3BFKA 3W5IA 4DUGD 4YMTA 1Y3AA 2HF9A 3SFVA 4RFSA 1GVNB 4GT1A 2JLUA 2QA4B 2DWPA 3W8RA 1XXHE 4JYCA 2EYQA 4IOMA 4KI0A 3ZBUA 4UNPA 3Q7PA 4YONB 2PEZA 3T06B 2ZRCA 1KIMA 2ONKA 1E96A 4B71A 3M1IA 2C8VA 4DDUA 3T1VA 1GKYA 1BH2A 4D4JA 3KQHA 2XJ9A 2O8BB 2X3UA 1OFTA 4B43A 1G64A 1KO4A 1KOFA 1NKTA 2IYWA 1JEDA 2PX0A 2GBLC 5KPDA 2WVJA 4B35A 3CWQA 2EFDB 1M8PA 2P65A 1ZBDA 1QGZA 5AN9A 1FP6A 2IF0A 4C43A 3SHWA 4BPBA 5HCNA 4URWR 3BB1A 2AN9A 4AKHA 1GKUB 1GAWA 2XXAA 1CKEA 5L3VA 4WQMA 1GP2A 1EFCA 5A4JA 5JI3E 5FOUA 4RJLA 2RMKA 4IDHA 1F3OA 4HB4A 4YMWA 4BZXA 2D62A 3Q7QA 4M9QA 3SYKA 3IPYA 1R8QA 3BAFA 2A5JA 4RFSB 4MDEA 3P27A 3CXCB 3CRW1 2PLRA 4ZCLA 4LJ5A 1TUEA 4DXAA 2NO0A 4HATA 3I92A 4M2LA 3KQUA 2WJGA 5DN6D 1JR6A 5FUXA 1R4AA 4C0QC 4AWXA 4C4PA 5HXBA 1KRHA 1Q7YD 1G6HA 2B92A 3CCMB 1E2NA 4EQ6B 3CD6B 2NO9A 2ZRHA 4KAXA 3W2EA 4B2PA 2KWIA 3TE6A 1Q57A 3NBYC 1YRAA 4B76A 1SXJB 3SYLA 4GP7A 5JECA 2W6ID 1AS3A 2WSSA 4PGOA 1E9FA 1XMIA 2BPOA 2FFHA 4C0BA 1E6CA 4NCNA 5L3QB 1IJFA 2OHFA 4NYJR 1Z5ZA 1A4RA 4BEJA 5KNCA 3RS0A 1JAIA 1JAHA 1II8A 4TMVA 3AVWA 1Q20A 2V54A 2ZAOA 4DLVA 2FSGA 4S2EA 5EP3A 3EW9A 3MAAC 4QBIA 5KSZA 1YJ5A 2BMDA 3THXB 3B1VA 3KQKA 2XOKA 5KSOA 1KYIA 2RH5A 2ZRMA 2DHRA 1CIPA 4ZDWA 3PUVA 4DWJA 2ZRFA 4Q01A 3QKRA 1P2VA 5EUMA 1D2MA 2QENA 1QVGB 1TUIA 2VP5A 1DELA 3LNCA 1U9IA 3N5CA 4FMCF 5HTKA 4AKEA 3K0AA 4CEHA 2BOVA 2D3WA 4PO9A 2CE7A 4ZIRA 1QH0A 3OEHD 1OLOA 2TMKA 3T35A 4G5OA 1O87A 3AF1A 1DOAA 4Q9HA 4K1XA 1DAHA 3CCJB 4P4SA 4TLAA 2QAGA 3ZGXA 2Q0HA 4R9UC 1XXHB 3CBQA 1GWNA 2FE4A 2FEOA 1OH5A 3UWKA 3CCVB 1BX0A 4Q1AA 1EFRD 2EFHB 1GVHA 3BC1A 5HZHA 1KK3A 3D31A 5CM8B 1VQ5B 3CF6R 1UKYA 2BBWA 3W3ZB 2HLDD 3Q3JB 1EWRA 2BKUA 1P72A 2QU8A 1N5LA 3P26A 1II8B 1XJ0A 2W00A 2WM9B 1NL3A 4WXPA 4ZKDA 3NVAA 3RABA 4NCKA 2J0QA 1Q12A 5FR2A 2ZS7A 1KI6A 4OL0A 4Q02A 5E7JA 1KZGB 3TW8B 4AF6A 4JLNA 3RLFA 2O8EB 1R5BA 5AUQA 4M1YA 1N5JA 1OFIA 2BF4A 3FHTA 3W3AA 3NBXX 2PT7A 1ZIOA 2HV8A 1AKYA 2VYFA 3UANA 4M22A 2G9NA 3RSLA 4PSAA 2BV3A 4JLVA 1W47A 5FR1A 3I5YA 2OEPA 2R2AA 3GLGA 4JVNA 3K0AB 3TMKA 3RC8A 5GJWC 4CVNA 3E1SA 4KBGA 3QVVA 1EWQA 4V0OA 4F7DA 2ZSFA 3J81k 4Q1FA 2AHOA 1E9EA 1E0AA 2XNJA 3LW8A 3TR0A 1EFHA 2X19A 4A4DA 2C9OA 3CPHA 4P4SB 4A2PA 4JL6A 3KUDA 1G16A 3NG1A 4S35A 621PA 1XEXA 3THYB 4HEJA 1Z3IX 1ZYUA 2QE7D 1ZNWA 2W6JD 4B75A 2JAQA 4Z51A 1KAOA 1NN3A 3EPLA 2ORWA 2FN4A 3GLIE 2IEYA 2ZSBA 4WZ6A 5D3MA 4DUGA 3T5GA 4D4LA 4OJQA 2FDCA 3CX7A 1IXSB 2FG5A 3RANA 2AD1A 1JA0A 3WYFA 4LY6A 4BEBA 1E63A 3CPWB 3L0SA 4PAQA 2IHBA 2FA9A 4QNMA 2NQ2C 1X1SA 3HPRA 4TL9A 1QF9A 3TH5A 1L8QA 4FMDF 3P1JA 3TAHA 3TVTA 1TNDA 1NIJA 1P62B 3VU9A 4URVR 4YALA 4B74A 2HXYA 4G1VA 3A8TA 2GRJA 3AVOA 1BOFA 1K5GA 3FE2A 2WIBA 1U81A 1QFZA 3CX6A 1H8ED 1SHKA 1RVDA 1QG2A 2NPIA 4DDWA 2AFIE 4OK5A 1F2UB 4ILEA 3K0EA 2GTPA 2R6AA 4B6EA 4DJTA 2I1QA 3OIVA 4KU4A 2IYRA 4AYWA 2VNKA 4AC9A 3M4YA 2HEIA 4TL8A 4ZGQB 1XTIA 4XH9B 4KJZA 4CT4B 4OHVA 4OHXA 2FZ4A 5C2JB 2BN4A 3B82A 3GD7A 3RS3A 3TSWA 4QJ3A 2H5EA 1FOEB 1DAKA 3NC0C 1TX4B 3FKQA 3EG5A 1WBDA 2AK2A 3U7GA 5EP1A 3V9PA 4G5GA 2EFGA 5ANRB 4W5WA 1UMKA 3EA0A 4ITRC 3IBGA 4BFUA 3FHCB 4DLRA 1Z47A 1XTJA 3DPUA 1SULA 1IY1A 2ZS9A 1MH1A 3D3QA 1MO5A 4EAQA 3QY0A 2JASA 3R7WB 3VR3A 4AK9A 5JI2E 1CXZA 2XNSA 5EXTA 4KODA 1OSNA 1JXMA 1XRJA 2EFEB 2IYLD 2JDID 3MFYA 1FP7A 1TF5A 2EU8A 4O25A 3SFZA 4DCVA 2GCPA 2QP4A 5FUVA 3KKOA 5KUTA 1MOZA 1E98A 1VYVA 2DWQA 2FMXA 4QJ4A 1AJEA 1K5DA 2GJAA 1VKJA 1QDEA 2B8TA 121PA 3IQWA 3KJGA 3OFND 2ODWA 3BJIC 5BYKA 4BFTA 1ZM4A 3CUEF 4M9ZA 2W6IA 1QZXA 1XZQA 1YI2B 1MV5A 4A8JA 2PMKA 4C9BA 2QGNA 4C0HA 1VCOA 1TU3A 1E9CA 5DLQC 4EUNA 1FMJA 3RSOA 2JLWA 1Q1ZA 4CT5A 2VH5R 4DLZA 2JEOA 2DCUA 4B73A 4PO8A 1HQCA 1D9XA 1VG9B 3IIMA 3CRZA 4QG7A 1P9RA 4JYBA 2QORA 3QG1A 1HT1E 3MD0A 1XF9A 1R8SA 4DC9A 1IBRA 2QT0A 2C9YA 4ACAA 2Y8EA 4NYMQ 2FPMA 3H86A 4UNRA 1QUFA 2IWRA 1BYIA 4JSTA 3P4XA 1YZUA 3KL4A 2F3RA 4G0NA 5KO2A 4LHWA 3A4MA 1WDTA 2CNWD 3OEHA 3EPHA 3VQTA 1NIPA 1E9RA 2F6RA 4Q47A 3EPKA 1XU4A 3I8SA 3CC7B 4KFRA 1C4OA 2CL0X 3NTUA 1Z6YA 1NDHA 1VG8A 3WRYC 2H18A 2ZSDA 5FTMA 1JXOA 1EFRA 4ZPXA 1CR1A 1HE1C 1H8HD 3ETLA 5FH9A 2BDTA 2HLDA 5EMNA 3CPJB 3CRQA 4GRAA 4Y7CA 1CQXA 4EPRA 3WMGA 2ATXA 2MMCA 1W5TA 3GEEA 1IY0A 2VO1A 3FPAA 3OAAD 2GJ9A 3I56B 2R62A 4LK2A 4Q1DA 2GBLA 2P67A 1YR6A 2IL1A 1UBGA 4POAA 1KZ7B 5E7MA 4DLWA 1S3SA 1DVRA 4KBFA 4WZBE 2GCOB 4PXAA 2GVDC 1IJEA 2ZRKA 2FJUA 3K53A 1Z28A 3BERA 4M8NE 1YR9A 2YZ2A 1U0JA 4JBXA 3SEAA 5BN5A 1GZSA 1RRFA 4MRNA 4P32A 1ESMA 1OYYA 4UNSA 1XCPA 3MSXA 1YZNA 4DIDA 1WCV1 5EJEA 2AXNA 3LO8A 3L0IB 1NP6A 1T8TA 5AK0A 1CTQA 1TMKA 2IUTA 3AVXA 2VP0A 3LY5A 2QSYA 2VP6A 5H1YA 4NYIQ 4AI6A 4PZLA 2DB3A 4YAUA 4H1UA 2GKSA 5F9HA 3K09C 2RGXA 3B9QA 4ASUD 2AR7A 4XTRA 1OIXA 1J2JA 1QVFB 1UM8A 2CXXA 2QE7A 2UVQA 4LDJA 4C0AC 2JJ2D 5SZJA 4CIDA 3FFAA 4EIWA 2YKGA 1M1KD 2BMEA 2KBFA 4F7WA 4C7OB 1M7GA 2OLKA 2VEDA 2OTLB 1YVDA 2VP9A 2Z83A 1EP1B 1YRBA 1LV7A 1VTKA 2Z4RA 1SVOA 4TMKA 2P0EA 3KKNA 2OG2A 2I3BA 4LYJA 2ZYWX 4V0MA 4F93B 4UXIA 1AS2A 3OJXA 3K0SA 1EWYA 1QFJA 5HE8A 3WYAA 5LB4A 3GEHA 3L0PA 2IF2A 2R6DA 2OUKA 5LB2A 1LVGA 3PEYA 3VFDA 4BRWA 3DL0A 1ESNA 2YWGA 3W6NA 4QC2A 3SI7A 1S8FA 2BJVA 3IQXA 2ZUDA 3B1YA 3A37A 2C04A 1FTNA 2OCYC 4RZUA 1Q82D 1M7BA 2KSQA 5KU1A 3C5HA 2GWHA 1KC8D 5L3SA 3TLXA 4UXJA 1TF2A 4TMZA 3PFIA 5C4GB 1UFQA 1ZAKA 3GJ3A 3LBNA 4KYUA 4B2LA 8OHMA 3FB4A 3A58B 2J46A 3SJZA 3AEZA 5H68A 2Z4SA 2HYIC 4JVLA 1FPMA 3D6TB 4X8OA 2QTZA 1CR0A 2O5VA 3A36A 1JBKA 3QE2A 1N6NA 2QPAA 2WBLC 2YOGA 2LCFA 2VF8A 1M6NA 2J41A 1N6HA 4HUQA 1KI9A 1XMVA 2VP2A 1E9AA 2F7SA 3BFVA 4EPVA 1KDTA 3S1AA 5LPNA 3EX7C 2HT6A 3V4RA 4OBEA 1L2TA 2GXAA 2QTVB 1XD2B 3QQ5A 3QI2A 3T15A 4F91B 2AK3A 2QEXB 2VSOA 4RSGA 1JJ2B 5B2ZA 2JDIA 2A5GA 5AJZA 3I73A 3K1JA 1WE2A 1E1QD 3FMIA 4TL7A 4V0KA 1IN4A 4B3BA 4JLOA 3KJEA 4Q7KA 1E2GA 2A7QA 3OFNA 4IKEA 2J0UB 2ZREA 1A82A 2FF7A 5DIFA 2QTHA 1SXJD 1WBBA 1AMOA 1HY3A 1E1RD 5JS7A 3LFUA 1ZRHA 4FD2A 4IOLA 1E2EA 1RC8A 4O2LA 5JCPA 2QBYB 2QMEA 4M1WA 2WIAA 1NMYA 1MABA 4PZZA 5JLJA 5CYOA 1E62A 2ERYA 3FYHA 1A2KC 2KE5A 4LSGA 4CW7A 4HUQB 2YC2C 4JLPA 4HLCA 1DO2A 1W46A 4ARZB 2C95A 4TYNA 5IDVA 3CNOA 1VCIA 4GPTA 3GCGA 4D25A 1B0UA 3D8BA 4AD8A 3VMFA 4NYMR 1W36C 2DYKA 4LJ6A 4MYUA 1G5RA 2VLIA 5FA6A 4US0R 4TMXA 1GUAA 3SNHA 1NN0A 2CNWA 4KYIB 5EZ6B 1G7CA 3OEED 2VBCA 4DB4A 1IONA 4PAOA 1YZLA 3LX5A 1Q21A 1VMAA 3OIWA 2KB0A 3TUJC 4Q5IA 3RRZA 2YYZA 1GKIA 4V0NA 3UIEA 2J7PD 1YHQB 2IW3A 4US1R 1YZKA 1D8TA 2CCKA 4G01B 3O8CA 1W87A 2DETA 4UQOA 1H8HA 3PEWA 2A5YB 5FPKA 2J1LA 4QXAA 4NYJQ 1ZM2A 4OJKA 1GM5A 1VQ6B 1UBEA 4B6FA 2QT1A 1B2RA 1KY3A 3AF2A 4V03A 4PC2A 1UDWA 2I4IA 3G5UA 1SKYE 5FFMA 4LOAA 4A0RA 2C03A 1NBMD 3DKVA 1MABB 3HDTA 3OAAA 4JLKA 4Q4JA 3U3JA 4ZGNB 4N3NA 1LW7A 5KDDA 1JA1A 2BCJQ 4C2UA 1QG4A 2ZANA 2XOKD 3HYRA 4YAWA 1Q44A 1OH6A 1JR3D 2WZQA 1E2IA 4BASA 4TTPA 5KNBA 1T5LA 2G3YA 2O8CB 2JA1A 1W2HA 3C15C 4RY2A 3CC4B 5F9FA 4Q4AB 4LBZA 4B34A 2V1XA 4DLTA 3TJZA 2OBLA 1JNYA 3LV8A 3WNBA 4C7OA 1YU9A 4W9MC 5TMPA 2W2TA 2J0VA 3W6OA 4L8GA 1ZNXA 1CRPA 3TNFA 1J9ZA 5H70A 5JRJA 1AQYA 2N42A 4DHEA 5AJXA 2PX3A 4DCUA 4XVUA 3K0CC 3CRVA 4TYPA 2AX4A 3BGWA 4A1FA 1ZINA 4IRUB 4NYIR 4IHQA 1PZNA 4ASUA 4K81B 3K70C 2DFKB 2V8OA 2V4ZA 1L4YA 221PA 3P32A 3I61A 1JJVA 2PCJA 4G3XA 2JJ2A 4TT3D 2V7QA 1FRNA 4IFBA 5JSZA 1P75A 4OI2A 5DO9A 1VQOB 5FOSA 2ZE5A 2C98A 5J4KA 3ZIAD 1U8YA 1KD1D 2ZJOA 4Q4JB 3X1WA 2QQEA 2ZS8A 3GLFE 3W5HA 1W4CA 2D06A 4I1VA 2Z6VA 2ONJA 3F5FA 2GAAA 3O8RA 2ZR9A 1NKSA 1M7HA 5CJ2A 3CR7A 1R5OA 4I1SA 4KLZA 5K8UA 4A15A 3PJRA 4IXNA 1ZCBA 1EX7A 3W2IA 4K46A 4W7SA 3JQPA 4B32A 1SVMA 4KCGA 5FTNA 2ZSAA 1JB1A 2W58A 3DO6A 1KQSB 3E20A 1DARA 2FOLA 2WJVA 1YJWB 3W5UA 1SVSA 3I8XA 3ZBTA 3LX8A 1W44A 4Q21A 3W9YA 1N0UA 1AKEA 3IBYA 4Q7JB 3TK1A 4R2IA 3C8UA 3LXRA 2B7CA 3QJYA 2ZEJA 2OSBA 2WJIA 3EZ6A 2D74A 4HAVA 4LCBA 4JLMA 5EE0A 5BN4A 1T0HB 2QG6A 5C4MA 2FSHA 3FVQA 4YC7A 3QF7A 3R9XA 3QXJA 1W1WA 2ORIA 1QHNA 1G8YA 3CW2A 4L15A 3ZS9A 2GEVA 2ZVQX 1KK2A 3W6PA 3MWKA 4JVSB 2NO1A 3A1UA 3C5CA 4DLUA 2Z0MA 3T1QA 1EP3B 3GJ6A 4URXR 2GJ8A 2AD5A 3EC1A 1F2TA 1HA3A 2DBYA 5SZHB 4RCYA 4M1TA 1R2QA 5CIQA 2WAYA 2XSZD 1VQ9B 3FPKA 4E09A 1DTSA 4LV5B 5TXGA 1M74A 3WRXC 1E1QA 1SKYB 3CCQB 2QZ4A 1G17A 3MGCA 4EQ6A 2IS6A 5C46F 4RD4A 5FI1B 3WHLA 1FRQA 3L82B 1G9XA 1E4YA 2GK7A 4LBWA 2WJHA 4B2IA 1SXJA 1T8UA 721PA 3CCLB 1E1RA 1XTQA 3BB3A 4YMUA 2IBMA 3SQXA 4MUBA 3LBHA 4B33A 5BYJA 4RD3A 4RD2A 3RRYA 3UMRA 4RCZA 5L3QA 5F98A 4BRUA 4TLCA 2VSXA 5AUNB 1A2BA 1OJLA 5FOXA 1E0JA 2YWFA 1EG7A 3H4MA 4BFWA 1A7JA 4OKSA 4ZDJA 3LXXA 1HH4A 3KFVA 2DFLA 1GR1A 1IHUA 3KKMA 2WMNB 3THXA 3LDAA 2VL7A 1QFYA 3UPUA 4BFYA 1ANKA 1HQYE 1XPRA 1AM4D 2PBRA 3DZDA 2JLSA 1E2FA 3K09A 1CLUA 3LVQE 1NVVQ 1U8AA 1F2TB 5C1BA 1AGRA 2NGRA 1AS0A 3I4LA 1ZU4A 4LUCA 3LVRE 4WVFA 3ZLJA 2IXEA 4AKGA 3OEEA 1ZC3A 1RW4A 1Q3TA 2IUUA 5GVSA 2ZSEA 1T3SA 1KI2A 4BFSA 5HCIA 4GBMA 1S1MA 3GLFB 3G4SB 1NLZA 3LBIA 1XXHA 2J7PA 4P6VF 4G5RA 5LDDC 4KSBA 2IX3A 2B5OA 1UKZA 3U2QA 1CJKC 2WV9A 3Q85A 4X8LA 2RHMA 5A5GA 1SM4A 1S2MA 2PZEA 2NZJA 2QQ0A 2YINC 4MQBA 2QEQA 1ZP6A 2IYZA 4Q4LA 3KDSE 4LYFA 2GZDA 2XZPA 1N8RD 3UMSA 4M21A 4R7ZA 1NBMA 2QMOA 1NJGA 2RAPA 1TEXA 5HKKD 1N0WA 2XJ4A 2O8EA 4WIAA 1JR3A 1G8PA 1NG9A 4F38A 4CEJA 3GLHE 2OTJB 4ESVA 2H1LA 1UEIA 1VG1A 4A0GA 3HR8A 3I3SR 2OO7A 5EXPA 3CCUB 1IB0A 1RRCA 3PUYA 2O8DB 4QFMA 2UKDA 3RS5A 2V55B 3KQNA 1P9WA 2XZOA 5A0FA 3GLGE 2VYQA 2ZVPX 1DADA 1G3RA 2OXRA 3JVVA 1CS4C 5IF9A 1NLYA 2R65A 5FL3A 3CH4B 4C0SA 3CCRB 4PPFA 3UG6A 2DWOA 2AL7A 2X1VA 1VQ8B 4MGIR 5IHPA 3THYA 4NU0A 4DSTA 1XB2A 3QFCA 2C78A 2N1BA 3JZAA 4TT3A 5AUOB 4PHFA 4LV6A 1S1CA 3A1WA 3QENA 1RRGA 2PT5A 4A92A 3QEJA 1M2OB 3ZS8A 1DAIA 3ZIAA 4MYTA 2B7BA 4U9UA 2BBTA 3H2YA 4JVMA 1NMZA 4TQ9A 2XB2A 1I4TD 1KK1A 1N3BA 1XEWY 1E9BA 1XD8A 2B6HA 4JBWA 1OF1A 3IKJA 4QNRA 3FTQA 4PC3A 1VQKB 4HAUA 4QGHA 4DDVA 2XITA 5JZVA 1QUEA 3WMEA 2BMWA 4EPXA 4CEJB 4RD0A 1ZM7A 3FHOA 1K9MD 2OT3B 2JIZD 2NIPA 2R9VA 1QG0A 1DDIA 3GJ4A 4PC7A 3KXIA 4RKFA 3ZD6A 1DO0A 3BB4A 4MKIA 5EE5B 4OHZA 1KO7A 3QIAA 3VX4A 5B30A 1XWIA 3C14C 1BYUA 4D0NA 2ZE8A 2FPLA 1V5WA 3ADKA 1F2UA 4CGZA 1IAQA 3U3MA 1FTSA 2XNCA 3PENA 3QBTA 4TMTA 2VHJA 2DFTA 2ZRPA 1E2LA 1RIFA 5EE3A 2Q9CA 2J87A 2QL6A 3EWSA 3ECCA 4WAUA 4QGGA 4A0FA 4XWOA 2XX3A 1CR2A 4XVRA 4PSKA 4YAFA 3B13B 3FJOA 4V02A 3U7FB 1FNBA 3CB4A 1EP2B 2GJKA 4FMCB 3AGPA 2CLCX 3IO3A 2J9RA 4FI3C 5JWOA 4Q18A 2GA8A 1W5SA 3PUXA 1FFHA 3Q5EA 1E2DA 3DM5A 4AYXA 4G1UC 3SR0A 2GEDA 3TAUA 1G3QA 3PEUA 1WRBA 3R7WA 3WP0A 4DEYA 2FGJA 3FDIA 1LS6A 1CNEA 4LC0A 1SQ5A 2AWNA 2WWHA 2CLSA 4BECA 4P4UA 3HU1A 2WAXA 2VSFA 2O0JA 2XSZA 5DHAA 5SZIA 4LBVA 2BCGY 1F48A 2QP3A 5E7IA 2IXFA 1YZTA 2CHVA 4TTQA 4YXWA 1E0KA 1G7SA 1NLFA 2ZR7A 1DAMA 3EIHA 2F1IA 3TGPA 2IXGA 5UKDA 3NBFA 3NKVA 1E99A 4NH0A 4B3FX 1S9DA 3AGQA 2FEMA 3HPQA 3VR1A 4MUAA 1W0KD 3GLHB 4ON9A 4YMSA 2WOOA 4BQSA 4PFSA 4QHTA 1E32A 1XTSA 4A2QA 1GAQA 4OQXA 3CKLA 1ZNZA 3TBKA 3EC2A 1WMSA 1WB9A 1W36B 2IS2A 2EQBA 3L0OA 1SZPA 4AURA 1KMHA 821PA 1XMJA 4DB2A 1KKLA 2GVZC 2DY1A 1RZ3A 3I32A 1W35A 5H8WA 1GL9B 1G19A 3K9HA 4FCVA 3W5JA 1G3UA 2YOFA 1LTQA 4JZKA 2YNMA 2GJSA 1WF3A 3CNNA 4EH1A 2E9SA 3ASYA 2O0HA 1NVVR 1RYFA 1X86B 4LHYA 3QXXA 1P60A 1Z06A 1GFIA 1GDDA 4TLEA 2XZLA 3T34A 3GJ0A 3TSOA 1XPOA 2FV8A 3GLIA 2VNJA 3AVUA 2YC4C 1UBFA 3TUIC 2ZITA 1MO4A
chains in the Genus database with same CATH superfamily
2DMRA 4WRRA 3R3JA 4P0PB 4YRFA 3DVQX 2VQSA 5HF8A 5TRTA 3DP7A 3BL5A 4Q4CA 2UZ1B 5JH7B 2VIIA 3M4ZA 5KS2A 2VWQA 3QPUA 3V33A 1ODKA 4XB6B 3TLKA 1HORA 5KYWA 2B2CA 2PK3A 4JQCA 5I4BA 2V8BA 4PWYA 4PYIA 1CQIB 4X3CA 2YCBA 2CCGA 2RBGA 4HDMA 3QWIA 5GGYA 3UFXA 5JPCA 2XADA 3R6DA 2Z9BA 3LC0A 5CCXA 1SU8A 1FX1A 4BBAA 3OX2A 1YK1A 1COWA 2I54A 4LJYA 5HFNA 2ZM5A 5DWQA 3OM1A 4J3FA 2HSEA 4KVAA 3PITA 4GDMA 4AG6A 5K01A 2PSJA 4MVJG 2CBZA 4OATA 5ALXA 4FN4A 4ALNA 1RAFA 2C7BA 3BQNB 2GCOA 3CCBA 4RQAA 3U7HB 1CB7A 2BFDB 3VU0A 2OPBA 5TMBA 1K92A 1ZONA 3K16A 1E58A 3NFYA 3GRUA 5KC8A 5E95A 3CX8A 2DH6A 4LGCA 3BORA 4BGDA 2XDQA 5LOVA 3M49A 4OK6A 4AICA 4Z1MD 3R76A 2OXCA 4MWZA 4RA9A 2EKLA 3WS7A 3PG5A 4TZ0A 3EGWA 1TQ6A 3LX4A 3VHXB 4G1MB 4J1NA 3HO6A 4JELA 2VT6A 2JGJA 3RBAA 3GJ5A 3NHMA 5HQJA 3L8ZA 4HR7A 1NRKA 2OD7A 2P7HA 4FFMA 1NW7A 4LQ4A 2VTEA 3DWIA 2WD9A 5A7FA 4EZBA 5IVPA 1I80A 1WSRA 1XFAA 1O0CA 5JT1A 3CR8A 1TM2A 3FWZA 2BWJA 1L7DA 3DKPA 1NE2A 4NIMA 5C5EA 2ST1A 4MARA 1GYRA 2Q5JA 4DYHA 1SXGA 3GG2A 1U0LA 3M89A 3DZ8A 4UHHA 5JCJD 2RGGA 2GFQA 2I3ZA 3MJRA 3OE4A 4ZVRA 3W4IA 5JALA 4M1QA 1L4EA 1MO2A 1RJ9B 1U1GA 1U7WA 1ULTA 2RJ3A 3KEOA 5D1HA 3BMOB 5TQ0A 1UFKA 2PUAA 4KNVA 3KYCB 4M46A 4IV5A 1DUVG 2EGGA 4ZAZA 3DTVB 3GO4A 5BN3A 2RGDA 1SBHA 2RC5A 4X9XA 4IVPA 5KHAA 4DZZA 2JFGA 5JLAA 3VSBA 3C7TA 3EGEA 1K6MA 2PIDA 4G2NA 4HRXA 2YWDA 1VDZA 1Q0UA 2ID4A 2HIMA 2RJNA 3R7SA 1N2CE 3ZVLA 3BK2A 3UBTA 3GELA 5D87A 2OK8A 4P3YA 2R1UA 1WP9A 2SNIE 4G5XA 1E7RA 2PBZA 1ADGA 2JBAB 4HQFA 4PZAA 1B8OA 3CF4A 2P9YA 3RG2A 1GG8A 3L8YA 1Q1QA 3D0RA 3TNJA 1JDUA 1PEYA 1SCQA 3LUPA 5B7NA 3N8GA 3RIYA 2ZTNA 2PKRA 1NVBA 3HUFA 3LHDA 3OHMA 1MNQA 2ZWMA 4XUEA 4UE6A 3IQFA 2ACVA 4WXRA 4Z0NA 5KSWB 4H1VA 1Z0KA 1KJYA 1XR3A 2OENG 4K86A 3CIOA 3H42B 4MR7B 1LNZA 5LMZA 2O2IA 3NYIA 5TPZA 4MVJA 1KZLA 3W90A 5A5EA 3WBJA 2ZYTX 2Z8XA 3ZWCA 4COOA 1CP2A 1DMSA 3UM9A 4OI4A 1BJRE 1UC8A 1TMYA 2BMJA 5FT9A 1R74A 2ZSUA 3AMVA 3V00A 4EATA 4MUHA 3T3IA 1EX6A 5KHOC 3KK0A 3ZHZA 4CG2A 1G4UR 4RPDA 1NV9A 2RB5A 2KX7A 3GBVA 4DARA 3OWOA 4H15A 5TV2A 2V7QD 4MITA 5AOCA 3RTAA 2WT4A 5F4OA 3HKBA 2YUIA 4KSCA 1XLUA 4D8TA 4TM7A 4A8TA 1MZVA 5IMSA 1OU4A 1ZNYA 5K0CA 3VC7A 2GM4A 1DC7A 5BSMA 3ELUA 1II0A 2HJRA 4QOHA 4R7TA 3D5QA 5KQMA 2ZYUX 3B2QA 3R09A 4G5SA 3T3OA 1CS0A 2ZYSA 1WUJS 1QWOA 4QRIA 1BXGA 3G49A 2QN1A 4BQQA 3V7FA 1IY2A 4B8YA 3Q2OA 1ZRSA 1NUTA 2A30A 3AERB 4JJZA 3RC3A 3U7EB 3AM3A 4YQEA 1Z2OX 2PJRA 4UAJA 1R18A 3L1JA 4B4VA 1RWQA 4K0KB 3W1WA 1PAUA 4A0SA 3NWEA 4XB1A 3AJEA 2WW8A 6Q21A 1AUQA 7REQA 2XDAA 3PDIB 3TTSA 1UBTS 1PFWA 3JYNA 3QWFA 4FU0A 2IYSA 2F43A 1OIVA 1YZHA 5DYYA 4DBZA 5L6LB 3G9UA 5TB5A 2J0UA 4F86A 1QCYA 4NL4H 1BA3A 1HYHA 1OI2A 1UXJA 3IVMA 1OB0A 1JKIA 1KU0A 2HLHA 4RK5A 5A04A 5F4MA 4Q16A 4BQRA 5L4SA 1PQUA 3GA5A 1XRPA 3A2KA 5HJ2A 4UTOA 2GPNA 1QV9A 3SHQA 4DSZA 4W6ZA 3GMTA 2D5CA 3I9V6 1A9QA 3T53B 2CLOB 2JCYA 3NBMA 3QWHA 2FWMX 4H6PA 1K06A 5D3QA 2FRVA 4FZJA 5H3HA 4Q05A 1P5HA 1ORTA 3QVJA 4RIEA 4U7HA 3EFOA 4P35A 4Q03A 5E0OA 1PHPA 2CEKA 2RAFA 4LRWA 5NLLA 3T61A 4WKOA 5LMUB 4BY9E 2ZIVB 3OJ0A 4R31A 3KWMA 6PFKA 2XWSA 3NGMA 5DM60 5BUZA 2WAOA 4V0QA 2R2GA 3ER6A 1T5OA 2PBFA 2PKQP 1QS0B 2AW3A 1B1AA 3E70C 1SHUX 3I76A 1N2JA 3KOOA 2QN3A 3AR4A 1E1NA 1NI4B 3FAKA 5DEIA 3M6VA 5KEIA 3HKEA 3CW8X 4OQFA 2JLRA 1P0QA 3HVRA 3DXYA 5AVKA 2PSEA 2C5EA 3I83A 2PKXA 3LHIA 1SR8A 1QH1A 3DNPA 1CY0A 5ITWA 3H0KA 4XVHA 1CY2A 1GUFA 2PE3A 1NATA 4G8JA 1G3MA 1UZUA 1LSSA 2AOWA 4U00A 1V71A 3ID6C 2B8NA 1QHXA 4FJ0A 4I50A 4KJXA 1T4MA 2QAGC 4GBED 4WZBB 5LYJA 2CKMA 2IT1A 3NKFA 4ALKA 4BO0A 5LDHA 3ANMA 4ZP1A 2RI0A 4I3FA 4LZOA 3SZGA 2ODQA 1U3CA 3JX9A 4ESHA 2PSHA 1IY9A 5HKBA 2ORYA 3AONB 4XWGA 4DG8A 4I4TB 1A9YA 1VQLB 4RTMA 1DQSA 1KF0A 4NBTA 3MOSA 3ESAA 5AHOA 1E0DA 3NI2A 5F5LA 2D7JA 4MW1A 4YLYA 1DDGA 1XVIA 1PR6A 1YULA 2JRLA 1T5SA 2P9BA 2XZTA 2Y1KA 3LY9A 3UMBA 4DOMA 3MNFA 4LGMA 3MAJA 1CVIA 2GBGA 5FRDA 3X1YA 1OKKA 2EQ5A 2F3PA 5DFAA 1GSIA 3AUKA 1U2DA 3KSZO 4CMEA 3GQBB 3WHKA 4X1OA 2VVTA 3GFPA 4Q3AA 1VJGA 3WGMA 4ALLA 4CM4B 3SWWA 1T2VA 2L2QA 2I4NA 3KAQA 1E5QA 1BROA 4R8LA 4RULA 1KK0A 5THXA 3R0ZA 3A1VA 4FX5A 4PGHA 2RI1A 2OMEA 3T0IA 1XE3A 3VAAA 3VNVA 1XIVA 1KNQA 1CUXA 5ICMA 1FFEA 3TSZA 1DX6A 3M7IA 2ZL5A 2BGLA 3AIIA 3JQ9C 3CNHA 4WSOA 1VJRA 2M5SA 3J7AC 1SKQA 1Y7TA 2CYBA 2FEAA 3MWLA 4DSOA 1PFQA 3PA6A 2YRXA 4FGUA 3DCIA 3DONA 1QWSA 4A6EA 4B6GA 5KAPA 4KR0A 2IYEA 2R96A 4NCXA 4OP1A 3QEBZ 4UEJA 3BD7A 2POCA 4RKYA 4AJKA 3U3KA 1V95A 3HJNA 4MP6A 1K68A 4C6TB 3FUTA 1H1TA 4BLRA 4EKDA 4XR6A 4J4BA 4D8WA 4GXTA 1E2QA 4CU5A 3WWOA 3WAKA 4PANA 4Z8YA 2CNDA 3TE7A 2WZPP 1KXJA 4TKUA 4YRSA 1QQAA 2IYTA 2QUKA 1WCXA 4Y1EA 3O7MA 1C0KA 4U3JB 4DC0A 4EI2A 3Q72A 4MVJH 4GLLA 4HDQB 5F9MA 2Z2YA 4ZAXA 1FLAA 2QUIA 4B8WA 5HM6A 4MYHA 3T8YA 1DQNA 5JG7A 1RQXA 3H9EO 2VBFA 4LV8B 4FDVA 2ZB4A 2GAIA 1YOVB 2FPGB 3Q3GE 5BXYA 2Z5FA 3D8SA 3E5HA 3R20A 5KREA 3U16A 3CMEB 2NSLA 3U60B 4PR3A 2KJQA 4ER5A 1E6EA 1H6DA 1KO1A 1RABA 1FFDA 3THWA 3KZ1E 2DTXA 3DEFA 4JB2A 3W5DA 4Q1CA 1L7VC 2GETA 4GI7A 4JI5B 4H7DA 3ILSA 1LNSA 5TGTA 1K73D 1IVNA 1D5CA 9LDTA 2HREA 3VTKA 1Z2PX 4WWHA 3ZJTA 1IUNA 1PD1A 2FZVA 1RE0A 3KLPX 3N0VA 2IDJA 2QLMA 4EP1A 3QJ5A 3ZZ1A 5I01A 5HZMA 1EZ4A 4Y2QA 1NE7A 3OZVA 1RPJA 2MSEB 2X5JO 3EXAA 4GGMX 1KI7A 4MVWA 4JX8A 2H1RA 1QO9A 2WWYA 3LPLA 4TWAA 1USWA 3WBBA 4C76A 1E3WB 1P81A 2QTCA 4EOGA 3CU5A 3L7YA 1Q14A 1T9HA 1M34E 2FMTA 2XMDA 3F97A 1AF4A 3GRPA 3H0CA 2FQ1A 3QV2A 3VYSB 3X2EA 4YPOA 5L6MB 4HNHA 4KAJA 3GVIA 1IN6A 4G0YA 5KWEA 1Y6GA 3DQPA 2PLAA 2VNAA 4QHSA 4AXBA 5L4LA 3GUCA 5H83A 4LVUA 4YRLA 5LXTA 3W7BA 4ND7A 3T9AA 4X7CA 1BNCA 1Q0QA 1SBYA 2YYYA 4YI3A 2FLKA 2QM3A 5C1DA 1T2NA 4IH1A 3JZMA 2B4AA 3H11B 3AUFA 2ZBGA 1PT8A 2HIHA 2AN3A 4FKMA 3TRFA 4C3ZA 3E9DA 1RHUA 2B94A 1QNLA 3LSYA 5AR1A 2HH9A 3BIJA 1ML3A 3SC2B 2YQ4A 4GOJA 5FNVB 3TX2A 2HA7A 4FOPA 2EDAA 4D9IA 3GLSA 5ICCA 4WXHA 3FCSB 4UVGA 4GPBA 1VB5A 1L5ZA 3PGA1 5K0BA 1FJXA 5CB8A 1XC7A 3ABSB 4KO4S 2HJGA 5TARA 4B7XA 4CKXA 2G4LA 2JGNA 2O52A 2R7MA 1G8GA 4DDHA 4MO2A 2V65A 1KI3A 1G3IA 2HA6A 2W42A 1I5RA 4HXYA 4OQLA 4B85A 1E3SA 1PLJA 2QM8A 4P33A 2QX4A 3BIXA 4FP9A 1G21E 1GQYA 2Q0XA 1V25A 2RIRA 1G5TA 1D1PA 4P4TA 3VVBA 9LDBA 1WDWB 4QFDA 2JHGA 4E13A 1Z0FA 1SCAA 1B2LA 1DEHA 3P2YA 4FHZA 5GZ1A 2X85A 5LZ9A 1N9ZA 1RKXA 5EP4A 3ZDQA 3NB0A 3IGFA 5AVTA 1WXWA 3JR7A 4IDNA 4OOFA 4XYLA 1KY2A 2JCVA 4Y2GA 1HL3A 4XN3A 5L8VA 1DLIA 1G2PA 2DUWA 2ZTHA 5DHTA 4DLKA 2WU4A 1B7GO 5CX4A 1DXHA 2YVAA 4HNUA 1GOTA 2HPVA 4DLXA 1XTTA 1NMQA 3A6GA 4KQIA 3VNRA 4AULA 1Q2UA 4IW3B 1QHYA 4ZT6A 3SQOA 4BNDA 4ZEMA 3GLFA 3E7DA 5BRAA 5LNK1 4YLGA 1NZFA 1N6LA 1OHHD 1QTIA 5DGTA 2V1UA 1BX1A 2R11A 5AWFC 1SWWA 5AVYA 2EW1A 3BRWD 4PLHA 2P4HX 3DE4X 5IVHA 4IZOA 2BTOA 5CEJA 1PW7A 4ZVVA 3OP4A 4O0MA 1OTXA 4D81A 3I2FA 2ECQA 2Q3MA 4RF2A 3DVAB 2IV2X 3S28A 4YXFA 3T51B 3LQFA 3WDSA 4M0CA 3STVA 5HR5A 1W34A 1HTWA 1TKAA 1W4LA 4X63A 3R7LA 4DA0A 4MS4B 3QNUA 1I18A 3ODGA 3FYDA 3VVCA 1A1VA 2XH8A 1CZNA 5CBKA 1P5ZB 3DMPA 1IBKB 2ZU0C 3O8BA 5FPHA 3COVA 3EZXA 3TQCA 4AY2A 4QFCA 1EIWA 1R3UA 1NYQA 4LNAA 1TVMA 4IJKA 2IZ1A 4KR3A 1CNFA 3S81A 2QY9A 2XUGA 4CLRA 1T5IA 1Z36A 2ZU6A 3MSCA 3HVUA 1F12A 1YUNA 1P2FA 1CJUC 1MRSA 1YNOA 2ZWVA 4GECA 2D1YA 2UUOA 2W2LD 3LBAA 5CX1A 3ZDAA 1SRQA 4KAFA 3DL4A 4PZYA 4HE6A 4C7VA 4ZOAA 1V1MA 1F8XA 1VYUA 1XJQA 2ZOSA 2A9FA 4CLOB 1F8YA 1D6SA 3BBPA 2OHGA 2OV2A 5LP1A 3K8YA 4K1LA 5GADl 3KXLA 1QGOA 1V7ZA 1YDWA 2A35A 5U4QA 4DGSA 5G40A 1M34B 1ZN7A 1VFNA 2HHAA 3H9NA 1PUJA 3KT8A 1FW6A 2B9EA 3NU1A 3VHRA 3GLVA 1HPLA 3MFYA 3LLMA 5AW5A 4BKMA 1GPYA 4X62B 5LLSA 3UCEA 4BB0A 2QZJA 3UF0A 3SHFA 3OQVA 4CLDA 5K09A 1KEEA 1XPJA 5AW9A 1N1MA 1DIAA 4OXXA 3AHGA 1UPTA 3CM0A 4U9IS 1OX5A 1VIYA 1WG8A 2EKDA 3DTVD 5C9ZA 3ZVNA 1IN1A 1WW3A 4KPGA 1A04A 4IMPA 3TQQA 1TFRA 5L7TA 5D2CA 4EJSC 5TX7A 1NQOA 3AR6A 3ZE8A 4A8PA 4X8MA 2OGWA 2CXUA 1M75A 2JC3A 4R1MA 3BHMA 4KN5A 3OW7A 1SCNE 4E5NA 4ZHSA 5SZKB 3OE7A 4MDFA 5F76A 2UYYA 3VGJA 1QIGA 3DR5A 1Z18A 3LT1A 1A7KA 2HO5A 3WTBA 3QEMB 2VPIA 5IN4A 1C1HA 4I8XA 4RDIA 2YV3A 5AHRA 3ACDA 3T12A 2Z43A 4Z54A 1QMPA 2XXAB 2NU6A 3LNTA 1HZEA 1FNNA 5EJIA 2CLEB 4A03A 4I4LA 3DTYA 5L7WA 1XZFA 4LXUA 4W63A 3RRXA 2R8ZA 2AJTA 3AHIA 2XTZA 4HX9A 3RSZA 2M1ZA 3AEQA 3F3MA 4P98A 4XIIA 4D79A 6ADHA 4AKSA 2AWOA 2QIPA 3CLRC 4BPRA 3OY2A 2GEJA 5MFZA 2VAXA 2YJGA 4GPEA 1DPFA 1UK6A 2Q62A 1R0KA 4MEJA 4MPPA 5BSTA 5HM8A 4TXMA 4GX1A 3O8QA 4DJJA 3MYRA 1MP0A 1X7WB 3O21A 4JVOA 5ALZA 1U0FA 4OA5A 4YRPA 1PFYA 4ABYA 1LJ8A 3E4DA 3KPUA 3GFGA 3E1YE 3QSYA 2ONCA 3LVBA 4AMYA 2ZUBA 3WKBA 4CN9A 1VQPB 2PHZA 3AB8A 3PDJA 4MRVA 1VHWA 2QD1A 3AEKA 4FNOA 3TD9A 1YB4A 1GCGA 4MWBA 3TIGA 5BMVF 4R98A 2G9RA 2QRHA 3NMUF 3GJ7A 2XCIA 4LGYA 1WEHA 1P73A 3N74A 3AI1A 4ZQIA 4C2TA 4LZPA 4QREA 4EVQA 4JJKA 2XCRB 1J2RA 3AP3A 2C2KA 1RTTA 3B6KA 3MLAA 4M87A 1J99A 3IQIX 1MO3A 3J80A 1H4SA 1JVSA 1RRPA 3L8GA 1CQZA 3Q7SA 3WLPA 1Y4SA 2GKGA 3DAOA 3DOEA 4M9SA 4NZMA 4XFDA 1XAIA 1G8SA 1KXZA 1SQGA 1WUHS 2A86A 1FDOA 1NULA 2QUZA 2W0MA 3D8RA 1D2NA 3E8MA 4D9MA 3IEPA 3QEKA 4E2XA 2GRUA 3U5ZB 4RPLA 5P21A 4B6JA 2JFNA 2IE8A 1L5SA 1LRJA 1R6VA 4EBBA 2DXIA 4GF5A 1WTHD 1YOBA 1L1FA 1HT0A 2PL1A 2A7XA 1J21A 2C59A 3ES9A 2E55A 1DS6A 2VBUA 3G0IA 1QQ7A 4NMLA 1M67A 3IBFA 2PPLA 3K5IA 4PGGA 3U81A 4F9TA 1IULA 4EKYA 4HRVA 1TJYA 4F4JA 5E6RA 1TQDA 2R68A 1ZK3A 2QD5A 1OE0A 2J0EA 3ZD7A 2CFOA 4OJTA 1ST3A 2Z98A 2Q4DA 3OCWA 4ML3A 4PINA 2P27A 3LKZA 4GOXA 3JQ9A 4JEMA 5I8PA 5AVOA 1NXQA 3WWZA 2QIOA 4MKHA 5AKJA 4D0LB 3KBOA 5F3WB 4PC6A 5PGMA 4ZHQF 2BGUA 2BTQB 3N8NA 4E5UA 1EB9A 5LZ7A 3FD8A 4HFJA 2AE1A 4PXYA 4XR4A 2IEDA 1GZ6A 4E30A 2JBWA 4NBSA 2NPFA 2QUHA 3C8ZA 2Y6UA 4BO2A 1R66A 1DBWA 2G72A 2VPQA 3ORYA 2EHJA 4LNUB 3U1VA 3UN1A 1FJGB 2JI9A 1U94A 1B3RA 4UU8A 1QM5A 2Q1SA 5DGCA 4YLEA 1IH8A 1Z2EA 4EGAA 1TTPB 1XPUA 2F9FA 2P2SA 1U90A 4PYRA 4BKUA 1GCOA 4AZ3A 3OZRA 3CCCA 3U6KA 2OFXA 4KV9A 4NBUA 3UJ6A 5JFGA 3AKCA 1UFOA 4V24A 4ZU3A 4BS9A 1Z82A 1J20A 1H93A 3KCQA 4M9UA 3B1KA 2FI1A 2QROA 4XSGA 4HGPA 4HI0E 2CJPA 1FUUA 3MUNA 2B7LA 2O0LA 4IHJF 4L6AA 4HWPA 2CXSA 3R3HA 2IELA 2XUKA 4QDUA 2Z95A 3OVMA 3SYTA 1GPAA 4Z99A 3V76A 2AMFA 4L75A 1XTPA 3H9UA 3N07A 2BVNA 4LCEA 3TJMA 3ZLVA 4YCCA 4ZYUA 3PPXA 5KWSA 1BD4A 2DHEA 3BCHA 4FR5A 4HAZA 5BPFA 4LX8A 3FDZA 1NMSA 4TKVB 5J4YA 1VMKA 1AVTA 2CCJA 2DUMA 2ISSD 3ER8A 1UJ4A 4EYEA 4KWHA 4DA6A 5K51A 3RVMA 3JVUA 2OHVA 1E18A 3KTDA 4LMRA 4M36A 5K3BA 5JSYA 1MHTA 4JSYA 4TT8A 4XZ3A 5HUHA 1D1NA 1OI4A 1WBJB 3PUHA 4IGIA 2C4UA 1EJ2A 3E7WA 1A9RA 2MSWA 3H9JA 4DQKA 1T36B 3FNEA 3EPPA 4NG5A 2F9LA 2IGBA 2WLTA 2WJWA 3NEPX 2HBRA 4XLAA 4JD5A 5B37A 5IHXA 4KDFA 4KNWA 5KJEA 4BUJA 2FSPA 5IYRA 3MJTA 4PC1A 5ELXA 1YDMA 3AHCA 2ECKA 5AXDA 4PQFA 3EASA 1DZ3A 4TWJA 2I6FA 5D3MB 2Y27A 3TFWA 4QT4A 1UBNA 1JEEA 3D3KA 1G6KA 1U3FA 2FRDC 3FFBA 4NOMA 4W1PA 4Z9FA 3M3DA 2P3LA 4WT7A 3MF4A 1DEAA 4JKIA 2R5NA 1KGDA 4H35A 4TLBA 1JKXA 4BKQA 1U2RA 3ELBA 2WG0A 3M5WA 3PUWA 4C5CA 2OESA 1EMDA 5DN6A 4E0FA 1RKVA 1ZUD1 2XT6A 3C87A 4NMXB 4O2BF 4FXPA 2V7GA 4RMIA 5CXQA 1Z0AA 3HZOA 4AYTA 1DCTA 2J3KA 1TQHA 4BXOA 2WJ3A 1TEVA 2OQIA 3FB1A 1QLJA 4IDQA 3EXHC 3DE5X 3H9BA 1FRVA 5M3BA 3CZ4A 5FOVA 1YASA 5B36A 3RRMA 3KBBA 3S8YA 1US8A 2DHQA 2BFBB 4Q1EA 3FDFA 5TDHA 3E1KA 3IRUA 2VF4X 4GC9A 4OLFA 2B37A 1AZLA 3I9KA 3QFTA 2JRCA 1Z7YA 3ZCQA 2B3TA 4Z0TA 1PYOA 2KS6A 2VRNA 1DBVO 1LGYA 3X1ZA 3ZCSA 3G89A 3WL8A 2CDRA 1H3FA 3TM5A 2G5PA 3BILA 1J24A 3HCRA 4K6MA 5IKPA 5DGXA 1YF3A 2JGKA 3LIPA 2E49A 4YUYA 4R6WA 3V46A 1E8NA 2C3OA 3L4SO 4N6GA 1VSVA 5TEWA 1ZVKA 8LDHA 3HBJA 4FEGA 4H7PA 1UCFA 3WFIA 1W5BA 4C3UA 1VQNB 1T0JB 1XTRA 4BNZA 3A4IA 3IUSA 2V0GA 2ZR0A 3H3JA 4GIBA 1E20A 1QANA 2BLNA 3ZWXA 1AN0A 3MWGA 4O5AA 4NC9A 4IIHA 1WS6A 5K8LA 1JJIA 3IB6A 2I3DA 3QU2A 4PGMA 1WCWA 1NW6A 2F64A 3AXSA 1X1DA 1FCJA 3W8FA 3WRXA 3D2CA 4F3RA 3NHRA 2IS4A 3CV3A 2ZDQA 3O74A 2ATVA 4HZUA 1XZGA 1V5IA 1Z0JA 1OUMA 2WJJA 4O2RA 1UT8A 4YJFA 4ALJA 1TT5B 4B6OA 6YASA 1OAOA 4IJ6A 3M3PA 4MUEA 1E1CA 5LIPA 3OMLA 2RHLA 4L85A 5A6SB 1GG2A 4Q4HA 4ZV4A 2C1ZA 1ZD3A 3BC9A 3WZ2A 4BOYA 1WORA 3W7AA 2VH2A 5JU6A 4TTRA 3FKSD 1SUSA 2HQ1A 3KM0A 5K6RA 4LTDA 1JI0A 4XJXA 4A8JB 2HO4A 4Y9RA 4INAA 1AKWA 1CZRA 3S44A 3WJAA 2QLTA 1U3WA 1SH7A 1M2GA 5H5JA 2AG8A 2BY4A 5L3RA 2AVNA 3AV0B 3BCSA 1FJHA 3BD6A 1MXFA 3PFFA 4X7RA 1KTVA 4XI9A 2DBVO 4BVGA 2QJFA 3KB1A 3KR0A 4EO9A 3MMZA 4DVGA 3M6AA 4DCGA 2CNLA 4R8MA 1SXJC 4MJ7A 1YL6A 4HMQA 3MBIA 1H2EA 3ESRA 4EUKA 3NIBA 1UH5A 2VF7A 2E5FA 3SJCA 4PQYA 5DBEX 4JLSA 2EWVA 3U4DA 3T7AA 1DSSG 1IZYA 1C7JA 3U62A 2V7WA 2I6UA 5E1MA 2HNKA 1G5QA 1ABBA 2C97A 3T1OA 2CJWA 2E87A 4G9EA 4QU9A 1KL7A 5DYNA 1W85A 1Y8CA 3T5DA 1F0NA 3CFYA 2B98A 4I1UA 3ZTTA 2HZBA 3CJTA 4X90A 5DNUA 1MR3F 2P4EA 1Z4PX 3C1OA 1UFRA 4RTPA 2JGAA 3FUUA 2H16A 2MSKA 3QE9Y 4LXTA 4ZK6A 5GAJA 3RYIA 1KH2A 3FUXA 4LI0A 1XLTC 1DAEA 1PUXA 2O06A 4HGYA 5AKXA 4LVOA 3UY4A 2WYUA 2X5NA 3H5OA 5CTJA 2OBMA 3QYFA 4HJXA 2YY5A 4EAAA 4BO5A 1C3OA 2JEZA 5K20A 4LPKA 1VECA 2PT9A 1JT9A 4JUCA 4LRXA 2C77A 3TQTA 5BWMA 5EFZA 5CLFA 5A62A 5K8TA 3BCDA 3KOZA 3L77A 4M38A 4FUQA 5F7OA 1YJBA 2A0YA 4F4DA 3K0KA 1GSHA 2IEBA 1QGYA 3NWJA 4UBIA 4BQIA 5LR6A 2JPDA 1NYLA 4URYR 4NESA 4DHWA 1A9PA 4R9SA 3RARA 3IBTA 4EJSA 3A6PC 3F6BX 2XVYA 2PWYA 5GJVC 1ZN2A 2WU0A 3B7WA 1EP9A 4FJ1A 4MYCA 4NEHB 4PYOA 4XDGA 2BMFA 1X8KA 2CFTA 3QW4B 4OHMA 1TZJA 1IY8A 3LBYA 5EZYB 5E3HA 4YJHA 2QL7A 3R77A 2DYIA 3TW0A 3PT5A 4RTSA 1NVWQ 3P9QA 1PYDA 2Q6OA 5C8YF 5DISB 5HYVA 3G23A 5TSDA 3ZUPA 3EIQA 5CGQB 2D5IA 4HXFB 3I0NA 4NPCA 4Q66C 5DBFA 5G0UA 4DRXA 2AKEA 1HDCA 2ZK7A 4RACA 5FV7A 1DTWB 1E2BA 4KFTA 2AN5A 5CDFA 2B25A 1Y1PA 2I7DA 1Q7RA 5IYNA 5CCBA 4J0KA 4NMMA 4H3KB 3T4XA 2BEWB 5ADWA 5FEMA 2O48X 1U2SA 3W0LB 3V3TA 3WB2A 2H48A 1H2YA 2QTBA 3HXTA 4AIRA 3GD5A 1U9IC 3KVNA 2JIDA 3EF0A 5H4HA 3DYBA 4EJ2A 1AHPA 4KZKA 2WKQA 4UNNA 4PSDA 2YV2A 4D6PA 3LQ6A 2ZI6A 5EMJA 3IVAA 4OH1A 3ORQA 1AUXA 1V1RA 1QQBA 1TTQB 2PJUA 4QEKA 5JS2A 3UJDA 3ZWBA 2N75A 2ZB7A 3I09A 2BKEA 2GBIA 1JEQB 2EL9A 3R6KA 2MINB 3E2MA 1GL7A 3AVPA 4M9CA 2CV2A 1OLSA 1EUCA 3LUKA 3BE4A 1T2AA 4BFVA 2X4IA 3GOQA 3OPQA 2V3CC 3DJYA 3A6FA 4WBNA 4OXRA 3UWPA 2AEMA 1G0NA 5ERXA 4NJEB 3G9QA 3RAPR 3V2IA 5K0FA 1UZMA 2BHLA 3DOHA 3QF4A 1UD6A 1THMA 3GPBA 4W99A 4DMCA 1Z5WA 1T4GA 3JZDA 5KTTA 2DP4E 4P0TA 5ITZA 5MGBA 3B20A 3TJRA 3C48A 3SVLA 1Q7GA 4ZCTA 3HEMA 3CTMA 3PS9A 4Z8XA 4ZYVA 1L9XA 4OHOA 2C5LA 5LVAA 1EVKA 3NJ4A 1BDIA 1NWCA 1MEOA 2AE2A 3NC4A 1QPBA 4UC0A 3AI7A 3AUUA 4JP1A 3U7QB 1V8OA 3E5NA 2XNDA 4HP8A 4CM8A 3LRPA 3OCZA 2OECA 4NZPA 4NENA 3ZIDA 4PQEA 5FWDA 2A9OA 5CFPA 5AW4A 3MVEA 2WFLA 4RPBA 4W8HA 5JFOA 4BTVA 5DI3B 3GG9A 1IE3A 4IMIB 1I4LD 3AFHA 2IIBA 2WNHA 3OZAA 1G60A 3PIRA 4TSFA 2IQ5A 3X2FA 3IP3A 2H00A 3S1LA 4HSEA 4ZQCB 4M4SA 5E2BA 5J3JA 4D41A 2ZE7A 1CUJA 1SBZA 5KTKA 5FLEX 2ZJ6A 4Y6LA 2XA2A 3FYTA 1JALA 1BRTA 2QLNA 5C32A 4XQGA 4LE0A 4BMOB 4D80A 3IAM6 5ALWA 5F5NA 1PKVA 3OCXA 3R0XA 4BO8A 4CR6A 4G5QA 3PYMA 4E1VA 2C96A 5JC1A 5DM70 3U4QA 4GOKA 3PNKA 5A03A 1SVIA 3RU9A 4KFCA 2KI5A 4H6VA 3S6JA 3BUSA 3O92A 5DNEA 2KVOA 3K9FC 4WKPA 1QR2A 2PH3A 3LHSA 4OK3A 1S2OA 4Q3BA 3KEMA 3TIVA 1RYZA 4OUDA 3AWIA 1HT2E 4EG6A 4YCNA 1CJBA 1FC0A 2BEJA 1GKLA 1NDUA 4MQFB 3JQRA 1C3JA 1VHTA 4RF5A 3MJFA 2B1GA 4NMWA 1I8DA 3L4JA 2QXTA 1NF9A 2K4MA 2WIFA 3QE3A 4MRMA 5EMLA 4QOJA 2JLBA 4MH0R 1JHVA 2Q5HA 4CMJA 2WSSD 1QH8B 5IJWA 1WV0A 2W71A 3EQZA 1QIEA 3Q41A 2YWCA 2ZYGA 3N2IA 4ND5A 3MIIA 5IK2A 2P5SA 4AIIA 2H4YA 3BOSA 4Q9NA 3FOCA 3RU2A 4OEHA 4OIMA 2SKCA 1U3TA 1VHLA 5IANA 1VPEA 3I6YA 4FHFA 1R7RA 2W37A 3D0OA 2XMPA 5E0KB 5IJXA 4I14A 5L53A 4KGDA 4W4TA 3MTIA 1A9XB 1PL8A 3QITA 4ATNA 2JKYA 1NU8A 4JN6B 2FZLA 2I2BA 1SZDA 4GPIB 1GQRA 1N9KA 2J4CA 1N5MA 1G291 4MGHA 1I13A 3W9SA 4MMXB 1SU7A 3HWSA 2BZGA 3LRTA 5AJHA 1OA1A 1O08A 2QA5A 1GNVA 2AUNA 2HWUA 4E51A 3OTOB 1NC3A 4EYKA 3JU3A 4G56A 1P2SA 3WR5A 2DFNA 1J1IA 2BGRA 2GXSA 3BXXA 4JR2A 4WV3A 3SX4A 2OGZA 2BMAA 2CSUA 3A31A 2OMKA 3A9UA 5EXSA 3GEBA 2HYDA 3ZY6A 4BVLA 4D42A 1T3GA 2NVUB 4BX3A 4XIFA 1RWXA 4ILKA 1SHJA 4HBZA 3HRIA 4N9QA 1IPFA 1QIHA 1XJCA 4HRYA 4XRGA 2I66A 3K71B 5C51B 1GARA 1JQ5A 4MPJA 5AVSA 1VG0B 2BLLA 4HLDA 1UJNA 4IVQA 4XJTA 3P0HA 1O6ZA 4XX1A 3U0BA 2B5WA 3H17A 3SF8B 2FLVA 2GN9A 2XT0A 3B9PA 2MYNA 3JSXA 3OFVA 4YV1A 3SQWA 3R40A 2GN0A 3LF1A 4D4GA 4LXGA 1Q22A 4J7UA 4CGYA 3OOWA 4PONA 3VDRA 3TLGB 3BBLA 3EXHA 3A3PA 1UPUA 3N0WA 4IEEA 4BRZA 4MR9B 3GN2A 4RKWA 1A96A 4LCJA 4LZAA 3DZIA 2DLNA 2V5UA 2ZJ2A 3AL2A 3GRRA 3HCOA 1Q1NA 5E6SB 2ZWAA 1POXA 1DOHA 4I3GA 4A6XA 2N9UA 1LF5A 3P71T