4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
molecule keywords eIF5B
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
4ARZA 1S9DA 1QGYA 4YAFA 3VO2A 4MYCA 2FSGA 4RD1A 1QHNA 5BYJA 1VDZA 3NHBA 3H84A 4ZCMA 1JJ7A 2HLDD 2PMKA 3C16C 3TRFA 2H1LA 4OQNA 1SM4A 3U4QA 3AP1A 3ZGXA 4AURA 3FDIA 2A78A 1JALA 3TQCA 3KL4A 1QFJA 2FG5A 3RSLA 2MMCA 3LXRA 2VTKA 3P4XA 2O8CA 1R5NA 1W2HA 1W48A 4RSGA 1MH1A 4TT3A 1DS6A 2JIZD 4RFVA 1QF9A 3QVVA 4JLBA 5CK5A 5J5CA 3ECCA 3T1QA 5AUPB 3QKSA 4TL8A 2VQSA 1KQSB 1MRNA 4Q4HB 3CKLA 1GRNA 2IX3A 4ZV4A 3U4QB 5EXTA 1E2FA 3NIBA 2OK7A 1DG3A 2FV8A 2CVHA 2F1RA 2Q3MA 5EP1A 2WWYA 1W36C 3OW2B 2BSAA 3CCUB 2KI5A 1GZSA 3UATA 1XX6A 1AS2A 5E7MA 3IBGA 2QRNA 2GK6A 1BQEA 3G4SB 4WA7A 3MWYW 2IF0A 2FEMA 2P5TB 2O5VA 1U8AA 3T12A 1SULA 2ZRHA 1XNJA 1H8EA 4P0TA 2VO1A 3L0OA 4HLDA 5EE1A 1G3IA 4B71A 1ZD9A 1G5RA 4IOKA 5FOUA 3FMOB 2JLSA 1Y63A 5TMPA 3BD9A 4JSTA 3KX2A 1KI1A 4IVQA 4E07A 3B2EA 2VL7A 3TSOA 4QHTA 1KD1D 4EPWA 1EWYA 1CRQA 4BLSA 2L0XA 4FCTA 4DSNA 4Q1CA 2OESA 2IYYA 2WWFA 2ZTSA 1IOZA 1E96A 1DADA 1UKZA 1G3RA 2FSIA 2BPOA 2FGKA 4HAVA 3THXB 3TSWA 3JQQA 1G17A 1IXZA 4PXAA 1XPRA 3LBHA 3CWZA 2IL1A 2QP9X 1DPFA 1W1WA 3IO5A 2F1JA 5JSZA 4DB4A 3KUCA 2XSZD 3ZVMA 4KVGA 1ZRHA 2HXYA 2J1LA 3EAQA 1SXJA 3EIHA 1AK2A 5FUVA 2AD1A 4A6XA 4A2QA 3U44B 1KI9A 3JZAA 3L8YA 3Q9LA 2B6HA 1DAHA 1U90A 3NHAA 4FWTA 1RJ9B 2IEZA 3R8CA 2XJ4A 5CJPA 2VNHA 4D25A 2CCGA 1QFZA 1EFTA 2QDXA 1D2EA 4CEIB 1GAWA 5BQ5A 2BGIA 2REBA 4HE6A 1Z6GA 2BC9A 2P65A 4C4PA 2GBLA 3AVVA 2FOLA 3PQCA 5K8TA 2ZRNA 1OB5A 3DOFA 3VR6A 4B2IA 2YVUA 3LLUA 2GZDA 2QPOA 1KJYA 1Q3HA 1Z6XA 2YOGA 3ETLA 2W2XA 4B44A 4NE2A 4LX0A 3AKDA 4NCKA 3Q8XB 1A7JA 2V7QD 2DFLA 2JASA 3QPWA 1E0KA 2V1XA 4TTQA 3IPXA 1WE2A 4HDOB 2QMOA 2ZI3A 5EE9A 3VKGA 5DYIA 4X8HA 3FMIA 3CW2A 2JAQA 4GDFA 3CCVB 1R8SA 2BHRA 2IXGA 4A8JA 4P32A 3QXJA 3W6PA 2QZ4A 5HR5A 4B3DA 3LNCA 4MRVA 3C15C 4I99A 5EXSA 3GJ8A 3NBZC 3EZ2A 1J9ZA 3GJ4A 3Q85A 4OJQA 1KI2A 1Y3AA 1PUJA 1KK3A 1WQ1R 3ZIAA 2OFXA 1CJTC 3BORA 3H4MA 4JLOA 3V4RA 4N3GA 3CRMA 1GG2A 3BS4A 3KKOA 2F9LA 3WYFA 1BKDR 1B23P 5G53C 1W2GA 4HAWA 1AKYA 1RRGA 2WMNB 3A1TA 3W8NA 1E9EA 3K0EA 1E62A 2W0SA 1V5WA 1PVOA 3BK7A 3IIKA 2YZ2A 1E9CA 1XMVA 2AFHE 4AI6A 3EWAA 4QNRA 1AA9A 2ZR7A 5CIQA 3U60B 3CMEB 2EFHB 5JI3E 1AMOA 1F6BA 1NG1A 2PT5A 5EE0A 1YITB 4C0SA 2GWHA 1BH2A 4PANA 4DDTA 4JJZA 5HE9A 1ZIOA 2IUTA 3T61A 1T8UA 1T3LA 3CIOA 3ADCA 2WPDA 2JDIA 1W35A 3KTAA 5DH9A 3SZRA 3OZUA 1FUUA 2DBYA 1M7GA 1HQYE 1KDPA 2WIBA 4JBWA 3QE0A 1UEJA 2ATXA 3KDSE 1P61B 4M1WA 5FPKA 1X1SA 2CVFA 4HLUA 2DWPA 1P2TA 5GV7A 1R10A 2PT7A 1KIMA 1MR3F 3KFXA 2X8AA 2EW1A 4MKGA 1R0ZA 1P75A 1UBFA 1P4SA 1AS3A 3OEED 4OKSA 4TL7A 1MRSA 4B3CA 2BKEA 2VP0A 4BZXA 2KE5A 5EMNA 2YYZA 4LJ5A 1OFUX 4MRSA 4YLGA 5FBRB 3R9IA 1XXHA 2J5XA 3K0AB 4MQBA 3KKPA 4IOLA 4H1VA 3I56B 1ZINA 3RYTC 1TNDA 1DAKA 4RD0A 3F8TA 4KV9A 5EE3A 3W5HA 1H65A 2HCJB 2ZRBA 4YQFA 3AKYA 4URWR 1FOEB 2BWJA 1UBCA 5DO9A 1UBGA 1R0XA 4RJLA 4PQRA 5ANRB 2VHJA 1HQCA 4IDPA 2GBLC 2W6ID 2QM7A 2ZVQX 1QHXA 1X3SA 1KTVA 1T3SA 1W4CA 4RD4A 2C99A 5J4KA 1N5IA 5FUXA 1TVCA 1S4QA 1YR6A 2GF0A 3I55B 2HDNB 1M90D 4NCHA 4CT5A 3CD6B 3R9WA 2J46A 4UNRA 2IYZA 4BFSA 5EXXA 8OHMA 3QG5A 3QQ5A 1E99A 3TLXA 1DTSA 1L7VC 1XEXB 2G1JA 3UKDA 3EZ6A 3MJHA 2NO7A 4XD7D 1KHTA 1QHHA 3CC7B 4DEYA 3ZDQA 1QHSA 1CTQA 1IN5A 5AUQA 1JA0A 1KDRA 4J0QA 2VHUA 3VR2A 1NVVQ 5FR1A 3GJ5A 1VG8A 2VP4A 2XB4A 4DJTA 5L3SA 1XPUA 5CYOA 1ZIPA 3DHWC 2A2ZA 2VP6A 1CNFA 2XNDA 2D2EA 3RRMA 2ONJA 2ZSAA 3NWJA 1ZC3A 1NNEA 3A6PC 1HTWA 4I4LA 5IHPA 1GL6A 1XEFA 4M22A 2PZFA 4IOMA 2V3CC 4M9ZA 4DC9A 4F91B 5K8IA 4JLPA 1T4GA 5JCPA 5AR1A 1TEVA 3CX7A 4JVMA 3OFND 4G01B 4ZO4A 1VQ7B 1JXOA 2ZITA 1KMHB 1OH6A 4B74A 3ICEA 1ZD8A 3MSXA 4IEEA 1VG0B 2CXXA 1UFQA 3U7GA 3IEUA 4U7DA 1QGAA 2RB4A 4MKIA 1OV4A 1W46A 5FR2A 2PZEA 2IK8A 2KSQA 1DAEA 1ODFA 2ZE7A 3AF4A 4TLDA 3VU9B 4TT3D 4KLNA 2D4HA 2J0SA 2GCPA 1Q7YD 1CLUA 2F7SA 3I73A 1Q86D 2ZSFA 2CHQA 3THWB 4F4JA 4A6PA 2NPFA 1SXJB 4UXHA 2BVNA 4BZQA 5JBQA 4R2IA 1E2KA 3SHWA 2QQ0A 2RGBA 2FZ4A 4NL4H 4XTRA 2R6FA 4YHBA 4I1SA 2BJVA 4PTLA 1NVUQ 3CH4B 3SYLA 4P4TA 1F3OA 2OTJB 1GNRA 3OE7D 1ONBA 3NDBB 4KU4A 1N0UA 2I1QA 4C3ZA 5FTKA 2ERXA 3TE6A 4TQAA 2IXFA 1TQDA 3V76A 1RZ3A 2ORVA 4XWKA 1JA1A 1TLLA 4FMCF 1XP8A 1D6JA 1VHLA 3DDCA 1CEEA 4ARZB 1ZYUA 1E2HA 1FP7A 2IXEA 521PA 5JMTA 3JQPA 4Q9KA 5FPYA 1KI7A 2RAPA 5AJXA 3E20A 2P6UA 1VQ9B 1Z6TA 3CO5A 4FWIB 3MWKA 1ZM2A 2ZM5A 2VNKA 2H18A 3NVAA 2R62A 2VPPA 5KHOC 2QPTA 1FX0A 3RS4A 4DEXA 4DLSA 3AUXA 4HI0E 5L3VA 5HPYB 3Q7PA 3K8YA 4L4UA 2BMDA 2GJSA 4Q1DA 1NJGA 4Q4LA 3VKWA 1Z2AA 1TTTA 1Z83A 2PLRA 4EFMA 4EJSA 3ADKA 5KNDA 3KKQA 5KDLA 1G8HA 2IYSA 4MRPA 4A15A 3FMPB 3VR4A 1OHHA 5DE3A 5KSPA 4DKXA 4JLKA 4D80A 4A36A 3IHLA 2QM8A 2IWHA 4HB2A 4W5WA 4G5SA 1KAOA 1GP2A 2XSZA 1KJZA 1G7SA 4A82A 2FDCA 5EUMA 3O8RA 2CLSA 2CLDX 2ZUDA 1JQLB 1G8GA 4JT4A 4WAUA 4TMVA 4DT1A 1T0JB 2FFAA 1N6OA 2FGJA 3RAPR 4YDHB 1PJRA 5AWFC 2J0UA 5AN9A 4JLVA 2GVDC 2HXSA 2JLVA 4QG7A 4Y0VA 3FE2A 1JI0A 3B1WA 3W5UA 3QXCA 1A2KC 1CIPA 1XD2B 3QKTA 4D81A 4DCUA 1QG2A 4M1KA 3NEJA 2QI9C 2QEXB 1QG0A 1LS1A 3H2YA 4JZKA 4LJ4A 3GLFA 2Q9CA 1MKYA 4YAUA 1NI3A 1VPLA 3QXHA 3EPKA 4GP7A 2VZLA 3U61B 2XZLA 4ITRC 1QBKC 1SKQA 2YKGA 4JL5A 4N0EA 2PEYA 1NN5A 4LV8B 5B57C 1EFRD 2VEDA 4MKFA 4ZDWA 4B35A 4B6FA 1Z8FA 4A0GA 2JJ2D 4PQFA 3W90A 3SFVA 4LV5B 2BKUA 4M1YA 4KBGA 2PLFA 2R6DA 4WOPA 1P60A 3E2IA 2BMEA 4HUQA 3T34A 1EGAA 4ZIRA 3HYRA 4ZPXA 3I5XA 1FQJA 4KFUA 1XCGB 1JNYA 1SXJC 4RCZA 2IYLD 3RABA 4PPQA 3OEHA 3MFYA 1OPXA 1R5OA 3ES9A 4TL9A 5EUQB 3UXMA 2BM0A 1NJID 3C8UA 2W2VA 1EFHA 1QHYA 1OJLA 3F0TA 2VNIA 3MRSA 1XF9A 1NY5A 2ANCA 3B82A 1C9KA 2D3WA 1VTKA 2C9YA 1NVWQ 3K70C 1KSJA 1T91A 1NMZA 2O8BB 4UNPA 2HEIA 4MYTA 4V0ME 3A1WA 4LYHA 4AYXA 4BUJA 2OAP1 3QSYA 2BBTA 2I3BA 1XJ0A 2F43A 2JEOA 3UANA 3J81k 1WDTA 2Q9BA 2ZE6A 2D74A 4AF7A 2AX4A 4JVNA 4V02A 2NIPA 5KNCA 2ZQ5A 4B75A 4RD2A 4BLPA 4FIDA 2WMOB 1JECA 1YZKA 4RD6A 4XVRA 4CIDA 3EX7C 3C5HA 1QDEA 4ESVA 4DXAA 1T9HA 3FFAA 3BFXA 2P67A 4QGFA 5LB4A 1F2TB 3KFVA 1NVXQ 2EWVA 2QMUA 2GEDA 3CUEF 3L0IB 4ILEA 4XJXA 2EIXA 1KYIA 2CE2X 4I1OA 2B92A 3N70A 5EJEA 4ZGNB 1R4AA 3CRZA 1P2UA 1L4YA 4MGIR 2HF8A 2QT1A 2VYFA 3AKEA 3CB4A 2WM9B 1P5ZB 4ASUA 4CYMA 4FMBB 2CDNA 3BFVA 2QY9A 2Z4RA 1U81A 2CCKA 1FNNA 1VQNB 2JA1A 5L3RA 4EFNA 2P6RA 4CEJB 4AC9A 1E9FA 1UAAA 1OE0A 4LWZA 1JJVA 2R6CA 3VX3A 2RGCA 3D7MA 3U3RA 4Q7MB 2YOHA 1SGWA 3AVUA 3BH6A 4II7A 1UKEA 1EXMA 3IKJA 2R6HA 2WSSD 3U3KA 3W6OA 3I62A 1JR6A 3BXZA 1OSNA 2Y8EA 3U44A 4WZAE 3W5IA 1X1RA 2H16A 4C0JA 3N2IA 1A4RA 3PG5A 2J59A 2VP2A 3ASYA 5AUOB 3KQKA 2QRZA 2ZI5A 1JAHA 2YJTD 1GR1A 1K8AD 1G16A 3TK1A 1E3MA 3BGWA 5DISB 2OCYC 3AEZA 2WVJA 3FGNA 4RFSB 4TSFD 4KXFB 3TBKA 3PEWA 2WKPA 5JS8A 1KC8D 4NKRA 4JVSB 1A82A 1VQOB 4CZ2A 5KPJA 2C9OA 1J7KA 2PMDA 1ELOA 1CJVC 2WWWA 1GM5A 2Q9AA 4G3XA 1OKKA 1DARA 1EWQA 5G41A 4GSYA 1A5TA 3FOZA 3AVYA 2YHSA 1KMQA 4HAZA 4WQMA 1P3JA 3IDQA 1VQMB 5P21A 3GJ7A 4EAQA 2VHQA 5TY0A 1TU3A 2EYQA 3TUIC 3L2OB 4JVLA 4OQLA 3VX4A 2QMHA 2WHXA 2QN6A 3I8SA 3ONWA 2O8BA 4A8JB 2E1RA 3PUYA 2ZXUA 4JKYA 3UG7A 4BQSA 3P26A 1LY1A 2YC2C 2RH5A 3LVQE 5JWRA 2QTVB 3NH9A 2VF8A 2D7DA 4OK3A 3QFCA 4EDHA 3RANA 4XH9B 2D2FA 4LOAA 4W7SA 2FEOA 4D4MA 5CYPA 4M4SA 4W5JA 1MABB 4LCBA 1T8TA 4Q7LA 1FMJA 3S1AA 3CCJB 2OT3B 3JZMA 5EQTA 4PSKA 4WVFA 2CHGA 3K9GA 5LD2C 4UNNA 2QA4B 5BYKA 4X8OA 2VF7A 5EE5B 4A92A 1QH0A 3LLMA 3UWKA 2XEXA 1HV8A 4LHZA 2MMGA 4LGMA 2LKCA 3QVUA 5TARA 1ZCAA 4D0LB 1KY2A 3IGFA 1LV7A 3VHXA 5K8UA 2AXPA 1X8JA 1VQ8B 4EJSC 4PZLA 1E9DA 3W3AA 1R0YA 4LRWA 4DDVA 2ECKA 4DB2A 4OYHA 4QJ5A 4BFWA 1GWNA 1QVRA 3Q7QA 2DETA 2HV8A 2ZU0C 3GEEA 4UQOA 3OJWA 1I2MA 3K9HA 3OIVA 4EFLA 3W2IA 3T5DA 4HDCA 4L9WA 1WB9A 2UKDA 3REFA 1OFIA 3T35A 1KGDA 1IN6A 2ODBA 2O8FB 1P9WA 1FW6A 4DT1B 1JQJC 1GTVA 1E1QD 1OXVA 3RRZA 1BYIA 3C7KA 1XFAA 1RC8A 4C2TA 3CPEA 1PLJA 1KDTA 2C77A 1FPMA 2CBZA 1J2JA 3A36A 4MYHA 3AM1A 1OH8A 2X19A 4YMWA 3K9NA 5CLLA 1BX1A 4F7DA 3G82C 3CRW1 3CR8A 1YZLA 1KO7A 2ZJ2A 1W34A 4IHQA 4B47A 3PEVA 4NYJR 4PPFA 3CCSB 3CPJB 4Q03A 1M8PA 3T15A 3GLFE 1E2PA 4Y7CA 1XRJA 3SU8A 1XBTA 4JKIA 2ZANA 1NL3A 3IHWA 4RZXA 4LHYA 4DCVA 1HT2E 3KQNA 1IXRC 4QBHA 4BE7B 1QGZA 1ZM3A 2DR3A 2O0KA 4HAYA 4E09A 2IYTA 4LJ9A 4TL6A 3THOA 4B6EA 3DPUA 4PSAA 3WNBA 4I81A 4ZKDA 3B13B 2XXAA 3AGPA 3BWDD 3LWNA 2WWHA 3QXSA 4PSVA 1E2NA 5CITA 821PA 1NRJB 2SHKA 1FRQA 3P27A 4L16A 1EP1B 1Z08A 3GFOA 3PITA 4JBXA 4P6VF 4DCTA 1VCIA 1YZGA 2YWEA 5D3MA 5L3QA 1QUEA 4LYJA 1YHNA 2G9NA 1GFIA 4DVGA 3VTKA 3CX6A 4B3GA 4B32A 4EIWA 3CNOA 1UBEA 2YWHA 1H8ED 2OCPA 3HU1A 1G3UA 1EP3B 2H7VA 1W0KD 1XMJA 1XXHE 3HU2A 3M1IA 3QF4A 2Q6TA 3B5JA 1ZW6A 3X1XA 1ZAKA 4UJ5A 3GJXC 4CRWB 5AK0A 5SZIA 1BMFA 2AFIE 4CW7A 3FPKA 3C4JA 3ZZ0A 1NLYA 1PLKA 1CJUC 1D1NA 2XOKA 4O2LA 5FTJA 4JL6A 1E9RA 1F5NA 5DI3B 2XXAB 4HB0A 5KDOA 3VU9A 1NDHA 1ZNWA 3WNDA 2OILA 3B1YA 3NH6A 1YQTA 1M6NA 1SVKA 3GLHB 4OQXA 4QC2A 4M53A 3W2HA 3KXIA 3ZVRA 3RSOA 4F7WA 4TTPA 2BBWA 5GJBA 1U94A 2RCNA 2IUSA 4PZZA 2VNJA 5B58C 1Z0DA 3LX8A 3KQHA 5E95A 5H59A 4GRAA 2J0QA 1E9AA 3LO5A 5KSYA 2REXB 2VP9A 4D82A 1RRCA 2F3RA 2R44A 2ZJYA 1JBKA 1FP6A 3VR1A 3RNLA 4C7OA 2QP4A 2ZJ5A 5JHGB 2GAAA 1YHQB 1CF4A 2F3TA 5JRZA 3GP8A 3PIRA 2GXSA 3VNUA 1EG7A 2NG1A 2G88A 1P2SA 5H1YA 1XTKA 4BASA 4EPVA 4NHOA 2ZRGA 1E1RD 3IQXA 1HA3A 3BH0A 4IDOA 2KBFA 4IKEA 3K0SA 5E7IA 2OXCA 4KITB 2A5YB 1UEIA 2ZRPA 1GUAA 1YIJB 1KZ7B 1P62B 4JYCA 1NLFA 3A4NA 1S3SA 3CLVA 1HE1C 4S35A 5TB5A 4AKEA 3PJRA 1CJKC 3EZ9A 2Z0MA 3U3JA 4LYFA 2J7PD 3X1DA 1KZGB 1U9IC 1G3QA 2DWQA 3TVTA 1VYTA 1Z3IX 1XWIA 2C98A 3G5UA 5FFMA 1LF0A 2R8RA 3UIEA 1E94E 4FINA 4PQYA 2WKQA 1F2UB 1Z63A 2YOFA 4KO8A 5A5GA 2QU8A 3TVDA 2ZI6A 4DLRA 3RS2A 1GL7A 3TAUA 4DZZA 5J4HA 1DG1G 2WJYA 3NC1C 3FJOA 1EX6A 1JEEA 4CEJA 2AWOA 2XJ9A 5CDFA 4URUR 3HDTA 2X2FA 2NMVA 1SKYB 2AK2A 3PEUA 621PA 4W5HA 3UWOA 5KSWB 3AVTA 5TV2A 2CL7X 4A9AA 2W0MA 3NDPA 2FE4A 3BB4A 3PR1A 2I1VB 3OAAD 4E03A 1OXXK 1S8FA 1W5TA 2JCSA 2P2LA 2ODNA 1G7CA 4Q7JB 2GESA 2DFNA 3WRYC 1GO2A 1U8ZA 4C0HA 1OYYA 2JLZA 2HYDA 1KI3A 4A2WA 5AJVB 2FPLA 2V8OA 5TDHA 3NBYC 5DYGA 1KK0A 3B78A 1TQ2A 5GV8A 3GLGB 1N5LA 1Q22A 3RRYA 2ZREA 1CULC 2ZS8A 4FMDB 5HCNA 4QHYA 2CJWA 2NPIA 1AN0A 2I4IA 3DEFA 4RKFA 4OK5A 4TSFA 3E1SA 3W2EA 4Q4JA 1DELA 5BW8A 4O2RA 1US8A 1ZU5A 2AL7A 3NKVA 1N6NA 4Z51A 2WJJA 1ZVQA 4YAOA 3FKSD 5GVRA 5BN3A 2W6JD 4B48A 3EZFA 2F43B 2GPJA 2PCJA 2QAJA 2WJGA 2ZIAA 3KKNA 2HUPA 3Q3JB 4G1UC 4NYMQ 3QNUA 2CK3A 2J3EA 1AGPA 3AVQA 2FX3A 3FB4A 4OHYA 4Q47A 1VCOA 3LX5A 2HF9A 2VA8A 4BLTA 5B30A 4Y9UA 2ODEA 2VP5A 4PPNA 4RY2A 2ZS7A 2IYWA 5DSZA 2ZI7A 4EPTA 2GEUA 3I61A 1FFHA 3AV0B 4TLCA 2XNJA 2GILA 4D0GA 3CPWB 1UADA 2BEKA 2IS6A 1S9HA 3GJ0A 1Q3TA 2GETA 1GAJA 3OEHD 4PHTA 4PC6A 1L4UA 2XTNA 3HJNA 4JLDA 1VYVA 1IN4A 3PUZA 1BMFD 4R9UC 4MITA 3BE4A 4TQUS 3N2EA 2RC6A 2ZU6A 1I7PA 4WBSA 4MDEA 1OYWA 4TMWA 3FHTA 4PO8A 3UG6A 2F1HA 1WCV1 4NYJQ 2B5OA 4ZCLA 1DO2A 2H8KA 2OFOA 2R6AA 4NYIR 4EKDA 1JXMA 3V4FA 3THYB 2Q0HA 2GZHA 1IQPA 3M6AA 3F3YA 4N1AA 4QXAA 4I1UA 3ZS9A 5C2JB 1ZNZA 2CL0X 4Q9LA 1N6KA 5EZ5A 1RYFA 3VMFA 3F5FA 3I4LA 4LUCA 4QJ3A 3B1ZA 1A2BA 2OAQ1 3MG9A 3CXCB 4URYR 2EVWX 4Q4HA 2V1UA 4V0KA 2J0UB 4D4JA 1HUQA 4MRNA 5FPHA 4BZPA 2RGEA 1LNZA 2CMKA 2IYQA 4DLWA 3SQWA 1ZCBA 3L8ZA 4DLVA 1GDDA 3H0KA 5G3ZA 4DBLC 3I3SR 1TQ4A 3W5VA 3LBIA 5C1BA 3GLFB 1XTQA 3HR7A 1E9BA 1COWD 1TAGA 4DHEA 3THWA 1RJ9A 3MUFA 1G8PA 1Q12A 1YU9A 3BB3A 3OAAA 2E9SA 4ZGQB 2PIAA 1E32A 2A30A 2A5FA 4G5OA 5K8LA 2GVZC 4C0AC 1QX4A 3GEIA 1VIAA 4D0NA 4AYTA 3FMFA 2OUKA 2F9MA 2OV2A 4POAA 1CKEA 2DY1A 2HLDA 2FWRA 1N8RD 4DQLA 1P73A 4NDZA 5FPTA 1XU4A 2FFQA 3QPUA 4HZUB 4KFSA 4PO1A 4U02A 4TYNA 4DLZA 1FNCA 3VAAA 2YWGA 1KK1A 1T0HB 3G0HA 5IDVA 2ATVA 5BXQC 3W2FA 1XMIA 5DGXA 1DVRA 5JJKA 5BN5A 5KSOA 3MGCA 4IOJA 3SJZA 1OFHA 2FZLA 3PUVA 4YMTA 2OO7A 1XE1A 3BH7A 1KO4A 2FF7A 2Q3HA 2GK7A 3DKPA 1IXSB 4F92B 5JJLA 2OBNA 3D31A 4M9SA 4B76A 4IXMA 4Q9IA 2KWIA 4DCSA 3LV8A 2QORA 3EPLA 3LH5A 1Z0FA 1WP9A 1D2NA 1AQYA 4KBFA 2QGZA 1S1CA 2IYVA 1U0JA 1TMKA 5FOXA 2A3RA 1NN3A 4KYUA 3TW4A 1K6MA 3X1YA 4B33A 5JZVA 4Q21A 3U2QA 3T06B 3GLHE 2G3YA 1NMXA 4PHGA 3SJCA 3DMNA 2IA5A 3QEJA 5CDFE 4BFZA 2ZJBA 1KO5A 1VKJA 4XTCS 2G77B 3WMGA 5F2EA 3QG1A 2FFBA 2EWWA 1E98A 4RZ3A 3W8RA 3VHLB 3K0CA 2WV9A 2WICA 1XZPA 3EZ7A 1S1MA 1N6LA 2J87A 4XD7A 3V00A 1C4OA 1YI2B 2RC5A 1LFDB 2FFHA 4Q9JA 3LA6A 4DDWA 3LY5A 4LJAA 2OE2A 2BMFA 2RHMA 2OK8A 3GMTA 4CT4B 1IN7A 1QG4A 4TLBA 2C04A 2HJVA 4HATA 1XXHB 4R98A 3P32A 4G5GA 4LJ6A 1YRBA 3QEOA 3ZBTA 2G0NA 2IS4A 3THYA 1B0UA 1KNXA 2NO1A 3OIWA 1ZP6A 2J45A 3BOSA 2RGAA 3QPVA 4MGYR 4G5QA 1OIXA 3A1UA 3KTAB 1CP2A 2NO6A 2ZYUX 3FKSA 4HAXA 4L8GA 3ZD6A 2YINC 2ZYTX 4OI2A 4MYUA 1NVVR 2WAYA 1X6VA 2IWRA 4DCNA 4B43A 3G6EB 1WF3A 4FK8A 1E2EA 2ZETA 1QHHB 2BJWA 1K5GA 5D3QA 3EPJA 4BFYA 1VQPB 5FBWB 2GXQA 4XOIA 2GJ8A 1G64A 2DFKB 2MSDB 4KVAA 2OCAA 2Q3FA 4R2HA 3QFSA 1N0WA 1PZNA 1SKYE 4UNQA 5EP4A 3L43A 1IBRA 1QHGA 2P6NA 3AVPA 3D8BA 4N0DA 3VKHA 1QRAA 4JLJA 5FOWA 2O8FA 1SHKA 4Q00A 4US2R 1T3HA 1TL7C 1W49A 3VQTA 3W3ZB 1QVGB 1EFUA 5KPDA 3WYAA 2UZIR 2G83A 2V55B 1G21E 2Z6VA 1XD8A 4P4UA 1KO8A 2VLIA 3SHFA 1KOFA 5FBQB 2OFWA 1YR7A 2N46A 3OE7A 1J8YF 1G9XA 2DFTA 2C78A 1FRNA 2ZSEA 2H5EA 3ND9A 4ACAA 2V7QA 4O0MA 5EZ6B 5JCZA 3KQLA 1TEXA 2IBMA 4R7ZA 5SZJA 5FOSA 2WBLC 3BAFA 4D2IA 5FBVB 5HTKA 2JLRA 2PX0A 1ZC4A 2EYUA 4MRRA 1S2MA 1CBUA 3L0SA 4LSGA 2PH1A 5IF9A 2IC5A 3MAAC 1OXUA 3I32A 4QJ4A 3EA0A 2WAXA 4TWZA 1HYQA 5KUTA 1U99A 4LPSA 5JWHA 2QSYA 2ZAMA 2JDID 1E2IA 2VSFA 5DHFA 1ZM4A 1NY6A 4YXWD 5BN4A 2BGJA 3QI2A 4Q01A 4H1UA 5FA6A 3Q5EA 2RGDA 4A0RA 4B2PA 2G0TA 2BM1A 5DNYB 1XPOA 1EESA 1W44A 2RMKA 2GTPA 4UAJA 3QKUA 3RS7A 3KZ1E 1W0KA 4B3BA 4PC7A 2JJ8A 4P3YA 5DN6D 5FI1B 4QHSA 2QTHA 3T1TA 1HEIA 1KSGA 1E63A 2W2TA 3CZPA 1GVHA 3JQRA 1GKUB 2CNWA 2IF2A 2WWXA 3R9XA 4BFVA 2XZPA 4DLXA 4NZYA 2QTZA 4Y0AA 3WP0A 4Q1AA 2Z5FA 5B64A 4V0MA 1VCMA 1GNPA 4ZDIA 5GJVC 4NPHA 4EPRA 1R6BX 2CLCX 2P0EA 3AF0A 3TUJC 2GCNA 2EFCB 2JLXA 1T6NA 1Q82D 1AM4D 4OHVA 1NIJA 1AJEA 4M9XA 5KOYA 5J40A 1XCMA 3K70D 2B21A 5FUWA 1OH5A 4LBVA 2D06A 4Q5IA 4OQMA 3RHFA 1LB1B 3OEEA 1ETUA 1WRBA 2XOKD 3AP3A 4OHWA 1OXTA 1OXSC 4EPYA 4B3XA 721PA 1TQ6A 4DSUA 4GMXA 4KJZA 3CX8A 121PA 2GHIA 3OZXA 3ZLJA 1II8B 1ZNXA 3CRVA 4HB3A 4H9GA 2A5GA 3B9QA 1S0UA 1U98A 1D9ZA 4GOJA 2B7CA 1W7AA 4GZMA 1AZTA 1YJWB 2WSMA 2C03A 3FYHA 1QUFA 1YZUA 2R9VA 1LW7A 4QBGB 3WMEA 4IRUB 4MUAA 3SYKA 2QE7D 4Q18A 2ZSDA 2VSOA 1BYUA 4Y9RA 3B1XA 1DAFA 4JLAA 5TVKA 3AVXA 2WKRA 4HEJA 2QQEA 4AKIA 1UKVY 1VQ4B 4FD2A 2FSFA 5F9FA 3ZVNA 1KNQA 2C96A 2ZJAA 2D7CA 1J70A 3GLHA 4PFSA 2V6IA 3IPYA 5TR9A 4P31A 4HZIA 1FUKA 3JVVA 1H85A 4ZCIA 3SFZA 1VQLB 3A37A 4AF6A 3K09A 2VHCA 3RRNA 5G40A 3QXXA 3A1VA 4IXNA 4YMVA 2PCLA 2QGNA 4NTZA 3U3OA 1E0JA 1YZQA 4AG6A 3TNFA 4TYWA 2WWIA 1KRHA 5SZHB 2RHDA 2YNMA 1FTNA 3TR5A 3TR0A 2VSXA 4JYBA 1YZNA 3NEYA 4AG5A 5E7JA 1KDOA 2JLYA 4LC0A 3R7WB 2PBRA 4IEIA 1TF5A 1NIPA 1BJKA 1KK2A 3RDPA 1T5IA 2O8DA 3OF5A 1E9SA 1KI8A 2WJVA 2O0JA 1OF1A 1XTRA 2XNCA 1U0HC 1W4AA 1W4BA 2FN4A 3NXSA 5L3QB 1QZXA 1OT3A 2EU8A 4M21A 3SDZA 1C1YA 1PLLA 3O8CA 2H57A 5A4JA 2ZR0A 3KJGA 1P2VA 1TUIA 4TYQA 3KUDA 4YXWA 1ZM7A 5DHAA 5H8WA 4BRWA 4LBWA 1I4TD 2JIZA 1FNMA 4RCYA 2B8TA 1Z0IA 4NH0A 4D4LA 1YZTA 4I1VA 4KCGA 2IEYA 4TQ9A 3BRWD 4Q7KA 3OESA 4M1MA 1XZQA 4B4DA 2C9CA 1Q20A 5UKDA 1LS6A 3KXLA 2WOOA 1ZUNB 2W83A 1B2RA 4JJKA 1XTSA 3QIAA 3AKCA 4V0LA 4HSEA 4M1OA 2BF4A 4X8LA 5F98A 2JJ1A 1WBDA 2YV5A 4HZUA 4WZ6A 3NBXX 3AVOA 2C95A 3W5JA 4Q19A 4DIDA 1VECA 2OCBA 3SYNA 5CB6A 4CGZA 1K73D 2IYRA 2O8EB 4GPTA 3OIYA 2ZRAA 1D8TA 4B73A 1GVNB 1Z5ZA 3ADDA 1RKBA 3PV0A 5KTYA 4GFDA 2IHBA 3K70B 5JEEA 3VR5A 4CEIA 3VR3A 1UJ2A 1XTJA 3ADBA 4R71A 2V9PA 2BDTA 1JR3E 2LKDA 1XD9A 2GA8A 3QKSB 3K53A 2JJ1D 1M2OB 2QMEA 3SBDA 1TU4A 3P4YA 1CR0A 3IIMA 5JEDA 3JVUA 3CCRB 3UK6A 4BLRA 5FTNA 3OJXA 4BGDA 4URZR 1EP2B 3HYTA 1QVAA 2VBCA 3THXA 1U8YA 2LWIA 3LRPA 2W6JA 2OM2A 4QM7A 2XGJA 1EK0A 2GCOB 4DUGD 1CR1A 4RZUA 1ZM9A 1K8RA 3CR7A 1DAIA 3QFRA 1G7RA 421PA 3GLGE 5HXBA 2ASEA 2CEAA 2ZAOA 4MGZR 4BFXA 2E87A 3LQRA 2XNSA 1M7BA 1HT1E 3QF7A 2DB3A 3E70C 2IYUA 4MGKR 3E5HA 4K8OA 5L8VA 2HJGA 4HLQB 4QGAA 1YR9A 2GEVA 3ASZA 4MUBA 4A0HA 2QUZA 4GP6A 2O52A 1SVWA 4C0QC 3KJIA 2RGXA 3DOEA 5C4GB 3BIFA 4CEHA 4ESHA 3WBKA 4EH1A 3HR8A 2EFGA 3M4YA 2DERA 3WYGA 5IT5A 1AS0A 1NN0A 3EWSA 5G3YA 2IS2A 1XDBA 3CF2A 1X86B 5DIFA 1E4VA 4DUGA 2F6RA 4LJ7A 1OFTA 2RGNC 3QFTA 3T1OA 5HKKA 4IDNA 4YDSA 1FMLA 2N42A 5AJZA 4V0NA 1XMSA 3PFIA 1SVMA 5IK2A 3X1ZA 2FPKA 4LPKA 3SS8A 3W9YA 4PHFA 3REGA 2MSCB 1OGIA 1RYHA 2QT0A 2ZE8A 4IVPA 1GJRA 1GILA 2O8DB 3DKVA 2ZRCA 1NF3A 1R7RA 3ZH9B 3PXGA 3K9LA 3LAWA 4IDQA 1JB9A 3PCRB 4MDFA 4BECA 3CMAB 1VIYA 4V03A 1COWA 2AD5A 3EC1A 2ORWA 4DLUA 3BB1A 3GJ3A 3TAHA 2Z4SA 2A5DA 3A8TA 3DM9B 4KI0A 1U2RA 4LYAA 1ESNA 5J4VA 3WRXC 2JLUA 1W0JA 4BPBA 2V6JA 2KBEA 1E79D 1H8HD 2JLQA 4Q1FA 1DAMA 1E0SA 3K09C 4GI7A 3C14C 2QPAA 3V9PA 4DLYA 1NBME 3PVSA 5CK4A 1KSHA 4RVCA 3MWJA 1Z22A 5J4LA 5LB2A 2NO9A 3LQQA 2ZRLA 2DEUA 4Q1BA 4YMSA 5JHHB 1G5PA 2HT6A 2QG6A 2QL6A 4LBYA 3CNLA 4Q4AB 2BMJA 1DAGA 4KODA 4JBYA 1IJEA 1IN8A 2W00A 5FTMA 2GF9A 3I8XA 2WIAA 4Z8XA 4L5BA 1WMSA 1D5CA 2QSZA 2QA5A 3EARA 5KDDA 4NYMR 5JECA 4IW3B 1OH7A 3B1VA 1Z6AA 5JJIA 1II8A 4M9QA 2QNRA 3RVBA 2UZ3A 5CM8B 1Z29A 1YKSA 1R0WA 1IY1A 1UKYA 2ZI4A 3SN6A 5M04A 1L8QA 1GRQA 1D9XA 4ZI2A 2ORIA 3DVLA 4WXRA 1UDXA 1KKMA 1P6XA 3N5CA 3UPUA 1F60A 2OZEA 1LF5A 1ESMA 1MOZA 1RIFA 3TMKA 3BJIC 3TJZA 1BS1A 1XEWX 4DSOA 1F2UA 4ASUD 2H92A 4PR0A 1OGJA 2X3UA 1BIFA 4LHXA 1E2DA 3HU3A 1N25A 2OLJA 2TMKA 4HUTA 2QAGB 4LV6A 1Q1BA 4BEBA 3K1JA 2P3SA 3OIUA 4TZ0A 1ANKA 1TF2A 2GRJA 1E4YA 1GIAA 1LTQA 3D6TB 3AP2A 4A2PA 1OHHD 1M1YE 4A1FA 4ZI3A 1N3BA 3OFNA 4Q66C 5FUYA 6Q21A 1E0AA 3KJEA 2IHYA 1IM2A 3TH5A 4BFUA 1W36B 3U5ZB 2AKYA 2AKAB 4L15A 1GKYA 2CK3D 4Q4JB 1BOFA 3WP1B 5AJWA 2RGNA 1NKTA 3EC2A 4BLOA 3IO3A 2ZSBA 4GT1A 2CCJA 2CJWB 3B85A 3R7WA 3IQWA 4AYWA 4U9UA 1KI6A 1NLZA 4NONA 3IILA 3CF6R 1CXZA 4Q9HA 3LO8A 1FDRA 2NZJA 3H1TA 1RE0A 2QTFA 1W47A 5DI9A 5IRCD 2ZJOA 4TMXA 1M34E 2OBLA 5DLQC 1O87A 4HYYA 4QFMA 1W87A 2GNOA 4F93B 5FH9A 3C41J 3DO6A 4OQFA 3HWSA 3RLFA 4IJMA 2CRVA 3PENA 1R8QA 3K0AA 4Z1MD 1G8YA 2X2EA 4Z8YA 1DO0A 4C0LA 3U7FB 2R2AA 2ERYA 3RC8A 4LJYA 2CE7A 4WZBE 1DE0A 1N5KA 3BFKA 3U7EB 1RVDA 1GL9B 2DHRA 1E1RA 4P4SA 2QENA 3X1WA 1TADA 3CC2B 3DMDA 5GADl 1G41A 4US1R 5HZKA 4TLAA 1NBMA 4OI4A 2AHOA 3VFDA 1FZQA 3GLIA 3CPHA 4LBZA 1E2JA 4QNMA 2ZRDA 4PAOA 3K0FB 4S2EA 1KKLA 4BWYA 4M0LA 3L0PA 5EP3A 4L9SA 4DDUA 4P4SB 1N6IA 4TMTA 2NQ2C 3BBPA 2VHTA 3H86A 4UNSA 3QOFA 3TGPA 2J0VA 2X1VA 4D4KA 3CCMB 4F38A 1GRRA 1NSTA 1MV5A 3DZ8A 4C0KA 5E3HA 2C8VA 3ND8A 1AKEA 2ZPTX 1VMAA 4KAXA 2IW3A 2XZOA 4A8JC 3MHPA 2ZRFA 1TPZA 1VG1A 1ZNYA 2AK3A 3DM5A 1YJNB 2EFEB 1KAGA 3B7GA 1O3YA 4UKDA 1W0JD 4D6PA 3AF3A 2HYIC 3PUWA 2GDJA 3DL0A 2V54A 3CONA 2Z43A 3I5YA 2WZQA 3SI7A 1Q1ZA 2YWFA 3ZC3A 1M7HA 4OI1A 2XAUA 4ERNA 3K0CC 3CCEB 4QKQA 1SVOA 2QBYB 4Q02A 2X77A 1WXQA 2PJZA 2C5LA 3HPRA 3MWLA 1G18A 4FI3C 1BX0A 2F55A 4M2LA 2OEPA 1N0VC 2QTLA 1FX0B 1GITA 4PAMA 2DPXA 4QGGA 4PPGA 3GLGA 4OBEA 4CEHB 4O25A 4HB4A 3A1SA 4LY6A 1AGRA 3IEVA 5GJCA 4YMUA 4TYPA 3CH5A 1NJFA 3LW7A 2NGRA 1E2LA 3FHOA 3P1JA 2J41A 2XTMA 3ZYCA 1HURA 1N2CE 3WY9A 4TYYA 3FTQA 4C2UA 2J7PA 1IY0A 1K5DA 3GFPA 3LVRE 3QKRB 3SJBA 1UF9A 3OHMA 2KJQA 4MA4A 2FPMA 5A0FA 5FL3A 3U6KA 1G4AE 1Q21A 3QBVA 1VYUA 3RS5A 4OI0A 4PC1A 3ZBUA 4ABYA 1SXJD 2GZAA 4MH0R 2GCOA 3WXMA 4BLQA 1UMKA 2ZVPX 4QM6A 1IY2A 3UMFA 4PX9A 5FOTA 5CB8A 4ON9A 5DN6A 1VQ6B 4FCWA 4M8NE 3TKLA 2ZEJA 4JLMA 5DI3A 1XCPA 1E2MA 3WBJA 4G1BA 1G4UR 3ZD7A 3TIFA 1MO6A 2CHVA 4U5XA 1Z28A 2NO0A 2A7QA 1UPTA 4XVUA 1FQKA 2ZRJA 4WIAA 1P9RA 2ODWA 4FCVA 3SC3A 1EFRA 3W34A 1SZPA 1Z2CA 1ZU4A 3GLIE 2FA9A 2J7KA 2IT1A 4JL8A 2BCJQ 3GPLA 1A1VA 3OZWA 2B8WA 2P5SA 2JGNA 2QROA 1J8MF 4WW0A 1KJWA 1FL9A 3C5CA 5C4MA 1SHZA 2GXUA 5BWMA 2O8EA 1JR3A 2REOA 1J99A 3S1AB 3CRRA 2ZYVX 4ZKEA 1RW4A 2BN4A 4C7OB 4QOSA 1IONA 1G8FA 1TF7A 2HMAA 2A9KA 5AJYA 1S72B 1NP6A 4EJSB 1II0A 3O8BA 4EQ6A 1I4LD 3KB2A 2OTLB 2VIIA 2VRWA 4K1XA 3A58B 2BIFA 4NMMA 4IFBA 2OBMA 4K46A 3QE2A 2YC4C 4GZLA 2BEJA 5FTLA 4XWAA 2J9RA 2O0HA 1AZSC 4FW9A 1SXJE 4G1VA 2BBSA 4NCNA 4C9BA 4Z54A 1SVLA 2K5UA 4W9MC 4ZDJA 1CRPA 1VQKB 2OLKA 5JLJA 3FPAA 3EXAA 1Q81D 5SZKB 2FSHA 1AQUA 4EPXA 5HKKD 3DZDA 1L2TA 1XEXA 3QBTA 3RC3A 1SQ5A 1JR3D 3L82B 2CL6X 1S3GA 2XNDD 3LXXA 2VH5R 3A4MA 3EPHA 2LCFA 4PAQA 3AH8A 4O3MA 3SJAA 1G20E 2JLWA 5KNBA 1HE8B 5AUNB 2OHFA 1I4DD 5GVSA 1P9NA 4C43A 1LVGA 1Z6YA 2RKOA 3QF4B 3ZVLA 2R65A 2XTZA 1VCNA 3SR0A 2O8CB 5H68A 5FI0B 4OJKA 4PZYA 3Q5DA 3TSZA 4RD3A 2VYQA 2FU5C 3LDAA 3AF2A 5D3MB 1KI4A 1G19A 5J47A 3CWQA 1ZJ6A 3NC0C 1CS4C 1G3MA 1TUEA 5HZHA 1UDWA 3D3QA 2ZRKA 3R20A 3U7HB 1WBBA 3QKRA 1CNEA 4HLUC 2PEZA 4D26A 1Q1QA 1I2DA 3KQUA 3GQBA 1EWRA 3ZZTA 1EX7A 2BOVA 3MCAA 2RGGA 2V4ZA 3QENA 4LDJA 2IUUA 3X2SA 5ELXA 3E1YE 1AIPA 5FPSA 5CIWA 4JT2A 4AD8A 4QGHA 5F3WB 3KXKA 2XITA 1R5BA 2ZR9A 4AKHA 2PJRA 3M0EA 4OHXA 2XX3A 3AF1A 2KB0A 3O47A 4KFRA 3R8FA 4KFTA 5JI2E 4HAUA 5THXA 3CRQA 5KO2A 4GNKA 2A5JA 4TLEA 5B2ZA 2DWOA 4B34A 1GAQA 3W6NA 3ZIAD 4JLNA 3BERA 1CR2A 3CF0A 3LW8A 2CNWD 4PHHA 1U9IA 1VQ5B 1KO1A 2IS1A 1MO5A 1W5SA 4PC3A 2ONKA 3SQXA 2JJ2A 1G1MA 1GSIA 2B7BA 2W58A 3GD7A 5CM9C 3WHLA 4TN1A 1N6HA 1F2TA 3I72A 3LD9A 1EFCA 2Q21A 2OSBA 1GOTA 2WPDD 1OW3B 4C0BA 4GOXA 1E6CA 2QE7A 1Q0UA 5L3SB 4YALA 1BO6A 3FWYA 3HP1A 1RFLA 2BCGY 5LD2B 1IHUA 4DRZA 3U6BA 3B60A 4GL2A 4KSBA 1RRPA 1DBSA 3KJHA 2FMXA 4GOKA 2AXNA 1US8B 1Z0JA 4NYIQ 5JS7A 5H70A 3GCGA 1E69A 1JEDA 1GKIA 1NSFA 3FKQA 2GAOA 5FOVA 2WOJA 4X8MA 3SNHA 3LBNA 5CLQA 4K81B 4CF7A 4WXPA 4AK9A 2ZYWX 4XSHA 2ANBA 3EW9A 3U3MA 4UJ3A 2GJAA 3CM0A 4A4DA 1ZBDA 3ZJYA 2OXRA 3IIJA 1R2QA 4BFTA 3NTUA 4FXPA 4DIEA 3FVQA 4CVNA 4UXJA 3TW8B 3KKMA 3I1FA 2PL3A 4F4IA 4DQKA 4TMKA 1NBMD 4QBIA 5JWOA 3OZVA 3TQFA 5JRJA 3W2GA 4YAWA 1MABA 1YVDA 3PUXA 4XIGS 2ZJZA 1ZD1A 1M1KD 1IJFA 2N1BA 3EA5A 1MO3A 1MO4A 4M1TA 2Z83A 2WJIA 2PX3A 1A8PA 3NBFA 3AB3A 4NP6A 3K0FA 4LHWA 3UMSA 4NCIA 4QL3A 2UVQA 5H5JA 1X8LA 3AGQA 4DSTA 3EG5A 4BRUA 1OIVA 5C18A 2H17A 1OKKD 5FL7A 3ZS8A 5J4YA 3CCLB 4AWXA 3GJ6A 1J90A 1E1QA 3CCQB 1KI6B 3AVWA 4IFEA 1TX4B 1XTIA 1T5LA 2PZGA 2GQFA 4C30A 1ZUIA 3QJYA 4ACBA 1WA5A 2DCUA 1Q57A 3A4LA 4IVRA 3CNNA 2BBOA 1CJMA 3G71B 1Z47A 1UM8A 4XWOA 4QRHA 4LK2A 1E2QA 3T5GA 1QHIA 4UXIA 4AY2A 3IUYA 4PC2A 4G5RA 2FH5B 2ZUCA 2MSEB 4JS0A 2FJUA 1IAQA 2C2HA 4NBSA 2R6GA 5KU1A 2GXAA 4F4CA 1OIWA 2QAGA 2HCBA 4A0FA 3EIEA 1CU1A 3RS3A 2XB2A 1W2BB 4OL0A 4QBFA 1RRFA 3SOPA 2GJ9A 5EP2A 2QBYA 1Z0AA 1PV4A 4RFSA 2ZE5A 1XJCA 1Q1EA 2OG2A 1D2MA 1YRAA 1NG9A 1H42A 2GKSA 1N6PA 1Z07A 2ZROA 3PEYA 4MKHA 3UMRA 4HE5A 3SEAA 1HY3A 3ZQJA 4DLTA 2GJKA 221PA 1N5JA 3CZQA 4TTRA 1XB2A 2BMWA 2WJHA 1CR4A 2G6BA 2AR7A 2AN9A 1ZMXA 4AKGA 5FBLB 3AQ4A 3RWMB 4AIIA 4RZ2A 1FTSA 3P20A 2AWNA 3MJRA 4CDGA 4XSGA 4Q1EA 4YONB 3CBQA 1PUIA 3I92A 1II9A 3RWOA 4PGOA 4U00A 4LJ8A 4XVQA 5LBIA 3GLIB 4P33A 3CC4B 5KSZA 3SE0A 1U0LA 2NOAA 1NMYA 3GFTA 3GEHA 5EXPA 4B2LA 5TXGA 4DWJA 3ZZUA 4JIMA 2WSSA 2WWGA 2ZS9A 3MD0A 1YJ5A 4KLZA 4ZIRB 2EQBA 3WHKA 1SVSA 1XD2A 4URVR 2ZI9A 2F1IA 1M74A 4G0NA 4KHZA 1F48A 4BEJA 2QAGC 1G6OA 3NG1A 1P7CA 4KSCA 5GJWC 1SVIA 2HT1A 3O8DA 1Q44A 1W36D 3WMFA 3ICQB 1S96A 2ZJ8A 4OHZA 5JFGA 4JSYA 1JB1A 2EFDB 1DDGA 1FNDA 1XEWY 4PO9A 3QY0A 1P72A 4BPRA 5LDDC 1IB0A 3EASA 3AUYA 1G5TA 1N6RA 1JPNA 5HCIA 1OLOA 4GBMA 2NTYC 1DOAA 4LI0A 4N3NA 1YE8A 1DDIA 1KSFX 1X8KA 2JATA 4TMZA 3B9PA 4NU0A 1VHTA 1CQXA 2W6IA 3EIQA 4LHVA 2ZRMA 5JSZB 3QUSA 3FHCB 1V43A 3ZQ6A 1GNQA 3RS0A 1JJ2B 4E22A 1Z06A 3HPQA 1K9MD 3KB1A 1QFYA 1KMHA 3LFUA 4US0R 4M1SA 3B8HA 2ZUBA 1G291 1G6HA 4KYIB 4V0OA 5IK2D 5LPNA 1NN1A 4FMCB 4EQ6B 1YJ9B 2D62A 4NCJA 1DEKA 4ZDKA 4E5UA 1E64A 1OB2A 4Q48A 4IDHA 2NZ8A 1YR8A 4B3FX 2ZRIA 1XJQA 1F20A 2WTUA 4RKEA 3FFBA 5C46F 2G1KA 5HE8A 4OK6A 3MMPA 3B6EA 4URXR 2QP3A 5KYKA 4HUQB 1E2GA 1JAIA 1QVFB 1W4RA 4YC7A 1E79A 1H8HA 3BC1A 4Z1MA 4GMDA 4LC1A 3IBYA 1MT0A 4HLCA 5FL7D 3SBEA 1NKSA 1JPJA 4JMPA 2DYKA 4FN5A 2IYXA 1FNBA 2QEQA 5CJ2A 1ZUHA 2CNDA 3TUZC 4FMDF 2BV3A 3LVBA 1HH4A 2FNAA 3Q72A 4Q4AA 1KY3A 5E4FA 3T1VA 1Z0KA 3VO1A 1VG9B 3VNVA 3WNCA 1RPZA 1G7TA 4LZZA 4EUNA 5F9HA 4TZ6A 4HDQB 3MLEA
chains in the Genus database with same CATH superfamily
1S2NA 1EEXB 1X9GA 1LTHR 4YAFA 1JJAA 1FRVA 2R85A 3A7EA 3GA0A 4UPDA 4K26A 4QYSA 1QHNA 2AF3C 3CJTA 3NHBA 1M34B 2IEBA 3H84A 1JJ7A 1R4NA 3HP4A 4J9VA 4KRYA 1T5BA 4O2BB 2ZZGA 1POXA 4OQNA 1PGQA 2YRWA 1TI7A 3I9LA 2YIJA 3PUKA 4M8KA 3ZGXA 4AURA 1H4SA 1IYZA 1JALA 3LT5A 1JG3A 3N8IA 2WJ3A 3M6LA 1BJRE 2MMCA 2IZ5A 1TIPA 1R5NA 2A9FA 5A88A 1UPUA 1W48A 2A67A 4MARA 4RFVA 1EXWA 2A1TR 4D9KA 3B48A 3QVVA 4GDMA 2P69A 4PEVA 1GA6A 4J16C 4TSKA 4PG7A 3TEMA 4V39A 4MVXA 4TL8A 1KQSB 2ZSIA 2FQYA 5JBIA 1YT5A 2FF5A 3Q3CA 8ATCA 5JASA 1VSVA 2ZB2A 4B0PA 1CJBA 1MLDA 2CVHA 2ECOA 4KO3S 4ZD6A 3OW2B 1K5PA 1F4VA 5EUBA 4RABA 2P5UA 1GZSA 5C1PA 4LZAA 1UJ6A 2RBEA 3C6QA 1IUPA 5A9SB 4JEMA 4LQCA 1XA3A 4WA7A 5AHXA 1KGSA 4LMAA 1KFCB 5A71A 2FEMA 2PAAA 3EODA 3LUKA 2P5TB 3RNOA 2W71A 1XMOB 4R3NA 4KKTA 4P9SA 2O1EA 2J4CA 3T12A 2E4VA 1XNJA 5KAPA 9LDBA 4P0TA 2FN3A 3LYLA 5E9JA 1K92A 4Q82A 5JANA 5EE1A 3LPCA 3Q0TA 3E18A 1G5RA 1F9EA 1JIXA 2O6HA 4FHZA 3FMOB 4IOKA 2JLSA 5LQMA 3BD9A 3W5DA 4FC7A 1I6LA 2ZYRA 4D9HA 1M72A 1NJ2A 2FW8A 2WF5A 4NNOA 3ISVA 5HK9A 4JV5B 1JKIA 4OOVA 1GZUA 3KWMA 5B3LA 1N78A 3WGNA 1KD1D 1YH3A 1DTEA 1EWYA 2ZDQA 3HZRA 4CODB 3PXUA 4YCCA 4Z4YA 4UFOA 2FZGA 3IMEA 4DSNA 4Q1CA 4YJGB 4ES6A 3HO6A 2IYYA 2FK7A 2FOXA 1JH9A 5HF6A 1E96A 5HWSA 4R5HA 1N1GA 2FSIA 2X0EA 3THXB 2HWYA 1G17A 1XPRA 2ID7A 2AEEA 4BVLA 5GZ3A 3CWZA 4E32A 3WLIA 4MO9A 5C8VA 2F1JA 4DB4A 4KVGA 5A1TA 4IG9A 4OXKA 4F5ZA 4TKUA 1SXJA 4YRMA 1M1NA 3U44B 2MSWA 3ABIA 1KI9A 3JZAA 2YWDA 2NVWA 3L8YA 3MT7A 4FQ5A 4JN6B 4FWTA 4RORA 1RJ9B 2IEZA 3ST7A 3ZU6A 4CTJA 1RXEA 2IX9A 4D25A 3TOXA 2GRUA 2H4ZA 2WA1A 3E0XA 1QFZA 3V7FA 3HUTA 4BMOB 2QDXA 4GLBA 1GAWA 3BN3A 1Y6GA 3GSIA 1Z6GA 1N5OX 1LC3A 2A0UA 2GBLA 3ED5A 1LDYA 4YAEA 3AVVA 2TMGA 3PQCA 3UW3A 4EB0A 4UZEA 3RWBA 5A5VA 2WV7A 5H4GA 1TK3A 3CVOA 1DHTA 4GXTA 4N01A 1XV5A 4R01A 3WLTA 3D8NA 3VNSA 1RMTA 4N8EA 2QPOA 4ID9A 1KJYA 1U3WA 1XRQA 2YOGA 1XK6A 2Q4EA 2V9ZA 4LRQA 4B44A 4NE2A 4HH4A 3FROA 3AIOA 1QCDA 3AKDA 3EGIA 1A7JA 2QD4A 2WTBA 3PD0A 1L5VA 2PKCA 3Q8XB 5I01A 1Q77A 1BCSA 4OXQA 4AICA 3B3QA 4TTQA 5J2TA 2C4NA 3ETCA 4HDSA 1S2DA 1WE2A 4V1CA 3JALA 3VKGA 1L5WA 3CKKA 4PE5B 4MHTA 1K7EB 3L6UA 5H80A 1LPSA 3BYZA 3QOXA 4I0WB 2XCUA 2CBXA 2CVOA 4H08A 2QZ4A 3WYEA 1DIBA 2NZXA 3EGOA 5EXSA 1EDBA 1AUVA 1SNYA 3QVJA 4OSOA 3EZ2A 3O2JA 1QK3A 4MWEA 1KYZA 4U2DA 1N0HA 3Q85A 3UFXB 3NKLA 2Z5VA 2XGSA 1KI2A 3TPFA 4B6GA 1H66A 3TRHA 1J00A 3DL7A 2Q5HA 3ENNA 3ZIAA 1K27A 2ZIXB 2FUG1 3FNQA 2XGMA 2WILA 3OBIA 5FXMA 1J1UA 4JLOA 4N3GA 2EKLA 1LSOA 1XZFA 2R8YA 3KVOA 4UEJA 3AU9A 1RACA 1GUZA 3G89A 4Q3LA 2QNBA 3BS4A 3WDKA 1FFGA 3HEBA 3KKOA 3GZ4A 3I42A 4MQMA 4PAWA 4YS6A 3WYFA 5G53C 1IUOA 5KQRA 3WWOA 1HGXA 3FOCA 4WT7A 3ZI4A 3QBJA 4DADA 3SZGA 1HE5A 2GASA 3A1TA 3JQAB 3K0EA 5KWJA 3NAGA 1C5KA 4UE6A 2H0RA 4YNBA 2W0SA 2FKNA 4QLAA 5U9CA 1Q15A 1T0BA 1RM4A 2XMBA 1F4PA 3EMKA 4ZMSA 1E9CA 1XMVA 3GL9A 2CUTA 1B0PA 3EWAA 4NE9A 4QTZA 5DNAA 5DJ5A 4YUYA 2IH4A 4L9AA 4UHFA 3GHHA 2EFHB 5L95A 4RTNA 1AMOA 2NSLA 3ZGLA 1SRRA 3T0IA 4BVAA 4E0BA 1JDBC 4AG3A 5HKAA 4HXFB 4C0SA 3MGGA 1DJNA 1NR5A 1YKFA 3KZXA 3A6KA 3AG6A 2C9DA 3GRVA 1USUA 3TX6A 1CS0A 2JDIA 3KTAA 3SZRA 2O3SA 4R83A 2DBYA 3NHPA 1IBKB 1AC5A 1M9NA 4M1WA 2ATXA 5FPKA 2YNMD 3IH5A 2FUNB 3VPBA 4Q39A 3VDQA 4DL9A 1XQ1A 3VMMA 2CD9A 2LCIA 4YHHB 2PT7A 3LUCA 3R8XA 2QMYA 3ZI7A 2QTGA 1P75A 1CLEA 3OEED 4ZHQA 1YVPA 5E1BA 4KXVA 4ZVTA 2YYZA 4YLGA 4N39A 5EQJB 1UR5A 3ZE6A 1V8FA 4BNHA 3O0TA 3K0AB 1K9VF 2QX7A 4KOEC 1E8NA 3KKPA 4BQFA 4MV8A 4IOLA 2XKAA 3AU8A 3EY9A 3INNA 3P4UA 4LDRA 5EZYA 3I56B 1JKJA 3CLUD 1HFKA 2WZBA 3I76A 1C29B 3JQGA 4FJ2A 2C07A 4HWOA 4YJFA 4XE5A 2WAAA 2FW7A 3AKYA 3TM4A 1N5MA 1EJ0A 1RJDA 1GR0A 4N0QA 3LOQA 4TKLA 1G63A 5DO9A 5JE8A 1R0XA 2VWHA 2J9XB 3UB2A 4DLNA 4F5EA 3EQ2A 1HQCA 3D7LA 4RHEA 3T1NA 3BMOB 4HK4A 4P0PB 1ZXBA 4QECA 5FFNA 5AP9A 1NVGA 2FRXA 2J85A 1VP9A 3DQQA 1FRZA 5J4KA 4X05A 2XF8A 1JTEA 5FUXA 1NUPA 5DMHA 4CNBA 1T4CA 4JUAA 3ZR4B 4F4HA 1Z4OA 4ENVA 2HDNB 3C4QA 3CD6B 3PUNA 3PGVA 1ISMA 5EXXA 4ARUA 1U7DA 1O8CA 3QQ5A 8OHMA 1DTSA 5F3RA 1K3UB 2P30A 4TUYB 2BFBA 2EATA 3M70A 2NO7A 3CZ4A 3PWTA 2ZYDA 1PT7A 2O3RA 1FS6A 1MPXA 4JB8A 3ZDQA 2XMQA 5EKUA 4BGUA 4LXYA 1ZRNA 1GZHB 1IN5A 5LL6P 1JA0A 1KDRA 2VHUA 1B1AA 1DKLA 3VR2A 4EB6A 4UFPA 2VP4A 2MU1A 2XB4A 4MVJA 4L50A 1KZHA 3RVNA 1T9GS 2Z09A 4O4LF 2VP6A 2DPHA 2O5RA 2XNDA 1UWLA 3B6ZA 3PTLA 1HTTA 3RRMA 4RH3A 3NWJA 1ZC3A 4CXMA 3NHYA 5IHPA 2VPZA 4Z3DA 2JKZA 2PZFA 4QU9A 2CWDA 2NTNA 2GM5A 1FJGB 2XYVA 3ZX4A 3U1VA 1FFWA 2O7QA 2QTBA 4GOMD 5AIBA 5A62A 1T4GA 1OLUB 5AR1A 3BCFA 1TEVA 3GXOA 4FT2A 5BW5A 5EZQA 1R8JA 2WAMA 3EF0A 2YWCA 3TFQA 5KZMB 1OH6A 1DIGA 2OBTA 4B74A 1T36A 3DLTA 1KZ6A 2OFPA 1GV1A 2ZB3A 1IHOA 4E13A 1E43A 2PU5A 4U7DA 4MKIA 1SVUA 4ZQGA 2CXSA 4O2AA 5HF9A 5FR2A 1CYEA 1CUIA 1NUQA 2PZEA 3G7NA 4TLDA 4EGSA 5KOJA 5IAKA 3ZHOA 4YJKA 4XPZA 3C6YA 4LY0A 3ZEAA 1CLUA 1M75A 1OLSB 5E4JA 5E4YA 3I73A 3FWHA 3L8DA 2A58A 4D9EA 1X80B 3HO1A 2HMVA 4RE5A 4F4JA 3O38A 4PN7A 1SG6A 2NPFA 4MP6A 3W5SA 2BONA 5JBQA 2Q2WA 4MHSA 2PBZA 4X20A 2QQ0A 5CCBA 3PPYA 4FGKA 4DNOA 4OX9Y 3F6CA 4CCSA 2X0RA 1SCAA 4I1SA 1KR5A 2B0CA 4EVQA 4DV7B 2B4RO 3BTOA 2IDMA 3NTXA 2VJMA 4WVLA 4NS4A 3RODA 4F5WA 5A6VA 1U0OC 3CH4B 3ILVA 2QTNA 4XASA 2K4MA 3BD7A 3IUQA 5COAA 3A0RB 1ONBA 1ZICA 1N0UA 1L8LA 4QSMA 4NESA 2ERXA 2HCRA 1VOTA 2HNBA 3NWEA 3CW9A 1TQDA 2YTZA 4H7DA 3QWBA 4B8ZA 1V1MA 4HWGA 4XWKA 1JA1A 1CEEA 1D6JA 2QHXA 3GDWA 4ARZB 3X3HA 1XE3A 4GPD1 4CL2A 1DQYA 1FP7A 3GJRA 4KAAA 4MEJA 4RLQA 4Y6LA 4J2OA 5BV8A 4HNSA 2Y0CA 3TLJA 4MVJE 5AJXA 4IQFA 3E20A 1QAMA 3CO5A 3O9ZA 4FX2A 5DM4A 1EU1A 2VNKA 4J4BA 2H18A 4D8VA 4R9VA 3LXUX 3NVAA 5ALEA 2OR3A 1ZGCA 3A9UA 3WGIA 1B26A 2L18A 2ODQA 1L5KA 5ERYA 3D3WB 4I4NA 4DLSA 3KAJA 3HVJA 3AUXA 1DIOB 2IEIA 1P0FA 2WR8A 2EHDA 1R3UA 3Q7PA 3AUAA 3MOIA 5CHYA 1UBLS 2GJSA 3G59A 3VKWA 2OMKA 3OX1A 1IJKA 3N8DA 5A4DA 2OV4A 4EFMA 1UP4A 4LNAA 5F2KA 2ZAYA 4BX3A 3C3DA 4LEIA 3HEMA 5KNDA 3MIIA 2PLAA 4ILKA 4Z0NA 5KDLA 1BDJA 2IYSA 3DFUA 3VR4A 1SQSA 5DE3A 5KSPA 3ANYB 3ZWQA 3IHLA 4KL8S 3CUWA 4OMCA 4K6MA 3L02A 4G5SA 4ZV7A 4A92A 2J3MA 1HT0A 7AT1A 2H06A 2GERA 1R9MA 3O8RA 1YBAA 1LLQA 1U4SA 2CLDX 1G8GA 1OR8A 3UMGA 5IM4A 1HT3A 2PZLA 3S6JA 1Y4DE 1QFMA 3RAPR 4LWPA 2I9PA 2VC2B 3RB8A 2A0XA 1E1NA 5AN9A 4FHEA 3KQOA 4G0ZA 4N7BA 3WL7A 1YJXA 3WIEA 4Y0VA 3KTOA 3ZY3A 1DC6A 2FG7C 4KIFA 2WM2A 3KQYA 2D9RA 3C3CA 1CIPA 1LW6E 2WLSA 2Z3ZA 1QG2A 1NQUA 1YZFA 1QG0A 2ISCA 1MOQA 2HQOA 3GLFA 1MKYA 5ESWA 1C0EA 4C5BA 4CM3A 2XZLA 2JIPA 2W5UA 2ZWVA 4UPEA 1S3IA 2X2OA 3GRKA 1IB6A 3KKKA 3DMYA 5HBGA 1PR4A 1NN5A 2Y4OA 4UDOA 4MKFA 4ZDWA 2NU8A 4ER3A 4DK1A 5J2UB 4EECA 4UBJA 1IQRA 3BTVA 3VR6H 3TLCA 4AW9A 3FDZB 2QVZX 1TXGA 2QQFA 2PLFA 3O1IC 4KWHA 3WV5A 3KFLA 1YE5A 3HSSA 3E2IA 3GCDA 4M6WA 3S2UA 5C52B 4Z4SA 2RH8A 4FI3C 4EATA 5AXAA 4UREA 2IIPA 4I2NA 4DTIA 4ZIRA 4OB7A 3JYLA 4KFUA 4B6SA 1XCGB 4CPDA 1SXJC 4RCZA 3RJ9A 4AZVA 3CISA 3OEHA 4AY4A 2ZCJA 4BN0A 1FDWA 4L4RA 3L18A 4TL9A 3HE3A 5EMKA 4FZRA 2BM0A 4LXQA 4MZDA 4AP9A 1ADBA 4PW0A 1QHYA 4GC9A 4BRSA 4XR4A 3R6TA 4R6XA 3WL5A 3JASA 3PWZA 1NY5A 3G9QA 2QRQA 2D3WA 5KOIA 3IVAA 2COEA 5DRYA 1T91A 2A4MA 1NMZA 4F8YA 3HXPA 2O8BB 4J0FA 4UNPA 1LBEA 5FPPA 4Y2XA 4LYHA 3GA5A 4BUJA 3KVRA 1YONA 2OAP1 4YGXB 1J56A 2I3BA 2JEOA 5BORA 3F9IA 1NM5A 4REMA 4DMMA 2DBQA 4Z4FA 4MHOA 1L5OA 4I8XA 3HYLA 5K03A 4TV8A 3W0LB 4OLBA 3DE0X 1TC2A 3HS3A 1XNQB 4MPJA 5ISMA 1DIRA 2GS9A 2CLLB 3B3FA 4ROXA 1UK6A 2ES4A 2SKCA 2WMOB 5I5GA 1HZEA 4XVRA 3ZHRA 2EW2A 2EZ8A 2ZVJA 3AF6A 2CYAA 4BX2A 3EX7C 4CMIB 3C5HA 4QUGA 1QDEA 4ESVA 4DXAA 4EJ0A 3WYDA 5JTUA 5F4JA 4WE3A 3U19A 3BFXA 1EQUA 1BFKA 1F2TB 1KC3A 4GQBA 2HNKA 2RBKA 1NVXQ 2UVPB 4JYPA 3L0IB 4OQDA 4N9WA 5KTPA 4GM4A 3P9SA 4D8YA 1QRSA 3FUCA 1Y8QB 1U11A 2B92A 1SOMA 1SQ6A 1WPQA 2VPWA 1OAKA 3N2KB 3N70A 4UDNA 4UHDA 1AK9A 1LI7A 3EDCA 4OXYA 2K2WA 2UUCB 1L4YA 4XIYA 3RV4A 2R66A 4EJ6A 4B7ZA 4CF5A 4UW9A 1QR2A 1P5ZB 2WM9B 4D43A 1NYRA 4ABTA 4FMBB 3NJRA 2AJLI 3LIPA 2QY9A 4XB6B 2R7MA 2CCKA 2Z4RA 5K3SA 3TTXA 4NJOA 5LP6C 3IV7A 2DUJA 4LSWA 3OFSA 1PJCA 5L3RA 2P6RA 3FYUB 1UAAA 2C4MA 3V1YA 1OE0A 2D5CA 2VSQA 3ISTA 4G7WA 4HQKA 4IWYA 4PIVA 3F7NA 4JU8A 4PO3X 1JHQA 4R84A 3HYCA 1JI3A 1Y7LA 2YOHA 3BE5A 1SGWA 3H1EA 3AVUA 4Q7MB 3KPWA 3WS7A 1UKEA 1EXMA 3GCXA 4OAPA 5EN4A 3ME5A 3CSDA 1RAEA 1RHRA 4KWCA 4QATA 2R11A 1EVQA 2HK6A 4DMLA 3QH4A 2WC1A 2MYNA 4C0JA 3LCVB 1UM9B 3N2IA 3OOJA 1U9CA 1CR6A 3EBOA 2J59A 2VP2A 2ZJ7A 1ABBA 3KHSA 4RYDA 3PDJA 3PPVA 5I4CA 2YJTD 5LMZA 1K8AD 3OQPA 2I2FA 2GBFA 4HQ0A 4NAVA 3U81A 1SBQA 5F2OA 4C3OB 1U2SA 1UJMA 4CF3A 4MUEA 5CTJA 1HRDA 3OY2A 2B94A 1WOSA 1ZESA 3PF9A 4ZVKA 4I5GA 5JS2A 3FDFA 1VQOB 4QDJA 2JGEA 4CZ2A 3QV2A 3BVPA 3PGJA 4G8CA 4JC5A 3OOCA 2Q4OA 5JXHA 1KVTA 1XZIA 4UHBA 4RK5A 1VKOA 3SDSA 3ZD9A 4G3XA 3K6SB 3FLMA 1I6KA 4ND8B 4P35A 1EWQA 3OJ0A 3RSSA 4GSYA 1QK5A 4HTFB 3PLRA 4MW9A 2AUNA 1KMQA 1VJ5A 2J0EA 4WQMA 1P3JA 3GXBA 4GLLA 2GK4A 1VQMB 5JZOA 1J8FA 2WDPA 1QDUA 5JC8A 4EAQA 1IOVA 3CX3A 3BUSA 1JHMA 2BL4A 4F5DA 5BSUA 2OSVA 4JX9A 2HWXA 3RVJA 3TUIC 2UXCB 1W93A 4IJ5A 2DQZA 4B7AA 2QN6A 3PDIB 2O8BA 2XMPA 1MC1A 1IFXA 4G67A 4RTKA 3ZUPA 2ZXUA 2DFDA 4R0NA 3AEKB 3P0JA 3TQQA 2EERA 1ZJYA 1QHEA 4HDSB 4KK4A 4BQSA 3IP8A 3GVIA 2RH5A 3LVQE 3W5AA 1NXTA 1NJSA 3NH9A 4CQLA 3BXXA 2D7DA 1T15A 3BCDA 1W59A 2OXFA 2XZTA 5IT4A 1UPXA 2D2FA 4F6RB 4ZQBA 4W7SA 5EZSA 1JP7A 3IS3A 2CXTA 3PNOA 4D4MA 2ZT5A 1GPJA 1BTOA 2BRUC 3EQ9A 5G0TA 4DJEC 1T8TA 4MDHA 4C4XA 3M81A 4X3CA 3DTNA 2HRDA 1O89A 3JZMA 1XHFA 4PAGA 4UQLA 1KH1A 1V0EA 1HMYA 4MXDA 3O8QA 3NW9A 3JVEA 3RJTA 4INOA 1VLMA 1ZQ1A 2XXBA 3OFJA 4RQUA 4UNNA 3FDZA 4EMTA 1ZN7A 1MO2A 2R3SA 4X8OA 5EE5B 1TW2A 4BO3A 5KKCA 1I7NA 1IIBA 4PS0A 1Y0RA 3X1JA 1B6RA 4PGMA 4FJ0A 1QPBA 3ILHA 4OL9A 2ZT7A 3N2ZB 2MMGA 1TVKB 2VFAA 2LKCA 3RT7A 5IKEA 2B4AA 3UT5A 4D0LB 3M4NA 3MS4A 5LYYA 1J2UA 1YIDA 1C3VA 1GPKA 4IPTA 4LRWA 2WWTA 4JP5A 2ECKA 1B00A 3R3XA 3ZWCA 4BFWA 1GWNA 4CQMD 4G37A 3GLKA 3Q7QA 4JQSA 4WNCA 5K51A 2HV8A 3GEEA 3SX0A 4UQOA 3OJWA 2Y0PA 3W2IA 3T5DA 1UH5A 1YA6A 3PJEA 1WB9A 2G72A 2UKDA 3RGWS 2FQQA 2ODBA 4QSHA 1WUKS 5BT9A 4C3VA 3M6UA 4N76A 4O4HA 3NRCA 3DE7X 4CKWB 3TF5A 1YDFA 2O3UA 5HIJA 2JPDA 1OXVA 3RRZA 1DNPA 5B6IA 4Y1EA 1ONPA 2Q3EA 3SSNA 3DDNA 4NZPA 4QO7A 3FNRA 2C77A 1U6JA 3ETGA 1M6EX 4MYHA 4EABA 1EFAA 2QXUA 1QTNA 2X19A 1XCBA 2ODPA 4I5EA 1BX1A 3CUVA 3HUEA 1CC1S 3I9KA 3UV6A 1BS9A 5IJXA 1WTHD 1X19A 2ZJ2A 2BT4A 5SY4A 1JG7A 4IHQA 5L4LA 4ZYXA 1CX9B 4Q03A 1FW8A 2R8BA 3EG9B 3GLFE 5CH5A 4Y7CA 4X65B 1Q1GA 2QYHA 4FEEA 1RTTA 5CBPA 1MZPA 1ND5A 1EEHA 5AVSA 5CB0A 1N8TA 4WKOA 5A9SA 2PXXA 5KNDD 2GO7A 1IXRC 2PDAA 1L3IA 4IIHA 5H82A 1ZM3A 2DR3A 4MB6A 4BE7B 2IYTA 4LJ9A 5EGNA 3ZHQA 2EKZA 1V0FA 1OASA 5KYWB 5CA0B 1PJZA 2GOYA 2WWHA 4HTFA 4LZLA 4EEKA 3LC1O 3EJ6A 3O31A 4DQDA 3ZJUA 1K3TA 2SHKA 3FPSA 1FRQA 3CBGA 3GD5A 5G0WA 4IKPA 2Q4DA 2OOKA 4XAQA 4CI9A 1UINA 4P6VF 4CM7A 4EHHA 1BCRB 1VCIA 5MFPA 4OP7A 3QEBZ 2A3NA 3DAOA 4FX5A 5D3MA 4ZJPA 1J25A 1X7YA 5L3QA 4UMVA 3X2EA 4HDKB 2Q5IA 3HJFA 1F8YA 1SXPA 2Z56A 1SK8A 4WLOA 3LX4A 4FNAA 4B32A 4OU4A 4QOFA 1MUUA 3NBQA 1G3UA 2H7VA 4D41A 3PC8C 4ZV9A 3MAJA 3M1IA 5H4HA 2PU7A 4RL6A 3GJXC 4BBPA 1ISIA 1UM9A 4RH1A 1BMFA 2XI4A 2OCIA 4GRIA 3QU7A 1VZ2A 4DJFC 1PLKA 2BTQA 1OOEA 4G23A 3GRZA 2Z6AA 5JBNA 1Q6YA 1DL5A 2H11A 4ZZ2A 3F7TA 5AYVA 4BX8A 4HB0A 5KDOA 1LJLA 2NTEA 1ZNWA 1XXLA 2X5OA 3KKZA 1RHJA 1ZCZA 1MAVA 2AE1A 3LBYA 4OQXA 3OCCA 4M53A 2PUCA 3PVDA 3QMMA 3RAGA 3FPJA 4U5QA 2VZEA 3S2ZA 2GPBA 4ZOEA 3QWAA 5GJBA 2IUSA 2J4FA 2P41A 5K0TA 5MN6A 3UCXA 1J9GA 1E8DA 2FPIB 1Z0DA 3LX8A 1B8NA 5ARBA 3U09A 5IJ9B 8ABPA 2D2VA 3VZPA 3LO5A 3OLYA 5KSYA 2REXB 2Q2NA 4J0GA 4HUJA 4N03A 2ZJYA 5TS3A 4LJRA 1ENZA 1OFVA 2GYUA 2ZJ5A 3LKZA 1U0GA 2R7LA 3IPAA 4C7OA 1RYEA 1YCFA 3IL2A 1GUBA 4WADA 3ET4A 3SF0A 3KPYA 1ZDMA 3VNUA 3PIRA 3PXBA 3V7NA 1CVIA 1N5RA 4LZPA 1TUGA 1P2SA 1RMYA 2R1UA 4KDEA 1XTKA 3NYQA 4MIEA 4RV4A 4BASA 3T3NA 3E9ZA 2JHFA 1YB5A 1ZKMA 2IY9A 1EFKA 4JA2A 4N9QA 3BH0A 5F12A 1ZBQA 2KBFA 3ELYA 4IKEA 4X9XA 2QLBA 4N8SA 2XF2A 1Y5NA 4OSPA 2M32A 1PL0A 4O4HF 2MSLA 1UMBA 1GUAA 2ZRPA 2E3JA 2ZTHA 1P62B 3L7OA 1TE2A 4MS1B 2IVFA 4I6GA 1QORA 4CL3A 3A4NA 2ZCUA 4DA8A 1XAHA 3CA8A 1JLHA 4XN3A 2DCMA 3CLVA 4KIGA 5TB5A 1Y8CA 3PJRA 1CJKC 3EZ9A 1VJSA 3SHQA 3BX1A 4XJTA 4LYFA 3X1DA 2BGKA 1IPHA 2DWQA 1W19A 2PO7A 1CUWA 1MJFA 2SBTA 2VNSA 5AI8A 3WFJA 3CZMA 3IA2A 2C98A 5FFMA 3UIEA 3CLUC 4EGCB 1LTKA 2Q1XA 4HNHA 2KVOA 4LZOA 4PQYA 2YOFA 5A5GA 4OB6A 5EIFA 1HYHA 3MOGA 3NUGA 3E9EA 2OZLB 3RS2A 3TAUA 2GR9A 3PQ5A 4DCGA 1QRUA 5AW3A 2QRPA 3NC1C 3QVWA 3R0IA 3QA3E 1Z2DA 3D4BA 5BY2A 4CEJA 1VHDA 4URUR 1KQPA 2QN2A 1D4ZA 1SKYB 3HA3A 4W5HA 2HB6A 3UWOA 3O7WA 3TBHA 3AVTA 4IDAA 1J7JA 2CL7X 4GG1A 4XLHA 3HKCA 3BB4A 2O7RA 3PR1A 5GGYA 1U0RA 2I1VB 3OAAD 4B7CA 2QIPA 3HTXA 1LPOA 1W5TA 2JCSA 1PNQA 3AO0B 3DLIA 4O8CA 2DFNA 5AI6A 4F6RA 3C98A 1S7CA 4KR9A 1GO2A 4BO7A 1UOOA 4RDCA 2YQZA 4C0HA 3ISXA 4V38A 2FPLA 2WABA 4KVFA 1GZ4A 1O94D 2Q1TA 3D6AA 3GLGB 1XEAA 2EEZA 1N5LA 4TKVB 1RWVA 1KKUA 3HJHA 4XIFA 5AW9A 1B7GO 3KYBA 1WIWA 4Z3KA 5IXSA 4MB2A 9ATCA 4QHYA 4ZPJA 2I4IA 2HK9A 1LQ2A 3DEFA 3JQ9C 4RKFA 1ZJWA 1QP0A 3E1SA 3IUNA 4LF7B 1LKZA 1NULA 3GAZA 3EMDA 3UJ9A 4U7HA 2XDAA 1XKQA 3NHRA 5TQ2B 2AL7A 1Z9BA 2O7VA 4ROTA 2SECE 1QX3A 1WB6A 1Y3HA 2WJJA 3O74A 4YAOA 2XKBA 3DAYA 2NV0A 1NE2A 1EVKA 5BN3A 1K5HA 1SCNE 5AW2A 2GPJA 2F43B 3AB7A 4ML3A 3TAXA 1EXVA 2I1WA 2HUPA 1UZMA 1AKUA 1THZA 2JCYA 4XGNA 5T4FA 3I8OA 2RONA 3KEOA 2OD9A 3HCBA 1UFVA 3L04A 1VGVA 1N2EA 3LX5A 2VA8A 1CQPA 3BIJA 3KO8A 3YASA 4BKRA 3M7IA 3OEYA 3REOA 4IUBS 3OLCX 4FDVA 5B30A 4E2YA 2ODEA 2PV7A 1Z37A 4RY2A 1Y9JA 2DF8A 5DLYA 5LMNB 2AR9A 2GX6A 2XYGA 1ZWKA 3ZHZA 1SURA 1WDLA 5JLAA 2PGOA 2GILA 2NSYA 2BEKA 2CFIA 1S9HA 2LDXA 3ISJA 2GETA 3OEHD 5I9MA 1RT9A 1BAPA 5MF6A 2XTNA 1PF7E 1YZHA 2ID8A 4UCWA 1RJEA 4QUDA 4XGRA 1S01A 1VYVA 3RYIA 10MHA 1LLFA 3D3KA 4JT9A 3DV9A 3DTTA 3P2JA 3PUZA 4R9UC 2DAPA 4DABA 3D7SA 4HJRA 1LQUA 2EX4A 3N2EA 2ZU6A 4WBSA 1PJ6A 1V8BA 1PYOA 2GNAA 4U7TB 2FRDC 4U7FA 5LQCA 3FHTA 5GWXA 3ZV4A 2CZGA 4DQUA 1RXCA 2JK0A 1WCV1 3BJRA 4ZCLA 4ZOLB 2OFOA 1MB4A 5TQ0B 3RUDA 4B4OA 4DCJA 2G36A 4F96A 5A89A 3JYQA 3THYB 2JVKA 2SCUB 5CCDA 1WMDA 4XORA 2GZHA 3RIXA 2AYZA 4KPUB 3ZS9A 5FWDA 4XLTA 3UWPA 1JH8A 4ZAXA 1ZNZA 3QTLA 4Q9LA 3H18A 1K6JA 2LVBA 3H6KA 3I4LA 3FOEC 1UBHS 5IVPA 3MG9A 4QU8A 5DYYA 1DI0A 4GYJA 2DJIA 3VOAA 4I1PA 5IC6A 1Y6ZA 4HWTA 4KN8A 4AUNA 4Z7NB 2V1UA 3JSAA 1VKHA 4V0KA 5DLDA 4IXTA 4D4JA 2EZTA 4BZPA 2RGEA 3IUBA 3UMBA 2IYQA 5LZ2A 4DLWA 2RHGB 1UC5B 2YZNA 1QOPB 5KINB 1NU8A 3ODGA 3TI9A 5FV4A 1L4EA 2KLHA 1T5EA 1U1CA 3LBIA 3I45A 4HFNA 5BURA 5I6DA 3IV9A 4R4JA 5M3BA 3H8VA 2ALJA 3TJMA 2D1SA 1PDWA 3THWA 3PGA1 4DYDA 1G8PA 3DTVB 1MJ5A 5F77A 4EUKA 5DNVA 4CLOB 1P81A 2E9SA 4P5DA 4HN2A 2VWGA 5U1PA 1AN9A 1I0IA 2Q1WA 2A5FA 3PD7A 4BJHB 1QO0A 1CY1A 4C0AC 2FHPA 4MUXA 3O92A 1O9BA 1QX4A 2YN4A 2X1HA 3FCEA 3GEIA 2Q4TA 4MAMA 4YJ3A 5CNIA 3O3NB 4AYTA 1J6UA 3FMFA 4FYKA 4WH0A 2F9MA 4POAA 1SUEA 3AFHA 1KVQA 5THKA 4BAGA 4BYMA 1N8RD 2HCTA 5FA8A 3VAZA 3QPUA 4U02A 3SD7A 4Y2PA 4C04A 1OLUA 3WGLA 2BHLA 4F4FA 4L1KA 5IDVA 4W5TA 1UAGA 3W2FA 2FUKA 1TT7A 1XMIA 1DVRA 1V6CA 2YMLA 5DGXA 5C8DA 5CIYA 3MF4A 1DRKA 4H7IA 2FZLA 1V4BA 2DLNA 2OO7A 2JCGA 2JI9A 2XADA 3N5KA 1KMNA 4KH0A 3L1UA 4MVJF 3TZQA 1JLMA 4MR7A 2Q4RA 1X87A 2P4HX 2OBNA 3MYRA 3RDPA 3WFZA 5EIXA 3GDHA 5ALYA 1KU0A 3HKEA 1BDMA 1QIEA 2RSLA 3VKFA 3WLAA 1FQWA 2QORA 3AEUA 3L7CA 1D2NA 3IALA 1AQYA 4IZ6A 2X13A 1RRMA 4ISCA 1UDAA 3U31A 1EWTA 1TMKA 1O9HA 2QG4A 3L05A 5L4NA 2I1LA 3T1YB 3TW4A 3X1YA 5HUQA 4AIIA 4LCJA 1YLOA 4PIPA 4Q21A 2QSJA 2XIQA 1DU4A 2ZBEA 3GLHE 1PV1A 2V6MA 1CDOA 3I58A 3IDZA 4GX2A 4PHGA 3R7FA 4JMQA 1GPYA 3QEJA 3SQOA 4P3NA 5CPBA 4BFZA 3RIYA 3UWSA 3C1UA 3PSAA 3KD2A 3QG1A 4FHGA 2YXDA 3ZLVA 3J80A 1GZ5A 1SO8A 1LDBA 4K9QA 3K0CA 3LT0A 2WICA 4HQ6A 5BR7A 3OQNA 1CHDA 2I5PO 1ULBA 4Q3BA 4WWHA 3SFTA 1S1MA 3V7YA 4N41A 4GNRA 3FIUA 5I47A 3MB8A 4M49A 1IEQA 2Z04A 2FFHA 4CKEB 3N9IA 4J6EA 4ONEA 1XYGA 2G9ZA 3LA6A 4N49A 4RULA 4DDWA 1RDFA 1N7HA 4OF4A 3LYHA 2F62A 5KYTA 3N8NA 3JWPA 1CHNA 4CT4B 4IV8A 1QG4A 1Y1QA 3W78A 2AJDA 3FN4A 1JFFB 4ZU6X 4TTAA 2INGX 3LLCA 3P2OA 4CQLB 1QKIA 5LQNA 3ZBTA 4IGEA 1TOAA 2G0NA 2ZP1A 4Z4VA 3R6WA 3WAJA 5IHXA 1E6LA 5G4KA 5MFZA 1JDNA 4I4IA 4YRLA 1MG5A 1B0UA 2XVMA 3U56A 2NO1A 2ZUEA 3OIWA 3ROZA 3BOSA 4DJDC 1RI5A 3U9LA 2RGAA 1AVTA 4BU1A 1I2BA 2GLXA 4IF4A 5KVSA 3KTAB 1CP2A 3FKSA 4KEAA 5IJ0A 1ES9A 4HAXA 3AB8A 2ZYTX 2WAYA