4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
molecule keywords eIF5B
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
1YI2B 4URZR 1XCMA 3ES9A 3SBEA 1I7PA 1W4BA 1WCV1 3WNDA 3QVVA 1DS6A 4EAQA 3THYB 4IW3B 3S1AA 3ASYA 2W58A 1US8A 2CCGA 2J5XA 2ODEA 2VNKA 3FFBA 1NIJA 3MSXA 5SZHB 4QM6A 1XMIA 2DHRA 2QSZA 3U4QA 4OQLA 3MWYW 1N25A 3HYRA 3U61B 4MUBA 2W0SA 4JL5A 5AWFC 4LPSA 2AX4A 2FNAA 3M0EA 2H17A 3AF3A 2O0HA 3BB3A 1Y3AA 2HCJB 3GP8A 3QF4B 5JI2E 1QX4A 5BWMA 1GNRA 1P3JA 3KTAA 1G6HA 4PGOA 2REOA 1ETUA 2BBSA 4RFVA 1ELOA 3WRYC 4DUGD 3D3QA 3PUVA 3ZBTA 4P33A 3WYFA 2BVNA 4XIGS 3IHLA 1KOFA 1P73A 4DWJA 1OH6A 1VDZA 2QU8A 1GRRA 4V0ME 1YVDA 5CK4A 1TEXA 4NCNA 4JLMA 4M1YA 3CCVB 3B1ZA 1GTVA 1OB5A 3RDPA 5AJYA 5JHGB 1JNYA 1U9IA 3M4YA 4LY6A 3KFVA 3M1IA 2WMOB 3LBIA 1XTKA 3EZ2A 4R98A 2CLSA 2WKQA 4PHGA 4KSCA 3THWA 3QVUA 4FMDB 1KSJA 2HT6A 4FW9A 2YWGA 1N5JA 4PX9A 2QE7A 2GF0A 2WHXA 2JLQA 4HDOB 4LUCA 4EDHA 4YQFA 2QGZA 1IXSB 4UNQA 3RLFA 1Z6TA 4MDFA 2PEYA 1J8MF 3SHWA 1GL6A 1TX4B 4I1OA 1GM5A 1GIAA 1ZU4A 3VKHA 4W5HA 2ODBA 2MSDB 1IAQA 1LY1A 1IY2A 1YIJB 3EIQA 1Z06A 3EA5A 4Q4AA 3DMNA 4MGIR 3KQLA 4FWIB 1B2RA 1GVNB 1FQKA 2JIZD 1AQUA 4JMPA 1H85A 4LGMA 1OE0A 4U02A 2R44A 4B6FA 2WJIA 2J0SA 3IBGA 1PLLA 2RC6A 4PQYA 3E1YE 1E32A 3T5GA 5EXXA 4MGYR 2KBEA 2IX3A 2I4IA 2IA5A 1E4VA 4WBSA 3REGA 1Z29A 1FNCA 4B48A 3AVVA 4UXIA 2FFQA 4IJMA 4KBGA 3WMFA 1RIFA 3QKRB 5CDFA 4EUNA 4B75A 1XPRA 2WBLC 4B34A 2OLKA 2QA5A 4M22A 4NZYA 3AQ4A 2NGRA 2HYIC 1JAIA 1VCNA 2JJ8A 1KZ7B 3PXGA 5CJ2A 4XJXA 4QJ4A 3GPLA 4XVQA 2B21A 2XNDD 1FRQA 3A1SA 1KO4A 3U7EB 4FMCB 4NYJQ 1ZUHA 1EXMA 4A0RA 3SOPA 4NONA 4LJ5A 3DOEA 5TXGA 2ZR7A 3CPWB 2IK8A 3HPQA 4E22A 3CLVA 5JWHA 4TMZA 2PLFA 4UNRA 3AH8A 3S1AB 1UJ2A 1XF9A 1CRPA 2BWJA 3I8XA 4A1FA 3I3SR 3MG9A 2FSIA 3EARA 5EE1A 3T61A 4BRWA 4QGHA 5D3MB 1COWA 3P20A 4NYMR 4PPGA 3AF0A 5JEDA 3KQKA 3I55B 4C4PA 2N46A 4RCZA 1JI0A 1GP2A 4TMTA 2QI9C 1XP8A 4B3CA 3FVQA 1QFZA 3CPJB 1Q1QA 4NP6A 2FE4A 2Q0HA 3T1VA 5AN9A 2IS1A 4F4JA 2VHJA 1IHUA 2AK2A 2OK8A 4B33A 4TZ6A 3QKUA 3HR8A 2DPXA 1U2RA 1AGPA 2OT3B 1Q12A 3ZVLA 1BH2A 3X1ZA 3G5UA 1IQPA 1BYIA 2DWPA 1BYUA 1RZ3A 4MQBA 3K0CC 4HAUA 2YZ2A 3TW4A 1DAGA 2XSZA 4AC9A 3MLEA 2GZHA 2YWFA 3NWJA 2VP2A 5FOSA 2GEDA 5GJWC 2WJJA 5EP3A 4QNRA 5TY0A 4DUGA 1D2NA 3RSLA 3NVAA 4D82A 2AWNA 4FIDA 2OK7A 2G83A 3EZ9A 1OHHA 3KUCA 2QTVB 1IN8A 3SJZA 1J9ZA 3BGWA 4M2LA 1KI8A 2A3RA 2QPOA 2Q3HA 1KNQA 2Y8EA 4A8JC 4XTRA 2GVZC 3HU1A 4F93B 4PC3A 4AF7A 2QAGA 1QUEA 1Z0DA 3LV8A 4ERNA 3RVBA 3FMOB 1X6VA 1AQYA 2H16A 2V6IA 4B73A 5KOYA 1Z07A 3MD0A 1X8JA 4C0SA 4IRUB 3DMDA 5JRZA 4O3MA 3BJIC 2JJ1D 4GP7A 4QNMA 1U0LA 2QP3A 3TSZA 3BK7A 4TLAA 4TYYA 4XVRA 2JDID 2XB2A 2BCJQ 2Z43A 1WDTA 4BWYA 2Z0MA 1U0JA 2G88A 3U44B 3WY9A 2ZJAA 3VX4A 2MMGA 4RFSA 3QE0A 4K8OA 4B2LA 3GLFB 1P2TA 3VR6A 1CJKC 1HYQA 1LW7A 1QG4A 3MAAC 4CW7A 2O8FA 5LD2B 2W2TA 4BFXA 1IY1A 3P1JA 4GMXA 4OYHA 4TQAA 1OHHD 4M1OA 5FOXA 2RGNC 1M1KD 2ZJ5A 3CRW1 2F43A 5GJVC 3NH9A 4GZMA 1W36C 3JQRA 4HE6A 2WIBA 3LRPA 4U5XA 4V02A 2C9YA 4X8LA 2PMKA 3N2EA 1BIFA 4HB0A 5KO2A 2XSZD 3TGPA 4B3GA 1P6XA 2QBYA 3RS0A 2OCBA 2ATVA 4EJSC 2G77B 4US1R 3LA6A 4JKYA 1G5TA 1KY3A 1SXJE 2B5OA 3BC1A 1NBMD 3T15A 5C4GB 4LYFA 5J4KA 2RGXA 3W6PA 3MCAA 2GAAA 2NZ8A 2V6JA 5FR2A 5BXQC 1OXTA 3SNHA 3EIEA 4OKSA 1OH7A 4F7WA 2RGCA 2IYWA 4KLNA 3ZZTA 1EWQA 3LXRA 1S3GA 4TMKA 1G1MA 3K70C 4URVR 1NG1A 3CNNA 4WAUA 1GVHA 1Q0UA 3UXMA 3GLFA 3A4NA 1G8PA 1E0AA 2H57A 4A0HA 4M1MA 2W6JA 1HV8A 3MRSA 3CCJB 3NEYA 1AJEA 1AN0A 3W5HA 3IPXA 5K8LA 1AZTA 1GUAA 5ANRB 5EE5B 3PEUA 2QENA 2PH1A 2R6DA 2XAUA 4Q7KA 2ZYUX 1UEIA 4L5BA 1TPZA 1YQTA 3NXSA 2QTHA 3RRNA 5F9FA 1RE0A 4BFWA 2GBLA 1YHQB 1N2CE 2IHBA 2WWHA 3GJ5A 2CHQA 2KBFA 4ON9A 2ZS8A 2CNWD 2REBA 2BPOA 1G3IA 2XNCA 1Z3IX 2H92A 3B1VA 3ZVRA 2OHFA 3ASZA 3RYTC 1T0HB 3KB1A 2IXEA 2W6ID 5A4JA 4XTCS 4JLOA 2ZYVX 3ZGXA 3U2QA 2BBOA 1XTIA 3U7FB 2P6RA 2J1LA 5E7IA 2OUKA 4YLGA 1HQCA 1JA0A 1XEWX 4JVMA 4GZLA 5K8UA 3GEHA 4DB2A 3GFOA 2OXCA 4KAXA 4BFVA 1Q1EA 3QEJA 5KSYA 4WQMA 2AD5A 3N2IA 1LVGA 1NP6A 2JIZA 3QBVA 4E03A 1P2SA 2B6HA 2GVDC 2GJ8A 3V4FA 1KZGB 4MKHA 3I61A 4QGAA 4JLAA 5JEEA 1X1RA 4AI6A 2QORA 2BF4A 2OTLB 4RZUA 2PMDA 3FMPB 1U8AA 2LKCA 3I92A 3KJHA 3U44A 4C3ZA 4HE5A 3U60B 4G1BA 4LBZA 1G20E 2P5SA 1YZGA 4E07A 1VG0B 1DE0A 1VMAA 5JHHB 3TVDA 2FSHA 4AG6A 3U4QB 2VEDA 1IJFA 1FP6A 4MYUA 3Q7QA 3HDTA 1SVSA 3JZAA 3UATA 4PC7A 1JXMA 3ECCA 3ADDA 3ZC3A 3B13B 3QG1A 2O8CB 1DBSA 2SHKA 2ZYTX 2IC5A 5KUTA 3E70C 1D8TA 2JLWA 2GWHA 2QEXB 5FFMA 3K9HA 1JA1A 1VQ8B 1ZYUA 1FNNA 1P4SA 2QAJA 2E9SA 2W0MA 1M7GA 4LSGA 4YMTA 1LB1B 1NBME 5KSPA 4D0GA 2FMXA 3CONA 3PEVA 2F1RA 3P32A 3THXB 2R65A 4LJYA 3NH6A 4G3XA 1WQ1R 4LC0A 1KI6B 3NBZC 3PENA 3CC2B 1VQ7B 1ZNWA 2V4ZA 1H8EA 5BYJA 3ZZ0A 2EYUA 3QG5A 5CB8A 2EYQA 3EPLA 2GEVA 4RKFA 4Q4LA 4XSHA 3QFSA 1N3BA 2FSGA 2W2VA 2NO6A 1N0VC 1DG3A 3A4MA 3QPWA 4MYHA 2FN4A 3HR7A 4KU4A 2L0XA 5DE3A 2P6NA 4TYWA 1GL7A 2X1VA 4ZCMA 421PA 1DO2A 4Q1CA 1NVWQ 4ARZB 1YKSA 2J41A 4R7ZA 4UXJA 4XSGA 3SC3A 2BCGY 3PIRA 2YWHA 4XVUA 4OI0A 4QBIA 3GLHA 2HF8A 2AFHE 3WYGA 4TYNA 2JLUA 2ZU6A 1N5IA 1ZUIA 4NYIR 1YZNA 1ZCAA 3WNCA 5DGXA 1R5BA 4WA7A 1YZQA 1ZBDA 1MO3A 4LI0A 4URXR 1A7JA 4GSYA 4JSTA 3R9XA 1W0KD 1ZP6A 1KSGA 1N6LA 4XD7A 2QPAA 2JATA 2MSCB 5LPNA 1ZNYA 4A6PA 4CEHB 5SZJA 1EESA 1JR6A 3EC2A 1XRJA 2R6CA 1VCMA 1Q82D 1U8ZA 1VECA 1WXQA 3W90A 3WP0A 3LVBA 3RS5A 1KI6A 1ZU5A 5JWOA 2B7BA 1DOAA 5DYGA 1T3HA 2WKPA 1M90D 1OXXK 1II8A 4ITRC 1KJWA 1G7CA 2XB4A 4LX0A 4OQXA 4B6EA 2QM8A 4FMCF 1P2VA 1CF4A 3U3JA 3T06B 3H4MA 2VIIA 1T5LA 3A1TA 4JBYA 3NIBA 3TH5A 4TLEA 1JXOA 2W00A 4II7A 5DIFA 3AP2A 4YXWD 2C78A 3LLMA 1I4TD 2BN4A 4RZ2A 1JPJA 3Q3JB 4V0LA 1E98A 2HT1A 3AM1A 1EG7A 5A0FA 3SFZA 2QRZA 1IN4A 1UADA 2PZFA 4FCVA 3CC7B 2EWWA 3FTQA 3O8RA 4ZDJA 2QUZA 4I81A 1A5TA 2A2ZA 2OSBA 4KFUA 4PHFA 2OAP1 2D06A 3EPKA 1FDRA 2XEXA 2BMFA 3CR7A 4OQMA 2ZI7A 5E7JA 4OJKA 4BFSA 1Z6GA 2IS6A 3WHLA 4M1SA 2XTNA 5KNCA 4DEXA 3CB4A 2IYTA 1XU4A 3TUIC 2GJKA 4RVCA 2V3CC 1W34A 3A8TA 4HZUB 1AKYA 2YC2C 4X8OA 1G3QA 3PUYA 2X3UA 2ODWA 3LVRE 1FUKA 1UMKA 2ZRHA 1L7VC 3L8ZA 4DLYA 3CCEB 1F5NA 2J87A 2WPDA 3LW8A 3PG5A 4PQFA 3T34A 1FFHA 1UKVY 4A2WA 4YMSA 1Z0KA 3QUSA 4C0LA 1EGAA 1W7AA 3JQPA 3K0SA 2Q6TA 4OHYA 1B0UA 4BLOA 4D4KA 5KPJA 3L0SA 4O0MA 1E79D 5EE3A 4QHSA 4ESHA 2JJ2A 1X1SA 3PJRA 2DWQA 2O8EA 2QGNA 4FXPA 3AF2A 2ZS9A 2GXSA 3L2OB 4LJAA 2VL7A 2PJRA 1G64A 4PZYA 1E1RA 1WMSA 2ZITA 1WA5A 4IOMA 4O2LA 4S35A 1EFHA 1ZCBA 2PEZA 1KKMA 2R9VA 3SBDA 3SJCA 3X2SA 4M4SA 1LV7A 2DFKB 1AM4D 1FMJA 2R8RA 1NVXQ 1UFQA 3NHAA 5EXPA 1HQYE 2QG6A 1AKEA 3EG5A 1K6MA 3IIJA 3DKPA 1QBKC 4C2UA 1NY5A 4NCIA 2GJSA 1U8YA 1JB9A 1P5ZB 1CNEA 1DAIA 4KJZA 1XDBA 1XEWY 1XX6A 4I1SA 3IO3A 2B8WA 4NU0A 1KK1A 1P60A 2D62A 3LO5A 1D9ZA 2HJGA 4JVSB 1D2EA 2X8AA 4LV6A 4LCBA 1AGRA 4Q21A 2JGNA 3LY5A 1CLUA 1VQKB 4BZQA 2WSMA 3IKJA 2X19A 5EP4A 4NKRA 4LJ7A 3AP1A 1JR3A 5HE9A 5GV8A 2PX3A 4QRHA 1B23P 3RNLA 1KK0A 2OILA 4C0QC 3R8FA 5BYKA 1Z28A 2JLVA 4DXAA 3Q8XB 4LZZA 2YJTD 3UWOA 3U6KA 1EFUA 4TT3A 1G4UR 2JLYA 1SVWA 5FBWB 1NLFA 2GTPA 4ZO4A 4Q02A 3VMFA 2ZIAA 3VR4A 2C04A 3MFYA 5KSOA 1E2DA 2ZVQX 2CVFA 4GI7A 3DOFA 1TU4A 3TLXA 2XXAB 1TQ2A 4Q00A 1G8HA 1KI7A 4LV8B 1XE1A 4M8NE 1YJWB 1MO6A 2CE2X 1CR1A 1X8KA 3VR1A 4DBLC 3N5CA 2QQ0A 1OT3A 1EX7A 4RD3A 4GOKA 1RRCA 1ZAKA 2C9OA 4PZZA 2XITA 4I99A 3G6EB 1ZD1A 3CRQA 4OK6A 3LAWA 4EH1A 2WAYA 1A1VA 1ZVQA 3B60A 3TQCA 4Y9UA 2WSSD 2MSEB 2V55B 1Z83A 4WZ6A 1M1YE 4BECA 1Z63A 2UZIR 3CX6A 4B32A 3OZUA 2CXXA 2ANCA 5F3WB 2VYFA 3SHFA 1L4UA 1T8TA 2C99A 3RC8A 3HYTA 5KDOA 4N1AA 2Q9BA 1HE1C 3PUZA 3W6OA 5DHAA 3ICQB 3AKDA 1CEEA 5B64A 3SYNA 1E94E 3UMFA 5G53C 4D26A 2KI5A 521PA 1YU9A 4JL8A 2IYRA 5AUQA 621PA 4CYMA 4BLRA 2CBZA 1Z6XA 4HDCA 2YYZA 4ILEA 1Z0JA 4M0LA 1CS4C 1VG9B 3T1OA 1ZD9A 5HZKA 1KKLA 1DAEA 2EWVA 3OIYA 4POAA 1MR3F 5FL7D 3KKNA 3BFXA 5KTYA 4G5GA 1SM4A 1UEJA 3BB4A 1W5TA 1AIPA 1XCPA 4JT4A 1Q44A 2GA8A 2QT1A 4AWXA 2ANBA 2EU8A 4NYJR 4CEIB 4G1VA 1S2MA 4M9QA 2FPLA 4YC7A 3UG7A 4D81A 2EQBA 3BE4A 4EQ6B 3TW8B 4RD0A 4P31A 3HPRA 3W9YA 5TR9A 4PSAA 1CNFA 4L9WA 4C0HA 5M04A 5JJLA 4X8HA 2H18A 1A8PA 2VRWA 4FINA 3EAQA 5KU1A 1W87A 5HTKA 5BW8A 4M9ZA 2IT1A 4HEJA 4KCGA 2XZOA 2RAPA 1YRBA 4URYR 1SGWA 1EP1B 5F9HA 3LWNA 1CR0A 4HZUA 1G7TA 4KLZA 1NJGA 2G0NA 1E9CA 1KYIA 1E6CA 2RGGA 2XOKD 1T3LA 4A36A 3GJ0A 1XD9A 2YNMA 3SN6A 2RKOA 4E09A 1VYUA 1L2TA 1SKYE 1JBKA 3CUEF 3CX7A 1M74A 3CD6B 4NMMA 4HLDA 1XTRA 4XD7D 2QDXA 1XTSA 3OEHA 1S9HA 1W0KA 3EC1A 3W3AA 5FUXA 4DLRA 3Q85A 4BUJA 2Z4RA 1MOZA 2DFLA 1Q3TA 1UPTA 1FZQA 5EE0A 2FF7A 1EP2B 4G5SA 2ZRGA 3REFA 3LO8A 1UDXA 5K8TA 1E2JA 1LS1A 1KC8D 4M53A 4IVRA 2WPDD 3B9PA 1OIVA 1R8SA 1D6JA 3O47A 1E0SA 4TTQA 1GITA 5BQ5A 4PXAA 4DLSA 5H59A 2ODNA 4WXRA 2OXRA 1KMHA 4LHZA 4K1XA 2P67A 3SR0A 1VG1A 3LVQE 1QVRA 4ZDKA 4AKHA 1G18A 2XXAA 3I4LA 2QA4B 1GKUB 1Q3HA 4OJQA 3CCRB 2JLXA 1E2GA 1R4AA 2D2FA 2IYLD 1NDHA 2EFEB 3RHFA 4KITB 2CMKA 3P27A 3MGCA 1T8UA 2VP6A 2WWFA 2WWGA 4HB4A 2XJ4A 1TF7A 2DFTA 2P6UA 2QZ4A 3IHWA 3W3ZB 1CJTC 2GESA 1JEDA 1G21E 4OHWA 6Q21A 4PSKA 4L8GA 1NL3A 3QKSA 3ZIAA 3CF2A 4G5QA 4BLQA 1IN7A 1SXJD 2ZRFA 2FPKA 4KXFB 4RD2A 3CRZA 4D0NA 4OI2A 5L3VA 2E1RA 3GCGA 4D6PA 2VNHA 1NKTA 1P7CA 2FH5B 4AYTA 2WJHA 5FPHA 2G3YA 2IS2A 1YR9A 4BEBA 5BN4A 1C9KA 3DZ8A 3UIEA 1NN0A 1YHNA 2RHMA 4OQNA 4MUAA 4Y0VA 5HR5A 4IFEA 4HZIA 3L8YA 1Q22A 1KHTA 3D8BA 2NPFA 3WNBA 5L3RA 3OEED 4BE7B 2FGKA 5JMTA 2ORWA 4GNKA 1N5KA 1VHLA 4TYQA 2EFHB 4Q7MB 2IYVA 4JSYA 2EIXA 5THXA 5G3ZA 4DEYA 3G0HA 4JLJA 1FW6A 3UPUA 3OIUA 5JI3E 2VHUA 4JYCA 4AK9A 1R7RA 1Z22A 2F1JA 2FFHA 1KI1A 1GAJA 3ZD7A 1GL9B 2Z83A 4RZ3A 5JECA 2J45A 3K0FB 5CYPA 1E9EA 4DIEA 4EPTA 2BC9A 1Q57A 1J7KA 1P72A 3NC0C 3ND8A 1QZXA 4URUR 5G3YA 3W5JA 3EPHA 5DNYB 2J0UB 4A2PA 1TTTA 2ZI4A 1OGIA 2XZLA 1XJQA 4PAOA 3BB1A 1UKYA 5KHOC 4CF7A 5EP2A 1PV4A 1JJ2B 4LHXA 1JAHA 2CNWA 5IDVA 4JJZA 1I2DA 3GJ8A 1CXZA 1FTSA 2ZE7A 3KXIA 5L3QA 1IY0A 1E2HA 1W2HA 3GQBA 3MWJA 3SZRA 4B71A 5HE8A 4R2IA 2O8BA 3TK1A 3V76A 1W35A 1Z2AA 2RCNA 3MWLA 2HXYA 3R9IA 3KDSE 5AJXA 3O8CA 1KD1D 4MKFA 4TSFA 5GJBA 4DJTA 3GMTA 5IT5A 1W47A 1OIWA 3B8HA 3QPVA 3I72A 3TJZA 4G5RA 2QRNA 4UNPA 1F3OA 1Z08A 1MV5A 5AUNB 1KO7A 1QF9A 2ZEJA 5B58C 4BZPA 1U9IC 1O87A 4IOKA 3CRVA 1FQJA 1W4AA 1QHIA 2QAGB 3ZH9B 3CCLB 2NOAA 5FTLA 4S2EA 3HP1A 2BMEA 4RKEA 3PEWA 4M9SA 3CC4B 2ZJ2A 4FCWA 1W5SA 2C98A 2FJUA 2CEAA 2XOKA 3HJNA 1MRSA 4DT1B 2XNSA 5TMPA 1P9NA 1S1MA 1TUEA 4OQFA 4TT3D 5EZ6B 2ZYWX 4Q47A 3Q72A 1QDEA 5FPKA 4CGZA 1ZINA 3RSOA 2OAQ1 3BD9A 4A6XA 2WMNB 5J47A 2ZSAA 5A5GA 4BPBA 1X3SA 3VHXA 1Z2CA 2QM7A 1DARA 2A7QA 4Q4JA 1CULC 1GRQA 1IN5A 1RRPA 1E2NA 4C7OA 4KYIB 4TL9A 1U81A 1DDGA 1KSFX 4KI0A 2OEPA 3U7GA 4C0BA 3DM5A 2OV2A 1M2OB 4PANA 4O2RA 2V1XA 3QKSB 4K81B 4PPFA 3ADKA 4N3NA 4NPHA 1YJ5A 2GHIA 4HB3A 4D4LA 4IXNA 4HB2A 3QSYA 4EFMA 4DDVA 1VCIA 1IB0A 1PUIA 5FOVA 4PZLA 4LOAA 3B1XA 2GQFA 1GOTA 1GFIA 1KAGA 5D3QA 3WP1B 4BEJA 1E1RD 4PC2A 3L43A 4GP6A 2LWIA 3KTAB 1R0YA 4H9GA 4O25A 2YC4C 5FPTA 4YHBA 1IONA 2V54A 3TKLA 1ZC3A 4LBVA 2ZI9A 4PQRA 5AUOB 4A9AA 4Q5IA 4MGKR 4XH9B 1VCOA 1HH4A 4AG5A 1RKBA 1K9MD 2QP9X 3CX8A 2BIFA 1NLZA 2C95A 4BPRA 1XEXA 1VTKA 1XPOA 4TYPA 1E2FA 1ZJ6A 2IW3A 4U9UA 3A1WA 2GKSA 1IBRA 3NBFA 3B9QA 3G4SB 2H1LA 1W0JD 1FOEB 3A37A 1CJUC 3EPJA 4NHOA 2VNJA 1BS1A 3C4JA 4YONB 4IDNA 2IHYA 1TQ4A 2Z4SA 4ZV4A 3NBYC 4TL7A 2FEOA 4DLWA 5TB5A 1K73D 3DO6A 3QXHA 5JCZA 2ZI5A 3QJYA 4V0MA 2C77A 3CBQA 3QBTA 1WBDA 1N5LA 2AD1A 5J5CA 3X1YA 3VNVA 4V0NA 4TWZA 1FTNA 2DWOA 2QAGC 3QKRA 2FU5C 2HF9A 3VU9A 3I5XA 1GAWA 2OO7A 3FDIA 4TZ0A 3I1FA 3QE2A 1RRFA 2G1JA 4ZPXA 1OB2A 4L4UA 2GPJA 4P4UA 1HY3A 4L15A 4CVNA 4OHXA 4PPNA 4Q7LA 2ZR9A 2AR7A 1YR7A 2FEMA 1UAAA 5C46F 3QOFA 2GBLC 2OFXA 2BM0A 2ZETA 5H5JA 1XMJA 1TUIA 2Z5FA 1T5IA 2NMVA 1NY6A 4ZCIA 4M9XA 3W5IA 2OFWA 1S72B 3CWQA 1FL9A 2RGBA 3E2IA 1NVUQ 4PAQA 1BX1A 4A2QA 1G9XA 1E62A 2PL3A 2ZSEA 2N42A 4LC1A 4Q1DA 4ZI3A 1XTJA 3EZFA 5IF9A 3SYKA 1KNXA 2E87A 3DEFA 1JR3E 5JBQA 3VQTA 1DO0A 5FBRB 3F8TA 2F9LA 1N6PA 2WV9A 4DT1A 1TF2A 3CMEB 1VQ4B 1SHKA 2O8BB 1BQEA 4IDPA 2IEYA 1YE8A 2QY9A 1GR1A 5TV2A 1K8AD 3FHOA 2ZRBA 4OHVA 1SVKA 1KGDA 4OI1A 2GNOA 5DH9A 1XJ0A 1NI3A 3KKOA 1Q81D 5FPYA 2TMKA 2BOVA 1ZM4A 2VHTA 2XNDA 3ND9A 2OESA 2JJ2D 2R6FA 5FTNA 4DQLA 3VO2A 2VO1A 3PEYA 1XCGB 2IUUA 3W8NA 3THWB 1Z8FA 4Z8YA 1KJZA 2J0VA 3QI2A 3QFCA 4CT5A 1QHHA 1EFTA 3ADBA 5FI1B 3LX5A 2Q9CA 3OIWA 1XXHB 3LQRA 5DI3B 4HAYA 2ZSFA 5EZ5A 2WOJA 3WXMA 3AVYA 2ZJOA 3KKPA 1AS3A 4FWTA 4QGFA 2IEZA 2WKRA 4Q9HA 4B47A 2ASEA 1R0ZA 1T4GA 2WJGA 5EXSA 5FOTA 1E0KA 1IN6A 2JAQA 5FBVB 4F4IA 5EE9A 4MKGA 1WRBA 3TNFA 3O8BA 4Q9LA 2J7KA 4QHYA 4IVPA 2YV5A 3BIFA 4A82A 3E20A 1NN3A 4YAWA 1VYTA 2AK3A 2D74A 5TVKA 4TMWA 1QFJA 2XTMA 1NLYA 2IYZA 2WICA 1DG1G 1W44A 3AUXA 4TL8A 2F3TA 5FPSA 1H42A 3GJ6A 4HAWA 3CPEA 4C0JA 1MABA 3L0IB 4HLUA 5KPDA 1MO4A 1CIPA 3VKWA 1OW3B 5IK2D 1JB1A 3NBXX 4DVGA 2QTLA 4AYXA 5KYKA 5DSZA 4R9UC 2BJWA 2HCBA 1OFUX 2NO0A 3D6TB 1US8B 3PR1A 4GRAA 4D80A 2R6HA 3AGPA 1DAHA 1RJ9A 1K5DA 4Q1EA 4UXHA 3TBKA 5SZKB 4HSEA 1ZW6A 2V7QA 4JYBA 5C4MA 3KQNA 4A8JA 1PLJA 2YOGA 2BEJA 4FMBB 4DQKA 1Q86D 3SI7A 5F98A 3CKLA 3C5HA 4HUQA 1Z0FA 5AK0A 1XFAA 3GLIA 2EFDB 2YOFA 5JS7A 1ZIOA 1Z6YA 3AVQA 1VQ9B 4LJ6A 4MRVA 1FMLA 1CRQA 4M1KA 3V4RA 5CLQA 3K9LA 4D25A 5DN6D 3ZVNA 1JQLB 2QBYB 4AKEA 2WVJA 1W36D 1QHYA 1HEIA 1LF5A 3MJRA 2CHGA 3R7WA 1E63A 4Q1AA 4B3FX 5EP1A 1A2BA 4DRZA 3AVUA 2ZUDA 4KHZA 1WF3A 1XD8A 2I1VB 4PAMA 5JJKA 3CXCB 2F3RA 3FB4A 3QNUA 1DVRA 1Q1ZA 3W2GA 4H1VA 5E95A 3B1WA 3OE7A 2FSFA 2QMUA 1A82A 4DKXA 5JS8A 1KY2A 2C2HA 1VQMB 2J59A 4P4TA 2ZRAA 2I3BA 4DZZA 1BX0A 3U3OA 3ZS9A 3K0AA 3GFTA 4ACAA 1E2EA 1DAFA 4MRNA 4GOJA 4FN5A 1NMYA 2GETA 3VHLB 1RJ9B 3U3KA 1E64A 2V8OA 1OH8A 4EPWA 2P0EA 3LXXA 1OXUA 4RD4A 2CJWA 1U94A 2ZANA 3UK6A 3ZS8A 3TVTA 1SVMA 4EJSA 5C18A 2YKGA 1YJNB 2J0QA 2OCAA 1F2TA 5CITA 3W6NA 1JJ7A 3QXJA 2QNRA 1TL7C 4DCTA 3CW2A 2IUSA 5HKKA 4RY2A 4QL3A 5FOWA 1KSHA 4LBWA 4YMUA 4GT1A 4MYTA 4IFBA 1KI9A 5H8WA 4JL6A 3TQFA 3I32A 3RC3A 2ZPTX 4W7SA 2ZE5A 1BMFA 3VO1A 1ODFA 4Q1BA 5FR1A 1N8RD 4H1UA 2VHCA 3IGFA 3FHCB 3LQQA 1EP3B 1CR4A 3X1XA 4LHWA 2OLJA 4NCHA 3QQ5A 5EQTA 2QE7D 3A36A 2NO7A 5BN3A 2B92A 4HI0E 3VNUA 1XZPA 2V7QD 2AFIE 3I8SA 4D2IA 4FD2A 4KFSA 5FBQB 1E1QD 3NKVA 2O8DA 4GPTA 2ZJ8A 1W1WA 4PR0A 3W5VA 4W5JA 5KNDA 2PCLA 5FTKA 1ESMA 1FP7A 1TNDA 5JRJA 4KVAA 4QG7A 4DDTA 1MRNA 2QQEA 5IK2A 2A5JA 5HXBA 4ABYA 1C4OA 1R8QA 1SULA 1UBEA 8OHMA 2ORIA 1S9DA 4JLNA 4RJLA 1ZRHA 3A1VA 2PZEA 2UKDA 3VAAA 3KQHA 1W4RA 2ZJBA 3IEUA 3PUWA 1F48A 2CJWB 3SU8A 2PLRA 4B74A 2XNJA 3A4LA 4QJ3A 3AP3A 5HCNA 2BKEA 1KO5A 1Q7YD 1E2QA 1G4AE 1WP9A 3EZ7A 3QXXA 5EJEA 1YITB 1XD2B 1PJRA 1T9HA 1D2MA 4BGDA 5IRCD 3AKEA 3Q7PA 3I73A 3T1TA 4MA4A 1ESNA 3T1QA 2GXUA 4KO8A 3EX7C 2QEQA 3PQCA 3FKQA 3ETLA 3RS2A 1Q1BA 1V5WA 2MMCA 3LW7A 4A8JB 2W6IA 1E99A 4WVFA 1T3SA 2PJZA 4JVNA 4ZDWA 5LBIA 3GJXC 3RWMB 2ZM5A 4A15A 2HV8A 3SDZA 1MT0A 2G1KA 4LDJA 5KDDA 1NKSA 3GFPA 2JDIA 3BAFA 4LRWA 2WWWA 3T5DA 1OV4A 4TMVA 3N70A 4B3BA 2VQSA 1ZNXA 2JJ1A 3LX8A 5FBLB 2C5LA 121PA 4TTRA 2PBRA 3WHKA 2IYSA 3R7WB 2FPMA 3UMRA 4Z8XA 2P65A 3VR2A 4JZKA 2AXPA 1XB2A 2GZAA 4TLBA 3LBHA 2IYQA 2ZI6A 1R5OA 4R2HA 1G3UA 1ZM3A 4RD1A 1YZUA 2QSYA 4KFTA 1M8PA 2W6JD 3GLHE 3IIKA 4CRWB 4HUTA 3W8RA 4M1WA 4IDOA 2NPIA 5GVRA 1N6NA 1D5CA 4AIIA 4P6VF 1G8GA 4KSBA 4TTPA 4ARZA 1SHZA 4NBSA 1QG0A 1YZTA 2JA1A 3QY0A 4Q03A 3GJ3A 5CB6A 2A5FA 3B82A 2WIAA 1OJLA 3FMFA 4JLBA 3KL4A 4UNNA 4WXPA 1J2JA 3KQUA 5CM9C 4NL4H 4NYIQ 1GAQA 2ZROA 2BGJA 2FFAA 2IL1A 4Q9IA 821PA 4LYJA 1TLLA 4EJSB 5J4LA 1X86B 3DHWC 4Q4AB 3RRZA 1LFDB 1YZKA 2RGNA 5J4HA 1XZQA 2R2AA 2VH5R 2CE7A 1ONBA 1S3SA 3JQQA 2RGDA 3KXKA 3AF4A 2X2EA 3CZPA 1H8HA 3CCQB 5JWRA 1G41A 5FTJA 1NRJB 2XX3A 4KYUA 2KB0A 1KDOA 4DC9A 3OESA 1FNMA 1MH1A 1KMQA 4QBHA 2IWHA 2YINC 4YMWA 3HWSA 1ZM9A 1HT2E 2BV3A 3AVTA 1IOZA 3CR8A 2WOOA 1U98A 5CLLA 4KVGA 4LYHA 2CK3D 1II9A 3UANA 5KSZA 4UQOA 2ZUCA 3SQXA 1Z0IA 4G5OA 1XXHE 4PPQA 1TADA 4B3XA 2FZ4A 4IDHA 4OBEA 5JCPA 1W0JA 1P61B 5KNBA 4J0QA 4TSFD 1DEKA 3AGQA 5P21A 4BQSA 3THOA 2QMEA 3TRFA 4KODA 5DO9A 1QGZA 4F4CA 3GLGB 1TQDA 1IXZA 1OLOA 4P0TA 2FX3A 1XEFA 1GWNA 4D4JA 4EPVA 3H1TA 3KKMA 4MRRA 4NH0A 4ACBA 1KDRA 1KIMA 2ZAOA 3L0OA 1GNQA 3CF6R 3R9WA 2DERA 1V43A 3CH4B 4L16A 3CRRA 3KKQA 1XD2A 1GKIA 2IUTA 2NIPA 3VX3A 1QFYA 4QC2A 5D3MA 4DSTA 1EK0A 1XWIA 4C0AC 4LK2A 1SQ5A 3GLGE 3CZQA 1OPXA 1EFRA 4WOPA 1N6RA 2GK7A 4QOSA 2PIAA 1OFTA 3OE7D 2HMAA 4HYYA 4DCSA 3KJIA 1R2QA 2VTKA 3I62A 1BOFA 3GJ7A 2YVUA 3QXSA 2OG2A 3F0TA 4ZCLA 5DISB 1YR8A 4B3DA 2C03A 3ZZUA 3IDQA 1PZNA 1DTSA 2VYQA 2HLDD 5JLJA 2EFGA 2JEOA 2ONKA 3WMGA 1NVVR 5LDDC 2A30A 4TLDA 1RPZA 1ZNZA 3C16C 1VPLA 2RHDA 1OH5A 2J46A 3QENA 1UKEA 3AVWA 3BFVA 4JS0A 1FPMA 4UKDA 2DEUA 3VR3A 2J3EA 5JFGA 1QHNA 2Q21A 1OXVA 1E3MA 3H86A 1SZPA 4BLPA 1UBGA 5J4YA 1XJCA 3M6AA 5CIWA 5EUQB 1NN5A 1L4YA 2O8FB 1F6BA 2LCFA 1GKYA 2D3WA 1SVOA 2ZRDA 3OAAA 3D7MA 1QHHB 1NMZA 4YAUA 4JVLA 5HCIA 1KRHA 1TQ6A 4KFRA 1OIXA 5FTMA 3RRMA 1COWD 1P75A 2DYKA 2BBWA 3FKSA 3LH5A 5DI3A 4ZKEA 3U3MA 2NG1A 1GG2A 1Y63A 2NO1A 3LLUA 3GEIA 5L8VA 2NQ2C 2ZRKA 2GCPA 3VR5A 4US2R 1QHSA 4HATA 1UF9A 1VHTA 1RRGA 5DLQC 4FK8A 1CKEA 1CP2A 2BEKA 2PCJA 4CZ2A 1FUUA 1KO1A 4P3YA 1RW4A 2QMOA 1K5GA 5HKKD 2YWEA 4Q9KA 2PX0A 4ZIRA 4NYMQ 1J8YF 2RGAA 1OXSC 4XWKA 4YMVA 5FA6A 3SJBA 5L3SB 4ESVA 2ONJA 4BLSA 4IHQA 4B2IA 4D4MA 3TAUA 2ORVA 3AUYA 1T91A 1N0UA 4LWZA 4BFZA 1MABB 3PITA 1F60A 1RC8A 3GLIE 4AURA 3LNCA 2ZVPX 3F5FA 2I1QA 5KDLA 1QGYA 3BS4A 2Q9AA 1SKYB 1AK2A 2H7VA 3TUZC 2D4HA 1QHGA 2KE5A 3BOSA 2YOHA 1KI2A 4N0EA 2A78A 2JLSA 1M6NA 1W2GA 4EKDA 1QH0A 4P32A 2CVHA 2CCKA 1NVVQ 4G0NA 5CK5A 2CNDA 2C96A 2GXQA 3SE0A 1NMXA 2F1HA 4LJ8A 1VQOB 2W83A 3NC1C 3GLIB 3IEVA 2VP4A 4HLCA 1VIYA 2ZAMA 4IEEA 3SYLA 1OFIA 4DHEA 1DPFA 4Z1MD 2H5EA 3EW9A 1TMKA 1NNEA 3NHBA 4PC1A 2F1IA 4DLZA 3CPHA 5DN6A 5BN5A 3RWOA 3TR5A 1TU3A 4NCKA 3MMPA 1QG2A 2ZRLA 4K46A 2QTZA 5H70A 4ZIRB 2RB4A 1NN1A 3RANA 2K5UA 3FMIA 3TMKA 1OFHA 2ZRCA 4RSGA 4DLTA 1G19A 2ZSDA 4OK3A 2DFNA 3KB2A 4YALA 3KJGA 4DLVA 2Q3MA 4IKEA 4N0DA 3NTUA 4JBWA 1C1YA 3PUXA 2ZRJA 4W9MC 3RABA 3CMAB 1EFCA 1NG9A 2P3SA 3IILA 4PC6A 3SJAA 1SXJA 2C8VA 2HXSA 1XPUA 4ZGNB 1JEEA 3ZIAD 1G16A 1N6HA 3L0PA 2GJ9A 1A2KC 2ZREA 1T6NA 3C8UA 4HLQB 5FI0B 3EWAA 4EQ6A 2QMHA 1CJVC 1Z0AA 3TUJC 5LD2C 1RYFA 2AWOA 2IXFA 2A9KA 3E5HA 2ZRPA 3KX2A 1ZIPA 3H84A 5DI9A 2KJQA 5G40A 2WJYA 3JVVA 4PSVA 2HDNB 1DELA 4YDSA 4QBGB 4CDGA 1W49A 2ATXA 2PT5A 5C2JB 1W36B 2VNIA 2VLIA 4CT4B 2JLZA 2BGIA 2CCJA 1I4LD 1GSIA 4BASA 4URWR 3B7GA 4CIDA 4UJ3A 1Q21A 2FOLA 4Q48A 4OI4A 4ZI2A 4MGZR 4GFDA 2NZJA 3Q5DA 1ANKA 4GMDA 2QROA 3NEJA 3B85A 3ZQJA 1K8RA 3K70D 3ONWA 1GDDA 1P9RA 3CIOA 1WB9A 2R6GA 3FE2A 3K9GA 4HAXA 1ZM7A 2CL0X 2FFBA 2O8DB 3A58B 3RS3A 2DETA 2YHSA 5JJIA 4TQ9A 4ZGQB 1I2MA 2AHOA 1ZD8A 3CCUB 1SKQA 3OEHD 2IF2A 4QJ5A 1JPNA 3NG1A 4AY2A 3BWDD 2FG5A 2IXGA 2HEIA 5J40A 5EXTA 4GDFA 4C43A 2BM1A 1J70A 4X8MA 3CM0A 5F2EA 1DDIA 1E4YA 2XZPA 1KMHB 3UKDA 4C30A 3K0CA 4TL6A 1R0XA 1LS6A 2BSAA 2ZE8A 3MJHA 3H0KA 1NF3A 2RGEA 1KK2A 1GRNA 1MO5A 1EWYA 3ZVMA 1DADA 2VSOA 4B2PA 4Z54A 3GLHB 1XEXB 2FGJA 2BDTA 4LJ4A 3TSWA 2CL7X 5E3HA 3K09C 1RVDA 1P2UA 3DDCA 4NCJA 2AKAB 1KI4A 2G6BA 2G0TA 2P5TB 3I56B 4U00A 3EIHA 2CL6X 4A0GA 2CRVA 4DIDA 3KUDA 5CM8B 1N6IA 4G1UC 5GADl 2EFCB 3IUYA 1OKKA 2HUPA 4P4SB 3IQWA 1Z47A 2ZXUA 4N3GA 3WYAA 2FDCA 4MITA 2EW1A 3WMEA 2KSQA 1AZSC 5B30A 4GL2A 1N0WA 3ZQ6A 1FX0A 2BBTA 1AS0A 3KJEA 5G41A 1BJKA 2RC5A 4Q18A 2O0JA 3OZWA 2Q3FA 3DKVA 4PHTA 3T35A 3G71B 3MHPA 3FJOA 1XBTA 3BBPA 5AJVB 2ZRMA 2ZJYA 3WRXC 4EFNA 3GD7A 2OM2A 1WE2A 4F91B 2IYXA 4B44A 1S1CA 2O5VA 4C2TA 5EUMA 1TVCA 5FL3A 2P2LA 2WWYA 4MDEA 1FNDA 2F43B 3LBNA 2F6RA 1E2IA 2XTZA 3CWZA 3EXAA 2GAOA 1XMSA 2ZRIA 721PA 4NDZA 2WSSA 2ZUBA 1GZSA 4Q19A 4DDUA 4CEHA 1G7RA 4BFYA 3PV0A 4UJ5A 1HURA 2VA8A 3OHMA 4GBMA 3QEOA 3W2FA 4AF6A 1XTQA 2VP9A 5B57C 4ZDIA 3FPKA 2W2XA 2BMDA 3KXLA 3ZBUA 2JLRA 4IXMA 2GF9A 1YZLA 4QGGA 3D31A 4DDWA 4QFMA 3TR0A 1LTQA 3ICEA 3OJXA 4A92A 1D1NA 2CDNA 4ZKDA 4HAVA 4XOIA 3ZJYA 3RRYA 2J7PA 1FX0B 2FZLA 4AKIA 4AKGA 1QGAA 3THYA 3Q5EA 4W5WA 1VQLB 1SXJB 4KV9A 2D7CA 2G9NA 4Q01A 4OK5A 3HU3A 1LF0A 2ECKA 4HAZA 1YR6A 3B78A 1JR3D 2OE2A 2KWIA 1XXHA 3QF7A 4PO9A 4YXWA 3TIFA 4LV5B 3K9NA 3SQWA 4V03A 1A4RA 4MRPA 1G3MA 2OCPA 3ZDQA 2QTFA 2EVWX 3QF4A 3ADCA 4V0OA 3GLGA 1ZMXA 4PFSA 4Z51A 3VTKA 1JALA 4RCYA 3E1SA 4YAOA 3K0EA 2F55A 3BH0A 4B35A 4BZXA 3EZ6A 4HDQB 2OZEA 3OW2B 4FMDF 4Q66C 1NIPA 1IM2A 1E9DA 5AUPB 5L3QB 2VHQA 3AVOA 3R20A 1IXRC 1G8YA 3W2EA 4B4DA 1G291 1KO8A 5DHFA 4ASUA 2FA9A 1G5RA 1E9FA 1P62B 4JLVA 5GJCA 1ZC4A 1U0HC 1G5PA 4Y7CA 3AVPA 2ZRNA 1VQNB 4WW0A 2QN6A 5FUVA 5TARA 4JBXA 5UKDA 3IQXA 3T12A 4EPXA 5FUYA 4CEJA 2VP0A 1M7HA 2A5DA 4D0LB 5JSZB 1E79A 3SEAA 1VQPB 3P26A 2VF7A 2GCNA 3QXCA 4PO8A 2AN9A 4QBFA 2ZS7A 3AB3A 2ZU0C 3OFND 5LB4A 4F92B 5J4VA 2REXB 1Q20A 2V1UA 4DCVA 4AD8A 4Q7JB 1S8FA 3FFAA 3KFXA 3PFIA 1LNZA 2VSXA 1XNJA 1NSFA 2WWXA 4NTZA 1KK3A 1E9RA 4DSOA 2OBNA 1PUJA 2BHRA 1DAMA 1CU1A 1CTQA 1H8ED 2C9CA 4PO1A 1H65A 3OFNA 4I4LA 3W34A 2HYDA 4JLPA 1R10A 3CH5A 1YJ9B 5ELXA 3AEZA 4LBYA 2UVQA 3K0FA 4Y9RA 2WJVA 3A6PC 1RFLA 5LB2A 4C9BA 3B6EA 1KDTA 1E2MA 1X8LA 2O8CA 1VQ6B 3AKYA 4EPRA 3GEEA 3EWSA 3RS4A 2RMKA 3CNOA 2J0UA 3MWKA 3RAPR 4XWOA 2FWRA 1U99A 4ASUD 3TAHA 5JSZA 2B7CA 3BORA 1W2BB 1E2PA 1E69A 3C7KA 3EA0A 4JT2A 3B5JA 3K0AB 4PTLA 3U6BA 3THXA 2XGJA 3OAAD 4IEIA 4MYCA 3WBKA 2OBMA 3JVUA 1G7SA 3OEEA 1UM8A 1HA3A 5GVSA 1VKJA 2F7SA 2BMJA 2J9RA 3BFKA 5H68A 4C0KA 5L3SA 4RD6A 2IYUA 4UNSA 3ZYCA 1JQJC 1U90A 2O0KA 3LFUA 1E9BA 3W2IA 1VG8A 1GO2A 3QFRA 5K8IA 4QXAA 5CYOA 2X77A 1M34E 5CDFE 3GJ4A 2WWIA 4XWAA 2RH5A 3K53A 4LHYA 3R8CA 5GV7A 3BERA 3OF5A 4QHTA 1OSNA 4Z1MA 3Q9LA 4CEIA 2BKUA 3K70B 2BJVA 2N1BA 2FV8A 3K09A 1E0JA 1KI3A 1SVLA 2VPPA 3ZD6A 2OTJB 3DVLA 4DSUA 4M21A 1NJID 2J7PD 1D9XA 3TSOA 4V0KA 4DB4A 4JKIA 4Q4HB 1QVFB 2GCOA 4MH0R 4RZXA 1SXJC 5FL7A 3FYHA 5CJPA 2B8TA 4I1UA 4IDQA 1E96A 1AMOA 1GNPA 1QVAA 1S96A 4B76A 1WBBA 1Z5ZA 2VSFA 3FGNA 2PT7A 2O52A 2IS4A 1QHXA 4DCUA 2V9PA 4R71A 1CR2A 1II8B 2ZE6A 1CQXA 3J81k 1R0WA 1TEVA 3KZ1E 3QKTA 2WTUA 1KAOA 2HJVA 1E2LA 2GEUA 3PVSA 4KBFA 4C7OB 1QRAA 5H1YA 3V9PA 1BKDR 1FRNA 4E5UA 2ZR0A 1ZUNB 4JJKA 4Q1FA 3UG6A 3OJWA 3OZVA 4IVQA 5SZIA 3U3RA 4MKIA 4Y0AA 5AR1A 1J90A 3C15C 3SS8A 3BXZA 4CEJB 1I4DD 3X1DA 1R6BX 4PHHA 4BRUA 2X2FA 3C41J 3ZLJA 4OL0A 2DR3A 1PLKA 2GZDA 2VP5A 2OCYC 1QVGB 2CHVA 2IBMA 3X1WA 1TF5A 2WZQA 3BH6A 3QPUA 4FCTA 2GDJA 2D2EA 1OGJA 2ZI3A 3AF1A 1F2UA 3DPUA 4TMXA 1S4QA 3FKSD 4AYWA 2NTYC 3VKGA 4HLUC 2ZJZA 1T0JB 3EASA 5B2ZA 3L82B 4EIWA 2DBYA 1EX6A 4NE2A 4Q4HA 3QFTA 1NSTA 3IO5A 5TDHA 5EMNA 4OHZA 5E7MA 1OKKD 3DL0A 3B1YA 1W48A 4QM7A 3SFVA 1KJYA 3F3YA 3FWYA 3CRMA 3CCSB 2R6AA 3DZDA 4JLDA 2QL6A 4YAFA 3C14C 3PCRB 3V00A 3UWKA 3CF0A 1OYYA 1UKZA 4WIAA 3RS7A 3DM9B 3P4XA 3CO5A 1HE8B 4DLUA 4RFSB 3H2YA 1G17A 2OFOA 5AJWA 3W2HA 1P9WA 5KSWB 4DSNA 4TN1A 5CIQA 2VF8A 3C5CA 5HPYB 2HLDA 3WBJA 2IYYA 5FUWA 1E9SA 1KQSB 1VQ5B 4WZBE 1N6KA 3AKCA 2ZSBA 1UBCA 1CJMA 2UZ3A 3BH7A 3K8YA 3TE6A 2O8EB 1G8FA 3I5YA 3OIVA 4LJ9A 2IWRA 3VFDA 4TQUS 4F38A 2GXAA 1F20A 3B2EA 1EFRD 3VU9B 1XMVA 2DCUA 1YRAA 3P4YA 4GOXA 4EPYA 4EFLA 2CLDX 2ZQ5A 5IHPA 2R62A 1O3YA 2PZGA 4IOLA 4HUQB 5AJZA 5FH9A 2F9MA 1JJVA 4I1VA 4G01B 4L9SA 5HZHA 2XJ9A 1ZM2A 3O8DA 3U5ZB 4US0R 3OZXA 1IJEA 3G82C 3CNLA 4BLTA 3LDAA 1GJRA 1VIAA 2IF0A 1HUQA 2ZTSA 4Q4JB 2GRJA 1UDWA 4TLCA 3W5UA 4Q9JA 1S0UA 3NDPA 2GK6A 1CBUA 3HU2A 3AV0B 2CK3A 1R5NA 4JIMA 3AVXA 1E9AA 2GJAA 2Z6VA 4BFUA 1FNBA 2AKYA 2AL7A 3A1UA 3LD9A 4U7DA 4IOJA 4A0FA 3IPYA 1DAKA 1W46A 1PVOA 1HT1E 5DYIA 1MKYA 1OF1A 1M7BA 2QP4A 4F7DA 1Z6AA 2QPTA 4P4SA 5FOUA 2DB3A 1QUFA 1II0A 3QIAA 3GLFE 1H8HD 1NJFA 4LHVA 5JZVA 2A5YB 1AS2A 2AXNA 1KDPA 5C1BA 2VZLA 1L8QA 3FHTA 2A5GA 1VYVA 3IBYA 1NBMA 1AA9A 2NO9A 1F2TB 2LKDA 1GILA 1G6OA 2WAXA 4JLKA 1E2KA 1HTWA 4LPKA 4DCNA 4LYAA 2D7DA 4YDHB 4M1TA 4UAJA 1SVIA 1G3RA 1EWRA 4FI3C 1E1QA 1J99A 2GCOB 4WZAE 1JECA 2QT0A 2VBCA 3JZMA 2GILA 1RYHA 1W4CA 3UMSA 1F2UB 3U7HB 2BMWA 1BO6A 3MUFA 3CCMB 3IIMA 1TAGA 1UBFA 1BMFD 221PA 1OYWA 2CLCX 1N6OA 4DLXA 4A4DA 3NDBB 2H8KA 3FPAA 5E4FA 3FOZA 4B43A 1KTVA 3BRWD 2ERXA 3K1JA 4MRSA 4BFTA 2DY1A 4QKQA 2JCSA 2JASA 2OBLA 2ERYA 2WM9B
chains in the Genus database with same CATH superfamily
2REQB 3Q2OA 4TM8A 4JB2A 2LDBA 2AOXA 1ENPA 2J5KA 2J33A 3W78A 2BEUA 2ZZMA 3ROQA 7AT1A 1GDTA 4WTOA 5JJCA 4W63A 3VYWA 3OU2A 3LS2A 3M82A 2OGUA 2P4SA 2CLLB 4RMHA 3UJPA 2PVCA 5SZHB 3U4QA 4E70A 4L3VA 1USKA 1UBNA 2Y3IA 4I7EA 1N25A 4IMJB 4RABA 3OZIA 2ATEA 1NVFA 1KORA 3DP7A 4WJKB 1G8SA 4MW2A 4LZJA 3CVYA 4GGMX 5AK3A 3OKFA 1JQBA 1YZVA 1J00A 3M0EA 4UD6A 5JJ5A 5KWSA 2J4FA 1TAUA 1P19A 2AW5A 2KPOA 3OVMA 2Z8YM 5JAPA 3ZJTA 1Z5PA 1WTAA 3PPVA 1Q2UA 3T9DA 5JI2E 4NBLA 1RAHA 1B3RA 2D0DA 3S7ZA 1GU7A 4F5ZA 5J3JA 2REOA 3NYWA 4RFVA 1V41E 3D7LA 5MN4A 2E1PA 2OSVA 1H1TA 1ELOA 3WRYC 3PUVA 1RPNA 1VI6A 4GE0A 3WYFA 2VJOA 2BVNA 4L28A 4XIGS 3T3OA 2X7JA 1P73A 1NZDA 4XUEA 1XZKA 1V1RA 3FOEC 1OH6A 5LNK1 1VDZA 4EGSA 1GRRA 2D2XA 2IPNA 2Z6BD 4NCNA 1PZEA 2QGFA 1U5AA 3ENZA 3CCVB 3K16A 3MT7A 4JXKA 2JRCA 4GPZA 1OVMA 2PLAA 1JDJA 1MPTA 2R25B 3FBGA 3MA0A 1MGPA 1X1TA 3OHSX 4LY6A 5IC6A 1D6MA 1R4MB 1XTKA 4ZV9A 5DRTA 4TV8F 3JATA 3ZHZA 3DTVB 1MX1A 2OBFA 4JMQA 2L69A 2BH9A 3HFSA 3NM5A 3OURA 1WCXA 4WLUA 4FMDB 2YUTA 4EJ6A 4F5EA 3THWA 3ONYA 3IOBA 4AY3A 5EEGA 2A0FA 1F0KA 3OQ6A 2X8KA 3JAKB 4ALIA 5C8YA 1F3LA 4HN9A 5H3CA 4HNAA 1YDFA 1H2WA 1XLVA 3RLFA 1XZMA 2IBTA 3UOAB 1SOVA 3Q40A 5IUNC 2XBUA 1HG0A 2ODQA 1RBQA 3K35A 1GIAA 4UHFA 1ZU4A 2HWUA 4KIFA 5JD3A 4RH3A 2WSBA 3EIQA 1PCXA 2EATA 1CQJA 2V45A 1GVNB 3KL9A 3AXTA 1AQUA 2DJ5A 4BGVA 1H85A 3DOHA 4LGMA 1YVUA 1ZH6A 4U02A 2R44A 3AYXB 5C80A 2JJYA 2AA3A 2DQKA 4G6ZA 1VLVA 4X41A 1PLLA 5COAA 3A25A 4KW7A 3U26A 2F4VB 2HHJA 5IJ0A 1MB0A 3O4IA 4GKJB 1M2VA 1TIBA 2I4IA 2IA5A 2JD0A 5BMOA 1JJIA 1FMCA 1SUFA 3LFHA 4GLFA 5JQGF 1IXYA 1UFKA 2JH8A 5AI6A 4G84A 2VPIA 1B73A 1YBFA 4FBLA 5SV2A 2HY7A 4IP0A 4YQYA 5HF8A 4CKWB 4EHJA 1G9SA 5TRDA 1D04A 2I7TA 3L4JA 1M34A 2WRZA 4FFLA 4FT4A 4BEVA 4EUNA 3GJQA 2QA5A 3S70A 3C85A 3N8KA 2HYIC 1HE4A 1JQKA 2PVPA 3EXEB 3L4BA 1EVZA 1KAHA 2BFDB 3PIDA 4WY5A 3PHCA 1SHUX 2NVBA 3FUXA 1K08A 1KO4A 2EP5A 4L2IB 4JDUA 3O8OB 3V1UA 1J4AA 1U65A 4NONA 5DLYA 3TOSA 3UK2A 3E82A 3DOEA 5AW5A 3WB1A 1MENA 2ZTGA 3OCVA 5ALIA 3WKCA 2HHCA 2VHXA 3CLVA 3O26A 1DEHA 4E22A 2OC4A 3OSZA 4TMZA 2PLFA 4DTIA 4UNRA 3MGBA 1FFBA 3L4EA 3S1AB 3Q8MA 3BWEA 4P3NA 1XF9A 4JEIA 3FNIA 2OQIA 5ERGB 1Y3BE 1C8KA 1FDTA 4QPPA 4XM2A 2YRFA 2I91A 2EW8A 3AW9A 4R5MA 1E92A 1GQSA 1ML3A 3D0OA 3LYAA 4QGHA 2YIVX 5EE1A 5IYZB 4MQMA 3P20A 4PPGA 5NULA 3AF0A 5TMEA 1O5IA 2MR6A 4J1TC 3I55B 1Q84A 2PUEA 1QC5A 1E7WA 1POXA 3CNEA 4ZZ1A 1JI0A 1RHJA 2O0LA 1Q83A 2XB8A 1BE1A 3C3WA 5CXSA 3X3HA 1XFDA 1AKRA 4MLZA 1U0SY 4QPZA 5K51A 3CPJB 1Q1QA 2DP4E 4KR3A 4NP6A 2FE4A 2GBPA 4F4JA 2CLMB 4FKMA 1LLQA 4B33A 3HM9A 3HR8A 4PWZA 2E55A 5F7JA 4DV6B 3HYNA 4FDMA 2OT3B 4ZZ2A 3L8HA 1BH2A 4OHCA 3U9TA 1IU9A 1ENOA 1IQPA 1BYIA 1TT5A 3G5UA 5GY7A 1JLMA 3CVXA 2RBGA 3W7BA 5IKMA 4BGEA 4AC9A 3MLEA 2GZHA 3EGDA 4EY3A 2YWFA 5FOSA 2VP2A 2WJJA 4F9EA 5BVGB 5HFJA 4DR3B 5FQOA 2OBBA 5BO5A 4DDKA 3IEIA 3HKEA 3RSLA 1HEUA 2AWNA 4D82A 2H1VA 5J63A 3LPDA 3UMBA 1IBMB 3BTOA 3KUCA 3SZ3A 1KYYA 2QTVB 5EZYB 1D8AA 3SJZA 1TIKA 3ZE0B 1SKMA 5KWJA 3I28A 4D92A 2EBHX 1EHYA 5D3KA 4E46A 3GT7A 1J56A 4RH0A 2QPOA 5FP0A 5A9SB 2VTBB 3GV0A 3ANYB 3JAKA 4R1QA 4XTRA 4PRLA 2GVZC 3HU1A 1BRTA 3JQ7A 3KYCB 4O2BB 5ALTA 1QUEA 3WL5A 1YJCA 2B4QA 1MX9A 4H6VA 4X85A 2AOUB 4V2UA 3EYWA 3WS7A 5JAUA 2B20A 3ZOKA 2V6IA 1H93A 1NXSA 1QVWA 1Z07A 3I6IA 3MD0A 3MGAA 1AY0A 2BM8A 4IJUA 4INJA 3LHFA 3DZBA 4R1PA 4AZ0B 3IQZA 4DCGA 1W59A 2IEIA 4ERXA 4K9PA 4QNMA 4MVJD 2KLHA 2QP3A 3DMPA 3I9FA 3VDMA 1UWVA 1OFGA 5CDUA 4XIIA 4TV9B 5DCWA 2ZULA 4G25A 1U0JA 2DQYA 3I9OA 4L02A 5C8DA 1DXYA 2ZJAA 4H27A 4AECA 3ZGLA 4UTOA 3L0BA 3TJRA 4CLDA 5EQJB 4AJ9A 2PPLA 4BVEA 1HYQA 1QG4A 3LQEA 1DEXA 1RQLA 3MAAC 5DHPA 2WT8A 1HDIA 2P9GA 3RYIB 1QCDA 3SF8B 4O4LB 2VLBA 2CJXA 2X0DA 1TFUA 4OPOA 4Q9AA 3U62A 2NU6A 4GMXA 3GEDA 5J2TB 1ECBA 2I4TA 2ILTA 2IXDA 4MVWA 4RHXA 5GGYA 5C1PA 3ZHSA 1NBEA 3H42B 2E18A 4LOHA 3KS9A 3CRW1 3NH9A 4GZMA 2W2QA 4G0MA 4U5XA 2WIBA 3LRPA 3O4JA 3PDUA 2OD7A 1FXWA 3PUMA 1BHSA 1BIFA 4KSYA 1R6AA 3MXTA 4B3GA 2XSZD 4HB0A 4X6UA 5FO1A 4X94A 5DBGA 3E9RA 4D0RA 4FR5A 3LC2O 4PPYA 1L5VA 1ZJJA 3GT4A 5FKJA 2HNKA 4NK4A 3JYNA 4Y2UA 5KKAA 3GR6A 1GU1A 5GM1A 5BR8B 4R9SA 1Y0YA 3TLMA 1AKTA 5I7WA 4XCQA 3BC1A 2O6HA 1NBMD 3T15A 2DECA 3F6SA 1CUVA 4LYFA 4MV1A 4FDVA 1RVV1 4CM6A 2Y68A 2BE9A 4R54A 2YV1A 1Q6YA 4F12A 2WA1A 4TKMA 3FH0A 4DVJA 5DNAA 1D0SA 5H83A 4IO0A 5EXEA 2RFLA 4OKSA 4CV3A 4HDNB 4W5OA 4DNFA 2GBIA 1BE6A 2IYWA 3B6MA 4BWGA 2GO7A 3R0XA 4GYJA 3V1MA 1I2BA 3CNNA 1GVHA 3UXMA 3X2FA 2QZSA 2DTDA 3N28A 4X00A 2H57A 5FV4A 3L7DA 2Y66A 2W6JA 1R00A 3NEYA 3UT0A 2OAEA 2DTXA 1AN0A 1V0JA 3W5HA 2AOTA 2F64A 3H83A 3EXFA 3IPXA 4H1WA 1Q17A 1V95A 2CXRA 5ANRB 3RQSA 3STTA 4WADA 4TSKA 5AKEA 3JQBC 2VXBA 3EVBA 4I3GA 4BV8A 5LJLA 3H2JA 3ZW8A 3I2JA 1X92A 1WUJS 2ZB3A 2SKEA 1RJGA 3SYMA 2W22A 4KN5A 1TU0A 2VTDA 4N7MA 1RE0A 1SOAA 4B45A 2O7VA 4IJ6A 4BFWA 1GTRA 4Z4EA 4C5CA 4D9NA 3A1FA 1DCKA 4HEA1 3Q3AA 3AG6A 5IASA 2KBFA 4M0PA 4WCFA 5JC1A 1Z5VA 5AXDA 5BOSA 3INGA 1TC1A 3JQ8A 2BPOA 1Z3IX 3B1VA 1SCJA 3HSSA 5B3JC 2OHFA 4PNHA 4KE8A 5CT4A 5A4JA 2FR8C 3Q2IA 2AQIA 3O0DA 2X3YA 3U7FB 2Z09A 2J1LA 3T41A 3VOBA 4JLSA 4YLGA 1G21A 1NUPA 4OF4A 3GEHA 4IMIB 3WIUA 1UP6A 3NLLA 2A59A 4A8HA 1G60A 2OXCA 2Q8QA 1FSZA 1HE2A 1Q1EA 4Z4HA 1AQJA 4WQMA 2AD5A 3N2IA 4E3ZA 1Z4QA 2YMPA 3G6KA 3G85A 3OZAA 4WJLA 2F8LA 3P9RA 4MJ3A 3QBVA 1KQPA 1MXHA 1P2SA 3L01A 2B6HA 1XK6A 2GJ8A 1SXHA 3A4TA 1FFWA 2YN4A 4X95A 3RASA 3BTUA 1K1EA 1XCBA 1N8KA 4RF3A 5KTOA 2ZZNA 1SU7A 2HSWA 1JL3A 4JLAA 5ESRA 1LKZA 3KDAA 3UMGA 1X1RA 1XVUA 4GM0A 2BF4A 5EHGA 1DZIA 3USCS 3MWEA 5JCOA 3VV2A 4EDFA 4ZYVA 3FMPB 4EYEA 4HOYA 2ZZKA 3I92A 3DV0A 4MUYA 3IDSA 1XDWA 4JLUA 1G20E 3LUDA 4XIFA 4B9EA 3CVVA 1L4GA 1YZGA 3AEQA 1DEOA 3WRXA 1Z4OA 2I6QA 4DNRB 1Z88A 1WUHS 2FSHA 4DK0A 5EIFA 3RG8A 3A3NA 3U4QB 1FP6A 5IYWA 2IIPA 3HDTA 3JZAA 3OA2A 4DPKA 3I01M 4MQ6A 4NARA 4KFCA 3G17A 5E6TA 5EJMA 4JELA 3B13B 3QG1A 1L7XA 2B34A 2VXYA 3NATA 5BN3A 3ZQ4A 1WXFA 2SHKA 3W8FA 4BNXA 1CUCA 3F7TA 3TSAA 3G9XA 2I2BA 4W9NC 5AK4A 1UDBA 1X7WA 3FDZA 2WJ6A 1VQ8B 5CCBA 2ZQZA 4K7JA 4WLNA 5KSPA 3VSBA 1LRKA 2HA7A 3CONA 5DM60 2VJQA 3JARA 3JQ9C 2F1RA 4HDAA 2CMDA 2BUCA 4HRVA 3UHOA 5BV2P 4U9HS 4E14A 2XLCA 2XIJA 2ZXHA 3CC2B 1ZNWA 1Y37A 2IX9A 3WG9A 4CTJA 2CFTA 3QG5A 1PU2A 2BZ1A 2EYQA 4XWTA 3V34A 5AQEA 3QFSA 1TM2A 1Z82A 4LJRA 2W2VA 3F67A 1HNNA 5AUOB 4C7MA 4BO1A 1J0AA 2ZK7A 3HR7A 3T51B 3P9NA 3GPIA 4LXUA 5DE3A 2P9BA 4TX1A 4GD3Q 5JTTA 3RVKA 2Q6IA 1Z4LA 3ZKWB 1W30A 2SKCA 4CTNA 4DNXA 3SC2B 3TB6A 4EB6B 3Q88A 5TEWA 1D3AA 3DKRA 4ZYUA 2J9ZB 5TX7A 2JLUA 2ZU6A 4M0CA 1I36A 4OQZA 3GT0A 1AD2A 4CG2A 5F21A 2FSUA 4GSYA 4J43A 4JSTA 2O2GA 4DSZA 1HK7A 2ZT8A 4F2HA 1W0KD 4AMUA 5H4GA 4LK3A 2P5YA 1KSGA 2C2KA 4DR7B 1N6LA 3U19A 3HVIA 1J42A 4KO3S 5BT9A 1VMEA 5H02A 2V5UA 2ZSUA 3HVUA 3TBFA 3U09A 4GP9A 3FR7A 2FR8A 4AL4A 1UJBA 3MHTA 1GDHA 2WAAA 2G71A 2QUKA 5C9ZA 3TBHA 3LVBA 3RS5A 4ZAVA 1ESCA 1XZHA 3JD4A 5FIUA 3L79A 4WCFC 5ESXA 4X1YA 1OXXK 1II8A 2B4RO 4ITRC 4RMJA 3UXEA 3OZFA 5IX8A 1MJHA 4CMAA 3U31A 1EA7A 1NXTA 4FMCF 2H4ZA 2VBIA 3JRXA 1YQUA 3U3JA 1Y1TA 3H4MA 3PQFA 3EZYA 4EUKA 2CXPA 3A1TA 4AP5A 2OWEA 3CGWA 2Y0EA 2GKGA 1YJQA 1XGKA 4FDUA 5B55A 4MHTA 5A7FA 2BN4A 3L1IA 1ABEA 4V0LA 1ADYA 1JP7A 3AM1A 3IP7A 2XMDA 2G5PA 4BNUA 1IN4A 1BD4A 2I1WA 4FCVA 5IT4A 4R2JA 3SSNA 3IUBA 1GPJA 2C5GA 3HO8A 1UWKA 5FFFA 3ZHVA 3H1FA 2J9YB 2C5AA 2QUZA 2ZDHA 4MI1A 4ZI5A 2G8NA 4ZDJA 3AEXA 3MTIA 2A2ZA 2OSBA 4N0QA 4V3CA 3SX4A 1GLVA 3O73A 3VOSA 1ZOSA 2XVZA 3IULA 3ROGA 1SUWA 1EAMA 1UJMA 3SDSA 2XEXA 4QXOA 1NBAA 3IMEA 3PGMA 4FZ5A 1YE3A 3CR7A 2ZI7A 2WMDA 2PH5A 3ID6C 1FA9A 3PC6A 3WC4A 3KHSA 4M1SA 4P2NA 4DEXA 5AVWA 1CZRA 3ZKAA 2FZWA 4ZXFA 2YC2C 3W8DA 3DBHA 4Z7JA 1UBTS 3PUYA 4XQ9A 4J7UA 5LIRA 4MOWA 2ODWA 5EWJA 3MQ2A 1FUKA 2GLUA 3L8ZA 1L7VC 2PKYX 4BVFA 3BNWA 1K7CA 2C42A 2I4OA 4WPGA 4OM8A 2H2GA 4KTTE 3RUPA 5BSHA 1WZ2A 4TTAA 5U4XA 1BAPA 4A2WA 3WK6A 4DV2B 3BJEA 4HRYA 4C0LA 3ZWKA 3QTTA 1T0BA 5BSVA 3A2MA 4U2DA 2Q6TA 4BO7A 6ADHA 4I3HA 3GPBA 5EJFA 5A88A 1L3IA 2GPBA 4XRGA 4Y8VA 3DDOA 1Q95A 4MVJF 4PG4A 3ZGOA 4W7IA 4ESHA 3U7QB 2Q7XA 3WX0A 4JWTA 3PJRA 2O8EA 4NBNA 2IV2X 1Y8QA 3FWZA 3JZFA 3NUGA 3DEZA 4ZI7B 2Q4DA 2ZS9A 1B7GO 5CB4B 1FE8A 1H5UA 1IBKB 4EI7A 3L2OB 4LJAA 4C3UA 1KU0A 1OLXB 2VL7A 5DNDA 1X80B 1G64A 5EPOA 3RW9A 4HQ0A 4IOMA 4O2LA 3IUMA 3VV3A 5BQFA 1ZCBA 1Y3FE 2RH4A 2CB0A 3SBDA 1WCIA 3SJCA 3X2SA 3CW8X 1NVXQ 4KNVA 5EXPA 1HQYE 1AKEA 4OL9A 5DNEA 5ED4A 4HCJA 3IIJA 1E3XA 2X8BA 3L7YA 5IKOA 2YWXA 3TG8A 2GYUA 1U8YA 3OOYA 3OU6A 1FFEA 1JB9A 1QTIA 1EFPA 1SCBA 3E9QA 4BNYA 3TW0A 4KJZA 1XDBA 2H7YA 2JH9A 3HJBA 4I1SA 3RNOA 2GDZA 1RLTA 1VHDA 5EMJA 1SK8A 5I9SA 1ZXBA 3UFBA 2D62A 2I4LA 3N8GA 3NFYA 1Z5OA 5JBNA 5IXYA 4YEJA 3TRDA 3HB4X 4G4SP 1I6KA 1SIOA 2HDOA 1CLUA 5BV1A 4BZQA 2H54A 3C6XA 3IKJA 3BICA 4BTVA 2YYSA 2H4FA 1CCWA 3R3JA 5GV8A 2PX3A 4QRHA 5A1JA 1N92A 4C0QC 3NVKI 2OLEA 2X9LA 3PC3A 4IUYA 4RHFA 3ZWQA 1ZVVA 2DHEA 2EL9A 3Q8XB 4GVPA 5B1IA 4CLRA 1NMSA 3BXOA 3EOBI 1W19A 4Q93A 5LBUA 2W8BB 2MWMA 2JLYA 3L6RA 1SVWA 5FBWB 3VMFA 2ZIAA 1PFWA 2G7ZA 1E2DA 9ABPA 4I5FA 5T6BA 3PHGA 2F3QA 4LRQA 4Q00A 3SF0A 3AO0B 3G8YA 4EMBA 3CMMA 2Y1LA 4LF7B 1IMOA 1OB0A 1MO6A 1K7FB 2E5LB 1NR1A 1X8KA 2IZOA 1QNFA 3K9QO 1IVSA 3N5CA 6ABPA 1A95A 3HKCB 4CJXA 4RD3A 4EA7A 1RRCA 3PX7A 3NNSA 2A9RA 4Y2QA 1NUQA 2Z04A 2FPXA 2XITA 4MIKA 2QSUA 3GROA 1AG9A 1RYZA 3CRQA 3LAWA 3EDQA 1M6HA 3D1JA 2OV3A 1DBPA 2XOXA 3PF8A 3UK1A 1YBVA 2CSXA 3GPDG 3WGQA 3B60A 4G0VA 5JNTA 2MSEB 2QQ5A 2V55B 1Z83A 3NTRA 1M1YE 2JZOA 3MRVA 4KX5A 3RSGA 4MLPA 1UXGA 4NMWA 3RC8A 1UBKS 3HYTA 1NAHA 4IV0A 5KDOA 1WP4A 2Q5OA 4O1IA 3U39A 2X15A 3KEMA 3DVAB 2O20A 4XB2A 5F4BA 5DHAA 3CLRC 3EOZA 4J6EA 3SYNA 1E94E 5G53C 1EEHA 521PA 1DL5A 4JL8A 2IYRA 4DPLA 3BN3A 1O0SA 3EIWA 4TS9A 2HSEA 3CMCO 4M0LA 1CS4C 4H7JA 4UM7A 1XAHA 2M2IA 3SP1A 1KRWA 2NTJA 5ALWA 3T1OA 3OIYA 1RT9A 4POAA 1SCAA 3VZCA 1P4HA 3AFOA 1MMFB 3KKNA 3T6KA 3OCXA 4I4NA 2I2XB 1EIZA 3VTFA 4XEUA 5JNLA 3DMTA 1URPA 2ZBQA 3RTDA 5AW0A 3QPBA 4EB0A 1AIPA 1KVTA 2Q1WA 4Y2GA 1YQ9A 1MD9A 2EJTA 3OD1A 5AK6A 1DWPA 1RQRA 4ETWA 1Q44A 4L5JA 4JJ4A 3BAZA 1T13A 4CCSA 3GN1A 3E23A 4D81A 2A57A 2PX5A 4M99A 4FILA 4TV9F 2CL5A 2EQBA 4E2YA 1YBMA 2DQSA 2NZXA 3BE4A 4R4JA 4YUVA 3MJDA 2HA5A 1HYBA 1JFRA 2Y2UA 4HFJA 4EQ6B 2W8ZA 1VM6A 3UWPA 5K3OA 3EEIA 3LWBA 5TR9A 1QGDA 4C07A 1WULS 1FFGA 5JS1A 2V6BA 3R3WA 2WJWA 3MTEA 1E1CA 1HE3A 2C61A 3WL7A 5BW5A 4JI2B 2AN4A 3OWHA 1XA3A 3QQPA 4M9UA 1RE1A 1UIRA 4URYR 2MCFA 1Z9BA 2HSGA 3LWNA 4IH4A 4ROSA 1NJGA 1OY1A 2INGX 3OF2A 5A7GA 1T3LA 4A36A 2XCIA 1XD9A 4IZHA 4E09A 2RKOA 4YT2A 2DBRA 5JD6A 1WUYA 4S2UA 5B5SA 3FNFA 1ITZA 1JFTA 1PS8A 1X1QA 2Z95A 1ZQ1A 2AI3A 1XTRA 1Y7IA 2HLNA 4L8LA 4DLPA 3VRHA 5IWAB 1BTOA 1S9HA 1P1HA 1TFRA 5BXYA 2JZCA 2IU0A 1KJ8A 3COYA 2DX7A 3HR4A 4ID3A 4R5HA 3T4EA 3WWOA 2FX2A 4V2IA 1MOZA 3LXMA 1UPTA 4O33A 4WWVA 5FTWA 3HN6A 2DULA 1AHNA 3EBOA 4HXGA 4IXWA 1E6EA 3REFA 3N2GA 5K8TA 1E2JA 1IUOA 2PRJA 4LHEA 1H2XA 3GHYA 4NQRA 4WXYB 5JPCA 5IKXA 1IQ0A 1ZGZA 1INLA 2WPDD 3B9PA 3C5EA 1OIVA 1R8SA 4GWLA 4IVRA 1E0SA 4TTQA 4UHJA 2C4MA 4J03A 1KMIY 5H59A 3I9JA 2ISCA 3DL7A 5IVKA 2OXRA 1KMHA 1JHYA 3C45A 2P67A 3EH2A 3EXHA 1SPBS 4LHZA 5FNVB 4X7DA 1LBSA 1VPVA 3SR0A 3W4JA 2FZ5A 4QUDA 1KEWA 3I4LA 2QA4B 1S8AA 5HK8A 1C30B 3WLSA 3KQSA 1Q3HA 1IUNA 1KOGA 3MBIA 3L8MA 4LY3A 3HO1A 4FFSA 1NDHA 4Y18A 3J7AC 3C7CB 4KITB 3QELA 1L7RA 4FSHA 1NB9A 4WNIA 3MGCA 3QLUC 1T8UA 4OATA 1DQSA 4PNPA 1O89A 4IXTA 4M98A 1OZ0A 1ZCFA 4HB4A 1TA9A 2I2CA 2BTEA 1NJ2A 3RM3A 1HYHA 2XMGA 3IHWA 1CJTC 3KLPX 5U9CA 6LDHA 3M4NA 1LTHR 3SIWA 3GARA 4PSKA 3F1KA 5ES4B 1NL3A 3RC9A 5AW8A 1IN7A 1CS0A 4MZDA 2V58A 2YXNA 4JQSA 4CM5A 3GCGA 4UDXX 2GASA 3NYRA 4D6PA 4UTRA 4HMPA 5FPHA 2G3YA 4I5EA 2IS2A 2CWDA 1LK7A 1FBTA 2PSFA 3DZ8A 4X91A 3V2HA 1Q7TA 2HXGA 3GN2A 1YHNA 2IIBA 3PXBA 4OQNA 2HA3A 5HR5A 3DOJA 4RZSA 5TQ2A 3RT1A 3Q6QA 1XWFA 3H1PA 3SC4A 3GHHA 4NZPA 3WNBA 2AR9A 2FGKA 3DAGA 2W48A 1U80A 2WJPA 4LE2A 4ND2A 2B4KA 3B89A 4FGJA 2EFHB 4JSYA 3EIUA 1N9GB 3LPCA 1UINA 1HF3A 2R00A 5JROA 2VHUA 1JKJB 3DCNA 3FDFA 4QYWA 5FV7A 4KGVA 2F1JA 3HJAA 3TOZA 3ZD7A 4RZ3A 3PUNA 3K0FB 4TRMA 4F6LA 3O03A 3IBFA 2JCVA 3S2FA 1UD2A 2G7MC 2HH9A 3LF1A 4URUR 4E11A 4XFDA 3GUYA 2X0KA 4ECAA 4LN1A 2HIHA 4LQ4A 1YVPA 1PWZA 1Z15A 1Q0SA 5BWNA 1D1SA 2J0UB 5EWLA 3WLLA 4K6KA 1OZHA 4CQMA 2BHSA 3FUVA 3OC0A 1TTTA 5G1OA 5TJ9A 4BKMA 5CPFA 3TXYA 5KBYA 3CKYA 5AKKA 5LYJB 3NHJA 1V5GA 2A9QA 3PU6A 3WQQA 1PV4A 1PTJA 2GA9A 3CJRA 5AI4A 3DUFA 2CNWA 5IDVA 5A03A 1YOVB 1N08A 3GJ8A 3OPMA 1VLHA 1PGJA 2ZE7A 4BMCA 4BMZA 3Q39A 3RH0A 4ARAA 1I01A 4IDAA 2JFVA 1MCZA 3K0BA 3MWJA 2AFIA 3GRKA 2PGXA 4FGKA 4NATA 4CLEA 5LZ5A 3TK1A 3M4XA 4QSMA 4JOBA 2XE8A 4X9XA 4BLUA 1J8QA 2XYPA 3HCDA 4YV2A 2HXYA 3E9EA 1ZBQA 3WZ2A 4EABA 3G8CA 1XNHA 3PI7A 3NHYA 5AW2A 5K8CA 1BLIA 1WIWA 2P1DA 3L04A 3OCYA 3PCXA 4O4JA 3PXAA 4E7OA 2WVGA 4RVFA 4BIIA 3QPVA 4Z4TA 2QRNA 4L3OA 4QOHA 5DHQA 3OECA 2HSDA 1Z08A 1MV5A 2H00A 1KO7A 3E05A 4Z4ZA 3LUKA 2OGTA 2ZEJA 1V5VA 3V33A 1A9XA 5JADA 2FMFA 1U9IC 4BZPA 4JEMA 4MP6A 1RJFA 2UUBB 2BEVB 2P7IA 3J80A 4S2EA 2Q2QA 1X0VA 5CVEA 2JGIA 2C98A 2AZ4A 3S2UA 1BKYA 3NO4A 4DT1B 3RVMA 4I55A 5TMPA 1F4VA 1TUEA 2RAVA 5EZ6B 2QE6A 1YU6A 1P1BA 2ZYWX 4RTKA 1M6VB 3Q72A 4O2AF 1YDEA 3S8YA 1QDEA 3M5PA 1I3MA 3RSOA 4LRYA 4XONA 2YJ3A 2OBRA 3BD9A 2I3DA 2WMNB 4BPBA 3CNHA 5A5GA 1DKPA 1T0UA 4K86A 4X1KA 5AXCA 4Z4CA 1E3ZA 2WYWA 1XZJA 3DWIA 4M7WA 2C5EA 4BJ5A 4MUFA 1IN5A 2BFPA 1E2NA 1RRPA 4C7OA 1FP2A 4IIJF 1L1QA 4LRSB 3N0WA 3P9QA 1KSFX 2G76A 2OEPA 1P39A 3F6YA 3ND5A 4KI0A 4P54A 3VKVA 5GGXA 4IG9A 3WWEA 1M2OB 3HJGA 3MEQA 4OHPA 4PANA 2JIQA 3WLOA 5MDHA 5FXMA 5C53B 2QD3A 4PPFA 5E8RA 4AB1A 4AZ3B 1M83A 4X6YA 4OJYA 2V74B 1NRXA 3AR9A 3JATB 1YJ5A 2ZJ1A 4HVTA 1AVTA 3ONNA 4JH0A 4EFMA 1MORA 3GK3A 4YS6A 3TDNA 1AHPA 3AMVA 1EWTA 4PYNA 3COWA 4R3NA 5FOVA 4DIBA 2GQFA 4D6YA 2QMYA 1GOTA 1H3FA 1QP7A 5D3QA 4LF6B 2ZUUA 1J6UA 4LW8A 4GX2A 1RI3A 2LWIA 3CCFA 4Y6QA 3MINA 1L5GB 3RBAA 2ZCJA 3FYDA 4ICIA 4Z86A 3OQOA 3KYDB 4N5DA 4D8VA 5FPTA 3WXBA 1CUHA 4WBNB 2RSLA 1QRUA 3KHUA 2V54A 1XQ6A 3H4IA 1QGUA 1RLJA 2PAAA 4LGVA 4MVXA 3WK5A 4YMHA 4LTDA 1EX9A 2Y1DA 2G1AA 4OXRA 4MGKR 1EFPB 4Q5IA 4XH9B 1HH4A 4HQLA 4RQUA 5IAJA 4AG5A 5DGCA 5CCEA 3CUUA 5F23A 4NEGA 4CMEC 1WUTA 3WDSA 2QRVB 5GONA 4LXYA 4RTJA 4DARA 2QLFA 4FFRA 2V0NA 4AZVA 2BJHA 3NGMA 4HRAA 4P5DA 5A04A 5KYGA 2DWCA 1W96A 2J48A 2W6NA 2HMVA 1P74A 1W0JD 2YZ7A 1LPBB 3C6QA 3BD6A 3EPJA 1FMFA 1EVIA 2AN5A 2VDJA 3HFGA 3ZWNA 4XWWA 4B6GA 3FSGA 2XCUA 2Z4SA 1QAMA 2AUNA 2FEOA 5JR3A 3MJSA 3DO6A 5JCZA 3QXHA 5MGBA 1T6XA 2TS1A 3QJYA 4V0MA 4CQNA 2C77A 3CBQA 5HJ5A 1SVUA 3NKFA 1WBDA 3FDXA 3R6TA 2O2HA 1JHRA 4UUQA 1RWBA 2Y92A 4V0NA 2IHKA 2VWQA 1VJRA 5FEMA 3UA3A 1M34B 2AVDA 3M49A 4L22A 5J1SB 2HT1A 5LOVA 2ZVDA 2QYHA 3LX6A 3I5XA 1GAWA 3FDIA 1GYRA 1SZDA 2ACEA 2G1JA 3ZJ5A 1V7CA 2WV7A 1EBUA 4X60A 4ER5A 5B6JA 2GPJA 1BE0A 4IDCA 1HL7A 2JBAB 1MQSA 5CJJA 3S8MA 2PRZA 5G1NA 2QS9A 4KRYA 4OHXA 4XFJA 2HSJA 1A9SA 3FPFA 1C14A 4AJJA 3R0ZA 1V4VA 1IPFA 3QOFA 1C1HA 1JH9A 1GPUA 4BX9A 2D0IA 1ZWKA 4W9NA 1TC2A 2Z5FA 1NY6A 2AFRA 4M9XA 4YBRA 4KQEA 3X1JA 1MIOB 1S72B 1VHJA 3KETA 1QE3A 3PL1A 5HZMA 1NVUQ 4PAQA 1BX1A 1U1DA 1XE3A 2R5NA 2HQ1A 4KIJA 4AO6A 1VLLA 3EZFA 2XMSA 3MMSA 3NB0A 5IF9A 3NTVA 4P2GA 3ZGYA 1JR3E 5JBQA 1SBHA 1U3VA 4PYMA 2GX6A 3WGVA 1VE9A 3IUNA 5FBRB 4AJEA 1SAYA 4Z3OA 2F9LA 3ENWA 4BBZA 2C9MA 1OU4A 1SWWA 2P0YA 4O4LF 3U80A 3V8QA 4DRXB 2C3PA 2GGSA 3MOGA 3VR6D 4BB9A 1TF2A 1JFFB 3QFFA 2XGGA 3GQBB 1PR0A 4ZZ0A 4IDPA 2FW6A 1YE8A 1QG6A 2QY9A 1K8AD 1M8KA 1TRKA 2O3RA 3FHOA 4OHVA 3QU5A 1D5WA 4PVCA 3EZNA 4S24A 5HMLA 3RIGA 3GW8A 5DH9A 2VT6A 4MUKA 3KKOA 3IEKA 1A8IA 5FPYA 1YA8A 2X9VA 3KHTA 4UBLA 3NDIA 2OESA 4KDFA 2JJ2D 4ZVKA 3D6VA 1RBZA 3GVJA 3D8HA 2VO1A 2IXBA 3HEMA 3THWB 1Z8FA 4Z8YA 4ZQIA 3VNRA 3QFCA 3HXPA 4TKVA 1ULTA 1GPAA 3PKIA 4J3JA 5DTQA 2YZGA 1QHHA 2ZLBA 1EFTA 2A0WA 2DSTA 5EI5A 3ADBA 1K66A 3UZUA 2WIGA 4F5WA 2MU1A 4HAYA 4O0LA 2XDWA 3IJPA 1PP4A 5DI3B 5LXTF 3NS7A 3WXMA 5AJUA 1DTWB 4GE3A 2R7LA 1AS3A 1LDBA 4FWTA 3ZU6A 2V7GA 2VOJA 1EB8A 4Q9HA 3MTAA 3LLSA 1E4EB 2WTXA 3UHJA 5EXSA 5FOTA 4PZ0A 4RVSA 4UUOA 5FBVB 2CKMA 2Q5JA 1GNTA 3HYCA 5EQFA 3LP5A 3TL6A 4Q9LA 4QHYA 2I80A 2FQQA 3VBEA 4C7XA 1ZH4A 3BIFA 1EFKA 4IVPA 1ES9A 4XW2A 4YCSA 1VBFA 2YIMA 4RY9A 2J8ZA 4X07A 5TVKA 4TMWA 2XTMA 5K2OA 5HRAA 4TRRA 1X13A 3B3JA 3O2SB 5AVSA 3AUXA 4OH7A 4TL8A 1HYEA 3EGDB 4NOJA 3CPEA 4I50F 2IP2A 1MABA