4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
b'MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords eIF5B
publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
2FX3A 2YWHA 3OE7A 2IWRA 2BMWA 2QM8A 5FA6A 2ODNA 2OO7A 4QOSA 3IPXA 3QF7A 2VHTA 1Q1EA 1JNYA 1N6IA 1VYUA 3ZIAA 3EA5A 1E9RA 1Z2CA 1U0HC 2J7PD 1VDZA 2PCLA 2YC2C 3UATA 4B3CA 2BBSA 1MABA 4GDFA 3VAAA 2HT1A 1NMXA 1IN6A 4MGKR 1XZQA 3RS5A 2CL7X 4D80A 2BM1A 2FZLA 5DGXA 3VO1A 2VRWA 3K70B 3OJWA 4LJ8A 1NVVR 3CRZA 1X8JA 3FPKA 3VR3A 5EP3A 4RD3A 4RD2A 3LW7A 2IX3A 3C16C 3HU1A 4UNPA 1QFJA 1KDRA 1NMYA 3B2EA 1VG8A 4JVMA 3VU9B 5JZVA 4BEBA 3B1VA 4OQMA 1ZM3A 1VG0B 3BC1A 3NEYA 3MHPA 4MDFA 3VKHA 1Z0AA 2GCNA 4MQBA 2FF7A 1D8TA 2CMKA 4LBVA 1II0A 4GOJA 4DB2A 1XXHA 1QVFB 2IHBA 1VHLA 4MYCA 2CL6X 4W9MC 1UEJA 3MCAA 3MGCA 1Q57A 3PQCA 3X1DA 4PZYA 3SR0A 3NC0C 4URYR 4NH0A 2XZLA 5CJ2A 3WP1B 5AJZA 2REBA 3W3ZB 4V03A 1T3LA 2DWOA 3S1AB 1TPZA 2AD1A 1E0JA 3CC2B 5K8IA 1G7TA 1YZNA 4J0QA 1RRFA 1KQSB 2OBLA 2QL6A 4TMTA 2D62A 4JKIA 4OK3A 3RS0A 1ZNXA 1BMFD 1Q86D 2BOVA 1N3BA 4Q66C 1OFUX 2OAP1 3T06B 4KAXA 3I1FA 4FMBB 4XTCS 4FK8A 3BH7A 2QNRA 1PVOA 1XD8A 2BJVA 3GJXC 3T12A 3R9WA 2WSSD 3H2YA 1M34E 4IRUB 5B57C 5GADl 5JJKA 4C0BA 3IUYA 4HAWA 1S1CA 1JQJC 3H84A 1RC8A 2NGRA 3J81k 3G6EB 1M7BA 3V9PA 5J47A 2RHDA 4OK5A 3LVRE 2VLIA 2ZSDA 4A8JB 2KBFA 5DI3B 4LK2A 2RGNC 1IBRA 2ZJZA 3AEZA 3RRMA 3OEEA 1KDOA 1YR7A 3MLEA 2QAGA 121PA 1YJ9B 2FMXA 1KDTA 2G6BA 4B47A 2P67A 5B30A 3DM9B 1T0HB 1DAHA 4O25A 4CW7A 3B1YA 5JBQA 3ZVNA 4QFMA 1ZD9A 4M1MA 1FL9A 2QTFA 4ZKDA 1X8LA 1FFHA 5FL7A 1IXZA 2XSZA 3PR1A 1J2JA 4XVUA 1IHUA 2ZRJA 2YHSA 3AH8A 3C7KA 3KQLA 1OW3B 2IYZA 1VQ8B 1DG3A 1YZGA 1RYFA 4M1OA 4DHEA 4YMUA 1ZINA 4GRAA 3QE2A 3W5JA 1XCGB 1R7RA 1VKJA 4M21A 2QGNA 4MKHA 2ZYVX 3CR7A 4URUR 1EWYA 4ZIRB 2DPXA 3IBGA 2NG1A 4Q4JA 5KPJA 2VA8A 3LY5A 4JZKA 1E2GA 2YVUA 3W2GA 2LCFA 2ZROA 4PO9A 4DLVA 4A2QA 1DAKA 1QG2A 4PSVA 5FOSA 3EPJA 2O0JA 1BX1A 4D2IA 1LS1A 3B13B 2EFGA 3RS3A 1S8FA 3K0FA 4RD6A 1EFRD 1SVMA 5JI3E 1CIPA 2O8BB 2EWWA 2GRJA 3GFOA 1ZP6A 4C4PA 4KYUA 3R20A 1KD1D 3MWLA 3ND9A 2PL3A 5DN6A 4HDOB 1E64A 3SYNA 1U8ZA 4XD7D 3LBNA 4HATA 1BQEA 2CDNA 3ASYA 2QA4B 4EPXA 2AKAB 2L0XA 3ICQB 3HYTA 5LBIA 5LD2B 1G291 4IOJA 3QFRA 1HYQA 1ZU5A 3D6TB 4GI7A 1FNNA 1H8ED 1FQJA 1MT0A 5JCZA 4URWR 3C4JA 4LJ5A 5JJIA 2I4IA 1R5NA 4PC2A 3B9QA 4GZLA 4LWZA 4QNMA 1S96A 5AJYA 2ZTSA 3Q5DA 3QPWA 4DLTA 3M0EA 4EUNA 1Y3AA 5J4KA 4ZDJA 2O8CB 2VNIA 2P6UA 2F43B 1GILA 4MGIR 4DLUA 4TSFA 2PLFA 4C43A 1JPNA 2GJAA 3B6EA 3B9PA 3FVQA 1RE0A 5IDVA 1XDBA 5FH9A 4JBYA 1J9ZA 3K53A 5AK0A 1X3SA 3QG5A 5B64A 5CB6A 5DHFA 4YDSA 2CVFA 2A7QA 1W1WA 3GLHA 1UEIA 1JJ7A 1MV5A 3JZMA 2WWFA 2QN6A 1Q21A 5TMPA 1FDRA 1V43A 3L0IB 4W5WA 3WRXC 1KC8D 1X1SA 4M2LA 1RVDA 2XOKA 1XEFA 2ZJ5A 2QBYB 3KX2A 4RZ3A 4M9SA 5KHOC 2Z83A 4ESVA 2PEYA 5EXXA 1QG0A 3CCJB 2ZUCA 3NDBB 4RCYA 1VCNA 1IAQA 5EP4A 3FKSD 1W7AA 1WXQA 3CNLA 1HURA 4D0NA 3CR8A 1II8B 5L3QB 1G3RA 1W47A 2HF8A 1JA1A 1U94A 2JDID 5JS7A 3THXB 3AVYA 3A4MA 4M9XA 3U6BA 2WAYA 2QAGC 4C0AC 4NCHA 2ODWA 4QGGA 4Q21A 4EQ6A 3NBXX 3X2SA 2NO0A 5FTMA 1S9DA 2JATA 2RGAA 1E9EA 4A0RA 2NZ8A 4DJTA 3AKYA 4JVSB 2EFCB 2J9RA 4RVCA 2D2EA 2GCOA 3MG9A 1S3SA 2V1UA 1W87A 4X8LA 1KI2A 4ERNA 1F48A 4IJMA 4QG7A 3ZBUA 1OGIA 4NYJQ 3BK7A 4US0R 3E5HA 1PUIA 3FHTA 1QUFA 3UMSA 1Z6YA 1QHHB 1G7CA 4OQXA 1SVLA 2WOOA 3R7WB 2ZJBA 3QG1A 3THYB 4Q1DA 3N5CA 1G3QA 1G5TA 2G0TA 4TLBA 1VQOB 2EQBA 4UNNA 5ANRB 1VECA 3GLFB 4FMCF 5FR2A 3I55B 1NSFA 2ZXUA 1TU3A 4FWTA 1DOAA 2OAQ1 1ZNYA 3NDPA 2BMFA 4PHTA 5CJPA 4B6EA 2YOFA 4C0KA 2FSIA 4KVGA 4Q1AA 4JYCA 1SXJD 1XXHE 5EQTA 4YC7A 4ZGQB 3BOSA 2GWHA 2VH5R 2GILA 2FZ4A 3CX8A 4IDHA 4LHZA 4US2R 3ONWA 2WOJA 2VHQA 1PJRA 4RSGA 4Q00A 1KGDA 2J1LA 1QH0A 1G1MA 1T4GA 2AR7A 3SJZA 4BUJA 3U44A 4EJSB 4B32A 2BGJA 1J90A 1GITA 1ZC3A 2ZR7A 4LY6A 2DFTA 5FTNA 2ZE7A 1KRHA 4TTQA 3GQBA 2W2VA 2DWQA 4PQFA 4OYHA 1B2RA 3EZ7A 4FWIB 1OXSC 2QM7A 3CH5A 4HB4A 2IEZA 1NKSA 2AX4A 4A0FA 1NKTA 3RC3A 1TMKA 1L8QA 1P9WA 1Q82D 1U99A 1Q3HA 5C4GB 4OBEA 1U8YA 2IA5A 1SQ5A 3QFCA 4HZIA 4B35A 4PAOA 1HT2E 3GLIA 2HF9A 1DVRA 3C8UA 5JRJA 4BFVA 3PEYA 3EPHA 3VNVA 2ERXA 4Q4LA 5H70A 1E79D 2Y8EA 1BKDR 1M7HA 2V8OA 3IIJA 2F1HA 2ZRPA 4DZZA 4B3XA 3U2QA 4TMWA 3AUXA 1JXOA 3A37A 4A1FA 3W90A 1DO2A 3SYKA 4A0GA 1GVNB 3O47A 2RH5A 3KXIA 1KI7A 4JJZA 5BYKA 3P4YA 1MH1A 3OEHA 521PA 2IF0A 4HSEA 4OQLA 1VQ5B 3QXHA 4LZZA 3F0TA 3B8HA 2FGJA 3EAQA 3QEJA 3PXGA 2XTMA 3WMGA 4U9UA 1PZNA 4D82A 4LPKA 4Q02A 1W5SA 4PGOA 4RD0A 4LX0A 5DHAA 3GJ0A 5FOTA 2X2EA 3ZQ6A 3X1XA 1NN3A 2QUZA 4URXR 2C2HA 1QZXA 4DEYA 2GAOA 2Z4RA 3IQWA 4ZPXA 1KKLA 5FPYA 3RNLA 2XZOA 1G3IA 1FUUA 3WYGA 4ASUA 2BKEA 4TYWA 5JEDA 4PZZA 3UWKA 3G82C 4NTZA 2QQ0A 4KO8A 2KBEA 5CIWA 2ZM5A 1AZTA 1XD9A 1A8PA 2JEOA 1OHHA 4V0OA 5EE9A 4DXAA 5B58C 1Z0IA 5GJBA 1TAGA 1VQLB 2WMOB 3FDIA 3CCMB 1GRNA 1II9A 4JKYA 1YR6A 2JAQA 2CHVA 6Q21A 3ZZUA 4IFBA 3TUJC 4PC3A 1NBMA 1XZPA 3ZD6A 1ZD1A 4M4SA 1GNQA 1JEDA 2J41A 1Z22A 1T8UA 4YMSA 1VQNB 4MKFA 1M2OB 3EASA 4B2PA 1OT3A 1W44A 3CXCB 5DH9A 4C7OB 4D25A 1ZBDA 4OJKA 4Z1MA 3TKLA 3U7EB 3W6PA 4CF7A 2QMUA 1EFUA 1Z8FA 1OIXA 2Q21A 4JT4A 2EU8A 3R7WA 1YZTA 1T5IA 1CNEA 1KI8A 1XE1A 3U3MA 4DUGA 1QUEA 2G83A 3Q85A 1W2HA 5C2JB 4R2IA 2J3EA 1KOFA 1BO6A 1E2IA 2WSMA 2GESA 1ONBA 3Q7PA 1XMIA 5TDHA 4CEJB 1Z08A 3CCRB 1BIFA 4FMDF 4AURA 1T0JB 2FPLA 1RRGA 2VF7A 5EMNA 3U3KA 1KY2A 4ACAA 4IDOA 3E2IA 4DLYA 1H65A 4RFSB 2HJGA 4TMKA 3W2HA 1GUAA 2ZRFA 4Y0AA 3EW9A 4G1UC 3T5DA 3WHKA 3SBDA 3PEWA 3MRSA 1NIPA 4MRRA 5HZHA 1Q3TA 4B75A 5DI9A 5IK2A 2ZIAA 2PH1A 1RZ3A 4GMDA 1M7GA 3JZAA 3WY9A 5JJLA 4EDHA 3SFVA 2WWGA 1OFTA 4UXIA 3A4NA 3NHAA 1ZMXA 1VIYA 1Z6XA 2BHRA 4AF7A 2BWJA 4O0MA 1EP1B 4Y9RA 4QBIA 1VYVA 1TVCA 1J8MF 1G19A 1G8YA 1FP6A 2I3BA 4A92A 2B7BA 1KO5A 3FHOA 1KK2A 4P4SA 2NPIA 3HWSA 3IIMA 5G53C 1ZRHA 2BC9A 1OYYA 2NOAA 4DT1A 4WXRA 4PPNA 1DG1G 3H1TA 4IDPA 2C77A 4QJ4A 3AQ4A 4CEHB 2AD5A 1XJQA 1NF3A 4AIIA 4GOXA 1P73A 3GJ7A 4QM7A 1FX0B 3FFAA 5JI2E 3Q72A 1YZUA 4Q7JB 1DELA 4FXPA 1NJGA 3VR5A 2FNAA 3RSOA 3LFUA 1WMSA 4MYUA 4TLEA 1AA9A 1Q22A 3L0SA 3QJYA 1U8AA 1DS6A 1E98A 5E7MA 1OV4A 3P1JA 2O8FB 4XWOA 5CYPA 2ZAMA 1W36D 1WRBA 5JSZB 3IGFA 2C95A 3TSOA 3WMFA 3GJ4A 5FUYA 1JJ2B 3CNOA 2X1VA 1E1RA 4Q03A 3RABA 4AYWA 1AQUA 2Z6VA 4L15A 1P62B 1XCPA 4UNRA 1XD2B 2V7QA 1HA3A 4AYTA 4L9SA 2VEDA 2ZR0A 1N25A 1CJKC 2VBCA 2WVJA 3LBHA 1RRCA 4P32A 3TSZA 1ZCAA 2B8TA 3HR7A 5BXQC 1OB5A 1B23P 1KMHB 1G8PA 4HAXA 1A1VA 2QP9X 1UFQA 3SJCA 3OJXA 4TL8A 3O8DA 5J4HA 3WNDA 3WBKA 1TADA 2V6JA 4NMMA 3UMRA 1JB9A 1E1QD 3LX8A 2X19A 3EPKA 3QPVA 5E4FA 1XEXB 2R2AA 4NYMQ 2XNDD 1K8RA 4EPYA 3EA0A 4FD2A 4NHOA 1T3SA 2XTNA 2OSBA 3I61A 2OILA 2QTHA 2OCBA 3MWJA 2HV8A 3B1ZA 2CNWD 2ONJA 3U3OA 4BFUA 4ARZB 2F55A 5KNCA 3GLFE 3CRW1 3SS8A 1OXTA 2GJ8A 2WJGA 3ECCA 2C78A 3U60B 1Q1QA 2HUPA 2IHYA 4DCTA 1XEWX 4LV6A 2JJ2D 2PZFA 3P32A 2HCJB 5DE3A 4KVAA 4AYXA 3I5YA 2YOHA 4U7DA 2E1RA 2FFBA 4I99A 3UXMA 1BYUA 3A58B 4WVFA 1OLOA 3CLVA 2IF2A 2R6GA 5KU1A 3G0HA 4WZAE 2W6ID 3REGA 3QKRA 4TTPA 1UM8A 1TF5A 3TUIC 4YAWA 3LBIA 1ZUHA 2TMKA 3B1XA 3K0AB 1BOFA 1X8KA 1NG9A 1L7VC 2FN4A 4NZYA 5FL3A 2VNJA 1OB2A 2BCJQ 3Q8XB 4LPSA 1OYWA 4PHHA 4DDWA 3AGPA 3U4QB 2CJWB 2VP2A 2BMEA 2RGXA 4NCKA 2BBTA 2XITA 5FR1A 3AVQA 4S2EA 3DHWC 2O8DA 3C5HA 1NVVQ 5G41A 3WNBA 1YJNB 2HXYA 4PO1A 3TJZA 3KFVA 2JJ1D 3KTAB 1K5DA 2FEMA 4XOIA 3QENA 1E2LA 1DARA 4Q4AB 1L2TA 2VHCA 1F60A 3K9HA 1KK0A 1NLZA 4A6XA 3FYHA 5EE0A 5BN3A 5AUOB 2BEKA 2CNDA 4HYYA 2VYFA 4NPHA 5KDLA 3VR1A 3W2EA 1B0UA 3GJ6A 2WWWA 3TSWA 4F92B 1F2TB 4Z8YA 2GF9A 3QSYA 3D31A 2W2TA 1VQKB 5H5JA 1MO3A 1IN8A 1JB1A 1D9XA 2IYSA 3KJHA 1BS1A 4DQKA 2OTLB 3AUYA 3SQWA 1Z2AA 1OFIA 3K9GA 4L4UA 2IEYA 3W5IA 3FE2A 5E95A 3LH5A 5G3YA 2WPDA 2R62A 1G9XA 1N6PA 1QF9A 3AKDA 1KTVA 2W00A 4M9QA 3SZRA 4D81A 3E20A 3CMEB 1IY2A 4C30A 1US8B 1QDEA 3KB1A 2Z5FA 2HMAA 1DTSA 3CX7A 1ODFA 1H8HD 4G01B 2FSFA 4A2PA 2HLDD 3U3JA 5FOWA 3OF5A 4G5SA 2CVHA 1MABB 2WWHA 4IVQA 3L8ZA 1QVGB 3RWMB 2XXAA 3NBYC 2XGJA 1AJEA 2QRZA 2CLDX 4QM6A 2O0KA 5A0FA 1P9NA 4GNKA 3OESA 2UVQA 1NVXQ 2F7SA 1SVWA 4PHFA 1I4LD 1JR3A 1IQPA 3SFZA 5J4LA 1RFLA 3PVSA 5JRZA 1W0KD 1T9HA 2ORWA 2ZANA 1E2PA 4PR0A 1NRJB 3UK6A 3KQUA 5E7IA 3U5ZB 4LV5B 3OZWA 2BPOA 1O3YA 4A4DA 4EPVA 4M0LA 1N2CE 3MUFA 1BH2A 1KJWA 4MGZR 4ILEA 2JLRA 2IUUA 1KO1A 1XXHB 2QDXA 3NH6A 5F98A 1IJFA 1A2KC 2GK7A 2R6FA 2XJ9A 3QY0A 4HAVA 1C1YA 3UPUA 3VNUA 5FOVA 3R9IA 3AF0A 4I4LA 2D7DA 4Q1CA 3ZZTA 2HEIA 4ZDIA 3GJ3A 3LX5A 4IXMA 1GP2A 2X2FA 1G20E 1FZQA 3E70C 2D2FA 3NWJA 4HUQA 2P6NA 2EW1A 2YNMA 1FNBA 2YWFA 4HE6A 2BN4A 1QHXA 1KZGB 2VO1A 4G3XA 2HXSA 3TH5A 1GVHA 3EIQA 1WP9A 5H59A 3GMTA 4BE7B 4G1VA 2F1IA 2ODEA 1OSNA 4CVNA 5A5GA 1VQ6B 2BJWA 2XZPA 4C0LA 4I1UA 1GJRA 2F9MA 1E9SA 1ZNWA 3EPLA 1VQ4B 3ZVRA 3K70D 2OLJA 4ESHA 2PZGA 4IVRA 3BWDD 1O87A 2GEVA 1OE0A 4NBSA 4BLTA 5FTLA 1CU1A 5HCNA 4E22A 4D0GA 4CT4B 1MO4A 2GTPA 5BYJA 2E87A 5JLJA 4LHVA 4DLXA 5ELXA 2ONKA 5KTYA 3NBZC 2AXPA 4QRHA 2GBLA 1P6XA 3EWSA 3QFTA 1RIFA 4WZ6A 1RJ9B 5BWMA 4PC1A 4F7DA 4EKDA 3KL4A 2FPKA 3QVUA 4A82A 1GO2A 4XIGS 2RGCA 4YMWA 1OFHA 2ZRHA 4XH9B 1Z29A 3HU3A 2QORA 4DC9A 5GVSA 3PV0A 4R98A 2G88A 2J7PA 1JALA 4MA4A 1F3OA 4LYHA 4Q4JB 4EFNA 2ZQ5A 3CC7B 2EIXA 3PUVA 1N5KA 4BASA 1XRJA 1UBCA 1DEKA 5DYIA 2CE2X 2NMVA 3GEIA 3W8RA 1QGAA 3GJ8A 3SOPA 2B7CA 2GCPA 2ECKA 1QFZA 2N1BA 1A5TA 3IQXA 1G21E 3K0FB 3K9NA 2LKCA 3L2OB 1KI6B 2VSXA 3EX7C 1OH6A 1U98A 1Z47A 2VP9A 4IDNA 3A1TA 4RY2A 4NYIR 2R8RA 5JECA 1S9HA 2WWIA 2G77B 2VP0A 3B85A 4PFSA 2IS2A 3VKWA 2YYZA 3K9LA 4P6VF 4HB2A 3P4XA 4IOKA 4K46A 3T1OA 1WB9A 2R9VA 3WRYC 1HV8A 1Z6GA 2LWIA 2BF4A 4RD4A 4ZCMA 2UKDA 1WBBA 5JCPA 4FCTA 1G5RA 5CYOA 3W5VA 4EAQA 3CCQB 4QJ3A 3VR4A 4C2TA 1X1RA 2G3YA 2GQFA 2R44A 1HT1E 2VPPA 4C2UA 4OK6A 2WJIA 4JMPA 1QGYA 3W6NA 4D26A 4OI0A 2DB3A 1NN0A 4GP7A 1F2UA 3Q3JB 3T5GA 4NCNA 1IN7A 1BMFA 4JSTA 1KK3A 4JL5A 1JEEA 1KO7A 3UKDA 2JLUA 3TK1A 4AC9A 1KO8A 4QL3A 4ACBA 3AM1A 2WSSA 2YZ2A 2FSGA 3TBKA 4HUTA 4DDVA 3NHBA 4IXNA 1MRNA 3IBYA 1XF9A 2GETA 3CRRA 3DPUA 4B73A 1GTVA 1Z07A 2WJHA 1XEWY 2P5TB 4XVRA 3U3RA 4B34A 3VR2A 2DERA 2FPMA 4Q4HB 3ZJYA 3M4YA 2B21A 2IYQA 4JLDA 2H8KA 4KJZA 1NLYA 1KHTA 3BORA 1E2FA 3KJEA 1YE8A 4IOLA 4C3ZA 2IYYA 2KE5A 1QG4A 2CEAA 5KOYA 1S3GA 1NVWQ 1XTQA 4FMCB 4PZLA 4OI2A 5GV8A 4BLQA 4EQ6B 3U61B 1YZLA 4ZV4A 2JIZA 2JLZA 2OM2A 2OZEA 3AVOA 2F1RA 3FTQA 3GJ5A 5IF9A 4G0NA 4GL2A 3B5JA 1T91A 5K8TA 1Q7YD 3FFBA 3IHWA 2H5EA 1UAAA 2GBLC 1YJWB 3BAFA 2WKRA 1CEEA 2CK3D 1N6RA 2GCOB 2SHKA 3W34A 5CB8A 1E6CA 3PEVA 4Q9JA 3TQCA 2AFIE 1UKVY 1EFRA 4Q47A 5DSZA 4C0SA 2QU8A 1K5GA 1COWD 1YVDA 2QSZA 1LY1A 3FOZA 4PQRA 4Q19A 2HCBA 1Z63A 1AMOA 4MITA 5AR1A 1WBDA 1JR3E 4XD7A 5JHGB 2ORVA 1KAGA 4AG6A 2QG6A 3DVLA 1EGAA 1KKMA 2QGZA 2VYQA 2PZEA 4LBWA 3VR6A 2VTKA 1UKYA 2BDTA 2JGNA 5CM9C 2C9OA 3N2EA 1H8EA 4MRPA 3BFXA 1Z3IX 2IK8A 2ZRNA 4KYIB 4ON9A 4GMXA 1HQYE 3DEFA 5H68A 2QE7D 3AB3A 1MOZA 1UJ2A 1NN1A 1AKEA 1R8SA 1U81A 1FNDA 1R4AA 4ZDWA 1BX0A 4R71A 2OESA 4G5RA 4YDHB 4DSNA 2NQ2C 3KQHA 1QHIA 2PIAA 2A30A 3CWQA 4HE5A 1UADA 1HTWA 2ASEA 2ZSFA 2F3RA 4V0MA 3U44B 4AKIA 4Q7KA 3DKPA 3L43A 3CCUB 5AUNB 4OHWA 3SI7A 1PLLA 1SHZA 4DEXA 2DFKB 2F43A 4R7ZA 5CITA 3D3QA 4P0TA 2OCAA 1UBEA 1FTSA 1V5WA 1OKKD 1I2DA 5FUVA 4BFSA 2I1VB 3RAPR 4PAMA 1KSJA 3W5UA 2IXGA 4A2WA 2C9YA 2PX0A 1HE1C 4PHGA 1XX6A 4WXPA 4DCNA 3Q9LA 1FRQA 1YI2B 2WKPA 4KFTA 1JQLB 2O8EA 1N0WA 2GXAA 5EE5B 2JDIA 4LJAA 1TNDA 2GZDA 5SZKB 2R65A 1Q1BA 1CJVC 1SVIA 2XTZA 3NIBA 3PUWA 3THWA 3HPRA 3QKSA 2QA5A 4W5JA 4TLCA 1CRQA 4HDCA 1N6LA 2BM0A 2C5LA 1II8A 5L3QA 4B2IA 2D06A 5FOUA 4NCIA 4GBMA 2IL1A 3FB4A 1QHNA 4I1VA 1EP3B 2I1QA 4HAZA 4ZO4A 2BSAA 4CGZA 1LF0A 2O0HA 4PPFA 3QIAA 1G6OA 2EVWX 2VHJA 1EFTA 1Z0FA 4DSTA 1E2KA 1FUKA 1NL3A 2BBOA 1ZUIA 3LLUA 3RRYA 4DVGA 3LQRA 4WBSA 4ZGNB 2XJ4A 2IXFA 1CNFA 1EX6A 3AF3A 3LWNA 3C5CA 3H0KA 3Q5EA 3FGNA 1ZYUA 3OZVA 4P31A 4LV8B 1IM2A 4LYAA 5HXBA 1CJTC 1P9RA 4II7A 4AKEA 3A8TA 2OK7A 4GT1A 1NG1A 4PQYA 1TF7A 1Q0UA 2IUTA 3F5FA 3OIUA 1VPLA 4BPBA 2REXB 1S1MA 2RGDA 2G0NA 2ZAOA 2OTJB 4RKFA 1SKYE 4FMDB 1QHHA 4ASUD 2ZI3A 1P2TA 4EPWA 4PAQA 2CBZA 5JS8A 4Q9HA 1NLFA 3BXZA 1MR3F 3AVXA 3OFND 1SXJA 2OCYC 1E9CA 4M1YA 2J87A 3RDPA 1CULC 2FFAA 1YRAA 3CPJB 2P6RA 1DDIA 2IXEA 4W5HA 1E9FA 3RRNA 5L3SA 2IW3A 4TYQA 2PJRA 3OW2B 4Q7LA 1K6MA 3GEEA 4D4KA 4QHTA 2DBYA 5BN4A 3LO8A 4OHVA 4YALA 2Q6TA 4FW9A 5FFMA 5D3MA 4F4JA 5HKKA 2IYWA 5AUQA 3DKVA 4NKRA 1OH7A 4IOMA 4MUBA 4EJSA 1A82A 2V54A 2H17A 5HTKA 4PC7A 1E2EA 2PEZA 5CIQA 3LQQA 1CBUA 3X1YA 2BMDA 1M74A 3FMFA 2J0QA 1TLLA 4GP6A 4PSKA 1GAQA 3WP0A 4U02A 4V0KA 4LRWA 4DLWA 4EFMA 1N0UA 2ZVQX 1E9BA 4NONA 1IN5A 2EYUA 2QQEA 4YLGA 1NMZA 2NTYC 4DWJA 5JWRA 3QBVA 4Q1EA 4KFUA 3JQPA 2KI5A 2HDNB 3R8CA 3OAAD 2X3UA 3QXXA 3LVQE 3O8RA 1DE0A 1LV7A 4O2LA 4QBGB 4IKEA 3SJBA 3O8CA 3VMFA 4AKGA 2GKSA 2MSCB 2VSFA 5G3ZA 5BN5A 4TWZA 3TNFA 3MJHA 5F9HA 1DAGA 1XB2A 2QP3A 1R8QA 3OZUA 4B4DA 1KI1A 2VIIA 1CRPA 2QEXB 2C8VA 4BLRA 5LPNA 1P60A 3GLHE 4P4SB 4FCVA 1UKEA 1Q44A 1VG9B 1UF9A 2A3RA 3ZLJA 3TVTA 3TVDA 1EFHA 4RJLA 3IPYA 1MO5A 1KIMA 4K1XA 1ZM7A 3IIKA 2NIPA 3FPAA 4CEIA 2QY9A 4JLPA 4Q18A 3K8YA 1NN5A 3CF0A 2YKGA 4MYTA 2DY1A 3KXKA 3PITA 5IHPA 4H1UA 3EG5A 4KBFA 4BFYA 3JQQA 3G5UA 3KKMA 1W4AA 4JBWA 2BEJA 3KKQA 3VTKA 4OQNA 1XPRA 2WMNB 1OH8A 5EZ5A 4RD1A 1N5LA 1OXXK 1P61B 4LUCA 3SN6A 3QF4B 4NCJA 3SU8A 1LS6A 3CB4A 1QHSA 2UZIR 1KNXA 4FCWA 3SJAA 4KITB 2OUKA 1YR8A 4Q9IA 3CPEA 1AN0A 4BZXA 1SXJC 2OBNA 4D6PA 1D2EA 5EP1A 2ZEJA 4ZI3A 1WA5A 3REFA 3CCEB 3QUSA 4C7OA 3I4LA 4A6PA 2RCNA 4JLJA 1CF4A 4KLZA 4V0LA 2A2ZA 1VCIA 2PMKA 1G7SA 1D2NA 1G6HA 3UG6A 4BZPA 5F9FA 2G9NA 1RPZA 2ZETA 3KUCA 3PEUA 1Q20A 3IILA 3A1VA 4LJ6A 3V4FA 3D8BA 5AN9A 3CZQA 1W2GA 1HH4A 4OHYA 4C9BA 3P26A 2ZSBA 5M04A 4CEJA 4M53A 3T1TA 2ZRCA 3LLMA 4M1TA 4EJSC 1P2UA 4PPGA 2OCPA 2ZI7A 1ZNZA 2ZREA 1CR1A 1GRQA 5FPKA 3BGWA 3FMOB 4ZKEA 3CPWB 3QNUA 2KWIA 4DDUA 3CZPA 5L3VA 2ZI5A 1N6OA 2C98A 4FIDA 4B33A 2FH5B 2A5DA 4N0DA 3I3SR 3ZYCA 1WF3A 2IC5A 3LAWA 3LW8A 1U90A 5DIFA 3BH6A 1GL6A 4HLUA 3MAAC 1H42A 1A2BA 3NXSA 1VQ9B 2GEUA 1VTKA 3THOA 3SE0A 4Q1BA 3ZH9B 3K0CA 5FBLB 1W0JD 4HZUA 1ZC4A 3GPLA 1Z6TA 1YU9A 2GJSA 2RMKA 4BFXA 1VCMA 2GF0A 1ZUNB 2ZRMA 3DMDA 3GFPA 4JLOA 4JYBA 3NTUA 2EFHB 1YITB 1LFDB 1TQ6A 1X86B 5CLQA 3QKUA 3GLIE 3SC3A 3ZQJA 4DSUA 4WIAA 3DZDA 2ZJOA 3A6PC 2QPAA 1E3MA 1NJID 4V0NA 1AK2A 2KJQA 3TR0A 1GKIA 1YRBA 4CEHA 2BKUA 2J0UA 1L4YA 1DAEA 2OV2A 3GLGA 5IT5A 1YZKA 3CKLA 3CWZA 4NP6A 1FX0A 2B8WA 2GPJA 421PA 2ANCA 3AGQA 3LA6A 2Q3FA 1FOEB 3TQFA 2W6JA 1KSFX 1XMJA 4IVPA 3GD7A 4EPRA 5LDDC 2DR3A 2NO6A 2QMOA 4TT3A 3W9YA 4TYYA 1SXJE 4YXWD 3I62A 2YC4C 5KYKA 4KCGA 1N8RD 1KI3A 2XX3A 4B3FX 2ZE6A 1DAIA 4HB3A 1CR0A 4LBZA 1T3HA 1Z0JA 2WPDD 3BFVA 5FOXA 1M1YE 3BB1A 1K8AD 4KU4A 1R10A 2ZUDA 2FG5A 1NY5A 1EWQA 2BMJA 2XXAB 5CK5A 1S0UA 1E1QA 3ETLA 3TIFA 3X1ZA 2C9CA 4CRWB 2PCJA 2XNDA 5FUXA 3ZS9A 1KMHA 5FTJA 1OIWA 1TEXA 5HE9A 4US1R 3JVUA 1JAIA 2FE4A 3U7FB 4I1SA 3CF2A 1G3MA 2QTLA 5CDFA 5FBWB 1GKUB 1IY0A 3R8FA 2CNWA 2NO1A 3TAUA 1TTTA 1XTIA 2ZYWX 3QEOA 2GVZC 3KB2A 1M90D 3NVAA 4BRUA 4E09A 1PLKA 4X8MA 2KSQA 1TX4B 4DCVA 1W4CA 2WJVA 1GRRA 4EIWA 3P27A 3VHXA 1QX4A 3B78A 3T1QA 4JLBA 5J4YA 2JJ2A 3LVBA 1ANKA 4B2LA 2CHQA 1PUJA 4B3BA 1NBME 5KNBA 2GJ9A 3U7HB 2K5UA 3L82B 4NU0A 4YMTA 4Y9UA 3KUDA 5KDOA 1KZ7B 4AY2A 1NY6A 3ZZ0A 3ADDA 1XFAA 2W6IA 3KJGA 1WE2A 2FU5C 2H92A 2V9PA 3LD9A 2QZ4A 2QPOA 2ZJ8A 3K09A 1CXZA 2QP4A 1E62A 1CP2A 1AKYA 1RW4A 2A5GA 2BVNA 2AK3A 3TLXA 5GV7A 1N6NA 3OE7D 1E2QA 5FBVB 1E0AA 2ZRAA 2BBWA 2HYDA 4HUQB 3PIRA 1AM4D 1HQCA 4UJ5A 1KO4A 2OE2A 2ZRGA 3ZD7A 1GAWA 3CC4B 1IXSB 3K0AA 3ZIAD 2JJ1A 4H9GA 1AGPA 3AV0B 4NYIQ 1KDPA 2RGBA 5FI0B 2W58A 2CJWA 4HLUC 4DLRA 1Z0DA 1LW7A 1XTSA 1P5ZB 2FEOA 1JJVA 2MSEB 3AP3A 1S2MA 5SZIA 3K0CC 3KTAA 1YQTA 5DYGA 3OIVA 2LKDA 1GZSA 1W5TA 2FOLA 2ZUBA 4YAUA 3FMIA 4DQLA 4WW0A 3ZVLA 1NVUQ 5THXA 4Q4AA 1YR9A 2RGGA 2A5FA 4V02A 5EUQB 3H4MA 5J5CA 4B6FA 4DDTA 1E32A 1C9KA 4ZCIA 3OIYA 4TZ0A 1U0LA 1YHNA 2GZHA 3C41J 2D3WA 1VYTA 1SVSA 2OFXA 3FWYA 2H7VA 4TLAA 5GVRA 2H1LA 1EESA 1UDXA 1GAJA 1KY3A 2X77A 1W36C 4PC6A 5HCIA 5E3HA 1BYIA 4LHYA 5P21A 3SEAA 3U6KA 2AHOA 1LF5A 3DDCA 4YMVA 3BB3A 3CF6R 1KYIA 1XWIA 2XNJA 1H8HA 1NJFA 1ZAKA 2VL7A 1GFIA 4W7SA 4UXHA 2HLDA 2JLXA 4P4UA 1G3UA 3B1WA 2AWNA 1UDWA 1DAFA 2CLSA 4JJKA 2RGEA 2GEDA 1US8A 3M6AA 4P4TA 4TTRA 1SVKA 2W83A 5UKDA 1AZSC 4OI1A 1HY3A 3ADBA 5GJCA 3QFSA 3EARA 3MD0A 2JLWA 4TZ6A 4DLZA 2ZSAA 1W4RA 3VX4A 1XTRA 4A15A 3JQRA 3AF1A 3CX6A 1J7KA 2IS6A 1LVGA 2QMHA 1G8GA 1W34A 3NKVA 4JVLA 1XU4A 2B6HA 2OG2A 1W0KA 2QAGB 4PPQA 3RVBA 1KJZA 1E2HA 4F93B 2DHRA 4GZMA 1SKYB 4QHYA 1M8PA 4EH1A 4N1AA 2OLKA 1DDGA 1XMVA 3NG1A 3ZDQA 1G41A 1TQ4A 1ZW6A 2XEXA 2BV3A 2JASA 2ZS7A 3OEED 4NDZA 1TUIA 4UNQA 4QHSA 2Q3HA 4NL4H 2UZ3A 3UWOA 3ADCA 2DEUA 1AGRA 2REOA 4MKIA 1CLUA 1OIVA 1XCMA 1J70A 3K0EA 4ABYA 3AVVA 5FL7D 2WAXA 2VSOA 5FUWA 3LXXA 2XSZD 3QI2A 2VP6A 3G4SB 1Z6AA 2IT1A 1F5NA 1CTQA 1JECA 1N5IA 5JWOA 1F2UB 4DIEA 2MMCA 3WNCA 4EPTA 1ZCBA 3U7GA 2ZS8A 3CIOA 3KFXA 3Q7QA 1KSHA 2W0MA 4M8NE 4NE2A 4AKHA 2WICA 3HPQA 2DFLA 2RKOA 3K09C 1OF1A 4KV9A 4LHXA 4CIDA 5EE1A 4N0EA 5BW8A 4WOPA 5HR5A 3WXMA 3TGPA 4LYFA 3MJRA 2D4HA 3BFKA 4MRSA 2F1JA 3AF2A 4KODA 1SGWA 2QTVB 1RYHA 4Q5IA 2ZJAA 3CONA 2ZYTX 4HLCA 2GXQA 2NO7A 3T1VA 2QTZA 3BE4A 2ATVA 2ORIA 3QXJA 4POAA 3BD9A 4LJ7A 4OI4A 5E7JA 3UIEA 4URVR 5DN6D 1R0YA 5H8WA 4K8OA 2H18A 3CH4B 5DNYB 4JVNA 3HJNA 4HLDA 4BLOA 1UKZA 2RC6A 3W5HA 3GLGE 2X8AA 4BZQA 2QEQA 3VU9A 3PG5A 4MH0R 1OXVA 1G4AE 2F3TA 3ND8A 1N6HA 1GSIA 2FWRA 5KSYA 1D6JA 3H86A 1TQ2A 2Q9CA 3OHMA 1KI4A 1GG2A 1U9IA 3VX3A 1D2MA 1JI0A 2IBMA 3V00A 1E2JA 4TQUS 2N46A 4Z8XA 1OPXA 1VMAA 1YJ5A 3GLHB 3NH9A 4KI0A 1YKSA 5JEEA 4TSFD 1RJ9A 3X1WA 3S1AA 4D4MA 2JIZD 4R9UC 3ASZA 4AD8A 2WJJA 3K0SA 4IFEA 2V4ZA 3AVPA 2ZRIA 2IUSA 3IO3A 2FV8A 4GOKA 4HDQB 3KQKA 1N0VC 3LO5A 2DYKA 4JT2A 1Y63A 3AVWA 3I32A 5B2ZA 3DMNA 5F2EA 2AKYA 3W8NA 2QPTA 4MYHA 3GP8A 4IEEA 2GHIA 4TMZA 5CDFE 4BLPA 1UPTA 1W46A 1JA0A 1DBSA 2VQSA 2XOKD 5TY0A 3BH0A 5L3RA 4A8JA 5L8VA 2PT5A 5DI3A 4RCZA 1KI6A 1E2MA 2IS1A 5HE8A 1Q12A 2G1JA 1P75A 2GZAA 3B7GA 3N2IA 1SZPA 2YV5A 2VHUA 4KXFB 1W2BB 4LJ4A 4G5GA 1AS2A 3E1SA 1ZVQA 1T5LA 1KAOA 3KKNA 2Q3MA 3EC2A 1G8HA 2W2XA 3K1JA 4JL6A 4LGMA 4LYJA 4BFTA 2ZJYA 4CYMA 1P2SA 1JPJA 1XP8A 2N42A 3BBPA 4TMXA 1G4UR 1ZU4A 2ZI9A 2PLRA 4AF6A 1DADA 3A4LA 1ZM2A 3BERA 1BJKA 3HR8A 1CJUC 5AWFC 4M22A 2JJ8A 4LCBA 2IYRA 3RHFA 5KSPA 4ZIRA 1C4OA 3MWYW 2QAJA 3PUXA 5FBRB 1KK1A 4A0HA 4N3NA 1IOZA 1IJEA 3W2IA 5DISB 4D4LA 3RS2A 4ZDKA 3FKQA 4HI0E 4LDJA 3F3YA 3SNHA 2O8BA 2ZU0C 1TEVA 1VG1A 2V3CC 1KSGA 2EYQA 1W35A 1VCOA 4LHWA 4WAUA 1OJLA 5FBQB 3KXLA 1N5JA 3TW8B 5KSWB 2XB2A 3CMAB 3OIWA 2O8EB 2GDJA 2BCGY 4JLNA 3K70C 1JBKA 4EFLA 4QGAA 1DO0A 2VP5A 3A1SA 4Q4HA 5K8LA 4QBFA 2FFQA 2IYTA 3D7MA 2ZI4A 2ZE8A 3THWB 3QKSB 1KNQA 3MSXA 4TLDA 1EG7A 4JLMA 1LNZA 2QROA 2OBMA 4MRNA 2D74A 4TQ9A 3EIHA 3EXAA 5J40A 4DRZA 1NP6A 1P72A 2E9SA 2R6HA 2YOGA 1E69A 3W6OA 3RS7A 3CPHA 2O8CA 221PA 3I8SA 4WQMA 1SM4A 1GL7A 5CM8B 2CK3A 5TB5A 2QI9C 1D9ZA 1CJMA 1W49A 2ZI6A 3L8YA 4PX9A 5F3WB 4XSGA 1U9IC 3GCGA 4TYNA 2ANBA 3L0PA 4AI6A 1IONA 3RS4A 3RRZA 5FI1B 1QVRA 3T61A 1YIJB 1R2QA 3I8XA 3VHLB 4RZ2A 2O5VA 1COWA 4ZI2A 1I4DD 3GLIB 721PA 4Y7CA 3FKSA 4Q9KA 5JFGA 4MRVA 2QBYA 2DWPA 2OHFA 2ZE5A 2HYIC 1QHYA 4KSBA 5LB2A 1VIAA 2ZRLA 3IO5A 4Q1FA 2ERYA 3OZXA 4UXJA 3ZGXA 2OXCA 2FDCA 1AQYA 4K81B 3DOEA 2P3SA 2QE7A 4KLNA 4U00A 1SXJB 3LDAA 2B92A 4OKSA 1W4BA 4A8JC 1IB0A 2ZSEA 3I56B 3THXA 2DETA 1R5OA 1DAMA 2VNHA 4QJ5A 3PUZA 2CLCX 3QE0A 4HB0A 5H1YA 4M9ZA 3CCLB 2A5JA 3A36A 5FPHA 5KPDA 1ZJ6A 1CKEA 2VZLA 1E2NA 5L3SB 2CL0X 2IWHA 4DBLC 2QT0A 4JS0A 1NSTA 1GM5A 1OGJA 4ITRC 2P0EA 2W0SA 3N70A 2J0VA 3OEHD 4PTLA 4M1SA 1EXMA 2YINC 4G1BA 3KJIA 4AG5A 2MSDB 1MRSA 5J4VA 2JA1A 5D3MB 2C04A 1OKKA 3BB4A 4MUAA 4P3YA 2GA8A 4JLAA 2ZYUX 5TXGA 3DO6A 3ZC3A 1CQXA 4X8HA 5EXTA 4D4JA 1P7CA 1Z83A 5C46F 2HT6A 2A9KA 1QBKC 5HKKD 2GXSA 3EIEA 2ZR9A 4B48A 3EC1A 3HU2A 1S72B 3LXRA 4O2RA 1FPMA 5C4MA 1EK0A 3THYA 3QPUA 3TAHA 1MKYA 3R9XA 2EWVA 1DPFA 3RSLA 3GLFA 3L0OA 4QBHA 1OHHD 1I7PA 3LNCA 3MWKA 4PXAA 1U2RA 3ICEA 1TL7C 3JVVA 1Z0KA 2XAUA 1RKBA 1FTNA 5DO9A 3I72A 4IW3B 2GNOA 4F91B 4JBXA 1XJ0A 3CUEF 1GR1A 4QGHA 1KI9A 5FPSA 1NBMD 2CE7A 4WA7A 1WDTA 4IEIA 2F9LA 1ZIPA 2YJTD 2QSYA 5LD2C 2Q9BA 1YHQB 4HAUA 5KSZA 3AKCA 4Z1MD 4G5OA 4PO8A 3CCVB 5TARA 3T34A 4TYPA 2OXRA 2ZJ2A 1FNMA 1EP2B 4ZCLA 4QKQA 1IN4A 4A9AA 2ODBA 4FI3C 4DUGD 2MMGA 4CDGA 4URZR 2DCUA 3M1IA 3PCRB 4KFRA 1AIPA 2GJKA 4CEIB 4OQFA 1IXRC 3FMPB 4M1KA 3C15C 1G5PA 2OK8A 4Z51A 1EFCA 1UBGA 1HE8B 1E79A 5AJWA 4JLKA 1GNPA 3EWAA 3MFYA 1QHGA 3C14C 1A4RA 3DM5A 3B82A 1FMLA 4NYJR 4DCSA 3AP2A 4E5UA 4Q48A 1R6BX 2JLYA 3OFNA 1KMQA 2C03A 4OJQA 4LSGA 3KKPA 2CCGA 4JIMA 4B71A 2QRNA 5KDDA 1AS0A 3IKJA 5IK2D 1A7JA 3AF4A 5KUTA 3RWOA 2G1KA 2OFOA 1XBTA 2DFNA 5EXSA 1CR4A 4CT5A 8OHMA 1XJCA 1IY1A 3G71B 4HAYA 1ESNA 4YAOA 2QT1A 1EWRA 1N6KA 3EZ2A 4AK9A 3AVUA 2PJZA 4DT1B 1E63A 2C96A 4RFVA 2CCJA 4BGDA 2FSHA 4L9WA 2JLVA 2WHXA 2Z43A 1G7RA 3FHCB 2J5XA 4A36A 4TL9A 4LC1A 2FGKA 4TL7A 4Y0VA 1SKQA 3VQTA 1QFYA 3QBTA 1GDDA 3I73A 4Z54A 1YZQA 4XWKA 3FJOA 1EX7A 2J0SA 3QOFA 3VKGA 3ZBTA 2WZQA 1ZIOA 1NDHA 1F6BA 4G5QA 1AS3A 3TMKA 3UG7A 4I1OA 4UJ3A 5AJXA 3EZ6A 1NI3A 2BIFA 1VQPB 2V6IA 3HDTA 4RZUA 2F6RA 3WYAA 3CNNA 3P20A 4YONB 3RANA 3OAAA 3GFTA 3LRPA 4LJ9A 2AK2A 4TL6A 1D5CA 2WIBA 1X6VA 4TQAA 1E1RD 3SBEA 1TU4A 4UKDA 4Q9LA 4JL8A 3KZ1E 2KB0A 4V0ME 2V7QD 4MGYR 2Q9AA 3SHFA 4BECA 5D3QA 5KO2A 1Q81D 3CCSB 3HYRA 4E07A 1M6NA 3CRVA 3HP1A 3RLFA 5HZKA 2IYUA 2QENA 2AXNA 1ZM9A 5IRCD 2ZPTX 1G16A 2O52A 4HZUB 4B3DA 1E99A 4B74A 2R6DA 4AWXA 3WHLA 2GK6A 4LJYA 2YWEA 3ES9A 3T35A 2RC5A 1ZD8A 3A1UA 5GJWC 3T15A 2P5SA 2IYLD 1XMSA 2V1XA 4KBGA 4Q7MB 1PLJA 4KFSA 2IYVA 2OEPA 4HLQB 1CS4C 3BRWD 1UBFA 2JLSA 4RZXA 3F8TA 4L8GA 3RYTC 4BFWA 2CHGA 1QRAA 1GL9B 1XPUA 1GOTA 2CXXA 4L16A 2J0UB 3GLGB 1VQ7B 1UMKA 1W36B 1MO6A 1G17A 2A78A 3EZFA 1GKYA 4RFSA 2HJVA 2IS4A 3V76A 5LB4A 3QKRB 1D1NA 821PA 4MDEA 1I4TD 621PA 3CO5A 4BPRA 4XSHA 5HPYB 2H57A 4QGFA 4UQOA 3TE6A 5C18A 2OFWA 4IDQA 1J99A 1FQKA 2J59A 1G64A 5SZJA 3W3AA 2OT3B 2W6JD 3SHWA 4BFZA 1JXMA 2O8DB 1E9DA 5G40A 2WWYA 1XPOA 5TR9A 3QF4A 1R0WA 4F4IA 4N3GA 4TT3D 4F4CA 3AKEA 2YWGA 3PUYA 2NO9A 1K73D 1ESMA 5JHHB 3DZ8A 1OH5A 1FW6A 2EFEB 2AL7A 3O8BA 4YQFA 3KQNA 3WYFA 4Q01A 4C0HA 4LOAA 4F38A 4DSOA 3CRMA 2ZRKA 4S35A 1I2MA 3AVTA 3ZVMA 2J7KA 2QMEA 3NEJA 4WZBE 1E2DA 4E03A 3SDZA 2GVDC 2WJYA 2GAAA 3E1YE 2FA9A 2JCSA 3TW4A 4C0JA 1FMJA 3NBFA 4JSYA 1HEIA 3TUZC 2J45A 1E96A 1LB1B 2Z4SA 1JAHA 3TRFA 3GEHA 2ZITA 3CBQA 4KHZA 3A1WA 2P65A 1FNCA 2O8FA 4B3GA 4TMVA 4P33A 1QVAA 3QQ5A 5JSZA 3SYLA 3TR5A 2WTUA 4IHQA 1T8TA 2VP4A 2RB4A 1Z06A 1H85A 1F20A 5CK4A 2WBLC 3UMFA 4TN1A 2AN9A 2J46A 3KDSE 4RKEA 1Q1ZA 3MMPA 2EFDB 1XD2A 2IYXA 3BJIC 4H1VA 1QGZA 1ETUA 4B43A 1GNRA 5JMTA 2RHMA 3SQXA 2C99A 2CRVA 1GWNA 2R6CA 2ZU6A 3DL0A 4BWYA 3I5XA 2A5YB 1CR2A 1WCV1 3IDQA 4L5BA 1E9AA 2XB4A 4UNSA 1Z5ZA 1Z28A 5AUPB 3IHLA 5BQ5A 1W0JA 4OL0A 4I81A 2AWOA 1NIJA 4BEJA 4C0QC 2ZRDA 2WIAA 4HEJA 1TUEA 2V55B 1RRPA 2CCKA 1XEXA 2ZVPX 1XNJA 1TF2A 4X8OA 3CRQA 3QKTA 1JR3D 2NZJA 3ZS8A 2GXUA 4XVQA 1KJYA 1E0KA 5TV2A 2XNSA 4ARZA 4KSCA 5EXPA 2Z0MA 1S4QA 3ADKA 4OHZA 3IEUA 3RC8A 4XWAA 4QNRA 4R2HA 3LV8A 5C1BA 3UANA 1E94E 4DCUA 4DIDA 3DOFA 4LC0A 1T6NA 1XTKA 2ZRBA 4FINA 5JWHA 4LBYA 1SVOA 4XJXA 4B76A 1E4YA 4BQSA 1TQDA 5CLLA 5GJVC 5A4JA 1E0SA 4PANA 1P3JA 2ATXA 1WQ1R 2D7CA 1ELOA 4QXAA 4YXWA 3V4RA 2H16A 1VQMB 2WKQA 2FFHA 2WWXA 1OXUA 1G8FA 1VHTA 4GFDA 3EZ9A 4U5XA 3BIFA 4GPTA 5EZ6B 4XTRA 4DB4A 3PFIA 2PBRA 1W48A 2VF8A 5SZHB 4BLSA 5TVKA 1P4SA 3U4QA 1ZM4A 4FN5A 3AP1A 5DLQC 1PV4A 1R5BA 2R6AA 4M1WA 4DLSA 1JR6A 2NPFA 2PMDA 1FP7A 2BGIA 1E4VA 4PSAA 1GIAA 4CZ2A 3WMEA 4QC2A 2RGNA 3CW2A 5EJEA 3VFDA 1XTJA 2WV9A 4DKXA 1J8YF 1NNEA 4YHBA 3CD6B 3NC1C 2PT7A 3KKOA 2WM9B 1SULA 2VNKA 1L4UA 2ZS9A 5EUMA 4O3MA 4NYMR 2JLQA 5FPTA 1R0ZA 2RAPA 4OHXA 1FRNA 4JLVA 4D0LB 3QVVA 2PX3A 4UAJA 3W2FA 3QXCA 5EP2A 4F7WA 1SHKA 3BS4A 1K9MD 3WBJA 1F2TA 3I92A 1U0JA 5FTKA 4YAFA 5K8UA 3PENA 5EE3A 3IEVA 2XNCA 1R0XA 4MKGA 5AJVB 2AFHE 3QXSA 3B60A 4GSYA 1P2VA 1G18A 2FJUA 4BRWA 5KSOA 5KNDA 4B44A 3CM0A 1LTQA 3VO2A 1HUQA 1M1KD 3PJRA 4LI0A 2P2LA 2B5OA 2Q0HA
chains in the Genus database with same CATH superfamily
1ZH4A 2FWAA 3N28A 2QM8A 4J3FA 2E4XA 2JFGA 4J0EA 1ZR4A 5J35A 3DHYA 5F52A 2PWYA 3N1UA 1Q7BA 3QF7A 2QUBA 2VHTA 2AS0A 3AL3A 1WMFA 1JNYA 1VYUA 4BX9A 3FNEA 1E9RA 2UVDA 3R24A 3UATA 4GP9A 5AOAA 3WIVA 3MUNA 5F76A 2JB9A 1MABA 3OVMA 4NXNB 3OUTA 4D9NA 5MHTA 2FUG6 5DW3A 1V6SA 3VAAA 2HT1A 1IN6A 2PSJA 3FKJA 3FPCA 5KOHA 1CUEA 2BRUC 2CL7X 2VKQA 3A6HA 2BM1A 1DBVO 2O2GA 3VO1A 5DGXA 2VRWA 3CE9A 4EKYA 3K70B 3CRZA 3FPKA 4RH3A 3VGJA 4KPYA 1P0PA 5AKIA 4D9IA 2IX3A 3C16C 4RX1A 3BA6A 4WA8A 1QFJA 1T2EA 1NMYA 2BELA 4PZUA 3BCHA 1O94D 3GRVA 4V2UA 4JP5A 3VU9B 3DEJA 4P34A 2YICA 3B1VA 4PZEA 1H2AS 4MMXB 1VG0B 4BQFA 1WPRA 2RHTA 2GCNA 1UBUS 5FV4A 1YS7A 1U5AA 5B3JA 4LBVA 4GOJA 1I3MA 1MV8A 2PZLA 2CSXA 4MRMB 2IHBA 2QNBA 1VHLA 1T2UA 5KYVA 3PDWA 1ABFA 5ITVA 3DUFB 3Q6MA 3OURA 3MGCA 3PQCA 4XRRA 3X1DA 4PZYA 1SPBS 3NVDA 4AN1A 3T7CA 1AHNA 4XX0A 2XZLA 3MELA 4FYJA 3WP1B 5AJZA 3ZN2A 4J0IA 4UMVA 3EISA 4F12A 3T7EA 2AEFA 2ZBDA 4YRFA 3BD8A 3P97A 3NTVA 1E0JA 1V26A 4OU4A 4Q3BA 3Q2IA 2O2YA 2QL6A 2TSYB 5AKHA 3FFWA 3RS0A 4OK3A 3GHYA 3OTHA 1Q86D 2BOVA 3SP1A 1N3BA 4Q66C 5TEWA 4H6VA 1OI7A 3I1FA 5T4FA 1U4OA 1X9IA 2QNRA 2VT3A 1TM7E 1VMKA 2B1IA 3H2YA 3LBYA 3R9WA 5EAIA 2FUG1 5JJKA 1FRFS 3BMQA 4HAWA 4YECA 4FEAA 1GCAA 1S8NA 4UOQA 2H2WA 3MJFA 4Q34A 4D6XA 2J3LA 5J47A 1WDLA 3R9IA 4DM3A 5KHLB 2VLIA 2ZSDA 2RH4A 1U7TA 3L8EA 2VP3A 3TLKA 3WOHA 2NXWA 4LK2A 1SXIA 4Q93A 4MEJA 3IR6A 2ZJZA 2IDZA 2HA5A 3AEZA 3TCKA 3J80A 5TEVA 2QZZA 4YJ2B 2FMXA 7MHTA 2P67A 1NNLA 1W52X 4O25A 2BZ0A 3ZVNA 4QFMA 1BJTA 3KYBA 1XP5A 4L1KA 4M1MA 4WNAB 2QTFA 5I7UA 3SSOA 2OB1A 5C8ZA 1IRIA 3RHTA 4H7PA 3PR1A 3EDQA 1RSZA 4WERA 4DA7A 4RLZA 4UM8B 3AH8A 5ARCA 1JEOA 2CDRA 4GXTA 2IYZA 4M49A 4O0LA 4ZMRA 2YJNA 1DCKA 2W93A 3ZTYA 4O2AF 3LC0A 1R7RA 1QZZA 1VE6A 2Z6QA 1ESDA 2CXRA 3CR7A 1IBCA 2OMEA 1EWYA 1U02A 2GBPA 2DPXA 3W05A 2Z5LA 2PKQP 3IBGA 4MQ5A 5I3CA 2LBPA 4Q4JA 3JWIA 2FQXA 3C97A 2EEZA 2ZG6A 4DCMA 2OHHA 1QG2A 3DE3X 4Q9AA 5FOSA 3BMXA 1XELA 3WO1A 1R0RE 4AICA 1QQ6A 1S8FA 4F8JA 1EFRD 1SA0B 3ZPXA 4BX8A 5JI3E 4OXIA 1OAAA 1ZP6A 4C4PA 3VPFA 3O21A 3HCFA 5C51B 4R1NA 1ORWA 4HDOB 3QUTA 5BSUA 3SYNA 1KVRA 4XD7D 4CLRB 4HDNB 5LLTA 3GDGA 4BN0A 1BQEA 1PDOA 1V8ZA 2DX7A 5JAZA 1ZGAA 4TRRA 3LZ6A 4UFNA 4YCJA 3WQHA 3VR6D 3HYTA 3JR3A 4WCFB 4GEGA 2PD4A 1TLTA 4A7PA 4IOJA 2IYOA 3KTFA 3D6TB 4MO2A 5LD2B 1E5XA 1JSCA 3QBDA 1FQJA 3CEJA 4WPGA 2IYPA 3C4JA 4P2BA 4N3CA 1SC4A 4GZLA 3KOZA 1LLDA 3NTXA 4KUGA 4DV7B 5DTIA 1L8XA 4LWZA 1K6XA 3S68A 5GINE 2O7VA 4YGXB 2F59A 1S96A 4DMLA 2G28A 4B6JA 3QPWA 5FFNA 5ULLA 1K6EA 5AQEA 5J4KA 4RTKA 1TJ5A 1ONSA 1T1SA 3PQEA 1BE1A 4M87A 4W7IA 1UINA 3C3PA 5CD1A 4QPCA 1ZG3A 1G98A 1V9LA 2E55A 4XONA 1GPUA 3KR1A 3LY7A 3NLLA 4REQB 4P7BA 4D3FA 4DR2B 2RARA 1J9ZA 3K53A 3ZY2A 4NV1A 1IK6A 5IDQA 1PIWA 3KBOA 4R9VA 4L22A 1BAPA 5CB6A 2SCUB 4AN0A 2A7QA 3GLHA 4DIBA 1UEIA 5BSHA 5BUZA 2H4FA 4WLNA 3E53A 2JFPA 1RI4A 2DR0A 3AYZB 3NO4A 1QYXA 2A33A 1KAEA 1Q21A 2CXOA 4IYRA 3VUFA 3JQ8A 1O97D 3L0IB 4W5WA 3DHNA 1KC8D 2C2MA 4M2LA 3DEYX 1ZJ5A 1QV6A 4R83A 1UZLA 1VYHA 1XDWA 3QWFA 4R2LA 1NUPA 3R3YA 3VJMA 4RZ3A 2DBQA 2Y68A 2PEYA 1OFUA 3CUKA 5CA0F 2UUBB 2DGDA 2YUIA 5IAGA 1I2AA 5LP6B 3HCBA 1J0AA 2R7AA 4P9NA 1VCNA 2QV0A 3TTSA 4Y6OA 1PVDA 1EX9A 2B2CA 2JGFA 4OB6A 3FKSD 4L78A 5EP4A 4B8YA 2JZCA 2VAWA 3CIFA 2AZDA 3CNLA 2W4IA 2HZ7A 3STWA 1QRTA 3E18A 2OYCA 2FP4B 2HF8A 1W47A 4XQ9A 3G0HA 4ZK6A 1I9CA 3AVYA 5IVHA 1B76A 1K0UA 3A4MA 3A6DA 1O03A 1XKLA 4NMHA 3WB1A 2G1AA 2QAGC 4R3WA 5LR6A 1YL6A 2EJTA 3FG9A 2CVOA 3NBXX 4PY2A 5KYUA 4FDLA 2HREA 4AS1A 1OLXA 4ZRMA 1EBBA 3AESA 3OJOA 2J08A 4BATA 4TKOB 4F3YA 4PLYA 1B74A 2EFCB 2J9RA 3IP3A 2C7QA 1YNSA 2JFWA 3SX0A 1EUCA 2HO5A 3O3MB 4PLGA 2BFNA 3NWEA 1VE1A 4TS1A 3W04A 3MT9A 2DH5A 3R5FA 1VI5A 4HAOA 3TL3A 1GQRA 4NPCA 3HP4A 4QUJA 3RADC 3V2UA 4V1CA 1PR2A 3KPVA 4HWOA 1CUYA 1F0KA 2CUNA 1JQKA 2OHJA 4P35A 3UMSA 1HT3A 1ZIXA 3EGIA 5ALUA 5DX1A 4BNYA 2Y1CA 3EY9A 3TZCA 1MBZA 3GK3A 5K05A 5L4NA 4Q1DA 3THYB 3I9V6 4UNNA 1VQOB 3HBJA 4ZZ0A 1VPWA 2PUFA 1JFFA 4M8SA 3QMVA 4L51A 4TZ0A 3I55B 1BE0A 1IHPA 1ORDA 4FWTA 1TU3A 2GLXA 1ZNYA 2AE2A 2OAQ1 2REQA 3LT1A 3NDPA 3OX3A 1G42A 3H42B 3QA3E 1T3GA 1Z88A 4R6WA 5JU6A 3IYLW 4C0KA 1ISJA 2O48X 2FSIA 1BMDA 4CMBA 4XN0A 4Q1AA 1OAOC 5EUCA 3P71T 2IE8A 2FWBA 4EX6A 2YWXA 4QOFA 2PKQO 3PNVA 4MTCA 2IHKA 4PICA 4LHZA 4QG3A 3A8JA 3AY3A 3PHGA 1X7ZA 3FOCA 1RBZA 3JQCA 3NIDB 4PWZA 2NP7A 3VC1A 4DR1B 2VHQA 1I6WA 4RE6A 1KGDA 4ZJUA 4N41A 5CFRA 1T4GA 4EW1A 1LSUA 3SJZA 3OCZA 1Z33A 1T6XA 4XJSA 5CRIA 5CVUA 5HS6A 3U7QA 4F9TA 5FTNA 3CVJA 3OJFA 2WWVD 3GQBA 2QXYA 3LM8A 2VRCD 3O83A 2C0QA 1UL1X 2P11A 4OYHA 1B2RA 3CEMA 3HDHA 1OXSC 3KLBA 5G4LA 5AVUA 4CNQA 4HB4A 2ZUWA 3I37X 4JITA 4OPSA 2OPBA 3ETNA 2NZVG 1YMVA 2VYVA 2AOTB 2CVPA 3BL6A 1DWUA 1JJBA 5FYDA 3WXBA 2W2KB 1NKTA 2YJGA 4GPD1 5T64A 3RC3A 1MQAA 2HK9A 3H18A 1Q3HA 4HZIA 2IA5A 1SQ5A 3EZLA 2Z4TA 3ABQB 4I5GA 3GLIA 5FWDA 2HF9A 2YN4A 3P9XA 1EGHA 1T1GA 5LJLA 3I9V1 1YFJA 3EPHA 2ERXA 2QLNA 2I4NA 2V3WA 2VHYA 2RI1A 3RAGA 3BJRA 1BKDR 1M7HA 1ULZA 4B3XA 5BUCA 4DUYB 1JXOA 4XQEA 1AKUA 2BZ1A 3PK0A 1VHJA 4AJEA 3GFVA 3ZI7A 3W90A 3SYKA 3ICPA 3IAAA 1GVNB 3E7WA 4RPIA 1OU0A 3A10A 4N49A 5K3FA 3SC2A 1KI7A 5BYKA 5BOSA 5AVRA 2I4OA 4WWHA 4O8CA 2IP1A 4EEXA 3N8KA 4BNXA 4DF3A 2QN8A 4H15A 1PT7A 1PSWA 3F0TA 3L8FA 1N1MA 1U8TA 2PU7A 2WD7A 3QMMA 4FNGA 2XODA 4Q05A 4X93A 1VSUA 3ZE9A 1PK7A 4Q02A 1GZ4A 1JVNA 4L3VA 3U39A 2YXPX 3KL9A 4G0XA 5FOTA 3AILA 3CLTC 3WNZA 1DTEA 4BJ5A 5B1YA 5LMCA 1NN3A 4ESOA 2H9YA 4ARUA 4C04A 1GCOA 4WFKA 1VHDA 5JAQA 3ZEAA 5JNRA 2W8BB 4ZPXA 3T7IA 2W4MA 1FUUA 3PE6A 3FOFC 1OGYA 4TPKA 4TLMB 4ETWA 4ME6A 1E7SA 1F06A 3VRHA 4Z3OA 4KO8A 2KBEA 2A0XA 2ZJ0A 4P82A 1PDWA 1XD9A 2XDYA 2ZM5A 1YC2A 1V1RA 1RKVA 1OHHA 3FX2A 4MHSA 1ORRA 5EE9A 4BJ6A 1Z0IA 2PGOA 4X0EA 5GOZA 1U0NA 3CCMB 4MUNA 1Z74A 4GKVA 4IFBA 2HMUA 1PKXA 5CVEA 3ZKWB 2RCYA 1ZD1A 3WGJA 1Z22A 1C4KA 2WYIA 5DOVA 3U1BA 3DZHA 4P3OA 1GUFA 2VDMB 1P4MA 1VQNB 3O8OB 2Z3VA 5KQLA 2B36A 3OQVA 3HMQA 4B2PA 1OT3A 3CLHA 3CXCB 2JNWA 1MJFA 2R96A 4OJKA 2X23A 3IV9A 4Y1EA 2V65A 2QMUA 2P77A 1EFUA 1SH7A 1Z8FA 3DZCA 3BWEA 4N76A 1OIXA 5CDUA 4PCVA 2G7ZA 3RVDA 4WLUA 1YZTA 1CNEA 1IY9A 3GVIA 6GPBA 1KI8A 1IHDA 2O06A 2VUHB 1NE2A 1XE1A 4EATA 3DDSA 5KJCA 3EVGA 4NBLA 5C2JB 4R2IA 3R75A 3ELDA 5A06A 2B3DA 4IH9A 2B5VA 3O8QA 1E5QA 2GESA 4U7JA 5F9MA 3Q7PA 5TDHA 2VBSA 4MB6A 2V7XA 3FPLA 2V7GA 1O0CA 5KHAA 1IXYA 4FLEA 2P9BA 4RULA 1RRGA 1AXGA 5U4QA 3BK2A 5ECYA 3H7AA 4AZ3B 1JDJA 1QK5A 4ACAA 3F6EX 3OZDA 5EJ6A 2Z5GA 2W6CX 1JQDA 4RFSB 2HJGA 2HKIA 4TMKA 2JRCA 4XQGA 1E1DA 4MQFB 3EEYA 2CXQA 2PM8A 5DNEA 3OTQA 2W4QA 1MZVA 3FPJA 1UBMS 1WXXA 3MRSA 2Q2OA 1N8SA 1TYEB 5HZHA 5IEBA 5FWXB 4H7IA 2BSXA 3JZDA 4XM1A 4EHFA 3KWJA 1QWOA 2PAAA 1RZ3A 3OUUA 1M7GA 3JZAA 1U2SA 4GMDA 3UOWA 3V7YA 3OA2A 3RTBA 2PJDA 2XMSA 3SFVA 4ZCQA 4BBZA 1UT8A 3T1HB 2HRDA 1OFTA 3A4NA 2DJIA 1NBIA 1QR6A 2X2OA 3EEQA 1ZMXA 2GUWA 3NHSA 3R3UA 4IDDA 3ABIA 1PJ8A 2FEAA 1REQA 5JXGA 2BHRA 5K0SA 3UUFA 5DT9A 4ZZ1A 3G8AA 1VYVA 5EHZA 3F4BA 3BKWA 2WTBA 4TKUA 1PWYE 3HYSA 4A92A 4RHFA 3C7CB 3FHOA 2CLLB 1KK2A 2C92A 4P4SA 3SC4A 1G0OA 1QORA 3KUXA 4DSAA 3UA4A 1ODTC 4M8KA 4DT1A 4WXRA 3TKYA 3TNJA 4I8DA 3BTVA 4MYDA 4N7RA 4QJ4A 4NNJA 2AD5A 5K99A 3EYAA 4HXEB 1UXHA 3PUNA 3R0JA 4MKZA 4JGIA 2F8SA 1RP7A 3NAQA 1IM5A 5BPHA 2EQ5A 2HSGA 3LUGA 3ILHA 3Q72A 3KPWA 2RAUA 4RETA 4YNBA 2X0RA 4C03A 1VZ2A 3PGJA 1W8DA 1XUOA 2C4VA 3VKUA 5JPDA 2EX1A 3TM5A 1WMSA 2VJYA 1Q22A 5E7MA 1OV4A 1UIMA 4J16A 1O8BA 3BFPA 1WRBA 2QQGA 3PIDA 4XA8A 5JSZB 1DJNA 4QYIA 4R81A 1BCSA 1L7QA 3U4CA 1PYDA 5FUYA 4P83A 4XD2A 5B1HA 1E1RA 4JBHA 4G4IA 3P9KA 4AYWA 4UVDA 2Z6VA 4DDUA 2D5BA 2ZB8A 1XCPA 4UNRA 1ABBA 5CW1A 1XD2B 1N25A 4NLLA 2QL7A 2WVJA 1PGPA 1JEQA 2EGUA 3OZCA 4CG2A 4LF6B 2IZ5A 5I01A 2ZIEA 1B23P 3NTLA 3FPSA 4PGFA 5DSXA 1KMHB 4ZXFA 4HAXA 2Y67A 2WINI 2BEUA 1TB4A 4DA0A 3SJCA 4TL8A 1XMPA 1ONOA 2Z1DA 1E1QD 2X19A 4JD5A 5E4FA 4QFBA 1G21A 1XEXB 3T3PB 2R2AA 3LYLA 3ZWKA 4B6OA 2D3LA 4ROTA 2XCIA 1OCEA 1WETA 4EPYA 1IVYA 4FD2A 4K9NA 1ZI8A 1ZGJA 2R7LA 1HE3A 3DOIA 4B6PA 1U2GA 3L84A 1RP1A 1JQ5A 3Q8MA 1GZ7A 2QTHA 3MWJA 2HV8A 2CNWD 2Y0BA 3OKFA 4ARZB 3WFJA 4PYOA 3CRW1 5KZMB 1Q0QA 1RBYA 1KDYA 2RK6A 5IYQA 1YJCA 2XT6A 3FCEA 3ECCA 4OAPA 2C78A 3D2AA 4MUKA 5FLXA 2Q0XA 1ZK0A 2DJ5A 1FBTA 3OOWA 2JIRA 1Y5MA 3AUAA 4LXYA 5HOQA 4E1AA 1YIOA 2JJ2D 3FDFA 3MCZA 5M3BA 4C2BA 2YTZA 4I6GA 4R40A 3RKRA 3I5YA 4TSRA 1Y98A 2FFBA 3UXMA 4DPKA 4D96A 5LZ2A 2I1WA 2EJUA 1MP0A 1UJNA 4OXKA 5AXAA 1L5VA 4O29A 2IF2A 4LQ4A 3AERA 5REQA 4GXQA 3EGWA 3BWXA 3QKRA 3TUIC 1NM5A 4YAWA 3PBKA 4RZSA 5C5CA 2XNKA 3LBIA 5AKLA 3TLBA 1U5BB 4FFVA 4JNKA 1BOFA 1NG9A 1L7VC 4NBUA 4NZYA 5HIIA 1PU2A 1YKGA 3U4QB 1V8FA 2CJWB 2R8ZA 3I5MA 2BMEA 3H94A 4RPCA 4YV1A 2I2DA 3ZCUA 4S2EA 4X65B 4FFDA 1DSSG 4JB3A 4XIFA 4IIDA 1BW9A 5LIPA 1L3IA 3GNLA 3TJZA 3WWYA 1T9CA 4HWSA 4YPVA 3IP1A 3U3ZA 1PTJC 4H31A 3WRWA 3I9OA 3SEJA 2H4YA 2SECE 3PE3A 3Q8LA 1J07A 4XCXA 4XOIA 1N4AA 3RTAA 1OTHA 4AZ0A 4HDRA 4LMAA 1F60A 1QG6A 4EW3A 4A6XA 1RLTA 1BE8A 1PL7A 5BN3A 4GOOD 2QVGA 5AIBA 5AW3A 3UFBA 2VYFA 3KSAC 3W2EA 1JSZA 3GT7A 4KRYA 4YIKA 1QLWA 4QXRA 3WQQA 2P6MA 4I55F 3QSYA 2K2WA 4LZNA 4Q24A 5KOJA 3NB0A 4PVCA 4FIZA 1A76A 4XPIB 1VQKB 1G4HA 2RG7A 2WA1A 4FS3A 3IUBA 3AUYA 3LUKA 3D0QA 3BXHA 3VJKA 1RBMA 1TZBA 1OLSB 4XKWA 3Q41A 4AVYA 4DFDA 3GCWA 4QAQA 3BXGA 1DLJA 2F62A 1O6BA 1U2QA 3MBIA 4K6CA 1UD8A 2EKZA 3SZRA 4M9QA 1MHPA 2EGHA 4KQMA 3KR2A 5B4UA 3KZVA 4C30A 2XIJA 3D26A 3VH3A 3KLNA 5FWYB 4WZLA 5K0GA 1GTG1 3OUZA 3ZCTA 1QDEA 2EL7A 3ACBA 2FKAA 2QLJA 2Z5FA 3KR9A 1THMA 2DTXA 2PANA 4LXQA 4BAZA 4DMHA 1DTSA 3OQIB 4OUKX 1EM8B 2H1SA 4O4JF 2P2YA 4XXHA 1NDUA 3QPCA 3DO5A 5FOWA 5A03A 4H7DA 4XR6A 2WWHA 1ZLYA 2G9QA 2P40A 3HGMA 4UDNA 3CUWA 1T2CA 3L8ZA 3R7AA 1T9ZA 4NEQA 4AXXA 1VLVA 1W9MA 2WT8A 4R8MA 2PMFA 3LDGA 3RK1A 3HCNA 2O0KA 2FN9A 4DG5A 4GNKA 3EIUA 1CE8B 3ND5A 2WNHA 4EGAA 2XGGA 1Y3HA 2NTNA 2XNHA 3A3KA 3D1VA 3M34A 3PUMA 1SVWA 5IJAA 1JR3A 1IQPA 2YY5A 3NWPA 3OJEA 2HRBA 1Y37A 4XLZA 4A8HA 5I7VA 1AGYA 4OMDA 1L7NA 2FG7C 3GG9A 3MIZA 2TMYA 3RNOA 1T9HA 4YXFA 3R6DA 4PXSA 1OXBB 2BFCA 2QRMA 1M72A 2R8BA 4B4OA 2I6TA 4XLFA 4BQPA 3ZWAA 3IELA 3VHQA 2H0AA 2DPLA 1A9QA 4IHKA 4JEHA 3ZD8A 4A5SA 3PQ6A 1SB9A 3ITEA 2FAXA 3TQHA 1K92A 3COPA 4QUEA 3DNMA 2W42A 3WISA 1XQBA 2DPGA 2J9ZB 1J8QA 2XJ9A 3IMGA 3L1JA 5SY4A 3PTAA 3E81A 4U0KA 3UPUA 1BJRE 1S8OA 1DMRA 2NT4A 2O57A 2PSHA 3F2IA 3QI7A 5FOVA 5I7AA 5ALGA 1YF3A 3M33A 1PWEA 3AF0A 4XEHA 1QE3A 2RSLA 4JJGA 2B4YA 3CJTA 5ALJA 1JTVA 1NVGA 3T3OA 2J32A 2X53S 5AVOA 5ADWA 1TECE 5LLDA 3UF0A 2N47A 3C3WA 4J9UE 3H65A 1VL8A 1GAEO 2D2FA 3C3DA 2P6NA 3QX7A 2EGGA 2XLBA 2XUZA 3C45A 1AX9A 1T0PA 2JBAB 2PVCA 3T3DA 2OC9A 3L8GA 4H3SA 5I9BA 3TH5A 4DADA 2VJQA 3FTCA 4K2AA 4PSDA 4X64B 1TYZA 1WP9A 1I13A 1C4WA 1XJWA 2A14A 4DWWA 4FE3A 4UULA 1GPMA 1K63A 4LWOA 3RVNA 1OSNA 3CX4A 1VQ6B 4C0LA 1J0EA 1SUWA 4WI1A 5E4JA 3T1NA 3OCWA 2AEJA 1RKQA 2NU7A 3TBHA 4A03A 4JP2A 3OA0A 3BSFA 1XEAA 3ZV5A 4ES6A 3UFXA 3ZX5A 1SK9A 2XYQA 3H7IA 2HB6A 2HY7A 5B36A 1PJQA 2NWQA 4F1JA 2YFKA 3KP1A 3M9XA 3PXBA 2YMLA 2Y4OA 4GLOA 4WY2A 4M0EA 1V5FA 2Y1FA 1IMOA 1MO4A 4LJSA 2ZW9A 2WT4A 2BYTA 2CHFA 1K9VF 1QTNA 4RMJA 3KVVA 1ULTA 4GI5A 3H2SA 5HA5A 3NM6B 3G79A 2NVWA 3C3CA 3Q8WA 3W5DA 1P6XA 1XE3A 4EZBA 3QFTA 3VPXA 4MCHA 1B4DA 2ZWIA 3M1YA 4EKDA 3UMBA 1GO2A 1Z4NA 1KBOA 1NF2A 3O4VA 2RGCA 5JE8A 4LXTA 4YASA 2YX1A 4ATNA 1Q0RA 4RJJA 2QSJA 5KNDH 3EZGA 2IYFA 1J23A 5LQMA 1PGQA 1TUBB 3WB2A 5GVSA 3PV0A 2GPSA 3GVXA 4MA4A 4LYHA 2A7XA 3RYHB 4EFNA 1Q5PA 1XI2A 1JQAA 1KH1A 1N5KA 2ETVA 3PRJA 3FRJA 1XRJA 5I9SA 2HUNA 3KCQA 4ZT6A 3WQZA 1QGAA 1CDEA 2BKVA 2C3OA 3K0FB 1Z25A 1A5TA 5LA6A 4QATA 4B3MB 1JJAA 2JCVA 4GEKA 3EX7C 1J5EB 4WNCA 4IS2A 1OH6A 4E88A 2Y1DA 1U98A 2HA3A 3DLTA 3DTYA 4RGYA 1BEEA 1F6DA 1FQOA 1VKHA 1XAHA 4GYJA 2WYVA 4NYIR 2AYXA 4F84A 2PSDA 5JECA 5TMBA 1S9HA 2VP0A 4E5YA 2IS2A 1I2BA 3VKWA 2YQZA 3KZCA 3K9LA 4P6VF 1M2FA 4HB2A 2CLHB 1X74A 3LT0A 3P4XA 4K46A 4KNWA 5DN9A 3T1OA 1GCUA 3Q6IA 5JNWA 4ZCMA 1K3UB 1SZJG 3L0BA 1E7MA 4FCTA 2HCRA 1CRLA 1SUPA 4H1WA 3H9BA 1D03A 4QJ3A 1QCDA 4IJQA 4B0OA 1O2DA 3U3XA 4X6LA 2OA0A 1GTL1 1JZTA 4MHTA 2G9ZA 1AQ6A 1YI8A 4EWLA 4DV6B 2AT1A 4C2UA 2WJIA 5EJIA 1QGYA 3PICA 1O08A 4Z4SA 1A7UA 2IZ7A 4OI0A 3E0QA 4GP7A 4JLUA 1Z0SA 3FAKA 3OM8A 1SD5A 3MXOA 1OX6A 4WINA 3T5GA 3D5TA 1IN7A 3HWRA 3O8NA 1NJ8A 3BL5A 4N5LA 3C6QA 5EJFA 3SFTA 3G23A 3UKDA 1FSZA 4AC9A 2VH2A 1JIJA 3ZQ4A 5EJ7A 1G2QA 5EJ8A 2OECA 3M82A 2CVQA 4R4JA 1WHSA 4IXNA 5BR7A 3EQ9A 4PGMA 3SMQA 3ONVA 2GETA 1K89A 2XVYA 3CVWA 4DR7B 4X05A 1QVVA 4XUEA 4CKEB 1J4AA 1HEYA 1MOQA 3QX8A 1YCFA 4IWNA 4JOSA 4B34A 3VR2A 1TKAA 2BGLA 3WGKA 5TPZD 2BLNA 4E46A 1KPHA 3M4YA 2O8VA 2R2GA 4Q3EA 1EAYA 1AH2A 3KC2A 4IVNA 2VPIA 4I9UA 4LTMA 4OXXA 2VDKB 2HMVA 2IYYA 2KE5A 4FT4A 3D6MA 3GUCA 4CBVA 5BWOA 3GJQA 3O5AA 2IVFA 5KOYA 1IY8A 1IZ9A 1NVWQ 4FMCB 3TMYA 2C4NA 1H94A 4MV7A 4EUFA 3R6WA 1ZJZA 3CT4A 4FQ7A 1YZLA 4GL2A 2F1RA 3GJ5A 1KYXA 1D7AA 3BMNA 3KRTA 1Q7YD 3T5AA 2ZB3A 5TPWB 2H5EA 4HX9A 3PX3A 1L9KA 2NV4A 1PS0A 3HFGA 1UAAA 3BAFA 3NI2A 4L8VA 2JH8A 1FC0A 2WKRA 4E5DA 3A2KA 3ZU6A 1YR2A 2BEVB 1IB6A 3U4MA 2B99A 2GCOB 4M38A 4YELA 4N47A 1AHHA 4CI9A 3U09A 2WNSA 4H16A 5JC8A 3ISXA 1RXIA 1T5DX 4Q9JA 2IV3A 1ZO8A 3DB1A 5K2OA 2QUAA 3GXBA 1IQUA 1EE1A 3EOBI 1JDBC 3FSRA 2XDAA 1YVDA 2MDTA 4Z8XA 4YB8A 3M70A 1EFVB 4O5AA 4Q19A 4YMIA 1DXHA 1AMOA 5AR1A 4CM9D 5F35A 3MJTA 4AG6A 4UHDA 1T8YA 5DEIA 4RVHA 3DVLA 2ISCA 4DY6A 5CBPB 2QGZA 3TFWA 2VYQA 3GAZA 2M6LA 1Q1GA 3II6X 3LBAA 3KAJA 4GE3A 1O4WA 2NADA 2BDTA 3B89A 3C87A 5E6SA 3UYKA 4GG1A 3N2EA 1ZHOA 1CHDA 5JSUA 2JFYA 1Z3IX 2IK8A 3BFXA 4ON9A 4YRKA 1RWOA 1ZI6A 1Z16A 3EWIA 2HWYA 4MIEA 4ZCRA 5C35A 2OLEA 4LTNA 2IH4A 4OYLA 1AKEA 1FNDA 2XKJE 2YY6A 5LCXA 1BX0A 2OESA 2ZVDA 3V7AA 4EGJA 4G5RA 2QZSA 1Q7TA 3LQEA 1OZ0A 2PIAA 1QHIA 2LR0A 2OAEA 3CWQA 4HE5A 1UADA 2ZDGA 4BNIA 3OSUA 5HQTA 1RZRA 2ASEA 2ZSFA 2NVUB 3U44B 3ETEA 2I3GA 3DKPA 3GZJA 3L43A 2H08A 4OHWA 3EWNA 4FEGA 2Q5JA 3QLJA 5DP2A 1PLLA 1SHZA 1TK9A 1FFGA 2FRDA 1XQVA 4DEXA 2DFKB 2QV7A 3IUMA 4QT4A 1OYOA 1IHXA 3HKDA 5CITA 2EG5A 2GN9A 3T7KA 3H1EA 3OHSX 4P0TA 2OCAA 2YFQA 3PHIA 3B3GA 3L06A 2I6SA 4EGCB 1NU6A 4PTYA 2IOQA 1UPUA 4IKOA 2D59A 4PAMA 3MT8A 3RAPR 1XRSB 4HXGA 4F4DA 1IPEA 2C42A 2O3SA 2QM3A 3RE1A 5D2CA 1KSJA 4MOWA 1H4TA 1R6TA 4EYEA 1Z5UA 4F6RB 5J9FA 4X1IB 2EFJA 4BO0A 2PWAA 2XUHA 4XVCA 4UBJA 1DWPA 2C9YA 4JYPA 2NSDA 4MWDA 2PX0A 2XBLA 4E0BA 2BHSA 4Q3DA 3AHIA 1QS0A 3H1AA 4WXPA 3UUWA 5L4LA 1MIOB 3TW8A 4R8RA 1QH1B 2QR2A 3H4TA 4OXNA 3WA6A 4P98A 5JNVA 2GXAA 2H7YA 5SZKB 4PS0A 3RTGA 4GD3Q 3V4PB 5E4TA 3DXYA 1CJVC 3WZMA 3HKBB 5B3AA 5CFNA 5J5VA 4M9RA 5K45A 4L3WA 1GQYA 1BEZA 8MHTA 2F1LA 4G86A 4LFCB 1CRQA 2BM0A 1CK4A 4ROXA 4Y2XA 2D06A 1QHNA 5IARA 5CG2A 4HAZA 5JYBA 3KV1A 2VWGA 3BMOA 5KYYA 1G6OA 2VHJA 2O2SA 1Z0FA 4DSTA 4KQIA 4NATA 1NL3A 3KYCB 4DQXA 1I94B 3LC2O 4H7EA 4ND6A 3ZW8A 4DVGA 1NRIA 1M2KA 3MNFA 1CS0B 2P9EA 3EBOA 4ISBA 4YJFA 3JWGA 1CNFA 4M83A 3OFJA 4P1ZA 1GRCA 1O96A 4JUFA 2Q27A 3E61A 4Q16A 2HA4A 5DCYA 4KPFC 3WKBA 2PRZA 1MGPA 5ICFA 4UEKA 2PX6A 3MMXA 3Q6RA 2WJ6A 1P9RA 4GBED 3EXHC 3OT1B 1BH6A 1DEOA 3A8TA 3CEPB 3ICOA 3VDQA 4AKEA 4GT1A 4P0PB 4D3DA 2I6GA 3QNMA 5TX7A 4BNNA 1VPLA 2RAFA 2MU1A 1S1MA 1AF7A 3FPHA 4Z0PA 1VL5A 4RKFA 5F2KA 3RB8A 1SKYE 3I09A 4FMDB 3X1KA 3ZJTA 1IPFA 3NW9A 3TZHA 1YVEI 4ASUD 1QMGA 3H75A 1P2TA 1EHYA 1AVTA 2E3JA 3PUJA 4PAQA 4O33A 4PLVA 5HP4A 4C7BA 1XZNA 4QOJA 4KXVA 4QTXA 3K30A 3GMDA 1RBQA 1SXJA 3ZWMA 1V11B 3WDMA 5FFFA 4QPJC 2GD2A 5MDHA 4M1YA 4DLNA 1QIFA 2CMDA 4PLCA 1YRAA 2WD9A 2ZJ4A 3CPJB 4C4OA 2JCGA 3ICWA 1DUIA 1VJTA 3SMVA 1NZDA 1E4EB 3MAGA 1UCFA 4X1YA 5HBGA 4QSMA 4TYQA 4E5SA 4K40A 3OW2B 2VSNA 1QRUA 1K6MA 1D4ZA 3DBHB 3GEEA 1B0ZA 3NANA 3Q0EA 2AZXA 1SPXA 2XIQA 3G7NA 2DBYA 5DNCA 2GNPA 4OHVA 2OKCA 3JQ9C 1YASA 4YALA 2RONA 3E15A 4FW9A 4MWOA 5D3MA 1KQNA 3HVUA 5AUQA 2O19A 2DSNA 4NKRA 4IOMA 3STTA 1A82A 2QGGA 4HQLA 2PEZA 2XH8A 4PYIA 1H2FA 2BMDA 1KQOA 1M74A 3RT1A 1R6XA 5AJUA 4RTNA 1TLLA 3S3TA 1GAQA 2I3DA 9ABPA 4R54A 1LPAB 1THZA 3T9BA 5CB4F 2ZVQX 1E9BA 2EYUA 5KMGB 5ADUS 3VH2A 1EK5A 3NGLA 1JMVA 4XI9A 4DWJA 3ZBPA 2O3QA 2ZTNA 4BOYA 2VDUE 1K68A 2Z9BA 2M98A 3H8WA 3TG8A 1G2OA 4IJ5A 3OKAA 5LNK6 2PRIA 1M2EA 3F6YA 4IKEA 4QBGB 3SJBA 3GFSA 1SC6A 2BW0A 1E89A 2VYCA 2BFBB 1G5HA 3R3ZA 2XUKA 3H4VA 4MPJA 4V0RA 1DAGA 2V6GA 4HLNA 5FA8A 1MEJA 5FCDA 3OZUA 4OBBA 1KI1A 3TIIA 4R2MA 2Q5QA 1MJHA 2B34A 4EY5A 5LQSA 5A02A 4FCVA