4TN1A

Translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MNKDNLRSPICCILGHVRTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVEAIKQKTAVVNKDGKFEFKVPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTIESLRLLRERKTPFVVALNKIDRLYGWKKIENNGFRESFALQNKAVQNEFRNRLDQVKLQFAEQGFNSELFYENKNFARYVSLVPTSAHTGEGIPDMLKLIVQLCQERMASSLMYLSELQATVLEVKAIEGFGVTIDVILSNGILREGDRIVLCGLEGPIKTNIRALLTPAPMRELRIKGQYIHHKEVKAAQGVKISAPGLEGAIAGSRLLVVGPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords eIF5B
publication title A monovalent cation acts as structural and catalytic cofactor in translational GTPases.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Translation
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4tn1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tn1A01
3RRMA 1ZYUA 4A4DA 2JLXA 3PCRB 5JFGA 3KUDA 4MKHA 1Z0AA 2C98A 3CNLA 4KAXA 5FUWA 3T61A 4BFYA 3L0PA 4C7OA 3ZZTA 3X2SA 1BOFA 2D2FA 1G21E 3KXLA 5DE3A 3LD9A 5HR5A 1E9BA 5SZKB 1UFQA 3R20A 4ACAA 5KSWB 2GAAA 3L8YA 2TMKA 4NYIQ 3DDCA 4K81B 3CX8A 3K53A 2ORWA 1X1SA 4UAJA 2ZRFA 3MWLA 3B9PA 1MABA 1WRBA 3U3RA 4MKGA 1IJFA 4TMXA 1W4AA 3R8CA 2ZI9A 1GDDA 2FX3A 2IF0A 2GCNA 4RD2A 5DI9A 5DHFA 3RS4A 3CC4B 2AD1A 1X8LA 1IHUA 2IYQA 2ZRGA 2WWIA 3SYKA 2Q3MA 2QE7D 3BJIC 1Z8FA 3RAPR 2X3UA 2GEUA 4YAOA 1V43A 2MMCA 2PT7A 2X19A 3ADKA 5JEDA 1E2JA 1OB2A 2J7KA 4B33A 1QVFB 1ZNWA 2QT0A 4ZIRB 1SVMA 1OHHA 3VQTA 2IYUA 4KI0A 3IO5A 3IPXA 5FUXA 1OB5A 1OXVA 3SQXA 1XF9A 4C0LA 1KI6A 2HMAA 2QZ4A 2ZS7A 4WQMA 3TE6A 3AVOA 3K0FA 5FPTA 2RGDA 2GZHA 1FRQA 4TT3A 4DBLC 4I81A 1QBKC 2D7CA 3K1JA 4ACBA 4D82A 2PZGA 1WCV1 2K5UA 4TQAA 4BLRA 1NMYA 4B2PA 2D4HA 5FBRB 1G5PA 1YHNA 1UM8A 4QBIA 1E6CA 5FL7A 2J0UA 1MO3A 5EE9A 3I56B 4V0KA 4DWJA 1EWQA 1Z22A 2G77B 3OIVA 3W90A 4HLCA 4AG6A 2IWRA 1NDHA 1NLZA 3GJ3A 4IXNA 5DYIA 4LV5B 3IUYA 4C4PA 5C46F 1TQ2A 1XXHA 5AJWA 4FMCB 5FTMA 4NE2A 4CW7A 4P4UA 2GJSA 3CNOA 1KD1D 3BXZA 2OBLA 1ZM3A 1OIXA 3EZ6A 3H1TA 1SULA 3VTKA 2GXAA 4LK2A 2PT5A 2VHJA 4U00A 1W0JD 1PLJA 1GUAA 2EIXA 2J87A 3K9NA 4MITA 4V0ME 4AURA 3U44B 3CRW1 3TVDA 4B3DA 4FW9A 3AV0B 3RANA 3AVXA 4IDHA 5EUQB 1GOTA 3OZWA 3CKLA 3Q85A 4NTZA 5FI1B 4A8JA 1M2OB 5H1YA 1NI3A 2ZS9A 3LLMA 3ZQJA 1Z08A 3E1YE 1DAGA 1G8FA 4X8HA 3ZVMA 5TY0A 3PUVA 1H65A 4YALA 3BERA 4TLDA 2NOAA 1R5BA 1G18A 3CZQA 3K8YA 4NYJR 3O8RA 2VHUA 1UPTA 3GEHA 1A2BA 3L43A 3KQLA 3I1FA 2ZUDA 3K09A 4YMVA 3KJEA 1VG1A 4QC2A 1W34A 1SKYB 3NTUA 3BD9A 4CEJA 1Q1ZA 1KHTA 4Y9UA 3AQ4A 1JQJC 2P6RA 1BMFD 2EYQA 1W2HA 4Q03A 2A5YB 2ZSDA 3CH4B 1FUKA 1EX6A 2IXFA 3BB1A 5JJLA 3AVWA 4JSTA 4MKFA 2VHQA 1UBCA 1VCMA 4ZDIA 2CE2X 3CC2B 1GNQA 4G01B 2BWJA 1KY2A 2OG2A 4PSVA 3TW4A 1E0AA 2KJQA 4EDHA 1M1YE 1QHSA 4HI0E 721PA 1Z2CA 3P27A 1XEXB 1ONBA 5HE9A 3TJZA 1EP3B 1OPXA 4C0HA 4K1XA 4CEIA 3CNNA 2QNRA 4EJSB 5CB6A 1HH4A 2ZRHA 4W7SA 4FN5A 2VLIA 2GCOB 5JRJA 2IYTA 3X1ZA 2QBYA 4RSGA 2IEZA 5LPNA 1NJID 3HR7A 2SHKA 3IQWA 3CUEF 4JVLA 5TDHA 4FMDF 3VMFA 3DOEA 2FSFA 1Q86D 3THXA 4DIEA 2BMWA 2B6HA 2Y8EA 2ZSFA 5CLQA 4C0AC 5E7JA 2F3TA 3ES9A 2ZYWX 1Q44A 4C2TA 2HLDA 3E70C 2ZJYA 4KCGA 1SXJB 2W6JA 1E9RA 2HXYA 3NH6A 1AZTA 2XXAA 3V76A 4LJ5A 2ZI4A 1GVNB 1SVSA 4UNNA 5CM9C 2IYZA 5HPYB 3Q7QA 3QKTA 4OQXA 2O8BB 1QF9A 4I1VA 3VO2A 1FTNA 3LY5A 4I1OA 3MJHA 4KBFA 4Q9IA 1NG9A 1GM5A 1CR4A 2WPDA 2BSAA 5J5CA 4URWR 4OHWA 4Z8YA 5EQTA 2REBA 4G1UC 4QM7A 2WHXA 4FCWA 5H8WA 2JJ8A 1XJQA 1CRQA 4XWOA 4DJTA 1CIPA 4Q4LA 2BHRA 2V4ZA 2VP5A 3LBNA 4URYR 1KAGA 1VQ9B 5TXGA 1G3RA 4ZCMA 3KTAA 2REOA 5FBLB 4RD4A 1VG0B 3QQ5A 2FGJA 3M6AA 3QF7A 2IL1A 3THYA 4JBWA 4IFBA 1W47A 2ZSAA 1Q57A 2FZLA 1N25A 4EFNA 4C2UA 3FWYA 4NCKA 1NVWQ 1NIJA 1X1RA 2CNWD 2OESA 3I73A 3NKVA 1XPUA 2P3SA 2AKAB 3SEAA 5B64A 3SJCA 4TLAA 4Q1DA 3D3QA 1YIJB 2BBOA 2ERXA 4TMWA 1IOZA 1CU1A 1Y3AA 2DR3A 2V54A 3MUFA 4W5WA 5FOSA 1JI0A 1XRJA 4DIDA 1K73D 3ZZUA 2VEDA 3DHWC 5DN6D 1ZAKA 4W9MC 3GLHE 2ZE5A 4MGZR 1Q12A 3UG6A 5GV8A 2AXNA 1DVRA 4M1OA 2XSZA 3KB2A 4R2IA 2XNCA 2E1RA 3CRZA 4M1YA 4JKYA 4RFSB 2JDIA 3TUIC 4IDOA 1SQ5A 4B6EA 4TYPA 1ZJ6A 2ZRKA 2CJWA 2BPOA 2WICA 3NEJA 4LYJA 2I3BA 4M2LA 4EH1A 1KI4A 1K8AD 3PITA 1IXRC 3H84A 3KX2A 5FR2A 4K8OA 1KI6B 3OW2B 3GPLA 5EE3A 3TGPA 2W0MA 4HE5A 3CBQA 2WJGA 1G6OA 1KI7A 2H1LA 3CLVA 2DEUA 2XNDD 2AFIE 2LWIA 1G3IA 3CXCB 4U7DA 3EX7C 1QG4A 5EUMA 1B23P 5DNYB 4ZI2A 4LYAA 1PLKA 3N2EA 4N0DA 4L9WA 3ADBA 4PPFA 2EU8A 2IXEA 3OE7D 2XGJA 1W4CA 2J0QA 3I55B 2QGNA 4LC1A 3U60B 2ZTSA 4PFSA 1GRQA 2XZPA 1NVVR 3H0KA 4C0JA 1Q20A 2OXCA 5LDDC 1QDEA 3GLGA 4KJZA 5EMNA 2FF7A 1CBUA 3F5FA 4FWTA 4YC7A 3FFBA 5E7MA 5AUQA 4KVAA 3AVYA 2CE7A 1KMQA 1U99A 2H18A 5EXSA 1OH6A 1CULC 4Q01A 2A2ZA 4A92A 5GJBA 2Z5FA 1RKBA 2HF8A 2PZFA 3WNCA 1NY5A 2A9KA 4KFSA 4LPKA 5LD2B 2F9MA 2WOJA 1E69A 4HLUA 3HJNA 2QROA 2XB4A 2F1RA 1E9FA 1FNCA 2HUPA 2I1QA 5KU1A 1D2EA 4UJ3A 1P75A 4NONA 4BE7B 4BFXA 2GF9A 4Q1CA 3H86A 3IEVA 1CQXA 4XIGS 2OHFA 1QVGB 4PTLA 1DS6A 4ITRC 4DZZA 1Z0FA 2WSSD 3QBTA 1WBBA 3C5CA 3HU2A 4CEJB 1XTSA 3D8BA 5BN5A 3GJ8A 2IYRA 2QE7A 1AQYA 2BCJQ 2KBEA 5FBWB 3ICEA 3L82B 3I61A 2AFHE 1UJ2A 1WXQA 2WJIA 2ZSEA 1M7HA 4HLQB 1GL9B 1E4VA 1TPZA 3AGQA 3CWZA 4AY2A 3EZ7A 1YVDA 4BLPA 4ZGNB 1N5LA 2OAP1 4RD3A 4LHZA 3C5HA 3DM9B 4KFUA 3TSWA 3T1QA 1KK2A 4RD6A 1K5DA 1G3QA 1JB9A 3U3KA 1UAAA 3QXJA 1E9SA 1ESMA 1KZ7B 1RVDA 1E1QD 4DB4A 4MDFA 4CEIB 3B85A 4NMMA 1AJEA 3DKVA 1S3GA 2AWNA 1W4RA 1E99A 3T5GA 4HDQB 4G1BA 2FMXA 2YHSA 4WZ6A 4JS0A 4ARZA 5K8IA 3SQWA 4PHTA 3UWKA 4B74A 3A58B 1XEWY 4Q19A 2W83A 3ND9A 2WSMA 1KIMA 4F7WA 4GL2A 2B7CA 1OKKD 3AP3A 3R9IA 4B2LA 3RRNA 1JR3E 1GIAA 1E2LA 1DAIA 5A0FA 2VNIA 4HLDA 2RHMA 4OQNA 3SDZA 3H2YA 1T3LA 3LW8A 1XD2B 2ZRLA 3GQBA 1TX4B 3OEED 1N2CE 1WQ1R 1N6HA 3BIFA 5CYPA 3RC8A 1S2MA 3WP1B 3B60A 1CP2A 2IXGA 4E22A 1KJWA 4M0LA 1G7SA 5GV7A 3D6TB 1W0JA 5TB5A 4XVRA 5CDFE 5KHOC 3F3YA 3OJXA 3B9QA 3OIUA 3TMKA 4B3BA 2V1UA 2QAGC 1AK2A 1ZCBA 2IF2A 1P73A 2G3YA 2NO0A 2LKDA 4PAMA 5BN4A 1WDTA 2ZJ8A 4ZDJA 5CIWA 3FJOA 3TVTA 2BGJA 2ZRCA 3CH5A 1EP2B 3EPLA 1KSFX 2WM9B 3KTAB 3U4QB 1AKEA 3FFAA 4NL4H 1XPRA 3PJRA 2W0SA 2P2LA 4L15A 3C16C 4LGMA 4HUTA 1FMJA 3BB3A 2H57A 3SNHA 4F93B 1XP8A 4UXJA 5JJIA 4Q7MB 3R8FA 2MSDB 1NIPA 5DGXA 4I4LA 5FOXA 1AGRA 1VECA 3W6OA 3IQXA 4Q1EA 1I4DD 2E87A 1LW7A 1TMKA 1Z07A 3AB3A 1N6OA 3SR0A 3TK1A 2MMGA 2EW1A 2DWPA 1YZQA 1AKYA 3CCJB 3K0CC 4PSAA 5DHAA 3FGNA 2WWXA 4ZDWA 3RWMB 3EPJA 2FN4A 3C4JA 2C5LA 3AUXA 3QXSA 2KBFA 2GJAA 5HE8A 4TZ0A 5FUYA 2FOLA 4G3XA 4OI2A 4Q9KA 3KQNA 4YMSA 4P6VF 4PO8A 1WE2A 3RSOA 3RYTC 2P6NA 3CRMA 3NIBA 3SU8A 4BFUA 4JSYA 2O8DA 3DZ8A 3BB4A 3IILA 2BJWA 2R65A 4DCSA 1YKSA 4QBFA 2CJWB 3OFND 1M7GA 3QUSA 1XMVA 4F4JA 5AUOB 1R6BX 2NO1A 1XZPA 2RMKA 4IVRA 4O3MA 2XITA 121PA 1S9DA 5C1BA 2VRWA 1B0UA 1DDIA 1COWA 2HDNB 2D3WA 4JLKA 1N3BA 4DSOA 3ZBUA 3ZVNA 2QY9A 3QEOA 1M74A 3LQQA 1CJMA 1P9WA 4YMWA 5CJ2A 3BS4A 3K70D 3P26A 2PH1A 3C41J 4QNRA 4BPBA 1TF7A 1OXSC 5JS8A 1S96A 4M1MA 1HUQA 2QSYA 5HZHA 2BOVA 2XZLA 5F2EA 4WOPA 1ODFA 1FNNA 1ZU4A 3I5YA 1CNFA 3K9HA 1R8SA 1UDWA 4D4MA 1ZVQA 1N6NA 5GJCA 1UBFA 2BEJA 1E9AA 4GDFA 2VBCA 1LS6A 2CL6X 3U6KA 1WF3A 2BMJA 3QXHA 2NZJA 4BEJA 1E9EA 3A1SA 1KY3A 2RC5A 1W1WA 1OYYA 1CJUC 2D74A 1N6PA 3HYRA 2GNOA 3PVSA 4GZMA 4LYFA 2W58A 1G7RA 1SHKA 2VA8A 2EYUA 4KLZA 4Q66C 4XVQA 4ZIRA 1XB2A 3LO8A 4MQBA 1K6MA 3GEIA 2E9SA 5G40A 3HP1A 4M9QA 1NN1A 1Z63A 4W5HA 1XPOA 1DBSA 1XXHE 4C0QC 2YWHA 1F6BA 3FKSA 1VHLA 1EESA 4AF7A 2ODBA 3A4MA 1E2KA 2A7QA 4PQYA 4Z51A 4BFVA 5J4LA 2Q9BA 5KO2A 1G5TA 1N5JA 3U5ZB 4MGKR 4PC6A 1G5RA 1G20E 2OBMA 2FZ4A 1OSNA 2J59A 1R0XA 2LCFA 1YE8A 4DLWA 1YJ5A 4AYWA 2NO6A 1W44A 1TU3A 2R6AA 3BOSA 1BYUA 2QP3A 3PEUA 2AKYA 4NYMR 2HEIA 3CX7A 1BIFA 5DIFA 3TSOA 1QRAA 2DFTA 4GRAA 5FBQB 5FI0B 4HAYA 2Z4RA 4NP6A 5J4VA 3ZVLA 2BN4A 3IHLA 4AKHA 4C0BA 2IT1A 1VYUA 1ZU5A 4HDCA 1HE8B 4FMDB 4EPXA 2J1LA 4D25A 4F4IA 1L8QA 4I1UA 1O87A 2VNHA 3DL0A 1E96A 4LJYA 3V9PA 4MGIR 2ZR7A 2QEXB 1F48A 4XD7A 1GL6A 2DFNA 4TLCA 1IN8A 3MGCA 4JLOA 1E0KA 2QTLA 1KNXA 3EW9A 2XOKD 3P4YA 4YAWA 3PUWA 3W5JA 1Q1QA 4A0HA 1II9A 2V9PA 2KWIA 4JBXA 3X1DA 3GJ6A 2CHGA 1T91A 4HYYA 2P65A 3A36A 2RGAA 3AVTA 2IUSA 3NBYC 3FTQA 3LX5A 4AD8A 3AP2A 2GXUA 4V0NA 5G41A 5UKDA 3UG7A 1U2RA 4RZUA 2GA8A 2WJHA 3QG1A 3DMNA 3FHOA 4FCVA 5J4YA 3ZD7A 3K70C 1FPMA 1I4LD 4GI7A 1VCOA 4Q7LA 3WMEA 4A2QA 3AP1A 4Y0VA 1UKEA 4A9AA 3I4LA 2GRJA 2DPXA 3W9YA 1XDBA 4AKIA 2JLZA 1XTQA 2J41A 3AF4A 1NBMD 4MH0R 3T5DA 2O0KA 3A4LA 1RRCA 4LBVA 1XEXA 4Q21A 3P32A 3G71B 2ZI7A 4LHVA 1J7KA 4EJSA 2RGNC 2QP9X 5IDVA 2GCOA 2HV8A 4MYCA 5D3QA 2GPJA 1E4YA 3RS7A 4ASUA 1V5WA 3W5HA 5HCNA 1E1RD 3BAFA 1QHIA 1KI9A 3QFSA 5EXXA 3CPWB 3HDTA 3KXKA 5EP1A 2JEOA 1MT0A 3V00A 3VU9B 3ZGXA 2GKSA 2PJZA 3BH6A 2JATA 1GRRA 2QORA 3PUXA 4U02A 3WRXC 3SYNA 1AA9A 2JGNA 1KYIA 1ANKA 2X1VA 3NXSA 4YXWA 4TZ6A 1SXJA 4PZLA 2ZITA 4FWIB 1NJGA 4BGDA 3AVPA 3F0TA 4QXAA 2QTHA 4IDNA 4J0QA 1KAOA 1Q22A 3WP0A 2O0JA 4B71A 1QFYA 4QGFA 2EFHB 4Y0AA 2HXSA 4IOLA 4A82A 5AR1A 2XX3A 4OL0A 2O8BA 2QT1A 1F20A 4JZKA 3NBXX 3NBZC 2FGKA 1XTJA 3KQHA 2EFCB 3Q72A 1SGWA 2O8DB 4R9UC 4WA7A 1ZMXA 5L3SA 3T1VA 4A6PA 2F43B 5BYKA 1W48A 4S2EA 1QFZA 3ZDQA 1D9ZA 3WXMA 2G1KA 2UZ3A 4MRSA 2FFBA 2H92A 4Y7CA 3UWOA 4ZKDA 4AIIA 4TL8A 3GLFB 1UMKA 1II0A 3WHLA 1OYWA 4B44A 3K0SA 2RGEA 3U7FB 2VNJA 1Z6YA 4TSFA 3ZH9B 3IDQA 1ZM4A 3Q8XB 3D7MA 3CRVA 4JLDA 3VNUA 2J7PD 4YMUA 3TIFA 1DG3A 3OEEA 4AKGA 4D0GA 2OK7A 3A1TA 2DERA 3EWSA 1X3SA 4TN1A 3ZIAD 1GVHA 1TLLA 2VL7A 4WBSA 4IFEA 2BIFA 4KSCA 1DOAA 4II7A 1A7JA 1GWNA 1YZLA 1XD8A 2CCKA 1IJEA 2QDXA 2VP9A 3LBHA 5JHHB 4PXAA 4RFSA 4AC9A 3QPWA 2V7QA 4URUR 1PV4A 1JECA 4WZBE 1P2TA 3ICQB 1OFTA 3RRYA 1AQUA 2Z0MA 5AK0A 2IHBA 4GT1A 1KTVA 5B30A 2J0SA 5FPSA 3GLGE 1QFJA 3EPHA 2D2EA 1Q81D 3FYHA 4B3FX 5SZHB 4P0TA 2F1HA 3QEJA 1ZP6A 1WMSA 1FZQA 3CCLB 4MRNA 4ON9A 4ZI3A 1RPZA 3X1YA 3QVVA 2RH5A 1KGDA 2RB4A 3U3MA 3WMFA 3T1OA 1DEKA 1Z0DA 1P3JA 3EZ2A 3ZYCA 2ZRBA 1KK1A 4GP7A 1OF1A 4URZR 3V4RA 2DBYA 2GBLC 2ZYTX 3O8CA 3QPVA 2C96A 1W5SA 2YC2C 1GP2A 3M4YA 4JLMA 5HZKA 3W2IA 1JNYA 3WBKA 2YKGA 2PIAA 3O47A 4V0OA 4UKDA 1FX0B 1F60A 1S0UA 2FNAA 1UEJA 4LPSA 4D0LB 5AJVB 3KDSE 2DY1A 4IW3B 1U8ZA 2ZVPX 3OFNA 3CWQA 4DLUA 4CVNA 1VQ4B 4UXHA 4OHVA 1DAKA 1I4TD 1IY2A 1XX6A 4OI1A 3PUZA 3KKOA 4BZQA 5KSOA 3A6PC 1AMOA 4Z1MD 2HF9A 1E98A 2QPTA 1W46A 1H85A 3PQCA 3HPRA 2OFWA 5GJVC 1HTWA 1E62A 5FPKA 1G291 2QP4A 3LFUA 2O52A 5DH9A 2O5VA 3IHWA 3G82C 2A3RA 3L8ZA 4G5RA 3WNBA 2GK6A 4QHSA 1IN4A 821PA 1NRJB 1O3YA 1U90A 5HTKA 1WB9A 3RVBA 4FCTA 3PR1A 3R9XA 1ZRHA 5CITA 2Z83A 3LXRA 2QAGB 3C15C 1AIPA 2WAYA 3AUYA 4QGHA 4V0LA 4BZPA 1T3HA 3PUYA 2GXSA 4Q9HA 1Z06A 3CR8A 3T12A 5KTYA 4EFMA 3FMFA 4HUQB 2VHCA 1CEEA 1U81A 4JIMA 1HEIA 4LY6A 2QGZA 3NVAA 4C0KA 1RRPA 4NCJA 4H1UA 3KKQA 4IDPA 3G0HA 4HZIA 3AF2A 3MMPA 3KJIA 1H8ED 1NSFA 4PAQA 4LV8B 1E0SA 1W2BB 1L2TA 2F1JA 2UVQA 2RAPA 4V02A 1VQPB 2GDJA 4EPYA 2W2TA 4PC7A 3BK7A 1OH5A 5FTJA 4PC2A 1NLFA 4U9UA 2QA5A 3OEHA 1ZINA 4BQSA 2OFXA 3AGPA 2R62A 4FK8A 3E1SA 4LJ6A 2JJ1D 5KSPA 2ODNA 4KFRA 2ZJ5A 1A82A 2WWYA 1QH0A 1MRNA 4LJAA 1JXOA 2BBTA 1ZNYA 4JT2A 1E32A 3SZRA 4NCIA 1E94E 4KVGA 3ZLJA 4QHTA 2ZI6A 3D31A 1XD2A 1W87A 2FEOA 4O2RA 1MO6A 1XMJA 5JBQA 5EP4A 1BS1A 1HYQA 3AVUA 1UBGA 5AN9A 1E79D 1G9XA 1MV5A 1Y63A 2ANCA 1A2KC 3TH5A 2PJRA 4ZDKA 3CF0A 2IS2A 1SVWA 4A2PA 2Q9AA 3IEUA 4JVNA 2C8VA 2ORVA 1QVRA 3CR7A 4N3NA 3WY9A 3X1WA 5JS7A 2RCNA 2ZJOA 4JLAA 3PFIA 5JLJA 1XWIA 4QHYA 3CF6R 1LTQA 1Q0UA 1TU4A 3HPQA 3FPAA 3L0OA 2R6FA 2WKPA 4Q4AB 3FMOB 1Z6XA 2R2AA 5IK2D 5E4FA 4XJXA 4DC9A 3U4QA 2D7DA 1C4OA 1T8UA 2BKUA 2WWHA 1U0LA 3SJZA 3RABA 4BLTA 1R8QA 1R2QA 3I3SR 5E3HA 3BFVA 4MYHA 4E03A 2QTFA 4R98A 2PEZA 2DCUA 2NPIA 2XZOA 3SBEA 4BEBA 3KQUA 2N1BA 1KI2A 3OAAD 1D2MA 4IDQA 1W0KA 2QM7A 1OFHA 1G4UR 2GJKA 2ZRIA 4M22A 4MRRA 3AF1A 4QJ3A 1R10A 5EE1A 4DLSA 1GNRA 2GEVA 3TAUA 5J4HA 4RVCA 3NBFA 5LBIA 4CGZA 1F2TB 3IBGA 5AWFC 4AYTA 4EKDA 2H17A 2FE4A 2NMVA 4PR0A 1Q3HA 1L4UA 3OIWA 4AWXA 1EG7A 4RD0A 2HJGA 2WWWA 3P20A 4WXPA 4C30A 2AK3A 2QL6A 2ZR0A 3MHPA 1W49A 1JJ2B 1IONA 5J40A 2VIIA 2W6IA 1KZGB 5J4KA 1EFCA 2V6IA 3NH9A 2ZU6A 2GETA 1U9IC 2IYWA 5BYJA 4MKIA 5BXQC 1IB0A 4WVFA 3NC0C 1PJRA 4ESHA 2GILA 1RRGA 1TTTA 4JLPA 3KKMA 2DETA 2FFAA 4XWKA 4KV9A 4LC0A 2QTZA 1E2IA 4M1KA 1YRBA 1KDPA 2RGXA 4LJ4A 5CK4A 4WAUA 2B5OA 3CMAB 3GFTA 1NVUQ 2V55B 4YAFA 5D3MB 4MGYR 1HY3A 2OEPA 1ZIOA 4LYHA 1GITA 2Q9CA 4CDGA 3ADDA 4DDVA 2B8TA 1KO7A 3QI2A 4N1AA 1R5OA 1KDOA 2FEMA 1MH1A 2G1JA 1FNBA 1JPJA 4ZCIA 4M21A 1TEVA 2AL7A 1G7TA 2VO1A 2JJ2D 1KSHA 2O8CB 5M04A 2GVZC 4B73A 5IRCD 5A5GA 3EG5A 1CF4A 2W2XA 4Q4JA 1JXMA 1ZCAA 4NYJQ 3SHWA 2CVHA 3LH5A 2ZQ5A 1FFHA 4AF6A 1W36D 3W8NA 4ZGQB 2YOGA 3RNLA 3K70B 1P9RA 2GZDA 1Z5ZA 1F2UB 2J7PA 1D8TA 2ZR9A 2CMKA 3UMFA 1UKZA 3QENA 1YZTA 1JALA 1XNJA 2OTJB 2HCJB 3IIJA 1KOFA 1KI8A 4D81A 2FFQA 3ZIAA 5FL3A 5HXBA 4DUGD 3VAAA 5BN3A 5KDDA 2BM1A 1OJLA 1TVCA 3KKPA 3IKJA 3U6BA 1Q1BA 1J9ZA 5FTNA 4HAZA 4AG5A 2HT6A 1CJVC 3TRFA 4BUJA 4PQFA 1JR3D 4DRZA 4R71A 4QJ5A 4QFMA 1GKIA 5L3QB 2OT3B 3KFXA 3MLEA 1SKYE 5DO9A 1LFDB 4UXIA 1YHQB 3ND8A 3U7GA 4EAQA 5KDOA 4TYYA 2NIPA 5DISB 1KC8D 2FSIA 1CKEA 2GK7A 5B57C 1CXZA 2CLCX 4LX0A 4O25A 2OTLB 3S1AB 1UKVY 4QBHA 3REGA 1II8B 4IVPA 3RDPA 4YMTA 2KI5A 1VPLA 4BZXA 1FMLA 3PXGA 1ZM9A 4DEXA 2IX3A 3ZZ0A 2OSBA 1EFUA 2ZYVX 4L5BA 1W7AA 1UF9A 3KQKA 1US8A 4OJQA 2IYSA 1JR6A 4Q00A 1QG2A 3TR5A 1CRPA 4ZV4A 1IM2A 1LVGA 2C9YA 3DOFA 3RLFA 4D2IA 1QHGA 4WW0A 3GEEA 4GMDA 2AN9A 2QQEA 2C78A 4EPRA 2QMUA 1E2QA 4Q18A 4D0NA 2O8EB 2AX4A 3B7GA 1PLLA 1B2RA 2XB2A 3TUZC 5EXPA 4FMCF 1EWRA 3L0SA 4XOIA 4US1R 1E2EA 1L7VC 2QM8A 2OCAA 3PENA 1VTKA 4JL6A 1BX0A 4JJZA 1EFTA 1SXJE 1TADA 4BASA 1J70A 4LUCA 3I8SA 4TMKA 1XD9A 1QHHB 1Z2AA 2MSEB 2ODWA 2C95A 3SC3A 5C18A 1DDGA 3DEFA 4MRPA 4OK6A 1T6NA 1VIYA 5FH9A 4I1SA 2O8FA 4Q1FA 3GLIB 2R6DA 4OI4A 4D26A 1L4YA 4PSKA 2NGRA 1M8PA 3GFOA 3TNFA 2YYZA 3FPKA 2GXQA 3LVQE 1G3MA 1MO4A 3NC1C 3N5CA 4HAWA 5IHPA 2IEYA 3AEZA 1OV4A 2KSQA 3L2OB 5JI2E 1RE0A 1JJVA 1XMSA 3N2IA 2R8RA 5GVRA 1CNEA 3GJ0A 3QG5A 4DLRA 3VU9A 1VIAA 1A4RA 2GJ9A 2QRNA 3GCGA 3U61B 2X77A 2Z6VA 1NN5A 1VYTA 2Q21A 3MSXA 4GP6A 1VDZA 4DDUA 4H9GA 1VKJA 1GAQA 4EPTA 1TNDA 4M9XA 4HB0A 3TLXA 1W36C 1BMFA 3AKCA 3VHLB 1H8HD 4YONB 2OXRA 3RS3A 4LOAA 1OH7A 1SVLA 3ONWA 5L3SB 4HB2A 1OHHD 1R5NA 2C03A 3I32A 4LHXA 5JECA 4M8NE 1DO2A 4PANA 1D5CA 4YHBA 2G88A 1U94A 3R9WA 2ZRMA 4A0RA 4TTPA 1BJKA 3GFPA 3HU3A 4NH0A 3B1VA 1NKTA 3A1WA 4F4CA 3CMEB 3EA0A 5JJKA 2CDNA 3AF0A 4YDSA 3LA6A 4ERNA 3OJWA 2BCGY 2J9RA 2F43A 4IXMA 1XTIA 2VP0A 4TQ9A 1EXMA 3RSLA 2IS1A 2A5DA 1TQDA 2JJ1A 1YZNA 2P0EA 4W5JA 4C43A 3F8TA 3GJ7A 4Q48A 1VQOB 2Q3HA 5FFMA 4FD2A 1KK3A 5FL7D 2WWGA 1RW4A 1M34E 3EC2A 3A1UA 3GLFA 2IYYA 4P32A 4Q1BA 4B43A 2FH5B 5FOWA 1KQSB 1NVVQ 2BBWA 2XJ9A 3BH7A 4Q9LA 3EASA 4TL9A 1R4AA 5FTLA 5BWMA 3OZXA 1FUUA 4PO9A 2ATXA 2ZPTX 3Q3JB 3U7HB 4KODA 2OM2A 4Q5IA 1HV8A 3CX6A 4NZYA 2BEKA 4TQUS 3B6EA 4P4TA 1NMXA 4DT1B 3QF4B 5F9HA 1AN0A 1P9NA 1VQMB 4OK5A 3THWB 2J0VA 3GD7A 4LV6A 1VYVA 3QFRA 2GAOA 3LX8A 3ADCA 1IAQA 2ZAOA 5K8UA 2ZUBA 4N3GA 1NY6A 2VF8A 1T9HA 1D1NA 4Q4JB 3T1TA 3QPUA 3M1IA 2RGGA 3EWAA 3EZFA 2CNWA 3DO6A 4JLBA 3VR6A 4HE6A 2F55A 1G1MA 1GO2A 2ATVA 4NYIR 2MSCB 1FP7A 1FNDA 2ZRJA 4LI0A 4B3XA 4BFZA 1KJZA 2VP2A 2JLUA 2X8AA 1U0HC 3JQPA 1GKUB 5DN6A 2YOFA 1KJYA 4NCHA 3OZUA 4A15A 2RC6A 1IN6A 5TV2A 1ZIPA 2FV8A 1CJKC 1SHZA 3MWJA 2ZREA 1CLUA 4TMZA 4ZO4A 2PL3A 2EQBA 4FXPA 3VR1A 1NJFA 2YINC 4B48A 1FX0A 2RGCA 4JKIA 4MYUA 4PHFA 2XEXA 3Q5EA 2VPPA 4P4SB 2QENA 4AYXA 3B13B 1YR6A 4G5GA 4G0NA 2IS4A 1FP6A 5P21A 4BRWA 4YAUA 2JAQA 4EUNA 1CR1A 1UKYA 1LB1B 1M90D 1OXTA 4M1TA 2ZU0C 2DB3A 2N46A 2JLYA 4AK9A 1P7CA 1DO0A 1NN3A 4HB3A 1NNEA 1N8RD 3W2GA 2PCJA 3MJRA 5TARA 1XFAA 4HZUB 4OJKA 2FG5A 5FOUA 2W6JD 5H59A 2XNDA 3Q9LA 5E95A 4HATA 5B58C 4OHZA 2IYXA 2A30A 2YC4C 3RC3A 1US8B 4DKXA 3W2HA 2NO7A 3QKRB 1CR2A 4IKEA 1S3SA 1YR9A 1VQ7B 1G41A 2J5XA 3EZ9A 3OE7A 5ANRB 3W5UA 2QUZA 1SVOA 3T35A 4QKQA 1KSJA 2KB0A 2QAGA 621PA 4A36A 3PIRA 1CTQA 1HE1C 1X6VA 2AK2A 2ZJBA 1G8GA 5L3RA 2ZE6A 1QUEA 3T06B 4HUQA 3CM0A 3Q5DA 2QG6A 1RYFA 2W2VA 1KO5A 3U3OA 4G5SA 2XNSA 3A4NA 2R6HA 1PVOA 2VF7A 1IQPA 1WA5A 4IOMA 4BRUA 1Q7YD 421PA 1IY1A 3AM1A 3PV0A 3TUJC 1DAFA 3BGWA 1ZUHA 2BMDA 4D4LA 3MAAC 5KNBA 1P62B 4G1VA 2GESA 4LBZA 1X86B 5EP2A 3JZMA 2O8FB 1G8PA 3K0CA 5JWOA 3WBJA 3C14C 3KJHA 2JCSA 2HYDA 3VO1A 4KYIB 4A8JC 4L4UA 4Q7JB 2JLQA 1KK0A 2OCBA 3G5UA 4PQRA 1NVXQ 4D80A 3VR3A 4WIAA 2XSZD 1FOEB 1M6NA 1BH2A 4DLYA 2WSSA 4M9ZA 1MR3F 5K8LA 3K09C 3BRWD 2RGBA 5J47A 2BF4A 2JDID 1I2DA 4FMBB 1G19A 4DCVA 3DVLA 1XTKA 4DCUA 3E5HA 4ZCLA 3EIHA 2BMFA 3N70A 4P31A 2GQFA 4XVUA 3KXIA 1QHNA 2FU5C 1N5IA 221PA 4GOXA 3ZQ6A 3WHKA 1Q21A 1QUFA 1J8MF 2OBNA 4LJ9A 4ABYA 1DAMA 1E1QA 4C0SA 2YWGA 1EFRD 2WIAA 521PA 4TYQA 2H5EA 3O8BA 5F9FA 1ZM7A 2J3EA 4Q4AA 2PX0A 2JLRA 4HAXA 2CNDA 4S35A 4RCYA 4JBYA 2HYIC 2ONJA 1P2VA 4B3GA 3HR8A 1IBRA 2DFLA 1W2GA 3BWDD 2Q0HA 3B78A 4A2WA 2QRZA 4C3ZA 1OKKA 3E20A 2ODEA 3EXAA 3KFVA 1DELA 3CRRA 2CHQA 3ZS8A 1GRNA 2VHTA 1HT1E 2XTMA 4PHGA 2YVUA 4D4KA 2NPFA 2A5JA 2ASEA 2R6GA 1KDRA 1P72A 2XJ4A 1EWYA 2B7BA 1RFLA 2FSGA 4JVMA 3W8RA 4CT5A 1W4BA 2X2EA 3WNDA 2VYFA 4NPHA 3U7EB 4BFSA 2FPMA 3W3ZB 3FVQA 4JJKA 2VZLA 2OO7A 3LVRE 2IBMA 1HURA 2RHDA 3DPUA 3K9GA 2A78A 4UNPA 1F2TA 3UATA 3BFXA 3GLHB 3VR5A 3T34A 4IVQA 1JA1A 3GJXC 5EZ5A 2VYQA 4M1WA 1G17A 2AR7A 1QX4A 4DCTA 1EFHA 2WBLC 2VQSA 3EA5A 1E63A 1Z6TA 2V8OA 5JWHA 3T15A 5KNCA 1KKLA 1T3SA 2GEDA 4DLVA 2QPAA 1W5TA 2W00A 2IHYA 4Q02A 3CC7B 2ERYA 4UNRA 1F5NA 2F6RA 4X8LA 3DM5A 4Z8XA 1FL9A 1GG2A 1VQ5B 1GZSA 2CK3D 3K0AB 4NYMQ 2QMHA 2ZJZA 3TSZA 3I92A 2OAQ1 1H8HA 1YZKA 3GJ4A 5FTKA 4M4SA 1DE0A 3Q7PA 1AS2A 2WOOA 5D3MA 2X2FA 1LV7A 1OIVA 3W2FA 3IIKA 2ZJAA 4RY2A 5THXA 5C4MA 2BC9A 1NP6A 5EXTA 4B6FA 3LW7A 5IT5A 2PCLA 2BBSA 2R6CA 5B2ZA 2CHVA 1ZW6A 4CRWB 3LVBA 4UNSA 3NDBB 3SYLA 4LBWA 4PPGA 5DYGA 1RRFA 1ETUA 2CLDX 2NO9A 2JLVA 4LBYA 2RKOA 2O8CA 3IBYA 1SZPA 1ZD9A 3J81k 2A5FA 1YZUA 4NU0A 3FE2A 3JQQA 2GTPA 3BFKA 1JA0A 3B1YA 3UXMA 2F9LA 1KI1A 2Z4SA 3C8UA 1SVKA 1NMZA 4F92B 3UPUA 4P3YA 1Z28A 2OLKA 1QGYA 4A1FA 3CONA 1J90A 3B1ZA 3DMDA 2NQ2C 4RZXA 4TL6A 3LDAA 4E5UA 3P4XA 1XBTA 1F2UA 4IHQA 3IPYA 1N6IA 1UBEA 1N6RA 4JYBA 4Q4HB 1BX1A 3SOPA 1AGPA 4KSBA 2YNMA 3AVVA 1Q1EA 4RZ3A 3FOZA 2OV2A 2HJVA 1UEIA 5FR1A 4V03A 4MRVA 1J2JA 4DEYA 4BFTA 5JMTA 2CBZA 2NG1A 1E2MA 3LNCA 4KLNA 4EQ6B 2EFDB 2IUTA 4OYHA 2RGNA 3QFCA 2GZAA 4OI0A 2J46A 4RJLA 4LWZA 1EGAA 4E07A 2YJTD 4BWYA 1WP9A 1OIWA 1OLOA 3AKEA 4H1VA 3B82A 1GAJA 4AKEA 5L3QA 4URXR 1KSGA 1JAHA 4A0GA 2XNJA 1G7CA 1XTRA 4DHEA 1GL7A 1NKSA 1ZD1A 3TBKA 3S1AA 4DXAA 1DG1G 1DAHA 2C9CA 4WXRA 1W36B 4NBSA 1II8A 3M0EA 4QGAA 4PX9A 4HLUC 1XZQA 4DVGA 5GVSA 5A4JA 3W5VA 5FUVA 3QKSB 2OCYC 4KU4A 2B21A 2OZEA 2DWOA 1TEXA 2QQ0A 1OE0A 4DLZA 1YR8A 4QGGA 5CB8A 1E3MA 2G0NA 3QOFA 2G0TA 3QVUA 3CPHA 1ZUNB 3FMIA 2CL7X 3EPKA 5FPHA 1KO8A 5EP3A 3SI7A 1HT2E 3GP8A 3KZ1E 3EIQA 2D62A 2YWFA 4RKEA 5FBVB 2O8EA 2ZJ2A 4QNMA 3PEWA 2ZROA 1K5GA 4CEHB 1JEEA 5HCIA 1S72B 1CR0A 2V1XA 3MFYA 5C4GB 4BLSA 4PZYA 3W6PA 4PPNA 2LKCA 5EE0A 3CD6B 2DWQA 1VMAA 1COWD 3RS0A 1GKYA 4RFVA 1QHHA 4BFWA 4ILEA 3RHFA 3CCVB 4IEEA 4O2LA 2ZIAA 3FHTA 1D2NA 2WJYA 3GLIA 4KHZA 1K8RA 1NN0A 2XOKA 4IOKA 4PZZA 3LBIA 4BLOA 2JLWA 4GMXA 1Z29A 5HKKD 2QU8A 3ZS9A 1P60A 2WTUA 2B92A 1BKDR 3FDIA 1U8YA 2I1VB 3WYFA 2CXXA 1HA3A 1PZNA 3VHXA 1XMIA 2VH5R 3U3JA 3VFDA 4F91B 1PUIA 1KRHA 2ANBA 3GMTA 4PC3A 4A0FA 4LZZA 3ETLA 1MO5A 1VQNB 1KO4A 2Q6TA 4JLJA 3GLFE 2A5GA 2H7VA 2ZI5A 2UZIR 1G64A 5AUPB 2IA5A 1QHXA 5AJZA 3SJAA 1P2UA 2OUKA 2ZEJA 2ZSBA 5CYOA 8OHMA 3CPEA 2OFOA 4B34A 1TF5A 4FI3C 5L8VA 4C7OB 1NBMA 1IN7A 1IXSB 2KE5A 4OQFA 4US0R 2FPLA 3FKSD 2H16A 3BBPA 1TQ4A 3EIEA 1ZNXA 1OW3B 4URVR 2G6BA 1GJRA 4XH9B 3OIYA 3CW2A 5ELXA 1JJ7A 2GCPA 4QJ4A 3RRZA 1MABB 2F3RA 3LO5A 4TMTA 1E1RA 2ZRNA 3RWOA 2GBLA 1G8HA 3VR2A 5G3YA 2EFGA 4L8GA 4PPQA 1P4SA 2WKQA 3A8TA 4ESVA 3CF2A 2AWOA 1GNPA 4LHYA 2OILA 4L9SA 4DLTA 3CCRB 1EP1B 5JSZA 2FA9A 5SZJA 1NL3A 5JCZA 3G6EB 1ZC3A 1S1CA 2AD5A 4JVSB 4LHWA 2G9NA 3B2EA 1Z0KA 3DKPA 3CCSB 1RJ9A 3HU1A 2EWVA 1JAIA 4QRHA 3RS2A 3PEYA 4G5OA 1A5TA 4IEIA 1YI2B 3K9LA 4I99A 4L16A 3THOA 3VR4A 1AZSC 1G4AE 4NDZA 3REFA 1R0ZA 5KOYA 4HDOB 1EFRA 4IOJA 4X8OA 4XTCS 4DT1A 4XD7D 3QF4A 4DSTA 2D06A 2QEQA 3B1WA 3K0FB 4RKFA 4YDHB 4GFDA 3C7KA 3THWA 5F3WB 1OXUA 2H8KA 2IYVA 5IF9A 5JHGB 3ZVRA 3NEYA 1FRNA 1TUEA 3LQRA 3W34A 4Y9RA 1GAWA 2QSZA 2WMNB 4DQKA 5KUTA 4M53A 2J45A 2J0UB 3EAQA 3MG9A 5TVKA 4MDEA 4QL3A 3CCUB 3CCQB 3LV8A 5E7IA 4GSYA 2VSFA 1QVAA 2WJVA 3QIAA 1BQEA 1P5ZB 1XXHB 2WMOB 1G8YA 1X8KA 3P1JA 4TWZA 4DDWA 4CZ2A 3ZD6A 2FSHA 1GTVA 1KMHA 2ORIA 3X1XA 1SKQA 2JIZD 4UQOA 3IGFA 1T5LA 2OCPA 1J8YF 3G4SB 1Q3TA 5KPJA 3I62A 5DI3A 3ZBTA 4LSGA 5BQ5A 4CT4B 3VKGA 4B76A 4GNKA 1Z0JA 4UJ5A 1AM4D 2QAJA 1FQJA 2ZVQX 3CIOA 3I8XA 2GWHA 1A1VA 4A8JB 2R44A 3SS8A 2PX3A 4P4SA 2VP6A 4FIDA 3SFZA 1YJWB 1E9CA 4ASUD 2YV5A 2OK8A 2CCGA 5CK5A 4OQMA 2IK8A 2WAXA 3FKQA 1NF3A 1P6XA 2ZYUX 3W5IA 1LF0A 5DSZA 2IS6A 2VNKA 1D9XA 2GF0A 1GILA 1NLYA 4B2IA 3JVVA 4QG7A 4JLVA 4JYCA 4PC1A 4HZUA 2QMOA 4YXWD 1YJ9B 2CK3A 4XSHA 1SXJD 1YJNB 4UNQA 3QSYA 3VNVA 2PMKA 4V0MA 4JL5A 1U8AA 2BJVA 3A37A 3HYTA 3QKRA 2ZI3A 1P2SA 4F38A 3AKYA 4HAUA 3QXXA 1JPNA 4EPWA 2BV3A 2CL0X 3PG5A 5EJEA 1FNMA 3GJ5A 1GR1A 3JVUA 3WRYC 4LRWA 4X8MA 1YU9A 4DCNA 5JWRA 2FDCA 2QBYB 1YRAA 3AF3A 2UKDA 1JBKA 2EFEB 4GOJA 4Z1MA 1Z6GA 3BH0A 5H70A 1T8TA 3WYGA 4U5XA 3THXB 2XTZA 4B3CA 1RIFA 1XU4A 1IN5A 2N42A 2QI9C 3CCMB 3JZAA 4TSFD 1WBDA 1DADA 3UIEA 1KNQA 2YZ2A 3KL4A 4B4DA 3ECCA 2XXAB 1MKYA 4EFLA 3BORA 2QA4B 1ESNA 1MRSA 2P6UA 3TQFA 4CIDA 1Z47A 3PEVA 2ZAMA 3KKNA 2JLSA 3ZJYA 2FFHA 2NZ8A 4NKRA 2AHOA 1QHYA 4M1SA 4EPVA 4D4JA 3CO5A 3FB4A 4KXFB 1ZUIA 4OBEA 5F98A 5DLQC 2V7QD 3QE2A 3H4MA 3E2IA 4OQLA 5AJYA 1E2NA 1VQKB 2WV9A 2WWFA 5JZVA 1Z83A 3UKDA 1YR7A 1Z6AA 4HSEA 3TW8B 5KPDA 3LAWA 3THYB 1R7RA 2PMDA 1U9IA 3KUCA 4RCZA 2BVNA 1H8EA 2VSOA 4OK3A 3MWKA 1N6LA 5EE5B 4B47A 1FDRA 4KFTA 5FPYA 3QFTA 4P33A 4NHOA 3W3AA 4N0EA 3IO3A 3SBDA 3EARA 1PUJA 1MOZA 3CPJB 4TT3D 2YWEA 3ASYA 1Z0IA 4XSGA 3HWSA 2HT1A 3LWNA 4B32A 4LJ7A 5GJWC 1UDXA 4EJSC 3R7WA 1JB1A 4LJ8A 4NCNA 2CCJA 1K9MD 4KBGA 1OH8A 4JL8A 3MD0A 2VTKA 5JCPA 5SZIA 1XE1A 1OFUX 5K8TA 1S9HA 2IC5A 1G16A 5JI3E 1RYHA 2ECKA 1ZM2A 1BYIA 4D6PA 5JSZB 4RZ2A 1E2DA 3CZPA 4CYMA 1U0JA 1A8PA 4PO1A 2CVFA 1OGJA 1E2HA 4MUAA 5KSYA 1SVIA 1SXJC 1JEDA 1RJ9B 2DHRA 1E2PA 1TQ6A 2ZRPA 5AUNB 3I5XA 1F3OA 1E79A 1E2GA 4US2R 2QMEA 2ZRAA 2VP4A 1N0UA 1Z3IX 3EC1A 4FINA 4DDTA 4GPTA 2I4IA 4QBGB 1AS3A 1JQLB 2REXB 2ZE7A 4GBMA 3GLHA 2F1IA 1XCGB 4DSNA 2BM0A 3LXXA 5CLLA 2OE2A 1D6JA 5IK2A 1HQYE 5JRZA 1TL7C 3LRPA 1GFIA 1FQKA 3MRSA 4TMVA 3NDPA 4TYNA 2BKEA 4F7DA 2C04A 3QE0A 5LB2A 5HKKA 3NHBA 2V6JA 3MCAA 1N6KA 3UK6A 1S4QA 2ZETA 3QXCA 2XTNA 2P67A 2B8WA 1ZD8A 4HB4A 2IWHA 3GLGB 3QY0A 1EK0A 3K0AA 1OGIA 2PBRA 2PLFA 5BW8A 3OAAA 3W6NA 2DFKB 1Q82D 1R0WA 1FW6A 1E0JA 1KMHB 3ASZA 1C1YA 2ONKA 3AVQA 3NG1A 3FHCB 4XWAA 3FMPB 4OHXA 2Q3FA 1DAEA 4LDJA 4B35A 3VKHA 3QKUA 4HEJA 1OT3A 2EWWA 5DI3B 4MUBA 1DPFA 1VG9B 4Q7KA 1C9KA 5KNDA 3O8DA 2WIBA 1VQLB 1T4GA 4TLBA 3UMSA 3UANA 4DQLA 2GHIA 4O0MA 1KI3A 2AXPA 3CRQA 4OKSA 3TAHA 4DB2A 1HQCA 1J99A 1I2MA 2F7SA 2ZANA 2ZE8A 4E09A 3SFVA 4TL7A 4XTRA 3OEHD 4R7ZA 4LCBA 2VSXA 5GADl 4PHHA 2CLSA 5H68A 1YZGA 4A6XA 2PLRA 4JT4A 2IUUA 1RC8A 1FTSA 1G3UA 3L0IB 4DLXA 2PEYA 2DYKA 2QPOA 1QG0A 3QJYA 1TUIA 1XEWX 2HLDD 3IIMA 4KYUA 1CJTC 1EX7A 2QTVB 2BMEA 2ZRDA 3K0EA 2ZUCA 4AI6A 1M1KD 1XJ0A 3VKWA 4QOSA 3ZC3A 2ZM5A 4Q4HA 3QBVA 6Q21A 3WMGA 1ZC4A 4Q9JA 1LS1A 1VHTA 1KO1A 5KDLA 1RZ3A 4POAA 1IY0A 2FPKA 4Z54A 1UADA 4TTQA 1LF5A 4OHYA 4DSUA 3NWJA 1NG1A 1SM4A 1VQ8B 2WPDD 2C77A 1QGZA 4JMPA 4ZPXA 5KYKA 3U44A 2IW3A 3KB1A 3VX3A 3KJGA 4EQ6A 1QZXA 1XEFA 2CEAA 1S1MA 4KITB 2JA1A 4M9SA 1E64A 4TYWA 1XCMA 2BGIA 4IRUB 4BECA 4GOKA 4GZLA 1X8JA 2JJ2A 2C9OA 4PAOA 2NTYC 4RD1A 4TTRA 4HAVA 4ARZB 2C2HA 4JLNA 2BDTA 4YQFA 1N5KA 2V3CC 2ZS8A 1BO6A 2WVJA 1E9DA 4K46A 3W2EA 2ZXUA 1AS0A 5L3VA 3BE4A 2R9VA 4MA4A 1E2FA 2YOHA 1T0JB 5H5JA 3U2QA 2FWRA 4WZAE 5FOTA 5G53C 5CIQA 2WKRA 5LD2C 3AH8A 4BLQA 1I7PA 3QKSA 1W0KD 1TF2A 5JEEA 1N0VC 1DTSA 4Q1AA 3SE0A 4QM6A 1G6HA 2HCBA 2JIZA 3TQCA 4DUGA 2FJUA 3GLIE 2PZEA 4TLEA 1VG8A 5TMPA 4Q47A 1QGAA 3MWYW 5TR9A 3OF5A 5C2JB 2C99A 2Z43A 2WZQA 2QN6A 1OXXK 1S8FA 1VCNA 3LLUA 1JR3A 3DZDA 1LNZA 2P5SA 3B1XA 3VX4A 1M7BA 1CS4C 4CEHA 1XCPA 3AKDA 4ZKEA 4EIWA 2W6ID 2L0XA 2GVDC 1P61B 1U98A 3B5JA 1N0WA 4YLGA 2CRVA 3JQRA 1IXZA 1GSIA 3CB4A 4MYTA 4BPRA 3OHMA 3SN6A 5CJPA 2IYLD 4B75A 4CF7A 3I72A 3OESA 5CM8B 3V4FA 1YITB 3A1VA 3SHFA 4C9BA 5FA6A 1R0YA 2JASA 2GJ8A 5CDFA 5G3ZA 1ELOA 1LY1A 4IJMA 1NBME 2OLJA 4PGOA 1TAGA 5LB4A 3R7WB 3RS5A 3CCEB 5KSZA 3OZVA 2XAUA 1VCIA 5EZ6B 3SJBA 1W35A 3B8HA 1VQ6B 1H42A 1T5IA 1XJCA 3BC1A 3NHAA 3WYAA 3UMRA 3TR0A 2G83A 4R2HA 1T0HB 3QNUA 3TKLA 1ZBDA 1YQTA 1NSTA 4G5QA 5AJXA 2O0HA 2WJJA 1KKMA 2EVWX 2P5TB 4KO8A 1ZNZA 1DARA 1OFIA 5FOVA 1KDTA
chains in the Genus database with same CATH superfamily
3FOFC 4A4DA 5EHXA 5JFGA 1C1HA 1Z0AA 3B3GA 5IYWA 1K4YA 1O94A 4ARAA 2PKWA 5FUWA 2Y1FA 2GPAA 3T61A 4BFYA 3ZZTA 4E94A 1ESCA 2BUCA 1DRKA 3LOUA 4DJDC 4Y9TA 3ACDA 3LD9A 4C04A 1NXXA 1QYVA 3GHYA 4LNUA 4FEYA 5SZKB 2GAAA 3L8YA 1H6BA 2TMKA 3UGQA 4UAJA 3U3RA 1MABA 1T6XA 4TMXA 2VSYA 1QNLA 1NR1A 3LFTA 3QLVA 4RD2A 5DI9A 5DHFA 4ZMRA 3CC4B 2BEWB 4JP2A 4J49A 4ANFA 1IHUA 1KWGA 2WG2A 2JGLA 1K2VN 4KNWA 2WWIA 2WVGA 1BRMA 1CUBA 1HLFA 2I6XA 2Z98A 2ZQYA 4DPKA 3UH0A 2QE7D 3NHWA 4JXJA 1IEWA 4MR7B 2O54A 2OCXA 1R9MA 4RDXA 4HWPA 1MGOA 4HFRA 5CYFA 2M2IA 2MMCA 2ZDQA 4B8WA 2I2WA 5JEDA 5E6RB 1E2JA 1OB2A 1E3QA 2J7KA 4B33A 1X1EA 1ZNWA 3M5PA 4ZIRB 1SVMA 5JYBA 2W7TA 3ANNA 1M6YA 3VQTA 2Z6AA 3DDZX 4CTOA 1ZUWA 2MYTA 2WU4A 3P2MA 1EK6A 1WDLA 1WJGA 4QU8A 1YH3A 2HMAA 1GPKA 2ZS7A 1BWRA 4WQMA 1LPSA 3RVOA 3TE6A 3FPEA 1X0XA 3OE4A 1FFCA 4X54A 5T6MA 4W9NC 2D7CA 2CXNA 3G8BA 4J16C 3GYGA 4D82A 3P97A 2PZGA 4BLRA 1L0BA 1NMYA 1K7SN 2XNKA 2VQ3A 3WSTA 4IPTA 2ZL5A 1UM8A 2BDUA 1H9AA 1V71A 1V6CA 5LDGA 4KI7A 4LS3A 3SQXA 3EZGA 4ZMBA 1TA0A 3MN1A 4PAGA 4M46A 2RGUA 2D1RA 4Q1VA 4TX1A 2NAPA 2JI9A 1N8KA 1NDHA 1NLZA 2ATCA 5JE8A 4MB6A 4MVXA 3ORSA 1XDUA 2CDCA 4IXNA 4QYIB 3IUYA 2X6YA 3ILYA 3TL3A 4NE2A 1JJAA 2I78A 5IYZF 4EEZA 3EF3A 4P4UA 3TLKA 1A4IA 2I4RA 4BNDA 4CM3A 1X7YB 1V37A 2FEKA 2PH3A 3WA7A 2QUJA 1Q0RA 1ISSA 1WM1A 4U00A 1W0JD 3TLJA 3NFRA 1T2UA 2EIXA 2J87A 3ADPA 4V0ME 1EHYA 5ALQA 1G20A 5TS2A 3CRW1 5B4UA 3TQRA 5KREA 3RANA 1ULUA 5ALUA 3X1MA 1Q83A 1RXCA 1T2EA 2E6KA 2WUFA 2XH8A 4HWTA 2UUOA 3RY8A 2Q4BA 1GOTA 4PQEA 3UCEA 5H1YA 1NI3A 2ZBGA 3EVFA 3R40A 5HIAA 2ESRA 4X8HA 4Q3DA 1YMVA 3JQAA 3ZVMA 1B16A 4U2BA 3WC4A 3F47A 1VSQA 2P3LA 3W7BA 1H1LB 3WV4A 1ZD3A 4TLDA 2JGAA 3URMA 4NYJR 3H5RA 4RBNA 2VHUA 4XIJA 2EQAA 3KQLA 3E0XA 2HU8A 3CEMA 3KWJA 3RBZA 1XHLA 2WZDA 5BW6B 1W9XA 2O8NA 3U4MA 2RSLA 2YZMA 3HS3A 1BJRE 1RYYA 4R83A 4DV4B 1ONPA 3EVDA 3BD9A 5TT0A 1BE1A 2I6UA 3W8DA 5HP4A 4J75A 3MJVA 5JQWA 1JQJC 2P6RA 2YW2A 4CQLB 4JJAA 2A5YB 3TW6A 3CH4B 1PJAA 1STOA 4XUCA 1FUKA 1P5FA 2IXFA 3CH7A 5JJLA 1E5TA 2GPWA 4DLKA 1DC5A 3KR0A 4HNGA 3GLQA 4FJ0A 3SBOA 3UMVA 4GBED 1LJLA 4KUHA 4BGEA 1YRQA 4G01B 4CUKA 1KY2A 1OLXA 1UAGA 3HBJA 2JRLA 2MT9A 2AN1A 3VDMA 1M1YE 3GAFA 2R7NA 4GC9A 3G49A 3SC2A 1ONBA 3PQ5A 5HILA 3RROA 4MQ4A 4Y2GA 4DFDA 3OQIA 1NUSA 1JHAA 1DIRA 1HH4A 2ZRHA 3JWHA 4FN5A 2Q0QA 2VLIA 5LUBA 1QYIA 2ZIUB 2FRDA 1NRKA 5KOHA 3LQ1A 3O93A 4ZREA 3LKZA 4CKWB 2E21A 1LDYA 2ZSFA 5CLQA 4C0AC 2PMWB 2XUIA 5E7JA 3Q8LA 2HF7A 1PO7A 4JCCA 3ES9A 2GK3A 5KWEA 4C2TA 4XYMA 5BR8B 3E70C 5HRAA 2ZJYA 3VMMA 1ZGGA 1SXJB 2HXYA 4B0OA 5B6PA 1DX9A 4JJ4A 4U2DA 1Q7CA 2PR2A 2QLBA 1BN7A 3NP9A 3W3AH 4ETWA 1QYCA 2DQ4A 3WNZA 2BFNA 3K15A 3EXFB 4OMDA 1BMTA 1CC1S 1PBTA 2QK4A 1XMXA 4LZWA 3ZHBA 3ETJA 4TV9B 3WRVA 4MDYA 3VO2A 4Q15A 5JNLA 1XVUA 1EYZA 3R6DA 2VQDA 4KBFA 1CR4A 5T3YA 1SCQA 5CCBA 1NG9A 5K4HA 2DTXA 5EQTA 5A4IS 4O4LB 4QM7A 3NHPA 1E89A 2WHXA 2ZUEA 1QONA 3QRWA 5JCOC 1TECE 1XJQA 2JJ8A 5H8WA 4BVLA 1IUKA 3GI1A 5EYPA 3FUWA 4URYR 1WCWA 2V4ZA 2ZIEA 5L45A 1KAGA 1VQ9B 3IAAA 3IDOA 3KIPA 5JCXA 1VG0B 3L4KA 2IHNA 3M6AA 3QF7A 1UD2A 1J8QA 2IL1A 4IFBA 3DLAA 2ZSAA 4D5GA 1Y8QB 3C3JA 4EGJA 1PFYA 1UBNA 3OKCA 3ZD8A 5IMBA 1ADFA 4DSZA 5JD6A 1RWOA 3DR3A 2IJGX 3DVQX 3I73A 3MQ4A 2FG6C 3D0OA 3A35A 5AI6A 4BX9A 2NTVA 2BFEB 3SJCA 1LK5A 4KQEA 4EHLA 4Q1DA 1XMPA 3HLYA 1YIJB 3RM3A 3SAJA 2ERXA 4DR5B 2FW9A 3USZA 4XR6A 1XDSA 4OOVA 4W5WA 3H05A 5FOSA 4ND7A 1JI0A 1H0HA 2C2ZA 1M1ZA 5FWDA 5I9TA 3DHWC 4AX8A 4B46A 4CV0A 5DN6D 1FY2A 3HJRA 2DECA 2ZE5A 3UG6A 2WJPA 4BNLA 3UW3A 5EIBC 2XSZA 1NE2A 2X41A 4Z9XA 1I6MA 1QAMA 1OLSA 2XNCA 1U8XX 2CXRA 3NV7A 2E1RA 2X8BA 4BFCA 5FUMA 4K87A 4JI5B 2C7PA 2IZZA 3TUIC 2GARA 4IDOA 2AYXA 3O03A 4B6EA 1DBIA 2Q6OA 3N3AC 3P0HA 4TYPA 1ZJ6A 5TGZA 3SXUB 4BKOA 3GRCA 4OLAA 4OQQA 5BN1A 5E2IA 3T38A 4Z9BA 3WB0A 4F2WA 4JA2A 5HIJA 5KTMA 3EXEB 4ZYYA 2QYTA 3PITA 3ZV7A 4D98A 5FR2A 2BGNA 2XQGA 1JR4A 1X42A 2ZIFA 3HVJA 3TGPA 4NHEA 3E18A 2EX1A 4C22A 2CC2A 4Q12A 1HTTA 4YJKA 4C3UA 2I7VA 4C6TA 1CZLA 1KOJA 2Y93A 4W99A 1U2GC 3F67A 1E1CB 4NE7A 4ZICA 1PLKA 3THRA 3O94A 4N0DA 5AI0A 4PPFA 4FFSA 3WGJA 2XGJA 2A59A 4FR0A 5I3CA 4EYSA 4JUDX 4ILKA 1PJ5A 2NSHA 3CCBA 2ZTSA 3MA0A 5EXEA 3TWOA 3U40A 3M49A 4TRJA 4ENPA 1FX1A 5BRJA 3KWMA 1NVVR 4MB0A 4C0JA 2OXCA 1J1UA 3GLTA 2IIVA 4QWMA 5LDDC 3WKEA 4MTCA 5EMNA 1L8AA 1LPMA 3FFBA 1BDMA 1DX4A 2HPHA 5D3KA 4BNDB 3D2BA 1KMQA 1U99A 3I6MA 4ZTZB 4Z4EA 1JHMA 2QTAA 3G9TA 3PEFA 5EJ8A 5JV5A 3W5DA 3H94A 2XRMA 4PLZA 5LD2B 2ZZEA 4MVJG 4AY6A 2WOJA 4HLUA 2QROA 1A0OA 4XN0A 1FNCA 5KU1A 3OKPA 4B3HA 4IIJA 3EUAA 1CY2A 4Q9NA 1XZAA 4IICA 3WLJA 3O0TA 1D4AA 4GZ6A 3JQFC 1RP7A 3EXIA 5BV7A 3SIRA 2GF9A 3FFXA 3KR1A 1QMPA 4URHA 2XT9A 4CCYB 3IEVA 3AG6A 5JCJA 3P0JA 1CQXA 2VEOA 2AG8A 5CH3A 2PZBA 1BXRA 3ACCA 4R1LA 5GONF 2WQ7A 2V0NA 2M6KA 3O1LA 1Z0FA 3G0CA 4ZN6A 3DTVD 4RENA 5TGDA 4ZT3A 1RWNA 2XCIA 3HU2A 1YK0A 2GHTA 3GJ8A 1ODLA 2MYUA 3R6JA 1W30A 3ICEA 1HDRA 4MCHA 3NI2A 4WZEA 2XBMA 3FYSA 3AHEA 3H1GA 3C8MA 4KAAA 5I4KA 4S0ZA 4I14A 2ZSEA 1VJRA 1M7HA 1KBQA 1GL9B 4O63O 2QXTA 4YECA 4D8VA 3AGQA 3KKEA 3WLRA 4K6CA 4AJIA 4BLPA 4D6PA 5CFMA 3UY4A 3DZCA 1C9DB 1JFLA 4HVAA 4JQOA 4RD3A 4QTXA 3VVLA 3T1QA 1K5DA 4RD6A 2W8BA 3EJWA 1YS2X 4XB2A 1HZZA 3U3KA 5I7FA 1FP2A 2XMCA 4YRCA 2X8KA 1E1QD 3PGLA 1L4KA 3JR7A 4MDFA 1QDLB 3S4YA 2X76A 3OQIB 4Q39A 1GTMA 1U0NA 3TZHA 1S3GA 1Z2DA 2RE8A 2OMEA 3MFQA 4D9EA 3T5GA 3CPXA 1N75A 2CFSA 4G1BA 3D6HA 2YHSA 4IX9A 4WZ6A 3RJMA 4ARZA 1YA6A 3FNRA 3PHJA 1VB3A 5FFNA 3ORYA 2BTQA 5ISMA 2WSMA 2Q2NA 2E7ZA 2EAUA 5E3IA 3ZQUA 5A02A 1J1IA 1OKKD 3R9IA 3HJBA 1QCZA 3QM1A 3RRNA 3UGTA 2WZPP 2H85A 1EVQA 4KO3S 4WOCA 1WVMA 3LUGA 4YUZA 2RHMA 1E5VA 3V42A 4TTIA 5JC1A 1T3LA 3UQYS 1XD2B 2FEXA 1QV7A 2ZXFA 3EEOA 5ITVA 3V6MA 1N1DA 1N2CE 3GVKA 3JD3A 3R3YA 1N6HA 4WN9B 3BIFA 3RC8A 1KRXA 5I7OA 2QB5A 4E22A 2B98A 2WJWA 1FFWA 3N7UA 4MEBA 2QSJA 4LWOA 1JR2A 5G1PA 3CS3A 1Q6YA 1XTZA 2NV0A 4G2NA 5GPBA 1AZLA 3OE1A 4UHEA 4BBAA 4FKMA 2IF2A 3IT2A 4FOLA 4RC9A 1P73A 1TAHA 2QN8A 1TVMA 2LKDA 1WXWA 2Y99A 3C48A 4K9DA 3S5JA 3NTQA 5CIWA 3ZJ4A 4JXXA 1FYDA 4P7FA 2WIJA 2ZRCA 2P2SA 3MRXA 3MTBA 1VLZA 3OZAA 2WM9B 3PFBA 5KYXB 4J8PA 4NL4H 2PY6A 4L15A 2I3AA 5C53B 1FMJA 1BTOA 4G5HA 1U3UA 3BB3A 3GP3A 3B5IA 4UXJA 5JJIA 1PFGA 2MSDB 1YQEA 3TZEA 4YRMA 3KL2A 1NIPA 4KR0A 5DGXA 1FP4B 1AGRA 2AF4C 1WXDA 2ZCVA 3IQXA 4EHFA 2IV3A 1RLTA 4Q1EA 3NPMA 1OI2A 5DFAA 1MH9A 2CJPA 4QO7A 4BTEA 3E2PA 1YJBA 1ZOPA 3VTAA 1KMNA 1PD0A 2ZRQA 2F3SA 3B1KA 3KQWA 4E51A 1GGFA 1XSEA 2P2YA 1NWHA 1O8CA 2I2XB 2A33A 2EW1A 3L1UA 3NVKI 4JU9A 1YZQA 3RWMB 4PSAA 2BW0A 1PRYA 2R1VA 1A8HA 1H2FA 1SBCA 1XUOA 2DSNA 5JNTA 2NU8A 2WRZA 4TRRA 5FUYA 4G3XA 3H9CA 4OI2A 3VVMA 3CN7A 1EMDA 5E6SA 4LECA 1Y89A 1GCGA 3UHJA 2Z08A 4FGWA 1S4MA 3RSOA 3HWRA 4NDAA 4RDIA 4CKBA 1GM5A 3GRPA 4IH4A 5F12A 2I6SA 4RTQA 3PNQA 1EK2A 1YKSA 4OKNA 4QBFA 4G67A 3DLTA 3QUSA 4X20A 1R6BX 1V7QA 2X14A 5IKMA 3CUKA 1S7CA 1S9DA 2AG6A 2R7KA 3IPAA 2WY2D 1RI5A 1ZXXA 1LLUA 1DDIA 1UIMA 1VKZA 4EKYA 2D3WA 2GYVA 2JB9A 1Y9ZA 3NHKA 1ZICA 5TQ2A 2ZIWB 1MD9A 1HF3A 2HMYB 1FU4A 1VPTA 2QY9A 3PZBA 3QEOA 3RARA 3LQQA 2XMPA 3OA2A 1KMIY 1AQIA 5CJ2A 3ZLUA 4CMAA 4BPBA 5B6JA 4NIMA 10MHA 3U09A 1W94A 3DHNA 1XQWA 4ZO7A 2R7LA 3CRNA 4KYTA 3ESBA 3WL5A 1IVSA 2JIQA 5L9AA 4W9RA 4DLPA 1GU0A 2GN1A 2OPBA 3DCJA 3LCJA 3UMGA 5BQXA 4KR3A 3R7BA 1S8OA 4AZVA 3H75A 3IIEA 4QREA 3DF9A 1N1MA 4Z3DA 1ZVQA 1N6NA 1U8FO 1CX9B 4PCLA 3OCWA 1UBFA 3CKYA 3OG9A 4FONA 5GJCA 4RYDA 4IGAA 3AFOA 3R6GA 1Q0ZA 2CL6X 2DKNA 2O3SA 4BEJA 3BD6A 4KDEA 2Y92A 3CN9A 3DAYA 4IJUA 5HCUA 1CVRA 1W1WA 2OORA 1CJUC 3JWIA 3S1LA 1N6PA 3GHHA 3WLOA 3WGHA 1SHKA 2VA8A 1I1OA 2OXFA 4XVQA 2A5LA 1IHMA 4D8YA 3V4OA 2B69A 2DT8A 3RUDA 3HP1A 3RVPA 4DTIA 5I7AA 4DA4A 3KOZA 4BB9A 1TM2A 1UBOS 1U2SA 5KYTA 1XPOA 1A04A 4KDCA 1JHYA 1VHLA 3TMYA 1OD6A 4LMPA 2ODBA 3N2NA 1WXIA 4OBWA 1H2ZA 1E2KA 5KO2A 4Z51A 4X62B 1VB5A 2OWEA 3GAAA 1Q84A 1Y6FA 4HRYA 4JC0A 1L7DA 4PC6A 2AN4A 1EVKA 2KMLA 2MHCA 1OSNA 5FP0A 4K0KB 1OZ0A 3UK7A 3ZDEA 3KOXA 4BIIA 4C5BA 4DLWA 1AXRA 1BXRB 5AXCA 3TSYA 5CT8A 3DMFA 1W44A 1EUCB 2CWWA 2H7XA 4UEQA 2R6AA 3F96A 4PYRA 1YR3A 3PEUA 3WRYA 4E7OA 1XDGA 3TINA 1YB1A 5DWDA 1IUNA 2RHBA 3GUCA 2JGFA 1C8VB 2TYSB 3IOBA 3MWDA 3D6MA 1EHCA 3S7ZA 3DT8A 3ZGLA 2Z4RA 3T7RA 3WQRA 5J4VA 2C2WA 3BN3A 2ZM6B 3LKVA 1K68A 1PS9A 3QVGA 4HGQA 2IT1A 4D74A 2GI4A 3R6KA 3R5JA 5DF1A 3O9VA 3G85A 2YMPA 1JQKA 3PQ3A 1HGXA 2HTFA 2FE1A 3QTTA 3QWFA 3RHTA 4M98A 4YR9A 2JIDA 4F4IA 4I1UA 1ZL2A 1WMBA 3NNDA 4X90A 4NMHA 2P6OA 1E96A 2XUPA 2JG3A 2ZFUA 4FN4A 4HDMA 3ZHVA 4XD7A 2D4AA 1F48A 3VAYA 5IFLA 1LSOA 4DR3B 4WE3A 4JLOA 1Z45A 3EW9A 1X7ZB 1GU1A 4G0UA 4YAWA 1Q1QA 2EBUA 3D64A 4FYXA 4HZGA 1II9A 2DOKA 1DIAA 5AI8A 2KWIA 3GV0A 1C7FA 1FVXA 3I04A 2CHGA 4N47A 1ADCA 3IJRA 2B1IA 3VRHA 3A36A 3AVTA 1JW9B 3O4GA 1HXHA 1K98A 2IUSA 2NZXA 3NBYC 1ACMA 2ZZGA 1C4WA 1RBMA 5LJIA 4MKRA 3AP2A 2AN3A 1WR8A 1U2RA 1U5BA 5IVIA 3ESZA 4DANA 4R40A 1IUPA 3F9CA 1XQVA 6AT1A 1PKVA 2EKDA 5CT6A 1YL7A 3DMNA 3FHOA 5J4YA 3HFGA 4QEDA 3MBKA 3BZBA 1D0IA 1VPDA 4GI7A 3TS1A 2NWQA 4OYYA 4A2QA 1NP7A 2QVBA 1SA0A 4Y0VA 4DCOA 4ZQHA 1YB2A 4NJEB 4BGVA 4MGEA 2YNMC 5C1OA 1XDBA 4WK4B 2JLZA 1XTQA 2E4YA 4KGVA 2V7GA 3KVNA 4YGYA 5EZYF 3T5DA 2UUAB 5CURA 2FPPA 4B80A 1YDHA 3P9CA 4FXOA 4WH0A 4YNBA 3SEFA 1XEXA 2OENG 4FKZA 3H5TA 3G71B 2HHJA 2ZI7A 3BRCA 1J7KA 2P4SA 2OAEA 3SKXA 4CI9A 3GMDA 3E3MA 1FRZA 1KPIA 1R1DA 2GDZA 1EFVB 2HV8A 4BNMA 4L3OA 1BDHA 5D3QA 1E61A 1UKCA 1PJ8A 1V5WA 2RKBA 5TRTA 4XGQA 2AJ8A 3HKEB 1H3EA 3O95A 5IF3A 4LXGA 3CPWB 5AW1A 1H0RA 1NZJA 3V00A 4ID3A 5HOEA 2Q2QA 1DQZA 2JATA 1XVAA 1CUCA 3TDKA 1KOGA 1PEKE 1KYIA 1XRPA 4YXWA 2WYVA 2ZSKA 2G0AA 3GFVA 1J7JA 3Q6QA 3DTTA 2BP7A 2DE0X 3E9DA 4BGDA 1S8NA 3JV7A 4DAOA 3DF7A 4MWZA 2XCLA 1VE7A 3NWOA 1Y5NA 5CM2Z 1Q22A 3HXKA 3WP0A 2AMVA 3F46A 5J2UF 1KS2A 2O8BA 4Y0AA 4A82A 4DOMA 3TL6A 2XX3A 4X1OA 4FHZA 4QQ8A 2IEBA 3AEKA 5E6SB 1WTAA 1B41A 1QQ5A 1SGWA 3AEQB 1R4MB 1S6YA 1BZYA 4HGRA 4MQ5A 3OM1A 3Q6IA 4LE2A 3RIHA 2H29A 1BMDA 4RVDA 1RYDA 1ZESA 2MR6A 3RVSA 1NBAA 4TXNA 3T1VA 3S68A 4X20B 1B8NA 2CFRA 1KY4A 2JBAB 1W48A 3I8OA 3KSMA 4ISBA 4F6RB 4JYZA 3ZDQA 4XR9A 4DMFA 4MRSA 4CTKA 2AG5A 3PCTA 5CLHA 4OP7A 4IKOA 2NU7A 4QLAA 3GJZA 5HF9A 2JI8A 3TD9A 4EUFA 3W1EA 5CP8A 2IP1A 4O4JF 3WHLA 1II0A 1YDEA 2DG2A 3HA7A 1OYWA 3E8XA 3MQ2A 3OECA 3PIDA 4WNYA 3ZH9B 5JXGA 3K0SA 3U7FB 1M5UA 1SEVA 1Z4PX 2AI1A 4W1RA 2AMYA 4CDRA 2V4UA 3CRVA 3D7MA 3VNUA 2J7PD 2Q62A 2VA9A 1I2AA 1XQYA 4JLDA 5FJJA 4OGGA 4CM8A 2OECA 3KLMX 3MYRA 3OEEA 1ZOSA 3ZWVA 5TC4A 3PRYA 5A0VA 2DERA 2GTIA 4TN1A 3D7KA 2JLBA 2ZYDA 5CDGA 1JBQA 4ZV7A 1PEYA 3EZYA 4XYEA 4F21A 2OWDA 2ECPA 3HVIA 1JFVA 1B6RA 1MJFA 1SUSA 1TZBA 2B1QA 2VDQB 2ZBPA 3WGMA 1IJEA 2QDXA 3LBHA 5ERYA 3M9XA 1CETA 4URUR 4JQCA 5AJHA 4MV8A 4HS9A 5KYGA 1KVUA 4QPNA 4WOBA 1KA9H 1L9KA 1SN7A 2OB2A 1A77A 2OBYA 2VPZA 2Z0MA 3L4BC 3PWKA 3DYIA 3Q9UA 3ZYZA 4RPDA 2DQZA 2H4WA 3A6ZA 3TTVA 5MN5A 2NW6A 5IWAB 1USGA 1R15A 4HIZA 3QP9A 2WQ6A 5FPSA 2H1OA 2Q7XA 1QFJA 4KTVE 2D2EA 4LRYA 3EPHA 2GERA 3G2MA 7ABPA 3FD8A 5K6AA 1Q1GA 3D1VA 5SZHB 1TUBB 1PR0A 1QHFA 2VQEB 2F1HA 4MRNA 4ZI3A 1FZQA 3CCLB 4LVOA 4MW2A 2QUKA 1XVTA 4GR4A 1L6RA 4ON9A 1AB5A 4RK4A 5JNWA 2QRVA 1NVKA 2IE8A 2XDQA 1XLWA 3D3WB 2NSYA 1B42A 1GSOA 5L4NA 1DEKA 3OZGA 1T2NA 3EZ2A 5EOVA 1YCHA 1ZMRA 2ZRBA 2WHQA 3ZNQA 4ATNA 3PICA 4RUKA 3RV4A 5FORA 3V4RA 3C7DB 1J00A 2ZYTX 1W5BA 2GBLC 2SBTA 2X1LA 3QPVA 5AM1A 2C96A 3TF5A 5HZKA 3SC4A 3W2IA 1PFVA 1SO8A 4X00A 1RWBA 4BC0A 2OHGA 2GHQA 2H1SA 4Y2PA 2XPCA 1QYXA 4RH3A 1FX0B 1KBZA 1S0UA 1Z5PA 1ZHFA 2ZJFA 3H9GA 4H0NA 1G2PA 4JGBA 3BWEA 4XUGB 3KDSE 1U8ZA 4B73A 2WYIA 3AYZB 4X9XA 2I66A 4B7XA 2BH2A 1N07A 2AI3A 4WLNA 1UUFA 4OHVA 1I4TD 2AR9A 2XADA 2G7MC 2HF2A 4JGGA 4NJOA 4HYEA 4PX5A 4OI1A 4BZQA 4YDQA 2HBZA 4J3NA 1Q50A 3QOWA 1O5OA 2R2GA 4EI7A 1P29A 1M2JA 3BYZA 3HPRA 3RSHA 2IODA 2YRFA 1C9YA 1E62A 5GJVC 5CA1F 1TD9A 4EX7A 2Q46A 1QQ6A 1CQJB 3G82C 3M6FA 4WESB 3L8ZA 4G5RA 4YT8A 3RKRA 4I4TB 1C50A 1I01A 4YAKA 2GD2A 1WB9A 1U90A 3QY9A 5HTKA 9MHTA 4F56A 2BONA 3EYAA 3ZDDA 5JALA 2BUAA 2YV1A 2YZNA 3EBOA 3PNKA 4IMIB 3IUMA 3KSAC 3EDCA 3OZFA 4NXMB 1VE6A 4XDYA 1AIPA 2GBIA 2WAYA 3MBIA 4MVWA 3IJPA 3RHZA 3UCFA 2QIPA 4RF2A 2GLXA 1B2LA 2GXSA 3T4XA 3G0OA 4Q9HA 1I0LA 3T12A 4Q3EA 5IASA 5JS1A 4K9PA 1A69A 4C4OA 3FMFA 3MK31 4WBNB 4KQCA 2FZKA 5JAUA 2VAWA 4JIMA 1HEIA 2B0CA 2HSGA 3ZU2A 4X44A 1RRPA 1Z5GA 1RYMA 5C5DA 4IDPA 5CYGA 4CQMA 1F6DA 4KACA 3CLHA 4HRVA 3M6MD 1NSFA 4LDAA 4J43A 3CLRC 2VK2A 4PAQA 2C7GA 4EY6A 1EVEA 5LP6F 3MMZA 5K0NA 2RAPA 5TEWA 5JQGA 1EE2A 2AGVA 3RIEA 4EPYA 4ED9A 4JYPA 4YUAA 1A2OA 3M1LA 2DC1A 2EGGA 3AWDA 3E61A 4TN5A 4Y6PA 3TR6A 1OH5A 1U0OC 1NYLA 3TFQA 1JFTA 1WHTA 3C6KA 3KCNA 1ZSNA 1HZJA 1NLFA 3JYHA 1LUAA 4Y2SA 1J0CA 1ZINA 5DWVA 4BQSA 4E2WA 4UZUA 5EHQA 1JHDA 5KYUA 2OYSA 3ZIUA 5I5EA 4HDSA 1DKLA 2ODNA 4HBGA 5DTRA 1A82A 1U1DA 2WWYA 5KIAA 4PBRA 1QH0A 2XUAA 4BN5A 1MRNA 3L8CA 4LJAA 2E4ZA 3UWDA 4FOSA 4HWKA 2Z3ZA 5FNVA 1E32A 5K3FB 3SZRA 4QPJC 2Y0EA 3W7VA 1H05A 4DRXB 2HIMA 1I51A 1GLNA 3ZLJA 1MQSA 4JBLA 4J2HA 2NSJA 4ER0A 2OPHA 3JYLA 4O5AA 3E7PA 2D2VA 3OTOB 1MO6A 1PK9A 1QS0A 1XMJA 2VPTA 3FCSB 1BS1A 1HYQA 1EVJA 3GFFA 1T9CA 1ZH6A 4HTFA 4B6SA 1UBGA 1NFQA 2FPIB 1Z25A 2I8LA 2AB0A 3MMSA 5DPMA 1CY4A 3FTPA 3F8WA 4G1MB 2PJRA 5JVDA 4Z2AA 1U2TA 2AEJA 4LOIA 4XJTA 2IS2A 4JVNA 3CXRA 1XZBA 4TMYA 4YA6A 1QVRA 3CR7A 3OZSA 3WY9A 4L8LA 2O59A 1YL5A 2Q5JA 5FTWA 2C3UA 2IZ1A 1XU9A 2VN8A 3BQ9A 4J2TA 3C3PA 3UMJA 3CF6R 3L0OA 3ONUA 5IK2D 2R6FA 3QYJA 2UZ1B 5CCDA 4IMJB 1FEZA 3KQYA 4EX6A 3HXOA 1DBRA 1C4OA 4O2AA 1SBTA 1UP6A 2G40A 4V0SA 5AIAA 2JJQA 3VUEA 2A14A 3TQSA 1J5XA 5ICGA 4OQEA 2NU7B 4AWAA 1E3WB 4NSNA 4BLTA 3RABA 2J9FB 5FRDA 3FWKA 4P26A 1PKEA 2YIMA 2X4DA 3BFVA 3JWJA 3PBKA 4FDMA 1K2WA 4MYHA 1YI0A 5EKDA 1K3FA 4GX0A 2IUFA 2PEZA 4R98A 2P91A 1WY7A 2LR0A 2NPIA 4N0PA 1HL3A 1KF0A 4E5DA 4O4HA 3K6KA 1VHJA 2N1BA 3A31A 3FNIA 3HYCA 4H27A 4OJNA 3OAAD 3ZDCA 4JUFA 4MOWA 1Y1SA 4EFDA 4X1KA 1NNSA 2VPYA 2QM7A 5FPQA 3FPLA 1G4UR 1KVRA 3CGGA 4TYMA 3IBCA 3OCUA 3GDWA 4M22A 3TCNA 3RUAA 5A9SB 4QJ3A 1R10A 5EJ6A 1GNRA 1VL0A 2F90A 4REOA 5HS6A 3PGA1 5K3AA 4ZT6A 1W9MA 3LZ6A 4N7RA 5FEUA 1HBJA 3A28A 3VU1A 4E15A 5LQMA 5JU6A 3N59A 5COAA 3FZQA 5AWFC 4YRTA 3RYCB 4PG4A 2AC2A 3GDHA 3JXEA 3UAOA 1YBVA 4W8GA 3V1TC 2Y0PA 1U6IA 1Q3HA 2XE4A 4MDHA 3LKBA 4MQEB 4O29A 4R51A 2X42A 1FBNA 1EG7A 4RD0A 4YEDA 2VF4X 2CBGA 1I3NA 2AK3A 2B2NA 2FFJA 1V6AA 2P9EA 2QL6A 3F5MA 4GE3A 1RKXA 4MVJM 3UB3A 4IQFA 1XL0A 4ZI7A 3EXG1 2W6IA 5I9NA 1GYPA 4XJSA 3WLQA 4CL8A 4BDSA 1EFCA 5CB0A 2V6IA 1BCSB 5CG1A 3CZ5A 2ZU6A 3NH9A 2AYZA 5SV2A 4BAZA 2AT1A 1D3AA 3D8RA 1Q0TA 5BSWA 4BJ5A 3CVWA 1PJRA 1USVA 1XTTA 3UHOA 4RKYA 2VDMB 2FFAA 3FROA 3KKMA 1PR1A 5HBGA 1QQBA 3DW3X 4CNQA 2JZNA 4LC0A 4C6RA 4M1KA 1VI2A 1KDPA 1PWYE 3UUFA 5IUJC 2B5OA 3IR6A 3QWAA 4OSOA 3V1LA 3F1KA 1O95C 4YAFA 3FAKA 1R16A 3FM9A 2HDHA 4IIEA 4MGYR 1QKKA 5CJJA 3CUYA 2CFCA 3BD8A 4LSMA 5BSYA 2IEIA 3GNTA 3KQQA 1V4BA 1ORRA 4CDGA 4DDVA 4Z3KA 3ADDA 2HFKA 4FYHA 3OBIA 5IDWA 2IYOA 4R05A 3A26A 4D0RA 4NBNA 4IVNA 3EBLA 4JV5B 3LUCA 1JPJA 2OZPA 3H1FA 4FYPA 4YRLA 5CNMA 2BHNA 3CIFA 1G7TA 1TIKA 1KYXA 4RV9A 3ZDYB 1KSHA 2RKWA 1BEZA 5JMPA 5LR6A 3SMVA 5GIOE 2IH4A 1DJNA 3VO8A 3Q7IA 1E59A 3EG5A 4ND1A 3RRXA 4P3XA 4PG5A 1ZCAA 2CVHA 3LH5A 4FFPA 4KR7A 4I6GA 4GS5A 3LYLA 4RV5A 4E30A 2DLCX 4EG0A 3WL7A 1CUYA 4JA0A 4ZGQB 4MVJF 3TLGA 1GAXA 3VC7A 4LXQA 1NW4A 4RPLA 2Q7DA 5LLDA 2ZBDA 3UMFA 3O21A 2XE7A 2ZVJA 4F2GA 5AJUA 1JALA 1KC3A 1NQ5A 2DBVO 3IIJA 1VRWA 2QL5A 1I6LA 5KJCA 2D1TA 1NPTO 3EGXB 1Y1KE 4DGQA 4IQ4A 1XMOB 5HXBA 1EVIA 5G2OA 2OVBA 1DP4A 1BFKA 1CSEE 4S1PA 2H2HA 2R96A 2HMVA 3AUFA 1JWAB 5DLDA 4W1QA 1Q1BA 2O2CA 1J9ZA 1UJCA 4HAZA 5FTNA 1DQPA 1QLWA 3WK7A 2DH5A 5HKLA 4HGYA 4AG5A 3ZWQA 4C7KA 2B8JA 4O33A 3TRFA 4BUJA 4GX2A 5H4GA 2HX1A 4IV0A 1PR3A 4OG2A 3F2VA 4QJ5A 2VDVE 1GKIA 2D2IA 1GPMA 3KALA 3TOSA 4L5AA 4DCMA 4HXYA 3IQEA 3KFXA 4K9KA 4AMYA 1C4KA 1XVLA 3R3ZA 5CD9A 1YHQB 3LT5A 3P8ZA 4EHIA 4PM4A 4EAQA 5KDOA 3WLSA 1IHXA 2NIPA 4PLPA 5DISB 2FSIA 1H4SA 2I6FA 1WDKA 3DTYA 4NU8X 4O25A 4I9HA 1V5GA 3S1AB 3FY4A 1UKVY 4QBHA 3REGA 5IJWA 1II8B 4WXYB 2BFCA 4MK4A 4ENRA 1U63A 2ZXIA 2C59A 2KI5A 1YHZA 4HR7A 1OAKA 1VPLA 5K3CA 4BZXA 4EMTA 1ZM9A 1S2NA 2GF2A 3ZZ0A 3UICA 1EFUA 4KKXB 3UV7A 4GYJA 4D8TA 3E27A 1US8A 2V74B 2X3YA 4QGSA 4P83A 1Z17A 4Q00A 1QAOA 5L53A 3ZV5A 4PCAA 2C9YA 3RLFA 1U9CA 3BKXA 1AC5A 1Y7HA 4BVEA 2YS6A 3EVBA