3E1YE

Crystal structure of human erf1/erf3 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
195
structure length
195
Chain Sequence
IRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
total genus 27
structure length 195
sequence length 195
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
E PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE01
2BM1A 3E20A 2BVNA 2EIXA 4FN5A 1QX4A 4PC6A 1GAQA 1Q86D 2QDXA 1ZUNB 2VNHA 4YAFA 3ZZTA 5H5JA 1Q82D 3AVXA 3JQQA 3ZC3A 4QFMA 4R71A 3JQPA 3W2GA 1VQ7B 2HDNB 1YI2B 2VYQA 3SJZA 4PC7A 2ZITA 2NPFA 3OJXA 2C77A 1M90D 1K9MD 3B78A 1QVFB 3VO2A 2QN6A 1YHQB 3WXMA 2VNJA 1VQLB 1VQ8B 2B5OA 2BN4A 1KK3A 3LVBA 4RCYA 4WQMA 4F7DA 2DEUA 4HE5A 2C78A 3MHPA 1JA0A 3OZUA 4RD0A 3CCLB 5EMNA 1FNBA 1GJRA 4G1VA 3W2IA 1ELOA 4RD2A 4IW3B 1QVGB 2BSAA 1GAWA 1A8PA 1IJEA 1JA1A 4K1XA 2OTLB 4RD3A 3MCAA 1YJWB 4N3NA 1QGYA 1FNDA 3G4SB 4C0SA 4HE6A 1W34A 3QFCA 1G7TA 3U6KA 4ZGNB 1EFTA 1QUFA 2QMUA 1B2RA 2FX3A 1VQ4B 1VQ9B 3I56B 4M53A 4Y7CA 1IB0A 1UMKA 5TV2A 1TVCA 1JNYA 1ZM2A 3VMFA 4PC2A 3WNCA 3CCSB 1KD1D 1SM4A 4EH1A 2YWFA 1B23P 4G5GA 3E1YE 4TMXA 3OJWA 3OZVA 1ZM9A 1DDGA 1E62A 4LBYA 3P27A 1VQOB 1FNCA 3WYAA 1OGIA 4QHYA 1EP3B 1W35A 3CCRB 2GQFA 2CNDA 4RCZA 3ZZUA 2X3UA 4B48A 3AVUA 4ZCMA 1D2EA 1KRHA 1G7SA 4UAJA 1NDHA 4YAUA 2BPOA 1QFYA 1EWYA 1DDIA 3U6BA 2HMAA 1JB9A 1VQMB 2QTZA 3CCUB 3ZBUA 3CCEB 4P3YA 5AN9A 4C43A 4LC0A 1VQNB 3W5UA 3ZBTA 2BV3A 2HCJB 3QE2A 1R5NA 3I1FA 1BQEA 3CW2A 2BF4A 1KJZA 4N3GA 3QFRA 1KTVA 4Y9RA 1R5BA 3G6EB 3I55B 3OZWA 1SKQA 5THXA 1M1KD 3OW2B 4LBWA 4ZGQB 3AVYA 1W2BB 4M2LA 3B82A 4LBVA 1N0VC 4RJLA 4B4DA 4AC9A 3V76A 4YHBA 1KK0A 2BGIA 2B7BA 1BX0A 1AMOA 1QGZA 2D74A 4TN1A 1GR1A 4ZCIA 1YJ9B 2DETA 3U2QA 2BMWA 3CB4A 3CRZA 3JQRA 3LO8A 4NCNA 1N0UA 1QUEA 1GVHA 3W5VA 4PGOA 2RC5A 3CC7B 1GO2A 1TTTA 4ACAA 1S72B 4DQKA 1D1NA 1QG0A 2RC6A 1BJKA 3W5HA 3FJOA 3G71B 4YALA 4M4SA 4TMVA 1S0UA 1R5OA 4YAWA 1EXMA 5GV7A 4M1KA 4G1BA 3B8HA 4P6VF 4M0LA 4AF7A 2OTJB 1U2RA 2E1RA 4BPRA 3ES9A 1JJ2B 3AGPA 1ZM4A 1QGAA 2B7CA 1CQXA 2VNIA 1XE1A 4B3XA 3WBJA 2VZLA 1G7RA 4J0QA 4YAOA 2XNJA 1QFZA 3CPWB 2BGJA 1QH0A 1NJID 3AVTA 1W87A 3AGQA 5GV8A 3AVVA 4ZV4A 3MMPA 5JBQA 2DCUA 1KK1A 1F60A 4MYUA 2YWEA 3ZZ0A 3CCJB 1K73D 4Y9UA 3WBKA 1AIPA 3AVWA 1Q7YD 1FDRA 3W2FA 1D8TA 1IJFA 3CMEB 4B44A 1VQKB 1TLLA 2BM0A 3CC4B 3QFSA 3VNUA 1FRQA 3CCMB 1EP2B 1QFJA 5KSWB 1TUIA 2OK7A 1HA3A 1YITB 1I7PA 1H85A 1DARA 5FA6A 5H59A 2EFGA 1K8AD 1YJNB 1KK2A 2YWHA 1OB5A 2PLFA 1F20A 1J9ZA 2J7KA 2R6HA 2QTLA 1XB2A 4DQLA 2VNKA 4ZCLA 1OB2A 3W2HA 2QEXB 4TMZA 1BX1A 1EFUA 2GPJA 4TMWA 3VO1A 1EP1B 3CD6B 4RD1A 4FWTA 2QA4B 2PMDA 1DG1G 4Q7JB 5HXBA 1CNFA 1YIJB 4AF6A 3VNVA 4H9GA 4FK8A 1CNEA 3CC2B 2CRVA 3CXCB 1WDTA 3FPKA 4U9UA 2DERA 3J81k 1VQPB 1KQSB 1Q81D 1FRNA 1E64A 1ZM3A 4RD6A 3WY9A 1G7CA 1H42A 3WNBA 3CMAB 4B47A 5DSZA 3P26A 2AHOA 3PENA 1OGJA 4PC3A 3W2EA 3WNDA 1E63A 2DY1A 4NBSA 1FNMA 2YWGA 4TMTA 4PC1A 3QSYA 1KC8D 4ACBA 3CCQB 2XEXA 3QFTA 4B43A 1N8RD 2XNCA 5TY0A 1EFCA 4MYTA 3CCVB 5TR9A 2PIAA 4LBZA 1VQ6B 1VQ5B 4RD4A 2OK8A
chains in the Genus database with same CATH superfamily
2BM1A 3E20A 2BVNA 2JDIA 1HZEA 3ZUGA 2XNDA 2EIXA 5IK2A 4FN5A 1QX4A 2DYIA 4PAAA 4PC6A 1GAQA 3H94A 2WPDA 1Q86D 3FPPA 2QDXA 3ASSA 1ZUNB 2VNHA 4X07A 4YAFA 3ZZTA 5H5JA 2VBUA 1Q82D 2I1LA 3AVXA 1FX0A 2V31A 3JQQA 3ZC3A 4QFMA 4P9SA 4R71A 1W0KA 3JQPA 3W2GA 1VQ7B 1E79A 2HDNB 1YI2B 1UD6A 3SJPA 4II3A 4RDJA 2VYQA 2X0KA 3OOCA 4Z4TA 2QGGA 2WJYA 3SJZA 4PC7A 2JIZA 2CBXA 2ZITA 4UZFA 1I8DA 3CMMA 4XL9A 2NPFA 3OJXA 2C77A 1M90D 4HIZA 1K9MD 5IYRA 4XONA 3B78A 2V7VA 3VO2A 1QVFB 2QN6A 1YHQB 2V7WA 3WXMA 2VNJA 1VQLB 3R6KA 1VQ8B 1UD5A 2B5OA 2BN4A 1KK3A 2C2WA 3LVBA 4RCYA 4WQMA 4F7DA 2DEUA 4HE5A 2M5SA 1YX2A 5DN6A 2C78A 4XNFA 3GIRA 3MHPA 1JA0A 3OZUA 4RD0A 4XM3A 5KW9A 3A35A 3CCLB 2R9VA 5EMNA 3SLDA 1FNBA 1GJRA 4G1VA 1W0JA 3HAGA 3KEWA 4XLFA 5B6IA 3W2IA 3BCFA 3PA1A 4RDKA 1V5VA 5FNZA 5L46A 1ELOA 4RD2A 4IW3B 1QVGB 3GSIA 2BSAA 1BLIA 1GAWA 4L8JA 4OOVA 1XFOA 3ZPNA 1V0FA 1A8PA 1IJEA 1JA1A 3ASPA 3VR6A 4K1XA 1SKYB 1H8HA 2OTLB 4RD3A 3MCAA 1YJWB 4N3NA 1QGYA 2X6YA 1FNDA 5E6TA 3G4SB 2ZL6A 2ZZFA 5F4JA 4C0SA 4HE6A 1W34A 1VLYA 1PJ5A 3QFCA 1G7TA 4CQJA 3U6KA 4ZGNB 1EFTA 1QUFA 1W9XA 2QMUA 1B2RA 2DIEA 4TT3A 2FX3A 4WZTA 4X7CA 3T51B 1VQ4B 1VQ9B 2GK6A 3OEHA 3I56B 5CDFA 4M53A 3PVDA 4Y7CA 5J3OA 1IB0A 3WQZA 1UMKA 5TV2A 1TVCA 1JNYA 1ZM2A 3VMFA 4XMYA 4PC2A 3WNCA 5A8AA 3CCSB 1KD1D 2X6WA 2HLDA 1SM4A 2ZBVA 3BCDA 4YEJA 2W6JA 4EH1A 3LNNA 1N05A 3SKBA 1KMHA 2YWFA 4KKTA 1B23P 4G5GA 3E1YE 4TMXA 3OJWA 3OZVA 1WORA 2Q6OA 1ZM9A 1DDGA 1E62A 4LBYA 4Z4ZA 3ONYA 2OBSA 2OBRA 2WSSA 3P27A 1VQOB 5IYWA 2GJRA 1FNCA 2XZPA 5FL7A 2WZPP 1WSVA 5F4OA 4XORA 3WYAA 1T5EA 1WOSA 1NB9A 3Q3AA 2WZNA 1OGIA 2XOKA 1EP3B 1W35A 4QHYA 3CCRB 2JN9A 3LQ6A 2DOGA 1BPLA 1E3ZA 2GQFA 2CK3A 2CNDA 5FO0A 4B3FX 4P12A 3A8KA 5LMZA 4RCZA 3ZZUA 2X3UA 3A8JA 4B48A 2E1BA 3AVUA 4ZCMA 1D2EA 3GVKA 1KRHA 4P25A 1G7SA 3BC9A 4UAJA 5BSYA 1NDHA 2C4UA 4YAUA 2BPOA 3OPOA 3V7AA 1QFYA 4DNRB 1EWYA 1DDIA 3U6BA 2WJVA 3BQJA 1T6XA 2HMAA 1JB9A 1VQMB 2QTZA 3CCUB 3ZBUA 1WOOA 3BH4A 2VBTA 4OOSA 1UD8A 4XOTA 4Z4WA 4P3YA 3CCEB 5AN9A 4C43A 4LC0A 4P2NA 4X05A 1VQNB 3W5UA 3ZBTA 2BV3A 2HCJB 3QE2A 1R5NA 3I1FA 1BQEA 1IHMA 4YXWA 2V4DA 3CW2A 2BF4A 1KJZA 2V7QA 3QFRA 4N3GA 1KTVA 4Y9RA 1R5BA 1UD4A 3G6EB 5J35A 3PUMA 1YLOA 3OZWA 2Q6LA 3T56B 1SKQA 1XQBA 3I55B 5THXA 1M1KD 3OW2B 5HZAA 2V7TA 1H8EA 4OPSA 2GJPA 4LBWA 4ZGQB 1W2BB 3AVYA 5HKKA 4M2LA 3B82A 4LBVA 1N0VC 1UD2A 4RJLA 4B4DA 4AC9A 3V76A 2GJKA 1KK0A 1HVXA 4YHBA 2BGIA 2B7BA 3R6JA 5HZBA 1BX0A 2ZL5A 2D3NA 1E3XA 3GVLA 1AMOA 4WWVA 3ISXA 1QGZA 2D74A 4TN1A 1GR1A 4ZCIA 1YJ9B 2DETA 5A88A 2BMWA 3CRZA 3CB4A 3JQRA 3LO8A 3U2QA 4NCNA 3FKSA 2Q6IA 3A1PA 1N0UA 1QUEA 1GVHA 3W5VA 4ASUA 4PGOA 2RC5A 3CC7B 4WZEA 4YELA 1GO2A 3OKXA 1TTTA 4ACAA 1S72B 4DQKA 1D1NA 4P1VA 1QG0A 1PJ6A 2RC6A 4Z4YA 4KKUA 1BJKA 3W5HA 5KNLA 2WR8A 1NRKA 1NBMA 3FJOA 4TKOB 3G71B 3ONUA 4TSFA 4RLZA 4YALA 1I18A 4RD4A 5IYPA 4M4SA 4KKSA 4TMVA 1S0UA 1R5OA 3CESA 1P4MA 4YAWA 1EXMA 1S4MA 4QVJA 1Y0RA 5GV7A 1EFRA 4G1BA 4M1KA 2X6XA 2P3MA 2Z6BD 1E1RA 3B8HA 3NE5B 4B3GA 4P6VF 3A3BA 4M0LA 4XR6A 4AF7A 1COWA 2OTJB 1U2RA 2F1LA 2E1RA 4OOXA 3ES9A 4BPRA 3AGPA 1JJ2B 2VJIA 4II2A 1ZM4A 1V0EA 1QGAA 2B7CA 1CQXA 2VNIA 1XE1A 4XKWA 2CW5A 4WZKA 4XQFA 4B3XA 3WBJA 1WOPA 2VZLA 4P6YA 1G7RA 4J0QA 4YAOA 4RPBA 2XNJA 1QFZA 2FVGA 2V7UA 3CPWB 3Q6RA 2BGJA 5IYQA 1QH0A 1NJID 3AVTA 3ASQA 1W87A 2VJJA 3AGQA 3BY2A 2PE3A 5GV8A 3AVVA 4ZV4A 3MMPA 1VLOA 4XKVA 1N06A 1N08A 2OBTA 2D9RA 3Q38A 3CP8A 5JBQA 2DCUA 1KK1A 1F60A 4MYUA 2YWEA 2C5BA 3ZZ0A 4NNJA 3T53B 3CCJB 2ZL7A 3G05A 2XZLA 4XN0A 1K73D 1WTHD 4Y9UA 3WBKA 1AIPA 5FIUA 3AVWA 1Q7YD 1FDRA 5F4MA 3W2FA 2C5HA 1D8TA 4QV2A 4X7FA 1IJFA 3CMEB 4B44A 1VQKB 2ZZQA 1WSRA 1TLLA 1VJSA 2X53S 2BM0A 3CC4B 3QFSA 2GREA 4OPOA 3VNUA 4P3IA 3GQBA 1FRQA 5DS0A 3CCMB 1EP2B 4X8IA 1QFJA 5KSWB 1RQRA 1TUIA 2D3LA 1NB0A 2OK7A 1HA3A 2X85A 1WU8A 1YITB 2VBSA 3ZIAA 1I7PA 1H85A 1DARA 3RY8A 2ZXIA 3OW7A 5FA6A 4DK1A 2EFGA 5H59A 3BNWA 3PA2A 3CPXA 1YJNB 1K8AD 2C4TA 2Q6KA 1KK2A 2ZBUA 2YWHA 4RM0A 2PLFA 1F20A 1Q9SA 1OB5A 1J9ZA 2J7KA 2R6HA 4RPDA 2QTLA 1XB2A 4DQLA 2LZJA 2VNKA 4ZCLA 1OB2A 4FXUA 3W2HA 2QE7A 2QEXB 4G7WA 4TMZA 4XLAA 1BX1A 2CF4A 4G7XA 1EFUA 2GPJA 5BSXA 4WZLA 1MABA 2CC2A 2V7XA 2JJ1A 4TMWA 5IYNA 3VO1A 1VHEA 1EP1B 2OYNA 2W6IA 3GVJA 4X0CA 3CD6B 4RD1A 4FWTA 2QA4B 3OFNA 2KVOA 2PMDA 1DG1G 4P22A 3DDYA 4Q7JB 5HXBA 1OB0A 1CNFA 1YIJB 4XN3A 4AF6A 3VNVA 4Z4UA 4XLCA 4Z1MA 5A89A 4H9GA 4XD7A 3A3GA 1CNEA 4FK8A 3CC2B 2CRVA 3SEJA 4UZEA 4UZUA 2ZZEA 3CXCB 4PABA 1K28D 3KL9A 1WDTA 3FPKA 3JU4A 4OPVA 3ASRA 4U9UA 2XZOA 2DERA 3J81k 1VF7A 1VQPB 2NV4A 1KQSB 1Q81D 1FRNA 2VBVA 4E0FA 2ZZGA 4XLHA 2ZTNA 2XGJA 1OHHA 2GK7A 1E64A 3CTAA 1E43A 1ZM3A 4RD6A 4X7DA 3WY9A 4X06A 4P26A 1VHOA 1MRZA 3Q39A 1G7CA 4OP7A 1H42A 3OEEA 3SLNA 3WNBA 3CMAB 1T6ZA 3PUNA 4B47A 2F1MA 4AVZA 5DSZA 2WYRA 3P26A 2AHOA 2ZXHA 4XOPA 4JMQA 4Z4VA 3PENA 3H9NA 1OGJA 3OE7A 4XLEA 1BMFA 3OP1A 4PC3A 4Z4SA 1PJ7A 3W2EA 3WNDA 1E63A 2DY1A 4NBSA 4GQNA 1FNMA 5FO1A 4DNTB 5TRDA 2YWGA 4TMTA 4PC1A 4ROXA 1N07A 3QSYA 1KC8D 4ACBA 3CCQB 2XEXA 1UD3A 4Z4RA 1WP6A 3QFTA 4B43A 1N8RD 2XNCA 2F43A 4DK0A 1KZLA 5TY0A 1EFCA 3OAAA 2JJ2A 4MYTA 1E1QA 3D26A 3A8IA 1T6YA 3LQEA 4X7EA 3ASTA 3CCVB 5TR9A 4QVAA 1PKVA 2PIAA 4LBZA 4QUZA 2F4NA 3CP2A 1RQPA 1Y0YA 4RDLA 3Q6QA 1WPCA 2X8KA 2ZTGA 1VQ6B 1VQ5B 4G6IA 3BY1A 2OK8A
chains in the Genus database with same CATH topology
2BM1A 3E20A 2BVNA 2EIXA 4FN5A 1QX4A 4PC6A 1GAQA 1Q86D 2QDXA 1ZUNB 2VNHA 4YAFA 3ZZTA 5H5JA 1Q82D 3AVXA 3JQQA 3ZC3A 4QFMA 4R71A 3JQPA 3W2GA 1VQ7B 2HDNB 1YI2B 2VYQA 3SJZA 4PC7A 2ZITA 2NPFA 3OJXA 2C77A 1M90D 1K9MD 3B78A 1QVFB 3VO2A 2QN6A 1YHQB 3WXMA 2VNJA 1VQLB 1VQ8B 2B5OA 2BN4A 1KK3A 3LVBA 4RCYA 4WQMA 4F7DA 2DEUA 4HE5A 2C78A 3MHPA 1JA0A 3OZUA 4RD0A 3CCLB 5EMNA 1FNBA 1GJRA 4G1VA 3W2IA 1ELOA 4RD2A 4IW3B 1QVGB 2BSAA 1GAWA 1A8PA 1IJEA 1JA1A 4K1XA 2OTLB 4RD3A 3MCAA 1YJWB 4N3NA 1QGYA 1FNDA 3G4SB 4C0SA 4HE6A 1W34A 3QFCA 1G7TA 3U6KA 4ZGNB 1EFTA 1QUFA 2QMUA 1B2RA 2FX3A 1VQ4B 1VQ9B 3I56B 4M53A 4Y7CA 1IB0A 1UMKA 5TV2A 1TVCA 1JNYA 1ZM2A 3VMFA 4PC2A 3WNCA 3CCSB 1KD1D 1SM4A 4EH1A 2YWFA 1B23P 4G5GA 3E1YE 4TMXA 3OJWA 3OZVA 1ZM9A 1DDGA 1E62A 4LBYA 3P27A 1VQOB 1FNCA 3WYAA 1OGIA 4QHYA 1EP3B 1W35A 3CCRB 2GQFA 2CNDA 4RCZA 3ZZUA 2X3UA 4B48A 3AVUA 4ZCMA 1D2EA 1KRHA 1G7SA 4UAJA 1NDHA 4YAUA 2BPOA 1QFYA 1EWYA 1DDIA 3U6BA 2HMAA 1JB9A 1VQMB 2QTZA 3CCUB 3ZBUA 3CCEB 4P3YA 5AN9A 4C43A 4LC0A 1VQNB 3W5UA 3ZBTA 2BV3A 2HCJB 3QE2A 1R5NA 3I1FA 1BQEA 3CW2A 2BF4A 1KJZA 4N3GA 3QFRA 1KTVA 4Y9RA 1R5BA 3G6EB 3I55B 3OZWA 1SKQA 5THXA 1M1KD 3OW2B 4LBWA 4ZGQB 3AVYA 1W2BB 4M2LA 3B82A 4LBVA 1N0VC 4RJLA 4B4DA 4AC9A 3V76A 4YHBA 1KK0A 2BGIA 2B7BA 1BX0A 1AMOA 1QGZA 2D74A 4TN1A 1GR1A 4ZCIA 1YJ9B 2DETA 3U2QA 2BMWA 3CB4A 3CRZA 3JQRA 3LO8A 4NCNA 1N0UA 1QUEA 1GVHA 3W5VA 4PGOA 2RC5A 3CC7B 1GO2A 1TTTA 4ACAA 1S72B 4DQKA 1D1NA 1QG0A 2RC6A 1BJKA 3W5HA 3FJOA 3G71B 4YALA 4M4SA 4TMVA 1S0UA 1R5OA 4YAWA 1EXMA 5GV7A 4M1KA 4G1BA 3B8HA 4P6VF 4M0LA 4AF7A 2OTJB 1U2RA 2E1RA 4BPRA 3ES9A 1JJ2B 3AGPA 1ZM4A 1QGAA 2B7CA 1CQXA 2VNIA 1XE1A 4B3XA 3WBJA 2VZLA 1G7RA 4J0QA 4YAOA 2XNJA 1QFZA 3CPWB 2BGJA 1QH0A 1NJID 3AVTA 1W87A 3AGQA 5GV8A 3AVVA 4ZV4A 3MMPA 5JBQA 2DCUA 1KK1A 1F60A 4MYUA 2YWEA 3ZZ0A 3CCJB 1K73D 4Y9UA 3WBKA 1AIPA 3AVWA 1Q7YD 1FDRA 3W2FA 1D8TA 1IJFA 3CMEB 4B44A 1VQKB 1TLLA 2BM0A 3CC4B 3QFSA 3VNUA 1FRQA 3CCMB 1EP2B 1QFJA 5KSWB 1TUIA 2OK7A 1HA3A 1YITB 1I7PA 1H85A 1DARA 5FA6A 5H59A 2EFGA 1K8AD 1YJNB 1KK2A 2YWHA 1OB5A 2PLFA 1F20A 1J9ZA 2J7KA 2R6HA 2QTLA 1XB2A 4DQLA 2VNKA 4ZCLA 1OB2A 3W2HA 2QEXB 4TMZA 1BX1A 1EFUA 2GPJA 4TMWA 3VO1A 1EP1B 3CD6B 4RD1A 4FWTA 2QA4B 2PMDA 1DG1G 4Q7JB 5HXBA 1CNFA 1YIJB 4AF6A 3VNVA 4H9GA 4FK8A 1CNEA 3CC2B 2CRVA 3CXCB 1WDTA 3FPKA 4U9UA 2DERA 3J81k 1VQPB 1KQSB 1Q81D 1FRNA 1E64A 1ZM3A 4RD6A 3WY9A 1G7CA 1H42A 3WNBA 3CMAB 4B47A 5DSZA 3P26A 2AHOA 3PENA 1OGJA 4PC3A 3W2EA 3WNDA 1E63A 2DY1A 4NBSA 1FNMA 2YWGA 4TMTA 4PC1A 3QSYA 1KC8D 4ACBA 3CCQB 2XEXA 3QFTA 4B43A 1N8RD 2XNCA 5TY0A 1EFCA 4MYTA 3CCVB 5TR9A 2PIAA 4LBZA 1VQ6B 1VQ5B 4RD4A 2OK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM1 A;  3E20 A;  2BVN A;  2EIX A;  4FN5 A;  1QX4 A;  4PC6 A;  1GAQ A;  1Q86 D;  2QDX A;  1ZUN B;  2VNH A;  4YAF A;  3ZZT A;  5H5J A;  1Q82 D;  3AVX A;  3JQQ A;  3ZC3 A;  4QFM A;  4R71 A;  3JQP A;  3W2G A;  1VQ7 B;  2HDN B;  1YI2 B;  2VYQ A;  3SJZ A;  4PC7 A;  2ZIT A;  2NPF A;  3OJX A;  2C77 A;  1M90 D;  1K9M D;  3B78 A;  1QVF B;  3VO2 A;  2QN6 A;  1YHQ B;  3WXM A;  2VNJ A;  1VQL B;  1VQ8 B;  2B5O A;  2BN4 A;  1KK3 A;  3LVB A;  4RCY A;  4WQM A;  4F7D A;  2DEU A;  4HE5 A;  2C78 A;  3MHP A;  1JA0 A;  3OZU A;  4RD0 A;  3CCL B;  5EMN A;  1FNB A;  1GJR A;  4G1V A;  3W2I A;  1ELO A;  4RD2 A;  4IW3 B;  1QVG B;  2BSA A;  1GAW A;  1A8P A;  1IJE A;  1JA1 A;  4K1X A;  2OTL B;  4RD3 A;  3MCA A;  1YJW B;  4N3N A;  1QGY A;  1FND A;  3G4S B;  4C0S A;  4HE6 A;  1W34 A;  3QFC A;  1G7T A;  3U6K A;  4ZGN B;  1EFT A;  1QUF A;  2QMU A;  1B2R A;  2FX3 A;  1VQ4 B;  1VQ9 B;  3I56 B;  4M53 A;  4Y7C A;  1IB0 A;  1UMK A;  5TV2 A;  1TVC A;  1JNY A;  1ZM2 A;  3VMF A;  4PC2 A;  3WNC A;  3CCS B;  1KD1 D;  1SM4 A;  4EH1 A;  2YWF A;  1B23 P;  4G5G A;  3E1Y E;  4TMX A;  3OJW A;  3OZV A;  1ZM9 A;  1DDG A;  1E62 A;  4LBY A;  3P27 A;  1VQO B;  1FNC A;  3WYA A;  1OGI A;  4QHY A;  1EP3 B;  1W35 A;  3CCR B;  2GQF A;  2CND A;  4RCZ A;  3ZZU A;  2X3U A;  4B48 A;  3AVU A;  4ZCM A;  1D2E A;  1KRH A;  1G7S A;  4UAJ A;  1NDH A;  4YAU A;  2BPO A;  1QFY A;  1EWY A;  1DDI A;  3U6B A;  2HMA A;  1JB9 A;  1VQM B;  2QTZ A;  3CCU B;  3ZBU A;  3CCE B;  4P3Y A;  5AN9 A;  4C43 A;  4LC0 A;  1VQN B;  3W5U A;  3ZBT A;  2BV3 A;  2HCJ B;  3QE2 A;  1R5N A;  3I1F A;  1BQE A;  3CW2 A;  2BF4 A;  1KJZ A;  4N3G A;  3QFR A;  1KTV A;  4Y9R A;  1R5B A;  3G6E B;  3I55 B;  3OZW A;  1SKQ A;  5THX A;  1M1K D;  3OW2 B;  4LBW A;  4ZGQ B;  3AVY A;  1W2B B;  4M2L A;  3B82 A;  4LBV A;  1N0V C;  4RJL A;  4B4D A;  4AC9 A;  3V76 A;  4YHB A;  1KK0 A;  2BGI A;  2B7B A;  1BX0 A;  1AMO A;  1QGZ A;  2D74 A;  4TN1 A;  1GR1 A;  4ZCI A;  1YJ9 B;  2DET A;  3U2Q A;  2BMW A;  3CB4 A;  3CRZ A;  3JQR A;  3LO8 A;  4NCN A;  1N0U A;  1QUE A;  1GVH A;  3W5V A;  4PGO A;  2RC5 A;  3CC7 B;  1GO2 A;  1TTT A;  4ACA A;  1S72 B;  4DQK A;  1D1N A;  1QG0 A;  2RC6 A;  1BJK A;  3W5H A;  3FJO A;  3G71 B;  4YAL A;  4M4S A;  4TMV A;  1S0U A;  1R5O A;  4YAW A;  1EXM A;  5GV7 A;  4M1K A;  4G1B A;  3B8H A;  4P6V F;  4M0L A;  4AF7 A;  2OTJ B;  1U2R A;  2E1R A;  4BPR A;  3ES9 A;  1JJ2 B;  3AGP A;  1ZM4 A;  1QGA A;  2B7C A;  1CQX A;  2VNI A;  1XE1 A;  4B3X A;  3WBJ A;  2VZL A;  1G7R A;  4J0Q A;  4YAO A;  2XNJ A;  1QFZ A;  3CPW B;  2BGJ A;  1QH0 A;  1NJI D;  3AVT A;  1W87 A;  3AGQ A;  5GV8 A;  3AVV A;  4ZV4 A;  3MMP A;  5JBQ A;  2DCU A;  1KK1 A;  1F60 A;  4MYU A;  2YWE A;  3ZZ0 A;  3CCJ B;  1K73 D;  4Y9U A;  3WBK A;  1AIP A;  3AVW A;  1Q7Y D;  1FDR A;  3W2F A;  1D8T A;  1IJF A;  3CME B;  4B44 A;  1VQK B;  1TLL A;  2BM0 A;  3CC4 B;  3QFS A;  3VNU A;  1FRQ A;  3CCM B;  1EP2 B;  1QFJ A;  5KSW B;  1TUI A;  2OK7 A;  1HA3 A;  1YIT B;  1I7P A;  1H85 A;  1DAR A;  5FA6 A;  5H59 A;  2EFG A;  1K8A D;  1YJN B;  1KK2 A;  2YWH A;  1OB5 A;  2PLF A;  1F20 A;  1J9Z A;  2J7K A;  2R6H A;  2QTL A;  1XB2 A;  4DQL A;  2VNK A;  4ZCL A;  1OB2 A;  3W2H A;  2QEX B;  4TMZ A;  1BX1 A;  1EFU A;  2GPJ A;  4TMW A;  3VO1 A;  1EP1 B;  3CD6 B;  4RD1 A;  4FWT A;  2QA4 B;  2PMD A;  1DG1 G;  4Q7J B;  5HXB A;  1CNF A;  1YIJ B;  4AF6 A;  3VNV A;  4H9G A;  4FK8 A;  1CNE A;  3CC2 B;  2CRV A;  3CXC B;  1WDT A;  3FPK A;  4U9U A;  2DER A;  3J81 k;  1VQP B;  1KQS B;  1Q81 D;  1FRN A;  1E64 A;  1ZM3 A;  4RD6 A;  3WY9 A;  1G7C A;  1H42 A;  3WNB A;  3CMA B;  4B47 A;  5DSZ A;  3P26 A;  2AHO A;  3PEN A;  1OGJ A;  4PC3 A;  3W2E A;  3WND A;  1E63 A;  2DY1 A;  4NBS A;  1FNM A;  2YWG A;  4TMT A;  4PC1 A;  3QSY A;  1KC8 D;  4ACB A;  3CCQ B;  2XEX A;  3QFT A;  4B43 A;  1N8R D;  2XNC A;  5TY0 A;  1EFC A;  4MYT A;  3CCV B;  5TR9 A;  2PIA A;  4LBZ A;  1VQ6 B;  1VQ5 B;  4RD4 A;  2OK8 A; 
#chains in the Genus database with same CATH topology
 2BM1 A;  3E20 A;  2BVN A;  2JDI A;  1HZE A;  3ZUG A;  2XND A;  2EIX A;  5IK2 A;  4FN5 A;  1QX4 A;  2DYI A;  4PAA A;  4PC6 A;  1GAQ A;  3H94 A;  2WPD A;  1Q86 D;  3FPP A;  2QDX A;  3ASS A;  1ZUN B;  2VNH A;  4X07 A;  4YAF A;  3ZZT A;  5H5J A;  2VBU A;  1Q82 D;  2I1L A;  3AVX A;  1FX0 A;  2V31 A;  3JQQ A;  3ZC3 A;  4QFM A;  4P9S A;  4R71 A;  1W0K A;  3JQP A;  3W2G A;  1VQ7 B;  1E79 A;  2HDN B;  1YI2 B;  1UD6 A;  3SJP A;  4II3 A;  4RDJ A;  2VYQ A;  2X0K A;  3OOC A;  4Z4T A;  2QGG A;  2WJY A;  3SJZ A;  4PC7 A;  2JIZ A;  2CBX A;  2ZIT A;  4UZF A;  1I8D A;  3CMM A;  4XL9 A;  2NPF A;  3OJX A;  2C77 A;  1M90 D;  4HIZ A;  1K9M D;  5IYR A;  4XON A;  3B78 A;  2V7V A;  3VO2 A;  1QVF B;  2QN6 A;  1YHQ B;  2V7W A;  3WXM A;  2VNJ A;  1VQL B;  3R6K A;  1VQ8 B;  1UD5 A;  2B5O A;  2BN4 A;  1KK3 A;  2C2W A;  3LVB A;  4RCY A;  4WQM A;  4F7D A;  2DEU A;  4HE5 A;  2M5S A;  1YX2 A;  5DN6 A;  2C78 A;  4XNF A;  3GIR A;  3MHP A;  1JA0 A;  3OZU A;  4RD0 A;  4XM3 A;  5KW9 A;  3A35 A;  3CCL B;  2R9V A;  5EMN A;  3SLD A;  1FNB A;  1GJR A;  4G1V A;  1W0J A;  3HAG A;  3KEW A;  4XLF A;  5B6I A;  3W2I A;  3BCF A;  3PA1 A;  4RDK A;  1V5V A;  5FNZ A;  5L46 A;  1ELO A;  4RD2 A;  4IW3 B;  1QVG B;  3GSI A;  2BSA A;  1BLI A;  1GAW A;  4L8J A;  4OOV A;  1XFO A;  3ZPN A;  1V0F A;  1A8P A;  1IJE A;  1JA1 A;  3ASP A;  3VR6 A;  4K1X A;  1SKY B;  1H8H A;  2OTL B;  4RD3 A;  3MCA A;  1YJW B;  4N3N A;  1QGY A;  2X6Y A;  1FND A;  5E6T A;  3G4S B;  2ZL6 A;  2ZZF A;  5F4J A;  4C0S A;  4HE6 A;  1W34 A;  1VLY A;  1PJ5 A;  3QFC A;  1G7T A;  4CQJ A;  3U6K A;  4ZGN B;  1EFT A;  1QUF A;  1W9X A;  2QMU A;  1B2R A;  2DIE A;  4TT3 A;  2FX3 A;  4WZT A;  4X7C A;  3T51 B;  1VQ4 B;  1VQ9 B;  2GK6 A;  3OEH A;  3I56 B;  5CDF A;  4M53 A;  3PVD A;  4Y7C A;  5J3O A;  1IB0 A;  3WQZ A;  1UMK A;  5TV2 A;  1TVC A;  1JNY A;  1ZM2 A;  3VMF A;  4XMY A;  4PC2 A;  3WNC A;  5A8A A;  3CCS B;  1KD1 D;  2X6W A;  2HLD A;  1SM4 A;  2ZBV A;  3BCD A;  4YEJ A;  2W6J A;  4EH1 A;  3LNN A;  1N05 A;  3SKB A;  1KMH A;  2YWF A;  4KKT A;  1B23 P;  4G5G A;  3E1Y E;  4TMX A;  3OJW A;  3OZV A;  1WOR A;  2Q6O A;  1ZM9 A;  1DDG A;  1E62 A;  4LBY A;  4Z4Z A;  3ONY A;  2OBS A;  2OBR A;  2WSS A;  3P27 A;  1VQO B;  5IYW A;  2GJR A;  1FNC A;  2XZP A;  5FL7 A;  2WZP P;  1WSV A;  5F4O A;  4XOR A;  3WYA A;  1T5E A;  1WOS A;  1NB9 A;  3Q3A A;  2WZN A;  1OGI A;  2XOK A;  1EP3 B;  1W35 A;  4QHY A;  3CCR B;  2JN9 A;  3LQ6 A;  2DOG A;  1BPL A;  1E3Z A;  2GQF A;  2CK3 A;  2CND A;  5FO0 A;  4B3F X;  4P12 A;  3A8K A;  5LMZ A;  4RCZ A;  3ZZU A;  2X3U A;  3A8J A;  4B48 A;  2E1B A;  3AVU A;  4ZCM A;  1D2E A;  3GVK A;  1KRH A;  4P25 A;  1G7S A;  3BC9 A;  4UAJ A;  5BSY A;  1NDH A;  2C4U A;  4YAU A;  2BPO A;  3OPO A;  3V7A A;  1QFY A;  4DNR B;  1EWY A;  1DDI A;  3U6B A;  2WJV A;  3BQJ A;  1T6X A;  2HMA A;  1JB9 A;  1VQM B;  2QTZ A;  3CCU B;  3ZBU A;  1WOO A;  3BH4 A;  2VBT A;  4OOS A;  1UD8 A;  4XOT A;  4Z4W A;  4P3Y A;  3CCE B;  5AN9 A;  4C43 A;  4LC0 A;  4P2N A;  4X05 A;  1VQN B;  3W5U A;  3ZBT A;  2BV3 A;  2HCJ B;  3QE2 A;  1R5N A;  3I1F A;  1BQE A;  1IHM A;  4YXW A;  2V4D A;  3CW2 A;  2BF4 A;  1KJZ A;  2V7Q A;  3QFR A;  4N3G A;  1KTV A;  4Y9R A;  1R5B A;  1UD4 A;  3G6E B;  5J35 A;  3PUM A;  1YLO A;  3OZW A;  2Q6L A;  3T56 B;  1SKQ A;  1XQB A;  3I55 B;  5THX A;  1M1K D;  3OW2 B;  5HZA A;  2V7T A;  1H8E A;  4OPS A;  2GJP A;  4LBW A;  4ZGQ B;  1W2B B;  3AVY A;  5HKK A;  4M2L A;  3B82 A;  4LBV A;  1N0V C;  1UD2 A;  4RJL A;  4B4D A;  4AC9 A;  3V76 A;  2GJK A;  1KK0 A;  1HVX A;  4YHB A;  2BGI A;  2B7B A;  3R6J A;  5HZB A;  1BX0 A;  2ZL5 A;  2D3N A;  1E3X A;  3GVL A;  1AMO A;  4WWV A;  3ISX A;  1QGZ A;  2D74 A;  4TN1 A;  1GR1 A;  4ZCI A;  1YJ9 B;  2DET A;  5A88 A;  2BMW A;  3CRZ A;  3CB4 A;  3JQR A;  3LO8 A;  3U2Q A;  4NCN A;  3FKS A;  2Q6I A;  3A1P A;  1N0U A;  1QUE A;  1GVH A;  3W5V A;  4ASU A;  4PGO A;  2RC5 A;  3CC7 B;  4WZE A;  4YEL A;  1GO2 A;  3OKX A;  1TTT A;  4ACA A;  1S72 B;  4DQK A;  1D1N A;  4P1V A;  1QG0 A;  1PJ6 A;  2RC6 A;  4Z4Y A;  4KKU A;  1BJK A;  3W5H A;  5KNL A;  2WR8 A;  1NRK A;  1NBM A;  3FJO A;  4TKO B;  3G71 B;  3ONU A;  4TSF A;  4RLZ A;  4YAL A;  1I18 A;  4RD4 A;  5IYP A;  4M4S A;  4KKS A;  4TMV A;  1S0U A;  1R5O A;  3CES A;  1P4M A;  4YAW A;  1EXM A;  1S4M A;  4QVJ A;  1Y0R A;  5GV7 A;  1EFR A;  4G1B A;  4M1K A;  2X6X A;  2P3M A;  2Z6B D;  1E1R A;  3B8H A;  3NE5 B;  4B3G A;  4P6V F;  3A3B A;  4M0L A;  4XR6 A;  4AF7 A;  1COW A;  2OTJ B;  1U2R A;  2F1L A;  2E1R A;  4OOX A;  3ES9 A;  4BPR A;  3AGP A;  1JJ2 B;  2VJI A;  4II2 A;  1ZM4 A;  1V0E A;  1QGA A;  2B7C A;  1CQX A;  2VNI A;  1XE1 A;  4XKW A;  2CW5 A;  4WZK A;  4XQF A;  4B3X A;  3WBJ A;  1WOP A;  2VZL A;  4P6Y A;  1G7R A;  4J0Q A;  4YAO A;  4RPB A;  2XNJ A;  1QFZ A;  2FVG A;  2V7U A;  3CPW B;  3Q6R A;  2BGJ A;  5IYQ A;  1QH0 A;  1NJI D;  3AVT A;  3ASQ A;  1W87 A;  2VJJ A;  3AGQ A;  3BY2 A;  2PE3 A;  5GV8 A;  3AVV A;  4ZV4 A;  3MMP A;  1VLO A;  4XKV A;  1N06 A;  1N08 A;  2OBT A;  2D9R A;  3Q38 A;  3CP8 A;  5JBQ A;  2DCU A;  1KK1 A;  1F60 A;  4MYU A;  2YWE A;  2C5B A;  3ZZ0 A;  4NNJ A;  3T53 B;  3CCJ B;  2ZL7 A;  3G05 A;  2XZL A;  4XN0 A;  1K73 D;  1WTH D;  4Y9U A;  3WBK A;  1AIP A;  5FIU A;  3AVW A;  1Q7Y D;  1FDR A;  5F4M A;  3W2F A;  2C5H A;  1D8T A;  4QV2 A;  4X7F A;  1IJF A;  3CME B;  4B44 A;  1VQK B;  2ZZQ A;  1WSR A;  1TLL A;  1VJS A;  2X53 S;  2BM0 A;  3CC4 B;  3QFS A;  2GRE A;  4OPO A;  3VNU A;  4P3I A;  3GQB A;  1FRQ A;  5DS0 A;  3CCM B;  1EP2 B;  4X8I A;  1QFJ A;  5KSW B;  1RQR A;  1TUI A;  2D3L A;  1NB0 A;  2OK7 A;  1HA3 A;  2X85 A;  1WU8 A;  1YIT B;  2VBS A;  3ZIA A;  1I7P A;  1H85 A;  1DAR A;  3RY8 A;  2ZXI A;  3OW7 A;  5FA6 A;  4DK1 A;  2EFG A;  5H59 A;  3BNW A;  3PA2 A;  3CPX A;  1YJN B;  1K8A D;  2C4T A;  2Q6K A;  1KK2 A;  2ZBU A;  2YWH A;  4RM0 A;  2PLF A;  1F20 A;  1Q9S A;  1OB5 A;  1J9Z A;  2J7K A;  2R6H A;  4RPD A;  2QTL A;  1XB2 A;  4DQL A;  2LZJ A;  2VNK A;  4ZCL A;  1OB2 A;  4FXU A;  3W2H A;  2QE7 A;  2QEX B;  4G7W A;  4TMZ A;  4XLA A;  1BX1 A;  2CF4 A;  4G7X A;  1EFU A;  2GPJ A;  5BSX A;  4WZL A;  1MAB A;  2CC2 A;  2V7X A;  2JJ1 A;  4TMW A;  5IYN A;  3VO1 A;  1VHE A;  1EP1 B;  2OYN A;  2W6I A;  3GVJ A;  4X0C A;  3CD6 B;  4RD1 A;  4FWT A;  2QA4 B;  3OFN A;  2KVO A;  2PMD A;  1DG1 G;  4P22 A;  3DDY A;  4Q7J B;  5HXB A;  1OB0 A;  1CNF A;  1YIJ B;  4XN3 A;  4AF6 A;  3VNV A;  4Z4U A;  4XLC A;  4Z1M A;  5A89 A;  4H9G A;  4XD7 A;  3A3G A;  1CNE A;  4FK8 A;  3CC2 B;  2CRV A;  3SEJ A;  4UZE A;  4UZU A;  2ZZE A;  3CXC B;  4PAB A;  1K28 D;  3KL9 A;  1WDT A;  3FPK A;  3JU4 A;  4OPV A;  3ASR A;  4U9U A;  2XZO A;  2DER A;  3J81 k;  1VF7 A;  1VQP B;  2NV4 A;  1KQS B;  1Q81 D;  1FRN A;  2VBV A;  4E0F A;  2ZZG A;  4XLH A;  2ZTN A;  2XGJ A;  1OHH A;  2GK7 A;  1E64 A;  3CTA A;  1E43 A;  1ZM3 A;  4RD6 A;  4X7D A;  3WY9 A;  4X06 A;  4P26 A;  1VHO A;  1MRZ A;  3Q39 A;  1G7C A;  4OP7 A;  1H42 A;  3OEE A;  3SLN A;  3WNB A;  3CMA B;  1T6Z A;  3PUN A;  4B47 A;  2F1M A;  4AVZ A;  5DSZ A;  2WYR A;  3P26 A;  2AHO A;  2ZXH A;  4XOP A;  4JMQ A;  4Z4V A;  3PEN A;  3H9N A;  1OGJ A;  3OE7 A;  4XLE A;  1BMF A;  3OP1 A;  4PC3 A;  4Z4S A;  1PJ7 A;  3W2E A;  3WND A;  1E63 A;  2DY1 A;  4NBS A;  4GQN A;  1FNM A;  5FO1 A;  4DNT B;  5TRD A;  2YWG A;  4TMT A;  4PC1 A;  4ROX A;  1N07 A;  3QSY A;  1KC8 D;  4ACB A;  3CCQ B;  2XEX A;  1UD3 A;  4Z4R A;  1WP6 A;  3QFT A;  4B43 A;  1N8R D;  2XNC A;  2F43 A;  4DK0 A;  1KZL A;  5TY0 A;  1EFC A;  3OAA A;  2JJ2 A;  4MYT A;  1E1Q A;  3D26 A;  3A8I A;  1T6Y A;  3LQE A;  4X7E A;  3AST A;  3CCV B;  5TR9 A;  4QVA A;  1PKV A;  2PIA A;  4LBZ A;  4QUZ A;  2F4N A;  3CP2 A;  1RQP A;  1Y0Y A;  4RDL A;  3Q6Q A;  1WPC A;  2X8K A;  2ZTG A;  1VQ6 B;  1VQ5 B;  4G6I A;  3BY1 A;  2OK8 A; 
#chains in the Genus database with same CATH homology
 2BM1 A;  3E20 A;  2BVN A;  2EIX A;  4FN5 A;  1QX4 A;  4PC6 A;  1GAQ A;  1Q86 D;  2QDX A;  1ZUN B;  2VNH A;  4YAF A;  3ZZT A;  5H5J A;  1Q82 D;  3AVX A;  3JQQ A;  3ZC3 A;  4QFM A;  4R71 A;  3JQP A;  3W2G A;  1VQ7 B;  2HDN B;  1YI2 B;  2VYQ A;  3SJZ A;  4PC7 A;  2ZIT A;  2NPF A;  3OJX A;  2C77 A;  1M90 D;  1K9M D;  3B78 A;  1QVF B;  3VO2 A;  2QN6 A;  1YHQ B;  3WXM A;  2VNJ A;  1VQL B;  1VQ8 B;  2B5O A;  2BN4 A;  1KK3 A;  3LVB A;  4RCY A;  4WQM A;  4F7D A;  2DEU A;  4HE5 A;  2C78 A;  3MHP A;  1JA0 A;  3OZU A;  4RD0 A;  3CCL B;  5EMN A;  1FNB A;  1GJR A;  4G1V A;  3W2I A;  1ELO A;  4RD2 A;  4IW3 B;  1QVG B;  2BSA A;  1GAW A;  1A8P A;  1IJE A;  1JA1 A;  4K1X A;  2OTL B;  4RD3 A;  3MCA A;  1YJW B;  4N3N A;  1QGY A;  1FND A;  3G4S B;  4C0S A;  4HE6 A;  1W34 A;  3QFC A;  1G7T A;  3U6K A;  4ZGN B;  1EFT A;  1QUF A;  2QMU A;  1B2R A;  2FX3 A;  1VQ4 B;  1VQ9 B;  3I56 B;  4M53 A;  4Y7C A;  1IB0 A;  1UMK A;  5TV2 A;  1TVC A;  1JNY A;  1ZM2 A;  3VMF A;  4PC2 A;  3WNC A;  3CCS B;  1KD1 D;  1SM4 A;  4EH1 A;  2YWF A;  1B23 P;  4G5G A;  3E1Y E;  4TMX A;  3OJW A;  3OZV A;  1ZM9 A;  1DDG A;  1E62 A;  4LBY A;  3P27 A;  1VQO B;  1FNC A;  3WYA A;  1OGI A;  4QHY A;  1EP3 B;  1W35 A;  3CCR B;  2GQF A;  2CND A;  4RCZ A;  3ZZU A;  2X3U A;  4B48 A;  3AVU A;  4ZCM A;  1D2E A;  1KRH A;  1G7S A;  4UAJ A;  1NDH A;  4YAU A;  2BPO A;  1QFY A;  1EWY A;  1DDI A;  3U6B A;  2HMA A;  1JB9 A;  1VQM B;  2QTZ A;  3CCU B;  3ZBU A;  3CCE B;  4P3Y A;  5AN9 A;  4C43 A;  4LC0 A;  1VQN B;  3W5U A;  3ZBT A;  2BV3 A;  2HCJ B;  3QE2 A;  1R5N A;  3I1F A;  1BQE A;  3CW2 A;  2BF4 A;  1KJZ A;  4N3G A;  3QFR A;  1KTV A;  4Y9R A;  1R5B A;  3G6E B;  3I55 B;  3OZW A;  1SKQ A;  5THX A;  1M1K D;  3OW2 B;  4LBW A;  4ZGQ B;  3AVY A;  1W2B B;  4M2L A;  3B82 A;  4LBV A;  1N0V C;  4RJL A;  4B4D A;  4AC9 A;  3V76 A;  4YHB A;  1KK0 A;  2BGI A;  2B7B A;  1BX0 A;  1AMO A;  1QGZ A;  2D74 A;  4TN1 A;  1GR1 A;  4ZCI A;  1YJ9 B;  2DET A;  3U2Q A;  2BMW A;  3CB4 A;  3CRZ A;  3JQR A;  3LO8 A;  4NCN A;  1N0U A;  1QUE A;  1GVH A;  3W5V A;  4PGO A;  2RC5 A;  3CC7 B;  1GO2 A;  1TTT A;  4ACA A;  1S72 B;  4DQK A;  1D1N A;  1QG0 A;  2RC6 A;  1BJK A;  3W5H A;  3FJO A;  3G71 B;  4YAL A;  4M4S A;  4TMV A;  1S0U A;  1R5O A;  4YAW A;  1EXM A;  5GV7 A;  4M1K A;  4G1B A;  3B8H A;  4P6V F;  4M0L A;  4AF7 A;  2OTJ B;  1U2R A;  2E1R A;  4BPR A;  3ES9 A;  1JJ2 B;  3AGP A;  1ZM4 A;  1QGA A;  2B7C A;  1CQX A;  2VNI A;  1XE1 A;  4B3X A;  3WBJ A;  2VZL A;  1G7R A;  4J0Q A;  4YAO A;  2XNJ A;  1QFZ A;  3CPW B;  2BGJ A;  1QH0 A;  1NJI D;  3AVT A;  1W87 A;  3AGQ A;  5GV8 A;  3AVV A;  4ZV4 A;  3MMP A;  5JBQ A;  2DCU A;  1KK1 A;  1F60 A;  4MYU A;  2YWE A;  3ZZ0 A;  3CCJ B;  1K73 D;  4Y9U A;  3WBK A;  1AIP A;  3AVW A;  1Q7Y D;  1FDR A;  3W2F A;  1D8T A;  1IJF A;  3CME B;  4B44 A;  1VQK B;  1TLL A;  2BM0 A;  3CC4 B;  3QFS A;  3VNU A;  1FRQ A;  3CCM B;  1EP2 B;  1QFJ A;  5KSW B;  1TUI A;  2OK7 A;  1HA3 A;  1YIT B;  1I7P A;  1H85 A;  1DAR A;  5FA6 A;  5H59 A;  2EFG A;  1K8A D;  1YJN B;  1KK2 A;  2YWH A;  1OB5 A;  2PLF A;  1F20 A;  1J9Z A;  2J7K A;  2R6H A;  2QTL A;  1XB2 A;  4DQL A;  2VNK A;  4ZCL A;  1OB2 A;  3W2H A;  2QEX B;  4TMZ A;  1BX1 A;  1EFU A;  2GPJ A;  4TMW A;  3VO1 A;  1EP1 B;  3CD6 B;  4RD1 A;  4FWT A;  2QA4 B;  2PMD A;  1DG1 G;  4Q7J B;  5HXB A;  1CNF A;  1YIJ B;  4AF6 A;  3VNV A;  4H9G A;  4FK8 A;  1CNE A;  3CC2 B;  2CRV A;  3CXC B;  1WDT A;  3FPK A;  4U9U A;  2DER A;  3J81 k;  1VQP B;  1KQS B;  1Q81 D;  1FRN A;  1E64 A;  1ZM3 A;  4RD6 A;  3WY9 A;  1G7C A;  1H42 A;  3WNB A;  3CMA B;  4B47 A;  5DSZ A;  3P26 A;  2AHO A;  3PEN A;  1OGJ A;  4PC3 A;  3W2E A;  3WND A;  1E63 A;  2DY1 A;  4NBS A;  1FNM A;  2YWG A;  4TMT A;  4PC1 A;  3QSY A;  1KC8 D;  4ACB A;  3CCQ B;  2XEX A;  3QFT A;  4B43 A;  1N8R D;  2XNC A;  5TY0 A;  1EFC A;  4MYT A;  3CCV B;  5TR9 A;  2PIA A;  4LBZ A;  1VQ6 B;  1VQ5 B;  4RD4 A;  2OK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...