3E1YE

Crystal structure of human erf1/erf3 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
195
structure length
195
Chain Sequence
IRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 27
structure length 195
sequence length 195
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
E PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE01
2C78A 1N0UA 2CRVA 2DETA 2BM0A 3W2FA 3CCRB 1KRHA 1VQMB 1EFUA 1W2BB 1VQKB 4EH1A 3AGQA 1FRNA 4Y9RA 1N0VC 1QGYA 4PC3A 4F7DA 5GV7A 4RCYA 2VYQA 1EFTA 1Q86D 3AVXA 3V76A 1UMKA 4B44A 4YAFA 1VQ4B 3W5VA 1EWYA 4P3YA 2PMDA 4TMWA 1GAWA 1IJEA 1GAQA 4U9UA 1AMOA 1VQ7B 1TLLA 4ACBA 2BSAA 2XNJA 1KC8D 1K8AD 2BMWA 1KTVA 1QUEA 3QFTA 4NCNA 3B82A 1JA1A 3FJOA 3WNCA 2YWEA 3G4SB 1QVGB 4TMXA 2QEXB 3ZZTA 1GJRA 1Q7YD 3VO1A 2BVNA 2FX3A 2E1RA 4UAJA 4RJLA 1EP3B 3CCVB 1KQSB 4R71A 1FNMA 4RD6A 4YAWA 3WYAA 2HMAA 2VNJA 5AN9A 4B3XA 1YHQB 5EMNA 1E63A 1S72B 1JJ2B 3B8HA 3MMPA 4DQLA 3QFSA 1ZUNB 3LO8A 1D8TA 1VQ9B 3ES9A 2RC5A 1FNBA 4B4DA 2EFGA 1VQ6B 3VNVA 1CNFA 3JQPA 3J81k 4G5GA 1VQLB 1QUFA 5THXA 4PC2A 4YAUA 1GO2A 5H59A 1XB2A 1QG0A 3MCAA 3ZBUA 5TY0A 3WXMA 1AIPA 1QFZA 4B47A 2BN4A 1WDTA 3ZZUA 4RD4A 1GVHA 1OB5A 2CNDA 3AGPA 3QFCA 4PGOA 2OK8A 4YAOA 2VNHA 3FPKA 3E20A 1YI2B 1G7CA 1F20A 4ZCIA 4YHBA 2DCUA 5DSZA 3VMFA 4ACAA 1TVCA 1B2RA 4WQMA 1EP1B 4PC6A 5FA6A 3P27A 1DDGA 4J0QA 1K9MD 1S0UA 4YALA 3JQQA 4M53A 3CC7B 3CC2B 1OGJA 3I1FA 2BM1A 1CNEA 2YWGA 3P26A 1B23P 2QTLA 1I7PA 1YJ9B 3B78A 1J9ZA 3W2GA 2EIXA 1TUIA 3U6BA 2XEXA 3U6KA 4M1KA 1ZM2A 4ZGNB 1YIJB 4DQKA 4RD3A 4FK8A 3W2IA 1W34A 1TTTA 1FNDA 4LBWA 4FN5A 2B5OA 3W2EA 2OTJB 3OJWA 3CCEB 4M4SA 4NBSA 1NJID 1G7RA 5GV8A 1BQEA 2GPJA 4K1XA 1IJFA 1BX0A 1VQOB 2DY1A 1FDRA 3CC4B 2YWHA 1FNCA 1KK0A 3CCMB 4IW3B 3ZBTA 1H85A 2PIAA 1KK2A 3VNUA 1EXMA 1D2EA 2BF4A 1Q82D 3OZUA 3AVWA 1JNYA 2QA4B 4N3GA 1SKQA 3MHPA 1GR1A 1U2RA 2BGIA 1JB9A 3AVYA 1HA3A 4TMZA 4TN1A 3CXCB 3WY9A 4HE6A 2YWFA 4ZCLA 1VQNB 1ZM9A 1W35A 2BPOA 3CRZA 3QSYA 2RC6A 1VQ8B 1YITB 4RCZA 3CB4A 3SJZA 1Q81D 1G7TA 1KJZA 2X3UA 4RD1A 3OZWA 3CCSB 1G7SA 4HE5A 1DARA 1A8PA 1ELOA 1E62A 4C0SA 1QFJA 1VQ5B 5TR9A 2NPFA 3I55B 1QVFB 1EFCA 3CW2A 2VNKA 4ZCMA 1QGZA 2QMUA 3G71B 3CD6B 4QFMA 3WBKA 3CMAB 4M2LA 3G6EB 1OGIA 1R5NA 4AC9A 1QGAA 1DG1G 4PC7A 1BJKA 2VNIA 3OW2B 1F60A 2B7CA 3OJXA 1FRQA 4Y7CA 4P6VF 4AF6A 5TV2A 1VQPB 3OZVA 1SM4A 2QDXA 4G1VA 4Y9UA 1K73D 1JA0A 4LC0A 4Q7JB 1M1KD 3WNBA 2BGJA 1CQXA 2OTLB 2QN6A 3ZC3A 4MYTA 4N3NA 4LBYA 1EP2B 3CCQB 1KD1D 1XE1A 1BX1A 2VZLA 1NDHA 2GQFA 2OK7A 2C77A 3U2QA 3W5UA 3W5HA 5HXBA 1ZM4A 2DERA 2DEUA 1R5OA 1KK1A 5KSWB 1YJNB 3CCJB 2R6HA 3QE2A 1QH0A 2PLFA 1N8RD 1E64A 4TMVA 4QHYA 1OB2A 1QFYA 4LBZA 4PC1A 4AF7A 1M90D 3ZZ0A 3VO2A 3CMEB 1ZM3A 2B7BA 2AHOA 2ZITA 3WNDA 4C43A 4RD2A 4B43A 3I56B 4B48A 4MYUA 4M0LA 3QFRA 2HCJB 3AVUA 1W87A 4TMTA 3W2HA 3AVVA 2J7KA 2BV3A 4ZV4A 3AVTA 2D74A 1YJWB 4LBVA 1IB0A 4BPRA 3CCUB 4G1BA 5H5JA 4RD0A 3LVBA 3CPWB 3JQRA 1KK3A 1R5BA 3PENA 2XNCA 5JBQA 4ZGQB 1H42A 1D1NA 1QX4A 3CCLB 4FWTA 1DDIA 3WBJA 2HDNB 4H9GA 3E1YE 2QTZA
chains in the Genus database with same CATH superfamily
2C78A 3HAGA 1N0UA 2CRVA 2DETA 5FO0A 2BM0A 3W2FA 4WZEA 3CCRB 1KRHA 1VQMB 3Q6QA 5J35A 1EFUA 4DK1A 1W2BB 1VQKB 4EH1A 3AGQA 3GIRA 1FRNA 4P2NA 5FO1A 1WU8A 2D3LA 4Y9RA 1N0VC 5BSYA 2ZXHA 1QGYA 3LQ6A 3DDYA 4PC3A 4F7DA 5GV7A 4RCYA 1HZEA 2VYQA 2DYIA 1WTHD 4TSFA 4Z4UA 1EFTA 2OBSA 4XOTA 1Q86D 2Q6IA 3AVXA 1KZLA 3V76A 1UMKA 4B44A 4YAFA 4CQJA 3OPOA 1BMFA 1VQ4B 3W5VA 1EWYA 2V7UA 3Q39A 4P3YA 1NB0A 2PMDA 4XQFA 4TMWA 1N07A 1GAWA 1IJEA 1GAQA 4U9UA 1AMOA 1VQ7B 1TLLA 5HZAA 4ACBA 2BSAA 2X0KA 1RQPA 2XNJA 1KC8D 3KL9A 2BMWA 1KTVA 1QUEA 4OPVA 3QFTA 4NCNA 1K8AD 4P22A 2F1MA 2WZNA 2V7TA 3B82A 4X0CA 1JA1A 3FJOA 3WNCA 3OW7A 4X7FA 2C2WA 2YWEA 4OOSA 3G4SB 1QVGB 4YELA 4TMXA 2QEXB 2W6JA 1GJRA 1N05A 1N08A 1Y0RA 3BNWA 3ZZTA 3VO1A 2BVNA 2FX3A 2CBXA 2E1RA 4UAJA 1KMHA 4RJLA 2X6XA 4DNRB 1EP3B 3CCVB 1KQSB 1WOOA 4R71A 1FNMA 1WP6A 1OHHA 4RD6A 4YAWA 3WYAA 2HMAA 2VNJA 5AN9A 4B3XA 3A3BA 2CW5A 1YHQB 2E1BA 4L8JA 2ZBVA 5EMNA 1E63A 4DK0A 5IYWA 1S72B 5A88A 4Z4SA 1JJ2B 3B8HA 3MMPA 4DQLA 2C4TA 3QFSA 2GK6A 1ZUNB 5FNZA 4NNJA 3ASPA 3GVKA 3LO8A 2ZL7A 4OOXA 2GJKA 4P6YA 1D8TA 1YLOA 1VQ9B 2WJVA 3ES9A 4UZFA 2RC5A 3A8IA 3ONYA 1FNBA 2OBRA 4B4DA 2EFGA 1PJ7A 1VQ6B 3VNVA 1CNFA 4ROXA 3JQPA 3J81k 4G5GA 1VQLB 1QUFA 2V7XA 5THXA 2XOKA 2XNDA 4Z4TA 4PC2A 3BCFA 4YAUA 5B6IA 3V7AA 1GO2A 5H59A 1XB2A 1QG0A 3MCAA 4HIZA 3ZBUA 5TY0A 4XLAA 3PA2A 2CK3A 3WXMA 1AIPA 1RQRA 3D26A 1QFZA 5HZBA 2ZXIA 4XMYA 4B47A 2BN4A 2F43A 1WDTA 2ZL5A 4RD4A 1WPCA 3ZZUA 1GVHA 1OB5A 1E79A 5LMZA 2XZOA 2CF4A 3FPPA 2CNDA 4XONA 3AGPA 3QFCA 2Z6BD 3BC9A 4PGOA 1T6YA 4OPSA 5E6TA 4XLEA 2OK8A 2V7VA 4YAOA 2VNHA 3FPKA 3E20A 1YI2B 4Z1MA 3T53B 2ZZGA 2X8KA 2X6WA 1G7CA 1UD8A 1F20A 4ZCIA 1OB0A 4Z4RA 4YHBA 5KW9A 2DCUA 1UD5A 1P4MA 2ZBUA 2C5HA 5DSZA 3VMFA 4XORA 4ACAA 1Q9SA 1TVCA 2F1LA 3PA1A 4QV2A 1B2RA 2R9VA 5KNLA 5TRDA 4WQMA 1EP1B 5IK2A 3A8JA 1W0JA 4KKUA 4PC6A 5FA6A 1E43A 4XL9A 3P27A 2QGGA 1DDGA 4J0QA 1K9MD 1S0UA 2X85A 3WQZA 4YALA 4G7XA 5FL7A 3JQQA 1N06A 3BCDA 4M53A 3BY1A 2VBVA 3CC7B 3CC2B 1OGJA 3I1FA 2BM1A 1CNEA 2YWGA 4OPOA 4XN0A 5J3OA 1EFRA 2V7QA 3P26A 1B23P 2QTLA 1VLOA 2V4DA 2QE7A 3CPXA 1WOSA 4RPDA 1I7PA 1YJ9B 5HKKA 1PJ6A 3B78A 3CESA 5DN6A 1J9ZA 3W2GA 1NBMA 5DS0A 1VHOA 1T6XA 1UD6A 2EIXA 2GREA 2VBUA 2WJYA 1TUIA 4RDJA 4XR6A 2OYNA 2D9RA 4XOPA 4X7DA 2XEXA 3U6BA 4B3GA 2F4NA 3U6KA 4M1KA 1ZM2A 4ZGNB 4X07A 1YIJB 4DQKA 4RD3A 1YX2A 4FK8A 3W2IA 4DNTB 1W34A 1TTTA 1FNDA 4LBWA 1E3ZA 4KKTA 2ZTNA 4RLZA 4FN5A 2B5OA 4XN3A 3W2EA 2OTJB 3H94A 3OJWA 4FXUA 3CCEB 4M4SA 4NBSA 1NJID 3OEEA 1G7RA 2X53S 5GV8A 1BQEA 4OOVA 2GPJA 4TT3A 5F4MA 4P12A 4UZEA 4K1XA 1IJFA 1BX0A 1VQOB 3LNNA 4JMQA 2VBSA 3Q6RA 2DY1A 3OP1A 4WZKA 3RY8A 1FDRA 3CC4B 2YWHA 3A3GA 1FNCA 1KK0A 3CCMB 1Q7YD 3SKBA 2W6IA 4IW3B 3ZBTA 1H85A 2PIAA 1KK2A 3ASQA 3VNUA 2WSSA 1W0KA 2JDIA 1EXMA 1D2EA 2LZJA 1SKYB 1NB9A 3ZUGA 2BF4A 4G7WA 3OZUA 5BSXA 1Q82D 3H9NA 3AVWA 1JNYA 2QA4B 4N3GA 1SKQA 2XGJA 3MHPA 1GR1A 3SLNA 5IYNA 3CP2A 1U2RA 2BGIA 2Q6OA 1MRZA 1JB9A 3Q38A 3AVYA 1HA3A 3ZIAA 4TMZA 4TN1A 3CXCB 4XD7A 3WY9A 4HE6A 2YWFA 3BY2A 4ZCLA 2ZZFA 1NRKA 1ZM9A 1VQNB 1W35A 2BPOA 3CRZA 3QSYA 4RM0A 2RC6A 3ONUA 5L46A 1VQ8B 1YITB 5FIUA 3OE7A 4RCZA 1E3XA 3CB4A 4TKOB 4OP7A 4YXWA 4AVZA 3SJZA 2ZTGA 1G7TA 1Q81D 1KJZA 4XKWA 2X3UA 2KVOA 4RD1A 4E0FA 3OZWA 5IYPA 3GVLA 1WOPA 3CCSB 1G7SA 4HE5A 4PABA 3SEJA 3G05A 1DARA 1A8PA 1HVXA 2XZLA 3PVDA 4XLFA 4XLCA 2VJIA 4P1VA 4XNFA 1ELOA 3CP8A 1E62A 3GVJA 1BLIA 1QFJA 4C0SA 2JN9A 5TR9A 2NPFA 1MABA 3I55B 3T56B 3ISXA 1VQ5B 1QVFB 1EFCA 3OEHA 1UD4A 3CW2A 2VNKA 4ZCMA 2PE3A 3A1PA 1QGZA 2QMUA 4G6IA 4RPBA 4UZUA 1IHMA 3G71B 3CD6B 1W9XA 4QFMA 2C4UA 2JJ2A 3WBKA 3CMAB 2WPDA 1UD2A 4M2LA 3G6EB 1V0FA 1OGIA 1R5NA 4AC9A 2Q6KA 1QGAA 3OOCA 4X7EA 1DG1G 4PC7A 5A8AA 1S4MA 1BJKA 2Q6LA 2VNIA 3GQBA 3OFNA 3T51B 3OW2B 1VHEA 1WSRA 2NV4A 3VR6A 1F60A 2B7CA 3OJXA 1FRQA 3CMMA 2ZZQA 4GQNA 4ASUA 4II2A 1PKVA 4P6VF 4Y7CA 2P3MA 4XLHA 4AF6A 5TV2A 1VQPB 2DOGA 3OZVA 1SM4A 3FKSA 2QDXA 4G1VA 2M5SA 2FVGA 4WZLA 4Y9UA 1K73D 4P3IA 3OKXA 3ASSA 1JA0A 4LC0A 2VBTA 3LQEA 4Q7JB 1M1KD 3JU4A 3WNBA 2BGJA 4Z4YA 2WR8A 1CQXA 2C5BA 2OTLB 1H8EA 3PUNA 3SJPA 2QN6A 4RDLA 2CC2A 4X8IA 3ZC3A 4MYTA 4P26A 4N3NA 4P25A 4LBYA 1EP2B 1E1QA 1UD3A 3CCQB 2JIZA 2XZPA 4X06A 1VJSA 2I1LA 4II3A 3R6JA 1KD1D 1XE1A 1BX1A 2VZLA 2GJPA 4B3FX 1NDHA 2GQFA 2OK7A 1I8DA 1XFOA 2C77A 3U2QA 2ZZEA 3BQJA 3W5UA 2WYRA 3W5HA 3GSIA 1ZM4A 1BPLA 5HXBA 2DERA 2DEUA 1R5OA 1KK1A 1WSVA 5KSWB 1YJNB 1PJ5A 4QUZA 5CDFA 3CTAA 3CCJB 5A89A 2R6HA 4WZTA 3QE2A 1QH0A 2PLFA 2HLDA 4RDKA 1FX0A 3KEWA 4YEJA 1N8RD 5IYQA 1E64A 2GK7A 4TMVA 4QHYA 1OB2A 2V7WA 1QFYA 1Y0YA 4LBZA 1I18A 3A8KA 4PC1A 4AF7A 1K28D 1VF7A 2D3NA 4WWVA 1M90D 1T5EA 2OBTA 4XM3A 3ZZ0A 5IYRA 4PAAA 3VO2A 3BH4A 3ASTA 4KKSA 1T6ZA 1WORA 2V31A 3CMEB 1ZM3A 3OAAA 2DIEA 2B7BA 2AHOA 2JJ1A 1E1RA 2ZITA 4X05A 3WNDA 3ZPNA 4Z4VA 2WZPP 4C43A 1V0EA 4QVJA 2X6YA 3R6KA 4RD2A 4B43A 3I56B 3PUMA 4B48A 2GJRA 1H8HA 3A35A 3Q3AA 4MYUA 1COWA 4QVAA 2VJJA 4M0LA 3QFRA 2HCJB 3AVUA 1W87A 4TMTA 3ASRA 3W2HA 2ZL6A 4Z4WA 3AVVA 2J7KA 2BV3A 4X7CA 4ZV4A 3SLDA 2D74A 3AVTA 1YJWB 4LBVA 5F4JA 1IB0A 4BPRA 3CCUB 4G1BA 5H5JA 4RD0A 3LVBA 3NE5B 3CPWB 3JQRA 1XQBA 1KK3A 1R5BA 1V5VA 3PENA 2XNCA 4Z4ZA 5JBQA 4ZGQB 1H42A 1D1NA 1QX4A 5F4OA 3CCLB 4FWTA 4P9SA 1DDIA 1VLYA 2HDNB 3WBJA 4H9GA 4XKVA 3E1YE 2QTZA
chains in the Genus database with same CATH topology
2C78A 1N0UA 2CRVA 2DETA 2BM0A 3W2FA 3CCRB 1KRHA 1VQMB 1EFUA 1W2BB 1VQKB 4EH1A 3AGQA 1FRNA 4Y9RA 1N0VC 1QGYA 4PC3A 4F7DA 5GV7A 4RCYA 2VYQA 1EFTA 1Q86D 3AVXA 3V76A 1UMKA 4B44A 4YAFA 1VQ4B 3W5VA 1EWYA 4P3YA 2PMDA 4TMWA 1GAWA 1IJEA 1GAQA 4U9UA 1AMOA 1VQ7B 1TLLA 4ACBA 2BSAA 2XNJA 1KC8D 1K8AD 2BMWA 1KTVA 1QUEA 3QFTA 4NCNA 3B82A 1JA1A 3FJOA 3WNCA 2YWEA 3G4SB 1QVGB 4TMXA 2QEXB 3ZZTA 1GJRA 1Q7YD 3VO1A 2BVNA 2FX3A 2E1RA 4UAJA 4RJLA 1EP3B 3CCVB 1KQSB 4R71A 1FNMA 4RD6A 4YAWA 3WYAA 2HMAA 2VNJA 5AN9A 4B3XA 1YHQB 5EMNA 1E63A 1S72B 1JJ2B 3B8HA 3MMPA 4DQLA 3QFSA 1ZUNB 3LO8A 1D8TA 1VQ9B 3ES9A 2RC5A 1FNBA 4B4DA 2EFGA 1VQ6B 3VNVA 1CNFA 3JQPA 3J81k 4G5GA 1VQLB 1QUFA 5THXA 4PC2A 4YAUA 1GO2A 5H59A 1XB2A 1QG0A 3MCAA 3ZBUA 5TY0A 3WXMA 1AIPA 1QFZA 4B47A 2BN4A 1WDTA 3ZZUA 4RD4A 1GVHA 1OB5A 2CNDA 3AGPA 3QFCA 4PGOA 2OK8A 4YAOA 2VNHA 3FPKA 3E20A 1YI2B 1G7CA 1F20A 4ZCIA 4YHBA 2DCUA 5DSZA 3VMFA 4ACAA 1TVCA 1B2RA 4WQMA 1EP1B 4PC6A 5FA6A 3P27A 1DDGA 4J0QA 1K9MD 1S0UA 4YALA 3JQQA 4M53A 3CC7B 3CC2B 1OGJA 3I1FA 2BM1A 1CNEA 2YWGA 3P26A 1B23P 2QTLA 1I7PA 1YJ9B 3B78A 1J9ZA 3W2GA 2EIXA 1TUIA 3U6BA 2XEXA 3U6KA 4M1KA 1ZM2A 4ZGNB 1YIJB 4DQKA 4RD3A 4FK8A 3W2IA 1W34A 1TTTA 1FNDA 4LBWA 4FN5A 2B5OA 3W2EA 2OTJB 3OJWA 3CCEB 4M4SA 4NBSA 1NJID 1G7RA 5GV8A 1BQEA 2GPJA 4K1XA 1IJFA 1BX0A 1VQOB 2DY1A 1FDRA 3CC4B 2YWHA 1FNCA 1KK0A 3CCMB 4IW3B 3ZBTA 1H85A 2PIAA 1KK2A 3VNUA 1EXMA 1D2EA 2BF4A 1Q82D 3OZUA 3AVWA 1JNYA 2QA4B 4N3GA 1SKQA 3MHPA 1GR1A 1U2RA 2BGIA 1JB9A 3AVYA 1HA3A 4TMZA 4TN1A 3CXCB 3WY9A 4HE6A 2YWFA 4ZCLA 1VQNB 1ZM9A 1W35A 2BPOA 3CRZA 3QSYA 2RC6A 1VQ8B 1YITB 4RCZA 3CB4A 3SJZA 1Q81D 1G7TA 1KJZA 2X3UA 4RD1A 3OZWA 3CCSB 1G7SA 4HE5A 1DARA 1A8PA 1ELOA 1E62A 4C0SA 1QFJA 1VQ5B 5TR9A 2NPFA 3I55B 1QVFB 1EFCA 3CW2A 2VNKA 4ZCMA 1QGZA 2QMUA 3G71B 3CD6B 4QFMA 3WBKA 3CMAB 4M2LA 3G6EB 1OGIA 1R5NA 4AC9A 1QGAA 1DG1G 4PC7A 1BJKA 2VNIA 3OW2B 1F60A 2B7CA 3OJXA 1FRQA 4Y7CA 4P6VF 4AF6A 5TV2A 1VQPB 3OZVA 1SM4A 2QDXA 4G1VA 4Y9UA 1K73D 1JA0A 4LC0A 4Q7JB 1M1KD 3WNBA 2BGJA 1CQXA 2OTLB 2QN6A 3ZC3A 4MYTA 4N3NA 4LBYA 1EP2B 3CCQB 1KD1D 1XE1A 1BX1A 2VZLA 1NDHA 2GQFA 2OK7A 2C77A 3U2QA 3W5UA 3W5HA 5HXBA 1ZM4A 2DERA 2DEUA 1R5OA 1KK1A 5KSWB 1YJNB 3CCJB 2R6HA 3QE2A 1QH0A 2PLFA 1N8RD 1E64A 4TMVA 4QHYA 1OB2A 1QFYA 4LBZA 4PC1A 4AF7A 1M90D 3ZZ0A 3VO2A 3CMEB 1ZM3A 2B7BA 2AHOA 2ZITA 3WNDA 4C43A 4RD2A 4B43A 3I56B 4B48A 4MYUA 4M0LA 3QFRA 2HCJB 3AVUA 1W87A 4TMTA 3W2HA 3AVVA 2J7KA 2BV3A 4ZV4A 3AVTA 2D74A 1YJWB 4LBVA 1IB0A 4BPRA 3CCUB 4G1BA 5H5JA 4RD0A 3LVBA 3CPWB 3JQRA 1KK3A 1R5BA 3PENA 2XNCA 5JBQA 4ZGQB 1H42A 1D1NA 1QX4A 3CCLB 4FWTA 1DDIA 3WBJA 2HDNB 4H9GA 3E1YE 2QTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C78 A;  1N0U A;  2CRV A;  2DET A;  2BM0 A;  3W2F A;  3CCR B;  1KRH A;  1VQM B;  1EFU A;  1W2B B;  1VQK B;  4EH1 A;  3AGQ A;  1FRN A;  4Y9R A;  1N0V C;  1QGY A;  4PC3 A;  4F7D A;  5GV7 A;  4RCY A;  2VYQ A;  1EFT A;  1Q86 D;  3AVX A;  3V76 A;  1UMK A;  4B44 A;  4YAF A;  1VQ4 B;  3W5V A;  1EWY A;  4P3Y A;  2PMD A;  4TMW A;  1GAW A;  1IJE A;  1GAQ A;  4U9U A;  1AMO A;  1VQ7 B;  1TLL A;  4ACB A;  2BSA A;  2XNJ A;  1KC8 D;  1K8A D;  2BMW A;  1KTV A;  1QUE A;  3QFT A;  4NCN A;  3B82 A;  1JA1 A;  3FJO A;  3WNC A;  2YWE A;  3G4S B;  1QVG B;  4TMX A;  2QEX B;  3ZZT A;  1GJR A;  1Q7Y D;  3VO1 A;  2BVN A;  2FX3 A;  2E1R A;  4UAJ A;  4RJL A;  1EP3 B;  3CCV B;  1KQS B;  4R71 A;  1FNM A;  4RD6 A;  4YAW A;  3WYA A;  2HMA A;  2VNJ A;  5AN9 A;  4B3X A;  1YHQ B;  5EMN A;  1E63 A;  1S72 B;  1JJ2 B;  3B8H A;  3MMP A;  4DQL A;  3QFS A;  1ZUN B;  3LO8 A;  1D8T A;  1VQ9 B;  3ES9 A;  2RC5 A;  1FNB A;  4B4D A;  2EFG A;  1VQ6 B;  3VNV A;  1CNF A;  3JQP A;  3J81 k;  4G5G A;  1VQL B;  1QUF A;  5THX A;  4PC2 A;  4YAU A;  1GO2 A;  5H59 A;  1XB2 A;  1QG0 A;  3MCA A;  3ZBU A;  5TY0 A;  3WXM A;  1AIP A;  1QFZ A;  4B47 A;  2BN4 A;  1WDT A;  3ZZU A;  4RD4 A;  1GVH A;  1OB5 A;  2CND A;  3AGP A;  3QFC A;  4PGO A;  2OK8 A;  4YAO A;  2VNH A;  3FPK A;  3E20 A;  1YI2 B;  1G7C A;  1F20 A;  4ZCI A;  4YHB A;  2DCU A;  5DSZ A;  3VMF A;  4ACA A;  1TVC A;  1B2R A;  4WQM A;  1EP1 B;  4PC6 A;  5FA6 A;  3P27 A;  1DDG A;  4J0Q A;  1K9M D;  1S0U A;  4YAL A;  3JQQ A;  4M53 A;  3CC7 B;  3CC2 B;  1OGJ A;  3I1F A;  2BM1 A;  1CNE A;  2YWG A;  3P26 A;  1B23 P;  2QTL A;  1I7P A;  1YJ9 B;  3B78 A;  1J9Z A;  3W2G A;  2EIX A;  1TUI A;  3U6B A;  2XEX A;  3U6K A;  4M1K A;  1ZM2 A;  4ZGN B;  1YIJ B;  4DQK A;  4RD3 A;  4FK8 A;  3W2I A;  1W34 A;  1TTT A;  1FND A;  4LBW A;  4FN5 A;  2B5O A;  3W2E A;  2OTJ B;  3OJW A;  3CCE B;  4M4S A;  4NBS A;  1NJI D;  1G7R A;  5GV8 A;  1BQE A;  2GPJ A;  4K1X A;  1IJF A;  1BX0 A;  1VQO B;  2DY1 A;  1FDR A;  3CC4 B;  2YWH A;  1FNC A;  1KK0 A;  3CCM B;  4IW3 B;  3ZBT A;  1H85 A;  2PIA A;  1KK2 A;  3VNU A;  1EXM A;  1D2E A;  2BF4 A;  1Q82 D;  3OZU A;  3AVW A;  1JNY A;  2QA4 B;  4N3G A;  1SKQ A;  3MHP A;  1GR1 A;  1U2R A;  2BGI A;  1JB9 A;  3AVY A;  1HA3 A;  4TMZ A;  4TN1 A;  3CXC B;  3WY9 A;  4HE6 A;  2YWF A;  4ZCL A;  1VQN B;  1ZM9 A;  1W35 A;  2BPO A;  3CRZ A;  3QSY A;  2RC6 A;  1VQ8 B;  1YIT B;  4RCZ A;  3CB4 A;  3SJZ A;  1Q81 D;  1G7T A;  1KJZ A;  2X3U A;  4RD1 A;  3OZW A;  3CCS B;  1G7S A;  4HE5 A;  1DAR A;  1A8P A;  1ELO A;  1E62 A;  4C0S A;  1QFJ A;  1VQ5 B;  5TR9 A;  2NPF A;  3I55 B;  1QVF B;  1EFC A;  3CW2 A;  2VNK A;  4ZCM A;  1QGZ A;  2QMU A;  3G71 B;  3CD6 B;  4QFM A;  3WBK A;  3CMA B;  4M2L A;  3G6E B;  1OGI A;  1R5N A;  4AC9 A;  1QGA A;  1DG1 G;  4PC7 A;  1BJK A;  2VNI A;  3OW2 B;  1F60 A;  2B7C A;  3OJX A;  1FRQ A;  4Y7C A;  4P6V F;  4AF6 A;  5TV2 A;  1VQP B;  3OZV A;  1SM4 A;  2QDX A;  4G1V A;  4Y9U A;  1K73 D;  1JA0 A;  4LC0 A;  4Q7J B;  1M1K D;  3WNB A;  2BGJ A;  1CQX A;  2OTL B;  2QN6 A;  3ZC3 A;  4MYT A;  4N3N A;  4LBY A;  1EP2 B;  3CCQ B;  1KD1 D;  1XE1 A;  1BX1 A;  2VZL A;  1NDH A;  2GQF A;  2OK7 A;  2C77 A;  3U2Q A;  3W5U A;  3W5H A;  5HXB A;  1ZM4 A;  2DER A;  2DEU A;  1R5O A;  1KK1 A;  5KSW B;  1YJN B;  3CCJ B;  2R6H A;  3QE2 A;  1QH0 A;  2PLF A;  1N8R D;  1E64 A;  4TMV A;  4QHY A;  1OB2 A;  1QFY A;  4LBZ A;  4PC1 A;  4AF7 A;  1M90 D;  3ZZ0 A;  3VO2 A;  3CME B;  1ZM3 A;  2B7B A;  2AHO A;  2ZIT A;  3WND A;  4C43 A;  4RD2 A;  4B43 A;  3I56 B;  4B48 A;  4MYU A;  4M0L A;  3QFR A;  2HCJ B;  3AVU A;  1W87 A;  4TMT A;  3W2H A;  3AVV A;  2J7K A;  2BV3 A;  4ZV4 A;  3AVT A;  2D74 A;  1YJW B;  4LBV A;  1IB0 A;  4BPR A;  3CCU B;  4G1B A;  5H5J A;  4RD0 A;  3LVB A;  3CPW B;  3JQR A;  1KK3 A;  1R5B A;  3PEN A;  2XNC A;  5JBQ A;  4ZGQ B;  1H42 A;  1D1N A;  1QX4 A;  3CCL B;  4FWT A;  1DDI A;  3WBJ A;  2HDN B;  4H9G A;  3E1Y E;  2QTZ A; 
#chains in the Genus database with same CATH topology
 2C78 A;  3HAG A;  1N0U A;  2CRV A;  2DET A;  5FO0 A;  2BM0 A;  3W2F A;  4WZE A;  3CCR B;  1KRH A;  1VQM B;  3Q6Q A;  5J35 A;  1EFU A;  4DK1 A;  1W2B B;  1VQK B;  4EH1 A;  3AGQ A;  3GIR A;  1FRN A;  4P2N A;  5FO1 A;  1WU8 A;  2D3L A;  4Y9R A;  1N0V C;  5BSY A;  2ZXH A;  1QGY A;  3LQ6 A;  3DDY A;  4PC3 A;  4F7D A;  5GV7 A;  4RCY A;  1HZE A;  2VYQ A;  2DYI A;  1WTH D;  4TSF A;  4Z4U A;  1EFT A;  2OBS A;  4XOT A;  1Q86 D;  2Q6I A;  3AVX A;  1KZL A;  3V76 A;  1UMK A;  4B44 A;  4YAF A;  4CQJ A;  3OPO A;  1BMF A;  1VQ4 B;  3W5V A;  1EWY A;  2V7U A;  3Q39 A;  4P3Y A;  1NB0 A;  2PMD A;  4XQF A;  4TMW A;  1N07 A;  1GAW A;  1IJE A;  1GAQ A;  4U9U A;  1AMO A;  1VQ7 B;  1TLL A;  5HZA A;  4ACB A;  2BSA A;  2X0K A;  1RQP A;  2XNJ A;  1KC8 D;  3KL9 A;  2BMW A;  1KTV A;  1QUE A;  4OPV A;  3QFT A;  4NCN A;  1K8A D;  4P22 A;  2F1M A;  2WZN A;  2V7T A;  3B82 A;  4X0C A;  1JA1 A;  3FJO A;  3WNC A;  3OW7 A;  4X7F A;  2C2W A;  2YWE A;  4OOS A;  3G4S B;  1QVG B;  4YEL A;  4TMX A;  2QEX B;  2W6J A;  1GJR A;  1N05 A;  1N08 A;  1Y0R A;  3BNW A;  3ZZT A;  3VO1 A;  2BVN A;  2FX3 A;  2CBX A;  2E1R A;  4UAJ A;  1KMH A;  4RJL A;  2X6X A;  4DNR B;  1EP3 B;  3CCV B;  1KQS B;  1WOO A;  4R71 A;  1FNM A;  1WP6 A;  1OHH A;  4RD6 A;  4YAW A;  3WYA A;  2HMA A;  2VNJ A;  5AN9 A;  4B3X A;  3A3B A;  2CW5 A;  1YHQ B;  2E1B A;  4L8J A;  2ZBV A;  5EMN A;  1E63 A;  4DK0 A;  5IYW A;  1S72 B;  5A88 A;  4Z4S A;  1JJ2 B;  3B8H A;  3MMP A;  4DQL A;  2C4T A;  3QFS A;  2GK6 A;  1ZUN B;  5FNZ A;  4NNJ A;  3ASP A;  3GVK A;  3LO8 A;  2ZL7 A;  4OOX A;  2GJK A;  4P6Y A;  1D8T A;  1YLO A;  1VQ9 B;  2WJV A;  3ES9 A;  4UZF A;  2RC5 A;  3A8I A;  3ONY A;  1FNB A;  2OBR A;  4B4D A;  2EFG A;  1PJ7 A;  1VQ6 B;  3VNV A;  1CNF A;  4ROX A;  3JQP A;  3J81 k;  4G5G A;  1VQL B;  1QUF A;  2V7X A;  5THX A;  2XOK A;  2XND A;  4Z4T A;  4PC2 A;  3BCF A;  4YAU A;  5B6I A;  3V7A A;  1GO2 A;  5H59 A;  1XB2 A;  1QG0 A;  3MCA A;  4HIZ A;  3ZBU A;  5TY0 A;  4XLA A;  3PA2 A;  2CK3 A;  3WXM A;  1AIP A;  1RQR A;  3D26 A;  1QFZ A;  5HZB A;  2ZXI A;  4XMY A;  4B47 A;  2BN4 A;  2F43 A;  1WDT A;  2ZL5 A;  4RD4 A;  1WPC A;  3ZZU A;  1GVH A;  1OB5 A;  1E79 A;  5LMZ A;  2XZO A;  2CF4 A;  3FPP A;  2CND A;  4XON A;  3AGP A;  3QFC A;  2Z6B D;  3BC9 A;  4PGO A;  1T6Y A;  4OPS A;  5E6T A;  4XLE A;  2OK8 A;  2V7V A;  4YAO A;  2VNH A;  3FPK A;  3E20 A;  1YI2 B;  4Z1M A;  3T53 B;  2ZZG A;  2X8K A;  2X6W A;  1G7C A;  1UD8 A;  1F20 A;  4ZCI A;  1OB0 A;  4Z4R A;  4YHB A;  5KW9 A;  2DCU A;  1UD5 A;  1P4M A;  2ZBU A;  2C5H A;  5DSZ A;  3VMF A;  4XOR A;  4ACA A;  1Q9S A;  1TVC A;  2F1L A;  3PA1 A;  4QV2 A;  1B2R A;  2R9V A;  5KNL A;  5TRD A;  4WQM A;  1EP1 B;  5IK2 A;  3A8J A;  1W0J A;  4KKU A;  4PC6 A;  5FA6 A;  1E43 A;  4XL9 A;  3P27 A;  2QGG A;  1DDG A;  4J0Q A;  1K9M D;  1S0U A;  2X85 A;  3WQZ A;  4YAL A;  4G7X A;  5FL7 A;  3JQQ A;  1N06 A;  3BCD A;  4M53 A;  3BY1 A;  2VBV A;  3CC7 B;  3CC2 B;  1OGJ A;  3I1F A;  2BM1 A;  1CNE A;  2YWG A;  4OPO A;  4XN0 A;  5J3O A;  1EFR A;  2V7Q A;  3P26 A;  1B23 P;  2QTL A;  1VLO A;  2V4D A;  2QE7 A;  3CPX A;  1WOS A;  4RPD A;  1I7P A;  1YJ9 B;  5HKK A;  1PJ6 A;  3B78 A;  3CES A;  5DN6 A;  1J9Z A;  3W2G A;  1NBM A;  5DS0 A;  1VHO A;  1T6X A;  1UD6 A;  2EIX A;  2GRE A;  2VBU A;  2WJY A;  1TUI A;  4RDJ A;  4XR6 A;  2OYN A;  2D9R A;  4XOP A;  4X7D A;  2XEX A;  3U6B A;  4B3G A;  2F4N A;  3U6K A;  4M1K A;  1ZM2 A;  4ZGN B;  4X07 A;  1YIJ B;  4DQK A;  4RD3 A;  1YX2 A;  4FK8 A;  3W2I A;  4DNT B;  1W34 A;  1TTT A;  1FND A;  4LBW A;  1E3Z A;  4KKT A;  2ZTN A;  4RLZ A;  4FN5 A;  2B5O A;  4XN3 A;  3W2E A;  2OTJ B;  3H94 A;  3OJW A;  4FXU A;  3CCE B;  4M4S A;  4NBS A;  1NJI D;  3OEE A;  1G7R A;  2X53 S;  5GV8 A;  1BQE A;  4OOV A;  2GPJ A;  4TT3 A;  5F4M A;  4P12 A;  4UZE A;  4K1X A;  1IJF A;  1BX0 A;  1VQO B;  3LNN A;  4JMQ A;  2VBS A;  3Q6R A;  2DY1 A;  3OP1 A;  4WZK A;  3RY8 A;  1FDR A;  3CC4 B;  2YWH A;  3A3G A;  1FNC A;  1KK0 A;  3CCM B;  1Q7Y D;  3SKB A;  2W6I A;  4IW3 B;  3ZBT A;  1H85 A;  2PIA A;  1KK2 A;  3ASQ A;  3VNU A;  2WSS A;  1W0K A;  2JDI A;  1EXM A;  1D2E A;  2LZJ A;  1SKY B;  1NB9 A;  3ZUG A;  2BF4 A;  4G7W A;  3OZU A;  5BSX A;  1Q82 D;  3H9N A;  3AVW A;  1JNY A;  2QA4 B;  4N3G A;  1SKQ A;  2XGJ A;  3MHP A;  1GR1 A;  3SLN A;  5IYN A;  3CP2 A;  1U2R A;  2BGI A;  2Q6O A;  1MRZ A;  1JB9 A;  3Q38 A;  3AVY A;  1HA3 A;  3ZIA A;  4TMZ A;  4TN1 A;  3CXC B;  4XD7 A;  3WY9 A;  4HE6 A;  2YWF A;  3BY2 A;  4ZCL A;  2ZZF A;  1NRK A;  1ZM9 A;  1VQN B;  1W35 A;  2BPO A;  3CRZ A;  3QSY A;  4RM0 A;  2RC6 A;  3ONU A;  5L46 A;  1VQ8 B;  1YIT B;  5FIU A;  3OE7 A;  4RCZ A;  1E3X A;  3CB4 A;  4TKO B;  4OP7 A;  4YXW A;  4AVZ A;  3SJZ A;  2ZTG A;  1G7T A;  1Q81 D;  1KJZ A;  4XKW A;  2X3U A;  2KVO A;  4RD1 A;  4E0F A;  3OZW A;  5IYP A;  3GVL A;  1WOP A;  3CCS B;  1G7S A;  4HE5 A;  4PAB A;  3SEJ A;  3G05 A;  1DAR A;  1A8P A;  1HVX A;  2XZL A;  3PVD A;  4XLF A;  4XLC A;  2VJI A;  4P1V A;  4XNF A;  1ELO A;  3CP8 A;  1E62 A;  3GVJ A;  1BLI A;  1QFJ A;  4C0S A;  2JN9 A;  5TR9 A;  2NPF A;  1MAB A;  3I55 B;  3T56 B;  3ISX A;  1VQ5 B;  1QVF B;  1EFC A;  3OEH A;  1UD4 A;  3CW2 A;  2VNK A;  4ZCM A;  2PE3 A;  3A1P A;  1QGZ A;  2QMU A;  4G6I A;  4RPB A;  4UZU A;  1IHM A;  3G71 B;  3CD6 B;  1W9X A;  4QFM A;  2C4U A;  2JJ2 A;  3WBK A;  3CMA B;  2WPD A;  1UD2 A;  4M2L A;  3G6E B;  1V0F A;  1OGI A;  1R5N A;  4AC9 A;  2Q6K A;  1QGA A;  3OOC A;  4X7E A;  1DG1 G;  4PC7 A;  5A8A A;  1S4M A;  1BJK A;  2Q6L A;  2VNI A;  3GQB A;  3OFN A;  3T51 B;  3OW2 B;  1VHE A;  1WSR A;  2NV4 A;  3VR6 A;  1F60 A;  2B7C A;  3OJX A;  1FRQ A;  3CMM A;  2ZZQ A;  4GQN A;  4ASU A;  4II2 A;  1PKV A;  4P6V F;  4Y7C A;  2P3M A;  4XLH A;  4AF6 A;  5TV2 A;  1VQP B;  2DOG A;  3OZV A;  1SM4 A;  3FKS A;  2QDX A;  4G1V A;  2M5S A;  2FVG A;  4WZL A;  4Y9U A;  1K73 D;  4P3I A;  3OKX A;  3ASS A;  1JA0 A;  4LC0 A;  2VBT A;  3LQE A;  4Q7J B;  1M1K D;  3JU4 A;  3WNB A;  2BGJ A;  4Z4Y A;  2WR8 A;  1CQX A;  2C5B A;  2OTL B;  1H8E A;  3PUN A;  3SJP A;  2QN6 A;  4RDL A;  2CC2 A;  4X8I A;  3ZC3 A;  4MYT A;  4P26 A;  4N3N A;  4P25 A;  4LBY A;  1EP2 B;  1E1Q A;  1UD3 A;  3CCQ B;  2JIZ A;  2XZP A;  4X06 A;  1VJS A;  2I1L A;  4II3 A;  3R6J A;  1KD1 D;  1XE1 A;  1BX1 A;  2VZL A;  2GJP A;  4B3F X;  1NDH A;  2GQF A;  2OK7 A;  1I8D A;  1XFO A;  2C77 A;  3U2Q A;  2ZZE A;  3BQJ A;  3W5U A;  2WYR A;  3W5H A;  3GSI A;  1ZM4 A;  1BPL A;  5HXB A;  2DER A;  2DEU A;  1R5O A;  1KK1 A;  1WSV A;  5KSW B;  1YJN B;  1PJ5 A;  4QUZ A;  5CDF A;  3CTA A;  3CCJ B;  5A89 A;  2R6H A;  4WZT A;  3QE2 A;  1QH0 A;  2PLF A;  2HLD A;  4RDK A;  1FX0 A;  3KEW A;  4YEJ A;  1N8R D;  5IYQ A;  1E64 A;  2GK7 A;  4TMV A;  4QHY A;  1OB2 A;  2V7W A;  1QFY A;  1Y0Y A;  4LBZ A;  1I18 A;  3A8K A;  4PC1 A;  4AF7 A;  1K28 D;  1VF7 A;  2D3N A;  4WWV A;  1M90 D;  1T5E A;  2OBT A;  4XM3 A;  3ZZ0 A;  5IYR A;  4PAA A;  3VO2 A;  3BH4 A;  3AST A;  4KKS A;  1T6Z A;  1WOR A;  2V31 A;  3CME B;  1ZM3 A;  3OAA A;  2DIE A;  2B7B A;  2AHO A;  2JJ1 A;  1E1R A;  2ZIT A;  4X05 A;  3WND A;  3ZPN A;  4Z4V A;  2WZP P;  4C43 A;  1V0E A;  4QVJ A;  2X6Y A;  3R6K A;  4RD2 A;  4B43 A;  3I56 B;  3PUM A;  4B48 A;  2GJR A;  1H8H A;  3A35 A;  3Q3A A;  4MYU A;  1COW A;  4QVA A;  2VJJ A;  4M0L A;  3QFR A;  2HCJ B;  3AVU A;  1W87 A;  4TMT A;  3ASR A;  3W2H A;  2ZL6 A;  4Z4W A;  3AVV A;  2J7K A;  2BV3 A;  4X7C A;  4ZV4 A;  3SLD A;  2D74 A;  3AVT A;  1YJW B;  4LBV A;  5F4J A;  1IB0 A;  4BPR A;  3CCU B;  4G1B A;  5H5J A;  4RD0 A;  3LVB A;  3NE5 B;  3CPW B;  3JQR A;  1XQB A;  1KK3 A;  1R5B A;  1V5V A;  3PEN A;  2XNC A;  4Z4Z A;  5JBQ A;  4ZGQ B;  1H42 A;  1D1N A;  1QX4 A;  5F4O A;  3CCL B;  4FWT A;  4P9S A;  1DDI A;  1VLY A;  2HDN B;  3WBJ A;  4H9G A;  4XKV A;  3E1Y E;  2QTZ A; 
#chains in the Genus database with same CATH homology
 2C78 A;  1N0U A;  2CRV A;  2DET A;  2BM0 A;  3W2F A;  3CCR B;  1KRH A;  1VQM B;  1EFU A;  1W2B B;  1VQK B;  4EH1 A;  3AGQ A;  1FRN A;  4Y9R A;  1N0V C;  1QGY A;  4PC3 A;  4F7D A;  5GV7 A;  4RCY A;  2VYQ A;  1EFT A;  1Q86 D;  3AVX A;  3V76 A;  1UMK A;  4B44 A;  4YAF A;  1VQ4 B;  3W5V A;  1EWY A;  4P3Y A;  2PMD A;  4TMW A;  1GAW A;  1IJE A;  1GAQ A;  4U9U A;  1AMO A;  1VQ7 B;  1TLL A;  4ACB A;  2BSA A;  2XNJ A;  1KC8 D;  1K8A D;  2BMW A;  1KTV A;  1QUE A;  3QFT A;  4NCN A;  3B82 A;  1JA1 A;  3FJO A;  3WNC A;  2YWE A;  3G4S B;  1QVG B;  4TMX A;  2QEX B;  3ZZT A;  1GJR A;  1Q7Y D;  3VO1 A;  2BVN A;  2FX3 A;  2E1R A;  4UAJ A;  4RJL A;  1EP3 B;  3CCV B;  1KQS B;  4R71 A;  1FNM A;  4RD6 A;  4YAW A;  3WYA A;  2HMA A;  2VNJ A;  5AN9 A;  4B3X A;  1YHQ B;  5EMN A;  1E63 A;  1S72 B;  1JJ2 B;  3B8H A;  3MMP A;  4DQL A;  3QFS A;  1ZUN B;  3LO8 A;  1D8T A;  1VQ9 B;  3ES9 A;  2RC5 A;  1FNB A;  4B4D A;  2EFG A;  1VQ6 B;  3VNV A;  1CNF A;  3JQP A;  3J81 k;  4G5G A;  1VQL B;  1QUF A;  5THX A;  4PC2 A;  4YAU A;  1GO2 A;  5H59 A;  1XB2 A;  1QG0 A;  3MCA A;  3ZBU A;  5TY0 A;  3WXM A;  1AIP A;  1QFZ A;  4B47 A;  2BN4 A;  1WDT A;  3ZZU A;  4RD4 A;  1GVH A;  1OB5 A;  2CND A;  3AGP A;  3QFC A;  4PGO A;  2OK8 A;  4YAO A;  2VNH A;  3FPK A;  3E20 A;  1YI2 B;  1G7C A;  1F20 A;  4ZCI A;  4YHB A;  2DCU A;  5DSZ A;  3VMF A;  4ACA A;  1TVC A;  1B2R A;  4WQM A;  1EP1 B;  4PC6 A;  5FA6 A;  3P27 A;  1DDG A;  4J0Q A;  1K9M D;  1S0U A;  4YAL A;  3JQQ A;  4M53 A;  3CC7 B;  3CC2 B;  1OGJ A;  3I1F A;  2BM1 A;  1CNE A;  2YWG A;  3P26 A;  1B23 P;  2QTL A;  1I7P A;  1YJ9 B;  3B78 A;  1J9Z A;  3W2G A;  2EIX A;  1TUI A;  3U6B A;  2XEX A;  3U6K A;  4M1K A;  1ZM2 A;  4ZGN B;  1YIJ B;  4DQK A;  4RD3 A;  4FK8 A;  3W2I A;  1W34 A;  1TTT A;  1FND A;  4LBW A;  4FN5 A;  2B5O A;  3W2E A;  2OTJ B;  3OJW A;  3CCE B;  4M4S A;  4NBS A;  1NJI D;  1G7R A;  5GV8 A;  1BQE A;  2GPJ A;  4K1X A;  1IJF A;  1BX0 A;  1VQO B;  2DY1 A;  1FDR A;  3CC4 B;  2YWH A;  1FNC A;  1KK0 A;  3CCM B;  4IW3 B;  3ZBT A;  1H85 A;  2PIA A;  1KK2 A;  3VNU A;  1EXM A;  1D2E A;  2BF4 A;  1Q82 D;  3OZU A;  3AVW A;  1JNY A;  2QA4 B;  4N3G A;  1SKQ A;  3MHP A;  1GR1 A;  1U2R A;  2BGI A;  1JB9 A;  3AVY A;  1HA3 A;  4TMZ A;  4TN1 A;  3CXC B;  3WY9 A;  4HE6 A;  2YWF A;  4ZCL A;  1VQN B;  1ZM9 A;  1W35 A;  2BPO A;  3CRZ A;  3QSY A;  2RC6 A;  1VQ8 B;  1YIT B;  4RCZ A;  3CB4 A;  3SJZ A;  1Q81 D;  1G7T A;  1KJZ A;  2X3U A;  4RD1 A;  3OZW A;  3CCS B;  1G7S A;  4HE5 A;  1DAR A;  1A8P A;  1ELO A;  1E62 A;  4C0S A;  1QFJ A;  1VQ5 B;  5TR9 A;  2NPF A;  3I55 B;  1QVF B;  1EFC A;  3CW2 A;  2VNK A;  4ZCM A;  1QGZ A;  2QMU A;  3G71 B;  3CD6 B;  4QFM A;  3WBK A;  3CMA B;  4M2L A;  3G6E B;  1OGI A;  1R5N A;  4AC9 A;  1QGA A;  1DG1 G;  4PC7 A;  1BJK A;  2VNI A;  3OW2 B;  1F60 A;  2B7C A;  3OJX A;  1FRQ A;  4Y7C A;  4P6V F;  4AF6 A;  5TV2 A;  1VQP B;  3OZV A;  1SM4 A;  2QDX A;  4G1V A;  4Y9U A;  1K73 D;  1JA0 A;  4LC0 A;  4Q7J B;  1M1K D;  3WNB A;  2BGJ A;  1CQX A;  2OTL B;  2QN6 A;  3ZC3 A;  4MYT A;  4N3N A;  4LBY A;  1EP2 B;  3CCQ B;  1KD1 D;  1XE1 A;  1BX1 A;  2VZL A;  1NDH A;  2GQF A;  2OK7 A;  2C77 A;  3U2Q A;  3W5U A;  3W5H A;  5HXB A;  1ZM4 A;  2DER A;  2DEU A;  1R5O A;  1KK1 A;  5KSW B;  1YJN B;  3CCJ B;  2R6H A;  3QE2 A;  1QH0 A;  2PLF A;  1N8R D;  1E64 A;  4TMV A;  4QHY A;  1OB2 A;  1QFY A;  4LBZ A;  4PC1 A;  4AF7 A;  1M90 D;  3ZZ0 A;  3VO2 A;  3CME B;  1ZM3 A;  2B7B A;  2AHO A;  2ZIT A;  3WND A;  4C43 A;  4RD2 A;  4B43 A;  3I56 B;  4B48 A;  4MYU A;  4M0L A;  3QFR A;  2HCJ B;  3AVU A;  1W87 A;  4TMT A;  3W2H A;  3AVV A;  2J7K A;  2BV3 A;  4ZV4 A;  3AVT A;  2D74 A;  1YJW B;  4LBV A;  1IB0 A;  4BPR A;  3CCU B;  4G1B A;  5H5J A;  4RD0 A;  3LVB A;  3CPW B;  3JQR A;  1KK3 A;  1R5B A;  3PEN A;  2XNC A;  5JBQ A;  4ZGQ B;  1H42 A;  1D1N A;  1QX4 A;  3CCL B;  4FWT A;  1DDI A;  3WBJ A;  2HDN B;  4H9G A;  3E1Y E;  2QTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...