3E1YE

Crystal structure of human erf1/erf3 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
195
structure length
195
Chain Sequence
IRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 195
sequence length 195
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
E PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE01
4NCNA 3JQPA 3FPKA 4ACBA 2BMWA 2QN6A 2NPFA 2BVNA 3CC7B 3QE2A 2OTJB 3J81k 3I1FA 1ZM4A 1CNFA 3CD6B 4RD0A 3MMPA 5H59A 4P6VF 4ACAA 2GPJA 1KC8D 2AHOA 3OZUA 3JQQA 4M1KA 4BPRA 1KK1A 2BSAA 3QFTA 3AVVA 2YWHA 1AMOA 4G1VA 4U9UA 3AVYA 1EWYA 1BQEA 1VQ6B 1EP1B 5EMNA 1Q7YD 4LC0A 4YALA 5KSWB 2OK8A 1BX1A 2R6HA 1DDGA 1JA0A 4C0SA 4C43A 1F60A 1XE1A 4ZGQB 1TTTA 1W2BB 1R5NA 2EIXA 3WNDA 4B44A 3B78A 5HXBA 2YWGA 3QFSA 1QUEA 1ELOA 4MYTA 5DSZA 4EH1A 4LBVA 1EP2B 1W35A 4ZCLA 3AVUA 1QFJA 4DQLA 1VQ9B 1H42A 4P3YA 2YWFA 4B3XA 1B2RA 3P26A 3AGPA 1YJ9B 3CCLB 1JA1A 1QUFA 2XNJA 2C78A 1AIPA 4LBWA 3CRZA 4RCYA 1DG1G 4FN5A 3I56B 4B47A 4R71A 1Q82D 2HCJB 3VO2A 4FWTA 3G71B 1NDHA 1VQ4B 1GAQA 1IJFA 1JB9A 1IB0A 2BGJA 1Q86D 4M2LA 1VQ5B 3OZVA 2PMDA 1EFTA 1G7RA 3E20A 2BF4A 3WBKA 4TN1A 2BN4A 1YHQB 1QGZA 3W2EA 3CCVB 4DQKA 3OW2B 1HA3A 1S72B 2VNHA 4YHBA 1K9MD 3U6BA 3B8HA 2QA4B 4LBZA 1D8TA 1KK3A 4AF7A 5TV2A 1GAWA 1EP3B 3I55B 1KQSB 3AGQA 1CQXA 1QGAA 1VQPB 3OZWA 3OJWA 2GQFA 3VNVA 1TLLA 3CMEB 3VMFA 4Y9UA 1OGIA 2VNJA 4RCZA 1FRNA 2VYQA 4ZGNB 4YAWA 4H9GA 1VQ8B 3CC2B 4TMTA 1YITB 3WYAA 1SM4A 1QG0A 1BX0A 1EXMA 2QTLA 2B7CA 3CW2A 1JNYA 4TMVA 1VQ7B 5AN9A 4B43A 4ZCMA 1ZM3A 2B5OA 1GO2A 2DERA 3ZZ0A 1K8AD 2PIAA 4TMXA 1ZUNB 3QFCA 4M0LA 4RD6A 1VQLB 2BV3A 3W2HA 1OGJA 1SKQA 2CRVA 2CNDA 1QGYA 4YAFA 3W5UA 1DDIA 1QFZA 2DETA 3E1YE 1IJEA 2B7BA 1TUIA 4N3NA 1E62A 2XNCA 3CCUB 3FJOA 4Y9RA 4B4DA 3CCRB 1VQMB 3WXMA 1QH0A 1KD1D 2QMUA 2RC5A 4AF6A 1S0UA 1N0VC 4PC1A 4LBYA 2YWEA 3CPWB 4J0QA 1TVCA 1KJZA 4M4SA 4RD4A 1J9ZA 3U2QA 3W5HA 1H85A 3W5VA 2VNKA 3CMAB 2PLFA 4RD1A 5FA6A 4ZCIA 2QTZA 2C77A 3U6KA 1W34A 3CCQB 4PGOA 3MHPA 4M53A 3W2IA 2DY1A 4YAUA 4PC7A 3WNBA 3G4SB 1XB2A 4PC2A 4PC3A 2HMAA 1GR1A 1K73D 1EFCA 4UAJA 1NJID 4YAOA 1YJNB 1G7CA 3WY9A 1QX4A 1A8PA 3CC4B 1VQNB 4ZV4A 4HE5A 1FNMA 1R5BA 4NBSA 1G7SA 4RJLA 2FX3A 3QSYA 3WNCA 1FDRA 1BJKA 1N0UA 4G1BA 1YJWB 1KK0A 4F7DA 4FK8A 3ZZTA 5TR9A 1KRHA 3LVBA 3P27A 4PC6A 5GV7A 1KK2A 2HDNB 3CCJB 2BGIA 4MYUA 5TY0A 3W2GA 3SJZA 3VO1A 4WQMA 1OB2A 2OTLB 5JBQA 2XEXA 3PENA 5GV8A 1VQOB 3VNUA 2BM1A 1CNEA 3OJXA 2VZLA 4B48A 3LO8A 1W87A 4HE6A 1DARA 1E63A 1FNBA 1KTVA 2ZITA 3ZBTA 4QHYA 3ZBUA 1FNDA 3AVWA 2VNIA 3MCAA 1B23P 1QVGB 3JQRA 1ZM2A 2OK7A 3CCSB 1GJRA 3CB4A 4AC9A 1GVHA 1ZM9A 4G5GA 1FNCA 2D74A 1M90D 4IW3B 1WDTA 2X3UA 4Y7CA 2DCUA 2BM0A 3AVTA 3CXCB 5THXA 1D1NA 2E1RA 3B82A 3V76A 1QFYA 5H5JA 4TMZA 3ES9A 1OB5A 1M1KD 2EFGA 1E64A 4K1XA 1R5OA 3ZZUA 4Q7JB 1QVFB 3WBJA 1I7PA 3W2FA 1UMKA 3ZC3A 1VQKB 1D2EA 1YIJB 1U2RA 1F20A 3AVXA 3CCMB 3QFRA 1FRQA 2QEXB 3G6EB 2J7KA 1YI2B 1JJ2B 2BPOA 1G7TA 3CCEB 2RC6A 1N8RD 1Q81D 4N3GA 2DEUA 1EFUA 4TMWA 2QDXA 4QFMA 4RD2A 4RD3A
chains in the Genus database with same CATH superfamily
4NCNA 3JQPA 3FPKA 4AVZA 4ROXA 4ACBA 2BMWA 1VLOA 2QN6A 4OPOA 3BY1A 1I8DA 2NPFA 2BVNA 4P22A 3CC7B 3QE2A 2OTJB 3J81k 3I1FA 1HZEA 2V7UA 4Z1MA 1ZM4A 3ONUA 3V7AA 1CNFA 2X53S 2ZZFA 3SLNA 4Z4TA 3OP1A 4OPVA 3CD6B 4NNJA 3MMPA 4RD0A 5H59A 4P6VF 3PA2A 4ACAA 4P26A 2LZJA 2GPJA 1KC8D 5IYNA 2AHOA 1V5VA 3WQZA 3OZUA 3JQQA 4M1KA 4BPRA 4XN3A 3BQJA 2WJYA 2CK3A 1VHOA 1KK1A 2BSAA 4RDLA 3QFTA 3AVVA 1UD6A 2PE3A 2VJJA 2YWHA 3Q38A 1AMOA 4G1VA 1T6XA 4U9UA 3AVYA 1FX0A 2XZPA 4XN0A 1WOOA 3H9NA 1EWYA 1BQEA 5HZBA 1EP1B 1VQ6B 4XKVA 3D26A 5EMNA 3PUNA 1Q7YD 4LC0A 4YALA 5KSWB 2OK8A 1BX1A 2R6HA 1DDGA 5L46A 2CC2A 1JA0A 1WSVA 4C0SA 3GIRA 4C43A 4OPSA 1F60A 1XE1A 2FVGA 4ZGQB 1W2BB 1TTTA 1R5NA 2EIXA 3WNDA 1NB9A 1W0KA 4B44A 3B78A 5HXBA 2YWGA 1N06A 2C2WA 3GVJA 3QFSA 1QUEA 1ELOA 4OOXA 4MYTA 2GK7A 4B3FX 2R9VA 2JIZA 5DSZA 2CBXA 1IHMA 3OOCA 4EH1A 4LBVA 1EP2B 1W35A 4X05A 4XQFA 4ZCLA 2WYRA 1BMFA 2WR8A 3AVUA 1QFJA 1BPLA 1E79A 4DQLA 5HKKA 1VQ9B 4RM0A 5IYWA 1H42A 4P3YA 2XZLA 1I18A 2YWFA 4DK0A 4DNRB 4B3XA 1B2RA 4G7XA 2C4TA 5KNLA 3P26A 3AGPA 1YJ9B 3CCLB 1JA1A 2GJPA 5F4JA 1QUFA 2XNJA 2C78A 4XR6A 2X85A 1AIPA 4LBWA 3KL9A 2KVOA 1WOSA 1W0JA 3CRZA 4RCYA 1EFRA 1DG1G 4GQNA 4P2NA 4Z4VA 2GJRA 2JN9A 4XLFA 4FN5A 3I56B 2X6WA 4Z4SA 2Q6KA 1KZLA 4B47A 3OW7A 4JMQA 4YELA 5FL7A 4R71A 1Q82D 2WJVA 2WZPP 4XONA 4B3GA 2HCJB 2V7QA 5KW9A 4DK1A 3VO2A 4FWTA 4UZUA 4X0CA 4WZEA 3G71B 1NDHA 5B6IA 1VQ4B 1GAQA 4XORA 1IJFA 1PJ6A 1JB9A 1IB0A 2BGJA 4PABA 1Q86D 4M2LA 1VQ5B 5FO1A 3OZVA 2X6YA 1PKVA 1MABA 1EFTA 2PMDA 5F4MA 3GVLA 1G7RA 3ASQA 3E20A 2BF4A 3WBKA 1VLYA 4TN1A 2BN4A 1YHQB 4P9SA 1W9XA 1WTHD 1QGZA 1XQBA 3W2EA 1VJSA 3CCVB 1Y0RA 4DQKA 3OW2B 3LQEA 1HA3A 1S72B 2VNHA 2ZZQA 4YHBA 3T56B 1K9MD 5FO0A 3U6BA 5IYPA 2JJ1A 2V7XA 3B8HA 4LBZA 1D8TA 3G05A 4XOPA 1KK3A 1H8HA 4AF7A 2QA4B 2D9RA 5TV2A 1GAWA 1S4MA 1EP3B 3VR6A 3DDYA 3I55B 5A8AA 1KQSB 1WOPA 3AGQA 1CQXA 2V7WA 1QGAA 4CQJA 5E6TA 1N08A 1VQPB 3T51B 3OZWA 1PJ5A 1NB0A 3OJWA 2GQFA 3VNVA 1TLLA 3CMEB 3VMFA 4Y9UA 1OGIA 5BSYA 2VNJA 3OKXA 4RCZA 4Z4RA 2OBTA 5BSXA 1FRNA 1PJ7A 4RPBA 2ZZGA 2VYQA 1RQPA 4ZGNB 4YAWA 4H9GA 1VQ8B 3CC2B 4TMTA 1YITB 3WYAA 1SM4A 1QG0A 2Q6OA 2CW5A 1BX0A 3LNNA 4QVAA 1EXMA 2QTLA 2B7CA 1WPCA 2NV4A 1JNYA 3CW2A 4TMVA 5AN9A 2F43A 4YXWA 4B43A 1VQ7B 3R6JA 3LQ6A 4ZCMA 1ZM3A 5J35A 1BLIA 4OOVA 2B5OA 1GO2A 2F1LA 4Z4UA 4G6IA 2DERA 1UD8A 2CF4A 3ZZ0A 3BC9A 2D3NA 5A89A 1K8AD 2PIAA 2ZZEA 1WORA 3GVKA 1T6ZA 1HVXA 3ASRA 3SKBA 1NBMA 4TMXA 1UD4A 1ZUNB 4P25A 3OEHA 3QFCA 4QV2A 4M0LA 4KKSA 4RD6A 1VQLB 4WZTA 1Q9SA 2BV3A 3W2HA 1OGJA 1WU8A 1SKQA 2XOKA 3ASPA 2CRVA 2CNDA 2GJKA 1COWA 1OB0A 1P4MA 1VHEA 1E43A 3NE5B 4UZEA 3ZIAA 1QGYA 4YAFA 5HZAA 4XD7A 3W5UA 4KKTA 1DDIA 2ZL5A 1QFZA 2DETA 1OHHA 1IJEA 3E1YE 3PUMA 3PVDA 2B7BA 1TUIA 4PAAA 4N3NA 1E62A 2XNCA 3CCUB 2V7VA 3FJOA 2XGJA 4Y9RA 1T6YA 4B4DA 3CCRB 1VQMB 3WXMA 2DYIA 3BCFA 1QH0A 1KD1D 2QMUA 2RC5A 3BNWA 3R6KA 1H8EA 1UD2A 3T53B 4AF6A 1S0UA 1N0VC 2X6XA 4PC1A 4LBYA 2YWEA 4ASUA 3A35A 4J0QA 1TVCA 1KJZA 4M4SA 4RD4A 1J9ZA 3CPWB 2I1LA 2QE7A 1WP6A 3U2QA 2WSSA 3SEJA 1H85A 3W5HA 3W5VA 5A88A 2VNKA 3CMAB 2PLFA 4YEJA 3KEWA 2VJIA 5F4OA 3SLDA 4RD1A 5FA6A 1N07A 1NRKA 4X7CA 4ZCIA 2QTZA 1E3XA 2C77A 3U6KA 1W34A 4RPDA 3CCQB 4PGOA 4X7EA 3ZUGA 4L8JA 3MHPA 3ASTA 3Q39A 3CP2A 4M53A 5DN6A 3W2IA 2DY1A 3OAAA 5FIUA 4YAUA 4PC7A 3HAGA 3WNBA 1YX2A 1XB2A 3G4SB 1UD5A 4PC2A 4PC3A 4UZFA 2HMAA 2OBRA 5FNZA 1GR1A 1K73D 4WZLA 1EFCA 4UAJA 1V0EA 1Y0YA 4XKWA 4XL9A 1NJID 2WPDA 4YAOA 1YJNB 4FXUA 3SJPA 1G7CA 3WY9A 1QX4A 3BY2A 1A8PA 4HIZA 3CC4B 4X06A 1VQNB 3CTAA 4ZV4A 4HE5A 2V4DA 5LMZA 1FNMA 4Z4WA 1R5BA 4NBSA 2C4UA 3A8IA 1G7SA 1T5EA 4RJLA 2FX3A 3QSYA 3JU4A 3WNCA 1FDRA 1E3ZA 1BJKA 1N0UA 2VBSA 4G1BA 1YJWB 1KK0A 2OYNA 1SKYB 4F7DA 4FK8A 3ZZTA 4TKOB 5TR9A 1KRHA 3LVBA 3P27A 3BH4A 1RQRA 2VBVA 4P3IA 4PC6A 2ZBUA 5GV7A 1KK2A 2HDNB 2ZL6A 2JJ2A 2M5SA 2WZNA 2ZL7A 3CCJB 5IYQA 2BGIA 2ZXIA 4MYUA 5TY0A 3W2GA 3A1PA 3SJZA 3ISXA 3VO1A 1K28D 4WQMA 5DS0A 2ZTGA 1OB2A 4TSFA 3Q3AA 5J3OA 1UD3A 5IYRA 4XLCA 2OTLB 5JBQA 2V7TA 2XEXA 3A3BA 4WZKA 1VF7A 4II2A 4E0FA 3PENA 2V31A 2GREA 4P12A 4XLHA 5GV8A 1VQOB 1XFOA 2BM1A 4RDKA 3VNUA 1CNEA 4QVJA 3OJXA 3Q6QA 4Z4ZA 2F4NA 2VZLA 4B48A 3LO8A 1W87A 2W6IA 2ZBVA 1DARA 4HE6A 4XLAA 3PA1A 1E63A 1FNBA 1KTVA 2ZITA 3ZBTA 4QHYA 2D3LA 3ZBUA 2DOGA 5CDFA 4X07A 4XNFA 1FNDA 3AVWA 2VNIA 3MCAA 3RY8A 1B23P 1QVGB 1WSRA 1V0FA 3JQRA 3A8KA 1YLOA 1ZM2A 2OK7A 3CCSB 1GJRA 3CB4A 3OFNA 3OPOA 4AC9A 1KMHA 4RDJA 4XOTA 1GVHA 2C5HA 4XLEA 1ZM9A 4G5GA 1FNCA 2D74A 3CMMA 1M90D 3FKSA 2QGGA 3ZPNA 3H94A 4IW3B 1E1QA 2P3MA 1WDTA 3OEEA 3Q6RA 2X3UA 2VBTA 4Y7CA 2DCUA 2BM0A 4II3A 3AVTA 3CXCB 4QUZA 5THXA 2XZOA 1D1NA 2E1RA 4WWVA 3B82A 3GQBA 2XNDA 2W6JA 3V76A 2X0KA 1QFYA 5H5JA 4TMZA 4X8IA 3ES9A 4X7DA 5IK2A 3OE7A 1OB5A 1M1KD 2EFGA 1E64A 4K1XA 2X8KA 1R5OA 2DIEA 3ZZUA 4DNTB 2Q6LA 3A8JA 4Q7JB 1QVFB 3WBJA 1I7PA 3W2FA 1UMKA 2E1BA 2HLDA 3CP8A 3A3GA 3ZC3A 1VQKB 4Z4YA 3GSIA 1D2EA 2JDIA 4G7WA 4OP7A 1U2RA 1YIJB 1F20A 4XMYA 3BCDA 4RLZA 2C5BA 2Z6BD 3AVXA 1MRZA 3ASSA 3CCMB 4TT3A 4P6YA 1E1RA 4KKUA 2Q6IA 3QFRA 1FRQA 3CESA 3FPPA 4XM3A 1N05A 2QEXB 3G6EB 2J7KA 1YI2B 3CPXA 2F1MA 1JJ2B 4X7FA 2BPOA 4P1VA 4OOSA 1G7TA 3CCEB 2OBSA 2RC6A 1Q81D 1N8RD 4N3GA 5TRDA 2DEUA 1EFUA 2GK6A 4TMWA 2QDXA 4QFMA 2VBUA 2ZXHA 4RD2A 2ZTNA 4RD3A 3ONYA
chains in the Genus database with same CATH topology
4NCNA 3JQPA 3FPKA 4ACBA 2BMWA 2QN6A 2NPFA 2BVNA 3CC7B 3QE2A 2OTJB 3J81k 3I1FA 1ZM4A 1CNFA 3CD6B 4RD0A 3MMPA 5H59A 4P6VF 4ACAA 2GPJA 1KC8D 2AHOA 3OZUA 3JQQA 4M1KA 4BPRA 1KK1A 2BSAA 3QFTA 3AVVA 2YWHA 1AMOA 4G1VA 4U9UA 3AVYA 1EWYA 1BQEA 1VQ6B 1EP1B 5EMNA 1Q7YD 4LC0A 4YALA 5KSWB 2OK8A 1BX1A 2R6HA 1DDGA 1JA0A 4C0SA 4C43A 1F60A 1XE1A 4ZGQB 1TTTA 1W2BB 1R5NA 2EIXA 3WNDA 4B44A 3B78A 5HXBA 2YWGA 3QFSA 1QUEA 1ELOA 4MYTA 5DSZA 4EH1A 4LBVA 1EP2B 1W35A 4ZCLA 3AVUA 1QFJA 4DQLA 1VQ9B 1H42A 4P3YA 2YWFA 4B3XA 1B2RA 3P26A 3AGPA 1YJ9B 3CCLB 1JA1A 1QUFA 2XNJA 2C78A 1AIPA 4LBWA 3CRZA 4RCYA 1DG1G 4FN5A 3I56B 4B47A 4R71A 1Q82D 2HCJB 3VO2A 4FWTA 3G71B 1NDHA 1VQ4B 1GAQA 1IJFA 1JB9A 1IB0A 2BGJA 1Q86D 4M2LA 1VQ5B 3OZVA 2PMDA 1EFTA 1G7RA 3E20A 2BF4A 3WBKA 4TN1A 2BN4A 1YHQB 1QGZA 3W2EA 3CCVB 4DQKA 3OW2B 1HA3A 1S72B 2VNHA 4YHBA 1K9MD 3U6BA 3B8HA 2QA4B 4LBZA 1D8TA 1KK3A 4AF7A 5TV2A 1GAWA 1EP3B 3I55B 1KQSB 3AGQA 1CQXA 1QGAA 1VQPB 3OZWA 3OJWA 2GQFA 3VNVA 1TLLA 3CMEB 3VMFA 4Y9UA 1OGIA 2VNJA 4RCZA 1FRNA 2VYQA 4ZGNB 4YAWA 4H9GA 1VQ8B 3CC2B 4TMTA 1YITB 3WYAA 1SM4A 1QG0A 1BX0A 1EXMA 2QTLA 2B7CA 3CW2A 1JNYA 4TMVA 1VQ7B 5AN9A 4B43A 4ZCMA 1ZM3A 2B5OA 1GO2A 2DERA 3ZZ0A 1K8AD 2PIAA 4TMXA 1ZUNB 3QFCA 4M0LA 4RD6A 1VQLB 2BV3A 3W2HA 1OGJA 1SKQA 2CRVA 2CNDA 1QGYA 4YAFA 3W5UA 1DDIA 1QFZA 2DETA 3E1YE 1IJEA 2B7BA 1TUIA 4N3NA 1E62A 2XNCA 3CCUB 3FJOA 4Y9RA 4B4DA 3CCRB 1VQMB 3WXMA 1QH0A 1KD1D 2QMUA 2RC5A 4AF6A 1S0UA 1N0VC 4PC1A 4LBYA 2YWEA 3CPWB 4J0QA 1TVCA 1KJZA 4M4SA 4RD4A 1J9ZA 3U2QA 3W5HA 1H85A 3W5VA 2VNKA 3CMAB 2PLFA 4RD1A 5FA6A 4ZCIA 2QTZA 2C77A 3U6KA 1W34A 3CCQB 4PGOA 3MHPA 4M53A 3W2IA 2DY1A 4YAUA 4PC7A 3WNBA 3G4SB 1XB2A 4PC2A 4PC3A 2HMAA 1GR1A 1K73D 1EFCA 4UAJA 1NJID 4YAOA 1YJNB 1G7CA 3WY9A 1QX4A 1A8PA 3CC4B 1VQNB 4ZV4A 4HE5A 1FNMA 1R5BA 4NBSA 1G7SA 4RJLA 2FX3A 3QSYA 3WNCA 1FDRA 1BJKA 1N0UA 4G1BA 1YJWB 1KK0A 4F7DA 4FK8A 3ZZTA 5TR9A 1KRHA 3LVBA 3P27A 4PC6A 5GV7A 1KK2A 2HDNB 3CCJB 2BGIA 4MYUA 5TY0A 3W2GA 3SJZA 3VO1A 4WQMA 1OB2A 2OTLB 5JBQA 2XEXA 3PENA 5GV8A 1VQOB 3VNUA 2BM1A 1CNEA 3OJXA 2VZLA 4B48A 3LO8A 1W87A 4HE6A 1DARA 1E63A 1FNBA 1KTVA 2ZITA 3ZBTA 4QHYA 3ZBUA 1FNDA 3AVWA 2VNIA 3MCAA 1B23P 1QVGB 3JQRA 1ZM2A 2OK7A 3CCSB 1GJRA 3CB4A 4AC9A 1GVHA 1ZM9A 4G5GA 1FNCA 2D74A 1M90D 4IW3B 1WDTA 2X3UA 4Y7CA 2DCUA 2BM0A 3AVTA 3CXCB 5THXA 1D1NA 2E1RA 3B82A 3V76A 1QFYA 5H5JA 4TMZA 3ES9A 1OB5A 1M1KD 2EFGA 1E64A 4K1XA 1R5OA 3ZZUA 4Q7JB 1QVFB 3WBJA 1I7PA 3W2FA 1UMKA 3ZC3A 1VQKB 1D2EA 1YIJB 1U2RA 1F20A 3AVXA 3CCMB 3QFRA 1FRQA 2QEXB 3G6EB 2J7KA 1YI2B 1JJ2B 2BPOA 1G7TA 3CCEB 2RC6A 1N8RD 1Q81D 4N3GA 2DEUA 1EFUA 4TMWA 2QDXA 4QFMA 4RD2A 4RD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCN A;  3JQP A;  3FPK A;  4ACB A;  2BMW A;  2QN6 A;  2NPF A;  2BVN A;  3CC7 B;  3QE2 A;  2OTJ B;  3J81 k;  3I1F A;  1ZM4 A;  1CNF A;  3CD6 B;  4RD0 A;  3MMP A;  5H59 A;  4P6V F;  4ACA A;  2GPJ A;  1KC8 D;  2AHO A;  3OZU A;  3JQQ A;  4M1K A;  4BPR A;  1KK1 A;  2BSA A;  3QFT A;  3AVV A;  2YWH A;  1AMO A;  4G1V A;  4U9U A;  3AVY A;  1EWY A;  1BQE A;  1VQ6 B;  1EP1 B;  5EMN A;  1Q7Y D;  4LC0 A;  4YAL A;  5KSW B;  2OK8 A;  1BX1 A;  2R6H A;  1DDG A;  1JA0 A;  4C0S A;  4C43 A;  1F60 A;  1XE1 A;  4ZGQ B;  1TTT A;  1W2B B;  1R5N A;  2EIX A;  3WND A;  4B44 A;  3B78 A;  5HXB A;  2YWG A;  3QFS A;  1QUE A;  1ELO A;  4MYT A;  5DSZ A;  4EH1 A;  4LBV A;  1EP2 B;  1W35 A;  4ZCL A;  3AVU A;  1QFJ A;  4DQL A;  1VQ9 B;  1H42 A;  4P3Y A;  2YWF A;  4B3X A;  1B2R A;  3P26 A;  3AGP A;  1YJ9 B;  3CCL B;  1JA1 A;  1QUF A;  2XNJ A;  2C78 A;  1AIP A;  4LBW A;  3CRZ A;  4RCY A;  1DG1 G;  4FN5 A;  3I56 B;  4B47 A;  4R71 A;  1Q82 D;  2HCJ B;  3VO2 A;  4FWT A;  3G71 B;  1NDH A;  1VQ4 B;  1GAQ A;  1IJF A;  1JB9 A;  1IB0 A;  2BGJ A;  1Q86 D;  4M2L A;  1VQ5 B;  3OZV A;  2PMD A;  1EFT A;  1G7R A;  3E20 A;  2BF4 A;  3WBK A;  4TN1 A;  2BN4 A;  1YHQ B;  1QGZ A;  3W2E A;  3CCV B;  4DQK A;  3OW2 B;  1HA3 A;  1S72 B;  2VNH A;  4YHB A;  1K9M D;  3U6B A;  3B8H A;  2QA4 B;  4LBZ A;  1D8T A;  1KK3 A;  4AF7 A;  5TV2 A;  1GAW A;  1EP3 B;  3I55 B;  1KQS B;  3AGQ A;  1CQX A;  1QGA A;  1VQP B;  3OZW A;  3OJW A;  2GQF A;  3VNV A;  1TLL A;  3CME B;  3VMF A;  4Y9U A;  1OGI A;  2VNJ A;  4RCZ A;  1FRN A;  2VYQ A;  4ZGN B;  4YAW A;  4H9G A;  1VQ8 B;  3CC2 B;  4TMT A;  1YIT B;  3WYA A;  1SM4 A;  1QG0 A;  1BX0 A;  1EXM A;  2QTL A;  2B7C A;  3CW2 A;  1JNY A;  4TMV A;  1VQ7 B;  5AN9 A;  4B43 A;  4ZCM A;  1ZM3 A;  2B5O A;  1GO2 A;  2DER A;  3ZZ0 A;  1K8A D;  2PIA A;  4TMX A;  1ZUN B;  3QFC A;  4M0L A;  4RD6 A;  1VQL B;  2BV3 A;  3W2H A;  1OGJ A;  1SKQ A;  2CRV A;  2CND A;  1QGY A;  4YAF A;  3W5U A;  1DDI A;  1QFZ A;  2DET A;  3E1Y E;  1IJE A;  2B7B A;  1TUI A;  4N3N A;  1E62 A;  2XNC A;  3CCU B;  3FJO A;  4Y9R A;  4B4D A;  3CCR B;  1VQM B;  3WXM A;  1QH0 A;  1KD1 D;  2QMU A;  2RC5 A;  4AF6 A;  1S0U A;  1N0V C;  4PC1 A;  4LBY A;  2YWE A;  3CPW B;  4J0Q A;  1TVC A;  1KJZ A;  4M4S A;  4RD4 A;  1J9Z A;  3U2Q A;  3W5H A;  1H85 A;  3W5V A;  2VNK A;  3CMA B;  2PLF A;  4RD1 A;  5FA6 A;  4ZCI A;  2QTZ A;  2C77 A;  3U6K A;  1W34 A;  3CCQ B;  4PGO A;  3MHP A;  4M53 A;  3W2I A;  2DY1 A;  4YAU A;  4PC7 A;  3WNB A;  3G4S B;  1XB2 A;  4PC2 A;  4PC3 A;  2HMA A;  1GR1 A;  1K73 D;  1EFC A;  4UAJ A;  1NJI D;  4YAO A;  1YJN B;  1G7C A;  3WY9 A;  1QX4 A;  1A8P A;  3CC4 B;  1VQN B;  4ZV4 A;  4HE5 A;  1FNM A;  1R5B A;  4NBS A;  1G7S A;  4RJL A;  2FX3 A;  3QSY A;  3WNC A;  1FDR A;  1BJK A;  1N0U A;  4G1B A;  1YJW B;  1KK0 A;  4F7D A;  4FK8 A;  3ZZT A;  5TR9 A;  1KRH A;  3LVB A;  3P27 A;  4PC6 A;  5GV7 A;  1KK2 A;  2HDN B;  3CCJ B;  2BGI A;  4MYU A;  5TY0 A;  3W2G A;  3SJZ A;  3VO1 A;  4WQM A;  1OB2 A;  2OTL B;  5JBQ A;  2XEX A;  3PEN A;  5GV8 A;  1VQO B;  3VNU A;  2BM1 A;  1CNE A;  3OJX A;  2VZL A;  4B48 A;  3LO8 A;  1W87 A;  4HE6 A;  1DAR A;  1E63 A;  1FNB A;  1KTV A;  2ZIT A;  3ZBT A;  4QHY A;  3ZBU A;  1FND A;  3AVW A;  2VNI A;  3MCA A;  1B23 P;  1QVG B;  3JQR A;  1ZM2 A;  2OK7 A;  3CCS B;  1GJR A;  3CB4 A;  4AC9 A;  1GVH A;  1ZM9 A;  4G5G A;  1FNC A;  2D74 A;  1M90 D;  4IW3 B;  1WDT A;  2X3U A;  4Y7C A;  2DCU A;  2BM0 A;  3AVT A;  3CXC B;  5THX A;  1D1N A;  2E1R A;  3B82 A;  3V76 A;  1QFY A;  5H5J A;  4TMZ A;  3ES9 A;  1OB5 A;  1M1K D;  2EFG A;  1E64 A;  4K1X A;  1R5O A;  3ZZU A;  4Q7J B;  1QVF B;  3WBJ A;  1I7P A;  3W2F A;  1UMK A;  3ZC3 A;  1VQK B;  1D2E A;  1YIJ B;  1U2R A;  1F20 A;  3AVX A;  3CCM B;  3QFR A;  1FRQ A;  2QEX B;  3G6E B;  2J7K A;  1YI2 B;  1JJ2 B;  2BPO A;  1G7T A;  3CCE B;  2RC6 A;  1N8R D;  1Q81 D;  4N3G A;  2DEU A;  1EFU A;  4TMW A;  2QDX A;  4QFM A;  4RD2 A;  4RD3 A; 
#chains in the Genus database with same CATH topology
 4NCN A;  3JQP A;  3FPK A;  4AVZ A;  4ROX A;  4ACB A;  2BMW A;  1VLO A;  2QN6 A;  4OPO A;  3BY1 A;  1I8D A;  2NPF A;  2BVN A;  4P22 A;  3CC7 B;  3QE2 A;  2OTJ B;  3J81 k;  3I1F A;  1HZE A;  2V7U A;  4Z1M A;  1ZM4 A;  3ONU A;  3V7A A;  1CNF A;  2X53 S;  2ZZF A;  3SLN A;  4Z4T A;  3OP1 A;  4OPV A;  3CD6 B;  4NNJ A;  3MMP A;  4RD0 A;  5H59 A;  4P6V F;  3PA2 A;  4ACA A;  4P26 A;  2LZJ A;  2GPJ A;  1KC8 D;  5IYN A;  2AHO A;  1V5V A;  3WQZ A;  3OZU A;  3JQQ A;  4M1K A;  4BPR A;  4XN3 A;  3BQJ A;  2WJY A;  2CK3 A;  1VHO A;  1KK1 A;  2BSA A;  4RDL A;  3QFT A;  3AVV A;  1UD6 A;  2PE3 A;  2VJJ A;  2YWH A;  3Q38 A;  1AMO A;  4G1V A;  1T6X A;  4U9U A;  3AVY A;  1FX0 A;  2XZP A;  4XN0 A;  1WOO A;  3H9N A;  1EWY A;  1BQE A;  5HZB A;  1EP1 B;  1VQ6 B;  4XKV A;  3D26 A;  5EMN A;  3PUN A;  1Q7Y D;  4LC0 A;  4YAL A;  5KSW B;  2OK8 A;  1BX1 A;  2R6H A;  1DDG A;  5L46 A;  2CC2 A;  1JA0 A;  1WSV A;  4C0S A;  3GIR A;  4C43 A;  4OPS A;  1F60 A;  1XE1 A;  2FVG A;  4ZGQ B;  1W2B B;  1TTT A;  1R5N A;  2EIX A;  3WND A;  1NB9 A;  1W0K A;  4B44 A;  3B78 A;  5HXB A;  2YWG A;  1N06 A;  2C2W A;  3GVJ A;  3QFS A;  1QUE A;  1ELO A;  4OOX A;  4MYT A;  2GK7 A;  4B3F X;  2R9V A;  2JIZ A;  5DSZ A;  2CBX A;  1IHM A;  3OOC A;  4EH1 A;  4LBV A;  1EP2 B;  1W35 A;  4X05 A;  4XQF A;  4ZCL A;  2WYR A;  1BMF A;  2WR8 A;  3AVU A;  1QFJ A;  1BPL A;  1E79 A;  4DQL A;  5HKK A;  1VQ9 B;  4RM0 A;  5IYW A;  1H42 A;  4P3Y A;  2XZL A;  1I18 A;  2YWF A;  4DK0 A;  4DNR B;  4B3X A;  1B2R A;  4G7X A;  2C4T A;  5KNL A;  3P26 A;  3AGP A;  1YJ9 B;  3CCL B;  1JA1 A;  2GJP A;  5F4J A;  1QUF A;  2XNJ A;  2C78 A;  4XR6 A;  2X85 A;  1AIP A;  4LBW A;  3KL9 A;  2KVO A;  1WOS A;  1W0J A;  3CRZ A;  4RCY A;  1EFR A;  1DG1 G;  4GQN A;  4P2N A;  4Z4V A;  2GJR A;  2JN9 A;  4XLF A;  4FN5 A;  3I56 B;  2X6W A;  4Z4S A;  2Q6K A;  1KZL A;  4B47 A;  3OW7 A;  4JMQ A;  4YEL A;  5FL7 A;  4R71 A;  1Q82 D;  2WJV A;  2WZP P;  4XON A;  4B3G A;  2HCJ B;  2V7Q A;  5KW9 A;  4DK1 A;  3VO2 A;  4FWT A;  4UZU A;  4X0C A;  4WZE A;  3G71 B;  1NDH A;  5B6I A;  1VQ4 B;  1GAQ A;  4XOR A;  1IJF A;  1PJ6 A;  1JB9 A;  1IB0 A;  2BGJ A;  4PAB A;  1Q86 D;  4M2L A;  1VQ5 B;  5FO1 A;  3OZV A;  2X6Y A;  1PKV A;  1MAB A;  1EFT A;  2PMD A;  5F4M A;  3GVL A;  1G7R A;  3ASQ A;  3E20 A;  2BF4 A;  3WBK A;  1VLY A;  4TN1 A;  2BN4 A;  1YHQ B;  4P9S A;  1W9X A;  1WTH D;  1QGZ A;  1XQB A;  3W2E A;  1VJS A;  3CCV B;  1Y0R A;  4DQK A;  3OW2 B;  3LQE A;  1HA3 A;  1S72 B;  2VNH A;  2ZZQ A;  4YHB A;  3T56 B;  1K9M D;  5FO0 A;  3U6B A;  5IYP A;  2JJ1 A;  2V7X A;  3B8H A;  4LBZ A;  1D8T A;  3G05 A;  4XOP A;  1KK3 A;  1H8H A;  4AF7 A;  2QA4 B;  2D9R A;  5TV2 A;  1GAW A;  1S4M A;  1EP3 B;  3VR6 A;  3DDY A;  3I55 B;  5A8A A;  1KQS B;  1WOP A;  3AGQ A;  1CQX A;  2V7W A;  1QGA A;  4CQJ A;  5E6T A;  1N08 A;  1VQP B;  3T51 B;  3OZW A;  1PJ5 A;  1NB0 A;  3OJW A;  2GQF A;  3VNV A;  1TLL A;  3CME B;  3VMF A;  4Y9U A;  1OGI A;  5BSY A;  2VNJ A;  3OKX A;  4RCZ A;  4Z4R A;  2OBT A;  5BSX A;  1FRN A;  1PJ7 A;  4RPB A;  2ZZG A;  2VYQ A;  1RQP A;  4ZGN B;  4YAW A;  4H9G A;  1VQ8 B;  3CC2 B;  4TMT A;  1YIT B;  3WYA A;  1SM4 A;  1QG0 A;  2Q6O A;  2CW5 A;  1BX0 A;  3LNN A;  4QVA A;  1EXM A;  2QTL A;  2B7C A;  1WPC A;  2NV4 A;  1JNY A;  3CW2 A;  4TMV A;  5AN9 A;  2F43 A;  4YXW A;  4B43 A;  1VQ7 B;  3R6J A;  3LQ6 A;  4ZCM A;  1ZM3 A;  5J35 A;  1BLI A;  4OOV A;  2B5O A;  1GO2 A;  2F1L A;  4Z4U A;  4G6I A;  2DER A;  1UD8 A;  2CF4 A;  3ZZ0 A;  3BC9 A;  2D3N A;  5A89 A;  1K8A D;  2PIA A;  2ZZE A;  1WOR A;  3GVK A;  1T6Z A;  1HVX A;  3ASR A;  3SKB A;  1NBM A;  4TMX A;  1UD4 A;  1ZUN B;  4P25 A;  3OEH A;  3QFC A;  4QV2 A;  4M0L A;  4KKS A;  4RD6 A;  1VQL B;  4WZT A;  1Q9S A;  2BV3 A;  3W2H A;  1OGJ A;  1WU8 A;  1SKQ A;  2XOK A;  3ASP A;  2CRV A;  2CND A;  2GJK A;  1COW A;  1OB0 A;  1P4M A;  1VHE A;  1E43 A;  3NE5 B;  4UZE A;  3ZIA A;  1QGY A;  4YAF A;  5HZA A;  4XD7 A;  3W5U A;  4KKT A;  1DDI A;  2ZL5 A;  1QFZ A;  2DET A;  1OHH A;  1IJE A;  3E1Y E;  3PUM A;  3PVD A;  2B7B A;  1TUI A;  4PAA A;  4N3N A;  1E62 A;  2XNC A;  3CCU B;  2V7V A;  3FJO A;  2XGJ A;  4Y9R A;  1T6Y A;  4B4D A;  3CCR B;  1VQM B;  3WXM A;  2DYI A;  3BCF A;  1QH0 A;  1KD1 D;  2QMU A;  2RC5 A;  3BNW A;  3R6K A;  1H8E A;  1UD2 A;  3T53 B;  4AF6 A;  1S0U A;  1N0V C;  2X6X A;  4PC1 A;  4LBY A;  2YWE A;  4ASU A;  3A35 A;  4J0Q A;  1TVC A;  1KJZ A;  4M4S A;  4RD4 A;  1J9Z A;  3CPW B;  2I1L A;  2QE7 A;  1WP6 A;  3U2Q A;  2WSS A;  3SEJ A;  1H85 A;  3W5H A;  3W5V A;  5A88 A;  2VNK A;  3CMA B;  2PLF A;  4YEJ A;  3KEW A;  2VJI A;  5F4O A;  3SLD A;  4RD1 A;  5FA6 A;  1N07 A;  1NRK A;  4X7C A;  4ZCI A;  2QTZ A;  1E3X A;  2C77 A;  3U6K A;  1W34 A;  4RPD A;  3CCQ B;  4PGO A;  4X7E A;  3ZUG A;  4L8J A;  3MHP A;  3AST A;  3Q39 A;  3CP2 A;  4M53 A;  5DN6 A;  3W2I A;  2DY1 A;  3OAA A;  5FIU A;  4YAU A;  4PC7 A;  3HAG A;  3WNB A;  1YX2 A;  1XB2 A;  3G4S B;  1UD5 A;  4PC2 A;  4PC3 A;  4UZF A;  2HMA A;  2OBR A;  5FNZ A;  1GR1 A;  1K73 D;  4WZL A;  1EFC A;  4UAJ A;  1V0E A;  1Y0Y A;  4XKW A;  4XL9 A;  1NJI D;  2WPD A;  4YAO A;  1YJN B;  4FXU A;  3SJP A;  1G7C A;  3WY9 A;  1QX4 A;  3BY2 A;  1A8P A;  4HIZ A;  3CC4 B;  4X06 A;  1VQN B;  3CTA A;  4ZV4 A;  4HE5 A;  2V4D A;  5LMZ A;  1FNM A;  4Z4W A;  1R5B A;  4NBS A;  2C4U A;  3A8I A;  1G7S A;  1T5E A;  4RJL A;  2FX3 A;  3QSY A;  3JU4 A;  3WNC A;  1FDR A;  1E3Z A;  1BJK A;  1N0U A;  2VBS A;  4G1B A;  1YJW B;  1KK0 A;  2OYN A;  1SKY B;  4F7D A;  4FK8 A;  3ZZT A;  4TKO B;  5TR9 A;  1KRH A;  3LVB A;  3P27 A;  3BH4 A;  1RQR A;  2VBV A;  4P3I A;  4PC6 A;  2ZBU A;  5GV7 A;  1KK2 A;  2HDN B;  2ZL6 A;  2JJ2 A;  2M5S A;  2WZN A;  2ZL7 A;  3CCJ B;  5IYQ A;  2BGI A;  2ZXI A;  4MYU A;  5TY0 A;  3W2G A;  3A1P A;  3SJZ A;  3ISX A;  3VO1 A;  1K28 D;  4WQM A;  5DS0 A;  2ZTG A;  1OB2 A;  4TSF A;  3Q3A A;  5J3O A;  1UD3 A;  5IYR A;  4XLC A;  2OTL B;  5JBQ A;  2V7T A;  2XEX A;  3A3B A;  4WZK A;  1VF7 A;  4II2 A;  4E0F A;  3PEN A;  2V31 A;  2GRE A;  4P12 A;  4XLH A;  5GV8 A;  1VQO B;  1XFO A;  2BM1 A;  4RDK A;  3VNU A;  1CNE A;  4QVJ A;  3OJX A;  3Q6Q A;  4Z4Z A;  2F4N A;  2VZL A;  4B48 A;  3LO8 A;  1W87 A;  2W6I A;  2ZBV A;  1DAR A;  4HE6 A;  4XLA A;  3PA1 A;  1E63 A;  1FNB A;  1KTV A;  2ZIT A;  3ZBT A;  4QHY A;  2D3L A;  3ZBU A;  2DOG A;  5CDF A;  4X07 A;  4XNF A;  1FND A;  3AVW A;  2VNI A;  3MCA A;  3RY8 A;  1B23 P;  1QVG B;  1WSR A;  1V0F A;  3JQR A;  3A8K A;  1YLO A;  1ZM2 A;  2OK7 A;  3CCS B;  1GJR A;  3CB4 A;  3OFN A;  3OPO A;  4AC9 A;  1KMH A;  4RDJ A;  4XOT A;  1GVH A;  2C5H A;  4XLE A;  1ZM9 A;  4G5G A;  1FNC A;  2D74 A;  3CMM A;  1M90 D;  3FKS A;  2QGG A;  3ZPN A;  3H94 A;  4IW3 B;  1E1Q A;  2P3M A;  1WDT A;  3OEE A;  3Q6R A;  2X3U A;  2VBT A;  4Y7C A;  2DCU A;  2BM0 A;  4II3 A;  3AVT A;  3CXC B;  4QUZ A;  5THX A;  2XZO A;  1D1N A;  2E1R A;  4WWV A;  3B82 A;  3GQB A;  2XND A;  2W6J A;  3V76 A;  2X0K A;  1QFY A;  5H5J A;  4TMZ A;  4X8I A;  3ES9 A;  4X7D A;  5IK2 A;  3OE7 A;  1OB5 A;  1M1K D;  2EFG A;  1E64 A;  4K1X A;  2X8K A;  1R5O A;  2DIE A;  3ZZU A;  4DNT B;  2Q6L A;  3A8J A;  4Q7J B;  1QVF B;  3WBJ A;  1I7P A;  3W2F A;  1UMK A;  2E1B A;  2HLD A;  3CP8 A;  3A3G A;  3ZC3 A;  1VQK B;  4Z4Y A;  3GSI A;  1D2E A;  2JDI A;  4G7W A;  4OP7 A;  1U2R A;  1YIJ B;  1F20 A;  4XMY A;  3BCD A;  4RLZ A;  2C5B A;  2Z6B D;  3AVX A;  1MRZ A;  3ASS A;  3CCM B;  4TT3 A;  4P6Y A;  1E1R A;  4KKU A;  2Q6I A;  3QFR A;  1FRQ A;  3CES A;  3FPP A;  4XM3 A;  1N05 A;  2QEX B;  3G6E B;  2J7K A;  1YI2 B;  3CPX A;  2F1M A;  1JJ2 B;  4X7F A;  2BPO A;  4P1V A;  4OOS A;  1G7T A;  3CCE B;  2OBS A;  2RC6 A;  1Q81 D;  1N8R D;  4N3G A;  5TRD A;  2DEU A;  1EFU A;  2GK6 A;  4TMW A;  2QDX A;  4QFM A;  2VBU A;  2ZXH A;  4RD2 A;  2ZTN A;  4RD3 A;  3ONY A; 
#chains in the Genus database with same CATH homology
 4NCN A;  3JQP A;  3FPK A;  4ACB A;  2BMW A;  2QN6 A;  2NPF A;  2BVN A;  3CC7 B;  3QE2 A;  2OTJ B;  3J81 k;  3I1F A;  1ZM4 A;  1CNF A;  3CD6 B;  4RD0 A;  3MMP A;  5H59 A;  4P6V F;  4ACA A;  2GPJ A;  1KC8 D;  2AHO A;  3OZU A;  3JQQ A;  4M1K A;  4BPR A;  1KK1 A;  2BSA A;  3QFT A;  3AVV A;  2YWH A;  1AMO A;  4G1V A;  4U9U A;  3AVY A;  1EWY A;  1BQE A;  1VQ6 B;  1EP1 B;  5EMN A;  1Q7Y D;  4LC0 A;  4YAL A;  5KSW B;  2OK8 A;  1BX1 A;  2R6H A;  1DDG A;  1JA0 A;  4C0S A;  4C43 A;  1F60 A;  1XE1 A;  4ZGQ B;  1TTT A;  1W2B B;  1R5N A;  2EIX A;  3WND A;  4B44 A;  3B78 A;  5HXB A;  2YWG A;  3QFS A;  1QUE A;  1ELO A;  4MYT A;  5DSZ A;  4EH1 A;  4LBV A;  1EP2 B;  1W35 A;  4ZCL A;  3AVU A;  1QFJ A;  4DQL A;  1VQ9 B;  1H42 A;  4P3Y A;  2YWF A;  4B3X A;  1B2R A;  3P26 A;  3AGP A;  1YJ9 B;  3CCL B;  1JA1 A;  1QUF A;  2XNJ A;  2C78 A;  1AIP A;  4LBW A;  3CRZ A;  4RCY A;  1DG1 G;  4FN5 A;  3I56 B;  4B47 A;  4R71 A;  1Q82 D;  2HCJ B;  3VO2 A;  4FWT A;  3G71 B;  1NDH A;  1VQ4 B;  1GAQ A;  1IJF A;  1JB9 A;  1IB0 A;  2BGJ A;  1Q86 D;  4M2L A;  1VQ5 B;  3OZV A;  2PMD A;  1EFT A;  1G7R A;  3E20 A;  2BF4 A;  3WBK A;  4TN1 A;  2BN4 A;  1YHQ B;  1QGZ A;  3W2E A;  3CCV B;  4DQK A;  3OW2 B;  1HA3 A;  1S72 B;  2VNH A;  4YHB A;  1K9M D;  3U6B A;  3B8H A;  2QA4 B;  4LBZ A;  1D8T A;  1KK3 A;  4AF7 A;  5TV2 A;  1GAW A;  1EP3 B;  3I55 B;  1KQS B;  3AGQ A;  1CQX A;  1QGA A;  1VQP B;  3OZW A;  3OJW A;  2GQF A;  3VNV A;  1TLL A;  3CME B;  3VMF A;  4Y9U A;  1OGI A;  2VNJ A;  4RCZ A;  1FRN A;  2VYQ A;  4ZGN B;  4YAW A;  4H9G A;  1VQ8 B;  3CC2 B;  4TMT A;  1YIT B;  3WYA A;  1SM4 A;  1QG0 A;  1BX0 A;  1EXM A;  2QTL A;  2B7C A;  3CW2 A;  1JNY A;  4TMV A;  1VQ7 B;  5AN9 A;  4B43 A;  4ZCM A;  1ZM3 A;  2B5O A;  1GO2 A;  2DER A;  3ZZ0 A;  1K8A D;  2PIA A;  4TMX A;  1ZUN B;  3QFC A;  4M0L A;  4RD6 A;  1VQL B;  2BV3 A;  3W2H A;  1OGJ A;  1SKQ A;  2CRV A;  2CND A;  1QGY A;  4YAF A;  3W5U A;  1DDI A;  1QFZ A;  2DET A;  3E1Y E;  1IJE A;  2B7B A;  1TUI A;  4N3N A;  1E62 A;  2XNC A;  3CCU B;  3FJO A;  4Y9R A;  4B4D A;  3CCR B;  1VQM B;  3WXM A;  1QH0 A;  1KD1 D;  2QMU A;  2RC5 A;  4AF6 A;  1S0U A;  1N0V C;  4PC1 A;  4LBY A;  2YWE A;  3CPW B;  4J0Q A;  1TVC A;  1KJZ A;  4M4S A;  4RD4 A;  1J9Z A;  3U2Q A;  3W5H A;  1H85 A;  3W5V A;  2VNK A;  3CMA B;  2PLF A;  4RD1 A;  5FA6 A;  4ZCI A;  2QTZ A;  2C77 A;  3U6K A;  1W34 A;  3CCQ B;  4PGO A;  3MHP A;  4M53 A;  3W2I A;  2DY1 A;  4YAU A;  4PC7 A;  3WNB A;  3G4S B;  1XB2 A;  4PC2 A;  4PC3 A;  2HMA A;  1GR1 A;  1K73 D;  1EFC A;  4UAJ A;  1NJI D;  4YAO A;  1YJN B;  1G7C A;  3WY9 A;  1QX4 A;  1A8P A;  3CC4 B;  1VQN B;  4ZV4 A;  4HE5 A;  1FNM A;  1R5B A;  4NBS A;  1G7S A;  4RJL A;  2FX3 A;  3QSY A;  3WNC A;  1FDR A;  1BJK A;  1N0U A;  4G1B A;  1YJW B;  1KK0 A;  4F7D A;  4FK8 A;  3ZZT A;  5TR9 A;  1KRH A;  3LVB A;  3P27 A;  4PC6 A;  5GV7 A;  1KK2 A;  2HDN B;  3CCJ B;  2BGI A;  4MYU A;  5TY0 A;  3W2G A;  3SJZ A;  3VO1 A;  4WQM A;  1OB2 A;  2OTL B;  5JBQ A;  2XEX A;  3PEN A;  5GV8 A;  1VQO B;  3VNU A;  2BM1 A;  1CNE A;  3OJX A;  2VZL A;  4B48 A;  3LO8 A;  1W87 A;  4HE6 A;  1DAR A;  1E63 A;  1FNB A;  1KTV A;  2ZIT A;  3ZBT A;  4QHY A;  3ZBU A;  1FND A;  3AVW A;  2VNI A;  3MCA A;  1B23 P;  1QVG B;  3JQR A;  1ZM2 A;  2OK7 A;  3CCS B;  1GJR A;  3CB4 A;  4AC9 A;  1GVH A;  1ZM9 A;  4G5G A;  1FNC A;  2D74 A;  1M90 D;  4IW3 B;  1WDT A;  2X3U A;  4Y7C A;  2DCU A;  2BM0 A;  3AVT A;  3CXC B;  5THX A;  1D1N A;  2E1R A;  3B82 A;  3V76 A;  1QFY A;  5H5J A;  4TMZ A;  3ES9 A;  1OB5 A;  1M1K D;  2EFG A;  1E64 A;  4K1X A;  1R5O A;  3ZZU A;  4Q7J B;  1QVF B;  3WBJ A;  1I7P A;  3W2F A;  1UMK A;  3ZC3 A;  1VQK B;  1D2E A;  1YIJ B;  1U2R A;  1F20 A;  3AVX A;  3CCM B;  3QFR A;  1FRQ A;  2QEX B;  3G6E B;  2J7K A;  1YI2 B;  1JJ2 B;  2BPO A;  1G7T A;  3CCE B;  2RC6 A;  1N8R D;  1Q81 D;  4N3G A;  2DEU A;  1EFU A;  4TMW A;  2QDX A;  4QFM A;  4RD2 A;  4RD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...