3E1YE

Crystal structure of human erf1/erf3 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
195
structure length
195
Chain Sequence
IRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor subunit 1
total genus 27
structure length 195
sequence length 195
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
E PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE01
4RD3A 4G1VA 3B8HA 1VQ4B 2E1RA 1CQXA 3W2EA 1A8PA 1EWYA 1EP3B 1FDRA 1VQKB 2DEUA 2HCJB 4LBWA 4DQLA 4RD4A 1VQNB 1QUFA 2VNJA 3LO8A 4TMWA 1EFTA 2ZITA 5GV8A 1ZM4A 1YHQB 4FWTA 3V76A 1JNYA 3U6KA 4ZGQB 2B7CA 1ZM3A 3OZVA 4LBVA 1JA1A 2C78A 1SM4A 4RD0A 2VNHA 3W2IA 2NPFA 2YWHA 3JQRA 3PENA 1D2EA 1IB0A 1YIJB 2XEXA 2BPOA 3CCRB 1D8TA 1SKQA 4Y9UA 1ZM9A 4HE6A 3CPWB 3I1FA 1ZM2A 1Q7YD 3WY9A 1NJID 3U2QA 4ACAA 4C0SA 2J7KA 4AF6A 1CNEA 4WQMA 2DCUA 2YWFA 2R6HA 1E62A 4G1BA 1K73D 2OTLB 3JQQA 1QG0A 2EIXA 1KC8D 4NCNA 3QE2A 1Q82D 1B2RA 4N3NA 3OJWA 4M4SA 3W5VA 3E20A 1DARA 4RCYA 3MCAA 2HMAA 4PC6A 1QVGB 3B82A 1IJFA 1K8AD 4B43A 2BN4A 4ZCIA 3CXCB 1BX0A 3VO1A 3CW2A 4B48A 1M1KD 4J0QA 3AVXA 3E1YE 3CMAB 5TR9A 1QGYA 5TY0A 1W87A 1YJNB 1QUEA 4M0LA 4U9UA 3LVBA 3SJZA 1IJEA 1EXMA 4N3GA 5TV2A 1TVCA 1QVFB 2PMDA 3CCSB 1KD1D 4C43A 3OZUA 1GR1A 4TN1A 3CRZA 4H9GA 1S0UA 3QFSA 4YHBA 2QDXA 3W5HA 1GJRA 2PIAA 4ZCMA 4R71A 1FNMA 2BGIA 4PC3A 1XE1A 4F7DA 2BMWA 4PC2A 1DDGA 1FNBA 3J81k 1OGIA 5AN9A 3QFRA 3G71B 4BPRA 4MYTA 4UAJA 4TMXA 2BM0A 3CCEB 2OK8A 1QFYA 1H42A 4IW3B 3WNCA 1VQ9B 4M1KA 3MHPA 5KSWB 3G4SB 1M90D 1KK1A 1S72B 3WYAA 4LBZA 4RCZA 2OK7A 1EP2B 1FRNA 1G7SA 3JQPA 3CCJB 1E64A 1DDIA 3I56B 3W5UA 3WNBA 1R5BA 1G7CA 1OGJA 2DETA 1G7TA 1VQ8B 4B47A 5HXBA 1GAQA 3OZWA 3CC2B 2BSAA 1W34A 4YAUA 3CMEB 1ZUNB 2D74A 2RC5A 1KRHA 1BX1A 4YALA 1EFCA 4QFMA 3I55B 1U2RA 1Q86D 3AVVA 2GQFA 1HA3A 2QA4B 4PGOA 2BM1A 1VQ6B 4B4DA 4ACBA 4B3XA 4PC7A 1D1NA 4FK8A 2X3UA 3W2HA 1EFUA 1N8RD 4EH1A 1VQLB 1TUIA 1FNDA 3FJOA 1OB2A 3AVWA 1G7RA 1J9ZA 3WBJA 3MMPA 1JB9A 2QMUA 4TMZA 1QFZA 1VQPB 3OW2B 4DQKA 4ZV4A 3QSYA 1I7PA 5DSZA 1QGZA 4TMTA 3VNUA 1KK2A 1R5OA 3QFTA 4RD2A 2CNDA 3ES9A 3CC4B 1QFJA 1OB5A 2BGJA 3VNVA 1KTVA 2BF4A 3CB4A 1KK0A 2C77A 4YAWA 2VNKA 3ZBTA 1F20A 3ZBUA 3P26A 4PC1A 4MYUA 4Y7CA 2B7BA 1GVHA 2FX3A 1B23P 1H85A 1YI2B 3AGPA 4RD1A 1KJZA 1K9MD 2AHOA 2YWGA 4P6VF 4M53A 1JJ2B 1DG1G 4ZGNB 4K1XA 4RD6A 3ZC3A 2PLFA 1XB2A 3WBKA 3W2FA 1YJ9B 4G5GA 1VQMB 4AC9A 3CCMB 1JA0A 4B44A 1F60A 1Q81D 3FPKA 3CC7B 5JBQA 3VO2A 2XNCA 1YITB 2BVNA 4LBYA 1WDTA 3AVTA 2YWEA 1N0VC 1TTTA 4P3YA 1VQOB 3U6BA 2OTJB 1QH0A 2DY1A 1EP1B 2XNJA 4HE5A 3CCLB 2CRVA 1E63A 1QX4A 2DERA 3B78A 3AVUA 4NBSA 1NDHA 2VYQA 2GPJA 4TMVA 1N0UA 3W2GA 4RJLA 1AIPA 2VZLA 1BQEA 5THXA 1KK3A 3WXMA 3CCUB 3P27A 3ZZUA 4LC0A 3CD6B 3AGQA 4AF7A 5FA6A 1W35A 4QHYA 3QFCA 4YAOA 1R5NA 1AMOA 3WNDA 1FRQA 2BV3A 5H5JA 1W2BB 1ELOA 1FNCA 1BJKA 1TLLA 4FN5A 3CCQB 1CNFA 3VMFA 2QTLA 2HDNB 1QGAA 2RC6A 5EMNA 1VQ7B 2QEXB 2B5OA 1UMKA 2EFGA 3CCVB 3OJXA 3AVYA 4ZCLA 4YAFA 2VNIA 4Y9RA 1VQ5B 3ZZTA 1GO2A 1KQSB 4M2LA 5GV7A 2QN6A 3G6EB 3ZZ0A 5H59A 4Q7JB 1YJWB 1GAWA 2QTZA
chains in the Genus database with same CATH superfamily
2QE7A 3OAAA 4RD3A 4G1VA 3B8HA 5L46A 1VQ4B 2E1RA 1CQXA 3W2EA 1A8PA 4OPSA 1H8EA 1E79A 1EWYA 1EP3B 1FDRA 4Z4RA 3OEHA 1RQRA 1VQKB 2DEUA 4KKTA 2HCJB 4LBWA 4DQLA 4RD4A 5IYPA 1VQNB 1QUFA 2VNJA 3LO8A 4TMWA 4DK1A 4OPOA 4XLCA 1EFTA 4XONA 4FXUA 2ZTGA 2ZITA 5GV8A 1ZM4A 5A89A 5KNLA 1YHQB 1UD6A 4AVZA 4FWTA 3V76A 1JNYA 3U6KA 4ZGQB 2B7CA 1ZM3A 2GJPA 2W6JA 3ASTA 1N05A 3OZVA 4LBVA 1JA1A 3PA1A 1UD2A 2C78A 1SM4A 4RD0A 4RM0A 2VNHA 2C4UA 2NPFA 2YWHA 2VJIA 3W2IA 3JQRA 1UD5A 5B6IA 2D3NA 4XLHA 2XOKA 1FX0A 3PENA 1D2EA 5A8AA 2X6XA 1IB0A 3H94A 2OBSA 3ZPNA 2JJ2A 1YIJB 4X7FA 2VBUA 2XNDA 2XEXA 3VR6A 2BPOA 2D9RA 2V7WA 3CCRB 1D8TA 3A8KA 1SKQA 4HIZA 4Y9UA 1ZM9A 4HE6A 2VBTA 3A8IA 5CDFA 3CPWB 3I1FA 4RDJA 1ZM2A 1Q7YD 3CP8A 3WY9A 4P12A 2WPDA 5IYRA 1NJID 1E1RA 3U2QA 1EFRA 4OOVA 2FVGA 1HZEA 2NV4A 5FL7A 4ACAA 3V7AA 4OPVA 2WJYA 4C0SA 2GK7A 2ZXIA 3SEJA 2J7KA 3GVKA 1WTHD 4AF6A 2JIZA 1CNEA 1VJSA 4WQMA 2DCUA 2YWFA 2JDIA 4RPBA 4XQFA 1T6ZA 2R6HA 1E62A 2LZJA 4G1BA 1K73D 2OTLB 3JQQA 2JJ1A 1QG0A 3RY8A 2EIXA 4ROXA 3OW7A 1KC8D 4XN3A 4OP7A 4NCNA 3QE2A 1Q82D 3ASPA 1B2RA 3CMMA 4N3NA 3OOCA 3OJWA 4M4SA 1PJ5A 3W5VA 3E20A 1DARA 1KZLA 2I1LA 2WR8A 4RCYA 3MCAA 2HMAA 4PC6A 1I18A 2V7UA 1QVGB 3B82A 1IJFA 1K8AD 4XLFA 4NNJA 3BNWA 4B43A 2BN4A 1Y0RA 2GJRA 2V7VA 1MRZA 4PAAA 4ZCIA 3CXCB 1BX0A 3VO1A 1PJ7A 3CW2A 4B48A 1M1KD 4J0QA 3AVXA 3E1YE 3CMAB 5TR9A 1QGYA 1H8HA 5TY0A 3A3BA 1W87A 4P25A 1WSVA 3R6KA 1YJNB 1QUEA 3D26A 4M0LA 4U9UA 3LVBA 3SJZA 1W0JA 1IJEA 1EXMA 2HLDA 2F4NA 4X06A 4N3GA 4TSFA 1WSRA 3JU4A 5TV2A 1TVCA 4Z4ZA 1QVFB 2PMDA 3CCSB 1KD1D 4Z4SA 2ZL7A 4X05A 4C43A 3OZUA 5FO1A 1GR1A 1T5EA 1UD4A 3CRZA 4TN1A 2X0KA 4H9GA 1S0UA 3QFSA 4YHBA 2QDXA 1GJRA 2PIAA 3W5HA 4ZCMA 1WP6A 4R71A 1FNMA 4L8JA 1E3XA 2BGIA 2X6WA 4PC3A 3FKSA 3GQBA 1XE1A 3PVDA 4F7DA 2BMWA 4PC2A 1DDGA 5DS0A 1FNBA 4G7WA 3J81k 3GIRA 1OGIA 5AN9A 1YLOA 3QFRA 3G71B 1WPCA 4MYTA 4XOTA 1RQPA 3LNNA 4BPRA 4Z4VA 4XNFA 5BSXA 2X6YA 1OB0A 4UAJA 2V7QA 1BMFA 4RDKA 1T6XA 4XR6A 4DNRB 4TMXA 1VLOA 2BM0A 2ZZEA 3CCEB 4OOXA 2F43A 2OK8A 4X7DA 1QFYA 5IYWA 4Z4WA 1H42A 4YELA 1NBMA 4GQNA 4YEJA 1V0EA 4IW3B 3WNCA 1VQ9B 4XKWA 3Q3AA 1S4MA 3MHPA 4M1KA 3H9NA 5KSWB 4B3GA 3BC9A 2XGJA 3G4SB 1M90D 1KK1A 1S72B 3WYAA 3CTAA 4LBZA 4CQJA 3SLDA 1YX2A 4RCZA 2CC2A 3ASRA 2OK7A 1VLYA 2V31A 1EP2B 1FRNA 5FNZA 3ZUGA 1G7SA 3JQPA 2Q6LA 3CCJB 1E64A 1DDIA 3I56B 3W5UA 3WNBA 3Q38A 1R5BA 1G7CA 3OP1A 4X0CA 1OGJA 2DETA 1G7TA 2GK6A 3Q39A 1VQ8B 4B47A 4II3A 2P3MA 5HXBA 1GAQA 1N07A 3OZWA 3CC2B 2BSAA 1W34A 4YAUA 3CMEB 3PUNA 1BLIA 1ZUNB 2C2WA 2D74A 2XZOA 2ZBVA 2RC5A 4Z4TA 1VHOA 4RDLA 1VHEA 2C5BA 1KRHA 3ASQA 1XFOA 1BX1A 4YALA 1EFCA 4QFMA 3Q6RA 3I55B 1U2RA 1Q86D 1E1QA 3AVVA 5IYQA 3LQ6A 2GQFA 1HA3A 2QA4B 4KKUA 4PGOA 2BM1A 1VQ6B 1HVXA 1PKVA 4P2NA 4QVJA 2X85A 4JMQA 4B4DA 3ASSA 4XLAA 4ACBA 4B3XA 4PC7A 3PUMA 4FK8A 4Z4YA 1OHHA 1D1NA 2X3UA 4UZEA 3W2HA 2VBSA 1EFUA 2V7TA 1N8RD 1SKYB 4EH1A 1TUIA 1FNDA 1V0FA 2V4DA 1VQLB 3FJOA 4QV2A 2GREA 1OB2A 3AVWA 1G7RA 1J9ZA 3WBJA 4WZTA 2ZBUA 1W9XA 5TRDA 3MMPA 1JB9A 2QMUA 4TMZA 1QFZA 1VQPB 3OW2B 3A1PA 4DQKA 4ZV4A 3QSYA 1I7PA 4P9SA 4Z4UA 2C4TA 5DSZA 1QGZA 4TMTA 3VNUA 5FO0A 1KK2A 2XZPA 1R5OA 1XQBA 2V7XA 1WORA 3QFTA 4XLEA 1K28D 4RD2A 4XN0A 2CNDA 3ES9A 1W0KA 3NE5B 2CW5A 4QUZA 4WZLA 3CC4B 1QFJA 1OB5A 2X8KA 2BGJA 4P6YA 1KTVA 1UD8A 4X7EA 2BF4A 3VNVA 2QGGA 3ISXA 1V5VA 4WWVA 3CB4A 1KK0A 5E6TA 2C77A 4YAWA 4WZEA 2VNKA 3ZBTA 1F20A 3ZBUA 2CBXA 3P26A 4PABA 2WSSA 4KKSA 1KMHA 4OOSA 4PC1A 4MYUA 4YXWA 4Y7CA 2B7BA 1N08A 1GVHA 2FX3A 3BCDA 1B23P 5F4MA 1H85A 1YI2B 3AGPA 1PJ6A 4RD1A 4X8IA 1KJZA 5HZAA 1K9MD 4XMYA 2AHOA 2YWGA 2CF4A 4P6VF 4M53A 2D3LA 1JJ2B 1DG1G 2ZXHA 4ZGNB 4X7CA 4K1XA 4RD6A 3DDYA 5HZBA 3ZC3A 2PLFA 1XB2A 2OYNA 4XL9A 3WBKA 3W2FA 2Q6IA 1MABA 3BH4A 5FIUA 1YJ9B 2Q6OA 5F4JA 4G5GA 1Q9SA 2WZNA 5F4OA 4B3FX 4DNTB 1VQMB 4AC9A 3CCMB 1JA0A 2JN9A 3ONUA 4B44A 1I8DA 1F60A 1Q81D 2OBTA 5J35A 1E3ZA 3CP2A 2W6IA 3FPKA 3CC7B 5JBQA 3VO2A 2F1MA 3ZIAA 2XZLA 3A3GA 3BCFA 3GVJA 3ONYA 2XNCA 1IHMA 1YITB 3LQEA 4X07A 2BVNA 4XM3A 3GSIA 4LBYA 1VF7A 3BY1A 1WDTA 5LMZA 2ZZGA 3AVTA 2YWEA 4II2A 1N0VC 3A8JA 1TTTA 4XKVA 4P22A 4TT3A 2X53S 4P3YA 4UZFA 5HKKA 1VQOB 1WOSA 2ZTNA 2ZZQA 3U6BA 2OTJB 1QH0A 3R6JA 2WJVA 2ZL5A 2DY1A 4DK0A 3OKXA 1P4MA 1EP1B 3GVLA 4XD7A 2XNJA 1N06A 5DN6A 2Q6KA 3OEEA 3A35A 4HE5A 4WZKA 3G05A 4P1VA 3CCLB 2CRVA 1E63A 1QX4A 2DERA 3B78A 3AVUA 1BPLA 4NBSA 1NDHA 2ZL6A 2Z6BD 3SKBA 2VYQA 1T6YA 2GPJA 4P3IA 2OBRA 1N0UA 4TMVA 3T51B 3W2GA 2WZPP 4XORA 4RJLA 1AIPA 2VZLA 3SLNA 4ASUA 5A88A 5KW9A 1BQEA 5IK2A 5THXA 3CESA 2C5HA 1KK3A 4TKOB 3WXMA 2PE3A 3CCUB 3P27A 1Y0YA 3FPPA 3ZZUA 4LC0A 4XOPA 3CD6B 3AGQA 1WOOA 4AF7A 5FA6A 3T56B 1W35A 4QHYA 3PA2A 2DOGA 4P26A 3QFCA 4YAOA 1R5NA 1NB9A 1NB0A 1WU8A 1AMOA 2GJKA 3OFNA 4E0FA 4Z1MA 1FRQA 2BV3A 5H5JA 3WNDA 5J3OA 1W2BB 1ELOA 1FNCA 2DYIA 5IYNA 4QVAA 3SJPA 2DIEA 3BQJA 4RLZA 1BJKA 1TLLA 2VJJA 4FN5A 2WYRA 2F1LA 3CCQB 1CNFA 2R9VA 3BY2A 1WOPA 3VMFA 2QTLA 2HDNB 1QGAA 3KL9A 3T53B 2RC6A 3KEWA 2KVOA 1NRKA 3OE7A 5EMNA 3CPXA 1E43A 1VQ7B 1COWA 2E1BA 2QEXB 2M5SA 2B5OA 1UMKA 2EFGA 4G7XA 3CCVB 3OJXA 3AVYA 4ZCLA 2VBVA 2ZZFA 4YAFA 3HAGA 2VNIA 4G6IA 4Y9RA 5BSYA 1VQ5B 3ZZTA 1GO2A 3Q6QA 1KQSB 4M2LA 4UZUA 5GV7A 3WQZA 2QN6A 2CK3A 4RPDA 3ZZ0A 3G6EB 5H59A 4Q7JB 1YJWB 3OPOA 1GAWA 2QTZA 1UD3A
chains in the Genus database with same CATH topology
4RD3A 4G1VA 3B8HA 1VQ4B 2E1RA 1CQXA 3W2EA 1A8PA 1EWYA 1EP3B 1FDRA 1VQKB 2DEUA 2HCJB 4LBWA 4DQLA 4RD4A 1VQNB 1QUFA 2VNJA 3LO8A 4TMWA 1EFTA 2ZITA 5GV8A 1ZM4A 1YHQB 4FWTA 3V76A 1JNYA 3U6KA 4ZGQB 2B7CA 1ZM3A 3OZVA 4LBVA 1JA1A 2C78A 1SM4A 4RD0A 2VNHA 3W2IA 2NPFA 2YWHA 3JQRA 3PENA 1D2EA 1IB0A 1YIJB 2XEXA 2BPOA 3CCRB 1D8TA 1SKQA 4Y9UA 1ZM9A 4HE6A 3CPWB 3I1FA 1ZM2A 1Q7YD 3WY9A 1NJID 3U2QA 4ACAA 4C0SA 2J7KA 4AF6A 1CNEA 4WQMA 2DCUA 2YWFA 2R6HA 1E62A 4G1BA 1K73D 2OTLB 3JQQA 1QG0A 2EIXA 1KC8D 4NCNA 3QE2A 1Q82D 1B2RA 4N3NA 3OJWA 4M4SA 3W5VA 3E20A 1DARA 4RCYA 3MCAA 2HMAA 4PC6A 1QVGB 3B82A 1IJFA 1K8AD 4B43A 2BN4A 4ZCIA 3CXCB 1BX0A 3VO1A 3CW2A 4B48A 1M1KD 4J0QA 3AVXA 3E1YE 3CMAB 5TR9A 1QGYA 5TY0A 1W87A 1YJNB 1QUEA 4M0LA 4U9UA 3LVBA 3SJZA 1IJEA 1EXMA 4N3GA 5TV2A 1TVCA 1QVFB 2PMDA 3CCSB 1KD1D 4C43A 3OZUA 1GR1A 4TN1A 3CRZA 4H9GA 1S0UA 3QFSA 4YHBA 2QDXA 3W5HA 1GJRA 2PIAA 4ZCMA 4R71A 1FNMA 2BGIA 4PC3A 1XE1A 4F7DA 2BMWA 4PC2A 1DDGA 1FNBA 3J81k 1OGIA 5AN9A 3QFRA 3G71B 4BPRA 4MYTA 4UAJA 4TMXA 2BM0A 3CCEB 2OK8A 1QFYA 1H42A 4IW3B 3WNCA 1VQ9B 4M1KA 3MHPA 5KSWB 3G4SB 1M90D 1KK1A 1S72B 3WYAA 4LBZA 4RCZA 2OK7A 1EP2B 1FRNA 1G7SA 3JQPA 3CCJB 1E64A 1DDIA 3I56B 3W5UA 3WNBA 1R5BA 1G7CA 1OGJA 2DETA 1G7TA 1VQ8B 4B47A 5HXBA 1GAQA 3OZWA 3CC2B 2BSAA 1W34A 4YAUA 3CMEB 1ZUNB 2D74A 2RC5A 1KRHA 1BX1A 4YALA 1EFCA 4QFMA 3I55B 1U2RA 1Q86D 3AVVA 2GQFA 1HA3A 2QA4B 4PGOA 2BM1A 1VQ6B 4B4DA 4ACBA 4B3XA 4PC7A 1D1NA 4FK8A 2X3UA 3W2HA 1EFUA 1N8RD 4EH1A 1VQLB 1TUIA 1FNDA 3FJOA 1OB2A 3AVWA 1G7RA 1J9ZA 3WBJA 3MMPA 1JB9A 2QMUA 4TMZA 1QFZA 1VQPB 3OW2B 4DQKA 4ZV4A 3QSYA 1I7PA 5DSZA 1QGZA 4TMTA 3VNUA 1KK2A 1R5OA 3QFTA 4RD2A 2CNDA 3ES9A 3CC4B 1QFJA 1OB5A 2BGJA 3VNVA 1KTVA 2BF4A 3CB4A 1KK0A 2C77A 4YAWA 2VNKA 3ZBTA 1F20A 3ZBUA 3P26A 4PC1A 4MYUA 4Y7CA 2B7BA 1GVHA 2FX3A 1B23P 1H85A 1YI2B 3AGPA 4RD1A 1KJZA 1K9MD 2AHOA 2YWGA 4P6VF 4M53A 1JJ2B 1DG1G 4ZGNB 4K1XA 4RD6A 3ZC3A 2PLFA 1XB2A 3WBKA 3W2FA 1YJ9B 4G5GA 1VQMB 4AC9A 3CCMB 1JA0A 4B44A 1F60A 1Q81D 3FPKA 3CC7B 5JBQA 3VO2A 2XNCA 1YITB 2BVNA 4LBYA 1WDTA 3AVTA 2YWEA 1N0VC 1TTTA 4P3YA 1VQOB 3U6BA 2OTJB 1QH0A 2DY1A 1EP1B 2XNJA 4HE5A 3CCLB 2CRVA 1E63A 1QX4A 2DERA 3B78A 3AVUA 4NBSA 1NDHA 2VYQA 2GPJA 4TMVA 1N0UA 3W2GA 4RJLA 1AIPA 2VZLA 1BQEA 5THXA 1KK3A 3WXMA 3CCUB 3P27A 3ZZUA 4LC0A 3CD6B 3AGQA 4AF7A 5FA6A 1W35A 4QHYA 3QFCA 4YAOA 1R5NA 1AMOA 3WNDA 1FRQA 2BV3A 5H5JA 1W2BB 1ELOA 1FNCA 1BJKA 1TLLA 4FN5A 3CCQB 1CNFA 3VMFA 2QTLA 2HDNB 1QGAA 2RC6A 5EMNA 1VQ7B 2QEXB 2B5OA 1UMKA 2EFGA 3CCVB 3OJXA 3AVYA 4ZCLA 4YAFA 2VNIA 4Y9RA 1VQ5B 3ZZTA 1GO2A 1KQSB 4M2LA 5GV7A 2QN6A 3G6EB 3ZZ0A 5H59A 4Q7JB 1YJWB 1GAWA 2QTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RD3 A;  4G1V A;  3B8H A;  1VQ4 B;  2E1R A;  1CQX A;  3W2E A;  1A8P A;  1EWY A;  1EP3 B;  1FDR A;  1VQK B;  2DEU A;  2HCJ B;  4LBW A;  4DQL A;  4RD4 A;  1VQN B;  1QUF A;  2VNJ A;  3LO8 A;  4TMW A;  1EFT A;  2ZIT A;  5GV8 A;  1ZM4 A;  1YHQ B;  4FWT A;  3V76 A;  1JNY A;  3U6K A;  4ZGQ B;  2B7C A;  1ZM3 A;  3OZV A;  4LBV A;  1JA1 A;  2C78 A;  1SM4 A;  4RD0 A;  2VNH A;  3W2I A;  2NPF A;  2YWH A;  3JQR A;  3PEN A;  1D2E A;  1IB0 A;  1YIJ B;  2XEX A;  2BPO A;  3CCR B;  1D8T A;  1SKQ A;  4Y9U A;  1ZM9 A;  4HE6 A;  3CPW B;  3I1F A;  1ZM2 A;  1Q7Y D;  3WY9 A;  1NJI D;  3U2Q A;  4ACA A;  4C0S A;  2J7K A;  4AF6 A;  1CNE A;  4WQM A;  2DCU A;  2YWF A;  2R6H A;  1E62 A;  4G1B A;  1K73 D;  2OTL B;  3JQQ A;  1QG0 A;  2EIX A;  1KC8 D;  4NCN A;  3QE2 A;  1Q82 D;  1B2R A;  4N3N A;  3OJW A;  4M4S A;  3W5V A;  3E20 A;  1DAR A;  4RCY A;  3MCA A;  2HMA A;  4PC6 A;  1QVG B;  3B82 A;  1IJF A;  1K8A D;  4B43 A;  2BN4 A;  4ZCI A;  3CXC B;  1BX0 A;  3VO1 A;  3CW2 A;  4B48 A;  1M1K D;  4J0Q A;  3AVX A;  3E1Y E;  3CMA B;  5TR9 A;  1QGY A;  5TY0 A;  1W87 A;  1YJN B;  1QUE A;  4M0L A;  4U9U A;  3LVB A;  3SJZ A;  1IJE A;  1EXM A;  4N3G A;  5TV2 A;  1TVC A;  1QVF B;  2PMD A;  3CCS B;  1KD1 D;  4C43 A;  3OZU A;  1GR1 A;  4TN1 A;  3CRZ A;  4H9G A;  1S0U A;  3QFS A;  4YHB A;  2QDX A;  3W5H A;  1GJR A;  2PIA A;  4ZCM A;  4R71 A;  1FNM A;  2BGI A;  4PC3 A;  1XE1 A;  4F7D A;  2BMW A;  4PC2 A;  1DDG A;  1FNB A;  3J81 k;  1OGI A;  5AN9 A;  3QFR A;  3G71 B;  4BPR A;  4MYT A;  4UAJ A;  4TMX A;  2BM0 A;  3CCE B;  2OK8 A;  1QFY A;  1H42 A;  4IW3 B;  3WNC A;  1VQ9 B;  4M1K A;  3MHP A;  5KSW B;  3G4S B;  1M90 D;  1KK1 A;  1S72 B;  3WYA A;  4LBZ A;  4RCZ A;  2OK7 A;  1EP2 B;  1FRN A;  1G7S A;  3JQP A;  3CCJ B;  1E64 A;  1DDI A;  3I56 B;  3W5U A;  3WNB A;  1R5B A;  1G7C A;  1OGJ A;  2DET A;  1G7T A;  1VQ8 B;  4B47 A;  5HXB A;  1GAQ A;  3OZW A;  3CC2 B;  2BSA A;  1W34 A;  4YAU A;  3CME B;  1ZUN B;  2D74 A;  2RC5 A;  1KRH A;  1BX1 A;  4YAL A;  1EFC A;  4QFM A;  3I55 B;  1U2R A;  1Q86 D;  3AVV A;  2GQF A;  1HA3 A;  2QA4 B;  4PGO A;  2BM1 A;  1VQ6 B;  4B4D A;  4ACB A;  4B3X A;  4PC7 A;  1D1N A;  4FK8 A;  2X3U A;  3W2H A;  1EFU A;  1N8R D;  4EH1 A;  1VQL B;  1TUI A;  1FND A;  3FJO A;  1OB2 A;  3AVW A;  1G7R A;  1J9Z A;  3WBJ A;  3MMP A;  1JB9 A;  2QMU A;  4TMZ A;  1QFZ A;  1VQP B;  3OW2 B;  4DQK A;  4ZV4 A;  3QSY A;  1I7P A;  5DSZ A;  1QGZ A;  4TMT A;  3VNU A;  1KK2 A;  1R5O A;  3QFT A;  4RD2 A;  2CND A;  3ES9 A;  3CC4 B;  1QFJ A;  1OB5 A;  2BGJ A;  3VNV A;  1KTV A;  2BF4 A;  3CB4 A;  1KK0 A;  2C77 A;  4YAW A;  2VNK A;  3ZBT A;  1F20 A;  3ZBU A;  3P26 A;  4PC1 A;  4MYU A;  4Y7C A;  2B7B A;  1GVH A;  2FX3 A;  1B23 P;  1H85 A;  1YI2 B;  3AGP A;  4RD1 A;  1KJZ A;  1K9M D;  2AHO A;  2YWG A;  4P6V F;  4M53 A;  1JJ2 B;  1DG1 G;  4ZGN B;  4K1X A;  4RD6 A;  3ZC3 A;  2PLF A;  1XB2 A;  3WBK A;  3W2F A;  1YJ9 B;  4G5G A;  1VQM B;  4AC9 A;  3CCM B;  1JA0 A;  4B44 A;  1F60 A;  1Q81 D;  3FPK A;  3CC7 B;  5JBQ A;  3VO2 A;  2XNC A;  1YIT B;  2BVN A;  4LBY A;  1WDT A;  3AVT A;  2YWE A;  1N0V C;  1TTT A;  4P3Y A;  1VQO B;  3U6B A;  2OTJ B;  1QH0 A;  2DY1 A;  1EP1 B;  2XNJ A;  4HE5 A;  3CCL B;  2CRV A;  1E63 A;  1QX4 A;  2DER A;  3B78 A;  3AVU A;  4NBS A;  1NDH A;  2VYQ A;  2GPJ A;  4TMV A;  1N0U A;  3W2G A;  4RJL A;  1AIP A;  2VZL A;  1BQE A;  5THX A;  1KK3 A;  3WXM A;  3CCU B;  3P27 A;  3ZZU A;  4LC0 A;  3CD6 B;  3AGQ A;  4AF7 A;  5FA6 A;  1W35 A;  4QHY A;  3QFC A;  4YAO A;  1R5N A;  1AMO A;  3WND A;  1FRQ A;  2BV3 A;  5H5J A;  1W2B B;  1ELO A;  1FNC A;  1BJK A;  1TLL A;  4FN5 A;  3CCQ B;  1CNF A;  3VMF A;  2QTL A;  2HDN B;  1QGA A;  2RC6 A;  5EMN A;  1VQ7 B;  2QEX B;  2B5O A;  1UMK A;  2EFG A;  3CCV B;  3OJX A;  3AVY A;  4ZCL A;  4YAF A;  2VNI A;  4Y9R A;  1VQ5 B;  3ZZT A;  1GO2 A;  1KQS B;  4M2L A;  5GV7 A;  2QN6 A;  3G6E B;  3ZZ0 A;  5H59 A;  4Q7J B;  1YJW B;  1GAW A;  2QTZ A; 
#chains in the Genus database with same CATH topology
 2QE7 A;  3OAA A;  4RD3 A;  4G1V A;  3B8H A;  5L46 A;  1VQ4 B;  2E1R A;  1CQX A;  3W2E A;  1A8P A;  4OPS A;  1H8E A;  1E79 A;  1EWY A;  1EP3 B;  1FDR A;  4Z4R A;  3OEH A;  1RQR A;  1VQK B;  2DEU A;  4KKT A;  2HCJ B;  4LBW A;  4DQL A;  4RD4 A;  5IYP A;  1VQN B;  1QUF A;  2VNJ A;  3LO8 A;  4TMW A;  4DK1 A;  4OPO A;  4XLC A;  1EFT A;  4XON A;  4FXU A;  2ZTG A;  2ZIT A;  5GV8 A;  1ZM4 A;  5A89 A;  5KNL A;  1YHQ B;  1UD6 A;  4AVZ A;  4FWT A;  3V76 A;  1JNY A;  3U6K A;  4ZGQ B;  2B7C A;  1ZM3 A;  2GJP A;  2W6J A;  3AST A;  1N05 A;  3OZV A;  4LBV A;  1JA1 A;  3PA1 A;  1UD2 A;  2C78 A;  1SM4 A;  4RD0 A;  4RM0 A;  2VNH A;  2C4U A;  2NPF A;  2YWH A;  2VJI A;  3W2I A;  3JQR A;  1UD5 A;  5B6I A;  2D3N A;  4XLH A;  2XOK A;  1FX0 A;  3PEN A;  1D2E A;  5A8A A;  2X6X A;  1IB0 A;  3H94 A;  2OBS A;  3ZPN A;  2JJ2 A;  1YIJ B;  4X7F A;  2VBU A;  2XND A;  2XEX A;  3VR6 A;  2BPO A;  2D9R A;  2V7W A;  3CCR B;  1D8T A;  3A8K A;  1SKQ A;  4HIZ A;  4Y9U A;  1ZM9 A;  4HE6 A;  2VBT A;  3A8I A;  5CDF A;  3CPW B;  3I1F A;  4RDJ A;  1ZM2 A;  1Q7Y D;  3CP8 A;  3WY9 A;  4P12 A;  2WPD A;  5IYR A;  1NJI D;  1E1R A;  3U2Q A;  1EFR A;  4OOV A;  2FVG A;  1HZE A;  2NV4 A;  5FL7 A;  4ACA A;  3V7A A;  4OPV A;  2WJY A;  4C0S A;  2GK7 A;  2ZXI A;  3SEJ A;  2J7K A;  3GVK A;  1WTH D;  4AF6 A;  2JIZ A;  1CNE A;  1VJS A;  4WQM A;  2DCU A;  2YWF A;  2JDI A;  4RPB A;  4XQF A;  1T6Z A;  2R6H A;  1E62 A;  2LZJ A;  4G1B A;  1K73 D;  2OTL B;  3JQQ A;  2JJ1 A;  1QG0 A;  3RY8 A;  2EIX A;  4ROX A;  3OW7 A;  1KC8 D;  4XN3 A;  4OP7 A;  4NCN A;  3QE2 A;  1Q82 D;  3ASP A;  1B2R A;  3CMM A;  4N3N A;  3OOC A;  3OJW A;  4M4S A;  1PJ5 A;  3W5V A;  3E20 A;  1DAR A;  1KZL A;  2I1L A;  2WR8 A;  4RCY A;  3MCA A;  2HMA A;  4PC6 A;  1I18 A;  2V7U A;  1QVG B;  3B82 A;  1IJF A;  1K8A D;  4XLF A;  4NNJ A;  3BNW A;  4B43 A;  2BN4 A;  1Y0R A;  2GJR A;  2V7V A;  1MRZ A;  4PAA A;  4ZCI A;  3CXC B;  1BX0 A;  3VO1 A;  1PJ7 A;  3CW2 A;  4B48 A;  1M1K D;  4J0Q A;  3AVX A;  3E1Y E;  3CMA B;  5TR9 A;  1QGY A;  1H8H A;  5TY0 A;  3A3B A;  1W87 A;  4P25 A;  1WSV A;  3R6K A;  1YJN B;  1QUE A;  3D26 A;  4M0L A;  4U9U A;  3LVB A;  3SJZ A;  1W0J A;  1IJE A;  1EXM A;  2HLD A;  2F4N A;  4X06 A;  4N3G A;  4TSF A;  1WSR A;  3JU4 A;  5TV2 A;  1TVC A;  4Z4Z A;  1QVF B;  2PMD A;  3CCS B;  1KD1 D;  4Z4S A;  2ZL7 A;  4X05 A;  4C43 A;  3OZU A;  5FO1 A;  1GR1 A;  1T5E A;  1UD4 A;  3CRZ A;  4TN1 A;  2X0K A;  4H9G A;  1S0U A;  3QFS A;  4YHB A;  2QDX A;  1GJR A;  2PIA A;  3W5H A;  4ZCM A;  1WP6 A;  4R71 A;  1FNM A;  4L8J A;  1E3X A;  2BGI A;  2X6W A;  4PC3 A;  3FKS A;  3GQB A;  1XE1 A;  3PVD A;  4F7D A;  2BMW A;  4PC2 A;  1DDG A;  5DS0 A;  1FNB A;  4G7W A;  3J81 k;  3GIR A;  1OGI A;  5AN9 A;  1YLO A;  3QFR A;  3G71 B;  1WPC A;  4MYT A;  4XOT A;  1RQP A;  3LNN A;  4BPR A;  4Z4V A;  4XNF A;  5BSX A;  2X6Y A;  1OB0 A;  4UAJ A;  2V7Q A;  1BMF A;  4RDK A;  1T6X A;  4XR6 A;  4DNR B;  4TMX A;  1VLO A;  2BM0 A;  2ZZE A;  3CCE B;  4OOX A;  2F43 A;  2OK8 A;  4X7D A;  1QFY A;  5IYW A;  4Z4W A;  1H42 A;  4YEL A;  1NBM A;  4GQN A;  4YEJ A;  1V0E A;  4IW3 B;  3WNC A;  1VQ9 B;  4XKW A;  3Q3A A;  1S4M A;  3MHP A;  4M1K A;  3H9N A;  5KSW B;  4B3G A;  3BC9 A;  2XGJ A;  3G4S B;  1M90 D;  1KK1 A;  1S72 B;  3WYA A;  3CTA A;  4LBZ A;  4CQJ A;  3SLD A;  1YX2 A;  4RCZ A;  2CC2 A;  3ASR A;  2OK7 A;  1VLY A;  2V31 A;  1EP2 B;  1FRN A;  5FNZ A;  3ZUG A;  1G7S A;  3JQP A;  2Q6L A;  3CCJ B;  1E64 A;  1DDI A;  3I56 B;  3W5U A;  3WNB A;  3Q38 A;  1R5B A;  1G7C A;  3OP1 A;  4X0C A;  1OGJ A;  2DET A;  1G7T A;  2GK6 A;  3Q39 A;  1VQ8 B;  4B47 A;  4II3 A;  2P3M A;  5HXB A;  1GAQ A;  1N07 A;  3OZW A;  3CC2 B;  2BSA A;  1W34 A;  4YAU A;  3CME B;  3PUN A;  1BLI A;  1ZUN B;  2C2W A;  2D74 A;  2XZO A;  2ZBV A;  2RC5 A;  4Z4T A;  1VHO A;  4RDL A;  1VHE A;  2C5B A;  1KRH A;  3ASQ A;  1XFO A;  1BX1 A;  4YAL A;  1EFC A;  4QFM A;  3Q6R A;  3I55 B;  1U2R A;  1Q86 D;  1E1Q A;  3AVV A;  5IYQ A;  3LQ6 A;  2GQF A;  1HA3 A;  2QA4 B;  4KKU A;  4PGO A;  2BM1 A;  1VQ6 B;  1HVX A;  1PKV A;  4P2N A;  4QVJ A;  2X85 A;  4JMQ A;  4B4D A;  3ASS A;  4XLA A;  4ACB A;  4B3X A;  4PC7 A;  3PUM A;  4FK8 A;  4Z4Y A;  1OHH A;  1D1N A;  2X3U A;  4UZE A;  3W2H A;  2VBS A;  1EFU A;  2V7T A;  1N8R D;  1SKY B;  4EH1 A;  1TUI A;  1FND A;  1V0F A;  2V4D A;  1VQL B;  3FJO A;  4QV2 A;  2GRE A;  1OB2 A;  3AVW A;  1G7R A;  1J9Z A;  3WBJ A;  4WZT A;  2ZBU A;  1W9X A;  5TRD A;  3MMP A;  1JB9 A;  2QMU A;  4TMZ A;  1QFZ A;  1VQP B;  3OW2 B;  3A1P A;  4DQK A;  4ZV4 A;  3QSY A;  1I7P A;  4P9S A;  4Z4U A;  2C4T A;  5DSZ A;  1QGZ A;  4TMT A;  3VNU A;  5FO0 A;  1KK2 A;  2XZP A;  1R5O A;  1XQB A;  2V7X A;  1WOR A;  3QFT A;  4XLE A;  1K28 D;  4RD2 A;  4XN0 A;  2CND A;  3ES9 A;  1W0K A;  3NE5 B;  2CW5 A;  4QUZ A;  4WZL A;  3CC4 B;  1QFJ A;  1OB5 A;  2X8K A;  2BGJ A;  4P6Y A;  1KTV A;  1UD8 A;  4X7E A;  2BF4 A;  3VNV A;  2QGG A;  3ISX A;  1V5V A;  4WWV A;  3CB4 A;  1KK0 A;  5E6T A;  2C77 A;  4YAW A;  4WZE A;  2VNK A;  3ZBT A;  1F20 A;  3ZBU A;  2CBX A;  3P26 A;  4PAB A;  2WSS A;  4KKS A;  1KMH A;  4OOS A;  4PC1 A;  4MYU A;  4YXW A;  4Y7C A;  2B7B A;  1N08 A;  1GVH A;  2FX3 A;  3BCD A;  1B23 P;  5F4M A;  1H85 A;  1YI2 B;  3AGP A;  1PJ6 A;  4RD1 A;  4X8I A;  1KJZ A;  5HZA A;  1K9M D;  4XMY A;  2AHO A;  2YWG A;  2CF4 A;  4P6V F;  4M53 A;  2D3L A;  1JJ2 B;  1DG1 G;  2ZXH A;  4ZGN B;  4X7C A;  4K1X A;  4RD6 A;  3DDY A;  5HZB A;  3ZC3 A;  2PLF A;  1XB2 A;  2OYN A;  4XL9 A;  3WBK A;  3W2F A;  2Q6I A;  1MAB A;  3BH4 A;  5FIU A;  1YJ9 B;  2Q6O A;  5F4J A;  4G5G A;  1Q9S A;  2WZN A;  5F4O A;  4B3F X;  4DNT B;  1VQM B;  4AC9 A;  3CCM B;  1JA0 A;  2JN9 A;  3ONU A;  4B44 A;  1I8D A;  1F60 A;  1Q81 D;  2OBT A;  5J35 A;  1E3Z A;  3CP2 A;  2W6I A;  3FPK A;  3CC7 B;  5JBQ A;  3VO2 A;  2F1M A;  3ZIA A;  2XZL A;  3A3G A;  3BCF A;  3GVJ A;  3ONY A;  2XNC A;  1IHM A;  1YIT B;  3LQE A;  4X07 A;  2BVN A;  4XM3 A;  3GSI A;  4LBY A;  1VF7 A;  3BY1 A;  1WDT A;  5LMZ A;  2ZZG A;  3AVT A;  2YWE A;  4II2 A;  1N0V C;  3A8J A;  1TTT A;  4XKV A;  4P22 A;  4TT3 A;  2X53 S;  4P3Y A;  4UZF A;  5HKK A;  1VQO B;  1WOS A;  2ZTN A;  2ZZQ A;  3U6B A;  2OTJ B;  1QH0 A;  3R6J A;  2WJV A;  2ZL5 A;  2DY1 A;  4DK0 A;  3OKX A;  1P4M A;  1EP1 B;  3GVL A;  4XD7 A;  2XNJ A;  1N06 A;  5DN6 A;  2Q6K A;  3OEE A;  3A35 A;  4HE5 A;  4WZK A;  3G05 A;  4P1V A;  3CCL B;  2CRV A;  1E63 A;  1QX4 A;  2DER A;  3B78 A;  3AVU A;  1BPL A;  4NBS A;  1NDH A;  2ZL6 A;  2Z6B D;  3SKB A;  2VYQ A;  1T6Y A;  2GPJ A;  4P3I A;  2OBR A;  1N0U A;  4TMV A;  3T51 B;  3W2G A;  2WZP P;  4XOR A;  4RJL A;  1AIP A;  2VZL A;  3SLN A;  4ASU A;  5A88 A;  5KW9 A;  1BQE A;  5IK2 A;  5THX A;  3CES A;  2C5H A;  1KK3 A;  4TKO B;  3WXM A;  2PE3 A;  3CCU B;  3P27 A;  1Y0Y A;  3FPP A;  3ZZU A;  4LC0 A;  4XOP A;  3CD6 B;  3AGQ A;  1WOO A;  4AF7 A;  5FA6 A;  3T56 B;  1W35 A;  4QHY A;  3PA2 A;  2DOG A;  4P26 A;  3QFC A;  4YAO A;  1R5N A;  1NB9 A;  1NB0 A;  1WU8 A;  1AMO A;  2GJK A;  3OFN A;  4E0F A;  4Z1M A;  1FRQ A;  2BV3 A;  5H5J A;  3WND A;  5J3O A;  1W2B B;  1ELO A;  1FNC A;  2DYI A;  5IYN A;  4QVA A;  3SJP A;  2DIE A;  3BQJ A;  4RLZ A;  1BJK A;  1TLL A;  2VJJ A;  4FN5 A;  2WYR A;  2F1L A;  3CCQ B;  1CNF A;  2R9V A;  3BY2 A;  1WOP A;  3VMF A;  2QTL A;  2HDN B;  1QGA A;  3KL9 A;  3T53 B;  2RC6 A;  3KEW A;  2KVO A;  1NRK A;  3OE7 A;  5EMN A;  3CPX A;  1E43 A;  1VQ7 B;  1COW A;  2E1B A;  2QEX B;  2M5S A;  2B5O A;  1UMK A;  2EFG A;  4G7X A;  3CCV B;  3OJX A;  3AVY A;  4ZCL A;  2VBV A;  2ZZF A;  4YAF A;  3HAG A;  2VNI A;  4G6I A;  4Y9R A;  5BSY A;  1VQ5 B;  3ZZT A;  1GO2 A;  3Q6Q A;  1KQS B;  4M2L A;  4UZU A;  5GV7 A;  3WQZ A;  2QN6 A;  2CK3 A;  4RPD A;  3ZZ0 A;  3G6E B;  5H59 A;  4Q7J B;  1YJW B;  3OPO A;  1GAW A;  2QTZ A;  1UD3 A; 
#chains in the Genus database with same CATH homology
 4RD3 A;  4G1V A;  3B8H A;  1VQ4 B;  2E1R A;  1CQX A;  3W2E A;  1A8P A;  1EWY A;  1EP3 B;  1FDR A;  1VQK B;  2DEU A;  2HCJ B;  4LBW A;  4DQL A;  4RD4 A;  1VQN B;  1QUF A;  2VNJ A;  3LO8 A;  4TMW A;  1EFT A;  2ZIT A;  5GV8 A;  1ZM4 A;  1YHQ B;  4FWT A;  3V76 A;  1JNY A;  3U6K A;  4ZGQ B;  2B7C A;  1ZM3 A;  3OZV A;  4LBV A;  1JA1 A;  2C78 A;  1SM4 A;  4RD0 A;  2VNH A;  3W2I A;  2NPF A;  2YWH A;  3JQR A;  3PEN A;  1D2E A;  1IB0 A;  1YIJ B;  2XEX A;  2BPO A;  3CCR B;  1D8T A;  1SKQ A;  4Y9U A;  1ZM9 A;  4HE6 A;  3CPW B;  3I1F A;  1ZM2 A;  1Q7Y D;  3WY9 A;  1NJI D;  3U2Q A;  4ACA A;  4C0S A;  2J7K A;  4AF6 A;  1CNE A;  4WQM A;  2DCU A;  2YWF A;  2R6H A;  1E62 A;  4G1B A;  1K73 D;  2OTL B;  3JQQ A;  1QG0 A;  2EIX A;  1KC8 D;  4NCN A;  3QE2 A;  1Q82 D;  1B2R A;  4N3N A;  3OJW A;  4M4S A;  3W5V A;  3E20 A;  1DAR A;  4RCY A;  3MCA A;  2HMA A;  4PC6 A;  1QVG B;  3B82 A;  1IJF A;  1K8A D;  4B43 A;  2BN4 A;  4ZCI A;  3CXC B;  1BX0 A;  3VO1 A;  3CW2 A;  4B48 A;  1M1K D;  4J0Q A;  3AVX A;  3E1Y E;  3CMA B;  5TR9 A;  1QGY A;  5TY0 A;  1W87 A;  1YJN B;  1QUE A;  4M0L A;  4U9U A;  3LVB A;  3SJZ A;  1IJE A;  1EXM A;  4N3G A;  5TV2 A;  1TVC A;  1QVF B;  2PMD A;  3CCS B;  1KD1 D;  4C43 A;  3OZU A;  1GR1 A;  4TN1 A;  3CRZ A;  4H9G A;  1S0U A;  3QFS A;  4YHB A;  2QDX A;  3W5H A;  1GJR A;  2PIA A;  4ZCM A;  4R71 A;  1FNM A;  2BGI A;  4PC3 A;  1XE1 A;  4F7D A;  2BMW A;  4PC2 A;  1DDG A;  1FNB A;  3J81 k;  1OGI A;  5AN9 A;  3QFR A;  3G71 B;  4BPR A;  4MYT A;  4UAJ A;  4TMX A;  2BM0 A;  3CCE B;  2OK8 A;  1QFY A;  1H42 A;  4IW3 B;  3WNC A;  1VQ9 B;  4M1K A;  3MHP A;  5KSW B;  3G4S B;  1M90 D;  1KK1 A;  1S72 B;  3WYA A;  4LBZ A;  4RCZ A;  2OK7 A;  1EP2 B;  1FRN A;  1G7S A;  3JQP A;  3CCJ B;  1E64 A;  1DDI A;  3I56 B;  3W5U A;  3WNB A;  1R5B A;  1G7C A;  1OGJ A;  2DET A;  1G7T A;  1VQ8 B;  4B47 A;  5HXB A;  1GAQ A;  3OZW A;  3CC2 B;  2BSA A;  1W34 A;  4YAU A;  3CME B;  1ZUN B;  2D74 A;  2RC5 A;  1KRH A;  1BX1 A;  4YAL A;  1EFC A;  4QFM A;  3I55 B;  1U2R A;  1Q86 D;  3AVV A;  2GQF A;  1HA3 A;  2QA4 B;  4PGO A;  2BM1 A;  1VQ6 B;  4B4D A;  4ACB A;  4B3X A;  4PC7 A;  1D1N A;  4FK8 A;  2X3U A;  3W2H A;  1EFU A;  1N8R D;  4EH1 A;  1VQL B;  1TUI A;  1FND A;  3FJO A;  1OB2 A;  3AVW A;  1G7R A;  1J9Z A;  3WBJ A;  3MMP A;  1JB9 A;  2QMU A;  4TMZ A;  1QFZ A;  1VQP B;  3OW2 B;  4DQK A;  4ZV4 A;  3QSY A;  1I7P A;  5DSZ A;  1QGZ A;  4TMT A;  3VNU A;  1KK2 A;  1R5O A;  3QFT A;  4RD2 A;  2CND A;  3ES9 A;  3CC4 B;  1QFJ A;  1OB5 A;  2BGJ A;  3VNV A;  1KTV A;  2BF4 A;  3CB4 A;  1KK0 A;  2C77 A;  4YAW A;  2VNK A;  3ZBT A;  1F20 A;  3ZBU A;  3P26 A;  4PC1 A;  4MYU A;  4Y7C A;  2B7B A;  1GVH A;  2FX3 A;  1B23 P;  1H85 A;  1YI2 B;  3AGP A;  4RD1 A;  1KJZ A;  1K9M D;  2AHO A;  2YWG A;  4P6V F;  4M53 A;  1JJ2 B;  1DG1 G;  4ZGN B;  4K1X A;  4RD6 A;  3ZC3 A;  2PLF A;  1XB2 A;  3WBK A;  3W2F A;  1YJ9 B;  4G5G A;  1VQM B;  4AC9 A;  3CCM B;  1JA0 A;  4B44 A;  1F60 A;  1Q81 D;  3FPK A;  3CC7 B;  5JBQ A;  3VO2 A;  2XNC A;  1YIT B;  2BVN A;  4LBY A;  1WDT A;  3AVT A;  2YWE A;  1N0V C;  1TTT A;  4P3Y A;  1VQO B;  3U6B A;  2OTJ B;  1QH0 A;  2DY1 A;  1EP1 B;  2XNJ A;  4HE5 A;  3CCL B;  2CRV A;  1E63 A;  1QX4 A;  2DER A;  3B78 A;  3AVU A;  4NBS A;  1NDH A;  2VYQ A;  2GPJ A;  4TMV A;  1N0U A;  3W2G A;  4RJL A;  1AIP A;  2VZL A;  1BQE A;  5THX A;  1KK3 A;  3WXM A;  3CCU B;  3P27 A;  3ZZU A;  4LC0 A;  3CD6 B;  3AGQ A;  4AF7 A;  5FA6 A;  1W35 A;  4QHY A;  3QFC A;  4YAO A;  1R5N A;  1AMO A;  3WND A;  1FRQ A;  2BV3 A;  5H5J A;  1W2B B;  1ELO A;  1FNC A;  1BJK A;  1TLL A;  4FN5 A;  3CCQ B;  1CNF A;  3VMF A;  2QTL A;  2HDN B;  1QGA A;  2RC6 A;  5EMN A;  1VQ7 B;  2QEX B;  2B5O A;  1UMK A;  2EFG A;  3CCV B;  3OJX A;  3AVY A;  4ZCL A;  4YAF A;  2VNI A;  4Y9R A;  1VQ5 B;  3ZZT A;  1GO2 A;  1KQS B;  4M2L A;  5GV7 A;  2QN6 A;  3G6E B;  3ZZ0 A;  5H59 A;  4Q7J B;  1YJW B;  1GAW A;  2QTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...