3E1YE

Crystal structure of human erf1/erf3 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
195
structure length
195
Chain Sequence
b'IRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor subunit 1
publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 27
structure length 195
sequence length 195
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
E PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e1yE01
3QFRA 5GV7A 4QHYA 4M53A 1KK3A 3OJWA 4B43A 4RD1A 4ZCIA 1R5BA 4M0LA 3ZBTA 1YJNB 1FDRA 3CMAB 3CCMB 1J9ZA 2EIXA 3CPWB 1KTVA 1JA1A 1AIPA 1GR1A 3QE2A 3W2EA 3CCEB 3OZVA 1D2EA 2QMUA 4MYTA 2CNDA 4DQKA 4B44A 3I55B 1FNBA 4LC0A 5THXA 3VMFA 4PC7A 1GJRA 1VQ8B 4AC9A 2PLFA 1OB5A 1D1NA 1W2BB 4ZCLA 3E20A 3W2GA 2PIAA 4LBWA 4ZGQB 3CCRB 2GQFA 3OZWA 1K73D 1Q81D 1NJID 1N8RD 1YJ9B 1KD1D 1OGIA 3WBJA 3WNBA 2OTJB 4EH1A 4ZV4A 1EFTA 2OTLB 1ZUNB 1XB2A 3VNVA 2DETA 3CCSB 1EWYA 3CB4A 2E1RA 4RD6A 1YJWB 3JQRA 3JQQA 1IJFA 1VQNB 2VZLA 1YHQB 2ZITA 2BVNA 1SKQA 1QGYA 3ZC3A 1H42A 4TMXA 3WYAA 2PMDA 1E63A 3WBKA 4H9GA 4YALA 1VQ7B 5FA6A 1R5OA 1G7SA 4ZGNB 1TTTA 3CC4B 3W5VA 1QFYA 1FNMA 1W87A 4RD2A 1OB2A 4K1XA 1EP3B 3QSYA 1QVGB 2XEXA 1QH0A 1Q86D 2R6HA 2HMAA 1KK0A 2HDNB 1F20A 3CRZA 3J81k 3JQPA 2QDXA 4M4SA 2YWEA 4G1BA 1TLLA 1FRQA 4C43A 4G5GA 2VNHA 1BX1A 1W34A 2DEUA 2OK7A 2VNKA 1QFZA 3MHPA 3B8HA 3U2QA 3I1FA 4DQLA 1G7CA 1EFCA 2J7KA 3AGQA 3CCQB 1ZM3A 3LVBA 4ACBA 2FX3A 4P6VF 4P3YA 1Q82D 3V76A 2BPOA 4B3XA 1XE1A 2B7BA 5TY0A 4B4DA 1JJ2B 1VQPB 2GPJA 5TR9A 4TMWA 1VQ5B 2BV3A 1GAWA 1QFJA 4PGOA 4RCYA 5GV8A 4RJLA 4Y7CA 3CCVB 1VQKB 2DERA 1UMKA 3QFTA 3W5HA 2NPFA 3P26A 1DDGA 1QUEA 3U6KA 4HE6A 1VQ9B 2BM0A 4MYUA 1BQEA 4Y9RA 3AVVA 2HCJB 3G71B 3CCJB 1TUIA 3VO1A 4Q7JB 1W35A 2QTLA 4TMTA 4U9UA 1VQMB 3WXMA 4M1KA 4NCNA 1EP2B 1ZM2A 4FN5A 3W5UA 4TMVA 2EFGA 1SM4A 1K8AD 1NDHA 1JB9A 1QVFB 3FPKA 4YAFA 2XNJA 2VYQA 2DY1A 1YIJB 1BJKA 3CMEB 1N0VC 5H5JA 1CNFA 3AVYA 1QGZA 3P27A 1QG0A 4AF7A 1KQSB 3CC7B 3AGPA 1H85A 1YI2B 3MMPA 3PENA 2AHOA 4YAUA 1GVHA 2YWFA 4LBVA 3WY9A 3CC2B 3QFCA 3CCUB 1QGAA 3VNUA 1S0UA 1B23P 3OW2B 3AVWA 2OK8A 4IW3B 1ZM9A 1EXMA 1WDTA 1M90D 3SJZA 1A8PA 3FJOA 4LBYA 3AVTA 3VO2A 2BF4A 1E62A 1KC8D 3CD6B 1DDIA 1KRHA 4YHBA 5AN9A 1ZM4A 2CRVA 1I7PA 1DG1G 5EMNA 2VNIA 4R71A 3W2FA 1QX4A 5KSWB 2C78A 3CW2A 1VQLB 1KK2A 2B5OA 4NBSA 2B7CA 2YWGA 1FRNA 4RD3A 5DSZA 1OGJA 1U2RA 1BX0A 2XNCA 1E64A 1F60A 2QA4B 3ZBUA 1GO2A 3I56B 4J0QA 3ZZ0A 4Y9UA 1N0UA 1S72B 1B2RA 4QFMA 4TMZA 1CNEA 2YWHA 2BM1A 5JBQA 3WNDA 4PC6A 2X3UA 5HXBA 4YAWA 3ZZTA 1G7RA 4RD4A 4PC2A 4RD0A 4YAOA 3WNCA 4C0SA 3CXCB 2BMWA 1AMOA 2BN4A 3ZZUA 3G6EB 2RC6A 1G7TA 2RC5A 4G1VA 4LBZA 2QEXB 4PC3A 1R5NA 2DCUA 3MCAA 1CQXA 4HE5A 1M1KD 2QN6A 2BSAA 1YITB 1EP1B 5H59A 2VNJA 4ZCMA 3AVXA 3ES9A 4N3NA 4UAJA 5TV2A 3CCLB 3LO8A 3OZUA 3AVUA 2BGIA 4TN1A 3E1YE 1FNCA 1VQ4B 1GAQA 3W2IA 1IJEA 3G4SB 1K9MD 3QFSA 2QTZA 1HA3A 2BGJA 3B82A 1ELOA 1TVCA 4N3GA 1JNYA 1FNDA 3B78A 1KK1A 4ACAA 2D74A 3U6BA 4M2LA 4RCZA 3OJXA 4WQMA 2C77A 1QUFA 1JA0A 1D8TA 4FK8A 4B48A 3W2HA 4BPRA 1KJZA 4B47A 4FWTA 4PC1A 1VQOB 1Q7YD 4AF6A 1EFUA 1DARA 4F7DA 1VQ6B 1IB0A
chains in the Genus database with same CATH superfamily
3QFRA 5CDFA 5GV7A 4QHYA 4M53A 1KK3A 3OJWA 1WSRA 2C4TA 4B43A 5KW9A 1NRKA 4RD1A 1VHEA 1BLIA 4ZCIA 1R5BA 4M0LA 1MRZA 4XNFA 3ZBTA 1YJNB 3OPOA 1FDRA 2VBVA 4PAAA 3CMAB 1E1RA 1J9ZA 2EIXA 4L8JA 1KTVA 3SEJA 1H8HA 3CPWB 3CCMB 1JA1A 1AIPA 3CTAA 1GR1A 3QE2A 3W2EA 3SLNA 5BSYA 3CCEB 2GJRA 3OZVA 1D2EA 2QMUA 4MYTA 2CNDA 1UD2A 4DQKA 4B44A 3I55B 2LZJA 1FNBA 3RY8A 4LC0A 5THXA 4XLCA 3VMFA 4PC7A 1GJRA 1VQ8B 4AC9A 2PLFA 4P2NA 4P9SA 1OB5A 2C4UA 1W2BB 3DDYA 1D1NA 4ZCLA 2W6JA 3E20A 3W2GA 2PIAA 4LBWA 4ZGQB 3CCRB 2GQFA 1WU8A 3OZWA 1K73D 2HLDA 1Q81D 1NJID 4RPDA 1UD5A 1N8RD 1YJ9B 4XMYA 1KD1D 3GVKA 3OW7A 4ROXA 2XZLA 1OGIA 2WR8A 3WBJA 2E1BA 2ZL6A 4PABA 3WNBA 2OTJB 4EH1A 4ZV4A 1EFTA 2OTLB 1ZUNB 4GQNA 1XB2A 3VNVA 2DETA 2Z6BD 3CCSB 1EWYA 4QUZA 3CB4A 3SJPA 5F4OA 4WWVA 2E1RA 4RD6A 4X7EA 1YJWB 3JQRA 3JQQA 1IJFA 1VQNB 2VZLA 1N05A 1YHQB 2CBXA 2FVGA 4XLEA 2ZITA 4P1VA 5IYQA 2BVNA 1SKQA 3KL9A 1WTHD 5A8AA 1QGYA 1VHOA 3ZC3A 4Z4UA 4DNRB 1H42A 1RQRA 4TMXA 1Q9SA 3WYAA 5IK2A 2KVOA 2GREA 1E63A 2PMDA 4H9GA 3CMMA 3LQ6A 4P26A 1UD6A 4OOXA 4YALA 5FNZA 4RDJA 3WBKA 1VQ7B 5FA6A 1R5OA 1G7SA 4ZGNB 3PA1A 3PUNA 3WQZA 2F4NA 2ZXHA 3HAGA 1TTTA 4P25A 3CC4B 1H8EA 3W5VA 1QFYA 1FNMA 1W87A 4RD2A 1OB2A 1BPLA 1OB0A 1N08A 1VF7A 4XM3A 4K1XA 1EP3B 2WPDA 4WZEA 3Q3AA 3QSYA 4X7CA 2DOGA 3NE5B 5FIUA 1QVGB 2X8KA 3A8JA 2XEXA 4E0FA 2Q6KA 1QH0A 3BCFA 2JJ1A 1Q86D 2R6HA 1T6YA 4G7XA 2HMAA 4XLFA 1KK0A 2HDNB 4WZKA 4WZLA 4WZTA 1E43A 3GVLA 1F20A 3CRZA 3J81k 3JQPA 2QDXA 4M4SA 2JIZA 4P6YA 5B6IA 2C2WA 1N07A 2YWEA 4G1BA 1TLLA 4XKVA 1FRQA 1YX2A 3R6JA 3FPPA 4C43A 3Q6RA 3BY2A 4G5GA 3BY1A 2VNHA 5KNLA 1W9XA 1BX1A 4P22A 1PJ6A 5TRDA 4X0CA 2WYRA 1W34A 2DEUA 2OK7A 1FX0A 2VNKA 1QFZA 3MHPA 4OPOA 3B8HA 3U2QA 2GK6A 3I1FA 2GJKA 4DQLA 2ZZQA 3A8IA 1G7CA 4X05A 1EFCA 2J7KA 3AGQA 3CCQB 1ZM3A 3OEHA 3LVBA 4ACBA 2FX3A 1XFOA 2V7VA 4P6VF 4P3YA 1Q82D 2V31A 4NNJA 1I8DA 4UZFA 3JU4A 2V4DA 3V76A 2BPOA 1NB9A 3SLDA 4B3XA 1XE1A 2B7BA 2OBRA 2XOKA 4CQJA 5TY0A 4B4DA 4HIZA 1JJ2B 1VQPB 2CF4A 4G7WA 2GPJA 5FL7A 5A89A 5TR9A 4TMWA 1VQ5B 4XOTA 2BV3A 4UZUA 1GAWA 1WORA 3ASSA 1QFJA 2DIEA 4PGOA 4RCYA 4II3A 1KZLA 5GV8A 2PE3A 4RJLA 2F1LA 5HZAA 4XN0A 4Y7CA 2V7QA 2OBSA 2WJVA 3CCVB 3GIRA 1VQKB 1V0EA 3T56B 2DERA 1UMKA 3QFTA 3T51B 3W5HA 2NPFA 2GK7A 4B3FX 1T6XA 4OPVA 3P26A 4XONA 3CESA 1DDGA 1QUEA 3U6KA 4HE6A 1VQ9B 2BM0A 4MYUA 1BQEA 3ISXA 4Y9RA 4RDLA 4QV2A 3AVVA 3D26A 1WPCA 2HCJB 4KKUA 3H9NA 2W6IA 2JDIA 4QVJA 3G71B 3CCJB 2XNDA 1TUIA 2WZNA 3VO1A 2CK3A 4Q7JB 1W35A 2QTLA 4TMTA 4RPBA 4U9UA 1VQMB 3WXMA 4M1KA 4NCNA 1COWA 1EP2B 1E3XA 2ZZGA 1WOSA 2R9VA 1ZM2A 2V7WA 1S4MA 4FN5A 3W5UA 4TMVA 3ZUGA 2EFGA 1SM4A 3OFNA 1K8AD 2ZZEA 1NDHA 1JB9A 2CW5A 2D3LA 4KKSA 1HVXA 1V0FA 1QVFB 3FPKA 1WOPA 3A3GA 3PVDA 4DK0A 2P3MA 4YAFA 4TKOB 2XNJA 4RLZA 4Z4ZA 3G05A 2VYQA 2NV4A 4Z4TA 1EFRA 2DY1A 1YIJB 4Z4SA 1BJKA 3CMEB 4G6IA 1N0VC 3Q39A 5H5JA 1CNFA 1PJ5A 2JJ2A 3AVYA 1QGZA 2QE7A 2Q6LA 3BCDA 3PUMA 2ZZFA 3P27A 1NBMA 1QG0A 1T5EA 4AF7A 1KQSB 5BSXA 3CC7B 4XLAA 4X8IA 4JMQA 3LQEA 3AGPA 1H85A 1YI2B 2GJPA 2D9RA 3MMPA 1WOOA 3PENA 2AHOA 1MABA 4DK1A 2I1LA 3A1PA 4YAUA 2ZXIA 4RM0A 5HZBA 5DN6A 5IYNA 1GVHA 2YWFA 2VJIA 5HKKA 4LBVA 3WY9A 4AVZA 3CC2B 3QFCA 3CCUB 1QGAA 1PJ7A 3VNUA 1S0UA 1BMFA 4TSFA 4Z1MA 2V7TA 1B23P 3ONUA 3OW2B 3AVWA 3ASQA 1VLYA 3LNNA 2OK8A 4IW3B 2VJJA 1ZM9A 2JN9A 1EXMA 4OPSA 3ZPNA 1WDTA 1M90D 3SJZA 1Y0RA 1A8PA 3FJOA 4LBYA 5DS0A 5J35A 3ONYA 3AVTA 1HZEA 2V7XA 3VO2A 2BF4A 4II2A 5IYPA 1E62A 2X6WA 5F4JA 1KC8D 3CD6B 1DDIA 1KRHA 4YHBA 5AN9A 1UD3A 1ZM4A 2CRVA 4B3GA 1I7PA 1DG1G 5EMNA 4Z4VA 2Q6OA 2VNIA 4FXUA 4P12A 4R71A 3W2FA 1QX4A 5KSWB 2C78A 3CW2A 1VQLB 1KK2A 3R6KA 2B5OA 4NBSA 2B7CA 2YWGA 4ASUA 1FRNA 5L46A 4RD3A 5IYWA 1KMHA 4XN3A 5DSZA 1OGJA 1U2RA 3A8KA 5LMZA 2M5SA 2WJYA 1BX0A 4XR6A 1XQBA 2XNCA 1E64A 2D3NA 2F43A 2V7UA 1F60A 4YXWA 2ZL7A 2QA4B 1E3ZA 4OP7A 2XZPA 5A88A 3ZBUA 1GO2A 3I56B 4J0QA 3ZZ0A 3PA2A 1VJSA 4XL9A 4Y9UA 2XGJA 2ZL5A 2VBUA 4RDKA 1UD4A 3CP8A 1N0UA 1S72B 1B2RA 4YELA 4QFMA 4TMZA 1I18A 1CNEA 1WSVA 3BC9A 3Q38A 2YWHA 1VLOA 2BM1A 4QVAA 2X85A 3CP2A 5JBQA 5E6TA 3OEEA 3WNDA 1K28D 1PKVA 4PC6A 2X3UA 4XKWA 4Z4YA 5HXBA 4YAWA 4OOSA 3VR6A 1V5VA 3ZZTA 1G7RA 4RD4A 4PC2A 2ZBUA 4RD0A 4YAOA 3WNCA 4C0SA 5J3OA 4X07A 4Z4WA 3CXCB 2ZTGA 1OHHA 2BMWA 1AMOA 2BN4A 3GSIA 2X53S 1T6ZA 3ZIAA 4P3IA 2WZPP 1IHMA 3ZZUA 3G6EB 2RC6A 1G7TA 2RC5A 4G1VA 4LBZA 2QEXB 1Y0YA 2VBSA 5F4MA 4XOPA 3H94A 4PC3A 1R5NA 2DCUA 3MCAA 1CQXA 3OOCA 4TT3A 4HE5A 1M1KD 2CC2A 5FO1A 2QN6A 1RQPA 3GQBA 3SKBA 2BSAA 2DYIA 1P4MA 4XLHA 3GVJA 1YITB 1EP1B 5H59A 2VNJA 4ZCMA 3OAAA 3A3BA 1YLOA 2Q6IA 2X0KA 1E1QA 3ES9A 3AVXA 2X6YA 3ASRA 2F1MA 5IYRA 2VBTA 4N3NA 4UAJA 5TV2A 4X7FA 4XQFA 4Z4RA 3T53B 3CCLB 2C5HA 1E79A 3FKSA 3A35A 3LO8A 3OP1A 3OZUA 2BGIA 4UZEA 3AVUA 3BH4A 4TN1A 3E1YE 1FNCA 2ZBVA 1W0JA 3KEWA 1VQ4B 1GAQA 3W2IA 4YEJA 1IJEA 2X6XA 3BQJA 3G4SB 2QGGA 1K9MD 3QFSA 4XD7A 2QTZA 1HA3A 4X06A 3BNWA 3OE7A 1N06A 2C5BA 2OBTA 2BGJA 3B82A 5FO0A 1ELOA 4XORA 1TVCA 4N3GA 1JNYA 3Q6QA 2XZOA 1FNDA 3B78A 1KK1A 4ACAA 4DNTB 4X7DA 2D74A 1W0KA 3U6BA 4M2LA 4RCZA 2OYNA 3OKXA 3ASPA 3OJXA 4WQMA 4OOVA 2C77A 1QUFA 1JA0A 1WP6A 3CPXA 1D8TA 4FK8A 4B48A 3V7AA 1NB0A 3ASTA 2WSSA 3W2HA 2ZTNA 4BPRA 1KJZA 4B47A 1UD8A 4FWTA 1SKYB 4PC1A 1VQOB 4KKTA 4AF6A 1Q7YD 1EFUA 1DARA 4F7DA 1VQ6B 1IB0A
chains in the Genus database with same CATH topology
3QFRA 5GV7A 4QHYA 4M53A 1KK3A 3OJWA 4B43A 4RD1A 4ZCIA 1R5BA 4M0LA 3ZBTA 1YJNB 1FDRA 3CMAB 3CCMB 1J9ZA 2EIXA 3CPWB 1KTVA 1JA1A 1AIPA 1GR1A 3QE2A 3W2EA 3CCEB 3OZVA 1D2EA 2QMUA 4MYTA 2CNDA 4DQKA 4B44A 3I55B 1FNBA 4LC0A 5THXA 3VMFA 4PC7A 1GJRA 1VQ8B 4AC9A 2PLFA 1OB5A 1D1NA 1W2BB 4ZCLA 3E20A 3W2GA 2PIAA 4LBWA 4ZGQB 3CCRB 2GQFA 3OZWA 1K73D 1Q81D 1NJID 1N8RD 1YJ9B 1KD1D 1OGIA 3WBJA 3WNBA 2OTJB 4EH1A 4ZV4A 1EFTA 2OTLB 1ZUNB 1XB2A 3VNVA 2DETA 3CCSB 1EWYA 3CB4A 2E1RA 4RD6A 1YJWB 3JQRA 3JQQA 1IJFA 1VQNB 2VZLA 1YHQB 2ZITA 2BVNA 1SKQA 1QGYA 3ZC3A 1H42A 4TMXA 3WYAA 2PMDA 1E63A 3WBKA 4H9GA 4YALA 1VQ7B 5FA6A 1R5OA 1G7SA 4ZGNB 1TTTA 3CC4B 3W5VA 1QFYA 1FNMA 1W87A 4RD2A 1OB2A 4K1XA 1EP3B 3QSYA 1QVGB 2XEXA 1QH0A 1Q86D 2R6HA 2HMAA 1KK0A 2HDNB 1F20A 3CRZA 3J81k 3JQPA 2QDXA 4M4SA 2YWEA 4G1BA 1TLLA 1FRQA 4C43A 4G5GA 2VNHA 1BX1A 1W34A 2DEUA 2OK7A 2VNKA 1QFZA 3MHPA 3B8HA 3U2QA 3I1FA 4DQLA 1G7CA 1EFCA 2J7KA 3AGQA 3CCQB 1ZM3A 3LVBA 4ACBA 2FX3A 4P6VF 4P3YA 1Q82D 3V76A 2BPOA 4B3XA 1XE1A 2B7BA 5TY0A 4B4DA 1JJ2B 1VQPB 2GPJA 5TR9A 4TMWA 1VQ5B 2BV3A 1GAWA 1QFJA 4PGOA 4RCYA 5GV8A 4RJLA 4Y7CA 3CCVB 1VQKB 2DERA 1UMKA 3QFTA 3W5HA 2NPFA 3P26A 1DDGA 1QUEA 3U6KA 4HE6A 1VQ9B 2BM0A 4MYUA 1BQEA 4Y9RA 3AVVA 2HCJB 3G71B 3CCJB 1TUIA 3VO1A 4Q7JB 1W35A 2QTLA 4TMTA 4U9UA 1VQMB 3WXMA 4M1KA 4NCNA 1EP2B 1ZM2A 4FN5A 3W5UA 4TMVA 2EFGA 1SM4A 1K8AD 1NDHA 1JB9A 1QVFB 3FPKA 4YAFA 2XNJA 2VYQA 2DY1A 1YIJB 1BJKA 3CMEB 1N0VC 5H5JA 1CNFA 3AVYA 1QGZA 3P27A 1QG0A 4AF7A 1KQSB 3CC7B 3AGPA 1H85A 1YI2B 3MMPA 3PENA 2AHOA 4YAUA 1GVHA 2YWFA 4LBVA 3WY9A 3CC2B 3QFCA 3CCUB 1QGAA 3VNUA 1S0UA 1B23P 3OW2B 3AVWA 2OK8A 4IW3B 1ZM9A 1EXMA 1WDTA 1M90D 3SJZA 1A8PA 3FJOA 4LBYA 3AVTA 3VO2A 2BF4A 1E62A 1KC8D 3CD6B 1DDIA 1KRHA 4YHBA 5AN9A 1ZM4A 2CRVA 1I7PA 1DG1G 5EMNA 2VNIA 4R71A 3W2FA 1QX4A 5KSWB 2C78A 3CW2A 1VQLB 1KK2A 2B5OA 4NBSA 2B7CA 2YWGA 1FRNA 4RD3A 5DSZA 1OGJA 1U2RA 1BX0A 2XNCA 1E64A 1F60A 2QA4B 3ZBUA 1GO2A 3I56B 4J0QA 3ZZ0A 4Y9UA 1N0UA 1S72B 1B2RA 4QFMA 4TMZA 1CNEA 2YWHA 2BM1A 5JBQA 3WNDA 4PC6A 2X3UA 5HXBA 4YAWA 3ZZTA 1G7RA 4RD4A 4PC2A 4RD0A 4YAOA 3WNCA 4C0SA 3CXCB 2BMWA 1AMOA 2BN4A 3ZZUA 3G6EB 2RC6A 1G7TA 2RC5A 4G1VA 4LBZA 2QEXB 4PC3A 1R5NA 2DCUA 3MCAA 1CQXA 4HE5A 1M1KD 2QN6A 2BSAA 1YITB 1EP1B 5H59A 2VNJA 4ZCMA 3AVXA 3ES9A 4N3NA 4UAJA 5TV2A 3CCLB 3LO8A 3OZUA 3AVUA 2BGIA 4TN1A 3E1YE 1FNCA 1VQ4B 1GAQA 3W2IA 1IJEA 3G4SB 1K9MD 3QFSA 2QTZA 1HA3A 2BGJA 3B82A 1ELOA 1TVCA 4N3GA 1JNYA 1FNDA 3B78A 1KK1A 4ACAA 2D74A 3U6BA 4M2LA 4RCZA 3OJXA 4WQMA 2C77A 1QUFA 1JA0A 1D8TA 4FK8A 4B48A 3W2HA 4BPRA 1KJZA 4B47A 4FWTA 4PC1A 1VQOB 1Q7YD 4AF6A 1EFUA 1DARA 4F7DA 1VQ6B 1IB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFR A;  5GV7 A;  4QHY A;  4M53 A;  1KK3 A;  3OJW A;  4B43 A;  4RD1 A;  4ZCI A;  1R5B A;  4M0L A;  3ZBT A;  1YJN B;  1FDR A;  3CMA B;  3CCM B;  1J9Z A;  2EIX A;  3CPW B;  1KTV A;  1JA1 A;  1AIP A;  1GR1 A;  3QE2 A;  3W2E A;  3CCE B;  3OZV A;  1D2E A;  2QMU A;  4MYT A;  2CND A;  4DQK A;  4B44 A;  3I55 B;  1FNB A;  4LC0 A;  5THX A;  3VMF A;  4PC7 A;  1GJR A;  1VQ8 B;  4AC9 A;  2PLF A;  1OB5 A;  1D1N A;  1W2B B;  4ZCL A;  3E20 A;  3W2G A;  2PIA A;  4LBW A;  4ZGQ B;  3CCR B;  2GQF A;  3OZW A;  1K73 D;  1Q81 D;  1NJI D;  1N8R D;  1YJ9 B;  1KD1 D;  1OGI A;  3WBJ A;  3WNB A;  2OTJ B;  4EH1 A;  4ZV4 A;  1EFT A;  2OTL B;  1ZUN B;  1XB2 A;  3VNV A;  2DET A;  3CCS B;  1EWY A;  3CB4 A;  2E1R A;  4RD6 A;  1YJW B;  3JQR A;  3JQQ A;  1IJF A;  1VQN B;  2VZL A;  1YHQ B;  2ZIT A;  2BVN A;  1SKQ A;  1QGY A;  3ZC3 A;  1H42 A;  4TMX A;  3WYA A;  2PMD A;  1E63 A;  3WBK A;  4H9G A;  4YAL A;  1VQ7 B;  5FA6 A;  1R5O A;  1G7S A;  4ZGN B;  1TTT A;  3CC4 B;  3W5V A;  1QFY A;  1FNM A;  1W87 A;  4RD2 A;  1OB2 A;  4K1X A;  1EP3 B;  3QSY A;  1QVG B;  2XEX A;  1QH0 A;  1Q86 D;  2R6H A;  2HMA A;  1KK0 A;  2HDN B;  1F20 A;  3CRZ A;  3J81 k;  3JQP A;  2QDX A;  4M4S A;  2YWE A;  4G1B A;  1TLL A;  1FRQ A;  4C43 A;  4G5G A;  2VNH A;  1BX1 A;  1W34 A;  2DEU A;  2OK7 A;  2VNK A;  1QFZ A;  3MHP A;  3B8H A;  3U2Q A;  3I1F A;  4DQL A;  1G7C A;  1EFC A;  2J7K A;  3AGQ A;  3CCQ B;  1ZM3 A;  3LVB A;  4ACB A;  2FX3 A;  4P6V F;  4P3Y A;  1Q82 D;  3V76 A;  2BPO A;  4B3X A;  1XE1 A;  2B7B A;  5TY0 A;  4B4D A;  1JJ2 B;  1VQP B;  2GPJ A;  5TR9 A;  4TMW A;  1VQ5 B;  2BV3 A;  1GAW A;  1QFJ A;  4PGO A;  4RCY A;  5GV8 A;  4RJL A;  4Y7C A;  3CCV B;  1VQK B;  2DER A;  1UMK A;  3QFT A;  3W5H A;  2NPF A;  3P26 A;  1DDG A;  1QUE A;  3U6K A;  4HE6 A;  1VQ9 B;  2BM0 A;  4MYU A;  1BQE A;  4Y9R A;  3AVV A;  2HCJ B;  3G71 B;  3CCJ B;  1TUI A;  3VO1 A;  4Q7J B;  1W35 A;  2QTL A;  4TMT A;  4U9U A;  1VQM B;  3WXM A;  4M1K A;  4NCN A;  1EP2 B;  1ZM2 A;  4FN5 A;  3W5U A;  4TMV A;  2EFG A;  1SM4 A;  1K8A D;  1NDH A;  1JB9 A;  1QVF B;  3FPK A;  4YAF A;  2XNJ A;  2VYQ A;  2DY1 A;  1YIJ B;  1BJK A;  3CME B;  1N0V C;  5H5J A;  1CNF A;  3AVY A;  1QGZ A;  3P27 A;  1QG0 A;  4AF7 A;  1KQS B;  3CC7 B;  3AGP A;  1H85 A;  1YI2 B;  3MMP A;  3PEN A;  2AHO A;  4YAU A;  1GVH A;  2YWF A;  4LBV A;  3WY9 A;  3CC2 B;  3QFC A;  3CCU B;  1QGA A;  3VNU A;  1S0U A;  1B23 P;  3OW2 B;  3AVW A;  2OK8 A;  4IW3 B;  1ZM9 A;  1EXM A;  1WDT A;  1M90 D;  3SJZ A;  1A8P A;  3FJO A;  4LBY A;  3AVT A;  3VO2 A;  2BF4 A;  1E62 A;  1KC8 D;  3CD6 B;  1DDI A;  1KRH A;  4YHB A;  5AN9 A;  1ZM4 A;  2CRV A;  1I7P A;  1DG1 G;  5EMN A;  2VNI A;  4R71 A;  3W2F A;  1QX4 A;  5KSW B;  2C78 A;  3CW2 A;  1VQL B;  1KK2 A;  2B5O A;  4NBS A;  2B7C A;  2YWG A;  1FRN A;  4RD3 A;  5DSZ A;  1OGJ A;  1U2R A;  1BX0 A;  2XNC A;  1E64 A;  1F60 A;  2QA4 B;  3ZBU A;  1GO2 A;  3I56 B;  4J0Q A;  3ZZ0 A;  4Y9U A;  1N0U A;  1S72 B;  1B2R A;  4QFM A;  4TMZ A;  1CNE A;  2YWH A;  2BM1 A;  5JBQ A;  3WND A;  4PC6 A;  2X3U A;  5HXB A;  4YAW A;  3ZZT A;  1G7R A;  4RD4 A;  4PC2 A;  4RD0 A;  4YAO A;  3WNC A;  4C0S A;  3CXC B;  2BMW A;  1AMO A;  2BN4 A;  3ZZU A;  3G6E B;  2RC6 A;  1G7T A;  2RC5 A;  4G1V A;  4LBZ A;  2QEX B;  4PC3 A;  1R5N A;  2DCU A;  3MCA A;  1CQX A;  4HE5 A;  1M1K D;  2QN6 A;  2BSA A;  1YIT B;  1EP1 B;  5H59 A;  2VNJ A;  4ZCM A;  3AVX A;  3ES9 A;  4N3N A;  4UAJ A;  5TV2 A;  3CCL B;  3LO8 A;  3OZU A;  3AVU A;  2BGI A;  4TN1 A;  3E1Y E;  1FNC A;  1VQ4 B;  1GAQ A;  3W2I A;  1IJE A;  3G4S B;  1K9M D;  3QFS A;  2QTZ A;  1HA3 A;  2BGJ A;  3B82 A;  1ELO A;  1TVC A;  4N3G A;  1JNY A;  1FND A;  3B78 A;  1KK1 A;  4ACA A;  2D74 A;  3U6B A;  4M2L A;  4RCZ A;  3OJX A;  4WQM A;  2C77 A;  1QUF A;  1JA0 A;  1D8T A;  4FK8 A;  4B48 A;  3W2H A;  4BPR A;  1KJZ A;  4B47 A;  4FWT A;  4PC1 A;  1VQO B;  1Q7Y D;  4AF6 A;  1EFU A;  1DAR A;  4F7D A;  1VQ6 B;  1IB0 A; 
#chains in the Genus database with same CATH topology
 3QFR A;  5CDF A;  5GV7 A;  4QHY A;  4M53 A;  1KK3 A;  3OJW A;  1WSR A;  2C4T A;  4B43 A;  5KW9 A;  1NRK A;  4RD1 A;  1VHE A;  1BLI A;  4ZCI A;  1R5B A;  4M0L A;  1MRZ A;  4XNF A;  3ZBT A;  1YJN B;  3OPO A;  1FDR A;  2VBV A;  4PAA A;  3CMA B;  1E1R A;  1J9Z A;  2EIX A;  4L8J A;  1KTV A;  3SEJ A;  1H8H A;  3CPW B;  3CCM B;  1JA1 A;  1AIP A;  3CTA A;  1GR1 A;  3QE2 A;  3W2E A;  3SLN A;  5BSY A;  3CCE B;  2GJR A;  3OZV A;  1D2E A;  2QMU A;  4MYT A;  2CND A;  1UD2 A;  4DQK A;  4B44 A;  3I55 B;  2LZJ A;  1FNB A;  3RY8 A;  4LC0 A;  5THX A;  4XLC A;  3VMF A;  4PC7 A;  1GJR A;  1VQ8 B;  4AC9 A;  2PLF A;  4P2N A;  4P9S A;  1OB5 A;  2C4U A;  1W2B B;  3DDY A;  1D1N A;  4ZCL A;  2W6J A;  3E20 A;  3W2G A;  2PIA A;  4LBW A;  4ZGQ B;  3CCR B;  2GQF A;  1WU8 A;  3OZW A;  1K73 D;  2HLD A;  1Q81 D;  1NJI D;  4RPD A;  1UD5 A;  1N8R D;  1YJ9 B;  4XMY A;  1KD1 D;  3GVK A;  3OW7 A;  4ROX A;  2XZL A;  1OGI A;  2WR8 A;  3WBJ A;  2E1B A;  2ZL6 A;  4PAB A;  3WNB A;  2OTJ B;  4EH1 A;  4ZV4 A;  1EFT A;  2OTL B;  1ZUN B;  4GQN A;  1XB2 A;  3VNV A;  2DET A;  2Z6B D;  3CCS B;  1EWY A;  4QUZ A;  3CB4 A;  3SJP A;  5F4O A;  4WWV A;  2E1R A;  4RD6 A;  4X7E A;  1YJW B;  3JQR A;  3JQQ A;  1IJF A;  1VQN B;  2VZL A;  1N05 A;  1YHQ B;  2CBX A;  2FVG A;  4XLE A;  2ZIT A;  4P1V A;  5IYQ A;  2BVN A;  1SKQ A;  3KL9 A;  1WTH D;  5A8A A;  1QGY A;  1VHO A;  3ZC3 A;  4Z4U A;  4DNR B;  1H42 A;  1RQR A;  4TMX A;  1Q9S A;  3WYA A;  5IK2 A;  2KVO A;  2GRE A;  1E63 A;  2PMD A;  4H9G A;  3CMM A;  3LQ6 A;  4P26 A;  1UD6 A;  4OOX A;  4YAL A;  5FNZ A;  4RDJ A;  3WBK A;  1VQ7 B;  5FA6 A;  1R5O A;  1G7S A;  4ZGN B;  3PA1 A;  3PUN A;  3WQZ A;  2F4N A;  2ZXH A;  3HAG A;  1TTT A;  4P25 A;  3CC4 B;  1H8E A;  3W5V A;  1QFY A;  1FNM A;  1W87 A;  4RD2 A;  1OB2 A;  1BPL A;  1OB0 A;  1N08 A;  1VF7 A;  4XM3 A;  4K1X A;  1EP3 B;  2WPD A;  4WZE A;  3Q3A A;  3QSY A;  4X7C A;  2DOG A;  3NE5 B;  5FIU A;  1QVG B;  2X8K A;  3A8J A;  2XEX A;  4E0F A;  2Q6K A;  1QH0 A;  3BCF A;  2JJ1 A;  1Q86 D;  2R6H A;  1T6Y A;  4G7X A;  2HMA A;  4XLF A;  1KK0 A;  2HDN B;  4WZK A;  4WZL A;  4WZT A;  1E43 A;  3GVL A;  1F20 A;  3CRZ A;  3J81 k;  3JQP A;  2QDX A;  4M4S A;  2JIZ A;  4P6Y A;  5B6I A;  2C2W A;  1N07 A;  2YWE A;  4G1B A;  1TLL A;  4XKV A;  1FRQ A;  1YX2 A;  3R6J A;  3FPP A;  4C43 A;  3Q6R A;  3BY2 A;  4G5G A;  3BY1 A;  2VNH A;  5KNL A;  1W9X A;  1BX1 A;  4P22 A;  1PJ6 A;  5TRD A;  4X0C A;  2WYR A;  1W34 A;  2DEU A;  2OK7 A;  1FX0 A;  2VNK A;  1QFZ A;  3MHP A;  4OPO A;  3B8H A;  3U2Q A;  2GK6 A;  3I1F A;  2GJK A;  4DQL A;  2ZZQ A;  3A8I A;  1G7C A;  4X05 A;  1EFC A;  2J7K A;  3AGQ A;  3CCQ B;  1ZM3 A;  3OEH A;  3LVB A;  4ACB A;  2FX3 A;  1XFO A;  2V7V A;  4P6V F;  4P3Y A;  1Q82 D;  2V31 A;  4NNJ A;  1I8D A;  4UZF A;  3JU4 A;  2V4D A;  3V76 A;  2BPO A;  1NB9 A;  3SLD A;  4B3X A;  1XE1 A;  2B7B A;  2OBR A;  2XOK A;  4CQJ A;  5TY0 A;  4B4D A;  4HIZ A;  1JJ2 B;  1VQP B;  2CF4 A;  4G7W A;  2GPJ A;  5FL7 A;  5A89 A;  5TR9 A;  4TMW A;  1VQ5 B;  4XOT A;  2BV3 A;  4UZU A;  1GAW A;  1WOR A;  3ASS A;  1QFJ A;  2DIE A;  4PGO A;  4RCY A;  4II3 A;  1KZL A;  5GV8 A;  2PE3 A;  4RJL A;  2F1L A;  5HZA A;  4XN0 A;  4Y7C A;  2V7Q A;  2OBS A;  2WJV A;  3CCV B;  3GIR A;  1VQK B;  1V0E A;  3T56 B;  2DER A;  1UMK A;  3QFT A;  3T51 B;  3W5H A;  2NPF A;  2GK7 A;  4B3F X;  1T6X A;  4OPV A;  3P26 A;  4XON A;  3CES A;  1DDG A;  1QUE A;  3U6K A;  4HE6 A;  1VQ9 B;  2BM0 A;  4MYU A;  1BQE A;  3ISX A;  4Y9R A;  4RDL A;  4QV2 A;  3AVV A;  3D26 A;  1WPC A;  2HCJ B;  4KKU A;  3H9N A;  2W6I A;  2JDI A;  4QVJ A;  3G71 B;  3CCJ B;  2XND A;  1TUI A;  2WZN A;  3VO1 A;  2CK3 A;  4Q7J B;  1W35 A;  2QTL A;  4TMT A;  4RPB A;  4U9U A;  1VQM B;  3WXM A;  4M1K A;  4NCN A;  1COW A;  1EP2 B;  1E3X A;  2ZZG A;  1WOS A;  2R9V A;  1ZM2 A;  2V7W A;  1S4M A;  4FN5 A;  3W5U A;  4TMV A;  3ZUG A;  2EFG A;  1SM4 A;  3OFN A;  1K8A D;  2ZZE A;  1NDH A;  1JB9 A;  2CW5 A;  2D3L A;  4KKS A;  1HVX A;  1V0F A;  1QVF B;  3FPK A;  1WOP A;  3A3G A;  3PVD A;  4DK0 A;  2P3M A;  4YAF A;  4TKO B;  2XNJ A;  4RLZ A;  4Z4Z A;  3G05 A;  2VYQ A;  2NV4 A;  4Z4T A;  1EFR A;  2DY1 A;  1YIJ B;  4Z4S A;  1BJK A;  3CME B;  4G6I A;  1N0V C;  3Q39 A;  5H5J A;  1CNF A;  1PJ5 A;  2JJ2 A;  3AVY A;  1QGZ A;  2QE7 A;  2Q6L A;  3BCD A;  3PUM A;  2ZZF A;  3P27 A;  1NBM A;  1QG0 A;  1T5E A;  4AF7 A;  1KQS B;  5BSX A;  3CC7 B;  4XLA A;  4X8I A;  4JMQ A;  3LQE A;  3AGP A;  1H85 A;  1YI2 B;  2GJP A;  2D9R A;  3MMP A;  1WOO A;  3PEN A;  2AHO A;  1MAB A;  4DK1 A;  2I1L A;  3A1P A;  4YAU A;  2ZXI A;  4RM0 A;  5HZB A;  5DN6 A;  5IYN A;  1GVH A;  2YWF A;  2VJI A;  5HKK A;  4LBV A;  3WY9 A;  4AVZ A;  3CC2 B;  3QFC A;  3CCU B;  1QGA A;  1PJ7 A;  3VNU A;  1S0U A;  1BMF A;  4TSF A;  4Z1M A;  2V7T A;  1B23 P;  3ONU A;  3OW2 B;  3AVW A;  3ASQ A;  1VLY A;  3LNN A;  2OK8 A;  4IW3 B;  2VJJ A;  1ZM9 A;  2JN9 A;  1EXM A;  4OPS A;  3ZPN A;  1WDT A;  1M90 D;  3SJZ A;  1Y0R A;  1A8P A;  3FJO A;  4LBY A;  5DS0 A;  5J35 A;  3ONY A;  3AVT A;  1HZE A;  2V7X A;  3VO2 A;  2BF4 A;  4II2 A;  5IYP A;  1E62 A;  2X6W A;  5F4J A;  1KC8 D;  3CD6 B;  1DDI A;  1KRH A;  4YHB A;  5AN9 A;  1UD3 A;  1ZM4 A;  2CRV A;  4B3G A;  1I7P A;  1DG1 G;  5EMN A;  4Z4V A;  2Q6O A;  2VNI A;  4FXU A;  4P12 A;  4R71 A;  3W2F A;  1QX4 A;  5KSW B;  2C78 A;  3CW2 A;  1VQL B;  1KK2 A;  3R6K A;  2B5O A;  4NBS A;  2B7C A;  2YWG A;  4ASU A;  1FRN A;  5L46 A;  4RD3 A;  5IYW A;  1KMH A;  4XN3 A;  5DSZ A;  1OGJ A;  1U2R A;  3A8K A;  5LMZ A;  2M5S A;  2WJY A;  1BX0 A;  4XR6 A;  1XQB A;  2XNC A;  1E64 A;  2D3N A;  2F43 A;  2V7U A;  1F60 A;  4YXW A;  2ZL7 A;  2QA4 B;  1E3Z A;  4OP7 A;  2XZP A;  5A88 A;  3ZBU A;  1GO2 A;  3I56 B;  4J0Q A;  3ZZ0 A;  3PA2 A;  1VJS A;  4XL9 A;  4Y9U A;  2XGJ A;  2ZL5 A;  2VBU A;  4RDK A;  1UD4 A;  3CP8 A;  1N0U A;  1S72 B;  1B2R A;  4YEL A;  4QFM A;  4TMZ A;  1I18 A;  1CNE A;  1WSV A;  3BC9 A;  3Q38 A;  2YWH A;  1VLO A;  2BM1 A;  4QVA A;  2X85 A;  3CP2 A;  5JBQ A;  5E6T A;  3OEE A;  3WND A;  1K28 D;  1PKV A;  4PC6 A;  2X3U A;  4XKW A;  4Z4Y A;  5HXB A;  4YAW A;  4OOS A;  3VR6 A;  1V5V A;  3ZZT A;  1G7R A;  4RD4 A;  4PC2 A;  2ZBU A;  4RD0 A;  4YAO A;  3WNC A;  4C0S A;  5J3O A;  4X07 A;  4Z4W A;  3CXC B;  2ZTG A;  1OHH A;  2BMW A;  1AMO A;  2BN4 A;  3GSI A;  2X53 S;  1T6Z A;  3ZIA A;  4P3I A;  2WZP P;  1IHM A;  3ZZU A;  3G6E B;  2RC6 A;  1G7T A;  2RC5 A;  4G1V A;  4LBZ A;  2QEX B;  1Y0Y A;  2VBS A;  5F4M A;  4XOP A;  3H94 A;  4PC3 A;  1R5N A;  2DCU A;  3MCA A;  1CQX A;  3OOC A;  4TT3 A;  4HE5 A;  1M1K D;  2CC2 A;  5FO1 A;  2QN6 A;  1RQP A;  3GQB A;  3SKB A;  2BSA A;  2DYI A;  1P4M A;  4XLH A;  3GVJ A;  1YIT B;  1EP1 B;  5H59 A;  2VNJ A;  4ZCM A;  3OAA A;  3A3B A;  1YLO A;  2Q6I A;  2X0K A;  1E1Q A;  3ES9 A;  3AVX A;  2X6Y A;  3ASR A;  2F1M A;  5IYR A;  2VBT A;  4N3N A;  4UAJ A;  5TV2 A;  4X7F A;  4XQF A;  4Z4R A;  3T53 B;  3CCL B;  2C5H A;  1E79 A;  3FKS A;  3A35 A;  3LO8 A;  3OP1 A;  3OZU A;  2BGI A;  4UZE A;  3AVU A;  3BH4 A;  4TN1 A;  3E1Y E;  1FNC A;  2ZBV A;  1W0J A;  3KEW A;  1VQ4 B;  1GAQ A;  3W2I A;  4YEJ A;  1IJE A;  2X6X A;  3BQJ A;  3G4S B;  2QGG A;  1K9M D;  3QFS A;  4XD7 A;  2QTZ A;  1HA3 A;  4X06 A;  3BNW A;  3OE7 A;  1N06 A;  2C5B A;  2OBT A;  2BGJ A;  3B82 A;  5FO0 A;  1ELO A;  4XOR A;  1TVC A;  4N3G A;  1JNY A;  3Q6Q A;  2XZO A;  1FND A;  3B78 A;  1KK1 A;  4ACA A;  4DNT B;  4X7D A;  2D74 A;  1W0K A;  3U6B A;  4M2L A;  4RCZ A;  2OYN A;  3OKX A;  3ASP A;  3OJX A;  4WQM A;  4OOV A;  2C77 A;  1QUF A;  1JA0 A;  1WP6 A;  3CPX A;  1D8T A;  4FK8 A;  4B48 A;  3V7A A;  1NB0 A;  3AST A;  2WSS A;  3W2H A;  2ZTN A;  4BPR A;  1KJZ A;  4B47 A;  1UD8 A;  4FWT A;  1SKY B;  4PC1 A;  1VQO B;  4KKT A;  4AF6 A;  1Q7Y D;  1EFU A;  1DAR A;  4F7D A;  1VQ6 B;  1IB0 A; 
#chains in the Genus database with same CATH homology
 3QFR A;  5GV7 A;  4QHY A;  4M53 A;  1KK3 A;  3OJW A;  4B43 A;  4RD1 A;  4ZCI A;  1R5B A;  4M0L A;  3ZBT A;  1YJN B;  1FDR A;  3CMA B;  3CCM B;  1J9Z A;  2EIX A;  3CPW B;  1KTV A;  1JA1 A;  1AIP A;  1GR1 A;  3QE2 A;  3W2E A;  3CCE B;  3OZV A;  1D2E A;  2QMU A;  4MYT A;  2CND A;  4DQK A;  4B44 A;  3I55 B;  1FNB A;  4LC0 A;  5THX A;  3VMF A;  4PC7 A;  1GJR A;  1VQ8 B;  4AC9 A;  2PLF A;  1OB5 A;  1D1N A;  1W2B B;  4ZCL A;  3E20 A;  3W2G A;  2PIA A;  4LBW A;  4ZGQ B;  3CCR B;  2GQF A;  3OZW A;  1K73 D;  1Q81 D;  1NJI D;  1N8R D;  1YJ9 B;  1KD1 D;  1OGI A;  3WBJ A;  3WNB A;  2OTJ B;  4EH1 A;  4ZV4 A;  1EFT A;  2OTL B;  1ZUN B;  1XB2 A;  3VNV A;  2DET A;  3CCS B;  1EWY A;  3CB4 A;  2E1R A;  4RD6 A;  1YJW B;  3JQR A;  3JQQ A;  1IJF A;  1VQN B;  2VZL A;  1YHQ B;  2ZIT A;  2BVN A;  1SKQ A;  1QGY A;  3ZC3 A;  1H42 A;  4TMX A;  3WYA A;  2PMD A;  1E63 A;  3WBK A;  4H9G A;  4YAL A;  1VQ7 B;  5FA6 A;  1R5O A;  1G7S A;  4ZGN B;  1TTT A;  3CC4 B;  3W5V A;  1QFY A;  1FNM A;  1W87 A;  4RD2 A;  1OB2 A;  4K1X A;  1EP3 B;  3QSY A;  1QVG B;  2XEX A;  1QH0 A;  1Q86 D;  2R6H A;  2HMA A;  1KK0 A;  2HDN B;  1F20 A;  3CRZ A;  3J81 k;  3JQP A;  2QDX A;  4M4S A;  2YWE A;  4G1B A;  1TLL A;  1FRQ A;  4C43 A;  4G5G A;  2VNH A;  1BX1 A;  1W34 A;  2DEU A;  2OK7 A;  2VNK A;  1QFZ A;  3MHP A;  3B8H A;  3U2Q A;  3I1F A;  4DQL A;  1G7C A;  1EFC A;  2J7K A;  3AGQ A;  3CCQ B;  1ZM3 A;  3LVB A;  4ACB A;  2FX3 A;  4P6V F;  4P3Y A;  1Q82 D;  3V76 A;  2BPO A;  4B3X A;  1XE1 A;  2B7B A;  5TY0 A;  4B4D A;  1JJ2 B;  1VQP B;  2GPJ A;  5TR9 A;  4TMW A;  1VQ5 B;  2BV3 A;  1GAW A;  1QFJ A;  4PGO A;  4RCY A;  5GV8 A;  4RJL A;  4Y7C A;  3CCV B;  1VQK B;  2DER A;  1UMK A;  3QFT A;  3W5H A;  2NPF A;  3P26 A;  1DDG A;  1QUE A;  3U6K A;  4HE6 A;  1VQ9 B;  2BM0 A;  4MYU A;  1BQE A;  4Y9R A;  3AVV A;  2HCJ B;  3G71 B;  3CCJ B;  1TUI A;  3VO1 A;  4Q7J B;  1W35 A;  2QTL A;  4TMT A;  4U9U A;  1VQM B;  3WXM A;  4M1K A;  4NCN A;  1EP2 B;  1ZM2 A;  4FN5 A;  3W5U A;  4TMV A;  2EFG A;  1SM4 A;  1K8A D;  1NDH A;  1JB9 A;  1QVF B;  3FPK A;  4YAF A;  2XNJ A;  2VYQ A;  2DY1 A;  1YIJ B;  1BJK A;  3CME B;  1N0V C;  5H5J A;  1CNF A;  3AVY A;  1QGZ A;  3P27 A;  1QG0 A;  4AF7 A;  1KQS B;  3CC7 B;  3AGP A;  1H85 A;  1YI2 B;  3MMP A;  3PEN A;  2AHO A;  4YAU A;  1GVH A;  2YWF A;  4LBV A;  3WY9 A;  3CC2 B;  3QFC A;  3CCU B;  1QGA A;  3VNU A;  1S0U A;  1B23 P;  3OW2 B;  3AVW A;  2OK8 A;  4IW3 B;  1ZM9 A;  1EXM A;  1WDT A;  1M90 D;  3SJZ A;  1A8P A;  3FJO A;  4LBY A;  3AVT A;  3VO2 A;  2BF4 A;  1E62 A;  1KC8 D;  3CD6 B;  1DDI A;  1KRH A;  4YHB A;  5AN9 A;  1ZM4 A;  2CRV A;  1I7P A;  1DG1 G;  5EMN A;  2VNI A;  4R71 A;  3W2F A;  1QX4 A;  5KSW B;  2C78 A;  3CW2 A;  1VQL B;  1KK2 A;  2B5O A;  4NBS A;  2B7C A;  2YWG A;  1FRN A;  4RD3 A;  5DSZ A;  1OGJ A;  1U2R A;  1BX0 A;  2XNC A;  1E64 A;  1F60 A;  2QA4 B;  3ZBU A;  1GO2 A;  3I56 B;  4J0Q A;  3ZZ0 A;  4Y9U A;  1N0U A;  1S72 B;  1B2R A;  4QFM A;  4TMZ A;  1CNE A;  2YWH A;  2BM1 A;  5JBQ A;  3WND A;  4PC6 A;  2X3U A;  5HXB A;  4YAW A;  3ZZT A;  1G7R A;  4RD4 A;  4PC2 A;  4RD0 A;  4YAO A;  3WNC A;  4C0S A;  3CXC B;  2BMW A;  1AMO A;  2BN4 A;  3ZZU A;  3G6E B;  2RC6 A;  1G7T A;  2RC5 A;  4G1V A;  4LBZ A;  2QEX B;  4PC3 A;  1R5N A;  2DCU A;  3MCA A;  1CQX A;  4HE5 A;  1M1K D;  2QN6 A;  2BSA A;  1YIT B;  1EP1 B;  5H59 A;  2VNJ A;  4ZCM A;  3AVX A;  3ES9 A;  4N3N A;  4UAJ A;  5TV2 A;  3CCL B;  3LO8 A;  3OZU A;  3AVU A;  2BGI A;  4TN1 A;  3E1Y E;  1FNC A;  1VQ4 B;  1GAQ A;  3W2I A;  1IJE A;  3G4S B;  1K9M D;  3QFS A;  2QTZ A;  1HA3 A;  2BGJ A;  3B82 A;  1ELO A;  1TVC A;  4N3G A;  1JNY A;  1FND A;  3B78 A;  1KK1 A;  4ACA A;  2D74 A;  3U6B A;  4M2L A;  4RCZ A;  3OJX A;  4WQM A;  2C77 A;  1QUF A;  1JA0 A;  1D8T A;  4FK8 A;  4B48 A;  3W2H A;  4BPR A;  1KJZ A;  4B47 A;  4FWT A;  4PC1 A;  1VQO B;  1Q7Y D;  4AF6 A;  1EFU A;  1DAR A;  4F7D A;  1VQ6 B;  1IB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...