1N08A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative riboflavin kinase
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 38
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n08A00
3OP1A 2VBTA 5A89A 1T6ZA 1N08A 1NB0A 2OYNA 5TRDA 1P4MA 1T6YA 2I1LA 5A8AA 1N07A 4UZFA 1MRZA 5FNZA 5A88A 5FO0A 1N06A 3BNWA 2X0KA 3ZUGA 2VBVA 2VBUA 1T6XA 1Q9SA 4UZEA 3CTAA 1N05A 5FO1A 1NB9A 1S4MA 2VBSA 2P3MA
chains in the Genus database with same CATH superfamily
1BLIA 3OFNA 3B78A 4NCNA 5TRDA 1V0FA 4KKTA 5TV2A 1KRHA 2OBSA 3ZZTA 5F4JA 2D3NA 4YAOA 4ZCIA 2OBRA 4ZGNB 3OW7A 1CNFA 1T6XA 1Q82D 3AGPA 1FNBA 4ROXA 4P1VA 4CQJA 4LBVA 4XR6A 4XQFA 5L46A 2V31A 4Y9RA 5IYQA 4M4SA 4EH1A 5LMZA 2BGIA 2Q6OA 4RD3A 1GAQA 4XOPA 2W6IA 1IJEA 4B47A 1N07A 5J35A 4TMXA 4Y9UA 4M1KA 1EP1B 3G71B 4ZV4A 3WXMA 2JDIA 4M0LA 4XN0A 4RLZA 1UMKA 1YLOA 4Z4SA 1YI2B 1WOSA 1QVGB 1WP6A 3Q3AA 2X6WA 4HE5A 3QSYA 4FWTA 1OHHA 1V0EA 3FPKA 3PUMA 2OTLB 4YAFA 3W2EA 1PJ6A 2FVGA 1BX0A 4DQKA 4P9SA 2V4DA 1M1KD 1VLOA 1KK1A 2F1MA 4RCZA 4PGOA 3R6JA 1YJ9B 3QFSA 4PC6A 1EWYA 1WOPA 2ZITA 1FRQA 3PVDA 1UD5A 3T51B 3CCQB 5DS0A 4M2LA 2I1LA 2V7VA 1I7PA 2JIZA 3ONYA 4RDKA 1YIJB 1EP2B 4X8IA 4TSFA 1ELOA 1KMHA 3ZBTA 4G6IA 3VNUA 2JN9A 3GVLA 2DOGA 4FK8A 1K73D 4WZTA 4GQNA 2Q6IA 3BY1A 2B5OA 3PUNA 1JA1A 1QGAA 4HIZA 3VR6A 1CNEA 5FO1A 3DDYA 3WNCA 3CPXA 3W5HA 4RJLA 4X7DA 4R71A 4H9GA 2BM1A 1BPLA 4OPVA 3JU4A 3OZVA 2RC6A 4PABA 1R5NA 2WPDA 4RDJA 4YXWA 3BH4A 1ZM9A 3Q6QA 3WYAA 1BJKA 3SJPA 3CC7B 1A8PA 1VQ6B 4PC1A 3OZWA 1E79A 3ASQA 1MRZA 4ACBA 2KVOA 4X05A 2C5BA 3NE5B 2YWHA 4LC0A 4RD1A 1VQ9B 1DDGA 3CCRB 3U2QA 2D74A 3AVVA 5B6IA 1G7TA 4P2NA 3AVWA 2M5SA 5HKKA 5KSWB 4XLFA 4RD2A 3R6KA 1WSVA 2Q6KA 2V7XA 2VJJA 1G7CA 4Z1MA 2OBTA 1UD6A 1E1RA 3BQJA 3WBKA 1NJID 2BV3A 3H94A 3WNBA 4UZUA 4JMQA 3SJZA 3CRZA 4KKUA 4XM3A 2QDXA 2QEXB 4LBYA 4RPBA 2YWGA 1T5EA 2AHOA 1CQXA 3V7AA 1YJWB 2E1RA 1QFZA 1OGJA 1VQPB 5H59A 1E3XA 4TT3A 1QFYA 2QE7A 4AC9A 3PENA 4NNJA 2VNJA 2XZPA 1HA3A 1K8AD 1W35A 4XLHA 2BM0A 3CP8A 4XORA 3CCUB 4XOTA 1F60A 2VBSA 5E6TA 1R5OA 4P6VF 2ZXHA 3Q39A 1KC8D 4Z4ZA 3JQRA 2V7WA 5IYPA 3AVYA 1E43A 4DNTB 4ASUA 3JQPA 2JJ1A 4QV2A 1QGYA 2JJ2A 3CCLB 2WSSA 3ZC3A 1W34A 4XLCA 3W2HA 4F7DA 4P3IA 4BPRA 4PC2A 3LO8A 1YITB 3SLNA 2EFGA 3G05A 4B4DA 4B3GA 1UD8A 3A1PA 3CPWB 3ASSA 2PMDA 3BCDA 1QH0A 4DK1A 3VMFA 2ZZEA 4TMVA 4G5GA 1VQNB 3CMAB 1ZM3A 4FN5A 4RM0A 3AVUA 4G7XA 1E62A 2XGJA 1G7RA 1KJZA 4OP7A 2VJIA 3OW2B 1EP3B 2ZL5A 5DSZA 3HAGA 5A8AA 2VNHA 4RD4A 5TR9A 1VQ5B 2DCUA 3SKBA 3QE2A 1AMOA 1VLYA 1Q9SA 3Q38A 2V7TA 1JA0A 2ZL6A 4PAAA 4X06A 4B43A 3W5VA 4RD0A 2ZL7A 4YALA 3OEEA 1RQPA 2E1BA 2XEXA 3MMPA 2VBTA 3OE7A 1GVHA 1PJ5A 3W2FA 1Y0RA 3AGQA 4X0CA 3WY9A 2WYRA 2LZJA 1OB5A 3OEHA 3QFTA 3A8JA 2VZLA 2WJVA 5IYWA 3CCEB 1YHQB 1W87A 5FO0A 1D8TA 1DARA 2R6HA 3A3BA 4B44A 2WR8A 2XNDA 1DG1G 3PA1A 4ZGQB 1ZM4A 2C4UA 1VQ7B 4XLAA 3CCJB 5CDFA 5GV8A 1H8EA 1GAWA 1H8HA 3A35A 4X7FA 4DK0A 2J7KA 1E1QA 2BMWA 4XNFA 3W2IA 3AVXA 1TTTA 3OP1A 4ZCMA 4QVJA 1K28D 3OZUA 3LQ6A 1DDIA 1N08A 2V7QA 3ZZ0A 4XMYA 1K9MD 3ZBUA 1FNDA 1T6YA 3CCMB 1WOOA 2PLFA 3AVTA 5F4OA 2C5HA 1SKYB 3CMMA 2X8KA 1S0UA 1M90D 2BVNA 3WBJA 1WPCA 1YJNB 1QVFB 1I8DA 4U9UA 4XKWA 4UAJA 1BQEA 2QGGA 1OB0A 4Q7JB 3CC4B 2DEUA 1JB9A 2FX3A 3H9NA 1N05A 1QX4A 3BCFA 4DQLA 1WSRA 3U6KA 3LVBA 4Z4UA 2VYQA 2OTJB 1NB9A 2DERA 1WDTA 3A3GA 1GJRA 2ZBUA 3P26A 1GO2A 5FIUA 3OPOA 1BX1A 2XNCA 1EFRA 2F43A 1SKQA 1KQSB 1NBMA 2CRVA 4QVAA 3I55B 4RCYA 2CNDA 3E20A 1U2RA 4MYUA 3CCVB 5IYNA 4XN3A 5HZBA 2D9RA 3FKSA 4G1VA 2WZNA 2C77A 3OJXA 1MABA 1FX0A 4YAWA 3BNWA 3T53B 1Q7YD 4YAUA 3JQQA 2OK7A 5FL7A 2VBVA 2XZLA 3QFRA 1VF7A 2ZZFA 4UZEA 3W2GA 1XQBA 3MHPA 4NBSA 1J9ZA 4OPSA 1NDHA 1WTHD 5BSXA 2GQFA 2XNJA 1W9XA 2PE3A 4P22A 3G4SB 2Q6LA 2F4NA 1ZM2A 4P12A 2B7BA 4TMZA 5HZAA 3B8HA 1G7SA 4QUZA 5A89A 1Y0YA 3CW2A 4XKVA 1D1NA 2C78A 3CXCB 4WZKA 5FNZA 1KK0A 2ZZGA 4B3XA 3ASRA 4P3YA 3CB4A 2BGJA 1HVXA 1ZUNB 4QHYA 3ASPA 3GIRA 4WQMA 5THXA 4RD6A 1UD3A 3CTAA 3OJWA 3V76A 4Y7CA 4Z4WA 1XE1A 2YWEA 4OPOA 3ZZUA 2GPJA 3Q6RA 3ASTA 4II3A 3U6BA 4IW3B 2CC2A 5HXBA 3CD6B 3G6EB 2RC5A 4Z4VA 4N3GA 5FA6A 4OOSA 2PIAA 3VNVA 4AF7A 1I18A 1JNYA 2X53S 5JBQA 1N06A 1AIPA 1TLLA 1KK2A 2QTLA 2CK3A 3GVJA 2HCJB 5BSYA 2X3UA 3MCAA 1COWA 1FRNA 1B2RA 2HMAA 2ZXIA 3D26A 1EFCA 2X85A 1QUEA 3BY2A 2BPOA 4XLEA 4AF6A 2BF4A 4WZLA 2GK7A 4HE6A 4K1XA 1H42A 2CF4A 4OOVA 3RY8A 4DNRB 5GV7A 1VQKB 1N8RD 1NB0A 1JJ2B 3ES9A 1HZEA 4P6YA 4YHBA 1QUFA 4N3NA 4RDLA 2WZPP 1KK3A 1RQRA 4UZFA 4ACAA 3CCSB 1WORA 1PJ7A 3BC9A 1VHEA 4Z4TA 4LBZA 4PC7A 3I56B 1OB2A 3GVKA 2QMUA 3I1FA 1QG0A 4Z4RA 4MYTA 3P27A 3ZUGA 1VJSA 3A8IA 4OOXA 4AVZA 4C43A 3CC2B 2X6YA 3VO2A 2QA4B 2GJPA 2X6XA 2GREA 4G1BA 2P3MA 2NV4A 4FXUA 1VQMB 4B3FX 3WQZA 1E64A 1F20A 3OKXA 1Q81D 3SLDA 3A8KA 1VHOA 4RPDA 2EIXA 1EFUA 2R9VA 4WZEA 3E1YE 4M53A 4WWVA 1VQ4B 2C2WA 3J81k 2CW5A 2NPFA 4TMTA 2B7CA 3FJOA 2X0KA 1FDRA 1N0VC 3KEWA 3LNNA 2VBUA 4TMWA 1SM4A 4XL9A 5KNLA 2DY1A 1IJFA 2DETA 3CMEB 2D3LA 3LQEA 1KTVA 2C4TA 2W6JA 5DN6A 1N0UA 4X07A 1EXMA 1E63A 1EFTA 5F4MA 3WNDA 2YWFA 1VQOB 4B48A 1IB0A 2XZOA 1T6ZA 1UD4A 4TN1A 4XONA 4YEJA 1P4MA 4ZCLA 4L8JA 1PKVA 4QFMA 1W0KA 5IK2A 5AN9A 1S72B 3B82A 1FNCA 1XB2A 1V5VA 2HDNB 3CESA 1QFJA 3KL9A 3CP2A 1E3ZA 2ZTGA 1IHMA 2GJKA 5KW9A 4G7WA 1TUIA 3ISXA 4J0QA 2DYIA 3W5UA 4XD7A 1VQ8B 3OAAA 3SEJA 2BSAA 1W2BB 3GQBA 4X7EA 5H5JA 2GJRA 1B23P 1XFOA 4P25A 1S4MA 2GK6A 1OGIA 2OK8A 4C0SA 4YELA 1H85A 1D2EA 1FNMA 1NRKA 1KD1D 2VNIA 4KKSA 3QFCA 2OYNA 1KZLA 2XOKA 2Z6BD 2F1LA 4II2A 4LBWA 1GR1A 2CBXA 1UD2A 4P26A 1Q86D 5TY0A 3ZIAA 5A88A 1WU8A 3ONUA 5IYRA 4PC3A 1BMFA 5J3OA 4E0FA 3FPPA 2VNKA 4Z4YA 4TKOB 3VO1A 1YX2A 2V7UA 3GSIA 1R5BA 2QN6A 3T56B 2ZZQA 1VQLB 2DIEA 1TVCA 2WJYA 3PA2A 2ZBVA 2BN4A 3ZPNA 1QGZA 5EMNA 2QTZA 1W0JA 2HLDA 2ZTNA 4X7CA 3OOCA
chains in the Genus database with same CATH topology
3OP1A 2VBTA 5A89A 1T6ZA 1N08A 1NB0A 2OYNA 5TRDA 1P4MA 1T6YA 2I1LA 5A8AA 1N07A 4UZFA 1MRZA 5FNZA 5A88A 5FO0A 1N06A 3BNWA 2X0KA 3ZUGA 2VBVA 2VBUA 1T6XA 1Q9SA 4UZEA 3CTAA 1N05A 5FO1A 1NB9A 1S4MA 2VBSA 2P3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP1 A;  2VBT A;  5A89 A;  1T6Z A;  1N08 A;  1NB0 A;  2OYN A;  5TRD A;  1P4M A;  1T6Y A;  2I1L A;  5A8A A;  1N07 A;  4UZF A;  1MRZ A;  5FNZ A;  5A88 A;  5FO0 A;  1N06 A;  3BNW A;  2X0K A;  3ZUG A;  2VBV A;  2VBU A;  1T6X A;  1Q9S A;  4UZE A;  3CTA A;  1N05 A;  5FO1 A;  1NB9 A;  1S4M A;  2VBS A;  2P3M A; 
#chains in the Genus database with same CATH topology
 1BLI A;  3OFN A;  3B78 A;  4NCN A;  5TRD A;  1V0F A;  4KKT A;  5TV2 A;  1KRH A;  2OBS A;  3ZZT A;  5F4J A;  2D3N A;  4YAO A;  4ZCI A;  2OBR A;  4ZGN B;  3OW7 A;  1CNF A;  1T6X A;  1Q82 D;  3AGP A;  1FNB A;  4ROX A;  4P1V A;  4CQJ A;  4LBV A;  4XR6 A;  4XQF A;  5L46 A;  2V31 A;  4Y9R A;  5IYQ A;  4M4S A;  4EH1 A;  5LMZ A;  2BGI A;  2Q6O A;  4RD3 A;  1GAQ A;  4XOP A;  2W6I A;  1IJE A;  4B47 A;  1N07 A;  5J35 A;  4TMX A;  4Y9U A;  4M1K A;  1EP1 B;  3G71 B;  4ZV4 A;  3WXM A;  2JDI A;  4M0L A;  4XN0 A;  4RLZ A;  1UMK A;  1YLO A;  4Z4S A;  1YI2 B;  1WOS A;  1QVG B;  1WP6 A;  3Q3A A;  2X6W A;  4HE5 A;  3QSY A;  4FWT A;  1OHH A;  1V0E A;  3FPK A;  3PUM A;  2OTL B;  4YAF A;  3W2E A;  1PJ6 A;  2FVG A;  1BX0 A;  4DQK A;  4P9S A;  2V4D A;  1M1K D;  1VLO A;  1KK1 A;  2F1M A;  4RCZ A;  4PGO A;  3R6J A;  1YJ9 B;  3QFS A;  4PC6 A;  1EWY A;  1WOP A;  2ZIT A;  1FRQ A;  3PVD A;  1UD5 A;  3T51 B;  3CCQ B;  5DS0 A;  4M2L A;  2I1L A;  2V7V A;  1I7P A;  2JIZ A;  3ONY A;  4RDK A;  1YIJ B;  1EP2 B;  4X8I A;  4TSF A;  1ELO A;  1KMH A;  3ZBT A;  4G6I A;  3VNU A;  2JN9 A;  3GVL A;  2DOG A;  4FK8 A;  1K73 D;  4WZT A;  4GQN A;  2Q6I A;  3BY1 A;  2B5O A;  3PUN A;  1JA1 A;  1QGA A;  4HIZ A;  3VR6 A;  1CNE A;  5FO1 A;  3DDY A;  3WNC A;  3CPX A;  3W5H A;  4RJL A;  4X7D A;  4R71 A;  4H9G A;  2BM1 A;  1BPL A;  4OPV A;  3JU4 A;  3OZV A;  2RC6 A;  4PAB A;  1R5N A;  2WPD A;  4RDJ A;  4YXW A;  3BH4 A;  1ZM9 A;  3Q6Q A;  3WYA A;  1BJK A;  3SJP A;  3CC7 B;  1A8P A;  1VQ6 B;  4PC1 A;  3OZW A;  1E79 A;  3ASQ A;  1MRZ A;  4ACB A;  2KVO A;  4X05 A;  2C5B A;  3NE5 B;  2YWH A;  4LC0 A;  4RD1 A;  1VQ9 B;  1DDG A;  3CCR B;  3U2Q A;  2D74 A;  3AVV A;  5B6I A;  1G7T A;  4P2N A;  3AVW A;  2M5S A;  5HKK A;  5KSW B;  4XLF A;  4RD2 A;  3R6K A;  1WSV A;  2Q6K A;  2V7X A;  2VJJ A;  1G7C A;  4Z1M A;  2OBT A;  1UD6 A;  1E1R A;  3BQJ A;  3WBK A;  1NJI D;  2BV3 A;  3H94 A;  3WNB A;  4UZU A;  4JMQ A;  3SJZ A;  3CRZ A;  4KKU A;  4XM3 A;  2QDX A;  2QEX B;  4LBY A;  4RPB A;  2YWG A;  1T5E A;  2AHO A;  1CQX A;  3V7A A;  1YJW B;  2E1R A;  1QFZ A;  1OGJ A;  1VQP B;  5H59 A;  1E3X A;  4TT3 A;  1QFY A;  2QE7 A;  4AC9 A;  3PEN A;  4NNJ A;  2VNJ A;  2XZP A;  1HA3 A;  1K8A D;  1W35 A;  4XLH A;  2BM0 A;  3CP8 A;  4XOR A;  3CCU B;  4XOT A;  1F60 A;  2VBS A;  5E6T A;  1R5O A;  4P6V F;  2ZXH A;  3Q39 A;  1KC8 D;  4Z4Z A;  3JQR A;  2V7W A;  5IYP A;  3AVY A;  1E43 A;  4DNT B;  4ASU A;  3JQP A;  2JJ1 A;  4QV2 A;  1QGY A;  2JJ2 A;  3CCL B;  2WSS A;  3ZC3 A;  1W34 A;  4XLC A;  3W2H A;  4F7D A;  4P3I A;  4BPR A;  4PC2 A;  3LO8 A;  1YIT B;  3SLN A;  2EFG A;  3G05 A;  4B4D A;  4B3G A;  1UD8 A;  3A1P A;  3CPW B;  3ASS A;  2PMD A;  3BCD A;  1QH0 A;  4DK1 A;  3VMF A;  2ZZE A;  4TMV A;  4G5G A;  1VQN B;  3CMA B;  1ZM3 A;  4FN5 A;  4RM0 A;  3AVU A;  4G7X A;  1E62 A;  2XGJ A;  1G7R A;  1KJZ A;  4OP7 A;  2VJI A;  3OW2 B;  1EP3 B;  2ZL5 A;  5DSZ A;  3HAG A;  5A8A A;  2VNH A;  4RD4 A;  5TR9 A;  1VQ5 B;  2DCU A;  3SKB A;  3QE2 A;  1AMO A;  1VLY A;  1Q9S A;  3Q38 A;  2V7T A;  1JA0 A;  2ZL6 A;  4PAA A;  4X06 A;  4B43 A;  3W5V A;  4RD0 A;  2ZL7 A;  4YAL A;  3OEE A;  1RQP A;  2E1B A;  2XEX A;  3MMP A;  2VBT A;  3OE7 A;  1GVH A;  1PJ5 A;  3W2F A;  1Y0R A;  3AGQ A;  4X0C A;  3WY9 A;  2WYR A;  2LZJ A;  1OB5 A;  3OEH A;  3QFT A;  3A8J A;  2VZL A;  2WJV A;  5IYW A;  3CCE B;  1YHQ B;  1W87 A;  5FO0 A;  1D8T A;  1DAR A;  2R6H A;  3A3B A;  4B44 A;  2WR8 A;  2XND A;  1DG1 G;  3PA1 A;  4ZGQ B;  1ZM4 A;  2C4U A;  1VQ7 B;  4XLA A;  3CCJ B;  5CDF A;  5GV8 A;  1H8E A;  1GAW A;  1H8H A;  3A35 A;  4X7F A;  4DK0 A;  2J7K A;  1E1Q A;  2BMW A;  4XNF A;  3W2I A;  3AVX A;  1TTT A;  3OP1 A;  4ZCM A;  4QVJ A;  1K28 D;  3OZU A;  3LQ6 A;  1DDI A;  1N08 A;  2V7Q A;  3ZZ0 A;  4XMY A;  1K9M D;  3ZBU A;  1FND A;  1T6Y A;  3CCM B;  1WOO A;  2PLF A;  3AVT A;  5F4O A;  2C5H A;  1SKY B;  3CMM A;  2X8K A;  1S0U A;  1M90 D;  2BVN A;  3WBJ A;  1WPC A;  1YJN B;  1QVF B;  1I8D A;  4U9U A;  4XKW A;  4UAJ A;  1BQE A;  2QGG A;  1OB0 A;  4Q7J B;  3CC4 B;  2DEU A;  1JB9 A;  2FX3 A;  3H9N A;  1N05 A;  1QX4 A;  3BCF A;  4DQL A;  1WSR A;  3U6K A;  3LVB A;  4Z4U A;  2VYQ A;  2OTJ B;  1NB9 A;  2DER A;  1WDT A;  3A3G A;  1GJR A;  2ZBU A;  3P26 A;  1GO2 A;  5FIU A;  3OPO A;  1BX1 A;  2XNC A;  1EFR A;  2F43 A;  1SKQ A;  1KQS B;  1NBM A;  2CRV A;  4QVA A;  3I55 B;  4RCY A;  2CND A;  3E20 A;  1U2R A;  4MYU A;  3CCV B;  5IYN A;  4XN3 A;  5HZB A;  2D9R A;  3FKS A;  4G1V A;  2WZN A;  2C77 A;  3OJX A;  1MAB A;  1FX0 A;  4YAW A;  3BNW A;  3T53 B;  1Q7Y D;  4YAU A;  3JQQ A;  2OK7 A;  5FL7 A;  2VBV A;  2XZL A;  3QFR A;  1VF7 A;  2ZZF A;  4UZE A;  3W2G A;  1XQB A;  3MHP A;  4NBS A;  1J9Z A;  4OPS A;  1NDH A;  1WTH D;  5BSX A;  2GQF A;  2XNJ A;  1W9X A;  2PE3 A;  4P22 A;  3G4S B;  2Q6L A;  2F4N A;  1ZM2 A;  4P12 A;  2B7B A;  4TMZ A;  5HZA A;  3B8H A;  1G7S A;  4QUZ A;  5A89 A;  1Y0Y A;  3CW2 A;  4XKV A;  1D1N A;  2C78 A;  3CXC B;  4WZK A;  5FNZ A;  1KK0 A;  2ZZG A;  4B3X A;  3ASR A;  4P3Y A;  3CB4 A;  2BGJ A;  1HVX A;  1ZUN B;  4QHY A;  3ASP A;  3GIR A;  4WQM A;  5THX A;  4RD6 A;  1UD3 A;  3CTA A;  3OJW A;  3V76 A;  4Y7C A;  4Z4W A;  1XE1 A;  2YWE A;  4OPO A;  3ZZU A;  2GPJ A;  3Q6R A;  3AST A;  4II3 A;  3U6B A;  4IW3 B;  2CC2 A;  5HXB A;  3CD6 B;  3G6E B;  2RC5 A;  4Z4V A;  4N3G A;  5FA6 A;  4OOS A;  2PIA A;  3VNV A;  4AF7 A;  1I18 A;  1JNY A;  2X53 S;  5JBQ A;  1N06 A;  1AIP A;  1TLL A;  1KK2 A;  2QTL A;  2CK3 A;  3GVJ A;  2HCJ B;  5BSY A;  2X3U A;  3MCA A;  1COW A;  1FRN A;  1B2R A;  2HMA A;  2ZXI A;  3D26 A;  1EFC A;  2X85 A;  1QUE A;  3BY2 A;  2BPO A;  4XLE A;  4AF6 A;  2BF4 A;  4WZL A;  2GK7 A;  4HE6 A;  4K1X A;  1H42 A;  2CF4 A;  4OOV A;  3RY8 A;  4DNR B;  5GV7 A;  1VQK B;  1N8R D;  1NB0 A;  1JJ2 B;  3ES9 A;  1HZE A;  4P6Y A;  4YHB A;  1QUF A;  4N3N A;  4RDL A;  2WZP P;  1KK3 A;  1RQR A;  4UZF A;  4ACA A;  3CCS B;  1WOR A;  1PJ7 A;  3BC9 A;  1VHE A;  4Z4T A;  4LBZ A;  4PC7 A;  3I56 B;  1OB2 A;  3GVK A;  2QMU A;  3I1F A;  1QG0 A;  4Z4R A;  4MYT A;  3P27 A;  3ZUG A;  1VJS A;  3A8I A;  4OOX A;  4AVZ A;  4C43 A;  3CC2 B;  2X6Y A;  3VO2 A;  2QA4 B;  2GJP A;  2X6X A;  2GRE A;  4G1B A;  2P3M A;  2NV4 A;  4FXU A;  1VQM B;  4B3F X;  3WQZ A;  1E64 A;  1F20 A;  3OKX A;  1Q81 D;  3SLD A;  3A8K A;  1VHO A;  4RPD A;  2EIX A;  1EFU A;  2R9V A;  4WZE A;  3E1Y E;  4M53 A;  4WWV A;  1VQ4 B;  2C2W A;  3J81 k;  2CW5 A;  2NPF A;  4TMT A;  2B7C A;  3FJO A;  2X0K A;  1FDR A;  1N0V C;  3KEW A;  3LNN A;  2VBU A;  4TMW A;  1SM4 A;  4XL9 A;  5KNL A;  2DY1 A;  1IJF A;  2DET A;  3CME B;  2D3L A;  3LQE A;  1KTV A;  2C4T A;  2W6J A;  5DN6 A;  1N0U A;  4X07 A;  1EXM A;  1E63 A;  1EFT A;  5F4M A;  3WND A;  2YWF A;  1VQO B;  4B48 A;  1IB0 A;  2XZO A;  1T6Z A;  1UD4 A;  4TN1 A;  4XON A;  4YEJ A;  1P4M A;  4ZCL A;  4L8J A;  1PKV A;  4QFM A;  1W0K A;  5IK2 A;  5AN9 A;  1S72 B;  3B82 A;  1FNC A;  1XB2 A;  1V5V A;  2HDN B;  3CES A;  1QFJ A;  3KL9 A;  3CP2 A;  1E3Z A;  2ZTG A;  1IHM A;  2GJK A;  5KW9 A;  4G7W A;  1TUI A;  3ISX A;  4J0Q A;  2DYI A;  3W5U A;  4XD7 A;  1VQ8 B;  3OAA A;  3SEJ A;  2BSA A;  1W2B B;  3GQB A;  4X7E A;  5H5J A;  2GJR A;  1B23 P;  1XFO A;  4P25 A;  1S4M A;  2GK6 A;  1OGI A;  2OK8 A;  4C0S A;  4YEL A;  1H85 A;  1D2E A;  1FNM A;  1NRK A;  1KD1 D;  2VNI A;  4KKS A;  3QFC A;  2OYN A;  1KZL A;  2XOK A;  2Z6B D;  2F1L A;  4II2 A;  4LBW A;  1GR1 A;  2CBX A;  1UD2 A;  4P26 A;  1Q86 D;  5TY0 A;  3ZIA A;  5A88 A;  1WU8 A;  3ONU A;  5IYR A;  4PC3 A;  1BMF A;  5J3O A;  4E0F A;  3FPP A;  2VNK A;  4Z4Y A;  4TKO B;  3VO1 A;  1YX2 A;  2V7U A;  3GSI A;  1R5B A;  2QN6 A;  3T56 B;  2ZZQ A;  1VQL B;  2DIE A;  1TVC A;  2WJY A;  3PA2 A;  2ZBV A;  2BN4 A;  3ZPN A;  1QGZ A;  5EMN A;  2QTZ A;  1W0J A;  2HLD A;  2ZTN A;  4X7C A;  3OOC A; 
#chains in the Genus database with same CATH homology
 3OP1 A;  2VBT A;  5A89 A;  1T6Z A;  1N08 A;  1NB0 A;  2OYN A;  5TRD A;  1P4M A;  1T6Y A;  2I1L A;  5A8A A;  1N07 A;  4UZF A;  1MRZ A;  5FNZ A;  5A88 A;  5FO0 A;  1N06 A;  3BNW A;  2X0K A;  3ZUG A;  2VBV A;  2VBU A;  1T6X A;  1Q9S A;  4UZE A;  3CTA A;  1N05 A;  5FO1 A;  1NB9 A;  1S4M A;  2VBS A;  2P3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...