1N08A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
154
Chain Sequence
b'RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative riboflavin kinase
molecule tags Transferase
source organism Schizosaccharomyces pombe
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
total genus 38
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n08A00
5FNZA 5A89A 4UZEA 1NB9A 1MRZA 1N08A 3OP1A 2OYNA 3ZUGA 1T6XA 2VBSA 2X0KA 5TRDA 1N05A 1T6ZA 1NB0A 2VBUA 1N06A 1T6YA 5A88A 1Q9SA 5FO1A 5A8AA 3BNWA 2VBTA 5FO0A 2I1LA 3CTAA 4UZFA 1N07A 1S4MA 1P4MA 2P3MA 2VBVA
chains in the Genus database with same CATH superfamily
4KKUA 3CMEB 4G5GA 2RC5A 2V31A 1JNYA 2CF4A 1W35A 2JJ1A 3A35A 2XGJA 2ZL7A 1ZM4A 2CRVA 3CP2A 3Q3AA 2ZZQA 2VNJA 5CDFA 2ZZFA 1KTVA 1GJRA 1SKQA 1TTTA 5DS0A 1VLYA 1KK2A 1E63A 2D3NA 4QVJA 4TN1A 4RD3A 2Z6BD 1G7SA 4YELA 4HE5A 1WOSA 5TR9A 2Q6LA 5KNLA 1RQRA 4ACBA 2ZZGA 3LQ6A 2EIXA 1D2EA 1G7CA 3BY2A 5GV8A 3W5UA 1QUFA 4C43A 3OZUA 1Q81D 1PKVA 4PC1A 3OE7A 3P26A 1E1RA 1IHMA 1GAWA 3FKSA 1NB9A 3CPXA 3KL9A 4RJLA 1BMFA 1MRZA 2FVGA 3CPWB 3QSYA 1Q82D 2C4TA 4XORA 4XQFA 2PLFA 1S72B 2ZBUA 1XQBA 1GAQA 2GJPA 3BCFA 4MYTA 1WOPA 1ZM3A 1JA0A 1ZM2A 3U6KA 1KJZA 5A88A 5DN6A 1YIJB 3ASRA 2C5HA 3CRZA 1QFJA 4YHBA 2XNDA 2J7KA 2ZXIA 3A8JA 4RD4A 1VHOA 4QHYA 1SKYB 4X05A 4B47A 3G4SB 1V5VA 4YALA 3W2EA 2VYQA 1QX4A 3MCAA 3ZC3A 1EP2B 2NPFA 1WSVA 3H9NA 1VQOB 5HKKA 2ZTGA 4Z4SA 4XKVA 2ZBVA 1T5EA 4Z1MA 1OHHA 3LO8A 2V7UA 2HDNB 4ROXA 3CP8A 1NB0A 2QGGA 3VR6A 4DK0A 5BSYA 4XD7A 4NCNA 2LZJA 3CCUB 1J9ZA 1FNCA 1G7TA 3CTAA 3PUMA 4P22A 5FIUA 4RD2A 1FRNA 1YLOA 1W0JA 1OB5A 2BV3A 4HIZA 4X07A 5EMNA 3ZBTA 2D74A 3CMMA 4OPOA 4TSFA 4Z4ZA 2CW5A 4WZEA 3FPPA 4X06A 3ASPA 1UMKA 1VQPB 2YWGA 3NE5B 2X53S 3Q38A 3R6JA 4TT3A 2DERA 1I7PA 1VLOA 1UD4A 1YX2A 1QUEA 4XKWA 5H5JA 3SJPA 1YJ9B 3P27A 4AC9A 3VNVA 1DDGA 2XNCA 3E20A 3V7AA 3BQJA 1WSRA 1HZEA 1QFYA 4NBSA 2XZPA 1UD2A 4P6VF 4ZCIA 1R5NA 4YAWA 3CCLB 4M0LA 4J0QA 1E1QA 3SKBA 3W2GA 2BGJA 2CC2A 1EXMA 4G1BA 1K73D 2D9RA 1B2RA 4XN3A 2NV4A 2X6YA 1TVCA 2VNHA 1UD5A 1ZM9A 4PC6A 3ONUA 1T6XA 2R9VA 4Z4UA 1WP6A 2F43A 3B82A 5TRDA 4XONA 1T6ZA 4E0FA 1N8RD 4DQKA 3VNUA 1VQNB 1YITB 4DNRB 2F1MA 2ZZEA 1KK1A 4YAOA 1AMOA 3CD6B 4OOXA 1U2RA 3WNCA 1FNDA 4LBVA 2QTZA 1WDTA 5TV2A 5KW9A 4TMXA 1JJ2B 4B3GA 1CNFA 1OGIA 4PGOA 1R5BA 2GQFA 4ZCLA 1NJID 3LNNA 2HMAA 4B48A 4TMVA 3G6EB 2OBTA 4XMYA 2V7TA 1VQ8B 2WR8A 1NBMA 1FNMA 5GV7A 1VQ4B 2VBTA 2OBSA 4RCZA 3Q6QA 5E6TA 2V7VA 1OB2A 4RLZA 1IB0A 2V7XA 1KK3A 4P3YA 1YJNB 2WJYA 1BX1A 3T51B 3GIRA 2X3UA 4UZEA 1UD8A 1CQXA 4PC7A 4WZTA 3ES9A 3GVKA 3G05A 5IYQA 2W6IA 1W0KA 2ZXHA 3ISXA 5JBQA 4YEJA 2C5BA 5L46A 3JQQA 3W2IA 2FX3A 1S0UA 1V0EA 3Q39A 2DY1A 2VBSA 1NRKA 1GO2A 5TY0A 4ZCMA 2C4UA 4N3NA 1VQLB 1YHQB 1HA3A 1N0UA 4XLAA 3ZPNA 1VQKB 1COWA 2E1BA 1K9MD 4TMZA 4TMTA 2QN6A 1N07A 1TLLA 1K8AD 3CCVB 3QFCA 4GQNA 2YWEA 4B4DA 2DIEA 2OBRA 2P3MA 2B7BA 2DOGA 3CB4A 5A89A 4FWTA 5J3OA 5LMZA 5IYPA 3SEJA 4RPDA 1YI2B 3WNBA 4Z4WA 4RDKA 2AHOA 1K28D 1F60A 1JA1A 3WBKA 2WZNA 1H8HA 3ASSA 2OTJB 2HLDA 3AVYA 4ASUA 2B5OA 4ZV4A 5BSXA 4RDLA 2VBUA 1WU8A 2BN4A 5IYNA 1UD3A 1VQ7B 3AGPA 4PC3A 2WYRA 2B7CA 3KEWA 3PVDA 4WZKA 2BF4A 4II2A 3QFTA 1W87A 1I8DA 3ZIAA 1RQPA 1VF7A 2EFGA 1Y0RA 3B78A 3OZVA 4R71A 1KC8D 2GK6A 3JQPA 3VMFA 4XN0A 2BMWA 2CNDA 2OTLB 4II3A 1N0VC 4X7FA 3WYAA 5B6IA 1KQSB 4X0CA 4Z4RA 4G1VA 2VZLA 3AVVA 2QTLA 2KVOA 1FRQA 3ZZTA 2WJVA 3PA1A 1UD6A 2WZPP 1N05A 3OEHA 2JIZA 1QGAA 1QVFB 5F4MA 1Q9SA 4X7EA 2XNJA 5A8AA 2BSAA 2QMUA 2BM0A 1WTHD 4RD6A 3FJOA 3CC7B 4YAUA 1VHEA 4K1XA 1EFRA 3GVLA 2XZLA 1VQ9B 1GVHA 2ZITA 4PC2A 3QFRA 4OPVA 4M1KA 4OOSA 2ZL5A 4XOTA 2M5SA 3D26A 3I1FA 4G7XA 3OJWA 2OK7A 1DARA 2YWFA 4X7CA 1AIPA 1PJ5A 2R6HA 3RY8A 3OAAA 2C77A 4XM3A 1FDRA 3E1YE 3MHPA 1Q7YD 3H94A 3BH4A 2Q6KA 2I1LA 4UZFA 4FK8A 1KRHA 4KKSA 2BPOA 3LQEA 5FNZA 2BVNA 3SJZA 1D1NA 3CMAB 3GQBA 1N08A 4P1VA 4L8JA 2X6WA 3BC9A 5FL7A 5IYRA 4X8IA 4B44A 4B43A 3CC2B 3GSIA 4FXUA 1PJ7A 2OYNA 2VJJA 4OOVA 4NNJA 2VNIA 2X85A 2BGIA 4KKTA 2X8KA 4RD0A 4DK1A 4G6IA 4X7DA 4Z4TA 3QFSA 2Q6IA 1QVGB 4F7DA 4OPSA 1XE1A 3PENA 3BNWA 2GK7A 4G7WA 5FO0A 4UAJA 3CESA 1QG0A 1S4MA 4WQMA 3CCSB 4CQJA 4M2LA 4QFMA 1EFUA 4AVZA 1FNBA 2W6JA 3ZZUA 1OGJA 4LBYA 3ZBUA 1R5OA 4Q7JB 4ACAA 2V7WA 4DNTB 3A8KA 2V4DA 3ASQA 1E3ZA 4EH1A 1H42A 3A1PA 3ZUGA 1TUIA 3U6BA 3I56B 3OW2B 3B8HA 4HE6A 1YJWB 4Y7CA 3CCEB 5THXA 2BM1A 4P25A 3CCJB 3ASTA 2CK3A 1EFTA 1E79A 3A3BA 4ZGQB 3I55B 1SM4A 1GR1A 4XL9A 4XLHA 3W2HA 1BQEA 3WQZA 4BPRA 3PUNA 3BY1A 4RPBA 3ZZ0A 1EP3B 1XB2A 4P6YA 1Y0YA 3HAGA 3FPKA 1EP1B 5F4OA 4ZGNB 1OB0A 4AF7A 3AVXA 2VBVA 4M4SA 4OP7A 1HVXA 4XLCA 3V76A 2Q6OA 4AF6A 1EFCA 1VQ6B 3W5HA 1PJ6A 4C0SA 3AGQA 4QVAA 3WBJA 1DG1G 3MMPA 3OPOA 1B23P 2V7QA 3LVBA 1FX0A 2D3LA 4P9SA 3Q6RA 1VQ5B 4TMWA 2RC6A 4RCYA 2JDIA 4XR6A 4UZUA 5IK2A 2F1LA 3SLDA 2F4NA 2PE3A 1N06A 4XOPA 1T6YA 2ZTNA 4Y9UA 4DQLA 1E64A 5IYWA 5HXBA 4M53A 1JB9A 1ELOA 5HZAA 3WY9A 3WNDA 3AVTA 1P4MA 3OOCA 4YAFA 2XOKA 5KSWB 2CBXA 4YXWA 2VJIA 1EWYA 1BLIA 2GPJA 1H85A 2E1RA 2X6XA 3G71B 4WWVA 4QV2A 1VJSA 1I18A 4P2NA 4MYUA 1KK0A 3CCRB 3W2FA 3ONYA 1E43A 4RD1A 3CXCB 4P3IA 3PA2A 3VO1A 3WXMA 1M90D 2PMDA 3BCDA 3AVUA 4RM0A 5F4JA 3SLNA 1V0FA 4LBZA 3OJXA 4LC0A 3T53B 3JQRA 3QE2A 1IJEA 4JMQA 2XZOA 5H59A 3CCQB 4PAAA 3GVJA 2C2WA 1E62A 1NDHA 2QA4B 4P12A 1D8TA 5HZBA 4XLEA 1BJKA 2C78A 2GJKA 5DSZA 1F20A 2JJ2A 4XLFA 4RDJA 2DCUA 2VNKA 3R6KA 1MABA 1E3XA 5AN9A 3OW7A 4U9UA 2WSSA 1IJFA 4FN5A 1A8PA 3OEEA 3CCMB 2X0KA 3T56B 3A8IA 3AVWA 4PABA 1KD1D 1W9XA 1WPCA 1CNEA 2YWHA 4XNFA 2GJRA 2DEUA 3OKXA 2HCJB 1QGYA 5FO1A 3VO2A 2XEXA 2QDXA 4LBWA 2JN9A 2PIAA 4Z4YA 1QFZA 1M1KD 2QEXB 2OK8A 2WPDA 4Z4VA 1W34A 1QH0A 1BX0A 3J81k 1KMHA 3OFNA 4P26A 5FA6A 2QE7A 3OP1A 5J35A 1H8EA 1QGZA 3OZWA 3U2QA 4Y9RA 4WZLA 4H9GA 1BPLA 2GREA 4B3FX 3CC4B 3JU4A 3W5VA 4IW3B 3A3GA 2DETA 1ZUNB 4QUZA 3CW2A 1G7RA 1DDIA 1VQMB 1Q86D 1XFOA 3DDYA 4TKOB 1W2BB 1KZLA 4N3GA 2ZL6A 1WORA 2DYIA 4B3XA 1WOOA
chains in the Genus database with same CATH topology
5FNZA 5A89A 4UZEA 1NB9A 1MRZA 1N08A 3OP1A 2OYNA 3ZUGA 1T6XA 2VBSA 2X0KA 5TRDA 1N05A 1T6ZA 1NB0A 2VBUA 1N06A 1T6YA 5A88A 1Q9SA 5FO1A 5A8AA 3BNWA 2VBTA 5FO0A 2I1LA 3CTAA 4UZFA 1N07A 1S4MA 1P4MA 2P3MA 2VBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNZ A;  5A89 A;  4UZE A;  1NB9 A;  1MRZ A;  1N08 A;  3OP1 A;  2OYN A;  3ZUG A;  1T6X A;  2VBS A;  2X0K A;  5TRD A;  1N05 A;  1T6Z A;  1NB0 A;  2VBU A;  1N06 A;  1T6Y A;  5A88 A;  1Q9S A;  5FO1 A;  5A8A A;  3BNW A;  2VBT A;  5FO0 A;  2I1L A;  3CTA A;  4UZF A;  1N07 A;  1S4M A;  1P4M A;  2P3M A;  2VBV A; 
#chains in the Genus database with same CATH topology
 4KKU A;  3CME B;  4G5G A;  2RC5 A;  2V31 A;  1JNY A;  2CF4 A;  1W35 A;  2JJ1 A;  3A35 A;  2XGJ A;  2ZL7 A;  1ZM4 A;  2CRV A;  3CP2 A;  3Q3A A;  2ZZQ A;  2VNJ A;  5CDF A;  2ZZF A;  1KTV A;  1GJR A;  1SKQ A;  1TTT A;  5DS0 A;  1VLY A;  1KK2 A;  1E63 A;  2D3N A;  4QVJ A;  4TN1 A;  4RD3 A;  2Z6B D;  1G7S A;  4YEL A;  4HE5 A;  1WOS A;  5TR9 A;  2Q6L A;  5KNL A;  1RQR A;  4ACB A;  2ZZG A;  3LQ6 A;  2EIX A;  1D2E A;  1G7C A;  3BY2 A;  5GV8 A;  3W5U A;  1QUF A;  4C43 A;  3OZU A;  1Q81 D;  1PKV A;  4PC1 A;  3OE7 A;  3P26 A;  1E1R A;  1IHM A;  1GAW A;  3FKS A;  1NB9 A;  3CPX A;  3KL9 A;  4RJL A;  1BMF A;  1MRZ A;  2FVG A;  3CPW B;  3QSY A;  1Q82 D;  2C4T A;  4XOR A;  4XQF A;  2PLF A;  1S72 B;  2ZBU A;  1XQB A;  1GAQ A;  2GJP A;  3BCF A;  4MYT A;  1WOP A;  1ZM3 A;  1JA0 A;  1ZM2 A;  3U6K A;  1KJZ A;  5A88 A;  5DN6 A;  1YIJ B;  3ASR A;  2C5H A;  3CRZ A;  1QFJ A;  4YHB A;  2XND A;  2J7K A;  2ZXI A;  3A8J A;  4RD4 A;  1VHO A;  4QHY A;  1SKY B;  4X05 A;  4B47 A;  3G4S B;  1V5V A;  4YAL A;  3W2E A;  2VYQ A;  1QX4 A;  3MCA A;  3ZC3 A;  1EP2 B;  2NPF A;  1WSV A;  3H9N A;  1VQO B;  5HKK A;  2ZTG A;  4Z4S A;  4XKV A;  2ZBV A;  1T5E A;  4Z1M A;  1OHH A;  3LO8 A;  2V7U A;  2HDN B;  4ROX A;  3CP8 A;  1NB0 A;  2QGG A;  3VR6 A;  4DK0 A;  5BSY A;  4XD7 A;  4NCN A;  2LZJ A;  3CCU B;  1J9Z A;  1FNC A;  1G7T A;  3CTA A;  3PUM A;  4P22 A;  5FIU A;  4RD2 A;  1FRN A;  1YLO A;  1W0J A;  1OB5 A;  2BV3 A;  4HIZ A;  4X07 A;  5EMN A;  3ZBT A;  2D74 A;  3CMM A;  4OPO A;  4TSF A;  4Z4Z A;  2CW5 A;  4WZE A;  3FPP A;  4X06 A;  3ASP A;  1UMK A;  1VQP B;  2YWG A;  3NE5 B;  2X53 S;  3Q38 A;  3R6J A;  4TT3 A;  2DER A;  1I7P A;  1VLO A;  1UD4 A;  1YX2 A;  1QUE A;  4XKW A;  5H5J A;  3SJP A;  1YJ9 B;  3P27 A;  4AC9 A;  3VNV A;  1DDG A;  2XNC A;  3E20 A;  3V7A A;  3BQJ A;  1WSR A;  1HZE A;  1QFY A;  4NBS A;  2XZP A;  1UD2 A;  4P6V F;  4ZCI A;  1R5N A;  4YAW A;  3CCL B;  4M0L A;  4J0Q A;  1E1Q A;  3SKB A;  3W2G A;  2BGJ A;  2CC2 A;  1EXM A;  4G1B A;  1K73 D;  2D9R A;  1B2R A;  4XN3 A;  2NV4 A;  2X6Y A;  1TVC A;  2VNH A;  1UD5 A;  1ZM9 A;  4PC6 A;  3ONU A;  1T6X A;  2R9V A;  4Z4U A;  1WP6 A;  2F43 A;  3B82 A;  5TRD A;  4XON A;  1T6Z A;  4E0F A;  1N8R D;  4DQK A;  3VNU A;  1VQN B;  1YIT B;  4DNR B;  2F1M A;  2ZZE A;  1KK1 A;  4YAO A;  1AMO A;  3CD6 B;  4OOX A;  1U2R A;  3WNC A;  1FND A;  4LBV A;  2QTZ A;  1WDT A;  5TV2 A;  5KW9 A;  4TMX A;  1JJ2 B;  4B3G A;  1CNF A;  1OGI A;  4PGO A;  1R5B A;  2GQF A;  4ZCL A;  1NJI D;  3LNN A;  2HMA A;  4B48 A;  4TMV A;  3G6E B;  2OBT A;  4XMY A;  2V7T A;  1VQ8 B;  2WR8 A;  1NBM A;  1FNM A;  5GV7 A;  1VQ4 B;  2VBT A;  2OBS A;  4RCZ A;  3Q6Q A;  5E6T A;  2V7V A;  1OB2 A;  4RLZ A;  1IB0 A;  2V7X A;  1KK3 A;  4P3Y A;  1YJN B;  2WJY A;  1BX1 A;  3T51 B;  3GIR A;  2X3U A;  4UZE A;  1UD8 A;  1CQX A;  4PC7 A;  4WZT A;  3ES9 A;  3GVK A;  3G05 A;  5IYQ A;  2W6I A;  1W0K A;  2ZXH A;  3ISX A;  5JBQ A;  4YEJ A;  2C5B A;  5L46 A;  3JQQ A;  3W2I A;  2FX3 A;  1S0U A;  1V0E A;  3Q39 A;  2DY1 A;  2VBS A;  1NRK A;  1GO2 A;  5TY0 A;  4ZCM A;  2C4U A;  4N3N A;  1VQL B;  1YHQ B;  1HA3 A;  1N0U A;  4XLA A;  3ZPN A;  1VQK B;  1COW A;  2E1B A;  1K9M D;  4TMZ A;  4TMT A;  2QN6 A;  1N07 A;  1TLL A;  1K8A D;  3CCV B;  3QFC A;  4GQN A;  2YWE A;  4B4D A;  2DIE A;  2OBR A;  2P3M A;  2B7B A;  2DOG A;  3CB4 A;  5A89 A;  4FWT A;  5J3O A;  5LMZ A;  5IYP A;  3SEJ A;  4RPD A;  1YI2 B;  3WNB A;  4Z4W A;  4RDK A;  2AHO A;  1K28 D;  1F60 A;  1JA1 A;  3WBK A;  2WZN A;  1H8H A;  3ASS A;  2OTJ B;  2HLD A;  3AVY A;  4ASU A;  2B5O A;  4ZV4 A;  5BSX A;  4RDL A;  2VBU A;  1WU8 A;  2BN4 A;  5IYN A;  1UD3 A;  1VQ7 B;  3AGP A;  4PC3 A;  2WYR A;  2B7C A;  3KEW A;  3PVD A;  4WZK A;  2BF4 A;  4II2 A;  3QFT A;  1W87 A;  1I8D A;  3ZIA A;  1RQP A;  1VF7 A;  2EFG A;  1Y0R A;  3B78 A;  3OZV A;  4R71 A;  1KC8 D;  2GK6 A;  3JQP A;  3VMF A;  4XN0 A;  2BMW A;  2CND A;  2OTL B;  4II3 A;  1N0V C;  4X7F A;  3WYA A;  5B6I A;  1KQS B;  4X0C A;  4Z4R A;  4G1V A;  2VZL A;  3AVV A;  2QTL A;  2KVO A;  1FRQ A;  3ZZT A;  2WJV A;  3PA1 A;  1UD6 A;  2WZP P;  1N05 A;  3OEH A;  2JIZ A;  1QGA A;  1QVF B;  5F4M A;  1Q9S A;  4X7E A;  2XNJ A;  5A8A A;  2BSA A;  2QMU A;  2BM0 A;  1WTH D;  4RD6 A;  3FJO A;  3CC7 B;  4YAU A;  1VHE A;  4K1X A;  1EFR A;  3GVL A;  2XZL A;  1VQ9 B;  1GVH A;  2ZIT A;  4PC2 A;  3QFR A;  4OPV A;  4M1K A;  4OOS A;  2ZL5 A;  4XOT A;  2M5S A;  3D26 A;  3I1F A;  4G7X A;  3OJW A;  2OK7 A;  1DAR A;  2YWF A;  4X7C A;  1AIP A;  1PJ5 A;  2R6H A;  3RY8 A;  3OAA A;  2C77 A;  4XM3 A;  1FDR A;  3E1Y E;  3MHP A;  1Q7Y D;  3H94 A;  3BH4 A;  2Q6K A;  2I1L A;  4UZF A;  4FK8 A;  1KRH A;  4KKS A;  2BPO A;  3LQE A;  5FNZ A;  2BVN A;  3SJZ A;  1D1N A;  3CMA B;  3GQB A;  1N08 A;  4P1V A;  4L8J A;  2X6W A;  3BC9 A;  5FL7 A;  5IYR A;  4X8I A;  4B44 A;  4B43 A;  3CC2 B;  3GSI A;  4FXU A;  1PJ7 A;  2OYN A;  2VJJ A;  4OOV A;  4NNJ A;  2VNI A;  2X85 A;  2BGI A;  4KKT A;  2X8K A;  4RD0 A;  4DK1 A;  4G6I A;  4X7D A;  4Z4T A;  3QFS A;  2Q6I A;  1QVG B;  4F7D A;  4OPS A;  1XE1 A;  3PEN A;  3BNW A;  2GK7 A;  4G7W A;  5FO0 A;  4UAJ A;  3CES A;  1QG0 A;  1S4M A;  4WQM A;  3CCS B;  4CQJ A;  4M2L A;  4QFM A;  1EFU A;  4AVZ A;  1FNB A;  2W6J A;  3ZZU A;  1OGJ A;  4LBY A;  3ZBU A;  1R5O A;  4Q7J B;  4ACA A;  2V7W A;  4DNT B;  3A8K A;  2V4D A;  3ASQ A;  1E3Z A;  4EH1 A;  1H42 A;  3A1P A;  3ZUG A;  1TUI A;  3U6B A;  3I56 B;  3OW2 B;  3B8H A;  4HE6 A;  1YJW B;  4Y7C A;  3CCE B;  5THX A;  2BM1 A;  4P25 A;  3CCJ B;  3AST A;  2CK3 A;  1EFT A;  1E79 A;  3A3B A;  4ZGQ B;  3I55 B;  1SM4 A;  1GR1 A;  4XL9 A;  4XLH A;  3W2H A;  1BQE A;  3WQZ A;  4BPR A;  3PUN A;  3BY1 A;  4RPB A;  3ZZ0 A;  1EP3 B;  1XB2 A;  4P6Y A;  1Y0Y A;  3HAG A;  3FPK A;  1EP1 B;  5F4O A;  4ZGN B;  1OB0 A;  4AF7 A;  3AVX A;  2VBV A;  4M4S A;  4OP7 A;  1HVX A;  4XLC A;  3V76 A;  2Q6O A;  4AF6 A;  1EFC A;  1VQ6 B;  3W5H A;  1PJ6 A;  4C0S A;  3AGQ A;  4QVA A;  3WBJ A;  1DG1 G;  3MMP A;  3OPO A;  1B23 P;  2V7Q A;  3LVB A;  1FX0 A;  2D3L A;  4P9S A;  3Q6R A;  1VQ5 B;  4TMW A;  2RC6 A;  4RCY A;  2JDI A;  4XR6 A;  4UZU A;  5IK2 A;  2F1L A;  3SLD A;  2F4N A;  2PE3 A;  1N06 A;  4XOP A;  1T6Y A;  2ZTN A;  4Y9U A;  4DQL A;  1E64 A;  5IYW A;  5HXB A;  4M53 A;  1JB9 A;  1ELO A;  5HZA A;  3WY9 A;  3WND A;  3AVT A;  1P4M A;  3OOC A;  4YAF A;  2XOK A;  5KSW B;  2CBX A;  4YXW A;  2VJI A;  1EWY A;  1BLI A;  2GPJ A;  1H85 A;  2E1R A;  2X6X A;  3G71 B;  4WWV A;  4QV2 A;  1VJS A;  1I18 A;  4P2N A;  4MYU A;  1KK0 A;  3CCR B;  3W2F A;  3ONY A;  1E43 A;  4RD1 A;  3CXC B;  4P3I A;  3PA2 A;  3VO1 A;  3WXM A;  1M90 D;  2PMD A;  3BCD A;  3AVU A;  4RM0 A;  5F4J A;  3SLN A;  1V0F A;  4LBZ A;  3OJX A;  4LC0 A;  3T53 B;  3JQR A;  3QE2 A;  1IJE A;  4JMQ A;  2XZO A;  5H59 A;  3CCQ B;  4PAA A;  3GVJ A;  2C2W A;  1E62 A;  1NDH A;  2QA4 B;  4P12 A;  1D8T A;  5HZB A;  4XLE A;  1BJK A;  2C78 A;  2GJK A;  5DSZ A;  1F20 A;  2JJ2 A;  4XLF A;  4RDJ A;  2DCU A;  2VNK A;  3R6K A;  1MAB A;  1E3X A;  5AN9 A;  3OW7 A;  4U9U A;  2WSS A;  1IJF A;  4FN5 A;  1A8P A;  3OEE A;  3CCM B;  2X0K A;  3T56 B;  3A8I A;  3AVW A;  4PAB A;  1KD1 D;  1W9X A;  1WPC A;  1CNE A;  2YWH A;  4XNF A;  2GJR A;  2DEU A;  3OKX A;  2HCJ B;  1QGY A;  5FO1 A;  3VO2 A;  2XEX A;  2QDX A;  4LBW A;  2JN9 A;  2PIA A;  4Z4Y A;  1QFZ A;  1M1K D;  2QEX B;  2OK8 A;  2WPD A;  4Z4V A;  1W34 A;  1QH0 A;  1BX0 A;  3J81 k;  1KMH A;  3OFN A;  4P26 A;  5FA6 A;  2QE7 A;  3OP1 A;  5J35 A;  1H8E A;  1QGZ A;  3OZW A;  3U2Q A;  4Y9R A;  4WZL A;  4H9G A;  1BPL A;  2GRE A;  4B3F X;  3CC4 B;  3JU4 A;  3W5V A;  4IW3 B;  3A3G A;  2DET A;  1ZUN B;  4QUZ A;  3CW2 A;  1G7R A;  1DDI A;  1VQM B;  1Q86 D;  1XFO A;  3DDY A;  4TKO B;  1W2B B;  1KZL A;  4N3G A;  2ZL6 A;  1WOR A;  2DYI A;  4B3X A;  1WOO A; 
#chains in the Genus database with same CATH homology
 5FNZ A;  5A89 A;  4UZE A;  1NB9 A;  1MRZ A;  1N08 A;  3OP1 A;  2OYN A;  3ZUG A;  1T6X A;  2VBS A;  2X0K A;  5TRD A;  1N05 A;  1T6Z A;  1NB0 A;  2VBU A;  1N06 A;  1T6Y A;  5A88 A;  1Q9S A;  5FO1 A;  5A8A A;  3BNW A;  2VBT A;  5FO0 A;  2I1L A;  3CTA A;  4UZF A;  1N07 A;  1S4M A;  1P4M A;  2P3M A;  2VBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...