1N08A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative riboflavin kinase
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 38
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n08A00
1NB9A 2I1LA 1T6ZA 1Q9SA 5FO1A 3BNWA 1N07A 1MRZA 1P4MA 2P3MA 2X0KA 1T6XA 1NB0A 2VBTA 5FNZA 2VBVA 1T6YA 1N06A 5A89A 3CTAA 3ZUGA 4UZEA 1S4MA 3OP1A 2OYNA 1N05A 5TRDA 5A8AA 1N08A 2VBSA 5A88A 4UZFA 2VBUA 5FO0A
chains in the Genus database with same CATH superfamily
3CC4B 1EWYA 5TV2A 4HIZA 3D26A 1HZEA 2W6IA 5FL7A 4OPVA 2OK8A 3PUNA 3AVYA 3WQZA 3W2HA 1FRNA 3ZBUA 4RD4A 1YJNB 3CCMB 3AVXA 2DIEA 2GREA 2B7BA 1DARA 1Y0YA 5AN9A 4XN3A 1R5OA 2RC5A 1JA0A 1SKQA 4TMVA 2WZPP 2BSAA 2DY1A 1VQ9B 2E1RA 1M1KD 2CNDA 2WR8A 4UZUA 4LBYA 3GVKA 1VQ7B 4DNTB 3W2GA 1E79A 2ZTGA 4X7EA 5GV8A 1PJ7A 2F4NA 4HE5A 1E3XA 3AVUA 4TKOB 2DOGA 3PA1A 1EFUA 4MYTA 3H9NA 2B5OA 3AVTA 4Y9RA 1QFYA 4UZEA 4TMTA 1GVHA 3GVLA 3U6KA 2QDXA 2Q6KA 3ASPA 1S0UA 1YITB 1B23P 4XL9A 3OFNA 4MYUA 1WOSA 4NCNA 4M53A 4TMWA 2BMWA 3QFSA 1G7RA 2ZL7A 3CB4A 4H9GA 2V4DA 4YAUA 1OGIA 2YWEA 1YI2B 3G71B 1BLIA 3BCDA 4RPBA 5FA6A 3OEHA 5HXBA 1E1RA 1WOOA 4PC6A 5HZAA 3ZZTA 2YWGA 4AF7A 3CW2A 4ZCMA 2D9RA 1FDRA 3SLDA 1CNEA 4AC9A 3H94A 3JQQA 5TR9A 2QE7A 2ZXHA 1WSVA 1VQKB 3ONUA 1OGJA 1QUFA 3A8KA 3AGQA 2QEXB 4KKTA 2C2WA 2OYNA 1VLOA 4RDLA 1JA1A 2WZNA 3QSYA 4NBSA 1KZLA 3PUMA 3PA2A 5KNLA 3J81k 2BGIA 1WDTA 2D74A 4IW3B 1QGAA 1U2RA 2ZXIA 1PKVA 5FO0A 3LO8A 3CC2B 1KK0A 3KL9A 3BNWA 1KJZA 1VQ8B 2QGGA 3QFTA 4Z4VA 2GPJA 1MABA 4RCZA 4DQLA 2VBVA 1EFTA 3SLNA 3CCLB 1FNMA 1EFCA 1BJKA 3WBKA 4M4SA 4XLHA 1VLYA 4RCYA 1VQLB 1BX1A 4B3FX 4PC7A 4B3XA 1KRHA 3CCQB 1W9XA 3W5VA 2C4TA 2F43A 3I56B 4CQJA 3QFCA 4ASUA 2CC2A 3MHPA 1N0UA 2BVNA 4BPRA 4XNFA 1I18A 1QVGB 1QUEA 3U2QA 3GSIA 4Z1MA 4X8IA 2DEUA 3OEEA 3MMPA 1OHHA 3JQPA 2XOKA 3W5HA 2B7CA 1AIPA 5HKKA 3OAAA 3OW7A 2KVOA 5F4MA 4B48A 3WXMA 4TSFA 5DN6A 2D3LA 3AVVA 1WPCA 4Z4RA 1EFRA 4P25A 1UMKA 2X85A 3W2FA 2GQFA 2VNHA 4P3YA 4PC1A 4N3NA 1N08A 1KMHA 3ZIAA 1OB5A 1KQSB 3OZVA 1OB0A 2XNCA 1EXMA 3ISXA 4E0FA 4TN1A 1QH0A 1WU8A 4II3A 1GJRA 1HA3A 2JJ2A 2P3MA 1K73D 2M5SA 1W34A 3A8JA 1K9MD 1UD4A 2R6HA 1KK1A 3GVJA 4XKVA 3VO2A 4ZGNB 4FWTA 2GJKA 4WQMA 1S4MA 1QFZA 2Q6LA 3Q6RA 4U9UA 3W2IA 4X05A 2ZL6A 4P9SA 1VQPB 2C4UA 2XZOA 2BV3A 2OTLB 2XGJA 1RQPA 1COWA 4WZTA 4QHYA 3P26A 1DDIA 1MRZA 4YXWA 4Z4YA 2F1MA 1VQ5B 4P12A 1YLOA 4XKWA 4Z4WA 3E1YE 2VYQA 1JNYA 1W87A 2WSSA 4YEJA 3B78A 4PC2A 1D8TA 3BH4A 1T5EA 4ROXA 4ZCLA 4Z4ZA 3OE7A 4G1VA 1VQMB 2PMDA 4XOPA 2X6YA 2EFGA 1QGZA 1WP6A 1FNBA 2X6WA 3ASSA 4ACAA 1W2BB 5A88A 1V0FA 1VQ4B 4UZFA 1OB2A 5F4JA 4TMXA 2NPFA 4M0LA 2VBUA 1IJEA 3V76A 1GAQA 3BCFA 2HCJB 3QFRA 4QVJA 4PAAA 1P4MA 4XLEA 1HVXA 1D1NA 1S72B 2BN4A 3Q3AA 3FJOA 2QTLA 1W35A 1I7PA 3E20A 1YIJB 1W0KA 1QFJA 1GAWA 5CDFA 3W5UA 3BY2A 4RD0A 1DG1G 1WSRA 3Q6QA 4RD2A 2WYRA 4FN5A 3FKSA 4G6IA 4Z4TA 2X3UA 3CCJB 1GO2A 2Q6IA 3CP8A 2DETA 1WOPA 2YWHA 4FK8A 2V7QA 1XB2A 1GR1A 3ASRA 3OZUA 4PGOA 4RM0A 2V7TA 1Q86D 4WWVA 4G7WA 4UAJA 2ZBUA 5H5JA 4R71A 1Q7YD 4OP7A 4G7XA 4KKSA 1XE1A 3U6BA 3OKXA 4G1BA 1N8RD 1KK3A 2VBTA 1KD1D 4J0QA 3G4SB 1T6YA 4RD3A 4WZKA 3WYAA 4P26A 4X7DA 5IYPA 4YHBA 4YALA 1Y0RA 2X53S 3Q38A 4RDJA 2VBSA 4N3GA 3SJZA 2GK6A 4GQNA 3FPKA 1TVCA 4RJLA 3I55B 5LMZA 5TY0A 1CNFA 5BSXA 1TLLA 2I1LA 1T6ZA 1Q9SA 2GK7A 4L8JA 1FRQA 2OTJB 4X7CA 3PENA 4TMZA 3A1PA 3PVDA 2HLDA 4M2LA 2VNJA 5THXA 2DERA 1J9ZA 4X07A 1BX0A 1H8EA 4AF6A 3CC7B 1UD2A 1ELOA 5IYWA 3WNCA 4XLCA 2C78A 4X06A 2QTZA 4PABA 5IK2A 2ZZGA 2C77A 2VNKA 4KKUA 4XLFA 3WNBA 1YX2A 4LBVA 3CCVB 2XNJA 2FVGA 1PJ5A 4WZEA 3T56B 4Z4SA 4YAWA 4JMQA 1WTHD 3CPWB 4XMYA 4B43A 4Q7JB 5DSZA 2NV4A 1FNCA 1IB0A 2X0KA 3OOCA 2V7WA 1JB9A 2OK7A 2QMUA 2X8KA 5L46A 1JJ2B 1V0EA 1N06A 4X7FA 4QUZA 3ZBTA 4OOXA 4P22A 4C43A 4Z4UA 4TT3A 3WBJA 3KEWA 3MCAA 1I8DA 3BY1A 4OPSA 1TTTA 2V7UA 3CP2A 3OJXA 4DNRB 3CD6B 3CMEB 1N0VC 2RC6A 1KK2A 3VNUA 3WNDA 5A8AA 4QFMA 2V7XA 4QV2A 3OZWA 1SM4A 1VHOA 3G6EB 3LVBA 1IHMA 2OBSA 2VZLA 4B47A 1NB9A 4ACBA 1XQBA 4F7DA 1UD5A 5EMNA 3FPPA 1VHEA 4FXUA 1E62A 2PLFA 2CW5A 2AHOA 1D2EA 1PJ6A 4Y7CA 1VF7A 3GIRA 5A89A 1H42A 3CTAA 2JDIA 2GJPA 3VMFA 1QG0A 2CK3A 2Z6BD 3SJPA 4XR6A 3V7AA 2BM1A 1NDHA 3A35A 5KSWB 3BC9A 3R6KA 1FNDA 2OBRA 4K1XA 1R5NA 4PC3A 1XFOA 2J7KA 5H59A 3WY9A 4M1KA 4XOTA 5IYRA 3VNVA 3JQRA 3CESA 1K28D 4B4DA 5J3OA 1EP2B 1G7SA 1NJID 4RPDA 3P27A 1G7TA 1F60A 4ZGQB 1E1QA 4OPOA 3RY8A 4C0SA 3LQEA 4X0CA 3Q39A 4DK0A 1F20A 1YHQB 2DYIA 5GV7A 3T51B 3T53B 1ZM9A 3B8HA 4B3GA 4ZCIA 3AVWA 4DQKA 4YAOA 3AGPA 4Y9UA 1RQRA 2ZZEA 5B6IA 1W0JA 3ONYA 3A8IA 4HE6A 1VQNB 1WORA 1R5BA 2QN6A 2PIAA 2W6JA 1Q82D 2XZLA 4YELA 3VR6A 1FX0A 2V7VA 1EP1B 4QVAA 4RD6A 4XD7A 4LBZA 1VJSA 5E6TA 4P3IA 2VJIA 1NRKA 3VO1A 1E3ZA 1A8PA 2PE3A 5FO1A 2ZITA 2QA4B 3SKBA 3CCEB 1NB0A 5FNZA 2JIZA 4OOVA 3BQJA 3CMAB 2JN9A 1BMFA 1NBMA 3ZUGA 1K8AD 3CMMA 5DS0A 4P6VF 1H85A 2BF4A 2JJ1A 3OP1A 1BPLA 2ZTNA 4XORA 3B82A 2R9VA 3ASQA 5FIUA 4DK1A 5TRDA 1ZM3A 3ES9A 5IYQA 2Q6OA 4XM3A 4YAFA 1B2RA 4XLAA 2ZZFA 1EP3B 1UD8A 1ZM2A 3DDYA 2DCUA 3CRZA 1QX4A 2HDNB 4II2A 5KW9A 1H8HA 2CBXA 4RLZA 1UD3A 1N07A 1IJFA 1YJWB 2CRVA 1E64A 5F4OA 4P1VA 1QGYA 1ZM4A 3OW2B 3A3BA 3ZC3A 3GQBA 2OBTA 2FX3A 2WPDA 3LQ6A 2D3NA 4LBWA 4G5GA 3ZZ0A 1VQ6B 2WJYA 2VNIA 3CCUB 3JU4A 1V5VA 2LZJA 3NE5B 3QE2A 4RD1A 4XONA 2X6XA 1N05A 1QVFB 1CQXA 2HMAA 1G7CA 4B44A 3A3GA 2XNDA 1VQOB 4RDKA 2ZBVA 1DDGA 2ZL5A 1Q81D 1SKYB 4NNJA 2EIXA 5J35A 5IYNA 2C5BA 1ZUNB 1E63A 3I1FA 2BGJA 2YWFA 1T6XA 2VJJA 4LC0A 1KC8D 3ZZUA 1UD6A 4WZLA 2V31A 3CPXA 1YJ9B 3SEJA 2C5HA 1E43A 2BM0A 4XQFA 2XZPA 3OJWA 4ZV4A 1TUIA 2BPOA 5BSYA 2F1LA 4AVZA 1M90D 2XEXA 3G05A 3ZPNA 1KTVA 4P2NA 3OPOA 4OOSA 3HAGA 4P6YA 5JBQA 3ASTA 3CXCB 3LNNA 2GJRA 2E1BA 3W2EA 3CCSB 2WJVA 2CF4A 2ZZQA 4XN0A 4EH1A 3R6JA 1BQEA 3CCRB 5HZBA 1AMOA
chains in the Genus database with same CATH topology
1NB9A 2I1LA 1T6ZA 1Q9SA 5FO1A 3BNWA 1N07A 1MRZA 1P4MA 2P3MA 2X0KA 1T6XA 1NB0A 2VBTA 5FNZA 2VBVA 1T6YA 1N06A 5A89A 3CTAA 3ZUGA 4UZEA 1S4MA 3OP1A 2OYNA 1N05A 5TRDA 5A8AA 1N08A 2VBSA 5A88A 4UZFA 2VBUA 5FO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB9 A;  2I1L A;  1T6Z A;  1Q9S A;  5FO1 A;  3BNW A;  1N07 A;  1MRZ A;  1P4M A;  2P3M A;  2X0K A;  1T6X A;  1NB0 A;  2VBT A;  5FNZ A;  2VBV A;  1T6Y A;  1N06 A;  5A89 A;  3CTA A;  3ZUG A;  4UZE A;  1S4M A;  3OP1 A;  2OYN A;  1N05 A;  5TRD A;  5A8A A;  1N08 A;  2VBS A;  5A88 A;  4UZF A;  2VBU A;  5FO0 A; 
#chains in the Genus database with same CATH topology
 3CC4 B;  1EWY A;  5TV2 A;  4HIZ A;  3D26 A;  1HZE A;  2W6I A;  5FL7 A;  4OPV A;  2OK8 A;  3PUN A;  3AVY A;  3WQZ A;  3W2H A;  1FRN A;  3ZBU A;  4RD4 A;  1YJN B;  3CCM B;  3AVX A;  2DIE A;  2GRE A;  2B7B A;  1DAR A;  1Y0Y A;  5AN9 A;  4XN3 A;  1R5O A;  2RC5 A;  1JA0 A;  1SKQ A;  4TMV A;  2WZP P;  2BSA A;  2DY1 A;  1VQ9 B;  2E1R A;  1M1K D;  2CND A;  2WR8 A;  4UZU A;  4LBY A;  3GVK A;  1VQ7 B;  4DNT B;  3W2G A;  1E79 A;  2ZTG A;  4X7E A;  5GV8 A;  1PJ7 A;  2F4N A;  4HE5 A;  1E3X A;  3AVU A;  4TKO B;  2DOG A;  3PA1 A;  1EFU A;  4MYT A;  3H9N A;  2B5O A;  3AVT A;  4Y9R A;  1QFY A;  4UZE A;  4TMT A;  1GVH A;  3GVL A;  3U6K A;  2QDX A;  2Q6K A;  3ASP A;  1S0U A;  1YIT B;  1B23 P;  4XL9 A;  3OFN A;  4MYU A;  1WOS A;  4NCN A;  4M53 A;  4TMW A;  2BMW A;  3QFS A;  1G7R A;  2ZL7 A;  3CB4 A;  4H9G A;  2V4D A;  4YAU A;  1OGI A;  2YWE A;  1YI2 B;  3G71 B;  1BLI A;  3BCD A;  4RPB A;  5FA6 A;  3OEH A;  5HXB A;  1E1R A;  1WOO A;  4PC6 A;  5HZA A;  3ZZT A;  2YWG A;  4AF7 A;  3CW2 A;  4ZCM A;  2D9R A;  1FDR A;  3SLD A;  1CNE A;  4AC9 A;  3H94 A;  3JQQ A;  5TR9 A;  2QE7 A;  2ZXH A;  1WSV A;  1VQK B;  3ONU A;  1OGJ A;  1QUF A;  3A8K A;  3AGQ A;  2QEX B;  4KKT A;  2C2W A;  2OYN A;  1VLO A;  4RDL A;  1JA1 A;  2WZN A;  3QSY A;  4NBS A;  1KZL A;  3PUM A;  3PA2 A;  5KNL A;  3J81 k;  2BGI A;  1WDT A;  2D74 A;  4IW3 B;  1QGA A;  1U2R A;  2ZXI A;  1PKV A;  5FO0 A;  3LO8 A;  3CC2 B;  1KK0 A;  3KL9 A;  3BNW A;  1KJZ A;  1VQ8 B;  2QGG A;  3QFT A;  4Z4V A;  2GPJ A;  1MAB A;  4RCZ A;  4DQL A;  2VBV A;  1EFT A;  3SLN A;  3CCL B;  1FNM A;  1EFC A;  1BJK A;  3WBK A;  4M4S A;  4XLH A;  1VLY A;  4RCY A;  1VQL B;  1BX1 A;  4B3F X;  4PC7 A;  4B3X A;  1KRH A;  3CCQ B;  1W9X A;  3W5V A;  2C4T A;  2F43 A;  3I56 B;  4CQJ A;  3QFC A;  4ASU A;  2CC2 A;  3MHP A;  1N0U A;  2BVN A;  4BPR A;  4XNF A;  1I18 A;  1QVG B;  1QUE A;  3U2Q A;  3GSI A;  4Z1M A;  4X8I A;  2DEU A;  3OEE A;  3MMP A;  1OHH A;  3JQP A;  2XOK A;  3W5H A;  2B7C A;  1AIP A;  5HKK A;  3OAA A;  3OW7 A;  2KVO A;  5F4M A;  4B48 A;  3WXM A;  4TSF A;  5DN6 A;  2D3L A;  3AVV A;  1WPC A;  4Z4R A;  1EFR A;  4P25 A;  1UMK A;  2X85 A;  3W2F A;  2GQF A;  2VNH A;  4P3Y A;  4PC1 A;  4N3N A;  1N08 A;  1KMH A;  3ZIA A;  1OB5 A;  1KQS B;  3OZV A;  1OB0 A;  2XNC A;  1EXM A;  3ISX A;  4E0F A;  4TN1 A;  1QH0 A;  1WU8 A;  4II3 A;  1GJR A;  1HA3 A;  2JJ2 A;  2P3M A;  1K73 D;  2M5S A;  1W34 A;  3A8J A;  1K9M D;  1UD4 A;  2R6H A;  1KK1 A;  3GVJ A;  4XKV A;  3VO2 A;  4ZGN B;  4FWT A;  2GJK A;  4WQM A;  1S4M A;  1QFZ A;  2Q6L A;  3Q6R A;  4U9U A;  3W2I A;  4X05 A;  2ZL6 A;  4P9S A;  1VQP B;  2C4U A;  2XZO A;  2BV3 A;  2OTL B;  2XGJ A;  1RQP A;  1COW A;  4WZT A;  4QHY A;  3P26 A;  1DDI A;  1MRZ A;  4YXW A;  4Z4Y A;  2F1M A;  1VQ5 B;  4P12 A;  1YLO A;  4XKW A;  4Z4W A;  3E1Y E;  2VYQ A;  1JNY A;  1W87 A;  2WSS A;  4YEJ A;  3B78 A;  4PC2 A;  1D8T A;  3BH4 A;  1T5E A;  4ROX A;  4ZCL A;  4Z4Z A;  3OE7 A;  4G1V A;  1VQM B;  2PMD A;  4XOP A;  2X6Y A;  2EFG A;  1QGZ A;  1WP6 A;  1FNB A;  2X6W A;  3ASS A;  4ACA A;  1W2B B;  5A88 A;  1V0F A;  1VQ4 B;  4UZF A;  1OB2 A;  5F4J A;  4TMX A;  2NPF A;  4M0L A;  2VBU A;  1IJE A;  3V76 A;  1GAQ A;  3BCF A;  2HCJ B;  3QFR A;  4QVJ A;  4PAA A;  1P4M A;  4XLE A;  1HVX A;  1D1N A;  1S72 B;  2BN4 A;  3Q3A A;  3FJO A;  2QTL A;  1W35 A;  1I7P A;  3E20 A;  1YIJ B;  1W0K A;  1QFJ A;  1GAW A;  5CDF A;  3W5U A;  3BY2 A;  4RD0 A;  1DG1 G;  1WSR A;  3Q6Q A;  4RD2 A;  2WYR A;  4FN5 A;  3FKS A;  4G6I A;  4Z4T A;  2X3U A;  3CCJ B;  1GO2 A;  2Q6I A;  3CP8 A;  2DET A;  1WOP A;  2YWH A;  4FK8 A;  2V7Q A;  1XB2 A;  1GR1 A;  3ASR A;  3OZU A;  4PGO A;  4RM0 A;  2V7T A;  1Q86 D;  4WWV A;  4G7W A;  4UAJ A;  2ZBU A;  5H5J A;  4R71 A;  1Q7Y D;  4OP7 A;  4G7X A;  4KKS A;  1XE1 A;  3U6B A;  3OKX A;  4G1B A;  1N8R D;  1KK3 A;  2VBT A;  1KD1 D;  4J0Q A;  3G4S B;  1T6Y A;  4RD3 A;  4WZK A;  3WYA A;  4P26 A;  4X7D A;  5IYP A;  4YHB A;  4YAL A;  1Y0R A;  2X53 S;  3Q38 A;  4RDJ A;  2VBS A;  4N3G A;  3SJZ A;  2GK6 A;  4GQN A;  3FPK A;  1TVC A;  4RJL A;  3I55 B;  5LMZ A;  5TY0 A;  1CNF A;  5BSX A;  1TLL A;  2I1L A;  1T6Z A;  1Q9S A;  2GK7 A;  4L8J A;  1FRQ A;  2OTJ B;  4X7C A;  3PEN A;  4TMZ A;  3A1P A;  3PVD A;  2HLD A;  4M2L A;  2VNJ A;  5THX A;  2DER A;  1J9Z A;  4X07 A;  1BX0 A;  1H8E A;  4AF6 A;  3CC7 B;  1UD2 A;  1ELO A;  5IYW A;  3WNC A;  4XLC A;  2C78 A;  4X06 A;  2QTZ A;  4PAB A;  5IK2 A;  2ZZG A;  2C77 A;  2VNK A;  4KKU A;  4XLF A;  3WNB A;  1YX2 A;  4LBV A;  3CCV B;  2XNJ A;  2FVG A;  1PJ5 A;  4WZE A;  3T56 B;  4Z4S A;  4YAW A;  4JMQ A;  1WTH D;  3CPW B;  4XMY A;  4B43 A;  4Q7J B;  5DSZ A;  2NV4 A;  1FNC A;  1IB0 A;  2X0K A;  3OOC A;  2V7W A;  1JB9 A;  2OK7 A;  2QMU A;  2X8K A;  5L46 A;  1JJ2 B;  1V0E A;  1N06 A;  4X7F A;  4QUZ A;  3ZBT A;  4OOX A;  4P22 A;  4C43 A;  4Z4U A;  4TT3 A;  3WBJ A;  3KEW A;  3MCA A;  1I8D A;  3BY1 A;  4OPS A;  1TTT A;  2V7U A;  3CP2 A;  3OJX A;  4DNR B;  3CD6 B;  3CME B;  1N0V C;  2RC6 A;  1KK2 A;  3VNU A;  3WND A;  5A8A A;  4QFM A;  2V7X A;  4QV2 A;  3OZW A;  1SM4 A;  1VHO A;  3G6E B;  3LVB A;  1IHM A;  2OBS A;  2VZL A;  4B47 A;  1NB9 A;  4ACB A;  1XQB A;  4F7D A;  1UD5 A;  5EMN A;  3FPP A;  1VHE A;  4FXU A;  1E62 A;  2PLF A;  2CW5 A;  2AHO A;  1D2E A;  1PJ6 A;  4Y7C A;  1VF7 A;  3GIR A;  5A89 A;  1H42 A;  3CTA A;  2JDI A;  2GJP A;  3VMF A;  1QG0 A;  2CK3 A;  2Z6B D;  3SJP A;  4XR6 A;  3V7A A;  2BM1 A;  1NDH A;  3A35 A;  5KSW B;  3BC9 A;  3R6K A;  1FND A;  2OBR A;  4K1X A;  1R5N A;  4PC3 A;  1XFO A;  2J7K A;  5H59 A;  3WY9 A;  4M1K A;  4XOT A;  5IYR A;  3VNV A;  3JQR A;  3CES A;  1K28 D;  4B4D A;  5J3O A;  1EP2 B;  1G7S A;  1NJI D;  4RPD A;  3P27 A;  1G7T A;  1F60 A;  4ZGQ B;  1E1Q A;  4OPO A;  3RY8 A;  4C0S A;  3LQE A;  4X0C A;  3Q39 A;  4DK0 A;  1F20 A;  1YHQ B;  2DYI A;  5GV7 A;  3T51 B;  3T53 B;  1ZM9 A;  3B8H A;  4B3G A;  4ZCI A;  3AVW A;  4DQK A;  4YAO A;  3AGP A;  4Y9U A;  1RQR A;  2ZZE A;  5B6I A;  1W0J A;  3ONY A;  3A8I A;  4HE6 A;  1VQN B;  1WOR A;  1R5B A;  2QN6 A;  2PIA A;  2W6J A;  1Q82 D;  2XZL A;  4YEL A;  3VR6 A;  1FX0 A;  2V7V A;  1EP1 B;  4QVA A;  4RD6 A;  4XD7 A;  4LBZ A;  1VJS A;  5E6T A;  4P3I A;  2VJI A;  1NRK A;  3VO1 A;  1E3Z A;  1A8P A;  2PE3 A;  5FO1 A;  2ZIT A;  2QA4 B;  3SKB A;  3CCE B;  1NB0 A;  5FNZ A;  2JIZ A;  4OOV A;  3BQJ A;  3CMA B;  2JN9 A;  1BMF A;  1NBM A;  3ZUG A;  1K8A D;  3CMM A;  5DS0 A;  4P6V F;  1H85 A;  2BF4 A;  2JJ1 A;  3OP1 A;  1BPL A;  2ZTN A;  4XOR A;  3B82 A;  2R9V A;  3ASQ A;  5FIU A;  4DK1 A;  5TRD A;  1ZM3 A;  3ES9 A;  5IYQ A;  2Q6O A;  4XM3 A;  4YAF A;  1B2R A;  4XLA A;  2ZZF A;  1EP3 B;  1UD8 A;  1ZM2 A;  3DDY A;  2DCU A;  3CRZ A;  1QX4 A;  2HDN B;  4II2 A;  5KW9 A;  1H8H A;  2CBX A;  4RLZ A;  1UD3 A;  1N07 A;  1IJF A;  1YJW B;  2CRV A;  1E64 A;  5F4O A;  4P1V A;  1QGY A;  1ZM4 A;  3OW2 B;  3A3B A;  3ZC3 A;  3GQB A;  2OBT A;  2FX3 A;  2WPD A;  3LQ6 A;  2D3N A;  4LBW A;  4G5G A;  3ZZ0 A;  1VQ6 B;  2WJY A;  2VNI A;  3CCU B;  3JU4 A;  1V5V A;  2LZJ A;  3NE5 B;  3QE2 A;  4RD1 A;  4XON A;  2X6X A;  1N05 A;  1QVF B;  1CQX A;  2HMA A;  1G7C A;  4B44 A;  3A3G A;  2XND A;  1VQO B;  4RDK A;  2ZBV A;  1DDG A;  2ZL5 A;  1Q81 D;  1SKY B;  4NNJ A;  2EIX A;  5J35 A;  5IYN A;  2C5B A;  1ZUN B;  1E63 A;  3I1F A;  2BGJ A;  2YWF A;  1T6X A;  2VJJ A;  4LC0 A;  1KC8 D;  3ZZU A;  1UD6 A;  4WZL A;  2V31 A;  3CPX A;  1YJ9 B;  3SEJ A;  2C5H A;  1E43 A;  2BM0 A;  4XQF A;  2XZP A;  3OJW A;  4ZV4 A;  1TUI A;  2BPO A;  5BSY A;  2F1L A;  4AVZ A;  1M90 D;  2XEX A;  3G05 A;  3ZPN A;  1KTV A;  4P2N A;  3OPO A;  4OOS A;  3HAG A;  4P6Y A;  5JBQ A;  3AST A;  3CXC B;  3LNN A;  2GJR A;  2E1B A;  3W2E A;  3CCS B;  2WJV A;  2CF4 A;  2ZZQ A;  4XN0 A;  4EH1 A;  3R6J A;  1BQE A;  3CCR B;  5HZB A;  1AMO A; 
#chains in the Genus database with same CATH homology
 1NB9 A;  2I1L A;  1T6Z A;  1Q9S A;  5FO1 A;  3BNW A;  1N07 A;  1MRZ A;  1P4M A;  2P3M A;  2X0K A;  1T6X A;  1NB0 A;  2VBT A;  5FNZ A;  2VBV A;  1T6Y A;  1N06 A;  5A89 A;  3CTA A;  3ZUG A;  4UZE A;  1S4M A;  3OP1 A;  2OYN A;  1N05 A;  5TRD A;  5A8A A;  1N08 A;  2VBS A;  5A88 A;  4UZF A;  2VBU A;  5FO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...