1N08A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords putative riboflavin kinase
total genus 38
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n08A00
5FO1A 5TRDA 4UZEA 2VBSA 5FNZA 1T6XA 2I1LA 5A89A 2VBVA 3ZUGA 1N05A 1Q9SA 1NB0A 1N08A 1P4MA 4UZFA 5FO0A 1S4MA 3BNWA 1N06A 2VBTA 1T6ZA 1T6YA 3OP1A 1NB9A 1MRZA 2OYNA 2VBUA 5A88A 2P3MA 1N07A 3CTAA 5A8AA 2X0KA
chains in the Genus database with same CATH superfamily
3A8IA 4Z1MA 5IYQA 1SKQA 2GJPA 4KKUA 1QUFA 4BPRA 1QGZA 3CXCB 5DS0A 3CC4B 4B44A 1EP2B 1NRKA 4NCNA 3T56B 1EWYA 1J9ZA 2C4UA 1T6XA 1EFCA 1FNDA 4M53A 3U6BA 2C5HA 1EFTA 1Q9SA 2E1RA 3MCAA 3CW2A 3CC7B 1N06A 1Y0RA 2VBTA 2EIXA 1T6ZA 3W5HA 1OGIA 2BGJA 4DK0A 4LC0A 2Z6BD 2C77A 3CP2A 1TLLA 3P26A 1GVHA 2GK6A 2AHOA 1QUEA 3B8HA 2YWHA 4LBZA 1G7CA 5IYRA 3ONUA 2PE3A 5HKKA 5HXBA 2CRVA 4ROXA 4UZEA 4RD1A 3W5VA 4FXUA 1WOSA 2F1MA 3ASPA 4OPSA 4EH1A 1ZM4A 2QDXA 3HAGA 3BNWA 3ZZUA 1IJFA 2RC5A 1QX4A 3ASTA 4RJLA 2CBXA 1YJNB 4WZKA 4XONA 1Y0YA 2VBUA 5L46A 3U2QA 3FJOA 1YIJB 3KEWA 3W2HA 1KK3A 1BJKA 1W34A 2V4DA 2BF4A 3CTAA 3JQPA 1AIPA 1EFUA 2C5BA 2XEXA 2X3UA 3BY1A 3WNCA 5B6IA 5J3OA 3AGPA 1D2EA 5H59A 3CCSB 3H94A 3Q38A 3V7AA 3CD6B 4P26A 4YALA 1EP3B 3CPXA 1CQXA 5DN6A 4OOVA 4DQKA 1KC8D 3AVVA 3OJWA 1MABA 1NB0A 3CPWB 3FPKA 1EP1B 4YAWA 1S0UA 4HE6A 4B3FX 3OJXA 5IYPA 3ASRA 4XR6A 2Q6OA 3SKBA 4PC3A 1BQEA 5GV8A 3G6EB 5BSYA 4TKOB 5TV2A 3OEEA 4TSFA 2BGIA 4RM0A 4Z4YA 1WOOA 1DARA 2CW5A 1Q82D 2ZZFA 2WR8A 2OTLB 4QVJA 1VQ5B 1QFZA 3QFCA 1KZLA 4C0SA 2F1LA 2VNKA 3WYAA 1PKVA 2V7WA 2JIZA 1K73D 3G71B 2XNCA 1D8TA 1JA1A 1VJSA 1ZM2A 3A1PA 4JMQA 4RPBA 4XORA 2QN6A 2X6WA 1CNFA 1BLIA 4UZFA 2BPOA 3QFRA 3WNDA 2WJYA 1KJZA 4P6YA 3AGQA 2JJ1A 2QTLA 4GQNA 3OZUA 3OW7A 2V31A 4YAFA 4RD4A 1I8DA 2HLDA 5A8AA 1UD3A 3MHPA 4Z4WA 4RD3A 4X7DA 2ZZQA 5KW9A 1K8AD 4YEJA 4FN5A 2ZITA 1QVGB 5TRDA 4QV2A 4XM3A 5H5JA 1W87A 2YWFA 4QVAA 2ZXIA 3Q39A 2XNDA 1RQPA 2QEXB 3GVKA 3ZZ0A 2ZL5A 5F4JA 1OGJA 1NJID 2BM0A 2M5SA 3CCMB 1NB9A 1DDGA 1YJWB 1VHOA 4AF7A 4PC7A 3FKSA 4RDJA 4WZTA 4II3A 2PIAA 2ZXHA 2B5OA 4TMWA 1WSVA 4XLAA 5IYWA 2V7XA 3OPOA 3P27A 3GSIA 1K9MD 3D26A 1V5VA 3SLNA 3ZPNA 4KKSA 2BSAA 3OZWA 1TVCA 4G1BA 4XLFA 4P22A 5A89A 3GVLA 4YXWA 4X7CA 5CDFA 1GR1A 4XN3A 3B78A 2V7UA 1QGAA 4ASUA 3VR6A 1OB5A 3CMEB 1E3XA 2WPDA 3H9NA 4PGOA 3ZBUA 2OBSA 4IW3B 4MYUA 3QSYA 1FNMA 1EXMA 4B47A 1VQ8B 1PJ7A 2JJ2A 4XD7A 3B82A 4P9SA 1G7TA 4RD6A 4HIZA 4DQLA 2X85A 2VZLA 3W5UA 1KK2A 3CB4A 1BX0A 1VQMB 5F4OA 1W2BB 4XKWA 2VNJA 1QFJA 4AC9A 2XOKA 3CRZA 2PMDA 3SEJA 5E6TA 2NV4A 2HCJB 3VO1A 1H85A 4P3YA 5FO0A 2D74A 2R6HA 2VJJA 2WSSA 5LMZA 1UMKA 2JDIA 1JNYA 2F43A 4Z4SA 2P3MA 3W2FA 1GAQA 1WORA 4B3GA 3JU4A 2YWEA 4G7XA 4AF6A 4MYTA 4E0FA 2X8KA 4ZGQB 3CCLB 2DIEA 2C78A 1KK0A 2WZNA 4L8JA 2Q6IA 1FDRA 4OPVA 4OP7A 5FIUA 2HDNB 1ZM9A 2WZPP 1XB2A 1N0UA 4II2A 3WBKA 3FPPA 3VNUA 4ZCLA 3LNNA 5FL7A 5DSZA 4DNTB 4FWTA 3AVUA 3CCVB 1F20A 2W6IA 3CP8A 2GPJA 2QGGA 3G05A 4P25A 3CCEB 4P6VF 3OW2B 1VF7A 4QFMA 1H8HA 4TMVA 4N3NA 3OP1A 4DK1A 4WZEA 2BVNA 3OKXA 2DERA 3KL9A 4TMXA 1UD5A 4C43A 3VMFA 3PVDA 4Y9RA 1FRNA 2GJKA 1PJ5A 5TY0A 2GQFA 2V7TA 3LVBA 3V76A 4PC1A 4ACAA 2X53S 1IB0A 4K1XA 4YHBA 1VQ9B 1XQBA 3E1YE 2LZJA 4RD2A 5FA6A 2RC6A 2VBSA 4Z4VA 1N0VC 3BCDA 4OOXA 1FX0A 4RPDA 1KTVA 3T53B 1KD1D 3G4SB 2D3NA 2OK8A 2OBTA 1A8PA 3JQQA 4Z4TA 1OHHA 1VQ6B 2QE7A 3DDYA 3J81k 1WOPA 1W35A 1D1NA 4B4DA 4RDLA 1E43A 2C2WA 3ASSA 2ZTNA 4N3GA 1YX2A 1KK1A 2W6JA 3WY9A 4XMYA 3ASQA 4PAAA 4X05A 1K28D 1FRQA 1ZUNB 2OBRA 1FNCA 2VNHA 3OE7A 4LBWA 4XNFA 1DG1G 3SJZA 1XE1A 2GJRA 2XZPA 5HZAA 3I56B 4YAOA 1N08A 1P4MA 1TUIA 3A3GA 1AMOA 3JQRA 3CCJB 3OFNA 4RDKA 4YELA 3I1FA 1Q86D 4X7EA 3NE5B 5JBQA 4LBYA 1E3ZA 2R9VA 3LO8A 4OPOA 3T51B 2QTZA 1OB2A 1WSRA 3OAAA 2EFGA 4P12A 4X7FA 3WBJA 3ZIAA 1GJRA 2V7QA 3AVYA 4Z4RA 2XNJA 2D3LA 4X8IA 3R6KA 1BX1A 4RLZA 2C4TA 1F60A 1IHMA 3VO2A 1WDTA 4HE5A 2I1LA 3ZZTA 4B43A 4Z4ZA 1E1RA 1T5EA 4FK8A 3SLDA 1M1KD 2ZTGA 1QH0A 3GQBA 2NPFA 4RCYA 1YHQB 3QFTA 1W0JA 4KKTA 4Z4UA 1WPCA 1VQOB 1TTTA 3ONYA 1CNEA 1EFRA 1UD2A 2VNIA 1E62A 1JB9A 2ZL6A 1GAWA 1NBMA 4DNRB 1N07A 1E64A 1KQSB 1ELOA 1B2RA 3BY2A 3CC2B 4P2NA 2CC2A 3BH4A 3E20A 5IYNA 1Q7YD 2QA4B 2B7CA 3PUMA 2FX3A 1V0EA 4X0CA 1H42A 3CCQB 1R5NA 4QHYA 5AN9A 2BV3A 3CMAB 4PC6A 1VQLB 1VHEA 1N05A 2Q6KA 2E1BA 3BC9A 3ZC3A 3LQ6A 1I18A 1ZM3A 2WYRA 2DETA 1XFOA 3GIRA 2BMWA 1IJEA 3WNBA 5TR9A 5KNLA 4P3IA 3PA1A 5A88A 3AVWA 4CQJA 1VQ4B 4RCZA 2YWGA 4XL9A 1PJ6A 1V0FA 4ZV4A 3LQEA 1VLOA 2X0KA 4ZCMA 3W2IA 3OEHA 4OOSA 4U9UA 4G5GA 4XLCA 1H8EA 2BM1A 2ZZGA 3ZBTA 5FO1A 1SKYB 1R5OA 4M4SA 4M2LA 4TT3A 3AVXA 4NNJA 2DYIA 3GVJA 2CK3A 3QE2A 2OTJB 1W0KA 3BQJA 4J0QA 1UD4A 3PENA 4M0LA 4ZCIA 4WQMA 1VQPB 1S72B 2JN9A 2ZL7A 4LBVA 1JA0A 2ZBVA 1WTHD 1FNBA 3MMPA 4G7WA 1YLOA 4XLEA 5IK2A 2FVGA 2CF4A 5THXA 3R6JA 2GREA 1QGYA 2VYQA 1YI2B 2D9RA 4Y9UA 3W2GA 3Q3AA 1R5BA 4ZGNB 1M90D 4G1VA 4H9GA 2B7BA 4TMZA 1QG0A 2KVOA 1BPLA 2VJIA 4UZUA 4Y7CA 5FNZA 1KMHA 2WJVA 3ES9A 4XN0A 4WWVA 3SJPA 2XZLA 3ZUGA 4XKVA 2DOGA 1HVXA 1COWA 4P1VA 3A35A 1VLYA 4R71A 2J7KA 5KSWB 4XOTA 1W9XA 4Q7JB 3AVTA 1MRZA 4XOPA 2F4NA 2OYNA 3WQZA 3CMMA 1YITB 3OOCA 5BSXA 5HZBA 3VNVA 1E1QA 3Q6QA 1I7PA 2X6YA 3QFSA 4TN1A 4X07A 3BCFA 5EMNA 4PC2A 1Q81D 1SM4A 2BN4A 1VQNB 3A3BA 4WZLA 4NBSA 5F4MA 3A8KA 3WXMA 1G7SA 1GO2A 1RQRA 4PABA 1S4MA 3A8JA 3CCRB 3CESA 3OZVA 2XGJA 1T6YA 2OK7A 5J35A 3RY8A 1JJ2B 2DEUA 1HZEA 4TMTA 2QMUA 4B48A 4X06A 1QFYA 2DCUA 3U6KA 2X6XA 4B3XA 4UAJA 2PLFA 3Q6RA 1BMFA 1E63A 2GK7A 1YJ9B 2HMAA 4M1KA 2XZOA 3I55B 4XLHA 1DDIA 4ACBA 3ISXA 2ZBUA 1WU8A 2VBVA 4YAUA 1WP6A 1B23P 1E79A 3PA2A 1OB0A 5GV7A 1VQKB 4G6IA 3W2EA 4XQFA 1VQ7B 2Q6LA 4QUZA 1G7RA 4F7DA 1N8RD 1NDHA 1KRHA 1QVFB 1UD6A 4RD0A 3CCUB 2ZZEA 2DY1A 2CNDA 1UD8A 3PUNA 4AVZA 2V7VA 1HA3A 1U2RA
chains in the Genus database with same CATH topology
5FO1A 5TRDA 4UZEA 2VBSA 5FNZA 1T6XA 2I1LA 5A89A 2VBVA 3ZUGA 1N05A 1Q9SA 1NB0A 1N08A 1P4MA 4UZFA 5FO0A 1S4MA 3BNWA 1N06A 2VBTA 1T6ZA 1T6YA 3OP1A 1NB9A 1MRZA 2OYNA 2VBUA 5A88A 2P3MA 1N07A 3CTAA 5A8AA 2X0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FO1 A;  5TRD A;  4UZE A;  2VBS A;  5FNZ A;  1T6X A;  2I1L A;  5A89 A;  2VBV A;  3ZUG A;  1N05 A;  1Q9S A;  1NB0 A;  1N08 A;  1P4M A;  4UZF A;  5FO0 A;  1S4M A;  3BNW A;  1N06 A;  2VBT A;  1T6Z A;  1T6Y A;  3OP1 A;  1NB9 A;  1MRZ A;  2OYN A;  2VBU A;  5A88 A;  2P3M A;  1N07 A;  3CTA A;  5A8A A;  2X0K A; 
#chains in the Genus database with same CATH topology
 3A8I A;  4Z1M A;  5IYQ A;  1SKQ A;  2GJP A;  4KKU A;  1QUF A;  4BPR A;  1QGZ A;  3CXC B;  5DS0 A;  3CC4 B;  4B44 A;  1EP2 B;  1NRK A;  4NCN A;  3T56 B;  1EWY A;  1J9Z A;  2C4U A;  1T6X A;  1EFC A;  1FND A;  4M53 A;  3U6B A;  2C5H A;  1EFT A;  1Q9S A;  2E1R A;  3MCA A;  3CW2 A;  3CC7 B;  1N06 A;  1Y0R A;  2VBT A;  2EIX A;  1T6Z A;  3W5H A;  1OGI A;  2BGJ A;  4DK0 A;  4LC0 A;  2Z6B D;  2C77 A;  3CP2 A;  1TLL A;  3P26 A;  1GVH A;  2GK6 A;  2AHO A;  1QUE A;  3B8H A;  2YWH A;  4LBZ A;  1G7C A;  5IYR A;  3ONU A;  2PE3 A;  5HKK A;  5HXB A;  2CRV A;  4ROX A;  4UZE A;  4RD1 A;  3W5V A;  4FXU A;  1WOS A;  2F1M A;  3ASP A;  4OPS A;  4EH1 A;  1ZM4 A;  2QDX A;  3HAG A;  3BNW A;  3ZZU A;  1IJF A;  2RC5 A;  1QX4 A;  3AST A;  4RJL A;  2CBX A;  1YJN B;  4WZK A;  4XON A;  1Y0Y A;  2VBU A;  5L46 A;  3U2Q A;  3FJO A;  1YIJ B;  3KEW A;  3W2H A;  1KK3 A;  1BJK A;  1W34 A;  2V4D A;  2BF4 A;  3CTA A;  3JQP A;  1AIP A;  1EFU A;  2C5B A;  2XEX A;  2X3U A;  3BY1 A;  3WNC A;  5B6I A;  5J3O A;  3AGP A;  1D2E A;  5H59 A;  3CCS B;  3H94 A;  3Q38 A;  3V7A A;  3CD6 B;  4P26 A;  4YAL A;  1EP3 B;  3CPX A;  1CQX A;  5DN6 A;  4OOV A;  4DQK A;  1KC8 D;  3AVV A;  3OJW A;  1MAB A;  1NB0 A;  3CPW B;  3FPK A;  1EP1 B;  4YAW A;  1S0U A;  4HE6 A;  4B3F X;  3OJX A;  5IYP A;  3ASR A;  4XR6 A;  2Q6O A;  3SKB A;  4PC3 A;  1BQE A;  5GV8 A;  3G6E B;  5BSY A;  4TKO B;  5TV2 A;  3OEE A;  4TSF A;  2BGI A;  4RM0 A;  4Z4Y A;  1WOO A;  1DAR A;  2CW5 A;  1Q82 D;  2ZZF A;  2WR8 A;  2OTL B;  4QVJ A;  1VQ5 B;  1QFZ A;  3QFC A;  1KZL A;  4C0S A;  2F1L A;  2VNK A;  3WYA A;  1PKV A;  2V7W A;  2JIZ A;  1K73 D;  3G71 B;  2XNC A;  1D8T A;  1JA1 A;  1VJS A;  1ZM2 A;  3A1P A;  4JMQ A;  4RPB A;  4XOR A;  2QN6 A;  2X6W A;  1CNF A;  1BLI A;  4UZF A;  2BPO A;  3QFR A;  3WND A;  2WJY A;  1KJZ A;  4P6Y A;  3AGQ A;  2JJ1 A;  2QTL A;  4GQN A;  3OZU A;  3OW7 A;  2V31 A;  4YAF A;  4RD4 A;  1I8D A;  2HLD A;  5A8A A;  1UD3 A;  3MHP A;  4Z4W A;  4RD3 A;  4X7D A;  2ZZQ A;  5KW9 A;  1K8A D;  4YEJ A;  4FN5 A;  2ZIT A;  1QVG B;  5TRD A;  4QV2 A;  4XM3 A;  5H5J A;  1W87 A;  2YWF A;  4QVA A;  2ZXI A;  3Q39 A;  2XND A;  1RQP A;  2QEX B;  3GVK A;  3ZZ0 A;  2ZL5 A;  5F4J A;  1OGJ A;  1NJI D;  2BM0 A;  2M5S A;  3CCM B;  1NB9 A;  1DDG A;  1YJW B;  1VHO A;  4AF7 A;  4PC7 A;  3FKS A;  4RDJ A;  4WZT A;  4II3 A;  2PIA A;  2ZXH A;  2B5O A;  4TMW A;  1WSV A;  4XLA A;  5IYW A;  2V7X A;  3OPO A;  3P27 A;  3GSI A;  1K9M D;  3D26 A;  1V5V A;  3SLN A;  3ZPN A;  4KKS A;  2BSA A;  3OZW A;  1TVC A;  4G1B A;  4XLF A;  4P22 A;  5A89 A;  3GVL A;  4YXW A;  4X7C A;  5CDF A;  1GR1 A;  4XN3 A;  3B78 A;  2V7U A;  1QGA A;  4ASU A;  3VR6 A;  1OB5 A;  3CME B;  1E3X A;  2WPD A;  3H9N A;  4PGO A;  3ZBU A;  2OBS A;  4IW3 B;  4MYU A;  3QSY A;  1FNM A;  1EXM A;  4B47 A;  1VQ8 B;  1PJ7 A;  2JJ2 A;  4XD7 A;  3B82 A;  4P9S A;  1G7T A;  4RD6 A;  4HIZ A;  4DQL A;  2X85 A;  2VZL A;  3W5U A;  1KK2 A;  3CB4 A;  1BX0 A;  1VQM B;  5F4O A;  1W2B B;  4XKW A;  2VNJ A;  1QFJ A;  4AC9 A;  2XOK A;  3CRZ A;  2PMD A;  3SEJ A;  5E6T A;  2NV4 A;  2HCJ B;  3VO1 A;  1H85 A;  4P3Y A;  5FO0 A;  2D74 A;  2R6H A;  2VJJ A;  2WSS A;  5LMZ A;  1UMK A;  2JDI A;  1JNY A;  2F43 A;  4Z4S A;  2P3M A;  3W2F A;  1GAQ A;  1WOR A;  4B3G A;  3JU4 A;  2YWE A;  4G7X A;  4AF6 A;  4MYT A;  4E0F A;  2X8K A;  4ZGQ B;  3CCL B;  2DIE A;  2C78 A;  1KK0 A;  2WZN A;  4L8J A;  2Q6I A;  1FDR A;  4OPV A;  4OP7 A;  5FIU A;  2HDN B;  1ZM9 A;  2WZP P;  1XB2 A;  1N0U A;  4II2 A;  3WBK A;  3FPP A;  3VNU A;  4ZCL A;  3LNN A;  5FL7 A;  5DSZ A;  4DNT B;  4FWT A;  3AVU A;  3CCV B;  1F20 A;  2W6I A;  3CP8 A;  2GPJ A;  2QGG A;  3G05 A;  4P25 A;  3CCE B;  4P6V F;  3OW2 B;  1VF7 A;  4QFM A;  1H8H A;  4TMV A;  4N3N A;  3OP1 A;  4DK1 A;  4WZE A;  2BVN A;  3OKX A;  2DER A;  3KL9 A;  4TMX A;  1UD5 A;  4C43 A;  3VMF A;  3PVD A;  4Y9R A;  1FRN A;  2GJK A;  1PJ5 A;  5TY0 A;  2GQF A;  2V7T A;  3LVB A;  3V76 A;  4PC1 A;  4ACA A;  2X53 S;  1IB0 A;  4K1X A;  4YHB A;  1VQ9 B;  1XQB A;  3E1Y E;  2LZJ A;  4RD2 A;  5FA6 A;  2RC6 A;  2VBS A;  4Z4V A;  1N0V C;  3BCD A;  4OOX A;  1FX0 A;  4RPD A;  1KTV A;  3T53 B;  1KD1 D;  3G4S B;  2D3N A;  2OK8 A;  2OBT A;  1A8P A;  3JQQ A;  4Z4T A;  1OHH A;  1VQ6 B;  2QE7 A;  3DDY A;  3J81 k;  1WOP A;  1W35 A;  1D1N A;  4B4D A;  4RDL A;  1E43 A;  2C2W A;  3ASS A;  2ZTN A;  4N3G A;  1YX2 A;  1KK1 A;  2W6J A;  3WY9 A;  4XMY A;  3ASQ A;  4PAA A;  4X05 A;  1K28 D;  1FRQ A;  1ZUN B;  2OBR A;  1FNC A;  2VNH A;  3OE7 A;  4LBW A;  4XNF A;  1DG1 G;  3SJZ A;  1XE1 A;  2GJR A;  2XZP A;  5HZA A;  3I56 B;  4YAO A;  1N08 A;  1P4M A;  1TUI A;  3A3G A;  1AMO A;  3JQR A;  3CCJ B;  3OFN A;  4RDK A;  4YEL A;  3I1F A;  1Q86 D;  4X7E A;  3NE5 B;  5JBQ A;  4LBY A;  1E3Z A;  2R9V A;  3LO8 A;  4OPO A;  3T51 B;  2QTZ A;  1OB2 A;  1WSR A;  3OAA A;  2EFG A;  4P12 A;  4X7F A;  3WBJ A;  3ZIA A;  1GJR A;  2V7Q A;  3AVY A;  4Z4R A;  2XNJ A;  2D3L A;  4X8I A;  3R6K A;  1BX1 A;  4RLZ A;  2C4T A;  1F60 A;  1IHM A;  3VO2 A;  1WDT A;  4HE5 A;  2I1L A;  3ZZT A;  4B43 A;  4Z4Z A;  1E1R A;  1T5E A;  4FK8 A;  3SLD A;  1M1K D;  2ZTG A;  1QH0 A;  3GQB A;  2NPF A;  4RCY A;  1YHQ B;  3QFT A;  1W0J A;  4KKT A;  4Z4U A;  1WPC A;  1VQO B;  1TTT A;  3ONY A;  1CNE A;  1EFR A;  1UD2 A;  2VNI A;  1E62 A;  1JB9 A;  2ZL6 A;  1GAW A;  1NBM A;  4DNR B;  1N07 A;  1E64 A;  1KQS B;  1ELO A;  1B2R A;  3BY2 A;  3CC2 B;  4P2N A;  2CC2 A;  3BH4 A;  3E20 A;  5IYN A;  1Q7Y D;  2QA4 B;  2B7C A;  3PUM A;  2FX3 A;  1V0E A;  4X0C A;  1H42 A;  3CCQ B;  1R5N A;  4QHY A;  5AN9 A;  2BV3 A;  3CMA B;  4PC6 A;  1VQL B;  1VHE A;  1N05 A;  2Q6K A;  2E1B A;  3BC9 A;  3ZC3 A;  3LQ6 A;  1I18 A;  1ZM3 A;  2WYR A;  2DET A;  1XFO A;  3GIR A;  2BMW A;  1IJE A;  3WNB A;  5TR9 A;  5KNL A;  4P3I A;  3PA1 A;  5A88 A;  3AVW A;  4CQJ A;  1VQ4 B;  4RCZ A;  2YWG A;  4XL9 A;  1PJ6 A;  1V0F A;  4ZV4 A;  3LQE A;  1VLO A;  2X0K A;  4ZCM A;  3W2I A;  3OEH A;  4OOS A;  4U9U A;  4G5G A;  4XLC A;  1H8E A;  2BM1 A;  2ZZG A;  3ZBT A;  5FO1 A;  1SKY B;  1R5O A;  4M4S A;  4M2L A;  4TT3 A;  3AVX A;  4NNJ A;  2DYI A;  3GVJ A;  2CK3 A;  3QE2 A;  2OTJ B;  1W0K A;  3BQJ A;  4J0Q A;  1UD4 A;  3PEN A;  4M0L A;  4ZCI A;  4WQM A;  1VQP B;  1S72 B;  2JN9 A;  2ZL7 A;  4LBV A;  1JA0 A;  2ZBV A;  1WTH D;  1FNB A;  3MMP A;  4G7W A;  1YLO A;  4XLE A;  5IK2 A;  2FVG A;  2CF4 A;  5THX A;  3R6J A;  2GRE A;  1QGY A;  2VYQ A;  1YI2 B;  2D9R A;  4Y9U A;  3W2G A;  3Q3A A;  1R5B A;  4ZGN B;  1M90 D;  4G1V A;  4H9G A;  2B7B A;  4TMZ A;  1QG0 A;  2KVO A;  1BPL A;  2VJI A;  4UZU A;  4Y7C A;  5FNZ A;  1KMH A;  2WJV A;  3ES9 A;  4XN0 A;  4WWV A;  3SJP A;  2XZL A;  3ZUG A;  4XKV A;  2DOG A;  1HVX A;  1COW A;  4P1V A;  3A35 A;  1VLY A;  4R71 A;  2J7K A;  5KSW B;  4XOT A;  1W9X A;  4Q7J B;  3AVT A;  1MRZ A;  4XOP A;  2F4N A;  2OYN A;  3WQZ A;  3CMM A;  1YIT B;  3OOC A;  5BSX A;  5HZB A;  3VNV A;  1E1Q A;  3Q6Q A;  1I7P A;  2X6Y A;  3QFS A;  4TN1 A;  4X07 A;  3BCF A;  5EMN A;  4PC2 A;  1Q81 D;  1SM4 A;  2BN4 A;  1VQN B;  3A3B A;  4WZL A;  4NBS A;  5F4M A;  3A8K A;  3WXM A;  1G7S A;  1GO2 A;  1RQR A;  4PAB A;  1S4M A;  3A8J A;  3CCR B;  3CES A;  3OZV A;  2XGJ A;  1T6Y A;  2OK7 A;  5J35 A;  3RY8 A;  1JJ2 B;  2DEU A;  1HZE A;  4TMT A;  2QMU A;  4B48 A;  4X06 A;  1QFY A;  2DCU A;  3U6K A;  2X6X A;  4B3X A;  4UAJ A;  2PLF A;  3Q6R A;  1BMF A;  1E63 A;  2GK7 A;  1YJ9 B;  2HMA A;  4M1K A;  2XZO A;  3I55 B;  4XLH A;  1DDI A;  4ACB A;  3ISX A;  2ZBU A;  1WU8 A;  2VBV A;  4YAU A;  1WP6 A;  1B23 P;  1E79 A;  3PA2 A;  1OB0 A;  5GV7 A;  1VQK B;  4G6I A;  3W2E A;  4XQF A;  1VQ7 B;  2Q6L A;  4QUZ A;  1G7R A;  4F7D A;  1N8R D;  1NDH A;  1KRH A;  1QVF B;  1UD6 A;  4RD0 A;  3CCU B;  2ZZE A;  2DY1 A;  2CND A;  1UD8 A;  3PUN A;  4AVZ A;  2V7V A;  1HA3 A;  1U2R A; 
#chains in the Genus database with same CATH homology
 5FO1 A;  5TRD A;  4UZE A;  2VBS A;  5FNZ A;  1T6X A;  2I1L A;  5A89 A;  2VBV A;  3ZUG A;  1N05 A;  1Q9S A;  1NB0 A;  1N08 A;  1P4M A;  4UZF A;  5FO0 A;  1S4M A;  3BNW A;  1N06 A;  2VBT A;  1T6Z A;  1T6Y A;  3OP1 A;  1NB9 A;  1MRZ A;  2OYN A;  2VBU A;  5A88 A;  2P3M A;  1N07 A;  3CTA A;  5A8A A;  2X0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...