2RC6A

Refined structure of fnr from leptospira interrogans bound to nadp+
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
306
Chain Sequence
PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Oxidoreductase
total genus 86
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc6A02
1G7SA 1Q82D 3CCVB 1EP1B 1KK3A 4Q7JB 2QTLA 1ZM4A 3ZZ0A 4DQKA 4HE6A 1JA0A 1YI2B 3OJWA 4N3GA 5GV8A 1KRHA 3MMPA 1EP3B 4MYUA 1XB2A 1DARA 3SJZA 1W34A 3LO8A 1FNCA 1QVFB 2FX3A 1F20A 1Q86D 1NDHA 1FNMA 4LBWA 4YAUA 2VNHA 1K73D 3ES9A 1DDGA 3CW2A 2DETA 5FA6A 3B82A 3FPKA 4AF7A 4LBVA 1VQ4B 3WBJA 3W2IA 2CRVA 4H9GA 2C77A 3VO2A 3CPWB 4TMXA 1QFZA 1ZM2A 1IJFA 4FK8A 4YALA 4ZGQB 1ZUNB 2AHOA 1ZM3A 3JQQA 3CCSB 1W2BB 3VNUA 1OB5A 1W35A 4M2LA 3LYUA 4AC9A 3QFSA 3G6EB 1UMKA 4C43A 4TMVA 1GVHA 1FRNA 4QFMA 3WYAA 3WXMA 4G1BA 2OK8A 1A8PA 4YAFA 1Q7YD 2BM0A 2E1RA 3I55B 1SM4A 2HDNB 3I56B 1R5BA 4BPRA 1KJZA 4K1XA 1XE1A 2QN6A 3A1FA 1E64A 4ZGNB 3QFCA 1VQMB 2BSAA 1B2RA 4PC1A 4P6VF 1VQPB 2BVNA 1K8AD 3WY9A 2XNJA 1QX4A 3VMFA 1H85A 4M53A 1S0UA 3E1YE 3MHPA 1AMOA 2VNKA 3W2HA 1QG0A 1KK0A 3CCJB 4TN1A 1G7CA 3W5HA 4Y9RA 3AVXA 3J81k 4LBZA 1CNFA 3OJXA 3E20A 2YWGA 3G4SB 1B23P 1BJKA 1EP2B 4B44A 1YITB 2BGIA 2GQFA 3CC7B 2YWEA 4RCZA 3CCLB 1KC8D 1FDRA 3FJOA 1QGAA 2BMWA 2VZLA 2PLFA 1QUFA 3QFRA 4PGOA 2BPOA 2EIXA 4ACBA 3ZZUA 1GAQA 3LRXA 3PENA 1YIJB 1OGJA 1SKQA 4G1VA 3CCMB 3I1FA 4B43A 1OGIA 1JNYA 1VQNB 2OK7A 1YHQB 3G71B 2VNJA 4TMWA 4M4SA 1VQ5B 3LVBA 1JJ2B 4B3XA 3ZZTA 3V76A 3W2EA 1Q81D 4G5GA 4DQLA 5DSZA 3ZBTA 2D74A 2QMUA 4HE5A 1YJWB 1H42A 4QHYA 3WNCA 4RJLA 1QGYA 3WNDA 1OB2A 1ZM9A 4AF6A 1U2RA 5THXA 3P26A 1EWYA 1E63A 1QH0A 1AIPA 4RCYA 3WNBA 1KK2A 4RD6A 2QEXB 3CCRB 1JB9A 3W5UA 3CCQB 2BV3A 1DDIA 3U6KA 2RC5A 4R71A 4J0QA 5KSWB 2YWFA 3CXCB 4RD1A 2BN4A 2X3UA 2VYQA 3CRZA 1R5NA 1GR1A 1VQ9B 1BQEA 3AVWA 1QFJA 3ZBUA 4RD2A 3ZC3A 4UAJA 4NCNA 1YJ9B 3AVVA 1YJNB 4FN5A 1TLLA 2DCUA 1VQ6B 4ACAA 3VNVA 2B7CA 1G7RA 2HCJB 2XEXA 1CQXA 5EMNA 1VQOB 1FNDA 3CCEB 5AN9A 4YHBA 3AVTA 1TTTA 4ZV4A 2QDXA 4IW3B 3VO1A 1M90D 1CNEA 1M1KD 2QA4B 2OTJB 1HA3A 4WQMA 2XNCA 3CB4A 1N0UA 3U2QA 4P3YA 4F7DA 4TMTA 1I7PA 2B7BA 2NPFA 4PC2A 2DEUA 1N0VC 3CC4B 1TVCA 1D2EA 2VNIA 3QFTA 1BX1A 2B5OA 3W2GA 4ZCIA 3JQPA 1ELOA 3P27A 4YAWA 2DERA 4N3NA 1DG1G 1QFYA 1QVGB 1TUIA 3CC2B 1EFUA 5H5JA 1KK1A 1GO2A 3U6BA 4Y7CA 4PC6A 3AVUA 1WDTA 1VQKB 1D8TA 1K9MD 2BF4A 4PC7A 2HMAA 3MCAA 1IB0A 1D1NA 4ZCMA 1QUEA 2EFGA 3W5VA 2BGJA 4U9UA 4ZCLA 3AGPA 1FRQA 2QTZA 4YAOA 3B78A 1VQ8B 1GJRA 3OZWA 2OTLB 4NBSA 5H59A 1VQ7B 1EFCA 2ZITA 3AGQA 4RD4A 4M0LA 4EH1A 3CMEB 5HXBA 3W2FA 1BX0A 1KQSB 1KTVA 1S72B 2RC6A 5TY0A 4B48A 2J7KA 4B4DA 2CNDA 3OZUA 4Y9UA 1EFTA 1G7TA 1QGZA 1J9ZA 2YWHA 3OW2B 5GV7A 2PMDA 3AVYA 3OZVA 1W87A 1E62A 4MYTA 5JBQA 3CCUB 1R5OA 3B8HA 1F60A 4C0SA 5TV2A 4M1KA 1GAWA 3JQRA 4LBYA 2PIAA 4PC3A 3CMAB 4LC0A 4TMZA 4RD0A 1N8RD 2R6HA 1VQLB 4RD3A 1FNBA 2GPJA 3QSYA 3CD6B 1JA1A 3QE2A 3WBKA 1KD1D 2C78A 1NJID 1IJEA 4B47A 1EXMA 2DY1A 4FWTA 2BM1A 5TR9A
chains in the Genus database with same CATH superfamily
3QM1A 3B1JA 4QQRA 3AJEA 4CV3A 1PZFA 3JYHA 3NASA 2IV3A 1WOYA 3BB3A 3CTPA 1BFUA 1SN7A 4GLFA 4O4IF 4RTRA 2B3DA 2AYXA 1ZM4A 2YJTD 4Z5XA 1AKNA 2WFZA 3FPFA 3BGOS 3TLBA 4WFKA 4JI4B 3O91A 3K6JA 5KB3A 1UZNA 1CQIB 3S2EA 1SAYA 4C0KA 3AZQA 4D6PA 2KX7A 1UOOA 2BH9A 2DT5A 2IIVA 1G66A 3LFTA 1DV1A 4PPNA 3HJFA 2HBRA 4CQMB 3LI2A 5ALZA 3O21A 1C0EA 1E9VA 2AZMA 2ZBRA 1IRIA 3A3OA 3HO8A 3LZCA 4HWSA 4OU4A 3OD5A 2CBXA 3OECA 1WCV1 4I5GA 4XYGA 1HL3A 2XMBA 3KT8A 5BXQC 4C78A 3N76A 2H8GA 2B69A 4DZRA 3BXOA 3I09A 5LB4A 4GVXA 2QGGA 2GM9A 3RUDA 1IEXA 4EHHA 3DBHA 2ODEA 1MIHA 1OAAA 1NDHA 2VL7A 3ODGA 3O74A 1SU7A 1QV9A 3LHFA 1G9XA 2VSOA 3OM9A 1JHRA 4ATNA 5IN4A 5JCPA 4DR1B 1IOLA 4YAUA 3L05A 3N75A 4J94A 3R76A 3IEVA 4WN9B 2O5EA 3N6XA 5JMPA 2DETA 4LFAB 4U7JA 4AJIA 3PKZA 3ZU2A 1HDYA 4IOLA 1TM1E 3EAFA 3DD5A 3R3YA 3SLGA 3TRFA 2ZZMA 3W1WA 5K0JA 2VPPA 1CS4C 3ANMA 1L4NA 2VHYA 4BRUA 2Z2KA 1F4PA 3I9NA 1MQ9A 5IYNA 4GMHA 1VE1A 2ZI3A 5EJEA 5MN6A 4JL5A 4Z4CA 1TRHA 3EQ8A 4CIWA 5HQ3A 4DLLA 1USKA 1K3TA 1OX4B 1VL8A 1X42A 2JAQA 2O1SA 3HL4A 1F8GA 2OHIA 4Z9XA 3RUHA 2G1PA 3RABA 3RUPA 4A8HA 2NXWA 2O14A 1W76A 4EJ0A 4PO8A 3A1SA 3KV3O 4ZGQB 5FWXA 4C0BA 5G3ZA 3GJXC 1ZOIA 1RKBA 3N2LA 3OZ7A 1QRUA 2WYRA 4A1OA 3QUTA 3KOYA 2FOLA 2F00A 1CV2A 3FZEA 3OD1A 4OEHA 1LS1A 1T2NA 2WE7A 1AT1A 4XLLA 1JHVA 1R50A 3E0XA 1OTXA 4FHGA 5H8WA 3KQKA 5DEIA 2AX3A 2HC9A 4HDRA 1ODIA 5CW2A 5JH7A 4B7XA 3GLRA 1TTQB 4PLPA 2CXNA 4QOHA 1UFVA 5FYDA 1V9SA 3E7FA 4HDOB 4QYMA 3WP1B 1XRQA 2YBDA 4WTOA 2JW5A 2P2ZA 1KI8A 3OF3A 4GBMA 2DWQA 5JE8A 1ENYA 4W6QA 3VH1A 4AC9A 2C3OA 2PXXA 3H19A 2OLEA 3L77A 4K0RA 3TIFA 4DA9A 3ZU4A 1OYWA 3IS3A 2QE6A 4RHFA 5IKMA 1WTAA 4QD3A 1AKYA 2JRCA 3VZDA 5F7XA 3S7ZA 1IN4A 3CRMA 3SU8A 3L8EA 2Z5VA 2QR3A 4EMSA 1VIDA 5IX8A 1XD8A 1HDZA 2WJ3A 3I04A 4LI0A 4A03A 3UMBA 4FX2A 1L4YA 1BCRB 3BF8A 2BGGA 2XGJA 1KEEB 3ZHBA 4BXOB 3HP4A 4LW8A 3BFXA 3R6TA 4JB3A 4JX8A 4Q7LA 4WPGA 4KFUA 4BNXA 4BIMA 1RCFA 1X1DA 1Y4UA 3OOYA 2MMGA 4XW2A 4BO6A 3L0PA 3OT1A 4M9ZA 4UHJA 4RENA 4IG4A 4RM0A 4FYVA 1EUZA 2VDOB 3WSVA 3FYUA 3OWOA 2W4MA 2AMVA 5AVKA 1NJ2A 2H52A 3TO5A 4X1OA 1XN4A 3FGZA 3JZIA 2HI0A 3LDHA 1X13A 2FXIA 3IUSA 3NM4A 3SBDA 4ZGNB 1ONOA 1HFKA 2X22A 3ANLA 3DH0A 2PWZA 1VL2A 4M83A 2XUJA 2Q0SA 4FINA 1H4VB 3K6RA 1PLJA 1W48A 3DOOA 3X3HA 4AXXA 4EOGA 3L7JA 1FUEA 4MWTA 3QWBA 1GGKA 2LCIA 1M2JA 4D8XA 1GSOA 1N9ZA 4LRQA 4MQMA 3RNLA 1PE0A 1XMXA 2Q99A 2ZIVB 2FSSA 4LC1A 4RM3A 4UHKA 3E1YE 4WRRA 3LTEA 5K0LA 1TLFA 5JAHA 3LC2O 2QZPA 2XYPA 3PQ4A 4K28A 4A0HA 4L6AA 4B74A 5DYNA 2ZJ3A 2P6RA 4RPLA 1QFXA 1I8DA 1JPVA 3RAPR 1Z2DA 2VC2B 3IDQA 2QMYA 4LI3X 1U2GC 2QHXA 3BTVA 3ZEAA 4L51A 3QLVA 4DILA 1I18A 5EKDA 4DNPA 5KWJA 5EE3A 3G9UA 3RHTA 4Q4LA 4DKJA 2XXAB 2FMXA 3PWZA 1NMQA 2JBAA 2BYTA 5FF9A 4R8KA 2FUKA 3NBFA 2F90A 1R16A 3BJZA 5F3WB 3NIDB 2E4XA 5DTIA 1IY0A 1UKBA 4Q9IA 1Q0PA 2LGJA 4GU5A 4R3UC 1X94A 1YOBA 3ENVA 3H6KA 3LMKA 2VT7A 4OPMA 1R8YA 3G85A 3CN9A 1RCUA 3BAZA 2HBYA 1OA1A 3QX9A 1AKVA 1X0VA 2V74B 5GM2A 3SSOA 3DT8A 2G5CA 1JMYA 3CCLB 1MJNA 4QC2A 4RS4A 2I0FA 1IG3A 2LCQA 4JYZA 4A36A 1DRVA 2BC9A 4OQQA 4EGFA 4KNVA 1PJAA 2EKQA 2WYWA 3QLEA 4KQHA 2GPBA 1DTWA 3R6GA 2PVCA 4NV1A 2RHRA 1ES9A 4IDNA 5IHPA 2VZLA 2HN9A 2VH2A 4H7KA 5BV2P 4JP3A 3TKLA 3L4BA 3V2UA 3X1KA 3QVGA 2NVWA 1WD7A 2V7EA 2BW0A 3CW9A 3RREA 3SOPA 4BNMA 4XVCA 1XP5A 1AVTA 2F8MA 4GL2A 1AQJA 2CVHA 3JSAA 3U26A 3QOFA 4I55F 4D6XA 3MJSA 3DBHB 3NM5A 3EAGA 4S1NA 4U5QA 1J8MF 4RK1A 5DBFA 3CONA 1OI7A 3LH5A 3RYFA 3ZI0A 4TSKA 3DE7X 3GUYA 4DM3A 3IVCA 3F3MA 2VT3A 3V80A 1D1QA 3I1FA 1N08A 4GI5A 2WWFA 1XAHA 2H11A 1TCUA 4JB0A 2FQWA 1MNQA 4PVDA 2O7SA 3BULA 1BW9A 1YHQB 1SUDA 4I1OA 5CIWA 1NUUA 5LNK1 3GIDA 4OHUA 4QUBA 1GFZA 2O0MA 3JWIA 4F56A 1B7GO 1ZMOA 4M98A 5FQOA 2PX4A 4RHUA 4B3XA 1MJHA 3IVMA 3C97A 1YZYA 3USCS 5BV8A 3BNWA 1TZCA 2Q7XA 5HQ3B 3Q8MA 1UPFA 4M9SA 1I7QB 4KBFA 1ZZEA 2IYPA 5T4EA 4A91A 4C05A 1JKJA 2MSWA 2Z30A 1RMQA 1CSEE 5ELMA 3RVMA 2MYTA 3KC2A 3TFWA 2GK6A 5FXMA 4POOA 4B3GA 5FWXB 3CB2A 1S2LA 4AWXA 4IOJA 3FA2A 1APBA 2R751 1CZUA 2X77A 2CW5A 2O3RA 4QU8A 2IIPA 1UDXA 4W9NC 1W49A 4X1KB 2AJTA 3WDKA 5IZCA 4M55A 4O08A 3TLJA 1NJFA 1KDYA 3GJ6A 1QGYA 4GECA 2FPOA 2UUBB 5DM0A 4HDRB 4I3FA 4G8DA 1NDUA 5JH7B 2FSVC 3QV2A 1DKUA 3FZNA 4L27A 4HYTA 4ZANA 2B8WA 2ZKIA 1B6RA 1L7RA 1W8IA 1Z83A 1PYDA 2YZGA 3GFBA 3LUBA 5AKJA 3T12A 4E1BA 1I8TA 3QE9Y 2FUNB 4DWWA 3SIWA 4DY6A 1NF8A 3RV4A 2OYNA 1E6WA 2EFYA 4UFOA 4RY2A 1KXZA 5G4KA 1NBME 4EL5A 3EZYA 5T41A 1NX6A 1XFOA 3FVTA 2EC5A 5CAEB 3G8YA 3R3JA 2C61A 5KSWB 4BJHB 1RXUA 5AESA 3QITA 4MYHA 4TTSA 2OAGA 2OAP1 2X3UA 4G1UC 4O4HF 1CHNA 3VH3A 2CN1A 5A1JA 3IIEA 3OCJA 1BMFD 3ZLTA 3B85A 1MAWA 3OT1B 4B3MB 5DLPA 1FMLA 3ZWPA 4F1JA 1GTG1 1MOSA 1BMFA 4YJ2F 5EHGA 4IXTA 3FYUB 4OPSA 2O8FA 2PWPA 4G84A 3ZBUA 3VDQA 3VR1A 4N3AA 5DXJA 2P30A 3R7SA 1FTQA 2PUBA 4QGGA 4YT5A 3JQ6A 4HLQB 5DJ5A 1IC6A 3FR7A 4OHMA 1XKQA 1LFDB 3BJRA 1UXIA 4PGFA 3THSA 4AY5A 4FGWA 2Y1LA 5DGCA 3AJAA 3GDFA 5FUQA 3KQNA 2CWDA 4AM8A 4IDBA 1U3CA 4TLEA 1WUJS 3CCEB 3EVZA 2OBMA 1U0NA 2DH6A 4CKBA 3SVTA 4FYWA 2VP4A 3COPA 3NBAA 1F1BA 3OZEA 5JYEA 3L4KA 3A35A 1D6MA 3B2QA 1E1MA 4E5DA 3T0GA 5LKAA 1D1PA 3PCRB 4U00A 4CPDA 1VKNA 3VPXA 1YBMA 4E1AA 3EJ6A 1N2CE 3LL4A 3NTQA 2H4YA 3UKJA 3WYFA 3LL7A 4EG4A 1L1RA 2F1RA 1NNUA 1I3OA 4Q1AA 4EI9A 2DFNA 3GZJA 4M88A 4Z6KA 3O8QA 1LTKA 3C14C 3T7TA 2UZ0A 1Z8FA 3WIVA 3OU2A 4E1VA 3FIJA 2NZUG 1U0JA 4P3YA 2PD3A 3UJAA 2X9VA 2JBAB 3T6KA 3DHVA 3QBTA 1AUOA 4E31A 1IATA 2ZUTA 5IDWA 5JSFA 4KQKA 1C8VB 5A5GA 3GZ4A 5EJ8A 5I9BA 3PXUA 3BCDA 4MCAA 5IVPA 1U9CA 4Q9DA 2WFLA 4XJSA 4X7CA 3NYIA 4V0ME 4XJTA 3FFAA 2I9KA 4NYMR 5FWNA 4IICA 5JD3A 5AJVB 3A4IA 1YJCA 3RDPA 3RU2A 2ZUSA 1N8KA 4F1KA 4RKYA 1T3TA 4G6IA 1ZH4A 3CF0A 4GMKA 4UM8B 1UEXC 3OIFA 4A26A 3VISA 4ZCIA 4OKIA 4B73A 1PQYA 4U2GA 4XNFA 2BFBA 3JQPA 3W6PA 1NDQA 3U48A 1V8BA 5GVSA 3VOTA 2JDIA 1DTWB 3H2YA 2AFHE 2DWPA 3PQ3A 3F49S 4DIFA 1DG1G 2MWMA 1HDXA 1SQ0A 3TGPA 2WTMA 4QGBA 1J49A 1GZ5A 3MT0A 3QVGB 3CC2B 1Z7EA 1FNSA 2D4HA 1P2VA 2Z09A 4V38A 1VG9B 4OQFA 1KK1A 1OXUA 1GO2A 4FEAA 5TJ9A 1MA3A 3D6TB 3UAVA 1YXMA 4RTOA 4D25A 2YXLA 4S12A 4EUEA 3AVUA 2FDCA 4J76A 2AV6A 3Q9UA 1U4OA 3Q1LA 4DE5A 4XRGA 4TT8A 5EUMA 3SVZA 4N9WA 1BPLA 2I80A 2YZKA 3ETNA 4RANA 3RYFB 1NBMD 2QTBA 5C52B 1KF0A 2Z2ZA 1KEVA 1KFKB 1D0VA 3ZJVA 2DQZA 4BZQA 2BSQA 4Y67A 5ICSA 3K20A 3DC7A 4OATA 4ZJYA 3H9NA 1KPHA 2D9RA 4P1VA 2XODA 1BW9B 1PSZA 1UWCA 2D1TA 1U8AA 4LJ7A 3BIWA 1SU6A 1F8FA 2V98A 4OG2A 5EZYA 2ZIZA 1NW8A 3CSSA 2Q6IA 4Q34A 2XECA 3G2PA 1QYIA 1EFCA 4DRXA 3UPTA 3RC3A 4OQPA 1XD9A 4ZQHA 1JKJB 4ROSA 3BHIA 4YJHA 3FROA 1CDOA 3ZV3A 1LEHA 1EA5A 4QDOA 3KR2A 1R4AA 5IS2A 4JZYA 1UXGA 4FJ2A 3WX0A 4C06A 5KHAA 4BEJA 4OLBA 4C9BA 4XDYA 3HVRA 3C3PA 2X42A 5DWVA 4BCBA 4CNBA 1K98A 4KRXA 4M7PA 1EFTA 3WKCA 1QGZA 2BJVA 1G8YA 2IH2A 3JVEA 3ZWYA 1W87A 1F9EA 1KBQA 4RABA 2V8BA 4DIDA 4XUDA 1DIHA 4KSYA 5LFAA 3DKPA 1MUUA 3KWFA 5E0OA 4M8LA 3EGWA 1I6MA 4I2VA 4XX0A 3RT7A 1IZYA 5I51A 4FNGA 4D9KA 1AXGA 1C9DB 3CW8X 2YN4A 1YJXA 5BT8A 1QIHA 5G4KB 3C6MA 2GXQA 1N2CA 2EEPA 4IGAA 5FD8A 5HIMA 1YT5A 1D2RA 1E7WA 1BZYA 2DPYA 2KQUA 4TMZA 1YC5A 2XGGA 1VXOA 2NO6A 2NTEA 3L82B 5JEEA 1G16A 1A2OA 4RD3A 1ESCA 4OGGA 1UC9A 1JJ7A 4NU8X 3ZWKA 1LY1A 3H04A 1HURA 5JJIA 1LPAB 2H8KA 3QKUA 3FUXA 4G9BA 4RTJA 3M5CA 1VJTA 1WP6A 2WZPP 5E6UA 4D98A 4UTRA 4ZJPA 2VBVA 1SCUB 3C6ZA 3KRTA 1LRJA 3HXLA 3KCQA 1Z4JA 2NQ2C 4V0MA 5IJWA 2O8FB 1DC6A 1ZR2A 3VYUB 4PYNA 3U1VA 1FFDA 4OL0A 1T2CA 2D1QA 2E85A 1J7JA 1NN3A 2ERYA 2QJTA 2ZROA 9LDTA 1GKLA 1SG6A 4C6HA 1KK3A 3RRJA 2YUTA 3BIOA 3U0VA 2Z6QA 1RSZA 1SEVA 2FVXA 5FLEX 5A9SA 1G6OA 4IVNA 1ZNQO 3I1IA 2C9BA 3KELA 3PUVA 1LC3A 1OZAA 3L7DA 5THQA 1E98A 2AFHA 2WAOA 4CHTA 3E3LA 1RJDA 1ZU5A 5KVVA 4L8VA 4CKBB 1OH5A 5HQJA 1OY1A 2VSXA 4U2CA 3MWDA 4UNSA 3RC2A 3B38A 3N74A 3GRFA 2V7VA 4PZZA 3ZHXA 4J9VA 5DI3A 3TL3A 4K6OA 2CUNA 5IDXA 4GXQA 3ZW8A 2DLNA 2QLMA 1XNJA 3HCBA 2IYVA 3DZKA 1OU0A 1KH2A 2J3DA 3KAPA 1JHOA 5A4JA 2IPOA 4DZZA 1CD5A 1FNCA 1LI5A 3L6RA 3RS7A 5JSYA 5A4MS 1G19A 3O8QB 4JBWA 4EHLA 3B3GA 2JIPA 3BE8A 4AKIA 3V7AA 1TU4A 2BMAA 1I33A 1N8NA 2ZSJA 3Q2KA 3H3JA 4ZPJA 3AFMA 3F98A 4GLLA 2HU7A 3RVBA 4IBOA 3T7EA 3ZHQA 3BXFA 3RTEA 3S8YA 4Y7DA 4LBWA 5KOYA 4TROA 2IEDA 2DAPA 2DHEA 3JAKA 4R1NA 5FO0A 3QEMA 7GPBA 4ZQFA 4RKQA 4BIIA 2WFLB 4HAOA 4BWGA 1DUVG 4Q15A 2IHBA 2XQKA 2LNDA 3FPBA 4RJTA 3HGQA 4QBTA 4YMGA 1T5BA 4DC9A 2NWQA 3NRBA 4L9RA 1R10A 1ML4A 1EVYA 3B53X 1D09A 2J30A 4MUEA 4QUHA 3M1LA 2BFBB 4HVLA 4TMXA 2VHUA 5BW8A 2Y1OA 2P2NA 3HR8A 4PCLA 1AB5A 2OO5A 4ZQGA 3MTJA 4AB1A 4C4OA 5JY1A 1KKLA 2Q21A 3MTQA 3H75A 4WCFC 1FS6A 1PQUA 3KVYA 1H3NA 2VHCA 3DLCA 2MHCA 1YZKA 2OBBA 3GUHA 1GNVA 4MVJE 2NV0A 2OCBA 3LW8A 1Z0UA 5TGTA 4BFXA 2JFZA 1KAQA 4TUYF 3PCTA 1LUAA 1ZRMA 2B9EA 2M1ZA 1UMCA 3W7VA 1DGQA 4LHYA 2HMYB 1X1BA 2JARA 5DYWA 3K8YA 4M0EA 3ZV6A 4MO2A 1PEDA 2NPIA 2X1VA 3QF4A 3FB4A 1DJPA 3QLTA 4M87A 1Z12A 1V5FA 2WU8A 3OA2A 4P81A 3VJLA 2HKIA 4D97A 5L6MB 4HAYA 4JI0B 1JR6A 4GKAA 4HFMA 4JP8A 4B75A 3EF3A 4FDTA 2ACVA 4I1SA 1KJQA 5GJCA 4U2FA 3RRFA 3G7SA 5HUJA 4Z3OA 3PNYA 2FG7C 4KOAA 3OPOA 3GCWA 4YRPA 1FB5A 2QRVA 5LBIA 3ROQA 4MZXA 1RPZA 2IOYA 3QFSA 3NNSA 4M86A 2VP5A 3JRXA 4NJMA 5D86A 1RKXA 3QBJA 3UWMA 2A5GA 5FR1A 3S28A 2J48A 3B13B 3ISJA 5I9SA 1T9HA 3GPIA 3PHJA 2P78A 2YASA 2IEZA 4PLCA 4XKJA 4ZQCB 1W2GA 2CGEA 5HF8A 3ZDEA 1VHDA 4K05A 4FNOA 3NTXA 4DRXB 3G9QA 4PQGA 5EE9A 2CLKB 1G2PA 2BRUA 2JAUA 3DAGA 3DE5X 4YJHB 4BVKA 2BDUA 3GJ0A 4H17A 1K06A 4UUQA 2ZPTX 4TM7A 1VYTA 4HRVA 3U7RA 3V00A 2F1LA 4PGHA 4L74A 1HDEA 5KQPA 2JLWA 2OOSA 1EMDA 4BTLA 1XCOA 4Q05A 1TVEA 3S1AA 3DWIA 3ONNA 4YQYA 4Z9AA 3BQMB 1L8LA 1JEAA 4A4DA 1MDBA 2EDAA 4INOA 2YKGA 4EYGA 3T95A 3EZGA 1MABA 1V3TA 3P97A 3W8FA 4P6VF 1RCTE 2R8ZA 4RZIA 3PE3A 1ZOPA 4XX0B 4OHWA 1ZQ1A 4BE4A 2XNKA 3BQNB 2D7CA 4RKRA 1XU9A 2D0OB 3E81A 4PEVA 3QVMA 3M70A 4LGYA 5CH5A 4X64B 4DT1A 3SBXA 5FX2A 3H6GA 1KY3A 2ZXIA 3TTVA 3VMFA 1N2CB 2FH5B 2OKCA 2R65A 2IITA 4IMRA 4OQLA 4Q1EA 3KFXA 5AI9A 4IZHA 3SF8A 3KTFA 2YJNA 5F76A 3RAJA 1PWHA 1AMOA 3DEIA 4M9XA 4V0QA 5COAA 3KZ1E 2FZKA 1PEYA 3PNKA 4F06A 1EP9A 1IZ8A 3GH3A 1DX6A 5HM8A 1GTSA 4NNJA 1FVHA 3IAS1 1JAZA 1C3XA 4MRAA 4P7FA 3T3EA 4KRFA 1YMVA 5E6UB 4CKWA 2IHUA 4DL9A 4JXZA 1L7NA 4AUNA 4Q03A 1EFAA 2OGUA 3H5IA 2Q2NA 3QU4A 1SXPA 1M5TA 3I5AA 4F72A 4K1LA 4LYEA 2CKMA 3QKSA 3Q72A 2VSFA 4R9VA 4LZPA 2QU7A 2IELA 2V3WA 3BMNA 2AJBA 3FYUC 1H6CA 2OVFA 3CR7A 4KPUB 4QDXA 3H65A 5A9SB 4FI3F 3VTKA 4JLPA 1WKCA 3KALA 2X1LA 2JASA 3RYTC 3U4QA 1P80A 3DE1X 3KE9A 4MVJD 2AFHB 5KOJA 3P2OA 2H1OA 1JHYA 1PJ4A 1OXKB 1D6JA 4L4XA 4Y2XA 2WHYA 5CVDA 4QQKA 2EG5A 4G26A 3MWDB 3M49A 4MVJA 3HP7A 1WHSA 5DI3B 3ZNQA 1RTTA 1E3JA 2WWHA 3A1VA 2O06A 3DLIA 5L3ZA 2IHVA 1QUFA 1ZGZA 3BOSA 3JQBA 1C14A 2JGKA 3BXHA 4WASA 2F4VB 1JP7A 1LPMA 4GZ6A 1AMUA 3LUKA 2WIDA 2V7BA 2D2FA 1DC8A 1CQPA 4G25A 4LY0A 1ONPA 4ARSA 4MB0A 2ZR0A 2NT3A 3DQQA 3FDIA 2PV0A 1CUWA 3EGIA 3OLQA 4IS2A 5FAXA 5BSFA 5AVRA 5KVAA 1UK7A 2WJIA 4QWMA 1TKBA 2QVBA 1HV8A 3RVRA 3CEMA 3GELA 1OAKA 2CVQA 2QTHA 1T1EA 3JAKB 1UP6A 3QEMB 1Z29A 2HA7A 1D2HA 2CNOA 4URYR 3MW8A 1VIYA 3HR4A 1Q0UA 3QJYA 4P2GA 3MQ2A 3UTDA 2C04A 4QPCA 2G25A 2X0DA 1NFQA 1RRPA 2JANA 2P68A 3QNWA 4ED9A 4LYHA 2ZKLA 5JQGF 1SQFA 2AI3A 1WXHA 1WETA 2I4LA 1T9BA 3IQZA 4KN5A 2OPBA 4H77A 4YONB 1QPZA 5KYUA 1ULAA 2QRNA 4E30A 1E2MA 1PR4A 2EX1A 2GDZA 2Y0DA 4R9NA 2OQIA 5G1OA 5T67A 1Q81D 4R2IA 3TZKA 2O0JA 1RHQA 3PD7A 1YTUA 1L1QA 3FVRA 1R37A 1XKXA 1VF7A 4X7BA 4RF5A 4ZZIA 1WOSA 1TFUA 4HQFA 5SYAA 4ZD6A 3ESDA 4JWKA 1N9GA 1CEXA 1UMCB 3OJLA 1LSOA 3RWBA 1ZJ6A 3TFOA 2ISQA 2NU8A 3E9EA 1BEEA 2QRLA 4NDAA 5DPMA 3QF4B 1TLTA 1VFPA 3NLLA 5B5SA 4X7RA 3UM9A 4QL3A 2AYZA 1ANKA 1ZGJA 2JFUA 3A3KA 3EIQA 4CIVA 4UC0A 5DISB 4XFDA 1S8AA 3OE5A 5A89A 5TE9A 3WKAA 4BN0A 1RABA 3PT5A 4BECA 3DVQX 2QRVB 4XGQA 3K35A 4RAQA 3S3TA 4NJMB 1Z33A 2VEOA 4X41A 4BO9A 1Z18A 5JARA 4U7FA 3U3KA 5HDQA 4JVNA 1A0OA 1L3IA 1HQDA 4BLSA 3IBCA 4EKDA 2QRKA 3T5AA 1QC5A 4S1TA 4I14A 3PDUA 4OGLA 2YQ4A 4RVSA 5C7LO 2X53S 2FUG6 3HZHA 1EB9A 3O1LA 4LNHA 4BNHA 1YL6A 2N3ZA 4MVJH 4UCXA 2WJZB 1K89A 4BLRA 1G2OA 2J46A 1SHUX 2QR5A 2WP8J 2PA3A 2Y2VA 3OSUA 5BW5A 4R1PA 4I46A 1A2KC 4QJBA 2QAGC 1FQJA 3IO3A 3LX5A 3PX2A 4R0VA 4UNPA 5GONA 1AN0A 3ZGLA 2ZWOA 1M6WA 3S55A 2A0FA 2P3SA 1I6LA 4RDHA 1JU9A 4B6OA 3HWSA 4BY9E 2YFKA 4M21A 3GSIA 4NE7A 3GEPA 3HV2A 3S1AB 1VMIA 1XK6A 4NBLA 3EPJA 1FC0A 1DHRA 1W4LA 1P6QA 1PFWA 2LW7A 1YJ9B 4F91B 5AHWA 3NWJA 3WFJA 5B57C 1MABB 1VPTA 2I2BA 2EKZA 4DIUA 4BJ5A 1E43A 2B7CA 1OVGA 4M6WA 1RAFA 1C3JA 3ENQA 3IIJA 1M1UA 3MTIA 3KPWA 3DXYA 3EVDA 3FUCA 3P20A 4FE3A 2NUTA 4XR6A 3S2UA 1DI0A 3JQGA 3GFFA 4RS3A 3UWSA 4DT1B 3WQZA 1S89A 3COZA 2VUHB 1GGMA 3LFUA 4LHEA 2H4JA 3S0JA 1T4CA 4C89A 4MI1A 2NNLD 3RRMA 1I2MA 3CF4A 4KXYA 1SKBA 1O87A 2PS0A 1BHSA 3LT4A 3NBXX 4FDMA 1P3JA 3SF8B 2QUAA 3AG6A 3PNSA 4QBFA 3RRZA 1MAVA 3SMQA 3FPAA 4F84A 4TKUA 1MAHA 3MUOA 2BHLA 4L4UA 3GL9A 2D7DA 2VJMA 1CF4A 2IOHA 4Q6WA 2JI9A 5HRCA 2XNCA 1E3TA 3CT4A 4A2WA 4DV1B 3F3SA 2Q2QA 2FX2A 2Z2JA 1G5RA 1JI0A 3QK7A 2CCGA 3IIKA 4CKWB 1PV1A 1CT9A 1DKRA 1FSFA 1OW3B 2JHCA 3KQHA 5TT0A 3S1LA 1O96B 3DL2A 5CPBA 5IF9A 1Q5PA 1DJNA 5L4SA 3GLIE 4UUAA 3QKSB 4EK9A 2A9PA 3MWFA 1RJ9A 5AJWA 1F4VA 3BMNB 1ZD2P 2BBWA 4ER0A 3OKCA 1KJ8A 2XCIA 1FCJA 1S1MA 3QE3A 4G0WA 3EVGA 3IEUA 1MO5A 3RY8A 4EBBA 1J70A 3H86A 4I8DA 2A9OA 4KQ9A 4L72A 3U4QB 1BX1A 1WLSA 3OMLA 3C39A 3DOJA 4OPVA 1KZ6A 4I0WB 3KUDA 5KOJB 2P4SA 3O8BA 1Q0SA 5CFMA 5A3VA 4C6TA 4NL4H 3HXPA 3TB4A 4X44A 1AGPA 4XYEA 1YONA 3AKEA 5DN9A 1WHSB 1LDYA 2UZ3A 2YICA 1EFRD 1R6VA 4R6XA 4DPLA 2XOXA 3WRWA 1A2BA 4OPOA 4US1R 1C8BA 4E51A 1CLUA 1Y6ZA 3NOXA 4EQZA 4GQAA 2G83A 1EFRA 1T5IA 4BNIA 4MV3A 2QF7A 5EMLA 2OAEA 4B2IA 1NV9A 1JT9A 4P0PB 4MTLA 4NNOA 2EFEB 3EFHA 2ATIA 1P74A 2PX2A 1D8TA 2PRIA 3Q7SA 2EQBA 4PC7A 4NE2A 2GYYA 3EXHA 3DKKA 1P1RA 2ZAIA 5FNVA 4ZU6X 1ZWKA 4F38A 2PUAA 4PG8A 1DAEA 2AMFA 2RB5A 5HHTA 4NV0A 5KTTA 3X1MA 2ZSHA 1ZLXA 3D0RA 4YP6A 1OXXK 2HRZA 5I7WA 1I2BA 4OXIA 2VH5R 5JS1A 2GEJA 4L4SA 1XSEA 4OHFA 3ZJ5A 2R1VA 3EXG2 4MS3A 1HG1A 4IGIA 1O03A 4F1WA 3EIOA 3KXIA 3B78A 1L5NA 2ZCJA 4OXXA 4O8CA 3AF2A 4NBSA 3QU2A 3KJIA 5KYUB 3CX4A 4WEQA 1IY2A 4UVEA 4UOQA 4V1CA 1U63A 2YCLA 3QWIA 1TW2A 1TEZA 1EFHA 1QO0D 4GOXA 3TD6A 1P60A 4QU5A 5FUXA 2JLAA 1V71A 2FQXA 3W8EA 1D2GA 3SSMA 3AHCA 1TYDE 1JHQA 1QO0A 2OXEA 1EAYA 1G8JA 2XNDD 1N9GB 3IALA 4LSGA 4J07A 2FLWA 2DY0A 3ETEA 3P4YA 3FAZA 4V39A 4Y0AA 2NU8B 4ARZA 1GCUA 5FBRB 4Y9UA 2XNDA 1G7TA 4OQMA 1T8PA 3ANTA 3BEDA 4K3UA 4JK3A 5DU2A 3UUEA 2PMDA 1VLHA 3DEYX 1UQTA 3NNDA 1E62A 1YJQA 3WKBA 3ZEIA 4ZK2A 2B37A 4GLJA 1KZGB 5CP8A 1U1EA 3W5AA 2ODPA 3LXXA 1VKHA 3NEPX 4ZOQI 3DFKA 3HVHA 5C4IA 4CR7A 4LYGA 5K0NA 3A2KA 1YDEA 1GAWA 1GQYA 4MWGA 4B5KA 5LMUB 5IFKA 4KZKA 3U7EB 1QC5B 3OX1A 2QGNA 4LY6A 5FV4A 4LGMA 4DIBA 3NXSA 2RCNA 3GJ5A 4BVHA 2OD9A 1B6SA 2WJAA 3ZHUA 4PN3A 5TQVA 1CXZA 4QOEA 4C0LA 3IT2A 3WBKA 1LB1B 3T3PB 3HG7A 4P54A 3F2VA 5GONB 4F4UA 4QEDA 1D2MA 3GLIA 2BCJQ 6PFKA 4Q02A 2W93A 2DH5A 2L0XA 5BOVA 4F5WA 5KYNA 1TI7A 1LPBB 2Q3MA 3QWHA 1THZA 3H7AA 4RK7A 5AW6A 4JI7B 5AQEA 1G4HA 4L5BA 1EP1B 4RTQA 1O5TA 4Q7JB 1L5YA 2OZLA 5H70A 2EG9A 2RGNA 3DC2A 3KFLA 2R86A 1XG5A 2WTAA 3QXSA 4RDIA 3DMFA 3UEOA 1PSDA 2ZRLA 1ISPA 2F59A 4M6WB 1ZJZA 2JB9A 2Z3VA 1JAHA 4QU0A 3E7PA 4UU0A 5DX0A 3JQGB 4LJSA 2ACWA 1E5DA 2VJQA 2POCA 1DTEA 1T4CB 3FG9A 2WV7A 2GCPA 2NYAA 3OCXA 3RFFA 2X8LA 2YHSA 5E7QA 1F4LA 3O03A 3K09A 2WWYA 4LOKA 2VDVE 3B5IA 4LXQA 5G41A 4IDQA 5C80A 1WXQA 4MUHA 3D26A 1FDSA 1LK7A 1Z5GA 2VJMB 1Q50A 2ALJA 2OTCA 4HGQA 4LV8B 3BL6A 3HPQA 2WYOA 4TTIA 4UEKA 2H5LA 5IAGA 5JG7A 3N8GA 2EWVA 4BFTA 4BFZA 5BR4A 4BGDA 4CRWB 1SVIA 1TQ6A 1I5RA 1VYUA 1Z4QA 1NAHA 1E7YA 2EFCB 3QU9A 3FWZA 2W58A 2R62A 3ZXSA 4JVOA 1OBCA 3N0XA 2DIEA 3ZU5A 3SYLA 1WMDA 2CNLA 2OUKA 2VQ6A 1I4LD 2ORYA 3IHLA 4AVYA 1EVIA 1OIXA 3CR8A 5DTRA 1RJ9B 2JCBA 4L22A 4URUR 2BH2A 3BQ9A 4OQNA 3FPKA 3X2FA 4L5AA 2WU3A 3I6QA 3WQHA 3DHYA 3HYNA 4HX9A 3SHFA 1ADCA 2V4UA 4HGNA 3JPYA 3TIXB 2VBTA 3IKMB 4PCUA 3RSQA 1C9JA 3KKKA 5BP7A 1JQJC 2YL2A 2Z08A 2ZIUB 1GLNA 1QONA 4FR0A 4JT2A 4I5IA 4WCVA 1IOZA 5DEOA 3SR4A 2ZWVA 1ZITA 1F51E 2CL5A 5IC5A 3R5JA 3ROGA 1SXIA 4LJ4A 5D87A 2A0XA 4C6TB 2WTUA 3NPMA 1PQWA 2QLFA 1NW9B 3NAQA 3TPFA 4ZXPA 1IIRA 3D5EA 4MQFA 1YK1A 4BUCA 1AZSC 3ZG6A 1RVV1 2WY2D 4TQAA 1SZCA 1THGA 4JXKA 4RYLA 1V9CA 5E9QA 2BBSA 1RQGA 3LUJA 3R3SA 1HE8B 5HCUA 3W5CA 4HN2A 3WA6A 2VRWA 2P2DA 3CZMA 1CKEA 4PCVA 4PBRA 4PRKA 4ZCQA 2B99A 2EJVA 3ABOB 1X1AA 2FN9A 2ZTSA 1TJPB 4UTXA 1O95D 1AGYA 1WB5A 1YJAA 3EXHB 5FNVB 1OB5A 2V0NA 3GZTB 3MT8A 1KOLA 3ZHYA 4YUXA 1E4EA 4WKBA 4GL4A 3HH8A 1QE0A 5KJFA 2VT6A 1GN9A 1O95A 3BXEA 3JR7A 4MX8A 3R7FA 3PQ7A 2YZ7A 2D00A 4FLFA 3W3ZB 2R1VB 1EKXA 1Z8NA 1DFGA 4MS3B 1NI3A 3ZXXA 4C7MA 1XZBA 2I76A 4N6NA 1E20A 2GN2A 5IM5A 5AVJA 4P9SA 1FXWF 4E5YA 3M33A 2NZ2A 2XTZA 3NNNA 3DYBA 3YASA 5HNKA 5CBKA 4V1CB 2E37A 4JNKA 4RZSA 4EHFA 2WSBA 2OK8A 3EA5A 5L8VA 2DTEA 3IDFA 3N07A 3V9AA 3CX3A 4P36A 1AJEA 1QCYA 4QM7A 4UEWA 3ZWQA 2IGBA 5FTKA 3TIVA 1BO6A 2HA6A 2E1RA 1K7YA 3DZBA 4P4GA 5T3UA 3CH6A 1R5BA 4ARZB 2J3EA 2M6SA 4IVRA 4D3YA 1AQUA 5TGDA 3KX2A 3O2SB 4YLGA 1SKMA 1Y7PA 3LQEA 2YWCA 3K9HA 3ODPA 4DA4A 2XZLA 1PO7A 4QVKA 3I61A 2EWMA 2JD1A 3CZAA 4QSMA 3BE5A 1FQKA 4HWRA 3MN1A 3HWWA 1QAMA 2NV4A 1CP2A 1F14A 2HDWA 3WE7A 5TVGA 2XNJA 3AG5A 1UDRA 4JT8A 4W99A 3VNSA 3A37A 3MPOA 2ZZNA 4ZI7F 4UBLA 1NW6A 1W46A 3FBTA 3IP9A 2RK4A 3MJFA 1V5VA 2X6QA 3CIFA 3UKDA 2PLWA 3AETA 1XI2A 4EKIA 2FQ1A 1BMTA 4G5HA 2VYFA 4B79A 1XA0A 2GJ8A 1NBWB 2XMCA 3A1CA 2PWBA 4X1KA 2QDKA 1DC3A 5DULA 4KQCA 1B76A 2VOEA 4UUMA 1G7CA 3W5HA 2BEKA 3TNDA 1LPSA 1EFPB 2RBEA 2DUMA 4CT4B 2FW1A 4BMCA 5CFPA 5SY4A 1P9OA 2E4VA 1P7PA 4YXFA 2PGXA 2QMEA 2PPLA 4MQ5A 3GLIB 1FU8A 4XLAA 1KQ3A 1RPJA 2HXSA 1EBFA 3DR3A 5G40A 1N5DA 4CM6A 2CDCA 4OXNA 1H3FA 4XUGB 2PH7A 1GEGA 3WGQA 2B4RO 1POWA 2FEMA 4D8YA 2ZYDA 1KZ9A 1RAAA 1ESNA 2OZLB 2WINI 3S5UA 3O3CA 2XA2A 5ED4A 1AOXA 1VL0A 3Q4GA 5A9TA 4W6ZA 4BN4A 2GAOA 1WVMA 3G6WA 4E09A 4TT3D 3NIGB 1NT2A 3W4IA 2FPGA 4B76A 2P67A 1W1IA 5HPYB 3VKGA 4QXOA 5IC6A 2NZVG 3F6YA 1YWGO 4LX8A 2XUFA 3LC1O 2F2TA 2D2XA 3OCZA 4QBKA 1E2HA 3OPVA 2VKTA 3MWJA 8OHMA 4C0WA 1U2EA 3SFTA 3TOSA 1Q7EA 3FOAA 5TQJA 4YPFA 4FXUA 5ITWA 1KH3A 4LVOA 1Q3TA 1ZSNA 2VZEA 3HJUA 3OKAA 3ZK9A 4GRDA 1EDDA 2HADA 2XTAA 1M8GA 1VFNA 4LK3A 5EKSA 4EJSB 5F2NA 5JC1A 2EP5A 4Q66C 4PY2A 5T3YA 1DX4A 4YK7A 4XKWA 1OT5A 3WWPA 5IBRA 5BYKA 5JNWA 3LVFO 1Z25A 4G65A 3LRXA 1KO5A 1XTIA 3U4GA 3PENA 3MERA 1BLIA 4O2AF 4JJZA 4H18A 4PVCA 5IXJA 3BJMA 4JWTA 4ZZ1A 2PK3A 5FI5A 3SJUA 2I67A 1D9XA 3PF8A 4GX1A 1YUBA 3ID6C 4XVHA 3WLAA 1YLOA 4RY9A 1B15A 4L5YA 4UPDA 4V2UA 2P8JA 4RDLA 5KTRA 1DLJA 1WSBA 4NFLA 2OK7A 1U8EA 1Y9JA 3FOZA 1R88A 2GO7A 4IUYA 1MFPA 2JIDA 2GK3A 3V32A 4MV8A 1B6TA 3JATA 1WD5A 1QHSA 1LF5A 1XZNA 1RMTA 2XJ4A 1MHPA 4K2AA 1UT5A 5I7UA 2W6PA 3WYNA 4DGQA 2VHEA 1Y3DE 2ZULA 3MELA 3GJ8A 4QHTA 3KQUA 5F33A 4FXOA 1A98A 4B85A 3H9EO 4MQFB 1IEVA 4MJLA 4OO3A 5CUQA 2K6GA 4XASA 1GRNA 5FAKA 5DSZA 1UPUA 1WUYA 3SYMA 4L3WA 4EKGA 1AB6A 1MRSA 2IYSA 1TCVA 4N9QA 2ZSKA 1AA6A 1Y0YA 4HB3A 4Q7KA 1W36B 3WLQA 2FEPA 3IBGA 3PK0A 5KVQA 3ZS9A 1H4SA 4G4GA 3NDIA 2BFCA 2B61A 2ZVQX 3Q88A 1S96A 4JBIA 4QUDA 1OQAA 2R2AA 3PQ8A 4D79A 3H9QA 1HNXB 3M3HA 4KGZA 2ZR9A 1QYCA 3AUSA 2GKOA 4LRTB 4ZHQF 1E4EB 2GVNA 3FNHA 5FOSA 5JAOA 4KB5A 5HILA 1T6BY 4EMBA 4KAAA 1F2DA 3AY0A 2J9XB 3DMGA 3IDOA 3EEYA 4AJJA 1DMSA 4U02A 5EIAA 1AIPA 4O4LA 4U7GA 4MUJA 1QVZA 3LHKA 1J20A 1RQNA 2QT0A 3AXSA 3BWBA 4G1FA 3CLUD 2DOGA 2JLQA 2AC4A 5LD2C 3CZCA 3L6BA 1Y3CE 2G04A 3ZE9A 3SD7A 2XA9A 1YR9A 4FI3C 1RXSA 1P9LA 3TINA 4M99A 2X5KO 5GP1A 3ROXA 3LBAA 3KVRA 4C01A 4WFIA 4WZEA 4ZDIA 1ONSA 5ER9A 1J24A 2JNWA 5G1NA 1BAPA 3VH2A 2XUZA 4CUJA 1E66A 1HE1C 1TA4A 5CT5A 3VV3A 3GWZA 3R3WA 1T26A 3L8YA 2BISA 5C7YA 1UIMA 4ZCRA 2EF0A 2VF5X 5JALA 3GVLA 5DSTA 4YASA 4RVDA 4FDLA 1TD1A 3KJGA 2OFPA 3L7AA 3NTRA 3W4JA 4YV1A 2A88A 2O2IA 4G63A 3DOIA 2IY7A 2HUNA 1DTSA 3WGIA 3IJ5A 3T1VA 4NCNA 3R0ZA 1GTZA 2I3AA 3BAFA 4G4SP 3ZPNA 4FN5A 4UHDA 2G80A 5JJCA 3NTVA 4HYEA 1BRTA 2J0SA 1MJGA 4U7TB 1FZTA 1K4MA 4DAEA 2AXNA 2H16A 1KZLA 1XZDA 3JQCA 3NI2A 3WKEA 1TU0A 3G0CA 1U7OA 1V2HE 3QYAA 2YTZA 5AN9A 1CR2A 1KEUA 1QRAA 2QW0X 3CRRA 3HKDA 2Q3LA 4FDAA 4OHVA 3X2SA 1K92A 1U3VA 3G0GA 4TWBA 4G0QA 2VSNA 3OI7A 3LQ4A 1ZBQA 3RROA 1L7PA 3AETB 3WHLA 3FHJA 2AWNA 3AXTA 2I2CA 3KLPX 3NEYA 4LDJA 2ZTGA 1KQPA 3KOOA 1M1KD 3FTNA 3TCKA 3D7RA 3QKTA 3UV6A 2C95A 5CVTA 1OU4A 4IINA 3ICQB 1SUCA 5KUTA 4G09A 3WWEA 4KL8S 1YMQA 2OD2A 2F1MA 2V6IA 4PYKA 1H2AS 4EO9A 2GASA 1YULA 1ZW6A 2BE9A 3NDBB 1Z2AA 4YMUA 2NP7A 4G0VA 5FV7A 1N5KA 1YHNA 3TBHA 1TMYA 4PHHA 16PKA 3FPJA 1CUUA 5FADA 1Z3CA 4IIBA 3S99A 1CZRA 3TMYA 1V0EA 1XJ5A 1GNTA 1TPYA 2OCPA 2WWVD 4P80A 4AP5A 3T3DA 1AHPA 2O48X 5JH7F 4OI2A 1S2OA 3WIEA 4DYHA 3DZCA 3LLVA 3IMEA 1HGXA 3HABA 1BQ4A 2FPGB 1S9HA 4P84A 4AZ0A 4MS4A 1W9HA 2ZTMA 4E33A 4M0CA 4Q1DA 1T8WA 1G38A 1QCZA 3R9IA 3VZRA 4WKCA 3NVMB 3QPUA 4OM7A 4ZGGA 2ZG6A 3MT9A 4QDKA 4ZAGA 5BMOA 1FA9A 3I32A 1V8ZA 1UPAA 2HNBA 2RAFA 1G17A 1E8DA 1YA4A 1DDOA 3A6FA 4O1HA 5GVRA 4C0XA 1W73A 3N2YA 5ALNA 4LUCA 4FFLA 3SAJA 2WKSA 2GX6A 5FBWB 2BFFB 1YQGA 5KYVA 3AWIA 4KAFA 3KXKA 3I9V6 4C29A 1ST2A 4YIKA 1MZPA 1U6JA 3AILA 4UPEA 3WAGA 4CZ2A 1A82A 2BFMA 2JJYA 3N8DA 1R6UA 1K5HA 1H1TA 3R3XA 1RVDA 2H1HA 1XZKA 4KQGA 2BZGA 2REQA 4JJKA 4PHGA 3C7DB 1BJTA 3ZKWB 4ZCMA 1SC4A 2XUQA 3O4IA 2C5BA 2NX2A 1TIKA 1EYZA 3V2IA 2PUHA 3OHMA 3AGPA 4L28A 3Q1KA 2EGUA 1QHGA 2VPZA 1FBNA 3TTSA 2APJA 4QDJA 2IS4A 3E5RA 1RFGE 4ZVMA 5HKLA 5E1DA 4W5NA 1PGQA 4YAOA 2KI5A 2WRZA 4E46A 3JATB 3MPUA 4AJHA 4HPWA 1ZRSA 4KAJA 1NURA 3HJCA 3FPPA 5H59A 2B2XA 2CNKA 4GKVA 4HPXB 3ROMA 3W8DA 3WGVA 3IA2A 5ADUS 1T0BA 5JJKA 3F5SA 2YJ5A 3I9MA 1KNXA 2XMDA 3FWKA 5E9JA 3BB4A 4XLTA 3LUFA 1WB4A 4OJQA 3W2FA 4B6PA 3F2IA 1V48A 2BLLA 4KTTE 2P5SA 3RO7A 1DE0A 1SVSA 4FHZA 1FBTA 4QLBA 4D0GA 2RC6A 2JGRA 4H59A 2DR2A 1X39A 2CXOA 2QM7A 1C0KA 4AL4A 1ZCBA 1YZUA 2H07A 2PS9A 2BFCB 5BSYA 1WMFA 4DLXA 3SJAA 4NXMB 4K46A 2VYND 3QVJA 4PO9A 3W3AD 4DA0A 3DL4A 2Q9BA 3HGTA 1EG2A 4MROA 3T61A 1M0WA 3KE8A 4OGFA 2VYNA 5J4KA 1NF3A 3R6LA 2RFLA 1ATIA 4FEGA 3W3AA 3C16C 4M0MA 4O4LB 1VMKA 3ASYA 1EQ2A 1I1HA 1NU8A 2Q5EA 3IP8A 3K53A 3K0KA 3L43A 3ND8A 1RP7A 2PT5A 1NJ8A 1EGMB 3EZLA 4I5DA 4Q9LA 3RHFA 3EJWA 1O89A 1ECLA 4UE3S 3SQMA 5AXAA 1KJ9A 4X7PA 2R8EA 1RC1A 4GGMX 2QMZA 1QO7A 4GPIB 3COWA 4ZI5A 1K7SN 3EMDA 4DDVA 4BFUA 1RBZA 5BO5A 3QWAA 4X97A 4Q47A 5I9IA 3E9NA 1AS3A 1R0SA 2AMYA 5B36A 3E03A 1KD1D 5HIAA 5TNXA 1RM4A 3FI9A 3PXBA 5EP2A 1J5EB 4FDUA 4MAMA 3PG5A 3O95A 4YN3A 3S8EA 4DR6B 2HK6A 3I73A 1NVKA 1GZ7A 1CNMA 1Q15A 4HAWA 1VDZA 2Q1XA 1XRMA 2CFOA 2P6MA 4M76B 4N7BA 4NZZA 1THTA 2D13A 2X23A 3AP1A 3BBLA 3I23A 4UBMA 2EZTA 1NU6A 2C2GA 5E2BA 1W36D 2OILA 4AG3A 4UZSA 2HA5A 2RGUA 4FHCA 5AHXA 3QH4A 2HA2A 5TC4A 4W7HA 3BH0A 4HXEB 4K26A 4ZFNA 4MNTA 6NULA 5CFQA 1WTHD 4XIJA 5EG5A 1TM7E 1GUFA 3RG8A 2VDJA 3GJ7A 3HSSA 3R8CA 2FZCA 4AWBA 4HKTA 2VDWA 3DUFA 3H5RA 5G0VA 3HKDB 1K5PA 4US0R 3ZGYA 1KRHA 2BAGA 3V7WA 9LDBA 2CDAA 3RQIA 3T9AA 5BNFA 2CDBA 1O97D 3IIIA 5JZOA 1BFDA 1PYGA 1KYTA 2O5RA 2WKPA 2OGSA 2OM2A 1QQ6A 2NU7A 3I42A 2HSGA 3T9FA 3P9ZA 3PGXA 4XWAA 4J16C 1TQ4A 5HEKA 1PDOA 4JZKA 2XITA 4Y2RA 2VXOA 4HLUC 4R68A 2H2HA 3CTAA 2G6BA 3LAWA 2OBXA 4IO1A 3DO5A 1NN0A 4UM7A 1K6IA 1VM6A 4AURA 4FBLA 1POXA 4FC6A 4WOBA 2I5PO 4XRRA 1TK9A 2XIJA 2RHTA 3FY4A 5EA2A 3C3KA 3KEOA 2ZYRA 2JK0A 2PAAA 3B82A 1IMOA 3O2NA 4TTRA 2EKPA 4B1FA 1OYOA 4ZYZA 4D8WA 1DKOA 1KI9A 3TF5A 4ZOCA 1IK4A 1HI9A 2ADOA 2DUWA 5J9FA 1NC3A 4AP9A 4UMEA 5HIJA 4MS4B 1W29A 4AZ0B 1T2FA 4B4OA 4JMQA 2EP8A 4NMMA 4H9GA 5LP6C 2RGNC 2FZWA 2RI0A 1U6KA 3SNKA 3W3AH 5L3RA 3VO2A 1A9QA 3QVOA 1PHPA 3L07A 2PANA 2IYWA 4UASA 2XRFA 1A4IA 4N8SA 3JZDA 4TV8F 4MR7A 4JJFA 4R2JA 2NG1A 4I1YA 3C5WP 3GJQA 2DP4E 2A67A 3V1MA 1P2TA 4C76A 3QQ5A 5LA6B 1SBTA 2VHTA 2QLJA 4BS9A 3BT7A 3I39X 4CMEA 4AMYA 4TVOA 2WLSA 2O59A 2PUFA 1KAHA 3I4CA 3FOBA 3PFWO 4AJEA 5TB5A 1RD4A 4E11A 4YJ3F 1E92A 5C1BA 3MT7A 4QG3A 4X61A 2FPUA 3EOAI 3JQ9A 3EQ9A 2AG8A 4JVLA 3HJGA 4JLSA 4ZAZA 3VU8A 2REQB 3P9IA 4BP8A 4ERNA 5DYIA 1MJFA 5CT4A 2XIQA 4GMFA 1YRBA 5EJ6A 4M2LA 5J1TB 3UVEA 2Y0EA 3SBOA 3CT6A 4MVJP 2GNAA 4ONEA 4OHYA 2FU5C 3SHQA 3DE3X 4C88A 1XHLA 2SECE 2ZDGA 3FPEA 3IHKA 1A77A 1KETA 4UUNA 3RANA 3VR5D 3L7IA 4XWGA 2R44A 1LJ8A 2YUIA 4LXUA 1Y7IA 2B8EA 3BJIC 1VL5A 1M1YE 1YZHA 3KYJB 3KPYA 3O8LA 4RPJA 2X8JB 4ER3A 3VR5A 4CIBA 3O3NB 1AF7A 2IA5A 2ZTVA 3HYCA 3PRKE 5P21A 2PKQP 3EVEA 3D2BA 1XVTA 3EB9A 2PUEA 3M6MD 4GOOD 4MW6A 1O0BA 4TWZA 3V8RA 3IT0A 4AY4A 3QVSA 3RRBA 4BMYA 4BNKA 4EKYA 4YRIA 3DZGA 1QFMA 1KC1A 1AO3A 1KBZA 1UFRA 1YRHA 4XQEA 4LJKA 2O0HA 4M9QA 3ZX4A 1MB9A 2GILA 4BPRA 3K3PA 3U40A 4P82A 5LIPA 3PUMA 1S2NA 5AVUA 3ROPA 1I30A 1NVWQ 2C42A 3CWZA 4KCGA 4NDNE 5F7OA 4F3CA 3HJTA 1E2EA 2AZTA 2J4FA 3DDSA 3M5DA 3MD9A 4UW9A 5EKTA 1CUAA 1DFIA 3K70C 5A7HA 1UXOA 4G23A 4RZ3A 1ZGBA 4D9NA 3VFDA 4C5CA 3DT6A 3WY9A 2ZYAA 3BH7A 1AKMA 1TECE 1WU7A 2B8JA 3DAHA 1FYVA 3WGUA 4KDCA 1Z5NA 3AR3A 4R01A 2HJSA 1QR6A 3U56A 4EW1A 3C3WA 1VHEA 1UT8A 2H4HA 3DP7A 5T8KA 4CKCA 1TC1A 4DJDC 3MJHA 621PA 4ZZ0A 1X87A 2YW9A 1DQYA 2ZPUA 3P9NA 2WQZA 1AKEA 2CYCA 3QUQA 4GGPA 3TZ6A 2AOVA 2DF8A 1KK0A 2JGDA 4RFSA 4C14A 3H42B 3IMGA 4Y9RA 4KVZA 1E3EA 1REQA 2V54A 4UKDA 3L4SO 5EINA 5B2ZA 5K0SA 3MMZA 3LY5A 5JNRA 3LC7O 1WHTA 4WK0B 4D0RA 3L06A 3CNLA 4DSUA 5EP1A 5DBEX 3RJMA 1TQHA 2YWGA 4DAOA 5DIZA 4V03A 1MGOA 4KMMA 1M6VA 3U49A 1S6YA 3SDBA 3KJEA 2PNJA 3VU3A 5K2MA 3AF0A 5D84A 3LP5A 5ITVA 3E4DA 2P3QA 3QNUA 2GM3A 1GARA 3IJPA 4NBVA 4AZSA 1LQTA 1LRKA 2B5VA 3NJ4A 1YITB 1SQGA 1ENOA 4N6OA 4PZAA 3T1YB 4BMVA 1IHDA 2QNIA 3QMWA 3V7UA 1OLXA 1TM4E 2YWEA 1QJ4A 1M75A 3K9LA 3MM4A 4JLJA 1AHHA 1IHXA 1CRZA 2VIIA 4X8MA 1BCSA 5CA1F 2IVFA 3ABQB 3QFHA 2VDWB 3DUFB 5F4MA 1MTZA 3GMSA 4O6VA 1JYSA 1JIVA 1T91A 2X13A 4Q82A 3C5CA 3VR6D 1G3RA 4HEQA 4WEOA 4YWJA 1T8TA 3WK8A 4JLMA 4EY5A 3PBKA 3D3QA 3NM6B 1L7OA 3BX1A 3VR6A 4TYQA 3X1WA 5AW0A 3PEFA 1XZEA 3TQTA 4AYXA 1MX9A 3HB7A 3DAYA 4HADA 2IOQA 3VR5H 1T36A 2RHBA 3OA0A 2PZFA 1NW5A 3B6IA 5AW3A 2PBZA 3A06A 1RQPA 1MP0A 3P0IA 4DR3B 2VDRB 4LOHA 5BORA 1M0TA 4JOCA 3NHBA 4TL6A 4MTCA 5C7OO 5IHXA 2HLNA 2WC1A 1ZA1A 2XCTB 1Z88A 3IBFA 1KDTA 1LPPA 3GVCA 5HIIA 1O4VA 3PEVA 1SKQA 1H93A 1Z0IA 1EJ0A 1XEXA 2X2PA 3FCEA 4BC0A 1A3CA 1PWYE 1T9GS 2XYVA 2BCEA 3PPXA 3OLZA 4GO1A 2JCGA 4HY3A 4TXNA 5JLJA 2V31A 3R24A 4KPFC 4QNMA 3FHCB 2BIFA 3CX8A 3TNJA 4XOIA 3ZWMA 1T35A 1M1YA 1WL8A 2DQKA 2XI4A 1CEQA 1T25A 3EY9A 4IDFA 4MUKA 2DMRA 4KZPA 3LVBA 1G98A 1S4QA 4O4JA 1JV2B 3KTDA 4MCJA 4E12A 1LX7A 2VP0A 5M2QA 1N2SA 3HEMA 2QRJA 3UB2A 2VTKA 3AQIA 3QIAA 1BYIA 3UXEA 2VJNA 3TQFA 1D5WA 5JO9A 4FILA 3OAAD 5C1DA 5I7VA 2WUEA 2FPLA 2J5KA 3B52X 4MR7B 1E89A 3V33A 4JU8A 2N9UA 1K8YB 5LBTA 1JALA 3Q9NA 1I7SB 3HDGA 3KTOA 1N8SA 2D74A 2BP7A 3IELA 5LVAA 2Y1XA 5H02A 1D4AA 4ZT5A 3WVNA 1PJRA 4ZDJA 1TF5A 3WLHA 5AFSA 3UAZA 2J3QA 2OEPA 2A1TS 1JSLA 4GLBA 1G291 3DCYA 5IVDA 4YRRA 3V2GA 4CG0A 3BWEA 3MJVA 3P2YA 2P9QA 2PGLA 5AVSA 2X0JA 4G0YA 4PFJA 4KXXA 5A6SA 4MPJA 1M72A 2F3UA 4HB4A 3TEJA 1QVWA 1B42A 3E5NA 2H2FA 3D7KA 3U7QA 4IL5A 3FFXA 3BK1A 3M4YA 4RPDA 2WWXA 2AVNA 3WGTA 5BN3A 3F3YA 5ESDA 3DCJA 3CGWA 4RCYA 5LMZA 3PZBA 4L5JA 4RA6A 4ML3A 3STWA 1NR5A 1KK2A 1DLIA 1EZ4A 4GX2A 5TXGA 3UANA 4OOEA 4CU2A 1L1FA 1Y6GA 1VPEA 3N58A 4WCDA 2ZE7A 3CS3A 1JYEA 1N2HA 2ABWA 1DDIA 1NBAA 2NXJA 3L8DA 3K72B 3GUCA 2V4MA 3Q10A 2ZP1A 1XQXA 2NSLA 3IT1A 4PZYA 2B94A 2DJ5A 4QGFA 1SHJA 4LCJA 5EHZA 5E8JA 5LZ7A 3WYCA 3RRYA 4Y1EA 4Q1VA 4Z7NB 5B4VA 3P2IA 4B87A 5J5AA 3BKXA 1PT9A 4FIZA 3URKA 3NRJA 3HZRA 1YDMA 2JK1A 4IH1A 3WQSB 1DHTA 1GPJA 4HWKA 3HBFA 4I6GA 2QBYA 1YJBA 4Q7MB 2EYQA 1JPNA 5DT9A 1OJLA 1M34E 3KKZA 4D45A 4D9JA 5MFPA 1WW2A 2GETA 2DXIA 4OHCA 3SE0A 2ENWA 4X93A 1S02A 2PO5A 3FUTA 4ILEA 2Z6VA 2FTKE 1LLFA 1R8QA 1G6KA 2GF2A 2ZAOA 1H5UA 3HBAA 3GOQA 3WLFA 1GKKA 2C9OA 3QHAA 5A7FA 5I01A 2ECFA 2OG2A 2WYHA 1HLFA 4KGDA 4NZMA 5ENVA 1GLVA 2QRZA 5FKJA 5B6JA 4HC4A 1JQLB 4RW0A 2IT1A 1WCXA 4H0CA 2PXCA 5HE8A 3E9CA 2ZJ0A 4GZ3A 4YHBA 3VYWA 2R3SA 1XKTA 4S1OA 4UEJA 3ER6A 4ZRMA 5KNBD 4XIYA 4XD7A 4UZFA 4FYMA 4FFMA 4X8LA 3CUWA 3JWEA 2ZWIA 3W78A 4FOTA 4J7AA 4GS5A 5KNBA 4D0NA 1WWKA 1CZLA 3PWSA 3HXQA 1TO2E 3AM1A 3SLDA 1M74A 3DVSX 4GPEA 3FVVA 4PSCA 3S2SA 1DKNA 2JGDB 3K2BA 4LV6A 1B3BA 4RFSB 4TWAA 1USVA 4XTRA 3B7PA 2ZYHA 3NWBA 1REQB 3U2QA 1NVUQ 2P9TA 5CT6A 1QDEA 2R7LA 5ICCA 2ZJFA 4ALMA 4V0SA 3BWMA 2JAWA 4OP2A 5JEDA 4PBSA 1L4BA 1M6VB 5F78A 1VJDA 3P9RA 4RXMA 2ODQA 1XHEA 3NWEA 4EA9A 3TDKA 3QZUA 1U0OC 4UREA 4QBHA 4H6XA 1XMPA 2WIFA 3I6BA 3HSKA 5BRJA 5I7OA 1PJZA 3O5AA 1VCHA 3G23A 4A2QA 4LWZA 2YC4C 2QM8A 4H7HA 5JAPA 1FDUA 2IVZA 4ENVA 1XRLA 4N48A 3QFTA 3AR8A 3QX7A 1X7XA 3RAGA 1OLXB 1W581 3KWJA 4PSVA 2AKEA 2HZ7A 4ZYTA 3F90A 3V4OA 2YJ6A 1BCSB 4NCKA 3W2GA 3LWZA 5HZAA 1HMYA 1J97A 1R4MA 2BGRA 3HYLA 2E21A 1AGNA 2CXPA 2GD1O 2AJCA 2ZRJA 2G3YA 4IUBS 4ER6A 1VHWA 2DBZA 4DEYA 1GGEA 2PFGA 2RBGA 1ZN9A 4RDJA 4FJ1A 3ZTYA 3ER8A 2XQFA 4EI2A 5EIBC 1QVGB 1ZXBA 3UGJA 1YZVA 3HUTA 3O9ZA 4MRRA 4J3NA 2KWIA 3DYIA 5AW5A 5HKBA 3V46A 3LXRA 1T36B 1XKLA 3EEQA 3OESA 2XMSA 5FOXA 2GREA 4DM7A 5ISMA 3P9QA 1Y1SA 1W85A 2AI2A 3OCVA 3RVPA 5KAPA 4JQZA 5BR1A 4RULA 3B2EA 3ZHSA 1UM8A 2ATXA 2GEFA 3ZCVA 2WJHA 3BDIA 1TT5A 1P1CA 1SUBA 2O7VA 2B8TA 2D54A 3AB8A 3BGWA 3LHSA 5D1HA 1WB9A 2D7JA 1OIVA 4E4YA 1I2AA 1XTBA 5FWDA 1XEXB 4W7SA 5KNDA 1QUEA 1NFRA 3M4NA 3RVSA 1AG9A 4JYCA 2IYOA 3L6CA 4YEDA 1Y3IA 2HDOA 1ISRA 1HDGO 3OQPA 3Q5DA 4MHOA 4CT0A 1QP7A 4OGKA 3UAWA 5A0VA 3EVFA 4ABYA 1M1YB 1FUUA 3EWIA 2BHRA 2I4MA 3QFFA 5LXTB 3HL0A 4O4JB 4K9LA 2OBNA 5EMKA 1QHEA 3ZHZA 2P1RA 1FEZA 3A4TA 3LUHA 3OIUA 3ZY3A 1B93A 4HR7A 5ICFA 1SCJA 4OJYA 3NT2A 1OXVA 3KOUA 2C82A 1IOWA 3A4YA 3F8TA 4P31A 3WHKA 3X43A 4D4HA 2OSBA 4GOLD 4UDYX 1P3Y1 3T1HB 4R1TA 2DFKB 3M6FA 3EGXA 2BP7B 1ZINA 3EXEB 4RGQA 4AO7A 1S72B 4GFDA 4PYRA 4F2GA 1VKZA 4L73A 1UBFA 1ZUD1 3A6PC 5A6SB 2VAXA 1N1MA 3V8PA 4A23A 4AS3A 2C2MA 4ZYWA 4E14A 2ZSUA 5DVZA 1L7QA 1XOIA 4PO1A 4WLFA 3U7QB 4GC5A 1Z6XA 3G5UA 2H06A 5DE3A 5BN3B 3GBVA 3STVA 3TE6A 2JH3A 1BC5A 3IO5A 5FHRA 5KPJA 1IHYA 4P7JA 3LUDA 1IUPA 3C6QA 1U90A 3N59A 4JMPA 4RA6B 3VRHA 2H63A 2A58A 1T1RA 1A9YA 3D59A 3FPSA 3CR3C 5DYTA 1Z45A 5TMDA 1KI2A 1VP3A 4TZ6A 2J41A 4PC3A 3T3NA 1PJ3A 4RMNA 5DOVA 3HY4A 1FX1A 1V4BA 3NHJA 5F35A 4K88A 2ZFUA 5C53B 3LQFA 1QB8A 2Y66A 5AVOA 4DOMA 3LCJA 3GUZA 1YRAA 3Q3CA 4R2HA 1PBNA 2MYPA 4RKFA 1P2GA 4GZMA 2IOFA 3OY2A 4HDAA 1JA1A 1Q1QA 1NQOA 1R8XA 2CHQA 2J3KA 3TEMA 5BWMA 1NJID 3PPWA 3BHMA 3D9QX 3PICA 4OQDA 4W8OA 5D3QA 1DC5A 1Q83A 2OYCA 3RBVA 5K4GA 2QL6A 5BWBA 1L9KA 5GJBA 4H6PA 2JLYA 1CRLA 1O6BA 3NAZA 2QBYB 3KSZO 3I3SR 2YV2A 3PUIA 4U3JA 3OC0A 3IEMA 3D6VA 1PNVA 1G55A 3D6JA 4CEIB 3OO0A 1N6RA 1C7ZA 4AT1A 1VTKA 3M2PA 1F7VA 3S2YA 4LTDA 2IKSA 2E6KA 2XDYA 4TTVA 5GMOA 5HUHA 2EDCA 3T7SA 3ILYA 1VRWA 4BNDA 2YR0A 1GGVA 2NO7A 3EMVA 4RQAA 5HBRA 5KNDH 1LF0A 5TMEA 5B7QA 1BHO1 2VPXA 2W2PA 4CG1A 3L9XA 4BV3A 4EZBA 5B3KA 2QN2A 3OLYA 3R7BA 1BKDR 1QK5A 1SUSA 2HR1A 3D0QA 4ZPXA 2JG3A 1T5OA 2RE8A 2OB2A 3KAKA 4J43A 4UUPA 1VLQA 3RK4A 1NATA 2JJ1A 4BMNA 2I1VB 2ZM6B 2C4HA 2Q1WA 4QGHA 3V8QA 3HCPA 2CBGA 2CUKA 3N0VA 1JR2A 3QIVA 1A1VA 1F20A 2GCIA 1VLLA 2VJCA 4Z4UA 2ST1A 3O1HB 1RHJA 1WP9A 1JR4A 1YDGA 3DB1A 2J3LA 4OA5A 1XK7A 5SV2A 4EA8A 1RXVA 3K9QO 5CEJA 2IYNA 4K9OA 3WC4A 4EKNB 4B8YA 2G40A 2B4AA 3C3EA 4KNYA 1ZRNA 3T5MA 1QOPB 3W90A 2GBIA 4AF7A 3DEFA 2DHDA 5GPBA 4MVCA 3FXAA 3PTZA 1C0IA 5JS2A 5CCEA 3W2IA 1G8AA 1OPXA 1GUAA 2J31A 2D1RA 2P9HA 5IASA 1FDIA 1DPGA 1QE3A 3NATA 3PE6A 5GOZA 1TL7C 5AJUA 5DDIP 3X1DA 1UP4A 1R4MB 5ALYA 1BS2A 5DN6A 2CL7X 1SBHA 3SXPA 1ECFA 4I50A 4D56A 4WL0A 3OLVA 1KFBB 3UA3A 5TRDA 1OXSC 4CKEA 2Y27A 4O0LA 2WT8A 4J0CA 4TRJA 2ZRBA 2IS2A 5A0TA 4UD6A 4FB5A 2MYUA 3HM2A 3B1VA 2TYSB 1TZMA 4CHGA 3JQQA 2R8YA 4IQ8A 1A9PA 1RI4A 2FOIA 2JEYA 4OI4A 4TTJA 4BUJA 1KVRA 1W85B 3B3JA 4PYOA 2ZAMA 2IZ7A 1YDFA 5EUCA 3FSEA 4H16A 4S05A 4KV7A 2ONJA 3UH0A 2ODWA 3RFXA 1O97C 3MFQA 3VM6A 1XVVA 2EL7A 3EG9B 2BGTA 4FQ8A 4HQLA 4J3FA 5AH0A 2QLTA 2O19A 1WF6A 2HF9A 4FT2A 3EZ7A 4N0DA 2Q5CA 5AUNB 4AKGA 1XMVA 221PA 3DZJA 3KDSE 1FSSA 5JXHA 3G6EB 1D6SA 1L5LA 2QY6A 4AN4A 4C43A 3GMTA 2CFIA 1VZ3A 2VJIA 2CEKA 2LDXA 3AONB 3IVGA 3ZCUA 4MGYR 1YKSA 5IAOA 3KR1A 2ANCA 4TLLB 1RLOA 5LP6F 9ABPA 1U2PA 4N39A 2ZB7A 4MKGA 5IKOA 2IUTA 4DWOA 3LPNA 1P6XA 4C30A 1U3UA 2AW3A 3QTTA 3RVNA 1PLLA 1DINA 4R1UA 3VKFA 3OCUA 1TJ5A 1G8FA 4MUIA 4NSNA 1NULA 1FX0A 2CDRA 3ZGVA 4L02A 5B37A 2C5SA 3EGXB 3AOEA 4S1PA 3RW9A 3C3MA 2IPAB 5AMXA 121PA 5D01A 4Q3LA 4PX3A 1SM4A 4UE2A 3UK1A 5JHHB 4J1TA 2OZPA 5GINE 3ZUPA 1LJLA 4GAEA 4PNZA 1CY6A 3RR2A 2OXFA 1EPUA 3FR8A 1G1MA 4GICA 5KJEA 1J0DA 1IPEA 4EEKA 1FPMA 2G1UA 4LJRA 1U2DC 1K9VF 4GGOA 4Q9NA 3T06B 2BVNA 4RBNA 2ZVJA 4GZLA 4JOBA 1G8HA 1QYVA 2EJBA 1U1DA 1GY8A 5AK6A 4BO8A 2CMFA 1YR8A 4M53A 2PQ6A 4WHMA 4JH0A 4EHJA 3AUFA 5EGSA 3VTFA 2CXXA 3T5BA 5M5BA 2VNKA 4IWXA 3T54A 1ZK4A 4NMWA 2W2TA 4KLNA 4A27A 1BMDA 4D80A 3CLHA 4YREA 3VOSA 4G5XA 2PIDA 5I7AA 5TJHA 4DJ5X 3WXBA 4B6FA 4M37A 3VJRA 5IDQA 2ZRFA 2ZJBA 3CSDA 3OKPA 3NORA 1CUXA 4PZLA 3UG7A 1GL9B 4QECA 2FEKA 1DCKA 1KAMA 1L1EA 3AH8A 5J2UB 2ZAYA 4U3JB 3TDMA 2J0UA 3AO0B 4RK4A 3M82A 1GD1O 4PSKA 3S2FA 1TZBA 2IXAA 1GN8A 5FTMA 4KWHA 1RHKA 3UCEA 1JXOA 3TFQA 4HOYA 1LCIA 2P5YA 2GAFA 1Q92A 2VJYA 1RWNA 3N8HA 4BNDB 3K71B 3ZDRA 1Z4LA 4W5JA 3KKQA 3OZSA 2Q2OA 4BO4A 1ZR4A 1N4AA 3N3AC 1AUXA 1T15A 4NABA 5C35A 2JI8A 4QELA 2I4NA 2FFHA 5ESXA 3PQEA 3KU4A 5LZ4A 5LB2A 1IBMB 1BDIA 3MD0A 2BMWA 3QVTA 1T6NA 3W7AA 1UMBA 2QL5A 1I2ZA 2VKQA 4LN1A 5A5VA 2PLFA 2V45A 5K8IA 1W0KD 3QFRA 3FSRA 5C7IO 1N77A 2LKCA 2WZBA 5KVSA 4L95C 1AS2A 1GDDA 1PF7E 3AQ4A 3DMTC 4YVFA 2GN6A 5IM4A 5T8KC 5BV0A 1N3BA 3PS9A 4CV2A 1KOFA 4WNAA 3AF6A 4GDFA 1B1CA 1HVXA 2Z6BD 4J91A 4QASA 1GNLA 1WXXA 1YIJB 1CTQA 2YY5A 5IJXA 1AK2A 2XMZA 4MVJG 3W05A 4DMKA 5HOQA 2DHQA 5LDGA 4LZZA 4PX9A 5JDIC 1HK7A 3NCHA 4BGVA 1ICEA 4DTIA 1VB3A 1OGIA 3V42A 3U4HA 2C5AA 5J2TF 5TMBA 3Q98A 1FP1D 2WZQA 4KO8A 1JIQA 1B14A 3RKUA 4LIPD 5TSDA 4DXHA 1FY2A 2H7CA 3N1UA 1T29A 4JQYA 4L8GA 4E5KA 5AW1A 3RIGA 2G07A 4M0DA 2UU9B 2F43A 5HF9A 2PFSA 3GLVA 5F51A 1GNPA 4O4IA 4N65A 4QXRA 3LQ6A 3M9WA 4L0DA 4ARBA 2VJPA 2ZQZA 4NJEA 4I50B 2C94A 2QN9A 2PD6A 5ITZA 1HM5A 3AMVA 3N2KA 2EX0A 4G0PA 4A0QA 4ALJA 3E9YA 4CKEB 3UN1A 3SY8A 4EFDA 3I4FA 1KH1A 1WR8A 3CZ9A 3O7MA 5JZVA 1GRVA 1M1NA 1NMZA 4CYMA 1NLFA 3F8WA 1PZGA 3K30A 3LWNA 1QHHA 5JDCA 4QHSA 2IXBA 1DEXA 1H42A 1J90A 1Y5RA 2FZLA 4HH1A 4MGIR 4ZKEA 1DQRA 5KIAA 3O8RA 3AR5A 1PG0A 1GT6A 2NZ8A 3LYAA 4JMLA 4XWYA 5JDIA 3IUNA 3T34A 4E7OA 2WSIA 1T0JB 5EZ5A 5BXYA 4QAJA 3JD3A 1E1QD 3CUVA 5H3LA 3VBCA 2Q6KA 1E2NA 4YIHA 2PU7A 5M34A 3MCTA 3KLBA 1SCAA 1RIIA 2FW6A 1E1QA 3LJKA 2BHTA 2V6JA 4AXBA 3CH7A 2P6UA 4Z4EA 4JI8B 3JWHA 2V3CC 1B0ZA 2W5UA 4C4TA 2RGYA 2RK3A 4IJUA 1EBUA 2Q2VA 2CHEA 1MEOA 1V39A 4O3FA 2FMIA 3ZD7A 3AHIA 2WJ6A 4FCTA 4L9WA 3AVOA 1WF3A 1YB1A 1PJSA 5CMLA 3VPHA 1QZZA 3KLNA 2XCOA 3CEHA 4EFKA 5EIFA 4R71A 4EIWA 1F17A 3VZQA 3R6KA 3ISXA 1JJBA 1YRLA 4J0QA 2IXGA 2NO4A 3HBMA 1EK6A 1XIVA 4G4JA 3NETA 3ASZA 5DTQA 2H5JA 1QH9A 3MUEA 4AICA 4DDWA 3VTAA 5KMGA 4FZVA 4CM4A 2LV8A 1PWXA 3IUQA 4KITB 1XLUA 3K0BA 3LLUA 1OHHA 4R9RA 4QU9A 2VBGA 4F6RA 3L0BA 1U8UA 3CG0A 3T15A 1AF4A 4HNUA 1CETA 4LVUA 2F3PA 4OXRA 5JMTA 4RD2A 2QPAA 3A6HA 4BNZA 1OB0A 1AD2A 4K6FA 5CK4A 2H4FA 2WSMA 4WZTA 4K9QA 5EXSA 5LNK6 3F67A 1HFEL 1JFLA 1UADA 1D6NA 5F98A 4A8JC 2WD7A 3TSWA 1VQ6B 4JCCA 3L93A 3DVLA 3UTCA 1QQAA 2H1CA 3FYSA 4F3NA 1CQXA 5I4BA 4QUKA 1GCAA 4FPXA 2E89A 2HRDA 2PX3A 2Q1YA 4YAJA 3FRIA 2EJWA 1DXHA 1Y7HA 4LSMA 3ZQKA 4AQDA 5KU7A 2BI7A 4ZV4A 4FIDA 5E9AA 3D3KA 4BBJA 3IJEB 3QU7A 1LDBA 1NJ1A 1PAUA 1TCCA 3TRKA 4D46A 3KYCA 3A2LA 2I7VA 4RO0A 2OTJB 5SYMA 4QULA 3E2IA 3K9NA 4PPYA 1E9AA 5FOWA 4UZEA 2V4ZA 3UQZA 1IPFA 5EJIA 4F21A 2EJCA 5BOSA 1AV6A 1T1JA 3U9LA 1N36B 3C8UA 5A9RA 1JEOA 4IEEA 2JFYA 2QD4A 3DE6X 3PGMA 5E9WA 5P8WA 3ZCRA 1JG1A 4YP0A 2ZRMA 5J4HA 5KU1A 5A05A 3KB8A 2PD4A 1YIDA 4MP8A 5D51S 2Q4OA 4ARAA 4GM4A 5HZGA 3FKQA 4F4FA 3B1WA 1MA0A 2DSNA 3CNNA 1M2NA 3TRIA 2J0UB 4OI1A 5JADA 3CF4G 3F6SA 2B7BA 3V1YA 2QTCA 3Q5GA 2I1WA 2HK9A 2O4CA 4J7XA 2O0LA 3W6ZA 3OFKA 1NRIA 1Q84A 4WXRA 3RLIA 1N0VC 4FZ3A 5IK2D 5JSHA 3DAFA 3DONA 3OO1A 1Y1TA 2QP9X 5BNTA 1Z34A 2QL9A 4XM0A 3EDYA 4UTNA 2ZSFA 4LSWA 2B5OA 5LDDC 1Z5UA 1YR7A 4OI0A 5FL3A 3CUSA 3D1JA 4F8JA 1QIGA 3OH8A 3SBEA 3HKBA 4WFJA 4DZTA 2CJXA 2OORA 2CZGA 3GJSA 1B2LA 4Y2HA 4EL0A 4DKXA 1JILA 4CQJA 2CHFA 4UHEA 3S4YA 1UMBB 2B20A 4M8SA 4UU8A 4QWWA 3FOWA 2Y3IA 1OXMA 2DPMA 2Y9MB 3E35A 5JYCA 1ZUNA 4BNLA 3R0QA 3G05A 1K7EB 1EFUA 2R1UA 4EW3A 2GBGA 4YFVA 1IM8A 4LF8B 1M2EA 3O38A 4WNAB 2OBRA 2ZE6A 4HS9A 4OLFA 4PTLA 2BUAA 4R2XA 2XSZA 4DCPA 2XCRB 4DR5B 1SXJD 1FJHA 4ZQBA 1XL1A 2JL1A 4Z9FA 4BWVA 4PN7A 5HS4A 2QN1A 3PR1A 2ZRQA 1IB0A 1GQQA 3K4PA 4G5RA 1SXJA 3LGAA 2EFGA 3PHGA 4IJMA 2BGJA 1CR0A 1YOVA 5KWIA 1N5RA 1UBKS 1PS9A 3A05A 4BX0A 4W7IA 1SBYA 2H54A 1U0SY 2X9GA 1QRDA 3SEJA 4B7CA 1SK8A 4J0KA 4BEVA 2QTZA 5BYAA 1XN1A 3PL1A 3P9KA 1SR8A 2XWJI 4BO5A 1JHMA 1GJRA 3OZWA 2F43B 1Y8QB 3CJTA 3OKFA 3W9YA 4B4UA 2P6PA 1XVUA 4O4IB 2Q7OE 4IDCA 2H0QA 5EOVA 4U7HA 3TGLA 4NJEB 1N92A 4L7VA 4BBAA 2ZT7A 4ZT3A 5CEFA 4M0LA 4EH1A 3VPGA 5ITZB 3N2KB 4ZTUB 5KTYA 3WJ1A 2EOAA 1E1DA 1O9HA 4HQRA 1WV1A 1M1NB 4HI0E 2N46A 2HT1A 4W1RA 3UQYS 4TL9A 4P25A 2BM9A 1QHHB 2Q45A 2QV7A 2QY9A 3EEIA 3DE2X 1SOMA 2H4ZA 4NZ9A 5JWHA 4HWTA 2FSIA 1K97A 1OFVA 4C4SA 5HJ2A 1T3GA 4TLMB 3AERA 1J9ZA 3INGA 3ZHOA 3TD9A 4F6LA 3KEQA 4NK4A 2ZATA 3E61A 4CF5A 2RGBA 1EX7A 4N6GA 4Y2QA 1E2BA 1G5HA 2AR9A 3A2NA 4I55A 3H1EA 3CMMA 5IJ9A 4AJOA 2EW8A 2L2QA 3VNAA 3Q5EA 1A9TA 4B6QA 3B8HA 3RT1A 3E84A 1F60A 1GUBA