2RC6A

Refined structure of fnr from leptospira interrogans bound to nadp+
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
306
Chain Sequence
b'PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-NADP reductase
molecule tags Oxidoreductase
source organism Leptospira interrogans
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
total genus 86
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc6A02
3W2EA 1FRNA 1M1KD 2OK8A 1UMKA 5AN9A 1CNFA 2BM1A 4RD2A 3JQQA 3AVVA 2YWGA 1D1NA 1AMOA 2QTLA 1OGIA 3I1FA 2EFGA 1YJWB 1GJRA 3QFCA 2QEXB 1ZM9A 1B23P 4LBZA 3U6KA 1FNBA 1VQOB 2BF4A 4Y9RA 3WNCA 1Q7YD 4RD3A 3CCJB 3ZZ0A 5KSWB 1NJID 4ZCLA 1FDRA 2PMDA 3AGQA 4B47A 2FX3A 3ZBUA 1FNCA 5JBQA 3W5UA 4EH1A 1H85A 3V76A 4MYTA 1YI2B 2CRVA 1Q82D 1GVHA 2YWEA 4TMWA 2BM0A 3FPKA 3ES9A 4LBVA 4TMVA 3MCAA 1KC8D 1G7RA 1YJ9B 1EP3B 3MHPA 1KJZA 4B44A 1YIJB 1VQ9B 1QX4A 2EIXA 2GQFA 4ZCMA 2OTJB 3CCSB 4RCYA 4FK8A 5TY0A 2DETA 1CNEA 3CW2A 2HMAA 1ZM2A 4G5GA 3CCVB 3AVTA 4TN1A 1VQLB 2DY1A 3SJZA 2BSAA 4M2LA 1GO2A 1D8TA 4RD0A 1CQXA 3VMFA 1K9MD 1SKQA 1R5BA 1YJNB 1BX1A 1ELOA 2VNJA 2YWHA 1JNYA 1BQEA 1R5OA 4YHBA 4H9GA 1N8RD 1EP1B 4B43A 1E64A 5FA6A 1TTTA 1DG1G 1JB9A 5TV2A 1VQNB 1GAQA 4TMTA 2BPOA 1KTVA 4PC1A 2CNDA 2XNJA 4UAJA 3I56B 4ACBA 4LBYA 4G1BA 1W87A 1QUEA 1JA1A 3B78A 2RC5A 5DSZA 1QGYA 3VO1A 4AF7A 2AHOA 3U2QA 1F20A 1WDTA 4FN5A 3CMAB 4K1XA 4C0SA 1NDHA 3CCRB 1ZM3A 2QTZA 3WBKA 2C78A 3PENA 1KK0A 3OZUA 4U9UA 2XEXA 1QVGB 1YHQB 4RD4A 4ZCIA 1EP2B 2QDXA 3CRZA 2DERA 2R6HA 3WXMA 1JJ2B 1VQ5B 1R5NA 1OGJA 3CCUB 1W2BB 2BGJA 3QE2A 3G4SB 3W2HA 3LO8A 4HE5A 1H42A 1G7CA 4BPRA 3VNUA 1EFUA 1E63A 3P27A 3W5VA 4M0LA 1KQSB 1QFYA 4B48A 2XNCA 3ZC3A 4YAFA 4ACAA 4TMZA 4R71A 3WNBA 3OW2B 3CCLB 3CCEB 4YAWA 3U6BA 3QFTA 2NPFA 4DQKA 1QH0A 2X3UA 1OB5A 1G7SA 4Y7CA 1IB0A 1I7PA 3CXCB 4TMXA 4RCZA 3AVYA 3G6EB 1Q81D 1B2RA 4YAOA 1QFZA 2BN4A 1N0VC 4J0QA 2DCUA 4NCNA 3LRXA 2QN6A 1OB2A 3W5HA 3CC4B 2D74A 3FJOA 4F7DA 1IJFA 3JQRA 1DARA 4ZGNB 1EXMA 2B5OA 3JQPA 4PC7A 2J7KA 1FNMA 2YWFA 4HE6A 5H5JA 1FRQA 4RD1A 4YAUA 2B7BA 1IJEA 2VNIA 4M53A 1J9ZA 1KK3A 2B7CA 1DDIA 3CD6B 4WQMA 3QFRA 3WYAA 1K73D 3CMEB 2E1RA 1SM4A 1KK2A 1XE1A 3CB4A 1VQ4B 1TUIA 2GPJA 3AVXA 3B82A 1VQ7B 4Q7JB 3CPWB 4N3NA 2HCJB 1F60A 4MYUA 4PC6A 1E62A 4N3GA 3OZWA 1S72B 1YITB 3W2FA 2OTLB 3G71B 3MMPA 2BVNA 4M4SA 1AIPA 4M1KA 3CCMB 1GAWA 1JA0A 3VNVA 3AVWA 4LC0A 2VNKA 3OJXA 2DEUA 4ZGQB 5H59A 3LVBA 3ZZTA 3AGPA 4FWTA 3WY9A 1Q86D 2C77A 2ZITA 1U2RA 4QHYA 1FNDA 1DDGA 1KRHA 2PLFA 1K8AD 5HXBA 4P3YA 2PIAA 2RC6A 1S0UA 1VQMB 4B3XA 3QSYA 4YALA 3AVUA 2VZLA 1VQPB 4RD6A 1EFCA 3QFSA 4ZV4A 3W2IA 1BJKA 4PGOA 1HA3A 4PC3A 4RJLA 4B4DA 1G7TA 1EWYA 5GV7A 2VNHA 1TVCA 3LYUA 1A8PA 5GV8A 1QFJA 4AF6A 1TLLA 1VQ6B 3E1YE 3CC7B 3P26A 3ZBTA 2BV3A 3B8HA 4PC2A 3A1FA 1ZUNB 4C43A 1QUFA 1KK1A 3E20A 4G1VA 3VO2A 2QA4B 2BGIA 1QG0A 2QMUA 4Y9UA 1BX0A 4QFMA 3I55B 2HDNB 1QGZA 1D2EA 3CCQB 1VQ8B 1XB2A 2BMWA 3ZZUA 3OZVA 1ZM4A 3WBJA 5TR9A 5THXA 5EMNA 4LBWA 1W35A 2OK7A 3CC2B 3W2GA 1M90D 4IW3B 4AC9A 1VQKB 3J81k 1W34A 4NBSA 1QGAA 2VYQA 3OJWA 1QVFB 1GR1A 1KD1D 4P6VF 1N0UA 4DQLA 1EFTA 3WNDA
chains in the Genus database with same CATH superfamily
1IULA 4DIKA 1V2GA 4QPDA 3V1LA 1GARA 4DPMA 4A0QA 2P78A 3KL2A 1M0SA 3LT1A 2QAGB 1DZIA 1IE3A 3CTMA 4YAIA 2XTZA 3EPHA 3PGKA 4MUHA 4BBPA 3LE8A 1P60A 2PH1A 3QKRA 1V2HE 1Z6TA 3QBEA 4RDXA 2WOJA 3KLPX 2VTBA 3EZ7A 1S2GA 4AO6A 3GLFB 1IDOA 4C0HA 3ZN2A 3K1JA 3HUTA 3FJ1A 3MQ2A 1XD2B 4DA6A 3IKTA 2I1QA 2IYZA 4M6WB 4M21A 2I2DA 1FS5A 4M86A 5UKDA 3ZJYA 4ZVVA 3U6KA 1U1CA 1FNBA 1NC3A 3P45A 3HRHA 1RLOA 3T94A 3WNCA 1Q7YD 1P9WA 3DEKA 1UKVY 4R51A 4DJDC 1YS6A 3GX1A 2NO6A 2XF2A 1JILA 3I9JA 3L6OO 4IOLA 4DG8A 5L7WA 5BT8A 2B0JA 2GKOA 1KP9A 1LNZA 2O0HA 5IDVA 4OMUA 4RL4A 5L6LB 5AKHA 5DM4A 2RE8A 4GGPA 2PMDA 1HE3A 2O2JA 2VSXA 1NN5A 3CGWA 3PUZA 2R1VB 4UDXX 3T7IA 4Y2TA 3UGQA 3VR1A 1L4GA 3KC2A 1HYEA 3AEXA 4CL2A 3PSAA 4PLYA 3PRKE 1QF6A 1OPRA 1RWKA 1KEEB 4MSUA 3T9DA 5JBQA 3TL2A 1LC0A 2J3LA 4WVLA 4KNVA 4O4JA 2O7NA 2WJVA 2A1TS 3EZFA 1QZUA 1H9BA 1VE9A 5AK6A 5H9WA 2CRVA 3DR3A 3JYLA 4DRYA 3OJEA 1RWWA 3KZCA 3SF8A 3ES9A 4LBVA 2X8JB 3FOWA 3F47A 1X3LA 4YCLA 5IT4A 4PTYA 3KPVA 4C6RA 2R0QC 3RVPA 4R0NA 3FUXA 3BE5A 2Q27A 4PM4A 4I3FA 1CUAA 1G8PA 1U3FA 3G2HA 4BQFA 2XUDA 5DHPA 1S8FA 1E9BA 1UFVA 2ZRPA 3UWPA 3ESRA 1TJ3A 4HEA6 4IM7A 5DKFA 4B5LA 4Y2SA 1Q3KA 2YNMA 2X41A 2PA3A 2ZIEA 1SJ9A 4XVHA 3BGWA 4U8GA 1QU2A 2FWMX 1TF5A 1UPAA 2J7PD 2WJWA 3U3XA 1W6UA 3VR6H 1POWA 1TZCA 4IBOA 3FZYA 4QECA 3RVKA 3CCSB 1V5EA 2C98A 2ZJ3A 1CB7A 1B43A 4ZV7A 4XE5A 2HMAA 1V37A 4CFSA 1OH5A 2VJDA 1SXJE 3AZQA 1GG2A 1VQLB 3LUKA 2OCAA 2Z5LA 4L5AA 4Q4HA 2YHIB 3KQSA 4B2LA 1E94E 4AY3A 1Q44A 1Z06A 4ZHQB 2D0OB 2OAGA 4Z4YA 3LVFO 4UUAA 4V3BA 5U9CA 4N9WA 1OFVA 3PDWA 3PC3A 4LZWA 1L5HB 2IPXA 4RZIA 3H5IA 3KDSE 4I9NA 4WRRA 4IHJB 4KH1A 4LF9B 1VLOA 1NASA 2BTQA 2B25A 3HEMA 3H9CA 2V7EA 4JLSA 2OWEA 3RS7A 1PJAA 2PGIA 2ZCVA 2VF4X 3R6DA 3BY2A 4EKNB 5LNK6 2PO7A 1U8FO 3HI6A 2IZ5A 1ZRMA 2OG2A 3E9RA 3TW8B 3ZW8A 4EVSA 1QJ4A 3TTVA 2XUPA 2JHAA 4PLGA 2Z4TA 5K6AA 1VQNB 3ENNA 3LXXA 4RDLA 2A0KA 4ONEA 2FFAA 4MCHA 5DYTA 3VNSA 3K6JA 3QMVA 3WRXC 1ISHA 2P9QA 3KR2A 2YV5A 5FOXA 3ZQKA 5B6JA 4IFTA 3LYAA 4N5MA 3ILHA 3RUPA 1PRYA 5KOIA 3R4CA 1JZQA 5AW1A 3RGGA 4G0UA 5AHXA 3L0PA 3THSA 3DDZX 3F4LA 1AT1A 2WMNB 3PWKA 4FDUA 3E81A 3HLTA 4AKIA 1R12A 1NBWB 2ORVA 2Z30A 3GJ6A 3HYLA 4DSUA 5ECGC 4C21A 3D7RA 1Q1BA 3V8EA 2VBSA 1G291 1B4DA 1M6WA 5BSHA 4IR7A 1EFVB 4RTPA 1SIOA 2WT8A 1VOTA 3KKNA 5CA1A 3KOOA 1KYVA 3UAWA 4BO6A 4EO7A 3WZ2A 2X7JA 2DP4E 4MQEB 4Y3UA 1O97C 4HFRA 3I1JA 4XPIB 2M9MA 3P8ZA 1F20A 5HZAA 1NXOA 1UM8A 3T52A 4NCKA 1HNZB 4S2EA 1WCXA 1ZN9A 2HBZA 3AYXB 3EGXB 1I2DA 2YN0A 1MO2A 4FFDA 1BHO1 3ASYA 2XRYA 5FTNA 4BC0A 1G2OA 2X4LA 3T4UA 1DADA 3V6MA 4CM3A 4D97A 3WR5A 1SULA 1CETA 4BV3A 3IRUA 4QHSA 3T9AA 4WNAA 4H7FA 3OZXA 1FMLA 3A6GA 3FTPA 1GUDA 2VFAA 3C8HA 4DZRA 2XEXA 3PPYA 1ULTA 2OD2A 3RS3A 2NV2B 1YBAA 4QRHA 2J3MA 2P5SA 1PW7A 5FPHA 3ECCA 4L9SA 1B42A 1FCJA 5JMTA 1US8A 3TZCA 3QHPA 3L7IA 1PV4A 3ITDA 1UD2A 4P4SB 5DRYA 5EP1A 5KNCH 4CL3A 1PGJA 1NMZA 2JK0A 1EDOA 2RGBA 4X62B 1L4KA 1AF4A 2PZGA 3MWDB 5KIAA 2VQEB 3KHUA 1W5AA 3QKUA 3OEEA 2X5OA 4POAA 5ECWA 4F6CA 4ERNA 2V0CA 4HB2A 2P2CA 3K9WA 4R8SA 4MDFA 5K99A 1L8XA 3ZV7A 4HPXB 3ETJA 4IJMA 4JYPA 3Q38A 3KOWA 4E5PA 4L8GA 1GZSA 4HFJA 2W2KB 5JZOA 2D54A 4YP5A 4MKZA 3G8YA 1NUUA 5AW4A 4TSFA 3MJSA 4V0ME 1GZUA 2DSNA 3F5SA 3KSMA 1U7UA 1H94A 4RACA 2J0UA 4PN3A 2IITA 2UZIR 4RMGA 4MIEA 4M0MA 1KQPA 2HSDA 2JH8A 2PM8A 5KWVA 1LD3A 2AOUB 1KGSA 4L8WB 3THOA 1QZTA 2J1LA 1J25A 1IEXA 3IGFA 1VJSA 3TCNA 3V8NA 5B3LA 2A9JA 2NWQA 2AUNA 2IPNA 3ZNPA 3OW2B 1ST3A 5JXJA 3OPYB 4G24A 4U5QA 3A8TA 3M5CA 4W82A 2WF9A 2BFEB 3LHFA 2WWYA 4DQKA 3E2MA 1ENOA 1HEIA 1IHPA 2CMFA 2RHGB 2VEDA 4M8LA 1G20E 2AB0A 2W2TA 3M1IA 2OBRA 4FUQA 4JYMA 1GKYA 4L6AA 2ZP1A 3OLQA 4JJAA 4B6SA 1P1HA 2I6QA 3LPAA 4K1LA 1ORHA 1BDMA 4G5HA 5D7NA 4BUCA 1BE8A 3LWDA 4DUPA 3I04M 4B73A 4D4KA 4ABTA 4X1KB 3BHNA 4ZQBA 2BDEA 3RIEA 3UJHA 2Q3DA 4LDNA 2GPSA 3EWAA 3GROA 3QUBA 3HGMA 5ALPA 3F71A 5KQSA 1RR6A 1ZJ4A 1YR6A 3V1MA 1VG9B 5A4IS 3V8MA 4QV2A 2C7BA 1U4OA 1IDN1 2ODNA 2AG8A 3OPYA 3W2TA 1RSZA 2BJVA 1GDHA 3B8EA 2FV8A 3HU5A 2C07A 1BMTA 3ACBA 1O4VA 3UV7A 1H2FA 4PCUA 4YCCA 1P0PA 1QYRA 3FTFA 4P0PB 2AWNA 5FWYB 3MWLA 1PJ7A 1K5PA 1KQ3A 2EJWA 1QG2A 3DZ8A 1LU9A 3SS8A 4K9SA 4BOYA 5IX8A 4XWAA 5LWQA 4F7DA 2HREA 1ODKA 3ND9A 3UCEA 3BD7A 5HILA 4QM6A 1XXHE 2Z2YA 4LWOA 2PQ6A 1NJSA 3TL6A 3VZDA 2JPDA 2WLTA 4K2HA 4TUYA 1MABB 2Y8EA 3KFLA 4RUKA 2C2MA 2MR6A 3IKVA 3H9NA 4HYEA 1UDRA 4O59O 1JHUA 1TNDA 4MULA 1RM4A 1NNI1 2UV8A 4Y2JA 3PUNA 1PEKE 4HE6A 2DUNA 2LE0A 5SZJA 4TZ6A 3DUFB 3ONVA 2DLDA 1LX7A 4Z9BA 5LQNA 1QAMA 4GQNA 2X5KO 4KJXA 2JCYA 1ZZGA 3O94A 2WU4A 1OAKA 1G21E 5FBHA 4BRWA 4Z9XA 4HAVA 2R11A 2PJZA 3EVFA 1U3UA 3AERB 1T3ZA 1D03A 1YUBA 3DDSA 2CLDX 1QYCA 4PLHA 2QP9X 4BX0A 2J6BA 3BZUA 3PRJA 4R1OA 3UTCA 5LXTA 4LJRA 5K8TA 2P6MA 3NLLA 1JKJA 1FYWA 1XELA 3KHSA 1Q0ZA 3QY0A 3SLGA 4EY3A 2JDID 4L57A 2VXYA 1I5OA 4OM8A 1AKYA 2QD3A 1RXCA 2H63A 5KYWA 2WDZA 1DC3A 5C80A 1IM5A 3M1AA 1EU1A 1MX3A 3DKRA 5DIZA 1VHOA 1K75A 2LCIA 1I0IA 2A0XA 2C4NA 1QFMA 2B4TO 3DYIA 1T5HX 2H7CA 1R0SA 2XYGA 4RH3A 3JPWA 4ZYZA 3LY8A 3VI4B 3IHKA 4M3NA 1JYFA 1O95A 3E0XA 3RSHA 4NOMA 1CHDA 3H5VA 1ZLXA 1ZUNA 4U7TB 1Z22A 2QB5A 2SCUA 3ZXIA 1YU9A 3PUHA 1GL3A 2H1IA 3T61A 2HV8A 2WG1A 5JSUA 3IP3A 5FWYA 2HBQA 2Z2KA 1XVAA 1N75A 1QIIA 5TMEA 3JPYA 3TIXB 4PYJA 3HJAA 5JNSA 2OORA 2C3OA 4Y2UA 2JLYA 1QCCA 5BSUA 1M2GA 3W6OA 4CETA 1T26A 2CFTA 1NC1A 4C0BA 3TQOA 2ZDQA 2WSMA 4O2AB 3IAEA 2C3MA 4KZKA 1E9SA 2FG5A 3W5BA 4ZAVA 4H08A 4ZO7A 4BX8A 1QPZA 1E7SA 2AI2A 2QOEA 3HXOA 1IHDA 3OEWA 3WY9A 1IHUA 2BFMA 3KJGA 4WD3A 2CKDA 1GNLA 1MEJA 4QDTA 2ZUBA 2AYXA 5C1OA 5K20A 2WSSD 2YW9A 3TS1A 2Q5IA 4ZOCA 5EGSA 4BNUA 5EZYF 5IF9A 5EUBA 3PR2B 1L5OA 3QELB 1NBME 4QASA 4YDQA 3OCXA 4NWIA 3IBGA 3HK2A 4XYBA 3R3JA 3TN7A 3IRVA 1IAQA 4W7SA 3WMRA 5KPDA 2FMUA 2VSFA 3TQCA 3DBHB 4LTDA 2FOXA 2FW7A 3RT7A 3CSDA 5ED4A 1RJ9B 3PQDA 4MWSA 4OBXA 2DR3A 4GMXA 4KXUA 2UKDA 4ND6A 5CGQB 2VTVA 5DIFA 5J9FA 3UMFA 3ZNNA 3INYA 2I55A 5DOZA 3RBZA 2Q3BA 1X7WB 1TDJA 4BEWA 4Q24A 3QFSA 1E0SA 2HF2A 3JD0A 3W2IA 3KUUA 3NP9A 4AN4A 4GEGA 1JFLA 1TEHA 1R0CA 3CUSA 5HIKA 4RJLA 2J45A 3SSMA 5AK5A 1EWYA 1JQKA 1R9NA 2EEZA 3JQ6A 1KYIA 4KXXA 2QA5A 3I45A 4QQ8A 1UKAA 1FXWF 1D7AA 3AEZA 3QYFA 1OJ7A 4DTCA 2L18A 1KHHA 5KSYA 5E3HA 1M0EA 4EG0A 3SR4A 3EIQA 5E95A 5HQ3B 5A6VA 2ZUWA 4MRAA 2H65A 2JA1A 2FSIA 3C7DB 4TGLA 1KE2A 2V7XA 1LSJA 1P4GA 2X13A 2DPGA 4OJQA 1BKSB 5T4HA 3ROZA 3K1YA 4C3OB 4Q7KA 1TM2A 1JFVA 4LSGA 1ZUWA 2XUAA 2IUFA 4URYR 4BWVA 1TK3A 4K0KB 3AX6A 3LWNA 4OJTA 4G1VA 2YXBA 1FSFA 2M32A 3KP1A 4IVNA 3O83A 2HF8A 3KSUA 4N82A 3RYIA 4EI9A 2JJ2D 3EIWA 4OPMA 1PZHA 3GDOA 4I55B 2OQRA 1CNMA 1WSWA 2CXOA 3PGXA 1X9GA 3PL5A 4Q21A 5J5CA 4PLPA 1UJNA 4MGYR 1CY6A 1BX0A 2F3QA 1PK9A 1NMXA 2CFRA 2QM8A 4LV5B 1M1YE 3TF5A 3H2ZA 2FLKA 4ZVNA 4H0CA 4WOBA 4Z7OB 3DKVA 2ZJZA 4IJWA 2HEGA 3IVAA 5J47A 3SPXA 1SURA 2YMMA 3TG8A 2I7XA 1IUNA 2WAOA 3CTPA 3B20A 3DEFA 1OR8A 3AY3A 3H2IA 3L1VA 2VCHA 4IDPA 3WFZA 1U8ZA 2N75A 2QPLA 2V58A 2FPLA 3T5GA 2I67A 3C4VA 4TTIA 2RBKA 3EOAI 2FWAA 3T9BA 3F9CA 3KZOA 2PQ2A 3TXYA 5IK2D 2XVMA 3IT1A 4LBWA 5EJ9A 4I19A 2AC2A 2GEBA 1CR6A 1DAPA 1JYSA 5ETJA 1RAAA 4FE4A 4OHFA 1Q84A 3ZWMA 1PJ5A 1T9ZA 4CR6A 3KTFA 1KOJA 2GBLA 5A5VA 4X05A 4IDEA 1QS0A 2WD7B 4CMGA 4GMFA 3OE1A 5ITZA 4I9HA 2RAVA 3VMMA 4L4XA 4DR1B 1GTRA 4AI6A 1IZ9A 1PWEA 3ZV6A 3GP5A 1R0KA 5CYPA 3L8EA 1F1JA 1O96A 1N2HA 4Q9NA 2HSZA 5SYAA 2FE4A 3BBPA 4PG5A 5EQTA 2FWRA 4MQUA 2FPOA 3QSGA 4C87A 1BGXT 5C5DA 1O5TA 3IAS1 1EQUA 1CRZA 3BRCA 2DPXA 2VOJA 3PTLA 4DQLA 2CF4A 1WMBA 1EFTA 3G8AA 1JW9B 1THTA 3BAZA 3ONNA 3PIIA 1E3IA 4AVZA 2VJCA 3EHEA 3QHAA 1E3EA 2C5AA 2O5VA 3I28A 4HLDA 4ALIA 4KNYA 2Y0EA 3RROA 2NZJA 2ZYIA 3HM9A 2P1ZA 4EM6A 3PVZA 2ZPAA 4P31A 4K05A 4V0KA 3N2NA 3RWBA 3M1YA 3TKLA 5JADA 2BM1A 5I7RA 2XDWA 4X7DA 4YO8A 3RLIA 2D5AA 1WV1A 3H2YA 4QTZA 1U0TA 1J5PA 1WEHA 4NCIA 3KDAA 4Z7NB 5CAEA 3OX1A 4OHKA 4CTKA 4QPPA 1PR5A 1X7XB 2O1SA 1R6XA 3E9CA 5A5GA 4ZHQF 4P34A 4ZHQA 2QTLA 4YH1A 2Z95A 2RK4A 4M1QA 5DEIA 4NFYA 3TAUA 3A6FA 2O3RA 2ONZA 1XK7A 2E4XA 3DPUA 2PDAA 3ILVA 2AA3A 4MI1A 5FI5A 4WOKA 3FHLA 4Z4WA 4MV5A 3CCBA 1YL6A 2Q7XA 1M1ZA 1NTRA 2P0EA 3UZUA 2IH2A 1Y7TA 3BGSA 3FCYA 3JZDA 3F9RA 4PBTA 3KNZA 5GVSA 2G25A 1L4FA 4HL6A 3P0JA 4II2A 5IMBA 2DH5A 2H0AA 5JW6A 2EF0A 5HRCA 2QRVB 1KRWA 3DG9A 2G36A 1GFIA 4XMYA 5EEGA 3EUEA 2VT6A 5G2OA 5IDWA 1P2GA 2QY6A 2Y1XA 3HY6A 4KN8A 2AR9A 2AMFA 3VU0A 3VHLB 3D6FA 4GQBA 4C6TA 4UVGA 1AA9A 1P2VA 4ZJYA 1YOVA 3UWKA 1WW3A 1GFZA 1P31A 4B9EA 1JPNA 4G23A 1DTSA 4MR8B 4MVJI 3SXPA 4B71A 1EBBA 3A9WA 2JGLA 1D2HA 5BOVA 3NBAA 3N0RA 4XYLA 1LB1B 2PXHA 1DEHA 2Y67A 3NH9A 1F2TA 3GEEA 4FDLA 4HWTA 4L28A 8LDHA 2O5CA 1A5TA 1ZOLA 3B6ZA 5JTTA 2I7TA 4RKWA 3VPSA 1XRNA 1Z5GA 3FPKA 2J5QA 2VNSA 2YH2A 4R01A 3GPBA 1V43A 3L0CA 4Z4CA 4AY6A 4B3TB 2VC2B 4LAFA 2OD7A 4GQAA 1L5WA 1XLTC 5CVEA 2KS6A 5DNWA 1GRCA 2PBZA 3L43A 3GEBA 2C7VA 4ZJPA 2RI6A 2VP9A 3ASTA 5AW5A 2WHQA 5IMSA 3F8TA 4B44A 2PX2A 1Z35A 2OO5A 1DTEA 4AZWA 5ECYA 4CQMD 1A8IA 1E2BA 1FLAA 1ZK2A 1YDGA 3L4SO 1X80A 2ECPA 1R4NB 2FW1A 2X0JA 4XWYA 3KQWA 3WMXA 4RCYA 2QVXX 4IIFA 4MWEA 1NP3A 5TY0A 2VRNA 1AHIA 1CNEA 2AHRA 2F1HA 3L8ZA 4J0JA 2HU5A 4LYAA 5MHTA 4JB0A 4OU4A 4ZP1A 1VMEA 1BW9B 1Z4JA 3MN1A 2WAMA 4RTJA 4PAAA 4E51A 1CQXA 4OLAA 3VJLA 3K4PA 1QC5A 3MEQA 2PSHA 2WZPP 1BDJA 1WDMA 4QJ3A 5C1PA 4ZOLF 1CE8B 2R8BA 4W63A 4GKKB 1G3IA 2GARA 3IVMA 1CUDA 2A9KA 5CFRA 1RU3A 1RMYA 4XYMA 1DIRA 1CVRA 2D5IA 3OUZA 1CUYA 4FONA 3ZVKA 2XT0A 3U9TA 4QLAA 1V48A 4K6FA 1XQYA 3FKSA 1ZL0A 1UD8A 3C5EA 4CQJA 1UPFA 3A6HA 4CKBB 4L2IA 1XP5A 2XTMA 1NXQA 5IYPA 5IP5A 1A72A 1TO2E 3F49S 4FYJA 1C5KA 3L7YA 2CWDA 2R65A 1RYDA 4KXYA 3E48A 2I4NA 3OQIB 3QVMA 5T4FA 5EXPA 3TNLA 4PC1A 2ZBQA 5HF5A 1JQ3A 4RHTA 1C9DB 1S3IA 4CTJA 2EWMA 5F23A 2NSYA 1F48A 3OFVA 3I0MA 4F0JA 5IFKA 3ZD7A 5EWLB 4H3VA 3PFGA 4X3CA 2FPWA 2FSFA 5DTRA 4RSMA 5I51A 3L7OA 2IYSA 1GG8A 2NQ2C 4KGZA 2KWIA 1F7UA 2CLHB 2VA8A 1RQ2A 1YQXA 3ZE9A 2D5BA 3JAMA 3X2EA 4GIBA 1WKCA 4NU0A 3A6DA 4Q3OA 3J81A 2JZCA 2O2YA 1BVYF 3ORQA 3TZ6A 4PYMA 1QQTA 1RCUA 2W00A 2ZBVA 1EA7A 2YNMC 4Q05A 3QNUA 2CT8A 1KIAA 1QIDA 4LMRA 4FCCA 3AF0A 3IUPA 4HS4A 3TGWA 4K1XA 1OXMA 1KMHB 2GBFA 1ZITA 2IIVA 5E2IA 2VTKA 4KI7A 3UH0A 4YRQA 2AL7A 3FA2A 3UHOA 1ZCZA 4X1IB 2NTEA 4I81A 3CVVA 2HR1A 1PL0A 3JAWA 3UWDA 2XADA 4K9MA 5LMZA 1AE1A 2VT7A 4PLCA 3SYKA 4XJSA 2WJJA 3OZUA 1OU4A 2IF2A 4AICA 5FBLB 4XDZA 5LOVB 1TQ4A 4WEOA 2GN9A 3KK0A 4GS5A 3WYGA 1QVGB 1NW9B 3NGMA 1QQ5A 5L51A 5BMOA 1YHQB 4M1SA 1MP0A 3MJHA 1TFRA 2QTRA 4IEFB 4QU9A 3Q8LA 2FQYA 2NVUB 3PHJA 3AJDA 5T8KA 1L7VC 1T9GR 3LD9A 2WBLC 4NE7A 4MUJA 1NNSA 2CDCA 4W7HA 4V1CA 2G1JA 3JQ8A 1Z0IA 1YNSA 2MYUA 2FUCA 4PGFA 1FZTA 9MHTA 1TVKB 2PAAA 4JXXA 1JSRA 1EH5A 2WAXA 4ZAFA 3A28A 3COZA 3ERCA 2JVKA 2AEEA 2GLXA 2G9UA 3EG5A 5EZYA 4Q1EA 3K9BA 5DLDA 4HRYA 1Y89A 3BVPA 2ACKA 1WD5A 2DVMA 2NX2A 2J3EA 3F3KA 4X7PA 4W1PA 4KYTA 3I42A 3FUTA 4O25A 1DJQA 4ZVMA 3WB2A 1UJMA 1XALA 2Y1OA 3JARA 4UFOA 4DLLA 2MOKA 3BDIA 3QXCA 3WQHA 1NG9A 3MWFA 3B38A 3Q3HA 4MKRA 4W99A 3RBVA 5MGNA 3BCHA 4G97A 4E33A 4JLAA 3VSBA 2IE0A 3GLIA 3H5AA 4JUFA 2I2WA 4EUKA 2PRSA 1ESEA 1KJJA 3TLMA 2GEVA 2QX9A 1TMOA 1XLUA 2FPPA 3N76A 1C4XA 1NMQA 4RAOA 3GGJA 4PW0A 2G5TA 1PX2A 1KI7A 4RS3A 3RQSA 4TT3A 1N2JA 5LQKA 2GCOB 3U6BA 3LH5A 1UWKA 4N8SA 3SLDA 1W88A 3WLRA 4CFZA 4NG4A 1QH0A 4EUEA 1N0WA 1JL3A 2EGUA 3WLAA 4AWBA 5CDSA 2XUZA 5BORA 2ATCA 1KDVA 2OZPA 2XW6A 1Q22A 4RW0A 2VJNA 2GJ4A 2XOKD 1ZICA 2B4AA 3PWSA 1AGPA 4KQ9A 4OV6B 1ZA1A 3SYLA 4ZREA 2CYBA 5E4YA 1X6VA 5BT9A 4OLHA 2Z98A 1QTRA 2IWHA 1V1RB 5DM2A 1EDZA 3SAJA 5BWCA 2CXXA 4TYNA 2G71A 4PVDA 4GNRA 5B4UA 5D7BA 4FYVA 5CNIA 5H8WA 5B2FA 4TTVA 3F74A 2FF7A 4W1RA 1AK1A 3GRAA 4LRTB 1FS4A 1OZHA 1TQ6A 4BV8A 3IEIA 4EKDA 2FWIA 4QWMA 2DCUA 5F51A 5FHRA 1XT6A 1K2WA 3E7XA 1HT2E 3AHHA 4HPJB 3A1SA 3AUYA 5A0VA 2LKCA 2PH7A 4X8HA 3FCXA 2ZB7A 3HHEA 1H9AA 1QTNA 3Q87B 4JBWA 3HEAA 1DXHA 1FQOA 1XQXA 1O2DA 2C88A 2JJYA 2K5UA 4NZYA 3UAGA 4UNRA 2QLFA 1U28C 4ZD6A 1YCGA 5DSXA 1MLDA 4R8VA 4U0JA 4UM9B 1V6SA 1DARA 2QTGA 3AQ4A 4LOAA 2XCUA 5M5BA 4TQAA 1UM9B 4ICIA 3K70D 2G8NA 1TEZA 1XEXB 1ZCBA 1FL9A 3E4CA 1JIIA 5ESWA 3NUZA 4RDKA 4F97A 1VBMA 2O7RA 2OCYC 1XBTA 2XDYA 3U3KA 5CT8A 3UK2A 2I0FA 2AFHA 2YWFA 1ZC4A 1E69A 4E5DA 1Z2OX 4UHCA 2HIGA 4BEBA 3QU9A 4CQMB 1JFFA 2JLBA 1WSAA 3ZY3A 2IF0A 1S2LA 2I65A 1DUSA 3K30A 1ZSYA 1XSEA 3ZY2A 3RAFC 1N5JA 2FTKE 2YV1A 1N2EA 2ZZQA 1B6RA 2I33A 2DFVA 3RS4A 4D8TA 5D3QA 3DHVA 2BLNA 3OJFA 2VNIA 2WA1A 4DLRA 1J9ZA 4JMPA 4EYOA 3H0KA 1ZK4A 3QEMA 4FU0A 4JJFA 3NV9A 4EQ6A 1U0GA 1DC6A 1P2FA 1M2OA 1U3DA 4QJ4A 2BGRA 4PGGA 5T3UA 1F5NA 2D13A 2I7CA 4MS3B 1Q7CA 1AM4D 2X8BA 2EU8A 5ABPA 2FZ5A 1V8BA 4M9XA 3REQB 3VPAA 2J3JA 1XE1A 3FLAA 5D85A 3ZWAA 1Z6AA 3HZZA 1JVNA 1KEZA 5DO9A 1WZNA 3MT0A 3NKLA 2CMHA 3W3AD 4UEQA 3ELWA 2BGWA 4EPYA 1XVLA 4DUGD 2NXEA 4HDKB 3M6IA 4RJKA 1JJVA 2G82A 1I13A 2HHCA 4TT3D 1KA9H 3WLHA 1VLLA 5NULA 4OMFG 4OAPA 4XLLA 2VBIA 3TXAA 2FPRA 2W5UA 3L7BA 3O03A 2O5EA 2JK1A 4Q4JB 3JU4A 3ZQ6A 3IP9A 4CN9A 3BTSA 3WLMA 3G71B 1E5LA 1EBFA 1I0LA 3EDQA 3TLYA 4E1BA 3KWLA 3PFCA 2A35A 1C7EA 4HD8A 1NLMA 1XNJA 5F98A 1Y6GA 4WX2B 1UXKA 1HE5A 2Y0BA 1DKLA 1KSHA 5KZMB 1PD1A 4G9BA 1YS9A 4N7MA 4LI0A 1SUFA 4Q39A 4WLUA 1YACA 4KIFA 4N7RA 2XVXA 1Z8NA 3V48A 1T24A 1RD4A 2VT2A 5A4AA 5JNLA 1X7WA 2WF6A 3INNA 4ITVA 5JTUA 1MKYA 2H31A 1VF7A 3CSUA 3P2KA 4Z4GA 1VZ3A 3GFGA 4RVDA 5AVUA 2VTDA 5CM9C 2FW0A 3HCPA 2C77A 3H17A 3CISA 2JG3A 1Y3IA 1DDGA 1YO6A 3JTEA 3UMGA 3DULA 3CKYA 2X7XA 3M9XA 1YC5A 3DKIA 4ZDIA 3B1ZA 2PIAA 2N9UA 5E1BA 1QR2A 3V8QA 4CDMA 1CLEA 5MF6A 2R60A 3ZG6A 5CYFA 3VDRA 5A6SA 1JDSA 3VKFA 4IKOA 5K09A 5KYNA 2O5RA 2QJWA 1J9EA 1D4FA 4BFZA 3TIIA 3ZLUA 2DOKA 4X71A 4ZOQI 1RBZA 1TX4B 3RC3A 1Q3HA 1EFRA 1XEAA 1QXSA 2LKDA 4FW8A 3PVSA 3X44A 3GIWA 4YYEA 1BXRA 5KVCA 2QHXA 3JS5A 3HB0A 2FRDC 4M36A 1WAMA 4A15A 3H7AA 5T6MA 1FFYA 1V45E 1Z56C 1L5RA 1USVA 5B2EA 1OZFA 3DLBA 1NXSA 1Q14A 3L46A 3RTEA 3ZHCA 5A6SB 4NMWA 3ZHSA 4J29A 1H6AA 4XONA 2QAIA 4NY1A 1MJNA 4RDHA 1LW7A 4ZAGA 2IE8A 3M2TA 2ID9A 3KQVA 4QD3A 3LYUA 4Z3KA 2XNDA 5GV8A 1HTWA 3CA8A 4S1NA 2EQ5A 4BWGA 4EX7A 5AM0A 1FP1D 1VHWA 2W8BB 4C7OA 5JPDA 5K5EA 4IYRA 3P4UA 4D8UA 1PBTA 2IY7A 4G89A 5H3HA 3KQKA 3A1FA 1R0YA 1EJ6A 2N46A 4ZZ0A 3Q9NA 2HFJA 5I8PA 1KIFA 3NBUA 1G8MA 3W5JA 5DS0A 2ZU0C 3K6RA 4WKPA 5KX5B 5KYTA 5DW0A 3KU1A 2OAQ1 3HCEA 3HBLA 3VSDA 4K9LA 2VZEA 3GAMA 3LNTA 4HB3A 4BCBA 1RKXA 1U63A 1W9HA 2YN4A 3MGGA 4JQZA 4UVDA 3QEAZ 4LQCA 1KPGA 3GDHA 1V7PC 2LVBA 1Y48E 3TB4A 2JVJA 5BN5A 3P9ZA 1I2CA 5AW0A 1SB8A 4Y9SA 1ZCJA 3SVLA 5JHHB 5LD2C 4Q4JA 4BO9A 3DTTA 3OLZA 2Q1UA 1YONA 2DT8A 2H7YA 1A27A 4ZMSA 1T4MA 4D4LA 2W0MA 1IN4A 3E7WA 3P0RA 3AF3A 1RZUA 3QVSA 2CJYA 2ZETA 2OCLA 3LQ1A 4UM7A 5BNFA 1TKRA 5CFPA 3WBJA 3DHWC 5KTNA 2X19A 3DLPX 3ADBA 1AKWA 1XE3A 2L69A 1U02A 2AKAB 3O74A 4OXYA 2FVGA 1U9YA 4BMOB 4U6QA 1MDBA 4JC0A 3I3SR 4BNKA 4DRXA 3JQ7A 3ZXYA 1IOVA 1E18A 3HUFA 1JUDA 1H05A 1QCYA 5F52A 3M4NA 1A82A 5JYBA 2QV7A 4BDSA 1CIVA 2F9MA 3AFNA 4J9UE 3CQ9A 2SHKA 4NBSA 5JAZA 3K70B 2C4HA 4YEDA 4CQMA 5JZ9A 3O82A 5CX1B 3BDAA 2X0EA 2AFHB 2OPBA 4B32A 1M72A 2VATA 4ZAYA 2V7VA 1YJAA 4JJ7A 5KJEA 3RUCA 3RU9A 3ZWNA 3PRHA 3MT9A 4DREA 2JIRA 1M2NA 1OSNA 1JZTA 1XU9A 1LS6A 3IA7A 3PHGA 4KWIA 4N6OA 4QZVA 3DT9A 4H7JA 4CEJB 2GF9A 5AM1A 3W2EA 3H3JA 2WP8J 3ZIDA 5HIJA 5CXQA 3ZD8A 1DIAA 2EW8A 2W43A 4HDQB 5JXWA 4UBLA 2DUJA 2PU7A 1GRRA 1H93A 5DK6A 3AEKA 4DR6B 1S7GA 1FJ2A 1Y98A 4AL4A 3ANMA 4B3JA 1WB6A 1N05A 5FDFA 1E6WA 4R84A 4CCYA 1WHSA 1XOIA 1SUBA 2A9QA 2HWWA 3MPUA 3TVDA 1S02A 3OU7A 1W6RA 2IX3A 1Z8DA 1GCGA 3ORYA 2QL7A 3FMOB 1BN6A 1GV1A 4JJIA 3AHIA 4JI7B 3G5MA 4Z8XA 2Q5FA 2P4SA 5M2QA 1ZVVA 3WB1A 2A9FA 3V6LA 5IN4A 2QM0A 4MXDA 4JUDX 3W06A 4GP7A 5DXAA 4BO5A 1UD5A 3W9SA 3CR3C 3Q10A 3D6TB 4OHUA 3IEXA 4JFAA 3TLGA 1OV4A 2BF4A 1MC4A 3HBJA 4Y2QA 3GIDA 2HHJA 2RJ3A 1T34A 2UXDB 5KTYA 4W8HA 1G2QA 2H9YA 3OKAA 1Z0KA 1UXGA 2IEBA 2ZEJA 3HJTA 1FU7A 1OLUA 3ZZ0A 3BH6A 4X07A 1OW3B 5DB4A 1W88B 5HIIA 3V9PA 5L53A 1G1AA 4LYFA 4R4JA 3IS3A 5JNUA 1N0IA 1NL3A 1FDRA 3BJIC 5CURA 2FZLA 3A1VA 4INAA 1Y34E 1JFSA 2FX3A 1JHQA 2X1LA 3GN1A 1KOGA 1F17A 1UXOA 1YHYA 2R00A 1RM0A 1U5BB 1V71A 2R9VA 2YV2A 3N2KA 4KPUB 5AM5A 4D3DA 2FMFA 4P54A 2NXWA 2P4HX 1ULSA 4GVLA 1V8DA 5A4KA 2PQMA 5IUKC 4DSOA 3R3VA 2HLDD 1BU8A 1NXPA 2WC1A 4FILA 4E5MA 1PT8A 3MLAA 5HMLA 1VLYA 2OHXA 4NIMA 1PD0A 1E99A 4RQAA 1U4NA 4X63A 1E1YA 3X43A 4D99A 3HRIA 3KT3A 2HF7A 4PZUA 3CB2A 5HRUA 5FWDA 3MS2A 2LV8A 4FYXA 5FIUA 2WWXA 3HP4A 4R69A 3X1YA 2GXQA 3D6VA 3UJ6A 1VLJA 2AJTA 2V98A 3Q6IA 1VI6A 3E7DA 2Z09A 4OXXA 1GPBA 2X1HA 1OAOA 1R64A 1USUA 3AETB 5F7XA 1VGVA 1WPQA 4J7UA 4Q3EA 3VX3A 3VH4A 3WB0A 3EXIB 3WRYC 1NUSA 4AYXA 4LYEA 4DC0A 1N4DA 1XG5A 2ZRCA 4B2IA 5CB0A 1YKGA 4YI3A 1VQ9B 2C2XA 4ZZ1A 5C5IA 2C0QA 3FYUA 3DEAA 1Z7BA 1V35A 2A1TR 4OUKX 3WHKA 2HMSA 1CUXA 1AN9A 3WWPA 3TZKA 2VCYA 3GRCA 2C4VA 1URPA 3W78A 2V97A 2ECOA 3LRPA 4Y67A 1MN6A 4D6XA 1SHJA 3HCWA 1WTHD 3AR8A 1AC5A 3NP7A 4LSWA 3A4TA 3BEOA 3LKDA 4LGCA 4LZJA 4V3CA 3RVJA 7GPBA 5AVZA 1J0XO 1ISPA 1EUCB 4RD0A 1EVZA 4RADA 4EG1A 1XMQB 1OVGA 1I4WA 3IAFA 4LYHA 1KR2A 4QODA 2EG5A 3M5DA 3PR1A 3KYJB 1BFKA 2J87A 3WRWA 3PGA1 5JALA 2WFZA 1FSGA 2CUNA 1Y9EA 3P32A 3PEEA 3X1ZA 3U60B 4FMDF 3ZEIA 1JNYA 6NULA 2O50A 2OLKA 4QAJA 2QX7A 3OLVA 4ZMRA 3SOZA 2RH5A 3VKGA 2G77B 2WYHA 1V9CA 3LC2O 4V0NA 5ALDA 4EHAA 4RGVA 2J85A 2H2IA 2QRGA 4EI8A 5M04A 1NV8A 2V4ZA 5J23A 5IJXA 4I1UA 1XHLA 5DWDA 3D1LA 3IJEB 1ID8A 5GONA 2X1VA 4P2NA 1JH8A 4O33A 4X6YA 3G9XA 4LGMA 3HNPA 5DPMA 4RTOA 1S3SA 1NV9A 2VRCA 2VHJA 1WCIB 4L9AA 3RIHA 4ADSG 4E2XA 4NZNA 4JLVA 4WY8A 5G0SA 4ACBA 1ODFA 2EJTA 2HO4A 1W1WA 2FY8A 4Y6RA 2FCAA 5H80A 2WUEA 4J0IA 4JY7A 1PR0A 1ECPA 1ENYA 4D0NA 1GPAA 3AVQA 3U3JA 2AWOA 2EKDA 5L7TA 3NVKI 2RGXA 4BNWA 1TM1E 1BN7A 1BS1A 2JI6A 3CLVA 4KAJA 1FDWA 4KZPA 1N78A 1CJTC 1KYYA 1BCRB 3HMKA 2YZKA 4OH7A 5A06A 5JAIA 2NU6A 1L5FA 1YZTA 3LPDA 4QJIA 2YDYA 1L4LA 3ZE6A 3KJIA 2VYVD 2XQJA 1QFXA 4GKBA 5AJUA 3TGPA 3A35A 1NVTA 5KW9A 3U2QA 1Z6XA 3UK6A 3I3OA 3WISA 2J0VA 4XR6A 1NVWQ 3OFND 1SBTA 1IN1A 1FMCA 3UGTA 4JCOA 3LGAA 2AEFA 1IAVA 3CC8A 4MVJP 4WOCA 5KMGB 5F4MA 2Q8QA 1Q1AA 5DBIA 4M87A 3QITA 3D2AA 1NONA 1N07A 4XH9B 3GVJA 1Z6GA 5F33A 2REOA 5LYJA 1VLVA 1QPGA 2IUYA 3FI0A 2QYOA 1ZOPA 3TOXA 3OE7D 3WA6A 2QW1A 4D9FA 1N33B 1G21A 3GYGA 2CXHA 3IDAA 5E2BA 2WF7A 2NO7A 4YRZA 5KC9A 1J09A 3GT7A 3SDSA 1F9AA 1T9BA 5AKZA 3WAKA 1P3JA 4Z4ZA 3REOA 3UEOA 5MFZA 2NP6A 3EQ2A 4PS1A 3V2UA 4WY5A 4F71A 1XL1A 3PX3A 2DHDA 3AJRA 2NZ8A 4MPTA 3OZRA 3KTAA 4CV2A 4EUSA 1JQEA 1LBIA 5KWEA 2QDXA 2WAYA 4BEVA 4OQDA 1EP9A 1VIMA 2JGDA 2QT1A 1MUUA 1BEEA 3ETEA 2GF0A 1B8PA 2QORA 4CFYA 1XXHA 2NT4A 3H84A 2GN0A 4BU1A 4DQXA 4JL8A 3VTFA 3SXUA 5EPUA 2Z2IA 2H5IA 4IWNA 3RK1A 3OJCA 4AZ3A 2XCRB 1NZFA 2A2ZA 4OHXA 3KEFA 2BGJA 2IOFA 1N2CE 4FNAA 1CY8A 4DFDA 1Y0BA 2D3LA 3LO8A 2RCNA 2RH9B 4WXYB 5AUPB 4ID3A 4KIGA 3LW7A 3O3OB 1F2UA 1WB5A 3OZDA 1EG7A 3SD7A 2BGLA 3SGLA 5EHZA 1EDEA 4Y1RB 1F2TB 2O0JA 3VPFA 4R1NA 4XDHA 2CFIA 3A14A 1JYEA 4KW7A 5HBGA 4NE9A 4EHKA 4JLNA 4E0BA 4EYEA 1UC9A 3MMZA 4FS8A 3F5DA 1H66A 2PH5A 1Q77A 1LBQA 4M1ZA 5DH9A 1DXQA 3FOAA 3GBSA 2G5CA 4RVNA 3REGA 1SBCA 1DFGA 1Y8QB 4R71A 5CDYA 1ZRHA 5COQA 4DNOA 4DBLC 4A36A 3GIRA 3LLUA 5KTKA 1OLXA 3W4JA 3ZBPA 5HTKA 4YAWA 2CMDA 2O4CA 1SUAA 4M7OA 4WBNA 1MPTA 1JLKA 3ZE1B 1XWFA 2JIPA 2QYHA 721PA 3HXQA 3FTEA 4LRYA 3TCXB 4A03A 4K88A 5A3JA 2XKBA 1E43A 4RLQA 4G4IA 2O14A 4IAOA 4O4IA 2XQVA 2E5WA 5HA5A 5LBIA 1G8GA 2PKRA 1GY8A 2K6GA 2PT6A 3MERA 2PZEA 4JVMA 1E6UA 3ADOA 4MPJA 3TLAA 2FNAA 4DIUA 2QN3A 1CEQA 1T9GS 4L3OA 3ITNA 5DM70 1KC3A 1XL0A 3MFQA 1KI2A 2XOKA 2E48A 4MLZA 2QM3A 3ER8A 3DDUA 3KOYA 1TMGE 3PDUA 1XZIA 2QRVA 5C7LO 4HO1X 4RABA 3DDYA 1GTJ1 4TMKA 3SS7X 1ISRA 4EW3A 2WB4A 3LRXA 4EW2A 1X7YB 1OT5A 4KRGA 4I08A 1VPLA 5GGXA 3SFTA 4RGYA 3RVSA 5AIAA 5IYQA 5JNTA 1J0EA 4NCJA 2EX4A 3C3DA 3FMPB 3SU8A 1DJMA 1M10A 1EDBA 2AN9A 3G2MA 4WZBE 5K3OA 2QR3A 3X0DA 3A1UA 3DCYA 5FLKA 5ICSA 1I18A 4KQJA 2JCBA 3TDMA 3WK5A 1YZKA 1HE2A 3EXG2 1XU4A 3HDGA 4LC9A 4WPGA 5K8JB 3BA6A 4JWKA 4H4CA 2HDHA 4HNRA 5FX2A 2CFSA 1B6GA 2FW9A 5TT1A 4QBKA 4EB0A 1GKUB 3NDIA 4N40A 4M1EA 4U63A 1K98A 1L5MA 2EJBA 4ML3A 5C8XA 5CCXA 3HU2A 1YL5A 5BVGB 1XA3A 2ETVA 3K2QA 2DLNA 3E5HA 4UU7A 3EF1A 1QP7A 3ZWPA 3C4JA 3O9VA 4IINA 1IN6A 2E89A 4FHCA 4MQFB 4OPVA 2V7TA 1NMSA 2GBGA 5B7GA 3QLVA 4ZTZB 5A2GA 5B3JC 4NE2A 4QEDA 1WMDA 3JZFA 2J0EA 4NQRA 1IVSA 2OESA 5DEOA 2BR4A 4DYDA 4KREA 3ZPXA 1RXUA 1V9SA 4LY0A 1ONOA 4YJGB 2HH9A 1TRHA 4HMOA 3U61B 3TD6A 3EPKA 3QFRA 1L9XA 3CPEA 2PMFA 1L4NA 4B76A 4Z4IA 1EJ0A 1K06A 3ZH2A 1QS0B 5HTOA 3N2YA 3T34A 1A95A 3QUAA 5AJZA 3TW4A 2O6LA 1E96A 4ZI7B 3EODA 4MW9A 1E7MA 2NNWB 3H7IA 5BW6B 1ACLA 2AFIA 4MUKA 5H02A 5CUQA 4DXHA 1D6SA 3UB3A 4EUFA 1TUIA 2GPJA 1U6IA 1ZGGA 1M8PA 3G2IA 3I4LA 4HFMA 3B51X 3TAXA 3V46A 3CVWA 3L1KA 4NABA 1TZKA 2P4UA 4L4RA 3RUEA 2G5GX 4JCCA 1A9TA 3QKTA 1AX9A 2HBRA 4YYZA 3PYXA 1IXZA 1JLLA 2PS1A 3EAQA 3GEIA 4R3UC 1RIFA 3TIFA 2ZAMA 2G80A 3DL4A 3ZIUA 2WJHA 5IC5A 3E9EA 4LX8A 3T1YB 2GNPA 1DT3A 1XTSA 1J8DA 5DTJA 3PFFA 3HN6A 4LRXA 1PJTA 4TX1A 1SZDA 1U9IC 3DO5A 4NZ9A 2KW5A 4HKTA 4DK1A 1RXIA 3IVXA 2OFPA 2EIHA 4F92B 4GT1A 3UT5B 3BXFA 3VTKA 5IEJA 3IV7A 4Q4LA 5HQ3A 2ZBPA 3BMCA 4UM5A 4HX2A 3ZLTA 4EMSA 2H59A 5K4HA 1OFIA 1XQVA 3ET4A 3HFSA 3WC4A 4FOOA 2HU8A 5YASA 3GRZA 1M0TA 1AHNA 4IXMA 2OR3A 2WWGA 4J4HA 4GZ6A 1M7HA 3L8DA 5AHKA 4A5SA 1SUCA 4ARBA 4FWTA 2JATA 4XM0A 5IHXA 3RUAA 3W0LB 4D57A 5I7UA 1M5RA 4ND1A 1TQ2A 2Z9DA 3H1FA 2D5LA 2J33A 3VOTA 1FNDA 4BNXA 2J31A 4TXNA 2IWRA 2AFRA 3VPCA 4C89A 3AY0A 4XASA 5G40A 4LJ5A 2VF5X 1F9EA 3VKUA 2ZULA 1D0VA 5G1PA 1VHTA 1PHPA 1RJ9A 2DWCA 4J9VA 5JISA 4H1WA 2W6NA 2W6ZA 4WECA 1PE0A 4Z3OA 2LBPA 3AC0A 1LH0A 1E2GA 3DBHA 1WNTA 3SHVA 5CFMA 5KKNB 3AU9A 4DJFC 1NJ6A 2HA5A 1GWNA 2NPOA 2PKQP 1WU7A 4NK5A 4NENB 1YDEA 1YR9A 4J1TC 4L6IA 5HJ2A 2FZEA 4ZYUA 2F3PA 5FUYA 5FO1A 4ND4A 3RYFA 2X42A 3NGXA 1L4UA 4I2VA 2B20A 3C2QA 2HLPA 1AN0A 3NNNA 3G3EA 4CCYB 1OZGA 5B7PA 3WK6A 2JAHA 2R84A 3PFBA 3AFIA 4F5YA 1D2RA 3PEFA 3L77A 4CKZA 5LUAA 1COZA 3HL0A 5J4VA 1Z0SA 2D0DA 3ELBA 4R7TA 2O3SA 5IXYA 5BRNA 1ZIDA 1I2AA 3ZE7A 1U11A 2BFOA 4JMQA 1JWAB 1NVEA 1AF7A 4IHAA 4Y2XA 5FYQA 3GPDG 4ETWA 2EGHA 1YXMA 2AZDA 5HYVA 3KD2A 5E9QA 2BKVA 3GA5A 2YZGA 5A71A 3EC1A 5DLYA 4NNJA 1KJNA 3RSQA 4DCMA 5H1YA 4ENPA 5E6SA 1ZUNB 2GWHA 5BV0A 1G5QA 5HVNA 3KO8A 1V0JA 4Q6BA 4P98A 1BHQ1 1MQ9A 3FLMA 4KAAA 4PG7A 1SKUA 1M75A 2QF7A 2ZBUA 2ZJBA 1SXHA 5EJEA 2JCVA 1RJDA 1DJPA 2ZUTA 2BGIA 1JPUA 3B9BA 4K26A 4DAEA 3H4VA 2FMTA 3EZGA 1JA9A 1YIOA 2BMJA 2FVXA 2Y4NA 2QK4A 2JAUA 2ZB2A 3FWPA 3K0KA 3PNOA 4IJ5A 3SSNA 4QVIA 4GBED 4IJ6A 3NC0C 3TO5A 3D3WB 2P9FA 3THYB 4KU4A 3K92A 3NHPA 4FW9A 2FN3A 4UZEA 4PLWA 5ALZA 3UFXA 3IUNA 5ICFA 4UVIA 1MO5A 2ZATA 3Q98A 4QT0A 3ZOKA 5DCWA 1RAHA 2V7GA 4OXNA 3RM3A 3RW9A 1RQRA 4ZCRA 5JD6A 4NK4A 3W4IA 3MXTA 3EQ9A 4Y2HA 5AW6A 3ZKWB 3ETLA 5T6BA 3S4YA 4A8JB 4AROA 3D4IA 4CT4B 2YDXA 5TR9A 4Y0AA 2POQX 4FXUA 4M0KA 5LMCA 5EMNA 1ZX1A 4DIOA 2CWWA 3F0TA 3O8BA 4B6GA 4EBFA 4DUYB 3ER6A 1VLHA 2QTAA 4UTXA 1HURA 3W2GA 1EHCA 5DZSA 1J0CA 1N5IA 4DAOA 3RDPA 4WK4B 4LKRA 4PQRA 5K4AA 2C9YA 3K8OE 2VJMB 4QARA 5EGNA 2V7WA 4KUGA 3COVA 2C03A 1TIBA 3L6RA 2JD1A 4LOKA 4MS4A 3TLEA 1QGAA 3RU2A 1G9XA 5IXSA 4I2NA 1PWYE 1Y5MA 2WTBA 2P2LA 2LZJA 5A03A 5FL7A 3T3GA 5AK4A 2A3RA 5CB4A 4XIYA 3T7JA 1IIBA 2PUVA 4CUJA 2HJHA 4J1NA 4QIHA 3U3OA 3WK7A 3EJWA 2R4UA 3KVOA 3S0JA 2ZWOA 5HJ5A 4ENQA 4FR5A 4JROA 1LDEA 1C41A 1T3HA 1MTZA 1IBSA 5AN9A 3JAKB 1MJ5A 4ZT4A 4IIUA 2V3VA 3Q4GA 3ZE2B 1I14A 4MQMA 1E1CB 1GKKA 5JPCA 4BMXA 1KO7A 1ZR4A 4HNHA 1NW3A 2RONA 1GG9A 1WE2A 2XOEA 3V7NA 1DSSG 3IYLW 4KLCA 4O1MA 2JBAB 1D2CA 2XPCA 3LPNA 2D1RA 1P17A 3PU6A 3QFCA 5JNVA 4DNRB 4IFIA 5HRAA 2D7DA 5F1KA 4WKNA 5KTOA 3VISA 1E79D 2IV2X 4DLYA 4XGRA 3EZ6A 1KAMA 1ZQ9A 2IVZA 2PZ8A 1DQZA 3SFVA 1UZMA 4EGFA 1ZBDA 2W6OA 1XVVA 3FNHA 3CCJB 1FYEA 3A3PA 4XTCS 2EZUA 2YJZA 3QBDA 4IIDA 2H08A 4WZAB 3BWXA 1GTL1 5JZSA 3VPHA 1LTKA 3FBTA 1E20A 3PZRA 4H4DA 1SHZA 4LXUA 4KLZA 4ZCLA 4QICA 5TLSA 2ZE5A 4BFYA 1WXQA 2AXQA 2JEYA 2PANA 3RYFB 4P38A 5HPYB 2JLQA 3G6KA 2IFTA 1SQSA 2FU5C 3HHPA 3ZI4A 2HRBA 2P40A 1ZS9A 1ZJJA 1BXZA 2Z2JA 1Z82A 2OHGA 3AHEA 3SKXA 2VLIA 3UOAB 4CLDA 1ECFA 4QSHA 4JXKA 3W5UA 2XUGA 4C3ZA 1CLUA 2KLHA 2F4NA 1K3FA 3DDOA 3NC4A 4KDEA 5C1DA 2I76A 2Q8NA 1Y3CE 2HNAA 2CYAA 3D54D 1N9GB 3L2OB 4N8DA 5FBKA 3HUDA 5FPSA 3RVOA 1YRAA 1E4OA 1P0MA 1AKTA 3DLIA 3H13A 2VJQA 3FPBA 4D4MA 2AKYA 5LMNB 2FB9A 2XTNA 4DARA 2M6RA 4WA8A 2XBMA 3C15C 1P4MA 5J3OA 1U3TA 1AQUA 1MBZA 4AX8A 1N5KA 3Q11A 5T4BA 1PQYA 1GNQA 4YC7A 1YR3A 1U2GA 3ZD9A 1YIAA 1K7FB 3OD1A 3MHPA 1WVMA 2CE2X 4EX6A 1ZI8A 1GDDA 1XJWA 3FTDA 4KI0A 4X7MA 4DANA 1KP3A 2BZ1A 5GZ3A 2FGJA 2XDQB 4PYLA 3PXAA 4EKEA 3ZDYB 3BFPA 1W73A 2ANCA 2C29D 4KQFA 4KXFB 1LI7A 1N3YA 3HNOA 4HN4B 2Y71A 2JGEA 3G2QA 5TQJA 3W1VA 4D80A 1XMSA 1HLDA 3V3KA 4B7XA 4P5DA 3M6MD 2J4CA 3QPDA 5CDFE 2CBXA 4YVFA 5JC1A 4YUZA 1ZU5A 3A2KA 1XZMA 3G17A 3G49A 4KVZA 2W98A 2QU8A 4L8LA 1ONSA 1DQYA 4BVHA 3C87A 3PDIB 1UP6A 1WVIA 1EGVB 2QGFA 4F21A 1LA2A 2JFOA 4KUEA 5J4KA 2EQAA 2HXGA 4M9UA 3QVWA 4H9GA 2C5HA 1Z9BA 2HRDA 4DWOA 1N8RD 2G72A 4QUJA 1GZVA 2AI1A 5FUXA 4JC4A 1WOOA 1V5FA 1E64A 3L6EA 4XN3A 5FA6A 4X1OA 1LSSA 3M3DA 2WSSA 4WNIA 1K6XA 3SCZA 1LVUA 5EOVA 3AB3A 2CC2A 2NUBA 1JU3A 2F17A 1B8OA 4UMDA 1DV1A 5A62A 3RIYA 1M67A 4EKYA 3C85A 3HU1A 3SM3A 1FJXA 2VIIA 1PJ3A 1NRKA 5KOHB 4MQEA 4WKGA 3HWSA 1AGYA 3JWHA 4U7GA 4XI9A 3AR2A 1A1SA 5KINB 2QG6A 4L08A 1YJXA 4RHYA 3ZCRA 4WK0B 3UNXA 5EPEA 3VZPA 3NIGB 3IV9A 1VIVA 3L93A 4HH0A 2VAPA 5L3QA 1EUZA 1QUEA 1TIPA 4Z0NA 3B78A 2JJMA 4PPFA 2VJYA 3DE5X 1FSZA 2FP3A 3DC7A 5HE9A 5IT9A 2GAOA 5CXUA 1TXGA 2IYYA 3KB6A 1O95D 5ENDA 5K0ZA 1WP6A 3LCVB 2JRCA 3CZCA 2FSVA 2MSLA 2YYSA 3ZJUA 5GQSA 1KI9A 2IYOA 3OH8A 1PF7E 1RPAA 3AONB 2QRQA 3B36A 3Q6NA 4UPVA 5TARA 3W90A 4N0MA 4YWJA 3BTUA 4E5NA 4UASA 1L7XA 4B74A 3I37X 1NQAO 5F2OA 5IYZF 2GH1A 2J46A 3LO5A 2QG9A 1PR4A 4XM2A 3U0VA 2XXAA 4A8JC 1VCMA 2GRAA 4M55A 3NPMA 1UJ5A 4U2BA 1XFAA 1NFQA 3D64A 3E3NA 4GOLD 4BQSA 1J0BA 2BTQB 4C04A 3NHBA 1H1TA 2P9EA 3BXPA 3KAKA 2IK8A 3F8SA 4UNPA 4N18A 1D9XA 1H6DA 1TU3A 2DE0X 1U3VA 3WGIA 4LHYA 2I6SA 1SUIA 4D9HA 2P3MA 1LV8A 1VDZA 4ZCIA 4TS4A 4UHJA 4UBOA 1GA4A 2QE6A 5ILGA 1PJ8A 2FFJA 3E53A 4AUKA 2GQ0A 2Z2XA 1T2NA 1QYVA 2XE7A 3N0VA 5A89A 1A7JA 2JCGA 3MJRA 3PG5A 3C6YA 3R5JA 3WGHA 3ZGOA 4LF4B 3I64A 1KBZA 3PNKA 3BHMA 4FZVA 1QX3A 3OT1B 3EVEA 4AZ0B 1MQSA 1Z0UA 5FNVA 4ER7A 3RC1A 1S2OA 2CMKA 2EDCA 1D1SA 3OZEA 2ZJ0A 3N87A 4FDMA 1D4AA 3PQFA 1LW6E 1BMQA 2IEDA 3RPEA 3QE2A 3B1YA 1ZP6A 2BDTA 3GU3A 3GUUA 1FFHA 2GJSA 3KXKA 1TKCA 2ZRNA 4IMRA 4IYJA 4KFCA 3B1KA 1E98A 1R2QA 3RRXA 1W25A 4TTQA 2WEKA 5AOVA 5EESA 4IGKA 1UOQA 1KRXA 2ZYWX 3PQ6A 2O05A 2OB1A 5TE9A 3WL4A 4HV4A 3UBMA 3BH4A 1XZQA 2RH4A 5ALNA 4DPLA 1KEEA 2PEYA 3IXQA 4BV9A 2PUTA 1T3GA 3EVAA 2OXRA 4YAFA 2FX5A 4Z9AA 3O90A 3MS4A 3T5TA 4AMBA 3G2PA 1YFZA 4P83A 4J7XA 2R1VA 1PSWA 3BTOA 3SC2B 1K4YA 3C14C 3HJNA 4ZEMA 3CCEB 2RI0A 5GMOA 2C31A 3GD5A 2H5LA 3BPSA 5J43A 1Q91A 3IVCA 1G7SA 2YUTA 3DZIA 4O4JB 2IU6A 1FSSA 1RADA 1BOOA 3ZZ1A 3GLSA 3DE6X 4TMXA 3HKDB 3DPIA 1SELA 2A8YA 3MWEA 5KNDA 5DV9A 4OX9B 1YB7A 1UD4A 2V31A 4DDVA 3ZIAD 3M6VA 3THXB 4KV9A 2WKQA 2KHZA 1OCEA 4D43A 1WZIA 3GLFA 3PQ2A 1E0DA 1VPEA 4NR0A 4J0DA 2IHZA 1OAAA 1JDTA 3FDXA 3A2LA 4FOTA 4CIWA 2P6RA 1PL7A 3EMKA 1OREA 5LXTF 2FUG6 3LQYA 3ZK9A 1G21B 3WV5A 1MO6A 2YIJA 5CNKA 3TINA 3RYCA 1SQFA 5J2UA 1PEYA 3ESAA 5KQMA 1G3RA 2QPAA 2UUCB 1EEHA 2ZYVX 1IQUA 3DE1X 2PX8A 3SHQA 5HKAA 2GXUA 3TTTA 4RXUA 1C81A 2X5JO 3NOXA 3SVTA 3JQPA 4TKOB 4ESEA 1B14A 4AY4A 5I8ZA 5LQCA 4RVOA 1G0NA 4V38A 2JH9A 4LXXA 2J3DA 2H2FA 4MYRA 3CM0A 1FQWA 4QELA 2QQ0A 2HWYA 2PBFA 2QRPA 5IH3A 4BP8A 1SQ0A 3G6WA 3L7AA 3VNRA 3ONYA 1N2SA 1NQVA 4QGBA 4ZQEA 4J0FA 1K8ZB 1Q57A 3CZ9A 3FJYA 4ZJZA 4IS2A 3M49A 3QPCA 3IDSA 2QYSA 1L8QA 4UQPA 3PB3A 4HTAA 1PFKA 4XLTA 4BWFB 1NLZA 4BQOA 5JI2E 2A57A 4R2JA 4MJXA 2FZGA 2RG7A 2X8WA 5G0UA 1AQ6A 2DU8A 4JBNA 1JSCA 5IG2A 1KZ6A 1QGOA 1ZQ1A 4TL7A 5DBFA 3QK7A 3UJBA 3FF4A 4AG6A 2W2MA 1UBEA 2C2BA 2OQIA 4PZPA 3AEQB 3TK1A 1GYRA 1SCAA 1PYDA 1WY7A 1BFDA 4XCVA 1P4RA 2QJOA 1P7PA 4EITA 5IARA 3WP0A 4YCNA 1EVJA 2B6HA 2Y1FA 4ATNA 1VQ7B 4M9CA 3ILYA 4TVSA 2ZBFA 1FFXA 2I8AA 3SJBA 3KRTA 3MGCA 5DT2A 3DLCA 3TRDA 2IW1A 2RHOA 3Q5GA 4OP3A 4WZAE 4PGHA 1ADJA 3LT5A 5AVJA 3VBCA 5EKUA 2XMQA 3OC0A 4JAVC 2ATVA 6AT1A 3OEHA 1CW2B 4QDKA 4O2LA 1QH9A 3RU3A 1FY2A 3W8DA 1AHPA 1BQ3A 2FPSA 2M5SA 1DJNA 3NW9A 5BR7A 2O2IA 5C3MA 3PA1A 3N6VA 5ALOA 2QSYA 1MJGM 1EM6A 4R98A 5H7XA 5AW7A 1JEYA 2P6NA 3KR1A 3QX3A 3B7WA 3K0BA 1YB4A 5FR2A 4PZ0A 2PGDA 2VK2A 3S2YA 1GAWA 1BKYA 3PA6A 1P81A 3SLNA 2QL6A 2NXCA 3KXLA 3PKJA 4QX6A 4RIIA 2FPGA 3ND8A 2GNAA 4XQ9A 1EGHA 3B12A 4MR8A 1YDWA 4M8NE 3RFFA 4H3SA 2VR1A 1BWQA 3PFWO 1PR1A 3IAM6 5H68A 1QP0A 4V0MA 5INTA 1M76A 1E3DA 5HZKA 2WU0A 4AJHA 1S8AA 4I1PA 4IVQA 4JOBA 2EJVA 1PWZA 3EA5A 2GZAA 5HXBA 3OD5A 4DYVA 3TPCA 3K2EA 1PLKA 2PRJA 3Q8XB 2BONA 2FCRA 4XB2A 1SC1A 1CJVC 1R5JA 4A0RA 4TKUB 4UOEA 2YZNA 2K87A 2PMEA 1TM7E 4RMIA 5T4EA 2WYUA 3FRIA 3H1EA 3QH4A 3AKEA 2O0KA 3Q7TA 3A37A 3PDHA 4MX8A 4TRJA 3GRFA 3TVYA 1IOZA 3MINA 2ONKA 4GLFA 1JKMA 3WIUA 4DILA 1O58A 5IM4A 1UP4A 1TD9A 3HUEA 3G89A 2W93A 3A8IA 2CJXA 2XODA 4M49A 3GVIA 3V00A 4F45A 1B1AA 4KE9A 2D62A 3OIGA 4LYDA 3LI2A 4UBMA 3TLKA 3C3EA 3TRFA 2VJAA 2WK1A 1ZPDA 2YL2A 3X2FA 1JG6A 2I99A 5FFFA 2ONJA 3EQ7A 4PXYA 4FI3C 4GPBA 3TSAA 2JBWA 1QG4A 3V8BA 1RWPA 3HNRA 3ZJVA 1W76A 2DLCX 1V3UA 2BV3A 1IM8A 1U2SA 2GZSA 3GO4A 1E3TA 2A1UB 4QRIA 3ZHYA 1C30A 2UVDA 2YRFA 1N0HA 1ZGJA 3ESQA 4Z3DA 2HJVA 4MUIA 3FGPA 2OHFA 5JLAA 3HZOA 1T0IA 3JU3A 3T41A 4YRMA 5BVHB 5KOHA 4QGFA 1Q83A 4A8TA 4C0JA 3IILA 2QSZA 1Q0TA 2GM3A 3HWWA 1MEOA 1EVEA 3STXA 3PIRA 5HKBA 5BSXA 4NAVA 4JLMA 1RPZA 4L5JA 1XWWA 5FAKA 4R9NA 4Q47A 4XD7D 5JXIA 3U16A 1NZJA 3NVMB 4BLTA 1MW9X 5AOBA 4C6SA 3LYHA 5LQAA 3AP1A 1RE0A 2BYTA 5EJ6A 3ZCSA 3TJZA 1K68A 1JIXA 3CZRA 4E70A 2Q6VA 2JIMA 2OHOA 1EHIA 3KT6A 3R9XA 2ZYDA 2AZ4A 2GCPA 4GM1A 4E09A 1U7OA 2BGUA 4MQ6A 2BEKA 3C3MA 4BNHA 5B5SA 4TS9A 3S2ZA 1GPYA 4MV3A 2P9ZA 4GX1A 4BTVA 2WIFA 1EGAA 1BFUA 3FDIA 1GL7A 2C8KA 3QPBA 4FR0A 5CX1A 1C2YA 2Z43A 2GN6A 4BB9A 1Q15A 1QKIA 4U7PB 4BLVA 3I05A 2IV7A 2QPTA 3OX3A 3L3BA 3TNJA 5DNCA 5JRJA 4YCBA 1J9GA 3HKDA 4UUMA 1WVGA 5B3JA 3C5VA 5F1OA 3UOWA 2OK7A 1H1LA 1T4BA 2P1DA 2Q8PA 2WINI 3E82A 4I55A 4MB2A 3HDYA 4PX5A 4B5KA 1EWTA 3C6MA 5A9SA 3L7CA 2GS9A 5CXXA 1IG3A 1TMYA 3D7SA 4JNCA 4CIVA 4YV7A 1W8DA 1XYVA 2Y68A 3C7AA 1RWVA 1EQ2A 3GC6A 3FCAA 3LDAA 3ORFA 4FNOA 3HJHA 2WDPA 4HDNB 4HGOA 1J2RA 3PFHA 3PR3A 2G40A 4RPDA 4NEGA 4YRPA 1L7EA 1N6OA 1KJ9A 3H6KA 3KVYA 1IL0A 1Y7PA 4FYMA 3RTDA 4P6VF 1JHAA 1MFZA 4XARA 1ISFA 3ZGXA 4HS9A 3CCCA 1BRMA 1ESMA 1OROA 3IODA 2NV6A 1W85B 1S2IA 2VDKB 2O9JA 1QBKC 4JS0A 9GPBA 3VGJA 3G0CA 2QMYA 4RKQA 1CDDA 1PX0A 1SD2A 1SVNA 1RMQA 3GUZA 4K40A 5LYYA 4EA7A 1QMPA 1Z3CA 3HI4A 1DDOA 2WF8A 1M1NB 1GGJA 1UAYA 3Q2KA 4IHKA 3RS9A 3IXMA 4E1VA 2WUVA 2QLNA 1P6XA 2PRIA 4FOLA 3N1UA 4JD5A 1ZC3A 4YMGA 3LY9A 1KMNA 3R8FA 4W7IA 2QGNA 1U81A 5IZCA 3EDCA 1XTZA 2YJ6A 3LNCA 2BSXA 2LRHA 3MWJA 5LZ5A 2OBBA 4DJTA 1C7QA 1XF1A 1RQ7A 4LVOA 1U04A 3I1FA 2NNLD 2EFGA 1MTOA 2KBFA 3NAQA 1DOHA 3U5TA 2W2LA 2ZZNA 2VG8A 4LHEA 4BRUA 4YT2A 1QIHA 2QP3A 4W5QA 3J7AC 1M1YA 1M33A 3O0DA 4GM4A 3KQMA 2E5LB 5AI6A 4MV0A 5DYIA 2FUG1 4MDEA 2JCXA 4TRMA 3H99A 1RBMA 4YIKA 2G70A 3MSCA 5JDCA 1GPDG 2DQYA 2BLLA 2GHRA 2ZTSA 1RYFA 1VHQA 2DZDA 4BGEA 4M99A 4D81A 3T7DA 2GEUA 4B82A 5TMBA 3AGQA 2Y1KA 3DXZA 1WOSA 5ALMA 4ZRDA 5KKAA 4U7FA 3U4IA 3S6JA 3AESB 2PNJA 5KQGA 2X6XA 1DEAA 5KTPA 2MSEB 4EHFA 1U31A 2F3TA 5JS6A 1FNSA 2C2YA 1NQXA 3NT4A 2OCBA 3DB2A 3F6BX 2BSQA 2ISQA 1KFKB 3NYQA 3NBYC 5DM60 4NYMR 3LBNA 1YD7A 3FPEA 5IJWA 4JYAB 2EL9A 4AW9A 1XJCA 4ZU1X 2NV0A 2SCUB 1G64A 1KTIA 4EHNA 3OA2A 4WN9A 2X2EA 4C4SA 1ZOOA 1M6EX 4P8RA 3IQHX 3K9QO 4Z86A 3TBKA 5BN3A 1Y33E 5J3JA 3RNOA 5BOSA 2PUDA 1UJ2A 4EJ6A 1A69A 4L02A 3O8CA 5SICE 3LY5A 5EWJB 2R6R1 4LYGA 4C4YA 2C20A 1KJZA 5E6TA 1QO7A 5KEIA 4HH1A 3PTAA 3D7KA 4C2BA 4KTTE 1Z6ZA 3IAAA 5JAHA 1H4SA 1BJTA 1OIWA 2IXEA 4BL5A 1DRKA 1P4SA 1C80A 1SY7A 2J6IA 4JKOA 4MR7B 3GA7A 2ZRGA 4L76A 4U2FA 1U0OC 3EJ6A 1A88A 2HM7A 3CW2A 1R6DA 2VHTA 4P35A 1GADO 3ASVA 2ZRKA 4D96A 2GUGA 5T3YA 5JVDA 3EC7A 4TN1A 2AE2A 4XZ3A 1OFHA 4N6NA 1B74A 3KUCA 2W83A 2BFCA 4CDNA 2G1KA 3HR7A 4RY0A 3PGMA 3I72A 4FMCB 4IJUA 3K6KA 3NIBA 4BNYA 4YY3B 3INTA 3K9LA 4N0PA 4KOEC 5ITSA 3DL0A 3GJ7A 5T8KC 1FP4A 2NIPA 2AC7A 2VUTA 3GH3A 3B1XA 5IXJA 5LD2B 3BRWA 3QQPA 2FG6C 3PT5A 1EEXB 3KZKA 5IZCC 5AJVB 2QJTA 1P72A 1A8SA 3IAM1 1ZZEA 4Y6OA 3A6EA 3TKAA 3PP8A 3KB2A 4FBGA 3OO0A 1QBGA 4OHMA 1DG1G 2J7PA 2LIPA 5KWSA 3IESA 2DKNA 2CJWB 4KYVA 2ERYA 4KMMA 1CUGA 4G0XA 5GM2A 5EIFA 4YP6A 4ALMA 2RGCA 2D00A 2PZAA 1MABA 3GBPA 3ZX5A 1NYTA 1RLIA 2F48A 1GXSB 2RIPA 4ZAWA 3V1UA 3HZHA 2JHCA 3VFDA 4BZQA 5KNBA 2P5TB 1YZYA 2Z1NA 3QEMB 5E8RA 2HW8A 5JD3A 3X2SA 4GYYA 3MELA 1KSFX 1U7ZA 3INRA 1M34E 1K7XB 4RVSA 4A73A 2I6TA 4XKJA 4E12A 4EARA 5K0BA 3U4QB 2BEWB 2DUMA 4MWTA 2FP4B 2DRIA 2VK8A 3H2GA 3WQZA 4TYMA 4JC8A 3EGDA 4LE2A 3T3IA 1EG2A 3GLGB 5BWOA 2OBYA 2W71A 3FPGA 3JZMA 4L4SA 5T41A 5B58C 1MB9A 2A3NA 4Q93A 4OYHA 4XR9A 4AKHA 5K3DA 3QRWA 1VCOA 1G55A 1XVTA 4IO1A 3ZY5A 3GAFA 1GZDA 2NG1A 2Q0SA 2PV0A 2O7VA 4TS3A 2Q2VA 1CEYA 4MVWA 1A0OA 1KJYA 4R8MA 2H1LA 2FPXA 2ZJYA 1GNVA 1FJHA 3J7TA 4OQNA 1VRVA 3FWKA 1UM9A 4P1ZA 3TUJC 1R18A 1NW5A 3FOBA 1O57A 5AVTA 2NV4A 2GZRA 5FTJA 1MCZA 4M8IA 2Y93A 2COKA 1KMIY 1RYMA 2PHZA 1YFJA 3OIVA 4AS2A 3O7WA 3A05A 2DFPA 4KRFA 1QGUB 1RPTA 4Q82A 4Y1EA 2NT3A 2CHGA 4DDMA 5ARBA 4FR2A 3FUVA 5AXAA 2QN1A 5C9ZA 1QE5A 2WKWA 1HYGA 4HG2A 1MC1A 4QUEA 3F78A 1G5RA 3UB4A 4IRXA 4NHEA 3P9CA 5JDIC 3TLBA 5TSDA 4FMBB 4F9EA 4LE0A 4E2WA 3UMYA 1IZYA 4WY2A 2J0UB 3UW3A 3TPFA 3WJ2A 3L4BC 2YWDA 4PPQA 2R6HA 2QLMA 4NV3A 4KP7A 4B3CA 1VGRA 4JR1A 1TTPB 4PVCA 4RQBA 5BR1A 3J80A 4U7DA 5B57C 2VHWA 2FEWB 2YMQA 3HJRA 3G5TA 1OXUA 2WTXA 3FWHA 1E3LA 5JO0A 1DV2A 4WFQA 3N8DA 5ALXA 3L82B 4BKMA 4JQOA 4B4VA 1WZ2A 1A76A 2IPAB 3VPXA 4D1YA 1ECLA 3GQBA 3G2NA 3JVVA 3LUBA 4X60A 3U4HA 3W8FA 3SZRA 4ZTUB 5ILQA 4B3BA 2ZZMA 3O73A 1R6UA 2Z0MA 2Z5FA 2ZQ5A 1PZNA 4FX5A 4CMJA 2IZ0A 4NYIQ 1Y8AA 4WK6A 2C4KA 4CODB 1HUQA 3CT6A 5HF8A 2JFFA 3WTCA 1JE1A 4NBTA 5EAIA 2ZS9A 3G0BA 3AHJA 3V5NA 5B1YA 2R6FA 5BSYA 3RODA 3LTNC 3HZRA 5AW8A 3RG8A 3IKLA 4KKXB 5IM5A 5KVQA 3RARA 1B26A 4OMCA 4NC9A 2VJMA 3UW1A 2O7QA 1QO0A 3D2BA 1R8SA 4DEYA 3NHLA 3NONA 3OWXA 3HG7A 3KHKA 1I7PA 4G36A 1EM8B 1N6KA 2FZ4A 5CDHA 1FDTA 2P0YA 3G6EB 2ZI4A 2O3JA 3AHGA 2IYNA 5C1IA 5KOJA 1UKEA 4OQYA 1TVKA 2IYUA 4BQRA 4UTNA 1QHXA 1SXIA 1VSTA 2VOEA 3F90A 1TI7A 1QFZA 2QNBA 2ZTLA 3M5WA 3U19A 1H2AS 3E5RA 1SCQA 3OETA 5HZGA 4Q37A 1H2RS 2CUKA 2XCSB 4TUYF 4OG2A 1J5EB 4G85A 3B1JA 3IALA 3TPZA 3MCUA 1LLCA 1ZMXA 3ZDEA 3IPCA 2RKOA 2NZVG 2Z04A 1I5RA 4HDNA 4B7ZA 1FTGA 1T15A 1OLOA 3GLHB 1E5XA 3HJGA 1Q1EA 3AUXA 1HOXA 1XQ9A 1Z45A 2GXSA 2OO3A 4PINA 3BT7A 5EJAA 3WQSB 1YK0A 4LI3X 5AWFC 3GGCA 1LC3A 1IJFA 3C97A 3JAWB 1BSVA 4PF1A 3R6KA 3WWCA 3M6FA 1QO0D 3VR3A 4HXGA 4L9WA 4DOMA 3TL3A 3DZCA 1VL5A 4X0CA 4E4RA 1PYOA 4MUNA 2OYNA 1JXOA 2FRXA 2KVOA 5C53B 4F7WA 4CMIA 3E58A 1JXMA 2VYFA 2FMHA 3IUQA 2R44A 4ND5A 4RANA 1YT5A 2FW8A 2PXCA 5LA6B 2Y77A 3M34A 3MOGA 3QF7A 5AXCA 4KG7A 1YS7A 2BMAA 4JKIA 4Y2YA 2EX0A 1S3GA 3JTMA 4LZLA 1G2PA 2VS1A 4RPBA 3HQ4O 2EKLA 4K86A 1J6UA 2VXBA 4BVKA 4FKZA 2AFHE 3GI1A 5AOCA 2BBOA 4NJMB 4K2AA 3ABOB 1W94A 1C4OA 5KHAA 1RACA 3EGOA 2Z3ZA 3PQEA 2ORWA 5KTTA 4YMTA 5EP4A 4RNDB 4HQ0A 3LHKA 4PCLA 1NJ1A 3IQDB 1QG6A 1O0CA 1XTIA 4CBVA 3GFSA 5HXAA 3A3YA 2HRQA 3MGBA 5IK2A 3ELUA 4IKPA 2WICA 2AJDA 5DT9A 1XAGA 5KTRA 1VQ4B 3UXHA 2YYYA 2PJDA 1GVNB 2RJOA 2XUJA 3CGGA 3GCDA 2QVYX 1T8UA 1X7DA 2JJ8A 4MWBA 1LFDB 1OZAA 3ZDBA 1O94A 1E89A 4N3NA 2GPWA 2HCJB 2HU2A 5EERA 1VJTA 5I9IA 3OOCA 1BIFA 4UCFA 2R66A 5F7JA 2XSZD 1N6HA 2P35A 3ECAA 3KEQA 1T2VA 4LVNA 4MIKA 1DBIA 3FTNA 4X44A 4C4XA 1U80A 2OKCA 2QZ9A 4FQ8A 5AMXA 3RRFA 4IEEA 3E9ZA 1YJBA 2DQZA 1JQDA 1C3VA 2G09A 3G82C 4U8HA 3OCYA 4CLEA 2E1BA 1ODSA 1QAQA 1R4ZA 4GMHA 3OESA 3MILA 3BTVA 3OCCA 4EWLA 1RBQA 1CKEA 4MVJH 2X8JA 3KSZO 3G05A 2XKKA 1QANA 3ZHXA 3I2FA 2HQOA 3GLUA 4BC1A 3V1TC 3RHTA 4WFJA 3IL2A 3C43A 3DJFA 4UFNA 1JA0A 5TGDA 2Q2WA 4ER3A 5IAKA 3M4YA 4LCJA 4TKUA 3AVWA 1W36B 4X00A 4LC0A 2HC9A 4YLEA 1SWVA 3DM5A 4IF4A 3IOBA 2CE7A 4IUDS 4ZI3A 4O5OA 3CU5A 3ZQUA 4JOCA 4YASA 4LGVA 3ZZTA 3Q40A 1M8GA 3L7DA 2PYZA 4OBBA 2P3QA 4XIFA 2P68A 3LZ6A 4EG5A 1RJGA 4R31A 4DVGA 2G7MC 1U2RA 4FHDA 2WFMA 4F9GA 1DIBA 5FPKA 5KNBD 1DRJA 4KWEA 1G59A 1VHDA 4IIJA 2FEAA 2QTVB 4GBMA 1GGEA 4CE6A 1H8ED 3OOSA 1V1MB 4M88A 1MAVA 4HNGA 3OPOA 2A59A 3H11B 3O21A 5ESXA 2XEDA 4L5YA 3RFTA 2O8EB 2CCGA 5L6MB 4DHEA 4FKBA 4HXFB 5BQOA 1BLIA 4WADA 4EG3A 2JN9A 4DC1A 1GCIA 1RP7A 4ISBA 1A77A 4CQLB 5GWXA 2EV9A 5SZKB 3OZBA 1IK6A 3AF1A 1H2ZA 4ZV4A 2W37A 521PA 2EWVA 1BJKA 5WRFA 4XXHA 3ROGA 1JEYB 2A88A 2XZOA 2I6XA 3AM4A 4ZODA 3BRWD 3O4HA 1ESDA 3KBOA 4X5OA 3DOFA 5HMMA 1DELA 1M6VB 5CFOA 5FUVA 1YJ5A 1UPBA 3PXXA 4CR8A 5TQ2B 1EHYA 3RAJA 4IQGA 3IUYA 1VCIA 2D5CA 4OIMA 5COAA 3HO1A 1LBSA 2D2XA 2GI4A 4BLQA 5EFZA 4L8YA 2PR2A 3DM9B 3NI2A 3P0HA 4I8XA 4I46A 3Q6RA 2W11A 5JZVA 1P19A 4HAXA 1KKLA 4FYKA 5DF1A 1VHLA 3WJ7A 1DKRA 3IE2A 3NDRA 3CC7B 3G68A 2M2IA 3GMTA 2UVQA 3LLMA 1GL9B 4HZIA 1J7JA 5FLYA 2IYLD 3T7AA 5EWMA 2G08A 2VAXA 4HGZA 2GKGA 4ZEVA 1M34A 5F7OA 4ARAA 2GM5A 3IH5A 4XUGB 2YRXA 3E27A 4Y1FA 3HB9A 4C43A 2H2DA 4JA2A 5FHQA 1PWXA 1NVXQ 1P1IA 3CNHA 3S2EA 3WSVA 3HC7A 3NIFB 4EHBA 2BH2A 1FYFA 1T36A 4MKGA 2RBEA 1R37A 2X8AA 3O8OB 3C3CA 5FPPA 3A9CA 4OQQA 5DHAA 5H16A 4IP0A 2QD2A 4OJYA 3SEFA 3HS3A 4FLMA 2JZNA 2R86A 1YK1A