2RC6A

Refined structure of fnr from leptospira interrogans bound to nadp+
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
306
Chain Sequence
PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin-NADP reductase
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
source organism Leptospira interrogans
total genus 86
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc6A02
3VNUA 2CNDA 2VNJA 1D1NA 1VQ9B 2E1RA 4AC9A 3OZUA 4ZGNB 1WDTA 4YAWA 4NCNA 3WNDA 2RC5A 1GAWA 4MYTA 3VO2A 3W5VA 1EP2B 3CCRB 4PC1A 1FRNA 1ELOA 1KK3A 2ZITA 2BGIA 3CXCB 4RD2A 3VNVA 1IJFA 3CC4B 4N3NA 3SJZA 3CD6B 1Q81D 1VQKB 4PC2A 4M4SA 1QFJA 4FN5A 3OZVA 1VQ4B 1W35A 4RJLA 2PLFA 3AGPA 1QGYA 5JBQA 3E20A 2VZLA 1QGAA 1QH0A 1W34A 4RD6A 1I7PA 1HA3A 2DERA 4EH1A 3CCSB 5DSZA 4H9GA 1FNDA 3PENA 3U2QA 2J7KA 2BVNA 5TR9A 1M90D 1EFTA 3WY9A 1G7RA 2BM0A 2D74A 2XEXA 1QGZA 2VNIA 1KTVA 1OGIA 2OK7A 1KK1A 3CMEB 3LVBA 3G6EB 2EIXA 4TMXA 1JA1A 1K8AD 2B5OA 2EFGA 3CC7B 4PC7A 3W2HA 3CCJB 2DCUA 1FRQA 3MHPA 5HXBA 4B44A 4RD0A 2BGJA 4M0LA 2HMAA 1NJID 3B78A 1YJWB 1FNCA 3B82A 3VO1A 3QFSA 2B7CA 4ACBA 4BPRA 2BN4A 2OTJB 3WNCA 1GVHA 4ZCLA 3I56B 4TMZA 3U6KA 4Y9RA 1QX4A 1QG0A 4LBWA 5TY0A 3WXMA 2YWEA 1KJZA 3B8HA 4YAOA 1VQOB 1CNFA 4B4DA 1CNEA 3FJOA 2DEUA 4B43A 1GAQA 2C78A 4C0SA 1JA0A 1VQ6B 4TMVA 4B48A 3CCUB 1E64A 4LBVA 3CB4A 1TUIA 4YHBA 3CRZA 1DARA 1NDHA 1S72B 4M1KA 1QVGB 4N3GA 4RD3A 4HE5A 4C43A 3AVYA 2DETA 1H42A 1EP1B 5H59A 3ES9A 4UAJA 4YAUA 1G7CA 1QFYA 4K1XA 4TMTA 4RD4A 1EWYA 3ZZ0A 3AVWA 4AF6A 1OB2A 5GV7A 3LO8A 4RCZA 5H5JA 1H85A 1OB5A 3LYUA 2X3UA 2YWHA 2OTLB 4Q7JB 1FDRA 2XNCA 3U6BA 1A8PA 3E1YE 2R6HA 1B2RA 3ZC3A 4YAFA 3CW2A 1KRHA 4LC0A 2PMDA 4DQLA 1XB2A 3CCLB 1R5OA 2BSAA 1AMOA 1CQXA 2QDXA 1ZM9A 3W5UA 4DQKA 1VQ8B 1YHQB 1Q7YD 4RCYA 1R5NA 5GV8A 1ZM4A 3ZBUA 4TMWA 3AVXA 1DDIA 2GQFA 1IB0A 3J81k 4Y7CA 3AGQA 3MCAA 2QMUA 2VNKA 1VQLB 1VQPB 4ZGQB 3V76A 1ZM2A 1VQNB 1D2EA 2OK8A 1KK2A 4P6VF 2GPJA 4Y9UA 4YALA 5THXA 1TVCA 4B3XA 1N8RD 1N0VC 3P26A 1DDGA 1QUEA 1N0UA 1R5BA 3I55B 2DY1A 4QFMA 1KK0A 3WYAA 1YI2B 3WBKA 3W2IA 5TV2A 2XNJA 1YITB 2QTLA 3OJXA 4F7DA 2BV3A 1SKQA 3G71B 5EMNA 1E62A 4P3YA 2B7BA 4M2LA 1GR1A 1D8TA 3ZZUA 3ZZTA 4J0QA 2FX3A 2RC6A 1YJ9B 1Q86D 2CRVA 2QEXB 4TN1A 4ZCIA 4PC6A 3JQQA 3MMPA 5FA6A 3A1FA 1TLLA 1G7TA 3CPWB 2QN6A 1EXMA 3OZWA 1S0UA 1XE1A 1W2BB 4B47A 3CCVB 1FNBA 3OJWA 3LRXA 2BF4A 3W2EA 4ACAA 3CCMB 4MYUA 1BX1A 2BPOA 3QFCA 4IW3B 4ZCMA 1U2RA 3QSYA 3W5HA 1UMKA 2BM1A 2YWGA 1GO2A 3AVTA 1BJKA 1Q82D 1KQSB 3QFRA 4PC3A 4PGOA 2C77A 1OGJA 4R71A 1EFUA 1K73D 1M1KD 4LBYA 1FNMA 1ZM3A 4ZV4A 1G7SA 5KSWB 1F60A 3CCEB 3CCQB 3AVVA 4G1BA 1JNYA 1F20A 4U9UA 1EP3B 2QTZA 1VQ5B 4FK8A 4M53A 4AF7A 3ZBTA 1JJ2B 1SM4A 1AIPA 1J9ZA 3JQPA 1YJNB 3AVUA 4WQMA 2VYQA 3QFTA 4LBZA 3OW2B 3WBJA 2BMWA 4FWTA 1TTTA 2QA4B 1ZUNB 3WNBA 2PIAA 1GJRA 4G5GA 3CMAB 1IJEA 1QVFB 1EFCA 4QHYA 3G4SB 1KD1D 2HDNB 5AN9A 1VQ7B 1W87A 1E63A 3QE2A 1QFZA 1BQEA 3P27A 1QUFA 2AHOA 1JB9A 1B23P 1KC8D 1K9MD 3W2FA 4HE6A 3I1FA 1YIJB 3CC2B 3JQRA 2YWFA 2NPFA 2HCJB 4G1VA 3FPKA 3VMFA 1BX0A 4NBSA 1DG1G 2VNHA 1VQMB 4RD1A 3W2GA
chains in the Genus database with same CATH superfamily
1IBCA 1BVYF 1UEJA 3OPYB 2DYKA 2HTFA 1FS5A 3SMVA 4FBLA 1M1YB 2AVNA 4Q37A 5CA0B 3F47A 3TLAA 1UXHA 4N8DA 5LXTB 3KR9A 3PITA 4LMBA 2G1PA 1EUQA 2YDXA 3RHZA 4YRKA 5IF9A 3DDWA 3MMXA 3O1HB 3TIIA 5B7QA 3LBAA 1JR6A 1UJ2A 5JC1A 4LZWA 1CQIA 2NXCA 3M1IA 1UBFA 3HYTA 3AB3A 4YAWA 3CWQA 2Q6OA 3A32A 2R4TA 4HDKB 5B3AA 3WQHA 4NBVA 4MGZR 4EVRA 5C46F 4Z4HA 1FSFA 2BRUA 4TV9F 2J9XB 3TQFA 1L4GA 3SZUA 5E1OA 5BQPA 3VV2A 4BAUA 3UGJA 1JPVA 3OESA 4S1NA 4S2EA 2OZVA 4TM8A 2QRMA 1WOPA 4I8DA 4QHTA 4Z9XA 3L9WA 5IYZF 3C1UA 2QM7A 1SIWA 3DMTA 1L1EA 5HZKA 3MCTA 4A15A 4EHFA 2PQMA 4FDMA 2H4ZA 1P5JA 3UT5B 3G49A 1X14A 3NNNA 1FDWA 2EP7A 3Q9UA 3BL8A 4H3VA 4R98A 3VNAA 1BEUB 1M1UA 1QG6A 2DLDA 2PKEA 2H6EA 2W2NA 2VYCA 3GCZA 4DXHA 4RHYA 1FQKA 3UNXA 3P97A 4OQFA 2ARKA 1LEHA 3IODA 5C1PA 2UZ3A 4URVR 3TRDA 4UNRA 1FQJA 1I2DA 2AI1A 1C4WA 4DNXA 1H9BA 3M81A 1V1JA 5CIQA 3KXIA 4H4CA 4R8MA 2N1BA 1BNCA 1Q57A 1IVNA 5JUWA 5A0VA 4I1PA 3C39A 4UZFA 1FVOA 1UD3A 4JX9A 4MRAA 1M2WA 4XTRA 1UKAA 3TSWA 3CF4A 3GVPA 3C6XA 4DUYB 3PYXA 4NHEA 1JDBC 1KJJA 1UMBA 1YMVA 2PCJA 4ZOLA 4L8GA 1W34A 4MHSA 2P9HA 1UXGA 3A1DA 5E6TA 1HUQA 4U2FA 2R8PA 4EH1A 1ZJYA 3D7LA 4OJNA 2XDAA 4XOUA 3VISA 5CDSA 1T3TA 4H9GA 2EVWX 4UKDA 2MSEB 2OCPA 4ER3A 2QN7A 4RXUA 3ZE2B 3OZIA 2VQ6A 4XLZA 1M90D 2C2YA 2VT6A 4RZXA 1RM5A 3LC1O 1D5WA 2Q4EA 2WWTA 4JJGA 2KI5A 4E09A 1C7JA 1PUXA 1B8OA 4JXJA 4X1OA 1E4OA 3SXUB 1D4OA 3EXFA 2AQIA 2BFDA 4KR2A 1UQRA 3ZVKA 1Z5GA 4UCQA 3PI7A 1IPFA 2O52A 3UV3A 1GFIA 4A6XA 4H7EA 2G63A 1RJ9A 1BA2A 3ZHZA 3OM0A 5EE5B 1FA9A 3I9NA 5AHXA 1JT9A 2FPGA 2X8JB 3ZOKA 1U0OC 1RR6A 2NPIA 4B7UA 3BKXA 5ARCA 3HVRA 4V1CB 1IN7A 4MRVA 1C4XA 3NFRA 1Y1KE 4O2LA 1QYVA 3HM9A 3LVBA 1R4AA 1RBMA 2FZVA 4BL5A 1RQXA 1R18A 2IZ1A 4D3XA 4FGKA 2ZSKA 1IWOA 2IXAA 2QTTA 3AHJA 4FZRA 1U6JA 3UXHA 1JFRA 5C8XA 1H6DA 5GVRA 4B3CA 3SFVA 4P98A 1H94A 4JVOA 2D2EA 3C6KA 1T3GA 4C05A 4YP5A 1T2UA 3ZHYA 3U7QB 3OHMA 4ND3A 4BO2A 1E69A 5D3KA 5KC9A 2PLRA 3HR7A 3NOVA 4AJ9A 2W2LD 3HVHA 1OW3B 5I7VA 1RHJA 2B83A 3CZAA 2C1ZA 1EK0A 1EFKA 4MYDA 3TE7A 3AEYA 1ID1A 2ORYA 3NPAA 3ONNA 4Z8YA 1TF7A 4LVCA 1Q0HA 3E9EA 4QUEA 3KLNA 4QG7A 1NN0A 1JHZA 3VO1A 4IYRA 4MEBA 3M3DA 4L95C 3FRJA 3VTAA 3R9KA 4WNCA 3T94A 4II3A 1TCVA 2DUUA 5CP8A 3W7VA 3K0KA 2XXJA 4N3CA 4M9UA 3B2QA 3HVKA 1UBMS 3CF6R 1TYZA 1XJCA 3G82C 4Q4AB 1H9CA 5M5BA 2YY5A 1QKIA 4B3SB 3AEUA 4X0CA 3PK0A 1UDCA 4AKGA 1CRLA 1N4AA 4LF5B 2CNBA 2ZK7A 3R6DA 1WTCA 3WXMA 4GWGA 3P2OA 3H5TA 4NI5A 3HKDA 1P4MA 2EHDA 1N2BA 2FY8A 2HDWA 2UVPB 2OHVA 2X22A 3QE4A 4KRGA 4TVKA 1WW2A 1D6JA 3AO0B 3RIYA 3ONVA 1YGPA 3CW9A 3QOYA 3C87A 5LOVB 5DM2A 1CNEA 1HFEL 2ET6A 3HCDA 4O4JB 3EZ2A 1Y4SA 5FXMA 2GAFA 1A27A 3O4FA 4GWLA 4TV8B 1S8AA 4PRKA 5DK6A 4R8VA 2ZIXA 4YEDA 2ZPTX 4UATA 4XQCA 3W4KA 4BBPA 2V7BA 2CT8A 3OBIA 3IEPA 2DLCX 3WO0A 3N5CA 2O3SA 4NKRA 1GTG1 4RQUA 3SQDA 4D81A 2CFOA 4LBVA 4LX0A 4DLUA 2VJAA 3CLSC 221PA 4RDLA 2YYAA 5IS2A 4ZWNA 1FPQA 1RXIA 3G9ZA 1LWOA 4E0FA 3R4VA 4WPGA 1MU0A 1MAWA 3N75A 4BO3A 1JLHA 3VFDA 2YIJA 1RXSA 4AQYB 1T5TA 2ZZNA 4V2UA 1I7QB 1SXHA 2OCLA 4N5HX 1Y7TA 1ZU4A 3FR8A 5HE9A 5LR6A 4MTLA 3SLKA 1T8WA 1EP1B 1OAOC 3WC4A 1Q6YA 1ZINA 2R6FA 1ZHHA 1GGKA 2WG1A 3LO5A 5HA5A 4G65A 3PV0A 2AE2A 5KTTA 4D8WA 1USGA 1F8UA 2AIRA 4CCSA 5KWIA 2O1SA 2QS9A 4K9OA 2JJMA 1X8JA 1ZC3A 2XGMA 2Q9CA 3NEAA 3OUTA 1SUWA 1JFFA 4Q3EA 4X92A 3D6HA 5KWVA 4K1XA 1IUOA 2RHMA 3M5CA 2J3KA 2WFMA 3T7TA 2F67A 3TUIC 1LDMA 4DK1A 4KZPA 1RWQA 4LISA 4JBGA 2Z3ZA 4NESA 1P2UA 4ZPXA 4XB2A 1L4YA 4QTUB 1E89A 1Q0TA 1N6NA 2RMKA 5J5VA 4M1ZA 1MA3A 2Q4BA 3V7UA 1BEZA 1A7UA 2WIDA 3LYUA 4NYIQ 3JSAA 4I9HA 4GX2A 3H2BA 4FCVA 1J6UA 4N7BA 3I9V6 4WFJA 4WEOA 3ZGYA 1VMAA 1OFVA 5SICE 4V3CA 2R00A 4GBGA 1HKHA 3W06A 3BGOS 1G2PA 4U7TB 2QXYA 3QW4B 4EG3A 1XPRA 2HRCA 5GZ1A 4LC0A 1M5UA 3F74A 4FFBA 4KKXB 1GTL1 4EECA 2XXAA 5E2IA 1F14A 3BN3A 4QTZA 1BVHA 1MGPA 1ZM7A 4D8VA 4EPVA 4Q9KA 2O8NA 1DUIA 2VRBA 1PVDA 1OREA 1QIEA 2PG3A 3C6QA 3GEEA 4WESA 5FPHA 3ABRB 2JBAB 5KC8A 1G20B 16PKA 1T1JA 1JLRA 1MNQA 4PX9A 3BCRA 2FGJA 3FWNA 3UXEA 1JECA 1H0KA 2DFKB 1JHXA 3AR3A 4JOBA 3SC3A 4OP1A 4G8DA 2IXGA 5T6MA 1CS0B 4PSAA 4E4YA 5IVPA 1R6XA 3FX2A 1ORWA 4OIFA 3TM5A 4UM8B 5DX0A 3WGUA 1CETA 5AVRA 4WWVA 1K88A 4DDHA 5D6OA 1E92A 1VQPB 2ZRKA 3ILXA 4I5DA 3SZMA 4HGZA 3ZY4A 4M46A 3BM5A 4Z4GA 3AXTA 1ENPA 1HDRA 2ZUFA 5FTNA 1T9GR 3A06A 5BSRA 1ZM2A 1BWSA 1L5ZA 4N39A 4YP0A 3E5RA 1KI9A 3IVXA 3ESDA 3V7YA 3FCCA 5HUJA 1HL3A 1SQ0A 6AT1A 4IFIA 1G8PA 1PGQA 3EZNA 5ELMA 1EWRA 2OBXA 3KSRA 2LWIA 2W6NA 4XDHA 4X66B 1QV6A 1R6VA 1E99A 2XE6A 4H6PA 5DWQA 1PGJA 1GU1A 1X7WA 4WA7A 3VSEA 4RLQA 1SBYA 3V6MA 5KI6A 1JHUA 1Q77A 1F2UA 3ND7A 2GN0A 3WLJA 1PP4A 1RHUA 2JFHA 4PBSA 2PAFA 3HGMA 3UH0A 1QRTA 4Y7DA 4DV3B 3I6MA 4ZP1A 1VE5A 4ZVRA 5K2OA 5HFJA 5E4JA 1Q2UA 3DE3X 5BY2A 4QD3A 3I45A 5TV2A 5CNJA 1Y1SA 3L7OA 2REXB 4L4RA 1FJHA 3A3PA 3FGNA 4WY8A 1LQ2A 2XUDA 5CB4A 2X5XA 3RUPA 1Z22A 2IW3A 3INGA 1OI2A 2BSXA 4MQUA 4RVOA 1NR7A 4WI1A 4PF1A 4G0NA 3C70A 1IDN1 1EK1A 1M9NA 2HO5A 5BWCA 1U9IC 4OH1A 4XVQA 5AT1A 2B7BA 3K9BA 2H11A 2ONYA 4HUQB 4CL8A 1IBMB 3FUUA 4OM7A 4H27A 1IZZA 3A0RB 2DGDA 4RH3A 5DS0A 3DDSA 2VAMA 4UAVA 3ULKA 2C9YA 3C3XA 3KQTA 4NZ9A 5LQRA 1CR6A 2MR5A 2I6GA 4CZ2A 4TN1A 2WYOA 3NT5A 5HJ7A 4CLRB 1JEQB 1UK8A 2XMDA 4DR6B 4FX5A 1ISJA 2RHJA 4LNUB 3H9JA 3MTQA 5F7JA 5DLPA 3ENQA 2R47A 1GGVA 1K6EA 1JVSA 4HWRA 3TBHA 2IUFA 3GRYA 3ROKA 2R97A 3GD7A 3T5GA 3TEFA 1Z2PX 3EXHC 1JLSA 3L5OA 4BDTA 2PGLA 3IE2A 1TYEB 4RZSA 3V4PB 4YR7A 1XNHA 1GZ5A 2PBRA 4MO2A 4PLYA 1N1GA 1KAMA 4BEWA 3AF5A 2PGIA 5MFZA 2IDJA 4RLFA 2GM5A 4MUAA 4PZZA 4AX4A 1XRLA 1I6WA 3OLYA 2CYBA 3CVWA 5EIXA 5DISB 2R6R1 3U4CA 3QFCA 2V7QD 1Q1QA 3DMHA 3QUBA 5EZYB 1M72A 3QKUA 3SIPA 4L8YA 3NIDB 4OHKA 3H8VA 2BY4A 2JAWA 4ND8B 3Q3CA 4FB5A 2EQ5A 3LIIA 4EI7A 3VPBA 3IV6A 3SAJA 2KQUA 1KA9H 1IWBB 4TLLB 5HBRA 4EG4A 4F1KA 3W5HA 3F9CA 2VBFA 4KVFA 1OFGA 1REQB 2JZCA 3G79A 1FEZA 3TAUA 1EFHA 4N4AA 3GCGA 2EBFX 4ZOEA 1Q82D 4Z9FA 3WICA 1HYBA 4QLAA 4YASA 4F4FA 3R9XA 2DCMA 2IGTA 4Y0NA 5DWVA 4DWVA 1QP0A 1YFLA 3CZPA 2VH1A 3S8EA 3BMQA 4NJOA 2ZXFA 2E37A 1J97A 2EQAA 1BCRB 3I83A 3PGXA 1GPDG 1QYIA 3B7WA 2P6RA 3G9UA 3LDUA 2DSNA 3NATA 4TRJA 5DYYA 4EG1A 3PIRA 3V1UA 4UUNA 4BN0A 2G4CA 4Q00A 3EBLA 1VZ2A 4RKYA 5FUWA 3ZJYA 4HGNA 3NM6B 1CE8A 1NMEA 1C0PA 1G1MA 3LQYA 1DWQA 2LNDA 1U0GA 2QG6A 4G63A 2ERXA 4RVDA 5PNTA 4CYMA 3AFOA 4G85A 4KQGA 4LJ7A 1E3XA 1D2AA 2JHFA 2RB4A 3C5EA 4GW3A 3STUA 1U11A 2A67A 5D87A 1FYXA 1QKJA 2A1UA 2GR9A 4UDXX 5FWXB 3DOFA 1U9CA 3GLGB 5HQ3A 2PUDA 2JJ2A 4FE3A 1L5WA 4ND6A 4RPHA 2B20A 3BULA 2BCEA 3SLDA 2ZZGA 1W5FA 3Q72A 4ZRDA 1JLMA 3S0JA 1VRCA 3ENZA 3RGWS 1XZCA 1YJ5A 4QXPA 3T54A 4OEHA 4EZEA 4ZYLA 2J85A 3B6ZA 5JPDA 1T9ZA 3BTOA 1CRQA 1GZHB 4N7MA 4ZYYA 1J9ZA 1E7RA 3O3CA 1GFWA 4L4YA 2F3PA 2R1TB 4ZYVA 1WXIA 5E9WA 4MK4A 5LCXA 3ER9A 4WLEA 3K94A 5CYGA 5E1DA 1RWMA 2I8AA 4XRGA 2PMBA 2ZTUA 5FNVF 3AXSA 4HBZA 4UCFA 1Q3HA 4YQEA 2EKDA 3BJEA 3ZWOA 3GLFE 1RZ3A 3CA8A 4NMWA 5D1HA 5KPDA 5C7OO 5EP2A 2M2IA 3EDOA 2E5WA 1G59A 1GJRA 2Q5CA 1JAYA 1Q7BA 1NT2A 2PZAA 3DM9B 4FHCA 5J3JA 1NFRA 2YZ2A 4QHYA 3KYDB 6LDHA 1SXJD 3D6JA 5A6SA 4QM6A 1XRQA 2OD7A 1R74A 3LAWA 3OX4A 1PV2A 3EQ9A 3QLEA 4MVJA 4REMA 3VYRB 4DUZB 1FFYA 1YAHA 4OYYA 1W36D 1J7JA 1X7YB 2JD2A 4G97A 1FCJA 1KI8A 1PZEA 3QMWA 4JJEA 4MQMA 1MQ9A 3SLNA 1ZIYA 5BN4B 1H8EA 2PX5A 4PEVA 3L0OA 1SIBE 1ZCFA 1MVOA 3FUWA 2W90A 4F8YA 1B23P 2GESA 3CWZA 4HO1X 2QNBA 1VLOA 3OQIA 3ISVA 3B12A 1U7PA 1W0JD 4HE6A 1XCJA 4O08A 4PGAA 3LKBA 4BNDB 4G5YA 2JLQA 1YVPA 1KVRA 1H2BA 2EOAA 4KEAA 1QQBA 3ICQB 4JYMA 5CCDA 2O7QA 2O2CA 2Q7XA 3AONB 3IXLA 3N0WA 3BZBA 2RONA 3G8YA 1N5OX 4FNAA 1O3YA 4NZYA 4X91A 3JQAD 5JEDA 2Q5OA 5K8VA 3DYIA 4X1IA 4QU8A 3CVXA 1NBIA 3L0YA 3SR3A 2HLPA 1C7IA 1M2OA 1MC4A 1OLUA 1SC1A 4D0LB 3PXAA 4XSHA 5CTAA 3F5DA 4G5QA 1TD1A 3Q8XB 4OGKA 3LQEA 1JVNA 1LNSA 1O89A 1ODIA 4JI8B 1OXMA 5FBQB 1D1NA 1SXJE 1NVVR 1B8PA 1HNXB 2G9UA 5FOUA 2ZSHA 3RPEA 3FF1A 5JZOA 3ACDA 2AG8A 5ENDA 1FTNA 3VSBA 3DEIA 4S04A 2VZEA 1AQ6A 2I0FA 3SBXA 3HUEA 4HAUA 3II6X 5EJ7A 4OUKX 5HK9A 4BRUA 1FIUA 4KVGA 4C3ZA 4LDPA 2FZ5A 3NTLA 4RJ2A 3MRVA 4RKQA 5A5VA 2JD0A 5KW9A 2WUGA 4UEQA 4L22A 4EF4A 1Z29A 1Y80A 2RK4A 2ZI9A 3HPRA 2NTYC 1E2BA 1DI0A 2PV0A 1G5PA 3KQPA 4P5PA 3W3AH 6REQA 1T2DA 1SBNE 2O4UX 2QTHA 1T10A 2FR8A 5GJVC 4YT4A 5DBHX 5K0FA 2JJYA 3G8DA 3OETA 3UXYA 3DC2A 5E2BA 1M6WA 4EW3A 5HF5A 1NXQA 2XCOA 3D0KA 3FROA 3G2MA 1I51A 1E1QD 1KBQA 1G18A 1K08A 2FW1A 4INZA 4QBFA 2Q5EA 7REQB 3KBOA 1NYQA 5D5HA 1EJ6A 1KEKA 5B6IA 4R51A 1IAQA 1LWNA 3LT0A 5EVCA 3WK5A 4IRXA 2XMQA 5L40A 4WZEA 1AJEA 4F85A 4JR1A 1BE8A 1NGSA 1SOAA 2O3TA 2OHFA 3N86A 4L3VA 5DI3B 4DM4A 5L4LA 1JDJA 1HDIA 4BNVA 4H6WA 4EUFA 3DG9A 2ZJ7A 3BRSA 2JVIA 5E8JA 3K5IA 2QKYA 4H7HA 5LNK6 3PHGA 1YJAA 3SR4A 1NXVA 4QDKA 4IQ8A 4MDEA 2B2XA 1QGYA 3OU6A 5FBLB 5BPHA 3E20A 2V03A 1VHDA 3VZDA 3GMIA 1PFKA 2IU3A 2ZFUA 3AHFA 1QGAA 4MULA 4YP9A 3ZX4A 1MB3A 5TIIA 5IJZA 1XFAA 2AB0A 3UJPA 4J6FA 1T43A 3FSRA 2ZB8A 4GP9A 5EJAA 1JWLA 5KBYA 1OASA 2JHCA 2GZ1A 5EFOA 4YB8A 4BNXA 3ADKA 3L77A 3LDFA 5FO0A 2BEVB 2VBGA 4LXTA 4HQNA 2XZPA 1G42A 3HDGA 1KFCB 1OIWA 2FDXA 4E88A 3ZX5A 3IR7A 5AKEA 5KQMA 3QWHA 5DNWA 4N47A 1VE9A 5EIOA 4QLOA 4NOLA 5CA1F 2HCFA 2V5VA 2ZGVA 3GUVA 4PR0A 4XIIA 3UJHA 3VJKA 1EE9A 3VR4A 2HM7A 2GBPA 4MPJA 2GI4A 3R0XA 4IAOA 4ZO6A 3M7IA 5FORA 2Z43A 3ZZ1A 3JQBC 3ZNNA 4NZMA 3I2HA 1TQ4A 4O2AB 4FNMA 2HA5A 5JAZA 3EIEA 5EWJB 4EUNA 2I03A 2WZCA 4AJJA 1R0ZA 2HC9A 3MWDA 1HKUA 2DAPA 4PINA 3F6BX 3ISJA 4JI5B 1ZUD1 4CDGA 4D9JA 1U8YA 1KR5A 3WQBA 4CLHA 1N8TA 2O0KA 4MR7B 2AJBA 1BGWA 2HWUA 1T0BA 3A6PC 1OLXB 2YWJA 3ITEA 1LSUA 3MD9A 2NUTA 1GY8A 4HLNA 4QYTA 1X74A 2YINC 1TU0A 2C9MA 1LLDA 3C3KA 4KV7A 1N8SA 5BOSA 2XB2A 1NVWQ 1NJ2A 8GPBA 1YZ3A 2AMLA 1C9DB 2B8EA 3EXEB 1UPUA 2B4YA 3JQ9C 4GE0A 2Z9BA 3B6MA 4R9NA 5HXBA 3O1LA 2BJWA 4K1LA 1KYTA 4M89A 4V0OA 4Y1RA 5ALIA 2EERA 1JDTA 1KP3A 1BPLA 4QJ5A 2YW9A 5ALXA 3GHHA 4U0KA 1YFZA 4JI0B 3N2IA 4PRZA 2A5JA 4NRDA 3ZS9A 1I01A 5ECWA 3NTXA 1AQNA 2WDZA 2WD7B 1GCIA 1YH3A 1Y8RB 4P1VA 3MT0A 4ES6A 1UMDA 3FYCA 1K4KA 1RIIA 4LGVA 2WAMA 3TD2A 1DV2A 1KBOA 4QYSA 2GVZC 3SHTA 4RZ3A 3UMYA 2I2BA 3W6PA 2DULA 2K5UA 5LD2B 4X97A 4OJKA 2OP0A 4UDYX 2ZRAA 4D3YA 2C82A 1CUGA 4JENA 1WUTA 1TADA 3DE5X 3F3YA 3CBGA 4I4IA 3SIRA 3S1LA 2N3ZA 3FKQA 2OXFA 1GR0A 3OUUA 2AOUB 3R3HA 5BO5A 4ZAXA 3IEIA 1ZNWA 2QUJA 2RHLA 3BE6A 3JAKA 2PJUA 1NYLA 3ECSA 2Z1DA 3WE7A 1XQ9A 1VG9B 1RABA 3PDHA 2ZRMA 1NFFA 2HNKA 1C1DB 2ZT7A 3HY4A 3OKFA 4WD3A 2B61A 3ZE1B 3ASRA 1SOWA 1YZFA 3MCZA 5IG2A 1QLWA 4PZEA 4MRMA 4PGMA 3OURA 5ISMA 4B43A 1FL9A 4E21A 2GCOA 4CLEA 2QTVA 4CV3A 2CSXA 2X7XA 4OMDA 4C0SA 4TMVA 1ZI8A 4IKPA 2WM9B 3DFUA 4GYKA 1DRKA 4F11A 3DS8A 5BQ5A 4KMRA 3CX8A 3CLHA 3UCXA 2HDHA 4E11A 4UPVA 3BFJA 1E5TA 3M6VA 3RFTA 3SBDA 4LKRA 3U3MA 3VTZA 2GBCA 3WYNA 1H4QA 2R68A 3U80A 5EJGA 4INOA 3S2ZA 4F3RA 3DE4X 2OBYA 3IT2A 3OZ7A 3KM0A 3DTYA 2FDRA 3PQEA 2AJCA 4Z9BA 5AIAA 4CI9A 3GLIE 2ADOA 3WMGA 2BGGA 1RWKA 2HK7A 2Q41A 5J35A 5HIAA 4KXVA 5BURA 1Z4PX 3QA9A 3TVTA 2ACVA 4RWZA 5H59A 1J8FA 2NT3A 3STHA 3UAWA 2BR3A 4AIIA 3PBKA 4EY5A 1E77A 1YB6A 1QLHA 1LFDB 5CFQA 4LYAA 3T5BA 1GV0A 3CC8A 3WQQA 3RUEA 3I3OA 4F0JA 1P31A 3W5AA 1ONSA 3EARA 1Z33A 1LZKA 2DBZA 2FSSA 2HFKA 4XR4A 3R7SA 5K01A 1Y4AE 1VC2A 5FP0A 1G6KA 4EA9A 2P41A 5B3LA 1O0SA 2EJBA 3DVRX 2WIFA 5JH7F 4GPAA 5GV7A 3SEQA 2RAVA 2QD1A 4RVNA 3ONEA 5EPUA 5F3WB 2V7VA 2WT8A 3ITDA 4ERXA 2QAGB 3TWOA 4JL8A 1O87A 1X19A 1RAEA 1I80A 3HSSA 5EWLB 4GKJB 2V96A 5JMWA 1RRVA 4OVKA 2ZJAA 1N2EA 3HCEA 3FG9A 5KDOA 4ROXA 2ZSFA 4MGYR 4DQDA 1ZO8A 4OQDA 1N33B 4MB2A 5DNCA 2ZKIA 4KYUA 3WRWA 1HSZA 2HY7A 4FFPA 3ZGZA 2IPXA 2POCA 3D4PA 1JE0A 1Z0JA 1MAAA 2DXIA 4JXXA 1AMOA 3PRYA 2W93A 4DNTB 3IPYA 4IGAA 4YN3A 3FHOA 4AWAA 3AR4A 4DY4A 4XSVA 3F6CA 4Y2GA 2GA8A 2IODA 3PEEA 4BEVA 3LLUA 3I4LA 1VQ8B 5EUQB 1P1KA 2ZREA 2Q9BA 4OI1A 4TKUA 5AI8A 4MCAA 1DG9A 3TX2A 2HJWA 3P52A 4WZBA 5I4CA 2RH8A 3DAPA 5IXJA 3LQFA 4LWPA 3TLMA 3AFGA 1IUNA 2GQFA 1ZD5A 5A4AA 6YASA 1DAIA 2W2PA 1SZJG 4X71A 4UHFA 2AN9A 2Q7DA 1EHYA 2ZDHA 5DBEX 4B3MB 1KRWA 2XDYA 3BRWD 1WULS 2ID7A 3LA6A 1AKMA 4N48A 2VPXA 2I9KA 2VNKA 1JHYA 2H5JA 1C7QA 1ZRSA 4DCSA 821PA 2FMFA 4S2UA 3OP1A 1NZFA 3E3NA 3W79A 5KQGA 4LC1A 1WCIB 4AUMA 4U3JA 2W98A 1A9YA 1KOFA 1E5XA 4LJ8A 4DA9A 2AOVA 3ZIUA 4AROA 3FXAA 4PCLA 1D2NA 5EJIA 1W4LA 4G0QA 3TNLA 3IAFA 4BFZA 4B3XA 2C03A 4K87A 4Q4LA 4Q7EA 1YASA 3EVNA 5K6AC 1E6WA 4FYVA 1NNUA 1CQJB 2PU7A 2EFHB 2YV1A 2P35A 3NE5B 4B32A 2FMKA 3A3KA 3UT6A 3TSYA 5KNDD 4Z0PA 4KFUA 4OOFA 2OUKA 3F3MA 3HVUA 2JASA 5SZIA 3SE7A 5TLSA 1E3SA 3L92A 2JKYA 4YUVA 3CRQA 3UMCA 1XVLA 4JMQA 1DKRA 5ESDA 1VIDA 1P6XA 1RKBA 4O1IA 2D5IA 1Q83A 3ITKA 2FA9A 5E3IA 4IDEA 4LFCB 3SBOA 4ALNA 2ZTLA 3R5SA 1XTJA 2PS0A 1OROA 3I37X 4DK0A 2YXLA 3C8UA 2JIPA 1IJKA 3GBSA 2GN9A 2VHWA 5BW6B 3HS3A 1VE6A 2I6XA 1ZJ4A 1CZKA 1GKKA 5LJIA 5HHTA 5JECA 3H2IA 1VP3A 2YWBA 3F71A 3GVHA 4OXXA 1I3OA 3EVTA 3IKMB 4TL7A 5EKUA 3SC4A 5IKXA 3ZQJA 5KOHA 4GS5A 4NULA 1ZG3A 3SM3A 3WMFA 2O4CA 1GA6A 1JU3A 1JEAA 2W9XA 2B82A 3M2PA 5MGBA 3GFVA 4Q9IA 3DWIA 2VAWA 2FDCA 3RC9A 2GM3A 2F1KA 4IEEA 3V9AA 1D2HA 3CONA 1I2MA 1UZMA 2XDWA 3MRTA 4IDNA 4G1EB 4C4TA 3T0FA 1VPLA 4Q34A 2GF0A 1ZK4A 2O0HA 1TZCA 4E5NA 3L40A 4GEGA 3F9RA 5THKA 1SIUA 4G0UA 1EXMA 3P0EA 4IQ4A 2LCQA 3FNIA 4YWJA 4IOKA 4G5OA 2JLSA 3GQBA 2GPWA 4RTMA 3TRHA 3GGCA 2XZDA 2W4MA 1YA6A 1WXEA 2HJGA 4WGFA 4FQ8A 1MXHA 3OJWA 5CU7A 3ZHTA 1C9NA 1WHSA 1DBPA 3IDFA 4P2GA 1CY2A 1V11B 3BDIA 1YMQA 3EHEA 4U2EA 2DR3A 5IYNA 4W5RA 3VSAA 1KFEB 1N5DA 4HNQA 2H2IA 1AF7A 3G0GA 3KYCB 1LI7A 3MLBA 4OAOA 1LLCA 1MVLA 2ZS8A 1NQWA 1TYDE 5CDUA 5CFMA 1EE2A 3A0UA 2WWRA 2RIRA 4XX1A 2OZLB 2QXUA 5E0KB 3GMTA 4BAGA 1P4GA 3DT6A 5ALMA 2C0PA 3HFJA 3RWBA 2ZI5A 4E5KA 2WJVA 5T4FA 4UNIA 1SBZA 5EHQA 4H1VA 3THXA 3GUHA 4FJ1A 1Q1BA 5DEOA 5I7EA 3TB4A 1MV8A 1WD5A 2Y66A 1XRJA 2FSHA 3G5UA 4NH4A 4WX2B 1BHJA 1A9XB 2AEMA 1X92A 4B0OA 3Q7EA 1GIAA 1P7PA 4ZHSA 2C5BA 4MGKR 4GQNA 3DFZA 3IAM6 5KOJB 5D51S 1I2AA 5H9WA 4GBMA 1NTRA 2C97A 3P9QA 1E5QA 1XN1A 2CSUA 3FW1A 2PT7A 3TNFA 4A2QA 1TYBE 1OIVA 4FFVA 2HRDA 2N42A 3BICA 4UUAA 1JU9A 1NX6A 1PFGA 1P5FA 1SCUB 2FMUA 3DNMA 4QUAA 5A3VA 2JGNA 4YJDA 4LY6A 5K3FA 5GIOE 4UM7A 2QRVA 3G2LA 4TRMA 4AN4A 4Z7NB 1LLQA 2G5CA 4QFDA 2GPTA 2YYSA 1LCIA 1U1EA 3HXMA 2GCPA 3SP1A 5FTMA 3PFNA 3BXXA 5KYUA 1JWAB 2HO4A 2YY6A 3H2KA 2IEYA 4ME6A 1VPTA 3DEJA 1YIOA 1Q7GA 1Z18A 4R7TA 3VYVA 5CH8A 3OQVA 3STVA 4D9MA 5IABA 1AGYA 4UFPA 4EB6B 4RACA 1I2BA 3RJTA 1CEEA 4AP9A 4BVKA 3LS2A 1HQCA 3FDZB 4FDAA 1OIXA 3PVSA 2RGGA 5CG2A 4QOGA 3S1AA 3S2SA 1X42A 5AYVA 2KS6A 1BMTA 1U7DA 2E21A 3ELWA 5IKPA 1XTQA 4OQQA 1A77A 2FSFA 4HTFB 1YRLA 2A7XA 3QHAA 4IBOA 3PXBA 4REQA 4UTVA 3OE4A 3UAYA 1TVKB 4CM9D 3O9VA 4KJXA 2AV6A 3RC3A 2Q5JA 4P7BA 2YWDA 3ZDRA 1N2SA 1JHDA 1UPTA 5BSEA 4IF6A 3LBIA 2TMYA 4XTCS 4PYRA 3KQWA 3UKDA 3F6RA 2AF3C 1GFZA 2ODEA 3WHPA 4IJMA 4P4TA 5LA6B 3OZSA 3RK4A 4Z4WA 1GTMA 3PFGA 5IP5A 2R6CA 5FPTA 2Z4SA 1LDNA 1Z6AA 3JYPA 2FPMA 3NM5A 4US2R 5JYDA 2A0UA 2Q3JA 3F97A 1QFZA 4PZ9A 5FPQA 2C4HA 4WTOA 3AV3A 3JXEA 4UUOA 4A0SA 4TVSA 4ZZ0A 1Q2XA 2A5FA 1IDOA 2G7ZA 3EC7A 4KQKA 1PT7A 1PUIA 2VUIB 1MIHA 4BXOA 1JGTA 1TA0A 4BWFB 3DE6X 1JFTA 3JWEA 1M7HA 3D7RA 2DLNA 3GDFA 3GLQA 1ZY2A 3HN6A 3KS9A 4GXQA 1A72A 4P31A 3ROPA 4Z6KA 5IZCC 3K8OE 5KZMB 3QIVA 4GAEA 3ASZA 2J3HA 3I1FA 4ALJA 3ESCA 3ZCUA 2BEWB 4EQZA 3VU9B 1MTOA 1SURA 4P1ZA 4IIJB 1VPDA 2ZU0C 3TRJA 4FOTA 3O84A 4FUTA 4MLZA 3TINA 2CLLB 4Z4ZA 4CQMD 3NNDA 4QT0A 3D02A 1Z5ZA 1DG1G 1JLLA 4QKQA 1XZBA 3KX2A 4ZAGA 1OPRA 3QTLA 2P90A 2H51A 1TT7A 1BHO1 5JVDB 3GFGA 1GNRA 2XUHA 1UBUS 1I7LA 3ILYA 3PUWA 3CO5A 3A1NA 4PG8A 5C37A 2G1JA 1VYVA 1YACA 3EISA 5E7IA 1NU6A 2UZ4A 3SSAA 1NY6A 1PX2A 1FU7A 1LKZA 2BKEA 4K9NA 4UEOA 3WTCA 1LU9A 1RAAA 3GRPA 4YH1A 1AUXA 3KETA 1AO0A 4Q1CA 1M8GA 4HGQA 2ZRFA 5ERGB 3DMGA 5EE9A 5JPIA 5T4BA 3RC7A 4B4OA 2B3TA 1SHZA 1A5BB 4PIMA 4MYTA 4B2PA 2G40A 2A58A 2D1FA 2IX9A 4RLHA 3COPA 2C92A 1UZNA 4R69A 4UQOA 1U0TA 4B2YA 1T5EA 4INAA 3CLUD 4YGXB 5A4IS 4I1SA 5CG1A 1A9ZA 2LXNA 3Q9SA 3COVA 1YS4A 1Y0YA 2YASA 5CXUA 2MSWA 1RLUA 4MDYA 2PRZA 3NBKA 1UPFA 2AI2A 3QTTA 5AO9A 5LP6C 3GC6A 4YRSA 3AT1A 5F23A 4EP1A 1EGAA 5ALDA 3ZPNA 3Q2IA 2CKMA 3REQB 1YIAA 1P0MA 3N8KA 5K0GA 1G38A 2VPQA 3QKTA 3ZLBA 3OZAA 2ONCA 4ENTA 1VQ4B 2QYSA 4QDOA 5B2EA 5CFNA 2P6PA 4OHVA 3OEHD 4LWQA 2PLFA 2OESA 3HDHA 1JQLB 3V6LA 1KDRA 3WKCA 3KT0A 1GXSB 1N2HA 4U8HA 1UBGA 4EM6A 1K6MA 2VJNA 3FPJA 3IMKA 1VSQA 2H2FA 1RWNA 3RS0A 2AG5A 2WLTA 3R76A 4B76A 2I91A 4G8JA 1VHOA 1BAPA 3BTUA 3OPVA 2XGSA 4GZMA 4Q93A 3MOSA 5BVHB 3AB8A 3TPZA 3BB4A 5AXAA 1IRXA 1T5IA 1IB6A 2OFXA 3KVYA 3M3PA 4M9SA 4AJIA 3DMDA 3LNNA 3BMNB 2ZJBA 2N46A 1FNDA 4Y0AA 3CPXA 2E2WA 3GEGA 2DE0X 3TD9A 4D25A 3FPLA 4HXEB 5TPWB 3RRBA 5ALUA 5JCPA 1Y8QB 4MYRA 4FC7A 3IHKA 5LC1A 2G71A 4LRXA 4X6YA 1H0SA 5LP6F 1G41A 1L5SA 1U5CA 1U0LA 1YRYE 1JU4A 5BPFA 3UMJA 2BKVA 3X1XA 1KZ9A 1WVIA 2BM0A 4C14A 1VB5A 5CHEA 3OPYA 3RYCB 1KETA 1KXJA 1SBHA 2HRQA 1M1YA 2OWEA 5CA0A 2M6LA 1E1RD 2BP7B 1INLA 3SD7A 2AOTB 3FBWA 4X64B 4UOZA 4L73A 4LXYA 4LSGA 4F84A 2ZJZA 1I24A 4U4AA 2PY6A 3MBIA 3MJ4A 4X7RA 1NKVA 2ZRBA 4TT8A 4RAOA 2OBFA 2CW5A 4NU8X 5FFFA 4MGHA 2VQDA 2JIZA 3AEXA 1ID8A 2PE5A 5JRZA 2Q3MA 4BATA 1ZMRA 4EX6A 3CC7B 4NYJQ 2DSTA 1UPAA 2FN4A 2IA5A 3IP1A 4BMZA 3C6MA 1SHJA 5TQ2B 1UFOA 1YQGA 1H5QA 2TSYB 4P4UA 3WQRA 5HM6A 2Y0DA 4M1QA 1RJGA 1C7EA 3UT5A 2VOEA 4C6TB 4RPJA 1FRQA 1KEUA 1BHSA 2IHYA 2ZQZA 1G6Q1 4LOHA 5HBGA 3AIOA 1NMSA 5ANRB 5CLFA 3O95A 5IVKA 3BFXA 4FGZA 1OXUA 1UBTS 1Z17A 4FOSA 4J0JA 2RGRA 1NF3A 5JSKA 4P3NA 3BH4A 1LNQA 3IJRA 1KAQA 3D8RA 1DJPA 1FTGA 3I1JA 2JG3A 1H22A 1UJ5A 1W8IA 1TK9A 1NB0A 2GTPA 2C9CA 2NXJA 2Q3HA 1U0RA 3DR5A 4L72A 2WJ6A 4X45A 3O8OB 4OOEA 2EWWA 4A8PA 5IT0A 4C2UA 2ZUCA 2Q27A 3MCUA 3R7WB 2EQBA 4GXRA 3ZWBA 1QFXA 3CJTA 2ECKA 3V7AA 1VSTA 3I12A 4OPSA 4OSPA 1ODCA 1U3CA 1PSDA 3R2JA 1ADCA 1S2NA 1U7XA 2GPNA 1GZ7A 2P9TA 4FXPA 1DBVO 2ZZKA 1YVUA 4A9AA 4A5SA 1QX4A 5KTOA 2C3OA 4Z4UA 1QG0A 1Q11A 1NE2A 2A57A 4CTJA 4N5NA 4RF3A 3ZK9A 1C41A 2EGUA 3SYNA 3WL6A 3RUAA 1YIDA 4L4ZA 3EBOA 1CFZA 1V7PC 4BNYA 3PWTA 4EJSC 5ED0A 2HRBA 2UUPA 2A0WA 1GQSA 2WU0A 3GAAA 3DV2A 4YAEA 3KXDA 4N6NA 3SXUA 1FLNA 4S24A 2II6A 2QPLA 4IGEA 2XB6A 5DGXA 3S3TA 5B7GA 3T7SA 3T5PA 2C1EA 3KFXA 1QX3A 1B3BA 1GARA 4YRDA 4LTNA 5JRJA 4S1PA 3ROEA 4QULA 2BUAA 2X8JA 4PZ0A 4BMNA 4YRBA 5JC8A 4OGGA 2GJ8A 4HE5A 3ANYB 5CX4A 1EJ0A 4V1CA 1XROA 3EGIA 2WMOB 3OX2A 2EIHA 1GYRA 3K0CC 4ISCA 1RTKA 1FNSA 2PL9A 3CGGA 1CJCA 1H42A 1MC8A 3N8HA 2DPYA 4QTTB 2BZGA 5IDYA 5IKOA 3T1OA 4BE7B 5J43A 3LNCA 1ACMA 1TJ3A 2Q5QA 2BBSA 3K1ZA 2V0NA 3KFVA 1VIVA 3NHLA 4X6XA 3CF4G 3BHJA 3L93A 4NJMB 3OEEA 3HA2A 1R0SA 3KKKA 4AJNA 3U7QA 1U6KA 3JYOA 2GJPA 1ZUHA 1OY1A 2ESRA 3PEVA 1ULTA 1UBKS 3C6BA 4GH5A 4P9SA 1N2XA 4JNKA 1FDUA 4Q7MB 4CN9A 4QUGA 1ZH6A 2O5CA 1IPHA 4X60A 2WT9A 4JT2A 3TJRA 3RFCA 2FEWB 2QLLA 3NWEA 4XB1A 2PXAA 4C22A 3DHNA 1T9GS 1YVRA 1XYVA 1TLFA 1JJIA 4M21A 2RB5A 5ITWA 4ARVA 2DBVO 2CK3D 3MTDA 3G23A 4PS1A 2WTEA 5BN5B 4D9KA 3TLGB 4ZEMA 3E15A 4FD3A 1B8NA 1E9BA 2Z5VA 1UFVA 4Q7JB 1WNTA 3DWFA 3KZCA 3O6VA 4Q4AA 4RHTA 2CCKA 3CH6A 3LC7O 1F0KA 3M33A 4AUEA 1ZIDA 2EZ9A 4CG2A 3PWSA 4GMKA 3SYTA 3PUVA 1X7ZB 2IYFA 3CW2A 1PKEA 3KL2A 3QX8A 4KXWA 1IHXA 1Z0FA 2GKGA 4DNQA 3GUCA 4U0JA 2PH1A 4UD2A 5HTKA 2QEQA 3MTEA 2UVPA 3A6HA 4IX1A 2PUHA 5KTPA 4XQEA 3TD6A 3E6AA 3O0TA 3PNKA 3CP8A 4DEYA 2RGEA 3U9LA 3LC0A 3OQJA 2QDXA 3K4PA 4H2DA 4O4JA 1DHRA 3D6NB 3RW9A 1AURA 5I7SA 4MOWA 4LSMA 3UANA 5JJIA 4O3MA 4TV8A 3RS7A 2FF5A 1Y5RA 3JWPA 4MH0R 3E5NA 4FR0A 2R1ZA 4O3FA 4RM2A 5B1HA 1NP3A 1CUDA 2ODBA 5ESRA 1UBJS 4M0PA 3MJHA 3VUEA 1ECFA 3IB3A 3QVGB 1XD2B 3DBLB 4O33A 5EAIA 1DU4A 7GPBA 5IAEA 4EEKA 3Q3EA 2AZMA 3ICOA 2PSJA 1MRNA 4QYMA 2VJKA 2IBMA 3FPEA 1P2FA 3HYRA 3HN7A 2PLWA 3PJGA 1KC1A 1PTJC 3IURA 5F7OA 4F6RB 1ORHA 2Y68A 1YL6A 4G1FA 4MSUA 5E9JA 2ZXHA 1M0SA 3SK0A 1Y7HA 2QMOA 1G5HA 4WXRA 1QHNA 1LK7A 2OV1A 5H9VA 3O8DA 3U1TA 2YBEA 3KJGA 1R10A 4UVHA 1XOIA 5E1MA 5DTQA 4G56A 4LJLA 1DS6A 2EZ4A 5FIUA 4TRRA 3ED1A 2G77B 4YCDA 3EGXB 1FMTA 4LJ9A 1N7IA 1UADA 1VHLA 3QKIA 4YY3B 2J6HA 2ZJ5A 2ZXIA 3RC8A 1QCDA 2HLHA 4WOJA 3IAHA 4LDRA 3DOHA 4ER0A 5FB3A 1Z5NA 3BD9A 3BYZA 2J6BA 4YXFA 2VNAA 4HNHA 2OCBA 4L7QA 5B37A 1KQNA 4UE3S 3FKSD 2QPAA 1U2SA 1V16B 1A4RA 1KF0A 4QVIA 3UJ8A 1UPBA 3D0OA 4R83A 4TSFD 4HZUB 3EIXA 3IUQA 1GQFA 4PZYA 3SF8B 1XTPA 3OAAA 4IWYA 3TCNA 5MF6A 3B89A 3Q85A 3CJQA 5TARA 5I4IA 2FLWA 3UPDA 1EJBA 4IDGA 1X9GA 1AY0A 1NPTO 1ZONA 1PNOA 1VLZA 4F7DA 3QQPA 3ZWDA 2KWIA 1R6TA 2QSZA 3UXMA 4P7JA 2A5YB 2GS9A 4ZCPA 3SXPA 2W6ID 1K28D 1VJDA 1C0KA 3CLTC 1GR1A 2F3TA 3I9OA 1XI2A 2R4UA 2FFAA 3SOPA 3HKBA 4KC0A 1IBKB 1VZ3A 1KNQA 3QBTA 3V1LA 3J81A 3WGKA 2OHIA 4UTOA 5G4KB 5KYVA 4PYOA 1XKTA 2C2ZA 2JBAA 3DCNA 1G20A 4OPOA 4PYQA 4NJEB 4Y6GB 4DPLA 2O6LA 4NBNA 1MJGA 1U0HC 2C7RA 3ETJA 4NMHA 4B6JA 3I4CA 3C43A 3CF2A 3KAJA 3A1FA 4KKVA 3KYBA 4AL4A 5LSAA 1CS0A 4MITA 1QQ6A 1Y9ZA 1VP9A 5JBNA 1PAUA 1WAMA 2PL3A 3U3OA 4RGBA 2DZDA 4A2WA 4D6XA 2ZRHA 1BGXT 3GZJA 1Y8ZA 1R8SA 4WOKA 1AQUA 3QVOA 2GK3A 2P30A 1FXWA 3P9SA 3AKYA 3TSZA 4K0KB 2X0FA 2XE8A 4J4HA 4D5GA 5FBHA 4K81B 2IYUA 1RU3A 2HIMA 2J3LA 3C5HA 4MWOA 1VYTA 3QKRB 5ELXA 3AP3A 4HN2A 3HUFA 4K7JA 4XQ9A 5F51A 1I5EA 1YS9A 3IIKA 1GCGA 1YQTA 1DHTA 2VS1A 3GJ3A 4YRTA 1X9HA 5EXTA 4IW3B 2QJFA 2CXTA 3ZWVA 1HYGA 3GX1A 4QU0A 3RRNA 1UXIA 4JDPA 4TQ9A 3B51X 3GAMA 4RDHA 4F91B 1YZNA 3QKSB 3VVCA 4PG5A 3PQCA 2BGNA 1RM3A 3PUZA 1S3IA 1XPJA 1GPAA 1YE3A 1PHRA 4IXWA 4OOVA 3AILA 1UOPA 4FGSA 5EIAA 3ZKAA 4H59A 4ENQA 3NHAA 2ZYAA 4M8LA 3PQDA 4PYMA 2DHQA 1WXQA 1ABBA 2QGNA 1BJTA 1TO1E 3A3NA 5ENZA 3NWOA 3U4GA 3LGXA 1L7OA 5DULA 3V8EA 4OTZA 2PA0A 4R71A 1ZIXA 2AOWA 3HXPA 5DH9A 2BT4A 2JI7A 1G21E 4YONB 4BX2A 4ZEVA 3O92A 4P3XA 4KXNA 4KTVE 4BLRA 3JSXA 4LBYA 2WJHA 1AHNA 4Q12A 5H3CA 3W3AA 4UBIA 2OGUA 4MW1A 3UA4A 3OJLA 3MMNA 4ZV4A 1SBQA 4HUQA 3RVPA 1BWPA 3AF3A 4F2PA 3OMLA 5KYYB 3QXCA 1P17A 3KR0A 2CLOB 3GT7A 4Z4FA 3LQ4A 3Q3GE 4DA7A 3AOEA 3EF3A 2CLEB 1KPIA 2QHXA 1R4NB 4OGLA 2WZBA 1CUYA 3KL4A 4Q7KA 1OU4A 3INYA 4HX2A 4X20B 2R1VA 4YJHB 5JCJA 2AFHB 1KBZA 3HJHA 4ZI2A 1NIPA 4IG9A 1ZESA 4CLRA 4LFBB 7ADHA 4NNJA 4JP5A 4Z99A 4CKZA 3TTSA 4F86A 1Z8FA 3FNFA 1ENYA 4EPXA 2NSHA 4JNCA 3W4JA 3OKAA 3O7WA 3VR6H 3AVUA 2DPHA 2ZVQX 2OO5A 2HA4A 3QFTA 1JLKA 2JAUA 3ON5A 1LQUA 2PX0A 1BMFD 4DTCA 2IF0A 1FFDA 1WV1A 2OCKA 2F8SA 4FGLA 1P4JA 2YUIA 4HTAA 1R3DA 1ZRMA 1WZ2A 1CHNA 1XZKA 3K0EA 1TTTA 5BT8A 2VYVA 3IDSA 1D2RA 2PMEA 4BNUA 2Z57A 3BX1A 1UF9A 4G5GA 2GPYA 4ZOBA 4GQBA 1T8RA 4FSXA 2BBTA 6ABPA 2UVQA 2RKBA 2PBLA 3WYBA 3FMPB 2B1QA 1FMFA 4ILKA 3BH0A 1CEYA 3RDPA 3P8ZA 3AETB 3CZ9A 1E0KA 3A4LA 3VKGA 3JVDA 1L4LA 2CHGA 5AM5A 4ESOA 1T5HX 2YN0A 2R1UA 4V24A 4DUGA 4MRPA 4ESVA 2FSGA 1SBTA 4GZ6A 3V48A 1REQA 3GCWA 4JODA 3UY4A 5BVGB 4MW6A 4KR9A 1CDEA 4ZOAA 1QUFA 1E60A 3RC1A 1M2HA 1SK8A 2VF2A 3UHPA 5HRCA 1GILA 4LHYA 1LV7A 3FZYA 4Q47A 2RHDA 1NJ5A 1K9MD 1ULUA 4JUAA 2BEUB 1FYEA 2DQSA 3OFNA 3HRIA 4RPCA 1BCRA 4ZVUA 5C9ZA 1U3UA 1ZK1A 4M1TA 4LG1A 4CV2A 5JXGA 4BWGA 5DM70 4Y3UA 5A4FS 4IINA 4I55F 2TMDA 4RDIA 1AA6A 1Z62A 4GR4A 4DA6A 1MCZA 5DLQC 4F3TA 2X5NA 4D99A 1KJWA 3X1DA 2CVHA 4GR9A 4GU5A 1G16A 1Z2EA 2QZJA 4DL9A 1Y42X 4MZXA 1FTYA 4D3FA 1WU7A 4B09A 2B5WA 5FJIA 3LXRA 1JG6A 4FMCB 4IHKA 2ZBFA 3U5ZB 3GLGA 4DABA 1UWVA 3AIKA 3H0KA 1MNAA 5FWXA 3GT0A 5IN5A 2WF6A 3P0FA 4XIJA 4BE9A 1GAXA 1PYGA 1VQ9B 1MQ8B 5IX8A 3T3IA 4EPRA 4EHBA 2IHNA 1ZJJA 2AJTA 2HSZA 3ZPXA 4KQMA 2WF9A 3N74A 3R6LA 2ASVA 4OY3A 1D8AA 3MYRA 4TT3D 3ZV4A 5DXJA 4D57A 5M29A 4KO8A 1C0EA 1I1NA 3PTLA 1NYRA 4ZHQF 3RK1A 4R0VA 4AVZA 1W0CA 2O3UA 3PKZA 3NVMB 5CLIA 2QRQA 3H5VA 5K05A 2K4MA 2C7PA 3RKUA 2R1TA 4M88A 1EG7A 1BTOA 1YTLA 2X2PA 2GN6A 3EHDA 1LQTA 3LUJA 1OH7A 1JJFA 4UASA 4HDOB 1J8VA 3IEKA 3KTDA 2VUUA 3QK7A 1QWSA 1E3LA 2CLSA 3PXXA 2AH5A 2OORC 4MV4A 3BL6A 1ELOA 4QVJA 4D9HA 2BMDA 1Z6ZA 3H16A 3NIGB 2VATA 4OM8A 1NBMA 3FUXA 5C1BA 1NRWA 3OOCA 4PRLA 3K5HA 5ALOA 1AS3A 3PDUA 2ZJ6A 5FOVA 1RYBA 2MSDB 3CEMA 2UXCB 3IMCA 4ZZ2A 1EG2A 2XITA 4GLFA 2OAP1 3KYDA 1BE0A 1GEEA 1ADJA 1NR1A 2J5RA 3QSGA 4M4SA 4JDUA 1C4OA 4MYSA 4XR9A 3UKJA 3VOSA 3I61A 3W77A 2O05A 4K8RB 5TRDA 2WW8A 3FCUB 4LZJA 4WXYB 4G6IA 4HDRB 4GT1A 3S2IA 4AQDA 1B93A 5M34A 2C98A 1FP2A 3U48A 3EXG1 5BN4A 4ALLA 1L8OA 2GH1A 3LY8A 2HQSA 1EDDA 3QQ5A 5B1YA 3H3FA 4M7RA 2QGZA 3B1KA 1V71A 2HN9A 1CV2A 4WK0B 1YZGA 4OYRA 1T15A 3W78A 1QH0A 2WG0A 3SX2A 1EFRD 3DVLA 5A4MS 1K8ZB 4MI3A 2P9GA 4QXOA 1TIPA 4BNDA 1JFLA 3CVVA 4B8ZA 2PMFA 1MABB 1WCYA 3P1JA 1X1DA 3TIVA 3QEBZ 1N2CE 4FCWA 4ZVMA 1C9KA 4AZVA 4EZBA 2R6AA 1TTHA 2HADA 2YH2A 2VXCA 2AN4A 1WUYA 1ZOOA 4QC2A 4D4GA 4UTRA 4PIPA 4Q4HA 3WOHA 2NZWA 4EY7A 2VTBB 2AC7A 3C3AA 1G7RA 2XUKA 4M76B 4N65A 4YDSA 2XMZA 3H75A 4KMOA 1A96A 4NV3A 3HZOA 1G291 8MHTA 3B5EA 3WQSB 1ECPA 3PDWA 4M7PA 1C30B 5J3OA 2OCAA 4NV0A 2OK7A 4UTPA 1Z5UA 3COYA 4JIMA 1A97A 4MINA 1P2GA 3B9QA 1E0JA 1ZQ9A 5TEVA 4G09A 1KGSA 2OLEA 3P0RA 3B20A 1ZGHA 4MVJG 1SPXA 2X19A 3TMKA 3L18A 5BUCA 3BMOB 3PC7A 3GXOA 4FYYA 4URXR 4KR6A 2XE7A 1MFPA 4YJ3B 1NM5C 1VPWA 1KZ4A 1YWGO 5E6RB 1VCMA 2HSWA 5EOVA 3IH5A 2QVCA 4RJTA 5HXAA 1ISMA 4CCYB 1L5MA 4C6RA 5JNVA 5K8TA 4DSAA 1QZZA 2I4OA 1Q12A 3O82A 1CERA 4QU5A 1HT2E 2LCIA 1BWRA 2JLXA 4DV7B 4Q15A 5CNKA 5FRDA 1E6MA 2PH7A 3AY6A 1LBQA 3AR2A 3ZY2A 5LDGA 3WNVA 3DEZA 3RUHA 3L04A 4P54A 4IDAA 2DBYA 4UEJA 1H6AA 1F5NA 3FI0A 5IU6A 4FYJA 5JXJA 2P2LA 3ER6A 4HAYA 2HMAA 1KEPA 5AUNB 2BOVA 3WFIA 5IF3A 5J4HA 5MN5A 1UBOS 3IXMA 5DNVA 3B78A 5DI3A 1VFPA 2JCXA 3JRNA 3IUYA 1WCV1 3PQ5A 2REOA 2FFQA 4M8SA 1VB3A 3QFSA 1UT6A 3BGIA 1NSYA 4KRXA 4BFLA 1V3QE 1OA1A 4Y1EA 1DFIA 4YUXA 3CMCO 1E2GA 4DVGA 2RIPA 2P3OA 3G0CA 1D2GA 2GRJA 2WJJA 3HR8A 1XHFA 3KZNA 4ZC1A 3M1YA 4DJTA 4HWOA 5AVWA 3DL2A 1JDVA 1YDHA 2P6NA 3DOIA 4WZAA 1XTKA 3EUFA 1T4CB 3EZLA 2KX7A 2OQ2A 3FOBA 2G6BA 4B74A 4CVNA 2VHEA 4IWXA 1E6KA 4ZANA 3I2KA 3R3XA 5F3DA 4DEVA 4KREA 2VHQA 4FXOA 2BEVA 1KYZA 5BSWA 5L4NA 3DZKA 4FJ2A 5G0SA 5C1OA 2SCUB 1VDMA 5E8RA 1WZIA 2A84A 4J29A 2FUG1 2JH3A 1GAQA 1SGWA 3ENWA 1TU3A 1IQ0A 2H2HA 1PJ4A 2BGKA 3HWRA 4AZ0B 1Q91A 4MHTA 3SZLA 2A0KA 4IJQA 2B7LA 4CIDA 2BFEB 3M83A 4I08A 2WYWA 3AI3A 1ORTA 2BAGA 5KNLA 3TLEA 4M1KA 2TMKA 1QVGB 1XMVA 5ICCA 1G8GA 4OHBA 4TLCA 1RQGA 4C43A 3G9TA 1OFTA 4O2AA 3V1YA 2VDWB 4JUFA 4BVEA 5GOTA 1XZDA 2H3EA 3OSUA 5EWJA 4A73A 3SCZA 5F5NA 4D42A 3K1YA 3P9NA 2JHAA 2QX8A 3M9WA 5KWSA 1EYZA 3K16A 3F5QA 3TW4A 1RJDA 4MR7A 3WWYA 4E4RA 3QXGA 1Y3AA 1C1HA 4IZHA 4V0RA 1OLXA 1JFVA 2NO4A 3U0VA 3OZGA 2WHEA 1UCFA 4C0AC 1QC5B 1E2QA 1ZOIA 3ONFA 1SVMA 2B78A 2W2VA 2NZVG 4EFNA 3EXEA 5I9MA 4MKIA 5CR9A 4JVLA 2QTCA 5FOTA 4WJKB 2B4QA 1XDDA 3FTCA 4PO3X 3D5TA 3A4YA 1H0RA 3T7CA 1J24A 3P4YA 4KFSA 3DPSA 5HS6A 1JG2A 3R20A 3WVNA 3UGQA 3WXBA 3RVLA 1VCOA 4DIEA 1G5TA 5JS2A 2WD7A 3H4TA 3M4YA 1HE5A 1Y8RA 3RRFA 2ZSJA 1U0BB 3WGQA 2FWAA 2HZBA 3OSZA 4IUYA 5BW8A 3CESA 5HKOA 4UDNA 5ICSA 2PCLA 3W7AA 5JFGA 2WZDA 2FV8A 4AI6A 3AVOA 3BE8A 3NVAA 4ND1A 1DQPA 1NE7A 1UT5A 2R6ZA 3GMSA 3R1IA 1FSSA 2GEJA 2PH3A 3LZCA 3JQGB 4TZKA 2AOUA 2J48A 4MRSA 5SZJA 1II9A 2A86A 3UMBA 3HUTA 5FJJA 2C7QA 1G8HA 3D59A 3DGFC 3T06B 4KHPB 1AKNA 1H2ZA 1ENOA 4TWJA 2EJCA 3NCTA 4TYQA 3UHFA 4RTPA 3TCXB 1OPXA 3PGVA 4MUEA 1JBQA 2P6MA 4PZUA 5KJ1A 3RRJA 1A7AA 4ESEA 2GETA 4EYOA 3OIDA 1QYXA 5GV8A 5CM9C 4YBRA 4RPKA 1C1YA 1LVUA 2JIQA 1LV8A 2ZIUB 2RGYA 1TYAE 4BP9A 2PL1A 4KIFA 4UDOA 4YRNA 1F9EA 2Z8YA 2LW7A 3RI3A 5GONF 1B6RA 5C1DA 4L3OA 1TMOA 4XPIA 4JI6B 1U8FO 3UOAB 1XZFA 4P80A 4R3WA 1A9RA 3M1LA 1Y3BE 1WE2A 5CT9A 3KJZA 1RAHA 3RCBA 1XMPA 4N7RA 4MO9A 5A6VA 5JQGB 1SXQA 2QD2A 1LTHR 3WLPA 1XVIA 2RKOA 4C0QC 4IXDA 1N2GA 4PSDA 2W2KB 1UM9B 4WVFA 5CPBA 4AXXA 3QWIA 2HMUA 4FLEA 2ZTNA 2HPHA 4QUHA 3LPAA 1R37A 3O83A 3GPBA 4AAYA 2ATCA 4GOLD 2JA2A 1NVFA 3O1IC 1AX9A 3E7XA 1GCOA 1PLLA 4RNCA 1DCKA 3IE0A 3P26A 3HO6A 2ES4A 4QIHA 4DIDA 4PX2A 3N2NA 4N8EA 2UYQA 4H1HA 5KHAA 1Y0BA 3BILA 3EIWA 1R5BA 4NVRA 4DZZA 1U81A 1SD2A 4P81A 2PE3A 3HKEB 3RSQA 3B5JA 3TZEA 3NRJA 4FDUA 4HWPA 5EIBD 2QAGA 2PX8A 2PZJA 4XH9B 2WJGA 2XAAA 3U9TA 4TM7A 5D5PA 3T3MB 1US8B 2IDKA 2O57A 4FFWA 4N0PA 1MHPA 1NNI1 1QFSA 3HRHA 4RTQA 3E82A 2BKLA 2FPPB 2IVZA 3A04A 1KP9A 5EIHA 4LYHA 3URKA 1RMYA 2FW6A 1NUQA 1V25A 1V4VA 2I54A 4Z4TA 1K8RA 2NNLD 2VYFA 2YNMC 3G71B 3ADPA 1T29A 1PR0A 3BA1A 3NAZA 1RM4A 4HOYA 1LPMA 4PO9A 4KTTE 5K1ZA 3W6OA 3FOCA 1KMIY 2PUTA 3IPLA 3TFWA 3KZXA 4QRHA 2BR4A 4MUKA 3WDKA 2RC6A 4IO1A 1Q86D 4RZUA 1C8LA 4W1QA 3V46A 4EHNA 3IKTA 1E96A 2CRVA 1AKVA 1CVIA 1LUAA 1R50A 1XVVA 2IFTA 1JSLA 3A2LA 3VOBA 3OIWA 3I6ZA 4LDJA 4OKIA 1EMDA 3O73A 4FN4A 3H9GA 3HI4A 5THQA 1MIOA 5WRFA 1VGVA 3WLIA 3ZV7A 5TMPA 2G0AA 3NVKI 1VI2A 3IIJA 1YONA 4J90A 2O9JA 2AF4C 1PBNA 1M74A 1UQUA 3ASPA 1CBUA 1IWPB 1J90A 1YSCA 2EX0A 3EFOA 3LP6A 4LDAA 2XECA 3T6KA 3DW3X 2QN6A 2Y76A 4H7FA 5L46A 1ULAA 2HJRA 2O1WA 2X8BA 1HX7A 1Q44A 2QTWB 1D03A 5K51A 4B6GA 4TYPA 1QZTA 4C4RA 1PS9A 3GT4A 5CVTA 5C3UA 1M8PA 4QQ8A 5K3CA 1FNBA 3O3MB 3ER8A 1JQKA 3LP5A 2FZKA 1WCIA 5IM4F 2C7GA 3DBIA 4R1LA 1E2UA 1UXOA 5IARA 1B26A 1DPFA 1UKBA 1SB9A 5T4HA 4OREX 1JSZA 2DBRA 1OI4A 3P45A 1TX4B 3H2ZA 2FVGA 4IMRA 5AI0A 5AVKA 1S7GA 1NI3A 2VF8A 3O3NB 4NAHA 3TE6A 3SQWA 1CQJA 3QLVC 4OJTA 2WZPP 1WRBA 3FGOA 4FZJA 4LECA 2IHZA 4C0XA 4F06A 5DI9A 4MMZB 3SIWA 1YX2A 5J47A 2O8FB 1PLJA 1LBIA 4KQEA 5J5CA 1KKUA 1XZLA 2D1TA 4YXWD 3PA2A 4TL6A 4O1HA 5CH5A 2OHHA 2VQSA 1GHTA 2WU3A 3QXXA 1MD9A 4EJFA 3RRZA 1DIBA 3HHPA 2QM8A 4D44A 2GBLA 3DZBA 4ABYA 4L5YA 4BVFA 4AG3A 1VKHA 2RGBA 1EFUA 2KPOA 3BJZA 3G9XA 4DIKA 4QYIB 3LVQE 3QPUA 3ZJTA 621PA 1CX9B 1P18A 3NDRA 1EFPB 2DPXA 3E9ZA 5A5EA 1FDTA 3PFWO 4QATA 4D96A 4DNPA 1CZHA 1EXDA 1EZ1A 3ODPA 3VR2A 4PSUA 4XL9A 2JFWA 3ISXA 1E79D 2MYPA 4RHXA 5FWAA 1A0OA 4J3JA 1WUKS 2P77A 3UHOA 4HVTA 4PQYA 1QB8A 4OPMA 3ZIAD 1EAYA 1PX0A 1YQUA 3EDRA 3GGDA 3IPAA 3CVUA 5TQJA 4LF8B 4MGIR 4NE2A 2VCYA 3QMMA 3IQGX 1EP3B 1TFRA 3GRKA 3N53A 4KWEA 1ZXBA 1L7BA 1PNVA 4H77A 4MEAA 3U19A 1UBNA 4WLNA 1ZJ5A 1VJ0A 1JB1A 1GT6A 2FPSA 2JFFA 3H5RA 4Z0HO 5ILOA 3NO4A 2X9VA 4BECA 5LPNA 1YJNB 4R1OA 1Y63A 3G1WA 1VL8A 1CD5A 1JIUA 1IXSB 1PSWA 4ZT3A 5TMEA 5ECYA 3H13A 3TQIA 3EMDA 4CGZA 1SHUX 4Y2PA 2P67A 2VWQA 2IWRA 1RLJA 3P71T 4WNAB 3WNBA 5CK4A 3GJ8A 4NV1A 3L7YA 2J9YB 4IIGA 1V11A 1B0PA 5FF9A 5CB8A 5FYDA 1HR0B 3A05A 5GOZA 2FUG6 2PS9A 1KTIA 3VDMA 1EFCA 3PUMA 2V6FA 3JQ6A 1MAVA 3ILSA 4GWKA 3ZYCA 1QHIA 4TV9B 3GJ5A 2BW0A 1O6ZA 2YYYA 5E0OA 3MQ4A 3PDCA 4YPOA 5LMCA 3OH8A 2OZLA 2QZSA 2WAYA 3GR6A 3IUPA 4RK1A 1RWBA 4ZK6A 2P9JA 1P39A 2V9PA 4X0EA 3KV3O 5AI5A 5IEBA 5IYZB 1ODTC 1X39A 2XBUA 1O95C 1S8NA 1XVTA 3LOPA 4WUVA 3X1KA 4G37A 4FGJA 2GZ2A 1Z07A 1K2VN 2FKAA 4C08A 3UJ9A 3TECE 3KALA 3BVPA 3WGVA 1ZC4A 4B73A 1P61B 3HYNA 1A9XA 5JAOA 5HTOA 3EH1A 4OPVA 2QUAA 3W5CA 4ZPJA 5KOJA 1Y1LA 2NW6A 3QVKA 1M10A 2XT0A 4I1UA 2FZCA 4JLAA 3N0VA 4PAMA 3FCSB 5FBRB 1EUYA 3I9KA 4LRQA 2OXTA 1X1SA 4YEJA 2IQIA 1XWFA 2ZI4A 3IUSA 4H6XA 1N77A 1D04A 4JLVA 3C48A 2X9NA 2CCGA 1X0XA 3S2EA 8AT1A 1TCCA 4D9CA 4U5QA 4RHEA 2OTCA 3EXG2 1JDNA 4EGFA 3DL4A 2O7RA 4WKCA 2C54A 3FKJA 1L7QA 5K4AA 4YK7A 2VQFB 4JR0A 1Z6TA 3K8ZA 3HZRA 3NBUA 2Y1OA 3PGA1 3G7UA 1W4RA 2P2ZA 2NU9B 5B1SA 3K9GA 3HCCA 4ILEA 5FPKA 3O9ZA 2ORED 3U39A 1BU5A 2JCGA 2ZLBA 4G4IA 3BXFA 3Q2OA 2XB8A 4WCVA 5IJWA 5MHTA 3L0ZA 1E2LA 4A26A 4QEZA 2CXQA 1VSBA 3HU2A 3BIOA 2G76A 4EB6A 1CUBA 1TQ6A 5JMPA 3VO2A 1JDZA 3FDZA 2OPHA 1EP2B 1Y8AA 4A0QA 3B70A 3C3CA 1T0JB 5ALYA 1Y1RA 2ANBA 3IMFA 4PC1A 3VR5H 1I5OA 4BBZA 3KLMX 4HTFA 1S8FA 2NO9A 4BFSA 3R5KA 5DOVA 2C2OA 1JFSA 4MYHA 2PNFA 1TVKA 3ZE8A 3TBFA 4D4MA 1T8SA 1XAGA 2H63A 5FI5A 1HM5A 1R9NA 3ZDQA 3CUVA 4AMUA 4CMHA 4URFA 2AMVA 3ORRA 3TL3A 4DNFA 4DC9A 3ORYA 1Y0RA 3UJ3X 1XZ8A 2QRPA 3F1LA 4KXQA 4NBLA 3R7FA 5KVCA 3MWYW 5JS8A 2D1QA 4MWCA 3MELA 2IS2A 3LQ1A 5LA6A 2VP2A 4PYIA 5DIZA 1KJYA 2N9UA 1QFJA 1MLDA 1FFXB 2ERCA 2ZUSA 4FN5A 3LHIA 4WERA 1XLVA 2KSQA 3KEOA 4N0MA 3TZLA 3WYFA 3GP8A 4B33A 4JLSA 1W35A 4RJLA 1RW4A 1OBHA 1XTUA 3CUTA 1M6YA 5B1IA 3V4OA 2W22A 2AQHA 4BFXA 4DMCA 2H06A 3AJ9A 4Y67A 1DAGA 3AGPA 4UHBA 3ZBQA 3A36A 2FQWA 1SVKA 3ZDAA 2C5EA 4JYCA 4CF3A 2O8DB 5KX5F 5DT9A 2I1WA 4DLPA 1I0ZA 2FB9A 3DDHA 2F48A 2DHDA 4FFRA 1ZN8A 4TWIA 3CEHA 4YPVA 2POQX 2OCXA 1NBOA 1M1XB 4XFDA 1EU1A 2HSDA 2D0OB 4HC4A 4BN4A 1Y34E 4C01A 2BEWA 3PC8A 3VU9A 5B7NA 3DDYA 1QHYA 1KQ3A 4IIJA 2WYVA 2ZULA 3D4LA 2IEAA 1WB5A 1J2YA 3VKWA 3UMVA 4KMMA 3D64A 2O1XA 4YR9A 1Z5PA 1WKBA 1ZNYA 3LRPA 5CPFA 3MAGA 3WY9A 2V4ZA 4DCOA 3CZQA 4ETMA 3U4HA 2Z4RA 1UBSB 1ZITA 2X6QA 3P2JA 3NOOA 4EHKA 1PV4A 1TFUA 1UK9A 4GUDA 4GX0A 1RKQA 3IIEA 1OWLA 4QGAA 3SYRA 3V4VB 3WB0A 3MBOA 3NV7A 3TAHA 3K0HA 4CV0A 3WWOA 4RULA 1A9OA 2IT1A 4MIYA 2R96A 3DKVA 3I3SR 2BFNA 3JZIA 1E1MA 3OZRA 3QXSA 3C0KA 1TU4A 1ORDA 3A1VA 2FFHA 2G9VA 3ELYA 1HDEA 1JA1A 1LSJA 3BC1A 3G88A 1GCUA 3IV9A 4YRMA 1ZWKA 2QSUA 2WYHA 1RKXA 2OXEA 1AU9A 2X4GA 1E3WA 4DREA 1DC4A 3W2HA 1MDBA 4AKHA 2QJOA 1W4CA 2DCUA 1TEXA 3L5KA 2P9QA 2YUTA 2FR8C 3S6JA 2QBYA 1TO2E 1PR4A 5BNTA 1FP4B 1XMJA 4KWTA 2D1SA 2GZAA 4MUMA 4CM1A 4D98A 2GWHA 2I3DA 1KDPA 3KB1A 3OY7A 3REQA 1Q15A 2WUFA 2WMNB 4QXQA 4RE5A 3NAQA 3PC6A 2G9ZA 2XA2A 1J2UA 4L9WA 1FC0A 1Z7GA 1DEKA 2Y0CA 3AHGA 2YICA 1OXTA 1ACLA 1GXSA 3IALA 5ADUS 5JZVA 3GGJA 3VH4A 4L5CA 3Q8MA 1T13A 4H3HB 2A9PA 1F0YA 3MTJA 4BO5A 1SD5A 2RHRA 1NI5A 4EGQA 3I8XA 5ICMA 1RHRA 1GVNB 2G1KA 4EARA 3NAMA 1DAOA 1H4VB 4W1PA 2YCBA 5BVHA 3EWSA 4FKZA 4N1AA 1E9FA 1ZXLA 4G1MB 4ZOQI 1N07A 4V0MA 4XLEA 1WSBA 1V2GA 2F1JA 5G0UA 3CRRA 3BMNA 1J8MF 1V8FA 1T9HA 3NX4A 2JAHA 4HADA 2XUJA 1LDGA 1JAHA 1OA0A 2RHTA 4UVIA 1CUEA 3TUJC 5BYAA 2YZMA 5TPWA 1U0JA 2CVPA 3AEKB 3DOEA 3IUNA 3M1AA 1Y8QA 3NBMA 3O2SB 4OK6A 2I6TA 2GJSA 1E7WA 3BWMA 3F7TA 1I7SB 4GSKA 2AWOA 4KO4S 1GDDA 8ATCA 3GIDA 5GGYA 3MUNA 2VA9A 1ZD9A 1G4AE 1QH9A 1Y3DE 2BUBA 3H5WA 1X0VA 3Q1LA 4Z0TA 1QR6A 3CXRA 2EHJA 4G24A 4AURA 3CCUB 5HJEA 3RYCA 4L15A 1G64A 4NE9A 1H2YA 1V5WA 2AOTA 1W6RA 3CN7A 3JQDA 5C7LO 2ATVA 5BUZA 1M2JA 2J3IA 3ZGXA 4UPDA 4R2MA 2EWMA 2XX3A 4JLPA 2VHJA 1KO4A 5AJZA 3CX3A 1HYQA 1Z3IX 3R6WA 4E30A 2F62A 2JGFA 1H66A 1IIBA 3CBQA 2FXVA 4HN9A 1X77A 3BWDD 3GZNB 2LIVA 1ACJA 4JYZA 4HIZA 3OZFA 4NPCA 1HE1C 1OV4A 2K2QB 2OMKA 2VF5X 5DBIA 5DPMA 5F7XA 3L1UA 3P5SA 3H7AA 3SFTA 2L0XA 3NHSA 2NYAA 1G17A 2Q07A 1BEEA 5TQ2A 4ARUA 3W9UA 2VBVA 5E38A 3I0NA 5E95A 1EVIA 5KIAA 1JUDA 3A1EA 3SY8A 2NTJA 5G4LA 2O19A 3QI7A 4UFOA 1QFYA 1J9EA 1VSVA 3M9XA 4FEEA 4GPBA 3RG8A 4EATA 2IKQA 2J5QA 5IFKA 1XZMA 3SYLA 4AX8A 2VWPA 5BV1A 4LXIA 5ELLA 1SEVA 2DY0A 2QENA 2FJ0A 2Y1CA 4YP7A 1JNXX 3ZV6A 4DMHA 1K3UB 2HHJA 3WZLA 3THWB 3NHRA 4MVYA 2WSLA 5KDDA 1JIKA 2HUNA 2GPBA 1WDLA 2OAGA 2ZOSA 3DOUA 3H9CA 4LDQA 1EGMB 2NQ2C 5DX8A 3SDBA 3OM1A 4PHHA 3W9YA 5JMTA 1K66A 4M9ZA 2YMPA 1NQUA 2RGWA 1SUBA 2ZIZA 1SEPA 3R7WA 1KWGA 2IC5A 1XCPA 4ZRNA 2CLFB 3A4VA 5HIMA 4L9AA 1AS0A 1K9VF 4JA2A 3S68A 1Z6XA 2O0JA 1YVEI 2GVDC 3B53X 2R6HA 3F5FA 5T3YA 1W7AA 5GZ3A 3HJAA 1Y6JA 3GLSA 3LMKA 4W7HA 2BF7A 1Z8NA 4RHCA 3HCPA 2PWYA 1QVWA 1LSOA 5CFPA 3GNLA 3PUXA 4L0DA 1ISSA 3QPDA 5ALJA 4FHGA 4KX5A 1X87A 1GPBA 1Q0QA 2CB9A 1UT8A 4L5IA 4URWR 3W7BA 2WTUA 4LI3X 5I9BA 3NETA 1XZQA 2CLKB 2NZXA 3N7UA 1CQXA 5D2CA 4FR5A 1BC5A 3TJZA 5H7XA 4M98A 2RH4A 2LR0A 3DTVB 1JG1A 3T1TA 3ESZA 4M1YA 4N9QA 3ZJ5A 3PUKA 2V98A 4ZCRA 4MGEA 5LUAA 1XTIA 4NX2A 2APJA 1P7VA 2HUPA 4MUFA 1NSTA 4HNAB 2Z83A 1Y3HA 2BMEA 4EYGA 3VZBA 2VSOA 3DLPX 3EPPA 2FSUA 3PFKA 4LYYA 2O2XA 2QRKA 2ZIGA 1AB5A 3AW8A 1TUEA 1K7CA 3MGKA 5K3EA 4ZIRB 1Q1GA 1DOAA 4P8RA 4J0CA 1IU9A 3NTRA 3I92A 1ZN9A 4KXXA 5I7WA 3MCAA 2A2ZA 4TKMA 3JX9A 3F98A 2Q0SA 1YDMA 2QIOA 5TQVA 4QTXA 4DLBA 5JY1A 3SVLA 4E2FA 1E5DA 1Q84A 1RE1A 1UIRA 2DP4E 2VJBA 3FB4A 1N5LA 3G1UA 3PKIA 5UKDA 4EB0A 4WBSA 5A3SA 2ZRDA 4WUTA 1H65A 1M6HA 2OK8A 1KK2A 1RKUA 1SNYA 2AI3A 2C9BA 4NJMA 4RKWA 3LDHA 5HF8A 1PQYA 2W2MA 5HDBB 5REQB 2IXTA 2RI6A 4GQAA 4IDBA 3T7IA 5IC4A 2PX3A 2AGVA 5BWNA 2RARA 1OBCA 3GAFA 5B5SA 1N8RD 4RIIA 4ZQFA 4EEZA 2P7HA 2XCRB 4TZ6A 3RVOA 3GJ4A 1GNSA 4OB6A 3VVBA 5DNYB 4QRIA 3EMKA 4DJFC 1HDZA 2OBSA 4XASA 5FTJA 1DX9A 4MI6A 5JCXA 2A9QA 4JC5A 1OB0A 3RUIA 4D9GA 2OHXA 5SZKB 1NQAO 1GRNA 3SLGA 1MGOA 3DWEX 3GPDG 5LQMA 2YMQA 3A3OA 1YJXA 1YZKA 5H0IA 5LQUA 3SDSA 5C5EA 5BN5A 4XVUA 2MOKA 4K9MA 3TLGA 5JSUA 3DB2A 2JATA 3VR6A 5GM2A 3V2HA 1HZJA 3ABOB 3MK31 4HGRA 4KMSA 1NW4A 3V2UA 2D2FA 2MT9A 4Z2AA 1U0SY 1UMBB 4PYLA 2QTBA 2BGTA 4I5FA 1X7ZA 3GBPA 1XQYA 2J3QA 3KSMA 3MBKA 5DOZA 1FUUA 1OBOA 4M2LA 3ZZUA 4FUQA 5H16A 3QJYA 2XKBA 4G9BA 1UPXA 4WBNF 2IH5A 2BELA 2IE8A 2Z58A 4Q9DA 3OKCA 4QJBA 5CVCA 4D0NA 4N40A 4DNRB 4OBXA 1LD3A 3HGTA 1YS1X 1DOHA 1Q1NA 2F59A 1C81A 1W5EA 1TRHA 3ASUA 4ZU1X 1URPA 2OE2A 2ZJOA 2QTNA 3AR5A 4U2CA 4QTYA 3IB6A 2ZCJA 1Z7WA 4A91A 4ZCIA 3GJZA 5EJFA 4PC6A 3U7JA 4EA7A 1LA2A 1YA8A 2QUHA 2RHWA 4IZOA 1VLMA 1PEKE 5IHPA 2Y4NA 1BDJA 1XD2A 1K06A 1NRXA 2P9ZA 3QVGA 4F97A 4YJGB 1KHHA 1MXFA 4ZGBA 1T1IA 1RI3A 3IBSA 1N5MA 3WAJA 2UZ0A 2EARA 2OSVA 1USWA 2B5VA 2QRGA 4BFUA 3IOBA 4XYBA 3WIVA 1Q9SA 4F6RA 3UG7A 1MO5A 3I23A 4NCAA 2R87A 1Q95A 1W47A 1OT5A 4NLLA 4A6EA 3ED5A 2JJ2D 3AWIA 5TF4A 1L2TA 4CR8A 4XPZA 2I4IA 2ZWIA 1VJTA 1Y8CA 1T6ZA 4XRRA 4WW0A 4P33A 1LPOA 2V4DA 1ZGAA 5G0TA 3OZCA 3LYLA 3ENNA 3JRXA 4Z0NA 1XT6A 5T7BA 2ECPA 1EUDA 1TJYA 3DBOB 1AGPA 1PJ8A 3EGXA 4LQDA 2HA6A 4RX1A 1XEAA 3C41J 1OTXA 1AA9A 2LV8A 1TQ8A 5AHWA 2FPRA 3MB5A 1WBDA 5KNCH 5EEHA 1TMGE 1WMSA 5FNVB 3U4IA 5BRJA 4G86A 1IE3A 2D0PB 2GEDA 4JT8A 4JKIA 2YOFA 3VPDA 2BJHA 2QD5A 1DJMA 1HK7A 5HIJA 4X93A 1V16A 4JKYA 1JVBA 2V54A 3GSIA 3QFRA 4RFVA 4X8MA 2J32A 1FRZA 2K2WA 3JD2A 4HZUA 4TSKA 5AHOA 1V5VA 4KKTA 2I6QA 2JI8A 2WFZA 4GPTA 1TJNA 3SF8A 3ZDEA 2P40A 1PK8A 1HMPA 4I1OA 2PUBA 1TAUA 2RDMA 1J5EB 3WFZA 4MJXA 3UOWA 9LDTA 3A25A 4DILA 1M1KD 1V45E 4HDQB 2J45A 2P2YA 2XCQA 2FQXA 3F4LA 3IUEA 4PV7A 2EFYA 4MVJD 1CQWA 3JPWA