2RC6A

Refined structure of fnr from leptospira interrogans bound to nadp+
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
306
Chain Sequence
PTREPQINLFKKSNPYKAKVISNVLLTPETGTGKRPKKEGEALVHRIVLAIDHSAYPYVIGQSGGVIPPGEDPEKKAKGLADVGYTVRLYSIASPSYSFGMKEDNIEFIIKRDNIYNGNIQFKGVCSNYMCDLKPGDEVTMTGPSGKKFLLPNTDFSGDIMFLATGTGIAPFIGMSEELLEHKLIKFTGNITLVYGAPYSDELVMMDYLKGLESKHKNFKLITAISREEKNSFDGGRMYISHRVREQAEAVKKILNGGGRFYICGGPKGMEKGVIEEIQKISGNTGTYEEFKHHLEGAHQLFVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Leptospira interrogans FAD-containing ferredoxin-NADP+ reductase and its complex with NADP+.
pubmed doi rcsb
source organism Leptospira interrogans
molecule tags Oxidoreductase
molecule keywords Ferredoxin-NADP reductase
total genus 86
structure length 306
sequence length 308
chains with identical sequence B, C, D
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2rc6A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2rc6A02
1DARA 1FRNA 2GPJA 1VQ7B 1D2EA 3MCAA 1YJNB 2E1RA 3LO8A 3QFTA 1FRQA 4U9UA 1KJZA 1JB9A 4P3YA 1GAWA 3VO2A 2BF4A 1DG1G 1F60A 3W5VA 1EXMA 2B7BA 3OZUA 3J81k 3VNUA 3CCQB 3B82A 4UAJA 3AVVA 5TY0A 2QTZA 3ZBTA 1GJRA 1TUIA 3AGQA 3CCSB 1R5BA 1FNDA 2GQFA 1EFUA 2OK8A 1VQ8B 4MYUA 2BGIA 4LBVA 3CCLB 1H42A 3E20A 4G1BA 4M1KA 4LBWA 3ZC3A 3I56B 2AHOA 1KK2A 3W2HA 1QGZA 1FNBA 2YWFA 2X3UA 2B7CA 1NJID 3CB4A 1QUEA 3OW2B 1EFCA 1OB5A 2XNJA 4B47A 1G7RA 1TLLA 4DQLA 1IJEA 2EIXA 4PGOA 2QN6A 3QFCA 1EWYA 4P6VF 4K1XA 1F20A 1J9ZA 3JQQA 2HCJB 4LC0A 3CCVB 4YALA 3E1YE 2DERA 2BM0A 1YJWB 3JQPA 2QTLA 1M1KD 3U6KA 2J7KA 1EP1B 3OZVA 2BVNA 3I55B 1ZM9A 5THXA 3U6BA 1GVHA 4C43A 4RD1A 1BX1A 1N8RD 3QSYA 4RD3A 4LBYA 1ZUNB 4G5GA 1VQ6B 4H9GA 4HE5A 1KC8D 1B2RA 5KSWB 1YIJB 4ZGNB 4RD4A 1XB2A 2B5OA 1Q7YD 3P27A 3W2GA 1SM4A 4AC9A 4RD2A 1VQLB 4ZCMA 5JBQA 1YI2B 1G7TA 4ACAA 4BPRA 3QFSA 2FX3A 4PC3A 3QFRA 3CCJB 2RC6A 3QE2A 4YAUA 4RCZA 3SJZA 4AF6A 4YAWA 3WNBA 2ZITA 2DEUA 4WQMA 1KK1A 4B48A 4J0QA 4PC7A 5H59A 1VQMB 1G7SA 1N0VC 3W2IA 2BGJA 3ZZUA 4TMZA 4M0LA 4QFMA 4MYTA 2VNHA 4PC2A 1QFZA 1ELOA 3WNDA 1D1NA 1VQ5B 3AGPA 1JA0A 4IW3B 2BSAA 3W2EA 2R6HA 1R5NA 4LBZA 4YHBA 1JA1A 3P26A 3WY9A 4NBSA 3CCRB 2VZLA 3WNCA 1K73D 4N3NA 3AVWA 2RC5A 4NCNA 1W2BB 3CCEB 4ZV4A 3VNVA 1JNYA 1QG0A 3W5UA 1EFTA 1FNMA 3CMEB 3ZZTA 4M2LA 1DDGA 1VQOB 3G6EB 3ES9A 1DDIA 2QA4B 2BPOA 3CMAB 3V76A 2BN4A 3AVTA 4YAFA 3AVUA 4HE6A 4PC1A 1E63A 3G4SB 2VNJA 5TR9A 1OGIA 3OZWA 3WYAA 3G71B 1BJKA 2OK7A 4DQKA 4B4DA 1GO2A 3CC4B 2CRVA 1VQ4B 4ACBA 1YHQB 4FN5A 3MMPA 4Q7JB 3CC7B 4FK8A 3W5HA 3LYUA 4G1VA 4TMVA 4Y9RA 4Y9UA 2DETA 3CRZA 3VO1A 2PMDA 1QVFB 1GAQA 1VQPB 3LVBA 1E62A 4TN1A 1Q86D 1QGYA 1OGJA 1KK3A 1W34A 4TMTA 3WBKA 3OJXA 1R5OA 1CQXA 2PLFA 2BM1A 1FDRA 1W87A 1GR1A 3A1FA 1CNEA 2XNCA 2C78A 1ZM4A 4R71A 1VQNB 4YAOA 1QFYA 2VNIA 5AN9A 2YWEA 1IB0A 1Q81D 1AMOA 3AVYA 2BV3A 2DCUA 5GV8A 5GV7A 3FJOA 3PENA 3CCUB 1S0UA 3CD6B 1AIPA 3VMFA 1I7PA 1EP3B 2NPFA 1VQ9B 1UMKA 1Q82D 3CC2B 2YWGA 3B78A 4M4SA 1XE1A 4RJLA 1FNCA 1TTTA 3WBJA 1S72B 1KK0A 1QH0A 1SKQA 1K8AD 4AF7A 2HMAA 5H5JA 1TVCA 1YITB 4C0SA 4M53A 2DY1A 1IJFA 1D8TA 1ZM2A 1CNFA 3FPKA 1QFJA 1W35A 4ZGQB 1YJ9B 4B44A 2PIAA 1BQEA 5TV2A 2OTLB 3AVXA 4TMXA 4TMWA 4QHYA 1JJ2B 1N0UA 1M90D 1ZM3A 1QUFA 2BMWA 1BX0A 4Y7CA 1VQKB 1EP2B 1KQSB 3LRXA 2CNDA 1QVGB 4F7DA 1KTVA 1KRHA 2QMUA 3OJWA 4FWTA 3W2FA 1HA3A 5DSZA 4B3XA 1K9MD 1A8PA 3CCMB 3B8HA 4RD6A 4ZCIA 3CPWB 4EH1A 2OTJB 3ZZ0A 2XEXA 2YWHA 4ZCLA 3U2QA 5FA6A 2VYQA 1KD1D 5HXBA 1B23P 2C77A 1U2RA 1E64A 3ZBUA 4PC6A 5EMNA 2HDNB 2VNKA 1OB2A 2D74A 1QGAA 3WXMA 1G7CA 1QX4A 1NDHA 2EFGA 3CW2A 1WDTA 4N3GA 3CXCB 4RCYA 4RD0A 4B43A 2QEXB 1H85A 3I1FA 3JQRA 3MHPA 2QDXA
chains in the Genus database with same CATH superfamily
3M82A 3W7VA 5KKCA 2EBWA 3C3DA 5F5NA 4RTQA 2X2EA 4JUCA 4P26A 1XDUA 3RTBA 4FR0A 1Y8QB 5TQ2B 4AJKA 4LK3A 3U3DA 2BT4A 2K2QB 2QVBA 3MTJA 3BDVA 4JJ8A 1SVOA 4YMHA 1V3UA 3N05A 4ND8A 1H8EA 3JWHA 2FLKA 2V0CA 3DBLB 1GNQA 1VFNA 3GGCA 1S3SA 1VM6A 4PLFA 2XPCA 2F00A 1CETA 2LXNA 4MB6A 3NT2A 5CT9A 3TX2A 1W9HA 4NNOA 1A9RA 5HZAA 5FBVB 4ROSA 2D00A 5CYPA 5LMZA 4YUWA 1F14A 1BTOA 1R8XA 3SVZA 3GR6A 4Z3KA 3FOCA 1M6VB 4HDKB 3RYHB 1V5FA 5TEVA 3HBNA 4DDTA 1B6RA 4OXYA 5THKA 3TBHA 1LWNA 3CCBA 4YLEA 2IXEA 2WU8A 3PHCA 5TY0A 3AR7A 3ZBTA 2OAQ1 4H6WA 4Y6QA 1U4SA 2O2IA 4PLCA 2ZRMA 2WMOB 2D1SA 4HS9A 1TEVA 2BUCA 1RI1A 3UGKA 2H1FA 2R86A 3VU0A 4I1YA 1F8GA 1JXOA 3HFSA 1V8DA 4DZZA 3GFFA 4EUFA 2W9XA 2YUTA 3ML1A 3OOCA 2X8KA 4LBVA 1N6HA 4G5SA 4WESA 4DRXA 4LKOA 4M88A 1RFGE 1WZCA 3I45A 3P2IA 1JJ7A 4AS3A 5GADl 2J07A 2QXTA 1O6FA 1SZDA 4XVQA 3ZC3A 1XZIA 1YS2X 4WCFB 3LT5A 5IDVA 3KBOA 5J3OA 4X90A 5EWJA 2ZQ5A 2IXBA 1JEJA 1N0HA 3JQGB 3NYWA 4MAFA 3S6JA 2BGRA 4NDAA 3D6JA 1ENZA 1V95A 3JQFC 4QU8A 3ROGA 5A4MS 1W2GA 3OH8A 2D2VA 5FBQB 4CEIB 4DCSA 3KWMA 2QX7A 5KVVA 1ENPA 1G19A 2HBQA 1H23A 3LPAA 1TK2A 2G1UA 5DCUA 3RRJA 2YMQA 3W1EA 4E4YA 4YQFA 3T7TA 4DV0B 2Y27A 1YJXA 1H3NA 1RBMA 4NZZA 1JECA 5ULLA 2X0FA 2DCMA 2HB6A 3KSMA 2JFZA 2CUNA 3IT0A 4J43A 5K0TA 3TSAA 4AO8A 3EVZA 2O2SA 1QZZA 3FUTA 1EFLA 3MCWA 2YKGA 4WCFA 4Y6SA 1XNQB 3CR3C 4K81B 3M6UA 2VBUA 2H31A 1JEQB 4GR5A 2XWJI 1M5UA 3M81A 5FXMA 1M1ZA 4RKEA 4YRNA 5J2UB 1EVLA 3I5AA 2QW8A 2XA2A 4IO1A 1UPUA 5DV9A 4GF5A 5DH9A 1C1HA 2WD8A 2WY2D 3SU8A 3RTEA 3G8BA 2XUHA 2ZRLA 1M75A 4L51A 3L9XA 4PHHA 3TSYA 1FVFA 4QOFA 3E9YA 2CSUA 2A0KA 4Q48A 5DM60 5KC9A 3CG4A 1YJWB 1OYOA 1T2AA 1DX6A 1ZICA 4FXPA 3UMBA 3W77A 2ORVA 3SMVA 3U7RA 5TQ0B 2LUOA 1NI5A 1EG7A 3KOYA 1RBZA 1FTYA 2H0RA 3RAGA 2XDQA 4DUGD 3DOHA 3MEQA 4FT4A 3H84A 3MRSA 4P4GA 1T6ZA 4ZVUA 4O4IF 3VR6A 3E8SA 2XUPA 3U7IA 4QVJA 4G0OA 4XGRA 4RD1A 4RD3A 3RIGA 3L7JA 2ZWIA 2P69A 4N01A 4UTVA 5G1OA 2OXTA 1G55A 2RHRA 1I5EA 1X13A 3ENQA 2WD7A 3QWFA 1RXIA 3E1SA 2YHIA 4Y98A 1BW9A 4J1TC 1RAFA 1IY1A 4MB0A 4WBNA 1UZNA 4CUKA 1DXHA 5F7JA 1P0FA 3FKSA 4RTMA 2UZ4A 1N4DA 1R6XA 4KIWA 1JA9A 1U2QA 4IFIA 4DLLA 16PKA 4KHPB 5ARDA 3HCCA 1WHSA 4QUJA 5JSYA 5I7OA 2WZBA 4CMCA 4E46A 4RD2A 2VC2B 3WRWA 3QVJA 4CIDA 1DO8A 2Q0HA 4GHWA 4NJOA 4CTKA 5E9AA 1T1SA 3BKWA 2CL6X 3UB3A 2HWYA 3PUHA 3ZD7A 3BERA 1CJVC 1T3LA 1P2TA 2XITA 2NO0A 3FTQA 4UM7A 4DREA 1TKRA 4OQFA 3GLRA 3QFSA 5MDHA 2FX5A 4GEGA 5K51A 4S12A 1OLSB 4CG0A 3L49A 3UPUA 4BVFA 4ZYVA 3SY8A 3PF8A 1BYIA 4RF2A 3FOFC 2RI0A 1ZJYA 3PR1A 1VHTA 1N6OA 3QKRA 3NBUA 3P5BA 3ZCUA 4IZIA 2W93A 3D02A 3VHXB 4CODB 2CHFA 1NSTA 5DTMA 3T5DA 2XGJA 2ZITA 3O74A 4UZFA 3ICVA 5A3VA 1KEEA 3NU1A 3N59A 4JYMA 5FBKA 3FCCA 4A8JA 1SU8A 2GBFA 5B1DA 3OIVA 1O5TA 3N8NA 5KSYA 1XRMA 1NATA 4K6CA 4OUDA 1SKYB 1MO5A 1Y3HA 1WMDA 2FXVA 2ONZA 2J9FB 3BWVA 4RY8A 3RSCA 1E9SA 2J0VA 1XX6A 2HF8A 2JHPA 3LZDA 2DF8A 4CKWB 4YV7A 4ZEMA 5EAIA 1TUBA 2VNHA 4H3VA 3AHCA 2EW1A 1A9QA 2LWIA 3HFGA 8OHMA 1WOPA 5DHRA 1KS2A 2YN0A 1TC2A 3B6IA 3ADDA 2VBIA 3Q87B 3DE4X 5AW6A 1S8NA 2R00C 2VP2A 4FOTA 1DWPA 3EUEA 1IHUA 1EE9A 1N5DA 3GB9A 3OZFA 3ZE9A 2B5VA 2W4IA 4DIKA 4DR1B 1EDOA 1U9IA 1WX1A 2HC9A 5D6OA 4BNVA 1KWKA 2B6HA 3EGIA 1MZPA 2H8KA 4BQIA 5IJ9A 4UBKA 4ZV7A 1YDFA 4NCNA 3KHUA 5JARA 3THXB 5A7GA 3HUDA 4C6HA 4J75A 1CPYA 3DEKA 4XFDA 2X1LA 1NT2A 4MIOA 4PIMA 4X1IB 4HDOB 2QXYA 1YMVA 2AJDA 1X7XB 3RU7A 3KSZO 4BMXA 5F4OA 1QOPB 2NOAA 3HXTA 4OREX 4R1QA 4B3SB 2D3LA 1ZX1A 4UEKA 3ZZTA 4Q9IA 1MRNA 4TL6A 3CH4B 1B8PA 2C5SA 2ZQZA 2BY4A 3CX4A 4W1QA 5AIAA 2QTNA 1IDOA 4RTSA 3WFZA 4RK0A 4FHZA 2GESA 5DNUA 3D8UA 3HUTA 5CM9C 1J0CA 1EM8A 2P5SA 2NO6A 2IQIA 1AGPA 5IYWA 1CUWA 3IE0A 4AIIA 3KZNA 4EPVA 2XIJA 5JY1A 1ZH8A 1C9JA 3EJ6A 3LQ6A 4NCAA 1C50A 1RI5A 1A82A 1XTKA 5HF6A 1Q5PA 4ZA2A 3Q4GA 5BSWA 3M9WA 2PGLA 3UN1A 2GYYA 1NPTO 4GKVA 3W6PA 2ERXA 5C34B 3UAYA 2QMQA 1Q6ZA 4IZHA 2ZIUB 5JQGF 1LNSA 2EJVA 1RE0A 1GIAA 2QRKA 3U7JA 5ITZB 1QPBA 2GPTA 3HDGA 3R4CA 3MW8A 4C05A 5IHPA 3OE4A 5CVDA 3A27A 1PVOA 4YDSA 4BNWA 3O38A 5IBPA 1RHMA 3S40A 4JCCA 3QMWA 2QVCA 1E9VA 2Q07A 5D3MB 1KSFX 1U2DC 1TKCA 2R48A 5I7SA 2SICE 3U56A 2IP4A 2Y66A 2IXTA 3CW8X 1PNRA 2DH6A 1BHSA 3CC7B 2VIIA 1V9CA 3GVHA 3EEQA 1HDZA 7ABPA 1PFUA 3HP1A 1WPGA 1CNMA 4X97A 3K96A 1DBVO 1JALA 2QPOA 3ILYA 4HF7A 5E1OA 3WBFA 1S2NA 3SEQA 1EFAA 1IU9A 4M21A 1SWVA 2ZIXB 5ESWA 1IQUA 3LC2O 3URMA 1NNUA 2DYKA 5KWEA 3ID6C 2I2BA 4EPRA 1V5IA 2W6JA 3B5JA 3I4LA 1FDUA 4B4OA 3WNZA 4FHFA 4KKXB 3UKJA 4DLTA 4Z4RA 1EH5A 3ZCXA 3SN6A 2CMGA 1N6IA 1NPDA 2GZHA 1FU4A 1O57A 1WW8A 2HDWA 2Q5QA 3HLYA 3IDAA 4D56A 2IBTA 4KOEC 5ABPA 4GKJB 5BSKA 4QTYA 1KSGA 2ECKA 1KTIA 3G7UA 4HP8A 4BASA 2GDJA 4NJEA 1UZAA 5LNK1 4DK1A 2HU8A 1CRQA 2N42A 3CUYA 4XGQA 1OF1A 5FL7A 3DUFB 2ZWVA 3E48A 1PK9A 2JIMA 1RJFA 3M2TA 1X1AA 5LA6F 4Q00A 4JMLA 1XD8A 5AW9A 2F8MA 4XSHA 4F8YA 1R6VA 4WJKB 4HDMA 4COKA 3PL1A 5KVCA 1F7UA 4PFKA 3VZRA 4MB2A 5AHOA 5KOIA 5JYCA 3MHTA 4D26A 2IIVA 3IHWA 4IXWA 1JKXA 4FIDA 4HADA 4MR8A 4ZVQA 4QIHA 1UMCB 3DFZA 2CL7X 4QDTA 4XCXA 2R96A 1VE5A 3L6RA 3OKAA 3KR1A 1R8SA 1P29A 3FRHA 1HFJA 3G8YA 4JELA 1N2IA 2A9JA 4CQLB 3ZVRA 5HTKA 4IJWA 1UBOS 2WKSA 1YHYA 5JAUA 1TZJA 2QJTA 4KQXA 2V45A 1IEVA 1N6LA 4R51A 2Y0DA 4DA6A 2QTCA 2A57A 3RIMA 4EUKA 1BRMA 1UEIA 5BV7A 1O9GA 3X1XA 3FYDA 1M6VA 3VHRA 2H4JA 3LDFA 3ZOZA 2RAVA 2FG7C 1TTTA 1WV0A 2XMPA 4FYWA 5GVSA 2PSSA 3MPOA 1Z82A 5FUMA 4PYLA 2XEDA 3I05A 3TQHA 4L2IA 3GT7A 5DTRA 2CLLB 3AC0A 3B6MA 3QMVA 2L0XA 1I0IA 4Y2XA 5CVEA 5DN6A 3LYLA 4Z0HO 2OGWA 3SC3A 1W25A 5DMXA 6REQA 4EPWA 4X05A 3BAFA 3DYVA 3PBKA 3H5NA 1FCJA 3F5FA 4KB5A 5FYQA 4JLBA 4QXRA 4ZI7A 2IUFA 3D4IA 5KNBH 1R12A 4R1SA 3AUXA 2PTGA 4BUJA 1PZNA 2P62A 4NJMA 3EXEA 5E2BA 5KPDA 3K6KA 1YITB 2C7GA 2G40A 4HDRB 4DMMA 2OR3A 5TMDA 2WU3A 2JAXA 4UBIA 3OZBA 5F1PA 4HEQA 1H2BA 1TJPB 1Y33E 1RKXA 1TF5A 5BYBA 1UBEA 1HR0B 1NVMB 1D8TA 3L8CA 1U3VA 1T6YA 2XJ9A 3HNPA 1JW9B 4BO7A 4TMKA 1DB3A 4W7HA 2AEEA 2GCGA 2GEBA 4CYMA 3JQAD 4B7AA 3EDMA 4RA9B 3D7SA 1ADGA 2OSBA 4TWRA 4X00A 1R74A 1SA0B 4UQOA 2AC4A 2G0NA 1UP6A 3MM4A 1Q12A 5FOVA 1TYBE 2IOFA 3K16A 4LDNA 3EVAA 4R83A 4L4YA 3ZIUA 1LA2A 4G36A 2O2YA 2P3OA 1OT5A 3SJBA 2LV8A 4B9EA 3INNA 1W6UA 2EGHA 1RWOA 4GRIA 2AC7A 1OA1A 2J9YB 3BSSA 3GX1A 3PNSA 1XVVA 2XZDA 3PXDA 4QDJA 3U0BA 4I4CA 5K0SA 1G59A 5A5EA 2CYBA 4MWBA 1JKJA 3EIUA 3P2EA 2OA0A 2C4NA 2ILVA 3OHMA 1N5JA 3CRRA 1ACJA 1RQ2A 1PNOA 3RC2A 3LHSA 3LLUA 3U1VA 3TGPA 1I51A 4XLTA 4GYJA 4LMRA 1BEZA 3AUAA 1ECJA 5JNRA 3M1IA 4K28A 3FPGA 3P94A 4PXYA 3RC9A 1PW7A 2H1WA 1VIYA 4NOKA 2VHTA 2I4NA 2B92A 3QH4A 4NBLA 5DGXA 2H1IA 1JG3A 1E18A 2ZJ1A 2VBFA 3D7MA 4B4KA 3QVSA 5IU6A 4JC0A 1IBSA 1PSWA 4X1KA 4Q0MA 3U1BA 2J5RA 3V4SA 3AZOA 3I9MA 1JLHA 4KLAA 4YRBA 1HA3A 3UANA 1M7HA 1RKBA 2J67A 3F0TA 1HQKA 4Z4ZA 4H7JA 4RHTA 4A16A 2I65A 4A82A 3EQ8A 4RD6A 2J41A 5KVSA 3NI2A 1GOTA 2Y9PB 3DKIA 4NCJA 5TEWA 2B4YA 1LRKA 1OBCA 1U9JA 1ZUD1 3SF8A 3I76A 5TDHA 4DA8A 4X9XA 3U2QA 4FGSA 2FMUA 1SHLA 3M6XA 4MRVA 5CT6A 5CAEB 4LECA 1KJNA 1JF8A 1U11A 2EOAA 2J7PD 2WBLC 1U8TA 3K0CA 1B41A 1I4WA 2XUDA 3OKFA 1I4LD 1RWVA 3F74A 3L77A 3P9SA 4KPUA 5AKIA 1Q16A 4B3IA 3EQ2A 3FFWA 4LISA 5E7MA 4IIJA 4QGHA 4F06A 2VNKA 3RAJA 3ZEAA 1Z15A 3ZWCA 2C7PA 4Q21A 3HL0A 5JZSA 3KDSE 1GGVA 2NTYC 3AHIA 3VGPA 4HVLA 3NRBA 1G5PA 1UFKA 2LD4A 1U02A 5DT2A 1QLHA 1OR8A 1HT3A 2XTZA 3B51X 3KD3A 4BDTA 2GETA 3V1NA 3QVKA 1N36B 4LZNA 2EFCB 3BSFA 1VE7A 4MK4A 5H68A 4B2YA 4MGYR 2RAPA 5SY6A 1QGED 4UCQA 1OVGA 3OA2A 5GOZA 1QPGA 4GR9A 4BFTA 5CB4B 4DF3A 2Q9UA 1UMBA 1QC5B 2V9ZA 2XB9A 2YQ5A 2Z9CA 3CC8A 4NCIA 3ZBQA 2CZCA 2HCTA 3PV0A 4OUDB 3PHGA 3M0EA 5A9SB 5IT0A 2R8ZA 4HVCA 1YH3A 1HM5A 3UV6A 2B20A 1KH3A 2ZWOA 3B3JA 2IU3A 1RYMA 4R8VA 2DFKB 2MSDB 1NXQA 3V42A 2VJAA 2IGTA 4UVIA 5J1SB 2XVYA 1I6MA 1TO1E 2Q5LA 4WLVA 1D6MA 3Q7PA 1NFQA 4LSWA 5AW0A 2HWXA 2Z95A 2J6BA 3GLFE 3A4YA 3W5VA 2HQBA 1NBAA 4LDPA 1HDRA 4PCLA 5K3FA 2VDLB 1UBFA 1G3RA 4ESVA 1WY7A 2CDBA 1PG0A 3RIXA 4DV5B 2GILA 1E66A 3V2HA 3GRVA 4XUGB 2J5QA 4EG6A 5AFSA 3B82A 1GU7A 4KWTA 2QTZA 4FLMA 1L9KA 3QF7A 1XWFA 4IXMA 3GEMA 4DABA 3I2KA 4YAGA 1WOMA 4ZI7B 3M6FA 4YRLA 4G0YA 2C8JA 4E5UA 3KHSA 3DVSX 3OBIA 2DTEA 3TQQA 2F8SA 4PLVA 1VQ8B 3SHOA 1E2LA 1TECE 3O75A 3EZ2A 4QG7A 2AL7A 2V6MA 3OUUA 1CVRA 3RFFA 4BLRA 2OD2A 3KVRA 3LW7A 1DAPA 3OCCA 1ZL2A 1EDBA 2GXSA 3R6KA 2C5HA 1S9DA 1CQWA 1QHGA 2FDCA 4LZAA 4DJ5X 1IUNA 4J94A 4I08A 4M9SA 1XCBA 5JPIA 1U2DA 3QZUA 3Q8XB 2E18A 1EGVB 2OP0A 2WT9A 5L3QA 1W5FA 2OM2A 2X9LA 3A8TA 5FNVA 3ZQUA 3ZJ4A 1DAHA 5CFRA 4DDWA 3GVJA 3OBBA 4TS1A 1TA9A 3L82B 4I50A 5JLJA 2EFDB 1FNBA 1WUHS 1U0GA 4MRMA 3B6JA 4OOVA 3KZOA 1W4RA 1Z5ZA 2YWFA 1KJYA 1K3TA 3ABIA 4G5QA 4E2WA 3O8CA 1P7ZA 3HUEA 1W0JA 1K9VF 4B3JA 5FD8A 1GG5A 1RYZA 1VZ2A 1WXFA 2FKNA 2OB2A 5J47A 3JATA 1OB5A 4BHTA 5JAMA 1L5GB 3A9WA 2I33A 1GM5A 3B9RA 3OTOB 1LDYA 2IIPA 4RSGA 3E9ZA 2VYFA 4MWCA 4EDFA 3GDGA 5DHTA 2YIJA 3GG2A 4K3UA 2VK4A 3R5JA 1TYCA 3HGQA 2OD7A 3K5WA 2WU4A 1J9ZA 1QR2A 4YRAA 1ID1A 1H8ED 2B4KA 2D3NA 3ZI0A 4CQJA 3ZWVA 2DZDA 1WY5A 2V4MA 4IHJB 2YXEA 1Y5IA 1E2HA 1WRBA 4YTEA 5J43A 4X1YA 1YCDA 1TQ4A 4KFCA 3RT9A 1S7CA 3ZCTA 1AXGA 2GPWA 1EP1B 2ON6A 1DTWA 1PZMA 1DBWA 1WD7A 4FLEA 4BO4A 1AQYA 1AZSC 3CF0A 3OQVA 4XYBA 3A1VA 2XJ4A 2UVPA 1K7CA 3UXEA 2PE3A 3DV0A 5TMBA 3BZUA 1E1QD 4MJ3A 2NQTA 1J5XA 1KYXA 4LWOA 2M5SA 5EKTA 1XF1A 1NMZA 1PJAA 4EHIA 1HF3A 1L6RA 2DSTA 3HB0A 1BVRA 4CTNA 5HRAA 5FR2A 3E2PA 5IM5A 2O48X 2RH8A 4YAEA 4IHKA 5AIBA 1VRCA 3PCTA 1RKVA 3I9JA 4GLLA 1ZEJA 3UG7A 3OP4A 2I3AA 2DIEA 1AY0A 1SG6A 1RXSA 1JPNA 3EBLA 3N2EA 1MQ8B 3Q1LA 3A6GA 3Q40A 3LUFA 4FI3F 4HDMB 1A2KC 2H2FA 1Q91A 2C2MA 4B7ZA 4ZC8A 2VT2A 4CBVA 4NZ9A 1TW3A 1G6HA 5C32A 1Y34E 1EFVB 1SM4A 2M32A 3G0IA 2BTQA 1IPEA 1X70A 4D8YA 1TZBA 4US0R 5C5DA 3DR3A 1AF4A 3ZXUB 1EJ6A 3WDSA 3DT9A 2ODNA 2HPAA 5ALEA 3KBBA 1IWOA 2IHVA 1SD5A 4MPRA 1GUBA 3MFQA 1TZ2A 3PUJA 4RORA 5ANRB 4PC3A 2EF0A 4ZAGA 4G8BA 3U61B 1ND6A 2P9BA 5EKSA 2PK3A 5ICSA 3WKCA 1ZDMA 4KQHA 3EAGA 1MC4A 3JASB 5LLTA 1NXWA 1T29A 3ZLTA 1AX9A 1GXSA 3AIIA 4XUEA 3IUJA 3QE0A 3PGKA 4AULA 2P6NA 2JIZD 2Q9CA 2CLEB 4X24A 3AINA 1VQMB 3HCAA 4CG3A 2EYUA 2WAYA 3O21A 1R18A 1RJEA 1VSBA 5KKNB 1H9CA 4P7JA 1UAYA 2CY0A 4D3DA 3C97A 4Z4IA 3PQ3A 3O8LA 3I6MA 5GGXA 1PQWA 2A84A 1GCUA 2YQZA 5TQJA 3D43A 2V9CA 3L7DA 3R3WA 4QOIA 4QGSA 2QX9A 1NIPA 3OEEA 4QRHA 3UUEA 4JVSB 4KR9A 3P97A 4Y2PA 4GYKA 3DGFC 2ISQA 5COQA 2EKDA 4DT1B 3VZCA 2XWQA 4ON9A 3F6CA 3TL6A 2BSAA 1QRUA 5CPBA 2PXHA 1PP4A 4QJ5A 5DHUA 2NXWA 2O0JA 1GNLA 5JMTA 1U0FA 4DMFA 4LF4B 1GZ3A 1L4FA 1U6KA 4H1TA 3R3YA 5TGDA 1G3QA 2CDAA 2I4LA 5UKDA 1IXZA 1JQLB 2NSJA 3CKLA 3Q11A 3WISA 3ELUA 3ND5A 4FB4A 1BGVA 4I4LA 5EOVA 3CKMA 1LDEA 4ZV4A 1D0VA 1YK1A 1EFHA 2IKQA 2A9FA 2TS1A 4ZEXA 4Q4DA 4IILA 2ZL5A 1RMYA 4RBNA 4FJ0A 1HXHA 3A6HA 1DIAA 1C7QA 4N0PA 2O1XA 4E5PA 1F48A 4JBLA 1RT9A 4LDZA 4WJLA 5F52A 3L4JA 2BRUC 2NM0A 3NO4A 3GAFA 5JMWA 3ICQB 5JJIA 3A11A 3OD5A 5EIWA 5HOEA 5ALLA 1L5NA 1TU3A 1Z4OA 2C5EA 4YJFA 4FWBA 4OI2A 2Z6UA 2M1XA 1KBZA 4X6UA 5HIIA 2BCJQ 2B99A 1Q3TA 2FEOA 2SKEA 3NW9A 2JATA 1FYEA 2ZJZA 1ULZA 5JC8A 2ZUEA 1CZKA 3FR7A 5DM2A 2B8WA 4F60A 3HXMA 2PUAA 3K1JA 1QYWA 1YL5A 4UNIA 5NLLA 2FA9A 5K3AA 2CV1A 2Z2XA 4IMJB 4OQMA 2JA1A 1Z37A 2QTGA 3EB9A 1L3CA 3EXIA 4POOA 4DG9A 1TK9A 3CN9A 3U4HA 2VOJA 1SKAA 1Y98A 3V2GA 5B58C 1S7GA 4BDSA 2KS6A 1K7EB 3OZWA 2O14A 3NOQA 3V4LA 3DMGA 3BL5A 2BONA 3O5AA 1L5KA 2RG1A 1BHO1 2Z4RA 4PO9A 3QYPA 2YYSA 4KYTA 4ABTA 1BDMA 1LSOA 2QU7A 3WDLA 1KAHA 3O6VA 3RJ9A 4X3CA 5JATA 3BTSA 1SCUB 2HA6A 5MGNA 1CV2A 1TB4A 2ZE5A 5FUXA 1QK3A 4EABA 1YRLA 3D2AA 4XWKA 3LQKA 4J16A 3BEDA 1MG0A 4O0MA 3FSGD 1XDGA 4NABA 3R23A 4DXHA 5L3SA 4FN5A 3COPA 4K9MA 3W8NA 2DJIA 2XQJA 3QU7A 5EIBD 3IODA 3S2GA 4D4GA 1SCBA 4P33A 2X5KO 1V45E 4Z2AA 5JI2E 4KBFA 4ITUA 5CAEA 1Y1TA 4BNXA 4CDRA 1CB7A 1XD9A 3O03A 4E6PA 2Y0BA 2ANBA 2G7MC 2XYPA 5HEKA 1J7KA 3BMQB 2OPBA 3KOOA 3IUSA 2G1JA 3CRZA 3EF0A 3L92A 3ENNA 3ZGVA 4AP9A 1SCNE 4M83A 2QG4A 1EFPB 4X66B 1BJRE 2JANA 4GQNA 1AKQA 4QJBA 4U0JA 3UHAA 3LT0A 1E3MA 1S9HA 3ZHRA 3VU8A 3GRKA 1SVWA 1W34A 1JLSA 4Y1FA 4F12A 3V32A 3C7KA 3DMHA 5AXCA 5AJYA 4HCJA 1N3IA 4DR7B 3PPVA 2XE8A 1UBHS 2AVNA 1GT91 2ENUA 2PSJA 3NEAA 4JKYA 5AK6A 2O5RA 4ZOEA 4DJEC 4C08A 2Y67A 4DA9A 2BM1A 1PL8A 5J4YA 3M6LA 3MGCA 4ZVVA 1Y4AE 1E6MA 1PQPA 4I50B 4PONA 5IC4A 3WK9A 2I5PO 1IEXA 2B21A 4R71A 421PA 2P41A 2C0CA 1M2NA 4FGUA 3ISJA 3O93A 4G01B 4I4TB 3GMSA 1ZUHA 1Z2OX 4PHCA 1ISHA 4RL4A 2VI5A 3FPCA 1UD2A 2V74B 1JSZA 2Q99A 4AXBA 1FDIA 1UQUA 2IYZA 3AEQA 1FFCA 3IAS6 3QVOA 5EE5B 2C61A 3PGVA 3KEWA 3AHDA 4C3UA 2A0FA 4W1SA 1WU8A 3T7EA 5IM4F 3T5GA 1HNZB 4I9NA 1E9FA 2DRIA 3OQ1A 4ETNA 5DHFA 5HHTA 1ZD1A 1V48A 5FTWA 3ZNNA 5EG5A 4ZEVA 3EFOA 4BXOB 3TN7A 3EGXB 1PR0A 4B73A 2V58A 2WEKA 5K09A 1UK6A 3ESZA 2B37A 1VBMA 4FOOA 3FETA 3A1PA 3CC2B 1IHYA 4HEJA 5EZYB 1NU8A 2EZUA 2YWRA 4CFYA 1A3CA 4HNAA 1DC3A 1KDVA 2A3RA 4GPEA 5SY9A 3LUJA 4JKIA 4X92A 2GXAA 4EFLA 3S1AB 3QUAA 3KAJA 3K1ZA 4C76A 3TQOA 2NG1A 4F46A 5TGZA 2H7YA 3J7AC 2ZSBA 4N6OA 4PHGA 5CXQA 1W5EA 2O07A 1AOXA 1XAIA 4JXKA 2FZGA 1K68A 1J00A 2X8JB 1THGA 4JSRA 4ZKDA 1VJ0A 4M0DA 4ZYWA 1NXPA 5CFOA 1VJGA 3USES 4DUPA 1J9EA 4F4IA 3ZUGA 1UQTA 3B1FA 4FZVA 3ZZMA 4EBBA 2VLIA 3AHGA 4XMYA 2I1VB 1PR3A 3LA6A 2ZJ2A 3PDHA 4DBLC 1FQKA 3WJ2A 4P4TA 1FVXA 1G8FA 3LQ2A 2ZZMA 4LNHA 1XXLA 1XL0A 2ZZGA 4YCAA 3ZY2A 1JR4A 4I7EA 1U6JA 2H00A 4O2RA 1JJFA 3GHYA 1U5CA 1EAMA 3SHQA 5ARCA 2QQ0A 2O59A 3NHAA 4MVWA 1YZYA 2BTQB 1I3CA 5EXSA 3T5AA 3R9KA 4AZWA 1ILWA 3GZNA 3WHKA 4DJDC 4HZUA 2WPDA 4C0BA 1CJMA 2QDKA 3TIIA 4HTFA 2CL5A 5DYYA 4CKEB 2ZBUA 3TKYA 2GPNA 4PR3A 2G9UA 1KWGA 2P11A 3QEJA 5DNAA 4CZ2A 1UJ4A 4RJJA 4ZQIA 2ZWPA 1G38A 1T2CA 3Q6QA 2NO7A 2VUSA 4AP6A 5KOJB 4Z4CA 1QUFA 4EEXA 1M1YE 1B73A 1LSUA 3AI3A 3EXIB 4V3BA 3SZOA 3UEOA 3VZBA 3O9MA 3BMOB 2FSSA 4PZDA 3WO0A 3H1PA 4XWGA 4DA4A 5HP4A 2D9RA 3JY6A 1LI5A 3PE4A 4U7PB 2OKGA 4G8DA 3L5OA 1LX7A 2IYLD 2L42A 1TAGA 4ZRMA 3M6AA 1ZL0A 5AVKA 2ALJA 4WNAB 4IEIA 5C8YB 4FWTA 2POCA 3WK6A 4WCVA 3NLLA 4AX4A 3H9BA 1N6PA 1T4DA 3VKUA 4XH9B 3ICCA 3VUFA 4XPIA 2WSYB 2ZB7A 2H8GA 3CLTC 4RUKA 5THQA 5JRZA 2BGGA 4S05A 1IULA 1T8YA 2WWTA 1U1FA 4RF5A 3DOFA 1P6QA 4GOOD 1TRKA 4PQFA 2PXAA 2DFVA 1IC6A 2CKMA 2RHBA 3NPMA 1OFVA 2CNLA 3TIFA 1H4QA 1FP4B 1JYSA 1P91A 4CM4A 2ZYSA 4C7BA 2ZRKA 1HQYE 2OTJB 1NSYA 5HIMA 3IAUA 4GBMA 2POQX 1VHQA 3JCZA 3E6AA 4F8JA 3AEUB 4V02A 4LZZA 4KWEA 5HXBA 5EP1A 5IVPA 5CLJA 2ERYA 5IRCD 3K2EA 2RH4A 3ZCVA 2ZATA 1B23P 2E85A 4JL5A 2C77A 3DH0A 3JVUA 4J2TA 3M5CA 4HH3C 1Z25A 3GPLA 4LXYA 1M1NA 2CMDA 4IMIB 4QEKA 1U2PA 2WMDA 4EJ2A 1MXFA 1JFTA 2J33A 4UUOA 3N2ZB 1YS4A 1DKRA 4KQKA 2RK6A 4P4SA 1W59A 4OFWA 3PFKA 4B87A 1ADJA 2XR1A 3IOBA 4YY3B 4GMXA 1R9MA 2DJ5A 2D1YA 1AKRA 1MFPA 3WXMA 1W46A 3MIIA 1W44A 1X1CA 2ZKIA 3DLCA 3HCBA 3NR2A 4B6PA 3NHSA 4FFNA 1NAHA 3SXUB 3VKHA 5DNVA 3U60B 1YRBA 2VSXA 2YV2A 3AT1A 4U63A 4BJ1A 5JSQA 3Q8WA 3WR5A 4DDMA 3D6HA 4HG2A 4N18A 5FTMA 4RIEA 2JVKA 3OFNA 2ZTGA 4ND8B 1M5TA 2CJWB 2IEGA 2PKQO 4BBJA 2RHCA 3ZNQA 2P4QA 4RK5A 2VXYA 2WAMA 4PYIA 2G63A 4YQEA 1P18A 2IXDA 5H81A 1HYQA 3V6MA 1PZGA 5K0CA 3GRRA 1RHQA 4KO3S 1ZD8A 4CLDA 2A5YB 2OHOA 1YQTA 3X1YA 3PHLA 1YLOA 3AETA 3B7WA 3C0KA 4JB3A 4F93B 4KE9A 2QX4A 4M3NA 2X41A 3VQTA 1MABA 2C9BA 1Q0PA 4LI3X 4LOKA 2E1RA 4FNMA 4PQYA 4TWJA 4Y0NA 3CX8A 4EHDA 2GZ3A 1EPUA 2GK4A 2J45A 1SNYA 3ZKWB 1B6GA 3DKVA 1HH4A 4JVMA 2ZT6A 3ZVLA 1BO6A 2QT0A 3CONA 3SI7A 4LJ5A 1G6KA 4CDMA 4GFDA 5AJXA 4C21A 2R2AA 4CQMD 2QVYX 3N2KB 3GUZA 4EVRA 2VUUA 1C1XA 2WVHA 5F3RA 5I8ZA 4CV1A 1NMSA 1LF5A 4X7BA 4R3NA 1SVLA 3IAXA 2WHPA 4AU1A 2WVAA 2G76A 2B1JA 3L84A 1K0UA 3LLVA 3U5ZB 3TBFA 1Z0UA 2ZBFA 2UYQA 3GY0A 3FHCB 5A0VA 3D6MA 4KE8A 2QTHA 4NIMA 2YZGA 3LQ4A 4R69A 4K88A 4EVIA 4EGJA 5JD4A 1PHRA 3PC6A 3MILA 4MPJA 3TLEA 1RYNA 2BEWA 2RGEA 4E51A 2J7PA 2ZSFA 4C2UA 4MYUA 1COWD 4TYMA 1BS1A 1GCOA 2WI8A 2XOKA 2HUNA 1R0RE 2MYPA 2ONYA 2QR3A 2W43A 2FMKA 2WF9A 2YBEA 2Z8XA 3H1TA 3Q3GE 4W63A 2OCPA 4RIGA 3SIRA 3I2HA 4Q1BA 1W29A 1WOYA 3O91A 3PT9A 2WM9B 1O08A 4MINA 4B45A 2O8EA 3N39C 1ECLA 3RTGA 4FPXA 4HBZA 4P84A 4RMIA 5IWAB 4GGOA 1PWXA 2R65A 2NO5A 2V8BA 1WSRA 3BD9A 1Y37A 1P1HA 3IP6A 3E81A 3Q3HA 3KKOA 3RODA 1CS4C 4RH0A 5A1JA 4V1CA 3FI9A 1DPFA 1GQOA 3P4XA 1QIKA 2C5FA 4BNIA 5BSGA 1YGPA 3V8QA 3T3DA 1O6CA 1T26A 2DPGA 2FTKE 2ODWA 3CF4A 3FNBA 3NGMA 4NP6A 3U4QB 1VIDA 2HJSA 2CFSA 1SXJB 3IQEA 3WVNA 2Z2YA 1EFCA 4O2BF 1DU4A 1H6DA 3KQPA 4HDKA 3RYHA 4DLKA 3W4KA 1TT5A 1UCFA 4RE6A 2VWPA 1GQSA 1R4AA 1ZC3A 1JFVA 1Z8NA 3GN1A 3PWZA 2IZ5A 4Q3LA 1U31A 4MQBA 4TTRA 3V7FA 2X4LA 3IQFA 5EKUA 1X9HA 2COKA 4RKQA 5CPFA 5B58T 4QNMA 1WSAA 4WXHA 1O6BA 2RHTA 4IDQA 2MYUA 1N78A 3IOYA 1R0ZA 4L4ZA 3DC2A 5EHIA 5FLEX 1OX6A 2VYNA 2RAUA 4H08A 1CY1A 3PQCA 9LDBA 1E2BA 1K3UB 2ZBVA 3A1WA 4FT2A 4DIOA 1VLLA 3DDSA 1BEUB 1V5GA 2OV3A 2SCUA 2GF2A 3HHPA 5MN4A 2BFCB 5A71A 4MQFA 4EHKA 4XLAA 4EGFA 4TTQA 1CY8A 1YE5A 3AM1A 2NAFA 4R0MA 4RNDB 3ICWA 1VCHA 1CIPA 4X1OA 3GGDA 4HAIA 4Z7JA 4P2GA 1WZIA 2XCQA 3T7CA 1Y0RA 4X8OA 3HJBA 2D59A 4CR6A 2R00A 1OYYA 3FYUC 4IGIA 2IEIA 4FFWA 3G82C 4M36A 4QRDA 5EYPB 1K7XB 1HQDA 1O95D 4N40A 1UFOA 1Q44A 4TKMA 2NQ2C 1B2RA 3K8ZA 2MWMA 4D9HA 3LCJA 1D09A 3E27A 4WW0A 5JS2A 3AM3A 3E9RA 2O8FA 1Q7YD 2EJBA 5IBQA 3VPFA 2OLJA 3A7DA 3OLXA 1N1MA 1RM0A 2BHSA 3BB1A 1I1QB 2VVTA 1Q77A 2YY5A 4QLOA 2JFBA 4AJ2A 4BMCA 3WAJA 1Z07A 4EF6A 2I8AA 3OOJA 4HRXA 4KUGA 4QA9A 4DR6B 2HFKA 3VOBA 1JHQA 4D9KA 2FW8A 4B6EA 1AQLA 1XRJA 3WADA 2Q6KA 3GJ0A 4YMSA 4DIBA 4NFYA 5FUWA 1L0BA 2X1MA 4ZT6A 2P1ZA 2C0QA 1ZOIA 4KFUA 2HQ1A 4LQCA 2ZSJA 3D2LA 3G0OA 3UF0A 1S02A 3HG7A 4GZ3A 4BYGA 3HVUA 2MSKA 3AHHA 3MGAA 2WJGA 3QXXA 3GQBA 4ZMBA 1VZ3A 2OZLB 2FPIA 2R8PA 3G2JA 3OLYA 5AM2A 6AT1A 1B8OA 3IBGA 2V9PA 1G7SA 1Q7TA 4PPNA 4Y6OA 5JE8A 1HT0A 3T34A 3T5PA 5DOVA 3GUCA 4BEWA 3LLCA 3DCJA 1R4NA 4DCVA 1EIZA 1U7HA 1U8CB 1DKMA 2D13A 2X40A 4EB6A 3UK1A 4JXXA 2G07A 1OBFO 2FFRA 4GZ5A 1U63A 1G4UR 3GP5A 2WTUA 2FPRA 5GWXA 3RE1A 1V8ZA 1GFZA 2C98A 2MSCB 1NVUQ 2QTFA 7YASA 2XBUA 5KYUB 2CDCA 3MWGA 1WOOA 4MGEA 1ZD4A 2AEMA 2GKSA 2I03A 2RHDA 1M1XB 3W2EA 1ADBA 1Q7RA 1P74A 1UJMA 2YFYA 4PXSA 2M6KA 3N7UA 2UZ1A 2J0UA 5F1YA 2X76A 4YPOA 4LF6B 1H5UA 1R6BX 5HDQA 3RTDA 4F3TA 2OZEA 2DTXA 4WZBB 3CCRB 2IJGX 2X3FA 1N9KA 1ZK2A 3X1DA 1JHPA 2YBDA 3TM4A 4Q4HB 2XYRA 1B26A 3FMGA 2WHQA 3I64A 1L4KA 2P3MA 4UTRA 5JAOA 4OLBA 4RZ3A 5ENZA 1HLGA 3GZNB 5EWLB 1CR4A 3E3OA 2ATVA 1N5RA 4WXRA 1SVIA 2F9LA 2QM0A 1FNMA 2UZIR 2E5FA 4OA8A 3IJ5A 2VJLA 3F5MA 4FFBA 1OI4A 1ZJ6A 4L50A 2KB0A 2VXBA 4BLQA 2GN2A 4BO3A 3EZNA 3VTAA 3BH4A 3SP1A 1MVLA 2GD0A 4EL5A 1I3MA 3TKAA 2C3YA 4JLKA 4MV0A 2YNMC 1SUBA 1I1NA 5BV1A 2V7WA 3V76A 1YKFA 1ZEMA 2Q0XA 2RKOA 4IOLA 3M49A 1J0DA 2HJ9A 2JKZA 3OLCX 1XRRA 1YZUA 5L9AA 4OX9B 4JVOA 3ZDBA 2HBZA 3KKPA 3RO7A 4IFBA 3X2EA 5KJ1A 2C9CA 4AKHA 1E3SA 2ZS8A 3ZIAD 2ICAA 3CEHA 5DDIP 1RQNA 4YREA 4PSDA 4ZI5A 4DQKA 1Z6AA 2J3KA 3JZDA 1NBIA 1M8PA 3W6NA 3U49A 3X1WA 3I2IA 3LBYA 4KACA 2JAUA 4Y0VA 3R9IA 1MJNA 2OHHA 2RGAA 5HIKA 1NA5A 1P4SA 2VHZA 2ZS7A 2CE7A 1RYDA 3FNGA 4XDHA 5BO5A 1N2GA 3B5IA 5K0EA 3Q0IA 1GRCA 3DC7A 1M2JA 4WNIA 4C6TB 5CITA 1Q11A 1X7XA 3O4VA 1XFAA 2VP6A 1SIUA 1HSZA 4L15A 4LGYA 5DNWA 3WQZA 1T0JB 2Z9BA 4AMGA 3PFBA 4B5LA 1ISIA 4MA4A 4DUGA 2ZBPA 4FUTA 4QOEA 1YASA 1PG5A 3ZU6A 3K6SA 4C7XA 3AEUA 1Z4LA 4J03A 4G0VA 1XHEA 2O2CA 4K6FA 1UD5A 3GJTA 2BZ1A 2NNWB 1QGDA 2P68A 3EW9A 3H5VA 4HDRA 2AR7A 2PKWA 2OXCA 4JLJA 3A6ZA 1V7ZA 3JD0A 3RS4A 1E6EA 2QLLA 2VJQA 4UMDA 4BWFB 2GCEA 3F1LA 2FN9A 1J2RA 2FN8A 4WUVA 5E2AA 4TN1A 1A76A 1XDBA 1L4BA 3BXEA 5T67A 4EHHA 2X0KA 1TD9A 3M1YA 3AJ9A 4N12A 1K63A 4PLWA 4YMLA 1YTLA 2O2HA 4WZBE 1Z6ZA 3E3MA 5ICFA 4QAQA 4U7FA 1VCMA 3VXKA 5CXSA 2ZUFA 4FXOA 4ZJUA 4GP9A 4GXQA 2C92A 3GEEA 1FFBA 1E79A 1G5IA 4CKCA 1PLJA 4PBRA 5A4FS 2WD7B 2LZ0A 4CL2A 1DJNA 2RBGA 1EJ0A 1GCAA 1DOAA 2QAIA 3LUGA 2FW7A 4IINA 4PTLA 5EWJB 3VU9A 3IDOA 1YBAA 2LDXA 4DA7A 3SICE 4YAOA 4F2PA 1M83A 3EUFA 1PU2A 2CFOA 3K05A 1F4VA 1U90A 4KX5A 4ETIA 5LU8A 5GV8A 4TXLA 5D84A 3RLIA 1T6NA 4D9IA 3LSTA 5HKAA 2BYTA 1LPAB 4TV8F 3IS3A 3KQYA 4RAOA 4ENPA 3FHLA 1U7ZA 2PH1A 2VUHB 3BKXA 4BY9E 3DAOA 3ZKWA 4Z54A 5G53C 3CO0S 3W4IA 2UYCA 4OHMA 4Q39A 2VL7A 2A5DA 1EZZA 2H2DA 3MMXA 2DFTA 4LXIA 2IU0A 2WQ7A 1HT1E 2C0PA 4EPYA 4KITB 2XDAA 2HCFA 3VU9B 1DFIA 4YNBA 2GM4A 2BZ0A 1UMKA 4W8OA 1N5OX 3N07A 5IH3A 4BFZA 2WTNA 2YJ3A 4FFLA 5FWXA 4JHXA 2M6LA 1I7SB 3GDFA 4DCMA 2EERA 4CMJA 3LX8A 4KRXA 4P8RA 1QAQA 2NWQA 4C3VA 1UK8A 3OPNA 1U04A 1O4WA 2A5JA 1Y7HA 2DQSA 4FQ5A 1FBNA 4O1HA 4D57A 2YYZA 4MQ6A 3R1IA 4DV1B 1TQDA 2C3MA 3P9NA 1YBHA 4HFJA 5BNFA 3FNQA 2E1BA 3FPFA 1M1UA 4JEUA 4PQEA 4IMPA 4RA6B 4KN6A 3G0CA 5I9NA 2YXBA 1QV6A 4UHBA 1E59A 2Q2WA 1C9KA 3O2NA 2WWFA 4MKIA 1QM5A 4C87A 1BVHA 2PZBA 1N06A 1PWYE 3OCXA 2ZZKA 2X1VA 3IMFA 4F84A 1N2CB 2J31A 3WRYA 3VJKA 4AG5A 1II8B 2Q5OA 3LA8A 1XQ1A 4ARZA 1JB1A 1G3UA 1K66A 2NPOA 2P5YA 2W7TA 4REQA 5LBIA 5EHGA 4V0MA 4BUCA 3STHA 5LBUA 2VT7A 1X1EA 2VYVA 4DLWA 1VLZA 2IY8A 1BWPA 5SICE 3V4FA 4B44A 3NIGB 4G6IA 3ODGA 2Y3IA 3NHJA 2JA2A 3U4GA 3ROXA 1E3EA 5LZ4A 4KMRA 1S8OA 3I9FA 4GVPA 3LY7A 4X63A 4BE9A 3A0UA 3OWHA 3T8YA 3DXXA 4BVAA 2XZLA 2DE0X 3ITKA 1PZXA 5CEEA 4P98A 4MKRA 3UFBA 4MDHA 3VC7A 4F2WA 1JZQA 4OQNA 3A26A 3JQCA 1WM1A 3HB4X 3KD2A 4NVRA 3CLHA 3T3MB 4WXYB 3H1EA 3C98A 3L1UA 2ZAMA 2HWKA 1BXGB 4LS3A 1KGDA 5ALYA 4EUNA 4AURA 5A9TA 3Q0TA 2E82A 4F04A 3TXAA 2ZI4A 1LY1A 3FAZA 3Q9SA 2ZJ0A 3IKLA 2QMUA 1NZJA 4XWYA 5ALMA 1BZYA 5B2EA 3NJ8A 4HRAA 1MC8A 3K71B 3DNPA 3DLPX 1LEHA 3IPAA 3W2FA 3UWMA 5FUBA 1FSZA 1U1IA 1XP8A 3OPYA 1RAGA 2IV2X 1L4LA 1XQWA 2ZIEA 2XMBA 3KSUA 4GW3A 4WY8A 4RGBA 2GFQA 3W7BA 2H1SA 5FBWB 5JDIC 2FG6C 1VLOA 3I6ZA 1BXZA 3AFOA 4XVCA 5H9VA 5HNKA 2AZDA 1P73A 4LVNA 5EYPA 2PKRA 4ND5A 1KJQA 4P3IA 4MLZA 1PS0A 3PVZA 4LSGA 1T1RA 2WJHA 3P0JA 1C3VA 3ETGA 3DM9B 2GN8A 3AERA 5WRFA 1WPCA 3W79A 4Z3DA 4X6YA 3FLMA 1PQ4A 3T3IA 1GGEA 2FJ0A 2JFYA 3EUAA 5FF9A 3STWA 1ITZA 3RRFA 5JASA 5I9SA 2PO7A 1EX7A 1KMQA 3TQSA 4B7UA 3AY7A 1KAMA 3AVOA 2R8RA 3KB2A 3MWKA 4CNBA 4KE6A 4U9HS 4WKGA 1NI4A 4A27A 2Q49A 3UOWA 5JNTA 3GRYA 3RUIA 4IIBA 3CPHA 3OF5A 3VAAA 2AXQA 4JU9A 2BMEA 1N2ZA 2VEDA 3H7IA 4L4XA 4ZO7A 3WZMA 1MT3A 3QPDA 3PRHA 2ZG6A 5CYFA 5TQ2A 1KZ9A 4XQ9A 3RVJA 3SC2B 4E4RA 1V5EA 3ZV3A 2F17A 3GIWA 3OJFA 1NDHA 3DDYA 2CXHA 4JT8A 3BRWA 4KDFA 1MH1A 4QOGA 1D7OA 4UTXA 4RTLA 4LF5B 1N6NA 1OBOA 1U8YA 2WUDA 4FYYA 4X6XA 4G1MB 1Y7IA 2C7RA 4X1KB 3G13A 5E1DA 1PT6A 3PC2A 1BMFA 3KJXA 3CX3A 1HFKA 2EXXA 4EKGA 2F1JA 1AKUA 2BFPA 4LXQA 1KVQA 4W7IA 4KPEC 2QNBA 1MVOA 2E6KA 2BGTA 3SXPA 4EF5A 1CS0A 4S1PA 1W5TA 1DARA 4TXMA 3DSRA 1IOZA 4IRMA 3RNLA 1DCKA 3ONWA 1LBHA 2PSFA 5CW2A 4JFAA 4ZYXA 1N5IA 1PJLA 4BNDB 1B00A 5L6LB 2QHXA 4CEHB 4UUNA 3MJDA 4WX2B 4XVRA 5KYWA 4B3GA 5TIIA 1AT1A 5DTIA 4Q3NA 3Q2IA 3CVUA 1I24A 4FMDB 1M34A 2O3JA 1AK2A 2Q41A 3IKTA 2IPAB 3AF4A 3D5EA 4K9LA 2AXPA 5EINA 4HC4A 5L95A 1I7LA 2HYIC 4DQDA 4DLXA 4FD3A 1AH2A 4M8SA 2RGGA 5E3IA 3S2EA 3K0CC 4HYYA 5E7QA 4ZALA 3VBCA 2B2NA 3F3SA 3BGSA 4QXMA 4DHEA 3CVWA 1G5FA 3EFEA 4LV8B 4V38A 3OFSA 1W7AA 4MV8A 5JHGB 1XNJA 3HB5X 1NOJA 3K53A 1Q1GA 1UPFA 4P5PA 3RRYA 2KM1A 4EUHA 3SC6A 1A9XA 3RT7A 4YR7A 3AYXB 2Z4TA 3AVVA 1Y6FA 4G97A 3FCYA 3G2PA 4ZGBA 1V1RA 3PTLA 4QXAA 2B2XA 4EYKA 2Q50A 2AOTB 2R6JA 4R2WA 4AG6A 3MJCA 3E1KA 4K87A 4QUDA 1UEXC 1Q1ZA 4GSYA 4OGGA 1YI8A 1QHHB 2VSNA 5IYQA 3KEGA 3VC1A 5LQAA 2PH3A 1QQ5A 3IXQA 2WHEA 2Q28A 3IP9A 3O92A 4JLOA 5FKJA 1Y1RA 2W4MA 4UVEA 3W5JA 4M9ZA 1WHTA 3K9QO 1DC8A 1RQGA 1MAVA 2P2ZA 4CHTA 2V7QD 4Q9AA 5DCWA 3GMTA 3AJEA 4ZJZA 2WHXA 2HU7A 2L18A 1AQ6A 3I73A 2OZKA 5FI1B 1Z7YA 4ZVNA 5KMGA 3ONYA 1C0LA 1O95A 1GTVA 3RS5A 3IEPA 4NDZA 1AB6A 1JQ3A 1I9GA 1ZK4A 4U6NA 3HKBA 3EFBA 1X80A 2B2CA 2H7CA 3NYRA 5L6MB 3U62A 4N5MA 2B7CA 1OTXA 1VYVA 3LV8A 4DA0A 4YUXA 2PPVA 5K3FB 4DYDA 2WV9A 4IDGA 2YICA 4KWCA 3EEFA 4YV1A 3EC7A 4FHCA 7REQA 5G0SA 2WYRA 1Z5NA 1G291 5DYNA 5EXEA 3K9FC 1X15A 1QQ7A 3RF6A 4BN5A 4RDXA 4O3FA 3K9BA 4CGYA 3TNFA 1A97A 1NB0A 1A95A 1JKJB 3THOA 5LOVA 1G8JA 2XA9A 2FQ1A 3CSDA 1NX9A 3QWAA 3G2MA 1G16A 2Q6OA 1Z39A 1ZJ4A 2HREA 2W4QA 3EEBA 1LLQA 3H5AA 3UMGA 5AMXA 3AM4A 3CCVB 4GWGA 3GEPA 3E1YE 4CMKA 4XB6B 1ZG3A 3PVSA 2H07A 4GL4A 3ZDFA 5G41A 3TYXA 2WAAA 3DUWA 2IY7A 3L1JA 3ZLUA 1M1KD 4L16A 4OP1A 5K0ZA 1D2NA 3P4UA 3UJCA 2DLNA 4QYTA 5HZBA 1ZN8A 4MKXA 3AW9A 4LXGA 3ZEIA 5E4YA 3IKMB 4JJZA 2WU0A 1KP3A 2OUIA 3IT1A 3JQ8B 4XM3A 4OQLA 1XPUA 2JZCA 1VJDA 2I4TA 2QRQA 1X1BA 2IVZA 1WCV1 2QN8A 2Z83A 3A2NA 4FFMA 2ZANA 4RX1A 3DF9A 3P9KA 3K6RA 1YZ3A 2GTIA 2AFIB 2W0MA 3MSCA 2CLKB 4O2AF 4MGZR 3MWLA 4Y9DA 4WOBA 4B4VA 1RYEA 1DADA 3NOOA 3D5QA 2XZTA 2D0DA 4H9GA 4HE5A 2W8BB 4NJMB 4P4NA 4A0QA 1KC8D 2C99A 3FYSA 1AHNA 1M73E 1MF7A 4RPGA 4Q9HA 2X86A 3A9TA 4MSUA 2EFHB 1Y42X 2QUZA 3W7AA 4MVJE 5EMKA 3PDUA 3UCEA 5KJ6A 1KJJA 2I2DA 3TRIA 4B82A 2R6CA 1HURA 3HN2A 5AOBA 5TJ9A 5DIZA 4FKZA 1TVKA 3OTWA 4X84A 3TQFA 5K2MA 2WQ6A 1VLVA 2XX3A 2V4DA 4HMPA 5KJCA 1T9ZA 1FVHA 5KQRA 2AFHE 1OX5A 1NBWB 2GSWA 1W52X 3KFVA 5JCPA 1BEEA 4O6VA 1KJ8A 4BO9A 3VYRB 4OBEA 1OFHA 2WT8A 1ZQ9A 3B13B 1QYCA 3K3PA 4OHPA 1KYWA 1JQBA 1NVXQ 2GZRA 1T9KA 4FGKA 2PWBA 4JLAA 4EFMA 1E1MA 2RC6A 5CJ2A 1RC8A 4B74A 4S24A 1T4MA 1I80A 1P2BA 2AB0A 3DQPA 2OV8A 3SBXA 2CD9A 3WLSA 5JFOA 4NS4A 2V7EA 4B48A 1JH8A 3JQBC 2JI7A 3PKJA 1L5OA 2VA8A 1RVDA 1UJCA 4DGQA 5DN9A 3F90A 5JS7A 4D9EA 4XRGA 4ZGGA 3BHMA 1O87A 2BR3A 3P0EA 1JG4A 1F9EA 2CK3A 2V3CC 1OXMA 2JCXA 1J8MF 3QF4A 2XMDA 1MOPA 4L3OA 1PT9A 3W06A 4FE7A 3DP7A 1O1YA 3R5KA 4IVNA 4Z4UA 2ET6A 3DLBA 3MBKA 4S2UA 1Y9AA 3IQGX 2X15A 3T3EA 1DOZA 2JIBA 2A4KA 4K46A 5BSTA 3X0DA 4CCAA 4URWR 5LOVB 3TRFA 2NUTB 4CCYA 3LC1O 4C4PA 1KIFA 4ZKEA 4TYWA 1RPTA 4IGFA 2H4FA 1X7YB 3HCEA 3G1UA 3TPCA 1E3LA 1JVSA 1ZR4A 3MK31 3GGPA 5H16A 1Z0DA 4X20B 2PCLA 3RS0A 2VJPA 2IWHA 5FV4A 4YCNA 2W2TA 2X0JA 3WY9A 1DEHA 3F6PA 4LRYA 4EM6A 4DR3B 3JATB 4PZ0A 1V5VA 1QKIA 3V1MA 1CD5A 4RF4A 4BP3A 3ITDA 2A14A 4UNPA 1NM5A 5AO9A 2X19A 4ROTA 5DX1A 1TNDA 4E32A 4I6EA 1N8SA 1TE2A 2VEOA 3PC3A 4W5RA 5BUZA 2LE0A 1TQHA 4G86A 4RXUA 1C8BA 3O2SB 3I5XA 4P3KA 4K0KB 4OSOA 1RRFA 2FNAA 5SZHB 3G6EB 1J49A 1RLUA 3EH2A 1V9LA 2XIQA 1RVV1 4QGGA 5EL0A 5EIOA 5IVDA 1LU9A 3RU9A 3GCWA 3VX3A 4PAAA 5FTJA 5SV2A 3KKNA 1WQ3A 1HYGA 2H1RA 3C6BA 4LI0A 4FS3A 5IT5A 1IB6A 2C82A 1ODIA 2WABA 3PE3A 1C0PA 1Q0UA 3ZQ4A 1NW4A 1MC1A 3LIPA 2Z1NA 1V6AA 4HE6A 4RPIA 2HLDD 5HMMA 3RK0A 2HV8A 3GU3A 3U7GA 1WNTA 2FUCA 4RPHA 5GPBA 4MMXB 1XPJA 5M5BA 1OIXA 1UOPA 1E5XA 5AVOA 1A9TA 2W6NA 3OQIB 4RVSA 5ECGC 4KXYA 3O7MA 2MCFA 3PR3A 5EJGA 4TV8A 1E6CA 3EXG1 1BJKA 5JYDA 4ZIRA 1YACA 3DTYA 2WV7A 4DVGA 2QJFA 5BNTA 1YS1X 4EUSA 1SHKA 3ZPNA 5FPHA 2D6FA 2ZBEA 4W9NA 4UUMA 2F9MA 2IEDA 2QRLA 2R11A 3N87A 5KWSA 1P4HA 3LBAA 4R41A 3KV1A 1TCBA 1VQ4B 1CSEE 3F67A 4DIMA 1L4UA 2YXNA 2X9GA 2GCNA 4DM4A 1QIFA 4KJZA 5FLYA 1NW3A 4BJ3A 4P3PA 5CFZA 1GZ7A 1DZIA 3PJRA 5DNYB 1PG2A 1U9IC 2AYYA 4YCLA 4J9VA 4R2KA 3VTFA 1C81A 4I81A 1N33B 5E4FA 1V6CA 5TF4A 5KBYA 1GRQA 4QDXA 3MWDB 4HXEB 3GQVA 3MUNA 3FKQA 4YAKA 3IIIA 5DLDA 4YFYA 2AG6A 2NUTA 1EXNA 4YJDA 2BP7A 3AB7A 2WIKA 4M9RA 3TMAA 4A5OA 5HKBA 2IXGA 1YVPA 2C9DA 2P79A 2Z08A 3R6GA 3FOZA 1QP0A 2MU1A 4FCWA 4IVRA 2YRXA 1DAMA 1YO6A 3NGLA 5K8TA 3OZAA 2IYOA 5AVJA 2ZEJA 3T1OA 3ZBPA 2WJYA 3NPAA 3NUGA 4O08A 1QLJA 3WWYA 3TZQA 1WDWB 2WOJA 4D9GA 2VZ8A 1L8QA 3SEZA 1UPBA 3BUSA 3TDMA 3IILA 4OYLA 3ZDZB 4C07A 4OMCA 1MJGA 2WYVA 1DTSA 1T9CA 2F43B 3EDCA 1RAEA 5EJFA 5I45A 2D5AA 3RUPA 1G8GA 1ZM4A 1P81A 1QV9A 2QA5A 4AKSA 2A88A 1NLUA 4HNRA 1WCIA 4H60A 4U8HA 3V33A 5EMHA 5I9BA 5I7RA 1ML3A 2NU7B 3G7SA 4QOSA 3T5BA 1NG1A 4AF8A 2PUJA 1EA7A 2B36A 3FGZA 9ATCA 1IHOA 3MS2A 4D0SA 2Q3JA 1L5YA 2IX3A 1EVEA 2JFUA 4GM4A 5CMLA 4C3OB 3L0BA 4IWNA 3FNRA 2JBAB 3JAKB 5AKKA 4JBYA 5KDLA 4Q4JA 1M34B 1VQ1A 1PNQA 1XU9A 2A0WA 4X60A 3REQB 1ZK1A 3CE6A 2NXEA 3GLHA 3TO5A 4E1BA 3VMFA 3JQBA 1I33A 2OBYA 2QJOA 3NTXA 5AKJA 1POXA 2O9JA 3KB1A 5B36A 5CLFA 2YNMD 2RGNA 2YZKA 3JD4A 1ZWLA 3AF0A 2NTJA 3VNAA 4L8FA 3LYAA 1FFAA 1Q82D 2GDZA 1F8UA 1QB8A 3DOCA 5AJTA 1O9BA 1P3JA 2C9YA 1UXIA 1I7DA 1O2DA 3FBTA 1H69A 1KU0A 4F4DA 4YMUA 1NW7A 3TDKA 1SKBA 2W6ID 2C5BA 1RQPA 2RHLA 5JSKA 4E4TA 1U0TA 3DXFA 3T4EA 6PFKA 5F64A 5IDQA 3T56B 1NE7A 3WMRA 1GQQA 5LB2A 3O0DA 5JMPA 1PTKA 2A59A 2XY4A 5AP9A 5FOTA 1VF7A 2FN4A 1TU4A 2K87A 2ACEA 3AQ4A 5DLPA 3GRAA 5F5XA 4DLZA 1LK7A 1QQBA 3DV0B 5T7BA 4BGUA 2AZMA 4HR7A 5H5JA 3A36A 1W96A 1EESA 1AG9A 3AUTA 3DHVA 2VHJA 4HAZA 1TU0A 2WB4A 3ZXYA 3ETEA 5LWHA 2D5LA 2DY1A 1T0HB 2CXOA 2Q4DA 3JVDA 2CJYA 4MGIR 4WINA 3DKRA 4P12A 3BGWA 4FC7A 3CX6A 2J4CA 2GVZC 3QBEA 4IH9A 3GFOA 4XDZA 5FOUA 3TVYA 3CZCA 3PC8A 3PT5A 1X74A 3OX3A 4NEGA 4YO7A 1NVDA 1S1CA 1TVKB 2SKDA 2HM7A 2UYOA 4JSYA 4QTUB 4W5HA 4YJ3F 3U13A 1EFRD 3CUSA 4INJA 3TR0A 4UTPA 5LM3A 2YJ6A 4U2GA 4WL0A 3TOSA 3AWDA 4RNCA 3HXKA 3GT4A 3N6XA 2IHZA 2ODAA 2BBSA 1NVKA 2A7XA 3LBFA 3AI7A 2C1XA 3H2ZA 3H87A 2NXCA 4R7ZA 4K9DA 2GCOB 2ZR7A 2P75A 4Q03A 4Q3KA 1SC4A 4RKWA 3I32A 3ZWMA 3A8KA 3BD7A 3E0QA 4M46A 5CB8A 2JFPA 3VH1A 4HVTA 3ZE0B 1VPVA 3VSEA 1SUPA 5K8CA 5JR3A 1PGPA 1S3FA 3LKDA 5JG7A 3AP3A 3KQMA 1STOA 2FK7A 3PHHA 2ZVPX 5ALFA 1NVBA 4EY8A 4MHTA 3MIZA 1SIOA 4DZTA 1ZLYA 2NO4A 3L5KA 2AUNA 2D06A 2L17A 5REQA 1YE8A 4BLOA 2JAOA 2ESRA 5C53B 4GNRA 5H4GA 4JX8A 3UJBA 4BMDA 4E7OA 4MLCA 1G8YA 2GSDA 4KQ2A 1DJLA 4HAOA 1D9ZA 4KXVA 3IFSA 3SLRA 4K7JA 4XN0A 1UF9A 1U8EA 1E2PA 3IHTA 4RULA 5KTNA 4IQ4A 2IYQA 5D3KA 3IELA 3V3KA 3PNVA 1L7EA 5AKZA 1ETUA 3RVMA 2OWEA 1YDWA 2HUPA 4M9QA 1NVVQ 1Z73A 4WKPA 1A8PA 1Q0LA 4ICIA 1N8NA 1FF9A 1CT9A 1YIAA 5K8IA 2PT5A 2JK0A 2XNDA 2OO3A 4WOCA 4DB4A 1AK1A 2QT9A 4N0MA 1RM3A 4PLTA 4QU9A 2I6GA 2I87A 4P4LA 1GGNA 3LG2A 1WJGA 2YN4A 3K9HA 4YACA 4N65A 1ZI9A 1PV2A 4YCBA 2EKLA 4XN3A 1Y1KE 4P1VA 2HQRA 4FYIA 4F96A 1MEOA 2YASA 5JWHA 4QQ8A 5FT9A 5C18A 4H31A 4L3VA 1VGQA 3ECSA 2IU4A 5C31A 2NT4A 1XJ0A 5EPOA 3I1JA 1TYAE 2DWPA 2R7NA 5JCXA 1DQSA 2J3DA 2HDNB 3I39X 3K20A 3QV1A 4LC9A 1DQYA 4OAPA 1EBBA 4QBKA 3SSNA 5BMVB 3ZHTA 1FQOA 1AN0A 3A6KA 4W82A 4INAA 4TL7A 3ZGLA 4O4JF 2H63A 5EERA 2BCGY 2W48A 4BVKA 1Y3BE 2NUPB 3IVCA 3UPTA 3FVTA 4JUFA 4AYTA 1V47A 1C3JA 2V6FA 2IDJA 1KF0A 4P6YA 4WEOA 1J2JA 1OKKA 3LIIA 4CLXA 4WZEA 1JHMA 5EJ9A 4J0DA 3KVOA 3A10A 3MMZA 1PEDA 1ZCAA 3BWCA 3ACCA 2PUGA 4IS3A 2C84A 3AKYA 5ENDA 1VE3A 1E3XA 5CLQA 8GPBA 1A4XA 1T0PA 4AKEA 4ANFA 4CMIB 5HQ3B 2A2ZA 3PHIA 4DLVA 4LRSB 3CWQA 1XD2B 1T5TA 1USIA 2MIIA 2W2LD 4MW0A 4PG7A 5IZCA 3HXQA 3QEAZ 3PVDA 3IPCA 2XI4A 3GRPA 4M54A 1D2EA 3DV9A 4LIPD 1WG8A 5HKKA 5EJAA 1RAAA 1OB0A 4KKTA 1Z88A 3FA2A 4Q3CA 1H2ZA 2VQ6A 4ZU1X 3P2OA 3TFOA 1FRQA 1KZGB 1N57A 2QX8A 3GJZA 3K0BA 3RB8A 1GPJA 2G9ZA 1J5PA 1YZKA 3IP8A 1NUUA 2F6RA 4BVJA 1KBQA 1DG1G 4CJXA 3GJRA 2PM8A 1YMQA 2PKEA 1XUOA 2VQDA 3MVEA 5ELLA 1L5HA 3SBDA 3KKKA 4X20A 2FPGB 5HJ5A 3AJ8A 3KXLA 3IRVA 1FTNA 1RJGA 2CVOA 3HA7A 4OATA 3QKUA 1CF4A 1REQB 3E03A 4IFTA 1KQGA 2AE1A 4A2WA 3AJAA 3UMFA 3EEYA 5HMLA 3K0FB 3X1MA 1HOTA 3FOAA 3LZCA 4DBVO 2EP7A 5EI5A 2PZAA 1NRXA 3OJCA 1WTHD 1J70A 3LVQE 4KFRA 5I7UA 5JRDS 2MOKA 1T9DA 2PGOA 3JR7A 1HE2A 1X94A 2O8EB 3TQRA 5KREA 3LH5A 4Z5XA 3DT8A 5EJ8A 4JBWA 2WZNA 1Z16A 3BFVA 3GLTA 3WGLA 1EZ1A 1XFOA 1KI9A 2RH9B 5FULA 3PNPA 3STTA 3UGTA 4OMUA 4PHFA 4OH1A 3CEMA 3NETA 4Z0PA 3R7WB 4EYOA 2GBPA 1U3DA 5IULC 1M2HA 1BHQ1 1NUHA 3LD9A 4G0WA 2EBHX 4E1VA 4QUHA 4R1NA 4D99A 2WYOA 3KYCA 4B3FX 4ZOCA 1CUDA 4V0RA 5JIBA 5LIRA 3U3RA 3FKJA 3MTAA 2F67A 3R24A 3C15C 2O20A 1RHRA 1N2BA 3H4MA 1IBLB 3CBQA 3DPUA 1AUPA 1HY3A 2DUWA 2VHQA 3HJNA 3WK7A 4W9NC 4MDFA 3E82A 5I3ZA 3P9XA 1QU2A 4YECA 1E5VA 3S70A 2ZM6B 1DFGA 4C7VA 1CZRA 4J0KA 2NMVA 1HDYA 4RPLA 5LVAA 4OEHA 3RY8A 1Z22A 2AEJA 4G3XA 5H3LA 3Q3EA 3UJPA 5KYTA 2JBAA 5F9HA 1JLRA 2OHIA 1IY0A 2RHWA 4O4HF 1J39A 2KWIA 1FFWA 3VYSB 1U0JA 4YBZA 2OCAA 1OWLA 3FROA 3HDYA 5D5QA 1EYZA 3KYCB 4GYYA 4FQ8A 1X8JA 3AONB 5HIJA 4BU1A 2GN9A 3G85A 1XQYA 3VVLA 3JAMA 3CLKA 3UOGA 3D6UA 1CZOA 2PZGA 3OQHA 1N07A 1CLUA 3LXMA 4FCTA 4Y2UA 5JPCA 2NP7A 4Q4CA 1OXBB 1FYXA 5L3ZA 2COUA 3O1JC 1PYGA 1PYDA 3SQMA 4DQXA 3K70B 2R8BA 2H51A 1EVQA 2PLAA 1E8MA 3O1LA 5I9IA 3N2IA 4L4UA 4YALA 3ZR4B 1DXQA 3LLMA 3C41J 5E6SB 4EKEA 4RZ2A 3QM1A 3S2UA 3Q2OA 3SWWA 2VDQB 1Z7BA 2R5NA 3CUKA 4WLNA 1L5RA 4Z6KA 5ILGA 3U6KA 1PR4A 1Z2NX 4L57A 3GLGE 4TLDA 1MIHA 2WLTA 3KLBA 4OI0A 2XVZA 3QHAA 4MUJA 4J91A 4AY4A 1T5DX 3PD0A 4W5NA 3RG8A 1T5EA 2VDJA 5JECA 5KVQA 1IZ0A 4PYJA 3WJAA 1K6MA 2ZYTX 2QLMA 4RLSA 1KZLA 2G25A 3JQGA 2CBZA 4G5GA 2ZRCA 3FUVA 5EXTA 4BIIA 1Z0JA 2ZM5A 1JQAA 1OXXK 4HFNA 4JXZA 1IQRA 1YS9A 2AG1A 3MS4A 3M6MD 1K2WA 2FPMA 3R6JA 3VSDA 5KSWB 4EI2A 3G7NA 3B52X 2FOXA 1NOKA 1P9LA 1MO2A 3WLNA 3KLOA 2VPXA 3M6VA 4ENSA 4YAIA 1OFUX 3S2FA 4EJFA 1DAIA 4Y8VA 5GMOA 4JBNA 4AC9A 1ACLA 3OWXA 3AR4A 2QP3A 4B33A 4Y2SA 4YS6A 1KERA 3TK1A 3MS7A 5BT8A 1G66A 5BV8A 1EHIA 4BNUA 2CN1A 4B3DA 2DKOA 3CNHA 2Q2OA 1ISRA 4J0GA 5G1PA 4K86A 1LI7A 3IKVA 3WJ7A 1APBA 4GE0A 4AJPA 4OHUA 1YRQA 4O4HA 3AILA 3QFRA 1KDPA 2XYHA 4HGYA 1J20A 3TDNA 4YYEA 1D8AA 1RD4A 1MQSA 4P5EA 2MR6A 3ESQA 5D6NA 3HMKA 4AF6A 4JT9A 3EIEA 3HEMA 4MLDA 3SEFA 1MX3A 4MVJF 5CT5A 3TQTA 3AJDA 4B6RA 2DUMA 1ZQ1A 4IFEA 2NYVA 3O8QA 3AWIA 2ZCJA 5H59A 1NR5A 4D9MA 5C35A 4OHWA 2Q8PA 2V4UA 1M2OA 1N7HA 2EG5A 3MA0A 4ENWA 2IUYA 3COWA 3VC3A 1HMYA 3QPBA 5J3JA 3N7TA 5DGDA 5KNBD 5HIAA 4JLUA 3PUYA 5AVZA 1F2VA 4TMZA 1EUZA 4NU6A 1NFRA 3G2OA 3JWJA 4WGGA 4D4HA 5LDDC 1X42A 1E2IA 4OOEA 2QSJA 3BTVA 4DLRA 2GI4A 1DSSG 1F3LA 4B71A 4MS1B 4A6PA 1XI2A 4E5YA 2LCQA 2VBTA 3EF3A 4KDEA 4FONA 3AFMA 2TECE 4RKFA 1JJAA 1JA0A 1UC9A 3B8EA 3C6XA 1GRRA 4QQKA 4WRRA 5HE8A 4BO0A 1JPUA 4F9EA 1PRYA 3RVSA 1XCGB 4WZKA 3MG9A 2RJOA 5GZ3A 5IYRA 1G20B 1TYZA 221PA 2HCBA 1JA1A 2XKJE 4KFTA 4NBSA 3BJMA 3TUJC 1ZOOA 3TSWA 2VRWA 5JZMA 4N3NA 1CEXA 2H29A 1EJ2A 4JROA 2ZJ4A 1J2TA 4W8HA 4WK4B 4TTPA 2IHYA 1S89A 1NMQA 1NQWA 1U0HC 3EISA 1OA0A 4RQAA 1EX1A 1E0SA 3ISTA 1NONA 4IYJA 1SAYA 2C2HA 1U4OA 3G02A 3HVIA 4H7KA 3A28A 2WW8A 3G1TA 2Z6AA 1DKNA 4I1OA 5HTOA 1EFTA 2CF5A 1SQFA 3IPLA 2I4MA 4LYDA 5CRIA 3P0RA 5DM1A 1DUIA 4GPBA 5JCOA 4A0SA 3ACBA 1NULA 5FL7D 4JB2A 3V8RA 3I9OA 4AMZA 2O1WA 5F12A 3INTA 5IANA 2LW7A 1QTIA 1UZUA 3FTFA 3RVRA 4G26A 3BWYA 1V71A 3QX8A 3UMJA 4IIDA 5DP1A 4NU5A 5FPYA 1G41A 2BBWA 3SNHA 4MUGA 2B8EA 1V2HE 4MUXA 3VR5A 4RSMA 4EIWA 2WUFA 3WLLA 2PYIA 3LF1A 1U9YA 1XMVA 4WWVA 1RXEA 2FFBA 2JK1A 3G4SB 5IAJA 3PIDA 4B32A 2FR8A 1XMQB 1IG0A 1SEPA 4C0XA 4YDHB 1UPXA 3BMCA 1JNXX 5EP4A 4ZYTA 1HE5A 4MJXA 2VDVE 3VR5D 4QXQA 1LBIA 3EAQA 2ZSAA 4A2PA 4DFDA 2AXEA 3HWRA 5AW8A 3WYAA 3VJRA 1PK7A 1JBEA 1CUXA 1K4KA 1NJ2A 3SAJA 2P6RA 1QHIA 4GDMA 2VJIA 1Z35A 5CNKA 4Q3OA 4WOPA 3ROKA 2H4WA 3Q8LA 1NZFA 4F8EA 3ZTTA 3LNTA 3RUHA 3RV4A 4KDCA 5T57A 3VZPA 2PU5A 3PDIB 3D2BA 2CT8A 1Q74A 2JAHA 4XKJA 3KT6A 3OIWA 3T35A 1NXOA 3DD5A 4Y2TA 1XTZA 1CVLA 2YVUA 2Z8YA 1KZ4A 3CYFA 1KXZA 3A3GA 4J1QA 4B6SA 3CRMA 5BY2A 3CFYA 4WCFC 2BDTA 7AT1A 3N5KA 1REQA 1SQ6A 4ER5A 4FK8A 1BFDA 4HWKA 1KSJA 4BZZA 2YV3A 3U44B 3DL7A 4KN9S 4M76B 5E6SA 3OHPA 1NOIA 4JOBA 4HQFA 2WWYA 1BFUA 4N8SA 3CCCA 4WZ6A 3HJTA 4LDJA 3A8JA 3DEZA 1KHHA 2QVXX 3RSGA 1ECCA 4OAOA 2G36A 3OCYA 2DETA 3SIWA 1CDZA 2YV5A 3BN3A 2EP8A 1O03A 4OHFA 2OBMA 1AKEA 4C7JA 2VCYA 4I5EA 1NMYA 1ZGBA 4QVKA 4QSMA 3W78A 3VA7A 1JLKA 2CJFA 2Q3CA 1WEKA 3WBKA 2QJWA 1JR2A 3BOSA 2OZLA 1AS2A 3BXFA 2C8KA 4IDFA 4U6SA 1C9EA 2D0PB 2A1TR 5AUPB 3EPLA 4HDQB 1QIHA 1WB5A 4I1SA 1T6XA 4NF2A 4IQ8A 4RENA 1QMGA 3GZ4A 2FHSA 3O9VA 5IAOA 2V0NA 1FRZA 4YP0A 5GAJA 2ZULA 1L7AA 4X54A 2FAXA 2P4UA 5CH3A 2B7LA 2OORC 3SYNA 4DWJA 2PMKA 4WZLA 1SBZA 3Q3IA 4HXGA 4TTSA 1W6RA 1X8KA 3ORQA 1YHZA 3UTCA 4DRYA 3B1VA 5C8DA 1QFYA 4GXRA 2Y1CA 3RJMA 2OAEA 3FDIA 4WVLA 3K4HA 2I9KA 1OYVA 1G8HA 1RXUA 1Z6YA 4KAAA 4B34A 3KU1A 3OM1A 3SR3A 2HR1A 4C89A 4M38A 4CGZA 3K0EA 2YS6A 5IAAA 4POAA 1R64A 1GSIA 4KX3A 1IHMA 2B78A 2YMLA 3JZAA 3OMXA 4EQZA 2FRXA 5AQEA 4UFNA 5HBGA 1XRSB 2I6UA 3QXSA 1LPPA 1MO6A 3VSAA 2MYTA 1F6WA 1S2OA 1BW9B 2IHTA 4IL5A 1S8AA 5AKGA 2CUTA 2FWAA 1YA6A 2NPFA 4MVJI 5KYYB 3BRQA 4NC9A 4YRRA 3UWPA 1Z2DA 4M37A 1IJKA 3LCCA 4S0XA 1OV6A 1DC7A 2HO5A 2QU8A 4GOND 2Z6VA 1XE1A 1KJIA 1XDWA 2R751 1FUYB 3H17A 2HA4A 3IQHX 4QV2A 1E6LA 3FSGA 4J6FA 3P1JA 1UFRA 2P9QA 3DE1X 2GAFA 4PR0A 2A3NA 1CXZA 3QPCA 1XQVA 1Y0BA 2R9VA 5AVWA 2QY9A 3EQ9A 4O1MA 4JBIA 5IUJC 2HJRA 4EMSA 2YL2A 2Q3MA 3PWSA 1AXRA 1E32A 2HF2A 3BE5A 5IKOA 3ZV6A 1RJ9A 2QZPA 2SCUB 1FY2A 2BI4A 1UK9A 2IELA 4WTOA 1F0NA 4MA5A 1DRKA 4FINA 4RGVA 3OAAA 1U6IA 2DHQA 1PX0A 2Q4RA 4J16C 1AZWA 3JQAB 5E8RA 4R3WA 4DR4B 1KDTA 2FRVA 2B35A 3EY4A 1PZHA 1V1RB 3P9PA 5C5EA 3ER9A 1KRXA 1DL5A 4M9XA 2REOA 2BBTA 4DLUA 5JC1A 1Y4SA 2BD0A 3OZXA 3WIBA 1S2IA 2CC2A 2GRAA 4S2EA 1SK9A 1TTQB 1PZFA 2FPLA 3T1HB 3ZJVA 4TOIA 1GA6A 1BJTA 1PLKA 2E0IA 1XMJA 2EJUA 4ND1A 2WZQA 3LUAA 1N08A 4CM5A 3W3ZB 1LLFA 1XMSA 2A9VA 4E0FA 2WMNB 4GC5A 5LXTA 4DSZA 1TEZA 1V4NA 4KO4S 4F2DA 5HUHA 4DV4B 1HDXA 2CDNA 4E0BA 2B1QA 3K2QA 5INTA 3QEMB 4OJTA 3INGA 5GY7A 2DSNA 2QLNA 3G0BA 1BFKA 4IIFA 4KXFB 4QPNA 5EWMA 3Q1KA 5KOYA 3H5TA 2GNOA 5TPZD 4NCBA 2V55B 1UANA 4LNUB 3C5CA 3TW4A 1NVTA 1IOVA 1BOFA 2PKYX 1OH6A 1CUAA 1Z0AA 3UT0A 5FRDA 1J06A 2FW6A 5BWOA 4E5KA 2C57A 4C22A 1UM9B 2JCGA 1T8WA 2ZXHA 4X44A 3WGTA 2DPHA 2GEFA 3LBHA 1N05A 1CZLA 2YJZA 3QE3A 4YMVA 3DE5X 3KRTA 1N3LA 4QPJC 3LPDA 1HG0A 4QU0A 1X38A 2RGCA 1KQSB 1ZW6A 3AO0B 3QEMA 4QXOA 1VCIA 4A0HA 1LVUA 5D3QA 5IARA 4YEJA 3C7AA 4ID9A 1JHAA 1YQXA 4IQ0A 1JHDA 3FBWA 4GM0A 3FFAA 1X8LA 2P7HA 2HSEA 1OY1A 2H18A 3KUDA 3OEYA 5J40A 1ADFA 3TB6A 4KXWA 1BYUA 3AUJB 4PX9A 4WLEA 4LZPA 2NU8B 3SK0A 4GAEA 4X64B 4JYCA 4L75A 3AEKA 3IMCA 4U02A 3WL3A 3SIXA 4X0EA 2AZXA 1CF9A 3PKZA 1M33A 1O8CA 4QT0A 4ETMA 4F6CA 4AKGA 3JRNA 2IYUA 4N5LA 1SVSA 4Q4AB 4NV1A 3DUFA 3HEBA 2OHJA 2J5KA 1IY8A 1XA3A 3WYFA 3RSHA 2ODEA 4OSPA 1DXYA 5I9MA 3ER8A 3UWOA 1V39A 4QECA 3CPWB 3NVAA 3HCNA 4IKEA 3FVRA 4N7RA