5IYQA

Protruding domain of gii.4 human norovirus chdc2094 in complex with hbga type b (triglycan)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Protruding domain of GII.4 norovirus CHDC2094 capsid
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
total genus 67
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iyqA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iyqA01
3ASRA 4QUZA 4X07A 4P1VA 4X7CA 3Q3AA 2OBSA 4OPSA 3BY2A 3Q6QA 4Z4SA 5E6TA 4RPDA 4RPBA 3RY8A 3PUNA 4ROXA 3SJPA 4QVJA 4OPOA 4P26A 3SEJA 4OP7A 3ASTA 1IHMA 3BQJA 3R6KA 4RDLA 5IYWA 3SLNA 4P25A 4OOSA 5HZAA 3SKBA 4X0CA 5IYQA 4X7EA 3ASPA 3R6JA 4OPVA 3LQEA 5KW9A 4Z4WA 3BY1A 4Z4RA 4WZKA 5J35A 3LQ6A 4RDKA 4WZEA 4X7FA 3V7AA 2OBRA 4RM0A 5F4JA 3PA1A 4OOXA 2ZL5A 5BSYA 3ASSA 3PUMA 2OBTA 4Z4ZA 3ONYA 4X7DA 4P2NA 5F4MA 4QVAA 5F4OA 2ZL7A 3D26A 4QV2A 3Q38A 3Q6RA 4Z4VA 3Q39A 3PVDA 4X05A 4WZTA 5IYNA 3ASQA 4P3IA 3ONUA 5HZBA 4P12A 5J3OA 4Z4UA 5IYRA 4OOVA 4Z4TA 5IYPA 3PA2A 4WZLA 5BSXA 2ZL6A 4RDJA 4RLZA 4X06A 4Z4YA 3SLDA
chains in the Genus database with same CATH superfamily
5B6IA 2HLDA 3CTAA 2Q6LA 4UZUA 2YWFA 3VO1A 2Q6KA 2NV4A 1E1RA 3CMEB 1GAWA 1GO2A 2C4TA 4OPSA 2F1MA 4B47A 1NB0A 1P4MA 1WDTA 4RPDA 4LBZA 1E1QA 2RC6A 2V7VA 1M90D 2QTZA 3VNUA 4ZGNB 2WJYA 3CCVB 3ZZ0A 1JJ2B 2BN4A 3HAGA 4XLAA 2CNDA 5KNLA 3BQJA 1FRQA 1VQOB 3A8IA 2ZBVA 3JQPA 4FK8A 4JMQA 1XFOA 1FDRA 5HZAA 3U6BA 1S72B 2GK7A 3G6EB 4ZCLA 2DETA 2ZTGA 2QDXA 2NPFA 1VQLB 2C5BA 2GQFA 2X6YA 4B43A 1HA3A 1FNCA 1G7CA 2Z6BD 3AGPA 3T56B 1FNDA 3CD6B 3CRZA 2B5OA 4DNRB 4R71A 2BM1A 2ZITA 2QE7A 3R6JA 1T6XA 5KW9A 1QGZA 1I8DA 4YXWA 4YAWA 3OFNA 4B4DA 2W6IA 1JA1A 2BSAA 4PC1A 4TSFA 1VLOA 1PJ7A 4Z4RA 4WZKA 3OW2B 3OAAA 3AGQA 5AN9A 4PC3A 2DIEA 3H9NA 3A35A 3ES9A 1I18A 1HVXA 4M4SA 4P6YA 2WZPP 3WY9A 5TRDA 1RQRA 5HKKA 1WOPA 4YAOA 4OOXA 4DQLA 1R5BA 2DY1A 2VBSA 2HMAA 3OJXA 1N0VC 3QE2A 5BSYA 2QA4B 2C77A 4G5GA 2PE3A 3OJWA 3OPOA 4FN5A 2OBTA 2OYNA 5FO1A 1VQ8B 4ZCMA 4XQFA 3ONYA 3GVKA 4ZCIA 1FRNA 3CPXA 3WBKA 4MYTA 1F60A 4XNFA 3W5UA 3U2QA 3AVYA 1EFRA 1QH0A 1S4MA 4L8JA 4RCYA 1E79A 4QVAA 5DN6A 2ZL7A 4KKTA 4K1XA 4HE6A 1ZUNB 2BF4A 4AC9A 1WSRA 2J7KA 4X05A 4N3GA 4ACBA 1N05A 3ZUGA 1TTTA 1E43A 4G1BA 2XEXA 2XNDA 4P3IA 4DQKA 4P12A 5DSZA 5J3OA 2C78A 4XOPA 2KVOA 3FPKA 1Y0RA 4OOVA 4LC0A 2OTLB 3PA2A 4WZLA 1VHEA 2X53S 5BSXA 3CXCB 5A89A 1SKYB 4XLFA 3W2GA 1DG1G 1W0JA 4XLCA 2V7TA 4YAUA 1YI2B 1WU8A 3AVVA 2VBVA 2V7UA 4IW3B 3DDYA 3CMMA 2PLFA 1JNYA 4HE5A 4PAAA 4X7CA 1VQ7B 1H8HA 3Q3AA 4XD7A 1Q7YD 2OBSA 3GIRA 4RD0A 3CCLB 2OTJB 1KMHA 3AVUA 3AVXA 3LVBA 4Z4SA 2CW5A 4PGOA 4E0FA 2ZZGA 4HIZA 4RPBA 2GREA 3AVWA 1E3ZA 2BGIA 4QHYA 4ZV4A 1VQ6B 3SJPA 1BX1A 3BCDA 1BLIA 1CQXA 1DARA 4J0QA 3SEJA 3P26A 3JU4A 4YEJA 1FNBA 1IHMA 1KK1A 1WSVA 3R6KA 1K73D 1JB9A 5H59A 2VBUA 4XORA 4PC7A 2AHOA 3SKBA 1Q86D 2X85A 4RD1A 3GQBA 1AIPA 1TUIA 1W9XA 4Z1MA 1ZM3A 1YIJB 1YJWB 1VQMB 1WPCA 3V76A 5IYQA 4PC6A 1MABA 1N06A 1E62A 4II3A 4Q7JB 4H9GA 4QFMA 1EWYA 3A1PA 1T6YA 4X8IA 2C4UA 3JQRA 4RJLA 1G7RA 3I55B 4II2A 2CK3A 1H8EA 1VF7A 1N07A 3OEEA 1EP3B 2V7WA 3CCQB 3BY1A 1NDHA 3CCSB 1H85A 2JJ1A 3QFCA 1VQ5B 2XZPA 1EXMA 4XKWA 2WJVA 4B3GA 2PIAA 4G1VA 1QGYA 4X7FA 3V7AA 3ZC3A 1NRKA 1JA0A 2QTLA 1VQPB 1OGJA 2F1LA 3CPWB 2OBRA 1EFCA 2VNJA 1W35A 1SM4A 2WSSA 3CC7B 2ZL5A 4XL9A 2CBXA 3FKSA 4M1KA 1QVFB 4XN0A 4Y9UA 3H94A 2BM0A 2BVNA 2D74A 4TMWA 1YX2A 2QEXB 3CCMB 4Y9RA 2GPJA 2GJKA 2HDNB 4X7DA 4YHBA 2W6JA 2VYQA 3MCAA 3W5VA 2QMUA 1OB5A 3WNBA 3OEHA 4UAJA 1Q82D 3D26A 3CP8A 1BJKA 2GJPA 4M2LA 1G7TA 4AVZA 1AMOA 2WYRA 3U6KA 2DEUA 4FXUA 4WZTA 4XR6A 4XOTA 2VNHA 1YHQB 1VQ9B 2EFGA 2OK8A 1SKQA 4XM3A 3AVTA 3CP2A 4F7DA 1FNMA 1OB2A 1KK0A 1ZM2A 1H42A 3CCRB 1T5EA 1B2RA 2VJJA 3QFSA 2P3MA 3ISXA 3VNVA 1TVCA 5GV8A 3WXMA 4BPRA 1QGAA 3OE7A 2R9VA 2VJIA 2ZZEA 3CCEB 4PABA 4MYUA 4YELA 1S0UA 4QUZA 1NB9A 4X07A 2JN9A 1IJEA 4P1VA 2B7BA 3LNNA 3WNDA 2FX3A 2X0KA 1D1NA 3Q6QA 1VJSA 2ZZFA 5E6TA 1VQKB 1V0EA 2V7XA 5FIUA 3RY8A 4LBWA 3PUNA 1QUEA 3ZZTA 1WOOA 4QVJA 4OPOA 3CCJB 3ZZUA 4P9SA 4TMZA 5KSWB 3ASTA 3WYAA 4RDLA 5IYWA 1BQEA 1KJZA 4C0SA 3SLNA 1NBMA 3W2HA 1D8TA 1RQPA 4OOSA 2ZZQA 5TY0A 3QSYA 4LBYA 3LO8A 3T53B 1VQ4B 4XONA 4TT3A 1YJNB 3W5HA 4B48A 2F4NA 3P27A 2WZNA 4X0CA 1N08A 3B78A 1BX0A 4NNJA 2D3NA 1M1KD 2QGGA 1KQSB 1D2EA 3OZVA 1GJRA 1KZLA 5THXA 1QVGB 5CDFA 3BNWA 3ASPA 5H5JA 2I1LA 3OKXA 3VR6A 3FJOA 4GQNA 4B3FX 2VBTA 5FO0A 4WWVA 4ACAA 1UD2A 4RD6A 3ZIAA 1YJ9B 5IK2A 1QFJA 2WPDA 1QG0A 1KK2A 2QN6A 1XE1A 3VMFA 4RCZA 2XZLA 2HCJB 3A3GA 1QX4A 1CNEA 1EP2B 4RM0A 2RC5A 3OP1A 1YLOA 2CF4A 2M5SA 1EFUA 3ZBTA 1TLLA 1U2RA 1BMFA 3MHPA 3W2EA 5A88A 3QFRA 1GR1A 3A8KA 4KKSA 4TMXA 2ZXHA 1OHHA 4Z4ZA 1W87A 1UD4A 4AF7A 2GJRA 1W0KA 2ZXIA 1CNFA 3CMAB 3CC4B 4YAFA 1WORA 2GK6A 1V0FA 1J9ZA 2Q6OA 2VNIA 4TMTA 1QUFA 3OW7A 4AF6A 4DK0A 5DS0A 3KL9A 4UZEA 2VNKA 4Z4VA 3Q39A 1QFYA 3PVDA 3QFTA 4RD2A 1FX0A 4DK1A 3JQQA 1N8RD 3CESA 2X3UA 3ASQA 2F43A 2BPOA 3ONUA 3W2IA 3B82A 2YWHA 3NE5B 5HZBA 1KRHA 3KEWA 3OZWA 2JJ2A 1WTHD 4Z4UA 5IYRA 1K9MD 4Z4TA 5IYPA 1MRZA 3WQZA 1KK3A 1T6ZA 2ZL6A 3CC2B 3BCFA 4RLZA 2OK7A 4Z4YA 4TMVA 5HXBA 3SLDA 2DERA 2X6XA 1XQBA 2PMDA 2D9RA 3ASRA 4NCNA 3ZBUA 4N3NA 1EP1B 1IJFA 3PENA 4RD3A 1GVHA 3WBJA 5FL7A 1UD5A 5JBQA 1G7SA 2VZLA 2WR8A 3BY2A 3BH4A 3CB4A 2XZOA 2ZBUA 2V4DA 5EMNA 5GV7A 1KC8D 4ROXA 4P26A 2B7CA 3BC9A 4P22A 1QFZA 4OP7A 2V7QA 1NJID 1BPLA 2BMWA 1R5NA 1UMKA 3I56B 4UZFA 3A8JA 1KD1D 2CRVA 4P25A 1PJ5A 2LZJA 2JDIA 1VQNB 5FNZA 4XKVA 4PC2A 3GVLA 4G6IA 1XB2A 2D3LA 4XLEA 4B44A 1ELOA 4C43A 3G71B 2V31A 4G7WA 4X7EA 3G05A 4U9UA 1OB0A 1WP6A 4TKOB 4TN1A 4Y7CA 2R6HA 4YALA 3A3BA 2Q6IA 4G7XA 3E20A 4XLHA 1K8AD 1GAQA 3GVJA 4OPVA 2X8KA 5LMZA 3LQEA 3OZUA 1OGIA 3VO2A 3G4SB 2E1BA 3W2FA 4Z4WA 3T51B 3MMPA 4ASUA 3CW2A 1I7PA 1KTVA 2X6WA 1Y0YA 5J35A 3WNCA 3LQ6A 5FA6A 4XN3A 2FVGA 4RDKA 4WZEA 1DDIA 2EIXA 3OOCA 4P3YA 4LBVA 1R5OA 1N0UA 1ZM9A 5F4JA 1WOSA 3PA1A 3FPPA 4NBSA 1EFTA 1UD8A 1HZEA 1VHOA 3I1FA 4EH1A 4WQMA 3ASSA 3B8HA 3PUMA 2C5HA 2BV3A 1ZM4A 3SJZA 2BGJA 5TV2A 4XMYA 2CC2A 1UD3A 2YWEA 1Q81D 4RD4A 2C2WA 1W2BB 4P2NA 3CCUB 4M53A 2XNJA 5F4MA 1W34A 5F4OA 4P6VF 1E3XA 1A8PA 1V5VA 3Q38A 3Q6RA 4M0LA 4QV2A 5A8AA 1IB0A 4FWTA 1K28D 5L46A 2DOGA 4B3XA 1F20A 4KKUA 5IYNA 4ZGQB 3J81k 2DCUA 1YITB 1UD6A 1PKVA 4DNTB 2XOKA 1Q9SA 1PJ6A 2XNCA 2XGJA 2DYIA 4CQJA 1B23P 3GSIA 1E63A 1E64A 2ZTNA 1VLYA 2YWGA 2JIZA 1COWA 4RDJA 5TR9A 3E1YE 4X06A 1DDGA 3ZPNA 2E1RA
chains in the Genus database with same CATH topology
3ASRA 4QUZA 4X07A 4P1VA 4X7CA 3Q3AA 2OBSA 4OPSA 3BY2A 3Q6QA 4Z4SA 5E6TA 4RPDA 4RPBA 3RY8A 3PUNA 4ROXA 3SJPA 4QVJA 4OPOA 4P26A 3SEJA 4OP7A 3ASTA 1IHMA 3BQJA 3R6KA 4RDLA 5IYWA 3SLNA 4P25A 4OOSA 5HZAA 3SKBA 4X0CA 5IYQA 4X7EA 3ASPA 3R6JA 4OPVA 3LQEA 5KW9A 4Z4WA 3BY1A 4Z4RA 4WZKA 5J35A 3LQ6A 4RDKA 4WZEA 4X7FA 3V7AA 2OBRA 4RM0A 5F4JA 3PA1A 4OOXA 2ZL5A 5BSYA 3ASSA 3PUMA 2OBTA 4Z4ZA 3ONYA 4X7DA 4P2NA 5F4MA 4QVAA 5F4OA 2ZL7A 3D26A 4QV2A 3Q38A 3Q6RA 4Z4VA 3Q39A 3PVDA 4X05A 4WZTA 5IYNA 3ASQA 4P3IA 3ONUA 5HZBA 4P12A 5J3OA 4Z4UA 5IYRA 4OOVA 4Z4TA 5IYPA 3PA2A 4WZLA 5BSXA 2ZL6A 4RDJA 4RLZA 4X06A 4Z4YA 3SLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASR A;  4QUZ A;  4X07 A;  4P1V A;  4X7C A;  3Q3A A;  2OBS A;  4OPS A;  3BY2 A;  3Q6Q A;  4Z4S A;  5E6T A;  4RPD A;  4RPB A;  3RY8 A;  3PUN A;  4ROX A;  3SJP A;  4QVJ A;  4OPO A;  4P26 A;  3SEJ A;  4OP7 A;  3AST A;  1IHM A;  3BQJ A;  3R6K A;  4RDL A;  5IYW A;  3SLN A;  4P25 A;  4OOS A;  5HZA A;  3SKB A;  4X0C A;  5IYQ A;  4X7E A;  3ASP A;  3R6J A;  4OPV A;  3LQE A;  5KW9 A;  4Z4W A;  3BY1 A;  4Z4R A;  4WZK A;  5J35 A;  3LQ6 A;  4RDK A;  4WZE A;  4X7F A;  3V7A A;  2OBR A;  4RM0 A;  5F4J A;  3PA1 A;  4OOX A;  2ZL5 A;  5BSY A;  3ASS A;  3PUM A;  2OBT A;  4Z4Z A;  3ONY A;  4X7D A;  4P2N A;  5F4M A;  4QVA A;  5F4O A;  2ZL7 A;  3D26 A;  4QV2 A;  3Q38 A;  3Q6R A;  4Z4V A;  3Q39 A;  3PVD A;  4X05 A;  4WZT A;  5IYN A;  3ASQ A;  4P3I A;  3ONU A;  5HZB A;  4P12 A;  5J3O A;  4Z4U A;  5IYR A;  4OOV A;  4Z4T A;  5IYP A;  3PA2 A;  4WZL A;  5BSX A;  2ZL6 A;  4RDJ A;  4RLZ A;  4X06 A;  4Z4Y A;  3SLD A; 
#chains in the Genus database with same CATH topology
 5B6I A;  2HLD A;  3CTA A;  2Q6L A;  4UZU A;  2YWF A;  3VO1 A;  2Q6K A;  2NV4 A;  1E1R A;  3CME B;  1GAW A;  1GO2 A;  2C4T A;  4OPS A;  2F1M A;  4B47 A;  1NB0 A;  1P4M A;  1WDT A;  4RPD A;  4LBZ A;  1E1Q A;  2RC6 A;  2V7V A;  1M90 D;  2QTZ A;  3VNU A;  4ZGN B;  2WJY A;  3CCV B;  3ZZ0 A;  1JJ2 B;  2BN4 A;  3HAG A;  4XLA A;  2CND A;  5KNL A;  3BQJ A;  1FRQ A;  1VQO B;  3A8I A;  2ZBV A;  3JQP A;  4FK8 A;  4JMQ A;  1XFO A;  1FDR A;  5HZA A;  3U6B A;  1S72 B;  2GK7 A;  3G6E B;  4ZCL A;  2DET A;  2ZTG A;  2QDX A;  2NPF A;  1VQL B;  2C5B A;  2GQF A;  2X6Y A;  4B43 A;  1HA3 A;  1FNC A;  1G7C A;  2Z6B D;  3AGP A;  3T56 B;  1FND A;  3CD6 B;  3CRZ A;  2B5O A;  4DNR B;  4R71 A;  2BM1 A;  2ZIT A;  2QE7 A;  3R6J A;  1T6X A;  5KW9 A;  1QGZ A;  1I8D A;  4YXW A;  4YAW A;  3OFN A;  4B4D A;  2W6I A;  1JA1 A;  2BSA A;  4PC1 A;  4TSF A;  1VLO A;  1PJ7 A;  4Z4R A;  4WZK A;  3OW2 B;  3OAA A;  3AGQ A;  5AN9 A;  4PC3 A;  2DIE A;  3H9N A;  3A35 A;  3ES9 A;  1I18 A;  1HVX A;  4M4S A;  4P6Y A;  2WZP P;  3WY9 A;  5TRD A;  1RQR A;  5HKK A;  1WOP A;  4YAO A;  4OOX A;  4DQL A;  1R5B A;  2DY1 A;  2VBS A;  2HMA A;  3OJX A;  1N0V C;  3QE2 A;  5BSY A;  2QA4 B;  2C77 A;  4G5G A;  2PE3 A;  3OJW A;  3OPO A;  4FN5 A;  2OBT A;  2OYN A;  5FO1 A;  1VQ8 B;  4ZCM A;  4XQF A;  3ONY A;  3GVK A;  4ZCI A;  1FRN A;  3CPX A;  3WBK A;  4MYT A;  1F60 A;  4XNF A;  3W5U A;  3U2Q A;  3AVY A;  1EFR A;  1QH0 A;  1S4M A;  4L8J A;  4RCY A;  1E79 A;  4QVA A;  5DN6 A;  2ZL7 A;  4KKT A;  4K1X A;  4HE6 A;  1ZUN B;  2BF4 A;  4AC9 A;  1WSR A;  2J7K A;  4X05 A;  4N3G A;  4ACB A;  1N05 A;  3ZUG A;  1TTT A;  1E43 A;  4G1B A;  2XEX A;  2XND A;  4P3I A;  4DQK A;  4P12 A;  5DSZ A;  5J3O A;  2C78 A;  4XOP A;  2KVO A;  3FPK A;  1Y0R A;  4OOV A;  4LC0 A;  2OTL B;  3PA2 A;  4WZL A;  1VHE A;  2X53 S;  5BSX A;  3CXC B;  5A89 A;  1SKY B;  4XLF A;  3W2G A;  1DG1 G;  1W0J A;  4XLC A;  2V7T A;  4YAU A;  1YI2 B;  1WU8 A;  3AVV A;  2VBV A;  2V7U A;  4IW3 B;  3DDY A;  3CMM A;  2PLF A;  1JNY A;  4HE5 A;  4PAA A;  4X7C A;  1VQ7 B;  1H8H A;  3Q3A A;  4XD7 A;  1Q7Y D;  2OBS A;  3GIR A;  4RD0 A;  3CCL B;  2OTJ B;  1KMH A;  3AVU A;  3AVX A;  3LVB A;  4Z4S A;  2CW5 A;  4PGO A;  4E0F A;  2ZZG A;  4HIZ A;  4RPB A;  2GRE A;  3AVW A;  1E3Z A;  2BGI A;  4QHY A;  4ZV4 A;  1VQ6 B;  3SJP A;  1BX1 A;  3BCD A;  1BLI A;  1CQX A;  1DAR A;  4J0Q A;  3SEJ A;  3P26 A;  3JU4 A;  4YEJ A;  1FNB A;  1IHM A;  1KK1 A;  1WSV A;  3R6K A;  1K73 D;  1JB9 A;  5H59 A;  2VBU A;  4XOR A;  4PC7 A;  2AHO A;  3SKB A;  1Q86 D;  2X85 A;  4RD1 A;  3GQB A;  1AIP A;  1TUI A;  1W9X A;  4Z1M A;  1ZM3 A;  1YIJ B;  1YJW B;  1VQM B;  1WPC A;  3V76 A;  5IYQ A;  4PC6 A;  1MAB A;  1N06 A;  1E62 A;  4II3 A;  4Q7J B;  4H9G A;  4QFM A;  1EWY A;  3A1P A;  1T6Y A;  4X8I A;  2C4U A;  3JQR A;  4RJL A;  1G7R A;  3I55 B;  4II2 A;  2CK3 A;  1H8E A;  1VF7 A;  1N07 A;  3OEE A;  1EP3 B;  2V7W A;  3CCQ B;  3BY1 A;  1NDH A;  3CCS B;  1H85 A;  2JJ1 A;  3QFC A;  1VQ5 B;  2XZP A;  1EXM A;  4XKW A;  2WJV A;  4B3G A;  2PIA A;  4G1V A;  1QGY A;  4X7F A;  3V7A A;  3ZC3 A;  1NRK A;  1JA0 A;  2QTL A;  1VQP B;  1OGJ A;  2F1L A;  3CPW B;  2OBR A;  1EFC A;  2VNJ A;  1W35 A;  1SM4 A;  2WSS A;  3CC7 B;  2ZL5 A;  4XL9 A;  2CBX A;  3FKS A;  4M1K A;  1QVF B;  4XN0 A;  4Y9U A;  3H94 A;  2BM0 A;  2BVN A;  2D74 A;  4TMW A;  1YX2 A;  2QEX B;  3CCM B;  4Y9R A;  2GPJ A;  2GJK A;  2HDN B;  4X7D A;  4YHB A;  2W6J A;  2VYQ A;  3MCA A;  3W5V A;  2QMU A;  1OB5 A;  3WNB A;  3OEH A;  4UAJ A;  1Q82 D;  3D26 A;  3CP8 A;  1BJK A;  2GJP A;  4M2L A;  1G7T A;  4AVZ A;  1AMO A;  2WYR A;  3U6K A;  2DEU A;  4FXU A;  4WZT A;  4XR6 A;  4XOT A;  2VNH A;  1YHQ B;  1VQ9 B;  2EFG A;  2OK8 A;  1SKQ A;  4XM3 A;  3AVT A;  3CP2 A;  4F7D A;  1FNM A;  1OB2 A;  1KK0 A;  1ZM2 A;  1H42 A;  3CCR B;  1T5E A;  1B2R A;  2VJJ A;  3QFS A;  2P3M A;  3ISX A;  3VNV A;  1TVC A;  5GV8 A;  3WXM A;  4BPR A;  1QGA A;  3OE7 A;  2R9V A;  2VJI A;  2ZZE A;  3CCE B;  4PAB A;  4MYU A;  4YEL A;  1S0U A;  4QUZ A;  1NB9 A;  4X07 A;  2JN9 A;  1IJE A;  4P1V A;  2B7B A;  3LNN A;  3WND A;  2FX3 A;  2X0K A;  1D1N A;  3Q6Q A;  1VJS A;  2ZZF A;  5E6T A;  1VQK B;  1V0E A;  2V7X A;  5FIU A;  3RY8 A;  4LBW A;  3PUN A;  1QUE A;  3ZZT A;  1WOO A;  4QVJ A;  4OPO A;  3CCJ B;  3ZZU A;  4P9S A;  4TMZ A;  5KSW B;  3AST A;  3WYA A;  4RDL A;  5IYW A;  1BQE A;  1KJZ A;  4C0S A;  3SLN A;  1NBM A;  3W2H A;  1D8T A;  1RQP A;  4OOS A;  2ZZQ A;  5TY0 A;  3QSY A;  4LBY A;  3LO8 A;  3T53 B;  1VQ4 B;  4XON A;  4TT3 A;  1YJN B;  3W5H A;  4B48 A;  2F4N A;  3P27 A;  2WZN A;  4X0C A;  1N08 A;  3B78 A;  1BX0 A;  4NNJ A;  2D3N A;  1M1K D;  2QGG A;  1KQS B;  1D2E A;  3OZV A;  1GJR A;  1KZL A;  5THX A;  1QVG B;  5CDF A;  3BNW A;  3ASP A;  5H5J A;  2I1L A;  3OKX A;  3VR6 A;  3FJO A;  4GQN A;  4B3F X;  2VBT A;  5FO0 A;  4WWV A;  4ACA A;  1UD2 A;  4RD6 A;  3ZIA A;  1YJ9 B;  5IK2 A;  1QFJ A;  2WPD A;  1QG0 A;  1KK2 A;  2QN6 A;  1XE1 A;  3VMF A;  4RCZ A;  2XZL A;  2HCJ B;  3A3G A;  1QX4 A;  1CNE A;  1EP2 B;  4RM0 A;  2RC5 A;  3OP1 A;  1YLO A;  2CF4 A;  2M5S A;  1EFU A;  3ZBT A;  1TLL A;  1U2R A;  1BMF A;  3MHP A;  3W2E A;  5A88 A;  3QFR A;  1GR1 A;  3A8K A;  4KKS A;  4TMX A;  2ZXH A;  1OHH A;  4Z4Z A;  1W87 A;  1UD4 A;  4AF7 A;  2GJR A;  1W0K A;  2ZXI A;  1CNF A;  3CMA B;  3CC4 B;  4YAF A;  1WOR A;  2GK6 A;  1V0F A;  1J9Z A;  2Q6O A;  2VNI A;  4TMT A;  1QUF A;  3OW7 A;  4AF6 A;  4DK0 A;  5DS0 A;  3KL9 A;  4UZE A;  2VNK A;  4Z4V A;  3Q39 A;  1QFY A;  3PVD A;  3QFT A;  4RD2 A;  1FX0 A;  4DK1 A;  3JQQ A;  1N8R D;  3CES A;  2X3U A;  3ASQ A;  2F43 A;  2BPO A;  3ONU A;  3W2I A;  3B82 A;  2YWH A;  3NE5 B;  5HZB A;  1KRH A;  3KEW A;  3OZW A;  2JJ2 A;  1WTH D;  4Z4U A;  5IYR A;  1K9M D;  4Z4T A;  5IYP A;  1MRZ A;  3WQZ A;  1KK3 A;  1T6Z A;  2ZL6 A;  3CC2 B;  3BCF A;  4RLZ A;  2OK7 A;  4Z4Y A;  4TMV A;  5HXB A;  3SLD A;  2DER A;  2X6X A;  1XQB A;  2PMD A;  2D9R A;  3ASR A;  4NCN A;  3ZBU A;  4N3N A;  1EP1 B;  1IJF A;  3PEN A;  4RD3 A;  1GVH A;  3WBJ A;  5FL7 A;  1UD5 A;  5JBQ A;  1G7S A;  2VZL A;  2WR8 A;  3BY2 A;  3BH4 A;  3CB4 A;  2XZO A;  2ZBU A;  2V4D A;  5EMN A;  5GV7 A;  1KC8 D;  4ROX A;  4P26 A;  2B7C A;  3BC9 A;  4P22 A;  1QFZ A;  4OP7 A;  2V7Q A;  1NJI D;  1BPL A;  2BMW A;  1R5N A;  1UMK A;  3I56 B;  4UZF A;  3A8J A;  1KD1 D;  2CRV A;  4P25 A;  1PJ5 A;  2LZJ A;  2JDI A;  1VQN B;  5FNZ A;  4XKV A;  4PC2 A;  3GVL A;  4G6I A;  1XB2 A;  2D3L A;  4XLE A;  4B44 A;  1ELO A;  4C43 A;  3G71 B;  2V31 A;  4G7W A;  4X7E A;  3G05 A;  4U9U A;  1OB0 A;  1WP6 A;  4TKO B;  4TN1 A;  4Y7C A;  2R6H A;  4YAL A;  3A3B A;  2Q6I A;  4G7X A;  3E20 A;  4XLH A;  1K8A D;  1GAQ A;  3GVJ A;  4OPV A;  2X8K A;  5LMZ A;  3LQE A;  3OZU A;  1OGI A;  3VO2 A;  3G4S B;  2E1B A;  3W2F A;  4Z4W A;  3T51 B;  3MMP A;  4ASU A;  3CW2 A;  1I7P A;  1KTV A;  2X6W A;  1Y0Y A;  5J35 A;  3WNC A;  3LQ6 A;  5FA6 A;  4XN3 A;  2FVG A;  4RDK A;  4WZE A;  1DDI A;  2EIX A;  3OOC A;  4P3Y A;  4LBV A;  1R5O A;  1N0U A;  1ZM9 A;  5F4J A;  1WOS A;  3PA1 A;  3FPP A;  4NBS A;  1EFT A;  1UD8 A;  1HZE A;  1VHO A;  3I1F A;  4EH1 A;  4WQM A;  3ASS A;  3B8H A;  3PUM A;  2C5H A;  2BV3 A;  1ZM4 A;  3SJZ A;  2BGJ A;  5TV2 A;  4XMY A;  2CC2 A;  1UD3 A;  2YWE A;  1Q81 D;  4RD4 A;  2C2W A;  1W2B B;  4P2N A;  3CCU B;  4M53 A;  2XNJ A;  5F4M A;  1W34 A;  5F4O A;  4P6V F;  1E3X A;  1A8P A;  1V5V A;  3Q38 A;  3Q6R A;  4M0L A;  4QV2 A;  5A8A A;  1IB0 A;  4FWT A;  1K28 D;  5L46 A;  2DOG A;  4B3X A;  1F20 A;  4KKU A;  5IYN A;  4ZGQ B;  3J81 k;  2DCU A;  1YIT B;  1UD6 A;  1PKV A;  4DNT B;  2XOK A;  1Q9S A;  1PJ6 A;  2XNC A;  2XGJ A;  2DYI A;  4CQJ A;  1B23 P;  3GSI A;  1E63 A;  1E64 A;  2ZTN A;  1VLY A;  2YWG A;  2JIZ A;  1COW A;  4RDJ A;  5TR9 A;  3E1Y E;  4X06 A;  1DDG A;  3ZPN A;  2E1R A; 
#chains in the Genus database with same CATH homology
 3ASR A;  4QUZ A;  4X07 A;  4P1V A;  4X7C A;  3Q3A A;  2OBS A;  4OPS A;  3BY2 A;  3Q6Q A;  4Z4S A;  5E6T A;  4RPD A;  4RPB A;  3RY8 A;  3PUN A;  4ROX A;  3SJP A;  4QVJ A;  4OPO A;  4P26 A;  3SEJ A;  4OP7 A;  3AST A;  1IHM A;  3BQJ A;  3R6K A;  4RDL A;  5IYW A;  3SLN A;  4P25 A;  4OOS A;  5HZA A;  3SKB A;  4X0C A;  5IYQ A;  4X7E A;  3ASP A;  3R6J A;  4OPV A;  3LQE A;  5KW9 A;  4Z4W A;  3BY1 A;  4Z4R A;  4WZK A;  5J35 A;  3LQ6 A;  4RDK A;  4WZE A;  4X7F A;  3V7A A;  2OBR A;  4RM0 A;  5F4J A;  3PA1 A;  4OOX A;  2ZL5 A;  5BSY A;  3ASS A;  3PUM A;  2OBT A;  4Z4Z A;  3ONY A;  4X7D A;  4P2N A;  5F4M A;  4QVA A;  5F4O A;  2ZL7 A;  3D26 A;  4QV2 A;  3Q38 A;  3Q6R A;  4Z4V A;  3Q39 A;  3PVD A;  4X05 A;  4WZT A;  5IYN A;  3ASQ A;  4P3I A;  3ONU A;  5HZB A;  4P12 A;  5J3O A;  4Z4U A;  5IYR A;  4OOV A;  4Z4T A;  5IYP A;  3PA2 A;  4WZL A;  5BSX A;  2ZL6 A;  4RDJ A;  4RLZ A;  4X06 A;  4Z4Y A;  3SLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...