5IYQA

Protruding domain of gii.4 human norovirus chdc2094 in complex with hbga type b (triglycan)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protruding domain of GII.4 norovirus CHDC2094 capsid
publication title Four decades of structural evolution of GII.4 norovirus
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 67
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iyqA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iyqA01
4X0CA 4X7CA 4P1VA 4P26A 3SJPA 3ONYA 2ZL5A 5E6TA 3RY8A 3SLDA 3BY2A 2ZL7A 5BSYA 5IYNA 4RDKA 3ASRA 3Q6RA 4WZEA 4OOVA 4Z4ZA 3LQ6A 5IYQA 5J35A 3PA1A 3V7AA 3ASSA 1IHMA 4Z4YA 4RLZA 4OOSA 4QV2A 3BY1A 4OPSA 3D26A 2OBRA 4X7EA 4Z4RA 5F4JA 4ROXA 4RPBA 4X07A 5IYRA 4QVAA 4X06A 4Z4WA 4WZTA 3PVDA 4Z4SA 4RDJA 4Z4TA 3SKBA 3BQJA 4WZKA 3Q38A 4QVJA 3R6KA 3R6JA 3PA2A 4Z4UA 4OP7A 4P3IA 4X7FA 4RPDA 3SLNA 5BSXA 3Q39A 3ASQA 5F4OA 4QUZA 3ASPA 4P25A 4X7DA 4P12A 5F4MA 5J3OA 3PUNA 4X05A 3LQEA 4RM0A 3ASTA 3PUMA 2OBSA 3SEJA 3Q6QA 4Z4VA 4WZLA 5IYPA 4OPOA 4OOXA 5HZBA 4P2NA 2ZL6A 3Q3AA 4OPVA 4RDLA 5HZAA 3ONUA 5KW9A 2OBTA 5IYWA
chains in the Genus database with same CATH superfamily
2JN9A 1XFOA 1EP3B 3ZC3A 4FK8A 1W35A 2GQFA 1CNFA 5FNZA 1NRKA 1Y0YA 2XEXA 1K28D 4UZEA 3ONYA 1BJKA 3OEHA 3W2EA 2OTLB 1N0UA 4QHYA 1DARA 2VYQA 1XQBA 1I8DA 1G7CA 5BSYA 1FNMA 2GREA 1WSVA 3ZZTA 4E0FA 2ZTGA 4TMZA 2VJIA 1UD6A 1WOOA 1KD1D 2XZLA 1S0UA 4G7XA 1YI2B 3OEEA 3V76A 1G7TA 5H5JA 4II2A 3QE2A 3U2QA 4RLZA 4DNTB 1FDRA 4JMQA 3MHPA 4YALA 2PIAA 4B3XA 1D2EA 1N06A 3D26A 1AIPA 4RD1A 4ZCMA 1T5EA 4G1BA 4X8IA 2ZTNA 4GQNA 3KL9A 1QFYA 2GJRA 5F4JA 1VQ6B 2JJ1A 1XB2A 3CMMA 3QFSA 4Q7JB 4TKOB 4TMWA 5FA6A 3OKXA 1TVCA 3CCMB 1VHEA 4X07A 5IYRA 2VNHA 2OTJB 4Y7CA 4J0QA 4Z4WA 1BX1A 1W34A 1Q82D 3CC2B 2GK6A 5IK2A 2C78A 3GVKA 1PJ5A 3OJWA 5EMNA 4QVJA 2WZPP 3AVYA 3WNBA 2Q6OA 1EFTA 1V0FA 4MYUA 2VBUA 2BSAA 1B2RA 3G4SB 1UD4A 1FRNA 3ISXA 4KKSA 4LBZA 2E1RA 1YHQB 3SJZA 3VO1A 1Q81D 2QTZA 4UZUA 4RD6A 3CCQB 1KK0A 4OP7A 4ASUA 2D9RA 2BVNA 2XNJA 4XLFA 2F43A 1EFUA 5BSXA 4TMXA 4XMYA 3ZZ0A 1OHHA 4YAOA 4M0LA 5F4OA 3ASPA 2ZZGA 1WDTA 2X6WA 1VF7A 1XE1A 1V5VA 3CESA 1S4MA 2GJKA 2ZZEA 1KK1A 2VBSA 4X05A 2CBXA 2C4TA 4B3FX 3CC4B 4RM0A 3G6EB 2VBTA 2HLDA 1JB9A 1FNDA 4RD3A 1DDIA 2NV4A 2EIXA 3PUMA 1VQKB 5HKKA 3Q6QA 2ZBVA 4KKUA 4G5GA 3BH4A 4OOXA 4ACBA 1KC8D 4WQMA 2CK3A 2YWHA 4XLHA 1OB2A 3KEWA 3W5VA 2CRVA 2OBTA 5A88A 1QH0A 2VNKA 3I55B 4X7CA 1WTHD 3H94A 4P1VA 4P26A 2ZBUA 3BNWA 3ZIAA 1VLOA 1Q7YD 2OK8A 4ZCLA 2ZL5A 3QFRA 3CXCB 2Q6KA 1W0KA 2B5OA 1EP2B 1KJZA 5GV7A 2Q6IA 1J9ZA 5FL7A 3CMAB 4TMTA 1W9XA 2JJ2A 2BV3A 2V7TA 1QGYA 4Z4ZA 3LQ6A 5J35A 1RQPA 3JQRA 3ASSA 4NBSA 4Z4YA 4LBYA 4OOSA 1EWYA 3GQBA 5AN9A 2DERA 4QV2A 3B8HA 3QSYA 4PC6A 3OAAA 1H8EA 2BPOA 1QX4A 1E43A 3ZZUA 2D3LA 2OBRA 2VZLA 1FNBA 3DDYA 4M1KA 4NCNA 1Y0RA 4TMVA 2X53S 2J7KA 3CRZA 2BF4A 3FKSA 1SM4A 1EP1B 1UD3A 4XOPA 5KNLA 4P22A 4C0SA 2GK7A 4XORA 3W2IA 1F20A 3T53B 3A3BA 3PVDA 1VQNB 1VQPB 4Z4SA 3CCSB 4RDJA 2YWGA 1BQEA 2DCUA 1TUIA 3A8KA 4R71A 3CPWB 3OOCA 1DDGA 2QTLA 4U9UA 3BQJA 1E3XA 5JBQA 5L46A 2AHOA 4WZKA 2VJJA 1AMOA 3A8JA 3P26A 3Q38A 2CC2A 4L8JA 4RD2A 1NBMA 2V31A 1GR1A 3R6JA 3OP1A 4XKWA 5H59A 1K9MD 4XN3A 2V7QA 4DK1A 3G71B 2DETA 2GPJA 2ZXHA 2C77A 3ZBUA 1T6ZA 1I7PA 2ZZQA 4LC0A 4P3IA 1QG0A 4UAJA 4X7FA 1JNYA 4PC2A 4CQJA 5FIUA 3CMEB 3CCRB 1D1NA 1QGZA 2YWEA 3ASQA 3GIRA 3GVLA 2Q6LA 1ELOA 3BCDA 3FJOA 3VNUA 2XZPA 3CCUB 2RC5A 3PENA 1YJ9B 5F4MA 2R6HA 3PUNA 3ZBTA 2F4NA 3CTAA 3HAGA 1QUFA 3T51B 1GVHA 3WQZA 1PJ7A 4YAUA 2OBSA 3JQPA 1HA3A 2X6YA 4XOTA 5TRDA 4WZLA 4OPOA 4B47A 4EH1A 5HZBA 4P2NA 3Q3AA 3WYAA 2HDNB 1QVGB 2JDIA 3OZVA 1JA0A 2W6IA 5HZAA 2M5SA 4II3A 1VQOB 1N0VC 4X0CA 3AVUA 2GJPA 1N07A 2BMWA 1MRZA 3AGPA 3MMPA 3VMFA 1VQ8B 4TT3A 4PC1A 1MABA 3SJPA 1T6XA 2F1MA 2R9VA 2WYRA 5E6TA 1YLOA 4XL9A 3RY8A 3AGQA 3E1YE 2DY1A 1Q86D 1FX0A 2JIZA 3BY2A 4B4DA 2ZL7A 3GSIA 4WWVA 2XZOA 1EFRA 5IYNA 3OFNA 4RDKA 2X0KA 2FVGA 2QGGA 3OW7A 3AVWA 5LMZA 1E64A 1YJWB 1ZM3A 4OOVA 1F60A 1WP6A 4P6VF 2I1LA 2WR8A 4XLEA 1YX2A 1NDHA 3PA1A 3V7AA 4B48A 3I1FA 2QE7A 4PC3A 4YAFA 1QFZA 4RD0A 1WORA 4P3YA 3W5UA 4H9GA 2CNDA 4LBVA 4YXWA 5KSWB 1G7SA 4RCYA 1EFCA 3J81k 2D74A 3NE5B 2DEUA 1GAQA 4FXUA 3BC9A 4Z4RA 1PKVA 4IW3B 2ZITA 3H9NA 1B23P 1QVFB 2C5BA 4RPBA 2B7CA 2PMDA 4RD4A 2DOGA 2HMAA 4WZTA 3CCJB 4G7WA 4B43A 1UMKA 4Z4TA 1E1RA 1R5NA 3SKBA 1VQLB 1E63A 1W0JA 2P3MA 3LO8A 5HXBA 1IJFA 1IB0A 2X6XA 1DG1G 1K73D 3R6KA 1A8PA 3FPPA 2CF4A 4M2LA 4RJLA 3WXMA 3W2HA 3VNVA 3WNCA 3OPOA 2VNJA 2W6JA 2BGIA 1VQ5B 1WOSA 1E79A 5FO1A 2PLFA 4AF6A 3OW2B 1GJRA 4N3GA 5FO0A 4HIZA 5DSZA 2F1LA 2X3UA 2ZZFA 4ZGQB 1M1KD 1WOPA 4M4SA 5A8AA 3CD6B 1U2RA 1WSRA 2WJVA 4NNJA 1OGJA 4RPDA 4XD7A 3Q39A 3G05A 1ZM4A 2LZJA 2QN6A 4Z1MA 1FNCA 4PGOA 1KQSB 5GV8A 2XNDA 1I18A 4P9SA 3JU4A 2KVOA 1COWA 4P25A 4P12A 2WJYA 5B6IA 3QFTA 1NJID 4MYTA 1QGAA 1QUEA 4UZFA 3CPXA 2XGJA 2CW5A 4BPRA 1N08A 3CB4A 1E62A 4G6IA 4K1XA 2D3NA 4N3NA 4Z4VA 4XM3A 1UD2A 2ZL6A 2QA4B 4OPVA 2BM1A 2XNCA 1W2BB 2B7BA 4G1VA 1NB0A 5IYWA 3A3GA 3VR6A 4TSFA 1R5OA 4QFMA 3OE7A 1QFJA 1HZEA 1OB5A 3OZWA 1KRHA 5DS0A 2ZXIA 5A89A 2BGJA 3VO2A 1P4MA 3SLDA 1KZLA 4Y9UA 1FRQA 1H42A 4DQLA 3LVBA 1VQMB 2WZNA 3CCLB 3I56B 2Z6BD 3JQQA 1BX0A 3ASRA 3Q6RA 2WSSA 4WZEA 4PAAA 4C43A 4YAWA 4F7DA 5TV2A 3MCAA 3CP2A 1Q9SA 3A8IA 4AVZA 5IYQA 4XNFA 1VLYA 4XONA 1YJNB 1JJ2B 1PJ6A 3LNNA 2QEXB 2FX3A 1K8AD 1IHMA 1G7RA 1R5BA 4HE6A 2V4DA 4ZGNB 1IJEA 3U6BA 1VJSA 1ZM2A 2OYNA 3WNDA 2DYIA 3BY1A 1KMHA 1GO2A 4OPSA 1WU8A 4X7EA 4YEJA 4XLCA 5TR9A 4YHBA 1BLIA 1CQXA 3B82A 4XN0A 4XQFA 1KK3A 1JA1A 3CP8A 4PABA 1E1QA 2C2WA 1SKQA 4ROXA 3A35A 1BMFA 4XLAA 1OGIA 4QVAA 1E3ZA 1V0EA 4X06A 1VQ4B 2V7WA 3P27A 3CCVB 3AVTA 4YELA 4FN5A 2QMUA 1OB0A 2OK7A 4FWTA 3AVVA 1D8TA 3QFCA 3WBJA 1T6YA 1W87A 5DN6A 1YITB 4B44A 4LBWA 1EXMA 1H85A 3U6KA 2HCJB 4P6YA 3PA2A 2DIEA 1YIJB 2V7UA 1GAWA 1N05A 4Z4UA 3WBKA 4DK0A 3ZUGA 5TY0A 2X8KA 1RQRA 4XKVA 2X85A 3CC7B 3A1PA 4ZCIA 1ZUNB 2C5HA 2EFGA 4XR6A 4PC7A 4AC9A 4ZV4A 3CCEB 3OZUA 2C4UA 3GVJA 3SLNA 2BN4A 2VNIA 4TN1A 3CW2A 3OJXA 3W2FA 1S72B 3ES9A 1ZM9A 1VQ7B 1UD8A 3AVXA 4QUZA 4X7DA 4AF7A 2E1BA 1BPLA 1UD5A 2WPDA 4RCZA 1VHOA 3B78A 4DNRB 1HVXA 3W2GA 5J3OA 1CNEA 2QDXA 3W5HA 1KK2A 4B3GA 4M53A 1KTVA 3WY9A 3LQEA 3ASTA 1NB9A 1SKYB 4ACAA 1H8HA 4KKTA 5THXA 1VQ9B 3T56B 2XOKA 2BM0A 2NPFA 3SEJA 2YWFA 2PE3A 1WPCA 1N8RD 3E20A 2V7XA 5IYPA 3FPKA 4DQKA 4Y9RA 1TTTA 4HE5A 1TLLA 4RDLA 2V7VA 3BCFA 3ONUA 3ZPNA 2VBVA 5KW9A 5CDFA 1M90D 2RC6A
chains in the Genus database with same CATH topology
4X0CA 4X7CA 4P1VA 4P26A 3SJPA 3ONYA 2ZL5A 5E6TA 3RY8A 3SLDA 3BY2A 2ZL7A 5BSYA 5IYNA 4RDKA 3ASRA 3Q6RA 4WZEA 4OOVA 4Z4ZA 3LQ6A 5IYQA 5J35A 3PA1A 3V7AA 3ASSA 1IHMA 4Z4YA 4RLZA 4OOSA 4QV2A 3BY1A 4OPSA 3D26A 2OBRA 4X7EA 4Z4RA 5F4JA 4ROXA 4RPBA 4X07A 5IYRA 4QVAA 4X06A 4Z4WA 4WZTA 3PVDA 4Z4SA 4RDJA 4Z4TA 3SKBA 3BQJA 4WZKA 3Q38A 4QVJA 3R6KA 3R6JA 3PA2A 4Z4UA 4OP7A 4P3IA 4X7FA 4RPDA 3SLNA 5BSXA 3Q39A 3ASQA 5F4OA 4QUZA 3ASPA 4P25A 4X7DA 4P12A 5F4MA 5J3OA 3PUNA 4X05A 3LQEA 4RM0A 3ASTA 3PUMA 2OBSA 3SEJA 3Q6QA 4Z4VA 4WZLA 5IYPA 4OPOA 4OOXA 5HZBA 4P2NA 2ZL6A 3Q3AA 4OPVA 4RDLA 5HZAA 3ONUA 5KW9A 2OBTA 5IYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0C A;  4X7C A;  4P1V A;  4P26 A;  3SJP A;  3ONY A;  2ZL5 A;  5E6T A;  3RY8 A;  3SLD A;  3BY2 A;  2ZL7 A;  5BSY A;  5IYN A;  4RDK A;  3ASR A;  3Q6R A;  4WZE A;  4OOV A;  4Z4Z A;  3LQ6 A;  5IYQ A;  5J35 A;  3PA1 A;  3V7A A;  3ASS A;  1IHM A;  4Z4Y A;  4RLZ A;  4OOS A;  4QV2 A;  3BY1 A;  4OPS A;  3D26 A;  2OBR A;  4X7E A;  4Z4R A;  5F4J A;  4ROX A;  4RPB A;  4X07 A;  5IYR A;  4QVA A;  4X06 A;  4Z4W A;  4WZT A;  3PVD A;  4Z4S A;  4RDJ A;  4Z4T A;  3SKB A;  3BQJ A;  4WZK A;  3Q38 A;  4QVJ A;  3R6K A;  3R6J A;  3PA2 A;  4Z4U A;  4OP7 A;  4P3I A;  4X7F A;  4RPD A;  3SLN A;  5BSX A;  3Q39 A;  3ASQ A;  5F4O A;  4QUZ A;  3ASP A;  4P25 A;  4X7D A;  4P12 A;  5F4M A;  5J3O A;  3PUN A;  4X05 A;  3LQE A;  4RM0 A;  3AST A;  3PUM A;  2OBS A;  3SEJ A;  3Q6Q A;  4Z4V A;  4WZL A;  5IYP A;  4OPO A;  4OOX A;  5HZB A;  4P2N A;  2ZL6 A;  3Q3A A;  4OPV A;  4RDL A;  5HZA A;  3ONU A;  5KW9 A;  2OBT A;  5IYW A; 
#chains in the Genus database with same CATH topology
 2JN9 A;  1XFO A;  1EP3 B;  3ZC3 A;  4FK8 A;  1W35 A;  2GQF A;  1CNF A;  5FNZ A;  1NRK A;  1Y0Y A;  2XEX A;  1K28 D;  4UZE A;  3ONY A;  1BJK A;  3OEH A;  3W2E A;  2OTL B;  1N0U A;  4QHY A;  1DAR A;  2VYQ A;  1XQB A;  1I8D A;  1G7C A;  5BSY A;  1FNM A;  2GRE A;  1WSV A;  3ZZT A;  4E0F A;  2ZTG A;  4TMZ A;  2VJI A;  1UD6 A;  1WOO A;  1KD1 D;  2XZL A;  1S0U A;  4G7X A;  1YI2 B;  3OEE A;  3V76 A;  1G7T A;  5H5J A;  4II2 A;  3QE2 A;  3U2Q A;  4RLZ A;  4DNT B;  1FDR A;  4JMQ A;  3MHP A;  4YAL A;  2PIA A;  4B3X A;  1D2E A;  1N06 A;  3D26 A;  1AIP A;  4RD1 A;  4ZCM A;  1T5E A;  4G1B A;  4X8I A;  2ZTN A;  4GQN A;  3KL9 A;  1QFY A;  2GJR A;  5F4J A;  1VQ6 B;  2JJ1 A;  1XB2 A;  3CMM A;  3QFS A;  4Q7J B;  4TKO B;  4TMW A;  5FA6 A;  3OKX A;  1TVC A;  3CCM B;  1VHE A;  4X07 A;  5IYR A;  2VNH A;  2OTJ B;  4Y7C A;  4J0Q A;  4Z4W A;  1BX1 A;  1W34 A;  1Q82 D;  3CC2 B;  2GK6 A;  5IK2 A;  2C78 A;  3GVK A;  1PJ5 A;  3OJW A;  5EMN A;  4QVJ A;  2WZP P;  3AVY A;  3WNB A;  2Q6O A;  1EFT A;  1V0F A;  4MYU A;  2VBU A;  2BSA A;  1B2R A;  3G4S B;  1UD4 A;  1FRN A;  3ISX A;  4KKS A;  4LBZ A;  2E1R A;  1YHQ B;  3SJZ A;  3VO1 A;  1Q81 D;  2QTZ A;  4UZU A;  4RD6 A;  3CCQ B;  1KK0 A;  4OP7 A;  4ASU A;  2D9R A;  2BVN A;  2XNJ A;  4XLF A;  2F43 A;  1EFU A;  5BSX A;  4TMX A;  4XMY A;  3ZZ0 A;  1OHH A;  4YAO A;  4M0L A;  5F4O A;  3ASP A;  2ZZG A;  1WDT A;  2X6W A;  1VF7 A;  1XE1 A;  1V5V A;  3CES A;  1S4M A;  2GJK A;  2ZZE A;  1KK1 A;  2VBS A;  4X05 A;  2CBX A;  2C4T A;  4B3F X;  3CC4 B;  4RM0 A;  3G6E B;  2VBT A;  2HLD A;  1JB9 A;  1FND A;  4RD3 A;  1DDI A;  2NV4 A;  2EIX A;  3PUM A;  1VQK B;  5HKK A;  3Q6Q A;  2ZBV A;  4KKU A;  4G5G A;  3BH4 A;  4OOX A;  4ACB A;  1KC8 D;  4WQM A;  2CK3 A;  2YWH A;  4XLH A;  1OB2 A;  3KEW A;  3W5V A;  2CRV A;  2OBT A;  5A88 A;  1QH0 A;  2VNK A;  3I55 B;  4X7C A;  1WTH D;  3H94 A;  4P1V A;  4P26 A;  2ZBU A;  3BNW A;  3ZIA A;  1VLO A;  1Q7Y D;  2OK8 A;  4ZCL A;  2ZL5 A;  3QFR A;  3CXC B;  2Q6K A;  1W0K A;  2B5O A;  1EP2 B;  1KJZ A;  5GV7 A;  2Q6I A;  1J9Z A;  5FL7 A;  3CMA B;  4TMT A;  1W9X A;  2JJ2 A;  2BV3 A;  2V7T A;  1QGY A;  4Z4Z A;  3LQ6 A;  5J35 A;  1RQP A;  3JQR A;  3ASS A;  4NBS A;  4Z4Y A;  4LBY A;  4OOS A;  1EWY A;  3GQB A;  5AN9 A;  2DER A;  4QV2 A;  3B8H A;  3QSY A;  4PC6 A;  3OAA A;  1H8E A;  2BPO A;  1QX4 A;  1E43 A;  3ZZU A;  2D3L A;  2OBR A;  2VZL A;  1FNB A;  3DDY A;  4M1K A;  4NCN A;  1Y0R A;  4TMV A;  2X53 S;  2J7K A;  3CRZ A;  2BF4 A;  3FKS A;  1SM4 A;  1EP1 B;  1UD3 A;  4XOP A;  5KNL A;  4P22 A;  4C0S A;  2GK7 A;  4XOR A;  3W2I A;  1F20 A;  3T53 B;  3A3B A;  3PVD A;  1VQN B;  1VQP B;  4Z4S A;  3CCS B;  4RDJ A;  2YWG A;  1BQE A;  2DCU A;  1TUI A;  3A8K A;  4R71 A;  3CPW B;  3OOC A;  1DDG A;  2QTL A;  4U9U A;  3BQJ A;  1E3X A;  5JBQ A;  5L46 A;  2AHO A;  4WZK A;  2VJJ A;  1AMO A;  3A8J A;  3P26 A;  3Q38 A;  2CC2 A;  4L8J A;  4RD2 A;  1NBM A;  2V31 A;  1GR1 A;  3R6J A;  3OP1 A;  4XKW A;  5H59 A;  1K9M D;  4XN3 A;  2V7Q A;  4DK1 A;  3G71 B;  2DET A;  2GPJ A;  2ZXH A;  2C77 A;  3ZBU A;  1T6Z A;  1I7P A;  2ZZQ A;  4LC0 A;  4P3I A;  1QG0 A;  4UAJ A;  4X7F A;  1JNY A;  4PC2 A;  4CQJ A;  5FIU A;  3CME B;  3CCR B;  1D1N A;  1QGZ A;  2YWE A;  3ASQ A;  3GIR A;  3GVL A;  2Q6L A;  1ELO A;  3BCD A;  3FJO A;  3VNU A;  2XZP A;  3CCU B;  2RC5 A;  3PEN A;  1YJ9 B;  5F4M A;  2R6H A;  3PUN A;  3ZBT A;  2F4N A;  3CTA A;  3HAG A;  1QUF A;  3T51 B;  1GVH A;  3WQZ A;  1PJ7 A;  4YAU A;  2OBS A;  3JQP A;  1HA3 A;  2X6Y A;  4XOT A;  5TRD A;  4WZL A;  4OPO A;  4B47 A;  4EH1 A;  5HZB A;  4P2N A;  3Q3A A;  3WYA A;  2HDN B;  1QVG B;  2JDI A;  3OZV A;  1JA0 A;  2W6I A;  5HZA A;  2M5S A;  4II3 A;  1VQO B;  1N0V C;  4X0C A;  3AVU A;  2GJP A;  1N07 A;  2BMW A;  1MRZ A;  3AGP A;  3MMP A;  3VMF A;  1VQ8 B;  4TT3 A;  4PC1 A;  1MAB A;  3SJP A;  1T6X A;  2F1M A;  2R9V A;  2WYR A;  5E6T A;  1YLO A;  4XL9 A;  3RY8 A;  3AGQ A;  3E1Y E;  2DY1 A;  1Q86 D;  1FX0 A;  2JIZ A;  3BY2 A;  4B4D A;  2ZL7 A;  3GSI A;  4WWV A;  2XZO A;  1EFR A;  5IYN A;  3OFN A;  4RDK A;  2X0K A;  2FVG A;  2QGG A;  3OW7 A;  3AVW A;  5LMZ A;  1E64 A;  1YJW B;  1ZM3 A;  4OOV A;  1F60 A;  1WP6 A;  4P6V F;  2I1L A;  2WR8 A;  4XLE A;  1YX2 A;  1NDH A;  3PA1 A;  3V7A A;  4B48 A;  3I1F A;  2QE7 A;  4PC3 A;  4YAF A;  1QFZ A;  4RD0 A;  1WOR A;  4P3Y A;  3W5U A;  4H9G A;  2CND A;  4LBV A;  4YXW A;  5KSW B;  1G7S A;  4RCY A;  1EFC A;  3J81 k;  2D74 A;  3NE5 B;  2DEU A;  1GAQ A;  4FXU A;  3BC9 A;  4Z4R A;  1PKV A;  4IW3 B;  2ZIT A;  3H9N A;  1B23 P;  1QVF B;  2C5B A;  4RPB A;  2B7C A;  2PMD A;  4RD4 A;  2DOG A;  2HMA A;  4WZT A;  3CCJ B;  4G7W A;  4B43 A;  1UMK A;  4Z4T A;  1E1R A;  1R5N A;  3SKB A;  1VQL B;  1E63 A;  1W0J A;  2P3M A;  3LO8 A;  5HXB A;  1IJF A;  1IB0 A;  2X6X A;  1DG1 G;  1K73 D;  3R6K A;  1A8P A;  3FPP A;  2CF4 A;  4M2L A;  4RJL A;  3WXM A;  3W2H A;  3VNV A;  3WNC A;  3OPO A;  2VNJ A;  2W6J A;  2BGI A;  1VQ5 B;  1WOS A;  1E79 A;  5FO1 A;  2PLF A;  4AF6 A;  3OW2 B;  1GJR A;  4N3G A;  5FO0 A;  4HIZ A;  5DSZ A;  2F1L A;  2X3U A;  2ZZF A;  4ZGQ B;  1M1K D;  1WOP A;  4M4S A;  5A8A A;  3CD6 B;  1U2R A;  1WSR A;  2WJV A;  4NNJ A;  1OGJ A;  4RPD A;  4XD7 A;  3Q39 A;  3G05 A;  1ZM4 A;  2LZJ A;  2QN6 A;  4Z1M A;  1FNC A;  4PGO A;  1KQS B;  5GV8 A;  2XND A;  1I18 A;  4P9S A;  3JU4 A;  2KVO A;  1COW A;  4P25 A;  4P12 A;  2WJY A;  5B6I A;  3QFT A;  1NJI D;  4MYT A;  1QGA A;  1QUE A;  4UZF A;  3CPX A;  2XGJ A;  2CW5 A;  4BPR A;  1N08 A;  3CB4 A;  1E62 A;  4G6I A;  4K1X A;  2D3N A;  4N3N A;  4Z4V A;  4XM3 A;  1UD2 A;  2ZL6 A;  2QA4 B;  4OPV A;  2BM1 A;  2XNC A;  1W2B B;  2B7B A;  4G1V A;  1NB0 A;  5IYW A;  3A3G A;  3VR6 A;  4TSF A;  1R5O A;  4QFM A;  3OE7 A;  1QFJ A;  1HZE A;  1OB5 A;  3OZW A;  1KRH A;  5DS0 A;  2ZXI A;  5A89 A;  2BGJ A;  3VO2 A;  1P4M A;  3SLD A;  1KZL A;  4Y9U A;  1FRQ A;  1H42 A;  4DQL A;  3LVB A;  1VQM B;  2WZN A;  3CCL B;  3I56 B;  2Z6B D;  3JQQ A;  1BX0 A;  3ASR A;  3Q6R A;  2WSS A;  4WZE A;  4PAA A;  4C43 A;  4YAW A;  4F7D A;  5TV2 A;  3MCA A;  3CP2 A;  1Q9S A;  3A8I A;  4AVZ A;  5IYQ A;  4XNF A;  1VLY A;  4XON A;  1YJN B;  1JJ2 B;  1PJ6 A;  3LNN A;  2QEX B;  2FX3 A;  1K8A D;  1IHM A;  1G7R A;  1R5B A;  4HE6 A;  2V4D A;  4ZGN B;  1IJE A;  3U6B A;  1VJS A;  1ZM2 A;  2OYN A;  3WND A;  2DYI A;  3BY1 A;  1KMH A;  1GO2 A;  4OPS A;  1WU8 A;  4X7E A;  4YEJ A;  4XLC A;  5TR9 A;  4YHB A;  1BLI A;  1CQX A;  3B82 A;  4XN0 A;  4XQF A;  1KK3 A;  1JA1 A;  3CP8 A;  4PAB A;  1E1Q A;  2C2W A;  1SKQ A;  4ROX A;  3A35 A;  1BMF A;  4XLA A;  1OGI A;  4QVA A;  1E3Z A;  1V0E A;  4X06 A;  1VQ4 B;  2V7W A;  3P27 A;  3CCV B;  3AVT A;  4YEL A;  4FN5 A;  2QMU A;  1OB0 A;  2OK7 A;  4FWT A;  3AVV A;  1D8T A;  3QFC A;  3WBJ A;  1T6Y A;  1W87 A;  5DN6 A;  1YIT B;  4B44 A;  4LBW A;  1EXM A;  1H85 A;  3U6K A;  2HCJ B;  4P6Y A;  3PA2 A;  2DIE A;  1YIJ B;  2V7U A;  1GAW A;  1N05 A;  4Z4U A;  3WBK A;  4DK0 A;  3ZUG A;  5TY0 A;  2X8K A;  1RQR A;  4XKV A;  2X85 A;  3CC7 B;  3A1P A;  4ZCI A;  1ZUN B;  2C5H A;  2EFG A;  4XR6 A;  4PC7 A;  4AC9 A;  4ZV4 A;  3CCE B;  3OZU A;  2C4U A;  3GVJ A;  3SLN A;  2BN4 A;  2VNI A;  4TN1 A;  3CW2 A;  3OJX A;  3W2F A;  1S72 B;  3ES9 A;  1ZM9 A;  1VQ7 B;  1UD8 A;  3AVX A;  4QUZ A;  4X7D A;  4AF7 A;  2E1B A;  1BPL A;  1UD5 A;  2WPD A;  4RCZ A;  1VHO A;  3B78 A;  4DNR B;  1HVX A;  3W2G A;  5J3O A;  1CNE A;  2QDX A;  3W5H A;  1KK2 A;  4B3G A;  4M53 A;  1KTV A;  3WY9 A;  3LQE A;  3AST A;  1NB9 A;  1SKY B;  4ACA A;  1H8H A;  4KKT A;  5THX A;  1VQ9 B;  3T56 B;  2XOK A;  2BM0 A;  2NPF A;  3SEJ A;  2YWF A;  2PE3 A;  1WPC A;  1N8R D;  3E20 A;  2V7X A;  5IYP A;  3FPK A;  4DQK A;  4Y9R A;  1TTT A;  4HE5 A;  1TLL A;  4RDL A;  2V7V A;  3BCF A;  3ONU A;  3ZPN A;  2VBV A;  5KW9 A;  5CDF A;  1M90 D;  2RC6 A; 
#chains in the Genus database with same CATH homology
 4X0C A;  4X7C A;  4P1V A;  4P26 A;  3SJP A;  3ONY A;  2ZL5 A;  5E6T A;  3RY8 A;  3SLD A;  3BY2 A;  2ZL7 A;  5BSY A;  5IYN A;  4RDK A;  3ASR A;  3Q6R A;  4WZE A;  4OOV A;  4Z4Z A;  3LQ6 A;  5IYQ A;  5J35 A;  3PA1 A;  3V7A A;  3ASS A;  1IHM A;  4Z4Y A;  4RLZ A;  4OOS A;  4QV2 A;  3BY1 A;  4OPS A;  3D26 A;  2OBR A;  4X7E A;  4Z4R A;  5F4J A;  4ROX A;  4RPB A;  4X07 A;  5IYR A;  4QVA A;  4X06 A;  4Z4W A;  4WZT A;  3PVD A;  4Z4S A;  4RDJ A;  4Z4T A;  3SKB A;  3BQJ A;  4WZK A;  3Q38 A;  4QVJ A;  3R6K A;  3R6J A;  3PA2 A;  4Z4U A;  4OP7 A;  4P3I A;  4X7F A;  4RPD A;  3SLN A;  5BSX A;  3Q39 A;  3ASQ A;  5F4O A;  4QUZ A;  3ASP A;  4P25 A;  4X7D A;  4P12 A;  5F4M A;  5J3O A;  3PUN A;  4X05 A;  3LQE A;  4RM0 A;  3AST A;  3PUM A;  2OBS A;  3SEJ A;  3Q6Q A;  4Z4V A;  4WZL A;  5IYP A;  4OPO A;  4OOX A;  5HZB A;  4P2N A;  2ZL6 A;  3Q3A A;  4OPV A;  4RDL A;  5HZA A;  3ONU A;  5KW9 A;  2OBT A;  5IYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...