2AHOA

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
414
structure length
401
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
molecule tags Translation
source organism Sulfolobus solfataricus
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
total genus 82
structure length 401
sequence length 414
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ahoA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ahoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ahoA01
1SXJC 2ATVA 4EFMA 4UJ5A 4M4SA 5GVRA 1HT2E 4LZZA 4XVQA 1IHUA 2CVHA 1E1RD 1FFHA 4R7ZA 3O8CA 1E4YA 4LBVA 2CBZA 1PLLA 5J5CA 1ZM2A 3EA0A 2QEXB 4MUBA 2ZAMA 1G8FA 3K0AB 4FMCB 3BK7A 1RFLA 1TU4A 1XJQA 3AVXA 1GG2A 3UK6A 1Q57A 4QC2A 4G1VA 2ZRDA 4EKDA 2X3UA 1E0KA 1P75A 1Z29A 4Q00A 5KU1A 1SXJE 3ASZA 4B71A 2O8EB 2WTUA 2DWOA 3ZVMA 4OHWA 3A8TA 4FIDA 4E09A 3QFTA 2O8CA 2QQEA 5TXGA 4OI2A 3U3KA 4HAVA 2JLQA 1FNBA 4LGMA 1UPTA 3ZGXA 1NVVQ 2ZJZA 5HCNA 2QUZA 3BS4A 4R2HA 3ZD6A 4D26A 3A6PC 3SBEA 1K5GA 1A4RA 2NIPA 3REGA 1YU9A 4DKXA 5FI1B 1DPFA 1D6JA 1E9RA 3GLGB 1UJ2A 2Z0MA 1F2UA 5A4JA 1X1SA 2EFCB 5JRJA 1OIVA 1BMFD 1TMKA 2BIFA 5IK2A 3Q7PA 1FW6A 2KJQA 1OH5A 2F1HA 2D74A 2VSXA 1W2HA 2RH5A 1KKMA 1M2OB 1AS0A 4FCTA 1RZ3A 2K5UA 1K73D 3CPEA 1OB5A 1ZM7A 3CRZA 4FI3C 4I99A 2IF2A 4AF7A 2CHVA 4GT1A 3A1TA 2PMKA 3X1ZA 1GJRA 2AWOA 4C0BA 1E9AA 4LBWA 1QF9A 2ERXA 2OAQ1 2JLUA 2AN9A 4KO8A 5ANRB 2J3EA 2WSMA 3B6EA 1ZU4A 121PA 3BAFA 2GWHA 1CQXA 5JMTA 2WOJA 3KJEA 1E6CA 4JVSB 4XJXA 1W2BB 1NN5A 1Q22A 4Q02A 1QFZA 1XD2A 1TF2A 2FU5C 3MWLA 5CYOA 4U02A 4DC9A 1DELA 2JASA 2FFBA 1AZSC 3U7GA 4TYWA 3TQCA 1XEWY 3CR7A 1G1MA 1T3SA 4BLTA 2J45A 1OFTA 3KB2A 1CJUC 3QF7A 5FOUA 4WXRA 1KSGA 5L3QB 1ANKA 2FE4A 5FOWA 5IDVA 4JYBA 1XCMA 2WMOB 4MUAA 4Q7KA 3SYLA 4JLVA 4P4UA 2IYXA 1GILA 4BZXA 5HKKA 2MSCB 1T3HA 1QH0A 2QI9C 1AK2A 1RKBA 2TMKA 2IWHA 5JLJA 1VQOB 1G7RA 5HE9A 2OHFA 2QA5A 3THWA 3W5IA 1J7KA 4G3XA 1F6BA 3AKYA 3ND9A 3TR0A 3TUJC 3OZVA 2ZYTX 2IX3A 2B5OA 1YQTA 2DPXA 4EFLA 1R5NA 2OV2A 1R4AA 4OHXA 4QBIA 1VQLB 1GAJA 1LV7A 2X77A 3ZIAA 4AWXA 3QI2A 3DMNA 4N0EA 2OEPA 2CLSA 3RS5A 1AZTA 1JR3A 5BN5A 2G88A 2R65A 4IDHA 2JEOA 4QGAA 2OM2A 5DO9A 1W0KA 3TLXA 4HDOB 3PEVA 2PIAA 5LB2A 3WBKA 2PX0A 4NH0A 1R8QA 3K0CA 1Z5ZA 2G83A 4Q9HA 4BASA 2QE7D 1N0VC 3A4NA 2R6HA 2V55B 3GJ4A 3OIUA 3B1VA 3GPLA 1O87A 1Q1BA 2XOKA 4RFVA 1KO7A 4LPKA 3V4RA 5G3YA 1JAIA 3AP2A 4GOKA 4EAQA 5JHGB 2G6BA 2XXAB 2XZLA 5JI3E 1ODFA 3QXHA 1E2KA 4BFUA 2ODWA 2QP3A 5AN9A 5BYKA 4WQMA 3DOFA 1GUAA 1XP8A 2R8RA 4CZ2A 3I62A 2WKQA 3K53A 5BYJA 2Q0HA 1SVWA 5EE9A 3CF2A 2QM8A 3SJZA 1XTRA 1OFIA 3OEHD 3FKQA 2DY1A 4IOMA 2QTVB 5EP3A 5JSZA 2YINC 2V3CC 3WYGA 5F9FA 3D31A 4PXAA 2YWHA 2UKDA 5DNYB 3MWJA 3HP1A 5DI3B 1ZYUA 2AK3A 1XJ0A 2WJJA 4M8NE 3K70B 3AB3A 4ERNA 1GRNA 4OI4A 1YITB 2J0VA 2MMCA 1ZAKA 3QXCA 4HLCA 1S4QA 2PMDA 3UG6A 4DCNA 2XSZD 4MH0R 4CEHB 2G3YA 2ZRLA 2V7QD 4B34A 3E20A 4C0SA 1IN7A 4MKHA 1MOZA 1JJ7A 3EWAA 2IS2A 5GV8A 4RZ3A 2ASEA 1IN5A 2OG2A 1JQJC 2DWPA 2DB3A 4B33A 2VP0A 1OGIA 1BOFA 1WP9A 3LX8A 4MYCA 3LQQA 3KJGA 1N8RD 4FWTA 3WRXC 4CVNA 2QTZA 2ZJBA 4RZXA 5E3HA 1G7TA 1XCGB 4NYMQ 5DLQC 3QPWA 3FFAA 3VR5A 3NEYA 2QROA 3FMPB 3W5JA 4RFSA 4DB4A 3KZ1E 4LC0A 2F9MA 5TDHA 1E9FA 1S8FA 3V76A 2QPTA 2X2FA 3L82B 5A5GA 1W36C 1BKDR 3AVPA 3DVLA 1CP2A 4TTRA 2OLJA 4US0R 3VR3A 4Z51A 3ZQ6A 1CJVC 1QHYA 2O8EA 2G77B 2GJKA 3WHKA 5CIWA 2OSBA 4C7OA 3QIAA 3PUWA 2FFHA 3D6TB 4RD6A 2PZGA 1GDDA 1NJGA 4ZCIA 1FX0B 3NC0C 1X8JA 4UNQA 4WBSA 3CCLB 3F3YA 4WZAE 1TADA 5DHFA 2A3RA 5KO2A 1YIJB 4B3XA 1G3IA 2YJTD 3CW2A 5FL7A 3K9GA 1GRQA 4LPSA 1YZTA 1N6PA 3ASYA 3CWQA 2BM1A 5AUPB 1NG9A 2V8OA 4X8HA 4LHWA 2F9LA 2IYZA 4HEJA 3JQQA 4V02A 4RD0A 1JA0A 4DQKA 2O0HA 1R2QA 2WPDD 4BEBA 4HAUA 3QNUA 4Q1BA 3KQKA 1W87A 2C95A 4PO8A 4V0LA 3U3MA 4L8GA 4BQSA 4NYIQ 1NN1A 2C04A 1SQ5A 1GNPA 3R8CA 4BZPA 1CRQA 3THXB 4C0JA 3I8SA 3LFUA 3KFXA 4GP6A 4TYPA 5HE8A 3L8YA 3HPRA 1SVOA 1P9RA 4TSFD 4MRPA 4EJSB 1RJ9A 2EWWA 3LXRA 1E2PA 1U90A 2GAAA 2GBLA 3NH6A 4IEIA 4CT5A 2NMVA 1JEDA 2QQ0A 1J8MF 2WMNB 3UPUA 1XXHA 4IXNA 2JIZD 3N5CA 4M1MA 3RS2A 1S3GA 1G7SA 3B82A 2GVDC 3NKVA 4FW9A 2OESA 4I1OA 1TF7A 1D1NA 4ABYA 1TPZA 4POAA 2YZ2A 4YALA 1K6MA 3C8UA 4NYJR 1KGDA 3K09C 1MO3A 1TF5A 4KCGA 1C1YA 1JI0A 4MA4A 5DN6D 4URXR 2ZS9A 1P5ZB 1H65A 3CH4B 4Q1CA 2VL7A 2VA8A 421PA 4V0MA 3X1YA 1IY0A 4ZDWA 3QKSA 4RKEA 1PV4A 3CZQA 3GLHE 4HLUC 2X2EA 3TVTA 4A15A 1FTNA 4PQRA 1P72A 2V6JA 1Z8FA 5B30A 721PA 1F2TB 1NJFA 2OCYC 5KSYA 4DUGD 2O8DB 2WJGA 3AKDA 2VIIA 3U7EB 4HZUA 4Z1MD 1G3UA 1S1MA 2LWIA 2R6CA 3VX4A 4URVR 5AJVB 2CRVA 3BERA 1TU3A 3CPWB 3MCAA 2OLKA 1HEIA 1AQUA 3W90A 4N3NA 1DO2A 4URWR 3VR6A 3TW4A 2WJVA 2PH1A 2WHXA 4NU0A 4R9UC 3P1JA 3BH6A 4X8LA 3LV8A 4EPTA 4HDQB 2DYKA 2EFHB 2J1LA 2JGNA 2ZSDA 3A58B 3BORA 3U4QB 1LB1B 1MRSA 2XB2A 3T1QA 2V1UA 1Q3TA 4Q4LA 5IRCD 4EPYA 2BMFA 3AQ4A 4Q4HA 5SZIA 2VYFA 2IS4A 1Q1ZA 2IF0A 3NWJA 2IEYA 5JSZB 2RGDA 2EVWX 4KHZA 1BJKA 2Q3FA 4W5HA 1YR9A 2RGNC 3QBVA 4XTCS 4CEJA 4Q48A 1YJNB 1SKYB 4Z1MA 5JCPA 1OV4A 1IONA 2JDIA 1XMVA 2OK8A 1SVKA 1R0XA 1A82A 1ZUNB 3CLVA 2VHQA 3PENA 3GD7A 3Q5DA 3QKUA 1VG0B 4AI6A 4DLVA 1U0JA 1EESA 3AF1A 2VNIA 4XVUA 4DDVA 4IOLA 3KTAA 3C4JA 4OHVA 1EFCA 3BE4A 3IILA 5L8VA 4MKIA 1E2MA 5AWFC 2H1LA 4MQBA 1W7AA 1SM4A 2LKCA 4B3GA 4A6XA 1WE2A 3ADDA 4JLPA 3HWSA 4Q03A 1KJWA 1UAAA 1G6OA 2PLFA 3ZBTA 2BC9A 2EWVA 2GJAA 2RGGA 3K0AA 3MHPA 1VQ9B 4LI0A 2XJ4A 1EFUA 4MYTA 3BC1A 4KSCA 2HJGA 3LQRA 4P0TA 1H8ED 1QHGA 3K0FB 4JLKA 4XWAA 3DOEA 4D4MA 3B9QA 4P4SB 1WB9A 3OAAD 1GKUB 3CD6B 2GBLC 1KC8D 2FOLA 1KY3A 2PLRA 5L3RA 4HLDA 3H86A 4Z8XA 1P62B 4D0NA 4B48A 3O8RA 2FN4A 5KPJA 2AX4A 2RGEA 4FD2A 4TSFA 1DEKA 5GADl 1OYYA 2HV8A 2FA9A 5EXSA 3C41J 1XXHB 1COWA 2CCGA 2ZEJA 4QBHA 1DOAA 2ZI3A 4P31A 4XH9B 2AXNA 5L3SB 1OH8A 1FP6A 3F8TA 1NBMA 2F6RA 2WWYA 1Q1QA 1R8SA 4GL2A 4EJSA 3E1SA 4Q1FA 4G1UC 1IAQA 2XITA 2NPIA 5SZHB 4C4PA 1QHHB 2CEAA 2NOAA 2WSSA 2J5XA 3TMKA 3KKNA 4AYTA 1BYUA 3E70C 4LBYA 2MSDB 2WPDA 3UMRA 3U60B 1Z3IX 1JXOA 4NCNA 2XNCA 4H1UA 3W8RA 4Q9KA 4HI0E 3AUXA 4RD2A 1UADA 2FDCA 1IXRC 1G9XA 2VHJA 3QSYA 5FPYA 1WCV1 4DQLA 3G71B 1G5TA 4P32A 1E1QD 3HJNA 2O8BA 2NO7A 5FL7D 4I81A 1J99A 1QUFA 2R6AA 4FMDF 4NMMA 4QKQA 1CR2A 1SXJB 1XX6A 4DDWA 3CRVA 4LHXA 4HUQB 3FHTA 3GJ6A 3BFVA 2XEXA 2IC5A 3DMDA 2H5EA 3EZ6A 3GCGA 2IXEA 1E2QA 1KZGB 4JZKA 1ZD9A 4B74A 2JATA 1AM4D 2SHKA 3RSLA 3QKRA 2BGIA 3TIFA 1YVDA 3PR1A 5H8WA 1YR8A 4O3MA 1LTQA 4HYYA 2HXSA 1W4AA 4IDPA 2XZOA 1FMJA 1UFQA 4PR0A 1E98A 3W2IA 4R2IA 1EX6A 3VKHA 4FMDB 1YR7A 4RD3A 4K8OA 5EXXA 2QU8A 2H7VA 5B2ZA 4M21A 4CRWB 4J0QA 1DADA 4MGIR 1IY2A 5HZKA 2F1IA 2GXQA 1CEEA 2ZE8A 1N6HA 4DIDA 3F0TA 4ITRC 2P3SA 5JBQA 1E96A 2EW1A 1KI9A 3IBGA 4F7WA 5JCZA 2J0SA 4MDFA 3CO5A 2VSFA 3RWOA 3ADBA 3NDPA 3TVDA 1HTWA 4PO9A 1N5LA 3KX2A 4B6EA 2ZRIA 4GI7A 5F98A 1XXHE 2O8BB 3C7KA 1A5TA 1JXMA 4B47A 2OBMA 4B35A 4KI0A 1A7JA 2BBSA 2VO1A 1G21E 4CF7A 3QVUA 2G1JA 1Z0FA 1XZPA 2OCAA 1OXTA 4LBZA 2ONKA 1HT1E 4OKSA 4PHFA 2OBLA 4TT3A 4A4DA 4Q18A 2Q9BA 2QZ4A 4DEXA 4M9SA 1OXSC 1AA9A 4QJ4A 2A5GA 5J40A 4GDFA 3TNFA 1EFTA 3QUSA 1GVNB 3GLHA 2EYUA 2WWWA 3CCUB 3BD9A 2GK6A 5GJBA 1IJEA 5CK4A 3FB4A 3ZZ0A 2Z43A 2BKUA 3EG5A 2CVFA 4HLQB 3ES9A 4XOIA 4YDHB 3VTKA 3GEHA 4LY6A 1AIPA 1Q7YD 2A7QA 4Y9UA 1QZXA 5DYGA 5G41A 4EQ6A 2ZJ2A 1M1KD 4R71A 4YAWA 1NVVR 2FZLA 4XWOA 3T34A 3C5CA 1DVRA 2V54A 1NJID 4P4SA 1Z07A 2BEKA 3THYA 3AH8A 1GL9B 3FYHA 3VNUA 5FOTA 2L0XA 3SR0A 2XXAA 3AP1A 1R0YA 1GR1A 1HUQA 4R98A 3Q72A 1SKYE 1VHLA 2FG5A 4JLNA 1XEXB 2WM9B 4KBGA 4NKRA 3I5XA 1W4CA 3AKEA 3KXIA 3RHFA 4TQ9A 5E7IA 3VR2A 1S0UA 1P2TA 2VNKA 2UZIR 1KI6B 1ESNA 4WW0A 4TN1A 1M7BA 3BBPA 4AIIA 4KVGA 1VIAA 2PEYA 3DDCA 2GRJA 3P4YA 3V9PA 4E5UA 2FX3A 4KFTA 2BBWA 5GVSA 5FR2A 4MYHA 5EJEA 5CDFA 1ETUA 3FMIA 1UMKA 3LLMA 1YZUA 3B1ZA 2CNDA 3BJIC 4TL8A 5HPYB 1KAOA 1ZJ6A 4HAYA 1KZ7B 2VNJA 3PXGA 2Q3HA 1W5TA 3I73A 1S1CA 4HDCA 2CL0X 4UXJA 1T5LA 2JJ8A 4EIWA 3LBNA 5JWRA 1MO6A 4US1R 3CCSB 3OIYA 5EP2A 1Z0JA 3NBFA 4XTRA 1NVWQ 1VMAA 4G5QA 1XEFA 3CRW1 2OCPA 2GEVA 2W6IA 4BWYA 1LF5A 1QVFB 2CL7X 4JSTA 3JVVA 1SVMA 2ZVPX 3LW7A 4DVGA 3RYTC 3IIKA 2WWFA 1AQYA 1T8UA 3OEEA 3QF4A 5C1BA 4Q4AB 4L5BA 2IHYA 2WKRA 4NYIR 2OE2A 4BEJA 4JT4A 4TLBA 1II9A 3B5JA 4O2RA 3EZ2A 4DWJA 3EZ9A 2EFGA 2ZRBA 4RJLA 2A2ZA 3X2SA 3LBHA 4B75A 2ZR7A 3F5FA 4UNRA 2O8FA 2LCFA 4ASUA 4URZR 1RPZA 1N0UA 3AVQA 3IHLA 821PA 1G3QA 1NMZA 3AF0A 521PA 1ZM9A 4DLYA 4DLZA 5DSZA 5BXQC 5JECA 2VEDA 1WXQA 4V0KA 1W5SA 1F2UB 2ZXUA 2QAJA 3A1WA 4AURA 4DSOA 4HATA 4HZIA 4KYUA 3IEUA 1JR3E 4IOKA 2D7CA 4ZDIA 2BF4A 2VZLA 1E9EA 3NBXX 1NVUQ 3AVOA 1DO0A 1YZLA 3ZD7A 2QA4B 3PFIA 2REBA 2UZ3A 3AV0B 1RRCA 2VBCA 3SJBA 1P9WA 1Z0IA 2WIAA 4CYMA 4YDSA 2XTZA 1IJFA 1FQJA 1UDXA 3ZQJA 1M74A 5KUTA 2IS6A 4Q19A 1KDRA 3RAPR 4NL4H 5L3QA 4JBWA 4WZ6A 3M1IA 1DAIA 1CU1A 1P2VA 3JZMA 3QXXA 2NZJA 2PJRA 1Z2AA 2J0UB 1HV8A 5CM9C 5DH9A 2HXYA 2BVNA 3LVRE 2IYQA 2WAYA 1F48A 2O8DA 3QFRA 2IUTA 3GLGE 2P67A 4TMZA 3LBIA 2ANBA 3REFA 4BUJA 3VX3A 3Q7QA 1E2EA 5GJCA 1U81A 1KMHB 2QT0A 1KO1A 1IB0A 4BFYA 2JLXA 2DETA 2BMJA 2ZSBA 2PZEA 2JJ1D 2ZRNA 1KDPA 4U9UA 1ZD8A 2ZU6A 2CDNA 3P20A 4OK3A 2QAGB 4HB2A 1RYFA 2DFKB 3RLFA 3VKGA 3JZAA 2QPAA 1HYQA 4G5GA 4Z54A 2RMKA 3PJRA 1YJWB 3WY9A 3CC7B 2I1QA 4XVRA 3W8NA 4IVQA 1QRAA 1XMSA 4TQUS 2XNJA 1NY5A 1W36D 1N5IA 1ZC4A 2VP6A 3QXJA 1YKSA 2C99A 4UNPA 3VO1A 1GZSA 1NF3A 2FMXA 2IYTA 2AKYA 4QG7A 3BB4A 1W49A 4IRUB 4BFZA 3SOPA 2GJSA 3U3RA 1XTJA 3ZYCA 1XTSA 2R6GA 5BW8A 3OJXA 3A1UA 5H59A 3EZ7A 4B3BA 2GXUA 1JB9A 1A1VA 1Q81D 3TSWA 4A6PA 4F4CA 3I4LA 1XRJA 4M9ZA 1YJ5A 3W2GA 1KTVA 5FUXA 2REOA 5BN3A 2W6ID 3K0EA 3GJ8A 2C77A 4GFDA 3G0HA 1QX4A 4KYIB 2QP9X 1H85A 1WBDA 4OL0A 1OIWA 1S3SA 1TUEA 3CZPA 4A36A 3CXCB 4OQNA 3LWNA 2ODBA 1NLZA 1E9DA 1UDWA 1MH1A 1J8YF 2IYSA 4K81B 2QN6A 4JJZA 2BSAA 3N2EA 4BFXA 1VCOA 2P0EA 4TLAA 1S2MA 3HR7A 4YMWA 5B57C 3ND8A 3AKCA 5KNDA 1FNNA 1KK0A 1Q12A 3TH5A 3OZXA 4S35A 1T0HB 4A0HA 5D3MB 5AR1A 4PAMA 5JHHB 1E2HA 5EUQB 2GEUA 2JAQA 4TMKA 4L15A 4PC6A 1J9ZA 3W6NA 3B1WA 1KJYA 1DAMA 1W1WA 1GL6A 4KFSA 3EXAA 1K8AD 5KOYA 1L4YA 3LA6A 1RRFA 2FH5B 2GCPA 1RVDA 3TAUA 4JLAA 2CK3A 2O52A 2ZS7A 2Z6VA 4B73A 2ZETA 5DI3A 5KSPA 4JSYA 4DCUA 1CLUA 3TRFA 1X1RA 4B32A 4MGZR 3LY5A 4OK5A 2ORIA 3H1TA 2DEUA 2AHOA 1OT3A 3WXMA 1Z06A 3L0PA 2EIXA 3CRRA 4W5WA 4DDTA 2Q9CA 1X6VA 1HQCA 4HAZA 2ECKA 1XTKA 2O0JA 4NONA 1P6XA 4DCTA 2VF7A 2JLVA 2OILA 3CCQB 4US2R 1Z63A 2VF8A 4QHSA 3SN6A 3L2OB 4LCBA 2BJWA 2GAOA 2FSIA 4TQAA 1Z6TA 1OIXA 221PA 1DE0A 3KKQA 4ZIRB 4PQYA 3B8HA 3THYB 3EPHA 2FSFA 4BPRA 3OIVA 2GCNA 4L4UA 3IGFA 1FNDA 2ZRJA 2JLYA 4TT3D 2HYIC 3LD9A 3THOA 4CEIA 4CGZA 4JL6A 4DCVA 3ZZTA 1W0JA 4D80A 4QXAA 2ZJ8A 2CK3D 5EP1A 5UKDA 4HB0A 4F92B 2ZRFA 1MR3F 2WZQA 5C2JB 4M9XA 1YZKA 2ZI5A 4DHEA 3PUYA 4QM6A 1KKLA 4KV9A 4MRSA 1FX0A 4MKGA 2XOKD 3OAAA 1VECA 3DM9B 4JBYA 3KDSE 4TWZA 2CJWB 3PQCA 4C7OB 4QJ3A 2Z4RA 1A2BA 3B1YA 1XPRA 1PLJA 2J87A 1AGPA 5KDLA 1EP3B 1W0KD 1P2SA 1EWRA 1NLFA 4L16A 3AVYA 3JQPA 1U0LA 3W6PA 4NCHA 1LS1A 4A8JA 3BRWD 1UEIA 1Z6GA 2AL7A 3UWKA 3DHWC 4PHHA 3UATA 1VYTA 1JJ2B 1UBCA 1P61B 2BEJA 2OAP1 3NG1A 4CEJB 2CJWA 5JJIA 1M1YE 2C2HA 3AVVA 3RS0A 3HYRA 4PC7A 5DISB 2WWGA 2OXCA 2IEZA 4M22A 5AJXA 4ZDKA 3KFVA 3RC3A 1I2MA 1ZIPA 2RGCA 4QM7A 1C9KA 1Z47A 4EDHA 3ZS8A 4UQOA 2IYUA 5JJLA 3J81k 4CEIB 3PITA 2NTYC 1NG1A 1HE8B 3MWKA 5DHAA 4UNNA 5CK5A 4DSNA 1N5KA 1N6IA 4RVCA 3SQXA 4ZCMA 1XCPA 4TLDA 1NY6A 1RC8A 1ZM3A 3M6AA 4M9QA 4B2PA 3LH5A 5EE1A 4C0LA 1E2GA 3TR5A 1Z08A 3GLIE 4Y7CA 2GXSA 3PEWA 2FPMA 4OHYA 1F20A 1VG9B 3W2EA 2RHDA 1TTTA 1GNRA 3ZC3A 1CKEA 3L8ZA 3SZRA 1OB2A 1E2JA 2CLCX 3QKSB 4NE2A 1JALA 3RS4A 1Q3HA 2KWIA 3K9HA 4AYWA 4EPVA 1XD2B 1XU4A 2FPLA 3CM0A 3Q5EA 1JB1A 1U99A 2ZI7A 1W4RA 1D9XA 4XD7D 2GDJA 2I3BA 2CXXA 1QG4A 1JR3D 1CIPA 1W34A 2QORA 4KFUA 4C0KA 4G5RA 1TL7C 4BGDA 3EIEA 2NO6A 4M0LA 2ZSAA 1VHTA 3CPJB 4N3GA 3KUDA 3O8BA 2RB4A 1GL7A 2RGNA 4F4IA 5HZHA 2V6IA 1E69A 5BN4A 2ODNA 2P6UA 5DI9A 1Z6AA 1O3YA 4UXIA 2RGBA 5DN6A 3WP1B 2B8TA 2GJ9A 1EGAA 4ZI2A 1XJCA 2R2AA 1QHNA 3A37A 1E9SA 3S1AB 4F7DA 3B2EA 2EU8A 3B1XA 3L0OA 4P3YA 1JBKA 2FEMA 3QPUA 4PQFA 5EXTA 1DS6A 2WICA 5FTLA 5JS7A 3KQNA 3EPJA 2FGKA 5C18A 5AUQA 3HPQA 4KBFA 2BMWA 4IFBA 1FNCA 1NL3A 2W00A 2XTNA 5CLLA 1T0JB 4IOJA 2I1VB 4OQLA 3A36A 1DBSA 5F9HA 4URYR 5JJKA 3QF4B 1U8YA 2ZJYA 4LOAA 3I32A 4TYYA 1MABA 3BB3A 2F3TA 5E95A 3GJXC 5F2EA 1KI2A 1E2IA 1XF9A 1G3MA 2UVQA 3AVTA 3KL4A 2KBFA 3VKWA 1XPOA 5FPKA 4P33A 2XNSA 3K0CC 4Q01A 1FDRA 2HDNB 3TQFA 3U3OA 1CJTC 1NMYA 2J7PD 5EE5B 1CS4C 1WQ1R 4PFSA 5HXBA 1C4OA 2ZYWX 4AK9A 1NSFA 2FPKA 2WKPA 2W6JA 4UNSA 3OEED 2DWQA 3FWYA 4M1WA 2OXRA 4A8JC 3FMOB 5DGXA 2DBYA 3W2HA 1ZVQA 2ERYA 2YV5A 3ETLA 1ESMA 1GTVA 3HR8A 2ORVA 3QENA 4A2PA 1J2JA 5FL3A 1BMFA 3A1VA 1XDBA 2ZSFA 5J47A 3U6KA 3W5HA 1ZIOA 3ZVRA 5KYKA 4II7A 3KJIA 4BE7B 1N6OA 4DLXA 1N25A 1M7HA 5K8UA 2NG1A 2Q6TA 4JS0A 4B6FA 4DLRA 5LPNA 5TARA 4ZGQB 1PJRA 4OQFA 3FHCB 1AKEA 2BDTA 4ZI3A 2Q21A 2ZRGA 1GKYA 4ZKDA 5IHPA 3T35A 2IHBA 4RZ2A 3QFSA 3O47A 4XWKA 1JR6A 1IQPA 1XEXA 3FPAA 4YMVA 1XZQA 2QBYB 1EWYA 2HMAA 5SZJA 2OT3B 3GFPA 3DPUA 2BMDA 3UMFA 4DUGA 1NIJA 1YZQA 2CL6X 3I1FA 2W2XA 1OJLA 3GLFE 1VQMB 1QBKC 2A5FA 1NMXA 4D0LB 1U8ZA 2PEZA 2VP2A 2QRZA 3BGWA 1KJZA 3QJYA 3AM1A 2IT1A 2QY9A 2WWXA 1LF0A 4I4LA 4YQFA 3SFZA 5FBLB 1VPLA 4QNRA 1BS1A 1HH4A 1E63A 3LNCA 1KSFX 1LFDB 3D3QA 2GKSA 3IEVA 2QT1A 2YWGA 5JEDA 1KHTA 2HYDA 1WF3A 2VP5A 4GMXA 5JS8A 2VHCA 4KODA 1OSNA 2WAXA 1CJKC 1DDIA 3CMEB 2W58A 3EARA 3KJHA 1OXUA 4WOPA 4CIDA 5CB8A 2ZR0A 3B9PA 4CW7A 2IL1A 1I4DD 1FMLA 1XD9A 3WRYC 4M53A 3GJ5A 3RWMB 1E0SA 2JIZA 4AKEA 1US8B 1VQ7B 5TMPA 3SU8A 2ZVQX 1E2FA 2OFXA 3FVQA 3W9YA 2GPJA 4HUQA 3BH0A 1R0ZA 1N5JA 4IVRA 2D2FA 2F43B 3MLEA 1W0JD 5FOVA 1NP6A 1SHKA 1FL9A 1VQ8B 3N70A 4O0MA 1XMJA 4LV6A 3SEAA 4TZ6A 3OEHA 4U00A 3W2FA 1U9IC 3G4SB 1NSTA 3LX5A 5FTKA 4PGOA 2FZ4A 2ZE5A 5JZVA 1CBUA 1HE1C 3PUVA 4JYCA 4JJKA 4AG5A 5FTNA 2QGNA 3I3SR 2WVJA 3MFYA 3MWYW 1LVGA 3ZBUA 2CLDX 5HTKA 2QBYA 1AMOA 3FE2A 1IM2A 4LJ7A 1K5DA 2HEIA 1OXXK 1FUKA 4NDZA 3PEUA 4LC1A 4TTQA 3G82C 3AUYA 4A0RA 4LK2A 4E07A 4QGFA 621PA 5KNCA 3JVUA 1QGYA 3NBZC 2YNMA 1Z22A 2WSSD 4LYAA 5FTJA 3AF4A 1QHSA 4JVNA 2RGXA 3R9IA 4C43A 2HJVA 2IW3A 3QY0A 2VTKA 4KAXA 3DO6A 3DL0A 5B64A 4TMWA 1TAGA 3IIJA 5E4FA 4GNKA 4BLOA 3ZDQA 3E1YE 5J4KA 2J46A 1KI7A 1MV5A 2E87A 3CNOA 4D4LA 5CLQA 1R7RA 3FGNA 3G5UA 1GO2A 3V00A 4I1UA 1VQ6B 2HT6A 2P65A 4YHBA 3HU3A 1W47A 4PHGA 2GQFA 3BB1A 1UBGA 3SC3A 4LJ9A 2J7KA 3CX6A 2ZJOA 5EUMA 2J0UA 3T5DA 2BPOA 1ONBA 3PG5A 4ZO4A 5G40A 4FXPA 3NHAA 4KLNA 1XD8A 2QL6A 3OE7D 4B3FX 2O5VA 4WAUA 5FBVB 3SBDA 3DZDA 3E2IA 3B7GA 5FOXA 1KI8A 5FPTA 2WWIA 4YAOA 3TE6A 1VQKB 1X8KA 2QGZA 1RE0A 1PLKA 2YVUA 4LWZA 5C4GB 3W34A 2B7BA 4DSTA 3RANA 3U6BA 1E1QA 2HUPA 3FMFA 5ELXA 3CF0A 3PCRB 4Z8YA 1DAGA 5P21A 1Q1EA 1YI2B 1QVGB 4ZV4A 2AXPA 4PZLA 4W5JA 5LB4A 4JKYA 1SVLA 4HB4A 5JWOA 3QKTA 1OW3B 1CNFA 3O8DA 1F60A 3K0SA 1I4TD 3CUEF 4KITB 4UAJA 3KQUA 3RSOA 4MYUA 2V4ZA 1R10A 3BH7A 1G7CA 1OFHA 3NIBA 3LXXA 4RCYA 2ZRKA 3KKOA 1G64A 1NBMD 3K0FA 4FCVA 4G01B 5FOSA 4ZIRA 2OK7A 3SJCA 2WWHA 2PT5A 1E79A 3ECCA 1KYIA 2GCOB 5IK2D 4AF6A 3DZ8A 3U7HB 1OLOA 3VMFA 2GVZC 3UMSA 3IBYA 2YOFA 3OZWA 1CTQA 4A9AA 1L7VC 4KLZA 2BHRA 4ACAA 5JWHA 5FFMA 3H0KA 4LSGA 3UANA 5TV2A 5EZ6B 3SYKA 1NNEA 1CF4A 3CCRB 1H8EA 1KI1A 2RCNA 1ZRHA 1GVHA 1VQNB 3TSOA 1LNZA 3UXMA 1NVXQ 3EX7C 4TMTA 2JJ1A 2NPFA 1F2TA 3QE2A 1J90A 2PX3A 4A8JB 3QE0A 1FRNA 1K9MD 1KSHA 3CRQA 3PIRA 4AYXA 5FTMA 3ICQB 4Q21A 2VNHA 1IXSB 1V43A 2V9PA 2PZFA 1D2NA 4ZDJA 3RNLA 4B44A 3BFKA 5B58C 3W6OA 1ZCAA 1LY1A 2E1RA 4GBMA 5KDDA 5KPDA 2ZU0C 2GESA 2QDXA 3CX8A 1Z6YA 2YC2C 4G1BA 1DDGA 3GQBA 4YMUA 4OQMA 3GLIA 3NEJA 2FFAA 5DIFA 4QFMA 2GJ8A 3U61B 1II8B 4URUR 2C78A 4MRNA 3SQWA 1ZNXA 4IFEA 1US8A 1JPNA 1HA3A 4DB2A 1IN4A 4PC1A 3EZFA 2WJYA 4BFSA 2JDID 3K9LA 1KIMA 2QAGC 2EFEB 4PTLA 1CR1A 3EIHA 3ONWA 4IVPA 5HCIA 3CCMB 4DEYA 5FUVA 4BLPA 4FK8A 4NCJA 4A2QA 3QG1A 1XE1A 3T06B 2ZUCA 1XB2A 1ZD1A 3GLFA 1FNMA 4FMBB 1SVSA 1W46A 3THWB 1FRQA 5LD2C 1E32A 4Q7JB 2JLRA 4U5XA 1MABB 3M4YA 1UKZA 3VQTA 4LJ6A 4AY2A 1GNQA 3THXA 2RAPA 5H1YA 1AN0A 3FFBA 4ASUD 3LRPA 4HUTA 1PUIA 3HU1A 2HCBA 2FFQA 1U2RA 3K9NA 1W2GA 1GM5A 4Y0VA 5TR9A 3CH5A 3GMTA 1E0JA 1E9BA 3IPXA 3GEIA 4JLDA 1VKJA 3CMAB 1QUEA 2G0NA 4A1FA 5AK0A 1M7GA 2ZI4A 3CCVB 3NTUA 4JLMA 4UJ3A 2ZTSA 3T12A 1N3BA 4RSGA 4A92A 2ZRHA 2R9VA 1T5IA 5JI2E 2OCBA 1TEXA 2ZS8A 3KXLA 8OHMA 1ZINA 2X8AA 4MGYR 3CCEB 4QHYA 4JKIA 2NQ2C 3TK1A 2OO7A 2BOVA 1G17A 1Q44A 4JIMA 5FBWB 2A5YB 3BWDD 2OUKA 1HURA 4Q1DA 4TL7A 5AUOB 5AJZA 1KI3A 3RDPA 6Q21A 2QAGA 4JVLA 4E03A 1NI3A 4MITA 2ATXA 2QSYA 4B76A 3VHXA 5EQTA 2G1KA 3VAAA 1GAWA 5KTYA 2JLWA 4PSKA 1GFIA 2IYVA 2VPPA 4HE5A 1DG3A 4B3CA 2GK7A 1GAQA 3SI7A 3MJHA 3OF5A 5LD2B 4ZPXA 1UM8A 1FUUA 2ZRAA 4M1KA 2AWNA 1L2TA 2ANCA 2FF7A 5FUYA 2QTHA 2QTLA 1OF1A 2BBOA 4FN5A 2OTLB 3ZLJA 4PPQA 1D5CA 3CBQA 4TLCA 1OXVA 1ZCBA 2C96A 4S2EA 3FOZA 1L4UA 2DR3A 3AF3A 3AVWA 3MMPA 2W83A 4ZKEA 3I8XA 5THXA 3CRMA 4WXPA 2A5DA 3FJOA 2CCJA 4HLUA 1U8AA 1XNJA 1E1RA 1B2RA 4IEEA 2IYWA 1AKYA 1GSIA 5AJWA 3C15C 1QG0A 3R20A 1UBEA 5CJPA 4YLGA 5CIQA 1UKEA 2QMHA 1S9DA 3ZS9A 3C16C 2HT1A 2XNDD 2QPOA 3SHFA 1VQ5B 2H57A 4QBGB 3TKLA 4V0ME 1GITA 3GLHB 1JA1A 1Z2CA 2FSGA 5C46F 2XZPA 3MD0A 2O8FB 5KHOC 4M2LA 4LV5B 3U4QA 1G8GA 1N0WA 3OZUA 5CDFE 2AK2A 1DAKA 5H70A 2QRNA 5FH9A 1IBRA 3QEJA 3NVAA 4UXHA 1EXMA 1ZM4A 5CB6A 2Z4SA 4NBSA 2Q9AA 3U3JA 3WMGA 4W9MC 4JT2A 4ZCLA 2DERA 3L43A 2C9OA 4D4KA 1WA5A 2FGJA 2ZRCA 2IXFA 3CWZA 3DKVA 1KK3A 3T5GA 1I7PA 2B6HA 2VQSA 3VU9B 1UKVY 1S96A 3IIMA 2GA8A 4PPNA 4N0DA 1TQDA 1JECA 3H2YA 1W4BA 3CB4A 2VLIA 2W0SA 2QP4A 4LJAA 1VG8A 3K1JA 3SDZA 3K09A 1R6BX 2CHQA 2OBNA 4PX9A 1G5RA 3KKPA 2D4HA 3DKPA 3CR8A 4W7SA 4C2UA 2QTFA 3RS7A 1G41A 1AGRA 2OFWA 3B85A 2CNWD 1P9NA 2P5SA 4BFVA 2YYZA 3HDTA 2VHTA 2RC5A 3AP3A 2OTJB 1TQ6A 3KQLA 1T9HA 1KD1D 3HYTA 1H8HA 3CIOA 2W0MA 4LDJA 4Q4AA 2I4IA 4NTZA 3LDAA 1GIAA 4HSEA 4O2LA 2KI5A 4OQXA 2CMKA 3SYNA 1G16A 3FDIA 3BIFA 2DFTA 3TJZA 4B2LA 4C0HA 4AKHA 1OFUX 2FV8A 2XSZA 2EYQA 3AF2A 2QMUA 2ZITA 1NIPA 2GZAA 2Z5FA 3VU9A 4ZGNB 2ZE7A 2ZQ5A 3DM5A 1GOTA 1Z6XA 1ZC3A 4PPGA 4Q7LA 4RFSB 4X8OA 2J9RA 4DJTA 5JEEA 4N1AA 3QXSA 4LYFA 5HKKD 4LHZA 2ZAOA 3IPYA 1TNDA 2LKDA 2HLDA 1VCMA 2JJ2D 2MSEB 3KB1A 3VHLB 2AR7A 4D82A 4EPRA 1QHIA 4LV8B 2EFDB 1Z0DA 3GP8A 1VTKA 4Y0AA 3TUIC 2J59A 2CE2X 3GFOA 4C30A 1F3OA 3CF6R 2YKGA 1RW4A 5CM8B 4DT1A 3ADCA 2ZI9A 1VIYA 2N46A 1EX7A 4EQ6B 4DDUA 1CRPA 5FA6A 4XIGS 2WBLC 2Z83A 3N2IA 4DLSA 4LJYA 4K1XA 2BWJA 4Y9RA 3ZVLA 2VP9A 1ZU5A 3EC2A 2QE7A 4GZMA 1NBME 3FPKA 4OHZA 3HU2A 1CR4A 3UIEA 4FCWA 2GCOA 2C98A 2D3WA 4A82A 4C2TA 3EWSA 1BX1A 4WA7A 4GPTA 3QVVA 1QGZA 3AGQA 1SVIA 2WJIA 1EFRD 4YAFA 1Z0KA 2JLZA 1E64A 3ZIAD 1IXZA 1UEJA 1COWD 1WRBA 5K8LA 2ZJAA 1YR6A 1ZP6A 4M1SA 4Q9JA 4NHOA 2EQBA 5HR5A 1G3RA 4TMXA 2FSHA 3OW2B 3RVBA 4HE6A 1TVCA 1KI6A 5M04A 1BH2A 2FJUA 1SGWA 3MJRA 1XTIA 3I55B 3I72A 3GLGA 3LVQE 4YMTA 1R0WA 3W3ZB 1YHQB 2GETA 3IKJA 4DLTA 1Z83A 3WYFA 2ONJA 3ZJYA 4EH1A 4Q47A 2N1BA 2X19A 4MGKR 4EJSC 2C8VA 2CNWA 4GMDA 5KSWB 1ZW6A 3IO3A 4HAXA 5E7JA 4WVFA 2IS1A 2PL3A 3ADKA 2B92A 4KU4A 2DCUA 2NO9A 2XB4A 3A4LA 3L0SA 2QSZA 2ZRMA 4IKEA 2NO1A 3A1SA 2CHGA 2X1VA 2VH5R 4C3ZA 1UF9A 4TL9A 4RZUA 1YHNA 3IQWA 1KY2A 4I1SA 4IDOA 5DE3A 2ZYVX 4PANA 1XEWX 1ZUHA 1G5PA 2BKEA 4B43A 2ZANA 4LYJA 4DT1B 3U44B 1XBTA 2A78A 1YRBA 1JJVA 2BBTA 2Y8EA 3P26A 2ZREA 4DXAA 3QFCA 4A0FA 2ZR9A 4M1YA 3IO5A 1KMHA 5F3WB 2KE5A 2QMEA 2AFHE 2P5TB 3LW8A 1E0AA 1KMQA 2KB0A 3IHWA 4WZBE 4QNMA 3X1DA 4HAWA 2GF9A 1JQLB 5KDOA 1EWQA 3Q8XB 2HLDD 2JJ2A 2P6NA 4FINA 4K46A 4TMVA 1SXJA 3MAAC 3ZVNA 1OGJA 3SHWA 5JFGA 4A2WA 5J4YA 3LLUA 2OZEA 3FKSD 3U2QA 1E2NA 5EZ5A 4UKDA 1OKKA 3MGCA 1KRHA 1NDHA 2WOOA 1F5NA 4GOJA 5CYPA 4C0QC 2CCKA 2DHRA 2G0TA 2FEOA 1SZPA 2NZ8A 2QENA 2XX3A 3WHLA 1QFJA 1Q0UA 4MRVA 4RD4A 4LRWA 3ICEA 3I92A 5E7MA 1II0A 2GZDA 3CCJB 3ZZUA 4B4DA 1QGAA 3PEYA 4AKGA 4QL3A 1T91A 2XNDA 4MDEA 1H8HD 3IUYA 3OESA 2F1JA 4F4JA 2DFLA 1UBFA 4H9GA 1G8HA 3TSZA 2C5LA 4YONB 2O0KA 1Y3AA 5L3SA 4P4TA 4GSYA 4H1VA 5CITA 1MO5A 4GZLA 5JRZA 1OPXA 3I5YA 4LUCA 2V1XA 3UG7A 5J4LA 2JLSA 4AC9A 4BRWA 4ARZB 1KO5A 4NYJQ 4V0NA 2F55A 2IYRA 4BLRA 1A8PA 2F7SA 4HB3A 2AFIE 5GJWC 3JQRA 1EP2B 1X86B 2ZPTX 3U44A 3MG9A 2IK8A 2GEDA 1VQ4B 1E2LA 1X3SA 4JLBA 1LS6A 4C9BA 2C9YA 3B78A 2RKOA 1KDTA 5FBRB 3G6EB 1XWIA 3EA5A 1N6NA 2O8CB 1CJMA 1WDTA 1W44A 1G291 2G9NA 3L0IB 4ESHA 4XSHA 1NKSA 1E9CA 1VYUA 2ZYUX 3VR1A 5K8IA 3QBTA 2OFOA 1QHXA 3QQ5A 1RJ9B 2PCLA 2RC6A 3D7MA 3RS3A 4QBFA 5EE0A 1P4SA 5J4HA 5A0FA 2AKAB 1E2DA 2YC4C 1E62A 4Q1AA 4ESVA 1RIFA 3W5VA 1KAGA 1U9IA 2IUSA 2QG6A 2BGJA 4M1TA 4FMCF 4KJZA 5D3QA 2VYQA 3WNCA 1G4UR 4LX0A 4Q9IA 2D06A 1GWNA 4DZZA 1TX4B 4YXWA 3TGPA 1KSJA 1Q86D 3GLFB 1BX0A 2YOGA 3P27A 1Q20A 5AUNB 3R9XA 2QNRA 3NDBB 3Q9LA 5FBQB 5IT5A 4YMSA 3T61A 4U7DA 5EXPA 5BQ5A 1G18A 2J7PA 3W5UA 4PZZA 1VDZA 4AD8A 2IUUA 5L3VA 3VNVA 2XJ9A 1DARA 3EW9A 1J70A 2N42A 3A4MA 1KK1A 1VCNA 4F38A 2XTMA 1DAFA 5EMNA 1E3MA 2H92A 4LJ5A 1CR0A 3M0EA 4V0OA 3U7FB 1NLYA 2H8KA 4IDQA 4YAUA 1H42A 3IDQA 2AD1A 1W35A 3CNLA 2YHSA 1NRJB 2GZHA 3X1XA 4CDGA 2GXAA 1NN0A 2BCGY 2PCJA 2H18A 4Q5IA 1E4VA 4TLEA 1M8PA 3RABA 1CNEA 1DTSA 3TW8B 4BRUA 1IY1A 3EAQA 1N2CE 1FZQA 1U94A 3PVSA 3Q3JB 1VQPB 3BOSA 4CEHA 4D81A 1B23P 3RRMA 1ZBDA 5GV7A 4OK6A 3CC4B 2CE7A 1MRNA 5FPSA 2C9CA 4D4JA 3C14C 5FUWA 3SS8A 4GOXA 3CX7A 3FTQA 5TVKA 4P6VF 4A0GA 2IBMA 4V03A 2P2LA 1XPUA 1VCIA 2R44A 1XTQA 2B21A 2FWRA 1T4GA 3WMEA 4Q4HB 3X1WA 2GNOA 3PV0A 3WBJA 5D3MA 2ODEA 5TY0A 4TYQA 1EFRA 4TZ0A 4RCZA 3D8BA 1IN6A 1FPMA 1AS2A 1K8RA 4XD7A 2A9KA 2QMOA 1OHHA 1P73A 4KFRA 3TAHA 1YRAA 1WMSA 2D2EA 1YZGA 2IA5A 5FR1A 5GJVC 1CULC 2PT7A 2A30A 3K8YA 3H4MA 4QHTA 1PZNA 2IYLD 3PUXA 1G6HA 3P32A 4PPFA 4EPWA 2YWEA 1KOFA 4O25A 3QG5A 1JNYA 5LDDC 2P6RA 1G8PA 4NYMR 1Q82D 1KO4A 4PC3A 3KQHA 3NC1C 2GTPA 3NHBA 1KI4A 2V7QA 1AJEA 1OYWA 1CXZA 1OE0A 2B8WA 2ORWA 2ZSEA 5LBIA 3GJ7A 4NP6A 4BLQA 1DAEA 4OBEA 2A5JA 2R6FA 4DBLC 3T15A 1E99A 1E79D 1OKKD 1QDEA 2H16A 3OFND 2IXGA 2E9SA 4JBXA 3VFDA 3FKSA 3VR4A 1P60A 1T8TA 4IJMA 1RRGA 4Q4JA 1ZNYA 1T3LA 2ZI6A 1SXJD 1FTSA 1MKYA 1A2KC 3AGPA 1Z0AA 2HF8A 1KO8A 2RGAA 4GRAA 4PHTA 4JLJA 1SHZA 2F1RA 5G3ZA 3OIWA 3OFNA 3SJAA 3EC1A 2WIBA 3BXZA 4YC7A 1SKQA 4DIEA 5KSZA 4IHQA 3EASA 2D62A 4F93B 4BZQA 3MRSA 2H17A 2REXB 3KUCA 4DRZA 1TEVA 5BWMA 2WJHA 1TQ2A 2YOHA 2W2TA 3LAWA 2XAUA 3U5ZB 4BPBA 2R6DA 2MMGA 3NH9A 1D9ZA 2HF9A 3NBYC 1KK2A 1W48A 1OH7A 1G8YA 1EG7A 3GLIB 3GEEA 3WMFA 3GFTA 1QG2A 1D2EA 2QEQA 1OH6A 1W36B 4D25A 4Q1EA 2W2VA 3TBKA 4G0NA 1RRPA 1TQ4A 2XGJA 2RHMA 3OE7A 1GP2A 1M6NA 1OHHD 1KDOA 4NCIA 3MUFA 2AD5A 4OJKA 4D2IA 5SZKB 3P4XA 4OJQA 1D2MA 3PUZA 2HCJB 4PC2A 1IN8A 1BO6A 2J41A 2R62A 1G19A 3QEOA 2ZUBA 1R5OA 1DG1G 1M90D 1T6NA 1VYVA 3LO5A 4I1VA 1N6RA 4JL8A 1HQYE 5CJ2A 2IWRA 1ELOA 3UKDA 3QPVA 4RD1A 4DCSA 1QVRA 1U98A 3OJWA 1Z28A 2KBEA 1QHHA 4IDNA 2PBRA 2ZE6A 1PVOA 4DLWA 1E94E 1FQKA 4NCKA 3Q85A 4HZUB 3QOFA 4PSVA 2B7CA 1LW7A 5FPHA 3B13B 4CT4B 1EP1B 3LVBA 3C5HA 4DSUA 4NZYA 1WBBA 1AS3A 3T1VA 3CKLA 3K70C 1X8LA 2BMEA 4AKIA 4Q66C 2GILA 2F3RA 3W3AA 2BM0A 3AVUA 1G4AE 2ZIAA 1YE8A 4JMPA 4XSGA 3OHMA 4JL5A 1JEEA 1XFAA 1KQSB 4OI1A 4QGHA 5G53C 5KNBA 3WNDA 3EPLA 1R5BA 1I4LD 1ZUIA 4C0AC 2VRWA 1P7CA 1I2DA 3I56B 1NKTA 3R7WA 3I61A 4OI0A 4G5SA 4Q9LA 1DAHA 1QVAA 4BLSA 3FHOA 3E5HA 3QKRB 3SNHA 2VP4A 1ZNZA 2QM7A 3WP0A 3VO2A 2NGRA 2VHUA 4QGGA 4ACBA 3LO8A 4OYHA 1JPJA 1HY3A 2JA1A 2BN4A 1Y63A 2C03A 1BIFA 3CONA 2DFNA 3SFVA 2PJZA 2ZROA 3RRNA 2GHIA 1N6KA 4IXMA 5K8TA 2ZM5A 5J4VA 3CPHA 1RYHA 1U0HC 4FWIB 4RY2A 1BYIA 5EE3A 3KTAB 1S9HA 3B60A 3DEFA 5TB5A 1D8TA 1UKYA 4L9SA 4LYHA 2NO0A 3R9WA 1YJ9B 2KSQA 4M1OA 3T1OA 4PSAA 4PO1A 3WYAA 4G5OA 4LJ4A 3RRZA 2FNAA 5C4MA 1G20E 1EK0A 4MKFA 4QJ5A 2ZUDA 3K70D 1V5WA 2GF0A 5DYIA 5EP4A 5FI0B 3S1AA 1NN3A 1XMIA 4TYNA 4KSBA 4D6PA 2D7DA 4ARZA 2ZJ5A 5KSOA 2VSOA 1KNXA 1SULA 1ZNWA 1TLLA 1BQEA 3BFXA 2YWFA 3KXKA 1IOZA 4BFTA 3EPKA 4L9WA 3T1TA 1II8A 3GJ0A 3NXSA 4NPHA 4PAOA 1S72B 4LHVA 4BFWA 4B3DA 4KVAA 4MRRA 2Q3MA 4EUNA 1QFYA 4KXFB 1P2UA 1M34E 4LJ8A 4QOSA 1JAHA 3TUZC 1B0UA 4DLUA 1L8QA 3AEZA 3KKMA 5AJYA 3CC2B 4ILEA 4F91B 3SE0A 3GJ3A 2BCJQ 4ON9A 4EFNA 1GRRA 2F43A 4JLOA 4QRHA 2ZRPA 3V4FA 2J0QA 4X8MA 4YXWD 4Q4JB 4PAQA 4RKFA 1Q21A 4JVMA 1TUIA 1VG1A 3H84A 2IYYA 4PZYA 3CNNA 1FP7A 2BV3A 1KNQA 3MSXA 4WIAA 4B2IA 4AG6A 1YZNA 4E22A 1MT0A 4Q7MB 1N6LA 4IW3B 3UWOA 4LHYA 4BECA 3R7WB 1EFHA 4D0GA 2JCSA 3ZH9B 1P3JA 3RC8A 3WNBA 1FOEB 3EIQA 4TTPA 5IF9A 1GKIA 1PUJA 2BJVA 4EPXA 3R8FA 2W6JD 4TL6A 5H5JA 1ZMXA 3IQXA 4GP7A 5H68A 1MO4A 3RRYA 2WV9A
chains in the Genus database with same CATH superfamily
1SD2A 2CBGA 3LVFO 4M4SA 2JI9A 4IQ4A 1T0PA 2J6BA 2XECA 4UJ5A 4XVQA 4ZO8A 1E1MA 1IHUA 4XCQA 1PWYE 5L7TA 2R48A 3I2IA 3DNFA 4R7ZA 3JALB 2H1HA 3MUEA 3CO0S 1TZKA 2LV8A 4I9FA 5J5CA 3ZJ4A 4DMFA 3FSJX 3JQDA 4BXOB 2DR0A 2H0RA 4Y2HA 5ICGA 2VDUE 1WF6A 1TTHA 3B51X 1IMJA 3AVXA 4R2JA 4R2MA 4I55B 4IPTA 2PE5A 4WJKB 5K0FA 2BEVA 1POXA 3O1JC 1NPDA 4Q00A 3PQFA 4RSMA 3BY2A 4AY3A 4BGUA 1QAOA 3VKUA 4NDNE 3LYHA 5JSQA 2HJSA 2JC3A 5C3UA 4B71A 2XMRA 2WAOA 3R3UA 4KJXA 2LDXA 5K0ZA 2H6EA 1V8BA 1XZDA 2FN8A 3A8TA 1BPLA 4OHWA 4ARBA 1USGA 2QQEA 1X94A 4OI2A 1YV9A 1FDWA 2XYGA 2VWPA 3VA7A 5T8KA 3PX3A 4E2ZA 5DX1A 1G8JA 2N0SA 2HMVA 3FH0A 2DH6A 3K8OE 4IH4A 3ZD6A 4XQ9A 3SZOA 3LKZA 1ESCA 2PN1A 1K5GA 1HSZA 1ZAYA 4OXNA 2FLKA 3DXYA 1MBZA 1YU9A 4DA8A 1J2EA 4HR7A 4DKXA 2IDJA 1D6JA 1E9RA 4R9VA 4V2UA 3GLGB 3RVPA 2HRRA 5ICEA 1UJ2A 4JENA 2X3FA 1LJ8A 1ISJA 3VOBA 2Q5QA 4ND5A 4ZVKA 3WWZA 1X1SA 3GPBA 2EFCB 4S1TA 1L5QA 4RU1A 3S68A 1FW6A 1R66A 3OIDA 2DTEA 3HSYA 1OYOA 2D74A 1W2HA 7ADHA 4WI1A 1M2OB 3G2IA 5EJIA 4D9HA 4FCTA 5B4VA 3T3OA 4FB4A 1EJ0A 3T5BA 2VJAA 1O6FA 4FI3C 2Q5CA 3Q40A 3UO8B 1XNHA 2RHBA 4AF7A 2WLSA 1PRYA 3KPVA 1WDLA 3HSSA 1GXSB 1V7QA 1YD7A 1GJRA 3PFBA 2AEFA 3LL7A 2AWOA 4ITVA 4Y6LA 3V2UA 4NNJA 3BWEA 4R2LA 2R8PA 1VKZA 3AJDA 1QF9A 4AJLA 2HSJA 2DT8A 3ZHCA 3EUAA 1YS4A 2GHQA 3S7TA 2JLUA 3BSYA 4KO8A 1OUMA 1VL5A 2J3EA 2P2YA 1C7JA 121PA 1P1CA 2WSMA 3GHYA 4KWEA 4WXHA 5B37A 1UPUA 3LLVA 4KVZA 5BNWA 3KJEA 2O57A 5HILA 5HYVA 4MO2A 4OB8A 2AS0A 4KZPA 4RPGA 4QOGA 3GH1A 3EE6A 3MWLA 1QYXA 3FPFA 4UD2A 2C4UA 3AXSA 5DBIA 5B1IA 4DC9A 3U7GA 4TYWA 1M73E 4KN8A 4JD5A 3BIXA 4JEIA 1NKVA 1JAXA 2QIOA 1OLXB 3WIVA 4QVKA 1T3SA 3ANMA 4GUAA 1VHQA 1X80B 3K4HA 4LRXA 4NARA 4QAJA 2BFOA 4H0CA 3VH3A 1P29A 3GV0A 4R1PA 4WXRA 3U5TA 4KVFA 1TKCA 6ADHA 2WMOB 4JLVA 2IYXA 3OPMA 1LVHA 3LZDA 4G9BA 2QI9C 3WLSA 5BWNA 4PLCA 2VH1A 4M0MA 1BE8A 5DK4A 3CVJA 4H4EA 5FEMA 4XOUA 3U56A 2CWWA 3CA8A 3THWA 1Z37A 2ECPA 2E4WA 3EFOA 3GFSA 4G3XA 4NJOA 4HXEB 3REQA 3OZVA 4BDTA 1YUMA 4DZRA 3Q7EA 1P74A 3QFFA 4BO0A 1XCOA 1YQTA 1U0GA 1ZESA 3EXHC 5KHAA 3VC2A 5EL0A 2H2GA 1PV2A 1HSOA 4TKUA 4WOCA 4B6QA 1GAJA 1ADYA 1RWNA 1XDWA 2OEPA 3DMNA 1R00A 5WRFA 4ZI5A 5SY9A 1OX6A 3RGGA 3RARA 2GOYA 2G88A 1WNTA 1MRZA 4F8YA 1MENA 2OM2A 1GCAA 2ZWPA 3QLTA 4HDSA 4L73A 4RLHA 1F7UA 4AO8A 2PX0A 4NH0A 1XMOB 3FLAA 4DRXB 5K2OA 3K0CA 1DTEA 1Q7GA 1ZLXA 2HRCA 3CR3C 3NHWA 4JFRA 1UPXA 4RTQA 4Q9HA 5CDTA 4FHCA 5KOHB 2QE7D 3LTNC 1GPWB 1O94A 5KNCD 3JQ9A 1NB0A 2V55B 1X0VA 5MHTA 1CZKA 5A3JA 2H9AA 3WICA 4LPKA 5G3YA 1JAIA 1U1FA 5JHGB 3P9XA 4BTEA 2O5EA 1WOPA 3P2KA 3H99A 5DCYA 3QXHA 1DWPA 2CJYA 1CDZA 1VIDA 5JAOA 1A9SA 1L4GA 4JMLA 3STYA 1CUSA 3DOFA 5EHZA 1R6UA 2R8RA 4CZ2A 2XMBA 5BY2A 2WFMA 2NACA 3CLHA 4QNNA 2C54A 2Q0HA 4G81A 1VYHA 3CF2A 3O4GA 1UZMA 1UP7A 1XTRA 2E6UX 4Y1RA 1OFIA 5GZ1A 5KX5F 3FKQA 2XUFA 4JUIA 1KEVA 5EP3A 3B36A 2NVWA 3WYGA 1JZSA 3ABZA 3FPBA 4UTNA 1YDWA 1P1IA 1X77A 5DI3B 2AK3A 3ZWOA 1XJ0A 4M8NE 4OL9A 4XVCA 1LKZA 3A1NA 4EATA 1YITB 3KHUA 3QXCA 4HLCA 4PGHA 4D92A 4YUAA 2PMDA 2PTHA 1T1JA 3DAPA 4N7BA 4MH0R 2XWSA 1R3DA 3LQFA 1W85A 1YDFA 2V7QD 4I08A 4FONA 3E20A 1IN7A 4Y2VA 1MOZA 1B16A 3A3GA 3VYSB 2PYZA 3W5DA 5GV8A 3AXTA 1FU4A 3FUVA 3HXQA 1PQUA 4D4IA 4JV5B 1Q17A 2VP0A 1OGIA 1R0BA 1RPNA 2VQDA 1N8RD 4MS1A 1O8BA 4FVTA 3DDSA 4N18A 4E3WA 5J3JA 1G7TA 2BEWA 4NYMQ 3OQOA 2XTAA 2DHEA 2XAAA 2O2DA 5LQUA 3KZ1E 3QEBZ 3CE9A 2DWCA 2C4MA 3N8KA 4ZT4A 1W29A 1S8FA 3V76A 2V4DA 1K2WA 2UYYA 4IH9A 5CURA 3BDVA 3IAS6 4FBGA 5A5GA 3WB1A 4HRAA 3L7NA 4LY0A 2QV7A 2P9QA 4X0EA 4H0FA 1CP2A 4TTRA 4Z51A 3VR3A 1H5QA 5LXTF 5L51A 3WHKA 4MS1B 2JAPA 1G6KA 3QVSA 1L4HA 2OSBA 3G7UA 2GT1A 5A03A 3PUWA 3JZIA 2WE7A 1MF7A 3EBOA 4HTAA 4O4LB 5B1SA 3ZCVA 3BHMA 4RD6A 3MRVA 2PZGA 2Q2QA 4MQLA 4ZQFA 5ALSA 3NC0C 3L5OA 1G21B 1UZAA 1H9CA 4WBSA 3CCLB 4WZAE 4DC1A 5KO2A 2A3RA 3I9V1 1OZAA 2FEPA 2ZULA 2ENUA 4J0HA 3C1TA 4XIFA 2P0YA 1KQPA 4YJ2B 4YUXA 3FX2A 4N5LA 2QV0A 1VZ2A 2XR1A 1Z5GA 4HYQA 3RH0A 3ZE1B 3SZ3A 3RNOA 2BM1A 3KEOA 4TKUB 4X8HA 2ZXFA 4LHWA 5DNCA 2F9LA 4HEJA 1IHOA 1JSZA 5F77A 2Q6IA 2YMLA 2QX8A 3MJEA 1R2QA 1RLIA 1I7SB 1RQGA 3QNUA 4WINA 1RZRA 1VBKA 1M6VB 2WA1A 2CYBA 1T9AA 1W9MA 4V0LA 4BQSA 1CHNA 3GFGA 1HDXA 1GNPA 4X71A 5KC8A 2XUPA 3R5TA 1SIWA 4KMRA 3VTFA 4BZPA 4C0JA 1I80A 2JD0A 5K9ZA 3KFXA 2XGMA 4MQ5A 5HE8A 3OUUA 3LCJA 3V1UA 2DOGA 1M0TA 2I6UA 3P9QA 5K3CA 4AKSA 4DHWA 5KHLB 4CPDA 5IMBA 2GN1A 3ELYA 1P9RA 1FMFA 1M5TA 1WUJS 2OB1A 2A0UA 1HZJA 5JSUA 5JYDA 1WDKA 4PW0A 4RMIA 2EWWA 2DUMA 5A6SA 2HWYA 2AC7A 3D6VA 4GLJA 1MC5A 2GAAA 3I05A 3F9CA 4WADA 4C76A 4CT5A 1J0EA 2YY7A 1PFVA 4RA9B 2J3JA 3UPUA 1YASA 5CR9A 1OAAA 1IAVA 5B1YA 3G0IA 1P7VA 4U8GA 4A2CA 2BZ1A 4BNDA 5C0OE 1VBMA 4X66B 3LLSA 2BRUC 3L6RA 4BCBA 2Y99A 2AN5A 4YLEA 4RC9A 2H1IA 2W6OA 3A9SA 3I9KA 3L05A 4ZC8A 4X61A 3INRA 1EZ1A 4J91A 3ZQ4A 2HL6A 3UAVA 5AHWA 4WZLA 1XKLA 4MA4A 5DN6D 1DO8A 4IIEA 3QIVA 3CH4B 2VL7A 1SU8A 2NSJA 4B8ZA 1RC1A 4V0MA 2AIRA 1A5AB 3QKSA 3ZOKA 4II2A 2EZ4A 3IVRA 5ALTA 1XL0A 2W70A 1TQ8A 2XQIA 4N5NA 3FCEA 4KH0A 4NNPA 3ZHOA 2WJGA 4RTKA 2OYNA 2D7JA 2VIIA 4MUFA 5A9SA 3JQEA 3DH0A 1Z12A 2V5UA 4NMHA 1ZK3A 2R6CA 4D3DA 1GUZA 2CRVA 1YI1A 1Y3HA 3DAYA 2OLKA 3RKRA 3ETGA 4ZZIA 1YFKA 3FNBA 3VR6A 2X6WA 3TZLA 2WJVA 4KH1A 3GRKA 2QTAA 4P3IA 3OPOA 2WTEA 4E5SA 1MW8X 2PZ8A 5A3QA 1RAEA 3KWJA 3NBMA 4L5JA 2GBIA 4LE1A 4X8LA 5EZQA 3OLZA 1NHWA 1GPUA 2H4YA 3G7SA 3NT2A 2JGNA 2O0LA 4DA7A 4G24A 4I1PA 4RK7A 2VCYA 1XSEA 3P9ZA 4S1PA 2C31A 3T1QA 4HAOA 5IRCD 4NCAA 3JQ9C 4GKBA 2BMFA 1JIIA 3QWFA 1WCXA 4FYPA 2IF0A 3LYUA 1RFGE 2ZZGA 1LC0A 4DFDA 4PCAA 1E1KA 1CR6A 1B00A 2RGDA 1XCBA 1RPJA 3RVMA 2D9RA 4WACA 2Q3FA 3FSGA 2C4NA 3KLPX 4W5HA 4XTCS 2IQIA 3P94A 2WPNA 2IH2A 1OU0A 2HMSA 4PYRA 1I7LA 4UHKA 1T3GA 2FPRA 1SKYB 2HGSA 5JCPA 1OV4A 2JDIA 1OASA 2OK8A 1AUPA 1Q7RA 1SVKA 1YIAA 4ZVSA 3UQZA 4MIYA 3WVNA 3PENA 3Q5DA 2PVPA 1VG0B 4JLSA 4KN5A 3BQJA 1M8FA 4LMAA 5BMOA 3FY4A 1EESA 4UE3S 5JV5A 2BR3A 2ROQA 1ZJYA 1E66A 4WBXC 4DWOA 2ISQA 1QAQA 2OY0A 3C4JA 3EXHB 4OHVA 3IILA 5ES4B 5L8VA 1E2MA 2VHWA 3HDJA 4UE6A 4MQBA 4QSHA 3RD5A 2BKLA 4EJ6A 2XUDA 4MWBA 4WXYB 4MI1A 2WD8A 1WE2A 5KTSA 3T1NA 3FYCA 4JLPA 5CLJA 5B1DA 1UAAA 2PLFA 1HDYA 3ZBTA 1UINA 3FLMA 5KTNA 4LG1A 2I29A 3ILYA 3UHPA 1SZJG 2RGGA 4EG5A 5AESA 1JFSA 2X8JA 1J8QA 1K7EB 1Q2XA 2F59A 3E8SA 5BUSA 5JH7A 1J5EB 3UH1A 4DW8A 4FZJA 1V1RB 1ZH4A 4F6LA 3E53A 3QEKA 2H4XA 4D9FA 2Z1MA 1H8ED 4P0TA 3LX6A 4XWAA 5C37A 3DOEA 2SBTA 4Q39A 4FCCA 2INGX 4PZUA 4RPJA 2FOLA 1IL0A 3AW9A 4YV2A 2AMYA 3PEFA 1H69A 4LOIA 5L3RA 5IJ0B 4GOLD 4D0NA 2WYHA 2CD7A 4FYMA 3UAZA 4B48A 2X0JA 5I8PA 4OIFA 4FD2A 1HDEA 1K8ZB 1DEKA 4DG8A 3H1PA 1R18A 1ENPA 2WZNA 2FA9A 4U7FA 5EHGA 2Q1WA 4DV2B 2JH9A 2DIEA 2ZI3A 4P31A 2AXNA 2WJWA 3LYAA 1FP6A 4WGGA 5IKPA 1YA6A 1G8KA 2IQ5A 1G5FA 2C1ZA 3M6WA 5G41A 2YFYA 4G37A 4D9KA 3R6DA 3VNRA 2O2HA 3P5SA 5BV1A 1C30B 1ZEJA 2G1UA 4LDPA 4G1UC 4Q1FA 5AW1A 2F3QA 4ER7A 1QV7A 2NPIA 2XITA 1FJXA 3GW8A 5ALDA 3BCDA 2CEAA 2WSSA 2X40A 2J5XA 3Q3GE 4AYTA 2YYAA 1E5XA 2V7BA 1UOOA 3O83A 4LSWA 2WPDA 3UMRA 3IE2A 2NYAA 5EYPB 1JG4A 3PKIA 1JXOA 4GRDA 5E7QA 1KEUA 4NMXB 4LFBB 3VSAA 1FFYA 3HKBA 4RD2A 1UADA 1NQUA 4S0ZA 2FDCA 1JDBB 3DL7A 3O0DA 1TW2A 1U1GA 2TMYA 4I8IA 5EFOA 5FPYA 3WMXA 1Y33E 1E1QD 3HJNA 1H4VB 1M1YA 2X15A 2DFPA 4W6QA 4EYEA 4KRFA 2VG8A 3KIPA 4YUWA 2O8BA 4KIUA 2VYVD 2ZQZA 1XX6A 2GI4A 3YASA 4DDWA 5D1HA 4ZRDA 1TC2A 3GEPA 2WZDA 3O8QB 4HUQB 3GJ6A 3Q39A 3BFVA 1DT3A 4QDJA 2H5EA 5LMNB 2IXEA 1CUUA 3I30X 5DNUA 1KZGB 1R88A 1PG2A 4H6WA 4ZOQI 1FRFS 4IXDA 1CUDA 3D6UA 3OFVA 3IULA 4NC9A 3RWBA 5BNZA 5ERXA 3MHTA 3IT1A 3QNMA 2P91A 3QKRA 3KU1A 4O3MA 4JNCA 1GTJ1 3G05A 5A9TA 5LNK6 1V71A 1ONPA 1GQRA 1VL2A 1XQ6A 2HXSA 3RTCA 4L8JA 4GQBA 2WNIA 3K6SA 1HNNA 4I14A 2EJBA 3F5QA 2AH5A 2BF7A 3H9CA 1D6NA 2FE1A 4RD3A 4FMDB 4MMYB 4X84A 2ZB8A 5EIHA 3KM0A 5LYJA 3LK7A 4N6OA 2H7VA 5B2ZA 2QZZA 2C00A 1M1XB 3OKXA 2PMFA 3TLCA 3UHFA 4CG1A 1UBHS 2FUNB 5M7EA 2F1IA 2P6OA 3BRWA 1N9GA 3K0BA 2ZE8A 4KGVA 2OV1A 1PFKA 1VMEA 4G67A 5CHEA 1KP2A 1E96A 2EW1A 1IRIA 2GQ0A 4H0NA 1KI9A 1L5KA 5CTAA 3EY4A 5DXAA 5JCZA 1SCUA 3RSFA 2HPVA 4MDFA 4D4HA 2QLMA 2VSFA 3TNYA 1ZGJA 3AMVA 1HTWA 2YNMD 5TQ0B 2YJ3A 1N5LA 3TOZA 3TFOA 2I91A 1W5EA 5KC9A 3OT1A 3ABSB 3L7JA 3PR3A 1JXMA 1P4MA 1TIPA 5ICSA 3U7QB 4JC0A 1E6MA 3EODA 4KI0A 3VHXB 5LMCA 3ASUA 2EAUA 2YN0A 2PZMA 1QGDA 2PBFA 1V35A 2AMLA 5IP5A 1FFEA 2F1MA 4PYOA 2G1JA 4DARA 1Z0FA 2GD0A 2P2GA 3TQIA 1TE2A 3SPXA 2ONKA 3TI9A 1CUEA 1K9SA 2JJQA 2JJYA 2OBLA 1OVMA 3EOBI 4PHFA 4Q18A 4A4DA 2QZ4A 2XYPA 1JE0A 3FVTA 4DEXA 3IPAA 4M9SA 1A2OA 4FNOA 4P7GA 4W63A 1GAXA 5AKHA 5EPEA 4L72A 1EFTA 2Q3DA 1A96A 2E3JA 3AEQA 3QUSA 1E3LA 3GLHA 3QY9A 2GK6A 1PJCA 2IZ0A 1ATIA 4O1IA 4RBNA 3ZZ0A 3QTTA 4HLQB 4KQXA 4Q3DA 4ER0A 5KREA 4XOIA 5J2TF 3VTKA 3DV9A 1KFEB 3GUHA 3OPNA 3OPYB 2A7QA 2VN8A 2WT9A 3H42B 3OIGA 4EQ6A 5A1TA 3C43A 2CKDA 4ZHQB 3NHKA 1NVVR 1U9CA 3AIOA 2AOVA 3C5CA 3MCVA 3T34A 3PNQA 721PA 3TQQA 1IG3A 1Y7LA 1VMKA 1Z07A 2CFRA 4P4SA 3THYA 1GL9B 4RHFA 2M9MA 2OG1A 3K6JA 2XXAA 2L0XA 1X19A 3SR0A 4CKBA 4B2YA 1LDBA 3LP5A 5CVCA 2P6MA 2QD1A 2EJCA 3BJZA 1SKYE 1VHLA 2FG5A 1ZOLA 2YJ5A 4JLNA 1NFQA 2FP4A 1O97D 1XEXB 2W4IA 4BQIA 4YAEA 1QOPB 2GEFA 3ZU4A 3RHFA 4EF5A 5LYJF 4TQ9A 1M3SA 4Z4SA 4ER6A 3ZDDA 2DPGA 4FE4A 3KL9A 1ORRA 2VNKA 1C9EA 4EP1A 3HXLA 1DZIA 4FHDA 4K6KA 3AT1A 1AY0A 3DAGA 2MIIA 2PO7A 4WW0A 2N3ZA 4TN1A 2OXEA 2YN4A 2WUDA 2OBTA 1HOXA 4RDHA 5FUQA 4NXNB 1GGJA 2C8LA 4I5IA 1DRKA 3DEZA 4E3ZA 4B17A 3LC0A 3V9PA 3LS2A 2VT3A 1EZ4A 3LQYA 4MCIA 5KYXB 1K5HA 5BUQA 3LIIA 2DHQA 5FR2A 4ARSA 5G1PA 3ZV6A 1AQNA 4TXHA 2B0JA 1IE3A 1M6HA 1K68A 2QJOA 2VUHB 3LLMA 3B1ZA 2CNDA 2Y71A 4MWOA 5HPYB 2PDAA 1I3MA 1WCIB 1U3GA 3PXGA 3I73A 2EQAA 3O84A 4GOMD 4JGBA 4JXJA 3SIXA 3V9AA 4UXJA 1T5LA 4DLLA 2JJ8A 3M8KA 5HIIA 4EIWA 3DMGA 4US1R 3OIYA 1ODKA 1RU3A 3C5VA 4G5QA 4Y98A 4G36A 2FEKA 1DINA 3A27A 3CRW1 4KPYA 3VKFA 4AMZA 4Q3NA 2W6IA 1QVFB 2HU8A 1JG6A 4L3WA 1M1YB 3U1VA 1V96A 3ZY3A 1Z35A 2CL7X 4JSTA 4EFKA 1BDHA 4CN9A 1OC4A 3ZYZA 2ZVPX 4DVGA 3WGLA 2XODA 4YYZA 3BSWA 1FS6A 1NVDA 1SA0A 2OHXA 3OEEA 2O9JA 1JG7A 3I01A 3NUZA 3R7DA 5C1BA 4F21A 3H97A 1G5HA 2WKRA 3P2YA 5CB8A 1L3BA 4MQEA 4TLBA 5BN1A 1V45E 3H1EA 3B5JA 4Y6PA 4GIBA 3SK0A 3PQEA 1UJBA 2ZRBA 1AUOA 1RI2A 3BQMB 4B75A 2CZGA 2FPUA 1KPGA 3TNDA 4LCJA 2Y1KA 1NYQA 3A3PA 4IL5A 3O2QB 4PG7A 3AY0A 4O0LA 3SSNA 1DXOA 3UJ8A 3JTMA 1G3QA 2NT3A 4OSPA 4EGCB 1F17A 5BXQC 1P2FA 3EGEA 4BNFA 2VEDA 3AIMA 4EG3A 5DLYA 1TA4A 5JAUA 3A1WA 4AURA 4DSOA 4HFNA 4HZIA 1BKYA 1JR3E 1NOIA 1U0NA 2XDQB 5BOVA 3TSYA 5BMVF 2FMTA 1E9EA 2J4FA 1L4EA 3FTPA 2VHVA 4MEAA 1PJTA 3K30A 1BCRB 4YBRA 3Q8LA 3N5KA 4KFCA 3PFIA 4DG5A 2B3TA 2REBA 4PLTA 4TTVA 2LD4A 1ORIA 4MV1A 1U7XA 4XOTA 1VA4A 1H66A 2WIAA 4YDSA 1UDXA 4Z0HO 1X7WA 3GMDA 4QDTA 3ZQJA 2P4SA 2BDEA 2YV4A 1OI4A 4AUEA 5KVVA 1TM2A 4M54A 2W7TA 3K5WA 2J9FB 1P2VA 2ZBQA 4FNAA 5DGDA 5DH9A 1U4OA 4WOBA 2EARA 2BT4A 3DXZA 4ZZ1A 3GD5A 1LLDA 5BSMA 2ZM6B 2VXBA 5LU9A 1F48A 5G0SA 3FFXA 1EG2A 1AB6A 1Q7TA 5C1OA 4CF4A 4EKIA 3FXAA 3VX3A 1HQDA 3CCCA 1U81A 1KERA 3GBPA 1JHAA 2GBPA 3P2MA 4BFYA 2JCYA 2PXXA 3QGMA 4DR2B 3DT9A 2VK2A 2PZEA 2ZSBA 3O94A 3D3EA 4DG9A 4DUZB 2JJ1D 2DWUA 3NT4A 2ZU6A 1ULUA 1O0SA 2XKAA 2CDNA 4QGSA 5F5XA 5EPOA 3AEUA 2Q7XA 3FNEA 3MQ4A 3RREA 3OPYI 2OXIA 3RLFA 1KFKB 1W5FA 4V2IA 4X05A 4X7BA 3V34A 4D3XA 3V8VA 1H6AA 2RMKA 1T43A 3CC7B 4XVRA 1NRWA 2BTQB 5T57A 1QVVA 1XMSA 2XNJA 1NY5A 2H4FA 1W36D 3SJPA 1ZC4A 2C99A 2I22A 4QQRA 3ZV4A 3VMMA 3GP3A 1V16B 3NHZA 3BB4A 5KTMA 4BFZA 3UWMA 1KVUA 5HX7A 3U3RA 1XTJA 1H5UA 1R64A 1XMPA 2JZCA 2PWPA 3F6PA 3H16A 3L8EA 3LNTA 3HB0A 3PICA 4DNOA 1A1VA 1IN1A 2TRSB 3X2FA 5B36A 1XRJA 3HUTA 4XM2A 5CGZA 3W2GA 3KKEA 2A1IA 5CXSA 3RK4A 3O73A 3KXDA 1NAHA 1Q1NA 2ATIA 3S99A 2R1UA 4K6HA 4JAVC 1BX3A 1H22A 2W6ID 2RB5A 5AW5A 1RYMA 3L79A 2PQ0A 2C77A 1XA0A 4GFDA 2BGWA 4DR3B 1I7DA 3UOAB 2OHOA 2F8TA 1SVUA 4KYIB 3OCXA 2I7VA 1T24A 3ULKA 1LPSA 4CCYB 1ZJWA 3A9CA 3Q9SA 1QYWA 3PBKA 2NADA 3QSGA 4OHMA 1PJAA 2ODBA 1MH1A 1TCUA 3I6BA 5CH5A 1NX9A 3TB6A 3N2EA 2EL7A 2NUPA 5ALFA 4H4DA 5EKUA 2B2NA 2ZYIA 1UBKS 4BV3A 4U2CA 5B57C 1XTPA 3AKCA 1P9OA 3G8YA 1FNNA 1KK0A 5KNDA 1YSCA 1T0HB 1Z6QA 5HHTA 1XDSA 2ADFA 4P08A 1Z39A 3NEAA 4PAMA 5AR1A 1NASA 3OC0A 3SIRA 5KJCA 4KR3A 4U5QA 4K0KB 1WDMA 3D1JA 3DBRA 1CQJB 3LUFA 4L15A 2GYYA 4FKBA 2OWEA 3AFOA 3OLVA 4MQFA 3R5JA 2E1PA 4KFSA 1W88B 3EXAA 4CUJA 1VL8A 2NZXA 2FH5B 2HRQA 4DMRA 3PUNA 2O52A 3FUCA 2TSYB 4JLWA 1R9MA 3Q9UA 3SGLA 3PNBA 3OTHA 3UT6A 2NU9A 2A1UB 5KSPA 5ALLA 4CCYA 1CLUA 3TRFA 4DLKA 1OR8A 3ZWCA 4MR8B 3R3SA 1WEHA 2FPGA 4OK5A 5T3YA 2GM9A 1A5ZA 3SNKA 1E1CB 3RIGA 4JQOA 1OT3A 1NW6A 3WXMA 1FVXA 4QYIA 2PGIA 1RZRD 4IIUA 1AF4A 4YJ3A 2WQ6A 1Q11A 3VDQA 5K45A 4PZCA 5INTA 4XR6A 2BHTA 2VBTA 2PL1A 4YO7A 1A95A 2Z58A 4WY2A 4D3FA 4Z0PA 2JLVA 3LUDA 2A0WA 3ID6C 4LXQA 4BN4A 1VSUA 5JZBA 4LCBA 2NXWA 4G0ZA 1Z6TA 2B98A 4PQYA 3B8HA 1LDYA 1ADCA 1W88A 2WT4A 2ZTMA 3ANTA 3R5XA 4XB2A 3THYB 3DFFA 2H5LA 4MI6A 3LCUA 5EJGA 3P9PA 1GGVA 5TMEA 3IGFA 3IEPA 1FNDA 4YRPA 1JAYA 4C3UA 1HF3A 1IMOA 1KMCA 3TI7A 1JFFA 5C3MA 3AYXB 3LUAA 2HWKA 4KDRA 4JITA 2AJ8A 4Q6BA 5KOJB 4DCVA 2X4LA 4CEIA 2ZJ1A 4WFKA 4F97A 1O9GA 2HTFA 4G4SP 2FSPA 2AV6A 3F97A 4M9XA 2O5CA 1LPPA 1YBHA 1KKLA 4QUAA 2WYVA 1UQTA 3ED1A 3UWSA 2JN9A 3FHLA 3OAAA 1VECA 1M75A 1OWNA 2NTJA 2UDPA 3KDSE 4E70A 2BW0A 2Q5IA 1D04A 1SK8A 2QYOA 2AG1A 2Z4RA 4G8BA 1A2BA 3B1YA 4EY3A 1F4LA 1HYBA 3OFKA 5IULC 4EUHA 2W22A 3UXHA 4DA4A 3M5PA 3WBFA 1W0KD 1EWRA 1NLFA 4DIUA 3COJA 5AVJA 4L16A 4U8HA 4LSMA 1EDEA 1U0LA 2PKQP 4NZNA 4NCHA 4A8JA 4DIKA 2Q50A 4D3SA 2AI2A 1JJ2B 2BKAA 2V0CA 1UBCA 2OCXA 2OAP1 4OP2A 5TQ0A 2PRIA 2PT9A 5AXCA 1M1YE 3U3DA 5JJIA 1R15A 1E92A 4N41A 2C2HA 3BX1A 3PGJA 4MR9A 4YJDA 4EW6A 4PC7A 13PKA 2IUFA 4H3VA 4HDKB 3ROPA 3ZU5A 4DNQA 2OXCA 1ZX1A 2NX2A 4M22A 1K9VF 1PUXA 3PNYA 4O4IA 5CEJA 3JQGB 2GPAA 3MCWA 4EDHA 1N3IA 2JI6A 5AVKA 5DHPA 2XW6A 2I1WA 3F6YA 1FFGA 1CY4A 3WQSB 2VBSA 3LFHA 4I9GA 4QFBA 3F6CA 1HE8B 5HUHA 2IYNA 4FDLA 2KYRA 3ZHRA 1P4RA 2DF8A 4UNNA 5DHAA 2C4WA 2O0MA 2W71A 2R7MA 2ABWA 2Z1DA 3IMKA 3QPDA 5CK5A 5U4QA 3TRDA 4DV5B 1N6IA 3SQXA 1K5PA 4PRYA 2O3QA 1BZYA 3E2PA 3AI3A 4XKWA 1NY6A 3FA2A 2I6GA 1ZM3A 3EEOA 3M6AA 5B6PA 3KYBA 1RC8A 1RJEA 4PVDA 1EQUA 3LH5A 1SJ9A 5EE1A 1SOUA 2J9YB 3D02A 4C0LA 3O7MA 2CBXA 4DCPA 3B38A 1Z08A 3FPLA 3H7IA 2GXSA 3FWHA 3PC7A 3W2EA 2VHEA 4MJLA 3VPCA 1YS2X 1I4OA 1DEOA 3EXFB 1R74A 1FYEA 1LI5A 1NQ5A 2X0IA 1MFPA 2R6JA 3L8ZA 3LPDA 3OTIA 5GMOA 5TPWA 4CM8B 3QKSB 2V65A 1BC5A 4UFNA 1EFKA 4CQLA 5CT6A 2R79A 5HOEA 4KP7A 1U99A 3PXDA 4GX2A 4B7XA 5B2EA 3I9JA 1KVRA 1LRJA 2WUVA 2AJBA 1QG4A 3NIGB 3QPBA 4ZVUA 1A4IA 4HDAA 4F9TA 3H75A 2O7SA 3WK7A 2CNLA 2GEBA 1Y8QA 6REQA 2JHAA 2NO6A 3UUEA 2R8YA 4M0LA 2ZSAA 1VHTA 3AY6A 2X0DA 2X2PA 3R75A 2RB4A 3Q15C 4AN0A 4L0DA 4QRIA 1BDMA 5BORA 3RFVA 3KETA 1S6YA 2X0KA 2ID7A 1E69A 5FLEX 2OKCA 4IUBS 5GOZA 3CJQA 1J20A 1VKHA 4X6YA 5CCDA 4EECA 1RPTA 2OGZA 4U2DA 5DNAA 1TO1E 4BUZA 5BNTA 4BBZA 4ZI2A 3DLAA 2A59A 1JIJA 1NXXA 4LCEA 2QPLA 3V1LA 1JLLA 1KS2A 1TZ2A 1W6RA 3HJUA 3KKLA 5EKXA 1QMGA 4NDAA 4TVKA 1E3ZA 4DILA 3B2EA 3B1XA 4OHYA 5J3OA 2FEMA 1ISPA 1YACA 2PVSA 4G0QA 1T3ZA 3JD0A 4H35A 3FYUA 3QWIA 3S2YA 3RW9A 3IIIA 4KBFA 1D03A 2AN1A 3L0ZA 1YI8A 2BMWA 1IK6A 1JDJA 1DJPA 1SB9A 2W00A 3CGGA 3PR2B 5CLLA 5GWXA 3R6JA 4JIGA 4EGJA 5AKJA 4OGLA 4HTFA 4BNZA 3F3MA 5JJKA 3QF4B 4ZALA 4HMQA 1MG0A 2BFAA 2J9GA 3BB3A 1WABA 3GJXC 2FHSA 1M2WA 3FOCA 4JUFA 1U8EA 3KL4A 1G3MA 4O5OA 3AVTA 1DRWA 2KBFA 3GIDA 4ZYYA 4FSXA 4Y6QA 5FPKA 1NQTA 1ECFA 1GQSA 2XNSA 3K0CC 4P33A 4CV3A 4Q01A 3V7FA 1CJTC 5ABPA 5EE5B 1A9PA 4UZUA 1WQ1R 5TPWB 1I2BA 1U1IA 5HXBA 4QXQA 3R77A 1K75A 4WERA 4AK9A 2HWUA 5IZ4A 1EKXA 1T8RA 3KRTA 3OSZA 4YVFA 2CVZA 3VAYA 3FWYA 3JS5A 1R1DA 4M1WA 4A8JC 2ZTNA 5BPHA 2YHAA 5KVCA 4LJSA 3M1YA 3WDMA 3W2HA 1MPTA 3KQYA 2YV5A 1LSJA 1GTVA 3PNLA 2V3VA 2ORVA 4KLRA 4QU5A 4Y8VA 3USES 1NJ5A 3WI7A 2CF4A 1J2JA 5FL3A 1BMFA 3S2EA 2P41A 3K4PA 2XT9A 3QW2A 3U6KA 1G98A 4BKRA 1ZIOA 2Q8QA 4OGGA 5KYKA 4L4SA 1JHVA 4NFLA 4II7A 1O6GA 2X8LA 2MYUA 3UAYA 1CD5A 1J2YA 2GWRA 3AR4A 1N6OA 1JEJA 3Q0IA 2PKCA 4R1LA 4EYSA 5LXTA 3UICA 2Z2KA 2PMEA 3RG2A 5TARA 1XVLA 2YL2A 1JU3A 4EITA 3PI6A 1BFUA 3IAUA 3JQGA 4OQFA 3FHCB 2NAFA 2XLBA 5I4CA 5IU6A 1MQ8B 2Q21A 1RQPA 3B3JA 4RDKA 3RJZA 5K0SA 1BVRA 2C8KA 2DTXA 2PXCA 5IHPA 2I71A 3IPCA 2GN4A 5JATA