2AHOA

Structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
414
structure length
401
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structural Switch of the gamma Subunit in an Archaeal aIF2alphagamma Heterodimer
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 82
structure length 401
sequence length 414
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ahoA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ahoA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ahoA01
3BFXA 5KYKA 4MA4A 1KZGB 2J9RA 4N3GA 4KJZA 3UIEA 4CEIB 1U0JA 5DN6A 3UKDA 2VF8A 2OXRA 2X2EA 3A4NA 4LV6A 3RABA 3FE2A 4LHXA 3OESA 4EKDA 2WSSD 4GRAA 2WWHA 3FVQA 2HJGA 1T4GA 3FFBA 3PCRB 1QX4A 3T5DA 4DLRA 4QBIA 4HEJA 4LJ7A 1YI2B 4JT4A 3VHXA 2HJVA 1GKUB 8OHMA 1S1CA 3GJ7A 3N70A 1XJ0A 2V4ZA 2R6HA 2CEAA 4DT1B 1N25A 1UDXA 3CWZA 3PEVA 1MO3A 5AJYA 1EP3B 4PANA 1JPJA 3QF7A 5HZKA 1ZNXA 1PLLA 4Q1DA 1A1VA 3DL0A 1OH8A 3AGPA 2B7CA 3J81k 4GP7A 5DO9A 2JCSA 4EFMA 1VIYA 3F5FA 3RVBA 1SKYE 3RWOA 1G9XA 4OI4A 4Q4HA 2C8VA 1XPOA 1QG2A 1V5WA 2DWOA 2J0UB 2WICA 4M0LA 4Q00A 4MRNA 1A7JA 1JAHA 4MQBA 4NCJA 1ZNZA 2ZSEA 3CR8A 4TSFD 1XEXA 4BFZA 3QKUA 4IOKA 1KDOA 1NY5A 1TEXA 1Z22A 2RGDA 3P20A 4R2IA 4TYNA 4AKHA 4DEYA 3U4QB 1ZIOA 2BBOA 2ZSDA 1M7BA 2NZ8A 3CO5A 3QBVA 2NQ2C 3WMFA 2JJ1A 1CR4A 1P2VA 3CCVB 1CEEA 4Q9JA 1H42A 1ZM4A 2BGJA 2RGNC 2WTUA 4A8JB 4AC9A 1DO0A 1G8FA 1KO1A 2R9VA 3LV8A 1QG4A 1NMXA 2CK3D 2EFHB 4B76A 2EIXA 1UBGA 1VYVA 2IS6A 2BM0A 4IKEA 2D2EA 2VP9A 3KKPA 3DO6A 1YRAA 3IGFA 4RCZA 3OEED 2H57A 3O8DA 2J5XA 4JLKA 3KJIA 4E5UA 1E0AA 1BH2A 3ZJYA 1MO4A 5H70A 3CM0A 2XITA 4CIDA 1NBMD 2OBNA 4YLGA 4H1VA 1J99A 4Y0AA 2FEOA 1LF0A 2CBZA 3X1ZA 4YMTA 1ZYUA 1CLUA 4XWAA 2H18A 1M34E 2CJWA 4OQFA 4C3ZA 1E0SA 1FNCA 4N3NA 2ZREA 2I4IA 3CH5A 4Q48A 5KNDA 1KNXA 2X1VA 4B32A 1NY6A 2A5YB 1CXZA 5HE9A 4MRVA 1RIFA 1GRQA 1W47A 3KQNA 2XZOA 4D4KA 2CNDA 4KVAA 1FX0B 2ZQ5A 2XZPA 3LVQE 1G41A 2QPOA 1XRJA 1CNEA 4LPSA 5CK4A 4PQYA 3TBKA 1E64A 1KOFA 4A4DA 4F91B 1RRGA 1R8SA 2BMWA 5JJLA 3LNCA 2VSOA 3ONWA 2C78A 1XDBA 3BS4A 1P9NA 4Q4AB 4URYR 721PA 2GJSA 2R6AA 1S8FA 2ZS8A 2F9LA 1GAQA 5JHHB 3FOZA 5FPHA 2HF8A 2XNDA 1P9RA 3C5HA 1XEFA 4FI3C 4KCGA 5LB2A 2PZEA 4ZI2A 2AX4A 4A1FA 2HLDA 121PA 1QGYA 2C9OA 2VP5A 2BF4A 3AF4A 1XMVA 3O8RA 2VP6A 2ZYVX 5J40A 4UAJA 5C2JB 1KO5A 2W2VA 3MCAA 3NXSA 1ZBDA 4RKEA 4Q1CA 3ES9A 1HY3A 1KSJA 3M4YA 4YXWD 1EWRA 2VP0A 2ZU0C 2I1VB 1AQYA 4E03A 1YQTA 1T5IA 4QC2A 4M9SA 5A0FA 2QP3A 2H5EA 3H86A 2CCKA 3QXJA 5KNCA 3TAUA 5IDVA 1JJ2B 4C2TA 2XXAA 1LTQA 4Q66C 4GFDA 4HAWA 3VAAA 4RVCA 2VO1A 1KGDA 2G0NA 4OKSA 1N5JA 2ZSAA 1Q3HA 3MD0A 2PIAA 4JLBA 5HCIA 2A5FA 1OIXA 1P2UA 3V4FA 3B1YA 5FI0B 4CEHA 2IS2A 2GZHA 1D8TA 4JBWA 3QG1A 4Q03A 4PZLA 4ASUD 4JLJA 4C0LA 3U61B 4P3YA 1RFLA 2VYFA 4OHYA 4ZDWA 1E2QA 5L3QB 4G5OA 4RFVA 2J87A 1T3HA 4TMKA 1I4LD 1UJ2A 3NTUA 4UNPA 2ZI7A 3I8SA 5C46F 5FTLA 2VRWA 3VKHA 4N1AA 2IC5A 3SNHA 1S2MA 3CF0A 1XCMA 2DFLA 4JVLA 1J8MF 1NSTA 4PPFA 5H1YA 3Q9LA 4KYIB 4OHXA 2XSZD 4A6PA 4BFTA 2JLVA 5HCNA 3D8BA 3PJRA 4AKIA 1YZLA 5EE9A 3KJHA 2FJUA 2X3UA 3IEVA 3AVYA 4KFSA 1EX7A 1FNBA 1DTSA 4BFYA 1W4BA 2QMHA 4B44A 4TQAA 3TLXA 3I3SR 3T1VA 1OXUA 4M9XA 2OK7A 1GL6A 1LNZA 2R6FA 3B85A 3TIFA 3V00A 2G6BA 4D82A 3OZVA 2IYQA 4M1SA 4YMVA 4NCHA 1KHTA 1K8AD 4L9WA 5H8WA 1YVDA 2C77A 3IIKA 1SULA 1X1SA 2QENA 4GSYA 4ZCLA 4I4LA 1JNYA 2RGNA 3VX3A 4FMCF 3TNFA 3GJ5A 1AK2A 5FBQB 3GLHE 2ZI4A 4YDSA 2QE7D 3ZIAA 3CD6B 1K8RA 1U0HC 1SHKA 2IWRA 4G1UC 4LV8B 4FCTA 1OF1A 1E2DA 3CZPA 4X8HA 2HUPA 4LI0A 1OV4A 2VNJA 1HE8B 1RZ3A 1GUAA 3DVLA 3GJ0A 4IHQA 2OTLB 1M90D 3HR7A 5FR1A 3RS3A 4B75A 5C1BA 1R6BX 3BK7A 4AKGA 4HYYA 2HT1A 5HXBA 3TR0A 1WBBA 3HDTA 2D06A 2VQSA 3K0FA 3LQQA 4G01B 4AYTA 1F60A 3U44B 1EFRA 2AKAB 3RS0A 1U99A 3GJ6A 2CLDX 3B78A 2ZU6A 3E5HA 1QUFA 2HDNB 2ORWA 1RJ9A 2VHUA 1YZTA 1Z0DA 1E9CA 3V4RA 1ZD1A 1D6JA 3NH6A 2IYSA 4V0NA 4LBWA 3U3RA 4HLUC 4LC0A 4OBEA 1HQCA 2ZVQX 3W2FA 2J41A 1E63A 1XMIA 2JJ2A 3GMTA 2DYKA 5FUYA 3TW8B 1N5IA 1IXSB 3V9PA 3LO8A 1E1RA 3QF4B 4Z54A 3K0EA 3C5CA 4BLQA 4B48A 4AG5A 1I2MA 2AK2A 1W46A 3SBDA 3AKEA 3ECCA 1R0YA 1TL7C 3OIUA 2FGJA 4JLMA 4QHTA 1YZQA 2Q3HA 1P4SA 4Z51A 2EQBA 3FMIA 4LJAA 4Q7JB 4BRWA 4CYMA 2A9KA 1E0JA 1SQ5A 1OFUX 2GJKA 4V0OA 3FPAA 2EVWX 3L0SA 1U8ZA 1Y3AA 2P67A 3PFIA 1E0KA 1SM4A 1QVFB 4D6PA 1FTNA 1NLFA 1IBRA 1QUEA 2FGKA 4PC3A 2V6IA 3B13B 4HLDA 4B33A 5IHPA 5KSPA 3T15A 3I8XA 1E9RA 2CVHA 3Q85A 4S35A 3AUXA 5BYKA 1KO8A 3A1VA 4MGYR 1SVKA 3CH4B 3UG6A 2IXFA 3TQCA 3IO3A 2OILA 4IEEA 1B2RA 5P21A 1M7GA 3UWOA 1G8YA 4ZCIA 2AK3A 3AM1A 1G19A 3KQHA 2OEPA 3BAFA 2XJ9A 1Z6YA 2G1JA 4W7SA 4A9AA 2ZTSA 1BX0A 2GXSA 1OB2A 3KFXA 3AP2A 1HE1C 4DLXA 1LFDB 4DBLC 3KKNA 3GLGE 1FNMA 3H84A 2QMEA 2WWWA 3AUYA 2CNWD 4ARZB 3QXHA 5L8VA 1G3IA 3A8TA 2CDNA 3C7KA 4DIEA 1AS3A 5FA6A 1IONA 2V6JA 4B6FA 2G77B 1AS0A 1G8GA 1G8HA 5AUOB 5AK0A 5LD2C 2A5JA 3RWMB 2CCJA 2ERXA 4MDEA 4U5XA 1P73A 2F1RA 4NONA 2G9NA 2PEYA 4BFWA 4JLAA 1R0ZA 3RRYA 5IK2A 2O8EB 1W0JA 2X2FA 1L4UA 3NG1A 4DIDA 2G83A 1UFQA 2RB4A 1K5DA 4KSBA 2J0QA 2FPKA 2VHTA 3TUJC 3O8BA 4UQOA 1KDTA 3WXMA 1XEWY 3QUSA 2HCBA 3LW8A 3LVRE 1OE0A 5FPSA 2ZJ8A 3PENA 3HYRA 2VEDA 4C30A 5JCPA 2GCOA 3U7HB 1KSGA 1VQ9B 2OBLA 1Q44A 1XMSA 4DLUA 2WV9A 5EJEA 1RKBA 1ZUIA 4FXPA 1IXZA 3LH5A 1G5RA 3R9IA 3CCEB 4TMTA 1XMJA 1HT2E 2H16A 1YR9A 4QBHA 4CEJA 1E2EA 2O52A 1BKDR 5FTNA 1FTSA 4RFSB 6Q21A 1W44A 5C18A 2RAPA 3RSLA 5JRZA 1OH7A 2PX0A 2FDCA 2OXCA 1JBKA 1K6MA 3EZ2A 3U3MA 1CNFA 5HTKA 4P4UA 3TUZC 3EA5A 3B1ZA 4IVQA 1NN1A 4G0NA 1ELOA 5FFMA 3HP1A 3T06B 3VX4A 1NVVR 4LK2A 1CJTC 3GFPA 2JASA 3ADKA 1WA5A 3U3JA 2JLXA 4B47A 2ZSFA 1YR7A 4Q1BA 5CJ2A 3QKRB 1NIJA 4DLYA 2O8FA 2KSQA 4C0JA 4M9QA 1Z2AA 2GBLA 2CXXA 2GF9A 4HAZA 4NU0A 1I7PA 4A15A 3FGNA 2DERA 4LBYA 2PT5A 2QTZA 1GP2A 4WVFA 1OT3A 5AJWA 3T61A 2QA4B 1ZD9A 3RNLA 2ZI5A 2EU8A 4Q9HA 4Q01A 3K0AA 5G3YA 2GEVA 2EFDB 3LWNA 4DCVA 2CHQA 1VQNB 2EWWA 4MKIA 3MWLA 4OHWA 4Q02A 2R65A 4FD2A 3VO2A 1YJWB 1COWA 3I72A 5E7JA 1D5CA 4PSVA 3Q3JB 4IW3B 1UBEA 3N2IA 3M0EA 2WPDA 4A0GA 4RZUA 2AFHE 4A82A 3K09C 1PUJA 1G7CA 5JSZA 1DG1G 2V55B 2J7KA 4OK5A 3H0KA 2XTMA 1E2LA 3PITA 3K9NA 5DI9A 1GVHA 3I55B 3GLFB 2OCPA 3IHLA 3U5ZB 2OK8A 1F48A 1IJFA 2BOVA 1S3GA 4PQRA 2C98A 2TMKA 4DDTA 2IYUA 4R98A 1JXMA 2WJHA 1X8KA 1WB9A 1LVGA 3OF5A 1ZAKA 2V8OA 1GAWA 2FZLA 3SS8A 3R7WB 3ZQ6A 4P0TA 5FBWB 5HKKD 1CU1A 4K81B 3NC1C 3ICEA 2PX3A 1LV7A 5B57C 1AM4D 1JR3A 4TLEA 3CC2B 1Q81D 4JLVA 2QBYA 1G4UR 1FL9A 1OB5A 1H8ED 1E2MA 4UNSA 5GJWC 1TU4A 4XD7D 4ZIRB 1XTIA 5FOUA 4KXFB 2QQEA 3KTAB 2CCGA 4GOJA 3NHBA 4KSCA 3QXCA 3TUIC 1QH0A 1R8QA 4HDCA 4CT4B 1JAIA 421PA 2O8DB 1XTRA 1EXMA 2PEZA 2BMJA 3OFNA 1OFTA 5J47A 1E2HA 2JGNA 1CIPA 4MUBA 1E2KA 4TL7A 4TT3D 4F93B 3CPWB 4A92A 4OJKA 3EARA 4B2LA 2Q9CA 1ZM2A 2CMKA 4AD8A 4RSGA 5JWRA 5DYIA 1FDRA 1GFIA 3U2QA 1US8A 2MMGA 3VFDA 4PSKA 1G18A 1SVOA 2IUSA 1W2BB 3GJXC 1U8AA 2BPOA 4K46A 1IY2A 4MKGA 5KNBA 4DLZA 3VR6A 3ZD6A 2MSEB 4GZMA 4QFMA 1SHZA 3A1WA 1ZVQA 1Z5ZA 1CR0A 2FZ4A 3K0CA 2RGAA 1OPXA 1W5TA 5G40A 3K70D 2J7PA 4YAUA 3NBXX 2D7CA 2VNKA 2CLCX 2IL1A 1N6PA 3BE4A 3QXSA 4ERNA 2F55A 1TQ2A 5IF9A 4NDZA 3I56B 2JIZD 1S96A 2NTYC 3I4LA 1NLYA 1MR3F 1XE1A 4RY2A 3OZUA 4DSOA 1GKIA 2X8AA 5CITA 2ZE5A 3A6PC 3K70B 4P4SB 1Z6XA 3TSZA 2H92A 3RLFA 1Q1BA 2IF2A 4V0KA 2F9MA 1TMKA 3ZZ0A 1TF2A 1KDPA 3K9GA 4CEIA 1VMAA 3A4LA 4XH9B 3CCLB 1QHXA 3N2EA 5CLLA 1YZGA 3U3KA 1ZP6A 1KI8A 4C4PA 1M6NA 3AKYA 3OJXA 2OLJA 3GFTA 5DGXA 4NCNA 3MUFA 4BGDA 3CRZA 5TV2A 1L4YA 3QKSB 4DQLA 4NE2A 4C9BA 5C4GB 5CYPA 2YZ2A 2QY9A 1GRRA 1D2MA 4XWOA 1HQYE 1KYIA 2QTHA 4UXIA 4EPVA 1CR2A 2AL7A 4URXR 1QZXA 1S3SA 4EPTA 2ZUCA 1DG3A 4DT1A 1Y63A 4GDFA 4MYHA 1TADA 4PAMA 3ZLJA 2C2HA 2WSSA 2QM7A 2WWGA 2JA1A 5JCZA 4PSAA 2ZRMA 2IUTA 1W34A 1VCOA 3MGCA 5JMTA 1JEDA 3Q7PA 1MKYA 3PG5A 3WHKA 1EG7A 3PEUA 2J0UA 3PR1A 3TE6A 2OFWA 2WWFA 4F7WA 2AR7A 3OE7D 4QNMA 3VMFA 2B8TA 1EP1B 2ZR9A 1BIFA 1BYIA 3U4QA 2IYRA 1N2CE 4B71A 2RMKA 3RDPA 2ZJ2A 1QBKC 3Q72A 2BJVA 1J70A 2GZDA 3H1TA 1T8TA 4A8JA 2QRZA 3G0HA 2ZANA 2B8WA 4Q4JB 5JHGB 1P6XA 3QENA 3WRXC 4KODA 1DE0A 2FOLA 3FHCB 3TVDA 3NWJA 3Q5EA 2QTVB 1UEIA 3A1UA 2BBSA 1E79D 2DFKB 2OM2A 5JJKA 5CJPA 1NN0A 1U0LA 2C99A 2FFAA 2ZRIA 5AR1A 1UPTA 2QGZA 2O0KA 4GOKA 4IOMA 3EWSA 3OEEA 1XNJA 2IYWA 1VQ8B 1CQXA 4TLBA 2P6NA 4CZ2A 5BXQC 1CS4C 1W4CA 1GZSA 1P9WA 2G0TA 4WOPA 3RS7A 3TMKA 4W5JA 1KKLA 2JLQA 4F4CA 1VQKB 1R0WA 4HAUA 1Q1ZA 1FX0A 5E7IA 1E9SA 1NVUQ 1QDEA 1T0JB 1LF5A 1J2JA 3A37A 3AQ4A 3THOA 4D25A 4EQ6B 3BH0A 5GVSA 1G7SA 2OBMA 4Q1AA 1VHLA 3PVSA 4DVGA 4Q4AA 3KX2A 5SZIA 3LO5A 5L3RA 3ZGXA 1RYFA 5FUVA 2BHRA 3VTKA 4JLPA 2ZR0A 2H7VA 1IJEA 4I1OA 4FMBB 3X1DA 2XNCA 3PUXA 4IFEA 4C0KA 1JXOA 1JALA 3G4SB 2BWJA 1NN5A 4C0BA 1BJKA 1F5NA 1Q20A 3NDBB 5GV7A 3FHOA 3NBFA 2NO6A 4OQXA 5EXTA 1FUKA 3A36A 3EIEA 1W36D 4WBSA 4OHZA 4NKRA 1YIJB 2W58A 1ZD8A 3WRYC 3BGWA 2YOGA 4NCIA 1SVLA 1VQOB 1OYWA 2JLUA 2ODWA 2A3RA 1EFUA 5CYOA 3SI7A 1NL3A 3CF2A 5DI3B 3ND8A 4EDHA 4US2R 4JSYA 2NZJA 3TQFA 2MMCA 1W36B 4GP6A 1AZTA 4WW0A 4ZCMA 4MGIR 2QA5A 3SEAA 2JLYA 2NMVA 2OV2A 1JJVA 4Q9IA 1ZMXA 2R6GA 3W90A 3X2SA 4ZDKA 1ZNWA 4PFSA 3UG7A 2HEIA 5B2ZA 3T12A 1YE8A 3WP1B 1JPNA 4UXJA 2JDID 1LB1B 4B6EA 3CW2A 5D3MB 4H9GA 3SQWA 3OAAD 1OW3B 3IEUA 4U7DA 3W3ZB 2UZ3A 1KI6B 5FOWA 2I1QA 4ASUA 2QGNA 4JKIA 1N8RD 3T34A 1Z47A 1DOAA 2GK6A 3B7GA 4TLDA 4A6XA 3BXZA 2F1JA 4AWXA 3U7GA 1FP7A 2WZQA 4XSHA 2PLFA 3OIWA 4TMWA 1DAIA 1XWIA 2C96A 1DAGA 3JQRA 1S9HA 4PGOA 1QF9A 2H8KA 2BEKA 3HU3A 2O8CB 1CBUA 1F2UA 1DELA 1QVAA 4KYUA 1Q7YD 4LBVA 1U9IA 1N6IA 5BYJA 1P7CA 2XSZA 2OFXA 1ZC3A 1KI1A 1PZNA 4YMSA 4EJSC 5DN6D 1T9HA 2OAP1 3IPXA 3CCQB 3ZH9B 5F3WB 2QROA 1NVVQ 4NTZA 2CHGA 4PO9A 3QE2A 5CIWA 3G71B 1YJNB 3LLMA 4F4IA 4D4JA 5KOYA 2EFEB 2ZRHA 1GSIA 2ZRGA 2E87A 3B1WA 5KPDA 2OCAA 2QTLA 1AKYA 1MV5A 5SZHB 2ZIAA 5EZ5A 2YYZA 2FN4A 2BDTA 3JQPA 4M1MA 5FOVA 2OTJB 2IK8A 1A5TA 3SYKA 2XZLA 3VKGA 2B92A 1KJZA 4NHOA 3BRWD 4BEBA 2FNAA 1R5NA 1OKKD 4OI2A 1GO2A 1MT0A 1E99A 1D9ZA 3FWYA 1CRQA 4II7A 4RKFA 4MGZR 2QE7A 2RGXA 3PUWA 3I73A 3PUVA 1VYUA 4GMDA 4CT5A 4QJ3A 3WP0A 5JI2E 1DAEA 4RZXA 3MHPA 3U44A 3PEYA 1VG9B 2F1IA 3IHWA 5KU1A 3ICQB 2KB0A 5DISB 3IIMA 2XAUA 3BERA 4GL2A 2YV5A 1NKTA 1Z0JA 3GFOA 4IRUB 2G1KA 5JEDA 5FL7A 4Z1MA 1G7TA 5CK5A 4F4JA 4A36A 2IYVA 4P31A 2WVJA 2GVZC 1XB2A 3MJRA 4RD3A 2PMDA 1ZUNB 1E4YA 4A0FA 2VHQA 4FK8A 4TTPA 1BX1A 1QG0A 2IXEA 4OI1A 2LCFA 2IXGA 2Q0HA 4ITRC 2J46A 1NLZA 2RC6A 3SHFA 1QHIA 3EPLA 3N5CA 3EC1A 4AURA 4C0QC 2Z6VA 2AN9A 2HYIC 1HH4A 3IILA 2YVUA 4BZXA 1L2TA 1WMSA 1AQUA 3THWB 3LLUA 1ONBA 4Q7MB 4WAUA 3RRZA 1JB9A 4DB4A 4W5HA 4JL8A 4BLSA 3O47A 2IS4A 1GG2A 2Q3MA 3AF0A 1YRBA 4BZPA 4NH0A 5TXGA 2JEOA 1JR3E 2Q3FA 1E2NA 3FYHA 5IRCD 5EQTA 3WMGA 4Z8YA 3KQLA 5CB6A 3QSYA 2BIFA 4DEXA 3IIJA 3QBTA 4POAA 4DLWA 5KTYA 1T6NA 2F3TA 1M8PA 3CWQA 4BE7B 3ZZUA 1YJ5A 3CRMA 4XOIA 2WSMA 2D7DA 2BMEA 4PC2A 3RC3A 1XD9A 2ZUBA 3OIYA 2DWPA 1YZUA 3JVVA 3SE0A 3GP8A 5F9FA 1DAMA 2REBA 4DZZA 4GMXA 4GI7A 4XTRA 2ATXA 1R0XA 4QRHA 1SVWA 4MRPA 1IY1A 1E1QD 1TEVA 2V7QD 2QMOA 1Q86D 5JBQA 2ZS9A 3CRRA 4LYAA 1G4AE 2WJGA 4TYQA 2VNHA 4DLTA 3E20A 3VU9B 4EH1A 2HXYA 3K0SA 1SXJD 2UKDA 5SZJA 1XXHB 3SJBA 4MKHA 4ARZA 4LWZA 2HLDD 2HYDA 2Z4SA 3A1SA 1FZQA 2YC4C 4O3MA 1M2OB 3AP1A 3AKDA 1ETUA 1L7VC 3TRFA 2YOHA 4AKEA 2B7BA 2WAYA 5L3SB 3THXA 3QNUA 2QSYA 3OW2B 4FWIB 4RZ3A 4C7OB 3AF2A 3DMNA 3EXAA 2CE7A 4ZDIA 3B9QA 2O0HA 3CPHA 1XD2B 1SXJB 2UVQA 1DADA 2WMOB 4ZO4A 4AF6A 2X77A 2B21A 3RS2A 4OI0A 5UKDA 4TTRA 4J0QA 2PLRA 4HATA 3L0OA 4EFNA 3G82C 4OQNA 4FMDF 1XU4A 3RRNA 4AG6A 4X8MA 4RD2A 1OXTA 1VIAA 4CDGA 4DC9A 4IEIA 2BN4A 3KUDA 4YC7A 4PPNA 4CW7A 1P5ZB 4GNKA 4XSGA 2IA5A 4Y9UA 2DWQA 2H1LA 1E2PA 1JI0A 2ZR7A 3DDCA 3CCRB 2QRNA 5CB8A 3UATA 1JJ7A 2HMAA 1UBFA 2GKSA 3QXXA 4TQUS 3VO1A 3BH6A 3DM5A 1Z28A 5CDFA 3SYNA 4UKDA 1YKSA 4JBXA 2BMFA 4XVRA 3K70C 3KDSE 1QFJA 1CTQA 1VKJA 4PTLA 1Z0FA 1TNDA 3EZ9A 5HE8A 3QY0A 4PZZA 3SJAA 4B34A 1FW6A 2O8BA 5EZ6B 2ONJA 4EUNA 3GPLA 3BC1A 4C0AC 2P5TB 2RC5A 3L8YA 4YAOA 5FUXA 3BWDD 3CMAB 5BN4A 3B82A 4MKFA 1EFTA 2W00A 3KB2A 5GV8A 4PHHA 4XJXA 4K1XA 2QTFA 4R71A 4L15A 5H5JA 2WJYA 4BFVA 821PA 2QUZA 2IEYA 1M7HA 1OHHD 2ATVA 3RYTC 1Z0KA 3QKRA 2GVDC 4DWJA 2WHXA 1BS1A 3OHMA 3DZDA 1UDWA 1KMHB 1AS2A 2EWVA 4DUGA 5JRJA 1Q1EA 1RRPA 2RHDA 1CJKC 2XTZA 3FDIA 3NH9A 4QL3A 3PEWA 1LW7A 1T3LA 3FKQA 5DHAA 2VZLA 2FFQA 1GL9B 5DE3A 2J1LA 3KJGA 5HR5A 2O8EA 2J0SA 2WWXA 1IHUA 1GNQA 3ZIAD 2VL7A 3KFVA 5FBLB 2KJQA 4Y0VA 1OIVA 3RANA 3PV0A 4BLRA 3B1XA 3WNDA 3C8UA 1GR1A 4L4UA 1KNQA 3GCGA 3KXKA 1G8PA 4JLDA 1OGIA 2BV3A 2C95A 3NDPA 4R2HA 5EE5B 2ZXUA 5H59A 2KI5A 3GLIB 2JATA 4WA7A 4DDUA 4EPYA 2ZRBA 3GLFA 5AUQA 5JECA 2L0XA 3OJWA 3D31A 1FFHA 1W0KD 1OJLA 4JYBA 1CKEA 4NBSA 4TL9A 4IDQA 1C1YA 2AWOA 3K53A 2RGEA 5KDLA 2ECKA 5CIQA 4F92B 4AIIA 2C5LA 1MABB 3R7WA 3TKLA 1CF4A 2IYXA 3UK6A 3IO5A 4FWTA 1Z07A 1TF5A 2WAXA 4M1WA 4EJSB 4L9SA 2VH5R 2W6JD 2H17A 5KDDA 1KAGA 4HZIA 3NKVA 1II0A 1P2SA 4DXAA 1UF9A 1ZUHA 4ZIRA 4IDOA 1A82A 4FMCB 2W6ID 1KY3A 3KKOA 1E1RD 2XOKD 4LHVA 4UJ3A 2YWHA 2QNRA 3B6EA 2QI9C 3KTAA 2WJVA 1JQLB 4HDQB 3CC4B 3L82B 1PV4A 1QHHB 1RJ9B 1NDHA 521PA 3EASA 4OJQA 1JB1A 2O8DA 1IN4A 2QQ0A 4YQFA 2IBMA 3OZWA 1H8EA 2BCJQ 2WBLC 4B3FX 4QJ4A 4XD7A 1NN3A 2ODNA 4TMXA 1FNNA 4HAXA 4JVMA 4HB0A 2QL6A 2X19A 4WZ6A 1W1WA 1TX4B 2KWIA 3K1JA 2Y8EA 4Q18A 3TK1A 2R62A 4FW9A 2OFOA 2WM9B 1GITA 3VNVA 2QT0A 3BB1A 3BBPA 3CCSB 3EZFA 1XFAA 3IBYA 4IXMA 4LY6A 4US0R 3UWKA 3VR2A 4A2QA 5B30A 4TT3A 2IEZA 4JLOA 3V76A 3B8HA 2AXNA 2RHMA 4KITB 4QGGA 4OL0A 2C9CA 4ESVA 1Q82D 1NG1A 3P1JA 4G3XA 2Z0MA 4HLUA 4O25A 3A1TA 3PXGA 2J59A 1S0UA 4NYJQ 5FPYA 2GAAA 3ADCA 1SVSA 1U8YA 4QHYA 1VQ4B 2WOOA 3HU1A 5J4YA 2FG5A 3QI2A 4KI0A 2BEJA 4LCBA 3UXMA 4C43A 3SDZA 1SKYB 1II8A 5TVKA 4IOJA 4P4SA 1WF3A 1JA0A 2QEQA 3ZVRA 5FBVB 1PLKA 1W36C 1QVRA 4U00A 3AP3A 2YJTD 1Z8FA 1D1NA 3NBYC 2R6CA 5E7MA 1H65A 5HZHA 4C0HA 2GXUA 4EPXA 1W2GA 2ZRJA 2F43B 3U6BA 3QKSA 2N1BA 4F38A 5IK2D 2FSIA 5KUTA 4LBZA 1ANKA 5LDDC 3W34A 3W5VA 3EW9A 1H85A 4LJ9A 4HZUB 5EP2A 3WYFA 4HUQB 3W2GA 4NP6A 1R2QA 4C0SA 1KQSB 4G5QA 3IPYA 1MRSA 4NYIR 4AK9A 4Z8XA 1NVXQ 1ZCBA 1SVMA 3FTQA 1YU9A 1FRQA 2A7QA 1L8QA 1CRPA 2FMXA 3WYGA 3AVPA 4DRZA 5AJVB 5EP1A 4O2LA 2JLWA 2ZJZA 1NMZA 2P6RA 2FWRA 1VTKA 2ZE8A 4I1SA 4WXRA 5J4KA 2DR3A 3GJ4A 3AEZA 2BCGY 2V1UA 1VCMA 2GQFA 4LUCA 1W5SA 1QGZA 2BKEA 1J90A 1FQJA 4G5SA 4QJ5A 1ZRHA 4RD4A 1NIPA 4CGZA 1I4DD 1JECA 1S72B 1KK0A 1KZ7B 1DS6A 4QM7A 4NYMR 5L3VA 2GESA 5EE3A 1P60A 4RD1A 3CXCB 5JWHA 1D9XA 1O3YA 1G3UA 3AV0B 2QAGC 2IW3A 4E09A 4PQFA 5KPJA 1X8JA 2CRVA 4JZKA 1AKEA 1F20A 4ZGQB 2ZRAA 2P0EA 4CEJB 1FMLA 3OE7A 1SZPA 3IQWA 4A0HA 1KI2A 1E96A 2D2FA 4Q4JA 5JLJA 1GJRA 2K5UA 5CM8B 2F3RA 4DCTA 3U6KA 3LXXA 3FPKA 2D74A 3KXIA 2WJIA 4HAYA 4KHZA 1HV8A 5H68A 2B6HA 4FCVA 2XNJA 1EX6A 5ANRB 2C04A 4R9UC 3F0TA 3WYAA 2G3YA 2PCJA 1E9AA 3UMFA 1ZCAA 3CR7A 1GOTA 2AXPA 4BECA 2JLZA 3ZDQA 1PJRA 2AWNA 1P61B 1TUIA 2GTPA 4B74A 1N6KA 1OXVA 2BMDA 3LD9A 2YC2C 2GAOA 3BD9A 4B35A 4TYWA 5TR9A 1H8HD 1NJGA 5TDHA 2HXSA 1WCV1 3KQKA 1Q0UA 5EXXA 4M1KA 1E79A 3BFVA 3D3QA 3W5JA 3MSXA 2XX3A 2ZAOA 3E1YE 3QFSA 3EG5A 4MYCA 2JJ8A 2GNOA 2OLKA 4EQ6A 1OSNA 1CJUC 4OK6A 2ASEA 3QQ5A 2MSCB 4ZKDA 3LXRA 4O2RA 1G20E 3R8CA 5IT5A 4BFXA 2FV8A 5AJZA 2DBYA 1OFHA 2ZS7A 3LX8A 1DDGA 1KK2A 3CPEA 3PUYA 2AD1A 5J5CA 3WNBA 4BZQA 3CNLA 1XTSA 2NGRA 1IN8A 4LV5B 4KFTA 4UXHA 5AJXA 5J4LA 5JSZB 1R5BA 2QEXB 4B3BA 3I5XA 1WRBA 1SGWA 1KI9A 1PUIA 1N5LA 3CNNA 3QEOA 2OT3B 2DEUA 2ZETA 4DJTA 1FQKA 5LBIA 3MAAC 1E32A 4P32A 3RSOA 5J4HA 1W7AA 5G41A 2ZJOA 2JAQA 1E69A 3D6TB 4QGHA 2PT7A 2KBFA 2VBCA 2J0VA 3F8TA 4TZ0A 4F7DA 1PLJA 4Y7CA 1J9ZA 1F2TB 1GNPA 3CCMB 4LC1A 5DI3A 3K09A 4HSEA 3S1AB 1II9A 2YOFA 4U02A 3D7MA 1DARA 2CVFA 3NBZC 1GRNA 3DHWC 3KKQA 4Q7LA 4YMWA 2GPJA 1ZIPA 2QSZA 3THYB 1GKYA 5DHFA 3SR0A 5HPYB 1VQ6B 1KJWA 2D4HA 3FHTA 5FL3A 3IBGA 4CVNA 4TSFA 4URVR 3X1WA 5KSYA 1Z6AA 2FH5B 1XP8A 1KTVA 1XPRA 4QGAA 5FTJA 3VQTA 4RD0A 5D3MA 3GLHB 3BB3A 3HYTA 2UZIR 3JZMA 4LZZA 4B2PA 1DVRA 1KI6A 4URZR 3TSWA 5JEEA 3ZBUA 4B73A 1W48A 2ZI6A 4RZ2A 1MRNA 1P75A 2QZ4A 2CK3A 1ZM7A 1YR6A 2W0MA 4KFRA 3O8CA 3AF1A 1UKYA 1U2RA 1JEEA 2ZEJA 3GD7A 1SXJC 2GEDA 3CRW1 3OEHD 3LDAA 2OESA 1BMFD 2C9YA 3OAAA 2QORA 5E95A 1HTWA 2F1HA 2IYYA 2ZJYA 1WDTA 4WXPA 1TPZA 3VR1A 2O8CA 1NBMA 2GETA 3CLVA 2P5SA 3QFRA 3QPVA 4D0NA 2V3CC 1Z0AA 2V9PA 1E2GA 2CE2X 3LAWA 5CDFE 1CULC 1UKZA 3EWAA 4PO1A 4D26A 1PVOA 1A2KC 1RRFA 2QPAA 2PZFA 1NP6A 4Q47A 5FPKA 1T0HB 4US1R 1NRJB 4S2EA 2XTNA 3SZRA 4TWZA 1FP6A 1S9DA 2DPXA 4TL6A 3I61A 4AI6A 2ZSBA 2REOA 4LHZA 1KI4A 4V0MA 4Q9KA 3W5HA 2ZRLA 4M4SA 3C14C 3LW7A 2CL6X 4JVSB 4YDHB 1IM2A 4O0MA 5FI1B 3SFZA 2NOAA 3FKSD 1JQJC 5BQ5A 3AB3A 1G3QA 3JVUA 1CJMA 3M1IA 3JQQA 1WQ1R 4M8NE 1HURA 1VQMB 4XTCS 4GZLA 2LWIA 4DB2A 1UAAA 3UPUA 2VSXA 2ZJ5A 1E4VA 1NF3A 3H4MA 2W0SA 3GJ3A 1KAOA 1P62B 2NO7A 1NVWQ 4RCYA 3IDQA 3IUYA 4W9MC 2D62A 3AVVA 1XJCA 4I81A 1IN6A 3C4JA 4YALA 4IVPA 1P2TA 1MOZA 3RS5A 1XCPA 4BPRA 3UANA 3UMRA 2J45A 1ZM3A 5BN5A 5B58C 1KJYA 1N5KA 1NI3A 2OHFA 1ZC4A 1GAJA 1OKKA 4ABYA 4YXWA 1ZJ6A 2XB2A 2N42A 4HAVA 2BVNA 2FPMA 2OE2A 4ILEA 4PX9A 4TQ9A 3W6OA 4BASA 1QRAA 1WE2A 2GZAA 4EPRA 4C2UA 4LJ4A 1KD1D 1IXRC 4QG7A 3SN6A 3QKTA 2W2XA 5EMNA 1R10A 3Q5DA 4NYJR 5FOTA 4YAFA 5L3QA 4DLSA 3P27A 1GNRA 1T8UA 1VG1A 2ORVA 2MSDB 3DM9B 5KO2A 3WY9A 3GLFE 1DO2A 5DSZA 2OSBA 2RH5A 2IS1A 4PO8A 1QGAA 3GLGB 4IDPA 2IWHA 5M04A 3THWA 4YHBA 3HU2A 2Z4RA 2ZI3A 5E3HA 1QFYA 1Q12A 1SKQA 5KSWB 2DFTA 5DYGA 3SBEA 3EPJA 1VDZA 2ORIA 1UADA 5TY0A 2DY1A 3TGPA 2HV8A 1HEIA 2DB3A 2QU8A 3ETLA 2VA8A 3AKCA 4H1UA 3Q7QA 2V1XA 1KSFX 5GJBA 3HPRA 4D81A 1G3MA 2OG2A 4Q21A 1A4RA 2QP4A 1M1KD 3WBJA 4P4TA 2REXB 3FJOA 2AKYA 1JR6A 3TR5A 2NIPA 2ODBA 2QAGB 2FF7A 3QJYA 5B64A 5FOXA 3TAHA 3HR8A 1ZW6A 1DEKA 2NO1A 2VF7A 4FCWA 4ESHA 1E3MA 1YJ9B 1V43A 1VPLA 1FMJA 4JL6A 3VU9A 5DNYB 3CCUB 3CBQA 1XXHA 4URUR 3EAQA 1D2EA 1G5TA 2FU5C 4NPHA 1Z6GA 1IY0A 1ZU4A 1UKVY 1G3RA 3EPKA 5L3SA 3U60B 2ZRKA 2YWFA 3FB4A 3Q8XB 4KV9A 4MUAA 3TJZA 4A2PA 1E1QA 2KBEA 5KSZA 3BORA 2V7QA 4C7OA 2VHCA 3DEFA 3JZAA 3AVXA 1XD2A 2XB4A 1SXJA 3GEHA 3GEEA 2NPFA 5EUQB 3CX7A 4NZYA 1DPFA 4OHVA 3W2EA 1AMOA 3I62A 1GIAA 1TVCA 4HDOB 2EFGA 2VSFA 1E62A 3VR4A 1I2DA 3LFUA 5K8TA 4K8OA 1M74A 2A2ZA 2ANCA 1KY2A 2FE4A 4Q4HB 2FSHA 1M1YE 2GCNA 3ZQJA 3MLEA 4TLCA 5J4VA 5AUNB 2JJ1D 3B2EA 1TAGA 2YWEA 1T5LA 1KI7A 3AVOA 4BEJA 2ZITA 3QG5A 3QF4A 3SOPA 4BLTA 2YNMA 3ZVNA 4JJZA 1U98A 1UKEA 1XEXB 3AF3A 2Z43A 1EK0A 1GTVA 3ZBTA 1YZNA 4DCSA 4NYIQ 4ACBA 1XPUA 3CONA 4MITA 5EP3A 4TMZA 3B1VA 4G1VA 1UM8A 3C16C 1FRNA 1E9DA 1N3BA 1DBSA 1QHSA 1WXQA 4KFUA 4A2WA 5A5GA 1W35A 4ON9A 3K8YA 5LB4A 1GVNB 1K5GA 1U90A 3HWSA 3U3OA 2GHIA 1B23P 3DOFA 1KSHA 3KKMA 1XBTA 1N6LA 2EW1A 2VHJA 4BQSA 1NG9A 4IXNA 4GBMA 3DZ8A 2P65A 4MYUA 1G64A 1LS1A 1TQ6A 3W5IA 4M2LA 4BLPA 1Z63A 3SYLA 4ZV4A 5AN9A 2YINC 4ZDJA 3KQUA 2IYLD 2GXAA 1SVIA 4TL8A 1Z06A 4JIMA 3X1YA 2DHRA 2RKOA 3B60A 3CRQA 4NYMQ 4BPBA 3AVUA 4RJLA 5F9HA 1J7KA 2VYQA 1TF7A 1KMHA 3LVBA 4HB2A 2ZROA 2OCBA 3BFKA 4KVGA 2A5GA 2CJWB 4PHGA 5EXPA 1MH1A 2ZVPX 3GEIA 1BQEA 3P4XA 1ESMA 2EFCB 4IJMA 3QIAA 3P4YA 3P26A 1OHHA 5FUWA 4EFLA 4M53A 1F2UB 1Z0IA 5JWOA 4QBFA 1FNDA 4TYPA 2QP9X 2BGIA 2XNDD 2QN6A 5FH9A 1IB0A 2FX3A 4Q1EA 2Q21A 1O87A 3FMPB 4JL5A 2XJ4A 1RPZA 3MG9A 1S1MA 4L16A 3LBNA 1NMYA 1VCIA 5EUMA 1Q57A 4DHEA 4B3GA 1T3SA 3SU8A 3WHLA 1VG0B 5TB5A 1UMKA 1OH5A 1TTTA 1FOEB 1TUEA 4URWR 4IVRA 3CX8A 4PC6A 1X3SA 4MRRA 4HUTA 3GLIA 1EWYA 3DKPA 3TH5A 3QEJA 3TSOA 4DDWA 3QE0A 1XD8A 2CNWA 5KHOC 2G88A 3EIHA 1YHNA 3I5YA 1XZQA 1BO6A 1U81A 1Z2CA 2P2LA 3HPQA 4WZAE 1MABA 1QFZA 4EJSA 3SFVA 4Y9RA 4DKXA 2DETA 3ZVLA 2DCUA 4DSNA 5GVRA 2E9SA 2VPPA 5FL7D 4DSTA 4Z1MD 1ZU5A 4BWYA 3EA0A 1YHQB 2XXAB 1W0KA 1R7RA 2WKQA 5DH9A 2QG6A 3U7EB 2FFHA 1DAHA 1E94E 2FSFA 4QGFA 4KAXA 1W87A 1QHHA 2GBLC 1G21E 3PIRA 4G5GA 2GDJA 4IFBA 4AYWA 1Z29A 1RRCA 2W6JA 4RFSA 4CEHB 2VNIA 2GILA 2BSAA 2WJJA 1ESNA 1CJVC 2QAJA 3MFYA 2VP2A 3R8FA 3W8RA 4HI0E 2W6IA 2XOKA 2OAQ1 2O5VA 4KLNA 4TN1A 3AGQA 4YAWA 1G1MA 3CUEF 5CLQA 2ZRCA 3F3YA 1WBDA 3NHAA 3I32A 1AGPA 3OIVA 3X1XA 2RCNA 1YITB 2YKGA 1Z3IX 2GEUA 3P32A 2NO0A 3R9XA 1A2BA 4PAOA 2BC9A 2R2AA 2Z83A 1AA9A 2IYTA 3L0IB 4JJKA 4Q4LA 4ZKEA 3LX5A 3REFA 1K73D 3LBIA 3BB4A 4PAQA 4B3CA 4FINA 3W8NA 4E07A 1Q22A 5JS7A 2QPTA 1N6HA 2HCJB 1ODFA 3FFAA 2BKUA 1XZPA 4L5BA 2R44A 2RGBA 2WKPA 3E1SA 3AVTA 4D0LB 5F2EA 2A5DA 4RD6A 2OUKA 3CF6R 2VP4A 3CKLA 4OK3A 4EIWA 3MWYW 4QBGB 4XVQA 3KUCA 1K9MD 4QHSA 1LS6A 4MH0R 5FTMA 1OGJA 4LYJA 3A4MA 3FMOB 1Z08A 2ZJAA 4LHWA 2AFIE 1HYQA 4V02A 1OXXK 5FTKA 2ODEA 2F43A 1MO6A 1S4QA 1ZNYA 3SJZA 1OH6A 3MWJA 4JSTA 1EFRD 1YZKA 4HZUA 4PPQA 2VTKA 3W3AA 1KC8D 2PJZA 4M9ZA 4HUQA 4Q7KA 3MJHA 1OFIA 3FMFA 3THXB 4M1YA 1J8YF 1WP9A 3C15C 1RW4A 3DPUA 1E6CA 2V54A 3LQRA 2ZYTX 3PUZA 4NMMA 4Q19A 2WKRA 1NJFA 2GK7A 3W9YA 2GRJA 3K9HA 4PC1A 1NBME 4PR0A 5FR2A 3DKVA 2JJ2D 2WIBA 3K0FB 3QFTA 4LJ8A 1W49A 4MDFA 2FA9A 3K9LA 3BH7A 2NPIA 3CX6A 3EZ6A 4LJYA 4WZBE 4IOLA 4B3DA 1W2HA 5BN3A 2XGJA 2ZRDA 4P6VF 2FPLA 3ZD7A 5HKKA 4M22A 5BWMA 3T5GA 4QM6A 2ZRFA 4D4MA 3K0CC 1GL7A 5KSOA 4V0ME 1ZINA 2I3BA 4Q5IA 2LKDA 1W4AA 1KK1A 4BFSA 5LPNA 1P72A 2GWHA 1R4AA 4M1TA 1HT1E 4M21A 3SHWA 4KO8A 4D80A 4QNRA 1KI3A 3T1TA 3QVVA 1EP2B 1G6HA 1X1RA 3KB1A 1AGRA 2ZE6A 3LRPA 2IF0A 1AN0A 1BOFA 1EESA 4QXAA 2HT6A 621PA 2Q9BA 2RGGA 1RC8A 1KMQA 5BW8A 2PBRA 2ZYWX 1CP2A 221PA 4FMDB 2O8BB 4WIAA 3G5UA 3QPWA 3B5JA 3WMEA 3MMPA 5EE0A 4DUGD 4DQKA 4LOAA 1KO4A 3QPUA 3ADBA 4V0LA 2D3WA 4JVNA 2PH1A 4LRWA 1KIMA 3SQXA 4MYTA 3GJ8A 3W2IA 1XX6A 5CM9C 3B9PA 1DAFA 3REGA 5K8LA 1XTKA 4LJ5A 1E9EA 4OQLA 4M1OA 4NCKA 4GT1A 1GM5A 2QDXA 4JBYA 4LYFA 4MGKR 3IKJA 4YONB 2JIZA 2W2TA 2SHKA 5SZKB 2OCYC 2FFBA 2ZM5A 2HF9A 4GOXA 1E98A 4LJ6A 1B0UA 4JMPA 3NC0C 4PHTA 4UNQA 5EP4A 2IUUA 3RS4A 4D2IA 4QKQA 3NEYA 3T1QA 1NJID 3LBHA 4TZ6A 1X8LA 2EYUA 4JT2A 1H8HA 1W0JD 4B2IA 3WNCA 1XF9A 4AYXA 2GJ9A 3KXLA 4D4LA 5JZVA 1E2FA 2CHVA 3DOEA 1AIPA 5AUPB 4V03A 4UNNA 2BBWA 3TW4A 3W5UA 1T91A 1RE0A 2WIAA 5EE1A 1DDIA 4YMUA 2AD5A 1KRHA 1RVDA 1UEJA 5JS8A 2PJRA 1Z6TA 2Q6TA 4MRSA 2GJ8A 2ONKA 2CLSA 2PZGA 4X8LA 4B4DA 4I1UA 4A8JC 4A0RA 3T1OA 3SC3A 3G6EB 1QVGB 4LPKA 3AVQA 4LHYA 3U7FB 3L43A 4PHFA 1N0VC 3RHFA 2ZJBA 5G3ZA 3ZVMA 1N6NA 5F98A 2ZAMA 2ZI9A 3DMDA 3GQBA 2KE5A 1AZSC 4TMVA 1X86B 2F7SA 4JYCA 1N0UA 4Q9LA 1IN5A 4KBGA 2QMUA 2GCOB 5JJIA 1F2TA 2VIIA 1G16A 4FIDA 1Q1QA 4DCUA 1KKMA 2OZEA 1QHYA 1G291 1GWNA 3S1AA 3I1FA 4X8OA 5G53C 4XVUA 3HJNA 3AVWA 1XXHE 5GJCA 3VR3A 3L0PA 3LA6A 4LDJA 4UJ5A 5GADl 1G5PA 3BJIC 4I1VA 4LYHA 4DCNA 1VQ7B 1FPMA 4HE5A 1BYUA 3THYA 3CNOA 1EGAA 2IT1A 4ZPXA 3W6NA 1R5OA 1IQPA 3LY5A 4IDNA 1QHGA 4D0GA 4EAQA 5EXSA 2XNSA 3ADDA 3H2YA 1AJEA 1XEWX 1MO5A 1IAQA 4P33A 1KO7A 2P3SA 2IX3A 3E2IA 4LX0A 4I99A 1SXJE 3GLHA 3EPHA 4WQMA 5GJVC 4BRUA 4IDHA 3NEJA 3AH8A 1DAKA 4Q1FA 1FUUA 1G6OA 2IYZA 4G5RA 2W83A 3KJEA 2F6RA 2JLSA 4DLVA 5TMPA 1P3JA 4HE6A 1VQ5B 2N46A 2WWYA 1F3OA 1I4TD 1X6VA 2O8FB 2GF0A 4ZGNB 4G1BA 4N0DA 4BLOA 2FEMA 3VR5A 4B3XA 3CZQA 1COWD 2YWGA 3CRVA 5E4FA 3ZYCA 1HA3A 2DFNA 2EYQA 3QVUA 3A58B 1VECA 4XIGS 1TQDA 3ZZTA 2WPDD 2PCLA 3R20A 2RGCA 5C4MA 1IN7A 3BOSA 1IOZA 2ZYUX 3T35A 2R6DA 2XEXA 1C4OA 5ELXA 2B5OA 4DDVA 1QHNA 1VG8A 4UNRA 4PZYA 1N6RA 3K0AB 3QFCA 1UBCA 4AF7A 3PQCA 2IHBA 1NKSA 3OEHA 4PPGA 1GILA 2ERYA 1VQLB 1II8B 1BMFA 1NSFA 3IQXA 4NL4H 2PMKA 4HLCA 4ZI3A 1NNEA 3VKWA 3CB4A 5K8IA 1VHTA 3C41J 5FOSA 1EFCA 3CC7B 3ND9A 2Z5FA 4L8GA 1OYYA 5THXA 3CIOA 3I92A 4OYHA 4TTQA 1W4RA 3EIQA 1XJQA 2GJAA 1LY1A 4AY2A 1JR3D 4EPWA 2O0JA 2CL0X 2ZUDA 4PXAA 3RC8A 2J3EA 4HB4A 2AHOA 3W6PA 2JLRA 2QT1A 2LKCA 4HLQB 4CF7A 2E1RA 1C9KA 5JI3E 1U94A 1VCNA 2ZRNA 1E9FA 1F6BA 3FKSA 1YR8A 2WWIA 2WMNB 2ANBA 2C03A 4CRWB 1TLLA 3ZS9A 5D3QA 4R7ZA 2NG1A 3OFND 4PC7A 1KK3A 5TARA 1OIWA 2VLIA 2QBYB 4N0EA 2CL7X 3E70C 3MWKA 4U9UA 4JS0A 4BUJA 3KZ1E 3QOFA 1EWQA 1TU3A 5K8UA 1EFHA 4OQMA 1KDRA 1E2JA 2BBTA 1E2IA 3NIBA 1G17A 3ZS8A 4KBFA 1E9BA 2BJWA 4DSUA 2GA8A 2ZRPA 2GXQA 1D2NA 4KLZA 4B43A 5A4JA 1U9IC 3UMSA 1Q21A 1HUQA 3W2HA 3EX7C 3GLIE 2QM8A 1VYTA 2OO7A 3ASYA 1GDDA 4FN5A 5LD2B 3L2OB 5KDOA 3VNUA 2YHSA 3L8ZA 4ACAA 3GLGA 2PL3A 1CR1A 4XWKA 1US8B 5JFGA 3EC2A 5DIFA 1VQPB 3R9WA 2J7PD 2A78A 4W5WA 4HB3A 3EZ7A 1XTQA 4TLAA 3RRMA 2GCPA 4JKYA 3TVTA 2JDIA 1G7RA 1TQ4A 4JLNA 5FBRB 3KL4A 3RAPR 2ZE7A 5FPTA 1N0WA 2BM1A 4E22A 3NVAA 2FSGA 1OXSC 3OZXA 3VHLB 3SJCA 4LGMA 4TYYA 4QOSA 2A30A 2WOJA 3M6AA 1Z83A 3BIFA 3ASZA 2P6UA 3MRSA 1RYHA 4LSGA 3WBKA 1XTJA 2NO9A 1ZM9A 2Q9AA 3ZC3A 2IHYA 5DLQC 1XCGB 3CCJB 1OLOA 1A8PA 2QAGA 2ZPTX 4KU4A 3CPJB 3CMEB 1N6OA 5AWFC 1Q3TA 2R8RA 4BFUA 4GPTA 1JA1A
chains in the Genus database with same CATH superfamily
4UBIA 3G88A 3EFOA 3ZDBA 3H65A 4HGQA 2Y4OA 4HQLA 3UIEA 1U0JA 2V6BA 3UBMA 1XKXA 2IEIA 3LWZA 1C3XA 4P58A 1WABA 3FE2A 3OESA 4FYYA 4LHXA 2H2WA 4MAAA 4N3BA 3TZKA 2HJGA 2ZOSA 4C6HA 3FFBA 3MPOA 5L95A 3D7KA 3DQZA 3RJ5A 1C30A 3D6VA 4DLRA 3C87A 1J09A 6NULA 1ZVKA 1Y7TA 3C8MA 1OLSB 4G1EB 1WULS 4PG7A 3VPDA 1EWVA 4D8WA 4DMGA 3Q8WA 8OHMA 3IYLW 3GJ7A 3N70A 3Q1KA 3TIVA 2VNAA 4JFAA 2ODPA 2QW1A 3E27A 2R6ZA 3IE0A 1Y1LA 2G25A 4YAEA 1UDXA 1XO1A 3CWZA 1JWAB 1EP3B 1GUZA 1YBAA 1AGYA 1O96A 2JANA 5TS3A 1JPJA 2EV9A 5DASA 5C1PA 5HTOA 1PLLA 3FWNA 1CRZA 3L7AA 4X95A 5H02A 1Z34A 4RGVA 3DL0A 3OLZA 1VE5A 4H3VA 1JIIA 4N5NA 2J3QA 2RIPA 1SKYE 3PNMA 5D85A 5HCUA 4ZTUB 5DBFA 2XCTB 2VCEA 2C8VA 2LW7A 5EI5A 2O5RA 4OQEA 2I34A 4KPUA 4ZGGA 2J0UB 2NTNA 4RPKA 2ZBRA 1Y0RA 2GWRA 3HEMA 4J1NA 1A7JA 4MRNA 1XZGA 3QGMA 4Q3CA 4W6QA 4X20B 2HW8A 3GJTA 2ACKA 1KZLA 4L07A 5AW2A 3L01A 1FP1D 3SSOA 1WUKS 4BFZA 1XEXA 4IOKA 3OPXA 1Z22A 1NY5A 1FFAA 5AKEA 4AKHA 2GFIA 4I55A 4PLGA 1EIZA 3AEQB 3RJZA 5EIFA 3UAZA 3CO5A 2Z04A 4CPDA 2JJ1A 2QXUA 1P2VA 3KOWA 4FS8A 4IGIA 4X1IB 5IYPA 3DVAB 2NVOA 5DHTA 3RUAA 4D9CA 3KOZA 1ZA2A 2JA2A 4GP9A 3UJ8A 2R9VA 3LV8A 1V0FA 1ONPA 3RREA 4F8EA 1AQLA 3GRZA 3RSZA 3TRKA 3RVMA 2IS6A 2D2EA 2VP9A 3OUZA 1UZMA 3KEMA 3K1TA 3IGFA 1UMCB 1T9CA 1GN8A 2QL5A 3OEED 4M0DA 4H0CA 5CLIA 1AXGA 1U7WA 3WKBA 1RADA 4BAZA 1BH2A 4HDMB 3OE5A 4I8DA 3ZJYA 4RTMA 2XITA 1S8AA 1NBMD 4NEHB 1LPAB 1VLMA 1XK6A 3M83A 4YLGA 4CIDA 2XHEA 4K05A 1ZYUA 3T41A 1WU7A 4C3ZA 4K7JA 2ZREA 5TQ0A 3BK1A 4NZOA 4QDTA 1YAJA 4XZ3A 1T2AA 3VC3A 5K3OA 5KNDA 4CIVA 1K8ZB 2HL6A 3NT2A 4Y2GA 2A5YB 3TBFA 5JXGA 4D1YA 1GRQA 1W47A 3CF4G 2CNDA 4XKVA 1FS4A 2EJUA 2FCRA 2ZQ5A 2ACEA 4KVAA 4PG4A 2XZPA 1R0KA 4D4GA 4KN5A 4HX5A 4PQYA 1GKKA 5CK4A 3TDMA 4F91B 3C74A 4MW7A 2BMWA 1NX6A 1TJ5A 2Z56A 1WOOA 4MW9A 5JJLA 1CHDA 1V3QE 2VSOA 4JLSA 3E0XA 4QTUB 2NYUA 4Q4AB 3H1EA 4LTDA 4KTTE 3LQKA 5C8YB 4GD3Q 3RPEA 1S8FA 3KG2A 1ZJYA 1GAQA 2E4VA 2PRSA 4QVIA 3RQSA 3WL3A 5DDIP 1SQ6A 2HF8A 2WE8A 5KVAA 2A9VA 2P2DA 5LB2A 3WIDA 4A1FA 1FC0A 3ESQA 4C6TA 2PO5A 121PA 4C7BA 2BF4A 2R8YA 3GRRA 2G8LA 1KYZA 4D45A 3WL4A 1JDVA 1RSZA 2QN9A 1ZBDA 1CV2A 1YIDA 4Q1CA 3LTNC 1HY3A 4L4ZA 1TJYA 3KPUA 3M4YA 3E0QA 2VP0A 1B00A 1MAUA 4GC9A 4UPVA 2WE7A 1T3TA 4NDAA 3TQIA 4QC2A 4RU1A 4HF7A 4GI5A 2QP3A 2B1RA 2DQSA 5IUKC 1T36B 5FI5A 3E1KA 4L8VA 4WLNA 2Q1TA 1C7JA 1JJ2B 1F14A 4BNXA 3UICA 2R1VB 1LTQA 3M34A 2V3VA 4O4HA 4PS0A 4Q66C 4E21A 4UHDA 3P0HA 2GPTA 4OFXA 4RKWA 4RVCA 3VAAA 2W2NA 1A27A 1NFRA 5BN5B 5LMCA 2H1FA 1MEJA 4YP0A 3WMWA 9GPBA 1W8IA 2PH3A 3AHGA 4YCCA 4ZRMA 3CG4A 3UHOA 1FBTA 2APJA 1N8SA 4RACA 1NW5A 2HA7A 5FWDA 2A9QA 3CA8A 3B1YA 1CPYA 2I4LA 2NZXA 2IS2A 2H3EA 3BFJA 1B6SA 4JLJA 4C0LA 1A2OA 5E2AA 1K7YA 3FPFA 2C20A 2HPVA 3OJFA 1XHEA 3K31A 3T3HA 2A88A 4RFVA 3GX1A 5AJTA 1T3HA 1QKJA 2XBUA 1I4LD 1P80A 4UNPA 2ZI7A 4F4FA 4ENVA 4YCDA 1E61A 4AKSA 1MGOA 1TIBA 2HDHA 2IC5A 4FOOA 5KNLA 2Q3JA 3AERA 1PT5A 3IOBA 1F7VA 2WABA 2YHIB 2Q9UA 3Q9LA 2XSZD 1JILA 3JD3A 2PM8A 4KYIB 4OHXA 2QB5A 1MTZA 3HB9A 1MA3A 4GPBA 3FUWA 2EWMA 2OPBA 5EE9A 3L1IA 1WVMA 5KTOA 1GQQA 4UOEA 4G67A 2AIRA 1E3WB 2CVZA 4KFSA 2GEJA 2ZB7A 3AJRA 2QMHA 1U4SA 4B44A 1UFVA 3HVKA 3ML1A 1X7ZA 5K0CA 5K6RA 5M34A 3I3SR 3KDPA 4BNFA 4M9XA 1AK1A 2FP3A 2Q29A 1T5EA 2GZRA 2WJZB 2ZL7A 2R6FA 3GAFA 3B85A 4U2DA 3V00A 2VK8A 5ALOA 3OZVA 2AJ8A 2X23A 4XQ9A 3QWBA 4XLZA 3ESDA 1PR2A 1ACLA 4QOEA 4D97A 1ZGZA 3NDIA 3ZWKA 3D3NA 2FRVA 1YVDA 3OZFA 2PWBA 4MUMA 3IIKA 1SULA 4KLRA 5JZOA 4OUKX 1KYYA 3FCUB 2DPYA 2OGTA 2W9XA 3OM1A 3R5KA 3A3NA 4I4LA 4RW0A 3SC4A 1T1IA 3VX3A 4NZNA 2RK3A 2VYNA 5FBQB 3GLHE 4CCSA 1YUNA 2OMKA 1R8XA 5A5EA 4N65A 3F6RA 3KXDA 1VBFA 3EQ2A 1XHFA 1FFCA 2IWRA 1T2DA 1DJNA 5K5EA 3D7RA 3PKIA 4KNWA 5L8VA 1E2DA 4AJ1A 1DHRA 4PAWA 1HETA 2FP4B 2HUPA 2QGFA 3CH7A 3M6IA 3UJCA 2DOKA 3GBVA 2VNJA 1H2HA 1RZ3A 3IAM6 5IM5A 2FSSA 4EX7A 1BMQA 2EBFX 3DUFB 1EZ1A 4H4EA 2OTLB 3NAZA 5C1BA 3SEJA 5TGDA 3CXRA 2PYZA 2MYPA 4HYQA 2OD7A 2DPHA 1P44A 1QIMA 3HDTA 3LC2O 4NJEA 4E1VA 3V7NA 4E5SA 4RWZA 5A3QA 5AXCA 1QWSA 2BTQA 2CC2A 2E6KA 3F6EX 3AL3A 3BC9A 2ZSUA 2AKAB 5JSKA 1U99A 3I34X 5JNTA 3ESZA 2GM9A 1SCIA 2J5KA 1VC2A 4B6QA 5HIAA 3M9WA 2ORWA 4OUDA 4DY4A 1Y8ZA 1FP2A 4QASA 3BDAA 1FF9A 1SOMA 4O2BA 3NH6A 4ZI5A 5C8VA 5I3ZA 3AF6A 1SUDA 4RNDB 4LC0A 1HQCA 1XMIA 3TW8B 3G8AA 2HKIA 1IXSB 3V9PA 1BHO1 1DRWA 1E1RA 3ANTA 4EP1A 3QF4B 4Z54A 3HB0A 3O83A 4IUCS 3RSGA 4HDRB 4EM6A 2J0SA 4BO0A 2AK2A 3I39X 3U3ZA 4AT1A 4OAQA 2IYAA 1YJAA 3JQDA 5BSYA 3EZNA 1UD8A 4QSHA 1Q9SA 3EY4A 3GUZA 4RTPA 3ZDYB 4EYEA 5JAOA 1TOAA 4LJAA 2PGDA 4CMAA 4CYMA 4EGFA 2GHTA 1SQ5A 1OFUX 5KVQA 3B3FA 2V9CA 1IQUA 1EUDB 2MTBA 3C6QA 3M5DA 1WBJB 2EVWX 2NADA 4O4JF 5M3BA 1YGPA 2G9RA 2V31A 2PXAA 1OFUA 3BTUA 2XBLA 4AO6A 4DHWA 5LXTB 1NJ5A 1QVFB 1RAHA 4KXNA 5ILGA 3PD0A 4ETWA 2Y1CA 4P9SA 3A3PA 2AG0A 3E9NA 1IBRA 2FGKA 2V6IA 4PC3A 3NANA 4B33A 3Q7RA 4QDUA 5KWIA 4U7WA 4B3TB 5IZCA 2C88A 1B16A 4PG8A 2CVHA 3Q85A 4S35A 1BQ4A 4UE3S 1KZ6A 1RPTA 3CX3A 2NAPA 1SVKA 3UG6A 1Y7IA 2CLOB 1WQ4A 2IXFA 2OP1A 1N2IA 1EE9A 2BKXA 3BWBA 3QPCA 4PNZA 5P21A 1DIBA 3GNLA 4JVOA 1QYWA 3D64A 4JXZA 2AGVA 3DBRA 4JJ8A 2BFBB 2PUDA 3O4FA 3DL7A 3Q6NA 3KQHA 1I6MA 3IBCA 4LNUB 2OHOA 2Z5GA 2YL2A 1QFMA 4CCYA 2C5HA 4RFLA 4MS4B 1OB2A 1PU2A 4EK9A 2H2IA 3GXOA 1LFDB 2PVCA 3KQOA 4MMZB 3RHTA 4QUZA 1ETHA 1THZA 2PKQP 3NU1A 4LHEA 5DEOA 3DNMA 5HKLA 2P9YA 2YXPX 4QO8A 3AUYA 3LIIA 1HBJA 5FBHA 5K0NA 2NLOA 3DXZA 3QXHA 2ZYGA 1G3IA 1T43A 3BBLA 2CNLA 4XEHA 3TLEA 1PWHA 2JI4A 4DIEA 3EYAA 3T8YA 4LOIA 3EGVA 1XNRB 5FA6A 3FW1A 3SZLA 5AUOB 4HRYA 2G0AA 3FSGA 2FPGB 1YDWA 2A5JA 2X2OA 3O1HB 1L7RA 3ORYA 2DPGA 3IAS6 4DE5A 2I91A 1ZH6A 1P73A 5E2BA 3EF1A 3V6LA 1ZQ1A 1YVRA 2H4ZA 4NONA 5E4TA 4JLAA 1FXWA 1R0ZA 4B7UA 1PJ4A 3D4IA 1W0JA 2X2FA 1GADO 2DKFA 2BDEA 4M89A 1RPNA 1Q5PA 3KKZA 5EJ2A 2X0DA 3UEOA 4ADSG 1DV2A 1JJAA 1ODTC 4DIDA 1CR6A 4TWJA 4KSBA 3WYDA 2J0QA 2FPKA 2VHTA 1JSZA 1K1EA 4TXMA 3L06A 3WXMA 1J8QA 3D6UA 3LW8A 1U2GC 1HSZA 4UFOA 5K9ZA 2NV6A 4J07A 1BN7A 5C5EA 1Q44A 1OA0A 1QO9A 4ZV7A 3TNLA 4F46A 3N0TA 2HHCA 2YCBA 2WV9A 5ALWA 5D6NA 5EJEA 3FKJA 4XYGA 2Y4NA 3PFFA 3EMBA 4AN1A 3C5VA 3IX7A 4TMTA 1UWKA 4JUBA 1HT2E 1YR9A 2FFRA 1U7HA 1YDFA 3GB9A 3NZEA 2D5IA 4CEJA 2QRJA 2WVGA 1Q0ZA 2H2DA 3NM6B 4QWWA 2J85A 2EF1A 5FTNA 4UAUA 3RW9A 4RFSB 2P9HA 4YRFA 1VPVA 3PFGA 1BA2A 1X74A 3N8KA 1C7EA 2QJTA 2PX0A 3C3XA 3KT6A 2FDCA 3Q0TA 4EFKA 3JTEA 1CNFA 2JJQA 5HTKA 3RKSA 3SDSA 3B1ZA 1KXJA 4XM3A 5HUQA 3RIGA 5CG1A 2OKCA 3IVCA 1VB3A 4GC5A 4BNYA 2ZWIA 1QU3A 1SB8A 2CHFA 2QLTA 2YBDA 3OD5A 3QMPA 3ZLBA 4CR6A 1A7UA 5KTSA 4Z4VA 3OZBA 5CW1A 3ET4A 1Q7CA 4QUAA 4RENA 4G4GA 2YZKA 3Q40A 5JMOA 5EJ9A 2JGFA 1Z2AA 1Y3DE 2HJSA 2JK0A 3MXTA 1DQNA 3TEFA 2GBLA 2ZJ0A 2ZZKA 3HVIA 1WXIA 1D4ZA 2EJVA 2JI8A 3KZXA 2H29A 3NNDA 4KQEA 3NUQA 3THSA 4RANA 3K9FC 4HFRA 2PT5A 2VDNB 4OQQA 5ALKA 1FS6A 1P5FA 1V41E 2C5SA 3BE8A 1H9AA 2PZMA 3RSHA 4FFLA 3UK2A 2EU8A 1MJGA 5K0GA 1Y6FA 1XZNA 2QKYA 2P4HX 4MKXA 1OC4A 1SU6A 5IHXA 3LCMA 3LWNA 5IDXA 1HF3A 2EWWA 4OHWA 4EJ0A 1DBPA 1YKGA 2R65A 4FD2A 1COWA 2FEKA 2XDQA 1GLVA 4PSVA 4CCWA 3FX2A 2OBSA 3H5WA 1UBEA 3FCOA 3Q3JB 2I6QA 5TQJA 2WPDA 4B3RB 4GOMD 3D4OA 5IYRA 1FDWA 3IBFA 3HO8A 5ENDA 4A82A 4CI9A 1PUJA 1Y1TA 2GOYA 5LNK1 1QE5A 1EGHA 3QELB 1RTKA 4K28A 4RSHA 2OGZA 2JAUA 2XTMA 1E2LA 2ETXA 5DI9A 1YFKA 3GLFB 3IHLA 3ETHA 3U5ZB 3LSTA 5K4GA 3ILSA 1JHXA 2NXJA 1D1SA 3ABZA 1O2DA 3IE2A 3N0WA 3PDWA 2C98A 4IQ4A 4RIIA 4DDTA 2IOFK 1WB9A 1Q15A 2VUIB 2HAEA 2R5WA 3C3AA 1ZCFA 4CLHA 1ZAKA 2V8OA 1J5EB 2FZLA 3RIXA 3KT0A 5HRUA 3TG2A 5FBWB 4XYEA 2W8BA 2YS7A 5JCJA 4XGNA 5IVIA 4O59O 1LBSA 1LV7A 3ZVKA 4RK0A 3G8YA 4JBHA 1JR3A 5ERYA 5JXWA 3PDHA 2P79A 3DZBA 3HE3A 1PNRA 1FL9A 2JBHA 4W8OA 4GX2A 4UNSA 5GJWC 3FETA 4XD7D 4MW5A 3LRTA 1UMDA 1XQ1A 1ZH0A 2PGOA 3CMCO 2ZG6A 3PNSA 3LBFA 5I7WA 3QNWA 4KXFB 5FFNA 3T9DA 3JALB 4MGHA 4H7IA 4DMFA 5C81A 5YASA 1KEUA 1R8QA 4RWEA 1M5RA 2QUHA 1Q14A 2QRVB 2WSBA 421PA 1XTRA 3DE2X 4DREA 4FC7A 1PQPA 3PGMA 1OFTA 5J47A 1CIPA 4E5MA 3DEYX 1E2KA 3JD2A 4HH1A 4TT3D 4YFVA 1I51A 2GYYA 3ZDEA 3CPWB 4MQ6A 3UYKA 4A92A 4B2LA 4UVEA 4J90A 3I6IA 4FE4A 3VTZA 5DFAA 3SEFA 1EVQA 2CDRA 2FZGA 3GH1A 4Z9FA 3JXEA 4RMJA 4RQAA 5DK6A 3SE7A 4F0JA 4KACA 1G18A 3PXCX 3KUKA 3GT3A 3DLCA 1O8CA 3DBOB 4Y8VA 1IY2A 1KDZA 4CUZA 4MCHA 2C31A 2OD2A 1ZH4A 3VR6A 3ZD6A 3UT5A 3ANYB 3NM5A 4GZMA 4F84A 3HCFA 3CTPA 3A1WA 3FNQA 5CRIA 2PUWA 5KWSA 5L51A 2FZ4A 3IDFA 3FBGA 4OXNA 2JD2A 4KKXB 1EBBA 4YAUA 1NW8A 3M6XA 4X1OA 2IL1A 4ERNA 1YASA 5BQ3A 3IMEA 5B3KA 1RYDA 5CEJA 1V95A 3I56B 2PWYA 2WU3A 3IVAA 1S96A 5AHOA 1LFAA 5JAPA 4Y2PA 3ZWNA 4H77A 1NC3A 2GYUA 2Z4TA 3IUBA 1NLYA 1BHQ1 1MR3F 1NFQA 4RY2A 1QDUA 1M1YB 1TUBA 3CS3A 3F98A 1KYQA 1Z6XA 1E8NA 4K3UA 4WNAB 2HU8A 3DTVB 4V0KA 1UXJA 2VJYA 1TYCA 3LTEA 4WNYA 1VYHA 4EA7A 4YT2A 1PF7E 2E7ZA 1QHXA 3E2MA 3CCBA 1NNSA 3ED1A 1TW2A 1XXLA 2J9FB 3FYDA 4OMFG 4R3NA 4WV3A 3EC7A 1PJQA 3D5QA 3BULA 1M6NA 3AKYA 3A32A 5DGXA 4O2AB 4BGDA 4DV7B 4IIGA 2ZQZA 3ZUPA 1QGOA 4L7VA 4DQLA 1OLSA 4NE2A 2VDLB 1YS1X 5CYPA 2YZ2A 3IS3A 1D2MA 3MT9A 4ZVNA 1KYIA 3KEFA 4RE5A 1YBHA 2Q28A 1E1CA 1QZXA 3JQEA 4WBXC 2HHLA 1W0CA 3ZBQA 1DG3A 2RGWA 4MYHA 1TADA 1M73E 4AJOA 5ALIA 3BY2A 1L7MA 2VHYA 3ABOB 1QH1B 4UD6A 4NV3A 1GZUA 4D92A 4CU2A 3DMGA 1FFYA 1W34A 1VCOA 4X07A 3V97A 4AZVA 4QVAA 4I66A 4O1HA 5LQRA 1GT6A 4MWDA 5CVCA 2OWEA 4U7GA 5AD1A 1E7SA 1RBZA 5TMBA 3DOOA 5JMTA 1ST2A 2BD0A 2D8MA 2GERA 2RARA 3PG5A 5FOQA 5KNBH 3WHKA 5TEVA 2AJBA 5K3FB 5M2QA 2J0UA 1Q1GA 2P4UA 2KHZA 3AF5A 3AI3A 3GGGA 5F7OA 4L6CA 3TE6A 4MVJD 2WU4A 1CQZA 1JG3A 4GBED 4X20A 1OPRA 2AF3C 2VRNA 3GH3A 3KYDB 2X6TA 1GV1A 5SV2A 3A4VA 1GCGA 1Q7RA 3DF7A 2W2PA 3EJWA 4I5FA 3UA3A 2BGNA 2ZWMA 5LQKA 3GRCA 4OGLA 2QD4A 3MTJA 2CYAA 3RDPA 3DGEC 3O4HA 4X1IA 1TE2A 2O2SA 3RS8A 2BJVA 4ZOEA 2ZBFA 4X97A 3T1YB 1YNOA 3GDWA 1USKA 5D3ZA 1JDZA 3H1GA 5CBPB 1G59A 3E3NA 2J32A 4TUYF 4KN8A 3FJ1A 4IJQA 1N5MA 3BREA 4D8UA 4P3KA 2OZLA 1QH8B 3OWXA 3GGSA 4KODA 3CKKA 3GY0A 4NDNE 2FOLA 3FHCB 1UMCA 3W7VA 4R1OA 2AS0A 4BV3A 1OBFO 2V6FA 2DQYA 4ZO6A 3UCEA 3NWJA 2FMHA 3KLPX 3Q5EA 2P9BA 2VCYA 5JCOA 3WIEA 4HDMA 1X7DA 4HP8A 2Q4TA 3HI6A 3B2NA 2YFKA 3G2KA 4INAA 3BIWA 3WYNA 3DV9A 1N8KA 5DNCA 1SC6A 3FR7A 3PD1A 1A1SA 4G2TA 2JHCA 4J9UE 4WZAB 2X86A 3JAKB 2FFAA 1FTYA 1V3UA 4LWPA 1HNXB 2FYTA 1UPTA 4A03A 1U6JA 4GOKA 3KEWA 2I3ZA 4CZ2A 1VQ8B 3PPWA 1NT2A 1NONA 5BXQC 1GZSA 2RCYA 4WOPA 2EKQA 5JVDF 3HY3A 4HWGA 5C7IO 2XCOA 3ETJA 3H1AA 4NCXA 5E7IA 3MEQA 1NVUQ 4FDUA 1T1SA 4EHJA 3VH3A 1A9SA 1KY5A 1MNAA 2P4QA 2IZ6A 4ZT6A 2DF8A 3AQ4A 4D25A 3NUGA 4HKTA 1BWSA 1DC7A 4MI3A 3ZN2A 1CG6A 1QPZA 5AQEA 2GM3A 1G7SA 2OBMA 5DX8A 4FDLA 1U1CA 4Q4AA 5JQGB 3KX2A 5C8YA 1WMBA 3LO5A 1H2ZA 4NH4A 3W8DA 1FRFS 1RYFA 3OKPA 4E3ZA 1WKBA 4JB3A 1QXSA 5FIUA 1SCBA 2ZR0A 5EGSA 2Y6VA 4AVZA 3VTFA 4LNHA 4DV4B 4KZKA 1NM5A 2QMQA 4V3BA 2AZMA 1I3CA 3S4YA 1JALA 4XB2A 3LLVA 4OX9B 1CZKA 1LLUA 1RJWA 3MTAA 2YDXA 4IJVA 4C0BA 2PD3A 2ST1A 1ULUA 5F9MA 3UJAA 3IERA 2XH8A 1HT0A 2IGBA 4JCOA 5EXTA 1VHJA 1G38A 3EIEA 1ZS9A 4WBSA 2FW7A 2Q49A 2IU0A 2X40A 1YC5A 5EG5A 4NKRA 1HDZA 3B6JA 2ZYAA 3JASB 1T36A 4OHZA 3WRYC 1JDTA 3INRA 1N9GA 1QIHA 4PLCA 5DPMA 3G23A 2HQBA 2R1VA 4IIEA 5GONF 1ONSA 1RI5A 2ODWA 2XA9A 4FYXA 3JQCA 3TZHA 5CYOA 4C4TA 5IASA 1OFVA 1NL3A 1UKAA 4ZMRA 1DU4A 4YCAA 5MFPA 1POXA 4EDHA 2ZQYA 4US2R 4D0SA 5IVKA 2ZBDA 4FLMA 1OI3A 1JFTA 4IX9A 5TJHA 1HDEA 2I8CA 3NRBA 3ADPA 1W36B 4GP6A 3GPCA 1H9CA 2GBGA 4WW0A 4NZZA 1CQIB 2UYGA 3FPBA 3NT4A 4C5BA 3Q4GA 3DHVA 1SBIA 6ABPA 3NT5A 3QU7A 2RKWA 1V47A 2O1SA 4NABA 1MG5A 5DGCA 1ZMXA 2R6GA 5BORA 4MIYA 1ZRNA 2D0DA 2H1SA 1A04A 2JGKA 4IJUA 4O5AA 3TIGA 4FHEA 4BUCA 2XMCA 5B2ZA 3RSSA 4IBOA 1QF7A 3EGDB 2JDID 4IYRA 2D00A 2CF6A 2FWAA 3DDZX 3GFFA 2EEZA 3HSYA 4Y7DA 5KKAA 1L5GB 4YUYA 1OBVA 3A1DA 2AFIB 3QY9A 2ZTNA 1Z18A 3IEUA 4OHFA 2BFAA 4MXDA 1KI6B 1RKXA 2XWBF 4ASUA 2Y9MB 2QGNA 3T34A 1N8RD 2PXCA 2YHIA 1JHMA 1WXDA 1ORTA 3SX2A 1GGNA 2J07A 5REQB 1X15A 4AWXA 4DA4A 3SQLA 1KFKB 5HF6A 1W6UA 1KY4A 4XSHA 4CMKA 2FLKA 1E3WA 4BN0A 2RH9B 1XWIA 2P5UA 1S9HA 1YCDA 4HLNA 1B73A 3CLUC 4EABA 1M2WA 1QF9A 1P0FA 5DTIA 2XAAA 2O8CB 4BX0A 1DELA 1QVAA 4HQRA 1Q7YD 1L5YA 4MPTA 5EKTA 1N6IA 5ALHA 4B45A 3HM9A 3FF4A 1R4MB 4JX8A 1P7CA 3OTHA 5J59A 4E88A 5KYXB 1ZC3A 4YMSA 5GMOA 1RYZA 4RE6A 2CD7A 4RKYA 4WJKB 4WL0A 4XQEA 4ZVPA 2VS1A 3UM9A 2C8KA 4L3OA 5D01A 2N9UA 3A6LA 2Q3EA 1E8MA 5F3WB 3UAWA 1ZKDA 3FZQA 1E92A 4XVCA 1X7YB 4Y6RA 4TYMA 3VHQA 1EX1A 1Q77A 1A9ZA 1BZYA 2IDMA 3GRUA 4D4JA 4GRDA 3L6DA 3MUOA 4F4IA 5KPDA 1V8DA 1MV5A 5SZHB 4LWQA 4RM3A 5EZ5A 2WJWA 3CIFA 1T6ZA 4MV5A 2IH5A 3JQPA 5I7SA 1E58A 1V37A 1QGUB 2OTJB 2XCSB 3G9XA 3RU9A 4EHKA 2P4EA 1ECBA 3FNEA 4UHKA 2FP4A 2JJMA 2IZ7A 4BB0A 4E2FA 3LPCA 1YD7A 3OBIA 1UJ4A 4ETIA 1CUWA 9LDBA 3DEKA 3DUFA 3ZPXA 1FLNA 1T5DX 1GU7A 3RJ9A 2JS7A 2IXTA 3EG9B 1DCTA 4EI2A 2IHTA 3G0CA 5JYBA 2DQKA 3D6AA 4GPD1 5LBTA 3PUWA 4Q39A 1EYZA 4G4IA 4DDKA 4CT5A 4KOAA 5JI2E 1XYVA 3MHPA 2DTXA 1C3OB 4HNAB 4L4RA 4Z53A 1OZGA 3GZNB 1MF7A 1Y1SA 3DO5A 4MTLA 1JHUA 4WOJA 1OD6A 4B46A 3F47A 1JG1A 2Y0BA 4GL2A 2YV5A 4CLOB 3JW8A 4DMRA 1GGMA 4FFSA 3DR5A 1AMUA 5H9VA 2FR8C 4OXXA 2PRKA 3P2KA 1V8ZA 5BYAA 4F4JA 4TQGA 1PJZA 4DDMA 3Q8KA 3UA4A 5JALA 3MJRA 3TW8A 1D04A 1F9AA 3LECA 1J0AA 2VHQA 4A0FA 4OI1A 3AHCA 2UVDA 5FAXA 4B4UA 3H75A 3SS7X 1ECJA 4ER6A 4Z7OB 4NU8X 5EJFA 3WICA 1GZ7A 4HDRA 4DEVA 2HBRA 1N8TA 4MCIA 3SICE 1FJXA 3HKDB 3QA9A 3N5CA 3R2JA 4K9LA 3KE8A 3RTCA 1MXFA 4C0QC 4NULA 2EP7A 2P3QA 1HH4A 3WLTA 2O8VA 4TV9F 1ORIA 3RTBA 3P5SA 1W19A 2YVUA 5DBOA 2MJLA 4N7RA 2W2LA 1AQUA 1SQFA 1ONBA 5FNVB 3WKEA 5LSAA 4W5HA 3OH8A 5HFAA 4WECA 3TKAA 1Z0SA 2BRUA 2Q3MA 2DR2A 2Z30A 1FU8A 5LXTA 1EWTA 3P2YA 5B2EA 4Z7QB 1JR3E 4XYMA 4EKNB 3HDJA 2BFWA 2YFQA 4XI9A 1YDGA 5JQWA 4Q12A 1OFGA 1MTOA 5IRCD 3WMGA 4Z8YA 5I7UA 3KZVA 3QSYA 2B5VA 2XCIA 3AXTA 4DLWA 3F5MA 3U1BA 1THTA 2NVBA 3JQ6A 1C1DB 3ZZUA 1QLWA 1AKQA 2X15A 3CRMA 1ESZA 1DJLA 1L5OA 2BMEA 3KR1A 1BDJA 5G0TA 1YZUA 3ITKA 3SE0A 5F9FA 2P9CA 5FA8A 1OBHA 2BFBA 1KZ4A 2I2DA 4GMXA 4DZZA 1R0XA 4LNUA 2Q8QA 1IY1A 1E1QD 3C98A 2PYIA 3TBHA 4YROA 1Q86D 1NVBA 2QJRA 2VTVA 1G4AE 2WJGA 3CRRA 3LUPA 4LYAA 5AKGA 3FTEA 2PQMA 2WYVA 4HSGA 3KVRA 4FE3A 4DUZB 4CQNA 2AXQA 3SJBA 3U5TA 1PR3A 2VPWA 2HYDA 3EGIA 2Z4SA 5F1OA 4QXOA 1UT8A 3AP1A 3AKDA 5BSKA 1MHTA 2YOHA 3A9CA 3H2BA 3T4EA 4R0MA 1QQ6A 1OAOA 5KS2A 4TTJA 1G8SA 2B2NA 4ZOLB 2FPGA 2NSJA 3AF2A 4NZMA 5JAUA 3GMDA 3HXMA 1AUVA 1UMBB 3R3HA 4UPEA 1EGQA 2X22A 1FLAA 4UEJA 5J58A 3GQVA 5LNK6 4KW7A 3V8BA 3HH8A 4YT5A 1ISFA 5TMDA 2HRDA 3WDMA 4AF6A 3WWZA 3RS2A 4OP1A 4WWVA 3VVBA 2DBQA 4TTRA 1JEQB 3KSUA 3M4XA 1JDSA 2YNMD 3L0OA 4HATA 3G82C 4OQNA 4EFNA 4EDFA 5JJCA 3I9NA 1ZMRA 5JZ9A 4RD2A 3C1TA 4X7DA 4IEIA 3P71T 4G9EA 4QQRA 5CFZA 4X6LA 2D2XA 4J1TA 4U2FA 4PPNA 3WIVA 4HNTA 3ASSA 3LS2A 2IA5A 2ZIGA 3GWZA 1YMUA 3OQIB 4B3IA 5FBZA 3W79A 1U8CB 1E2PA 5B1YA 3DDCA 3CVJA 2R87A 2JFHA 2PUGA 1CD5A 1JJ7A 1I3KA 3Q11A 1PL0A 2GKSA 3F8WA 1OX6A 3QX9A 3CV3A 2QX9A 3FDJA 3JQAB 1IHPA 4KWEA 1Z28A 1W29A 2DX7A 4QRDA 3SYNA 2GSWA 2OWDA 1YKSA 3D8RA 3H9QA 3USCS 4TS9A 1CTQA 2M1ZA 5B3AA 3ROFA 3IALA 5FLYA 2C2MA 2WFAA 3O7WA 1IBCA 4HAOA 1UPBA 3OHSX 1TGVA 2FW9A 4RAOA 4GUAA 1FW6A 5EZ6B 2ONJA 4PZPA 4YAOA 3HUTA 3BWDD 2VT7A 1AKMA 4Y6PA 3PHIA 1EFTA 3H3FA 3KB2A 5GV8A 3BCFA 2BYTA 5KYNA 3AY6A 3MUEA 4BQQA 4RZSA 1SKUA 1RWQA 3K1YA 3S29A 821PA 5J23A 1P0MA 3IC5A 1Z7GA 4FYHA 1JT9A 4E4RA 1JSRA 3RYTC 1Z0KA 4DWJA 4QVJA 4EEXA 4J2HA 2WHXA 1FFDA 3NP7A 4LDRA 4DNXA 4X0CA 3K9BA 3GGPA 1MU0A 3PYMA 4I5IA 4EF5A 2H5JA 5ES4B 1I14A 1FDVA 2EWVA 5IULC 4M8KA 1Q1EA 3BMQB 4TZTA 2FR8A 5THKA 5J9FA 3FDIA 1V39A 1UPUA 2FUEA 3NH9A 4GWKA 1LW7A 1T3LA 2Y1WA 3KCNA 3D59A 3T3PB 2JFVA 4LF5B 1K7XB 2VZLA 2FFQA 3I9V1 1A9YA 1JNXX 1TM7E 2PH7A 4MB6A 4WX2B 5DNDA 5KQMA 3KJGA 1JZSA 1FSPA 3L49A 4JDPA 1MW8X 2WWXA 4P92A 4X7EA 1IHUA 3I5MA 2PT6A 4QOJA 4E1BA 1GNQA 1W94A 4EA6A 2Q1SA 4XQ0A 4R9NA 4YGYA 1PVVA 1LDYA 5H82A 5NULA 3O8OB 4CG3A 4BLRA 1O4VA 8AT1A 2Y1GA 3H2JA 4ZQBA 1AQJA 4W5QA 3H83A 4ATNA 3C8UA 1TJNA 1G8PA 5FO0A 1P5JA 2C95A 2EX1A 3NDPA 3QV2A 4JBNA 4GUDA 4KXLA 4M83A 3QELA 5ALJA 2KI5A 5K05A 3NR2A 1Q7TA 3IT3A 3LYUA 5TIIA 2QUJA 4EKIA 2JGEA 3HXPA 4KK4A 4UEWA 5AUQA 3GLFA 5JECA 5G0SA 3D31A 2HBYA 1ZOPA 1FFHA 1OJLA 1IWPB 4ZALA 2DZDA 1M0SA 4IDQA 4C21A 3STUA 5AJHA 2RGEA 1Y8RB 2BFEB 5HJ2A 1VSQA 5CIQA 3SXUB 3TOSA 1WTAA 1U7PA 1MABB 3QLVC