4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords MJ0495-LIKE PROTEIN
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
4M1KA 2H18A 5F3WB 1P6XA 5K8LA 1K8AD 1R4AA 2FGJA 3NHBA 4PC7A 1VQKB 5HZKA 1U2RA 4ZDKA 3IO5A 1J99A 3MJRA 5HZHA 1UKVY 4M9XA 3OE7D 3MD0A 5KNBA 4BLOA 2VSFA 5FBRB 4CVNA 1KSGA 4B3XA 1E2PA 1RJ9A 3QPWA 4RCZA 4C2UA 1KK0A 2QMHA 4G1VA 2GZAA 2GXSA 4D81A 1MOZA 1P62B 3CF0A 2WKRA 1KJYA 1UF9A 5CDFE 3TSWA 2IUTA 3NWJA 4LV8B 4OHZA 2X2FA 3P32A 2GK6A 1K8RA 1TF7A 4JSTA 4BGDA 1CR2A 3B1WA 3WMGA 2ODEA 2BBTA 3BXZA 3LAWA 4AG6A 1G7SA 4LYAA 1SM4A 1XXHB 1ZINA 4NONA 5SZJA 3J81k 1JXMA 2F1JA 5JRZA 1ZC4A 1SQ5A 4RJLA 4D0LB 1YHQB 4NCNA 1VQLB 1E2QA 1OHHA 4PC1A 1TNDA 1XBTA 3SJCA 3U44B 4RD1A 1L4UA 4DEYA 3EZ2A 3KQNA 4TLAA 2B7BA 4LPKA 1XTJA 1G5RA 1HUQA 1KK2A 4GFDA 5LDDC 2QSYA 1NBMA 4A8JA 1ZD9A 4UQOA 5B57C 2B6HA 5L3QB 2XGJA 3UMFA 3QQ5A 3OAAA 5JWOA 1NKTA 3TRFA 1SQRA 4LJ8A 3K0EA 4H1VA 4IXNA 4S35A 4LBYA 4BPRA 3M0EA 4LDJA 1EWRA 2YHSA 4EUNA 5DNYB 4GZMA 4P4SB 3DZDA 2BCJQ 3WYFA 3ZIAD 4LYFA 4OI0A 4F7DA 3E20A 2HT1A 1RRFA 4W5JA 4D2IA 3JQPA 2ZYWX 4JIMA 2QI9C 3LX8A 4DT1A 2BHRA 4JLPA 3ZS8A 4D6PA 2BM1A 3VKGA 2J45A 2QROA 3A37A 1KHTA 4V0MA 2OILA 4WVFA 3FMOB 3AVYA 3U4QB 3A4LA 2IHYA 1ZUHA 2WMNB 2IS4A 4X8HA 3UATA 1T5LA 5A5GA 2PMDA 3CCSB 1KI4A 4V03A 3K70B 4A2WA 3KB1A 4BLPA 4ZCMA 1YRAA 5JS8A 2X8AA 4C7OB 1E99A 4TZ6A 1GJRA 4V0ME 4LV6A 5FFMA 1NJID 1US8B 1DDGA 4D4JA 1LY1A 2QRZA 1DBSA 3CX6A 2IXGA 3WBKA 2D4HA 2QMEA 1I7PA 5P21A 1IONA 3ADKA 1N8RD 3HR8A 4KU4A 1GL9B 1NY5A 1RYHA 2G1KA 4XD7A 5FPTA 5J4LA 1TEVA 4B3BA 2IK8A 3N2IA 5C18A 1GITA 4RY2A 1U99A 3CNLA 3BERA 3IPXA 4PHGA 5IHPA 3A4NA 4M9ZA 1DG1G 1FNBA 2G6BA 2QM8A 1RYFA 4CT5A 3LDAA 5JCZA 1SKQA 3CRZA 1S3GA 2A7QA 1BJKA 5GV7A 3WNCA 1SGWA 4DCUA 2C99A 1PLKA 1OFHA 2OCAA 3MRSA 5CJPA 5DYGA 2RGEA 1CKEA 1IJFA 3WMFA 4DEXA 1E0KA 5UKDA 4A9AA 5FOTA 1VQ9B 1IY2A 1ZYUA 3HJNA 5L3RA 2PX3A 2ZU6A 1VYVA 2QG6A 3KKNA 4BZXA 3W2FA 3ND9A 3LNCA 4FN5A 4DLZA 1VIAA 2PCLA 2CNDA 4HDCA 4PXAA 1G8GA 2FPMA 2ZSEA 3OEHD 2BN4A 2ZROA 2VP0A 4FINA 5E7MA 2O8DA 5FBWB 5DI9A 1R0WA 3A8TA 3AGPA 4B44A 3T06B 1IXRC 3D3QA 1VCMA 3GLGA 2R6HA 1E2KA 1E6CA 3CF6R 1J8YF 4HZUA 3UWKA 5FL3A 721PA 1COWA 5TMPA 4G5GA 1Z0FA 221PA 4WOPA 3W8RA 1R6BX 1ZRHA 1MRSA 5AUOB 4HUQB 2P3SA 4MYHA 2ZRMA 5KOYA 1KI3A 2BBSA 3C5CA 3L2OB 1ZCBA 1NSTA 5ELXA 4Z1MA 1UKEA 2IW3A 4XOIA 4RZ2A 1W35A 5JS7A 3PEUA 2ZXUA 3B85A 1OJLA 3QEJA 4Q7LA 4BEJA 1QVFB 2REBA 4DVGA 4A6PA 1DO0A 3A58B 3OZXA 1DARA 1IB0A 3V76A 4LBWA 1OE0A 1KI9A 1YZTA 4Q5IA 5KDLA 3H1TA 1WQ1R 4A0HA 4HYYA 1ZNYA 4M0LA 2C9CA 4LHYA 4LX0A 3PFIA 4NP6A 4EPVA 1Q12A 3SHWA 2JJ2D 2VHJA 4BFWA 1P60A 5KPJA 1W2GA 4YLGA 3ICQB 4X8MA 4TQUS 4V0KA 3K9HA 4Q03A 3CBQA 1G3MA 2QDXA 3B2EA 4C0KA 4E07A 2A2ZA 3PEYA 4BEBA 1J70A 4Q9IA 2DFTA 2CLSA 3FYHA 5DYIA 3BH0A 2NO1A 4GI7A 4Q48A 2ZR0A 4GRAA 3V4FA 1HEIA 5SZKB 1OXUA 1EP3B 4JYBA 2P6NA 4RFSA 5TB5A 3HYTA 1EWQA 4RD3A 1KO1A 2YZ2A 5J40A 2IF2A 4TYYA 4MKGA 4G5OA 1EXMA 4TLBA 3TGPA 1YZLA 4DQKA 4KXFB 4OKSA 1KI7A 1NBMD 1XRJA 2RMKA 4DWJA 1OKKD 2WJIA 4TTQA 1XD2B 1GSIA 4EJSA 3C16C 2JASA 5KTYA 3GLHA 3SJZA 2WZQA 4CZ2A 1EFRA 3SI7A 1IXZA 4XTRA 2GEUA 4B32A 2GXUA 1F2UB 121PA 2EFEB 1Z2AA 3AP1A 4PPNA 2QY9A 2G88A 2RGGA 3ZIAA 5AJYA 3UXMA 5EJEA 1P75A 3ES9A 3G82C 3ZQ6A 2GEDA 2Z6VA 1AM4D 1HT2E 2MMGA 5ANRB 3THWB 4F93B 2FSIA 5SZHB 1XD8A 3E5HA 3EIHA 3EC2A 1L8QA 1P9RA 2IEZA 1QGYA 2Z5FA 3GJ5A 3PITA 1SXJE 3L0PA 4DLYA 4Y9RA 2P65A 4C30A 4ON9A 4PC6A 3B9QA 4GOJA 1LF5A 1YRBA 1KQSB 3RS5A 1N2CE 4PC3A 1KDOA 3UWOA 5KU1A 1LVGA 3OJXA 3TMKA 1XEWY 1PVOA 5BWMA 2VH5R 2ZYUX 3AKEA 4HUQA 1LFDB 1KTVA 2IYWA 1Q1QA 2EFGA 3QKTA 1T3SA 4BE7B 3TW8B 2IA5A 1E9SA 2CK3D 1W44A 2CEAA 3JVUA 4JJZA 4A0RA 2QE7A 3BOSA 1II0A 4UXIA 5JCPA 5H1YA 1VG0B 2GCPA 4FXPA 4OI2A 3DKPA 4DDUA 2XZPA 1Z5ZA 4ZKEA 4EAQA 1EK0A 2R62A 3THXB 1EFHA 4LC1A 5G41A 3D7MA 4M1SA 3ZVMA 2QGZA 2JGNA 1NVXQ 3N5CA 4KLNA 1FX0A 1P7CA 5CIQA 3K0CC 3K8YA 4U5XA 5EP4A 4AWXA 5EXXA 1EFTA 5L3SB 2GK7A 1D2MA 3ND8A 3W5HA 3EAQA 3I32A 1ZM4A 1RW4A 5JEEA 1M1KD 2J46A 2JLRA 3EPHA 1VG1A 2YWFA 3W3AA 2GA8A 3EIQA 1MO5A 1OXSC 2VF8A 2W2VA 4TL9A 4KVGA 1NJFA 1WA5A 1SVKA 3LVRE 1P72A 2ZANA 3AVOA 5FOSA 5FUYA 2F3TA 2BMFA 1GDDA 4DLWA 2HYIC 2ZRFA 3VR2A 1KGDA 4B34A 2JJ8A 4PO8A 4HAVA 1KNXA 3I5XA 3A4MA 2WWHA 4NE2A 1XNJA 4HI0E 1TU3A 4L4UA 1RVDA 3OIWA 4MRVA 2OXCA 3I62A 1F20A 1JAHA 3LD9A 3MG9A 4MITA 3U3KA 5CK5A 2NIPA 2HUPA 2LP6A 3GLHB 1D9XA 3Q72A 3THWA 4D4MA 2R6CA 3K70D 3AGQA 4URUR 4C7OA 1FNDA 3WMEA 1ONBA 1P5ZB 2FV8A 2ZR7A 4KODA 3PQCA 2JATA 4JVSB 4Q47A 3FFBA 2C98A 3TE6A 2FFHA 3ZBTA 2CDNA 4UAJA 3A36A 5TR9A 5IRCD 5JSZA 3TLXA 2DWOA 2FSHA 3A1TA 5EZ6B 4B6FA 1ZU4A 3WNDA 4OK3A 3EPLA 1Z07A 8OHMA 4I1SA 4DDWA 2AHOA 2IYLD 3CD6B 2GETA 3GFPA 1CR0A 3F3YA 3I61A 5IT5A 5JJLA 4QGAA 4DCSA 2R8RA 4LBVA 2A30A 2GVZC 4FD2A 1MKYA 2FF7A 4MUBA 3EPKA 2ZRKA 4DJTA 4YMUA 1XJCA 1GL7A 4EFLA 2NTYC 3KTAA 1ZBDA 1WB9A 2Q3FA 3GLGE 4ABYA 4AF6A 4HB3A 4HAUA 3Q8XB 2YYZA 2W6IA 5JEDA 1VQ7B 1FNCA 1KMQA 621PA 1KO4A 2OSBA 3AF4A 5JLJA 3JZAA 3FOZA 3QE2A 2BEJA 1YJ5A 3ZLJA 3OE7A 1VYTA 3K9LA 2HDNB 3GMTA 4JLAA 1X6VA 5DHFA 4IOJA 2NO9A 1F60A 1G16A 1C1YA 3KJGA 4B74A 3R8FA 1T8TA 3TVTA 4QJ3A 3GJXC 4QKQA 4IFEA 5BYKA 1P2SA 1HT1E 4PX9A 2CJWB 1JNYA 2IYYA 3AB3A 1ANKA 3QXHA 2B5OA 2ZRNA 3CB4A 3FE2A 2PLFA 2A5FA 4TWZA 4PHFA 3K53A 1Z0IA 4HAYA 1NLYA 4K81B 2CCKA 3R8CA 5CB8A 1Z6GA 2QQ0A 3NKVA 4NDZA 3DZ8A 5GV8A 1QHNA 2CXXA 1N25A 1W4CA 1W48A 3EA5A 1GO2A 3FHOA 1QH0A 2J59A 4QRHA 4S2EA 4TYQA 4PGOA 2QAGC 1PLLA 1FNMA 2D06A 5FPSA 1N5JA 1Z2CA 3I73A 4KFUA 2FGKA 3OF5A 4DLSA 2XZOA 2JLZA 2KI5A 4ARZA 2JLWA 1K9MD 1OXVA 3QIAA 4TLCA 4P0TA 1S0UA 1XU4A 4HSEA 1CJMA 4TQ9A 4A36A 2QTHA 4Q18A 2RGNC 1A82A 3M1IA 1YU9A 3IBYA 3KUCA 1JALA 1GKUB 2Q9BA 4TT3D 3UK6A 3QOFA 1RC8A 5L3SA 2PJRA 4TLEA 4B73A 3NC0C 1SXJC 4BFYA 4BFZA 3GJ6A 4NHOA 4URVR 4ZDJA 1N6NA 1CJVC 5J47A 3L8YA 1KO7A 1TLLA 1RRPA 1W4AA 1M6NA 1GAWA 1DDIA 4A82A 2D7DA 3K0AB 2CK3A 4OBEA 3MCAA 3BE4A 2Y8EA 1E98A 2IYXA 4NCHA 5GJVC 3SN6A 1IN8A 3NBZC 2F9MA 4LJAA 4V0NA 2GJ8A 1KMHB 2P2LA 1M34E 5GADl 1VG8A 2C2HA 4HEJA 4PQYA 3UMRA 4H1UA 4MYTA 3IIJA 4B75A 1Q57A 4Q1AA 4M4SA 3CXCB 2XEXA 2I1QA 3VR6A 2RGDA 2A5JA 2BMWA 2YOFA 4LUCA 3X2SA 3SBDA 2ZJ5A 4TMVA 4MRRA 1VECA 2FOLA 2LKDA 1RIFA 2CNWD 2XX3A 2EU8A 3I55B 2QSZA 2Z4RA 3DKVA 3DMDA 3GEEA 2QM7A 3LO5A 3GPLA 2VNHA 2Z0MA 1W5TA 2DFNA 1ZU5A 4M1OA 1HA3A 4J0QA 1HV8A 2IYSA 2ZRBA 3AH8A 1WXQA 2BBWA 2KSQA 1V5WA 1E2FA 3LW8A 2Q9CA 2XNSA 2WJYA 3CMEB 4MRPA 3TAHA 1GAQA 1GNQA 1NP6A 3VNUA 4BFVA 4A92A 2O8BA 1QHHA 4P31A 3TKLA 4Q4LA 1QHSA 1V43A 5EXPA 5FUXA 2QTZA 3PIRA 4Q1EA 4QXAA 2QEXB 1XFAA 1GP2A 2L0XA 3CM0A 2QT0A 1J7KA 1KKLA 2FPLA 4GSYA 2ZSDA 1G6HA 3CRW1 5EXSA 5J5CA 2WWFA 4KITB 3QXSA 3IHWA 5FPYA 4YHBA 1CNFA 3CCEB 1SZPA 4L9WA 5CDFA 4I81A 1BMFA 4KBFA 4KSCA 2WVJA 4QBGB 3SBEA 3CNNA 1LF0A 4RKFA 2IS6A 3DOEA 5CLLA 1G19A 1KO5A 4OHYA 3QNUA 2PZFA 3LO8A 2X19A 1KJZA 1SXJB 3S1AB 3FHTA 1KSJA 1H85A 2B7CA 1NY6A 2V4ZA 3TR5A 1IOZA 1E2IA 1QHXA 4IVQA 4M22A 1Y3AA 1JAIA 3KQHA 1E2GA 2QAJA 2F7SA 5JI2E 5JWRA 3KFVA 4Q4JB 1TQ4A 4P4SA 3B1XA 1Z0DA 4Z51A 4JKIA 3I92A 5H59A 2VA8A 3LA6A 3GFOA 4O0MA 4UNSA 5EE1A 3W90A 4LRWA 1II8A 3U61B 1Z08A 2LCFA 5JHHB 4ESVA 4FK8A 4NZYA 3B13B 3SQXA 3BB4A 1H65A 5CIWA 3HPRA 1S72B 3CX7A 2W6ID 5IDVA 1N5LA 5TXGA 1CJKC 1AS3A 3AF2A 5C1BA 4IKEA 3NBYC 3B8HA 4MKHA 1ZNXA 4Z54A 1NN3A 2J0UA 4AURA 3T1QA 1YJWB 3TUIC 2PH1A 1TUEA 4Q9HA 4L9SA 2Q6TA 3REFA 4BWYA 1A5TA 5D3MA 1T91A 2BC9A 4D80A 3BC1A 1ZD1A 2BSAA 1G8HA 2VP5A 2XOKD 1QUEA 3ZH9B 4XTCS 2F1RA 2BGIA 3WP0A 2RKOA 4HAXA 2RGAA 2C9YA 3MJHA 1T3HA 5EUQB 3X1DA 3B1ZA 4DSTA 4WQMA 1VIYA 4B3CA 2B8WA 4NCJA 4II7A 1CF4A 3A1UA 3RS2A 1P73A 4B4DA 1N6RA 4MDFA 5LBIA 3GLIB 5FR1A 1R5BA 3TQCA 2RGCA 1JQLB 1NN0A 1OGIA 5DN6D 4OL0A 2FZLA 1R0XA 4PR0A 1KSFX 4GP7A 5A0FA 1HTWA 1UM8A 1UPTA 1GM5A 1JPJA 4HE6A 1NI3A 3LLUA 3LX5A 3OHMA 1DAEA 3UIEA 1JECA 4DXAA 2ZM5A 4AKGA 3VNVA 3GLIE 2C9OA 5CM9C 2O8CA 3BFXA 1I2DA 5E7JA 5LD2B 1YKSA 2R2AA 3KXKA 1R7RA 4XSHA 4Q1FA 3MMPA 3TBKA 1E1QA 2QP9X 3DMNA 2NO0A 1IJEA 1VQMB 1DADA 1ETUA 3SQWA 4GZLA 3TSOA 1E4YA 1U9IA 3KJHA 5JJKA 3AVWA 1E0AA 3IDQA 2FX3A 1Z6AA 1XF9A 4Q21A 2RGBA 2SHKA 1GUAA 2GTPA 2WJJA 3BS4A 5E7IA 1OH5A 2ATXA 1UEJA 4N0EA 4CDGA 4US0R 4GT1A 1G5TA 2ZUCA 3QKRA 1SVLA 2WJVA 3B1YA 3ICEA 2BDTA 4DB4A 3RS3A 1C4OA 1YHNA 4TTRA 4OQLA 3L43A 2GCNA 1NN1A 1W0JA 4LJ6A 3AEZA 2ZSBA 1BH2A 2P5SA 2C95A 2VNIA 2NOAA 2IF0A 2G9NA 2DB3A 5DI3B 2YWGA 1T4GA 3RHFA 1JI0A 1G4UR 5FTNA 1G9XA 2R9VA 4DLTA 5JMTA 3LW7A 3WHLA 3ZZTA 5BYJA 1KK3A 3NDPA 2VSXA 3CCLB 3AVQA 1Q81D 4JVNA 4L16A 3U6BA 4M8NE 4V02A 3AKDA 3GCGA 4KI0A 4PPQA 1QHHB 1UBGA 3H2YA 3OJWA 3VU9B 2YKGA 2G83A 3QPUA 1XXHE 4CF7A 4A8JB 2VQSA 3BBPA 2O8FB 1XMJA 2LWIA 4EPYA 3FMIA 4W7SA 3U60B 4Q7JB 1NF3A 4EPWA 1WBDA 1DS6A 1P2VA 3E70C 4NMMA 1TVCA 4QOSA 3CRMA 3LQRA 1JA1A 3EX7C 3LQQA 4LHWA 4TMKA 3SNHA 1QZXA 3H0KA 4C0BA 1P9WA 3Q85A 2OT3B 1OYYA 4EIWA 2JDIA 4XWKA 1WCV1 1QFZA 1FMLA 1A7JA 2H57A 3P26A 4IDNA 4LHXA 1ZM2A 1NVVR 2DYKA 5FOXA 4A6XA 4CEJA 4Q4HA 1Q86D 3CPWB 2V3CC 5DISB 2IWRA 2O8DB 1BMFD 2ZRCA 3KKQA 5C4GB 4DIDA 2H17A 1ESNA 2TMKA 2BKUA 3ZD6A 4MRNA 3QUSA 4ARZB 1F6BA 4PFSA 2GBLA 2FDCA 1J2JA 2E87A 1TF5A 2V7QA 4TMTA 4CIDA 3RRYA 1J90A 2ZJYA 2C5LA 3P4XA 5HTKA 1TMKA 3NHAA 2D62A 2X77A 4OK6A 1XE1A 3X1ZA 2O8EB 4QNMA 3BD9A 4F7WA 3IKJA 3QI2A 3U3RA 1HQYE 4YXWA 4F4JA 4KAXA 4YDHB 1NIJA 4M1TA 5EE0A 5K8TA 2PZEA 2R6AA 4YALA 3W5VA 4WZAE 3RRZA 2VNKA 1XTQA 2JJ1A 3AF0A 1E2MA 1NVWQ 1N6PA 1TF2A 3U7FB 2ASEA 4AIIA 4YQFA 4KBGA 5FBLB 5JHGB 3BFVA 1VQ5B 5HCIA 1R0ZA 1MH1A 3IPYA 4ZV4A 4UKDA 5EXTA 3ADBA 4TSFA 3T15A 1OH7A 1W36C 2BGJA 3A1WA 3O8CA 4Y0AA 2Q9AA 1OB5A 2O0JA 4PAMA 2QORA 2BEKA 3ZYCA 1P2TA 5KNDA 1H42A 5JBQA 2IYZA 2H8KA 3U2QA 1W36D 5J4KA 1XEWX 2GAAA 5LB4A 3OIYA 2GPJA 2IT1A 1NG1A 2CLDX 1X8KA 2IS2A 4DSOA 4B71A 2O5VA 2ZE5A 5FBQB 1I4TD 3VU9A 1BQEA 1JR3A 2ORVA 5KO2A 1H8EA 3FMPB 3CW2A 4NYJR 1G7TA 2CJWA 4PSAA 1K5GA 2GF9A 4P32A 1CEEA 2IHBA 4KYIB 3DL0A 1PUIA 2YNMA 5H5JA 2GXQA 2GZDA 4A1FA 4OHXA 3W6OA 5LB2A 3RRNA 3RSOA 1A4RA 3QKRB 4A8JC 1OHHD 3SE0A 3QE0A 2FZ4A 3FVQA 3CCQB 2WBLC 2DETA 4I1UA 1GOTA 2CVHA 4QFMA 1R2QA 2B21A 3M4YA 1KDTA 3AP2A 3KL4A 4JLDA 1PUJA 2OAQ1 1G3QA 2VSOA 1NBME 2W58A 1GKIA 1L7VC 2ZSFA 4PAOA 2CBZA 2X3UA 4R98A 3K09C 5AUQA 4B2LA 1FRQA 2R65A 2WWYA 1E1QD 1E96A 3FWYA 3JVVA 2QN6A 1XD9A 1XTRA 2GEVA 2ZIAA 2BWJA 3IHLA 4X8LA 5KUTA 2QU8A 1YI2B 2WOJA 4FMCB 4FMCF 4DLUA 3L0SA 4NL4H 5DLQC 2MMCA 1P9NA 3HPQA 3T35A 4DCNA 4EQ6B 2IX3A 2ODWA 4QNRA 1GL6A 5FA6A 2C96A 2G3YA 2KBEA 4E03A 3C41J 4BRUA 1JB9A 2KBFA 4UNNA 5FUWA 1OYWA 1NDHA 1W5SA 4UNRA 1HH4A 1P4SA 2VHUA 1ZP6A 2XNDD 2QTVB 1KY3A 1N6KA 3O47A 5J4VA 1VQ4B 4NTZA 2QE7D 2WHXA 4PSVA 3LXRA 5BN5A 2ORIA 4FCTA 2FG5A 1OIXA 2CHGA 2CE7A 5DO9A 2H16A 5FR2A 2F3RA 4WW0A 3KKPA 5E3HA 3IQXA 3AVTA 3ZVRA 5JZVA 5D3MB 3I3SR 2AL7A 1RE0A 1QG0A 4QC2A 2ZI7A 4AYWA 2ZJOA 1IQPA 1XEXB 2IC5A 2AFIE 5F9HA 2WJHA 2EWVA 4IOKA 3WP1B 1O87A 3EPJA 4OJKA 3VR4A 3A1VA 2C8VA 3EWSA 3WY9A 5FUVA 1FMJA 1VPLA 4CYMA 3GEIA 3PUVA 2ZI4A 4QM7A 1E2EA 3GJ7A 2FSGA 1KIMA 2IYUA 3R9WA 1ZUIA 3NH9A 4IOMA 3T12A 1OIVA 4KFRA 5JI3E 3GLGB 1TQ6A 1P3JA 4XD7D 2HXSA 4NCKA 2C78A 1Z06A 2ZYVX 1B0UA 4JLMA 4U7DA 2ZQ5A 3W2HA 4DRZA 1EFCA 1GNRA 3VX3A 2QTFA 2YC4C 4RCYA 3UMSA 3ZJYA 1K5DA 1N0WA 1S96A 2D7CA 2QENA 1G6OA 4XIGS 2GZHA 1Z0AA 3CKLA 1EWYA 3LWNA 1H8HD 4LPSA 1E64A 3HP1A 3SZRA 2JEOA 1Z3IX 4HZUB 5KSZA 4PO1A 2LKCA 3TUJC 1OT3A 3EZ9A 3H4MA 1SVIA 2IEYA 2F1IA 2Q21A 3G4SB 1U8ZA 2K5UA 5HE9A 3RC3A 3V9PA 2F55A 1UADA 2EIXA 3QFCA 1GWNA 4L5BA 6Q21A 1KAOA 1SXJA 4YAOA 2H5EA 1G41A 3F8TA 4UNPA 2FEMA 1G7CA 1DAHA 4HAZA 2A5YB 1E94E 3B7GA 3FHCB 1VCOA 2PEYA 3EA0A 4Q9KA 2OO7A 5KHOC 5FL7A 2J7KA 1FP7A 1K73D 2KJQA 1Z6XA 2ZTSA 4EPXA 2QA4B 1CXZA 1DO2A 4RKEA 3U5ZB 4MKFA 1AS0A 5C46F 4ZI3A 2OZEA 4B48A 1XP8A 2ONKA 1KI6B 2QAGA 2GNOA 1WF3A 4FCVA 4JL5A 2XTNA 1AGPA 2N42A 2Q3MA 1US8A 3MAAC 1YJNB 2OBNA 3C5HA 1T0HB 3NEJA 4GBMA 4EPTA 3V4RA 1QHIA 1QVAA 4O3MA 5EMNA 4BUJA 3RRMA 3NTUA 4Z1MD 2BKEA 2JJ1D 4R2IA 1QHYA 1E1RD 3ZD7A 4Q02A 4Q1CA 1E4VA 1K6MA 1ZCAA 3B9PA 2AWOA 3KDSE 1TU4A 3B5JA 4C2TA 1ZNWA 5TV2A 3WXMA 1CU1A 3O8DA 1NMZA 1XD2A 2A9KA 5DE3A 1U0JA 2DR3A 1ZMXA 4TLDA 3CLVA 3CCUB 1SKYB 4ZCIA 3C14C 3SYKA 1M74A 2ZRHA 3MGCA 4KFTA 3HU1A 4XWAA 4Q19A 2GJAA 5DI3A 5FI1B 4DC9A 4NBSA 2W6JA 2AX4A 3JQRA 4K8OA 3W8NA 4G5SA 5CJ2A 3AF1A 2QMUA 2WWWA 4WXPA 2AD1A 1JR3D 2Z43A 2D74A 1W87A 2BBOA 3L0IB 1QFYA 4ZGNB 2XZLA 5JWHA 1Q20A 1DAFA 3AUYA 5KPDA 5IK2D 4U00A 1U8AA 3QG1A 4JBYA 1EFUA 4IVPA 1D1NA 1TQDA 4NCIA 3QXJA 1UBFA 1U98A 4RFSB 3O8BA 1DAMA 1UMKA 1CTQA 2RCNA 4O2RA 3M6AA 3EG5A 4US2R 1TADA 2REOA 3SFVA 2NQ2C 3ADCA 1GNPA 1T0JB 4D0GA 1OFUX 1FP6A 1I4DD 1FQJA 1GVNB 1HE8B 2XOKA 4KYUA 5FOVA 3SJBA 1KDPA 2QQEA 3BH7A 1KK1A 2MSDB 2W2XA 1X1RA 2DWQA 4JKYA 1AS2A 3RS7A 1Z47A 4LI0A 1TL7C 2H92A 1M8PA 4TN1A 2QPAA 2OV2A 2D3WA 3P4YA 2GXAA 1VKJA 2JLVA 2HEIA 2N46A 3RS4A 3R9IA 2I4IA 4YONB 2IXEA 1TEXA 1KI2A 1FX0B 3CR7A 2PL3A 4CGZA 4F4IA 4M1WA 4BFXA 3SOPA 4RD6A 3X1XA 1G8PA 4LWZA 2NO6A 3I72A 1II8B 3EXAA 4W9MC 5JRJA 3ZZUA 4RD0A 1G18A 4Q4HB 1NMYA 1E9EA 1X8LA 4URYR 5DIFA 3TVDA 3CC2B 2OCPA 2ZI3A 1P61B 4Z8XA 4LSGA 3KB2A 3CUEF 1XPUA 4JLNA 5JFGA 2B92A 4ERNA 2VPPA 1E2NA 2PBRA 4W5WA 1E62A 1F5NA 1XCMA 4OQMA 2BF4A 2HF9A 1CIPA 2WIBA 1Q1EA 4P3YA 2GJSA 2HV8A 2OESA 4G3XA 3U7HB 1QF9A 2UZIR 3KJEA 4PO9A 5EE5B 1Q82D 1ZW6A 3MWLA 2OHFA 1A8PA 1E9RA 1DEKA 4OQFA 4IHQA 2CE2X 1CNEA 5HKKD 2P0EA 4LJYA 3WHKA 1ZUNB 4A2PA 5DGXA 2ZAOA 1LV7A 2AFHE 2R6FA 3CZPA 1F2TA 1G17A 3R7WB 4E22A 1AJEA 4PANA 3ASZA 1UKZA 3VKHA 4IDHA 4JLJA 2WWGA 2HCJB 3ZQJA 4YMVA 4ZO4A 3NDBB 3OESA 4YAFA 3W34A 4A0GA 1U8YA 1MT0A 1W0JD 3D8BA 3QG5A 1DE0A 3NBXX 4LC0A 1E9FA 2PIAA 1AQYA 2FU5C 2V55B 1QVRA 3OEED 5B58C 1HY3A 2OAP1 1GG2A 2J1LA 2BIFA 3QKSB 3SHFA 1G291 2XXAB 1H8HA 3W2IA 2OBLA 3SS8A 2OBMA 3HU2A 4DSUA 4QGHA 4CEHA 1OW3B 2CL0X 3CO5A 3QBTA 2GRJA 4NPHA 1KJWA 4CRWB 5EUMA 4HUTA 2HMAA 4OHWA 2F43A 2DCUA 2C04A 1UJ2A 1W47A 3AQ4A 1E9AA 4OHVA 1DAGA 2CRVA 2ZRLA 2FFAA 3IQWA 5EE9A 3UG7A 1SXJD 4G01B 5JSZB 2VYFA 2J5XA 2XB2A 4IVRA 4FWTA 4FW9A 4HLDA 3QKUA 3Q9LA 3GJ8A 4YAWA 1Z22A 5FOUA 2WJGA 3FJOA 2IUSA 1AIPA 4LJ9A 1E79A 3L8ZA 1T5IA 1TAGA 2XB4A 2ZEJA 4WA7A 3FMFA 4IDOA 4TZ0A 1XMIA 4RD2A 2OCBA 4JJKA 1MR3F 5LPNA 4HAWA 1QGZA 1BOFA 4DB2A 2PT5A 1UEIA 2PJZA 1EX7A 2OXRA 2E9SA 4LHVA 4PZZA 2A5DA 3KXLA 4WZ6A 4K1XA 2ZVQX 5CM8B 2ZSAA 4LHZA 1JPNA 3NBFA 2RB4A 4OYHA 4CT4B 1E1RA 2F6RA 1UDXA 4EJSC 3P1JA 2BMEA 4C4PA 1G3IA 1FNNA 2VLIA 4LJ4A 2OFWA 1NVVQ 4LYJA 2CVFA 4R9UC 2NZ8A 3C7KA 4UNQA 2NO7A 1E2LA 1FOEB 1LS1A 2H1LA 1UAAA 5FBVB 3HWSA 3LXXA 4PAQA 5FTLA 2PX0A 1U94A 2QP4A 3EZ7A 2ECKA 2ODBA 2QGNA 1CJUC 2R6DA 3I1FA 1ZM9A 4JT4A 1R8SA 5KDDA 2F9LA 3ETLA 2FFBA 4N3NA 1Z29A 4JLBA 4BLSA 4POAA 2XTMA 2ZYTX 3AVPA 4PPFA 1LTQA 1YR7A 4I1OA 2CLCX 2J0QA 2HT6A 3TAUA 2VHQA 3RWMB 4TSFD 4GMDA 4L8GA 4BLRA 4TL8A 2XJ9A 2IS1A 4Q01A 4B3FX 3PENA 4QBFA 3W2GA 5HXBA 1DVRA 3GP8A 4M21A 1Q0UA 3KKOA 3VFDA 1DPFA 1SVMA 2OCYC 2GHIA 4AC9A 3QPVA 5AUPB 3A6PC 1KDRA 1VTKA 1BKDR 2WWIA 2CL6X 2QEQA 3F5FA 4OI1A 2CCGA 1KAGA 1XB2A 3U3JA 2G0TA 5B64A 2DEUA 1FFHA 2VYQA 2WSSA 4A0FA 2WPDD 1KSHA 4RZUA 2ZRPA 3PV0A 1AZSC 1XZPA 4MGIR 3QVUA 1GTVA 4Q4AA 5AK0A 3RSLA 1KZ7B 1YIJB 1XCPA 4MGKR 4NH0A 1Z83A 1JEEA 1S4QA 4UXJA 3IIKA 4AG5A 4EFNA 5H68A 4DCTA 2DFKB 4EPRA 2ZVPX 2X2EA 4HB0A 3S1AA 2P67A 2XJ4A 3IILA 1Q21A 4NYJQ 5CLQA 4IFBA 1XPRA 4DKXA 3PG5A 1X3SA 1O3YA 4D82A 4DZZA 3DO6A 3GFTA 2W0MA 1IN6A 2OLJA 2ZPTX 4UXHA 3BRWD 3W5IA 2J3EA 4GP6A 1N6IA 1XEXA 3K9NA 4OK5A 1CJTC 1AN0A 3NG1A 1W2HA 1AK2A 2V54A 4XWOA 3LY5A 3ZBUA 3I5YA 5HKKA 4GDFA 2YVUA 1TX4B 2BJVA 1Z0JA 1NMXA 1W4BA 1JJ2B 1FTNA 2GAOA 5TVKA 1AA9A 5CITA 3SC3A 2XSZA 4JZKA 4B33A 1M7BA 4KLZA 2HCBA 1NNEA 1Z8FA 1AMOA 1E9DA 5AWFC 1CR1A 4IJMA 4HZIA 4C0QC 4XSGA 4DQLA 1OLOA 3KTAB 2FE4A 3TSZA 3RWOA 4C0LA 5A4JA 3IUYA 2GKSA 4B3DA 5HPYB 1JXOA 1L2TA 4DDTA 3GEHA 4MYCA 2VBCA 4U9UA 3HR7A 3VAAA 2QTLA 4KVAA 1YR6A 2CCJA 1U81A 2EFCB 1NRJB 4Y0VA 4GOKA 1EG7A 1FW6A 1VCIA 4ZDIA 3TH5A 1TQ2A 3PEVA 2ZJAA 1LS6A 3T61A 3MUFA 1VQ8B 2JAQA 2KWIA 3BJIC 4R2HA 1UBEA 1XDBA 2OLKA 3CCVB 3VHXA 4LY6A 4LOAA 5FTMA 3RLFA 4PZLA 1WMSA 5HCNA 4PC2A 2IXFA 3K0AA 1UBCA 4IRUB 3OEHA 1XX6A 1Q22A 1HYQA 1IBRA 1ZIOA 5EP1A 1MABB 1B23P 2VNJA 1N6HA 2IWHA 2QPOA 1OFTA 1XMVA 3IO3A 4KFSA 2ONJA 3FGNA 1W36B 2ERXA 3PCRB 2V7QD 3NEYA 1NG9A 4M9SA 1IM2A 1SULA 1T8UA 4MYUA 3RANA 1BS1A 1E69A 1HURA 4XVUA 4B47A 1KD1D 1COWD 1KY2A 4MUAA 3OIUA 3E1SA 1CR4A 4CW7A 3T5GA 4BPBA 2VO1A 2WAXA 3THYA 1U9IC 3P20A 3TJZA 3T34A 1RZ3A 3TIFA 2ODNA 3W5UA 1JB1A 4IW3B 4LV5B 3W6PA 3O8RA 1R8QA 1N3BA 3K9GA 4BASA 1XXHA 1G1MA 1OSNA 2VEDA 2X1VA 3BAFA 4G5QA 2B8TA 4YMSA 2GCOA 3SR0A 2FA9A 3VR1A 1CLUA 2J0SA 4HDOB 4DCVA 4DUGD 2WV9A 2NG1A 3GJ4A 3IBGA 3KZ1E 4ZI2A 3DM9B 2JLSA 4MGZR 2ZUDA 2RHMA 2WSMA 4AF7A 4JSYA 4O25A 5KSOA 1ZJ6A 4PPGA 1DG3A 5AN9A 2ZJ2A 1KOFA 3IIMA 4M9QA 1G64A 1Z63A 4JL8A 1KNQA 2AKAB 3GJ3A 3MHPA 1N0VC 3I8SA 4A2QA 1U0HC 5TY0A 2GILA 1GVHA 4BLQA 1N5KA 2JJ2A 821PA 1IN5A 1ZVQA 4FMDB 2DERA 3GD7A 5L3VA 3BWDD 2W0SA 3JZMA 3BB1A 2A3RA 3Q5DA 1FRNA 3L0OA 4HLCA 1DELA 3CONA 3ZVNA 4XVQA 1ESMA 1H8ED 3D31A 3K70C 4Q66C 5HE8A 5KDOA 1T9HA 1Q3HA 2Z4SA 2IYQA 2YINC 4AKEA 3QY0A 3VR5A 1CS4C 1QGAA 3PUXA 1MV5A 4TYNA 3THXA 2ANCA 1HE1C 2WTUA 3KJIA 3K1JA 2DBYA 4AI6A 2W2TA 4L15A 2W83A 4DLXA 1D2EA 3CX8A 1G3RA 2ZRIA 1E32A 2ZR9A 1RPZA 3LRPA 4TYPA 4B2IA 2NPFA 5K8UA 4F91B 3KKMA 3KQLA 4CEJB 1Y63A 4IEEA 2ZE6A 5L8VA 1VDZA 3QBVA 5DHAA 2V1XA 4Q4JA 4OJQA 4ZIRA 2NMVA 1XTKA 4JBXA 3G71B 3FTQA 2OFOA 3JQQA 4Y7CA 3BFKA 1YZNA 2G0NA 3I56B 5DH9A 4HB4A 2VP2A 3PUZA 1RRCA 3HDTA 2IBMA 5IK2A 5SZIA 3RABA 3DDCA 3ZVLA 4LZZA 1RKBA 1TTTA 1MABA 2VTKA 3KQUA 1WP9A 1R5OA 1DAIA 2QPTA 3PEWA 5IF9A 2BMJA 1CBUA 2QRNA 4QHSA 4RZXA 1E63A 1S9DA 3QFTA 2FNAA 5B2ZA 4DDVA 3MFYA 2XNDA 4QBHA 2VP9A 4Q9LA 1IY1A 4Q7MB 2ZS7A 1YZUA 2WIAA 2EYUA 2GVDC 5GJWC 3U4QA 2J7PA 4R71A 5G3ZA 3G0HA 1G7RA 1ZAKA 1QDEA 5J4HA 2OTJB 3CWZA 5THXA 4I99A 3DEFA 3G5UA 4AK9A 4JVLA 1I4LD 3OFNA 3MSXA 2WKQA 1QBKC 2CMKA 3QF4A 5AR1A 2HJVA 2I3BA 3W2EA 4JL6A 1FDRA 3GQBA 2YJTD 3QXXA 1W34A 4EJSB 4JVMA 1YR8A 1MO6A 4BRWA 2MSCB 4OI4A 4LK2A 3PUWA 4WXRA 3K09A 5AUNB 1OPXA 3QFSA 3GLFE 3NXSA 3CRVA 3A1SA 4EFMA 1UFQA 1YZKA 5BN3A 1DAKA 1X1SA 2QUZA 4RFVA 3FDIA 4PQFA 3CC4B 1YZGA 1SHZA 3DPUA 1TUIA 1XZQA 1S3SA 1Z0KA 4PHTA 1S2MA 3AKCA 1MO4A 2F1HA 3K0FB 4M1YA 1Z28A 1QVGB 2ZS9A 4QL3A 1E0SA 2ZJBA 1QUFA 4CEIB 3IEUA 1BX0A 1YE8A 2ZJ8A 3Q7QA 1RRGA 4OQNA 3RVBA 1QHGA 4B3GA 1OB2A 4JT2A 4QJ4A 2OEPA 3CRQA 1CP2A 3GLIA 1OH8A 2P6RA 5GJCA 5L3QA 2FN4A 1XWIA 2R44A 3QKSA 2YOGA 1M90D 3RS0A 1VQNB 5BXQC 3RAPR 3TQFA 3CPJB 1X86B 3CCMB 1G5PA 2YWHA 2KE5A 3F0TA 3N2EA 4NYIQ 4ESHA 1FUKA 1XEFA 4RSGA 3GLFA 2AN9A 1SVWA 3OIVA 4E09A 3LBHA 2V6IA 2EWWA 4W5HA 3DM5A 4CEIA 1Q44A 1S1CA 3FKSD 2VP6A 3ONWA 2DPXA 4LBZA 1YVDA 3U6KA 5GVRA 4NKRA 4BFTA 3MWKA 2JDID 4C9BA 1CQXA 2I1VB 4URXR 3CCRB 1E2HA 2D2FA 4ILEA 2GJKA 4IEIA 2BJWA 3DVLA 2JLXA 4DSNA 4ZCLA 2ANBA 2ZRJA 4WZBE 3VO1A 4EH1A 4JYCA 5FTKA 1NLZA 4IDQA 5EZ5A 1ZM7A 2NZJA 4C0HA 4EQ6A 1WBBA 1WE2A 1Z6TA 2YOHA 3HYRA 2FEOA 5DSZA 3AVVA 3H84A 1CULC 4RVCA 2OTLB 1OXTA 1JR6A 3OZUA 3WNBA 4EKDA 5C4MA 2W00A 1MRNA 2DFLA 4LJ5A 3Q7PA 1EGAA 2PLRA 1OXXK 2VP4A 2ZRDA 1G20E 2QZ4A 1XCGB 4ITRC 4N3GA 3SEAA 2RGXA 2XNJA 1JJ7A 1QFJA 4Q7KA 3W5JA 4YAUA 1Z6YA 2EVWX 3ASYA 4V0OA 3QENA 1N0UA 3CRRA 2QT1A 3CH4B 3I8XA 2HXYA 4B2PA 3BK7A 5G3YA 4GNKA 3QF4B 4HATA 4JLVA 5AJZA 4BQSA 3T1OA 1J8MF 2ZETA 2C77A 1KC8D 1A2KC 5FPHA 4TMXA 3U3OA 4E5UA 5LD2C 1D6JA 2ZI6A 2FSFA 5AJWA 3LBIA 3NIBA 2PZGA 2UVQA 4DLVA 5C2JB 4PHHA 3RNLA 4XVRA 3LFUA 3QEOA 3EIEA 1W0KD 1N5IA 3D6TB 1JR3E 3X1YA 3MWJA 5M04A 3OZVA 2ZI5A 1CRQA 1NN5A 1DOAA 1KMHA 5E95A 3W9YA 1EP1B 5EE3A 1FL9A 1ZD8A 3OAAD 5H8WA 4B6EA 4GPTA 1OV4A 3EARA 2V8OA 2WAYA 4GMXA 2JLYA 4QM6A 4LGMA 4QHTA 4HE5A 2VHCA 1Q3TA 4IDPA 3C15C 4MRSA 4US1R 3AUXA 3C4JA 3SFZA 4ZDWA 2WICA 1IAQA 2P5TB 4G0NA 5F98A 2GDJA 3DHWC 1LB1B 5TDHA 3P27A 2GJ9A 2OM2A 4P4TA 5FTJA 2VHTA 4Q4AB 1KI6A 4TQAA 3VX4A 1NLFA 2GWHA 4MA4A 3ECCA 5CYPA 4JLOA 4PQRA 4C0SA 4A15A 1KI1A 2HYDA 521PA 1FUUA 2J7PD 4Q9JA 4C0AC 5GJBA 1D9ZA 4HB2A 1OKKA 1W2BB 4RZ3A 3BORA 4NYIR 3AVUA 2J9RA 3X1WA 2FFQA 4JMPA 1W4RA 3CPHA 1TPZA 3ADDA 1EX6A 3PXGA 2J0VA 1G8YA 5E4FA 4BLTA 1EESA 2N1BA 2ZREA 2WSSD 1NJGA 2WPDA 2REXB 3LBNA 1OGJA 2AK2A 4QGFA 1A2BA 4JLKA 2OK7A 3WYGA 1E9BA 2ORWA 2XTZA 3B6EA 3I4LA 2VRWA 2R6GA 1ZM3A 1G3UA 2PEZA 1ELOA 3PUYA 5TARA 2Z83A 5K8IA 3LVBA 4KV9A 2O8CB 5AJXA 2PMKA 1G21E 3AM1A 1B2RA 4AYXA 2BVNA 1GAJA 4N0DA 5FPKA 3NVAA 5EP3A 2V9PA 4QJ5A 4BZQA 4HDQB 2G77B 4X8OA 1SHKA 3VTKA 1CRPA 4Z8YA 3L82B 3TNFA 3WRYC 2QP3A 5KSYA 1S8FA 4R7ZA 2GCOB 4YMWA 1KZGB 1Q7YD 1QG4A 3THOA 3NH6A 1L4YA 5BN4A 1YR9A 2FH5B 2UKDA 4MGYR 4B35A 2RHDA 1KO8A 2AK3A 4AY2A 2ZITA 1IY0A 2IYVA 5JJIA 3GLFB 3AF3A 3VO2A 4MH0R 1E9CA 3DOFA 4KJZA 2O52A 4URWR 5G53C 4HLUA 4JS0A 2DWPA 2ZI9A 2WOOA 1R5NA 1R0YA 3THYB 4KO8A 4HLUC 2J0UB 4V0LA 3R9XA 2XSZD 1E2JA 3TR0A 1WRBA 2EFDB 1MO3A 2GESA 2EYQA 1GRQA 2FJUA 4RD4A 3K0CA 4Q00A 2EQBA 4MKIA 1W46A 4GOXA 3VHLB 3FFAA 1PJRA 2VIIA 4LJ7A 1GKYA 2OUKA 2HF8A 4PTLA 5GVSA 1WDTA 1JBKA 2UZ3A 3N70A 2ERYA 5KSWB 4TMZA 1M7GA 4ACBA 2RC6A 5KYKA 4ZGQB 3RC8A 1M7HA 2O8BB 1II9A 3BB3A 1AKEA 3IEVA 4QHYA 1YZQA 4C43A 1F3OA 2AXPA 3EW9A 2BMDA 3K0SA 2FPKA 1FTSA 4FMBB 3SDZA 1PV4A 3CMAB 2E1RA 3AVXA 1SKYE 2ATVA 3CWQA 2JIZD 1W7AA 5KSPA 1XTIA 3V00A 4NU0A 3K0FA 3CZQA 2F43B 4WIAA 4GL2A 4TMWA 1JA0A 1JQJC 3PR1A 3B82A 2YV5A 3FKQA 4KHZA 3E1YE 3B60A 3KXIA 2XNCA 1BYIA 4TTPA 4P4UA 1QX4A 2HLDD 1D5CA 5EQTA 3TW4A 3VKWA 1M1YE 1VQOB 1FQKA 4ACAA 5FL7D 1KRHA 2G1JA 4XH9B 1JJVA 1M2OB 2FWRA 2WKPA 4IOLA 5HR5A 4F92B 2QNRA 1VYUA 2RH5A 3TUZC 2JLQA 2BOVA 1G8FA 3VMFA 1BX1A 2WWXA 2D2EA 4G5RA 3CIOA 4DHEA 4C3ZA 3H86A 1T6NA 4D0NA 3R7WA 4ASUD 4YMTA 4ZIRB 2VZLA 1EP2B 2C03A 3KUDA 3QSYA 3OZWA 4U02A 3KQKA 1GRNA 1LNZA 2JA1A 4MQBA 1KI8A 1IN4A 4I1VA 3LLMA 2V1UA 3FB4A 1BYUA 2QAGB 2Q3HA 2V6JA 5F2EA 3Q5EA 4FCWA 1VQPB 1VHLA 1NIPA 3WBJA 1F48A 3WYAA 4D4LA 3UANA 4DT1B 1QG2A 4DUGA 2BM0A 4P6VF 1AKYA 3SU8A 4WAUA 2O8EA 3U7GA 4ZKDA 1XJ0A 3EASA 1W0KA 3UKDA 1T3LA 4KCGA 4QG7A 2OG2A 3W3ZB 1E3MA 3CCJB 2QA5A 2GBLC 5FOWA 2ZJZA 1BO6A 1UKYA 1UDWA 2W6JD 5KNCA 1KKMA 2PT7A 1GFIA 2AR7A 4M1MA 3RYTC 1ZIPA 3MLEA 3ZGXA 5FH9A 4CEHB 2ZRAA 1EFRD 421PA 1I2MA 1PZNA 3LH5A 1GZSA 1ZNZA 3GJ0A 4ZPXA 4DLRA 1E2DA 2AD5A 4M2LA 4TL7A 4NYMQ 3AKYA 1AZTA 4BFUA 1U0LA 5DN6A 3U44A 4O2LA 1QRAA 1W49A 4C0JA 2NPIA 2VF7A 3TK1A 2GF0A 2PCJA 2XITA 2ZRGA 3AV0B 2JLUA 4BFSA 1VCNA 3SYLA 1IHUA 2IL1A 1F2TB 3IGFA 1HQCA 1RJ9B 2Q0HA 3FPAA 4QBIA 4F38A 3Q3JB 3QXCA 1VQ6B 3RDPA 1ODFA 5BQ5A 3T5DA 1D2NA 5CB6A 5FI0B 3T1VA 2CHQA 3QJYA 1XTSA 3LV8A 1IN7A 3CNOA 2QBYB 2ZAMA 3QFRA 3CH5A 3QVVA 2IYRA 3T1TA 2VL7A 4YC7A 2A78A 3W6NA 1GR1A 4FMDF 4N1AA 3MWYW 4KSBA 4HLQB 2HJGA 5BW8A 1N6OA 2RGNA 3ZZ0A 2RC5A 5CK4A 3UG6A 1J9ZA 2YC2C 2O0HA 1LW7A 5F9FA 3AP3A 3LVQE 4Q1BA 4YDSA 1NKSA 2OE2A 4UJ5A 3SYNA 3EZFA 4TT3A 4AKHA 1GILA 3OFND 4Q1DA 3QF7A 1SVOA 1OIWA 5D3QA 3NC1C 1E0JA 1OFIA 4DBLC 1FZQA 4F4CA 2IUUA 4G1BA 2H7VA 2CL7X 4AKIA 2MSEB 1XJQA 4FI3C 2EFHB 4OQXA 2GQFA 3CF2A 3VR3A 1A1VA 2BCGY 3KX2A 1D8TA 1OF1A 1GIAA 2WMOB 4WBSA 2CHVA 5J4YA 3PVSA 1DTSA 1SVSA 1C9KA 2O0KA 2IYTA 2ZS8A 3R20A 4TL6A 1XPOA 1IXSB 1Q1BA 1R10A 2ZUBA 1VHTA 3BH6A 1ZC3A 2QL6A 5EP2A 4P33A 3WRXC 3OW2B 1BIFA 4G1UC 1GRRA 4LCBA 2O8FA 1P2UA 1S1MA 1OH6A 2OK8A 2WM9B 1S9HA 1AQUA 4AYTA 3ZC3A 4B76A 3OEEA 1JEDA 3EC1A 3U7EB 4Y9UA 1YITB 1F2UA 3FPKA 3GLHE 4BECA 2NGRA 3BGWA 5H70A 1XMSA 5B30A 5AJVB 4URZR 4PZYA 4D4KA 4LYHA 2P6UA 4JBWA 4AD8A 3U3MA 5CYOA 2EW1A 2JIZA 2A5GA 2CNWA 1NL3A 1YQTA 2AXNA 2FMXA 4A4DA 5G40A 2AWNA 1YJ9B 2AKYA 2XAUA 1Q1ZA 3UPUA 4D26A 1RFLA 2XXAA 2KB0A 1G4AE 4XJXA 2ZE7A 1KYIA 2DY1A 3E2IA 1X8JA 3EZ6A 3B78A 4H9GA 2DHRA 2ZU0C 3CR8A 3SJAA 4BZPA 4UJ3A 4QGGA 4M53A 2HLDA 1N6LA 2BPOA 3B1VA 3FKSA 4IXMA 3REGA 1NSFA 1VG9B 2RAPA 1VMAA 1E79D 1FPMA 2OFXA 3HU3A 4FWIB 3CPEA 4NYMR 3ZS9A 4TYWA 2BV3A 3ZDQA 3EWAA 4D25A 2JCSA 4EDHA 2YWEA 1AGRA 1U90A 2J87A 5JECA 3PJRA 3KFXA 2ZE8A 3G6EB 4DIEA 4PSKA 1PLJA 4FIDA 3VQTA 4ASUA 4YXWD 4K46A 1W1WA 3C8UA 2QBYA 4B43A 4MDEA 2QMOA 3BIFA 1NVUQ 4I4LA 2J41A 3CC7B
chains in the Genus database with same CATH superfamily
1QBGA 1V5IA 2FS9A 3E48A 5ECYA 3MJRA 2B1IA 3NHSA 3DWFA 2NYAA 3MAGA 4PZPA 5KC8A 2GXSA 4GAWA 1ADCA 1DUEA 5CDFE 3D2LA 3IT2A 3NWJA 4C2BA 2OV4A 2CB0A 4BXOA 1ZXXA 1GSHA 4PNPA 1TCAA 1UQRA 4OQYA 1SCBA 4R8LA 2C5HA 4DPMA 3UAYA 3OAAA 1MVNA 1SUAA 5I7FA 3DCIA 4CMIB 3LNTA 2FP4A 4OP7A 1MC1A 1EPTC 2BCJQ 3ZIAD 2D9RA 2AG8A 3D3EA 5F64A 2R2MB 1RRFA 5KECA 3WLNA 2GYVA 3UXHA 3KEMA 3U8OH 2A4KA 4WVFA 2SGFE 3M83A 5BV7A 5A5GA 1OX6A 2FRDC 4JI8B 1HV7A 5JS8A 3TLGA 3PUJA 1NESE 1LY1A 2JBHA 3CMCO 4W1QA 2GT7A 1WPXA 3WRVA 3T28A 4DGJA 4ABFA 3OO1A 1N8KA 1FIZA 2G04A 1S3GA 3RVOA 1J5XA 2JHGA 3GJZA 3OQ1A 3DLPX 5KKCA 4PYQA 1A8UA 1PL6A 4NF2A 4DUPA 2OWDA 1TGSZ 3ND9A 3A3YA 2PCLA 3RC6A 2J85A 2FPMA 4OGFA 4AZVA 2W48A 4BO3A 3S99A 3UJ7A 3PX2A 3GLGA 4UZFA 1QGED 3FN4A 1J8YF 4HZUA 4IGFA 4ICIA 2P3SA 4P02A 2DBZA 1TMBH 2WPIS 1K0FA 1A4IA 5T8KC 3NDJA 3S6JA 5BN3B 3KYDB 5KDLA 3FY4A 3Q3GE 5EZYB 2II6A 2X53S 1M2WA 1YJAA 2AOTB 4F9GA 2BGLA 3B2EA 1L5VA 1VSQA 1C7RA 2EJWA 4GPGA 3FYHA 4V1CI 1AKUA 2NO1A 2B9EA 1OXUA 3V4VB 1T13A 1QCDA 4Y76A 1F8YA 1NBMD 5I48A 1PSZA 4QQKA 1VP3A 1TNIA 1A8QA 2G88A 4KE8A 2INGX 2Z6VA 4RI0A 2ACEA 5KOHA 2PWZA 3THWB 2VBTA 1WAMA 1UQUA 1LRKA 1YFZA 2FIRH 2ETXA 3HFGA 3RSHA 3ZU4A 1SXJE 1K8QA 2OBFA 3N87A 3KM0A 3HBJA 2OC1A 1OVGA 1QIDA 2VH5R 3H9NA 1XP5A 5K0ZA 1JHVA 4BE7B 1F0KA 1DKOA 2XE8A 3D81A 1TIOA 2GVNA 4A0RA 3AHGA 1GGJA 4PYMA 1GGVA 1CD5A 1FVFA 3MF4A 2EF0A 1YKFA 2P3QA 4G1CA 1FX0A 4ALIA 3NQ41 5EXXA 1IPHA 4D9BA 3F71A 4NDAA 2FOEA 2W2VA 1MOSA 4NCBA 3DE1X 2ZSHA 4INAA 1L5YA 4IF6A 1RZUA 4BNIA 4TWWA 1ZUWA 3ANYB 4OM8A 2B0FA 1Z8RA 4RLZA 1QB9A 2R8ZA 2Y71A 2O6HA 3ZWBA 2FV8A 3AIKA 1XROA 1NNSA 1MBZA 2H3HA 1PWYE 1KERA 3E5MA 1SUBA 4PZ0A 3CE6A 1JG6A 4C6HA 2OXTA 1F5SA 1LVOA 4FSXA 2GPBA 5IT5A 5JJLA 1JGTA 1I94B 4LBVA 3Q2IA 2FFJA 3NR2A 3UJAA 4C4RA 3VKVA 1ZBDA 4QOIA 3GLGE 3Q8XB 2V6MA 5FULA 1YVPA 2GZRA 3A28A 3SIPA 4M0UA 2OSBA 1NNUA 2PQMA 4TV8B 1UKAA 1P2SA 1HT1E 4REQB 4XEUA 4IIJB 4JI4B 1Z0IA 3DEJA 1A76A 3HJUA 3QSGA 1Z6GA 4HN4B 2OKGA 3L07A 5FLKA 1EAWA 1S2DA 4A3SA 5T6BA 2J59A 1WG8A 2OORC 2JLWA 1K9MD 4TLCA 1T1GA 1XU4A 3CENA 2QTHA 4C0WA 1IATA 3PTNA 1V8DA 3NC0C 4BFYA 1L5HB 1M75A 4ZDJA 1PDOA 5AW1A 1RRPA 3O90A 3K0AB 1XRNA 4MR9A 2CK3A 4OBEA 3KK0A 2ZT7A 2H0RA 2VDJA 4Q3BA 2BKAA 2A35A 1SQTA 1EZSC 4PQYA 2WNSA 4N9QA 4NE9A 5EQFA 4I8KA 3BILA 2ZJ5A 4MRRA 5IVPA 4P7BA 1GBKA 2O8TA 1W5TA 2ZRBA 2PSDA 5JAZA 1HFWA 1Y5BT 1P05A 3A88A 3GCZA 3MQ2A 4NBKA 3TEJA 1C1OA 4B4KA 1X39A 4GSYA 3FANA 3EVFA 5BPHA 5CDFA 3FPFA 4R83A 4AO8A 2COEA 4KIFA 1MLDA 1RYBA 1XV5A 2WR8A 1QQUA 3X2FA 3RGGA 1EUFA 1B1AA 4HNGA 1DTWA 3OQHA 1QJ7B 1Y8ZA 4XE5A 2J4DA 4O0MA 5H83A 2EZUA 1BJUA 2PD3A 2FZ5A 3LDUA 5NLLA 1RQLA 1N5LA 5E9WA 2I8LA 4FILA 1EPTB 3ON5A 5C7LO 1FP4A 2WHPB 1DJOA 3Q11A 4EYKA 1Q7TA 4ZRMA 3T1QA 3TW0A 3M7TA 3DDHA 3DF9A 5AKLA 3L6OO 5JVDF 3BC1A 1O2WA 1VXRA 1ZOMA 3ZY2A 4GOMD 3MJHA 3A1UA 2H2FA 4MJ3A 1OAOA 2ZVJA 5FR1A 1QQ5A 2RGCA 1O2KA 2Q45A 4MSUA 2R1ZA 5I9SA 3FYSA 3RVSA 2NU8A 2IYFA 1V2KT 1QQ6A 1JECA 1KORA 2P2SA 4HXGA 4Q1FA 3TZLA 3UFXB 4F96A 3MCZA 2FDAA 3GIDA 4N6OA 5M5BA 1MAWA 2DSNA 1FFYA 1U9IA 2YIMA 4TWRA 2GTPA 1GCTB 2WJJA 1Z6ZA 5E7IA 1M2VB 3OQ6A 3IV9A 1C4OA 2IPMA 3O92A 2QVGA 4JC0A 1NN1A 2ZSBA 1LWNA 3UOGA 5KCZA 2WU1A 2DB3A 2V7VA 1B0ZA 5BYJA 1KK3A 1M54A 2I03A 5AW5A 1TXGA 4XYEA 3ENSB 2G83A 3HCPA 5K7RA 3DQPA 3RM2H 1N57A 1WP6A 4OP1A 1QZXA 2WPKS 1P9WA 2OT3B 2FUCA 3NRCA 1H3EA 1TTHA 3DZFA 2GDDA 2FESH 2TMKA 4YWHA 1BJTA 4IHJB 3E05A 3L6CA 1JE0A 1S01A 1J90A 2Q1YA 3U16A 2X77A 5K3FB 1ZRBA 4YOGA 1XN4A 5A9TA 4F4JA 4GPAA 3L7BA 3T7SA 3BT7A 5EE0A 4PG6A 1G2MA 5CFNA 2YJNA 4AIIA 3NFRA 4IUCS 5HBRA 1O0DH 1MH1A 4E3ZA 2O20A 1GV0A 2WZBA 5J4KA 4CH2B 3OIYA 2ZHEH 2GPJA 1P44A 4DSOA 5DP9A 4YX9A 2ASUB 3GGSA 1Y80A 4PSAA 2IZ5A 1HAYB 5AKGA 4EZEA 4L75A 3B2NA 3DVAB 3QKRB 5DXAA 1OHHD 3K65B 4D9HA 2GK3A 3VRHA 2IV3A 2HIHA 1R2QA 1DFIA 3O0DA 3KAJA 2A5LA 1C2IA 3A31A 3BX1A 2R1VB 4X8LA 5JSYA 4DMKA 2NQ8A 5DJ7A 3HPQA 1GL6A 2KBFA 1NDHA 1V8FA 2Z1MA 4MR8B 4B9AA 5BN5A 3LXRA 5AW2A 1T3ZA 5PGMA 3H8JA 4MLCA 3HP7A 2H2ZA 1W10U 4HN2A 4P12A 2XNKA 4CU5A 5EINA 1RWMA 3I5MA 4YLYA 3R3ZA 2P8OC 2C8VA 5EHQA 4J0GA 3KOZA 2FMHA 4PZDA 4MS4B 1NZDA 4F55A 4PGFA 4U7DA 4EELA 5IJ9A 3DCJA 4I6JA 4HZUB 3H4MA 4G26A 2J98B 1O94D 4D74A 3KR9A 1WOMA 5HE9A 3PNLA 4B5LA 3DHNA 5EPEA 3E18A 4R9NA 3LYLA 4BNLA 1UBRS 2FEMA 3CKKA 4GO1A 4IKOA 3BSWA 3FHCB 3IAS6 5DS0A 1Y5MA 5C5IA 3KHVA 5AMXA 2KJQA 2C4TA 1DINA 1AS0A 2OXSA 1KOGA 2IH2A 5AM2A 1HOTA 3MAAC 3UR6A 2OBNA 3CLRD 1ULTA 1FYDA 5DM2A 1E4VA 4TM7A 1GL0E 3V4SA 1F0PA 4IJ5A 1K9VF 4Q12A 1V1JA 2FLWA 4PX3A 1N78A 3EDOA 1GJ5H 4G41A 2AD1A 4NCXA 4P93A 2XZLA 3KSAC 5LMUB 4FVBA 4N54A 1U98A 4LSWA 3E0QA 4JXXA 4RZHA 3A81A 1J9CH 1FP6A 4KYUA 1AKSB 5I9TA 3QA3E 4D9QA 2E2WA 4LWOA 1HF3A 3KOUA 2EQ5A 2VTEA 1XUKA 3COPA 4BFXA 4DM7A 1SAYA 3GUUA 2BJHA 4RD0A 1XXDA 2R47A 3SP1A 4F6LA 1QRUA 1GBAA 3O8QB 1P4JA 2EBUA 1ELCA 4J0IA 4LXBH 4EYQA 3RFFA 5A6SA 3IOCA 3RSFA 3CV3A 2R79A 2QR3A 4NI5A 3EFOB 4UPDA 4YMVA 2PQ6A 1CZHA 1DRKA 4AB8A 2VYVD 1LNQA 3N3AC 2FWWA 1QS0A 3EW7A 3DCNA 4KE9A 5I7HA 1PJ8A 2QV1A 1YD7A 3IBSA 1N36B 4HUTA 2CXSA 4IVRA 3BTOA 4G97A 4ISBA 1BH6A 4IXTA 3HM2A 4HBGA 2LELA 2Z04A 3DL2A 3FMFA 2XYPA 3ODFA 1QAQA 3T3OA 3PR2B 2HTFA 3P1JA 2XRMA 3PQ2A 1FNNA 2VLIA 5TRTA 3A6LA 4LVOA 5BV0A 2HU7A 4EX6A 1ZL0A 5GCHF 3S2YA 4X44A 3FLAA 2O8LA 1R64A 3AVPA 3NIDB 1GDNA 3BTGE 4P3OA 1S82A 4ZEOA 4LF7B 5HXBA 3KPVA 4FKZA 4HADA 2OCYC 1SB1H 1SUIA 1EWTA 1F7ZA 4N8SA 4H77A 2CCGA 1X9GA 3VZCA 1L5HA 1QK4A 4CCYB 2Q1SA 3UFBA 2ZRPA 2KCOA 4WUVA 4XRGA 5IARA 4EGJA 2ZVPX 2I2CA 3STXA 3IILA 2XJ4A 1AUPA 2ZKSA 3RXBA 1OOEA 4DK1A 1JWTA 4X7CA 4MVJA 3QE9Y 1M9UA 1B41A 2JGLA 2B61A 2CWDA 4RPDA 3MGBA 3I5YA 2VPXA 4R41A 4JZKA 4U39A 4FLEA 3AR9A 2C2ZA 3IUYA 2O9JA 1L2TA 3C3DA 5FQNA 2WYWA 1YR6A 2YXPX 1V2JT 1N8OC 5K3SA 3PEVA 2CT8A 1QF7A 2QN1A 1V2HE 3OFVA 2IIQA 2OLKA 3CUSA 3RLFA 3VPFA 5H7XA 3KWLA 1WSVA 4AFSA 3B38A 1ZIOA 1UP4A 1USIA 4QXOA 2PK3A 2HDWA 3JATA 4NZOA 4QOGA 3DG9A 2NSDA 1W0ZU 3LT5A 2C88A 3EJWA 2ODNA 3VDXA 1X1QA 2R8XA 4BASA 4OLHA 4RT1A 3ZDFA 3NYRA 3SNEA 2CSXA 3SR0A 1HRTH 1CLUA 1ORRA 4LISA 3D3JA 1ESEA 1ZX1A 2Q0XA 4CKBB 2KX4A 1QTRA 2YZNA 2GILA 3LUGA 5B12A 3KZOA 3VSAA 3O8OA 4C5CA 3QX3A 3BF8A 5HE8A 2PZ8A 1L8OA 2VBFA 1SG8B 1CT2E 1OASA 3PUXA 4X1RU 3L18A 4MQ6A 4FNGA 1AN9A 5BQOA 1XQ6A 4LQLA 1DOHA 4MMXB 2P3UB 5HS4A 1Y63A 3EG9A 1TM3E 4U3JA 1BVHA 4Q4JA 3U4AA 3VBCA 1ZCZA 4EI2A 4F48B 4V38A 1RRCA 3HDTA 4KR7A 3EODA 4LZZA 3PHCA 3S7HB 1IHOA 4X0EA 2H7YA 4YMIA 4BCCA 2OHJA 4DDVA 4ZCNA 2CFIA 2VP9A 4GICA 2ZS7A 3Q9SA 5G3ZA 2VUSA 4X24A 2C2KA 1LD3A 4MIOA 2GN1A 2HJVA 2VRNA 1W34A 2N47A 2YWCA 2MSCB 3GHHA 1OPXA 4F60A 5BN3A 4UC0A 2VKTA 5AHOA 3U49A 1YQWA 4QDXA 2OV3A 2QYTA 4CEIB 3TGWA 3RVBA 2C42A 4B3GA 2Q8NA 1EVKA 5G4KB 3ZDZB 3WWBA 4MQUA 4Z4TA 3TL6A 3QKSA 2XF2A 3H9QA 3BTTE 3E35A 4R8KA 3OIVA 1MX1A 3K4HA 3DM5A 4HXEB 1ZL2A 1A2CH 4UREA 4LW8A 3MWKA 2W7TA 3PJFA 4EJ6A 3P8NA 4OXYA 5F1KA 4X62B 1MX5A 3V7NA 2NSYA 1V16B 1HAOH 1OWLA 4X93A 2PLRA 1AO0A 1X7WA 3TJMA 2ZWMA 3HZZA 1XKLA 3PNBA 4ITRC 4OSPA 3DE4X 1JJ7A 4OGWA 3HWX1 1Z6YA 5AXAA 4GNKA 4KKSA 3DT9A 4BQSA 2TPIZ 3ZYDA 2H4YA 1DRUA 2AX3A 3SJ8A 3EIEA 2BGUA 3RXLA 3BV9B 3HAGA 1L9KA 1UKBA 4MTLA 2ZI5A 1CJCA 2QN8A 3WQQA 4EL0A 1K4MA 1FL9A 2R3UA 3W78A 1WXHA 2WAYA 3I05A 4CV1A 5LQCA 2DECA 4US1R 3AUXA 2A1UA 3E58A 2WICA 4YJFB 1Y3IA 3OJFA 4OQQA 2P8JA 2GJ9A 2ZEBA 2UYGA 2H9HA 2I6QA 4MV8A 3BHIA 1VMDA 3LBNA 3EY9A 4P7GA 2ORWA 1EWKA 1Y4UA 3INNA 1SR5C 2PT9A 1OA0A 1J17T 1HGXA 2C54A 3L1UA 3LNNA 4OREX 2UYQA 2BVNA 1XXLA 1YVUA 3JQBA 2A9PA 3UNSA 3TDNA 1CRPA 1C2HA 1T5BA 5KSYA 2BB4A 5B6OA 3VOAA 4GWGA 3TGJE 4WH6A 1SUCA 3A8AA 1C0EA 3IR7A 2X0DA 3KB8A 1T32A 1R0YA 5TEWA 3OE5A 2HQBA 5TSDA 2EYQA 4Q00A 1E92A 3OX7U 1X7ZB 4DWWA 3U48A 4P7FA 5KVSA 2IXTA 3QKWA 1BMMH 2WLTA 2XVMA 3OUTA 3EXHB 1E89A 5T41A 3CWQA 1V11A 2XRZA 1WXWA 1GQRA 4Q6WA 1WZIA 1JA0A 4ZOLF 3DP7A 3AU9A 4HRXA 1ZWLA 2H7XA 1XMNB 5GONB 4GLBA 1M2OB 3J81A 1VM6A 4DXDA 4WKCA 1G98A 3KCGH 1KQ3A 4WMLA 2WWXA 3NX4A 4FEAA 1W5AA 4P98A 3SZLA 1ZHOA 3JU4A 3GSIA 2VZLA 3LC7O 3PTBA 3NRJA 4TQGA 2JA1A 2P7IA 4MQBA 1KI8A 3GT7A 4S05A 4RQBA 2Q3HA 4YPFA 1Z0ZA 3ZIDA 3SD7A 4HGRA 3T7KA 2O8EA 1E35B 4F4UA 1LDMA 1MQSA 3CCJB 4OHFA 2QA5A 5FOWA 4U32A 4OAPA 2C29D 1DWBH 3EVDA 1NGSA 1XVMA 1JEQA 3L8DA 3PUIA 4AJHA 1UPBA 3OZBA 1NT2A 3ENNA 3WGGA 1WVGA 2P6PA 1GRCA 1FLDA 4IV5A 5C1OA 3TNSA 4DSZA 3DAGA 4D3YA 2IL1A 2Q0HA 3DXXA 3IIEA 4UU0A 1SGFG 4H7IA 1UW7A 4KW7A 4UE3S 2V58A 3IEPA 1IN7A 4OP3A 2I33A 2ZAMA 3V8PA 1MTVA 1NI4A 4BV3A 1GR1A 1RBQA 4DMFA 2X0JA 4LQDA 4P0PB 1EPUA 1LW7A 4BB0A 3RC9A 5KHLB 4EDFA 3QELA 3GZNA 5BSMA 1JWLA 4ZN6A 3DKKA 1GTZA 5J4YA 1GIAA 2ZWVA 3LSTA 5D3ZA 2IYTA 1XPOA 5BURA 1ZC3A 2O9QA 4MQ5A 4AAYA 1TUBB 3SDBA 3Q6IA 1ANCA 1C2GA 4NAVA 3RXOA 1YCPM 3K4PA 1O36A 2EC9H 1LLUA 2A5GA 2FMXA 1Z13A 3KJZA 3UPUA 3EZ6A 1QH1A 4LEIA 2NU8B 3MRTA 1A8SA 3QWFA 1E79D 2OOKA 2XF8A 4M87A 4TYWA 3IOEA 2BV3A 1PO7A 3QLVC 1X0XA 2ZHWH 3OPOA 4AJIA 4DIEA 1PLJA 4FIDA 2AIQA 4GHTA 3E7XA 4BNDA 1MQ5A 4Y1EA 2I6FA 2F4VB 4M1KA 4KGXA 1K7YA 1L1FA 3DVSX 4PS0A 2IJOB 1JP7A 1E2PA 1RBYA 2F4LA 4NAUA 4PFQA 1KOLA 3T94A 3KALA 2ODEA 4H6VA 4EB0A 1IBSA 1MXHA 3WMWA 5FX5A 5LQRA 1JXMA 3AWDA 3EC7A 2BFBB 4FYWA 5BT9A 1I8TA 4PG4A 1P04A 4XUDA 4HXYA 1PQPA 4YJHA 4JMYA 4OHOA 1WZNA 1P5JA 3C3CA 2Q7XA 3NORA 4YY3B 5CRIA 3L0BA 5DM4A 2YHSA 2XWQA 4OFZA 3EIXA 3MCVA 2YS6A 3QK7A 1NBHA 1VYHA 2UXCB 4I4CA 1TUBA 5LZ8A 1R0LA 3SKXA 4JLPA 5HF6A 2QROA 3EEIA 5A0VA 4JIGA 2IS4A 3ZUPA 2R68A 2PHBA 5CDUA 3CCSB 1OP2A 1D07A 2WKWA 1R9MA 3T7IA 1EJ2A 1I1NA 3ZI7A 1OSSA 1RYHA 1GUZA 4UCWA 1QGFA 1R0KA 1RJDA 3U1TA 2Q4DA 5CH5A 4X6LA 3OP1A 3TIGA 1SGWA 3STUA 5LP6B 4XVCA 1RCFA 1BZXE 2P2NA 1ZYUA 2P8SA 3D0KA 3OEWA 2NZYA 4WFJA 5KX5B 5MN5A 3FUUA 2PXHA 5I3ZA 1XALA 1SZJG 4TRRA 1DX4A 1F7UA 4G5GA 1RAHA 3M6FA 1Z0FA 2Q5FA 4WOPA 5DNCA 2WF6A 2F8TA 4GQIA 2CLLB 4H6XA 1HQKA 2HX1A 1IEQA 4IMQA 4YI3A 2CF6A 5LKAA 4OOXA 1S0QA 1U5CA 2QJRA 4FUFA 2NX2A 3R6TA 4NP6A 2C0PA 4GPD1 4GGPA 4GKJB 2ERCA 2QRVA 4ZARA 1G3MA 1IXYA 3R6GA 5HFAA 2I99A 3QU7A 4X6OA 5DYIA 1D5WA 1ULBA 1UP7A 2Y27A 5J40A 4ZOQI 1JJBA 3O95A 1KR2A 2RMKA 3DLTA 2GYUA 2EP8A 2NU6A 3C5WP 3I9FA 1O97D 3SI7A 2WYIA 4ZQIA 3DWIA 4MJLA 2BFEA 1BE6A 3ZQ6A 4GD3Q 4YRRA 3ZOKA 2QUJA 3HDYA 4K40A 3I0MA 1X80A 1V4BA 5TVGA 2P65A 1XHEA 5DPAA 5H80A 4KEAA 1LF5A 4H3VA 3UWOA 1MTWA 4RXMA 4CETA 1YPHE 3BFJA 1XEWY 3MD9A 3E0PB 4CRBA 4QU5A 3CPXA 3KYDA 2VWHA 2QE7A 4O4JA 3CLHA 1NN6A 3F6UH 4MQEB 2JGNA 1MJFA 1DBRA 1GTRA 3K0CC 5EP4A 4A8PA 1L8XA 4HYEA 1V2RT 2FMIA 1OYQA 1WOSA 2GOYA 4WJKB 3CW9A 1M5TA 3DMTC 4KVGA 5E1OA 3LVRE 3AVOA 1GDDA 5ECGC 3ZDDA 5AQEA 1H2AS 2VZ0A 3PXDA 1TBRH 3LVFO 3H7AA 1CP3A 4HDNA 1LA2A 1RVDA 3OJCA 1ONSA 3P94A 1XAJA 4Y8XA 3NYQA 4UTNA 4TXLA 2Z2JA 1C9TA 1O95C 3WMEA 1PJBA 4JVSB 4RPIA 5TR9A 5E0OA 4RKJB 5CURA 5ERXA 1O35A 3CLUD 2GETA 3AY6A 4GC5A 2GVZC 1MKYA 3S9AA 4HEA6 3KXPA 4G25A 3KS9A 3ZHYA 1SUDA 2C00A 2ZYRA 3ZNNA 3T3NA 3M82A 3KJGA 4M55A 1P4AA 2IYYA 2B5OA 4ABAA 4HQLA 3FE2A 3KZKA 4RVFA 4TWZA 4PXYA 3TRDA 3VH2A 3O74A 3ZX5A 3FHOA 2QAGC 2E4XA 2OCVB 4NG4A 3OF5A 3EF3A 1T34A 4QODA 4KR2A 3C85A 5SICE 1P1JA 2ZPRA 2QJWA 3UKOA 1TQHA 5LNK1 5EESA 3I2YX 4CRCA 3WBBA 5F4OA 2RH8A 4ZMRA 1QO7A 5HM6A 1N08A 5ULLA 1KO7A 4YTAA 4F45A 5ALXA 4LZJA 1GU7A 1N2JA 3N59A 1IN8A 1T6YA 3NBZC 1UO6A 1E3WA 2P2LA 2X6RA 3PE6A 2O19A 4FSHA 4UOZA 3L40A 3X2SA 3NM5A 4H0NA 2CNWD 3DMDA 4KR6A 3DKVA 4KR3A 2Z0MA 3TG2A 4M1OA 3W3AD 5IYNA 1XRRA 1V5WA 1PVDA 4EVSA 3U28C 2JETC 2XD4A 4H7HA 4IMJB 1LLQA 1QHSA 3MJ4A 2QEXB 3CM0A 1T8PA 1NV8A 1W9MA 5G4LA 1C5XB 4KBFA 2ULLA 3VYUB 3CNNA 3D3KA 2CHUA 4HQRA 4ZI7A 1KSJA 4D97A 1V7QA 1QA7A 1QPBA 3QUBA 2FX2A 3NJ4A 1Z0DA 3QWHA 2ZDGA 1GUDA 4HY3A 1GMHG 3CX7A 5IDVA 4MKZA 1BTZA 4Z54A 4C06A 4X9XA 3D6FA 4WBNA 1AUXA 4HV4A 1RYMA 4NEQA 2H2HA 2BGIA 1J39A 4KWTA 1ZI6A 4W5RA 3WB2A 1XVAA 1QFKH 4HNQA 2F9FA 3EQ7A 1KSFX 2A9QA 1MAVA 4DXAA 3B6IA 2YNBA 2YW9A 3LPCA 3KXKA 3AJEA 4XSHA 4PYJA 1R16A 4ZODA 1XLTC 1JA9A 2DOKA 2LV8A 2O4UX 1XAHA 4PEVA 4D1YA 4I1YA 4US0R 2PUBA 1HZEA 1G5TA 3ICEA 2BDYA 4DB4A 2X4GA 1S6HA 3L43A 3F4LA 2IU3A 2FYTA 3WK7A 4F3KA 1Q50A 2FHPA 2P5SA 4OTZA 3PWKA 3HB7A 1Z4PX 2ZGVA 2IPAB 3RU4D 2V0GA 3H4IA 4V1CB 4L73A 3A89A 3AKDA 3RARA 2ZU3A 4O3UA 3FZNA 3AWIA 4W7SA 3N6RA 4Q7JB 3OECA 3JWIA 3H4VA 3LQRA 4V2UA 1LBSA 1WCV1 1FMLA 3JAKA 5HMMA 4Q63A 2DYKA 1TJ5A 5DTJA 3SU6A 4WEOA 3C8HA 1G8SA 3F7OA 3UTDA 2AKEA 3N8KA 4EF5A 2WZDA 5K6TA 1WBJB 2D5AA 3ZXUB 1D03A 1ZH4A 4DNTB 5BPFA 2PKAA 2X5KO 4MP6A 2UXBB 4FSDA 4M1TA 3NS7A 3WL3A 5CDTA 4YALA 2ESTE 1O5EH 1UAYA 3NAGA 3VUFA 3ZXYA 2A86A 4N9WA 3A3BA 5FUQA 2QORA 1P2TA 2D2IA 2IYZA 2GAAA 5IXJA 5K0LA 2Z94A 2NZUG 1I4TD 1O3HA 4RK0A 2VVUA 3C4QA 1A2OA 4EVRA 4P32A 4XGRA 1PUIA 4RVOA 5H5JA 2GR9A 1A4RA 3TR6A 1JMVA 2JD0A 2Q5CA 3ZDRA 2C93B 3RRFA 2B21A 2PS9A 3N39C 1NBME 2R84A 4ZO6A 1FU8A 3VDNB 4PLCA 4CE6A 2BFNA 1KDQA 2CZCA 1GDTA 1HT3A 2PO5A 3EXFB 2AGVA 2I34A 4FNAA 4O63O 3KQWA 4TWJA 4D9FA 1VHOA 2XDQB 5EWMA 1OIXA 3JQBC 2O0LA 3A8CA 2F3RA 4YNBA 2ZTMA 2BFMA 4QC2A 4JITA 2EWVA 1O87A 3T7JA 3H1FA 3GQVA 1JEOA 2ZJ7A 4GOOD 1IZ7A 1Y8TA 4UMVA 3BAZA 2P2GA 1IZZA 2M32A 2CYAA 1B0UA 2CSUA 4U2BA 1S96A 3GCTG 3SGQE 2EATA 3LWNA 3PLNA 1GBIA 1Z3IX 1OT3A 4C3VA 2A1UB 2DKFA 1ZPBA 3RADC 1EDDA 1GWNA 2HHJA 3PO1B 1VL2A 1WMEA 4HAZA 5AVRA 3E2PA 4CQLA 3N7TA 3QUQA 4H7DA 1PWZA 3SICE 3A9SA 5JIBA 2OZEA 3AUKA 1DOZA 1RJWA 2QAGA 2GNOA 3NK8A 3R3WA 2AH4X 3WJAA 3NTUA 3WHIA 2ZJ0A 4NFSA 3ZD7A 3KELA 1EB2A 1J06A 3KDSE 5AHGH 1ZLYA 3FWNA 2FVXA 4DLKA 2RHRA 4DS3A 4DRXB 5F21A 2XMDA 3GCXA 2GZ9A 1YFKA 1QFYA 5B7GA 5BMVB 1G8AA 4Y10E 1DUAA 4K9PA 5IMBA 2RCNA 1CTQA 4P92A 1DWUA 1YZYA 1GNPA 1ZDMA 4ND6A 1X1RA 2DWQA 4LVUA 1WXRA 2ZXIA 4QOFA 3RMLH 1M8PA 5ICCA 2OV2A 2JLVA 1BGWA 1C1DA 1H0HA 1IG3A 3K6YA 3I4CA 3WO0A 1H2RS 3CR7A 1STOA 2BTQB 1Z4MA 3E8MA 4EJFA 1O2ZA 4FDUA 2XMPA 1Z68A 4O4JB 3KB2A 1EVQA 5TMEA 1N07A 1E2NA 1PPFE 2A5KA 1XCMA 2BF4A 3KLNA 1LSUA 1YOVA 1S4MA 2BM8A 3ZOZA 1XZDA 1JKMA 4M46A 4KQXA 1F51E 1ECLA 1F17A 4XDGA 1NVMB 2ZAOA 4YI5A 3A6KA 3QPAA 2HCJB 1XK6A 4UDXX 4BV2A 3PHBE 4U1RA 4RV9A 3MIIA 1FUYB 5GONF 4GBJA 4QUAA 2ZJ6A 1N92A 3SHFA 3LHFA 1OW3B 1SGTA 5EUMA 2R1VA 1XNQB 2BTCE 3RYCB 5CHAB 3AQ4A 2NZVG 1E9AA 4UARA 4FXUA 3QQPA 4X1OA 5LXTA 4BFLA 3GDUA 4JZYA 4HLDA 4PHCA 3RTAA 1D6WA 1KOJA 1E79A 2XYHA 3BE5A 3L05A 3VPDA 2JVIA 1ORVA 4P54A 2MJLA 4I8HA 2IELA 1GI1A 2ACWA 2JD1A 2IODA 1K1JA 4LJ4A 1Q3KA 1G20B 3GVJA 4PAQA 3IERA 4Y9SA 3HKBA 1TQ7B 1R8SA 3Q2KA 4JLBA 4BLSA 5HQ3A 2JETB 1NI4B 2LBPA 3TTVA 2J0QA 1MTOA 2IS1A 1CQWA 2GV6A 2PNFA 1RQXA 4IY1A 4MWGA 1VTKA 4TTIA 3HCEA 3F5FA 3P9NA 5BY2A 2G5CA 2WSSA 1KSHA 5KQMA 4MGKR 1KYYA 1C7FA 1H0RA 2JHFA 1SXQA 2BUBA 4EG5A 5CPBA 3UREA 2Z2IA 4FEEA 3UNQA 4FETA 5B53A 1XEXA 3MRVA 1HE5A 1NMXA 1W4BA 1FTNA 3ATMA 3M1YA 4KGAA 4B33A 3GPIA 1W4ZA 5J3JA 4X7RA 3SV6A 5HSGA 1OC2A 4YV1A 5H3CA 2F1KA 2VBCA 1MB0A 4W8OA 1NRJB 4WOCA 4GOKA 4JZDH 4FC6A 1E3WB 2OENG 2BTOA 4KK4A 4R2HA 1OWOA 4L3WA 3LK7A 5ERYA 1VJRA 5LXTF 8GCHG 3V7FA 1QTFA 2VNJA 2IWHA 5DP2A 4CIWA 5C0OE 3KR2A 5FI5A 3IAFA 1AWFH 1NURA 2VEDA 1X7YB 4HDOB 2NG1A 2O8NA 2DTXA 5KSOA 3M6WA 5FF9A 3V2GA 1T5TA 3IIMA 4JL8A 3I28A 4ASHA 5TY0A 1NVGA 4X85A 821PA 1FTGA 3Q0IA 1A5ZA 3M3TA 4QJBA 4MTCA 1Q3HA 4EHDA 5JNWA 3F7NA 1SLVB 3O2SB 1MV5A 1JHAA 4AYVB 2AXQA 3K1JA 3DEYX 4Z99A 5I9MA 1HT0A 2VBIA 3EMKA 4BE9A 1YZFA 5ETXA 2X8LA 2SBTA 2FI3E 1GT6A 3GU3A 2X8WA 2YWRA 5C8DA 1YRYE 4WSOA 3IAUA 4YOJA 3GRVA 3VNAA 1R6TA 1XZKA 1ZAKA 1XMXA 4G7WA 3DEFA 3HLYA 4AK9A 1IDN1 4JVLA 1I4LD 2CVOA 2LZ0A 2CMKA 5B2FA 2W37A 2NUBA 4UHBA 5DCUA 5EN4A 3GLFE 3NXSA 2DQYA 1DXPA 3DPUA 1T8RA 3H2HA 1ETSH 2GBCA 2I80A 3OLWA 1QVGB 3C1UA 4KTVE 4FFOA 1E0SA 2ZJBA 1RM4A 3TXYA 2FFRA 3Q7QA 1O0BA 2VG8A 2P9EA 1OH8A 4JXKA 4N3AA 3OJ0A 3U4GA 1KBOA 4RKRA 1MUEB 5DW3A 3F7MA 9LPRA 4A10A 2YWHA 1XEFA 1VJ9U 3UAGA 5C0TA 3LCCA 3HB0A 4CMKA 4LBZA 2CF5A 3IL2A 3OQMA 3X0DA 1GHTA 3CCRB 2V6NA 2PKAB 4ZCLA 3GGJA 3ILSA 1W25A 2ASVA 1BJRE 1TVEA 1GBMA 2Z3VA 4A5TS 4LNAA 4WADA 2YMQA 2RHTA 2IGBA 4FQ5A 2PGOA 3HUFA 1SUWA 3FCEA 4IFTA 1IQIA 1L7BA 4L76A 3DVRX 2NU6B 1XRSB 2I65A 3E90B 4MUFA 1DP4A 1F14A 5E38A 3QMPA 2B94A 5T3YA 5AVXA 2ZETA 4X6XA 3U3OA 3D8TA 3DMFA 3COZA 3VZBA 4WY5A 4Q93A 1GR0A 4PHHA 4O8CA 2P9JA 3MWEB 3ND6A 1SMKA 1WBGB 1O3OA 2XUDA 4XMYA 1FYEA 2OD3B 4B6RA 5ADWA 4GOLD 3M6XA 4CR7A