4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords MJ0495-LIKE PROTEIN
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
2W6ID 3V4RA 3K9HA 4QGHA 2AX4A 1HQCA 4DLWA 4DWJA 2BC9A 4C7OB 3SE0A 821PA 2QEXB 2GILA 3VAAA 2DWOA 3Q3JB 1ZNWA 3BH7A 2IUSA 1Z2AA 2O8FB 2BIFA 3ZLJA 1I4TD 3NDPA 1S8FA 2FSHA 3KJGA 2ZRCA 4UNNA 1IQPA 1NN5A 3BXZA 4KSBA 1NIJA 2P67A 1XZPA 2DWPA 3DM5A 3SEAA 4ZO4A 3SR0A 1GZSA 1OXVA 2ZQ5A 3UK6A 3EIQA 3ZJYA 1OIVA 3FMPB 5EUQB 2ZSEA 3VHXA 3G4SB 5L3SB 4PR0A 1YR8A 3LA6A 3LFUA 1F60A 1XZQA 3IIKA 3WBKA 4MGKR 4B3CA 1T91A 4NP6A 1FP7A 2GCNA 3LXXA 4BASA 3CB4A 5TY0A 3CLVA 3HP1A 4DLRA 1FDRA 1NVVQ 3QENA 3W90A 1CJUC 2GXAA 4Z8YA 1LS1A 2XNSA 3GLHA 1JXMA 4A6PA 1U81A 2IS4A 1P2UA 2Z0MA 1T5IA 4JLAA 1CJVC 1ZC4A 3IPXA 4A9AA 3OEHD 5C4GB 5IF9A 2VHUA 4N0EA 1U8AA 3C14C 4GOKA 1D9XA 2WJJA 3DZ8A 3PEWA 5BXQC 1AJEA 3K9NA 3K8YA 4HLUA 4HUQA 3P32A 1RPZA 1IY2A 2A5DA 1MOZA 3GJ3A 3FTQA 4AF7A 4NYIR 2F43A 1VQNB 4JSTA 2G83A 1CQXA 2IC5A 3TQFA 4ZV4A 2WSSA 3FHTA 1OLOA 1Q0UA 2EVWX 3CC4B 3RS7A 3ADDA 3KB2A 3N2EA 1N0UA 2QENA 3NXSA 3S1AB 2ZJ5A 3KTAA 1KI3A 4JBXA 4YMUA 1TQ6A 2FSIA 3SHWA 4WOPA 4XSGA 3SBDA 4A8JA 4DLVA 3THWA 2JLXA 2F6RA 4G3XA 1TF5A 3IIMA 1XXHE 3BWDD 1MR3F 3PV0A 2N1BA 1XJCA 2YZ2A 5EZ6B 3VR5A 4B2IA 2BJWA 4DEYA 5JSZA 3GLIA 3THOA 2ZJYA 2JJ2A 1E98A 2XTNA 3K0EA 3QF4B 4PQYA 1OV4A 4DIEA 5CB8A 1VQMB 3AVWA 3PFIA 1KJWA 2ORWA 5AJVB 1GAWA 5KSWB 4A0GA 1TQDA 1SM4A 3DM9B 1CJMA 3ZS9A 3NEJA 1XD2A 2JLSA 2NZJA 3QOFA 1U8YA 3EZ2A 4A2QA 4C0JA 3B1XA 3EAQA 4W5JA 3U60B 1BH2A 5CYPA 1TNDA 5DISB 1M7BA 2H8KA 3A1SA 4V0KA 4KAXA 3IEVA 4C43A 3B82A 3TKLA 221PA 4FI3C 2ONKA 4EQ6A 5JJIA 2PX3A 4I1OA 5FR2A 1SXJC 3EPKA 3QY0A 1KY3A 3K70C 1E9CA 1KSJA 1M1YE 3AKYA 4B32A 1KAGA 2UZIR 3M1IA 1E32A 3HPRA 4FWTA 4B75A 5GJBA 1GRRA 1XEXB 4HE6A 1VHTA 1YZUA 1E94E 1JB9A 2IEZA 3U7GA 4FK8A 2O8CA 5HE9A 2VZLA 2CK3D 3AF3A 4AG5A 1LB1B 4Q9LA 1U99A 3RANA 3IHWA 3T1OA 1JR3A 2GK6A 4L9SA 2RGNA 3QPVA 2WJHA 1BX0A 5IRCD 2C98A 5GJWC 3B9QA 4D0LB 3LDAA 4LJ6A 4ZDJA 4ZGQB 3N70A 1JR6A 4M0LA 4FN5A 3FVQA 4BEJA 3I92A 3GLGB 1CRQA 1OGIA 3ECCA 3V00A 5JFGA 5GADl 3I56B 1R0ZA 1GKUB 4A0RA 3BORA 4FMBB 3SC3A 1COWD 2JJ1A 3DEFA 3OE7D 4F4IA 5JI3E 1NN1A 2OESA 2Q9BA 5TV2A 2XNJA 3W2EA 3SHFA 3CR7A 1BMFA 2OCAA 2VBCA 1N25A 2ZJ2A 2OFXA 5GVRA 1TU4A 4QG7A 5AUPB 2EYQA 4LYJA 3OF5A 2B21A 5EXSA 4NCKA 1R0WA 2BJVA 1Z0AA 4TYPA 5GJCA 4EPTA 4OJKA 4P6VF 2ZJZA 2HT1A 1SQRA 1KDRA 5SZIA 1XJ0A 2OTJB 2PJZA 4EFMA 5L8VA 4X8LA 1NP6A 3R20A 3CRZA 1E2EA 1JNYA 1YZGA 4QM6A 3RRNA 1GILA 2WMNB 1Z6XA 3KKOA 2GDJA 2BCJQ 1US8A 2D2EA 4IEIA 4AG6A 3HU2A 5AUQA 1P4SA 3KQLA 3PXGA 4URXR 4IOJA 4UQOA 2EW1A 2F43B 3B1WA 3NH6A 4E09A 2REOA 5EP3A 2FNAA 4Q66C 3W8NA 5P21A 1G3IA 3FWYA 3CCEB 3ASZA 3TK1A 4Q01A 1AS3A 3V76A 3NIBA 3A4LA 3E2IA 1A1VA 2IT1A 5KPJA 2E9SA 3T61A 3UKDA 1K8RA 1XBTA 4DJTA 4HAYA 4BLSA 4KO8A 1VECA 2UZ3A 2GA8A 1OGJA 4G5QA 1ZM7A 1ETUA 5AWFC 1JPNA 2BBSA 4B3XA 3W5IA 4WW0A 2WMOB 4IDQA 3SNHA 4CT4B 3VO2A 1E6CA 4N3GA 2XOKD 1QVAA 2WOOA 3KDSE 1O3YA 1OYWA 3CUEF 4FD2A 4YONB 2JLZA 3D7MA 2JLQA 3PG5A 2FPMA 2GKSA 4HE5A 4ZDWA 1QHSA 4LHYA 3ZZ0A 2CDNA 3TR5A 1XD9A 3WNCA 2QSZA 2Z43A 4PANA 4BEBA 1JEDA 2FFQA 4POAA 1UKVY 5J4HA 2JLVA 3CMEB 1BMFD 4I81A 5BYJA 5AK0A 3GLHB 4PC1A 2WV9A 3L82B 4RKFA 3BB3A 1A82A 2BVNA 2HJVA 2IYYA 1W34A 3UG6A 2OZEA 1G5PA 4CW7A 4RD4A 2QG6A 1FUUA 4IXNA 1Z63A 1QHYA 2CEAA 1XCMA 1Z08A 3IQWA 3WHLA 2BMWA 4LPSA 1T5LA 1YITB 4TSFA 1Z0FA 2F1HA 2GAOA 4IDNA 4OJQA 4JYCA 4QRHA 1TTTA 4RFSB 3THYA 1TF7A 5G3ZA 2GEVA 1VQ7B 1GRNA 1IOZA 3TAUA 4EJSA 2OK8A 3O8DA 4C0LA 1KSFX 3Q85A 1Q3HA 3WYGA 1SVSA 4E5UA 2IWRA 2C03A 2QUZA 3Q5EA 3TBKA 5FOWA 1Q82D 1CNEA 1FZQA 2QPAA 1GNQA 2H7VA 2QGNA 5EE5B 2QQEA 1AIPA 4NMMA 4M22A 4DDUA 2IYLD 1S72B 3W2FA 4TTQA 1VQKB 4QBGB 1FQJA 3THWB 3WMGA 4MRSA 3W5HA 1NNEA 1L8QA 1VQ5B 4M9SA 1J8MF 1JXOA 2OHFA 2RGEA 4DDTA 1KI1A 1II8B 1YVDA 4ZCIA 1B23P 2JIZA 1QF9A 2YNMA 1GL7A 1J99A 4Q48A 5CM9C 4EH1A 2HXYA 4NYMQ 1NKTA 2QEQA 2GESA 1M6NA 2ZUBA 1UKEA 4GSYA 4ABYA 4B74A 1X3SA 4D81A 3RABA 1KMHB 2OCPA 1ZU5A 4WIAA 5KUTA 1AQUA 2FFHA 1Q20A 1XD2B 2J5XA 1MKYA 3I4LA 1T8UA 4HZUA 4B73A 4TLAA 1X8KA 3BB1A 4HAWA 1DO0A 2EYUA 2OXRA 3LVBA 2RGNC 4Q7KA 3T1TA 3HDTA 2GJKA 4RJLA 2FEMA 2AD5A 3QVVA 2QTVB 1WBDA 4XWKA 3UPUA 3WYFA 5JCZA 2C04A 3AF4A 1QFJA 3W3AA 1C9KA 1QFZA 2BM0A 1M7HA 1MV5A 3GEIA 1G4AE 3MG9A 1E1QD 4NHOA 3ICEA 3CWQA 4TQAA 2A30A 4ZI2A 4V03A 1G6OA 3K70B 2D4HA 1XEWY 1PV4A 2O8DB 4ASUA 2YC2C 4UJ5A 4CYMA 2O0JA 1G1MA 1SHZA 4JT2A 4O2RA 2XZPA 1RE0A 4DT1A 2FWRA 1G8HA 2RHMA 1P9NA 4DBLC 2YOHA 3NWJA 4C0BA 4QHYA 3FFAA 3OEEA 4PHFA 1P2VA 5IHPA 3CPEA 4JVLA 4K46A 4PC3A 3OEED 1GL6A 1HA3A 4EDHA 4PZYA 5CK5A 2CCKA 1LF0A 2G77B 5L3RA 3EPHA 1FRNA 3NC1C 3I8SA 1P2TA 3LQRA 5DYIA 3REGA 4MRNA 3NBFA 3T34A 4MKIA 2R6DA 1EG7A 4TT3D 4C7OA 5C1BA 2B7CA 1P5ZB 2PBRA 2AD1A 4B43A 4P33A 3PEVA 5D3MB 4MH0R 2PZGA 1H8EA 4RZXA 2AXNA 3VU9A 5KYKA 2DB3A 4F7DA 3LBNA 2IYSA 4ZPXA 1GKYA 2GEDA 2OAP1 4Q1BA 4RD2A 3AV0B 1UBGA 3CZQA 2DBYA 1G19A 1KI6B 2W6JA 1E9AA 1NN3A 2CNDA 1NY5A 3NH9A 5LDDC 1J8YF 3QFSA 4OYHA 2ZITA 4EFNA 2BM1A 4WZ6A 2ZE5A 3CR8A 3MAAC 1OE0A 4UNSA 1FQKA 5EE1A 2G1JA 1YJ9B 3SYLA 2OTLB 5B64A 3IQXA 1B2RA 2GJ8A 3LLUA 1UBCA 4LV5B 1GG2A 4RZ3A 5DHAA 3TSWA 2ZU0C 4A15A 4YMVA 1Z83A 2WSSD 4HZIA 5CIQA 3LAWA 4JMPA 1Z6YA 2GHIA 3CCSB 2H5EA 5DO9A 4MYCA 2QT0A 4M53A 3CCMB 2GF9A 1I2DA 1DAMA 4PO9A 3GLGE 1CR2A 1EX6A 1P72A 3HR8A 2XZLA 3QXHA 1F5NA 4B6FA 4PPFA 2VSOA 2BHRA 4XD7D 1FPMA 2WTUA 2JJ2D 2YV5A 1J7KA 1XRJA 3CNNA 3WBJA 2ZRJA 4ON9A 3IHLA 1D9ZA 1XXHA 1AM4D 3QJYA 3U4QB 4MYUA 1P7CA 1ZUIA 4YHBA 1RC8A 1E2DA 1W4BA 2ANCA 2R6FA 3EA0A 3OIWA 4A6XA 2WWHA 1MRNA 4MRVA 1XMVA 2OCBA 1DAKA 2QE7A 4QL3A 4K81B 2V7QA 4C0KA 3VMFA 1CJTC 4H9GA 1WRBA 2F9LA 2NQ2C 2QE7D 1QGAA 2WWGA 3FDIA 3KKQA 4G5RA 3UWKA 4A0HA 3OHMA 4TL9A 1W47A 2PZEA 2VQSA 2PLFA 5DSZA 1I4DD 3CW2A 5CB6A 2AFHE 5E7IA 1GO2A 4BPBA 2QTHA 3EPJA 2J0SA 3VTKA 1U8ZA 2WVJA 5EXXA 2WZQA 1IY0A 1E63A 3GJXC 4JJKA 2BN4A 2NZ8A 4UNQA 3ASYA 1Z5ZA 3TGPA 1X1SA 4AKEA 2OILA 4F92B 1NG9A 4Q47A 2WJIA 4NL4H 1EFCA 4CDGA 1JEEA 1R7RA 2VNKA 3H0KA 3TUJC 3L8ZA 1CS4C 2QZ4A 5CITA 1OKKD 2F1JA 2OT3B 1Q22A 2CL6X 4DQLA 2QSYA 4D26A 2F7SA 5J4YA 2XSZD 4P32A 4V0ME 4FW9A 2QMUA 2FSGA 1GFIA 1GOTA 2KE5A 4R7ZA 1F6BA 2I4IA 1KI7A 2ODBA 1H8HD 4KI0A 3VX4A 3UG7A 2QA5A 4QOSA 1DVRA 1PLKA 2JJ1D 2B6HA 1XF9A 4JLJA 4II7A 1SVIA 2EWWA 4EFLA 4QNRA 4KITB 4BLPA 4QNMA 1DS6A 1DAEA 4UXIA 5HR5A 3G71B 1XEXA 2JATA 2WBLC 4KCGA 1XB2A 5FH9A 4Q9JA 3CMAB 3FMOB 3SJZA 2DHRA 4MITA 1KMHA 1OH5A 2HEIA 1JJ2B 4R71A 2VEDA 3LQQA 2ZVQX 2CMKA 2YWFA 1I2MA 5TXGA 1A7JA 5TARA 3GJ8A 2SHKA 5K8UA 5TDHA 1UKZA 1P61B 2KBFA 1VMAA 5BYKA 5K8LA 1CEEA 5LB2A 1F20A 2Z5FA 2LWIA 3JVVA 1E2QA 3ADCA 1W0KA 2GTPA 3SZRA 4GNKA 1QG2A 4WVFA 1SVWA 1D8TA 1II0A 1DARA 3EPLA 2YWHA 3DOFA 5CIWA 5JRJA 1UF9A 1XMIA 5F9FA 2HUPA 2RH5A 3RC3A 1JAHA 3EASA 4M4SA 2J45A 5AJZA 5JMTA 1AKEA 1AS2A 1ZBDA 5B2ZA 3AVXA 2P5TB 4G1BA 3CBQA 4GZMA 2XOKA 4LJYA 2QGZA 5L3QB 4MA4A 3NC0C 2GJSA 2GBLA 1NJFA 2BCGY 4PAMA 1U98A 3B13B 2KWIA 4W7SA 1TUIA 5FL3A 1QVGB 1X86B 1E0JA 2J9RA 1BYUA 4DXAA 2AN9A 3KKMA 4A0FA 1XU4A 2BMJA 4HEJA 4NYJR 1RW4A 2YWEA 1KO8A 4P4TA 1W44A 5JWOA 3DOEA 1GP2A 2ZM5A 2GVDC 1XCPA 1AZTA 5JJKA 1WXQA 1KTVA 3CCVB 3QSYA 4EPVA 4HAUA 2WIAA 4QBFA 2MMGA 1EWRA 2GZAA 2PCLA 2B7BA 3IBGA 1SULA 2JLYA 4D0NA 1G8GA 1M90D 1N5JA 1MO5A 1Z29A 4PO1A 2HXSA 1P73A 3EWAA 4HAXA 3RS0A 3KQUA 2XSZA 1W1WA 2ZS8A 4CEIA 3VKHA 4A2PA 3U7FB 1A2KC 2XB2A 1D2EA 4LV8B 3QXCA 4DDWA 4URVR 1NBME 1NSFA 1ZVQA 4HDCA 4F38A 1IXRC 3QFTA 3GLFB 5IT5A 4L5BA 1GIAA 3QKRB 5UKDA 2FEOA 4Z1MD 1S0UA 3S1AA 3CPWB 1SXJE 2GWHA 2HT6A 4FMDB 4DCVA 4JVSB 1L7VC 2W2VA 2H16A 5FR1A 1WB9A 2YVUA 1S9DA 4O0MA 1T3HA 3GD7A 1HY3A 4FXPA 2REBA 2RGCA 1NI3A 3QF4A 4ZCMA 1G3MA 4Q19A 4TTPA 1NY6A 2QNRA 2CHVA 2AL7A 4TTRA 3P1JA 3CRVA 3I62A 4BFXA 5BWMA 3MJRA 4OQMA 1JA1A 4AI6A 5KO2A 1ZNZA 2V55B 4KJZA 1YRBA 2XX3A 4C2TA 1E4YA 1X8JA 4AYXA 2OLJA 3KB1A 3W6NA 3V9PA 4G0NA 4LJ9A 2BGJA 1CR1A 3LRPA 1NJID 1N0WA 1UADA 4XOIA 1C1YA 2QTFA 1X1RA 4QGFA 1KOFA 1GR1A 3U3MA 3MWJA 1VTKA 4Q9IA 3K09A 3K0SA 1VHLA 4NBSA 3PEYA 3PR1A 4L9WA 1Q12A 1KDPA 3TJZA 1E9EA 1ZRHA 3NKVA 1XTJA 4EJSC 3Q7PA 4BZXA 3AF0A 2ASEA 1KK0A 5AR1A 3LW8A 4I1UA 3AF2A 3LO5A 4HI0E 1EFUA 2Z4RA 4IDOA 1OPXA 4QHSA 1E9RA 3SDZA 3MJHA 1CTQA 1G3RA 3FKSA 4A1FA 3BK7A 1HEIA 2OEPA 3ZVLA 1Y63A 2PT5A 3C4JA 4LHZA 4LBZA 1RFLA 1V43A 4OBEA 4IW3B 2GEUA 1G21E 5KTYA 2IL1A 1VYUA 3QKSB 1G5TA 2WICA 1W7AA 1UDWA 2PZFA 2XAUA 4JSYA 4OL0A 3BAFA 4TYNA 4RD3A 2DEUA 1E2KA 5JJLA 3PUVA 3PQCA 1FTNA 2OK7A 4F91B 5JI2E 2Z4SA 4Q4AB 3ZQJA 5HZHA 1ZIPA 1SKYB 2ZUDA 1KGDA 4YAOA 2CRVA 2F1RA 3WMEA 1G3QA 3BC1A 2OCYC 5A4JA 1UMKA 4U00A 4YAWA 3TAHA 4D4JA 3GLFE 1ZUNB 1LW7A 1A4RA 1VCIA 1YZTA 4PHGA 3BBPA 1IJEA 4IXMA 4OQFA 1TU3A 1VG1A 2YWGA 4IVPA 4HDOB 1FX0B 4JKYA 5D3QA 5EP2A 1E0AA 2VYQA 1VCOA 3RYTC 1CULC 3EX7C 2NTYC 3FHCB 5DHFA 4Q9HA 4DLUA 1U0HC 3GCGA 4V02A 3NBZC 3TQCA 4Q7LA 2BMFA 4LHWA 2AWOA 2JDID 2C77A 2BMEA 3K0CA 2ZS7A 4PPQA 1OH7A 2R6CA 2EFCB 2ZRNA 1IN6A 2PJRA 1IJFA 3LW7A 1Z8FA 5FUXA 1Z07A 5EUMA 2ZSDA 1CP2A 2ZI4A 4YALA 5CDFA 1GTVA 1AK2A 3I55B 4RD6A 1L4YA 3LXRA 4RZUA 4EPXA 4KFSA 5GVSA 1U94A 2FGKA 1N2CE 3FHOA 4IJMA 1E2IA 2EFDB 1SXJA 1YRAA 4AURA 4I1SA 4LCBA 2A2ZA 2GETA 2JLWA 1NBMD 5FBLB 4BFSA 1AMOA 4LGMA 2J7PD 1WE2A 2WWIA 3BD9A 2CBZA 4OK3A 3ADBA 2J7PA 2KBEA 1NMXA 3KQNA 4TYWA 4B2PA 1GWNA 2O8EA 4US2R 4JKIA 2QPOA 1W36B 3B78A 4XJXA 3NDBB 4GP6A 2WIBA 5AJWA 2O52A 4LWZA 4BFVA 4C0AC 1IN8A 1ZYUA 3JQPA 3KXKA 1XTIA 3LLMA 3R9XA 1QUFA 1DG3A 4N1AA 1VYTA 2FZ4A 4FWIB 1GNRA 3EIHA 1VKJA 1FNDA 4MYTA 2WKQA 1JB1A 1RRPA 4MKFA 4V0LA 4PFSA 3F0TA 3KFVA 1P3JA 4FCVA 3LO8A 1Q3TA 1VCNA 2RMKA 2ZRAA 2OXCA 2DPXA 2AHOA 5FTMA 4OK6A 2G0NA 4YXWA 1ZP6A 3SFZA 3FE2A 3QBVA 1GAQA 3ETLA 2ZRDA 2DETA 1ZIOA 5FI1B 4KFTA 5GV8A 4LJ5A 3K70D 5CDFE 2HCJB 2LCFA 1XTSA 1RRCA 4PPGA 1YR7A 3A6PC 1WCV1 3OE7A 5SZJA 3RRZA 3NBYC 1N3BA 1MABA 2FE4A 4U9UA 2CL7X 2FA9A 3ZD6A 2A7QA 4CEHB 1VIAA 2GRJA 4QXAA 2JGNA 3CD6B 3SYNA 1JA0A 1Z0JA 4Y0VA 2ZIAA 2FGJA 3CRW1 3W6OA 3ZIAA 4EUNA 4OI4A 5JLJA 4D2IA 2ZRGA 3SN6A 4EQ6B 2D06A 1WQ1R 2OLKA 1DEKA 1VQ4B 5CJPA 2KI5A 1GJRA 4TSFD 3ND8A 4PSAA 2OSBA 1WP9A 1AGRA 1W0JA 1FUKA 2AR7A 5EMNA 1II8A 5H68A 1PUJA 1SKQA 2C99A 4EPWA 3UATA 3X1XA 3ZD7A 3OZVA 4WZAE 1IHUA 4US0R 3THXB 3DDCA 2ATXA 3A1TA 3ND9A 4OI0A 1JECA 3KUDA 2ZAMA 5FBVB 3AVYA 2V6JA 5G41A 1QGYA 1GNPA 5GV7A 2VH5R 3B60A 1VG8A 2VIIA 5JEDA 2VP4A 3O8RA 1SHKA 2NG1A 1G8FA 4LUCA 3D3QA 1RZ3A 3W2HA 2VA8A 1ZM9A 3OZUA 3R7WB 4L16A 5K8TA 3HU1A 4URUR 3WHKA 3LVRE 4BFYA 4UKDA 4TLBA 3W5VA 1D6JA 4ESHA 1NG1A 1VYVA 4MGIR 4AD8A 1U0LA 2C95A 2J46A 3LX8A 4M8NE 5AN9A 4W5HA 3JQQA 2C96A 3ZGXA 2DFLA 1EXMA 1FMLA 3B1ZA 5GJVC 1OFUX 1N6HA 3K0AB 2Q3MA 5E4FA 1NVXQ 1KO7A 2GZDA 5F9HA 1E2PA 4GOXA 1HT2E 621PA 3G6EB 5FTJA 2V4ZA 3HJNA 2G88A 3LD9A 1BO6A 4U02A 4R2HA 4PQFA 3RNLA 2CVFA 3QXSA 2XNDD 2W00A 5A0FA 3TR0A 1E3MA 2HLDD 1HT1E 3CM0A 3MRSA 4CT5A 3P27A 3JQRA 2NOAA 5KOYA 1QFYA 1KMQA 2CL0X 4GPTA 3D6TB 5E95A 4BFZA 2O8BB 4R98A 4TZ6A 2O8EB 2IBMA 3QEOA 4B47A 2GPJA 4Q1AA 3OESA 4D0GA 2IEYA 2HMAA 2EU8A 2O0KA 4EPRA 5F3WB 2WAYA 4AYTA 4F7WA 5JZVA 4TMWA 3I5YA 4NE2A 4XWOA 4ZCLA 1Q1QA 1Q21A 2QL6A 2ZJ8A 4H1VA 3QBTA 2I1VB 1SVLA 2VP6A 4M1WA 4U5XA 2QPTA 1Q1EA 3IBYA 2ZYVX 4PSVA 4DVGA 2HF8A 3FPAA 1SVOA 4NONA 2WJYA 4WZBE 4XSHA 2CNWA 2ATVA 3U7EB 3U3RA 1KKMA 2QRZA 3GJ5A 1G7RA 3CX6A 4KYIB 1T3LA 3I3SR 3L43A 4D4MA 3AQ4A 3AF1A 3NEYA 5BQ5A 3TRFA 5ELXA 1TAGA 2ZYTX 3ICQB 1QUEA 1QBKC 3E1SA 2ERXA 5J5CA 1EX7A 2C9CA 3BJIC 1UBEA 3MWKA 1EP3B 5B57C 4TLCA 5J47A 3KXLA 4B2LA 1MRSA 5A5GA 2XXAB 1R5NA 4RCZA 1E79D 3QEJA 1XDBA 1E1RA 3I72A 1ZCAA 3QFRA 4TMXA 1AA9A 1P9WA 1OFHA 2VL7A 2ZXUA 2CK3A 2QQ0A 5H70A 3A1UA 4AKIA 1H8ED 4Y9UA 2JCSA 4BZQA 2IYTA 4B3GA 1KJZA 1TVCA 1E4VA 3K9LA 4LBWA 1W87A 3BERA 4HYYA 4ZDIA 3QG5A 4RD1A 421PA 2FZLA 2GCOB 4FMDF 3K9GA 2GAAA 2H1LA 5FBRB 5JWHA 3RWMB 4DLZA 4IDHA 3W34A 4QJ4A 2Q9CA 5TR9A 2FH5B 4DSOA 4CGZA 4GFDA 4QGGA 3U3KA 3SFVA 5FOUA 1T8TA 1ZJ6A 1KDOA 3EZ7A 3GLIE 5LD2C 4BLTA 2YKGA 1H65A 4KVAA 4C0QC 1FRQA 3EARA 1P2SA 4XVQA 2V1XA 1NLFA 4UNRA 1W5TA 1J2JA 1VPLA 4LSGA 2IHYA 4MGYR 4Q1DA 1N8RD 3MMPA 2QP3A 1VG9B 2VNHA 2MMCA 4A36A 1K9MD 1II9A 1Q7YD 5DN6A 4PC2A 4ACAA 3GJ6A 4KBFA 4M9QA 1YHNA 1Q57A 4FIDA 4BLRA 1KO4A 2CHQA 1NKSA 3EIEA 1TQ4A 2P3SA 1V5WA 3RS4A 2OV2A 2IHBA 2MSCB 1R6BX 3PUXA 1OF1A 3UMFA 3KKPA 4ERNA 2PMDA 4NCJA 2OG2A 1EFRA 4PQRA 5SZHB 1GDDA 2Q0HA 4HZUB 1G18A 1YQTA 4OHVA 3R9IA 3MFYA 1E9FA 3U6KA 1LVGA 4JVMA 1OIXA 4A92A 1XPUA 4CRWB 3KTAB 1BS1A 3GEHA 1E79A 1N6IA 2JLRA 2O5VA 1Q86D 2OBMA 5AUOB 5FBQB 1N6RA 4HUTA 3P20A 3T1VA 2O8BA 2CE2X 2EQBA 2G6BA 2XITA 5IDVA 1E2NA 2IYXA 5DLQC 1GRQA 4F4JA 3EWSA 4LY6A 3VHLB 1RKBA 5SZKB 4M1TA 2VNIA 4KBGA 2ZRFA 3HWSA 3LWNA 1YZQA 1FW6A 2IYWA 4P0TA 1Z0KA 1KQSB 3BB4A 2GXQA 2WHXA 5JHGB 4TN1A 1VQ6B 1T3SA 1OB5A 1KI2A 2ZSBA 4M1SA 4TMVA 5J40A 1R10A 2PX0A 3M4YA 2J41A 4QKQA 3OZWA 3K1JA 2IS1A 2HV8A 2BBTA 4TMKA 2D3WA 3GJ4A 3ZVMA 2OBNA 3JVUA 4JLVA 1UPTA 2A9KA 2GZHA 5FFMA 3IO3A 4NCIA 4K8OA 5FUVA 4DCNA 1UEJA 5B30A 3VQTA 1JBKA 1KZGB 4DDVA 4RD0A 3EZFA 2BGIA 2X3UA 1EGAA 3PUYA 3PENA 1FX0A 2XXAA 3H84A 3ZC3A 1HYQA 3X1WA 1E2GA 3RDPA 3X2SA 3K0AA 1XPOA 2VP5A 4TQUS 4C3ZA 4KVGA 4N0DA 2ZE7A 3IEUA 3RHFA 3ZS8A 4Q7JB 1HUQA 4A4DA 1XE1A 4ZIRB 3F5FA 1XMJA 2W2TA 2ZVPX 4V0OA 3LNCA 3O47A 1X6VA 4NKRA 1LFDB 1KYIA 2ZYWX 4A8JC 3CF0A 3AKEA 4X8OA 1F2TA 2Q6TA 1Q1ZA 3W5JA 1TUEA 1WF3A 4XWAA 1DO2A 1ZCBA 4W5WA 3GLHE 3J81k 5H5JA 3GLGA 1VQPB 4IVQA 2D2FA 2ZRBA 4LJAA 2H17A 4Q5IA 1OHHA 1R5OA 1T6NA 1G7TA 1QH0A 2GBLC 1SXJB 1DOAA 1EFRD 3QIAA 3AVUA 3UXMA 4RCYA 4WXPA 1K5GA 1GVHA 5E7MA 5FL7D 2G0TA 3X1YA 4FMCB 3KJHA 4BWYA 4C0HA 4DCSA 4YAUA 3DKVA 5G53C 1QX4A 4M2LA 1M7GA 5FOVA 1BX1A 2RC6A 2VP2A 1XMSA 3G82C 1GUAA 1S2MA 1JR3D 1W49A 3CRRA 5DI3B 2FFBA 4JYBA 1NVUQ 4UXHA 3PUZA 1IN5A 4D4LA 2W83A 1S3GA 3RLFA 2QMEA 3IIJA 3GLFA 1YJNB 2ODNA 4JL6A 1NDHA 2VLIA 2GXSA 2YHSA 3TLXA 4OK5A 2ZRKA 1K5DA 3H4MA 3CZPA 1JJ7A 1PJRA 4GMDA 4YMTA 4OQNA 3CXCB 3C5HA 4S35A 4NYJQ 3PCRB 2I1QA 1NRJB 3UANA 2N46A 2QY9A 1YZNA 5KSYA 1ZINA 4TYQA 3CNLA 2HF9A 4LHVA 3T35A 3HYRA 4OKSA 5TB5A 3NTUA 5FOSA 1FNMA 4ARZB 4P3YA 4V0NA 1JALA 3TSZA 2ANBA 3BE4A 3BS4A 3L0IB 5FTNA 1FL9A 2ZI5A 2CNWD 1OXUA 4M1MA 1S1CA 1EP1B 3C15C 2IYZA 5C46F 4KODA 4KU4A 2ZU6A 2EFEB 1QRAA 2R44A 4LDJA 4IOMA 1J90A 3VX3A 2XZOA 3FYHA 1Z28A 2YINC 3CRQA 3CCJB 3LV8A 1NF3A 4OQLA 3HR7A 5HCIA 1NIPA 5DYGA 3TIFA 3TW8B 4EIWA 2R6AA 1CR0A 4LZZA 3I61A 4B76A 4PSKA 2QAJA 3I8XA 2Q3HA 4AK9A 5KNDA 1RYFA 2WPDA 2ZANA 2V7QD 2WAXA 2FV8A 2ZE6A 2JASA 1Z0IA 3O8BA 2GF0A 4CEHA 4IFBA 4LYAA 1QHIA 5KDOA 3PVSA 1AS0A 1BIFA 1L4UA 1NSTA 3DPUA 3BFKA 2BSAA 2OFOA 3A8TA 3SQXA 1TEXA 2OO7A 2RC5A 1OHHD 4HAVA 1YU9A 1R0XA 4K1XA 1ZNYA 2J7KA 3QPWA 1YI2B 4PGOA 3OIUA 4CF7A 1E96A 4Y9RA 3THXA 2F55A 2IUUA 4Y0AA 5EXTA 2PMKA 2Q9AA 1YJWB 3K53A 1KSHA 2Z83A 2AWNA 2QM7A 1FMJA 3PUWA 4C9BA 2GVZC 3DMNA 1OIWA 4TL8A 2GJAA 2ONJA 1ZD9A 4BFUA 1W36D 3OIVA 1XEFA 2R8RA 4PXAA 1TF2A 2C2HA 2I3BA 1XTKA 1RJ9B 4KFRA 4TLEA 3DKPA 3GQBA 2VP0A 1TX4B 4LJ4A 4BLOA 2V1UA 3VO1A 3RS3A 5DI9A 4B3DA 4B6EA 3QVUA 1BQEA 3W2GA 2IWHA 1W4RA 1KHTA 4LBYA 4M9ZA 1QGZA 1KNXA 1A5TA 3DO6A 2O0HA 1E1RD 4LYFA 2P6RA 3AUXA 1Q1BA 4URWR 5JHHB 1N0VC 4DLYA 2NMVA 1IY1A 5FTLA 1CBUA 3AP2A 2X2EA 4D80A 2J59A 5F98A 1R4AA 2NO1A 1E9BA 1P9RA 3B1VA 2EFHB 3QF7A 2RGBA 4PTLA 3MD0A 4MDEA 2A5YB 5KSZA 2IS2A 1WMSA 2B8TA 1ZM2A 1KO5A 5FA6A 3X1ZA 2QAGA 4ILEA 5CK4A 1P75A 2J0VA 3N5CA 3OZXA 2PLRA 2IS6A 2QTLA 1KAOA 2XTMA 1XTRA 1E9DA 2C9YA 4PPNA 3JZAA 5FOXA 4Z54A 3MCAA 2MSDB 2XJ9A 1N6KA 1OYYA 3IUYA 2XEXA 3SJCA 1JPJA 2VHTA 1HE8B 1KD1D 2VO1A 4G01B 2H57A 4RZ2A 1G41A 2ZJAA 2ORIA 2P5SA 3GJ0A 3GMTA 1W36C 1QHNA 4YXWD 3I1FA 2R6GA 4G5SA 2OBLA 2FX3A 4URZR 4ZIRA 4EJSB 4CEIB 2QMOA 4DB2A 2KB0A 1C4OA 2X1VA 1KZ7B 2FN4A 3KXIA 3CF2A 4B4DA 4X8HA 4YDHB 5JCPA 5DIFA 5L3SA 4BFTA 1XFAA 1IXZA 1G17A 1P60A 3MLEA 3SYKA 3T5GA 2ZREA 4Q1EA 5JBQA 2IF2A 4IKEA 4EPYA 2NGRA 2ZETA 2ZRPA 3VNUA 5EP4A 2CE7A 1SZPA 5DH9A 4E22A 1W5SA 1IBRA 1E62A 3OW2B 4BE7B 2BEKA 1Q81D 4GZLA 1NN0A 1LF5A 1H8HA 3CCUB 4I99A 3OJWA 1S3SA 2WWWA 2ZEJA 4IOKA 4OQXA 5FUWA 1VQ9B 4PAQA 4QM7A 5KNBA 1AGPA 2HCBA 4RSGA 3R9WA 3O8CA 2W0SA 4E03A 1M34E 2XB4A 2P6UA 4D82A 3CC2B 2CCGA 2BBWA 1HQYE 2R65A 5TMPA 1W2BB 3M6AA 2N42A 1YIJB 3CPHA 2UVQA 2FF7A 3TSOA 3B2EA 1ODFA 1SGWA 1E0KA 4MDFA 1KJYA 3QKTA 5FBWB 2PT7A 2IXFA 2ZROA 4Z51A 3NHBA 3WYAA 1ONBA 1G4UR 3AVOA 2VF8A 1KI9A 1UM8A 2WJGA 4LOAA 2UKDA 1XWIA 3CX8A 4NYMR 1RRGA 2GCPA 1Z6GA 3L0OA 4CZ2A 4NCHA 4RFSA 5F2EA 1G9XA 2QROA 4IFEA 1GAJA 8OHMA 1RRFA 3THYB 1CXZA 2C5LA 4G5OA 4DUGA 4GMXA 2ZS9A 4D4KA 1LY1A 2G1KA 3Q5DA 2EIXA 1DADA 1YZLA 3CCLB 2CJWB 4HATA 4KLNA 4QBIA 2GXUA 1NJGA 4URYR 2BKUA 4NH0A 5EP1A 5JEEA 1QVRA 1VQ8B 3DHWC 1J9ZA 2RHDA 2FPLA 2FOLA 2PH1A 3B1YA 4D25A 3KX2A 1E2MA 1O87A 2NIPA 5ANRB 2DR3A 3A1WA 2FSFA 2X2FA 3P4YA 5DN6D 1OFTA 2BEJA 1F2UB 4LK2A 1M1KD 5FPSA 3C8UA 4DLTA 1A2BA 2J0UA 3QFCA 4P4SA 2RKOA 3RSOA 1Z47A 1ZM3A 4YQFA 3AB3A 1NBMA 2CLSA 5JRZA 3ZVNA 1W4CA 3TUIC 2IUTA 3I32A 4P4UA 4PZZA 2QBYB 4Z1MA 1EESA 4HLUC 2XGJA 4TYYA 3EZ6A 2W0MA 4DSNA 3KQKA 1QDEA 4P31A 3AP3A 1AZSC 4JT4A 2V6IA 3AVQA 4V0MA 1TLLA 3K0FA 3KQHA 1K6MA 1JJVA 3QUSA 3EC1A 4XTCS 4TLDA 3WP1B 1A8PA 3RC8A 1KO1A 1XP8A 4G1UC 4W9MC 5FI0B 5C2JB 1DBSA 4EAQA 4ESVA 3CONA 1OXSC 1ESNA 1Z06A 3CO5A 5KHOC 4L4UA 1G8YA 3VR3A 1CIPA 4YDSA 2QI9C 1TMKA 2P2LA 1GKIA 3GJ7A 1AQYA 4HLCA 1S4QA 3HU3A 3T1QA 1U2RA 4JVNA 1AKYA 4CIDA 2BF4A 3AM1A 2V8OA 5CYOA 3VR1A 3TNFA 3EW9A 4CEJA 1IONA 5EZ5A 3KKNA 4XH9B 2G9NA 2IF0A 4AYWA 1E2HA 2F1IA 1NMYA 2O8DA 4LBVA 4LX0A 2WWFA 1PLLA 3PIRA 3W3ZB 4OHYA 1E2LA 2XNDA 4DSUA 4MGZR 5FUYA 1GM5A 3QPUA 1FP6A 3EXAA 1QHXA 3FB4A 1ZAKA 2DFKB 3ZQ6A 5M04A 1E2FA 1KDTA 2XNCA 2ZR9A 1DAFA 1F3OA 2ERYA 2W58A 4NPHA 4PC7A 2L0XA 4GBMA 1BKDR 1FOEB 1US8B 1JI0A 4X8MA 3BH0A 1HH4A 2WSMA 2D7CA 2BV3A 3VR6A 1CKEA 1QHHA 1DG1G 2QU8A 1S96A 3QXJA 1KI4A 1XD8A 4YLGA 4UNPA 1F2TB 3B85A 3W5UA 2Y8EA 2VTKA 1UAAA 2RCNA 2ZRIA 1OKKA 2VF7A 3W9YA 3AGPA 2IW3A 4C0SA 1TADA 1U90A 3PEUA 4Q4LA 1T4GA 2ZRMA 2JAQA 1XNJA 3MUFA 1YKSA 2F3RA 3CH4B 4F93B 5DI3A 4LV6A 4KFUA 1ZNXA 1PVOA 1KI6A 2CXXA 1JQJC 4H1UA 3R8CA 4DSTA 1LS6A 2AK3A 3RSLA 1F48A 2ODWA 2KJQA 5G3YA 4Q03A 4HUQB 5EXPA 2WJVA 3C41J 3QKUA 3LBHA 1CLUA 4HDQB 4YC7A 4DRZA 3Q9LA 4UJ3A 1DAHA 3MSXA 4J0QA 3RS5A 5C4MA 5H8WA 3L0SA 1N5LA 1U9IC 2HJGA 4WBSA 1G7CA 3ZVRA 1NLZA 3IILA 4HLDA 3W6PA 4JLKA 3FPKA 4BRUA 4TT3A 3HPQA 4B35A 4PHTA 2WKPA 1IAQA 3IPYA 2ZI9A 4Q7MB 4IDPA 3H1TA 3MWLA 2NPIA 1F2UA 1W2GA 3ES9A 3LBIA 5HXBA 4GI7A 2V3CC 2WKRA 1RYHA 1N5KA 3Q8XB 1N6NA 4AF6A 2BDTA 4QC2A 5IK2D 4D6PA 2E87A 4QJ3A 5TVKA 4KYUA 4LRWA 3VR2A 4ARZA 5HKKD 1YE8A 3BIFA 4NZYA 3U4QA 1W2HA 2A5FA 2G3YA 2JDIA 3LX5A 3BH6A 1KSGA 3VR4A 1E99A 1CR4A 1Y3AA 3U44A 2AKYA 2W6JD 3L0PA 3B7GA 1SKYE 5BN4A 5FPKA 4KLZA 4RKEA 1CF4A 2KSQA 2X8AA 3B8HA 5E7JA 1NLYA 4B34A 1EFTA 1GL9B 4JZKA 3T12A 2QN6A 3MHPA 2DWQA 2ORVA 4AC9A 1D2MA 1ZMXA 1H42A 4B48A 1T0JB 3RS2A 4MQBA 5DGXA 1B0UA 3IGFA 3NG1A 3WP0A 1RIFA 5J4LA 1N6PA 2BKEA 3GP8A 1BJKA 2JLUA 2DFTA 1QG4A 2TMKA 2IYRA 3ZBUA 1VG0B 2QT1A 4L15A 2PL3A 3OIYA 2NO6A 1S9HA 4LHXA 1OT3A 5KDLA 1G64A 3U7HB 2ZSFA 3A1VA 2VYFA 4US1R 5CLQA 2JJ8A 3RAPR 3OFNA 3K0CC 4Q4HA 3WY9A 3GFTA 5CLLA 2RAPA 2OFWA 4UXJA 4ACBA 1TL7C 2HYDA 1FNCA 3ZDQA 1G16A 3W2IA 1OW3B 4M1YA 4B3BA 1DDIA 2AK2A 2EWVA 3EA5A 4IVRA 4DC9A 2P6NA 4TMZA 3R8FA 2PIAA 3NBXX 3NVAA 3E5HA 3FOZA 4PHHA 4QGAA 1E9SA 4R9UC 1JQLB 2J0UB 2ZUCA 4TMTA 4BRWA 1KC8D 1QHGA 1Z22A 1X8LA 1E0SA 3AEZA 1W46A 2CHGA 4TQ9A 2LP6A 4NDZA 1SVKA 1LV7A 1T9HA 3ZZUA 2ZRLA 3FMIA 3QE0A 4DEXA 2PCJA 1BYIA 2NO9A 1Q44A 2BOVA 1ZW6A 3K09C 3VFDA 4HB4A 2FMXA 1W0KD 5FOTA 1KK2A 3SJBA 3DZDA 5G40A 4BFWA 3RWOA 4PC6A 1D2NA 1KK3A 3A37A 1W4AA 2ZR0A 1XPRA 1ZD1A 2RGXA 4GDFA 3RRMA 2FJUA 3BGWA 4Q9KA 3QKSA 1IXSB 4Q18A 5CM8B 1DELA 1PZNA 3UIEA 721PA 3P4XA 2B5OA 3G0HA 1I4LD 1G7SA 3C7KA 4AWXA 2A3RA 4O2LA 3P26A 4HB0A 3WRYC 1VIYA 1SXJD 5JECA 3DVLA 1OFIA 4IOLA 1CRPA 3CX7A 4LYHA 2FFAA 1ZD8A 4YMSA 4GOJA 2QORA 1WBBA 3V4FA 2QM8A 3LVQE 4NU0A 5K8IA 2ODEA 1U9IA 4DCUA 1XEWX 5D3MA 3FKQA 1FNBA 2IX3A 4A82A 3VU9B 3B6EA 2D62A 1HE1C 2F9MA 2GNOA 2XJ4A 1WA5A 3AH8A 3ONWA 4HSEA 4OI2A 3REFA 3OFND 3U61B 5EJEA 3T06B 1UJ2A 3ADKA 4RVCA 3Q7QA 3H2YA 2ZPTX 2PEYA 4JL8A 1W0JD 4BQSA 3WNBA 4G1VA 2AKAB 1GSIA 3U2QA 2WM9B 1EWYA 4R2IA 5AJYA 5JWRA 4M9XA 4HB3A 1YR9A 3U44B 3AVTA 4XVUA 5KNCA 4IEEA 3KJIA 3U3OA 1U0JA 2V54A 5JSZB 1MABB 4M21A 3TW4A 3SQWA 4BGDA 5EQTA 5FL7A 5LBIA 4NCNA 1VQLB 2MSEB 3BOSA 2ZTSA 4MKGA 1R8QA 1ELOA 1N6OA 2ZI7A 1ZC3A 1DTSA 4FMCF 2FG5A 5H59A 3CRMA 4MKHA 1G20E 4DQKA 1MT0A 2LKCA 3SU8A 5KU1A 4DUGD 1EP2B 4YAFA 1KIMA 2CLDX 3AKCA 1UEIA 2DYKA 4ITRC 2DERA 3X1DA 4KXFB 3SBEA 4AKHA 3ZBTA 3GLIB 3QI2A 1JR3E 5DE3A 1Z3IX 3A58B 2J0QA 1I7PA 3D31A 4JIMA 2CVHA 2IXEA 4NTZA 1MO4A 3QKRA 1K73D 3VNVA 3TH5A 2YOGA 4L8GA 4HAZA 4JLBA 4O25A 3CF6R 1YR6A 2OAQ1 1BOFA 4S2EA 1TQ2A 3CWZA 3W8RA 1CU1A 3BFVA 2P65A 4CVNA 2NPFA 3TE6A 4Q4AA 4LPKA 5KSOA 3CC7B 2Q21A 5LB4A 4DIDA 5FPYA 2ZE8A 1G291 1MH1A 2J1LA 1OH6A 2REXB 1VDZA 2CCJA 4LJ7A 1E64A 4Q4JA 5EE9A 2QP4A 1R0YA 1VQOB 3F3YA 4JLDA 2HDNB 1K8AD 2WOJA 2CJWA 3QXXA 1OJLA 3N2IA 4ZKEA 2W2XA 3L2OB 2VHCA 2VHJA 3AKDA 2QTZA 4QBHA 4LC0A 4AY2A 4M1KA 4A2WA 3A36A 4C2UA 2VSXA 4Q02A 2O8CB 5LPNA 4AKGA 3HYTA 5DNYB 4C4PA 1KY2A 5THXA 1G5RA 2R2AA 4WAUA 3EC2A 1M8PA 2WPDD 2JEOA 4MYHA 3BRWD 4PX9A 2IK8A 5CJ2A 2RGGA 2IYVA 4U7DA 1IM2A 1HTWA 3C5CA 3A4MA 1RJ9A 2Q3FA 3FGNA 3SOPA 1ZU4A 1XTQA 2RGDA 2R62A 3K0FB 3KUCA 3AVVA 3MGCA 4BPRA 4XTRA 3UWOA 2WWYA 3H86A 2ZR7A 1IN7A 2O8FA 2ECKA 3CH5A 4P4SB 1PUIA 4OI1A 1S1MA 1FNNA 5IK2A 3RVBA 4JLOA 3TVDA 3U3JA 1OXTA 2EFGA 1DAIA 1TEVA 4MRPA 5EE0A 4KSCA 3GEEA 3SJAA 2X19A 5J4KA 2IA5A 3CPJB 1SVMA 3SI7A 2JA1A 4DKXA 3E20A 1D5CA 2PEZA 1P6XA 2ZSAA 5BN3A 4Q1FA 3E70C 2RB4A 4Q4HB 4Z8XA 4XVRA 3ZYCA 2V9PA 3CNOA 5L3VA 2D7DA 4JS0A 2QRNA 1OH8A 1R5BA 3IO5A 1UFQA 1DE0A 1LNZA 1KRHA 4Q00A 3GFOA 3R7WA 1OXXK 2X77A 2QA4B 1EK0A 4QHTA 4DLXA 2QDXA 1Z6TA 2QAGB 4PZLA 4I4LA 4ASUD 1P62B 3WNDA 4Q21A 4DZZA 3KFXA 4DLSA 3EZ9A 1H85A 3B9PA 5FTKA 5AUNB 1R2QA 1Z6AA 3AP1A 2BMDA 5J4VA 1E1QA 1G6HA 1QZXA 3QG1A 4DCTA 4E07A 2VNJA 4JLPA 2R9VA 1DDGA 3VKGA 1XX6A 4CEJB 2QAGC 4JBWA 4Q1CA 4BECA 1NMZA 4DB4A 3ZIAD 3ZH9B 4QJ5A 3FKSD 1NVWQ 4BZPA 2B8WA 2RGAA 2C78A 1QG0A 2C9OA 5L3QA 3WXMA 1QHHB 5FPHA 2FU5C 5EE3A 2VRWA 3G5UA 2ZAOA 4ZI3A 1IB0A 1GITA 3QE2A 4XIGS 2ZI6A 4TL7A 4BUJA 3WRXC 2ZRHA 1J70A 4XD7A 2DFNA 1IN4A 2FPKA 3ZZTA 2NO0A 5HTKA 1PLJA 4HB2A 4TZ0A 5LD2B 4WA7A 3OEHA 4JJZA 4ZGNB 1ZM4A 1Z0DA 4NYIQ 4A8JB 4FCTA 4ZDKA 4IRUB 1FFHA 3I5XA 4QFMA 1KNQA 1QVFB 1FTSA 5KDDA 2R6HA 1CJKC 4OHWA 4PO8A 2JIZD 2DCUA 2BWJA 3Q72A 4GP7A 6Q21A 2GQFA 3TVTA 3OAAD 4FINA 4N3NA 1N6LA 2A5JA 3D8BA 3BFXA 2K5UA 1WDTA 3NHAA 3PJRA 5FPTA 3DMDA 1LTQA 2VHQA 121PA 2WWXA 3UMSA 2H18A 5HCNA 4JBYA 1YHQB 3E1YE 4F4CA 3GPLA 5BW8A 1YJ5A 2HLDA 3VKWA 2ZI3A 3CIOA 4MUBA 4IHQA 4JL5A 3QQ5A 4B3FX 5JS8A 1G8PA 3I73A 3CKLA 1XXHB 1MO3A 3AGQA 3FJOA 3CCRB 1AN0A 1UDXA 1YZKA 3GFPA 4BLQA 4HLQB 4TL6A 3T5DA 1UKYA 3AVPA 3IDQA 3KJEA 3U6BA 1T0HB 2IXGA 2A78A 3QNUA 5E3HA 1RVDA 2HYIC 5B58C 4RY2A 3KZ1E 1DAGA 2IYUA 1M2OB 3KL4A 1CNFA 1XCGB 2IYQA 2D74A 4PAOA 5C18A 2YJTD 4DHEA 2Z6VA 2NO7A 3UMRA 4AIIA 2ZJBA 2W6IA 1NVVR 5AJXA 1KI8A 4MUAA 3SS8A 3IKJA 1OB2A 2AFIE 2YOFA 1JAIA 4C30A 1TPZA 2H92A 2GJ9A 521PA 4UAJA 3FFBA 3AUYA 3T15A 2QMHA 1XJQA 5KPDA 1ESMA 2BBOA 2AXPA 3PITA 1W48A 2ZYUX 3M0EA 1DPFA 2GCOA 1EWQA 4OHXA 4YMWA 2YYZA 3TUZC 2VSFA 4WQMA 1Z2CA 1KK1A 5KSPA 4M1OA 2DY1A 2OUKA 4B44A 3B5JA 1NL3A 1R8SA 1D1NA 1UBFA 2OE2A 4I1VA 4O3MA 2FDCA 4B71A 1OSNA 3F8TA 4KV9A 2YC4C 5BN5A 4KHZA 4LI0A 2J3EA 2A5GA 1N5IA 2LKDA 1SQ5A 1VCMA 3OJXA 2BPOA 1GVNB 2C8VA 3EG5A 5HE8A 1ANKA 1HV8A 4ZKDA 2QBYA 4B33A 3C16C 3LY5A 3A4NA 3OAAA 4Q4JB 1W35A 2E1RA 2OM2A 4JLMA 3CCQB 3LH5A 1E69A 4FCWA 1MO6A 3WMFA 4LC1A 2GK7A 2XTZA 2VPPA 4WXRA 2J87A 4RFVA 3DL0A 3U5ZB 5HZKA 1E2JA 2ZJOA 1G3UA 3MWYW 4OHZA 5HPYB 1ZUHA 5JS7A 4MRRA 1M74A 4EKDA 4G5GA 1HURA 3FMFA 1EFHA 2CLCX 4GL2A 5HKKA 3L8YA 4LJ8A 3JZMA 4TWZA 2QP9X 4GT1A 2VP9A 1KKLA 4Y7CA 4DT1B 4GRAA 1L2TA 1COWA 5H1YA 2B92A 2P0EA 4JLNA 3TMKA 3RRYA 2F3TA
chains in the Genus database with same CATH superfamily
1T9KA 2PR3A 1Y0BA 2QEXB 3BH7A 2F3PA 3DTVB 5JQGA 1A98A 1S8FA 3A7VA 5E6RA 4MMYB 1IQPA 4DIHH 1NIJA 3A70A 3ETEA 3STVA 3SEAA 4L75A 1EK6A 1BDMA 4HCJA 1U0EA 1AUQA 1MG0A 1T91A 4Q6WA 1FP7A 3RUPA 1Y9DA 3B6ZA 4HQLA 3KOMA 3M3TA 2OGTA 5HFAA 1NQTA 1Y80A 2IS4A 2VUHB 3OWHA 4TVBA 1L8OA 4Z4WA 5GAJA 3F9IA 2HPAA 3R3ZA 3PEWA 1AJEA 5BXQC 1Y7PA 3WLLA 4BAQB 3WGKA 1WZNA 1SLXB 3AR9A 4IMRA 4C5BA 5AFZH 2FUG1 4DNRB 5MN4A 3I12A 1MAVA 5F1KA 1ZJYA 4YMUA 4TXMA 3UFBA 4TVKA 1DZIA 4GOOD 3S1LA 1DEHA 3VR5A 4J7AA 4CIBA 3QF4B 4BO9A 5EW1H 2J5KA 1B43A 4YWHA 1O4WA 3KHKA 2AGEX 3EAQA 2XMQA 2M2AA 3EJWA 1LDGA 1ND5A 3B82A 4C43A 4FI3C 6GPBA 4CR5A 1X39A 4UW9A 3UBTA 3U1IB 4KIUA 4BWGA 5FR2A 3LONA 5C0OE 4LZNA 1HQKA 5IF3A 3ERCA 3AF3A 5K0CA 4FYJA 2C98A 4D0LB 4OO3A 4FN5A 4GOND 4L95C 3BMCB 1RQNA 4G6ZA 4FMBB 4MR8B 1BS9A 2NQ8A 5IS2A 2SNIE 4RH1A 4MEAA 2EYQA 3M7IA 5F77A 4LC9A 5SZIA 2C93B 3UK0A 2BCJQ 4IEIA 4WGFA 1RTTA 3KQLA 4UQOA 3P7MA 4CNBA 3B1WA 2REOA 2FNAA 3O1LA 2HGZA 3A4LA 3LC0A 2IT1A 5KPJA 2E9SA 4OVKA 2C3SA 3CMCO 3FBWA 2GA8A 2VZ0A 2O3UA 4HYTA 2YX1A 3SNHA 3VO2A 4DFDA 1DC8A 1YLCA 3HFRA 1A4UA 2GKSA 4HE5A 1J97A 3WA7A 3WNCA 1N7HA 3PRKE 5EAIA 2DXIA 3VYWA 3VMMA 5H7XA 3PXAA 2EKDA 1T36A 2E5LB 4RD4A 1A9XB 5D3ZA 2CEAA 2H1HA 1CVRA 2XKBA 4ER3A 3DVRX 3FIJA 2GEVA 2WYGA 2ZTYA 2QJRA 3O8NA 1KQFA 2PZ8A 3DO5A 1UVPA 2ZXFA 2HWKA 4MVJF 3G05A 3A6ZA 4QULA 1Y1RA 1GU7A 2IYLD 3NIFB 5DNAA 2Q5EA 5D5HA 3ZU4A 3RXKA 1E6UA 3ZCUA 2FIRH 1AE5A 2NXCA 4FFDA 1GADO 4Y2UA 2XUOA 1BGXT 5IM4F 1EZ4A 3ZH2A 1FFCA 1Y37A 1QYRA 2HCTA 4PWYA 4EJ6A 3WYFA 2D1JA 1BHXB 4NBUA 4V03A 1JDPA 2X3FA 4ER7A 5AKJA 1RE0A 4LKOA 4Z2YA 2AMLA 3UJHA 5AVKA 4JVLA 2CCKA 5L3RA 2BXUH 3TF5A 2XMCA 2X0IA 1JJAA 5TCAA 2PZGA 1RWWA 3AHGA 3F2GA 3LBNA 4ZPXA 1KI6B 1NN3A 1EZ1A 2ZU3A 1TABE 2A0KA 5ALEA 5A5DA 3CR8A 1F38A 4UNSA 2PIDA 3PP8A 4LIPD 3SC2B 5B64A 2NW6A 4RF4A 4PRYA 1D1QA 4X8SH 2VDUE 1CUCA 2VT7A 1Q15A 3CCMB 2JHCA 3GLGE 1GVLA 3UHOA 1EX6A 2WYRA 4BS9A 1MENA 1FPMA 4WEOA 3IP3A 3FH0A 3PTNA 1Y9JA 1N78A 2EQAA 4W8HA 2F9PA 3HY4A 1O3PB 4KXUA 3HHEA 3KQPA 5KJFA 3I6MA 1W581 5E7IA 3PJDA 2IY8A 4CH2B 4JOQA 1MEEA 2P9TA 4ETMA 5TLSA 3OKCA 2BFFA 3UR9A 1CS4C 1EKXA 1SG8B 5FULA 1G3DA 3S69A 2QN1A 5I9MA 2F7SA 1R50A 3K6SA 3GLUA 1HE5A 4EI2A 4MPJA 1NRXA 1GDNA 4QNRA 3OCVA 2WBLC 1M8FA 4MA5A 3L7NA 1H0HA 2W48A 1YC0A 3VC1A 1E5QA 1J33A 2SHKA 3UW3A 3K32A 3ADCA 3HFSA 1J1UA 3DOFA 3ZDFA 3RC3A 5AJZA 2JIOA 1NULA 1YRLA 4YREA 4UUQA 1HFKA 3DXXA 4YH1A 3H65A 3E6PH 1TX8A 1TUIA 3FCXA 4P5PA 3EZGA 2HXGA 3TL3A 4NYJR 1KO8A 1HBTH 1J22A 2FPSA 4H16A 4TSKA 4E94A 1EWRA 4IW4E 3LIWA 1CQIA 4D0NA 5JAZA 1P73A 2ZS8A 3RYFA 4H6PA 4J2YB 3N86A 3TLMA 1JT2A 3M9XA 5A4FS 4FE4A 2CJXA 3I45A 1DMRA 2Q1TA 4MARA 3RC1A 1HY3A 1RHMA 1OTXA 5I9BA 4AKSA 4R8VA 3GA5A 1M6YA 4M87A 1YS1X 4KOEC 3MJRA 1JA1A 1V11B 1ZNZA 4C2TA 4KJZA 2XX3A 5EKUA 2XTJA 1E4YA 3PHHA 4LJ9A 4CM4A 3G49A 4U2GA 4XOIA 2AR9A 2KAIB 2CXNA 3FWZA 2RI0A 5HSGA 3K92A 4RF5A 2NZUG 3ESXA 4XGKA 1U9JA 1ZRHA 1XTJA 4KNVA 3SZ3A 5IJ9A 2G5VA 1TXGA 2FE1A 5JDUB 2YIDA 4P9SA 3FOWA 2XCRB 4O29A 5GWXA 2I54A 3BTUA 3DCLA 4DPKA 2XYGA 1Y63A 3ZHVA 1X94A 1AE8H 2BFDB 3UHPA 2CXUA 1DJQA 1Y1SA 3GVJA 4D3DA 3U13A 3G8AA 4LDRA 3BWCA 4X6XA 2QZSA 4ZHLU 4UULA 1G3QA 5JBTA 3T0FA 2BLVA 1ZJJA 2XYQA 4I6JA 4YAWA 3UJDA 2V96A 3GLFE 1RQGA 1VG1A 2GERA 1YXMA 1RBYA 2YXLA 2ZIGA 1DRVA 3NOXA 1GBKA 5CUQA 2Q8QA 1EX1A 3STIA 2Y1DA 2J5QA 3RLIA 1DQZA 2HTEA 1VLLA 3KBOA 3FHOA 3H9UA 5HZBA 3W04A 2EFDB 1BA2A 1C4XA 1QIJA 5BUSA 2ZHEH 1RAGA 2PK3A 2AUTA 2R6ZA 3D2CA 2G25A 7ADHA 2VH1A 1U80A 3U7JA 1UDBA 2B7LA 1WULS 1NBAA 1QUFA 5EMJA 2ASUB 3OPYI 4FCVA 1Q3TA 1J5XA 2XGGA 3ZHXA 2PQ6A 4IZHA 5G4BA 1NFRA 4BX2A 1WOFA 4V39A 5IAEA 2AN1A 3EYWA 3SYNA 1RPNA 3BDAA 3DT8A 5BWCA 2ZYAA 4RIFA 3GQVA 1IHUA 4C4YA 3THXB 4Z4CA 4EYQA 2BT4A 1QGYA 3GT3A 1G8FA 1QY6A 3ZK7A 1I7SB 4IN2A 1G60A 4M54A 3SS7X 1U8XX 4PS0A 4PSCA 3V2GA 2FP4A 2J46A 1AMNA 5AVZA 3ZGXA 4X24A 1UKAA 2XKKA 2DHEA 2Q3MA 1L1NA 1UPXA 3NWEA 4BO8A 2XCIA 1QBNA 2QLLA 5KOYA 1ANDA 4XR6A 2AEFA 1O2PA 2IJOB 3BSQA 4L0MA 1RS0A 3PNYA 1CPYA 4MIOA 4NE2A 3MBIA 4L4XA 2VP6A 2AC7A 5FLKA 5LJLA 3I09A 1FP4B 2X41A 3PDWA 2PBZA 3TRFA 3ICQB 3ASRA 2O14A 2DSTA 4GPIB 4KQ6A 4B2LA 1MRSA 1VBNA 1DU4A 4B4KA 1E1RA 3EY9A 3NGLA 3TMYA 1QK4A 1SUPA 5JNUA 1FYFA 4LMBA 1N9GA 2NWQA 2KW5A 5E3JA 2GAAA 3RWMB 5KAPA 2D54A 1EPTA 2AFHB 1ZJ6A 5LD2C 4BLTA 3GDVA 1QFKH 1PJBA 1FRQA 1WHSA 3A3GA 3IAS1 1L4EA 5HCUA 4XEUA 2PNFA 5FLEX 1XA3A 5DM0A 3I2YX 3HA7A 4PLGA 3VNRA 2EQ5A 1AO3A 3NHLA 4GH5A 4HNTA 1EINA 4YMLA 4C7JA 3PVDA 4JVMA 2XRMA 5KYUA 5FBQB 3T1VA 2AN3A 2CYCA 4MB2A 2QXJA 5K3CA 4F4JA 2Q7OE 4LY6A 3A1FA 1KQSB 2PO7A 5EY5B 1Z8GA 4MVJH 1VQ6B 1FQWA 1R10A 2J4IA 1PPCE 4AJNA 2BBTA 3PNQA 1ARBA 1C8VB 3HRKA 1UPTA 5CMXH 3C97A 3ELDA 4RPDA 5FFMA 1UVOA 4UM7A 3CTAA 3B70A 3GI1A 3MS2A 2I4LA 4EATA 4BX9A 1XRPA 4EHHA 4QDZA 2VTBA 4J7UA 2OKCA 4ZCNA 3KPJA 1KYIA 4IVQA 2GARA 2GBLC 1T6NA 1X9IA 1ZRBA 3TRDA 4M9UA 4BMPB 3K0HA 3WQRA 5B3KA 1O2XA 4I50F 1DIBA 1JR3D 1ZMOA 4CPDA 3BGOS 3MPOA 4A6DA 1VCWA 1SVUA 1ODTC 2ZRKA 2HRZA 2QQGA 3L4BA 3QLVA 4O2BA 4S35A 4XLCA 3HWRA 2QY9A 4YT4A 4FHDA 5EQSA 1CDEA 4OYRA 3ESQA 3QX7A 5C46F 1GL0E 2GDEH 2UWPA 3FYHA 5HCIA 5KYXB 3EF3A 2R6AA 4B3JA 2ZPUA 5L7TA 1RYFA 1F2DA 2Y1EA 5AKXA 3W5SA 3TXXA 3RO7A 3QA3E 1JAZA 1ODKA 4LZAA 3MIZA 4P3XA 1CY6A 3Q9NA 2AE1A 4GPEA 3SGLA 1W12U 3RXAA 1YJWB 4GX2A 2QM7A 1FMJA 1YZHA 4Y0NA 1CETA 1O6ZA 1PFVA 4FFRA 3CKMA 3DAFA 2HEGA 3BGDA 1SUSA 1Y8RA 2HRQA 4B87A 1QGZA 3DO6A 2FPWA 4CHGA 5L2YH 2NU8B 1IQIA 2Q8NA 2X2EA 4D80A 3NBAA 1PQ7A 2EFHB 1VP3A 2A5YB 3ETDA 4ZOBA 4KRXA 3U7QA 4L73A 2NO5A 2PLRA 2PUVA 4C4SA 1SLVB 3AETA 3P9PA 4V2IA 1N6KA 5FPPA 1VPEA 1Q7BA 3SJCA 1JPJA 4MCAA 2L6OA 4RZ2A 2ORIA 2P5SA 4J4BA 2OBLA 2CFTA 3HVKA 5DIFA 4ZO8A 2F8MA 1X1CA 5CLJA 4B17A 2Y99A 3PYHA 1P02A 1WPGA 3R5SA 1E3TA 2B98A 4EHJA 1OBHA 1M34E 3SD7A 1O2OA 3CC2B 3DFMA 3P0JA 1WW8A 2BUBA 1NFXA 2W4IA 1REQA 2JH5D 3RK1A 2AW5A 2BTQA 2FZ5A 3C27B 3U4GA 1N7JA 2X8KA 3IT1A 3Q5DA 1I94B 5G0SA 3W0LB 4HATA 1EHIA 2GXUA 1TPYA 3DHWC 4R0IA 2Y67A 4PCLA 1ENYA 4LF4B 3LUGA 5BP7A 1XF1A 2PSJA 3KCQA 3ZQUA 1IWOA 4F1WA 1YIOA 4J1QA 3LT0A 1O3HA 4XCXA 3RSSA 1Y9ZA 2QBYB 4XUEA 4K7JA 4QUKA 3KQKA 1ACMA 4U30A 1KC1A 2RGWA 1XA0A 5DBHX 1HKHA 4G1UC 4G5YA 2BGLA 5HM8A 4EAQA 1YUBA 4LISA 5EJ9A 3NKLA 3OMLA 3VO9A 1BRTA 2P2LA 3DB1A 3H7TA 3MJ4A 3HVHA 1SIOA 3HU3A 3T1QA 1VRVA 2IEGA 3R3XA 3KKNA 3WISA 1YF3A 4GI2A 1VLOA 1R6AA 1A4IA 3PWBA 1ACBE 1GLVA 3ISTA 4NLLA 5KTTA 2LTAA 1CW2B 2RJNA 2DVMA 2W58A 4PIMA 1ORTA 4RUKA 1ESZA 3ROGA 3ORHA 2P5YA 2QU8A 3F8SA 2HFKA 5CDGA 5IXYA 1TRMA 1JIUA 3L8GA 5IJ0A 3GICB 4Q4LA 4JEUA 3EQZA 3LXUX 3EBLA 3Q9LA 1EAWA 1U9IC 4LDAA 3IILA 4OXKA 1BHQ1 1V5GA 2ZFPH 5KNLA 4IDPA 3PS9A 2NPIA 5HXBA 4HRXA 1CDDA 3WWZA 2E87A 5KWVA 1WCIB 2H2WA 4QNNA 1AB6A 1JT9A 1GZDA 3PE3A 3CUUA 5HP4A 3TTVA 1MQ8B 1KFEB 5FPKA 3HK3B 3G79A 2PA0A 1FSGA 4R2MA 2I4NA 3GYBA 1E1YA 1ZMXA 1GJ4H 1OWPA 3DZFA 2CGAA 5J4LA 1E1CA 3B6IA 2IYRA 4M0UA 4HYQA 1H6DA 5KDLA 1G64A 2X15A 2JHPA 5CLQA 2C8KA 3WY9A 1QWSA 1BBRK 4ACBA 1EE1A 5EC8A 1UC9A 2CSUA 1F6WA 3R6LA 5JH7B 1K2I1 1C2JA 1UD2A 4JI6B 3LPRA 2BOVA 4AORA 3V4ZA 3JRXA 4AO6A 1KK3A 3PIDA 1KZYC 3VU3A 3L8CA 3BGWA 4B5LA 1I4LD 1BWQA 1Q0TA 1DCKA 3ZZMA 3SVLA 2HWWA 1CB0A 1E6MA 1WIWA 4CL3A 4GOJA 2QORA 1DC3A 1TM1E 5TMBA 1ELDE 4WXIA 3O21A 3ZHZA 3OFND 2VSNA 4FFVA 1EZUC 1O5EH 5CCEA 2FF5A 1T31A 3I29A 2VDWB 2FJPA 3AVTA 5IDKA 5FOQA 3QV2A 1QQBA 1QRSA 2DMRA 1FVHA 2DYKA 2FTMA 1V6AA 3V1KA 2B35A 4DDKA 2R3YA 3ML1A 3FOEC 2DF8A 2JK1A 3BFVA 4UC0A 2GQ0A 5FI5A 3QXXA 3VR5D 1XU7A 4W7IA 1ID1A 3L7AA 2JIDA 4LC0A 4Q02A 5LPNA 1ZGVA 3VB4A 3DBRA 1KY2A 3HJCA 3R77A 1GSOA 3TS1A 2LBPA 1E1KA 1VLZA 1CP3A 3UV3A 3SLNA 2GVNA 4U7DA 1OZHA 3RADC 5C9ZA 1XTQA 3ELUA 1BE6A 2ZR7A 1K92A 3BIWA 4ZP1A 4RYDA 3U3JA 4P98A 2EFGA 3GEEA 4MPWA 1DUIA 2IV2X 2I34A 2G08A 1U2GC 2P4EA 4K28A 3ZYCA 3U3DA 2VYND 4DIBA 4L0DA 2VJDA 1EK0A 2QDXA 1LHGH 1UJNA 1V6SA 3NRJA 4XXHA 2C42A 4AJ4A 3IQFA 4H7JA 3DFKA 1XUKA 1Y3BE 1XX6A 2P0YA 2QAGC 1VHDA 4BZPA 2B8WA 1L5OA 3HEMA 3K05A 5CJJA 1PR9A 4X62B 5JG7A 3O2QB 3N53A 1EHCA 2GF2A 2Q2QA 2FPKA 5HTKA 4Y1EA 5IYWA 3S9CA 1IUNA 1HRDA 3SHAH 5ETJA 4GYWA 1J20A 3ILSA 4N3NA 4I8HA 2A5JA 4GKBA 4YYZA 3SLRA 2XW6A 1YHQB 3Q3EA 1P39A 2H1FA 4YPOA 2XIJA 4BMSA 2JH9A 3C98A 5EIFA 3VJLA 1P04A 4OOEA 5GIPE 4TL6A 3AVPA 3U8OH 2VDWA 1RVDA 1D2AA 5EN4A 1XCGB 1QB9A 3G2NA 2FOAA 2QTWB 4PWZA 5AQEA 4L6AA 4FN4A 1RWOA 2XH8A 1WHTB 3EUWA 1SRRA 1UEXC 4X2VA 3CCBA 5COQA 3BD6A 1NOKA 2QA9E 4XKWA 2JZNA 1KK1A 1JXQA 2OHVA 2WT9A 1NL3A 4I1VA 1COZA 1LTHR 1KY5A 3RT1A 3P95A 3NHMA 4OF4A 2ZPQA 3I1IA 3OZAA 1RKXA 4YROA 4E11A 4UUBA 4AQ7A 1NW5A 2VPPA 4J3NA 5CDTA 4WXRA 3ISXA 2BDEA 5A0AE 3BWBA 3ZOKA 1NFQA 3FMFA 1XZ8A 3RXOA 1EFHA 3N2KA 1MHPA 4YEJA 3GY7A 3O2JA 1L2TA 5H1YA 4CRCA 4DWJA 1RI3A 2WWRA 4GSKA 4JMLA 2IQIA 5K4HA 1J0BA 1J09A 4GKVA 4F71A 4P3OA 2VA9A 1O58A 2B36A 4UM9D 5EQRA 3L8HA 1CYDA 1VZ2A 2HIAA 4ENUA 1A9ZA 3PROA 1OIVA 3ZY3A 3VHXA 3LA6A 3VPCA 1EVZA 3G0IA 1QB6A 1Q92A 1SGTA 2GXAA 3JAMA 5BR1A 1SK9A 1WW2A 4N0EA 4AZWA 1D9XA 3H8SA 5CG2A 4HUQA 4BJHB 5TX7A 3ADDA 1PJSA 3P8ZA 2EP8A 1UM9A 1BMTA 3L8DA 1U0SY 1FFWA 2H2ZA 2JLXA 1XXHE 2YZ2A 4DIMA 1BVYF 3I2IA 4OA8A 3UT6A 1TKAA 1ZUWA 2ROQA 3PFIA 4WOBA 4JJAA 4G4SO 1SM4A 2VIPA 1BDHA 5BSHA 4A2QA 2A1TS 1HEUA 4EQ6A 4PLPA 5DOZA 5KIAA 2Y0BA 3QY0A 1JEOA 2H2AA 1H69A 2O3SA 2CHFA 4NECA 3MU8A 1FRZA 4JYMA 4FK8A 4RVFA 5K0NA 5H16A 4YFVA 1W13U 4N7MA 5JSFA 2HVYB 4FUGA 4QOFA 4ZGQB 1OGIA 3IAFA 1XALA 2EDCA 5IKXA 1NN1A 5KJ6A 4AU1A 3JV7A 5CA1B 4HJRA 1TT7A 1MA0A 5L8VA 2WIGA 4X8LA 2AFRA 2GA9A 4H3VA 3CRZA 2WMNB 2ZGVA 5GZ1A 1SQ0A 1VPWA 2GM4A 1NXWA 4WNAA 3CRNA 3GFSA 2DE9A 1QC5A 3AUAA 1ZMLA 4J76A 2QRUA 1QVAA 2WOOA 5JXHA 2JLQA 3WY8A 3Q0TA 4LHYA 3CCFA 3A87A 7ABPA 2AMVA 1BMFD 4R1PA 5AK0A 4Z6AH 1JKXA 4MW4A 2B5TB 2QOEA 1LMWB 4YRTA 4VGCB 3IQWA 1KOJA 2GAOA 4RFSB 3IVCA 1N4AA 5D2CA 1FTGA 1H93A 3O8DA 3Q85A 4B79A 4E5UA 1OAOA 5KCMA 3DDZX 5JD5A 1EYZA 2QPAA 1GNQA 1AVGH 1RHQA 5JYDA 3C6ZA 5ENZA 2GGVB 3BMCA 4ZZ0A 4AFSA 2WNSA 5CM9C 2JFVA 3FF4A 3RJMA 4RO0A 1X80A 4U2KA 2GN2A 4FNAA 2Q4TA 4ZOEA 5L7WA 3O74A 3GARA 1M34A 3RVDA 4HAWA 4R1QA 1W85A 2AFQB 3K7EA 3ZZ3A 1QH9A 3WLMA 1W59A 3QVXA 3V7TA 3ICEA 4IX9A 1AZZA 4UEWA 2I6SA 1X7AC 4FHGA 3EIFA 3OFVA 1MEOA 4QTTB 1G6OA 2DRIA 4FS3A 1GZHB 4ASUA 4PCUA 4UJ5A 1G1MA 1BXGA 1G98A 3NAZA 3GGDA 3FFAA 4REMA 4PC3A 2C8YB 4YQEA 5I9TA 5I3CA 1WMAA 3TMAA 1EJMA 4IXWA 5ESXA 3MNSA 5I5EA 4XKJA 3AY0A 1P5HA 2AXNA 5KYKA 4F7DA 3GW8A 2I7VA 2GEDA 4WCFA 3AK4A 5AKYA 1NY5A 3O3CA 4QSHA 5DNWA 3OKFA 2ZE5A 4DCCA 5JT1A 1E9VA 3LC3A 1FQKA 3SYLA 2Q5FA 3CWCA 5FLXA 1C0KA 2IXBA 3ENQA 1VJ0A 4ESTE 2VQ6A 4BJ5A 1QBOA 1U7WA 1P72A 4R1MA 1ZH6A 4MO2A 5IZ4A 5EJ1A 3QJYA 3FSJX 2ZSJA 3KRTA 3K72B 3SZUA 3MXOA 3VYVA 3HO8A 4K81B 1Z8RA 2F9LA 1L1GA 5F7ZA 1X8XA 3BV9B 2QTVA 1W11U 1S01A 4INPA 2D2IA 4IINA 2J0SA 5JDIC 2PG3A 3TGPA 3F96A 1GT91 4F92B 3T52A 1A5GH 1DE7H 3IHTA 1O34A 2B4QA 3LF2A 4R3UC 4EUHA 5WRFA 3GVPA 1NXPA 2HDOA 5AESA 3SCZA 1FJGB 4IS2A 2R7NA 3THSA 2FDRA 1KEZA 4EFLA 3E9QA 2EWWA 4BLPA 2SGEE 1ZRSA 1L4MA 1AXRA 1I2MA 2N1MA 3SC6A 4AWBA 3JTMA 5K8UA 4XGRA 2Q9UA 2Q4DA 1CEEA 2PD3A 1QMPA 2GTPA 4HDRA 2ZWAA 2PHBA 2AERH 3QX5H 3BFPA 3BEUA 1XMIA 2RH5A 2JGRA 2FWJA 1ZBDA 1RYDA 3K2BA 3AVXA 3HG7A 3E9DA 2GBLA 4IIJF 2PKSB 2QTRA 3FR7A 1XU4A 4X1IB 3LDGA 1QCYA 2E4WA 3JQFA 1GP2A 4MV8A 4HNQA 1H5QA 2YBDA 2B5WA 3WGVA 5GIBA 4BB5A 2FWAA 1MO5A 2WTNA 3M37A 2PD6A 4YCLA 5KC9A 1CSOE 2QTMA 4CL8A 4R41A 1KZLA 5IT5A 5J2TF 2H00A 4DSZA 4RQUA 2XLBA 3AWIA 4MINA 2C0PA 5DHTA 4JT9A 4WNYA 3QUTA 1NI3A 3T95A 3O4HA 5LWQA 2HF2A 1DC5A 5LLDA 4NOMA 3PPXA 3GY0A 1O8BA 2IPAB 2A5IA 4GP9A 3BK2A 1JEJA 1PGNA 1SN7A 4F8JA 3H1AA 13PKA 1E9EA 3C48A 1ML4A 4RK6A 4I08A 1XKXA 1E9RA 2RGUA 1CTQA 3FKSA 2Y5GA 1D0IA 2Y0DA 3E3MA 4LHZA 3ILYA 4ABTA 1G21E 4M49A 1RWVA 2IL1A 5BOSB 2YZ7A 3WGJA 1RCTE 4RDJA 2OYRA 1ZPCA 2CRVA 3CHYA 2BEWA 1HB0B 1ISIA 2PXAA 1YONA 3JD3A 1EP9A 1OC4A 3AV3A 3RYTC 1JDUA 3F7MA 1ZFNA 1L8XA 1V7PC 2JDID 2C77A 3R6WA 4CM1A 4N6GA 4XX0B 1WZ2A 3PFWO 3LFTA 3VAYA 1XVOA 5F03A 4RZUA 5KYYA 1XVTA 3EJ6A 4GAEA 4PTZA 5EPNA 3O4FA 4IRXA 1JHUA 5M7EA 3EBPA 1JZTA 2A2ZA 3ZWVA 4EG3A 4OAPA 4J0KA 4FHCA 5BNFA 2C1EA 3RU2A 3HB0A 2BGKA 1DXYA 1GGFA 3E23A 3GT0A 3KSDO 1DX6A 2CEKA 1BTYA 4BJ6A 4YUWA 4Y6QA 5AJWA 1RI2A 1W2KH 4RJTA 3SBXA 2X2PA 3P8FA 4Q93A 4NENB 4G24A 3VH1A 3A8IA 3TR6A 1MQSA 1FMCA 2G0NA 3R3GB 2OZLA 5GV8A 1TQ0B 1NX9A 3DBHA 3M3SA 3M49A 2H0RA 3EPPA 1FSPA 2D06A 1II8A 4M89A 1SKQA 1BHXF 1O36A 2P9QA 4MVWA 4YY3B 4FMPA 5FBVB 2WF6A 5G41A 4JR0A 4MKRA 3D3QA 1ZM9A 2GLTA 4H4EA 1JBQA 4AO8A 3W1WA 5B5SA 2BXTH 3W7BA 4LOLA 4DA0A 1L5HA 4KXXA 5EHGA 4QLOA 4XVCA 3D3WB 5GJVC 1OFUX 2CLIB 5HF5A 2ZFRH 2F9NA 1KO7A 3LF1A 3DAHA 4OGXA 2V4ZA 3IQEA 3IESA 1BEUB 3K9WA 4AUMA 3LD9A 1GRVA 4BQIA 1L5YA 1T10A 1KMQA 3B3FA 3BTTE 1DBQA 1F92A 4HDRB 3JQDA 3QEOA 3DEJA 2KM0A 3HATH 2SGDE 2Z8XA 3UGTA 3A3PA 5DMHA 4K0RA 4QT0A 2HSZA 4K3JA 1X7DA 3K5HA 1QV9A 3L43A 4D4MA 3R6KA 3T9AA 3WK5A 4CCSA 1RJGA 4HNAA 3ANMA 2C8LA 5A7GA 3N7AA 5SYNA 1UHBA 2J98B 1NBWB 3GPIA 2FPPA 5H70A 3A6HA 3VG8A 3GAFA 2XYRA 2DUJA 1E4VA 3K9GA 4IYJA 1UZUA 1CJCA 1UMBB 4PBTA 4QJ4A 3IV7A 2OYCA 1W25A 4DMLA 2A31A 3SFVA 3ZKWA 1QL7A 1A8QA 3V32A 2A9RA 2QRPA 3EXFB 1YSCA 3HUTA 2K6GA 3VBEA 3BXOA 4LHSA 2MMCA 1Y5BT 1K1PA 4H4CA 1PKXA 1YHNA 4DIUA 3RS4A 1OF1A 1EUYA 3ZEAA 2L19A 4ERNA 1O97C 4FP9A 1ODJA 1U0GA 3D6UA 1Q86D 5U1PA 2YHIB 4IMZA 1HAHH 2W2LD 5LC1A 2CE2X 2BJHA 1OZGA 3OQBA 4QZVA 1HETA 2KPOA 1XMOB 3PO1B 2ZRFA 2I8LA 3NONA 3U0BA 4HFPB 4DJFC 2CB0A 4KKXB 1F9AA 1UP4A 4HRVA 4NWLA 4WN9B 4OX9Y 3C4QA 5ICCA 4NCIA 3ZV6A 3EZLA 5BW6B 4V3BA 4Q9NA 1TRNA 2LW7A 3K0AA 2C5HA 3BXGA 5HJ7A 3JTEA 1ZUNA 3H11B 3VNQA 2ZYWX 4MQUA 4C0XA 1YRQA 3EQ7A 3SC2A 2H17A 2NU4E 2EY4C 4S1PA 1NTOA 3ETJA 1RM0A 2V4MA 1DBWA 4XIJA 4MS1B 1K1LA 3NXKA 1WOYA 2FFBA 9GPBA 1IN5A 3GLFA 1NDHA 3DNFA 1UBSB 1U7UA 3ZU5A 4HNGA 3N6RA 5EZYF 5EZYA 3MNBA 8MHTA 4FDVA 2R8OA 1MC1A 2WZBA 4RWEA 1FL9A 4F46A 4G1FA 3C15C 3F8WA 2PBLA 5EZSA 4EYGA 3ELWA 1GPJA 1X0VA 4FEEA 5LWHA 2OFPA 3GMIA 1Z0IA 4PM4A 3O8BA 1NAIA 1AC5A 4PYQA 4CM6A 4DA8A 4TGLA 2GM3A 4K1XA 4X7PA 3QPWA 3D4NA 3A8JA 1N33B 2E49A 5FNZA 5TQ0A 4NPAA 2NT4A 1F8XA 4C9BA 4KVFA 2GD0A 2PU5A 4IGEA 1U3WA 4IMPA 4PXAA 1ZWLA 4XQCA 1RJ9B 2M98A 4L8LA 1TIBA 4B3DA 4B6EA 4U9IS 3RXDA 3BSSA 4GSLA 1BQEA 2OD3B 4M9ZA 1I2ZA 5EYPB 3Q2IA 3NOVA 5HM2A 1VXOA 2NMVA 4FU8A 4JYZA 2PNJA 2XA1A 2FVYA 4ENVA 3TPFA 1ZM2A 5FORA 2QAGA 5CK4A 3IDFA 1ZEJA 1NP7A 1E9DA 1A5BB 2QGRA 2ZPAA 4F48B 3H9JA 4G01B 4E5YA 3MMGA 2ILVA 2H57A 4ZMBA 3PF8A 1LI5A 4HRAA 1TA4A 2B0CA 2X1VA 2QD4A 1E3JA 4QU0A 2QV7A 3WBBA 1IY9A 4C88A 2V7UA 1E35B 4C14A 3QNMA 4JB3A 2X6YA 1KLTA 2V6GA 5HKLA 1W30A 5BPHA 2JEZA 1QO0A 4BIIA 3V7FA 2HCBA 3R9WA 2W0SA 3HMQA 5JC8A 1OSSA 1KAQA 5T5QA 1NYRA 5TMPA 2BBWA 4B4OA 2P7HA 4EVRA 1YDWA 3EB9A 4OHRA 2P11A 3HH8A 1XZCA 1KJYA 4R68A 2QLTA 2ZROA 1P7ZA 1M3SA 4Z3OA 1PBNA 3SBOA 1GCIA 4NCHA 2CD9A 1Z13A 1LZLA 2AQHA 4TYDA 4Q15A 2BKUA 5DNVA 2D2VA 4KXWA 3BEDA 3NVMB 2UYYA 8GPBA 2C4UA 5KMGA 5MGNA 5DN6D 2BEJA 4I0WB 2YMSD 1Z47A 3WL3A 3TTWA 1W4CA 1H22A 1P1CA 4UTPA 3LLCA 1VKNA 4W5QA 1E1LA 1TLLA 1NW4A 3KQHA 2GO7A 1O9HA 3RC8A 3SLGA 1XP8A 3UB3A 3I30X 3J81A 3TJMA 1BE0A 3AIOA 4YDSA 3GJ7A 2VBSA 3DJYA 1W88B 3LQ6A 1DRJA 3LHIA 4F2WA 3I0MA 3NPAA 4DC1A 4U5QA 3PWSA 1SU6A 2C0QA 4G81A 1KTTB 2C83A 2L0XA 1C5MD 3MWEA 1CKEA 3G17A 1TIKA 5A9RA 2ZUVA 1J2EA 1XD8A 1QTQA 4JCNA 3NUGA 4ABFA 2F3RA 5AVOA 5KOJA 1LI7A 1NRPH 5E0OA 2AHME 2EXXA 2HA7A 3QKUA 1WNFA 4P5DA 5AFSA 1EUDB 2WYUA 3SEQA 2CF5A 6YASA 1U7ZA 4I2NA 1T8SA 3Q8XB 5LR6A 4G36A 4XM0A 4KKVA 1I33A 1OLXB 3OFKA 2G36A 4LFAB 2WUWE 1M5TA 4LXTA 1DWCH 1SGQE 3ON5A 3E9NA 3MCWA 3T7SA 4JZ1A 2KSQA 4FDAA 2YV2A 2QM3A 4JUDX 4NIVA 3DDHA 1GHAG 4HG2A 3E82A 1N6PA 1MZAA 1HRTH 3S55A 4O97A 5K6AA 3L0DA 1WSWA 1L7OA 1NROH 2A7HA 3OFNA 5B3LA 2Q7DA 3QO6A 1U0OC 2R00C 3HJHA 2BLWA 4ECAA 3EA5A 4Q3NA 2DLDA 4ZARA 1B15A 2C4FH 2Z2YA 3JZIA 2Y1FA 1OWNA 1YH3A 3QRWA 4BOYA 3VEQB 1X2EA 2OB1A 3K09C 1Z36A 4MG3A 1KK2A 3ZR4B 3NUZA 3BCSA 2HWYA 3IE0A 1AKTA 4IDFA 1K68A 1YB5A 3EVEA 2RGXA 2GMWA 4PNPA 3TGJE 1MIHA 3QVSA 3C7KA 1U8UA 4INJA 2Z3WA 2O8LA 3EMKA 1W88A 3O26A 1NJ2A 2O7SA 2WC1A 3LVQE 4X3CA 5K8IA 2XA2A 3HCOA 3R2JA 3VU9B 3B6EA 3N7OA 3AH8A 4EOGA 5T3YA 3QEBZ 1JFVA 1XLTA 2D0OB 3WK7A 4BTUB 1YDGA 1GSIA 3DHYA