4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MJ0495-LIKE PROTEIN
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
4UNNA 2I1QA 1UDXA 2BOVA 2CNWA 2VNHA 3OIWA 4CRWB 5JJLA 2KBFA 1F6BA 2W00A 2PMDA 1OXTA 4L9SA 4NYIR 5EZ6B 4G0NA 2A5FA 2QA4B 1CJUC 2GJ8A 1VECA 4C0LA 3G82C 3B5JA 4N0DA 2RGBA 3MAAC 1YR9A 1XEXA 4DUGA 1ANKA 1Z5ZA 2GJKA 4W5WA 1QG2A 2KB0A 2GAOA 1NLYA 1Z6GA 4UNQA 5TXGA 4KODA 5KYKA 3PUYA 4P31A 1VG8A 1P73A 4R9UC 3GEEA 5KSYA 1DAEA 3QBTA 4P4UA 5TARA 1NI3A 4K8OA 4MDEA 1P2UA 4DB4A 3K8YA 2QMOA 2WBLC 3TSZA 3E1SA 4AKIA 4KFSA 4ESVA 3OZVA 2V1XA 4A2QA 1S9DA 1UKYA 1Z0FA 3VR6A 1DTSA 1U99A 4QFMA 3OZXA 5L3SB 3CUEF 2YWGA 5HTKA 2W2XA 3U7FB 5DLQC 1F2UB 2FX3A 4JLJA 4LWZA 4B3DA 4FCVA 3L43A 3OESA 2IUTA 2XTMA 5GJVC 3TKLA 1Q1ZA 4CT5A 1J90A 2PLFA 3LBIA 2RC6A 2ZRGA 1HUQA 1YRAA 3DZDA 1N2CE 3DOFA 3MJHA 1T5LA 2BMJA 2AFIE 2P65A 4AKEA 4B4DA 4BFSA 2QORA 5L3SA 1FZQA 3GPLA 5J4VA 1W2GA 5FUWA 1KD1D 1Q12A 4LYJA 4ASUD 3UKDA 4A82A 2QE7A 1ELOA 4LJ9A 1FX0B 2W6JA 1GILA 4OHWA 3B1ZA 3BORA 1KK3A 2Q0HA 4LHWA 4YMTA 1S3SA 1GR1A 1E0SA 3G6EB 4RCYA 1E9DA 1WA5A 1KI1A 4IDNA 4XOIA 4ZDWA 4E22A 4HAWA 3W2HA 2IEZA 4X8MA 4BGDA 4TYPA 5JRJA 1RPZA 2R9VA 3A4MA 4ERNA 3HJNA 1ODFA 1CTQA 3GJ3A 2QP4A 3HU3A 5KSPA 1FX0A 5EE9A 1E1RD 4LBYA 4PC2A 5HE8A 4PR0A 1U8ZA 2BC9A 1NBMA 3FFBA 2JDIA 3QFSA 2MSCB 2ORWA 4HAXA 4US1R 1RIFA 2G83A 5DI3B 5BW8A 3JZMA 4U9UA 4KU4A 1D9XA 4LHXA 3AEZA 4KAXA 3KJGA 1E4YA 1H42A 1XJQA 2AKAB 4URWR 1MR3F 4URYR 1RRFA 3QXCA 4XIGS 1Z29A 3RS4A 2YWHA 3KFXA 3H1TA 3CX7A 3SFVA 4NZYA 2VEDA 3EA0A 3JQRA 1I7PA 4ZCLA 2HEIA 1NP6A 3KKOA 4BFYA 4ZGQB 2QT0A 2DERA 2ZI4A 3L8YA 3MHPA 1OIXA 3ICQB 1WBDA 5FH9A 2X2FA 3DHWC 4TLBA 2PBRA 4B3BA 3TQCA 1JAIA 3AQ4A 1RRCA 2XXAB 4FWIB 4II7A 1R10A 1OH6A 1P9RA 4BLOA 2XZOA 3RNLA 3TLXA 3KQHA 1LW7A 2DBYA 4WZ6A 2E87A 3GMTA 1W35A 4NYMR 1JXMA 4DCNA 3PJRA 4LRWA 1G3UA 2RHDA 3ZBTA 1NY5A 2YWEA 2ZE7A 4E07A 4ZO4A 3H86A 2IS2A 2GCNA 1DEKA 2PX3A 2FN4A 5FL3A 3UK6A 1O3YA 3QOFA 1QHSA 1Z0JA 2KWIA 1XD2A 4TTQA 5H68A 1MRSA 1XNJA 4Q9JA 1J8MF 4QGFA 2XXAA 4Q1BA 3PQCA 2BCGY 4LJ5A 4OJQA 4TTPA 3VR4A 4OQLA 3K9LA 3NBXX 2PEZA 5CK4A 5A4JA 1KYIA 1E4VA 1U98A 2WSMA 4Q66C 5DE3A 1W36D 3IBYA 4IVQA 4GI7A 4LCBA 1ZNXA 1EFUA 2ZQ5A 1RVDA 4O2RA 4A9AA 3IILA 2CL0X 3FOZA 5AJXA 2ZRFA 1XTQA 3W6OA 3NBZC 4HSEA 4MKFA 2AK2A 1PLJA 4EPTA 4C0HA 3CCSB 1ZW6A 3W90A 3ZGXA 2BN4A 5SZIA 5ANRB 2CHVA 1A5TA 3AVPA 4M9SA 1E0JA 4HZIA 4AC9A 5SZJA 1ZM4A 1EG7A 2NOAA 3SYKA 4DIDA 2NO9A 4YLGA 2O8BB 5FPKA 2FZ4A 1JEEA 4KYUA 1IY2A 2CE7A 3HDTA 1OH5A 4V03A 1KY2A 4RKEA 4YAOA 1IJEA 3UIEA 2Z5FA 2D74A 1GOTA 1GP2A 5IRCD 4AF6A 2YINC 4B73A 4TZ6A 1ZP6A 3RS7A 3GJ5A 2QPOA 1SGWA 1XEFA 5JWRA 2LP6A 1VPLA 2VP2A 2O8BA 1J70A 1S3GA 2W2VA 1N6LA 2ONKA 3EZFA 2F1IA 1P75A 3WMGA 1K5GA 1KJWA 2GF9A 3IPXA 3Q72A 3LDAA 1NN3A 1PLKA 1VQ9B 1KI2A 2N42A 2RCNA 1XZQA 1ZU4A 2WSSD 3LBHA 1PUJA 4BQSA 2XNJA 3CBQA 2C98A 3W5VA 1S8FA 2OCYC 4AWXA 2A30A 4Y9UA 4QBHA 3A4NA 2ODEA 1GL7A 1FP7A 4PPGA 3FMPB 4XVQA 3GFTA 1G9XA 1NLFA 2JCSA 2RGXA 2HUPA 5JWHA 3QNUA 4PHTA 2J87A 3PUZA 3T61A 1II8A 3I61A 2QMEA 1SKYB 4NCIA 3LQRA 1H8EA 1SXJC 2DWQA 2E9SA 4O2LA 2BCJQ 3TW8B 4DCSA 2CBZA 621PA 3PEUA 5JJKA 1DE0A 5LPNA 3BERA 2JAQA 5GADl 1GNPA 2ZIAA 2MMGA 3X1DA 1KK2A 4B43A 1P2VA 1KI4A 1P62B 3VX3A 3VQTA 3THOA 4DC9A 2HDNB 4RZXA 4N3NA 5KPDA 1F60A 1JALA 1W2BB 5LB2A 2WV9A 3O47A 3CRVA 1M8PA 2XSZA 221PA 4LGMA 2XNSA 4PAMA 5EXTA 5JWOA 4G5QA 2ZITA 2OK7A 4NCNA 3ZBUA 4WW0A 1NJID 4RD0A 2ZJZA 3QI2A 5CJPA 3KXKA 3S1AB 3SNHA 4YMVA 1DADA 4KVGA 1AKEA 1ZUHA 4HAYA 3HWSA 4Z1MD 3WYGA 4BFXA 1YJ5A 5HCIA 2WWIA 3KUCA 3EWAA 2LCFA 2O8DA 3P27A 3B13B 1GL9B 1EX6A 4Q1AA 5B57C 4JBWA 4DSNA 2WJGA 2OSBA 4G5OA 1E2KA 1JR3D 1OB2A 1NVXQ 1UBEA 1KKLA 2H5EA 2W2TA 1CQXA 2V4ZA 1R2QA 3B1YA 2ATVA 3HPRA 1HE1C 3GJ7A 3LV8A 2ZI3A 1KK1A 3RRNA 3IKJA 1EWYA 2FZLA 4AY2A 1YJNB 2ZRLA 1COWA 2V9PA 4UNSA 1AZTA 4WQMA 5AJYA 1AK2A 3NEJA 1SHKA 3I73A 2RGDA 3D7MA 3X1XA 2IYTA 3MFYA 4QJ3A 1VTKA 4WXPA 2WTUA 2H17A 4DDTA 1TMKA 1MT0A 2PZFA 1EFHA 1WF3A 4MQBA 4WIAA 1YITB 2ZYUX 3A1UA 5JEEA 1E3MA 4TMTA 1Q44A 1NVVQ 3AGQA 1JB1A 5L8VA 1OFTA 3B9QA 4YALA 3VHLB 4MGZR 4P33A 5DN6A 1E2JA 2IX3A 1AIPA 3C5HA 3OE7D 2VHTA 3P4XA 1NN5A 1L2TA 1Q86D 1P3JA 3AKEA 3M0EA 1QGZA 3MLEA 2Q3MA 1II0A 5H5JA 1A2BA 2UZ3A 4TQUS 2R6FA 1AM4D 3CC2B 2LKDA 3VX4A 4AD8A 1OV4A 4IVPA 1CR1A 2QROA 2QG6A 3PV0A 1B2RA 3CPHA 2IWHA 2W6ID 2ZREA 3SYNA 1D8TA 1LY1A 4CEHA 4QHTA 2J0QA 1OE0A 5FTMA 3CW2A 1ZM3A 1ZBDA 1R5BA 1UADA 3GCGA 1XCGB 3Q9LA 5L3RA 1E2FA 3GEIA 2J0UB 1Z63A 1YZQA 3AB3A 2HCBA 4LBZA 4B47A 5FOVA 2QQ0A 4NE2A 4DSOA 2C9YA 2IYZA 4KHZA 1W0JA 2GHIA 1R0ZA 4NPHA 4ZKEA 4NTZA 3I56B 2DPXA 4XJXA 5FR1A 3WRXC 2IBMA 3ZS8A 1OXXK 4BECA 2YOFA 1FPMA 1G20E 4TMVA 1XXHE 2P5TB 3W6NA 1LVGA 2BIFA 4IEEA 3CRW1 1I2MA 1BYIA 5EE5B 3NBYC 4LV6A 5EP2A 5FBRB 3RAPR 3CRRA 5K8IA 3LX8A 3CO5A 3P1JA 1IXSB 3ND9A 1RJ9B 4F91B 1XF9A 2AL7A 2Q6TA 1A4RA 3U44A 3WNCA 1G21E 3KKNA 1G3RA 1Y63A 1F3OA 5DHAA 4BASA 1JEDA 1W0KA 3C41J 2VLIA 1P2TA 4NDZA 3BRWD 3H0KA 4IOLA 4LJYA 5KNBA 1KNXA 1KO4A 4PZLA 2E1RA 4TLAA 1GIAA 2GJAA 1KO8A 3HYRA 4FXPA 4A2WA 4FWTA 1GUAA 2JIZA 2XITA 1GO2A 1G1MA 1AQYA 1RJ9A 1A8PA 2UZIR 2VSXA 3EXAA 3LLUA 1G7TA 1KTVA 2A2ZA 2IF0A 2IYYA 2ZRBA 3Q85A 3B2EA 2WWXA 3GLFE 521PA 5JHGB 2GEDA 2IW3A 3TSWA 5HKKA 2FEMA 2ZUDA 3KB2A 3VMFA 4KITB 2VP9A 3DDCA 4GPTA 3QBVA 4DDVA 3THXB 5TR9A 4LYAA 821PA 1OH8A 1XB2A 3W2EA 5THXA 4C0SA 4DQLA 1N6NA 2RGGA 1ETUA 4BRUA 4GOJA 3UMRA 1Q3TA 1U8YA 4I1UA 4Q9HA 4LY6A 3VFDA 2GWHA 4PAOA 2C8VA 4FMDB 1G5RA 4PC6A 2AR7A 3MWKA 3QF4A 3NIBA 1H8HA 2RC5A 1OHHD 1AZSC 1OKKD 1OYYA 2ZYTX 1GRRA 2DB3A 1QHHB 1DOAA 4AKHA 4UKDA 2ZSEA 4TYWA 1ZM9A 2JEOA 3NC0C 3SBEA 3OJXA 2WWYA 4LPSA 3T5GA 4GFDA 3I3SR 3CMEB 1E9SA 5CJ2A 3A36A 3W2IA 2J1LA 1E6CA 5SZHB 3SZRA 2ZYVX 2R62A 3ZVLA 1AGPA 4UNRA 5IF9A 5IK2D 4JLOA 2V7QD 1VQ8B 1TU3A 4JYCA 1IM2A 2XNDA 4LDJA 2HXSA 4B74A 2QY9A 1VHTA 2NQ2C 1CULC 3SR0A 1GZSA 4DCTA 2H7VA 2QTFA 4ABYA 1GKUB 3QE0A 3T1TA 2IYVA 1PV4A 2KE5A 3K0FA 1X1RA 1Z08A 1UM8A 1PUIA 2BKEA 2ZVPX 4M1WA 4AYWA 1J8YF 1S9HA 1B23P 1FTNA 3WYFA 3DM5A 1WXQA 2V55B 1GFIA 3CF6R 1Z6AA 3BB3A 3EWSA 4D82A 1NMZA 2ZJOA 5GJCA 1ZINA 1EXMA 3U5ZB 3LVRE 4Q5IA 3BFKA 2QPTA 4L16A 1SXJD 5TDHA 2ORVA 3TVTA 1FQKA 1NVUQ 4IW3B 3OHMA 4ESHA 1N8RD 2XX3A 4IOMA 4US0R 2D2FA 3HU2A 8OHMA 4JSYA 1MO3A 4OQMA 3U4QB 1U81A 2CJWB 5EP3A 5BYJA 3AF0A 3G5UA 3IO3A 4JZKA 4NL4H 4KFRA 3U61B 4HDQB 5AUOB 4LHYA 3FPKA 2BMWA 1CKEA 4OHXA 2FFHA 4FW9A 4AIIA 3OIYA 4I4LA 2VF7A 1YZLA 2XTZA 3L0PA 3CM0A 1EFRA 4JL6A 4RJLA 2GCOB 2BJVA 4Q03A 1YI2B 1DDGA 1OXSC 1RC8A 1YVDA 5EXSA 2ZI7A 1Q7YD 4GP6A 5AUQA 5FPSA 3EW9A 3CRMA 2HLDA 2WMNB 2X3UA 1G8HA 1X6VA 3LH5A 3U4QA 2AKYA 5DGXA 2GILA 1SVLA 1KOFA 2VP4A 4QXAA 1N0VC 5FPYA 3G4SB 5M04A 1E2PA 1M2OB 2CEAA 2GRJA 3SJAA 4YXWD 4RD4A 3IPYA 4HDOB 4JLBA 5EMNA 4WAUA 3QVUA 4LSGA 2FGKA 2CRVA 2P3SA 4D0NA 2B92A 4AURA 2NZ8A 3FHCB 4Y9RA 1JECA 2JLVA 3WXMA 3FKSA 5TVKA 4MKGA 3RC3A 3PUVA 3CMAB 3JQPA 4DZZA 4WZBE 3D31A 4B34A 1S96A 5J4YA 1XJCA 1ESMA 4A1FA 4D4MA 1OB5A 5CB8A 4WZAE 5DNYB 3IQXA 1UKVY 1BMFD 1Z28A 4MRRA 4XSHA 4G5GA 2F9MA 2ZRKA 3QEJA 1L7VC 1TQ2A 3CR7A 1CLUA 3TSOA 3I1FA 4YMUA 1CEEA 1WE2A 5EUMA 4XD7D 4EH1A 1KAOA 5BWMA 4JL8A 5J40A 3PEVA 3K0SA 2EW1A 3KL4A 2Q3FA 3ZC3A 4LV8B 5FUVA 4P6VF 5JLJA 2J0SA 1Q57A 1QHNA 1G5TA 2D06A 4TLDA 1XDBA 4TL8A 2QTLA 4BLQA 1Q21A 4M1MA 1C1YA 2Z4SA 4HEJA 2V1UA 4OI0A 4EKDA 5GJWC 2O0KA 3B9PA 4QG7A 3GQBA 4YMWA 2AX4A 2OO7A 4I1OA 1AKYA 4B48A 2RGNC 2V6IA 5G40A 3HP1A 4ACBA 5GVSA 2H92A 2XNCA 4Q19A 1WMSA 3CR8A 2WOOA 5JECA 3RLFA 2QEXB 4QHYA 4DUGD 4UAJA 2ZS9A 3WBJA 3BB4A 4A6PA 5E4FA 3R9IA 2G1JA 4JLVA 1YIJB 3BJIC 4HUQB 2IS1A 1UJ2A 2GXQA 2VP0A 3LLMA 2ZSFA 1GAQA 2F3TA 1XCPA 1SVIA 3RYTC 2WMOB 5DSZA 1YJWB 2FSFA 4FINA 1K8RA 1YZKA 3TBKA 4DLRA 2EFEB 2VO1A 4JVSB 4TSFD 3BFVA 4NYJQ 3CCLB 2R6AA 4QKQA 3FGNA 3PFIA 2OE2A 4DIEA 5FOTA 4Q9IA 3H4MA 4JLNA 2FPMA 2JJ2D 4UXHA 1NRJB 1JR3E 4HUQA 4PHGA 1G41A 4XWOA 5JZVA 4CEJB 5JBQA 3LVQE 2YNMA 4EPXA 4LBWA 1KI6B 2ZR7A 3OEEA 2OEPA 1W49A 3DMNA 3NDBB 3X2SA 5F2EA 1G6HA 1QDEA 2JLXA 4DLXA 5JCZA 3K70B 1TX4B 2J45A 4C0JA 4U02A 1E2EA 1E9FA 4Q1FA 4CF7A 3SJBA 1R0WA 3TQFA 4C0KA 3LA6A 5SZKB 2BEKA 2ZRCA 3B6EA 4JLPA 4CEJA 3C5CA 1KI6A 5EE3A 1TEVA 4DDWA 2TMKA 4XVRA 1K9MD 2X8AA 2PZGA 3ZQJA 3GJXC 2BBOA 4KBFA 3EX7C 1IB0A 4LPKA 1DARA 4Q7JB 1VQNB 1LV7A 1OFUX 1M6NA 2DHRA 2ZJ2A 1UBCA 2IHYA 3QKSA 4TT3A 4A4DA 3W5HA 2NZJA 2VYFA 1UAAA 2C99A 4G5SA 4A2PA 4CIDA 4RSGA 2QMHA 4PX9A 3OZUA 2ANCA 4PQRA 4F93B 1AS2A 4DT1B 3CD6B 1KZ7B 5L3QB 2VA8A 2HXYA 2YZ2A 1ZIPA 2AK3A 2QMUA 1IHUA 2F9LA 1NBMD 1NSFA 3OJWA 3AV0B 1FNCA 4IOJA 2OZEA 2D2EA 2Q9BA 4Q9KA 1D2EA 3RSLA 1HQYE 2DR3A 3GLHE 3UWOA 4HYYA 5K8TA 1ZJ6A 5DI9A 5FUXA 4IDPA 4MUBA 1OLOA 2FOLA 2I4IA 1NY6A 4ZKDA 4DSTA 4ITRC 3G71B 3K0CC 1FW6A 4DT1A 5L3QA 3A1TA 2QP3A 1UF9A 2Q21A 5K8LA 2QEQA 3A1WA 4LX0A 4WBSA 2XJ9A 1CRPA 4GMXA 3WMEA 3SJZA 1ESNA 2AXPA 4BFTA 4D4KA 2O8CB 2BM0A 5AN9A 3HPQA 1SVMA 2CXXA 1P6XA 3L0IB 4MDFA 2UKDA 4CGZA 5FPHA 2H18A 5J4HA 5G53C 4U5XA 2QTVB 3KJHA 5H59A 4W7SA 3IQWA 2DWPA 2VHUA 1W2HA 4B3GA 1KO7A 3OAAD 5EZ5A 4PO9A 1KI8A 4DLVA 4URXR 1HQCA 3F5FA 2J59A 3NWJA 4MRSA 5B64A 1U2RA 3QFTA 2O8CA 3ZIAA 4F7WA 4MA4A 3GLGE 2J41A 3PEWA 1FP6A 5ELXA 4HUTA 2ZJ8A 2A7QA 4Q9LA 4RCZA 1T4GA 4IDHA 2IYQA 1G8GA 2JJ8A 3W5JA 2V6JA 1R6BX 4GOXA 4JVNA 5CDFE 2ZUCA 1HT2E 3NHAA 3EPLA 4HZUB 4M4SA 1HH4A 3B82A 3ICEA 2J3EA 1T3SA 1E0AA 3CF2A 2R6DA 2B6HA 3BAFA 4LK2A 1IN6A 4I1VA 3AF1A 3W6PA 4PPFA 5J4LA 5FTJA 2IYRA 4HE6A 3QENA 4C0AC 2BGIA 3ZQ6A 3I5XA 3VNVA 3X1YA 4IRUB 3O8DA 1GVNB 2O0JA 1QZXA 2D7DA 2ZETA 4V0NA 3BK7A 3CCUB 4HZUA 4GRAA 1NIPA 3B60A 5B30A 5FOWA 3ZVNA 2GBLA 4LJ8A 1G6OA 1V5WA 4TMKA 1VG1A 3EASA 1XWIA 4U00A 2FE4A 1E1QD 5CYPA 3TUZC 1IN8A 1K8AD 4JYBA 2FEOA 3M4YA 4PPNA 1DDIA 1XTIA 4OK5A 1DAKA 3U3RA 2ZUBA 3CWQA 3RS2A 1EESA 1XXHB 2G88A 5J47A 1X86B 1JQJC 3F8TA 2AWNA 3K9GA 3FHTA 3THYA 3BS4A 5FI1B 4IDQA 2EIXA 1VYUA 1XD2B 1VQMB 3BIFA 1MH1A 3L0OA 3IEVA 2QU8A 5H1YA 3VR3A 4OYHA 2DETA 1A82A 2OG2A 3R9XA 1CJTC 5BYKA 2IWRA 4PANA 2VH5R 1U9IC 4HB0A 4MRVA 2PX0A 1IN4A 2ERXA 2BEJA 1XXHA 1R4AA 1XMIA 1RKBA 2DFNA 4M9XA 1OH7A 1QG0A 4RD1A 3EG5A 4TL6A 3NBFA 3W3ZB 2GEVA 2P0EA 4JL5A 4JS0A 1VQKB 1CNEA 1A2KC 1M7HA 5G41A 2PT7A 4XSGA 1VQ4B 1E32A 4BFZA 3CC4B 3T1QA 4IOKA 2WHXA 2F6RA 3GLFB 4O3MA 3OEHD 2ZJ5A 4DLSA 2ZRPA 1H8ED 1SXJE 3ZZ0A 2JASA 3NH6A 3QPUA 3TW4A 4LC0A 4QC2A 2I1VB 3PEYA 2OK8A 3K0AA 2ZSDA 3UWKA 4H1UA 4NYJR 3QIAA 3HU1A 1QUFA 4HI0E 5C1BA 4ASUA 3W8RA 3ADDA 4LJAA 3V9PA 3NKVA 4W9MC 2A9KA 4A8JB 2EFCB 3R8CA 3GLFA 2JATA 3WP1B 5H8WA 3DZ8A 3B8HA 2H16A 1HE8B 3MUFA 4X8OA 2C04A 4PFSA 2ZE6A 2XEXA 2QAGA 4DWJA 1G8YA 1Z07A 4V0KA 4WOPA 3SHFA 4DRZA 1VKJA 4OHZA 2B21A 2B8TA 1P4SA 1P9NA 1QFZA 2C96A 4HAUA 1FNDA 1G7CA 3CCEB 1F2TA 4Q21A 3I92A 1E1RA 1GWNA 4A8JA 3QQ5A 3ZYCA 1N6HA 1NLZA 4LI0A 4YONB 4D26A 1SVOA 2RGCA 3WNDA 5KUTA 2O52A 4R2HA 721PA 2PCLA 4YAFA 2QPAA 2HT1A 3VKHA 3LAWA 1W48A 4IEIA 4O25A 5JJIA 2A5DA 5JS8A 4QRHA 1II8B 2ZTSA 4HB4A 5TB5A 4C9BA 2ZRAA 5IHPA 2AD5A 2PCJA 3QXXA 3ZZUA 5KHOC 3D8BA 1GL6A 3PCRB 3ZVRA 2P2LA 4RFVA 1Z47A 2Q9AA 2JLRA 4M1SA 3WHLA 2ZEJA 1ZC3A 1DPFA 4NONA 5C46F 2CVFA 3AVYA 1CBUA 3B78A 4LJ6A 4XTCS 4JMPA 5CLLA 1KMHB 3K1JA 5CIQA 1LF5A 1NMXA 2GESA 1N5IA 2CK3A 3B85A 4D81A 3U6BA 3B1WA 4GOKA 3LD9A 1EK0A 3LXRA 1VQ6B 2WAYA 2WJIA 2NIPA 3C7KA 3LFUA 4Q7LA 2FNAA 1RRGA 2BPOA 2IYSA 2ANBA 3E20A 4MKIA 4MGIR 1G4UR 4PQYA 1JJ2B 4J0QA 2ORIA 4JKIA 1E9RA 3D6TB 1KMHA 5EP1A 2CL7X 1F5NA 2ZANA 4HB2A 1QVGB 2EYUA 5IDVA 1WDTA 3LO5A 2O8DB 3U3OA 4IFBA 1OPXA 2D3WA 1ZM2A 1T5IA 3W8NA 1QRAA 4O0MA 1JXOA 1U0HC 3ZD6A 4F4CA 3WY9A 2Z0MA 2HCJB 1N6OA 3W34A 1TL7C 1BJKA 3O8BA 3AVVA 1N6PA 1TQ6A 2N1BA 3IHWA 2IS4A 4ILEA 3RWOA 3QXJA 1HYQA 2RAPA 1U8AA 2J7KA 5CM8B 4FN5A 1VDZA 3I8SA 4GNKA 3VU9B 4Q48A 4QJ5A 4LUCA 2WWFA 1X8KA 2WZQA 4QM6A 2G77B 3PXGA 1FMLA 1SVWA 3E70C 2BMFA 4E5UA 1N6IA 5KOYA 2ZJAA 5BN3A 1HY3A 4QNMA 3B1VA 1KGDA 4X8LA 4LC1A 2C2HA 3WP0A 4EUNA 3OIUA 3EZ7A 4EIWA 1IXZA 2WWHA 2ZRHA 1KDPA 1M90D 1TTTA 1ZCAA 1E2IA 4Q00A 3T06B 4M0LA 4A92A 4YAUA 4K81B 2PL3A 2QBYA 1KNQA 4B33A 1W7AA 3ES9A 1N25A 3MSXA 2OESA 3REFA 4OBEA 1AMOA 2CCKA 3NVAA 3VU9A 1LTQA 1GSIA 1OW3B 4HB3A 3ADCA 2IK8A 4U7DA 1GRQA 1FNMA 4C3ZA 5EXPA 1ZM7A 5EJEA 1VQOB 4Q7KA 4HATA 3ADKA 3CH4B 1VG0B 1TUEA 3SBDA 3T1VA 3PVSA 5FL7D 1N0WA 1P5ZB 1Q1BA 2EYQA 2CE2X 2XTNA 3MWLA 3RS5A 3ZDQA 3ADBA 4G01B 2G9NA 4PO8A 2W0SA 4OQNA 1WBBA 3Q7PA 2WSSA 5KSOA 2QGNA 4CEHB 1H85A 2FSIA 4URVR 2MSDB 4HAVA 3QFRA 3JVUA 3PG5A 4QBIA 1GAWA 5HKKD 3K70C 3SQWA 5C4MA 1GVHA 1R8QA 3RWMB 2R65A 3FKQA 4GZLA 1QVAA 2OUKA 1L8QA 3F0TA 5TV2A 2KBEA 2OTLB 1IJFA 4CVNA 4F7DA 1QBKC 3A37A 1E62A 1DAMA 2YC2C 1GNQA 1VYVA 4EFNA 5K8UA 1PVOA 3TGPA 3KKPA 2P6NA 1VHLA 1NBME 2ZJYA 1VQ7B 2R44A 1NMYA 1S1MA 1Z6TA 4B35A 3VR2A 1UEIA 1VCMA 2WOJA 1G3QA 2ZS8A 5CLQA 4DLWA 1BYUA 4KI0A 4YHBA 3WNBA 4M9ZA 3SDZA 5E7IA 1XE1A 3U44B 3CCQB 2HJGA 1DBSA 4F38A 1N6RA 1DO0A 1YKSA 1WRBA 3RANA 1RFLA 1ZAKA 1GJRA 3KB1A 4Q1DA 5GV7A 3I72A 1VQPB 2X77A 3GJ0A 4PHFA 3VO2A 1KQSB 4S2EA 1C4OA 3DMDA 3OFND 3R20A 4KLZA 3LVBA 3U3MA 4K46A 4PHHA 3CZQA 1E9BA 3BD9A 3CCMB 4Z1MA 1F48A 5JRZA 2ZPTX 5B2ZA 3CPWB 3KJEA 2NG1A 2XNDD 1AS3A 1W5SA 1LB1B 3FVQA 2IYUA 4JIMA 2GDJA 4MGYR 2GXSA 3MGCA 1D2NA 1EFCA 3SS8A 4M1KA 2DFLA 4B76A 2O8FB 4BWYA 4EJSB 2BKUA 4JLMA 4GSYA 3AUXA 1KI9A 4EFMA 3Q8XB 4YMSA 3THWB 2JJ1D 4C0QC 1VG9B 1DAGA 2G0TA 3T15A 4BZPA 4PO1A 1D6JA 2QSYA 2ZI6A 3T5DA 2BV3A 3I4LA 2FPKA 4JSTA 4M1TA 1GM5A 2O8FA 4PC3A 1HTWA 2QM8A 4EJSA 3QF4B 5JS7A 2BF4A 1MKYA 4ZCIA 4Q1CA 1W34A 3DO6A 3FDIA 1IN7A 4IFEA 5E3HA 1IXRC 1E9CA 1Q3HA 3RRZA 3THWA 1T91A 1GKYA 2G1KA 1E64A 3W2FA 3L82B 1ZNWA 1E2DA 4BFVA 3OE7A 4MYHA 1YZNA 1EFRD 1XMSA 4UJ3A 1LS1A 4A6XA 1ZNYA 2VHQA 1HV8A 2JLWA 1NNEA 3KQUA 4AI6A 4AG6A 3CPEA 4RD2A 2EFHB 3A8TA 1OGIA 4H1VA 5CIWA 3DL0A 3GFOA 4PXAA 1SHZA 1ZU5A 1R5NA 3UPUA 3K0FB 4Q02A 3H2YA 4PSAA 5HCNA 3AM1A 2W6IA 3AVOA 4BPRA 3PIRA 3TH5A 5DH9A 2RH5A 1R0XA 3GLHA 2PEYA 2GKSA 1FRNA 2F3RA 2ZROA 1U90A 5HZKA 4TMXA 4LYHA 3V4RA 4DEXA 2GXAA 1Q1QA 4P3YA 3FKSD 2GK7A 3NDPA 1G19A 4ZDIA 3MCAA 2C03A 5AJZA 2HV8A 5AUNB 4L15A 4UXJA 4BLRA 2AFHE 2CHQA 1ZVQA 3ETLA 4A0HA 5F9FA 1DS6A 2WVJA 2EFGA 4V0ME 5FTKA 4A0GA 2XOKD 3GLGB 3O8RA 2RGAA 4RZUA 3AUYA 3K0EA 3P20A 2YV5A 4QL3A 1FOEB 4XWAA 2NPFA 3BFXA 1FMJA 1TQ4A 2BMDA 4KSCA 1Q20A 3LRPA 3DOEA 1E99A 2XZPA 3HYTA 3P4YA 2J7PD 3A6PC 4ZPXA 4FMBB 1NG9A 1ONBA 1W47A 1MRNA 2FA9A 4EPVA 1JJVA 4IHQA 2VTKA 4NMMA 5E95A 5KNDA 2QZ4A 2PJRA 3VHXA 3LXXA 4CW7A 3GLGA 4NHOA 1GG2A 5P21A 2VNJA 2C9OA 2NPIA 3QKTA 5EP4A 5AUPB 1EP3B 2EFDB 4PZYA 4LZZA 2FFAA 1OFHA 4Y7CA 1NJGA 1TF5A 4C2TA 2P6UA 5CDFA 2C5LA 5FOUA 3NG1A 3MWYW 1ZD8A 5JMTA 4P32A 4QM7A 5KTYA 4Z54A 3CX8A 1KDRA 2ZR0A 1N6KA 3BH0A 4BLPA 4DHEA 2UVQA 3UG7A 1US8A 2V3CC 3GD7A 1UMKA 1T8UA 2QUZA 1YRBA 2W83A 3E2IA 3CB4A 1KKMA 3T12A 1E79D 2V54A 4QJ4A 1YR6A 2IUSA 1OFIA 1CR2A 1KJZA 1M34E 4UQOA 2GF0A 4C43A 1MO5A 5C4GB 2WICA 2CL6X 3NC1C 3J81k 4JJZA 3NXSA 1NKTA 2AXNA 1ZD9A 1A1VA 3DM9B 4XH9B 1OKKA 5CK5A 4PGOA 2FJUA 4YAWA 1E69A 1GAJA 3VR5A 1N5LA 4XVUA 2J0VA 2F1HA 1IBRA 4NBSA 4AYXA 5B58C 3TNFA 1LFDB 4DB2A 2J9RA 3FHOA 3ONWA 2QN6A 4JBXA 4Q18A 2OXRA 5AJWA 2OV2A 2O0HA 2OBNA 4CZ2A 2IHBA 1E2GA 4JLAA 3C16C 2V7QA 1DG3A 3EPKA 3PR1A 1R5OA 4GMDA 5FFMA 1UKZA 2X2EA 4JKYA 3QKUA 4Q1EA 2GA8A 3K70D 2OFWA 2WPDA 2VZLA 2ZRJA 4Q4JB 2AHOA 1L4UA 5TY0A 2BDTA 2CNWD 3CF0A 1YQTA 4B75A 2DCUA 2VQSA 3MG9A 4B2IA 1HA3A 4F4JA 4UNPA 2J5XA 4ON9A 4MKHA 1SXJA 3SC3A 1RYFA 4XTRA 3V4FA 3DKPA 2GQFA 2FH5B 2QNRA 2QT1A 4AK9A 4D80A 1TF2A 1RE0A 3MMPA 4Q4JA 3T35A 2REBA 1Z0AA 4KFTA 2OTJB 1SZPA 4FK8A 3QKRB 3SN6A 1DVRA 2WKPA 2VP5A 2F1JA 1TEXA 1KSGA 3M6AA 4RZ2A 2W58A 5G3ZA 1Q82D 1VQ5B 1NKSA 2QTHA 4CDGA 1Z8FA 2GPJA 4RY2A 1QX4A 2BSAA 2AD1A 4BUJA 5JI2E 4QGGA 3DKVA 4KSBA 4MRPA 3ZD7A 2G6BA 3R7WB 3QKRA 6Q21A 4A0RA 4Y0AA 2F1RA 3X1ZA 1QGYA 1CR4A 3TUJC 1BH2A 5KO2A 4Y0VA 4YXWA 3QG5A 1EFTA 1AN0A 3SE0A 4D6PA 5LDDC 4ZIRA 3K9HA 3GEHA 2FFQA 4KCGA 3IDQA 2WJJA 1Q0UA 4OK3A 3QKSB 2AWOA 2FWRA 2WIBA 1SQ5A 1T0HB 1M7BA 4NCHA 2O5VA 2BWJA 5F3WB 3BGWA 4QBGB 3R7WA 2GCPA 2QE7D 2W6JD 3PUWA 4BE7B 1T9HA 2HYDA 5KDOA 3VTKA 3TK1A 2FGJA 4NH0A 3I5YA 1FDRA 4C2UA 3A1SA 4TZ0A 2RB4A 3A58B 3KKQA 1XMJA 1CR0A 4B6EA 3EZ2A 1PJRA 1NJFA 2R6CA 3Q7QA 4M1YA 2FF7A 3DEFA 3EC1A 1VYTA 3KXLA 4PPQA 1GNRA 3IIKA 5KPJA 3IEUA 2FU5C 3IUYA 3U7GA 3CCVB 5KDDA 4R71A 2KI5A 4ARZB 2RMKA 1CJMA 2VIIA 1I4TD 2JDID 2ZI5A 4MYTA 4EQ6B 2F43B 4LHZA 5FTNA 1GRNA 2ZE5A 3CNNA 2DFKB 2ODNA 2XB2A 4TL7A 4QHSA 4BEBA 2ZSAA 1SULA 1NF3A 3I32A 4DBLC 1M1KD 3DVLA 2XAUA 3CRQA 2A78A 4B32A 1XTSA 2FSHA 2QAJA 4M1OA 4RVCA 1G4AE 1RYHA 4ARZA 3V76A 3CCRB 2YOGA 3BWDD 4FMCB 2YYZA 2ZYWX 5DO9A 1ZYUA 1P60A 5LD2B 2VHJA 1UFQA 5BXQC 2W0MA 4EQ6A 1Z6XA 2F43A 4JVMA 1Z2CA 2DFTA 1XFAA 1XP8A 4LBVA 4E03A 1R7RA 2D62A 4CEIB 2ZS7A 2EVWX 3BH7A 1M74A 4TL9A 4EPYA 2BJWA 2ZAOA 1QHYA 1W4AA 4EPWA 1H65A 4TSFA 1TUIA 2GK6A 1J9ZA 5FI0B 3PUXA 3RC8A 2P67A 4OK6A 3N5CA 1KY3A 5FOXA 2JJ2A 1YZUA 4Z8YA 3SQXA 2DEUA 3RS3A 1T8TA 2QDXA 1Z3IX 1EWRA 4CEIA 4G1VA 4D4LA 1FUUA 1RRPA 2FG5A 4MYCA 1R8SA 4WXRA 1I4DD 3QE2A 4N3GA 4TLCA 2IEYA 2GNOA 1KK0A 1QUEA 4Q01A 2ERYA 1VCIA 5HE9A 4Q4AB 4NP6A 1RW4A 2QA5A 5CITA 4HE5A 3A1VA 1WQ1R 2JLSA 2H8KA 3ASYA 4KLNA 4EJSC 2OBLA 2KJQA 4GL2A 1AQUA 2N46A 4NKRA 1Z0DA 3ZZTA 1F2UA 1TU4A 1UKEA 3W9YA 1S0UA 1K73D 1NIJA 1SVSA 1ZUNB 4JVLA 1WP9A 3M1IA 1U94A 1E0KA 2A5GA 4Q4AA 3ZS9A 2JLYA 3THYB 2IXFA 1JPJA 5UKDA 2BHRA 4IKEA 2FMXA 2A3RA 4DLZA 1W44A 5EUQB 5FBQB 1VCNA 4B44A 4JJKA 2R2AA 3SHWA 2PT5A 2C95A 3KTAB 5H70A 2WJYA 3B1XA 3T34A 2CDNA 3NEYA 2Z4RA 2VPPA 3WHKA 3L0SA 2ZI9A 3MWJA 2X19A 2ZVQX 5HPYB 1YJ9B 4D4JA 2PJZA 2IA5A 1YU9A 2ZU0C 1N5KA 4G5RA 1EP2B 1JI0A 1VIYA 3EA5A 3RSOA 4YQFA 1D5CA 2GAAA 3OW2B 1QVFB 2IYLD 4AYTA 2B8WA 4NU0A 3KTAA 3P32A 1QFYA 2C77A 3Q5EA 3UMSA 1BX0A 4OI4A 3U7EB 4M22A 2FDCA 3FFAA 4WA7A 3R8FA 1OIVA 5EXXA 3FJOA 1DAHA 3K0AB 4ACAA 1G16A 1ZMXA 5DI3A 4BZXA 4M8NE 3AH8A 4BEJA 1GKIA 2WJHA 2CLCX 2REXB 2OXCA 2CK3D 2PH1A 1JQLB 1MO6A 3FYHA 1TADA 3H84A 4I1SA 3TRFA 4L8GA 3GLIE 2EWWA 1XJ0A 2ZRIA 1EWQA 2YHSA 3OAAA 4NCKA 1ZRHA 1P2SA 3ASZA 1E96A 2VF8A 3TR0A 5KSWB 2Q3HA 2QAGB 2IXGA 1O87A 3FE2A 1FQJA 2ASEA 1KI3A 1S1CA 4L4UA 4W5JA 4N0EA 1G7RA 3K53A 1YR7A 5EE1A 1IOZA 2BVNA 3RABA 2LWIA 4YDSA 1F2TB 3AKDA 3FPAA 1P7CA 3HR7A 2Z6VA 2Z83A 3K09A 1U0JA 2XSZD 2IL1A 1TVCA 1ZC4A 2BBSA 1YZGA 1KZGB 2QM7A 4Q7MB 3BOSA 4TQ9A 2QP9X 1V43A 3RVBA 3LNCA 4B71A 1XRJA 1NL3A 2MSEB 4M9QA 4ZDJA 4ZV4A 2GZHA 5D3QA 3BE4A 1Y3AA 3ECCA 2OCBA 2CNDA 1FNBA 2DY1A 3CIOA 3RS0A 5TMPA 2RKOA 3ZLJA 2EU8A 2IS6A 1DELA 1KAGA 1TF7A 4CYMA 2YWFA 1IQPA 4IXMA 3N2EA 1LS6A 4V02A 1YHQB 1NSTA 1Z0KA 2G0NA 2GXUA 1YR8A 4LHVA 3AP2A 3QJYA 5EQTA 1I2DA 5A5GA 2J46A 3QY0A 1E1QA 1MO4A 2QSZA 3LY5A 3KXIA 5AWFC 4F4IA 3EZ6A 3TIFA 1X1SA 5F9HA 5KSZA 1COWD 4RZ3A 1YE8A 3CPJB 1XPUA 4DJTA 4MYUA 4TWZA 4FMDF 3U3JA 1XZPA 4RD3A 5DISB 3C4JA 4QGAA 3SI7A 1XEWX 3TVDA 3AVUA 2R8RA 3OIVA 1D2MA 3TJZA 3WMFA 3G0HA 3SYLA 1M7GA 3C14C 3WBKA 4HLUA 2ZAMA 4LJ4A 1E9AA 2HF9A 3SOPA 5DN6D 2YKGA 1KO1A 1W36B 1ZCBA 2Q9CA 3UXMA 4V0MA 4Z51A 2NO1A 1GDDA 1MABB 3FMOB 4MRNA 4CT4B 5FBVB 2VNKA 1P72A 2QTZA 1SKQA 3AVXA 1K6MA 3BBPA 2XJ4A 4HLDA 3P26A 2ZRMA 3AVQA 1N3BA 4PAQA 2NO6A 4S35A 3IO5A 3GFPA 4OQFA 2MMCA 3W3AA 4DVGA 1XU4A 3OEHA 3AF4A 5CM9C 2GVDC 1IY0A 3W5IA 3ZVMA 1E2LA 1MOZA 1MABA 1TAGA 1Z6YA 2WM9B 2ZJBA 1XD8A 3W2GA 2JLZA 3FWYA 2P6RA 1IY1A 2QBYB 3BH6A 5HR5A 2Z43A 4URZR 1JB9A 4I99A 2X1VA 1E2QA 1LF0A 4ZI3A 2RGNA 1W46A 4XWKA 1W0JD 3C8UA 3I62A 1VIAA 1N0UA 5JI3E 1G18A 3QPVA 5J4KA 3AKYA 2OT3B 1UEJA 4M53A 4R2IA 3WRYC 1IONA 2C78A 4OKSA 2KSQA 1QHXA 1SM4A 3FTQA 3U3KA 1JNYA 3QFCA 3FMIA 2XGJA 2ODWA 1BOFA 1Z06A 3E5HA 3K9NA 4RKFA 3CNOA 2OCAA 2Y8EA 2B5OA 4P4TA 2ZM5A 2PIAA 4L5BA 5FBWB 2QRZA 1KO5A 4GBMA 5FR2A 1MV5A 5J5CA 3U7HB 3JQQA 1CJVC 1JJ7A 1KSHA 121PA 1HURA 3EAQA 1W0KD 4JBYA 2GZAA 3IBGA 5FUYA 2ZRDA 4BLSA 3RRYA 3S1AA 1Q22A 1CU1A 1VCOA 4QOSA 1Q1EA 1S4QA 3QSYA 1FUKA 2P5SA 2GZDA 4KFUA 4PSKA 5DHFA 1BIFA 3TAHA 4HDCA 2IYXA 2JIZD 2YJTD 2ONJA 3CONA 4POAA 1G3IA 2CVHA 5JCPA 2CMKA 4B2LA 3R9WA 2YOHA 1E2NA 2A5JA 2REOA 3LO8A 5HXBA 1Z0IA 1JPNA 2OAQ1 2L0XA 3EC2A 5F98A 2IC5A 2OAP1 1F20A 4R7ZA 3TE6A 2WWGA 4A15A 4TMZA 3U6KA 1QGAA 4G1UC 3SFZA 1HT1E 2VBCA 1KJYA 4QBFA 4MITA 3MRSA 3MJRA 5E7JA 3U2QA 1G291 1XTJA 1XCMA 2IF2A 1KIMA 1T6NA 1I4LD 1SVKA 4V0LA 4YDHB 5GVRA 3NTUA 3FB4A 1W87A 4HLCA 1AS0A 4Z8XA 2QL6A 1KMQA 2BBTA 2YC4C 1XPOA 3I55B 2PLRA 4MH0R 4FCTA 3LWNA 2QI9C 1H8HD 5FA6A 1J99A 1FL9A 3UATA 4C4PA 5CB6A 2K5UA 1XD9A 1T3LA 4FCWA 1DAIA 5LBIA 1Z22A 4TMWA 1CF4A 2VL7A 1HEIA 3VAAA 3CRZA 3EARA 1OSNA 3RRMA 3TUIC 4TN1A 1S2MA 4P4SB 4TTRA 3CLVA 4B3CA 3CWZA 3TMKA 1IN5A 3SEAA 4W5HA 2WWWA 4DLTA 2SHKA 4B3XA 3K0CA 1K5DA 4RFSB 4PQFA 1JR3A 3IGFA 1YHNA 2I3BA 4TQAA 5LD2C 1VQLB 1BO6A 3CC7B 2IYWA 2B7BA 4OI2A 4Q4LA 1TNDA 4IVRA 4P4SA 2J0UA 1W4BA 1WCV1 2XZLA 1OF1A 1P61B 3KQKA 3L2OB 4N1AA 4I81A 2JA1A 3DPUA 3EIEA 1KRHA 3KQNA 4FD2A 1ZD1A 2BMEA 3JZAA 1VMAA 2ECKA 4RFSA 4B6FA 2H1LA 3QUSA 3D3QA 5FL7A 2R6HA 4EAQA 1U0LA 4UJ5A 4KVAA 1X3SA 1QH0A 1EX7A 2PMKA 1BQEA 1KSJA 1JAHA 5LB4A 3LQQA 3AVWA 3AKCA 1CRQA 2G3YA 4HLQB 1NG1A 4BFWA 4X8HA 3I8XA 3GLHB 1YZTA 4L9WA 5DYIA 3U60B 1DG1G 4LJ7A 2GBLC 1QF9A 1PLLA 4F92B 2V8OA 3RHFA 2WKQA 3VKGA 4PC7A 1EGAA 2HLDD 2CLDX 4MGKR 3OZWA 4Q4HB 1GTVA 5C2JB 3KQLA 1FRQA 2HF8A 4D2IA 3IIMA 1XTRA 1KI7A 1XX6A 2GEUA 3LW8A 4D0LB 2NMVA 2BBWA 5AK0A 4AG5A 5BN5A 4DLYA 3CX6A 1BX1A 4BZQA 2FFBA 1OXUA 2IXEA 2OHFA 3B7GA 2ZU6A 2NO7A 3EPHA 2HMAA 3WYAA 3LBNA 1NN0A 1RZ3A 3CCJB 4Q4HA 1SQRA 3THXA 2ZXUA 2ATXA 3VNUA 5KDLA 2HYIC 3CXCB 1QG4A 3AVTA 2QQEA 4D25A 5JSZB 4NYIQ 2CLSA 1KDOA 2YVUA 3SU8A 2EWVA 1J7KA 1G5PA 2GETA 1W1WA 5EE0A 3OFNA 2QGZA 1KC8D 3UANA 1QHIA 3OF5A 1II9A 1TLLA 2CCJA 3LW7A 4PTLA 1Z2AA 2FPLA 4DCUA 3LX5A 1U9IA 4ZCMA 2IT1A 1OJLA 1UBFA 3JVVA 1QHHA 4FMCF 4DEYA 5JSZA 3KJIA 1JBKA 4MUAA 2GJ9A 2BGJA 1JA1A 3ZH9B 4TYNA 2VNIA 2WPDD 4OL0A 1S72B 2WJVA 3RDPA 4Q47A 2BM1A 1US8B 3UG6A 1OGJA 3QXSA 1W4CA 4IXNA 1E94E 4HAZA 2ODBA 2RHMA 1NN1A 2JJ1A 3GJ4A 2O8EB 1E2HA 1XMVA 4AF7A 3N70A 4EFLA 1QHGA 3K09C 1AA9A 1SKYE 2PZEA 1UDWA 2WIAA 1W4RA 4OHYA 2D4HA 3KKMA 5FOSA 2DWOA 2QAGC 5BQ5A 1DO2A 1JR6A 4H9GA 2A5YB 2GJSA 2OCPA 5IT5A 1E2MA 1T0JB 3KUDA 4EDHA 4US2R 1E63A 2VYQA 2OLJA 4G3XA 4M21A 3E1YE 3FMFA 5JHHB 4GDFA 4AKGA 5BN4A 4OQXA 2WKRA 4KV9A 1LNZA 5FBLB 2O8EA 5CYOA 1D1NA 4A8JC 4PZZA 3CH5A 1WB9A 1D9ZA 1P9WA 2JLUA 2EQBA 4DDUA 4FI3C 4ZDKA 3ZJYA 1CNFA 3W5UA 1E9EA 2NGRA 1KHTA 5KNCA 2IUUA 3ND8A 1GITA 5AJVB 1XEWY 1L4YA 3HR8A 1QVRA 5G3YA 1OHHA 2GTPA 2ZRNA 4GP7A 2CJWA 4A0FA 3OEED 1TQDA 1ZUIA 3QF7A 1A7JA 4LV5B 1W5TA 4K1XA 3T1OA 5E7MA 3AP3A 2VRWA 3EIQA 2GCOA 1ZNZA 5FTLA 3PENA 2HJVA 1NVVR 3MD0A 5IK2A 2FV8A 3KX2A 3GLIB 3N2IA 2R6GA 3Q3JB 4DQKA 1AGRA 1G3MA 1BKDR 3BXZA 3IIJA 4PSVA 5HZHA 3C15C 4QNRA 4WVFA 4HLUC 1SXJB 4DXAA 4BPBA 4M2LA 1KDTA 1NVWQ 4KO8A 5DIFA 3V00A 5JFGA 1G8PA 1X8LA 2ZR9A 4GZMA 5A0FA 1UBGA 4EPRA 4LYFA 3NHBA 1OYWA 2CHGA 2GVZC 2XOKA 2ZSBA 1OXVA 4DSUA 1FNNA 1CIPA 2C9CA 3QG1A 4DLUA 2AN9A 1EP1B 4TLEA 4TT3D 1G7SA 2VSFA 4P0TA 4UXIA 3GLIA 4DCVA 1NDHA 1CXZA 5D3MB 2J7PA 3EZ9A 1TPZA 3CKLA 2F55A 4YC7A 4B2PA 3VR1A 1C9KA 1W36C 1BS1A 2OM2A 3AP1A 5GJBA 3EPJA 3O8CA 4NYMQ 4TYYA 3X1WA 4OJKA 4E09A 1OT3A 3KFVA 1AJEA 5FPTA 3CNLA 3AF3A 2B7CA 4NCJA 3F3YA 5AR1A 5C18A 4DKXA 2NO0A 1XTKA 4C0BA 4PC1A 1T3HA 5D3MA 4KYIB 2RGEA 4JLDA 4OHVA 2F7SA 4ZIRB 2H57A 4GT1A 3A4LA 3QPWA 4C7OB 4C30A 3VO1A 2OLKA 1IAQA 4B3FX 1R0YA 4BRWA 2VSOA 1CJKC 5GV8A 1N5JA 3GJ6A 4FIDA 2QRNA 1FTSA 1CS4C 2VP6A 3QXHA 3BB1A 1X8JA 4BLTA 1J2JA 2OBMA 1G64A 4TYQA 1XPRA 3GP8A 2ZE8A 3QVVA 2HT6A 1G17A 2WAXA 5KU1A 5JEDA 4OI1A 4V0OA 1E79A 1PZNA 4BFUA 4KXFB 3ZIAD 1E98A 4ZI2A 4LOAA 1XBTA 4C7OA 4ZGNB 1DAFA 1KSFX 3SJCA 4IJMA 1B0UA 3TAUA 2VHCA 4A36A 3GJ8A 3Q5DA 3L8ZA 2JGNA 2OILA 2JLQA 1QFJA 4G1BA 3VKWA 5L3VA 1ZIOA 4URUR 2NTYC 3QEOA 3IHLA 2LKCA 1OIWA 4RD6A 1BMFA 1M1YE 3AGPA 1UPTA 2QENA 421PA 3NH9A 3TR5A 4KJZA 1CP2A 4KBGA 1JA0A 3KDSE 2CCGA 4IDOA 4D0GA 1Z83A 1G8FA 3AF2A 4XD7A 3EIHA 3CZPA 2FSGA 3UMFA 2OFXA 4JLKA 3KZ1E 4JT2A 4QGHA 5DYGA 1Q81D 3REGA 2D7CA 1XEXB 3PITA 4JT4A 2XB4A 1FFHA 3BC1A 2OFOA 2DYKA 4R98A
chains in the Genus database with same CATH superfamily
5JDCA 1HORA 1KPHA 3VH3A 2P8SA 1C30B 1B8VA 2KBFA 4IS3A 2HU2A 2F3CE 4AG2A 2QA4B 4GUAA 3AWDA 2EX4A 2C0PA 2X9VA 5C8YF 4Z4TA 4J7UA 4RX1A 4Z5XA 5B1HA 2AIPA 4QTZA 4M7GA 3IS3A 3KLMX 1EAMA 4P2BA 1KORA 2PGQB 2PVPA 1CQWA 1U0GA 2PFKA 2Z2XA 1AKQA 2ZZFA 3OESA 2XTMA 2MU1A 4UHHA 4BFLA 3VR4H 4SGAE 1XAIA 2QJTA 1NT1A 1IQGA 1XDGA 2VDJA 4ASUD 4RU1A 4K9SA 3AXTA 2W6JA 3PGXA 1NVMB 3B1ZA 1Y1SA 5EODA 1X80B 3PNVA 3F0PA 5JCXA 3ATKA 4RCYA 1P3EA 2CNOA 4ERNA 3N86A 3HU3A 4RHXA 3K0HA 1JRSA 5EY5B 4HAXA 5IJZA 3AEZA 4KJXA 3E5RA 1MR3F 1X7AC 2Q3BA 1JAXA 3V4LA 5CCEA 1Z37A 3CX7A 3P0RA 1ZY2A 3SXPA 4W82A 5CB4B 1UJMA 2X5JO 3V3MA 3A27A 4N0MA 3ZDFA 2JZNA 1GZ5A 2P77A 2Q5JA 1SFIA 3JD3A 1R10A 3PRKE 4EBFA 1LW7A 3FFWA 2IS2A 5FL3A 2KWIA 1H2XA 1CSOE 2RI1A 3JTMA 2VJMB 3VR4A 4KQJA 2NU6B 5T64A 5EGMA 2AN5A 2POQX 4RZHA 4LOJA 4QXMA 1DMSA 2EGHA 2XKBA 3LU1A 4HWOA 1F5LA 4O1HA 4FBLA 2JEYA 6CHAB 3KBBA 1CUEA 1LQTA 5K4GA 4D4IA 2AMFA 1IY2A 4P7BA 3RVDA 2D74A 1YQDA 1MHTA 2W2VA 2WD8A 1L5GB 3EYDA 3ZV9A 2H1HA 2EKZA 1Z8HA 1PNRA 1GGFA 3G3EA 1O6BA 2OCYC 4UAVA 2XE4A 1QP0A 5BSWA 4GM0A 2RGXA 1Z8IB 3OKPA 1UCYH 5I51A 1VFNA 5JBNA 2YW9A 4W1RA 1UEXC 5GADl 5CRIA 2LNDA 3KTOA 4FYMA 4MHTA 2A0KA 1DWBH 3LPDA 4Z86A 5C4IA 1M34B 3UQVA 2OK7A 4BO9A 2G80A 5DGHA 5TJHA 4B6GA 3CGGA 4ZQBA 1YJ5A 2SCUB 3QHQA 2OSBA 4TV9A 2CUNA 2FWBA 2D0IA 5DTJA 5K0HA 2WSBA 3ZZ6A 3T1HB 1K88A 3UMMA 3KNXA 5AVYA 1ZH8A 1ML4A 3KP1A 5AJYA 5DO4H 2WTUA 2VK4A 3K31A 1JBEA 2ISSD 1U2ZA 3ETNA 4MNWA 4ZVKA 3C5HA 1JG3A 5K0FA 5JDCC 1O2WA 1P5RA 1JIRA 1N2EA 3HGNA 3DEIA 1CR1A 1D2RA 1LA2A 2TMYA 4CEHA 5A88A 2G72A 2O5CA 1UADA 1VJSA 3FBGA 3AZQA 5AW1A 3G2KA 4NE2A 4ZKRU 1EJ0A 4KHZA 1R0ZA 5EFZA 1OXXK 1XQWA 1I51A 3RC6A 3TCXB 2HMWA 4X7RA 5EP2A 4PQGA 2QUHA 1RJ9B 3OM8A 3CESA 3KAPA 1HNZB 2JFBA 3TNDA 1CUCA 5CDYA 5F2KA 4TLAA 3EOBI 3H1AA 1WZCA 4FXPA 1Z75A 2HPPH 3I8OA 5TC4A 1JU9A 5BV0A 4AY4A 3FWKA 2PK3A 2K4MA 3LBFA 3RU3A 4W8GA 1OH8A 1SAYA 4PSUA 4ZVQA 1AX9A 3VFDA 2GZ1A 3UOPA 3NIBA 4E4TA 5H4HA 5IAOA 2JH5D 3IG6B 4BLVA 1K4YA 5DM60 5LPEA 1BWPA 1MGPA 2BEWB 2JEOA 1TT7A 2PUTA 3GY6A 2BMAA 3RIHA 3IT0A 3PDWA 2JAPA 3OBBA 4RABA 4ARAA 2XNDA 1K7EB 1NQUA 3TF5A 1O3NA 4U2GA 1PV4A 3UUZA 1AQ6A 3FFGA 1WAMA 1Y5RA 4FU8A 1B23P 3F96A 1NMZA 2QNIA 5JSFA 3EXEA 1BQYA 3OY6U 4E5VA 2QPTA 1LTHR 1GJ4H 5HQ3B 3EGVA 4IOMA 2PFGA 4H6XA 1AN9A 5FX2A 3GJQA 4JI6B 4HDQB 5CFOA 3L5KA 4AIIA 1JTVA 5MN4A 5BNZA 1YI2B 1Y33E 1ZGJA 2ZI7A 1SVLA 2C31A 1TZ2A 1O1YA 1KDZA 2FEKA 1P9LA 5H0IA 4ZOLA 1PJPA 2FGKA 2CRVA 3OEWA 1BJUA 4KGAA 3GJRA 3CMAB 1ESMA 1DX5M 4JI5B 1OB5A 3PPXA 4BBPA 2GYWA 4OB8A 3GQBB 4RHCA 4ECAA 2ZBDA 2CV2A 3EDOA 3RIGA 4OP7A 5BWNA 2UUJB 2FR8C 1WKBA 3SZMA 1WLSA 4TLDA 4RIIA 4ZO8A 4QG3A 3VI3B 3HFGA 2OO7A 3GCDA 1NQWA 4KR3A 5IXSA 2DUUA 3R6KA 2AOTB 4L2IA 1GQSA 4CKCA 2WHRA 1ES9A 2DE9A 2Q5QA 2ZSFA 1SVIA 1G8AA 4GBGA 3TH3H 1ZUWA 4BNYA 4X94A 1B3RA 4NEHB 4BL5A 2YFKA 5ADVA 5E1DA 1XC7A 1G41A 3D7KA 4CLOB 2YNMA 2PUAA 2PRKA 4RNCA 3WLEA 3DUXH 3OBIA 5JCZA 5HIAA 2ESTE 1QIIA 4J8PA 2XT6A 3AERA 3GUVA 1JIVA 2JIBA 4DR6B 3GMIA 4Z4ZA 1NRPH 2VJDA 1VQNB 4BIMA 4J0KA 3PMHB 1PZMA 2V4DA 4CLXA 4K6CA 5MFZA 4U32A 4AMGA 4PX9A 2I54A 4TTJA 4TV8A 4HPJB 2CFTA 1ADBA 4PBRA 1HZZC 2DRIA 1GI6A 3AV0B 2F9LA 3OJWA 2RG3A 3ZQKA 1W0YH 3RSLA 1UFRA 2IPHA 2GMWA 1E5QA 4X6XA 1J0CA 3A80A 3RJTA 4INOA 2FI5E 4LISA 4FJ0A 1YLCA 5G53C 5H59A 4EA8A 1NXQA 2ZB8A 4ND6A 1WOFA 5FJIA 2O8CA 1N06A 2J41A 3PEWA 4WBNA 2WF5A 1KMMA 2V6JA 1AU8A 4B8ZA 3G05A 4MSUA 4YRPA 3CLRD 3PJFA 5FTJA 2BGIA 3OTOB 3CCUB 1HZJA 4W5NA 3ZG6A 5BW5A 5DM4A 3FNEA 3M4YA 3I4FA 1EAIA 1XTIA 1WUTA 3B6ZA 5HDQA 4AJEA 1SOWA 4PCLA 3SBKA 2YIDA 4AORA 5B3JA 5H1YA 3AJAA 5ALTA 5EC8A 1G21B 4HB0A 2WM3A 2R1VB 2X7XA 1XMIA 2X7JA 2Z2IA 2FPXA 4WX2B 4OBBA 1AXGA 4S1NA 3AR2A 1CHOF 2H9EH 1Y0BA 1VQ4B 4BFZA 3O21A 3ZK9A 2J08A 3WWEA 5B7GA 4OV6B 1SXJE 3BSFA 2QTRA 3HK6B 3LGUA 2C94A 1CZKA 4FC6A 4H27A 2EFCB 1TTQB 2VDPB 1TOAA 2FZ5A 4LHSA 3S7HB 2ACKA 3FSRA 2IW1A 1Y5LA 1T7CA 2JAWA 4HAUA 1SGPE 4R3WA 2ATCA 721PA 3UB2A 3ATLA 5JJIA 4QNNA 1A9QA 3MSCA 1RJXB 2HRDA 2CVFA 2IQIA 1BHXB 1TONA 1R74A 4C6SA 3LD9A 4XSVA 4EI7A 1TIOA 1HDTH 1PKXA 3H5NA 3Q00A 3WQZA 3PWBA 4UTPA 3FPLA 2GEKA 3VOBA 1PPCE 3H5OA 3RGGA 1N6OA 5JBIA 5K6RA 4HNGA 2A9JA 3U9AH 1MA3A 1ZYOA 1G1AA 3K9QO 2WZQA 1DB3A 2M6LA 2GGVB 4CCAA 2RKWA 2C7GA 1J2UA 1QQBA 2BLWA 2YNMC 1MH0A 3TOXA 4UPEA 2NW6A 3GW8A 3ADKA 3SBDA 2A8YA 1VIVA 3U1BA 2HJ9A 4KDRA 2RAFA 4DAOA 1D4AA 4Y1GA 4L4ZA 4BBZA 3CV3A 2WSSA 1UIMA 4CEHB 2YVQA 3FCUB 3RWMB 2NP6A 2DSNA 4AJOA 3KEQA 2YC2C 3KKPA 2IUFA 2GD2A 4I46A 1Y1PA 4DLWA 3P7MA 1O6GA 4FZ3A 2V03A 3FLMA 3PVCA 1EU1A 3S3TA 3O90A 3Q3AA 3I72A 3AUFA 2P8OC 3OFND 4Z1MA 1F48A 1MB4A 2QD1A 5JRZA 4NS4A 2NXWA 2GDJA 5AVSA 1W8BH 4EKGA 3F90A 4TTTS 3T7RA 4YMSA 3BMCA 4EY3A 2E21A 3CKMA 2OWDA 2QSYA 2HTEA 5LP6B 2AG0A 1QPBA 2BF4A 1MKYA 5E6SB 3WVNA 1T91A 4Y1RA 3WLFA 4RSPA 3MO6A 4D8UA 1L7XA 4M83A 4UJ3A 1E89A 4C5AA 4H15A 1C81A 2QNBA 1WCZA 2MJLA 1R5NA 2WB2A 1TQHA 2C9DA 2M6KA 3R7SA 3ZHRA 5EWMB 5B3JC 3WDSA 1GZUA 1AV6A 5JDUB 2BFBA 3WJAA 3UWMA 1XQBA 1OFVA 2EQAA 3K0EA 2NPFA 2QRPA 4M0CA 3SC6A 3FVWA 1ONPA 1SUDA 4KRGA 3ATIA 2Z3ZA 1UOPA 1OI7A 4MWBA 2PNJA 4IHQA 4NMMA 1VMEA 2QZ4A 4D9NA 2VNJA 4NZZA 4RACA 4ZOLB 1PPEE 3H1FA 5F12A 1GZ3A 2O5RA 3CU5A 1RJDA 2WJPA 1N4AA 3E9EA 2IUSA 2EKBA 4DLBA 4J75A 5IMSA 3LT0A 4AMVA 3QITA 3E1KA 4JJZA 5CX4A 2DHQA 1TLFA 1GAJA 2CNBA 1D04A 5A7GA 2DKOA 3FHOA 3FWPA 3WLSA 3DE5X 4RVHA 2D5IA 5EHGA 3HXKA 2EBHX 2O7NA 1QBVH 3HN2A 4G9BA 5ABPA 1J2RA 4HLNA 3GN2A 5CA1A 2HGSA 2XYVA 5ALSA 2G4LA 3JQ7A 3HFJA 2QT1A 5I47A 4FKBA 4RKYA 1U8FO 4Q4JA 3C5WP 2VJLA 1W1UA 2R47A 1DVRA 1MX9A 4U1RA 2W58A 4H42U 3AERB 4BUJA 1BG6A 3HYLA 2PLXA 2C5GA 1T8LA 3QKRA 2F1RA 2IODA 4XRRA 3RYCA 4Y6QA 1Q0UA 1XRNA 1BBRE 3PLKA 2BFFB 1L4HA 3URCA 3R6WA 4BNZA 1T9HA 5KDOA 2FGJA 3FUCA 4TZ0A 2K2WA 4M1YA 1GNRA 3DDUA 4CLHA 1JR4A 5C31A 3P5SA 4QDJA 3O8NA 3EVZA 3KOZA 1SCIA 4HH0A 4NMXB 5CW2A 2IZ7A 1KPIA 4TL9A 1Z5NA 1LKAA 1RZUA 1SKBA 4U30A 2VQ3A 4AZ0A 5EVCA 1T8TA 5T3HA 4G1VA 3MEQA 1DFPA 4BMXA 3QE2A 3IEMA 5K3FA 2JFPA 3JR3A 3NHPA 4Y0YE 1UKBA 2YWDA 3PIIA 3ET5A 1OWKA 1RTTA 1UBTS 5JTUA 4HQ0A 1ZXBA 3FN4A 3M37A 4ZYTA 4C5CA 5CCXA 2CL5A 2GM4A 4MCJA 4B44A 2PT5A 3FH0A 1PG0A 2VPPA 1EZUC 1QHRB 1VZ2A 2ZVQX 4YCLA 2VIOA 1PG2A 4AYTA 4B3JA 3U7EB 2FDCA 1KQGA 4M46A 4CKEB 2BGTA 3JD1A 1P7PA 2P41A 4ACAA 1JV2B 1EJ6A 2FP4A 1VHJA 1NNSA 3L8FA 2OCKA 4I1SA 4MR9B 3BGOS 3P2KA 4Q3KA 3EUEA 3CTAA 4RIEA 4BV2A 2PBLA 3LX4A 2X0FA 1FQJA 1KTTB 4OFBA 1IOZA 2GRAA 3RABA 3DVSX 3VU0A 4K40A 3AL0C 1CY7A 1CUHA 2Y1EA 1EK5A 1GTZA 1HPLA 4QPNA 2O54A 3IP8A 2PAAA 1TOMH 1AKVA 4M9QA 4G5HA 1P2QA 3EVNA 4AJPA 5MN5A 4NCXA 2EU8A 4LVCA 1IQPA 1LS6A 4IDAA 4YLYA 1XU7A 2AUTA 3PDIA 3LY5A 5JAOA 5B1YA 4JC5A 3SFTA 2FHPA 2QZSA 3OIVA 3VKUA 2IN2A 1J25A 5A0BA 2KQUA 1EP9A 3BD8A 1UINA 2NV2B 3KPVA 4CT4B 3LDXH 1CUZA 5H9WA 1P72A 1HNWB 4X1YA 3KQPA 5C2ZA 1C5RA 3RMLH 4LJKA 4K88A 4RO0A 4WXHA 4OPOA 3MJFA 3B9RA 3MWDA 1YRLA 5HR5A 2X9GA 1TNJA 2X1VA 1E2QA 5IC6A 5FWYB 3C8UA 4HR7A 4Y2RA 4N3BA 3AKYA 4G9GA 1QHXA 5A4AA 1D3QB 4PSCA 3E5HA 1IOWA 2DY0A 1HYBA 1ZS9A 2AA3A 2NSJA 4IHAA 5ALZA 5JNWA 3RXVA 4WI1A 2ZPSA 2DAPA 1A77A 2G5GX 1EUDA 1JYEA 3PYLA 4BLSA 2OP1A 1ORDA 2V97A 3T2NA 4J1TA 4LC9A 1G3IA 4IBOA 4W1QA 2YOHA 1U7XA 1Z0IA 1YC2A 3SX2A 5AHGH 3MGGA 4AN1A 3IULA 3DTVA 4LRYA 2A2QH 1LWNA 1XPOA 5JBBS 1P04A 1OI2A 5FA6A 4OS4A 5JQGA 5IDQA 2Q9UA 2BD2A 4P3PA 3RRMA 5BRNA 3TIXB 2ZIUB 3BMCB 4KMSA 1HLGA 4W5HA 3SZGA 2QN8A 1LJLA 3RQIA 5KREA 5C5NA 4K5ZA 4R1SA 4D9JA 3OD1A 2ZW9A 2Y3IA 1OF1A 1UPCA 2P9BA 1G60A 1U65A 4INZA 2B34A 1O5IA 2V4MA 4E2ZA 4Y0ZE 4G0PA 4BB6A 3RSFA 1RWOA 3KM0A 4Q7EA 2CBXA 2GBLC 1PLLA 1WSBA 3RHFA 2Y1XA 5FLXA 1CBWB 4A0SA 1GTVA 3KQLA 2BFBB 1U02A 4PO3X 4D2IA 4QELA 1W14U 1AZLA 5BORA 2QN9A 3CX6A 1GPZA 5ALFA 1CY8A 4DDKA 1NN0A 4AZWA 2PXAA 2FCAA 1NW5A 2QQEA 1MDFA 3HLKA 3C8ZA 4J0DA 1LI4A 1F12A 5LQRA 2HPAA 1QHIA 1ZR2A 1AVWA 3E58A 1QVWA 3NWEA 4BNIA 3DAGA 1EWTA 3ETCA 1N0IA 4BYMA 4HAZA 2ODBA 2RHMA 3MU5A 4AF7A 3M2TA 4RYDA 4KK3A 1QHGA 4W1PA 4M0EA 4KIWA 1FUEA 1BITA 3BICA 4UD2A 4B83A 5BQ5A 1ZD2P 2OXFA 4FS3A 4MMYB 2OLJA 5I01A 3E1YE 3DSRA 5L9AA 3D54D 4PZZA 5H81A 3TDKA 4FXGH 1GITA 1NLMA 3FB1A 1NRXA 3PX7A 5DGJA 1W5TA 3PWKA 1E7RA 4HO1X 1WTGH 2VRWA 1CB7A 1YGYA 3TJOA 3BPSA 3EIQA 5CA1B 3MZ0A 4DQKA 1AGRA 1G3MA 3PV5A 4ZYXA 3P70B 2X3FA 4YPFA 2XOXA 1HCGA 2DQSA 2XLBA 4DXAA 1MT3A 4GLFA 1X8LA 4U2KA 2I6QA 3LQFA 1ZEMA 3TN7A 1MVNA 4YJ3B 2P9FA 2HDHA 1YVUA 4YZUA 1NDHA 2VKQA 2NSHA 3RADC 2BFPA 1Z74A 1IXKA 1C9KA 3HKEB 2BE9A 4TT8A 4DAEA 3A6GA 5KZMB 1XTKA 1ZRNA 4GT1A 2BD8A 2FUKA 2H85A 5H3CA 4DJJA 5KWVA 3GJ6A 1RP7A 1BWQA 1CS4C 3U4DA 1QTRA 1X8JA 4P92A 3KZCA 1WP6A 1VP3A 1CUVA 1R00A 2I34A 3LLCA 3ZWMA 1ZIOA 3H94A 1OIWA 4KQ6A 1NC1A 421PA 1MTSA 1SZDA 1G8FA 2NT4A 3D4PA 1R88A 1P77A 2FSGA 3N8IA 1U3GA 2O3RA 4NOMA 1AKNA 3UGKA 2YVAA 3K9CA 1Y8ZA 4J6EA 1SHHB 5JFOA 3RH0A 1XLWA 3GUUA 4NR0A 4Y2SA 1NLYA 4IGIA 2STAE 2VCEA 4EZEA 3OY2A 5K3FB 4WK4B 2ZGBH 1DAEA 4WZEA 2OUAA 3CJTA 1HAVA 4CBNA 3E1SA 1VL5A 4FHEA 4GM1A 2EOAA 2WAAA 2BLVA 2IRWA 3A81A 3MCTA 2H59A 1QOPB 4ARSA 1PUXA 4BFSA 3LG2A 4I4TF 3S1LA 1HAGE 3RIYA 2CYAA 5B2FA 2Q0HA 3KUKA 2FOFA 4LHWA 4XOIA 3G6EB 1H0SA 2IEZA 2PMFA 2PZLA 1QRWA 1OWIA 2HGZA 4R2XA 5HE8A 2ZIZA 1NBMA 1EX1A 2FP4B 3COSA 4LTMA 1X1BA 1K4KA 1TQ7B 4TSRA 1DOZA 1BCSA 4NCYA 2GPTA 4ZRMA 4S1TA 3JQRA 4J1SA 3KKOA 3OVMA 1OIXA 3QEKA 4EG0A 4QTUB 3TQCA 3QTOH 1GHZA 1HKHA 3RNLA 2IVFA 3PJRA 2EKLA 3E3AA 1XN4A 1YOBA 3H86A 4DLPA 3I42A 1M9UA 2IEAA 3DXZA 3E18A 1JG7A 1H6BA 4BEWA 2YWJA 2DR0A 3H17A 2HDOA 5C8XA 3QKWA 2GGSA 3IAHA 4QYSA 1F06A 1OBFO 3FOZA 4WKPA 1I3MA 2VDNB 5CHYA 4BDSA 2HSEA 3CCSB 1ENPA 4NCAA 1GYPA 2MDTA 2BN4A 4HZIA 1HOXA 2WWRA 3KEMA 3QVMA 5CFLA 2O20A 1MUUA 7GPBA 1GU0A 1S01A 4DNQA 4QDOA 1T4DA 1VR1H 4G8BA 1NN3A 2P3TB 1Q0TA 2XDQB 2N42A 2M98A 1KQNA 1W73A 2ZOSA 1C7QA 5FKJA 1GL7A 5AI0A 3ENWA 3FMPB 4PZUA 2H6MA 1NLFA 3A7XA 2XAAA 1Q50A 4CMJA 4DNXA 4C7VA 5GPBA 4EBBA 1KI4A 1SC1A 1PQPA 1X7XB 1EB1H 3THOA 2AZXA 4HNUA 3VYUB 1X39A 4ABEA 5D7BA 5EHIA 2H5CA 5AHOA 4EJ0A 2O8DA 4OP1A 3RXGA 1XZLA 2WF7A 1A72A 4LCJA 4LE2A 1BGVA 2X42A 1K7SN 1YL6A 2W2TA 2EZ4A 1FVFA 4X06A 1JQ5A 3R5TA 3RC7A 1FMCA 3QKIA 3PPYA 4F9TA 4GXRA 1GJ7B 2BY9X 1XRQA 2DX7A 4AY2A 1LTKA 1MXFA 1YJNB 1QLJA 4BXOA 3KOYA 3NEJA 3SV2H 4WXPA 2Q1YA 4C4TA 1SGYE 1SC4A 3S7KB 4TMTA 4A8PA 4IAOA 4YALA 4II2A 1KYZA 2SGPE 1UXJA 5DVZA 1J4AA 3FNIA 1A2BA 3CC2B 1CQPA 5CEFA 4KDEA 2OYRA 2WFAA 3V33A 2J0QA 1TGCA 1SC9A 3M5OA 2HCBA 2QCYA 2OENG 4Y6LA 3TGKE 1CYDA 3PWCA 3KELA 1JIMA 3VZDA 3MHTA 3K6KA 5EKTA 4JJGA 1TCAA 2BIFA 3MXTA 1V2WT 3V4PB 4GI1A 4J0EA 1FV9A 3HE3A 1GPH1 4OAPA 2JFUA 5DHAA 4LVUA 3B3QA 4I7EA 1CE8A 1KO8A 3KYCB 4YPVA 1XVAA 3OEYA 4WLUA 8GPBA 5I3CA 1G7TA 2ZRBA 3FPBA 1AUQA 4OQEA 2GREA 5JALA 3S2UA 5DGIA 4GNRA 2H31A 2ODAA 3AHHA 3B53X 2HSZA 2UV8A 3WIDA 4DCCA 5GONA 5JCJA 4HHEA 4JX9A 2RC5A 3DR3A 4JEIA 4XD2A 2Q5FA 2ZSEA 4TYWA 3NZEA 3I6YA 2WWYA 2ZT8A 4ZWNA 3AHJA 1MTVA 5D85A 2Z8YA 1EI9A 1YVPA 5AD1A 2ZGXH 4LDJA 3U8TH 4BVHA 1VHTA 2ZP1A 2FO9A 1D4FA 2NU7A 3QE0A 3K0FA 2ZVPX 3EUWA 1VSQA 2PQ2A 2IX9A 3ZY5A 4ZANA 4N7MA 4IS2A 2C42A 2WJ3A 3V7FA 3PX3A 1MQ6A 4JSYA 5KOIA 4EF6A 5JC1A 4RJLA 3DLPX 4Q03A 3N6XA 2OBBA 3OP4A 2I62A 3F71A 3U7QB 4HDOB 5ELLA 3E2MA 1W9XA 1B2LA 2JLVA 1Y6QA 5KU7A 1SUCA 3H8VA 2NUAA 1ACBE 4OXXA 3T38A 5JJ5A 4EUKA 4MUYA 3WZLA 2QV0A 1PJ8A 2H1VA 1SY7A 2DQZA 2WG0A 2FXVA 1E8DA 5G0UA 4J03A 1LDBA 3KV1A 4PONA 2I8AA 1ST2A 2COEA 3A9WA 4F11A 4ACBA 4S1WA 3U3ZA 4DUGD 4A6PA 4F55A 4JLVA 4UUAA 5FNVF 4KN6A 3QBDA 1HFJA 1GAQA 3GU3A 3L1KA 1ADGA 3IUJA 3QEMA 4C6HA 4DARA 1YZKA 2EFEB 2ZYRA 3FZGA 3RPEA 4TM8A 1UCFA 4KSYA 3DWIA 5JBQA 3EODA 4KKXB 5K4HA 4DIUA 3DA9B 4U3JA 3RODA 3P9ZA 4RXUA 4XJVA 2JH9A 2J45A 4QIHA 4CF7A 3LH3A 4O4JF 2ZRCA 2AHRA 1QV9A 1IK4A 5IKOA 3GJXC 4TROA 1QWOA 5HHTA 1UIRA 3A3YA 2VYFA 3BN3A 5KYYB 4OPMA 3HVKA 2ANCA 1AS2A 4DS3A 2JGIA 2AK3A 1GI3A 4CHAB 3UWOA 5E38A 3AILA 1OLOA 5FTWA 3O8LA 3LQKA 1PGQA 1W10U 5AVJA 5L3QA 4NQZA 1RRKA 1PSZA 2AXPA 1YK0A 4NLLA 4ZHMU 3OAAD 4QT8C 4PO9A 2EZ9A 3VO8A 3F5FA 3LDFA 3NWJA 5KTPA 3VJLA 1U2RA 2REQB 2A7QA 4RCZA 2BQWB 1EAXA 3MT9A 4JEHA 3ORRA 1RXPA 1T2FA 9GPBA 4HZUB 3COVA 3ICEA 1AIXH 2R6DA 1FU7A 5F52A 3KN2A 3WC4A 4X9XA 2D7DA 4BVKA 3ZCXA 3M6LA 2ONYA 3QPDA 1LBQA 1SU8A 3R5FA 1QLWA 1Y1KE 2WYIA 3ZNNA 2ZUBA 1UPBA 1C9EA 1JQJC 2ZTMA 3HG7A 5FI1B 3S99A 3JU3A 3IUPA 1AV7A 4MUGA 1NT4A 4P2NA 4BOYA 2OHIA 3DQQA 1TB6H 2JB9A 1Z39A 5BWLA 1PQ7A 3EG5A 4JS0A 1VQKB 3EDXB 3T1QA 3AC0A 4KOAA 4E21A 2P7HA 1ADJA 4PLVA 1M33A 1JVNA 4AJ9A 4HI0E 2W2KA 1G5FA 4OPSA 4AW9A 1GDQA 1U6QA 1JLLA 1TVKA 4DRZA 1VKJA 2XC5A 4Z9BA 2C96A 1LDNA 1F2TA 4YT7H 2ILVA 3I92A 1EHCA 4XE5A 3F0OA 1N2OA 2V0CA 4V38A 2Q5IA 4AP9A 4EHLA 1N5MA 2ZFRH 1LPGB 1AO0A 3GELA 5C46F 4WNCA 4TWWA 3BIVH 3SX0A 2WJIA 1RC0A 2WAYA 2WA1A 2HIGA 4BQQA 4XE4A 4TWIA 3T0FA 4ZEXA 4ZAGA 5KINB 1E9RA 4X3CA 1F5NA 4MPXA 1BWSA 4GX5A 2IEBA 4E5PA 1JDTA 2J9XB 2O8DB 5LQKA 3BXEA 3MILA 4J90A 1N6PA 1TQ6A 1ZJWA 5A6SA 5CPBA 1JZQA 1QE5A 4GNKA 3NHRA 1MFPA 4GI3A 1M90D 4LXHA 4K81B 3LQ6A 4B33A 3JVDA 2OESA 2ODQA 1T43A 3NVAA 4MVJD 1JSZA 5C0TA 1TFXA 4P22A 4F85A 3INTA 1C3LA 1VG0B 3F5SA 5IKEA 2OQ2A 3UR9A 1RM0A 1NM6A 1DT5A 4CR7A 1M54A 3CF4A 1H5NA 4HAVA 1C2YA 2AEJA 1G8JA 2DLNA 1J49A 2I4OA 3A37A 1AU9A 1E6EA 4DLKA 1C5NH 2Y1FA 3WYCA 3V48A 1RKUA 2ZJYA 3SHCH 2XY4A 3FSJX 2R44A 1ENOA 3SDZA 1CIJA 2JGRA 5I7WA 2VRCD 1ADFA 1FYXA 3M4ZA 1I24A 4NIVA 1RSZA 2JH8A 4M49A 1CE8B 4DC9A 4FJ2A 2NZVG 3F8SA 3CW8X 1J2EA 2IE8A 2NG1A 1O2HA 3SF0A 1R37A 2ONZA 4JIMA 4P7GA 2IEGA 4CKBA 4WNAB 2XUAA 3AUXA 1KI9A 4RHEA 2JKYA 4R9NA 1M1YA 1SIWA 1ZHRA 3TI9A 2G0TA 2C20A 1GJAB 4PO1A 2PD3A 4UC0A 5F21A 2FPKA 3Q7RA 1GM5A 1K6XA 4NCBA 3KJFA 1HV7A 2P9QA 5LDGA 4IFEA 4BTVA 5CUQA 5KAMA 1E64A 3FYCA 4Z7OB 2I1LA 2VI5A 4QTTB 2RH9B 3TEFA 1NNEA 3BH4A 3DL0A 1P2KA 2NU7B 3K0FB 1YPJH 3PIRA 2ZR8A 3GLHA 2ZROA 4AXBA 3MT0A 5EZQA 1P9UA 3ESBA 2GK7A 4DR3B 5AUNB 5GZ3A 4BLRA 3P9NA 4OUKX 1FA9A 1TJ4A 3TK6A 2O6HA 3GLGB 3CUUA 1OWDA 3PL1A 2BI4A 3P20A 2YV5A 4QL3A 1FOEB 2QYIA 5CIYA 1NX6A 1TQ4A 1JSRA 5JTTA 2EKQA 3IT2A 1YA8A 3L8GA 3SQDA 3LKZA 3ZXXA 2A3NA 5P21A 4DSAA 4XM0A 4EY7A 1BRTA 2C5LA 4KKSA 4KC0A 4IS5A 1GXSA 2BQ7B 1KZHA 5EL0A 4M55A 2NUAB 4PYMA 1ETTH 4QJ4A 1SK8A 4D7GA 3GJTA 1IXYA 4JR2A 5ILOA 3I9JA 5A3QA 2HMSA 1A1VA 4HQ6A 1N5LA 4C04A 2F1HA 2L2QA 4J3JA 1Y80A 1LFDB 2P4HX 3ONWA 2DT8A 3FWZA 1C4Y2 3T41A 1ACJA 1AC5A 3ROZA 2WMYA 5PTPA 4MPTA 1D4OA 2AHOA 3FZYA 1C1XA 2PYIA 4HGOA 2D1TA 4NY1A 2A94A 4UNPA 4EG5A 3VZRA 3BXHA 1ZPBA 4Z3OA 3UAVA 2E82A 3O4VA 4AK9A 4ISOA 2X15A 1W0CA 3B5IA 4GZ3A 1NZDA 1ORWA 4KW7A 1SCUA 3G59A 2A33A 4U3JB 1PJ2A 1WQ4A 1X7ZB 1O95D 5EKSA 4RY2A 1QGYA 1KH3A 3G7SA 3HNRA 2CLFB 3P92A 3QBEA 1YH3A 3DE6X 4LQDA 3A10A 3EVBA 5SV2A 1JS1X 4JGIA 5L2YH 1EDDA 1WUHS 3JS5A 3IAM1 2ZVDA 4B2CA 3Q7QA 1A27A 4UFOA 3FAZA 1Z5GA 3VC1A 2P4EA 1VL2A 3NHKA 3FNFA 4LHZA 3I2JA 3O4JA 2XRZA 1O38A 4NABA 4DBLC 1M1KD 4MUNA 3ZNPA 3HI4A 1XTSA 3NRJA 3LHIA 4Z9FA 5BXQC 2W0MA 4BB9A 3MLBA 2ZP0H 4CEIB 1U04A 4ZI7F 5LPFA 5IWCA 2VVCA 4HK4A 1U9CA 4BUCA 4E5NA 3MTGA 1QSGA 2R0QC 4K2HA 4F3RA 5EI5A 1VCIA 2XE8A 2FMUA 5HILA 2B5TB 2BKXA 2WV5A 3PU6A 2ICAA 4CKWB 2BHRA 1DZIA 3CS7A 4DLZA 5EUQB 4P0QB 2GJPA 4B4WA 4PLPA 3BCRA 2WJYA 3V80A 1YJ9B 1U3VA 1YU9A 2J9YB 1PFWA 3EGXB 4C6TB 5B6JA 3TQHA 1VITH 1UK9A 1QGUB 2ZWVA 3BIJA 4WA7A 3R8FA 2RFKC 4LS3A 3I2FA 2UYYA 5DI3A 3OM9A 2EJBA 2W2KB 2ZT6A 4F2HA 2YMLA 2G7ZA 4GGMX 1ZESA 2YHSA 4AY5A 3BJEA 1U0RA 2HJHA 3CUWA 3KB6A 1R1DA 1S2OA 2GFIA 1HAIH 3EGWA 3VA7A 1F2TB 1BA2A 1U0JA 4GVXA 2QM7A 2ZBUA 1P5FA 4L22A 3M36A 2DY1A 1AY6H 1IHPA 4YT5A 3AL2A 1HDXA 1GZVA 2KPOA 3K20A 1NPYA 1YTLA 1L7RA 3EZ6A 2HKIA 3H7IA 4WMFA 5AM0A 4UU7A 4IDCA 2ZKIA 1WB6A 4B79A 1QQAA 1DSUA 4HN9A 1NSYA 1NXXA 1DKUA 4Z51A 2NO1A 1DU4A 1M2GA 4ARIA 3RU7A 3DV9A 3P26A 3L5OA 2FR8A 3I6IA 5CM9C 3CEJA 4RQBA 1C0KA 5DK6A 4JA0A 4KREA 1J21A 1CZRA 1WVIA 3GOVB 4KDFA 4RL6A 9ABPA 1JNYA 3KOUA 1BOFA 1GWAA 3ZZBA 3BGDA 4EA6A 4J1QA 2O05A 5FBWB 2F8TA 1BW9B 2P9HA 4QVIA 1TWXB 5HKLA 1NI5A 2BJHA 3NYIA 3PFCA 1KR2A 2REOA 2OAQ1 1JPNA 2FWAA 3K1AA 2AQHA 2X22A 1EAWA 1F20A 4WFQA 3KDAA 1ORHA 3ZXIA 1EUCA 1C2GA 3HDHA 4X0EA 5E7JA 4DV5B 5EW2H 4LW8A 4KXNA 4HLCA 2QL6A 2Q6VA 2A58A 4MUJA 3LH1A 4BNJA 4MH0R 2UZAA 3EGOA 4H17A 1UW7A 1C5SA 4FSHA 4C4PA 3TK9A 3COWA 1BN6A 1HZZA