4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords MJ0495-LIKE PROTEIN
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
2ZTSA 2ZI7A 4NDZA 2VEDA 3FMIA 4LJ8A 1T6NA 3ADDA 3Q3JB 3CZPA 5FOUA 1GL6A 2XNDD 1RZ3A 2BVNA 4CT4B 2R6CA 2BMJA 3K0CC 1K5GA 2QRZA 2ZUDA 1D5CA 2CE7A 4PO9A 4V0NA 3U3JA 2PX3A 4NPHA 1PVOA 2HMAA 3A1WA 2BPOA 2W00A 4WA7A 4HB4A 3CCMB 1E94E 4US0R 1WP9A 2O8EB 4RFVA 3UANA 2WKPA 3CNNA 4UXIA 1UFQA 1NBMD 5J40A 2BCGY 1AKYA 2GA8A 1W4RA 1OIVA 2NMVA 4CIDA 2D74A 1Z6GA 3QKSB 4JLKA 5H8WA 5BYJA 3CPJB 3WYAA 3QFSA 4MUBA 5TXGA 2YWGA 1JJ2B 3AP2A 2JLYA 2HDNB 2ZSFA 1Q1BA 4KODA 4DSNA 3MUFA 4M1TA 2FPMA 3CMEB 3QQ5A 1I2MA 4TWZA 4IHQA 2AXNA 3UPUA 1DAKA 3HR8A 3QG5A 1JA0A 1BMFD 2I1QA 3G5UA 3U44B 4TMTA 4FK8A 2GVZC 1ZD9A 2VLIA 3U44A 4OQFA 4PZLA 1F3OA 2NO6A 1D6JA 2F9LA 4EFMA 2WHXA 1XWIA 2QPAA 2VTKA 3GFPA 4KLNA 5BN4A 4LWZA 4EJSA 3B13B 2ZRNA 3M0EA 1FP6A 4PPFA 4B73A 1Q81D 3EZ7A 4A2WA 1VPLA 2O8FB 2H5EA 1ZNYA 5EZ6B 4EJSC 4I1OA 1FX0B 2W2VA 2B7BA 2QBYB 1Z0IA 4WQMA 2QBYA 1IY1A 3KX2A 3FFBA 2IYYA 3C5CA 4TT3D 2CL0X 1ZM9A 2SHKA 4ACBA 2IK8A 2IWRA 1QVGB 1N6PA 4UKDA 1W47A 1AN0A 1E2KA 1NIPA 5EP1A 8OHMA 1Q3HA 5KU1A 5HR5A 5J5CA 3BD9A 2KWIA 2QTLA 5GJCA 2RMKA 4G01B 2VQSA 4HAZA 4JLJA 2P5TB 2GEUA 4M9SA 4B33A 2O8BB 3VR3A 2WSMA 2ZRBA 1CBUA 3DHWC 4EPRA 5TMPA 4RFSB 1P72A 2XJ9A 2YOHA 1OH6A 3L0OA 4TTRA 1E79D 4HSEA 1A7JA 5FUYA 2ZE8A 3LLUA 1E9AA 1G20E 2HUPA 2ZRCA 2R65A 4QGGA 2W0MA 5FOXA 1E2HA 2RH5A 2NTYC 2ZE5A 1SQ5A 3MD0A 1OFTA 4F4CA 3TUZC 4CEHB 1G5TA 2A3RA 3ZIAA 4QHTA 4DLWA 2XB2A 4XTRA 3B60A 2YWEA 4HDOB 5HCNA 1XD9A 2XNJA 1W5SA 2Z4SA 3B1ZA 2P6UA 1TVCA 2AXPA 3VR6A 4EQ6A 1L8QA 2GPJA 1IN6A 4PC3A 2H8KA 3KKPA 3P32A 3OJWA 5EE0A 4KI0A 5FI1B 2IUUA 3CF6R 4POAA 4G1VA 4HUQA 2VRWA 1KK3A 3BS4A 5E4FA 1UBCA 3REFA 2XXAB 4GDFA 2QAGB 2O0HA 3NDBB 1VG8A 3CCVB 4M53A 4O2LA 2GCOB 2Q6TA 4US1R 1F2TB 2P6NA 4GZMA 1R0XA 1Q12A 2ZIAA 1P3JA 5K8UA 5HKKA 1C9KA 4GOXA 2GKSA 1U0LA 1EP1B 2HJVA 2REXB 1W35A 1QHYA 2R8RA 3QVUA 3VFDA 4NCHA 1U9IC 1GO2A 4C0LA 3OEEA 1YZGA 3OEHA 1NDHA 1ZMXA 3CH5A 4GMXA 3FPKA 1XE1A 3AQ4A 2F7SA 5FOTA 1N5KA 3L82B 4GSYA 3EPKA 1CR1A 1GAWA 1NVXQ 2UKDA 1XJCA 3T12A 3W2HA 4UQOA 3KUDA 5FR1A 4HI0E 3THXB 5CM9C 2YC4C 1OXXK 1KDPA 1LB1B 3E1SA 3T5GA 3WRXC 4PR0A 4F93B 3HJNA 2E1RA 4H1VA 1JPNA 1JNYA 2ZR9A 2BMFA 4QGHA 3W5VA 3GFOA 3T1OA 1OFUX 4DLXA 5B30A 2ZYTX 2Z5FA 2BBOA 2J7KA 1Z0AA 1D1NA 2HT6A 1OFHA 2WJJA 4EFNA 1IXSB 5KSYA 1QG0A 4YAWA 2V4ZA 1QG4A 3OEHD 1XXHE 3ZQJA 3B82A 2CEAA 2ZROA 3ASYA 1MO6A 3LW7A 5CK5A 5AUNB 1CNEA 3W90A 5IF9A 4TLBA 1Y63A 2DBYA 1VKJA 1Q1QA 2BV3A 1VQ5B 2YKGA 1OE0A 5EE1A 4BLSA 3ND9A 2Q0HA 3V00A 2HV8A 1B0UA 1IN7A 1KMHA 3RVBA 1DE0A 3U7FB 1E4VA 2GCNA 2O52A 3SNHA 4LGMA 3AVYA 2VSOA 4BFSA 1DDGA 1Z5ZA 2FEOA 3QBTA 4L8GA 1OKKD 2QORA 2UZIR 2ATXA 2FSFA 2ERYA 3C8UA 1OXSC 4HDQB 1HH4A 4HZUB 4ZDIA 4ZDKA 1XCMA 4BRUA 1VMAA 4JBWA 4XD7A 4JKYA 2ODNA 2F3RA 2OSBA 4TQUS 4Q00A 1K8RA 1AZSC 3QXCA 4A6PA 1RYHA 4FW9A 2CNDA 4UNRA 2D3WA 1ANKA 5L3SA 3F3YA 4TN1A 3DOFA 2ZETA 4NE2A 4BZXA 4KBFA 4A0FA 4QKQA 1QGYA 3L43A 1M74A 2O8FA 1H8HD 2JLWA 4L16A 1TUEA 2ONJA 3JVUA 3AB3A 4LJYA 1NI3A 4TMKA 3EZFA 4CEIA 4Q18A 3AH8A 4GBMA 3CX6A 4GT1A 2YV5A 2OCYC 1JXOA 1XF9A 1XZPA 1HURA 2FE4A 4URUR 2AWNA 4JVSB 3FOZA 1TQ2A 4LX0A 2H57A 1E63A 1W5TA 1FUUA 2OFXA 1MO4A 4DQKA 3OF5A 1X1RA 4JBXA 4PPGA 3U7HB 5GJBA 2QAGC 3EC1A 4DQLA 4TYQA 4XD7D 1W2GA 3CX7A 3TSOA 1YJ9B 1E2QA 1VG1A 2ZI6A 3LLMA 1KNXA 4MGIR 2IYVA 1OXUA 3IKJA 3PFIA 4M21A 3W34A 1R5NA 4A0GA 2AR7A 2XGJA 4ZCIA 1RFLA 2JATA 4AYWA 5CYOA 3LX8A 3RRMA 4I4LA 5KHOC 3GCGA 5KSOA 4JL6A 1S0UA 1B2RA 4WZAE 1G1MA 4C2TA 1SXJC 4PX9A 1KRHA 5JBQA 1HE1C 4F4IA 4URXR 2ZANA 2GNOA 2A5FA 4Q4AB 4ZO4A 4D81A 4EKDA 1G3RA 1ZNZA 4FMDB 4UAJA 1RVDA 621PA 4Q02A 3LVRE 1JXMA 4RZ3A 4CEJA 2R9VA 1R4AA 3AV0B 1EFTA 3I3SR 5E7JA 4G5GA 2Q9BA 3EZ2A 4AG5A 4TTPA 1YIJB 1IN4A 4M1OA 3U4QA 3CMAB 3EPHA 4PO1A 5A0FA 1RRCA 5F3WB 1W2BB 3U4QB 4PGOA 4TYYA 1DS6A 2ERXA 1KI7A 1SVSA 1NJFA 1YZQA 1N6OA 1KGDA 2CNWD 4RD6A 4DDUA 1KO8A 1QF9A 2MSCB 4NMMA 1CQXA 1OF1A 3CIOA 3KJIA 3MLEA 1BIFA 4BLOA 4TYWA 2FDCA 4Q66C 1OXTA 4C0HA 1KK2A 4V0OA 2FSIA 1M7HA 2BF4A 4OJKA 1G21E 4Q4LA 4TMVA 4W5JA 1ZD8A 2WJVA 2DWOA 3AVPA 5CLQA 3T35A 3OW2B 1U98A 2GJSA 2IL1A 1R10A 1WMSA 2QPTA 2QP4A 4GRAA 3PJRA 2OM2A 2OBLA 1X6VA 3QY0A 4NHOA 1FPMA 3CCJB 2ZJBA 1M8PA 1SXJB 4CF7A 4YAUA 2N46A 4JSTA 4CZ2A 4OK6A 2QE7A 1ZM7A 1K73D 3GFTA 3VO1A 1VCMA 4II7A 3T1TA 1DAGA 4LDJA 5J4LA 1QGAA 1QGZA 1FQKA 1XJ0A 2FFHA 2GAOA 2PX0A 5DYIA 2IA5A 3R8CA 5FPYA 2OTLB 2R44A 4UXJA 3UIEA 1NJID 1U81A 3GLFE 4FMCB 2OLKA 2DWQA 3QXHA 1F2UA 3H2YA 2QGNA 2BEKA 2XSZD 4JL8A 4M1MA 5P21A 3GQBA 3TW4A 1F2UB 4MGYR 4B32A 5HZHA 3AP1A 1G41A 1W0JA 3VX4A 3QF4B 4LJ4A 4F38A 4DDTA 2AD5A 3I92A 1N5JA 2J59A 1E96A 3LY5A 3GJ5A 1JR3E 2LCFA 3PEYA 3Q7PA 4TTQA 3MG9A 3TH5A 3ZH9B 4PHHA 1DTSA 2XOKA 4LYHA 5L3QA 4HB0A 1ELOA 1H42A 5C4MA 4Y7CA 2W2XA 2EFDB 5FTKA 4KVGA 2CRVA 4M4SA 1XMIA 1IXZA 1KJYA 2P67A 2QL6A 1YJNB 5JS8A 2ANCA 4RCYA 3GJ7A 3NH9A 1QBKC 2ZYWX 4QBGB 5KSZA 2ZRPA 2GXQA 2ZSDA 5K8LA 2WOJA 2OFWA 4P4UA 2FGKA 2IS6A 221PA 4OBEA 3F0TA 3GLHE 3TR0A 3ZD7A 2ZI9A 3KUCA 1EP3B 3QFRA 1VYVA 4LJ9A 3AKYA 4UNQA 2GXSA 4GL2A 3HPRA 4ZI3A 1SQRA 1KAGA 2QTVB 3RSLA 3K09A 3JQRA 1IQPA 2WM9B 3N70A 4CW7A 3RS4A 4HATA 4AG6A 4FIDA 4LBVA 1K5DA 3KFVA 4KBGA 2GJAA 1D2NA 2IYWA 3VHLB 1P6XA 3H4MA 4EPXA 5BN5A 4MDEA 2XJ4A 1G17A 3IEVA 1K8AD 4YAOA 2FG5A 3D31A 4C7OA 2DFTA 3MRSA 2GTPA 3HYRA 4YONB 4OHYA 3QPVA 4DB4A 1DVRA 1Q57A 1LVGA 4MGKR 3B1YA 2H7VA 4A15A 3KTAA 4QOSA 3WNBA 3PUWA 2NO7A 2J0QA 2V55B 2A2ZA 3WNDA 3QKRB 1GG2A 4KFRA 3PR1A 4AK9A 2H1LA 2ZYUX 4LOAA 1S2MA 3TE6A 2O8DB 4R9UC 2IS1A 3SJBA 4MITA 3OIYA 2GESA 5EJEA 4D2IA 4JLBA 2ZJOA 3CLVA 3EIQA 1XEWX 1QRAA 4IDHA 2ZRAA 5FR2A 3BRWD 4PC1A 1XBTA 4ZGNB 2XNDA 4XSGA 3WHLA 1D2MA 5H68A 1TLLA 4EAQA 1TAGA 1G4UR 4KLZA 5LD2B 2G1JA 4AD8A 4AKGA 2BKUA 3I4LA 1T4GA 4DRZA 1II0A 4TLDA 1W46A 5JHHB 5DNYB 2ZRGA 4JLAA 1ZVQA 2G6BA 4US2R 5LBIA 2ZXUA 4KSCA 1YVDA 4PZYA 4LHVA 4A2QA 4CEHA 4DIDA 3PUZA 1G5RA 2I3BA 3VX3A 3W6NA 1G8GA 3EX7C 1MABB 3QUSA 2GXUA 2V1UA 3PG5A 3QOFA 3T61A 4WZBE 2QM8A 4RKFA 2RGNA 3HYTA 3RS3A 3UATA 3THYB 5TV2A 1AS0A 3THOA 2HT1A 3K1JA 1JQJC 4BUJA 3GP8A 5FTJA 2ZE7A 1UEJA 3NDPA 1DG3A 1UBEA 1AA9A 3UG7A 2J5XA 3BFKA 1G7SA 3CZQA 4HAVA 4HUQB 4MYHA 4YDHB 1HA3A 2W0SA 3T5DA 3I62A 1AM4D 6Q21A 1S8FA 4DUGD 4Q47A 4RJLA 1Z07A 3FPAA 4CRWB 4LRWA 1NBME 1KMHB 3BGWA 3IO5A 5E95A 1D9XA 3DEFA 4HLQB 4F7WA 4C30A 4QJ4A 2YZ2A 2D62A 3CR8A 1GAQA 2ZUCA 4NKRA 5CDFE 1XDBA 1XPUA 3KQLA 1OB5A 2F43B 2VP0A 2C77A 3AF2A 4QRHA 4TQAA 521PA 1N6IA 3C14C 3E2IA 5CYPA 2VF8A 4ZKEA 2C03A 3LRPA 1E9EA 2DHRA 2G83A 2QMEA 3Q85A 1DG1G 1XTQA 2IBMA 1E98A 2DR3A 4A0HA 4DKXA 3W5IA 3GJXC 2G0NA 2RAPA 4NU0A 4BRWA 1U0HC 3JQQA 2FZLA 2RGEA 2QTFA 5JEEA 1N3BA 3ZVNA 5DHFA 3IBYA 2I4IA 1ZP6A 3LH5A 3UMRA 4C3ZA 5AJYA 2GJKA 2BJVA 3QXXA 2MSEB 2Q3HA 5HPYB 1OV4A 2F1IA 3WBJA 2IF2A 2JGNA 3THXA 3C4JA 4RD1A 1P5ZB 3U2QA 1MRSA 1NN5A 4N1AA 3AKEA 3AM1A 1G3QA 1E9FA 1GVNB 3CPEA 4LHYA 2WWXA 4BFYA 5IHPA 1MR3F 1AS3A 1KI2A 1S9DA 1X8LA 4JBYA 1A5TA 4YMSA 3EW9A 3GEIA 3R7WA 4A36A 2NO1A 3OFNA 4TLEA 2ZVQX 4PQFA 1BOFA 1SVLA 3TGPA 5E7MA 4AF7A 3VQTA 4KFUA 5JLJA 1AQUA 2PEYA 5K8IA 4H9GA 1P2TA 4IVRA 4DSTA 3BK7A 4TYPA 3GLFB 4UNSA 4DCVA 4PPNA 5BQ5A 3U3OA 5FPSA 1NLFA 4Y0AA 5L3QB 4B34A 3P27A 3QE2A 1XXHB 1YR8A 4QM7A 1H85A 4KU4A 2KSQA 1SULA 1WB9A 3SE0A 1NMZA 4RZUA 2WWIA 3SQWA 4Z8XA 4RFSA 5FI0B 4NYMR 4I1SA 4AWXA 3WMGA 5AR1A 3RRYA 2DY1A 5AUOB 1XEWY 3U7GA 2ECKA 3S1AB 2J0SA 5FBLB 4IXNA 2ZRFA 1TUIA 1Z22A 2VHJA 4P32A 4MUAA 1FL9A 4MRRA 1YRBA 2VIIA 3BH7A 2ZJ5A 2QA4B 1RJ9B 3TQCA 1AJEA 5GV7A 1CR4A 2BM1A 3E1YE 2ZRDA 1L7VC 3GLIA 1ZM3A 2CHGA 4JLOA 3VO2A 1KI3A 2PLRA 1CEEA 2ZSAA 3ZC3A 3UMSA 4O2RA 5EMNA 3VKWA 1Z2AA 1GOTA 2FSHA 4MRVA 821PA 1COWA 4QNMA 3RDPA 3NIBA 4A9AA 3K0SA 3MWJA 3NBZC 4U9UA 2BSAA 1QHHA 4IDNA 3WP0A 1XEFA 2JLZA 4PSKA 3BAFA 4KFTA 4NL4H 5AUQA 4DEYA 3U6BA 3DL0A 4AF6A 2BDTA 3VAAA 3L8ZA 3T06B 3H84A 2AL7A 2NPIA 1JR3A 2FNAA 4PANA 5EZ5A 3AUXA 3CF2A 2AHOA 1Z28A 5TVKA 3ZLJA 1KYIA 3LA6A 4LYFA 1JB1A 3NBFA 4AIIA 3ZS8A 1YHQB 1T0JB 4PPQA 2JDIA 1M7GA 2WPDD 4DLVA 3FHTA 4Q9KA 2YOFA 3FVQA 3SS8A 2IYUA 2OXCA 3FWYA 3OIVA 2VNIA 1U8AA 2QQEA 3DPUA 2GEDA 1JA1A 1R0YA 1VCOA 2E9SA 3BB3A 4UJ5A 3WP1B 3KQKA 3I61A 2F9MA 2IS4A 1KDTA 1Z06A 1Q3TA 1E4YA 1SXJA 2CL7X 1DOAA 3B8HA 4RD0A 3TSWA 4DSOA 4LBWA 1RJ9A 4EH1A 2PBRA 3T15A 2IYRA 2HXSA 1LS1A 3W2IA 1SVOA 1FFHA 1OGJA 1JAIA 1W44A 4BGDA 1VQPB 1ZCBA 5IT5A 3EZ6A 3C15C 3WBKA 3AVOA 3DZ8A 1QHXA 4R2IA 1COWD 1KDOA 1VQLB 4D0NA 1IOZA 2WSSA 1UKZA 3B2EA 3KXIA 3B1XA 2O0JA 2CCGA 4K81B 4OQLA 2EYQA 2JLUA 1II9A 2H16A 5EXSA 5DO9A 4XWKA 4D80A 2FH5B 1ESMA 1RC8A 3A8TA 5JHGB 1ZW6A 4Q4JA 1WBDA 4D25A 3LD9A 5B58C 4OQMA 1DARA 2EVWX 1FUKA 3KZ1E 4LI0A 2PZFA 1AIPA 3LVQE 4DDVA 1KJWA 3D6TB 3NBXX 2BMEA 1MT0A 1Q1EA 4HEJA 4JMPA 1WF3A 3W8RA 3AGPA 2OEPA 1Q1ZA 2YNMA 2J87A 4DCUA 1V43A 4M9ZA 3DDCA 4Q9IA 1KJZA 2ZS9A 4B2PA 5BXQC 3V76A 3QPWA 3HU2A 5FL7A 3H1TA 1EFUA 5JS7A 1CTQA 4RD2A 4HZUA 2QP9X 4A1FA 1YKSA 1FMLA 1Q82D 4D6PA 2WMOB 5IDVA 3AVVA 1M1YE 4OI2A 2FN4A 1OSNA 2QUZA 1CJUC 3SBDA 1JB9A 2BBSA 2OK7A 2VHUA 4EUNA 3CC7B 3CCRB 1XTKA 1P61B 1FTSA 4PHGA 2ZS7A 2ZRHA 4QC2A 2DB3A 2CLCX 3M1IA 3QBVA 2ASEA 1G16A 3BORA 1ZUIA 1QHGA 1WXQA 3K53A 3LXXA 1OHHA 1FP7A 1A82A 4DSUA 5HE8A 1I4TD 3LNCA 2LKDA 1Z0JA 3FKSA 1NLYA 1Z6YA 1OH8A 4C0QC 1E9RA 4HLDA 4Q1CA 3ZZUA 3X1DA 4TQ9A 3IUYA 2JEOA 2ZPTX 2OTJB 4FCVA 4OK5A 3Q72A 4LYJA 2GJ8A 3CRVA 2YWFA 1AKEA 1FTNA 1QVAA 1T8TA 1JBKA 1I2DA 4Q4JB 3CNLA 2GBLC 5JJKA 1XXHA 4OI1A 2V7QD 3B1VA 4AYTA 3IPYA 5JWHA 4F4JA 1GNPA 4PTLA 1VDZA 4LV6A 1Z08A 3CC2B 3GJ3A 4ACAA 2PMDA 2HLDD 4QL3A 3WMFA 4KSBA 3ZZ0A 4WW0A 1E2DA 2CXXA 1KKLA 4O3MA 1RE0A 5UKDA 1XFAA 4NCIA 4KFSA 3GLIB 1BMFA 2EFEB 4M9QA 4ZI2A 3RS2A 4NCJA 2BKEA 3RC8A 3AEZA 1E6CA 2WPDA 3A4MA 4ARZB 4P3YA 1NF3A 2EFHB 4MQBA 3REGA 2PT5A 2Q9AA 5GV8A 3JZAA 1CJTC 4KO8A 4AYXA 1XRJA 4NH0A 2NPFA 2QI9C 5C2JB 4HB3A 5FFMA 1AS2A 4D26A 3VKGA 1KTVA 1E0AA 3KQHA 4OQXA 2DPXA 4QFMA 3RC3A 1Z0KA 1XMSA 1OYWA 1VHLA 4YLGA 1DAIA 4TZ6A 1TNDA 1W2HA 2WAXA 4Q7KA 3P4XA 1OB2A 2RHMA 4DEXA 3O8DA 4Y9UA 1ODFA 2CLSA 4RY2A 5JECA 2Q3MA 1M6NA 2GILA 2WWGA 1EWQA 4DT1A 4GFDA 4IDQA 3HR7A 3K0EA 3R9IA 4E07A 2FFQA 3A1VA 4C0BA 1TPZA 1F20A 4B3XA 2RGXA 3PENA 4URWR 5G53C 4DLYA 2NZ8A 1HEIA 3BC1A 3EWSA 2AKYA 3A1TA 4BWYA 2GJ9A 3QJYA 1CRPA 2N1BA 2R6AA 3IHWA 3ZDQA 1U2RA 1A4RA 4DJTA 4I1VA 3PEVA 2XSZA 1BJKA 1ZCAA 4QJ5A 3EIHA 2B6HA 5BN3A 2IYTA 5GADl 5JEDA 1S4QA 4X8MA 4R7ZA 5BYKA 1KZGB 2QQ0A 5JJIA 1RRFA 4JVLA 1M90D 1V5WA 5CIWA 4RZXA 3LV8A 3UK6A 4XJXA 1ZBDA 2G77B 2BGIA 2TMKA 2RHDA 3SDZA 4MYTA 3SR0A 1GP2A 3CRZA 5GVRA 2QP3A 3I72A 2DYKA 4LJ5A 5KOYA 3DMDA 3X2SA 4HAXA 3CKLA 4BPBA 1QUEA 3FHCB 5TB5A 3LO5A 3WY9A 4WXPA 1R0WA 4FMCF 1A2BA 2UVQA 1VG0B 2CHQA 4YMVA 1Q0UA 1Q21A 1FMJA 4HDCA 1CR2A 2QPOA 1W34A 1ONBA 1TEXA 1ZIOA 2B8WA 3FTQA 1G9XA 3R8FA 1X8KA 3E5HA 2J7PD 1E1QA 1ZM4A 1SVMA 3CH4B 3GEEA 5G40A 2B5OA 4G5OA 3MSXA 3MWLA 1JAHA 1P62B 1US8B 1Z0FA 3QFCA 5AUPB 1Z63A 3KB2A 3KJGA 1E0JA 1GSIA 3IBGA 4TL8A 1R6BX 3AF1A 2C98A 1NJGA 2OK8A 5SZKB 4JJZA 1J8MF 1P73A 1RRGA 2KBEA 1KI9A 1GTVA 5J4VA 4JLMA 1W4AA 1E9BA 1UPTA 2V8OA 3MWYW 4AI6A 4P0TA 1FDRA 2PH1A 4GOJA 3K70B 2CDNA 3AP3A 2XX3A 3ZVRA 4IOKA 2C04A 1XTSA 4WBSA 4LV8B 4ARZA 2GZDA 2PIAA 3ONWA 5JJLA 2JDID 2NO0A 3KQUA 1R8SA 4DCSA 1XD2B 2ATVA 5B57C 2L0XA 2VBCA 1W7AA 1OKKA 1E79A 1JPJA 3I73A 1U90A 1E2FA 1E9CA 2ZVPX 4FCWA 2CK3D 1KI6A 1GJRA 4RKEA 1F2TA 5FA6A 1HQYE 2OT3B 3RNLA 3U60B 3CC4B 4ASUA 1FNNA 2EW1A 2ZJ8A 4JVNA 1KSGA 3U61B 1PLJA 1SM4A 3IEUA 5TDHA 3DKVA 3ZJYA 3EPLA 1QHSA 4M22A 1EGAA 3GJ0A 1DADA 2C5LA 2ZUBA 1XU4A 3K0AB 3GLGB 4ZPXA 1ZU5A 4AKEA 4KV9A 5K8TA 2GWHA 4C43A 2FFBA 2ORWA 1ZNXA 5FTNA 1ZD1A 3A4LA 2PCJA 1E1RD 4LV5B 3K9HA 4Q7MB 1SHKA 2ONKA 2QROA 4IKEA 2D2FA 2ZAOA 3EZ9A 1XTJA 4UJ3A 1SXJE 2ZRMA 1EG7A 4A82A 1PLLA 4YXWA 3VR1A 1YITB 1JECA 1EXMA 2RKOA 3NBYC 1MRNA 2FV8A 2MMGA 2LKCA 5DISB 5H5JA 1MABA 3R20A 4JSYA 1OH7A 2Q9CA 2CJWB 4FI3C 4P6VF 2YVUA 4OHZA 2B7CA 3WNCA 4W9MC 1LF0A 2UZ3A 2RB4A 4IDOA 4TLCA 1G19A 1NKSA 1CP2A 3VR4A 4D82A 4I81A 3RYTC 3TAHA 3ADCA 1BO6A 4KYUA 3ASZA 1E2MA 5KNBA 3ND8A 2ZM5A 2FSGA 3CPHA 2WKRA 2XAUA 1VCIA 5DI9A 3CUEF 3MJHA 3FKSD 3SN6A 4TSFD 3UKDA 2QGZA 4B75A 3Q9LA 5CLLA 2HF9A 2QNRA 2FMXA 3LQQA 3KQNA 4IXMA 4B3CA 4M2LA 4MGZR 5KDLA 4R2HA 4XVUA 4JLPA 2ZJ2A 1UBGA 5FOVA 5LB4A 2ZI4A 3GJ4A 2A5GA 4K8OA 4BEBA 2GXAA 2IUSA 1UBFA 4B3GA 4EIWA 1US8A 5F9FA 1S3SA 4JT4A 2OCBA 3OZXA 4BZQA 5KSWB 1G3IA 4QG7A 4QGFA 5DN6D 1KO7A 3GLIE 4NTZA 4Q01A 1SVIA 4IRUB 4PAQA 1QVRA 3RRZA 2Y8EA 3GLHA 1TTTA 1KAOA 3CPWB 4ERNA 4MKFA 4MYUA 1N8RD 3GLHB 3SYNA 4URYR 2D7DA 4Z54A 4E09A 3RANA 2K5UA 3OHMA 4IEIA 3B5JA 1K9MD 5JCPA 2D4HA 2B92A 3A36A 4LPSA 1ZRHA 4W7SA 1QHHB 4QBFA 1Z6AA 2PZEA 5LPNA 2CBZA 2YC2C 4JL5A 3IPXA 3AVTA 3ZS9A 4TMZA 2JA1A 2QEQA 4JJKA 4D4LA 3D7MA 1EESA 1E2LA 1OFIA 2J3EA 3DMNA 5J4YA 1WQ1R 1Z29A 3VNUA 4PHTA 2A30A 1HY3A 1UDXA 3KKNA 2XEXA 1EK0A 3B9PA 1MKYA 1TQ4A 3Q7QA 2OE2A 4DLZA 1LFDB 3G6EB 3AVWA 1VYUA 5FUXA 4CT5A 3ZVMA 4G3XA 1G7TA 3D8BA 5CM8B 1J70A 3QENA 5HXBA 1NN1A 2IYZA 4ZKDA 5THXA 2J0VA 4FN5A 5DHAA 4AURA 3UG6A 3B85A 1QHNA 1YI2B 4HAUA 4P31A 2EFCB 1KK1A 1OJLA 3TLXA 4J0QA 1UKVY 1U0JA 1U9IA 4Z51A 4C0SA 4S2EA 3WRYC 4D0LB 4B74A 1WRBA 4DWJA 3BB4A 3IGFA 3L0SA 2WJYA 1F5NA 2V9PA 4Y0VA 4G5RA 2X19A 2ZU0C 2FGJA 4ZCLA 3D3QA 3DO6A 1KMQA 3B1WA 1SXJD 2AK3A 3QXJA 4OKSA 3AKDA 3EG5A 4XVQA 4DCTA 4EQ6B 1R0ZA 1DEKA 2IW3A 4MKGA 5DE3A 1P75A 1CIPA 1N5IA 2XB4A 1OW3B 3PEUA 4NYIR 1GKYA 3E20A 5KPJA 4MH0R 121PA 1YZKA 4QHYA 3DKPA 3VKHA 3SFZA 3AGQA 4GPTA 1FQJA 2Q21A 3LBHA 4XTCS 4TMWA 1XD2A 2VHQA 2ZEJA 1E69A 1E9SA 2OO7A 2XZOA 2VA8A 4JLDA 1W4BA 3IQXA 2CVHA 3X1ZA 5H59A 3I56B 1YE8A 1SKYB 1HT2E 2ZI3A 1MV5A 2F1JA 1SVWA 2QY9A 4RSGA 4ON9A 421PA 5JFGA 2ZJAA 1QUFA 3ZQ6A 1JALA 3W2FA 2DETA 3TR5A 4ZDJA 1KI4A 5JRZA 1XNJA 4PC7A 4HZIA 3ZVLA 4P4TA 4YMWA 3LFUA 2CHVA 5G3YA 2V6IA 1I4LD 2EIXA 3K9GA 4NONA 3SHFA 4YMTA 2FF7A 2VP2A 1VQ8B 4ABYA 1P2SA 1T0HB 1Z83A 5FBRB 1S72B 2BHRA 1CLUA 1P2VA 2F55A 3IO3A 3OEED 1XB2A 1J90A 4MKIA 1ZUNB 1SHZA 1FOEB 2WWFA 3UMFA 4Z1MD 1QHIA 4R98A 1XEXA 4KITB 5FPHA 2IXEA 1UF9A 2PJZA 2JJ2D 4LUCA 2JLVA 1T3HA 4O25A 4DVGA 1FRNA 1Q44A 1P60A 3CF0A 1JJ7A 2BBTA 2QSZA 2Q3FA 2ZJZA 2REBA 2YHSA 3BWDD 4JLNA 4W5HA 5FH9A 1P9WA 2VNHA 3KKQA 2D06A 1G7CA 3CB4A 1CRQA 1NLZA 2HCBA 2X8AA 3Q8XB 4DHEA 2AX4A 3TK1A 1F48A 2CVFA 4KCGA 1UDWA 5DIFA 1MO3A 3QXSA 2EWVA 1ZAKA 3IILA 4W5WA 2JAQA 2D2EA 3L0PA 3SBEA 2PJRA 1WE2A 3OFND 4DXAA 4Q48A 1L4YA 1Z47A 5EP3A 5IK2D 4GZLA 1WDTA 2ZS8A 4L9SA 4BASA 1KNQA 3RS5A 2GAAA 4TL9A 4B6EA 3NEJA 2BMWA 5CB6A 2V1XA 3NEYA 3RWMB 3BERA 4JYBA 4QBHA 4B71A 4OQNA 4A8JA 1LS6A 2VNKA 2CMKA 1JEEA 4S35A 4GOKA 4BLRA 5IRCD 4KJZA 3CWQA 3QVVA 2DCUA 1ZYUA 2OZEA 1KSFX 2VP5A 1IM2A 2OUKA 3K0CA 1ZU4A 2OG2A 4K1XA 1RRPA 4G1BA 1VTKA 4LYAA 1W87A 2A5JA 4B4DA 5HE9A 5TY0A 2J45A 2JJ8A 4FWTA 1T3LA 4MKHA 3O8CA 1FRQA 2QEXB 2N42A 3VU9B 5DN6A 1W36C 3KL4A 1XP8A 4QNRA 1HQCA 1S3GA 1CKEA 1R7RA 3DOEA 2NQ2C 2LP6A 3FJOA 4OL0A 1AK2A 4OK3A 2OBMA 4ZIRA 3IQWA 1QFZA 1II8B 1SKQA 4CDGA 2XNSA 4EJSB 1FNDA 1E2GA 3ES9A 1E9DA 2GQFA 2ZI5A 2VSFA 4RD3A 3L8YA 1FNCA 2RC5A 2VHCA 4R71A 3W6OA 3WXMA 3X1XA 2C78A 4LBZA 1G3UA 2GK6A 1NSFA 1IB0A 1KIMA 1GKUB 3VMFA 3EAQA 4IJMA 4TMXA 2DEUA 4IFEA 3K9NA 3MWKA 4ZDWA 1G8FA 3P1JA 2A7QA 4EDHA 1F6BA 4HAWA 3EASA 2VF7A 5ELXA 1LV7A 2A5DA 3CO5A 1CS4C 1E2IA 4YHBA 1E2NA 1YRAA 2C8VA 1XCPA 4WIAA 3QEOA 1TQDA 4JZKA 3K0FA 3K9LA 3NXSA 3FMOB 1BYUA 1XEXB 3AF0A 3OAAD 4IVPA 4ZGQB 2RC6A 3O8BA 1X3SA 2FOLA 2ZRIA 1G5PA 3HP1A 4V03A 4WOPA 3BFVA 3BH0A 3C41J 3W3ZB 3I1FA 3CRMA 4TZ0A 4M1KA 5FTMA 1TF2A 2JIZA 1YZTA 2XTZA 3PVSA 2ZSEA 3IIMA 1R5OA 3BOSA 4CEJB 1VQOB 3PV0A 1EFCA 2BGJA 2DFNA 4A0RA 4Q1AA 4Q7JB 4A4DA 2FX3A 2PCLA 1S1CA 4Q9HA 2V7QA 1PUIA 3C7KA 4ILEA 1JQLB 4BFUA 2GVDC 4OYHA 2BC9A 4RZ2A 4IOJA 4WVFA 3C16C 3SFVA 2QTHA 2ZE6A 3BIFA 1RIFA 3PUYA 5H70A 1IN8A 4NYIQ 1VCNA 2P3SA 5KTYA 2Z43A 2PT7A 3CW2A 1GRNA 1E64A 2QG6A 3NVAA 3AF3A 1JEDA 4C2UA 1ZIPA 4IOMA 1ZINA 4G0NA 3WYFA 1P9RA 1H65A 4A8JB 2JLRA 2XXAA 2F43A 4Q1DA 4DUGA 3QG1A 2O8EA 5FL3A 3C5HA 2QM7A 4ASUD 3VNVA 1C1YA 2GHIA 5GJWC 2WIAA 1PZNA 1IHUA 1UKEA 1H8HA 5FUVA 4U00A 4FMDF 2XZPA 1KK0A 4Y9RA 2G88A 4M1WA 3EA5A 3GD7A 1I4DD 3OE7A 5EXTA 5TR9A 5G3ZA 3PCRB 3SQXA 4HE5A 5AJXA 5IK2A 3UWKA 1GAJA 2AFIE 4V0LA 5AN9A 4Z1MA 3EXAA 4WAUA 1L2TA 1QH0A 1LTQA 1TQ6A 3EIEA 4YMUA 1W1WA 1N0WA 3L2OB 1F60A 2GRJA 1W49A 1HTWA 2ORVA 3FFAA 1BQEA 1DAEA 1O3YA 1PLKA 2GETA 2ZRLA 5D3MB 4YQFA 2Z83A 2IXFA 3MMPA 1II8A 4F7DA 4WZ6A 3KJEA 3EA0A 1E1QD 3WMEA 1TL7C 4Q19A 4UXHA 3TUIC 5KNDA 1TMKA 1DAHA 2BIFA 2PMKA 1DAFA 1KI6B 5F9HA 1EWRA 3HU3A 4YXWD 1EX6A 1U8YA 2MSDB 3DVLA 3LO8A 3EARA 3MAAC 4A92A 1FZQA 4XOIA 3KKMA 4RD4A 3RSOA 1E3MA 4B43A 2QZ4A 4P4SB 4XVRA 2J41A 1EP2B 2XTMA 4Q7LA 2YOGA 5KDOA 1GR1A 1GL9B 4I1UA 3P20A 4A8JC 1KO5A 3O47A 4KHZA 2JCSA 2IWHA 5DSZA 1U99A 1YZLA 3BBPA 3U6KA 1ZJ6A 2OHFA 2IX3A 3NTUA 1NG9A 3TW8B 3TBKA 1OXVA 2WJHA 4Q21A 5DI3A 5G41A 4BLPA 4JT2A 1KHTA 3G82C 2F6RA 1VQMB 1LF5A 1NSTA 4IVQA 4BFZA 4E22A 5L3VA 1IXRC 5JI2E 4U02A 2VH5R 2PLFA 4H1UA 2BN4A 4PC2A 1T9HA 2WZQA 4C0KA 2QE7D 3J81k 3DM5A 2JJ2A 3T34A 4NBSA 4LPKA 1YQTA 4O0MA 3QNUA 2OXRA 3HPQA 3LDAA 1K6MA 1GWNA 5JWOA 2OLJA 3ECCA 3QKTA 4HUTA 2HYDA 1VQ7B 1Q22A 4DLUA 2W2TA 1MOZA 4BPRA 2FZ4A 3I55B 2OFOA 3LXRA 5AJZA 4TL6A 1JJVA 2OCAA 721PA 1N0VC 4HLUA 2G9NA 3EPJA 4YALA 3BB1A 1LY1A 3OE7D 1T91A 1D2EA 1FNMA 1KZ7B 1YHNA 3I8SA 4GP7A 4RVCA 1VG9B 2PEZA 1UJ2A 2IYXA 4Z8YA 4BE7B 3CNOA 1ZC3A 3H0KA 3TMKA 3W5JA 3ZYCA 4PC6A 5HCIA 1MH1A 4MRPA 1UEIA 3LWNA 5D3QA 1Q86D 3CWZA 1E0KA 1YR9A 4IDPA 3T1QA 1SKYE 2REOA 2BM0A 1D8TA 2J46A 4L5BA 1G18A 2DERA 2OAP1 5JWRA 1KI1A 4DBLC 2JLQA 2GF0A 5FBQB 4MA4A 5CJPA 4ITRC 4GMDA 4N3NA 1AQYA 1CR0A 3N5CA 2ODWA 3WYGA 1UMKA 2C96A 2RCNA 2QN6A 3B9QA 1NIJA 3DM9B 1QFYA 2CCJA 4GP6A 4LK2A 1JR6A 3U3MA 1HV8A 2RGCA 4BFXA 1EWYA 1QX4A 3LBNA 4OI0A 3A4NA 3A1UA 3CRRA 3JZMA 4Q9JA 2B21A 3VR2A 3OZVA 5F98A 5JSZA 1OIXA 4FD2A 1IJFA 5C18A 2EWWA 3PXGA 2VHTA 1NL3A 4NZYA 3TKLA 1FNBA 4DLRA 3PQCA 3K8YA 2BEJA 3GPLA 1AGRA 2IUTA 2CJWA 2EQBA 2QMUA 3A58B 4YC7A 1VQ4B 2AK2A 4TYNA 3IDQA 3H86A 1Z8FA 5BWMA 3ZZTA 5DLQC 4LHXA 2WICA 1IY0A 4B47A 1Y3AA 1U94A 4P4SA 1RKBA 3DZDA 1DPFA 3KB1A 1SZPA 1DAMA 3MHPA 2IEZA 4TT3A 3IIJA 1DBSA 1N6LA 3IHLA 2FPKA 4L9WA 4C0AC 1CJKC 4XH9B 5E3HA 2WIBA 4NCKA 4U7DA 1EFRA 1UAAA 3ZD6A 2JIZD 4D4KA 1G3MA 4E03A 3A1SA 2QT1A 2WTUA 4UNNA 3HDTA 2B8TA 3W9YA 4OHXA 2ORIA 4G5SA 3RLFA 1E99A 2WV9A 3MGCA 4JLVA 2J1LA 2FA9A 3HWSA 3VU9A 3O8RA 4RCZA 1XMJA 5FBVB 3BH6A 5FOWA 2VO1A 3QKSA 3PIRA 4URZR 3ICQB 3RWOA 2DFKB 3LW8A 4BEJA 1G8YA 2DWPA 4B76A 2A78A 3MJRA 3F8TA 2V3CC 3TJZA 1BX1A 1JI0A 2JJ1A 5CB8A 1R2QA 2BCJQ 3FDIA 2C2HA 5DGXA 5JSZB 4ZIRB 2WOOA 1PUJA 2YYZA 3SJZA 4LJ7A 5LD2C 3JVVA 4L15A 4LC1A 1OHHD 1YJ5A 3OAAA 2R6HA 3LQRA 2V6JA 4LHZA 4MDFA 2NO9A 4I99A 1XTIA 4LZZA 1E2JA 4DLSA 4M8NE 4PQRA 3I8XA 3Q5DA 1B23P 4XSHA 5EUQB 5J4HA 2G3YA 1BYIA 5AJWA 2R62A 3QE0A 4URVR 4PXAA 1BX0A 1WCV1 5SZHB 2HEIA 2J9RA 2X1VA 1W0JD 2X77A 3OJXA 4KAXA 3GLFA 1YR6A 3W6PA 4DZZA 3K70D 3U5ZB 3ICEA 1IBRA 1O87A 5B64A 1TX4B 4E5UA 2H17A 5TARA 3ZBTA 5A4JA 3P26A 2R6GA 4FINA 4F91B 5J4KA 1GKIA 1X8JA 2WAYA 4PHFA 4NP6A 2ZR7A 1N6HA 5B2ZA 1GUAA 3GMTA 2CK3A 1HYQA 2O8BA 2O8CB 3NKVA 4C4PA 2W6IA 3B6EA 2QENA 1BS1A 2D7CA 3THWB 1RW4A 1R8QA 3ZBUA 2IC5A 4KYIB 2GEVA 1IN5A 1E62A 4IFBA 2P0EA 1GIAA 3GJ8A 5CITA 3SYLA 1NVWQ 3CR7A 1Q7YD 2IYSA 2FFAA 3TUJC 3FYHA 3JQPA 1E2EA 4P33A 2FWRA 3NC1C 2JJ1D 5FTLA 3TVTA 3U3KA 1G6OA 2EYUA 2R6FA 2QA5A 3X1YA 2LWIA 3CCSB 3CCQB 1NG1A 2GDJA 1TF7A 1RYFA 4QJ3A 1NN3A 1UADA 5EP4A 2VSXA 4Q1FA 1CXZA 1GRQA 4EPWA 2O5VA 2P65A 1XMVA 2ZREA 3EWAA 5H1YA 3CONA 3FB4A 2H18A 4D4JA 3LX5A 3M6AA 2Z0MA 2W6ID 4OHVA 4BFVA 2WWYA 4F92B 2A9KA 1JR3D 2GF9A 2QMOA 1NVVR 5FOSA 1OGIA 2XOKD 1SVKA 3QKUA 3G4SB 4ZCMA 5CJ2A 1VQNB 4YAFA 2BJWA 5KUTA 3KJHA 4QM6A 1NP6A 2AFHE 2GZAA 2C9OA 5AK0A 1NY5A 2IYQA 1KO1A 3LVBA 4V0MA 2EU8A 4LY6A 2GCOA 1H8EA 2KB0A 3OIWA 4GI7A 4MRNA 4LHWA 3NHAA 2Z4RA 1VECA 4A2PA 4X8LA 1NN0A 3NC0C 1AGPA 1FW6A 3T1VA 2NIPA 5FPKA 1S9HA 2GK7A 5KSPA 1CF4A 1A2KC 1TADA 1J99A 2OESA 1NNEA 2NGRA 2F1RA 3UXMA 2WVJA 4PQYA 3TVDA 1KY3A 2ZRKA 3ZIAD 5KDDA 1OIWA 1E32A 4C0JA 1N2CE 1I7PA 1YU9A 2ZRJA 2FPLA 4EPVA 4QBIA 3GEHA 4DLTA 2Z6VA 2CNWA 4Q1BA 3RS7A 3UWOA 3SI7A 4B6FA 4BZPA 1ZNWA 3I5YA 1HE8B 4MYCA 4M1YA 1YJWB 4NYJQ 4V0KA 2X3UA 2J0UB 3QPUA 4XIGS 1OYYA 4Q4AA 3KXKA 4X8HA 1G8PA 1XCGB 3FMFA 2AKAB 2VYFA 1FX0A 5DYGA 2XTNA 1BKDR 1TU4A 2AD1A 2VYQA 1S1MA 3AUYA 2JLSA 1XPRA 3RHFA 2C9CA 1J9ZA 4Q1EA 5SZJA 1EX7A 2WSSD 2X2FA 1QG2A 3PITA 2WJGA 2PZGA 2I1VB 4G1UC 4U5XA 4XWOA 3TRFA 2R2AA 4D0GA 2ZU6A 3A37A 2HCJB 4HYYA 3K0FB 5EE9A 1CJMA 3KXLA 1G6HA 1N6RA 5DI3B 4AY2A 1DDIA 2O8CA 3VTKA 4B2LA 1CNFA 1GM5A 2YJTD 2FEMA 1KDRA 1VHTA 2VP9A 4UNPA 3ZGXA 5EXPA 3THWA 3FMPB 1GITA 5EP2A 1GVHA 2GBLA 1LNZA 3QIAA 3VR5A 3QEJA 3W5UA 3W3AA 4TSFA 5LB2A 1S96A 2FJUA 4CYMA 2KBFA 3IIKA 4B3DA 3W8NA 3TIFA 2OBNA 2RGAA 1XD8A 1W4CA 3BXZA 3AVQA 2ZSBA 2IT1A 3RAPR 4BLTA 4BFWA 4M9XA 2W6JA 3W2GA 2BOVA 3NH6A 4LBYA 5GJVC 1BH2A 3ADKA 4IOLA 1UM8A 2WWHA 4DC9A 4N3GA 4NYMQ 1VIYA 5F2EA 3KDSE 2ZYVX 1WBBA 1A8PA 2QMHA 2MMCA 1ZC4A 2KI5A 5L3SB 4C7OB 4WXRA 4TLAA 3TQFA 4KVAA 3TNFA 2RGNC 1OT3A 4B48A 1CU1A 1J8YF 1CULC 3U7EB 2J0UA 1T5IA 2QAGA 2PL3A 2F1HA 1KKMA 2BBWA 1KOFA 2G0TA 3F5FA 4X8OA 3NWJA 2YINC 1L4UA 4OJQA 4YDSA 2IF0A 3QKRA 1P7CA 2WJIA 4QGAA 3V4FA 5C4GB 3OESA 1PV4A 3SU8A 4TL7A 3R7WB 2GZHA 3B7GA 5L8VA 4Q4HB 3GJ6A 2IXGA 1IONA 5EE3A 1KC8D 2AN9A 1P9NA 3FGNA 4N0DA 3HU1A 1J2JA 3E70C 4B3BA 3FHOA 5AJVB 2VP6A 3RRNA 4JS0A 1M1KD 5JCZA 4JIMA 5DH9A 2HJGA 2HXYA 1KO4A 4JKIA 4V02A 1A1VA 2QDXA 2V54A 2P6RA 1QFJA 3P4YA 3KKOA 1Z0DA 4LC0A 3SC3A 4JYCA 1GFIA 1N6KA 3L0IB 5KNCA 3S1AA 1NVUQ 2IHBA 1EFRD 1W36D 2QRNA 2HLDA 1LW7A 2KJQA 5GVSA 1GDDA 5JMTA 2CL6X 2H92A 3CX8A 3KFXA 2W6JD 4K46A 4M0LA 1XJQA 1Z6XA 5CIQA 2E87A 3PEWA 2X2EA 2CCKA 2XZLA 2O0KA 3LAWA 3QI2A 3B78A 1E1RA 4B44A 5FL7D 4LCBA 5M04A 5EE5B 3SOPA 4CVNA 1MO5A 3U3RA 3THYA 3CCLB 3RS0A 3CXCB 5CDFA 1VQKB 1Z6TA 5JRJA 3R9XA 2ZAMA 3CRW1 4L4UA 1GILA 4IW3B 4V0ME 1GNQA 1NBMA 4DT1B 1NKTA 1E0SA 3N2EA 5J47A 3GLGE 1XPOA 4PFSA 4N0EA 1WA5A 1HUQA 1YZUA 3QF7A 1ZUHA 5HZKA 4OI4A 3K70C 1TU3A 3SJAA 1N0UA 1DO0A 2CLDX 2HYIC 4NCNA 1E2PA 1GNRA 1J7KA 3PUVA 2ODBA 1OH5A 1W48A 5ANRB 4HLUC 4HE6A 1IAQA 4PSAA 3VHXA 4Q9LA 1GZSA 2RGGA 1M34E 2A5YB 3M4YA 2NZJA 1VIAA 2W58A 4XWAA 4EFLA 1G291 3AKCA 1GL7A 2JLXA 2RGDA 1Q20A 2WKQA 3SYKA 3SZRA 5LDDC 4PAMA 1NMXA 3CCUB 1Z3IX 3EC2A 4Q5IA 1TF5A 4BECA 3I5XA 4B3FX 1AMOA 1ESNA 1T8UA 5KO2A 5HKKD 1SGWA 4M1SA 2ZR0A 1YZNA 5FUWA 4B35A 4LJAA 3G0HA 1R5BA 2VP4A 2OCPA 3I32A 4OHWA 3Q5EA 4PAOA 5L3RA 1XTRA 5SZIA 1RPZA 1KQSB 1G7RA 4HB2A 3ADBA 4ESVA 3AVXA 2NOAA 5EQTA 1AZTA 2HF8A 4DIEA 1GRRA 3OZWA 4FCTA 3QSYA 1G4AE 1T3SA 4PZZA 1W0KD 1IY2A 3TSZA 1UKYA 4G5QA 1N5LA 3QFTA 2JASA 2W83A 2WMNB 4FWIB 5C46F 5A5GA 1ETUA 4DCNA 4ESHA 1W0KA 2CE2X 3QF4A 2VNJA 5KPDA 5AWFC 2QSYA 3BE4A 5EXXA 4BLQA 3LBIA 2C95A 2EFGA 5CK4A 4ZV4A 3G71B 2FU5C 2P5SA 4MRSA 1NMYA 2NG1A 2G1KA 2OILA 2XNCA 2IEYA 1VQ9B 1CJVC 1N6NA 3FE2A 1G64A 4HLCA 3AVUA 1KY2A 1Z2CA 3R9WA 5HTKA 2IHYA 3MFYA 2ZITA 1X1SA 2GCPA 2KE5A 1ZM2A 2BMDA 2QT0A 2OAQ1 1QZXA 3X1WA 2QTZA 4QHSA 4BQSA 4Q03A 1U8ZA 3A6PC 4HAYA 2ODEA 2IS2A 3W5HA 3WHKA 3V4RA 4BFTA 4C9BA 1KSJA 4QXAA 2WBLC 1D9ZA 3W2EA 4DDWA 5JI3E 4CGZA 1DO2A 2OV2A 3AF4A 3NG1A 3OIUA 5FBWB 1C4OA 4JVMA 4AC9A 1H8ED 2C9YA 4LJ6A 5EUMA 3CD6B 3BJIC 4EPTA 2QAJA 1YR7A 2BWJA 3SJCA 1NVVQ 2F3TA 2VPPA 3N2IA 1TEVA 5E7IA 5BW8A 5KYKA 1NRJB 2P2LA 3TAUA 5C1BA 1W36B 3BFXA 2YWHA 1NY6A 1P2UA 1G8HA 2C99A 3KTAB 3SHWA 2IYLD 3FKQA 4FMBB 1M7BA 3MCAA 4AKIA 2DFLA 1M2OB 1T5LA 2VL7A 3CRQA 2R6DA 3K0AA 3GLGA 4CEIB 1OPXA 1X86B 2WWWA 2J7PA 2XITA 4GNKA 3V9PA 4A6XA 2O8DA 3OZUA 4EPYA 1OLOA 3ETLA 2ZJYA 4Q4HA 1PJRA 2AWOA 1QDEA 2VZLA 4AKHA 3NHBA 1HT1E 1XX6A 3CBQA 5FPTA 4D4MA 1KSHA 1XZQA 3PUXA 5JZVA 4KXFB 1N25A 3CM0A 1P4SA 4B2IA 1IJEA 1EFHA 3CCEB 4FXPA 2ANBA 5D3MA 2QU8A 1VYTA 1QVFB 1VQ6B 3K09C 1KD1D 4IEEA 1KI8A 2RGBA 4PSVA 2ZQ5A 1DELA 4LSGA 4PO8A 4NYJR 3RABA 3SEAA 4DB2A
chains in the Genus database with same CATH superfamily
1A7UA 3D54D 2R8EA 3F8WA 2IZZA 5AKXA 4RSPA 5F12A 2ONYA 1BSVA 1Y3YA 1QNJA 2AX3A 2IYEA 4ZI7F 1BCSA 4B4UA 1B00A 1E94E 4N8DA 2WKPA 1X0XA 1VA4A 3SJPA 3S9CA 2NMVA 4XBCA 4PV7A 1SCDA 4QLOA 5EU8A 2FRVA 1CDZA 1H2BA 4TTTS 3AOGA 2VLIA 1Q19A 2R5FA 1WZCA 2F9LA 1DBRA 2J95A 2VTKA 2PUAA 1KZHA 5KAMA 3K65B 4R0NA 2WU3A 3EZ7A 3VR4H 2ZB7A 4O1MA 1GWAA 1JSCA 4GBED 5AVJA 3BRWA 4ZVMA 3RRJA 1ZM9A 4O9VA 1DJLA 4I46A 5C7LO 4PLYA 4WINA 3DEZA 2A5AA 4HSEA 1E9AA 3MBIA 2VRCD 4IY1A 4O2BF 4D41A 4CKCA 4YJ2A 4MV1A 4CIXA 1C1UH 3C3YA 4KEAA 3RO7A 3O4HA 4ML3A 3CF6R 3TXAA 2XMSA 5F78A 3JZDA 1T8YA 4QU5A 2O0HA 3T3DA 1INLA 3TRKA 3JRWA 4Y98A 2UWPA 4US1R 5B2FA 4WKCA 4JQSA 2PGBB 3GYBA 1B14A 1ZHRA 5DO4H 2WPHS 4M7RA 1E3DA 2REXB 1XNQB 1W35A 5I8PA 2JAWA 4C0LA 1AN1E 5K0FA 4XD2A 2EF1A 3L82B 3EPKA 3A04A 2QU7A 3B5IA 4XGRA 3C85A 4QGHA 3FUVA 4CQLB 3GT4A 4DLXA 1OFUX 4ENVA 1AGXA 3WLOA 1VE3A 1U8XX 2V7GA 2WJJA 4QX6A 5C0TA 2D5IA 1MQAA 3ASYA 5FI5A 3PWTA 3TE7A 3FUCA 1HR0B 1T4UH 1Y5LA 1VKJA 4GM0A 1S02A 1TALA 5TQVA 3STYA 3LLSA 1RXYA 1BW9A 3AVYA 2VQ6A 2QN2A 2VAXA 4D7GA 4FEAA 1H2YA 1OPRA 2XGMA 3GPCA 1U80A 3KE9A 5GQSA 4GOOD 1MBMA 2AOWA 5ESWA 4BZXA 3IUNA 3VZCA 3DHYA 4P25A 5GIOE 1YMUA 2H06A 1QB9A 2FE4A 2AWNA 2PKXA 1QJ7B 3K6JA 3U31A 3EBOA 1KXFA 3OFSA 1R5NA 1Q77A 2Q2QA 4AL4A 4L1KA 2I22A 3ND7A 5CLHA 1DRWA 1NP3A 4FVTA 4K03A 4QT4A 5C81A 4C2TA 3CNRA 1HRTH 1P6UA 1G3RA 1VIVA 4UAJA 3GY4A 1OC4A 2R9VA 3OT5A 5GPIB 4EI8A 3WLHA 3NW9A 4TTPA 5KVVA 3A25A 4TYYA 4MNVA 3Q5GA 3EFOB 4CDMA 1KO8A 3KQYA 3UJ3X 1KK2A 1GRVA 2QLNA 3MGBA 4UTPA 1RGQA 1Y1TA 2WJVA 2PMEA 3DZFA 3F1KA 3O4FA 4IF4A 4P35A 2N46A 4JSTA 4DW2U 1XRMA 2X4LA 1TA0A 1UBKS 2FFHA 4QQFA 5FPYA 3IAEA 1MG0A 3DHEA 3K5HA 3GLFE 3LXMA 2DWQA 1UTKA 3GQBA 3QZUA 4CMJA 1CUDA 1YL7A 1N5JA 3LY5A 5IZCC 3PMHB 4TTQA 2OBSA 4XLFA 5K51A 2P2YA 2W2XA 3AWDA 2ANCA 4IJUA 2JRLA 3HV0A 2ZZEA 2Z09A 2ZYWX 4MVNA 1H4SA 1PG2A 2ONZA 2WUFA 4H3HB 3DFKA 3KSMA 5DPAA 2L82A 1SQRA 4WZKA 5FA5A 4MVCA 1KFEB 3RXQA 1K5DA 4EX6A 5BN5A 3QBJA 4D9BA 1Z18A 4WXMA 5B6IA 4OHYA 3SE7A 4QEZA 5IEJA 1JHMA 2OPBA 2V55B 2WFZA 3CLVA 2OV1A 2Z3VA 4O08A 7GCHF 3RTAA 2G1JA 3PHBE 4CFSA 3I4LA 2G9RA 1UOOA 1II0A 3YASA 1OP8A 5DNYB 1YUBA 2C2GA 1GDQA 4GYYA 3X2EA 2OQ2A 3VX3A 3U48A 1FFDA 1G8GA 3QOFA 3TXXA 3OQ1A 1V3VA 1O2RA 1V6DA 1G7SA 4MYHA 1AM4D 1LDBA 1QURH 3U8OH 1XWWA 3SS7X 2MSKA 5HG0A 5MN6A 2X58A 3LYUA 5IM5A 4QRHA 3H2JA 3A10A 3U19A 3WKDA 2DR3A 4NV3A 3AO0B 1QV9A 2A0FA 3RC7A 1WSRA 1N3BA 2F4VB 4QT0A 2DBZA 2EKPA 2XC4A 1Z7KA 1OZGA 1WXXA 2AN3A 3TCNA 2PE3A 2WWRA 3CO0S 4YVFA 1EUZA 3PNSA 1LTKA 1S9DA 4JBYA 3OFNA 4TRJA 2VBIA 4YV0A 2RH4A 2BFAA 1YLOA 4P3IA 5ALYA 4PG7A 5EKXA 5J1SB 3JYHA 4MUIA 2J6BA 3U7GA 1Z4KA 1TUIA 4CDRA 3L05A 5ENDA 1XFDA 4HBGA 3KWJA 4UCQA 1TMYA 4Z9FA 1CGJE 4YEDA 1I18A 2BLQA 3OJCA 4A9AA 3NIBA 3KDPA 1YJQA 3WP0A 3L6UA 3DA8A 3BIVH 2RHOA 5F33A 3NIWA 2BDTA 2FEPA 2NPIA 1FU8A 4NZQA 4I50B 3RLYH 1JB1A 4WXVA 1T0JB 4PPQA 2RJ3A 5DEOA 3H42B 1WQSA 3E5RA 4JUDX 3HCWA 3RYHB 3WNQA 1T2DA 2CL7X 1D03A 5GPBA 2QQ5A 2PBRA 3RFFA 1QRXA 3EGDB 1OGJA 1W44A 3JASB 3QVTA 5LA6A 3AVOA 1OXBB 4WNIA 3KXIA 5JAQA 3P7MA 4GX1A 1PL8A 4IJVA 1LNQA 4D25A 3UCFA 1P6QA 3DULA 4GPGA 2JCBA 1RBZA 2ZIQH 4CETA 1JIXA 3AJEA 1CETA 1Q82D 2MJLA 3QTLA 4J4HA 4JUBA 2CXPA 3ZGZA 1AE8H 3UVEA 3DZCA 2ZRHA 3AEUA 5IFLA 1EDZA 4AZ2B 1A82A 1UCYH 2VQEB 4XYBA 4XA8A 2JARA 1H0SA 4NV0A 4PG4A 1Z7BA 3L02A 4Q1CA 3SZLA 3G5MA 3QVOA 1M2VA 2OXEA 1GPJA 1YJXA 2DLNA 1NS3A 5KWJA 3N0WA 1CT4E 3IPYA 3MT7A 1Z08A 4E6PA 1BVYF 4NBTA 3GJ3A 3RXGA 4YOJA 1NKVA 4WW0A 4X1IB 4L0CA 4X1IA 3AR8A 3RC8A 3CU5A 2I6GA 3WICA 2NZVG 3REGA 1VI2A 3RHSA 3EIUA 5AI5A 2G17A 2NPFA 2ZZMA 5FAXA 1Z8DA 5BURA 5DYYA 5JECA 4F3TA 4DT1A 2Z1NA 2WVAA 3SQEE 4URWR 5G53C 5LN1A 3CG0A 3QELB 3RARA 1TW2A 2BFBB 2GARA 4ZAWA 1ZH8A 2A4GA 1CQWA 3A9RA 1YE3A 1KZYC 1PFUA 3NEPX 3UK6A 4MW6A 1ZO8A 4J0KA 1UD2A 4UMFA 4KKVA 3C1OA 2Q0SA 4PTZA 3FHCB 4X06A 1MAXA 4FFSA 1Z37A 2RG7A 1N33B 2W26A 1R6AA 2R8BA 1ZJ5A 2B8WA 4DV4B 1X8KA 4B80A 4ZVTA 3PTZA 3KAKA 4LRSB 1WQVH 1W6UA 5J4VA 4ARBA 4TM8A 2QUIA 2CDNA 3DAOA 3A87A 3AL2A 1ETTH 4NBWA 4BX0A 1EPTB 1HFWA 3A3OA 3GISB 2VBCA 2QVGA 1LBIA 1E2FA 2XV1A 3QN7A 2FW9A 4A23A 1NNI1 2SGDE 4X1YA 2HMUA 1Y3BE 5HA5A 3IEUA 4P1ZA 1PK9A 1M2OA 3K0AB 2EI7A 4W99A 4UVEA 1ZQ9A 2QVLA 1ZNXA 3A7DA 3NHFA 3NNNA 2PWPA 3A4LA 4MMYB 2WPJS 4W4TA 4EG7A 1ZEJA 4KC0A 1K8ZB 1JLLB 2R3YA 4RMNA 3WVNA 4BP8A 4DLNA 5L6MB 3LKBA 3EYDA 5H5JA 3A80A 2NU8B 3STVA 1LI7A 5EXNA 1XU7A 5JARA 4IDOA 1VR1H 1ZN9A 1L7DA 1C1NA 4D82A 5F4BA 1Y33E 2G25A 5DI9A 4D9HA 4YAIA 1ZCFA 9GPBA 1ULUA 3SQOA 4U5QA 5F9FA 4U7FA 1G3IA 3DV9A 3NP7A 3L7AA 4Q01A 2I3GA 2NU2E 3CP7A 1GHVH 3U56A 3C3KA 5PGMA 4MKFA 2XE7A 1TCUA 1YOBA 4X6YA 5JCPA 1ZOMA 4YT4A 1E5TA 3CJQA 3GCWA 3IPXA 1SELA 1PJCA 2IEBA 4ZV9A 3WXBA 1WQ1R 5J4YA 2HIHA 4JK5A 4EUSA 1C41A 2JLCA 4O3TA 5IJAA 1YFZA 1STOA 3JD0A 4CCYA 3HKCA 4JJ7A 2NVWA 4CMCA 4MNWA 1WDMA 1V8BA 1TX8A 3N7AA 5JXWA 5KNDH 1Z25A 2V9PA 3NI2A 4Y0VA 2OYNA 3D3QA 4DCTA 3AJDA 1P75A 1MRZA 2VDJA 2JIQA 3RYIB 4P81A 1TA2A 2XZOA 2OO7A 2IYAA 2FIRH 1Y42X 2AV6A 2WYVA 3U4CA 1MV5A 1IZ0A 3NDIA 4QUEA 3ZQ6A 4YRZA 5GTDA 1FPQA 4YRJA 1L4DA 1P2SA 3PXAA 4Z1MD 4R83A 4MUNA 2EP5A 2IXEA 3OKXA 1XZIA 2X8WA 4S1WA 1EAMA 4X24A 1S4MA 1A9XA 1CRQA 4AW9A 3WYEA 3KEOA 4AZ3B 3UV7A 3SC2A 3L0PA 3MH7A 1CVLA 2BELA 1PT8A 4F9EA 1WDTA 4BASA 5K45A 3V2UA 2GASA 1R4NA 3P17H 3B9BA 2FUNB 3D8TA 4EEKA 4KXUA 1NRIA 2ZSJA 4S35A 3A6GA 1LDMA 3PF9A 3PHLA 4A26A 3KJXA 1B0ZA 1ISMA 1P0CA 2X3FA 3O8CA 4DLPA 3AK5A 4Q12A 2HKIA 1C2GA 3IQWA 3ZDYB 3HB4X 4R8TB 3D4OA 3IRVA 4R71A 5DGIA 1MTUA 3U9SA 3V1KA 1HE2A 1QH1A 4GQAA 4LE0A 1T8MA 2AHME 2WPLS 3FLBA 4BOHA 1MJHA 2PS0A 1SPJA 4IX1A 4NESA 2ID4A 2CLOB 4RKQA 1SOAA 1G5PA 5JDIA 4FOOA 4W1QA 3ZHQA 2OYSA 3BOSA 5D1HA 4JYVH 3SGAE 1JG3A 4K5ZA 2G5NA 3HYLA 1RXUA 5DXJA 3OBIA 2FW0A 4ZYTA 2CKMA 4WNCA 3QLVA 3MCZA 2CMHA 3IG6B 4WZTA 3FOBA 1L8OA 4A8JB 2F43A 4FUDA 1C1YA 3PWBA 1CZLA 4PR3A 4RGQA 5FYQA 2QRVA 2W8BA 4Y9RA 1TCAA 2G88A 2R7KA 3N2GB 5G3ZA 3SQXA 5IK2A 3RRBA 4GW3A 1QFMA 2HRVA 4YMUA 1YSCA 1NJ6A 1Y8RA 5PTPA 1NONA 5HBRA 5D3MB 5CP8A 1IZ7A 3TUIC 1DAHA 2Y99A 2NWNA 1EX6A 1U8YA 3DSOA 4XOIA 3UYLA 2H2IA 2V58A 3WB9A 2PUVA 3UZUA 1KO5A 4I4TF 6LDHA 1K63A 1RAEA 1ZJ6A 3LM8A 3B51X 1T29A 3MYWA 1OXVA 2G09A 4NMWA 3DDHA 1P31A 4EMBA 5L3VA 4MQMA 2F2TA 1C9TA 5K0JA 1QIDA 2EQAA 3DM5A 1DXOA 3PQ4A 1PNVA 3T26A 1PFQA 3ZU4A 3PE4A 2FMJA 3BFPA 5I9LA 1MOZA 3HCCA 1N0VC 3BB1A 1W14U 2IYXA 3D0RA 3B3GA 3LWBA 2OBBA 3ECAA 4Y8ZA 3WWOA 3MWIU 5FWXA 1KYNA 1KXEA 1K75A 2P7IA 5HM2A 1NIJA 5BSHA 1F1BA 3RADC 1PZEA 1PKVA 3OZVA 1YV9A 4H17A 4FD2A 3VSDA 4P58A 2VHTA 2O48X 1BJTA 3K8YA 1XQVA 5H3CA 4BHTA 3ZY2A 3WL5A 2HRBA 1DUVG 3IJEB 1VA5A 1T4VH 3IIJA 5IUNC 1NC6A 4XH9B 1A97A 1VOTA 1EFRA 2V7BA 4D4KA 1FNSA 1E99A 2J1LA 3AFNA 4MMXB 4RCZA 3RWOA 2DFKB 1VMKA 5CBPA 2ANKH 5DNEA 4D9JA 2ZTMA 1EMDA 2BCJQ 4NA9H 2IUEA 3FDIA 4KVFA 3B5EA 1I10A 3L8GA 4I5FA 5EWLB 3BN9A 2G51A 5CXXA 3STJA 3TLAA 4D8XA 1EOJA 4ZGBA 3RU4E 3WNVA 2J94A 2ALJA 3U5ZB 1IQUA 3PT5A 4ND8A 1UJ1A 5IJ0B 1PJ2A 1N6HA 4KK4A 4I66A 1PFVA 1FMFA 1X1TA 4B09A 2CFIA 3NKVA 2D7CA 4G4JA 3THWB 1R8QA 1ECCA 1GIAA 4E6EA 3HB5X 3TSCA 2ATCA 4K9NA 5I01A 4KTUA 3CZCA 3PGA1 1P2NA 3P94A 4C6TB 3OG9A 3V33A 1NG1A 2QQGA 5AP9A 2A7XA 1YOVA 2PZ8A 1XJWA 3ETDA 4HX9A 4F92B 1DIGA 2DHQA 3LSYA 1NP6A 1IZ9A 4V0MA 4MJ7A 3CUTA 1AGPA 1PVDA 4LHSA 2HH9A 1C3JA 3D8RA 1J99A 4K6OA 1T0BA 1T6ZA 1I1NA 1QO7A 2GKVE 4WEOA 4C0JA 1YU9A 3PX3A 4RY9A 2MINB 2CNWA 4XIGS 5K0HA 3NK8A 4K9DA 2QLLA 3FMFA 5DYGA 2C3OA 4DR5B 2WV5A 1VI6A 1HLTH 2WJGA 1T32A 5IM4A 1XMNB 1QH8B 1I5OA 1U9ZA 3GJRA 1UOQA 1DEHA 5DI3B 5FB3A 4UNPA 2XBVA 5EP2A 3QIAA 2XQJA 1XZHA 3QITA 2IY9A 2BVXH 1F7ZA 4UDWH 1ENYA 4RKJB 3JS5A 1SUDA 1E1MA 4DR2B 5IKMA 1E37B 3G9TA 3I4CA 4N3GA 3F2FA 1ISIA 4NEHB 1OT3A 4H4EA 3HV2A 2PL3A 1M2EA 1MVNA 1O38A 1XI2A 4E2ZA 1SOVA 3B7GA 3L7BA 5EE3A 4CM8A 4U2WA 1PR6A 3IFSA 5DH9A 2HXYA 3SG0A 1HDYA 3GDFA 4JYCA 5C5NA 3KFXA 4MLPA 2F3QA 3LAWA 4V1CB 1SMFE 4KWHA 4TX1A 4EMTA 2Q6DA 2SKEA 3KLOA 1GU1A 2QUKA 5IXSA 5ALUA 1NUHA 1IATA 4QFBA 1HUQA 4DEVA 1QRUA 8AT1A 4BDTA 3QUTA 1EB8A 1RHKA 3RSQA 1GZSA 1JHVA 4FX2A 1GGVA 1EINA 4JDPA 2VT6A 4UFPA 4RIEA 5KO2A 3JQAD 2JD2A 5HKKD 1GG9A 5DP2A 2N0SA 4PLFA 4INOA 5HCUA 3R7LA 3PE3A 3ZDZB 1IY2A 7LPRA 4G5QA 3FCOA 1TJPB 1QGOA 3VDXA 2VN8A 1GZVA 4Y9TA 3BE4A 3W79A 3H2GA 1MFPA 3LGVA 2X9VA 1G64A 5EY5B 2HSDA 3V97A 3R9WA 2QUHA 1FSZA 1L3IA 1IHMA 5K1ZA 1MZAA 5BYBA 3IR7A 5KKAA 5FFFA 4J3JA 3PHCA 1PFWA 5M5BA 3RUFA 4AC9A 5EUMA 2P9HA 3SJCA 5BW8A 1C5VA 2NXNA 3MNCA 4DTIA 1J0BA 5HJEA 2Y82A 3GRKA 4X97A 4OLJA 1M2OB 3K0AA 2WWWA 2BDEA 4U7GA 3MFJA 3RF7A 2ZUFA 1P2OA 5LZ8A 2CWWA 3FPSA 1N2CA 1YAJA 4UARA 2A4QA 4LTDA 2Y77A 1HXHA 3ND6A 5A8YA 2ZQ5A 4GXQA 2X6XA 1DELA 2IY7A 3UOAB 3BHJA 4OHRA 1EUFA 3TF5A 3AILA 4TYDA 4Y3UA 4EA7A 3MXOA 3S2FA 1C3XA 3K9CA 2JFYA 3CNNA 3IH5A 5I6DA 4C03A 1LV8A 1MBQA 1QQTA 1ZJDA 3HUEA 1S0RA 2WIFA 1GHAG 3RODA 2YWGA 2F9UA 4D5EA 2OBXA 1JRSA 4FUHA 2CFCA 3U13A 1JA0A 2KQUA 2YQ4A 4ENTA 4K26A 4RM2A 2HA6A 3ZV6A 1IQLA 4MS3B 5BN4A 3OP4A 3MWGA 1FP6A 1FX1A 4HUJA 1Y89A 1OILA 1U9JA 4A2WA 5HKAA 4IRMA 2H5EA 1WUIS 4DUPA 3PEFA 1KOLA 4PRLA 1SIUA 2GEJA 3FFBA 3PNLA 1SGEE 2Q6KA 1OLSA 3L4JA 4N6NA 1G0NA 1NVKA 4UKDA 5LP6C 8OHMA 1FQOA 2VJMA 3K94A 4B6QA 2JFPA 4IS5A 1GNVA 2FQQA 2NUPA 5KVSA 4QYIA 1E79D 3LLUA 3M5CA 2CVOA 3ZCQA 2FOGA 1SQ5A 4QHTA 4F9FA 3B60A 4JQYA 1XD9A 1M76A 4GLLA 4RVOA 3SOSA 1GHAF 4R3UC 2GPJA 1ZJKA 2PSJA 4R3WA 1WJGA 1RBMA 3BNWA 3P97A 1F2TB 1Y8QA 5AHKA 2VH6A 3F0PA 1KMNA 2P7HA 3WMRA 5JVDB 3KVNA 2QRQA 3TCXB 1TVKB 2OCIA 4ZGWA 3HKEA 2R48A 4FR0A 4B6GA 3T0IA 2YVLA 1CYEA 2XMQA 2X5JO 4RF5A 1R15A 3A4VA 3PLRA 3FPBA 2X6YA 4NZZA 1IXSB 3RAJA 5KSYA 4YRAA 3ZQJA 3SW2B 2GSDA 5IF9A 3C98A 1K3UB 2MU1A 3T7DA 2Q0XA 4YRLA 4BUCA 4Z4VA 2HV8A 1KMHA 3P9NA 1PR4A 1QPZA 1O3AA 4BFSA 1LXCA 1GI3A 1W8DA 1A5BB 4HADA 1OXSC 4D9RA 4HGOA 4BN5A 3BAZA 4IPTA 3CX4A 5I5GA 4XX1A 1U3FA 2XCOA 1PJBA 3L43A 3QFFA 5K0LA 1IBLB 3AUFA 3T7AA 5LSAA 1WAMA 3MMSA 2OCXA 3Q00A 4DW8A 4JK3A 3TZKA 2IPHA 5HGGA 2H5LA 3I6YA 2YHIB 3FWKA 4I3FA 5T4EA 1N2OA 2ZBDA 4ZCIA 1DTWA 1P4AA 2H4FA 4RGYA 1MORA 4JL6A 3BRQA 2BOHB 2KW5A 5JBQA 2O50A 1BHXF 3HI4A 1HEUA 1GQ2A 4Q02A 4L51A 3H09A 2P9EA 5HWSA 1GU7A 1TCBA 1M8KA 2D8MA 2BHGA 1U7DA 3ANTA 1DS6A 4KGXA 3OSYA 2XVXA 1SVSA 1W75A 4BBPA 1OLUA 1NY22 4NMMA 2O3QA 1BE0A 2E4YA 3KJIA 1BRAA 3QK7A 4DCCA 1RQLA 5JYIA 3ZY3A 3GBSA 4QYXA 1J7JA 5IYNA 4ZCQA 1TEZA 3VC2A 4OHCA 2L17A 1XC7A 4Y9DA 1H3NA 4UHFA 1MX9A 3DCLA 5IYZF 3RIEA 1BZYA 1RE1A 3PUHA 2WJ3A 3UQOA 4JEUA 1GZ3A 4GCHF 3NHUA 3QU5A 2IXAA 2R3SA 2MSWA 3ZH9B 4PHHA 4HB0A 4Y7CA 4KVGA 1XMIA 5FNVB 3VXFH 2XCSB 3ABIA 3H3XA 1XKBC 2WOJA 2IS6A 221PA 4DILA 3KSAC 1K68A 2DBVO 1F6DA 2XUFA 1WHTA 4H4CA 4MDEA 1G17A 3ZKWB 1M1YA 5K0ZA 3ER8A 1Z5OA 3ZV9A 2WILA 3G0OA 4UM7A 2Y5HA 4XDGA 1DVRA 1E0DA 4BVFA 2NO7A 4BFCA 1G55A 4DR3B 2IS1A 5EJEA 2G7MC 4YRBA 5FR2A 2UUJB 3K8ZA 2R7MA 2XNDA 4H3KB 4XSGA 1G4UR 2G0AA 2I99A 4KLZA 3DLHA 1ZMTA 4AD8A 3OZBA 1ZY2A 4BQOA 4ZQFA 3TLKA 3PFBA 3NNDA 3IELA 2VDVE 1FB5A 1VJCA 1XUKA 3W6NA 3QUSA 3OICA 5LQJA 1VGRA 1YFLA 3V7UA 1FLNA 4ZCNA 1LTHR 1UFVA 4O4HB 7ESTE 3LGXA 4NIWA 1LVYA 3ZV3A 3ILVA 1B6GA 1MVOA 3OPYB 4HLQB 3S9BA 2QXIA 5GZ6A 4JI8B 521PA 2C03A 1QPGA 1ZLYA 2MWMA 1F12A 2G0NA 3D6HA 1JYEA 2WT8A 2QMYA 2OO5C 2A0WA 1D09A 3M7UA 2GJKA 4FOPA 1O3GA 4E3ZA 2YBDA 4INZA 4HH4A 2QM0A 4Q37A 3NWPA 3ANXA 2EZTA 1I36A 2Q62A 5U9CA 4JZEH 4EL5A 5BW6B 1XUOA 3VQTA 1H6DA 3V1TC 2Q0QA 3UJ9A 3KDAA 5FPSA 1BEZA 4Y0AA 3QE2A 1H85A 1VPEA 2KSQA 2WWIA 4UFGH 4Z8XA 3ZWXA 3TW6A 1LDTT 4JA2A 4P32A 1YRBA 3A1EA 3B9FH 3GLIA 3OCCA 2PLRA 2ZSAA 4WESA 5EIYA 3THSA 2YXEA 3KTFA 5JJBA 3W3AD 2MCFA 4MRVA 3LWZA 3NBZC 5BPHA 3FLMA 2Y92A 3GGPA 2FN3A 4EY5A 3AIMA 1YLDA 3UGKA 1E3WB 5AFZH 4NFEA 5KBYA 4FYWA 3EVNA 1HYEA 2DLDA 1W4LA 1ECJA 1THMA 4UJ5A 3BB3A 3HZHA 1U0GA 3B8HA 1YFKA 3TSWA 2FG7C 3KCQA 4LBWA 1RJ9A 1SVNA 1YK0A 3BC9A 3LUHA 4D3ZA 3I83A 3RU7A 1LRKA 1J0EA 2IP2A 2QYHA 3KN2A 1J4AA 3FUXA 2O0JA 4K81B 3ZCPA 3GVXA 1YI0A 4YPFA 2H16A 4B9EA 3DG9A 3FNIA 3A8TA 5JHGB 3V2IA 4OQMA 4C0XA 1IWBB 2R9PA 1H8IH 2VG8A 4BO9A 4KGDA 3TNLA 4PICA 3KD3A 1KJZA 1YM0A 4QDXA 3UCXA 2FWBA 3WIEA 4YP7A 1C2EA 2IYNA 1XTKA 4GZ5A 3JRXA 3IPLA 1COZA 1OHHA 4ZI5A 4ARCA 3VOAA 3ASQA 1YBVA 1UINA 4FOTA 5DGCA 3Q72A 1PR9A 2NADA 4FHZA 4B7XA 3VU1A 2GBLC 5IFKA 3ZWVA 2PL5A 3WMFA 1B2LA 1OLXB 3M3SA 5L40A 1KKLA 1P1CA 4KO4S 4PF1A 3C97A 3JQAB 1ZVMA 3B9RA 4ZT6A 4MQBA 1NBIA 3O26A 4D26A 3LFHA 5A3JA 2GF2A 2P59A 4KE7A 3LC0A 4RORA 5DM0A 4Q7QA 1GGMA 1NVDA 3O8DA 1CIJA 4Y9UA 2XCRB 4B3XA 3PENA 4QU8A 4MIYA 1RJGA 2JEYA 1GTMA 3VPGA 5A9SB 2N1BA 1U2RA 1KDYA 4EBBA 4FXOA 2WHYA 1V2TT 4DY4A 4YLQH 4KKDA 3F9GA 2VJLA 2TMKA 5J4SA 1T8NA 3E18A 4LJ5A 3TPZA 1M0WA 4LZPA 3PNOA 1E3IA 2CZGA 5TB5A 1S5PA 4L22A 4NVRA 2W7UA 5K01A 3ADPA 2QPOA 2H2ZA 2DSTA 3ZDBA 3WLRA 1VL8A 3CZMA 3WR5A 1QJ4A 5CDYA 1QCZA 4LY3A 5SZKB 1RRGA 5JAPA 4G0ZA 3AM5A 2JKVA 3SU1A 3MJFA 2ZFQH 3ZNQA 2BLVA 2VTBB 3HAGA 1O3NA 5IVHA 1YB6A 3S9AA 1R8SA 4JI4B 1XZCA 3LQ4A 4HFPB 3K96A 3AMVA 4RKEA 3TB4A 4JXXA 2D7JA 1I7SB 2UYYA 4L76A 1ELVA 5G0WA 1QB7A 1ZU5A 2AE1A 1Y6GA 2F83A 5K20A 4XLZA 1F7VA 3MT0A 2RDEA 3MWEB 3VR1A 1DQNA 4II2A 1WKVA 5C1YA 1IEVA 4X1OA 1P19A 4K6MA 4OHKA 4JEMA 4JSYA 3ROFA 2BZAA 3VGCB 3C74A 1LF0A 2B82A 1LVUA 4G7WA 1TMBH 2HF9A 4RPGA 3LX6A 3WLTA 2ZI4A 1RZUA 1UBFA 3FZZA 1US8A 3HGQA 6GPBA 2JGLA 3GLIE 5FUMA 4X7PA 1QVRA 2PNJA 4IDEA 1UFRA 2QXJA 3JSXA 5ALOA 1ZKMA 2YWXA 1C29B 2WDZA 3PQ5A 1RRKA 2J9XB 4MQUA 1YULA 3I1JA 3WWPA 3B9PA 1W9XA 3PSAA 1T4MA 2ZUEA 1LFDB 4HWKA 1KEUA 2X0DA 4P7GA 1BCRA 1G7TA 3OZ7A 1J70A 4XQFA 5THXA 3OZCA 4LXBH 1C2TA 3EYWA 4FT2A 4LYEA 1YI2B 4BVBA 2EFCB 1GJ7B 4Z51A 1T2NA 3G2OA 2IYFA 5AVZA 1WRBA 2BZ1A 3KUUA 2NNWB 3SZOA 4U9HS 3AKDA 4ZZ1A 3UEOA 1HB0B 1GKYA 2X4GA 3SFZA 1BPLA 1NR5A 4GPTA 2Y4NA 1GUFA 1N4DA 3IAXA 4LRYA 2B7DH 1GZ5A 1GLNA 3U4AA 5BY2A 1SQ0A 1GYQA 3H3JA 4ABYA 1S72B 2PXAA 2BHRA 1KYZA 2WWFA 1E0FD 1X7YB 1EA7A 1T2UA 1UF9A 1AUVA 4LXGA 2CD7A 2PIDA 2ZYIA 2ZGJA 3TYXA 3AHIA 3W5SA 2D06A 5CTAA 4FEEA 2GVFA 3QM1A 2FZ5A 2PBLA 3AESB 1A8UA 1ZAKA 2QDKA 2D2EA 4WY5A 2ZB4A 3Q3IA 5AW5A 2FLWA 4NIMA 5CLJA 3MGAA 1LS6A 4MI3A 1C7FA 2R47A 1UMCB 4I36A 4ZT3A 2FUEA 1HNXB 1D2AA 3TQQA 1U3CA 1HNZB 5AKYA 3Q15C 4MKHA 3INNA 2N42A 2Z9CA 3VU9B 1XP8A 4QNRA 4GEKA 1S3GA 1XA3A 4U7PB 3AR5A 1DKPA 1TYNA 3PQ3A 4KH0A 2MT9A 4PLHA 1KY5A 4TWRA 1NM5C 3DUWA 2UWOA 3CF4G 5L6NH 2AS9A 3BE6A 4GQBA 1YS7A 4GLJA 4ZJYA 3VM6A 3VOBA 1PJZA 4D3YA 1E2IA 1PSZA 1XO1A 3BIWA 3NASA 4JZKA 4KTTE 4IVPA 2HU5A 3S1LA 2RC6A 5EIHA 3Q0EA 3VJRA 1AHTH 4IKPA 4RL6A 1NRQH 4EO4A 3ATLA 2O9QA 1MW8X 2BGJA 1FDOA 4Q9DA 4XW2A 2FX3A 3IJ5A 4ILEA 4O6VA 1ACLA 2QTHA 5K99A 1R66A 2D1FA 5H70A 4E2FA 5EJIA 1JEDA 1ZGAA 1XMOB 1NW9B 1P9RA 3LZCA 4B6PA 2QM7A 3F3MA 1O5FH 3F4KA 4N0PA 1P18A 1OYTH 1F5SA 4Z1MA 4U30A 1R50A 4BB5A 1H6AA 2V5AA 3FHLA 2I7VA 2XF2A 5KQLA 1RYBA 1CUUA 2RGUA 3KM0A 5IUJC 4QYTA 2RI0A 4DL9A 1TL7C 4Q19A 5NULA 1TMKA 5K4GA 1G4HA 3UBTA 1EWRA 5K6AA 5SGAE 2LZJA 4IZHA 1TK3A 1JHXA 4YJ3A 2G07A 4KMOA 5ADUS 1O2KA 5I7WA 3FVTA 2A2QH 1A50B 2CNLA 4UEQA 3LCMA 1EVEA 4C0KA 4N48A 1QRRA 3W4KA 1RC1A 3F47A 2OXRA 4JASB 1K6MA 2PXCA 4FMPA 1VQ7B 1MAAA 4WH6A 2W2TA 5AJZA 3S2IA 1L5HB 1GCTB 3L6RA 4NU5A 5IHXA 2IV2X 1Y1SA 2A9QA 1J9GA 3LWNA 1VPDA 2ZIGA 1SKYE 4IQFA 2J46A 4DBLC 1SCIA 4MA4A 1W2KH 2OGTA 1PT5A 4EUKA 4ALJA 3JZMA 3LHSA 4P7KA 3TK6A 2WG1A 4BMOB 3G5AA 3ONDA 5K3BA 3X2FA 3M3HA 1PGQA 2EWWA 3TKLA 2VVTA 3GPLA 3CVWA 5KTRA 3COJA 2GK3A 1P8AA 4TYNA 3ZZTA 5DLQC 2XYPA 1FVHA 4NMHA 2NYAA 5KX5B 4B47A 4AZ3A 1XQXA 3FZDA 1VCHA 1UDAA 2B34A 5T3YA 5AW0A 4HQNA 4DIIH 5AVQA 2FPKA 2XUAA 2BDYA 3NHYA 4ISIH 1CA0B 1H9BA 2PHBA 1CV2A 2QRVB 3O2QB 4KR0A 2ECPA 4RHCA 1SC3A 4BEJA 4V38A 2Z1DA 2V3CC 3GELA 4KR3A 1R2QA 4WX2B 2HN9A 5IH3A 3RLIA 4NDNE 1GG6C 2UVPB 4O4IF 3DE0X 4F4FA 2V6JA 3C3JA 5AVUA 4MCAA 2IPNA 4F1WA 2G3YA 3MNBA 1PQUA 1YR6A 2WB2A 3WYBA 1JYFA 2PMFA 5CVCA 4TTJA 3N99A 3B6EA 5CDHA 3CE6A 3ZBUA 2TPIZ 1U02A 4IFBA 2V3HH 2PPVA 2R11A 2O6LA 3FYHA 3JQPA 4ZCSA 2WRZA 2G8TA 2ODPA 2EYUA 3K0KA 4PVDA 2VSXA 3TNDA 5FQOA 3J81A 3QXGA 2LNCA 3BSWA 4BFVA 3SNAA 4B2YA 4BQRA 3RR2A 2BJWA 5BW4A 2ZBEA 2GZAA 2GCOA 3L4BA 4KR9A 4ID3A 5FPKA 3V2GA 1Y9ZA 1K7XB 3COPA 1OREA 1O34A 2GHTA 3TOZA 3DMTA 4LQ4A 4XJTA 3V4ZA 3GEHA 1T9ZA 4Q1BA 4RTQA 4MYCA 5HJ5A 5AK5A