4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
b'HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MJ0495-LIKE PROTEIN
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
3FHOA 1DAGA 2EIXA 3WHLA 4FK8A 1JPNA 2PMDA 4ZIRB 2H18A 2VBCA 4DCUA 5F98A 3N2EA 1XEXA 2OTLB 2BF4A 2GVZC 2VA8A 4AKGA 221PA 4A4DA 5FFMA 2GPJA 3BK7A 4AI6A 1H85A 5CLQA 2F6RA 5L3SB 2BBTA 1ETUA 2VHQA 1CJUC 1E4VA 5IF9A 2OBNA 2J0QA 4GMDA 3ADBA 2N1BA 2YV5A 1NI3A 3U3JA 1QFJA 3RANA 4C7OA 1PZNA 3KTAA 2Q3MA 4YXWD 3BH7A 4IDQA 3TQCA 5CB8A 2GK6A 4RD2A 1HT2E 2BVNA 3SDZA 3EZFA 3QF4B 1UBCA 2VIIA 3GQBA 5CM8B 2NO7A 3CR8A 5GVRA 3ICEA 3SJBA 3ZZUA 5DSZA 4PC2A 4YALA 3PUVA 4RD4A 4AF6A 1W36C 5CK4A 1L4UA 1DAKA 1E1RA 4G0NA 3AVYA 5FBRB 3O8RA 5EUQB 4BWYA 2BCGY 4IRUB 2GRJA 2AN9A 5HXBA 1RVDA 4URVR 4NH0A 3NTUA 4URWR 2ORWA 2AFHE 2CXXA 4TQUS 3EZ2A 2ZS7A 2JJ1A 4DDVA 4UQOA 3CKLA 1R7RA 1YJNB 1XTKA 2QL6A 4OQFA 4YAWA 2VH5R 1KO8A 1YHQB 2H16A 1T0HB 2BJWA 4WOPA 3A1SA 1Z47A 1DTSA 2P3SA 3AVUA 2PLRA 3QKSA 4DZZA 4LV6A 2GJ8A 2X8AA 1P4SA 3B7GA 2HDNB 3ZYCA 2A5YB 5FTNA 2QA5A 1JI0A 1KDRA 2WOJA 1UDXA 2Q6TA 1YVDA 4IFBA 1MABB 1G3IA 1XBTA 1QFYA 1GIAA 1NJGA 5E7IA 2FSGA 3HU1A 1GG2A 1RJ9A 4XTCS 2O8DA 2RC5A 1N6PA 4D82A 1V43A 1FNMA 2EWWA 1D9ZA 2XJ9A 1U0LA 2WHXA 4L9SA 1XEWX 1D5CA 3BAFA 3AGQA 2JAQA 3B1YA 3W90A 1NMZA 1YZTA 4G5OA 3D31A 4LK2A 3FFBA 1BJKA 1NVVR 2PCJA 1IN5A 3U4QA 2O0HA 3KB2A 1Q81D 1AS0A 2FEMA 2RH5A 5KYKA 4IJMA 1CR0A 1GNQA 1S8FA 4UNQA 4TLDA 1G7SA 3HYTA 3GCGA 2R6HA 2V8OA 5J4LA 1EWYA 1QVFB 2QPAA 4BLSA 2GEVA 3NBZC 3TUIC 1Z28A 3CCSB 1IHUA 2GA8A 3BB3A 3UWOA 4MGIR 3PUXA 2QRNA 1GKUB 1GZSA 1E2NA 1ZIPA 2IHBA 1ZRHA 4LYAA 3X1XA 3L43A 2HF8A 1BO6A 1ZUNB 3X2SA 1Z63A 1FDRA 2HLDA 4NDZA 4CVNA 1FRQA 2IEYA 4C0SA 1IXRC 3CCEB 1ZCBA 3ZDQA 1E64A 2ZI3A 2RCNA 2ZS8A 4KFUA 1TQ2A 1RRGA 1FP7A 3EARA 1W4RA 3QENA 621PA 5KSWB 4OJKA 2W58A 5UKDA 1CEEA 1ZMXA 4Q48A 4N0EA 4TMZA 2R8RA 2I1QA 3LO5A 2WWXA 4EAQA 2VHUA 2AKYA 1OW3B 3QF7A 2JLUA 4XWOA 4N3GA 1TAGA 3EWSA 4JLAA 4LOAA 4RD6A 2CCGA 3GFPA 4NCHA 5FTLA 2F43A 3NC1C 4ZO4A 4Z54A 3QFSA 1UKVY 2IYYA 1RIFA 1W1WA 5E95A 4ZKDA 3KJHA 3R8CA 1S3SA 2CE7A 2IYVA 1IN6A 2AD1A 2PT7A 2D2EA 3H84A 1XD2B 2C9CA 2OG2A 2LP6A 4LJ9A 3ZVNA 2GZDA 3SQXA 4OHYA 1NKTA 4DXAA 1HUQA 3I62A 1YRAA 1FPMA 2QGNA 5IHPA 2JDID 3CXCB 2IW3A 1TADA 4IEEA 5FUYA 2ZI4A 2YNMA 4I1SA 1Z0AA 1T91A 2BBWA 1CXZA 1TU3A 1KI8A 3A4MA 3U6BA 1CS4C 2J0VA 1PUIA 3N5CA 4HLUC 1OH7A 2ZRHA 4NE2A 2C95A 4Y0VA 2IYLD 5BW8A 3T1QA 1I4DD 5K8UA 2ZYTX 1ZCAA 1ZC3A 1T5IA 4NCNA 2XOKD 4KVGA 5C18A 1G3UA 2W6JD 3IPYA 5H8WA 2VSXA 1WB9A 2XAUA 4DJTA 2XB4A 3SQWA 1P9RA 2VF8A 421PA 3W6PA 3HDTA 3UATA 3NHBA 2B7CA 1S3GA 1IM2A 2DWQA 2VP5A 4MA4A 2IXEA 2ONKA 1CNEA 2VL7A 2D2FA 4US2R 2GZAA 2FGJA 4PANA 3QOFA 2QAGC 1QHSA 1ZP6A 5K8IA 1FMJA 1C9KA 1W5SA 1KZ7B 2H8KA 3LLMA 1JA1A 3CC7B 5HPYB 4BLPA 2BV3A 3VNVA 2SHKA 4NMMA 2XNDA 4A9AA 4TTPA 4A15A 3RWOA 1S0UA 1KNXA 2Z0MA 4QNMA 2F1HA 3K0AA 2ASEA 3NH6A 1GRNA 5J5CA 2HCBA 1BOFA 3LBNA 3T35A 2QUZA 5JBQA 3O8BA 2D3WA 1KI6B 2XJ4A 1AIPA 4IVRA 1CR4A 4BPBA 5GJVC 2WJYA 4B33A 5AUOB 1LS6A 2QEQA 1JB9A 2ZE8A 3FB4A 5DI3A 3ZD7A 5CJ2A 4Y0AA 1Z0DA 2W6ID 3CWQA 2V9PA 3QXHA 2P67A 1TF2A 4DEXA 2QA4B 1HQYE 4JLBA 1FX0A 2HJVA 3CMEB 1BS1A 3CBQA 1N6LA 4IEIA 1GAJA 3RS2A 3SFZA 3IEVA 1AJEA 2C96A 3F5FA 4RY2A 2EYUA 4YMTA 2HXYA 3KQHA 1VKJA 2W6JA 1Q22A 3HR8A 1GILA 2CNDA 1SHZA 4ESVA 3FKSA 2F1RA 4B3FX 3LNCA 4B35A 2JASA 3HP1A 2VTKA 2D4HA 2NO9A 3GLFE 4HLUA 4YC7A 3NEJA 1PVOA 3TUJC 4DLRA 1A4RA 1KOFA 2VRWA 2Z4SA 2MSDB 4Y9UA 4Q9KA 5A4JA 3ECCA 1NVXQ 2DPXA 3PQCA 3BGWA 1W0JD 3LWNA 3UANA 3B85A 4DLWA 5JSZA 4S35A 2VLIA 2BN4A 4E07A 3GD7A 1AK2A 1DOAA 2CJWB 1T3LA 1F2TA 1UPTA 4YMWA 3U3RA 2Z4RA 4GZLA 4QM7A 3UWKA 3AVWA 2WAYA 4HB3A 5EE5B 4LPKA 2VP9A 3K9NA 3A6PC 1WQ1R 1UDWA 4US1R 4CDGA 3CPHA 4RZ3A 2RB4A 3KFVA 4BZQA 4LJ6A 2H5EA 2Y8EA 5KOYA 4DB2A 4YMUA 3VR3A 4ITRC 3CCLB 4QFMA 3EWAA 3AF1A 2J1LA 5KTYA 5AN9A 3BORA 3L0SA 4JBYA 1VYUA 3FMIA 1OXVA 2JJ8A 5J4VA 4AG5A 4EDHA 1II8B 2YWEA 3F3YA 4C4PA 1E3MA 4Q4AB 8OHMA 4BLRA 2ODBA 5EXSA 4DBLC 1CR1A 2FPMA 3VKGA 2NTYC 1KNQA 4KFRA 4Q9JA 4QOSA 1N5IA 4LUCA 1QRAA 4K8OA 2XGJA 1COWA 3C41J 4TSFD 4KAXA 5DN6A 5DYGA 2J0UA 2A3RA 1M34E 4EH1A 3VU9B 4V02A 1IB0A 1Q12A 3CM0A 4A8JC 1P3JA 4BQSA 4BEBA 1WBBA 1JR3E 5FBQB 4LPSA 1SM4A 1E9BA 2QN6A 2NZJA 3K0FA 3I5XA 2FFAA 2BPOA 2ZJ8A 2A5GA 2C03A 1CULC 3FPAA 5EE9A 1XU4A 2F3RA 1DVRA 5KSOA 2IF0A 4R7ZA 5FOVA 4URYR 1IONA 3BH0A 3LX5A 5BN4A 3OW2B 3RRYA 4B75A 3T15A 4DCNA 1TVCA 4HUQA 1NIPA 5FPHA 2WKQA 3PFIA 2ZRJA 5DIFA 2YC4C 2IK8A 1GNPA 4MUAA 2EFGA 2PCLA 4P4SA 2FX3A 1E0AA 1G7TA 5L3QB 3OJWA 3WYFA 4M8NE 3R7WA 4ARZB 5AUQA 4KU4A 4NU0A 1LF0A 5FUXA 4DKXA 4TL6A 3GLHB 1VHTA 4C9BA 4EKDA 1SVMA 2ZJ5A 2QGZA 2ZREA 2OM2A 2JLZA 5JJLA 2GXUA 2A5JA 3CRQA 1KZGB 4JLKA 1M74A 3EZ6A 4AYTA 3WRYC 1YZKA 1G291 2QT1A 5HCNA 3IPXA 4IXNA 4PFSA 1JR6A 1E2KA 1VHLA 1GUAA 1Z29A 2D7CA 2G6BA 2YZ2A 2G0TA 1Z8FA 2KJQA 2ZEJA 3C14C 3EIQA 4TWZA 4EJSB 2KSQA 2OBMA 4KFTA 1Z6AA 1E0SA 4X8OA 5IRCD 3R9WA 2C2HA 4GPTA 2AR7A 821PA 4F91B 1US8A 4LHWA 4ZI3A 4F38A 1Z0JA 2A5FA 4B2PA 3QPWA 4DQKA 4E09A 3BOSA 4MUBA 5C4MA 4S2EA 2WJVA 1R6BX 4LHZA 1XTQA 2CEAA 4BLQA 1IOZA 5HKKA 3QXJA 2TMKA 4M21A 1JQJC 5LDDC 4EQ6B 3H4MA 5JCZA 2QP4A 4Q21A 1EFUA 4A8JA 3FMOB 1GAQA 4BZXA 4ZDIA 3DEFA 2FWRA 1QVAA 4HI0E 3OFND 3BH6A 4NPHA 2A9KA 1XXHA 2OXCA 2ZJZA 3SJAA 3B82A 2WKRA 1E79A 4OBEA 2QE7A 5CYPA 5K8LA 3CC2B 4DSTA 2VEDA 2W2VA 3SU8A 4JJZA 2J9RA 4KV9A 1QHXA 121PA 2HCJB 1OFHA 3MWJA 4NKRA 3Q85A 1E2QA 1CJMA 3PUWA 2V6IA 4QHTA 2I3BA 3HYRA 1OYWA 1MH1A 3JZAA 5FOSA 4ACBA 3I61A 1HQCA 1GKYA 2IYTA 1EP2B 3C5HA 3OE7D 4LV5B 3FTQA 3GLGA 4ZI2A 3UPUA 3VNUA 2GZHA 1LFDB 3RDPA 4CYMA 3TH5A 2Q0HA 1IBRA 1QHHA 3I56B 3CCQB 1KHTA 3U44B 1GWNA 4DWJA 1QX4A 2F55A 2HMAA 4AF7A 3W2EA 3EW9A 5FR2A 1KMQA 3GJ7A 3IIJA 4KI0A 1EWRA 4RZXA 1J2JA 2D74A 1DAFA 4BECA 3AP2A 4Z8XA 1WCV1 1C1YA 1WF3A 4ILEA 1SQ5A 1A7JA 4A82A 2PL3A 2WWHA 5G3ZA 1Z22A 4WIAA 2CHQA 5AUPB 5AJVB 2FV8A 2JLYA 4FCVA 1OIVA 4Q4JB 4UNSA 1TPZA 1JB1A 2GCPA 2QSYA 5D3MB 2O8EA 2Z5FA 4DEYA 1DG1G 2VNHA 5JRJA 2GCOA 5G53C 5BYJA 2RGBA 3IGFA 5ANRB 2NGRA 3B1WA 1S4QA 4OK6A 4D0NA 2Z43A 3QVVA 1KI1A 1YR8A 3KJEA 4M1SA 1NN1A 1D8TA 5JHHB 2QENA 3VHLB 1Q1BA 2WSSA 2PZFA 2AD5A 4I99A 1XEXB 4DIEA 3GJ5A 2PLFA 2Q9CA 2V7QA 2FF7A 3DL0A 4QJ5A 3LAWA 5SZIA 3UIEA 3TQFA 2DBYA 2QP3A 3K0CC 2ZSDA 4JYBA 2BIFA 4Z1MA 4LJAA 4Q00A 2BJVA 4A1FA 2GAOA 2CL7X 2OK7A 4C7OB 3KTAB 4F4IA 1CU1A 4M1MA 1OFIA 3K9GA 2GWHA 1S2MA 4F7DA 2E9SA 3THXA 1M6NA 2FSFA 4ASUD 2EYQA 2WJGA 4NHOA 3WNCA 1X8LA 4MYTA 1OHHD 5HCIA 3THWA 4PR0A 3BE4A 1M1YE 3KZ1E 4DVGA 3L0IB 3RS3A 3IKJA 1ZJ6A 4IOJA 5G41A 1E9AA 1N0VC 1QFZA 1UMKA 2REOA 5F9HA 3CX7A 4NYJR 4G3XA 4IOKA 2ZSEA 4PPQA 1JR3D 1GAWA 5E4FA 1TU4A 4TLBA 2JLWA 3VR6A 1CKEA 2IYSA 1OKKD 2FSHA 4RSGA 1VIYA 2UVQA 2GAAA 2ZE7A 1RRPA 1OB5A 1I4LD 1SXJE 3IEUA 4M22A 3TMKA 2ZJBA 3AUXA 4FMDF 3M0EA 4DUGD 1GRRA 2O0KA 4OI4A 2J7PA 5FTKA 3GJ0A 3QKSB 3LRPA 2R2AA 4HZUA 4PAQA 4LBYA 5TR9A 1G41A 4R2IA 4MKIA 1ZD8A 2V1UA 3WMGA 1VQKB 4TYPA 1KO5A 3CNLA 3KB1A 2E1RA 4LYFA 1FNCA 1RRFA 2RGNA 2WICA 1RJ9B 1Z2CA 2O8DB 5JI3E 1NP6A 2DWOA 4WA7A 1B0UA 1BMFD 1HV8A 1XNJA 3PVSA 3VR2A 4NCIA 1OH8A 3PENA 4B74A 3OAAA 4ASUA 1SVIA 3IQXA 2IYZA 3AF4A 1OHHA 1BH2A 1W0KD 3P32A 4R2HA 3AV0B 2C77A 4KHZA 3U4QB 4KXFB 1FUUA 4WZAE 2ZRBA 3ADCA 1FTNA 2WMOB 2YKGA 1WBDA 2XEXA 1ZIOA 4P4UA 1X86B 4LX0A 5FL7D 1SVWA 4M9SA 1VTKA 2VHTA 2F7SA 2YOGA 3GLIA 2MMGA 1FNBA 2OCPA 3NDBB 5AUNB 2LCFA 1JR3A 1A2BA 2JJ2A 4D0LB 5GJCA 4M2LA 5FR1A 4AKEA 1VCNA 2YINC 3EXAA 4GOJA 5CJPA 5CITA 4Q19A 1AMOA 1KJWA 2EFHB 4JLNA 4Q7LA 2GETA 3DKVA 4Q02A 1J8MF 5DLQC 1F6BA 3RS4A 3K70B 4FMCB 1Z6YA 4IXMA 4PO1A 5H70A 3EPHA 1RW4A 3D3QA 5BN5A 1ZD1A 1IXZA 3EA5A 3AKDA 5JJIA 3T1OA 2VYQA 2O8CA 1OLOA 1VQ8B 4CW7A 5E7JA 1RC8A 1N6OA 1U90A 1MKYA 3PJRA 3FMFA 1HE1C 4B6FA 3CLVA 2OFOA 1SKYB 4HYYA 1VQ7B 4OL0A 2QT0A 2ZAOA 1LW7A 1J9ZA 4YHBA 1N6KA 2WBLC 2PZEA 2CK3D 3RC3A 3VQTA 2C99A 3MWYW 3WMFA 2F43B 5FPSA 4POAA 3Q9LA 1W0KA 4FWTA 3NWJA 3RNLA 1TL7C 5B30A 4JBWA 4BE7B 4UAJA 1AS3A 4LJYA 5FL7A 1E96A 3K0EA 2JEOA 4XIGS 3RHFA 4Q4HA 3A4LA 4O25A 3GMTA 2JLRA 2ZRIA 3D6TB 1QG4A 3CC4B 3L82B 1G18A 2ZYVX 3CUEF 4HAUA 3MG9A 1Q0UA 4B44A 4PPFA 1U8AA 4QNRA 3SOPA 1HTWA 4PX9A 2H92A 1QGAA 1CLUA 1XMVA 3NBXX 3KQNA 3CD6B 1P2TA 4FIDA 2J5XA 4TL9A 2FFQA 1NY5A 1P5ZB 4LV8B 1EFTA 1P60A 1U9IA 1EXMA 2YWGA 3PITA 3R20A 5CDFA 4LJ7A 1OGIA 1E4YA 1G17A 2WPDD 2ZU0C 1NLZA 4BEJA 4QBFA 4C0KA 1OIXA 1DE0A 2CL6X 1NSFA 4DLTA 4WQMA 4NL4H 5DNYB 4CEJA 1UM8A 4NP6A 2FGKA 3RS7A 4JLMA 1UBGA 4N1AA 5DO9A 2G3YA 3VHXA 3N2IA 4PHHA 4JL5A 4DRZA 2ERYA 1YZLA 3LD9A 1RFLA 3W2HA 4GNKA 1A8PA 1EFRA 4PSAA 3C4JA 3B1ZA 3A1UA 4IDOA 4EPYA 3OEEA 2ZR0A 3CRVA 2G1JA 3KX2A 1G16A 4V0OA 1TNDA 5C46F 2FMXA 2AFIE 3K0AB 3WMEA 1NG9A 2EW1A 4WXRA 1WRBA 3SBDA 2CHVA 1BIFA 1KO1A 1T6NA 2CNWD 3THYA 2RGDA 3W5IA 4KSBA 4M4SA 4WBSA 4GL2A 1T0JB 3IQWA 3SS8A 1XCMA 1IN4A 1E2JA 3MMPA 1O3YA 2JIZA 3C16C 3DHWC 3NVAA 4HB4A 3E70C 4DLYA 5FUWA 3THOA 2P65A 3QSYA 4CEIA 3BIFA 3OZWA 1Q82D 3CCRB 2VHCA 4A2PA 1ZM2A 5LPNA 3P20A 1R5OA 3HPRA 4G5QA 3RRNA 2C8VA 4YAOA 1E9FA 3CPEA 2VZLA 3G5UA 3N70A 5G3YA 4URZR 1FX0B 3TBKA 1TTTA 4QBIA 4YDSA 3CW2A 4GOXA 2YOHA 3S1AA 3I72A 3Q8XB 1SXJC 3QG1A 4NYIQ 3T61A 2BC9A 2DCUA 4AWXA 2H17A 3VO1A 4ZV4A 5TY0A 1M8PA 2B92A 3MRSA 3MWKA 4X8MA 4DQLA 4LZZA 4TLEA 4YXWA 1W35A 4Q18A 1G7CA 1B23P 4XVRA 1Z3IX 1KSFX 4Q9IA 2CLCX 4IHQA 1SXJD 4AYXA 3UKDA 4RKFA 3E5HA 5JSZB 3W3ZB 4LBWA 3TVTA 4DSUA 2BCJQ 3CCMB 4FN5A 4A2QA 4ZKEA 1CBUA 2J3EA 4M9QA 4QHSA 4DSOA 1F2TB 2CVHA 1J7KA 4TMTA 3I92A 5KDOA 2CCKA 1L4YA 4W5JA 1AZSC 2F9MA 3BC1A 4TT3D 3NH9A 1P61B 4JLPA 2IXGA 4PQYA 5P21A 1F60A 3G0HA 3LQQA 2BM1A 3SR0A 5JLJA 1Q21A 1E2FA 1Y3AA 4GMXA 2OFXA 3WBJA 1VPLA 3SHWA 3C15C 3TR0A 3OEHD 2ZRDA 2ZXUA 1KYIA 2AWOA 1JXMA 3L0OA 2YWFA 1O87A 3CO5A 5BN3A 1R5NA 1N6HA 2Q9BA 1X6VA 4B2LA 3LFUA 2R6AA 1KSJA 3T1TA 1G3MA 4RZUA 3CCUB 1MRNA 4D2IA 1OV4A 3KQUA 1CNFA 4P0TA 2RGCA 3QFCA 5FOUA 3UG7A 2IS1A 2VP4A 1GKIA 3DVLA 1P62B 3H86A 2JLQA 1VQNB 2BOVA 2O0JA 3I73A 2XTNA 4D0GA 1DEKA 1E2EA 2WJJA 2WWWA 3K0FB 4NYMQ 2DFNA 4JZKA 1YJ5A 4B76A 5JECA 1XJQA 1VG9B 2GQFA 1FOEB 2B21A 2MSCB 4OKSA 4PPNA 3VR1A 2AKAB 2GESA 3DZDA 5FA6A 2J46A 4BUJA 4D80A 4XWKA 4OJQA 1NJFA 3KFXA 4PSVA 2ZUBA 3K9LA 1EGAA 1CRQA 2VP6A 4JVLA 4HUQB 2IYUA 4OK5A 5FOXA 2PZGA 2OZEA 3OESA 3V4RA 1U2RA 3CCVB 2RGXA 4P4SB 1NMYA 4J0QA 3GFTA 4OYHA 3AF3A 1Q44A 1SKQA 2BDTA 2IS4A 2O8FA 3R7WB 4UJ3A 1NDHA 1E2PA 1Y63A 4YAFA 1NY6A 2NMVA 4EIWA 1T8UA 2C9OA 1KJYA 3TIFA 2ODEA 1N0WA 1K5GA 4PQRA 1SVSA 3A4NA 1OF1A 2IA5A 3OIVA 1JJ7A 4FINA 4F93B 1E9CA 3GEHA 1WMSA 1F20A 3IIKA 3KQKA 3GEIA 2HF9A 3ZVLA 4L15A 2QMEA 3W2FA 4XJXA 3I3SR 3EPJA 1TF5A 3LX8A 1PV4A 1N8RD 3JQQA 3DM9B 1P72A 4UXHA 2VSFA 1OFTA 3CF0A 2L0XA 2C5LA 4MH0R 2FJUA 1E6CA 4R9UC 1US8B 1XTIA 1JECA 3OJXA 1Z5ZA 2GJSA 4EPVA 3BBPA 5L3SA 1J90A 2W0SA 4DDWA 2OSBA 4I4LA 2H1LA 1NBME 4LC0A 2GJKA 4I1OA 4I81A 2XZOA 1FNDA 2ORVA 2ZYWX 4XH9B 4LRWA 1YE8A 4A8JB 1W48A 2BBSA 2LKCA 3W6NA 1XXHB 3KKMA 3CZPA 4I1VA 4RD3A 3E2IA 1XPRA 3RVBA 4JVNA 4KODA 4D26A 2JDIA 2DHRA 3L8ZA 4BFWA 5KU1A 1XZQA 2A2ZA 4OHVA 1JXOA 1ZUHA 4EFLA 1G21E 3K53A 5CM9C 4B47A 4JJKA 2XB2A 4A2WA 3GFOA 4X8LA 1M90D 4AYWA 2XOKA 1HA3A 5FOWA 3CZQA 3GLGB 5JWOA 4OQLA 1QHHB 2FPLA 3NBFA 4RFVA 1R0WA 5KSZA 1V5WA 3F8TA 3GEEA 4AD8A 4ZCIA 4HAWA 4TZ6A 4MDFA 1G3QA 3BXZA 4HATA 3I8SA 4O2RA 1GO2A 3EC1A 5L3VA 4WAUA 1K8RA 4K81B 2ZRMA 4M53A 1F3OA 1QGZA 3O8DA 3JVUA 3K8YA 1MO3A 4ZDJA 3AKYA 3KUDA 2QROA 4DDUA 2QQEA 5J4YA 2BMJA 4IVPA 3W2IA 1JPJA 1KI7A 2H7VA 2XTMA 2GBLC 5HE9A 3VFDA 2MSEB 1JNYA 2ZE6A 2PEYA 1P75A 2PBRA 2GEUA 1DAHA 2QAGA 2ZQ5A 3PEVA 4MYUA 3GLHE 4U9UA 2WJIA 2O8EB 2PMKA 2X77A 4JLJA 3DZ8A 2QPOA 3F0TA 1D2NA 1MO4A 4EFNA 2WM9B 2GCOB 3QBTA 1TLLA 3SBEA 3SYKA 2W6IA 2WVJA 4MQBA 3LO8A 4TYNA 4FCWA 4Z8YA 1ZNXA 3CRRA 1G3RA 2X19A 2YVUA 1DPFA 4DT1A 2GK7A 3MUFA 2CBZA 4QBGB 3EX7C 1KQSB 5KNDA 2ZSAA 2XSZD 1Z0FA 1QUEA 5DGXA 3VKHA 2GF0A 1E0JA 1NVUQ 521PA 3JQPA 4LYJA 1M7BA 2GNOA 2XZLA 4HE5A 1XF9A 3X1YA 3P4XA 2GEDA 1ANKA 3U3OA 1W0JA 3HR7A 5EQTA 3REFA 4EFMA 2W2TA 4N0DA 3PXGA 4G1VA 4BFTA 3HJNA 1ZNWA 3THXB 3H0KA 2VPPA 4C3ZA 2GJ9A 2GILA 3MLEA 1Z08A 4B48A 1ZYUA 4HE6A 3THWB 1SVOA 4KCGA 1KMHA 3ZIAD 2AXPA 1OXXK 4Q01A 3DMNA 4C30A 3NBYC 5KNCA 1GITA 4FD2A 3LW8A 4RD1A 2WSMA 1G64A 3RWMB 2XITA 5JRZA 4C2TA 2NZ8A 5EJEA 2GBLA 1TX4B 4KFSA 4YMVA 1WXQA 4MGKR 4RFSB 2Q3FA 5F3WB 2HUPA 1FW6A 1OPXA 3KKPA 2BKEA 4RVCA 4E5UA 2HT1A 1IXSB 2IHYA 1IN8A 1H8ED 2PT5A 2ZR9A 4US0R 1OJLA 3OIYA 2O8BA 1LTQA 2C78A 2V55B 1S1MA 5DHFA 4YONB 3AVXA 2ZTSA 4TSFA 4XTRA 3K09C 4HZUB 4HDOB 5HTKA 3RSLA 4ZGQB 1N5LA 5GVSA 3UG6A 3VO2A 4O3MA 2EFDB 3GJXC 1DAIA 2B5OA 2G83A 3AVPA 1G1MA 3WXMA 2VP2A 4G01B 1H8HD 1UADA 3EZ9A 4NCKA 3ZVRA 3TW4A 1W4BA 4KBFA 3I8XA 1ZU4A 5EE1A 5TMPA 2ZI7A 3U7HB 4YMSA 4AURA 5TB5A 5LD2B 1Z0KA 2EFEB 5JWRA 3U5ZB 4PHTA 4UNRA 2GTPA 2HYIC 1KI9A 4H9GA 1II9A 1XZPA 1X1SA 3IBGA 3LY5A 3LA6A 4PPGA 2V6JA 3CWZA 3WNDA 1BYUA 2DYKA 4MRNA 3W8RA 2WJHA 2OILA 3CIOA 3SYNA 4D25A 4JBXA 3GLIB 4OI2A 4PHGA 1L7VC 1Q7YD 4TL7A 1RYHA 4GP7A 3VR5A 3WYGA 1CTQA 2G77B 4ZCMA 1NBMD 3LVQE 4UXIA 2R6GA 4PAOA 4WXPA 1T8TA 2CLDX 5L8VA 5KHOC 2G9NA 5GJBA 4M1KA 1HE8B 4OI0A 3UMRA 2QQ0A 4CEHA 2QDXA 1W4CA 4QKQA 4U7DA 5CLLA 1GVNB 3HWSA 5JWHA 5EP1A 2Z83A 4JLVA 5EE0A 4H1VA 4B3CA 4EPRA 5EUMA 2O8CB 1XB2A 3D8BA 3FWYA 1RRCA 4Q47A 2IXFA 4HLQB 4NCJA 3RYTC 4QC2A 1SVKA 3R9XA 3MCAA 1MR3F 4LHXA 1GL7A 3ZS9A 1G5PA 2OESA 5JI2E 3WYAA 3PUZA 2BGIA 2LKDA 3NG1A 3U60B 1NN0A 1IY2A 2DY1A 1E2IA 3DKPA 3OFNA 1XTJA 1M7HA 4BFXA 2KE5A 1JJ2B 2O5VA 1ZNYA 1R2QA 1XMIA 4HDQB 2V1XA 5E7MA 4CZ2A 4IW3B 2P0EA 2IL1A 2ZANA 1JEEA 3FDIA 2CCJA 1TQDA 1YZGA 5EMNA 5G40A 2JATA 4A0RA 3V9PA 3CRZA 3TGPA 2ZETA 5A0FA 4JLOA 1TQ6A 3ICQB 1XP8A 5L3RA 3KQLA 2R6FA 1NG1A 2F9LA 3NDPA 5FPTA 1HEIA 1EP3B 2BM0A 3U7FB 3GP8A 3OE7A 1QGYA 1NBMA 1YQTA 3P4YA 4UNPA 3ZQJA 4P6VF 5BYKA 2FOLA 3AQ4A 5JFGA 2IWHA 5FUVA 4A0FA 4TMVA 2XXAA 5JMTA 1FL9A 3GJ8A 1FMLA 1R8QA 1D6JA 2AX4A 5F2EA 3QEJA 5LBIA 3U7GA 2ZITA 4CT4B 3CX8A 1CJVC 1SGWA 3QFRA 5CK5A 3MJRA 4D4KA 2G0NA 1ZM9A 1E2LA 2R62A 3CRMA 3X1WA 4CEJB 2OLJA 3DPUA 3C8UA 4D4JA 3KUCA 1QZXA 1NKSA 1Z07A 2IUSA 2EQBA 4XVQA 2YOFA 5B2ZA 4JMPA 3B78A 2DFLA 1E1QD 1Q57A 3VU9A 5DE3A 1H42A 1AQUA 1OSNA 2QI9C 5SZHB 2R9VA 4OHZA 4QG7A 1BX0A 2IYWA 2WOOA 2CRVA 4Y9RA 3T34A 5DYIA 2W0MA 4LHVA 1WDTA 3GLFA 4HAZA 3RAPR 4KLNA 2NPIA 2ZS9A 4MKHA 3Q7PA 3TSZA 2FH5B 4YQFA 3SN6A 1GOTA 3X1DA 3FKQA 1F2UA 5IK2D 2OHFA 5B58C 2HJGA 3FYHA 4CEIB 3I1FA 3K1JA 2CDNA 4BLTA 3E1YE 1JBKA 2GVDC 2NQ2C 5TVKA 5L3QA 3B9QA 2WTUA 1UF9A 4QGFA 3VX3A 3U3MA 2ATVA 4KJZA 2ONJA 3PCRB 3NC0C 3S1AB 3EASA 4B71A 3AEZA 1AGRA 5H5JA 2C9YA 1IJFA 1SKYE 3BFXA 4NTZA 5HZHA 2PJRA 2HYDA 2VP0A 3GLHA 3CCJB 4Q7MB 2RAPA 3TAHA 1Q1QA 4JVSB 3U7EB 3WBKA 1UBEA 1VQLB 3UXMA 4AC9A 4MGYR 5TARA 1DARA 2Q3HA 1CF4A 3WRXC 1OFUX 4HUTA 3OZUA 3CF2A 4TYWA 1KY3A 4IDNA 2V3CC 1I2DA 3K0CA 1L2TA 1QVRA 4F4JA 3WY9A 4FW9A 1XEFA 4ZPXA 4HAVA 3TW8B 4C0LA 1E1QA 1ESNA 3CPJB 4M0LA 4FMCF 4TZ0A 4YLGA 4DLZA 2A30A 1UKEA 1QHNA 3LH5A 3LQRA 4LJ8A 4OQNA 4Z51A 3AGPA 1PJRA 1OGJA 2RHDA 4PO8A 1G4UR 4W7SA 5TXGA 3CRW1 3B9PA 3CMAB 4TQAA 1UAAA 4TLCA 1AN0A 1TF7A 1N3BA 1DS6A 1KAGA 1G4AE 2Q9AA 3AVOA 3B8HA 2ZR7A 4FMDB 4Q1DA 5JCPA 1NMXA 1OKKA 5AJZA 4BRUA 5IT5A 1W36B 3ZBUA 1OB2A 4C43A 2OT3B 4IDPA 3MD0A 4A6XA 2IUUA 1XD9A 2ZI9A 2AK2A 2PH1A 5BXQC 1FP6A 4DUGA 2QBYA 2W83A 1Z0IA 2IYQA 2WKPA 3ZH9B 1A1VA 4GBMA 1ONBA 1E98A 1DELA 1QHYA 4B3BA 1G8YA 1W2HA 3VTKA 4F4CA 5KO2A 4XD7D 3TUZC 1SULA 2AWNA 2Z6VA 5ELXA 3CNNA 3OIUA 2ZRPA 1IJEA 3REGA 3FGNA 5A5GA 4XSGA 3KXLA 1T3HA 721PA 2OAQ1 1G6HA 3TRFA 3FVQA 4Q9HA 3CF6R 1P6XA 2ZAMA 1BMFA 2HXSA 2FU5C 1UEIA 3U44A 4LSGA 2IEZA 2AXNA 3DMDA 1L8QA 3CNOA 1W47A 2ZJYA 3LBHA 1Q3TA 2D7DA 4JSTA 5FPKA 1AGPA 5EE3A 1OH6A 2IBMA 4WZBE 2ZROA 2REBA 3UMSA 1IY0A 4AIIA 4B32A 1K8AD 1N5KA 1XRJA 2IX3A 1EWQA 2WIAA 1WA5A 1RZ3A 3BERA 1E94E 1W44A 1ESMA 1LV7A 2YJTD 1DDGA 5FTMA 1AKYA 1HYQA 3LVRE 2QM7A 1EK0A 1P9WA 1OXUA 2GF9A 4OQMA 2O8FB 4Q03A 4NZYA 3V4FA 2ZRKA 3PV0A 2OE2A 3SC3A 1E1RD 2DFKB 1NN3A 2ZVQX 4QXAA 5JZVA 3AUYA 2FSIA 2OO7A 5KUTA 1YZUA 4M9ZA 1ZM4A 2JJ1D 1YR6A 2XX3A 1B2RA 3DDCA 3B1VA 4JKYA 4PQFA 4UXJA 3ZZTA 1AQYA 1NVWQ 2H57A 4MYHA 4ON9A 4C0AC 3IIMA 1G9XA 1X3SA 3IDQA 3OHMA 3MWLA 4KYIB 4PSKA 4NONA 2XZPA 1NVVQ 1KK0A 3B13B 2R44A 5KDLA 1EX6A 3A1WA 1XJCA 1I7PA 1A5TA 4LCBA 1NNEA 2CLSA 5JEEA 2JGNA 1KKMA 2ECKA 2CK3A 4G1BA 5K8TA 3QKTA 2JA1A 3TE6A 2FE4A 4D4MA 4ABYA 1N6NA 1HT1E 5J47A 2IS6A 2MMCA 1BQEA 3W5UA 4UNNA 3Q7QA 5HR5A 4DLXA 3RS5A 3QE0A 4QBHA 2P6NA 4UJ5A 5EZ6B 4HDCA 4PZZA 2IWRA 4Q1BA 1UKZA 3QXXA 4WVFA 4URUR 3OZXA 3TK1A 1DO2A 3AM1A 4V0KA 5DI3B 4JIMA 2ZE5A 3V00A 1E2DA 1R0XA 1D2MA 4LDJA 2QTZA 4FCTA 5FBWB 3V76A 1VECA 3IUYA 3W8NA 1XPUA 3RABA 3ASZA 4QJ3A 1VQ9B 5FPYA 2J59A 4QGHA 1CR2A 3QFTA 1NIJA 1TQ4A 4PXAA 4U5XA 2QZ4A 1E2HA 1YJ9B 3SFVA 4FMBB 3K70C 2NO6A 4PO9A 1FUKA 2V4ZA 3EA0A 3M4YA 1VYTA 2C98A 3P27A 4MYCA 4YDHB 2D62A 4JL6A 1VCMA 1XCGB 4BFZA 4MRVA 4CIDA 2WPDA 4Q1FA 1W36D 4C2UA 4KO8A 4DSNA 1HY3A 1IY1A 3BB1A 1GDDA 3ZZ0A 1U0HC 4LI0A 1D9XA 1U0JA 1E2GA 3LLUA 3K70D 4UKDA 2HLDD 4O0MA 2ZVPX 1XX6A 2DEUA 4MDEA 2GKSA 1GRQA 2NO0A 2OCYC 3LBIA 4FWIB 4K1XA 2CHGA 2VHJA 4HB2A 2QTLA 4B3XA 1E9EA 1QHGA 5THXA 2AHOA 1NF3A 3FFAA 2R65A 4DIDA 2WWGA 1GL6A 2UZ3A 4Q5IA 5AR1A 5HZKA 1OXTA 3IHLA 1QBKC 3LXXA 3P26A 1MRSA 1ODFA 2QAGB 4W5WA 1AA9A 1P2UA 2CNWA 3W5VA 2FZLA 3KXKA 1CQXA 4RCZA 4GFDA 3JVVA 4W5HA 2G1KA 4LWZA 2I4IA 3A8TA 5B64A 5BWMA 3GJ3A 2VO1A 2OXRA 3QXCA 4GT1A 4OQXA 4ZDWA 3SNHA 3BFKA 4B43A 1W49A 1KSGA 3VR4A 5KPJA 4F7WA 3RC8A 2F3TA 2PEZA 4DT1B 4G1UC 2PJZA 1LY1A 4WZ6A 3QKRA 4XOIA 5DI9A 3ZLJA 3L2OB 3W5JA 4Y7CA 1ZU5A 4BPRA 1KAOA 1TEXA 3QUSA 2J0UB 3A1TA 2R6CA 3VAAA 1R0ZA 2AL7A 2VNIA 2BMEA 2ZUCA 1DO0A 5KSPA 4DHEA 4DC9A 1NRJB 2J87A 3JZMA 4V0ME 2QAJA 3HU3A 2GXQA 4C0JA 1DDIA 4QRHA 5BQ5A 4P3YA 2OCBA 1X1RA 2YYZA 1K73D 1SXJA 2ZYUX 4IKEA 2QPTA 5GJWC 5C1BA 4KLZA 2E87A 3W34A 2ZSBA 5JS8A 5SZKB 3FMPB 1T3SA 1XXHE 2B8WA 3OF5A 3Q72A 4BZPA 2XNJA 2IYRA 4MITA 3SI7A 4B6EA 3MSXA 3LXRA 1KTVA 4NYIR 1VYVA 1UEJA 3K0SA 1ELOA 4XSHA 1KMHB 4RJLA 3NEYA 2GDJA 4JYCA 1MOZA 3IHWA 4TT3A 1YR7A 2K5UA 1QUFA 3QE2A 1KI2A 1ZUIA 3NHAA 3MHPA 4PHFA 3IO5A 3RLFA 4AG6A 4B4DA 3CPWB 4PC3A 2OK8A 2XNDD 1BYIA 2RMKA 2OBLA 1TUIA 3OEHA 3GLGE 1N2CE 3VX4A 3CX6A 4LC1A 1GJRA 1N6RA 3L8YA 4ZGNB 1XMSA 3QXSA 2PIAA 1TUEA 3ZS8A 5J4HA 3O47A 4TYQA 2QTHA 3ZJYA 3JQRA 4EPXA 4D4LA 3OZVA 2CE2X 3G4SB 1E99A 1IQPA 1R4AA 1VQ5B 2JLXA 1YHNA 2BGJA 1A2KC 4PZLA 5FOTA 1YZNA 3WHKA 2O8BB 1MV5A 1C4OA 2OV2A 3AF2A 1RKBA 4OK3A 4DCSA 3MFYA 2NO1A 4P32A 2ZRGA 5EXXA 2GXAA 4Q1AA 3DOEA 4TN1A 4IVQA 4L9WA 4W9MC 1E62A 1YU9A 4BFVA 4ZIRA 4PGOA 4PC6A 4YAUA 3TJZA 2BEKA 3ONWA 2G88A 1JAIA 1EESA 1R8SA 3EAQA 2IUTA 2FZ4A 2ZRNA 3NKVA 5TV2A 2F1IA 1Q86D 3FKSD 2RGGA 3ES9A 1SVLA 3Q5DA 5FH9A 3CR7A 3ZD6A 1KC8D 4LJ4A 5DH9A 1Z6GA 5KSYA 2ZPTX 1N5JA 4QJ4A 3QVUA 3QF4A 2QU8A 1KRHA 2AK3A 4JL8A 1ZBDA 4KITB 2EU8A 1GSIA 1Q1EA 1XD8A 2QTVB 3AP3A 1GM5A 3RRZA 3KL4A 1VG0B 2R6DA 1OT3A 4B3DA 3I5YA 1T9HA 4NYMR 5LB2A 2IC5A 1LVGA 4GDFA 3W9YA 3FPKA 5F9FA 1W4AA 1CIPA 1YITB 1W2BB 2KB0A 4CT5A 1CJTC 2VYFA 3A1VA 3PEUA 1SQRA 1YRBA 2RC6A 2YHSA 4DB4A 3ADDA 1ZC4A 4G5RA 4FI3C 2IYXA 3KDSE 4RZ2A 1KDTA 4WW0A 4CEHB 1HH4A 1VIAA 1VQMB 3ADKA 4IDHA 2BBOA 4TTRA 1GNRA 1XDBA 4TYYA 1KY2A 3PEYA 2NIPA 4HSEA 4DLUA 1G8PA 1J99A 3U6KA 3TAUA 2VNKA 5AJWA 3QBVA 4QGAA 1COWD 2QG6A 2VQSA 3ZC3A 1KO7A 4XVUA 4FXPA 1MABA 5DN6D 3UK6A 4QGGA 2LWIA 4U02A 1Z06A 3AVTA 3KJIA 2WWYA 4RD0A 4Q7KA 1AKEA 2DFTA 3TR5A 3UMFA 1KIMA 3LV8A 3U2QA 4M1TA 3ZQ6A 1VG1A 4LBZA 1K9MD 1KDPA 3IBYA 2FG5A 2X2FA 4HZIA 1S96A 4JT2A 3G71B 3SJCA 2I1VB 2IF2A 3C5CA 4CGZA 2KWIA 5JS7A 1LF5A 1LB1B 1P2SA 5LB4A 4IFEA 2WWIA 1XTRA 5JEDA 1VQ4B 1KO4A 1KK3A 4Q1CA 1XPOA 2P6UA 1J70A 4ACAA 2WIBA 2ZUDA 4G5GA 2OUKA 4GI7A 4JLDA 4B2IA 1F48A 2GCNA 3D7MA 1E9SA 2ANBA 4BASA 3QPUA 4DDTA 1T5LA 5KPDA 3LVBA 2ANCA 2X3UA 3AF0A 4F92B 1GVHA 3KKQA 1QDEA 2J45A 2XXAB 2N42A 1DBSA 3SEAA 3CH4B 1EX7A 3BD9A 1G8GA 3W3AA 1W87A 1P73A 3QG5A 2Q21A 1FTSA 1K6MA 2GHIA 1LS1A 5H59A 1KDOA 4O2LA 1JQLB 4JT4A 2WV9A 4OHXA 5C4GB 3FE2A 3BFVA 4LHYA 2HV8A 1D1NA 3SJZA 4I1UA 3SHFA 3ND9A 1TEVA 4E22A 2BHRA 4LJ5A 1YIJB 1M1KD 3E1SA 3AKEA 1N6IA 5D3QA 1R0YA 3GLIE 3ZBTA 2QRZA 1NJID 4MGZR 2HEIA 3RSOA 1E63A 1RPZA 1SZPA 4C0BA 1UJ2A 5DISB 1ZD9A 3M6AA 2UKDA 1E0KA 1Q3HA 5AJYA 2PX3A 4HEJA 3GLFB 5HKKD 3MJHA 3O8CA 2J41A 4TL8A 2ORIA 3AH8A 4BFYA 5EXPA 2WZQA 2P2LA 2KI5A 2OEPA 3H1TA 4R98A 1NLFA 2QTFA 1U94A 1F2UB 3PR1A 4Q9LA 1OIWA 1XD2A 2ZRFA 2ZU6A 1JA0A 1U8YA 2B8TA 1E79D 4ZCLA 4MRSA 2QE7D 3QY0A 2EVWX 2EWVA 1P9NA 4PTLA 4KVAA 3CB4A 1FQKA 5H1YA 1QH0A 1G5RA 3MGCA 2XSZA 4KBGA 1DG3A 1R10A 5B57C 3FHCB 4JS0A 1E32A 4G5SA 3GJ6A 1RYFA 3W5HA 2ERXA 2FN4A 2P6RA 3WNBA 1G6OA 2JCSA 2REXB 1XFAA 2QORA 3SYLA 1OE0A 1PLJA 1Z6XA 3SE0A 4NBSA 3QPVA 1KI4A 2VNJA 1BX1A 3PG5A 2WMNB 5JHGB 5J4KA 4AK9A 4B3GA 4OHWA 4DLSA 1M7GA 4BGDA 2FEOA 6Q21A 2BMWA 1E69A 5FI0B 1XWIA 4BFSA 5EP4A 2X2EA 1FRNA 1G5TA 1E9RA 3C7KA 4ESHA 3T12A 1S1CA 1MO5A 3GJ4A 3ZIAA 3M1IA 2PX0A 3CH5A 5FBVB 2FNAA 1J8YF 3TSWA 2CL0X 2XNSA 4MRPA 3RRMA 1H65A 3IO3A 4A36A 1VQOB 2A78A 4AKIA 4V0MA 2JLVA 5AK0A 3BWDD 3RS0A 1QHIA 1EP1B 1PUJA 3A37A 3A36A 1VG8A 1ZAKA 3SZRA 3TKLA 4AKHA 2GXSA 3H2YA 2ZJOA 4IOLA 1VDZA 3ZGXA 5CDFE 1KGDA 1KI6A 1QF9A 2QY9A 4A6PA 2NG1A 2QSZA 1H8EA 2QBYB 4TLAA 1CJKC 1DAMA 5M04A 3EG5A 1KSHA 3AP1A 1Z6TA 1E2MA 1KJZA 4MKGA 1KK1A 1G8FA 4L5BA 4M9XA 2XTZA 1CP2A 1KKLA 4QHYA 4KSCA 2OCAA 3I32A 2QMOA 2D06A 2YC2C 2QEXB 2P5TB 1D2EA 1EFCA 2WSSD 1II0A 4DCTA 1H8HA 3G82C 3KJGA 4HLCA 2BMFA 3BRWD 3Q5EA 4PC1A 1UKYA 2J7KA 3K09A 1TMKA 1FZQA 2V7QD 4GZMA 1OXSC 2ZI5A 4PZYA 2OTJB 4CF7A 4PC7A 2YWHA 3PUYA 3BJIC 1IAQA 1A82A 4DLVA 4Z1MD 4NYJQ 1ZINA 2B7BA 2IS2A 1BKDR 3FJOA 1X8KA 3B2EA 3TVDA 1YKSA 2FFBA 3QNUA 4P31A 4P4TA 1F5NA 1E9DA 5C2JB 2CJWA 3AB3A 4Q4HB 1U99A 2QM8A 1OH5A 1Q20A 3DM5A 2QP9X 4TTQA 2JLSA 4TMWA 3VMFA 1JAHA 1DADA 5JJKA 1Z83A 4LBVA 5FBLB 1G7RA 3X1ZA 4GRAA 1XEWY 5GADl 4QM6A 4HLDA 2OFWA 2ZRLA 1QG0A 1S9HA 3K9HA 4V03A 1RE0A 4M1YA 2FDCA 3KKNA 1UBFA 4HB0A 5EP2A 1GTVA 1II8A 1QG2A 3Q3JB 3QQ5A 4LGMA 2X1VA 4RKEA 4Q4AA 4EJSC 3EPLA 3J81k 1KD1D 4ZDKA 3R8FA 1GFIA 1VMAA 4C0HA 2ZSFA 1JALA 2ZJAA 5IDVA 2RGNC 2J7PD 1K5DA 2N46A 1N0UA 1FFHA 3QJYA 1XE1A 1X8JA 3HPQA 1AZTA 5GV8A 4M1WA 4JSYA 3TSOA 4X8HA 3I55B 2B6HA 3ETLA 1AS2A 3W6OA 3MAAC 1M2OB 4TMKA 4D81A 5LD2C 1UFQA 2CMKA 3B60A 1ZW6A 3PEWA 1HURA 5FTJA 2FFHA 2XNCA 2HT6A 3NXSA 3FOZA 4DCVA 4HAYA 1U98A 2ZJ2A 4XWAA 2BMDA 5CB6A 5EZ5A 4R71A 2FA9A 4Q4LA 3EC2A 3THYB 3L0PA 3OAAD 4Q7JB 4E03A 1YI2B 3ND8A 1WP9A 1ZVQA 1I4TD 1CRPA 3NIBA 5TDHA 2P5SA 5EXTA 4K46A 3T1VA 3FHTA 3U3KA 4CRWB 1W7AA 4P33A 3W2GA 1EG7A 3QEOA 5J40A 4ERNA 5KDDA 2IT1A 3EIHA 4LYHA 1FQJA 4ARZA 1P7CA 2OAP1 3AVVA 5AWFC 2WWFA 1JJVA 5E3HA 4C0QC 4B34A 2JJ2D 1VCOA 2DETA 1VQ6B 2VSOA 3HU2A 5H68A 1ZM3A 1G8HA 1R5BA 2RKOA 1GP2A 4JKIA 3B1XA 3B6EA 1QVGB 4L4UA 1YZQA 4RFSA 5GV7A 1JEDA 5CIWA 5CYOA 5FI1B 2BSAA 3QKUA 2BKUA 2RHMA 4M1OA 2KBEA 2ODNA 1I2MA 3IILA 4GSYA 4II7A 3PIRA 5CIQA 3U61B 4EUNA 1EFHA 1NN5A 3OIWA 4JVMA 4BRWA 1GL9B 3ASYA 4EJSA 4L16A 2UZIR 1KI3A 3A58B 3EZ7A 3EPKA 1T4GA 4KYUA 4D6PA 3AKCA 3WP0A 2W2XA 3G6EB 2DR3A 3P1JA 4Q1EA 3B5JA 4A0HA 5KNBA 1AM4D 5SZJA 2DERA 1Q1ZA 4GOKA 2W00A 4B73A 2RGEA 4BLOA 4EQ6A 2GJAA 4AY2A 2BWJA 3EIEA 2ATXA 1W5TA 3BB4A 5IK2A 4QL3A 3QIAA 1MO6A 1G20E 3E20A 1Z2AA 5DHAA 2KBFA 1XTSA 5EP3A 2ZM5A 3WP1B 4A0GA 4L8GA 3DO6A 2CVFA 1PLKA 4H1UA 3QKRB 4Q66C 1U9IC 5FL3A 1IN7A 1S72B 3VKWA 1KK2A 2FPKA 1XMJA 2RGAA 2ZRCA 1U81A 3CONA 4EPTA 4RCYA 1OYYA 4TQ9A 3T5GA 2C04A 2NPFA 1U8ZA 2V54A 2DB3A 1SXJB 1SHKA 4IOMA 1NLYA 2OLKA 3T06B 3AVQA 4V0NA 2BEJA 2VF7A 3TNFA 4A92A 4PAMA 2QMHA 3DOFA 3KXIA 3ZVMA 3GPLA 2J0SA 4V0LA 2ZRAA 2QNRA 1XCPA 1XJ0A 3LW7A 4GP6A 1P2VA 4HAXA 5AJXA 3BS4A 1S9DA 2ZI6A 2QMUA 2F1JA 4URXR 4TMXA 1YR9A 1EFRD 2DWPA 1PLLA 1LNZA 1WE2A 1VQPB 1N25A 2ZIAA 4LY6A 4Q4JA 5D3MA 3OEED 3I4LA 4BFUA 4EPWA 2ODWA 2O52A 3R9IA 3TLXA 1YJWB 2A5DA 4MRRA 2A7QA 2WAXA 5HE8A 1W2GA 4OI1A 1GR1A 3LDAA 1NSTA 1ZM7A 3QI2A 1FNNA 1VCIA 4MKFA 1MT0A 4U00A 3T5DA 1G19A 1DAEA 4N3NA 2JIZD 3KKOA 4XD7A 1NL3A 2EFCB 1W46A 2NOAA 1W34A 1ZNZA
chains in the Genus database with same CATH superfamily
4D8UA 3U4CA 4FK8A 3WICA 1IDN1 3SJ9A 1UJ5A 4ARVA 4YT8A 5FFMA 1PJ2A 3BK7A 3RSCA 1B0FA 2OBNA 3G0DA 3ADBA 3U3JA 4XXHA 1QFJA 4C7OA 5ALTA 1WU7A 4KO1S 5E2BA 5C5IA 3M1AA 2G1AA 3U39A 4RD4A 1J23A 3D8TA 3AVYA 3COWA 4UQLA 3LPDA 2I2FA 2CXXA 3EZ2A 1XKXA 3V4SA 3O8LA 1UMAH 5ABPA 1KEEA 1P4SA 4YP5A 5IH3A 4L9SA 1IZYA 2GN9A 1NMZA 2IRWA 3FFBA 2PCJA 4AOQA 4IJMA 1CR0A 1QQUA 4UUAA 5F51A 2XRYA 4C88A 3BMCA 2E48A 5CVEA 1INCA 3LGXA 2WYJA 3ASTA 1XL1A 3X1XA 3DNPA 1CUHA 3OF2A 4PVDA 4YGYA 2C2YA 4CVNA 5BYAA 3PC8C 2WPJS 2UAGA 1DBPA 3A6ZA 1RRGA 5I9MA 4EX7A 1E6MA 3N0RA 3H6HA 1Y5RA 4L9AA 5FTLA 1TYAE 4BNMA 3H4IA 1UCYE 3MH6A 1J0DA 4ZKDA 3G01A 1ZCFA 5HNKA 1QP7A 2W43A 1KH3A 1V47A 1Q84A 2LXNA 2H1FA 4PR3A 4EG5A 1TADA 2ZI4A 3MRTA 1CXZA 3A4MA 1SKMA 1C2GA 4J7XA 1Y0RA 2QVBA 5JFOA 1GYPA 2QD2A 3DZJA 2FPPA 1S3GA 3ATLA 3OOEA 4LOYH 2ONKA 3HK3B 1A27A 1SSXA 3IKLA 5C0UA 2GO7A 1PPEE 4B7XA 3WYCA 1M6EX 4X90A 2B0JA 4BLPA 4A9AA 4TXNA 3INYA 1NM5A 3Q6RA 1KNXA 3T0IA 3T52A 3T35A 3QTVH 1FFXA 1A7SA 3IL2A 5AUOB 3ABIA 1M2HA 1UK3A 2O3QA 1K1IA 4RNCA 2H1WA 3CUWA 5KNDD 2HNAA 1Q22A 4EY8A 3FBWA 4DG8A 1U8EA 2SNVA 3LNCA 4ZVMA 3WZLA 1B3RA 2C5EA 4FYVA 3NMUF 2BP7A 2FP7B 3KIDU 3R5XA 1LXCA 3JVDA 1JMOH 2FX6A 1UPTA 5KEIA 5GONF 1KZYC 2W6MA 4YRZA 3M6FA 5AVWA 3IXQA 1BHSA 1JJIA 3R1IA 3PYLA 4Y10E 4EFKA 2X23A 3GEMA 4JBYA 3UC5A 4QUJA 1ELTA 1J8VA 4F4FA 1FDSA 3PD1A 1V6AA 4HJRA 4M46A 3SS9X 3UKOA 3MGKA 2OM6A 3C4VA 4ISHH 1Q12A 4A8JC 4ZT2A 1G3CA 3K0FA 3O8QA 4W9NC 1XU4A 1MX1A 4J1TA 1P31A 2IF0A 4R7ZA 4QOJA 3ZYDA 2E85A 4LGVA 2IZZA 3TGIE 1PPGE 3PXEA 1JOUB 2IK8A 1E0AA 3A6DA 2FX3A 1AH2A 3OJWA 3GD5A 4Z9AA 4ARZB 1H9LB 3SEJA 4NU0A 2G5GX 5AM3A 2GCTC 1JG1A 4E94A 3COZA 3PQ4A 2A5JA 1K6IA 3OKFA 1H3EA 4WKPA 4IXNA 5I7FA 1SCIA 1E2KA 3CYFA 1B8VA 4BP9A 2KJQA 1W4LA 3EIQA 5IRCD 1E0SA 1SOVA 5KGOA 2WJVA 5HKKA 4LXUA 3DDHA 5JCZA 5FBEA 1Q0SA 2WKRA 3NKKA 5DMXA 1A9RA 3R9KA 2W26A 2JJMA 1MB2A 4Y2RA 3NHRA 1PK9A 3OT1B 4JJGA 4R1PA 5WRFA 2QX9A 3GLGA 4FVBA 4EKEA 3RDPA 4DV5B 4F4UA 2JZNA 1IBRA 1VMKA 5CA1A 5AH0A 4UPVA 1KMQA 3GJ7A 5EZYF 1BS2A 1QQAA 3BIJA 4FEAA 1N75A 4U2KA 2ZFQH 3ZZMA 4MR7B 1Z5VA 3UPEA 2QCYA 5DGIA 2JFGA 4N6NA 1ETRH 4DLNA 2HTEA 4JCOA 3EVAA 1ZQ9A 2P2ZA 4EI8A 2WQ7A 4KG7A 4XBDA 1IY9A 3KJEA 2QV0A 4KO4S 4XZ3A 3UA3A 4LXTA 7YASA 2VJCA 3DL0A 5F03A 2AYWA 4H3HB 4B3IA 1EZZA 5ALWA 4C7OB 4NR0A 3MT0A 5A03A 4F7DA 5IDKA 4ZQCB 2A45B 5C34B 3ZZ4A 5DCYA 5LVAA 3OJLA 1PE0A 3LYLA 1YJAA 4JI0B 2GM5A 2HGSA 1VIYA 2C7GA 3AUXA 4K9RA 1CW2B 4IUCS 3U3XA 4OI4A 3N0WA 1V5FA 2ZVDA 2JK1A 2AC4A 1LDGA 2UXDB 3PMHB 5L4SA 5JI3E 3LCVB 1ILWA 2BE7A 4N8SA 5PNTA 2ZZKA 2ZRBA 4MPRA 5KOHA 3SX2A 1X86B 4WNIA 3K2BA 2FRXA 1L7EA 1GU0A 1TWXB 4FQ5A 4COKA 3BMCB 1G55A 3PNKA 2XYQA 4UTOA 3IDSA 3T41A 2R6ZA 3ZGZA 4ISIH 4M2LA 2QLTA 4AKEA 4Z7NB 2DUWA 3W6ZA 4GOJA 4Q19A 2F1MA 4W6QA 1DL5A 4R1SA 1B2LA 2ZKSA 3DOUA 2R5FA 3C5WP 4I2NA 4QOEA 2PKRA 4K6OA 2Y1EA 2ZDVH 5JB9S 5IBQA 2ZAOA 3PYMA 5LPEA 4BX8A 1EHCA 3L92A 6AT1A 1DJMA 1EINA 1TL7C 4F3YA 4U6QA 2PX5A 3AR3A 3NWOA 5ALMA 2V0BA 3ETGA 4KQEA 2AOWA 4Z4IA 3IEPA 3EISA 1WCIA 4N5NA 5CDFA 1CEYA 1OGIA 3OX2A 3ZD8A 4LF5B 4RZIA 4EHAA 4D9NA 4C0KA 2FPPB 1CHOG 2BEWA 4WQMA 3SI4H 1ZBQA 4JLMA 2BFOA 1A50B 1JSLA 1WXDA 2G3YA 4WERA 4QAJA 5FXLA 4CCAA 1ZD4A 3LD9A 2JH0D 3C3WA 4IDOA 2XVAA 3WLTA 3IUMA 2XODA 3SDBA 2CHVA 1FFXB 2I3DA 3KAPA 4KSBA 1I18A 5D5PA 4YM9A 2VRBA 3TQQA 4DLYA 5F9MA 3D0KA 1MC4A 4TN5A 2HDHA 1Q82D 3NWEA 3RRNA 3TBKA 4CPDA 1PT9A 3PXUA 1GEGA 2JI4A 4JSRA 3LX6A 3JZ2B 5TY0A 4N7RA 1K63A 1GT91 3QWFA 1KSFX 1SXIA 4O4JA 4EW6A 2BP7B 1BBRH 4DSUA 3Q0IA 4QHSA 3ED1A 3TLBA 1KS9A 4JLPA 3SR0A 5FOQA 1W19A 4E0BA 3NATA 1O87A 4B2LA 1NVDA 3EQ8A 2R6AA 1KSJA 3T1TA 1MRNA 2OBXA 3M34A 1GKIA 4ZZ0A 1P62B 3H1AA 2BGWA 1ZUWA 4BTEA 3SZGA 4EEZA 1DEKA 3C3AA 2WJJA 3K0FB 3O8QB 2H4FA 3U81A 4PSVA 3K9LA 1E2BA 2H1RA 1C0IA 2PPVA 3OESA 1R8YA 4PBRA 1QRWA 1IMOA 2JN9A 3IJRA 2ZWPA 3KBOA 3KOYA 3TW6A 4C4OA 2NMVA 2I7XA 3RWBA 4TGLA 1JHZA 2CXHA 3IAM6 3IIKA 3KQKA 1TF5A 4K3VA 4K7JA 1E3XA 4MH0R 4TVKA 5M7EA 3ETNA 4P2BA 4J2OA 5G2OA 4I8DA 3V48A 1EM8A 1NBME 4JK6A 1K7SN 1VPWA 1XLTA 3R3SA 4EG8A 2JIDA 4L74A 3VVMA 2H8GA 4RD3A 1NNSA 3HB9A 1LW6E 2FEWB 4HXYA 1U5CA 3FWNA 5KOIA 2JC3A 3GLGB 5JWOA 4AFSA 2Q1XA 3A84A 3MOIA 5CA1B 3TL3A 1WLYA 3UZUA 1F3OA 1UVPA 3JVUA 3K8YA 1C8VB 1JDPA 1YJ8A 3PBKA 4N8EA 1GGJA 3BMNA 2BZSA 2I2WA 5F2NA 3E81A 5D5HA 2BXUH 3F0TA 2QJWA 4FP9A 2WVGA 1HRDA 2ZLBA 1JNXX 4AX4A 1TNGA 1G3RA 5BWNA 2O8MA 3OCJA 1DDJA 4QBGB 1GNLA 4I3FA 4BNRA 3SU6A 4IMQA 3SNAA 1M7BA 1CA8B 4Z2YA 1SGFG 1MJGM 5AQ1A 1DFIA 2IOHA 3A4TA 1C3LA 1WMDA 4PYQA 2W7UA 3IVCA 2Y99A 1C7EA 3VNQA 4WI1A 4RD1A 2EKZA 5ALEA 4C2TA 4ZYTA 1L0BA 3E7DA 5KQMA 4ZJUA 2BKEA 4LDPA 1ZVMA 4OPSA 1RPNA 2QYSA 1N05A 1GJ7B 4L9RA 2WUFA 4Z9YA 1WVGA 5A02A 4ABIA 4IILA 1QIDA 3GWZA 2J2UA 5AOAA 3S8EA 1FSZA 2P9ZA 2PMEA 1HE2A 4PNEA 1RD4A 1A9XA 1O6BA 1P4MA 2E18A 1H94A 5KJ6A 3TFOA 3VR5H 4XLHA 5J35A 2B8JA 1V2TT 1I94B 3L3BA 5KOHB 1RBQA 2AOTA 3W8RA 3ZWYA 1SAYA 4MWZA 4TL7A 2A5KA 2YVAA 4DF3A 1AB5A 2Q6VA 2AFVA 1AQNA 1AQ7A 3DHVA 4ZKOU 2B2NA 1W76A 2PX2A 1S0QA 3WS7A 4BGIA 2C3YA 4K5ZA 5HQJA 3KLPX 5BQOA 2QRJA 2SCUA 4M89A 2EJTA 3MCAA 3B9RA 1G5PA 2M5TA 1NN0A 4FW8A 1P11E 4K2HA 1FFSA 1JJ2B 3DSRA 3H2SA 3H5TA 4A0RA 2ZXIA 4HRYA 1UOOA 5L3RA 2Z5VA 1B00A 1FX1A 1NPYA 3ZQJA 1ZRSA 1WCIB 4EL0A 2ZGBH 4EGAA 1LPGB 4LQLA 3HVIA 2Q62A 3RADC 4KR0A 1RAAA 2BEWB 2R62A 3CRMA 3KEOA 3PGLA 3LL4A 3DPUA 3TDMA 1IQRA 1NKSA 1PGJA 3Q3AA 4WFIA 5DIZA 4NBRA 2OGSA 1AQUA 1R9NA 1JV2B 5SV2A 2P4EA 4QULA 3RGGA 1X7AC 1F92A 2ZPSA 1LBSA 3E7WA 4ND2A 2X2PA 3HLTA 5TVKA 3RXCA 3C3MA 2XVXA 1U6QA 3WY8A 3HPTB 1GBIA 2E4WA 3BULA 4K1LA 1CF4A 1CZOA 2OUAA 1OP0A 3K0CA 3LH3A 1QVRA 1XEFA 1G42A 2F3CE 1T8MA 1WR8A 1ESNA 4M0LA 4OQNA 1TRMA 2DP4E 5F4BA 4W1RA 1LPBB 1R1DA 1OKKA 3MD0A 2DPYA 3DSGA 3PA6A 5LQDA 1MOSA 1RXSA 3CNNA 4GOOD 2NO5A 1QJ7B 3REGA 2IXDA 3UJ6A 5A5GA 2QXHA 1JBUH 3NDIA 5BP7A 3CF6R 4DFDA 3GW8A 3P2JA 3LBHA 2WFLA 3RO7A 5JCOA 5C1UA 3UMSA 2OC4A 4YR9A 3AHHA 3FGZA 1ID5H 2WIAA 1EWQA 1E94E 4Z9BA 3AESB 1VCWA 5CFLA 1U2QA 1EPTC 1E1RD 3OPOA 1NN3A 5BQ3A 5GAJA 2HHCA 5A9TA 1GQOA 2WVHA 4IIDA 4UXJA 4YACA 5J4QA 4EJ6A 2DOGA 4R3WA 4DV4B 3ODGA 3D8SA 1RYDA 4R31A 5F5LA 3JZFA 4DA6A 1GJ5H 1P6QA 1X1CA 4DR4B 3KUXA 4JB2A 2PRIA 2OHIA 3BN9A 2UWOA 3GBPA 3MNXA 3GN1A 1Y0BA 2HF7A 2VLBA 4OXQA 1GCIA 5IJWA 2Y2UA 1UTJA 2LDXA 3N8GA 3SFVA 4PO9A 1AKTA 1XCGB 4Q1FA 1S3IA 2A5LA 1DM4B 3P2KA 2UYQA 4W8OA 4MDEA 2R8PA 5KYNA 3LC3A 4K1XA 3NE5B 1Y3BE 3BMNB 9ATCA 2B35A 4JYZA 1MRSA 2WHQA 5THKA 5K09A 1SZCA 4RCZA 3IJPA 8ABPA 5LIRA 1Y9DA 2FUNB 2OXRA 1OFGA 1OC4A 3BFKA 3AJ8A 4YELA 3VR4A 4XR9A 3NM4A 3GJZA 3CTPA 2VNIA 3MOCA 3V1LA 3TM4A 3U4AA 3SF8B 2R00C 1KVTA 5B3JC 3W34A 3FAOA 4YI3A 2AMFA 2WV4A 2ID8A 3DJYA 2QZJA 3S2UA 1VYVA 4BO0A 3OUZA 5FKJA 2A9OA 3MHPA 4EDFA 3BZWA 1RQPA 1LGYA 1OI3A 3GLGE 3OTQA 4ZRMA 4JI1B 3TE7A 1TUEA 3KAKA 5DBHX 3ZS8A 2AMYA 1J4AA 4D4LA 1E99A 1IQFA 3O4FA 4ZGBA 4NV0A 3KXPA 3KKEA 1XPJA 4TLLB 4U4AA 2FMUA 2P6PA 2ONZA 3FPBA 1RM5A 3H1FA 4YPOA 3NKVA 4W5NA 2XT9A 2V6MA 1FFDA 4ARBA 3GRVA 1A9XB 1YCHA 3FD8A 2HX1A 2YL2A 3ICOA 3OTWA 2G25A 1BFUA 2EU8A 4NDNE 2AOTB 6ABPA 3IYLW 1OGYA 3WK4A 3L6DA 3K6RA 2VXCA 4LNUA 4YZUA 4G09A 4UFOA 3W9YA 2WPNA 3LUJA 5E6RA 3M4NA 4MUYA 1VJ0A 4LNAA 3CFYA 2PTHA 1LTHR 1FXUA 4C7JA 1I7SB 1CJBA 2FEXA 4CKYA 2SCUB 1NOIA 3CESA 4DE5A 4O0LA 2I8LA 2J3QA 2FFJA 1FP4A 1A77A 3M83A 2WC1A 3T5MA 3I12A 3C5CA 4CGZA 1DBVO 1CF2O 4ACAA 2PO7A 3QPUA 1N4DA 2MYPA 2CLLB 1QDEA 1LHDH 1TM4E 1ECPA 4IQ4A 2GHIA 2UUBB 1LS1A 3U48A 1DRVA 2ES4A 5TS2A 3MTAA 1FFEA 3SHFA 2FW6A 3PU6A 4R8KA 3DCJA 1RQ2A 1SZPA 1M75A 1UJ2A 3K1YA 4IQ0A 4FUHA 2FPOA 1E0KA 1QL9A 1HO3A 3L06A 1T26A 3BQJA 5EMJA 3NIWA 4Q3AA 2KI5A 2GNAA 1YMQA 4BVJA 1P9NA 4H1HA 1QR6A 5H1YA 4B6JA 2AZ4A 1DDOA 1QRXA 5KX5A 3KQPA 1VC2A 1SH7A 2X6XA 3K9FC 4FB5A 3FYDA 3JD1A 3RFVA 2YS6A 5J4SA 1Y7TA 1KJQA 2W5UA 1TALA 1L7AA 2XNSA 4ZHQF 2ZNKH 2OPBA 2CJYA 1MX9A 3RXSA 3NPSA 2XBWA 3TKLA 2MSWA 5CDFE 1VDZA 3ZGXA 3PE6A 3KD2A 1ICEA 2C3PA 3OX1A 4XJSA 2PGAA 3EZNA 2IPHA 7AT1A 1BZXE 1C14A 3IUEA 3WKDA 2HKIA 3WHPA 2P5TB 3NS7A 3L0CA 2VDMB 2YMSC 4YFVA 2FEKA 2ZI5A 5C5OA 4PC7A 4B81A 4OQPA 1S5SA 1B41A 2WFLB 3ZBPA 1BKDR 1Q3XA 3TVDA 1B42A 1DUVG 5IZCC 1OH5A 1OXGA 3M5PA 1MA0A 2NZ2A 2VF5X 1FV9A 5JTUA 3FYSA 4I8JA 2OWDA 5A0CA 4RKEA 3RVJA 2FQ1A 3KAQA 4V0QA 2GT1A 3LC7O 4MUGA 2B6HA 3H75A 3MAAC 2PX8A 4CTJA 4JBLA 5LD2C 5ALIA 1HURA 3LWBA 4C0WA 5K2OA 1PFVA 1G9TA 1EZXC 2C2OA 2XT0A 5EZ5A 4U5QA 2BDCA 3PP8A 3I77A 4G0XA 1ZVQA 2YICA 4GMFA 5KDDA 1QF7A 1S2LA 3ZVDA 2BFCA 3AL2A 4G7XA 2XA9A 4M3NA 1MT3A 3ZHZA 2XTTB 1LRLA 3GNQA 4RFSA 1JEDA 1CZKA 3E58A 4BOYA 1TRKA 4ZWNA 2X1MA 5HIJA 3KYGA 4EHHA 1U0OC 3A11A 3A58B 5JQGA 3NM5A 2QMZA 3WWFA 4B73A 2ICAA 3HRIA 2R5WA 4X64B 1ZSVA 4NEHB 3DO6A 4H1UA 4LXYA 8GPBA 4DJDC 3UA4A 1DEXA 2D1FA 1LX6A 2PDAA 4EGFA 1FF9A 1YJXA 1U6IA 2TMYA 5JPMH 3DFUA 4C20A 2BGRA 3WRXA 1EUQA 2VJLA 1XCPA 3JYHA 4GP6A 3TRHA 2QXUA 1RR6A 4IY1A 4U2DA 5EI5A 3G8BA 2INGX 1QYIA 1MP0A 1OLXB 1NQWA 2QRGA 2UYHA 2JFVA 4F5EA 3T5DA 4WDQA 3EGDA 1W94A 4IRMA 2Y67A 2PMDA 4NMXB 2Q7DA 4GQBA 1XEXA 1KRXA 2F3SA 2OTLB 4A4DA 1BWQA 1AOXA 5A8YA 4GC9A 3QW4B 4NATA 2NLOA 2OP0A 2HTFA 3SDZA 2DZDA 1LFAA 4BAMB 4A16A 3ZZUA 1NR1A 2I2AA 4AF6A 2ZTXA 2BY5X 4LNUB 1CZRA 5E6RB 3TS1A 2DKOA 3SXUA 4YIKA 3ZJVA 1T0HB 1OWMA 4KNWA 2A5YB 1Z5GA 1RQNA 3P0IA 4TUYA 1QH8A 1V2NT 4WZKA 3SNKA 4NIYA 1QFYA 3QE3A 2RDLA 1ZG3A 4XTCS 2RC5A 3ZCUA 4P36A 4MKXA 1VBFA 1FP4B 1D5CA 3W90A 1IN5A 4ZEMA 2BHSA 2O0HA 4P26A 3RXOA 1NE2A 2P9CA 1KFCB 4D79A 1UDBA 3PSAA 1E35B 3F5QA 1NHWA 3BWYA 2FCRA 3L43A 5JBNA 1TFUA 3BTQE 1C1WH 3BWMA 1FY4A 4FGUA 2ZUWA 3RM0H 4I5EA 1Z38A 3SAJA 4HX2A 1USGA 4ZO4A 4Z54A 1DICA 4DJEC 1B0AA 3KJHA 3U7QA 5IVIA 2PS1A 4G81A 3KCNA 2RSLA 4HZGA 5FBIA 5KYYA 1VFPA 1NNLA 2W8BB 3VH1A 5KX5B 4I1SA 1C8BA 3C3XA 4R1UA 4OLBA 4CLXA 3Q98A 5JE8A 2IHNA 4H42U 2R96A 1ZL2A 1QHSA 2R87A 2VBIA 1LJLA 3KSRA 4AKSA 2WTAA 1GV0A 2GYUA 5T67A 1GA6A 4BKPA 2X6YA 1GPDG 2V45A 4IEIA 3F5FA 5AI0A 3PJFA 4YMTA 3GEGA 3P7MA 3WLNA 2QTCA 4B3FX 3C7DB 3R0XA 1NVXQ 2OOSA 3NHWA 5C8ZA 3ZDDA 1AK2A 2Z4RA 4GZLA 4BMPB 3G68A 3THRA 3K9NA 1ZO8A 3WLFA 2E4ZA 4LJ6A 2PW8H 3PFBA 3V6LA 5CX1A 1JTFA 4YMUA 4AULA 4YY3B 3NHMA 1GHZA 3KQEA 2JJ8A 1I13A 4E1VA 4OBXA 3MJSA 2QV7A 1E1LA 4C3OB 5EIBC 3O3OB 2GSDA 1DEHA 2XB8A 4V02A 4BQSA 3DL4A 2A5GA 4GUXA 4EA6A 2GCEA 4ZN6A 5JZMA 3HFJA 3LX5A 2A0QB 3L79A 3LYAA 3T15A 5A2QA 2ACEA 3GYBA 2PFGA 4LVNA 3O93A 2A1TR 2H1CA 4FQ7A 3KJXA 2BFCB 2P7HA 4YOGA 4Y0NA 4KU4A 4IDBA 4HRXA 2JGDA 3PC7A 3HWX1 2ZJ5A 2JLZA 4RK1A 4TX1A 2GXUA 4EATA 2PUGA 4LZ1H 1RD3B 1TT5A 4AUEA 2Y82A 2EFYA 4LMPA 3R9WA 4CLDA 3FG9A 2D7JA 1GG9A 3BOSA 4L07A 1R6UA 3QXJA 7ESTE 2QP4A 1UPCA 3HCAA 2W4MA 4EEKA 1E79A 2XDAA 4OBEA 1SBYA 1QAMA 2VEDA 2J9RA 1Y1PA 5K3DA 2BCEA 1DAPA 5CT8A 1E3ZA 1ZMOA 1WZCA 1C5SA 2GMTC 1N2CA 3P0JA 1RJXB 2Q0HA 4GMHA 4XOPA 4PSUA 4EJ2A 1VB5A 1Y9EA 1DIGA 2O0LA 3IRUA 3LZDA 3PUHA 2PXAA 4QSMA 2ZZUH 1TPZA 1C0KA 3DTYA 4INAA 4RV4A 4BN4A 4ND8A 3C1UA 3EGDB 2A0UA 3VZQA 2ZTGA 2H2AA 2QENA 4EENA 4YCCA 1XEXB 4UE3S 5SZIA 2VGCC 2ZSDA 1LPSA 4QEKA 3D2AA 1CU1A 1BMDA 2E9SA 3THXA 4B2YA 3WNCA 3SJKA 3KJFA 5DT9A 3IAEA 1SG9A 4JLWA 3UFXA 1N4AA 5GCHF 2ZSEA 3OBIA 3NVDA 2J4CA 2GAAA 4M22A 3SXUB 2ZJBA 1GRRA 5KWEA 5K1ZA 1BCUH 1CZNA 1PL8A 3LRPA 4PAQA 2BL4A 2QD5A 4UD6A 1KO5A 1QH8B 3CNLA 2ZA5A 3OY7A 3ANXA 1WB6A 1Z2CA 2AQIA 3ZWVA 2SNWA 3DMHA 2J4DA 1U3FA 3Q41A 2YV4A 3T3HA 1BU5A 2FUG6 4OGYA 4Y6LA 2WD9A 2I1LA 1U8UA 3QGMA 2BE9A 1LPZB 4RLFA 2F7SA 5DGHA 3Q2KA 5EHIA 5AUNB 4Y9DA 1C4XA 2CDCA 1VGCB 4HQ0A 2EFHB 2Z2ZA 1J8MF 3FTDA 5FHQA 2A7JA 3AKDA 1I0LA 4MB2A 1NTRA 3MQ4A 3UKJA 1G8KA 3Q2OA 4L8VA 2C8ZB 5C7OO 3F47A 3ZV8A 3Q9LA 3T7DA 4CCSA 2H0AA 3U7QB 3WE7A 1ZNQO 1XJ5A 1NZQH 3AEYA 4XIGS 1YR2A 3H13A 5E4YA 2X0RA 2DJ5A 4J6EA 3CUEF 4N4AA 1G6KA 1KAHA 1QGAA 3KQNA 1PTJC 4Y67A 4LV8B 5DB4A 3PS9A 1P91A 3A14A 3HUTA 3L7NA 4YRGA 5LQNA 5FAHA 4BEJA 3UY4A 3F8SA 1OIXA 3TIXB 4MVJF 3G85A 4YO9A 3CQ9A 3ZVKA 4P3XA 4QPDA 4MJ7A 3DXZA 1C7FA 5IANA 3O03A 3Q3XA 2ZJFA 1WCWA 2AS0A 2Q6IA 1SVNA 3VZRA 1OWOA 3NUQA 3ERCA 1TYEB 3OUUA 2AUTA 5JJCA 1U65A 3G6KA 1Y6ZA 1ECCA 4CM6A 2Z08A 4S1TA 1AGYA 1M33A 1PX2A 4JY7A 1E6WA 2LIVA 3GA0A 4WWVA 1G6Q1 1CUCA 2H52A 4P34A 2IV3A 2J38A 1MEOA 1ZR2A 3PHBE 2PZMA 2C4WA 4A73A 2IXGA 5CX1B 3RREA 4P3NA 3S40A 3C15C 1JG4A 5FA8A 4TRNA 4D3FA 3U0BA 2HIAA 1UFVA 2XHEA 1O2KA 3I2IA 3TZ6A 1T8WA 4RVFA 2UU9B 1YPMH 2ZDHA 3LK7A 4B0OA 4X5OA 4KIGA 4KMRA 5EIYA 3ZCVA 3NT4A 1YJ5A 1XJQA 1NJFA 3ORQA 3WGZA 3MHTA 1ZZZA 3A3PA 2WPKS 1U2RA 4J0QA 2YRXA 1ZOOA 1Y63A 2JGDB 5AW6A 2ZJ3A 1XZBA 3GEHA 1U4OA 1WMSA 2R68A 2BDEA 4HVTA 1S2DA 1LDEA 4ER5A 1VL1A 1ODJA 4AGJA 5EJ9A 4B3MB 1L5MA 1E6CA 1RXWA 4YBZA 3SFTA 1T2UA 2W0SA 5IYTA 3UNXA 2UZ4A 2H1LA 2GJKA 1U1FA 3EXG2 2VZ0A 1W48A 1WV0A 2CKDA 4FOOA 4PZ9A 4X7DA 3HEAA 3MH7A 3A10A 1FIZA 1A3EH 3JRXA 3K53A 5CM9C 1LX7A 1TQ8A 4BNLA 3OP4A 1P1BA 4RH0A 1N2CB 3LGTA 3WJ2A 1DCFA 4TZ6A 1O8BA 1UBRS 1KXEA 5L3VA 1VLHA 4RVNA 1VHQA 4WAUA 2VK2A 3OOYA 3M81A 3RIHA 4BWVA 3AG6A 1DZ3A 4XEHA 5K0NA 3PEVA 3L8GA 4O4IB 2D4AA 1PR0A 4DWVA 1MO4A 2BD3A 5DNCA 4GLBA 1M2GA 3I01M 4FCWA 3ABOB 1U2DC 4II3A 1V96A 1E6LA 4DYVA 4IC5A 1Y6GA 3Q3VA 4WPGA 3VKHA 1BHJA 1NFXA 1O9HA 2AS9A 1IBLB 5ALQA 1EZQA 2E1BA 3THXB 3D0QA 1VE5A 3MERA 1UPAA 1Z08A 4C5CA 3UFXB 5KNCA 2RG1A 3MILA 1R6DA 5KJEA 2YUIA 2JVIA 2I8CA 1UXHA 4MQUA 1VKNA 4KPGA 2ZGJA 4MRMA 1IN8A 1DX5M 1DY8A 1LTQA 3BEDA 4J6FA 4CG1A 4FFVA 4MB0A 3UFAA 5I51A 3QMPA 1IC6A 2EFDB 4MP8A 3BFJA 3AL0C 3ZE2B 1W88A 3TW4A 2ZI7A 2Q9UA 1DY9A 3GJYA 2HYIC 1WXRA 4OMCA 2V6JA 3BE6A 4BXSA 1PW5A 3CIOA 1K3FA 1C81A 3KNXA 3DZHA 2ZF0H 1YACA 4TKUA 3STWA 3E1KA 3BJZA 3WHIA 4MVWA 4PAOA 1QR2A 1YMVA 5AI9A 2AG8A 5EP1A 3AB7A 2Y92A 3D8BA 5EGMA 2B1QA 4YO8A 5COAA 4QPNA 2ZZEA 1MR3F 2ZUUA 4BVFA 3ROEA 1DGQA 2QYTA 4R3NA 1G63A 1U6JA 4QBKA 3LONA 3OFNA 3LT4A 3H9CA 3OY5U 4OYYA 2PL1A 4HDQB 5E7MA 5T4BA 2A88A 3FDIA 4OPVA 2JATA 3B89A 4AO8A 1TA4A 4RDHA 3U7FB 4L28A 1NBMA 1H6AA 2QZZA 2FOLA 4RQAA 2H48A 3GJ8A 4LF7B 3G9XA 1NUAA 3RUEA 3C8UA 3L7LA 1FYDA 2J3LA 2DFLA 2PZJA 1NJ8A 1GARA 1UD3A 2ZPUA 2J6IA 4LYEA 1USWA 3A4VA 3KGPA 3A9RA 3LECA 3GOQA 3TSZA 2FH5B 1HC7A 1W8BH 4BLTA 2BQWB 1PR4A 3KLMX 3S7KB 3M2PA 3DZIA 4BUZA 5H5JA 4YPFA 2W11A 3VB3A 1F8YA 4AC9A 5KNBH 5C17A 1OFUX 1RJDA 1HJ8A 1GPBA 3QLVC 3D7KA 4LJ8A 5CPFA 4QTYA 5J5AA 4Z51A 1PJRA 3RIEA 4DVJA 3H8JA 3PQDA 4KIFA 1WBJB 3BA6A 2VNTA 1KAGA 4FMDB 2UXBB 3TL2A 3ZBUA 5DJ5A 2ZI9A 2PV0A 1U7WA 4QPCA 2NX2A 1GPZA 2G9QA 1BFKA 1ZTKA 1JMYA 5KO2A 2GZMA 4CTNA 4W1SA 4KYTA 4XSGA 3II6X 4UBIA 3OIDA 4B6GA 2ZAMA 3DP7A 3JARB 1Q3TA 3LHSA 2JF0A 3I8OA 3ONNA 3I0MA 2IX3A 5CA0F 1XFOA 2YJTD 3SGLA 1XRNA 3LBFA 2GDEH 3K8QA 3FR8A 2RFLA 5CCDA 2W71A 3PV0A 3QOWA 1YWGO 2I5PO 4GUAA 2OO7A 4DS3A 1VE6A 1MQSA 5CEJA 3UXEA 3LDHA 4INHA 3IIMA 3QOYA 2HQ1A 3QWIA 4MIKA 5EXDA 4PLHA 3OOSA 2Q1TA 4E5YA 5HR5A 2W2MA 3IAS1 3HKIB 4JH0A 1E2DA 2OYRA 2CHAB 5FQNA 3IUYA 2ZIQH 4ENSA 4ZJYA 3R24A 4QGHA 1T24A 3P8ZA 4BFZA 2D62A 4MRVA 3U26A 3FBTA 2NU3E 3QQPA 4WXIA 3LLUA 1HR0B 1VJ1A 3TXYA 4KYVA 5M29A 1GRQA 4DG5A 2OCYC 1CUIA 1UTLM 3QTTA 2CUNA 1MTVA 2R65A 4Q5IA 4G4IA 2Q6FA 1K1MA 4YNBA 4LQDA 5JADA 1GU7A 4R0VA 4TXJA 4BNJA 3SV8A 2G1KA 4LWZA 1EXDA 3QXCA 3B20A 1RXCA 3WADA 5K6RA 1ML3A 2BI4A 3TOZA 4NV3A 4BPRA 2O2ZA 3HU3A 1DAOA 1EUCA 2JFNA 4TROA 4OKIA 4Y0ZE 2PZAA 1EAXA 3A8AA 1CWUA 4U7HA 1CZUA 1ELOA 1D2GA 2H65A 5CFOA 4MWSA 1GQSA 3OEHA 1N2CE 3E61A 3QXSA 2PIAA 3O7WA 2LZJA 3C3BA 4QDJA 3TOVA 4DTCA 1Y3IA 4MRMB 1RHRA 1YHNA 5FQOA 4GIBA 4OQDA 1O3HA 5I9IA 2HHJA 4D42A 3FPJA 5M2QA 2BEKA 3KVNA 3TG8A 1W88B 4Y79A 5TV2A 3ES9A 2EX0A 4LY3A 3CR7A 2YRFA 2R25B 2Z9DA 1HDXA 1Q19A 3RXPA 5LP6C 3AX6A 3QTOH 3GH3A 5HDBB 4H6VA 4KSYA 4TKUB 3I58A 1IZ7A 1LK0A 1YITB 2Q27A 5ITVA 3A1VA 4E4RA 2ZWIA 1EHIA 2H7XA 3KDSE 2XCQA 4WW0A 4IDHA 1KY2A 4G5YA 1G8PA 2HQOA 4MWEA 1MABA 4IXTA 4U02A 5DP4A 5LYJA 3SP1A 3AY3A 4NA9H 1TM7E 3UMFA 3JSAA 3TH4H 4JZYA 1AMHA 3L7OA 4LBZA 1N2OA 1P2SA 4HF7A 2XCSB 5JEDA 1PG0A 1SCUA 1WY5A 4Q1CA 3S55A 3AEQA 4KREA 3QITA 3L7JA 1V2OT 1S01A 5BQFA 1IATA 2ZPAA 4O5OA 2N42A 1DBSA 3CH4B 4S1OA 1L5ZA 3W3AA 3CBGA 4PYOA 4PGHA 1JQLB 5F7JA 5TVGA 1FA9A 1Y4UA 5JO0A 1YIJB 2QRZA 3ZGLA 1CRZA 4URHA 5DISB 5EKSA 1ZD9A 3DCIA 1S6YA 2BLOA 2ONCA 1WW3A 4RDXA 4HEJA 1DQZA 4ZOCA 2MYUA 4BGEA 5F3DA 1KZ1A 4LJLA 3ASPA 4RA9A 5GMOA