4AC9A

Crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords MJ0495-LIKE PROTEIN
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4ac9A04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4ac9A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ac9A01
2VF8A 1LTQA 3QF4A 2DB3A 3CCVB 3HPQA 4AC9A 2HLDA 2JIZD 1QGAA 1G21E 3GJ3A 4C0HA 5EE9A 1E2QA 2XJ9A 2FX3A 1ZJ6A 4C0QC 4GP6A 4H1VA 1W0KD 2KJQA 4MGIR 3AP1A 1QG0A 5CM9C 1R0ZA 1UBCA 2UVQA 3LQQA 4QXAA 1OJLA 2WICA 4LBWA 1TQDA 1QFJA 2OFXA 3SQWA 1NN1A 4DQKA 3OIWA 5IK2D 1HE8B 3ZC3A 1KMHA 5AJZA 2J0VA 2RHMA 5J4LA 1Q7YD 4I1VA 3L2OB 2C96A 4MRNA 3ADCA 4M0LA 2J59A 4DHEA 2H16A 5GV7A 3KB2A 1G5PA 4LHZA 4A0RA 2HMAA 4K1XA 2CJWB 3CKLA 1TPZA 1S9DA 1KSFX 4OK3A 2TMKA 3P32A 1K5GA 2AN9A 3TVTA 2AX4A 4KLNA 1OH7A 2ANBA 2QMHA 2PEYA 1UBEA 4JJKA 5HZHA 3DM9B 3R20A 1GAQA 1E63A 1ZNXA 2WSSA 1W4CA 3FGNA 5TXGA 1Q1ZA 4JLDA 4BLPA 3WY9A 4X8LA 1RPZA 1JEEA 1KK2A 1E2JA 5LDDC 5DSZA 3GJ4A 3K0AB 4I1OA 1JECA 5BWMA 2HCJB 2OXRA 1E2IA 1R0YA 2XTMA 2ZRIA 3MUFA 4PSVA 1W47A 2VSOA 3UANA 3SHWA 4PC1A 3K9GA 3WRYC 4PSAA 4KFSA 1EXMA 2FOLA 3ICQB 1G3UA 4AKIA 2FSFA 2VBCA 2XNCA 5AJVB 5FUVA 3OE7D 2ZSFA 5GJWC 1SVSA 3EX7C 4TLEA 2QA4B 4JJZA 5E4FA 2JJ8A 2W0SA 2O8EA 1XRJA 4EIWA 2H57A 1IBRA 3GD7A 3ZZUA 3EW9A 5JJKA 5G53C 3P4XA 1ZM3A 2IXFA 3X1XA 3R9WA 4M9QA 3TE6A 2ZRGA 1JXOA 2OBMA 3W5VA 1IN4A 2BEKA 1GNPA 1H8ED 2IBMA 5FOXA 4PC6A 1EG7A 2WBLC 5K8IA 2FZLA 1XD2A 3NXSA 1GZSA 2IEZA 3ZS8A 1N5JA 4F92B 4DJTA 1LF0A 1DDGA 2C8VA 1K5DA 1W4RA 3DOEA 4JYBA 4PXAA 1II8A 2QAJA 2CXXA 5IDVA 2ZRMA 3TAUA 1EP3B 4EDHA 1KIMA 1GTVA 3NEYA 4XOIA 4C4PA 2FMXA 2GKSA 4RFSB 4PPNA 4GDFA 1T3SA 4IDHA 3ADBA 4M8NE 2IT1A 4Q03A 3CCUB 1ZU5A 4QC2A 2ATXA 4F7DA 1XEWY 3BD9A 3NBYC 1EWYA 1UBGA 2BBWA 4A15A 3FFBA 2ERXA 1UDXA 2XAUA 4EKDA 2ZYVX 3HU2A 4DDWA 2B5OA 3BB1A 4TMXA 1AKYA 4AG6A 4OJQA 1XEFA 1K73D 4KYIB 3CMEB 1N6PA 1J90A 2BOVA 1E9RA 1IM2A 4QGFA 3EWSA 2JLXA 1TTTA 3E20A 4OQMA 3B5JA 3QVUA 3EZ2A 2WOJA 3CH5A 4MGZR 3V4FA 2FEOA 2R2AA 3V4RA 2AD1A 4WZAE 3U61B 5L3VA 2YNMA 1XJQA 4LHXA 3W2FA 3CLVA 4DLSA 3U3KA 1ZU4A 3NBXX 2GBLC 3B85A 3PENA 3ZD7A 5DI3A 3CRQA 1VCIA 3KXIA 3F0TA 2QQEA 3QKSB 1Z08A 1KY3A 2RB4A 1QHXA 1XTRA 3SJBA 3T35A 1E9CA 2VEDA 2J0UB 2WJGA 1E99A 4JKIA 3VU9A 3CPWB 5LPNA 3DOFA 1I4DD 4D4LA 2WJHA 3NHBA 4Q4AA 3O8RA 3ZD6A 3TIFA 2G0NA 2QT1A 2F1RA 5ANRB 2RH5A 4IVQA 4AK9A 1ZUIA 1G1MA 1ZVQA 2F3RA 1T8UA 1T91A 4GRAA 3HJNA 4IRUB 5BW8A 2YV5A 3AH8A 2ODEA 4M1SA 2QENA 2Z4SA 4Y0AA 4B3BA 1OH6A 4Q9LA 5EXXA 4FWIB 1NMYA 3OZXA 5EE3A 4B6EA 1GKIA 2QU8A 4UAJA 2P67A 1E6CA 1GL6A 3GFOA 2QPOA 3KJIA 2VYFA 3FHCB 1MO6A 2IYYA 4CZ2A 4NKRA 3ZDQA 4P6VF 4WW0A 4ESHA 3D8BA 2QMUA 3ZZ0A 2PX0A 4II7A 3QXCA 2BM0A 5HE9A 4TMKA 3HP1A 3AQ4A 1XWIA 3CC2B 4EH1A 4LYFA 3JVVA 2HXSA 4UXHA 2OBNA 3U5ZB 2XJ4A 1P9WA 1TLLA 4Q4JB 3B1XA 3D6TB 2OCYC 4XTCS 2OHFA 4D4MA 2O8FA 2GAOA 3IIMA 2QA5A 1XPOA 4QBIA 4XSHA 3BB4A 1OHHD 2LP6A 1CLUA 2EWWA 1Q20A 4UNNA 4ZI2A 4LWZA 1ZC4A 2ZE5A 4PANA 3VAAA 4DKXA 1AJEA 1NF3A 4LSGA 2GETA 4LV8B 4Q1CA 2ODBA 3KZ1E 3J81k 2C04A 5FH9A 2RHDA 1I2DA 3EA0A 2VF7A 4DCNA 2O5VA 4LJ8A 4L5BA 1UBFA 1T6NA 5C18A 1F48A 3CONA 1YR7A 1GUAA 1LY1A 1RRFA 3MRSA 2JIZA 1J8MF 1Z6YA 2CNWA 4M1MA 5H5JA 2OFOA 1OFTA 2WPDD 4C7OA 1E94E 4D26A 3NBFA 1W0KA 3FB4A 1WBDA 4XIGS 2R8RA 5JI2E 1C4OA 4P4SA 1ELOA 2OTJB 3W2GA 1G6HA 4NCHA 5FOVA 3DM5A 4TYWA 3DKPA 2FPMA 3AF3A 1W87A 2OT3B 3K53A 3QPVA 3B9QA 3U44A 1A82A 1ZM9A 1M7HA 1VQLB 3BB3A 3IQXA 1OXUA 1E4VA 4HZIA 3CCRB 2GVZC 1FQKA 1TVCA 2Z0MA 2P6RA 4D4KA 1E2NA 3ICEA 4D0NA 4B3XA 1Z6TA 2DPXA 4URWR 3W5IA 1AQYA 3I32A 5KDOA 2ZM5A 4C30A 4JKYA 3FMFA 4L8GA 2HEIA 1X8JA 1XTQA 4H9GA 3WP0A 4DDVA 1UKYA 3I3SR 2JLUA 1WRBA 1G7CA 4UXJA 2XB2A 1IY1A 3LX8A 2R6GA 3BH6A 4HEJA 3X1DA 5ELXA 2V9PA 3L82B 1QVFB 1KDRA 2CL7X 2UZ3A 4KJZA 3CXCB 1Q1EA 3RSLA 4OHZA 2WM9B 4OYHA 3THYB 2BEJA 3K1JA 1T9HA 3HR7A 3AF1A 3OIYA 2G3YA 4P4TA 5GJCA 3VKGA 4NH0A 4P4UA 1A2BA 4M9SA 1KSGA 1NVXQ 1KK3A 3PUYA 2GBLA 2XSZD 4LGMA 121PA 3KJEA 3FKQA 3LLUA 4KBGA 2NGRA 1TF5A 3R9IA 4BEBA 4NMMA 1VQNB 2EVWX 1GAWA 2MSDB 2VHJA 3KTAB 4PHGA 1T5IA 1SVWA 2ZI4A 3OE7A 2G6BA 1MKYA 5G40A 3ECCA 1K6MA 1D2MA 3A1TA 1NLYA 3SBDA 1ESNA 1G3MA 4HSEA 5FUXA 5FTKA 3NBZC 1KJYA 3GCGA 3OIVA 4BFWA 3ZZTA 4AY2A 2NOAA 5J4HA 1HT2E 4B2IA 3P20A 1DE0A 2P6NA 5C46F 1QHIA 2BC9A 2R6DA 4QJ3A 4ZIRA 5JS7A 4B75A 1H8EA 3GEHA 3RRMA 4LV5B 1KI1A 4XWOA 3UATA 2JLZA 3CX8A 4CEHB 4HB0A 5EE0A 4P0TA 4TYNA 3BC1A 4EAQA 5CM8B 2QTHA 1Z22A 4ZKEA 2HJVA 5UKDA 3CWZA 1BX1A 4A2WA 1NN5A 1N6HA 5HR5A 4CYMA 2VNJA 1FL9A 4M1KA 2WWXA 4HYYA 3K09C 2DETA 3TGPA 4BE7B 1CR2A 1Q1QA 3OAAD 3X1WA 3MGCA 4A6XA 1V43A 1P62B 2OZEA 1Z29A 1XNJA 1PUJA 2B8TA 3D7MA 1H85A 1HURA 3M1IA 1HEIA 1OIXA 3A4LA 2CVFA 4FK8A 1UKVY 2BBOA 3U3OA 2NO9A 4EPVA 2IW3A 1J2JA 3N2IA 4EUNA 5EXSA 3TSZA 521PA 1P2TA 1KI7A 3P4YA 4AD8A 1ZD1A 2VA8A 3H2YA 2JA1A 1PJRA 3EXAA 4RZXA 5J4VA 3SNHA 3FTQA 1E79A 2DFTA 3ND8A 3GFTA 1PLJA 3K0SA 3FHOA 3RS7A 2QTLA 4Q4HA 2PMKA 3SYKA 3KXLA 4CEJA 4HDCA 3FMPB 2GJKA 2PCJA 3FVQA 2A78A 4F93B 4GI7A 1AIPA 1B2RA 2PH1A 2WAYA 2HDNB 4TWZA 4WIAA 4EFNA 4LHVA 5JHHB 4D81A 5AN9A 1GRRA 4Q19A 2GJ8A 2OV2A 3B2EA 2XEXA 2V8OA 1S1CA 2PZGA 1NKSA 2ZI6A 2F6RA 3CNLA 3I56B 4S35A 4DDUA 1I4TD 3VR1A 1CJMA 2V4ZA 1Z0DA 1TAGA 4QJ5A 1QUEA 5B58C 4LI0A 5CB6A 2AWNA 1R0XA 1EX6A 1KI9A 1FZQA 4B6FA 3GLIE 5B30A 4HAYA 1YE8A 2ZRDA 1X8KA 1E2GA 1KTVA 1I4LD 4E07A 4JLOA 3ZGXA 5CDFA 1J7KA 5JWRA 3GLHB 3IUYA 3GLFB 2CHQA 4CT5A 1SVLA 1TQ6A 1VQMB 3LVRE 3ZVMA 3QXXA 1QHHB 2CE7A 2UKDA 3AP2A 1OXTA 4G1VA 1JPNA 3AUXA 4OL0A 2YOGA 3TUIC 3VQTA 4EPYA 1QF9A 2R44A 3TW8B 2OFWA 2QL6A 2RKOA 3LA6A 4URYR 3THXB 3AVYA 3PV0A 4UQOA 1KKLA 2XXAA 2IWRA 1QVAA 2QE7D 4QGAA 4R2HA 1E1QD 5FPHA 3OESA 2FFBA 5JRZA 5KU1A 1OV4A 2Q6TA 4KU4A 4R98A 3W2HA 1A1VA 1KDTA 4YAFA 3CH4B 3TVDA 3I4LA 3C5CA 3JZMA 2ZS9A 4FI3C 4NBSA 4Q9KA 2BCGY 1OFUX 4B73A 1H65A 1QDEA 3A36A 3BRWD 3QEJA 2FWRA 3CCEB 2OK8A 2J41A 2NQ2C 5JWHA 4BFTA 4Y7CA 3TAHA 4LBZA 2X19A 1OHHA 1EWQA 4C0JA 1DAFA 2I4IA 3I73A 5KSPA 1B23P 4AYTA 5TARA 5HPYB 5DIFA 1VPLA 4TLAA 1W36D 4TYYA 2GILA 4QNMA 3T1VA 4C0LA 4C3ZA 3HYRA 4YAOA 4NL4H 5L3SB 3CRVA 1R0WA 2QNRA 2C95A 5CIWA 2G9NA 1KO5A 1KO8A 1Z6GA 1DARA 2CCKA 3QPWA 1YVDA 2JLWA 3WYAA 3G0HA 3KKMA 2WWIA 1IN6A 2RC5A 2OUKA 3GJ5A 1TMKA 2VZLA 4LBVA 4B44A 4A82A 2VP4A 1XMJA 1JPJA 3ZIAD 4Q48A 2ZSBA 2DYKA 4ZPXA 2XZOA 1E32A 4HB3A 5FTLA 5B2ZA 2I1VB 4B76A 1K8RA 3ZJYA 2AXNA 2YOHA 3SI7A 4M4SA 1RYHA 3BFXA 4MYHA 4Q01A 1OXVA 4ZO4A 1R4AA 4KLZA 4PQFA 5FOUA 4DLWA 1CJKC 1WBBA 2QAGB 2ZANA 3IBGA 1GOTA 1KI2A 3LXRA 3KL4A 3OZVA 4X8OA 4QG7A 1CJTC 2E87A 5A5GA 2Q0HA 2DERA 1XCMA 3HYTA 3K09A 3VX3A 4MKFA 3CCQB 4QM6A 5CIQA 3A6PC 4D4JA 1GAJA 2EYUA 1CQXA 4NYJR 1G8HA 5KSZA 3PG5A 4NCKA 4JL8A 1WP9A 3BH0A 1JA0A 3C8UA 1D6JA 1TF2A 1OGJA 4NYJQ 5JBQA 1XXHE 4WVFA 2VSXA 1XD9A 3WHLA 2A9KA 1ZMXA 1A7JA 1EP2B 1L4YA 3K9LA 1Z2CA 2NZ8A 4GL2A 1QG4A 1N6OA 1JQJC 4AYWA 1NSTA 2BKUA 4LJYA 4YALA 1M2OB 1KNQA 3EC2A 4L9WA 1SKQA 2BWJA 4RD2A 1X1SA 2AKAB 3I5YA 1W36C 2CDNA 1G6OA 3TW4A 5TMPA 5J5CA 3GLGE 1L4UA 2IA5A 4F4JA 1R10A 3NVAA 3WYGA 1DAKA 3CB4A 4HLCA 1W34A 3CPEA 1RFLA 5JSZB 4LOAA 3AEZA 4B3DA 5FI0B 1DTSA 1EWRA 4EFMA 4Q7JB 3T12A 1M74A 2J0SA 2WKQA 3AP3A 4OJKA 2VSFA 4XD7D 1SHZA 1AGPA 2CL6X 5HCIA 4ZGQB 3Q5DA 1G3RA 1E98A 3AKCA 3W9YA 4RZ2A 2IXEA 1VECA 2PT5A 1GKYA 2GZDA 2FNAA 3P1JA 5KHOC 3R8FA 4MDEA 2CCJA 3QVVA 3SS8A 4RCYA 5DISB 2XTZA 1COWD 2ZJYA 2ONKA 2W2XA 3GEEA 2ZVPX 1FNCA 1ZINA 1PZNA 1F2UB 1GRQA 4N0EA 3RRNA 3T61A 1DADA 3QF4B 2SHKA 3PXGA 5DYIA 2O8DA 2A2ZA 4NCNA 1IXRC 1VHLA 1KJZA 3IEVA 1JA1A 4BLTA 5DNYB 4HAXA 3OAAA 4EJSC 1FTNA 3W5JA 1VG1A 3W6PA 3O8DA 4S2EA 1Z07A 1E2KA 1Q22A 3KFVA 1SXJE 3GFPA 3RAPR 2YJTD 4BFVA 2R9VA 4MKIA 4U5XA 4ITRC 1KAGA 2IYUA 3BORA 4POAA 4JSYA 4DXAA 3ND9A 2QI9C 1XCGB 3SR0A 3TMKA 1CU1A 3H84A 1DAEA 1ZD8A 4Q1AA 2IF2A 5E7MA 2BGJA 1AN0A 1GVHA 1FPMA 5GJBA 1DEKA 2G83A 4AYXA 3AGPA 3I8XA 3TR5A 4IDNA 4C9BA 1W5TA 5EZ5A 1FX0A 1UEIA 1Z5ZA 1E9EA 4IFEA 1NN3A 1JR6A 1U8YA 5FTNA 3FKSD 1VCOA 4GOJA 1CBUA 1IJEA 1KY2A 2GCOA 1XMIA 2MMGA 2V55B 2D3WA 1W35A 1N8RD 4OQNA 4MH0R 2AR7A 4M21A 1KD1D 2WJYA 4DT1A 3EPJA 5LD2C 1ODFA 4UKDA 4PSKA 1YKSA 1G7RA 2GXUA 2OG2A 5EUQB 1YJNB 1DPFA 3SDZA 2GCNA 2ZJOA 5FPKA 3R7WA 4TL7A 3THWA 4PO1A 4IXNA 1OLOA 4JL6A 4DB4A 4PQRA 2V6IA 1R5OA 3OFND 1RE0A 1XDBA 1AKEA 2RGXA 1W2HA 1JAHA 3KB1A 2VNHA 1YIJB 4G5RA 2CNWD 4N0DA 4E5UA 5FR1A 1T4GA 4LZZA 4LYAA 1OXSC 1FOEB 5THXA 2O8BA 2YWEA 1KZGB 2ZRJA 5EE5B 4NYIR 1GNQA 3IQWA 4MKHA 5DHFA 1S3SA 2DEUA 2WV9A 3BK7A 4Y9RA 3PVSA 5HE8A 2ZSEA 3RHFA 4MDFA 2VIIA 4NYIQ 2Z4RA 4I1SA 4OI1A 2YWHA 3U7FB 5LB2A 1XX6A 2CBZA 3QXHA 4LUCA 2FJUA 1XJCA 3BXZA 2HF8A 3E5HA 2WWHA 5HKKA 2QE7A 1E1QA 2W2VA 1GITA 1GIAA 1XD2B 4JLAA 2ORIA 5CJPA 3UK6A 3FOZA 3A1UA 3BS4A 4BRUA 1Q21A 1AZSC 3A58B 2FSGA 5KO2A 3PUZA 1Z2AA 4P33A 1VG8A 4Q21A 1R5NA 4PGOA 2IYZA 1II8B 1P72A 4MRRA 4XVUA 1CEEA 4RD0A 4QFMA 4DCTA 1CRQA 4NPHA 1NVWQ 3EWAA 3W2IA 5JI3E 4B48A 5HXBA 1ZNYA 4PC7A 2XNSA 1SZPA 2GNOA 1S1MA 3QKRB 1W0JA 3E1SA 4US0R 3WNBA 3ZBUA 1EFTA 3AM1A 1KZ7B 2VRWA 1XTJA 2YINC 1QUFA 2IX3A 4CIDA 2NTYC 1US8A 3I8SA 2FH5B 3OJXA 3AF4A 4O2RA 1VDZA 1OB5A 1NMZA 1KDOA 2KB0A 2JLRA 3LQRA 4Q9HA 2ZI3A 1X6VA 4UNRA 3CIOA 2BCJQ 3LDAA 4RZUA 1EK0A 3ES9A 1KI6A 3ZIAA 4AF7A 1IQPA 1K8AD 1T8TA 1CRPA 4ZDWA 1FDRA 2NZJA 4BLOA 1BS1A 2Q9CA 5DH9A 4AKHA 1MABA 4L16A 1KOFA 4G0NA 1G8YA 4HZUA 5DI3B 3OF5A 4DWJA 4B33A 2ASEA 4W5WA 2O8CA 1R2QA 2QDXA 1P2VA 2FV8A 2VP2A 2GPJA 2WAXA 3QIAA 2ONJA 4A0HA 1S8FA 3VU9B 2JEOA 1IJFA 2OCBA 3OW2B 1U0LA 3ADKA 1KO1A 4V0ME 4DLYA 4HLUA 2QM7A 1Q0UA 4Q4AB 3B1ZA 4EJSA 1AS2A 1SKYB 4JLJA 2Z5FA 4LHWA 1E96A 3SEAA 4K81B 2IS6A 2GXQA 2ZRAA 1FP7A 4KV9A 1XBTA 3RS5A 3FDIA 4U7DA 4LJAA 4F7WA 1SGWA 4E22A 1G5TA 2IHYA 2FN4A 1GG2A 3O8BA 4L4UA 3VHLB 1PUIA 1H8HA 4JIMA 1E2EA 2AK3A 1EP1B 1M1KD 4EPWA 2ZUCA 4QRHA 3U7GA 4RKFA 1N0UA 4JL5A 2ZJBA 1ZIOA 3RS0A 4D0GA 5JWOA 3SFZA 4BUJA 3UMRA 2WWWA 1TNDA 3MMPA 1QVGB 1RRGA 2CJWA 3B1YA 2FGKA 3KKPA 4LC0A 1W49A 2P2LA 5EQTA 3JQRA 5JS8A 2C99A 1CS4C 1N6LA 5F98A 1KKMA 1J99A 1E79D 4Z54A 2GRJA 3FMIA 2QP9X 1GDDA 3LX5A 3RRYA 4TL8A 2W58A 2GF0A 4CEIA 4JVSB 1XF9A 2O8FB 4G1UC 4BFSA 2F1JA 3CF6R 1BO6A 4D2IA 2F7SA 1A5TA 3SHFA 1YR8A 1P9NA 4PAOA 2ZUDA 4OHVA 2GK6A 2ZPTX 4RKEA 4LK2A 1E9SA 4XD7A 1JEDA 1VQ9B 3CCJB 4DZZA 5H1YA 3SFVA 3W6NA 1PV4A 3QNUA 3OHMA 1YR9A 4KHZA 3SOPA 2FU5C 1S3GA 1KK1A 1COWA 4BFXA 1AMOA 5EUMA 5KPJA 4BLSA 4Z8XA 3PUXA 1M6NA 3U7EB 4DDTA 4HUTA 3RS2A 3EZ7A 5FPTA 3RLFA 4FD2A 4P32A 1AS0A 4XVRA 2OBLA 4C7OB 4WAUA 2D2FA 1XPUA 3CW2A 2ZROA 4LBYA 4Q1FA 1M7GA 2R6HA 1OPXA 3ZVNA 4KCGA 4P4SB 1RJ9A 2ODWA 3CNNA 1F60A 4F38A 5H59A 3BWDD 2AXPA 2AWOA 4IOMA 4Z8YA 3VMFA 5EXPA 5M04A 1U99A 3U44B 3U60B 2EYQA 3PJRA 2AD5A 1XZQA 4QGGA 2GEVA 5IF9A 4N3GA 1HYQA 2DWOA 2PX3A 1UAAA 3MAAC 1Z8FA 3RS3A 3VR5A 3WNDA 3BBPA 2WWYA 1Y3AA 2FEMA 4F4CA 4E09A 4PHTA 1HTWA 3CX7A 1E69A 2DHRA 4G1BA 3W90A 3EPKA 2QZ4A 2WJVA 1TEXA 5AJWA 2ZIAA 1QVRA 4O3MA 1D9ZA 2CLSA 5DGXA 4JLKA 4HAUA 1GP2A 4CW7A 1XMSA 3DO6A 3FKSA 3E2IA 4TQAA 4M1YA 3JQQA 2QBYA 1E2DA 4O25A 3QI2A 3RABA 4BRWA 2PZFA 4Q7LA 2ZQ5A 2J46A 5KOYA 4JBYA 3Q72A 3GJXC 3I61A 5DE3A 3AB3A 2F1IA 4V0OA 3K0EA 2JGNA 3BE4A 2IYSA 4UNQA 1M1YE 1RKBA 2F9LA 4Y9UA 3OFNA 3CRW1 1VQ4B 5KDLA 3QKSA 2RC6A 5JCZA 1E9BA 2OSBA 2ZTSA 3NTUA 5FOTA 4F4IA 2C9OA 1YJ9B 3L0IB 1KI8A 3BAFA 1W7AA 3CR7A 2ZI5A 2ATVA 3W3AA 3L0PA 3EIEA 4TN1A 3NKVA 2R6CA 4TQUS 4KITB 4ZIRB 1WA5A 2ORVA 4FMBB 3WBJA 3PUWA 3TK1A 5DYGA 4HB4A 4A6PA 4DEXA 3LW7A 2IUTA 2DY1A 3U7HB 2REBA 2BMFA 1VYVA 3VFDA 4F91B 4AG5A 3TRFA 1AM4D 3U3JA 4HI0E 1PVOA 3NH6A 4ABYA 5JJLA 1Z0FA 2UZIR 1N25A 1XEXA 3TSOA 3KQKA 1S96A 5DO9A 3BGWA 5BXQC 1VQ7B 2CL0X 5KSOA 1D9XA 4HDOB 1H42A 1DOAA 4GBMA 3UMSA 3QY0A 1P5ZB 2PLRA 1OYYA 1UM8A 2HJGA 1KO7A 4R7ZA 3RYTC 1E0KA 2B7BA 1XD8A 2VP6A 2VP0A 1YZQA 4RD4A 2VYQA 3QOFA 1WMSA 1ZM2A 1W48A 2P5TB 4BPBA 1VQPB 2GF9A 3VNUA 1YRAA 4O0MA 2AFHE 1SVKA 3CMAB 3B13B 3CPJB 4YQFA 2W6JA 4WA7A 5EE1A 4TMWA 3RRZA 1TQ2A 2CLCX 4ERNA 1SXJD 1R7RA 1KYIA 2F55A 5BYJA 1UF9A 2HUPA 1XEWX 2J45A 1OYWA 1BH2A 1HH4A 4LC1A 4I1UA 2ZI7A 4YDSA 4FINA 3K8YA 4Q4HB 4CEJB 2XB4A 2DWPA 2JLSA 3G4SB 4K8OA 1Q44A 2DFLA 2Q9AA 2J9RA 4W5JA 4DSUA 4NP6A 4NYMR 3PEYA 2QG6A 2IUUA 2CE2X 1NVVR 5LB4A 4TYPA 1CIPA 2DR3A 4NYMQ 5B57C 1MOZA 3FWYA 5EXTA 4LX0A 1NVVQ 4MA4A 4MRSA 2A5DA 1RRCA 8OHMA 4MITA 4B71A 3CCSB 5BN3A 1WE2A 1X3SA 1D8TA 1GWNA 3SN6A 2H18A 3X2SA 4UNPA 2YWGA 4M1WA 3I62A 3DHWC 3ADDA 4FMDF 1WB9A 4QL3A 3NDPA 1E9AA 3V9PA 4RJLA 2HYIC 4DLRA 2ZETA 3A8TA 1W44A 1L2TA 4MUAA 3TNFA 4BECA 3GLIA 2NMVA 4TMZA 1FUUA 4FXPA 1VQ8B 2D7CA 3RANA 1AA9A 1MO4A 2RGDA 3T5GA 1BMFA 2L0XA 1W5SA 2HYDA 1ZW6A 2ZRLA 1X1RA 4HE5A 1E1RD 3RS4A 3B1WA 2XXAB 2QRZA 3MWYW 4OI2A 1ZBDA 3GJ7A 4JT2A 2LKCA 5JFGA 1LV7A 1Z0IA 2BMEA 2B6HA 3L0SA 1E0JA 4PC2A 2WKRA 2AFIE 2OK7A 3DEFA 2GXAA 3AVQA 4IEIA 1UMKA 2X1VA 2JATA 3EIQA 2X2FA 3AVTA 3Q9LA 2W0MA 3WHKA 3PUVA 1OH8A 3OZWA 4JZKA 2E9SA 1SXJC 1NLFA 2Q21A 1MT0A 3CRMA 1E62A 1ZIPA 3Q7PA 2NPFA 1P7CA 3KTAA 5FI1B 4Q7KA 1U0HC 1YZLA 4PFSA 4TLBA 4GP7A 2EU8A 4PZZA 4US2R 4DUGA 4AI6A 1XE1A 2BN4A 2OLKA 3D31A 1TUEA 5KPDA 3SQXA 1VG0B 5JLJA 2RGBA 2AHOA 2ZVQX 1FMJA 1IN8A 3BH7A 1MRNA 2ZAOA 1JAIA 1Z47A 2OESA 1YZTA 4IOKA 3K70D 4B3GA 5D3MA 3EC1A 2JLQA 4JT4A 4MYUA 2LCFA 4JLPA 3TLXA 3ZYCA 2YHSA 2WJIA 2IS4A 5TDHA 1T3HA 4PAMA 3CNOA 2BKEA 4RY2A 3AVOA 1XTIA 1CJUC 3QEOA 4DLZA 2EW1A 2D2EA 1UPTA 1EX7A 2MMCA 4CDGA 2QRNA 3WMFA 5HKKD 4GMDA 2V1UA 1U9IC 1YZKA 1Q82D 2IEYA 4QHSA 1CNEA 1YU9A 4Q5IA 4PZYA 4I4LA 1MO3A 4Y0VA 1G3IA 2JDIA 4GOXA 4KODA 3C15C 4YDHB 1G17A 3T15A 1NJID 4PR0A 3EA5A 3TBKA 4QBHA 5BYKA 2VTKA 1J8YF 1O3YA 4TTQA 1KSJA 2P0EA 2C2HA 4TQ9A 6Q21A 3U4QA 3T06B 3LO5A 5H8WA 3FYHA 1YR6A 4HUQB 4HAZA 3C14C 1W0JD 4BFUA 4ACAA 3F5FA 5TB5A 4URVR 4Q02A 2J1LA 1R8SA 1F2TA 1N5LA 1ESMA 1DO0A 2IL1A 3SJAA 1W46A 4ARZA 1RVDA 2VP9A 2G1JA 2KSQA 2HXYA 3U3MA 3PFIA 1XXHA 2BJVA 3QG5A 4LPSA 4KFRA 2BMDA 2YVUA 4MUBA 4A1FA 1CP2A 5CK5A 2X3UA 821PA 4Q00A 3QFTA 1EESA 1KMQA 221PA 4FWTA 4Z1MD 3O8CA 1FFHA 3IILA 2ZU6A 1LW7A 3SYNA 3QJYA 3PITA 4IVPA 5F2EA 4X8HA 4TLCA 3B8HA 3MJHA 2EWVA 4U02A 5L3QA 4ZGNB 4C0SA 3IPYA 1R6BX 3WP1B 1XU4A 1Z63A 1IOZA 3NC0C 1D2EA 3OZUA 3GLGA 4TTRA 1T0JB 2H92A 3VKWA 3ETLA 3FJOA 3K70C 2RGGA 3NWJA 5C1BA 4GT1A 4WXRA 1G5RA 1CR1A 2QTFA 1N6NA 2ZRCA 3ZH9B 4ZCLA 3GP8A 4JBXA 1UEJA 3BFVA 1KSHA 4AKEA 4MGYR 3UG7A 4MGKR 3SE0A 4A8JA 1C1YA 2VHQA 4YHBA 2G88A 2RCNA 1W1WA 2HT6A 2R6AA 3PR1A 5HCNA 3IIJA 2PIAA 1RZ3A 4EPRA 1H8HD 3AV0B 2O0KA 2O8DB 4P31A 3GEIA 5FFMA 4L9SA 1MO5A 3U6BA 1VCMA 3CRZA 1YRBA 3V00A 2GJAA 4R71A 4PAQA 1KRHA 4RSGA 1NBME 4B74A 3LWNA 1CR0A 3LO8A 2QN6A 1NG1A 1IN5A 2RGAA 2VQSA 2OILA 4AF6A 3B9PA 4C0BA 1JB9A 5AR1A 4G01B 4AURA 1U8AA 1E0SA 1YI2B 1C9KA 3K0FA 4RZ3A 5CLQA 3S1AA 2BVNA 1SXJA 1KHTA 1VCNA 5KDDA 2KI5A 3I55B 2O52A 4DIEA 2Y8EA 2IUSA 2R65A 1UDWA 2GVDC 1G8FA 3L8YA 4TSFD 2QP3A 1BOFA 5L3SA 5H70A 1QHYA 3EARA 1QH0A 2ZS7A 3VR6A 4JYCA 1FX0B 1Z28A 3MJRA 4KI0A 2YC4C 3GLHE 1P2UA 3GLFE 2EFDB 1KK0A 5DLQC 5FR2A 1U94A 1DDIA 1PLLA 2GCOB 1SVOA 2QGNA 3HU3A 5J4YA 2LKDA 4DT1B 5H68A 2ZYTX 4B4DA 4MRPA 3H1TA 2PMDA 4IOJA 1CTQA 1G8PA 621PA 3AVWA 3W8RA 2I3BA 3THWB 4XH9B 2ZREA 1MRSA 3L0OA 2ECKA 1DG1G 1GR1A 1Z0AA 1SVIA 4HATA 1CJVC 1F20A 4EPTA 2PZEA 1GL7A 1Z6XA 1U9IA 4M22A 3RDPA 3THOA 5DN6A 1VQ5B 5D3QA 4HLUC 2O8BB 4Q66C 2FFAA 4GFDA 4ILEA 3O47A 4FCVA 4WQMA 1N5IA 3NG1A 1E9FA 1JXMA 2JASA 2RGNC 4G5OA 1P61B 4M9XA 3I1FA 1W4BA 2IYWA 3LW8A 1KMHB 1E1RA 1LS1A 1N0WA 2QTVB 1IY2A 2XTNA 3C7KA 4LCBA 4B2LA 4BFYA 4W5HA 4EQ6A 5FOWA 2FA9A 1ZM7A 3BFKA 4C43A 1YJWB 1XTKA 4GZLA 3MD0A 5E95A 4IW3B 2QEXB 2WOOA 1VYTA 2JJ2D 1QRAA 3OEHD 4ESVA 2XGJA 4DLTA 2BMJA 3ZVLA 2IYVA 2C9CA 3K0CC 1FMLA 3LH5A 5HZKA 3HPRA 3CD6B 2FPKA 4YLGA 3KJHA 1OW3B 1VYUA 2GQFA 3G82C 1ZM4A 4C2TA 3OIUA 1KI4A 2QUZA 4I81A 4FW9A 4LYHA 4NTZA 4Q1BA 1ONBA 4FMCF 5AWFC 3B6EA 2DWQA 1UKZA 3TKLA 1W36B 4ZCIA 4WXPA 2FGJA 4DB2A 2QM8A 1JR3E 5P21A 4ZKDA 5FL7D 4OHWA 1OKKA 1NIPA 3A4NA 3CF2A 1ETUA 1US8B 3QKTA 1CNFA 4XSGA 2F43A 4IXMA 4DC9A 4GOKA 4HE6A 1MR3F 4QGHA 4MYTA 4A4DA 1TADA 1Z83A 3DZ8A 4DSNA 4PO8A 1UADA 3AGQA 3EZ9A 1KI6B 3VTKA 4KSBA 1JNYA 2LWIA 1N2CE 2GWHA 4OK5A 4CGZA 1W4AA 3VR3A 2O8EB 3TH5A 4BLRA 4V02A 4QBFA 3RNLA 1F6BA 3IGFA 1MABB 2IXGA 4TL9A 3C4JA 3LBIA 1NG9A 4HZUB 2V3CC 1BKDR 5SZHB 2ZRPA 1FTSA 2HF9A 3QKUA 4B3CA 2WIAA 4DCUA 2O8CB 1E4YA 1QHGA 2R62A 2BJWA 1WCV1 4PX9A 3EZFA 1GSIA 3JQPA 3VHXA 4O2LA 1OGIA 2A5FA 4IOLA 4KVGA 1Q3HA 3BIFA 1BX0A 4OQLA 4EJSB 4PTLA 2NO0A 3EZ6A 4Q7MB 5A0FA 4V0MA 2WSMA 2O0JA 4OI4A 1QBKC 4D0LB 2CRVA 1X86B 3CX6A 3I5XA 1GNRA 1MV5A 3DVLA 1X8LA 2WTUA 4JLMA 3ASYA 2Z43A 4G3XA 5F3WB 2J3EA 2NG1A 1CXZA 2GJ9A 3B60A 4P3YA 5FUWA 2JJ1A 3AF0A 2P3SA 3ZBTA 3EIHA 1JJ7A 1ZRHA 4OKSA 5GVRA 5GVSA 3FPKA 421PA 3IO3A 2BIFA 4HLQB 2W6JD 4YXWA 3IPXA 4DLXA 2OAQ1 2XOKA 2B92A 2IYLD 3F3YA 4TLDA 4KO8A 5K8UA 2J7PD 2IYTA 2ZJ8A 3TSWA 2PLFA 1P60A 3KJGA 3UIEA 4TYQA 3KQNA 4Z1MA 1G8GA 1G4UR 4QKQA 5EMNA 5FPSA 2GZAA 5LD2B 3TR0A 4CEIB 3QG1A 1B0UA 2NO6A 5JEDA 1TQ4A 2W83A 3UXMA 2BV3A 3CC7B 1WDTA 1NN0A 3KKQA 4NCIA 5GJVC 5JRJA 3CF0A 1T3LA 2V54A 4AWXA 3VKHA 5JZVA 5C2JB 1VKJA 2CNDA 1K9MD 3AKYA 1TF7A 2G1KA 3QE2A 3C41J 1FNBA 3ZVRA 3Q5EA 3FE2A 5TV2A 3A37A 5JCPA 3RSOA 2GZHA 2N42A 4B34A 3QQ5A 3EPLA 2RGNA 1VTKA 2B8WA 1DAMA 1NLZA 1WQ1R 1EFCA 3QSYA 2GK7A 4UJ5A 3ZS9A 1P3JA 1G7TA 4B35A 1DELA 1P73A 2QPAA 1Q57A 3LRPA 2DFKB 5K8LA 3NHAA 3E70C 5HTKA 2C98A 1N0VC 2VHCA 3F8TA 1SHKA 2EFHB 4NCJA 1ZCAA 5AUQA 2BDTA 3QFCA 1S4QA 1BMFD 3X1YA 4A2QA 1WXQA 3LD9A 3X1ZA 1XFAA 2V7QD 1TU3A 2B21A 1RIFA 1D2NA 2G77B 4DVGA 4XJXA 2JCSA 1RJ9B 3K0CA 3DMNA 3Q3JB 4QM7A 4C2UA 1G4AE 1E3MA 5L8VA 1W2BB 5EP2A 1TX4B 1BYUA 1L8QA 1A4RA 1E2LA 2ZRHA 4LDJA 5E7IA 1GKUB 4KXFB 1XMVA 4MYCA 4PPGA 4XTRA 2WWGA 1Z0JA 4PPFA 3H86A 3QKRA 4ASUA 3PIRA 3SJCA 1DS6A 4LY6A 4TSFA 4EFLA 1FQJA 3OJWA 1E9DA 3DZDA 3K0AA 5AUOB 2C77A 3KUCA 1NP6A 2A3RA 3B1VA 4M2LA 3IHWA 2CK3D 1A8PA 1AS3A 2FE4A 5K8TA 1GO2A 4RD3A 4NZYA 2F1HA 3QXJA 4PHFA 1UFQA 4DSOA 3MCAA 3HR8A 3W3ZB 2QBYB 1V5WA 5AK0A 3AVPA 4DUGD 5AUPB 2FG5A 1R8QA 3LXXA 2ZYWX 1KAOA 1OE0A 4Q9JA 4G5GA 4G5QA 4IHQA 4JVMA 3LBHA 1F5NA 5B64A 2Z83A 3FPAA 2ZI9A 4RD6A 1NL3A 3M0EA 2W2TA 1ZUNB 1GL9B 1M90D 1HY3A 1EGAA 2HT1A 4GSYA 1II9A 4YAWA 4M1OA 4D25A 4N3NA 2V1XA 2QSZA 5DI9A 1DAGA 4HB2A 2D06A 4DCVA 1RYFA 5EJEA 4JLNA 5AJXA 5E7JA 5KNBA 5GV8A 2XNDD 1CKEA 3CRRA 4JS0A 3CBQA 2W6ID 2JDID 4RFSA 5IT5A 4YMVA 1VIAA 4DCSA 1E2HA 3N2EA 2IHBA 2RGCA 2JJ2A 3OEHA 3N5CA 2Q3HA 4LYJA 3VO1A 1DAHA 4OQFA 1OH5A 4ZV4A 2DFNA 1DG3A 1XEXB 3KQUA 5J47A 3NH9A 3VX4A 1VQOB 3LBNA 4KYUA 5BN5A 1FW6A 2A7QA 1KI3A 2REXB 4A9AA 3T34A 3VO2A 1UJ2A 1Q86D 1VQ6B 3DDCA 2CCGA 1NKTA 2EQBA 2ZJAA 1N5KA 3GQBA 3DKVA 2H17A 1BYIA 1MH1A 1DBSA 1ZP6A 2QP4A 3CR8A 3UMFA 5JMTA 4YMTA 3GMTA 3WMGA 1TEVA 1U81A 2ZSAA 2D74A 4TT3A 5FL7A 1A2KC 1NBMD 2QY9A 2BBSA 1Z0KA 3RC3A 1Z3IX 2KBFA 1E2FA 4QNRA 2XZLA 4OI0A 3IBYA 3K9HA 1SKYE 2ZR9A 5J4KA 4QOSA 2C9YA 4C0AC 2J0UA 2E1RA 4TL6A 5JEEA 1XZPA 4WZBE 3QXSA 4DRZA 3EPHA 3IEUA 1F3OA 2QORA 1VMAA 4UNSA 3KKOA 5FBVB 2WIBA 1XPRA 3AF2A 1QHSA 1XP8A 2WMNB 3QBVA 1AK2A 1ZAKA 2WKPA 4W7SA 4N1AA 5CLLA 2XNJA 2IWHA 1YHNA 3ZQJA 3UPUA 2VNIA 3H0KA 1RW4A 5BQ5A 1BJKA 1IN7A 2ZRBA 4TMTA 2VPPA 1FNMA 4G5SA 4IKEA 2KWIA 2VHUA 2VO1A 1E0AA 3Q8XB 2CVHA 4OHXA 2QMEA 1JQLB 3DL0A 4B32A 3E1YE 3WNCA 5C4GB 2IYXA 1ZCBA 2F9MA 4ON9A 1T0HB 1Y63A 4YONB 5TR9A 5KYKA 3GJ0A 4LJ4A 2GAAA 1KJWA 3IO5A 4ZDKA 5IK2A 2H1LA 1XCPA 2J7KA 3SJZA 2P6UA 2AK2A 4A36A 1P75A 1SQ5A 2HV8A 3GLIB 2PJRA 4CT4B 4DQLA 5IRCD 2ZJ2A 3KQLA 3TUZC 3PEUA 4Q4JA 1D1NA 2REOA 1CULC 3R9XA 3LV8A 3MSXA 3REGA 5FA6A 1YHQB 1M8PA 5J40A 3OEED 5TY0A 5CB8A 2J7PA 3G5UA 3UWKA 2BPOA 1KQSB 1GFIA 1YZNA 2CMKA 2QGZA 1I7PA 3KX2A 2ZRNA 4JLBA 4XWKA 2OM2A 1FP6A 4OK6A 3CUEF 2EFGA 2FFHA 2O0HA 2QTZA 1SVMA 1HE1C 3CC4B 4R2IA 1LS6A 3NIBA 3U3RA 2GJSA 4FIDA 2AKYA 3W2EA 4LJ9A 5TVKA 2C5LA 3RVBA 1Z6AA 2H5EA 4BZXA 1I2MA 1NVUQ 2VH5R 1U2RA 2ZS8A 3LAWA 3IIKA 3QFRA 1N6KA 2QT0A 4RFVA 4U9UA 1JBKA 1ANKA 2YC2C 1OFIA 2MSEB 2GEUA 5C4MA 1JR3D 3AKDA 4RCZA 4BGDA 1IONA 3L43A 3A1SA 1KGDA 1QGZA 2MSCB 2RGEA 2OLJA 2DCUA 3CCLB 2GXSA 5CYPA 5D3MB 5DN6D 5FOSA 4X8MA 1TL7C 3LLMA 1R5BA 2ZE6A 2JLVA 1YZUA 1FRQA 3LY5A 1DVRA 4BFZA 3A1WA 5AJYA 4LHYA 4E03A 1D5CA 2V7QA 5FUYA 1P4SA 2PL3A 4RVCA 5AUNB 3NDBB 1QZXA 4BASA 4TZ0A 1II0A 3IKJA 3GJ8A 4IEEA 1IXSB 2A5JA 4FMDB 3VNVA 4I99A 4WBSA 1KDPA 4URUR 3MLEA 1SM4A 2GEDA 2D4HA 3H4MA 1ZNZA 5KUTA 1ZD9A 1EFRD 2JAQA 2CHGA 3G6EB 3CZQA 4WZ6A 5FL3A 4C0KA 1NY5A 4LJ5A 3AVVA 3TQCA 3ZQ6A 2FZ4A 2PCLA 2X8AA 3QBTA 4Q9IA 3THYA 1LVGA 3U2QA 1E2PA 2XITA 3EG5A 4Q47A 3U4QB 2NO1A 2WZQA 1T5LA 2RMKA 4A2PA 1FNDA 5CJ2A 2YZ2A 4GNKA 3KQHA 1GM5A 2BBTA 2CK3A 4FCWA 4D6PA 4FN5A 4CF7A 4YAUA 2C78A 3FFAA 3WXMA 4GMXA 2ERYA 1F2TB 2WWFA 2ZUBA 3ASZA 1NJFA 2ZR7A 1OKKD 4ARZB 3REFA 1NDHA 3SBEA 1Q3TA 1NSFA 1SULA 1XXHB 5CITA 4UJ3A 2JLYA 2GCPA 2RAPA 2X2EA 3G71B 2VNKA 4QHYA 1LFDB 4DIDA 2P5SA 3MG9A 3I92A 3TUJC 2A30A 3T1OA 1HV8A 1WF3A 4K46A 3GPLA 2DBYA 3LNCA 1M34E 1P6XA 4YMSA 4QJ4A 3PEWA 1GILA 2N46A 2FSHA 3V76A 4A0GA 4CEHA 2ZSDA 3SC3A 2FPLA 4Q4LA 1JJ2B 5L3QB 2YOFA 2IYQA 1G7SA 4GPTA 3UWOA 5IHPA 721PA 1N6RA 2EFEB 2XX3A 1IB0A 3GLGB 1JJVA 2Q9BA 1QFYA 2QAGC 4PPQA 2NPIA 1OB2A 4M53A 1BQEA 2HLDD 2R6FA 3WRXC 2XNDA 2QPTA 1G19A 4KAXA 3LVQE 4A0FA 3QUSA 3C5HA 1HQYE 2W6IA 2A5GA 4BZPA 2GDJA 2OEPA 3N70A 5FTJA 1HUQA 5FBWB 4AIIA 1JALA 4Q1EA 1XB2A 3K9NA 1CF4A 5F9FA 3W5HA 3CWQA 2BM1A 2BMWA 4KSCA 1G64A 3MFYA 1QG2A 3LFUA 4IDOA 3MHPA 5KNDA 2OCPA 2ORWA 2GHIA 3IHLA 1S2MA 2FDCA 3PEVA 1QFZA 4HAVA 1G18A 2KE5A 1QHNA 3HWSA 2ANCA 2KBEA 3Q7QA 4DBLC 1S0UA 4PHHA 2GA8A 2P65A 4FCTA 3UG6A 2JJ1D 1N6IA 2QQ0A 1CR4A 5A4JA 3CCMB 2NO7A 2PBRA 4YXWD 4JVNA 3NC1C 2ZE8A 3MWLA 5KTYA 1G9XA 1SQRA 2XOKD 2XZPA 3A1VA 3CM0A 2OTLB 5L3RA 1FUKA 4URXR 4BQSA 3RWOA 1NBMA 1G16A 3VR4A 3T1TA 5FTMA 5E3HA 2QSYA 5EP3A 2WMOB 3S1AB 3K0FB 4A8JC 3LVBA 1SXJB 4V0LA 1NNEA 2ZITA 1EFHA 2WSSD 3EASA 4HLDA 2VLIA 1GVNB 4WOPA 1GRNA 3W6OA 1RRPA 1HQCA 2YYZA 4BWYA 2IYRA 3BERA 4OBEA 3CPHA 3Q85A 1LF5A 2BSAA 3FHTA 4LJ7A 4IDPA 2J0QA 1IY0A 1XTSA 3C16C 4KVAA 1VG9B 1LNZA 2ZRFA 5G3ZA 1IXZA 4MRVA 4Q18A 5CDFE 1OF1A 1NJGA 3M4YA 3ZLJA 3SZRA 3DMDA 4URZR 1YQTA 4OHYA 4V03A 3GLHA 4ZI3A 3GLFA 5GADl 3WBKA 3B82A 2J87A 4TMVA 2YKGA 2WPDA 1QHHA 5DHAA 1G20E 4BZQA 3BJIC 3KFXA 2BGIA 4IJMA 1NI3A 2I1QA 3A4MA 1GJRA 3THXA 4TTPA 3RC8A 1DO2A 3NEJA 1OXXK 4IVRA 1KC8D 1S72B 2CHVA 2CLDX 3AKEA 5G3YA 5FBQB 2VL7A 3T1QA 2IC5A 3M6AA 1YZGA 5G41A 1FNNA 1G41A 1NIJA 2ZEJA 1NRJB 4ZDJA 2OXCA 3UKDA 5F9HA 2ZR0A 3R8CA 3HU1A 5JJIA 4LRWA 3QENA 1AZTA 3L8ZA 3W34A 1J70A 2PJZA 2ZE7A 3KKNA 4YMWA 4L15A 4ZCMA 4US1R 2OO7A 1ZUHA 1KNXA 1OFHA 4MKGA 4QBGB 4DSTA 2ZJ5A 1EFUA 1W2GA 3OEEA 4KFTA 4HUQA 5KNCA 4JBWA 1J9ZA 1IAQA 2VHTA 5EZ6B 1BIFA 2OCAA 5FBRB 4EQ6B 4XVQA 2A5YB 2EFCB 2Z6VA 4ASUD 1JI0A 1G3QA 1HA3A 2VP5A 2W00A 1IHUA 3KXKA 3B78A 1U0JA 4GZMA 1E64A 3P26A 3P27A 3WYFA 4BPRA 4Z51A 4NU0A 4H1UA 1AQUA 1P9RA 4RD1A 1TU4A 4LJ6A 5FBLB 5KSWB 4IFBA 3FMOB 1VIYA 1U8ZA 1QGYA 3CZPA 4BLQA 2X77A 2XSZA 2EIXA 3AVXA 3BOSA 2IK8A 3CO5A 2IF0A 3AUYA 4QHTA 4A8JB 2GESA 4PZLA 2BHRA 4KFUA 2V6JA 3SYLA 2GTPA 1E2MA 2FFQA 1KO4A 3R7WB 3WMEA 4B47A 5KSYA 4TZ6A 2IS2A 2C03A 4M1TA 2WJJA 2F43B 5BN4A 2J5XA 3W8NA 4JMPA 1JR3A 2ZU0C 1Z06A 5CK4A 5CYOA 4A92A 2QAGA 3QFSA 5EP1A 3K70B 4JLVA 3MWJA 3KDSE 2PEZA 4YC7A 4CVNA 4J0QA 5SZIA 1AGRA 2HCBA 3QF7A 2D62A 5SZKB 2OAP1 4DLVA 1JB1A 2CEAA 1M7BA 3D3QA 4R9UC 4KBFA 1Q12A 3TJZA 4ZDIA 4B3FX 2YWFA 3GJ6A 4U00A 4IDQA 3AVUA 3KUDA 2N1BA 4ACBA 5LBIA 3I72A 1Q1BA 1QX4A 1FRNA 3JVUA 3SU8A 4M9ZA 2F3TA 3PCRB 4EPXA 2K5UA 2ZRKA 4Q1DA 2NIPA 4DEYA 2OE2A 4UXIA 1PLKA 1OIWA 3DPUA 3MWKA 2FSIA 2IS1A 1ZNWA 1EFRA 2G0TA 1LB1B 1G291 3B7GA 3EAQA 5SZJA 4V0NA 4B2PA 1DAIA 4PQYA 2QMOA 4D82A 4HDQB 2Q3MA 5JECA 2B7CA 3W5UA 2ZXUA 4PO9A 3JZAA 4MQBA 5JHGB 4NE2A 5FPYA 2BF4A 1ZC3A 4B43A 5EP4A 3U6KA 4JVLA 2D7DA 2ZYUX 1NMXA 1U98A 3VR2A 2H8KA 4TT3D 4OQXA 2ODNA 2PT7A 4YMUA 4AKGA 1RC8A 2ZJZA 4LV6A 3ONWA 3HDTA 2WVJA 4HAWA 1S9HA 3T5DA 5JSZA 1YITB 2FF7A 4LPKA 1OSNA 1OIVA 1UKEA 4W9MC 4JSTA 4NONA 3RWMB 1YJ5A 3QE0A 4BEJA 1OT3A 4D80A 2H7VA 1HT1E 1Q81D 2ZAMA 4FMCB 1VQKB 1P2SA 4DLUA 4PC3A 4CRWB 2WHXA 1TUIA 3TQFA 1O87A 4XWAA 2AL7A 2Q3FA 1N3BA 3QPUA 4NDZA 1VHTA 3IDQA 1U90A 2QEQA 1XJ0A 2QROA 3PQCA 4V0KA 1L7VC 1ZYUA 1NY6A 1F2UA 4NHOA
chains in the Genus database with same CATH superfamily
2VF8A 3HWRA 1VL6A 5IVKA 2JIZD 1G21E 3GJ3A 5FAXA 3OPQA 2ZDAH 5EVCA 4JI6B 4A5OA 3TFOA 1FNIA 1OJLA 3PVDA 3O1LA 1NN1A 5IC4A 4IHAA 2FVYA 3KOMA 4E5SA 2EL9A 3A7EA 5I7HA 1CVLA 3CNHA 2NSYA 3G9XA 3AZOA 1D6MA 3IDSA 3G02A 2QMHA 1T4VH 4QULA 3H05A 3GA7A 3FF1A 3FGNA 4LTDA 3SQHE 4KUEA 1UJNA 2IXTA 2PWYA 1Y3UA 2FOLA 5TX7A 3I23A 3ZVCA 1NJ8A 3E8SA 2PRSA 1SLWB 2O8EA 2C4VA 3FFTA 2ZAGA 5EL0A 2VBIA 1J33A 2OBMA 1HWYA 1L7QA 4K0RA 3U1IB 4Y1RA 1O6GA 4DRXA 1O3JA 1RS0A 4F92B 3U40A 3R3HA 3Q3KA 4LYDA 2D5AA 2G4VA 1AKRA 2ILTA 5JQGF 2FMXA 1YB4A 5CX4A 2E6UX 3KR0A 4WOCA 3MNSA 3CCUB 1ZU5A 4FUJA 1B15A 4QC2A 3C87A 3FFBA 4AG6A 1AKYA 1XRLA 3EFHA 1RIWC 1XEFA 4KYIB 2H9AA 5B4TA 1MQSA 4F97A 3A86A 2V7XA 1HDIA 3PF8A 2VAMA 5EMJA 3EXG1 4MTLA 4ZQCB 2JB9A 3SJBA 4XMYA 4MEAA 3PXBA 2B5WA 3NHBA 4BDTA 4N7MA 4F49A 3R6TA 1RM4A 4YA6A 2AG1A 4Y0AA 4GIBA 1EVKA 4KPUA 1CZLA 4P6VF 4EW6A 3OUZA 3OWOA 3A3OA 1CT2E 2PTGA 3L4BC 1K6EA 1AUXA 1XPOA 4K9KA 4CIYA 4UNNA 1O2PA 1TYBE 1EUCB 3BTKE 3A7DA 2XNHA 2ZM6B 4LDAA 2OB1A 2D8AA 1INCA 4K9PA 1EFVA 4RNCA 3V2UA 4RSMA 1OWEA 4I1IA 2OT3B 5DX0A 1OB0A 3QLUA 4FEAA 3CCRB 4M54A 3R0FA 2C42A 3CCFA 4D0NA 2LV8A 4A5SA 1KPIA 2PDAA 4Z2AA 1O30A 3T5BA 3NKKA 1Y4SA 1X13A 3BA6A 1XQBA 2R6GA 3LJOA 4R84A 1IVSA 3HH8A 4YJDA 1QVFB 3RSLA 2BVRH 4TV8A 3K1JA 4MW1A 1T9HA 1Q16A 1D07A 3A8BA 3FKQA 2HLPA 1FVFA 4LOIA 5J3OA 3HGTA 4JGBA 2Y0DA 3CS0A 3SBDA 1G3MA 1OXKB 3NQ41 2QRUA 1VMIA 1N33B 2C88A 1PYDA 2RBGA 1PFYA 1TLFA 1Z7YA 1MP0A 3OBIA 3CX8A 5JISA 5TCAA 4YRPA 3TM5A 4EF4A 2UV8A 4AFSA 5EJGA 4M1KA 2WWXA 3RRXA 1XNJA 3QLJA 5DHSA 2CVFA 2FQXA 3MH4A 3U3OA 2NNLD 3GPCA 1MAUA 1N9GA 3EXAA 4RZXA 3AONB 1W1IA 4ETIA 3SYKA 5C81A 3C6MA 1CUWA 2LW7A 2PBLA 4F4OC 1SI5H 1I7SB 2WVAA 3UGTA 2Q3CA 5JH7A 2IVZA 1D2CA 3F5QA 1P81A 1MIOA 4QJ5A 1YF3A 3PQ7A 4IYJA 2M5SA 1AE5A 3AW9A 1F4VA 3CB2A 2VDPB 4DVAU 3HA7A 3PDCA 1WSSH 2P2DA 4IQFA 2I4OA 3IXLA 5LU8A 2GI4A 5JU6A 3IEMA 1IUKA 1YQUA 3LDUA 5L6MB 3DFJA 1QPBA 2TSYB 2X19A 3OQMA 4H7FA 4C0JA 4H4CA 1CK4A 1VPLA 1HRTH 3SUFA 1DJMA 5L3SB 3VSAA 1Z6EA 3ODPA 3WGIA 1I9GA 2O7RA 4Z4EA 3HKEA 2YJ4A 3G0HA 2A86A 2OUKA 2CBXA 1PJSA 1VLLA 2VP4A 4ZHMU 4HB3A 3BJEA 4KN9S 4B76A 4JYMA 3PI7A 1RYHA 3BFXA 4MYHA 3BGOS 3LQKA 4HPXB 1U7TA 2Q0HA 3AR4A 2YV1A 2V9ZA 3EGXB 2SGAA 1W0CA 3TL3A 1MC5A 3EMBA 4M8KA 2A6PA 2EBUA 1LZLA 2FP3A 2FWPA 3BGVA 3QO6A 2W2KA 4QUBA 1ACJA 4I3HA 3OLVA 5HSGA 4RVDA 1NUAA 5LLDA 1N6OA 3O8QA 4L9WA 4JJ4A 1KNQA 1ODIA 1SKQA 1BGVA 4YCDA 4L50A 5GONF 3L77A 2B2XA 3CW9A 5E3IA 3EXHC 5CCBA 4B3IA 3QM1A 4IYRA 3MTGA 2VSFA 3B3QA 3GVXA 4CHGA 4DMGA 3ZDDA 1QB7A 5AW8A 1GKYA 4BNJA 4OOFA 3ZHYA 2VUTA 4ZOEA 1YULA 1RGQA 3WQBA 3T61A 1DADA 4NCNA 4MVJD 4YRNA 5C1XA 2QTMA 4O2BB 5A2GA 4E12A 3GS9A 5FQNA 2PZJA 4S2EA 1VE3A 2PMCA 3KFVA 4GUXA 1VB5A 1TPOA 1TTQB 1C8KA 3JQ7A 3R0VA 4MO2A 4Q1AA 3KU4A 2Q6DA 1B8UA 5CB4A 1SB1H 1CBUA 2GYWA 4NABA 4PSKA 2XRFA 1YJNB 2GCNA 4GX5A 1Z7BA 4AY3A 2WG1A 3MAGA 3TGIE 3CESA 4NLLA 1PHRA 5FR1A 4B8ZA 3BGDA 1GNQA 2QM0A 1A0LA 5T41A 1S3SA 2WV9A 3OWXA 4OI1A 3L6RA 2TIOA 3E5HA 4M0KA 3OQHA 1GIAA 4RJJA 2CLIB 2D1RA 2IYZA 2IDKA 4QFMA 3W2IA 3PQ6A 4B48A 1NESE 4LOHA 1E3XA 4JWKA 4NIXA 1YUBA 2JBAA 3HI6A 3HKDA 1XTJA 4NWLA 1XZNA 5M29A 3N7OA 2XZTA 2E3JA 4UBLA 1W6RA 1VDZA 1A9XA 3PPVA 4C4OA 4YHHB 1C1PA 2IHTA 4RZUA 1DXWA 4ZT2A 1AIXH 1G98A 3IJRA 2G5NA 4ZU3A 2Q9CA 1JYFA 4OGFA 4WZAA 5T6BA 4W5WA 2YWRA 1F1JA 3WWZA 1QGUB 3GRPA 4LYEA 1U0LA 1AKNA 4YECA 5BVHA 4I9NA 1LRLA 1QO0D 3A88A 4RKJB 1EDEA 5DGDA 3C3MA 3Q3IA 1L5MA 2VHZA 4I8LA 5HGXA 2A2QH 2VIVA 4CLXA 2E85A 3PF9A 1B00A 4F9FA 2ZUDA 4L5JA 1SCKA 1PQUA 2HNAA 1JEDA 5KYWB 5K51A 1NE2A 3SFVA 1CRZA 2CLKB 1MTSA 1S3GA 5B4UA 3OA0A 4JNKA 1ZUWA 3ZU2A 1NC3A 1ISRA 1H22A 4KIJA 4Y3UA 3U1JB 4KCGA 3WNVA 4RPKA 4Y98A 4YEJA 2E4WA 3MBOA 2EYQA 4G4JA 2WB4A 4CM4B 1KEPA 4IXDA 3RS3A 3PGKA 1Z5OA 1HTWA 4FYJA 5E2BA 1NT4A 2BY8X 1W93A 4KDEA 1X14A 2HWWA 1Y7LA 5FNVB 1VHWA 2IPOA 4DYDA 4QELA 3BE4A 3QZRA 1UJMA 1ZUNA 3HO1A 5KDLA 2FEXA 4LRSB 4F4IA 1V8DA 1BQ3A 4NOLA 1BXGB 3ZQ4A 2GK3A 1EQAA 1PQYA 2TYSB 2IZ1A 1ARZA 2EP5A 3SLRA 3OTGA 1W7XH 3VPAA 4HDSA 3TSOA 1S96A 3BGWA 1BRTA 5E2PA 3QY0A 1UK3A 1ZBQA 2KHZA 1R6UA 3P5SA 4ZXFA 3AOEC 3TGWA 4V0RA 4QTTB 2AFHE 4BATA 5EE1A 1AGYA 4V1CA 4DV1B 1W52X 1ZOSA 1KYIA 2J45A 3WLHA 1D5WA 1OYWA 1JFTA 4PY2A 4CEJB 1Q9SA 3L4SO 4TS1A 1H2BA 3I9LA 1NLMA 3DHVA 4DTIA 1TAWA 1MZPA 2WP8J 3JRWA 4B71A 4U2GA 1Y6ZA 3GD5A 2BXTH 4UNPA 1AHTH 4K9QA 4UU7A 4F84A 2HPQH 1THRH 3D3WA 1YCPM 4HE5A 4AJHA 5BV2P 1LV7A 3QUBA 2B1IA 2ZXEA 4CN8A 1I14A 2PVCA 2YXBA 1CBWC 4MV8A 3UAVA 4MK4A 2VXYA 1OH8A 1M75A 2X7HA 1NLFA 1V16A 4Q7KA 3UKJA 2YXDA 1Q7CA 1NU6A 3WL6A 1A9YA 3ND6A 1N2BA 5F8TA 3UOPA 2V65A 1Z47A 1HV7A 4YJ3F 3OOHA 2J6BA 3ZYCA 3IPCA 3UYLA 3L0BA 1U4SA 2SNIE 1Q0HA 2J8ZA 3QFHA 4E5MA 1TZJA 2VS1A 5CVUA 1RWBA 3SYTA 1UPTA 4ZAEA 3KVOA 4KHPB 3B5IA 4PZYA 2AJBA 3VNBA 4KODA 4DZTA 3M4ZA 4QBHA 3L1UA 4TTQA 2GDDA 1XALA 3P4UA 3G0CA 4HAZA 3C14C 2QF0A 5TB5A 2G1JA 2HXYA 3FUTA 4YGYA 1IYZA 5EC8A 1CP2A 1EESA 4XRRA 4IMJB 1R4ZA 4XN3A 1EAYA 2FSUA 4U2FA 5TPWA 2EWVA 1JZSA 2Z7FE 5F2KA 4B87A 1XKXA 4Y0ZE 5G2OA 2FSSA 4JY7A 5G1OA 2RGGA 4KR6A 4U7HA 1WXEA 3ETGA 3BFVA 4UHFA 3FSRA 3CH6A 2BW0A 4Y7BA 2NP6A 2HV9A 2RCNA 3EEQA 1Y3VA 2F9PA 1RZ3A 3JQ8B 1H8HD 2MHCA 1AGJA 4PNHA 1Z12A 3LWNA 4RPGA 4L4RA 1IY9A 1UJCA 3PRBA 5ICSA 5ALIA 3PM3A 3R3VA 4MS1A 5HOQA 3ICPA 2UYOA 1Q92A 5A5FA 2P30A 4KI0A 5EJ2A 1KK0A 1A50B 3AUAA 4ZWNA 2ZYTX 1J2RA 3ER9A 2WP0A 1IHXA 4KK3A 5MN5A 3SY8A 4PGMA 4CR8A 4P81A 3NASA 4WCFB 4GFDA 4DV6B 4BC0A 2UWLA 2PZLA 1C1XB 1LK5A 3I1FA 3I9NA 2WUWE 3O9MA 1EPTC 4H4FA 4L2IB 3OZ7A 5I01A 3BTME 3Q1LA 3BD7A 2ONCA 3ZVLA 2I80A 4GYWA 5ITVA 2D2XA 4FTWA 2UUJB 5IS2A 1JSZA 4GM1A 2QSUA 3OKXA 3LG2A 3RAFC 3N8GA 3A4NA 4HE6A 2GFHA 4AY6A 1RAGA 3V1MA 3HV2A 5LBTA 4PN7A 3PPYA 2P91A 2PFKA 4GPZA 2PUJA 1J2UA 4BNDB 1GPYA 2IXGA 2PWAA 4B3CA 2LDBA 2VH0A 2C3PA 4JCOA 3B9FH 2FY8A 4WOJA 2HJHA 1PAUA 3X1JA 1OGIA 2G52A 1FUIA 4PTLA 4Q7MB 2XUKA 5HXAA 2AEEA 1SOMA 2DR2A 3DVLA 3N2KA 1BFUA 1YR1A 2J5QA 1DQYA 4C88A 1HAVA 3B60A 3A8DA 2WUEA 4ZQFA 4RK5A 4GC9A 1FU7A 2XGSA 3IPXA 2HPHA 4CMBA 1GJDB 5LQRA 2IYTA 3GY3A 1NURA 3HXLA 5EMHA 3MILA 4AB1A 4CEIB 2GTBA 2NO6A 2W83A 1WDTA 3M61U 4NCIA 1CEQA 3AKYA 5A3RA 3UTUH 4NESA 1M3SA 2PUHA 1T9ZA 4WZBB 1OOEA 4DA4A 2BR3A 1ZEJA 4YLQH 3LD9A 3VHQA 3RTCA 4C2UA 3INTA 4Q05A 1L4ZA 2XTTB 3O38A 3QU4A 3A9VA 2HW8A 3T9EA 4ZGWA 5J9FA 5BPHA 1N2GA 3IHWA 8ADHA 1A8SA 5JXHA 5K8TA 4D5GA 1K9OE 4Y6OA 3P94A 1CIVA 4MW4A 4TV9B 4C2AA 2HMUA 2Q0XA 1C4WA 1RJFA 4LF8B 4RD6A 3JY6A 2VDLB 5LZ2A 3D5QA 2ZGCA 1G6KA 4WH0A 1TK9A 5LYJA 4GC5A 3RU2A 4DCSA 1RM5A 4Q37A 4G67A 4D97A 2GUWA 2Q5IA 2CLFB 4L9RA 2JD1A 2VT7A 4Z4FA 1OI3A 1BVYF 5CCEA 3PV2A 4N0MA 5EHGA 4Z0TA 3SHOA 4ITVA 4MQ6A 3WKDA 2LE0A 1F5SA 2B61A 2OSVA 1NV9A 3UOAB 2YZKA 4X7BA 1H0SA 3S2SA 5L7TA 1UZNA 4N65A 1NBOA 1NB0A 2ZR9A 1QSGA 4TL6A 5JNVA 1FVOA 1L3IA 1VCWA 3WW7A 2QORA 4DQUA 1UKAA 3AF2A 4K5ZA 2B35A 5C8VA 4FBMA 2VQDA 3EQ2A 4IKEA 2VF5X 1MH9A 4WBNA 4B32A 5AK5A 3PLPA 1T0HB 1GG9A 3DHKH 4YONB 4FOLA 2H1LA 4O6VA 4K69A 1LK0A 4YUYA 3WK6A 2REOA 3SJ7A 3ZE8A 4MKZA 2OBBA 3GVKA 3TK6A 1GFIA 1ZMNA 2G63A 3QMVA 1RI1A 1ZLRA 3AJ8A 1QQTA 4H7DA 2QTZA 2GKGA 4R2IA 4C7VA 2MWMA 2OORA 1EFKA 2GJSA 4Z5XA 1H9HE 2I7TA 4LOLA 3LAWA 4MPJA 1Y34E 2UVPB 3MB5A 3DQZA 3VYRB 5ELLA 1OAOC 1YQQA 2D1JA 5D3MB 4X6NA 1QORA 4RA6A 3GISB 3UW3A 1DVRA 2VRNA 1BKYA 2WD7B 1P4SA 4QNNA 3WLAA 2JFYA 1SQ0A 1LTKA 3OQNA 4UUPA 1EFRD 1TGYA 4D9KA 3LKZA 3N75A 1LVGA 3AY0A 4Z4TA 2GZ1A 2HQRA 4WY8A 5DVZA 3OM9A 2J9XB 3I30X 5EJLA 2GCPA 1LFDB 3AETB 1UKBA 5HVNA 3ENQA 1U3VA 1WF3A 1M34E 4OSOA 1UOPA 2FSHA 1C1VH 4WECA 4YLUA 1Y5RA 1M2EA 3WX0A 3VHRA 1P19A 2AZTA 2JHCA 3WGUA 1T8YA 2RHRA 3SIRA 3M3VA 3DP7A 4GP9A 1S83A 3LHFA 2AJTA 1LLCA 1ZD4A 1V5GA 2WE8A 4WJLA 2KBEA 1Q3XA 2QUHA 3UG6A 2JJ1D 5DDIP 4EHFA 5KTKA 3MXOA 5KTYA 2A0KA 4XDZA 1MCTA 1G63A 1W9XA 4UMDA 3P9IA 3HWWA 3SXJA 3O84A 1Y1RA 3DD2H 4HTFA 4TGLA 1EBBA 1PK9A 1IY0A 1FLNA 3DLIA 1T4CA 5I6DA 1NJGA 3DMDA 2HIAA 6REQA 4MIKA 3GWZA 4YQEA 3THXA 1U3WA 5HX7A 1ZH8A 5LC1A 3LYHA 4KKTA 5BY2A 1SWVA 3R6KA 3L8ZA 3V5NA 4US1R 4AROA 2R8EA 4RMGA 3G79A 4DEVA 2CZQA 2Q3BA 2VHTA 1NW8A 3ZX4A 3MNXA 3ZXXA 2P3MA 1SRRA 1U0JA 4Z51A 1TU4A 3LHSA 3BOSA 4HRVA 2BHRA 3HHEA 1EDZA 2GASA 5TEWA 1D1SA 3PUHA 1NVTA 1JR3A 2ZU0C 5JDCC 2ZUFA 1U5BB 2DQYA 4O2BF 4LDRA 2R87A 3I2YX 1S3IA 4MB0A 3RC5A 5FCKA 4B3FX 1B1CA 3GJ6A 1KFCB 2JAOA 3ZV5A 1FRNA 3VZCA 4KLAA 5L53A 1GPDG 4B46A 1LB1B 1L5FA 1RQPA 2A0XA 1GA4A 2Q29A 1WS6A 2ZWAA 4NBWA 2BF4A 3FYTA 1MORA 3L4EA 3HP7A 4RM2A 1SLUB 3VR2A 3CU5A 4P35A 4RK1A 1P9LA 2ODNA 1S9HA 3DFIA 3NW9A 3M6LA 1AZ8A 1X3LA 4JSTA 4BEJA 3ET5A 4I46A 2VUHB 2IPXA 2PPLA 2OBSA 5DHUA 3EIOA 2WHXA 4R1NA 1NRXA 1C5ZB 2GPBA 1TGTA 3TDKA 4PLZA 4DV4B 4WNYA 5MGNA 1AQ7A 4LBWA 5B7NA 2KFWA 1A98A 4AM8A 3ADCA 3EVBA 2H1OA 4LHZA 4K1XA 3EE7A 2ZU4A 1U2QA 3CKLA 1KSFX 2AN9A 4IDFA 3B3FA 1PG5A 5HZHA 1MMJN 1ZNXA 5IN4A 4JLDA 3CSDA 2ZJ0A 5LQCA 1RPZA 1P04A 1E2IA 1F2SE 4N8DA 4D8YA 3UNQA 2I4TA 1SUWA 1XKAC 5C35A 5JJKA 3KE9A 1PL8A 4LQCA 5BVGB 4YT6H 3TE6A 4YAGA 1JXOA 1TCVA 4IXWA 1UD4A 3NHRA 5K8IA 1R0LA 1XD2A 2Y4OA 4EG1A 5KOIA 3BWXA 1DDGA 1GZ6A 1FU8A 4WNCA 1OWDA 4MLDA 2O2DA 2OPBA 4IDHA 1GPJA 3ODFA 3S0JA 1NQTA 1JDPA 1DBPA 1UBGA 2BBWA 2UUPA 4IF6A 1JMKC 4PX2A 4FBLA 2JLXA 1ZEMA 5HKOA 2ZO3H 1SGTA 4BXWA 5KJCA 1DT3A 3SSMA 3EEOA 4AB9A 4F56A 4DIKA 3M5PA 2JPDA 2G0NA 1EFLA 4LYYA 1P31A 1B41A 4LNAA 5K6TA 5EXXA 4FWIB 5DCWA 3Q9NA 2GAIA 4UAJA 3PE6A 1HM5A 2VYFA 3HY3A 3FTPA 2ZGBH 1TIBA 1XV5A 4TMKA 2I7DA 1KVQA 5JQGA 5FNVF 3M3TA 1HLFA 2HXSA 2B4YA 1EUQA 2DH5A 3R9XB 4XTCS 1VZ2A 4YEDA 1WP6A 3TG2A 1EUDB 2PQ0A 3HL4A 1K28D 2GETA 2C04A 2RHDA 5F64A 1B6TA 4VGCC 4MP3A 3UHFA 5FJJA 5ADHA 3TINA 1KL7A 3L8FA 2D1TA 1J8MF 1X8XA 5U1PA 3ZWMA 4FHFA 3DBHA 3LPLA 3QPCA 2GZMA 3OBBA 3HR4A 4ZMRA 1Y0YA 4NNJA 2Z0MA 4EARA 3QVSA 4NNOA 4I19A 3LGWA 2DPXA 3QHAA 2DHEA 4HGZA 4CU5A 4L8GA 3GN1A 4H9GA 3I3SR 3E35A 2C0QA 1RBQA 2V9PA 4OPSA 3BV9B 3L0YA 2CL7X 3L7YA 1XKQA 1FN6A 3E6AA 2FMIA 3R9IA 4X7EA 3HB1A 1OXMA 3LMKA 3ECCA 1FE8A 4E4YA 5E6UA 3OJFA 4B2IA 5JBTA 3DKRA 1XLUA 5IULC 4XYMA 4UVHA 3I0ZA 2GEJA 1JEYB 1GBDA 1FXSA 1AB9B 3BC1A 1P2FA 3ZWCA 3FOBA 1GU0A 3K4HA 4CYMA 4GGMX 4DFDA 4HYYA 3K09C 4Y6SA 2FR1A 2ID4A 4F1JA 4Z4ZA 4I8KA 1HURA 3U9SA 1P2TA 3P4YA 1JG2A 4R69A 4XORA 3ND8A 3GFTA 4R8LA 4XB1A 2A14A 2QTLA 3KQWA 5K1ZA 5LLSA 3BK2A 4EG8A 2V7BA 5JO0A 5AN9A 2ZDNA 2GJ8A 2PU5A 1GBBA 2PZGA 1I4TD 4AX8A 3DEHA 4DNQA 4QREA 3WIDA 3Q7SA 1PNQA 2YOLA 1FDIA 4KH0A 2H4XA 2O7QA 2I7VA 2OHXA 3IUYA 1L7RA 2IQ5A 1LI4A 2IIVA 3ESRA 5JADA 3AVYA 4UQOA 4DWOA 4G0UA 5DP2A 3NALA 4FXUA 5ENZA 1XKLA 1KDTA 4JMLA 3VV3A 3HAGA 1YS6A 1JDTA 2GMTB 1O36A 2P1RA 4NBSA 4XW2A 3N8NA 4XGIA 5HCUA 1OOKB 1Z8GA 5U4XA 4C0LA 4NL4H 2C95A 3DHYA 3TWOA 4CKWB 3WYAA 2LZ0A 2RH9B 4R81A 3UJ9A 2AEIH 4P83A 5F4ZA 1WUIS 3RI3A 5C2ZA 2YCBA 2BFFA 2ZSBA 4N4AA 4DG8A 4OSEA 3H99A 1GOTA 1U2TA 4NFYA 3LKBA 2FI1A 2WF8A 1K5PA 5GM2A 1HXFH 4QM6A 2IPQX 3A6PC 1RLJA 2N47A 2EYUA 3OX2A 1D0SA 3CUVA 2ZB4A 3C8UA 3WYCA 3CRNA 1KC1A 3IDOA 3Q00A 4JENA 1J0BA 4OYYA 1GGNA 4IGIA 2A9KA 4B5LA 3MGBA 4ALMA 1C5XB 2JKHA 4KR9A 3IVRA 2CJYA 5T5QA 1Z4QA 5EG5A 4B3MB 3EDRA 4ZTZB 1EI9A 3I5YA 4BNWA 1GHBF 4OKNA 4F4JA 2PU7A 3IP8A 3FF4A 5BRJA 3I2IA 4MINA 4B3DA 3L6DA 4S1WA 1KC3A 3T1NA 3ATKA 5HCIA 1XAHA 1KWKA 1G3RA 1E98A 3HSYA 5EIOA 2PT5A 3QVVA 1L3BA 3K16A 5A7FA 4N0EA 3FWZA 1NN6A 5LQKA 1KH3A 4CFYA 3F7OA 3H5RA 1I30A 3JATB 4HAXA 1MC1A 4CR7A 1KKUA 1AQJA 4BFVA 3H9NA 1GEEA 1KAGA 3KGPA 1VGCC 3ETDA 5I47A 3KQDA 5JS6A 3IPLA 3JD4A 4KXUA 1W2WB 4HH1A 1QVZA 4JGIA 2GERA 1FPMA 3NETA 5JZBA 1AO5A 3FWPA 3KC2A 7ESTE 1E9EA 1KY2A 4Q1BA 5AVQA 5GONA 3ZGVA 2RGYA 4UD9H 5EUQB 3FRJA 3WL4A 4EKGA 3R7WA 3Q3YA 3LL7A 3OPXA 4YUXA 4PQRA 4PLWA 1Q17A 4MDSA 4Z3DA 2EIHA 5LQDA 4M7WA 1YO6A 3DE7X 4F55A 3A27A 3MQFA 4HVTA 5F53A 1UPUA 3BK7A 1IHMA 2C97A 1K1IA 2Z4RA 2CBZA 3O1JC 3F8WA 2FJUA 1Q7TA 2HF8A 4LOJA 3UK6A 5BPFA 2F2TA 4WI1A 3RVLA 3FPBA 4BNZA 1SZPA 1PG2A 4Q3LA 3RFTA 4OQDA 1SZCA 2KB0A 3URMA 2NV4A 3R77A 1BXRA 1X6VA 1USVA 3RY8A 1UVTH 1ZRSA 3P17H 2WZDA 3RXCA 3SYJA 4E08A 4ZKOU 4O08A 4L16A 1K1OA 3RHZA 1M76A 4LZLA 4XI9A 4D43A 4BFCA 3IB3A 4LHWA 3PD0A 2ZRAA 5JJ5A 3NB0A 2FW6A 3I1YA 2X14A 1GZUA 1PUIA 1TCAA 4UOZA 2DYIA 1UPBA 1RRGA 1BZXE 3F90A 1NC6A 1GPLA 3H7OA 2XMGA 3DV0B 1L1GA 5LIPA 1Y3BE 5AIBA 1TYZA 3GBPA 4B9AA 3DCLA 4TV9F 1CA0B 3KZNA 4Z4WA 1QTIA 5EXEA 2I6FA 3ZVDA 1T6YA 5LN1A 3H75A 5BSHA 1DJLA 4LK2A 4XD7A 4Y2HA 4I1RA 3ATMA 3GR6A 5JSKA 3W6NA 1YR9A 1NRSH 2C54A 1HJ9A 4XWGA 3TRKA 3AEKB 1CY4A 5KPJA 3ZGZA 3C3DA 3U4MA 1CE8A 1D4ZA 1TMBH 1F5LA 1XNHA 3PLKA 4IJ5A 1S8OA 3A7YA 3CW2A 1CHOG 4UMEA 2HWKA 1Z88A 1WW8A 1ZZGA 3PJRA 2BM9A 2DWOA 1I01A 2KCOA 3M6WA 1PJBA 4P3IA 5C94A 3L5KA 3TYXA 4YZUA 1P12E 5ILGA 3I01A 2BGTA 3DO6A 5C1YA 5E1DA 1YI1A 2ZQ5A 3R3JA 3M5WA 3RUFA 2R84A 1CG6A 4IUCS 2BTEA 3FANA 2SNWA 2G8TA 4HXGA 2HZBA 4XLFA 4C6HA 2ATVA 2PKEA 3UAOA 1XZLA 3K2IA 4C22A 4Y67A 2ORVA 2YV2A 1JLLB 3SNEA 2REBA 1K7FB 1OI4A 3PTAA 2FXIA 5CVDA 1E7QA 1I80A 3R4CA 1P5ZB 4JU8A 4HZGA 1Z6PA 4R7ZA 1XD8A 4DILA 3M89A 2VYQA 2ICAA 1RAFA 3ZIUA 4ZAWA 1MEEA 4O0MA 1JKIA 4D4HA 2W6JA 2LVBA 1CT9A 1MQ6A 1FYDA 2KLHA 3OCYA 1EB8A 4IH1A 1Q44A 4NP6A 1TGNA 4WJZA 2KLBA 2OAEA 1D3AA 4MVNA 4TYPA 3TLYA 1MOZA 3QN7A 5K7RA 2PZMA 3DZIA 3ZQKA 4M1WA 1KTSB 3DHWC 3WK4A 1E9AA 3UAZA 4FT2A 1LKBA 1CFJA 2ZECA 5H9VA 4AX4A 3H8VA 1NY22 5ED0A 5K3OA 1DEOA 3TQTA 2QHXA 1T15A 1CZUA 1MZDA 1E0JA 3WDSA 3CE9A 2H9IA 3AVQA 2BTQB 3RADC 1ELGA 1CDEA 1LGYA 3F5MA 1ELEE 2NPFA 1YCGA 3URDA 3T53B 2BKAA 1VIMA 4AWBA 4AI6A 4EEXA 4CV0A 3VC2A 2XBWA 2PHBA 5KC9A 1ZN8A 3P19A 1XROA 2BFDA 3PJFA 3JQGB 4OKIA 1DT5A 3DOUA 2BKEA 1UTMA 1PE0A 5JPCA 1UK2A 1JQ5A 1Y80A 2MMCA 2X6RA 1IQKA 4HQNA 1EHIA 3DAPA 4GWGA 2Y7ZA 2D0DA 3FGZA 3LO5A 5AVXA 4NJEA 2X9NA 5EPUA 1IUPA 5I3ZA 3BXGA 3DHEA 5IWAB 2J1LA 4ARZA 4CBNA 2BJVA 2XKJE 2VT6A 4ZYZA 2EL7A 4N41A 3STJA 5AOCA 2JANA 4J03A 3IPYA 1JWTA 2FKAA 3ZKWB 4D4IA 5DLDA 2YN2A 1X7YA 2AJCA 3V3TA 3DTVD 4YJ3A 1EE9A 1TKRA 4UONA 4YP1A 3SF8B 5FQOA 1PQ4A 3BXHA 4OO3A 2ZUWA 3LLSA 1QA0A 2EJUA 4BE4A 1SHJA 2O0KA 4LXGA 2WYGA 3AWDA 1U2PA 4PAQA 5DM0A 3OTJE 2IH5A 4YLYA 3V4OA 3BMCA 4W1QA 1YGYA 4M37A 1M72A 2BVNA 1SXJA 1U2GA 3PQFA 2H8GA 2BLLA 1U3CA 1XVLA 4I1PA 4XM1A 3L93A 3RMMH 4RI0A 4H4DA 1N1GA 1SWWA 4MUGA 5H68A 4IOJA 1G8PA 3AFNA 1TRHA 1F0PA 1Z6XA 5E1MA 5DN6A 1VQ5B 3WRXA 1TQ7B 4LA4A 3O47A 2P40A 5T8KC 4JJAA 2J4CA 3UA4A 2Y66A 5T67A 2X0EA 5C7LO 1W4BA 5FF9A 1DFHA 3D49H 6GPBA 3VR5D 5TIIA 1A5SB 5JNRA 1BMQA 3OX3A 4P58A 3PL1A 1KDQA 1L3CA 4M87A 4BQIA 4IWXA 1T8PA 5ERXA 3KQLA 5AFSA 5F2NA 5E0GA 5FB3A 3NGLA 1IY8A 2EKQA 2IHZA 2W6ZA 3GHYA 2EP7A 2Z3VA 1LLFA 4NR0A 3UM9A 1E4YA 1TO1E 1WCV1 2Z94A 1JILA 1ZA2A 4O2LA 2F1LA 3GVJA 1JJAA 1LI7A 1B43A 4BCDA 3TTTA 1PGOA 1IFXA 2SCUA 4CDRA 3B70A 4CKCA 1CUZA 3C3JA 5IJ9B 3ZZMA 2JI6A 3KQNA 1G4UR 3OYPA 3M9XA 3KJQA 3TVJB 3V55A 1UBRS 2A2XH 3B1FA 5BSXA 3KKQA 5A02A 2QTNA 1T3LA 4AWXA 3C41J 3ZZNA 3QTTA 3ONEA 4XUDA 3L04A 2RB5A 2Y05A 3T7KA 1GU7A 1MTOA 1I3LA 2VHCA 1GBKA 1SHKA 3DGEC 3W5BA 3KTOA 1U7ZA 3D4NA 1RJ9B 4QM7A 2NZXA 3IMGA 2ZRHA 4Y2GA 1F4LA 4MYCA 1X7ZB 2WWGA 5EW1H 8KME2 2YMSC 1FQJA 2YJGA 1NRQH 4R68A 1NP6A 1WBGB 1TC2A 5H9WA 2QTBA 1K1PA 3IR5A 1GO2A 5IUKC 1EZ4A 2F1HA 3R75A 1JIRA 4ABTA 1L4LA 5AUPB 2GX6A 2C8ZB 1VE6A 4NZOA 4LY9A 3LBFA 2Z83A 1OP2A 5JY6A 4CUKA 3M8KA 2C9DA 2O07A 4GKBA 2NWNA 2ZZNA 1DAGA 4HB2A 3GLTA 3W1WA 5EJEA 1K1EA 5KNBA 4RPLA 1KA9H 2I66A 5IT5A 1E2HA 3T4XA 4YROA 2RGCA 1X39A 2PM8A 3I2FA 1YPMH 5KNDD 3L84A 1Z4IA 4DSZA 2A9VA 3VO2A 3LGTA 1Q86D 2ZJAA 1FDTA 1E6UA 2FPPB 4KWTA 4DGJA 3VR4D 4DUPA 2QRVB 2R1TB 2QJTA 3AHDA 1E2FA 2G06A 1RLIA 3ROMA 5JEEA 5D5HA 2SICE 4MAFA 4KIWA 1DWPA 1YI8A 3UXYA 4UNSA 2APJA 1EVZA 2P0AA 4CFZA 4YAJA 1T0UA 2VNIA 3T4EA 1XLTA 5BQ5A 1IN7A 1OPHB 2GSWA 2FZVA 1C4KA 1P5FA 2CWDA 1V71A 3CPXA 4M99A 3WNCA 4FS8A 2O5EA 3WAGA 3DUFB 3RBAA 2PKQP 2DH6A 1XCPA 1FQWA 2BELA 3I9KA 4ARSA 5L4LA 1GI6A 1D1NA 2BMVA 3PJEA 2ZBGA 3R5SA 1USIA 2Q1UA 3LHKA 3ORYA 4A73A 2ZRNA 4PYMA 1BGWA 1JHDA 2ISSD 1LS6A 1EUCA 3QEBZ 1SLXB 1BH6A 5KQGA 3ZJ4A 3MTDA 2JCXA 3DVAB 1Y8TA 2QTRA 3S2YA 4UPEA 1QGZA 1HAXB 3FZGA 1AKVA 4MB6A 3V6LA 4D8NA 3A1WA 4FT4A 3FROA 1C1MA 4RVCA 4BASA 4QBTA 3JX9A 2NU4E 2H1CA 4B2BA 4BGVA 3JWPA 1FZTA 5FHTA 5DP1A 3T5AA 4C0KA 2J9GA 5JBBS 2G51A 2ZKSA 2NU0E 1ZXBA 5KYGA