1FRNA

The involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
b'HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYVIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Involvement of serine 96 in the catalytic mechanism of ferredoxin-NADP+ reductase: structure--function relationship as studied by site-directed mutagenesis and X-ray crystallography.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase (nadp+(a),ferredoxin(a))
total genus 96
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frnA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frnA02
1QH0A 4C43A 3CCJB 4Y9UA 1IB0A 1TLLA 3VMFA 3LVBA 3JQPA 3QFTA 3V76A 2YWFA 1XB2A 4B48A 1DARA 4PC6A 2NPFA 3CC2B 5GV7A 4TMXA 3ZBTA 4YAOA 2QDXA 3CCEB 4FK8A 4M1KA 3J81k 4IW3B 5JBQA 1OB5A 4QFMA 2FX3A 3WBKA 3AVWA 1VQLB 4PGOA 1VQPB 1G7TA 1XE1A 1D1NA 3W2IA 4NBSA 3CCVB 1EFCA 5KSWB 5EMNA 1YJWB 4Y7CA 1E62A 4YALA 2VYQA 2EFGA 1ZUNB 1VQ7B 4MYUA 2XEXA 3U6BA 1W35A 2AHOA 1JNYA 3I1FA 4F7DA 1QVFB 4C0SA 3G6EB 3OJXA 1WDTA 4G1BA 1N8RD 2B7CA 2B7BA 1E63A 1KK2A 3VO2A 2VNIA 2YWGA 1YITB 1BQEA 1Q82D 3U2QA 2C78A 2DY1A 1R5OA 1ZM4A 1KC8D 1FDRA 4TN1A 3P27A 4B44A 1E64A 2HDNB 1KTVA 2YWHA 1B23P 1N0UA 3QE2A 1K9MD 2YWEA 2R6HA 2D74A 3CCSB 4ZCMA 1KRHA 4Y9RA 1M1KD 1BJKA 1ZM2A 1ZM3A 2HCJB 3W2FA 3W5VA 2X3UA 2CNDA 3VNUA 1W34A 1EP1B 2BF4A 4ACAA 3FPKA 1NDHA 5FA6A 3ZC3A 3PENA 4Q7JB 1S0UA 3QFCA 4G1VA 1N0VC 2CRVA 4RD0A 3U6KA 1KK3A 1GVHA 5TV2A 1JJ2B 1M90D 1BX1A 2BPOA 3CMEB 4YAUA 3ES9A 4RD1A 4MYTA 2PLFA 3ZZ0A 4UAJA 4PC2A 2PMDA 1F60A 3W2GA 1GJRA 2C77A 2BGJA 1KK1A 4FWTA 3QFRA 1JA1A 3VNVA 3OZUA 2QA4B 4TMVA 1VQMB 1VQNB 1NJID 2GPJA 3G71B 3A1FA 4TMWA 1D2EA 4LBWA 3OZWA 4HE6A 4ZV4A 3CC7B 2BN4A 3CCUB 1R5NA 4RCZA 3CB4A 1YJ9B 3SJZA 4N3NA 1EFUA 4WQMA 4J0QA 3LRXA 2OTLB 3CW2A 3OZVA 4RCYA 4P6VF 1BX0A 3WNDA 1QGAA 1AMOA 3B8HA 4HE5A 1D8TA 5DSZA 2B5OA 2ZITA 2QN6A 3E20A 4RD4A 3CMAB 1GR1A 1JA0A 2XNJA 3CRZA 5TR9A 3VO1A 1G7SA 1EWYA 3W2EA 4LC0A 1KJZA 1S72B 3MMPA 4RD2A 4PC7A 1K73D 4YAFA 4M53A 4BPRA 5H5JA 5HXBA 2QTZA 2RC6A 1GAQA 1VQ4B 3CCQB 2BM1A 4ACBA 1QVGB 1GAWA 3OW2B 3AVUA 1QGYA 2VNKA 1QUFA 4YAWA 1QUEA 1CQXA 1FNBA 1FNDA 1H42A 3ZBUA 4FN5A 4RD6A 4TMZA 1EP2B 1DDIA 4DQLA 3CC4B 1QX4A 2HMAA 1R5BA 1TTTA 4U9UA 3CCLB 5GV8A 3WNBA 2XNCA 4PC1A 5AN9A 4M0LA 3I56B 1CNFA 2BVNA 1DG1G 3LO8A 3B82A 4B43A 1W2BB 4YHBA 3WXMA 2VZLA 4PC3A 4AF6A 3WBJA 2PIAA 2BGIA 3JQQA 5H59A 1QFYA 4B4DA 1YHQB 2OTJB 2QMUA 1TVCA 1H85A 1Q86D 2J7KA 3ZZTA 4B3XA 1VQOB 4LBVA 3W2HA 3W5UA 1QGZA 3W5HA 2QEXB 1VQ5B 3CCRB 4TMTA 1OGJA 3AGQA 2DERA 1W87A 4RD3A 1Q81D 1KQSB 3WYAA 3AVYA 1YJNB 3B78A 4M4SA 3AVVA 1F20A 3OJWA 4DQKA 2OK8A 1I7PA 3JQRA 5TY0A 4LBYA 1VQ6B 1GO2A 4QHYA 3LYUA 1U2RA 1ZM9A 3FJOA 1FNCA 4ZGNB 3I55B 1QFJA 3E1YE 1K8AD 1Q7YD 1UMKA 1VQKB 4P3YA 1SM4A 1FRNA 2DCUA 3MCAA 1SKQA 1FNMA 2BMWA 5THXA 2DEUA 1YIJB 3AGPA 4RJLA 1G7CA 2EIXA 4H9GA 4EH1A 2OK7A 2VNHA 4M2LA 4R71A 1KK0A 4ZCIA 4ZGQB 1JB9A 4LBZA 4G5GA 3P26A 1G7RA 3CCMB 1J9ZA 3WY9A 2GQFA 1AIPA 4B47A 4AF7A 1B2RA 1EXMA 1DDGA 3AVTA 1CNEA 3MHPA 2RC5A 2BSAA 4K1XA 3QFSA 1FRQA 1A8PA 2BM0A 1QFZA 1EFTA 1VQ8B 1OGIA 1QG0A 4NCNA 1IJFA 1VQ9B 1HA3A 2BV3A 4N3GA 3CD6B 4AC9A 3AVXA 1TUIA 2E1RA 3WNCA 3ZZUA 3CPWB 2VNJA 1IJEA 1KD1D 1ELOA 1OB2A 2DETA 2QTLA 1EP3B 3QSYA 3CXCB 1YI2B 4ZCLA 3G4SB
chains in the Genus database with same CATH superfamily
1G4HA 3QUAA 5LFAA 3UGJA 1GM5A 1BRTA 1YQEA 1JTFA 1M1ZA 1YRWA 1J56A 2QMQA 2WD7A 1RVDA 2ZYVX 4L0CA 3VM6A 2RHOA 4Y9UA 4P35A 5DGIA 2QRZA 2VSYA 1YOBA 3NAZA 3T0GA 3SC4A 5E6RB 4D8YA 1BC5A 1W36C 1XNQB 5DWDA 4LHZA 1GPBA 4PN3A 2Z09A 1VJSA 4MV4A 1EQUA 4LE1A 1CBUA 2H4ZA 3GPDG 4NEHB 3WBBA 4WN3A 4JXZA 1YZYA 4E5SA 1YQUA 1TM5E 3PFWO 5G02A 1EE1A 3EXFA 4YYEA 4E33A 4LVOA 3QENA 4Z9YA 1UWCA 2QSZA 4YDSA 5ES4B 1MHPA 3LMKA 1AZTA 1QYIA 3GUHA 4RSGA 5JZ9A 4CNBA 3Q3GE 4PLPA 4YAOA 2XUPA 1YIDA 2OSVA 5I47A 2F62A 4TS4A 4RK1A 2AXPA 2WEKA 3RG8A 4YJ2A 1SA0A 3DOOA 4RZ3A 3ZCPA 2PUAA 1THZA 1U0TA 3ND7A 1EM8B 4AAYA 4ZVLA 3QHQA 3VA7A 3ND8A 2OYSA 3OC6A 1OTYA 2CYCA 2ZJ7A 3PR2B 5ER9A 3A0RB 3OZGA 4W8GA 3CVOA 4AS2A 5IHXA 5DHFA 5CLQA 1FQOA 3W1WA 1D1NA 2FQ1A 1TTPB 2ILVA 3GVLA 4U8HA 5DLEA 3QFFA 3MAJA 4I46A 3N8KA 3VAAA 3IA2A 4JDUA 3CPHA 4PWYA 1O58A 3ET5A 5K3DA 4FR0A 3DEJA 3ISTA 4RDHA 1XQXA 4XDZA 3VBCA 3EQ2A 3KXKA 4MW2A 3QVOA 3AO0B 3HABA 4R9NA 4DSNA 1CFJA 1O77A 1PF7E 1DAHA 1Y1KE 3TMYA 2VQSA 3WMGA 4EYKA 3EK2A 1ZIPA 2EKPA 2X1LA 2C42A 3PXXA 4FD3A 3WRWA 3ZKAA 5FNVF 2LBPA 1N0WA 3U9TA 2ZYWX 4R69A 4FR5A 5AP9A 4G8JA 1VPTA 4J0DA 3JATA 3UK0A 4AG5A 4B2PA 3ZG6A 2EKBA 2RAPA 4YJ3B 2JIZA 4G1BA 5JJ5A 1G8FA 1A27A 2BE9A 3QF7A 3H2JA 5T57A 1MAVA 4PSCA 3RJTA 4EHAA 3EMDA 5C37A 8LDHA 2JGLA 2O8BA 1UXHA 3AM5A 4KXUA 4FZVA 1G21E 1ZSNA 2CBGA 1NVTA 2ZE7A 2FZKA 4GM4A 4DS3A 2C78A 4Y1RB 4RZSA 1GCUA 3B89A 2WQ6A 5JOQA 1L6IA 1QIMA 1PS8A 2GJAA 2QAIA 2XRYA 3ONVA 2M9MA 2QYSA 4IDPA 4NLLA 2F17A 4A5OA 4DQVA 2VK8A 3RSZA 3UFXA 4QOHA 3SXJA 4G0MA 1A5AB 5KOJB 2W6QA 3IPCA 1JR3D 2CW5A 1TZJA 4OHKA 4H1UA 3AF6A 2ZIAA 3IAM1 3W2TA 1EZZA 4WKPA 1TGYA 2GTPA 5B55A 3QPCA 4DILA 1NQAO 2JLQA 4LQLA 1NPYA 1EP9A 3USES 4Z7JA 4CIDA 4I66A 3I2KA 1H3EA 3KZVA 4KKTA 5HE9A 4YRIA 821PA 1Z5OA 3EBLA 5A88A 1JQLB 1GPUA 1GN8A 1YASA 2IY8A 3HMKA 3HLTA 4RSRA 1LW7A 4TV8F 5JSZB 4DR7B 2F1MA 2VJKA 3WZLA 1YTUA 5FBKA 3BB3A 1M2JA 3MRXA 2MSLA 3PICA 3KB1A 2QVBA 2TMYA 4NATA 5LDGA 5JFGA 1XPUA 5BPHA 4EX7A 1IE3A 4BWFB 4KR9A 4BFUA 4OQNA 2Z08A 1H3NA 1AXRA 4KIWA 2HCJB 3E5HA 4I9NA 3U7JA 5TQVA 1UJBA 4YJGA 1YT5A 3S7TA 3V7FA 1K66A 1AV6A 3T3PB 4Z5XA 2B5WA 5IUNC 3FYUC 2HN9A 5JJIA 1M6HA 1M6VA 3PRHA 1XVVA 1KY4A 1HDYA 4ES6A 1R3DA 4I5EA 4L4ZA 3LX5A 1JFVA 2JLYA 2P6RA 2FDRA 1VHOA 4TKUA 2XNKA 4BNLA 1AZLA 3DMPA 4F8JA 1SXJA 5JXWA 1FXUA 4RABA 1SHKA 5HQ3B 1UUFA 4GUDA 5K0JA 2I34A 1PJCA 3O73A 2QZZA 4MQBA 1D2HA 3B3AA 4X60A 4QFBA 3FNFA 4UMVA 5SYMA 3OM0A 1NM5A 1IXZA 2ZIZA 4QQ8A 3G49A 3THSA 4F4IA 2I2AA 4QXRA 5DKFA 2WVHA 1W7AA 1O5TA 1UFRA 3LHFA 4GOLD 4JOBA 2E55A 1CQWA 2WIDA 3C1OA 1MVOA 2ZAGA 4OTZA 3I9V6 3D9QX 4BNKA 2DBRA 1EFPA 1IWPB 3H9JA 3M70A 3C3WA 4KQFA 4XD7D 5H3LA 2OEPA 1VCMA 1KFCB 2CLIB 4YAGA 3ZWQA 4RD1A 3ZZ0A 2FW0A 1DTSA 4X94A 2C8VA 1KZGB 3A1CA 3L01A 4ARSA 1CQZA 4YPOA 2YUIA 3VUEA 2M6LA 5IAOA 3C3CA 5BV8A 4BLQA 1BZYA 2MSWA 4DMKA 3FDXA 4LVNA 4BV9A 2J46A 5HW0A 1GSIA 3ZX4A 1TA9A 4ER3A 2D2VA 1KYYA 1ZQ9A 2FPPB 2QA4B 2ZSFA 5K6RA 5CB6A 3AERA 1U7UA 3CEMA 5FTLA 1NYTA 2VHVA 3ZD7A 3K1ZA 2FEOA 3MBOA 4M9ZA 2G6TA 3GGGA 3SBOA 1Y7TA 4RDJA 1VMEA 2JANA 4E32A 2GPJA 3G71B 4F4CA 4L0QA 1D2EA 2I8AA 1JYFA 3LUPA 3OKXA 3WNVA 1RNLA 3SYLA 4MCIA 3UWOA 4C88A 3OZWA 1K3FA 1P2GA 1QS0B 2VRCA 4QUEA 2LKCA 4K9RA 4KODA 4KWCA 4UU0A 1EPUA 2ZI5A 2YKGA 4HWSA 1E6KA 4JYPA 3EDMA 1ZSYA 1DELA 2WUDA 3ILSA 2AMLA 2PIDA 3SJZA 1NYQA 1HZJA 4WQMA 2PK3A 2UZ0A 2C3UA 3KD2A 2BBWA 4OGWA 3OZVA 5CFRA 3DDHA 3ZS9A 4PONA 2VPZA 4C2AA 4ZGWA 1A82A 4HN4B 1QIJA 4GI3A 5GZ6A 1CEXA 5IDQA 3PKJA 3A25A 4PXSA 2NQTA 2ZSUA 2PKQO 2QX9A 2DR2A 1NAIA 5HILA 2GCGA 2BC9A 4ZT6A 5B4TA 3KKPA 4N5HX 5LLDA 2W6JA 1AKNA 1ZY2A 3JQ7B 5EIOA 1WSAA 3L0YA 3ZHZA 3O6VA 2VP4A 1LD3A 2YOHA 4CDMA 3RVLA 5DM4A 4KSBA 3WLAA 5HUHA 1GU1A 3CR8A 1CUXA 3EGWA 4CIBA 1QIGA 5KNDA 1P7ZA 5C51B 1DC7A 2HA0A 2NYVA 3O9VA 4UNPA 2AUNA 1Z73A 3B7WA 4JLJA 4H1TA 3T3DA 3E18A 4AX8A 3OPOA 3I3OA 4LC0A 1S72B 5KSOA 4WT7A 3OZAA 3NM4A 4RX1A 3V9PA 5DTQA 3AU8A 2V98A 5C5DA 5DE3A 5I7FA 2Z58A 3BHJA 3IJEB 2WTXA 3I5YA 3GMIA 1FC0A 2V6FA 4CMEC 3R9XB 1XC7A 4NTZA 4R1UA 4BEBA 4HSGA 1H5UA 1JHVA 2H92A 3M3PA 3SF0A 5CD1A 3KLOA 2ZBPA 1R64A 3GCZA 3W5BA 1KZ6A 1OBFO 3FUXA 3N8HA 4JVLA 2JEZA 5FB3A 4TQ9A 5JNRA 4PLGA 1EM6A 5KNBH 1A0OA 1XBTA 3VSCA 2VTEA 1XRQA 5EAIA 2V0NA 3ZR4B 3D59A 1LDNA 1V3VA 2IK8A 1Q7BA 3FWYA 3ZXIA 4X7CA 1BD4A 2AVDA 1J99A 4QBHA 1TUBB 1Q7TA 3CG0A 3Q2OA 5IWAB 4NC9A 1IK4A 5IM4A 3DUWA 2QZ9A 1YB6A 1WVIA 2WYRA 1AKQA 2PGLA 4KCGA 4CDNA 1FUYB 4GE3A 1T9DA 3LCUA 1JU9A 5KYWB 3OAAA 3O8QA 2ZS8A 3I3SR 3DFFA 3ZHQA 3CFYA 4X00A 3KVVA 2RIRA 3ZBUA 1O08A 2ODNA 2XUHA 1PTKA 4P7FA 5AQ1A 1L1FA 4IH9A 2P2NA 4NYIQ 2OZVA 1RI4A 3NYIA 3CC4B 2HMAA 2OQRA 2EF1A 1R9NA 3F90A 4I9FA 3HKBA 3MT8A 4DUGD 2NZWA 3QUCA 3P0IA 3AKZA 4U9UA 2VP2A 3CVJA 1DHTA 2ASEA 4HDCA 4K46A 1QHFA 4O4JA 1L5LA 3I6QA 4F5YA 1QAQA 1Q1QA 1JXQA 2R6AA 4KIFA 3CLRC 5DLYA 4DKJA 5BOVA 4JUFA 5BYAA 2XX3A 3JZIA 1L7DA 4OXNA 1CNFA 2XUOA 3RARA 3BSYA 5BUSA 1H4SA 1OI4A 5CPBA 5GONA 2R6R1 2R60A 4JEUA 4K9PA 4KQMA 4PO3X 2ADFA 1YCFA 5E0OA 1C1DA 5CCDA 3UHJA 3PE4A 4S3MA 4GDFA 3HLKA 4DQUA 3DMTA 3KYIB 3WXMA 2ZBRA 2X6RA 4C6SA 3Q3EA 4JQOA 4WDQA 4CTKA 2HLDD 1QZUA 2C4VA 3OZRA 2V54A 2XHZA 3RHSA 3TCKA 3ID6C 4XPZA 4XVRA 3JRNA 1IQRA 3NTXA 2VUSA 3O2NA 3T4EA 3ZHSA 2XTZA 1CZOA 1S2IA 2SBTA 1IZ7A 1RWOA 4QSHA 4F6LA 2MWMA 1RDFA 1D4AA 1ECLA 1Y7LA 2ZTMA 5G1OA 1I5EA 2JD0A 2XOKD 4YRBA 2ZVPX 2DH6A 2ZE5A 4WD3A 3B1VA 3L6OO 4MUKA 4XFKA 3WLJA 3A9WA 3MWGA 1FZQA 1NKSA 1Z15A 3BXOA 1XJCA 2I29A 2HYDA 1E4EB 3L05A 3KQNA 2VEDA 2AJTA 3W3AA 2EFDB 1KY2A 1PI3A 3R7WA 4D8TA 3D3QA 3WL5A 2PKXA 1KNQA 1NVMB 1NYLA 4OL0A 4RJKA 2NVOA 4YV2A 2R44A 1QHIA 4F4UA 1CEEA 2QUJA 1VECA 1TD9A 3M6LA 4ZU3A 3MWEA 1TKCA 5KYNA 3H1AA 1YSCA 2NO9A 3A70A 2AJLI 1UKVY 5LB4A 2Q5JA 5J3OA 1JIIA 1ML3A 1Z6YA 2B1IA 3KFVA 3UWDA 3S8EA 4HNSA 2IUYA 2XGOA 2O3QA 1SRRA 1Q5PA 2VRWA 3F2IA 4J49A 4AZ0B 4WDRA 3C1TA 1T2DA 4MYCA 5JS2A 4GBGA 2V6BA 2IS4A 1ZIXA 4C30A 3CYFA 3MCZA 1N3LA 2B8EA 3WNQA 3E5MA 4JASB 3U4QA 4DR6B 5GJBA 4JJ7A 3GARA 3HYSA 1VJ5A 1XLUA 2GWHA 4R2KA 4XKJA 5LBUA 3U40A 4B79A 2BFEA 3B1JA 4IUDS 1CJCA 5ETJA 3MTIA 4BVEA 3G17A 1XZKA 2SKDA 3BSFA 1P6UA 3VHQA 3EGVA 2GPNA 5AUQA 4P3YA 1Z2DA 4EHLA 1BE8A 3Q2IA 3TH5A 3FVTA 5GADl 2UZ3A 3PFCA 1IQUA 1XNGA 3P4XA 1F2VA 4OXYA 3DULA 4O2BF 4JB3A 2ONKA 6Q21A 5EZSA 5I7VA 1ABBA 2DEUA 3Q3VA 1TVKB 4R1TA 3KPWA 1G2PA 1Z0SA 1A7KA 2BEWA 1UEIA 5E38A 1UJNA 1LK0A 2ZK7A 3UA3A 3ZZNA 4P7BA 3NG1A 2H2AA 4XPIA 4B6FA 3R74A 5DTRA 3RK1A 1OFTA 1Z4JA 2XCLA 3GFFA 3E3LA 4LDNA 2ZL6A 4WJZA 2A5FA 3P5BA 1ONOA 3JAKB 2ICAA 5AVJA 2OK7A 1PR9A 4M1QA 4F1KA 5JS7A 1SIUA 2W6PA 2VNHA 3Q98A 1J5XA 4ZQHA 5E6RA 1EE9A 5LA6A 1SUBA 1ZOOA 5FBWB 2FN9A 1QVZA 2PZAA 2HWXA 2DFPA 1FQKA 3T3MB 1IFXA 2C9CA 3IEUA 2BGRA 2Y76A 4EMSA 4NZ9A 1MX3A 2RGWA 2C2KA 1O87A 3PXUA 2WB2A 2ZDQA 3TINA 5IPFA 4DG9A 1SK8A 4I4CA 1JR4A 1V9LA 2Q8NA 4PLHA 4QTUB 3C8MA 4P25A 4LYFA 1KVUA 1Z75A 2HCTA 1T2CA 1XDSA 2P27A 3PXBA 1VCHA 3RAGA 4NCKA 3SYKA 1MV5A 4HDQB 5E3IA 1LDBA 1SU6A 3O31A 3MHPA 3V2HA 3I9KA 2IBSA 1E1NA 3EC2A 1RVV1 3EHEA 4H2DA 2QRVB 3REOA 2BGWA 4N54A 2P69A 4UHCA 4WLNA 4ZRNA 1FZTA 4LCBA 1C9JA 5FAXA 2IJGX 4MZXA 1OYWA 3VAYA 4JBYA 4ALKA 3NLLA 4EYOA 2E82A 1WW2A 2DGDA 2PGJA 1NBME 1Q16A 3BC1A 3LXMA 3PXDA 1QG0A 2X0FA 4AMBA 5FOSA 2WD9A 4KX3A 5GWXA 5HA5A 3RRMA 4L7VA 1E9AA 3K9LA 4FYHA 3X43A 1ZDMA 1KEEA 2ZTLA 5BN4A 1N6RA 2C98A 1PWEA 1RLTA 3AC0A 4FKMA 4A6DA 1O1YA 1B8PA 4KO1S 5SY9A 2Q4DA 5FQOA 3QBTA 2C0CA 3I9MA 5IJ0B 1W4ZA 2NACA 1KO7A 2G3YA 3IDZA 5DYTA 4KVZA 2PVSA 2QM7A 4WK4B 1ZO8A 1PJQA 4OJTA 2J67A 1AF4A 4QPJC 4UNSA 2CXUA 4CGZA 4ER6A 4W5OA 4KO3S 1ZW1A 2WIFA 1UBKS 5TQ2A 5GPBA 3KJHA 4WADA 1QYWA 3EIQA 4ZAGA 5A03A 1VSTA 3U4GA 3F6RA 4ZRMA 4S0XA 3UJ3X 3QLUA 2C4HA 1EYZA 3O1LA 3FWPA 1NFQA 4YJ3A 4L27A 2Y67A 1ZPDA 3IQHX 4MK4A 2OMKA 2CHQA 5JNWA 4GOMD 3AYZB 4KWIA 1VIDA 5K0ZA 3RYHA 2QIPA 1XWIA 2YVQA 4PAGA 2O2JA 1TAUA 2XJ4A 3NALA 3RYIA 2XZDA 2I4IA 3DL4A 3SZLA 4HK4A 4CL8A 1V96A 2XB8A 1IXRC 4EYGA 3OLCX 1UK7A 2BUCA 3D31A 3FSGA 2BBSA 1YZNA 2P3OA 2Z8XA 3E3NA 1KEUA 3BPSA 5GV7A 4KK4A 3H13A 2GCEA 4NG5A 1ONPA 5KOJA 4NYMR 4EITA 4K7JA 2I6GA 4EEXA 3CCEB 2MIIA 3L1VA 4Z9FA 1EFHA 1DRVA 4YN3A 1X8JA 4EFKA 2I3GA 3ZHOA 3A9TA 2W70A 4D7AA 4NZNA 4KXFB 3DLBA 5JADA 1T13A 3JQ8A 3QEMB 3RKSA 1F17A 3N0RA 3P2JA 2RHHA 4MP3A 1VQLB 2WZCA 1A76A 2AK3A 2W43A 3KSDO 4HAOA 1AY0A 3E5NA 3KL2A 1YRAA 3EZNA 5JSZA 5K3EA 1OFVA 2WJ6A 2ODWA 1ABFA 5K01A 3SHVA 3DBOB 4ZAXA 5COBA 3A1PA 1W9HA 2JH9A 5EMNA 1YJWB 4LIPD 3UV3A 2R5FA 1I1OA 1QWSA 4KAJA 3ZQ6A 4Z4WA 3FR7A 3DG9A 4YALA 1NY6A 5KTPA 5CH8A 5EIEA 4BWYA 3PUZA 3BA1A 5BP7A 2R62A 4X66B 1BFDA 1YIAA 3ZDXB 3DQZA 4JX8A 3TKAA 4EFNA 9ABPA 3H19A 3GU3A 3ETGA 4KVFA 2CB0A 1YTLA 2JPDA 3IP7A 4J7CA 1N1GA 1L0BA 1HFWA 3M2PA 2GBLA 4KMOA 4X1KA 5L7TA 2GN2A 5EXPA 2QTBA 5KHLB 1AN9A 3WWEA 4P22A 1DC8A 1E2KA 3D8RA 3K09C 3RV3A 4LE0A 1VIMA 3MQ4A 4D4IA 3KAJA 2AD1A 1T0BA 1HXHA 2YIVX 4YMTA 1FYXA 1R0YA 5I7WA 4DA6A 1EKXA 3GPIA 4N0EA 4PNEA 4MUIA 2WUWE 1TCCA 2NXNA 3JQGA 3WIVA 1Y0RA 3G8BA 3KUKA 3OIDA 5K05A 4XJVA 4BLPA 3U48A 3KOMA 1BU8A 3PQEA 4KX5A 2WBLC 2IX9A 3ZGNA 2D5IA 5KYTA 1I94B 1HRKA 5HJ5A 4KN9S 3PUMA 1QM5A 2C7GA 3MERA 4NE7A 4BTEA 1W93A 1P4AA 1KC8D 4NPAA 3ZVMA 3I28A 5LL6P 1QX3A 1O4VA 3DEIA 1E64A 2Q1WA 2H8GA 1K6MA 2Z04A 3N2IA 2HDNB 1E9EA 3FHLA 3NEPX 4UUAA 4J16C 4FYKA 4OB7A 1C50A 1JDUA 2CDRA 4K9QA 1UQRA 2VJJA 1K9MD 4WN9B 5EFOA 4EVQA 1L8AA 1PZXA 1VCOA 2Y92A 3L0ZA 4LI0A 3UAZA 2C07A 2CKMA 6AT1A 3IMKA 4LY6A 2ZRMA 3TZHA 1U81A 2W2VA 3LQ6A 3R5TA 4XRRA 2NUPB 5ELXA 3ZEIA 3G6WA 3B20A 3ITKA 2WWGA 3QELB 1DQZA 5HCIA 4JZYA 3VNQA 1UF9A 3LDHA 3F5FA 2FW7A 2B3DA 5E2IA 5IH7A 4K28A 2IRWA 1B6TA 1RZRA 2HGSA 3CZ4A 2Q4EA 5HMMA 1ZM2A 4XB2A 2A5GA 1TF2A 2B20A 3DZIA 3HI4A 4DSTA 1SUDA 3HQ4O 4NMHA 1L5QA 2D1TA 3HUUA 5D51S 5AKHA 2FN3A 5HKKD 3KU4A 4TT3A 3HUTA 5IS2A 1EP1B 4IH1A 4X8IA 3R0IA 4LDQA 4A27A 1UM9B 1K4KA 1V7CA 4LZJA 1Q74A 2IYXA 4AMUA 2PO7A 2I6TA 3GLSA 3GT3A 3CPXA 3PENA 1E2EA 1OFUX 2JIRA 3QMPA 4BX0A 4EJ0A 2FPIA 4ZK6A 3P32A 5IYNA 2H1WA 2JA2A 1ZCZA 2BCEA 3G88A 1ZLXA 5TRDA 3PWTA 1U9JA 1GSAA 4B4WA 3A9UA 4JI1B 1JKMA 1EGHA 2L82A 3C70A 3DGFC 4XYGA 4YRQA 2V0CA 2IW3A 1N2OA 3SEFA 3TUZC 3KJQA 2QTHA 4LJ5A 2EVWX 4K0KB 3C4QA 5K8VA 2VA9A 1USGA 2QBYB 1QE3A 4J6EA 3JQFA 2JFBA 3GPBA 2QV7A 1EFVB 3JQ7A 3X1ZA 2SNIE 4NEQA 4B35A 1IUOA 1KMMA 2CXRA 2CMGA 3CZRA 1UWLA 5A9SB 5AUNB 5HGJA 3FCEA 2HAEA 3VHRA 2GEBA 4H3KB 4M46A 5EXSA 4I1RA 1RQXA 2Z8YM 3P8ZA 4HAWA 4QVAA 1UMCB 2YBDA 3DKKA 1LNZA 1IHXA 3RBZA 1OF1A 3JU4A 2XDYA 2WSBA 1CY7A 3ELWA 3NHRA 1C9NA 4MV6A 3PNVA 2ZSKA 1Z38A 4U7GA 5SV2A 5B7NA 2XXAB 4ASUD 4DUZB 5SICE 2H4YA 2WZPP 2G80A 5FWYA 4QUJA 1PQYA 1ZXXA 2KE5A 1WWKA 3VNVA 2ZUTA 3GJZA 5HQTA 5ICFA 4ISBA 1U3CA 1GGEA 3L7YA 2WABA 1G3RA 3QBJA 4QYSA 1KDYA 3ZCVA 4BNGA 1TCBA 2GPBA 4AQYB 1NJID 3W06A 3AR7A 2AOTB 3MS4A 4KGVA 3TW0A 2QNRA 3NGMA 4ABYA 3CNNA 5I9NA 2XKJE 3L6BA 1QHSA 1DOHA 1OWLA 1PR3A 1ZRNA 1XVTA 4DMMA 3J80A 3VKVA 4MQ5A 2O3UA 1I30A 1YE8A 2JIMA 3I01A 4R2IA 4TYMA 5EY5B 4NCAA 3PIDA 2IIVA 5E4YA 4ZMBA 2PEZA 1FX0B 3T4XA 3QLVC 4YXWD 1I7LA 2NV2B 4NOJA 2ZDGA 2AI1A 3IESA 3DTYA 3H86A 1VL8A 4M87A 2VP5A 3F6EX 4Q6BA 1LLFA 2JARA 3M6MD 3PC8A 3HSKA 2JCGA 3PFNA 2QX8A 3D4NA 1W0CA 4U2BA 3GL9A 4J0QA 1ATIA 1OMOA 1UPFA 3MWJA 3GGPA 2FZGA 1CY2A 3AZOA 4TWAA 1TMKA 3RQSA 1H1TA 4FCVA 1N2SA 4J6FA 1WCYA 4NPCA 4PYKA 4ZALA 1Y8QB 5F1YA 3ETEA 1GAJA 1UWVA 4LJ9A 2I7CA 1X9IA 2OXEA 3NTQA 3WSWA 4X54A 5A05A 4E6PA 1XQWA 3IUJA 5AJZA 2B35A 2YZKA 3P9PA 1UFOA 1CQJB 4PX5A 4K6HA 5D2CA 2QVZX 2PJDA 4C4XA 2HFJA 1S8NA 2XTJA 1CF9A 4RIHA 1ZISA 4MYRA 2AQKA 1YZQA 3BRWD 5JVDB 1Z8DA 5L4NA 4H3VA 1TIBA 3LS2A 4WCVA 4BLRA 1Q1GA 3CPJB 3MWYW 5JCJD 2WYHA 4LJLA 1W85B 4LJ6A 1U9YA 3HN2A 2DWCA 1XYVA 4QDOA 3T5MA 2YJGA 1MH1A 3TNJA 3MIZA 1ZH0A 5C5CA 4NE2A 3N2KB 1EVIA 4IXNA 3I05A 1Z26A 3C7AA 3UHPA 1KS2A 2ANCA 4B4KA 3AUAA 1GPYA 2PN1A 4GLBA 1NBMD 2DVMA 3KXPA 3QOYA 4JIMA 4YPFA 4W7HA 1YO6A 1NJ5A 1QF7A 3KX2A 3OT5A 4MWSA 2QMEA 3HNOA 5AFSA 1R50A 3QBVA 4HQKA 2W83A 3OLYA 2N75A 1O4WA 3AHFA 3NBZC 4YNBA 3R7SA 4YH1A 3AEUA 3TTYA 4AVYA 4F2HA 3ET4A 5I3ZA 1N1MA 1II0A 2O2XA 2W4IA 4M9XA 4F96A 1ZA2A 1XFOA 1N3YA 2G8LA 3RKUA 3STTA 1NJ6A 4CTOA 5FBQB 4F2WA 1XELA 2R84A 4V0ME 2PA0A 3NM6B 3MRVA 2C57A 2COEA 5KHOC 1U9IA 1SXHA 2HMTA 1HDXA 3R9IA 4PABA 2VDMB 1KVQA 1IM8A 2C61A 2R8BA 4RMNA 1YBHA 3OLZA 2Z1NA 1N2CE 3RUDA 1JR2A 3WWPA 3HM9A 4LXXA 2ZAMA 3N7TA 3ECCA 1G60A 2A5YB 2PUHA 2VSQA 2LV8A 3ETDA 3QNWA 1QUFA 4PWZA 1XZBA 3NW9A 1DAPA 1XZIA 3HFGA 1RYFA 4MS4A 1L7PA 2CDCA 3JV7A 4TS1A 2YNMA 3U0BA 3BQJA 1KFBB 3KYDB 3BK2A 3GWGA 3LUCA 1DBQA 4JBHA 4NCJA 3LPNA 2A3RA 1CR2A 1JSRA 1EDDA 1DDIA 1LPNA 3EIHA 4XOTA 1PEKE 2X41A 1HDIA 1K9SA 2DULA 4G37A 2QRJA 4RZIA 3MILA 3R5XA 3VPDA 5I8WA 1C41A 2WE8A 1CB0A 1Q7CA 3KSZO 2BTQA 5EJ6A 5AI5A 2YHBA 5G0VA 3EN0A 1FLVA 4U5QA 4D3SA 4MRRA 2X23A 1PWHA 2Z9CA 3MRTA 3WK5A 1UD4A 3DD5A 2IKSA 4CG1A 5E7QA 1YBFA 2CUTA 5DEIA 1U0GA 2VAVA 2JEOA 3L0BA 4MICA 4U2CA 5DP2A 2A4KA 3AG6A 2CZQA 5DZSA 5IC6A 5F4BA 4JS0A 3SNKA 3T9FA 5HM8A 1U3GA 4IIEA 3SXPA 5BSKA 5BRJA 5KTSA 5D3QA 5KQGA 3EH1A 1QB7A 1JW9B 3R3VA 1AA9A 1A04A 3W6UA 1SBYA 2ZWIA 3EQZA 2R6GA 3IUSA 3WL7A 3X1JA 4GOND 2ZZNA 3FHTA 3A26A 1UP6A 2UUOA 3CKKA 4XLCA 2R8EA 4C1NA 1KOFA 3L8YA 3EEQA 4IYJA 1DO0A 3IKTA 1W5EA 1B93A 3SSOA 4AF8A 1TVCA 1NOJA 4BNUA 1ZK0A 1CRZA 1J9GA 2EBHX 2BFBB 3LP6A 2NUTB 2WWFA 1AKYA 3DAFA 2G1UA 3UW1A 3HRKA 1PFKA 4QNMA 1VQOB 4B3HA 2ANBA 3KQMA 3CVVA 2CV0A 2D1SA 5JZVA 3W5HA 1IAQA 1C8BA 2DQZA 4CV0A 3DCYA 2XWJI 3PQ7A 3ZVLA 4OLJA 1V26A 4RTQA 3WIOA 4A2CA 2BZSA 1OJLA 1CZLA 3GN1A 4Z1OA 5F5LA 1N6PA 3M9LA 5G41A 4EG6A 4B73A 1V3QE 1KQSB 2DTEA 4ERNA 3PR1A 3KETA 1YGPA 1KP3A 2PWPA 3ROZA 4YMWA 3DBHA 1L4FA 3P0RA 4RY8A 1D4ZA 1IN8A 1WXEA 2B2NA 4IFBA 4JP1A 4M4SA 2DYKA 5C35A 1LWNA 4CEHB 4ZI3A 1I7PA 5CTJA 2P91A 2QHXA 4TPKA 3GJSA 2R7KA 4PO9A 1P5FA 2X7XA 1MOSA 3HTXA 3FNBA 4FFLA 1L8XA 1UKYA 2B78A 1GGNA 3HDGA 2OKGA 4I81A 3FOCA 3PXAA 1VA4A 2DU8A 1SKYE 3WFIA 4HVLA 1T9GR 3BE4A 3GRFA 4G5XA 4ZHSA 2HRDA 4PSDA 3WDMA 1OAAA 3THWB 2D3WA 2BBTA 3D7KA 3FZQA 4E07A 1UOOA 1WO8A 3ETJA 3JVEA 4IZOA 4OVKA 5FPPA 3LDAA 3WADA 2EJWA 3B2QA 2JLBA 1G8AA 2ZTHA 2PYDA 3F4KA 1PLKA 2E87A 3SEAA 3MCAA 2I5PO 2XMRA 3IERA 1FNMA 1XIVA 3GJRA 4ESHA 3IFSA 1YDHA 4XIJA 2IPNA 1E94E 1XZEA 2IHYA 3DKVA 4H1HA 2NLOA 1C80A 2ORED 1XKTA 5ADUS 4IVRA 3N87A 1YIJB 2CLSA 2DFNA 2MSKA 3H7AA 3OCWA 3CJRA 4Y2YA 5CGQB 5E9JA 5TEWA 4DBVO 5K45A 1W88B 5BMVF 2FFJA 3PJRA 2C5SA 2F9MA 2QE7D 1V47A 2J41A 3KPJA 4LHEA 3GDOA 5CVJA 3UUFA 3WOHA 3EOBI 2P1DA 5A1TA 1DWUA 2FFQA 2QGNA 3HR8A 3F5SA 1VC2A 4MYHA 4IBOA 3II6X 1GCOA 1NQOA 1YRLA 5F4JA 3WGVA 3IIKA 4R2HA 4R16A 5E6TA 4W99A 2P5UA 3K2QA 4RPIA 5CBKA 1UXGA 3RW9A 3DOFA 3HR7A 2RAVA 2DPXA 1LV7A 5B7GA 3OUUA 4HN2A 3B1ZA 1YJ5A 2Z3WA 2C7BA 3NHZA 1I80A 5EZYB 5HDQA 2F7SA 1US8A 3ILHA 4PO1A 4X97A 2HEGA 2GNAA 1CVLA 3IUNA 1J20A 1QYDA 2J9RA 4UAVA 4CKCA 1SKMA 1CNEA 3NC4A 3GPLA 3IO3A 3OHMA 3KU1A 1QYCA 4HEA6 5DSXA 4K1XA 4IEFB 3CEJA 1CK4A 1NVAA 4Q3CA 1E1CB 3QEMA 5TGDA 4URUR 3DO6A 4JJFA 2G9NA 5AM3A 1GLVA 5CTAA 4Q1EA 3KUUA 3HDQA 5BWBA 4KKSA 4ATNA 1Q9SA 2VQ6A 4IPTA 1OGIA 1QIIA 1CUCA 4I5FA 1SIOA 2GH1A 1CY8A 1NT2A 5LQAA 1NY5A 1QE5A 3S55A 2OUIA 3GIRA 1X2BA 1E6UA 2GN1A 2PUTA 2V97A 3AHGA 3OU6A 1NBOA 3TTVA 4CKXA 1TUIA 1ODIA 4CR7A 1W0JA 1RCFA 3OCCA 1UFVA 3B3JA 3EFOB 1KMHA 4GR4A 4E13A 3CPWB 1LRJA 3I2JA 3OD5A 2J0VA 4S0ZA 4HQ0A 2OFFA 3R3SA 4UNIA 4DLBA 1PT9A 2O0KA 3A2LA 2SCUB 1BYUA 1URPA 2MMGA 3EUWA 4BTLA 2ARKA 3QSYA 2MU1A 1T0UA 2QX4A 4QFDA 5AVVA 3DMDA 1C9MA 2OV8A 3PLRA 4GPTA 4Y6LA 2OFPA 5EI5A 3DMGA 3ST7A 2DFTA 4DQ0A 5A6VA 3DGEC 1E3SA 4JEIA 3GNLA 6REQA 2HMSA 3MT0A 3V4VB 5IYZF 3QKIA 4AMGA 1E5XA 3M4JA 3LA6A 1OZ0A 1VLMA 4NBUA 4Q3OA 5CURA 4MO9A 3GP5A 1AGNA 1JEEA 3QX3A 4DCGA 4IUCS 4PPFA 2ODTX 5AOVA 3NQ41 1Y6ZA 4L3VA 1VXOA 4XIFA 1GTRA 1MZVA 3KALA 3AEKA 4GZ6A 3K8OE 1XZPA 4R9VA 4G0VA 3NXKA 1JILA 1QGUB 2VDWA 4RF2A 3U60B 3K35A 1XVIA 2H7YA 3LC0A 5CYOA 2EJCA 3FBTA 3GRAA 4PC6A 1LK7A 2VA8A 4ZJUA 3ZE1B 4MS1B 4TMXA 5JJKA 2BUBA 3V8PA 1LBEA 3MXOA 3FYUA 3MPOA 4XCXA 1E7MA 1S6YA 3I9JA 4TLLB 4ZOLB 3K16A 5BV0A 1WOMA 4G1MB 3C3AA 4EY6A 1KYQA 1P4SA 3P45A 4MR9B 2HRCA 4YEJA 5AKJA 2ECQA 1E2MA 1Z7BA 2C5BA 2IYSA 4ZQBA 3D6HA 4EVRA 1HDEA 3ADOA 3BCRA 1RQNA 3DE7X 3CUUA 4ZYYA 5IF9A 1KE1A 2HB6A 2JBHA 1DV1A 3D2CA 1V3UA 3QELA 4GLJA 4RM0A 1B8UA 2PT9A 3N3BC 4PW0A 3QPUA 4RPGA 4WK2B 1H69A 3I83A 3JAWA 2IBMA 1T36B 1GL7A 3SHQA 3QE9Y 2J5XA 1N7GA 4KQCA 2I6QA 4OI0A 1TKBA 2JJQA 1KDOA 5LMUB 2YYSA 4I9HA 4K88A 4KDCA 2VJMB 3PI7A 4NP6A 3NX4A 5KBYA 1V4BA 4EPVA 1Z88A 3M6XA 1I0LA 1ZU4A 1ZZEA 4BO9A 2VLIA 1MRSA 2WJZB 2EKLA 4L50A 5CAEA 3I0MA 3QE4A 2GO1A 3KWMA 1EJ0A 5TT1A 4YI5A 5JH7F 4UASA 4OXQA 5DP1A 4P6YA 1Y3BE 3CF4A 5KWVA 3KZOA 3W8FA 4WZTA 1CRWG 3L3BA 3PC3A 5EUQB 1CW2B 3L04A 1GARA 1ISHA 1BS1A 3AR2A 2VNIA 3NHUA 1YITB 4N0MA 4BAGA 4YAIA 4Y1FA 3F73A 1NN5A 5D5HA 4PZCA 4KXYA 4CETA 1YRHA 2AXEA 3GAMA 5BUQA 2CYAA 4OHMA 1EFVA 4QRDA 1F4LA 1RM3A 3NVAA 3NYQA 5AJHA 1GFIA 3VC2A 4GR9A 1H0KA 1X80B 2LW7A 4IQGA 5AW0A 3MTQA 2GBGA 3OCUA 3VR1A 5FBHA 4AWBA 3UPTA 2NT4A 1M8JA 4EPXA 5CFMA 5I01A 4ZQFA 5AKKA 3T95A 2QTFA 3NWPA 4IYRA 5B3AA 4PIMA 3VRHA 1KTVA 1GIAA 3WGYA 1O8BA 1GITA 1E2NA 5AYVA 2HUPA 4XD2A 2Q5CA 1N0UA 1B0PA 3MMXA 1I24A 1DINA 1Y5IA 2ENWA 4LQCA 4Q39A 3AG5A 1H6BA 4YACA 1XTKA 2JLWA 1J4AA 1H0RA 3JWGA 4M76B 3RABA 4P7JA 3QBDA 4JYCA 4FJ1A 5I7AA 3V4FA 1Z56C 4WFKA 4WNIA 2Z6QA 1SELA 1AK1A 1SVWA 2ZREA 3GMDA 5A9TA 3IX7A 1FQWA 2VJOA 1NE2A 2PL1A 1I9GA 1PQWA 2QRGA 3HN7A 5KTTA 1SZJG 2YIJA 1N9GB 4B9EA 4KR2A 4Z3OA 4OJYA 4P2GA 4D44A 3B6ZA 1U9CA 5ALIA 1WOOA 2CNDA 1MO6A 3ROGA 4IRUB 1FX0A 2WMDA 1U65A 1ZJJA 2Y6VA 3VNUA 4TLMB 2BKEA 4G6IA 4ILKA 4BOYA 4PHTA 5FV4A 4HFMA 2IHKA 4DY6A 2O4UX 4J07A 2QW1A 1EJBA 3L7CA 4Z4QA 1G0OA 2BFWA 2G40A 1E7WA 3OX1A 3O83A 4E94A 4KV7A 4YK7A 1YRYE 3SN6A 3EPRA 4KSYA 4G81A 1XCBA 2XD4A 5ALLA 4AG6A 3W8NA 4XIGS 4RGBA 4EHKA 1A9OA 3BMQA 3SM9A 5ICEA 2GF9A 5KYKA 3NU1A 5CNMA 3BM5A 2W71A 3R76A 1VFPA 3U6KA 3VVCA 5E2AA 4HEHA 3C6BA 3LUBA 3AR5A 3ZJ5A 4J2OA 1CQJA 4XJTA 2CNWA 2AJBA 2UVQA 2VAPA 1IHDA 4UQLA 4G1CA 5JVDA 3M6IA 1PG0A 3OT4A 3NAMA 4Y6QA 3DOCA 1R88A 1GUDA 1ULTA 1NRIA 2XY4A 5L3RA 4RY0A 2QMHA 1DKMA 1W85A 1XTQA 4MYTA 3CESA 1FSFA 3EPPA 5IFKA 1Y4DE 3CB2A 4UM5A 1WZIA 1I7NA 4KEAA 3UAOA 1FUUA 3IP8A 5B6IA 1VLQA 1DJLA 2DYIA 1DUVG 1YCGA 3GLHE 2CWDA 3M4ZA 4L7QA 3QHPA 5ED0A 4YAEA 3RVDA 4OFWA 3D2BA 4EPWA 4DV2B 1JRLA 3STHA 4I1PA 4NZPA 3OCJA 2GASA 1W52X 1WLYA 1S9DA 4RO0A 3NUQA 4BRSA 1RMYA 3B5IA 4Z8YA 3WLQA 1E43A 3TLGA 2ZQ5A 3A9SA 4LBWA 4O2LA 3AYXB 4RFLA 4MLPA 3F49S 4ZK2A 3BHNA 1D2AA 4FNOA 2ISCA 1X42A 3IT2A 1U0LA 1W5FA 4JJ4A 2GBFA 2MINA 2WINI 4BQFA 1P6QA 3KTFA 4HGOA 3HA3A 5DHRA 2CJWA 3ZD9A 2I1VB 4ZPJA 1WMFA 5KNBD 1AKTA 4UE6A 5AK5A 4F2GA 5H9WA 2OHGA 3GAFA 3TGPA 3PQ5A 4DC1A 2G9UA 4XLFA 4UEWA 2CVFA 4RV9A 1JJIA 3A6ZA 3Q7QA 4ZO8A 3RYFA 3N86A 2VPIA 4UUMA 4RGYA 3B7GA 2PCLA 4A2WA 5JJBA 5KNCD 1KPGA 1T6BY 1HSOA 1UDXA 4CM1A 4U7FA 1AMOA 4R9RA 4S1PA 3CWZA 3GG2A 2O8FB 2EATA 5GVRA 4RVNA 5DRTA 3WHPA 3BZBA 1C3VA 4LJAA 1G20B 3C5HA 2GOYA 2QN6A 4NFSA 5JAZA 2QZ4A 5JQGF 1DMRA 3Q40A 4X0CA 1BLIA 3OETA 3QKUA 4DWJA 5TR9A 4IUYA 3VXKA 4BNIA 2VEOA 3HL0A 2DRIA 3LC2O 1EWYA 2RH9B 4Y6RA 3A37A 2VUIB 2JK1A 1TAQA 1RQ2A 1T6ZA 1LC0A 1H2RS 2I65A 4P98A 1XTUA 1HE4A 1QLJA 1LK5A 1U0EA 1ZIDA 2E4XA 2RBKA 3TB6A 2ZUBA 4MHTA 4KH0A 3A6DA 4PHGA 3TWOA 3ZPNA 3UV7A 3I62A 3I9OA 1VKOA 2FW9A 3PGLA 4CFSA 4CMIB 4YRZA 3H4TA 2W2NA 2VDKB 4MPPA 1RRCA 2R6CA 3K1TA 1RPTA 5JEDA 4X8OA 1NF8A 5L45A 4Q05A 3HS3A 4I6JA 3PJDA 2E18A 4NOLA 1EVEA 3T4PA 3C7CB 1PO7A 1JIUA 4NU8X 4X71A 3AB7A 2OCGA 1SG9A 3BICA 1KEVA 4MOWA 5JFTA 1RI5A 5B6PA 2OCAA 4HQOA 4TZTA 3ROQA 3NOOA 2M6SA 3OUZA 4BTVA 1UT5A 1BJRE 1M1YA 1HT1E 1ZKMA 2C94A 3TW4A 3ZK7A 3KZMA 5L51A 4CMAA 3IC5A 4O4HB 1VG9B 2ODBA 3AUTA 5DWQA 4HH4A 4G23A 4XGRA 1YDWA 5JWRA 4DNPA 1FDTA 4CPDA 2GDZA 3NNNA 1J8YF 3QPBA 5B7QA 1Z3IX 4RJ2A 1CPYA 4UCQA 1UC8A 4FVTA 4MROA 3IBSA 2H1IA 2PMBA 4REQB 3GMTA 5ALYA 1DIBA 1FJHA 3GVXA 2GZSA 1RKVA 3KR0A 3C3DA 3T51B 1B15A 2ZJYA 3CLSD 3PUYA 4OK5A 4X7PA 4C7OA 3RR2A 1QF6A 4XKVA 1HDZA 3HEBA 2REQA 4LY3A 1FNSA 3P5SA 4U2KA 4FN5A 5FJJA 2ORVA 1I6MA 1Y1LA 2JZNA 4RGQA 1Y6FA 5CX1B 4MRMA 3I9FA 2I99A 1R5BA 1J0CA 4U7JA 1MG0A 4GDMA 3NATA 4BLOA 2RARA 4CM7A 1IOWA 1LDYA 3M0EA 2WF6A 1OLUB 2WYUA 4XONA 3G9TA 1T24A 3UYLA 1ZHOA 5K0GA 1NI3A 2KPOA 5L3SB 2O2SA 1JYSA 2GN4A 2NMVA 5D3MB 4GI5A 2IXTA 4EO4A 2BIFA 2ZLBA 1C1XB 3KV3O 4BFCA 3IE0A 4F2DA 3HKCA 2DPLA 4XVHA 1EQAA 1T4CB 3MMNA 4GKKB 2Z4RA 1JHRA 1UIRA 3RRNA 3UMSA 1WB9A 1HYQA 4MVJF 4XASA 2RAUA 3DFZA 1UJ4A 4FLMA 4NQRA 4EB3A 2CN1A 3T41A 1FSGA 3FCOA 3PVDA 4KKUA 2PKQP 1QFYA 1N33B 3VNAA 1JG2A 1ONBA 2PL5A 1A97A 2WU1A 2ZW9A 4JWTA 5FRDA 2X0DA 4Z9BA 4YRKA 3JSAA 3HDYA 4QREA 1JBQA 3ABSB 5M29A 2J4FA 4X8HA 3HYLA 1UJ6A 2ZQYA 3P9SA 4TTVA 1F8XA 1YZUA 3D6UA 5EP2A 4XWKA 2M32A 2OHOA 4ME6A 4YYZA 1ISPA 2CF6A 4NBTA 4RJIA 2OC4A 3PGVA 1N1DA 3PQ2A 2B2CA 4EECA 4YT8A 1W88A 1HE1C 2ZYAA 1EX9A 3Q7RA 3R20A 3WWZA 4BZWA 3PNPA 2RHGB 1ZH8A 3OQJA 2FWMX 5ANRB 4Z1MA 2FQXA 2GFHA 2VF2A 4F4JA 1USIA 3ZKWB 1XJWA 3BS4A 4UDXX 1OHHA 4B40A 5F9FA 4OQFA 1EEXB 2QPTA 3CVUA 5JW6A 4MX8A 3V8NA 4E1AA 1EX7A 2AFHA 5DBIA 1LVGA 2CCKA 2C7PA 5CLFA 4LF6B 1AUVA 1P9RA 1CUIA 3H4MA 4MEJA 5LQMA 5IVDA 1P44A 5JMOA 3MGBA 4W1QA 4CMKA 4RA9B 2CLKB 1KZ9A 3AW8A 2P4EA 5HF6A 4INZA 5HS4A 3QV2A 2R8ZA 2VBGA 2F1JA 4IMJB 5EZYA 4HH0A 1AKWA 1DQSA 4IJUA 3PNLA 4YP6A 2ASVA 2H5LA 2PRIA 3NBFA 2OB2A 1VL5A 5K8CA 1YVPA 4YXFA 5FUYA 2D7JA 3ONFA 1MO5A 4TRMA 1GTVA 2JI8A 3IUEA 4EKYA 4HNTA 5JTTA 1ZM9A 2PKWA 2NIPA 2FMXA 1CTQA 3UNXA 4PBTA 5K0SA 4RESA 1V8OA 4QOGA 1OOEA 4Z0PA 4XAQA 4MW5A 2E48A 1DWOA 4JSYA 1II9A 4RHTA 4NV0A 1DKQA 1KBQA 5BQXA 2GEKA 1K7SN 1UBRS 3DBRB 2PMWB 7YASA 5K09A 1S01A 3UUGA 2HA3A 2JIBA 3M4XA 2QZJA 2AFRA 2XQJA 4MJ3A 5F64A 4ZAWA 2DR0A 4OU5A 4PZZA 3WV5A 4WW0A 2QGZA 2PAAA 4E08A 4K81B 3V2UA 1SZCA 4E70A 5SZHB 2SCUA 1FFSA 1GP2A 3O4RA 1CUWA 1C7FA 1P1BA 1PFWA 4URVR 4JBXA 5EC8A 4ZDJA 1TRKA 4RACA 1UDAA 5C81A 2HK9A 3IH5A 2M5SA 3AILA 1DNPA 1NLZA 3MJFA 4OBEA 2Q1TA 2EFJA 2FG6C 4H7IA 4X6XA 3VNBA 1PJLA 5A5FA 2H4XA 1O0BA 3FMFA 3LC7O 1IK6A 5ALGA 1KK0A 5DT9A 4ZEVA 1SCQA 2HK6A 3HP4A 5AVRA 5CCBA 1IMOA 1EDBA 3KSAC 3QX8A 3ZYCA 3C3KA 4NAHA 3Q6NA 1E9SA 3NOQA 3WS7A 4MUEA 4E5VA 3H5WA 5E6UA 1T4BA 1VLVA 3CSSA 4LF9B 2HDOA 1C7ZA 1E1DA 1P7PA 2PQMA 4HDRB 4HQNA 4K5QA 7MDHA 1QKJA 1XP8A 4B47A 1L5SA 3Q6RA 2Q21A 1XD8A 1XRMA 3LLCA 1EXMA 1SBTA 3U4AA 4EGSA 1Z47A 3KDAA 1DKPA 5CK4A 1AU9A 4WZBB 5BPFA 1CJUC 5HKLA 5BWOA 5AICA 3A4VA 3TPZA 1I2AA 3O8OA 4FKBA 1K88A 3WLNA 4B3JA 1OSNA 3UK7A 3OLVA 3RM3A 3IEMA 1SUPA 4ZAYA 4ZOLA 8MHTA 5I8PA 1KARA 2AC2A 2K4MA 4Z51A 4MQUA 5CA1B 1ZCFA 4GWLA 3UA4A 1MOQA 4AN4A 4BATA 4K9NA 3LKBA 5BOSB 1E5LA 5LU9A 1SCDA 1QC5B 4JQZA 3GROA 3OQNA 1BQ4A 4JXJA 4NCNA 1FDOA 3PD0A 1IJFA 4IWXA 4NYJR 4DMGA 3DC2A 1HA3A 3W77A 4JL5A 1XYGA 5IXJA 3WZMA 3CW8X 4NCXA 4A36A 2PEYA 3X1DA 1HNXB 2V8OA 3RTBA 4F9EA 1RLOA 4BB5A 2CVPA 3QG5A 1YB4A 1BHSA 1GY8A 2EWWA 4Q4JA 2ID7A 4RELA 4DNOA 1R4AA 1AURA 2GM9A 2I22A 1FMTA 3KYCA 4JVOA 4E15A 4JVNA 3MXTA 5BSWA 4Q1AA 4RCVA 5A1JA 2VAWA 1U2DC 1Q1NA 3GVIA 2FPGA 2HF2A 4C6TA 2GR9A 3LBAA 5DNWA 1UOPA 2PTGA 1TO1E 1FP7A 3RK4A 3RVBA 1AS3A 4ZCLA 1XRNA 4FHFA 1QH0A 2DC1A 1W59A 2H6EA 3DZBA 3ETCA 3GT0A 4J16A 4PGMA 1OA1A 4XTCS 3VDMA 1JR3A 4OG2A 1F6DA 5DHPA 4JGGA 3BH0A 1MQ9A 1YDEA 3HA7A 3MCVA 4GECA 5BYBA 1MGPA 1Z2PX 2C04A 4TUYF 1VRVA 1GFWA 1N2BA 5B1DA 4L85A 4AN1A 2H4HA 5LPNA 5JJCA 1XA3A 3FCXA 1OTXA 2P77A 3I09A 3FAZA 1OLOA 3L02A 4PQEA 4MAFA 1K3TA 4KBGA 4N12A 4YRRA 1DEXA 4Q3EA 4J4HA 5EHNA 5C7LO 2NO5A 3LP8A 2BCGY 3C3BA 5BN5B 5BVGB 3MWDB 1K5PA 1QDEA 3CC2B 2JLXA 4H4EA 4C06A 2DY0A 3ZBTA 3AUXA 1X8XA 1YBMA 4FHZA 4RL4A 3FPLA 4LYYA 5EIHA 3WLMA 5BN3A 2W2KA 1VLJA 5BSGA 2IX3A 4R41A 1Q0UA 4FK8A 3E9YA 3ESZA 2BFCB 1TYEB 1N7HA 2IEBA 4TM8A 1XQVA 1IB6A 3V7AA 1MIOB 2BMVA 1KGDA 2HJHA 4XX0A 1WCV1 1D03A 2DFDA 4ZODA 1M74A 4S1OA 5A4MS 1BDBA 5K4HA 1B6RA 2ZU0C 3WA6A 4X91A 5J2UF 2DHCA 1IPFA 1I3CA 2UYQA 2J7PD 3ZUGA 3PIIA 1LI5A 3L06A 3O82A 5K3AA 1J8QA 5CT4A 3LCCA 4NBSA 3G9XA 4MCHA 4CTMA 1G5IA 2GF0A 4Z3KA 1AH2A 2F3UA 4LRTB 3U9LA 1KAQA 4Y7CA 3PFBA 221PA 3USCS 1PL0A 3WK8A 4OQMA 3DONA 2FDXA 3KKKA 3NT2A 1PEAA 2XA2A 1N9GA 4H08A 2EOAA 1CUDA 4MYUA 1XNHA 1RAFA 1FLDA 2AVNA 1A9XA 4D45A 1XDBA 2ODQA 3B6KA 1J0EA 3GZ4A 4CCYA 1JNYA 1N5JA 4ER7A 2ZYDA 1LUAA 4QT4A 5LIPA 4HUQA 4PAQA 2VTBA 3TL3A 5I4BA 4AJOA 4W9NA 2BR5A 2OM2A 1WDTA 1KJNA 4OFXA 3DDCA 5ELMA 4P83A 1RYDA 1Z2CA 4PVDA 4R01A 2B7CA 2GLXA 4E2YA 1J5EB 1NI4A 3VU0A 4TZ6A 4P4LA 5CFZA 3HUFA 5L4SA 3NO4A 3KV1A 1MX9A 1JS1X 3GFSA 5DNDA 1ENYA 3PUIA 3RKRA 1JIJA 3F3MA 2B8JA 2P65A 4OJKA 5CYGA 4XQ0A 4G5RA 4IIBA 4ENSA 1WXGA 3A36A 1BGWA 5ECWA 1D09A 4GOKA 1IONA 3E22A 1B1AA 2IODA 4JR1A 2BLLA 2REBA 4L16A 4ZI7B 5JYBA 2GI4A 2VYVD 3ANNA 3GWZA 3RAFC 3QLVA 3V1TC 1VJGA 2IEAA 1OILA 2L17A 2HQOA 5EERA 3VVLA 1HETA 4FE7A 4JEMA 4MLZA 2G9VA 4ARZB 1FMJA 3HGTA 2X8AA 1GNRA 4HGZA 2GCOB 3L4EA 4WKGA 4PZAA 1ZI8A 2AE2A 4YMHA 1M7HA 3WKAA 1X3LA 3OBIA 1SKUA 1WP6A 3CCSB 1CD5A 2WYWA 3JQDA 4B8YA 3DR5A 4B3DA 1B8OA 5EPEA 3R3WA 5LXTF 2C9ZA 1D4FA 2NSDA 3J7TA 2H2FA 4PYLA 3QEKA 5HOEA 4N8SA 4RK7A 2C2HA 3DOHA 1PZMA 1Y63A 2APJA 4ZDKA 2HMWA 8ATCA 3C14C 2HO5A 4UFNA 4KE7A 3THYA 2CJYA 4TKVB 4D2IA 2WPNA 5DM0A 1M34A 4XOIA 4MKGA 3OH8A 2ZI3A 3AI3A 1QHYA 5G4LA 2VO1A 2BF4A 1LTHR 5LUAA 1SB8A 1V5IA 4G07A 2I0FA 1VOTA 1Z2NX 4OU4A 4OHRA 4IQ0A 1NU6A 5CM8B 3U7QB 1U1IA 1F14A 2AF4C 4HS9A 5GGYA 2Q6KA 3MS7A 1RRMA 3BGSA 3D6AA 4INOA 1KQNA 2TRSB 4XN3A 1KH1A 3IXLA 3OI7A 1T9KA 3ESCA 3O8LA 3DO5A 1KO8A 5IASA 4XUDA 1AK9A 1FJXA 3WFJA 1L1RA 1MT3A 2G4CA 4QD3A 2Z6VA 3OPNA 2ZGVA 4DUYB 4QT0A 2E4AA 3D3JA 2R96A 1MU0A 3D3EA 4IIJB 5M34A 2WJWA 1Z45A 3N6RA 2AEJA 1BVYF 1RWQA 1WETA 1G20A 3MGCA 3GLIB 3FMOB 4CHGA 1VRCA 4N7BA 4LOLA 4WXEA 5JC8A 3QK7A 2PKYX 2FVYA 2R6FA 3H5AA 4I8XA 1KIAA 1NZFA 5CB8A 5FUMA 1Y0BA 3WAKA 3KTAB 3Q9SA 5CJJA 4E7PA 1TQ6A 1P0PA 1P7YA 1ZC3A 3SQOA 1SQGA 3DF7A 3OBBA 5F9HA 3TJZA 2B69A 2B21A 1V8FA 4WLOA 2QQ5A 5C7OO 1MDBA 3BB4A 4QBIA 5AI8A 3ZW9A 4MGZR 3SC2B 2GK7A 1XTBA 1E8NA 2ERYA 2H7CA 4IS3A 4X1IB 1UAYA 3G79A 1SIBE 3SWWA 2J3IA 3IHWA 4M0CA 2IZ6A 3ZWPA 1JA1A 1DEHA 1X94A 5FWXB 4HIZA 4TMVA 3CZPA 2EG5A 3V8RA 3P9IA 4ZOEA 2J9YB 4LGMA 4AU1A 4RZQA 3ZJYA 4JP5A 4D0RA 3UT0A 3U61B 1PJBA 2IHUA 4YDHB 4LXIA 4J3JA 2XUIA 1PL8A 1ZNQO 1SKBA 3RSHA 3TR0A 3JYOA 4AY4A 4PYOA 1YACA 4Y2HA 5LUBA 5JUWA 3M34A 4A2QA 5TIIA 2C9DA 4LNHA 4EKIA 4I4TF 2VYFA 3LL7A 1XTVA 4MQMA 3S3TA 1R8XA 2VPWA 4O4HA 1DC6A 1DUSA 2QGFA 3CCUB 4G24A 4BCDA 1S4QA 4RCZA 1OXKB 5CYPA 4GQIA 4BVAA 3E0QA 4LF8B 3ADKA 1Y8CA 3CUYA 3WISA 1IEQA 2W6ID 3EEBA 4GI2A 4F12A 1BEEA 1FB5A 1R0XA 2OGSA 2IYOA 3LL4A 1P45A 4RCYA 3TOZA 3X0DA 4CKWA 1MHTA 1MOPA 2O5VA 2H51A 4BU0A 4DCNA 3EODA 4Q4AA 4HN9A 5IC4A 1F0PA 3F4BA 3RU9A 3TG8A 4KQ2A 1TTHA 1L2TA 3I4LA 4H7FA 3UMRA 2BKVA 5JHHB 1JKXA 5U9CA 2H1HA 1CIVA 3L8DA 2PZKA 5TMEA 1S96A 4ITVA 3DKPA 5IDVA 3LUJA 3K1AB 3N8NA 4HRAA 1GPDG 5TPZD 4B33A 3ZGZA 4Q3AA 2GJKA 2FRDC 2HLDA 3VJLA 4YV7A 3TVDA 4LWZA 4BJ5A 4DPMA 1V8DA 3FETA 1HZEA 3GA0A 1UKEA 5BSYA 1AB5A 1GTZA 1VSQA 2WJHA 3K0BA 3NDJA 4L1KA 4UUPA 4ZKEA 1J2UA 1Q95A 3MGAA 1TAGA 3WKEA 5C1OA 2XCSB 5CHEA 5AKYA 1EDOA 4RDKA 1QVVA 1TT5B 2G82A 2JS7A 2A35A 3DL7A 4LV8B 4PLTA 4WLEA 5I8ZA 3ZY6A 2DPYA 2N9UA 2VDOB 3EGCA 5I45A 2XOKA 1QAMA 3L0OA 3QEJA 4YVFA 1JH9A 3IPAA 1NP7A 4D6YA 5F2KA 4H59A 4GWKA 4D8UA 4N5DA 2ACEA 3G02A 5K6AC 1WY7A 2YN2A 3BWMA 1NMXA 5KWEA 4PS0A 4L15A 4N7RA 3OQIB 1X15A 4RY9A 1W4AA 2WK1A 3GGDA 3OOWA 4RHCA 4KPFC 3WYCA 2YRWA 3BWCA 4WY2A 5IWCA 3DUFB 4OHPA 3L0PA 4P33A 2I7TA 2RJ3A 4W1SA 2ZRAA 1YBAA 3BRQA 2I2FA 1FXWA 1AHHA 1G21A 4B7UA 1DCKA 5DTJA 4WBNB 3LJKA 4P34A 3UEOA 1EWQA 3R75A 3E3AA 4MB0A 3BTOA 4Y30A 3M7IA 4K26A 2PX3A 4NMWA 3PUWA 1K6EA 4I4IA 3IUQA 4XB1A 4ENPA 5CH5A 5DBEX 2VOEA 4J1TC 5CVDA 4GSYA 4UAUA 3ANTA 4B6EA 4C21A 2JIOA 4QOSA 4WFQA 4X63A 3HDHA 3Q88A 4UC0A 5DH9A 5DI3B 2FF5A 3VPGA 3WYFA 2J09A 3NKFA 2BDTA 2ATIA 1ISJA 3RHZA 3SIPA 1CQXA 1EMDA 4P4NA 1L4KA 3YASA 4DLTA 1ICIA 4Z4HA 3CLSC 3U44B 8OHMA 3FAKA 4HUJA 3C8DA 4RLSA 3L0CA 2BEUA 2YV2A 2OA0A 3LFTA 1GHTA 1DBIA 4DUPA 2XZPA 4P0TA 2PY6A 3IKVA 3N7UA 2EZ8A 4RPDA 3LUAA 3GJ6A 3AUSA 3S5JA 1SULA 4ETMA 3QYJA 4F1JA 4G65A 4AXXA 5A3JA 7REQA 1E5TA 4XFDA 4GBED 3ZY2A 3QW4B 1N5OX 1OH7A 4L4UA 3KDPA 5AIAA 4UTPA 2F00A 1WPXA 4HNAB 4WZLA 2CT8A 4L8YA 1HSZA 1W5BA 3CM0A 4A10A 1DPFA 4FI3F 3ZV7A 5BNZA 1TK2A 5JCPA 2WNIA 4K9KA 1HE5A 2XMCA 3JQAB 3K73O 3NDBB 4MV8A 2OE2A 2Z2KA 1G41A 1FXSA 3DBRA 4YHBA 1YLOA 1QNLA 3C2QA 3A1DA 4FT4A 4JBIA 4HDSA 2KB0A 4MW1A 4LHYA 3FN4A 2O2IA 5AM4A 3SYMA 1MA3A 2BSXA 3DDNA 2HSDA 3P96A 4HDNA 4LJYA 2OHJA 2I1WA 5LZ8A 3WKBA 3AI1A 1I2BA 2EU8A 4EAQA 1NYRA 3OJEA 1WCIA 2I4LA 3SJUA 1SVNA 1MABB 2HA2A 1YS9A 4KQJA 2OFWA 1V0FA 1BWQA 1L5GB 2TMDA 5EMLA 3K70B 4HDAA 2J5BA 3Q2KA 1RZVA 2O6LA 3ME5A 2VBFA 1JALA 2F8TA 1MNAA 4DRZA 3UF0A 4GWGA 4ARCA 2ZRBA 4HRXA 1WF6A 4MCJA 1ST3A 4PPNA 4RC9A 4JQYA 3A8KA 1QPGA 1YOVA 3P2MA 1NC3A 2QSJA 3NT4A 4Q3DA 2QTCA 3ELBA 3TO5A 2PT7A 1JDBC 2FUG6 2ZR0A 5ALMA 1IHMA 5T4BA 2QQGA 4M1OA 3C6YA 4UFPA 2DKFA 4OV6B 4CEIB 5H9VA 1BXRB 1JG6A 2IHBA 3SDBA 2A1UB 4FFOA 1HGXA 3ECAA 3N0WA 3AHEA 1E1LA 2DWPA 5LM3A 4EYQA 1MXHA 1SMKA 1IG3A 1Z3CA 1PT6A 2P0EA 4QDTA 3MTAA 1Q50A 4JJGA 1LBHA 3SNHA 1B74A 5SZKB 2XLBA 2Q3HA 2F6RA 1ZSVA 4JUCA 1KI7A 2OILA 4EJ2A 4D25A 3CH4B 5TY0A 2Y3IA 2JFYA 1J7JA 2NYAA 4UZUA 4PGFA 3NASA 3KR1A 2ZT7A 3CINA 3CKYA 4CG3A 1T8RA 3FLMA 4F5DA 1MQAA 3N28A 1KI6A 2BI8A 1DAIA 1V9CA 3CT4A 3JX9A 1Y4AE 3A9CA 3AESB 1DSSG 3OIYA 2HSWA 5F73A 3TX6A 1QC5A 1D2NA 1DFHA 1DPGA 1U2PA 1UPXA 1UMDB 3GB9A 1Z28A 4Y2UA 5DCLA 3N0VA 1CJSA 7GPBA 2XTNA 1PJ2A 4JBWA 3FTDA 4INJA 4W7IA 1SM4A 4D5GA 5BR1A 2GJPA 5FDFA 3LSYA 2WLTA 2FI1A 3B3QA 4L0MA 1S4MA 3RIYA 4EHJA 2G7ZA 2R2AA 5EGNA 1N07A 3FYDA 3TOCA 1A5TA 1I6LA 2QVXX 4IINA 4PG7A 5E95A 5IAEA 1MQ8B 1IUKA 4RSHA 1ITZA 3IDOA 3NWEA 2CHUA 2V03A 1PJ6A 2LIVA 4YFYA 1R6XA 2MOKA 1TO6A 3GH1A 2D0IA 1PFYA 4HNGA 3KB6A 3UK1A 1AOXA 4KAXA 1VBNA 1PJAA 2AUMA 3HUEA 2I78A 1P0QA 4IHJA 4DZZA 1JSXA 1U7WA 1UEXC 3FUUA 3G2KA 4NZOA 4WZ6A 3B6IA 3RVQA 4AVZA 3L4SO 5F4ZA 1MC8A 1WDWB 5FBVB 2CLMB 2BBOA 1E7RA 5FYDA 2XVMA 3OOJA 4ZGQB 4Q1FA 1TM7E 2FZCA 1GNSA 1GKLA 1OUMA 1L9KA 4G5GA 1PGNA 2F8MA 4JA0A 4XQEA 2ECFA 3BY1A 1O03A 2XCRB 1XTIA 4ZDWA 5K2OA 1YJAA 4BN5A 5AVQA 4ZYLA 3CUTA 5BVGA 1SHUX 4UBLA 2YJ5A 1IVNA 3F6YA 5KYUB 1B2RA 3PNBA 4RXUA 6CHYA 2W8BB 3P4YA 3UWKA 3B38A 4QRHA 2QQ0A 5TS3A 1B42A 2ZZFA 2VJLA 5HZAA 1DU4A 3B70A 4HDKA 1C4WA 2XRFA 3QFSA 3BWDD 1AGYA 3RHTA 4IY1A 1ORRA 4MW9A 1C30A 1XZLA 2HOQA 3QUSA 4KI0A 1AGPA 5CIWA 1HDOA 1LS1A 3ADPA 3Q7EA 5IKOA 5KYGA 1E7QA 1X8LA 4A8PA 2QXYA 4DDKA 1Z8FA 5M7EA 3RFXA 4EM6A 3RYTC 3SVZA 1HFJA 1Y5RA 3JD3A 3AFGA 2W0MA 3B5EA 5JO9A 5J47A 3BK1A 1F5SA 3EVZA 4H3SA 1QYVA 3TOSA 2MSCB 4QVJA 2GEFA 3RGWS 3FROA 1DO2A 1XTSA 2IYYA 1JHZA 1EP3B 4IVNA 1G1MA 2M98A 2O2GA 5AKEA 1JAYA 4HSEA 1A88A 3JPWA 1WHSB 4DIDA 4DTIA 6ABPA 4B6JA 3G4SB 5JATA 4KQGA 3HFSA 4WK0B 3UXEA 4JYBA 1K8QA 1NW9B 4Q34A 2O19A 3E35A 4C4SA 2JBAA 4U7TB 2R7NA 1ORWA 1B8NA 4CM8B 5DMHA 4JMPA 3ELUA 4E14A 3PEEA 1LS6A 1PJ4A 2C83A 1PW7A 1MF7A 3H2YA 4ZEOA 3ZJ4A 1RKBA 3Q7TA 4CU5A 4DV3B 1G16A 3QFTA 1DMSA 1GA4A 4I1OA 3RFUA 1VKZA 3D4LA 4BZZA 2IYUA 2VPYA 2ZR8A 1UBHS 2P9QA 5HF9A 4HTFB 3W5JA 1JUDA 2P4HX 4BNFA 1FP4B 1G19A 2GWRA 4NG4A 1PTJC 4F97A 4AJHA 5A5DA 3LI2A 3MZ0A 4HGYA 1I4TD 1HEIA 4QC2A 5HCNA 3D81A 4ZT7A 3T38A 3T9DA 3NGXA 5CEFA 2TMKA 3SBDA 2ZSBA 5K8IA 5K8TA 3VTAA 3RJ5A 3GVPA 3MG9A 2V0GA 3DAPA 2PZJA 3W3ZB 2KI5A 1Q17A 3L0IB 4X41A 5A3QA 4BRZA 4C0AC 4E3ZA 2FSHA 5IBPA 3E9CA 1ZM7A 3C6KA 1F4PA 3FPSA 2V7QD 5EYPB 4NHEA 1EBBA 3NHPA 4A1FA 4LRXA 1QJCA 5T6MA 1TVMA 4B7ZA 4YUVA 4DV6B 4KPYA 4W82A 1U8CB 1MJNA 4GHWA 4MAAA 2CFCA 3RS4A 1LBQA 2QPOA 4HL6A 2W2LA 4BECA 3K9WA 3G0CA 4ZDIA 1WEHA 5L7YA 4R1MA 4ZRDA 3GZNA 1GNLA 2IS6A 4R54A 2QRHA 1ES9A 2ZATA 2LE0A 3RLFA 2MMCA 1CLEA 3Q0EA 4ZOAA 1G0NA 4DLWA 3QX9A 2I62A 1OFHA 2AEEA 3K9CA 1EUDB 1JIXA 3VOBA 2G76A 3SFZA 1XO1A 5F23A 3U7RA 4WTOA 3TSZA 4J2TA 3I1FA 4XM2A 2H07A 1KDPA 1AQ6A 3A8TA 4F3YA 4Z4TA 3CF2A 3JR7A 1Q83A 2Q0SA 3RUCA 4CIWA 1E3QA 5ESWA 1ZEJA 3G68A 1H8HD 3IKJA 3LHSA 3Q41A 4A8JB 2GXAA 1XVLA 3ZCRA 5JZMA 1N8RD 3SY8A 4DV5B 2Q1SA 1E63A 2VHJA 3RTDA 2Y8EA 3B1KA 3KB8A 4C4TA 5A7FA 1BQEA 4ASUA 1WSRA 1H1LB 4W5QA 3HXQA 1JEDA 3ED5A 1BVHA 2BRUC 4LRYA 1YAHA 3AX6A 3DLTA 3UKJA 2IXGA 1DO8A 5AVZA 1GQRA 5LYJA 4DCOA 4HCJA 4OOFA 2IE8A 1XRJA 1FDRA 4B44A 4FIDA 1RQGA 1E3WB 1MRNA 3IAUA 3PPIA 1E59A 1ENZA 1W581 4LJ7A 2P11A 3UJAA 5JSQA 3K6SA 3CHYA 3ZDBA 3P2IA 2G9ZA 2PSJA 2WAMA 3TI7A 3AZQA 4RE6A 3CRW1 3TSWA 3GA5A 4L75A 2IV2X 1U8UA 1M8KA 2K87A 3Q0IA 4YXWA 2HQRA 3MAAC 4X1IA 5IKXA 1UDCA 4YJ2F 4OK6A 3BQ9A 2HD4A 3W8EA 1X9HA 4K9LA 4UOZA 1GRRA 4IGKA 1BN6A 2FVXA 5SZJA 2GXUA 1JVSA 2QJRA 1X7WB 2WT8A 3C97A 1L5VA 3IXMA 4G36A 1ECGA 2R87A 2QLMA 4JXKA 4NYIR 3LDUA 1IHYA 1QH8A 4N47A 4TQAA 1RLIA 5U4QA 4LEIA 3R7DA 1JU4A 1I4WA 4OP1A 3NMUF 1M0SA 2CXTA 5EJFA 4KDFA 1RWVA 3R0VA 4DHEA 2LZJA 3CKLA 1VRWA 2CUKA 4LZOA 4UUQA 3S1AB 3LT2A 4YCBA 1VA5A 4YMGA 2B8TA 4NS4A 5AKGA 5HTKA 1YK1A 2AMVA 3HWRA 1MTZA 1X1RA 3G2IA 1Y6RA 3QPDA 4B4UA 4MA4A 4YHHB 3BRWA 3FNEA 1W4BA 2EJVA 1YDMA 4NICA 3A28A 2FZ5A 2OBRA 4YGYA 3FVQA 5KVSA 5EIXA 4XIYA 2WSSD 4QDUA 2IY7A 1XRPA 2QAGA 3L4BC 1TECE 4JCOA 3ZX5A 4S1WA 4OIFA 3NTUA 3RYCB 5KIAA 4BFYA 4R9UC 2BYTA 1XJQA 3D8HA 1LVHA 4TWJA 1O7JA 2Q5HA 4YP7A 4BNZA 4CV2A 4D9NA 4MITA 1XMOB 1S3FA 2Q5IA 3JVUA 3A05A 3FLAA 4WNAA 1RYBA 4BBPA 5CITA 3PX2A 4AMVA 1Q1EA 4UU1A 1NBMA 2X0KA 1TUEA 3SHTA 3L1UA 2PAFA 4FYVA 1KOGA 4X65B 4WY5A 4UREA 3NUGA 2QD1A 2G36A 4M8SA 2WDZA 4CIVA 5BSTA 4WASA 2OBNA 2ZSDA 2FSVA 3O7WA 3PTZA 5AW6A 3SXUB 2Y0DA 1MTOA 4QG7A 3N3AC 2OBBA 1EUCA 1NX9A 4KSCA 3KB2A 5DN9A 1TT5A 1YIOA 3AINA 2FJPA 2WU3A 1DWPA 3GJQA 3PCTA 4HO1X 3W2GA 1A96A 1O95D 3NEJA 4X3CA 4UBIA 3MD0A 2J9GA 4Z9AA 3MMZA 3LT5A 4ZICA 1OX5A 3AJDA 2A5JA 3DWGA 2ZVDA 3LU1A 4JKOA 3FKJA 4MO2A 4OKIA 4UHJA 4FSXA 1ZN8A 2VQ3A 3PQFA 4YASA 1AG9A 2VH1A 2CNBA 1DHRA 4XJXA 4AUEA 2WU0A 1NMSA 1CUJA 1F3OA 2FEKA 3EJWA 4COOA 2XDWA 1H66A 2RGXA 2YS6A 3HR4A 3OQIA 2OXTA 2GHQA 1PDOA 2W6ZA 3LKZA 5CJ2A 1IRIA 1SC1A 1UT6A 5DBHX 4RMHA 5EFZA 3SZOA 1FMLA 2Q3JA 3A6EA 3DUFA 2L42A 2P78A 2YQ5A 1N8KA 2V7GA 2VHTA 4JJKA 1L1QA 3CRMA 1WXFA 2W6CX 1XCMA 4XLHA 3I1IA 1P1CA 2Y1EA 1KU6A 3T3OA 1L4LA 2AK2A 2MYTA 4EZEA 4WBNA 1LNSA 1NLUA 2EKQA 5FTJA 4O2AF 5AM2A 1YJBA 3INYA 3RS9A 4G5HA 3K0HA 2W4MA 4PZ0A 2G25A 1XAIA 4UNRA 5DCWA 1ZNXA 3ZTWA 1IVSA 4PFSA 4I08A 3C41J 4XI9A 3T34A 3H94A 1REQB 3DTNA 3SLNA 3DVSX 3MWFA 3RS3A 5DI3A 1UXJA 2H1VA 5FEMA 4BE4A 4C7MA 2GBCA 5JXIA 1ZICA 3H4VA 4JEHA 1E2DA 3ASUA 3MJRA 1N2HA 1IYZA 1Z0KA 1CKEA 1ZC4A 3HXMA 2ZIVB 2AZXA 1YI0A 5TDHA 3DXFA 2AH5A 1PNVA 1QZZA 2RI6A 3L9XA 4J91A 4RM3A 2Q7OE 1H2HA 1FTNA 3BFPA 3H3JA 3E7WA 3ROEA 5J4KA 2X0NA 2EBWA 3DM9B 4FMPA 1V8BA 5KX5F 4RWZA 2OAEA 4LZAA 3X3HA 2CFSA 3LRPA 3E20A 4WXYB 5FHQA 3CN9A 4ND2A 4KE9A 2H31A 2JGDA 3CEAA 4V0OA 1WTAA 4JC0A 4ZCQA 2KJQA 3UTDA 1QOQB 4DA8A 1JMVA 3DSRA 2Q2VA 2FLWA 4FGZA 3OURA 4BMPB 1A69A 1J8DA 1VJDA 1Y6QA 1NXWA 1JAIA 3ISJA 1KYTA 3QWAA 4UXIA 3WK7A 5IVPA 5JWHA 1XMXA 2MSEB 3DVQX 3M5PA 3LZDA 4XWGA 3UYKA 4E51A 5HMLA 3IO5A 3RC2A 3MC1A 3CZ9A 1GXSB 3JWPA 3O3OB 1Y3AA 3FGPA 5J3JA 4X93A 3QWFA 3MMPA 1H1DA 4MR8B 2QTWB 2PGDA 3TM5A 2GPAA 1GPLA 2EAUA 3K0CC 4G25A 3EXEA 4MQLA 4M36A 4CBVA 1JBKA 2PXHA 1Z4LA 2XTAA 1JIQA 1MABA 1PRYA 1RE0A 1UZNA 2RI1A 3PPVA 4CKYA 1EH5A 1FP1D 3CONA 3GEPA 1NU8A 4PBSA 5JDIA 5IJ9A 3AWIA 2ZUFA 5CBPB 1PZGA 1CUUA 1O6CA 5HPYB 4EEZA 1CZRA 2MDTA 2P1RA 1VQ4B 5CFPA 4P92A 5JFOA 1AQLA 3S6JA 1NNEA 2JZCA 4NY1A 4UJ3A 1LA2A 2GHIA 4BO6A 2G6BA 2NV6A 4R1LA 5CVTA 3SEJA 3D6NB 3EA5A 4GX0A 4LSWA 2HK8A 3FKSD 4F11A 3TQFA 4C04A 3OPMA 4J0HA 4CEIA 2POCA 1E3LA 2XMBA 4J3FA 1BXRA 4RTOA 2GAIA 3KEMA 4IIFA 4AO6A 1L7EA 4F4FA 1V16A 2BHLA 3IR7A 4TKLA 1VP9A 4OHCA 1EE2A 1FVOA 2DQYA 3H5VA 5BNTA 1DLJA 4O4IB 3VUFA 4B2LA 5GINE 4MRNA 1ADGA 1P0CA 4XA8A 3VDNB 1UK6A 1DGQA 2B82A 2ALJA 2XUQA 2BFDB 1K08A 4J03A 3TJMA 4L3WA 2P3QA 1TTTA 1OVMA 1MEJA 1LSJA 2IELA 2Y1GA 1MC1A 4QHTA 4JB8A 5L7WA 3A6PC 3FWZA 5ARCA 4KKXB 3SEZA 1FU8A 1XJ0A 1Q14A 2HSZA 2DCMA 4JKIA 1FOEB 1N4DA 5FH9A 2MR6A 1KYVA 2ZJFA 4POOA 1JDNA 5CK5A 3SU8A 5IFLA 5C18A 5JXGA 3A10A 4KNYA 1O97D 3AESA 2ZG6A 4JX9A 4QBTA 3RLIA 3AL0C 3TRHA 2V6IA 3K0AB 4HKTA 1NG9A 4IKEA 3LO8A 1VHTA 1UMDA 2QE7A 2EBFX 3RSSA 1GYRA 4JJZA 3IBCA 1PJSA 3NRCA 4KMMA 4A8TA 2D3NA 3GRUA 5FOUA 2QUBA 2ZL7A 3WBJA 2XE7A 4YB8A 1XVAA 1NZJA 1ZRSA 4O0MA 1SWWA 1AD2A 2WT4A 3MPUA 4DABA 2BGIA 1P73A 2X5NA 4PANA 3OZSA 4Y8VA 3TTXA 5DGTA 4P0PB 2YV4A 2YFYA 2V5VA 1EBFA 2J3KA 3DZKA 3PA8A 5DCUA 4QYIB 2ZYTX 3EAGA 3OQPA 1I0IA 5AO9A 1BW9B 3EOAI 3V42A 1OB0A 4E0FA 1Q86D 1S3GA 4MGYR 5EMMA 1BTOA 4NZMA 3M8KA 3R5SA 1T35A 3UQZA 1HOTA 4B3XA 1NUUA 2JCBA 3Q10A 2QUHA 4UQOA 5DM60 3W90A 4ZYXA 3IQDB 3FIJA 1U11A 1U28A 1QPBA 2P9FA 5BSMA 4B9AA 4YLYA 1K4MA 1YDGA 3W2HA 2VI5A 3GLRA 1Y6JA 1TQ8A 3R6GA 3D4BA 3T54A 2ATXA 2PJUA 4W6QA 4Q7KA 3Q8WA 4M1SA 3UGQA 3PWZA 5AXCA 2ZVJA 2HBRA 3WLPA 4M99A 3BIOA 2A8YA 3EFBA 5DOZA 5IM4F 1K2VN 3T8YA 1YONA 3O03A 4N82A 3U4CA 3IPXA 2J9FB 5E6SA 4P54A 4TQGA 1CVIA 2XMPA 2FX5A 1KI1A 1XYYA 2O23A 1K2WA 1IWBB 4J7UA 3BL5A 3WYAA 1JXMA 1X7YA 1WIWA 3G0DA 3VH1A 4EWLA 4LX0A 1W73A 4QUHA 5J2UB 3OE4A 1JZQA 3BQNB 2ENUA 4X44A 1JDTA 2ZWVA 4DXAA 5L9AA 1S7GA 4TV9F 2JAHA 3T6KA 3CRVA 3PC7A 4KXLA 4EMBA 3F67A 1A8SA 4ZCTA 2GM4A 4W5HA 4NBKA 4KQEA 1AQNA 1UP7A 1N3IA 4ZU1X 2IHVA 4MIYA 2XNSA 3SC6A 4RW0A 5HWSA 2LCFA 2PFKA 4HYTA 1ETUA 4PHFA 4UCXA 1RPZA 3ASYA 5I4CA 2XZOA 5E4FA 1YUMA 1QKKA 3EZ6A 2Q28A 5EWLB 3IRUA 4QAQA 1GLNA 4ZGNB