1FRNA

The involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYVIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Involvement of serine 96 in the catalytic mechanism of ferredoxin-NADP+ reductase: structure--function relationship as studied by site-directed mutagenesis and X-ray crystallography.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase (nadp+(a),ferredoxin(a))
total genus 96
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frnA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frnA02
5HXBA 1G7CA 1Q7YD 3OJWA 4RD2A 1OB5A 3CMEB 1ZM9A 1KQSB 4K1XA 1QUEA 1KK3A 4ACBA 1JA1A 2VNKA 4LBYA 1JNYA 4BPRA 3OZWA 4G5GA 1Q81D 3QSYA 1JA0A 1FNCA 2BF4A 1J9ZA 1VQLB 1DG1G 4RD3A 3WBJA 3VO2A 2BVNA 4B3XA 4ZCMA 1R5OA 2YWGA 3P27A 5KSWB 2OTJB 3LYUA 2VYQA 2BSAA 4P3YA 1EP2B 3WY9A 1XB2A 1QX4A 1AMOA 3CD6B 1BJKA 3B8HA 4LBVA 4PC1A 1DDIA 3FJOA 4MYUA 1CNFA 3I55B 4M2LA 1QVGB 1E62A 5GV8A 3CCVB 5GV7A 4FWTA 4C43A 3SJZA 1ELOA 2QN6A 3OZUA 2PLFA 1VQ8B 4J0QA 3QFSA 3ZC3A 2DCUA 1Q86D 4B44A 1WDTA 2B7CA 2RC6A 1FNDA 1K8AD 1B23P 2VNJA 3CCQB 2CRVA 5AN9A 1KD1D 4ZCIA 3AVXA 1YITB 4TN1A 3ZZ0A 2OK7A 3G6EB 3MHPA 1VQNB 1EFUA 3CCJB 1KJZA 3ZBTA 4TMVA 1K9MD 3E1YE 3OZVA 2QTZA 3CCLB 4RD1A 1QFJA 3AVVA 2XEXA 3MMPA 1GAWA 4FN5A 1G7RA 1KK2A 1I7PA 3LRXA 3OJXA 1VQPB 2BPOA 1D1NA 2VZLA 4F7DA 4PC2A 1FNBA 3LO8A 1AIPA 4ZV4A 1VQ7B 3U6BA 1S72B 1HA3A 4UAJA 2QDXA 5TY0A 4R71A 4Y9UA 1B2RA 1E63A 4LC0A 3ZZUA 4Q7JB 1U2RA 4AF6A 1GR1A 1QUFA 2AHOA 3P26A 1QGZA 2YWHA 2DY1A 1ZM4A 4ZCLA 4YHBA 3A1FA 4TMWA 1ZUNB 4RCYA 4TMXA 1BX0A 2HDNB 1DARA 3ZZTA 3E20A 1XE1A 5JBQA 1SKQA 1YIJB 3I1FA 4PC6A 1UMKA 3G71B 1GAQA 3CCSB 1SM4A 2EFGA 5H59A 1W2BB 3W2EA 4YAUA 4DQKA 2YWFA 3FPKA 1EP1B 3WBKA 3B78A 4LBWA 3W2GA 3JQPA 5H5JA 1KTVA 1YI2B 1VQMB 1ZM3A 4PC3A 4N3NA 1K73D 3I56B 1QGYA 1D8TA 1TVCA 1ZM2A 1IJFA 1KRHA 1A8PA 3W5VA 3W5UA 1E64A 3AVTA 4RD4A 3J81k 4ACAA 4B47A 3VMFA 2NPFA 2J7KA 2XNCA 5FA6A 3ZBUA 1VQOB 2QEXB 1CQXA 3AVUA 2EIXA 1EXMA 2QMUA 4TMTA 1TLLA 2ZITA 3CC7B 2RC5A 2CNDA 4B43A 2R6HA 2BMWA 4QFMA 4M1KA 1OGJA 1YJ9B 3W2FA 2B5OA 4YAFA 1EFCA 4WQMA 3CRZA 1KC8D 3CCEB 4YAOA 2E1RA 2FX3A 3OW2B 1EFTA 1OB2A 3CC4B 3WNBA 4H9GA 3U2QA 2VNHA 4M0LA 3LVBA 4RJLA 1H42A 1QGAA 2X3UA 4YAWA 2XNJA 4EH1A 1G7SA 1FRQA 3W5HA 2BV3A 4M4SA 3WXMA 1S0UA 1M1KD 2B7BA 1VQ9B 4TMZA 3JQQA 5THXA 3CC2B 4ZGQB 4LBZA 1DDGA 4RCZA 3VNVA 3CXCB 1YJWB 1GO2A 5DSZA 4Y7CA 3QFTA 1Q82D 1M90D 1H85A 2YWEA 4IW3B 3ES9A 1VQ6B 4MYTA 3V76A 4DQLA 5TR9A 1NJID 4C0SA 1QFZA 3CCUB 1F20A 1R5NA 4ZGNB 3B82A 1KK1A 1CNEA 3W2IA 4HE5A 1TTTA 1D2EA 2C78A 4B48A 2PMDA 3VNUA 4N3GA 2OTLB 1BQEA 3QE2A 1F60A 1QFYA 3CPWB 2BGJA 4B4DA 1NDHA 1W87A 3CCMB 3VO1A 2D74A 2HMAA 4YALA 1VQKB 1IB0A 4RD0A 2DEUA 3G4SB 2DETA 1W34A 2HCJB 1QG0A 4HE6A 1W35A 1QVFB 3MCAA 3WYAA 4QHYA 1FNMA 4G1BA 1OGIA 1VQ5B 1QH0A 3W2HA 3PENA 4FK8A 1R5BA 3CW2A 2VNIA 1IJEA 1YHQB 1EWYA 1VQ4B 3AVYA 4U9UA 2GQFA 3AGPA 4RD6A 2OK8A 2BM1A 2QA4B 1JJ2B 4AC9A 4NCNA 1JB9A 1G7TA 4M53A 2C77A 1FRNA 3WNDA 5TV2A 4P6VF 3WNCA 3AVWA 1N0UA 2QTLA 4NBSA 1TUIA 1KK0A 3CB4A 4Y9RA 4PC7A 3AGQA 3JQRA 2BN4A 4AF7A 3U6KA 1GJRA 1N0VC 2PIAA 3CMAB 3QFCA 1BX1A 1FDRA 1N8RD 1YJNB 4PGOA 2GPJA 2DERA 1EP3B 1GVHA 2BM0A 3QFRA 3CCRB 2BGIA 4G1VA 5EMNA
chains in the Genus database with same CATH superfamily
1PTKA 3B2EA 1ZCJA 2QAJA 3O1LA 3RRYA 2CMKA 4CF4A 4C0BA 4GLOA 4RLQA 4UHKA 1YDEA 4DJJA 3ILHA 4O02B 3O4JA 1I7QB 1V35A 1CJVC 3IMCA 4P86A 5K0BA 4BVFA 4EJSB 2OYNA 1M2HA 1DCKA 1V5VA 1EWVA 4JIMA 4D99A 1R0KA 5AW0A 4CT5A 1SXJB 3PR3A 4M8KA 1KJJA 3QMMA 1T9BA 3AZOA 3BXFA 1E69A 4EKIA 5IJ9B 3CH4B 1NYRA 1D2GA 3R6LA 1B74A 1RT9A 3FH0A 2P9TA 3IKJA 4QULA 3QMVA 1IOLA 1PE0A 2CNWD 1Q1NA 1EDZA 4IVNA 4Q37A 4R2IA 2J31A 5B53A 3SR0A 5EZ5A 4QGSA 1WORA 3LF2A 4FFMA 2GARA 5CM9C 2IPAB 1JLRA 2EF0A 2R4TA 4GXRA 5K3CA 1GEGA 1GU7A 4H35A 4IHJA 5A3QA 2OD9A 1JKJB 2AX3A 3EGXB 2B0CA 4RK0A 5D6NA 2HMWA 2QTVA 3KEWA 1YFKA 3P0RA 4FNGA 3DAYA 1U6JA 3PA6A 4ZREA 3GGSA 4GH5A 2ZREA 5AD1A 5CB6A 2Z8ZA 1AQ6A 3T0FA 4G84A 5EMMA 4UM9B 1MEJA 3I42A 2F1HA 4LWPA 3MTIA 4GQNA 2OFXA 1LLDA 5IP5A 4FFNA 5T8KC 2XCRB 2BEWA 2C82A 4MRNA 1C9YA 4DPKA 4ESVA 3PC8A 3GN1A 1QG4A 3HYTA 4CDRA 2BTEA 1L5YA 1OYVA 3E9RA 2NT4A 1G8FA 5HUQA 3CCBA 2NO7A 2CZCA 1XDWA 5CLHA 1AQYA 1EXDA 3N8KA 3GFGA 1BO6A 2FLVA 1LNQA 1KKUA 3ZDYB 4YACA 4O4LB 4ND7A 3OPYA 1JYSA 3ONDA 2C07A 5EWLB 3OZUA 1KF0A 1NBHA 5ITZA 2AKEA 1IU9A 2OB1A 3B6EA 3ST7A 2MSEB 3V80A 3VJMA 2JD1A 4QM6A 2VUHB 1YHNA 2AXQA 1LDBA 1FDOA 3EARA 4HQ6A 2DCUA 1NNUA 1YTLA 1ZYUA 2RMKA 3WRXC 4RA6A 1H1LB 1Q86D 1SHJA 5JNWA 2W6QA 1J09A 5F52A 1UFKA 3HNOA 4F21A 1F17A 1PFVA 1YBVA 1Z35A 3X1DA 5JJCA 1ADCA 1XZDA 5TRTA 4BNFA 3UJ8A 4N49A 4AZ0B 5HCIA 5L45A 3FVWA 1EIZA 3G5AA 4Y67A 1VE3A 5CM8B 1XTTA 2JD0A 3ZZ0A 1C7JA 1GKLA 1N7JA 3OHSX 3MHPA 2AI2A 4N39A 3IIMA 3NHWA 1YZQA 2C2GA 1NZDA 3IVCA 3MGCA 3M6WA 3AFOA 1USWA 2WTBA 2GYUA 4H3HB 4JDUA 2F55A 4W1SA 1K06A 3ET4A 3RK4A 1U2EA 4TSRA 1BEZA 1UBTS 3UCFA 3EXFA 4AUKA 4KOAA 2QWXA 5F23A 4R1TA 1U80A 1R8SA 1URPA 3HZHA 1UFVA 3RBAA 1HT3A 4HX2A 3EZGA 1SU7A 4RY0A 4GSKA 1U1FA 1L4FA 1L8LA 2B35A 3IAUA 3O26A 4EVRA 1QHNA 4BGDA 3U4QB 5K5EA 4WDQA 3H9GA 3Q6MA 3DNPA 4BO4A 3VJKA 1Z5ZA 3G8DA 1U7ZA 2OZPA 2WIAA 3EXG2 3FCOA 4X7BA 3ZQ4A 4D3DA 2IRWA 2CCJA 5FQNA 4DLXA 1GTZA 2DHQA 3I1YA 3ND8A 4JOQA 2I33A 4DLWA 4EVSA 2FEOA 2CNOA 4X5OA 1MZPA 3SHFA 1X14A 4LOIA 4NULA 3LD9A 2WF9A 1J21A 3T4UA 3NTOA 2IOFK 2WF8A 5F76A 2WM3A 4FCCA 3KL4A 2C2MA 5ALZA 5KYWA 2QDXA 3LC7O 1X8LA 3AUSA 4HG2A 4Y9UA 1OBFO 1V4VA 2VI5A 4QIHA 1X39A 4MRMA 1MAUA 1IPFA 5G41A 4Q9DA 1GNQA 4XCVA 4GMXA 4PG5A 2QIOA 3O0TA 4ZVQA 1N05A 2ZVPX 1QYIA 2FU5C 3PSAA 2LP4Y 1QZZA 4JWTA 3RSZA 5AM2A 4MQFA 2XYVA 2G1JA 3BWBA 2QRMA 1DKPA 2D6FA 3L8FA 2NADA 3HFJA 2HIHA 1ULSA 3I9LA 3M70A 4RANA 4U6QA 4YECA 5HYVA 2WMOB 3UHJA 5T7BA 2NUTA 1NW8A 1MA3A 1WETA 4Q5IA 4WSOA 4YHBA 4A3SA 4AURA 1M2EA 4KQ9A 1Z7WA 2XYRA 4A0RA 4GNRA 3O74A 3SQNA 3SYLA 4ARBA 3HKDB 4NESA 1XVUA 3K70C 2AOVA 2ZRMA 3F8TA 4KQJA 2VVTA 1FX0A 4XR6A 4IHJB 5EIXA 5CDYA 4XTCS 4P7KA 3FCXA 1JSCA 1VZ2A 4PLVA 2QTVB 5JPIA 1ZC4A 3TECE 2F1LA 5LIRA 4AN1A 1HLPA 1TJ5A 3U3JA 3USES 4YP5A 3DKIA 3K2QA 4FMPA 1L8OA 1C7QA 3G71B 3WGJA 3QUAA 4P8RA 1T2NA 4Y8VA 2ZIUB 4HKTA 4PXAA 2R66A 1W5FA 2BEWB 1Q0QA 3HCFA 4PG6A 4MWGA 2BFNA 1VL0A 1W0KD 1ZMOA 5H59A 5DXAA 2DUWA 2P77A 2PWZA 4AL4A 7GPBA 3DBHB 1C9KA 4IILA 4AJ2A 2FE1A 3N53A 2EWVA 3EULA 4AQDA 1LF0A 3ESRA 1J0BA 4BP1A 4K2AA 2GDZA 3C6BA 3QXCA 4KI0A 2IYLD 1QIKA 4N82A 3PRKE 4XWYA 1QF6A 2CXRA 3Q10A 4G56A 2ZGVA 2FGJA 1T4BA 3ND6A 1W4BA 3GJ4A 5H5JA 3L4EA 1NR5A 3C6MA 2FGKA 2OV6A 3OZEA 4LYDA 2SKDA 4PYRA 1RLIA 1UFRA 3GQBA 4YQFA 5ITZB 1YI2B 2GEVA 2EEZA 2JEOA 2OILA 2Y1LA 3ISJA 5EQJB 3TXYA 2YXDA 1QO0D 4ZZ0A 1KGSA 1FRFS 4RA6B 1VHQA 3Q1LA 4X6UA 3AXSA 4R0MA 2I7TA 2H07A 5CT4A 5JAIA 2PUBA 3RIXA 3QTBA 2E4YA 4MWOA 4BNJA 3PVZA 2ZT6A 1HYQA 3RJ5A 5BSGA 4OB6A 1IN8A 3MJTA 1H2BA 5FLKA 4QJ3A 4UFPA 2IZZA 3V8VA 5B12A 1QG2A 2JJ8A 1T34A 2BMVA 3J81k 3HUEA 2IY9A 1JLKA 3VMFA 1IVYA 2HHJA 4CTMA 2IE0A 2ZJ5A 1W1WA 3DZBA 3PPVA 3K72B 1U0FA 1PF7E 1F06A 1KJ9A 3A6JA 4TV9F 2QS9A 4E51A 2W6JA 1MX5A 1PWXA 3BILA 5EEGA 4DA7A 2H5LA 1UD4A 1ZUIA 5DXJA 4A6DA 5BT8A 3CWZA 5IAEA 2ZAIA 5DMXA 4JQYA 3QFFA 3EXFB 4L76A 4AY3A 1HNWB 2H52A 4E3ZA 3W06A 1PJTA 1OIVA 3UV6A 5TJHA 2O59A 5TX7A 3RBXA 2R6HA 1L7EA 1ZI8A 5J43A 3PEYA 3DLCA 3BG5A 3F3YA 3SC6A 3T1QA 4EHKA 4TWZA 2HMTA 4RTNA 2XMRA 4RHYA 2PD6A 5IAKA 1DZ3A 1SVLA 3QW2A 1HKHA 4PSDA 4IDBA 5FUVA 3PKIA 3F67A 3U1BA 1U3TA 3MGAA 1XZAA 5TB5A 2Q1XA 1CT9A 1ODKA 1WUKS 4JOBA 1V95A 3RRNA 3FG9A 1QK3A 2W83A 3PE3A 4B09A 3G23A 5F5NA 1ACJA 2J3IA 4GM1A 4HUJA 2JIZD 3DXZA 2XXJA 2VHWA 1XTQA 1CR6A 4NTZA 5KYWB 1T1GA 1E9FA 2GREA 4HZGA 1ZPDA 2DULA 3PZBA 1XMIA 4PPGA 2ONZA 4KKSA 1J0EA 4HS4A 3B5IA 4Y0AA 1H6CA 3O8LA 3MTAA 5JV5A 3WNBA 2YY6A 3PNLA 4M0LA 3QVXA 1WY5A 4DR1B 2KLHA 2PX4A 1R8YA 1FB5A 4M6WA 4PRKA 3RI3A 4Z3KA 1P45A 2JVKA 3G0GA 2J0EA 1RXVA 4BOYA 1NURA 4K3VA 4MQFB 4RKQA 4YC7A 1G7SA 5ALXA 3LY8A 1OWPA 2WWXA 1GQ2A 2O1XA 4H3SA 3ADCA 2Q5OA 3V3TA 2F64A 2NUTB 4DJAA 4NYJQ 1UD8A 1F48A 2QX4A 3BYZA 3ESZA 4YAEA 3ZE8A 1NJ2A 1KEKA 4Q82A 1K89A 3AEXA 4PZPA 4I4LA 4DK0A 4X7PA 5AKEA 2YN0A 1RKVA 1IY9A 1I7DA 3MGBA 4XOTA 4N1AA 2ZQYA 4N5MA 1FX0B 1P39A 1QHSA 2C95A 1UJNA 4YH1A 2M6SA 4GBGA 5DNDA 4KR6A 3GA7A 2WG2A 4QNNA 4RVDA 5K8VA 4B3JA 4LJKA 3SX2A 4DY4A 1VJ5A 1MO6A 1SBQA 2YC2C 2QIPA 1XDDA 1N3LA 3SC2B 3REFA 4YLEA 3VBEA 4DZRA 5DYIA 2D54A 4HRXA 4MQ4A 3B2QA 3BHNA 4RAQA 4C0KA 1WP9A 4EF4A 3VDXA 4JBGA 3P9QA 1U2GC 4R0VA 1CEQA 1SQ0A 4MEJA 5F3WB 3E0QA 3L8EA 4CGZA 1L7MA 4U5QA 3DULA 1LPAB 3ZGNA 4C6TB 5TIIA 1EVIA 3I9V6 5FEUA 5ICSA 3NHRA 1YDHA 3N8GA 3KNZA 4G81A 2XOEA 3IUPA 3GMIA 3IR7A 3FNIA 4TSFD 4JYAB 3CH5A 4KX5A 1C3EA 1CB0A 2CL5A 1YR8A 1IIRA 1Q19A 1QIDA 2LE0A 1BCSA 3BS4A 3AR6A 3WZMA 3CX8A 1B2LA 2F1JA 1VJRA 5BSRA 4LCEA 1LLCA 1VJ0A 3HGMA 2JF0A 4BMDA 1GNRA 5JD3A 1CX9B 1IJKA 2X86A 4WEOA 2DFTA 3IAAA 4KFSA 1M0TA 2DSTA 1QAQA 4ZQFA 2EL9A 3I0MA 3PXBA 3A2KA 2IQ5A 3L5KA 3QLJA 2FCRA 2X5NA 2A1UA 1V8FA 1DIOB 1B6RA 3EYWA 1CBUA 3QELA 4O2AF 2VR1A 2AFVA 2WJZB 4G5FA 3PDHA 2JDIA 1SCQA 3LAWA 2C7GA 4UJ3A 3GEPA 4LMBA 1ZGHA 1QE0A 1GGHA 1P8AA 1XDUA 5DBEX 1CVRA 4QXAA 2Q6OA 5ICEA 3R6KA 1EBFA 1XDGA 3MTEA 1JMYA 2ZSAA 3MTQA 4LE0A 3ITKA 4BB6A 4BMXA 2EJCA 4E31A 3QVSA 3G0HA 2WQ7A 2O8EA 2ZS9A 1A9PA 4FTWA 2B37A 3I32A 3V7AA 2WU4A 2YDYA 3PPWA 1HO3A 2IU0A 4JR0A 2JW5A 3NOVA 4X7CA 3P2YA 1D7AA 3G2OA 2W6ZA 4W7IA 5KYXB 5JSHA 4QPZA 4TRNA 3EDYA 3GCWA 3S44A 2FUCA 4Z4QA 4KRYA 2XBLA 4LVCA 4Q9JA 1TGYA 4QUDA 1Z0ZA 2AEMA 2FPIA 2Y9PB 1ULZA 1ZD2P 4WERA 3QX9A 4C4YA 4CG3A 4CL8A 1KWKA 3IB3A 4PFJA 1JHPA 2C0PA 2R1TB 2QU7A 4E88A 1R5BA 4RJJA 1LK5A 4Y6RA 4HQRA 4ZZ1A 2MU1A 1HZEA 1S5PA 1AN0A 3ZW8A 2BMFA 4P3PA 3H9CA 5EIAA 1CQIA 4TLAA 2P11A 3ZGXA 5BSHA 3PLRA 3V2GA 3IOMA 3WGUA 5ELMA 1XDZA 2QQFA 4ND6A 1WKBA 4IJVA 4R8LA 2XADA 1WY7A 4RZXA 3O4GA 1WNFA 4JYBA 1N2SA 4Z0PA 4CMHA 1GYPA 5A5DA 4LXQA 3IKLA 1K86A 3EB9A 1W9XA 2DVMA 1K8YB 3LOUA 1DQYA 1F8XA 1Q1ZA 2O2GA 1G7TA 3N75A 1K7XB 3QU9A 3ZE0B 3ZJ4A 2JPDA 5CVCA 2C77A 5TGZA 2CXQA 2ORED 3L6BA 4L3OA 3WR5A 1KY3A 2XUZA 4M6WB 1D2NA 5LMZA 3OTWA 3E9NA 1N0UA 1AS3A 4YRKA 1L5RA 5LQKA 2LCFA 2QTLA 5CG2A 2W6PA 1X70A 1I1OA 5FWXA 5JS7A 1MJNA 4IP0A 3O1JC 2BN4A 4AF7A 2AFRA 4EAQA 1V6AA 2FUEA 2PS1A 3W3ZB 3U6KA 2ZWMA 2ZAYA 4TTAA 5DV9A 2GOYA 4NBKA 4DYVA 3RRJA 3KAQA 3LRTA 1XEFA 1EVEA 4LDRA 1SMKA 4YNBA 2VPYA 3FFAA 3GPBA 4KQ1A 4P0TA 5EGNA 4R7GA 3VR2D 3MLEA 1ODIA 4CIXA 2X1LA 2DH6A 3PYXA 4PGAA 2HT6A 3KJHA 3MBIA 5K9ZA 2CSXA 4LZOA 2IEIA 1QIHA 1A0OA 1HOXA 2IDZA 4DLUA 4AKEA 1UPCA 3ND9A 5CVTA 5JD6A 1E7WA 2XCLA 3MYRA 2E6UX 2F4NA 4GRDA 4CL2A 4KUEA 1DFHA 1LUAA 1RXYA 1RKUA 2VQ6A 4QV2A 1TEVA 5EE3A 2G06A 5KJCA 3ZWQA 5F7JA 2LTAA 3EQ2A 3OEYA 3PYLA 1E2UA 4ZI7F 1R88A 5ALMA 4YWHA 1YS7A 2SHKA 1Z2OX 3ANSA 3OPNA 3U3XA 5C32A 4JYPA 2J5KA 2CVFA 4CMKA 1ZCZA 5BSUA 1SBZA 4BNZA 1XJCA 2XHEA 3HV0A 2UYYA 4CCAA 1JNXX 5G1PA 1ZRHA 2HJSA 1Z5PA 4WINA 2AJDA 2M5SA 2PPVA 3SEFA 5K2OA 1HDCA 1W30A 1I8DA 5JS8A 3I5MA 2UUOA 4QVJA 5DLEA 1NQUA 4AJLA 5EOVA 7REQA 1F38A 2QORA 4G5GA 1F4LA 1MB2A 1UM8A 1ODTC 3BEDA 1ECFA 1BCSB 1JQJC 4M60A 5EINA 1KDTA 4DMMA 1QB7A 4AFNA 4EYKA 2GZRA 4Q4LA 3QVLA 1VECA 4JT2A 2GQ0A 4LF8B 5CBKA 3E3NA 3W6ZA 1V48A 1SD1A 1XFDA 3IT1A 1RADA 2OUIA 5JMOA 1XT6A 3P27A 1RXWA 1GZ7A 1PJLA 2A1UB 5J58A 1FNNA 1AS2A 2LCQA 1XE3A 3QELB 4KRGA 2WOJA 4LGVA 3OQBA 4OATA 5ALFA 5DTMA 1VGVA 3T1NA 4EYQA 3TB6A 1U9IA 3OKAA 1WQ1R 1EB8A 2BH2A 2P62A 3DKVA 4C04A 1QX4A 1AMOA 1L4HA 4RMHA 2CNNA 1D0IA 2FW1A 3QXSA 1NNEA 1VP9A 3VNQA 1L1FA 2I2BA 3AH8A 5ALUA 2O8DA 4TTPA 1ZL0A 3DJYA 2AJBA 5IH3A 3UOWA 3WV4A 4BLOA 5BORA 3KHTA 5IJXA 2C58A 3GLIE 4CQNA 3VUEA 5EVJA 3OZGA 2Y1CA 4RDCA 4YMGA 4NBLA 1GUBA 3GT7A 1APBA 2WAYA 4DV7B 4P6YA 5HDQA 4TKVA 1H69A 1CRWG 2C4HA 2ZRPA 1TIPA 3LY9A 3OA0A 1M54A 1Y8CA 1N6NA 1Y0RA 1ZSYA 2VIIA 3QTTA 3D6UA 2OOKA 3MJEA 1KYIA 4PW0A 5KWSA 2GN6A 2A9RA 2W93A 4AXBA 2H5IA 3HYLA 4DDWA 1G3MA 3FZQA 2V9ZA 2VA8A 3FVRA 1GLVA 1N57A 1T9HA 2B5WA 2GM9A 3FPLA 3FPHA 5BN1A 4OBEA 1HNXB 4TLLB 1RBMA 1RTKA 4QEDA 4KFCA 3DBIA 3IQFA 2CLLB 3L4BA 5JSZB 4YUAA 1CQIB 4OGFA 2C9OA 4FFLA 4X8HA 5AOBA 4D0NA 4EG4A 1OH5A 6AT1A 1S1MA 4DDKA 3MIZA 4LJ5A 3HG7A 2E7ZA 2OO5C 2VTEA 1FP2A 1N6KA 1JI3A 1JECA 1JAHA 3H2HA 4M0UA 4DCVA 3JARB 3GJ8A 3L7MA 3C6ZA 3PKZA 2Q6KA 2B2XA 5F73A 1QB8A 3KLOA 4M9RA 4IL5A 2HSWA 3NIWA 5IC5A 3BZWA 3C1UA 2BUCA 4Z7JA 3G6EB 1MFZA 1RJWA 2EFEB 3KX2A 3CUWA 2CF6A 1EFUA 3OE7D 4XIIA 2EJWA 5CT9A 3SJAA 2ZL7A 2PRKA 5I51A 5FWXB 4WNAA 1OXBB 3EEYA 3WKCA 2HTEA 1RXIA 1ZEMA 2W11A 2C2KA 5L9AA 4G0UA 4D96A 4KQXA 1SU8A 5G0WA 1MO3A 2JG3A 4EGAA 4X8IA 3CCLB 3WFJA 4CM8A 4EJ2A 1Q95A 2AIRA 6PFKA 4TM8A 1CJBA 1QANA 1YSCA 5K1ZA 5B57C 4JT4A 4EJMA 4EUNA 3CEHA 4CDGA 2EJUA 1OLXA 1IB6A 1SVMA 3O3NB 3AVVA 3E5HA 3MMPA 1GAWA 4KE9A 1BJRE 2ZTVA 4PYNA 2Z58A 4Q1FA 4WZBB 4OQYA 3M8KA 1A96A 4FOTA 5KTYA 3AF1A 4HXFB 5FUWA 4ZCPA 2XCTB 5LU9A 3IEPA 3AIKA 2JIRA 1TZBA 5KBYA 3ZWKA 1L8XA 1DC5A 1YZLA 3I8XA 4FR5A 1YHZA 1SNYA 2FSIA 4MICA 5FUYA 2ISQA 1VQ7B 2QRLA 3VGPA 4DTCA 5C53B 4K03A 4MROA 4G1UC 2ZJAA 1DIGA 3ZHOA 3E9MA 3E7PA 2PYDA 2NO0A 3KJNA 2P5YA 4J7CA 4JC8A 1Z4KA 3JZMA 4MMZB 3S2YA 1E63A 4TYNA 3EUWA 3LFHA 3KB8A 2VNAA 4FCWA 2P4EA 3W9YA 1VYHA 7REQB 4P3XA 3B3JA 5A89A 1I1NA 1TAUA 1B73A 4XI9A 1UBRS 3N7TA 1VI2A 2IE8A 4XKJA 1V8BA 4OUDA 1GGEA 4HDRA 3WYDA 3H5LA 4ZO7A 4LISA 1WWKA 2ONJA 5C5CA 3LUBA 3W0LB 3X1XA 4NECA 5HOQA 3SFTA 2PAFA 4F2DA 2YV1A 1CJMA 2OCLA 2B4YA 2G9ZA 3TMKA 1SY7A 4OP7A 4YJHA 1DELA 3ZCTA 2XE8A 1L7OA 5KJEA 2HADA 4WNYA 5C18A 3MT9A 4M49A 4JSTA 2QW0X 1T10A 2GK3A 1EE1A 4JEIA 4CEIA 4RORA 4BB0A 2ROQA 4R6XA 4JV5B 3TNYA 4OOFA 3AY3A 5DMHA 1SCUA 1NMQA 1QWSA 3CG0A 3FSGA 3Q88A 4GXNA 3GU3A 1GPNA 3LP6A 3URMA 1AOXA 1PFYA 1TQDA 3SZRA 3DVLA 4DS3A 1O5IA 2J5BA 4Y6QA 1ZIYA 1QHEA 4XPZA 1KS9A 1SM4A 4OX9Y 2O8DB 1LDMA 1N25A 1T5IA 4IKEA 2W8ZA 4HMPA 1RQLA 4EHFA 1DKLA 3WRWA 3OUZA 4HVAA 4ALKA 4LSMA 2Q3LA 2OM2A 1Z5OA 4TKVB 4YAUA 3DQPA 1XGKA 1G5IA 2WY2D 1L4BA 1QDLB 3K8ZA 4ZT6A 2C94A 2Y76A 3HLKA 4PICA 3R7SA 3TMYA 1J7KA 5DN6D 3PUVA 4X97A 1P5JA 3IUMA 4YHHB 2UVPA 1TPZA 1EP1B 4KLAA 1AURA 1OQAA 1Q7TA 3RDPA 3SBXA 3WLPA 3BFXA 4F38A 4FDTA 1M83A 1FFBA 4J6EA 2OV2A 4ND4A 2WUDA 3D31A 5BRJA 4FMBB 1Y4DE 5ELLA 1Y8ZA 1TM2A 1KTVA 1WCV1 1U2PA 2IHJA 1OXMA 1ESEA 3MK31 5DI3A 1JXQA 1PEYA 1BLIA 1RAEA 2NU8A 3R7FA 3ZGZA 3B6JA 2AA3A 3DTNA 1CIVA 4N18A 1CY6A 1YUMA 1D07A 2OLJA 4B2YA 3G79A 3R23A 5JO0A 3OIUA 2ZYWX 1Y80A 1AKYA 2R1UA 4JSYA 5EJAA 2VDRB 3KHSA 1O6ZA 3UFXA 4P33A 1GSOA 4GPBA 1WCYA 1EE9A 3C6YA 1U5AA 2MINA 2YHUA 4KDRA 2HWKA 1OXTA 3G0OA 4QGBA 4LJ8A 4KL8S 4ARAA 4WLEA 2OCXA 3L0DA 1QCYA 1E1MA 3W6OA 1YA6A 2J7KA 2E0IA 2I5PO 4LJSA 4CLXA 4E1AA 5IX8A 3VPSA 5BN5B 4G4GA 4X3PA 2QAIA 4WNAB 2W0SA 4KBYA 1NBMD 2BELA 3N58A 4FMDF 1QBKC 1DT5A 2ZITA 3B6KA 3RBVA 2BBTA 5CIQA 2OGTA 3AR3A 2I03A 5FWNA 4CM8B 4RKYA 1WB9A 1O0SA 1FFXA 1FU7A 3I9OA 1VHTA 5E9JA 3S40A 3DEHA 1U7DA 1IQ0A 2RCYA 5DIZA 3KTOA 3HJBA 1YS1X 4LV5B 4MYSA 2F1MA 1NF8A 1NVUQ 3GFVA 4RO0A 3RARA 1HE3A 1OLXB 2O3UA 3VR3A 3L77A 4ZI3A 3V42A 4A6XA 2V7UA 5GIOE 1RRPA 3AX6A 1E4EA 3FFTA 4QA9A 3UJDA 2HCTA 3L6UA 1WZ2A 2XQJA 4XTRA 2PBFA 1PJ5A 2QTRA 2B5OA 1FFDA 1T3GA 4YVFA 1Z8DA 5DHAA 4YAFA 5EQFA 5H81A 3IUSA 5JQWA 1S2NA 2EKLA 1SH7A 1YZYA 3I01M 4EY7A 3V4RA 3GGOA 4NMLA 5KDOA 1KFEB 2EZTA 4MW9A 4D25A 1CY8A 2PNFA 2YC4C 3H1GA 1A5AB 2QTNA 2B2NA 3W5SA 3QE9Y 2NW6A 1GN9A 4J0FA 2H9AA 1C9DB 2HCBA 1YDGA 2QXUA 4B1FA 3WXBA 1NW6A 2HV8A 1H94A 4DNXA 1VBKA 4L5AA 3MZ0A 4Z1OA 3M3DA 5G40A 4KXFB 1P5ZB 3ZK7A 4DOMA 2AW5A 4NABA 3W5JA 3L4KA 4A9AA 2CNWA 2G9NA 4RJLA 1JSXA 1UKVY 4FYYA 3IUYA 3BMOB 3W5IA 3HBLA 3TQFA 5HJEA 3PL5A 3HJUA 2HY7A 3AM5A 4PQYA 1AVTA 2R8YA 1J7JA 5D51S 4NEGA 2BFOA 2X4GA 1PZGA 2AKAB 2BRUA 3FA2A 2MSNA 1Y3DE 4OUDB 4HDRB 5FB3A 4NVRA 3E61A 5KTTA 4P58A 1P1RA 4CIBA 5JSFA 1H0RA 1ETHA 1Y4AE 3ZCPA 5IC4A 4BXOA 4J0KA 2GNOA 1KVSA 3Q7QA 4NV1A 3GAFA 2FZKA 3U0BA 1HFKA 4C6SA 4YJHB 3ICCA 5EMLA 1UWVA 3GGPA 1F8FA 3FFXA 4M0DA 3VYVA 1M8GA 1OI4A 4YP6A 5FNVF 4BWGA 4JJIA 3GAAA 5H16A 4DLNA 1NLFA 2ZVJA 1SA0A 4HGZA 5JDCC 4PG8A 4JC0A 5CAEA 2C7PA 1R1DA 2JLCA 3LWBA 3R6TA 4HQLA 4RMGA 4TWIA 3E3LA 3RT1A 1SCUB 4F8EA 4F5WA 5A0TA 4M38A 1HGXA 3C8HA 2V45A 3OM9A 5DGIA 1FY2A 3O03A 3F5QA 3J7AC 4YJ2F 1H0KA 1PEDA 4I66A 3M81A 5FDFA 4JLWA 4NBWA 3GJYA 3JQ7A 1XC7A 4OHVA 1EAYA 1R9JA 2PFKA 2J0QA 1PVDA 1YQGA 3IJ5A 3B70A 2Q2VA 4PZ0A 2GPWA 3NHAA 3GFRA 3IR5A 1DAGA 2Y27A 3ETGA 4I81A 3ABZA 3L8ZA 1WXIA 2K87A 3RF6A 2UVPB 4C0SA 3GN2A 3H1EA 3SCZA 2O8BA 2I3AA 2V4UA 3GLTA 3WYGA 3C8MA 4ZGNB 3WJ1A 2ZJ0A 3EIQA 3NC0C 4TV9A 2ZTGA 5C3UA 2PL9A 3W4IA 4ZN6A 1GCGA 3W2IA 1XMVA 3R5KA 1G5PA 1V26A 4HMOA 3T7IA 4IDFA 3FHJA 4EX7A 1MPTA 5DI3B 1SOVA 3IIJA 3LCRA 3LVRE 2NU8B 2MSCB 2ZBRA 3NFYA 4R4JA 1U28A 4OPSA 2SCUA 3RLFA 1Y8AA 2ZUUA 4FNMA 4S1WA 1V41E 5AICA 2X7HA 3LCJA 1X94A 3STUA 5CB8A 1W48A 5JASA 5B2ZA 4X90A 4YRAA 3G2LA 1SG9A 1NDHA 1DAPA 3UFXB 3ZZMA 2UUBB 5HE9A 3SNKA 3MB5A 1E6KA 1VP3A 5FBRB 4TKOB 1CZKA 2FDRA 2MINB 1KDYA 1J99A 4XASA 3WWZA 2Q8QA 4GG1A 1JQLB 3VU9A 1Q7CA 2A3NA 2VK2A 3IIEA 1KDRA 3VDQA 4TS4A 5BNFA 3LX5A 3AIMA 3IA2A 2CDAA 3MUFA 3N2ZB 3OC6A 4O4HF 4MH0R 1ZMBA 3MM4A 3W2TA 1PKXA 3ZVNA 4FDMA 3P7MA 5REQA 5AVQA 1GPUA 3FKQA 1Q57A 2NWQA 1G66A 3Q9UA 3B9BA 4JZKA 4MVJG 1U7OA 3GELA 1WCIA 1AC5A 1KZLA 2ZSKA 3V4ZA 5A7GA 3W78A 1FFXB 2CXSA 2GDJA 3G0BA 3ESAA 4LTMA 4ZFNA 3KE9A 1L2TA 2B8WA 1N3BA 1Y3CE 1E2GA 1E9BA 1XCMA 4KITB 5JSQA 5LMNB 3A4NA 5EXXA 4IIHA 4PU0A 1QP8A 5C34B 5BPHA 4QXRA 3W2HA 3PENA 1JFSA 4WY5A 3OX4A 1ZI6A 4WADA 1E4EB 4Q9NA 3OZDA 2ZIVB 3IH5A 1XQ9A 3C6KA 3CNEA 1EWYA 1EINA 3G2HA 3HB0A 4TLMB 5AVKA 5BUQA 3O4IA 3RC1A 3HKEB 1F2UB 3F5FA 3LGSA 1P2SA 2R4QA 1CR2A 2KI5A 3AGPA 3DMTC 3G7NA 1R18A 1KI7A 1NAIA 3AF3A 4PQGA 4D02A 3UMJA 3H99A 3SN6A 2C2OA 3ESDA 5GM2A 1HXHA 3MCWA 2FN3A 3IDSA 2ZXHA 1LDEA 1VLMA 4DARA 2JAWA 3L0SA 1V8OA 3ZK9A 4NK4A 3I04A 4H6WA 1JB9A 1Z7EA 4YROA 1GPLA 4Z8YA 4FSXA 3FYTA 1WUHS 2FR0A 3I1JA 4ZYVA 2PEZA 8ABPA 4X6XA 1JFTA 1HYEA 2JFQA 2I6UA 5LDDC 4UU8A 4OFWA 1A2KC 5HVNA 4AUMA 4NEQA 1AA9A 1SCBA 2E5WA 1TF5A 2LKCA 3LXUX 4NICA 1PLJA 3OP4A 2BFDA 4G25A 3JQRA 4WHMA 4BN5A 2H1OA 2HFKA 3MRVA 3ANYB 5FOXA 3NH6A 5EIWA 3DL7A 4M89A 5LDGA 1HPLA 1YRAA 3E0XA 3FI0A 3N5CA 2ZZNA 4QTUB 1SUFA 2YL2A 2A0UA 3GEEA 5C0OE 3SQDA 5JNUA 4GC9A 4Q3AA 4OA8A 5M04A 3BGSA 5EL0A 3TZLA 4A5SA 2X3FA 1T5EA 3RAFC 1CJUC 2RGNA 5DPMA 3PD0A 2DLDA 1IHDA 1NKVA 3KUCA 4IH9A 4HN2A 2F3QA 4G41A 1SA0B 4X1IA 5CAEB 5AKIA 5E7QA 3R9XA 1MTZA 3SXPA 1W0KA 4G0ZA 5L4NA 1ZI9A 2GM4A 4MQBA 1Q0RA 4FFBA 2R7MA 5AP9A 1AKMA 2H2FA 2I66A 4Q7KA 2IYYA 4E2ZA 1N0HA 4LOLA 1WKCA 3EQZA 1Q5PA 5FIUA 2I1QA 3K9CA 5EJGA 3JYLA 3KQQA 1LY1A 3JQ7B 5KJ1A 3A14A 4RD2A 2PJZA 1JR6A 4KO2S 1GP2A 1ZEJA 3NVAA 1YV9A 3N70A 1EBUA 2CWWA 1YRHA 2PQMA 3KOOA 4WRRA 1JPUA 2WIBA 4O2AA 4K81B 1ZVKA 4Y7DA 3I2IA 1XO1A 5LLTA 4JBWA 4X06A 1XMQB 4JLSA 3OLVA 3DEIA 1T2DA 4M7RA 4NZZA 1QO0A 2W5UA 1EKXA 5LZ8A 5FWAA 1L0BA 2C59A 3FPFA 4HWKA 2I7DA 4TV9B 4XVHA 5EGSA 5FPQA 1CRPA 3KM0A 2DU8A 3L1IA 4V0QA 4OMFG 2IOQA 1LWNA 2VHQA 3CGWA 3RVBA 1YCGA 3GRRA 4KQGA 2O3RA 5IZCC 1TFUA 1JIQA 1LV7A 1M5TA 1NG1A 2AOXA 4PTLA 1WR8A 4RENA 5G0UA 1N2EA 2HK9A 2ZROA 1P18A 4KKUA 3NT5A 1M67A 3OJLA 1ZK4A 2B4RO 2WSBA 4ZMBA 2BISA 4UQOA 4IZOA 2QUZA 4DZTA 1ZAYA 4ZCMA 5HZMA 2KW5A 4EY3A 1A7KA 4UTZA 3ONEA 3QKSA 4XWWA 2FZWA 4ME6A 3QGMA 3UMSA 1KEZA 1IAVA 3P2KA 4I6GA 3HRHA 1BTOA 5D7BA 1CCWA 3ZE1B 2HAEA 3EZ2A 3CUVA 2CMHA 2P5SA 2GPYA 2W0MA 5DM2A 5AW9A 2ZSHA 3VU9B 4C0JA 5FPSA 4BKPA 3I52A 4CIWA 2DXIA 3U3KA 5H1YA 2JZOA 3IL2A 3K9WA 4XORA 3D8RA 1N08A 2WABA 4Y2QA 3ZXSA 5JNRA 2V7TA 3FKSD 1RXEA 3M49A 4MP3A 3L6RA 5D2CA 3DQZA 5REQB 3RSFA 2FDCA 4COKA 2B78A 1WCIB 1FVFA 5CH3A 1VPDA 3PQ8A 4TVSA 1P75A 2PD4A 1TAQA 2AKYA 2AXNA 5KCZA 5JDCA 2UAGA 5M34A 5AJTA 1UDCA 1J1IA 3OM0A 3QEOA 3LFTA 1DTSA 1OWOA 4KYUA 2OV1A 4OD0A 1P9RA 2QL5A 3OCUA 4QZVA 1VC2A 5KYKA 4U6NA 1X7XA 4XIFA 1UT8A 1DBWA 2CLSA 4H2DA 3DE3X 3HN6A 3O2QB 1K1EA 4KLNA 5SZIA 3ZX5A 2P3SA 3SJZA 1W4RA 2JIZA 1MRNA 2G08A 5TRDA 2WWFA 3P9NA 1JEDA 2ZZFA 1U5BA 1A4UA 4AVYA 4L5IA 4EP1A 3L6EA 1XEXA 3B1KA 2BGNA 5JMTA 3W6UA 4YRFA 3L9WA 1KY2A 4JCOA 3AETA 4F5YA 1YH3A 4EPVA 2VPTA 3PQ3A 3EJ6A 3QOFA 2ZUTA 4DPMA 2FUG6 4FB5A 2FUKA 4M1OA 5JNSA 4BV2A 1N5LA 2RC6A 1JHOA 2HIAA 4B4KA 4DUGD 4HD8A 1B23P 1S1CA 1J70A 2GAIA 2ZULA 1JDBB 3DDOA 3F7TA 4X91A 2AXEA 4YR9A 2C5GA 1A4XA 4ZCIA 2PX3A 3SZLA 3TCNA 4DG9A 1OWMA 3PC6A 5J4LA 3TZEA 3CF2A 3JRXA 1THZA 4ENTA 1DG3A 3EUAA 2P40A 4RVHA 3ZIUA 4LZZA 4KH1A 1TNDA 4EHHA 3GLIA 1VQNB 4ZI7A 3CLTD 1K4KA 1TRKA 1TAHA 1ZH0A 2BFDB 3LO5A 4JQOA 3T7DA 4WD3A 4AKGA 1RYBA 5KNDH 1ZNQO 1O87A 5CM2Z 1A27A 1ECBA 2GD2A 3LE8A 3RVRA 3BEOA 4MUKA 3AHJA 2DR3A 1YB7A 2P2ZA 1B7GO 2PZ8A 3G5TA 3HXPA 2BI8A 4TRJA 1QDUA 3FB4A 4HSEA 4DBZA 1JEOA 2Q3HA 2VSYA 3KDPA 1VCMA 1K0UA 2A9JA 1EM6A 1V11A 2IKSA 1D1PA 3E8XA 4OHYA 4FW9A 4F11A 2VEOA 3FYUC 5CLLA 4IIGA 4NH4A 3CSDA 3SKBA 1E1NA 4BO8A 4X1IB 1Q1GA 4JU8A 5THKA 2YNMC 3BXOA 5LQNA 1J23A 3U44A 4FFBB 5K0FA 1CEEA 1R66A 2I65A 2FTKE 4ZJPA 1JPVA 2CL7X 1IM5A 1Q1EA 2D8AA 4ZMSA 5B6IA 3DAOA 5EXDA 1LDNA 1RM5A 4JLJA 1PR5A 1QAOA 1UBFA 1RZ3A 3WIVA 2I2WA 2F8SA 1HA3A 2FPWA 4TSFA 1YVUA 3LQ6A 2FEXA 2R1ZA 5DRTA 3UIEA 4A5OA 1PDOA 3FYCA 2A4KA 2BFPA 3HVJA 4O2AB 2H4FA 1X19A 1VZ3A 2VZ8A 3ZPNA 4FGJA 2PLRA 3OFKA 4X41A 4EVIA 4LC0A 3ZZUA 3E3AA 1L9KA 2Z30A 3MLAA 1KEWA 1CE8A 1U2RA 1FE8A 3GWGA 3OFVA 3NTLA 3UWDA 1W581 4FVTA 4B9AA 3JRWA 2FX2A 4OQZA 4UCQA 4GL4A 1YI0A 2KX7A 3JYNA 5L95A 3X44A 5EE5B 2WOOA 1WSWA 3ETDA 3KWJA 4CEJA 4RCYA 3C39A 4ZVRA 3GI1A 1DUVG 1YL5A 3GBPA 4FC7A 3R7DA 3NTXA 1MQAA 2P1RA 3A7EA 3DHEA 4DXDA 5IK2D 5KHAA 3GLRA 3QKSB 4O4JA 2J41A 4G6IA 4IFIA 3ERCA 1T2UA 1GHTA 5SYNA 3CZMA 1R0WA 1YIJB 3ONFA 2N1MA 4I8DA 1KJIA 3TLZA 1WBJB 2BHRA 1UIMA 2Q2NA 5BWBA 4CUJA 1JHYA 3RG8A 2WIDA 2OGWA 4C30A 3U4AA 1UQRA 3BMNA 2GA9A 2VT2A 4XDHA 5EERA 4P1VA 1V5EA 1C0PA 1LTHR 3C85A 2PKEA 1GFSA 2R9VA 4JGBA 4M86A 1DOAA 1N7GA 1SUPA 1Z0UA 1CIJA 3DFIA 3FRHA 1I7SB 2OKCA 4AB1A 1RYNA 2WV9A 3M4XA 3DWIA 4KPYA 3U81A 4QNMA 5HP4A 2C3PA 1HDRA 2Y1XA 1SVOA 3JWIA 2DMRA 4Z54A 1ATZA 1T4CA 2Y8EA 3U9TA 3GP5A 1OXSC 3P52A 3D8UA 1DEXA 2JCVA 2JCGA 4MDHA 1IK4A 1SULA 1P0PA 2J08A 1U5BB 1XZQA 1UINA 4LHZA 2ZU6A 3UWSA 5K3EA 1SZCA 4QQRA 1JQBA 4PVDA 4PNPA 3H13A 3BIWA 3B89A 1CLUA 2VAWA 5EI5A 4N3NA 1HEUA 1OASA 1QG6A 3AETB 4I4IA 2G71A 4UMDA 2FWPA 4Z4FA 1YR6A 1TVCA 1Z6ZA 1SCKA 2N3ZA 1SQFA 2OHXA 3AEQA 3E4DA 1NMEA 3K30A 4G5QA 1NSTA 4MUGA 4D9HA 5I7VA 2I6QA 3GP3A 4TMYA 4X05A 1NOKA 1T4GA 1IBRA 3O84A 2E48A 4J0JA 1P9WA 4HI0E 4L57A 1J22A 4MS1B 5JCPA 2PL5A 4D3XA 3R3SA 1Q6YA 3KEGA 2UYCA 2WILA 1KIAA 2F67A 3ZHBA 5A3RA 3ZJYA 1P80A 1GV0A 1VMAA 1ADGA 3GLIB 4P3KA 5D3ZA 3VR2A 5KKNB 4ZI7B 1PD0A 1FZQA 3F7OA 4PIMA 4MI3A 4ZRDA 4EBFA 3U5TA 3CINA 1V4NA 3VVLA 3P5BA 3TSWA 5ALRA 5M5BA 2B4KA 4QOSA 4P5DA 5TT0A 2P3QA 3RW9A 1UAGA 3AM4A 5K51A 1WXXA 2E2WA 1TE2A 1T91A 5I7FA 5BWLA 4CKWA 1BQ3A 1C7FA 4ZAFA 3VBCA 3GEHA 4DC0A 1RWMA 3EDQA 2BMWA 2Z1NA 1V11B 1VLJA 3NBQA 3QSGA 4K9LA 1P7PA 5CHEA 4Z4SA 3GVKA 3BCFA 2AW3A 3K1AA 3OPMA 1BYUA 1YD7A 1RWWA 2DBVO 1MJFA 2IHBA 4GZ5A 4OSOA 1QIMA 4RJIA 4OQEA 5CMLA 2IWHA 1C1HA 5KAMA 3WAJA 3BRQA 1IN5A 3TSYA 3WMFA 3ZEAA 3G9UA 4GMHA 2QRPA 4BV3A 3M6UA 4DJFC 3U44B 1QKKA 1ULTA 2PV7A 2QM3A 2QRKA 2HMUA 4J6FA 2CJPA 5KSPA 4YMLA 3VAZA 1MQSA 3FNQA 3ZY5A 1INLA 2CUZA 5LQAA 3D02A 4B7UA 2V3VA 3R7LA 3EVBA 4CM1A 5FBVB 1L1RA 3BL5A 1J1UA 1F2VA 2IGTA 1IM2A 3BZUA 3C7CB 3OBBA 3CNHA 3ZV3A 4ARZA 3F0TA 3PHLA 2JBHA 1WMSA 3D6NB 2ZTHA 3EN0A 3V00A 5LOVF 2XRZA 3HDQA 4G63A 3DDYA 3UF0A 5B58T 1IZYA 3F9RA 1H42A 3OOJA 5HZBA 2D1QA 3CX3A 2IODA 3MMXA 1Z6PA 4HVTA 4X92A 5H3LA 1CE8B 3ZH2A 1N6RA 2HSDA 1L8AA 3QK7A 4OQ4A 1GL7A 4LFAB 3Q3JB 2HRBA 1K28D 3OOEA 2C57A 4IIVA 3OFSA 5TS3A 3TW4A 3V8MA 4BAGA 1G63A 4P4GA 4R84A 1DMSA 1I0ZA 5GZ1A 4J3NA 3LFUA 4A36A 1TK3A 5JS2A 2FF7A 2PA3A 2X8WA 1WW8A 5LC1A 3Q3CA 4WAUA 1RVV1 4QOFA 1M1KD 2AZXA 2WYUA 1BWSA 2I7CA 2QX8A 4MRVA 4M1MA 2VHVA 3P20A 4FEYA 4WDRA 4DIFA 1CP2A 1ZY2A 2GAJA 3NX4A 3OW7A 3PNQA 4RCZA 1NQAO 4BFZA 2ZJ3A 1U4SA 1IL0A 3K6RA 1D6NA 4IJUA 4W5HA 3MWYW 5TQ2A 3FDFA 1D6MA 4LVUA 2QU8A 2BHTA 1DHTA 4UHHA 3T9DA 3WHKA 3H5WA 4XX0A 3EISA 1DBSA 2I8CA 4Y7CA 5JH7F 4D0SA 3H6HA 1BZYA 4L7QA 4QYTA 1NP7A 3BMNB 3KQMA 2EDCA 3OTGA 2GK4A 4H77A 3T38A 4RTQA 3HJFA 3A3BA 1RR6A 2AV6A 1M1YA 2BT4A 2QUHA 3A2LA 4ZAYA 1Z33A 1WZUA 2Q41A 3FYUA 4E33A 4G89A 3REQA 3AB8A 4B79A 2CE2X 1Y98A 5EWMB 4RULA 4BV8A 1JG2A 4JI2B 3SR3A 1J8VA 3SY8A 3DOEA 4OJMX 1ULUA 2DWCA 3SICE 1SU4A 2C3UA 2XUQA 4TX1A 5BWOA 2C8JA 4W99A 2IPNA 5EJIA 2C8KA 4PQRA 1N92A 1UM9A 3ASZA 2QLMA 2C78A 2PMEA 3T7AA 1FLDA 5K6RA 1A7AA 1XD8A 2F9LA 1PL0A 3OQPA 3OPYB 3U7EB 2A35A 1XK6A 1N5KA 3SHQA 3UOAB 1QIJA 1U11A 3GSIA 1Z83A 2RH9B 2NSHA 4M0PA 3UTDA 3RCBA 4MV6A 1QF7A 4U3JA 1JF8A 3AEQB 3D8HA 1PLKA 3WA7A 3OE7A 2OBMA 4BEBA 4OPVA 5HKOA 2A0WA 4RPHA 1IXRC 3DXYA 1YFLA 1IUOA 2Y71A 3PUZA 1J8FA 2V1UA 4TTTS 4QEKA 4YELA 2RGUA 2DJ5A 2X1MA 5DWVA 1YI8A 4WZ6A 1X9GA 3TX2A 2AEEA 1PTJC 2KSQA 4Z4UA 2VP0A 5AMXA 4BRWA 4M37A 4F96A 2VAXA 4PFKA 3M9WA 2UZ1B 2HRQA 5EXTA 2BZGA 1MXFA 3UJ6A 2QZSA 4QOGA 4F6CA 5CFPA 2LUOA 2YIMA 4H08A 2B1IA 3HY3A 4GEKA 4R01A 4Y2PA 3TLBA 3RYTC 1WP6A 5KYTA 3F90A 4GEGA 4D9CA 1JQEA 3PSHA 4ARIA 4JU9A 2X2FA 1IVNA 3DMYA 1JEAA 3RO7A 4CKWB 3A8IA 3UWOA 1IY2A 1RFLA 3GDWA 1M2NA 1UBCA 3NNNA 1A2BA 4OV6B 4P31A 3DE7X 3K1AB 4DSAA 1C30A 4R83A 2HWWA 3KXDA 3BVPA 3P0JA 5EIHA 1XTZA 5G3YA 2DPLA 2YY5A 3CW2A 4QBIA 2M6KA 4P3IA 5F4JA 1I5RA 3TGWA 4MHOA 4B0PA 1RYFA 1OD6A 1NW7A 3EF0A 1DEAA 3GVIA 2E4WA 1M5UA 4J1QA 5FAXA 3GZNA 4BN0A 1PVVA 3EPLA 5HFJA 1F9AA 1ND6A 1I4EB 3A6GA 5AVVA 2F8LA 2H29A 5F5LA 4BO5A 3JWEA 3K92A 4JKOA 5AW4A 3FPBA 4NCNA 4D8VA 5FNVA 4ARZB 2HA5A 2CV0A 1M2OB 4WZEA 2DUMA 4A8PA 2P27A 2KWIA 3TW8A 4XSGA 4AJKA 3OHMA 1VXRA 2BR4A 2XTZA 1RPJA 4KCGA 1K88A 5I4IA 1S6YA 3CSSA 2B99A 4FHEA 1GGVA 1KHTA 1RP1A 2ONYA 2QZ4A 1WPXA 3CB4A 3KXKA 4UNQA 1L5FA 4PC7A 2X58A 3JYOA 5TPWA 5ES4B 1YQ9A 4ANFA 1I14A 3BD6A 1FVHA 2I8AA 1CZUA 2PKQO 2WSYB 3EBLA 2EYQA 4TYQA 2BTOA 1GJRA 1P8JA 2W2LD 1QAMA 3G6KA 3I9MA 4LI3X 4MIYA 3KQWA 1FIUA 1M9NA 1Y8RA 2WVHA 2ZRAA 2VKTA 1NMZA 3KU1A 3UKJA 1I36A 1U1IA 3FDJA 3I6IA 3H97A 4RPDA 1HEIA 1Y9AA 3A6LA 3N05A 4HDMB 1ICIA 2W2XA 5GQSA 3KSBC 1R6BX 4BQRA 8AT1A 1RAIA 5IBQA 1K08A 3B5JA 1NVVR 4LWOA 3QU5A 4F72A 2EZUA 3SQLA 3GJSA 2WSIA 2X5JO 1Z4JA 4G8DA 4QDTA 4XX0B 3LWZA 2DUJA 3CF4A 5E7JA 5EXSA 1OWLA 3V7NA 1KKMA 3V8NA 1D04A 3AZQA 1HL3A 3WQRA 5DN6A 4WXMA 3ZWDA 4BMOB 4EGCB 3BX1A 4Z53A 3QX8A 2JFXA 3PXUA 2HPHA 2R7LA 3UT5A 3OJWA 4XSHA 3GFSA 1M1YB 4HH0A 4INOA 4RLZA 4MAMA 1V25A 1UAYA 1KQSB 3DKPA 3FYUB 4MQUA 2LR0A 4QXMA 4X93A 3WLNA 1NIJA 1DAFA 1EK1A 1OAOA 1RJGA 2XMZA 3UHAA 1NSFA 2IYUA 1MP0A 4MNTA 5EAIA 4DJEC 4WKCA 2AVDA 3JZIA 3LQYA 4WIAA 3AUUA 2HXGA 1G5RA 2XMQA 3D8BA 1XQBA 4EEZA 1HZJA 3CWQA 3K6KA 1NN0A 4I2NA 4D9NA 3NYQA 1ULHA 1RQGA 4O4HA 2YIDA 5KUTA 2QTGA 2E85A 3A3NA 2WF7A 4DG5A 1J2EA 4TWRA 3BF8A 3KKQA 4E1VA 1UMCA 3KR2A 1UM9B 4FMDB 2WWVD 2JCBA 5DH9A 2AS0A 5B6PA 5JWHA 5HJ5A 5KQRA 1E3QA 3C15C 3PC4A 3EWNA 4X7RA 4HNUA 1X1RA 2DFNA 4CF6A 4E94A 4DL9A 3DE4X 2XD4A 4U3JB 3NIFB 5EMHA 4LYFA 2OZKA 2AOTA 2AJ8A 2BSAA 3I2YX 5DM0A 4DLLA 3RSHA 4LEIA 4JI7B 1NJFA 1LSUA 3DWFA 2VJKA 5CURA 1NBMA 3WY9A 2C97A 3CNBA 5KU7A 4LY6A 2V6FA 1ZNWA 1DADA 4AVZA 3LC0A 3DBOB 1BH6A 1XB2A 4R69A 4Y2XA 1CR4A 3H2YA 3WNZA 2WZDA 5IKPA 5K0ZA 1DINA 4LJRA 2LBPA 4OOSA 3SZOA 3HCNA 4UKDA 1FQJA 2A0FA 2BF7A 3NVDA 2W6NA 4PSCA 4PONA 2GD1O 2WUWE 1X7YA 2VT3A 1FYVA 5JO9A 2GUWA 2WJ6A 4MGHA 4JASB 2G9UA 1A8IA 2XAAA 3FN4A 2IXEA 4AZWA 2YASA 4D6YA 2B8EA 1ARZA 4MV5A 5C37A 1DX9A 4RK4A 3QLUA 3IQIX 1EK2A 1NBOA 3CJTA 5JZOA 3CNNA 2MHCA 3O82A 4EEKA 1RE0A 2GCEA 2CUKA 2PX5A 1C30B 4UMVA 4ZEWA 3VHQA 3UWMA 4KJZA 1NJGA 1W8IA 2A14A 4MR9A 2AJLI 1E8DA 1WXHA 2MYTA 3RVMA 3VC7A 4CDMA 4RZ3A 2CXXA 2JH8A 4G97A 1TJ3A 2H4XA 2OO7A 3TDNA 3HP4A 4OHFA 1XRPA 3D0KA 1GTG1 1DJOA 4YMHA 5FH9A 1DKQA 1LCIA 3GZNB 1KJNA 1A82A 1L7AA 2P4HX 3H7IA 1BEUB 3PHBE 1JR3D 2DKNA 4UHFA 3O8RA 3BDVA 3NYRA 1GPKA 2DF8A 3O91A 4L6CA 3AM3A 1JG3A 4NZNA 2NQTA 3EDRA 3ORSA 1A9OA 5CNMA 5FNVB 1RM3A 2CJXA 4P32A 5K6AC 1O96A 1VI5A 3LUAA 3UUGA 1QHGA 1OBOA 2I7VA 2MR6A 2PR2A 2DKOA 2WHXA 1YITB 3HVUA 5DRYA 2G1AA 3N2GA 1GPYA 4XJXA 4ZT3A 3RAGA 2YYAA 1CUWA 4EZEA 3AUAA 1J49A 1W94A 3QBVA 3AI2A 1NX6A 2PJRA 4ZQCB 2AUMA 2JFVA 5TPWB 5EJ5A 1ZLXA 5K3AA 3ELWA 1SG6A 2DPXA 2GHQA 4B7CA 1U7HA 1YL7A 4IJMA 4ZEOA 1B8VA 3DDCA 2Z2ZA 5I9LA 4MVJP 1ML4A 5TMPA 3NBUA 1IXYA 3BB3A 1Y8RB 4KG7A 2ZSUA 1GA4A 1VJCA 3E35A 2LWIA 1QFJA 1H2EA 4RZUA 4RYDA 3TW0A 4B6RA 2IHUA 3NE5B 2ZM5A 4JJ6A 1QV7A 2E18A 3F6RA 2PU7A 4RGBA 1U3UA 1VKRA 2QGGA 3P9YA 3KZNA 4LVNA 5BQ3A 3NRCA 1PFGA 1GL6A 4PZAA 2IS6A 3SHWA 3AUXA 4M87A 2VZLA 1Q0UA 2BEJA 2PGXA 3DMNA 4UNPA 5CPBA 2WA1A 4EA6A 5BURA 2D7DA 4JHLA 4L1KA 4PXSA 4ZARA 1PJCA 1XD9A 2VSOA 4EG0A 3H1PA 1EDBA 3DR3A 3LI2A 3VZRA 3TBHA 3UT5B 2BMJA 4FYHA 4BUJA 3EIFA 1K6IA 3VH1A 1UDRA 3BXEA 2PG3A 3WIUA 3T5TA 1YJAA 2GB4A 5B1SA 3AF4A 3OE4A 4MRAA 5GONF 3T52A 1P44A 1QRTA 1CUJA 2NNLD 5JEEA 1P60A 2CHEA 3CLTC 2RHMA 4DWJA 1TKCA 1P9NA 2HBYA 2Y1OA 2NZUG 4GM4A 3HBMA 4CG0A 1U7TA 4O4HB 4IDDA 3LWDA 4Z9YA 1UMCB 1DB3A 2F1IA 3QBTA 3GCXA 1MAVA 1N36B 2R1VA 1TCVA 4V0KA 3NIDB 4YQEA 4D5GA 5JATA 5KNDD 4YJFA 5D5QA 1GTJ1 1WUTA 2XRYA 1VG1A 3KOUA 3M5CA 2C5FA 2GJRA 4IXWA 5HHTA 2XGGA 4CQMD 1I6LA 3E9DA 2WMNB 3LYHA 5DBFA 1EK0A 1FRVA 1GFZA 4PAWA 5IWAB 2FW7A 1UAAA 2BP7A 3ROMA 2QPAA 5A9TA 5IM5A 1QVVA 5JVDA 3VKHA 4FGUA 2FWRA 9LDTA 2VWGA 2Z83A 3RVSA 1KYZA 2XNDD 2R6FA 3LHKA 3AU8A 4FFSA 5KW9A 3NDRA 2II6A 2HPVA 1IM8A 1NV9A 1O6GA 2JFNA 4KXUA 3V9AA 2GZHA 1VE5A 1Z0SA 4ER7A 3GJ5A 3JAWA 3CX6A 3D64A 3FYSA 4H27A 2D4HA 3DAGA 4UZUA 2FSVC 2E82A 1PS8A 1PYOA 1IHYA 2G8LA 4HYQA 1QVRA 3GVLA 2ATEA 4UBOA 4YCBA 3AUYA 3AWDA 4G0WA 4F93B 4UVIA 1P17A 1T1IA 3RODA 4YPVA 3VSDA 2X9NA 3COWA 3VAYA 2RDMA 3DDSA 5JU6A 1YZFA 2L82A 1YE3A 4WZLA 2ZI5A 3FHCB 1R50A 4HBZA 4R1NA 1IN1A 4J3JA 4B7ZA 2VP4A 3CUTA 1NUHA 4GOKA 1BE0A 1XELA 2H92A 5FOWA 5CXXA 3PUYA 4MR9B 2WJIA 3O31A 4O29A 2A5FA 4B6JA 4TL8A 3RUHA 2B8TA 2EWMA 3PEWA 5ICGA 1T8UA 5H0IA 4BFXA 1AUXA 2ZQ5A 1D8TA 4DQ0A 4ZRNA 1M0SA 4BVBA 2H7XA 3EW7A 1UWLA 3G1UA 4C29A 1YTUA 1MH1A 5C7OO 3FW1A 1GCAA 3ZCQA 2GMWA 2K7ZA 3C3JA 4OP1A 2AEFA 1O96B 421PA 1SHZA 1CK4A 1D1QA 1K7EB 2REQA 1MAWA 2R5NA 5A3VA 4EA8A 4UTRA 2PX2A 4CV1A 4RTRA 2C5AA 3N2GB 4L28A 4R05A 4RF3A 4LF4B 2QY9A 3ESYA 3BKXA 3FHLA 4R1UA 3HA7A 1M34E 4QNRA 1UJCA 2QLFA 3A9TA 5DXFA 3PA2A 4BRSA 2GASA 3IOYA 2CXHA 2YWXA 5AKZA 5E2BA 1MRSA 1ZITA 5G0VA 4DYDA 5JWOA 3M4JA 2V5VA 1QQBA 1OVGA 2WEKA 4Q12A 1W76A 2AMJA 2EWWA 3IAXA 2IITA 5DN9A 5GJWC 2WU1A 3C3PA 1UXJA 4A1FA 2TS1A 4GYYA 1ZDMA 3CUKA 4HWTA 1Q91A 4F45A 2IP4A 1Y4ZA 1JSZA 1PR3A 1I2MA 2I29A 1OGYA 2Z9DA 3AMVA 3LL7A 4F2WA 1ZJWA 2O2CA 5JJLA 2GPTA 3FIUA 2A78A 5LQRA 4AWBA 4M99A 3FTFA 3OO0A 3Q3AA 1Y33E 4N8SA 3H6KA 2GEKA 1OC4A 2QGZA 5SZJA 3ROEA 4YRPA 3ZH9B 2BJVA 4B34A 2GZ1A 3LWNA 2H4HA 1PS9A 2W2OA 1SD5A 2FEMA 4FFDA 5IYPA 4WQMA 5YASA 1I24A 4RV5A 1KRWA 3ZY4A 3PQ6A 1QZ3A 2VF8A 4HRAA 5E4FA 4YAOA 3NANA 4XGRA 3U7HB 3A0RB 4INPA 1OXXK 2C4NA 1P73A 1VHDA 2XCSB 4J0DA 1CUIA 4P38A 1RHJA 1YBHA 1W25A 4FNOA 4KR3A 2VHXA 1XQWA 4QYIA 3I6QA 1FSZA 4Z2AA 1ZD8A 4MVCA 4GOOD 2O54A 1DRVA 4MMXB 1L3BA 1NVXQ 5C1IA 4AJ1A 3HXMA 3RUAA 4HXGA 3ZV7A 3LVBA 2JAPA 3UXMA 4NCJA 1PJ6A 1LXCA 3NASA 1ENYA 6YASA 4QUJA 4MR8A 4UPVA 5L3VA 2X85A 3RYFA 4EH1A 2JD2A 3HVRA 2PUDA 5AOVA 2RJ3A 1L7QA 1RAAA 3BSWA 3EDOA 4XIJA 3C3YA 2X0FA 3KLBA 1P3JA 4YO8A 2R1VB 4B17A 1JR3E 4CG2A 2I34A 4M1TA 4YJFB 4K28A 5BUCA 3WMXA 3EZ9A 3JQCA 3VZCA 1BVRA 4LCBA 1ISFA 2V5UA 1U2ZA 2I2DA 5HS6A 3CPSA 1ZSVA 2BP7B 2XAUA 3CC2B 4QQ8A 4CNBA 5EP3A 1K5GA 4CHTA 3FKSA 1KXZA 1V1RB 1X2EA 2DWPA 2EJBA 3CE9A 2G9VA 1TDJA 2C7VA 2G17A 3QXGA 4M1QA 5LB4A 3CXCB 2HSZA 1GCOA 2A5LA 5LQUA 3HHEA 4UEQA 3SP1A 3CUEF 3UC5A 4HJRA 4XM0A 1TU3A 2VWHA 2C29D 3AIIA 1KQOA 1G2QA 2RBKA 1H85A 4IW3B 5CLJA 3B60A 1PV1A 3U4CA 5LJIA 1AKEA 2QHXA 4ZVLA 4G5YA 1ISMA 1PR1A 4ZZ2A 3BE5A 4RZQA 5CTAA 1M8KA 5DK6A 3LCUA 4IOKA 5H9VA 1TPYA 3BTUA 4MJXA 4YY3B 4HFNA 3GA0A 4Q9IA 4OOVA 4MVYA 4WK2B 4YDSA 2IY7A 2G5CA 2GR9A 2HGZA 5H4HA 5IUNC 4XR9A 4V0NA 3RY8A 2QYTA 3QYFA 4QVIA 4BE7B 1M3SA 1NG9A 1UBJS 3LUGA 4E22A 2EL7A 3N0TA 3EVNA 3N2YA 3FRIA 5EXPA 5HPYB 3B9RA 5ENDA 1PR9A 4DUGA 2H2DA 2X0EA 1DRWA 4C1NA 4Q7LA 2VDKB 3P96A 3O1IC 3NYIA 1BQEA 5KVCA 3ZU5A 3CPWB 2O50A 4BMPB 2JLQA 3PQCA 4JP8A 3X1MA 4GLJA 4X7DA 1JFLA 1OZGA 5FOSA 3HL0A 4X60A 4DC9A 2OCGA 2XUAA 3LNCA 4LDAA 3T0GA 1KARA 1M7BA 4YJGA 1SOWA 1W46A 3BORA 1FFGA 4E21A 2REQB 1JDPA 2Q5EA 2BE9A 3OQ6A 2EKPA 3DZ8A 3AL0C 3F78A 3AHHA 3Q40A 1UPTA 3NJRA 3MERA 4LHEA 1ZX1A 5HJ2A 2JFPA 1W34A 1WPGA 3DL4A 4LYYA 3RIGA 3OF5A 4C78A 3KVRA 1W35A 3AF2A 4R98A 1B43A 1Q92A 2AOWA 4TXNA 4YBZA 3AFIA 3AR9A 3UT0A 4NE2A 1MGOA 4AP6A 4BX9A 3ICQB 3WMGA 1LQ2A 2RI1A 1UZNA 3A3KA 3BULA 3QPAA 1F6WA 1JFRA 4XYEA 5LOVA 4P0PB 2BGGA 4Z4RA 2M32A 3HMQA 1FS4A 3KQHA 1DP4A 3E05A 1DIBA 3DZDA 1JHUA 3PL1A 1G1MA 4L5BA 3ZYCA 4ENUA 2ZLBA 1DO8A 1K92A 2HWXA 4YJKA 4LOAA 2G0AA 3JX9A 4NOLA 1D5WA 4MK4A 5GADl 3KAJA 1K8QA 5BSWA 1O97D 4FK8A 1QGOA 3W1EA 4RPBA 5HFAA 1MOZA 3KYIB 2PO5A 2BEKA 1TM1E 4B85A 2AD5A 1RBQA 2A1IA 2AN9A 4EYSA 4U9UA 2ID4A 2A3RA 1L6RA 2FSVA 4PGMA 1NZJA 4OLAA 1C3OA 2JVJA 5DGDA 2ZYAA 4YQYA 4E5YA 1EUYA 3SSOA 4BVLA 5HWSA 3WWDA 3IOBA 2QN8A 5EQDA 4PLTA 1Z4PX 2X4DA 1AKUA 1RHUA 5LZ5A 3BGWA 3K35A 1NJSA 1WHTA 1H2XA 2ZJOA 4PZCA 1E3DA 4QYIB 2DP4E 1XP5A 2X0JA 1I1HA 2XKBA 1OHHD 4AUEA 4XQ9A 4B71A 1V6SA 2TECE 3CLSC 4Q19A 1YJCA 3MJDA 1MN6A 1EGQA 4DDVA 3S5JA 3JQEA 5EKSA 3BD8A 4WXRA 4W8HA 1KETA 4WCFA 1XLTC 1NUAA 2A7XA 2ZCUA 4AZ3A 1RZRD 5JH7A 2BKXA 3R1IA 4MLPA 2IXDA 5TQ0A 1W49A 2WMDA 3RYFB 3OCZA 4IFTA 1RM4A 1K8RA 5JIBA 1PKEA 3IT0A 2C99A 4OLJA 4EHJA 1T13A 3KOYA 5DO9A 3OZBA 5IK2A 1XOIA 4KIGA 4KXYA 4HN4B 1LWOA 2CEKA 3VJRA 1KAHA 5I7RA 5KWVA 4Y2YA 2Q6LA 5CW1A 4EITA 1L4GA 2VL7A 4EWLA 1R0RE 5E0OA 1P33A 2BMDA 3WFZA 2VPWA 3IR6A 3RC7A 1SZPA 1LS6A 2GK7A 1SOAA 3QFCA 2VSNA 3ZHUA 1BX1A 2AFIE 1A8QA 1J1ZA 1FMTA 1M2FA 1PJAA 4QE3A 4DT1B 4EY5A 5IM4A 3UCXA 5K8IA 3TQOA 2J0SA 1D4AA 4ND3A 1NBWB 3QNUA 4CJXA 3WGIA 1JLSA 3EXAA 1G64A 3SKYA 4LPSA 3WL5A 3A06A 4FHCA 2ZYVX 1WDLA 2IFTA 4IV5A 4YAJA 4OHOA 5J3JA 1ZN9A 3B2NA 5FO0A 1DPGA 2QW1A 1QH8A 2YOFA 3WMEA 4MRSA 1V8PA 1JDSA 4KNYA 4KFRA 2F1KA 4RH1A 2BH9A 4B3SB 1ZIOA 1VRVA 4URXR 1L6IA 1ZU5A 2YWJA 3WKDA 4DIEA 1T15A 1M8PA 4LX8A 7ABPA 3N8DA 5FLXA 1SB9A 4QYMA 4WKNA 1QTRA 3OTOB 4MYDA 4OIMA 1YZVA 5DW3A 1S7CA 2O3JA 1R9GA 1E6WA 4OM7A 1Z4QA 3CGGA 4IRXA 4REOA 4U7TB 2VNKA 4LBYA 4TZ0A 2XWSA 1J39A 4BLSA 3HK2A 3F6YA 2ZB7A 2VDPB 1SB8A 3Q39A 5CBPA 5C1BA 3C3EA 2GBIA 4ARUA 3RD5A 2AZ4A 3COJA 2WIKA 3WGQA 3QWIA 3ZV5A 1N6OA 3WJ7A 3H5VA 4BTLA 5K0NA 3L1UA 2C04A 3SBDA 3T5BA 4EKDA 1NVVQ 2EKBA 4JBHA 4JVNA 3S27A 3PUMA 2XYHA 3FJYA 1L7PA 4PR0A 5EZYF 3ZHTA 3VX3A 2OTJB 4Z9FA 3KXPA 2WG1A 1UKEA 2VYQA 1AM4D 4ZWNA 1RWXA 1FX1A 1ZVMA 5F4ZA 5CEJA 3RFFA 1AQUA 4YJGB 3F47A 4RJ2A 5C31A 3WB9A 4X45A 1Q0PA 4OKNA 1FXSA 2FKAA 1JE1A 4XN0A 3NTQA 1YUNA 4Q02A 3IJEB 3BN3A 4QXPA 2FA9A 4MVWA 2FZEA 4EGJA 5IJAA 5C8ZA 2HT1A 1QRDA 3KOZA 4HUTA 2B98A 1TO6A 4U7PB 3OURA 5FKJA 3BKWA 1OAKA 2NZYA 4DTIA 2GCNA 2AC2A 2F3UA 4PWYA 1FDSA 3HE3A 3LLCA 3O4VA 2Q3MA 3VU8A 3KYBA 2X8BA 5LOVB 5KREA 4HN9A 4HVLA 2ZRKA 4CETA 4M2LA 3HPRA 1GNPA 4C4TA 1VJDA 1TM5E 2EEPA 1HNNA 5HDBB 5C8YF 5DWDA 5DWQA 2PUEA 1XU7A 3Q85A 2EKQA 2Q28A 3IPLA 4ZGBA 2WU8A 2M1ZA 4L2IA 3HR8A 3C7KA 3N9IA 5FPPA 3M1LA 1CQZA 3QV2A 4DIMA 5I45A 1TCCA 5IXYA 3Q3IA 4QJIA 1AU9A 5P8WA 3U13A 4F9FA 1QHFA 3D5QA 3GHYA 3EY4A 1C3OB 2Q45A 1X1DA 1U5CA 3OIFA 4MCJA 4P7GA 5F9FA 3JW8A 1CIPA 2FEWB 1V6CA 3FNFA 3RJZA 5C46F 2C2XA 4QREA 3T61A 1R6DA 1W5EA 2B7CA 3C4QA 4UVHA 4WKPA 4XOIA 1FVOA 1WHTB 1ULBA 3MAAC 2CRVA 4P2NA 2QTMA 5IAGA 2C2WA 1KD1D 5TPZD 1EH5A 1P1CA 2YDXA 3PRHA 4IXNA 5TC4A 4N03A 4Q3DA 1RYZA 2QV7A 1DEOA 1XPUA 5FWYA 4OG2A 4AZ3B 1U8AA 2VDJA 3M89A 3E58A 5JH7B 5TQ0B 1CXZA 1OA0A 1DSSG 2GBCA 4DMHA 4P81A 3G9ZA 5FORA 3WBBA 2AXPA 2WV7A 2JFOA 4INJA 3W5BA 2KE5A 2O5CA 4ZAXA 5CLQA 4N41A 1AK9A 2NUPB 2FQWA 2BOVA 4W5TA 4IZ6A 2WINI 5CK5A 1PJBA 5B1HA 4CL0A 3L40A 1QFSA 1ZXLA 2E49A 3DG9A 4WFKA 1Y1PA 4Z86A 3BJEA 3VOAA 4BVKA 1EESA 1L5VA 1N2OA 2J4FA 4YP1A 4WVLA 5ICMA 1U1GA 2QZJA 3DYBA 3H1FA 2D1RA 2OT3B 1OYOA 4HNAA 4UVEA 4ZPJA 1U8UA 4DZZA 3AINA 1X7ZA 1YX2A 1L1EA 1LS1A 1S2IA 1WIWA 2E21A 1X9HA 2FZ5A 4QATA 4US1R 4BNTA 4E70A 4EG6A 5IUJC 1QSGA 3K9FC 4ROTA 3CMCO 3UYKA 2ORVA 3I92A 2GCIA 2X41A 3RC9A 3HXLA 2FNAA 3EIUA 2X9QA 3MJRA 3RFVA 4ZV4A 4ID9A 4BX3A 5BQXA 3IAS1 1S72B 2CFSA 2R4UA 3A6FA 5BSXA 1AKVA 4H7HA 1FW8A 2WZBA 5BW6B 3VTKA 5KB3A 1FJHA 1G5QA 4MA4A 3N39C 4Y6SA 5H3CA 2XF2A 3VOBA 4PPFA 2ZCJA 2XMCA 3P2IA 4J9UE 4RJTA 4PRYA 4KWTA 2OXRA 3IULA 3UV3A 4D82A 2C03A 3L41A 5AVRA 2YCBA 1H8HD 2RAVA 3PWZA 4R2LA 5ERGB 5J9FA 3UMVA 4MVJI 4CIYA 4IEFB 3SE0A 5CBPB 1JIKA 3P26A 1TI7A 3BK2A 2CUTA 2WUVA 4HGPA 4ZP1A 2AQKA 3FD8A 3KPWA 1S2GA 1U0OC 8MHTA 4EB0A 1P0FA 5CGQB 1CZOA 3A6EA 4X94A 2RARA 6GPBA 3PE6A 2FPLA 2XWBF 3WX0A 5HF5A 5I9IA 2Y6VA 4XL9A 4AYWA 5BSEA 2H9IA 2R6AA 2YZNA 4L08A 5HA5A 3TKLA 2AN4A 4OUKX 1UPXA 2ECQA 1TT5A 5BMVF 3BL8A 2ODPA 5H70A 1XLTA 4QL3A 4NPCA 1MQ8B 5E38A 3VM6A 4Z7OB 4NENB 3AVQA 3EW9A 1JSLA 3SMVA 2HHCA 1DC7A 5JBQA 1IH8A 3FNBA 3BK1A 1E2DA 3HUTA 4GPIB 3RJMA 4CI9A 1AY0A 3AOEC 1UMKA 3QTLA 3RVDA 4S3MA 1S01A 4C01A 1ORDA 3H87A 4ZTZB 2PXXA 5BY2A 4BFVA 3DZKA 2G40A 4Q1VA 3BL6A 1DX4A 4DSZA 1K7FB 2W2QA 2NU9B 3A2NA 1DWPA 1ZD9A 3KWLA 2XR1A 4PNHA 1J2RA 2NM0A 4GLLA 5BYAA 5GOTA 4XLZA 2CVPA 1G291 4GECA 4K6OA 4OB7A 1E5QA 5IHXA 1VSBA 4JJKA 1MC8A 2H59A 1UODA 1P91A 4L2IB 4NCXA 2CCGA 4QVKA 3WYNA 3WK5A 4BNMA 3ACBA 1U7UA 1WKVA 5F4MA 4BVJA 5JADA 4EQZA 1JS1X 3MELA 1CFJA 4MW5A 4KZKA 4NARA 1JH8A 3ASYA 2PKCA 3CKYA 5LQDA 2ICAA 4JR2A 4JUAA 4YCAA 1E6UA 5AHWA 3LT5A 2PNJA 3MG9A 4H1HA 4P34A 3CZPA 3UXHA 2HU7A 3P9ZA 5CNKA 2OORC 1PK7A 3E5NA 1YJBA 4CIVA 4C0HA 1RCTE 1AF4A 3I5UA 4GR4A 4Y30A 2LW7A 4BMVA 3DB1A 2X5KO 5BV7A 4A4DA 1GM5A 2R751 2W2LA 1ZK0A 3JPWA 3EPHA 2XNCA 4D43A 3X1KA 1OPXA 4EFKA 3CVYA 2O8CB 4PAAA 1F3OA 4JC4A 3QXHA 3KD2A 3BD7A 5CXQA 5JCOC 1RACA 4FR2A 4W1PA 3R9IA 4AUNA 3UMMA 2IBMA 3G49A 2V6BA 3D7RA 3OE5A 4P4SA 4CTNA 4QU0A 3TFWA 5E4JA 4RFVA 1ODSA 1V8ZA 1Z08A 2FVYA 3ZDCA 1NASA 3A32A 1T5HX 4I1PA 1THTA 2CMGA 3PP8A 1U7PA 1ZIDA 2HUPA 3HNPA 1ADBA 4ILKA 3EA5A 5GONA 4XQFA 5J47A 3TQRA 3JALA 4OMDA 4TS3A 3ZDEA 4JXZA 2I55A 1NE7A 4QFMA 1X77A 3MWEA 2HA4A 1Q7RA 1K2VN 2PIDA 4K9MA 4LPKA 4CV0A 1IMOA 3FWZA 5B37A 2WE7A 4AMBA 4XMYA 1U2TA 3T4EA 4ETWA 2QJOA 2PKQP 3NV9A 4GU5A 4HNAB 1SVIA 2J85A 3VNSA 1HE2A 4IG4A 3RADC 4HNTA 3CRZA 3L05A 3BJIC 2WJVA 5H9WA 3PI7A 2JEYA 4RVOA 2XE6A 2P6OA 4LK2A 4LDQA 1NRWA 4UBJA 1C1XB 3D3QA 3GZJA 3HZOA 4G5SA 4MUJA 1XZIA 5CYGA 1OJ7A 1LBQA 1F7UA 1RTTA 3R7AA 3MXTA 3ZQ6A 3RAPR 4WASA 4CGYA 3HDYA 4ZDKA 1ENZA 1YZ3A 1J0CA 2PVPA 3PDJA 1TZKA 3GH3A 3W7AA 4KGZA 5K8TA 1YA4A 1QVAA 1KO4A 2B7LA 2BEUB 1M34A 3L2OB 1MFPA 2FMXA 3BFPA 3EPPA 3LPDA 4L8VA 4NYIR 3R6DA 4EKEA 2PN1A 2I9PA 3HBNA 2XZDA 1E1RD 1EDDA 2RBEA 4H6VA 3SIXA 3V8EA 1ISSA 2ZE6A 5JRDS 1XVIA 3RASA 1TX4B 3ZI4A 2NZ2A 5DE3A 1AX9A 3QOYA 4YYZA 4WPGA 1RD4A 5BUZA 5K2MA 1OXKB 3RF7A 1XP8A 3H1AA 3KQOA 2X76A 4BTVA 4R2WA 1J8YF 2QMOA 2VRWA 3SZ3A 3FBGA 1YS2X 2EBHX 5AVSA 3G9XA 2IXBA 3N2LA 3M1IA 3FLEA 4O2LA 3QLEA 5JNVA 1KBOA 3KEQA 1HX7A 3DHYA 3BXGA 1DDOA 4IJKA 2YJ6A 3K09C 4BNNA 4LX0A 2ZSJA 1AB6A 3INGA 5M7EA 2JFUA 1UK7A 1VKNA 2HWYA 4XAQA 4LBZA 4P4UA 5IMBA 3SJUA 2UZ0A 3HAGA 4DMLA 1WXWA 3Q38A 1PNRA 3GD7A 4HNHA 5FFFA 2B3TA 3CESA 2FXVA 1Z9BA 2QI9F 2WM9B 4MI6A 3ZDBA 4YYEA 2ONCA 1EJ2A 1ZFNA 3ELYA 4Q4DA 2NSLA 3SOPA 1XDSA 1YDFA 2FSSA 2FETA 1WF3A 3LA8A 1A9ZA 1XNGA 5A02A 3SVTA 2RK6A 4R1SA 4RACA 1ZRMA 3T8YA 1CVIA 4F86A 2YBDA 3OEHD 3DD5A 5KYGA 4DB2A 3WLFA 1BN6A 2VH5R 4OJNA 3T7RA 1L5LA 2C9ZA 4LNUB 1KQNA 3EFOA 2BIFA 2VJCA 4G26A 5EJ6A 2FDXA 2JHCA 3QI7A 1CQPA 3JV7A 2H54A 2GXSA 1XAGA 4HWSA 4DFDA 5DHSA 2CNKA 1UZLA 2O7NA 4Z4GA 3TGLA 1GG8A 2PWPA 1BH2A 5HQ3A 2V7VA 3IO5A 3CPHA 2AR0A 1R5NA 1M6EX 2H7YA 4MIKA 1NN5A 4QWMA 5FUBA 5H82A 4GI5A 1JZTA 1JR3A 2RH4A 4OQNA 4PYMA 5AOAA 5B2FA 1NF3A 2QJWA 3RGGA 1VPEA 4LKOA 4YJ3F 4P80A 4G5HA 4PLFA 4DCUA 5LZ2A 3FCUB 1VDZA 2JJ2D 1MORA 4OJKA 1VMKA 2DPMA 1NYQA 4K9RA 4D8TA 2WUEA 2H1SA 3F1LA 4LTNA 3E2IA 1SHTX 4I4NA 3W8RA 3WJ2A 4L8YA 3AL2A 2G88A 4C5AA 1FTQA 3AR4A 1DAMA 4LF9B 1A69A 1TJNA 2VBSA 5JJBA 3JSAA 1C0LA 2TMYA 1MX1A 5FTKA 1T2EA 3U4GA 3KAKA 1G8JA 3G7SA 4N7MA 5NLLA 4F04A 4WECA 2DFLA 2IYZA 3E18A 3FUVA 5D1HA 2GNAA 3ABQB 4A03A 2O8NA 1E2MA 3HPQA 3NDIA 3TRFA 4LJ9A 4V0OA 1EEXB 4BYGA 3QPWA 4K8RB 3OU7A 4IIEA 4UHCA 2IZ0A 2ACEA 1NVGA 3A11A 1GRQA 1ORHA 4BMCA 2V7QD 4P4SB 4O2BF 3P8ZA 4LV8B 2YHIA 5KPJA 4GKBA 4V2UA 1EJ0A 4QHSA 1F5SA 4JLDA 2AG0A 3PFHA 2ZWVA 4B2PA 4NOJA 1NB0A 1KU0A 2XOKD 2PGDA 1WXDA 2WJPA 3E53A 3JALB 5GONB 4CR8A 3NRJA 3O92A 1GPWB 3MWEB 1VQ5B 1YNOA 1IXKA 3B3GA 3CLKA 3AOEA 5AK5A 1ZKDA 1PZEA 2O2IA 4TQAA 5A6SA 4YPFA 2ECOA 1BDHA 3MQ2A 1PJ4A