1FRNA

The involvement of ser96 in the catalytic mechanism of ferredoxin-nadp+ reductase: structure-function relationship as studied by site-directed mutagenesis and x-ray crystallography
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYVIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Involvement of serine 96 in the catalytic mechanism of ferredoxin-NADP+ reductase: structure--function relationship as studied by site-directed mutagenesis and X-ray crystallography.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase (nadp+(a),ferredoxin(a))
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 96
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frnA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frnA02
2D74A 2BV3A 3W5VA 4P3YA 4AF7A 2BF4A 4TMXA 1JB9A 4TN1A 2FX3A 2NPFA 3ZZ0A 1GAWA 4M2LA 1EFUA 3CCMB 3AVVA 3QSYA 3OZWA 1SM4A 1GVHA 3J81k 1QGAA 3G4SB 4ACAA 3A1FA 4AC9A 1EFTA 4RCZA 5AN9A 1OB2A 3AVYA 3CCUB 1M1KD 2DEUA 5TY0A 3V76A 4FN5A 1OGJA 1K8AD 4TMZA 4WQMA 3QFSA 1HA3A 4DQLA 1W2BB 2VNJA 2QN6A 4RD6A 4Y7CA 3CCEB 1VQMB 1Q82D 3CRZA 1TTTA 4Q7JB 4ZCIA 1G7TA 1E64A 4Y9RA 3JQRA 2QMUA 2QDXA 2YWFA 1H42A 3CB4A 1QFJA 1CNFA 1FRQA 2PIAA 1KTVA 1F60A 4N3NA 2HCJB 4QHYA 3B78A 5H5JA 4ZGNB 1S0UA 3OW2B 1ZUNB 2BVNA 2AHOA 1KK3A 1GO2A 3AVWA 1EP1B 2EFGA 4F7DA 3U6KA 1B2RA 5TV2A 4RD3A 1DARA 3MMPA 3MHPA 1N0UA 4ZCLA 3WNCA 3CCRB 5KSWB 1QFZA 3AGQA 4HE5A 1A8PA 1EXMA 3P27A 1M90D 3CCQB 3WNDA 1YJNB 1DDIA 3AVTA 4TMWA 2BSAA 1J9ZA 1FDRA 1TLLA 1XE1A 3SJZA 2BN4A 1KQSB 1G7CA 1BJKA 1QVGB 1B23P 2YWGA 1NJID 4LBZA 4RD0A 1KC8D 1VQ6B 1BQEA 2XNCA 4RD4A 1E62A 1YHQB 1W35A 1W87A 4IW3B 2YWEA 1EFCA 4M0LA 1JNYA 2DCUA 4TMTA 3W5HA 3U2QA 3W2FA 2BGJA 3QFCA 2GPJA 1ZM9A 1W34A 4FK8A 3WNBA 4AF6A 4B47A 2QTLA 2OK7A 1YITB 2B7CA 1GJRA 5THXA 2HMAA 5TR9A 1VQ7B 1VQLB 1QFYA 3CXCB 5HXBA 1JA0A 3AGPA 4M1KA 4PC7A 3QFTA 3WBKA 1GAQA 1AIPA 2CNDA 1K73D 3CMEB 1VQ5B 4G1VA 5GV8A 1KK0A 3JQQA 4YHBA 3I1FA 2BGIA 3ZBUA 5EMNA 2PLFA 1YIJB 1KJZA 3FJOA 3CCSB 1VQ8B 2C77A 2DETA 1ELOA 3CCJB 1EWYA 2GQFA 5DSZA 1QX4A 4Y9UA 1ZM2A 4M53A 1YJ9B 4RD1A 3WYAA 4RJLA 2VZLA 3CC7B 3E20A 1IJEA 1FNMA 3I56B 1OB5A 1FNDA 1R5NA 4RD2A 4C43A 1S72B 4ZCMA 3WXMA 4PGOA 1VQOB 3ZC3A 2XNJA 1IJFA 3B8HA 4C0SA 1GR1A 5JBQA 4HE6A 4NCNA 4ZGQB 4B44A 4RCYA 4NBSA 4BPRA 3WBJA 2ZITA 1G7SA 4PC3A 1NDHA 2BM0A 2RC5A 1YI2B 1Q81D 2EIXA 3OJWA 3P26A 3CC4B 1VQ9B 3VNUA 1EP2B 3OJXA 3E1YE 4N3GA 1QG0A 1XB2A 3W5UA 1ZM3A 3QFRA 1G7RA 2E1RA 4YAWA 1R5BA 4YAUA 3CMAB 1QH0A 1VQNB 3LRXA 1FNCA 4DQKA 1YJWB 1D1NA 2VNKA 4B43A 1QGZA 1N0VC 1JA1A 2OTLB 1H85A 4QFMA 4B4DA 2BPOA 1VQKB 3LYUA 2C78A 1QVFB 1UMKA 3JQPA 4YAOA 1Q86D 2RC6A 3VNVA 3G6EB 3OZVA 2OTJB 3PENA 1ZM4A 4K1XA 4P6VF 3VO1A 1D2EA 4EH1A 1JJ2B 1R5OA 4YALA 1SKQA 1FNBA 4B3XA 4R71A 3FPKA 3CCVB 4LBWA 1QUEA 4M4SA 4ACBA 3AVXA 2X3UA 1KD1D 3B82A 3U6BA 1CNEA 1FRNA 1IB0A 2DERA 3AVUA 2PMDA 3W2HA 1U2RA 4B48A 4MYUA 4G5GA 1OGIA 3ZZUA 4PC1A 2J7KA 1CQXA 3CW2A 3ES9A 2YWHA 4PC2A 3CPWB 3I55B 1KK2A 3CC2B 4LC0A 5GV7A 3OZUA 3MCAA 2QEXB 3CD6B 4LBVA 2VNHA 2OK8A 1BX0A 3W2EA 4U9UA 4LBYA 3LO8A 1KK1A 3ZBTA 1TVCA 2B7BA 3W2IA 1WDTA 4MYTA 3W2GA 2QA4B 1QGYA 3G71B 3ZZTA 1D8TA 3QE2A 4YAFA 1F20A 1VQPB 4ZV4A 3LVBA 2XEXA 4TMVA 1EP3B 4H9GA 2BM1A 3VMFA 1K9MD 5FA6A 4UAJA 1QUFA 1E63A 2VYQA 1KRHA 1VQ4B 1DDGA 2QTZA 1DG1G 1TUIA 4FWTA 1BX1A 2DY1A 2CRVA 3WY9A 5H59A 2BMWA 4J0QA 3VO2A 1Q7YD 2VNIA 1I7PA 1AMOA 3CCLB 2R6HA 4G1BA 1N8RD 2B5OA 4PC6A 2HDNB
chains in the Genus database with same CATH superfamily
2IYAA 2ZIXB 2X15A 3UC5A 3FMVA 4DTIA 4W5OA 1S8FA 8ADHA 1CZKA 1Z4IA 4I14A 4MWEA 3ORSA 1GL9B 3VJMA 4UHCA 1GUDA 1ZCFA 4S1PA 5AJXA 3GT3A 3CZAA 5AVJA 5SZKB 1DT3A 4WZAB 5AIAA 4AO6A 2HMVA 2XIJA 2O7VA 1JU4A 3LT4A 5ED0A 1XX6A 1N3YA 3P71T 4UBKA 2GZSA 3B9BA 4RJIA 3VTKA 3RAGA 2PJDA 4OU4A 1W5TA 2ZUCA 3VZDA 4PG8A 2JLYA 4QEDA 4ZVQA 3F49S 4HAYA 2R1TA 4BNLA 5CCEA 4TTQA 3EEFA 3LUKA 3OT4A 5CVCA 4HGPA 5JARA 1HO3A 1V7PC 3WWZA 1EP9A 1HTWA 1ZI6A 3UAZA 4DHWA 4ZI7F 1FYEA 3WGKA 5ALXA 4F6CA 2HJWA 2OAGA 2I34A 2XE8A 3PC7A 1C2YA 2UZ3A 3F46A 4R7TA 1SM4A 3IUBA 4DM3A 5AQ1A 3SVLA 2HBYA 1Z7EA 4NCJA 3SG0A 3IA2A 3ELUA 4F6LA 3CSDA 5G2OA 1JILA 1POWA 2W2LA 5CUQA 1QQBA 2DPHA 3HACA 3QMWA 1UOPA 1YA8A 4LRXA 4PBRA 4QWMA 2OSBA 1EH5A 4JYBA 2VYVD 3TGPA 2RH5A 2Z2YA 1SCUA 3GGCA 5EPUA 4MKIA 2QA5A 4W9NA 4XW2A 1P29A 4QOGA 5EKUA 1VE5A 1ZGAA 3EIXA 3SHQA 2E5WA 1B6TA 3ZDZB 3F5FA 1X80A 3ETCA 2CHUA 5TEWA 2AQ8A 1SKAA 4ZFNA 1EJBA 1PEDA 1NC1A 2BM9A 2J0VA 3MTQA 5TY0A 1U8EA 1WDKA 2K7ZA 3AINA 3H9QA 1G5RA 3VJRA 4V3CA 4F3RA 2GNOA 3GMIA 4LCBA 3AI7A 4IZIA 4YLEA 421PA 2DSNA 1T6XA 1NLZA 2P2YA 4GMFA 1TMGE 2ZANA 1UK9A 2CDNA 2GBIA 3NTLA 3W1VA 3GSIA 4F71A 3CN9A 3IPXA 4DIDA 1K1EA 1F4LA 3P1JA 2BR4A 3GJ7A 4Y7CA 4JC5A 1BDBA 1SU4A 2AOXA 3GV0A 1WX1A 3H2YA 1BVRA 4HQRA 4TROA 1UC8A 1GZ6A 1GOTA 1I0LA 3AR8A 4U6NA 5DB4A 3U1TA 4BFTA 4C7VA 1QZZA 4A2CA 3P2YA 4RPIA 5K3FB 1BFUA 5FBLB 1CRPA 1K6JA 3O1JC 1N2OA 3BX1A 3H9GA 4G5QA 2OORA 5K1ZA 1L7AA 1LLCA 1I1QB 1P1IA 4I1UA 4Q4AB 5KNCH 3EBLA 4JBNA 5IDQA 3TLGA 4PQRA 1SHKA 5IVDA 3M6WA 2ZR9A 1AA9A 5G02A 4JI1B 1JXOA 3DLTA 1B1CA 3GUCA 4BC1A 4ZOCA 4JOBA 2B0JA 2Q21A 1J23A 3AY3A 3PYMA 3W34A 4F93B 4MV5A 2WE8A 4WNAA 3V8BA 1WUTA 4BO1A 1K68A 2FN9A 4J9VA 2CDAA 2KW5A 5HIJA 3MCVA 5FOSA 1DAMA 3CIOA 2I6QA 1ZUNB 1R0ZA 4PCUA 2V0CA 3AEQA 1A2KC 1QIDA 4BFYA 1E7WA 1XRMA 3S7ZA 4JEUA 2RG1A 4B71A 5A2GA 2QU8A 3DTVD 2XVYA 5LOVB 5F1OA 3NDPA 1I7SB 3KAKA 2XUOA 3AG5A 1SNYA 1K7FB 1JVBA 2RGNC 1Y1RA 1YJBA 4QGSA 3N2LA 1E3XA 2I3GA 4AS3A 1JTFA 5KTOA 1UKYA 4J0KA 5M29A 1YJ5A 4KPYA 1FYDA 2VHTA 5CITA 1UBGA 2CDCA 2WSLA 2AFIA 3TS1A 5FT9A 2C31A 4LY6A 1JTVA 5D01A 4K9DA 2AE1A 4J03A 1USUA 3FBTA 1T1JA 3QWHA 3VSBA 4BAGA 4F72A 1WBDA 2GCNA 2O9JA 1XVIA 3D2BA 3V1KA 3GJXC 4UE3S 1W6UA 5CLGA 2CNOA 1V8FA 4W5RA 1A8PA 3P9QA 4KXNA 3HGQA 1M90D 5ILQA 1KKUA 3VOSA 4B3TB 5K5EA 2JFHA 2FH5B 4LMRA 5ALTA 3AVTA 2CYBA 2V1UA 1KI2A 2BEKA 1DO8A 1SOVA 4F6RA 3F5MA 3IE0A 1K2VN 4MQLA 1JPVA 2NADA 1H9CA 5LZ8A 3HSKA 4H3KB 3W5DA 4LF6B 5C1BA 1KI1A 3EDRA 4EVSA 1Q5PA 1Z8DA 4O33A 1TFUA 1N7GA 1Y6RA 2VEOA 1Z5PA 2YOFA 2Z2IA 3BTSA 3NBAA 5KQGA 2FUG1 3P52A 4EGCB 3FWNA 5LQKA 2NZUG 1Q2XA 1LPSA 1BEUB 4RD0A 1L3IA 2B4TO 3K9WA 2N1BA 3SX0A 7YASA 1KC8D 5I7EA 4G81A 1ZUD1 3ORHA 2AW5A 4J6FA 1MG0A 1VKJA 2QX8A 4RDCA 2IUFA 4Y2JA 2YKGA 2X5OA 3BA1A 3KALA 1UBNA 2H51A 3C1AA 1OFIA 4IW3B 1EEHA 1XQVA 2YL2A 6PFKA 3J7TA 3NTRA 3R3HA 1K6IA 4N3AA 2F00A 5JANA 1FVXA 1JNYA 1NN0A 4JQOA 3D3QA 2FEXA 1DMSA 2GMWA 3MAGA 4Y2YA 3WQSB 2EKLA 1I7QB 4OF4A 3LPDA 3COYA 5FFNA 4WL0A 1QIEA 1CW2B 2PSSA 5HZBA 1J33A 2VUUA 4NV1A 3ZI7A 4LC1A 1LB1B 1TW2A 2A59A 3MM4A 1Y5RA 5JS8A 1GSOA 3UV3A 4MKFA 4MVJE 3ZW8A 4LJ8A 4POOA 3L1IA 1A9YA 3USES 1DWOA 4D0NA 1WD5A 4RZQA 1F8UA 1DIAA 3AR7A 4IGIA 4KQHA 3V48A 4HDRB 1X1CA 3ZGXA 4BNFA 1R6UA 4CIVA 2P7IA 1EVIA 2W00A 3SHVA 5JASA 4HMOA 3DB1A 1A9ZA 1BZYA 4Y30A 5ALSA 4N0DA 4CUZA 2I7VA 4ARIA 4QYIA 3KTFA 5HS6A 5JZBA 2O2CA 4FEEA 2NUTA 1F3LA 3SZ3A 1UBHS 5CA1F 1KNQA 1J24A 4U02A 3FPJA 1TUGA 1DIRA 3B6KA 1DX4A 2JFXA 3LYLA 4M88A 4UJ5A 1TJPB 1A82A 4AZTA 2ES4A 2XH8A 3H5RA 5C8YF 1OILA 1DHRA 2WJJA 3JYQA 2P6UA 1JA9A 4D79A 4FIDA 2FN4A 2J30A 3EXEA 3HFSA 4LGVA 2J3QA 1BOFA 1EZ4A 5DLYA 4KQGA 5C7YA 2WHPA 1YUNA 1F17A 1P8JA 2W6JD 3DZIA 3FJ1A 3I9OA 3NG1A 4CQNA 4JP5A 4WLOA 1NFFA 3HI4A 4FMCB 4MS1A 4HQKA 2O59A 3MTGA 1TRKA 3ZW9A 1OSNA 2I8CA 2J5QA 2DBYA 1CS0A 4CHGA 5JDCA 5B37A 5L45A 3EVAA 3RC8A 2IEIA 3FYTA 3D9QX 2P8SA 4QXOA 5L7WA 5BW6B 2FN7A 4OP7A 3MUNA 1S8NA 3LHSA 2OE2A 1N5DA 3ZV6A 4CLHA 4DUGA 1BDHA 3U61B 1V9SA 4MR9B 1ZM2A 3KJZA 5D3ZA 3NX4A 3NZEA 2OYRA 1QKKA 3JWIA 3RUHA 1ENYA 2JIZD 3WAJA 5JRJA 2OQRA 4XGQA 2IHNA 1LLDA 1FK8A 1XQ6A 4L5YA 4KXLA 3EE6A 3WWOA 1BRTA 1TZMA 2V3WA 3CPXA 4R3UC 2IPOA 4L4YA 1J8MF 4QUAA 4FE7A 3T5CA 5IDWA 4R98A 4UAGA 3K35A 4S1WA 2WTUA 3CWCA 2XB2A 3A28A 3ONVA 1KPIA 4JGIA 5CURA 1OKKA 1PT5A 2DCMA 3RYTC 2OZLB 5A4KA 4AYXA 2CLOB 2VDMB 3PSAA 4RDHA 1SAYA 4RS4A 5G0WA 3AHCA 4RPLA 1N1DA 1OASA 1TYAE 4INAA 4WLFA 4L02A 4P31A 3ISJA 3IPAA 3PHGA 3KBBA 3QOXA 1QYIA 1FS5A 4G8DA 3VXKA 5CLFA 3GLIB 1S01A 2ZZMA 1C7FA 3WXMA 1JIXA 3IEUA 5C31A 3ITNA 3QKRB 4L3OA 3EZLA 1QNLA 1JQLB 1GYRA 1SIUA 2ZJ1A 4J2HA 4UQLA 4AZWA 1G0NA 2X42A 3KB8A 4N0EA 4FE4A 4US0R 5FI3A 4E2FA 5JNUA 2MYPA 5AKLA 4ZGQB 5DSTA 3BE5A 3G13A 4P4TA 1M34B 1VHTA 4MUKA 2CV0A 4GP6A 2ZITA 4GGMX 4EI8A 1WXDA 2I2BA 1K97A 3HNOA 4UHEA 4ARBA 2SCUB 1N5KA 5LD2B 5IZCC 1VG0B 3U60B 5EVJA 1FUKA 3LI2A 3MINB 1E89A 4R8MA 5HQ3A 4JKYA 4II3A 2W6ZA 2IIPA 3ASSA 3EXG2 4WWHA 1DTWA 3VC2A 2EERA 2PL3A 5JC1A 4WV3A 4DK0A 3HJCA 3RJTA 4IH9A 1N32B 1K63A 4M37A 3TECE 3STUA 1KMHA 3TNFA 5U4QA 3CZRA 1T9BA 4JUDX 3D0QA 3QTTA 2MMCA 2Y1EA 3KYBA 1QG0A 1M1YA 1L1RA 1XP5A 1JEQA 1JHQA 5BR7A 1A77A 3NH9A 1VGVA 3UMRA 1MV8A 2I99A 1QU2A 4R51A 4BAZA 3ZCSA 2R87A 4I5DA 3UZUA 4RIEA 3OUTA 1VQNB 1J0DA 3DT8A 2A14A 3Q9NA 1E2GA 4XLTA 3U56A 3OX1A 5LOVF 3DLIA 4N7BA 4RULA 1DTEA 1HT2E 2V5AA 3H2IA 1SB9A 4DVJA 2HEIA 3OMWA 2EXXA 4GPZA 2C78A 1VJ0A 4IYJA 5AJWA 5G1PA 2GSDA 1TTQB 2Z2JA 4A8HA 4AL4A 1CUVA 3DBHA 2V96A 5AKIA 3TQQA 1HNZB 5BMVF 1SXHA 2EWMA 1EB9A 2PWYA 3AY7A 3IPRA 4E5UA 5E4FA 5LP6B 3TQIA 1EXVA 2ZAYA 2W6QA 2AFHE 3KETA 1BMFA 3TNLA 4P9SA 1O4WA 1XNGA 3Q9SA 2EC5A 4B0OA 3EYAA 4QVAA 1RWNA 2H31A 3UHAA 4QX6A 4XE5A 3BFJA 3WG9A 1GGFA 4C04A 4DSTA 1OBCA 4LDQA 4P38A 4BWYA 2UXDB 2UXBB 4Q47A 1KNXA 4NZOA 4OH1A 1E1CA 2JGDB 2X9QA 3V7WA 3NHYA 5CTJA 1NUAA 4AUNA 2YZ7A 5MGNA 1XAIA 3H5OA 4P4NA 2XUPA 4V02A 2GM9A 3UICA 3IIMA 1KOFA 2XOKD 3QV1A 1CNEA 5IULC 3WK8A 4WERA 5EHNA 1NY5A 1OHHA 1M73E 1Q0SA 2I6FA 2DERA 2NLOA 3LNCA 3PYLA 4N39A 4DXHA 5LQNA 1NP6A 1NOIA 3FROA 3H04A 2GETA 1C9JA 4OATA 4GKJB 1GUZA 4XYEA 1XZQA 2G70A 1SVSA 3DM5A 1Z4MA 2I4OA 4U6SA 4TL9A 4YC7A 1OGIA 3DKVA 5JXIA 5LXTF 1OU0A 1QOPB 5ED4A 5IJWA 2XCLA 1XJ5A 3GJZA 1HE4A 1PK7A 3HR8A 3VX4A 3BBPA 2BE9A 3HZHA 3NOXA 5BUCA 3RI3A 2YJTD 3OCUA 1L5MA 1NF9A 4FFWA 4K9SA 1CRZA 2CL6X 4BLQA 1K5HA 1J90A 2E4WA 2B69A 1AQJA 5JYBA 1OOEA 1XDUA 2COKA 4LBYA 1P6QA 2DRIA 2FHPA 2YJ6A 3PGKA 1MQSA 4Q24A 1L5HB 1TKRA 3FW1A 4EHIA 5FQOA 2ZUVA 5JJCA 1UEXC 5JS2A 1J8QA 1YS1X 3SD7A 3PE3A 1WABA 4OP3A 2OAEA 4RFLA 4H7IA 5BV2P 1W4AA 5TS2A 3ZV7A 1W47A 4G1FA 5LIPA 2WEKA 4LQLA 1L3BA 1DNPA 1YUMA 3D8HA 3MUOA 4D4GA 5FUMA 1BAPA 3TLKA 1RHMA 2QSJA 2ZL5A 1XXLA 4DLNA 1KYQA 3LCMA 2WOJA 1D8TA 3ZZTA 1I51A 1WV0A 1ZSYA 2ZR0A 3CYFA 4ZI5A 4ALNA 2PE5A 1VQPB 1GQFA 2JB9A 1WXQA 4GOJA 2QYHA 1A4XA 1DKNA 1U1EA 3Q8WA 5E6TA 4TMVA 1KI6B 4H18A 4RSHA 5JMWA 5KOHA 1PKVA 4EA6A 1GQSA 4H7JA 1E1CB 2ZT7A 3E23A 3V4ZA 4X3PA 1VIMA 3ED1A 4OA8A 1KI3A 2WIFA 3D1JA 3DBHB 1V5IA 5KINB 3IKTA 2UUCB 3WL6A 1XALA 1UKEA 4GWLA 5FDFA 4L9AA 4FXUA 1KY4A 1QR2A 2Q4DA 3DDNA 4EO7A 4JJFA 2HMSA 4YP5A 3DL0A 5KWEA 5LXTA 2JIPA 4IYRA 4D3SA 2KWIA 1ESDA 4U2CA 1UMBB 5BXQC 2VXCA 4UUBA 5KVAA 1IEXA 4AWBA 1GPH1 4XWAA 4J2TA 5JY6A 4BQEA 1GCIA 1VMDA 1RYFA 2DKNA 1VJSA 3UATA 1Z33A 4D0SA 2WIKA 4U9IS 4CM7A 5T6BA 5JI2E 2LXNA 1WPGA 1JT9A 2CNWD 3KZVA 1HFJA 1S3GA 1EHCA 4N9WA 2HA6A 3LXXA 1W5BA 5BN4A 1MW9X 4FQ8A 1P74A 1PG2A 2PS3A 2OD9A 3WQQA 2PBFA 1FMFA 2YWBA 2TSYB 4MIKA 3D1VA 1WV1A 4KITB 3EPHA 2QN1A 4IXTA 2F3QA 2EBHX 1NN1A 3JQEA 3MA0A 5DVZA 3T1QA 3AOEC 2AG1A 3JD4A 3OFSA 4V2UA 4DR1B 1NV9A 3EODA 1IJBA 5ICEA 4LXQA 4LY0A 5BOSA 1GGEA 2QLBA 5TMPA 1HURA 5H3CA 1L4LA 5AH0A 4QJIA 5AW9A 4PG5A 3SNKA 3E05A 3T3EA 3V33A 2EP5A 4NONA 4DLUA 1ZJ5A 2ZSFA 4HKTA 3TDMA 4MTLA 4B7UA 3KVRA 2E3JA 3C6XA 4V0ME 4EEKA 3AF3A 1R0RE 3WLRA 4NKRA 3TVTA 3FCUB 4YCSA 2WUVA 4IINA 4F2HA 5LNK6 3BZWA 2XMCA 1XTSA 2GN8A 2C2XA 2GH1A 1SMKA 3MMXA 4OHVA 5DBGA 4DIBA 4J94A 4JJ8A 2WZDA 4JITA 4X8MA 1V4BA 4M2LA 3HA2A 1CPYA 1IOVA 2AFRA 1H2XA 1N7HA 3WGOA 1CUHA 2Z2XA 3NEJA 3RS8A 2IZ6A 2V0NA 3OZWA 3SKVA 1CY7A 3FZGA 2FRVA 5D86A 2AR9A 3C97A 4ANFA 1NM5A 3C3WA 1LDYA 5LQJA 1RXSA 4BFUA 5CJPA 5M04A 1OLXA 3ULKA 4DV6B 1RQPA 3BL5A 4G65A 4QU0A 3QKIA 2IV3A 2XGOA 4AJ2A 4YMTA 2FYTA 4ZT2A 3RGWS 1Q0QA 1ZIOA 1ID8A 4OHWA 1UPCA 2P5SA 4YDSA 1IK6A 3NWOA 4ZI7B 3O8CA 3G0CA 1QZ3A 1TPZA 3AM4A 4M9CA 2ORVA 1II9A 3PRKE 2QD1A 1FFXB 1KYXA 4UUMA 1KHTA 1DBQA 5NULA 3RARA 1N2BA 1P17A 3ZCPA 3ADPA 2DEUA 1OAAA 2GJSA 4QODA 3SOPA 2QI9F 1WHSB 2N3ZA 4PXSA 3PCRB 2XMZA 4XIYA 5DGIA 4AB1A 4FN5A 2E5FA 3AWDA 1WHTA 4MR8B 3GA0A 4UAUA 1U8CB 4DCVA 4EF5A 4UD2A 3RYHA 5DWDA 2WU0A 4FXPA 4AULA 1NKVA 2YMLA 4KPUA 2R85A 1KDYA 3QE4A 2MWMA 4IUCS 5CX4A 4YTEA 3R1IA 4DF3A 1R6TA 1WNFA 2F62A 1MGOA 2X7XA 1ZI9A 4H6WA 2YZKA 3L0BA 3QBJA 3P8ZA 1KQOA 2BGUA 3COJA 3HO1A 1XTUA 3NORA 4UHFA 2ODWA 1R4MA 5EMKA 1TUEA 3QKSB 4KW7A 4KUGA 2ORED 3L8MA 3AHJA 3GUZA 2FSVC 1E2NA 3NCTA 1P5RA 4J4TA 1SUAA 2QP3A 1V16B 3C8DA 1ECCA 4YR7A 1G7TA 3BREA 2PH7A 3CH4B 3WBFA 4DZRA 4P26A 3I2HA 5AKKA 4E31A 3WAGA 2H0QA 3HVIA 4JI8B 1V8ZA 2P91A 1T8UA 4U7PB 2YWDA 5A9TA 4AMVA 2VTKA 3GMSA 5JS6A 4PPYA 4E2YA 1E7MA 1G64A 1SWVA 1W46A 2ZT6A 2GR9A 3ANNA 5GGXA 5E1DA 2VNSA 4NZ9A 5LIRA 3E61A 5H1YA 5FV4A 4KB5A 3B78A 5A05A 1AK9A 2Q3LA 2PX8A 2GCIA 4WJZA 4MR7A 2OZKA 1LX7A 2WJZB 3IUNA 2GBGA 4X6LA 1Z8HA 2XBUA 2ZULA 3CLTD 2B2XA 2HDOA 2GOYA 1E3IA 2NXJA 2HFKA 4JQCA 2BWJA 2Q1SA 5FR2A 4AICA 3NO4A 1F6DA 1FQOA 2HLPA 4DLBA 5K09A 2VUSA 5CVTA 2RHRA 5JPDA 2P3MA 3B12A 3FB1A 4KHPB 4FINA 3H87A 3CC8A 3SICE 4M9SA 1GD1O 1I4WA 2BHLA 3HB1A 1VE9A 1XFOA 2CMHA 1JLRA 4NS1A 4OP2A 4PTLA 5ER6A 5K0NA 5LUBA 1G291 4HD8A 2GK3A 3L2OB 5K8VA 1FC0A 4NCKA 2OCIA 3ZWMA 2CMDA 4RV4A 5HILA 1A5TA 2Q3FA 4MZDA 4IIEA 4UUPA 5KNBD 2VT7A 5JV5A 3FTEA 2Q3HA 1A8IA 4LPSA 1X7GA 2FWRA 1QYVA 4M0EA 2AYXA 2RG7A 1VMEA 3K20A 3Q72A 1KDVA 4HV4A 1KIAA 1WSRA 2Q49A 4IIJA 4HXGA 5FUBA 3IXLA 4DEVA 4Q9DA 2GPNA 4PYQA 4JS0A 5E9AA 3T3DA 3GP5A 2VP2A 3UPDA 4KXVA 2JAUA 4YJ2A 4ZXPA 3HXOA 3G59A 1H2YA 1O96B 2D0DA 4I55A 3W3AD 2G72A 1CUUA 2HJSA 4TSRA 3VH2A 3VV3A 4EAQA 2CXNA 4HAIA 1G8KA 2I7DA 2R65A 1N8TA 1RJEA 1CFZA 2WJGA 3ENKA 5BUQA 4OV6B 8ATCA 1R8XA 3PNVA 4IFIA 5B2EA 4E11A 2F9FA 1F8GA 2A9KA 3H5IA 5CFQA 5IYZF 3B2QA 2VZEA 3DLCA 4IDHA 1H5NA 4IS2A 4WTOA 4YROA 2B4QA 4WZ6A 3VR3A 1RP7A 2XNCA 3ILHA 4RD4A 1N9GA 3UENA 4EG4A 5BSKA 4QDKA 4RVOA 2WFZA 2YNMC 2FW7A 2VJIA 5AOCA 4XDYA 3OQMA 1ZD9A 2X6TA 5CYOA 4PGFA 3GLGB 1A97A 2OLKA 4ZDKA 2OYNA 3B1YA 4ZMBA 3PJFA 3A1CA 3Q8KA 3N87A 2FFJA 3HYRA 3A6GA 3SN6A 5K8CA 3BGDA 3FNIA 4HAVA 4BMVA 3R8XA 3NALA 3SR4A 1GL6A 2CJYA 4ISBA 3K30A 4RVUA 1ODFA 1Y1PA 3SJBA 2BLNA 3HC7A 3IV7A 2JAWA 3H8VA 3M0EA 1YB2A 4ZYXA 3NEYA 1KEKA 3W5HA 2AMVA 1FDSA 2CEAA 1Y9EA 3QFCA 4MUIA 2PL1A 1P2GA 3C48A 4FVTA 1A9OA 5BQ5A 3VTZA 1CEYA 2CLLB 2I2DA 1UK8A 3WNBA 3C15C 3W8FA 3GCXA 5IK2D 2PQ6A 4LI0A 1FSPA 3GN1A 1N3IA 1GQQA 1NZDA 1Z2PX 3N59A 2B7CA 4CV2A 2WK1A 1WRBA 4EI7A 5JIBA 2GTHA 5THXA 2HMAA 1IEVA 3G9QA 3QOFA 4GBED 2PX2A 4PSDA 1AK2A 1WQ1R 3I0ZA 4IDDA 4LK3A 2PH3A 1KY5A 5DGCA 4NWIA 2PZJA 3Q2KA 1U1FA 3AGPA 2Q50A 1TMKA 3BK2A 3LUPA 2Z6AA 4GGPA 1YWGO 2HBZA 3BCSA 3C85A 5DPMA 1SOUA 2WYIA 2VJDA 5A8AA 1AIPA 1VHDA 3L8CA 4AP6A 4ARAA 4BN0A 1NL3A 1IIBA 2BJVA 3BC1A 3T4XA 2PUGA 3IP7A 1N4AA 1I3NA 4MUAA 2ZB4A 4OQPA 4BDSA 1MF7A 2P4EA 2CKDA 4DY4A 2NP7A 4JJGA 5ALMA 3ZGZA 3AX6A 1AKNA 1I4OA 1QVWA 3IUYA 1UPAA 1J2UA 1OA1A 4HYEA 4B73A 2ZIZA 2VKQA 4LE2A 1KH3A 3TNJA 3VRHA 2DETA 3QI2A 5K3AA 4WZEA 3L79A 2OENG 1ODKA 3OE1A 4X92A 1TIPA 1Z37A 1X8KA 4CWAA 4AMZA 3KR0A 3TTYA 3WKAA 2ZWAA 4W82A 2OHJA 3BDIA 4LNHA 1TYCA 2CFIA 4DWVA 1MX5A 4DMRA 2ZVPX 4RABA 1KI4A 3OEYA 3WYBA 4HAUA 1AGYA 1IC6A 2C4MA 1O97C 2O2ZA 2Q5LA 4BJ1A 4Z4IA 4H08A 3HCAA 1QVVA 3NLLA 1USKA 1UT6A 1FEZA 1ZA1A 4MKXA 1YAJA 4AJKA 4BAUA 4FMCF 1C3JA 5EUMA 2IS1A 2WUWE 2AI1A 1WSDA 2W2LD 1U28A 3LWZA 4PRKA 5GGYA 3M3DA 3RLFA 2GF0A 1A5ZA 3TZKA 3SEJA 1I5RA 1KERA 1F4PA 2XWBF 3VYTB 4RVNA 4IHJF 2MT9A 1HZEA 5DFAA 2JFYA 4H16A 4RV5A 4UCWA 4A03A 5EJ5A 2O6LA 3EEQA 3H1AA 4WK0B 3U3DA 2OLJA 4WHMA 5B58C 5LU9A 3N0WA 1SUDA 2Z3WA 3E3AA 4E13A 2X3FA 3I2KA 1I3CA 4ZO7A 3SYLA 2YV2A 3E5HA 2ZYUX 2XUIA 3DG9A 3KXIA 1TQ8A 1NR5A 2W98A 1G8JA 3HUEA 1NRJB 1TKAA 2Q29A 1NXWA 1TQDA 3ESXA 1U5BB 1Y3FE 3NIWA 4CFZA 4UPEA 4E14A 2I9PA 2FDXA 2YWJA 3FFBA 3UAWA 2GDJA 1JT2A 3OOWA 3WKEA 4CNQA 2ZEJA 3M70A 3KEMA 3LUAA 3NBXX 4ND2A 3A27A 3NR2A 4JYMA 5FA8A 5HZGA 5K20A 2FE1A 4DIOA 5D87A 1IQPA 2ZBDA 5EE9A 3DNPA 5IBRA 4D8YA 2V8OA 1Y82A 3NKLA 1GNTA 5JE8A 4CLXA 4CDRA 2J3DA 3WGIA 3D02A 1NDHA 3VAYA 3O4FA 2AKAB 4UD6A 1WCWA 4TMYA 1K8YB 3GWGA 3QLUA 5EIWA 3OJCA 1T0UA 4EY5A 1T9AA 3P26A 3HMKA 5E0KB 1F0PA 2WVGA 1IWPB 4HYYA 2FMKA 4IZ6A 3RVJA 2I4LA 3V1LA 3KQLA 1GGHA 2ZU0C 3RSLA 1PKXA 1NYLA 4HSEA 1RIIA 1VPVA 3GJ5A 3ZXYA 4EK9A 5A3VA 1JEYA 1TQ6A 5HRUA 5J35A 4CTMA 1KJYA 4XQGA 621PA 4M1MA 1ONPA 1XB2A 2DQZA 4MPPA 4Q1VA 3SK0A 1GV1A 3GU3A 3BD8A 3EXIB 3KB2A 5TEVA 4PS0A 1P9OA 3T7RA 2I2CA 3HKCA 3L6CA 4JSRA 3VR4D 4JLBA 4R40A 4TVOA 1M1NA 1PZHA 1F1JA 1LC0A 2VJNA 3RIHA 2IU4A 1G5PA 1FBTA 5B1YA 2DUMA 4B43A 4K9QA 3RVQA 4DANA 1UD6A 1KA9H 2VJBA 5JNTA 3ZHRA 2VT2A 3REOA 4QFMA 4B4DA 2O3TA 3EWNA 3LYUA 4C21A 4NG4A 2C07A 1GWNA 1W581 3DTNA 4HUJA 1V6CA 1A7UA 1V3TA 2HA4A 3NWPA 4RGYA 2RC6A 4Q66C 1EFVB 4N6NA 2CMGA 2QJWA 4E4RA 3QA9A 1HOTA 5SYAA 4CQLB 3ESDA 1C1HA 4JL6A 4EW3A 1GUFA 1SXJE 2HU2A 3OLVA 4H1TA 4KTVE 2NPIA 4KQ1A 4QGFA 2V7QD 3I42A 2Z1DA 3WIOA 3K6SB 3JRXA 1EU1A 4OX9Y 3OO0A 3MGBA 1Y48E 3HKBA 3UANA 4OVKA 1YI1A 4FEYA 3AM3A 3UXEA 4FQ7A 1V7CA 1TZBA 1M2OA 2Q8NA 1G20E 3F7OA 3VPXA 4RDLA 1VLVA 4KGXA 5JAOA 4GXQA 4R71A 1KS9A 3FPKA 3KWFA 1A04A 1QQTA 4DR4B 4J7AA 5KTNA 4Q12A 3ONNA 3PUIA 2RGNA 4OHMA 2D1FA 4LXGA 4RDXA 3PGMA 1FRNA 3TG2A 1M2KA 1RJGA 3I8XA 4GUDA 3VR0A 4E3WA 2YQ4A 4YREA 3CU5A 4CLRA 4TRJA 2WJHA 3KSDO 5AK0A 4ZV7A 1COWA 3Q85A 3EASA 4KDRA 4QNMA 2O7SA 3JVEA 2VPWA 3U9SA 5B7NA 3V6LA 4Q82A 3WLHA 4I3FA 4RF5A 3Q6RA 5TMDA 2ZB8A 1PJLA 2HI0A 3PXCX 4DM4A 4CQJA 3VGJA 2GFIA 3L8ZA 3KR1A 4ZEOA 4E15A 4RIGA 2J7KA 2W8BA 5AKJA 3N2IA 5I5EA 2QT0A 4NPCA 4GSLA 4PYRA 4DABA 2P0YA 4DN6A 3MRXA 2OT3B 1LF5A 4I9NA 4XCVA 3R7AA 5H70A 1FUUA 2DT5A 1E3LA 2QTHA 4R9NA 3IAS1 1ZD3A 4U4AA 3E03A 5KBYA 1IPFA 3HQ4O 1BMTA 4NCXA 1DKMA 2XWQA 5EE0A 3MYYA 5FORA 2ODEA 1DJLA 4B6OA 2B1IA 5CB4F 2WFAA 4OUDA 5LXTB 5G4KA 4RCVA 4OKSA 1T4MA 1YV9A 4RXUA 1H4QA 1B74A 2X13A 3PQ3A 3VZSA 5KSPA 3LVFO 1R8SA 4C7MA 1XPUA 2JJYA 1DINA 1GFWA 3VSDA 1OV6A 4MYSA 4C78A 2QT9A 4K9NA 5HJEA 3MQFA 1OR8A 4HTAA 4LOAA 2XQVA 1AQNA 1NUSA 1WF3A 3WWEA 1TCAA 4FB4A 3STWA 3VPCA 4KKUA 1IBRA 4LJSA 4ZWNA 1W9XA 1VL8A 2GWRA 2JBAB 4XM2A 2GCEA 4PN7A 3VMFA 2R0QC 3D1LA 5GZ6A 5KYYB 3QLVC 2XMQA 1YE3A 3RJ5A 3MN1A 5KPDA 3LRTA 2FPUA 2XT0A 3L1JA 1JDBC 1LH0A 3T3HA 5IU6A 2GNPA 4RELA 3WLEA 1XAGA 3QQ5A 1NB9A 4P0PB 1D1QA 2C4NA 2R751 3HLTA 3IP3A 4E08A 5B7GA 4RK4A 4TXLA 2O20A 1ACLA 3U4QB 4KL8S 2C7PA 3C6YA 4H1WA 4IHQA 1I33A 4AN0A 3GF4A 2H5JA 3OKFA 1C9NA 4LYEA 5LD2C 3E1SA 3O03A 4K6KA 1L7XA 3TTWA 1JTEA 3UB4A 3L07A 5H3HA 2Q5IA 1V25A 2WPNA 1SG6A 1T4BA 1C30A 3WRXA 1XCMA 4P4SB 1I8DA 1N33B 1VPTA 4QPDA 5JWRA 2XPCA 1N1EA 1E98A 1ZP6A 1YVPA 1Y4ZA 3IH5A 2QUIA 3G02A 1BWQA 2DU8A 2R6HA 2OOSA 5JDIA 3PFCA 4FKZA 2WRZA 4B33A 1PKEA 3B53X 4UHKA 2D54A 2R00C 1HZJA 1T29A 1R1DA 3I01A 3TKAA 4D2IA 3I64A 4QVIA 2UXCB 5FLKA 2HHJA 1NU8A 2XECA 3C4VA 4HGQA 4G0UA 1T9GR 3N2GB 1KRWA 5G1NA 4DJEC 3FZNA 3S8EA 4PM4A 2HJGA 1N06A 1AQIA 1G42A 2OBLA 2G7ZA 4YELA 5JATA 4GG1A 3H2BA 4NCIA 1OYVA 1L4NA 2EG9A 1XTQA 2PAFA 4TZKA 2ZTHA 3GPIA 3LL7A 4IJ5A 4D4KA 3I8SA 4KODA 4LOLA 4MVJH 2EDCA 3FE2A 3NAGA 2VBIA 5FUVA 3UTCA 3QUSA 2GD0A 4M1EA 2G1UA 5JAMA 3QELA 4F06A 3R4CA 4X71A 1QP0A 2Q9AA 2QLJA 3ZDXB 4MVJI 1FQJA 1ISGA 4IJVA 2B82A 3EMBA 3B6JA 3L8DA 4I46A 4QXQA 1W1WA 2ZCVA 3DEIA 4B75A 2FPRA 5JUWA 3PK0A 3LKBA 3L8HA 5DRTA 4NZZA 3KQKA 1GVHA 3N3BC 4EG1A 2OWDA 1MG5A 2QVGA 3QLUC 1TJYA 1JQJC 5B4TA 1RKXA 2QGZA 1NF2A 3ENWA 1V43A 1L7NA 2PXAA 3LQ2A 3TXXA 2ZRLA 2GJ9A 1V16A 3K92A 4AMYA 3WHLA 2ZBUA 4O4IF 4RZUA 4I8IA 3ESBA 4OXRA 4EFKA 1USWA 4UVGA 2A1UA 3V1NA 1O6BA 1M5UA 1T4CB 5HKKD 3BQ9A 1QYRA 3EW9A 3GFTA 2GKGA 3KTOA 5KUTA 4DL9A 1H94A 2A3NA 4JJKA 3U4HA 3E7PA 4YP7A 2Z43A 4S1VA 1A9QA 1D0SA 2YVKA 4DNXA 3R5HA 2JAHA 3CG4A 2XDYA 5CVJA 2GKSA 2QTVA 3SU8A 1V1RA 3LZCA 2EG5A 1TJNA 1I0ZA 2QN6A 3EHEA 3R6TA 2WD9A 1UZLA 1T26A 2ZT5A 2JD0A 1KQFA 4H4CA 1ZMXA 4P08A 2PTGA 5AOVA 4Z4FA 1AD2A 3CCEB 2X0KA 3F7NA 4DK1A 3GLHE 3M34A 4D4MA 4WBNF 2OBTA 3ASUA 4KAAA 4L9RA 3CX8A 5ANRB 3TPFA 2FP4A 4YJFB 3PUJA 2R2GA 4DFDA 2XYRA 2AN3A 1PQPA 4QPCA 2OCGA 2QNRA 3DKIA 3EXHC 4MV4A 4RTKA 2XSZA 3R3XA 4TYWA 1U0GA 4PZ9A 3OLYA 3ADCA 4MQEB 1Y8QB 1A96A 1XWIA 4HL6A 4JUCA 3PJRA 3SPXA 1CUAA 2F8TA 2JLUA 2X58A 1RTTA 1Z16A 1YR6A 2HCRA 1FRFS 3BMCA 1HRKA 2PIAA 3WLIA 3STTA 5DISB 1G2PA 4KXUA 2EIHA 3FCXA 4PWYA 1P4JA 1TU3A 2I2FA 5H5JA 2FSPA 4ZGNB 1S0UA 3KE9A 4K9LA 1H1LA 5FTMA 4C4ZA 5IPFA 4ZALA 2BVNA 4X6UA 1XCBA 4JIMA 1XDBA 4Y2GA 1XZMA 3UTDA 2R6ZA 3BIOA 3W9SA 3DDWA 3BFVA 3FNEA 1JEQB 1HDRA 3CTMA 4LSZA 2X1HA 4K03A 4XFKA 5LBTA 4DQ0A 5LUAA 1XFAA 4WOJA 5AM2A 5LQUA 4A2WA 5TJ9A 3QYAA 1HF3A 4RF4A 1IK4A 2VDPB 5K0LA 4AXBA 1KMHB 2ZUSA 3BCHA 4KFUA 1KU0A 4RTMA 1XP8A 1IVNA 2PGAA 4MOWA 4B74A 1PVDA 3NBQA 3MMPA 4MARA 3MGCA 3K72B 1FFEA 2GCOB 4EY8A 3SSAA 1EGVB 1QCDA 3AJ9A 1LNZA 5BRAA 5JQGA 1LS6A 3ZNQA 3X2FA 5JRDS 3B3GA 4GPD1 3WIEA 1DAEA 3IP8A 1Z6AA 1SUPA 4RZ3A 3HV0A 2JLSA 4IWNA 3RF7A 4PFQA 3ST7A 5C5CA 1EKXA 3ADKA 1K88A 1CQWA 4CR8A 1UINA 1FDVA 4QSMA 3SJAA 1ODIA 5KOYA 4CKBB 2F55A 1M5RA 2IX3A 1Z6ZA 4CEJA 2B1RA 1B4DA 1DU4A 1FYFA 4KJXA 1P19A 3GGDA 1BJKA 2HA3A 3E3MA 1GITA 3LXRA 3ODGA 4GO1A 4R1NA 3RRZA 1GNRA 2X6XA 4EEZA 3W8NA 2QTWB 4QRHA 5F12A 3EVNA 2J5KA 4BB5A 1X6VA 3V55A 2QQ5A 5UKDA 1T36A 1T24A 1PL6A 5BWLA 1A7JA 1SXJD 2VP0A 1IQ0A 4JB2A 1G17A 4HZUB 2ZW9A 1U3TA 1SBIA 3HVKA 4CMCA 3MT7A 2HADA 1MX9A 1VHQA 2FX2A 5J47A 5HTOA 2PS9A 1P0MA 4RM3A 3O8QB 2H9AA 2QJOA 3EG9B 2BFEB 3JQ8A 1DHTA 4YAIA 2OV1A 1XD2B 4BB6A 1VZ2A 1V11B 1BCRA 2XYPA 1AO3A 3C43A 2ZRHA 6LDHA 2GZ3A 3DS8A 1Q11A 3BTUA 4HY3A 3ZK9A 5K0BA 3FDXA 2ZDGA 4N1AA 5KMGA 5AOAA 4YT2A 5B3LA 1CRWG 1P1KA 4Q48A 1WWKA 3A1SA 4E7OA 1OXMA 4EYQA 2J4DA 4YMHA 2BUAA 4Z49A 5KDOA 3W2FA 2WIDA 4AT1A 4OQEA 4QQFA 4F4DA 5KREA 4D0RA 2XMRA 4XMYA 1T25A 4L78A 5IH3A 4KKVA 2HRDA 1J56A 2RHOA 3RAEC 2VHVA 4NMLA 3SYMA 5BVGB 3PX7A 4AG3A 1GKUB 1YVRA 2EBWA 4V38A 4WUTA 1MRNA 2NW6A 5A3JA 2HRQA 5IVPA 3DDCA 1L7OA 3FLBA 3CRNA 3HXPA 4MWCA 2BP7A 4G01B 1UD3A 3LL4A 1Z17A 4JJIA 5ICFA 3KSAC 1O0BA 3GVJA 2XDWA 2DQSA 3TUZC 2WJ4A 1IVSA 4MJ7A 1JECA 3GROA 4PQFA 5HW0A 1W75A 3ZDAA 2V98A 2DWPA 4YPFA 3DBOB 1B73A 1JE0A 1OX4B 2YJNA 3CVJA 4KMSA 4TS1A 4IQGA 4QYXA 2B21A 1K3FA 2PR2A 4ZO8A 3JQQA 4YHBA 1RQNA 4ZYLA 4U7FA 1RI5A 4P3IA 4MYCA 3G49A 1Y6QA 4AX4A 5EMNA 3PQ7A 5IT5A 1DBWA 2JHFA 5T4HA 2D13A 1QJ4A 2IYEA 4XWWA 3T15A 2O52A 4R83A 4YO8A 3TSAA 3RRYA 4UC0A 2ID7A 2J0UA 3KZOA 4TS9A 2ZIUB 1J20A 1NXVA 4LXIA 1O94C 1V3QE 2BI4A 3QXSA 3DO6A 4E51A 3QX3A 1UD5A 3IBYA 3TTVA 1UT5A 2CHEA 1B00A 2KX7A 1D5WA 2C9DA 4Q39A 3V8RA 1JHYA 1XZFA 1V41E 4MKGA 3V46A 2HMUA 3L6UA 4B6JA 1G16A 2VEDA 1F2TA 2RIRA 1UOOA 4KX5A 4QG7A 3IMCA 3ZI0A 3BIXA 3KUXA 4BNGA 3SR3A 1JNXX 2GSWA 2GLXA 1J5PA 2X14A 1OT5A 2JGLA 3GGGA 2FSIA 5L8VA 3EQ6A 3M4ZA 1HTBA 2C0CA 4EMTA 5CD9A 2ZDQA 4U5XA 1OB0A 1RYZA 3Q7PA 5IBCA 2CFTA 1R15A 1LV7A 1V0JA 2VHEA 4DJFC 1Y0BA 1XBTA 3GCWA 3TDNA 5F3WB 4OUDB 3IT1A 2QTRA 4LZNA 1YOBA 5KCMA 3WQZA 1JSXA 2C92A 2ZTMA 5H83A 4HGOA 1ZCJA 4N6OA 5TDHA 2IYXA 3RPEA 1IWOA 1N2HA 3GFPA 5IYPA 5HF9A 1VXRA 1IZ9A 2DH5A 1X15A 4HX5A 1RHKA 3HY6A 2D1YA 5D5QA 1EX1A 2A58A 5ITZB 1CJUC 2MSWA 2QAJA 2ZLBA 5TE9A 1CVIA 2DPMA 2QTCA 1ZRSA 1XZKA 4B40A 2GK6A 4IRXA 2HM7A 1M1YB 4A2QA 1EG7A 2HAEA 4AQDA 2H59A 1XZAA 3KOYA 3WOHA 4JYAB 2VLBA 2PHZA 3BDVA 1X74A 4KGZA 3SXJA 4DAOA 3ZCTA 2VAWA 5GIPE 4AF8A 3NNDA 1B0AA 2Q6OA 3VR6A 2OFXA 2R6JA 3CPEA 3K5HA 3P0FA 1W94A 5KPJA 2AFIB 1BMQA 2ZQ5A 4JEHA 1X1BA 2FEAA 5EIBC 2MYUA 5C80A 5IN5A 4U2DA 1IIRA 4JI5B 5LNK1 3RUPA 1AB5A 1Q2UA 2E37A 3ZBPA 1PFGA 4UXJA 1C9YA 3OJEA 5JTUA 4DR7B 4E21A 3BT7A 1BVHA 2XB9A 2J0EA 1AV7A 3PC8C 5I01A 3D2CA 3K0EA 1NIJA 1DKUA 4JOQA 3DYIA 3D59A 1ZM7A 3N07A 3PR3A 5HKAA 3RSHA 2Y0BA 4L6CA 1NP7A 4NECA 2LCQA 3HCEA 4W5WA 2WF6A 1YO6A 4B3HA 4EL5A 5HZAA 3IT2A 3OIWA 3V2HA 1ZIXA 2NX2A 1FXSA 3OLWA 2XF8A 4OIFA 3TRDA 2MHCA 3H19A 1R4AA 3SS7X 4CT4B 1NLYA 4DQKA 2J4CA 2JEOA 2O2HA 3C7DB 3PKJA 4JQSA 3VJLA 2W93A 3HGMA 3R0VA 2R96A 2ZRMA 4EKGA 4XPZA 1N0VC 2VVTA 4NP6A 2HV9A 2LP4Y 4OMCA 4RBNA 5BT8A 1NKTA 2G25A 5FADA 2C4TA 3HV2A 3U4MA 3HK2A 2DUUA 3R20A 4L95C 1TDJA 2H4FA 2KVOA 1KJQA 4L1KA 4MRSA 2FPWA 3FPGA 3Q5DA 1AZWA 2Y0EA 5ERGB 4M87A 3MBOA 4QBFA 1V95A 1AUQA 3BEDA 3N6VA 4FD3A 3CM0A 3PPIA 4IX9A 3WV4A 4D9EA 5EUCA 1E43A 4ZVPA 2AFHA 3B20A 2RAVA 1YZFA 3DC7A 3I58A 4LEIA 4BN5A 2A9RA 1VE6A 1NX9A 1ADBA 3A1VA 4R3WA 5J1SB 2FDRA 2X0JA 4EH1A 1MEEA 2UUPA 2BIFA 1L1EA 3KL9A 3T94A 2P2SA 3IQWA 4HUTA 1XYGA 4YUZA 3A26A 1R18A 2XE4A 4IIVA 1UWLA 4W8GA 4C0KA 1Q91A 2G88A 5CA1A 1YNSA 4M46A 1X7WB 4G6ZA 4FM9A 1JYFA 2FJ0A 1QUEA 3AESA 2QZ9A 4D9JA 2IOHA 1J9EA 2GTPA 3GLFE 4IUBS 1IB0A 1KPHA 3RSQA 2I33A 1NT2A 2WPDD 4XM1A 5KYXA 3TW0A 5J40A 3N7UA 4YPVA 5CMLA 3MWYW 4UUNA 1PCXA 5J2UA 3AFGA 1W0KA 1TB4A 1TYEB 1WAMA 4HP8A 5K0FA 4XPIA 1HQCA 2CNWA 4UU7A 4CEIA 3I01M 3H5TA 1H1DA 1VPWA 4UHBA 3PBKA 5E6UA 1T1GA 2D8MA 3ONFA 3TI9A 3HH8A 4UDNA 1ODSA 4MWZA 4HNQA 3PXBA 1MO5A 3D7KA 4LYHA 3KKPA 3R7LA 3LFHA 2C5EA 3PUNA 2V6BA 2PZFA 1KMQA 4ZGGA 3UJPA 3H3FA 4JI3B 4R0MA 4F9EA 1T1RA 2JI4A 3R3VA 4IZOA 1QTNA 2H7CA 4POAA 2FWNA 4C7XA 2BCEA 1ZOOA 2G6BA 2DT8A 1RCFA 2KYRA 1I2MA 2YMQA 3GRPA 5EEGA 2QEXB 5F4JA 1Q84A 1RQGA 5AK6A 1PZEA 3WRYA 3ORFA 3OIDA 1JKJA 5FV7A 5ESRA 2QGGA 3VU0A 3LO8A 1PYOA 1ZOLA 3C70A 4RLQA 3R3UA 5BN3B 3HYLA 4OXIA 3V97A 5KYXB 4YI3A 1WY5A 1JDNA 1G8MA 1Y0YA 3ID6C 2B4RO 4AJ1A 2XBLA 4JB0A 4YIKA 1XNHA 1CB7A 2HO5A 1O1YA 3EIUA 1DC8A 1Z2DA 2VUTA 4B6PA 4QBKA 5G4LA 3T35A 1FW6A 3ZJVA 1HY3A 1HKUA 2VRWA 1YHZA 2XDAA 3OFNA 2QM3A 5IYWA 2X6YA 3OA2A 5EPOA 3TL6A 2C1ZA 5AW4A 2Q4EA 3KU4A 4UXIA 4UNIA 5EP4A 3H65A 4EYKA 4YAFA 2D2XA 1MVNA 2FMXA 3LHKA 2YIVX 3PTZA 4EFMA 3D8SA 3TW6A 6ADHA 1R74A 4CUJA 1TL7C 3DP9A 3FTCA 4EW6A 1QPBA 1U1CA 1U2PA 2R6R1 1QG4A 4HWSA 4UEJA 3L7OA 2F90A 5AYVA 5IW8A 4RVDA 3RE1A 2PKQP 3WQHA 4IGFA 4HFMA 2EFJA 3JTEA 1WPCA 4I8DA 4ATNA 1F2UA 5F1YA 2AXEA 1DKPA 4OXKA 1R0LA 3D31A 4RWEA 1NXSA 3IAEA 5H81A 2C5HA 1AF4A 1UZNA 1DEHA 1T36B 4JBIA 4G24A 2FCRA 4M0PA 1EEXB 2DECA 3MTBA 2VTVA 3AJDA 2P67A 4TV8F 4DNRB 4UNQA 3G8CA 2X22A 3OH8A 1D1PA 4GUAA 5F2NA 3GEEA 2Z5GA 3UAVA 3SEQA 2NV4A 2WJIA 3E8SA 3TJMA 1BWSA 4PGAA 3PQCA 4I50B 4LHXA 3UOWA 3D7SA 5CFPA 1DO0A 1DXOA 5EY5B 1Q7YD 1D2NA 2OCBA 1YTLA 2O06A 5FBVB 2ZOSA 2DFPA 1AY0A 1VHEA 1C8LA 1JDSA 1T2DA 2FB9A 3M8KA 1HE5A 3PD0A 3PXAA 4HRAA 4K8OA 1U0TA 3R9IA 3V7YA 4AECA 1NXXA 1Q7EA 2QJTA 4M86A 4Z54A 3HB7A 3SC6A 3BH6A 3Q5GA 1M6YA 2Q9CA 1KFKB 4TKLA 3B3JA 3LYAA 1MMFB 4FDTA 2BV3A 1TC2A 2YBEA 2QUHA 3AVPA 4ITVA 2TMYA 4KLNA 4PZEA 2FAXA 2AVNA 1W96A 1JB9A 2GRAA 3LLVA 1XPJA 5DBOA 3R5JA 1YR8A 2D0PB 3CJTA 3AZPA 4IS3A 1RZ3A 3KKKA 4WH0A 2Q6VA 4A2PA 1XEXA 5GM2A 2HBRA 1MEJA 1YRBA 2D1SA 3NBFA 2LUOA 5AI9A 4IDOA 4U63A 3U81A 1YSCA 3ZD7A 3MJHA 4UEWA 3ML1A 4LXUA 2EFYA 2NPFA 4MRRA 3LQQA 5DHQA 4A10A 4G4JA 4ZPXA 4ZKEA 1S7CA 1SH7A 3TSCA 1IAVA 2MINA 3PWSA 4IOKA 3L4SO 3CVUA 3GQBA 3HYCA 2O8CA 4TSFA 2YYAA 1SWWA 4OGFA 5EKSA 3PD1A 5BOVA 3V8PA 5IK2A 3EZ6A 3THWA 4ZQFA 3A0RB 1SBZA 2H29A 3KJNA 2CJWB 3NHBA 2PT9A 3DEZA 1JQAA 1QGED 2RGEA 1Y3AA 4MKZA 4ZVTA 3OX3A 4ZI2A 5J2UF 4OKIA 2NO6A 1S7GA 2Q7OE 1E1YA 3RSCA 1AQLA 4D46A 4CG0A 1XCLA 1HQKA 3ESRA 4V39A 1UXKA 3LP6A 1VRWA 3FRJA 5KHAA 3R75A 3PS9A 5MF6A 4QUEA 3T1HB 4TRRA 4NX2A 5F3DA 5JCJD 3P9ZA 1J7JA 5L7YA 4UZUA 4MCHA 2HUNA 2XUGA 2W6ID 3A04A 2CHGA 3JWEA 4DCJA 1Y37A 2CFCA 3OQ6A 4DR3B 3ETEA 4S1TA 2WYVA 2QUZA 4RCZA 1E1DA 3VKUA 1XFDA 2B2CA 3B8EA 1GZHB 2P2CA 1N5LA 4XM3A 2P90A 5AM4A 5LPNA 2ZUWA 1PTJC 2QRUA 1GTG1 3DZFA 3GRZA 4HB4A 4BKRA 4E1VA 4EB6B 4ZN6A 2PX5A 2XLBA 3V3TA 5D6OA 1TGYA 2QRZA 3HU2A 3M4JA 5SY4A 4G8BA 1ZJ6A 3KR2A 3R3WA 4H7PA 4QRDA 1P33A 3TK1A 4CM4A 3IP9A 5FWDA 3DOUA 2WQ7A 5H4HA 3AOEA 3EY4A 3U4IA 2PBRA 5DNVA 4ZIRB 4BO2A 2Y3IA 3NHUA 1B8PA 3M49A 3MUFA 3NS7A 4QTTB 1M7GA 1Q82D 1O6FA 3JQAA 3LPMA 5IAJA 1Q12A 1K4KA 2PKQO 1LI7A 4O1HA 4N0MA 2PXCA 1RM4A 2WLTA 4ZODA 5DX1A 4ZJZA 1Y6FA 3VYUB 2P3OA 3V8VA 1DJQA 3PUZA 2J48A 3TEJA 2ANBA 3DUWA 3KKNA 1OI4A 4CMIB 1BYIA 4INJA 2H2FA 4P83A 4EELA 1QFJA 3ZHQA 4PSUA 2C95A 4PSKA 1LPBB 2GPWA 1HMYA 1XDDA 2VP5A 5F7JA 2HLDA 1KP2A 3N8GA 1X1SA 1ZEMA 5E2IA 3E2MA 3JD1A 1OAOA 4WBNB 2OHIA 4M8IA 5THKA 3NOOA 1NNSA 2NXEA 1M0TA 1JG4A 2PD6A 5CVEA 4DTCA 4F5DA 5F78A 2YXPX 3DE5X 1OKKD 1LBSA 3SBEA 3FR8A 4YPOA 4V0OA 4Y0VA 3ZWVA 3K6KA 2QNIA 3E7DA 4G67A 1XAHA 4MCAA 3RKUA 3WBBA 2G77B 3IVAA 2FFBA 2DLDA 3G2JA 3MFYA 3KEQA 2A9OA 4N82A 4JLDA 1DVRA 4F8YA 2R60A 4WKPA 1OFGA 2IS2A 2OO5A 5M3BA 3ZD8A 4XSGA 2JW5A 3P0EA 5IT9A 4EGAA 3C8ZA 1A7KA 2BOVA 2CCJA 3DGEC 3LGXA 4G37A 4BMOB 3TRJA 4K6GA 1HZZA 4P4LA 4U7HA 4BQSA 4LSMA 1NQ5A 3WGUA 2OP0A 4H15A 1R9MA 2ZGVA 2CUZA 3EZYA 4DARA 4FWBA 1JFFB 3O7WA 3C6QA 4U2GA 2B4KA 4E22A 3GYBA 2FWBA 3IAHA 5AKZA 4GM1A 1XZNA 4NQZA 3GGOA 2BFEA 1V9LA 1CUSA 2R8YA 1JAHA 1AKWA 1PNVA 1IBKB 1OI7A 3CPSA 4JLUA 3MC1A 2G6TA 4LJ4A 4RTSA 4UBMA 3O8RA 4NENB 2C2YA 2JC3A 2P6OA 1VDZA 1QVRA 4WFJA 2B2NA 4YI5A 2BSAA 4A73A 3LU1A 5KNDD 3FPLA 3GH1A 4B9EA 1PJ8A 1MIOA 1NPYA 1O7JA 1W5SA 2D5CA 2P79A 2PUBA 1X7DA 1P1BA 1U0OC 1X13A 5GONF 4EB3A 2CV2A 2KJQA 5JY1A 4P2BA 3G0HA 1J97A 1ZSVA 3NHSA 5AJVB 1UJ4A 1Q0UA 2PT5A 3ND9A 1EVLA 1S2GA 3QBVA 4DEYA 4NXNB 4KMOA 2J5BA 4PZUA 2W11A 2ACWA 1WY7A 5IMBA 4NU6A 4F1JA 3QXXA 2CLCX 2RH4A 2R8PA 5BORA 4LE0A 9LDBA 1UZUA 2F1KA 2JI8A 3IEPA 3NI2A 1NA5A 3G8YA 3AQ4A 1E62A 3IC5A 3ZCRA 3ESQA 1S1CA 1YHQB 1Z22A 3OQIB 2D06A 3PLRA 4IDFA 2VHCA 3CY6A 2BFFA 2R7MA 2VP4A 3P32A 4JH0A 4BTEA 4EL0A 2XZOA 1ZN8A 1TYDE 1PK9A 2XUQA 3EC2A 4GZ6A 4ZIRA 5JXJA 2D1QA 1PJTA 1PT6A 1QAMA 2GT1A 2NNLD 4O2BB 5DYGA 4XAQA 3RFXA 2CUTA 2Q3DA 3TRIA 2IEYA 4M7WA 4OPOA 4BNNA 5CDFE 2EBFX 3D2AA 4M6WB 3X1KA 5HRCA 5K01A 1B6SA 4G4SO 3UK0A 3ZE0B 2Q5OA 4OBXA 5FI1B 5FEUA 5JAIA 5KQLA 3D5QA 4BEJA 3F3SA 1II0A 2H1SA 4OLJA 3C98A 2OEPA 3GYGA 4ABYA 3OO1A 2IYVA 4RZ2A 4DMCA 3EVZA 4EHHA 3S70A 2LDXA 1E6CA 4BNYA 5A7FA 1OF1A 3COPA 2C7VA 2OYCA 1J22A 3ADBA 3GLGE 1JIVA 3GNQA 3Q7TA 2ZRKA 3EUAA 3AY0A 3IS3A 4R31A 1I30A 1GJRA 2VK4A 3ENNA 5EZYB 3I9KA 1XCOA 1TOAA 5GM1A 3A4TA 4CMAA 3PLAE 1JEDA 1K8XB 5I4CA 1GTMA 3T61A 4ZAFA 4L57A 5A62A 3G2HA 1J49A 4O2BA 5CB0A 1U8XX 2Q4OA 3DKPA 1G38A 1PP4A 3ND5A 2QLNA 2F67A 2WDZA 3KUKA 1MJGA 4PC7A 4UATA 1OXUA 4DJTA 4EVIA 2Z8YM 4C6RA 2JFOA 3FPPA 1EE2A 4C0XA 3CMEB 4V0SA 5KQSA 2X85A 1Y9JA 4DCNA 3MGKA 1O2DA 2WUGA 1C7RA 1EYZA 3K9NA 3ZVMA 1QLHA 3GUHA 4RKRA 4AP5A 1DC3A 1OWMA 3G1UA 2ZSEA 4GBJA 3I37X 4UBIA 4HVLA 3LX8A 4DDWA 3DVRX 4HLDA 3OZ7A 2GJ4A 4U2EA 3VUEA 3R6KA 5EZYA 5FPTA 2ADOA 1G20A 5PGMA 2JD2A 1L4MA 2XYQA 1B8VA 2MINB 4WLVA 1KFEB 1Q1ZA 2XRZA 3E82A 2A2ZA 3HP7A 3NB0A 4C0AC 4DB2A 3GJ8A 5B7PA 4DQUA 1JW9B 2NYVA 4JVLA 3P4YA 1U5CA 2XOXA 4DA4A 2VJOA 4BGDA 4P7KA 1G8YA 1ZLYA 2LWIA 1HDCA 5DSZA 2PKYX 4MWBA 4AN4A 3RIEA 1KZ1A 2W71A 1U94A 1J0BA 3H7AA 5HGJA 1NUTA 2H5EA 1V4NA 4U8HA 4EHJA 1JHRA 2C20A 3TEFA 4WZBB 1OH5A 3O92A 3JYHA 2WP0A 2D8AA 4QLBA 5JZMA 3GT7A 1R8JA 5SYMA 4K28A 2PDAA 4BQFA 1AG9A 3AI2A 4IXWA 4N7JA 3TZBA 5KU7A 1TCVA 1XYVA 1SCDA 2QX6A 4RVGA 1Z0UA 4L5BA 4YJHA 2PYIA 3LSTA 5KVCA 4DV0B 1A2QA 4TXJA 4CQLA 3PFIA 3ER8A 3ZE6A 2ZP1A 4JGGA 1JHUA 4Y0NA 4L4ZA 4TTJA 3NYWA 1AUXA 2PWPA 1PJ4A 1FNMA 1BA2A 1DFGA 3JVUA 1AKTA 3ZWBA 3I56B 1IRXA 1TTPB 2R68A 1CJBA 4OOEA 1FNDA 1R5NA 1U2GC 3D2LA 4CPDA 2WYRA 4EFNA 4EKNB 1SU7A 2Z0MA 4JLWA 4QPNA 2GK7A 1U2GA 5C9ZA 1U3CA 2DTXA 4A1OA 2UVQA 2M32A 2QN7A 1P3DA 3LHDA 1QIGA 4BLRA 4E5VA 4F4IA 2OHGA 2BT4A 4INOA 5K3EA 4NENA 1D04A 1N5RA 4V1CA 1TUBB 4R3NA 1AS2A 2VTBA 3T51B 4BNVA 4ZZIA 2C99A 2BGKA 2I6SA 2C7QA 4UBNA 5CDSA 3C5EA 3ZLTA 3NAQA 3U7GA 4CYMA 4EZBA 1YB4A 1TCBA 4LN1A 4DC9A 1R64A 1XRRA 2BL4A 2RK4A 5CT6A 4G4SP 4R81A 9ABPA 4OXYA 3Q2IA 4UOQA 3LQRA 3RIMA 4C08A 5CNMA 2PVCA 3GD7A 3S8YA 2QSUA 1VMKA 1LBQA 4N3GA 2DTEA 1M2EA 3DV0B 4LHSA 3PSHA 2BBTA 4LJRA 5DI9A 3VPAA 1YBAA 2JIOA 1NVGA 3SZMA 1QP7A 2CSXA 4K2AA 3H0CA 3CTAA 1OGYA 4LPKA 3WO0A 3TSOA 4DMGA 1G3QA 2AIRA 3ZU3A 1KI9A 4GEKA 1S3FA 5CEFA 5ALHA 1G7RA 2G9UA 3AHIA 1KEVA 1JMYA 2LR0A 1HDEA 4PLFA 4BQQA 3RH0A 1J1UA 4QFBA 4JB3A 1NB0A 1S3SA 4NLLA 4QQNA 4ZK6A 1E9RA 1FJGB 4DA6A 2DFKB 2HSGA 3Q3AA 4HVAA 2OKGA 3FN4A 2V9ZA 2ZSHA 5HTKA 5CA0A 5JD6A 3HDHA 2ZAIA 4LECA 1DXQA 2PNFA 4S3MA 1HL7A 4TGLA 1D3AA 4D8VA 3FCCA 3K0CA 1UPUA 5P8WA 4MQFB 4RETA 4X1YB 2A6PA 2GDZA 2YTZA 4NZYA 5F5LA 4OK3A 3M6VA 1JB1A 3BF7A 1VL5A 3CUYA 1AZSC 2JJMA 2Y1DA 3AKCA 3DT6A 4QEZA 3KPUA 4QYTA 2QS9A 2DUNA 1JLLA 4DY6A 4DLTA 2CXOA 1PQ4A 3ASZA 1RMQA 2QRQA 1P5ZB 4IHJA 4K1XA 2OBFA 1XRNA 4QGBA 1AF7A 1OBVA 4ZI7A 3T5TA 1E61A 3UOAB 4PLGA 4NCBA 2ZR7A 4BVHA 4MITA 2F9MA 2QX9A 4YCJA 1MDBA 2XGJA 2KM1A 4RXMA 4LHEA 2EKPA 3KLOA 4URUR 3WLFA 2VWPA 3H9EO 3CMMA 2ZRBA 1SKQA 4BYGA 4EX7A 4P80A 1GEEA 1SQGA 2YVAA 1LNSA 2BE7A 1RZUA 4I4LA 2WPDA 1LLQA 3CLRD 1Z7GA 2WU1A 4MGIR 1GARA 1Z18A 5DM2A 5GONB 1GM5A 5LYJF 1T6BY 3SQMA 1E9DA 3U6BA 1QQ7A 4JQYA 1NY6A 4TRNA 4I1SA 3URKA 1KWGA 1BU8A 2NTEA 2GRUA 2LZ0A 1NJ8A 3MAJA 3OY7A 4RHXA 1Z35A 5E38A 2BZ1A 3AMVA 2GAFA 3OHMA 2QD5A 3BRWA 1NLUA 1GY8A 3CG0A 4KQ2A 4W4TA 5EVCA 3V4LA 3ICPA 5E4YA 5C8DA 2GJAA 3OJLA 2FTKE 5B12A 2FFHA 2XQFA 2ZJYA 4XN0A 3DZDA 1AHNA 1MR3F 5LOVA 3EUEA 1TW3A 3F3KA 2EZTA 5AI8A 4BYMA 1GKIA 5BQ3A 2H3EA 3JATB 5ICSA 1OHHD 3I9FA 1QHXA 2YWHA 1MB0A 3CPWB 5GJCA 4C6HA 5A5FA 1QF7A 5ITZA 4DT1A 1TF5A 3FTNA 2CC2A 2ZZGA 3ETJA 4GL4A 4M38A 3K1AB 4MNTA 3ZXUB 4AVYA 5K7SA 2CB0A 3LQ1A 2WNSA 2HL6A 4I5EA 6ABPA 1LS1A 4CCSA 1VJ5A 3FI9A 4DT1B 3ZVNA 1XROA 2YQ5A 4MV1A 5F9HA 3DMDA 2XZTA 4FP9A 1UIRA 2OK8A 1U99A 2XUZA 5MFPA 1BE1A 1LF0A 2XTJA 5C81A 1MO6A 3DE2X 3ITEA 1OQAA 1MVOA 4I36A 1KQ3A 3KVOA 2H4JA 3DVQX 4RQBA 4TKVB 5A3SA 4KXYA 2JATA 2NVBA 5DK6A 2AKEA 4FFDA 1N25A 4LJ9A 4MB2A 3ITKA 3N28A 1NI5A 5J9FA 3OUZA 1SK9A 4F38A 3MW8A 2Y0PA 4I55F 2IV7A 3HJHA 2XXAB 5C53B 3BH7A 1D5CA 3OLXA 1ZRHA 3DTVB 3H8JA 2UYHA 2QL6A 2ZAGA 3OTHA 3IESA 4WNCA 2AZMA 2DQKA 3D0OA 2CKMA 3BULA 3DQQA 3NYIA 2V5UA 1JQDA 3ABIA 1ILWA 2GPYA 1I7NA 1AX9A 3PVCA 1WQ3A 3SMVA 3ZDEA 5DBHX 4AZVA 3ENVA 1P73A 3AR4A 4F46A 3UGJA 1YCGA 1G8SA 1U98A 3EUFA 1E5LA 1SEPA 2AJDA 4OXQA 2E0IA 1B3RA 1NMQA 3HEMA 3NPMA 3K6RA 4UEKA 5HUQA 4A5OA 3DV9A 1KRHA 3KDAA 2B25A 5KS2A 3FPAA 2J0UB 2QRGA 4G07A 4KLRA 5E1MA 4D3FA 3P9CA 2OO7A 3K9HA 3WYGA 4O3FA 1DAGA 3K0FA 4OYRA 4N5NA 3STYA 2A1TR 1RWWA 1T9CA 1R3DA 1PJ7A 1JKJB 3KJXA 1IM5A 2Z4TA 1BJRE 4MUFA 5HM6A 1P4GA 1XZIA 2J9FB 2WJ3A 2A5FA 1K75A 5AHKA 4TUYB 1GNQA 2BEVB 5BN1A 2LZJA 2PZGA 1M72A 3A2LA 3G2PA 1Z6GA 2ZI4A 3EG5A 3EHDA 1ISHA 3WSWA 5MFZA 4MICA 1IN8A 2FEMA 1SRRA 3B1XA 3GRFA 2N46A 3IB3A 1YZHA 4LF5B 5FUQA 1U7TA 1ZGCA 2OCYC 3OX4A 5E6UB 2FW0A 3C6ZA 1RZRA 2YDYA 4I50F 3HB4X 3TTUA 5C51B 4B81A 4P3YA 2BFMA 1NFQA 3QVXA 2X0EA 1PK8A 3WX0A 5J2TF 3VZPA 2E7ZA 3ZGOA 4BQOA 4NYJQ 1RIFA 3PHCA 5E9WA 4X94A 3LZ6A 5C5IA 1U04A 4XGKA 2MIIA 4D3DA 2I1VB 4XCQA 4EA8A 1H6BA 3IKVA 1EB8A 3KX2A 4MGZR 2JG3A 4QGHA 1QTQA 1YDEA 1PSZA 1HYGA 2JH9A 1U0SY 1WDMA 2Z08A 3WYDA 4F56A 1PX2A 5TMEA 2FVYA 1Z13A 3E9YA 4LSGA 2O19A 1KYWA 3VPGA 4NABA 2M6KA 4IWYA 4D9IA 5EHIA 4F8JA 1SCKA 2O3RA 3R6WA 2NU8A 3S5UA 4XWTA 2FHSA 3TSWA 1Z2EA 4FSHA 4S24A 1EFUA 4B7CA 3I1IA 1Z5GA 4JUIA 1EFAA 1KMCA 1F5SA 3BGIA 3H8SA 2JI6A 3RD5A 5LLDA 5HGXA 3OP4A 4RH0A 3IQXA 4D4HA 3IBFA 1A2BA 1ZIYA 1W88A 3F8TA 2Q1TA 3LUHA 2ZL6A 1JR3D 4IKEA 5EJGA 2BZGA 1T0IA 2GQ0A 3I5AA 5JSZB 1XCPA 1QGAA 3D3KA 2EVWX 4R1SA 2AOWA 3P19A 4NU8X 4PG6A 1U65A 2G09A 4HNHA 4HDSA 2BP7B 2OHXA 2Y6VA 1LZKA 3N1UA 4W7HA 4I4IA 3RSZA 4AJEA 3RHZA 1KDZA 3QFHA 4BMDA 3P2EA 3HAGA 3V8EA 4CMJA 4HNVA 5MN6A 4RHYA 2VATA 5EA2A 5J2UB 1ZW6A 5K0GA 1YR7A 2CWDA 2H1OA 4E2XA 2V8BA 3DDSA 2UZ1A 1B8UA 2Y2UA 2BFBA 2N42A 2RKOA 4CEJB 4O2AA 1M1KD 3VZBA 4R1UA 1DB3A 1H9AA 1OAOC 4Q3OA 1E1MA 1Z4KA 2EU8A 1KQPA 3OMXA 2F8MA 4JD5A 3E9QA 4G5FA 3PRJA 4WXRA 2PMBA 1VE7A 2JKYA 3EPKA 1RPZA 2IDJA 2L82A 2X77A 3QFSA 3QOWA 4N5LA 4ZU6X 1RC1A 3KKLA 4GWKA 4EMSA 1WOSA 1PAUA 2WU4A 4I5FA 5T41A 3RBVA 5LDHA 1UP7A 4CU2A 1WU7A 2A35A 2TRSB 3E3NA 4HI0E 4PG4A 5AKXA 3QVMA 3EIFA 3OHPA 3ZQKA 2I3ZA 5JI3E 1YDFA 3O8QA 3DHNA 2JHAA 2R25B 1TTTA 1V6AA 1PG5A 4IV0A 3DJYA 4CFSA 1J0EA 4GM0A 1WNTA 4LRSB 4XQCA 3SXPA 2JFZA 2WMNB 5G3ZA 2LVBA 3PHBE 2AOUA 4G9GA 4HGYA 3WA6A 4L2IB 1AURA 4OFZA 1GL3A 1PS8A 2HJVA 3HGTA 1QWOA 1X92A 3ND8A 1JFRA 1CUIA 3P2IA 1ZINA 4PICA 3DFFA 1ZU4A 4GZLA 1KXZA 2P1ZA 1F60A 2BAGA 5HUHA 4KN5A 3GLHB 5IVHA 1E2DA 1E6KA 3TLZA 1NW6A 3WB1A 3NE5B 3IUQA 1XOIA 2PEYA 3K1AA 2DF8A 4B6RA 1NMEA 2AVDA 3PQ6A 1N5OX 4C14A 5ABPA 4LF7B 4KR6A 4JHLA 2ZATA 4EG5A 4PHFA 3MTJA 3NATA 1XZBA 2AHOA 3ILXA 1LJLA 1L7RA 5LYJB 2WJPA 4LUCA 3H1GA 1HE3A 3PDCA 4WN3A 3TB4A 1ZEJA 2ZI9A 2DYKA 5JXWA 4BO6A 1KEZA 2V3VA 1ND6A 4B8ZA 4WWVA 3SIXA 1P7ZA 2CFRA 3U6KA 3FMIA 3IMFA 4Y2XA 4LE1A 5A9SA 4KQXA 4KGDA 3H0KA 1QVZA 3M1LA 3WNZA 2V4MA 4E33A 1DARA 1UKCA 5LJLA 1DCKA 2XRMA 2I6GA 2QZSA 3UKJA 3NEAA 2JS7A 3KWLA 4JDPA 5L6MB 3ZHOA 4DPMA 3D7MA 3JZAA 5F7XA 4QYWA 3UHJA 5CVDA 2EJWA 3CW8X 5ESXA 4MTCA 2O1EA 2YXNA 4Q21A 5FYQA 5BN4B 2XVZA 1U63A 1KEUA 2G5TA 5I9SA 3GBVA 1J9ZA 3MQ4A 3SJZA 4GGOA 1KQSB 4RPGA 1YQ9A 2D4HA 3V80A 3AL2A 3K6JA 1L4BA 3PEVA 5ESDA 4BMNA 3N9IA 5EWJA 2VT6A 1T3ZA 3E3OA 5A5DA 4CDMA 3HWWA 3HHPA 2P4UA 2QRJA 5CEEA 4PZZA 2H11A 4FC6A 4I55B 1VQ1A 3DL7A 2HHAA 1N2ZA 3B52X 1EX9A 4MW7A 1GQRA 1E0DA 4HQ6A 1DT5A 1PW7A 1Y8CA 4YUVA 1LW7A 4ZCPA 1G9TA 3RBZA 3RO7A 3SI7A 4B4UA 4BIMA 2AK2A 4KG7A 4IJ6A 1CEQA 3MLBA 5T3UA 4CLEA 1K7CA 2PXHA 4M0LA 2FWIA 4H27A 1RYYA 3PVZA 4IIJB 4XDHA 5AI5A 4H7KA 4X85A 3RKRA 5C1OA 2XAUA 2UKDA 3DZJA 2UUBB 4HG2A 5BR8B 4X3OA 3UV7A 5TRTA 5L3SA 1XF9A 2EL7A 4QVJA 2DCUA 2J1LA 2VBVA 3A1EA 5AHOA 5EESA 1WETA 5IM5A 3NHLA 4M1ZA 5FUXA 3HR4A 2VHXA 3OA0A 2DHRA 3VC1A 4W9NC 2H07A 5B53A 3DV0A 1JSCA 2ZE6A 3M6AA 2WYHA 4P8RA 1TF7A 3FUCA 3H86A 1DKQA 2ZBRA 1MV5A 1T4CA 3HCWA 4EUNA 5AUOB 2Z5VA 5K8LA 1FFWA 3QVTA 4RENA 3HXMA 1DAFA 2Q28A 1J2TA 5K2MA 4G1UC 3K8OE 3SJUA 2O8BB 5AVZA 3ABZA 2EKQA 4FDAA 3ZNOA 3HYNA 4P3KA 5A03A 4FR0A 3VNAA 1M54A 3T5GA 1JJIA 1JDPA 5HFJA 4MGKR 3ASRA 5CTAA 2BKAA 3EG9A 5AP9A 2DY0A 1JAIA 4BXOB 4CZ2A 1EX7A 1GA1A 2XE7A 1P9LA 4I3GA 5DN6A 2CNDA 1L8LA 5CT9A 2JCXA 3TNDA 3SHFA 1PFVA 2HJ9A 4GM4A 1CY0A 4R5HA 4JB8A 3OZAA 4XKWA 4CW7A 3NVKI 3LGAA 2DG2A 1GL7A 5C2JB 1EVQA 5LMUB 1GXSB 3ZBUA 2JGAA 1KQNA 3WMRA 4OG2A 3L9XA 1NP3A 2D7CA 1D9ZA 2C5BA 2ZWVA 5C46F 3WB0A 1WS6A 3K0BA 4BRUA 5I8ZA 5BN5A 3QP9A 3VO9A 4F8EA 1NU6A 3VKWA 4OP1A 3HVRA 3ITDA 1WMEA 4I2NA 1HQDA 5BSRA 1TKBA 1ETUA 4P7GA 1G19A 4RA6A 3LG2A 3OMLA 4MCJA 2IQ5A 4C0HA 4KSBA 1O03A 3ZK7A 1YQQA 3FCYA 4GPEA 4YRIA 4N48A 1G21A 4AYWA 2PKEA 2VYVA 4IFBA 5BWNA 5KVQA 4X7CA 2OPHA 5I8WA 3PPYA 4DSAA 2IVZA 4I5GA 5I7WA 3Q4GA 4ND8A 2EZ8A 2NNWB 4OM8A 3F6PA 3OAAD 1E99A 2P9EA 1ETHA 4RLSA 4Q5IA 5EE5B 1OC4A 1TVKA 1PYGA 2HPVA 1UXGA 1XF1A 1SXQA 4FU0A 4TLBA 2BMVA 5JPCA 1PWZA 5CNJA 5NLLA 3NM6B 2GVNA 4HZUA 4JLSA 2QV0A 4Z86A 3TD9A 4NULA 3PGVA 1MRSA 3GOQA 1C41A 4ENQA 3GIRA 5KYGA 5FOQA 3LCRA 3ZY5A 1HDGO 1XTIA 2EJBA 2NO0A 3X1ZA 1AZLA 5TVGA 5F51A 1L7PA 2J3EA 3AR9A 3MBKA 1T9KA 1X0VA 1HX7A 2IWHA 1DCFA 1UJ6A 2LIVA 2IT1A 3G2NA 3HN2A 1SQ5A 4TN5A 3ZDFA 2G3YA 3ZE2B 4D0LB 1XA4A 2VHUA 4LOJA 3UK1A 1YBHA 4YRTA 3GJSA 4ZHQB 2GAAA 1TAGA 1GZVA 3RUCA 4B76A 4C0SA 3RUIA 4N0QA 2PUVA 4JLPA 4JMPA 4B44A 4BPRA 4NBSA 2GK4A 3MJRA 2ATIA 4LV6A 4Z7OB 1M8FA 2HXYA 3NGLA 1TXGA 4KO3S 4FR5A 1UR5A 5C5EA 221PA 1YZQA 4AI6A 2AE2A 3IIEA 4I4CA 3SKYA 1JE1A 1UPFA 2NSYA 3IQHX 1XZEA 3NBUA 3NT2A 1RYHA 3LC7O 2VYCA 4O6VA 5FL7D 4MHSA 4C3VA 2ZI5A 4KV9A 5DLPA 1XMPA 1Z74A 2YS7A 4KKTA 4MVJD 3C2QA 1EK1A 1Z0FA 4EX6A 1O94A 4Q1CA 5EXDA 3PX2A 2YVUA 2F3TA 3PTLA 3F47A 1U4NA 4WKGA 1BXZA 4F3YA 4MJ3A 2COUA 3RRNA 3TPZA 4OGKA 1QHGA 1KKMA 1VPDA 4Q6WA 4XB6B 5LA6B 4MHOA 4F12A 1Q15A 3CURA 5HKKA 4P84A 4MX8A 4OQXA 1ULUA 1G9XA 1V1RB 4IMPA 1VIYA 5DEIA 2ID4A 3ADOA 3FYUB 4RK7A 3W5UA 3LUDA 4UZSA 2FUCA 3MOSA 4GRDA 4LDNA 4M6WA 4NI5A 5REQB 3ZV4A 3ORYA 4NYIQ 2E1RA 4YAWA 2P4HX 4BP8A 4RAQA 4ID9A 3VISA 2XMPA 4QDUA 4MB6A 1QH0A 2PZMA 1G2OA 2H65A 3LA6A 2JGFA 4HZIA 4KWCA 1S8AA 1FP2A 4OJTA 3TIFA 3ZHSA 3U5ZB 4PNEA 2JA2A 3OY2A 5A4MS 4XWOA 4J0EA 1ZITA 5EJ4A 3NUGA 5ECDA 1DEOA 3ZQUA 3S40A 1QVFB 2I3DA 2WY2D 1UMKA 3QVOA 4BBZA 3M5CA 2Y99A 4RFSB 2HCTA 3P97A 3UHFA 3OE7D 2AD1A 3QVJA 4ENVA 2Y1GA 5IANA 3ZQJA 2SKDA 1EFDN 1QIFA 4Y2UA 2G5PA 5FAKA 4TV9F 1BGVA 1X7XB 3S1SA 1N2GA 2VAVA 3VO1A 1D2EA 3JV7A 5ALRA 1SIOA 4BLTA 1QPGA 3NH6A 4HC4A 3NHZA 5FCDA 5GPBA 4KQIA 1IXZA 3WZMA 2DJ5A 2XRFA 2EW2A 2QPTA 4ZXFA 2V7UA 4Z4TA 3KJIA 4V0KA 4YQEA 3CLUD 4IXMA 3DR3A 3SQLA 1EUDA 3HUTA 2G9RA 1ABBA 1J99A 2HR1A 2GM5A 3HEBA 4OHOA 3AZOA 2CL0X 3HKBB 1FP4A 4DJ5X 3TQSA 2JLWA 4H0FA 1L7BA 3K9CA 2NPOA 4HWPA 3SLNA 1DTSA 2PZBA 1L4GA 2FSUA 3F97A 3M4XA 3MCWA 4X41A 3WLMA 3FA2A 4JYZA 1WIWA 1YS4A 4OU5A 1G6Q1 4QUHA 5LMCA 4RL6A 4YX9A 1PFQA 1RKVA 2J6IA 3G1WA 4PLCA 2ZYRA 4FZ3A 3VHXB 2H4WA 1EGMB 3JU4A 2JD1A 3N53A 5L51A 2BD0A 3ADDA 2FG6C 3NEPX 4KXMA 2J46A 2I5PO 3RWBA 3U1BA 1IUNA 2FQQA 3CUVA 1VI5A 3GZ4A 4BVLA 3V4RA 3CUKA 1L4KA 3L7JA 4GKBA 4RNCA 4ARVA 2OQ2A 5A06A 5JSZA 5T8KA 1MHTA 3NTQA 4PC2A 2CGEA 2VQEB 2FMIA 2CHVA 2DH6A 1Q21A 3BXEA 2ACKA 2GXUA 2IV2X 4X7FA 2ZJOA 1T9ZA 3SYKA 5EXEA 3OZUA 3ZTTA 1DS6A 1VMIA 1AH2A