1W35A

Ferredoxin-nadp+ reductase (mutation: y 303 w)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena pcc7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w35A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w35A02
5TR9A 4TMZA 1CQXA 2C78A 3OZUA 3CC2B 1N0VC 1JA1A 1W2BB 3ZZ0A 3VNVA 1G7CA 2EIXA 3CCRB 3AGQA 1JJ2B 3WBKA 4ACAA 4RD4A 2VZLA 3E1YE 3QFCA 1D2EA 1FRNA 1KRHA 2BF4A 1ELOA 1Q86D 2VNIA 2VNKA 3CCJB 4UAJA 1VQMB 2PLFA 4AF6A 1YIJB 3QFSA 3OJWA 1QFJA 1R5OA 3AVVA 2B5OA 1TLLA 3U2QA 3CCVB 4EH1A 5TV2A 1ZM9A 2DEUA 4B48A 1OGJA 5THXA 2BVNA 2VNJA 2OK7A 4Y9UA 3CCUB 1XB2A 4ZGQB 1B23P 1K9MD 1TVCA 4LBVA 2VNHA 3E20A 1QVGB 3VO2A 1VQLB 3CCEB 1KK2A 3MMPA 1U2RA 1EFCA 2YWEA 3OZWA 3QFRA 2VYQA 1QGYA 2D74A 3WXMA 1BQEA 3WYAA 1NJID 1J9ZA 1EP2B 1BX0A 2BV3A 1QGZA 3P27A 3P26A 4DQLA 1QUEA 1JB9A 3WY9A 1F60A 3ES9A 1QUFA 1SKQA 4HE5A 4P3YA 2XNJA 3CCQB 4M4SA 1GVHA 4F7DA 2GPJA 3CCSB 4PGOA 4G1VA 1AMOA 1EWYA 2B7CA 2ZITA 4M2LA 1YITB 1E64A 4DQKA 5EMNA 3I1FA 1JNYA 1Q82D 1EFTA 4QHYA 2BGJA 2BM0A 1FNBA 1VQ9B 3JQPA 3V76A 1YJ9B 1VQKB 4YAOA 4PC3A 3G71B 3CPWB 3W2FA 2OK8A 4LBZA 2GQFA 4P6VF 1FRQA 2OTJB 1W87A 3CC7B 1R5BA 1EP3B 4YAFA 2RC6A 3ZBUA 3CW2A 4LC0A 1W34A 1D8TA 4FN5A 5HXBA 4C0SA 1TTTA 1VQ8B 3FJOA 3ZBTA 2HCJB 4WQMA 2DERA 2EFGA 4N3NA 1S72B 4ZCLA 4AC9A 2RC5A 1EXMA 2QTZA 4R71A 3JQRA 3AVWA 1QFZA 2PMDA 1WDTA 4ZCMA 1CNFA 3W2IA 1ZM2A 2QEXB 4QFMA 3CRZA 2X3UA 4B43A 4G5GA 4MYUA 3G4SB 3CMAB 4LBYA 1N0UA 5FA6A 3A1FA 2QA4B 3W2GA 4AF7A 2DCUA 4U9UA 1FNDA 4YALA 1ZM4A 3B82A 4G1BA 3W5UA 3AVTA 2E1RA 4YHBA 4Y9RA 3AVYA 1N8RD 1M1KD 1GAQA 4RD1A 3G6EB 3WNCA 1H85A 2DETA 3WNDA 2BN4A 1M90D 5GV8A 1DDGA 1KK1A 3CB4A 2BGIA 2C77A 3OW2B 3VO1A 4RCYA 1E62A 1G7TA 3ZC3A 1S0UA 1YHQB 3QFTA 1ZM3A 4TMXA 4BPRA 2QN6A 3W2EA 3W5HA 1QG0A 5AN9A 4ZGNB 2OTLB 3OZVA 1GAWA 1K73D 1OB5A 5KSWB 3B78A 4RD6A 3WBJA 3MCAA 1FNCA 4YAUA 1DDIA 4H9GA 1KC8D 2XEXA 1D1NA 1IB0A 3VNUA 3QSYA 4C43A 2AHOA 1KK0A 1EFUA 2PIAA 1VQ6B 2QDXA 3QE2A 1VQNB 2CRVA 4K1XA 4NBSA 1KD1D 1UMKA 3CCMB 3AGPA 2YWGA 2YWHA 1GJRA 5GV7A 2YWFA 1K8AD 1JA0A 1KK3A 4FK8A 1VQPB 4TMTA 3CMEB 1TUIA 3VMFA 1IJFA 1QX4A 1OGIA 5TY0A 2BSAA 1GR1A 4RJLA 1VQ4B 1OB2A 1QVFB 4M0LA 4RD3A 4PC1A 2FX3A 4B3XA 4TMVA 1E63A 3SJZA 3MHPA 1HA3A 1YJWB 1XE1A 3ZZTA 4RD2A 1EP1B 1GO2A 2QTLA 2BPOA 3W2HA 4ACBA 3PENA 5H5JA 4ZV4A 4IW3B 1H42A 1I7PA 4PC6A 3WNBA 3LVBA 4PC2A 3CCLB 1BJKA 2B7BA 2BMWA 4HE6A 4YAWA 1DARA 1B2RA 1R5NA 1VQ5B 3CD6B 1SM4A 4TMWA 1A8PA 3W5VA 3JQQA 4RD0A 1QGAA 1NDHA 3B8HA 4Y7CA 5JBQA 3CXCB 1KQSB 2CNDA 4B44A 4M1KA 4B4DA 3U6KA 1KJZA 2XNCA 1G7RA 3J81k 2R6HA 4LBWA 1BX1A 1G7SA 4B47A 4NCNA 4RCZA 1QFYA 1ZUNB 4M53A 1DG1G 4FWTA 2BM1A 2J7KA 2QMUA 3OJXA 1KTVA 1W35A 1AIPA 3AVXA 3AVUA 5DSZA 4PC7A 4Q7JB 4N3GA 2HMAA 1Q7YD 1IJEA 3I55B 4TN1A 1FNMA 1VQOB 3U6BA 3FPKA 3ZZUA 2NPFA 1QH0A 1FDRA 4MYTA 2HDNB 4ZCIA 1VQ7B 5H59A 1YI2B 1F20A 1CNEA 2DY1A 3CC4B 1YJNB 3LO8A 4J0QA 3LYUA 3I56B 1Q81D 3LRXA
chains in the Genus database with same CATH superfamily
1DC6A 5EIAA 5EAIA 2QPOA 5A4MS 3QOXA 3H5IA 2FPIA 4MULA 3HB7A 2Q27A 3SZRA 3MJFA 4M0EA 2NAFA 1KE2A 2QRHA 1I14A 4CG0A 2O1WA 5D01A 4IHKA 4BQIA 1OC4A 3QIAA 3GDFA 5IT0A 3CMMA 3EGVA 4CMGA 4G8JA 4MW4A 3VNQA 1GKLA 1IRIA 2X8JA 1DJPA 1H23A 2EFDB 4GYKA 2EG9A 2PUHA 1Y5RA 1IM8A 3S2ZA 1OC2A 3IELA 2OYNA 4FXPA 3ELDA 4FEGA 4X7CA 5J5CA 3WWPA 2VQ6A 3NGXA 5HSGA 2A0WA 3DZBA 5LUAA 1OYOA 1BD4A 1MA0A 1MUUA 4G81A 4ER6A 3D2AA 4UBIA 3GRYA 3ENNA 2W6NA 2OFWA 5FV7A 3WS7A 1JHYA 2Z9DA 4EMBA 4UW9A 3DOEA 3V4VB 3ZWPA 3FYTA 4Z9YA 2IXFA 3LDAA 1HLGA 4DA8A 3RG2A 2IFTA 3E1YE 3BICA 5CG2A 5DHUA 4PYQA 2A94A 4FFVA 2ZAIA 2PJDA 2JAQA 4G89A 3T3GA 5GZ1A 1UFOA 1E9DA 4H1HA 1Z16A 4XR9A 3EDQA 4RK5A 5E9QA 1CPYA 2BMDA 2CD9A 4KQEA 3WK9A 4B0PA 4WXYB 1SUWA 4A9AA 1BMDA 2YXEA 3HMKA 3TPZA 1MABB 4G5FA 4QDKA 2MWMA 1G8FA 3C6QA 1IWPB 1XZKA 2I8CA 2I3AA 3BMXA 4QPJC 8MHTA 4G01B 4M1QA 2BONA 4KH0A 3M81A 4JI8B 2PGNA 2V7GA 3ESBA 3VYWA 4OX9B 4RS3A 1J0AA 2W8ZA 1JHXA 3OCZA 2HI0A 1NQTA 2G5PA 3QLJA 3QJYA 4GUAA 2QI9F 4RHXA 5LYJA 2IUUA 3SCZA 3T15A 1P1KA 2Q5EA 3UCEA 1JVBA 2YXNA 1TPZA 3G88A 4Q4CA 3FSRA 3WQRA 3CY6A 1SQ5A 3GGJA 4V0LA 3KKEA 3SJBA 1UDRA 1X2EA 3ORHA 4U7GA 4BLTA 2FPKA 4RPDA 3PQEA 3R6TA 4P0TA 1WMBA 1TYAE 1YR6A 2PL1A 4MW0A 1JEAA 1EINA 1RLJA 4XOTA 2QHXA 3PQDA 5KYXA 4L50A 1QIKA 1VLMA 3NPAA 1RRPA 4HNAB 3L6EA 4UOZA 2VNJA 2FFJA 4TPKA 4ZHSA 4G0YA 3CF4A 1XIVA 3D4BA 3U39A 3QVKA 2G5TA 1GPDG 1NNUA 1NNLA 1ZNZA 2ZL5A 1VKOA 5P21A 4UU1A 4QUDA 1E61A 1SBNE 4G2TA 3BWEA 3MLBA 1W36D 1P4SA 4QATA 4E09A 4EA8A 1Y6FA 1DV1A 1XVVA 2ZE6A 1P0CA 2C5BA 1A82A 4BE4A 3DMFA 1QCCA 2R6FA 3L5OA 2RJOA 4JASB 4OM8A 4P4SA 3U4QA 2V3WA 1I32A 3ILVA 4EIWA 1JQEA 4UM9D 4JJAA 4EF6A 1W76A 2A9QA 1PJ5A 2AN5A 2ZJ7A 3F6SA 4L74A 4OYYA 5JALA 1GUBA 2J0VA 4DCGA 2VHWA 4L8VA 1NQVA 4AZWA 3FW1A 4C88A 3B6IA 1QGYA 2PSDA 2YNMC 2WSLA 3A70A 3DQZA 2Y9MB 1VI5A 3BDVA 1ONNA 1JV2B 1V0JA 2VYCA 3M3DA 3AG5A 5H68A 1LEHA 4Z7JA 5BYKA 1J9ZA 3MFQA 5CHEA 4A91A 4X90A 3IXMA 1YA6A 2A9VA 4E22A 2GS9A 4KE7A 2PT7A 4ZZ1A 3JD4A 2IW3A 1WUKS 4KIUA 4OI0A 2ORVA 3G8BA 1W25A 3FRJA 1MBZA 2C9DA 1Z8FA 2GXSA 4Z4YA 4DQLA 3OI7A 4K9OA 4G8BA 4OQNA 5AK0A 4YQEA 4RSGA 3X2EA 1R9NA 1KDOA 1NTOA 4Q18A 1ZRMA 4KTTE 2O0KA 1CY6A 4L0MA 2R79A 3PIIA 3EXEB 4G24A 1BC5A 4BIMA 1DKMA 5K0LA 3WLEA 2HXGA 1FMFA 2FQWA 2GARA 2XW6A 4HGNA 4P4TA 1KDTA 1UBKS 4LXUA 3V1KA 1N9GA 121PA 5L9AA 1IEWA 3ME5A 3HB5X 1M1NB 1P1FA 2X9QA 3ETEA 4GRDA 2ZSDA 4Q19A 5IZ4A 2B7CA 4M2LA 1Y1SA 1OYYA 5DM1A 1WMSA 1ZN8A 2OBYA 2UUOA 5U4QA 1OHHA 3LUCA 5GONF 2A88A 3LCUA 3X1DA 3RI3A 4XPZA 4Z1OA 2I55A 3RH0A 4KMSA 4XWTA 5JCZA 1Q21A 4LWOA 3TTYA 3WGYA 4B87A 1CUUA 1RTTA 1WCXA 3GLTA 5E6UB 2HKIA 1ZK4A 2AFRA 5E6SA 1MP0A 4FI3F 2H17A 5KSYA 4W9RA 2X5KO 2BGJA 3E8MA 3Q7PA 2VAWA 2PG3A 2VJCA 3FCYA 3IT3A 4KEAA 1DO0A 1PT8A 3ZGZA 4DR3B 3H4VA 4YAOA 2HMUA 2VJAA 5GAJA 1AHNA 2Y76A 2YJ3A 3H2YA 3RBAA 3ZNQA 3ZHQA 1LBIA 1EGAA 1V7CA 4Q4HB 5KOHB 2FZCA 3I01A 4IFBA 4NABA 3PR3A 2DUJA 3WC4A 1XAJA 4PVDA 4W1RA 1ZXBA 2NPIA 2X3YA 5CDUA 3GCGA 3QE4A 1T4BA 4P53A 3I1IA 3FVRA 1Y8RB 2IHKA 3G02A 1R0RE 2Q4DA 4NU6A 3T5DA 4TXHA 4DA0A 4ZQIA 4EM6A 2RC6A 1SCIA 1F8XA 1VA5A 3V1LA 5B4UA 5BRJA 2CV2A 1KZ9A 4BFCA 1Q1EA 2JAUA 1MQ9A 4HSGA 3COYA 3OD1A 2CJXA 3RAEC 1V11B 2NU7A 1EDBA 1CSEE 1CLUA 1L4NA 2VK2A 1RD4A 3I6QA 3OCXA 3ZI4A 1N1GA 3ZR4B 2HHJA 2HRBA 4YUZA 5JTTA 1VYTA 3IUEA 1TYZA 5B6JA 2Q29A 5T8KC 3LLSA 1W5EA 2W4IA 3OT4A 5BV8A 4FFBA 4YXWD 3AU9A 8ADHA 4YV1A 1G8YA 3ZWXA 1EU1A 3EA4A 1ENYA 1V95A 1DJNA 2Q3BA 4YECA 1NULA 2AK3A 3OBIA 2Q99A 4GYJA 3MJCA 4KK3A 3BMCA 2YW2A 4RJKA 3H9QA 5K3EA 5KTMA 4QOEA 1C0LA 8GPBA 4RJTA 5IUJC 2PRSA 1U3TA 3FYUB 3N59A 3LOUA 2P77A 2A7XA 1PLLA 3BS4A 3D81A 3MT7A 4NXNB 3SJPA 1FFSA 3IXQA 3IQEA 2CW5A 4H3HB 4M9XA 4A0RA 2J0QA 5CBKA 4XJTA 4IWYA 4QNMA 3AUFA 4AIRA 1OTXA 1WV1A 2PXHA 1D4OA 2CFRA 1G59A 1GNQA 2FDRA 1W5FA 2X3UA 4JXKA 4MCAA 3HDVA 5CVVA 3ZHTA 2OECA 4ZCRA 2JD2A 3HKDB 1VJSA 5JSKA 3TD6A 3E23A 2FJPA 3NBXX 1ZUD1 2WU4A 3RTGA 1N36B 3VH2A 1T4DA 1GCIA 3SC2A 5CB4B 5LWHA 2QLJA 3KB1A 3KT6A 2QA4B 1ZMBA 1OJ7A 2X2OA 3KPWA 1FUIA 1PYDA 3OU6A 1EFVA 1LBEA 5G4KB 1L5LA 1XTVA 1HC7A 4URZR 5HDBB 1O4WA 4JVOA 3ACDA 5IX8A 1EK1A 3AF2A 4ZMBA 3BN3A 3OLQA 3TTWA 3NHFA 1FXWF 5JNLA 3L8ZA 4MROA 2Q5IA 5CYPA 1J99A 1JKJA 4RH3A 2CXUA 4UD6A 1UP6A 2BFBB 4AMGA 1TEZA 3KQYA 1E4VA 1FFAA 4RCVA 3LOQA 1VHLA 4H7PA 2PKQP 4Q3CA 3THXA 3P5BA 3A9VA 4PAGA 5HMLA 3TM5A 5KTYA 2EL9A 4F4CA 3L7LA 3PXDA 4MJ3A 3EPJA 3AV0B 1Y48E 3LUGA 4PRKA 4RMIA 5GONB 4HNHA 2J3QA 1W96A 1TKRA 4OQMA 2P8JA 2OC4A 3K1TA 3FPPA 1XXHA 1L3BA 1UAGA 2GF9A 4H17A 5KDLA 5KNBA 1IC6A 5DF1A 3M3HA 2IOYA 3GFTA 5HRAA 1EH5A 2G77B 4E31A 4LGMA 3ZV3A 2BT4A 3I45A 1NHWA 3CU5A 4WV3A 2BR4A 2KS6A 1NV8A 4I2NA 3OE5A 5EWJB 5JVDA 1JFTA 3BAFA 3LDGA 2ZL6A 3BY2A 3EC7A 1IZZA 4TKOB 2DYIA 1YRLA 3PLRA 5L3SA 3RUHA 1G18A 3V8RA 4Y98A 1X1RA 4FD3A 5KUTA 2ZUUA 4XGQA 4LJ9A 2AJ8A 1E1LA 2OD2A 3R3SA 4YPOA 3GJ5A 1MJGA 2DLCX 1DO2A 3PWTA 2C61A 4QRHA 4FGUA 2QX7A 3N2IA 4PV7A 3KHTA 3ND9A 4J0HA 4BGDA 2OBNA 5JLAA 1B2LA 5JPIA 3P2YA 1J0XO 1UFKA 2UU9B 3KQKA 2QENA 4REQA 3OQJA 1UZUA 3VR4D 3F5DA 2O1XA 3FM9A 4N0EA 5AWFC 3WJ7A 5CNKA 1Y37A 5J2UF 2R7MA 4LMAA 5KAPA 5KHOC 1X9GA 5EMHA 4BBAA 4I1VA 4OLBA 1KI4A 4H18A 4G5OA 1O77A 4D8WA 4FYXA 1N5RA 4QX6A 2P1RA 1DC5A 3ICWA 2VHCA 3TGWA 5ALHA 1NJ2A 4R41A 1NC1A 4HQRA 1QQAA 1E2BA 4HNRA 2D9RA 4Q1VA 4DR5B 2HRDA 1OAOA 4O02B 1ONOA 3AR2A 4IDOA 1MB2A 4GSYA 1BFDA 4RHFA 1U11A 1PG0A 1U8YA 4F8YA 1JG6A 3KHSA 3G82C 2C99A 2R6JA 2EQAA 2NUPA 4PAMA 5FHRA 5J5AA 5K4GA 5BWOA 4RTPA 3M6WA 5EHIA 1BS1A 5J2TB 3GT7A 3PKIA 2J0UA 3N9IA 1I4TD 2GEVA 1WUYA 2W2QA 5DMXA 1ZA1A 1NC3A 1N25A 2R87A 2RHJA 3PHHA 3FWHA 2VBUA 3AUXA 3UQZA 2PO5A 1C9EA 2X8AA 4NV0A 2HK9A 2X4GA 3G2JA 3KFLA 3QVWA 3Q9SA 5FADA 1C30B 2Q5QA 3COPA 3V4LA 4GL2A 4LVUA 1QVFB 3PDUA 3FLEA 5ERXA 3IOMA 2ECPA 2HQ1A 2FX3A 1NBMA 2J46A 5JC8A 2EKBA 4P4UA 1QR2A 4QTYA 2OHIA 4WY8A 1K6IA 1T9ZA 3H2JA 3N0VA 2DWOA 3UB3A 4UQPA 1K7SN 3RD5A 3JYNA 3NIBA 3STUA 3UMJA 1UPCA 4UHCA 3OQ1A 2H2GA 5DHRA 2BGNA 4HRYA 2BY4A 4YAGA 3H6GA 1MHTA 3AFIA 1X1CA 2N0SA 2ZUCA 1LI5A 3AKEA 1Z26A 2HMWA 3IGFA 3LHDA 2QP3A 1I01A 5E4TA 3RFFA 3BFXA 4HYYA 1RWKA 3UENA 1TC1A 4DPMA 5KHLB 4DV0B 1I3NA 2BZ1A 3FFTA 4QD3A 4BFWA 1AGXA 1E2FA 3M1AA 4JK3A 4TXJA 1Z4NA 4X1YB 1MDBA 1YE3A 4RUKA 2OQ2A 4RTJA 3R5XA 3TTXA 2E82A 4C7XA 3QYAA 3FNIA 4X1YA 4C08A 1O9HA 1WMEA 1JYEA 1UBUS 2WKWA 4WBXC 1AUVA 4YRDA 1XN1A 2J9RA 4JX8A 3QKUA 1QF9A 3BEOA 2JGLA 3AHCA 1Q12A 2VHQA 4XI9A 1HORA 1JX6A 4ABYA 2WMDA 1DWUA 4ZI5A 4BVFA 1CF9A 1C4KA 4MR8B 3HBJA 3UWOA 4D5EA 4DGQA 3UKOA 4GT1A 3ZZMA 1UKVY 5ILQA 3EXFB 4EYEA 1WCWA 2EEPA 5J1TB 5TT1A 4J7XA 4FOSA 3FOWA 5CNJA 3TD9A 1DXYA 4O08A 3RVMA 2YDYA 4EABA 4RK1A 4HWRA 1UXKA 4B9EA 4RA9B 3I58A 4JB8A 1JJFA 2RD2A 2G4CA 1C30A 2K2QB 1ETUA 3I9KA 3V8PA 1O95C 5T6BA 2YXDA 3V2IA 4Q5IA 4ZIRB 1JHRA 2J4DA 4B47A 2ECQA 3C6BA 4FDAA 1B7GO 2PEZA 4JEHA 1KAOA 1F48A 2H4JA 4QT0A 4NOLA 2DBRA 2VXBA 1OIXA 3QU4A 3EQ2A 2Y9PB 4CPDA 5IJ9A 1BMQA 2J0UB 3MOIA 4LY6A 1WZCA 3PTLA 3L7JA 3H3JA 1RQXA 3AERB 3G1WA 2A5YB 3IQWA 5AHWA 1GZ5A 3ITKA 1Z6PA 4KQIA 4BECA 4ENUA 4IVRA 4YCBA 2CLSA 2CNKA 2NUPB 2ZIEA 1OU0A 2Z5LA 3MB8A 1K6EA 4LCJA 4R2MA 5EFZA 2VUIB 3T56B 1VGVA 2EX4A 5ADVA 2OT3B 5TQ2B 2RIPA 3HU1A 4INJA 3IIEA 1TJPB 3LQYA 4KXVA 1CVIA 3NHMA 4MLZA 4OOEA 2J1LA 3LHIA 1XZ8A 5MFZA 1OPXA 1K0UA 3QQPA 2NVUB 1CP3A 1UIMA 3CUYA 2YZ7A 1TEXA 1F4LA 1MB0A 3OJFA 3Q5GA 2JLZA 1JHAA 2CXXA 5AD1A 4LZWA 3JCZA 3DPSA 2HDNB 3KOWA 4ARCA 4B33A 1KMQA 4YROA 1Z0SA 1YI2B 4OSPA 3CJTA 3FNGA 1V8PA 1GTL1 2GJ9A 3CF2A 3VNAA 3TXYA 2XVYA 5A05A 2FZ4A 4CQMB 4FZ3A 4J0QA 2BGKA 3N8KA 4MYDA 3V34A 2ISQA 2OCDA 4E4RA 2HK7A 4K9RA 1NLMA 5C2JB 5KWEA 3KK0A 5AK4A 1YR1A 2GEKA 1H0KA 1OA1A 4PSAA 5ENZA 3IV6A 1ORDA 5IH3A 2EAUA 6GPBA 2WB4A 1D2CA 3G89A 3M6IA 3OPYB 4JC5A 4WZZA 4E1BA 4HNVA 5L3SB 1T5EA 2DSTA 2FDXA 3AY3A 1GTZA 1XZNA 2VDNB 5AI6A 5EWJA 5CYOA 3C97A 5JVDB 3H8JA 1P6XA 3SS9X 4AK9A 4CQLA 4NKRA 2G0NA 1YAHA 3MJTA 4HEJA 1G66A 1T9BA 5AESA 1ESDA 3ZVLA 4X97A 4EPVA 3CWCA 1RPNA 3KR1A 3Q3JB 4YELA 1JEOA 2XEDA 3MRSA 4XJXA 2DTXA 2YV1A 4R2JA 2RJNA 3B2EA 1DEAA 5HZBA 1GR0A 1XXHB 2E89A 3ASYA 4ID9A 4Z1MD 4LZAA 3DUWA 1M8PA 5B7GA 5IANA 2OMEA 4XOIA 4LRTB 3RYCA 3D8BA 1SC3A 1P7ZA 4JXJA 2J59A 3ILXA 5DBHX 3TJRA 1KEKA 2EJBA 2VPWA 4TSKA 3X0DA 2BSQA 4YO7A 3PQ8A 4MXDA 4X91A 1LQTA 2P9BA 2NWQA 5COAA 1RJEA 3D8RA 4GOXA 3K1YA 5IMBA 1WW8A 2SNIE 4CR8A 2VWGA 3GROA 4RO0A 4BLPA 1HFWA 1EK2A 2VNIA 1E3DA 1P2DA 4ZWNA 4CU5A 4D9KA 1ZUHA 1Z2OX 2OO5A 3CCJB 4U2CA 2EDCA 2QRGA 3RS3A 5C8YF 4D9NA 1XVTA 2ZPAA 1EFVB 4TTIA 3MGCA 4WDRA 2IYOA 4XWWA 2BRUA 2QQFA 1R0ZA 2ISCA 3T12A 2YV4A 2AFHE 4DWOA 5GADl 4CM6A 5JBNA 1NNSA 3AVVA 3Q88A 2PT9A 4WOKA 1J2EA 2QDKA 1CIVA 1HE4A 4GF5A 5AKZA 2P0AA 4HJXA 4RZUA 1NJ8A 3RBXA 4YQYA 3AB8A 2XGOA 3PPVA 1YQEA 3RPEA 4KR2A 2IX9A 1WQ4A 2RBEA 3DONA 4B48A 3IDSA 2P6MA 1EX7A 1GTVA 1TO2E 3AEXA 3GCDA 3K5HA 4M1EA 4Q01A 421PA 3ZHUA 1Y4DE 1T6NA 3DHEA 3E22B 2AFIA 2GHRA 4RDHA 3JS5A 3KYDB 2AMVA 3DFKA 1ZJYA 4MW9A 4N7RA 4Y9UA 5DTEA 5LDGA 3ZH9B 4YS6A 2Q49A 1B0ZA 2H0RA 1YS4A 2IZ6A 3FF1A 3BXEA 3IQDB 1XB2A 4E2FA 1HE8B 4AJ4A 1GZDA 4LXXA 1NATA 1KS2A 3V7FA 1SHUX 2BUBA 2Q3MA 3BMCB 4TTVA 4FKMA 1LPBB 2H4FA 4Q3EA 3E20A 1P2FA 1A2KC 4ZQHA 1GEGA 1MQSA 1QHYA 2A67A 2FUCA 4HPXB 4I9GA 4R8LA 4UCQA 3OIYA 4D3XA 4EHHA 5CJJA 2VJNA 3ZJYA 3IAAA 5CURA 3STWA 1CERA 4F5EA 9ABPA 2D7DA 4W8GA 3S2IA 4FFWA 2RSLA 4MWGA 1V5VA 4MRRA 1SXGA 4Q3LA 2PX8A 3IILA 1X77A 1Z5WA 1E2UA 4HZUB 3TI7A 3I32A 5CITA 4M1YA 3U81A 2GCEA 2ZJ6A 1XMQB 2D74A 3IMCA 4YNBA 1P3DA 4FJ2A 3TL3A 1L7QA 4MHSA 1QFSA 5FBKA 1VXRA 3RT1A 1CIJA 1KYIA 2VPTA 1C14A 2ETXA 2VZ9A 5I9MA 1PI3A 2G25A 1N5KA 2LCIA 2OCXA 2ON6A 4KLZA 2V7QA 1DHTA 4JEMA 5T4FA 4F56A 1ZKMA 4A92A 2XQVA 4H6XA 2FUNB 5FEMA 4IEFB 2JHGA 1RPJA 1OV6A 1L5OA 3ZWOA 3GY0A 3A31A 1QUFA 4U0JA 4XQ9A 4G4GA 4HE5A 1B0PA 4GH5A 2Q4EA 5JADA 3HUFA 5BV1A 2HWYA 4PS0A 3ZCXA 1KEWA 4RVSA 3VR2A 3ZEAA 3IVGA 1TTHA 1F0KA 3KSBC 3BBLA 4DLRA 4UHEA 2B1RA 2IUEA 5G3YA 3WMXA 2OFXA 2WJ4A 4DSZA 1VHDA 4YLEA 4RDKA 3C3KA 3Q41A 2FQYA 3Q1LA 1ZA2A 4HH0A 2ZITA 4NNJA 2NXWA 2FEPA 4IF4A 4PPGA 1NB0A 4DQKA 4XGNA 3WAJA 4FQ8A 4D4JA 2PZGA 2PFKA 5THKA 1TRKA 4N41A 2FGJA 2ANCA 2H1CA 3TLXA 1HE2A 3LWNA 3HRKA 4Z0HO 4B84A 8LDHA 5CA0A 4YMUA 1F8GA 4U2KA 4MUKA 2C03A 3LVFO 5KNBD 2AV6A 2ZUBA 3K4PA 4LFBB 2GZSA 2LZ0A 3PNVA 4IDGA 4PPNA 2ACVA 1IMJA 4DCJA 3BHMA 1WXEA 4RULA 5J4VA 1Y3CE 1EB8A 3V76A 1PDOA 1XHLA 1ABEA 3AKCA 1GPJA 1I2CA 3OX4A 4HDNB 4MQ6A 2GZAA 2ZYUX 2Q62A 1LU9A 2MR5A 3OIFA 2B2XA 2JCSA 3PDHA 2F8MA 2VSFA 2Q3FA 1ND5A 1ULUA 1SD1A 2EFHB 2I6XA 2X0NA 1MGPA 4U0KA 4YK7A 5LZ5A 2VC2B 3UJ3X 5L4LA 4Q1AA 3F1KA 5HOEA 4YAFA 3D5TA 5AIBA 1CBUA 1RAGA 2D2IA 2E7ZA 2YMPA 2ZTMA 4HB3A 3L8EA 5CPFA 3TQIA 5IJ0A 1UOPA 3QEOA 1S2NA 4DK0A 3EXHB 3WSTA 5AI4A 3WYFA 5DM70 4V0NA 4EJSB 1M67A 2L82A 4NOMA 3RO7A 1FS6A 4KP7A 2PLAA 1S1CA 2IYVA 3JRNA 3ADDA 3U60B 1M74A 4OBBA 3T7TA 2XR1A 1Y1PA 4N0DA 3IDOA 3NX4A 1LPOA 4U1RA 2YHIA 2YCBA 1LV8A 3IEVA 4LGCA 2R6GA 2HRCA 1DT3A 4US2R 1F9AA 2DRIA 4I46A 2RE8A 4MV7A 4QE3A 1C8KA 4DANA 3G5LA 3H04A 2UYOA 4P4SB 2HCJB 2W2LA 3CR8A 5ED0A 1I4DD 5EZ5A 2X86A 3WBBA 1UH5A 2HEGA 1CDZA 2A5JA 2JIDA 3NH9A 1BXRA 4H08A 5LIRA 2CF5A 2RCNA 3S2YA 3IP7A 3T4EA 3U19A 1TD9A 2IUTA 4RF4A 1AZWA 2HHAA 2W8BA 3H83A 4KR0A 4FVTA 3USES 4ESOA 2YKGA 2O7QA 5DNDA 3B1XA 4QOIA 5K0ZA 3ORYA 1VL6A 3KKOA 1EFDN 4NYIQ 4JKIA 4IIJA 4F60A 1U9CA 5C5DA 5KYXB 3VSDA 1QPZA 4BU0A 4QAJA 1CJUC 3S1SA 3ZWCA 1U98A 2FXIA 5BUSA 1QGUB 4QFMA 4ND7A 1W2HA 3KM0A 4HXEB 1RRCA 2AWNA 2J3DA 4MYUA 2ZDHA 3LD9A 4M54A 4ZT4A 1WVIA 3MCTA 3I1JA 4NZZA 1SKYB 4KU4A 2VOJA 2FPPA 4JBNA 3CLTD 1AD2A 3FOFC 3K2IA 5ESDA 2IHYA 3ENZA 2W2TA 1PGQA 1V4BA 2NZJA 4KN5A 4Q12A 2VXOA 1HZEA 5EQDA 4F4IA 2PLNA 2QM8A 1I8TA 4QHSA 3G9XA 2HSEA 4U7PB 4CKYA 5HXAA 4MVJD 1XL1A 4X3OA 4UMEA 2I3DA 1OPRA 1RVV1 1PJZA 2FG5A 3N7UA 3NUQA 3VR0A 4FNOA 2JIQA 2QORA 4HH3C 5BVHA 5IFLA 2C5GA 2E1RA 1WW3A 3ZI7A 1NSFA 4LUCA 1ZRHA 3I0ZA 2ZAOA 2IYFA 3ZN2A 2R7KA 4FIZA 4C4YA 3RYFB 2KM1A 1XTQA 1NOKA 3V42A 1E6MA 3ZWBA 1M5TA 2RH4A 1MAVA 3PXAA 1PG5A 1ZN9A 3HJBA 4HDCA 3NRBA 4AMVA 3WLAA 2B7LA 1A72A 3U7RA 4WBNB 3AF4A 3IIMA 2B94A 4ZHQF 1DDGA 5I5GA 4PABA 2YWCA 3BQ9A 3LIPA 4TLMB 1JZTA 1SXJE 1SZPA 1VL8A 4XOUA 4LJLA 5AKHA 1NWCA 3FB1A 3P9XA 5K3SA 1ZR4A 3ZQ4A 3O92A 5C8YB 1YC2A 3CRQA 4Q3KA 4BX8A 4E2ZA 4YV0A 2G4LA 3QU7A 4XVQA 1SUDA 2YVLA 3N6VA 4JA2A 3G8CA 3GK3A 4LGVA 5EE5B 1E1NA 2NZ2A 3C8MA 3SR4A 4ILEA 5FYQA 4WPGA 3UOWA 3P71T 1P7VA 2XT0A 2O8EA 4J2HA 4JJEA 4M7WA 1GUAA 3DAFA 4ZGNB 2V7EA 4JP1A 4AJOA 5JSZB 2FH5B 3BJZA 3ESDA 5G1NA 2NQTA 4WXRA 4JQSA 5T3UA 1FRZA 1POXA 5G4LA 3WYNA 1T34A 3TQCA 3ZDXB 2O8DA 1Y7IA 2C88A 2HSZA 4O5OA 3HU3A 5HPYB 1SB9A 1JSXA 2A3NA 4WK2B 5F5NA 2YH2A 4IY1A 2CZQA 4R16A 1RZRA 4WZKA 1G2IA 3A6PC 1T2VA 3TW8A 3DPUA 4EELA 3PUNA 3VNUA 2H7XA 1ESEA 1G16A 4GPZA 3HNOA 4LOIA 4GVLA 3IBTA 5ICFA 3OJEA 5B4VA 3TAHA 2GZDA 3EVFA 4RY8A 4AG3A 1K8YB 1CRZA 3DVLA 3M1YA 3L0PA 3GRPA 1OTYA 1R8SA 3RK4A 3WE7A 2E4YA 3GNQA 1QCZA 2TECE 4M9ZA 3GMDA 1O6CA 2P2GA 1RT9A 3NJ8A 1T9AA 2GVDC 5REQB 3B6ZA 4EUSA 3N0TA 4WCVA 5JO0A 4WKNA 4XDYA 4O1IA 1H2ZA 2Q0SA 3QVXA 5FA8A 5ALDA 5JCPA 3EA5A 3RS0A 4DWJA 1JG4A 3UMMA 3FWPA 3M9XA 3NEYA 4XTRA 5DU2A 3RGWS 3VNBA 4D97A 1UJ2A 5K6TA 1Y7TA 3IUNA 2IYEA 2XUFA 4CLXA 1UBSB 2GZ3A 4D41A 5DNUA 4KI0A 3B38A 1FQJA 1K8QA 3IAUA 3L6OO 5FH9A 4U3JA 1Y3FE 1JHDA 1MB4A 1J4AA 4CG2A 3AOEC 2ZIXB 4UM5A 1OB2A 2CE7A 4NQZA 3HJUA 2EP8A 3RKRA 3WK4A 2UVPB 1PJ3A 3LBYA 3JZIA 4Q4JA 4HXYA 5D8DA 5AW3A 2P6PA 2DBZA 2V6MA 1IZ7A 2XAUA 3MQ4A 3VU9A 3I39X 2VRBA 1TPYA 2CJWA 3IJEB 4WA7A 2ODWA 2BP7B 3MGBA 4ZU6X 3RUIA 2FETA 4NJEB 2V3CC 4W5NA 4DTIA 3RARA 1O97D 3DHYA 4B6JA 4JQCA 2ZB8A 2WJHA 5D3MA 5ED4A 1ZD2P 2FWJA 1HGXA 1PQPA 3EUFA 4MX8A 1T2FA 3OIGA 3REFA 2SECE 4V24A 1APBA 2GREA 4ZV4A 1CRQA 2X15A 5LA6B 3RC2A 4HC4A 1TM3E 3AUAA 4XIYA 3H0EA 3O8CA 1L4FA 2DX7A 1PRYA 3GJ8A 4PC6A 3R7FA 1DAEA 1MB3A 2HYDA 3QX9A 1QAMA 2VH5R 1DSSG 4LDQA 2RKOA 3SSNA 5EJMA 4ENPA 1P62B 3U7HB 1WHTA 3O90A 2H85A 2AB0A 3DP7A 5L3QB 1T0PA 4DSUA 4DR7B 4KQGA 4NZNA 1WZIA 4I3FA 1JLSA 1DARA 1HZZC 2VDLB 3FA2A 4RVFA 4TLCA 5D86A 1GUFA 3RNLA 5AR1A 2WPNA 1T6XA 1KOLA 3BMNA 3BOSA 3MCVA 4LI0A 1I6LA 3LT4A 5DEOA 2R1TA 3R7LA 5AW2A 2P9JA 1JS1X 4ZQCB 2RBKA 1OZFA 4UTZA 2CNDA 2VCEA 2X4DA 2ZU6A 3O73A 3H9GA 3I9V6 3O7WA 1CJCA 2ODPA 3PUJA 4H7IA 4CV2A 3IUMA 1DAPA 3RVKA 3HWRA 4FFRA 4QEZA 1G7RA 3TZBA 4DMFA 3EXHC 2GZRA 1W19A 3CZRA 1TMYA 3JAKB 2GN0A 3DTVA 5AVUA 1ACLA 2NO6A 3KOYA 3RU3A 3S4YA 1QFYA 5A4DA 4P35A 2HQBA 2QLTA 2VZ0A 3H2IA 4PFSA 1RYBA 5LQUA 3OQIB 5JAZA 1HETA 1P8AA 4Q66C 4MSUA 1CIPA 3CKMA 3W4IA 1Z6ZA 3E8SA 5HIJA 3CO5A 4LKRA 5H83A 3SYRA 4I50F 1KEUA 5D2CA 5IHXA 4PC7A 1PTKA 4Q7JB 2BTQA 4QECA 2CY0A 5FP0A 3ZLJA 4N3GA 3VPFA 2NPOA 3DDOA 3GC6A 3RCBA 4LJ6A 3T5BA 2DAPA 3IODA 3OY7A 1MRNA 1U8AA 1BU5A 1Y1LA 2AEFA 5IM5A 1IH8A 1KZ4A 4L8GA 2OHOA 3P9RA 4Y6GB 4BKRA 3BWMA 1W0JD 4MP8A 4BO6A 2JI4A 2WIBA 5JWOA 1H8ED 2GK6A 3FPKA 1N6KA 1XHFA 2ZIVB 2Q9CA 3DKIA 4OGWA 3PFNA 4TYMA 5A2GA 1BOFA 3TX2A 2WSMA 4E5NA 4S3MA 4MUEA 4YT8A 3IMFA 3I52A 3WV4A 1EDOA 3LC2O 5ECGC 2HM7A 3SGLA 2PH3A 4HDOB 4E3ZA 4C6TA 4E3WA 4FZRA 1PGOA 3IC5A 1XWFA 1F6BA 3PCTA 1O5IA 5CHYA 2LXNA 3QGMA 4D99A 3NUGA 2OGWA 4L5YA 1EQ2A 2UZAA 3CLUD 4ZVVA 3URMA 3SHVA 3BL6A 3MWEA 2QZJA 4OI1A 5CB4F 1XVUA 3DDUA 2PT6A 5ADWA 4ILKA 3EXG1 3ZCPA 1KDZA 2P75A 2B99A 4DHWA 4YAIA 1A88A 5E1MA 3SVLA 5IZCA 2ZJYA 5IVKA 3G6KA 4I5FA 5I8PA 2JVIA 4F9TA 1V16B 4IGEA 4DBVO 1DIOB 2H8KA 3L6CA 2HTFA 1MEOA 3BH7A 3GDWA 3ZW8A 5CDSA 2HU2A 3Q15C 4TRNA 7YASA 2AT1A 4B2PA 2CHGA 1MIOA 3HVJA 5L40A 3D59A 2ZZGA 1EAYA 4D9IA 2P91A 3L4KA 3NKFA 2X0DA 2GZHA 1KYVA 1ZSNA 4ON9A 4QGGA 1SBYA 1ST2A 4MO9A 4P36A 3RFCA 3TBKA 1RNLA 4G9BA 2Z6QA 4LRXA 3OTGA 3IVAA 4E08A 1Z37A 3HR8A 3W78A 3U0BA 3TL2A 2HSWA 1R0WA 4BYMA 4FFPA 1OKKD 1SK8A 2HV9A 2Q6TA 4BMZA 4IRMA 1DTWA 3MYYA 4NI5A 4DJTA 4AWBA 4JEUA 1MO3A 1X42A 5AHXA 3ZHSA 3SR3A 3T3OA 3CUKA 3Q6IA 4B3JA 3PS9A 4D4HA 2HADA 1Q86D 1BXGA 1EK5A 4Y0AA 2O2SA 2NTNA 3WYBA 1I0IA 3AIMA 1T43A 3M34A 5MGNA 3UB4A 4JSRA 4AY2A 2KVOA 1T3ZA 4OYLA 1NJFA 4B17A 2OXCA 2G80A 1M1YB 4YJ2F 1CE8B 1VKNA 2OSBA 2A0UA 2YXBA 4ZVMA 5K20A 1UADA 2GPTA 4PNZA 2ZYWX 1XAHA 1P75A 2CD7A 5D6NA 1GAXA 2ZKLA 4KDFA 3HNPA 1FYWA 2PTGA 1HFJA 2GFQA 1XMVA 2H1FA 5IUKC 4ZJUA 1R5OA 2GPBA 3Q0IA 4D4MA 4HT3B 5K09A 3AP2A 2IY9A 2K6GA 2Z08A 3EG9A 2V7VA 1A04A 1VPLA 2QSZA 3T41A 4AXBA 4LISA 1Q9SA 4H0NA 1NVMB 3EIQA 5FR2A 4EVSA 4IAOA 4KLNA 4CR7A 2D1RA 2G1JA 4OOSA 1RI4A 1SIUA 1JAIA 4FHFA 1VA4A 3G5UA 1H1LB 4F1WA 5JHGB 4AWAA 3EPPA 3G13A 1PJSA 2Q45A 1ZD5A 4H1UA 5EJ4A 1QP7A 2ZYGA 2YJ5A 2R5WA 1MPXA 5BR8B 4DREA 4KR6A 2UYQA 5HE8A 2FZWA 4DAEA 3SM9A 3UUGA 1J1ZA 4W5OA 3A1SA 3IP5A 1QG6A 4KJXA 5CB6A 3D02A 5B12A 3GLVA 4G1FA 3ZKAA 3D3QA 4KN9S 3HHEA 4TN5A 4NULA 3PBKA 3EX7C 3I0NA 4PF1A 5HE9A 1C81A 3RKSA 4JUFA 4BFLA 4BC0A 3WYEA 2O2XA 3DYBA 3JALB 3TB4A 2H07A 1NE2A 3FDJA 2PANA 3FVTA 3IUJA 1ZN2A 1D07A 1QIEA 2NU9A 4L4YA 4PCVA 4AICA 4Q7EA 1BMFD 2ESRA 4KO4S 2IU0A 1DZIA 1HYEA 1L7EA 1WMAA 4L3WA 3CESA 2R86A 3RF6A 1L1EA 1WUJS 1WZNA 3L0SA 4CRWB 5EJIA 2W2KA 4RKEA 4AJIA 4RM0A 2C8VA 2FK8A 2FPSA 2XNDD 3AEQB 1U2EA 3DYIA 4ETMA 5C1BA 2VJOA 4KLRA 1CJTC 2IY8A 4BNFA 3GRUA 4CF4A 1O6GA 3DZ8A 3UWDA 3JAWA 4D26A 3P26A 2PQMA 1ADGA 3KAJA 1Q2XA 3WGUA 1WDLA 5AP9A 4R3UC 2PPLA 3CNEA 4CM8A 4D80A 4YV2A 3P0FA 2C2OA 5C7OO 3ES9A 1F14A 3WIUA 1SKQA 4JI1B 4P3YA 1SC4A 2JLQA 3CCQB 4X8MA 3HBAA 1MT0A 2Z58A 2GZ1A 3PSHA 2MSCB 3LFHA 4ZVQA 5SY9A 2XY4A 3ZK7A 4B80A 2EJVA 4E5KA 3G0GA 1CKEA 1J07A 3OM9A 2YRXA 3Q6RA 4I36A 2NW6A 2OBXA 3S99A 3T5TA 5AM1A 3BD6A 3OHSX 1E8NA 2G72A 4FZ5A 3R0ZA 2BM9A 4I9FA 4D3YA 1JBQA 4AJJA 1XLTC 3NBZC 5BMOA 3UCFA 1CHNA 4ZPJA 4DZTA 4MWSA 3U44B 4PWZA 5I9TA 4C9BA 1DADA 1DP4A 3H87A 2P4EA 1UPXA 5DK6A 5C8DA 1YR2A 3CLHA 3SDBA 1P81A 3TEMA 3DD5A 3TF5A 5ALWA 1K89A 2LVBA 5LQAA 1CZNA 3FKSD 1Z82A 1N5JA 1XA3A 4HNUA 4R6XA 3MEQA 1OX4B 1N2XA 2JLWA 1FCJA 1KOFA 2P78A 1XC7A 3U0VA 3VKGA 2NO9A 5GQSA 4TXNA 3T7EA 2XDWA 1YVRA 5FUQA 3QBTA 1YJ9B 1DKNA 4HDKA 4ZDIA 4DRXA 3QVOA 1GUDA 1SCDA 4PC3A 2AQKA 3D8UA 4KX5A 1IOWA 1XJ0A 2CEKA 2QAGA 3CPWB 4S1VA 2GPYA 1G60A 2EFJA 1IXSB 3I9V1 4GWGA 4XXHA 4AVZA 5F77A 1CXZA 3I9LA 1QE3A 2ID9A 3Q5DA 1IL0A 2ZSIA 1C4XA 4YJ2B 5UKDA 1A50B 2ZJ4A 2I62A 1L5NA 2W4MA 4RK6A 1UBOS 4JV5B 2YVAA 3AJRA 5A4AA 1CFJA 2BCGY 3O0DA 1KNQA 1SEPA 3OTWA 3PVZA 3OJOA 2IH4A 1X7WB 4K9KA 5FJJA 2CLEB 3A8JA 3RJTA 5DM60 3A1WA 4PNPA 1II8A 1J9EA 3W6OA 3WK5A 1RZRD 4LC9A 1GNTA 5EJ2A 1CY8A 1GPUA 9MHTA 3F5FA 1G4HA 3L7NA 3WGZA 2NSJA 2HK6A 2OHHA 3GZTB 3KPYA 5IJXA 4DADA 5IKMA 3UUFA 3GVLA 1BDMA 4DKXA 4MARA 1OLSB 1YRHA 3QF7A 1KYWA 3S70A 2D4AA 4G8DA 4YT5A 3D1VA 3EISA 3V4OA 5BP7A 3GFSA 2QKYA 2Z9BA 5EIBD 1MTZA 4YACA 4BLRA 4P2GA 3PHIA 3BERA 3AEYA 4RLQA 1NG9A 4FYKA 5LU8A 2H5IA 5C34B 1S3SA 2CVHA 4MB6A 3E4CA 3ZY6A 1DJQA 3RG8A 3TX6A 4EKNB 1KTIA 2E49A 1Z2DA 3EEFA 4JLJA 4AC9A 3QQ5A 1YZGA 1BMFA 3UZUA 1ZXXA 1MC4A 4JVMA 3AVWA 2VWQA 3E7DA 3TCKA 3USCS 3WZ2A 1E1CB 2XGGA 3CLRD 3LWZA 3TPFA 1QFZA 2HSDA 3BNWA 4E30A 1G21B 3JZMA 5BNWA 4O29A 2A5DA 1JR3D 3C6MA 1M2NA 1FZTA 2QNBA 2IYQA 2ZRIA 1Y7PA 1XRSB 2BDEA 4HN2A 3BBPA 5DTQA 3C3AA 4ZGWA 5BN3B 3CZQA 1G5TA 1ONPA 3DNPA 5FTNA 1W59A 2AF4C 2LCFA 4NBLA 4WNIA 2I2BA 1R6DA 3L77A 3QV1A 5FI3A 2HLPA 3LNCA 2CDCA 1R0CA 3IHKA 4O33A 4AYTA 3BF8A 4C30A 3T3IA 1NXSA 3NWEA 4HMQA 1D4AA 1M75A 4MRPA 3NHUA 3O8QA 4CZ2A 1KE1A 2FN8A 2WG1A 3ODPA 4X8LA 4XLZA 1FUEA 4MS1B 1E7QA 2Q5OA 3CA8A 3PFHA 2BJWA 3EQZA 3H8WA 4MPPA 3HJFA 4QWMA 3OUZA 1CQIB 4MVJI 2QGFA 2DHQA 5HF6A 2ACWA 3UATA 2B37A 4P3IA 1GUYA 4BO7A 3R8FA 1B00A 1T9DA 4WOBA 4MVJG 4H4EA 2YMLA 2VSQA 3GRCA 4QELA 1QFXA 2OLEA 3NP9A 2LKDA 1Z0FA 4LK3A 1G6OA 2EFCB 3BH4A 3OOSA 3A58B 4YN3A 4D3SA 5IP5A 1GAQA 4BRUA 3UNXA 4DTCA 4UFNA 1WCIA 1E89A 3Q10A 2QTGA 1E4EA 2BMAA 2IXDA 5E2IA 3L0IB 3JY6A 5KQRA 3DJYA 1YR8A 5GV8A 2Y1CA 3M49A 8OHMA 1KK1A 2EBFX 4ZVPA 1W47A 4IJQA 4PHTA 4Y9TA 1EDEA 2CYAA 5DYIA 5D3ZA 1TTQB 1U9JA 4HFJA 4QYIB 4R6WA 2JLRA 3L4SO 3M4ZA 3MILA 4YC7A 3ZHBA 1SVKA 1E62A 1DIBA 1JALA 1XCPA 2CDNA 2GYUA 1T3SA 4J9UE 2VUTA 3MUOA 3QKRA 2VHTA 4XCQA 5LB4A 1TU3A 5AM3A 5JNSA 1X86B 1S7CA 1U1CA 4GX0A 4K9LA 3A1PA 1PCXA 2WTMA 4CN8A 3C3JA 1GL7A 1GTJ1 1B93A 3C15C 3NI2A 4KOAA 5IWCA 5LQKA 2BFAA 3ZD7A 2FVYA 1YUMA 4ZOAA 4HTFB 3QG5A 1NW3A 1RHRA 3GX1A 3OQMA 1DG9A 1VJ5A 2BL4A 1XDWA 2HK8A 3KWJA 2P2CA 2FRDA 2ONYA 1JAZA 2OP0A 1QHHB 2XUKA 3IPRA 1ENZA 4V0OA 3VJRA 1VIYA 1TZMA 2H4YA 5LLDA 2ZIGA 1KC8D 4OHPA 4OKNA 3S7TA 3C16C 3ZX4A 3AKDA 2EC5A 3R6JA 4Z9XA 3LQFA 1DQZA 1R27A 2WKRA 3ZHYA 1FMCA 2H4ZA 1QK5A 3IBFA 4PGHA 3L1JA 3UAWA 4WKOA 3OC0A 3MJ4A 2D54A 4WXMA 1B74A 1RWXA 1RAEA 3I42A 1GYPA 3LCJA 3LC0A 3LKZA 5TQ0B 3T52A 3WJ1A 4Z7OB 1IXKA 2FA9A 4HRVA 1GEEA 1ZMTA 4X1IB 1Y0BA 2BWJA 4DSNA 3RS9A 3G0OA 3LUFA 3UHFA 2CLLB 1NVFA 1W5TA 1YOBA 4JDPA 5SZJA 2J08A 3RANA 1ISHA 5HHTA 1NUPA 2ZBPA 2O0MA 3H7AA 3M1IA 2YWGA 3UKDA 1RE1A 2ZUEA 2VT6A 1DXQA 2QB5A 4GXTA 4J4TA 2GVZC 4OFXA 2Y1DA 2ECKA 3AR3A 1JA0A 1VKHA 3HVHA 3FPAA 5JTUA 4K3VA 4UCXA 1EX1A 1Q14A 1XI2A 3FWNA 1CRLA 2BGTA 1Q0ZA 4OL0A 5CXXA 5ALTA 3LQ2A 2B0CA 5M5BA 4IQGA 4C0QC 4R83A 5DVZA 4IV5A 2O0HA 4X3PA 5H82A 2AZXA 4X00A 2C0PA 2J9XB 4ZI2A 3WLPA 3ESAA 3JWHA 2DYKA 4EAQA 5MFPA 4CODB 4X85A 3BWYA 2GK7A 1PQ4A 2X0FA 3GYBA 5IVHA 3ADKA 1FP4B 2C00A 1QYWA 1PFGA 3ZU4A 1AOXA 3UPTA 1KZ7B 1RBQA 1XKTA 3ZJ5A 5HJEA 4KSYA 3C8UA 1KQOA 4FW9A 4NE2A 4CKCA 5HZAA 3ZG6A 4X7EA 2K87A 5EQTA 5HS4A 1PU2A 5A1TA 2AW5A 3DZIA 5TQJA 1Q7TA 3O75A 1LF0A 1XA4A 1UT8A 3JQ9C 3V2UA 1ESNA 3HYNA 4J03A 1T9KA 1MB9A 2D13A 4OPMA 1SUIA 3ROEA 4CMCA 3LQQA 1PV4A 3TLYA 2J4FA 3F7TA 2AL7A 4ACBA 4BQNA 5CD1A 3DLPX 4FPXA 1JIXA 3AL3A 2PS9A 1J5EB 4BXOB 1RXSA 5JAPA 1S9HA 1UXIA 3PKZA 2CL6X 3W0LB 2J48A 4EG7A 3MCWA 4PC2A 5IG2A 5SZKB 5KMGA 4TZ0A 1TQ6A 2AEMA 5L46A 3IEXA 3TNDA 4D1YA 4QPPA 2CKDA 1X8KA 3IAHA 2YIVX 6REQB 2ZBRA 2AE2A 3TOZA 4U00A 3VR2D 3V7WA 1SC6A 3ZNOA 1TIPA 3H5RA 2QUAA 4DUGA 4O2BA 3ZK9A 5EMLA 1YE8A 2CXRA 5BQOA 5KNCA 3M4NA 2R751 3DAHA 1A9YA 1ICIA 1RXUA 4LHWA 4ZO4A 1GHTA 1V2HE 4UE3S 2BKUA 3C2QA 1P72A 3GQBA 4BGIA 5M2QA 3NVKI 1R3UA 3D0OA 4NPAA 4MTCA 3U6KA 2EFEB 3OUTA 2W4QA 2SKDA 1NVAA 2E4XA 2O50A 4PNHA 1RRGA 2VDMB 3BGWA 3KVRA 1UAAA 2AGVA 1ECGA 2ZYIA 3GFVA 4KACA 1EG7A 3G1UA 4IP0A 1G7SA 1WL8A 2WC1A 1WOYA 4NXMB 1MAWA 1PTJA 2Y1EA 3UJAA 1QHNA 1T8RA 3LK6A 5JYCA 3PTZA 2FOLA 3BORA 4HLDA 3H0KA 2CMDA 4IQ0A 3L06A 4HDMB 3TCXB 1FLVA 4L95C 4NZYA 3CF4G 4O5AA 3KB6A 5JXJA 1KF0A 2Y2UA 3FDZB 4CETA 4DZZA 1GPBA 4CEJB 1QZTA 3AEKA 4PLHA 4YRLA 4GOKA 4O4IB 2QAIA 2BFCB 2WNIA 4J0IA 5BWBA 1KSFX 2ZTVA 2J5XA 3FJ1A 4BX2A 1KZ6A 5JAQA 2DOGA 3KDSE 3G5TA 5B6IA 1T3LA 2Z2YA 3BYZA 2WY2D 3AOEA 4DIFA 3IB3A 5I3ZA 5KYGA 1FJGB 3DS8A 3GZNA 1Y8CA 2GVNA 1LRKA 4KE8A 5CM8B 5FB3A 4LXTA 1LNSA 4F4JA 2BTOA 3D6FA 1GZVA 2X7HA 4TMYA 1VG8A 2JGFA 2WAOA 1YRAA 3FFXA 3HJGA 4B32A 1F5NA 1TJNA 4GI7A 4XUCA 1OWNA 5FPSA 2IUSA 3B6KA 3U7IA 1Q83A 2E48A 4ZVKA 2BGMA 1PLJA 4ND4A 3KUDA 3WBFA 3TCNA 2E1BA 3T99A 5HKKD 4I5IA 4PYRA 1EUYA 4IV8A 4HBZA 3LO8A 3D8SA 4YXWA 1TI7A 1SUPA 1VLQA 3PA6A 5K0GA 1E1YA 2VSOA 1T1GA 3LUDA 5L8VA 3GLGA 1E5TA 2GFHA 5EJEA 1EFHA 1NBEA 4MQEA 1HTBA 3L1HA 1C3OB 3AHIA 3ZWDA 1NVXQ 1Y1TA 1LX6A 4I7EA 3Q2KA 3RM3A 3NRCA 3T5MA 4C01A 5JD5A 3UKJA 4CR6A 4A73A 3VO9A 1KSJA 5IKXA 1G2PA 1G5FA 1QTNA 2ZI4A 4BQQA 3D5EA 4QOGA 3OZUA 4JLAA 1KKUA 4WX2B 3RJZA 2VA8A 4YHHB 3RVDA 2C95A 1MR3F 3PKJA 5DYWA 2ZK7A 1Z0JA 1W2BB 2D0IA 1S5PA 2F1RA 3INGA 3K0EA 3OESA 4IHJB 3Q6QA 1EUCA 1NXXA 1FF9A 4DK1A 2DE0X 2LBPA 3KQTA 2R4QA 1VBKA 3HJNA 1JT2A 2ZRQA 3QJGA 4M55A 4BX0A 5A4FS 1N33B 1WHSA 2RH9B 5KIAA 3DLBA 2AZTA 2L0XA 2PCJA 4ACAA 2B2NA 3FIJA 3IULA 2P9CA 1Z2NX 2AYZA 2MSEB 3DE0X 4QXMA 2OV6A 5E3JA 3KQLA 2PQ2A 2WRZA 1IJKA 1IXRC 3H2ZA 1OLXB 4RK0A 2WOJA 3CXUA 2FG6C 5B1IA 4L6AA 1I5RA 3UJCA 4FUTA 3DDYA 3CBGA 4B4VA 1UDXA 4LJ4A 1UPFA 2ZB7A 1G5QA 3VO8A 4EYSA 2C98A 4A0GA 5F64A 2BOVA 1BDJA 1R6UA 1UWVA 1LNQA 1NP7A 2E1PA 4DJJA 1I2AA 2DCMA 5BWLA 5IASA 1NUHA 5IBCA 1U8EA 4LECA 3CLVA 3KQPA 4WZBB 5F3WB 5ECWA 3ASZA 4QIHA 4YJDA 4ZZ2A 2Z6AA 3BQMB 1E79A 2XODA 3VVBA 2ZIZA 1N5IA 1NR5A 2Z5GA 5I51A 3Q7EA 4AYXA 2K5UA 2OV8A 3ELBA 1JIUA 2H5EA 3MTIA 1CUDA 3N5CA 4LZPA 5CB8A 3V00A 5HZGA 1QP0A 1N75A 3AM1A 2OOKA 2QMZA 4EW1A 1LX7A 3EODA 3WHKA 1CG6A 1UFQA 1QH8B 2CYBA 2PGOA 3CYFA 3R3JA 4MDHA 3ACBA 2VTDA 5FUVA 3R6DA 4CWAA 1GNLA 2QEQA 3PXUA 3A4TA 4K87A 4TYQA 3DBIA 2CLHB 2EYUA 4B6SA 5BV2P 1B15A 2FWMX 3BXPA 2COEA 4L2IB 2VT2A 3RBZA 4ZKEA 1AKUA 3BJIC 2WT9A 2VHXA 3UBTA 1OGJA 2AFVA 3LBNA 4NY1A 3ADOA 4MB2A 3AZOA 2BVNA 2EG5A 1UINA 2ONKA 3IBCA 4NZPA 4L0DA 2QIOA 1Z12A 2PXCA 3RS2A 3R24A 4Q03A 4F3YA 5MN5A 2YBEA 4CM3A 3EQ7A 4TRMA 4HYTA 1FTNA 2O2CA 3DB1A 4I19A 4BHTA 1GDTA 3BIOA 1YGPA 4RM2A 2ISSD 3ND7A 3IE2A 2H18A 2DR3A 3GIWA 2ZCUA 3OWXA 3U3OA 1RHQA 4K0RA 4C7MA 1QVGB 1X7YB 3L1UA 4YUWA 1EVJA 3DOHA 2GN1A 3EK2A 3GBVA 3IV7A 5ER6A 3G2IA 3K6JA 1LCIA 1QVWA 1KK2A 2VVTA 4UMDA 1Q0SA 1WZEA 4A2QA 3I53A 2BI7A 3T1TA 4ZC8A 1ESMA 1QDLB 4REOA 3KZKA 3P2KA 2M6RA 3OZWA 3TRHA 1K88A 2Q1WA 2AG1A 3FLAA 1XCBA 2I7CA 3LGSA 4RZIA 5DASA 5TSDA 5BWCA 1W30A 4P38A 4B75A 4KPEC 3F96A 4F85A 3K70C 3SF8A 3RTEA 3ZXXA 1FYDA 2R00A 3GFFA 2J6BA 4PLVA 5ALYA 5SV2A 4N39A 3UW3A 3SVZA 2CXHA 1WULS 3QKWA 3D0RA 5AJVB 1AY0A 4RK7A 1VSUA 1WB6A 3EQ8A 2OBLA 3BZUA 4LPKA 3AP1A 3IA2A 3SXPA 3T9FA 3HY6A 9LDTA 1U0GA 3A6EA 4NBVA 1ZGGA 5LSAA 2PR7A 3T0IA 2IIBA 3JQ8B 3R4VA 2ZBEA 4GBED 1Q84A 4H6WA 4X20A 3QPBA 2J5RA 3I6ZA 2NSLA 1M1ZA 3LKDA 4DBLE 3TNFA 3OLCX 1JEQA 3KSDO 5IABA 4KKVA 2WF9A 4QC2A 4RMNA 1M2HA 3NGMA 1EXNA 5AUNB 5JJ5A 3O8OA 3VR5D 2WB2A 5K51A 3MGGA 4KAXA 5LBUA 1PJAA 3D7KA 2J3JA 3A6HA 2P9GA 2NX2A 4F38A 3AF1A 4Z2AA 1A9XB 1G8AA 3HACA 4G1VA 1GTG1 4E14A 2PBZA 4UBJA 2RK4A 4F5WA 5LYJF 3RRJA 1LZKA 3RVRA 1VLLA 1SKYE 4G6ZA 2QVLA 1Q7GA 4FR0A 4BQPA 2MSWA 2XYQA 3RVOA 1Z7YA 4F5YA 3BRCA 3EUWA 4O63O 5AW7A 5JZBA 2SICE 3LCCA 1CLEA 4RZQA 4LF6B 1E2MA 1SHZA 4L02A 3E1GA 3H94A 4R4JA 3BK1A 3I23A 4I5EA 1M0TA 1X0XA 1ZI8A 3EZXA 3JWIA 1T0JB 3KKKA 3LDHA 2PJZA 1D09A 3OAAD 3PDJA 2IYTA 4W8HA 4ZCSA 5EJ6A 5AM4A 2YFQA 3PLAE 2XZTA 3JQPA 2NTYC 1G3RA 2ZE8A 3RKUA 2RGNC 3GJ7A 4KR3A 2VBFA 1TE2A 1DTSA 1SH7A 4W5WA 1LLDA 3FKJA 2OVBA 2N1MA 3NTXA 4FI3C 3WKAA 5IYNA 2WWFA 1KS9A 4YB8A 1K0FA 1W581 4G0UA 3NM5A 3KJEA 5HM8A 4M1MA 5I7OA 4F5ZA 3LBIA 3CC7B 1SUSA 1L4KA 2Q1TA 3GUHA 3C4QA 1THMA 3EG5A 4OGLA 4IS2A 4J4BA 4EP1A 3BT7A 4NBTA 4FBMA 4JVNA 3BCFA 1OJLA 1RIFA 2O3QA 2XB9A 3Q9UA 1T2CA 1O94D 1U0RA 2DECA 2YL2A 2I78A 3H4TA 3NASA 2WZBA 2RIRA 4MUJA 1SY7A 4X62B 4B79A 2QRJA 1ISIA 5JR3A 3QXJA 1YBHA 4TXMA 1J7JA 3CVXA 5M34A 3DWGA 5EJAA 3H1BA 2F9FA 5CG1A 2EBUA 3KLOA 1Y6JA 4KXLA 5C52B 2XSZD 1WPCA 1OI3A 4C14A 4CV0A 5BWMA 1X14A 3KETA 3KTAB 2HT1A 3SKBA 1KEEB 2WWYA 1PT5A 3K6KA 3WLHA 2C4KA 5ALUA 1E98A 3AB3A 3B1YA 3F9RA 1ZRNA 4Q1DA 3UWSA 3WRXA 4D96A 1X38A 4BOYA 2A86A 2YQ4A 3TWOA 4OAOA 5E1BA 3I61A 1C0PA 4CKXA 3DL4A 2EFGA 4GAEA 3GEBA 4PLGA 4I9UA 3A4NA 1YA8A 3FPLA 3QZUA 2QRVB 3VPBA 1V43A 4ZCLA 4NAHA 3R7WA 1EXMA 2CFTA 2YIJA 2R8ZA 3ZTTA 2F55A 1FIUA 4TV9B 1CZHA 2POQX 3G2QA 4HDRA 3WB9A 2QYTA 3FPEA 1NKSA 4QOSA 4EOGA 4Y2GA 1SUBA 2PVPA 3CRMA 3DVAB 2M2IA 3K9QO 3PT9A 5EIWA 1KI6A 2IZ1A 1QQ5A 2QMEA 3TZKA 3WFZA 3FG9A 3BA1A 2JEYA 3C1TA 2CV1A 1T9CA 1PJ4A 5LM3A 1SAYA 3KZNA 4A2WA 3WRVA 4QG7A 5B57C 4I14A 3EQ9A 4I5DA 4QREA 5CT8A 1AHHA 3ANSA 4MWTA 4X84A 5SZHB 4DMLA 5IEJA 3M70A 1JFSA 2DUUA 3KYCB 2RHRA 4A0SA 2VQEB 1BNCA 1TTPB 3QUBA 3LX8A 5A89A 4WW0A 1JP7A 4D6YA 4Y30A 1XK6A 4ATNA 1RKVA 2GJPA 3G79A 1AZSC 3LA8A 3N86A 4M0FA 4D81A 2O2GA 2IYAA 5C5CA 5FDFA 2C2MA 1K7YA 2PGDA 1Z38A 3PDIA 3PWSA 4KFUA 1YVDA 4E88A 1ESZA 1O95A 1BWRA 2G83A 2FSIA 3DEJA 3MB5A 3O03A 4AN0A 4BRZA 3MWDB 4DQUA 5IH7A 5GJBA 5F52A 4F6RB 1U1FA 1KI8A 1O94C 2QM0A 2PRJA 3K71B 1J8QA 2O8CB 1Z06A 4HEA6 2XKBA 1FLAA 4A26A 2X0RA 5EJ7A 3EVGA 4Q4AB 4ZQBA 1H3NA 4FYJA 4HUTA 3FTNA 3SG0A 5IJAA 1HEUA 1WXFA 1U0OC 1VF7A 3P2JA 3EXIA 2Y05A 1OVGA 2A9PA 2QTWB 3VDRA 1A8SA 4EHNA 3U9SA 5AW5A 4H7FA 1Q11A 4X5OA 4LF7B 1GZUA 4NAVA 4CIBA 221PA 4GYYA 1U3CA 4WNCA 4ZICA 2ZRCA 1ZG3A 3U61B 3FVQA 1ZWKA 1XG5A 5AVKA 4KBYA 1MW9X 4YJ3B 3I04M 4D9JA 1JHVA 1KGDA 2O1EA 1GNPA 1P2TA 4OU5A 3THWA 4L6IA 1JJVA 3LV8A 4IFIA 4JLSA 4HWGA 4MEBA 5AKJA 1XZEA 3I2YX 2Q4BA 3L41A 4CIXA 3HXTA 7GPBA 1U3FA 4EVRA 4M3NA 1SC1A 1XVIA 1GAWA 2Q5LA 2YJGA 4GX2A 2GEDA 3ZE8A 7MDHA 2HXYA 3L05A 2O05A 2F3QA 3GYGA 2WHPB 3ND8A 4LFAB 1YDHA 3K2BA 3K9FC 3REQA 1ZK3A 1WPRA 2XCIA 3W4KA 3A9CA 1BA3A 3MG9A 2H48A 1IOZA 1M2WA 1OQAA 4PSDA 5AMXA 1KY5A 2BH2A 4Q7QA 4QVIA 1A9QA 2QRQA 2P7IA 1NP3A 5FLXA 1K7CA 5BQPA 5TARA 1M0EA 5JE8A 5BV0A 3VU8A 4X1KA 1IDN1 3N0XA 4AKGA 2QXUA 2QX9A 4LSWA 3HYSA 2IELA 5H0IA 2JAXA 1JR3E 3UJBA 4MV4A 1U2GC 1YVUA 2FPGA 5CVTA 2GCOA 4OGKA 3B3QA 3KEQA 1YF3A 1H9CA 4CIAA 2V74B 3CG0A 1CB0A 2C7GA 2A0XA 4ZTUB 3CCMB 1AXRA 3OURA 4H1WA 1XRMA 1EVKA 2YWHA 1DINA 1UODA 2DP4E 1GV1A 2ASEA 3BFKA 2Z2JA 4HIZA 3OCUA 5GJCA 3T7DA 3TLGB 5AVRA 4JI4B 4KMMA 1VL1A 1CR2A 1FJHA 4GEKA 5AJWA 4UTRA 4A36A 1E2LA 2ADMA 2JFHA 2FTKE 4J29A 1L4YA 1L5RA 2ZCJA 3M9LA 4YRBA 3UMSA 2FQXA 1AKMA 2ZYVX 4A82A 4RTLA 4YUVA 2CF6A 1QX4A 2FEWB 1C1YA 5JPDA 4UASA 1VP3A 3KE9A 3HVRA 1VLOA 1IN4A 4FC7A 4YRMA 1AN9A 4R1MA 1WX1A 4U7WA 2ZWVA 3KYBA 3MWGA 1ZGCA 4M0LA 3A25A 3FDIA 5C81A 3IAM6 3PQ4A 4UAGA 1HXHA 4X63A 4AY3A 1ABFA 2ZTGA 1ODCA 2VTVA 1EUDA 4FHCA 2WA1A 1BVYF 2IW1A 1M2OB 3D26A 1NRKA 4JP5A 3TG8A 5FBZA 1E2EA 1FU8A 5K0TA 4Q02A 4F0JA 2A57A 1P0MA 2I87A 2QVXX 3B52X 3N87A 2RGNA 2IRWA 4FFOA 1CR1A 1Z18A 3DZDA 2GETA 3PNYA 5AW8A 4KKUA 1YHNA 4QRIA 3O4FA 1XZCA 3U62A 1U0JA 2FW9A 4JJFA 4OJYA 4DDKA 1KAGA 2JB9A 3R7DA 3I2GA 4ZYUA 1IY2A 1U2PA 3L46A 4YGYA 3UV6A 4C5CA 1X9IA 2C8LA 3OEHD 2MSDB 4GS5A 1JPJA 4O2AA 3STVA 3TMYA 3V6MA 2OM6A 4XRRA 3AEUB 5C1DA 3I9OA 3L4BA 721PA 3B7WA 1AKRA 2NQ2C 2GESA 7AT1A 1WETA 3HDHA 2NUTB 5BUZA 1VBFA 3TFQA 2OL4A 2R6CA 2I1LA 4K9DA 5AW9A 1ULSA 3FZQA 2ZJFA 3OE7D 4ERNA 1XRJA 1E3LA 3NG1A 2QNRA 2G63A 1DKOA 2WIGA 3R7BA 3CD6B 3ISVA 1E3MA 2HFJA 2XOXA 3BDAA 4XL9A 1FLDA 1E20A 3ZKWA 4L5IA 3W9UA 4IILA 4EHBA 3VDQA 3ZWNA 5JLJA 1I33A 4HWKA 1UMDB 2X1LA 4MUGA 1I7DA 3HDQA 4Q9AA 1A9ZA 5LD2C 1Z08A 3OTHA 4YJ3F 2C7PA 2BFDB 2WM9B 1X80A 1ZC4A 4NLLA 4OH1A 1GQFA 3KT3A 3U16A 4AZ3B 1QK3A 1C9JA 4HUJA 1S3FA 3IFSA 2OQVA 3HRIA 3D3EA 1BX1A 3OTQA 3DCYA 2WK1A 1TCBA 3BGSA 1Y1KE 4PINA 4NCNA 2J0SA 1SD2A 4Q9HA 1W46A 3T1VA 4S12A 3BPSA 2QMUA 4FHEA 2MT9A 2WABA 2WVHA 4QARA 4RACA 4UDYX 1PBTA 4DDHA 1ZHOA 1F38A 3QEJA 2GTHA 3NWBA 5KKNB 4WJLA 2VTBA 1QIJA 1RXEA 1WQ1R 1Z36A 1PQUA 4Q21A 2YWJA 1JT9A 3KS9A 2TS1A 2QNIA 3V4RA 3NIFB 3FGPA 4COOA 3M1LA 2H1OA 5JCOC 3OSZA 4E1VA 1YBAA 1LUAA 1FYFA 1FMJA 4MYCA 4TKVA 1K08A 1D04A 1DVRA 3VH3A 5INTA 4BGUA 2NU6A 1QIGA 2NNLD 3GMTA 3IT2A 4OQYA 3ACCA 4LSZA 4P86A 3DAPA 4P93A 2P27A 1OWPA 4TWZA 4WA8A 4WH0A 2RHCA 4EA6A 1QH0A 2G9NA 5ADUS 1QYIA 3EMBA 1T15A 2BIFA 1KQPA 1VQ7B 2PMWB 1R16A 3GEIA 1VLYA 1A8UA 3MMNA 1T0HB 3PQCA 5DP2A 4OK3A 4AMYA 4R9VA 4BV8A 1KXJA 1RADA 2YC2C 1WXXA 1YJNB 2XOKD 1F2DA 5LMNB 3CUVA 2NZ8A 3NHYA 4OXKA 1LWNA 4DJEC 3JQ9A 3TRFA 1GZHB 1BOOA 3JASB 2ZDGA 1NMYA 1RQ2A 3TIVA 2IEZA 2OO7A 3D1LA 3Q98A 4U39A 3WP1B 5FPYA 3WIOA 4RV9A 4M37A 1L1FA 4F4HA 4F04A 4TT3A 2FAXA 2QX4A 4N6NA 4ME6A 5K9ZA 4FCVA 3L8CA 2YICA 5B6PA 2ATVA 2QLNA 3PUKA 3A6ZA 3MTGA 2JLAA 1BKSB 4OCZA 3W8RA 4HLCA 2WTUA 5WRFA 3UHOA 1SUCA 1N0VC 4HNSA 3HN2A 3NBYC 4AYWA 4IDDA 4EJFA 2CLFB 4EZEA 1N8TA 3NNNA 3WV5A 2IZ7A 4I1RA 2O2IA 4RJ2A 1RCTE 2CJYA 1U0TA 1DT5A 3EARA 5E6RA 4HDAA 3UJ6A 3CX8A 2ZXHA 1MAHA 1J33A 2A0YA 2AC7A 3EZ9A 3FFWA 1RI2A 5F4OA 4RGVA 3RHZA 5KJCA 2PGXA 1Y8QA 1FVOA 2G4VA 2DF8A 4OQFA 1CC1S 4CF7A 5JFTA 3V46A 3AKZA 4ZK2A 1D7OA 3E0XA 4CEHB 3AH8A 3HA5A 4CLHA 5KYWB 5LJIA 1K4YA 3T7IA 4PZAA 1TO1E 1J0EA 1A9TA 1P74A 2P41A 5TF0A 4C04A 4YRNA 1PFYA 3R74A 3IDFA 4MGYR 1E58A 1K6JA 2HV8A 4DIMA 2C42A 5DI3B 4DLBA 2OHJA 4ZOBA 5LQDA 4RFSA 4AT1A 4WBSA 1C2TA 1Z6AA 3GVHA 4OQLA 2X3FA 5CDGA 5FI0B 4B7XA 5JJCA 2XWQA 2RGWA 2PT5A 1NXOA 3C3DA 4G5XA 2F4NA 3OP1A 4P3PA 3E53A 4IICA 2I6QA 3OQVA 4WLFA 2FZ5A 2Q6LA 3KEOA 3MCZA 4LDZA 4PTYA 5EKTA 4AF6A 4I4IA 3LY7A 5AKGA 4M7RA 1ZX1A 5ALLA 4PRZA 5D85A 4ZQGA 3NFRA 1M2KA 4XNFA 1CQJB 1DIAA 1VE5A 1WBJB 1OR8A 1YACA 1V48A 1QDEA 1CUSA 4NBKA 5BNFA 4ZJYA 1DBSA 1HWYA 4AO8A 3T1YB 2HGSA 3DEHA 2JHPA 3GLIA 5BYBA 4ZCPA 4OXRA 3CCFA 4CKWA 2QLLA 1RPZA 1Z7BA 1Z68A 4KL8S 2XSZA 2OK7A 1CZKA 2PZ8A 1YRYE 3CUWA 4PG8A 2QN9A 1RTKA 2IDZA 4JXZA 3CCUB 3UN1A 3ML1A 3DBRB 1NW6A 5ETJA 4OKSA 1TVCA 2DHEA 2CCGA 4XJSA 2XQKA 3KX2A 3OETA 3F74A 4HWOA 2WYVA 4IZIA 3RUDA 1E3ZA 1G8KA 3N28A 4V03A 2YASA 3OPQA 1UM9B 5GOTA 3HP4A 4KGDA 4NMWA 2GXUA 3L40A 5AJHA 2GUWA 4PO1A 5KJFA 1Y82A 4TTAA 5EMJA 1W4CA 5LNK6 1G17A 5LQNA 2N42A 1KP3A 3IE1A 2EBHX 4LNUB 3RREA 1QG4A 4MWCA 5JRJA 3I5MA 3N2GA 2QZSA 3O3MB 4EGCB 4EY5A 4ZZIA 5BW4A 5ITZA 3GMIA 3GH1A 1K8ZB 2WWWA 1G5PA 1NURA 2ZPUA 1NJID 2XUJA 4OOVA 1SHLA 2RHHA 3A26A 5JNWA 4DV2B 5BN1A 4B3DA 5JD3A 2HJHA 3S2GA 2C4TA 4S0ZA 4JC0A 1WXDA 2GRAA 1UMCA 1JHUA 1W88B 4I8IA 3WG9A 3JYQA 1P80A 2GN2A 2WHRA 1PV2A 3P52A 5CDYA 1HOXA 3X1KA 2VR1A 3GWZA 4GO1A 4BP9A 2G8NA 4K9SA 3ISXA 2J5KA 3VOTA 1JNXX 1LBTA 3F6EX 3H5VA 3UAOA 4HUQB 2JD1A 1E77A 1EFPA 4JY7A 4A8TA 4QUBA 4I1SA 2FP4A 3NUZA 3HI4A 4XPIB 4F7DA 2QTTA 2GPJA 4MR9B 5JNRA 5KSZA 3BMOB 3UW1A 1QS0B 1ZGAA 1THZA 4YJKA 1GAJA 5T4EA 1ZHHA 4DUPA 2C4HA 3EA0A 2JZNA 1YXMA 2YXLA 2ZR9A 2ZUVA 1Q17A 4UREA 3GNLA 3CR7A 3WGKA 2IPOA 4XOPA 3I12A 3O31A 3VVMA 2X8KA 1U28C 1GU7A 4HRXA 3GJSA 2KSQA 5KBYA 4UNPA 4H16A 4CEIB 4M89A 4ALIA 2EGGA 2O06A 4DIKA 2IS6A 1FP2A 4HQKA 4K26A 1ILWA 1Q6ZA 1U8UA 2XYHA 1YJXA 4I1PA 1OT5A 3G0HA 3CWQA 1AKEA 4RFVA 2H59A 3AVPA 3H97A 2F3RA 1BG6A 5CFMA 1KI3A 3NOQA 2D3TA 1GA4A 4Q9DA 4JT4A 6AT1A 2FPLA 1R4MA 3Q8KA 3HCDA 1VZ2A 4FJ0A 3W2FA 1H6CA 3IE0A 4AECA 3WLLA 1G6Q1 1OXMA 2PZBA 2ZW9A 4NK5A 2DIEA 4LCBA 1YO6A 1PSWA 2XDYA 3LY8A 6CHYA 2O6LA 2NACA 4YCLA 1ECFA 5BT8A 2VXYA 2OTJB 1NX9A 1W5SA 1DAKA 1Z74A 1GG5A 3QOWA 5K8JB 1TZBA 4FYHA 3F67A 3PFBA 5KYNA 2CNLA 5HX7A 3RHSA 2WJVA 3H2BA 3JATB 4FYWA 1PN3A 4R2LA 3WGJA 1KH1A 1DO8A 5T4BA 2Z98A 2QQGA 1NJSA 3EFHA 4N54A 1T5HX 5JQGB 3E1KA 4MJ7A 3FDXA 4OPSA 3QPWA 1ZJ4A 5TEVA 5BMVB 3MLEA 5BURA 3WGTA 3DCJA 2A1IA 3AU8A 4PLPA 2DQSA 4Q9IA 2XMCA 3ZH2A 1G8MA 1E9FA 3HR4A 4QPNA 1G55A 1X7ZA 3BH0A 1YR9A 4J1SA 5NULA 5K0EA 5DLDA 2OBRA 3RJ5A 2QD1A 2C3YA 3F4BA 3HC7A 2EQ5A 4BWVA 3ZBTA 1XDSA 2G40A 3PNSA 3IIKA 4CT4B 1YK1A 3GCXA 5G1PA 1ZR2A 2H7YA 3SF0A 4N8EA 1FDVA 3GPCA 1UWLA 2G9QA 3GA5A 4JT8A 3JSAA 2WTAA 1Z4LA 2DERA 3E5NA 1A4RA 2QROA 4OP7A 3QPUA 5HKAA 4M9CA 2HIMA 2WAXA 1O6BA 2F7SA 4L78A 1HRDA 1AGYA 4KQCA 3ZW7A 3IL2A 2PAAA 4XX0B 4MQ5A 4JI5B 5DN6D 2GF2A 3R44A 3CFYA 4N65A 3W9BA 3I4CA 3H99A 1GARA 3DMHA 3HUDA 1OX6A 2X4LA 3KQUA 3IHTA 2D8MA 3IBYA 3G23A 1N0HA 2XBLA 3JARB 1R9GA 2VOEA 4PQYA 5F4JA 1TM1E 2X8LA 1Z62A 3IPCA 5DZSA 2QRUA 3OFNA 4MUYA 4DXAA 3ECAA 3UMGA 1TW2A 5HKLA 2G09A 2XYPA 3GO4A 4TM8A 4DB4A 1N0UA 4GDMA 1YFKA 1TVKB 3ZTYA 2GRUA 4NYMQ 2DPGA 3U3JA 3ZHCA 4WJKB 2QR2A 4CU2A 4PVCA 3PFFA 1U3VA 2W22A 2RGGA 1R4NB 2Z8XA 2FQQA 1V71A 3L7MA 3TQFA 3A9UA 1CZLA 2FW1A 3TDNA 1TM4E 4JJIA 4PR3A 4G1BA 4KRFA 3VA7A 3B12A 3B48A 3PYXA 4TS1A 3X1YA 4IPTA 4FYMA 4XDHA 1FS4A 1C8BA 2IYPA 1ZLXA 4XLFA 2VF4X 2V59A 1E0JA 2SHKA 1LKZA 2ZBDA 3S55A 4PQEA 2I5PO 4D8TA 2Y67A 4M8SA 3ZLVA 3O47A 1ZLYA 4B31A 2FZKA 1RM5A 1M1KD 1TQ8A 1ULZA 4LC1A 3G6EB 1CZOA 1P0PA 4C7BA 3W1VA 1K5GA 5L53A 4IL5A 3URKA 3SEZA 3K0AB 1PK7A 3AHJA 1E9SA 5ICGA 1KMIY 1XQ6A 1KPGA 4KO8A 1P4JA 3OE7A 1N7GA 4P7BA 2R6AA 4RVDA 4I3GA 3YASA 4UBLA 4U8GA 5KOIA 5IAGA 4P33A 5EIXA 1Z7EA 4HS4A 2CVZA 4G0XA 1OXVA 4RCYA 5C18A 4X60A 2UXBB 3N8IA 4FBGA 1YH3A 3LXRA 3UT5A 4JQYA 3UIEA 3AHGA 4IINA 2AJBA 3QVJA 1FJXA 4X8OA 5F78A 1U2TA 4AURA 1WNFA 4WZ6A 3THSA 1SU4A 4KNVA 1B6GA 1QNLA 4DJAA 5AUQA 1IBLB 1QAQA 3D8HA 3L6BA 1FFHA 3MXTA 4N82A 2VFAA 1FQOA 1YR7A 3F71A 1P1CA 2JFWA 2PA0A 1G41A 3WL5A 3ZQKA 2B9VA 3R4CA 4HP8A 1E96A 4OFWA 1JMKC 1NXPA 3ENWA 1N6LA 1RM3A 4MQFB 1US8B 4OUKX 5DH9A 3SZGA 4ZEMA 1AO3A 1NWHA 5DN9A 2C5EA 1YZLA 2IK8A 2WUFA 2WG2A 3X43A 4UDNA 5K8IA 3C70A 1FP6A 3GAAA 1WWKA 3SVTA 2ACKA 5CNMA 3DR3A 5G0VA 3EGOA 4UCFA 3FBGA 5LP6F 3T3MB 3K6SA 2HH9A 3KXDA 5DMHA 1KL7A 3HGQA 2FEAA 3OZSA 4ZMRA 2FXVA 1RABA 4LHEA 4N6OA 4WWHA 4WY2A 1UMKA 2R4UA 2JJ2A 3TNJA 3CINA 5G1OA 1Y7LA 5HNKA 3AHDA 3ED5A 3EFOA 5IPFA 1V3QE 1PJRA 3OT1A 4W9NC 2YWFA 1CETA 1D03A 1MX5A 4LHYA 5EKXA 4LJSA 2QPAA 1DUIA 4X24A 5HS6A 5SY6A 4MW5A 1UJBA 1AZTA 4HMOA 3CMEB 2JGNA 1BU8A 3FTCA 4K0KB 2CFIA 2W90A 2C3OA 3DNFA 3PEUA 1JE1A 2ATXA 4EG4A 2R85A 1RRVA 3DBLB 5T67A 2VDVE 3HP1A 4CM4A 5AW4A 1NM5C 3U40A 3OCYA 3G0BA 1YIAA 2WJAA 1JAYA 1AT1A 1MZVA 2GN6A 2X7XA 3TTVA 1D6SA 2IY7A 1SVOA 4IKOA 3RASA 2AOTB 4W9NA 1NN5A 4KK4A 4CLDA 5HW0A 4GZ5A 2A4KA 2B5WA 4XM0A 1SOAA 4Y18A 4D25A 1P6QA 3PHCA 1YBVA 3LO5A 5CA1B 3N70A 3PQ7A 2X5XA 3SS8A 4GDFA 1OBOA 2J9FB 4YAEA 2W6OA 1MHPA 4BN5A 2B8WA 2PU7A 3DE4X 1I13A 3ZWYA 4G4SO 4HVLA 2UDPA 3ZV7A 4Y3UA 3DE7X 2NUAB 3BAZA 2MSNA 3EAFA 1HYQA 1OWLA 1J22A 4BFVA 1EP1B 1ZPDA 2XUIA 2QTLA 3VC7A 3LKVA 5CX1A 2YWRA 2VJYA 4Q05A 5TRTA 4P31A 1E9CA 2JLCA 4W6QA 2R5NA 3PENA 2OZVA 3KL2A 1ICEA 1E6CA 1NXWA 4NU8X 4ZV7A 5KCMA 5LZ7A 4NENB 1W8IA 4A1OA 2ORIA 3B2QA 4BFUA 1XN4A 5H3HA 2OO3A 4HL6A 4HVCA 4NCIA 1AKYA 2GDJA 4K03A 4BZXA 1KQFA 3WX0A 1V25A 1A2BA 4WEQA 3D3NA 3PHLA 2IYUA 5GMOA 2CCJA 2H29A 1IU9A 1E2KA 3BREA 4GIBA 1X7DA 1L4BA 3CKYA 3EAQA 5ENVA 2YNMD 3B9RA 1XQWA 1YS9A 2BJHA 2WYUA 1F5SA 2ZZKA 3GAMA 4NR0A 1SM4A 2XCUA 4NU0A 3GLIE 2X2PA 3G2KA 4ND1A 2O20A 3RIEA 5FTJA 3WDMA 1GU1A 5GOZA 4YA6A 2ZAMA 1PQWA 3NS7A 2PKRA 1XDGA 3WGHA 5CDHA 1KDRA 3MWLA 2PDAA 3BMQB 2PZEA 1KQNA 4X06A 3TEFA 4E51A 4NMXB 4GPIB 3VC1A 2E9SA 1K8RA 4ER3A 3PF9A 1U5CA 1EFKA 1PT9A 2HBYA 1JZQA 2PQ6A 1QQ6A 2XQJA