1W35A

Ferredoxin-nadp+ reductase (mutation: y 303 w)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena pcc7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w35A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w35A02
1JB9A 1IB0A 3CCMB 4RCZA 4C0SA 1OGJA 3FPKA 3QFCA 3OJWA 1R5BA 4FK8A 1FNDA 3W2EA 1JA1A 1G7RA 4Y9UA 3CC2B 3LYUA 2XNJA 2AHOA 1N0UA 1W35A 3U6KA 1KK1A 1BJKA 1QUFA 1OB5A 4TMWA 2VNKA 2HMAA 2QN6A 3VNVA 3OW2B 1KK0A 4QFMA 1XE1A 4K1XA 4RD1A 4U9UA 5GV7A 3G71B 1WDTA 1NDHA 4P3YA 4NBSA 1GJRA 3FJOA 1Q86D 1OGIA 2X3UA 4AC9A 1R5OA 3AVVA 1M1KD 2VYQA 2OTJB 2OTLB 1S0UA 2YWGA 2BV3A 4RD6A 3ZBTA 1VQ8B 1SKQA 2QTZA 3W2GA 4YAWA 1GO2A 1D8TA 1VQ6B 4UAJA 5TV2A 2VZLA 1VQ7B 2OK8A 5EMNA 4ZGQB 2B7CA 1A8PA 2ZITA 4M1KA 3AVXA 2QDXA 4AF7A 3AVYA 1FRQA 1G7CA 2B7BA 1QH0A 1JJ2B 3QFRA 1QVFB 1CNFA 3QFTA 1KD1D 1JNYA 2EIXA 1VQ5B 2CNDA 2GQFA 1YITB 4N3GA 3B78A 1S72B 5DSZA 1YJ9B 4RD0A 1BX0A 2C78A 4PC6A 2QMUA 2YWHA 1VQNB 3I55B 3CCQB 1GR1A 3CXCB 4DQLA 3PENA 3I1FA 4ZCMA 5JBQA 1GAQA 2BGIA 2DCUA 3WNCA 1TUIA 2QA4B 1DARA 1VQMB 4AF6A 4M2LA 4G1VA 1VQ9B 2YWFA 1EFUA 1VQLB 4HE5A 1FDRA 1TVCA 3VO2A 1AMOA 1G7TA 5KSWB 3CCJB 3VO1A 1OB2A 3AVUA 2PLFA 4YAUA 2EFGA 4G1BA 1D2EA 4FWTA 4RD3A 4RJLA 2YWEA 1F60A 4TMTA 3V76A 1W2BB 1IJEA 1J9ZA 3AGQA 3CB4A 2R6HA 3QFSA 2FX3A 4TMXA 3B8HA 2J7KA 3MCAA 4ZCLA 1KK3A 4YAFA 1FNMA 1ZM9A 4B3XA 1EP1B 3E20A 1EP3B 3P26A 4TMVA 1FNCA 1E64A 3W2IA 3CC7B 4LBWA 3U2QA 1K8AD 1TLLA 1B23P 1DDGA 1KC8D 2CRVA 2VNHA 1DDIA 1G7SA 2PMDA 1EXMA 4H9GA 4Y9RA 4M0LA 1YI2B 4N3NA 3P27A 4ZV4A 1QFZA 3G6EB 3CCVB 3VMFA 4BPRA 3LVBA 4QHYA 3CD6B 3WNDA 4EH1A 2DETA 4PC1A 3VNUA 3JQQA 3B82A 3CCRB 3CC4B 4M4SA 1YJWB 2RC6A 2BPOA 2DEUA 4RCYA 3SJZA 1KJZA 4C43A 5FA6A 3ZBUA 2C77A 4B47A 3G4SB 1YIJB 1IJFA 1N0VC 4ZCIA 4P6VF 1EFTA 4HE6A 1EWYA 5H59A 1ELOA 4Q7JB 1Q82D 3ZC3A 4YALA 3I56B 4RD2A 1SM4A 3W5HA 4B4DA 2GPJA 1FNBA 3OZVA 1VQKB 3CMEB 1NJID 3AVWA 4IW3B 3WBKA 1W34A 1Q81D 4TN1A 1QGZA 2NPFA 4MYTA 3WBJA 1KQSB 3OZWA 1ZM4A 3QSYA 1BQEA 1QGAA 3ZZ0A 1ZM3A 1CQXA 2XEXA 1YJNB 1QGYA 2HCJB 2BSAA 3ZZUA 1H42A 3WNBA 2QTLA 1W87A 2D74A 3W2HA 4ZGNB 3JQRA 4B48A 1U2RA 5THXA 4PC7A 4G5GA 3A1FA 1XB2A 4YHBA 5H5JA 3ZZTA 1KTVA 1QVGB 3J81k 4PGOA 2VNJA 4MYUA 3WY9A 1KK2A 2DY1A 1M90D 1E62A 1E63A 2BVNA 4FN5A 1KRHA 1VQOB 1D1NA 2B5OA 1JA0A 4Y7CA 3CW2A 4LC0A 1QX4A 4LBVA 3E1YE 4YAOA 4PC2A 1DG1G 1AIPA 4B43A 3CCEB 2VNIA 4ACBA 4LBYA 1ZUNB 3LRXA 1QUEA 1QFJA 1N8RD 1EFCA 4NCNA 1B2RA 2QEXB 4WQMA 1ZM2A 3W2FA 1FRNA 1GVHA 3ES9A 1QG0A 1F20A 1TTTA 1K73D 4B44A 3CCLB 3MMPA 3OJXA 1H85A 1CNEA 3LO8A 2OK7A 1YHQB 1HA3A 3CCSB 4R71A 4DQKA 1K9MD 3CPWB 1VQPB 3CCUB 2BN4A 4LBZA 5AN9A 3OZUA 3JQPA 5TY0A 3W5VA 2DERA 2BF4A 2BM0A 5HXBA 2PIAA 2RC5A 4PC3A 4J0QA 3MHPA 1GAWA 3WXMA 1QFYA 1UMKA 3CRZA 3U6BA 1Q7YD 1I7PA 3QE2A 4ACAA 2BMWA 3WYAA 2XNCA 1EP2B 2E1RA 4F7DA 3W5UA 2HDNB 5GV8A 3CMAB 3AVTA 4TMZA 2BGJA 2BM1A 1BX1A 4M53A 1VQ4B 5TR9A 4RD4A 3AGPA 1R5NA
chains in the Genus database with same CATH superfamily
2CLHB 1AQ6A 3IPAA 4JLJA 2QW0X 4TS1A 2I2CA 4WXYB 3CCMB 4HNHA 4DPLA 5CNKA 1OVMA 3DVRX 4BNKA 4L57A 4NAUA 4RZIA 1KMQA 3P2EA 4KXWA 4E0FA 1UEXC 2E7ZA 4LJ6A 4IIDA 1FL9A 3MWJA 3EXG1 2GZDA 4BNIA 1U9JA 1J8YF 3CUTA 4GGOA 3UK6A 2I3GA 1RBZA 4JSYA 3NM5A 4DC0A 1K98A 2RBGA 5DM4A 3JVEA 1C9EA 1ND6A 1Q2XA 3R9XB 1R66A 3C1OA 5IJ0A 2PGOA 4BO7A 3QG1A 4DMRA 4YYZA 3SSNA 4DIUA 1CY2A 3ETDA 5JFOA 2I78A 2VUHB 3H2KA 1M5RA 5L6LB 3O0DA 3BOSA 2RAFA 2QLJA 3KR1A 5CLIA 3ADPA 1V8ZA 2G0TA 3VHQA 2O8DB 3ZHTA 1UPCA 1RBYA 4ILEA 4GXTA 4MXDA 1CW2B 3V2HA 3V80A 1RXUA 3IAM1 2H51A 4XJSA 4Y2QA 3PITA 2J31A 2KBEA 2O9JA 2UYGA 3R77A 4HI0E 3UAWA 3VVBA 3BILA 2XE7A 3L7YA 3LQYA 4GM1A 1WOOA 4HD8A 5CT4A 5JDIA 1H2EA 4CBVA 1M34A 3SIRA 4PXSA 4R9NA 2ZPTX 3NTRA 1T5IA 1U7WA 1TEXA 3B3GA 5EMJA 4C4ZA 3AUJB 5L46A 4DLWA 3C45A 1MG5A 2BTQB 1E1MA 1ZI6A 1W9XA 3A1NA 1HZEA 3DKKA 3GFQA 3MW8A 1VHOA 2WUWE 1J8VA 1E3MA 1OFUX 4NE7A 4O3MA 2FFHA 4W5OA 1A8HA 3I72A 4FNOA 4NMLA 3GEPA 4OGGA 2WLSA 2ZU0C 3I61A 3E9EA 2VYQA 3AFGA 4JOSA 2R25B 2EFEB 3GA5A 4URUR 1FVHA 4QQKA 4BMNA 4E5YA 2QL9A 3RS5A 3F7OA 1WD7A 4KQFA 2J0UA 3DB1A 1QO7A 5TS3A 1U1IA 3I0ZA 1Y4UA 3DEZA 3ROKA 1T2NA 3R0JA 4H18A 3F4LA 3DE4X 1DI0A 2IPLA 2IYVA 1PE0A 2QB5A 1V7ZA 4WBXC 4OJMX 2H1OA 1O95A 1T4CA 2AFIE 3UO8B 4ZZ2A 3GVJA 4QBTA 1KI3A 2ZT7A 4HTAA 5ENDA 1E3WA 3RVPA 4IXNA 3R7AA 1PR3A 3HY3A 3TNJA 3E03A 4NFLA 4Q39A 2YMQA 5F35A 2CE2X 3DT8A 2XAAA 1Y5LA 5CVJA 4Z51A 1MAAA 1RYMA 1H23A 1XZIA 1Q6ZA 2C20A 3FGNA 3NBKA 4I2NA 4KG7A 4WZBA 2ZITA 3SOPA 2IX9A 4UBOA 4IIXA 4C01A 3VKVA 2P1RA 3VPAA 4ESHA 2XUIA 1SZJG 4PV7A 1RYBA 2YMPA 1U2EA 2JBAB 3KS9A 3PFIA 3ORHA 2UYOA 3PUWA 3Q3GE 3V4OA 3W9SA 1IRXA 3CEJA 4U2DA 5JQGA 5E6SB 2WILA 4CIBA 3C3BA 5AJUA 2HSWA 3N8KA 1YRWA 3OO1A 3U62A 2NPIA 2FX5A 5C4GB 2OGWA 3NAQA 1RLIA 4BP8A 3WZLA 1QYXA 4C20A 2F00A 2EFYA 5EY5B 2JBWA 3ECAA 1WPQA 3IKLA 1WWKA 4K8OA 3W7BA 3ZWCA 4N3GA 1AQLA 3ONVA 2HPVA 5JSKA 4O1HA 4GX1A 3KKLA 5CAEB 1R9MA 3IDSA 4BJ6A 4CIDA 3P0HA 1DCMA 4UOZA 3FMIA 1ZN2A 2WAYA 3HJNA 1A8UA 5LDDC 2HMYB 3GLGE 3KLPX 1E1RA 3F9CA 1LU9A 4BX8A 3ESAA 1IPHA 1UFOA 4NMMA 3GMIA 2RI0A 1DBQA 2ZJ7A 3T3EA 4D74A 4FX2A 1KDYA 5G4LA 1E7YA 2J9ZB 3ISVA 1SMKA 4RXTA 2RD2A 4MGKR 3PT9A 4EMUA 5B55A 1PT7A 2P5TB 2WKWA 3MSXA 5AH0A 2DCUA 4WZLA 2C7GA 1HSZA 3R9WA 4JXZA 2QA4B 1FDUA 1KZ6A 1F8YA 2JLSA 3ASVA 1JHAA 3BRQA 4M2LA 1MF7A 1XN1A 2RGBA 3D3JA 3DXZA 3EMVA 3RLIA 4EI7A 2FFQA 2AZ4A 3HKCA 2WIAA 3KB1A 2VP4A 4MQ4A 4V0LA 1Z56C 2J5KA 2ZYIA 3FAKA 3P9ZA 4W7HA 4MYCA 5BOVA 1CP2A 1MT0A 3AJDA 2OUKA 4ZPXA 3TO5A 3B51X 3MS4A 5KYUA 2DSNA 3NHUA 4I4IA 2Q4TA 4ZO9A 5J2TF 4Q18A 3DLTA 1A7KA 2HFKA 4KH0A 5HS6A 4RZSA 2B82A 2BFEB 1UQUA 2BHRA 2JZNA 2BMDA 1I1OA 4F46A 4FIZA 3I83A 4CIXA 4EMSA 1MC5A 4ES6A 4P3PA 3LBIA 3A1PA 4YAUA 1ZESA 2CHQA 1FBNA 2QRNA 3PFHA 2JRLA 2VJNA 1JN0A 2QQ0A 3II6X 4RK6A 3RRZA 3T7IA 4EJSA 5IYZF 1JQ3A 1I4LD 1H3FA 3DLPX 3MWDB 3OQVA 4BLSA 2X0NA 2XCUA 1EA7A 2VTEA 4EI9A 4QEKA 1YCHA 2PX3A 2ZWMA 3K0EA 4RVUA 3MWKA 3Q3AA 5D7NA 2YNMD 5KX5F 4ZU3A 4FHZA 5IJXA 3WRWA 4BEWA 3DOJA 1VSBA 1XRRA 4TWRA 4REQB 1K8QA 1MC1A 3KSUA 4YJKA 1IEXA 1MORA 3G8YA 4UU1A 1OTHA 2JRCA 4YRBA 1H2YA 4FGZA 1UDCA 5DH9A 3WLLA 2X4DA 4BLTA 5C1DA 5JD5A 4PGHA 1GKLA 4B6PA 2J7KA 121PA 1KY4A 2DG2A 4GC9A 5KHAA 4DV3B 1WCYA 2W6NA 2CDCA 4MDFA 1KAEA 5EWMB 1WB9A 3ZV7A 3D6JA 4ID9A 4YMTA 1Z8DA 1GGFA 1U3VA 2AG1A 3KM0A 4Y30A 1N2SA 4KRXA 5C8YA 4XGQA 3E20A 5LP6A 3ADCA 2ALJA 5KTNA 5DS0A 5FF9A 3RDPA 3SC2A 5JWOA 4D1YA 1O57A 4D0GA 3GMSA 3CC7B 1XVLA 1NQTA 5DB4A 2VPZA 3U2QA 2CJWB 4Q4HA 4TKMA 1PDWA 3GAFA 4JGGA 2HIAA 3R3SA 5CW1A 4YGYA 2HH9A 2HV8A 2P4SA 2V4UA 1LVUA 2FMUA 3QKUA 4D44A 5HXAA 1PV4A 1NOIA 2IP2A 2QN2A 4NYMQ 1JI0A 5AKXA 3FPPA 3P20A 4OJQA 4MULA 2D7DA 3SC6A 3T3MB 2CEKA 3Q4GA 4L3OA 1TMOA 3GRUA 3ZH9B 4HWTA 5J1SB 1GTL1 1R9NA 3DMDA 3AT1A 4HB0A 2WFZA 1UXJA 4YWHA 1U7OA 1FFXB 3JS5A 4Y9RA 2QPAA 3CN7A 2V9PA 2E0IA 2G1KA 2QIPA 2FR8A 4HXFB 4OQFA 1GZHB 1CB0A 4AULA 1E7WA 3FLEA 4CQMB 4NYJR 4R8RA 3ZGYA 3OCZA 3E15A 4TRJA 1W49A 1S89A 4YV2A 1AV6A 4WOBA 4GKBA 4NV1A 1XE3A 4KAFA 5CFZA 5KOHA 5DYNA 4P80A 1XRSB 5GJWC 2FSUA 4GWLA 3LPDA 1CZOA 1JQKA 3TTSA 1CR2A 4BO5A 3ZJUA 1GTVA 3N74A 4JLWA 1VL8A 2OBMA 1BWSA 1N78A 2D3WA 4DLSA 2FI1A 2Z2IA 1JIXA 2QSUA 2GDZA 4NMHA 4L3VA 1NQOA 3BFKA 3L9XA 4R0NA 4DQUA 1J0AA 3FZGA 1T2DA 3PT5A 4URWR 4G9EA 3E9QA 5JZ9A 4YPVA 3LDHA 4N54A 4YO8A 2DVMA 4H2DA 4I1IA 5JS2A 4DV4B 1S8FA 1P3Y1 2KX7A 1Z6ZA 2WJJA 5E6UB 3B7PA 4DIDA 3DDUA 1IOLA 1JYEA 4HDKB 2B4YA 3NS7A 3SJZA 2WU8A 4NPCA 4CF6A 1WX1A 1G2PA 4AUMA 1D2MA 4Z49A 2XI4A 4B6SA 1GTZA 4RKEA 3JQFC 3TEMA 4EF5A 2I55A 1PW5A 4BUZA 4F6CA 3N8HA 4BECA 4MB2A 4FZRA 5FBWB 5KQRA 1GDHA 4DJTA 1ZLXA 1L7QA 2PUJA 1EFTA 3DR3A 2I7TA 2IKQA 4QAQA 1LV7A 3D7NA 2JLZA 5CK4A 1ECBA 4IL5A 2Q2VA 1DBRA 2RGUA 4IOKA 3SYRA 3IQFA 1D03A 3F3SA 4JBGA 1X8LA 4L8GA 4WVFA 4WN9B 1Z2CA 5JCJD 1N3BA 3PGLA 4E32A 2A1TR 1H8EA 8MHTA 3INYA 1KS9A 1XF1A 2GARA 3L49A 5L8VA 4UU7A 3X1WA 2CL0X 2XYHA 5TGTA 1JQBA 2A14A 1KEZA 3RC2A 1PJTA 1I3LA 4WK0B 1VMDA 2WWFA 3Q1LA 1JR3E 2I03A 1XDGA 2H59A 3QX8A 4HZUB 5DYGA 2F64A 2O0JA 1Y8AA 2GXQA 5IANA 3RYIA 3AUYA 4XLHA 3HCCA 2B69A 3IVMA 5LIPA 4UTVA 1I4WA 2GLUA 1XDSA 2XUAA 3CS3A 4GBMA 4TKOB 1ZISA 1ZM3A 4M21A 4NDNE 4DWVA 3FOBA 1HDZA 1P0PA 1RMQA 2R8EA 3TB4A 4NH0A 3ELDA 3WL4A 1OOEA 1V4NA 3MILA 1XCOA 3SVZA 3PXDA 2O7QA 5JFGA 1DBIA 2IIVA 4MJ3A 4ND6A 1S7GA 2A0UA 4UU8A 3QKSB 4UM9D 4Y6GB 2XF2A 5BT9A 3KOXA 1UFRA 1P1BA 2D74A 4P92A 4Q1AA 4ZGNB 4ZAXA 4BVHA 4YJFA 4Z3OA 3CLSC 2XYQA 1Q14A 3ASYA 4DM4A 5BQXA 2IQ5A 1SBYA 3CUSA 3VPCA 5AVZA 3I39X 2BF7A 1U2RA 5BVHA 4WHMA 1JR3D 2PKQO 2GCIA 2TMGA 3RLFA 1N9ZA 4QEDA 1ORTA 3IO5A 4RV4A 4U7PB 4D42A 3T5BA 4DJEC 3FFTA 4WY2A 5CEEA 4EBFA 4URVR 3PEYA 4YI5A 1S8NA 1K0UA 3GJSA 1OLXA 4MO2A 1WA5A 3TNFA 3WTCA 3A9CA 4R41A 1HFJA 1VRCA 3I04A 4JIGA 5J35A 5E6UA 2O8EB 1V96A 4JLBA 3PICA 1KZ1A 2BEUA 1P72A 2EQBA 3OCXA 3D7LA 1KK2A 2QUIA 1KDZA 5HK9A 1DMRA 1XIVA 5CX1B 4RTKA 1N9GA 4AROA 4DSNA 4MP6A 4X20A 1UQTA 2PTGA 4BRUA 2I7CA 2X1VA 3A6KA 2PMEA 4ARUA 4ETNA 1ODCA 1TKRA 4TLCA 1C7RA 1HT1E 2I1LA 4JR0A 5AKKA 4DQ0A 1TT7A 1I5OA 1UJ2A 2IU4A 1SXJD 5EZSA 3U16A 3B3AA 3ADOA 1LTKA 4KAXA 3ZU6A 1T5DX 5AJWA 4ZV9A 5DNEA 4EAAA 2BGTA 2NV6A 1G20E 1QQ7A 4LBVA 1KH2A 2JAOA 2MU1A 4OXYA 1T9CA 1QYWA 2IYWA 1PSZA 1ZMBA 4B43A 2Q2NA 3D0RA 3VKFA 1XCJA 2YQ4A 5F77A 3GF4A 4NHOA 5DNCA 5DXFA 1EYZA 1M9NA 1JZSA 1KKLA 1YT5A 2XWBF 3F98A 3MCUA 2JCBA 1F2DA 3N2EA 4M8IA 1PZNA 4AP9A 1GCOA 4W7IA 5TF4A 2CV0A 2ZBPA 4EFLA 1IY1A 4CMAA 1RHQA 4CNQA 3GOHA 2IIBA 1F7VA 4EL5A 1T8UA 2HWYA 1YIDA 1PQ4A 1T4DA 5A9TA 1ZW6A 1UBTS 2VRBA 1FRNA 1E0KA 3ES9A 3T56B 1G6KA 1Q1NA 1TQ6A 4U6SA 2CXHA 2HDOA 3FLBA 4XXHA 2VCEA 1VJTA 4OG2A 4D0SA 1X3SA 3TOZA 1EAMA 4QV2A 1WF3A 3RFTA 3H1EA 3U19A 1ZYUA 1B8PA 4OK3A 4HAXA 3C3DA 3CRQA 4MHTA 5FQOA 5JR3A 3NWBA 3QGMA 5LOVF 3QBTA 2XT6A 1PJ4A 2ON6A 1TZJA 3GJYA 3N1UA 3THOA 1AZSC 5DGTA 4CL8A 3D26A 3KL2A 3QXGA 5CURA 2Q7DA 3VPFA 1E94E 2JI4A 4DIOA 4IJUA 1CZNA 3OZIA 1DC4A 16PKA 5E9JA 4ENWA 1OIWA 3CRVA 3IR6A 5JJIA 1Z2EA 1B15A 1P9OA 2HK9A 2W2KA 3U4DA 2R1ZA 4EHHA 2HNBA 3OZBA 3MINB 4HGRA 2OE2A 1CQIB 2RK3A 5AHOA 1FQKA 2P9GA 3ROTA 4BNDA 1U0TA 3MPOA 1FFGA 4UPDA 3KJGA 2IXBA 1CD5A 1Z5VA 2XZDA 3UB3A 2RB5A 4UREA 2I9KA 1E1RD 2WJPA 4HDQB 1GU0A 3OU7A 2X0KA 1XA3A 1VYUA 3W5VA 1ZIDA 3Q3EA 4Q4AB 1DAIA 1KYQA 1IVNA 2ZYAA 3MGBA 4LA4A 3ZI4A 3DYIA 4ARZB 1SU7A 4RMNA 2CFTA 4J0HA 3OKAA 2GD6A 2XCQA 5ECDA 1IHPA 4GX5A 1B6TA 5BOSA 1N2BA 2G8LA 4KK3A 3E7WA 1U5CA 1ORHA 1OCEA 2BFBA 1TRKA 4FGLA 4OQEA 2Z2KA 1GUDA 3UWSA 3B70A 3U6BA 1XRJA 2BZSA 4RETA 3BCFA 2BHSA 4RKQA 3O03A 3PLRA 3FTEA 1I18A 3HCDA 1JTFA 2PD4A 3C3CA 2JIOA 2YWXA 3SJ7A 4INOA 4C3ZA 1OTXA 5GV8A 5IVHA 3AK4A 5EQTA 1WY5A 3MFYA 1D1PA 2C2HA 2HYIC 1M3SA 1QB8A 2A9RA 1MAWA 3COYA 1L1FA 3U31A 3U9SA 4BBZA 3T7RA 2D6FA 4LY0A 5IWCA 2OSBA 1PO7A 4XLFA 5JAIA 1LKZA 2OHOA 3E35A 3LH5A 4MPDA 2D3LA 1R0BA 3ICWA 3EFOA 1H0SA 4RA9B 1LPMA 3RUDA 1I7NA 3R09A 2ENWA 3GSIA 2GEVA 5KPJA 4OI2A 4KHZA 2FJPA 3L0YA 3T4PA 4YJGB 4KQ1A 3QFCA 3Q15C 4REMA 3ZHSA 4C4TA 2DR0A 1AC5A 2AZXA 3M3DA 1NLZA 1FX0A 1ZITA 5LNK1 2JATA 1FMCA 3S27A 3U40A 2BUCA 5JAOA 2G1PA 3NDJA 4DSOA 5C8XA 3KOMA 3AFOA 5H02A 1Y4AE 4FFLA 5CNMA 3PC6A 2Z3VA 2Y77A 5DTIA 1VL6A 5K6AA 2H63A 1VJDA 2ATEA 2MSLA 1JHYA 5B3JA 2IYRA 4YP7A 2XJ4A 8ABPA 3I76A 4I8XA 2ZATA 1YAJA 1ISHA 1T9ZA 2HMAA 4GHWA 4K6GA 1BXRB 1TL7C 4AL4A 1DV1A 4D45A 4E12A 2P6UA 4XYEA 1WZNA 5DHPA 2QN6A 3O9MA 4CL2A 1NYLA 1T3LA 3OW2B 1GNQA 2XECA 1N6PA 3HZZA 3WICA 1O0CA 2BFDA 4GS5A 3MQ4A 3CR3C 1CX9B 4BVLA 1OAOA 5ALOA 1W6RA 3BICA 5LC1A 2IPXA 4FGUA 4BMOB 1CDZA 1FP1D 1UODA 4B3CA 1W4AA 1Y42X 2OOKA 1RTTA 2J9YB 2IXTA 3RHFA 1FFYA 3P71T 1JKIA 3OIVA 2BFMA 3OPYB 5KDDA 1OREA 4K7JA 3D8SA 1PGQA 2E85A 2PR2A 3D6UA 3SICE 4YMLA 4B9AA 2C7PA 3U49A 1JAIA 2PL3A 5BQ3A 3BCHA 1Y8RB 1I14A 4GF5A 2PX8A 3A6EA 4F06A 4F6RA 2P0AA 2D2IA 2XMQA 1L5VA 1UC4B 5ALEA 5GONF 1GKKA 5K0FA 1HX7A 4G81A 2VTBB 1KZLA 3VR4H 4GXNA 3ER8A 5E0OA 3JZMA 3WGHA 5AKZA 1NF8A 4MV4A 3ZE0B 1P39A 1QLHA 1MO4A 2FXVA 3BDVA 3H1FA 3DTYA 3QE0A 3X1KA 2ZXHA 1LB1B 2G4CA 3KRTA 3RTCA 4CCYB 3GDWA 1W76A 2B92A 5CFMA 4V39A 5TV2A 3V4SA 2C96A 3GJRA 2WYOA 4MGIR 1BFUA 1L0BA 4MYSA 3G0HA 2GH1A 2VT3A 4IHAA 2Z56A 1VHLA 4FYWA 1PVOA 2QRPA 4G3XA 2AD1A 1SOMA 2I80A 5HTOA 1FEZA 3F5DA 1QZZA 2F6RA 4TQAA 4RDIA 3WDMA 1NM5A 3E48A 1IB6A 1Q1GA 4Z9BA 2XT9A 4XGIA 4ETWA 5IYQA 2I33A 1SUIA 3GA0A 1NM5C 1VE6A 4QGAA 3ONNA 3UJ9A 4S1OA 5CLLA 2FLKA 1VYVA 3BF8A 2HBRA 1LBSA 2ZJ0A 2OBNA 4GSKA 3NNDA 3ZY2A 2G83A 3JARA 3M81A 4URXR 1S9DA 3GR6A 1HE8B 1DCKA 1VKZA 2FRVA 3FPEA 1DKPA 1CNFA 1SQSA 2W90A 3B3FA 5TQ2A 4R8MA 2JIPA 5P21A 3ISXA 1E9EA 2OSVA 5LZ9A 2CNDA 1DFIA 4MVJA 1W2GA 4WLOA 4RACA 2FQ1A 3TDNA 1A9YA 1NB9A 4RXMA 1EZ4A 5KNCH 1FP7A 4N8DA 1DXQA 5DSZA 2OC4A 3Q6QA 5AW4A 2YINC 1T0IA 1XVVA 2I62A 3HYLA 3KTOA 2QMUA 4DGQA 3VI3B 1P2FA 1UPFA 1O87A 1CYEA 1OH5A 3W6PA 4UEKA 1SWWA 3VJMA 1GPJA 3CUVA 5U4QA 3PENA 4QL3A 4XCQA 3USCS 1WNFA 1MR3F 2A9KA 1H6AA 3KEMA 2TYSB 4REQA 1HYBA 2YHSA 1PG0A 1Y0RA 2AOVA 2XSZA 4M1WA 1XZKA 4NL4H 1FYDA 1NC3A 3ONEA 2UZIR 4KUEA 4XKWA 1JRLA 3MJDA 4RE5A 2Z9BA 3BGSA 2XDAA 4URYR 4A1FA 4DGSA 4J0IA 1KJ8A 4WL0A 2GK7A 1QVVA 2AJDA 2JGDB 1NVBA 3RTEA 3FOFC 3VNSA 1XPOA 4FOOA 5AW7A 1CUWA 2GPYA 2JFOA 4MGZR 8ADHA 3H4TA 2AWOA 1YBFA 4LDNA 2C2ZA 4IIGA 2NU7B 1B8UA 4XIJA 2RGAA 2X6RA 2ZROA 1EXWA 3B6ZA 3VYTB 5EWMA 3OZEA 4A0RA 1DAOA 4KR3A 2Y1GA 4ZCSA 4EM6A 3C3KA 2XZLA 2WOJA 2HQOA 4IILA 1JHZA 4C4SA 4BVFA 3AVUA 2NO9A 2ZUCA 4G0NA 4V0SA 2QTRA 4XUGB 5DULA 4IGIA 3TSAA 2QY9A 3UKOA 5KOYA 4RPLA 2J6IA 2EF0A 2TMYA 1K66A 3AIOA 3TTUA 4R1QA 4P7JA 1SVOA 1HG1A 1EGQA 3KOOA 4M7OA 4X7RA 2FXIA 4MRRA 1Y3AA 5I9SA 3V1KA 4BHTA 3MWYW 1LVHA 1PDOA 3IP3A 5GJBA 4YB8A 3V34A 5A4IS 1ISSA 4W9NC 3R75A 4LVNA 1RXYA 2Q9UA 3FPBA 4FFPA 4G5SA 1YKFA 4E46A 2BDUA 4MW0A 2WUEA 1PZGA 2XCIA 2CKDA 3DZBA 3PS9A 4KXVA 1HYQA 4I5EA 1THZA 4L74A 4WK2B 5ALXA 2WTNA 3G0GA 4PO9A 1SXHA 1NIJA 3NIDB 2R96A 4FC6A 4AF8A 1E4EB 2FDRA 3LQQA 5IARA 2CD7A 3MCAA 2VFAA 5HMLA 1Z6TA 4B3IA 5TPZD 1MIOA 1OI7A 3RIGA 5K8JB 5LP1A 2WPNA 1I4TD 1YZVA 3A3YA 1PP4A 1HL7A 3VH2A 2LIVA 4LWZA 1EP3B 4CMIB 2FF5A 1L7RA 1FX1A 4C0XA 4I2VA 5FWNA 1NBEA 2C5EA 3O8RA 4YJ2F 4X5OA 1MC8A 1XZEA 1NN1A 4G84A 5FEUA 1U8FO 1QYVA 3MT9A 1JQJC 1N2ZA 2NT3A 4L7QA 3MTIA 3UA3A 4YRAA 2BELA 2PUHA 3NT2A 4CFYA 2GN4A 3RI3A 1YE5A 3ZGNA 1S5PA 3JD1A 4G26A 1A4IA 3RFFA 4A82A 4C3OB 2F17A 4MEJA 2O2IA 1Q0TA 3C8HA 2O7VA 4BNHA 1XCPA 1XD2A 2VF5X 3B1YA 3NDIA 2CVHA 2B0CA 4PU0A 4A5SA 5JD4A 4ALKA 3DZIA 4H9GA 4G4GA 3R3YA 4LW8A 3ZGLA 5KUTA 4DMFA 3DQQA 5GM2A 4KTTE 1KSGA 3A4VA 4LYJA 4AYXA 4ZV4A 3L4EA 2HA2A 1KZYC 4MUGA 2ZXIA 3CBGA 4RS4A 4B46A 1BMFD 3KX2A 4PQEA 2YDYA 4IRUB 3W4JA 1J0BA 1XEXB 1JJ7A 3DVQX 4FX5A 2GN9A 4Q9AA 3TYXA 3W3ZB 5DPMA 2NU7A 1AA6A 3HR8A 1RRVA 4RGQA 1WKVA 4RNCA 3GUHA 4MGEA 4Q4JB 2W2VA 1WMAA 3EJ6A 3R0XA 3AR8A 4X90A 2V7BA 1OTYA 1N1MA 5CFLA 5LMZA 3OU2A 4JWKA 4M22A 4U7HA 5JCOA 4GR9A 2V4MA 1P44A 3X2SA 3DV2A 3L0IB 4IHJB 2AMYA 4WVLA 2A92A 4DBLE 4TSFD 4BO4A 1QV7A 3EQ8A 3W1EA 2Y6UA 1EDBA 1UBFA 1ZI9A 1PL6A 4YASA 5AKJA 2HF8A 1DV2A 5AVQA 1ORRA 3M33A 5F9HA 3IEIA 5ARCA 3IC5A 4RQBA 3G2IA 1L7OA 4KGXA 4M7PA 4ZI7B 2Y71A 4DY6A 2C5SA 2V7VA 3GPIA 3ODGA 4XWGA 4PBTA 2C77A 5CDGA 3TLXA 3ZE7A 1V5VA 3E7DA 4R31A 2Z2XA 1HOTA 1IZYA 1PFYA 2IOHA 3QH4A 2ZI5A 3BGOS 2ZYGA 1JJFA 3ZV5A 2J3DA 1KI6B 3H11A 2C97A 4F56A 2Q3JA 4YY3B 4FXPA 1CJSA 4ATNA 2HA7A 5JXWA 4UUOA 3NRCA 3ZIUA 5DN6D 4D80A 2FDCA 4GXRA 4NJEB 2DFVA 1TMGE 2VP5A 3RODA 2GPJA 1DWPA 4H77A 4HLUC 5JXHA 1XTPA 4Z7OB 3AIIA 1T6NA 1E2NA 2B37A 4UHHA 4MYTA 1M2EA 3L6DA 1L3CA 1YL5A 2F3SA 5TRDA 4LSGA 5IAEA 1Y6GA 3L5OA 1ZU5A 4J49A 1I6LA 4Z9AA 1GQQA 3SBEA 2BI4A 4YC7A 1JIUA 5JXJA 1OBVA 1G5TA 5A4AA 4DRYA 2OBFA 4DSTA 1USGA 1JEEA 4MKZA 1E58A 3ZDXB 2JVKA 1HMPA 4I36A 2GF0A 2GTPA 1W46A 4TRNA 2P2DA 1FQWA 4Q93A 5DOZA 2CMDA 3QVKA 2QT9A 3BMCB 1QCDA 5KYYB 3M82A 1BQ4A 3TSYA 2XVAA 4FT4A 4JI6B 4DCJA 3ZZUA 4PM4A 1KO5A 1YHYA 2A5FA 3EVZA 3IALA 4LHVA 3HE3A 4LRSB 3NT5A 5IZCA 3DXXA 3UXEA 4GYYA 3DAOA 3BRSA 2Z95A 4MWEA 3Q5DA 1VBKA 2VUSA 3T7KA 4F45A 3IBSA 5BSGA 1U0HC 3I28A 5THQA 1EPUA 3ET5A 5E0KB 3TW8A 4ARCA 4ZICA 2W6IA 2AOTB 2C2MA 2PYZA 3OZDA 1V3UA 3K9NA 3RIYA 4P5PA 5FUBA 3K0KA 4BWYA 3IPXA 3SHQA 5KKAA 3HADA 4M83A 1SQ5A 3IURA 3QVWA 2ZTUA 3IT1A 4IMPA 1F4LA 3GUUA 1WV1A 2G3YA 2I8AA 1QO0A 2JGEA 2WIKA 3FZQA 3LLVA 2DE0X 1IH8A 3O8OB 4G4IA 4DIKA 1GSHA 2F1KA 5JSQA 1SVIA 2MSKA 4I1VA 4WNAB 2K7FA 5JDIC 4EI2A 1PX0A 2FV8A 1E62A 3IQXA 2F3QA 5FV4A 3CIOA 1LS1A 3OD1A 4LAFA 4PYLA 3V48A 4CLEA 5F7OA 4YCCA 2GD1O 1JQAA 3DB2A 4HN9A 4MWCA 5AOAA 1NVTA 4Z3KA 2NUPA 1KRHA 3M89A 1M2VA 2BBSA 1EE9A 4G4JA 1C7QA 4EW6A 1X7ZA 4I4CA 1JA0A 3H99A 3H9CA 3H6GA 2OMEA 1RAHA 4O4HA 2XE8A 5FWAA 3FBTA 4X7FA 4LC0A 1PJBA 2FVGA 3ZQ4A 2OM2A 1US8B 4U2KA 4X3OA 1L7VC 4Q05A 3D1JA 3PE3A 4MR8B 3MWEB 4JUAA 2E4AA 2HV9A 2LWIA 4N6GA 1D2RA 3DEFA 4CKCB 1NMSA 1T91A 2XZOA 2W6PA 4M46A 1PT6A 1QWSA 1FLDA 1R0CA 4S1NA 4DA8A 2V03A 4UFOA 4J9UE 1I5EA 4FEYA 5JYDA 4BVGA 3SEAA 2YJ6A 3D02A 4WQMA 1TQ2A 2IEYA 2QKYA 3PUKA 2I3BA 3QE3A 4HMQA 1NVMB 3IUQA 4O4LA 2P69A 3E9NA 2E55A 3JALA 2LPMA 5DIZA 5DHSA 5AXBA 2H1IA 2H9IA 5B7QA 7AT1A 3T0FA 5CW2A 4CMGA 5DX8A 2ONYA 5B3JC 1KEKA 3HRKA 3UMSA 4MICA 4CGYA 1QCCA 4M9QA 1CUXA 1P1JA 1SC9A 3I9MA 1KPIA 5C4IA 2YJGA 1EJ2A 1T9BA 5K6AC 1TTQB 2JD0A 2NSHA 3U37A 1HDIA 5ADUS 1NMXA 2B30A 1VG9B 2HA0A 4ISCA 2FR0A 4H7PA 2YXLA 4KB5A 4BTEA 1N36B 1X2BA 4IM7A 1S2LA 4BZXA 4MW2A 4HRYA 3KU1A 4GW3A 1W6UA 4OHMA 4ZA2A 5LUAA 4DPMA 1AKNA 3I45A 1RQRA 1LI5A 3GNTA 3OPVA 2ZJ2A 1KMNA 3JZDA 4CT5A 3INGA 4OSEA 2V7GA 1IOVA 2ZRNA 4TQ9A 4LE2A 2WJWA 3CCUB 5DXAA 4ZARA 3HFSA 2JFHA 2QP4A 1A9PA 1J2TA 5K8IA 1VG0B 4AP6A 1KP2A 2V3WA 1AM4D 5AN9A 1E9DA 1AGYA 5EZ5A 2WOOA 2IZ1A 2J45A 3BB4A 2OV6A 1SU6A 1JAZA 4LVOA 5E7QA 5FI5A 1ZL2A 2PNJA 5K8TA 3AL0C 1YC5A 1SFRA 3QFHA 4QA9A 3ZXUB 1XPUA 4RPKA 2B4TO 1U0JA 3GGCA 3GLSA 1V5FA 5F5XA 1YJBA 3BMNA 4I9NA 3BSSA 4HR7A 5IAKA 2FUKA 3MA0A 4P2GA 5EMHA 5LLTA 2GJSA 2D00A 3KQHA 1SZCA 3KIPA 1YJXA 2R11A 2X13A 1JMYA 4CG0A 1R74A 2VYVA 5C31A 5A7GA 3RVLA 5EIBD 1DKOA 3WL5A 3L4JA 2BMWA 3GBPA 3CP8A 4QIHA 2X0RA 3A4TA 3WLTA 3GFBA 1PWHA 4WN9A 2HDNB 4NCHA 3GRFA 1SELA 3QA9A 5DYIA 3SYLA 1P4GA 2XAUA 2ZUEA 4UNRA 4O59O 3ZHCA 3DFIA 3VX4A 5GIOE 5TR9A 3NDRA 1OLUB 1JSXA 2YW2A 3LFTA 4XOPA 5IBCA 3OZAA 5F12A 2ZTHA 1G55A 3LKDA 3S2YA 3H1TA 4QD3A 3GCDA 3VHXB 1T3TA 1O95D 4RYLA 3RS2A 4DCTA 2IU6A 3PUHA 2WIDA 2IZ0A 3C70A 3D8NA 1HYGA 4X0EA 1ES9A 2VK1A 2AKEA 2OHHA 4OXXA 3KQVA 5FP0A 1RLUA 2ZVJA 1QHIA 2N1MA 4RC9A 4L72A 1UINA 4ZVPA 4F1JA 1RHUA 2QRVB 2C2GA 1VM6A 3PNMA 5GQSA 1CIVA 1FW6A 3KJFA 4RTMA 3FJYA 1DJMA 1AA9A 4O4HF 4L5IA 4B7UA 1YNOA 4UTNA 5EFZA 2ATIA 2NOAA 4KW7A 4U7TB 2X8KA 1E6KA 4CCWA 2D2VA 2IP4A 3O8QA 4KRGA 2BFCA 1QVRA 1CJVC 1Z17A 3KE9A 2PR7A 4CCAA 3DEYX 1J2JA 4KR2A 1P29A 2EJUA 2D1RA 3BCUA 1D2HA 1E9BA 4EY8A 4RSGA 2HJVA 4Q4JA 5EQDA 5KQMA 1OXMA 3DAGA 3NWEA 1P7WA 1C9KA 1JFRA 3V4VB 1QP0A 3CO0S 2ZCUA 1LC0A 3FE2A 4O02B 1MV8A 1DT3A 1VYHA 2VDJA 4KO2S 4MUHA 3C3AA 4AY2A 2PO5A 2GZMA 1QHSA 1RRGA 4DDMA 4ZCRA 4IZHA 1B43A 3BEDA 4EQ6B 1UK7A 1WB5A 4NCBA 3ILHA 3QUQA 1G5HA 2H4FA 1TCCA 2HJSA 1RWNA 4MMZB 3SK0A 3HCEA 4QBIA 1G16A 3EDRA 5HP4A 1NVUQ 2VSOA 1P0IA 2K5UA 2H1FA 3A9TA 1MKYA 4ZDWA 2HO5A 3HFGA 4GNKA 4NBSA 2RK4A 4P35A 2DWCA 5AK5A 3BCDA 1W47A 1VHDA 2DHEA 1CS0B 3EEBA 3RRNA 1BS2A 3OETA 1L8AA 2OHFA 2IPOA 4MCIA 4MW7A 3U1BA 4YJFB 1TUBB 2IZZA 3AC0A 3LVFO 2WDPA 4O4LF 2Q0QA 3LUHA 2J6HA 2OTLB 1OYWA 2DJIA 2JH3A 2YYYA 2ZIFA 3ZU5A 1FJXA 1VQ8B 1MB0A 3NOQA 1W5AA 4HGOA 2FLVA 2OG2A 2WZQA 5FPKA 1YB7A 1HLDA 2ZZFA 3ANYB 1ZU4A 3T95A 4U4AA 1RLTA 3N0TA 3NETA 4D4MA 2FZGA 2CXSA 2XRMA 3C1UA 1NUTA 2QTMA 4GD3Q 5C8DA 1GNSA 3I8OA 4JOCA 1MU0A 2OBLA 4JZYA 4MMXB 2ZT5A 3GLRA 1XQBA 1OH7A 3UTCA 3ZE6A 1D2CA 4FR5A 1ZD4A 4IXMA 1UOQA 2J5RA 2LIPA 4PYKA 1UZNA 3BGVA 4RLZA 1G5FA 2G8NA 3D81A 4CE6A 4ER3A 2VTKA 1I1NA 3NYIA 5KWSA 4NZ9A 4RXUA 2F1IA 2I3ZA 1I01A 3K0HA 4B40A 4Q37A 2B7BA 1T1GA 5DRTA 4Y1EA 2I2WA 2J3IA 1I7QB 3TI9A 3DYBA 2NXJA 1I2CA 1QVFB 1NY6A 1QV9A 4PYIA 5FOXA 4PQRA 4EATA 4MWBA 1MRZA 1XHFA 1JNYA 1JSLA 1LI7A 1EK5A 1XLWA 3HXTA 1F5SA 5DN9A 3HCAA 2Q1TA 2C04A 1HDEA 2YS6A 1U3CA 2PU7A 3EE6A 2NTYC 1QCYA 2R84A 3BTOA 4K6OA 4K8RB 5REQB 1N4DA 2Q6LA 2R6CA 1WKBA 1C3EA 1AH2A 2HSZA 4KQEA 4XB6B 1MQ9A 221PA 3DEHA 5C8YB 1QYCA 4QJ5A 4HNAB 4KQGA 1M7GA 4IDAA 5AOCA 3GLUA 2D1TA 1G5QA 2VPIA 4TYYA 4W9NA 2A1IA 2H57A 2ZRCA 3M6FA 5LB2A 4A36A 1YRLA 1N5KA 3BQNB 4OKIA 5B36A 1DTEA 5DKFA 4D9HA 4RX1A 1WW3A 1UBKS 2LV8A 4YCMA 3OC6A 1CSEE 2IS1A 3CH5A 4O4HB 4FHEA 4QXPA 1Q7RA 1X7HA 1O03A 4TSKA 1XMJA 1E4VA 1LUAA 4WGGA 3ASSA 3K09A 2JKYA 1EA5A 1OW3B 1EP9A 1UOPA 2YWRA 2Z30A 4WRRA 2VCHA 4LDAA 4Z6KA 3FTQA 3TLGB 1HDXA 2RMKA 5JASA 1RWVA 2YIJA 3CZPA 4OPMA 4WCFC 1G8YA 3V8RA 3NDBB 5ICCA 5MGNA 2VBIA 3S99A 3VO2A 2XEDA 2W2XA 1IN6A 1Z7WA 4H7KA 2VKTA 2HRDA 2J59A 4G1FA 3VR2D 4E3WA 4EY7A 1BAPA 3HCWA 1V6SA 4GICA 4JX9A 4EKEA 3QU4A 5KHLB 1B41A 3WIDA 3OLXA 1E2LA 4QFCA 5D6OA 3IHLA 3V4FA 2OZLA 1E3XA 2DB3A 2QN8A 4FC7A 5KYWB 1CDDA 4V1CI 4XD7A 3UC9A 5F4JA 1BXKA 3UT5A 4RYDA 2GD0A 4YV7A 2CKMA 1G8SA 1YQWA 5F3DA 1YS9A 1ECLA 3PNKA 1M8FA 4M87A 3WAGA 2X2OA 2BEWA 4HPJB 3ONYA 1IJEA 5KNDH 1P1HA 5K8CA 1RLOA 1IBLB 1MGOA 2B7LA 2ADFA 2ZS8A 2FJUA 3D3WB 1YJCA 1GADO 4F2DA 3TLGA 3GVXA 3ZU2A 3T5MA 1ULUA 4CMHA 1T10A 1KFCB 4D3FA 3EFEA 1N6LA 4IQ8A 3VJLA 2BFEA 2GTHA 3EUFA 2C9ZA 4MS1B 3JARB 5UKDA 4GKAA 1XEXA 3TIIA 1UWCA 4AY3A 4GP7A 3KLMX 4PSKA 4ZVQA 1T1JA 1ZJZA 2EHJA 3JZAA 3CLRD 1E64A 1RIFA 3E9CA 3UAYA 1JR6A 4KKXB 4RHTA 3OP1A 3ABOB 3ZN2A 2QHXA 2EDCA 3JQ8A 2O5RA 1OBCA 2IZ7A 1RI5A 3CR7A 5E6RA 1DDGA 1KC8D 2A86A 4QYIB 4RTNA 1ZGZA 1I2MA 1VE5A 1XCMA 3QTTA 2UYYA 3LQEA 2JPDA 4GPD1 4QBGB 1GYPA 1DWUA 2VQ3A 4JYMA 2VH2A 3U60B 3A4MA 1XMIA 3VC3A 3EAFA 3R5FA 5HR5A 1QHNA 4XCVA 4YFYA 3W9UA 1DB3A 2OO7A 3S8YA 1FSZA 3UMRA 4RK0A 5A6SB 2O6LA 4COOA 4ZK6A 4RSRA 4G2TA 5KSYA 1POXA 2PZ8A 4KBFA 4PVCA 3FIUA 4RDHA 2P3QA 1S4QA 5FTKA 3EY9A 4JGBA 3CQ9A 3VMFA 1PHPA 4HH0A 4RO0A 4WBNA 1MXFA 4GMKA 1QQTA 4RFSA 2I1VB 1ZVKA 4K86A 4GRAA 2R7AA 5TPZA 4C03A 1WXGA 3PBKA 2PWZA 2TMKA 5EE1A 2DETA 2QE6A 4X64B 1HMYA 5TQ0A 1G63A 2O7SA 1SD2A 4QNMA 3L02A 2SKEA 3CNHA 4U7DA 4PR0A 4Z7JA 4YRCA 3R7LA 5CDYA 3U3MA 1DIGA 1CRQA 1XT6A 3C5WP 5F21A 4KSYA 4C6RA 5JZVA 3QYAA 5FUVA 5B3KA 5AOBA 1C4XA 3QELB 2JJYA 3OJLA 1PRYA 3T3NA 2JKVA 821PA 3WHIA 1OX4B 2HUNA 2BBTA 4LHZA 4K9NA 1AG9A 1F0YA 1Z25A 4FJ0A 3C3XA 2QUHA 1GNVA 1E6MA 1SEVA 1Y8QB 2FPWA 2I6QA 4GZ6A 4M76B 3GGDA 3H5LA 1AS2A 2P40A 1UBMS 3A6FA 1SWVA 4JT9A 3LWBA 4DYDA 1IK6A 4J3NA 3JQAB 7REQB 4P5EA 2GZ1A 4EY6A 1Y7LA 1OBOA 2DQZA 3RGWS 4BPBA 3SLNA 1E5TA 1OAOC 1Z22A 1JDTA 4YCBA 4RJTA 3CVXA 5LJIA 3HCOA 4Q3LA 4PS0A 4EFNA 3OTHA 5TSDA 1WP6A 2O8FB 1DKNA 5CA0F 1J09A 2WIJA 1A3CA 2WWGA 4IG9A 1N7IA 4R81A 3PFWO 2ZRBA 4R6XA 4RK5A 5GGYA 5TMBA 3OIGA 3RKSA 4CODB 1RKUA 1QPZA 4EUSA 1Z29A 1ENZA 3CLTD 4RIHA 4G89A 1DTWB 4K9RA 1K3FA 4B8WA 5CJPA 1CJUC 3W6UA 1UC9A 2H52A 3O8DA 4GVXA 4BGEA 3EVDA 4ZQBA 5ER9A 1UJ6A 2I8CA 4PGFA 3KPVA 1OLSB 3GBSA 3B1VA 3TD6A 5CDSA 1TCUA 4TSRA 1V4BA 3G2NA 3F3KA 1J49A 3ESCA 5LZ5A 2R87A 1KETA 3D1LA 3NTOA 3QVLA 3QYPA 4OQPA 3TRHA 3UMBA 1VLVA 4BDSA 4ER6A 4N39A 4C05A 2Y3IA 5EYPB 4B6QA 2IOQA 1C4WA 3NIFB 4QPZA 3KG2A 1IMJA 3NONA 2IE8A 1NE2A 2Z6AA 4EG4A 3VC7A 1T0BA 3CT6A 1A97A 1E66A 4MTCA 3V7FA 3FMPB 4I5FA 2CVPA 2J6BA 4J2OA 4JBXA 4EHLA 3BWCA 2QTLA 1GRCA 3SN6A 3GARA 1PEYA 4F9EA 4P7KA 3W2HA 4Z4TA 1XQ9A 3PLAE 4ED9A 4RELA 4DXHA 1UXKA 4B48A 2JZCA 5J47A 1CQIA 5IS2A 4D8VA 2F62A 4HVCA 1PZHA 5LDHA 3UZUA 4CDNA 4ZIRA 1Q2UA 2KE5A 4FXOA 5JRDS 1QH8B 3HNPA 4WKCA 4ZODA 1JHDA 1MPXA 3FSGD 4N7MA 4EO4A 3EX7C 1JU3A 1R6BX 3H3FA 4KE8A 3TOSA 2RAUA 5AKHA 2H08A 2FP4A 1FTYA 5HKKA 1Q3TA 3UC5A 2CXPA 1JG4A 3QJGA 1ZS9A 3AP3A 3H2GA 3C48A 3TLCA 4FM9A 3N2NA 4QELA 4B3MB 3KJHA 1ZJ4A 3VHXA 1SULA 1JG6A 1E63A 3IBGA 1JEYA 1G291 2BVNA 5FTJA 4EW3A 1ZCJA 2PU5A 3GCGA 3NVAA 4QRHA 1VQOB 3C16C 2OHJA 1XN4A 3BE8A 1H6BA 2C2KA 4OLBA 5TQ2B 2IS2A 1EUDB 1CERA 1PX2A 2J0UB 3EVBA 1ZHOA 1W88A 1DAEA 1W1UA 1AHNA 2CNLA 1Q15A 3DNFA 3BJEA 4BV3A 5KVAA 1C2TA 2VJBA 2XQVA 621PA 4BV9A 4EA6A 4XJVA 1PFGA 4GI3A 1HLGA 1XLVA 2WYWA 3DWEX 4JJFA 1KFEB 1S8OA 3KHSA 2DY0A 2H3HA 4R7TA 4TTJA 2IS6A 1H4VB 5FBHA 2AW5A 4MZXA 4RPBA 3A28A 1EVEA 3GELA 1NSFA 4DYVA 1GN9A 2ORYA 1JKFA 4JLAA 4PGMA 2ZZNA 1NWCA 1CUZA 2BZ1A 1GPDG 3ZHYA 2QJFA 4A2PA 4JCOA 5IMSA 3VTZA 3VVMA 3WLJA 2B8JA 4RENA 4BUCA 4FFMA 1LCIA 1VSQA 4C0KA 3TIVA 4Z4WA 4GLBA 1DMSA 2F8LA 2NU8A 4UOQA 2P9TA 4ESOA 3I73A 5EPUA 3O38A 5ICSA 3TM4A 4Z7NB 3H05A 2FSIA 4NHEA 4Q7QA 3HDHA 1Z73A 4LXHA 3CCSB 5DV9A 5IMBA 1AHPA 1JT2A 4HG2A 4ZOLA 5EC8A 4E5SA 3WDLA 4CLRB 5B6PA 2C1XA 1S2OA 4WEQA 5JRZA 3THXA 2Z98A 2HJGA 5KAMA 2WZCA 3GEMA 2FWJA 3JYOA 13PKA 1VJGA 2VP2A 3K9HA 2WD8A 3QMWA 1BKYA 5AR1A 3UH1A 1HE1C 5EJEA 4TLMB 4ZU6X 4EJ2A 1Z5WA 4XVCA 3TG2A 4CEIB 3N6VA 4YCNA 1N2XA 3TQFA 4X8IA 1L4YA 4RY9A 1XOIA 1FFWA 4G36A 1A82A 1ZD2P 5G3YA 2ODNA 2XTNA 2XTAA 1PNTA 4MV3A 5EZYB 1L4EA 2HF9A 3CCBA 3L6UA 3D0QA 1EFRA 3R4VA 1V1RA 1KVQA 2Q6IA 2WYHA 4MO9A 3IR7A 4U63A 3RJTA 1L8XA 1J1UA 2O2JA 2YHBA 4UPVA 5CHYA 3OLVA 3L77A 1K1EA 1KAGA 3LOQA 4RFVA 2H8KA 5TPWA 3M6MD 3KSMA 2AFVA 3U3OA 2XQKA 4QTXA 4FR0A 2ZP1A 4QVGA 2XUPA 3CKMA 2WQ6A 4ABYA 2DT5A 3C2QA 4URHA 4ZO6A 5ERXA 2XMSA 3DMRA 1HKUA 1Y1TA 2WHRA 3JYQA 4KXFB 2FE4A 3A1SA 3OAAD 1NLYA 3CCCA 1LQ2A 4MUIA 5AICA 3RIHA 3VNRA 1PKVA 3EDCA 1JWBB 2CDAA 2FRXA 4DCVA 4MUMA 1Q0RA 2Y1FA 3QKIA 4K28A 4Z1MA 3KB6A 4QYXA 1E32A 3I0MA 5DYYA 3OC0A 4BJ3A 1ONSA 4HDRA 1X8KA 1JECA 1U0OC 1OR8A 1JQEA 5BN4B 2AYXA 4LOAA 3P0JA 3PI6A 2A5JA 1I0IA 1LBIA 1PUIA 4RSHA 3SS8A 4JP2A 4ZFNA 5DBFA 1W75A 1FNNA 1SCKA 1JB9A 1FOEB 4XIGS 2WHPA 3NALA 3ZZMA 4DW8A 1IB0A 2OTCA 5L45A 5AYVA 4RTJA 1A9TA 3AM4A 4PN3A 4MA5A 1PL0A 1WUYA 3EFBA 3UJ3X 2X2FA 4CF7A 1WR8A 3TLMA 3L7MA 4LECA 1Y0YA 1G38A 1IY0A 1R5BA 3QVJA 3TVYA 5BV0A 5HWSA 4CIVA 2JD1A 4N47A 4YUYA 3JAWA 1FNDA 1P6UA 1REQB 4HEHA 4I1YA 3DDCA 2PX5A 5DLDA 4FMPA 4Q7LA 3VOBA 1YRYE 5D3MB 4J1TA 1RWKA 3LX4A 2GREA 2O3QA 3LYUA 1XD8A 3TLAA 3ZKWB 1RYNA 3GMTA 2ID7A 4CJXA 1T9AA 3HY4A 3EGVA 1N0WA 4H3KB 4BFZA 3I8XA 1JAHA 5EKTA 2UUCB 3SBXA 2K7ZA 3M8KA 4BWFB 3A05A 2VNKA 4JU8A 2NMVA 3C6QA 5BQPA 1B93A 3PR2B 4E21A 1G8JA 1TM4E 1ZGBA 4FYXA 1S3GA 3F6SA 4LXTA 3O4FA 1CR0A 4HX9A 3SXUA 1BGXT 2YWCA 3QW2A 5DGHA 4K40A 3PDHA 3LS2A 3GPBA 1CETA 1R6XA 3DUFB 3R40A 4U9UA 4JB3A 4UUNA 5TARA 1BHQ1 1MX1A 4MIKA 3V3TA 5G1PA 3QLVA 4G7WA 3AERB 3CGWA 1M2OB 3NU1A 4KKUA 3SJAA 2VP0A 2EKBA 4IIJA 1XWFA 3PPVA 2CDNA 4HXGA 1LPSA 3Q7QA 4RHFA 1RQNA 1XTZA 2PZAA 5FQNA 4UVGA 1KY3A 4F12A 3MLEA 4DOMA 1PN3A 2O8CA 2NU6A 2PYDA 3E4CA 2XVMA 3PD7A 4J0KA 1NT4A 1U2ZA 1UD4A 2LCIA 4AKTA 4JXXA 2XZPA 1A76A 3WV4A 2WTEA 4CKBA 3ACBA 5KYYA 1OX5A 3ANLA 3FUTA 2AMLA 2CMFA 1VI6A 4IFIA 2DFDA 4D9JA 4RD6A 1UKVY 2H4YA 1UZLA 3IAS1 3FNFA 3ZZNA 4DDWA 4AJNA 2VUUA 2WR8A 2XWQA 3D4OA 5KNDA 5F7XA 4QXRA 5IDVA 3K4HA 3WLEA 3HKDA 3K5WA 5K0SA 3NXKA 3FB1A 3VU3A 2PKXA 3NKFA 4IVPA 1QQAA 2J0QA 4J4BA 3Q6RA 2HGZA 2ZJAA 3NEYA 2I4TA 4IDBA 2V8BA 4TTAA 1Z63A 4ZJYA 4UAJA 4UUQA 3VO8A 4XGNA 1IOWA 3O4JA 4BOYA 3GZ4A 1A1SA 2C5BA 1LVGA 3DC2A 2FR8C 3R5SA 4YLGA 4ENSA 5JVDF 3F78A 1T29A 3ANNA 5ENVA 1Z07A 1WV0A 1KQ3A 4QVAA 3IUMA 4U5QA 3SFZA 3TJRA 1TAHA 2IYOA 5BSWA 1J5EB 2YX1A 1Z13A 1M8GA 1SAYA 2WU3A 3H8WA 3BVPA 4KDCA 3RB8A 3G6KA 5D84A 3JRXA 3G23A 1B0AA 3JQCA 1VBNA 4ZO7A 4AF7A 1XXLA 4CKBB 1PFWA 2AQIA 5BWCA 3I4FA 1UPUA 2WYRA 3QLUC 1KVTA 1JR3A 2JGLA 1JJ2B 3IUPA 3NBQA 4HRVA 2QBYA 3C1TA 4K05A 1KD1D 2RI1A 1KEWA 4XDYA 4CM7A 4HNGA 3S2EA 1BDMA 1I6WA 3H87A 3VU1A 4BYGA 4ZOCA 4ENRA 5ABPA 1RYYA 5LP6C 4V2UA 2WIBA 4MYDA 5EAIA 5I7SA 4B2PA 5U9CA 1YA4A 1ZK3A 1NVAA 4DLRA 2AEJA 5L4SA 3WK6A 1L7PA 1NRWA 2QW8A 2IV7A 4CR6A 2JJ1A 2IHZA 2W0MA 9ATCA 3AF2A 4JSTA 5FJJA 3KEOA 3QEAZ 3OA2A 4MINA 2YXEA 5CB8A 3G5UA 4WXRA 3BDIA 1V3VA 3R0VA 4TS9A 3SZOA 3WL3A 3K6RA 1VKNA 3CXCB 1I9GA 3N39C 2CHFA 4GGPA 2PUDA 1RVDA 2ZB8A 3UGTA 4G9BA 3RYIB 1IY2A 1WXHA 2XWSA 5DM2A 2H9AA 4J4TA 3TRIA 4V1CB 4JKOA 3U4QB 1YB4A 1NVVR 1OQAA 4JYAB 3N2KA 3W79A 3DQZA 4V3BA 1TAGA 1U2GA 2NXWA 3HKEA 4EARA 4F92B 5IKEA 3AL2A 1U9IC 1S02A 1DFHA 2QD1A 3PJFA 4PTYA 3RT1A 3V7YA 1NFFA 1GQFA 3U44A 3IQWA 4HAIA 3WYGA 3AHEA 3PUVA 2ENUA 5F1OA 7MHTA 1VQ9B 3DO8A 3GZJA 3H2SA 1X7WA 4KJZA 1GPUA 2WJYA 1NW8A 1U8EA 4KRYA 5HDBB 3B12A 3LD9A 1OF1A 1DVRA 1I3NA 4HE5A 3GT7A 1STOA 3K0CC 4J0CA 1S9HA 3OICA 5BORA 1U2DA 1X9IA 1OLOA 2I3DA 2QN1A 3K30A 1BFKA 1MB2A 3LOUA 5E8RA 3E2PA 1VE3A 4HDSA 4NESA 3HU3A 4HDMA 1EJ0A 3KVNA 4BVKA 4GDFA 4IKPA 4OA8A 1SXQA 2RH8A 2Z5GA 4RBNA 1P19A 3PC8C 3DKIA 1KS2A 4FYIA 2PX6A 4ND7A 1DQNA 5U4XA 4D9EA 8AT1A 1PNRA 1TPZA 2C82A 2VSQA 4G5HA 4MX8A 4FQ8A 3BXEA 4Y2JA 3OQ1A 5JLAA 1UXGA 1YQQA 2AR0A 2EQ5A 2EARA 2HRRA 3OURA 4HQNA 4ODIA 4YI3A 1KRXA 3B1FA 3GRYA 3R6KA 1LXCA 1Y3CE 3OHSX 4IYJA 3ZS9A 3PUZA 4MKRA 3GCXA 1W2BB 1XVIA 1IUKA 4NU0A 3IUJA 4NR0A 1P3DA 2HZBA 5FCDA 1ZUNA 2C2BA 2LNDA 3I6MA 1ZIXA 4U2EA 2QNBA 2AOXA 1Z0KA 3H5VA 1JE0A 4CG2A 2B5VA 2EHDA 3EXG2 3STTA 3M6UA 1XLTA 4ZDJA 1T0UA 3H16A 1N7JA 4D81A 3A6HA 1TUEA 2EXXA 4IYRA 1GP2A 2REQA 3EBLA 2AG8A 2FPGB 5KU7A 4CT4B 1DXHA 1EDEA 1G5RA 2FPPB 2K2QB 4I55F 4EB3A 4LK3A 2YVUA 2VHWA 4DQDA 3VPSA 2FU5C 4YRIA 3GVHA 4FCCA 1ZVQA 1XROA 3NTUA 3ZWWA 4RPIA 1CHDA 3KETA 3PF9A 3AEKB 1ULZA 1D2NA 1EXVA 4NFHA 3VYRB 1EBUA 2YFYA 4JNKA 4IFTA 3WIBA 4AG6A 1E1KA 2ZJZA 1Q0SA 3N8NA 2PD6A 5K05A 2E3JA 3AKYA 3BWDD 5B1YA 3ILXA 1Z5ZA 2I66A 1E3EA 1JHRA 2QTFA 1K7SN 3RTGA 3KQPA 3ZCXA 4MVXA 3GVIA 2DGDA 2ZBQA 1C4KA 1RZRD 5CYGA 2RAPA 5ISMA 3QU9A 1L5HA 1M1YE 5EJFA 4ZEOA 3CCVB 5DLEA 4YMIA 3QIAA 1W4BA 2BHNA 3D64A 1TM7E 4NE9A 1R9JA 2XWJI 1SRRA 3LSTA 4JLPA 3TQIA 3ITNA 1FDWA 1R27A 4O4JA 1KJJA 1O96A 5ERGB 3RFVA 3M4YA 5C37A 2N1BA 3GLGB 3RVDA 4KFRA 4QICA 1FDOA 3HFRA 4N5MA 3PWZA 1DO0A 1QBKC 1M6YA 3LPMA 2HAEA 3DEAA 4MUXA 4ZHQB 1VPTA 3PPIA 3ZI0A 1CQWA 1E59A 2H92A 1UUFA 4RZUA 4U0KA 1ZVVA 3L1HA 3EB9A 2BGRA 2AGVA 4Z4VA 3N7AA 2PGDA 1RJWA 4NIMA 5J4YA 4KFTA 3S0JA 4GX0A 4FYJA 4QECA 4BZQA 1QTQA 3R7SA 2YASA 3UW1A 2WJ4A 1BMTA 1LWNA 4IJ5A 5JWHA 5A2QA 4C43A 3QU7A 3K70B 2RI6A 5FBZA 3I6YA 4LZAA 3B9QA 4Y18A 1VFNA 3OT4A 3PDUA 4DEVA 4DRXA 7YASA 5TDHA 2ETVA 1N0VC 3IP1A 3N8GA 3QX9A 4DCSA 4EITA 1VMKA 4HNVA 3GFPA 5KSOA 3FNHA 3RYFB 2CLDX 3PA2A 2NTEA 4KPEC 3TECE 2JAHA 3PGJA 4DDKA 4WEOA 4L50A 1QIMA 3TFWA 2BRUA 3ZDYB 1S96A 5A4KA 5DXJA 1A98A 2D5IA 2IYSA 1G21B 4RD2A 2IYEA 2VLBA 3HUDA 4NWIA 3PK0A 3A35A 1G5PA 4PCVA 2B2XA 2LE0A 4YUXA 4BE7B 1MJNA 2ZK7A 5LJLA 2WTXA 4R69A 3SPXA 4D7AA 1JDZA 5EZYF 5B2ZA 4OEHA 1NGSA 2HQRA 4H6PA 3S4YA 1A5BB 2IY8A 5I6DA 4QVIA 4ALJA 1L4FA 2Y1EA 4BV8A 2VDRB 2JD2A 3UG7A 3V8VA 2YFQA 3D1VA 4HGQA 3WOHA 4Z1OA 1WMBA 2OGSA 2Z4TA 3HLKA 4PLHA 1T1RA 1Z39A 1JA9A 3G8BA 3QI2A 3U7JA 3DZGA 1QGAA 4N0MA 4X92A 3JQBA 1Q7EA 1R18A 1OHHA 1EFPB 2XUFA 5LA6B 3ZD7A 1SHJA 1W5BA 3RJ9A 4RPHA 4LSMA 1YOBA 1T4GA 3QY9A 4DBLC 1U4SA 3TQRA 5JQWA 3KTDA 4X1OA 2ATXA 3K73O 4G0YA 2NVBA 2EVWX 1UBUS 4LY3A 3V4RA 3I5YA 1J1IA 2FN9A 2XH8A 1SUSA 2J0SA 2YZKA 1SQGA 3NCTA 4DRZA 4MVYA 3WTBA 4P6YA 3CLRC 4JLVA 2G7MC 1ZH8A 1P9WA 3P2JA 1Q1ZA 4BB6A 1H3EA 1EJ6A 4PC7A 1EBBA 3D7SA 4G5GA 3I6BA 1NDQA 4H1HA 5ESWA 9ABPA 1YIAA 4EHBA 5GGXA 4YYEA 3EA5A 3QMVA 4QDTA 1WP4A 4YHBA 3OQMA 4HN2A 3TRKA 3UJDA 3O9VA 3CC8A 4I4TA 1KKMA 4NFSA 1YQXA 2WZPP 1MAVA 1UZAA 2FB9A 3GHHA 3AZOA 3JU4A 2AA3A 3BYZA 4LC1A 4X3CA 1I3OA 3MOGA 4KXUA 4WNYA 2PMBA 3ZWDA 1EVZA 4F4JA 1WIWA 2Z0MA 4V0NA 1P1FA 3FR7A 3G88A 4BNUA 2RH5A 4Z2AA 1GPMA 1QF7A 1R0LA 2ZIUB 4OUDA 3Q5GA 4UNSA 4FN5A 1Q0LA 1UMCA 2HU8A 4OKNA 1WB6A 3NBXX 1N06A 1E3IA 1JIIA 2ZJ6A 1ZAKA 3R44A 4HN4B 5KYNA 2ZCJA 5JNLA 1MAHA 4I55A 2VK8A 1SPBS 1M2FA 4E31A 5CCEA 1PJ7A 3HO6A 2X9VA 4QDOA 3A31A 4JROA 1E9RA 4QUIA 5MDHA 1JFSA 3F6BX 3BL6A 3TIFA 2WHEA 2GAJA 5FL7A 3EC7A 2OZKA 3CLHA 4G5OA 4U02A 2GVNA 4TL7A 1UR5A 1QUEA 4S2EA 4A6DA 1G8PA 3B60A 2HMUA 3FM9A 4I46A 5AWFC 1WD5A 2EEPA 3I30X 4GZMA 4E94A 1EFCA 1NXSA 4UM9B 1B2RA 5JNUA 1U7HA 4JFRA 2D8AA 5ITZB 2PA3A 1P4RA 1ULTA 5AKIA 1V37A 3T5CA 5K3AA 2X8BA 3F46A 5IAOA 3F5QA 4N01A 2Q5FA 1PEDA 2W4MA 4JR1A 5KB3A 3IR5A 1GVHA 3UGJA 3MM4A 5I7FA 4DV6B 2QK4A 3DV0A 4Q4AA 4FYKA 2JCYA 1K73D 2WIFA 4HF7A 3NASA 5E1BA 1YTUA 1GKUB 1EDZA 4HZIA 4QREA 3RWMB 3SZLA 1W7AA 1HKHA 1CS0A 1OMOA 3P2KA 3GFRA 1N2GA 5HQJA 2JIDA 3WQBA 1G8GA 3OX1A 3H6KA 4LQ4A 1J99A 4DV7B 2M6KA 4JX8A 4BCBA 2HF2A 2WUVA 2C61A 4LZJA 2IYAA 3I5MA 2G9RA 4Y6LA 5IJ9A 2O8VA 2WZBA 3AI1A 1S2DA 3B89A 4EG6A 4TZ0A 1T5BA 3L4KA 3HKDB 1WU8A 1Z2NX 3EZNA 3HZHA 2GPSA 1TMYA 1LK5A 1T2FA 2UVDA 4EZEA 2WSIA 1NULA 4HDAA 4YJ2B 3WWCA 2VQDA 2H4WA 4X66B 4OM8A 1Y5RA 3UOWA 1YQGA 2Y1KA 3H86A 1U7TA 3GQVA 1GTRA 3FZNA 3HAGA 3ZLBA 5JO9A 4HPXB 3MELA 4W1SA 4YAEA 1BS9A 4EW2A 2VSFA 2WAAA 4RABA 2EEZA 2O20A 1Q12A 2BM9A 2P2SA 3C39A 4OCZA 3ASQA 2YV4A 2Z58A 4PQFA 5BSTA 1H66A 4DNTB 1NJ8A 2BM0A 1OB0A 4YP5A 5CB6A 1EUQA 1HZZA 4ZHQA 2D06A 5HXBA 1HZJA 2PIAA 4FDUA 4PC3A 3VZBA 5LKRA 3SKBA 1Y8ZA 3A6PC 5C1OA 2QVLA 1L3BA 2AUTA 1M6HA 5K7SA 2UZAA 5KJ1A 4BFUA 1KYWA 2HZ7A 1JIQA 2WM2A 5F1KA 2DC1A 1CLEA 3NB0A 5AESA 4L5JA 1QFYA 2EZUA 4OXKA 5IJ0B 2IOYA 2KYRA 3EK2A 2KS6A 3ETNA 4GLLA 3TTVA 4KGVA 5I9NA 3GH3A 3WHPA 1Y6JA 2PKCA 2RHTA 3K8YA 2HTEA 3H1BA 4WOCA 3H83A 3WYAA 5AVYA 2OQIA 1U0SY 2ZYTX 1IXKA 1USIA 3NBFA 3BD6A 2BFNA 5M2QA 3TZQA 2DUWA 1J9GA 1YK1A 1VF7A 3GH1A 2ZRGA 1VL5A 4EY3A 2Y0DA 2FUCA 2OESA 5AP9A 5KOJA 1N5LA 1TM1E 5BSFA 1TCBA 2FG5A 3P96A 1SCQA 1Z4NA 5BQFA 2ECOA 4GR5A 1V1MA 2D4HA 2G63A 1TO1E 1NQWA 1BMDA 5DM70 3VC1A 4Z4RA 4IIJB 2VSXA 4LJSA 2QF7A 1A7UA 1IAVA 2C31A 4BFXA 1AKQA 4IQFA 1Y89A 3PKJA 1IXZA 3OZSA 3TF5A 4RMJA 3RVBA 4HAZA 2QSJA 2ANCA 4HYYA 3WGJA 1LLCA 1HETA 1BXGB 2ZYHA 3NRJA 4YBZA 1AHHA 4L85A 5I7OA 2QI9C 2QV7A 1HEUA 3KPYA 5KDOA 3PJGA 2AUMA 2V3CC 3DYVA 2ACVA 1UAAA 1RPJA 3IP5A 5FJIA 2WAXA 1MQAA 4UUBA 4B2LA 5IN4A 2ZBFA 1H2WA 1GPH1 1PSDA 1SQFA 2ONKA 3W8NA 3CRMA 1F0NA 4AKHA 2C7RA 3L6OO 2A30A 3O0TA 3B3QA 1CJKC 3L0OA 1XRQA 1QZ3A 2H5JA 1C81A 2WD7B 3DE7X 2ABWA 3F4BA 3Q9UA 2DKFA 4KOAA 4LJKA 4UBNA 3QEOA 3VSCA 3A1CA 1XP5A 5LQDA 1W36C 5M3BA 4HFMA 1LLFA 1GNLA 3QUAA 5H3LA 2JLXA 1E96A 5HZBA 1DIOB 2DQ4A 4YONB 3HJBA 4DR1B 2CV2A 2QTGA 5CH8A 4X6XA 2TS1A 2QD4A 1E0AA 4XFKA 4QUGA 3F6CA 3K4QA 1JEOA 1KY5A 4GWGA 1RMTA 4OPOA 2VDQB 4LOKA 4JHXA 2GZ3A 5ALKA 4DNPA 3RUIA 1JR4A 2WKPA 3NJRA 1HEYA 2QAGA 4Y0NA 4DJDC 2QQFA 3IV6A 3D0KA 3QV2A 3FRJA 1UBCA 1Y1KE 1ZGAA 3IA2A 3OCWA 1CY1A 4FDLA 2GAIA 4QEZA 3LNNA 3D2LA 4B3RB 5DW0A 3IMKA 4HIZA 1TUGA 5EFOA 1UCFA 3DHVA 2AMJA 3BMXA 1R0KA 3LQ4A 3WRXA 721PA 3ZTTA 1QCZA 1XQ1A 3MUEA 4FDAA 1SXIA 4AY6A 1U2TA 4KV7A 4XR9A 4RVHA 1Z08A 2IUYA 1ZC3A 1QHHA 4LV6A 4ZAYA 3RSOA 4AX4A 4DCMA 2JLBA 3ESQA 3C8ZA 5GJCA 4EEKA 2V7UA 3TLBA 4G6ZA 1NXXA 4YEDA 2Q1XA 1NN5A 2C9DA 1M10A 2XXBA 5KDLA 1XJWA 4XWKA 3GIDA 3RSSA 1KO7A 3JATB 4WKOA 3SU8A 4CMEC 2HPAA 3MQ2A 4WZAE 5G41A 4HUTA 2QN7A 1W0KA 1S3SA 3BFXA 3DS8A 3KUCA 3KOYA 3CZ4A 3W7VA 1YNSA 2RJNA 1FDIA 4TXNA 2OCXA 1VLHA 1ISFA 3WRVA 2WAOA 3DVAA 4FEAA 3RRXA 1NVDA 2C4HA 3S5UA 2VYVD 2OFXA 2GKGA 3E9DA 4GBED 1SKAA 4ZGQB 4C0AC 2OCYC 2NNLD 2JI8A 5SICE 1BA2A 3AETA 1K08A 2B4KA 4ICIA 4OL0A 2ZI6A 4JT8A 1I32A 4TMFA 3OQBA 3UAGA 1ZR4A 4XIYA 5C18A 2D1FA 2HREA 2VPYA 3KUDA 1DX6A 4TV9F 5KYTA 1II9A 3DLHA 5TGDA 2VHXA 4K6FA 4OYHA 2WAMA 1QH0A 5JDCA 1EM8A 4G0QA 3PQCA 4NCJA 2P91A 4O4IF 5FNVB 4EVQA 2NYAA 1WUHS 1QU2A 1T43A 4MKIA 3X44A 4YDRA 3IOBA 3NEPX 4GPAA 3N3BC 4HEA6 1VQ5B 2ZWIA 2NO5A 1RWXA 3L7OA 4ZHQF 5CR9A 5C3MA 3EZXA 2P11A 2GEFA 2H7CA 2R6ZA 2Q7OE 2EW8A 1HI9A 1PNVA 1YZQA 1DUVG 4NU8X 1PGPA 2BMAA 1VGQA 1Z47A 3V8BA 4E5MA 4KIGA 4TS3A 3D59A 4L0MA 4RORA 3EQ6A 1QPGA 3H5OA 4IWNA 4N3CA 2IBTA 4DVGA 4WDRA 2E18A 4JR2A 2QENA 1H2ZA 3LJKA 4JJEA 4FR2A 3WADA 5C46F 4DQLA 2W8ZA 4YT4A 4OTZA 5FR1A 1MZVA 3TNLA 2V1UA 5JVDA 3ERCA 1QANA 1RWWA 2F4NA 2PSJA 1EVJA 2IYZA 2O2DA 3A3OA 3CESA 1L5MA 3IT0A 3VZPA 3HXMA 1PR6A 1NUAA 1U4OA 1HOXA 3L0BA 4AX8A 2BGUA 3WNCA 2MR5A 4BP3A 3O90A 2H5EA 4AF6A 2VDNB 4UBLA 4M6WB 4IDFA 1XAGA 1U94A 2G6TA 2VDUE 3UCFA 2FMHA 1QH1A 3JXEA 5HEKA 3MTBA 4R8KA 1NZDA 1J2RA 2QXUA 4C6TB 2FCAA 1NMEA 2ZOSA 1DOHA 4BLVA 1ILEA 1RKBA 1YCFA 3ITEA 3HDJA 4OBXA 3WK9A 5IPFA 5JATA 4Q9NA 4HGNA 3C14C 3H8VA 4GKKB 1TGYA 1J2UA 4R8LA 3SE7A 1VKOA 4DL9A 2H2HA 5CXSA 1D4AA 1NW4A 4TYQA 3L18A 3FG9A 3FPHA 4QTUB 4EHJA 3I9JA 3RIXA 1DCTA 2WU0A 2XDYA 1IJKA 2XE4A 3LNTA 2PAFA 3V9PA 1P74A 1NPYA 3N8DA 4JP1A 4UQOA 4I3GA 1L4BA 4V03A 3TXYA 3SC2B 1WBDA 3CUKA 1QOPB 4G56A 5DNUA 2FPIB 1AQUA 2CXXA 2WBLC 3O2SB 3HVRA 3KXLA 3LAWA 3A04A 2DIEA 5FYDA 4RD3A 2YZ2A 1FYVA 4UPEA 1IZZA 1F60A 1RFGE 5EXSA 2C4WA 3F2VA 2R8BA 2WG1A 4MWZA 2VPTA 1YKGA 2WTAA 1COZA 4ESVA 2WM9B 3M0EA 3SHTA 3DHWC 1UPXA 5FBLB 3BJMA 2YKGA 4BNVA 2ZIXA 4YLEA 4ZIRB 2QVYX 4CL0A 2NV4A 3COWA 4K81B 1BDBA 2AEFA 1LRJA 2QTWB 3LWZA 3EIHA 2PUGA 4DABA 2R60A 2UXCB 4KXXA 2JCGA 3SYMA 1DC6A 3EQ7A 2QUJA 2FOXA 4IX1A 4UUAA 1EXNA 1JHXA 4NMXB 4A8JC 4LMPA 4LJRA 3NHYA 1PAUA 2QS9A 5BMVF 1FNCA 1CY4A 2VJQA 2J07A 5G02A 2C98A 3ZDEA 3OPNA 4KLZA 3DGFC 5SYAA 4BBAA 1O6GA 4J1SA 3K92A 1UBLS 3UHOA 2BC9A 2W2PA 3IE2A 3V1LA 3SXPA 3TD2A 3TTYA 2JHAA 2XW6A 4DT1B 1FY2A 1NZJA 1ZVMA 5LBTA 1ZRNA 2FFAA 3RQSA 1NU8A 3UM9A 2OXEA 1IM8A 2YW9A 4G07A 1VCIA 2XTJA 4N40A 4NCIA 1QGUA 2EYQA 3CO5A 3L0SA 1LDEA 3CP2A 2P1ZA 3EZGA 5CH3A 4M0LA 4YGXB 2DFNA 4PZDA 1P9RA 1RMYA 5FHQA 3R74A 1WEHA 3N0RA 4DYHA 1SXJE 3Q8MA 2Q0XA 3FXAA 1WNTA 1V7PC 3K05A 2VKQA 4G8CA 3ZCPA 4QOGA 3KVOA 2IDJA 4PYRA 1ZHHA 5AW8A 3ZGZA 3HEMA 2GEUA 3D8TA 1LRKA 1BMQA 1OZFA 2CL6X 2YHAA 1CZRA 2H2AA 2CLEB 3VNUA 4DUZB 3ZGVA 2NPOA 4I19A 2JW5A 3UOGA 3PGA1 1YUMA 1C1HA 1Z5OA 3C3EA 1ZNXA 3OMWA 5JJCA 2VTDA 2GCGA 1G0OA 4NNPA 1X0VA 1YH3A 2D8MA 3DTTA 4HCJA 2JDIA 3UAZA 5AM3A 5I47A 3V7AA 1ECPA 1JWAB 5JD6A 4DR7B 2XA1A 3TE7A 5HKAA 1DG3A 1N2CA 1WS6A 2FZWA 2QVGA 1T9HA 2I6UA 4IQ4A 4IIBA 4P3OA 5E1MA 5L3SB 5J2UB 2JN9A 2PXAA 4DDTA 5AT1A 1WG8A 3AHIA 3RYHA 3U0BA 4BS9A 1GDDA 2A94A 2FQYA 3QQ5A 1ONBA 3FMOB 4MQEA 3I2JA 2W4QA 4ZVLA 2L18A 5J3JA 5MN5A 1QE3A 3ZX5A 4BNWA 1L9XA 3L8FA 2ZPUA 3L8MA 3LBFA 1N2EA 2QRHA 3UQYS 2M98A 4GKJB 1RT9A 2DFTA 2NW6A 3ANXA 3NYQA 3E0XA 1EWYA 3HVIA 5E6SA 5BUCA 5IC5A 5ILGA 3QLTA 1PHRA 4J29A 1FJ2A 2QLMA 3OESA 5DTEA 2ZRFA 2FA9A 1E8MA 2RGEA 1U3DA 2BKAA 3LBHA 3LZCA 4FZ3A 4I50F 3EBPA 4TL6A 3VR5H 3QWIA 4B7ZA 1UFQA 4U2BA 2AEEA 3N2YA 3FF4A 2ZZGA 4J0EA 2FHPA 3TW8B 3WB2A 2XODA 1OJ7A 1YI1A 2QX6A 2GJ4A 4H59A 4IIFA 5TEWA 2FKNA 4MK4A 5BUSA 2AG5A 2OWEA 4EFKA 1T6YA 3LHKA 3DWIA 4BFLA 4DMGA 2O3RA 5EGSA 3KQWA 3HGMA 4QUDA 2EIHA 4PAMA 4CW7A 3C4VA 3OJ0A 1LBTA 3TUZC 4X1IB 5CGQB 1KNQA 2G17A 3CX3A 4B6FA 2R85A 2BH2A 4ZMSA 1JLKA 3KSZO 4NBVA 3PWSA 1JEQB 3SMQA 2J7PA 3OMLA 4QU8A 1Q17A 2OYCA 4BY9E 3IT3A 2VJIA 2GFQA 4AN1A 3SSOA 1NE7A 5A4MS 2AK3A 2JFZA 5E2AA 5EUBA 5JZSA 2HC9A 2BFPA 1GPWB 2PSEA 4LSZA 2FG6C 1C0EA 4GL2A 3LSYA 2VDWB 3M1AA 4H4CA 5B7PA 2H2FA 4IDNA 3PTAA 2HLDA 3D6VA 3EPRA 4ZAGA 1ODJA 1PLLA 3ORSA 1M1YA 2V65A 3UMGA 1CQZA 3WGGA 3R76A 1XPRA 4JKIA 4PZEA 1UAGA 1VCHA 5EJ6A 5KVVA 4HH1A 2O07A 3G2QA 4B4WA 1EJBA 3S70A 4QSHA 3K9GA 1NC1A 3VR4D 3AG6A 2CJWA 1XB2A 2F67A 1O58A 2HLHA 4QGHA 4Z0TA 1MJFA 5C1BA 1TA9A 4KWHA 4H4EA 3DZKA 5HM6A 4NY1A 4H1TA 5CP8A 4C0HA 1UJBA 3KZMA 1OXBB 2BW0A 4I1PA 4RHYA 1MHTA 3GG9A 3JWIA 5EYPA 1Z9BA 4X6UA 2IOFA 2WPDD 2RGNC 1Q83A 2R6FA 4S3MA 1OD6A 1UWLA 5T8KC 2HLDD 2J3EA 4MUEA 3MYRA 4CUZA 421PA 4XVUA 5HKOA 1PGOA 1EVIA 3VDXA 1AKMA 2DSTA 1DEHA 3IO3A 1GR0A 3C15C 4L4UA 4ZAWA 3RK1A 1P7VA 4B4VA 3K6KA 1QRUA 1ONPA 3AY3A 4UHKA 1MQSA 2VWHA 1BO6A 2R3SA 4Q24A 4R16A 1II8A 4NZPA 2PJZA 3KAQA 3TFOA 3OFSA 4TV9A 1AMUA 4NTZA 5AVTA 3GRAA 3FF1A 1C3VA 2JFNA 4RHXA 2QA5A 2FCRA 2IYYA 5IF9A 4XM1A 1G3MA 1WSAA 4GPTA 3WWOA 2H1SA 2JFUA 1WMEA 4IHKA 2VNIA 1KJIA 2QRUA 3KDSE 2XGOA 2ZPAA 3LUKA 3R41A 4IDDA 2QUKA 1CR4A 4IGEA 5GOTA 1W29A 3SJBA 4N7BA 4XPZA 1CUFA 1N8RD 1MDFA 3EVEA 2NO6A 2O4UX 1OXTA 2JHCA 2VEDA 3TWOA 5KNCD 3BEOA 1EVYA 3EWAA 1F6WA 1KY2A 4JQOA 4MW1A 4BU0A 5ES4B 3ICPA 5JI3E 3ZCUA 3UUWA 4DT1A 5AW3A 2OB1A 4NEGA 4OI4A 3C87A 3N6RA 5LWHA 3OQPA 1XSEA 3BBPA 4IGKA 4C07A 4JASB 4R8SA 4V38A 1B8VA 3AVQA 3PHBE 1C30A 1SA0A 2C5LA 2YC4C 4RDLA 1IQRA 2PZMA 3B6IA 3VYSB 4JUDX 4KPUB 2YYSA 4LK2A 4JI3B 4AY5A 5DK4A 3VAAA 2I8LA 1FX0B 4C88A 3PEVA 1GNTA 1E3QA 3EZYA 3D4PA 3NBYC 3DMYA 1KHHA 1E92A 2B5WA 3L6CA 2W2OA 3U1VA 2HBZA 4ENUA 1XJQA 4DQKA 1A9ZA 4H35A 1WOYA 4QHSA 4TWJA 2UV8A 3A26A 1O94D 1UEIA 1DIBA 3T5TA 3CPWB 5BR1A 2E5WA 3PGXA 3CVOA 4OFWA 5I7AA 4PSUA 5ALGA 4DCNA 2X9LA 1JUDA 5F76A 5EVJA 4LBZA 4G37A 2BYTA 4QFDA 3O7WA 3KZOA 4LHYA 4QULA 3I9KA 5EP2A 3U7QB 4O2BF 3EXAA 1M7HA 3OKFA 2HHCA 4KN8A 3FIJA 1VJSA 1PQYA 4X0CA 5I3ZA 3ADKA 2BF4A 3F9IA 3K96A 3UJ7A 2ZKIA 5L3RA 1LFAA 3QUBA 4XIFA 2HA6A 3JR3A 2VF4X 4J0QA 5LZ4A 3T1QA 1ZHFA 1I30A 1KR5A 1VL2A