1W35A

Ferredoxin-nadp+ reductase (mutation: y 303 w)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
molecule tags Oxidoreductase
source organism Anabaena pcc7119
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w35A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w35A02
3AVTA 4M4SA 1FDRA 2HDNB 5FA6A 5JBQA 4LBVA 4K1XA 1ZM2A 4Y9RA 5HXBA 2QEXB 3AVXA 3FPKA 4G1VA 3W2HA 2X3UA 1BX1A 4B47A 1QGZA 3AGQA 4YAFA 3U6KA 1E64A 3W5HA 3QFTA 1FNBA 4LBZA 4TMXA 3OW2B 4HE6A 4ZGQB 1TVCA 3I55B 1EFTA 3CCUB 1YHQB 1IJEA 3ZZ0A 3QFSA 4EH1A 3ES9A 1AIPA 2D74A 1Q7YD 4Y9UA 5KSWB 1EWYA 2HMAA 2DCUA 3I1FA 4R71A 4YAWA 1K73D 1M1KD 1OB5A 1VQMB 3CRZA 1NJID 4AF7A 1KJZA 1GJRA 3VNUA 4LBWA 1GR1A 4B43A 1E63A 2YWGA 1CQXA 3P26A 3QFCA 1DDIA 3CMEB 1W2BB 1S0UA 1QFZA 2VNKA 4M53A 4TN1A 4TMVA 1OGJA 3U2QA 1VQ7B 1KRHA 1NDHA 2FX3A 2GPJA 1QFJA 1QH0A 1UMKA 4RD4A 1VQOB 1G7RA 2CNDA 1VQ8B 2VNJA 3CCJB 3ZZUA 4B4DA 1QGAA 3W2FA 3OZVA 3G4SB 4PGOA 2B5OA 3CCSB 1R5NA 1VQLB 4H9GA 3ZBUA 1AMOA 1QVFB 2PIAA 3WBKA 4AC9A 1QGYA 1A8PA 3JQRA 1EP2B 1N0VC 2R6HA 4C43A 1VQ4B 3B78A 4TMWA 2EFGA 4RJLA 3G6EB 3E1YE 1WDTA 5AN9A 4WQMA 1N0UA 1ZM9A 1GO2A 5DSZA 1VQ6B 3SJZA 4YHBA 2DY1A 2RC6A 2GQFA 2J7KA 2YWHA 2BF4A 2VZLA 1E62A 2BPOA 3W5VA 2BGJA 1YITB 2VYQA 2QA4B 2PMDA 3WNCA 3E20A 4C0SA 4YAOA 1IJFA 1VQKB 5GV8A 1Q86D 1BX0A 3P27A 1OGIA 2B7BA 3U6BA 1N8RD 4FWTA 3W5UA 1YI2B 1QVGB 4ZV4A 2QTZA 2BVNA 1G7TA 3VNVA 1DARA 1CNFA 3QFRA 1F60A 4TMZA 1KK1A 4LC0A 5EMNA 4UAJA 1IB0A 3V76A 4MYUA 2DETA 1G7CA 4YAUA 1H42A 4U9UA 4RCYA 1W35A 2OK7A 4G5GA 1YJWB 3WY9A 4AF6A 3CC7B 4RD6A 3VMFA 1CNEA 2XNJA 4ZCIA 3OZWA 3VO1A 1VQPB 3CCLB 4ACAA 1YIJB 1B23P 4B3XA 5TV2A 3CW2A 5GV7A 3CC4B 3CCRB 3OJXA 1GVHA 5H59A 1VQNB 4P6VF 1JB9A 1Q81D 4TMTA 2NPFA 2BM1A 3QE2A 3W2GA 3WBJA 1KTVA 5TY0A 1FRNA 4RCZA 1K9MD 3JQQA 4RD0A 1JA0A 4DQKA 2VNHA 2C77A 1QX4A 1W87A 4B44A 1H85A 2E1RA 3CXCB 2QDXA 2YWEA 4G1BA 1DDGA 1JNYA 2QN6A 4QFMA 2BSAA 2C78A 1Q82D 4PC3A 1HA3A 4PC1A 1KK0A 3CCMB 4FK8A 1XE1A 4PC6A 1J9ZA 1XB2A 1FNMA 3AGPA 1G7SA 3B82A 1FRQA 1K8AD 4Q7JB 1D1NA 4YALA 1SKQA 3LRXA 1U2RA 2DEUA 5TR9A 2AHOA 3WXMA 1KK2A 3CMAB 1QUEA 2EIXA 3CCVB 1D2EA 3CCQB 3CCEB 4QHYA 2CRVA 3CPWB 3MCAA 2HCJB 4PC2A 4N3NA 3B8HA 1R5OA 1DG1G 1M90D 4BPRA 1ELOA 1FNDA 4RD1A 3OJWA 1GAWA 3ZZTA 4HE5A 2B7CA 1GAQA 3LYUA 1EP1B 3LVBA 4M1KA 2QTLA 4FN5A 2OTLB 1BJKA 1YJNB 2BM0A 3AVUA 3AVWA 3MMPA 2OK8A 5THXA 1KQSB 1EP3B 1ZUNB 3FJOA 3A1FA 3PENA 3WNDA 3AVYA 3JQPA 1B2RA 1R5BA 2VNIA 3I56B 1EFCA 1JJ2B 1QG0A 1SM4A 3VO2A 4ACBA 3LO8A 3AVVA 2BN4A 4PC7A 1VQ5B 1JA1A 2PLFA 3ZBTA 3MHPA 3J81k 4M2LA 1VQ9B 3OZUA 1EFUA 4MYTA 1D8TA 1YJ9B 3CD6B 1EXMA 1ZM4A 4ZCMA 1KC8D 4NBSA 4ZCLA 2DERA 3WYAA 1ZM3A 1KK3A 4B48A 1I7PA 4Y7CA 1F20A 3W2EA 1TTTA 3CB4A 3ZC3A 1TLLA 1BQEA 1OB2A 2YWFA 4LBYA 1S72B 4NCNA 2XNCA 1QFYA 4RD2A 1W34A 3QSYA 4DQLA 3G71B 2RC5A 4M0LA 2OTJB 4N3GA 3CC2B 1KD1D 1QUFA 2XEXA 1TUIA 2QMUA 2ZITA 4F7DA 4ZGNB 4P3YA 2BV3A 2BGIA 4IW3B 2BMWA 1FNCA 3WNBA 3W2IA 4RD3A 5H5JA 4J0QA
chains in the Genus database with same CATH superfamily
1SD2A 2CBGA 3LVFO 4M4SA 2JI9A 4IQ4A 1T0PA 2J6BA 2XECA 4UJ5A 4XVQA 4ZO8A 1E1MA 1IHUA 4XCQA 1PWYE 5L7TA 2R48A 3I2IA 3DNFA 4R7ZA 3JALB 2H1HA 3MUEA 3CO0S 1TZKA 2LV8A 4I9FA 5J5CA 3ZJ4A 4DMFA 3FSJX 3JQDA 4BXOB 2DR0A 2H0RA 4Y2HA 5ICGA 2VDUE 1WF6A 1TTHA 3B51X 1IMJA 3AVXA 4R2JA 4R2MA 4I55B 4IPTA 2PE5A 4WJKB 5K0FA 2BEVA 1POXA 3O1JC 1NPDA 4Q00A 3PQFA 4RSMA 3BY2A 4AY3A 4BGUA 1QAOA 3VKUA 4NDNE 3LYHA 5JSQA 2HJSA 2JC3A 5C3UA 4B71A 2XMRA 2WAOA 3R3UA 4KJXA 2LDXA 5K0ZA 2H6EA 1V8BA 1XZDA 2FN8A 3A8TA 1BPLA 4OHWA 4ARBA 1USGA 2QQEA 1X94A 4OI2A 1YV9A 1FDWA 2XYGA 2VWPA 3VA7A 5T8KA 3PX3A 4E2ZA 5DX1A 1G8JA 2N0SA 2HMVA 3FH0A 2DH6A 3K8OE 4IH4A 3ZD6A 4XQ9A 3SZOA 3LKZA 1ESCA 2PN1A 1K5GA 1HSZA 1ZAYA 4OXNA 2FLKA 3DXYA 1MBZA 1YU9A 4DA8A 1J2EA 4HR7A 4DKXA 2IDJA 1D6JA 1E9RA 4R9VA 4V2UA 3GLGB 3RVPA 2HRRA 5ICEA 1UJ2A 4JENA 2X3FA 1LJ8A 1ISJA 3VOBA 2Q5QA 4ND5A 4ZVKA 3WWZA 1X1SA 3GPBA 2EFCB 4S1TA 1L5QA 4RU1A 3S68A 1FW6A 1R66A 3OIDA 2DTEA 3HSYA 1OYOA 2D74A 1W2HA 7ADHA 4WI1A 1M2OB 3G2IA 5EJIA 4D9HA 4FCTA 5B4VA 3T3OA 4FB4A 1EJ0A 3T5BA 2VJAA 1O6FA 4FI3C 2Q5CA 3Q40A 3UO8B 1XNHA 2RHBA 4AF7A 2WLSA 1PRYA 3KPVA 1WDLA 3HSSA 1GXSB 1V7QA 1YD7A 1GJRA 3PFBA 2AEFA 3LL7A 2AWOA 4ITVA 4Y6LA 3V2UA 4NNJA 3BWEA 4R2LA 2R8PA 1VKZA 3AJDA 1QF9A 4AJLA 2HSJA 2DT8A 3ZHCA 3EUAA 1YS4A 2GHQA 3S7TA 2JLUA 3BSYA 4KO8A 1OUMA 1VL5A 2J3EA 2P2YA 1C7JA 121PA 1P1CA 2WSMA 3GHYA 4KWEA 4WXHA 5B37A 1UPUA 3LLVA 4KVZA 5BNWA 3KJEA 2O57A 5HILA 5HYVA 4MO2A 4OB8A 2AS0A 4KZPA 4RPGA 4QOGA 3GH1A 3EE6A 3MWLA 1QYXA 3FPFA 4UD2A 2C4UA 3AXSA 5DBIA 5B1IA 4DC9A 3U7GA 4TYWA 1M73E 4KN8A 4JD5A 3BIXA 4JEIA 1NKVA 1JAXA 2QIOA 1OLXB 3WIVA 4QVKA 1T3SA 3ANMA 4GUAA 1VHQA 1X80B 3K4HA 4LRXA 4NARA 4QAJA 2BFOA 4H0CA 3VH3A 1P29A 3GV0A 4R1PA 4WXRA 3U5TA 4KVFA 1TKCA 6ADHA 2WMOB 4JLVA 2IYXA 3OPMA 1LVHA 3LZDA 4G9BA 2QI9C 3WLSA 5BWNA 4PLCA 2VH1A 4M0MA 1BE8A 5DK4A 3CVJA 4H4EA 5FEMA 4XOUA 3U56A 2CWWA 3CA8A 3THWA 1Z37A 2ECPA 2E4WA 3EFOA 3GFSA 4G3XA 4NJOA 4HXEB 3REQA 3OZVA 4BDTA 1YUMA 4DZRA 3Q7EA 1P74A 3QFFA 4BO0A 1XCOA 1YQTA 1U0GA 1ZESA 3EXHC 5KHAA 3VC2A 5EL0A 2H2GA 1PV2A 1HSOA 4TKUA 4WOCA 4B6QA 1GAJA 1ADYA 1RWNA 1XDWA 2OEPA 3DMNA 1R00A 5WRFA 4ZI5A 5SY9A 1OX6A 3RGGA 3RARA 2GOYA 2G88A 1WNTA 1MRZA 4F8YA 1MENA 2OM2A 1GCAA 2ZWPA 3QLTA 4HDSA 4L73A 4RLHA 1F7UA 4AO8A 2PX0A 4NH0A 1XMOB 3FLAA 4DRXB 5K2OA 3K0CA 1DTEA 1Q7GA 1ZLXA 2HRCA 3CR3C 3NHWA 4JFRA 1UPXA 4RTQA 4Q9HA 5CDTA 4FHCA 5KOHB 2QE7D 3LTNC 1GPWB 1O94A 5KNCD 3JQ9A 1NB0A 2V55B 1X0VA 5MHTA 1CZKA 5A3JA 2H9AA 3WICA 4LPKA 5G3YA 1JAIA 1U1FA 5JHGB 3P9XA 4BTEA 2O5EA 1WOPA 3P2KA 3H99A 5DCYA 3QXHA 1DWPA 2CJYA 1CDZA 1VIDA 5JAOA 1A9SA 1L4GA 4JMLA 3STYA 1CUSA 3DOFA 5EHZA 1R6UA 2R8RA 4CZ2A 2XMBA 5BY2A 2WFMA 2NACA 3CLHA 4QNNA 2C54A 2Q0HA 4G81A 1VYHA 3CF2A 3O4GA 1UZMA 1UP7A 1XTRA 2E6UX 4Y1RA 1OFIA 5GZ1A 5KX5F 3FKQA 2XUFA 4JUIA 1KEVA 5EP3A 3B36A 2NVWA 3WYGA 1JZSA 3ABZA 3FPBA 4UTNA 1YDWA 1P1IA 1X77A 5DI3B 2AK3A 3ZWOA 1XJ0A 4M8NE 4OL9A 4XVCA 1LKZA 3A1NA 4EATA 1YITB 3KHUA 3QXCA 4HLCA 4PGHA 4D92A 4YUAA 2PMDA 2PTHA 1T1JA 3DAPA 4N7BA 4MH0R 2XWSA 1R3DA 3LQFA 1W85A 1YDFA 2V7QD 4I08A 4FONA 3E20A 1IN7A 4Y2VA 1MOZA 1B16A 3A3GA 3VYSB 2PYZA 3W5DA 5GV8A 3AXTA 1FU4A 3FUVA 3HXQA 1PQUA 4D4IA 4JV5B 1Q17A 2VP0A 1OGIA 1R0BA 1RPNA 2VQDA 1N8RD 4MS1A 1O8BA 4FVTA 3DDSA 4N18A 4E3WA 5J3JA 1G7TA 2BEWA 4NYMQ 3OQOA 2XTAA 2DHEA 2XAAA 2O2DA 5LQUA 3KZ1E 3QEBZ 3CE9A 2DWCA 2C4MA 3N8KA 4ZT4A 1W29A 1S8FA 3V76A 2V4DA 1K2WA 2UYYA 4IH9A 5CURA 3BDVA 3IAS6 4FBGA 5A5GA 3WB1A 4HRAA 3L7NA 4LY0A 2QV7A 2P9QA 4X0EA 4H0FA 1CP2A 4TTRA 4Z51A 3VR3A 1H5QA 5LXTF 5L51A 3WHKA 4MS1B 2JAPA 1G6KA 3QVSA 1L4HA 2OSBA 3G7UA 2GT1A 5A03A 3PUWA 3JZIA 2WE7A 1MF7A 3EBOA 4HTAA 4O4LB 5B1SA 3ZCVA 3BHMA 4RD6A 3MRVA 2PZGA 2Q2QA 4MQLA 4ZQFA 5ALSA 3NC0C 3L5OA 1G21B 1UZAA 1H9CA 4WBSA 3CCLB 4WZAE 4DC1A 5KO2A 2A3RA 3I9V1 1OZAA 2FEPA 2ZULA 2ENUA 4J0HA 3C1TA 4XIFA 2P0YA 1KQPA 4YJ2B 4YUXA 3FX2A 4N5LA 2QV0A 1VZ2A 2XR1A 1Z5GA 4HYQA 3RH0A 3ZE1B 3SZ3A 3RNOA 2BM1A 3KEOA 4TKUB 4X8HA 2ZXFA 4LHWA 5DNCA 2F9LA 4HEJA 1IHOA 1JSZA 5F77A 2Q6IA 2YMLA 2QX8A 3MJEA 1R2QA 1RLIA 1I7SB 1RQGA 3QNUA 4WINA 1RZRA 1VBKA 1M6VB 2WA1A 2CYBA 1T9AA 1W9MA 4V0LA 4BQSA 1CHNA 3GFGA 1HDXA 1GNPA 4X71A 5KC8A 2XUPA 3R5TA 1SIWA 4KMRA 3VTFA 4BZPA 4C0JA 1I80A 2JD0A 5K9ZA 3KFXA 2XGMA 4MQ5A 5HE8A 3OUUA 3LCJA 3V1UA 2DOGA 1M0TA 2I6UA 3P9QA 5K3CA 4AKSA 4DHWA 5KHLB 4CPDA 5IMBA 2GN1A 3ELYA 1P9RA 1FMFA 1M5TA 1WUJS 2OB1A 2A0UA 1HZJA 5JSUA 5JYDA 1WDKA 4PW0A 4RMIA 2EWWA 2DUMA 5A6SA 2HWYA 2AC7A 3D6VA 4GLJA 1MC5A 2GAAA 3I05A 3F9CA 4WADA 4C76A 4CT5A 1J0EA 2YY7A 1PFVA 4RA9B 2J3JA 3UPUA 1YASA 5CR9A 1OAAA 1IAVA 5B1YA 3G0IA 1P7VA 4U8GA 4A2CA 2BZ1A 4BNDA 5C0OE 1VBMA 4X66B 3LLSA 2BRUC 3L6RA 4BCBA 2Y99A 2AN5A 4YLEA 4RC9A 2H1IA 2W6OA 3A9SA 3I9KA 3L05A 4ZC8A 4X61A 3INRA 1EZ1A 4J91A 3ZQ4A 2HL6A 3UAVA 5AHWA 4WZLA 1XKLA 4MA4A 5DN6D 1DO8A 4IIEA 3QIVA 3CH4B 2VL7A 1SU8A 2NSJA 4B8ZA 1RC1A 4V0MA 2AIRA 1A5AB 3QKSA 3ZOKA 4II2A 2EZ4A 3IVRA 5ALTA 1XL0A 2W70A 1TQ8A 2XQIA 4N5NA 3FCEA 4KH0A 4NNPA 3ZHOA 2WJGA 4RTKA 2OYNA 2D7JA 2VIIA 4MUFA 5A9SA 3JQEA 3DH0A 1Z12A 2V5UA 4NMHA 1ZK3A 2R6CA 4D3DA 1GUZA 2CRVA 1YI1A 1Y3HA 3DAYA 2OLKA 3RKRA 3ETGA 4ZZIA 1YFKA 3FNBA 3VR6A 2X6WA 3TZLA 2WJVA 4KH1A 3GRKA 2QTAA 4P3IA 3OPOA 2WTEA 4E5SA 1MW8X 2PZ8A 5A3QA 1RAEA 3KWJA 3NBMA 4L5JA 2GBIA 4LE1A 4X8LA 5EZQA 3OLZA 1NHWA 1GPUA 2H4YA 3G7SA 3NT2A 2JGNA 2O0LA 4DA7A 4G24A 4I1PA 4RK7A 2VCYA 1XSEA 3P9ZA 4S1PA 2C31A 3T1QA 4HAOA 5IRCD 4NCAA 3JQ9C 4GKBA 2BMFA 1JIIA 3QWFA 1WCXA 4FYPA 2IF0A 3LYUA 1RFGE 2ZZGA 1LC0A 4DFDA 4PCAA 1E1KA 1CR6A 1B00A 2RGDA 1XCBA 1RPJA 3RVMA 2D9RA 4WACA 2Q3FA 3FSGA 2C4NA 3KLPX 4W5HA 4XTCS 2IQIA 3P94A 2WPNA 2IH2A 1OU0A 2HMSA 4PYRA 1I7LA 4UHKA 1T3GA 2FPRA 1SKYB 2HGSA 5JCPA 1OV4A 2JDIA 1OASA 2OK8A 1AUPA 1Q7RA 1SVKA 1YIAA 4ZVSA 3UQZA 4MIYA 3WVNA 3PENA 3Q5DA 2PVPA 1VG0B 4JLSA 4KN5A 3BQJA 1M8FA 4LMAA 5BMOA 3FY4A 1EESA 4UE3S 5JV5A 2BR3A 2ROQA 1ZJYA 1E66A 4WBXC 4DWOA 2ISQA 1QAQA 2OY0A 3C4JA 3EXHB 4OHVA 3IILA 5ES4B 5L8VA 1E2MA 2VHWA 3HDJA 4UE6A 4MQBA 4QSHA 3RD5A 2BKLA 4EJ6A 2XUDA 4MWBA 4WXYB 4MI1A 2WD8A 1WE2A 5KTSA 3T1NA 3FYCA 4JLPA 5CLJA 5B1DA 1UAAA 2PLFA 1HDYA 3ZBTA 1UINA 3FLMA 5KTNA 4LG1A 2I29A 3ILYA 3UHPA 1SZJG 2RGGA 4EG5A 5AESA 1JFSA 2X8JA 1J8QA 1K7EB 1Q2XA 2F59A 3E8SA 5BUSA 5JH7A 1J5EB 3UH1A 4DW8A 4FZJA 1V1RB 1ZH4A 4F6LA 3E53A 3QEKA 2H4XA 4D9FA 2Z1MA 1H8ED 4P0TA 3LX6A 4XWAA 5C37A 3DOEA 2SBTA 4Q39A 4FCCA 2INGX 4PZUA 4RPJA 2FOLA 1IL0A 3AW9A 4YV2A 2AMYA 3PEFA 1H69A 4LOIA 5L3RA 5IJ0B 4GOLD 4D0NA 2WYHA 2CD7A 4FYMA 3UAZA 4B48A 2X0JA 5I8PA 4OIFA 4FD2A 1HDEA 1K8ZB 1DEKA 4DG8A 3H1PA 1R18A 1ENPA 2WZNA 2FA9A 4U7FA 5EHGA 2Q1WA 4DV2B 2JH9A 2DIEA 2ZI3A 4P31A 2AXNA 2WJWA 3LYAA 1FP6A 4WGGA 5IKPA 1YA6A 1G8KA 2IQ5A 1G5FA 2C1ZA 3M6WA 5G41A 2YFYA 4G37A 4D9KA 3R6DA 3VNRA 2O2HA 3P5SA 5BV1A 1C30B 1ZEJA 2G1UA 4LDPA 4G1UC 4Q1FA 5AW1A 2F3QA 4ER7A 1QV7A 2NPIA 2XITA 1FJXA 3GW8A 5ALDA 3BCDA 2CEAA 2WSSA 2X40A 2J5XA 3Q3GE 4AYTA 2YYAA 1E5XA 2V7BA 1UOOA 3O83A 4LSWA 2WPDA 3UMRA 3IE2A 2NYAA 5EYPB 1JG4A 3PKIA 1JXOA 4GRDA 5E7QA 1KEUA 4NMXB 4LFBB 3VSAA 1FFYA 3HKBA 4RD2A 1UADA 1NQUA 4S0ZA 2FDCA 1JDBB 3DL7A 3O0DA 1TW2A 1U1GA 2TMYA 4I8IA 5EFOA 5FPYA 3WMXA 1Y33E 1E1QD 3HJNA 1H4VB 1M1YA 2X15A 2DFPA 4W6QA 4EYEA 4KRFA 2VG8A 3KIPA 4YUWA 2O8BA 4KIUA 2VYVD 2ZQZA 1XX6A 2GI4A 3YASA 4DDWA 5D1HA 4ZRDA 1TC2A 3GEPA 2WZDA 3O8QB 4HUQB 3GJ6A 3Q39A 3BFVA 1DT3A 4QDJA 2H5EA 5LMNB 2IXEA 1CUUA 3I30X 5DNUA 1KZGB 1R88A 1PG2A 4H6WA 4ZOQI 1FRFS 4IXDA 1CUDA 3D6UA 3OFVA 3IULA 4NC9A 3RWBA 5BNZA 5ERXA 3MHTA 3IT1A 3QNMA 2P91A 3QKRA 3KU1A 4O3MA 4JNCA 1GTJ1 3G05A 5A9TA 5LNK6 1V71A 1ONPA 1GQRA 1VL2A 1XQ6A 2HXSA 3RTCA 4L8JA 4GQBA 2WNIA 3K6SA 1HNNA 4I14A 2EJBA 3F5QA 2AH5A 2BF7A 3H9CA 1D6NA 2FE1A 4RD3A 4FMDB 4MMYB 4X84A 2ZB8A 5EIHA 3KM0A 5LYJA 3LK7A 4N6OA 2H7VA 5B2ZA 2QZZA 2C00A 1M1XB 3OKXA 2PMFA 3TLCA 3UHFA 4CG1A 1UBHS 2FUNB 5M7EA 2F1IA 2P6OA 3BRWA 1N9GA 3K0BA 2ZE8A 4KGVA 2OV1A 1PFKA 1VMEA 4G67A 5CHEA 1KP2A 1E96A 2EW1A 1IRIA 2GQ0A 4H0NA 1KI9A 1L5KA 5CTAA 3EY4A 5DXAA 5JCZA 1SCUA 3RSFA 2HPVA 4MDFA 4D4HA 2QLMA 2VSFA 3TNYA 1ZGJA 3AMVA 1HTWA 2YNMD 5TQ0B 2YJ3A 1N5LA 3TOZA 3TFOA 2I91A 1W5EA 5KC9A 3OT1A 3ABSB 3L7JA 3PR3A 1JXMA 1P4MA 1TIPA 5ICSA 3U7QB 4JC0A 1E6MA 3EODA 4KI0A 3VHXB 5LMCA 3ASUA 2EAUA 2YN0A 2PZMA 1QGDA 2PBFA 1V35A 2AMLA 5IP5A 1FFEA 2F1MA 4PYOA 2G1JA 4DARA 1Z0FA 2GD0A 2P2GA 3TQIA 1TE2A 3SPXA 2ONKA 3TI9A 1CUEA 1K9SA 2JJQA 2JJYA 2OBLA 1OVMA 3EOBI 4PHFA 4Q18A 4A4DA 2QZ4A 2XYPA 1JE0A 3FVTA 4DEXA 3IPAA 4M9SA 1A2OA 4FNOA 4P7GA 4W63A 1GAXA 5AKHA 5EPEA 4L72A 1EFTA 2Q3DA 1A96A 2E3JA 3AEQA 3QUSA 1E3LA 3GLHA 3QY9A 2GK6A 1PJCA 2IZ0A 1ATIA 4O1IA 4RBNA 3ZZ0A 3QTTA 4HLQB 4KQXA 4Q3DA 4ER0A 5KREA 4XOIA 5J2TF 3VTKA 3DV9A 1KFEB 3GUHA 3OPNA 3OPYB 2A7QA 2VN8A 2WT9A 3H42B 3OIGA 4EQ6A 5A1TA 3C43A 2CKDA 4ZHQB 3NHKA 1NVVR 1U9CA 3AIOA 2AOVA 3C5CA 3MCVA 3T34A 3PNQA 721PA 3TQQA 1IG3A 1Y7LA 1VMKA 1Z07A 2CFRA 4P4SA 3THYA 1GL9B 4RHFA 2M9MA 2OG1A 3K6JA 2XXAA 2L0XA 1X19A 3SR0A 4CKBA 4B2YA 1LDBA 3LP5A 5CVCA 2P6MA 2QD1A 2EJCA 3BJZA 1SKYE 1VHLA 2FG5A 1ZOLA 2YJ5A 4JLNA 1NFQA 2FP4A 1O97D 1XEXB 2W4IA 4BQIA 4YAEA 1QOPB 2GEFA 3ZU4A 3RHFA 4EF5A 5LYJF 4TQ9A 1M3SA 4Z4SA 4ER6A 3ZDDA 2DPGA 4FE4A 3KL9A 1ORRA 2VNKA 1C9EA 4EP1A 3HXLA 1DZIA 4FHDA 4K6KA 3AT1A 1AY0A 3DAGA 2MIIA 2PO7A 4WW0A 2N3ZA 4TN1A 2OXEA 2YN4A 2WUDA 2OBTA 1HOXA 4RDHA 5FUQA 4NXNB 1GGJA 2C8LA 4I5IA 1DRKA 3DEZA 4E3ZA 4B17A 3LC0A 3V9PA 3LS2A 2VT3A 1EZ4A 3LQYA 4MCIA 5KYXB 1K5HA 5BUQA 3LIIA 2DHQA 5FR2A 4ARSA 5G1PA 3ZV6A 1AQNA 4TXHA 2B0JA 1IE3A 1M6HA 1K68A 2QJOA 2VUHB 3LLMA 3B1ZA 2CNDA 2Y71A 4MWOA 5HPYB 2PDAA 1I3MA 1WCIB 1U3GA 3PXGA 3I73A 2EQAA 3O84A 4GOMD 4JGBA 4JXJA 3SIXA 3V9AA 4UXJA 1T5LA 4DLLA 2JJ8A 3M8KA 5HIIA 4EIWA 3DMGA 4US1R 3OIYA 1ODKA 1RU3A 3C5VA 4G5QA 4Y98A 4G36A 2FEKA 1DINA 3A27A 3CRW1 4KPYA 3VKFA 4AMZA 4Q3NA 2W6IA 1QVFB 2HU8A 1JG6A 4L3WA 1M1YB 3U1VA 1V96A 3ZY3A 1Z35A 2CL7X 4JSTA 4EFKA 1BDHA 4CN9A 1OC4A 3ZYZA 2ZVPX 4DVGA 3WGLA 2XODA 4YYZA 3BSWA 1FS6A 1NVDA 1SA0A 2OHXA 3OEEA 2O9JA 1JG7A 3I01A 3NUZA 3R7DA 5C1BA 4F21A 3H97A 1G5HA 2WKRA 3P2YA 5CB8A 1L3BA 4MQEA 4TLBA 5BN1A 1V45E 3H1EA 3B5JA 4Y6PA 4GIBA 3SK0A 3PQEA 1UJBA 2ZRBA 1AUOA 1RI2A 3BQMB 4B75A 2CZGA 2FPUA 1KPGA 3TNDA 4LCJA 2Y1KA 1NYQA 3A3PA 4IL5A 3O2QB 4PG7A 3AY0A 4O0LA 3SSNA 1DXOA 3UJ8A 3JTMA 1G3QA 2NT3A 4OSPA 4EGCB 1F17A 5BXQC 1P2FA 3EGEA 4BNFA 2VEDA 3AIMA 4EG3A 5DLYA 1TA4A 5JAUA 3A1WA 4AURA 4DSOA 4HFNA 4HZIA 1BKYA 1JR3E 1NOIA 1U0NA 2XDQB 5BOVA 3TSYA 5BMVF 2FMTA 1E9EA 2J4FA 1L4EA 3FTPA 2VHVA 4MEAA 1PJTA 3K30A 1BCRB 4YBRA 3Q8LA 3N5KA 4KFCA 3PFIA 4DG5A 2B3TA 2REBA 4PLTA 4TTVA 2LD4A 1ORIA 4MV1A 1U7XA 4XOTA 1VA4A 1H66A 2WIAA 4YDSA 1UDXA 4Z0HO 1X7WA 3GMDA 4QDTA 3ZQJA 2P4SA 2BDEA 2YV4A 1OI4A 4AUEA 5KVVA 1TM2A 4M54A 2W7TA 3K5WA 2J9FB 1P2VA 2ZBQA 4FNAA 5DGDA 5DH9A 1U4OA 4WOBA 2EARA 2BT4A 3DXZA 4ZZ1A 3GD5A 1LLDA 5BSMA 2ZM6B 2VXBA 5LU9A 1F48A 5G0SA 3FFXA 1EG2A 1AB6A 1Q7TA 5C1OA 4CF4A 4EKIA 3FXAA 3VX3A 1HQDA 3CCCA 1U81A 1KERA 3GBPA 1JHAA 2GBPA 3P2MA 4BFYA 2JCYA 2PXXA 3QGMA 4DR2B 3DT9A 2VK2A 2PZEA 2ZSBA 3O94A 3D3EA 4DG9A 4DUZB 2JJ1D 2DWUA 3NT4A 2ZU6A 1ULUA 1O0SA 2XKAA 2CDNA 4QGSA 5F5XA 5EPOA 3AEUA 2Q7XA 3FNEA 3MQ4A 3RREA 3OPYI 2OXIA 3RLFA 1KFKB 1W5FA 4V2IA 4X05A 4X7BA 3V34A 4D3XA 3V8VA 1H6AA 2RMKA 1T43A 3CC7B 4XVRA 1NRWA 2BTQB 5T57A 1QVVA 1XMSA 2XNJA 1NY5A 2H4FA 1W36D 3SJPA 1ZC4A 2C99A 2I22A 4QQRA 3ZV4A 3VMMA 3GP3A 1V16B 3NHZA 3BB4A 5KTMA 4BFZA 3UWMA 1KVUA 5HX7A 3U3RA 1XTJA 1H5UA 1R64A 1XMPA 2JZCA 2PWPA 3F6PA 3H16A 3L8EA 3LNTA 3HB0A 3PICA 4DNOA 1A1VA 1IN1A 2TRSB 3X2FA 5B36A 1XRJA 3HUTA 4XM2A 5CGZA 3W2GA 3KKEA 2A1IA 5CXSA 3RK4A 3O73A 3KXDA 1NAHA 1Q1NA 2ATIA 3S99A 2R1UA 4K6HA 4JAVC 1BX3A 1H22A 2W6ID 2RB5A 5AW5A 1RYMA 3L79A 2PQ0A 2C77A 1XA0A 4GFDA 2BGWA 4DR3B 1I7DA 3UOAB 2OHOA 2F8TA 1SVUA 4KYIB 3OCXA 2I7VA 1T24A 3ULKA 1LPSA 4CCYB 1ZJWA 3A9CA 3Q9SA 1QYWA 3PBKA 2NADA 3QSGA 4OHMA 1PJAA 2ODBA 1MH1A 1TCUA 3I6BA 5CH5A 1NX9A 3TB6A 3N2EA 2EL7A 2NUPA 5ALFA 4H4DA 5EKUA 2B2NA 2ZYIA 1UBKS 4BV3A 4U2CA 5B57C 1XTPA 3AKCA 1P9OA 3G8YA 1FNNA 1KK0A 5KNDA 1YSCA 1T0HB 1Z6QA 5HHTA 1XDSA 2ADFA 4P08A 1Z39A 3NEAA 4PAMA 5AR1A 1NASA 3OC0A 3SIRA 5KJCA 4KR3A 4U5QA 4K0KB 1WDMA 3D1JA 3DBRA 1CQJB 3LUFA 4L15A 2GYYA 4FKBA 2OWEA 3AFOA 3OLVA 4MQFA 3R5JA 2E1PA 4KFSA 1W88B 3EXAA 4CUJA 1VL8A 2NZXA 2FH5B 2HRQA 4DMRA 3PUNA 2O52A 3FUCA 2TSYB 4JLWA 1R9MA 3Q9UA 3SGLA 3PNBA 3OTHA 3UT6A 2NU9A 2A1UB 5KSPA 5ALLA 4CCYA 1CLUA 3TRFA 4DLKA 1OR8A 3ZWCA 4MR8B 3R3SA 1WEHA 2FPGA 4OK5A 5T3YA 2GM9A 1A5ZA 3SNKA 1E1CB 3RIGA 4JQOA 1OT3A 1NW6A 3WXMA 1FVXA 4QYIA 2PGIA 1RZRD 4IIUA 1AF4A 4YJ3A 2WQ6A 1Q11A 3VDQA 5K45A 4PZCA 5INTA 4XR6A 2BHTA 2VBTA 2PL1A 4YO7A 1A95A 2Z58A 4WY2A 4D3FA 4Z0PA 2JLVA 3LUDA 2A0WA 3ID6C 4LXQA 4BN4A 1VSUA 5JZBA 4LCBA 2NXWA 4G0ZA 1Z6TA 2B98A 4PQYA 3B8HA 1LDYA 1ADCA 1W88A 2WT4A 2ZTMA 3ANTA 3R5XA 4XB2A 3THYB 3DFFA 2H5LA 4MI6A 3LCUA 5EJGA 3P9PA 1GGVA 5TMEA 3IGFA 3IEPA 1FNDA 4YRPA 1JAYA 4C3UA 1HF3A 1IMOA 1KMCA 3TI7A 1JFFA 5C3MA 3AYXB 3LUAA 2HWKA 4KDRA 4JITA 2AJ8A 4Q6BA 5KOJB 4DCVA 2X4LA 4CEIA 2ZJ1A 4WFKA 4F97A 1O9GA 2HTFA 4G4SP 2FSPA 2AV6A 3F97A 4M9XA 2O5CA 1LPPA 1YBHA 1KKLA 4QUAA 2WYVA 1UQTA 3ED1A 3UWSA 2JN9A 3FHLA 3OAAA 1VECA 1M75A 1OWNA 2NTJA 2UDPA 3KDSE 4E70A 2BW0A 2Q5IA 1D04A 1SK8A 2QYOA 2AG1A 2Z4RA 4G8BA 1A2BA 3B1YA 4EY3A 1F4LA 1HYBA 3OFKA 5IULC 4EUHA 2W22A 3UXHA 4DA4A 3M5PA 3WBFA 1W0KD 1EWRA 1NLFA 4DIUA 3COJA 5AVJA 4L16A 4U8HA 4LSMA 1EDEA 1U0LA 2PKQP 4NZNA 4NCHA 4A8JA 4DIKA 2Q50A 4D3SA 2AI2A 1JJ2B 2BKAA 2V0CA 1UBCA 2OCXA 2OAP1 4OP2A 5TQ0A 2PRIA 2PT9A 5AXCA 1M1YE 3U3DA 5JJIA 1R15A 1E92A 4N41A 2C2HA 3BX1A 3PGJA 4MR9A 4YJDA 4EW6A 4PC7A 13PKA 2IUFA 4H3VA 4HDKB 3ROPA 3ZU5A 4DNQA 2OXCA 1ZX1A 2NX2A 4M22A 1K9VF 1PUXA 3PNYA 4O4IA 5CEJA 3JQGB 2GPAA 3MCWA 4EDHA 1N3IA 2JI6A 5AVKA 5DHPA 2XW6A 2I1WA 3F6YA 1FFGA 1CY4A 3WQSB 2VBSA 3LFHA 4I9GA 4QFBA 3F6CA 1HE8B 5HUHA 2IYNA 4FDLA 2KYRA 3ZHRA 1P4RA 2DF8A 4UNNA 5DHAA 2C4WA 2O0MA 2W71A 2R7MA 2ABWA 2Z1DA 3IMKA 3QPDA 5CK5A 5U4QA 3TRDA 4DV5B 1N6IA 3SQXA 1K5PA 4PRYA 2O3QA 1BZYA 3E2PA 3AI3A 4XKWA 1NY6A 3FA2A 2I6GA 1ZM3A 3EEOA 3M6AA 5B6PA 3KYBA 1RC8A 1RJEA 4PVDA 1EQUA 3LH5A 1SJ9A 5EE1A 1SOUA 2J9YB 3D02A 4C0LA 3O7MA 2CBXA 4DCPA 3B38A 1Z08A 3FPLA 3H7IA 2GXSA 3FWHA 3PC7A 3W2EA 2VHEA 4MJLA 3VPCA 1YS2X 1I4OA 1DEOA 3EXFB 1R74A 1FYEA 1LI5A 1NQ5A 2X0IA 1MFPA 2R6JA 3L8ZA 3LPDA 3OTIA 5GMOA 5TPWA 4CM8B 3QKSB 2V65A 1BC5A 4UFNA 1EFKA 4CQLA 5CT6A 2R79A 5HOEA 4KP7A 1U99A 3PXDA 4GX2A 4B7XA 5B2EA 3I9JA 1KVRA 1LRJA 2WUVA 2AJBA 1QG4A 3NIGB 3QPBA 4ZVUA 1A4IA 4HDAA 4F9TA 3H75A 2O7SA 3WK7A 2CNLA 2GEBA 1Y8QA 6REQA 2JHAA 2NO6A 3UUEA 2R8YA 4M0LA 2ZSAA 1VHTA 3AY6A 2X0DA 2X2PA 3R75A 2RB4A 3Q15C 4AN0A 4L0DA 4QRIA 1BDMA 5BORA 3RFVA 3KETA 1S6YA 2X0KA 2ID7A 1E69A 5FLEX 2OKCA 4IUBS 5GOZA 3CJQA 1J20A 1VKHA 4X6YA 5CCDA 4EECA 1RPTA 2OGZA 4U2DA 5DNAA 1TO1E 4BUZA 5BNTA 4BBZA 4ZI2A 3DLAA 2A59A 1JIJA 1NXXA 4LCEA 2QPLA 3V1LA 1JLLA 1KS2A 1TZ2A 1W6RA 3HJUA 3KKLA 5EKXA 1QMGA 4NDAA 4TVKA 1E3ZA 4DILA 3B2EA 3B1XA 4OHYA 5J3OA 2FEMA 1ISPA 1YACA 2PVSA 4G0QA 1T3ZA 3JD0A 4H35A 3FYUA 3QWIA 3S2YA 3RW9A 3IIIA 4KBFA 1D03A 2AN1A 3L0ZA 1YI8A 2BMWA 1IK6A 1JDJA 1DJPA 1SB9A 2W00A 3CGGA 3PR2B 5CLLA 5GWXA 3R6JA 4JIGA 4EGJA 5AKJA 4OGLA 4HTFA 4BNZA 3F3MA 5JJKA 3QF4B 4ZALA 4HMQA 1MG0A 2BFAA 2J9GA 3BB3A 1WABA 3GJXC 2FHSA 1M2WA 3FOCA 4JUFA 1U8EA 3KL4A 1G3MA 4O5OA 3AVTA 1DRWA 2KBFA 3GIDA 4ZYYA 4FSXA 4Y6QA 5FPKA 1NQTA 1ECFA 1GQSA 2XNSA 3K0CC 4P33A 4CV3A 4Q01A 3V7FA 1CJTC 5ABPA 5EE5B 1A9PA 4UZUA 1WQ1R 5TPWB 1I2BA 1U1IA 5HXBA 4QXQA 3R77A 1K75A 4WERA 4AK9A 2HWUA 5IZ4A 1EKXA 1T8RA 3KRTA 3OSZA 4YVFA 2CVZA 3VAYA 3FWYA 3JS5A 1R1DA 4M1WA 4A8JC 2ZTNA 5BPHA 2YHAA 5KVCA 4LJSA 3M1YA 3WDMA 3W2HA 1MPTA 3KQYA 2YV5A 1LSJA 1GTVA 3PNLA 2V3VA 2ORVA 4KLRA 4QU5A 4Y8VA 3USES 1NJ5A 3WI7A 2CF4A 1J2JA 5FL3A 1BMFA 3S2EA 2P41A 3K4PA 2XT9A 3QW2A 3U6KA 1G98A 4BKRA 1ZIOA 2Q8QA 4OGGA 5KYKA 4L4SA 1JHVA 4NFLA 4II7A 1O6GA 2X8LA 2MYUA 3UAYA 1CD5A 1J2YA 2GWRA 3AR4A 1N6OA 1JEJA 3Q0IA 2PKCA 4R1LA 4EYSA 5LXTA 3UICA 2Z2KA 2PMEA 3RG2A 5TARA 1XVLA 2YL2A 1JU3A 4EITA 3PI6A 1BFUA 3IAUA 3JQGA 4OQFA 3FHCB 2NAFA 2XLBA 5I4CA 5IU6A 1MQ8B 2Q21A 1RQPA 3B3JA 4RDKA 3RJZA 5K0SA 1BVRA 2C8KA 2DTXA 2PXCA 5IHPA 2I71A 3IPCA 2GN4A 5JATA 4L4XA 2IHBA 5BURA 3ZCSA 4EVRA 7AT1A 2ZL7A 3O21A 1PZFA 3U0VA 2R4TA 4OATA 1KYZA 1XEXA 3C24A 2YWXA 5KNLA 3FPAA 1XZQA 2GEKA 3UKJA 4Z6KA 4DUGA 4HDNB 1R4NB 2HDWA 4NICA 3UJ7A 3WLPA 1NIJA 1RWQA 2RH4A 3I1FA 3QLVC 1IIRA 2OQRA 1W8DA 4H3SA 4ZJPA 2B2XA 1NMXA 4D0LB 4PONA 5CVTA 3BGWA 1WPCA 4ZTUB 5D85A 1AXGA 2QY9A 3AZQA 3PK0A 3Q8WA 5I9BA 3VPDA 3THSA 4AUNA 4DJAA 1G4HA 4R3UC 3UF0A 4ZN6A 3IEVA 5JEDA 2II6A 5IYWA 1S7CA 1BTOA 2HYDA 2FWAA 3R4VA 4M0UA 4Y9DA 2QRVA 5JS8A 2XEDA 3RAGA 1QU3A 4F2DA 1OSNA 2HA2A 1ZVMA 2WAXA 2IDZA 3AO0B 4RV4A 3KJHA 1OXUA 3L9WA 1KJ8A 5HBGA 2ZBFA 2ZR0A 4L9RA 2G9RA 1VRWA 3E1GA 2OPHA 1G2PA 4LKOA 3H18A 3GJ5A 1XRNA 1RS0A 2AOUB 3RLIA 1VQ7B 2QQGA 4CL3A 3KOOA 2PR2A 3SU8A 5JFOA 3ZG6A 4YRBA 1E2FA 2RHOA 3FVQA 3GA5A 4ZU3A 3GLQA 3R23A 4HRXA 4HHEA 2WZPP 4LYDA 3MLEA 4V3BA 3RG8A 4YEDA 4QRDA 1NTOA 3RAJA 4AZTA 5C7OO 1K3TA 1SHKA 4ENPA 3UHJA 1XXLA 1XMJA 2BUBA 3F96A 2BGUA 1H2HA 3KJNA 3SHVA 3G02A 3OEHA 3IVGA 3PTLA 5IYZF 1UIRA 3SFTA 3W1VA 4TZ6A 1NSTA 2VTVA 3ADOA 2V0GA 4PGOA 4PNHA 1BDIA 4YP7A 1XZEA 5JZVA 4OB6A 2OTCA 2JGDB 3PUVA 4JYCA 5HOQA 3HCNA 2VRCA 3UFXA 3OBIA 2WVJA 1DHTA 3ZBUA 2VK4A 1DMSA 3UK7A 2FMIA 1I6LA 1IM2A 2FPWA 1K5DA 2HEIA 2W43A 2IU3A 4FJ1A 2KX7A 4N9QA 4PCVA 4CU5A 4NDZA 2DXIA 3G82C 1YBVA 4AQYB 3D6AA 3GZJA 2DPYA 4N9WA 3PJDA 4ZCPA 2JFGA 2ZUVA 3FPPA 3GLSA 2VUTA 3C6MA 1JEYB 3EY9A 3NBZC 2YNMA 2PX8A 3Q6IA 3WB0A 5KYUB 1P5FA 1OTXA 1Z2NX 2VBIA 2OYCA 5ALGA 4W5OA 2FZKA 4DBLE 4K3VA 2A57A 4KPUA 3D43A 2WE8A 4TMWA 3IIJA 5KMGB 1FUIA 4UZEA 1RKQA 3G1TA 4QIHA 3ZDQA 3QBJA 2NU7A 3P0RA 2J46A 3WZMA 5DBEX 2PHZA 3AR8A 1B0PA 3CLUC 1MV5A 5LLTA 4D4LA 4CF5A 5EIBC 4GS5A 1R7RA 2F00A 4AXBA 3V00A 2HT6A 2PSEA 5LKAA 1WUIS 4ZA2A 3OCZA 2C92A 2Y1OA 5NULA 3BB1A 1OT5A 1EBUA 4BKOA 1QYDA 3BK2A 4EW3A 5DXFA 2ZJOA 3WGVA 3DVSX 2AJCA 2Y67A 1PDWA 3EZXA 2BPOA 4C4ZA 3PG5A 4Z7QB 2QLFA 1SMKA 2NXNA 3ILSA 3JQFC 3V32A 1YS9A 3GNSA 1JDZA 4WAUA 4PYLA 4EA7A 3HVHA 5A4IS 1AZWA 5FBVB 1N5OX 5H4GA 3SBDA 4ND8A 2CXTA 5FOXA 1JEQA 5B3AA 2VTBA 4FQ7A 1V39A 4QU9A 5CBPA 3LY8A 4F3TA 4S1WA 1TOAA 2QGZA 3LDFA 4LSZA 4YPOA 1PLKA 2JRLA 3KQWA 1IJBA 2JLAA 1N4DA 2RONA 4IV5A 4RFLA 5FA5A 3W34A 4C0WA 4DAEA 5ELXA 1E1QA 1VM6A 2HUPA 2XBLA 5HJEA 1N34B 2GO1A 3EIXA 4CM1A 4HAIA 1Q1EA 1YI2B 4PZLA 4ZV4A 2A4KA 1G42A 3PT5A 4W5JA 1OROA 4JKYA 3DXXA 1V0JA 4HB4A 2I9KA 3ZBPA 2NUAA 1UP4A 1QE0A 2F3UA 3PF8A 4CMEA 3P9IA 1L1QA 1LEHA 1MOQA 1FDVA 2IEGA 2P2NA 3NBQA 3P9RA 4JU9A 4PZ0A 4CM5A 4FGLA 3RSOA 4IQ8A 2V4ZA 3TX6A 1MA3A 3BH7A 2AMVA 1GQOA 4IX9A 3BCFA 3A0UA 4JI1B 4RCYA 1GQFA 3K0FA 1U63A 5JPIA 5LA6A 5CA1A 5I4IA 1JLHA 2DP4E 1ZJ5A 4QYMA 5JH7B 5LP1A 3VMFA 1BE6A 5D3KA 5GIOE 3SVZA 4UNIA 2IKQA 2VZEA 3GEBA 3OZWA 1CTQA 2G08A 1SCAA 3NI2A 5FFMA 2A84A 2H2AA 1Q0HA 1GT6A 2EEPA 2ZYSA 4LSGA 3SYKA 2PLAA 4EI2A 1I3NA 1KAMA 1OZ0A 3G6WA 1CF4A 4U2FA 2XXBA 1H8EA 1WQ3A 2RCNA 1Y42X 4F6RA 3UXMA 1LNZA 1O03A 4E6PA 4AX4A 5IXSA 2IP2A 1N2XA 1NDQA 3GRCA 1F2TA 2IY8A 1EI9A 3QE2A 2UUAB 4CU2A 3HCOA 3BY1A 3QE0A 1CIVA 2ODTX 3TW8A 1WSVA 1FRNA 2IRWA 3L0CA 3CRQA 3PIRA 4NULA 5FTMA 2RE8A 4Q21A 4PLHA 5JAZA 3ZEIA 3NKLA 4MQMA 2AOTB 3QU5A 4B44A 4BNNA 2EL9A 3BL6A 1GPMA 3QBEA 4QODA 3ZGVA 3SIWA 1SXHA 4D42A 4RADA 1T36A 4EELA 1P5JA 3S4YA 2QDXA 1DQYA 2CWDA 1Z6YA 5FWXB 1V5VA 3VHRA 4OYLA 1NUTA 2HSGA 3OTOB 5C1PA 4E31A 4QFMA 2IXBA 1TQHA 3O26A 4KTVE 3TAXA 1CJBA 1ZNXA 1BW9B 1DIHA 2DJ5A 2ZIEA 3PPXA 4X93A 2Y68A 5BW6B 4DB2A 2VS1A 1H6CA 3DEHA 2WJYA 2YWRA 4DCMA 4AROA 2IZ1A 1WOSA 1MGPA 1EMDA 3ONWA 4IVPA 1SBIA 4ZQBA 4IRMA 4EA8A 5FUVA 2X9NA 4BEVA 4A2QA 3P9NA 3KV3O 1XE1A 3QG1A 2DQZA 1BHJA 2ZUCA 4PF1A 1XB2A 3RPEA 4LFAB 4KRXA 3QEAZ 3T0IA 3GLFA 3LK6A 2VDJA 3THWB 4P0QB 3RU9A 2VCHA 3PNSA 1HZZC 4MUGA 3BD8A 2Q2NA 5BW8A 1T6ZA 1MABB 1Z5OA 2BKVA 2M5SA 1TCCA 4CHGA 4F96A 3FIUA 1NYTA 1DJNA 5LZ7A 2YFHA 4NS4A 5CFOA 2RHTA 4BQPA 5H1YA 1AN0A 4OM7A 2XMSA 5IKEA 1IATA 3H65A 4ASUD 4X1KA 2Q27A 4C6HA 4CMIA 2O2GA 4DADA 3OZFA 3PX2A 1LX7A 2RK6A 4RHXA 2Z8XA 5CA1F 1ZCFA 4ZOCA 5HA5A 1CSEE 2BLNA 4O59O 1W2GA 4RHCA 2VJMA 1EGHA 2R5FA 1GY8A 3IPXA 4OQPA 3SQDA 5C51B 1VKJA 1BDJA 5F4BA 1X7XA 2ZI4A 2B1QA 2HO5A 3OQVA 4JLMA 2ZTSA 4CCAA 1N3BA 5JI2E 3WB9A 1VE6A 2AF4C 3OETA 4F9EA 2ZS8A 1S5PA 2NQ2C 4D46A 1M8JA 2XYRA 4FFLA 1KQOA 4ZVTA 2XUJA 1N7JA 1T8YA 2GFIA 1JPUA 3DMTA 1BQ4A 2Q0SA 1KI3A 2P2DA 3IUMA 6Q21A 3G1WA 2QAGA 2RGRA 1PR9A 1Y7PA 2I7DA 1QONA 3LHSA 5HQ3B 1FQWA 3W5AA 3PHHA 1E3EA 3VHXA 5EQTA 1HDOA 4ZAXA 1T1EA 3N6RA 4W8HA 4NEGA 1N2SA 5TGZA 2OO5C 4PSKA 1XYGA 2IYVA 1EFAA 4D56A 4PGGA 4HE5A 1DG3A 1O94C 1OZHA 1RWOA 2R8BA 4H18A 2GK7A 1GAQA 4DXDA 3VU0A 1V8DA 3MJHA 5LD2B 3ACCA 1IXKA 1FUUA 2ZRAA 3AIKA 4ZPXA 4M1KA 1F6WA 2ANCA 2FF7A 3IA7A 1ONSA 1ES9A 1YB7A 5FUYA 1HETA 2QTLA 2BBOA 4FN5A 2OTLB 5KW9A 1KZ9A 3PT9A 1HRDA 1D5CA 4JY7A 4QPZA 3ZWWA 4AZWA 2O1EA 1IZZA 3ORYA 4UHHA 2ZYHA 2DR3A 3W4IA 5KOHA 1XR3A 3AVWA 3D4OA 3MMPA 3AM5A 3G5AA 3I9MA 3IMGA 5THXA 3G17A 3FJOA 4H7DA 2AJDA 1U8AA 1XWWA 2ISCA 3V6LA 5B1EA 2HU5A 5EJ4A 1IVNA 2NXEA 5EG5A 3RK1A 4IEEA 3JAWA 1JQ5A 5FT9A 1NU6A 5JO9A 1D4OA 1JIVA 1W6UA 1XE3A 5FI3A 4AY6A 1T5EA 1ZUWA 5ALQA 1QG0A 4ZO6A 1UBEA 3I0ZA 2QMHA 4MW7A 3RADC 3DLTA 5I7WA 4ES6A 4S24A 5CTJA 1ZL0A 2OR3A 2XNDD 3QA9A 3LXUX 3SHFA 2ZVDA 3F9RA 1XZAA 2PRKA 3JD3A 4QBGB 3ZWYA 3GLHB 1X1BA 4TTTS 1WMDA 2Y9PB 1Z2CA 5DTJA 2F62A 4FFBA 3IOMA 4NBVA 1W5AA 1VHOA 3O7WA 3TS1A 2O1XA 4Z4FA 1WV1A 1NE7A 3PGA1 2AK2A 1KBZA 2WTMA 5ESXA 2NO5A 3MPUA 1PJQA 2H48A 3W9UA 3QEJA 4W5QA 1QORA 4R3NA 3HJTA 3WMGA 4ZCLA 2FEXA 3IOCA 3AI1A 3L43A 4P4NA 1WA5A 4B46A 2FPIA 1GV1A 1POWA 2BELA 1OWPA 4CLEA 1KK3A 5DWDA 1N2CA 1KDVA 4YMHA 2V6BA 1RIIA 1K86A 4AW9A 3WLAA 5G0UA 1U80A 1LBHA 1I01A 1XCJA 3S8EA 4BMPB 1UKVY 4LF7B 5AW7A 1EGQA 3VU1A 2VNSA 2X9GA 2W2KA 3KT8A 3VBEA 2W0SA 4LDNA 4M8IA 4C6TA 2EKZA 4LJAA 3K1JA 3SDZA 3IODA 1O4VA 2O5RA 2P78A 3FFTA 3TLYA 1CUZA 4C5AA 1JSCA 1N05A 1X9GA 3U4GA 2HA6A 3PFCA 4E51A 4ZHSA 1CDOA 3H4TA 4YAKA 2OHGA 1G5RA 4KKXB 3KQSA 2QZPA 3G49A 3UUGA 1J1IA 4X1YA 2PGLA 3W79A 1NXWA 1P80A 2PV7A 3U1TA 4C2UA 2XE4A 1Y4ZA 3RS7A 5C35A 1YFLA 2BFCA 4R5HA 5C5DA 3RYFB 1DXYA 4Q12A 5BSVA 1YWGO 3SY8A 2VHTA 2RC5A 2G8LA 2REQB 1TQ6A 2WRZA 3B3QA 2V31A 1T9HA 3GAAA 3TFQA 1N57A 3KQLA 3MGGA 1H8HA 5MN6A 5JC1A 4E22A 4F93B 2I4IA 5A89A 2IE8A 2JHFA 1GIAA 1TUBA 4NTZA 3RBXA 4CCSA 4PV7A 3EVBA 2CMKA 4EFDA 5HJ7A 1OB0A 1C9NA 3SYNA 1RP7A 5IYQA 1NGSA 3D2CA 3BIFA 3GK3A 5C1IA 2DFTA 4CM6A 2JCBA 4C0HA 4JI8B 4DMUB 1GTL1 1SKBA 2IU6A 4IZ6A 2FV8A 2XSZA 3AUFA 3UB2A 1CYEA 2QMUA 1NIPA 3VSCA 1I7NA 5KKCA 4TTSA 4XZ3A 4ZGNB 2NUTA 2ZQ5A 2GPBA 3DM5A 4LXGA 1JQEA 4Q7LA 4RFSB 4X85A 1O57A 3H04A 1M2NA 4HPXB 5JEEA 5LLDA 2H29A 1RAIA 4I2VA 4OBXA 3Q87B 4XJTA 4EB6A 2GM4A 5ENVA 4EY7A 1G8SA 2Q4TA 2Z56A 1FFAA 2HLDA 1L6RA 1VCMA 2LKDA 4D80A 3BJRA 2QLTA 3HBJA 4YH1A 1R4MB 4XN0A 4GH5A 2EFDB 3GP8A 5F52A 1TKBA 1WMEA 2R66A 4RA6A 2IOFK 1CS0A 5ER9A 2BH9A 2A9QA 1L5FA 4UUMA 2A58A 3CF6R 4R9RA 2ARKA 3DDNA 2AB0A 2JFWA 2XGOA 3ZDBA 2FETA 3N2LA 4GNRA 2JNWA 2VAXA 5F76A 4ZOBA 2PUCA 1C3EA 2B1GA 2N47A 4ZZ0A 5FA6A 3MFQA 5CGQB 2BEUA 1V1RA 2BWJA 4TQGA 1H0SA 1K97A 4IFTA 1E4EB 5G2OA 2VP9A 2JFUA 4IDFA 3WYEA 5ES3A 1WG8A 4IZOA 3Q2IA 3G9TA 4QREA 5BN4B 3FPKA 2DKOA 3EZGA 3HO8A 1UBMS 2K87A 3IL2A 3UIEA 1GPBA 1P7PA 3LA8A 4FCWA 2GCOA 4IGFA 1NV8A 2D3WA 4A82A 3JAWB 3EWSA 3VGJA 5JXJA 1BX1A 3OZDA 1K7YA 3KWMA 3OE5A 4GPTA 5A5FA 2X1HA 4C3VA 1EFRD 4YAFA 2I2CA 5ALZA 4EY4A 3I04A 4NBNA 4LGVA 4ZJZA 3L4BA 5EINA 3DMRA 4ZT2A 5K8LA 2R1ZA 1V25A 1WAMA 2ZJAA 1YR6A 4L02A 5ALRA 4M1SA 3S28A 4NHOA 1OD6A 1GGEA 2V7PA 3LKDA 4OOVA 1Z7EA 1G3RA 5MN5A 5C5IA 2R7LA 2W6QA 1HDCA 2HU7A 3QV2A 4HMOA 4O5AA 1KI6A 5L40A 1BH2A 5M04A 1FBNA 1SGWA 2I2BA 1RBMA 1XTIA 2A33A 2FSUA 3IDZA 4C05A 4YMTA 2HMTA 4BO3A 2IPNA 1B8PA 1J2UA 1K92A 3JD1A 2Z5VA 4AF8A 1OPRA 1Z83A 1N2IA 2FAXA 1RM0A 4U6SA 4Q47A 4OBBA 3WYFA 3ZJYA 2X19A 3IS3A 1ZMOA 1YIDA 4Q1AA 2B4AA 4FGUA 5JDCA 2BYTA 2IHZA 1Y1RA 2OBYA 2Y2VA 2A7XA 2NV2B 1WM1A 4FTWA 3KSDO 2IS1A 2P3MA 3UOWA 2B92A 1I6KA 1VIMA 3L0SA 1VJRA 2ZRMA 4IKEA 4UW9A 3A1SA 1NT4A 4UC0A 4ETNA 2A1TS 2CHGA 3GFRA 4AN1A 2OORA 2LP4Y 3KU4A 3Q7TA 4N6GA 1PTJC 3H83A 2GTIA 4TL9A 1ZOIA 5E6SA 3SX4A 1KY2A 3INGA 4ZT3A 1BS9A 2QIPA 4CIYA 4GPD1 4CMEC 1S7GA 3U44B 3GBSA 4LZAA 1PL0A 3PJFA 2HFKA 2YZKA 2BBTA 1WZNA 2HIHA 3T7IA 2CXPA 1QIFA 1Z6PA 4ZCQA 3U3ZA 1R0RE 3KQPA 3WDLA 2OGSA 3DPSA 3IO5A 4R40A 1XQVA 1IEXA 1JLLB 2Z6BD 2O7NA 1DJOA 4HS9A 1B1CA 1GFSA 3H5NA 4NH4A 4QNMA 1YJXA 2WFZA 1E5LA 3SLKA 4J76A 2PUAA 3GLTA 1DC3A 4G0PA 4CV0A 5EIEA 4TMVA 3MAAC 5M29A 1XIVA 3VO9A 1SURA 5JFGA 4A2WA 2PZJA 3DE2X 3H9GA 3TPCA 3LUBA 1OKKA 2XUAA 3HYNA 1KRHA 1NDHA 1Z25A 1PHPA 2GSDA 3O1LA 4P86A 9ABPA 4INJA 3CX3A 5GAJA 3WHLA 3DTVA 1O6BA 4W5NA 4Z0NA 3ETHA 4W8GA 5IN4A 3ET4A 3FM9A 4B8YA 5ITVA 4MYSA 3CCJB 4B4DA 3DZBA 4HGQA 5E1OA 4AKGA 5DW3A 2NXCA 4TRNA 3T94A 4F1WA 2J48A 4QPCA 4ZVLA 1SB8A 2F1OA 1C0KA 1N3LA 2Y1XA 2DFLA 3IT3A 5HIMA 2XIQA 1G8HA 3IDOA 1I1NA 2C5LA 4JR1A 1MO2A 5L3SA 5CT8A 2CSUA 4H1VA 3WSWA 3B9RA 3KD3A 5K20A 4OX9Y 1B0AA 2DFVA 1VLHA 4YV7A 1JBQA 2HC9A 3O8LA 5CIYA 1XMQB 3DBHA 4AC9A 2A0FA 4IS2A 1RI4A 2R97A 1MIOB 4WV3A 2WIDA 4V0NA 4V39A 4Z5XA 4BLRA 4FLFA 1CRLA 2C7VA 4ZICA 4HBZA 4B3TB 4D96A 2ZPTX 3JWGA 3U44A 2OCKA 1BDBA 3BWYA 4PYMA 2QU7A 2IK8A 5DEOA 5HFAA 3GG9A 5KYWB 1FC0A 1X3SA 1K66A 1N2EA 1RM4A 1SCQA 3M5DA 4JLBA 3V8QA 3RIYA 3T56B 3NAMA 2WQZA 5K05A 2QVZX 3BCUA 5FBRB 1ZGCA 4IR7A 3FLEA 5JMPA 3C45A 3A2KA 3ZHQA 1J0BA 3QWAA 4KGDA 1E1YA 5E38A 2G9NA 2GFHA 1OC2A 4YQZA 4N3AA 2ZBGA 1C3LA 1NKSA 3DQZA 3GRYA 3VR1A 2VKQA 2GKOA 2WYRA 1RJ9B 3F90A 3GCDA 4OIMA 4XYGA 3LGAA 4EG6A 3MS7A 3SCZA 4BNGA 4I5FA 1FP4B 3FPHA 1TAQA 3HMKA 4ZVNA 1EHYA 2R1TA 1HDIA 3A6KA 1P4SA 4J0CA 5A0FA 4EKNB 4NI5A 3H9UA 1D2RA 2AFIA 2DQYA 3HNOA 3UJAA 4MVWA 3RK0A 3FJ1A 1Y6GA 2V7VA 1U9IA 2XWPA 2GZ1A 4PLGA 1FCJA 2VPZA 3QYPA 2P69A 2HQ1A 2VYQA 4PO3X 4J29A 3VPFA 5EKDA 3SC2A 3ZNOA 4QD3A 5IBQA 1CB0A 2D06A 4INAA 4EHFA 4YMLA 1SPBS 3FPCA 4YXWA 3TGPA 5CFLA 1V5IA 3K71B 1XK6A 1JT9A 3NDBB 4E5NA 5FBQB 3BHJA 4EY6A 4YMSA 1Y8RB 3F5SA 1Z3CA 5FCDA 1U0BB 1T2DA 2C4VA 3BM5A 5B2FA 1UM9B 1N7GA 4PZZA 1Q7CA 3OUZA 4TS3A 4DQVA 3EHEA 5I9SA 4QASA 2IUUA 3C4VA 4NV1A 4Q3AA 4BGIA 2NTEA 3ML1A 5ECDA 1NLMA 4DPLA 1KFCB 1VCNA 4U9HS 4F38A 5C8YB 1WUYA 4TKVA 4UD6A 2AEJA 2QLNA 4ILKA 3RC9A 4P4LA 1VPTA 1QXSA 1UMCA 2GH1A 1H0KA 2J6IA 2VKTA 3FUTA 3E9MA 4JP8A 1IH8A 4V0OA 3U7FB 1EB8A 1VJDA 1ZD4A 3HSKA 3KYJB 3B6KA 3Q5GA 1CZRA 3CNLA 4V0QA 4BMSA 1E5DA 1TTPB 1YAHA 2OO5A 4KAJA 4KXNA 2P9EA 3X1XA 4MMXB 4CDGA 4X7FA 5CB4A 2ID4A 1EFDN 1MX5A 4DS3A 2PCJA 4Q5IA 3TGLA 3HXTA 3LKVA 2BGTA 2M6KA 4TLEA 5D6NA 3NHMA 2FMHA 3TW8B 5EXDA 1IY1A 2B99A 3EAQA 7GPBA 4HN9A 1NYRA 4I36A 1PQ4A 1M6WA 4QSMA 5REQB 4CTMA 4UM5A 5LIPA 1RTKA 4GMFA 4I0WB 5CLFA 1Y5RA 3FWKA 3RRMA 1LPMA 1UWVA 1ZBDA 3CC4B 1E7MA 2CE7A 3FYSA 4K6OA 2C9CA 2JBHA 5FPSA 3VH1A 3UJBA 1U2DA 1YHZA 3CX7A 4KE6A 4C1NA 4QTTB 3G8AA 3SZLA 5KWEA 3THXA 5JR3A 3QX3A 5SV2A 1H2XA 4RK6A 2GBCA 5JSYA 1KL7A 3OZRA 1SIUA 1VHJA 4Q4HB 4Y2UA 3X1WA 3WBJA 1C50A 2OP0A 5TY0A 4WLEA 1EFRA 3D4PA 3ORHA 3SBOA 4EQZA 4RCZA 5IC4A 2PWAA 3FFWA 3NHUA 4XD7A 1B3BA 2A9KA 3CZ4A 4KFRA 3A6DA 2J4CA 1KVSA 4RAOA 5AM0A 1T2NA 1YZGA 2YMPA 3SF8A 2XRMA 2PS1A 5KNCH 10MHA 3K8YA 5LOVB 3H4MA 4ZJUA 1PZNA 1G6HA 2MINA 1TT5A 1SHLA 3M2PA 1J8FA 4PPFA 2G4LA 3R0JA 4GKAA 3QG5A 1JNYA 1QGED 2AVDA 5AIBA 4QFCA 3CF4A 1GADO 4H2DA 2BE7A 3SX2A 2Q7OE 1U2SA 2FRXA 2GTPA 2JD1A 1Y9DA 1CXZA 3D0OA 2ORWA 1Z73A 4M36A 4M9CA 5SYAA 3GJ7A 2ZSJA 4NP6A 2VUSA 1DAEA 4OBEA 4XRRA 2HA7A 1FLDA 1IPHA 1OKKD 3EUEA 3IAXA 4OHFA 3VFDA 3RQSA 1T8TA 3I83A 4Q4JA 2I3GA 3ND7A 3GIWA 2GZ2A 2BUCA 3HN6A 4KIGA 1MKYA 4GGPA 4IO1A 1QM5A 3PA1A 2F64A 4RPCA 1XC7A 1Z0AA 2HF8A 2VTBB 3DEIA 4GRAA 1C3XA 3LUHA 4JLJA 1SHZA 2F1RA 1GCGA 3BA6A 1GKLA 3OFNA 1OMOA 3KKZA 4MGEA 5ESWA 3D7SA 2MR6A 1W59A 3SJAA 2BTEA 1SKQA 1P4GA 2YJ6A 4JUAA 5GOTA 4IHQA 3SS7X 2YZ7A 1VJSA 4WKPA 2XCSB 2G4CA 3UGQA 3A28A 1H05A 1VLQA 3HG7A 3AR6A 2YZNA 4IGKA 2WJHA 1RXCA 1TQ2A 1VHDA 1SG0A 2AOTA 5DGTA 3U5ZB 1TW3A 2X5OA 4PCUA 1LWOA 3NBYC 1KK2A 2G7ZA 2XRFA 3Q2OA 4ZPJA 5HRUA 3EVAA 3SMQA 3EZNA 1F2DA 4O2AF 1QG2A 4UVIA 1D2EA 1OH6A 2J6CA 3ERCA 4Q1EA 3TBKA 1FX1A 3RHZA 3HY4A 1EH5A 4CCWA 4LE2A 1M6NA 3COWA 1FTGA 2ZBUA 1STOA 2MWMA 3HZHA 3LP8A 5AI5A 3FOWA 5AYVA 4HEA1 5LOVA 1SU7A 4OJQA 4OGKA 1JYFA 3W6UA 3PUZA 2HCJB 1IN8A 2J41A 4W99A 1NFRA 3G85A 4B4UA 4FYXA 4PIVA 2ZUBA 1R5OA 4I1VA 1VYVA 2YWBA 4KUGA 4O25A 2KS6A 2CXOA 2YIDA 4S2UA 1MZVA 3BCHA 3DD5A 5LA6F 2IWRA 4C20A 2GMWA 3OOCA 4FOSA 1X15A 1U98A 4E7PA 4D6XA 3IBTA 3DQPA 4G9GA 2PO5A 1YAJA 3OE1A 4CIVA 4CTJA 2DULA 3ZDCA 3B12A 4N12A 1EX1A 3Q3HA 1ZSYA 3L7AA 2FY8A 2F1LA 4PSVA 5AK5A 3RJ5A 3IOYA 3X1KA 4ZCTA 5L6LB 2B7CA 4V0RA 1KVQA 4CT4B 2IELA 5EJ9A 4KE8A 4NZYA 1AS3A 1VL0A 3HCAA 3QVXA 3T1VA 5C1DA 3E3LA 4J90A 1X8LA 2Z6UA 1HFJA 1GRCA 2BMEA 2QVBA 2EG9A 3IKVA 4AKIA 1NQOA 1N0HA 3WG9A 5KYNA 2ZIGA 5LZ2A 1C7ZA 4YI5A 3V1NA 5DGHA 4P7BA 1Z74A 3W3AA 5G1NA 1G4AE 4EHIA 3UPTA 2AT1A 2YYYA 4IHAA 4INPA 3A70A 5CDSA 1QE3A 1KQSB 3NWPA 3T5AA 3KE9A 4Z1OA 2J4DA 5KNBA 3ISJA 4GM1A 4UCQA 1KU0A 1ZUIA 1Z0UA 1A9YA 3RRJA 4XLAA 3WYCA 2R7NA 1LDEA 1P7CA 3W5CA 4UHDA 4YJFA 3I56B 3ODGA 4MZDA 1HLFA 4ND8B 2RI0A 5AOVA 3M34A 3TTUA 5JPCA 4XM0A 4HT3B 1XQ9A 2VP4A 1V4BA 2QM7A 5F2KA 5EEHA 3WP0A 2G0AA 2VHUA 2YJZA 4ACBA 4OYHA 1Y81A 1VB5A 2B30A 3M4NA 1GCUA 1JPJA 2BFEB 3HACA 3I5MA 5HKBA 5MDHA 4XKVA 3DFIA 3CONA 2DFNA 3E22A 3QHAA 1KP9A 6CHYA 4LRSB 2GHIA 3AJ9A 3RRNA 1MH9A 5JISA 1T9DA 4JJ8A 3EFEA 5J4VA 4X1IB 1Y82A 1EFPB 1X1CA 2FJPA 2G7MC 4WFJA 3SDSA 3SYRA 3RVRA 4D7AA 1DBQA 4DR6B 1KORA 2C4TA 2ATCA 2HN9A 1JHPA 3Q7SA 1DI0A 2RFLA 2FX5A 3DEFA 1VJ5A 3R5FA 4GR9A 4M99A 1UKYA 4L9SA 4L76A 1U5CA 3BQ9A 3E7XA 4S05A 4PZ9A 1WY7A 4M1OA 1VXRA 4R1OA 5GY7A 2Y4OA 1S8AA 1ADJA 2YBDA 1NJ1A 3F7OA 3T1OA 4AAYA 4PO1A 1VKOA 2YXPX 3KQMA 5F51A 2ZJ7A 3HU5A 3AF5A 1NVTA 2M2IA 4HWRA 4MW2A 2H1SA 5CFPA 4YRRA 3DDWA 4JJGA 1P1HA 4ZCSA 4EBBA 4OPVA 5LDGA 4YRNA 2VHZA 5FI0B 1NN3A 2BZGA 1XMIA 2XCLA 1H1TA 3MA0A 4Y3UA 4D6PA 2YHIB 3K8ZA 2GPTA 4HBGA 4K9LA 4ARZA 2PUFA 2JHGA 4B3JA 5FWDA 3RVOA 1YJAA 1KEPA 2O3SA 2B69A 4UBLA 1IHDA 1H2ZA 3BFXA 4UEWA 4RGYA 5KBYA 3KXKA 3AR5A 1QKJA 2C4HA 3KHKA 1K8XB 3R09A 3DOHA 3VSDA 1FQOA 3WGQA 3DBLA 1A2QA 1S72B 4HNHA 4LHVA 1Y1QA 4KVAA 1RC0A 3CPSA 4B3DA 4BFWA 1I51A 2VWHA 1YB5A 4F11A 3MWGA 4KXMA 4EUNA 1QO9A 2LXNA 1N06A 3G2LA 5FF9A 3LCRA 5B4UA 1M34E 2FEAA 1K7XB 5PGMA 4LOHA 3TUZC 3OO1A 1MMFB 2V7EA 3EQ2A 3NIDB 1C1XB 1BMDA 1YIOA 1AB5A 1SCBA 1Z9BA 4QTZA 4CKBB 5CXXA 5EJ5A 3SE0A 2BCJQ 2OL4A 3PQ6A 1GA6A 3D3WB 2Y0DA 4EFNA 3HJGA 2IUEA 3O75A 4JLOA 5JY1A 4PRLA 2IPAB 4CKCA 1RRVA 1TLTA 4X8MA 5FAKA 1H1DA 5AVTA 4RKFA 4KO2S 3K72B 2ZZNA 3AV3A 3H84A 3WIUA 1JMKC 1NXOA 4A0SA 1EAYA 1Z0ZA 4RIGA 3MSXA 3HB5X 3M4JA 3SXJA 4IFIA 4KYTA 1L8OA 1YZNA 1LSUA 4Q7MB 4Y6SA 3V8PA 3VJLA 4AG6A 3UYKA 3VAZA 4IW3B 3UMCA 4LHYA 3P9YA 4MV4A 3R7WB 3N74A 3PFWO 3TKAA 4BECA 3V33A 1JQBA 2JCSA 5AM4A 3IMFA 2R5WA 4PS0A 3ZH9B 1TYCA 4BN0A 4D0GA 3RC8A 1KS9A 2H65A 2E49A 1C8KA 3WJ1A 2CT8A 3EIQA 3L8HA 4GLLA 1TO2E 3DT6A 1MAHA 2AI3A 2B20A 1ZUNA 2UZAA 3PCXA 4HPJB 2HBZA 2A1TR 4TSKA 3RODA 5H5JA 4GVLA 4YA6A 3B70A 3U7RA 3WL5A 4BJ5A 2WV9A 3H4IA 4E5VA 4EJSC 4FSDA 2ATVA 3JU3A 1KVTA 1X87A 3IHKA 4J3JA 3TO5A 1H4TA 2J09A 4NZOA 1HT2E 5KJ1A 2O59A 4O2AA 1GNTA 1E1RD 3TW6A 2PIDA 5H16A 3O8CA 4J03A 2CBZA 4I1RA 5CLIA 5FADA 4JUBA 4XLEA 4MUBA 3GX1A 5T5QA 1G8FA 1Y98A 2RAFA 3K0AB 4UQPA 4DLBA 1N07A 1XJQA 1JHUA 1EB9A 3NR2A 5KTTA 1E6UA 2OO3A 3FJYA 4G1VA 3IV7A 2G5CA 5AKZA 3U9LA 1VXOA 1SNYA 2X3UA 1E0KA 2XOXA 4QYSA 3AU9A 1EZZA 1SXJE 2JJMA 2FR8A 3ASZA 3EGWA 3QELB 4BO2A 2GLXA 5B7GA 4A16A 5JNSA 2PRZA 3VUEA 1ORHA 3ZQUA 3ZVMA 4ARIA 1LSOA 5CVVA 3QFTA 4E09A 5KINB 3R7BA 3RJ9A 3T9EA 4W1QA 4ENRA 1RXYA 4HAVA 2JLQA 1A97A 4X92A 2G28A 1UPTA 2W9XA 3EYWA 1NHGA 4IIDA 1HFKA 4MXDA 1RI5A 2ZJZA 1DKMA 2QUZA 2Y1FA 4R1TA 1PSDA 4ZJYA 5FO1A 3F71A 1XT6A 5EXEA 5EIXA 4B9EA 3SBEA 2NIPA 3HBMA 6AT1A 5FI1B 1WPGA 3UT5B 1IUPA 4W1RA 3ZK8A 2E1BA 5ISMA 1F2UA 2R2GA 5A4JA 1J2TA 3DLIA 5JRJA 3EVGA 2FYTA 2BIFA 4G8CA 2KJQA 4JJEA 4OHPA 2O1WA 4GOOD 5AO9A 3EQ7A 1KKMA 4JEUA 1AS0A 1XZJA 1O6ZA 2ZZKA 1K73D 3CPEA 3C98A 2UV8A 3BTSA 3HUUA 4PYNA 3EB9A 5T64A 2JF0A 3A1TA 5TNXA 2WD7B 5E9AA 4DR4B 4O4LA 3V8RA 4C0BA 2Y92A 4XFDA 5CYFA 2AN3A 2EQ5A 2ERXA 5IC6A 3T7JA 2AN9A 3WDSA 3ZLUA 1PG5A 1IJKA 5L9AA 3JAKB 5LSAA 1P1FA 3OCUA 1T25A 2OBFA 3RJTA 2O06A 5JMTA 5L53A 2GN9A 4JVSB 4XJXA 2AFRA 1W2BB 2XD9A 1NN5A 1JP7A 1THTA 4HLNA 5CYOA 2FU5C 3B53X 4OAPA 4U02A 1L7XA 1DELA 2JASA 2FFBA 4BN5A 4AZ3B 1LTKA 4YQEA 5PNTA 4EVIA 3Q98A 5MFZA 1Q91A 2XRZA 2XMPA 1AVTA 1XEWY 3DD1A 3O93A 4KQ9A 4FEEA 4TN5A 3H7AA 3TQHA 1DFGA 4BLTA 2J45A 1CUCA 3TF5A 1OFTA 3QF7A 6LDHA 2FZWA 1B4DA 1FYVA 1A8SA 5K1ZA 1KSGA 5IDVA 5FOWA 4EJ2A 4DKJA 3PC3A 3SYLA 4MV8A 3IVXA 1GILA 2EFYA 1MJFA 2MSCB 2XB8A 4IWYA 2DMRA 3RU7A 4KLAA 3OMWA 3QE4A 3TYXA 2TMKA 2IWHA 4WT7A 5IZCA 1G7RA 3NDJA 5U1PA 5HE9A 4AO7A 3L8FA 4HUJA 4PIMA 1NVGA 1NVAA 3N86A 2M98A 3W5IA 1J7KA 5K8VA 3DZFA 4I8DA 3ND9A 2WWTA 3AKYA 3PUMA 2ZYTX 4F5EA 3V3TA 1OI3A 3LCCA 3RFFA 2B5OA 1KH3A 2P5UA 3EXG1 3WGOA 2DPXA 1QPGA 4ZOAA 4G6ZA 3DBIA 4D9EA 1F8UA 5IXJA 4QBIA 2XF2A 1BXGA 3HXMA 4HEHA 4AWXA 4N0EA 4KKVA 4MP6A 1JR3A 3JZFA 2HI0A 3L3BA 4OHUA 2DY0A 2Q5OA 2WYWA 4YXFA 1G38A 3HLYA 3I5AA 3ZGOA 2XT6A 4CM8A 4GSLA 2GK4A 3PEVA 4HDOB 2PIAA 5LB2A 5KVAA 4G86A 1HDRA 3TLGA 3KAPA 3NBKA 4AU1A 4JP1A 1S89A 2UXCB 2QRVB 3Q3CA 4U6NA 4CKCB 2XUZA 5IEJA 1CF9A 3T99A 4LJRA 2R751 1IPFA 2P5YA 3OIUA 4N39A 1M9NA 5DTIA 1QFXA 3DCJA 1O87A 1Q1BA 5BV2P 2DT5A 4C5CA 4OPSA 5IXYA 4XX0B 1CEQA 1ADFA 1XPJA 4GOKA 4EAQA 2XZLA 1O89A 1THGA 1UKAA 2G6BA 2Q6VA 1GZ4A 3HV2A 4KO1S 4Z0TA 1Q83A 5JI3E 1E2KA 4BFUA 5AN9A 3KO8A 1SFRA 3MAJA 1GTSA 4FD3A 1OX5A 3K35A 4GQAA 3BWCA 1WCWA 1GUAA 3IV9A 4Z99A 4BNUA 1R0SA 3OG9A 2RAUA 3P7MA 4FYIA 3K53A 2NPOA 2Z8YA 4WNAA 5B3JA 2QM8A 2HD4A 4U39A 3D8UA 3KJZA 4JGIA 1MC8A 3WV4A 4LKRA 1D0IA 4IOMA 2HHJA 2JK1A 4Q37A 2QTVB 2TECE 4BV8A 4F45A 5IS2A 2PKRA 2V3CC 1B93A 3D31A 2YWHA 5CVEA 3VYUB 3ZWXA 3MWJA 1L5NA 5DNYB 1LLQA 1CF2O 3V8NA 1AN9A 1NC3A 3AB3A 3E7WA 1DPGA 1N4AA 1REQB 1PFUA 1M0SA 1BHSA 4WZTA 1XLTA 4NV3A 1BEEA 2CJPA 4DUYB 3OLCX 4CEHB 1UDCA 3CP2A 2IYEA 4B34A 1FXSA 1D3AA 3EIFA 4MKHA 1EHCA 3BILA 1FLVA 1ZD2P 1Z7GA 2ASEA 4RZ3A 4TROA 4FIZA 3UXEA 1JQJC 1JX6A 3D26A 1M2GA 3DWIA 2I6TA 2HBQA 3WYNA 4B33A 4AKTA 2K7FA 1OOEA 3LQQA 3PD7A 2CEKA 2C5SA 4IJUA 2Z2JA 1K89A 3JQAA 2P77A 3KJGA 1VB3A 5KQMA 1PKEA 3DYIA 3HLKA 4A23A 5E3HA 3GGDA 1G63A 1XCGB 2V58A 3FFAA 4P0PB 3HKCA 2CLEB 2QROA 3DVQX 4RFSA 2NWQA 2UXBB 2UUBB 1NZFA 1GNSA 2F9MA 1AH2A 3JV7A 3C6QA 5TDHA 1NUAA 1E9FA 4K03A 4Z4YA 4UQLA 2X2FA 1KY5A 2I65A 5ECYA 5EQDA 4BTLA 1O97C 2FZCA 2R3SA 4BOYA 2RI1A 4IP0A 2YQZA 4RMJA 1Y7HA 1SUSA 3DVLA 1LI7A 2PYIA 3CTPA 2OLJA 3MCTA 4I4IA 4US0R 3RUDA 3WGTA 3ZD9A 4RKQA 3ZQ6A 4ARAA 3KVYA 1SOWA 1R0KA 2FCRA 2PZBA 2VQ6A 4LRQA 4ZO7A 5LP6F 3CLRC 5ERYA 2O8EA 1HL7A 5FIUA 1IVYA 1QGOA 3QIAA 4IXTA 1DC7A 1U7TA 4QDOA 4XX0A 2FFHA 3PDJA 4GPBA 1U7UA 4AG3A 1C9MA 3FGOA 1GD1O 2IZ7A 4HVTA 1GDDA 2HSWA 5BQXA 3E0QA 4ZCIA 1FX0B 3GRPA 3W2TA 3FTNA 4UNQA 4MA0A 4CFYA 2FK8A 1Z6ZA 1PEAA 2Q07A 2E4VA 1X7HA 5HFJA 1AGXA 3CW2A 1R0LA 4NG5A 2F8MA 1JTVA 2IZZA 3K9GA 3G2OA 1K88A 3CG0A 4RZQA 5A4AA 1J8DA 1GRQA 4YAIA 1FIUA 3FOBA 3RROA 4CKYA 4LIPD 1BU5A 3TXYA 1YZTA 4LTNA 5TEVA 3UMJA 2GD2A 4DNXA 4MUIA 1NRXA 3V8MA 1GPAA 1SC1A 2DQKA 1NE2A 3ZTTA 4MV3A 3GR6A 4DQKA 5FXMA 4I50F 2WPDD 4BEBA 3CY6A 3ROMA 2QX4A 4FXOA 3KQKA 3QVLA 3HLTA 4RACA 5IDYA 2ZL6A 1P45A 3NP7A 3BMXA 2C95A 4KUEA 3R7NA 3U3MA 4G8DA 1PZMA 4NYIQ 1NN1A 2VBUA 1ZJ4A 2J5KA 1MAWA 4BNDB 2PFGA 4EB8A 2FQWA 3R8CA 3PLNA 2BZSA 4QDUA 4J4BA 1CRQA 2ZYGA 4OG2A 4X7PA 5TSDA 3THXB 3O90A 3LFUA 4HDRA 4PE5B 4DIBA 4TYPA 4R2XA 3HEMA 4RDLA 4N4AA 3FCXA 4H17A 4MUMA 3L8YA 2DUUA 1ULZA 4RPLA 3FMGA 2QL5A 3P2IA 4TSFD 4MRPA 2DLCX 3N0WA 2EBFX 4BGVA 4HC4A 3MS2A 3QYJA 4CKWB 4EJSB 1ZI9A 2HNAA 1E2PA 3Q3EA 1JMVA 2GBLA 2ZB4A 2NMVA 1JEDA 2JGFA 2WJ4A 3N1UA 1EPUA 3GVIA 4IXNA 2B35A 5BYBA 3C5WP 3N5CA 3ZHBA 1TM7E 2WTXA 4BX2A 1K0UA 1X7WB 2EP8A 1E5VA 1G7SA 1BXGB 2IPLA 2JIOA 4MSUA 4RH3A 4FW9A 4WN9A 2OESA 4E2XA 1P31A 4ABYA 2VDPB 3C8UA 3GQBB 4B3IA 4HMPA 1ISRA 4NYJR 4C7BA 3VGPA 4RVSA 4BL5A 3K09C 1PNOA 2H06A 1C0EA 5JSKA 3LCVB 3MM4A 3BIOA 2GREA 1O5TA 4G26A 1WCYA 5L4SA 2AHRA 4MLCA 4O4JF 1JI0A 1E59A 1SHJA 5JS2A 2ZS9A 3NM4A 4GE3A 1P5ZB 5BMVB 1JDTA 3FWZA 1RT9A 3X1YA 1C9DB 4BO1A 1IY0A 3DLCA 4J4HA 3T4XA 4YJ2A 4HLUC 2EX0A 1Y3IA 1JHQA 3TVTA 2H2WA 1CC1S 1FTNA 4EO7A 2D3NA 3N7TA 1Z8FA 3II6X 4R31A 4HN2A 4A6DA 4MVJP 4UU0A 4IJ5A 1HKHA 3ZNQA 5B58T 3AKDA 4DUGD 3TIXB 4HVAA 3EVFA 3GT0A 2BFDB 3ZGZA 1P3DA 1QLWA 1Q2UA 1S1MA 2JFHA 2LWIA 3IIEA 3ZY5A 4OLBA 3VX4A 2HY7A 3BJMA 3F2VA 4KACA 5AJVB 1ZIDA 2EZ8A 4B6PA 3QKWA 4JJIA 3MCAA 2XHZA 2XCOA 4RSHA 1AQUA 1Y9EA 1DO2A 1EQAA 4URWR 3Q3AA 3TW4A 2D4AA 2Q3EA 3M81A 2E21A 3M49A 1HTTA 1MB9A 2PH1A 1TM5E 3ESBA 5IVIA 2CHFA 3HRIA 3SKXA 4C4TA 3AESA 5T4HA 1GA1A 3D64A 3E61A 3SR4A 3ZWVA 2ZSDA 4NEQA 4CBVA 4C07A 3A58B 1BNCA 3BORA 3BCSA 3U4QB 2DOKA 2GLUA 4DCSA 1U0RA 1YH3A 3OUTA 1CK4A 4C5BA 2HF7A 3CCFA 4EPYA 4IX1A 4Q4HA 2OBBA 4UBNA 2IEYA 1EAMA 1PWZA 2CFTA 4JOSA 5E4TA 3STTA 5JSZB 4WK2B 1EJ2A 1I0LA 4KHZA 1GSHA 2H11A 5TPZD 3L4JA 1ENZA 3QBVA 4Q48A 2MINB 1USIA 4P38A 1TXGA 1YJNB 3E05A 3MELA 3GDFA 2GA9A 2PAAA 2Q1TA 1QF6A 3QKUA 1F8GA 1A82A 1R0XA 2F2TA 2H2DA 2W6MA 1TK9A 5AKXA 1PYOA 1WBJB 4DLVA 5CH8A