1W35A

Ferredoxin-nadp+ reductase (mutation: y 303 w)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena pcc7119
molecule tags Oxidoreductase
total genus 87
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1w35A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1w35A02
1OGJA 1KK0A 4PC3A 1G7TA 1KTVA 4YAOA 1H42A 2BGIA 2RC6A 4DQKA 2QDXA 3P27A 1D8TA 2VZLA 1K8AD 1N8RD 3CB4A 1B23P 4RD4A 4QHYA 4AF7A 5JBQA 1WDTA 1CQXA 3B78A 2CNDA 3CRZA 1QFJA 4PC2A 4RCZA 4M2LA 2PLFA 1K9MD 1D1NA 2AHOA 1QUEA 3W2EA 2DETA 2BVNA 4TMWA 1EP2B 3QFSA 4LBYA 4ZV4A 1IB0A 1BX0A 4ZCLA 3W2FA 1Q81D 2OTJB 2OK8A 3QE2A 2EIXA 4ZCMA 1M90D 3U6KA 3W5VA 1N0VC 5DSZA 1TLLA 4RD6A 1R5OA 1CNEA 4G5GA 3AVYA 3JQQA 3G71B 2BN4A 1XE1A 1Q7YD 3CCJB 1JB9A 3W2IA 2EFGA 1QG0A 4N3GA 1VQ6B 4FWTA 1TVCA 2VNKA 3VNUA 2QA4B 2YWGA 1VQKB 5KSWB 1G7SA 1W34A 3OZUA 3ZC3A 4FK8A 1JJ2B 4C0SA 4UAJA 1YJNB 1D2EA 3AVXA 4QFMA 3U2QA 2VNIA 1KJZA 2GQFA 1GR1A 1EFTA 4ACAA 1U2RA 4PC6A 1FNDA 3AGPA 4NCNA 1IJEA 3CC4B 3CCVB 4TMZA 3WYAA 1F60A 2D74A 1YJ9B 1YIJB 3ZZ0A 1AIPA 4YAFA 4LBWA 2PIAA 2BSAA 4G1VA 3G4SB 3AVVA 3WY9A 3W5UA 1QVFB 1GAWA 2XNCA 2XEXA 3QFTA 3LYUA 2BGJA 3AGQA 1QUFA 1QFZA 5TR9A 4Y7CA 5TY0A 1AMOA 2OTLB 4TN1A 1VQ9B 3I1FA 4HE5A 2QTLA 1ZM3A 2R6HA 1E64A 3LVBA 1VQ5B 3CCSB 2B5OA 3A1FA 2VNJA 4RD2A 4B4DA 4NBSA 4B47A 4B44A 1QFYA 2VNHA 3AVWA 4TMTA 4ACBA 4F7DA 4ZGNB 3CW2A 1BJKA 1F20A 2BM0A 1DDGA 3CCLB 3WBJA 3CMAB 1ELOA 2QEXB 1YJWB 3ZBTA 5H5JA 1DARA 1EFUA 2HCJB 2BF4A 2QMUA 4IW3B 1ZM2A 4YAUA 1J9ZA 4M1KA 1CNFA 4RD0A 4G1BA 3ZZUA 1GAQA 4N3NA 3CCUB 3OJWA 2BV3A 4YAWA 3QSYA 1YHQB 1H85A 1UMKA 2J7KA 4K1XA 2OK7A 1KD1D 1W2BB 1E62A 1EP1B 2XNJA 4P3YA 4Y9UA 3CC2B 2BM1A 5H59A 1QGAA 4J0QA 2VYQA 1FNCA 3W2HA 3W2GA 2HMAA 4RCYA 1OB2A 1FRNA 2DERA 3PENA 1R5BA 1JA0A 3WXMA 1VQOB 1FRQA 1SM4A 4ZCIA 2DEUA 2DY1A 2RC5A 4HE6A 3OW2B 1IJFA 2QN6A 3P26A 1VQ4B 1JA1A 3MCAA 5AN9A 1BX1A 1W87A 4RJLA 1K73D 4B43A 2YWHA 3J81k 3JQPA 1TUIA 2CRVA 4B3XA 1KQSB 1I7PA 3AVTA 4MYUA 4M53A 3CMEB 4PGOA 3WNBA 1M1KD 4LBVA 3I56B 1DG1G 1ZUNB 2DCUA 4TMVA 3WNCA 3E1YE 2BPOA 5GV8A 3VO2A 1QVGB 3B82A 4PC1A 4LBZA 5HXBA 1NJID 2ZITA 3CXCB 2HDNB 1VQMB 1G7RA 1KRHA 4RD1A 1FNMA 3W5HA 5TV2A 1FNBA 4M0LA 1B2RA 2BMWA 4H9GA 4EH1A 4DQLA 3OZWA 1SKQA 2C77A 3U6BA 2GPJA 1E63A 4FN5A 1HA3A 4AC9A 1GJRA 1KK3A 1QGZA 3FPKA 1QGYA 3CD6B 2C78A 2QTZA 4B48A 2YWEA 5FA6A 4M4SA 3OZVA 2PMDA 1VQNB 3B8HA 3ZBUA 3CCRB 3LRXA 4Q7JB 3WBKA 1BQEA 1FDRA 3E20A 4PC7A 4YALA 1Q82D 3MMPA 3OJXA 1KC8D 1VQ7B 1A8PA 3LO8A 1VQ8B 3CCMB 1ZM4A 3ZZTA 1YITB 3SJZA 1EWYA 4C43A 1Q86D 3I55B 1QH0A 3QFRA 1W35A 3MHPA 3CCEB 1ZM9A 3ES9A 1S0UA 4U9UA 1KK1A 2YWFA 4YHBA 1VQLB 2B7BA 4LC0A 1EP3B 1DDIA 3FJOA 4R71A 5GV7A 3CPWB 4P6VF 2B7CA 1EFCA 1YI2B 4Y9RA 3WNDA 1OGIA 1QX4A 4TMXA 4ZGQB 3AVUA 4BPRA 1XB2A 4AF6A 1TTTA 4RD3A 3CCQB 1NDHA 3JQRA 2E1RA 1GO2A 4MYTA 1R5NA 3VMFA 3V76A 5THXA 4WQMA 1GVHA 1N0UA 2NPFA 2FX3A 3G6EB 1G7CA 2X3UA 5EMNA 1S72B 3CC7B 3VO1A 3VNVA 1OB5A 1VQPB 3QFCA 1KK2A 1EXMA 1JNYA
chains in the Genus database with same CATH superfamily
3BYZA 5J3JA 1P1RA 1SIBE 4CLXA 1U3CA 1F0NA 4JB3A 3TZEA 4BBZA 4OKNA 2OPBA 4PC3A 3FI0A 1S4QA 1G7TA 1UD6A 2Q4OA 1JMKC 3V32A 1WRBA 3H5OA 1H42A 4ETNA 2BGIA 1N3IA 1X7GA 2JEYA 2BM8A 1FYFA 2AR0A 3HXTA 4HLUA 1ENOA 3NANA 5D7NA 3U3ZA 5TMEA 4MJXA 3KQQA 4KPGA 3RVBA 5ALIA 1AKQA 3ETCA 1CRPA 2X5JO 3NHBA 4M0UA 5CT8A 3BFKA 2Z6QA 2ZU0C 1N8RD 2VF2A 1LSJA 2PHZA 4G63A 1T1GA 2OZEA 3AL0C 1X1DA 2LW7A 3Q87B 1PGQA 1B23P 4JP2A 4A6DA 5CFLA 5A62A 5FL7D 4QHYA 4MQBA 3AY0A 3W8EA 2N9UA 3ZV5A 2OFOA 3L6BA 1H4QA 1P5HA 5REQA 2ZXEA 5IXSA 4LN1A 3ONUA 3F7TA 3CRZA 5FLKA 1CZHA 1ORVA 3EFBA 1B3RA 1V6AA 3CVOA 1GTL1 2O6HA 3ENZA 3G6KA 1D2CA 1P17A 221PA 3PBKA 1MTZA 4HNSA 4KXLA 4L4SA 4RF3A 5ALMA 5F1YA 1BCRA 3OX2A 5LXTB 4FSXA 3K2QA 2PZJA 1K2WA 3W5CA 4OCZA 3SP1A 1UBJS 3H4TA 3AHIA 3BXZA 1YE8A 3HRIA 4TSFD 2A1UB 4HF7A 1R16A 3EZNA 4JNCA 3X43A 2DETA 1BN6A 4E22A 2X77A 3F2VA 1Y8QB 2BFCB 1DJLA 2GTIA 3USCS 1J0BA 4Q1BA 3R41A 4L3VA 2B92A 2P0EA 3V3TA 3NYWA 1AKEA 2J1LA 4HAWA 4L02A 3JWHA 2Q4TA 4ZOCA 4Z1MD 4EO4A 4E14A 1A4UA 5DRYA 2QTTA 4HADA 1BX0A 4RK1A 3W78A 4DUGD 3LLMA 3W2FA 3CGWA 2OTJB 2C2GA 1QH9A 4HGQA 5E8JA 2QP4A 2WU3A 4C22A 4ZOBA 2VAMA 3DQZA 4RSMA 3S27A 3HGTA 2YJNA 4JVNA 2FFBA 3CO5A 5CFMA 1I4DD 4OBEA 4Q9DA 5EWJA 4ZCPA 1CR2A 3WSWA 3WMGA 2RSLA 2XNHA 3K5WA 2JCVA 4ZYTA 2ZXUA 2HR1A 3GJSA 3UA3A 1MZPA 1FCJA 3IXQA 1RAGA 3GK3A 3EXEB 4UHKA 2XCIA 2YV5A 3LE8A 1X7WB 3PFCA 4WFJA 3RODA 3L93A 3H5WA 1B42A 1SVIA 4HJRA 1IHOA 2C29D 3ZI0A 4GOMD 2B2CA 1MB2A 3OZGA 4KVGA 3ZU6A 1VHLA 5C7YA 3S81A 5JH7F 4X90A 5JO0A 5BYKA 1NE2A 2RHWA 3P4YA 5E2AA 5BN1A 1JDSA 2K5UA 3WO0A 4BNWA 4KXUA 2QA4B 4EJSA 4OGKA 1ZGZA 4MNTA 3V46A 5A71A 1VQKB 3NKLA 3WJAA 4DNQA 5JAHA 1G4UR 1Z56C 1QIDA 4EECA 5LQRA 2AX4A 3UJDA 4FW9A 3FTQA 1ZZEA 4JDPA 4KU4A 1JE1A 4KQMA 4KXWA 4PYKA 5JRJA 1QIIA 4S12A 1PT7A 2NYUA 1L7RA 4DCCA 1AGPA 4B3IA 1X9HA 4RPLA 4OPVA 1NU6A 2L18A 5JDIC 3LWZA 3AY7A 5KMGA 4D80A 1Y4SA 3AZQA 4JD5A 4FNOA 3UTCA 4YQZA 4REQB 3NAGA 1EK6A 2FP4A 4WCFC 1UQRA 2VCYA 2P1RA 4TQUS 4O4JA 2NU9B 4LKRA 2Z98A 1Q12A 3E27A 3GOQA 1M6EX 1Z4MA 3H1TA 3KFXA 3AGPA 4NCNA 4E94A 5KYYB 2ZL7A 5D1NA 4ZIRA 2QUBA 5H0IA 4DLVA 5KOIA 3KZMA 2XA2A 3JWGA 4RZ3A 3WLFA 3EXIB 5DLYA 5BSRA 5CEJA 4MCHA 3FOEC 4AL4A 4QOSA 1HOXA 2JKYA 4JVLA 4WBNF 3DO5A 3GVCA 4DLRA 1QGOA 1RXUA 2NZUG 3BC1A 4HNTA 4UHFA 1WV0A 6YASA 2GETA 1AXEA 5EYPA 5K01A 4U9HS 1Q91A 3E7PA 3KD2A 3WGVA 2B7LA 2OGWA 5CB4A 4EB3A 4AY3A 3WGNA 1PSWA 4PLFA 2OKGA 3A04A 3PNYA 2B99A 1Z25A 2FH5B 3QXGA 2JIOA 4BB5A 1ZIPA 4D9HA 4DC1A 1Q20A 4DTCA 5MF6A 2ZT5A 4M1WA 4D96A 4O33A 1D9ZA 1I4LD 4U4AA 3KUKA 1CERA 2A0XA 1DKLA 1NJ6A 3GLVA 3THXA 1K6IA 4RPGA 4EHAA 4S04A 1Q9SA 4P2NA 2C9BA 3CX7A 4MVXA 2ORYA 1FYEA 4BNVA 1SVNA 2PE3A 2X6TA 1VSBA 2G7ZA 4JX8A 4OVKA 3U7GA 1QWOA 1R9JA 2WYVA 3HU3A 3ZW9A 1OKKD 1WF6A 2O48X 2C8LA 3SX4A 1YQXA 3ODPA 3ZTWA 3RU3A 1U8XX 1OIXA 2YQZA 4GKBA 4UC0A 2GPTA 4Y7CA 1QHHA 2HW8A 4ZT6A 1FP4A 5HVNA 1KFJB 2Z2XA 5D3QA 1C7IA 3OFKA 4ALMA 5CBKA 1TMGE 2XMPA 1T3ZA 1X15A 4R2XA 3IS3A 1NKSA 4R1QA 1H5NA 1WXXA 3B70A 4P8RA 4P2BA 4WLEA 1DJQA 2BJVA 1HXHA 2FXIA 3HS3A 3D3QA 4E1AA 4ABTA 2MSEB 3EFHA 2J4CA 4QYTA 4H0CA 4CEIA 2Q21A 3LG2A 4JJAA 3ZLUA 5B57C 5ISMA 3DBLA 4H31A 4DQDA 2WTEA 3KU4A 1B3BA 2R1TB 3D8HA 5IDWA 4IVRA 4L73A 3TIGA 4EG8A 1LSOA 3K70B 3R09A 3R6TA 5JYCA 2HLHA 3G2LA 3RYFA 1LPAB 5JCZA 3VVCA 3RSZA 3C7DB 4LOAA 2FB9A 3IR7A 4V0KA 5ICEA 1U8AA 2BLNA 3PDWA 3SYRA 4D45A 4YRBA 1RD4A 2F3TA 2GVDC 3TPFA 4NE2A 3G02A 3W8RA 1ZVKA 5FOUA 2FYTA 2HEGA 5B2FA 2HCJB 3V4LA 1E69A 1KYZA 1L2TA 3R0QA 4GH5A 4QDXA 4YASA 4URVR 5HHTA 2F55A 1RYDA 5CPBA 4P3KA 2CLIB 2ZYUX 3HJBA 3RT9A 4E46A 1CCWA 1E2GA 1PX0A 1CNFA 1WKVA 1PJ8A 2CXPA 2EBUA 2FKAA 5J35A 3DNMA 3UAZA 1RYYA 2X42A 2X1LA 4EPWA 3H1PA 4BWVA 2J0VA 4V0QA 2OSBA 4OXYA 4AUEA 2CUKA 1H4VB 4AJHA 3H2KA 3OIDA 3ZN2A 3IUBA 3SYMA 2OILA 4D9IA 4GPBA 3ODGA 3QSYA 4R1OA 1UPTA 5IYWA 1UMKA 2I3BA 2ZS7A 2BEWB 3TNFA 1F8UA 4B1FA 1KEEA 2XWPA 4KPFC 4MWTA 3L1VA 4L5AA 1EQAA 5JPIA 1SD5A 1U1DA 1ZGCA 3KALA 1CB0A 1POXA 3BFPA 5CH3A 1D6JA 5BV2P 1CF2O 4NVRA 1JH8A 5FTNA 1X9IA 4AP6A 4J90A 5CB8A 2BSXA 4TQAA 3VAYA 2L17A 4JL5A 4I0WB 4DS3A 2AFIB 2C92A 1T2FA 1EFHA 4WWHA 5ITWA 1OYYA 4HRYA 3NEYA 4ZVSA 1UM9A 2F4NA 2P3SA 2ZSBA 3OIWA 4DRXB 3K0SA 1VBFA 2G82A 1NE7A 2EHDA 3NIGB 3OC0A 3QWHA 4PM4A 4WXMA 5HMMA 5BSVA 1U2QA 2PMKA 3PENA 1TM7E 3HB4X 3JYNA 4GMKA 2WUFA 3BRWA 4NE9A 5LWHA 1XMQB 2WE8A 3NASA 1JA0A 5I48A 2OXRA 4P7BA 2UUBB 2PUHA 3AB3A 2QGGA 3OFND 2Z6UA 3TXXA 1EDBA 1EM8A 1NBWB 3LDFA 4M1SA 2D1SA 4R1PA 4D3DA 5KYGA 2R751 3E7XA 3NRJA 3MFYA 4B3GA 1R6VA 4Q6BA 3TM4A 1A9RA 3DMGA 3H7IA 1RQ2A 2GD6A 3G9UA 3GEPA 3JARB 1UINA 1D09A 3OBIA 2CXQA 3P26A 1VQ4B 3M4JA 2PKYX 4MI6A 5H02A 3SN6A 4NBNA 2RHLA 4X1KB 4KGZA 3GJ5A 5A4IS 2PXAA 4E08A 5I6DA 4MWBA 4XUGB 5JXHA 4RJLA 2GQ0A 2OXIA 1SWWA 3FZEA 2KMLA 3KZVA 3AL3A 3AEUB 3Q0TA 4I55F 4D9FA 3A58B 4LYDA 4QXMA 1MAUA 3KJIA 2OL4A 2DKNA 1KORA 3BN3A 5A7FA 1U7UA 1J0CA 1MEEA 3F5SA 4FVTA 3DOUA 3ZCPA 1OWPA 1RC0A 1L4NA 3AR3A 4XKJA 3RJZA 3FOZA 4PGOA 2DULA 2GR9A 3DHNA 4G9EA 4UAGA 3IIEA 3J81A 5F4BA 2WWRA 4L4ZA 4QECA 3KZKA 3GGOA 4HZUA 3L8HA 2G4LA 2DQ4A 1SVLA 3O6VA 4FFNA 2PV7A 4IRMA 1I6KA 5C1DA 2YN4A 2B37A 3N3AC 4J4HA 1E9VA 3VO2A 4XIFA 4AWXA 3UMMA 1G6OA 3D6HA 4FOSA 4OO3A 4PG6A 4PNPA 3GIRA 1W94A 2YZMA 3AH8A 3GPDG 4IUDS 3RSQA 1TKRA 2GN1A 1R2QA 3OOCA 1AKWA 1MVOA 3GAZA 3GGPA 3IT3A 3KB6A 2JGDB 3KWLA 1SCUA 2AX3A 1CQIB 4NYIQ 2HRQA 3CWZA 2PJDA 1G8MA 2GPWA 3SFVA 2M6SA 3FBWA 1OXMA 4U9IS 2XADA 4EHKA 1NW4A 1JJBA 3ESYA 4RHXA 2QTHA 4PZEA 3FYUA 3P45A 4C4PA 4ENWA 3HJGA 1LSSA 1FLVA 2G04A 4MWCA 4BNIA 1ILEA 1ZW1A 4D9MA 1E0AA 3EQ2A 1QGUA 1Z06A 2GAIA 1LDBA 3O8QA 1E5DA 4DC0A 3PE3A 2IYPA 4PV7A 2GN0A 3O74A 4FHCA 4PTYA 4Y2HA 3OZWA 4JUBA 4X65B 4TYQA 2K4MA 2GPJA 2B4QA 3HM2A 2ZR8A 4JASB 1XLTC 3W1VA 3U09A 2OQ2A 1XSEA 4LJLA 1E9CA 2XF2A 2Q6LA 2NG1A 3LY9A 4Q37A 1GDTA 5AVZA 2Q6IA 1PNVA 2ANBA 2X1MA 1T1RA 4ZGGA 2J5QA 5J3OA 3FZQA 4C0JA 1TYCA 3B7WA 3GR6A 4LHVA 4ND8A 3B1WA 2QAIA 2QSYA 2E85A 1N9GA 1KO8A 2JFXA 4JYBA 1KVRA 3IPAA 4H6WA 5LQKA 4S1TA 5ALTA 1O94D 3TMAA 3VU9A 1ZMOA 2UZ3A 2IYYA 3LDHA 4BATA 2VF8A 3HKCB 2AOUB 4AZ0A 1GFWA 5KYXA 1Y0RA 1PD1A 2GJ9A 1SU6A 2TMGA 3OH8A 4XWGA 3G7SA 1FMTA 1H4TA 1SXJD 2ZIAA 4I1OA 1ABEA 5JCJD 5D1HA 4DDMA 4EG0A 5L3QA 4OQYA 2R00A 2FE1A 5F4JA 1RMTA 1IEXA 1TT5A 2FJ0A 1KYIA 3EE6A 4I46A 4F2WA 2CYAA 2I3ZA 4NJMB 3PJEA 4CR8A 3A4NA 1NXWA 1FLAA 1ZMXA 4WA8A 3W04A 4WY2A 1GFIA 5C8DA 2YOGA 1O9BA 3TXYA 5JSZA 5BSUA 1HR0B 3IOEA 3A3KA 3OLCX 2DB3A 3EGXB 3DZCA 2AFHA 3N6XA 3C7CB 1QIEA 3L7OA 1MO3A 2Z9BA 1UOPA 4RF2A 3WA7A 5ECGC 3K1YA 1PV2A 3LPNA 1Z8HA 1U90A 3ICEA 3AHGA 1GPNA 3HVUA 2PKCA 4EFDA 3GA7A 1P45A 2ZSFA 5IM4A 3CT6A 4KVZA 3TQTA 2BJHA 2F43B 4MP8A 4TKLA 5A9SB 3L0SA 3NTVA 4UFPA 3OQIB 3VDNB 2BY4A 1YRBA 1GZ4A 2JW5A 5M34A 3OO1A 3MHPA 2ISCA 3JQDA 2HF7A 3KD3A 4ZRNA 3UWMA 3N2YA 1LJ8A 2EKBA 1GGNA 2PMBA 5FD8A 3LT5A 1Z62A 3CZ4A 4U9UA 5TB5A 4FGUA 5DI3B 1NC3A 1P74A 4NU5A 1JIXA 2AJCA 2G70A 1XTSA 3PITA 4M9RA 4K0KB 2YWFA 3UT5B 1NG9A 3TR0A 1OH5A 4A8JB 2V6FA 1P0QA 3RUHA 4DEYA 1YS4A 1XQ9A 2B1QA 3T7KA 3U60B 4HX9A 1EEHA 2OC9A 3SC6A 1G63A 2WBLC 1CLEA 1WX1A 1URPA 2JFVA 3OEWA 5SV2A 3P9ZA 4G5SA 1ENYA 3ED5A 3GUHA 4FGJA 1S5PA 2WUGA 4JK3A 3HDJA 5CW2A 1JSRA 5HWSA 5J2TA 5HQJA 3SLKA 1B43A 3ITKA 3A3OA 1A2KC 4CM5A 2RGRA 1Z7GA 5H4HA 2ZAGA 1LRLA 2J6HA 3BAZA 3I9KA 2IPXA 1Q1ZA 1JFRA 3WLSA 3EVAA 3EXHC 1VOTA 2E5WA 1ZONA 3NLLA 4KBFA 3N2NA 5FCDA 4U7WA 4IMRA 1SUCA 3ZQKA 5GONA 4LMRA 4EX6A 1EHYA 4KLNA 4OXNA 4BPRA 2DCMA 1JFFB 2DP4E 3K72B 5HOEA 2V4ZA 4BCBA 1MOZA 1Z2DA 2FPOA 3WRXC 2JAUA 5E4TA 5EFOA 4LF5B 1A82A 1KOJA 4RD3A 3KT3A 3SBDA 3TTUA 5EJMA 1OXXK 4B33A 4YAGA 1RWBA 3HC7A 5B3AA 4YPVA 2A14A 3IAAA 4IDFA 4V1CB 3VMFA 5A7GA 4CKEA 1BVYF 2A1TS 1PGPA 4QUDA 2BFDA 1DQZA 2E4AA 1JQJC 2Q0SA 3A0RB 4X9XA 3R7SA 2NPFA 4FS8A 4H15A 3SYKA 1E59A 3C6MA 3QKSB 2BF7A 3GJYA 1PUXA 1DQRA 3RVDA 3W6PA 4C1BA 2VYFA 4D8TA 5B2EA 1SUFA 2Y05A 1GYPA 4QOJA 3KDSE 2D5AA 2J4DA 5AH0A 1PZGA 3NUZA 4HQNA 2IEBA 2GTHA 2VT2A 3Q6RA 1MC1A 2H54A 3EWAA 2G1UA 3LYHA 4EY5A 4BMSA 1CC1S 3TFQA 3C85A 4CLDA 1E92A 4WERA 3VI3B 4P54A 3MWFA 5I8ZA 3PT9A 2ADFA 1EXMA 1XVTA 2WJYA 2ZYGA 4HV4A 1T5IA 4CM4B 1Y3BE 2FPIA 1VLOA 3QWAA 4P93A 5F76A 2X4IA 7MDHA 1RHKA 1T36B 2F3PA 4NFHA 3MT8A 4L7VA 1WEHA 5FIUA 2RAFA 1RRFA 3C43A 7MHTA 3MNFA 1Z2OX 1M8JA 2AC7A 2DH6A 2YXDA 4TTPA 4DQKA 4GD3Q 4CM1A 1HG0A 4OX9B 1U0FA 1UQUA 3CLTD 3HCRA 1NRKA 4UZFA 4KJZA 4IQ4A 5F21A 4RABA 3TL3A 2ZATA 2EXXA 4JJIA 3VTAA 3I9V6 3RVPA 1H5QA 3JV7A 4MDYA 1N8KA 5CXXA 3E5MA 4LJ4A 1MOPA 2GZSA 3QBTA 5EL0A 4PN7A 3ZDFA 1ZCZA 2G08A 2GO7A 4W1SA 5SZJA 4W7SA 3ZKAA 5FPKA 1R0RE 5NLLA 3FDXA 3WGIA 3W3AA 4WLFA 4KQIA 3RUDA 1XMVA 4Y1RA 4WESB 3L6RA 1Z2EA 1Y8RA 3TOZA 1UDWA 1SBYA 4UNQA 4D42A 1US8A 2XZTA 4P22A 3SYTA 1D4AA 3DUFB 4R83A 5FTMA 2XVAA 3IPCA 3NU1A 3CA8A 4YUYA 3LUHA 5DMXA 4KSCA 4WY8A 1Z4IA 3CLSC 2K6GA 3TQSA 3FE2A 4ALNA 4UCFA 1VGQA 4BLTA 3MGBA 4XQEA 1SVKA 3DMHA 2WT9A 5DM2A 1KERA 1KPGA 5ECWA 4IFBA 4F96A 1PJ7A 4HEA1 2HLNA 4DWWA 3V2IA 4B3FX 1DX9A 1QH8B 1CR4A 4OB7A 1DGQA 2KBFA 1Z38A 2XVMA 2ZSIA 2R85A 2FG7C 5F2OA 3B51X 4MLDA 4GKJB 3QLUA 2JS7A 5G0TA 3K5HA 1MEOA 3KOOA 4A0QA 2CV1A 4XQCA 3HN2A 5C51B 4OX9Y 3CRRA 2D7CA 1RLOA 3FZGA 1XCOA 2LKCA 1B76A 1M7BA 2F6RA 4N12A 2FN8A 4MYRA 5AKJA 2VTKA 1IQRA 2VO1A 1JTVA 3LP5A 4WZAA 1WPQA 4GSYA 3KBOA 3MXOA 3LH5A 5CLGA 1M5RA 2Z5FA 1R5OA 4HDKA 4MVJM 5DKFA 1AS2A 1KE1A 4ARZA 3KJGA 1ZA1A 2G1JA 5AKHA 2I6UA 3CW9A 2O2CA 5AVSA 1D0IA 1QANA 2P2CA 1YR9A 1AU9A 4W4TA 1JU9A 1OXUA 2FZKA 4Y0NA 3TOXA 4ZYYA 1QC5B 5B36A 3CVXA 1VQ6B 3AUSA 3ESDA 3JWIA 2V5VA 2YNMA 4E15A 1Y33E 2O3RA 1RQPA 3K73O 2Q99A 2DT5A 2Z2YA 3C98A 3T3OA 4AJ1A 4BTEA 1SY7A 2XUIA 5LZ8A 2Y4NA 1WAMA 2VEDA 5A03A 1JDJA 3ZGLA 3C3DA 3LHKA 5DX1A 1M76A 1X8XA 4X8OA 2WSBA 1UXOA 1YZHA 3V55A 2A30A 3LI2A 2YICA 4OH1A 1XD9A 1JJ2B 3TO5A 4C5CA 3TXAA 2WYIA 5BO5A 4Z0PA 3GPCA 3A3GA 5LXTA 1GN8A 3Q8MA 1RW4A 3O93A 1RM0A 4U6NA 2VNIA 4E5DA 1L4KA 1MN6A 1OYVA 1LQ2A 1BHSA 2PZFA 4IZOA 5ERXA 2PSHA 2POCA 4MKGA 1KR2A 3SJCA 3VHRA 1L7PA 1JV2B 1EFVB 4FINA 1GPJA 1GUBA 1Y80A 1Y8QA 2BFCA 2PN1A 4IM7A 4Y0VA 1AHHA 1E3DA 3F1LA 3T06B 1T2DA 2YHBA 3CR7A 5CLQA 1DBPA 1ORHA 1TW2A 2E49A 4FZ5A 4URUR 5I9BA 5GJBA 3HA7A 4OTZA 3ZI7A 4L4UA 3GSIA 5EOVA 4CYMA 1XRQA 1V95A 1L9XA 5JO9A 4ZFNA 5IFLA 4NIMA 5DBEX 2PYIA 3EDQA 1H2ZA 4Z4UA 1UT8A 1IM5A 2XLCA 3O83A 4YMLA 5JBNA 1V26A 4WBSA 4BKOA 2VH2A 1WCYA 4TN5A 1YASA 4C4SA 2AG1A 1LC3A 1PQ4A 2YWCA 3PR2B 3AVVA 1EX6A 4HDRB 3NHUA 1UL1X 4G0QA 2LV8A 1X14A 1XMXA 1LK5A 1ZN8A 1RQLA 1QTNA 1GFZA 2HUPA 3DAGA 1X7WA 1O87A 3F47A 4RQTA 5DBHX 1RYMA 3VJLA 2VRCA 3WGKA 1D1PA 1N8TA 1BFUA 2Y0PA 2RDMA 3LCMA 4ZI7F 5I51A 3NYQA 3SSMA 4HKTA 2LRHA 4DG8A 3EGIA 2W2NA 1TZJA 1WHSB 2ZTNA 1U2DA 3OESA 1ECJA 3IEUA 4RQAA 4DDWA 4TV8B 4X97A 7ADHA 4MPRA 3V6MA 2A0YA 5T64A 4FOPA 1R4ZA 2IS4A 2XGJA 3JPWA 4G5QA 2AK2A 3GVHA 4TN1A 4ESOA 2FG5A 3QG1A 2QENA 4ARUA 3BBPA 2JK0A 1KI6B 1LVHA 5AIAA 3SGLA 2R8YA 3THSA 2I1WA 1USWA 2X9LA 1IK6A 1AF4A 1Z88A 2OO7A 3AR5A 5KJFA 1NHGA 1VQ5B 2XB4A 3OLWA 4BMVA 3MW8A 2EZ8A 4TKOB 1XTKA 4CU2A 2IHTA 2W90A 3QEJA 1KDRA 3H97A 4FHFA 4B47A 2IUFA 3EA5A 4JIGA 2DUUA 1NFQA 4M9XA 4OHCA 4REQA 3VQTA 3VV3A 2EFHB 4MQEB 2NU9A 4YJDA 3ZK7A 1ZEJA 4GZ3A 2O7RA 3DM9B 1TCBA 1A7JA 2ZWIA 2Z1MA 2JGIA 5KYYA 4UTOA 4HNUA 3EQ7A 2VQEB 4MB2A 4DPMA 2FW9A 2OV3A 2JEZA 2VCEA 5DCUA 1YJCA 3BD9A 2CLHB 3EXIA 2AN4A 5B30A 4XE5A 1VKNA 1ZK1A 2V0CA 2WW8A 1RI5A 2ZXIA 3QVTA 2Y66A 1JPVA 3E82A 2MU1A 3KZOA 2BF4A 4Z3DA 2FFAA 2C9YA 3S2EA 1DXHA 1NQVA 4AO6A 5LKAA 4H4CA 4NMLA 4BRWA 2RHHA 3S3TA 3BWYA 4REMA 4WT7A 3BRWD 2X6XA 3SS7X 2JI6A 2IS2A 3LQEA 2PA3A 2RGBA 4UUOA 4EGAA 2P9TA 5K0BA 1N0IA 2HM7A 1B6SA 2GEUA 2O8NA 5ALOA 3HVKA 5DXJA 2NUAB 3T3EA 4ZT3A 3I4CA 5GADl 2H0AA 3CSSA 3EZ7A 3MCWA 4KOEC 3R8CA 4C6TB 3PUNA 3PHLA 3EXAA 1C9EA 1J2RA 3OCCA 4MYSA 1FIUA 4D26A 2IYTA 5LZ9A 2A84A 2FG6C 1THGA 3I62A 1Y42X 3GVPA 1DBSA 1HDOA 3A4VA 4KFCA 1F9EA 4MLCA 1IXKA 4Q03A 4JJ6A 1ZFNA 1W1UA 4XDZA 4C07A 2BTOA 4PPNA 4B3MB 1TKCA 3LP6A 4KQHA 4IMJB 2P6NA 1MGOA 3BD6A 1WNTA 2QAJA 4WCVA 3GJ3A 3W2GA 3DOOA 1W4BA 5HJ5A 6ABPA 4HVAA 4P6YA 2QIPA 1YOVB 3DULA 3K0FB 2CV0A 1N2SA 4KKUA 4ARVA 4R2HA 5AW6A 3L1HA 2HADA 4ZT2A 4H2DA 2CJYA 4D02A 2J3KA 3NG1A 4AKEA 3X2SA 1XLWA 3F7OA 4EDHA 3V1KA 3ETDA 4KDEA 5JNVA 3NDBB 4U2CA 4X41A 2GN8A 1KMNA 2O7VA 1H2FA 2DEUA 2I34A 2XNDA 1YB1A 3E35A 3HACA 4JLBA 1W4CA 4BNGA 5D3MB 4A6EA 4E13A 2VSFA 1NX9A 3AG5A 4IDEA 1U2PA 1Z3CA 2VJYA 4LSGA 3SJAA 1QVVA 4M88A 2ES4A 3ESRA 4TZ6A 3VNBA 3PQ3A 4EZEA 1RQGA 1E5QA 4B43A 3T0FA 3ZTYA 4LDAA 1HYBA 1I24A 1L7DA 1SPXA 3FNIA 3FWYA 1GUAA 4NMXB 4MRAA 4XGKA 5DYIA 4V24A 3NWEA 1E2LA 2X8KA 4M86A 2QT0A 1WZNA 4FT2A 5ALWA 1I7PA 3PNBA 3AVTA 1QHEA 2F00A 2VUHB 3BMQB 2B20A 1NT4A 5KCMA 4LBVA 3I56B 3C5WP 2HREA 2V1UA 2OKCA 1ZUNB 2DCUA 1AS3A 1Y0BA 4KTVE 4R8RA 4EUSA 1M7GA 4XAQA 3KTAB 1BD3A 1NULA 1BMFD 4B3HA 1KY3A 3B2NA 1V2GA 5A4KA 3IP3A 2BEWA 3R75A 2OG2A 4RPJA 3WWYA 1GTRA 2ODEA 3QLEA 4OYRA 1EDOA 1UUFA 5ELMA 5HXBA 3L8MA 1H93A 1TPYA 2O54A 2WMNB 1U3WA 2ZBUA 1YACA 4U0KA 3T7IA 1VRCA 3A1WA 4UHEA 4YEDA 1TEVA 2IYSA 1G7RA 3UOAB 1AQLA 2CF4A 1L4MA 4RD1A 4IQ0A 3UBTA 1XXHE 2AFIA 3BWMA 2J6BA 3T4XA 2A9FA 4GL2A 4MVJP 1ZIOA 3QX3A 1CV2A 3IAEA 1BWRA 4K28A 3W4IA 3ZCRA 1QRUA 4YR9A 5J4KA 4DRXA 5JAPA 2WPDD 3SQLA 4YAKA 1K4MA 1DQYA 2A57A 3CLUD 1O6BA 1ITZA 1KBOA 2XUGA 2FUG6 3LX6A 1Z0UA 2AOVA 3HL0A 2VUTA 4DDVA 1JEAA 2F1KA 1AO3A 4DQLA 4CCYB 4WKPA 5KIAA 2GEBA 3KJQA 1T5HX 2ZJ7A 3VYRB 3JYPA 2YASA 1ZVVA 3GLIB 1DCKA 3L5KA 1EMDA 2BH2A 1FFDA 2Q5CA 1SG6A 3ABRB 3IBCA 3JARA 5EPOA 2WJAA 4F93B 4RULA 1W5FA 4Z3OA 1WZUA 2BFOA 5FX2A 1N5DA 4FD3A 4HMPA 2J8ZA 1QH1B 2AN9A 2AWOA 2YWBA 3DWGA 2P6OA 2VSQA 3NOQA 4LOJA 4M9SA 4TWRA 4X1KA 3TI7A 3W3ZB 2OZPA 5ICCA 2YFQA 1QYIA 2I3GA 3OZCA 3WYFA 3FSGD 1GG5A 4UNPA 3CCRB 3D6MA 4JGIA 5DFAA 3W9YA 3WAGA 5AD1A 3AEUA 4TS4A 3VOSA 4NU0A 4BXOB 1TZ2A 3LUFA 1PJ4A 3CW8X 4BO1A 3K9LA 4MYCA 2YVLA 4J3NA 4IL5A 4EVQA 3Q9UA 4YALA 3CONA 4K9NA 1V96A 1X38A 2I8LA 5COQA 4D41A 4RVDA 4L57A 4XEHA 2AJLI 3A31A 3TMKA 4EJMA 4ZTZB 2VF5X 4IDQA 2I2WA 5C2JB 4FR5A 2XMBA 1VQ7B 3GQVA 3HSKA 4MV1A 4KO2S 2PUAA 4MB0A 3LO8A 4KAJA 3C6KA 2YN2A 2ZROA 5DTJA 3NZEA 2OGUA 1OFVA 2QY9A 4TX1A 1R1DA 2JGDA 1E1DA 1RYZA 5A5FA 1CQIA 3Q12A 5CNIA 1TO1E 1U6KA 4E4TA 1ESNA 3WQQA 1HEUA 1VI5A 2WF9A 3TOCA 3PQDA 1EK2A 1I3MA 3A1CA 4MPDA 4MW9A 1J23A 3DD5A 5TQJA 2OQVA 3MELA 1N5OX 5EP4A 1QCCA 1T8RA 5E9AA 5IULC 3OT5A 5LBTA 4CLRB 2X0IA 5DH9A 5TARA 3MRVA 3OOHA 3MEQA 2X0FA 4KI7A 1WDKA 4M8NE 5H81A 2X8LA 2HHHB 3QX9A 1AHIA 4Y7DA 2CY0A 2FSFA 1PIWA 2WAOA 4YT8A 1R6UA 3A2KA 2F4VB 2Z3WA 4WJKB 4ZJYA 4JBHA 1U31A 3FJOA 4R71A 3RJ9A 5GV7A 2QTCA 3VNAA 4TKVA 2D7JA 1P3JA 1YI2B 2EX0A 1ODLA 4OLHA 2QUKA 3HKCA 1DRJA 3TR5A 2J32A 4ARBA 4BKRA 1NVGA 1VPTA 3C3BA 2P11A 1P0MA 3RFVA 3QBVA 5AK6A 5F23A 5E9WA 3JRXA 4AZTA 4LJ5A 3TGWA 2EZ4A 3DEFA 1ZIXA 1IEQA 3SI7A 2FCRA 4EOGA 3ANLA 1G8PA 3RGGA 2IHNA 3O5AA 5A3QA 5K0FA 3KVNA 3LWNA 4Z0NA 5I7SA 1XZJA 1U2EA 2EWMA 4NJMA 4X61A 4CZ2A 2FNAA 2VL7A 3VDMA 2VYNA 1P73A 1S96A 5AW7A 1YC5A 3FZNA 4BTVA 2G25A 3AIKA 2VBSA 1YZLA 5KNCH 1PYGA 5I7RA 3WL7A 2X6RA 1E6KA 1XVAA 3EGXA 3KOMA 4MWSA 1NFFA 5KYTA 1JDZA 1VLZA 2R47A 1D6MA 2QAGA 3BGIA 3FPGA 5JQWA 3EF1A 4WVLA 3SOZA 3BFVA 1P4HA 4TT8A 4ZOLB 3TVDA 4O02B 5K4GA 1AF7A 1GV0A 5EIOA 2A7XA 2F43A 3CISA 5ITZA 5A9SA 2H2AA 3OTOB 4TRRA 3JAMA 4JOQA 4GXQA 1F06A 2VJNA 4W5QA 3WMWA 1LPMA 3IOMA 4C01A 4PG4A 4ND4A 1LDNA 3HBFA 4IIJB 4DWVA 1HI9A 4B34A 1R64A 1NT2A 1JWBB 3DDSA 4KO1S 1C8VB 3C41J 4O5AA 4HNRA 5DI3A 1T9AA 2E48A 1JALA 1T13A 3PXDA 3TKAA 5MN6A 4G0WA 1U4OA 4LY9A 5FWAA 2B36A 3R8FA 1VF7A 4FYHA 4A8JA 2QUZA 5EJGA 5FLEX 4EHNA 3ZOZA 3R5JA 1H2EA 4CT0A 4D3FA 5HPYB 1EQUA 1JQBA 1K86A 5BSFA 2FUEA 3MBKA 4WZEA 1AQ6A 4EKDA 1RI1A 1JQKA 5DYTA 1E3WB 3KL2A 1FFSA 3STHA 3P2MA 1B8UA 3UV6A 3ZCVA 3DDYA 2QVXX 1NLUA 1XFOA 1C3OA 2JFBA 4W5HA 2JC3A 1JF8A 1I7DA 4AY4A 4L78A 4CDMA 1TJNA 2OO5A 1NUTA 1Y1SA 2P9YA 1YZQA 3E81A 3N8KA 5ERYA 4TSKA 5JWRA 4RD4A 5T6BA 2OCGA 3BWCA 3OECA 1MQAA 1M75A 4C20A 1QDUA 2BM9A 2ONZA 2PANA 3H0KA 3H9JA 4V39A 1NN5A 3ER9A 4G5YA 2V7QD 2O7QA 4EL5A 4NH0A 2FCAA 1VCHA 2JA1A 1I9GA 1Z0ZA 3FHLA 4W9RA 4XVHA 4RF4A 1JFFA 5WRFA 3SC4A 1LWOA 2GXQA 2P9BA 4EAQA 4AG3A 4M2LA 2Q3DA 2NO5A 4WZKA 2VHXA 1TM4E 1XKLA 4K9MA 2X1HA 5FOTA 4I50B 3UAXA 1RYFA 5I8PA 3D2LA 3R5XA 1K9MD 4HATA 1AQUA 4CG0A 1BGVA 3NNNA 3ZWCA 2XOKA 1SZDA 1YL5A 1WCIA 2VP9A 3V7NA 1S2GA 2RGNC 3VPAA 4V1CA 5AKIA 1XMPA 2CW5A 1Z4KA 4TXMA 1JXQA 3CBGA 1X0VA 4P0TA 4ZAYA 1PJ5A 1MVNA 1SOUA 2HQRA 3RDPA 1RMYA 1MQSA 2CNNA 3LNCA 5HE9A 1K7EB 4TQGA 3DMYA 3QITA 5C3UA 3BMCB 1HL3A 2XKKA 3OKFA 1LXCA 3T3IA 1Y3HA 4AJ2A 2GZMA 4EZBA 4UUPA 3TSOA 1EBUA 1XZFA 1VG9B 2EKZA 4E5PA 2Q0XA 2W2KB 5BW8A 1K75A 5JAZA 1N2JA 4RKWA 5CD9A 1E2IA 2NTNA 2BDUA 3P0IA 1FSGA 4RLFA 2XCSB 4RDIA 2NXNA 3EWIA 1D7OA 3OT1A 3QVVA 4FE3A 4OLAA 1CQJB 4Q24A 3W5VA 1Z6TA 3EH1A 2C7GA 4YMVA 2BEUB 3FPBA 3JYQA 1E2NA 2IOQA 4GFDA 1CUFA 4RK7A 2AJTA 3ZWPA 4CM8B 5JC1A 1PJ2A 1T36A 4LJ6A 5T6MA 4K9SA 1Q0UA 1ZCBA 2IUYA 5FNVF 4G5GA 1JQEA 3KV3O 4DA8A 4EG6A 1PQUA 3OF3A 4UTVA 2GPAA 5JJLA 3H5RA 3PC3A 4R54A 2XBUA 4PR3A 5AR1A 4MI9A 1RWOA 1L7XA 1EE9A 2UVQA 3BCSA 2QBYB 5DYGA 4QBIA 4Y1FA 5KW9A 3A9WA 3WDMA 5JALA 3O8CA 5J9FA 2PRZA 4LYHA 4DUYB 4AKGA 2FPRA 2BGUA 4UASA 2MJLA 1IEVA 2HMWA 2CHEA 4Z4WA 5K3EA 1N32B 3I9V1 2TMDA 4DL9A 2C2YA 4KR6A 2I6XA 1CKEA 1MAAA 5CVUA 2O7NA 9LDBA 2LIVA 1QO7A 1VHTA 4BS9A 5JV5A 3PR1A 4B8YA 2YWDA 2R7AA 3HY6A 1M83A 2P8JA 3HR7A 4WESA 1PK9A 2V8OA 1L3CA 4IWXA 3WSVA 1O4WA 1J0DA 1P7ZA 2CVOA 3X1DA 2GFQA 4NPAA 4O4IF 3TN7A 1D2EA 2I6FA 2H4FA 5EXPA 3UXHA 3K09C 3MQ4A 5DM0A 2L0XA 3M6XA 4RM0A 2YCLA 3AHDA 2J5BA 3PJFA 2JAPA 4MWGA 4R1UA 1ODTC 2VHWA 1YDWA 2ZUBA 4WLOA 3TD9A 4BAUA 3AI1A 3FB1A 1CJSA 3MD0A 1VQ1A 5KPJA 4PYOA 4F9FA 3U48A 3WO1A 1L4BA 2RH8A 3H8JA 4BMXA 1KEVA 1QP8A 3NTUA 1C0EA 5EZSA 1P1BA 1T4MA 1XEWY 3FTEA 1UD5A 5DGCA 1LDEA 3QK7A 1W49A 1YIJB 3QVOA 4R7ZA 3SJ7A 1RJGA 4EABA 2ZL6A 1OASA 2YRFA 2PYZA 3IPRA 1I80A 4BAZA 4BLQA 1L8QA 4K6OA 4R8VA 3Q3JB 5D5HA 1PZXA 1VYVA 1XQ6A 3V1UA 4CMHA 3WTCA 4LBWA 3EIOA 4DR3B 2C4MA 1DG9A 4IIEA 3GLGE 2O07A 5L7TA 1ZD8A 3GXOA 2B4AA 1GPUA 1T6BY 4C29A 1QZUA 3H87A 3IGFA 4OU5A 3KAKA 4ENTA 1YDHA 4I9UA 3TYXA 2XA1A 3KCNA 2PMEA 3I5AA 4RTQA 1M1YB 1VCIA 2G8LA 4S2EA 1LBIA 1G8KA 4RSGA 3TTVA 4PHHA 1QWSA 2ZBVA 2H4WA 1I10A 4ND1A 3W5UA 3H3JA 3PHGA 4KGVA 1QC5A 2VTDA 3RB8A 4MAAA 3WMFA 3CH5A 4ZYVA 2MSKA 5A88A 1G21B 1CPYA 1G6KA 3BXGA 5AHXA 5E1OA 1T0BA 1G1AA 2XWQA 3LY7A 3WK4A 2IPMA 3U3DA 2IKSA 3GRRA 3JQEA 4R98A 4L9WA 1BXGB 1FEZA 3E2PA 3RAPR 5EIBD 4G5RA 4DIFA 5FUQA 3OZFA 1DMRA 3KEWA 4ZJUA 1AZWA 3ZHRA 3H8VA 3X2FA 4ES6A 3X1MA 1BVUA 1LS1A 3NWOA 4KQJA 2CHFA 2NT3A 4NG5A 1CUXA 2EW1A 1HMPA 3JSXA 1SCNE 5B55A 7REQA 1WCWA 4H77A 3CCSB 1XZGA 3UKJA 4OHWA 5JCOC 1WU7A 1FXSA 2A78A 1E7WA 3WK7A 1XRSB 4TWIA 2J31A 1P4AA 4TMTA 3TL6A 3P9RA 2GPNA 5DVZA 2EL9A 4GOOD 4PZZA 4WOKA 1C7ZA 1EFVA 1T8SA 1A5SB 1ZH6A 2BWJA 3GHYA 3JRWA 1E3XA 4EYQA 4Z5XA 1UC5B 2QLNA 2JAOA 5BVHA 4OJMX 1NW7A 4P58A 4J76A 1OXSC 3N2KA 4AIRA 3C6ZA 4FFSA 2GRAA 2HF9A 3VPHA 1KYXA 2ODQA 3KR1A 1Y3FE 5D5PA 4G2TA 5BR7A 1NURA 3A6PC 1WPGA 2OYSA 5JRZA 2Z4RA 4X20B 5JTTA 5DN6A 4C4XA 1LTKA 1J0XO 3PFWO 4QYSA 5DBIA 4DMRA 2XRFA 2QZSA 3EQZA 2G77B 4GVXA 4Q34A 4TYPA 4ZVKA 5D8DA 4E5NA 3ZHVA 5JS2A 1SCJA 3K71B 2XXAB 2R1UA 3NAQA 4G1BA 4HDRA 4IR7A 3RWOA 1E9FA 1XN1A 1HT1E 2HA4A 3KJFA 4WXRA 2HNBA 3K70D 4BBJA 1XDGA 5IC4A 3UMYA 3AYXB 2K87A 5KX5F 4MW5A 3N8DA 5ICSA 1EUZA 2G76A 5GWXA 4B7CA 1B26A 1N78A 1W5AA 2RIRA 1UOEA 3AC0A 3LBFA 1RIIA 2Y3IA 4P5DA 4P4TA 4TV8A 5K3SA 2XUKA 4C03A 3FIJA 4YQFA 5CLFA 4ZHQF 3JQ9C 2I03A 4RSRA 4PLYA 2ZG6A 3L05A 4CTKA 4O1HA 1KFKB 4QFBA 3IQEA 1UBSB 2GCIA 3NRCA 4JJKA 4JMPA 1JHDA 3W2HA 4D1YA 1V1RB 4NYMR 2HMAA 4AJ4A 4G0YA 3CB2A 2JVIA 4TL6A 1G55A 2CFTA 3PC8A 4BRUA 4R9VA 5EUBA 3K0KA 1N7HA 1ZMBA 4F5EA 2XB2A 3V7WA 3V7YA 4HYQA 1UFRA 2ZSKA 3PRHA 4NICA 4JR2A 3OZXA 4MQ6A 3TDNA 3ZCSA 4BFZA 5JCPA 5BSGA 3SLNA 1T0PA 3H2BA 4Y9TA 1HZZC 2GFHA 4MQEA 4EKGA 2ZJ8A 4I3GA 2G5CA 2DY1A 1U1EA 3DWEX 1TU0A 3O8OB 3PQ4A 1ULAA 1U0SY 2Q41A 4QGFA 3B1FA 3GUVA 4YT2A 1YB2A 2VSYA 4UMEA 3P2YA 2PKEA 1H8HA 1JXAA 3G68A 3A36A 1UBUS 4FEGA 4IPTA 3X1KA 1X7XA 2CDBA 1XK7A 2WK1A 1G2QA 5FOVA 5FEUA 2XMGA 5AK0A 4A4DA 1WDLA 3KR2A 4PRKA 1AXRA 1FBTA 2R8BA 3KJNA 4QHSA 4X71A 2W2MA 1MB4A 1NV9A 3DZ8A 3LT4A 4OA8A 4PCVA 2BMAA 4R1SA 4UM5A 4B75A 2FSUA 3NDPA 1DX6A 2H5JA 2PM8A 2XYGA 1SNYA 2JAWA 3D3WB 3KPJA 1PBNA 3QF4B 3W9SA 2VDRB 4JMQA 4MYUA 1AN0A 3PIRA 3W34A 4IIHA 3STTA 2JJQA 5HP4A 4QVJA 1IMJA 2PRIA 3ROQA 3AUYA 5F98A 5D86A 3TRIA 3AWDA 1OHHA 2OD9A 3ETNA 1I7LA 1XC7A 3C7TA 3EF3A 3RE1A 3WKCA 4C6TA 5IT0A 5JJIA 4GS5A 3RAJA 1OXTA 3CV3A 3NHFA 3NMUF 5HF6A 4BEWA 2ILVA 5E38A 4INZA 1RWNA 2BHTA 3UB2A 1T5DX 3LNTA 4MA4A 2QE7A 3MPOA 1XNRB 1GARA 3HMQA 1YBAA 1VM6A 4RDXA 3NT2A 2JD2A 1PWEA 4CQMA 5A06A 2YOFA 1QKIA 3VZRA 2BR5A 3W5HA 2PGNA 1FFYA 3OP4A 2Q3FA 2EC5A 3BWXA 2ZT7A 3TW8B 5TV2A 3K0FA 1YOVA 2VXOA 4JT2A 4MB6A 5H83A 5LL6P 1F8FA 3L46A 2MYTA 3LXRA 5KREA 4XCXA 3OPNA 3BDIA 1UKEA 2WU0A 2HMTA 4HH4A 3U49A 1WDWB 3UHAA 3I6IA 3P0JA 5I9MA 5LQDA 3BT7A 1N0HA 3BMNB 5CA0A 2JI7A 5F12A 3ZX4A 4R2KA 4YUZA 5LFAA 4YCSA 1G5IA 1JG1A 2FEMA 2VG8A 1QIKA 3EVDA 1T8WA 2IP4A 2QXTA 4OHUA 4PICA 5JBIA 3A6JA 5D3MA 1THZA 2JARA 3BJZA 4JC5A 3TLAA 4XM3A 4PSUA 1CUUA 3GHHA 2FPPB 3K16A 2PFSA 2R7KA 4DGSA 4WDQA 4EYOA 1J39A 2VUUA 3ZJUA 4N76A 3ZPNA 1JQ3A 3RK4A 3AINA 2PMDA 3FOAA 1MC4A 1K0UA 5HF5A 4DADA 1G8HA 1LDMA 1W9MA 1YMUA 2I2FA 3M1YA 1DHTA 3HB7A 3FCXA 4JLDA 4IGFA 4ZEWA 3TOVA 1T1EA 1JJAA 4YLGA 1KAEA 1Z47A 3X1ZA 1Z7WA 2ZIGA 3CCBA 4JU9A 4NZZA 5AKYA 4BLRA 4HBGA 4QU9A 1SHJA 2OLKA 5LQMA 4QLAA 2QORA 1OWOA 3CRNA 5F9FA 4XVCA 1U8UA 3QUCA 2AUMA 3AILA 4OF4A 4QKQA 5FB3A 3JW8A 1ZUNA 2Q49A 2ZT6A 3VSAA 2LE0A 1NONA 2D54A 3KTAA 2TMYA 1BHQ1 1YJ8A 4AWBA 2X8WA 4DNPA 1RZ3A 1YT5A 4BFTA 1F2TB 5HKOA 3ST7A 2RKWA 3MTEA 4FJ1A 3O1LA 4WK2B 1U7HA 3GGDA 1DJOA 5BN5B 4NXNB 4ZTBA 4WXYB 2AKYA 5C31A 4OIFA 4BE7B 3DLTA 3KVOA 2VDOB 1HY3A 4PLGA 4M0CA 5CIWA 1DP4A 3D6VA 4FZJA 4U2BA 2PU7A 4BX2A 3P7MA 1I3LA 5A4MS 1O8BA 4B3SB 1YQ9A 3PRYA 3IJEB 3M6WA 4F4DA 1W35A 1T9DA 4BX3A 4C0HA 3HDGA 3RAFC 3CCEB 3FSEA 4DDKA 2ZBRA 1TJ4A 1YV9A 2RGGA 1DOAA 3F46A 3RV4A 4S0XA 3IAM1 4IEEA 2C3OA 3U7IA 1PJAA 2I1LA 2D4AA 2FUG1 4MV9A 5CM9C 2XDAA 4OJKA 3RTAA 4WBNB 1D2AA 3I32A 3T51B 2FWIA 3DT8A 3O8NA 4P86A 1FQOA 2JAXA 3E22B 4Y9DA 4YB8A 5GJCA 4F3RA 3UAOA 1GM5A 1V39A 3VTKA 4MRPA 1N5MA 3U4HA 1SH7A 1XQYA 1QU3A 4OJTA 1NR5A 3WB0A 1JG4A 4G0OA 2C61A 2GCOB 3H9CA 5EKSA 2PUEA 1QH1A 3HTXA 2ZE7A 4LE1A 1TAUA 3CPWB 1W7AA 1SN7A 5L3VA 1DAIA 4KYVA 1RJ9A 3ANXA 1EM6A 3D4PA 1L5HB 4WH0A 1G20A 1RJEA 5C5CA 1VLQA 4NV3A 4V0OA 4ZU6X 3KAJA 3VISA 5K4HA 1QOPB 1W4RA 2QJOA 3TQOA 4BXOA 4LRYA 4EQZA 5FI0B 1P2UA 1P5RA 1RABA 2IX9A 3DO6A 2CXRA 2JDIA 3DKIA 4TUYA 5AOVA 5FUBA 2NXCA 3EXG1 3ROGA 2WU8A 5L53A 4I9GA 4MVJE 3NTRA 2D0PB 3TLKA 1M1UA 3I37X 1KY5A 1UANA 4NDZA 3BE6A 3ZDBA 4JUAA 1FDWA 2OV1A 2C84A 2C4TA 3I52A 1BCSB 2AVDA 1FDVA 1NDHA 2FI1A 2WWWA 1NM5A 1ZVMA 3IDFA 3L9XA 4I1IA 1RRKA 2XMDA 2ZJBA 2NVUA 5KSPA 3HDHA 5ECDA 1UP7A 2HWYA 2QLBA 2XD4A 5EI5A 3D0QA 3L1IA 2FW6A 4AJNA 1VJTA 1IUOA 1KOFA 2EBFX 4EI2A 2V3VA 1QVZA 1OOEA 3WHIA 2PT7A 3WSTA 1PL7A 2P9ZA 5EMNA 5HIKA 5JZ9A 3TLBA 1JA9A 1CF4A 3HLTA 4Y6RA 3UK6A 3KUUA 4WL0A 3IMFA 1RKVA 3DAOA 2IGBA 3E9ZA 3K32A 9LDTA 4YXWA 2A6PA 3DPSA 4BKUA 4CLRA 3EEQA 5K3AA 3T3MB 4Z9BA 3OPOA 3AR4A 3WB2A 2OCDA 4P1ZA 2XITA 2O52A 4PQEA 3PXGA 3UFXB 2OXCA 2CB0A 2O1SA 5AW1A 5L6LB 4N0MA 4JCOA 3C2QA 3ZYCA 1DU4A 1NNLA 2VNSA 2OE2A 1DTSA 2E0IA 2HRBA 3GGJA 3MB8A 3FMPB 3ADCA 1KZ9A 4IDNA 1XTQA 4KZPA 2CFRA 2LWIA 3FPCA 4QQFA 1KQNA 4BQPA 1ML3A 1E77A 1OVMA 3CTAA 1QO9A 5TC4A 5AJZA 4R68A 5CVVA 4LHEA 5IT9A 4R8MA 4YRSA 2XJ9A 4C2TA 5KYVA 3ZZ1A 2ZI4A 1N3LA 4JNKA 5JW6A 2CFCA 3IEPA 3OCWA 3SJPA 4KEAA 2B1JA 3E9RA 1H6DA 2ZTGA 1JIVA 2WF6A 3O26A 1N8NA 2R60A 4DB4A 2P0YA 3AU8A 3H5AA 4KE7A 3UPUA 2OBXA 3T8YA 2A5JA 2C5SA 2DLNA 3R23A 4QT4A 2ZRMA 2R4QA 1FDIA 1F6DA 2G4CA 1NNUA 1QUEA 3W2EA 1XJ0A 3G1TA 3IEIA 1V6CA 4UDOA 2G0AA 1H1DA 4PYLA 4UPVA 4WCDA 2QVZX 3QVJA 4NCJA 1WB5A 3KQWA 1AQJA 2OV8A 3LPCA 3OZDA 1E1QA 4C08A 3M6VA 4OQQA 2VP2A 1VMEA 4JOSA 1Z8FA 2BVNA 2AEFA 3HGQA 3LY8A 1YZ3A 3L6UA 1U4SA 1HURA 2XUPA 4MGEA 3UJPA 2XE4A 4N3AA 3QFSA 5K8CA 5LZ4A 1V43A 1Q7RA 3EPKA 2O3QA 4HNVA 5IDVA 4RZXA 1OA1A 4FMDF 5EIEA 4K9OA 4GVLA 2IOFA 3EB9A 4HEHA 4YRFA 4WADA 2R7LA 1V48A 2WF8A 2BDEA 2IT1A 3H11A 4YRGA 1PZHA 5ALHA 1NRXA 4IIJA 5KC8A 4DR5B 4A8TA 2VRBA 4COOA 1QIJA 4MEAA 4XFDA 1Y7HA 3IRVA 3JQGB 3NHJA 2GYYA 3E8XA 4TSRA 4B6FA 5FLXA 1UJ6A 3IOYA 4LTMA 5CDHA 3EZLA 1U7DA 5IYNA 3EPJA 3GEGA 1NJ1A 1WW8A 4S24A 4C1NA 2GBLC 2Q3JA 2AGVA 2QM0A 1U2GC 3Q98A 5KNBH 3CUUA 3BHIA 5JS6A 5HRUA 1DCMA 1JKXA 3ICPA 1C29B 1ISRA 1E3WA 4EO9A 3MMXA 1T3LA 2R8PA 3T7AA 4UZEA 2ERXA 3HNOA 2WY2D 3GFSA 2W8BB 4Y0AA 3STYA 1P2GA 2VA8A 3DOIA 1HNWB 2I4IA 4BLVA 3ERCA 2CMDA 4CG2A 1IBKB 3FVWA 4W8GA 4D9KA 2F8MA 3MJCA 1ACLA 1F2VA 1S02A 2Q1XA 4JUDX 4LHYA 4CKXA 3UMCA 2A86A 2DHDA 1CZUA 4FFDA 1R6AA 3RVQA 1BRTA 1HQYE 9ATCA 3OLYA 4HR7A 3FUTA 2GPSA 5KPDA 3JZIA 1U02A 2ZJAA 3MWYW 3JQBC 3ER6A 4I50A 3D9QX 3N7UA 5CYGA 3IA2A 1GNPA 3OPYI 1C7EA 1DXOA 2FZVA 4D9BA 3QA3E 1WABA 4OG2A 1HORA 2SKCA 1W73A 1A9QA 4BLSA 2WA1A 4X7EA 2KW5A 1JMYA 1JZQA 2DU8A 2IOFK 1IOWA 4GO1A 3T34A 4X0EA 3X2EA 4DV1B 2BFPA 3K4QA 3LQRA 4IKEA 3A35A 1T3TA 1CIPA 3BOSA 3GP3A 1RU3A 4EHIA 2C5EA 2IHZA 4OQDA 2GEKA 1P7CA 4XX1A 3BMCA 5CB4F 1Q0RA 1V4BA 2QQEA 3KVVA 1EB8A 2LP4Y 2D74A 1A2OA 3EMBA 3HP1A 4BLUA 4DR7B 3ZZ0A 4NCAA 3D1VA 4IIGA 2B34A 2W2KA 3WL8A 5JS7A 3UY4A 1Z5GA 2P3OA 1RI4A 3R5TA 4YAFA 4N0DA 1IAQA 1F6WA 3GNQA 3RAEC 2P79A 5E0KB 3AFMA 2YY5A 2DFDA 4CLOB 4CM8A 4GUAA 3C14C 4CI9A 4BKMA 2HSWA 3G9TA 1KIAA 2JIPA 5GJWC 2PVCA 2VUSA 4HSGA 3NWJA 5FR2A 2GREA 2I3AA 4LCJA 1HNZB 3PJRA 3TR6A 3OF2A 4EYGA 2PX0A 4M0MA 1XXLA 2JCGA 4ZCQA 2QRZA 2WWVD 5CVJA 5JRDS 4XRRA 3DB2A 2QYSA 1AM4D 3EODA 4GGOA 4IOMA 2CVZA 4I6GA 1II8B 4GMFA 1AVTA 1IN8A 4YJ2A 1J00A 4N5MA 3ZYZA 5JY1A 3MB5A 3QA9A 2HFJA 4EF6A 1JH9A 4PBRA 3JQFA 1JHXA 1T0JB 4OOSA 1TYAE 1XAJA 3A3PA 4I1VA 4XOIA 3ZJ4A 3HHEA 1GZ3A 3BMOB 3BZUA 3AFNA 1GKKA 1VHWA 1JHPA 4ADSG 4L8JA 4ABYA 2O4CA 4WZZA 2HBYA 3K5IA 4I5EA 4MZDA 4GZ6A 3ZY2A 2VVTA 4EHFA 2WD9A 3NT5A 1IXRC 3VKWA 1NAHA 1H94A 4IZIA 3T1TA 4J9UE 3PHBE 3PI6A 3CUSA 1K5HA 1DBVO 2EKQA 2WTMA 2UV8A 4RQBA 4U3JB 1WP4A 3V2GA 2WABA 1J1IA 4L8WB 1BDMA 2AF3C 3WDSA 2A4KA 4I4CA 2EHJA 2IVZA 2X6YA 3L4JA 1KP3A 1B8OA 4FDAA 3EFEA 5A9RA 4Y2UA 4IXDA 2C2HA 3ZVMA 1MAHA 3U7EB 2C9OA 3BF8A 4D98A 4FMBB 1SBTA 1K8YB 4XIJA 4ZVMA 3HZOA 3QEMB 4BRZA 3RYCA 2EKLA 2O3SA 1P3DA 1YJWB 5LIPA 3O4GA 5KWJA 1I4WA 3OJCA 1J5EB 1V0EA 2P67A 3T5MA 4KUGA 1GWNA 3C4VA 3GLFE 1PKVA 4WLVA 3AP2A 4DCPA 5C80A 2YC2C 2QX4A 4HXEB 2HZBA 3DMNA 1SIWA 4RFVA 3PEWA 1HYGA 4LZLA 3HCPA 1ZK4A 3SS9X 2P5SA 1K7FB 4JL8A 2JGJA 2UAGA 3VR5H 5A3RA 3U31A 1VA5A 5ILOA 1VLVA 3HUEA 1EX1A 1M1YA 1A5BB 5L8VA 2CMGA 4Y1EA 3RH0A 5GZ3A 1OT3A 1XWWA 2JLCA 2XTMA 1TEHA 4EY4A 2R1VB 2BV3A 1M66A 2GKGA 2JNWA 4UNSA 3C4JA 3LIIA 4RE5A 1G21A 4K1XA 2ZWPA 5HNKA 3IMGA 3K1JA 1L7BA 3GW8A 3KAPA 4Y98A 4WMLA 5EXEA 3RG2A 1FS6A 4A0GA 4TTVA 4CT4B 4OL9A 5H7XA 3CC2B 1TJYA 3JQAB 1T26A 2XKJE 2GBFA 4Y6PA 1BXGA 5H59A 2OHHA 4ZZIA 3MUEA 4CKZA 5KNCA 1H1LB 2VPIA 2PD4A 2WMDA 2WSIA 3MWEB 1ND5A 2Q9UA 4OHBA 4PPYA 3NGLA 2A4MA 4F0JA 3LQYA 3MXTA 1ECLA 3WE7A 1C7FA 3A8KA 5JLJA 1ZIYA 3F9IA 4AMZA 5IYQA 4BVEA 4R8LA 4HZGA 2VDPB 4IBOA 4RNCA 1OHHD 1FYXA 5KJEA 5KTTA 1ZI6A 2ENWA 4KYUA 1FOEB 5LCXA 2DKOA 4G0UA 4U2EA 1YS6A 2EKDA 2H1FA 3JWEA 2PGLA 2DPMA 3P5SA 2OSVA 4HPWA 5L3ZA 1JVNA 3BBLA 1KKMA 2O8CB 1NPDA 4BFUA 3UG6A 1G17A 2QL5A 4F4HA 3AESB 1JBEA 2HNKA 3L4KA 3ZWYA 3FGPA 5LQCA 2ZCUA 3NTQA 5IT5A 1UBOS 4B45A 2WT4A 4INOA 4ZPJA 4GZMA 2QN6A 2IHUA 5DNEA 4LSMA 3PA2A 2CUZA 1IQPA 4AP5A 4ZI5A 5JARA 1DO2A 1E4EB 2P3QA 5FPYA 5JWOA 4YP1A 5KNDD 4ZQEA 1HE8B 1LPOA 4QGHA 4OYYA 1P0PA 1QG4A 1J5XA 2PCLA 4FDLA 2M5SA 4FMCB 2WIBA 3HWRA 4M87A 1UMCB 5F3RA 5F7ZA 3ZDAA 2A5FA 5B37A 4KXNA 4O4HF 5C81A 1KWKA 2R84A 4DZTA 4PYQA 1OYOA 2FK7A 2CXXA 4KN8A 4QU8A 3RHZA 3KLOA 5LZ5A 3ZDEA 5E6TA 1DG1G 2WI8A 3JZDA 4ISCA 4WV3A 4HFJA 5HFNA 3FYSA 4A82A 4Y67A 5JE8A 1Z0SA 4DBLE 3DBRA 4I1UA 4G7WA 1B0UA 3TLJA 2WYRA 1CUZA 3C16C 1KF0A 2H65A 1GUYA 1R0LA 3WKDA 3M4ZA 3ESXA 4PS1A 3VKVA 4HVTA 4P80A 2ZITA 1E6EA 2PQ0A 3EASA 4FKBA 1KO1A 3LQ2A 3PYXA 1WORA 4BECA 1DL5A 5IVDA 1Q7BA 3HYSA 3KHKA 1IAVA 3QM1A 3KDAA 4C0AC 2P9FA 3O0DA 1V1RA 2O2ZA 2WJGA 4BWFB 1Q74A 2AOTB 1DRWA 4GE0A 1QBKC 1LPBB 4RVOA 3TKYA 4B2IA 5HZHA 4YQYA 1A9OA 4HFRA 3U4DA 4QO7A 1L5OA 3I5MA 2X15A 3U80A 1C3VA 2P9GA 4BWGA 4LK2A 1ZRHA 5DHPA 3HP4A 4OBWA 4UXIA 2GAFA 4PGFA 3UGTA 3BKWA 1JSZA 2PVSA 3ZHSA 3IB3A 1BH2A 1Q57A 3CVJA 2B3TA 4YREA 1JIUA 2O0MA 4NE7A 2WJVA 2ASEA 2V4UA 2GDZA 4HQFA 5G40A 3O8OA 4D0GA 1JE0A 1TKAA 4KR2A 1JW9B 3RJTA 3CD6B 4P34A 3R9IA 5F9MA 3HR4A 2JH9A 3EJWA 2FAXA 2ZUCA 3H0CA 2WUWE 4LXGA 3BUSA 4NBWA 2AOWA 1KVSA 5HDBB 1UZAA 3VFDA 2XUQA 3CNLA 4GEKA 2O5CA 1LGYA 3FYCA 5HBRA 2QA5A 5ALNA 4OXRA 3N0TA 3FZYA 4LX8A 4X0CA 5THQA 1VL5A 4R2LA 4A36A 3G0BA 4Q7JB 4JYPA 3W6OA 1S7CA 3B2QA 1USGA 2QD2A 3E84A 1USVA 5HIIA 3R6JA 3ZBQA 4ER3A 2JG3A 3UK1A 3LYAA 4PLCA 4XTCS 4YRJA 3QF4A 3P9CA 4UDYX 5G3YA 2WFAA 3T1NA 5KBYA 4KDCA 1LZKA 2IWHA 2IA5A 4UUMA 4ZRDA 2PSDA 2KJQA 4YO7A 4WASA 1VCMA 2FZCA 2XUJA 4Y18A 2ECPA 4K3VA 4B87A 4H7FA 2FHSA 4S1NA 2JI9A 4RIIA 3JS5A 1BOFA 4XFKA 3U7FB 3KB1A 4HWOA 5IM4F 2QYHA 1E2BA 2IJGX 4LOHA 4OLBA 1AUXA 1VTKA 2QK4A 2N42A 1DAMA 2R11A 4R3UC 4DAOA 4O1IA 4UNIA 4GOKA 2C54A 2QP9X 4LPKA 5TGZA 1DNPA 4CM6A 3KOXA 4LWOA 1NF8A 1U1GA 2X5NA 2CXHA 1JJIA 4FFPA 1HF3A 3PUIA 4N7BA 1IN1A 1Z17A 4LPSA 4LHSA 4JLAA 2B4TO 3EY9A 4P82A 4PTLA 4V02A 4K6MA 4MI3A 1ODIA 2OCYC 3C3CA 4E09A 1XAGA 3RREA 3K4PA 4QQRA 4ZXFA 3IMCA 2OBLA 1IULA 3H18A 4Y6GB 2BUCA 4E12A 4WXPA 1AKNA 1JILA 2CDCA 2Q8NA 4KK4A 4N40A 1QK4A 2BZ1A 4YRCA 2X3YA 3RYIB 4LYFA 2HT1A 1JQAA 1E3ZA 3BMNA 1S9DA 4RV5A 2GUGA 4N9QA 3RBAA 1VFPA 3ONYA 3A9CA 3PUWA 2O1WA 5TRTA 4KIJA 4Q3KA 2D59A 2Q2QA 2WLTA 4BZQA 3T5TA 2ZTSA 2DE0X 2N1BA 2Z0MA 3BF7A 2Y92A 2IYAA 3AL2A 3C15C 5L40A 5FBKA 3K05A 3QQPA 3UXYA 3CEJA 4WN3A 4BIIA 2CD9A 5EJ6A 3I61A 1JBQA 3ANTA 4RY8A 2DMRA 3HDQA 1UIRA 3R3HA 5GONF 5IARA 2NV6A 3BFJA 1BHJA 3FCEA 3I2JA 3JCZA 3O47A 4G81A 3DMTC 4II7A 4LVCA 3GRCA 4RPHA 1X42A 3ZHQA 4N3BA 1YIOA 3PXBA 4J75A 1OGIA 2JLSA 1PEDA 1H0RA 2CLOB 2H1LA 4I7EA 4F06A 2EP7A 3CYFA 3PSAA 1BFKA 3FTDA 4QRDA 4CNBA 2HJHA 1UEIA 3IQZA 1OV4A 3RAGA 2Q6TA 4JJEA 3R6LA 3ZHBA 4JJ4A 2H0RA 4XXHA 1HPLA 1T10A 3F3YA 4YLEA 4UBIA 1DCTA 3N1UA 2A5DA 1C4KA 2J9RA 3U7RA 4YV1A 5HEKA 2C98A 1LLCA 4C7VA 1YQGA 4LJYA 4RADA 2G17A 4O8CA 1JJ7A 1F2TA 1JHVA 4QICA 1F6BA 3UH0A 4FI3F 4F85A 1TXGA 2GBCA 3FKSA 5BN5A 5BNWA 1O94C 1PG2A 3IPLA 1Q14A 2C57A 5K3BA 4W9NC 1SK8A 2X4GA 1PT8A 4OOVA 1E2MA 2OV4A 3G3EA 3IUYA 3T3GA 1OZHA 1Q3HA 3NKFA 2H31A 4D3SA 3ANSA 4AKIA 1SXJC 2Y6VA 2PSSA 1QE0A 1XEXB 1OBOA 2YRWA 3AKEA 5J47A 2XDWA 1LJUA 2ONYA 4ALJA 4L6IA 3I73A 4GP7A 4EHBA 1E0KA 2MSDB 2ZANA 4J0GA 4WXHA 1T0IA 2OD2A 4AO7A 2RK6A 4B7XA 3VSDA 5FTLA 1YZVA 4JEHA 4RU1A 1PNRA 3OEEA 1NXPA 1LJLA 1OB5A 3KLBA 2IPOA 4OJNA 1KFBB 3QUBA 3GFRA 5CM8B 3QFCA 2PZKA 1Z6AA 4ZMBA 1M2FA 4MKXA 2QDKA 4WBNA 2HLDD 3RTBA 2GXSA 2WHXA 3UT6A 2OBRA 3E22A 3SZUA 3W6UA 1M0WA 4HB0A 2BKVA 2JD1A 5HZAA 2PX5A 4OI1A 2ST1A 3BGWA 1DWOA 1CY6A 4QSMA 2B98A 2ZU6A 4S05A 3KPUA 4IDGA 5IT4A 2XRZA 5ENVA 2GCOA 2O06A 1DKUA 4XRGA 2V7PA 4ND3A 1I3OA 1LDGA 1MFPA 1TNDA 3FBGA 2IYFA 4N5NA 3GVXA 4CEJB 4QUHA 1LNQA 1L5HA 4DB2A 2PUCA 1DWUA 3O38A 2I2AA 1P6UA 5MN4A 4IJMA 3AP3A 3M5CA 4HXYA 3QW4B 2IPNA 4HLDA 2DBVO 4R81A 3RCBA 3X1XA 4H35A 5JEEA 2WWIA 3RKRA 3Q9NA 1HDYA 3FGZA 4KQ6A 4E5SA 1MOSA 1DEKA 1YH3A 1LDYA 2AQIA 1YCFA 4ME6A 5FADA 4RUKA 4J0DA 4RMHA 2P62A 3E3MA 1MJ5A 1PW7A 2P90A 2VJKA 1BCSA 2WSYB 4E51A 4OQZA 4UZUA 1QOQB 1P3Y1 1W6RA 1E2JA 4NBLA 5EQJB 1M2JA 4W6QA 1CDDA 2VAXA 3WKAA 2Q28A 2DWQA 5ARBA 1P2TA 2EYUA 4JYAB 4I2NA 5CJJA 3I6BA 3THYB 5DGXA 4AJLA 1Y1KE 2HO5A 3JTMA 3K9WA 1XOIA 3I0NA 3ORQA 3ONNA 4JJFA 4MS4B 4XIYA 4LFAB 2C3MA 2JRLA 2DUNA 1WXIA 2HCFA 3JALB 3P2IA 1U9IC 4MV4A 4D8XA 3EUAA 1V6SA 2HPHA 4NEQA 2P5TB 3JVEA 2PL3A 3G6WA 1KPIA 2P3LA 3DFMA 3LCCA 4OATA 3BICA 5LB2A 1ZAYA 7GPBA 1RHMA 3D0OA 1EJBA 3QE2A 2AKAB 1ABFA 1UJMA 2YIDA 3E03A 3N59A 3D59A 5J2UB 5JZBA 1THTA 4QSHA 3UFXA 3ZV4A 2H06A 3LUAA 4YWJA 5DV9A 3PV0A 2C1XA 2YMQA 2CEKA 1Y7PA 1Z7EA 2R87A 2O20A 3RYHB 3V7FA 2IKQA 3TD2A 5FH9A 1NL3A 4J4TA 4CCWA 1M6YA 3CINA 3IE0A 1M8GA 2VDNB 2ZB3A 2GVZC 1TB4A 2YVQA 2YV2A 2X6WA 2NU6B 4C21A 1NW8A 4JSTA 4KN9S 2A3NA 1LI7A 4LC1A 3A25A 3ZTTA 2RAPA 5JQGB 5LXTF 5DHRA 3OURA 1XQBA 1EHCA 4LZJA 3PWSA 5CTAA 2UVDA 2GZ3A 2AMLA 3F5DA 4JIMA 5CG1A 3OI7A 3H6GA 3FCSB 3QVSA 1Q0PA 4FSHA 4HQLA 5U1PA 3V8RA 3WJ7A 4AUMA 4CIBA 5AVRA 3RS7A 4OHFA 4J1QA 1SO8A 1C1XB 1AKMA 2QTRA 4ETIA 4F91B 2ZVJA 4EQ6B 2FE4A 4M46A 1J20A 3CLTC 3ENQA 3U16A 1XLVA 3CCCA 4Q02A 4CMEA 4UM8B 4JI0B 5K0SA 5IYRA 1ACMA 4UJ3A 2F3SA 4YCAA 3X1YA 1OW3B 2PUJA 3EEFA 3DAPA 3RKUA 1VMDA 1KE2A 3U3OA 1FNDA 4LRWA 1A3CA 3K9GA 4CV3A 5IYPA 4KKVA 1ZRNA 2WV7A 3FMFA 4KLRA 2BJWA 1DLJA 1YRWA 3G23A 4XX0B 5CNMA 3VRHA 4DQXA 5K6RA 1TVEA 3WHLA 4OSEA 1RI2A 3KELA 4B8WA 3PCTA 4FKZA 4O3FA 1A1SA 1WW3A 4WCFB 3T7RA 1QQBA 4BZXA 4BO7A 1E8DA 3DOEA 2CNWA 4WDRA 5KJ6A 4IINA 2X0JA 1IWPB 1U8ZA 2OMEA 4IZ6A 3O31A 4O08A 1BGWA 3G4SB 5AKEA 3VR0A 1SKMA 1G38A 3FTCA 1ZLXA 3LMKA 1HOTA 3UJ9A 3OOWA 2DYKA 4OGLA 1NLMA 1Q0LA 5BSYA 4H08A 1P1HA 5HUHA 3FDZB 1NPTO 4QBTA 1J09A 2ZAMA 5ALGA 4D0NA 2Y8EA 5IZCA 1U8YA 2QRGA 4YROA 2ADOA 1L8OA 3HBLA 2FSPA 4X7DA 2CJFA 2V4MA 2PRJA 3GF4A 2VK2A 1FRVA 2X41A 3CF0A 4LY3A 4Z54A 1D2NA 2LXNA 2YMLA 5FV7A 1GYQA 3ETLA 4I8DA 4CF3A 3QLTA 1CG6A 1GGKA 3HV0A 4GQBA 4V38A 5TDHA 1VJSA 3FOBA 1Z5ZA 4XKVA 2IDZA 4E2YA 1UJ2A 1ZJZA 1PFGA 3KPVA 2OXEA 3W9BA 3X1WA 1GEEA 2P4HX 1HTTA 1NQXA 2WZQA 3OIUA 4NKRA 4CR7A 5FUVA 1C3LA 4F7WA 5G4KB 4AS3A 2VTBB 3Q7RA 5AIBA 4A15A 4UFNA 2DC1A 4B4DA 1NW9B 1V16A 2XOEA 4NBSA 1YDMA 3FD8A 4R7TA 4QX6A 1CEYA 5DMHA 3HO6A 1E2PA 1KSHA 3ZWVA 1GEGA 2ZE6A 1L5KA 5EHQA 4WUVA 3ZBPA 4Q4CA 2I7TA 2CMFA 4IJ5A 4IJVA 2CLMB 4QRIA 2QF7A 4AUNA 2BM0A 1BJTA 1YZKA 1KJ9A 4HAUA 4OP1A 5MGBA 3FCYA 4LZNA 5EWMB 1W9XA 2A58A 2R25B 2P8SA 1GUZA 4QDUA 4RDJA 2OZLB 2AV6A 4IVPA 2V9PA 4DQUA 2QEXB 2C5AA 2ORED 3IHKA 3R3ZA 4EATA 4JBWA 5KNCD 2D2EA 1OI2A 3FROA 3CH4B 4LJKA 1E1CB 2W2OA 1A88A 1IG0A 1S3GA 2YMMA 3QY9A 4AW9A 1SG9A 4M9CA 2W2LA 5CAEB 3F6SA 2VI5A 3SY8A 1T0HB 3HJHA 3BGDA 1COZA 5AKXA 2ZRHA 4EF5A 3P0HA 1UBHS 4CLOA 1MENA 3UO8B 1V1JA 5MN5A 1BXRB 1SG0A 3AM3A 4NZNA 4BO6A 3CKYA 1YLOA 3MOIA 2E82A 2CNKA 1EXWA 4YFYA 4M1MA 3UANA 3OOSA 3G79A 3K20A 1KMIY 1NHWA 2P65A 1N8SA 3BEDA 4UBNA 3KJHA 4B85A 5GQSA 3NHSA 3AYZB 3L84A 2CUTA 3O3OB 2BI7A 4GQIA 5E3IA 3HB9A 1II8A 4FC7A 3S7TA 1AQNA 4XASA 4X91A 2DWOA 4HLNA 4HDNB 2DHRA 2AR9A 4HDSB 4JXKA 2QTVB 5DM70 4P3YA 2X14A 4M98A 2XE6A 3MRSA 2BM1A 2V7WA 1JLMA 3KXIA 1G8SA 4KP7A 4R69A 3V3KA 1ULHA 1ZN9A 3DTVD 3BMOA 3L41A 2OFWA 5TGDA 4CR6A 2YWJA 3FHCB 2FOIA 1GXSB 2HIMA 2PX8A 3A4MA 1P2DA 1B6GA 4TTIA 2F59A 2WP0A 4HFNA 1FRNA 1A71A 3OQNA 3I83A 4DA6A 1LB1B 4NP6A 1TEZA 1PD0A 2WWGA 3IBYA 1Y5RA 3BX1A 1ZKMA 4MK4A 4FN4A 3Q3CA 1W46A 2ACKA 3KHTA 4U3JA 4X7RA 3G7NA 5AVVA 3WIDA 1T4GA 4GPIB 4FOTA 4BKPA 1BZYA 4J2OA 2YJTD 1K5GA 3AI7A 2Z3ZA 3Q7SA 2QW8A 1WKBA 1P31A 4BFYA 3VHQA 4IDBA 1KYYA 1MOQA 4YIHA 4TT3A 3AQIA 3HRKA 1YAHA 2GF9A 3TAXA 4AN1A 3DCIA 1A4XA 3QEMA 4B4WA 1IMOA 2AG6A 2A33A 3ILYA 4WXEA 1FDUA 5AN9A 3VJKA 3ZDRA 3S40A 3ILVA 3ELWA 3INYA 3PDHA 3ASUA 1M3SA 8MHTA 5F73A 4AXBA 3A9UA 3QKUA 4BCCA 1WPCA 4DIMA 3NC1C 1RHUA 3HVJA 4NOLA 4QXAA 1ZC3A 2CMKA 4B3XA 2QOEA 4MEBA 4DE5A 4FDTA 4ER0A 5B1IA 4DABA 4KV9A 1TTPB 2Z8ZA 4L28A 5K2MA 4ZVVA 3W8NA 3RASA 4XONA 5ESXA 1I13A 3WNBA 2HC9A 2PEYA 1ZBQA 2R6FA 5D87A 3UJAA 4EM6A 1WUJS 5I01A 2D1FA 1JWAB 2ON6A 3PUVA 2Y9MB 4GYWA 5HILA 3V4FA 4I99A 4N6GA 2OHVA 2R1VA 3BNWA 3AW9A 2WM8A 4Z53A 2CYCA 1MRZA 2MMCA 4UU8A 4XQFA 4FQ5A 3RS2A 3OWOA 3QTLA 4ML3A 4CFYA 3EGCA 5CB0A 2AJBA 2JFZA 2RH4A 2BGRA 3U9SA 1MX3A 5HF8A 1BS9A 4FHZA 1AZTA 4QVKA 3NO4A 4LWZA 2VK4A 4MARA 3JQAA 3WK9A 5J5VA 3EWSA 4CBVA 2XW6A 2I6GA 1YCGA 3H9UA 4J7XA 5KOHA 5KNLA 3TFWA 3EH2A 2R4UA 3MWEA 4MS3A 1SZJG 4RCVA 1PEKE 2AH5A 2C2MA 3IVAA 1K1EA 4Y6SA 3OEHD 3FKJA 4ENUA 3OJEA 4RORA 3L79A 3HNRA 2J67A 1FLDA 4IEFB 4DNRB 1IZZA 3AVOA 4GX0A 5ALFA 3V8PA 4H18A 2P2SA 1WBJB 3CGGA 2HA6A 2XV1A 2IZZA 3LUJA 1PTJA 4LYJA 4OV6B 4PPQA 3AIOA 1PU2A 4AT1A 3ZE8A 5EMKA 4QD3A 1HLPA 1RYNA 1SBNE 1V2HE 3HYCA 3OLVA 1IHMA 1SUBA 4DJAA 1XZQA 1JEJA 1YI1A 2BEJA 3EMDA 2LVBA 2R2GA 3ZY5A 3AESA 5DT9A 2JJ2D 4PYIA 1QGYA 2SCUB 2O8VA 3QI7A 1JL3A 2C4NA 3WGTA 1W1IA 2CZCA 4WOPA 4KLAA 3BK1A 5FBWB 5FNVB 2XBMA 1E4EA 4YT5A 3B8HA 4YGXB 1CY8A 4MJ3A 2JD0A 4LJAA 5EP3A 5KNBA 3SM3A 1CLUA 5CFZA 4JQSA 4X3CA 1UMCA 1ZK3A 3BSWA 3H1AA 3LLVA 4IX9A 3W5IA 5BWCA 2G63A 2GMWA 2QYTA 5K09A 2JFOA 1ZJ4A 3LCUA 5LDHA 3PVSA 2HJGA 1HQKA 4H7PA 2P5YA 2VATA 2ZB8A 2GPBA 2IITA 4JCCA 1F38A 4P3XA 4R9NA 4HDQB 3CWQA 3KNZA 1QTIA 2GT1A 4MDHA 2KQUA 4Q7MB 3TINA 2IXEA 4MJLA 4C6RA 1QR6A 1E89A 4O4IB 1CUAA 5JT1A 1WOPA 3A9VA 3K53A 5GGYA 3EOAI 3HGMA 2NV2B 1AURA 4YAEA 4DIBA 4RTMA 3SJZA 4QLBA 1Y0YA 3LV8A 3NXKA 3G05A 2GF2A 2MSWA 1R9GA 3HCBA 3QYPA 3IDSA 4JKOA 5CFNA 4FILA 4QV2A 5AT1A 3R3JA 4BVFA 1WY5A 4ZO6A 1KEZA 5K0EA 1BDIA 5JNUA 4BMZA 5B53A 3K2EA 3PEUA 5J63A 4B5KA 2Q07A 4JBYA 3L0ZA 5JNLA 1KQ3A 2PX2A 3G2PA 3JVDA 4URXR 1WUTA 1L1EA 2RB4A 4XLAA 5IK2D 1GGEA 1PRYA 5ICMA 4WK4B 3LOPA 1P4RA 3NHYA 1LFAA 1DXYA 1SRRA 1TQDA 5FO1A 1P9WA 2WEKA 4KOAA 2O5RA 3LHFA 5LA6B 4K9KA 1EHIA 2C7RA 1TGYA 4KMMA 3WJ1A 5CK5A 2OQIA 3PJGA 3IEXA 3LU1A 3BCFA 4FDVA 5AHRA 1YU9A 5G0SA 3V9AA