2C2WA

The fluorinase from streptomyces cattleya is also a chlorinase. structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title The fluorinase from Streptomyces cattleya is also a chlorinase.
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c2wA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c2wA01
2Q6OA 2Q6KA 2CBXA 2C4UA 2V7WA 2V7UA 2C4TA 2ZBUA 2CC2A 2Q6IA 4CQJA 1WU8A 1RQPA 2V7VA 5B6IA 2V7TA 2F4NA 5LMZA 2WR8A 2C2WA 2Q6LA 2CW5A 2C5BA 5FIUA 2C5HA 2V7XA 2ZBVA 1RQRA
chains in the Genus database with same CATH superfamily
1LW6E 1OYVA 3DGFC 1NPYA 2QLTA 5IZCC 1QAQA 1ETHA 2PL9A 1ZMXA 3E53A 1E6MA 3GI1A 1FNBA 4J0EA 4C7OA 3BNWA 5BSXA 1XLTC 2R4QA 5EMMA 1DAOA 4TMTA 2OV2A 2QV7A 4QU5A 2V54A 4NCKA 4X3OA 4YV7A 3FPEA 2O19A 5JJLA 4TMZA 4DR6B 2AR0A 4X7PA 3UWSA 1FFGA 3RM3A 4KQXA 4DEYA 1QNLA 3K20A 1XMXA 3C3MA 3OW2B 4JWKA 4MUXA 5FJJA 4A6DA 2Q8NA 3TMKA 3ZWCA 1E9EA 2Y0PA 4TKMA 4MR9B 2QUJA 4B5KA 4P82A 1P0QA 3U7FB 1G2QA 4WJLA 4X05A 4MUEA 5D3ZA 4GPEA 4UTPA 4A2WA 2VLIA 4RQBA 1RZVA 1O5OA 2QY6A 4KWCA 3TZ6A 4HE6A 2NPFA 1MIHA 2HK9A 3EGIA 2P3QA 4AG5A 3E23A 1P1FA 4EQ6B 4WLUA 4PYQA 1CPYA 2CLFB 3PUZA 4TXHA 5F4ZA 1HL3A 3T3MB 3LCRA 4BNYA 2RHBA 1MJ5A 1N2OA 5IABA 2OBNA 1JPUA 3ASRA 1VSBA 1KO4A 2FR8C 2LDXA 2X8JB 4L78A 5DWDA 4QOEA 3VXKA 1DAKA 3ZVKA 3CF4A 1U2GA 1YDMA 4G09A 3QY0A 2VYNA 4J0GA 4FHFA 2C3PA 1ADFA 2GN4A 4TKUB 4H1WA 4P7GA 3M34A 3I4FA 4Q4AB 3BHIA 3EGCA 4X9XA 1UC8A 5F5XA 1IZ0A 2ATVA 1D1QA 1FFXA 2BFMA 2VP4A 1GLNA 1SXJB 4FNOA 4YHHB 1G8AA 1YDWA 2PJDA 3NKVA 1GZ6A 5BYKA 2VHZA 3LQ1A 1W4RA 3B5EA 5EKSA 2IYEA 5LMUB 3KLMX 1I5EA 2CEAA 3HN7A 3MTJA 1X7WA 2ZI5A 5K0FA 1NYLA 1D3AA 3LW7A 5CT6A 3WQBA 1ADJA 3GZJA 3TLZA 1G8MA 2X8JA 2P9QA 3V8MA 1W49A 4TPKA 1A9PA 3IXQA 2QGGA 4QDJA 4XX0A 4IL5A 3HXPA 3A6ZA 2E6UX 1U9IC 2YN4A 2GD6A 1ORVA 1N25A 1R8JA 4Z4ZA 2IHYA 3HNOA 1N34B 4QUEA 2FJPA 4S1WA 4F5EA 1Y1TA 2ADOA 1RAIA 2WF9A 1SXJA 1M72A 2JFOA 2ZJYA 4M88A 3VNBA 3WFIA 1KH1A 4BNNA 4ZJYA 2ZIZA 3GPCA 5CEFA 3SHOA 2FSVA 1KFEB 3OUZA 2H08A 3UH0A 2PPVA 3TR5A 3QE9Y 1PBNA 4M6WA 5TQJA 2I3DA 1B8OA 1JN0A 4JLOA 4Q3KA 5EE3A 4BRZA 2ZI7A 3THXA 1XZLA 2IDJA 2YHBA 3A4YA 1KD1D 4PZLA 2WUVA 4WKOA 4U6QA 3TCXB 2GPJA 1WOMA 4JR2A 3NGLA 1CP2A 2EFYA 1O54A 4EKIA 3PA6A 4UC0A 4HK4A 4Z49A 4PF1A 3QKSB 3H2GA 2ONKA 3AESA 1V3VA 2G3YA 1Z73A 4R2MA 1ZZEA 2CF6A 2YN2A 1V8OA 4AY6A 2WKSA 4U7GA 3IKVA 1SZJG 4AQ7A 2VDUE 1EUZA 1LQUA 3M6IA 2X4DA 2FZGA 1TQDA 2NZ8A 1ODIA 5GY7A 3ZPXA 1OKKD 1JHPA 2FU5C 1V0FA 5E95A 4PN7A 5KWVA 1J99A 1NVMB 2I62A 2J5BA 2MU1A 4HR7A 5C18A 1JFFA 1TT7A 1WPGA 2GD1O 2H3EA 3CUWA 3U7QB 2FEKA 3VOBA 3WDKA 4BV9A 3HO8A 1PSDA 2Z1DA 1QM5A 3DT9A 4IZOA 4PVDA 3C6ZA 2IYFA 4D4LA 3GVPA 4PXSA 3ZHQA 4EUFA 4TYWA 1P19A 3FGOA 3PRKE 2B2XA 3JD0A 2I2FA 3QKSA 4C4AA 3G7UA 2G70A 1U5AA 2HQSA 3BPSA 1Y6FA 2VZEA 2GPNA 1XTBA 1H69A 1Y4AE 3BRWD 3HZOA 1Y89A 2I2XB 4E1VA 2H11A 4D5GA 5DLQC 2ZITA 4BKRA 4FLEA 4OSPA 4EJMA 5CDTA 5LKAA 3PFIA 2MT9A 1T4GA 3FXAA 3S3TA 3MFQA 3KSDO 5K03A 3MGBA 4MR7B 1QBKC 2AR7A 3C8DA 3GR6A 4HAOA 1QPGA 5E6SB 5C7YA 2G08A 3A3GA 2QAJA 5EZSA 3ZDZB 4UMFA 1HDZA 4DLXA 2ZSIA 4B6GA 3K9WA 4GMDA 1ZM9A 4PFJA 1SVNA 5JAMA 3K9CA 3AU8A 2CXHA 2R8RA 2VEOA 3G88A 4OB8A 4PRYA 1X9HA 1QYVA 3D8TA 4X20B 3KSZO 2BH2A 3L0ZA 4K03A 1R6XA 1QP0A 2XB2A 3STTA 3RS8A 3Q85A 1GPAA 2TMGA 4RQAA 2PX0A 3M3HA 4NMWA 3THYA 5JE8A 3SX4A 4QHYA 4M9UA 4PPFA 2EFDB 4YONB 4GI1A 3SJZA 1JIUA 1SHKA 3UJ8A 1OXSC 4B6JA 4N18A 3MXOA 3C3DA 1XZMA 1DKPA 1PNTA 4ZCTA 5LC1A 3VR0A 4BNHA 5K0JA 1YOVB 4YJ2B 4D4IA 1DPFA 4LGVA 1DDIA 1V4NA 2YICA 1X19A 4FINA 4QTYA 3CX7A 2HC9A 4EB6B 1P5RA 1X1TA 5DGTA 1W34A 4JASB 4D8TA 4OJYA 4ZEXA 4XM3A 1NBIA 2VKTA 3P20A 2F6RA 4JB2A 2DOGA 1EM6A 1VYVA 3SQLA 4RTMA 2QZPA 3H2YA 2WJVA 2I8AA 1O2DA 3GYBA 3QEOA 2J3LA 4OMFG 5B5SA 2PCJA 1DJMA 3UKDA 1XCGB 3F7TA 3L8ZA 2GEBA 4P7KA 3NBQA 3K70D 1XF1A 2X4IA 1X1EA 3D6UA 3LBAA 2BISA 2P62A 1VJ0A 3HGTA 2GZHA 2QX4A 5AKLA 5HFNA 5KNBH 4K3UA 3L82B 1LX7A 3IDZA 3ZQKA 1QPZA 2IP1A 4CHTA 1KBOA 4FTWA 4KLRA 2BRUC 3IE2A 1QHNA 1J2JA 3EIEA 2A84A 3C70A 3GY0A 5FLXA 3SZMA 5TEWA 4YK7A 3MTBA 2VYQA 2RHLA 4J16C 3SBEA 2XTAA 4DQ0A 4OI4A 1DCTA 5C35A 3TGPA 1SU7A 2WJGA 2ZUDA 3FCUB 4XFJA 1WZUA 3GAZA 4DEXA 1Q84A 4NCAA 1WF3A 5T6BA 2VDVE 4P98A 4TZ6A 1YKFA 2ZYAA 1XQWA 3AFOA 3ETEA 4KUEA 1PNOA 4BZPA 2GK6A 1AQ6A 4XKVA 3MTDA 5E9JA 1JLLB 3CURA 1YB2A 3BGWA 4YBZA 5A6VA 1M0WA 4N03A 2FFRA 4BVBA 3TW0A 1GO2A 3W5UA 2BFEB 3MFYA 2O0MA 5DXFA 3E20A 5I5GA 3WV5A 3M1YA 5A1JA 2AWNA 2J0SA 4QT0A 5F1KA 2EQBA 1SUIA 4OPVA 3KBBA 1N1EA 3KXDA 4JUDX 1NQUA 1SOMA 4E7PA 1ZAYA 3HABA 1ZUIA 3BMXA 3BSYA 1QANA 2D1YA 3IDFA 4JQCA 2J7PA 4MR8B 5ENVA 2Y1FA 3O8CA 2XHEA 1DHRA 4X90A 1GA1A 2XQIA 1T29A 5JDCA 2ZYRA 3E0XA 6ADHA 1NVTA 1DOZA 3TPZA 3K2EA 1EQ2A 2PMDA 1ESZA 3BSFA 1FX0B 1JWAB 3I9V1 3LKZA 1EK6A 4IRMA 3O2QB 3CLSD 3UTCA 3BKWA 3WLMA 4F4CA 1VBKA 2LNDA 4RHEA 1LF0A 1M0SA 4K9DA 1RYFA 5K8JB 1DJOA 2O2IA 4W5JA 4L73A 2M6LA 4DZZA 1KZ6A 2FPOA 1QYWA 3TNFA 5J58A 3ZYCA 2PXHA 3O73A 3EDRA 1NNUA 3TLBA 1XQYA 2WHQA 3K0CA 4Z4WA 5A1TA 4ZQFA 4J7AA 1XZHA 2IELA 3ZNNA 1RXSA 4PIVA 4HYEA 5IM5A 2BSXA 2WAYA 5DF1A 3WS7A 1MAHA 4CL2A 1IK6A 1K4MA 1UT6A 2A4KA 4XKJA 3U7RA 4UOZA 2P75A 1GVNB 2G0AA 4IKOA 4MAAA 4DDVA 4Q03A 5G0WA 1VB5A 4XUEA 2B6NA 2DB3A 1TZ2A 3WA6A 1E2JA 2ODNA 1GRQA 3WGVA 3E1YE 4C5CA 5G1OA 2PJRA 2IXFA 4LJ4A 5K0SA 2FEOA 4GP9A 2YVLA 4B3BA 4Q18A 4IQ8A 5G2OA 4XWKA 1K88A 1DKMA 1H5NA 2OZEA 4GO1A 1DG9A 1FQOA 2J0UA 3PTAA 3CPXA 5LZ8A 3U56A 2ONJA 5ALIA 1YL5A 3LNNA 3AV3A 1HDCA 5JRZA 2KS6A 3TLJA 1FY2A 4X6UA 7MHTA 2WILA 3CCRB 4QBFA 4I3FA 1XT6A 1B6GA 4MI3A 3SVZA 1HE8B 1G2IA 2B7CA 4N7JA 1RHUA 1RADA 4PG6A 2O2GA 4BVJA 1OYYA 1YMVA 5CLLA 2B8NA 1HZEA 3T7IA 1RQ7A 5AXCA 4JYAB 3CV3A 1VIDA 3EC7A 4LRUA 4KSYA 2O8DB 1YIOA 5IYQA 2PT9A 3DZIA 1FX1A 4NIMA 2GEUA 3DHVA 3FCOA 2OFOA 2V9PA 2GGSA 4JBGA 4PIMA 3QEMB 1EE9A 1T2CA 1NKVA 3CX8A 4JEHA 1NFFA 2YCBA 3ANNA 4KQWA 3RRXA 1WIWA 1XJWA 1E0DA 3RS4A 1BQEA 1RRPA 1B0PA 4S1PA 1QSGA 4QEDA 2OOKA 2QU8A 4RVSA 3T51B 2CFRA 2V6GA 3B20A 3N2NA 5BMVB 4KVGA 3KSUA 1IN7A 4BGDA 2FWJA 1NT4A 2VBFA 3GIRA 4YELA 1IN5A 1DQRA 1O1YA 2RBKA 4H27A 1BVRA 4X63A 1EG7A 2QT1A 1J09A 1EJ6A 1UIRA 1EQAA 3O4IA 4GHWA 4D45A 4KK4A 5EXXA 4XVRA 2MYNA 1JKFA 1EX6A 1CE8B 3HP4A 3NM6B 2W6CX 2OD9A 1XQBA 2F3QA 5DNAA 3RKSA 5B4VA 1P18A 2JLVA 2CF4A 4JC4A 1WTHD 2ATEA 2HJRA 2H92A 1OBHA 3SAJA 1MZVA 3K6KA 3JW8A 4C7KA 4PQGA 2QLFA 3TOSA 2OFXA 1QGUA 2Z2KA 4TRJA 3A2MA 5D3KA 4IJUA 3LTNC 2JBWA 2RARA 3ZEAA 1KETA 4MQBA 4GUAA 3ZGNA 2J08A 4UU7A 4CETA 2JLZA 3OZUA 1KQOA 2EEPA 2ZYHA 4BQEA 1S8OA 2XGOA 1IOZA 4G4IA 2O2EA 1CE8A 3D59A 2FLWA 3PA1A 4HDAA 1XUOA 2CYCA 3CRMA 5JATA 4LZWA 2P90A 4ZOLF 1EZ4A 4MV9A 1FZTA 1MVNA 1YR9A 2HGSA 2YFKA 2O1EA 4RLHA 3CKMA 2FRXA 4GOXA 4OXIA 3KZKA 3AHIA 4K26A 1KS2A 2JFHA 4E30A 4JI4B 3O94A 2CKDA 4K9QA 3RK0A 1NUSA 4V2IA 1N4DA 4PYJA 1LTKA 5CM8B 2Z9BA 1IAVA 1ULHA 4I1SA 2BM1A 2OHFA 3R7NA 1JSRA 1NUAA 2PS1A 2PZFA 1O77A 2ZTNA 4XIFA 1SFRA 2WQZA 1ZVQA 2FZEA 2JGEA 4K87A 4A36A 4KGDA 3PXGA 1YHYA 5ICEA 2VYND 4CKYA 3SJCA 1N92A 2JAXA 2PUTA 3BF8A 3VR2A 2RKWA 2SHKA 2OPHA 1AM4D 2OR3A 5B3AA 4GE3A 3IERA 4LMBA 1RI3A 1CS4C 1YS4A 3EGDA 1TJ4A 3DF9A 1IMOA 3NANA 4RPIA 1QYCA 1ZSVA 3DONA 2JPDA 3UV3A 1KIFA 5KYTA 5L7WA 1QIKA 2GAOA 4DR2B 2AQ8A 1E7SA 3QBJA 1EE1A 1BH6A 2ZZEA 2KQUA 1EWKA 4UBJA 2BSAA 3RARA 3SKYA 5FO1A 5LP6F 1JEEA 1UAGA 5IZCA 2I6SA 3PIIA 1UXGA 3R77A 4NFSA 1OBVA 1EVLA 5DCUA 5HUJA 3FOWA 4D3SA 3KP1A 2BM0A 2HJ9A 5BNZA 1Q7YD 3QP9A 3FKSD 4YJ3A 3ZHRA 4G0VA 1Z88A 3A3OA 3FD8A 5BV1A 1YAHA 3PD1A 1BVHA 3LHIA 2Q7OE 1JDPA 1SJ9A 1EJBA 2WT4A 3HPRA 2P4HX 5EKXA 2WU8A 5B64A 1SXJD 3RG8A 3U19A 1KJYA 2HIAA 4EVSA 3FCAA 3VPGA 5C51B 5D6OA 2X8KA 4D41A 1N5JA 2VDQB 3O4VA 1U7UA 2D06A 1ECJA 4LOAA 4F85A 4XORA 4ND5A 2ILTA 2PS0A 1NJGA 2R1VA 2XUQA 4KIJA 1CR0A 2C4HA 4KK3A 4EWLA 1VJ1A 4NNJA 1B8PA 1K8ZB 5TR9A 1NJ2A 1YL7A 2ZRHA 1LY1A 4A23A 2BL4A 4YP9A 1XF9A 2QRMA 4EGSA 1P33A 5JUWA 1DAMA 4HX9A 3FYDA 1YZUA 2VP6A 4J49A 1A7UA 5TNXA 3UH1A 1P2UA 5A2GA 5GVSA 5KYUA 3FDXA 5FR1A 1AMUA 4NNPA 4KO3S 3ZK9A 4C4XA 5K8IA 2I5PO 3R0ZA 5T5QA 1MF7A 4QODA 2VL7A 5G3YA 4XW2A 4YRPA 3T52A 1P1JA 4W6ZA 3ZQJA 3IEUA 1J21A 3UMGA 2YWDA 1WA5A 2OHGA 4C78A 5C1BA 4DR1B 1W29A 4P8RA 1H66A 3ANLA 3F98A 1HZZA 4PYNA 5IEBA 3TOXA 2EKDA 2P65A 4ERNA 1KWKA 4Q3CA 3FOEC 1RP1A 3FPHA 3ZIDA 5ICSA 4ARIA 3NTRA 4YGXB 2V7WA 2PZAA 4RF2A 4RPLA 3UCXA 4BKUA 1EGAA 4BUCA 2XDQB 2V6IA 5MN5A 4AF7A 1NZFA 1TL7C 2JGMA 5I7RA 2WF5A 7YASA 5IYZF 1ZW1A 2F59A 1QE3A 4LSMA 4YH1A 1R00A 1OZGA 3TQIA 3KAQA 4EFKA 1APBA 4EARA 2GN1A 3H4MA 3UGJA 3C39A 4FMCB 4G0WA 3FPSA 4JL8A 3I52A 1TCCA 1U9IA 1UBCA 3LT0A 5KYWB 4A8JC 1ZCZA 4TYPA 2NSHA 4MH0R 5LR6A 1QB8A 1W19A 2V1UA 2XXBA 3HDVA 1EVZA 2QMHA 4WXEA 5AKYA 4PPQA 1KVQA 3ZX5A 2W43A 2E4AA 2OP1A 1WKCA 3A6EA 3OPOA 4S12A 1G8FA 2D9RA 4URYR 4AJNA 3TFQA 2HSWA 2UDPA 1W5TA 1XMVA 4E2YA 3KQNA 1VXOA 3HCAA 3IAHA 5GMOA 1V7QA 3QPWA 4K8RB 1HYHA 2PL5A 2AJBA 4A4DA 4O5AA 4J4BA 3A35A 2HO4A 3IHTA 4BEBA 2VDKB 4FQ7A 1N9ZA 1C7ZA 3TQCA 4CV0A 2JLCA 2O0HA 1VSVA 2OCBA 3OPXA 1MAWA 1N6NA 1HEIA 1RE1A 2FK8A 3OFSA 4IFTA 1ULSA 4MJ3A 3QEAZ 3GXBA 3LG2A 3B6IA 2RJ3A 3GVJA 1R12A 2QRNA 4Z9YA 1TC2A 3GH3A 3FFTA 3KK0A 2H5JA 1SKUA 3OZEA 4JBWA 4A27A 1E3XA 2Z5FA 5IF9A 5JH7A 4MYDA 4FC6A 1P1IA 2K87A 2P9HA 5DV9A 4ND6A 4MW5A 1EYZA 2AOXA 4X60A 4KE9A 2A88A 4MEJA 4C05A 2IYAA 3VHLB 1GPKA 4QVIA 1SQ6A 2YJ3A 1RRGA 1T2UA 2QPOA 3SEZA 5L3SB 1FTQA 3OY2A 3LO8A 3ZXYA 3S2FA 4GX1A 1SG0A 4L9WA 4NOLA 4M0MA 4TS3A 3CMAB 2WPDA 3IQGX 2QYOA 4GRIA 5I3ZA 3BJEA 3GWZA 1KWGA 4LBYA 3QVLA 3L1KA 5AHWA 4F4IA 3C5CA 1ZQ9A 2V7EA 4R9SA 4Z9BA 3RWOA 1C0IA 3LPLA 3OW7A 2AI3A 1AQIA 1BDMA 2JZOA 4N6NA 2Q1TA 3FAZA 5FTWA 4C9BA 4EA7A 5JD6A 4DV4B 5TQ0A 3U44B 2IHNA 4AI6A 1LRJA 2OO5C 4UNPA 2UZAA 2EHDA 1HT0A 1ZVJA 1QQAA 1AQLA 2W00A 3MMSA 1MC5A 1YZGA 1YFZA 2CHVA 4DMUB 1OWNA 3DHYA 5FWYB 4LF9B 4LW8A 4FLMA 1FDIA 3A2KA 2P3LA 1DEAA 5L3SA 2QKYA 3ZOZA 1VLQA 3MMNA 2ATCA 2E89A 4O2AA 1ZBDA 1S96A 4OHPA 2QL9A 2GM5A 3BHMA 2WMYA 3CNHA 1W2BB 3FWKA 5K0LA 1D8TA 4RA9A 5T64A 4B6OA 4BE4A 2H9AA 4TXNA 4HY3A 2RJOA 1XVTA 3P2KA 2W0SA 3E70C 3IJPA 1X0XA 4Z3DA 3BJIC 4TS1A 2PK3A 4DCUA 4MDHA 1TM2A 4HXGA 2GCEA 3V8RA 3ZX4A 4ZDIA 2ODPA 2CCGA 3SHVA 2P9YA 2AEJA 2AG6A 3BGDA 4JL5A 3ZQ6A 3WRWA 5FWYA 3UA3A 1BWQA 1KY2A 1BMDA 3EX7C 4YRBA 5A02A 1PEDA 4UAGA 5EFZA 2W42A 2R60A 6PFKA 2BKXA 4P3PA 4BMVA 2VQ6A 3N3BC 5BN4A 1GQRA 4X71A 3OT5A 3OLQA 3V00A 4DMFA 1VCIA 5JQGF 3PXCX 2HYIC 3EZGA 2GR9A 3RV4A 4C0JA 1P1BA 4KVFA 5I3CA 3U3KA 3EVAA 1JTEA 3N7TA 3RS0A 1EXMA 2WEKA 1DKNA 3IOMA 4RUKA 3KEWA 4JVLA 2VNJA 1YJ5A 3SJ7A 2Q6LA 1X8JA 1ZG3A 2A0KA 5H0IA 3V4FA 2AYZA 2EF0A 3RRFA 4CKBA 5LQRA 2QUIA 2GMWA 1XDSA 5JSQA 4RHCA 5DNWA 2CWDA 1E58A 2DCMA 1MAAA 4P4SB 3ZHUA 4JC0A 2A59A 4YCNA 3QV2A 4HNAA 3S0JA 4CQMA 4EG1A 3F49S 2DVMA 3RY8A 2ZYGA 3PGMA 2JIOA 4R5HA 1W75A 4S3MA 5K0CA 4GMXA 2BRUA 4ZCMA 3KT3A 3K1YA 1PFKA 2M6SA 5CK4A 4DM7A 3PCXA 3H65A 3GD7A 1K1EA 1YJBA 4GXRA 2EARA 3MIIA 2IC5A 3IRVA 4HVTA 1NFQA 3JRXA 4J16A 2WMNB 1RJDA 4RF3A 1EX1A 4P53A 4BMDA 4QRDA 5FAKA 4BPBA 2HSZA 4G8CA 1EESA 1CB0A 121PA 1NF8A 3EQ8A 2QYHA 3RIGA 1Y7LA 2AKAB 4LGYA 4XKWA 2CUZA 3MK31 2W6MA 3G23A 4WCVA 2F2TA 4U6NA 1AKVA 4Q1DA 2EDAA 1CUHA 1SCUA 4EZIA 3T3PB 1PZMA 5KX5A 1KR5A 3DVQX 4HTFA 1G2OA 2P2NA 3MJVA 4QTZA 4OHYA 4JJEA 1TO1E 4OQFA 4UCFA 1T5SA 3H4VA 3OICA 1VHLA 5B58T 2NUAB 3ZKWB 1TRKA 1CQZA 2EERA 1HDXA 2FI1A 2YXNA 5ALYA 4XGNA 4GOND 2QTCA 4LOHA 1U0GA 5KSYA 3MCTA 1S89A 1FOEB 5T4BA 3ZV3A 3WQQA 5MFZA 4JB0A 3LC0A 2I4LA 5DEIA 3KXIA 1G7CA 2OCKA 1FTSA 2WIFA 4YQZA 1JYFA 2G04A 1GZVA 2H2DA 5BY2A 2D1SA 1UMDA 2OZKA 4C7BA 4DPMA 5SYAA 1PGNA 1CS0A 3IVMA 4IILA 3DQPA 2GILA 4TQ9A 2IIQA 4A6PA 1NJ1A 2FPGB 4IIJB 3UG7A 4DJEC 3EFHA 2PS3A 1B6SA 1VMKA 2CMHA 2FW6A 4DREA 1WSRA 2I99A 3TFWA 3NC0C 1VQ6B 5EKDA 5P8WA 3A1PA 4PHHA 4DKXA 1QK5A 5BR7A 2CFIA 4ENTA 5C2JB 3ACDA 3B12A 2OMEA 2VHTA 3ZD7A 1VB3A 2VWPA 2VAMA 5SYMA 2QVXX 3L7LA 3AOGA 1ZH4A 3KEMA 1N3IA 4NAUA 3VDQA 3I55B 4CM6A 1BHSA 2XKJE 4OXQA 2V31A 3L92A 4KR7A 1F6WA 4OHFA 5LB4A 1JDBC 4CKEB 4MYTA 4YDRA 1V6CA 4RLSA 4U2GA 3T61A 3ZD9A 4EVRA 2VHQA 5ITWA 2JI4A 3Q41A 4IO1A 2ZYWX 4H7PA 4IIVA 2JGKA 2R79A 3HA7A 2Q5HA 2V7BA 1WULS 1Z9BA 4DDKA 1GGVA 4N1AA 3VR6H 5IHXA 1T0JB 1XZGA 4LFAB 2GBPA 4Q48A 4F2PA 2CDNA 1E2GA 2QMOA 5CNMA 3V3TA 5SICE 2NVOA 2YVAA 4MTLA 1YI1A 3VBEA 5IFKA 1N8KA 4KNVA 3KKNA 1TJ3A 3DHEA 1KZ4A 2ZRQA 4ND7A 1OLXA 3KKQA 5BPHA 4CODB 2R96A 3UO8B 1CNEA 3LMKA 1UJ5A 3K35A 5D87A 3QUBA 3ZY2A 4CKEA 1H1DA 4HWKA 2Q3EA 4NE2A 3EIOA 5BWNA 4GBMA 1U1FA 5SV2A 3RSFA 4O4HB 1DDOA 2PT6A 3PT9A 3RC1A 2QW8A 2D3WA 1K66A 2F1IA 4RD4A 3AEQA 5DRTA 2JGIA 3GH1A 4UZSA 1OLUA 1EFDN 4W5RA 1N2CE 4IFEA 4LHXA 3ROMA 1LI7A 1Z33A 5JO0A 1AGNA 1CJCA 3A06A 3EMVA 2M1XA 2VTKA 3H4IA 4IFIA 4YCDA 3TI9A 3V1YA 5ICGA 2CNBA 3LUDA 3SFTA 1XXHE 2J67A 3N0VA 4L4RA 3RFTA 1MOPA 1GZHB 3SSMA 5BWCA 3D7SA 4CEJB 2I03A 4DCJA 3V6LA 2ZOSA 2VF8A 2R4TA 4KPUB 3QX3A 5EJ4A 2ZKIA 4NCHA 2IU3A 1UEJA 1PQPA 2P91A 4XIIA 1TAGA 3F3KA 5LZ7A 4M36A 4KTVE 5K0ZA 1Z0FA 4KQ6A 3PJRA 1S2OA 4NDNE 5TF0A 4J1TC 1I7DA 1TA0A 2WV9A 5FPYA 4AURA 1D5WA 3JAWA 2AG0A 1GV1A 1RKUA 4KXLA 4MROA 3ROKA 1Z63A 2JGRA 2G8NA 4K2HA 3UT6A 4BU0A 3VNQA 2CGEA 3KJZA 4I5DA 1U8UA 4DGQA 3DE5X 1GU7A 3KTAB 3O1LA 4GGPA 4ZAFA 3GPIA 3UVEA 1HXHA 3IDAA 4YREA 5L3ZA 2HMUA 3RBVA 4DARA 1AC5A 4DCGA 3GLKA 5BP7A 1ACMA 2PBZA 2RG7A 3DL2A 4G23A 4BVFA 3U13A 3CUUA 3SC6A 5EJEA 3P32A 3NOVA 1IJKA 2P69A 4NP6A 1NVDA 1FFCA 1T1JA 3OJCA 3RNOA 4EA6A 2DWUA 3FGPA 1PGOA 1RLMA 1NN3A 4L0DA 4NOMA 3A25A 3BFXA 3BJZA 4IYRA 1ZH2A 3KTFA 5K51A 1A4IA 1GNSA 1QKIA 5JSKA 3OY7A 3AM4A 3T0IA 4DUGD 1NLYA 2HU7A 4DQLA 5CA1B 3ZBTA 4K40A 1RIIA 4ENSA 1ZK3A 3IQFA 4MKHA 5J1SB 3TQTA 3KQKA 1Y6JA 4K6OA 3GLTA 4M0CA 1NM5C 5HILA 2GBFA 4WAUA 4L6IA 4NZNA 1BXKA 1YJXA 3VC7A 2Y99A 3FN4A 3TIFA 1H6BA 1VJRA 3L6OO 1PLKA 4BQOA 2POCA 2R1ZA 2WTXA 4N41A 1ENOA 2HF2A 9GPBA 1P45A 2ZUCA 1KDVA 3EPJA 2W2MA 3LVQE 2XB4A 3B1XA 3GJZA 2Q0QA 1IY8A 1XZEA 1H23A 3FR7A 3L8GA 3S2YA 3UB2A 1JJBA 3U4QB 4JLMA 2JLYA 2QTRA 2P6UA 3EVTA 4C3OB 3CNQS 1YOBA 2WINI 3DE4X 3IT1A 3KOXA 4G1MB 4IUDS 1JLSA 3ED5A 1KH3A 4MW1A 5AVZA 1QJCA 4QTTB 3E2PA 3ZDYB 3PNPA 2ZRAA 4DSOA 3I34X 5JLAA 4I1IA 3TYXA 1CF4A 1ULAA 4A0SA 1RT9A 4WECA 2QE6A 4QHSA 2NMVA 3OG9A 2B2CA 3U62A 1RMYA 1GJRA 3R6LA 3EQ9A 1LSJA 3R7WA 3G71B 1GN9A 4IKPA 2QN8A 5TPZD 1XTVA 1ZD4A 3EAQA 3I56B 2V7XA 5GGYA 1BS1A 3SHWA 2YMQA 1UOEA 1DTWA 1FVHA 2AE2A 5KINB 5BUSA 3PC2A 4FXPA 2Q21A 2X7XA 1E4YA 3IUMA 3AVWA 3C8MA 4V3BA 5LDHA 1CY1A 3PFCA 1RWQA 3WGGA 3ISTA 4CMAA 4FDMA 1JVNA 2Z6BD 3TQHA 2P9ZA 4PPYA 4EHDA 3T5PA 1YI0A 3A0UA 5GINE 1AUQA 4D6YA 4RETA 3WNQA 1JMKC 4MQMA 2W6JA 3NBYC 4AMVA 2R5NA 1Y3HA 3HMKA 1WMAA 1ULZA 3ZI7A 5MGBA 1GTRA 2VZ8A 4CDMA 1NUUA 4I50F 3DBHA 3K4QA 5LLDA 3MBIA 3CEAA 2G4VA 5IKPA 1F3LA 1KYWA 3H19A 4CMCA 4RV4A 5LU9A 1CQIA 5FUBA 5CTJA 5B53A 3WJ2A 5EJ7A 3LX5A 4ZZ1A 2KE5A 1J90A 3CMMA 2CNNA 2XWSA 3V7AA 1NB9A 3FNIA 4FLFA 4Q34A 4U7WA 5DK4A 4BMPB 2E2WA 2VUIB 5A3QA 1F2TB 5HG0A 2Q1YA 1R0BA 4TLCA 1JBEA 3N87A 1HDGO 4HMPA 1QG4A 5EC8A 2WM9B 5DX8A 4BGEA 2JIRA 4I1VA 2C03A 1GPUA 3MGGA 1N2CB 1AURA 1JU9A 1ZIXA 2J3MA 2W22A 1QONA 1UINA 1TZKA 1XXHB 1WOYA 1XAHA 1WXGA 2XYHA 4IHKA 1GAXA 1I3KA 4MWDA 1ZESA 2O59A 1Y9DA 4EVIA 2JGDB 4FFDA 4Q9AA 3RK1A 4A8JB 1J7KA 1Q82D 2YL2A 3DOIA 1JG4A 3GP3A 4P81A 1EXDA 1EHCA 2X77A 1FLNA 4CMJA 5BQFA 4OJNA 1PG5A 4KYVA 2PY6A 3T95A 3CPWB 2D2FA 4EW2A 1ZMOA 1A27A 1CDZA 2V59A 5D3QA 1HDIA 5DLYA 1KSFX 4YRNA 1Q81D 1PVVA 5IUJC 3ICCA 3VZPA 4DSNA 2CLOB 1P7YA 3QHAA 4OK5A 3V4LA 4EFNA 5FI1B 2RHDA 4I9UA 4FI3C 1ZXBA 4QFDA 3BCHA 1L4UA 5LQCA 1G9TA 3E84A 1N8RD 1EVKA 1Z2DA 2C9OA 3F7NA 4PW0A 5HF5A 5DP2A 4CF3A 1DQYA 1JU4A 5E3JA 3T9DA 3OZIA 3R6JA 3DDOA 5AM0A 5A89A 1X15A 1T5BA 1J20A 2OGTA 1IXKA 3W8NA 1IWPB 2ZUEA 5ALFA 4KWIA 5M3BA 1XIVA 3I2FA 1Q3HA 1WHTB 2X0DA 4FMDB 4WXHA 1TQHA 4CI0B 3MCVA 4KU4A 4CM7A 1CDOA 3BRQA 5JZMA 1M0EA 4UBNA 4Z1MD 2YDYA 2DY1A 4IEEA 1FTNA 1GXSB 2NTJA 5FOVA 4BLOA 1TYDE 3M6VA 4DC9A 2ZJ0A 5EPEA 1WMFA 3L0BA 1JI0A 3E0QA 1PI3A 3ET4A 4N12A 1NB0A 1U1GA 1VE3A 4UOQA 1JDSA 3RTAA 3LIIA 3HU3A 4YRLA 5CW2A 4PE5B 3QE4A 2CWWA 3A6DA 3DP9A 2OP0A 5DM70 1XK6A 1GCGA 2CZCA 3AY3A 5BUCA 3LOUA 3T1YB 1YIDA 3BMOA 2V3WA 5HRAA 3R09A 3MILA 1FS6A 2V4MA 1N0WA 2C07A 3HG7A 4NU5A 1AA6A 3GLHE 2VDWB 5I7UA 1YAJA 5G0UA 5J4KA 1WHTA 3M5WA 4XTCS 1K6XA 2PEYA 1FP6A 2QG4A 5JY1A 3MT7A 5KQSA 1XTTA 1GGFA 1RYNA 4QDUA 3TCNA 5KB3A 2QJRA 1LJLA 4D4HA 2GZDA 3BCSA 3MTGA 3PQCA 3OT4A 3K5PA 3KQSA 1YBMA 4UBLA 5AYVA 4L5JA 1D7OA 2GD2A 2DEUA 3IEXA 4HGZA 5F35A 5MN6A 1N6RA 3SXUB 2FG7C 2QQEA 3JWGA 4XEUA 4DV1B 1JEYB 2QVBA 3CX3A 4I6EA 3M3PA 4GNRA 2EOAA 3SFVA 2C2WA 2YVKA 1N8TA 2P9CA 1GRVA 4NPCA 3T0FA 4URWR 1DXOA 1HPLA 1NRIA 3STYA 5FPKA 4MYRA 4YP1A 1K2VN 2FKNA 4KFSA 4X1IA 1QV7A 2V3VA 1CY7A 3IP6A 1CUAA 4G63A 4E09A 1BE8A 3AX6A 4AUMA 4F56A 4R41A 4CKWB 3EUFA 4XLLA 1NVEA 2DQZA 3AJDA 5EHGA 1XNJA 1FPQA 4WUTA 8GPBA 1U0JA 4EKYA 3KD2A 3ZJUA 2HT6A 2X5NA 1VHOA 1B1AA 3DDUA 3FGZA 3E8XA 1W94A 1BA2A 1VJTA 2PWYA 3PUWA 4OA8A 1IQPA 1UBFA 1N07A 2YV3A 3L6UA 1WQ4A 3N2KA 4TLBA 3KQVA 3KVYA 5CGZA 4F3NA 3ABSB 1E4EA 4TKVA 3ZWXA 4Q21A 5H59A 4QC2A 5ELMA 1SA0B 3K9NA 2C97A 2RB5A 3HVHA 1OIVA 3DKVA 4IH9A 1A72A 1HWYA 1USGA 3ID6C 3FCSB 2GCOB 3LQYA 3A6HA 4BEVA 1AUXA 1YQWA 3CLTC 1XCPA 4MQEA 4MV7A 3VJRA 2OYSA 2PX5A 4GZLA 3KAPA 4ZPJA 4YROA 1L2TA 2VNSA 5C80A 1DDGA 1ZH0A 3WGTA 4Z4RA 1EFRA 1E7WA 2X58A 5CH5A 1VMEA 3SF8B 3PJFA 4DBLC 3WGOA 1EDDA 1XGKA 1Z4LA 3QA3E 1IBMB 1NLZA 1PHRA 2C1EA 2QNIA 3AEKB 1X7ZB 3ZK8A 3HB1A 3SIPA 2DFVA 4XN3A 1UF9A 4NCIA 3OEHA 3AF2A 3X1JA 4IW3B 2AC7A 1IMJA 1L5HB 3IUEA 3V33A 1CUDA 3BM5A 4JENA 4BO6A 5TGDA 1M2EA 1WU7A 1ADBA 3HCPA 3KZNA 2ZM5A 1XQ6A 4BAGA 3CEJA 3DEIA 3D8HA 4Q82A 1MOSA 3LY7A 5LNK6 1P9RA 2I76A 2GVZC 4D8VA 5KNBA 2GZ1A 1UJ6A 3I23A 2ZBVA 1C9DB 4FD2A 4Q19A 5KYXB 2ECOA 3NYQA 3SF8A 3MINB 5IJAA 1UXKA 4JD5A 1RYBA 2ZUTA 3U3DA 2QTVA 1OVGA 4ZHQB 1P8AA 2PPLA 2C61A 2AI2A 2I33A 1OF1A 4ACBA 4R83A 1S6YA 3EWNA 1PJLA 1RBQA 3ZJTA 4DIFA 2QTBA 1P7CA 4R1SA 3N2EA 3UHJA 1KQNA 1L5HA 3DA8A 3FUXA 2RKOA 3X1KA 4D43A 2OTJB 1IY2A 1GTG1 1O0SA 3RVQA 1Z28A 2XUGA 4NFLA 2JAUA 3LX4A 1PHPA 4WY5A 4QWMA 4CMIB 3GD5A 4PCLA 1O0CA 4A92A 4EKNB 3JQPA 2GDZA 4NULA 5JPCA 3DCJA 2HA5A 3HBLA 3CCVB 4RNCA 1E63A 2AN4A 3JY6A 3MINA 2IXEA 1NNSA 1UT5A 4LE1A 5JBNA 1A8SA 1BJRE 4PQYA 2H57A 1NL3A 3F3SA 4WOJA 2DQSA 5ALSA 1DZ3A 2AVNA 2F8LA 1X7XB 4TRMA 3VSAA 2WJ6A 4ALJA 3U7IA 3SSNA 3ER8A 1VPLA 3FVWA 1X42A 3N75A 4M54A 4B73A 5INTA 3BGVA 2QPAA 1C7JA 3ZBQA 5GWXA 3RU9A 2IP2A 3VAAA 3V9AA 4CMIA 2HZ7A 1RWVA 4F5YA 3GLHB 1JDBB 3AHGA 2ZUWA 4J1NA 2GJPA 1XN1A 4YRDA 2XKAA 3BILA 4P3IA 3NGXA 1Y3BE 4RF4A 4RCZA 1IRXA 2H0AA 5AKXA 2PGDA 3MWDB 3PUVA 5EKUA 5DM60 3QFFA 1KZ9A 3PA8A 3CISA 3HUFA 1EPUA 3EEYA 1FBTA 2OY0A 1DBVO 1M8PA 1ZK1A 2F1KA 4CM4A 1HT3A 2GK7A 1J1IA 2EJWA 1O97C 4LRQA 3CXRA 2A4MA 2PUEA 4W63A 4RTSA 4JJ7A 4L4SA 1MX1A 4GEKA 2NVBA 3AM1A 2I8CA 1M0TA 3LW8A 4WNYA 3UEOA 2C2YA 1I3MA 3CRRA 4MJXA 1TVCA 1AUPA 5GP1A 4D8UA 2B94A 1P8JA 4Y6QA 4FS8A 1TDJA 1GYPA 1MQSA 4G56A 3U60B 1U4NA 2COEA 5ES3A 1D1NA 3U40A 4Q01A 2E4XA 4AY2A 1SRRA 4KP7A 2VSXA 2NSLA 3E7FA 4Q3LA 2NACA 3MCZA 1RC8A 2O7QA 2MSLA 3P9IA 2JHPA 3HDYA 2NIPA 1H2XA 3N74A 3CGGA 3TRJA 4INAA 2Z83A 4DQKA 2M5SA 3VFDA 1LU9A 4KH0A 4LISA 4WK0B 4G9BA 3FMVA 4HXYA 5BMOA 1L8AA 1B14A 3GLUA 2OL4A 3AFGA 2H8GA 3LXUX 1VG1A 3HGMA 1TQ2A 4GOLD 2VEDA 4J7CA 1YIJB 2XMGA 1B7GO 4E2FA 1OQAA 4KE7A 2BGNA 3JASB 5E6TA 2BLNA 2CVPA 2AYYA 2DBYA 4EHIA 1JS1X 3T1OA 5I9IA 1W5FA 1ZIYA 1SKYE 5F9MA 2FA9A 4FFRA 4YXWD 3EVFA 4NMXB 3SKVA 3FNHA 3CCJB 3NDRA 1YTLA 4UTVA 3HZHA 4BO3A 1LH0A 2VDNB 2WV7A 5KW9A 2ENUA 3Q0IA 2SBTA 2CNDA 4RPJA 3VTAA 5L4LA 1E6LA 3VX4A 4W9RA 1SK8A 4BFYA 3U3RA 4X5OA 3JX9A 3KEOA 3COZA 2J6IA 3HC7A 1JR2A 3MB5A 5TF4A 4CF5A 1QG2A 3I6MA 5THQA 1D6SA 4Q9NA 3NDIA 4Y2XA 3KB8A 3FKQA 1ZEMA 5KNDH 1HR0B 4BCBA 1JG1A 3BGSA 2ZRGA 3NAGA 3RO7A 3BZBA 3VYVA 4OPOA 3WBJA 4B4DA 1LK0A 4RU1A 4M1ZA 1XNGA 2GBCA 5AM1A 4NBLA 1FXWF 2B35A 2BV3A 1OTYA 4MUNA 2PR2A 4W7HA 2MSNA 2REBA 4L4XA 3TM5A 3W77A 1G6Q1 1KI3A 2YOGA 3HXKA 4QU8A 3OQHA 4B4WA 1ZU5A 4ZVPA 2Q7DA 4BGIA 4DA7A 1UFOA 5K3SA 1XDZA 4OMCA 4OYHA 3F5MA 3AWDA 2B4QA 4B4VA 1A9XA 1T36B 4BLRA 1J22A 3RSGA 4IR7A 1DE0A 4AN0A 3IKJA 5CVEA 2L0XA 2P8SA 1PKEA 2WY2D 4HH3C 4ALLA 3CWCA 4WN9B 2X0RA 1BAPA 2H63A 2YW2A 4Y0VA 3PNSA 4GR4A 5IWAB 2H4JA 3FBTA 1DXYA 3OF5A 3ZY5A 4QATA 2WUDA 4CCYB 1FFWA 5J35A 3FHOA 4TMYA 1FFEA 1CX9B 4ZU6X 1W4AA 2VG8A 4GDMA 1YD7A 3DZHA 2OHOA 4RNDB 4UTZA 1GQ2A 4OB6A 2RI0A 3ZGXA 4ZZ3A 5JVDA 2OMKA 3BWDD 1G4UR 4TYMA 4YA6A 5DKFA 4DB2A 2LIVA 3BQJA 2MINA 1CCWA 4HJXA 2CJXA 3F6SA 1AV6A 4OLJA 1Y6RA 3PL5A 1XU9A 3ZI0A 3LDGA 4DK1A 1VMIA 1RBYA 1VHWA 1QVFB 2YVUA 3ODGA 5CCXA 1UC5B 1XRMA 1NXTA 4EF4A 1TLTA 1U2RA 2N46A 2YHSA 3KOMA 4G81A 2PRJA 3FOCA 4WN9A 4J3NA 1RABA 1J0AA 1I24A 4KHZA 1KP2A 3RSLA 3PTLA 4TQGA 4QDZA 1XL1A 3NCHA 4BJHB 1Z5OA 1SG6A 4HEHA 4JOBA 4NV3A 3SX2A 3U9TA 5HMMA 4CR7A 2OE2A 5EESA 4RTKA 4DJ5X 3DLHA 2QMQA 5LB2A 5GONF 3GVKA 1YA6A 2W2NA 2RHGB 2VZLA 2GF9A 4HDMA 3JQRA 1GZDA 1HKHA 4ER0A 3HBNA 3Q1KA 4MIYA 1UWLA 1F20A 1XD8A 2HZBA 2PO5A 2J1LA 4FHCA 2FG6C 5CHYA 2HA4A 4L51A 4L8JA 1A2BA 4QJ5A 3GG2A 5E2AA 4RESA 3GUYA 3S55A 1SXGA 2A86A 3HA3A 3KLBA 2B98A 4GKBA 4TTIA 2D0DA 2PRYA 4LQLA 4R8VA 1I2BA 4LVOA 1QFXA 2JIPA 2R87A 4K7JA 5K8TA 1UPAA 4IS3A 4BIIA 2JBAB 2AN1A 4TQUS 3SK0A 2G9VA 3EWIA 2Z57A 1M1XB 2RK3A 1M54A 1KOLA 4EPXA 4S0ZA 1GNVA 2DYIA 4YGYA 5KOHA 4DBLE 5FIUA 3CN9A 4AZ0B 4D0RA 3FETA 4H59A 3B1YA 1B74A 4XE5A 1W48A 4KQJA 4YC7A 3GT0A 1MVLA 1FU8A 1Z82A 3HN2A 4WT7A 5BW6B 3VU1A 3WLHA 5CFRA 1YS2X 2FWIA 1B93A 4RAOA 1NLMA 4QYSA 2ZJ8A 3CSDA 4ZP1A 3DOJA 2ZLBA 1RPZA 4W99A 2P2DA 3CF4G 2C2KA 2X9VA 1HGXA 1VHEA 3A6JA 5LQNA 3U2QA 2W6OA 1OA1A 3PI6A 1OY1A 3PGXA 3Q3CA 1M66A 3TXYA 2FVGA 2QROA 1OAOA 4Y2QA 3QYPA 4KXMA 1XD2B 3GUVA 4HDSB 2H1CA 5KNCH 1SRQA 2GN2A 3FKJA 3JS5A 1HRKA 4DXAA 1NI3A 3QEKA 2ZTLA 2B1IA 3G9QA 5AT1A 3NAQA 2PX6A 3QIAA 5HGJA 1HURA 4PGGA 4OGKA 5JRJA 1JG6A 4M0FA 5FL3A 4FBLA 5K8VA 3E1KA 2F48A 1AT1A 2I3ZA 2JCGA 3BTVA 1VRVA 3EGVA 2H7YA 4OKSA 1PUIA 1SCKA 3KKOA 1FC0A 1U0NA 2MSCB 3QPAA 4TVKA 1D9XA 3V2UA 1BWSA 3OWOA 5JZSA 1BW9B 2X5OA 3HO1A 2R6CA 3ZCXA 2PL1A 1WB4A 2ID7A 3AEYA 3HVUA 4CCSA 3EXFB 1G41A 3ADKA 4WK2B 2FPPA 3ZNOA 2BF4A 3C3XA 1IY1A 4XYMA 4CM8A 1E1DA 2Z58A 2VDLB 1QB7A 2OGUA 2ZBQA 5LMZA 3ITNA 3KJHA 1OXXK 2SICE 4BFXA 3IUQA 4EPRA 3RTCA 5BW4A 5D51S 1ENPA 3T4XA 2IS6A 4G4JA 5EP2A 2R85A 1N75A 4R40A 1SBYA 3M7IA 3VKWA 1SHLA 5JAIA 1E2BA 4EYQA 2C5EA 1K5DA 4R1MA 3DBIA 5KIAA 3ANXA 3MWLA 3HI4A 1MPXA 4H6XA 3SU8A 1JB1A 2D3NA 1XALA 5CDFE 5HFAA 4E2WA 5E1OA 2XYVA 4D44A 4XVCA 2FDCA 2Z5LA 4OHRA 4P0QB 4YBRA 3H1BA 1YRYE 3HE3A 2R0QC 3ROTA 1PR3A 4JLKA 4DT1A 1CY8A 2CCKA 4MW9A 4BRWA 2V0NA 1NW3A 3HRHA 5IG2A 1DEXA 4M4SA 3DAHA 3LI2A 1H8HD 2BY4A 4FNGA 1QGDA 1UM8A 2DULA 1ACLA 4UHKA 5HF8A 4YCLA 5CIWA 2X8WA 5DJ5A 2A1UB 5EL0A 1WXDA 3EY9A 4FC7A 3ZCSA 2Q1UA 1Z8HA 1A0OA 5IAKA 1BD4A 1NW8A 4P12A 4KEAA 4TV9F 4OHUA 1J9ZA 4MV5A 3SZ3A 1L7DA 1UXHA 4B3TB 5ERYA 1G3UA 1VQ1A 4KRFA 1RZRA 3R0VA 3AFMA 4YRQA 5A4DA 2JD1A 4IVNA 2E9SA 5FA5A 1DT5A 4GOJA 4D74A 5KTMA 3G0BA 2H1FA 2YJ6A 4IHAA 3ZZ1A 2GOYA 4WNIA 3TOZA 5KYNA 1W5EA 2ZWMA 4UXHA 3VNRA 2XQGA 2JVKA 3FPGA 5EYPA 2I8LA 3S40A 2HRRA 3VISA 3WVNA 1ZM3A 4D98A 1T1RA 1JTFA 4NXMB 1ZZGA 4LX0A 4XM2A 2B78A 2IV3A 1NMSA 2WIDA 4JU9A 1QRAA 3AF0A 3DL7A 1U9JA 1PR9A 3HMQA 1Z2OX 3OF2A 2QI9C 5ENZA 2A1UA 4TTRA 5J2TB 2EZ9A 3I30X 2C5GA 4KCGA 3EULA 4RSGA 2H3HA 3WHLA 1T4MA 2P1ZA 5BSRA 2C20A 1KDPA 2Q0SA 2VJKA 2Q2WA 4I8DA 5CA0A 1QIDA 3UJAA 4ZGQB 1E99A 2RHWA 4U4AA 3DXFA 1T26A 1L5LA 2GPAA 2JAOA 2JH9A 4OJTA 4PZUA 1CG6A 3DG9A 4CXMA 3GRVA 4YMWA 3NT4A 3IT0A 2ZR8A 3IUJA 3W5AA 3OOEA 1I1QB 1F06A 1P4HA 2ZG6A 1G5HA 3CCBA 3GQBB 3NEJA 3E81A 5GGXA 4LDPA 4BJ6A 3SR3A 3MJHA 4OHXA 5A3VA 3LT2A 1QWOA 4B40A 1IZZA 2GEFA 2VPTA 2ZSUA 4XJVA 3HB7A 5CYOA 2B4RO 4M9XA 2BP7A 3KKMA 4PXAA 3ZCUA 5ICFA 2AF3C 5I9BA 1S2LA 3VX3A 3MZ0A 1KXJA 3G1UA 1ONPA 1ZUNB 3CH6A 4FFPA 1C3JA 4HGOA 3BMCB 5AJVB 5H16A 2G76A 2E1BA 4LE2A 2B83A 2FZVA 2NXEA 3GAFA 4IBOA 4MQFA 5HK8A 4YAFA 2YJZA 3DNMA 1NONA 2LCFA 3LF1A 1I7SB 3G0DA 4CUKA 4TV8B 2JL1A 1NVUQ 1GDDA 3C7CB 3DP7A 3OAAD 2EGGA 2HT1A 2GI4A 4N9WA 4KXXA 1CZKA 3SBDA 3ZWAA 4HAIA 3WJ7A 1PYGA 4ND8A 3ZQ4A 3NPAA 4OL0A 1DAHA 1FRNA 2Q3HA 3E35A 5TGZA 1K5PA 1SWWA 2F90A 4PO8A 4X07A 4CW7A 4MGKR 4ADSG 4P4LA 4DA0A 1Z45A 3KEQA 3H4TA 5JVDB 4TT3A 3IODA 3BMCA 4TWZA 3PIDA 1LKZA 2QF7A 4QOIA 1OT3A 2YS7A 4HNGA 1U7TA 2RB4A 3N8HA 4B45A 4IY1A 7REQB 5K05A 3CJRA 4RABA 3P26A 5BVGA 1GQOA 3W3ZB 2F64A 5HS6A 3ZW7A 1MO2A 4WUVA 4E4RA 3HVJA 1T35A 4ZEVA 3IQDB 1DQSA 2JATA 2O2CA 3VH3A 2TMKA 1DHTA 5LA6A 3K9BA 4E32A 2Z8YA 1B73A 2QA5A 3KB1A 1FP1D 1A69A 3DAOA 2GJKA 2UU9B 4JJ8A 3PFBA 4FWBA 2RC6A 1MEJA 2XNDA 4QRHA 4OAOA 4Z4UA 2C00A 4MUHA 4IDFA 5DBIA 2OCXA 3WQRA 1XRRA 3Q7RA 1PJRA 3A11A 4H4CA 2QVYX 4P5PA 5BV8A 1LBSA 1X1BA 4C07A 2WB4A 1MQ9A 6CHYA 2HU8A 4RKYA 1MC8A 2G1UA 3A3YA 3RVLA 3WNDA 3WX0A 4NG5A 3W6OA 3D3JA 1I14A 1NMXA 3N70A 1THMA 4R51A 3P71T 2I7CA 3F8TA 4JQOA 3ZXUB 2E85A 2PN1A 1E3TA 2HRBA 3N07A 2V5AA 5THXA 3WKAA 2GN0A 1CVIA 3ISJA 2EZTA 5F52A 2CSXA 1U0SY 1AHIA 3QF7A 2UZ1B 3RU2A 4L3VA 4F45A 1VJDA 1R3DA 1NASA 2C0PA 2EBFX 1QAMA 2OZVA 3EZYA 1V3QE 3GIWA 3IP8A 3LP8A 4DV6B 3Q5EA 5IDWA 3MT0A 4HB3A 4MKFA 1K92A 1C7QA 2CL5A 2YV1A 1ZL0A 2XOKD 1B3BA 2RONA 1E5VA 1WPCA 1PKXA 2XCLA 1UPFA 1G8GA 2NU9B 2V7QD 5CDFA 2DWPA 3OQMA 1PSWA 3UB4A 2RH8A 3R5SA 1NV8A 4GOOD 2I1LA 3RVOA 5IC6A 2CN1A 3KOZA 4BQRA 1OYWA 4MS1B 4ZODA 4PAAA 3D6VA 4OYLA 1DC7A 1E3WB 2XTNA 1A88A 1JJ7A 1FUUA 2PH3A 4B8ZA 6YASA 2VTEA 3GZTB 3NQ41 5LZ9A 3BDAA 1WBBA 1EFPB 4CU5A 1YR8A 1NQOA 5HKKA 2WWFA 3H1FA 4P86A 1W4ZA 2PANA 2VI5A 2PMKA 1Y0BA 2I7DA 4KG7A 1OFGA 4CQLB 4IDNA 1VQNB 4W1SA 5JLJA 2QN6A 2NU9A 5FBQB 1Y9AA 4G1CA 2BM8A 1ADYA 2PXAA 3DWGA 3BJMA 3JSXA 1USWA 4RE6A 3L4BC 2F3TA 3IIEA 3RFUA 5CBKA 1KI2A 1RJWA 2WJZB 5JI3E 1ORRA 1UZLA 3EZ2A 3CP2A 3E9CA 5DXJA 3T7AA 3ZU4A 2C2XA 2VUTA 1MEEA 4W8OA 3WB1A 3PQFA 3ORFA 1E3WA 2RBEA 4DY4A 3D4IA 4F2HA 3KE9A 4F5WA 2QLNA 4RVNA 4A7PA 4XQFA 1U7XA 2ZT8A 5KEIA 3KEGA 1BQ4A 1I3CA 1M6WA 1RJ9A 3DDNA 4BQFA 1TUIA 5AVKA 4ZQGA 1NXOA 4BJ5A 3J7TA 3E7DA 1EBUA 3OZFA 3R7FA 1AIPA 4RVOA 4N47A 3DMFA 5EOVA 4H7HA 2YZKA 1CBUA 2HBQA 3I1IA 4B83A 2JLXA 4DDWA 1WSWA 3UAYA 1PL6A 2NU7A 4R6XA 4LC9A 4FOPA 4DAEA 1D0SA 1YQXA 1UCFA 4D81A 4DPLA 5ADHA 4E03A 4XH9B 3H9CA 3W04A 1FFHA 5AESA 2FMTA 2XIQA 5AK0A 2FSFA 5FD8A 4L5YA 3RLFA 5AKIA 3W0LB 2GJSA 2WIKA 4E4YA 2QBYB 4FHEA 2KLBA 3MMZA 5DVZA 3EDOA 1IUNA 5H83A 3PWTA 3ZU6A 3HI6A 3FLBA 4L1KA 3RC9A 3TG8A 2BTEA 4NSNA 2H7CA 4OYYA 2ORVA 3O83A 2XRZA 4UUQA 1QO0A 4AB1A 1JKJB 3A31A 4JX9A 4DA6A 2ASEA 3JD4A 4XIJA 4L5IA 5DASA 3AEZA 5KSZA 4M9CA 1ORWA 1SHJA 1LDYA 1WUTA 3RSOA 2CHFA 1EA5A 1SQGA 4V0LA 4BXOA 4M1EA 3BT7A 4JOQA 3ADCA 2B99A 2ERCA 1L6IA 1P74A 1XE1A 1RAGA 4MNTA 1R5NA 4Q3BA 4MVJI 1SCAA 2OZLB 2ZWPA 3B1ZA 3AF4A 2NXJA 1NF9A 2HF9A 3GROA 3O4RA 1AS2A 2P3SA 5F1YA 3UXYA 3W6ZA 4LBZA 4FYVA 1UOOA 2P77A 1ISHA 4UDOA 4UHEA 4E4TA 5E4FA 4EVQA 2O8BA 3FNGA 4C7XA 4I1PA 5F7OA 3WLLA 4Z7QB 2BMVA 4JSTA 1RACA 1Z0KA 1HYQA 4FCWA 2JDIA 1YVEI 2UUPA 3L0SA 1IXSB 1MG5A 5FO0A 2WT8A 3MRVA 4FZ5A 5DMXA 3RYFA 3TTWA 4S05A 4GMHA 4YJHB 1HK7A 4QPJC 4ZRNA 4F4UA 5CFMA 4Y67A 3RK4A 3AI7A 4D02A 2Y0CA 1NNLA 4Y1RA 1V9CA 4O4JF 3Q72A 1T3HA 4M22A 2A5DA 5F77A 4XLAA 2F8SA 2ZSBA 2OZLA 1RC1A 3LC1O 3K09C 1PN3A 4IVPA 1ST2A 1YE5A 2OHXA 3QM1A 1NRKA 3X1MA 2UYGA 1Z6TA 2RBGA 4LJ6A 1FQJA 1D2CA 2YJNA 2RHHA 3FDIA 3SDZA 2CFCA 3SM9A 3JATB 2NO7A 2VT3A 2HMTA 5E4JA 5LP6C 1OC4A 2TECE 4Y1FA 1LRLA 2R48A 1AY0A 1FJGB 1DEHA 4U02A 3G0CA 1QGED 4V0RA 5C1IA 5HRUA 1EFLA 4O8ZA 4WY8A 1CW2B 3OZVA 3O0DA 4PINA 1NLFA 3ENKA 3FYUA 2B3DA 2XI4A 1DKRA 2WWXA 3PL1A 4D9MA 4Z8YA 1HEUA 5ITZA 4N76A 1J6UA 2QNBA 2Z0MA 5EXTA 1QUEA 2YNMA 3LH5A 2M9MA 2CD9A 2HRQA 3LDAA 4JN6B 4K81B 1H0HA 4YT5A 2II6A 3NP9A 4JCCA 4ZT2A 5FQNA 1T5OA 3CVJA 3HLKA 4MPJA 3EPHA 2W48A 1VL8A 2J9FB 4TXJA 2GM4A 1LCIA 4BLUA 1NDHA 3OSUA 4S1OA 1Q14A 4ZO6A 5C4IA 2ZK7A 2VP5A 1NSTA 3GCGA 1MAUA 1B76A 5I7OA 1K8RA 2XE4A 4B7CA 2IW3A 5C3UA 4E3WA 3GSIA 3MUOA 2ZIEA 3NNSA 4BP8A 3TSAA 3VR5D 4FP9A 4OXXA 4QPNA 5ITSA 4ZCQA 4I99A 3NZEA 1TTPB 4Z51A 2QT9A 1Z06A 3D7LA 3HKBA 2CFOA 5IVDA 1GGHA 2O0KA 3QTTA 2NU8B 2OBBA 3LBIA 3RAGA 1CUYA 3ZCRA 2AG5A 2NP7A 1C1HA 1B15A 3ECAA 3UGTA 4BWGA 1A1VA 3T5TA 4NARA 4GD3Q 4X61A 3GU3A 1CUZA 4L74A 1L4MA 3WLQA 4C6SA 3BCUA 1JR4A 5JXJA 2GFIA 4UE3S 4F93B 2L2QA 4Y9SA 3NVAA 2Y2VA 4ZU1X 3RYHA 3G79A 1J24A 1GKLA 1H3NA 3OTIA 4XYBA 5K3BA 3W9SA 4HUQA 4ENRA 4D79A 5JH7F 4JVMA 1J25A 1EVIA 1MIOA 1UFRA 3IAAA 3VBCA 2EFCB 2I2BA 3ZY6A 4BTEA 5KCMA 2DPXA 3OKCA 3T7CA 3WWZA 3JU3A 1Q5PA 4RV5A 4YMLA 2OWEA 1E2QA 2QTFA 3NETA 1K6JA 4K0RA 2FH5B 4CM1A 4CL3A 3RNLA 3QOWA 1FZQA 2WI8A 2NU6B 3B1JA 4P1ZA 5TARA 2BGIA 3TH5A 3ZU5A 1W0JA 1W35A 5JD5A 3KETA 2B0CA 4PC7A 1EK0A 4G0NA 4UE2A 2AT1A 3RTDA 1OTXA 2YJTD 3CW9A 4TLMB 3KSRA 1CK4A 1QHHA 1Z6AA 3DPUA 1LSOA 1W30A 4WQMA 3C45A 5EXEA 2YFQA 1NSFA 5SZJA 2HCJB 3ENVA 3L6DA 4OQMA 1DIOB 1L1FA 1RZRD 1KAGA 2J3EA 4LF6B 2TMDA 4C0LA 1E6UA 2PD3A 3O8BA 3B1VA 3LDUA 3RVJA 4G24A 3V4SA 1MFZA 2A9KA 5JWHA 3TUJC 2VCYA 2B21A 3VGPA 4HT3B 3LYHA 3SHTA 1T25A 1YBHA 1NV9A 2H5EA 3SQDA 3CUVA 3SMVA 1Z3CA 2RGWA 1A5TA 2B25A 4B7XA 1CTQA 4GI5A 2ZRDA 2DQKA 1CJBA 5E9WA 2JA2A 3MBKA 1IHMA 3E3MA 4H1HA 3HJUA 4MA4A 4ETNA 4MQ6A 2IEIA 3THWA 1H9BA 2XSZA 3EXIB 3R3HA 4Z9AA 5I9TA 1QIIA 4MQ4A 5FHQA 2OHHA 5T67A 2Y93A 5TQ2A 2PG3A 1OX4A 2UZ3A 3SDSA 5COBA 1SCQA 4UBMA 2Y0DA 2Z1MA 4F8YA 4JGBA 2EFEB 1E1QA 3KU1A 1YNSA 1AHHA 1F48A 1KMIY 4NJOA 3DYVA 1OWLA 1QIGA 3RT1A 1ZM4A 1G63A 3ECCA 4NEGA 4RLFA 4CMEC 3MF4A 2GETA 3EEQA 3STWA 2NAFA 1X80A 2ZR9A 1JG7A 3P9QA 4P2BA 4XVQA 4KAFA 1FS5A 2E55A 3GFOA 2B0JA 2VQDA 3W2TA 3PD0A 1K6EA 1BVYF 4WZTA 1PGJA 2Z3VA 3BFPA 1ISMA 1IONA 1DTEA 1CV2A 3H1GA 3EXIA 4QVKA 2C7RA 1PWZA 4LHYA 3H3XA 3PV0A 4OLFA 4UEQA 2O8VA 3K73O 1DG3A 5DK6A 5GAJA 3U1VA 3GF4A 1PJ6A 1GILA 2B37A 4WKGA 3QYAA 1AHPA 1FDWA 2GWRA 2OCIA 4XASA 2BKVA 4NMMA 3ZWPA 4X65B 2B9EA 1T4BA 2HLDA 1X70A 3ELDA 1JIJA 4CNBA 1KHHA 3GO4A 4IIGA 4HO1X 4HAVA 4PSKA 3CLTD 4PTZA 4WKCA 4B74A 5ADUS 5F9FA 3PPIA 2HSDA 3CZ5A 1WHSA 3FUUA 3I4CA 4BZXA 4ETMA 1LPOA 2G1JA 2JEZA 4PWYA 4H1UA 5AKEA 3TDMA 2JFYA 5JNUA 1H94A 3BJRA 2GZAA 2HWYA 2VXYA 1K06A 4X1KB 3EVNA 4HWOA 5CT9A 2AG8A 1CQPA 4QAQA 1I5OA 2JKYA 3L1VA 4ZYWA 2BELA 2NVWA 4EMBA 1PKVA 1T3SA 1IHPA 4IJMA 1IJEA 1KYTA 4C30A 2OFFA 5KCZA 2OYRA 4G0ZA 4OQEA 1K9MD 3IS3A 1DIRA 1RXCA 5JV5A 2YOHA 3F9CA 2REQA 5CNIA 4WEQA 1BTOA 4P7FA 4IJVA 4U3JA 1ZMRA 4AP6A 1GA4A 2ZR0A 1NRJB 3R2JA 4LVUA 5BV0A 5L3QA 1G5TA 2PZKA 2VP3A 2LWIA 1NW7A 2HTEA 3HKCA 3GLGE 4QOSA 1U8TA 1H2WA 2CJFA 4G6IA 2A1IA 2FF5A 1VPTA 3A58B 3QA9A 2P1DA 1U81A 2JIMA 2PBRA 1E3EA 1Q74A 1D8AA 1MN6A 3EPLA 3E03A 4UHHA 1VM6A 2O4CA 1UH5A 2PFKA 2VDJA 2Z2XA 3H97A 1RKVA 2W71A 3IHLA 2HBRA 3OUTA 5FNVB 5AO9A 3T9EA 1R8SA 4FFLA 2IUSA 3TRKA 2R9VA 1JF8A 1WUKS 2Z4RA 4TWBA 4E12A 5C53B 3E5RA 1Y48E 2D8MA 3L93A 3CB2A 4CMBA 2NO1A 3MWEA 2A5YB 1DJQA 1TECE 3IAS1 3S1AB 4ZK2A 3A04A 3G49A 3F2VA 1WDTA 2ECQA 2VF4X 1U0TA 3AILA 3ABIA 3WQZA 1R6BX 1PQYA 3P9XA 5K6AC 1DC4A 3ENWA 2VNKA 4QGGA 1N0VC 1MG0A 1KIAA 1PJAA 3A6GA 3B6EA 3GEEA 3QMVA 1XVUA 2L82A 4FFBA 1KE1A 1L3CA 3TLGB 5FDFA 4HDCA 4JVNA 1DL5A 1PJTA 3SQNA 1A9OA 5MFPA 4QXQA 4BFZA 4CTJA 3F67A 3UBTA 2NYAA 2B4YA 3EODA 4LEIA 3GGJA 3Q8WA 3WO0A 3VAZA 2Y3IA 4RCYA 1IJBA 5ES4B 4MRRA 3D5TA 4RH1A 5K4GA 4RKFA 2WC1A 4J2HA 3SMQA 4DCMA 2YUIA 1DCFA 2YUTA 5EVCA 1QU3A 2JFBA 6NULA 1KJ9A 4LNHA 1OH5A 3NHPA 2NLOA 2RHOA 3EC1A 3C4VA 4NI5A 1KDZA 1GAQA 2AZMA 4K9OA 2A30A 2QMEA 1H42A 1TVMA 3MTEA 4RXMA 3N76A 4OUDA 5GOTA 4CIBA 4J43A 1DBWA 2J4DA 3WI7A 4I9FA 2WYRA 1WQ1R 2A33A 2J5KA 5JBIA 4RTPA 3IAFA 5U1PA 1NTRA 4BQIA 1A7AA 1O97D 3P4XA 4PBRA 3DPIA 5DBEX 3B70A 3GJSA 2WW8A 2VP9A 1X92A 1UDAA 5ALNA 2ISSD 2KHZA 5LYYA 1MTOA 5B7QA 1V9SA 3SS8A 5CXQA 4URUR 4B6EA 1VLYA 4N6OA 4QOFA 2XZDA 4EUSA 1ABBA 3EDYA 2GN6A 5GTDA 1FP4A 3EYAA 3KPWA 2EIXA 1DIAA 1FVFA 2OSBA 1QRSA 3K9GA 3VR6D 1F3OA 2FRDC 3B2EA 5EMHA 5FFFA 3DCIA 1CZHA 4OI1A 1C81A 2XNJA 2EBWA 1YMQA 3RW9A 1LPSA 3QKRA 4L76A 5KVAA 1I94B 2VBTA 2EYUA 1XHLA 4DIBA 4HAWA 2IEAA 1FUEA 1FJXA 4CYMA 1E9AA 3PUKA 2XD4A 1DBSA 1W1IA 1UUFA 4NAHA 2JGFA 1MO3A 2W6PA 1RLUA 2W70A 3DE7X 3P4YA 4ND2A 1YFJA 1Q17A 2D2EA 3GGCA 4LYJA 3VH2A 3F1KA 2E82A 2QX9A 4ZANA 4HDKA 2MJLA 3W8DA 2ETVA 3PE3A 4R1UA 2B3TA 5G41A 4FDTA 3RV3A 1A95A 4F3CA 5EEHA 3B3JA 4BNGA 3AKDA 1UD5A 1NP7A 3WSWA 5I4CA 1RWXA 2NZWA 3NDJA 2Q4BA 1H4VB 2INGX 2IY8A 3OIVA 4O0MA 4XUGB 5EINA 3TOCA 4ZIRB 4TZTA 1AG9A 2GT1A 3N1UA 3NRBA 4EJ2A 3W8RA 2OGWA 3KDSE 4YDSA 4YECA 5HZMA 4AU1A 3D1JA 3LL7A 4J3JA 2N47A 2R6DA 2Q6OA 3C74A 3L1HA 4QWWA 3DDWA 4AMBA 2POQX 2OKGA 2ID9A 1IM5A 3GMDA 3KXKA 2R1UA 3RSSA 4QNRA 4C14A 3O31A 2YY7A 3L6BA 9LDBA 4DUPA 3UATA 3EAFA 1I0IA 2H18A 4URVR 5CB0A 2D5BA 4HLUA 2AHOA 3R5TA 2P30A 3L4BA 3BHJA 3N59A 3GG9A 3GLGB 1JKXA 2J48A 3HADA 2XZLA 3JSAA 1RRMA 5E0OA 1YZNA 5I8ZA 2EG9A 4DLUA 4JOSA 5TRTA 4Z4HA 3CMEB 2W0MA 4I55F 4Q15A 1UWKA 5LQMA 4FDVA 4CLOB 2VQSA 3L6CA 4G8BA 3S2IA 3LHDA 1SD2A 1XYYA 3ORSA 4JY7A 4UDYX 4XIYA 1K75A 1K8YB 5DPMA 3SDBA 1JH9A 4FCTA 2RGAA 2CK3A 2HXGA 1QFMA 5REQB 4E08A 5HJ7A 4GRDA 2X2EA 2BDUA 5FYDA 3S2GA 4XWWA 2CRVA 1C8KA 1CT9A 2DHCA 4RX1A 3CLRD 4LOLA 3PDUA 3FUVA 1U90A 3R1IA 5ALDA 5I7AA 4E3ZA 2X0NA 5HM8A 2VBCA 4ZOLB 1F5SA 3LSYA 1KI8A 4ZC8A 5A5EA 2H2FA 3O4FA 4YJ3F 2VNAA 4C20A 1WO8A 1OB2A 1U0EA 3CCUB 4RIIA 1PWEA 4HGQA 3K0FA 3MJSA 1XMQB 1E2DA 5CLJA 1W0KD 1VCMA 4PZPA 1E8MA 1AQJA 3ZYZA 2IS1A 3ZGLA 2VP0A 4PY2A 4I4TF 4OYRA 4EYKA 2IX3A 1XFOA 1CRZA 3QYFA 4KXNA 4AWBA 2JK0A 1UC4B 3GFRA 4C0AC 5BRAA 1Z75A 1GEEA 1YJ8A 2IVFA 4WNAA 1SC9A 1H22A 1KJJA 4A5SA 1IC6A 3G2QA 4JELA 4ARBA 5KNDA 3NIBA 4K6FA 3SD7A 2ZJ5A 4GXQA 5HWSA 3FFXA 3JZFA 2Q3MA 3JZDA 3GP8A 1PZXA 2K5UA 4U7FA 4DJTA 1ILEA 1UBGA 2PA0A 3DKRA 3ESBA 3BBPA 2ERYA 1BNCA 3D4NA 3D0RA 3KKEA 1I4OA 4P58A 1N2EA 4YJGB 1QVZA 3AW9A 4YRFA 4AY3A 4S04A 2XBMA 3ZE0B 4F1JA 4PYRA 4IGAA 3NM5A 1Z4NA 3O4GA 1DO8A 2ZZQA 4B31A 2EP7A 2AZ4A 4R98A 3DL4A 1RXVA 4I3HA 3VMMA 1RYHA 4ZRDA 2GBLA 3TCKA 3VU8A 5LP6B 3LGAA 2IDMA 2IQ5A 3R6WA 4M0PA 1K89A 1X8KA 3ZGOA 4JA2A 4PPGA 2G9UA 1C7RA 4C4PA 4EYOA 3EUEA 2QORA 4GEGA 4YVFA 4HWPA 2CNLA 3L01A 3PUIA 5TS3A 3TD2A 1CU1A 3B3FA 3LTEA 3TN7A 1XZFA 2B1RA 2WKRA 2Y9MB 2VZ9A 4ROXA 4GOMD 5FPQA 5A4MS 4XTRA 3MA0A 1J49A 3JARB 3OQNA 2YY5A 3EZ9A 1I2MA 3QVJA 4C5BA 4DLBA 1I7NA 1PS8A 4ZICA 4GYWA 2XTZA 3OZRA 1FP2A 3OTGA 2AMYA 4PLPA 4XB6B 3PE6A 3ZCVA 4PN3A 1O58A 4L4ZA 4JGIA 1UJMA 3P96A 3EF0A 5E7QA 1M76A 1EGQA 3GCWA 3PZBA 5LP6A 3C5HA 3QJYA 5EP4A 2VQEB 4XVHA 3KDPA 4XX1A 4M8SA 5ALTA 3QLVA 2DLCX 3SICE 1RWBA 3PBKA 1D6MA 1VL1A 3X0DA 4BNMA 1BCRA 1N8NA 1GSIA 3DKIA 4OIMA 2H54A 2B7BA 4TVBA 1ZU4A 4Z0TA 2NTVA 3ZKAA 1YONA 3C8ZA 2ZJAA 3TR0A 3UN1A 3WIOA 4HATA 1CF2O 1QHYA 3DVAB 4RWEA 2ZGVA 3MM4A 2VRCD 3WMWA 2FXVA 3QOXA 3VKGA 5H70A 3ZDDA 1H1TA 2QRUA 5F1OA 5IBCA 2WSSA 2HPAA 5JY6A 2J45A 4HLNA 2IUYA 4YRJA 4GAEA 3M70A 5AW1A 3R7BA 1M1ZA 2O7RA 4YTEA 1ZNXA 4JUAA 2K7FA 4K1XA 1K9SA 1YNOA 1YZKA 4JOCA 1B43A 1WXQA 5BW8A 2EWVA 2ZJ6A 1RQRA 2ZWIA 3EVDA 3PIRA 1CJSA 3D7KA 4N0DA 4Q1AA 4XQ9A 3T5BA 2IZ6A 2UUCB 2XITA 4RK0A 2H0RA 2ZI6A 4D5EA 4CIAA 4ISBA 4B4KA 1N2ZA 4ES6A 1XBTA 2OO3A 2P6MA 2JLSA 2BEVB 4A03A 3DVAA 3RWMB 1E9RA 5ECGC 5CB6A 4XARA 4AXBA 1XA4A 1RM4A 3OIFA 1GG5A 2HV9A 3H9EO 4PC2A 1DV2A 1HTWA 1G3IA 3Q4GA 4ZEWA 5CW1A 1JLRA 3QNWA 1U6IA 2WFZA 3KQOA 4ZV7A 4MW2A 2VR1A 4MXDA 3OPNA 4DM4A 1TUBB 4JXKA 2YHAA 3FSGA 1ZUD1 3TINA 5KI6A 4K9MA 5AKGA 3I6BA 3ZE1B 2QQ5A 1Z0ZA 3D4PA 4RHTA 4XDYA 2OORA 1ZM2A 3RT9A 4FN5A 3CW8X 4J7XA 4UARA 4D26A 4B3RB 1ORTA 1RRKA 1JWLA 5IC5A 5CX1A 1BS2A 4KOEC 3ZLUA 3FYSA 4TKZA 1K3UB 1Q0HA 3DW3X 1C3OB 4OMUA 1Z26A 1MMFB 1GU1A 1IXZA 3FOFC 3D81A 4KMSA 2IQIA 2QP3A 4DLKA 2ZPTX 4JLDA 5IYZA 1WB6A 5JU6A 4KN8A 3D7MA 2VT2A 5BSKA 1UM9A 2XR1A 2Z56A 3O2JA 4O2AF 4XYEA 4EGJA 1H0KA 2B69A 2RFLA 3I04A 3K15A 2YV5A 4N8SA 4WKNA 3SQXA 2PLFA 3DXYA 1T10A 2Q3FA 1YRQA 1Q3KA 4NOJA 4BVAA 5KNCA 1HMYA 1QLWA 1VI6A 1IEVA 1P0FA 4C76A 1SBHA 2VTBA 4H16A 3TSZA 3O95A 3IEKA 2ZJ1A 3AYZB 4HL6A 1QLHA 5DNEA 3RVKA 1NNI1 3SQOA 2AOTB 4QXRA 3W2HA 2M2IA 5AP9A 1ORIA 4EJ0A 3Q7TA 3K2BA 1GUFA 1PTKA 3JPYA 1A96A 2Q3JA 4MUGA 3ZE9A 1KOJA 3I2HA 1CZLA 4KDFA 3T5DA 5GIPE 1HFKA 1YR2A 4KR3A 3EXHC 1U28C 4EX7A 3WMXA 4B2IA 3CZRA 1MDBA 3T1NA 3OUUA 4R2WA 5JECA 3ERCA 1TB4A 3I5AA 2VJOA 4KRGA 3IPLA 4K9LA 3VVLA 2GQFA 4XWGA 1E3QA 2I7VA 5IARA 2ZATA 2WFLA 3EBOA 4MB6A 4LWPA 3OCVA 1SHUX 2G1AA 3AP3A 4X6YA 2VTVA 3V4ZA 4GPBA 3NONA 5DB4A 1ZJ6A 3TXAA 4ER7A 5FOQA 2DAPA 1T9KA 3VC1A 1P4AA 4QOJA 2ZIXB 2ZROA 3RFVA 5CYGA 1T0HB 3FPCA 4TUYB 3ULKA 2GK4A 1AF7A 1HA3A 4O63O 4G07A 1ZCAA 2VDRB 3OKPA 1MH1A 4R8SA 1F51E 2ZBUA 1BQ3A 2ZSJA 4K8OA 4BDTA 4CM9A 3SXJA 5AJXA 1P29A 3FY4A 1HE2A 2YRFA 4MS4B 5EE5B 3RSQA 1T5DX 4IWNA 2UUAB 1GCIA 4V1CI 1H2YA 3ABZA 4IJ6A 4REQB 4CTOA 1U7PA 1MX9A 1P7ZA 3PUMA 2NT3A 3JYLA 5JNRA 5LYJF 3ZK7A 2ZS9A 1QH1A 1TQ6A 2IUUA 3X1XA 4PRZA 1FDRA 4P38A 3C5WP 3QLUC 4KBFA 5ILQA 3WZMA 4EI2A 3P5BA 4TN1A 3HZZA 4GPAA 5DTIA 3KWLA 3W5DA 3KQHA 4RA6B 5A7GA 1DAIA 1OI3A 2BFBB 3DUFB 2F43A 1ZJZA 1E1LA 3OQIB 1RRVA 3G1TA 1BH2A 3RAEC 4GL2A 2WICA 1CQXA 3LP5A 1XWIA 4YCAA 2ZB7A 1O95C 1BX1A 3EVCA 1ISRA 5B7GA 5DI3B 5FR2A 5K0BA 2IH2A 5JQGB 5K2MA 4AX4A 1JI3A 2FHPA 1CEQA 4IZ6A 3MERA 2I65A 1KJIA 4JYZA 3D26A 4LFBB 3NTUA 4YT4A 2IX9A 3H17A 3LUGA 4PO1A 4REQA 3TJZA 1V1MB 5AXDA 1KSGA 5CVDA 5DLDA 4UXJA 2PLAA 2XRFA 5K1ZA 1PJQA 4ONEA 1VQLB 3ETLA 3W3AH 1RHRA 4G5YA 5ALWA 4Z4GA 1GL6A 5JSUA 2DFDA 4XVUA 2HH9A 3TTTA 2R66A 5LZ4A 1GQFA 3G3EA 3PNOA 3IR5A 3DDSA 4PZYA 2WG2A 2I34A 3OPYI 3DXZA 5JXGA 1PGPA 5B1EA 1XJCA 2RAUA 3KAKA 4MWTA 1YRLA 2Y92A 2ZI3A 1TLFA 2DPGA 3PPVA 1L4KA 1HDOA 4JC8A 3GRUA 5DI3A 3RSCA 1HFJA 4L4YA 5JQGA 2QDXA 2BI8A 1XLVA 5LQJA 2XQFA 4DN6A 4M1KA 1ZL2A 2CC2A 2XF8A 1H1LB 2QM3A 1ECLA 2IOYA 4PGMA 1RQLA 3HY3A 4J07A 3GVXA 3I0ZA 1T0UA 2WQ6A 4B34A 2QQFA 2MSKA 3KJFA 3SVLA 1Z0UA 1Q0QA 3PXUA 3PDIA 5CFOA 1XCOA 2YYSA 3ZHVA 1NXWA 3BMQB 1THZA 1NGSA 4R01A 4BB6A 3A14A 3GNLA 4L4UA 4UPDA 4CM5A 2C9MA 2K2QB 2WU4A 3EGWA 4ZI7F 2QLMA 13PKA 2FPUA 5I6DA 3MYRA 1GDHA 3T0GA 1LDNA 4W7SA 4CLXA 4CTNA 3ZHCA 1K86A 1UAYA 2XKBA 2FP4A 1BROA 2PS9A 3MYYA 2E4ZA 4Y0NA 5B57C 5BOSA 4D80A 1BO6A 1DRUA 1R9GA 3EIFA 3WYEA 3A9WA 3QE3A 4R7GA 1GPH1 1ISFA 4N01A 1F6BA 2HK6A 4IM7A 1JVBA 4M60A 2JGJA 1LPMA 3NNNA 2LGJA 2HDOA 2WZBA 2H59A 3A4NA 4K9RA 1TQ4A 4H17A 1WSBA 4P22A 1YDGA 1D4AA 1ZK2A 2PUHA 3AGQA 2VJNA 2XMZA 3DMHA 4PR3A 4JMPA 3AOEC 4CMKA 4LCJA 3EN0A 4AM8A 2V55B 2C5BA 3AKYA 3BTOA 2XGJA 1JQDA 2CXTA 1RXYA 3BIWA 4KTTE 1U8EA 4EPTA 3PF9A 4ZAYA 1Q44A 4CIDA 4N9QA 4F06A 3CZQA 5E6UB 2IYQA 2ZTVA 5BYAA 2W93A 3R0QA 2I22A 3DLAA 3T06B 1OX5A 1FU4A 5HDBB 3IESA 5C4GB 4ZFNA 1R4NB 2J3KA 1VI5A 4ZREA 1KBZA 3HS3A 3KZXA 4AJOA 3ZW9A 1W5AA 3WGUA 4EO4A 4HMOA 5EWLA 5KKCA 2Q99A 5D3MA 2HCTA 1GV0A 4Q4HB 4G5RA 1EVYA 4JITA 1BKYA 5DP1A 5EJ6A 5KTPA 2AFHE 3CLKA 5KUTA 4HD8A 3UIEA 3IT2A 3RU7A 2PSEA 4UFOA 1ILWA 1GUZA 3ND9A 1OJ7A 2ISQA 4CI9A 1N9KA 2YHUA 4Q7MB 4L9AA 4QM6A 2O2ZA 1KDTA 2PH5A 4NBWA 1GNRA 1HFWA 4WBSA 4WCDA 1W88A 1ML4A 4YUYA 1PVOA 5T7BA 4NS4A 5AW0A 1NSYA 1UD2A 3JQQA 5KYYB 1GOTA 4WOCA 5IJ0B 4MA0A 4A2QA 1QYIA 3EIUA 8OHMA 1XDBA 3BGOS 1HETA 1E69A 2NSDA 5JZVA 4O4IF 4Z99A 2AN3A 3VKHA 2FUG6 3DZCA 2AOVA 1WX1A 4IUYA 4UDNA 1VXRA 1H05A 3QOFA 3OO0A 3WO1A 4F9FA 3WLSA 5AIBA 5FBHA 2PX8A 3B9PA 1P0CA 3VOAA 3KYCB 3IOEA 4X95A 4IV0A 5C7LO 1BD3A 2PV0A 3ZPNA 5ALZA 4RXUA 1KEZA 4JROA 1UWCA 3DYBA 1IU9A 3D1VA 4MPTA 3TQRA 3GAMA 1KEEB 1E1MA 1PUJA 3T34A 2GBIA 2VK2A 3WGIA 4Q1VA 3I2YX 4YWHA 1FMLA 4BB0A 4PTYA 2D74A 2HGZA 5IJ0A 4FHZA 1GSAA 1P44A 2X6XA 3GX1A 5KNDD 2GFQA 1E7MA 1N2IA 1SHZA 1T15A 1X39A 3HJHA 4HDNA 4O02B 1T0BA 4OQ4A 5D01A 2VF2A 1U8AA 3CZPA 3JPWA 3F0TA 2KJQA 1P7WA 5ED4A 1OREA 1WVGA 3VPBA 4RPBA 4Z1OA 1KMHB 3HXTA 2F17A 3Q88A 1TD9A 1QR2A 2JAHA 4CG0A 4IGEA 2IHBA 1E0KA 2Z9DA 3KQYA 3ZY3A 5A9SA 2CYAA 2ZXIA 1RCFA 5IHPA 3DTVB 4AKGA 5KTYA 3HDGA 1GRRA 2YOFA 1E89A 4I1RA 3LCJA 8ADHA 3V1NA 2J3HA 1VQOB 2E6KA 3UFXB 2RI1A 4C2TA 1SUAA 2FW1A 1PAUA 3DE3X 3RHFA 2XT9A 1PJ3A 2H4HA 2WYVA 2Z6AA 1PT8A 1RCUA 4INZA 5I7SA 4AYWA 4YYZA 3EVZA 4UNNA 5KPJA 4QREA 5LLSA 4ZYYA 1UBNA 1LZKA 3MWJA 5EEGA 4GL4A 1DVRA 3ZLJA 2ECFA 5A0TA 4RKQA 5GIOE 2QTZA 2OV6A 3AIIA 1RLJA 4O1MA 4PYOA 4RJJA 1K08A 4HHEA 1TK2A 2X19A 4JWTA 4MV0A 3D4OA 3DTVA 1SMKA 2RHRA 1X0VA 1TQ8A 1YB1A 1OV6A 1ZGBA 2X22A 4MLPA 4PBTA 3VKVA 1L6RA 5LQAA 3SIRA 1JL3A 3ZW8A 2HREA 1N06A 4I4IA 4RPHA 1IDOA 1U2DC 3B5JA 4IG9A 1K3FA 4YV0A 3EVEA 3OLZA 5HNKA 2WHYA 2IVZA 1Z8DA 3QU9A 1EFHA 1Y8RA 4MA5A 3DJYA 5CM2Z 4R9RA 4DB4A 3LX8A 2H52A 3P9NA 4EB0A 2O7NA 5B6JA 1Y0YA 2ORIA 1WL8A 1M1YE 1Z7BA 3FCEA 3OPQA 4LSZA 1E9DA 1T9GS 1TGYA 2W8BA