2C2WA

The fluorinase from streptomyces cattleya is also a chlorinase. structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The fluorinase from Streptomyces cattleya is also a chlorinase.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
total genus 74
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c2wA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c2wA01
2CC2A 2Q6LA 5LMZA 2C5BA 2WR8A 2C5HA 4CQJA 2Q6IA 2ZBUA 5FIUA 2V7XA 2CW5A 2V7WA 2C4TA 5B6IA 2F4NA 2Q6KA 1RQPA 2Q6OA 2V7VA 1WU8A 1RQRA 2CBXA 2V7TA 2ZBVA 2C2WA 2V7UA 2C4UA
chains in the Genus database with same CATH superfamily
4GL4A 4NEGA 2HU7A 2Q1UA 4R5MA 4KUGA 1B4DA 1RXIA 5SZJA 3WFZA 1Z29A 2XUJA 5BWNA 1QOPB 2VJLA 5JJKA 3BK2A 1CEEA 3OPYI 2J3DA 2W6OA 5FIUA 5G40A 4F2PA 2HBYA 5HUQA 5JFOA 1K8QA 3ORFA 2JPDA 3H9GA 2YFHA 5J5AA 2BGIA 4CE6A 1IBRA 4KO8A 2PV0A 5AXCA 4Y98A 1JKJB 1JTFA 5LWQA 1OFIA 4XWYA 1DAFA 3B48A 4FS8A 4ILEA 1S0UA 1Q44A 2BFCA 2V59A 4WESB 3V3KA 2Q7XA 2OE2A 3ZY2A 4AULA 2C58A 2CNLA 3DNFA 1RHJA 4K28A 1NN1A 1IZ7A 2ALJA 4W9MC 3SSNA 3BD6A 1ZGCA 3T51B 3ROTA 3OE7A 2ZJ5A 2AH5A 3IUPA 4BN4A 5FNVA 5ICCA 2HPZA 5D8DA 3TLBA 2ODWA 1KSFX 2P35A 1A9QA 1WG8A 3AEKA 1RS0A 1N8RD 1Z0KA 3EYAA 1TK9A 1CETA 2QP9X 1Z18A 8ABPA 4D4HA 3EC1A 1L7AA 1OIVA 3UB3A 2VJNA 3SFZA 3K96A 4Q02A 3A1DA 4BMXA 4TYYA 1GPBA 4N0QA 2HUPA 1NR1A 3RFXA 3VNAA 3WRYA 2J45A 3R8FA 2IF0A 2D9RA 1VQMB 1X19A 2Y77A 3RFUA 2NWQA 3TX6A 1Q7YD 4MUKA 2OA0A 3VPHA 3MRSA 4ZK6A 5E6UB 3O3CA 1DBVO 2ZRNA 3WOHA 4HB3A 1KRHA 2VYQA 1DKNA 2ID9A 4R54A 1O7JA 1J21A 2O5RA 3AVXA 2ZBVA 4NOKA 1CULC 1X92A 4CTMA 4ZJUA 2Z57A 4F86A 1UZNA 2VDUE 1NC1A 2XYGA 2VBGA 2VDVE 3ASQA 3U9SA 2GPYA 1LJ8A 1KAGA 4G86A 1ZP6A 2CE7A 2BUBA 2ETXA 4HZUB 4WLFA 4D8WA 3DG9A 1O6GA 1P5RA 2XOEA 2GS9A 3BMXA 4BFCA 2EFGA 1DIAA 5JCXA 1RRVA 2E85A 5B1IA 5EHZA 3BGSA 2A86A 3KTAA 5FTJA 2ZYWX 4HDOB 4O4LB 5L3SA 2GPNA 4Q82A 2ADFA 4F1JA 1ZMRA 4B3SB 1W44A 4ZI7A 2HA7A 3VSEA 4OH1A 4DPMA 1J7KA 3A3KA 3AR8A 3D3KA 4H31A 2VOEA 3QFCA 1TJ3A 2BGTA 5JADA 4X20A 1K5DA 5GZ6A 3ONNA 3UATA 2B8WA 3BBPA 1JAZA 4N65A 2MWMA 1TTTA 3EGDA 5EP1A 4KAFA 5DF1A 2J3LA 3PQ8A 3HGMA 5A06A 2F8LA 5ESRA 2VI5A 2J0SA 4EECA 3ZQKA 4AMBA 4DR2B 3QGMA 2BCGY 2VP6A 1XEWY 3ON5A 4Y9UA 3RU2A 1JSRA 1N5IA 3KFLA 4LZJA 3THRA 3THXB 4P38A 2QW1A 4YRZA 3FH0A 5AW4A 3TK1A 1X1BA 3OVMA 2Y3IA 5DM70 3MK31 1JHXA 1OLUB 4HG2A 4O0MA 3NFYA 4MNTA 3IOYA 4IDCA 2VJQA 3KBOA 4M0EA 4IIEA 9LDTA 5AVTA 3COYA 1E1CA 4ASUA 4XLHA 1YULA 1G66A 3A37A 1UC5B 4NYIR 2IYAA 3NWPA 1MX1A 3UK7A 4B09A 2ZWMA 3O47A 4YGYA 1RQXA 2PSFA 3FI0A 3SEAA 1NBME 3RAJA 4R98A 4PLCA 5FO1A 3IBFA 3T95A 1RWPA 1L4HA 1WHTB 3LQ2A 1QJCA 4YJFA 2C4VA 3ESQA 1M83A 4P80A 2OTLB 2HBZA 4JLKA 3DZDA 1RC0A 3PEUA 4GW3A 1HVXA 1SQFA 4EHFA 2WB2A 2MSEB 3PEEA 7MDHA 1ZS9A 3BZBA 3FNRA 2EU8A 3IQEA 4L0QA 2VZLA 3CPXA 3S1LA 3JQQA 1I36A 3E3NA 3K9QO 1JLLA 2VDWA 1REQB 2F9FA 2XW6A 4K3UA 4N7MA 1DWQA 4Q5IA 1F12A 4W5HA 1L1QA 3M81A 4DCTA 2F67A 5IFKA 4B85A 2EL7A 3HCPA 4I9UA 3SS9X 5HNKA 3FGZA 3KYIB 2V4ZA 2HWWA 3DQPA 1EGMB 4KQ9A 1Z5UA 4M9QA 4R16A 4MW0A 3P27A 4OP2A 3D6TB 3GLVA 2FF5A 4R2LA 4RLFA 4AG5A 1ACLA 1JI0A 4E5SA 3P96A 3GH1A 3TW6A 2VR1A 3PFHA 3S29A 3EC7A 2G28A 5DHUA 1UD8A 4JDUA 2Z5FA 4HUJA 4JGGA 5HILA 2D0PB 3AHIA 4X6LA 1D6NA 4X60A 2BEWB 1NVWQ 1U1FA 2PUTA 4MGEA 1PK8A 3LGAA 2JAUA 3SQDA 4UD6A 1YR2A 1PJQA 2ZRHA 2E9SA 2OB1A 4LDAA 4PU0A 4FN5A 5GZ1A 4WCDA 4J1NA 5DHQA 3ZNOA 3QVJA 1WSBA 5JPCA 1CDDA 1L3IA 1XFDA 1OU0A 3I76A 1WLSA 2W4MA 3ICVA 4FZRA 2HLHA 4C4AA 5EN4A 2P3SA 4F2DA 3IPLA 1KQSB 1OWMA 2EC5A 1DAHA 2JH3A 1CUAA 2XE7A 3GPCA 3GZNA 1I9CA 4A5SA 4AUKA 5AXDA 4YMGA 5KYYB 5EXSA 2AFHA 3UGQA 5IZCC 1XBTA 4TWBA 2GPAA 2AI3A 4MMXB 4MVJI 3WYGA 1ACJA 2QXYA 2R8YA 1DINA 1U5BB 2D3TA 2GHRA 2GSDA 1Y0BA 3T15A 5EY5B 4CYMA 2ZUDA 3TAXA 1Z0AA 2NUPB 4RSMA 1JIUA 1M1NA 2V7PA 4ND2A 4NHEA 3RSHA 5CFLA 2OR3A 1ZJJA 3FCOA 2P30A 1SUSA 2HIGA 1C1DA 4R81A 4ZCQA 4J7CA 2BEVA 3PPYA 5CVVA 3QY9A 3TB6A 4CL8A 2R79A 4DEXA 2DPLA 3ONDA 3UHFA 2X4LA 4RJJA 3LHKA 4D5GA 4ZI7B 3DBVO 3GRZA 3HKCA 1IULA 3UB4A 1YS6A 2PXAA 1TGYA 5AHWA 4KL8S 3LLUA 4G84A 1B8VA 4JQYA 2PS1A 1IWBB 3B9PA 2ECOA 3V4LA 5DYGA 3VHQA 4CM1A 3DAPA 1A2KC 3WFIA 1ONPA 2JJ8A 3MLEA 3PD0A 1RI1A 4OBBA 2ZATA 4ALJA 4M54A 1K7FB 2NMVA 1RMYA 4R8MA 2GN1A 4XYBA 2CLDX 1EKXA 2QRKA 5REQB 3VO2A 1P7CA 5BY2A 1LS6A 2W98A 3CEPB 3SP1A 3JVDA 3R3XA 4Q1CA 3U3ZA 1E2UA 4KRGA 2PVCA 5TARA 4EJMA 1CRPA 3A1VA 4X5OA 2NXNA 3MAAC 2G76A 4JELA 2KMLA 2VCYA 2X4GA 3VPAA 2UZ3A 4JLNA 3DDUA 4KXWA 5ESDA 3SPXA 5I9IA 5F4MA 1TMYA 5JRJA 1CWUA 3DFUA 3OPVA 2AN3A 5CG2A 2OGUA 4UM9B 1NQ5A 4XXHA 1CE8A 1ZGHA 3GGPA 2FGKA 3M33A 1LW7A 3OEYA 5JCOA 3UF0A 4MP8A 3TKLA 2VPTA 3CWZA 4BJ5A 2Z6VA 1WF6A 2ORYA 5K09A 5GM1A 4BVJA 3RD5A 1UBSB 2J4FA 2HT6A 2FLKA 1ZH0A 2JBHA 4CL0A 3TG2A 1WHTA 3AZQA 3I2FA 4L5IA 4NCXA 4WUVA 4YJFB 4OK3A 4DADA 4ES6A 5CB8A 4HLQB 4KQHA 5I8ZA 3G71B 1FDWA 1V7PC 5I4BA 3MUOA 1C7RA 1G8HA 1QJ4A 3HLKA 3IYLW 4MHTA 1E20A 5JARA 4UQLA 7REQB 5CGZA 1PR4A 2QVZX 4UHFA 4IHJF 1KY3A 3O4FA 3PLNA 4RIFA 1FYFA 3WDLA 5CD1A 3E3MA 1LI5A 3DVLA 4LMBA 5JI2E 3AGPA 5FTKA 4AJKA 3QA3E 1S3IA 2W2MA 2X42A 4NP6A 1UKEA 2OP1A 5KHAA 2V7BA 2W37A 3LUBA 1OVMA 2BJHA 5YASA 3E15A 3S55A 3SXUA 3AL2A 3TRDA 5A2QA 5G3YA 5U4XA 2ZZFA 4UFOA 4TLLB 2L17A 4EA6A 4RD4A 1M8PA 2XLCA 4EKNB 3P1JA 1A97A 3GZTB 2IUUA 1A5BB 1U7TA 1EFLA 2G72A 3RCBA 4YJ3A 2DF8A 2BPOA 3UWKA 3WWZA 2I80A 3QVGA 3ZOZA 4CF4A 4DIKA 1PWXA 1I51A 1RXYA 1XVUA 3AJDA 3N39C 4I1IA 4HWTA 5FI0B 5L53A 2O5CA 4PX3A 1QPBA 4URYR 4FOSA 5L3QA 2PYDA 1L4UA 4AKHA 3FZGA 3IUBA 1JDUA 3P0RA 2QJFA 1Z4QA 2D1YA 1OH5A 4XZ3A 1NJ1A 2XGJA 2DPGA 3KLPX 1UMDB 2ZIUB 1UDCA 2YDYA 3TLKA 3ADKA 1B8OA 1EBUA 3NWEA 2HK7A 1EDDA 1XJWA 2I54A 4G0OA 4M89A 4NQRA 1X6VA 5KCMA 3TUJC 2QG6A 1KSJA 2ZT8A 3EFOA 5JSKA 4ZEOA 1IZ8A 3WP1B 3CRVA 2ANBA 2JIRA 5D6OA 2V6MA 2VHQA 3C3JA 3L77A 2QEQA 3GMSA 1US8B 1NYLA 2C5FA 4YNBA 1KNXA 1FTWA 1SMKA 5E6TA 1EZ1A 3CSSA 1HORA 2Q07A 3DM9B 1HMYA 3JPYA 1OPRA 4MTCA 4C3VA 3I6QA 2IHVA 1HXHA 4R05A 2Q1WA 1Q1GA 1FPMA 1V95A 2F8MA 2VPYA 3CH4B 2O8CB 3W5BA 4MQMA 3CMCO 3KWMA 2C5LA 1R6BX 2ZS9A 3HMQA 1X7WA 1SHKA 2AI1A 4AUEA 3H5AA 2YH2A 3A1UA 1YJXA 3VM6A 3TFQA 3N8IA 5KWJA 3TZLA 2JL1A 3CZ4A 4L5AA 2A1UA 1O5IA 2GD2A 3C97A 2PA0A 2HRRA 4W9NA 4CMBA 1W6UA 3I58A 1J8YF 2VATA 4JGBA 3B2NA 4XDYA 4XSGA 1G5PA 2FWPA 4FMBB 2JJYA 2EHJA 3HUUA 4ZVLA 3GJZA 2PRIA 3TQQA 1A2BA 3BRSA 4II7A 1XELA 4GI7A 1LCIA 2ZB2A 1Q77A 4GBMA 4QFCA 3RKSA 4L4UA 2A67A 4HDMB 4AVZA 2FX5A 2NNWB 4YACA 2VKQA 3IIEA 3B6KA 4IWYA 1ISFA 2GYYA 1EHCA 3ETHA 4HH3C 4JC5A 3V7AA 3PB3A 3RRNA 3ZVLA 4ALIA 5BSKA 3I39X 2AFIE 2JFYA 4MPDA 4TZ6A 1R15A 3R3JA 2YJZA 4IZIA 3LQ6A 3L05A 6NULA 1JH9A 3IIIA 4Z6KA 4P7FA 1I0ZA 2WEKA 1T2UA 1NZDA 3IKLA 3HJBA 1IY8A 1EEHA 3C4QA 4QVJA 1N5MA 2AJ8A 5JZ9A 2PJZA 5IT4A 1SBNE 4JP8A 2ZIVB 1JXOA 3BD7A 5KZMB 3KTFA 4AO8A 1UD4A 1XQBA 4J6FA 1EXVA 3SE0A 3RRFA 4PYQA 3TGPA 4LRUA 5AM1A 1QG0A 1XF9A 4I9FA 3W05A 3UNXA 3LXUX 5L7TA 4DKJA 1EG2A 3PNQA 1DT5A 1PR1A 1RMTA 1WKBA 1NB9A 2GFQA 2ZRDA 1U0NA 3BL5A 5LQCA 2A9PA 1UMCA 3S99A 1BSVA 3ZE7A 2G40A 1G2PA 1H3EA 1UPBA 3ZI4A 4ND6A 4CL2A 5J47A 1FDVA 5CNJA 1LXCA 2EFYA 3D0OA 2OC9A 4H3SA 3MWJA 4FBMA 4LDQA 2J9RA 2WTMA 3CV3A 4AJ4A 3P97A 1WSVA 3Q9LA 4MICA 3PL1A 2C5HA 1ZIXA 1XTUA 1KI3A 4BO1A 3WLRA 3SM9A 4A0QA 1DXHA 2F00A 5IABA 4ZAXA 3FDFA 3KQOA 4RGQA 3C8MA 2RGAA 1AXGA 4KKVA 1VIYA 2H2HA 2YHIB 3DAYA 1Y8RA 3ZKAA 4O1MA 4S1VA 5IDWA 1T36A 3IAM1 2AIRA 5CLFA 2P2ZA 3DHWC 1JYSA 1U0JA 2PE5A 2JAOA 3Q7IA 3HP1A 2H4JA 2A0YA 3BWYA 3U3JA 4WLOA 5IJ0A 2JN9A 1IRIA 4MRMB 4UPVA 2ZI5A 4J3FA 4S0ZA 4AWBA 4JXXA 1MABB 1VMAA 1JG3A 4HUQA 4X24A 1TAGA 2GJ8A 4GLLA 4J8PA 4AX4A 1BVHA 4D96A 4EB6A 1SBZA 4Q9AA 2QZ9A 2IW1A 2C5AA 4UXJA 5DM0A 1LS1A 3DKKA 3U4QA 4P53A 1C3OB 1VE7A 4R8VA 3WV5A 4G36A 1ZLXA 5AQEA 5AXBA 2B1JA 5LM3A 4CF3A 4XVUA 4P5EA 2AA3A 2YY6A 5DBOA 3HKBA 2Q3BA 1QQ5A 1GCOA 1Z5VA 4RD1A 3WSVA 3DBRA 1NR7A 1T8PA 2QAGC 2PMCA 3HP7A 1VHQA 2WILA 3LG2A 4AMVA 5L9AA 1OI7A 1XMSA 3DEIA 1I7PA 3FMOB 5DX0A 1PU2A 5JW6A 3JASA 4EHIA 1RAFA 3V42A 5EHXA 1YQTA 1GZUA 2OD7A 4V1CB 1WOMA 2B37A 5AI8A 1ZL2A 4LDNA 4PAQA 4EPXA 1O1YA 1R0KA 2A84A 1SCKA 2G7ZA 2M6SA 1DJPA 4UZFA 1VL8A 2ZE7A 4KWTA 4BN5A 4JV5B 3V6MA 3L4BA 4BP8A 4BL5A 3A9CA 4IIFA 3GEGA 3OPYA 2XQJA 3L84A 3ZCPA 1C9MA 1GUAA 3FFXA 4C06A 4B8ZA 3C5WP 3VU9B 3WKCA 1I6WA 2ZT6A 4RFLA 1B3BA 3M5DA 4E1BA 3WLNA 4BNMA 1XKQA 3BQ9A 3CP8A 1EK1A 4QGHA 4L5BA 2W0SA 1IOZA 2EJTA 2XECA 3IPAA 5CMLA 4EY4A 1V8OA 3LKZA 3REOA 3FPPA 4JVLA 4WAUA 3DTNA 2ZJOA 3NETA 1FU8A 3GMTA 4IF4A 2C8JA 2QLMA 2IQIA 1BCRA 2D74A 1UWCA 1UBHS 2X14A 2FPPB 2G4LA 2IXEA 3SF8A 3E22A 4DV3B 1TZJA 1FYEA 3LMKA 5D5HA 2NUTB 4E5PA 2CHGA 2QGZA 2QTCA 2VQEB 1O5OA 2IYFA 2WUEA 3SJBA 2FN3A 4AYWA 3RNLA 4JI0B 4HXGA 3NQ41 4DABA 4DCOA 4KXNA 3GLHE 1QCCA 2RBEA 3QLEA 4RDKA 2CFRA 1YXMA 2VUUA 4O29A 1T9BA 3WWCA 4AW9A 3IA2A 4TV9F 4D8YA 2BFCB 4U9HS 1KJIA 4D3FA 2P7IA 2JH9A 4WVLA 3RSCA 4NNOA 2Q2OA 3QA9A 4DWJA 4YP9A 4EVSA 1KQGA 1PR9A 3PR3A 4OEHA 4HJRA 5C46F 3JQRA 3SM3A 4G3XA 4IXDA 2UUAB 1FSFA 3K1AB 3AL0C 1T3LA 1QWSA 1LK5A 4G1UC 4QU8A 2BTOA 1BWPA 1NQTA 2FW7A 5ED0A 3TLYA 5IJWA 3L5KA 1FNSA 4UOEA 1E8DA 2F8TA 5JO9A 4LSMA 1YU9A 1P3DA 2QMEA 4MAFA 4DN6A 1VQKB 1Y6QA 2N1MA 1ARZA 4OL9A 2Q21A 2PK3A 3GLSA 4F71A 4ARAA 1EFPB 4BVHA 4IJ6A 4P35A 5A7FA 4OGWA 5HOQA 5IH7A 2EEZA 3GLHA 5HZBA 4MW9A 2KSQA 5DPMA 1YX2A 2YOFA 3OF3A 5I7RA 2PR2A 2AFVA 4HH1A 1Z25A 1QCYA 3RSFA 4MWGA 3S2FA 2LPMA 4GOND 2ZXHA 5JYCA 1Y34E 3HVJA 3IP8A 1WCIB 2Q6TA 5EYPB 3P9YA 3UMFA 4H17A 5A0FA 2I4TA 3E3LA 2IPNA 4HDKB 4OJNA 4PZCA 3TLGB 2JGNA 5EUQB 3ICOA 3GWZA 3RQIA 5JSZA 2DPMA 1DUVG 2PH1A 4O8ZA 5KOHA 4NYJQ 1NPYA 1XDGA 2ZIGA 5BN3A 2GPTA 2GETA 1GFZA 2I5PO 3AM1A 3DBRB 4OX9B 1ZUD1 4M7PA 3AR5A 2EAUA 2YNMA 3HUEA 5HJEA 1CY2A 5IUJC 4RL4A 5B4TA 1U7XA 2EG9A 2WU1A 2I4LA 2VA9A 4LHYA 4LJ5A 1TUGA 4W1SA 1L5KA 3WMRA 2GK6A 4AIRA 1EFTA 4Y1RB 1C0KA 2MMGA 5K8LA 1X7DA 1NF9A 3I9NA 1N2ZA 1YC2A 3P0IA 4QC2A 4KREA 3VR0A 4Y9SA 4OQFA 5B6JA 2I6XA 1AJEA 4FGKA 1ZXLA 2Q6LA 2WJWA 1O6ZA 3E7FA 4ZEWA 3ZC3A 4CIWA 3KLNA 1J1UA 4FI3F 3A1TA 3AUYA 4ZOEA 4XGIA 3RYCA 4JHLA 2CDRA 2OHGA 2XTAA 3CC4B 1IIRA 1DZIA 5FPPA 1FS5A 2PUHA 3DDOA 2Q4EA 3BSYA 2WLTA 5TQ0A 4A73A 1SVUA 1GDHA 4I7EA 4Q1AA 3GT3A 4YPFA 3L4KA 4B84A 2BN4A 5KVAA 3V46A 1V8ZA 2NG1A 2D5BA 4U7PB 3SVZA 4DIMA 4WBXC 3JAWA 2PS0A 2C7BA 2X86A 4CMJA 3RSGA 4DSAA 3ES9A 1RSZA 2YWGA 2WUGA 4WFJA 3I4FA 2IW3A 3W9UA 3V7WA 3VH1A 1R6UA 3C3BA 1ESCA 3UMVA 4YDSA 4NK5A 3SVLA 3Q8XB 4K81B 1LRLA 3SYLA 1F2UA 3JAMA 4TVKA 3G5UA 3TFWA 1UM9B 4Q7EA 1ODSA 2PRKA 3AL3A 1UDAA 2NV0A 3EDYA 3PGKA 2PEYA 4G2NA 5E8RA 5ABPA 3L4BC 3MLBA 4PO1A 5CU7A 2WYRA 4O4IB 1TQ8A 3TIFA 4DARA 2HCRA 2CXHA 1BDHA 4HEA1 4MV9A 1GQRA 4ENVA 4E51A 1NMSA 5DW0A 1MG5A 1T24A 5J2TA 1XK7A 1DUIA 5CPBA 1DAPA 1K0FA 4TMTA 2QTVB 2Z30A 3FB1A 1T1IA 4A91A 4DLXA 5B6IA 2ZRCA 2AOTB 2QN1A 4FWBA 2V9PA 4B6PA 2X0DA 2HMUA 2QGGA 2AC7A 3ORHA 4QECA 4Y2SA 1EP1B 4OYYA 4ASUD 2E4WA 1YACA 1RWWA 2H4FA 2ZUVA 3CTPA 3K0CA 2GJPA 2XF2A 2HGZA 3CURA 3N7AA 3EISA 4XLAA 1AKVA 1T10A 2YNMD 3D9QX 3O94A 3QWHA 4GEGA 1AQ6A 3KWLA 3ENZA 4QULA 4IVQA 1W36B 2WAXA 2HHLA 4UW9A 1Y8AA 3F73A 4OXKA 4Z8XA 1P1KA 3RUCA 4E4RA 1MC1A 2AYYA 1ESMA 1XA3A 2RGEA 3G6EB 2LV8A 3BWDD 5B3JA 1AGNA 2IHZA 3U7JA 2QX9A 2X5JO 1UPTA 2QG4A 1Q11A 4C76A 1SCBA 2YV4A 1V5GA 1FW8A 4HGYA 4ZHQB 3NUZA 4QXQA 1K9MD 3IUNA 4R83A 2CFSA 1L7PA 1VKZA 3ND7A 3ETEA 3PFIA 4YJ2F 4D6YA 4XSVA 4O63O 1E6CA 1KJ8A 4YRDA 4RY8A 2G1UA 2PNFA 2YUIA 4YWJA 1SCDA 3E1KA 1NX6A 4LC9A 1D6MA 4KDFA 4RSHA 2C84A 2NSDA 2WAAA 3MJRA 4DT1B 1T43A 3QEMB 1MCZA 2QY9A 4Q05A 2QQEA 4FQ7A 3BCHA 4I55B 2GK7A 2QL9A 4HXYA 3S2YA 1W36D 1T9KA 4U0JA 3QEBZ 3A11A 5KNCD 2FLVA 1D2CA 2P77A 5CAEB 4ZQCB 4DGSA 2CCJA 3RK4A 3ESYA 2B8EA 4NY1A 3TJZA 2QW8A 3A8JA 1XTZA 3QWFA 4AXXA 2G5GX 3FDIA 1V48A 4QUJA 3A2LA 3FG9A 4Q4AA 1SUFA 3RTBA 1EP2B 2GYWA 2R1TA 3BFJA 1NRIA 6REQB 5FA5A 4HAYA 2Z83A 2NQ8A 4DM4A 2P2NA 4X8OA 4OMUA 4PAOA 4AD8A 2A5JA 4AAYA 5KJCA 1PDVA 2H59A 3EFHA 1HT0A 2FZ4A 3L6BA 1C29B 3PA1A 1SULA 3GGDA 3L8DA 4RGBA 3M6IA 3EAGA 3JQFA 3Q5DA 4A2CA 5C81A 5CLQA 3U4CA 1VPWA 4P1ZA 3VC3A 2G1AA 1NFFA 3PXUA 3MD0A 1MU0A 2OWEA 2VT3A 1IPHA 2RBGA 2OXEA 4I5DA 5CDFA 4M99A 2Q9CA 4B6FA 2WYHA 1YVPA 4RLQA 3OD1A 3S6JA 3JD1A 2AOTA 2HFJA 1MNQA 1R4MB 1SVOA 4XLEA 3R0XA 3VH3A 4UZEA 3VPDA 1JL3A 3AKZA 3DBLA 4X1IA 1USVA 3GFVA 5TVGA 3NOXA 3S8EA 1A5SB 1E94E 2NZUG 4KBGA 2CF5A 2AC2A 4WW0A 4WSOA 3UMMA 4FEGA 4GPZA 4QJ5A 4HWOA 4WDRA 5FFNA 2JLWA 1OX6A 2JA1A 2IOHA 4XQ0A 1SZPA 3KE9A 2RHJA 4KE8A 4FFMA 1RT9A 1JEJA 1QHNA 3EY4A 1GRNA 4NV1A 5D2CA 3SJUA 2C0PA 1FDIA 4MQLA 4REQA 1CZKA 1L9KA 2FK8A 4WKCA 5BSEA 3PEWA 3N0VA 3ECSA 3OOCA 3K1JA 3OJCA 4G81A 4RYDA 5J63A 2AXPA 1Z3IX 2H54A 4ZDWA 3W8FA 2QBYB 2WAYA 3W3AD 4BTVA 3WLIA 4FYIA 1CUHA 3TZ6A 2LIVA 2ZSKA 2P4HX 5IEBA 3SICE 3LT2A 1T5BA 3KOWA 3JD2A 4LJ7A 4X3PA 2XA9A 4ZVTA 3HO8A 4W9NC 4MZXA 3BHMA 1KJYA 4ZTZB 3AVYA 4WXPA 2XMZA 5LL6P 2W2LD 5K8TA 1FX0B 1YDGA 5FTWA 3UK6A 2C04A 2IYVA 1EXWA 5A9SA 7REQA 3M1LA 4CI0B 1GKLA 3K1TA 2Y8EA 3BT7A 1GGHA 3J7AC 4OQYA 4MQ4A 2PWAA 3I6ZA 3B89A 1GVHA 3SLDA 5HR5A 3OQMA 3CBGA 1CUUA 4AQDA 1ML4A 3SLKA 3PDJA 1FDUA 4C87A 4DJDC 5LNK6 1G4HA 3PNMA 1V1JA 3BKWA 3LVFO 2I7VA 3V7UA 4BO8A 5CITA 3ROKA 1DARA 4BATA 1JH8A 3L0CA 2XT9A 4ZQGA 4FYXA 4Z0HO 1U3TA 3PQ2A 2QTBA 3VAAA 3MG9A 3OC6A 1QHGA 3MD9A 1W73A 7ADHA 2ISSD 2X76A 1SIUA 5DTIA 3Q9UA 5TRDA 3DNMA 1TKBA 2RK4A 3PFBA 4PX5A 1CS0A 1SUDA 4R8KA 4M98A 5CK4A 2XOKA 1N0UA 2AOXA 1UEXC 3P2EA 3Q3HA 5DYIA 3S40A 4FWTA 1GCGA 2Q5CA 4BGVA 2PLFA 1JSZA 2YXPX 4DDKA 2QXTA 4ZO8A 5SZIA 5JYEA 1T0UA 3KM0A 3ECCA 4IKPA 2EGHA 4XLCA 2FETA 1HFWA 1BE6A 3NHZA 3NHFA 4ROTA 4YJ2B 5LYJA 3ZG6A 2CFOA 4EW1A 4V39A 5TT1A 3CFYA 4WASA 3UTCA 1RFGE 1ZD3A 4HWKA 2ZRPA 4PQFA 1Q16A 2H9YA 4ISBA 5EQTA 5JZSA 5BV1A 1X39A 4ND8A 2C4WA 3QF4B 2Q2WA 3UJNA 5B2ZA 1GT91 3JQCA 4EI9A 4XTRA 4YT4A 2YV3A 4NPAA 1VECA 2FEPA 1ZMXA 5EPOA 4BB9A 5LJIA 3LTNC 4CLRB 1RXCA 2J0VA 2A30A 1RHUA 2V5VA 1POXA 3EUEA 3LUAA 2YZ2A 4Y2QA 4QELA 5J5CA 1CP2A 1DO0A 1GZ6A 3A58B 3JQAD 1JLHA 1AO3A 4QFBA 3UMCA 2HREA 4F38A 3CNOA 4AKIA 1MJ5A 3IJ5A 5LQRA 1DX4A 4LYHA 3UUWA 1PV2A 1LJUA 2EFJA 3VTFA 4WKNA 3MILA 1SZCA 3DWEX 2GYVA 3QJYA 4YEDA 3VX3A 2FNAA 1B6GA 5A4DA 5B58T 3TLJA 5IRCD 7MHTA 1E3TA 3CX7A 3KXPA 3VR3A 2OY0A 1FC0A 3H8WA 2P9FA 1RHMA 3X1ZA 3LP8A 1IG0A 2ZCVA 1YFKA 1TK3A 3LO8A 4UXIA 4B7UA 2IS1A 1SOWA 2RAUA 2UYQA 3H11A 4ENRA 1TPZA 2PMWB 4PYKA 4CCYB 2ZJ0A 1VMKA 3RUEA 2WSSD 5HM6A 1FTSA 1KEEA 1N0IA 1P8AA 5FI5A 5M5BA 3OZVA 1KYXA 1L4KA 4XCQA 4QUBA 4PZLA 4HWPA 4IIJF 2PBRA 4MKXA 1Z4JA 4Q7KA 4U9IS 5AKHA 5LB4A 5CB4F 4QVGA 2R8OA 2WZBA 4JWKA 5IBRA 1QZZA 1OLOA 5KYXB 5DBIA 2F43A 2QZSA 2P0EA 3L9WA 3ZCUA 2EP7A 1V7CA 3NIGB 2RDMA 4RM0A 1BEEA 1XKTA 1XNGA 2IBMA 2V03A 2XKBA 1N3LA 4II3A 3A1CA 1J5XA 3EGEA 5COQA 3E1YE 1NOKA 5HQ3A 2BGWA 1F6BA 4P31A 3KZVA 5AW6A 1CERA 1HYGA 3EY9A 3ZWVA 1YVUA 1EFRA 2AJBA 1XSEA 1I2DA 4YUVA 3UAXA 9GPBA 3I37X 1NT4A 3FWNA 4XPIA 4OOXA 1G17A 3RS9A 4BWYA 4E5NA 3EPLA 2CMKA 5DLPA 3HZOA 3QU7A 5BQXA 4HRVA 4XYGA 4TTQA 1QVAA 4QYIB 1A72A 1IN5A 1KK2A 4XL9A 2Y76A 3Q7TA 2D5LA 1TM2A 4LSWA 4TPKA 3RH0A 3W6NA 5JZOA 5F9FA 1AMUA 2GA8A 1QH1B 2XWPA 2RKOA 3GQBA 3OPXA 1T35A 2NSLA 2CL5A 3LY7A 3CX4A 1G8GA 2AEFA 2IEZA 1PZMA 1TLLA 1YAHA 4OKIA 1EE1A 3E81A 4OK5A 5BYJA 1JN0A 2G63A 4P3PA 3BCDA 1X38A 2EWVA 5DOVA 2P6MA 5IM5A 4QIHA 3MT0A 3FOAA 4MVYA 5EIAA 2O2CA 3B1ZA 5BXQC 1H5UA 5LLDA 5IXSA 4BAUA 2WJPA 3EIEA 4AO7A 1UDXA 4BFVA 3CR8A 2Z8YA 3PFCA 3U7HB 4XORA 2F1HA 3L06A 4LF7B 4C2TA 5KW9A 1PQWA 4MUFA 1IHYA 4G4IA 3T53B 4YRIA 2M1ZA 4JI5B 3G5AA 3D6AA 4O1HA 1IK6A 5KI6A 5JDIC 1E2GA 2EKZA 3I92A 3TM5A 4MEJA 1V4NA 1Z7WA 2HC9A 4D45A 1RVDA 4A3SA 3O8RA 2OQ2A 2VBIA 3O8DA 3NP7A 2DFNA 3D81A 4HUQB 1VRCA 2BGMA 5HFJA 1PO7A 3TW4A 1E69A 3RNOA 1KGSA 2GXUA 3I0NA 3ZWXA 2XVAA 4D42A 3VDMA 5KCZA 4XX1A 4ZAGA 5HUJA 2COEA 3K0HA 1LF0A 4RTMA 1XTQA 3PXXA 4GP9A 3TECE 1XR3A 2R6GA 1W93A 3N6VA 3V8QA 4RMIA 4O4LA 4COOA 5IC4A 4WT7A 1FJHA 3WLTA 1CP3A 4S0XA 1VDZA 2HX1A 4ZAWA 1CBUA 5HF5A 1FFYA 2D54A 3N2YA 3OCJA 2VQSA 4JOSA 1HDYA 4DV1B 2I2BA 3TZBA 2G17A 4J16C 1SR8A 4UNQA 3NC0C 1YL5A 3M6UA 3OIYA 4FR0A 1N33B 1VLOA 2HNKA 1P73A 3MEQA 3BJZA 5P8WA 4C6SA 1P1CA 4RTOA 1VTKA 4L08A 4HEQA 3KNZA 4KLNA 1UJNA 2YC2C 4GP6A 3D2AA 4Q00A 4FXUA 4HC4A 3BN3A 4XW2A 4WQMA 4CLDA 1QTIA 1NBEA 3H11B 1H23A 1NVUQ 2C97A 3GMDA 4RY0A 3FUCA 1DRWA 5BSHA 5JNUA 3SZ3A 2F48A 2HWYA 1GUFA 4KR0A 1T8SA 3DXZA 3TW0A 4NCBA 2G5CA 1GTRA 2HA2A 1W581 1AB5A 1Q95A 1XNRB 2W7TA 3LRPA 1QKJA 3MERA 4BGIA 4JI4B 2QQ0A 3I32A 4TS1A 1I1OA 3HCCA 5HDBB 3D5EA 2QZJA 3IP9A 3WGJA 3D2BA 2J9FA 5E6SA 1OKKD 5EMLA 5JALA 4O2AA 4S04A 1XXHB 1M34A 3R5XA 1WA5A 2P9ZA 1SKUA 4LZAA 1ZUNA 2JAHA 4DYVA 5A3RA 2IV3A 1T5SA 2OBYA 1VZ3A 1Y3CE 2G8NA 5KYTA 1HDRA 2HDOA 3PUXA 1EVJA 4OHOA 5EVCA 5A2GA 1SEPA 3RBZA 4R69A 4HMPA 1RI5A 1DX6A 4C3OB 3MQ2A 3CXCB 2IFTA 5A6SB 3TIXB 4EQ6B 2ISQA 1SH7A 3AP2A 1OFUX 3Q0TA 1NUAA 5J59A 4NZNA 1M1UA 1XRNA 3BXPA 4IFBA 4HQLA 2HWUA 3MCWA 2B25A 2C42A 2IYXA 4WVFA 2UAGA 1D4FA 1P2SA 1TU4A 2O3TA 4AWAA 1F2TB 1ZPDA 1LDBA 3JYPA 3ASVA 3LE8A 3TXAA 4M0DA 2XX3A 3TSWA 5AN9A 1MB4A 4BVKA 1OY1A 2HJVA 2CUKA 2YASA 3DMGA 3OIFA 2J6IA 3PJEA 4OP1A 3SHFA 4RFSA 4ZEVA 2GZHA 1KAEA 4RM2A 2NU8A 2ACEA 5LQSA 2FV8A 1A50B 1EINA 1G291 4OTZA 2EDCA 3S2EA 1VLLA 1TEZA 1TVEA 1GN9A 1SC1A 3BC9A 1ZRHA 3SC3A 4NCKA 4DR3B 2LZ0A 2G1PA 5F64A 1Y4ZA 3JD4A 4QBKA 4U2DA 4KHPB 4RO0A 3KYCB 3ZGNA 4EGCB 3LKBA 2Z2JA 1C7ZA 3T12A 4Z4HA 4B3RB 4RA9B 2IZ5A 5A4JA 1B7GO 1ISHA 3QSGA 4EG0A 4OBXA 3VAZA 4PFJA 3L0IB 1MRSA 3N8HA 4IFTA 2KJQA 4BE7B 3TQCA 1PEAA 3V1LA 1F3OA 1FYVA 3H4VA 4JLMA 3ZXSA 1JGTA 1MRNA 3ZH2A 3K0BA 4NEQA 3GRFA 1A4IA 2FZKA 3NRCA 5B5SA 4RANA 1QRSA 2PWYA 3JR7A 4ND8B 1X3LA 1YI2B 3PPVA 5THKA 2ZWPA 3QKRB 5U1PA 1Q0QA 4R6XA 1KY5A 5BSUA 3VVMA 1JR3E 3TTTA 1Y4DE 2I2CA 1SVNA 2XBLA 1VLVA 2AUMA 1GAQA 4PHTA 3PFFA 4B33A 5C52B 1V9CA 2YW9A 4EUKA 1WUJS 4JLVA 3ZKWA 1KU0A 1LSJA 1RPJA 4XASA 4C0XA 2R5NA 1W5FA 4P34A 4JOQA 3EQ7A 1UWVA 5ALGA 5BR7A 1ESNA 4NS4A 5LQAA 2ZDQA 4YP1A 1II8B 1Y5MA 3FRIA 1ND5A 2G36A 2JZCA 2O2EA 4I66A 4W7HA 3HSSA 2BWJA 3H2JA 3N8DA 3HBNA 2ZR9A 1N9GA 3A3GA 4TX1A 4L9RA 1IM5A 4DV6B 4AZ0B 3OQOA 4Z1OA 3DQQA 5AW9A 2Z2IA 5JY6A 2BM0A 2JF0A 1ORDA 3OIVA 3GP3A 4RPJA 1Q1NA 1C8BA 1TT5B 1L3BA 3B3GA 1SC3A 4KU4A 4BVLA 3C7TA 4EY8A 2G9ZA 4RK7A 3U1VA 1U7DA 1GPWB 3DEJA 3FFWA 3FX2A 4HAVA 4JJZA 4BLTA 3GLGA 5LLTA 1E3LA 2VHZA 3DLAA 1Y42X 4DMHA 5MFPA 1RKQA 3LX4A 2AD1A 2E5FA 1C3VA 4AZVA 3HR7A 4MGKR 3WC4A 4PPFA 1ZK3A 2YXDA 4DSUA 3C70A 1OWPA 2PSJA 4IP0A 1VKNA 3GYGA 3LFHA 1VBNA 5WRFA 3BE8A 4UKDA 1AO0A 1GRQA 2GJKA 3MLAA 2IH2A 2PLNA 4JK3A 2XT0A 4WGFA 2Y1FA 1X9HA 3VR1A 4IKOA 4RPDA 1M6EX 3EDQA 1F5NA 2OO5A 3GA0A 3LFUA 1SVWA 4M4SA 3GV0A 3N0TA 2WYUA 5BMVF 5K20A 3GLIB 4AQYB 4I4IA 1FY2A 3VYSB 1J2UA 2Q6IA 3OY7A 1YGYA 4H1HA 5LMUB 1PVOA 3GGCA 2J3KA 3RRJA 2HCFA 4ZVMA 1W96A 2RHMA 1QMGA 1W4AA 4KK4A 1CNFA 1JQEA 2HEGA 2BFEA 1NJ2A 2OBNA 3L8ZA 1TU3A 4ITUA 4IXNA 1A9SA 2YQ4A 1NB0A 4FD3A 3LBNA 3FUTA 5LWHA 3N76A 4EWLA 4QTTB 4Q15A 4RL6A 2FG7C 3DL2A 1TQHA 3OP4A 3CCEB 1F17A 1QCDA 1F2TA 2B99A 2XKKA 1C7FA 1M6WA 3GEHA 4Y2PA 5LLSA 4G01B 4Q7MB 3TCXB 5JROA 4M49A 3DA8A 3GRCA 2CNKA 3HJRA 2XGOA 3K2EA 3NS7A 4IQFA 4OB8A 4XGNA 3Q9SA 1LKZA 3KOXA 1RCTE 3LVRE 1TU0A 3TIGA 4AMGA 4F5EA 3MWKA 3QFSA 1Y7HA 3BG5A 2VF2A 4TS4A 4HWSA 1ZFNA 1L1FA 3ZI7A 1NOJA 5BVGB 1G6Q1 1KI4A 3V5NA 2DLCX 3VPCA 2AW3A 3QBJA 5EEGA 4Z9YA 3AF1A 3A04A 2G9QA 2ZBQA 3E9QA 5HA5A 3PXEA 4BP3A 1TYEB 3IDSA 3OAAA 4PY2A 1D2AA 3L8YA 3EN0A 1LX7A 1W1IA 3GMIA 2VAPA 5EZQA 4E4YA 4AKSA 3OFNA 1MJNA 3G8YA 5HIMA 4RVOA 4Q19A 1OZFA 1ZH6A 2NTNA 3DXYA 5JVDA 2FJPA 3WX0A 1W8IA 3YASA 2FFAA 4ZIRA 1VE1A 2ZZGA 4IOMA 1ZMOA 4B7ZA 5FULA 3I9OA 3ID6C 2RFLA 1YH3A 4ACAA 3QE2A 3CLSC 1SU4A 1JHUA 3MCZA 1WB9A 2QX8A 2AFIA 3EMVA 4NMWA 1RYMA 2QDKA 4FDTA 2FPMA 3N0RA 2Q7OE 2V98A 3RWOA 3I2HA 1E0KA 1E5LA 3ABSB 1FTYA 3PE4A 3QU4A 1DGQA 4E2FA 5CEFA 3RUAA 1MAHA 4KXQA 2Z04A 2P6RA 3K1ZA 1F0PA 2YHSA 4TVSA 3DMNA 4HBZA 2YWEA 4TL8A 2PANA 2O5EA 4LGVA 4M8LA 2ACWA 2PL1A 3ADCA 1T91A 3SOPA 1D2HA 4EMBA 4Y6OA 4MS3B 1OGJA 5DGHA 4IJMA 3DO5A 3M6LA 4FVTA 1H66A 3HVUA 2GK3A 1AS2A 1JB1A 4I99A 2XRZA 5D1HA 1FLVA 3FIJA 3H2GA 3ISJA 5DISB 3V1UA 2GM4A 4D7AA 3ZDBA 1XNJA 2ORVA 5CHEA 4ZVSA 3B8EA 3WMFA 3RHTA 3LZDA 2E1PA 4X1KA 3DFIA 1TUEA 1QGAA 1HL3A 2OSBA 2VVTA 3M1IA 5D3MA 4IYJA 3REFA 1QHFA 4BRZA 5A8AA 1AIPA 3OUTA 4RGVA 3QHPA 1Y37A 2DKOA 1S4QA 5CVTA 1D04A 3W2HA 3D3QA 4LRTB 2ICAA 4TV9A 3BBLA 2HBRA 3LT1A 1C9YA 3COZA 4B6SA 1ABBA 3HYLA 3KRTA 4QGFA 3FJOA 1MR3F 4BLUA 3F3KA 1GXSB 5DNCA 3GZ4A 1QXSA 4YJ3F 4C21A 5JQGB 4PZEA 3F47A 3U16A 4CI9A 1WCYA 1J25A 1QDUA 4C03A 3K0FA 3RUIA 1OUMA 4DCVA 5J4KA 5TEVA 3PQ5A 3FPHA 4X6YA 4ND3A 2H3EA 2I9KA 1HF3A 2JHPA 2Z95A 3C3AA 2OBXA 3IIMA 5DK6A 4JLPA 3R7NA 4KLAA 3P20A 4N8SA 4D9CA 5G0VA 2ASEA 1N05A 1NVGA 3M5CA 4WZEA 1JIIA 2XUPA 3MVEA 2IYUA 3QVSA 3L9XA 4UVEA 1ECFA 3VR3D 4L4RA 5FQOA 2IU0A 1P9RA 2WFMA 2ZZEA 3DOJA 3B3FA 3L7AA 5HIIA 3MNFA 1CYEA 2ATXA 2GF0A 3QIVA 5TJHA 4KXLA 1GV1A 3PRKE 4Z8YA 4P22A 2P3QA 3BWBA 4YQEA 1NUTA 4BS9A 1M5UA 2BD0A 5CLIA 3BRCA 4JX8A 5GTDA 5KUTA 2O59A 2AWNA 4PLYA 2GFIA 4Y1GA 2P65A 3NW9A 5AW1A 1RI3A 4IX1A 3R6JA 4KMRA 1X8KA 2WKQA 3W34A 1AQLA 2K7FA 4HDQB 4QXPA 1PWEA 3GCGA 3DW3X 3AR6A 4X7PA 2Q7DA 1FDSA 2A4MA 1J09A 2HHCA 1PBTA 4RJIA 3T7IA 1G8FA 1SXIA 2CYCA 3I5UA 1NVVQ 3BH7A 4JC0A 2JFFA 2YWBA 5FUYA 3IX7A 3LM8A 4RBNA 2QR2A 3VR2A 3ZHOA 4X7EA 2RHRA 4H6VA 3AESB 1SC6A 2GT1A 2Y9MB 4RCZA 3QBTA 2GDZA 1C81A 3QKWA 4P3XA 1I1NA 1SWVA 2EQAA 3ZGXA 1MZVA 2EXXA 1ZU4A 1DKMA 3LLVA 4W63A 2NSYA 3ZWYA 3IMKA 1U9IA 4JB8A 3REGA 1UDWA 5FBZA 1NSTA 2FMIA 1BN6A 4H6WA 1H1LA 2WKPA 2I1LA 1WOYA 4M1ZA 4RSRA 1KSGA 3TEFA 3LFTA 4F9FA 1UAYA 3ORSA 3ZN2A 1D5WA 3LLSA 5BW4A 1NBMA 3LWZA 4LXUA 2BYTA 3W2TA 2AF4C 2G06A 4EUNA 2B8TA 2X5NA 3LH5A 3C1OA 4YMVA 3GFRA 4U0KA 2JLRA 2CSXA 1G0NA 1DZ3A 2EZ8A 2W8BB 4A2PA 1DFIA 4DCCA 4NULA 5IJ9B 1FP2A 2FX2A 3I53A 3GNLA 4UAVA 3EA5A 1N77A 2O8FA 1Q0HA 4KEAA 3WYEA 1DG3A 1RWQA 4PCVA 4EB3A 1CEXA 1NUHA 3N2IA 4MGYR 3NHLA 1I0IA 1UPUA 2FP4B 5DVZA 4RKFA 2JCSA 2VQ3A 3CKLA 5DWDA 4QOHA 1L5RA 1BRTA 1E2KA 3KR2A 5K3CA 4YUWA 4V0ME 1P2TA 3IKTA 1RYDA 1RBQA 3H1EA 4MROA 1FNMA 5KQMA 1GCIA 3M9LA 3WTBA 5F76A 2PS9A 2RH9B 3FSJX 4BRSA 1DOAA 4LJSA 5K0BA 3OEWA 3VOBA 1T9HA 1AX9A 3D4OA 1OASA 4E07A 4HFNA 1E7WA 4WZAB 2NP7A 2V7WA 4LJ8A 3QP9A 2DTDA 1YMQA 3P52A 4C4PA 4WZZA 3N3BC 1G2IA 1NMYA 1RPZA 1RBMA 4F5WA 2V3CC 1XAGA 2JGDB 3P45A 1AQYA 1SVIA 1XU4A 5LBTA 3BCFA 2REQA 1P2UA 3UFBA 4BZZA 2HQSA 2G88A 3AUJB 1YR3A 4QHSA 4YRKA 2XZDA 4RCVA 4OJYA 2BISA 2E18A 2DJIA 4KTTE 5TQJA 2OLKA 2XYPA 1AV7A 2ZE5A 4PINA 4Z9BA 2NUTA 1WUKS 2PUWA 4J75A 4KR9A 5ALJA 5AVXA 2R8PA 3TNJA 1FFAA 4MULA 1DBPA 2CNDA 3TNLA 3R3UA 5G02A 2JLZA 2Z6QA 4KSYA 3EGXA 4HFMA 4YCMA 1C4OA 1VCNA 3H19A 3CLHA 4QPNA 1MOPA 2D4AA 3PFNA 3VO9A 5KNDD 3QPCA 3UYLA 2PUEA 2DB3A 4KI0A 1OAOC 2D4HA 3A3YA 2KW5A 3BGVA 2EBHX 5K2MA 4N39A 4DR1B 3FWPA 1REQA 4P0QB 3U09A 1J5EB 1ZQ1A 2DQKA 3NONA 2ZXUA 2BFOA 2QAGB 2Q4BA 3UICA 3V80A 3F96A 3QPDA 4YREA 4BQNA 4FM9A 5IG2A 3BGIA 3ZUGA 3HL0A 3DMYA 4GU5A 3SD7A 1UIRA 3BGDA 3DC2A 3DDSA 1B42A 4U7FA 3KJZA 5C1DA 4A15A 1JR6A 3DDCA 3GLQA 9ABPA 3JQ8B 4YXFA 2AXNA 1FP4A 1V5WA 4KI7A 1Y1QA 5EXDA 3C3WA 3C6KA 4S2UA 5JMWA 3OOWA 1O54A 4XVQA 3KQWA 3PWZA 1URPA 3RGWS 1XN4A 3RYFB 4F3KA 3T3MB 4YMHA 2VP5A 3MS7A 5A5DA 4G5XA 4I3HA 1UK9A 3FF1A 4MHOA 5K4AA 1N9KA 1OI4A 1SA0B 1R0YA 5AHRA 1EVQA 2Q5IA 1V9SA 1QE3A 4V0OA 1FTNA 1XQWA 1TEXA 2CLOB 2Y4OA 3D02A 2VBFA 3AVPA 2Q28A 3DV2A 3HLYA 5E1DA 3WVNA 4BVAA 3I05A 4MYCA 3GVPA 5AFSA 2EFEB 1Y6JA 2ID7A 3GUVA 4HADA 1UDBA 2BEUB 2W5UA 1ZU5A 1CUWA 1S01A 1UT6A 1IHXA 3EFEA 4HDRB 1BWSA 2WW8A 1Y1LA 3UK1A 4OI4A 1I24A 1WXHA 1JX6A 5EJ9A 3L4JA 4IFEA 2PE3A 3FW1A 1F4PA 4DBZA 1Q0SA 2DFDA 3QMPA 4PO9A 4UU8A 3H2ZA 1W2BB 2GJSA 3OTHA 4EO7A 3WLKX 5DNUA 5IN4A 2OK7A 3OJWA 4EJFA 3SQWA 1T6NA 1P62B 1O96A 3IEUA 2QX4A 3SKVA 5TMEA 4HNQA 1HM5A 4PHGA 5SYMA 3OKFA 2WIDA 2SBTA 4K6HA 2Z08A 5JXHA 1TQ4A 2BI8A 4K9RA 3RIXA 4W99A 3KUXA 3SLNA 2R87A 1Z6ZA 1I80A 2QU7A 2C5BA 3IP6A 1S8AA 3IOBA 1MIHA 3KPJA 3WWDA 3DUWA 4HB0A 3SNKA 2H08A 5J4YA 1KH2A 3H0CA 4NK4A 3QPVA 1OC4A 4H0CA 4R6WA 1DFHA 3KLMX 4LHZA 4URHA 1L4FA 2ZIAA 2DECA 4GX5A 4ZJZA 3WB2A 1LGYA 4GZLA 1CNMA 1W29A 3QMMA 4KJXA 4MWTA 3ZJ5A 4J1TA 4WXEA 3PFKA 4FZ5A 1G64A 1WZCA 3G9XA 4WWHA 1HQKA 2WHPA 5DYNA 4MYTA 3V1NA 1WKCA 4OHPA 3V7FA 1QWOA 2BDTA 4BV3A 3BXEA 3CH7A 2J9FB 3G2OA 3ZDEA 2CF6A 5J40A 4HNSA 3F5DA 4KH0A 3H5NA 1F9EA 2DVMA 4ID9A 5GV8A 4INAA 4N0PA 3VKFA 2I1WA 4AJNA 3DCNA 1FF9A 1ISJA 1I3MA 3NNNA 1OB5A 4HAXA 4MUHA 4UUQA 2HI0A 4UCFA 2WMDA 4I6GA 5DNVA 5AR1A 3RVRA 1YJ9B 3IDQA 5D3ZA 3B36A 3L41A 3ICCA 3WO0A 3Q3CA 1E1DA 1Q7TA 1AQUA 1JMYA 1KDTA 2IODA 4M7WA 1PUXA 2QVXX 4UXHA 2WJHA 1COZA 5ENZA 1AY0A 1E3DA 1F0NA 2QS9A 3BMNA 2CHQA 1ULSA 2V7QD 2SKCA 4YRQA 3HXPA 5CTAA 2PBLA 3FHLA 1U2ZA 2C7GA 1F20A 1SG9A 4QU9A 5BVGA 2WWGA 3K09C 4J2TA 1R18A 3VZCA 3WA7A 4JT2A 4X91A 3K0SA 1VJTA 4ZVQA 2PPVA 3UM9A 1QGUB 4ARIA 2HMAA 3GJXC 4RHYA 1XEXA 5DO9A 3Q6QA 1N75A 1ZA1A 4IVRA 3HBFA 4R9NA 3HCRA 1E0AA 4X64B 3ZD6A 4N76A 4RIHA 2B4AA 4RIGA 3PUNA 3AMVA 3OW7A 1OLXB 1Z06A 3IAFA 4YDQA 3CJRA 3B3JA 5T41A 3ZWKA 3CG4A 5JNSA 1FSGA 5DX8A 1VIVA 1YJ5A 1TECE 5IHPA 4J07A 1HGXA 4OXRA 5TXGA 1HE8B 4Q9DA 4FBLA 5FOSA 2BR4A 4QUZA 2F3PA 5JZMA 1WUHS 4DMKA 3WWOA 1YJBA 4BCDA 2P2CA 2V9ZA 4IUCS 4KQEA 3D7MA 4MYUA 2FUNB 1W4LA 3JALA 1I4DD 2FF7A 5KTMA 1E2NA 4OAOA 3EC2A 1P74A 4ZV9A 1JLSA 1N8TA 5B64A 5EKTA 5IHXA 1GG8A 1MHTA 2D1FA 1N1EA 1VCIA 4BNJA 4RPBA 1GO2A 1T8TA 5IYZF 1F2UB 4YECA 1JAHA 2N47A 4IEIA 3VJMA 4ECAA 1A9ZA 1T1EA 1R0WA 3PEFA 4IDFA 4TKMA 4QGSA 4CIBA 2PSDA 4OIMA 1XTBA 2YS6A 3KKKA 3MM4A 3T7CA 2VAVA 2QRMA 4R31A 4I1SA 3SF0A 3QPWA 4QOSA 4BECA 8ATCA 3TD2A 1Z2CA 5MFZA 2QM7A 5AO9A 3G2KA 4D0SA 4RKQA 1KK3A 5FUMA 3LUFA 4UQPA 2GNPA 1ZBDA 1YKSA 2RI0A 3CCLB 2W2PA 1QBGA 2W6PA 3ONVA 3TQFA 3AQ4A 5F5LA 2BLNA 4L8LA 1GLVA 4FT2A 1LDNA 2WZPP 3B12A 4WOCA 4QYIA 4G7WA 1SKYB 1Q0PA 8LDHA 4EJ6A 1R4MA 1GUBA 2P5TB 3FPEA 2HJWA 1ZD5A 4QOEA 2RB5A 1O97C 3LW7A 4ZA2A 1ULUA 1MV5A 3EUFA 4H6XA 5KVQA 1O0CA 2WF8A 1GXSA 5H70A 3R75A 2J46A 2CBZA 2XLBA 4FDAA 4X1OA 4ZEXA 4FE3A 1ZUWA 4HDSB 1AB6A 4GX1A 3HJCA 4HNGA 4L8VA 1KE2A 1JIXA 3ASYA 3V8NA 5F3WB 1VHEA 2GXQA 4CT4B 2ZM5A 3RTAA 4YV1A 1IBKB 2G9UA 2XE6A 1EX1A 2RSLA 3ZDCA 1VSVA 1XHEA 3PFWO 1W34A 2Y6UA 3K4PA 1M10A 1NYQA 3QE3A 4MLDA 3N7TA 1UR5A 3TD6A 4E03A 4DW8A 1GZ7A 1OCEA 4RABA 4WE3A 3MWEB 1KXZA 3ZVMA 2EP5A 4PM4A 4BFLA 1O97D 4FGUA 4CFYA 5D51S 1Z33A 2R47A 2W43A 3HC7A 5ESWA 2D0DA 5EIXA 5TF4A 1SD5A 4OHWA 1ZK1A 4EHDA 2VRCD 4JLJA 1VI2A 3THWB 3TLGA 2QI9F 1QTQA 3C8UA 4XNFA 1M54A 3GLHB 3ZX5A 4DJ5X 2BV3A 2VHUA 1GNQA 4L2IA 3DD5A 1YS7A 2V54A 1HPLA 4PRLA 3CINA 1NTRA 3RC3A 5EJ7A 2ID4A 4IGFA 3UV3A 1XJ0A 1MKYA 3I9JA 2PX2A 1JVBA 2PXCA 1YRAA 1RKVA 2C9BA 3GEMA 3KT0A 4WACA 5JS2A 1T8UA 5BUQA 5BWOA 3G8CA 2VF8A 2IQ5A 3T3PB 3KQYA 5EE0A 3A35A 3OWHA 3ZWCA 1T6ZA 3IQIX 4OQQA 3M7IA 4IQ8A 4QASA 1BJRE 3GJRA 1VJGA 4DTIA 4Y6QA 2MIIA 1KFBB 3NC1C 1YUNA 721PA 2BSAA 2QLLA 3QLVC 4MWDA 2PRJA 1P77A 2C2HA 2HUNA 3KPUA 3K70C 1D2RA 2MT9A 4M8IA 2AMFA 3H6HA 1YZYA 2LUOA 4DANA 3ONYA 4JXJA 5SY6A 1H0KA 1ZNYA 4G24A 1SBYA 4H7JA 4UBKA 1E1QA 2H17A 1R64A 1BCSA 2QRPA 2V97A 3O1HB 1QQ7A 3T8YA 2FLWA 3T7TA 3L02A 3L6CA 4D81A 4YAKA 2X8JB 1OSNA 3BYZA 2C59A 4YJ2A 2CCGA 3RWBA 2PLWA 4D3XA 3OO0A 3OE7D 4BLSA 3D6MA 2FPWA 5CTJA 4R9SA 1M8KA 5EJMA 4FLEA 4IIHA 5DNWA 3KEGA 4NBWA 4PG6A 1T9ZA 3A31A 2M6LA 3W8EA 4BTLA 2SNIE 1KC8D 1U3VA 1XCPA 2FSSA 1C30A 2QMYA 1GQSA 2QRVA 2XODA 3ILHA 3OM1A 1D9ZA 3IP7A 3X1MA 4BO9A 3C14C 5DH9A 1WP4A 5C7OO 2DY1A 2VHEA 5JAHA 2DCUA 5F7OA 1Z16A 3NHMA 4KK3A 3SFTA 3R5KA 5C7IO 5B3JC 3UJBA 1UT5A 2O3UA 3FOCA 2J5BA 1H2HA 3R5SA 1BFKA 2OBMA 2AOWA 2YMQA 2YTZA 1B73A 3D7NA 3QNMA 2OAQ1 4L4YA 2X0FA 3HJTA 3RB8A 3HFRA 4UPDA 1HYBA 1SOAA 5ITZB 1QF9A 3GPDG 3LIIA 4OM7A 1N34B 3T34A 5CDFE 3F2IA 5A9SB 5JU6A 1COWA 2K6GA 2NVOA 4JFRA 3TH5A 2GJAA 2EX4A 2RC5A 1NI4B 2OL4A 3NVMB 5KJ1A 1X13A 3FI9A 1UXKA 3TN7A 1FJ2A 4LBZA 3H65A 3QVKA 4C30A 5AKKA 3VKWA 1V6AA 5AHOA 4LJ9A 4E09A 4JI8B 4Q37A 1SRQA 4BVFA 4EKDA 4RAQA 4N5LA 3W3AH 1KVRA 3P2YA 2XYVA 3DDYA 3DTVB 3FTEA 4JCCA 4IILA 1MQSA 2AS0A 2CE2X 2HSZA 3U60B 4BX2A 3R6KA 1DHRA 1GU0A 2QYHA 4W8GA 3IEPA 1KK1A 1CXZA 1Q6ZA 2GEKA 2J6HA 2PSEA 4MRMA 3X2FA 4BFUA 5IX8A 5KQLA 3WL3A 5LYJF 4GH5A 4GKJB 3BXHA 3DONA 1LBIA 2MHCA 4GM4A 5LP6F 3F6CA 3MJDA 1OX5A 3IBGA 1DTWB 4F1WA 3DKVA 5CW2A 3AY0A 4FYWA 3TIIA 1N6HA 3K6KA 3FHOA 5GONF 5BO5A 2V0NA 5CDTA 3IELA 4BLRA 4AZTA 2HO5A 5DRYA 1W36C 4ENWA 1KI1A 2H63A 3WRXA 1NW6A 3OJLA 3IBCA 4NYIQ 4C08A 1HDOA 2Z2ZA 3E9RA 2QUZA 4U9UA 4RDCA 1VQ7B 3D8UA 1LPBB 3GUZA 5E6RA 3KUCA 5EPEA 3H1FA 5KQPA 2GD0A 1Z4MA 2Y1XA 3SK0A 3I9MA 4IXWA 2W2KB 4KBYA 2Q3MA 1KVQA 4WNYA 5BSVA 3MQ4A 4B34A 4EKGA 1LQ2A 2VJDA 4JXKA 1C4KA 1PX0A 3C6QA 4P86A 4UTNA 5KIAA 4BXOB 5DHFA 3QKRA 1OJ7A 3ZE6A 1IBMB 3ERCA 2ILTA 3K15A 5K0LA 5IUKC 2Z6AA 5DM60 3Q7SA 2VRCA 1YRQA 4PW0A 5ICEA 5JQWA 1Q7RA 1T5DX 1CLUA 4LWOA 2ZL6A 1K28D 1EGVB 1EFAA 4LYFA 3WAGA 2CXNA 1QGED 3ONFA 2DC1A 3PVDA 1GG9A 2GF2A 1CCWA 1IB6A 4DLWA 4YAIA 3TI7A 4EGFA 2C98A 4E94A 3U7FB 1OLXA 3TEJA 4ECEA 1QO0A 2J48A 5J3OA 2OFPA 4NDNE 1FE8A 4OJKA 3UH1A 1KO4A 1TKRA 3AFMA 2JZNA 3GEEA 4N8EA 3FPSA 1T5HX 1W4ZA 1YB5A 4L72A 5JDCC 3U13A 2WIBA 3G89A 3KQQA 2JHGA 3PE6A 3QMVA 2XVXA 1EXDA 1UP7A 3PU6A 1LJLA 2FR0A 3DP9A 3IT3A 2FHPA 4R1SA 1JQLB 4KPGA 1Z38A 2ODBA 3I64A 2C2XA 2G67A 4LYDA 3ZUPA 5JHHB 5K0FA 2X9QA 4HK4A 4F9TA 3E0QA 4OJTA 2EWWA 3EZGA 4BO5A 4JMQA 3ZI0A 1F38A 1RACA 2TMKA 2FJ0A 3WSWA 5BOSB 2OMEA 4FLMA 1VQ6B 1EGHA 3K9CA 4KO2S 2ADOA 2VO1A 3VO1A 1NA5A 3CT6A 3T7DA 3WK6A 2BFMA 4AG3A 4Z4VA 4K9DA 4XJSA 2CK3A 2II6A 4IR7A 3N8GA 3GFPA 2ZI7A 2G6BA 2R2AA 1XMVA 2A9KA 4P4SB 3CF6R 1TZCA 2HF7A 1IJEA 2IYWA 2B83A 1MPXA 3EW7A 4HH4A 3P2IA 4BKRA 4HNUA 3LT4A 3VKHA 2GM5A 1IUPA 1Z45A 3SYMA 3ACBA 1U5AA 3P9ZA 4M9RA 4GRIA 4XIGS 1UPXA 3I04M 2EBFX 4GAEA 3LRTA 3OBIA 3A6EA 1PTJA 1R0CA 1WQ1R 4LISA 1ULBA 1H22A 2GPWA 3NBXX 2YICA 2CV0A 2DULA 4N03A 4PSVA 4D8TA 4F2WA 5EJ4A 3W77A 5FWXB 2GTHA 5JHGB 2XB4A 1DS6A 4ABTA 2R62A 3QELB 2C9OA 5FYQA 2FSGA 2CXQA 3EOZA 4BMYA 5JV5A 3LSTA 3MOSA 3QU2A 5E6SB 5AM2A 3PX3A 2CV1A 5H02A 1LVUA 1J24A 3G6WA 4RZXA 1C2TA 5FA8A 2ORED 2RBKA 3H83A 4TGLA 2P8JA 5KTKA 1OHHA 1HURA 1YB1A 1EBFA 2Q62A 1QZUA 4MKIA 2OHJA 1NE2A 4QUDA 1ZR2A 4KNYA 2TRSB 3AXTA 1DB3A 3WQSB 1RZRA 2AG5A 5BPHA 4TTPA 2C7QA 2VUSA 4IDBA 4BUCA 4XM0A 5LQDA 2C2WA 4KFTA 1RVV1 1M1YB 4XD7D 3R5FA 4Z54A 4UJ3A 4B48A 3FTFA 3TTVA 2QD2A 3NZEA 5D84A 1O57A 3CMAB 2PMFA 2V0GA 1XMQB 3I3OA 4AY3A 2QR5A 2Q5EA 1DCTA 3G7NA 2VN8A 2B4YA 2YRWA 1ZC4A 1UBOS 4D3YA 1NKSA 5L7WA 2O2IA 1BA3A 5IJ0B 4U7WA 2P2SA 2AOUA 3AB7A 1LBEA 1YHYA 1WU7A 3F97A 2ZQ5A 3GJ0A 3Q7QA 4XH9B 5JMTA 1X1SA 2J1LA 4EATA 2Q3CA 1E4EA 2IHBA 2HTEA 4EENA 5KINB 2CDCA 5CLLA 4CKBA 4ZQEA 5B12A 1WXQA 1P8JA 1NMZA 1VKRA 2XUHA 3X0DA 1K7SN 2C0CA 2NW6A 1UH5A 4WHMA 2X23A 4PG7A 4G97A 4JP5A 3ROZA 3ZE0B 2VJJA 3LX5A 1DLJA 3GRKA 2PO5A 3RT9A 3B82A 4A26A 3DDHA 1OIXA 3RRBA 4YTEA 1SCAA 3HABA 1UEJA 4URUR 3OFJA 3WNBA 4XRRA 3RJMA 4C01A 4C22A 3BH4A 4LE0A 2GN4A 4G6IA 4PRYA 5DHRA 3O3OB 3INRA 4AKEA 4NYJR 3AHHA 3VZPA 4H60A 4ARVA 1B6TA 3DMTC 1O89A 3AFGA 3UJ7A 2N3ZA 3DB2A 1NR5A 5JMPA 4LNUA 2IK8A 3F1KA 2WWRA 5F2EA 1UBKS 1UXIA 5FWXA 4P6VF 4DA6A 4ALMA 4NMXB 4KE7A 1AN9A 1PJLA 1PT7A 5EKDA 3NE5B 4O2RA 2BFDA 4DSTA 2PLAA 2QNRA 3HXKA 1WKVA 4HNTA 2DKNA 5CHYA 2CNWD 1GPH1 1OFTA 4M0MA 2VBSA 1PHRA 3F4BA 3LQFA 1ENYA 1DC3A 1NTOA 1W85A 1UJ5A 2KX7A 4DRYA 3O3MB 5CLJA 1AS0A 3JRNA 3T4UA 3EMKA 3FYUB 4IVNA 3VU3A 5AKGA 2WJ6A 1VP9A 5T4FA 1S2LA 2A33A 1W5SA 2D0OB 5IXJA 1ICIA 1MQAA 2J3QA 2P0YA 3GARA 3K4HA 1AG9A 1ZOLA 2Y0DA 3JQBA 3NTRA 3VR6D 1F7VA 3ELUA 4YAJA 3J80A 2PMDA 4LNHA 3DVQX 3JWEA 2RH8A 4QATA 4EJ2A 1K4YA 1MB9A 4GX0A 4QVAA 3BTSA 1SKMA 2HSEA 4ZV4A 4HB2A 3GRYA 1KD1D 3P0HA 4X61A 1NVXQ 5DTRA 3TSOA 3KTAB 5DTJA 2DM6A 4CODB 2CV2A 5TB5A 4ZYWA 3DOCA 4FPXA 4L51A 3K71B 5LP6C 4JBNA 4JFAA 2HK9A 4KYIB 2F1JA 4RLSA 5D1NA 5LBIA 4D0NA 4JIGA 4BBAA 2JFHA 1FJGB 3NAMA 2Q1XA 3BRWA 2Q49A 5HQ3B 3FGNA 3ZW7A 1XPUA 1RRGA 4GSKA 2FGJA 2G82A 1U28C 1UC4B 4CFSA 3QV2A 4RVDA 3KUDA 1XZIA 4CIVA 4F4DA 3W04A 1LPPA 1NP6A 3KJEA 2Z43A 4CQMB 4R0MA 5J2TB 3IB3A 3D7LA 2FZEA 2CUZA 4LY6A 1XDBA 1KZGB 5IKPA 3EZ2A 2GZ2A 4PG4A 4QQFA 5DI3B 1DRKA 2XBMA 3WL8A 1NMEA 1P3Y1 4J29A 4LRXA 4BNKA 2ZVJA 4JYAB 4RV5A 1BJKA 1JS1X 3QEMA 5TGTA 2VJCA 2ISCA 4BAGA 4S05A 3E9CA 4QUEA 4HZIA 3NT5A 1XZQA 2QXUA 4E0FA 1IEVA 3A6JA 5BSGA 4BLPA 4PGMA 3IKJA 1PR6A 2FAXA 4BMZA 4MVWA 1VLYA 1VJSA 2NM0A 1XB2A 1ECGA 2WG2A 3FROA 4M1TA 5ALHA 5E1OA 4EFKA 1TMGE 5A04A 3H99A 2PLRA 5EINA 3VPBA 3G7UA 2I7DA 3DHYA 3E2IA 2F4NA 1JHVA 2QGNA 5FI3A 4DMFA 1C3JA 2X2PA 5FJIA 1TYZA 2GN8A 1RC8A 4GVPA 3OLZA 3PQ3A 5AUNB 2XCRB 1S8FA 3V2HA 1XA4A 3JTEA 2CLFB 2M32A 4YYZA 4LVCA 1WUIS 1JPVA 5A4FS 3SEJA 5EWMB 2PT5A 2R5FA 4LZOA 5E0KB 1I2CA 1QGZA 1ZNWA 2NXEA 3DQZA 3MRXA 4XCXA 3L92A 4Q16A 2B0CA 1W59A 4FNAA 4RHCA 4ZOLB 3KB1A 1XZFA 1QVZA 3LGSA 4FZ3A 4OIFA 3OOSA 5IYRA 1DMRA 4ZVUA 3IPXA 2XMCA 1V0JA 4K8RB 4DZZA 2IS2A 2FEOA 1Y6ZA 1JU4A 2WVJA 4Y6GB 2ZUSA 2B3TA 4NSNA 3FWYA 1Z82A 2E6KA 3JQEA 2RGNA 3K8YA 3RVKA 3V1TC 3WL4A 3CSDA 5E3IA 3L7BA 2P8SA 3D3WB 3DE7X 5ALVA 5B3KA 1ZA2A 1XZGA 3MQFA 2AQHA 1ADBA 5LZ2A 1ST2A 1STOA 1EXNA 3T3EA 4YUXA 2C77A 3RU3A 4CEHA 1KKMA 1NF2A 2Y1WA 3N05A 2OG2A 4P82A 1WPXA 3WL5A 1WWKA 2MYUA 3I72A 4HYEA 3ORQA 1HE4A 3MELA 4OQLA 1VSBA 3V9AA 2Q99A 2RHOA 3GPLA 3AI3A 3LL7A 3SKXA 1CY7A 3NYIA 1E9DA 4UUBA 4HPXB 3EAQA 3RT1A 2O8EA 2H1HA 2FZGA 4FFVA 5A5EA 2CKMA 3KKQA 5DLQC 5DWVA 4REOA 2KI5A 4JBLA 2GN6A 3BSFA 3UCEA 5JEEA 4EF5A 3FUWA 1VJRA 5TMBA 1FX0A 4FWIB 4WBNB 1GJRA 4B43A 1RC1A 3L6OO 1RAHA 3RJTA 2PZMA 4N5HX 1BMDA 4C6TB 3NI2A 5DXAA 1XA0A 1EDOA 4Z49A 3QOYA 1R5BA 2B92A 1M8JA 3M2PA 1R16A 1H85A 4IZHA 5K0ZA 4ESOA 1ZH8A 1QGOA 3TOSA 1HA3A 2BGLA 4DR7B 2VF4X 2ID8A 4E5YA 5ILQA 1YAJA 1QX3A 2PVPA 3SX0A 4TTTS 1T25A 4DLVA 3WLFA 1GARA 1PS0A 1X7HA 2VJPA 4CTJA 1QIFA 2QJRA 3NYWA 5LYYA 4H77A 1Z83A 4Q4DA 4HGNA 3M9XA 4MIYA 2QTFA 4RVCA 2QTAA 2JFNA 2VJYA 2W6MA 2AQKA 1XZJA 2AV6A 2C96A 1D2EA 2PDAA 2Y93A 2YYYA 4K6GA 1XYVA 3QY0A 4WXMA 2AN5A 4Y67A 1W4RA 5CH5A 1ZX1A 4BX8A 3WNCA 4ZOLA 3BIXA 2DT5A 3FIUA 2WU3A 4KO1S 3UUFA 1XJ5A 2IUYA 1Z2EA 2QYSA 1CPYA 2EYQA 3JRWA 4CRWB 1KVTA 3T1QA 2RAFA 4UREA 3WYAA 1YR6A 1WMAA 3DDWA 4BQOA 2W2KA 2Q4TA 3L7MA 1Q12A 1U99A 1R4NA 3H3FA 4LDPA 4K6OA 1IWOA 1GPJA 3FDXA 4RK1A 1PJ5A 3WZMA 1U9JA 3JVIA 4IWXA 4K6MA 5BOVA 4X3CA 5CFOA 3RIMA 2P3OA 1KR5A 3D6HA 3R7DA 2BBWA 3WGTA 4IV8A 3I12A 4OUKX 1KIFA 2AZDA 2WINI 1SCNE 3PUIA 2R6HA 1GPDG 2L82A 2MR5A 3PIIA 4Y2VA 1LC0A 5CXSA 4E5VA 1TQ6A 2PX6A 5C53B 1G7CA 4D25A 2C92A 2FRDC 2F59A 1YZLA 5LZ4A 1V11A 4YRGA 4M1QA 4HBGA 1KO5A 4OMCA 1VLHA 3LYUA 1BFDA 2ZJFA 4RD3A 1ZIDA 1ODCA 2ZJ8A 3CU5A 3E5RA 2ZI4A 1T29A 4D41A 4ERXA 2EFCB 4EZIA 5CDUA 4JKIA 1R0ZA 3CRZA 4PYLA 4Q34A 3OQ6A 2CVZA 1NONA 4GLOA 4X7RA 1Y89A 2DUWA 2Z1NA 5CX1B 2I71A 4L78A 3G4SB 3A3PA 2VXBA 4LF6B 2GPJA 1N2HA 1N3IA 1KP9A 4L0DA 2PJUA 3PJDA 1Z2NX 1DIBA 5HBRA 2BE9A 1QLHA 1MD9A 1C80A 4OHRA 1EVLA 4Z4ZA 2HWXA 1RQPA 1Z2AA 2A7XA 3AESA 3A26A 4Z9XA 5GONB 1OT3A 4HQ0A 4DE5A 1PF7E 1JHDA 4PO8A 4LQCA 3L0DA 3ZDFA 4CN8A 5CIWA 4B0OA 3DDNA 3FMFA 2OHHA 2QENA 2R1TB 3E22B 1MC4A 3ESXA 3PLRA 4IBOA 3UJHA 6REQA 4UCWA 4H35A 5FBWB 5HK8A 1PS8A 5I4KA 1A9TA 1LB1B 1EVKA 1P61B 3T7AA 3IR5A 5G1OA 2QVGA 3SZUA 4HRYA 3TSAA 1XZLA 2H51A 1NW9B 4WK2B 1O6BA 2QMZA 2E1BA 3PHLA 3FLEA 4MQFB 5FTLA 2MINA 5EUCA 1ATIA 1DEAA 1SHJA 2XVZA 3OUZA 3H05A 3ESBA 4I8IA 5DU2A 5LDDC 1XKLA 1DFGA 4CV2A 4A0FA 4D9GA 2AXQA 4U02A 1C0LA 1PJTA 3WGOA 1GR0A 1FNDA 1C7QA 3KJFA 4DR5B 1RNLA 1PEKE 3K92A 3OPYB 3RYHB 4C0LA 4FONA 4WX2B 3W7VA 4CGZA 5FPTA 2Q1TA 3A6FA 1A8SA 2LKCA 3N2ZB 3OTGA 1LBQA 3OU7A 1J8QA 3AINA 4PIPA 2VBCA 4KB5A 3DEHA 1UC8A 2M1XA 5FLEX 3QUSA 2C2YA 3VYTB 1U1DA 2H4HA 1IYZA 2QRLA 3NDJA 3BICA 4PE5B 3U81A 3WLMA 5CYGA 1K97A 1L3CA 2FPSA 4LDRA 3GEDA 4N01A 3WGVA 1MGPA 3BTOA 4HEJA 2VH1A 3WYDA 4C5CA 1U2GC 2GRJA 2GH1A 3KLBA 3P0FA 2UXBB 4YJ3B 3BWVA 4G6ZA 1T1GA 3CZQA 3K0AA 4FHEA 2XNDA 4RQUA 4EHJA 3GLFA 2YUTA 1RI4A 2WUFA 3HADA 1IN7A 1R8XA 3RSLA 5A4MS 5LDHA 4CMCA 1IY9A 1HKHA 2Q3JA 1B41A 4ZOAA 3Q5GA 4ER7A 1ECCA 4LECA 1JB9A 2KYRA 3NEPX 2ARKA 4HDNB 1E2IA 4BNDB 3WGHA 2QGFA 2V9CA 3H5LA 3RANA 3RS4A 4TWIA 4IJ5A 4AP9A 3ITDA 2GI4A 4UBNA 3MS4A 3I2YX 1XD2A 1SKQA 4BP9A 4F12A 5C35A 1O6CA 3TZQA 5K0TA 4A10A 2EJBA 4HGZA 5AK4A 4M7RA 1P7PA 3DP7A 1Y0YA 3CCCA 1QSGA 2FKNA 3NTOA 3R24A 4BB5A 8OHMA 3P9QA 1XQ9A 4RD0A 1O95A 2QD1A 5JCJD 2APJA 3K9WA 5C5CA 3TG8A 3ETGA 1G9SA 3VNSA 4CEIA 1XTTA 4QEKA 2C9MA 1X1QA 2ZIZA 3SS8A 3F6EX 4B9AA 1G21E 4OFZA 5HIAA 1FMTA 1NASA 4EW3A 3KEQA 2AFIB 1OOEA 3DWIA 2WK1A 4FILA 1C9EA 4BO3A 4GXTA 4UHJA 1EFVB 5T8KC 4TTVA 1SBTA 3RUPA 1FP4B 2I4IA 3GJ4A 3R0VA 4B81A 4DA4A 1ODFA 2AR9A 1HRKA 3DOEA 4J0HA 1EM6A 2DXIA 3O74A 1V16A 1U0GA 1G8PA 1W0KD 2SICE 1YCHA 2I3AA 2VXYA 5IJAA 2RGRA 1CQIB 1QANA 3DZBA 1IL0A 1DP4A 3ZGVA 5JISA 4MA5A 3AF6A 2AFHB 1XXLA 2ZLBA 2WDPA 1G18A 5A62A 1CUJA 2HZ7A 2HJGA 1IRXA 1E3JA 4JUAA 4QE3A 4IEEA 3O4VA 2XQFA 4OQZA 3IURA 5EL0A 5F3RA 1SO8A 1QOZA 1QFZA 1UBMS 5GM2A 1JALA 4L7VA 3TX2A 3IOCA 4WIAA 4ZHSA 4B44A 4LVOA 4KODA 4ZT5A 1NMQA 2ZTNA 5KBYA 4L4XA 3UH0A 1IHMA 4HSGA 5D87A 1W5AA 3CKYA 4GI5A 3DOFA 4HFRA 1HNZB 2RKBA 3LNTA 3UXEA 2Z8XA 4OXIA 4XN0A 3GELA 5CJPA 3ZHBA 1NM5A 1LD3A 1EX6A 4X97A 4GRAA 4YRRA 3T9EA 4BZXA 2WI8A 1E2BA 4GQAA 2VHJA 1UIMA 4QBHA 2A9VA 2WU0A 3A27A 5G53C 2D3NA 4B75A 5IAOA 3ZGLA 3U1BA 1QHEA 5GJVC 1VHOA 3R5JA 5F78A 1FK8A 3O9MA 3RC1A 2QQ5A 1YS9A 3Q2OA 1S3FA 4O4HB 1OH8A 2VPZA 4E3WA 5JXGA 1M2OB 1Z12A 1ABEA 2YXNA 4QRHA 5HRUA 2B3DA 1BOFA 5JAUA 1MT0A 1A9OA 2WIKA 4MVXA 4TMXA 1A8HA 3H6GA 3B5JA 2JKVA 4J49A 2K87A 1E1YA 4ZALA 1M7BA 4DXHA 3JTMA 5IW8A 4Z51A 3O82A 2DTEA 1L5OA 4RDJA 3QI7A 4C7BA 4HEHA 4PSAA 4JUDX 2XA2A 3EQZA 2B6HA 4RV9A 4BO6A 2QTNA 4KXVA 4GEKA 2G1KA 1TIPA 3HDGA 1PLJA 3KOZA 3RASA 4B3GA 4TYWA 1CIPA 2CNWA 2BKVA 4HLNA 1DDGA 2WNSA 5EJ2A 1RQRA 1HDXA 3GW8A 5GIPE 3T3NA 2P3MA 3QVLA 3RV3A 3K31A 2RJNA 2AD5A 5HTKA 1N7GA 1Q1QA 2C29D 3QBVA 3S5JA 2FMTA 3FR8A 1T3GA 1WBJB 5I7HA 4JS0A 3IAS1 1PZEA 1XN1A 2NUAA 3LHFA 4TV8B 5D85A 3V2IA 4TSRA 2VHTA 3OF2A 3UXYA 5A4IS 3O95A 2WFAA 1SKBA 4PFKA 4I3GA 3ILSA 2AOUB 2P9QA 5IBCA 3U4QB 4KKSA 1TVKA 5E0OA 4XFJA 5IAJA 4F5ZA 4JKYA 2X1HA 4YC7A 1E7SA 5J2UB 3B13B 4D3DA 5DHPA 4B6JA 2EKDA 1P4GA 1R74A 3EGDB 1AMOA 1N6LA 2XJ9A 3A1EA 1YR7A 2ZRQA 3DHEA 3N59A 4MRPA 3IP1A 2W70A 1A27A 3T7EA 4JJKA 2P9EA 4G1BA 1Y7PA 4GYYA 1GPMA 3HXMA 3BHJA 4QREA 4KWEA 5BUZA 4TM7A 3UQZA 2PWPA 3I23A 3F6YA 6GPBA 3WTCA 1W1WA 3NHJA 5BW8A 1DC5A 1ZNXA 1T2DA 3HCBA 5ALIA 3UKJA 1FUYB 1P33A 1AUOA 4GS5A 3RROA 5I51A 5C34B 1DCMA 1DBWA 3D8SA 1D1SA 4OA5A 4OM8A 1D6JA 4YCDA 2OPHA 3N0XA 5J1TB 3C85A 4KQ2A 3KOMA 1TO6A 4AUMA 3T38A 2I3DA 4N47A 4US2R 3MWFA 1NZJA 3F6PA 4RMJA 2V4DA 2V8BA 4J0KA 1FS6A 3E7WA 4MUAA 4RZSA 1KDOA 1R7RA 3HB0A 4LBVA 4W5TA 2ADMA 1JPNA 2P4QA 5CLHA 1S72B 4ZGGA 2GXAA 1SXJC 3IAM6 4UTOA 4NEHB 3I62A 4HDSA 1QC5A 3NWOA 3DKRA 2N42A 3CSUA 4RZ2A 3GO4A 1D0VA 4BNUA 2W6IA 1B2LA 1USUA 3CXRA 5CX4A 1B93A 3PUHA 4X7DA 1XEWX 5FBQB 2YJTD 4AM8A 1EFPA 3G0GA 2BY4A 3EEYA 4Z86A 3VBCA 5AQ1A 2QE6A 2C20A 3ZK8A 4V3CA 4ZO9A 3TR6A 2D5IA 4OHKA 2LGJA 4LK3A 3AM5A 5JS6A 3GZJA 3ABRB 4PC3A 1ECJA 1Y1TA 2PKWA 5IJZA 1W87A 2P67A 1T5OA 2ZKLA 2Q27A 4JLBA 3ZHCA 1G7TA 1E59A 4W4TA 4TXLA 4RPIA 5P21A 4BQSA 2WFZA 2PZBA 1NJFA 1XTPA 3LQYA 3ROQA 4B3JA 1VBKA 3CN7A 3NTVA 4OFWA 3LPMA 4IAOA 1YZHA 1BH6A 5ALTA 1ZGGA 1PFGA 3RPEA 4I50F 2ZETA 4L4ZA 1S2MA 1WRBA 1ILWA 2X6WA 3IUQA 3U3XA 3O4HA 1P2DA 4U1RA 3UWSA 4MQEA 3Q72A 4J4BA 3ZR4B 1PVVA 3TW8A 4C7OB 1Y1SA 4DZRA 1AV6A 4LV5B 1GUYA 3GDHA 1FQKA 2X5KO 3OQVA 5U4QA 2X3UA 4KN5A 3WKBA 1F51E 1S89A 2WQ7A 4MCAA 1QTNA 1UC9A 5A3SA 2V7EA 4EKEA 2KPOA 1RRCA 1KAMA 4IMPA 3DMFA 1JG7A 1WQ3A 1XO1A 1YRYE 1XQYA 2WJZB 3BK1A 3VR6A 4P5PA 4KIJA 3WK9A 2HAEA 2WAMA 4GDMA 1NOIA 3Q3GE 3GEPA 4ZCPA 2C3PA 4YXWD 1O03A 3OMXA 4FINA 2FJUA 1L4EA 2CXXA 3HMKA 1NF3A 4GP7A 1POWA 3MTGA 3WQQA 1AHHA 5CCEA 3RIEA 1VCHA 4P98A 1CRQA 4ZIRB 2GKOA 3LNNA 2E89A 1E9SA 3PQ6A 2AQ8A 5ENVA 3V1MA 5GIOE 2VAMA 2ABWA 1IOLA 5JSQA 5FNVB 3I8SA 1S7CA 3IQHX 2DFTA 3EVBA 4HFJA 4J2HA 4TVOA 4JYMA 4ZAVA 3NNSA 4XR9A 1HV8A 2WB4A 2WJ3A 4M0PA 1R4AA 2OC4A 4NNPA 2Y2UA 4ZVOA 3JQ8A 5LNK1 3VOAA 5HKOA 2C4NA 4NICA 3MTQA 4OPOA 2O23A 5INTA 1UXOA 2YWXA 2AWOA 4C6HA 3HKEB 1OBFO 3UMYA 3HK2A 1AT1A 3ZE2B 4V1CA 4QOGA 1HOXA 4J1QA 4UCQA 5CA1F 2B4KA 3I5XA 2IYTA 3WIOA 4BNIA 4DIOA 5K5EA 1DC6A 2OZVA 4RELA 5FOUA 4F92B 1ZN7A 2JK0A 3FY4A 3FE2A 1Q0LA 4M6WA 4M9CA 4Q4LA 4V0SA 5ALKA 4HO1X 2QM8A 2G25A 1Q92A 1H2RS 2VDJA 3RUHA 5L4NA 1WE2A 1VE5A 1XCOA 2H16A 3IDAA 2I4OA 4FX2A 4UUMA 3PHCA 2ZI6A 4JI3B 4AZ0A 1MB0A 1QFMA 3CNQS 3T7JA 5C7LO 5FAKA 1B0UA 2WE7A 3T1VA 4WCFB 4QDXA 3ZZ0A 7YASA