3MCAA

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
377
Chain Sequence
KKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLGRIMFELGEIIGDAPGHRDFISGMIAAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVTVTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLRPGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
molecule keywords Elongation factor 1 alpha-like protein
total genus 82
structure length 377
sequence length 438
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF08938 HBS1_N HBS1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mcaA02
1T6NA 5KSPA 1MKYA 3SHWA 1AK2A 2OM2A 2HV8A 2QSYA 1KI7A 2XNSA 4LHYA 2DYKA 4WXPA 4DVGA 1BX0A 2J59A 1Z07A 5J40A 1IXZA 4KCGA 3WRXC 5IT5A 1E2DA 4LJ8A 3ZVMA 2FU5C 2PMKA 1DAHA 4PC3A 3ZBTA 1XTRA 3CRW1 4DEXA 5CM8B 4M53A 1IN8A 4YMSA 2JJ1A 5GJVC 1Z0FA 3ASZA 3SJCA 1FUUA 3MHPA 2FE4A 3Q5EA 1JR3A 4IOJA 4XSHA 3K0SA 4A2QA 3P1JA 3VR5A 1YZLA 2FN4A 1KC8D 2WSSD 3NTUA 2JJ1D 2VYQA 5LDDC 2WJJA 4DLTA 3AF2A 5CJ2A 3BIFA 2JJ2D 5CYPA 3KB2A 3QE0A 5K8TA 2D4HA 2BN4A 1ESMA 2R62A 1TQ6A 3GEIA 1GKYA 2B92A 4A8JB 3HR8A 4EJSB 2XNJA 4M0LA 1RPZA 1TU4A 4Q4LA 4LBZA 3OEED 2QMEA 1P73A 3C4JA 3JQPA 2CCJA 1S1MA 2N46A 1KZGB 3B82A 3CCVB 1M7GA 3IBGA 5KSZA 3UIEA 2P6RA 3N2IA 1K6MA 4M9QA 1NG9A 5EP4A 1Z5ZA 4DIDA 1LNZA 3U44B 3HWSA 5JBQA 1E2QA 5D3QA 4HATA 5CDFE 1U94A 3B1XA 4GFDA 3T12A 1S8FA 2J87A 4ESHA 1LF0A 4V0KA 3CB4A 1TUIA 4EPVA 1R0XA 3FMFA 4B43A 2CNWA 4Q18A 3VFDA 2GAOA 4L5BA 4JBXA 4TMKA 4YXWA 4KYIB 2ZS7A 2QZ4A 3O8BA 3G0HA 4M1TA 3BAFA 2CL0X 4JLNA 1IHUA 3LD9A 4IRUB 4JT4A 1OB5A 3CWQA 3K8YA 2NMVA 2QG6A 3QPVA 2WPDD 1PJRA 5DSZA 2ZJ8A 1Z6YA 3EWAA 5SZJA 3T5DA 2ECKA 3PEYA 1G6HA 4HAUA 1XCMA 3VX4A 4TYPA 3BE4A 1H85A 1P2UA 1Z83A 4S2EA 3RS7A 4M9XA 1H8EA 1O87A 4OI4A 1G5TA 3WMEA 2QP4A 2RGNC 4MUBA 2ZRMA 1FL9A 1OFIA 3OIWA 1QHGA 3L0OA 3DL0A 1U0JA 4D26A 4JKIA 1YR6A 3KZ1E 2CJWB 1UBFA 4DDTA 2IS6A 1N6LA 4P6VF 4QBGB 2JLUA 1KK3A 1XJQA 3D3QA 4MYUA 4NYIQ 1AKEA 2IYRA 4PQRA 1FPMA 5HE8A 4PHHA 221PA 1XEWX 2AFIE 4CT4B 1LS1A 1Q1QA 1RJ9A 1RVDA 1HQCA 3K0CA 4DEYA 3RHFA 4B48A 4G1BA 4GP7A 3RRYA 2X1VA 3OFNA 2X19A 4XIGS 2DR3A 3U6BA 2JIZA 3V4FA 1YE8A 2WJIA 2ZTSA 4BPBA 1VDZA 1BIFA 3TSOA 1PVOA 1EGAA 2JLSA 1W47A 2HUPA 1Z0AA 1E79A 2YOHA 4LYAA 1D9ZA 3RABA 1W34A 2O8BA 2F1IA 1OGIA 4IOMA 4HYYA 3A36A 3JZMA 5FPHA 4GL2A 1E1QA 2W00A 5FTLA 2H17A 3RYTC 5F98A 1Q12A 4LX0A 3CMAB 2NZ8A 5J4LA 3TR0A 3B6EA 2OEPA 3NXSA 3W5HA 3LBNA 1QH0A 3THOA 1UEJA 1XMSA 2DEUA 1DTSA 3KKPA 5KDLA 3LX5A 3O8CA 1KZ7B 1ZM7A 1VQKB 1KAOA 3NBYC 4IVPA 3O8RA 1X1SA 2IK8A 1W2HA 3SQWA 3UMRA 1G21E 3OZWA 5BXQC 3CMEB 3N70A 5TXGA 1YQTA 4NYIR 4V0ME 4LPKA 3VTKA 2VNHA 1HT1E 3SS8A 3KDSE 1MRSA 2OTLB 4M4SA 2O0KA 2MSCB 3R20A 3SFZA 4QNMA 3Q8XB 4AYTA 1GFIA 2C95A 1OF1A 3DOFA 3CC4B 3ZD6A 3QEJA 4FMDB 5FTMA 4LBYA 1OJLA 1ZUNB 1P2TA 4MITA 3IKJA 4UXIA 3AGQA 2IXGA 4AY2A 2BHRA 2C03A 2J0UB 4H1UA 3K70C 2YHSA 3SQXA 1ANKA 1JQJC 1VIYA 1XU4A 3IILA 1UFQA 2G9NA 1F2TA 3KUDA 1OHHA 4HZUB 4EAQA 4CEIB 3C5CA 4YHBA 2FA9A 1KSFX 4ZI3A 1YZGA 3FFAA 2AX4A 3I32A 3FDIA 4TT3D 4DHEA 5FR2A 2WWIA 3U3KA 5BWMA 4QJ3A 2QU8A 3LXXA 5G3YA 4BFYA 4QBFA 2QROA 3REFA 1GWNA 4BRWA 3W2HA 5EE3A 1D2NA 1CR0A 1Z0DA 2HT1A 1KI3A 1CKEA 4OL0A 2ZUBA 4LBWA 1GRNA 3CX7A 1XF9A 1UKEA 2FEOA 2IW3A 3MJHA 2DFTA 3NDPA 2WJGA 2WIBA 3FYHA 2VF8A 1KTVA 4GT1A 1JPJA 2J46A 5CIQA 1DG3A 4PPQA 2QEXB 5JZVA 2QGZA 4FK8A 3I61A 1YJWB 2XNDD 1XFAA 3PFIA 3SBDA 1UKZA 2R44A 1ZNWA 2EWWA 2ZM5A 3G5UA 3W5IA 1FNDA 3B9QA 3CCUB 1MO6A 2O5VA 3G6EB 3GLIA 4FN5A 1XPUA 3RRNA 4A82A 1F48A 3BC1A 3MSXA 1G7CA 1ZVQA 3RDPA 3UG7A 4HE5A 2G6BA 3IPYA 3C16C 1T5LA 1QG0A 2D2EA 3TK1A 2FNAA 4ARZB 2BM0A 3OZXA 2RKOA 3CONA 4Z1MA 3U3MA 2WJVA 4D0GA 3CCMB 4CDGA 4Q5IA 3K70D 3W34A 1XXHE 4G5SA 1VG0B 4RZUA 3CRVA 4PGOA 1E2EA 1OKKD 2P65A 4LI0A 1R5OA 2QE7A 1RRFA 5JWRA 2D62A 3QXJA 1CBUA 4G5GA 1FFHA 1SHZA 4Q9IA 4RVCA 5CLLA 5D3MB 4CYMA 1NBMA 4MGKR 2FFBA 1K9MD 5DHAA 2XTZA 4KFSA 3KKQA 1BMFD 2ODEA 3BOSA 3BORA 3PJRA 3GFTA 1QBKC 4TSFD 3DM5A 4EQ6A 2W0MA 3I73A 3IHWA 5TMPA 3OZUA 4X8MA 5DN6A 5IF9A 2MSEB 1U8YA 4A4DA 1MO5A 2QN6A 4J0QA 1P72A 2RH5A 1GP2A 4JLAA 1SULA 2PT5A 3G71B 2IT1A 2IYQA 3OAAA 4N0DA 3X1WA 2Y8EA 3LDAA 3VNVA 3AEZA 4LJAA 5JEEA 1KGDA 5KNCA 1VQLB 2XNDA 5CIWA 4KAXA 4FW9A 1OGJA 1ZC4A 1N6IA 5FBQB 2O8FA 3WNCA 3OEHD 1YJ5A 4D4KA 1X8JA 2ANCA 5LD2B 4AKHA 3CCLB 2Z43A 3PENA 3K0CC 5CB6A 4KLZA 1QVFB 3EIEA 3I3SR 5IRCD 1CLUA 4O2RA 1ELOA 4W7SA 3S1AA 5K8UA 4US0R 1XMIA 1D6JA 1XX6A 4WBSA 3MCAA 5J4YA 2XTMA 1W0KA 4YQFA 4UNPA 1TMKA 3V00A 1CRPA 4Y9UA 1Z2CA 3FVQA 2GCOB 2O8DA 4ZPXA 3LQQA 1Z6GA 1LW7A 2B8WA 1G4UR 1N6PA 3CX8A 4AK9A 2VNIA 4ZDJA 4D4JA 1JAHA 3CNLA 4HDOB 1NIPA 4DT1B 4EFNA 2D7DA 3J81k 1SXJB 1CJUC 1A4RA 2BMFA 3L0SA 4P32A 3W2IA 2J41A 5EP1A 2ATVA 2BF4A 2WVJA 3CPWB 1KDOA 3OJXA 1MV5A 2GPJA 2YV5A 1DO0A 4MH0R 3KX2A 3ASYA 2YWFA 1Q20A 5SZHB 3WY9A 2UZIR 2R6GA 3TBKA 3WMGA 3EW9A 1GL9B 1PUIA 2V3CC 2D2FA 4FIDA 2NZJA 3RRMA 2XJ4A 2DB3A 1E0JA 3RWOA 1P60A 2GVZC 3EX7C 1J99A 2J7PD 2A2ZA 3O47A 1KDTA 3AV0B 4KSCA 2ORWA 4I81A 4QGAA 1E98A 2ONKA 4IEIA 2GQFA 2ZRNA 4JSYA 1UAAA 3F3YA 2KB0A 1E96A 3NHBA 4GOKA 3VMFA 4IKEA 1OH6A 2VZLA 2DCUA 1S9HA 5FTJA 3E70C 1YITB 4HSEA 2JJ2A 4ZV4A 3U60B 1FMJA 4LV6A 4HUQA 1E1RA 3FHCB 2FZ4A 4DB4A 1R2QA 4RD3A 1IN4A 3W9YA 1XP8A 2ZIAA 3CRZA 1KSGA 3UK6A 1S3SA 1X8KA 5KNDA 3X2SA 1YVDA 4LJ9A 4LOAA 2QNRA 4A6XA 3ZVLA 3THXB 1BOFA 3RLFA 4I1OA 3QF7A 1TQ4A 2WOOA 2VHQA 1KY2A 5BQ5A 2Z0MA 4EPWA 3P26A 1KNQA 2EVWX 4KSBA 1NL3A 1N0UA 4UJ3A 3WRYC 1E6CA 4BLSA 2VHUA 2RGGA 5J4VA 2OBNA 4EJSC 1NNEA 3W90A 1FOEB 4HDCA 3GEEA 1JECA 4YDHB 1BX1A 4P4TA 1E1RD 2P5TB 3AKYA 3B13B 1QHXA 2ZETA 3QF4A 1E62A 4IVQA 3LBIA 2GEVA 3RS0A 2DHRA 1TAGA 5IK2A 1QHSA 4DLWA 2P6NA 2PCJA 1HA3A 2VTKA 4BLTA 4WQMA 2D7CA 4TYQA 4ZDWA 3K09C 1KD1D 3ZH9B 5SZKB 1Z6AA 2FJUA 1R7RA 1RRPA 2J7PA 3CH4B 3U5ZB 1XB2A 2RB4A 2QPAA 2ASEA 4EIWA 3TW8B 3EG5A 5FUVA 1OXSC 2CEAA 4KITB 4C0HA 1FRQA 1DVRA 3EPKA 2QP9X 3Q7QA 5J47A 4RCZA 4ZCIA 3CCSB 1T5IA 1BYUA 1MO3A 4YAWA 3QVVA 4PO1A 1SXJC 3AP2A 1JR3E 3QXHA 1RIFA 1AS0A 2ZRGA 4I4LA 4Q1BA 3WP1B 3B1ZA 3OFND 1NN3A 4DSOA 5F2EA 1YR9A 2BBSA 2VO1A 3C41J 4S35A 1GSIA 2HF8A 2PX3A 2W6JD 1Y3AA 4LHWA 2EYQA 4QJ4A 5FBRB 2ZSDA 5C1BA 2OHFA 2ZE6A 2BEJA 3VR3A 1J90A 1KO4A 1D9XA 4NKRA 2AD5A 2Q3MA 3QY0A 2YWEA 1KJYA 3WP0A 2ZYWX 3BRWD 3TMKA 1NF3A 2FSHA 3T35A 1WCV1 3R8FA 4B3XA 2V1XA 1E69A 4RD6A 2OBMA 2VF7A 4B2IA 4XD7A 1VHLA 1BS1A 1NSFA 3NBXX 1T0HB 4BQSA 1UDXA 3CCRB 4IOLA 1SVMA 1OPXA 1PLKA 1W49A 1X86B 3ZC3A 1OIVA 2BKEA 3I4LA 4XWKA 2BBOA 1VPLA 1QGYA 1QHHB 2OAP1 3QOFA 1Z28A 2BJVA 4U00A 1KNXA 1NVVQ 2ZI9A 4EDHA 1QX4A 5KUTA 5CK4A 3SJZA 5C4MA 4D4MA 4JL8A 1KMHA 1COWA 3A4LA 4DCVA 3PITA 2PX0A 4BGDA 4MRNA 2GHIA 4OI0A 2H5EA 1G19A 1AS2A 3ADBA 2ZRDA 1M34E 1SKYB 4C7OA 4UXJA 2JEOA 2FGJA 2CBZA 3RC8A 1U8AA 4F92B 1M7HA 4E07A 3MG9A 3FMOB 4P4SB 4QBIA 4TLEA 2VSOA 1YR8A 4OQMA 2QMUA 1QGAA 1ZM2A 1M1KD 5DE3A 5C46F 3KJHA 5TVKA 5FL7A 1XJCA 4MYCA 3X1DA 3THYB 4Y0AA 1I7PA 3AQ4A 1W36B 1KK0A 2RGNA 1CU1A 5AJWA 5DISB 3TUZC 1XTKA 4RFSB 3K0FA 4NPHA 1NI3A 2BCJQ 3THXA 3CH5A 2PH1A 1OH7A 3JVVA 5JI2E 4D25A 1GAQA 4CEHA 5ANRB 2EFHB 4TMXA 2J0UA 2V7QA 4NTZA 5P21A 3MWKA 2FFHA 1FRNA 4DLZA 3MGCA 1WRBA 4F93B 4I1SA 1HTWA 3T61A 3F0TA 4QHTA 2ZQ5A 2XJ9A 2E1RA 1IQPA 5DH9A 4HZIA 4BZXA 2P3SA 2FGKA 4O2LA 1RZ3A 1KDPA 1KKLA 1NVXQ 1ODFA 3CF0A 3QG5A 3AM1A 4HLQB 3L2OB 1CIPA 1TLLA 2VQSA 3Q72A 4B2PA 2WJHA 2JLVA 2ZAOA 3L0PA 5H70A 1KK2A 4QJ5A 2AWOA 3KJGA 1KIMA 1XEWY 2DFLA 1TADA 2H57A 2ZAMA 1V43A 1ZU5A 2YVUA 4LK2A 2N1BA 3ZS9A 4D82A 5AN9A 1MOZA 2QTFA 4DKXA 3Q3JB 4C9BA 2RCNA 4PZZA 1N5KA 821PA 4E09A 1TF5A 3ZQ6A 2DWQA 4F4JA 3VX3A 1JBKA 4W5JA 1VG1A 3NEJA 1K73D 1S3GA 2ODWA 4GOJA 2RHDA 1NJFA 2NO0A 4M1OA 3E20A 5AUPB 1KO8A 2ERXA 4NCKA 3R7WB 5CITA 3K09A 4OI2A 1VQ7B 3UXMA 2XSZA 1LB1B 1VQPB 3VU9A 5EQTA 1II9A 1XTSA 2ZJOA 4EPTA 4KV9A 3WYGA 1AGRA 2O8FB 1TPZA 3HYTA 4MQBA 1CJMA 2HT6A 1NG1A 2GJ9A 1EWQA 2YWGA 1M7BA 3TUJC 1YKSA 4PAQA 1QHHA 2A3RA 4FWIB 4B3GA 2R6CA 3OESA 3U3RA 4BEBA 2JLYA 1JJ2B 2GCPA 4WA7A 1RW4A 4UNRA 3W5UA 2WIAA 3W6PA 3L8ZA 3EWSA 1FP6A 2KBFA 2CE2X 1EFRD 1Z0IA 2HCBA 2VBCA 2XXAB 1VCMA 4BE7B 4C0QC 4IDNA 3GLHA 4JVLA 1YU9A 2KE5A 2VHJA 4IEEA 3B60A 5JECA 3PEWA 1IN6A 5CM9C 2MMGA 5BYKA 3QUSA 1CNFA 2BMEA 2QI9C 2XB4A 5AUNB 5L3SA 1CTQA 2DBYA 1E79D 1DE0A 2HLDA 2GEUA 4UNQA 4LWZA 3RWMB 2YNMA 1UJ2A 5DNYB 4PZLA 3WMFA 5B2ZA 1W48A 2ZRBA 3CZQA 5AK0A 5GJCA 2HF9A 4DDVA 4JBYA 2XZOA 4CEJB 2NPIA 2QEQA 3IUYA 2GJAA 4TMTA 4MYHA 3R9IA 2C99A 1EK0A 4OJQA 1T9HA 4ZDKA 5HCNA 1W0JA 2I3BA 1D1NA 1E2KA 4NCHA 5FOWA 5LB2A 4B3BA 5M04A 2G77B 3A1SA 2IS4A 5DO9A 4R71A 3L43A 4GNKA 5FTKA 1P61B 2A78A 3V9PA 2ZJ5A 1R4AA 4HB3A 2X2EA 2QM8A 2GXAA 1F60A 2F1HA 1NVVR 1U98A 2QORA 3QJYA 2BGIA 1VQOB 1Q44A 3R9XA 5BYJA 2XSZD 1XEFA 3EC1A 3GMTA 4A0RA 4U02A 1GTVA 1Y63A 3ND8A 3AF3A 1QGZA 4MKFA 2W2VA 3RSLA 1QG4A 4QHSA 2IYSA 4W5HA 5G41A 3DEFA 2CVHA 4ZI2A 2NQ2C 4GSYA 2HDNB 3UMFA 3HDTA 5L3SB 2WPDA 1Q0UA 3E5HA 1P5ZB 2FSIA 2HLDD 2RGBA 2JA1A 2TMKA 3FHOA 4URXR 3CD6B 1DAEA 2IHBA 4MGYR 4RZ3A 2GDJA 2OLKA 4OQLA 3W2FA 1M6NA 2HXSA 3IIMA 2IWHA 1QHIA 2XXAA 4GDFA 1M1YE 1H8ED 4HI0E 1NKSA 1XXHA 4OHVA 2BSAA 4QC2A 1Z8FA 3KQNA 1TF2A 1CXZA 3ETLA 1EWRA 3GFOA 1UBCA 1M8PA 2P2LA 1JA0A 4HB0A 3I62A 4EPXA 4HZUA 5EZ5A 3GLFE 1G6OA 5GV7A 1Q21A 4IDOA 3BB4A 4BZPA 5GADl 3B1WA 2LKCA 3TLXA 4RD2A 1G8YA 2VHCA 1NDHA 4C0SA 2AHOA 1XMVA 2QENA 1G4AE 1Z63A 4HE6A 2AFHE 1FMLA 4FXPA 3WYAA 3KKNA 1JJVA 2H18A 3SDZA 5BN5A 2V1UA 1JA1A 2QM7A 4EPRA 4OHYA 4UNNA 1VG9B 4KFUA 6Q21A 2GNOA 4DC9A 4X8OA 5AR1A 1MR3F 3R7WA 1P7CA 5HE9A 3PG5A 5E4FA 4Z1MD 2Q3HA 3SE0A 5KO2A 2OTJB 1CS4C 2VPPA 4MDFA 2JLRA 4P0TA 4Q66C 3VHXA 3ZGXA 5H5JA 1W0KD 1XE1A 3FMPB 1SQ5A 4M22A 5JEDA 1NRJB 2ZRJA 1E9SA 4LPSA 4JIMA 5K8IA 4CEHB 4PO8A 3VR1A 3DMDA 4UAJA 3HU1A 2YWHA 3EC2A 2E87A 1G41A 3FB4A 5HR5A 4KODA 4OK6A 2R6DA 4DDWA 1MRNA 1KHTA 2QY9A 4G1UC 4Y0VA 1E2LA 5L3VA 4LDJA 3KFVA 1NLZA 3Q7PA 2QTHA 4F7DA 5C4GB 1B0UA 3LO8A 2R65A 3FGNA 3GEHA 1YI2B 1DAKA 2IWRA 2IX3A 1JB9A 1U99A 1OV4A 4RD0A 3BK7A 4Q7MB 2AD1A 4QNRA 4ZKDA 4BLPA 2G3YA 4D81A 1W2GA 4NCJA 2OFOA 3KTAB 5CDFA 1L4YA 2J3EA 2VYFA 2ZITA 5H1YA 2PZEA 4L16A 3RS2A 1UM8A 3GQBA 4B32A 5LD2C 3U4QA 5BN4A 1X6VA 4G5OA 2NO9A 4V03A 4G1VA 3SFVA 2CDNA 4G5QA 4DRZA 4F4IA 4LZZA 1U2RA 3LWNA 4JZKA 1PV4A 1S1CA 2FX3A 4LHVA 1Z08A 1IJFA 5FI1B 4CVNA 5E7JA 2GAAA 2VRWA 4ZGNB 4PAMA 1W46A 4Q7JB 1BQEA 1JR6A 4PPNA 1VQ4B 4RFSA 5DI9A 1ETUA 2VP0A 3R8CA 1SM4A 1VQNB 3MMPA 3SC3A 4EQ6B 1FZQA 2OUKA 4LYHA 3TSZA 2J0QA 2FV8A 3LVQE 4M1WA 3OW2B 2ZI6A 2BBWA 2IXEA 4XSGA 4EPYA 4LCBA 1NJGA 4ZCMA 3UANA 3A4MA 2GCNA 2F55A 4G3XA 5JHHB 1GL6A 3UATA 1KI1A 5HZKA 1YJ9B 2B8TA 4TLDA 1G8PA 3B2EA 1ZM9A 4CF7A 1XRJA 2EIXA 2QMOA 3T1TA 4QXAA 3ZBUA 3ADDA 1HT2E 1US8A 2GK7A 3NHAA 1DELA 1SVWA 2ZSFA 2JDID 2YKGA 2NPFA 1F5NA 5FPSA 3IQWA 4RSGA 4ARZA 1NSTA 2CLSA 1QVAA 5B58C 2UKDA 2P6UA 2RGDA 1A1VA 1T0JB 1JI0A 2BC9A 1GOTA 3QNUA 1CR4A 1YZTA 1E64A 2O0HA 3QXSA 3SZRA 4M2LA 4R9UC 2WWYA 5B30A 2B21A 1TNDA 3AUYA 1G20E 1OSNA 1PLLA 5FL7D 4BASA 2R6HA 2GBLC 4ACBA 5AJZA 2GF9A 1NMYA 3QKSB 3VO1A 1E2JA 3K9HA 1E99A 2FF7A 3GJ5A 1OHHD 1FNMA 1RRCA 4CEJA 3JZAA 1AN0A 4MGIR 3NBZC 3SHFA 4Q7KA 1G3QA 3QG1A 4K1XA 1E2PA 2IEZA 3LFUA 2BPOA 1QDEA 1RFLA 4IHQA 3QF4B 4KYUA 5TB5A 5KTYA 1FNBA 3LVBA 1KJWA 2HXYA 3HYRA 4C2TA 2O8EB 5AJXA 3X1XA 1ZAKA 1U0LA 3QBTA 1ZNZA 3NKVA 4TLAA 1QUFA 1N6OA 3C15C 3F5FA 1JXMA 1Q3HA 1T3SA 4B3FX 2YINC 1XPOA 3AKDA 4V0NA 2OXCA 3LLUA 1R5NA 4XVRA 4ASUA 2GVDC 4BPRA 2XX3A 1QHYA 4QOSA 1WBDA 2QQEA 1VMAA 4IDPA 3T1VA 4Q4AA 3TSWA 2MSDB 4JLPA 4CEIA 4TMVA 4BUJA 2RAPA 4LGMA 1WQ1R 2BKUA 2ZE5A 4Q19A 1KI2A 2QQ0A 1XTQA 1B2RA 3GCGA 1A2KC 5IK2D 3CX6A 3C7KA 5FOSA 1IN7A 4LJ6A 3T1OA 5EE5B 3ZZ0A 1UMKA 3QXXA 2NIPA 3D6TB 2GILA 1YZKA 4MRPA 4ERNA 3WYFA 2Q9CA 3NH6A 2XOKA 4KXFB 1EWYA 4AG6A 2H7VA 1IOZA 5SZIA 4KLNA 4AYWA 4L9SA 4B71A 3HPQA 2ATXA 3B7GA 4KFRA 5J4KA 4QM6A 1Z29A 2FPKA 4BZQA 4XH9B 4B75A 2W2XA 4LHZA 4HUTA 1Z0JA 2VP2A 2FOLA 1NVWQ 1XZQA 1JNYA 2N42A 4KVGA 1K8RA 3VR6A 3P4XA 1N0WA 3FWYA 2XNCA 3NC1C 1J8MF 4ZKEA 1OT3A 3PV0A 5HXBA 3AKCA 4FMCB 1JEEA 3T06B 4C4PA 2V8OA 1QRAA 1BH2A 3D8BA 1M90D 1T4GA 4BFSA 4US2R 1G7SA 1Z6TA 2NOAA 2O52A 4YMTA 5JS8A 1GG2A 1SZPA 1WXQA 2IYXA 4O3MA 4C0BA 5FOTA 4G5RA 5KDOA 2O8DB 2WAYA 4XWAA 3AVQA 4M8NE 1JAIA 3KFXA 3P4YA 5FI0B 1J9ZA 4OBEA 1U0HC 1B23P 1XD2B 4QM7A 1SGWA 4ABYA 2ZRFA 4KI0A 3EASA 3WHLA 4TTQA 3U7HB 3B1YA 4JSTA 3FOZA 3ADCA 2ODNA 3EZFA 1D2EA 3IDQA 2IUTA 2VNKA 2ZI5A 3B9PA 4HB2A 2YZ2A 3MD0A 4PC1A 5CLQA 4YMWA 4PX9A 2LWIA 2AWNA 3D7MA 4LHXA 4QG7A 3PUVA 4MYTA 4LJYA 4NCIA 2Z4RA 4F38A 2IEYA 4IJMA 2AXNA 2AL7A 1Z2AA 3BFXA 4GPTA 2IBMA 4Q1DA 4BEJA 5JRZA 1E0KA 1VECA 1ESNA 3IGFA 1N6NA 1G291 4YALA 3W5VA 2NO7A 1XNJA 1HY3A 1AQUA 1GNQA 1R8QA 1SXJA 4OHZA 1E9CA 3SJBA 5JWOA 4HAYA 2AKYA 5GJWC 3DKPA 4PFSA 2FPMA 3OIUA 4GI7A 1W4RA 3RNLA 3Q9LA 3EZ6A 4C30A 4Q9KA 4AKIA 3SYLA 1HH4A 5TDHA 1M74A 4GOXA 1SVLA 4V02A 3BB1A 4WIAA 1W7AA 4IXMA 4R98A 5FBWB 2HCJB 1UKVY 3NC0C 2R8RA 2BMJA 4NONA 2WTUA 3T1QA 3PUYA 3Q5DA 4F7WA 1GIAA 3CZPA 5G53C 2WWXA 2C98A 3CF2A 2IC5A 2OCBA 3QKSA 1TQ2A 1AZSC 1SVOA 5GVSA 1RC8A 1DPFA 2PLRA 3H1TA 3RRZA 1KMHB 3QEOA 1E2IA 4JVNA 4B4DA 5TR9A 1C1YA 4TL7A 3KQUA 3QBVA 3G82C 1ZJ6A 4WXRA 2HYDA 4NHOA 4JKYA 2IS2A 1DO2A 1X3SA 1L8QA 3P32A 2QSZA 3C14C 3AVVA 3GLIB 1RYHA 1ZIOA 1GL7A 2F9LA 1U8ZA 3TUIC 2D3WA 4PSAA 2X77A 2WOJA 3IPXA 4I99A 3V76A 4HAXA 4FCWA 4TL6A 4Y9RA 4Q1AA 5DHFA 2ONJA 2GZDA 4I1VA 4UJ5A 1US8B 1JEDA 4PQFA 3GFPA 5KSWB 5CK5A 1FUKA 1E2NA 4EH1A 4NMMA 2HMAA 2ZI4A 3PIRA 1EG7A 2C5LA 3M6AA 4HAZA 1W5SA 1N5JA 1VKJA 2GRJA 1XPRA 4K81B 2XAUA 2O8CA 1NBMD 3CWZA 5H68A 1UF9A 1BKDR 5KPJA 4DLVA 1ZNXA 1VHTA 3CW2A 1MT0A 2QT1A 5TY0A 3GLHB 3MUFA 4M1SA 4D4LA 1FDRA 4C0LA 4Z8YA 1SVSA 4AF6A 2QUZA 1W0JD 4JLKA 4Q02A 4LV5B 2ZRAA 4V0OA 2ZRCA 3U61B 1DADA 4LRWA 1Q7YD 4KBGA 1F2TB 3QFTA 2JLWA 3DDCA 4JJKA 4AKGA 1GVHA 5JWHA 3QVUA 3GLGB 4R2IA 1YIJB 2KJQA 4PQYA 5L3QA 2GKSA 3EAQA 1PLJA 3CCJB 1WE2A 3AUXA 1GR1A 3BFVA 5FPKA 1G8FA 2ZJZA 3X1YA 1XCPA 3U4QB 1RE0A 4JMPA 1S2MA 4DZZA 1UEIA 3IHLA 4QGFA 4OK5A 4H1VA 3M0EA 3EPJA 1WA5A 3CC7B 2ZYUX 1W1WA 3LLMA 1ZCBA 2WICA 3BWDD 3AKEA 4B47A 1OYYA 2QRZA 4GMDA 4IVRA 3VR4A 2QP3A 4B73A 3AP1A 1LS6A 1J8YF 4LC0A 2WJYA 3QQ5A 1XDBA 2J9RA 2QGNA 2IUSA 1J7KA 2R6AA 3CIOA 3NBFA 4FD2A 2B7CA 2WHXA 4ZO4A 5FBVB 1Q1BA 5FTNA 1GUAA 2GF0A 4JLDA 2XZPA 4DWJA 3TNFA 2QAGB 3PEUA 4RD4A 4URVR 1WMSA 2XTNA 3W3ZB 2OFWA 5JSZB 2OAQ1 1E9AA 5K8LA 4PXAA 2O8BB 4C3ZA 3L82B 4TTRA 1A82A 3BERA 2EFEB 1E0AA 2OILA 3I56B 2F9MA 3SYNA 3AVUA 3L0IB 4AURA 2DWPA 4TTPA 2JLQA 2PT7A 1I2MA 3BH0A 4B76A 2XB2A 3LBHA 2ZR0A 1W87A 2EYUA 4MUAA 3W6OA 1CRQA 1RRGA 3CBQA 4K46A 1OIWA 3RC3A 3GJXC 4TZ0A 4PR0A 4K8OA 2PL3A 3I8SA 3RAPR 2REOA 3UMSA 5JMTA 1IN5A 1PUJA 4LUCA 5J4HA 3IO3A 3N5CA 5EUQB 2GESA 3DZ8A 3HJNA 2A5GA 3TW4A 4TMZA 1N3BA 4D80A 2CJWA 2F43B 1DAMA 1VCOA 1KSJA 4Q00A 2OG2A 2A5DA 2ZUDA 3DOEA 4JLVA 1XXHB 1VYUA 1G16A 4ON9A 3JQQA 1GITA 1KK1A 4F91B 1G3MA 1T91A 2QTLA 1U9IC 1LVGA 1R6BX 4ASUD 3TVDA 1DARA 4MRSA 3SN6A 4P4SA 2WZQA 3FPAA 1D2MA 4ITRC 1JB1A 5HCIA 1PZNA 3X1ZA 1ZBDA 3AVOA 3FTQA 4UQOA 4IOKA 1BYIA 5B64A 5KDDA 4C7OB 1P2VA 5JHGB 3F8TA 4A2WA 4W5WA 2VIIA 2OT3B 3C8UA 4HB4A 4Q47A 4OK3A 4LC1A 2ZEJA 2AK3A 4QHYA 3DMNA 4L9WA 5EMNA 2FDCA 1A5TA 2VL7A 3BB3A 4DIEA 5KPDA 1DAIA 3QKUA 4RKEA 2C9YA 3IO5A 4YMUA 4B6FA 2ZROA 2QBYB 2XOKD 3H2YA 2C2HA 3G4SB 3U44A 5CYOA 5HKKA 4A0HA 1W36D 2XGJA 4NCNA 1VQ6B 3ECCA 4L15A 4BFZA 3CRMA 3LH5A 3I5YA 4WAUA 4AWXA 1YRAA 1QZXA 1CP2A 1KQSB 3LY5A 4A2PA 1SVKA 2VA8A 121PA 3DZDA 5KHOC 3U2QA 3BGWA 3W3AA 1AKYA 2G0TA 4QGHA 5EE9A 2PEZA 4X8HA 3OEHA 3T15A 4Q4JB 1K8AD 4B33A 5JJKA 4I1UA 2Z5FA 4RZ2A 1RYFA 1EP1B 3DHWC 4ZGQB 4DQLA 4RFVA 4AIIA 4BECA 2IA5A 3MLEA 4LJ5A 1GJRA 3KQHA 2X3UA 3FJOA 2HYIC 2CK3D 4OQNA 1A2BA 4L8GA 1S0UA 2ZRLA 4LYJA 3OEEA 4HLUA 2KI5A 5LB4A 4CT5A 1LF5A 4G01B 2CK3A 3IEUA 4V0LA 1JJ7A 3GD7A 3SOPA 4XD7D 4Z8XA 3A4NA 2C04A 3I8XA 2JCSA 2HJVA 2CCGA 4FMDF 1ZD9A 3FKSD 3QPWA 2YYZA 4PO9A 1DAGA 3AVPA 4GRAA 2WBLC 4UNSA 4MGZR 5DIFA 1YRBA 3KQKA 1ZRHA 3SU8A 3VHLB 3OHMA 3T34A 4RJLA 4RKFA 1OKKA 3KXLA 3A1TA 2C77A 2D74A 1CR1A 4PHGA 2EQBA 2JJ8A 5FUWA 4C0JA 3AVTA 2GBLA 4TL8A 4CZ2A 4DCUA 3VKHA 1E32A 1KKMA 1K5DA 1XEXA 4XVUA 2J5XA 1AM4D 1P75A 1F6BA 3GPLA 3VU9B 4EJSA 3RSOA 1WP9A 5EXXA 4JLBA 2BCGY 1WF3A 1G64A 2ZANA 2YC2C 5E7IA 2H92A 1GILA 4EKDA 3TE6A 2FFAA 1G7RA 3OZVA 2FEMA 1HE8B 4M9ZA 1G18A 1JXOA 1QFYA 3VR2A 1MO4A 2VP9A 4HLUC 4YAOA 2QAGC 2VSXA 4TMWA 2QMHA 4KU4A 1FTNA 4JS0A 2W58A 4MA4A 4MKIA 4YC7A 3DVLA 1OXVA 1E2GA 1V5WA 5FOVA 3CPHA 2EWVA 1ZUHA 1X1RA 2F1RA 3A8TA 4PC6A 4BLRA 4WOPA 1AJEA 2K5UA 1SXJE 5A4JA 4PAOA 3GP8A 4HUQB 2BGJA 1OXXK 1JPNA 3FE2A 2YJTD 2Z83A 4TQAA 1EESA 1KI6A 1NMZA 4TYYA 1EFUA 3OF5A 5IDVA 3Q85A 3W2EA 5FUYA 2WAXA 4PHTA 2V55B 4TSFA 2R9VA 4Q9JA 2PIAA 1NY5A 2GA8A 4TWZA 1E9EA 2C96A 4DLRA 4B2LA 2OLJA 1Q57A 3AVXA 1VCIA 2CHGA 4NL4H 4Q9HA 3M1IA 3ZLJA 5C2JB 3CRQA 3KJIA 4JYBA 2IYYA 1H42A 3OAAD 5GJBA 2Q21A 3R9WA 1IY2A 4JJZA 1JR3D 1XBTA 4BFUA 3LO5A 3B85A 4U5XA 4JVSB 1AIPA 3MJRA 1Q86D 3DM9B 1YHNA 5FBLB 5TARA 4XTRA 3WNBA 3QI2A 1CR2A 4AD8A 5AUOB 3ZDQA 2VP5A 4PPGA 5B57C 2BOVA 2RGCA 3B1VA 3K0FB 2IYTA 2J1LA 1W44A 1W36C 1U81A 8OHMA 2OZEA 4E5UA 5BW8A 2JDIA 4DLYA 4RD1A 3CLVA 1GO2A 2ZI3A 1G7TA 5JJIA 2CE7A 4A92A 1E0SA 2QE7D 3THYA 2ZJYA 1U9IA 1II0A 1S72B 1EP2B 2WMNB 3HR7A 1GZSA 2VHTA 4QBHA 2R2AA 4TYWA 1T3LA 4II7A 3WHKA 3TAUA 3MWLA 2PMDA 2J0VA 2GEDA 2J0SA 4HLDA 2Z4SA 4DCSA 1M2OB 2CL6X 3K0AA 2REXB 2IF2A 1TTTA 2PBRA 2EU8A 2L0XA 2REBA 1EFRA 4URZR 2VH5R 1NLFA 1NLYA 1XZPA 3MWYW 4D6PA 1TU3A 2QTVB 1VQMB 3GJ0A 3ZIAA 1RJ9B 2VP6A 5FR1A 4A15A 3LV8A 3QIAA 5THXA 2ZRHA 3I72A 3NIBA 2OCAA 1KMQA 3U3OA 2B6HA 1AA9A 1DDGA 2FSGA 2GK6A 1KYIA 1NBME 3KUCA 2JATA 5E3HA 3QKRB 1SHKA 1G3RA 1VTKA 1FP7A 1L4UA 4M21A 3VAAA 4DLXA 1ZD8A 5EXSA 1EX7A 2AR7A 2AKAB 2F7SA 3V4RA 3LW7A 2CL7X 2PZGA 3LXRA 5E95A 4DUGD 1RKBA 3VQTA 4B3CA 3IBYA 1H65A 1KDRA 4O25A 1IB0A 2QPOA 2B5OA 1G8GA 2ZJBA 3CC2B 2IYVA 5JCZA 5EUMA 5D3MA 5A5GA 1KOFA 2ZS9A 1WDTA 3PUZA 1SKYE 1N8RD 3K9GA 3AGPA 4KJZA 4WZAE 5EXTA 3AVWA 2WWGA 3KB1A 2BBTA 4EFLA 4Q01A 3B5JA 4QRHA 3N2EA 4FMBB 1Q3TA 4EFMA 2AN9A 4NYMR 4XJXA 5GVRA 1VYVA 1AMOA 1UKYA 3L8YA 3ICQB 4LSGA 3GLFB 1C4OA 1OXUA 4ESVA 2IUUA 2IF0A 1FNCA 1KI9A 2ZE7A 3QKTA 2ZXUA 3SR0A 1CULC 2Q9BA 1ZM3A 4R2HA 2ZVQX 1N0VC 4QFMA 5JCPA 1GRQA 1EXMA 2G88A 4TYNA 3VKGA 1QFZA 3K0EA 4YLGA 3GJ7A 3LRPA 2OESA 4FI3C 4B3DA 2F6RA 3CR8A 3CXCB 2IHYA 1UDWA 2ZU6A 2ZYTX 1QG2A 1NN1A 3E1YE 2CNWD 3BXZA 3BH6A 4NE2A 4URYR 2XITA 3TR5A 621PA 4Q21A 3QKRA 1HYQA 3ZZUA 4BWYA 1U90A 1DG1G 1UBEA 4NYMQ 2ZR9A 4Q1FA 4A8JA 5F3WB 1YHQB 2I4IA 4JT2A 5KSYA 5KNBA 3KQLA 3CCQB 2GZAA 2YOFA 3KKMA 2YOGA 4RCYA 2IS1A 1E63A 3WXMA 2GETA 2HJGA 1SXJD 5EP2A 2E9SA 3FHTA 4DJTA 1EX6A 3HPRA 2DERA 3LAWA 4A9AA 4QKQA 4GMXA 2LCFA 5KSOA 2NTYC 5UKDA 2GWHA 3P20A 3ONWA 3QXCA 1TL7C 1KRHA 3BFKA 3CUEF 5JI3E 3NG1A 5G40A 1E94E 4BFVA 1TX4B 3THWB 3IIKA 4KVAA 1OB2A 4LJ7A 1G8HA 2CXXA 2F3TA 2G83A 2QAJA 2FMXA 4HAWA 4NP6A 1KO1A 4US1R 2ZJAA 2Q9AA 4GZLA 1GKIA 3ZQJA 4PHFA 5J5CA 5ELXA 4UKDA 3UPUA 3QENA 2OFXA 1II8A 3VNUA 2W83A 1MABA 4Q4HB 1FNNA 4CIDA 4Q7LA 2QDXA 1IXSB 1L2TA 3KJEA 3K9NA 1E4VA 1CEEA 2EFGA 2CNDA 2UZ3A 4POAA 2UVQA 2G0NA 3SJAA 1Q81D 3E1SA 4OYHA 1OW3B 4HLCA 2WKPA 4AG5A 4QGGA 4V0MA 1G9XA 4GP6A 3VO2A 1HURA 2V7QD 3ND9A 3PQCA 3SEAA 2DY1A 2XEXA 3UG6A 4DT1A 3MRSA 4DUGA 1DDIA 3SI7A 3ZIAD 2OK8A 4NH0A 4BRUA 4JVMA 2ODBA 2GCOA 2ZE8A 4A6PA 1TQDA 2ZSEA 4RY2A 1E9RA 2GXSA 3I1FA 2QRNA 1T8TA 2KSQA 2SHKA 3TH5A 4B74A 5JSZA 1VQ8B 2XZLA 2A30A 1IJEA 1W4CA 3B8HA 4WZBE 1AS3A 4LV8B 3S1AB 4IXNA 1W2BB 4ACAA 1GRRA 2BIFA 3PEVA 4C43A 3UWKA 1GVNB 3NH9A 2A5YB 4DCTA 2RGXA 3A1UA 2KWIA 4UXHA 1P9NA 4PZYA 3A58B 1FX0B 3EARA 3FKSA 5EP3A 5EE0A 1TUEA 2ZSBA 2V4ZA 2H8KA 1P3JA 3GJ6A 1P9RA 3RVBA 2PJZA 3W6NA 1CJTC 5IHPA 1CJKC 1DEKA 2W2TA 1ZW6A 2X8AA 3PR1A 3QPUA 1F2UB 3OIVA 1SKQA 3B78A 1P6XA 1EFHA 2OCYC 4U7DA 2JIZD 3ZVNA 1VQ9B 4KFTA 4ZIRB 1Q82D 1GAWA 5L3QB 2WKQA 2PZFA 2O0JA 3EZ9A 3GLGA 1E3MA 4MRVA 3GJ3A 1ZUIA 4P31A 1OXTA 3FPKA 1ZM4A 1E2FA 1N6KA 5BN3A 3ZZTA 4TN1A 3K9LA 2OE2A 2NGRA 2BVNA 1EP3B 2V9PA 1ZYUA 4EUNA 4O0MA 1TEXA 1VG8A 1OH8A 2A5FA 2YC4C 3SYKA 2V6JA 1NIJA 2OO7A 1ZD1A 3GLFA 2C9OA 1BJKA 4Z54A 3W5JA 4TT3A 3ADKA 1IBRA 2GXUA 2BV3A 4MRRA 2MMCA 2NG1A 1I4TD 4A0GA 4R7ZA 1W4BA 2BJWA 2ERYA 2GTPA 4TQUS 1OE0A 1O3YA 1LFDB 1P4SA 1OYWA 3PVSA 2BM1A 4JYCA 1NJID 1P2SA 5G3ZA 1KAGA 2CRVA 4Q1EA 4PC2A 4KO8A 4B6EA 1LV7A 1E9DA 5F9FA 4LYFA 3ZYCA 1G1MA 5JLJA 5KOYA 4KHZA 4YMVA 4FCVA 4DBLC 4B35A 1N6HA 1TEVA 1F2UA 2OV2A 4XTCS 1IAQA 4YXWD 1KO5A 4JL6A 5DGXA 2P5SA 4NDZA 2R6FA 1GDDA 1C9KA 2RC6A 4AC9A 4C0KA 2OSBA 2A9KA 3ZD7A 3QSYA 1A7JA 1G5RA 1MH1A 2QBYA 2ZI7A 1G17A 2ZVPX 1IM2A 1ONBA 2DPXA 4JLJA 4TQ9A 3W2GA 4BFWA 2IYLD 3AH8A 4XVQA 5KU1A 1E9BA 5DYGA 2WWHA 5H59A 4DLSA 1FQKA 5FL3A 3MWJA 2PCLA 3JQRA 2DETA 3K0AB 3H84A 4M9SA 3LVRE 4A8JC 4TLBA 2Q6TA 1CNEA 3O8DA 3LX8A 5HPYB 1GNPA 3AP3A 4JL5A 3ZVRA 1GM5A 2ZUCA 1KI8A 4DSUA 4PC7A 3TGPA 4LBVA 2QPTA 2FPLA 4KBFA 2WKRA 1KSHA 3HP1A 3M4YA 3ES9A 2WM9B 2JAQA 2I1VB 3EZ2A 1N6RA 2VLIA 3CKLA 4DCNA 1P62B 2QA5A 3AF1A 1IONA 1XWIA 1ZMXA 3OJWA 2BDTA 5CJPA 4BLOA 3PCRB 1XMJA 4D0LB 2WSSA 2ANBA 3K1JA 1FTSA 2VNJA 4M1YA 4LJ4A 721PA 3NWJA 3CNOA 3EIHA 2BWJA 1CF4A 4DSNA 2D06A 1N5LA 3JVUA 2RC5A 3EA5A 1G5PA 3QFCA 2J7KA 4MDEA 4NZYA 5HKKD 1XCGB 1K5GA 2RHMA 4CRWB 2VP4A 3CCEB 4CGZA 1HE1C 2ZS8A 3UKDA 4QL3A 1VIAA 1XTIA 2ZPTX 3E2IA 3MFYA 4PSKA 4DQKA 4XWOA 2QA4B 3QFRA 2EW1A 2W6IA 1VYTA 3OIYA 4F4CA 1E4YA 1ZU4A 2A7QA 2GXQA 1OFHA 1BMFA 1HUQA 1R0YA 2RGAA 2V54A 5LPNA 2I1QA 4N3NA 1R8SA 2KBEA 4Q9LA 1R5BA 4H9GA 3GJ8A 1XD2A 1UADA 4PPFA 4WVFA 2ORIA 2AK2A 5DI3A 2BMWA 1TVCA 4FWTA 5FPYA 2WSMA 4FINA 4YONB 1HEIA 1Z0KA 5HZHA 1DBSA 3H0KA 1NP6A 1AQYA 5GV8A 4IDQA 2W6JA 1Q22A 4HAVA 2F3RA 3EZ7A 3TIFA 1EFCA 1Z6XA 5FOXA 3REGA 3U7EB 4OKSA 4NYJR 2ZU0C 3OE7D 1QF9A 4URWR 4JLOA 1DS6A 1N2CE 2BEKA 4WW0A 3W8NA 1E9FA 4GZMA 5JS7A 4C2UA 1WB9A 1YZQA 2VEDA 4BFTA 1D8TA 2ZRKA 4BFXA 3A1WA 1GAJA 2FFQA 2P0EA 2RMKA 1MABB 4IW3B 4Q4HA 2ZSAA 1XTJA 4ILEA 5EJEA 1H8HA 2IXFA 1NVUQ 2B7BA 2GJSA 3K53A 1XEXB 2G1JA 1ZC3A 2WMOB 4X8LA 4TL9A 3TQCA 5C18A 3RANA 3I55B 2C8VA 3UWOA 1W35A 4YDSA 1HQYE 1N5IA 3MAAC 5JRJA 1AGPA 1CJVC 1IY1A 2ZYVX 3AF0A 3AB3A 3THWA 2WV9A 4JBWA 4P3YA 4Q03A 2GJKA 5FUXA 2DWOA 3HU2A 2FG5A 4D0NA 1Z06A 5EZ6B 3P27A 1ZP6A 3RS5A 3ICEA 3EIQA 2C78A 4DDUA 4Q4AB 4IFEA 2IYWA 5CB8A 4DB2A 1NN5A 4B44A 4M1KA 2LKDA 2DFNA 2ZRIA 1QVRA 4N3GA 1QFJA 1G3IA 4NU0A 5JJLA 2H1LA 1T8UA 5A0FA 2QT0A 1OH5A 2CHQA 4Q1CA 4XOIA 2QTZA 2CLDX 3FMIA 3KL4A 1DAFA 3PXGA 3SNHA 5L8VA 4E03A 4JLMA 1WBBA 1XJ0A 3CRRA 3EA0A 4PTLA 4CW7A 2O8CB 1LY1A 1YJNB 5EXPA 2OBLA 5L3RA 2O8EA 2IYUA 2OCPA 1J70A 2ZJ2A 3KXKA 1CQXA 4N0EA 4PANA 3DO6A 3LW8A 2ZREA 2VSFA 3GLGE 2DFKB 4OJKA 5DYIA 4Q4JA 3EPHA 1I4LD 2G1KA 5TV2A 1JALA 1NN0A 4MKGA 3CNNA 2FWRA 3BJIC 1OFUX 1T3HA 2Z6VA 1X8LA 1SVIA 1IXRC 2W0SA 5F9HA 3WBKA 4IDHA 1XD8A 3NEYA 4P4UA 1ZNYA 3TKLA 5DN6D 4OQFA 5FFMA 3GLHE 2JASA 4AYXA 4HEJA 1FQJA 1KJZA 1GNRA 4NBSA 1DOAA 3SBEA 3TVTA 3QE2A 2NO6A 1D5CA 3HU3A 3BH7A 4PSVA 3U7GA 2FH5B 2H16A 1J2JA 3KKOA 2NO1A 3FKQA 3PUXA 1NMXA 1IY0A 3H4MA 5KYKA 3I5XA 1Z22A 3WBJA 2CCKA 4ZCLA 1FW6A 1I4DD 2OK7A 1EFTA 2ORVA 4AF7A 1JQLB 1Q1ZA 1S4QA 1QUEA 1W4AA 4URUR 3CPJB 4Q48A 4U9UA 3CM0A 2RGEA 1OLOA 2X2FA 1E2MA 3I92A 4OHXA 2QL6A 2IL1A 5FOUA 2CHVA 1YR7A 4N1AA 1Z47A 4A36A 3VKWA 4M1MA 2W6ID 4LY6A 3TJZA 2OXRA 1S9DA 4ZIRA 3GLIE 4AI6A 1HV8A 2BMDA 1YZNA 3LQRA 4IFBA 1COWD 3T5GA 3A1VA 4A1FA 5H8WA 3IEVA 3ZS8A 1XD9A 1KO7A 2PEYA 1ZIPA 2PLFA 3DPUA 2A5JA 2F43A 1OFTA 3TQFA 1UPTA 3NVAA 4OQXA 1Z3IX 4A0FA 3IQXA 2Q3FA 3U7FB 2AXPA 1LTQA 2CMKA 5FPTA 5AWFC 2PJRA 5DLQC 1P9WA 2V6IA 3TAHA 1NY6A 1W5TA 4FCTA 3U3JA 2CVFA 4DSTA 5JFGA 2JLZA 3H86A 1FX0A 4RZXA 4OHWA 4TLCA 3A6PC 3GJ4A 521PA 3LNCA 3TRFA 3C5HA 3AF4A 4B34A 3CO5A 5FA6A 3KXIA 3RS4A 4E22A 1ZCAA 4C0AC 1VQ5B 2CLCX 4YAFA 3KTAA 1R0ZA 1R0WA 3CR7A 3EXAA 2JLXA 1QHNA 3OE7A 2Q0HA 3CPEA 1KI6B 2ZR7A 3K70B 1UBGA 2WWFA 3FFBA 1I2DA 5FH9A 4FMCF 3NDBB 1H8HD 2JGNA 1TF7A 3WNDA 2P67A 5DI3B 5EE1A 2EFCB 4AKEA 4BLQA 4WZ6A 4ZDIA 1Q1EA 2F1JA 1BO6A 1OIXA 1GKUB 1KI4A 3U6KA 1ZINA 4G0NA 3LA6A 3CF6R 4OI1A 3W8RA 4TZ6A 4HDQB 1F20A 2QAGA 4P33A 3BD9A 2EFDB 5HTKA 2GZHA 3A37A 3QFSA 5AJVB 2HEIA 4MKHA 2J45A 5AUQA 2C9CA 1QVGB 3IIJA 5LBIA 2WWWA 3BS4A 4NYJQ 3DKVA 2ZRPA 5AJYA 4DXAA 1A8PA 1F3OA 5E7MA 3D31A 4DLUA 1S96A 2FSFA 421PA 3EPLA 1E2HA 1NKTA 1L7VC 4GBMA 2FZLA 4Z51A 1AZTA 2GJ8A 1VCNA 1YZUA 4L4UA 3PUWA 3RS3A 2IYZA 1R10A 1N25A 4Y7CA 1E1QD 1G3UA 4D2IA 3BBPA 4YAUA 1KY3A 3AVYA 1II8B 3ZJYA 4W9MC
chains in the Genus database with same CATH superfamily
3OY2A 5CUQA 3Q7EA 1T6NA 1M2WA 1UCFA 1FTQA 1MKYA 1K08A 4IIJB 1KFKB 3LUAA 1I24A 1QK3A 1AK2A 3P0FA 3MILA 3RBZA 1R0SA 3SSAA 2HV8A 3TE7A 5HIKA 3U19A 4CTMA 3HRKA 4DIKA 4YMHA 3F90A 3DMTC 4II3A 1ZGCA 3RIEA 2J59A 3NYRA 1Q0LA 1P45A 3HJRA 1KWKA 1IXZA 4TRNA 5IT5A 4PGGA 1VJ1A 2CLIB 1ENOA 2AQKA 3IXMA 1G21A 1L6RA 2FU5C 1XTRA 3CRW1 4L78A 3AXSA 3TW6A 4YMSA 3V1UA 2I80A 5GJVC 2XYGA 1Z0FA 3ASZA 4UCXA 3MHPA 3H6KA 3S4YA 3DLHA 3A4TA 2ON6A 3I39X 3N0XA 4TZTA 1RADA 3K0SA 1JBEA 2NO4A 1YASA 1MAVA 1VGQA 2DUJA 4X7DA 3NTUA 1AKQA 1V9CA 3OTOB 4JXKA 2GNPA 2GRAA 1SU6A 1TT5B 5EA2A 5KVCA 1ZQ9A 1JIJA 4HNAB 5DRTA 3QTTA 4XYGA 5LDDC 5LN1A 4NEGA 1X7HA 2JJ2D 5CYPA 3QE0A 5JDIA 1EEXB 4YRQA 2O7SA 1D03A 2YZMA 1TQ6A 4D99A 1QO0D 4XRGA 1MDBA 5T64A 4A8JB 4EEXA 3OX2A 5A7FA 1A2OA 2ZTNA 4XKWA 1M9NA 2CZGA 3HXOA 4HXYA 2GPSA 3PDIA 4CWAA 5HX7A 5KOHB 3OWHA 4N49A 3OJOA 3EVCA 2XI4A 4MUGA 4B4OA 5SYNA 1NF2A 1U28C 5CXSA 3CCVB 3HBJA 3AFGA 1LVUA 1M7GA 3I5UA 3IBGA 5C8VA 4I55F 5JYBA 3N2IA 5KWJA 1K6MA 1V8FA 2VWHA 4UHFA 3IS3A 1TO2E 4EKIA 4DUPA 1YL5A 1SAYA 3LUKA 1JR2A 2J4DA 1JYFA 3GNQA 3KQVA 2Y1FA 4N3AA 5JBQA 5D3QA 5A03A 1NPTO 1N3LA 2IU4A 1YB5A 1BFDA 2FZEA 5CDFE 5HQ3A 1Z0ZA 3B1XA 4HWOA 3ZKWA 1S8FA 2CMDA 1TGVA 3QVLA 4B2YA 1ZJ5A 2AUTA 5ARDA 3TAXA 3CB4A 4DADA 1QO7A 4IAOA 1F9EA 1KAEA 5ALNA 3FZEA 1XYGA 3QA3E 2GAOA 2KM1A 2QPLA 3AQIA 1EQUA 4JBXA 2CYAA 4TMKA 5ICEA 3G0HA 4M1TA 3BGDA 5F1OA 2QR2A 1DZIA 3H9GA 3LD9A 3TQSA 4J6FA 1OB5A 1PZHA 3CWQA 1YGYA 2Q62A 3GT4A 4YRMA 1AQIA 1BHJA 3FWZA 3QPVA 2WPDD 3OCJA 4ISCA 5AK4A 1PJRA 3EWAA 4BZWA 5A62A 1B8PA 1WMEA 1BKYA 3OEWA 1MO2A 1VI2A 4GI2A 4HAUA 3VX4A 3OEYA 1X3LA 1PJ4A 1I7SB 1O87A 2QVLA 4X7BA 2RGNC 4D44A 2FVYA 3ZGZA 2B5WA 2H4JA 1OFIA 3CUSA 4EBFA 1QHGA 3TQIA 4I8IA 3L0OA 4RA6B 2QD5A 2CMFA 5AQEA 3SZ3A 4D26A 4FYHA 2A4KA 2GI4A 1YR6A 3A0UA 3VAZA 4BNLA 1UBFA 1UMCA 4E5PA 1SD5A 3DVAA 2X5OA 3LXMA 4INPA 5FNVA 4P6VF 2IS6A 3WNZA 3TCKA 2W2LA 1KK3A 1XJQA 2I6SA 5CBKA 1QSGA 2C8JA 2ZYAA 3D0QA 3L40A 3NT2A 4FGWA 221PA 2GREA 1BS9A 1K98A 3LA8A 3LOQA 1HQCA 1D7AA 2PYDA 3A6GA 1CP3A 3DOIA 1OAOC 1UC8A 3A14A 3P5BA 5I8ZA 3RRYA 1NXPA 3OFNA 1QTNA 3H18A 4XIGS 2DR3A 1T4MA 3T7EA 1JHVA 3A9UA 1ADGA 3MOGA 4OHFA 3ESXA 1T1EA 1VDZA 4OJTA 2NXNA 3BFPA 1RFGE 1W47A 5WRFA 4EJ0A 4UTNA 2B7LA 1Z0AA 1E79A 3F6YA 3CBGA 3JWPA 4TN5A 5EJGA 5CFRA 1D5WA 3E22A 1TCCA 4HEA1 1Y3IA 1GCGA 3IUJA 4FE7A 2IUYA 4IOMA 3NB0A 3JZMA 4AW9A 3DFKA 3E7XA 1BEZA 3RSFA 2W00A 1YQQA 3FBTA 4J7AA 3R6GA 4R31A 1EWVA 4FZ3A 1I51A 4OU4A 5AVKA 3WLSA 4UBLA 1O96B 4UAUA 1H2BA 5AI6A 3UJ9A 2J5RA 5MN4A 4DYDA 3CMAB 4WNCA 2ARKA 4P3KA 4C4ZA 1QF7A 2NZ8A 4OPMA 5J4LA 3TR0A 2AOUB 2OEPA 3AUSA 3W5HA 3B6EA 2XWSA 3HJHA 1IH8A 3ODGA 1XRMA 4GGPA 4GD3Q 3BCDA 1XMSA 2O2DA 3B52X 4HGRA 2VQ3A 4R3UC 3TRIA 2QW1A 4IDCA 5BUSA 2HZBA 2PA0A 2Q6VA 4UBMA 4HDKB 2PS0A 3VU3A 1F0YA 1MC5A 3SQWA 1A98A 2OAGA 2SCUA 2Z57A 3UKOA 4AQDA 1ONSA 1R64A 3K4HA 3N70A 3O9ZA 4MEJA 5JNVA 3EE6A 3N3BC 5IC6A 5KIAA 3CYFA 4PONA 2VNHA 1OX6A 4QE3A 2E5FA 3KDSE 1MRSA 1HE4A 4DQ0A 3A6ZA 2P0AA 2JKZA 5IBRA 4E1VA 4X91A 3ZZ1A 1L4NA 4FMDB 1XZNA 4YMLA 1U2GA 2HQSA 1OJLA 4AJHA 5LXTB 2V0CA 3IKJA 2M6RA 3OQJA 5KOIA 2VPWA 4EYOA 2IXGA 3LOUA 2BHRA 4AY2A 2J0UB 2YHSA 5KVQA 1ANKA 3PRJA 1IAVA 5L7WA 1XU4A 3S27A 1UFQA 1F2TA 1JSZA 2EJBA 1IMOA 4XQFA 4HZUB 3EEIA 1INLA 3R9KA 4OIMA 3JQBC 1XDUA 3B1JA 4MIKA 5EWJB 3D5TA 3KJQA 5AVRA 3K9QO 3EVBA 2WWIA 1CUYA 3WYNA 2BEVB 3PPVA 5BWMA 3CJRA 3WNQA 3FNBA 1GZ4A 1P5HA 4PSCA 5G3YA 3O93A 2FFJA 3RUEA 1MA0A 4WK4B 1N78A 4F72A 4MDYA 3W2HA 2PAFA 3H4TA 1Z0DA 1EHYA 3HVIA 4Y6OA 5AH0A 2ZUBA 3CJQA 4W82A 4Y2XA 1BSVA 3CX7A 1Y1LA 4LN1A 4EA8A 5IBCA 2DU8A 2FEOA 2IHKA 2IW3A 2DFTA 1Q84A 3PC6A 4MPPA 5DP1A 3V7AA 4J29A 4D46A 1A2QA 3FYHA 2VF8A 3OCXA 2IITA 1ZBQA 2J46A 5IUNC 1DG3A 3WI7A 5C7OO 5JZVA 2P4HX 2QGZA 1MEEA 1RWQA 3G9QA 4RSRA 5FYQA 2EIHA 4GSLA 4ED9A 1YWGO 3PFIA 2Y66A 3SBDA 3WOVA 4IIBA 5I48A 2HFKA 1A9YA 2EWWA 1I9CA 3ITDA 2YRXA 3OCCA 3S2YA 4EVSA 3G5UA 2VTBA 3W5IA 5A5VA 3WYDA 2X23A 3HLYA 1MO6A 2O5VA 3B7PA 4L50A 1A8SA 2AXEA 2JCXA 2OB1A 4FN5A 4KDFA 1S2OA 1VLLA 4XFJA 4A82A 5IXYA 3BC1A 4AF8A 3BC9A 1DFHA 3MSXA 4FJ0A 4MR8B 1ZSYA 5DTIA 4HE5A 3KKZA 2FW1A 4EYKA 5KTNA 3IPYA 5DWQA 2RHOA 2NTJA 4G2TA 4O33A 2Z1MA 3X1KA 2WJVA 3EVEA 3NYIA 1R12A 3SBOA 3CCMB 8AT1A 1WO8A 4HR7A 1KFEB 1G9SA 1JHQA 1I10A 3DMHA 3O1JC 4Q5IA 4ZA2A 1R4NA 3SHTA 3ZZMA 5ITZA 1A8HA 1CYDA 4RZUA 2Z2KA 3GF4A 4WLFA 4DBVO 1E2EA 1N1EA 1OKKD 3ED1A 3PDHA 4LI0A 4RHTA 1R5OA 1UQTA 3A3PA 4WNAA 5T4BA 3RTDA 4KQHA 2YXPX 2Q1TA 1O97D 1SHZA 2N75A 3Q3VA 1RCUA 5F77A 1FJXA 4P2NA 1EKXA 4MGKR 2H4HA 1NJ5A 2CFSA 4JAVC 1BG6A 1ZL2A 3G0IA 4JLSA 4M0MA 2XTZA 1QFMA 4OP3A 5DHAA 5F5XA 1KBQA 4KFSA 3KKQA 3BORA 3BOSA 4B4KA 3R0XA 5J2UA 3D3NA 5TQJA 5C8ZA 2WYVA 2A86A 5EHXA 2Q1YA 5TS3A 2W0MA 3IHWA 1QIJA 4D9FA 2QM3A 3OZUA 5IF9A 1NZFA 2MSEB 2OVFA 1X2EA 1MO5A 4PN3A 2QN6A 3H2JA 3EGEA 5IT0A 3G1WA 4JLAA 3G71B 1JUDA 3MELA 3OPYI 5AYVA 2VS1A 3OAAA 2HTFA 4EB6A 4N0DA 5L46A 3BM5A 5IDYA 3H9NA 1EM8B 1YJBA 2Y8EA 3DA8A 3LDAA 3HXLA 4BQNA 4LJAA 4Y1FA 5JEEA 4N40A 2NZXA 2XNDA 2FRDC 2QVXX 3JRNA 5CIWA 4KAXA 1O5IA 1OGJA 1NM5A 2J9FB 1ZN8A 4DG9A 2O8FA 1X8JA 1GGMA 3HY3A 5LD2B 4AKHA 4RM3A 2Z43A 5CB6A 4F3RA 3T3MB 3ADOA 3MTGA 4IGIA 4QUGA 5HBRA 5JTUA 3JASA 1AZLA 4J43A 3BRWA 1EDDA 1R9GA 1UJCA 4FFOA 5EVCA 4DQUA 3NUZA 1A27A 1YH3A 1ADCA 1YRYE 2PXAA 4A8PA 3C8DA 1DC7A 2A0WA 4G5FA 1GFWA 1D2AA 2ACWA 4YQFA 4XR9A 2MINB 1JHPA 3SEFA 5I9IA 1U2ZA 1CRPA 3PIDA 2A0KA 2XCLA 3FVQA 1RLMA 5A1TA 3RUFA 3C8MA 1POWA 3F9CA 4ETIA 1Z6GA 1LW7A 2DTXA 1ZMTA 2J09A 2V31A 2AR9A 1N32B 1CUSA 1A0OA 1TA0A 3CX8A 1DAPA 1HK7A 2VNIA 4PXYA 5PGMA 1WU8A 1SFRA 1V26A 1HQKA 3G8BA 1QJCA 4EJ6A 5EIOA 2D3TA 3G0OA 3K1YA 1CJUC 1KAMA 5KPJA 2BMFA 4P32A 4ZHQF 5JROA 2YHIB 5E9WA 1ZKDA 8ADHA 3CPWB 3W4JA 5IWCA 2LPMA 2AC7A 2WTNA 2GPJA 4KXYA 3ICWA 3ASYA 1UUFA 3K9CA 3J7TA 3WY9A 2WKSA 3ORYA 2HA2A 3SD7A 3RRMA 2DB3A 3DAHA 2P9FA 4BJ6A 1LSUA 1P60A 1PYOA 2GVZC 3UJ7A 5JZOA 5C1IA 1YHZA 1O6BA 1ZXLA 4I81A 1Z7BA 2ONKA 1QWOA 4IGAA 2ZRNA 4CCAA 3RRFA 1DC3A 1MTZA 3NHBA 3D7RA 1ZD2P 4G89A 4QXPA 4XJVA 4IKEA 4Z0NA 4EGCB 1YXMA 4YT8A 1Y4ZA 1WZNA 1J5PA 3FCEA 3EVGA 1YITB 4J76A 5DK4A 4EECA 1TM2A 3U60B 1FMJA 4FHCA 4Z0PA 3T3EA 1R2QA 4DEVA 5B7GA 4DMHA 2X9NA 1EBUA 3HWRA 1XP8A 3W3AD 2A9JA 1AGYA 2JK1A 4GF5A 4LJ9A 4B17A 4LOAA 5HMMA 3ZVLA 2EJVA 3DEYX 4J90A 4C29A 3AFIA 2BZ0A 3PGXA 2A88A 1ORDA 3ORRA 5EIAA 2BDUA 1KY2A 4EPWA 1W30A 3P26A 1I5RA 1U0FA 5ENZA 4J3NA 2BGGA 1NL3A 4FCCA 4RPHA 3E1GA 2AYYA 4AS2A 3ABRB 4QU0A 4JQZA 4PSUA 3IMEA 4EARA 3O9VA 2RGGA 2I8LA 3QV1A 3VKVA 2PX2A 4HDCA 3A6HA 4LF8B 4QQ8A 4P4TA 1C50A 1IU9A 1VP9A 3ZPNA 4DY6A 1E62A 2JL1A 3LBIA 3RS0A 4BNYA 5BWNA 2FVGA 2P6NA 3KVRA 4Y9TA 5AESA 1N2SA 1PO7A 2WUFA 4TYQA 3R24A 2VH2A 3H4IA 1KD1D 3AFNA 3WIUA 4NJEA 3UT6A 1XFOA 3PEYA 1EIWA 2W2KB 4R0MA 3BRSA 5SZKB 1YK1A 2FJUA 2J7PA 2AG1A 3DHVA 5B53A 1Z7WA 4YPOA 2OP0A 3U81A 2P2ZA 1DT5A 1A9XB 2HADA 1M6VB 5MGNA 1R00A 3ZGYA 3CW9A 3VDXA 4DTIA 1K68A 1PJLA 5ILQA 3FN4A 4YAWA 4WNIA 3QVVA 4KMRA 4P5EA 4CMGA 1KYVA 2OUIA 4BNZA 1HYGA 4DIOA 5A0VA 5EQFA 2UXDB 4WV3A 1IWOA 3IJ5A 3AP2A 5CVCA 1DIAA 4HQRA 2H5LA 1EK2A 2P9ZA 4MKXA 3B1ZA 4DSOA 1NN3A 4BO9A 1MOPA 5F2EA 1M76A 2G28A 1X8XA 2VO1A 2PSHA 3DQPA 2E1PA 3E5MA 3GBSA 4S35A 3TOVA 3VO8A 2HF8A 2OZVA 3NDRA 4CFYA 4LHWA 4QJ4A 3I6BA 4KPUA 2O14A 2NU8A 4KQKA 3W77A 2ZZNA 1FFEA 2EJUA 3IMFA 4YAKA 2ZE6A 4IHJF 2RG7A 2R79A 2MIIA 3UJAA 2PKEA 2AD5A 3S3TA 4ND6A 1ITZA 1M66A 3HVRA 3I0ZA 1IUPA 1F2DA 1ZGHA 3UTDA 1P0QA 2ZXFA 4EB3A 2OSVA 4KR3A 2FSHA 1PS9A 4QODA 4C07A 1SG6A 1AU9A 1J9EA 1WCV1 2V1XA 1E69A 1Z2PX 2JGIA 2EEZA 2OBMA 4W6QA 4ZO7A 2OXEA 2VF7A 1U7HA 1JIXA 3MXOA 4Z2YA 4BKRA 3E7PA 5IJ9A 1T0HB 4BQSA 3H7IA 1UDXA 4YI5A 3UAOA 4BWFB 4QDTA 1PLKA 2RBKA 1NOJA 2XUIA 3I4LA 1ZJWA 2OAP1 5FFFA 2ZVDA 1K27A 3FUCA 4RFLA 2I4TA 4ARUA 1SCNE 2GR9A 4U00A 1QX4A 1M6VA 2D9RA 1TB4A 1L3BA 4B7AA 1WZ2A 3PA1A 2A9RA 2FN3A 4XQCA 4D4MA 1QF6A 2CF5A 1KMHA 1FJHA 2XCUA 4JKOA 3RC9A 4C89A 4UM9B 4P08A 1P80A 1YBVA 2P9BA 3OOYA 3R0JA 1TVKB 4NPCA 3L6BA 5HJEA 4OI0A 3HCFA 5TEWA 3SVLA 1FQWA 1C4XA 2ATEA 2RHRA 4JT8A 1HDEA 3ADBA 1MUUA 5BR7A 4KV7A 3PHGA 4PS1A 4K03A 1O03A 2G06A 1Z37A 1DQSA 2HU5A 5ECGC 1EDEA 4H1HA 2CZQA 3TXAA 2BSQA 1FSGA 1DEOA 1M1KD 3V2IA 1V3TA 2PUAA 3W04A 2R6ZA 3X1DA 1WY5A 3EB9A 3PICA 3AQ4A 1J6UA 3E23A 4KDEA 3R7LA 2QWXA 2RGNA 4NK4A 4DVJA 1PR3A 3DMGA 1HDGO 2HDOA 1ZD5A 3R7BA 4D45A 5IT9A 2QK4A 3K0FA 4NPHA 2BCJQ 1ZOSA 5C0OE 1KQFA 3CH5A 2PH1A 3JVVA 1Y7TA 2WILA 2PQ0A 3KQOA 5JI2E 3F5SA 1GAQA 4D25A 2P30A 3SSNA 4CM3A 2EFHB 2O7RA 5GZ1A 4TMXA 4QO8A 1DXQA 1ATIA 2V7QA 4YRGA 1Z5PA 2C4KA 2Y2UA 3Q3GE 4RGYA 1ADBA 3MWKA 4E21A 5KEIA 2W7TA 1LKZA 1OLSA 4DHWA 2XCSB 2H1CA 5DASA 3DDSA 1OB0A 1CZKA 2VK8A 2ORYA 3FG9A 3BZBA 1MJHA 2PH7A 3V32A 1B76A 1CK4A 1MFPA 1RYEA 3MF4A 4U3JB 2CV0A 1XZFA 2YVAA 2HRRA 4BTVA 3I0MA 4QHTA 2ZQ5A 5LBTA 1OILA 1TTPB 2P1RA 2FW6A 3SX0A 1I4OA 2J3LA 3R40A 4JC4A 4M38A 3RY8A 1A9RA 4R54A 4HZIA 1NU8A 2FGKA 2G1UA 4O2LA 4B31A 5H3CA 4FEYA 5JNRA 3ZE0B 4GXRA 4JK3A 1SC9A 1TK3A 4HPXB 1CIPA 2VSNA 2VQSA 2C31A 2PS3A 4PYNA 3UC9A 2JLVA 1YB1A 2WJHA 3L0PA 1QYXA 1NP7A 5KKAA 1FK8A 4M7OA 4BP8A 3CW8X 5DT2A 3I2JA 3RU2A 3R41A 1FJGB 4MIEA 4QJ5A 5SY9A 3BWCA 3Q1LA 4C3UA 3BQ9A 1E1LA 2DFLA 4IXDA 3ZCXA 1V43A 2YVUA 1FDIA 1W581 3G17A 4KIJA 1QOPB 5AN9A 1MOZA 4BMDA 4D82A 3AZQA 5AKJA 1QYDA 2XUKA 4FGJA 4N0QA 3SK0A 1TF5A 2ONYA 1M10A 2UUPA 2I1LA 4N12A 3VX3A 1JBKA 5I3ZA 4KMOA 2ZJ6A 2PE3A 4BNNA 2NO0A 2ZWVA 3A2NA 3GVXA 2VT3A 4RZHA 4CL2A 1KO8A 3HJCA 2P41A 1XRQA 3JU4A 3O7MA 4JELA 3I30X 2Y1KA 3BJEA 4HADA 4K6MA 1VQ7B 1OTXA 3UJPA 4CI0B 3IOCA 4H15A 2CLEB 2EF1A 2PUVA 2XSZA 5L95A 3WHPA 1GGFA 3VU9A 3WLMA 3AX6A 5LQUA 1IPHA 1MBZA 3HZRA 1II9A 1XTSA 2YXEA 4KQIA 5ALEA 5EQTA 4C01A 4EPTA 3R5HA 3F7MA 2HGSA 2O8FB 3HYTA 4MQBA 4MV6A 2B3TA 1UKAA 3FR8A 5TQ2B 3VI3B 4XWAA 4EKGA 2PGNA 1M7BA 3QEKA 1M67A 1YKSA 1A5AB 2I3AA 3EISA 5CH5A 4YYEA 2JVKA 3K3PA 2R6CA 4P6YA 3A9WA 4FKZA 3RSZA 3VC2A 5JCJD 3LTNC 2JLYA 4KACA 2G70A 2X8JA 3O3MB 3WXBA 1TMGE 3GY0A 1E3XA 4IG4A 3V1LA 4V2IA 4YT4A 3IEKA 2LV8A 2HN9A 3ANNA 2OORC 5INTA 1EVZA 2GD6A 4RABA 5LFAA 3FPJA 3AHEA 1CHDA 4C0QC 1ZIYA 2QTGA 4IDNA 4JVLA 3A35A 5JAHA 1HG1A 5EJ4A 3ZV5A 1IN6A 3QUSA 3AEKA 1F4VA 1JHAA 3WTCA 4I36A 1ODJA 5JW6A 4FXOA 3MRVA 3IKLA 2DBYA 1GV0A 3LM8A 1RRKA 4X7CA 4KQ9A 4D0SA 4NX2A 5IC5A 3VPCA 2YNMA 4C78A 4ECAA 1PSWA 3TM5A 4PZLA 3GP3A 5B2ZA 1XK7A 3FYSA 3DTVA 2XZOA 5GJCA 2AW3A 4JBYA 1OU0A 1GQ2A 3I9KA 3HZZA 3EQ2A 4MYHA 3GRAA 3QOYA 3WLOA 4C04A 2WAMA 5ALQA 1DQYA 4OJQA 1AN9A 3WGLA 5TS2A 1W0JA 3TJRA 1D1NA 1E2KA 3DE0X 3E7FA 2BFMA 3P96A 4KTTE 2Y4OA 3VGPA 2E4ZA 2JHFA 2W70A 2GASA 5DBOA 3V2HA 4GNKA 4O59O 2XKKA 5F4JA 3O4GA 3WZLA 1QB8A 1OZHA 1X14A 4DUZB 3KHSA 4NARA 4YAEA 4JU8A 5IDWA 1T9DA 4ZVMA 4G0WA 2FQYA 5K0EA 3HJFA 4REOA 1NBEA 3FBGA 2A0YA 2QZZA 1ZDMA 3IUEA 1U98A 1ZW1A 3V4OA 5L6LB 1BEUB 2LBPA 2BGIA 2JGEA 1EE9A 4ZOEA 4J75A 2ZB4A 3A9TA 3O83A 5KAPA 5BYJA 4FGLA 1NNI1 2PO5A 4U02A 1RM5A 4F21A 1Y63A 3P0EA 4G36A 4UMDA 1SXGA 3AB7A 1PQUA 1DWPA 4F2GA 4NBNA 3ZDZB 1OXKB 1X80B 5HUQA 1FDUA 3EBPA 1QR6A 4FEEA 4MKFA 4YWHA 4ME6A 1CV2A 1DV2A 1WOYA 4W5HA 2IYSA 1YI1A 2DJ5A 3GDGA 1WMAA 3M5WA 3P9KA 2OGZA 1Q0UA 4FT2A 2IPOA 1K6EA 2ID9A 2X4LA 3BXHA 3NANA 1QPGA 4MW2A 2O8NA 4MGYR 1DAEA 3DE7X 5T4HA 2EKLA 3LYHA 2GDJA 4OQ4A 3F6BX 3W2FA 2HXSA 5KYXA 2XXAA 4ADSG 4RH0A 1M1YE 4HMQA 4HTFA 1NKSA 3PA2A 3IXLA 3L41A 4OHVA 4ZQCB 5KWIA 1CXZA 3ETLA 3D64A 1ACMA 4HB0A 1JA0A 4RX1A 5F4MA 1ETHA 4HZUA 4EG8A 4K5QA 3I62A 2ZK7A 1G6OA 5GV7A 2WF6A 1KJNA 1M75A 3F5MA 4H7DA 4YRDA 2GB4A 5AKKA 1IPFA 1BRMA 2QQFA 4AJNA 4EMUA 2LKCA 3TLXA 4MV5A 1EHIA 1G8YA 2FY8A 4IDGA 1NDHA 4FS8A 3MJEA 3KC2A 4OBBA 1YIDA 1J21A 2VJAA 4KRFA 1G4AE 1Z63A 2AFHE 4FXPA 1EJBA 1VFNA 2Q5IA 3KKNA 2QM7A 2CYCA 2ILVA 5DW3A 3JQGA 2Q5OA 3M3PA 2GNOA 4X8OA 1UJ6A 1KETA 3CQ9A 3ODPA 4I6JA 2ZYRA 2Q49A 3PG5A 2SCUB 3QMMA 3TZLA 4DIUA 4EUHA 2VPPA 1NONA 3VHXA 3SNKA 5H5JA 4ID3A 2BRUC 1HE3A 1WD5A 2EW8A 1Z0UA 4WT7A 4I14A 2PXXA 4M22A 1OFUA 3PFWO 5EY5B 1NRJB 1SKAA 2ZRJA 5F4ZA 3ZHVA 1E9SA 4LPSA 4JIMA 2ZZKA 3FZNA 3PXXA 1IIBA 1UD6A 2GM4A 3VR1A 2AEEA 4UAJA 1U7UA 3U0VA 4YRAA 4D57A 1AKWA 1VOTA 3PZBA 1LXCA 3C6MA 1R8JA 1USWA 3BE5A 2R6DA 3CH6A 4O8ZA 1B7GO 4YJ3F 4ZV9A 2IP1A 3SYTA 4X90A 1NQXA 1XNGA 2NTNA 2WIFA 2ZB2A 4Y0VA 3U7JA 4A8TA 3UOWA 2HBYA 2W4MA 2QTHA 1XQ9A 3LRXA 4KIFA 4J4TA 4WKCA 3U1VA 4H27A 2KX7A 5LA6A 2EBUA 2PQ2A 2E1BA 1JB9A 4Q7MB 2GEJA 1K8ZB 1TKRA 3WICA 4QNRA 4ZKDA 4BLPA 2XZTA 1W2GA 1WHSA 3ONVA 1VZ2A 4R7TA 4D81A 4YLYA 2EP8A 3CC8A 3T0FA 4X93A 3WK8A 1NW3A 3JRXA 2JFZA 2VYFA 1ORIA 2IDZA 3U9SA 4L16A 2JI7A 3AI7A 3N2GB 3RS2A 5E9QA 3DAOA 5JMOA 2DY0A 2ILTA 3VYWA 4YO7A 4G5OA 3ZCVA 5HQTA 1VHQA 3UPDA 2XIJA 4PZDA 1PIWA 5AIAA 3PHCA 5ALSA 3K1TA 3DQQA 3TPZA 4XGKA 4F0JA 3GRZA 2WNHA 2E4UA 1LK7A 3MGKA 3ONDA 4NDNE 3F1KA 4NZZA 2HMYB 4G65A 3GGJA 1RJFA 2P0YA 5C3MA 1ESZA 4P1ZA 2VRWA 5LUAA 2XWPA 3LDFA 3M1LA 1UXHA 4RFSA 2YJ5A 3KETA 3SYMA 1ETUA 2ETVA 1H5NA 2VP0A 1WOPA 1K89A 5AW4A 3PD1A 3ZE8A 1NA5A 1ZGZA 4YJGA 1X74A 4Y2JA 2AUNA 4OBWA 3PJFA 4N18A 5JVDF 2WU1A 5D51S 1SN7A 4PYQA 2OUKA 3PXAA 2PUHA 3QVJA 2FV8A 3DT6A 3IEXA 3OW2B 1W5FA 3KB6A 4OHKA 3U7IA 4Z4QA 1YUBA 2AV6A 4LCBA 4LF6B 1C0PA 3UANA 3RJ9A 5E6RB 1PBNA 2FKAA 1Z3CA 4WXEA 2XMBA 4G2NA 2R3SA 3UATA 4IY1A 5HZKA 3IKMB 1Z5UA 2B8TA 4UM9D 4JR2A 3HDHA 2AQIA 3THWB 1G8PA 3B2EA 4CF7A 1B1AA 1P0CA 3QIVA 3W4KA 1JKXA 1E3LA 1K3UB 4QXAA 3ZBUA 3KOWA 4ONEA 3M6MD 1HT2E 2GK7A 4Z4IA 1SVWA 2ZSFA 2JDID 3FETA 2NN3C 2XMDA 5JTTA 3IQWA 1JP7A 5LDGA 4RSGA 4P0PB 1NSTA 1IL0A 1I0LA 1BGXT 3K8ZA 1I4EB 2PA3A 2RGDA 3EODA 2DLNA 1JI0A 3VOAA 5IJAA 2HU2A 3U56A 2HM7A 1Y1RA 1GOTA 2AJ8A 2Z9BA 3R4VA 3QNUA 4H35A 1PJ8A 5DHSA 1DO8A 4YBZA 1E64A 5GIPE 4UOQA 1WVMA 5IBQA 1TNDA 2B21A 1OSNA 1W1UA 4X05A 2JGDA 3D54D 3V4VB 1NTOA 1WP6A 4WE3A 2JEZA 3ASVA 2EG9A 3I9MA 3MEQA 5JBNA 1Q0HA 1ZI8A 2QTNA 3M3HA 4G07A 4KXUA 2LTAA 5HFNA 2QMYA 3BA6A 1SUWA 3JZAA 3SHFA 4Q7KA 3CY6A 4QNNA 1YB6A 1E2PA 3HKDB 3LFUA 3ESQA 1LPBB 4J0KA 1NPDA 1RFLA 1XHEA 3Q88A 3QLJA 2DF8A 1KJWA 3IQGX 2HXYA 4IX1A 1ECBA 4MINA 4MPDA 4NBRA 5AJXA 1VJRA 1U3GA 1VGRA 1ZAKA 2W2LD 3C1TA 1OLUB 3QW4B 1U0LA 3QBTA 4I4TB 4NIMA 4JQOA 5LKAA 5T7BA 1Y4UA 5DZSA 3FMGA 1A8UA 5DPMA 1IBSA 3UCEA 3WTBA 5JC8A 2YINC 3D3KA 4ZYXA 2HA5A 1E92A 1R5NA 1Y9DA 4XVRA 2B4TO 2P4QA 3AZPA 3N8HA 4YJKA 3UUWA 1QHYA 3B2NA 4MJ7A 1WBDA 1RYBA 4Q3OA 1P4AA 3T1VA 2ECQA 2H06A 4MWOA 1YS4A 4TMVA 3FA2A 1BCSB 1EDZA 3FPHA 4FHFA 4C6TA 3A3GA 3CH7A 2RAPA 4BTLA 3CPXA 1W85B 3T4PA 1QH9A 3HE3A 5JNUA 1KI2A 2IVZA 1FDVA 1M2EA 1OCEA 2OY0A 1B2RA 1J8QA 2QQ0A 3W9SA 4F6CA 3C7KA 4YELA 4WDRA 2OKCA 1BC5A 2RHTA 1C29B 1GUZA 3BFJA 1NVFA 3IOEA 4JOBA 4M1EA 3T1OA 2O7VA 1JDNA 1YZKA 4Y0NA 4OB7A 2G9RA 2H7VA 3QWAA 4E70A 1A9TA 1IOZA 4KLNA 1F12A 3HB0A 4HGNA 5EPOA 2ATXA 4CM4B 4F56A 4QM6A 5T3UA 4XH9B 5FUBA 3RF7A 1KARA 1FLNA 4LHZA 1Z0JA 4UTXA 5F2NA 3LCJA 1NVWQ 2BR4A 1XZQA 1IRIA 2N42A 2ABWA 3VR6A 1N0WA 1W5BA 3JU3A 3NC1C 1J8MF 4YQEA 4EAAA 5HXBA 4FMCB 2BFWA 4XN0A 2XHEA 3BCRA 3WGYA 5B3JC 1U7DA 3IA2A 1UWLA 1BH2A 1R18A 3B3FA 1VI5A 2XKJE 1GG9A 5JS8A 4WFQA 1GG2A 1GPKA 3PC8A 1MN6A 3A04A 4O3MA 5GONB 1FP2A 4KE6A 5FOTA 2O8DB 2K2WA 2WAYA 1JVNA 2Q2NA 3C45A 1HNNA 3CEHA 3KZNA 3MJDA 3OUTA 4NEHB 1J9ZA 2ERCA 2ACVA 3WHIA 1B23P 1FA9A 1CE8A 1XD2B 1Y6RA 2GD0A 2BHLA 2OCIA 3LIPA 4MUYA 2KYRA 4KI0A 2FMUA 3EASA 5BQOA 3U7HB 4MUFA 4W4TA 4ZOCA 1DJMA 3GLKA 4XJTA 3EZFA 1D2EA 3IDQA 4HB2A 2GF2A 4PX9A 1ZCZA 4BB5A 3GSIA 2AWNA 2YUTA 1T6XA 2EKBA 1QLJA 4LHXA 3ZTWA 4BAUA 4NCIA 2Z4RA 4W8OA 3F47A 4I5IA 2AXNA 4IJMA 5AOVA 5AVOA 3VV3A 3LXUX 5BR1A 3WL8A 1D1QA 2JVJA 3U09A 4YCJA 2P4SA 3UCFA 1OZFA 1G291 3PI6A 1LSSA 1UD3A 3BD8A 1SXJA 1ENYA 2BI8A 3LJKA 4Z9YA 1E9CA 4H17A 5C53B 4KQJA 4HAYA 2OBBA 2PPVA 1OA0A 3DKPA 3OIUA 3JYOA 1HMYA 4K9NA 1S01A 4FGUA 1YI8A 1LSJA 5D00A 2NQ8A 4GOMD 3PDCA 4E2WA 4NOJA 4AKIA 1HH4A 5TDHA 2DT5A 2JAXA 5FHQA 3BB1A 4WIAA 1AHIA 5NULA 4IXMA 5BSMA 3DKIA 1AK1A 4CCWA 4CKYA 1OLXB 2GA9A 3NC0C 4YJ3B 2BMJA 1G0OA 3RV3A 1OREA 4J9VA 4Z9AA 3JAWB 4F11A 5AI9A 1ORWA 3CZPA 5G53C 2NADA 1E3IA 2AQ8A 2MSLA 4U2DA 5ISMA 2PL5A 4Z3OA 4LS3A 2C98A 2AN1A 3B53X 4U39A 1CVLA 2OGUA 3PNMA 3PX2A 2GJ4A 1CVRA 3I2GA 4LJKA 2CNLA 3D43A 3CEAA 1AZSC 1PGQA 2ZSHA 4HX9A 4JCOA 1VCHA 1VLVA 1E2IA 2AXQA 1JHMA 3P9IA 3CVOA 3ACDA 4G9BA 1O95D 4TL7A 1DU4A 3KQUA 3BCHA 4E1AA