3MCAA

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
377
Chain Sequence
b'KKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLGRIMFELGEIIGDAPGHRDFISGMIAAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVTVTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLRPGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
total genus 82
structure length 377
sequence length 438
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF08938 HBS1_N HBS1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mcaA02
1XPUA 3H0KA 5JWOA 3AP1A 2AR7A 5TVKA 3CB4A 1CLUA 2GXQA 1I7PA 1VYVA 1UDXA 1W2BB 1KSHA 4R9UC 4TN1A 4KFRA 4ACBA 4M1OA 1XD9A 4GMDA 1AKEA 2F1RA 4JYBA 1II8A 1MRSA 4QGFA 1G64A 2JLRA 3H86A 2IA5A 2OILA 2JASA 2QP9X 1QHHA 1QBKC 2CL6X 3TQFA 1X8LA 4B3BA 3LAWA 5IT5A 4NE2A 4ASUA 3ZS9A 4TT3D 1G7RA 3HDTA 2UKDA 4B35A 3HR7A 4IDHA 1WBDA 3WXMA 1KHTA 3W8NA 1GRNA 1VYTA 2J5XA 3B7GA 2MMGA 1N5JA 1YZKA 3CX8A 1G4AE 4JBYA 3UWKA 2V6JA 2WAXA 2N1BA 3ND8A 5CLQA 5C46F 4X8HA 5J4YA 3AP3A 5DI3B 5JHHB 2JIZA 2QU8A 1DAIA 3MSXA 4WW0A 3VU9B 1X86B 1ZD8A 2ZJZA 4LC0A 5AJWA 3TRFA 4D4KA 4ITRC 3VAAA 4G5QA 4D0NA 3RS7A 4FXPA 2B8TA 4PQFA 3O8CA 1QGAA 1FW6A 2WSSD 1XXHA 3AF1A 4DQLA 2GXAA 2XEXA 2Z4SA 2IT1A 1TTTA 4TMTA 4TYNA 1XEFA 3GFPA 2WWYA 2CMKA 3OZWA 4DLZA 3GLIA 2BBSA 3SEAA 1U90A 1W5TA 3A1VA 2ZS8A 1LB1B 4HSEA 1OXVA 2QSZA 4V0ME 2KI5A 3EZ7A 1K5DA 1NBME 4A6XA 1GO2A 3CCSB 5IK2D 3EC1A 5EE1A 2OFXA 4MKFA 4HLUA 4D4JA 4LUCA 1JJVA 2IWRA 2Z83A 2GZHA 3DL0A 5EE5B 3O8DA 3HJNA 2VHQA 1Q1EA 3ZVRA 4IEEA 1OXXK 3W2HA 2ZQ5A 4TYWA 2ZE8A 3KTAB 2OTLB 2F55A 1WRBA 4KITB 1F20A 2QPTA 2VHJA 1BX1A 1E98A 3IUYA 3U3RA 4F38A 5KU1A 4CGZA 2OK8A 1ZUNB 1VMAA 3FFBA 3X1XA 4ZCLA 1F2TA 3PEWA 2ZRPA 3SDZA 2JJ1A 4PC1A 1QZXA 3QEOA 2GCOB 2A5JA 1YR6A 1L7VC 2HCBA 2OZEA 4HB0A 3NIBA 3CIOA 2VRWA 1S96A 3CC7B 4KFUA 1P9WA 4Q9LA 4NYMR 1GWNA 2V1XA 4UJ5A 1BMFD 1Q21A 2ZRNA 5FOSA 2N42A 4ZKEA 4OHYA 5CYOA 4Q47A 1Z0IA 3E5HA 4BLSA 5JI3E 1TF2A 3U4QA 5CJ2A 5E7MA 4NCHA 3GEIA 1JJ2B 4RD1A 5LD2B 5L3QA 4W9MC 2B7BA 1YJWB 2FH5B 3GJ7A 2OV2A 4TMKA 1N6LA 1NVUQ 4D26A 3VO1A 4N0DA 3TK1A 2ZE7A 1SXJB 3RAPR 5FTNA 1S3SA 4RSGA 2QUZA 2XZLA 3A1TA 1YZTA 2F6RA 4DJTA 4F4CA 3H84A 4WOPA 3CWQA 2IUUA 4EPWA 2QE7D 4NONA 2ZM5A 4LJAA 1VTKA 4GL2A 3PITA 1MR3F 2WWFA 4XSHA 4RZ3A 4L8GA 5EJEA 3KFXA 1RC8A 3TVTA 2IS2A 1E1RA 4V0NA 1Z3IX 1D2MA 5TY0A 3CRW1 4QBFA 4OYHA 3U7HB 4LJ5A 2OAQ1 4IDQA 2PEYA 1DG3A 1NIPA 4JJZA 4PX9A 3T5DA 1KZGB 3B78A 5AJYA 1YRBA 2J45A 3V4RA 1E32A 4HYYA 2XSZA 1TQ4A 4PZYA 4NBSA 3W6OA 4CF7A 2CHQA 4LYJA 4M1KA 4B43A 1LY1A 2EFHB 4MA4A 4JBWA 4IOJA 2ZPTX 4R2IA 2GBLC 4DSTA 4RJLA 5THXA 1GP2A 3AGPA 2WWHA 5EXPA 1G8FA 1OHHA 3IO5A 2UZIR 4C0BA 1NP6A 1XCPA 3ES9A 3REGA 4URXR 4LBZA 2QT0A 4HDCA 3UMSA 3LQRA 4Q9KA 3W3AA 1E9CA 1K73D 1S1MA 2VIIA 4M9QA 1GDDA 4LDJA 2QROA 3F0TA 4Z1MD 521PA 4LPKA 3N70A 2PJRA 4LV8B 2WICA 3DKVA 1J90A 1UKZA 2DB3A 3RYTC 5LDDC 3UPUA 3GJ4A 2OFWA 1NN0A 5KPJA 1XEWY 1S72B 3QPUA 1NI3A 4QHTA 2G83A 2X2FA 2P6RA 3CR8A 3W5UA 4I1VA 4TLBA 4ON9A 4N1AA 4TL7A 3W3ZB 3EPKA 2BGIA 1FUKA 1W2GA 3EZ6A 3AVOA 5DI3A 3TUZC 1KOFA 5IDVA 3AVQA 2JDID 3VU9A 3ZDQA 2LKDA 2O52A 1OIXA 3BRWD 1VQNB 3SU8A 3B1YA 1AIPA 2VP0A 3GJXC 4TLAA 4IDPA 4TMXA 2G1KA 3ZZTA 2Z4RA 1P2TA 4BRUA 2OTJB 1E4VA 4EIWA 2O8FB 3VX3A 3CPHA 3LVBA 1N6NA 2JA1A 1RVDA 2A5DA 1Z22A 3AUYA 1SM4A 2FGJA 1NLYA 3CCVB 2X2EA 3NEJA 3G6EB 1TNDA 5HPYB 1GR1A 4B75A 3V00A 3B60A 3E1SA 5FPTA 3SJBA 3I3SR 2Q3MA 2I1VB 3RDPA 2F3TA 1UEJA 2FF7A 1T3SA 2VP6A 3PEYA 1OV4A 5H68A 1LVGA 5BN4A 4BFWA 1G3MA 2C9YA 5CJPA 1WP9A 4Q1EA 5FPYA 1TEVA 1AQYA 4BEBA 4NCJA 1RFLA 1Q1ZA 5CB6A 5B2ZA 4MYHA 2H17A 1ODFA 4BLOA 3KTAA 3QKUA 3CCJB 4JSYA 1IOZA 1Z8FA 2Z0MA 5F98A 2IUSA 2B7CA 4UAJA 2W2XA 2YYZA 4A0RA 3FMIA 2ERYA 1M34E 5GVRA 4EAQA 2QMEA 4BLTA 2DY1A 2ZR9A 1FUUA 4ACAA 3JZMA 1ZC3A 2GCOA 3W5IA 5FBRB 1EFTA 4YAOA 3R9WA 5AUQA 4OJKA 3I8SA 1E9RA 4DUGD 4TTRA 4PHHA 4S35A 3LW8A 3UWOA 4RFSB 1GM5A 3T1QA 1Q7YD 4Y9RA 2RHMA 3CRVA 3HYRA 4AK9A 4Q4LA 2QQ0A 4FMCF 2J9RA 4GOXA 1Z0JA 4M1MA 1ZRHA 2FNAA 2BV3A 2GJ8A 3CXCB 2PZFA 3EIEA 1E94E 5FFMA 3I55B 1K6MA 1Y3AA 5DISB 4ZI2A 1IN8A 3B5JA 4AG5A 2GK7A 3WNBA 3FE2A 4D80A 2ZSBA 1XBTA 3NG1A 3FFAA 4PGOA 1H8EA 1E79D 4V02A 1AGPA 1SXJA 1K8AD 1QFZA 4RZUA 1W87A 3PCRB 3K0CC 2GPJA 2FPMA 3LV8A 1XU4A 1JECA 3SHWA 2NMVA 3FB4A 5DNYB 5CIQA 1R2QA 4Q9IA 1B23P 4HAYA 5AJXA 2QTVB 5FI0B 2WJGA 4M9XA 3VNUA 3BK7A 3NEYA 4L9WA 1ZM4A 2DHRA 4YAFA 4Y0VA 4A6PA 1N0VC 2IWHA 2WBLC 3FMOB 1JXOA 1MKYA 3EZ9A 4DRZA 1Z63A 2QAJA 1VECA 2GTPA 1CP2A 5FOXA 3GLFB 2CDNA 3SJZA 4YAUA 2CHVA 2QRZA 4GP7A 2QN6A 1A2KC 1OXTA 4QGGA 4DLXA 1P3JA 3KXLA 4BFXA 1Q86D 1N6RA 4CT5A 3ZD6A 3TSZA 1HT1E 1PLLA 1FNDA 3OEED 3UIEA 4II7A 1FP7A 3Q85A 4I81A 1XEXB 5J40A 3L8YA 2NPFA 2Q0HA 3F8TA 1CJVC 2ZI7A 2RC5A 1XTKA 3OW2B 1E9AA 1EWYA 2B5OA 4POAA 4A36A 1GRRA 2OCAA 1NBMD 1W4BA 1XTSA 5H8WA 2J7PA 1NVXQ 3OJWA 4XIGS 4KLZA 2FPKA 3LY5A 2IEYA 1G8GA 1UADA 3TAHA 4LJ7A 2GETA 1OLOA 1PUIA 5BN3A 1SKYE 3QBVA 4LHXA 4Q4AB 4WAUA 4TYQA 1JR3E 3K1JA 2YOGA 3IGFA 3TUJC 5L3SB 1G7CA 1IXSB 2OBNA 3C4JA 3QF7A 1N6HA 1EESA 4AC9A 3LBNA 4TL6A 2YWGA 1QHIA 2PL3A 3SJCA 4V0LA 5CK4A 4PPNA 2PX3A 3GP8A 2R44A 4DSUA 4F7WA 5C4MA 3CCUB 2YVUA 1COWA 1ZJ6A 2R8RA 3RRZA 1RRCA 5JI2E 1YZQA 2GJKA 3AH8A 1P2VA 1UEIA 2QQEA 4BLPA 1CEEA 2FMXA 2FOLA 3AVTA 1Z06A 2AWNA 2X77A 5HE8A 4B2IA 1XJ0A 4M1TA 5KHOC 1CULC 1T91A 3X1ZA 1D6JA 1OFTA 3B1XA 4TLEA 5G40A 1R5NA 1P2UA 4BZPA 4R2HA 4B47A 4C4PA 4LX0A 4CDGA 2DYKA 3ZBTA 1IHUA 1KI1A 5B58C 2JGNA 1GOTA 1LNZA 3AKDA 2OG2A 2YWEA 5DN6D 1N0UA 2GRJA 1XTQA 2IYSA 3M1IA 3NC1C 4E22A 4FWIB 3W2FA 2OE2A 1BJKA 4YALA 4DIDA 3P1JA 3CNLA 2Q9AA 3WY9A 1OKKD 2A2ZA 4RKEA 1UJ2A 4M53A 1M90D 2J41A 2BM1A 2IYTA 5GJCA 1JQJC 2R62A 2ZJ5A 1ZM7A 3U60B 2IXFA 1GL9B 1UM8A 1QX4A 1OSNA 5HR5A 4URVR 1GTVA 4NKRA 3C41J 3CC4B 1KY2A 2GAAA 5FTLA 1VCMA 1XMJA 1YIJB 3WMGA 3E20A 3QVUA 3R8FA 4DBLC 3W5VA 1BYIA 1Q1QA 1US8A 3FDIA 3AF2A 1XMIA 2OLJA 4CT4B 3EPJA 1XE1A 4LC1A 3O8BA 2FZLA 4FCTA 1G3UA 2J1LA 2KSQA 4MKHA 3SN6A 3Q7PA 1CXZA 4B2PA 5HTKA 4WZAE 3CZQA 3FPKA 1E9BA 1XPOA 3CF2A 3LFUA 4RFSA 4LJYA 4K1XA 3WP1B 1Z29A 5EXXA 3ZQJA 3ZVNA 2LKCA 3UXMA 4MYUA 4TQUS 3KXIA 2GJSA 4UXIA 4TMVA 1XF9A 1E9DA 2ZROA 2NTYC 3CR7A 2ZUBA 4GRAA 1DAGA 4Q7LA 4EUNA 2W2VA 2FZ4A 3P4XA 1KO5A 4PQYA 4M1SA 1RYFA 1NSTA 3MGCA 5KOYA 1W36C 2BCJQ 1U98A 2GF9A 2QAGC 2ZSFA 3BH7A 1JB1A 3EWSA 1Q20A 4M21A 5FA6A 2ASEA 2EYUA 3SQXA 1R0ZA 3ADBA 1XCGB 4IVRA 4F93B 5IHPA 1GSIA 1FNCA 4MRSA 3C7KA 1T3LA 2WIAA 3SOPA 3B9PA 4AYWA 1IN6A 1EP1B 4EPRA 4QRHA 5GJWC 2ZETA 1Z0DA 2VPPA 5TR9A 1S8FA 4E09A 4EKDA 1E6CA 5JZVA 2VL7A 1IB0A 3GLFA 4FCVA 4RD2A 4Q48A 4DLUA 4WA7A 2A9KA 2FWRA 1AMOA 1T5LA 5LD2C 4IKEA 1ZU5A 3K70D 2VHTA 2A78A 6Q21A 1KK3A 1M2OB 1FQJA 5JBQA 4QHSA 2XZOA 1A7JA 2JAQA 1T4GA 3SFZA 3FJOA 1ZIPA 5EZ6B 2ATVA 1XEXA 3MWKA 2PZGA 1VQ5B 2HCJB 4S2EA 3CMEB 1SXJC 2AWOA 4OI4A 3CCEB 1R0YA 4M2LA 2YNMA 1XX6A 3RNLA 2BPOA 2G77B 3OHMA 3EX7C 1R4AA 3K0EA 2MSDB 4Q1AA 4TWZA 3N2IA 4TT3A 3K09A 4B3DA 2NO6A 1QHSA 4UXJA 3QPVA 1G6HA 1TQ6A 2IYRA 3HPQA 3K9LA 5M04A 4B3GA 1F60A 4FN5A 1E2FA 3BFKA 4O2LA 1DO2A 2AK2A 4JVNA 4Q4AA 2YV5A 1DAMA 2RH5A 4WQMA 4GT1A 5L3SA 3K0AB 2ANCA 2FEOA 3WMFA 1S4QA 1E69A 4A4DA 4PO1A 4ZI3A 5K8TA 1BKDR 4I1UA 3WYFA 4OK6A 2ZXUA 3BERA 4HB4A 4B4DA 1PJRA 1E96A 1EK0A 1U0HC 1X6VA 3HU1A 3JVUA 4GMXA 5EUQB 4ZV4A 4Q03A 1N5IA 3OFND 1KI6B 3ZBUA 2LWIA 2F9LA 2C98A 4HE6A 4UNNA 5E7IA 2WWIA 3KKMA 1MOZA 3A4LA 2WSSA 2G0TA 3OZXA 2CNWA 2OFOA 1HE1C 2RGCA 2YWHA 3VNVA 4XTCS 4P0TA 1W2HA 3VKHA 1E62A 3U6BA 1Z83A 4RZ2A 3A1WA 3KJHA 4AIIA 5CITA 1XZPA 5KYKA 3OEHD 4LHVA 3RC8A 2MMCA 3L0OA 5E4FA 3RWOA 3NHBA 2N46A 2IK8A 1CNEA 2ZSDA 2RGNC 3AV0B 3AUXA 3GD7A 1OW3B 3LH5A 1G17A 3PR1A 4Q9HA 3MCAA 5EMNA 2EVWX 3KB2A 4KSBA 3C5CA 1MT0A 1OH8A 1WCV1 3CW2A 2ZR7A 1HQYE 1E2QA 4IRUB 2BBTA 2PLFA 4UJ3A 2ZANA 4OK3A 4P4UA 4E5UA 5FTJA 1R8QA 3GPLA 2F9MA 2NZ8A 2F1HA 1P5ZB 4WBSA 4FI3C 1GL7A 1F3OA 1GILA 2GA8A 4TLDA 5HCIA 4R98A 4MDFA 5FR1A 1X8KA 4JLVA 4MKGA 821PA 2O8BB 1KI8A 3GJ5A 2ZRAA 2I1QA 1E1QD 4PC7A 2R6FA 3LLUA 1W48A 1Q81D 1OFUX 4WXPA 2DBYA 3I72A 4M9SA 3AVPA 2OCBA 2HXYA 3QG5A 2ODWA 5FL7D 1BX0A 3I5YA 1NKSA 2QP3A 5D3MB 1M74A 4C9BA 1WBBA 3ADKA 4JLAA 4XVRA 2C03A 2YWFA 2C9OA 1Q0UA 4LOAA 4OI2A 1AS2A 3ZZUA 5EE0A 3OE7D 1S9DA 2IYYA 1CKEA 1AQUA 2HF8A 3AKYA 3RS5A 4EH1A 1U94A 3VHXA 1FMJA 4BRWA 2O0HA 3FKSD 4ZDKA 1CIPA 4HAUA 3SI7A 1NDHA 2DWQA 4DWJA 3ZD7A 4BPBA 1U0JA 5FH9A 4AYTA 4BUJA 2BOVA 3W8RA 3W2GA 1HYQA 4URZR 4QBIA 1NMXA 3B82A 1JR3D 3QE0A 2NPIA 2VF7A 3B8HA 5CIWA 3ZVLA 1EFRA 1DAFA 1E2NA 2BJWA 4WZ6A 4YMTA 1AZSC 2P2LA 3QUSA 5FOTA 5FPKA 3CUEF 1R8SA 1KMHB 1A5TA 2Q6TA 2FE4A 1JR6A 1YJ5A 2CNDA 4C0SA 1QHNA 4M1WA 1ZM2A 2NO7A 1GZSA 1P75A 1ZBDA 3BWDD 4FIDA 4HDQB 4CYMA 1G21E 1KAGA 4IVPA 2VF8A 1OYWA 3FTQA 1G18A 3CCLB 4L16A 2AN9A 4F91B 4U5XA 5JJKA 1VCNA 3TSOA 4BFYA 2D06A 4OQMA 1N8RD 4ZPXA 1LF0A 3C16C 1XJQA 2QM8A 2GCNA 3A8TA 4BFVA 4YDHB 2PLRA 2P0EA 4QBHA 1CU1A 4WZBE 2GESA 2A5FA 3HPRA 3LW7A 4PR0A 3D6TB 4MRNA 1KRHA 4MRRA 2HJVA 4U02A 1VCOA 5SZKB 3RS3A 1U9IC 1P4SA 3TVDA 3CO5A 3TMKA 5H5JA 3ECCA 2EWVA 3MD0A 5J4HA 3ASYA 4IOKA 3B1ZA 3QXHA 4OQFA 4LPSA 2D3WA 3T1TA 4DHEA 4BQSA 3I1FA 1S9HA 1Z2AA 3D3QA 4JYCA 2O5VA 4TMWA 2W6IA 2ZI6A 4IJMA 2GXUA 3LBIA 3AM1A 5GJBA 1UKEA 2ORWA 4RZXA 1W4RA 4DIEA 1XFAA 2W6JD 3EA0A 2ZI4A 3OZVA 4RD4A 2QA4B 3K0AA 5CYPA 1FMLA 1LF5A 3WRXC 1CRPA 1AS0A 4OHWA 4XD7A 3C15C 1VG9B 3MFYA 5EP3A 4QM7A 3U2QA 1W0JD 1UBEA 2R6DA 4HI0E 4O25A 2VNHA 1S3GA 4U7DA 2C96A 1Z6XA 3AP2A 3PUWA 2WPDA 1KI6A 2P65A 1IY2A 1MABB 4JLNA 2FEMA 3IO3A 1DAEA 1HH4A 2G6BA 2O8DB 1B2RA 4URUR 4RD3A 1E2PA 5LPNA 4KVAA 3AVUA 3MRSA 4B32A 4DDWA 2GWHA 4YMVA 1HT2E 1MO4A 3U44B 3QF4B 4A2QA 1XMVA 3Q5EA 1ZW6A 2IUTA 3AF0A 3ND9A 2O0KA 1Q82D 1H8HA 2H16A 1W7AA 2EFGA 1GIAA 2QGZA 2GF0A 2XJ9A 1CJTC 3RWMB 4JLDA 1NLZA 1OE0A 2OM2A 4HAZA 4I1SA 1DVRA 2FU5C 1GJRA 2OEPA 1IXZA 4OI1A 2XB2A 2ZRGA 2GNOA 1MO3A 4M0LA 2ZRKA 5J47A 4Q21A 3RRYA 3NBXX 4IDOA 1RRFA 4AKGA 4URYR 4A2WA 1Z07A 2W00A 3IIMA 2VQSA 1HA3A 2GILA 2OCYC 3QBTA 2GDJA 4MH0R 1Y63A 3ONWA 1NY6A 2JLUA 3GLHE 2O8BA 3BAFA 3KB1A 2RGAA 1KDPA 2VYFA 3CF0A 3U5ZB 3AVVA 1RW4A 2MSCB 2HLDA 4BFZA 4D82A 1ZP6A 1SVKA 4LV5B 4TL9A 1G4UR 2ZEJA 3U7EB 2A3RA 1PVOA 1W4CA 4B34A 1EXMA 3N5CA 4A2PA 3GFOA 5D3MA 1OB5A 4QL3A 5AUNB 2HMAA 1XTIA 3QG1A 2DFLA 3U7FB 5AK0A 2KB0A 1QHYA 4ZKDA 2BEJA 3WYAA 3CC2B 4YHBA 3VHLB 4NHOA 1ZYUA 421PA 4ZDJA 4D25A 1T9HA 2AKAB 3DEFA 1T0JB 1UKVY 2F43B 2O0JA 4HLQB 5E3HA 1KNQA 2ZYTX 1E79A 4LHWA 4LGMA 2V6IA 2ZI3A 5JCPA 5JJIA 2AFHE 4F4IA 2WWXA 1XNJA 2ZI9A 3L2OB 4Q7JB 4F7DA 4XH9B 4MGKR 3B1WA 4TLCA 1IONA 4Q7MB 2WJIA 4MKIA 3HWSA 1QGZA 4OQNA 1AK2A 2Q9CA 3LLMA 3R20A 4HZIA 4LSGA 2IYVA 1CNFA 3EZ2A 3KZ1E 2ZRBA 1KMHA 3KX2A 3SYLA 3C14C 3WP0A 4ASUD 1KYIA 1YITB 1SXJE 2IBMA 1ZUHA 1JA0A 1PLJA 4H1UA 1M7GA 4AKIA 3T35A 2IYQA 1F5NA 4JMPA 3CH5A 1HUQA 1TLLA 5FUXA 4PAOA 4GOKA 2ZUDA 3QE2A 3KKOA 4A8JB 4C0KA 2JLZA 2UZ3A 3K70B 3CRQA 2R6GA 1KI2A 4AI6A 1I2DA 3Q7QA 1KZ7B 3OEEA 3DZDA 4HB2A 3DKPA 3KL4A 3QXJA 5DSZA 3U3MA 1U8AA 1F2UB 1E99A 3BC1A 2Q9BA 1L4YA 4MRPA 4V0MA 2QRNA 1KO1A 1NBMA 3GEHA 4Z8XA 1GKYA 2BF4A 1HQCA 1KK2A 4CEJB 2DETA 3CCQB 1OGIA 3TGPA 2QTLA 5F2EA 1NVVR 5FUWA 3ZIAD 5J4LA 2V1UA 4MDEA 3B1VA 2XB4A 2O8CB 1C1YA 3PFIA 2HJGA 2J0UB 1AN0A 221PA 3AEZA 3L0IB 2DEUA 1SHKA 2HEIA 1IY1A 3W6PA 4DDUA 4P6VF 1FRQA 2R2AA 3HYTA 4GSYA 2V7QD 3MWYW 3D7MA 4RD0A 2GVDC 4GI7A 2RGDA 4FMDB 4BZQA 3PEVA 3K0SA 2AKYA 3GFTA 4OHXA 3BS4A 3S1AB 4IXNA 3EPLA 4EJSB 1CF4A 3KQNA 2VP5A 5AWFC 4UQOA 1GVNB 1R0XA 2BN4A 1R10A 1CS4C 3VR4A 1A8PA 2BDTA 3D31A 4QJ5A 3QSYA 1HTWA 2QTZA 4EPXA 1IY0A 1XDBA 1Z6TA 1OYYA 4Z51A 1G8YA 4QG7A 1MABA 2H57A 4GNKA 2GZAA 1IQPA 1S2MA 2WWGA 2O8DA 1F6BA 1N6PA 2JJ1D 2B92A 2J46A 1VQKB 3CX7A 2EWWA 3I92A 2AXPA 2UVQA 2ZRLA 1PLKA 1YJNB 2C99A 4JIMA 4MGIR 1FZQA 2IXGA 4PTLA 3IBYA 3U44A 3QF4A 1OKKA 4JVMA 3DPUA 4NDZA 2BVNA 1DDGA 4URWR 1YZNA 4IXMA 5JCZA 1NIJA 1VQLB 3RANA 3TKLA 1KSFX 2NO9A 1BYUA 2ATXA 2CLDX 2VNKA 3JQPA 4X8LA 4LCBA 4HLUC 1GAJA 2IC5A 2OK7A 4OI0A 1KDRA 5HE9A 3KQKA 2QP4A 3ICQB 1G5PA 2ZJ2A 1WE2A 2BMFA 2DFNA 4XOIA 2BCGY 2PZEA 2A5GA 1RJ9B 4OL0A 1W5SA 4DCVA 1Q1BA 2CL0X 3FKQA 1ZAKA 2EYQA 1VHTA 5H70A 4JL5A 5J4KA 4BE7B 4O0MA 2RGEA 4KJZA 5KPDA 1TX4B 3LA6A 3Q3JB 4IOLA 2ZITA 4N0EA 4UNSA 4B76A 4QJ3A 1WF3A 4TSFD 5FPHA 4ESHA 3V4FA 1JAIA 2CCJA 3FWYA 2C2HA 2WJHA 1YZLA 3SZRA 1V5WA 3K9NA 4G1VA 1NJGA 1FNMA 2ZJOA 2QTHA 4US1R 3TIFA 5ANRB 3OZUA 3X2SA 1M7BA 2ZS9A 4P33A 3A4NA 1VIYA 5HZHA 2RHDA 1DADA 2QSYA 4PZLA 1X1RA 4MUBA 4NMMA 2VSXA 3QXXA 3Q9LA 3H1TA 4P4SB 3GLGB 4NZYA 3ADCA 4HAXA 1FRNA 5AJZA 4NU0A 1D1NA 5L8VA 2F43A 3A36A 2NG1A 2AXNA 2GJ9A 2IL1A 4KYIB 1T5IA 2AFIE 3THOA 4C0LA 2FG5A 1DELA 3UMFA 1E2EA 3B2EA 2DWOA 2ZRHA 2CVHA 4HEJA 4DLVA 1M1KD 4JLMA 4DCNA 1IJEA 4HE5A 3CCMB 4LV6A 4DLYA 5B30A 2IW3A 2HYIC 1F48A 2QPOA 1JEEA 3FHOA 4LY6A 5FTMA 1TQ2A 3IQWA 3QPWA 1XMSA 2ZJYA 5EXTA 2W58A 4EQ6B 5JEDA 3LXXA 1SVLA 1B0UA 1U0LA 2OCPA 3AB3A 3EA5A 2C78A 1XD2B 2NOAA 3A37A 3PEUA 1OFIA 1E9SA 3VR5A 3RVBA 4NYMQ 3ZYCA 3KKQA 5FL3A 3PUXA 1TQDA 1GUAA 4YXWD 2VNIA 5CDFE 4A8JA 5KDDA 1W44A 1G20E 3NC0C 4R71A 3U6KA 3RC3A 2FSGA 3VQTA 3SHFA 2H1LA 5FBWB 3I5XA 1G41A 3TR0A 4B71A 5EP1A 1F2UA 2JLWA 3AKEA 3AQ4A 3A4MA 5DO9A 1VPLA 4BLQA 5FUYA 3VR6A 1VG1A 4CEJA 1SULA 4IEIA 1OXSC 1ZM3A 1KMQA 2D7CA 5FBLB 3ZLJA 3K53A 3ZZ0A 4L5BA 1P72A 2ZE6A 5G3YA 5JWHA 3UKDA 1RE0A 3TW8B 3ZJYA 2CBZA 4AURA 4FW9A 1NVWQ 5AUPB 2J0UA 2O8FA 1O3YA 1P62B 1EFCA 5BYKA 2RKOA 2CEAA 5KDLA 4PFSA 2PBRA 3K0FB 1FX0B 1VQOB 2H92A 2FDCA 3RSLA 2R65A 2JJ2D 3VTKA 1VG8A 1W4AA 5KSOA 2RCNA 2NZJA 1EFUA 3EAQA 1I4TD 3S1AA 3EZFA 4EJSA 1G5RA 4ZGQB 1DPFA 3KKNA 2BC9A 2VO1A 2ZRIA 1I4DD 3CX6A 2EIXA 5JRZA 1NF3A 4EPVA 3K9HA 3CH4B 4Q1CA 2XNSA 2DERA 2EQBA 5IRCD 2QGNA 5JECA 1W36D 4CEIB 4H9GA 2O8CA 2CCKA 1D5CA 4Q18A 3G4SB 3OEHA 4KSCA 1D9XA 4BLRA 2W2TA 2RGGA 1GRQA 4HATA 4UNPA 1QF9A 1NN5A 3T5GA 3ICEA 1CR0A 1G3RA 1GNPA 1N6OA 2CK3D 2Q3FA 5LBIA 4OHZA 1W46A 2ONJA 4PSKA 1UF9A 1WB9A 2Z6VA 2GQFA 4KO8A 4HAVA 4WXRA 1UMKA 4KFTA 3SBEA 1K8RA 3BH6A 5E7JA 4IVQA 5A5GA 1LFDB 2ZYVX 4DLTA 4QKQA 3RABA 3O8RA 4GDFA 4QM6A 1W1WA 3Q8XB 5IF9A 1CR1A 3CZPA 1DARA 2GKSA 4GZLA 2ONKA 1EWRA 1Q12A 2NO1A 3THYB 4C3ZA 2FSFA 3OIUA 5CM9C 1KAOA 4TMZA 1BO6A 1YKSA 4JKIA 5DLQC 2VP4A 3IHLA 4QBGB 1SXJD 2XITA 3KJIA 3GQBA 1Z08A 2FJUA 5EP4A 1RJ9A 3PXGA 4BWYA 4L9SA 1JA1A 2WHXA 2IF2A 4MITA 4B3CA 5G3ZA 2MSEB 1W0KA 4RCZA 5FL7A 4D0LB 2XNDA 3DO6A 2ZSEA 3EPHA 4QJ4A 1KY3A 4EFMA 1YVDA 4KBGA 5SZIA 2ORVA 2P3SA 1W47A 3OE7A 1D8TA 2BWJA 1WMSA 4Q19A 4A92A 3Q5DA 1R6BX 4PC3A 1T8UA 4BEJA 4XVQA 2BMDA 4LHZA 2IYUA 1J8YF 2GVZC 1WQ1R 3EWAA 3QVVA 4M8NE 3QOFA 4DB4A 1ZU4A 2HV8A 2B21A 4P4SA 1GAWA 4CEHB 1S0UA 1KSGA 3GLGA 1Q3TA 3LNCA 4C7OB 2HUPA 4DSNA 3T12A 2J0VA 3LD9A 3LQQA 1JR3A 2HXSA 2R6HA 4CRWB 3MUFA 4R7ZA 2JCSA 5JFGA 1MRNA 1ANKA 3NKVA 2FPLA 1KD1D 4B44A 1CJMA 2J7PD 4QOSA 2D2EA 3EG5A 4CIDA 3THWB 3WBJA 2OESA 1AGRA 4RKFA 3C5HA 2BBOA 3PG5A 1J70A 4PXAA 1NLFA 5K8UA 2WMOB 2V8OA 1YJ9B 2XAUA 3EXAA 1VYUA 1G7SA 2K5UA 4NYIR 4X8MA 5F9HA 5EE3A 1EX6A 3IIJA 3HR8A 4EQ6A 1DBSA 2C77A 4XWOA 1XD2A 5JWRA 3JQRA 5HZKA 1AS3A 3E70C 3NBFA 3NWJA 2E9SA 2ZIAA 1ZUIA 3B6EA 4YONB 2ZVPX 2P6UA 2Q3HA 3VKGA 1COWD 4P3YA 2GEVA 4Q02A 2BGJA 1Z6YA 3L8ZA 4PO9A 3TUIC 2I3BA 2ZJBA 3EW9A 3PUVA 4LJ9A 4PANA 2CLSA 2OXRA 2YJTD 3LRPA 3OAAD 2KJQA 4HUTA 1QGYA 2Q21A 2VH5R 4P4TA 3U7GA 4B6EA 2Y8EA 3GJ3A 2WJVA 2YZ2A 1OPXA 1YQTA 1QVAA 5EP2A 1DE0A 1HEIA 1M6NA 3DDCA 1G3IA 2WJJA 2YC2C 5AN9A 5GJVC 3MLEA 5C18A 3QFRA 1SVWA 5HKKD 1MH1A 2VLIA 3B85A 1S1CA 3JZAA 5FOVA 1DEKA 2OT3B 3VR3A 1FFHA 4G3XA 1IN5A 4JBXA 1E2HA 4JLKA 1LV7A 4MQBA 1YHNA 2C04A 1FX0A 3BD9A 1K5GA 3K0FA 3BOSA 4GZMA 5IK2A 1XXHE 4FWTA 5KSPA 4M1YA 1W0JA 4TYPA 4F92B 1UDWA 2KBEA 1N25A 5JS8A 5DI9A 2V55B 2OSBA 1NRJB 1KO4A 2EU8A 5K8IA 2AD1A 1U8YA 3GLIE 4G5SA 4J0QA 2OBMA 4GOJA 2ZE5A 4YC7A 3SBDA 3WMEA 1T6NA 2WSMA 5FTKA 3U3OA 3T15A 3TQCA 2CLCX 4G1UC 2P6NA 1WXQA 2ZVQX 1QFYA 4CEIA 4UNQA 2BSAA 3EIHA 4FD2A 4HUQB 1Q3HA 2GXSA 5JSZB 4WIAA 2VHUA 2WOOA 3FVQA 1NL3A 2D7DA 3DM5A 3R7WB 1GITA 2JLQA 2HT6A 5FOWA 4ERNA 2W0MA 4K8OA 2P67A 3BFVA 1X3SA 3QXSA 4AD8A 2TMKA 2JATA 1KIMA 3T06B 2DPXA 2ZI5A 4KFSA 1DTSA 1BMFA 4YDSA 4E03A 1E3MA 4TQ9A 1SVIA 2QEXB 2HDNB 2JJ8A 2VA8A 2VYQA 3CONA 4PAQA 4US2R 4TTPA 1M7HA 2ZJAA 2GBLA 4TZ0A 3TSWA 1XD8A 4PSVA 1VQMB 4M4SA 1J2JA 4G1BA 3CMAB 3W2IA 1ELOA 3WHLA 3KUCA 4K46A 3THYA 1P7CA 1JAHA 1QUFA 5FPSA 4C30A 2QM7A 2ZRDA 4QFMA 4KCGA 4O2RA 1C9KA 4XVUA 1GKUB 1E9EA 2Z43A 5BXQC 1N5KA 4MYCA 5TB5A 5KNCA 3EC2A 2J0SA 2BKUA 4B73A 4DLWA 2YKGA 1E2KA 2QE7A 3NDPA 4TTQA 5DH9A 3FGNA 2D62A 4B48A 1FP6A 1U8ZA 5H1YA 4D0GA 3I4LA 4HLDA 4WVFA 2VTKA 2BMJA 1GVHA 4PHGA 4BASA 2GCPA 3EIQA 5KSWB 2ZRMA 3OIYA 2ZUCA 2CE7A 1HE8B 3TH5A 4DXAA 2NQ2C 2YOFA 2QL6A 3LVQE 3R8CA 4KV9A 4D81A 2AD5A 5G41A 3QI2A 2QI9C 3DM9B 1KK0A 4G5GA 4ZIRB 1KKMA 2DFKB 1XPRA 1QHXA 4U9UA 3NDBB 2XGJA 1EP2B 3H4MA 3TBKA 2CHGA 3I56B 3J81k 3X1DA 1LTQA 1N3BA 4ZCMA 4CEHA 3G71B 4C7OA 3DHWC 1G16A 2ZAOA 1A4RA 2D2FA 3UATA 4BGDA 1ZNZA 1ONBA 2RMKA 1KKLA 4QNMA 4Z1MA 3THWA 5DIFA 1P61B 4JSTA 1ESMA 4LBVA 2PT7A 1O87A 3CNOA 2WOJA 5TDHA 3AKCA 4I4LA 3BJIC 2PT5A 3GCGA 2I4IA 2RAPA 2FN4A 4IFEA 5DHFA 3QY0A 3A1UA 3NTUA 5KO2A 2OXCA 1DAKA 4MGYR 1VQ4B 1EGAA 4A1FA 2FSIA 3LVRE 5EUMA 2HYDA 4YAWA 3BB3A 1KK1A 3AVWA 1E4YA 2EFEB 2E87A 4TZ6A 1EWQA 2CE2X 3GJ0A 2EFDB 2XTZA 5CK5A 1UAAA 3DOEA 3OJXA 3IEUA 4IOMA 1RPZA 1AKYA 3L0SA 3QFTA 4UKDA 3QFSA 2JDIA 1QH0A 2WKQA 4G5RA 4KI0A 1J9ZA 5EXSA 2O8EB 1SZPA 1NN1A 2CNWD 5EZ5A 1NG1A 1SVOA 3G82C 3W5JA 2LCFA 3SS8A 2WJYA 3NBYC 3ZIAA 2D74A 4LI0A 4AKHA 1KDOA 2CXXA 2V3CC 2QTFA 4BFSA 3AF4A 3LWNA 5TV2A 3CNNA 4TQAA 5KNBA 1N6IA 2ZRJA 4Y7CA 1J8MF 1ZNXA 3CRMA 3K9GA 3JQQA 2XNCA 4JLOA 2V7QA 1EG7A 2CRVA 2AL7A 4LYFA 4NPHA 3TLXA 5ELXA 5E95A 4RY2A 4OJQA 1L2TA 2QMHA 3K09C 4XWKA 3GLHB 3IQXA 4DLSA 4GBMA 1BOFA 4PHTA 2FGKA 1IJFA 1E2LA 4Q4JB 1G6OA 3WRYC 4XSGA 4KVGA 2C9CA 4UXHA 1TMKA 3U3JA 1W36B 2YC4C 1TVCA 3MMPA 4C43A 2QAGB 1E0AA 5FUVA 4FMBB 1D9ZA 3ASZA 3VFDA 2A5YB 1VKJA 1U99A 2A30A 2WKRA 2WV9A 3K0CA 5DGXA 3W9YA 4DB2A 2XOKD 4Q1DA 1ZD1A 4Q9JA 4P31A 3A58B 3LO8A 4B2LA 2G0NA 2J59A 3FHCB 3IDQA 4A0FA 1YZGA 4E07A 1KNXA 1KI7A 4HUQA 1KJWA 2ECKA 3KXKA 1JBKA 5JSZA 1VQPB 1BH2A 4P32A 4PAMA 4Q1FA 4Q5IA 1P2SA 2AX4A 4LYHA 2FFAA 1XEWX 4QNRA 3R7WA 2GEDA 2X8AA 4JKYA 1Z0FA 5DYIA 3SE0A 4NYIQ 4OQXA 4DUGA 2IEZA 3I8XA 3FHTA 3L82B 4NCNA 1Z47A 1DAHA 3WNCA 3OESA 2QBYB 1ZNYA 1P60A 5K8LA 1E2GA 4LJ6A 3SFVA 3I61A 5A4JA 4G01B 1X8JA 4GP6A 2QEQA 2L0XA 4Q7KA 1G1MA 4NP6A 2RB4A 4OK5A 1XZQA 4GPTA 3KQHA 1BQEA 3V76A 2DWPA 2RGBA 4W5HA 2E1RA 2OO7A 2JLSA 2WVJA 1VCIA 4B6FA 1EFRD 1JPJA 3N2EA 1OB2A 5DE3A 4TSFA 4EPTA 1IBRA 1AJEA 2R6CA 1QUEA 5KDOA 3BORA 3W6NA 1D2NA 2XXAB 3E2IA 2PMKA 3E1YE 1UFQA 3BB4A 3D8BA 4PC2A 1X1SA 4HB3A 4KBFA 3VX4A 2IYLD 3UG6A 3A1SA 3KQUA 2XTNA 1TPZA 2A7QA 5LB4A 1QVRA 2NIPA 4PSAA 1IN7A 2PIAA 4OKSA 5J4VA 3CCRB 1UBFA 3AVXA 1IXRC 2PCJA 2QY9A 1GFIA 4LRWA 4W5WA 1H85A 1KSJA 4A9AA 4ZDWA 1CRQA 2XNJA 2DFTA 2ZR0A 3P20A 4ZIRA 5L3VA 1G5TA 1NY5A 2REBA 4QXAA 2H8KA 4PZZA 1DDIA 1E2DA 4US0R 2JIZD 1AA9A 1J7KA 3QKTA 3BFXA 3SYKA 4B74A 1E9FA 3CKLA 1TUIA 4AF7A 3IILA 1ZM9A 3IHWA 3MG9A 4Y0AA 4JLPA 2IHYA 2B8WA 2BIFA 1G7TA 4KXFB 4QGAA 5KSYA 3L43A 2IYZA 3AGQA 1ZNWA 2WWWA 4FCWA 1MO6A 1D2EA 2BEKA 3BXZA 4V0KA 4AWXA 4JS0A 4JLJA 4L4UA 2W6ID 3MJRA 1ZMXA 3VO2A 2H7VA 1Z28A 3QKSB 5GVSA 1XB2A 1IN4A 1LS1A 1GNRA 4YXWA 2W83A 3THXB 2KWIA 3GJ8A 1VHLA 1I2MA 2BBWA 1U2RA 4XD7D 4ILEA 3DVLA 4KYUA 3W5HA 1YR8A 5BQ5A 2WPDD 2OAP1 3U61B 4PHFA 1P9RA 1OF1A 1ZVQA 2IYWA 4FMCB 3TE6A 4JVLA 2O8EA 3LXRA 4CZ2A 1KGDA 1KTVA 4BPRA 4BFTA 4PQRA 3JVVA 4YMUA 3NHAA 4EDHA 1E0JA 1Z6AA 3PJRA 2CJWB 3CPJB 5HXBA 5CB8A 1DG1G 4DEXA 3PUZA 1LS6A 3ZS8A 3VKWA 1FDRA 2AK3A 3LX8A 5HCNA 1GL6A 4M22A 1N2CE 1MO5A 1RRGA 5DN6A 3QXCA 1G9XA 2WMNB 3AF3A 3LO5A 1H8HD 2JJ2A 3QKRB 4ZDIA 1SVSA 4ARZB 3NVAA 3ADDA 3GLHA 4JLBA 3RS0A 3A6PC 4U00A 1JI0A 1Q57A 3M0EA 2QORA 1G19A 3TJZA 5BWMA 5TARA 3QFCA 1PUJA 3T1VA 1TF7A 3SC3A 1TU4A 1V43A 4Q4JA 1HV8A 1DO0A 2PH1A 3MWJA 1FNNA 4D4LA 3BGWA 3T34A 2JLXA 1W35A 2ZAMA 4X8OA 5TMPA 1OH6A 4H1VA 1VQ8B 2QAGA 2SHKA 2G1JA 3KFVA 4QGHA 3BE4A 2EW1A 1NN3A 1US8B 2KE5A 2ZS7A 4DSOA 1JNYA 2C8VA 2FFQA 1VQ9B 4TL8A 3TR5A 1KI3A 1II0A 2WM9B 4LBYA 4KHZA 2HLDD 2G9NA 4C0JA 5JHGB 4FMDF 1KJYA 1NJID 2P5SA 2XJ4A 4DCUA 4JL6A 2VSFA 2CK3A 3SNHA 4HAWA 2IF0A 1E1RD 2ZREA 1RRPA 3MWLA 1KJZA 2V4ZA 4OQLA 2GEUA 4GFDA 1QG4A 4DCSA 2FFBA 1Z5ZA 2YOHA 3UK6A 4C0AC 1OFHA 4DKXA 1JALA 1N0WA 4Q4HB 3T61A 5FOUA 4HDOB 5BW8A 5JLJA 2J87A 1Z0AA 4XTRA 1A1VA 4Z8YA 2QBYA 2XSZD 3K8YA 5B57C 2DR3A 1YHQB 2XTMA 2F7SA 2BMWA 3ZH9B 1ZCAA 1CJKC 3MAAC 4RFVA 2DCUA 1KI9A 2REXB 1SKYB 1QG2A 1E0SA 3VR1A 1TU3A 1YI2B 1FTNA 3QQ5A 2QA5A 4W5JA 1OHHD 1ESNA 4LYAA 2FFHA 5FBVB 2HT1A 4C0QC 5B64A 4Q1BA 1G8HA 1CJUC 1N6KA 2ZU0C 1FQKA 2XXAA 5KUTA 3KJEA 2F3RA 3SJAA 4FINA 2IHBA 2PCLA 4DEYA 2WKPA 1TAGA 1JQLB 3PUYA 1T8TA 4AF6A 5JS7A 1XTRA 1VQ7B 1NKTA 2ODBA 3OIWA 3KJGA 1P9NA 3G5UA 2IXEA 3HP1A 1YU9A 4PC6A 4BFUA 2WAYA 2VSOA 1Q22A 1UPTA 1ZCBA 5JMTA 3ZQ6A 3RSOA 5JJLA 5FBQB 1HY3A 2XZPA 1UKYA 2PX0A 2V54A 4N3GA 1FNBA 1WA5A 1VIAA 2V9PA 3CPEA 4HZUB 3SYNA 3FYHA 2VP2A 3P26A 1EP3B 2PEZA 4LBWA 2QNRA 1TEXA 2FA9A 4Z54A 5A0FA 2J0QA 3GLFE 1QVGB 1YRAA 1DS6A 1NMZA 1P73A 2RGNA 3NBZC 3PQCA 3U3KA 3GLGE 1H65A 4NYJR 4AKEA 1G291 4YMWA 3ETLA 2R6AA 4MYTA 2NO0A 5DHAA 1II9A 1KI4A 4OBEA 3F5FA 2VHCA 2J3EA 1CBUA 4PPQA 4G0NA 1R0WA 1AM4D 1W34A 3RS4A 4LK2A 3RLFA 3G0HA 4F4JA 3B13B 3QKSA 1T0HB 2AHOA 3KUDA 2ZRCA 2CVFA 1YR7A 1ZINA 4D4MA 5H59A 1CR2A 3QENA 3UANA 8OHMA 2ZTSA 3FMFA 3BBPA 3THXA 1TL7C 2JEOA 2C95A 1XP8A 2REOA 3KQLA 1TF5A 2QPAA 3R9IA 2B6HA 1HURA 1N5LA 3OFNA 1ZD9A 1OXUA 3CWZA 3OAAA 2X1VA 4I1OA 4EFLA 5KTYA 2F1IA 1OIWA 1R7RA 1XTJA 1JXMA 1PZNA 4IHQA 4Y9UA 1OT3A 4JT4A 2Z5FA 3BB1A 3PVSA 5HKKA 3DMNA 2WZQA 2CJWA 3PV0A 4DDVA 1RIFA 2FX3A 2D4HA 4KODA 5AJVB 4B3XA 4ZO4A 1EX7A 4N3NA 4G5OA 4AG6A 1XRJA 3IIKA 2BJVA 4KLNA 1XWIA 1FOEB 4V03A 4DVGA 2CL7X 3FMPB 2ZRFA 3QKRA 3MHPA 3RRMA 1ZIOA 4B33A 4ABYA 3ZVMA 1YZUA 5BYJA 4ARZA 4MUAA 5AR1A 3HU3A 1CR4A 1M1YE 1P6XA 3QJYA 3F3YA 2BM0A 2YINC 2VZLA 4QC2A 3X1YA 4KU4A 5KNDA 4EPYA 5F3WB 1KC8D 1E2MA 4EFNA 1FL9A 3CF6R 1G8PA 3KDSE 4LJ8A 1QVFB 5L3RA 1SVMA 5P21A 1E1QA 3FOZA 3VMFA 1XCMA 1H8ED 1NMYA 2X19A 3QIAA 2IYXA 1KQSB 5CM8B 1L8QA 2PMDA 3Q72A 1NVVQ 2GZDA 2QG6A 4RVCA 4DT1B 1E2IA 1R5BA 4DLRA 4IFBA 3NH9A 3WBKA 2GJAA 4BZXA 3I32A 1U81A 4ZGNB 3BIFA 1R5OA 1H42A 4DCTA 2GAOA 4QHYA 2ZSAA 2QZ4A 4Q4HA 1PV4A 1K9MD 4ESVA 3DMDA 2X3UA 3I73A 4PPFA 5C2JB 1SKQA 3PIRA 2BHRA 2QENA 3FKSA 1A2BA 5UKDA 2QDXA 2VNJA 3TW4A 1YE8A 2GK6A 3NH6A 4XJXA 3V9PA 2VP9A 1U9IA 1II8B 3M6AA 1BS1A 2R9VA 2IS1A 4JL8A 4RCYA 1I4LD 3HU2A 1IM2A 4NCKA 121PA 1OGJA 1GG2A 2OLKA 3DOFA 5C4GB 4B3FX 1QHHB 1JB9A 1CQXA 1WDTA 4NTZA 3W90A 1UBGA 1QDEA 4A82A 1OIVA 1ETUA 1AZTA 1RYHA 2FV8A 2J7KA 1SQ5A 1XJCA 1ZC4A 1LW7A 2ODEA 2ZJ8A 4Q00A 5CDFA 2H5EA 2IS6A 2H18A 2ZYWX 5DYGA 4KAXA 1Q44A 1E2JA 2RGXA 2EFCB 3OF5A 3P32A 3REFA 2ZYUX 1RKBA 3ZGXA 721PA 4AY2A 1QG0A 1QHGA 5FR2A 2YHSA 4A15A 2PJZA 2W0SA 4JZKA 5GV7A 4D6PA 2BMEA 4YLGA 5JEEA 2P5TB 1MV5A 1GKIA 3UMRA 1KO8A 4L15A 4LJ4A 3PENA 4W7SA 1E0KA 4A0GA 5G53C 1YR9A 5FI1B 5AUOB 2CCGA 3EASA 1NJFA 1L4UA 4OHVA 1CTQA 3TAUA 1XXHB 3CM0A 1W49A 4HZUA 1J99A 1TUEA 4O3MA 1E63A 2QT1A 3CRZA 3W2EA 1QRAA 3AVYA 1M8PA 2ZU6A 4PO8A 4Q01A 4XWAA 2JLYA 3SR0A 1SGWA 3GLIB 3IBGA 4V0OA 2VBCA 3C8UA 3KKPA 4JVSB 5BN5A 3ZC3A 3FPAA 2BKEA 5J5CA 4Q66C 5F9FA 3P27A 4MRVA 621PA 1RZ3A 4JJKA 4DQKA 5CLLA 3X1WA 3BH0A 2W6JA 3DZ8A 3WHKA 2ODNA 1JEDA 1C4OA 3GMTA 1NSFA 1VDZA 3NXSA 4M9ZA 5EE9A 5LB2A 4NCIA 3IPYA 4YMSA 1JJ7A 2IX3A 2ERXA 4I99A 1GAQA 1DOAA 4ZCIA 5TXGA 1JPNA 2RC6A 3TNFA 4A8JC 3K70C 4NH0A 2OUKA 3H2YA 1UBCA 2ANBA 2QMOA 4NL4H 1KO7A 3RHFA 3MJHA 4C2TA 1F2TB 5SZHB 4LWZA 3W34A 1NNEA 2WTUA 4UNRA 1NG9A 3RS2A 4K81B 3CLVA 1OJLA 2GHIA 3EARA 4DDTA 2JLVA 5GADl 1GNQA 1G3QA 3I62A 5EQTA 1Z6GA 2ORIA 3B9QA 4AYXA 3CD6B 2G3YA 4MGZR 5GV8A 2KBFA 3T1OA 1SHZA 1QFJA 3U4QB 3RRNA 1OH5A 3SQWA 2C5LA 1T3HA 4FK8A 4BECA 3UG7A 4C2UA 5L3QB 3GEEA 4IDNA 4JT2A 2IS4A 1EFHA 1VG0B 3LBHA 1FPMA 3WYGA 3L0PA 1FTSA 2OBLA 3CRRA 1E64A 1A82A 3M4YA 4EJSC 2FSHA 2XOKA 4LHYA 3CBQA 2WIBA 4CVNA 4YQFA 3QNUA 1VQ6B 4PPGA 3WNDA 1KDTA 4LZZA 1IAQA 3IPXA 3LDAA 2QMUA 4IW3B 1TADA 3OIVA 1Z2CA 2F1JA 4CW7A 1W0KD 4DZZA 2G88A 2VEDA 3P4YA 4DC9A 2XX3A 5SZJA 2XNDD 5KSZA 3IEVA 4NYJQ 3CPWB 4D2IA 2HF9A 3R9XA 3O47A 2NGRA 4RD6A 4TYYA 5C1BA 1OH7A 4C0HA 3QEJA 4HLCA 1Z0KA 2OHFA 3IKJA 5D3QA 1BIFA 3GJ6A 3LX5A 4A0HA 4DT1A 5JRJA 3VR2A
chains in the Genus database with same CATH superfamily
2HIMA 3PJEA 1R6VA 4F2GA 5DP1A 3MILA 1BG6A 3ZPNA 3QA9A 2BDUA 1WTAA 3P9NA 3EZLA 3I76A 3KQSA 4QUIA 3V7UA 3OPYA 2SCUB 5TVKA 3CB4A 2GXQA 1I7PA 1XRLA 2FX2A 4XIYA 2O4CA 2BUBA 5HZMA 5U9CA 1L7XA 4IH1A 1H93A 2GGSA 3IV6A 3N2KB 4ACBA 4K03A 4M1OA 4GMDA 4RY8A 1BRMA 1GZ4A 1PR4A 4HN4B 3IUBA 4JYBA 4PTYA 5D3KA 3VR6H 2YMQA 3TBFA 2R751 3WLTA 4XR6A 4PX2A 1JS1X 1NLMA 4ALKA 2OILA 4RCVA 4YQYA 4OOFA 4Q34A 2PZJA 2OOKA 4X6XA 3IA2A 3RYFB 4PRKA 1PEYA 5A5FA 1P18A 1I0ZA 3II6X 4N65A 4B3BA 4IMJB 2EZ4A 2Z5VA 2QYTA 2WHPA 2VPYA 1N05A 2YNMD 3LAWA 3DONA 4O4HA 4P7FA 4E5NA 1JG7A 4D9JA 2FK7A 3NYQA 5HW0A 4B35A 3KBBA 4LMAA 3C5VA 4YJFA 2BGRA 2HRDA 4IDHA 1B1CA 3U7QA 3W5BA 3O7MA 5AVTA 1KVTA 3T5AA 3I1IA 3CX8A 3EVEA 4JBYA 2VBFA 3L5OA 3C3XA 4U2KA 4N12A 4BQFA 2JJYA 1EHYA 3CU5A 4GKAA 1BSVA 1WCYA 1NXXA 3DW3X 4QUJA 5DX1A 1V16A 3OECA 4G25A 4NECA 2RDMA 5IVKA 1DAIA 2ILTA 3P2JA 1N1DA 5DBOA 3LPCA 2E1BA 1X86B 1FP4A 3NRJA 5EA2A 5J58A 1C9YA 1V35A 4PLTA 2NU9B 2OPHA 1KJ9A 1FXWF 2RGYA 1PK8A 1QQ5A 2FZEA 4X1KA 1U5BB 2B8TA 3EPRA 3PNSA 1QGAA 4PQFA 3KAPA 4PIPA 3WOHA 3ZHOA 1V7ZA 3TZEA 1T26A 1T5BA 3JWIA 4P3OA 3L7MA 4ND1A 4GSKA 1N5OX 2XA9A 1C9NA 2XEXA 2NZYA 3GP5A 5A5VA 4C7KA 4A0SA 5BMVB 1S7CA 2DLDA 2F2TA 2IYFA 3FSJX 1AHHA 2XQFA 4UFNA 3HZOA 2WSIA 4YRSA 1W5TA 1LEHA 2ZS8A 3U3ZA 4FN4A 3ML1A 4HSEA 2KVOA 3RPEA 2XB9A 1E3WA 2KI5A 2O6LA 3EZ7A 3Q7TA 4QELA 1GO2A 1SBHA 4A6XA 3WIUA 5IK2D 1UZMA 2XE6A 2XYRA 3F7TA 1B4DA 1WB5A 4HLUA 3UW3A 3ZTWA 2IWRA 1KQFA 2Z83A 3ZHCA 4O4IA 1HEYA 3LT5A 5JSUA 5MHTA 4FYIA 1ZL0A 4WH0A 3WLLA 3C6QA 3O8DA 3CH7A 4I50B 3HJNA 4W1RA 3DBVO 3TPFA 3H2IA 4RACA 1Q1EA 1BH6A 2HA7A 1OXXK 4TKMA 3W2HA 3O4IA 4J0EA 5IC5A 2ZB2A 1A8HA 1JG6A 1XQVA 2QPTA 2VHJA 3RV4A 4F38A 5ALGA 1EZ4A 2GPAA 5D51S 4ZTBA 3UKOA 2NU6B 1FDTA 4U7JA 4BP9A 1ZA1A 1DZIA 4C1NA 1ZUNB 3X1XA 3L5KA 4JBIA 5C3MA 1NASA 1VIDA 2QYSA 5J35A 2AQ8A 3DP9A 1ENOA 1NMEA 1CZLA 3N28A 3ONFA 4IDAA 3S27A 2CDRA 1QZXA 3EXHA 4MR8B 3CY6A 5JBIA 4P4GA 4YCJA 1CD5A 4IO1A 3TQQA 2HPAA 2WMDA 4PIMA 3WJ2A 1CFJA 4PLYA 1L7AA 1V71A 3B6IA 2PGLA 4IINA 4KFUA 1FRFS 4Q9LA 3UB3A 4LYYA 1OWNA 4M99A 2CHEA 4NYMR 3UHAA 1KH1A 5IDQA 1BMFD 3FR8A 5AKKA 3R24A 2ZRNA 5FOSA 3GQVA 3WL7A 1C29B 4Q47A 4KUGA 1HKUA 4EW3A 3O8LA 1IK4A 1QOQB 1WEHA 5EWMA 5E7MA 1Y7IA 4NCHA 3WIEA 1RLUA 5L3QA 3M6UA 1V9SA 2PFKA 3I12A 2LP4Y 3HLKA 2UUBB 1T0UA 3OX1A 4BNDB 2EAUA 4ZVNA 5BSVA 4CKBB 1CE8B 1JG1A 5H81A 1PN3A 4HN9A 4CE6A 1JQ5A 5K1ZA 3PRJA 3RAPR 4MAMA 4J0KA 1PNVA 2FUG1 2H9IA 3NYRA 4J2OA 2GBPA 4N54A 4Q0MA 4RSGA 1HETA 4YB8A 3E82A 4UTOA 1VTKA 3NHKA 1IIRA 1GQ2A 1G2IA 4YNBA 2IS2A 4JASB 5E1MA 1USVA 4ZXPA 4IIJF 4EY5A 2FW1A 3GRFA 1J2RA 3E9MA 2ADMA 4QBFA 5CAEB 3K72B 2GRUA 2JBAB 4LJ5A 2OAQ1 2ZPAA 4LOLA 2PEYA 1L5ZA 4JJZA 1A69A 1Q84A 2P9ZA 5H80A 3NYWA 1LSSA 2FMIA 5LZ5A 3B78A 2B0CA 4IMPA 3DTYA 4RK6A 1A9XA 1J00A 3EGVA 3MVEA 2J45A 4BNHA 1UC5B 1TAUA 1E32A 3BWYA 4NS4A 2ENUA 4PZYA 1RC0A 2CHQA 4AQ7A 1CIJA 4M1KA 4B43A 1BU8A 3EVDA 4XQ9A 2OXTA 1U8UA 3JWJA 1PNQA 2PRYA 4HGQA 4A6EA 5CFPA 4MIEA 2GBLC 4HFNA 4ARVA 4RJLA 1O5OA 4XDHA 4DSTA 2E2WA 2R68A 2WWHA 3ZI0A 3G68A 2FR1A 1G8FA 3FOCA 3S8YA 3IO5A 2BSXA 2CUTA 2IQ5A 3S2SA 2F90A 3K8QA 5LQMA 2IE0A 1B3BA 1NP6A 2E5FA 3ILYA 4ALMA 4YMHA 1BWQA 4KX5A 4RO0A 1PZHA 4EATA 4ZHQB 1XAIA 2QT0A 4KBYA 2IPAB 4ECEA 4KR3A 3NW9A 2B8NA 4ZVVA 4Z1MD 2VIIA 1IPEA 4LDJA 3UWSA 4TLLB 4HWOA 4C06A 5I9NA 4XLTA 1CEQA 1H66A 2PLNA 2VWPA 3MMZA 2JLBA 3TW0A 1KKUA 3VC7A 4EW2A 3TZQA 3DUFA 4OJTA 4TVSA 5L7WA 4IQGA 1XZCA 3P4UA 4RMIA 4FBLA 1WD5A 1RWQA 1YS2X 3MJEA 3RYTC 1I94B 3UPUA 4ZOLB 4B46A 3GJ4A 4QSMA 4QU5A 2PQ6A 5JJ5A 3SSAA 3UAVA 4L76A 1DBPA 2G83A 2G70A 4X71A 4XUDA 3AI1A 4G8JA 3ASRA 3W5UA 1SC6A 1U4NA 4ON9A 4X90A 3UAYA 3EPKA 3BIJA 4LF9B 4Z4EA 3FDZB 2ZBQA 4EZEA 2GX6A 2XA2A 3MB5A 5IDVA 1MAVA 4AULA 1HE5A 5DWDA 1VLMA 2BW0A 4MIOA 5F1YA 1VQNB 3SU8A 2DR2A 1D8AA 2VP0A 1Q7BA 1YBMA 2FUCA 5DNAA 4E0FA 2O1SA 4UTVA 2O8FB 3WK6A 4X6LA 3MWFA 4PGMA 4F9EA 5FO1A 1N3LA 2AT1A 1Z22A 3K20A 4XYEA 3AUYA 4BO1A 1SM4A 1LPMA 2CGEA 3PQ3A 4EVRA 2AFVA 2X2EA 3F7OA 2GASA 3NEJA 3WO0A 1L7DA 5AVUA 1WOPA 3V00A 3G9ZA 3K1YA 1NGSA 3D6AA 3QMPA 1M5TA 3B6KA 4I46A 4DXDA 4G0PA 4JU8A 1RLTA 5FPTA 3NHWA 2WZDA 1ARZA 2I1VB 1UEJA 1XLTA 2V5UA 4G7XA 3DZGA 4IYJA 4CM9A 5K6RA 1QYRA 1KY4A 1LPNA 2C2XA 4Z86A 3TSYA 4C4AA 4GRIA 1T9CA 4INZA 2C57A 2CXUA 2C9YA 4A91A 3RUHA 4UVIA 1RM0A 1WP9A 1DXHA 4JX9A 1E3JA 4QYXA 1P3Y1 1Y9DA 5FPYA 4XYLA 1RFLA 5C5IA 3KSRA 5FXMA 5B5SA 2PANA 5DXAA 4CLOB 1VL1A 3KTAA 1VCHA 2Z0MA 2C7GA 2IUSA 2B7CA 2YYZA 4A0RA 3UK2A 4JLWA 2Q6LA 3UB2A 4XGIA 4ARAA 3QU5A 5D7NA 4AUKA 4DUPA 3LL7A 2B35A 4GWGA 3CPSA 4UZSA 4A23A 4BB9A 1FUUA 4ACAA 3OQ6A 4C29A 2PUAA 1S02A 1NOKA 2C4TA 1XTPA 4GYYA 4KLRA 2PVSA 5AW4A 2ZATA 2ZIVB 3ROEA 2XE4A 3R9WA 2J08A 2Q07A 3GB9A 3MT9A 5DHSA 3U81A 3IVMA 3L77A 4G36A 3I8SA 4LNHA 1YO6A 4DUGD 4PHHA 3NTXA 1QH9A 3HJCA 2QK4A 1EGHA 4Z3DA 2BTOA 3UUEA 1V6SA 3CRVA 4KPGA 5F7ZA 4RTSA 1RI4A 2TS1A 3HO8A 4FMCF 4GOXA 4M1MA 1Z0JA 1Z4JA 3JQAB 3V1LA 3WO1A 3SD7A 3EUAA 2FNAA 2DX7A 2BV3A 1QJCA 4S1WA 5KYVA 3FCSB 4DQXA 1E94E 5DV9A 1F8UA 1NW6A 3I55B 2P78A 1V96A 2WHYA 1V2HE 3P0FA 3B2NA 3U7IA 5AKZA 3B5JA 4R8SA 2P9EA 3WNBA 4AG5A 4D80A 2ZSBA 1HFKA 1XBTA 5IH3A 3FFAA 3L04A 3QWBA 1UDBA 5LXTA 1Z5PA 4MQ4A 4V02A 2O5EA 3RAEC 1AU9A 1W87A 3PCRB 3Q4GA 4DMMA 2GPJA 2QNBA 4EEKA 2NQ8A 5IBCA 2IHJA 3C8HA 2NMVA 4J0HA 5DNYB 1NJ1A 3GJYA 5C8XA 2P75A 5LLTA 4I0WB 1ZM4A 1MJGA 1PT9A 1AHNA 4Y0VA 2NUBA 3H5NA 1LBHA 2LTAA 2JCYA 1MKYA 3EZ9A 1O03A 1NYLA 3GAAA 1OBCA 1Z63A 3GI1A 3FZYA 2OORC 3DXZA 4WBNA 1JDBC 2GTPA 3ZZMA 1XJWA 3T7IA 4A6DA 1U7TA 3SJZA 2I5PO 2QRZA 3C6KA 4JR2A 4A8PA 1A2KC 5AVRA 2OHJA 5C52B 2AQHA 4DLXA 2XRMA 4BFXA 1Q86D 4G85A 1YVUA 2VPZA 1SEPA 1ETHA 1UWLA 3FNIA 4MVJP 3N0XA 2G8NA 3QITA 3RF6A 5FOQA 3G89A 1XEXB 2ZTNA 1U2DA 1U7HA 4R1QA 5ITSA 5LMUB 2CNLA 4HADA 5KQRA 4G8DA 2MINB 2Q0HA 2Q8PA 1XNRB 1CJVC 2ZI7A 2RC5A 2XUHA 4L4XA 1Z9BA 1ZSNA 5HF9A 2OCAA 1W4BA 3T3MB 3CF4A 4XIGS 1NVXQ 1G5QA 3WQSB 4C87A 4DE5A 4M0EA 1DT3A 3BE6A 2FPKA 1E89A 4I4TF 4HAOA 3LY5A 1MEOA 1R74A 1NUAA 4LJ7A 2GETA 3N86A 1OLOA 4FT2A 4U6SA 2Z58A 5EJ2A 5BN3A 4MV4A 3AJRA 2AE2A 5L4NA 4W5RA 3VJRA 2NVWA 2YOGA 3IGFA 5L3SB 3ZDXB 4PYIA 2LNDA 1MOPA 4W1SA 1ZI6A 3U09A 2GNPA 2YWGA 2PL3A 5EZYA 4IFTA 3S2EA 4ZO9A 3DZIA 1IWOA 3GP8A 1XQ9A 1W19A 1UWKA 2Q4TA 3EQ9A 3ISVA 1Q0ZA 2YVUA 3PQ8A 1ZJ6A 2H59A 5BSTA 5C4MA 3ZU6A 5EJ9A 4ETIA 4OREX 3AH8A 1DKUA 2EW2A 2GDZA 1A5SB 4MYDA 1UEIA 2E1PA 1R8XA 1KJNA 4JJAA 1BQ4A 5HTOA 1CEEA 2FOLA 2X23A 1KU6A 2X77A 3RYCA 3UKJA 1MW9X 1ISGA 3ENKA 3K1TA 1E5XA 2EBFX 3A0UA 4BZPA 1KAQA 1Y48E 1R5NA 1P2UA 1OZ0A 2HRQA 4R2HA 4B47A 3JQGB 4QQNA 4LX0A 1A4XA 2XUKA 3ZBTA 2CXQA 5TX7A 3MQ2A 4YJ3A 1H05A 2WSBA 3WIDA 5ALJA 4JI4B 5DN6D 1UJNA 3NP9A 4B7AA 3HI6A 2IFTA 4EX6A 4E22A 4IQ0A 4RYDA 1BJKA 4YALA 3AERB 4Z9FA 1V26A 4AN0A 1ZFNA 3T5PA 1Q6YA 3MQFA 2DBRA 1WQ3A 1TZJA 4RGVA 5CLGA 5ICEA 4LF7B 2UUAB 3TLGA 2VDOB 4Z0PA 1UJ2A 1M90D 1Z6PA 2FN9A 2ARKA 3E6AA 2G17A 3R3VA 5GJCA 4JC8A 4BMZA 1KPIA 1X7ZA 1F9AA 1C0EA 1OILA 3CO0S 3WTCA 4P25A 4NNOA 1M1UA 4E1VA 4E5YA 5F4ZA 4KPYA 1UM8A 5A03A 5GZ3A 2CLLB 3VYWA 1HF3A 2Z04A 2ZXFA 4X92A 5EKTA 3LHDA 5HR5A 1SUIA 3CN7A 5IAOA 4NKRA 2B9EA 4RXMA 2A14A 3W5CA 3NGMA 2PT9A 2ZBFA 1P1KA 1CETA 2BGNA 1XMJA 1YIJB 1N3IA 4DDMA 1YB2A 5F2KA 5EJ8A 5AYVA 1K6JA 2G7ZA 4XZ3A 3LQEA 4GQIA 3WGZA 1UP6A 3M82A 3ZE6A 2UXBB 2DQ4A 5IZ4A 1PGQA 1TKRA 2HD4A 4JVOA 5FNVB 3BE8A 2K7FA 1K8QA 2OLJA 3HWRA 1ENYA 1BHO1 1VJ5A 4N0MA 2C31A 2FXIA 2I4LA 3NYIA 4EW6A 1CUHA 3QOWA 3SN6A 2V9CA 2WP8J 4RK7A 4TV8B 1IHOA 2HBZA 4YRPA 2PKRA 2FP4B 3IBFA 3M1YA 3CZQA 3FPKA 4IUCS 4QUGA 4W9RA 3VHXB 2CWWA 3WP1B 3CZMA 3ZZNA 5I9BA 4MYUA 3BRCA 3D8TA 4TQUS 4IQFA 3TFWA 1GFSA 1KIAA 3KZMA 4TMVA 2X5NA 1E9DA 1ULAA 2ZROA 2LR0A 2NTYC 1GADO 3OQVA 2Q5IA 2OAEA 1HVXA 4D41A 2ZUBA 4GRAA 4P84A 5AVWA 3P4XA 3U39A 4UU8A 1RYFA 2E7ZA 1WWKA 1W36C 4HRVA 1U98A 1GPBA 2EX1A 2PD4A 1V11A 1Z2NX 2IZ1A 4MICA 3P2KA 5D01A 5IYZF 1QQAA 2H9YA 1Q20A 1V1MB 3SY8A 1OBOA 1REQB 2ZIWB 1FFDA 2ASEA 2EYUA 3KTDA 1P1BA 4FYVA 4FOTA 4BV9A 1UJCA 1TT7A 3HBJA 2VXYA 4IVRA 5AD1A 5IHPA 3I64A 2XKBA 3EAFA 3IULA 3EDQA 1NU6A 3IPLA 2NVOA 4YI3A 4LNUB 3SOPA 3WYEA 1IN6A 3B1KA 1MCZA 4Q82A 1UL1X 4PYQA 1CQPA 3SZLA 1RZVA 3OZTA 1JKFA 5DK4A 5GJWC 1KE1A 5IKPA 1SXHA 5C8DA 4NV1A 2P4HX 4GKBA 3L0ZA 1T29A 4EVSA 1MA3A 5CXSA 1U6IA 3EDMA 4EKDA 3H97A 1E58A 4IJ5A 1UZLA 2VL7A 2YIMA 3OJOA 1D1TA 2JNWA 3VR5D 3LF1A 4BLOA 5JH7B 4Q48A 3IL2A 3KOMA 2CF4A 1GLNA 4DLUA 4QEDA 4WDQA 5E6SB 1UPUA 1Y8CA 2YWDA 2YX1A 4RDLA 2GBGA 3VPAA 3K1AA 3CNEA 4IZ6A 2VHTA 4RVNA 1AF4A 3RAJA 6Q21A 1B2LA 2ZW9A 1WMEA 2XZOA 2VJJA 4L28A 4YCSA 2P9CA 5DSXA 1T4GA 3SFZA 1Q50A 4N40A 4MZXA 1KY5A 4L9RA 1XWWA 1DTWB 3MWKA 2PZGA 4HJRA 1K88A 3S7TA 4F3TA 2ZB3A 3CMEB 1QPBA 1SXJC 3MINA 4DSAA 1R0YA 2WQ6A 2YNMA 1DBIA 3RNLA 1ISSA 3OHMA 2X2PA 2GYVA 2MSDB 4Q1AA 1XCJA 3DXYA 2BTEA 4BUCA 1ZWKA 2VUUA 4B3DA 5BWLA 5EJAA 3WGIA 4B3GA 1G6HA 2X7XA 4OGFA 5CVDA 4U2DA 3BFKA 2XYHA 2OBFA 4O2LA 2AK2A 5J2TB 2WLSA 3DBHA 1G38A 3GFBA 3N75A 2ANCA 3R0QA 1E69A 4A4DA 1UPCA 3LYLA 1UKBA 1BKDR 4ZI3A 5K8TA 1Z75A 1FZTA 5I8PA 1FCJA 1X6VA 1U0HC 1XKQA 1FA9A 3BF8A 3HU1A 5FJJA 3TPCA 3TXAA 3C8ZA 4F6RA 3VPSA 1RQXA 1KI6B 2V0CA 2HF2A 4CUKA 4HE6A 5E7IA 4KXNA 1UJBA 2G0TA 3VVMA 4KQ9A 3C3YA 5AM4A 2OFOA 1HE1C 2ABWA 3GFQA 2RGCA 3LOPA 4RQTA 4YGXB 5HJ7A 2J67A 4H7PA 4CG2A 4FZ3A 1ZGBA 2UVPA 3EY4A 3U6BA 3ZK7A 4RZ2A 2GZMA 4FDMA 2P1DA 1VYHA 3A10A 1E7SA 3RC8A 2MMCA 5E4FA 1M1YA 3WADA 3NHBA 1SKBA 1J24A 4RK4A 1ODKA 2IK8A 3KEGA 4P58A 4CXMA 2ZSDA 2BKAA 5JZBA 1XUOA 3LH5A 3O6VA 5ERXA 4CM8B 4IUDS 5A71A 1XDGA 1YBVA 3TB4A 3H75A 3C5CA 3S1LA 6PFKA 1DCMA 2HFKA 2BBTA 2PT6A 4UJ3A 6ADHA 1G9TA 3I9V6 4D57A 3ROZA 2C88A 4XRGA 4YXFA 4G84A 3WV4A 4FSHA 1Y89A 2NZ8A 4F2DA 4W8HA 5LP6C 4FI3C 1YDGA 4TLDA 1GYRA 3OI7A 3U4CA 3V32A 4MDFA 2C20A 4REOA 4S1OA 821PA 3O8OA 4LCEA 1E1QD 1Q19A 2XADA 2V5AA 4I14A 1H6CA 4W7IA 4YP1A 1M9NA 1OFUX 3AR7A 1CS0A 4N4AA 5A5DA 1Q0SA 2DBYA 2JB9A 3I72A 5AQ1A 3BAZA 1TQ8A 4HD8A 1F0PA 4JH0A 2NYRA 3NM5A 4A7PA 2BFWA 2ODWA 1BX0A 2C9ZA 1R37A 4C9BA 3BTSA 4EK9A 4ZAGA 1GCUA 4DNQA 2LXNA 4BNLA 2F1KA 2C03A 5KJ6A 1H1LB 3L02A 4UHFA 3EY9A 5GINE 3U4HA 3M70A 5EE0A 4ZT4A 2PIDA 3P2OA 1I5OA 3EJWA 3L1JA 4ZYLA 1AQUA 3IKLA 4U8GA 4JUFA 4CLRA 4OLBA 3R2JA 3ESRA 2QTGA 3B7PA 3DWEX 1FMFA 4EH1A 3T9AA 2BKXA 5JVDA 3HKDA 1JU3A 3WQQA 1BMQA 4ZC1A 3PZBA 4DWJA 4DNFA 4RHYA 5C4IA 4ENQA 1BCSA 1KDYA 2C2GA 2X58A 1U0JA 1MX5A 3TM4A 3K5IA 2BOVA 2CFCA 5DB4A 1HYQA 3DCYA 3GRUA 2W6ZA 5HJ2A 1NMXA 4ND3A 3QE0A 2VF7A 3ZVLA 1K3TA 2CDCA 3FNGA 1PJQA 4IIUA 2BJWA 4N0QA 4DM7A 4WZ6A 3WWZA 3AEUB 3AIMA 2OB1A 3GIWA 5FPKA 4KQJA 2MYTA 2Q6TA 4U6NA 2X4DA 4JOBA 5E4TA 1PU2A 1YJ5A 1FJXA 3H5RA 3BMCA 1ZM2A 1BAPA 2NO7A 1SN7A 1P75A 3HYLA 4CIWA 1O8CA 1ZBDA 2H2IA 3LT4A 2WD9A 1Z6ZA 4HDQB 4PGGA 4CDRA 2QZZA 3HJBA 1OYWA 1T8WA 2CHFA 3OU6A 5IT9A 1IZ8A 1N57A 2D5IA 4Y6QA 3G0DA 3LHFA 3OMWA 3DE0X 1Y6GA 1VCNA 3QHAA 4IR7A 4LY9A 4WN9A 1GDHA 2ZCUA 4W1QA 4C07A 2Q62A 3QZUA 3TNYA 3CVXA 5EKSA 4GKVA 4J1SA 2CLMB 3ZDZB 4MKRA 6NULA 1IIBA 5H0IA 4D8UA 2GCNA 5DEIA 1PTJC 4BFVA 1NF8A 1DKNA 1HQKA 2PLRA 4WZBE 4YDHB 3TR6A 1M2OA 2GESA 2HSJA 1DRKA 3H4VA 4OMUA 2A5FA 5AI5A 3P19A 3GUVA 3LW7A 4MRNA 4U02A 1CVLA 3ECSA 3ANYB 3TVDA 4JGGA 4RAQA 4CR8A 3CO5A 3TMKA 4HNAB 3IRVA 4IDFA 5HSGA 4AY6A 4HVLA 4EJ0A 1JEOA 3Q6RA 1XDWA 1RYBA 2X0NA 1CSEE 3ASYA 4IOKA 2JFFA 3QXHA 1P1CA 4GXTA 3UZUA 4ENWA 1ECPA 5KKAA 2XT9A 3RNOA 3VISA 4D44A 3V80A 3FTPA 5FD8A 3B6JA 4BQSA 2E85A 3I1FA 1SCNE 1L5RA 1SCUB 2ZK7A 2AMFA 3R3UA 1XCOA 2PDAA 4MUYA 3TBHA 3WX0A 5K45A 1V7CA 2ZI6A 4YT2A 3D0QA 4JBLA 4YIHA 2EG9A 1H0KA 2DQYA 4RZXA 1IY9A 1QYWA 3FSEA 5AQEA 2KS6A 3EA0A 5CYPA 5JC8A 1E3EA 1VOTA 2XMZA 3F4KA 4C7BA 3WRXC 1ORVA 1I5RA 1W0JD 2XKKA 3CGGA 2VNHA 4EKNB 4JZYA 2EL7A 1FB5A 3NB0A 2XUJA 1MF7A 5KVQA 3H9GA 3ZIDA 1K86A 4HYTA 1UDRA 3SYMA 4CM4A 5AHOA 4G65A 3TG2A 2BE7A 3U17A 2D3NA 3W5AA 2DUMA 4O2BF 2BEVB 4HV4A 2F00A 2V97A 3SC4A 1UT6A 2R25B 1QGUB 1B2RA 1A8UA 3I9KA 4AP5A 1ZGAA 2CD7A 5B4UA 2CDAA 2PRSA 3BEOA 3NTRA 1V2GA 1J21A 4J0FA 2PHZA 2Q5LA 2XQKA 3AHDA 3SIXA 1FYDA 2H9AA 3JU3A 3FCYA 4X6UA 5LOVA 4XN3A 3H1FA 4GUAA 1ZW6A 2IUTA 4PS1A 3F9IA 4B6QA 3AF0A 4JOSA 5KNCH 3ND9A 1MX1A 2Q50A 1Z62A 3ENZA 3LX6A 4IIJB 4ITUA 2EFGA 2QGZA 1PNOA 4TKVB 1H2HA 2PQMA 2QS9A 3CVVA 1KBZA 1X77A 3UPDA 4JLDA 1OE0A 5LLSA 3N0WA 1YS9A 2OM2A 3JASA 2FU5C 2OEPA 3E1GA 2ZRGA 3BDIA 2GNOA 4ED9A 2AI1A 3BKWA 4D8XA 3OKAA 5CA0A 4YT4A 3CZRA 3Q7RA 3QA3E 3RRYA 2C2MA 4A2WA 4HJXA 1LLQA 3MN1A 5AVVA 2IY9A 4EG1A 5FTWA 1EFKA 1P4AA 2WDZA 2AFRA 4NBNA 4D9FA 3OP4A 1Y63A 3ONWA 1NY6A 2JLUA 2COKA 1KDPA 3GJZA 1ZJ4A 1VE6A 4J0DA 4MDHA 3H87A 4TS3A 3SMVA 2MWMA 1RW4A 2B1RA 4BXOA 4BJ6A 2MTBA 3CNHA 3NAMA 1NR5A 2GEJA 1K4MA 4LOIA 2MSLA 4KN5A 1ZD3A 3ETJA 3G7SA 4B34A 3KB8A 3N5CA 5HMLA 1VBNA 3ZWBA 2UXDB 1SCIA 2YRXA 3VR2D 1VC2A 1R66A 2EBUA 4OP1A 3MTIA 4QL3A 3O21A 3HEAA 5KQGA 2DFLA 3U16A 3OQMA 2Q3LA 2NV6A 1AB5A 3MGGA 2Z6AA 2R60A 4TSRA 3CC2B 2YN4A 4YHBA 2W2LA 3M9XA 4QAJA 4N5NA 1ZYUA 4P5PA 2WY2D 3ACCA 3WBBA 3PA2A 4BNXA 4D25A 2FQWA 3BWCA 4QPPA 3ZBQA 1PL0A 3KVVA 3Q9UA 2PKXA 4NS1A 4HLQB 2X1HA 1RD4A 1BNCA 5A0TA 5DPMA 3AFHA 1FTWA 2BHSA 2ZYTX 3FW1A 1CG6A 4XGKA 1NX6A 2SBTA 2ZI3A 1IU9A 1JV2B 5JCPA 2WWXA 2WLTA 3DBLB 3L2OB 1J0DA 3T3GA 2AJ8A 3I4FA 1IONA 3M2PA 2C7QA 1T10A 2WM2A 4DNPA 4Q7MB 4NEHB 4KR2A 1QGZA 1DFHA 1GGVA 1Z3CA 1RYNA 2AZMA 3FLMA 3GUCA 1AK2A 3E9YA 4OQNA 5FBHA 1UQRA 3HCAA 1QIKA 3EZ2A 4FHCA 1NSYA 2DHEA 4WFIA 3WP0A 1KYIA 5IAGA 1O96B 4WNYA 3QPDA 4AKIA 4EJMA 2IYQA 1IOVA 3LXMA 3RHSA 1KYWA 4M36A 1VHEA 4UTPA 1GZVA 4BQOA 2IV7A 2VDVE 1PYGA 2ZUDA 3KKOA 4I2NA 4Q3LA 1S2GA 2BMVA 1ZVVA 3KR1A 3R6WA 3QEMA 3LVFO 4Z53A 4IIDA 1I2DA 2QSUA 1X3LA 3GA0A 1G1AA 1Y3DE 4DCGA 1I0IA 5DDIP 3DKPA 3KL4A 4XKWA 2RI6A 1PZMA 3HA2A 3B8EA 3JRNA 4RELA 4BKRA 4CL8A 2H4FA 2XWPA 4XSVA 4NR0A 1F2UB 1N8NA 4DYHA 1V5IA 2ZJ1A 2Q9BA 1L4YA 2Y92A 4MRPA 2OPBA 5A06A 4FYJA 1K28D 5F1KA 5JYEA 3DR3A 5CEEA 5M5BA 5IKOA 3TGPA 3E61A 4FOPA 5CVTA 1NW7A 3LC7O 3O1LA 3VOTA 5BYAA 3ZIAD 5BW6B 4I5DA 5DGDA 2O8CB 1QNLA 2H2WA 2PRIA 3PFIA 4ILKA 4MHSA 1FJ2A 2FUEA 1N2ZA 4YCDA 3VBEA 4CFSA 3DMTA 1Y6RA 4HXFB 4R31A 3U19A 4KOEC 1IY1A 1BVRA 4B3IA 4P6VF 4GSYA 3JARB 1L7EA 5EJGA 3D7MA 4HEA1 4PBSA 2HWWA 1PS8A 4H7JA 5COQA 2RGDA 1M34B 4BNKA 1GQQA 1U8CB 3DWIA 4DPMA 3K0SA 5AKYA 3KO8A 3BS4A 4B6PA 4J16A 4EJSB 3PNQA 1JMYA 5AWFC 2K2QB 4HNTA 2DBVO 4GF5A 4ZV9A 1R0XA 2BN4A 3EVAA 3OX2A 3FWNA 4C03A 4JI7B 4ER5A 1DC3A 1A8PA 2BH2A 2BDTA 3D31A 1HMPA 2JKYA 4QJ5A 3RT1A 3C3MA 4EVQA 3QSYA 3LP6A 4GZ5A 1LU9A 4MNTA 1IY0A 1P5RA 1EIWA 4HBGA 3CEPB 1SNYA 3O26A 4OF4A 3E9QA 1G59A 2H57A 3AESB 2Q4EA 2WWGA 2GM5A 5JC1A 1GPNA 4PYKA 2JJ1D 2NYAA 4DM3A 2YVAA 2J46A 1R0BA 3EFEA 1L9XA 1CJBA 1PTKA 1E6KA 5KYXB 1PLKA 1YJNB 2C99A 1L8OA 1QVVA 1WXGA 2QUKA 3RSFA 8GPBA 2XI4A 3L06A 2QN7A 2UU9B 1IQRA 3QF4A 4R84A 4JVMA 3ZKWA 5LP6F 2JG3A 4NDZA 2BVNA 4ZMBA 4Q39A 1TKAA 3CQ9A 3H5OA 4HWSA 4KR7A 4IFIA 1SO8A 4L2IB 1PDVA 4IXMA 1QH1B 1NIJA 2KQUA 3DHYA 4HL6A 4R1NA 4RWEA 4E7OA 5KX5A 3TKYA 3R5HA 3TRHA 2OXEA 1NNUA 1BYUA 1J8VA 4IWNA 2VNKA 1Y98A 4BX2A 3JQPA 4LCBA 3TQTA 3SDSA 2IPMA 1GAJA 4HLUC 3WB2A 3JRXA 5DCYA 4B3MB 2IIBA 1ECFA 1UOPA 1MPTA 5HUQA 3JALB 1CQZA 2O0MA 3IDSA 1FFEA 1SBTA 1O9HA 1P29A 2QL5A 3P5SA 5JE8A 3HBFA 3HWWA 3F5MA 1SQGA 3LSYA 1I7LA 2OWDA 1QCDA 1YMUA 3AYXB 3BIWA 5DM60 1W5SA 3JR3A 1Q1BA 3GOQA 1ZAKA 3KEOA 2EYQA 1AOXA 1VHTA 3JR7A 4U3JB 3OE1A 4EX7A 5LQNA 5J4KA 1TPYA 3R5SA 4KJZA 1C8LA 1H2YA 1TX4B 3ABOB 2H5JA 3CJTA 3LA6A 4IOLA 4UNSA 3H9BA 4BCCA 3ZDYB 4TSFD 5C7OO 1ILEA 3BJZA 4BAUA 4HQRA 3FPEA 1LX6A 3E22B 3OJEA 3RUEA 2CCJA 2CZQA 3EXHC 1T1EA 3FWYA 3FNQA 2JA2A 4K9DA 1V5WA 2ZR8A 2FSUA 1OY1A 2ZJOA 3TZKA 2QTHA 2CJYA 3L6DA 3EE6A 4F9FA 2YJZA 5FWYB 1U1IA 3F5QA 1T5DX 1OX4B 4YCBA 5AK6A 3X2SA 3BMQB 5CB0A 3EIFA 2B2CA 4EW1A 2IXTA 3IURA 1Y5MA 3AI3A 3B3QA 3IJEB 4KGZA 4BQNA 2QSYA 1DWUA 1HDXA 1X1RA 2VKQA 1LDBA 5KTRA 3OCXA 2A0XA 3QXXA 4URHA 1MOQA 2X9QA 1W4LA 1EGQA 1ZO8A 3TI7A 2Z2YA 3FGZA 2MHCA 3NHPA 4HAXA 3KU1A 1G2QA 3NORA 2E6UX 5JYBA 1XQBA 1HO3A 2J9FA 1UWVA 2AXNA 1NUPA 3N8HA 2AFIE 3NJ4A 4I66A 2FG5A 3G5LA 3H2SA 4P36A 5T41A 3UMFA 5IYPA 2CNNA 1XZJA 2WTXA 3F6BX 4YWHA 1YOVA 3G0IA 4QTYA 2CVHA 4F6CA 3L0YA 1NAIA 1M1KD 2Y93A 2G71A 4JLMA 1XU9A 4UUQA 3K15A 1TM7E 2E5WA 5CG1A 3LY7A 3OTHA 3O1HB 3WLMA 1FBNA 3CE6A 2IEIA 3LDUA 2XRFA