3MCAA

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
377
Chain Sequence
KKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLGRIMFELGEIIGDAPGHRDFISGMIAAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVTVTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLRPGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation regulation/hydrolase
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 82
structure length 377
sequence length 438
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF08938 HBS1_N HBS1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mcaA02
1P2SA 1V43A 2C9CA 5J5CA 4BLQA 2GETA 3WY9A 3KKQA 3U44A 3E1YE 3QVUA 1N2CE 1JB9A 1E94E 2DBYA 2J5XA 4KVGA 3TSZA 5EXXA 4HSEA 4JLVA 1I4TD 1H8EA 1OIXA 2IYTA 2Z83A 2R65A 4G5GA 3QKUA 4PZLA 2O5VA 4B47A 2FG5A 3W2IA 1G5PA 1RRFA 2BHRA 2JJ2D 3MD0A 5G53C 5AWFC 4C7OB 4JL8A 4YAWA 1QG0A 4OK5A 5K8TA 1COWA 3CCQB 1WMSA 5FUYA 4PC6A 1G3IA 3ZC3A 5HCIA 3L0PA 2AFHE 2YWGA 4HB4A 3K0AA 1U98A 3KQNA 4ZI2A 2J59A 3LX5A 4MITA 1W4CA 2ZU6A 3RRMA 1GWNA 3FPAA 3LA6A 3LWNA 1JPNA 3L0IB 3I8XA 4QL3A 1F20A 4KSCA 3VQTA 3NBYC 1KDPA 4RFVA 4YDSA 3SE0A 4OHYA 3W2HA 1A2KC 1OH5A 1D6JA 1VQ4B 2RGGA 1KC8D 2WSMA 1DAEA 1OH6A 2ZETA 3OJXA 2RC6A 4B6EA 3N2IA 3V4RA 2FEMA 2R6DA 4DRZA 1E2DA 1XZQA 3DMNA 3GPLA 3A1TA 3BOSA 4Z8XA 5HE9A 2KB0A 1D2EA 4N3GA 3P4XA 1Q20A 1LNZA 2QUZA 5KUTA 4KU4A 5E7MA 1R8QA 1K6MA 1N6NA 1S3GA 3BJIC 1XCMA 2HEIA 4AG5A 2CNDA 2HJVA 1CS4C 3RRYA 3T61A 4Q9JA 3VR5A 4K81B 1AIPA 2W6ID 2QMOA 2GRJA 4IDQA 3ZVRA 3A4NA 4LRWA 4RZ3A 2QGZA 3LY5A 1QHGA 3QXJA 2QE7A 1J7KA 2A5DA 2O8DB 2OXRA 4LJ8A 2OT3B 2NMVA 1AS2A 2OAP1 2VNKA 2W0SA 5DHAA 1GAQA 3QXHA 3ZBUA 4G01B 3TVTA 1ELOA 4RCYA 1HURA 1TEVA 4ITRC 4GBMA 3JQQA 1OB5A 1X1SA 1LVGA 3A8TA 3GP8A 2GDJA 1H42A 2WPDA 4M21A 1JR3A 2XZPA 2BOVA 2IYZA 4QJ3A 4DDUA 3G71B 4IFBA 2VP5A 2XNSA 1BS1A 4KAXA 5GADl 1GRRA 4ZGNB 4CDGA 1II8B 1NN5A 2NIPA 2WWYA 3UKDA 5L8VA 2PL3A 2VP0A 3LVRE 1ZVQA 2HYIC 4POAA 4G1UC 3SJZA 1PLKA 1X8KA 4DCUA 2AK3A 4R7ZA 1GZSA 1KDOA 1MKYA 2OBMA 1GP2A 3A1WA 5CJ2A 3MGCA 1E9BA 4WZBE 2J9RA 2ZR0A 1CEEA 1T8UA 2DFLA 3N70A 2WAYA 4M8NE 2ODWA 4DLRA 1KNXA 2ZRLA 2O8DA 1RPZA 3O8CA 1SGWA 3ZGXA 2F6RA 2GESA 3ASZA 5C1BA 2MMGA 1LF5A 5L3QB 3QQ5A 2OCYC 2DPXA 1QUEA 4GI7A 5JBQA 1DAKA 4B3BA 2ZE5A 4LJ6A 4RKEA 3ZQJA 2GAOA 4BFVA 3DO6A 2F9MA 3W2FA 1NBMD 3NEJA 1W87A 2O8EB 3I92A 4JT4A 1QGZA 2VTKA 4M2LA 3VMFA 4M9XA 4NMMA 3OESA 4IW3B 1U94A 3KJHA 2BBWA 4II7A 3GQBA 3FDIA 5EXSA 2CRVA 5J4YA 2KE5A 1P4SA 3L8ZA 1XU4A 2BSAA 4LCBA 1P73A 1NF3A 2JLUA 3D3QA 2ATVA 1FP7A 1II9A 4OQNA 5DIFA 1NDHA 4Q4HA 1TU4A 4Y9RA 1KI4A 1NLFA 3NVAA 3UPUA 4AF7A 2ORIA 1OW3B 1XX6A 5JMTA 1IAQA 1W49A 2GQFA 2R6GA 3QFRA 1BX0A 3ONWA 5KSYA 5CIQA 1IB0A 3OZUA 1JNYA 1G8FA 4DSUA 4PPNA 3OIWA 3KZ1E 5L3QA 2DCUA 2WZQA 4TMWA 2WOJA 4KVAA 1JXMA 5FFMA 1J2JA 1T5IA 3UG7A 3GJ3A 1Y3AA 4ZCIA 4AYXA 1HQYE 3ND9A 4C0HA 4RZ2A 2X8AA 1EP2B 1CLUA 1EESA 5KHOC 5TXGA 4DLYA 2B7CA 1VCNA 3LX8A 4B34A 2XNJA 5J4LA 4UAJA 2O8EA 3L2OB 2ZRBA 1QVFB 3CCJB 2R2AA 2ZE6A 5JSZB 1LS6A 1COWD 3IBYA 4HDQB 5KO2A 4PAMA 2AXPA 2QA4B 3U4QA 1S4QA 2F1RA 4HI0E 1R4AA 1UM8A 4V0KA 5KNDA 4PAOA 1UAAA 4LBYA 1L8QA 4B75A 2ZSFA 4LHXA 4N0EA 1AGPA 4GRAA 3I73A 2FZLA 4JBWA 1YZGA 3UMSA 3THWB 2TMKA 1Z0DA 3K8YA 4LC1A 1BX1A 3AVUA 3KL4A 4B3FX 2J87A 2IYWA 3EWAA 2E87A 1CBUA 4MA4A 4ZPXA 1DVRA 2CE2X 2ZYTX 2G6BA 4PHGA 5FOTA 5GVRA 3H4MA 1DBSA 4QM7A 1R0ZA 5HCNA 2ZRNA 3SFVA 4EPXA 3VR2A 2A5FA 4DZZA 1W7AA 3CZQA 4A92A 1VKJA 2XNDD 4ZCLA 4YAOA 1G1MA 4JLPA 3I5YA 5FOWA 2A9KA 2PMKA 2JIZA 1TQ6A 2H18A 2QPAA 3FWYA 1VQOB 2WM9B 1KY2A 1IXSB 4PANA 4PHFA 5AJXA 1GVHA 1I7PA 2J0UB 2WVJA 4TT3A 5JSZA 3KKMA 4PSKA 3SHWA 4C0BA 4LYHA 3RSLA 1RYHA 1ZNYA 3GLHA 1G5RA 1ZNXA 3JVVA 3P20A 4V0NA 1XJ0A 3R7WB 4JLJA 2CL7X 2EU8A 4NH0A 3D7MA 3KKPA 2VP4A 5FPHA 4CF7A 1OFHA 1SVMA 1Z08A 3HDTA 3SYNA 5ELXA 2ORVA 3THWA 1ZJ6A 3OE7D 1IQPA 1EFUA 1DS6A 4JS0A 2EFGA 4L8GA 3VKWA 1M7GA 5EUMA 2O8CB 1DG1G 5JI2E 1Z0FA 1QFJA 1D9XA 1Z6GA 2BMFA 3CPEA 1H8HA 1XB2A 3RWMB 1FX0B 1JR3D 1OE0A 2CNWA 2GCPA 3C4JA 4FCVA 3QENA 2MSCB 4I1SA 5EZ6B 4DLWA 4GZMA 2FSGA 3THYB 2D4HA 2CBZA 4GZLA 1E2EA 2FA9A 3B1ZA 3W8NA 3RRZA 4NE2A 1ETUA 1GL6A 1SVWA 4DLVA 2F1IA 4JLOA 4XIGS 3NKVA 3B13B 2NTYC 1KSFX 1L2TA 3T15A 1FFHA 1R0YA 3CR7A 3AVOA 4BFTA 3QPWA 4BPRA 3AVQA 3AF0A 1MABA 3S1AB 3NHAA 4YMWA 1UBCA 1AZTA 1Q0UA 4V0ME 5FUXA 4BFWA 4JYBA 2WJJA 2CLSA 2OV2A 3OFNA 2XB2A 4DWJA 5HKKD 3B2EA 3U3MA 2CL0X 2C5LA 2ZRGA 2VF8A 4D6PA 3KQKA 5FPSA 1LV7A 2B8WA 4AKGA 1XP8A 3LBHA 2QBYA 3SYKA 4TSFA 1AN0A 5JZVA 3W5UA 4KFTA 2ZRJA 2R6FA 3MG9A 4AF6A 3FYHA 4JVSB 4Q02A 3T1VA 2OBNA 1BYUA 2VP6A 3WP0A 4C0QC 3T1TA 1W0KD 4MGYR 4DB2A 1WBBA 1QFYA 2X2FA 1G8PA 2VBCA 3VR1A 3ZDQA 1P5ZB 2O8CA 3ND8A 2H57A 5AR1A 3MFYA 4BE7B 3GLGA 4K8OA 4AY2A 2RHMA 1ZIOA 4TZ6A 1QUFA 4MKIA 5A4JA 3TK1A 1U2RA 4MDEA 1AKEA 4QJ5A 2ZR7A 3THYA 3RYTC 1W2BB 5DHFA 1FPMA 3FKQA 5FOXA 4U7DA 1NG1A 1G7SA 3QUSA 4A2WA 2ZJAA 3E5HA 4EPWA 2QPOA 3KXLA 1Z0AA 5JS7A 1HQCA 2UVQA 3NXSA 2WJGA 3CR8A 4IJMA 3S1AA 2Q21A 3RAPR 2CK3D 3RS7A 3PEVA 2D74A 2O8BA 1KSJA 5C46F 1B23P 2AKYA 3FJOA 1A82A 3AVVA 4DUGD 1ZMXA 3ZZUA 1R5NA 2P6NA 3TJZA 4E07A 2QAGA 1A5TA 2XITA 2A2ZA 4AG6A 5IF9A 1G7CA 2ZTSA 3FMIA 3EAQA 2ZJZA 4EQ6A 1Z47A 2QSZA 3VO1A 3PEUA 1QGYA 1MO4A 4Q48A 2B8TA 4JT2A 2GKSA 2OBLA 5GVSA 2QEQA 2ZQ5A 3WHLA 3SZRA 4UXIA 3K0SA 4JLDA 3G82C 4MKHA 5D3MB 3CC7B 4AI6A 2BJVA 1NVWQ 3R9IA 3BB4A 3GJ0A 5DE3A 4DC9A 2O8FA 4Q4JB 1UKEA 3WYGA 2RGEA 2HUPA 2DHRA 1E9EA 3MWLA 1KSGA 2JATA 4EJSB 2ZREA 1JEEA 1U81A 2VYFA 5LB4A 1YZQA 3R9XA 4M9ZA 2A3RA 1RJ9A 1CJVC 1LTQA 2EVWX 1PUIA 2A5GA 3D31A 2CCJA 3FVQA 3K0EA 5L3RA 4QHSA 3WHKA 1FTNA 4LPKA 3RS5A 1W36B 2AFIE 5JCZA 3U5ZB 4PHTA 4LSGA 2J7PA 3PFIA 2ZEJA 4LUCA 3PENA 3F5FA 4TWZA 5KSWB 2B7BA 2WAXA 3AM1A 3K0CC 5FBRB 1KI7A 3SC3A 1LS1A 2BBOA 2FFBA 2ORWA 3QPVA 1XTQA 3NHBA 2AX4A 1NN3A 4GOJA 3RANA 2NOAA 3MHPA 2F7SA 3CCLB 1F6BA 4FXPA 3EASA 1RZ3A 4EAQA 3LVQE 1PZNA 4F4JA 3MAAC 3VNVA 2QEXB 2YZ2A 3K09A 2ZYWX 3R8CA 2WWHA 4OI4A 1XMJA 3ASYA 1R10A 4OJKA 4V0MA 3TQFA 4US0R 4M1SA 1VQMB 3BD9A 3QFCA 2NO0A 2IF2A 1S72B 4R2IA 1DAGA 4D25A 4DCVA 1YJ5A 2R6AA 4DSNA 1E1QD 2F1HA 2ZS9A 4MRVA 1DE0A 1NP6A 2JIZD 4Q47A 1Z6AA 3E20A 2LKDA 3QF4A 4I99A 4QHTA 4F4CA 4LJ4A 3ETLA 5FBVB 2A7QA 3AGQA 4PHHA 5CM9C 2B21A 1J8YF 2FNAA 1HYQA 2V6IA 2YNMA 3C16C 3IBGA 4JVMA 4OQMA 1Z0JA 1JJ7A 4AKHA 2WICA 1G8HA 1ZU4A 4DKXA 2W6JA 1EWYA 1D1NA 3FMFA 1W0JA 1G4UR 4URYR 4B74A 3AP2A 1OSNA 4Q7KA 1D8TA 4RZXA 1H85A 4W5WA 4GMXA 4NP6A 2C77A 1ESNA 1LF0A 3CMAB 1KMHB 3U3OA 3V4FA 1E0KA 3ECCA 4D81A 3ZS9A 4D26A 1EWRA 1HE1C 5HZKA 2JLWA 1KK3A 4P4SB 2HCJB 4AKIA 4E09A 4J0QA 4MQBA 3U7HB 4B2LA 1G21E 2DR3A 1FNMA 3RWOA 3B9QA 1JECA 1KAGA 2CNWD 2W2VA 2ZE8A 2PLFA 1XF9A 3GMTA 2VO1A 3WYFA 1EFCA 4OQXA 1K9MD 3NC0C 1OXSC 1SZPA 5SZIA 4LOAA 1T0HB 4B44A 1VYTA 1YZKA 5JFGA 1OJLA 4A2PA 4RJLA 3AUXA 3W6NA 4MGIR 2VLIA 3HR7A 5BYJA 5E95A 2WIBA 4L16A 4P0TA 4WOPA 4A2QA 1JA1A 1JR6A 4O25A 4UQOA 5CYOA 1P61B 3TVDA 2SHKA 3LXXA 1E98A 2BEJA 1OHHA 2Z43A 4DJTA 4C43A 2PCJA 1S0UA 3JQPA 4PC1A 1ZUNB 121PA 5AJWA 1KO5A 4FMBB 1M34E 4IOJA 1Z2AA 4BZQA 2IX3A 3K70D 5F9FA 2GNOA 2REBA 4DCTA 5JECA 1DDGA 1NBME 3ZS8A 3KQHA 2LCFA 3IPYA 1M2OB 5FI0B 3SU8A 2ZIAA 1GOTA 3AKCA 4LYFA 5G3ZA 4PZYA 1QHHB 3SJAA 5D3QA 1KI9A 3A6PC 4OL0A 1CIPA 3TQCA 1SXJC 1JBKA 5L3SA 3KJGA 3KX2A 2ZVPX 1E9FA 1F5NA 2X2EA 3F3YA 2QMEA 3FTQA 1PV4A 5KPJA 1CNFA 3TSOA 2GEUA 4CT5A 2QENA 2ONKA 3A4LA 4LX0A 2C03A 2DYKA 4JLBA 1VHLA 2QZ4A 1UF9A 1G3UA 1YITB 3H0KA 3CX8A 3G0HA 3RRNA 4LDJA 4ZDWA 1X8LA 5GJVC 1GR1A 4ZIRB 2QP9X 4QFMA 5EXPA 2UKDA 4CZ2A 2GJAA 2J0SA 4B3GA 4PO8A 1OYWA 1ZD8A 3ZD7A 1IJEA 3L0SA 3OJWA 2RCNA 3FB4A 3UK6A 4MYHA 4RVCA 4MUBA 2W83A 4EJSC 5TMPA 1VMAA 1YKSA 1OGIA 2OZEA 4F4IA 1ZIPA 5K8LA 2VA8A 3EC1A 3DHWC 4P31A 1G7TA 1QHHA 2IWHA 1W36C 4PQFA 4DDWA 1DO2A 4KFSA 4QHYA 2AWOA 1EWQA 3ES9A 4KHZA 4DT1A 4F7DA 1G291 3IPXA 1P72A 2Z4RA 4EPTA 2DFTA 4DCNA 1E4YA 2OFOA 4QBHA 5KYKA 3EG5A 3M0EA 5KOYA 1J70A 3FE2A 3NH9A 1P2TA 4XWAA 4G5QA 1PJRA 3AVTA 1W35A 4FMDB 1IN8A 4JVLA 3TMKA 1BMFA 3HP1A 2OEPA 1CULC 3EXAA 1VQ5B 5TVKA 1XBTA 3WBJA 4I4LA 3MLEA 2JLXA 2D7CA 1EX7A 4ZIRA 3I55B 1GIAA 4UKDA 4YHBA 3EZ6A 3HU3A 4CT4B 1K8RA 2HT6A 3DL0A 1W2HA 2C96A 2J45A 2VHJA 3T1OA 2FDCA 4I1VA 1NMZA 2UZIR 4WVFA 1CRQA 1F60A 1UFQA 3L43A 3BWDD 5IHPA 5JRZA 1GRQA 3BC1A 2Q3MA 1F2TA 4Z1MD 1YJWB 2NZ8A 1Z28A 1E2FA 2N42A 2V4ZA 1P75A 3CO5A 3VAAA 5GV8A 2A5YB 4Q01A 4DB4A 2Y8EA 4AD8A 2JLVA 4M4SA 4ZDKA 4PZZA 3A1SA 3TR5A 4XSHA 2BMDA 2J1LA 5F9HA 1OXUA 4URWR 1U8ZA 3QPUA 1N0UA 3QF7A 2RGXA 1OXTA 1DTSA 4LK2A 5EP4A 3OZVA 1W0JD 2ZJBA 3LBNA 3LDAA 4HAXA 4C2UA 1BJKA 4FMDF 2IT1A 2GCOA 2QL6A 2AKAB 3FKSA 4ASUA 1AK2A 1GFIA 2XSZA 5KDDA 1Q21A 2OM2A 5FTNA 3WNBA 3NWJA 3OEED 2EFHB 2V7QD 4ZKEA 3IEVA 1CJMA 1IY1A 1KJYA 3VHLB 3X1XA 3OEHD 5AUPB 2F3TA 3F0TA 2PH1A 5KNBA 2F1JA 4CEIA 1N6RA 4QM6A 3DEFA 4NCKA 4RZUA 2KWIA 3ZQ6A 5FH9A 1FOEB 1E1RD 1FUUA 4P3YA 5HE8A 2CHQA 3LBIA 1TVCA 2QN6A 2VHQA 4DQLA 3EX7C 1E62A 5F98A 2V54A 4CW7A 3PXGA 5EE3A 3CUEF 5EP2A 1TQ2A 2ASEA 3CBQA 2HXSA 1E79D 3LQRA 3HU1A 4KBGA 4XVUA 5J47A 5CLQA 1XDBA 4UNNA 2FE4A 2VEDA 3BH6A 1XPOA 2BV3A 4DDVA 4JBXA 5FPTA 1NY5A 3Q7PA 3W8RA 4EUNA 4W5HA 1KKMA 4OYHA 1NSTA 5CM8B 4QBGB 5FL3A 1NKTA 5KSZA 4Q9HA 3LFUA 4L15A 1XNJA 2ZYVX 4LJ5A 3VKHA 5GJCA 1H65A 4HLQB 5CYPA 4OHWA 4C7OA 2Q6TA 3L8YA 2VPPA 3B6EA 4HUQB 1RW4A 1F2UB 4TQ9A 3PR1A 2H17A 3FHOA 4YQFA 2X3UA 1NMXA 1W4RA 3SBEA 4U9UA 2P6UA 2QQEA 4Q00A 3QJYA 1XEXB 4C0AC 1YZLA 4DLUA 1Z6YA 3ADCA 5FTKA 3CCRB 1CNEA 2HF9A 3G6EB 1YHQB 1LY1A 2F43B 4XH9B 5DI3B 5CITA 4CRWB 4GNKA 5P21A 4JL5A 4OQFA 5KDLA 3CC4B 2YOFA 1LB1B 1M74A 2O0KA 2OSBA 4US1R 1EX6A 2GZDA 1P6XA 4BFYA 2HDNB 1NIJA 2D2FA 4D2IA 5TARA 3W6PA 3U6KA 1QX4A 1KIMA 2ZUBA 1IJFA 3BB1A 5IRCD 1FMJA 3VTKA 1KZ7B 1SVKA 1TUEA 1T3LA 2H16A 4H1UA 2RGBA 2FFQA 2BF4A 2QMHA 3BFVA 3W3AA 4JZKA 1G8YA 4NL4H 2DFNA 4TQAA 3DZ8A 1ZU5A 2OLKA 5CLLA 1JQJC 3V9PA 1MOZA 4WXRA 2GEDA 5BWMA 1E69A 4OK6A 4AIIA 4MKGA 2VHTA 4XD7D 3Q3JB 1IHUA 2ZRAA 4LHVA 3MMPA 2VHCA 3TSWA 4HUQA 3VR3A 2VP9A 4PXAA 1F2UA 3SBDA 5EP1A 4NU0A 2C9OA 3ZVNA 2GCNA 5H68A 1UBGA 1XEXA 4PSAA 4G5SA 1N5JA 4I81A 1IONA 1CJKC 4EPYA 4HB2A 1VQPB 2NO1A 3U60B 1B2RA 1R2QA 3IIJA 5FOUA 3X1DA 1DEKA 1Q22A 3LLMA 1W4BA 4JLKA 3ZZTA 1N6LA 1BMFD 3CH4B 5BN3A 4JMPA 1DAFA 1ONBA 3OZWA 1EK0A 1GL9B 1R0WA 1VIYA 1KRHA 4ZCMA 1E9AA 2AD5A 2GA8A 5EE5B 2NO9A 3J81k 3ZIAD 4CEHB 3FHTA 2XZLA 1EG7A 4MYTA 1E2LA 2HYDA 5BQ5A 2RGNC 2GXUA 4A8JC 2IYQA 1W44A 4B73A 3DPUA 1II8A 3T06B 4PX9A 5JEEA 3AP1A 1OKKD 3H84A 3TUJC 3SR0A 3OIUA 1EGAA 3THOA 3BH7A 2IK8A 4TYQA 5H8WA 4Y0VA 1T3HA 3GJ8A 3CCSB 1HT2E 2Q9AA 1SVOA 2KSQA 2IC5A 3QG5A 4QJ4A 1A1VA 3EC2A 1U0JA 5AJZA 4Y0AA 4Y9UA 4WAUA 2QP4A 1QH0A 1S2MA 1YVDA 4RSGA 1SKQA 2BN4A 1ZC4A 2P5TB 3I5XA 4YMTA 3TE6A 3LNCA 5IK2A 1H8ED 2YHSA 5J40A 4ESHA 1G3MA 3DVLA 2CHGA 1T8TA 2ZE7A 4HLUC 1OIVA 2GK7A 2R6CA 4U00A 1I4DD 2ZANA 1N5LA 2ZS7A 1FP6A 3LRPA 2ODEA 1RRGA 1AMOA 2WSSA 1KY3A 3SJBA 3WYAA 4CEHA 4N0DA 3VKGA 4IOKA 3PV0A 1XTSA 1QVRA 2GTPA 1VG8A 3CF0A 2P67A 4FK8A 2WKPA 4FCTA 3TAUA 2H1LA 2Q9CA 2OK7A 2CLDX 2ZJ5A 3RS3A 1HV8A 1YR7A 2ZAOA 4AWXA 1CJTC 3CWZA 3QXXA 3C15C 4TL9A 3KXIA 3FMPB 4P4TA 2BKEA 4QNMA 2FEOA 1GAJA 4KFUA 1CP2A 3UMRA 4DLSA 5C18A 3AF2A 1M1KD 1NRJB 2CMKA 1ZC3A 3D8BA 3QNUA 4RCZA 2OK8A 1L7VC 2OCBA 4ZO4A 4C0JA 3AV0B 4NCIA 1M6NA 1E0JA 1NSFA 3ZD6A 4MGZR 2EFCB 2O0HA 2FH5B 2ZYUX 3GJ4A 1OH8A 1T6NA 3BS4A 4GT1A 4DLXA 3C8UA 3BFKA 1TF5A 2N46A 3MWYW 3LXRA 1P7CA 4KODA 3NBZC 2G83A 1JAHA 1X8JA 1JB1A 4W7SA 1NVXQ 1U9IA 5JJKA 1G64A 3A1UA 2YWEA 1VQLB 2FGKA 4OI2A 3GJ7A 1HTWA 1CF4A 1R5OA 1JI0A 2IUUA 2O52A 2R62A 4MRPA 2W0MA 4CYMA 1QGAA 2QGNA 4QGFA 2IEYA 4YMUA 3FGNA 3QOFA 5LDDC 1QZXA 3UANA 4DXAA 3CMEB 4Q21A 4Q7MB 5C4GB 2DERA 2VIIA 2QDXA 2QE7D 2R9VA 1ZM7A 3IHLA 3VX4A 1CR2A 2J0VA 2K5UA 3EZFA 4HDOB 1KHTA 2KI5A 3X1WA 4TMVA 2A78A 2JAQA 3K0CA 5EQTA 1Q44A 4K1XA 3C7KA 4UJ5A 2ZITA 3KB2A 1KQSB 1N6PA 1RE0A 3TUZC 4TMKA 2WPDD 2VNJA 1SXJE 4RD6A 5KSPA 5HXBA 3CPHA 2RGAA 4D80A 4CGZA 3KTAB 2G1KA 621PA 3X2SA 5E3HA 2BCJQ 1OGJA 1VG0B 2FV8A 3CNOA 1SVSA 3K1JA 3CB4A 4TMTA 3NDPA 3PIRA 3TBKA 2GEVA 4BRUA 4TLBA 4BFXA 2FOLA 1M7HA 4R2HA 1U0LA 4C4PA 5IT5A 2J0UA 1HH4A 4D4LA 4NYIR 3QE0A 1ZAKA 2C9YA 3C5HA 3K9GA 1KNQA 2JLSA 4NPHA 4JLAA 1Z0KA 2FSFA 4WIAA 1VQKB 4JLNA 2OCAA 3GD7A 4HDCA 3N5CA 4K46A 2EW1A 5JHGB 5CK4A 1M90D 3R7WA 2WWXA 1TF2A 2RHDA 3BRWD 4PC3A 3QEOA 3IQXA 1QVAA 4ON9A 2YC4C 4LHYA 5BN4A 3I8SA 4JSYA 1BKDR 4RD3A 4HAYA 2HF8A 4B3DA 4WZ6A 4BFZA 3A4MA 1IN4A 3I56B 2OAQ1 3IQWA 3PQCA 1KTVA 1GILA 4W5JA 3SHFA 4P4UA 1E2GA 3EIEA 3WP1B 2FWRA 4DHEA 1FX0A 1TPZA 2D7DA 1J99A 1E6CA 4TYPA 4URUR 1JA0A 2WJVA 2FSIA 721PA 3KTAA 1NY6A 4URVR 3AVWA 1NVVR 3NTUA 2RKOA 2PZGA 4LYJA 1WE2A 4Q5IA 3W2GA 4MGKR 5EXTA 2JLRA 2HCBA 5G41A 2PCLA 2GWHA 4DLTA 1SXJB 2IYUA 5HPYB 3SJCA 2BJWA 1HEIA 2IYLD 4OHVA 3QI2A 3Q7QA 4YALA 1TUIA 1TU3A 5B2ZA 3CCVB 2ZJYA 3P26A 1QF9A 1VECA 4B3XA 4DSTA 4HUTA 1KI2A 1BQEA 4QNRA 3CIOA 1P2VA 3AKDA 4NYJR 5DH9A 2GXSA 5J4VA 3I61A 1ZUHA 4DCSA 3GCGA 2RH5A 4LV6A 3OHMA 3AVYA 2JDIA 4B2PA 2QPTA 2DY1A 1G6OA 3RLFA 2PZEA 3LW7A 5ANRB 1ZINA 3A1VA 4MYCA 3GFTA 3PUZA 3VU9B 4BZPA 4H1VA 1FQKA 1KMQA 3UIEA 4D0LB 4M1KA 1U9IC 4D0NA 1QVGB 1KYIA 2GJKA 4RD1A 2P6RA 1W2GA 2VNHA 2QROA 2W2XA 4NCHA 4EH1A 5AK0A 3KJEA 1HY3A 4ZDIA 1D2NA 1DG3A 2ZAMA 4Z8YA 1E9DA 2WSSD 5GV7A 2G1JA 5EP3A 4HAWA 3R9WA 4LHZA 3EPLA 2GBLC 2PJRA 3MCAA 4ARZB 2GVZC 3B5JA 2NGRA 2AR7A 4OKSA 3HU2A 4ZKDA 4BGDA 3THXB 5H5JA 1SXJA 2DWQA 1GJRA 1N6IA 4DEYA 1XTIA 3KXKA 1R8SA 4X8HA 1NMYA 5BXQC 1K5DA 2O0JA 4FW9A 4O2RA 2PEZA 2ZI6A 4OHXA 3TUIC 3AEZA 3BORA 4M1YA 2YYZA 1UDWA 1IOZA 1FDRA 5BYKA 1VG9B 1N8RD 5FA6A 1G19A 1KI6B 4G5RA 2BDTA 4GP6A 5AUOB 3QXSA 4IVRA 5D3MA 3AVXA 3FFBA 1NLZA 1W48A 4KBFA 821PA 3UG6A 2XX3A 1UKVY 4QBFA 4Q4JA 5K8IA 2YKGA 3QIAA 4LV8B 2V3CC 3SN6A 4EJSA 1OT3A 1KI1A 2XZOA 3B1YA 4LJYA 1XEWX 4JSTA 3SYLA 1GKIA 1MO3A 3PCRB 1CRPA 2HLDA 4TT3D 2R6HA 4PAQA 3QVVA 2OE2A 4JLMA 3CRRA 4U02A 4OQLA 4A0RA 5EE0A 1DOAA 1AS0A 1DELA 2CEAA 2YINC 4TLCA 3DOFA 1UEIA 4IFEA 1IN5A 4IRUB 1TX4B 3GEHA 1W5SA 4R9UC 3ICQB 4MH0R 1P62B 2ZRCA 3CD6B 1VHTA 2IXFA 2ZUDA 3ZH9B 1MO5A 3NBFA 4LGMA 4HB0A 2ZRKA 4XVQA 4PGOA 3B78A 1HUQA 2QT0A 2XJ9A 4NYMR 4U5XA 3LO5A 3U7FB 4S35A 1TQ4A 1MR3F 1H8HD 2ZUCA 3CPJB 5SZJA 1JAIA 2G9NA 2JEOA 3RSOA 3QKRB 1RIFA 4HLCA 1US8B 2ZRMA 3BBPA 3P4YA 2CL6X 1S3SA 1C9KA 3E1SA 4E5UA 4EFLA 2FFAA 2RB4A 4CEJB 1I2MA 3F8TA 1KI3A 3WNDA 2JJ2A 3AVPA 1KZGB 4TYWA 5B57C 1T9HA 2J7KA 3EW9A 4Q4LA 4NHOA 1JQLB 1R5BA 4L5BA 5EUQB 1I4LD 3X1ZA 2ANBA 3OFND 3KFVA 4O2LA 4Q66C 4YXWA 2QA5A 3CRW1 3Q9LA 221PA 4DSOA 4ZDJA 2OESA 2IYRA 2QY9A 1KK0A 2Z0MA 1QFZA 1CKEA 4BLSA 4IVQA 3KB1A 1T3SA 3B7GA 2NG1A 2JJ8A 1N5IA 1UBEA 1KMHA 2BM1A 2V9PA 2ZRPA 4TSFD 1VQ6B 5UKDA 2QAJA 3CH5A 2WTUA 1WXQA 2E1RA 3Q72A 3PUVA 4P4SA 4Q9KA 4Q9LA 4A9AA 4GP7A 1JXOA 4B32A 2FPMA 1CXZA 2GK6A 3WMGA 4KI0A 4XOIA 3DM9B 2WWIA 1NVVQ 3TKLA 1KO4A 4M1OA 4NTZA 2IXEA 3QKRA 4FIDA 2QG6A 2BMJA 1GRNA 1P2UA 2D3WA 3JZAA 3KDSE 1US8A 3QEJA 2ZSDA 5HZHA 5TDHA 5JI3E 3VO2A 3QKSB 2GHIA 3RNLA 2OLJA 4P32A 3W6OA 2PLRA 3W2EA 4LPSA 4NYJQ 4BUJA 2C99A 1QG4A 1U0HC 1P9RA 1P60A 4M9QA 4Q9IA 5FUWA 2KBFA 1IM2A 5TB5A 2NZJA 1E0SA 1OF1A 2PJZA 1J8MF 4US2R 2KJQA 1Z07A 1AKYA 2EYUA 2AHOA 4RY2A 2F55A 4WXPA 2VF7A 4URZR 2VZLA 3SS8A 1UADA 4A1FA 2WKRA 2QI9C 1VQ8B 3AKYA 3B60A 2JDID 3K9HA 4IOMA 1XCGB 3MWKA 1EFHA 3KKNA 2ZI9A 5FR2A 4RKFA 1Q81D 3U3KA 4ESVA 3SQWA 2EWWA 1G8GA 1VDZA 1G3QA 2ZSBA 5DN6A 1E2KA 2ZR9A 4B33A 3PG5A 3NIBA 2X19A 2GF9A 4YMSA 3ZLJA 3B82A 3OAAA 1WRBA 4E22A 2Z6VA 2BVNA 1KKLA 1G9XA 1GO2A 4YMVA 2IS4A 2Q3FA 1SKYE 3CRZA 2WJHA 3I62A 5A0FA 2IBMA 4G1VA 3EWSA 5JWOA 1YI2B 3SOPA 1ZYUA 3EZ2A 3RVBA 3T1QA 2YOGA 2OG2A 4HAVA 3VR4A 1ESMA 1Y63A 2ZRDA 1ZM9A 1OPXA 2ATXA 1UPTA 2ZU0C 3IKJA 4PQRA 5FOVA 5CDFE 2REOA 5CB6A 3AP3A 1G18A 1FRNA 3WNCA 1TNDA 2J7PD 1TEXA 3BB3A 3PUXA 1SVIA 2FU5C 2V6JA 2PMDA 4FN5A 1ZM3A 2AK2A 5TR9A 5AN9A 4OBEA 1JJVA 2ZI5A 3I32A 3TRFA 1WCV1 4V03A 4TYNA 2FGJA 3H1TA 1E9CA 4R98A 1G20E 2QRZA 4EDHA 3RDPA 2OUKA 4HATA 4RD4A 4IXMA 1A2BA 1VPLA 1HT1E 1K8AD 4Q03A 1WP9A 4X8MA 1YR8A 2MSEB 3U44B 3CNNA 5JEDA 4ERNA 2W00A 4RD2A 2LKCA 2EWVA 4A8JB 4PR0A 3CXCB 1G41A 1XMVA 4GSYA 2RMKA 2Z4SA 2WMOB 4N3NA 2IYYA 5H1YA 1SULA 3W90A 3VFDA 1ZUIA 4C0LA 1NNEA 2BGIA 1NBMA 2WBLC 4HAZA 2CCGA 4PSVA 4AKEA 2XOKA 2HLDD 3DM5A 3ZYCA 1J90A 4D0GA 1P9NA 2WJYA 1SKYB 1BH2A 3CC2B 5DSZA 4KSBA 1L4UA 4ILEA 4QGAA 4Q4AB 5LB2A 5FL7A 2W6JD 1Q3TA 2IS1A 3TH5A 3K0AB 1AQUA 2H92A 4L4UA 4XSGA 3VNUA 2EFEB 5EMNA 1N0VC 1OFIA 3K0FB 3WRXC 4IDNA 1TTTA 1AA9A 1Z2CA 1XWIA 5FTJA 1AQYA 1TADA 1Z0IA 1JR3E 3EIHA 3EPJA 1FMLA 1QHYA 3REFA 3E2IA 3EPKA 1T5LA 2AL7A 1CU1A 2I3BA 1YZUA 3HWSA 5KDOA 4DVGA 3QE2A 1YRAA 2WJIA 4KFRA 2PZFA 4E03A 3TR0A 1E2NA 2REXB 3U7GA 3P27A 3TIFA 1MRNA 1OFUX 3SDZA 4A0GA 2QM8A 1CQXA 1XD8A 1Z5ZA 5FR1A 4LY6A 2ZM5A 4Q1EA 2RGNA 4A8JA 3CLVA 3JVUA 2QRNA 4HZUB 3GLIE 4MYUA 2P3SA 4MRSA 5LD2B 2IYVA 4RFSB 1ZM4A 1FQJA 3KKOA 3B85A 3TLXA 2IEZA 2ZJ8A 4LJAA 2OFXA 3DKVA 4KLZA 3CONA 2KBEA 5AUNB 1AJEA 2NO6A 2PBRA 4Q4AA 5LD2C 1OHHD 3FHCB 4YXWD 1G4AE 2JJ1A 3TGPA 5J4HA 2FZ4A 2NO7A 3IHWA 1XPRA 3AQ4A 4NBSA 2MSDB 1E63A 1WBDA 3K0FA 1RC8A 5CDFA 3AUYA 4TZ0A 3CW2A 1S8FA 1RFLA 3GEEA 3M6AA 4V02A 2NPFA 3EA5A 1VCMA 2HJGA 1KDTA 3RC8A 2JLZA 3NG1A 2IWRA 4HLUA 2BC9A 2ZI3A 4HLDA 2IS6A 3W5HA 2C04A 5GJBA 1RYFA 1WF3A 4C9BA 2DWPA 3DMDA 4QG7A 4ZGQB 3U2QA 3IIMA 1JALA 2CDNA 4FD2A 1OYYA 3DZDA 4HZUA 3W5VA 5HTKA 1IY2A 1RVDA 2XNDA 3CX7A 3EZ7A 5C4MA 4RFSA 3BFXA 3UWKA 2ZRIA 2GJ8A 2UZ3A 3CF6R 3WXMA 4FWTA 2A30A 4LBWA 4B6FA 1ANKA 4YC7A 3B9PA 4A0FA 2D62A 3GLIB 1EFRA 1ZRHA 4JBYA 1G16A 1ZCAA 1KK2A 1BIFA 2PT5A 3M4YA 1VYUA 1GITA 1QBKC 1XFAA 1XMSA 3NDBB 4LBZA 2CVFA 4EFMA 5A5GA 1YR9A 1OXVA 4URXR 2G88A 1ZBDA 5DN6D 4JJZA 5DNYB 4IDHA 3DOEA 2J46A 4PO9A 3OAAD 4AURA 1U8AA 4UXJA 4C30A 3OE7A 3I4LA 3SEAA 1NL3A 1SQ5A 4Q7JB 3L82B 1TMKA 1Z06A 2GPJA 3JQRA 3ADBA 2J41A 3O8DA 3IILA 2IUSA 4V0OA 1Q1BA 2WKQA 3WMFA 1FNDA 4KXFB 1DAMA 3ZVLA 1AM4D 3FOZA 1U8YA 3RC3A 2ERXA 2GILA 4GPTA 4HB3A 1DO0A 1GUAA 1U99A 4ZV4A 2BMWA 2F43A 5DI3A 1OH7A 1Z63A 4QGHA 2V1XA 3U6BA 2EFDB 5J4KA 2QT1A 2BBTA 1XTKA 4PFSA 1TLLA 3W5JA 3VX3A 1GL7A 2YOHA 4Q4HB 2EYQA 3GLIA 2RGDA 2ZRFA 5AJYA 2VL7A 1R7RA 3U3RA 5HKKA 3P32A 1EFTA 2QTVB 4GL2A 5KSOA 3QY0A 4D4KA 2OXCA 1C1YA 2XTMA 3B1VA 1IXZA 4Q1CA 1R0XA 1D5CA 4X8LA 4TLDA 2H8KA 1E2PA 2P2LA 521PA 3CPWB 4UXHA 1BOFA 4LI0A 5SZKB 3O8BA 4KITB 4BEBA 3TW8B 3LW8A 5B58C 1W0KA 4Z51A 1VIAA 1E3MA 4IKEA 2ECKA 2ZRHA 3CRVA 4TTPA 4FMCB 5FBWB 3EIQA 2G3YA 3CCUB 5JWHA 1XJCA 1XPUA 4NCJA 4C3ZA 4MUAA 1W4AA 3GLHE 3N2EA 2XEXA 3IUYA 4BECA 5LPNA 2RC5A 2XOKD 2CCKA 3CNLA 2OTLB 4HYYA 5FBQB 5KNCA 3IO5A 2RGCA 2C95A 3B8HA 5FL7D 3U4QB 1NG9A 3T35A 3K9NA 1E2JA 2QNRA 2QTHA 3SNHA 2GZAA 1E96A 3TW4A 4DIDA 3B1XA 5M04A 3PJRA 2CK3A 3JZMA 4EPVA 5FOSA 4KCGA 3U61B 5KTYA 3FKSD 4ASUD 1TF7A 4FWIB 1VTKA 2X1VA 1XCPA 2XSZD 5FPYA 2ODBA 4DUGA 3AB3A 1HA3A 2C78A 2IHYA 4N1AA 2W2TA 4BLOA 1S1MA 3Q8XB 4GMDA 1QDEA 1Z8FA 2XB4A 4PO1A 3HPRA 3PVSA 4Q1AA 1LW7A 3AF3A 1QHIA 1F48A 1RRPA 2FJUA 3CZPA 2P0EA 3K53A 3QG1A 4D82A 2QMUA 2HMAA 3A36A 1S1CA 3QFTA 2CVHA 4FMCF 5DISB 4B3CA 1EXMA 1DAIA 1MRSA 3QBVA 4NCNA 1GTVA 5F2EA 5DI9A 3C5CA 2WV9A 2I1VB 2IW3A 2R8RA 4FCWA 3R20A 4TLEA 4XWOA 1GAWA 1UBFA 4GOXA 5E7IA 1GKUB 2LWIA 4AYWA 5B64A 3ADDA 3VHXA 2QTFA 4C2TA 4PQYA 4JVNA 3X1YA 1W5TA 1SM4A 4XJXA 1NKSA 2L0XA 3LV8A 2VRWA 2JJ1D 3GLHB 5DGXA 5DYIA 1GNPA 3WBKA 4HAUA 1CJUC 1Q86D 5CK5A 1W1WA 3GLGE 2MMCA 4IOLA 1X1RA 3I72A 2HXYA 1UJ2A 2BWJA 1TAGA 4W9MC 1E64A 4D4JA 5CJPA 2B92A 4P6VF 2DFKB 3UXMA 1IBRA 3EA0A 2D2EA 3D6TB 5DO9A 2EQBA 3OF5A 3B1WA 3TNFA 4M53A 2FN4A 1G5TA 4UNRA 2EIXA 3V00A 3FFAA 4B2IA 1KOFA 2PX0A 3BIFA 3NC1C 2FF7A 3CCMB 3GJ5A 3MUFA 2J0QA 4A6PA 4RD0A 1ZCBA 2GBLA 2Q9BA 1E32A 5FTLA 2JLYA 3PUYA 4KYIB 4OK3A 3CM0A 5H70A 4A0HA 3AGPA 1E1QA 1XD9A 5TV2A 1S96A 4G3XA 2OO7A 4HEJA 2GZHA 1WB9A 2VNIA 1GM5A 1IN6A 1PVOA 1OFTA 3SFZA 2ZJOA 3LH5A 1IN7A 1MABB 2IF0A 2ZI7A 2CXXA 4DBLC 1M1YE 2GVDC 2GXQA 2Z5FA 4UJ3A 1GG2A 1EFRD 4M1TA 4EFNA 4Q18A 4DQKA 2QP3A 4Q1DA 2B6HA 3RS2A 2FMXA 1OLOA 2VSXA 4BZXA 3K70B 2ZPTX 2QBYB 3QSYA 4B35A 4TTRA 4M1WA 1GDDA 4ACAA 2X77A 2HV8A 1E99A 4O0MA 1XE1A 1E4VA 4OHZA 4TMXA 4BQSA 2QTZA 5CB8A 2FSHA 2VHUA 1N3BA 4IEIA 2V8OA 4KJZA 4QRHA 1QHNA 3W9YA 3GLGB 4ZI3A 4WA7A 3BK7A 1X3SA 1FUKA 3GJ6A 4Q7LA 4ACBA 1G17A 1CTQA 2OTJB 1C4OA 4LJ7A 4BLTA 3HPQA 2C2HA 4R71A 2NQ2C 3LD9A 1G3RA 4M0LA 1N25A 4IHQA 2VP2A 3OIVA 1Z22A 5L3VA 2ANCA 2W58A 1YHNA 4PC2A 4DIEA 2VYQA 1JPJA 5AJVB 4HE6A 2BIFA 5EE1A 1NIPA 1A7JA 4DLZA 1ZNZA 2QU8A 3IDQA 2O8BB 1R6BX 4H9GA 4JYCA 3AF4A 1Z3IX 1XJQA 2QAGB 1RRCA 4MRRA 5E4FA 4UNSA 3R8FA 1Q7YD 2ZSEA 4QXAA 3PEWA 1G7RA 2FX3A 5B30A 1E2QA 1CR4A 4LZZA 1GSIA 5IDVA 4EQ6B 4XWKA 2PIAA 3FMOB 4IDOA 2WHXA 1QRAA 1MO6A 1VG1A 3OW2B 1Z29A 1MV5A 3LAWA 4KO8A 2V1UA 4LBVA 2D06A 2QSYA 1TQDA 1YZTA 3NBXX 1GKYA 4XTCS 5E7JA 2IXGA 2IYXA 2XNCA 3CX6A 2YJTD 4JKIA 2O8FB 2FPKA 4NZYA 1FRQA 2ODNA 2Q0HA 2VQSA 3CF2A 5JRJA 1UEJA 4TQUS 4PPGA 1Q1EA 4BASA 1XXHE 3EARA 4Q1FA 3U3JA 1PLJA 2YC2C 1DDIA 1X6VA 3Q85A 4BEJA 1RJ9B 2GF0A 4DEXA 1VQ9B 3H2YA 1QG2A 2OFWA 2XGJA 5GJWC 2ZVQX 4EIWA 4M1MA 4JJKA 2FFHA 1XEWY 5IK2D 5G40A 5JJLA 1JJ2B 2RAPA 1D2MA 3RABA 3LLUA 1MT0A 4F91B 4CVNA 2YV5A 3KFXA 2XTNA 1Q1QA 4EPRA 5K8UA 4BLPA 3P1JA 5FBLB 4MKFA 4FI3C 1NLYA 1W34A 1IXRC 3H86A 4G1BA 2VSFA 2ZROA 2CLCX 3EPHA 3RHFA 2V55B 3U7EB 4A4DA 1T91A 4WW0A 3QKTA 1E9SA 4TTQA 4NDZA 2PEYA 3BH0A 1W47A 3OIYA 5CIWA 4A15A 2IUTA 1V5WA 1FNCA 2XTZA 4PPFA 3T5GA 1XEFA 2ONJA 2BBSA 2FPLA 2WWGA 1NJFA 3WMEA 5DLQC 3QF4B 1FL9A 1N0WA 1P3JA 4JIMA 2CHVA 1ZM2A 1KI8A 5FI1B 3A37A 4A82A 4BWYA 2HT1A 2YWHA 3MJHA 1DARA 4QBIA 4B4DA 1M8PA 1KDRA 1N6KA 1TL7C 1XXHB 1UKZA 2P65A 3AF1A 4TL6A 3VU9A 2OCPA 3NH6A 5AUQA 1WDTA 4FINA 3ICEA 2AD1A 4OI1A 4AK9A 1AS3A 5THXA 5KPDA 1KK1A 2GAAA 4L9WA 1ZD9A 5FTMA 2NPIA 1Q1ZA 3LVBA 4LWZA 1SHZA 1XZPA 2B5OA 2IL1A 2XJ4A 2JLQA 3I1FA 3IIKA 4IEEA 3W3ZB 5C2JB 1CR0A 2N1BA 4KLNA 4ARZA 4WQMA 5EJEA 1DADA 1IY0A 4G0NA 4BLRA 4EKDA 4TL8A 2F9LA 1T0JB 2JGNA 3DDCA 3ZZ0A 421PA 3THXA 3QFSA 1M7BA 2JCSA 4A36A 3KUDA 4KYUA 2ZXUA 3T34A 3WRYC 3C41J 4Z1MA 3BAFA 3SQXA 3CCEB 3K9LA 3HR8A 3MSXA 3BERA 1UKYA 2G0TA 2ZJ2A 1Q3HA 3GJXC 3OZXA 3HYRA 1SVLA 1AGRA 1KO1A 2DEUA 1E9RA 1CR1A 1E2MA 3E70C 4S2EA 4XTRA 1ZNWA 5KU1A 3KJIA 1KI6A 4MRNA 5JLJA 3K70C 2DETA 4QKQA 3UWOA 2AWNA 3BE4A 2OILA 1Z83A 3V76A 4GFDA 1KO8A 1A4RA 1XXHA 4I1OA 1E2IA 4TMZA 1OIWA 3PEYA 4CIDA 2CJWB 3QXCA 3UMFA 1KJZA 3CRQA 1F3OA 4NYIQ 1K73D 4IVPA 1N5KA 2AN9A 1VCOA 4UNQA 8OHMA 4OJQA 3GEIA 1KJWA 1YJ9B 4B71A 4BRWA 5JWRA 4LYAA 1FW6A 3C14C 3OEEA 1GNRA 2V7QA 3W34A 4L9SA 1EP3B 3O8RA 3OEHA 3MWJA 1YE8A 1YQTA 2PT7A 1S9HA 2YVUA 3EZ9A 1DAHA 1XD2B 3L0OA 1WQ1R 2JA1A 3MJRA 4M9SA 3Q5DA 3W5IA 4D4MA 2IHBA 4WBSA 3ZVMA 1W46A 4LV5B 4IDPA 2WWWA 4LHWA 4X8OA 1E1RA 3O47A 1Q82D 3IEUA 5L3SB 3CRMA 1BYIA 4BFUA 5JS8A 1PUJA 1L4YA 1ZD1A 2P5SA 2G77B 4PPQA 4ABYA 4C0KA 4BPBA 3CKLA 3ZBTA 3GLFE 2VH5R 2QAGC 2BCGY 5FPKA 1E79A 2A5JA 4GOKA 5F3WB 1KD1D 2Q3HA 5HR5A 5EE9A 3VR6A 1A8PA 1YRBA 3IO3A 1J9ZA 3FPKA 4DDTA 1NN0A 5JJIA 4C0SA 1VCIA 3GFPA 2C98A 1II0A 2BGJA 1B0UA 2CJWA 2IA5A 2QM7A 4UNPA 4JL6A 4LJ9A 4CEJA 1Q57A 2BEKA 2QORA 1NJGA 1YR6A 1S9DA 1FNBA 3REGA 3T12A 2PX3A 5JHHB 4QGGA 3PITA 2BMEA 2DWOA 4TN1A 1U90A 1E2HA 1FZQA 4LC0A 3AH8A 1YU9A 1X86B 5JCPA 4TLAA 3GFOA 1XD2A 1Q12A 1SHKA 3KQLA 2W6IA 4BFSA 2OHFA 1PLLA 1FNNA 5TY0A 3Q5EA 4JKYA 4YDHB 3G4SB 4NONA 5H59A 4DT1B 1P9WA 1BO6A 3LQQA 2XAUA 2BPOA 5FUVA 4Q1BA 1GNQA 4V0LA 1LFDB 4YONB 1Z6XA 4G5OA 1I2DA 4HE5A 5EZ5A 2GXAA 1HE8B 2BKUA 4WZAE 1UDXA 3TAHA 3QBTA 2GJ9A 4Y7CA 5LBIA 3K09C 1YIJB 4QOSA 1OB2A 1NJID 3UATA 4YAUA 1YZNA 2ERYA 4F38A 3DKPA 1N6HA 4M22A 5SZHB 3GLFB 2G0NA 2YWFA 1VYVA 1VQ7B 2IYSA 1XRJA 3HYTA 3QKSA 1NI3A 1ZW6A 3LO8A 3ADKA 3I3SR 4TL7A 1QHSA 3M1IA 4A6XA 3SI7A 3KQUA 1SXJD 2H5EA 4F93B 2WMNB 1EP1B 2E9SA 2WIAA 2R44A 1E0AA 3G5UA 4XD7A 3PUWA 4HZIA 3RS0A 1F2TB 1JEDA 4P33A 1ZP6A 3NEYA 1K5GA 1KSHA 1KGDA 2XXAB 1KO7A 1O3YA 1RKBA 1XMIA 5G3YA 4KV9A 1WA5A 4IXNA 2I1QA 4I1UA 1DPFA 3CWQA 2CE7A 1O87A 1AZSC 1MH1A 3BGWA 4B76A 1UMKA 1D9ZA 3AKEA 4MDFA 1ODFA 1XTRA 2GCOB 2J3EA 4QC2A 2IS2A 3BXZA 1N6OA 1XTJA 2AXNA 4XVRA 4B43A 3ZIAA 3GLFA 4YAFA 1NN1A 1YJNB 3T5DA 2ZSAA 3A58B 4F92B 4TYYA 4AC9A 2ZI4A 6Q21A 2C8VA 1KAOA 1VQNB 2BM0A 1QHXA 2QQ0A 1W36D 2I4IA 4CEIB 2GJSA 2JASA 4F7WA 1OKKA 4NKRA 4YLGA 2H7VA 4Q19A 5BN5A 4O3MA 2ZS8A 2F3RA 3IGFA 4NYMQ 1NVUQ 4OI0A 4GDFA 2WOOA 1Z6TA 4Z54A 4PTLA 4PC7A 1GVNB 1OV4A 2WWFA 2VSOA 2DB3A 1T4GA 3MRSA 3KUCA 2XXAA 4B48A 5BW8A 5DYGA 3HJNA 1G6HA 1OXXK 4AYTA 1FTSA 3RS4A 3ZJYA 2QTLA
chains in the Genus database with same CATH superfamily
1M6WA 1TK3A 2H08A 1P2SA 2ZYHA 4R2XA 4A3SA 3WY9A 2I91A 4YHHB 2QVGA 4FDTA 3GT0A 1JB9A 3HO6A 4UPDA 3TTWA 4DJFC 1IY8A 2I6FA 3INRA 4HSEA 1CZKA 3K2QA 4JFAA 1XV5A 5TF0A 4JX8A 4PZLA 3N5KA 4B47A 3LGAA 4BMDA 1QPBA 2ZIWB 1P4AA 4EMUA 2Q41A 4ZVOA 5AD1A 4CQLB 1RAAA 2HPHA 4Q6BA 3IQFA 1JG6A 5G53C 1XRNA 3R44A 1F4VA 5KC9A 4RK1A 4KB5A 4YAWA 1QG0A 3F7NA 4OK5A 4YQYA 3VSEA 2OD2A 5K8TA 3ZDFA 5L53A 4EFDA 1SA0A 4DV3B 4IG9A 4B80A 3CKMA 1WMSA 4X95A 3FRIA 1I6WA 1G3IA 1A4IA 1U2DC 1OU0A 1RXSA 3DH0A 1H4QA 5A9RA 2YWGA 2PL1A 2OY0A 5ALWA 1RWWA 4HDNB 1JTFA 4TN5A 2PE3A 1NHWA 1QJ4A 1W73A 3GXOA 4MR7B 3PKZA 3KQNA 2J59A 3LX5A 3RRMA 3FPAA 4RDKA 1HNZB 3L0IB 5FI3A 3SQDA 3ZCTA 1E6UA 1C0PA 1EQUA 1TKCA 2QG4A 3R3XA 4MVJF 2D1QA 2H0QA 3AF1A 4MHSA 5EUBA 3TOXA 1V9CA 3R5KA 4WZTA 3A6GA 3DZFA 4NQZA 3W2HA 1A2KC 1R0CA 1D6JA 3DB2A 3NM4A 4FLEA 2RGGA 4WXMA 2WAOA 4NBLA 5AW5A 3TRDA 1DAEA 4C08A 4RJKA 4B3IA 5BSEA 3RS8A 2B8EA 1OPRA 3OJXA 2L17A 3D1JA 4QXPA 4XA8A 1T9GR 2R96A 1ST3A 5JSFA 2R6DA 2WT4A 1IHXA 1UH5A 1DT5A 1JEOA 4H08A 4MWEA 1XZQA 2P2GA 1PJAA 3AW9A 5G4KA 3S7TA 3GPLA 3K5IA 1OI3A 4N3GA 1FNSA 1N2CB 1Q20A 2C07A 1GRVA 1L0BA 4BIIA 2OCGA 2OPHA 2FVYA 5E7MA 3H99A 2FZGA 2VTEA 4PYRA 1XCMA 2JLAA 3MNFA 1CS4C 3MS2A 3RT1A 2E1BA 5DLYA 1JZQA 3GDWA 2QMOA 3OF3A 4N0PA 3ZTTA 4C6TA 4IDQA 1PG5A 3QRWA 1AUVA 4L73A 5H7XA 3ZVRA 5HCUA 4ERXA 1N8KA 4M55A 4RZ3A 3CSDA 3O4JA 3TWOA 1QHGA 4F2PA 5CDSA 1CQWA 1QZUA 4C4ZA 2X7JA 4NCXA 2A5DA 2O8DB 2REQB 1ATZA 1SCIA 2FEPA 2C58A 4DMRA 1LDBA 1GLNA 2VNKA 1YQXA 2W0SA 3IJPA 2H31A 5H80A 3ANLA 1MH9A 3QXHA 4ZGWA 2ZIFA 2LD4A 3ROQA 3TVTA 1XRMA 2Z2KA 4J4BA 1HURA 4ZO8A 4GBMA 2YYSA 4GHWA 3F5QA 5FTMA 1EUDB 4LYYA 1AKQA 4JXZA 5BURA 1YB7A 5IVPA 3BJEA 4QJ3A 4OO3A 5JH7A 2ZULA 4DDUA 3JQAD 1XQ6A 1M5UA 2OENG 3TX6A 2GERA 5IN5A 4DTCA 4Y2GA 1V5GA 2XR1A 1XQWA 4UEQA 4BTEA 3GQBB 4BNFA 1CZOA 1KEVA 3F3MA 5IEBA 2OYRA 5B7QA 1YQQA 1AGNA 4BVBA 3IUQA 4RQAA 4IJ5A 1QIKA 3H87A 3LVRE 1GTSA 4LJRA 4X1IB 2ZATA 1M5RA 5AW7A 4G1UC 4KQWA 1PLKA 2EEZA 4DCUA 4R7ZA 1TMYA 5C1IA 1KDOA 4H16A 4J0GA 1Y98A 4MWSA 5E9WA 3RPEA 1SBQA 2RSLA 1NASA 2V59A 2X0EA 3MGCA 1I6KA 3H7IA 3FBTA 1MOQA 1S2GA 4WZBE 2ZR0A 4WTOA 1A9RA 1CEEA 1NX9A 1T8UA 1TLTA 1UAGA 2OSVA 2ODWA 1UT6A 2XADA 1KNXA 3BRWA 4M8NE 4QVGA 1RPZA 2AUNA 3T3NA 1UJMA 5C1BA 4CTMA 1LCIA 3HWWA 2OCYC 1QUEA 2R4QA 4GI7A 5KWVA 4MR9A 2DCMA 2W6MA 4FS3A 4AM8A 4DR2B 1EE2A 1KYQA 4REQA 3NS7A 3ZHUA 2F1LA 1LBTA 4OXQA 3GU3A 3H9JA 2F9MA 4MXDA 3W2FA 4XM0A 2C3PA 4Q4DA 4NI5A 2O8EB 4JT4A 3S8EA 2O06A 1X3LA 4NDAA 4O4HA 3T51B 1TJ3A 1VHEA 2JVJA 2VTKA 3GVXA 4TZTA 5JZOA 2YVLA 2YVAA 3PYLA 2WC1A 1U94A 4OIMA 3KJHA 1RWPA 3HVUA 2BBWA 4II7A 1RM5A 1JHMA 1T3TA 2BSAA 2CF5A 1U2GC 2GCIA 4LCBA 4NBNA 1NF3A 5IBPA 3D3QA 2ATVA 2WIDA 1EU1A 1FP7A 1II9A 2HJ9A 3KR9A 1KDZA 3RRJA 4PYJA 1EVIA 1Q7CA 4F5EA 2C4VA 1M1NB 1SIOA 3EE6A 1CUIA 1TU4A 3GZNA 4J7XA 2HPVA 4TM7A 1OW3B 3VSDA 2R68A 4IXDA 5JMTA 3NGXA 1KQOA 4MI9A 5KOHA 1SQ6A 4BNDA 4UQLA 1NSYA 3AM4A 3D43A 3CP2A 1K5PA 1BE0A 4RIIA 1TJNA 1R4MA 1JNYA 1B4DA 1JEAA 1W85A 4UULA 1G8FA 5CYGA 2V0GA 4F3CA 1RPAA 4DMFA 4PPNA 3EIXA 2H2GA 5L3QA 3O75A 2CHEA 3GDHA 5AHOA 1ZX1A 5JD4A 1FTGA 3ZGZA 1ZHHA 4E21A 1JXMA 1ZVKA 4ROXA 3AU9A 3UG7A 1T5IA 3WIVA 3ZCQA 3GJ3A 4QTUB 2HDHA 3VGPA 4AYXA 1HQYE 4X7PA 2X8AA 1EP2B 5HVNA 2CWWA 3ESRA 3UGQA 3GFRA 1FU8A 3E9YA 4IJ6A 2B7CA 1Z12A 3CXUA 3AUKA 3LX8A 4HT3B 8MHTA 3QVGA 3Q3IA 1ZMOA 3OT4A 4AJNA 4D9CA 1M0WA 1WV1A 2ZRBA 3ESZA 3F1LA 3HJRA 3CCJB 5DTJA 5HF9A 5T57A 4ARSA 3G5LA 5ALLA 3AHJA 1LS6A 3ET4A 1B6GA 4QOFA 4RSHA 4LF7B 3LLVA 4CPDA 4EUSA 2G6TA 2AUMA 2AXPA 3QM1A 2QLBA 1HFKA 2FW9A 4YCCA 1A7KA 1Y1TA 1PD1A 1VLJA 3ITNA 4JJEA 5HF5A 2NAPA 2WTEA 1YNSA 3G2LA 3C8HA 3D2CA 1C9JA 4UVEA 3Q3VA 1JU4A 2B3TA 1U7DA 2EQ5A 3UMSA 5A06A 5K0ZA 3FR8A 1B0PA 2Q50A 3LDUA 3CFYA 3AVUA 1E5TA 4B3FX 1UDCA 3BJMA 4JP3A 5ER9A 4YT8A 1JLLA 2W2LD 4F86A 4A5SA 1Z7GA 2E87A 2EAUA 1NQAO 2YWJA 3KT3A 1JT2A 1YUBA 2XOEA 3PNSA 4O33A 2ZYTX 3LGXA 1L7BA 4HTFB 4F5ZA 1B1CA 3ROXA 3BWCA 1YC5A 1RWBA 4BNHA 3H4MA 1R0ZA 1SELA 2XUKA 3H2BA 4JOSA 3UUGA 1MAVA 2C2YA 4IGFA 2OORC 1I36A 3E1GA 1M6HA 2XB8A 4KQ1A 4QPZA 3VR2A 2P9YA 4A92A 1W7AA 2XNDD 10MHA 4YAOA 2IY9A 4JLPA 1Y82A 2A9KA 2PMKA 4X20A 4RTNA 3I5YA 1Z38A 1TQ6A 4XN3A 1JJBA 1SXIA 1YT5A 4UPEA 4MUNA 2WFLB 2JFZA 3VYTB 4PHFA 1T36A 2PXAA 3KQPA 1GNLA 2EKDA 3IULA 4UHBA 1ZK1A 4ZU3A 2VCEA 4PSKA 4C0BA 2FWJA 2R6ZA 3GY0A 3RSLA 2H59A 2OTCA 2ORED 3ITEA 1WPRA 4J8PA 1ZNXA 1N92A 1X1BA 2XZDA 2Z57A 4V0NA 4UVGA 2XB9A 4O4JA 4JLJA 2EU8A 1K9VF 3D7MA 4M87A 1NC1A 4FNGA 5IXYA 4MWBA 2CLKB 4FZJA 1WW3A 5FPHA 3UY4A 5DNWA 5GGYA 1L1RA 3W8FA 4BO6A 3RHSA 5C8DA 4WK0B 3THWA 2QN1A 4DNFA 5BNWA 3G23A 3OM8A 3K6SB 1ZJ6A 3UN1A 4EGSA 2DVMA 3FLMA 1M7GA 3WKDA 3PXAA 4XRGA 5JI2E 1Z0FA 1BZYA 4QYMA 1D9XA 3ECAA 2FRVA 3CPEA 1XB2A 2JFOA 4GEKA 3QE9Y 3VSBA 4EG8A 2GZ2A 4RU1A 3PJDA 4P92A 2P9HA 3C4JA 3QENA 2H1CA 1YFZA 3TXYA 4HNVA 4V0SA 5ICSA 2D4HA 2FA9A 3B1ZA 4I3GA 3RASA 3RRZA 2J3HA 4G0PA 4OP2A 4JKOA 1IRXA 1NVBA 1OWNA 1TJYA 3I9V1 1D1PA 1KSFX 3NKVA 1VLHA 2LVBA 4I7EA 1IWBB 4ES6A 4BFTA 1XRRA 3OP1A 1MABA 1Q0LA 1UBCA 2VAVA 4NV1A 2JJQA 3MUOA 1AZTA 4TZKA 5JD5A 2XUOA 3AQIA 2GTHA 5FUXA 1X15A 4JYBA 3L4BC 1TCAA 1TI7A 2CLSA 2RAUA 5HKKD 1MOSA 2VF8A 1XNRB 3KQQA 4NY1A 2B8WA 2BEVB 3UAZA 4CKBA 3Q3HA 3NYQA 1HYGA 3SEJA 2AJBA 2DX7A 3SYKA 4D98A 4F3YA 4KFTA 2J5BA 3MG9A 3VDQA 4AF6A 4JVSB 4QUHA 2VP6A 1JHQA 1NURA 4C0QC 1V6SA 4MGYR 4BO9A 2KYRA 3FHJA 1ZGAA 3H4IA 4HGPA 5HIAA 3KPWA 3LL7A 1OTXA 3QIVA 4DDKA 2ONYA 1QV9A 4X6YA 3I9FA 4K8OA 1ZIOA 3E4CA 2DKOA 1VKOA 3FFTA 2ZBFA 3HCFA 3Q87B 3IMFA 3L0BA 1QE0A 3NJ8A 1W2BB 5DHFA 5A71A 4F3NA 5HYVA 2QTTA 3DV2A 1SG9A 1NG1A 3JRXA 4NEQA 4XM2A 2VQFB 1H2AS 4XLHA 1HE2A 2AN4A 2QPOA 1Z0AA 2QR3A 1UANA 4Y7DA 5DP1A 1T29A 1BRMA 1HQCA 5A6SA 2O8CB 3RSFA 4UBMA 3S1AA 2Q21A 1CERA 1CVIA 2A33A 2A6PA 3UW1A 1BA2A 1UT5A 2ECFA 1O6FA 3BMNB 4RWEA 4JR0A 3I1YA 1KSJA 1NW7A 1RJWA 1B23P 1R4NB 2GO1A 3HXPA 1FP4A 1MVLA 4YGYA 4EAAA 1R5NA 5LLDA 3V7WA 1JDVA 2JKZA 4GE0A 2ZJ4A 5TGTA 4EA9A 5CDHA 5BR7A 5IF9A 2JD1A 2ZJZA 1BHJA 4M9CA 1UZAA 5TQJA 2HIHA 4FDUA 3HBLA 1ZI8A 2B8TA 4Q12A 4YRFA 1W88A 5KBYA 3TNJA 1H2ZA 4NJEB 4ZAFA 1LK0A 3AHEA 1PHPA 3BJZA 3G82C 3I23A 4FFVA 4MKHA 4UXIA 4ZOBA 5D3MB 5E1MA 5I4KA 3HJFA 4AI6A 4E08A 2NU6A 2NZVG 4EKYA 3I53A 5AO9A 2YMQA 3Q6QA 5EAIA 2O8FA 1UKEA 1RXEA 5A7GA 1B42A 4W5QA 2VBIA 3MWLA 2H9IA 3IVMA 4HJRA 1FW8A 5EESA 2XHZA 1F7VA 3V1MA 1U81A 1IG0A 2P9FA 2VYFA 4W8HA 4UZEA 4P36A 4M9ZA 2VJMB 2Y1LA 2AQHA 3D31A 4MX8A 1PUIA 5IH3A 2CCJA 3BCDA 3G9QA 3K0EA 1UP7A 2QUAA 5L3RA 3WHKA 4LPKA 3N0XA 4DLPA 4CM8A 1K3FA 3FDFA 3U5ZB 1IWPB 2HQOA 1YBFA 1MT3A 3E3LA 4MRMA 1KH3A 1U8UA 1DKNA 1JR4A 3O73A 3WZLA 1KI7A 2QF7A 3ULKA 2FFBA 3NHUA 1TVKB 4LKOA 4Y2XA 5BSRA 4ED9A 3RLIA 5K0BA 5ILOA 2HRCA 1VJ0A 3FF4A 3IT0A 4RX1A 4RK4A 3ZKWA 3MHPA 3CCLB 4FXPA 3AU8A 3EASA 4C6HA 4EAQA 4EYOA 1PZNA 3EVDA 3RVNA 3VNVA 2BFCB 1P18A 2J3LA 4EENA 4X0CA 2WWHA 1XMJA 4FR0A 3TQSA 4CV2A 3DPIA 2EX4A 5ABPA 4M1SA 4QOEA 4RLFA 3BD9A 2B2NA 3JU3A 2IF2A 1M67A 4MPPA 1BN7A 3DV0B 4J4HA 1O95D 2WFAA 1I18A 1DAGA 2C2GA 2H9YA 2YXLA 3ZW9A 5JC8A 1L5SA 4RK7A 1DE0A 4CLEA 3D8TA 5LZ8A 3QF4A 4G89A 1JYSA 1PO7A 4DMLA 2NUPB 4R84A 5C80A 5AVUA 4E88A 3AGQA 3FAZA 4PHHA 3RYIB 4ZK2A 2YNMA 4JVMA 2YMLA 3FWZA 2ACEA 4H7PA 4C2AA 2X8KA 1Z0JA 5K8JB 1JJ7A 1T13A 4U2GA 1OX4B 2WICA 1I0LA 1ZU4A 3UCFA 4F85A 4F9EA 1K7CA 1WKBA 3FYUA 3SSOA 2PZKA 4RPCA 4H3VA 4X3OA 5JZ9A 4PPYA 1V2GA 1PGNA 4IH1A 2AG5A 2AOUA 4OP7A 4W5WA 1EXDA 1U80A 4GMXA 4FR2A 1L8XA 1G4HA 4Z9BA 2A35A 1VSQA 2C77A 4G0YA 4YACA 1KMHB 1TEHA 1YJXA 4F45A 4WACA 1E0KA 3TZCA 5CB4A 3ECCA 1J23A 2PV0A 1BAPA 2XYRA 4G4SO 2AFIB 4KE7A 1EWRA 5G0VA 4S1VA 4JUCA 3N9IA 3NUZA 2AJ8A 4WV3A 4DW8A 3UHFA 4E09A 2YWDA 1Z34A 4J0QA 2ZT6A 1SHJA 2NYVA 4RTQA 3WWCA 5CDTA 1FNMA 1L5KA 3LZCA 2I2BA 3UT6A 3VYRB 5HW0A 3WYFA 1XF9A 1H2RS 2LZ0A 1ZN2A 3PKIA 4LRQA 1K9MD 2CWDA 3T9BA 5BWBA 1Y8CA 2BFEB 4M6WB 1SZPA 4XNFA 1DFIA 2TECE 3P8ZA 3GLUA 2B1JA 2A0WA 2VWPA 1OJLA 4NNJA 4W9NC 4FFNA 3F5SA 1KZHA 3JQ9C 2R97A 4RJLA 3QELA 2KQUA 4O1HA 4AT1A 5BSHA 1MD9A 2HFKA 1LQ2A 4XW2A 1C9DB 3FWKA 3M5WA 4MOWA 4WOPA 4EABA 3N86A 2BELA 3AG6A 3GYBA 5SYMA 3TVDA 3ACBA 4CT0A 2LV8A 4DJTA 2PCJA 2HSWA 1S0UA 4UZFA 4Y1RA 3DMYA 3FVTA 4RPIA 4FMBB 1J5XA 1V45E 3K70D 4HGOA 4ZI5A 2MINA 1GQSA 3MMZA 3QLVA 3WJ2A 1SBZA 3K20A 4DCTA 5FEUA 5JECA 2Y0PA 2AH5A 2HWUA 3KQHA 3E35A 3OOWA 3L4JA 5C53B 2HSZA 5FI0B 4HRYA 4EY3A 3CNEA 3HYCA 1RDFA 1V3VA 3ND6A 1A50B 5DBGA 1RKXA 1DQRA 2FEKA 2F64A 3F90A 1EVJA 4YCJA 1QHHB 2GYYA 3SJAA 3I34X 1HX7A 4B8WA 3TQCA 4KACA 5CXUA 1SXJC 2HHAA 1JBKA 4CHTA 3P9CA 4UM7A 9ATCA 3F5MA 3QYFA 1TYAE 2OHVA 2ZVPX 4UBIA 3GJYA 1E9FA 2QN8A 3F3YA 4A7PA 3PC4A 3FTQA 1G21B 4AL4A 1T26A 3I2KA 4LTDA 1P0IA 3RT9A 3RBZA 4HQLA 4DNXA 3TTUA 1NUUA 1QNFA 1P7PA 1K8ZB 3WMRA 3X43A 3ZCXA 4CT5A 5BT8A 5KYGA 1L5QA 2DYKA 4WN3A 3FCXA 5LC1A 3VMMA 3M5CA 3FI9A 2QRVA 5HRAA 3EYAA 5ARBA 1G3UA 4ESEA 5JNVA 3A35A 3JQ8B 1YTLA 4RZHA 3VH2A 4QDTA 1PR3A 5GJVC 4RAOA 4WKCA 2IHZA 2IYFA 3LY9A 2QVZX 4OSPA 4QFMA 5IWAB 4B3GA 1W2WB 2GJAA 2IY7A 2ZRQA 1ZD8A 3MERA 4J7UA 2V8BA 1IJEA 2G82A 3L0SA 3MGGA 4JROA 4PFKA 3VPBA 3FB4A 1XKXA 1WX1A 3BULA 4RVCA 3QYAA 2L2QA 2H2HA 2O3SA 4AY5A 4C4OA 5JCOC 1K98A 1SU6A 1BD3A 1QE3A 4JJ4A 3X1KA 2OZEA 3D02A 3AEXA 5K8LA 2OVFA 2VA8A 4BMVA 3F46A 1DU4A 3EXFB 4XDGA 5F7ZA 2BZGA 2AG1A 3GIRA 5BQFA 4ARBA 1QWOA 3QLJA 2PVSA 4PSUA 2IWHA 3RK0A 4E3WA 1W36C 2UUBB 1KMIY 2CFIA 4Q9NA 3ZN2A 4QHYA 1ZGBA 2AWOA 2RHBA 3HEBA 3SM3A 4DT1A 5EJMA 2H2IA 1IDN1 1P72A 4EG7A 1ZGGA 4FD3A 1PR6A 4YR7A 4QUGA 4UUMA 1E4YA 4Q3EA 2GB4A 5KJCA 5KOYA 5FBZA 1J70A 2QS9A 1E5VA 3HUTA 2PK3A 4G8DA 3DZBA 4WESA 4XWAA 1WSRA 3AVTA 2P4EA 2Q28A 1O08A 2FPPB 2OEPA 3HVIA 5TVKA 4YUYA 4H17A 3FMGA 3WBJA 2NACA 4Y1FA 4I4LA 3ZHZA 4X93A 3AL0C 3IKVA 3I55B 2PE5A 4UKDA 2GHRA 5BNTA 5ARDA 3HU3A 3QHAA 4E2ZA 5KWJA 5MN6A 1K8RA 2HT6A 4JOQA 2N75A 1E43A 1P7YA 2FDCA 3D7NA 3IA7A 2QYOA 4F2GA 1F60A 5LP6A 3RRBA 2JIOA 1PTKA 3N6XA 2ROQA 3UHOA 5ALPA 1CUGA 2Q3MA 2APJA 2X2PA 2YRFA 2IH4A 1C9YA 3VAAA 1P75A 4CIYA 3T1HB 2AJTA 1IOVA 3HKCB 4DB4A 3T1YB 4M7RA 1XZ8A 2Y8EA 2JB9A 4ZQFA 4M0DA 5K3FB 4EY8A 3SVLA 4PZZA 1OFVA 4F8YA 2OAGA 4YY3B 3ED5A 3JVDA 4F1KA 2YNMD 2IH2A 7REQA 4N3CA 3ZE1B 1N0UA 4HRVA 3MPUA 5CMLA 1E4EA 5EJGA 2IX9A 2ZJBA 2GARA 4RZIA 4EGQA 4N9WA 5IABA 1Y5RA 4MW2A 1BJKA 2J5RA 3D59A 2UVPA 4XUEA 3FPLA 4AROA 2QL6A 1AE1A 5TX7A 3RK4A 2HREA 4B7AA 4GQBA 4IDFA 3WL6A 3RCBA 4YYZA 3U19A 1Q21A 4YI5A 3V4OA 1K4YA 2IU6A 1E92A 2H48A 3QW4B 1RRMA 1U2SA 1GSAA 2AX3A 3M6WA 4YRQA 7AT1A 5D3ZA 4WZAA 5KNBA 1T9GS 4CEIA 1N6RA 1ZLYA 4D8VA 1OUMA 5ES3A 3JD3A 3OPNA 4RZUA 4FR5A 5DOVA 2CV1A 2OL4A 3OOHA 1FOEB 1UJCA 1RXVA 3GFQA 4UVHA 4N03A 1LLCA 5A4KA 2B0CA 2VXBA 4DQLA 1E62A 4LQ4A 2QRJA 2B2XA 3AUAA 3FB1A 5EE3A 4PE5B 3PXGA 3W78A 1A76A 3H05A 4NVRA 1IHYA 1RWMA 1YRHA 1TQ2A 1VCHA 1NVMB 2HV9A 2OP1A 1AOXA 3FVWA 5J47A 3SLDA 1YUMA 3HU1A 3LQRA 4HSGA 5CLQA 2J33A 4DGQA 5EJ9A 3P9NA 5IMSA 2H1HA 3G89A 1XDBA 4L2IB 4UNNA 1N0HA 1UFVA 3VR6D 5BPFA 5JNRA 2BGMA 2IITA 2P8SA 3BGOS 5I7EA 4UOEA 2GF2A 2BDUA 4Q9AA 5LU9A 3NRJA 2JARA 2B9EA 3OHSX 1KKMA 4TXHA 3VDNB 3VPDA 2F8MA 4F1JA 5CM8B 1BOOA 2Y6VA 1JAYA 2YV3A 5KSZA 2WD7A 2YTZA 4J0CA 2XBMA 1LK5A 4JK3A 2XQGA 5CVJA 5EMJA 4YB8A 5BPHA 1XNJA 4LJ5A 5CAEA 5IKEA 4XJSA 4LZJA 3UPDA 3L1JA 4C7OA 1DBRA 4PXYA 1WHTA 3E0QA 4AKSA 3CEHA 4NG5A 1H1DA 2XW6A 3EQ7A 3FNHA 1COZA 4D5EA 2W2PA 1MUUA 4XGIA 3TMAA 1F2UB 4DMMA 2DTDA 3FETA 1Z74A 2YIJA 3PR1A 4PQGA 4YTEA 1C4KA 4OA8A 5DASA 4AJJA 4YQFA 4AMVA 5KYWB 1P4MA 4L95C 5D6OA 4JYAB 4EG3A 3KWMA 2YV1A 3TLAA 2G5CA 1NLUA 2NT3A 3DQZA 2DZDA 3CCRB 4FFLA 3WLFA 4B7XA 4A8TA 1OLXA 1YHQB 1LY1A 5DI3B 5CITA 3PX3A 2AB0A 4YJFA 3LTNC 4GNKA 4RMIA 4A73A 3D3KA 1E9VA 4K3UA 1KQ3A 2RI1A 3CC4B 1FFGA 3GT7A 4JBGA 2YOFA 2O0KA 2J3QA 2OSBA 3ESCA 1K8YB 1QIHA 2FDRA 1EX6A 3TLGA 1P6XA 4O4LF 3NDRA 4WXEA 3K72B 3OCJA 2B4AA 4Q9DA 1QX4A 3K8QA 3OJCA 3WVNA 4TKVB 4PV7A 1WNFA 1DAPA 3R4CA 1TGVA 1KZ7B 1V4NA 2IZ6A 1SVKA 3L1VA 1BMQA 1T3LA 3PX2A 3WLRA 1L6IA 2OBXA 4JZKA 2QMHA 1U2ZA 3B3FA 4NL4H 4EELA 3DKRA 4TQAA 2PWBA 2X8WA 1CLEA 2BFAA 2NNLD 2J6CA 4R8LA 2D1SA 3V9PA 5CLLA 1JQJC 4NU5A 5EHQA 2A0YA 1MOZA 2A4MA 4ZZ2A 4DEVA 4MAAA 5ALVA 4RE6A 5BWMA 3DBHA 4AIIA 1I2AA 2V7UA 3C48A 1Z15A 3E9MA 4MKGA 2XQIA 1NF2A 4JXJA 4FTWA 4MS1A 1KJ8A 4LMAA 1O58A 4G63A 1QSGA 3BY1A 1X7DA 1RQRA 3QWBA 2CN1A 4GXNA 3PQDA 4JR2A 5DB4A 5DCUA 4B6JA 4N5DA 2AXEA 1JW9B 3RROA 5JXGA 2P2CA 3KQOA 3IAUA 3L7YA 5E9AA 4FGSA 4EA6A 5AICA 1AG9A 3O8QB 3RYCA 2NO1A 2BISA 1H0KA 2A3NA 3PQ7A 3Q8WA 2RARA 1ZQ1A 1FTQA 3FUWA 2GJRA 3TE7A 2ILTA 5FOUA 4F9TA 3N7UA 1B6RA 3ZZTA 3CH4B 2Y0DA 3H2ZA 4L8JA 1YI0A 2R5NA 1DAFA 2X8BA 1ONBA 1R0WA 4WZKA 1GL9B 2XUIA 5CFPA 1DFHA 1VI5A 1KRHA 3ZIAD 2Q8QA 4NZ9A 5AIAA 2NO9A 2EFYA 5EE5B 3FHTA 4DVJA 5I7RA 5B7NA 1UD2A 1B93A 2DF8A 2RGNC 4A8JC 4E94A 1FCJA 3VNQA 4ABTA 1XIVA 4B73A 1II8A 4KWHA 4M9UA 4PX9A 3AP1A 3TUJC 2Z58A 2C82A 5DXAA 3OD5A 1KDVA 3O0DA 3QBDA 2BKXA 4XCQA 3SR0A 2WWRA 5ECWA 1GCIA 1M0EA 3I2JA 3OIUA 4QT0A 1EGAA 4CQNA 3HP7A 3WZ2A 4BWFB 3I05A 2CDBA 3JQDA 4NAVA 1P2FA 3UAGA 1R16A 1O5TA 1QH8A 2JD0A 4TYQA 3A3PA 1T3HA 1JVNA 5AOBA 1CZHA 2WZNA 1L7RA 3DE1X 3O92A 3CCSB 5ECDA 4BNGA 4EK9A 2RHLA 2KSQA 5EFZA 1JQKA 1KFKB 1U2TA 2IYPA 4UUQA 3S29A 4AJHA 3OQBA 3BD6A 2CDCA 2NT4A 2HHJA 3CG0A 2WI8A 1Q50A 4Y0AA 3V97A 4QLBA 1M2JA 3REQB 1ST2A 1XA3A 4QQKA 4AP6A 4FIZA 3P2YA 5CB0A 1T6BY 4ZZIA 4IIVA 3I5XA 4P1ZA 4MHTA 1T6ZA 2I2XB 2QR2A 3AFOA 3TEMA 2C1XA 1G3MA 3GFSA 4TRJA 5CHYA 4E5DA 3NBMA 2VJYA 4PRYA 1GEEA 1E6KA 3C74A 2IZZA 1MZVA 2P1RA 4BRSA 3EGWA 1I4DD 3Q7IA 1NBWB 4N5MA 5F73A 5CT5A 3VDXA 3SF8B 1NF9A 1AMOA 1J24A 1XLWA 5IJWA 1KY3A 3SJBA 1JQAA 1QKKA 1RCUA 1YJCA 1TA9A 3TF5A 1SIBE 2RKWA 5KNBD 4N82A 5I9LA 1JDBC 3N6VA 2P67A 2WKPA 3V3TA 1I01A 3I2IA 3UK7A 3NAZA 1D6MA 2Q9CA 4D8YA 4CWAA 2CLDX 1KOJA 2O3UA 3SVTA 2AUTA 1HV8A 4J6FA 1ZJZA 2IOYA 3C6QA 4IIHA 3BXFA 1MJ5A 3QXXA 1E1NA 2NLOA 3L79A 4LDRA 4OHMA 4TL9A 5CFNA 3R6TA 4CCWA 3SSNA 1K3UB 4LJLA 1R9JA 3OJOA 3UMRA 5BR4A 5C18A 2Z3VA 2IIPA 3O4VA 4K28A 1N1DA 1I51A 1XG5A 1VMIA 1EPUA 2CMKA 4RCZA 1L7VC 3DMTA 2BGNA 4ZO4A 5DX8A 4GQIA 3AV0B 2C31A 5D01A 4O8CA 2WLTA 4BVFA 3O38A 3DTVD 3S40A 2F9FA 1NSFA 1R74A 2DKNA 3ZD6A 5CU7A 2RH9B 5IM5A 5JMWA 1EGMB 4MYDA 1I8TA 1X14A 5SY9A 2OQVA 3HFGA 1G60A 2Y77A 3GJ4A 4IGEA 5LMZA 4GT1A 5K1ZA 1KXJA 2FMIA 3V8VA 3C8UA 3BFKA 3GDFA 1OR8A 1Z9BA 4YRNA 3MWYW 2AQ8A 3LXRA 4KGVA 4YQZA 3R76A 4UTZA 1X8JA 1GGJA 1X7YB 2Z9DA 7ADHA 3S28A 1YONA 4AZ3B 1SC4A 4XVCA 1CYDA 3EC7A 3I8OA 5HTOA 1R5OA 1CF4A 4UFPA 1PK9A 5ALFA 2O52A 5EHXA 3SWWA 1H05A 2VJAA 5A3RA 4A0QA 4CYMA 2FW7A 3SQMA 5BR1A 1Y6JA 1M6VB 4NOLA 3QOFA 1BXKA 3UANA 2Q46A 4NDNE 4YREA 3WK7A 1WKVA 3MGBA 1HZJA 3R7FA 4ZQCB 3T5MA 4EYEA 4ER6A 2FSVA 3WTCA 1ZM7A 2C9DA 4KN9S 1CR2A 2H4JA 3JQ7B 2DU8A 5JDCC 4EB6A 2HLNA 1DJPA 4RVHA 1IRIA 4WK6A 1VE3A 1MF7A 2JAHA 5JBIA 3A6LA 3QI7A 4WLFA 1Q44A 4CG1A 4DV6B 1H0RA 1RTTA 2C92A 3ANYB 3D7SA 4UDOA 2NV6A 1ZRNA 2ZITA 3KB2A 1KQSB 1LSOA 2YY6A 3ZGLA 2AG0A 1VA4A 2VNJA 3UGTA 4RD6A 1DC3A 4W6ZA 4BP9A 3SZ3A 1K92A 1JBEA 3CPHA 3R6WA 1Z45A 5KKAA 4BFLA 1B73A 3U0BA 4DQ0A 4U7GA 2G1KA 621PA 1E8NA 2J3KA 1JHAA 3K1JA 4QIHA 3T53B 3CB4A 1X38A 3TBKA 4BRUA 5K0TA 2BZ0A 4JU8A 4BFXA 3WIEA 4C4PA 3PHBE 2C7GA 4BMNA 1PEAA 2IOFK 3AHHA 3V7UA 2J0UA 1HH4A 3C3MA 1F3LA 2W2KA 4NYIR 1SC6A 3RYHA 4BNTA 5KYYA 3TGWA 4WOBA 4JLAA 3UOAB 3GC6A 1CJSA 2FSFA 3CSSA 1VQKB 4JLNA 5CGZA 5DWQA 1LTHR 4K46A 5JHGB 4LC9A 1M90D 5CK4A 1Q77A 2W2OA 2ZJ0A 4L22A 1RU3A 3HVKA 5AKZA 3C6MA 1AKNA 1I1OA 4AVZA 1MNQA 3QEOA 1QVAA 3O8OB 1BHSA 2YC4C 5DOZA 1TM1E 3Q98A 3I8SA 3JYHA 3MGAA 4M46A 1DX9A 3EODA 4XQEA 3TYXA 5BYAA 3MWEA 1OZFA 4HD8A 2Y4NA 2QL9A 3DJYA 4JJGA 5IZCA 2BGUA 4L07A 4IIUA 1GGFA 3SHFA 4B6QA 1XZBA 4L4SA 4LW8A 4RTOA 1DKRA 2O23A 5H0IA 2FWRA 1TZMA 1FX0A 4YP1A 4TYMA 1QC5A 1UD5A 2DJIA 2IEGA 3L7BA 4H15A 5FFFA 4HEQA 4HK4A 1ZOSA 1X74A 4I1YA 1VJTA 4ND3A 3M9LA 2RKOA 2PZGA 4UUBA 4CUJA 1USUA 1UC5B 2JFYA 3D7KA 2JLRA 5EJAA 2O1WA 2IYUA 3SJCA 1JSZA 1PVVA 2BJWA 3CU5A 5FFNA 4RS4A 3PNVA 3L0CA 5FTWA 3QI2A 3T3EA 3UYKA 4IQGA 4BNUA 1PR4A 5F5XA 5CBPB 4DGSA 4U7JA 3P26A 5CDYA 4B3XA 4DSTA 2X3FA 3Q88A 2W7TA 3B3AA 3HJGA 4HUTA 1CVRA 2ZZQA 1E7MA 1P2VA 3AKDA 5FWYB 4CR8A 2C2WA 4XGKA 1HDYA 3LNNA 1PS9A 2I0FA 3H9UA 2JRCA 5AVTA 4OHBA 1G6OA 1W0CA 3RLFA 3LW7A 5ANRB 4B6PA 1LK7A 2AEFA