3MCAA

Structure of the dom34-hbs1 complex and implications for its role in no-go decay
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
377
Chain Sequence
KKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLGRIMFELGEIIGDAPGHRDFISGMIAAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVTVTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLRPGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1 alpha-like protein
publication title Structure of the Dom34-Hbs1 complex and implications for no-go decay
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation regulation/hydrolase
total genus 82
structure length 377
sequence length 438
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF08938 HBS1_N HBS1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mcaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mcaA02
1ANKA 2C96A 3I4LA 1TQ2A 4RD6A 2HLDA 3MLEA 4GOXA 3GFOA 3GJ3A 4LJ6A 3THOA 1BX1A 2OCAA 3RDPA 4D25A 3MWYW 3NBFA 3ZS8A 3W5HA 2XNSA 3CC2B 4OI4A 2FFQA 2C95A 1QG2A 5JEDA 4R2IA 4DDUA 1NJGA 3A1UA 4ON9A 2P3SA 4MQBA 1YKSA 4HDCA 3ND9A 2ZJOA 1CXZA 4MYHA 2DR3A 4OYHA 1DPFA 2VNHA 3D6TB 3EA0A 4KODA 2OXCA 1Z8FA 3NC1C 4PZLA 1QHIA 5FPKA 1W5TA 2GCOB 3VMFA 4HZUB 2GJSA 1XD8A 3TIFA 2FPLA 4R71A 1CRQA 3GP8A 4S2EA 2VBCA 3LO5A 4L9SA 4UKDA 2HDNB 2PT7A 3M1IA 3ZJYA 1M74A 1NMXA 4NYMQ 1YHNA 4U5XA 1TL7C 2GHIA 2VYFA 1X1SA 3TR0A 3L82B 4BFZA 4DLVA 5AJXA 1CIPA 5JLJA 4TMXA 2ZEJA 5EP4A 4LHXA 1ZM9A 5SZIA 3M4YA 3KJEA 4KBGA 5HKKA 1KQSB 1I4DD 1OIWA 4ZDKA 4Q4AA 1JI0A 4BFXA 2WWWA 1UEIA 2B6HA 3TK1A 1JB9A 5DN6D 1EX6A 2C9YA 1R10A 2G3YA 1VG1A 4PSKA 1RJ9A 5TVKA 2E1RA 5FOWA 5AUNB 4LJYA 1VQ7B 3VO2A 4FWTA 3TMKA 2PLFA 2J87A 3PQCA 5JFGA 4KO8A 3LW7A 3FGNA 1A1VA 3NBYC 3E1YE 2HF9A 1TNDA 3WBJA 3U7EB 1Z5ZA 3TUZC 1EP1B 1SKYE 1LW7A 2OUKA 4DHEA 4Z51A 1YJWB 3Q72A 4CDGA 1AZTA 1XXHB 3QENA 4GRAA 4GZMA 5TY0A 3AVXA 1NBMD 1US8A 1YRBA 4YC7A 2I1QA 4UAJA 2CXXA 5CM8B 2JLUA 1Q20A 4GOKA 2RGGA 4L16A 4LY6A 4CYMA 2CBZA 1XD2B 2G0TA 4RJLA 1JJ2B 3F0TA 3MSXA 3GQBA 4JBXA 3BWDD 2ATVA 3ES9A 4N0DA 4ARZB 2IF2A 2AFIE 5SZKB 1P2SA 3SJBA 3QE2A 1IBRA 1IOZA 3LBHA 4C4PA 2Z6VA 5E4FA 5BN5A 4KBFA 3HPQA 4HUQB 5JEEA 1GL6A 4F91B 1UEJA 3Q8XB 1DTSA 1CNFA 1E9CA 1YE8A 4JMPA 1XTQA 3KJHA 1IJEA 5IK2D 5KDDA 5FA6A 2JEOA 4US1R 1L7VC 1UBFA 3QXSA 1RKBA 1EFRD 1Q3HA 2MSEB 2ZS9A 4AK9A 4TYQA 1OIVA 1ZU5A 3SBEA 2HXYA 3NEYA 4YDHB 1J99A 4IW3B 3K9LA 1XJQA 1W4RA 4TT3A 3MUFA 4M0LA 1QRAA 2BC9A 1QHSA 4TWZA 1A2KC 1CJMA 2IUSA 2NIPA 3GLIE 1ZD9A 5CDFA 2ERXA 4ZKDA 1E2EA 1D2MA 3PR1A 1KI4A 1II8B 4Z1MD 2WMNB 1WRBA 3K0FA 1AMOA 3DZDA 5FTJA 1M1KD 4M21A 1DG1G 1BX0A 3A4LA 1XFAA 1FMJA 2X2FA 1HQYE 2J59A 3OW2B 3ZZ0A 1DS6A 1EFHA 2V1XA 3Q9LA 2ZUDA 1NN1A 3I8XA 4I99A 4CEJB 3BD9A 1Z63A 4JVSB 4ZI3A 2CCKA 2QENA 1S0UA 4WBSA 1QH0A 3EW9A 1IN5A 2F1RA 2J7KA 1P4SA 2W58A 1G8GA 3IIJA 5CM9C 3V00A 1WQ1R 1FUUA 1E96A 4NYMR 4TZ6A 4IEEA 4RZXA 2VPPA 2XZPA 1N6NA 1SHKA 4X8MA 5KNDA 4KYIB 5BN3A 5JWRA 1QGYA 2GXQA 3OIVA 3SC3A 2NPFA 2ZRCA 1YZUA 3C5CA 4HYYA 1ZNYA 1Q1EA 2SHKA 1OB5A 2GZHA 4LX0A 4EPTA 1JAHA 1E62A 2BDTA 3NBXX 3X1DA 3FOZA 2BKUA 3KKOA 1SVSA 4IFBA 2H16A 2FX3A 3GLGA 3SS8A 3R7WA 2R6HA 1F2TA 3TVTA 3H86A 5K8LA 4EPRA 2PEYA 2O0HA 3I55B 3SE0A 1KDTA 3LD9A 2CJWB 1YZLA 1GRQA 3RSLA 1EP2B 3RWOA 1W2HA 4GZLA 2RGBA 4RD2A 3V4RA 4UNNA 2RGNA 2QM8A 1BOFA 4A15A 2REXB 1EG7A 2ZE6A 4GMDA 1F2UB 1P5ZB 821PA 4DIEA 3DM9B 1ZYUA 3OIYA 2ZI5A 5DIFA 3R9IA 4XTCS 4F7WA 3AVVA 3MGCA 4ZPXA 2ZQ5A 5AJWA 2A5YB 3AF3A 4PGOA 1AA9A 4I1UA 4WOPA 3T34A 4DCVA 1Z6AA 4JLMA 4KHZA 1FTSA 4TZ0A 1V5WA 2PLRA 4MGIR 4Q4LA 1QVGB 2BVNA 3O47A 3VX3A 2JJ2A 1UJ2A 3E70C 3SI7A 4EQ6B 1K9MD 4L5BA 2J41A 2J0UA 1YI2B 3ADKA 4JYBA 4XSHA 1QVRA 3AKCA 3GEEA 4HATA 3AVUA 2V55B 3A4NA 1JJ7A 1LF0A 5FOSA 3VKGA 3QKRB 3IBYA 4PHFA 2YYZA 1T3LA 3BBPA 3R20A 3RWMB 3QFRA 3NC0C 1NBMA 3TJZA 5KDLA 1Q3TA 3MMPA 4LBVA 1FL9A 2A5GA 4IDPA 5JWOA 3KJIA 1KK1A 1ZBDA 4TYPA 3CD6B 4AKEA 3NH6A 3CNNA 4HAZA 5LD2B 4TLAA 3ZVLA 4B75A 1KDRA 2W0SA 3P32A 4DLZA 1NJFA 1JR3E 2XX3A 3GLFE 2CK3A 4PC6A 1W0KD 3FMOB 1IXSB 3GMTA 5KUTA 2FSHA 2JA1A 4L4UA 1RIFA 3GLIB 4O2RA 4D81A 1AZSC 1KI1A 4YAOA 4DCNA 2JDIA 2O52A 2WKPA 2GESA 4E07A 1D1NA 4UNQA 1UAAA 4M22A 2HUPA 2WJJA 1VTKA 4DDVA 3I62A 1XF9A 3W6NA 1UBGA 2P0EA 3ETLA 1RC8A 4P4SB 2BMFA 1JQJC 2ZRJA 2WOJA 1Q86D 1SXJB 2QP9X 2UKDA 2HT6A 4EPYA 1QHNA 3Q5EA 4YMSA 1YHQB 1DE0A 2D3WA 3ECCA 4YAUA 1OFHA 1WMSA 3WYGA 2ZREA 1AN0A 1EX7A 1EFTA 3QF4A 4NHOA 1B23P 4TTPA 4EUNA 1COWD 3HWSA 4OK3A 4PXAA 5JS8A 1WA5A 4JIMA 1HA3A 1TF7A 2X8AA 2LCFA 4V0MA 5DI9A 3ADBA 3Q7QA 2Z0MA 4MDEA 1EWRA 1GTVA 4E03A 4C0SA 2GILA 3U7GA 3CPJB 4B35A 3AF2A 1N0VC 4ZCIA 1S3SA 1UKYA 3CH4B 4QJ3A 2O8FB 1E1RA 1P9WA 4NTZA 3CMEB 2QA4B 1NIPA 4HDOB 5B2ZA 3PCRB 4URXR 1FZQA 2IK8A 2JLZA 4RSGA 3GEIA 5FOUA 2NO6A 4LJ7A 2GCOA 2OK7A 2Z83A 4HZUA 1KJZA 1YIJB 1LS1A 2R6AA 3B9QA 4EFNA 1YJNB 3PEUA 1G19A 3CX7A 3U5ZB 4EAQA 3B2EA 1K5DA 2HV8A 2J45A 1KK2A 3UPUA 3VHLB 5DISB 4CT5A 1U0JA 4LPKA 1BMFD 2IXGA 3PENA 2WOOA 3L0PA 2QT0A 1E0JA 4N0EA 2IBMA 3GLHA 1I7PA 1W36C 1KTVA 1ZIOA 2AN9A 2W2XA 4QGAA 1G6HA 1E63A 1Z28A 1ZD1A 4HB0A 2VLIA 4JJKA 3AVOA 5SZHB 5AWFC 3SYKA 1SULA 2CE2X 4M9SA 4M1TA 3U7FB 4DB2A 2H8KA 3C16C 4HAYA 4G01B 4LYHA 1N5JA 2RKOA 1IY1A 1XJ0A 4QHYA 1FOEB 5FL3A 3BFKA 5CDFE 1WE2A 2ORVA 3FE2A 3SJAA 3GFPA 1LTQA 3NDBB 1W87A 4B71A 3X1ZA 1HH4A 4G1UC 3LAWA 5A5GA 3W2FA 3E5HA 3RAPR 3ZZUA 2FFHA 3AF0A 4XTRA 3RVBA 2GF0A 4LI0A 4PZYA 3SEAA 3CCVB 3I1FA 3UWKA 2P2LA 2UZ3A 3KQNA 2BOVA 5BW8A 1I2DA 2VHTA 4YMWA 1LF5A 3B5JA 5KHOC 1X3SA 2XNDD 3DL0A 3UKDA 1XWIA 1BH2A 4YAFA 1C4OA 2EWVA 1U8ZA 1Y3AA 3CX8A 1KGDA 3FPAA 2VHCA 3THXB 3U3JA 8OHMA 1VPLA 3KUCA 4HLDA 4AY2A 3U3KA 4MRRA 2BKEA 1L8QA 4QJ5A 3RHFA 2BGIA 4DLTA 2B7BA 4PC3A 4B76A 2KI5A 3NEJA 2X19A 1XE1A 2EFGA 4BLSA 2D7DA 3CUEF 2P6RA 2F3RA 3CONA 5AUOB 3L2OB 3BB4A 3CRVA 2HYDA 3CBQA 4HUQA 4Q1EA 2GA8A 2ZE8A 2YC2C 3QFTA 1Q7YD 2X77A 4XJXA 5AJYA 4LJAA 4EPVA 4CEHB 1KI6B 3G6EB 4D6PA 3W8RA 1FNDA 4V02A 3VR2A 1WP9A 3TSWA 3DZ8A 1SXJD 2VHUA 3OF5A 2RGNC 2QZ4A 5DLQC 2IWHA 4LC1A 2ZJZA 3NKVA 4AWXA 5GV7A 1Q82D 3AVYA 3QNUA 3WHKA 1Q81D 2F1JA 3WHLA 1GNPA 3KTAA 2OCYC 1AS3A 1ESNA 3IHLA 1VIAA 1DAMA 1WBBA 2QPTA 2R6FA 2KWIA 2RGEA 4Y7CA 5JRZA 2WWXA 2D62A 2QTZA 2JJ1A 3QG1A 3T15A 5FPYA 3MWKA 1N2CE 2G0NA 3O8DA 4AURA 2P5TB 3BH7A 2A2ZA 2QL6A 4KFSA 1MH1A 2BMWA 2C98A 3RS5A 2VIIA 3W6OA 2QEQA 2QMEA 1T9HA 2ASEA 3H84A 3B60A 3KJGA 2XNCA 1VQLB 3C5HA 1L4YA 3D7MA 4RVCA 1VQOB 1BIFA 2VQSA 2KE5A 3IIKA 4FMDB 4LRWA 2RHDA 2AFHE 5J4YA 3OZVA 1COWA 1XTRA 1ZP6A 2CE7A 2GZDA 2WJGA 4LK2A 4TLCA 4Q9HA 1SVIA 4A0FA 5KO2A 1KI9A 5E95A 3NXSA 2DWQA 3LX8A 1NBME 4U00A 5AJVB 2RC5A 3CCSB 2IA5A 3KXIA 1GO2A 4Z54A 3AVTA 1Z6TA 1JECA 4EKDA 4BFTA 2IYZA 4G1VA 1CF4A 3WYAA 5D3QA 2XGJA 4EIWA 4OL0A 5GJCA 1U90A 1TX4B 3W2GA 2JLQA 3L43A 4JL8A 1GL9B 3RNLA 2DERA 3CWQA 1UDXA 2P67A 4Q47A 1YITB 1W2BB 4Q4HB 1XZQA 5EXSA 2BBSA 2YKGA 4IEIA 1NLZA 3D31A 3NWJA 4KJZA 1XRJA 1SM4A 2X3UA 2H5EA 1NNEA 3WRXC 2BMJA 1GNRA 5HE9A 2IS1A 1N0UA 3JQQA 2GAOA 4G5RA 1XMIA 1IB0A 4D4JA 4B2LA 5H68A 3P26A 3GJ4A 4D0NA 1OGIA 1CJUC 3CM0A 5GVRA 1KK0A 4QM6A 5KDOA 1Z3IX 3TNFA 4FMDF 4BPRA 3JZAA 2V3CC 3U4QB 2BGJA 2ZRBA 1TUIA 4B73A 3SQWA 3VU9B 2W6IA 1KKMA 3I3SR 4R2HA 1PUIA 4KV9A 2QQEA 2VHQA 3CRRA 1TLLA 4BFSA 3K0SA 4HUTA 3OESA 1NSFA 3KQKA 4HAVA 2WM9B 3P20A 4OK6A 1VIYA 1GDDA 1GIAA 1Z0IA 3K0CA 2GQFA 1E99A 1XTJA 2ZANA 1GAWA 1DAHA 4G5GA 1AS2A 2IS4A 1LS6A 2RCNA 3N70A 2ZYWX 4OJKA 4DC9A 3IUYA 1XDBA 4ZV4A 5KNBA 1HURA 4URZR 1OYWA 3AEZA 1GRRA 1KIMA 1W5SA 2IW3A 2XNJA 1KO5A 1VDZA 5JCPA 1AGPA 5TXGA 4PAOA 5LB4A 1VG9B 1VYTA 2D06A 1KSJA 4GT1A 1SVOA 3GJ7A 2WWHA 2QROA 4RZ3A 1SHZA 3ZDQA 4IVQA 2PT5A 3VTKA 4A2PA 3CRZA 1FX0B 3SFZA 3W6PA 1F48A 1GL7A 1Q1BA 4P0TA 1GM5A 2BEKA 1OYYA 1QVAA 4QFMA 2QBYA 5J40A 1A5TA 1MT0A 2A5FA 5HTKA 4C7OB 2ZRPA 5FUYA 4TSFA 3EC1A 4GMXA 4QJ4A 1IONA 1SVMA 1G4AE 3RRYA 5FH9A 1R0WA 3TLXA 4Q4JB 4YDSA 2XB2A 3GLIA 2NTYC 1JQLB 3C7KA 1C1YA 3JQRA 4ZDWA 1ZM2A 1P61B 5LBIA 4HB3A 2WIBA 1KZGB 2RGXA 1D9ZA 1HT2E 2VP4A 3AKYA 3FKQA 3QKTA 1E0SA 1P73A 2XOKA 3ADDA 4P4SA 4LBZA 3A1TA 4ZO4A 4YXWD 4URWR 4B32A 1OHHD 1SXJA 4TQ9A 2ZR7A 1SVLA 3D8BA 4MKIA 3VFDA 4ZIRA 5F9FA 1E9SA 5E3HA 2HYIC 1ZUIA 2GEUA 2EFDB 4TTRA 1F20A 4UJ5A 3CF6R 1XXHE 2PCLA 4KFRA 2NGRA 3MD0A 1KSFX 2GETA 2V54A 2ZSAA 4B34A 3IEVA 4BE7B 1GKUB 2F1IA 3LQQA 2Q9CA 4NCJA 4X8LA 4BFYA 1OKKD 5GJBA 1W2GA 3GJXC 4KYUA 2R62A 1Z47A 3TSZA 2V4ZA 3LFUA 2J0QA 1IN8A 3T35A 1HUQA 4HEJA 3WRYC 1MO6A 2CCJA 1RFLA 2PMKA 5KPJA 1F6BA 2WMOB 3EASA 4NH0A 4BLRA 4Y9RA 3IO5A 3KKMA 2F6RA 4C0BA 3HJNA 1E2QA 3F5FA 4TL6A 5E7JA 2BPOA 1M6NA 4ACBA 3CPEA 3OEHA 3QKSB 3BXZA 4UXHA 2PMDA 1YVDA 5FI0B 3DMNA 2IUUA 2EYUA 1H8HA 4JKIA 3TAUA 4XD7A 2ZE7A 2ZJAA 2IEZA 1CR2A 2C78A 2VNKA 4UJ3A 5EE9A 2XEXA 1U98A 2F3TA 2YVUA 1E6CA 3BORA 4MYTA 2F9LA 3E1SA 3ONWA 1IY2A 2V8OA 3ZS9A 1GNQA 2UVQA 2DETA 2V9PA 3IEUA 3LA6A 4AF7A 1Q12A 3U3OA 4JKYA 3NTUA 4QNMA 1WF3A 2FWRA 2IC5A 1KNXA 2REBA 4NYJQ 2NO0A 4F38A 1U8YA 5JMTA 121PA 2OAP1 1K8RA 1TF2A 2BM1A 3DOFA 3N2IA 3W5IA 3IGFA 3OE7D 4LYJA 4UNSA 4DT1A 3GJ8A 3QOFA 1KO8A 1DADA 2WPDD 1N6PA 3EC2A 3K8YA 5L3RA 3TQFA 3LW8A 5CIWA 4QHTA 1EFUA 4A6PA 1XX6A 2YNMA 2QU8A 4JLNA 4KCGA 2XSZD 3TAHA 4LHVA 4AF6A 3CNLA 4HE5A 2ZXUA 5FBRB 1H85A 1QG4A 1QF9A 2ZSDA 4RD4A 1OH8A 3PEYA 4DLXA 1R8SA 4FI3C 4OQFA 5FR1A 2YWFA 1HT1E 1YZTA 1KD1D 2VTKA 1FFHA 4B6EA 2WWGA 1KJYA 2P5SA 3AQ4A 1PLKA 3L0OA 2FG5A 1R5OA 2JAQA 2RB4A 4HAXA 4MRSA 4OI2A 4RZUA 4RD3A 1GFIA 2ZIAA 4M9QA 1E2DA 2IS2A 1P7CA 1GKIA 3C41J 2LKCA 1D2NA 3JQPA 3I72A 3O8RA 1JR3A 4Q9LA 4NU0A 3GLFA 3KFVA 1GVNB 2I3BA 2ODEA 4LHWA 4LCBA 3T61A 4BLOA 1M7HA 4FW9A 2OCPA 3ZZTA 2ATXA 2VSOA 3CB4A 1QGAA 4IOMA 3TSOA 1Z0JA 1Z6GA 3B85A 4ASUD 2AKYA 2PIAA 1JB1A 1S9DA 3EARA 3VR4A 4GPTA 4C0AC 1M34E 2PX0A 4CEHA 4NL4H 1K8AD 1R5BA 1HE1C 1OE0A 2W00A 3PG5A 3RS0A 3EPJA 3MAAC 4ESVA 1RPZA 2OILA 1MV5A 4P4UA 3CZQA 3AV0B 1F3OA 4PHHA 4A8JA 1P75A 4EFLA 4Q02A 3K09A 2FV8A 2BJVA 2A78A 4B43A 1JXMA 3ZQJA 1QHHB 3UIEA 4XWOA 2B8TA 5DNYB 3CF0A 1RVDA 1PJRA 3SOPA 1YZQA 5AR1A 1CKEA 4DEXA 1QVFB 4IDOA 4WIAA 2IXFA 1RRPA 2EW1A 2O8EB 1K5GA 4RZ2A 3VR6A 1E79A 2FGJA 1T4GA 1RRFA 2CMKA 5DI3B 3B82A 4OI0A 3K0CC 3PEWA 1GRNA 3S1AB 5KSOA 5KU1A 5L8VA 2F43B 3CZPA 4DB4A 4V0NA 2XXAA 2WSSD 4Q1CA 1CLUA 4DLRA 1XEXB 4IVPA 4Y0VA 5JCZA 5J4LA 3V9PA 2DB3A 2JLVA 5HCNA 4Q5IA 1JEEA 1EXMA 1QHGA 3OIWA 1R0YA 4B6FA 1JBKA 1NN0A 1SVKA 4PHTA 2D74A 5L3SB 3K70C 1W44A 1KSHA 2W2VA 1RE0A 2PH1A 3T1OA 4FIDA 1UMKA 2QSZA 3U61B 1DAEA 4NP6A 2OM2A 3PJRA 4HDQB 2G1KA 5KTYA 5LD2C 3P4XA 2QRZA 4JT4A 2OTLB 2H1LA 1MO5A 3AVPA 4I4LA 3G5UA 1DOAA 2PJZA 2QGNA 2FA9A 1IXRC 4D26A 2KJQA 4C0KA 1G1MA 3QY0A 5EE5B 1ODFA 2R9VA 4QHSA 1OV4A 2JJ8A 2QRNA 1GG2A 3BC1A 3FHOA 4YMTA 2EVWX 1NIJA 1ZM4A 4Y0AA 1RW4A 4NYJR 2ODNA 221PA 4NZYA 4DSNA 4PQYA 4MH0R 1W0JA 3DKPA 1OFUX 3K9GA 1N6IA 2GBLA 3LVRE 4I1VA 4DJTA 1NF3A 2JIZD 1SXJC 1YZNA 4JLBA 4RFSA 3QPUA 2O8CA 5C18A 3IQWA 4DCSA 1WB9A 1SXJE 1DDGA 1FQJA 3A37A 3QUSA 2F55A 2E87A 2G83A 1RYHA 1XJCA 4BFVA 5FPTA 4F92B 3CR7A 2ODBA 4NBSA 3U4QA 3AB3A 2FEMA 4IFEA 2J0VA 4AG5A 3VU9A 1UM8A 4OQMA 4C9BA 2CEAA 2DHRA 2QGZA 2J46A 4OJQA 3TH5A 4TQAA 3GJ6A 3RS3A 4AYTA 3KB1A 1DAGA 2WJIA 5DGXA 4D80A 4EPXA 2WHXA 3H1TA 3FMPB 3T5DA 4JLKA 1ZU4A 4R7ZA 3CRQA 1VQ5B 1L2TA 3RABA 1NG1A 4D2IA 1G17A 4POAA 2R6DA 4DQLA 2QMUA 1KO1A 2GXUA 4FD2A 3OHMA 5HPYB 3AVQA 3NHAA 2XSZA 4Q1AA 5EXTA 3DPUA 2FE4A 1FMLA 1G7CA 2CLCX 2YWHA 4PO1A 4WQMA 3HU3A 2PEZA 1NP6A 4ESHA 2HXSA 3OFND 1N5LA 3LXXA 2GTPA 2RC6A 4C2UA 2P6UA 3WNCA 1ZCBA 2BM0A 2AWNA 3VNVA 2EIXA 2XTMA 4OHVA 1X8KA 1BYUA 1XCPA 2ZRIA 2J9RA 3FVQA 1G16A 3IPYA 4C7OA 1AJEA 1GILA 2X2EA 4D4MA 4CZ2A 3X2SA 5M04A 4B3GA 1I2MA 3CC4B 2EYQA 4B47A 1GUAA 4PANA 3RS7A 2VRWA 2XTZA 4FCWA 4MYCA 1II0A 5DN6A 3THYB 2PZGA 3BH0A 4TMVA 1E32A 3H4MA 4EDHA 2CLSA 2WV9A 1JALA 2JASA 3BRWD 4BEBA 5L3QB 1G3RA 1GOTA 3AF1A 3B78A 4IXMA 3W9YA 1MRSA 3IO3A 4ERNA 3PVSA 2ZAOA 2BF4A 4OQLA 3TRFA 3QVUA 4AYWA 4LHZA 4DDWA 3DOEA 4QNRA 1E2KA 1GVHA 521PA 5BXQC 5CLLA 2RGAA 1P62B 4IKEA 3ZBUA 2KSQA 2IUTA 5FUXA 3WMGA 2MSCB 2Z4RA 2AX4A 2NO9A 1YR6A 2FPMA 3GCGA 3C4JA 3PUWA 4A6XA 1QFZA 2VO1A 5KNCA 1EESA 1WBDA 4A92A 1MABA 4AKIA 1LY1A 3THWA 2FFBA 4Q03A 5CK4A 4B3BA 2QA5A 2GXSA 2C9OA 2GDJA 1KHTA 3TE6A 4TQUS 3VX4A 3U44B 1ZM7A 3E2IA 1RRCA 3MFYA 5CIQA 3UWOA 4ZGNB 4MDFA 1IXZA 3DKVA 4KFTA 2YJTD 4Q9JA 3I56B 2VP6A 3FYHA 1VQ8B 3VO1A 3EPKA 1E3MA 1KC8D 4GP6A 5FBWB 4YMUA 2O0JA 4G3XA 4JVMA 1P2TA 1EP3B 2C2HA 1Q21A 5JI3E 1E2JA 2R65A 5IK2A 1NRJB 1WCV1 3B1ZA 4QBGB 5JZVA 4A8JC 1W46A 2GEVA 2GRJA 5LPNA 3K09C 2ZI4A 4AIIA 4B4DA 1OSNA 4TLEA 1EFRA 1E0KA 1HQCA 4OK5A 3VR3A 3FB4A 1DO2A 3GJ0A 1J7KA 2B92A 3LRPA 5CYOA 4G1BA 4W5WA 5D3MB 1JNYA 5BWMA 5JSZB 5FUWA 3K0AB 4PPNA 5C2JB 3EZ6A 1J8YF 1ETUA 3ZQ6A 4GL2A 4AKGA 4MGYR 5E7IA 2I1VB 1DO0A 2VP5A 1FNCA 1VCIA 3B1VA 5AK0A 5K8UA 3CCJB 2RH5A 2QT1A 4Q7MB 2IYSA 2AD1A 4ZKEA 2CDNA 1VKJA 4OBEA 2R44A 1ZNWA 3CX6A 3QI2A 1SKQA 4Z1MA 4BZQA 4JL5A 1AKEA 4GDFA 2A9KA 3TBKA 2FSGA 4ZGQB 2DCUA 2VEDA 1FTNA 1E69A 3EWSA 1VQMB 3U6KA 1T91A 5H5JA 1E1QD 2ZUCA 1W34A 4IOJA 4OHZA 2ZRAA 3UK6A 3WMFA 1JEDA 1KY3A 1N25A 3DM5A 1JPNA 2BEJA 4M1SA 4XVUA 5L3VA 2O8DB 3KKPA 4A1FA 1HY3A 1R7RA 3AP2A 3CCMB 2VA8A 3OAAD 721PA 2GK7A 4URUR 1N6LA 2QTFA 1QFYA 5EE0A 4HLCA 1Z2AA 3LXRA 4UNPA 4LDJA 4P32A 4Q7LA 4B48A 1H42A 1K6MA 3ZIAD 2OFXA 3QG5A 1QGZA 1GR1A 4LV5B 1G20E 2E9SA 1A2BA 1NL3A 5DSZA 4E5UA 1TAGA 1DARA 4A4DA 2WWYA 4P4TA 2OK8A 1BO6A 1M8PA 2GBLC 5AJZA 5JRJA 1X86B 4IDNA 2DYKA 1QG0A 3OEED 4UXJA 4TYYA 4CEIB 2GCPA 4F7DA 1OIXA 4D82A 4ZDIA 1Q1QA 4HE6A 4LUCA 1QHXA 2VNIA 2ZS7A 4GSYA 4KVAA 2OG2A 3A4MA 3VQTA 2JLSA 1TU4A 4XIGS 2CL7X 1OF1A 2ZI9A 4QG7A 1XXHA 4M9XA 1U9IA 3PUXA 2FDCA 3R8CA 3N2EA 4JVLA 4F4CA 3UG6A 1DG3A 2OHFA 2ZJ5A 2ZJ8A 4LHYA 3TUJC 1IN7A 2RAPA 2PX3A 3T1QA 1XD2A 3U3MA 1XU4A 2F43A 3HR8A 3QF7A 4WXPA 1ZC3A 2AHOA 2C03A 4IXNA 4WW0A 5F3WB 2Q9AA 4ARZA 4C43A 1TQDA 3ZVMA 1P72A 3I73A 4Q7KA 2JLXA 2P65A 4BRUA 2V7QD 1P2UA 4KSBA 2W6JD 3CNOA 2OESA 1Z0DA 3Q5DA 1ELOA 3QXJA 4GI7A 4NDZA 4W5HA 3WBKA 3WP1B 4DBLC 1T5LA 3JZMA 5FL7D 4PPFA 2GEDA 3EIEA 1UBEA 2JGNA 5LB2A 4ZCMA 2WVJA 4V0LA 2FFAA 4WAUA 3AGQA 2QUZA 2ZR0A 1VCMA 1MRNA 2D2EA 5JJIA 4TLDA 4HAWA 3SFVA 4Q4AB 3WY9A 1S1MA 4XWKA 5CB6A 3KKQA 2GWHA 3IIMA 3L0SA 1RJ9B 2QSYA 2ZSBA 2HJVA 4TYWA 4GOJA 4LJ9A 3ND8A 4DLUA 2VNJA 1N6HA 1W0KA 3IDQA 3PEVA 4Q9IA 1H8ED 3FKSD 3VNUA 4KXFB 1U81A 1KRHA 4OHXA 1UKVY 1II8A 1HE8B 2EFCB 2Q6TA 3V4FA 3DO6A 4I1OA 1XMJA 1NY6A 1C9KA 1G41A 1KI3A 1YJ5A 1T3SA 1HYQA 1NN3A 4K1XA 1Z6YA 2AK2A 3SHWA 3AM1A 3GD7A 3HR7A 4M1OA 5HR5A 3CH5A 2LKDA 4PR0A 5J47A 2QG6A 2AK3A 2ZITA 1E2NA 3TGPA 4F4IA 5H70A 4CEJA 1KAGA 1US8B 1ZVQA 2O8BB 3W5UA 1CTQA 2FPKA 3EZ7A 1ZUNB 1EWQA 1P2VA 4RD1A 4JLOA 4O0MA 3M0EA 3UMFA 2OFOA 3ASYA 1T8TA 2EFEB 2F9MA 4B74A 4CW7A 2IYWA 3IBGA 1IJFA 3UMRA 1AGRA 3FFBA 3G71B 4PAMA 1M2OB 1RZ3A 4PTLA 3EIQA 2ORIA 1FRQA 2AXPA 3HP1A 5CJPA 4AC9A 5JHHB 4RFVA 4WZBE 4HB2A 3MWLA 1Z06A 1UPTA 1E9AA 1AKYA 1FP6A 1NVUQ 4KFUA 1N8RD 3PXGA 4DZZA 1TEVA 4HLUA 1CJTC 4C0JA 1X1RA 1DEKA 1XMVA 1DDIA 2CNWD 4KLNA 1CQXA 5TARA 1VQ4B 2QP4A 1QX4A 1E2IA 4MKGA 4QBFA 3JVVA 2QM7A 2AXNA 2CJWA 4Q1BA 3T5GA 1BMFA 3QXCA 4PQRA 3SZRA 2QTLA 3AGPA 2HLDD 1UKZA 2CVHA 2GJAA 3G82C 4I81A 4KVGA 4NYIQ 4PC7A 4AD8A 1OT3A 1S4QA 1KO4A 1F2UA 1KJWA 1OXSC 1J9ZA 2DBYA 1OXUA 4DWJA 4N3NA 4BLQA 5K8TA 2QMHA 5KOYA 5F98A 1W4AA 4B3FX 2GVZC 1OB2A 4M4SA 2BSAA 3ZIAA 3THYA 3TVDA 4H1UA 3I32A 4V0KA 1LVGA 2HEIA 4QKQA 2OBLA 3CIOA 2B7CA 1HV8A 3K0FB 3R9WA 1IAQA 2VZLA 2DY1A 1S72B 1NN5A 2PZFA 3O8BA 1IY0A 4MKFA 3Q3JB 1FNMA 1E2GA 2WZQA 3SBDA 3G0HA 4MUBA 1E2MA 5FBVB 1YQTA 4EQ6A 3WYFA 5K8IA 3K53A 2HJGA 3I5XA 3NDPA 2C77A 4NMMA 1P9RA 3QKRA 2RHMA 1WDTA 5CYPA 5B57C 4DSUA 2A5JA 3EG5A 4Q7JB 1GWNA 2FGKA 2XJ4A 3U60B 2HCJB 4BLPA 3WNBA 2XNDA 2N1BA 1W1WA 4TMTA 2O0KA 5HKKD 1GSIA 3PFIA 3CXCB 1SQ5A 5GV8A 1H65A 1LNZA 1XCMA 2NO1A 5FOTA 1W48A 5FUVA 2L0XA 3GEHA 4D0GA 2NMVA 2IYUA 1NVXQ 4NCHA 3GLGB 1DVRA 2G6BA 4M1MA 2WKQA 5KPDA 2V7QA 1SVWA 4M8NE 1R2QA 2BHRA 4G0NA 4XVQA 1JR6A 2Y8EA 3LV8A 4PPGA 2ONJA 4EJSB 1AQUA 2BMDA 1XPOA 2GAAA 1E98A 5GVSA 1RRGA 1KSGA 3CKLA 3KQHA 2GPJA 3W8NA 3T1TA 2ZRHA 3QJYA 1K73D 2OTJB 3TW4A 4BFUA 1ESMA 2HCBA 2QAGB 1S8FA 5D3MA 1AK2A 1U9IC 3ZGXA 3KXLA 5JSZA 3WMEA 4RKFA 2HMAA 3EX7C 2OLJA 1R5NA 3KQLA 2BCJQ 1U0HC 3MJHA 2ZU0C 3FKSA 1O87A 1TVCA 3ZC3A 1KI7A 2VSXA 1JAIA 3B1YA 3SJCA 2O8FA 3AUXA 5JBQA 2FZ4A 1JXOA 1R4AA 1XEWY 3OIUA 2DFKB 3UANA 1DAKA 2WWIA 3QIAA 1J90A 4LSGA 5EUQB 3W90A 1OH7A 3PUYA 421PA 2ECKA 1XCGB 4L9WA 2O8BA 2MMGA 2ZR9A 1B2RA 4TYNA 1BQEA 3LH5A 1KMHB 3FFAA 4BZPA 4JL6A 1XNJA 2H57A 2ODWA 2ZS8A 4Y9UA 5EP3A 4KLZA 3W5VA 2GJ9A 4WXRA 1CNEA 4OKSA 4TL8A 3CO5A 1ZRHA 2OAQ1 3RRZA 4DDTA 1G7RA 4FCTA 4NYIR 5C46F 5HXBA 4TT3D 1HTWA 2XZLA 5G3ZA 3T1VA 1VQKB 1OGJA 1NKSA 1Z0AA 1X8JA 2ZVPX 1G4UR 2WAXA 1T6NA 2IYXA 1Z2CA 2WAYA 5JS7A 1XPRA 1GAQA 4URYR 5FOXA 3ZD6A 2ZPTX 5G53C 2VF8A 1W7AA 4NONA 1OLOA 3TQCA 2TMKA 5TV2A 1S1CA 2DFNA 2OZEA 3CPWB 2GJKA 4W5JA 2YZ2A 4KAXA 2F1HA 1O3YA 3QFCA 2ZTSA 4XH9B 2ZRDA 4EFMA 3G4SB 3FDIA 1UKEA 1R6BX 4B3DA 3I8SA 3EPHA 3AVWA 5FI1B 4Q19A 4V0OA 1MR3F 3OZXA 3QF4B 1KDPA 1FUKA 5JHGB 1N5IA 4CRWB 1ZC4A 4LJ5A 4R98A 4EH1A 3U6BA 5IRCD 1VQNB 1U99A 2IYYA 3BJIC 2VF7A 2VYQA 4IHQA 1TQ4A 5BQ5A 2PZEA 5HE8A 1FDRA 4IOKA 1S3GA 5FR2A 3AKDA 3X1YA 2IEYA 1XTKA 4FN5A 3H2YA 2JLWA 3KQUA 3THXA 4K81B 2OCBA 3SNHA 5HZKA 2PL3A 5JECA 4MRNA 1M90D 2HT1A 3MHPA 3BB1A 4ABYA 5FPHA 5F9HA 4HLUC 1W49A 2YOFA 3REGA 4WZAE 4G5QA 2DEUA 2IT1A 4JYCA 4QC2A 2J7PD 4WVFA 3ZBTA 4JLPA 3RANA 3B8HA 1G3MA 1D9XA 2AR7A 3P1JA 1OXVA 1KI6A 2RGCA 1Q0UA 3FMFA 3GLHB 1ZUHA 2K5UA 4PFSA 2GK6A 4LZZA 1NMZA 2OV2A 4BPBA 1F5NA 4Q66C 3RC3A 3W5JA 3QKUA 4KI0A 5EP2A 2ZU6A 3BH6A 5IF9A 2CHQA 4JLVA 1FNNA 2IHYA 2R6GA 4L8GA 4UNRA 2C9CA 2J0SA 3TR5A 3A1VA 3UG7A 1R0ZA 2Z43A 4JS0A 2ZSFA 4YHBA 2VP2A 1VQ9B 5J4HA 3R8FA 3QEJA 3RRNA 5G40A 4JLJA 1ZINA 3I61A 2JJ2D 3T06B 4ITRC 4HSEA 2N42A 1QFJA 3B13B 1BS1A 1XPUA 3EZFA 1JA1A 2ZI7A 3LLUA 3VKHA 2ZRKA 4YXWA 1KMQA 1KY2A 1V43A 2ZRNA 3EZ2A 4AG6A 5CITA 2EU8A 1OHHA 2DFTA 4B44A 1E9FA 3A1WA 3KZ1E 4PSAA 5DYIA 5AUQA 4DSTA 6Q21A 1TTTA 2W83A 1G5TA 1Q22A 2BIFA 2F7SA 5DO9A 3CW2A 2J3EA 5F2EA 5FOVA 3SR0A 1Z0FA 3AKEA 1XD9A 1XEWX 3IKJA 4Q1DA 1FQKA 4CT4B 2A5DA 3Q85A 2D7CA 1CR4A 1MO4A 4QXAA 2Z4SA 4PC1A 2FN4A 3AP1A 4X8HA 4D4LA 5EXXA 4FMCB 1G21E 1S2MA 1G9XA 1G3UA 1P6XA 1OKKA 2CK3D 1QBKC 4CIDA 5A4JA 3ZYCA 1TUEA 4Q18A 2QN6A 3BS4A 2G88A 4A82A 2QTVB 2Q3FA 2C5LA 2JDID 2V6JA 2H17A 4DKXA 4P6VF 3MWJA 5IHPA 3QSYA 4Q4HA 3TKLA 2RGDA 4IRUB 5H8WA 1A82A 1XTIA 2ZSEA 2QQ0A 1Q1ZA 3KKNA 1NVWQ 3WNDA 4F4JA 3CRMA 1KOFA 5CJ2A 1GITA 3MRSA 4HB4A 3VAAA 2IYRA 2WJYA 2ZROA 1ZNZA 2ZE5A 4IVRA 1ZMXA 1IHUA 2FSFA 3EXAA 3KTAB 3SN6A 2IYQA 3QPWA 1CR0A 1E4YA 2CL0X 4DLWA 5TB5A 1D6JA 4BASA 5IT5A 2ZRLA 3LLMA 4J0QA 5B64A 1OJLA 5E7MA 4CVNA 3SJZA 1ZD8A 4JLAA 3REFA 3M6AA 1E1RD 2MSDB 2Q0HA 1KDOA 4G5OA 3HDTA 1OH6A 2YWEA 1XB2A 1FP7A 2WJHA 4D0LB 1NY5A 2BBWA 4FMCF 4QM7A 2LWIA 1MKYA 2UZIR 3OE7A 4BGDA 1E94E 4JVNA 1VCOA 2WPDA 1UADA 2NZ8A 5P21A 3A1SA 5TDHA 1E2FA 1SGWA 1YZKA 2VHJA 4DQKA 4N1AA 3L8ZA 1E9BA 2B8WA 2WKRA 4HI0E 3SDZA 3IHWA 2OXRA 3RLFA 3RS4A 4IJMA 2YV5A 3OZUA 4WZ6A 5GJWC 5H1YA 3TW8B 4O2LA 2DFLA 3NH9A 1II9A 2CNDA 2OE2A 3PITA 4TN1A 1WXQA 2BJWA 3I92A 1G3QA 2XB4A 4BLTA 4BQSA 5GJVC 3GJ5A 4DUGD 3TUIC 1FX0A 4LC0A 2PJRA 1S9HA 2GVDC 2Z5FA 1VQ6B 4Q00A 2IS6A 4HAUA 2WSMA 5JI2E 3LDAA 2H18A 3FWYA 2AL7A 1AM4D 1A8PA 5EMNA 1KKLA 3CLVA 2OSBA 1HEIA 2D2FA 2V6IA 1DAIA 1J8MF 4H1VA 5J4VA 2RMKA 4Q4JA 4RCYA 4C0LA 2AWOA 5EP1A 3QEOA 1T3HA 3ZH9B 4O25A 4YLGA 2J7PA 3K9HA 4ASUA 4DSOA 1I4LD 3KXKA 4EJSA 3HYTA 1W35A 4E22A 2KBEA 3BFXA 1FPMA 1QDEA 3LQRA 1SKYB 4BUJA 1IN6A 1VHLA 5FTLA 1T0HB 3IPXA 2ZRFA 4OHWA 5EE3A 5HZHA 1VG8A 2QAGA 3A58B 2NOAA 2NQ2C 2OEPA 3X1XA 4DIDA 4KSCA 3EPLA 3ICQB 2QEXB 2WWFA 1Q44A 4E09A 5BYKA 1TMKA 3C14C 2FEOA 1A7JA 3UATA 1CULC 2Q21A 1YJ9B 4NKRA 3W34A 4KITB 4OI1A 5CLQA 4P31A 4M1KA 2FSIA 3ZVRA 5GADl 2V1UA 4C30A 3F8TA 2KB0A 1UDWA 3NIBA 1N6OA 3ZD7A 3CCLB 4US0R 5FTMA 3Q7PA 4LGMA 4PZZA 4M1WA 3CWZA 3BERA 4LWZA 4BRWA 3FJOA 3DHWC 2WSSA 1ZIPA 4Q01A 5FBLB 4DLSA 4N3GA 4QRHA 2OBMA 3BIFA 4QBIA 1T5IA 3W2EA 4JBWA 2ZM5A 1NG9A 3K70B 2NG1A 1VHTA 3QKSA 4Q21A 3NHBA 4C0HA 4RCZA 1KMHA 1G8YA 1TQ6A 5THXA 5J5CA 3BOSA 1TPZA 1KNQA 4TL7A 3EZ9A 3H0KA 4JJZA 4BFWA 3GPLA 2QE7D 1T8UA 3FMIA 4NPHA 1BYIA 4LOAA 1OW3B 2QBYB 2FF7A 4GNKA 1EK0A 4II7A 5C1BA 1KO7A 5FFMA 3LBIA 1GZSA 2QI9C 4LBWA 4R9UC 4AKHA 3BFVA 2CVFA 1U94A 1Z29A 3MG9A 4MRPA 4A9AA 1G291 4G5SA 4K8OA 4Z8YA 3CF2A 1EWYA 2NZJA 1NDHA 1PZNA 1I4TD 2DWPA 4NCNA 3CC7B 3CR8A 4MA4A 2REOA 2JJ1D 4D4KA 3B1XA 4QBHA 3FTQA 1YR8A 2ERYA 4PX9A 5H59A 4MITA 4RY2A 3SQXA 3BB3A 1CU1A 2QPOA 2JLRA 5EXPA 3B1WA 1UF9A 1CP2A 5G3YA 1YU9A 3KFXA 2KBFA 5FPSA 1VMAA 3QQ5A 4FINA 4YALA 2R2AA 4QOSA 2ZRMA 4ZIRB 3EIHA 1AS0A 1Y63A 2PBRA 2CHVA 2JIZA 2IYLD 5IDVA 3WXMA 2GNOA 1JPJA 5JWHA 2B21A 2ZI6A 4NE2A 2Q9BA 1VYUA 4HLQB 5KSZA 2BWJA 1R0XA 1RYFA 3LO8A 1MO3A 4RKEA 3CCEB 1GJRA 1E9DA 4OHYA 2BV3A 5AN9A 3LY5A 3RRMA 1L4UA 2ZYTX 3AUYA 3P4YA 2HF8A 3QBTA 1U2RA 3BK7A 1YR9A 4FWIB 3EA5A 4I1SA 1G6OA 4M1YA 2EWWA 1VYVA 2CLDX 1OPXA 3VKWA 1QHYA 2GKSA 4PC2A 1LFDB 1D5CA 5HCIA 3AP3A 4ACAA 2ZYVX 2J5XA 3A6PC 5B58C 2YC4C 3AH8A 5C4GB 4Z8XA 4LYAA 1CJKC 2Q3HA 2FU5C 4GBMA 3CCQB 4US2R 4IOLA 4ZCLA 5FTNA 1CBUA 2P6NA 621PA 2A30A 1X8LA 1P3JA 4DUGA 2QY9A 1NLYA 3RYTC 2BN4A 1G18A 4QGGA 3DVLA 3OFNA 1A4RA 2VP9A 5EZ6B 1FW6A 2G9NA 3GFTA 2OT3B 1Q57A 4NCKA 2IHBA 2N46A 1PLLA 1XP8A 3E20A 2QPAA 4TMWA 3CMAB 1LB1B 1PUJA 3LNCA 1QHHA 1TEXA 2W6ID 2GCNA 4TMKA 4DEYA 2IXEA 2VH5R 3DEFA 4PAQA 1VECA 3LX5A 2QAJA 1G5RA 2G77B 3JVUA 3KX2A 4PPQA 4QGHA 3W3ZB 2C04A 1ONBA 3V76A 1N5KA 2VL7A 2ZJYA 2O8EA 3BE4A 1N6RA 3OZWA 1E4VA 5EUMA 4DT1B 2XJ9A 3SYNA 4YONB 5DI3A 4CF7A 1KYIA 2NPIA 4UXIA 3S1AA 3OJWA 4A2QA 1NSTA 5DH9A 3N5CA 1Z07A 1XEXA 1D2EA 1OXTA 4UQOA 2EQBA 1E2HA 4CGZA 1D8TA 2C8VA 3K70D 5AUPB 1DELA 4A2WA 3NBZC 1G7TA 1KZ7B 3K0EA 1M1YE 1IQPA 5L3SA 2ZUBA 4YAWA 5KSWB 3PUVA 4A0GA 1OXXK 1NLFA 4AYXA 1NKTA 3HPRA 1YRAA 1GP2A 3D3QA 3HU2A 4A0RA 1XZPA 2G1JA 1F60A 3J81k 4TSFD 3LVQE 4NCIA 4ZI2A 4KU4A 3GLFB 4LPSA 1TU3A 5A0FA 4DXAA 2R8RA 3B9PA 3W3AA 3HU1A 4X8OA 4BECA 4JLDA 1ZNXA 5CK5A 3GLGE 4U7DA 1CEEA 4H9GA 3CRW1 1U8AA 4TMZA 2YINC 3IQXA 1NMYA 3QVVA 5ANRB 4MGKR 5G41A 2AKAB 2XOKD 3VR5A 4EJSC 2ZRGA 4C2TA 1KK3A 2X1VA 4IDHA 1XMSA 1W47A 2C99A 5JJKA 3LBNA 3RSOA 4TTQA 2QE7A 2B5OA 2ZVQX 2QORA 4A8JB 1G7SA 4IDQA 1DBSA 2ZJ2A 1FNBA 4PO8A 4S35A 5LDDC 2QAGC 1ZAKA 4FXPA 2IYTA 1CR1A 4P3YA 1XEFA 3EAQA 2OO7A 4C0QC 1GKYA 1NI3A 1G64A 4K46A 1G5PA 3PIRA 3FPKA 4XSGA 3U3RA 2I4IA 4JBYA 2YOGA 3EWAA 3ADCA 4B2IA 1T0JB 4DRZA 3O8CA 3QPVA 4B33A 2XZOA 5ELXA 2O5VA 2IL1A 1OFIA 2QDXA 3QE0A 5EZ5A 5EQTA 2XXAB 3L8YA 1QUEA 3KL4A 2ZJBA 2QMOA 3SHFA 1CRPA 1VCNA 1P9NA 3PV0A 2NO7A 3RS2A 2QNRA 3HYRA 1CJVC 3OEHD 4MUAA 2A3RA 2IF0A 1PVOA 4DCUA 4DLYA 2WBLC 3CPHA 4GFDA 3OJXA 2H7VA 1E1QA 1H8HD 1KAOA 3F3YA 4XD7D 2JATA 3KUDA 4C3ZA 1QZXA 2YHSA 1G8PA 1BJKA 2FZLA 3SU8A 4AI6A 4V03A 4M9ZA 3SYLA 3NG1A 2IWRA 1S96A 3L0IB 1SZPA 2FMXA 1N3BA 3OAAA 4PO9A 1BKDR 5TMPA 1W36B 4BEJA 2GZAA 4MGZR 2PCJA 1Z83A 4YMVA 2CRVA 2ANBA 1IN4A 1N0WA 4JZKA 4F93B 3B6EA 4JSYA 4O3MA 1YR7A 2A7QA 1NJID 1NVVQ 2FOLA 2Q3MA 4LV6A 2R6CA 1TADA 1OFTA 2CL6X 3I5YA 2BBOA 4OQNA 5C4MA 5UKDA 4GP7A 1J70A 4A36A 2ONKA 3RC8A 1J2JA 3UXMA 3AF4A 1R8QA 4MKHA 1PLJA 5L3QA 4RFSB 2O8CB 3DMDA 4Q9KA 3OEEA 1E2LA 2CCGA 3R9XA 3ASZA 3X1WA 1OH5A 4PHGA 1M7BA 4PQFA 1Z0KA 1UBCA 3IILA 4FK8A 2WICA 4MRVA 3CCRB 4V0ME 2WIAA 3PUZA 3ZVNA 4LJ8A 2FNAA 4TLBA 5SZJA 3W2IA 3KB2A 4PSVA 2ANCA 2BBTA 2QP3A 4MYUA 4BZXA 1ZCAA 5BYJA 1W4CA 2OFWA 3ICEA 1PV4A 4WA7A 1JR3D 1E2PA 4XVRA 4LJ4A 1KI8A 4LYFA 4DCTA 2GXAA 4B2PA 4LBYA 2XTNA 4BWYA 3BGWA 1ZJ6A 2D4HA 3VHXA 1EGAA 3U44A 2DWOA 2J1LA 2ZETA 2ZYUX 1U0LA 3A8TA 4Q1FA 1F2TB 4JT2A 3R7WB 1DAFA 2OLKA 2FH5B 1YZGA 2W6JA 1W4BA 3A36A 3QXXA 4U02A 2W0MA 1E9RA 1Z22A 1KI2A 4FCVA 5FTKA 5JJLA 5FL7A 3GLHE 4QL3A 3B7GA 1G8HA 1X6VA 3BAFA 1XTSA 3C15C 2FJUA 3ZLJA 2CHGA 5KSPA 3QXHA 1JA0A 2YOHA 3KDSE 4ZDJA 1ZM3A 2ZI3A 3U2QA 4M2LA 3WP0A 2ORWA 1EFCA 1P60A 4XWAA 3K0AA 1E79D 4U9UA 2IX3A 1VG0B 2QTHA 3NVAA 1IM2A 2IYVA 5DE3A 4M53A 2JLYA 3QBVA 4URVR 1E64A 4RD0A 5DYGA 1H8EA 3DDCA 4JSTA 5EJEA 3U7HB 1ZW6A 4XOIA 1GAJA 4P33A 5KYKA 4TL9A 2MMCA 2J0UB 1B0UA 2EFHB 3K9NA 4W7SA 4LV8B 1MOZA 3C8UA 2WJVA 2AD5A 4EPWA 1QUFA 5KSYA 3MCAA 3MJRA 2BCGY 3T12A 3P27A 2JCSA 4OQXA 5DHAA 3W2HA 2O8DA 4B3XA 1MABB 2GJ8A 4L15A 5B30A 4FMBB 4DVGA 4HZIA 3THWB 1G3IA 4Q48A 1E9EA 4ILEA 3FHTA 3QFSA 1W36D 2YWGA 1G8FA 3UMSA 2WTUA 1AQYA 2H92A 3LWNA 2VP0A 2DPXA 5TR9A 3K1JA 1FRNA 1M7GA 1Z6XA 5BN4A 5J4KA 1JJVA 4A0HA 4YQFA 2VSFA 1AIPA 4B3CA 1Z08A 1N6KA 1XBTA 1W0JD 2W2TA 1NVVR 5DHFA 2OBNA 5FBQB 5CB8A 1CS4C 1TF5A 3LVBA 1E0AA 3CCUB 5EE1A 2CNWA 1VQPB 3FHCB 2XAUA 2XITA 2BMEA 4W9MC 2GF9A 4QGFA 4CEIA 1LV7A 1UFQA 2ZAMA 3VR1A
chains in the Genus database with same CATH superfamily
2HGSA 1KVSA 2XMQA 3I4LA 3HXOA 3ZDZB 4BMYA 5G0TA 4QWMA 3GFFA 4RD6A 1XL0A 3MCWA 1A5SB 4BU1A 3F3MA 1PK8A 2HD4A 2DP4E 1U7UA 1YK0A 2R4QA 4U0JA 1XG5A 2C57A 3LUBA 4UFPA 2QLJA 1UK6A 3BL5A 4Z9BA 4D25A 3DHYA 3RDPA 1SXHA 2QZJA 4HWGA 3IE2A 1VB5A 2BKXA 4PLVA 5JSQA 1QG2A 4L8VA 2EW2A 4FJ0A 3KD2A 2WF8A 1NJGA 4JI5B 1H5QA 1VMEA 1VJTA 2JFUA 1Y5NA 3ND9A 1RQNA 2ZJOA 1Y6JA 4MYHA 3KJXA 1SVUA 5KWSA 4OYHA 1VPDA 1L0BA 2JCBA 4NFYA 4UM5A 3W8FA 3AHGA 5AK5A 1Z8FA 2B3DA 3L0CA 3NC1C 1UWKA 3R4CA 3AHIA 4NNPA 2GCOB 1CQWA 1O96B 3VMFA 4NMXB 2RJOA 3WK8A 5JAMA 2FPLA 5BNIA 1E1CB 3G0GA 3KHTA 4KK4A 4UKDA 1KA9H 2IIBA 1G8KA 1ZN8A 2WTXA 1PAUA 2VOEA 4LOJA 4NYMQ 4JC5A 3SGLA 4OYRA 4TZKA 5ALQA 3V7FA 3MS7A 3Q98A 4X00A 5GIOE 1NKVA 1X14A 4KN6A 3L82B 3RLIA 3WGJA 4WJLA 5K3OA 1P3Y1 1CIPA 5ICGA 3ROQA 3LP8A 4Z3OA 5CB4A 2X8JB 2WTNA 3N8KA 5EP4A 5FNVA 3SS9X 3WLKX 2EBUA 1TMYA 3KJEA 4HRVA 2HMYB 1OIWA 2VRCD 3KK0A 4Q4AA 4IQ0A 2B6HA 1RXIA 1YLOA 1RE1A 1JB9A 2ZJ6A 1EX6A 1JIXA 1UMCB 2C9YA 1SY7A 4X7BA 2PXXA 5DN6D 4BO2A 1RYDA 5AUNB 4LJYA 4L95C 3VO2A 4FWTA 5HMLA 1T9KA 3CKKA 3C45A 2A0KA 3TMKA 1DKOA 3T0GA 1O0BA 4J6FA 4FZ3A 4LDPA 4HKTA 1XTZA 2VK8A 4TSKA 2DHEA 4WXHA 1G98A 3OKCA 5JFGA 1PW5A 1VE6A 4D9CA 5HYVA 3QX8A 1FRVA 3UB2A 1J33A 4BQOA 1C3JA 1GZ3A 2BFMA 3U7EB 4AMYA 4GLFA 3UHOA 1SKYE 1LW7A 2C3UA 2OUKA 3NHUA 4DHEA 4Z51A 1YJWB 1J5PA 3JD1A 4HMPA 1GPKA 3WIUA 1E7RA 2P40A 4JHXA 4MQEA 2Q0SA 2R00C 4FGJA 5ALRA 1F1BA 4OAOA 4WKOA 4FGWA 2WTBA 4GZMA 1NBMD 3N2ZB 2QX9A 2PTGA 3EGIA 3SCZA 1E1DA 4CUZA 1ZUNA 5JASA 5LP6A 1L5OA 2P2DA 3C8HA 4IDFA 4TXLA 4GOKA 3BVPA 5E7JA 5DMXA 2J31A 5KNBH 2E6KA 2ETVA 5LQSA 2AOVA 1U8CB 3BL8A 5JZBA 2V0GA 5MN6A 1AZWA 1T26A 3NNDA 3GQBA 4L8FA 1VE7A 3BCSA 2ATVA 3SLGA 2C2BA 3H1FA 2IF2A 4IJWA 3A70A 2I22A 5HRUA 3TE7A 2OV8A 5C7YA 4C4PA 3QWFA 4O63O 5A0VA 3TD6A 5DM60 5M29A 3ME5A 3HPQA 4P36A 1GL6A 4F91B 3BTUA 1CNFA 1YE8A 1KOJA 3UJ9A 1XTQA 5I7RA 1NRXA 2EBHX 5KDDA 1P3DA 2UDPA 2VP3A 5F7ZA 1CUYA 3K05A 3WGTA 5FO0A 2JAWA 3I53A 2CYBA 2VXBA 3P9SA 4NZPA 3E84A 1K06A 2BFNA 1U1FA 1YVPA 4QJBA 1ZU5A 4XASA 3SBEA 2HXYA 3NEYA 2WK1A 3H9BA 2HX1A 3HFRA 5IT0A 4UZSA 3K4HA 4UZEA 3WYEA 3H42B 5KKNB 1VLHA 1DFHA 1U3FA 3R8XA 3EXHB 5EIXA 3CSSA 4CLRB 2QXYA 3PUKA 2ZTVA 3UF0A 4MHSA 2IUSA 4OG2A 2NIPA 5DBEX 3GLIE 4AAYA 2JEZA 3E58A 3KVRA 3SZ3A 1B15A 2ERXA 2D5BA 3KVYA 5CH8A 3JR3A 4M6WB 4XCVA 4ZKDA 5A3RA 5C35A 3AHFA 2OO3A 1C3XA 4Z1MD 4YJ2A 3JVEA 4Z2AA 1AMOA 3G68A 4DREA 4UBMA 2E1PA 2RHOA 1EHCA 4WOJA 5FTJA 4A23A 5F4JA 1QE5A 3A4LA 2X2FA 1GPMA 2XT9A 5JYDA 3AFGA 3OETA 4L2IA 1ZITA 5JDIC 4CKZA 1BLIA 2V1XA 3STXA 3NVKI 3Q9LA 3WBFA 1NN1A 4PPYA 5A7FA 1YDEA 1IL0A 1XTBA 2EX0A 1Z63A 2R7KA 1Y9EA 3LDUA 4RHFA 4IPTA 2JC3A 4WBSA 1JFTA 2X8WA 3EDYA 3ULKA 2O2HA 1NRIA 1PEDA 1A9XB 2W58A 3G2QA 2HW8A 3HK2A 4TZ6A 4F8EA 5CBPA 5G02A 1WKVA 3RY8A 3MPUA 4IEEA 1NV8A 4IGIA 1GR0A 1YRQA 3DXXA 3DNPA 4KO1S 4KYIB 1QLJA 1QGYA 2EKZA 4YMGA 1P7YA 3DV0A 1QOZA 4F8YA 5I4KA 3JQGA 1VKHA 4PSDA 4CHGA 1Q1EA 2Q4DA 2Y4NA 3K35A 4KGDA 1MOSA 4L78A 2XRYA 1E62A 1SBTA 4M38A 3U3ZA 1WOMA 2FE1A 1TZMA 2O7RA 4E13A 1U6JA 3KKOA 4KP7A 2ZIZA 4OOEA 2H16A 2RK3A 3D2AA 4R9VA 1S8AA 2KPOA 5CH3A 2R6HA 1F2TA 1CFJA 2J5QA 4U7GA 3R7WA 2EARA 3SNKA 2HK6A 1WCWA 3VH1A 3KR2A 2PEYA 1VBFA 3H3XA 1EDDA 4EUFA 3SY8A 3PFCA 1KDTA 3ILVA 1WMAA 2C4KA 3LD9A 4RLHA 1OT5A 3QPCA 4XFJA 3SVZA 4CQMA 2VJYA 1XZDA 4K3UA 4MV7A 4WNIA 2RGBA 2FLVA 2ICAA 1A5ZA 2QM8A 1BOFA 1ZX1A 1T9AA 4N7MA 2H63A 1EG7A 2ZE6A 2GHQA 1F2UB 1P5ZB 4HRAA 4DIEA 1PHPA 3R7SA 4X94A 5KTRA 1VMDA 1M5TA 4L6AA 5DIFA 5WRFA 3TWOA 3E03A 1CY8A 4XTCS 1RPAA 3RVPA 1D6NA 4FI3F 5DTIA 3KKLA 1GZVA 3FBGA 2CDBA 4Y2PA 4PGOA 4WOPA 4I1UA 5BSHA 2QRJA 4JLMA 1GCIA 4KHZA 1FTSA 5E1BA 2PLRA 5K3SA 4GH5A 1WHSB 2HI0A 4R8RA 3VX3A 2NPOA 1BXRB 3S2ZA 2V31A 1GA6A 2SNIE 4RZQA 1FB5A 5D1NA 5ESXA 1WXXA 3MERA 4W8GA 1YI2B 1M0WA 2DLNA 4JYBA 1QVRA 2QB5A 1HFWA 3GEEA 3DP9A 4B09A 2QD3A 1YB1A 5IPFA 5FOSA 4E4RA 3BZBA 3HLTA 4AY6A 2YYZA 3BBPA 3H9UA 5TT1A 2D1RA 3RWMB 1DQNA 1KQNA 3W4KA 2PGLA 2VI5A 2WTMA 4E2YA 5JC8A 5JRDS 4CL0A 2BD0A 3OUTA 1Z25A 4LBVA 3PX2A 1ZIXA 1ZOLA 2A5GA 4LE1A 5JWOA 1QP8A 2C82A 2QRVB 2VJNA 3ETJA 3H65A 3KJIA 3UAOA 4BIIA 2ADMA 4JJ4A 1N78A 4TLAA 4AKTA 4DV3B 4FEGA 2I0FA 2I6FA 1J8FA 3ETEA 4R3NA 3EFOA 1JR3E 1JFLA 3H9GA 2DIEA 3MTIA 3VR4H 2CK3A 4ROXA 5T3UA 3JWHA 1CK4A 5K3FA 4JCCA 3FMOB 4HMOA 1IXSB 2GNAA 3ABZA 3ZU5A 4BNFA 5KUTA 3KKKA 1RIFA 4W5QA 1AZSC 2DPGA 4YAOA 5C5CA 2O52A 3COJA 2WKPA 4PCVA 5D84A 4E07A 1UAAA 1JFVA 3F4LA 1IZ0A 2WJJA 2AHRA 2WZNA 4H7DA 3WRXA 4P4SB 2BMFA 2CZQA 4J91A 3AY7A 2ZRJA 2G7MC 4NOMA 2J3KA 1N92A 2FETA 2WOJA 1VHDA 4DIFA 4EPYA 3H11B 5LJIA 2I2BA 2EOAA 4YAUA 1WMSA 2F67A 1IIBA 3DS8A 3NRJA 4R2JA 3WYGA 3VR6H 3DEIA 3QF4A 2JFYA 5BNZA 2CXQA 1ULSA 3HWSA 4PXAA 1Q1GA 2JGIA 1MFZA 5JS8A 2JKYA 1P0PA 2DULA 2X8AA 3SHTA 2V7XA 1KKUA 2QN3A 3C74A 4LZLA 1I5EA 1E3WB 3ORHA 3UH0A 3VA7A 3A0UA 2JA2A 3TL2A 1NUHA 2Q5HA 3IUQA 4B35A 1CUBA 1Y4SA 2JKZA 2OD9A 2YIDA 3IJ5A 3OI7A 1JQ3A 5EKSA 3SKVA 1N3IA 4B81A 1XR3A 1S3SA 1SRRA 2B83A 5CLGA 4BMDA 5K6AC 3IERA 3L9XA 1P9WA 4NTZA 2VBTA 2WD8A 1NIPA 4LY3A 4U7JA 1GFSA 4E1BA 2XY4A 1IBKB 1YHYA 2PMCA 4RSGA 3VGPA 4K03A 2GCOA 2XYRA 1HLPA 2UAGA 2XA1A 2Z83A 4CKYA 5CX1A 2G4CA 2R6AA 2CT8A 5IC5A 1YJNB 3FLMA 3FVTA 4EDFA 1JIJA 5AW5A 3O3CA 3UPUA 2B4YA 1L4LA 5A7HA 4CT5A 4KTTE 1JSRA 1Y5MA 3WTCA 4HNGA 2JD2A 3I52A 3VYWA 4FXUA 3HZRA 4N0EA 4XLCA 4L85A 1A04A 2V98A 3VYUB 4EKGA 1ZW1A 1SCNE 4A7PA 1PNTA 4KO3S 3E82A 2H11A 3Q6QA 4DF3A 3VUEA 2Q5JA 3JVIA 3IS3A 3VDQA 1G6HA 3O3MB 2RDMA 1Z28A 3GLRA 1V11B 3AZQA 4HB0A 1NZDA 4IX9A 4P98A 1CZHA 5IN5A 4LWPA 5JCOC 3AVOA 5AKYA 3ZXYA 4EA6A 1RKXA 3GAAA 4UEOA 3LRTA 4KKXB 1D1SA 3H9NA 3CURA 2Z8YM 3TOXA 1LTHR 4NK4A 1O5OA 4YMIA 1M1XB 3ABQB 3BMQA 3KPVA 4MS1A 3DAFA 2G1UA 2V9ZA 3FYTA 3KEQA 4YUVA 1LTQA 2DFDA 3A6HA 3FDXA 1FFGA 5T64A 3WAJA 5JCJA 3X1ZA 4AP6A 2GGSA 2RI6A 3LAWA 3BPSA 5A5GA 3E5HA 1AXEA 3ZZUA 2LDBA 3AF0A 4Y2SA 4E3ZA 2HU5A 2SKEA 4D96A 2GF0A 1TTQB 3GBSA 3N1UA 1XF1A 1UBKS 2EG9A 1MQ9A 4P7GA 2VUHB 4UW9A 5ALGA 2BCEA 3CCVB 4ZAZA 5FJJA 1F1JA 1M10A 3FVVA 4GW3A 2DX7A 3KQOA 4AWAA 2P2LA 4YMWA 5A9RA 1QFSA 3B5JA 2NLOA 1ZBQA 2FDXA 2PZ8A 3RSHA 2MCFA 2QN8A 3F7MA 4YJGB 1P31A 3ROTA 4BYGA 3MJVA 1ACMA 1A8QA 5KAPA 3P0HA 3AJ9A 5BUSA 3BMCB 3PS9A 3U3JA 3SD7A 4DJFC 3NO4A 8OHMA 3KUCA 5LKAA 2H5LA 1LGYA 3ACCA 1L8QA 4M7RA 4YRRA 4D9KA 3HXLA 4ZT5A 4NOLA 4ECEA 4BB0A 2ACKA 3A06A 5HUQA 3IRUA 2AN1A 1C1XB 1VHEA 3CUEF 5I5GA 4EB6B 2VAPA 1NVGA 2P6RA 4RVGA 3NR2A 2IBSA 3LU1A 5AUOB 3AXSA 2GA8A 2YC2C 3QFTA 4EL5A 5H9VA 2H1OA 3QYPA 1V47A 1IOLA 4H35A 3R40A 3GUZA 3RBZA 1FNDA 4K05A 1L5MA 1WP9A 3OZEA 4V02A 5FTWA 3DZ8A 2YHIA 1SXJD 4LSWA 5BVGB 3IB3A 3D7RA 5IUKC 2XMRA 1Z73A 2IWHA 3W77A 1XALA 1UD5A 3NKVA 4JH0A 5JANA 4ER7A 1JG6A 3FWZA 2I2WA 2F1JA 2D0OB 2GD2A 1SU4A 5DS0A 2BKAA 2OCYC 3IHLA 1VIAA 5JJCA 1DAMA 3HYNA 1WBBA 4WECA 5BSGA 2P7IA 4CLRA 4RELA 3OURA 2TYSB 3JYOA 4RIFA 5AVQA 3UAZA 4F3YA 1JKJB 2CVPA 4M6WA 2JJ1A 3QG1A 1QQ7A 3MWKA 3D9QX 4US1R 1GGNA 1T2DA 4Q16A 2RARA 2XD4A 2Y6UA 4AURA 4XGQA 5JJBA 4KFSA 3T3DA 3ASSA 2C98A 2PTHA 4MS3A 3W6OA 4F2WA 3F97A 1T9HA 2ASEA 3C3PA 1C8LA 1C0LA 4R1QA 3ZY4A 4R0VA 1VQOB 4RKWA 4ZXPA 4EHIA 5T57A 4AXXA 1NQ5A 4RSRA 5EJ7A 2RHDA 3HRKA 4B4KA 3PQ5A 2BONA 4LK2A 4JFRA 5DT2A 1R6TA 4HFMA 1XP5A 1SVIA 2Q3DA 3BSYA 4JDUA 4Q9HA 4XRRA 5E95A 2AS0A 3NXSA 4BKRA 3OFSA 4ENUA 5J3OA 3DBLB 5CNKA 5AJVB 5A6SB 4YRSA 3CCSB 1R4NB 4TMYA 4D74A 4IQFA 3R77A 1Z4IA 5BSEA 1V37A 2X0RA 2I65A 2P2YA 4YCDA 3UGJA 3V7YA 2F3SA 2A1IA 1NWCA 4OFWA 1EA7A 1UMDA 2QT9A 5GJCA 3QTTA 3L7BA 1HLGA 2B7LA 3W2GA 1TX4B 1W6RA 5E7QA 5GOTA 1GL9B 3D0KA 3QTLA 3OCVA 1W2BB 4IBOA 4K3VA 3GMSA 2DHCA 4HEA1 1XZQA 2G36A 3UHJA 4H16A 2XIQA 2I9PA 4KJZA 3NWJA 1CUCA 2E21A 4N39A 5KTTA 4KQGA 2XTAA 2X3UA 4TTVA 1NNEA 3PLAE 3PL1A 4XR9A 5HE9A 3BIWA 2WQZA 4JENA 4BJ1A 3DMHA 1N0UA 2B69A 5C8VA 2HUNA 4B2LA 3GJ4A 3CEPB 3V1KA 1KF0A 3CM0A 1GPNA 5GVRA 2QTWB 4Y8VA 3UCFA 1PFVA 3NWBA 3GPCA 3O8NA 4J2TA 3U3DA 5KDOA 5F1OA 3TNFA 1C8KA 4Q4DA 3M2PA 4BZZA 2V3CC 1TEZA 3LTEA 1TGVA 2YRWA 2ZRBA 4KKUA 2BFAA 4WOBA 3VU9B 1WY5A 4EENA 2V97A 1J0XO 3EUFA 3H9QA 4JK3A 1KKMA 3DDSA 3VC3A 3SVLA 4R2HA 4TV8F 1YI1A 2HRQA 1K3FA 3A4IA 4QNNA 4G0YA 3RPEA 3EY4A 1FYEA 3PHCA 5GZ1A 3OESA 1Z16A 2FSVC 3SIXA 3VTFA 3ZHCA 4OYLA 2QVLA 3U40A 1GDDA 2W8BB 1QNFA 2QZZA 3E9YA 4HGOA 4R2WA 5EY5B 1DAHA 1D07A 4G5GA 1SU7A 1AS2A 3NEPX 1LS6A 5LXTF 2NNLD 2ZYWX 4DC9A 5E9AA 4CGYA 1XDBA 1Z5PA 5BVHA 5REQB 1LX7A 4J7CA 4URZR 5FI5A 4K9MA 3ZDEA 4IV0A 2C9BA 3JQCA 4GYKA 5LB4A 1VG9B 2IOHA 2D06A 5I9NA 4X1OA 4HBZA 1CVLA 3N2NA 3PTAA 1D0IA 3TTVA 4M0UA 4X0CA 1U5CA 3RSCA 1NOKA 3W6PA 1E5XA 1GL7A 1Q1BA 1RSZA 2IU4A 1GM5A 3RYIB 2ZDHA 2CVZA 5F35A 2AC7A 3PC4A 2R5FA 2OP1A 1MT0A 4ME6A 1YRLA 5HTKA 1N0HA 2ZRPA 3RTDA 1I32A 1EXDA 1TAQA 3EC1A 1N5DA 3EVAA 3RC7A 4WKBA 4X6YA 5FH9A 1A71A 3R0JA 2Y1EA 1QKKA 4YDSA 3BGVA 1LBIA 1A7AA 2GTIA 4RXTA 4TUYB 4BNLA 2XUOA 2WSLA 3JQRA 5LBIA 1ZM2A 1L7RA 4B5LA 4ENWA 3KQVA 2NXNA 1MO2A 1EAMA 3P2KA 5AVKA 2PZBA 1YRHA 5TJ9A 4GF5A 5MF6A 4Z7NB 1OWPA 4WXYB 1ODCA 2XOKA 4NIMA 1O57A 3GZNA 2EATA 1I3CA 4IIYA 1ISRA 4P4SA 4TV9B 3DPIA 4YXWD 3GWGA 3DC2A 1OHHD 3H99A 4I3HA 1X7WB 1OZHA 1SVLA 3D8BA 3OCCA 4MKIA 4OAPA 4ZIRA 5ALYA 5C4IA 1M6VB 1E9SA 4LQDA 4H27A 4OP2A 3TCKA 1P4RA 1A8HA 1AHNA 2MINB 4ND5A 3WWCA 5DTMA 2EFDB 4KXWA 2ZUFA 2E6UX 4AMZA 1Y4DE 1RZUA 4GGOA 4TTRA 1N34B 3LYAA 3P2OA 3CF6R 1XXHE 2O20A 1G5QA 2ZDGA 4MW5A 2C2OA 2NGRA 2ACEA 1KSFX 3O03A 1XLWA 3ZLTA 3N0RA 4E5MA 4F46A 1XDGA 1E3WA 2ZSAA 5EJGA 3KYDA 4IMPA 3IEVA 4TX1A 4MYSA 3LQQA 2F1IA 4ZEVA 4BFYA 5GJBA 3F5SA 3GJXC 4O1IA 1O6GA 1KRWA 1C0KA 4ZCTA 2EX4A 4P9SA 5KWEA 1HUQA 1WOSA 3WRYC 2PMKA 3BF8A 1F6BA 3OY7A 4D4GA 4NH0A 3RVSA 4TVBA 4ZMBA 4GKKB 3ZR4B 3SR3A 5ECWA 5BPHA 2FLKA 4Y9RA 2HY7A 2RHLA 3IO5A 2F6RA 2P9EA 3T3HA 1SKBA 2ZSIA 1GTMA 2HRRA 2J09A 4F3KA 4UXHA 1JAXA 2VF4X 1BS9A 3ELDA 4AMBA 1FNSA 2PJDA 5FI0B 2VOJA 2IUUA 1H8HA 4JKIA 1WMFA 1WTHD 3N2KB 5LLDA 3EQ7A 5EE9A 4YK7A 1N5OX 2R7LA 4FX2A 5C5EA 3D3WB 1NZJA 4H3VA 2F9LA 3TPZA 4F5ZA 3E1SA 2CW5A 1P18A 2UXDB 1IY2A 3ZS9A 2RKWA 1GNQA 4LDAA 3A6FA 1AZLA 3LA6A 5LLTA 1KWKA 4P4LA 1TMOA 1JGTA 1SUWA 4PBTA 3DMYA 1VL6A 4QNMA 3OVMA 3L6CA 2FWRA 2FQWA 2IC5A 2PL5A 2PA3A 3FFWA 4NYJQ 1ZOIA 4G9EA 3LUJA 4RTRA 1W4ZA 4IIBA 4FP9A 3A6GA 2FEWB 3L0BA 4GMFA 3SXPA 1JQDA 4UNSA 1JSCA 2Q8NA 2YZGA 3GJ8A 3QOFA 4DT1A 1AH2A 1X0XA 2WPDD 5L3RA 3AM3A 2Y0EA 1N4DA 2NT4A 5ULLA 1R3UA 3FNIA 4BX8A 3U56A 1EFUA 5A3SA 1Q7CA 3CKMA 3GEGA 4JLNA 4KCGA 4ZRMA 3TAHA 2J9XB 4LHVA 3WDKA 1KZ9A 4BMSA 4C4TA 3TZQA 1EUDB 1QG4A 3G7UA 1QF9A 4RD4A 1PEYA 1YQQA 4LZJA 2W4QA 3AC0A 4U5QA 2LVBA 3DEYX 1M6YA 4FPXA 3SX0A 1ND6A 3WSVA 3WGVA 4OQFA 3ZGZA 5FR1A 4CNQA 1KD1D 1NF8A 3ZDXB 2WWGA 4PR3A 4YJGA 5LDGA 5KOIA 1R5OA 2B78A 3B52X 4HAXA 4RTKA 1N8TA 3EYAA 1JBQA 3DDOA 3FHJA 1J1ZA 4I8DA 4RZUA 4YP7A 3S1SA 4RD3A 4QULA 2JIQA 1L5NA 4YO8A 1PK7A 4M9QA 3Q7TA 4N4AA 1AQIA 5HKLA 1EX9A 1GKIA 1RAEA 1G63A 2WIKA 3N8DA 3JQPA 4O1MA 2VTBB 3EVFA 1TD1A 3NONA 4N9QA 2QTCA 2Y68A 5E6UA 3O8RA 3IKVA 3PC8C 3GLFA 3KFVA 5BO5A 4WNAA 3V80A 4HPXB 1JE1A 4LZWA 1GVNB 2I3BA 2Q2VA 1XZGA 2V96A 4LCBA 5C34B 9ABPA 3BL6A 3D6UA 1WEKA 4ITUA 3RUDA 4EB6A 4TXNA 2VSOA 5KREA 2XB8A 3B85A 16PKA 2CKDA 2IZZA 1JB1A 1YQGA 1FVXA 2YZKA 1AQLA 1VZ2A 3G2IA 1FUIA 3LKVA 2VYND 5K99A 5M5BA 1D6MA 2JH9A 1PU2A 5DSXA 2YJ4A 1O4VA 2EF0A 3EDMA 2PX2A 3JQ9C 5K0GA 1RPZA 3RS0A 5LQRA 3MAAC 3R6TA 1C1DA 3EPJA 1MV5A 1MHPA 8LDHA 2ZZMA 2AG6A 4P3PA 2ZTHA 4A8JA 4EFLA 2Z3VA 1SXIA 1V7CA 4UE2A 3M3HA 4CXMA 3COVA 2A78A 4B43A 2W2QA 3JATA 4MUNA 2OBTA 2G8NA 2NACA 3MTJA 5LZ7A 5BV2P 2GEJA 3RU9A 2ORYA 5KNCD 5A05A 4RWZA 3DSRA 2PRIA 2JH3A 2V6GA 3L93A 4P4GA 1CLEA 4TPKA 4NCBA 4RKYA 4B3JA 2D3TA 2QLFA 4BNHA 4RZ2A 4CQJA 1P2GA 4ZT4A 5ICCA 4B9AA 1P7PA 1PJQA 4N0MA 3TD9A 3JWEA 4KRXA 5C52B 3B82A 4LF5B 3BCDA 3KB6A 2QNBA 1Y48E 4Y1RA 4YGXB 3PEWA 5L8VA 2GAJA 2P5YA 2VDPB 4V0NA 2WSSD 3USES 2RSLA 2GCIA 3ZH2A 4ED9A 5JCZA 1VIMA 5AVOA 3V9PA 3GLSA 5J4LA 5CPBA 2DB3A 2FP4A 4Q37A 5KHLB 1WULS 3PBKA 1HTTA 1EXMA 3GAZA 1QHGA 4EG1A 1E18A 1EI9A 1QV9A 2FRDC 3KJZA 5L3SB 1W44A 1KSHA 1ZMTA 1I2AA 4JB3A 3L46A 1E92A 4BKUA 4X6LA 4GYYA 4K1LA 4NP6A 1YDFA 2B2NA 5AESA 1JA9A 5AVYA 5CT4A 2VXYA 1JHPA 2UVDA 3KR0A 4ZQFA 5KTYA 4P0PB 4GLLA 5HP4A 3MTBA 4JZYA 4Q3OA 3G5UA 2FXIA 4N9WA 3R24A 5AVUA 3T3NA 1Q3KA 2PG3A 3GCWA 1Q6ZA 1Q1NA 4V0RA 3GIWA 1DPGA 5DTEA 2FFRA 4C0KA 1N06A 3KZMA 1E2BA 3MS4A 1CUDA 3AL3A 4OMUA 2QRNA 4OV6B 4QHSA 1ZD3A 1B8PA 3G23A 4O3FA 1D04A 2EVWX 2VHYA 3NBUA 1UR5A 2QY6A 3A3YA 2H1RA 4N3AA 2OORA 4HEA6 4DSNA 3AF5A 2NSLA 4NFLA 1RTKA 4YECA 5HK8A 3A27A 4TWJA 3GJYA 3ZX4A 3U9SA 3Q88A 4B6PA 2PVPA 4K9KA 3W7VA 2C7RA 1YXMA 4PGGA 1H2BA 3FSGD 3ZWKA 1NVBA 4DJTA 2JIZD 1RCFA 3UMGA 1ZRNA 2G0AA 2WHYA 3QPUA 5ELMA 4CFSA 4EB3A 2J3MA 3H8SA 4D41A 4RGBA 5C18A 3C5VA 4RA6A 5KOJB 4GGMX 2IZ0A 2ZVDA 4C6TB 1KEEB 1DP4A 3E05A 3FETA 3H18A 1XJCA 4FNMA 4IUCS 4JVOA 1ZUD1 4WESB 4O4JF 4Q0MA 5FQOA 4JI4B 2XEDA 3BQNB 4RVUA 4E1AA 4KKSA 2FEMA 2J0VA 3VU9A 2PS3A 1JEQB 1UM8A 3DBRA 1DC3A 4RTJA 2DHRA 2QGZA 3TEMA 4G0PA 1F6DA 5EJIA 5EJ8A 2GBCA 3RS3A 2Y3IA 5CFRA 4UZUA 1DAGA 1ULZA 4G86A 5DGXA 1GRCA 1GFZA 1IXKA 3FN4A 1NASA 3O8QA 3KBBA 3N5KA 3R5TA 4IUBS 1ZK1A 4PYJA 1ZU4A 2VLBA 1LPOA 3CRQA 1HVXA 1UCFA 3G8YA 1G17A 1E2UA 3HYSA 3IT0A 4POAA 1YJQA 3DOIA 4TS3A 3KQNA 2I33A 2RH8A 3Q8MA 4RHTA 1YQ9A 1VSTA 5EJ9A 3GVLA 3OHMA 3NHAA 2A94A 4BEVA 4E1VA 4CM5A 3KSRA 5EXTA 5F5NA 3V55A 4EKIA 1K7CA 2BKLA 2RBEA 3DPUA 3ZDAA 5LIPA 1G8MA 3REQA 1R9JA 1U3VA 1QAMA 1V8ZA 2CLCX 2QYOA 3K6JA 4WNYA 4AJPA 5JSHA 6AT1A 1BHJA 2OOSA 1SA0B 3N7AA 4D6XA 4ESHA 4F6CA 2YN4A 1LDBA 3WQHA 3H2HA 3G8BA 3LXXA 1DIRA 3FIUA 3GHYA 4HGPA 3G89A 1HXHA 3Q6NA 2AWNA 2OSVA 3H5IA 4M37A 1B73A 1GCUA 3MTGA 1X8KA 3BSSA 3I45A 2H2AA 1N32B 2HWYA 3OZ7A 1DBRA 3EQ6A 4RQAA 4YUAA 1YF3A 4CQNA 2VRCA 2P7HA 3DAOA 4RGYA 4C0WA 4B47A 4LF4B 1VFPA 4FCWA 3U31A 5DN6A 5ITVA 2PZGA 5EMMA 4MTLA 1QDUA 3CNEA 1XHEA 2RHJA 3AR5A 4W6ZA 1JALA 1QZ3A 1TC1A 3SLNA 3BRWD 5KTKA 1MDBA 5HNKA 1RHMA 3GRYA 4RF3A 2F2TA 3QW4B 3THSA 3TLGA 2G25A 5HJEA 3AF1A 2AE2A 2KHZA 4TTIA 3K0HA 1T5HX 1W88B 3IO3A 4GI5A 5DHTA 2UZ4A 1TYDE 3DCNA 4I50F 3UJ7A 4D43A 3TRFA 2XT6A 3MILA 2EL9A 2GASA 3DOEA 4QNRA 4R51A 4UOZA 1IMOA 521PA 3DHEA 3ZBUA 2KSQA 2YJ3A 3CH7A 4DUGD 4RTSA 4L75A 5KO2A 4CM9A 2C29D 1YI8A 2Z4RA 3ZWWA 3DWGA 2AX4A 2NO9A 2HADA 1IATA 1IWBB 2FPMA 3LQ1A 3A7DA 4D8YA 2OPBA 4FYKA 3ISJA 3BXHA 4A92A 4EW3A 5LYJB 4WVLA 3E7XA 2HA6A 5K1ZA 4GZ5A 4Q03A 3UHFA 1C7RA 1EM8B 1G21B 4TKLA 5CXXA 4DANA 2FPOA 2NADA 3BUSA 2AC2A 4YJFB 5H0IA 4E51A 1TCBA 1KHTA 1W1IA 2PWAA 1QOPB 1YUMA 4M0CA 4MJXA 3M4ZA 1GTZA 4TQUS 1B4DA 1N2ZA 4NR0A 4X6XA 1ZM7A 4EX6A 4N76A 2GAFA 5IJZA 3TX6A 1RRCA 4XQ0A 1HEUA 4KNWA 4GX1A 1Z68A 2D1YA 3UWOA 5AOCA 5A62A 1OA1A 4MDFA 3DKVA 3T1YB 1T9CA 3EPKA 1VQ8B 3VO1A 3SHVA 1PJSA 1FMFA 3MMZA 4JP1A 4QEKA 2J3IA 5FBWB 2C9MA 4QQRA 1EP3B 1DU4A 3H5RA 1RZRA 3ZGVA 5LFAA 2FQYA 3TQTA 2ZJ0A 2R65A 1WCV1 3B1ZA 3MWDB 2B8EA 2GLXA 3EIUA 4WRRA 2GRJA 1VLQA 5GTDA 4B4DA 2IVFA 1E0KA 1KIAA 4FGZA 1AVTA 3FB4A 5CT9A 1J7KA 2B92A 3A2NA 3FOAA 3FXAA 4ZRDA 5GONA 5JSZB 3FR8A 4O4HA 4Q3BA 5HS6A 1J8YF 3D0OA 1UC4B 4GL2A 3HBJA 3DXYA 5C1PA 2H2DA 2HMTA 2VP5A 3FVWA 1FNCA 1VCIA 4UBKA 3T9CA 1MF7A 1A5AB 3KJQA 3ZHZA 2PBZA 5LU9A 2QT1A 2OB2A 2PBFA 3FDFA 3G5AA 1VKJA 2W22A 4GX2A 4OBEA 4XYBA 1ZNWA 2OLEA 2VBGA 5EJ4A 1SKQA 1BW9B 4Z1MA 3EXIB 4HDMA 4OUDB 1LWOA 2YY6A 3HKCA 3AO0B 3HBLA 2A9KA 4HWPA 3WICA 1QRSA 4I0WB 2VEDA 3EOBI 4G89A 1GAXA 5JZMA 2GD1O 3PC6A 3EWSA 2GERA 1J0EA 2G28A 4Y9TA 5H5JA 1KJ9A 3LSYA 4CI0B 5K6TA 4OHZA 3RT9A 2ZRAA 4O02B 2LGJA 4W9NA 3WMFA 4H6XA 1SRQA 1I01A 1N25A 2GM9A 1JPNA 2HSDA 3DM5A 4GX0A 3KKPA 3OPXA 4ZYXA 4H6PA 2LP4Y 4CN9A 2G9ZA 5I7HA 1GZ5A 5DJ5A 1OLSB 1KBQA 1Y1TA 3RASA 4C29A 2QTFA 5EE0A 2H59A 5CNIA 2J33A 4QTXA 2F4NA 4OH1A 4QDKA 1IPFA 2AG8A 4WCDA 1R6UA 5EWJA 4P54A 3I4FA 3RSQA 1Q50A 4EATA 3WSWA 1NYLA 4EHHA 3BF7A 2J3JA 2JGDB 5EIEA 4J0IA 3OU7A 1UINA 3UYKA 3QLUA 4DV6B 5I48A 4L02A 3GDGA 1TZ2A 2CWWA 1VLJA 4LV5B 2E9SA 3BSFA 1NL3A 2OR3A 4HDKA 4ZVKA 2A92A 5DSZA 1NBEA 4ZK2A 4F3CA 5CA1B 4YEDA 1DARA 1TAHA 1H2EA 5I7VA 3KOYA 2OK8A 1BO6A 2GBLC 4EHJA 3LKZA 2AOTB 2PWPA 3TLAA 1P5FA 4XKWA 4UXJA 4GLJA 4UTVA 1IVSA 4GQBA 4GG1A 3VNSA 4AZ0B 2Z1DA 3WLQA 2GCPA 4F7DA 2Z9CA 2BLNA 3F7NA 2NZVG 3U9LA 2CLKB 2GO1A 2L18A 2G17A 1AHIA 2UU9B 4ZDIA 5HM8A