4RD4A

Structure of aif2 gamma from sulfolobus solfataricus bound to gdpnp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
413
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 413
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd4A01
1HQCA 4M1SA 1T0HB 3AH8A 4EH1A 4GI7A 1AN0A 3MG9A 4IOJA 1VQOB 1W4RA 2GRJA 5FI0B 1SVKA 1Q21A 5C4GB 4MKHA 4IDQA 4ARZB 4G0NA 2ODNA 4B3CA 4C4PA 4AF6A 1N6HA 1QRAA 3AP1A 4H9GA 2NZ8A 4DEXA 2AX4A 1QG2A 1DPFA 4PAQA 4OYHA 1E9DA 1KK1A 2QROA 3ADKA 4DQKA 3CBQA 1YVDA 1P9NA 3Q7PA 1DARA 1OFIA 1Z0KA 4GZLA 3IBYA 2FX3A 1JAHA 1DVRA 3L0PA 2QP4A 4B2LA 3ZBUA 5ELXA 2B8TA 3D31A 1H42A 1NJGA 2F6RA 3GEHA 2OFOA 4BEBA 1WB9A 4MGKR 5JBQA 3LQQA 3IQWA 4Q02A 2HYIC 1W46A 4ASUA 4B44A 4AG5A 1F2TB 2ZI5A 3LXXA 1SXJA 1DAEA 4JVMA 2G6BA 1CLUA 1ZVQA 4I1OA 1JJ2B 1Z0JA 3TK1A 3BB3A 2WJJA 2HXYA 1EK0A 2QAGC 4LY6A 1KI7A 3KFVA 1UFQA 4WBSA 5E7IA 5GV8A 1XCPA 4URWR 1FTSA 1SULA 3IHWA 3K70C 4W7SA 2QPOA 4NCNA 2G1KA 2YV5A 1W4AA 1WQ1R 2VYQA 2J1LA 5JCPA 1P2VA 1AA9A 3AVWA 2VP0A 1E98A 2CRVA 3CF6R 3DM5A 2JJ8A 4KFUA 2ZRKA 5CLQA 5KSYA 3O8CA 2NO9A 4Q66C 4DHEA 3REGA 1SVLA 4XVRA 1F48A 4FK8A 1HT1E 3UMRA 1UEIA 1HT2E 3U7FB 4B48A 4BFUA 2WM9B 2C9YA 2KI5A 2ZRMA 3QKSA 2WAYA 2GBLC 3GFOA 1RE0A 4QJ4A 3P26A 4URZR 4V0KA 4FD2A 3CF0A 2DETA 4TTQA 4DXAA 5KNCA 4FCWA 4NCHA 3TUJC 1JQLB 3HYTA 3QXSA 1GOTA 2ZE5A 3GEEA 4NH0A 3CNOA 4UXJA 2EFGA 1EX7A 1W5TA 1OLOA 1WCV1 2OLJA 2ZITA 1BO6A 1F60A 2PMKA 2CNDA 2Q0HA 1II8B 1N6PA 2QE7D 4JL6A 3RS3A 4LUCA 2VHCA 4RZUA 4CZ2A 1DDGA 4DZZA 3GLIA 4TZ0A 3H1TA 4AY2A 1E2PA 3GLIB 3NHAA 4GNKA 2Z4SA 3PUVA 3K0SA 4LI0A 1Z29A 2I3BA 3OE7A 1P72A 3GLFB 3ZIAA 4QM6A 3FPAA 1KNXA 4QGAA 5EP4A 2RGNC 3C8UA 4DLVA 4W9MC 3SJBA 4G5QA 4NP6A 5AWFC 1QF9A 1RPZA 1AS0A 3CCVB 3RWOA 3KTAA 1KJWA 3GMTA 3I1FA 4KBFA 3U3KA 3KXKA 4RFVA 3WYGA 1JBKA 1Q1BA 3RABA 5JI2E 1HE8B 3WYAA 2ZM5A 2O8FB 3QG5A 4NBSA 3LW7A 4PHFA 4BQSA 4DSOA 4JBYA 3NWJA 3DKPA 3F8TA 4KCGA 1SGWA 5KO2A 3K0FB 4NYMR 4EPWA 3GLGA 1PV4A 2YWEA 4Q7KA 3VQTA 5B58C 3DDCA 4A8JC 1GVNB 3B85A 4Q19A 3GLGB 2JLRA 1SXJE 2V3CC 3TNFA 4EPYA 4GL2A 2JCSA 4DIDA 5G40A 4Q1AA 2IWRA 3GPLA 4B3DA 1E2LA 1OYYA 1NLFA 3Q9LA 2Q6TA 5CK5A 1LFDB 5HR5A 3ADCA 3CRVA 1KQSB 1QX4A 5EJEA 3F5FA 2A5FA 5TY0A 3MWKA 1QUEA 4KODA 5JCZA 3GLGE 2DEUA 4A0RA 3ONWA 4DLYA 3CD6B 4NYIQ 2WSSA 3Q3JB 4TQAA 2B21A 1G16A 1TUEA 3TGPA 1W35A 3ZGXA 3RRMA 2QRNA 4M1YA 5KDLA 1DAKA 1E69A 1JEDA 4ZDIA 4JL5A 4POAA 2X1VA 3RAPR 2DERA 4B3XA 1NKTA 1BYUA 1QHHB 1ZC4A 1W1WA 5FUXA 4ZGNB 1UF9A 4PZYA 1N0UA 1NP6A 4UNNA 2EIXA 2H18A 3B13B 1HE1C 2FJUA 3EZ9A 1ETUA 5G41A 5DHFA 1X8JA 1E1QA 3IEVA 1YR6A 3MLEA 3CCRB 1Z3IX 2FG5A 2ONJA 1I2MA 1HV8A 5CYOA 2BGIA 5H5JA 4B35A 4UAJA 1G3RA 2IXEA 4TL9A 3C4JA 2VSOA 1BMFD 2GJKA 3QJYA 3KB2A 4WAUA 3NBYC 1F20A 5J47A 1UAAA 4TZ6A 1KI9A 4I4LA 3W6PA 2B6HA 4I99A 1IM2A 4Q1BA 4ZCIA 4ZI3A 1YJ5A 2QP9X 4Q4HA 4XD7D 3VR3A 5FTMA 2KBFA 5BW8A 3HYRA 4DB2A 4C7OB 2ZRCA 3MCAA 1G18A 4D4LA 4BWYA 1G5PA 4DUGA 2BSAA 3SHWA 3O8RA 3HU3A 1U94A 1QHHA 2OEPA 2TMKA 3T1TA 1JALA 3VO1A 2G83A 3GJ4A 2XTMA 2OM2A 4LJAA 4MH0R 3R20A 4P0TA 5DI3A 3FFBA 3TBKA 4OHYA 1K8RA 1J99A 2CVHA 1G20E 1NBME 4CRWB 1PVOA 5LBIA 1XU4A 2LKCA 3LV8A 1N5IA 4GOJA 1S1CA 1E0KA 1NVXQ 1R0YA 3L0IB 4CEHB 3EPHA 3QQ5A 4TYPA 4IOLA 3RYTC 4DCSA 3X1ZA 2RGEA 1U81A 1VYVA 3LY5A 1YR8A 1XE1A 1KMQA 1W44A 4ZDJA 1KI8A 3DL0A 2IEYA 5CM8B 5K8IA 4LJ7A 1BJKA 1D9ZA 4KI0A 1MRSA 3BFKA 5FBQB 5JHHB 2C95A 4LHWA 2A5DA 2PEZA 1T0JB 3H2YA 3SEAA 3KUDA 4BLRA 1CF4A 3SR0A 1T91A 2BVNA 1DO0A 2ZRPA 4IDNA 1OHHA 2ASEA 2QTZA 2GCPA 2HYDA 4NCJA 2HCJB 3NG1A 2WWYA 2XNCA 1UJ2A 3BOSA 3I8XA 2E1RA 2H17A 4Q4JA 5BXQC 3V4RA 1VMAA 4L5BA 4LBWA 2LCFA 1Q1ZA 1H8HA 3QFCA 1L4UA 4Y7CA 1EWYA 1G1MA 1W47A 4DRZA 4IDOA 1P6XA 4QFMA 1FP6A 3L0OA 3X2SA 4V03A 1UPTA 1W48A 2YNMA 5BQ5A 2DHRA 1HYQA 1CJTC 2XJ4A 3DKVA 3RWMB 1ZNXA 4EPXA 1M7HA 3MWJA 3JQPA 1NIPA 3FE2A 1ZIOA 1XX6A 2J0SA 2XOKD 2F43B 1ZMXA 3JVUA 1GWNA 2NG1A 4W5WA 4XH9B 2QA4B 2RCNA 1D2NA 2H16A 3CR7A 2FV8A 1IQPA 5FL7D 5DISB 4QRHA 3UPUA 3TAUA 1U2RA 4ZDWA 3ZJYA 3CCQB 1OIVA 1P4SA 2H8KA 1XCMA 3TVDA 4JLOA 4GRAA 4CT4B 3RHFA 1Z28A 1JJVA 4OQFA 4X8HA 4A2PA 2IS1A 1OPXA 4DT1A 4GP7A 3K8YA 5FTJA 1AKYA 1ZNYA 1LF5A 4LHXA 3REFA 1XEXB 2BKUA 1DOAA 2KBEA 1VIYA 3AF1A 3RSLA 1YIJB 3ES9A 1KIMA 1OFTA 1XRJA 2FH5B 2GEUA 4MRRA 5FFMA 1KRHA 2BN4A 1EFRA 2GILA 3R9IA 3SJCA 2A9KA 5DI3B 2ZR7A 4IRUB 5CB8A 4NPHA 4QG7A 1JECA 3LDAA 1N8RD 1TEXA 4HE6A 3I56B 4WZBE 5KU1A 2QEXB 1X1RA 4Q7MB 4JIMA 4DDVA 1JPNA 3FFAA 1R5OA 3B9QA 1N0WA 3AVVA 2WKRA 4R7ZA 1U0JA 1ZC3A 4G5RA 2UZ3A 3OFND 5JS8A 3VO2A 2ZS8A 4EKDA 4WOPA 3THXA 4GT1A 1WMSA 2F3TA 3EIEA 1LV7A 3OIWA 4QNMA 2QSYA 1PUIA 5LD2B 4H1UA 4CDGA 2PL3A 5TVKA 1JNYA 2GEVA 3CX6A 3VTKA 3NBZC 1YI2B 1M34E 2QEQA 3I61A 2VHQA 1GAJA 4P4UA 2PH1A 1XNJA 1G64A 3IIMA 1BOFA 1FDRA 1XCGB 3GEIA 4RFSB 3WBKA 4CF7A 4OK3A 1RJ9B 4PPQA 5FTNA 3LO5A 5CIWA 1W4CA 3EA0A 2QMHA 1YRAA 2MMGA 3Q8XB 3D6TB 4NKRA 1QVAA 3HR8A 1LY1A 3THXB 4GZMA 3KXIA 3SE0A 1OB5A 2YC2C 1ZNWA 2C2HA 1HTWA 1GG2A 2XOKA 3HWSA 1ZUIA 2BC9A 1QFYA 2XITA 3WMEA 3OZWA 2R6GA 3PIRA 1F2UB 1LS1A 3ZS9A 1EFUA 1GVHA 4M0LA 1SHKA 3KUCA 4HLCA 4H1VA 5DGXA 2XNJA 3KDSE 2O0JA 1NVVR 2IYTA 3K9HA 2ZRJA 5D3QA 4DWJA 4HAUA 3I5YA 2GPJA 4UJ5A 1TPZA 4LWZA 4S2EA 2ZRIA 1Z07A 2OBLA 2QUZA 4IHQA 3VR5A 1P9RA 5TB5A 3L8YA 2ERXA 3G5UA 1VQ5B 3NDBB 3RSOA 3L8ZA 3CX8A 2ATXA 3AKDA 1WF3A 2D2FA 1JQJC 2D2EA 1XTSA 3B1VA 3LLUA 2QMEA 1KZGB 3JQQA 2DFKB 5TDHA 1X8KA 4KHZA 2AD5A 4I1UA 2VL7A 1M6NA 1FOEB 2I1QA 2R6FA 3OEHD 3PEVA 1JXMA 4ACBA 2KSQA 4BFVA 1S3GA 2XEXA 4NHOA 2WBLC 3K0CC 3FVQA 5KOYA 1Z63A 1COWA 4BLPA 2IYYA 4OJQA 4TT3A 2NPIA 3IIJA 4KFTA 1QHSA 4KSCA 5F9FA 4PPGA 1ELOA 3GFTA 1TLLA 4OK6A 1QG4A 1KO8A 5LPNA 1II0A 1Z22A 2J3EA 4C3ZA 4E09A 3IPXA 2ZRBA 2BPOA 2VF7A 3OAAA 2XZPA 3AKCA 3FYHA 2DWPA 2IXFA 3QF7A 2PCJA 1F3OA 1US8B 4TLAA 4XD7A 2JLSA 2OUKA 2X77A 1W5SA 1GL6A 1G291 1KDRA 1XTRA 4ZIRA 1TU4A 4MYHA 2Z6VA 4PTLA 2QTVB 4RZ2A 2WOOA 2HT1A 5FOTA 3UATA 5HZKA 2HEIA 3L43A 3DEFA 2RAPA 2XNDD 4GP6A 2VQSA 2PIAA 2GCOB 3F3YA 5JRZA 1XJCA 5BN5A 4AWXA 4M1MA 2GETA 1RKBA 2CHQA 3DO6A 3LAWA 3TKLA 1FNBA 3PV0A 2JIZD 2XSZA 1U8ZA 1Z0IA 2QDXA 1RRFA 3AF3A 3F0TA 3J81k 5L3RA 1G17A 2GWHA 4HUQB 1LNZA 1LVGA 4EPVA 1JR6A 2ZYWX 2ZRGA 4US2R 4M1WA 3GCGA 1XB2A 2MSEB 4PFSA 2JLWA 2ZSFA 1XD2A 2V6IA 2QGNA 2VH5R 3LA6A 3RNLA 2YKGA 2NPFA 4KV9A 2Q3MA 1AK2A 4PX9A 4TLCA 4DIEA 4DLRA 1J9ZA 3KKMA 1QGAA 3QXJA 2OBMA 4KO8A 3WHKA 4JYCA 2ZI7A 3KQNA 1RW4A 1VCIA 2X2FA 3AF2A 2HLDD 3TIFA 1CXZA 1NBMA 3U7HB 4A0GA 2P6UA 1EWRA 3QVVA 3MUFA 3RRNA 2RHDA 4OHXA 3QPVA 1BIFA 2A30A 1N6IA 2BEKA 4JLBA 3GQBA 4AKEA 1KO7A 2JDIA 1CNEA 2ZAMA 1VIAA 1TEVA 4B71A 4PQYA 2GXUA 1RRPA 2ZYTX 5LB4A 5JJIA 1T8TA 4LGMA 1S9DA 3ZDQA 1FPMA 5FPHA 2PMDA 4DDWA 1COWD 1S72B 3O8BA 3FJOA 1OV4A 4QBGB 3BS4A 4LBVA 4QBIA 2OG2A 2EFEB 4US0R 2O8CB 2FA9A 4ZI2A 2VP4A 3IIKA 2C78A 5A4JA 2DY1A 4QC2A 3CMAB 2BMJA 4PC1A 3KKQA 1TVCA 1E2MA 1G3MA 1X3SA 2OFXA 4Q4JB 4F4IA 2ZUBA 1NLZA 1UDWA 4GPTA 4A2WA 2ZXUA 1VECA 1OH7A 2R9VA 5IK2A 3TVTA 1GNQA 1IXRC 2ZE7A 1G41A 1YE8A 2RGXA 1Z6AA 3UXMA 1OKKD 5KSWB 3SNHA 4MDEA 4MUBA 3UG7A 4RD0A 4AKHA 3HJNA 3W5HA 5FBRB 5F2EA 2QT1A 2J7PD 3BGWA 4IFEA 2UZIR 2QENA 1NG1A 4CYMA 1UDXA 3KB1A 4HLUA 3BWDD 3CIOA 3B8HA 2FPMA 4ILEA 4KXFB 4MKFA 4NTZA 1FUUA 1IBRA 1KO4A 2ZYVX 3W9YA 4XWOA 1DELA 1U9IA 4RCYA 4HLDA 1K5GA 1Q44A 5K8TA 3THWA 4C30A 1NIJA 4EFMA 2YYZA 2FSFA 5FPTA 8OHMA 2GHIA 1H85A 3WY9A 1P60A 3T5GA 3OFNA 4LCBA 1S0UA 1RIFA 1BQEA 3FB4A 4ZCMA 5BYKA 2VO1A 4FW9A 4HEJA 2IS4A 2BMDA 1G5RA 2FPLA 1QHIA 1MO4A 2FFHA 3TH5A 3LNCA 3ECCA 3ICEA 2VP2A 4WXRA 2VRWA 1FMLA 2EYQA 2ZROA 5FUYA 1XWIA 1TQ2A 3EG5A 2GZDA 4JLVA 4C7OA 3QBVA 2WZQA 3K9LA 3QFRA 2GXQA 1GRRA 1VQKB 3PEWA 4M9SA 3CH5A 2IT1A 2FEMA 1W2HA 4A92A 4NCKA 3MWYW 2YOHA 4Q9HA 1J8YF 1UEJA 1IY2A 4WZ6A 5EXTA 4DLSA 3KQHA 3NKVA 1I4LD 1KK2A 3VR6A 3HU1A 2LWIA 2W2TA 2GNOA 2XSZD 2ZSAA 3NDPA 2C04A 2Z43A 1TQ4A 2ZUCA 3AM1A 2Q9AA 4IXMA 2CJWB 1R7RA 2R44A 3G0HA 1XMJA 3AVTA 5KPDA 3BORA 2OXCA 1ZU4A 1VCOA 3EARA 1II9A 3LVQE 2FSGA 2BMWA 3OW2B 3OHMA 4BRWA 3A4MA 4UQOA 3IO5A 2UKDA 4M9QA 2VP9A 3ZQ6A 5TMPA 5H8WA 4AYXA 5A5GA 1NVVQ 3CCMB 2HF9A 2WIAA 4GOKA 3B1YA 4ZGQB 1X6VA 3P4YA 3U3JA 4LHYA 3TQCA 3B82A 4FI3C 1NBMD 3CC4B 3EZFA 1YZUA 4YC7A 1RRCA 2QU8A 2REOA 2A5JA 3I73A 1E1RD 4CT5A 4V0MA 5IHPA 4D26A 3A37A 1G6HA 3KQKA 4Y9UA 3EZ6A 4QHYA 1MABA 1F2TA 4PSVA 4M2LA 1N6OA 2XZOA 3LX5A 4PAOA 4FMCF 1KTVA 4CIDA 4W5JA 4B3GA 1TQDA 1UKYA 1KSGA 3TJZA 2P2LA 1UMKA 2GK6A 1AZSC 1CQXA 2ZS9A 4MKGA 5H70A 3L2OB 4KAXA 5J4LA 3CWZA 2W6JD 4D4KA 1OB2A 2ZI4A 4JLNA 2A2ZA 1TAGA 4R2HA 5GJVC 4EJSB 1EGAA 1N6RA 1A2KC 3EC2A 1YR9A 2BGJA 2WJYA 5F9HA 3FKSD 1G4AE 2IC5A 3O47A 4HAZA 2GEDA 3MD0A 2R65A 2WKPA 3K09C 1KSHA 1ZM3A 4YAFA 4F7WA 4ZKDA 1VKJA 1Q7YD 3QKSB 4O2LA 2QTLA 1ZU5A 4BFTA 4AD8A 1P2TA 3AQ4A 4YLGA 4DDUA 1Q86D 1XBTA 2JJ2D 1C4OA 4QJ3A 2CEAA 2J87A 2ZU0C 2ZSDA 3B1ZA 4MKIA 2VNKA 3RANA 2IYVA 3CRZA 4Q1FA 3MGCA 4Q4LA 1VQLB 1U8AA 5EZ6B 3I5XA 2CVFA 2CHVA 4YAOA 2FZ4A 2RGNA 4G01B 2CL6X 2DFLA 3DVLA 5KNBA 1P7CA 2ZJYA 1NJID 1YHQB 4BLSA 2PCLA 1IJEA 1IN5A 1CJVC 2R62A 1N3BA 1G8YA 2A5YB 3QFTA 4Q4AB 1ANKA 1Q81D 4LOAA 3DPUA 3U3MA 5FOWA 4ZKEA 4NYJQ 2WHXA 1YJWB 4EPRA 2D06A 1X8LA 1E9SA 4KYIB 4OJKA 3BH7A 1AZTA 3V00A 3CF2A 2XB2A 1T8UA 2V8OA 2ZAOA 3A4LA 3AVOA 1IN7A 4PC7A 1Z0AA 4TYYA 1E9FA 4TQ9A 4WXPA 1S8FA 2HCBA 1D8TA 2ZI6A 4C0KA 4LDJA 4DQLA 1V5WA 4IOKA 2JLYA 2OCPA 4B3BA 2NMVA 3R8CA 3SJAA 2K5UA 3K09A 1NMYA 121PA 1MOZA 3ZIAD 3GFPA 2W00A 2QAJA 3SYNA 4IFBA 5TV2A 1TF7A 1VCMA 3OE7D 1DEKA 2P6RA 4U7DA 4OI1A 4DSNA 4PANA 2D7DA 2ANBA 4K8OA 5DIFA 1T3HA 4XSGA 2R2AA 3GJ3A 1EP2B 1CIPA 2CNWA 4EJSC 5J4KA 4A4DA 3VHXA 4LHVA 2JLUA 2PZFA 5H59A 4B33A 2GCOA 2DYKA 3VX4A 1H65A 3QXCA 2FWRA 4RSGA 4D4MA 4NMMA 4C0QC 2PZGA 5SZHB 1NG9A 1OGJA 4AG6A 1ESNA 4C0AC 4DJTA 1OIXA 4F4CA 4EFLA 4OHWA 5SZJA 2IYWA 4OQNA 5ANRB 3SDZA 5EXXA 1SM4A 1E2JA 3GJ0A 4CW7A 3T06B 4CEJB 3AVUA 4XTRA 1FW6A 1CR2A 2QL6A 5AUPB 4JVNA 3EAQA 2D62A 2J45A 2BBWA 5FPYA 1XZPA 2GJ9A 3EIHA 2G9NA 1W36C 2EYUA 3T34A 4BZPA 2EU8A 2FNAA 1AIPA 3T15A 3PITA 1N2CE 2V6JA 1OYWA 4D82A 1FUKA 4KSBA 2XZLA 1II8A 1MH1A 4RY2A 2AXPA 1E94E 3UMFA 4PSAA 1NMZA 1ONBA 3U44B 2ZUDA 3NEJA 4G5SA 1T5LA 2NO1A 3RDPA 1Q1QA 4C0HA 5HCIA 3KKPA 1ZIPA 4TLEA 5SZIA 4ZCLA 4A36A 5JLJA 3K0AB 5CDFA 2V1XA 1XMIA 2XNSA 2ZTSA 3CPEA 2QN6A 3FWYA 1NRJB 3U3OA 3SN6A 6Q21A 5FR2A 3Q5EA 5DYGA 3KJHA 5FUVA 3M4YA 5BWMA 4JVSB 2GBLA 4FMDB 3ZYCA 4LJ9A 4O0MA 1EX6A 4D25A 3EA5A 1DE0A 1CR1A 4RD4A 4NDZA 2JEOA 3OZUA 2O0KA 5GADl 2B7CA 3T61A 2IF0A 4KITB 4A15A 3QEOA 1GKUB 4A0FA 2A7QA 4F92B 2WWHA 2IEZA 1E1RA 3L82B 4Q9KA 5JECA 1YZTA 1XMVA 3QE0A 2VF8A 4G1BA 1SKQA 1Q3HA 2ZE6A 4YQFA 3NXSA 2OCYC 1VG0B 2J41A 4AKGA 1D1NA 1FL9A 1Z6YA 2CLDX 1KGDA 3PG5A 4V0NA 4ZPXA 1XPUA 5J4HA 4LK2A 4RKEA 3WMFA 3T1OA 2FEOA 4TLBA 4P4TA 3PJRA 5AUNB 1KDTA 4R9UC 3AB3A 5L8VA 1XTKA 4HLQB 5CK4A 2V55B 2OZEA 1Z0FA 2W83A 2P65A 1I4TD 4F38A 2N1BA 3WRYC 3KFXA 2GKSA 1XF9A 3O8DA 3Q7QA 4PXAA 4D4JA 2WJVA 1TX4B 2PLRA 5CB6A 1MRNA 2IS2A 1XXHB 1YZLA 3CCJB 4B4DA 1ZD8A 2DWQA 1RJ9A 2R6AA 2RB4A 4BGDA 3AKYA 2JLXA 3QOFA 4TSFD 5JHGB 4ERNA 2V1UA 1K9MD 2GF9A 2BDTA 1IXSB 1QG0A 2W2XA 4JSYA 1C1YA 4FXPA 4Q7LA 4DSTA 3RVBA 2V7QD 2QE7A 1A1VA 3NC1C 3GP8A 1S4QA 5TARA 3RS4A 4Z1MA 2OE2A 4MYUA 4HUQA 4FIDA 1OIWA 2QMUA 3UIEA 3I4LA 4AYTA 1G7SA 1XDBA 2FDCA 4D0NA 2XTZA 2QORA 1NN1A 1G8PA 1X86B 1DO2A 4QHTA 1G5TA 2H1LA 3CRRA 2CBZA 2VSFA 2L0XA 1GRQA 2XGJA 1B23P 4P31A 1WRBA 2P6NA 2QA5A 3U3RA 1KI3A 4OBEA 4XVUA 1LF0A 3TW8B 2D7CA 2NIPA 4HDQB 1R0XA 3CPJB 3R7WA 1YITB 1G19A 3A8TA 3T5DA 4YALA 2QZ4A 3GD7A 4F91B 2ZETA 2OT3B 1G4UR 2FFQA 2PX0A 3MRSA 3W6OA 4MA4A 3P20A 3WNCA 3PUZA 4PHHA 1T6NA 3ZD7A 5EE9A 2BMFA 4FMDF 4FMCB 3X1WA 1XD8A 2O8DB 2F1IA 2OESA 3BH6A 1E9CA 3M0EA 3W3AA 4YONB 1E96A 2F9MA 3K1JA 1D2MA 3CM0A 2IYZA 3KZ1E 4DCTA 4X8LA 3SJZA 4KU4A 2IW3A 4G1UC 4V0ME 1FZQA 3HR7A 1M90D 5AUQA 3OZVA 2AWNA 2FF7A 3C7KA 1W36D 1PUJA 2XJ9A 4DUGD 3QF4B 2YC4C 1BYIA 5GVSA 3IHLA 4TYWA 4WQMA 1J8MF 5DHAA 2ZJBA 4RD1A 2RMKA 2F3RA 5J5CA 1YJ9B 1GNPA 3VX3A 3U61B 5CLLA 2O52A 3P32A 2DWOA 3TLXA 3UG6A 2CMKA 1Z2CA 4Q9LA 2DFTA 3AP2A 4LRWA 2PX3A 1NDHA 4XIGS 4JKYA 3BAFA 2IWHA 5CIQA 1GM5A 1NLYA 1DBSA 3OZXA 4AC9A 2ZYUX 3RRYA 2QY9A 4WZAE 4XVQA 1JEEA 2JJ1A 5JRJA 2IS6A 2JLZA 3VU9A 1P3JA 2F43A 2BJWA 4YMWA 1NVUQ 5BN4A 3VR2A 3W2HA 2C8VA 2JJ2A 4BFWA 2OK8A 4X8OA 2GXAA 3BERA 1T3LA 5L3SA 1M1KD 2ZRHA 1ZM7A 4ACAA 2FSIA 2VPPA 3EZ2A 2GDJA 1GUAA 2IYLD 3ASZA 4D2IA 4B6EA 3CCLB 4N0DA 4B76A 5JJLA 3BC1A 3WRXC 4HB3A 2GJ8A 2OBNA 3D7MA 4G5OA 2VTKA 4ZIRB 4MDFA 3CPWB 1FX0B 3FGNA 4P32A 4BFSA 5K8LA 1RRGA 1R2QA 4ESVA 2J9RA 3QF4A 3CCUB 2WOJA 5GJWC 2JJ1D 4LHZA 2W2VA 4V0LA 4OQLA 4FMBB 4PQFA 4V02A 2DBYA 2PZEA 1OH6A 4TMWA 4HZUB 4BLTA 1W87A 4B3FX 5KYKA 5GV7A 2R6CA 2ANCA 4FWTA 3K9NA 2BJVA 1NKSA 1SVOA 1MKYA 1YZNA 4B73A 2A5GA 3ZVRA 2KB0A 4HDCA 3LRPA 4P33A 4DVGA 3SYKA 3KKNA 5JSZB 2EFCB 4QBHA 4BZQA 2ODEA 4I81A 1IN4A 1OF1A 4HB0A 1CRQA 4QOSA 1KYIA 2IXGA 2RC6A 4LV5B 2RHMA 1L8QA 2GVDC 2ORWA 1FQJA 5D3MA 1AJEA 5B2ZA 3RS5A 1G6OA 2QQEA 1R10A 1FP7A 4NU0A 3CLVA 1OKKA 4HUTA 4LSGA 1QVRA 821PA 2OAP1 4WVFA 3W8RA 1HH4A 1JR3A 2ZSBA 4E07A 2GZAA 3SC3A 3QE2A 3VNVA 4ZV4A 2GK7A 4IDPA 5K8UA 1QVFB 3ZD6A 1DAHA 4G5GA 1VQMB 3EASA 2GJAA 3EWAA 4K81B 4NE2A 1ZNZA 1E1QD 5FBLB 4LBYA 3TR5A 5KPJA 3BK7A 1V43A 4URUR 2E87A 5FOSA 3KX2A 3W34A 3OEHA 2JIZA 421PA 1G8GA 1Q82D 2CLSA 2OCBA 4TWZA 3VFDA 5DNYB 4FCTA 5KDOA 2Z0MA 4UKDA 3TMKA 2QG6A 5EP2A 3LQRA 2O8CA 2HV8A 3GJ6A 1XMSA 1SXJB 2F7SA 4UNQA 3IGFA 2VEDA 4QNRA 3AGQA 1QHYA 2QM7A 1QGZA 2ZR0A 3HPRA 3KXLA 2XTNA 1WBBA 1YKSA 1R5NA 3I72A 4AI6A 5KUTA 4IVPA 4L9WA 1FNDA 2FGKA 1R0ZA 3EXAA 3GJ7A 2BV3A 2WVJA 3E20A 1UBFA 4FCVA 4M21A 3ZVLA 1Z06A 1W0KD 2WWFA 1VG8A 4QKQA 4TYQA 1NN0A 1GNRA 2P3SA 3CX7A 4BZXA 3N2IA 1B2RA 3QKTA 1JJ7A 3M1IA 5JWOA 1VG9B 1WA5A 3LBHA 4Q4HB 4KFSA 4PC6A 5C1BA 2O8BA 5KSPA 2ZIAA 4AKIA 4OI0A 3BB1A 2RH5A 3TAHA 1M8PA 2AXNA 1EFCA 3N5CA 1D9XA 3WP1B 3NHBA 3OF5A 3QENA 4UNPA 3GJ8A 4KJZA 3FMPB 4BUJA 1KNQA 4V0OA 1A8PA 2G3YA 3A58B 1KY2A 5HXBA 4NL4H 4CEIA 4CVNA 1QBKC 1GP2A 4MRVA 4TYNA 5FH9A 3OESA 1E2FA 2IYRA 4PHTA 3R7WB 5IK2D 3MMPA 5HPYB 3ADBA 1A82A 3CCSB 3CC7B 5EMNA 1YRBA 5DE3A 1XEWX 4MGZR 1IY1A 2REBA 4NYMQ 4A6PA 1YJNB 4HZIA 3RC3A 5C46F 2G0TA 1LTQA 2CL7X 1XPOA 4R2IA 4OKSA 5FR1A 1YR7A 1G3QA 1U9IC 1KK3A 1DG3A 2XX3A 3JQRA 4B75A 1FRNA 2NO0A 5UKDA 3X1XA 1P9WA 2XXAB 2FMXA 1H8HD 1ZCAA 3CRW1 4PSKA 5G53C 5J4YA 3NVAA 2BHRA 1YQTA 2CHGA 4JYBA 4M1TA 3MFYA 4YMSA 4LJYA 5IDVA 1W2BB 2Q3FA 1WP9A 1BX0A 5EUQB 2BCGY 2ORIA 5JFGA 1OHHD 1XTIA 1R0WA 2J0UA 3C41J 5JMTA 1ZUNB 2MMCA 5F3WB 4KLNA 1FNMA 1H8ED 3MSXA 4P4SB 4WA7A 3SI7A 5FOXA 1N5KA 3W6NA 3TUZC 1VQ4B 3GLFA 1XTQA 5KSZA 1Q22A 4BASA 4DEYA 4EDHA 3PEYA 1Z6TA 1Q1EA 4C2TA 2B8WA 1BS1A 1KC8D 1PZNA 621PA 3S1AA 2FN4A 1N6KA 4CEIB 1MV5A 4HAYA 3AVQA 3R9XA 1FNNA 5AR1A 4QXAA 1G7TA 4B47A 4LZZA 2F1RA 3H86A 1NY5A 2ZRFA 3W5VA 1Y3AA 4Z51A 3RLFA 1ZM2A 4L9SA 5DSZA 3AEZA 4Q9JA 3WHLA 1H8EA 2WKQA 3B7GA 2ZRNA 3VR1A 1KKMA 1PLJA 5HKKD 3CH4B 4Z8YA 3K53A 5E7MA 2ZSEA 5J4VA 4ABYA 1U98A 3FTQA 2VZLA 2OILA 1RYFA 3THOA 1KK0A 1W0KA 3ZBTA 1KI4A 4JLAA 2XNDA 2AR7A 3MAAC 4MGYR 5IRCD 3LFUA 1E99A 1KY3A 4P3YA 4PPFA 2JASA 3SQWA 2PJRA 5E4FA 2IHBA 4EAQA 4LX0A 3QXHA 4LBZA 3C5HA 1AS3A 4YDSA 3UANA 3QG1A 4TLDA 5E3HA 4UNSA 4EFNA 4PO1A 1P75A 5THXA 3FMOB 2EWVA 3BH0A 1QHGA 4NZYA 3T1QA 1KI2A 2WJIA 3U7GA 1EP1B 2Q9CA 3K0FA 1FMJA 5GJCA 4LYFA 3THWB 2BF4A 2X2EA 1KI1A 2PLFA 3OEED 4IKEA 4TMKA 1WBDA 4AURA 4NCIA 1ZCBA 4MGIR 2F1JA 4G3XA 3A1VA 4S35A 1AMOA 3G71B 4B2PA 2ZRAA 1O3YA 1KI6A 3H84A 2W0MA 1ZP6A 4XTCS 4UJ3A 1JR3E 1C9KA 4E22A 4ITRC 5GJBA 4U9UA 3P4XA 4KBGA 4RFSA 5FA6A 3QVUA 3THYA 4PO9A 4BLQA 3FHCB 3FHOA 4C0LA 3K70D 4DCVA 3AUYA 3RC8A 1NN5A 3TE6A 2BMEA 1EFHA 4Q00A 4OI4A 2HF8A 5EZ5A 3LBIA 5CITA 1VCNA 2DFNA 1CJUC 1KZ7B 1OJLA 3ZS8A 4D81A 4BRUA 4N0EA 1E4YA 1KAGA 1NVWQ 2IYXA 2HDNB 2WSSD 3NBFA 4XWAA 3X1DA 4J0QA 1CR0A 1OXVA 1VHLA 1ZW6A 1P61B 1E9EA 2HJVA 1QFZA 1M7GA 3GJ5A 3UWOA 1CS4C 5FBVB 5E7JA 5EQTA 1UKVY 2GZHA 3QKRB 1IJFA 5BYJA 1R8SA 2FU5C 4Q18A 4M9ZA 3TW4A 2GAOA 4LJ5A 2A78A 221PA 3HU2A 1LW7A 2ATVA 2VA8A 2OK7A 4KVAA 4EPTA 1FX0A 4MUAA 1KAOA 2QRZA 2V7QA 3GLHE 3BFXA 1TF5A 3EPLA 1OXXK 2ODWA 1YZKA 3JZMA 4HAVA 5HZHA 2YHSA 1UKZA 2WWXA 2RC5A 3NEYA 4HAWA 4DLTA 2AKYA 1EFTA 1Z5ZA 1VHTA 4L16A 2GJSA 2VYFA 2PBRA 4OK5A 2VBCA 3VNUA 2ZJ2A 3I92A 1RYHA 1WDTA 1XXHA 721PA 2AHOA 5EE1A 5KTYA 4PGOA 2CLCX 4PZZA 3TQFA 2WJHA 1VG1A 4DLUA 4TTPA 1UKEA 2SHKA 5EE5B 1U99A 3PFIA 2WPDD 1JA1A 1Z8FA 2BBSA 2EW1A 2IA5A 2QMOA 3ND9A 5JJKA 1GL7A 1AM4D 4DDTA 1QHXA 1E2HA 1HEIA 4G1VA 4IJMA 4URYR 4LV6A 1W7AA 4X8MA 4C0JA 4HI0E 3GLIE 4NYIR 1ZYUA 1GILA 1EXMA 3OAAD 3A1SA 4W5HA 5J40A 4A82A 1NSFA 5E95A 1KDPA 2JGNA 2ZANA 3QSYA 1GJRA 3DMDA 5M04A 4CEHA 3PEUA 4Z54A 1EWQA 3U60B 3UMSA 4MYCA 3B78A 5CYPA 1UBGA 3D3QA 1J70A 2CK3D 2V9PA 2ZI3A 4OHVA 4IEIA 2AFIE 3T1VA 4RZXA 2CCGA 2P5SA 3VAAA 2O8FA 1XP8A 2QGZA 3KJIA 3VKHA 1F5NA 2FFBA 3NIBA 4A9AA 1JXOA 1YHNA 1GSIA 4D6PA 3C5CA 2ZPTX 2UVQA 3LVRE 2DB3A 2FOLA 1HA3A 5EP3A 2Z83A 3Q5DA 2D4HA 2C9CA 4AF7A 2HUPA 3ZC3A 1FTNA 1KMHB 3C16C 5FL7A 2CL0X 2CCKA 4JBXA 3NBXX 1E2DA 4B43A 4Q01A 4QHSA 5HCNA 1OXUA 4JLPA 2AL7A 2WICA 1VQNB 4U5XA 2BBOA 2D3WA 4YAUA 1P5ZB 2GXSA 2RKOA 1W0JA 4OI2A 1OGIA 1J7KA 3I8SA 3IEUA 5CJPA 1BX1A 2C03A 2QSZA 3LLMA 2HXSA 4L4UA 1I4DD 3VR4A 4QGGA 4JJZA 5LDDC 5DN6A 5GVRA 1CTQA 4MQBA 4A0HA 3BBPA 4RKFA 5KSOA 1VQ7B 3SFZA 2W0SA 3QKRA 4BLOA 3CR8A 3W2EA 1EG7A 1UADA 3IPYA 2FSHA 1A5TA 3MHPA 5JEEA 4KVGA 3UKDA 2FE4A 4IDHA 3TR0A 4HB4A 2FZLA 2NOAA 2B5OA 2HMAA 2OO7A 2IUUA 4IVRA 2C77A 3ZVMA 1SVIA 1Z08A 1JA0A 1W49A 3PUXA 1TADA 5AK0A 1N0VC 5CDFE 1P2UA 1RFLA 3PXGA 3LO8A 3R9WA 1ZRHA 4TMZA 1J90A 1E6CA 2MSDB 4UXHA 1EP3B 4PO8A 4LPKA 2VSXA 1NN3A 5FL3A 3TSZA 1E9AA 2VHUA 5CJ2A 4UNRA 4E03A 3ICQB 1A2BA 4LYHA 2IBMA 3SU8A 3E1SA 5FUWA 3RS2A 4JZKA 3U5ZB 1RVDA 3QEJA 2BWJA 3U4QB 3WMGA 3W3ZB 1GZSA 5EE0A 4GOXA 2YJTD 5G3YA 2VLIA 3UK6A 2V54A 2IYQA 4RCZA 2P67A 4D0LB 4RD3A 3U44A 2ODBA 3AVPA 4TL6A 3VKWA 5B57C 5EXSA 1NNEA 2ZJ8A 2N42A 4I1SA 2V4ZA 1G8FA 1DAGA 3CB4A 4TMXA 1QH0A 4II7A 2AFHE 4TT3D 1TQ6A 4MYTA 1EESA 2IX3A 4OQXA 4DLWA 1R5BA 3ZZ0A 2IF2A 1E2EA 3MJRA 1K5DA 5KNDA 3DOEA 2FFAA 3C15C 3BJIC 3E70C 3N2EA 4IVQA 3P1JA 3AV0B 2ORVA 3SS8A 2WMNB 3W8NA 3IUYA 2R8RA 4DCNA 2P5TB 1U90A 1Z83A 3DZ8A 3RS7A 4BFZA 1AKEA 4XSHA 3FKSA 2QTFA 1VPLA 2BKEA 1ZAKA 2R6HA 1UBCA 2EVWX 1XEXA 1JB9A 1YZQA 2OLKA 5DI9A 3W5IA 1KSFX 2GA8A 3QUSA 5HTKA 5L3QA 2BOVA 3EPKA 3JZAA 3WYFA 4RD2A 1CJKC 1DAFA 1JB1A 1T4GA 3OEEA 4BFYA 1SKYB 2PT5A 3BXZA 3KKOA 1QGYA 1AS2A 1PJRA 1KDOA 1S1MA 2C99A 3KJEA 4C0BA 5TR9A 2WIBA 3SYLA 3MWLA 2QI9C 2X8AA 2REXB 2QNRA 4TMVA 5EUMA 4OQMA 1G7CA 2OTLB 1E2NA 1BMFA 2PEYA 3K0AA 4GMXA 2H57A 4DB4A 1SKYE 1PLLA 4LJ4A 3WBJA 1DADA 3WNBA 1F2UA 2A3RA 1XJ0A 4LV8B 4Q47A 1F6BA 3R8FA 1FNCA 2ZS7A 3CCEB 3H0KA 2WMOB 1XZQA 1GFIA 3WP0A 3K70B 1CU1A 4JBWA 5JWHA 1O87A 1OXTA 1I2DA 1M7BA 4TL7A 4Q03A 4JSTA 2BEJA 4YDHB 1ZINA 1OSNA 2CK3A 2F1HA 2GESA 3IBGA 1KSJA 1D5CA 1E79D 2NZJA 2N46A 1XEWY 3B6EA 3AVXA 1PLKA 1QVGB 2F9LA 2JAQA 3HP1A 1N5LA 1G8HA 2ZRLA 3GLHA 2QPAA 1Q20A 3VMFA 1BH2A 1NF3A 1G3UA 3CONA 521PA 3TSWA 5AN9A 4HZUA 3CNNA 3A4NA 1X1SA 1K73D 1E63A 4Q48A 5D3MB 2AD1A 3I32A 1CBUA 5C18A 1US8A 4JLJA 2NTYC 4GBMA 4YXWA 1W36B 3IQXA 3ZLJA 3ADDA 3QIAA 4JL8A 2ECKA 4AK9A 4M4SA 5AUOB 3JVVA 1QDEA 3OIVA 1AGPA 2ZI9A 2WPDA 2Q3HA 3HPQA 2ERYA 5AJYA 2D74A 3RS0A 4DBLC 2GAAA 3AUXA 3QPWA 1IAQA 1EFRD 4DLZA 4URXR 1TF2A 3A36A 4JLDA 1GKIA 4M1KA 1R8QA 3RRZA 4FN5A 2OHFA 4BPBA 2QPTA 1GITA 1KMHA 3EW9A 4B34A 4M22A 2NO6A 5HE9A 4N3NA 5JZVA 5IT5A 4HYYA 1GRNA 5JEDA 2AN9A 4B6FA 5AJXA 4RJLA 2C5LA 1VQ9B 3SBDA 1FQKA 2X3UA 4TSFA 4JS0A 3A1UA 5C2JB 2H5EA 3CC2B 1L4YA 4I1VA 1MR3F 1OXSC 4P6VF 4A8JA 3PUYA 3OIUA 1T5IA 3CO5A 2YVUA 3IO3A 4A8JB 1E9RA 3U6BA 2WWGA 3V4FA 1U0LA 1YU9A 1SHZA 3NH9A 3VHLB 3E1YE 1MO5A 3TRFA 1VQPB 3DOFA 4GDFA 2G0NA 2ZREA 4QM7A 2DCUA 1B0UA 3TSOA 4A1FA 3WNDA 2CXXA 3ZZUA 1R4AA 4DLXA 1OT3A 1Q57A 2KWIA 1TMKA 4Q5IA 1I7PA 1Q0UA 3B60A 2JDID 1JPJA 1IOZA 4O25A 4JJKA 5A0FA 4DCUA 3EC1A 5FBWB 4HDOB 2JLQA 1IY0A 4LYJA 1VQ8B 5FOVA 1GTVA 4BECA 1W0JD 3A1TA 5KHOC 5DO9A 2J0QA 2BBTA 2HLDA 4KYUA 1WE2A 3CWQA 1Z47A 2OFWA 2ZJAA 4F7DA 2VNHA 4UXIA 3UWKA 2Z5FA 3LW8A 4RZ3A 4ARZA 4IW3B 3M6AA 2AK2A 1NL3A 4B2IA 1D6JA 3AP3A 3CZQA 1TNDA 3OJWA 2KE5A 2MSCB 3E5HA 4TMTA 4N3GA 2WJGA 4EIWA 2IUTA 2IL1A 1KJYA 4MRPA 3G6EB 1JI0A 1W2GA 1OE0A 1E2IA 5TXGA 3TUIC 3FMIA 4NONA 1S96A 3AF0A 1ZD1A 3QNUA 1KKLA 4L8GA 3CRQA 5H68A 3PVSA 1G7RA 1SVWA 2QAGA 1SXJD 3Q72A 4IOMA 3CKLA 1ESMA 1IN8A 4CEJA 4DT1B 1T9HA 4ASUD 1AQYA 1DAIA 5H1YA 1FRQA 2YOGA 2CE2X 4JMPA 4Q1DA 1CULC 1U8YA 4B32A 5JWRA 1JR3D 3IILA 5DN6D 1Z6XA 2I1VB 5EXPA 1XD9A 3P27A 5L3VA 2QT0A 4YMUA 2YZ2A 5AJWA 4PZLA 1XEFA 1OFUX 1K6MA 4ZDKA 5L3SB 5DYIA 3BD9A 4ZO4A 4QL3A 2IUSA 3THYB 1IONA 2J0VA 2QBYB 2GF0A 4EQ6B 1QZXA 3T35A 4GSYA 5B64A 4PR0A 3ZH9B 4NYJR 3KJGA 4OL0A 1IB0A 4R71A 3CW2A 3PQCA 1P62B 1GIAA 2QP3A 1E32A 2RGBA 3KQUA 4TN1A 3U7EB 2OTJB 3CUEF 2GVZC 2BCJQ 1NJFA 3SZRA 4Q9IA 3CZPA 2CNWD 4JT2A 4MITA 1GR1A 5HE8A 2E9SA 2Q21A 1ZM9A 4EJSA 2YINC 3W2GA 1R6BX 2DR3A 4C2UA 1G3IA 4MRNA 3EWSA 4WW0A 1MT0A 3QXXA 3SBEA 4RD6A 2GQFA 3WXMA 3LD9A 3AVYA 2J59A 1MO3A 2ZU6A 2ZJ5A 4D0GA 5KDDA 1OH5A 2IK8A 1G9XA 2OV2A 3OIYA 4AYWA 2IHYA 3FMFA 5IF9A 4HAXA 3G4SB 3BRWD 3LX8A 2ONKA 1VQ6B 4ESHA 4EUNA 3PR1A 3FHTA 5FOUA 4L15A 4Q7JB 2WV9A 2CE7A 3EZ7A 3LWNA 1YZGA 3BIFA 3V9PA 3H4MA 2JLVA 5F98A 3ZZTA 1TU3A 1FFHA 2AWOA 4R98A 2EWWA 3FDIA 2ZE8A 2O0HA 2F55A 2QM8A 2CCJA 3EX7C 2EFHB 1ZUHA 4JKIA 5P21A 3AF4A 3LBNA 4LJ8A 2H7VA 1T3SA 4M53A 4Q21A 4PC3A 4RVCA 2NO7A 4GFDA 2RGAA 2HJGA 4B74A 2YWHA 3L0SA 3BE4A 1KD1D 4KFRA 4Z1MD 2C96A 5FPKA 4URVR 4JLKA 1DDIA 3ASYA 5AJVB 3GLHB 5B30A 4MRSA 1E2QA 2RGDA 2ZQ5A 1A4RA 3B5JA 4PQRA 5JSZA 2QAGB 1CP2A 2O8DA 3FPKA 5JS7A 3B2EA 3E2IA 1QFJA 4M1OA 4F93B 4XOIA 1M2OB 5FTLA 1TTTA 3SFVA 2Q9BA 1OW3B 4OHZA 4Y9RA 1ZBDA 1CJMA 2NGRA 1E62A 2ZJOA 2AKAB 4F4JA 4PAMA 5BN3A 2J7KA 1CNFA 1KI6B 4HATA 1KJZA 2VIIA 3NH6A 2FPKA 5CM9C 3SOPA 5AJZA 2W6JA 2KJQA 2X19A 4O2RA 3A6PC 1Z0DA 4JT4A 2O8EA 2FGJA 2WTUA 2BM0A 1UM8A 2O8EB 1AGRA 1VYUA 2ZJZA 3DZDA 2EFDB 3B1XA 3QI2A 2BIFA 1KHTA 4Q1CA 5JI3E 3OJXA 1P2SA 5G3ZA 3D8BA 3SQXA 2OCAA 3MJHA 1XTJA 4QJ5A 1S3SA 1CRPA 3ETLA 4IEEA 2C98A 1Q12A 3EPJA 3FKQA 5DH9A 1GAQA 4LPSA 1E3MA 3I3SR 5DLQC 4BPRA 3G82C 1NI3A 2Z4RA 4E5UA 1GKYA 1ZD9A 4YAWA 4Y0AA 1GDDA 3KQLA 4BE7B 3W90A 3SHFA 2RGGA 4N1AA 5C4MA 1AQUA 2QQ0A 4YXWD 2XAUA 3AKEA 3NC0C 1D2EA 3PUWA 4DSUA 1M74A 2VNJA 3DHWC 3GJXC 1HURA 1JAIA 1NY6A 3W5JA 3NTUA 3DMNA 4GMDA 4LYAA 3LVBA 2ZVQX 3U4QA 1E0JA 2O8BB 5HKKA 4Y0VA 2VP6A 2YWFA 2OXRA 1SZPA 2AK3A 4U00A 3CRMA 1OFHA 1KO5A 3QBTA 5LD2C 1N25A 4A2QA 3VU9B 2J46A 2GTPA 3V76A 1S2MA 4YHBA 1VDZA 1GAWA 3S1AB 3A1WA 2B7BA 3Q85A 5FPSA 1J2JA 2J5XA 1ZM4A 1E0SA 4CGZA 4TTRA 2ZR9A 3W2IA 2R6DA 2OSBA 3C14C 1IHUA 1Y63A 3B1WA 4PPNA 4Z8XA 1KO1A 1RZ3A 1E0AA 1BKDR 2JA1A 1N6NA 2G1JA 3AGPA 4FWIB 4U02A 4D80A 4PHGA 2WAXA 3ZQJA 4Q1EA 3QKUA 4TL8A 1CEEA 2WWWA 2YWGA 4LC1A 3EIQA 4HB2A 3U2QA 3CNLA 2QTHA 4K1XA 1IN6A 1E9BA 3DM9B 2XXAA 1KOFA 2RGCA 3CXCB 2P0EA 2PJZA 1QHNA 1IXZA 1CR4A 1L2TA 3VKGA 2ZRDA 4LC0A 2C9OA 4QGHA 3PCRB 2QBYA 3T12A 4EQ6A 1GL9B 2J7PA 1OH8A 5L3QB 3QPUA 3BB4A 4O3MA 4P4SA 2NQ2C 4HLUC 3CMEB 1U0HC 2J0UB 2JATA 2ZVPX 4C0SA 1QUFA 3W2FA 4M8NE 2XB4A 2PT7A 4FINA 1DTSA 1E2GA 4WIAA 2O5VA 2YOFA 5FI1B 1HUQA 1XJQA 3K9GA 1TL7C 1K8AD 3KTAB 4LJ6A 1WXQA 2VHTA 1E2KA 3FOZA 4KLZA 1XXHE 1ZJ6A 1G21E 4PC2A 1MO6A 1CKEA 2Y8EA 4QGFA 1S9HA 1SQ5A 1L7VC 5LB2A 2W6ID 4K46A 3GLFE 4QBFA 2G77B 4ON9A 4YMVA 3ZVNA 1HQYE 2IYUA 2I4IA 1A7JA 4US1R 1SVSA 5FTKA 4DC9A 3KL4A 2WSMA 2BM1A 1VYTA 1NSTA 1VTKA 4YMTA 1XPRA 1ODFA 1XFAA 1M1YE 2B92A 3LH5A 4C9BA 3I62A 2ZEJA 4JVLA 4A6XA 3B9PA 2DPXA 4HE5A 1Z6GA 3IKJA 3I55B 1UBEA 2IYSA 1MABB 2VNIA 1W4BA 2G88A 1P73A 2W58A 2VHJA 4AIIA 3IDQA 5EP1A 3QY0A 2GCNA 3CPHA 1GO2A 1N6LA 1Q3TA 1XD2B 2LKDA 1RC8A 4JLMA 1N5JA 2CDNA 1DAMA 4C43A 3LXRA 5SZKB 1E4VA 1DS6A 2OAQ1 1Z2AA 3PENA 4Q4AA 1LS6A 1W34A 3W5UA 3QFSA 2W6IA 2EQBA 2VP5A 4IXNA 1SXJC 3BFVA 4HSEA 4BFXA 3K0EA 1LB1B 1NMXA 3U6KA 3X1YA 1TUIA 3HDTA 4M9XA 1E64A 5EE3A 4BEJA 2HT6A 3ND8A 3K0CA 4DKXA 1E79A 4TQUS 4XJXA 2WWIA 1DG1G 1SVMA 2CJWA 3N70A 1HY3A 2H92A 4XWKA
chains in the Genus database with same CATH superfamily
2FW6A 3B48A 4GE3A 2CYAA 2FCRA 1DMSA 1NM5A 2P3QA 5JAMA 4EH1A 2C2YA 1AN0A 3KZNA 3Q3VA 4IOJA 3IUEA 4Y1RB 4MV6A 1XFDA 5C8ZA 1M8GA 2ZIZA 3A0UA 2O06A 4U8GA 5J5VA 5C31A 4MWEA 2WZNA 3RTCA 2PZBA 3O2NA 1VHOA 4H9GA 2AQ8A 2C4NA 2NZ8A 1P5JA 4K9NA 2IV7A 4XRGA 3CKYA 1GU7A 4Q0MA 3VMMA 1NX9A 4W9RA 4J0DA 4R2MA 4AQYB 3EQ6A 1WORA 4UATA 2H65A 4YY3B 3PWZA 1QV7A 4JX8A 1DARA 5I01A 3Q10A 3L1HA 3DDHA 3ZBUA 1GFSA 4X7EA 1NJ5A 1V5VA 1YB7A 1EP9A 4GKKB 2PRJA 4TM8A 3CESA 1EA7A 3SHOA 1NJGA 2YXPX 3AWDA 5AW9A 3LBAA 1X7GA 1RWBA 1WZIA 3WLJA 4MGKR 5KJ1A 5M34A 2ZZKA 3NTXA 1P7PA 4GLBA 4BV3A 1QVWA 1NFFA 4JVMA 4ZCQA 1VHQA 3ENKA 3EQ2A 2FMUA 4UZFA 3FYUB 3MGBA 4WGGA 4AAYA 2I7VA 3OCZA 4DWVA 2HXYA 1J0XO 2PSFA 1UFQA 4QQKA 3SDSA 5KWJA 1T5OA 3NVDA 3DMTC 4L7VA 4DADA 3GCDA 2EJBA 2OHJA 4L3WA 2BH9A 1F8GA 5IASA 1N9GB 2H4YA 1G1AA 5G02A 2BFBA 4O3FA 4Z0TA 1LBQA 1G2IA 1AA9A 1HETA 1O6BA 1V5EA 1T5TA 3I8OA 1W1UA 3NNNA 4S24A 5E3JA 4A26A 1C7JA 3EXIB 3LYUA 1J8QA 2JJ8A 4ZZ2A 3Q39A 4XLHA 2ZRKA 4HNVA 3K73O 3AF6A 1I33A 1YB1A 4ME6A 5FUBA 2ODTX 2GZ2A 3MMNA 2YRFA 3MQFA 3UMRA 3VR5D 1NW9B 4B48A 1XTUA 1Y8CA 3D6AA 4BB0A 4AUMA 1UBRS 4BFUA 5ALHA 2KI5A 2WAYA 2WF7A 4QJ4A 3V7UA 2CV0A 3P2EA 4KYVA 4TTQA 4JI8B 5B3LA 4FCWA 1NFQA 4NCHA 1J2UA 1JQLB 1RBZA 1GPH1 3HYTA 1N1EA 3I39X 3MGGA 3QXSA 4NH0A 3GEEA 4C7BA 1V48A 5LDGA 3QTTA 4PLWA 3FRHA 4EB0A 4P82A 3TQRA 1OLOA 4I50F 3T7EA 1F60A 2QE7D 5EN4A 2PH3A 2PJRA 2JIRA 4BAUA 3V8RA 4FGUA 1SH7A 1ND6A 2XI4A 4G8BA 2HWXA 4DZZA 4O2BF 5DHTA 1WVMA 3H4TA 3G05A 3B8EA 2C00A 4AM8A 4NFSA 2P8SA 3NHAA 3SX4A 4OJMX 4IIXA 5CT5A 1JDSA 5TGDA 4CETA 3O83A 3K0SA 1N5OX 3N9IA 2CLIB 4IDGA 3TCXB 5A04A 1PWYE 4RKYA 4I4TA 5EP4A 1QH1B 3C8UA 5KYVA 3ORRA 4W9MC 3SJBA 3M9XA 5EHNA 1YBMA 1XQXA 1QF9A 5AWFC 4F9FA 2W4IA 4FXOA 1TECE 2YV3A 4G67A 3GMTA 2ZUVA 3CVWA 3JYLA 4Q9NA 2VZ0A 3U3KA 9LDBA 2NYUA 9GPBA 3WLKX 4DC0A 4RFVA 4UUQA 4QUKA 1Q1BA 1XAJA 3RABA 4XYLA 1PGNA 1EFAA 3M49A 4XM2A 3A4TA 4AP9A 1HE8B 3OZFA 1C7RA 4RIHA 5ALFA 5A4IS 2O8FB 3QG5A 1P33A 4BQSA 2WYHA 4PGFA 3DKPA 1OGYA 5AQ1A 4NYMR 4XW2A 1JHQA 5KYXB 1BXRA 2JZCA 2JPDA 2RAVA 1PO7A 4LCJA 3PEEA 4J1NA 4UCFA 1WV1A 4CR7A 1GVNB 2HJ9A 3RKRA 5JS2A 3CTPA 4MVJI 3D0KA 2JCSA 2ZDHA 3DBOB 4OU5A 3RC9A 4DIDA 1XCJA 4EGQA 3GPLA 1W1IA 1Y9EA 1T24A 2HA7A 3JWGA 1NB9A 2WKWA 2V5UA 1OYYA 3C5EA 3Q9LA 4IZOA 4EHJA 4XUGB 1LFDB 1LSJA 2RK6A 5AW8A 3CRVA 5A6SB 1QX4A 1NNLA 4RKRA 3WB2A 5EJEA 3OWXA 3LCVB 2O5CA 2PUTA 1YL5A 3FR8A 5KYGA 1QUEA 1Q95A 3RSFA 4DJFC 5TPWB 5JCZA 2O2CA 3G7SA 4AS2A 2YVLA 4UHKA 4N49A 3JARB 2Q3EA 1CJCA 2HIAA 1B0PA 4MUEA 5DYWA 1TKBA 1W35A 1J33A 2A5LA 2QRNA 2YIMA 4FR0A 4RIFA 3RRMA 3WLOA 3TTSA 3TOXA 4JCOA 5BWCA 5ECWA 5FRDA 3SK0A 4MOWA 3WJ7A 4KKUA 1E69A 3DZBA 1V8DA 5CX1A 3C3AA 4F0JA 4ZDIA 5A0TA 2X1VA 1P7YA 2IOQA 4PBTA 1NW5A 3KTOA 4B3XA 3RAPR 1PHRA 4H59A 3C45A 5FUXA 2PS0A 3E8XA 3L5KA 2A33A 2NVOA 4PZYA 4UNNA 4X85A 4QAJA 4W8HA 4CTOA 4EUKA 4ZO9A 2CJPA 1Q7GA 4NPCA 3GZTB 3GX1A 1F2VA 2FN9A 2WU1A 1W52X 2CSXA 4FQ7A 2DTEA 3WRVA 1LSOA 2V4MA 4B3TB 3CCRB 2YUTA 1UXOA 5I7AA 1SY7A 5KCZA 5CYOA 4DA4A 5CHYA 4B35A 1MC1A 3OE4A 1WJGA 4N5HX 3DMHA 2IXEA 1ORWA 3BCHA 2OV4A 3QJYA 3KB2A 2RHBA 1Y0YA 4WAUA 3V1NA 1PFQA 4KMOA 3WWDA 1E4OA 2QSJA 3N74A 1KI9A 3RD5A 2HM7A 3A6DA 3DDUA 3GNLA 2IOHA 3HFRA 3I1YA 3IPRA 1NXOA 3UCFA 2E4UA 3WTBA 4RZQA 2CNNA 1YJ5A 4ZI3A 3UO8B 4UHFA 4FLFA 3DBHA 3I2FA 4CKEA 1JT2A 1J0AA 2VK8A 1G18A 3QV1A 3ND5A 5KTMA 5T5QA 2BSAA 4O4JA 3HU3A 1PJQA 1YI0A 4FCCA 4K2AA 4QDTA 1P19A 2XUIA 3G13A 2OENG 2DOKA 4D8TA 3VO1A 1JS1X 4Z7NB 1XRLA 3A6FA 3OTGA 3R20A 1NI5A 1BHJA 4HY3A 4TOIA 4CLOA 1IK6A 1K8RA 4CM9A 1G20E 1NBME 1TI7A 2GZRA 1P0MA 1PVOA 5LBIA 4G0VA 3ANSA 4LDZA 5DCLA 3AR3A 4S05A 4YT8A 1C5KA 2O2XA 4E7PA 1V8OA 3CPSA 3LDGA 1TQ8A 3RBVA 4NOKA 1T2EA 3A9SA 4MI6A 3L0IB 3MJSA 3HJUA 3EPHA 3QQ5A 2G6TA 4IOLA 3RYTC 4B3JA 3X1ZA 5HUQA 4QV2A 2R68A 1XE1A 3G2HA 2L42A 3DL0A 4AMVA 1OX5A 3WWZA 1PD0A 3DEIA 3FOWA 5DNAA 1A5ZA 1G98A 2WNIA 4YJKA 4KI0A 1MRSA 4WLNA 3OZRA 5FBQB 3EZYA 1AKNA 1QANA 5EJAA 2C95A 3PRKE 4WUVA 1KDVA 4CKXA 5J2TB 2PEZA 4BLRA 3CZCA 4Y18A 5JO9A 3SR0A 1DO0A 1F7UA 5CEEA 2XQGA 3WR5A 1E18A 3B70A 1C0LA 1DJQA 1U4NA 3GF4A 4GHWA 3RGWS 4C1BA 3LRTA 3SLRA 4J1TA 3GB9A 3TGWA 3BOSA 4MVCA 1P5FA 6GPBA 1H8HA 2AI1A 2QJFA 2HIHA 3JXEA 3OE5A 3OX4A 4JDPA 5JCJA 1EWYA 1MTOA 1Q0ZA 4RLZA 1YC2A 4YLYA 2C3YA 1I2AA 4XEHA 4QFMA 4HNSA 3OUUA 5BV2P 3HKBA 1O97D 1W48A 5A89A 1XPJA 2QYHA 5B3JC 1ZR4A 2YNMA 1R9GA 2CKMA 2DHRA 1CJTC 1G8JA 2XJ4A 4BKOA 2GNAA 3TWOA 3VSEA 4EPXA 3ZXIA 3MWJA 4PBSA 1ZS9A 3HKEA 2BHTA 4UU7A 3M81A 3ZGNA 4BKRA 4W4TA 5CDGA 1NR1A 1F4PA 1DUIA 4ILKA 4QUDA 3TZQA 5C9ZA 2F43B 3KOZA 3JVUA 2FMTA 4N5DA 4M49A 1Z88A 4W5WA 2QA4B 2PJDA 5MFZA 2HA4A 2P68A 3IQDB 3UPUA 3V1KA 1DRKA 4BKPA 2WF8A 1U2RA 4F12A 1R6UA 1VSVA 2X8KA 3OH8A 3RF7A 4EW6A 5AI5A 1GQ2A 2QTMA 4DMUB 4GRAA 1SBZA 3WK5A 5A3VA 1JJVA 3VH3A 3W3AD 1HYEA 3RR2A 5BSEA 1S5PA 5D8DA 4DT1A 3K8YA 2ID8A 1V47A 3C70A 3VKFA 3BSWA 1ZNYA 4LHXA 3K2BA 3DE1X 1GL3A 1GKKA 1Q74A 2KBEA 5JAQA 2QRKA 3ORFA 3IP7A 4PHCA 1KIMA 4RX1A 1YS4A 2GEUA 3V7AA 2VRNA 4OFBA 4Q24A 4CQLB 1A77A 1DZIA 1EFRA 1RRMA 4MW5A 4RMGA 3VR0A 5B2EA 3TSYA 5DI3B 2ZR7A 4UBOA 3LP8A 3BMXA 3RVNA 3I2YX 5CX1B 3R7AA 1Y37A 2A86A 2V96A 2B25A 4QG7A 3V80A 3KTDA 3ZV3A 4F97A 4RAOA 1N8RD 2O19A 4Y2YA 3RVKA 3ONYA 2O2EA 1X1TA 3HFSA 5LM3A 2QEXB 5FPPA 1WUJS 5J58A 4C5BA 4HDRB 1KMCA 2FB9A 1COZA 2IPXA 1ISMA 4R7ZA 2A0YA 4Z4CA 2PGLA 4LQCA 5EXDA 5ERXA 2DX7A 5KJFA 2UZ3A 1AMNA 1ZMBA 2G82A 4EKDA 4WOPA 4H7JA 1O6CA 5IANA 1T15A 4DFDA 3AHDA 2JNWA 3HY3A 3UA4A 6REQB 1GGJA 3OIWA 4QNMA 1N7IA 2GM3A 2QL7A 1DZ3A 5I9NA 1NRIA 1A88A 2PL3A 3KELA 5TVKA 5FI5A 5EJ7A 5JC8A 2RK3A 1Z8HA 5LA6F 1R4MA 3VTKA 5D51S 3OT4A 5EIOA 4E13A 1M34E 1SXIA 1KS2A 3IERA 4AL4A 4ENRA 1ZGBA 4MVJG 3LLSA 2XXBA 4F3TA 4LF5B 4M8LA 4CF6A 4K6MA 1L5OA 4E51A 4UCXA 1BOFA 2R8PA 4OVKA 4B0OA 1KU6A 2FR8C 4TYMA 4XWGA 4L8LA 4PWYA 2HUNA 2LNDA 2XW6A 1Y98A 5FTNA 4UUMA 4WK4B 2BSXA 3BZUA 5IVPA 1XLVA 3R7LA 1I8DA 4EG8A 3EA0A 4ZQFA 2MMGA 3Q8XB 1RLUA 3JVIA 3QLUC 1CDEA 3KLMX 3ZV6A 5JALA 4D9CA 1LY1A 3AIIA 3THXB 1U02A 4GZMA 1OB5A 2YC2C 3BXOA 4QTYA 1ZNWA 2XOKA 3HWSA 1GG2A 3I9NA 1GZ5A 4S1WA 2BC9A 3BDIA 3WMEA 2XITA 4KNYA 1P1KA 2QE6A 3PIRA 1IG0A 4QVIA 3IR7A 3F78A 4MW4A 3BGVA 2C9ZA 3I04M 5DGXA 4HLCA 3H9JA 4JMLA 4X92A 5TMEA 4FGLA 2HMYB 2YNMD 2XNJA 5T4FA 5IKXA 4Z4EA 2HPVA 1HT0A 1NVVR 2IYTA 2QU7A 1XK6A 2PX4A 2XNHA 3C6MA 5D3QA 4LFAB 3RYCB 2Q7OE 3OQBA 4CI0B 2OLEA 5HKLA 3CVOA 4LWZA 4S2EA 2OV6A 2QUZA 1TZMA 5FBHA 3L8YA 2ERXA 1XZJA 3M4NA 2A92A 3LKVA 4BWVA 2QUKA 1LZLA 3W5AA 5AP9A 5CB0A 3EFHA 5AVZA 3L8ZA 1BOOA 3RJ9A 2YWDA 1FYDA 5DM4A 1C0EA 5CXSA 3L6BA 4UHEA 2G1UA 1J09A 3LLUA 3LQFA 1NR5A 5ED0A 4QLOA 3NV7A 3UAZA 3H9NA 3PNLA 1X8KA 1ZIYA 3H8SA 2AD5A 3W7VA 2WYVA 5DZSA 2I55A 1K3UB 3OEHD 3PEVA 2VQDA 2YL2A 2B94A 1IXKA 4ACBA 4ED9A 1GZ3A 4H3SA 3W06A 2AJTA 4IRMA 4EG7A 2HLHA 5LN1A 2F3PA 3HGQA 3WRXA 2IUYA 2AOUB 1TXGA 3K0CC 1E61A 3CYFA 1ZGGA 2IYYA 4JEUA 3C3PA 4MV0A 4TT3A 3IP6A 4EHBA 1YJAA 1H9CA 3RFUA 4QVGA 1TKAA 4KFTA 3ZCPA 4KSCA 1IRXA 4YS6A 3MB8A 2Y27A 4UVIA 1TLLA 4HS4A 1QG4A 1SHLA 5D7NA 1TEZA 2CJYA 3I0MA 3AB8A 1M1NA 3CCBA 2XRFA 2VCYA 3EY9A 2O1WA 4PX3A 5DV9A 2OV1A 3IPXA 3ZDFA 4BGUA 5JG7A 3RHZA 1PCXA 2ZIXA 5HF9A 4JI7B 1GLNA 4RV4A 4MUMA 3ZE0B 5CBKA 2V5VA 4PCLA 3N7AA 2DWPA 3NNSA 4R1OA 1V4BA 1GSOA 1US8B 3GT4A 4XD7A 1M3SA 2JLSA 4OLAA 3ZX5A 4LWOA 2P2DA 3VSCA 1GPNA 2EBWA 1XTRA 1P31A 2M6SA 1T9ZA 5JMPA 2QTVB 3PVZA 4RZ2A 2WOOA 1G9TA 4EG0A 5EKUA 5FOTA 4INZA 1ISPA 1A4UA 1K89A 4D3YA 4L5YA 5ESRA 4HWSA 4B7CA 3HXPA 4D9NA 2VQSA 2PIAA 4X7FA 2DPGA 2GCOB 3AUFA 1XJCA 2NU6B 3F3YA 3TS1A 4LF4B 1GPJA 3LAWA 1GU0A 2QG9A 3CZAA 4PG5A 4EHHA 4RDXA 5LYJB 2IYOA 4BHTA 2BDUA 5AIBA 1Z0IA 2PK3A 3GGJA 4FYXA 1RI3A 2DJIA 3J81k 2G67A 3UW1A 3PXAA 4F6CA 1G17A 3KPJA 1Y81A 2BRUA 4IS3A 4KIUA 3V2HA 1LNZA 4XKWA 1OMOA 3LYHA 5GY7A 5GGYA 2ZRGA 3A9VA 1TZCA 2XMQA 5BSKA 2A9VA 5K8VA 5E3IA 1WPXA 2V6IA 1LC0A 2VH5R 3H5NA 3RREA 1NJ2A 3PUHA 2NPFA 4PCUA 3S70A 7ADHA 3E8SA 3FGOA 1I9CA 4IF4A 4OGWA 4CDMA 4PX9A 4FHEA 4DLRA 4BMVA 3I45A 3QXJA 5SY6A 3SSMA 5CFQA 3P97A 3L1JA 3OZCA 1RW4A 4AZTA 2AKEA 1DQSA 3D54D 3FH0A 1CXZA 1YRHA 2P9TA 2QRHA 3V1LA 4A0GA 4AJPA 3MGAA 2PUVA 3MUFA 3RRNA 1AB6A 1JKIA 1U2DA 4DGQA 3QPVA 1JKJA 2A30A 5T67A 2BEKA 3BT7A 4OUKX 3Q2OA 2ZAMA 2G72A 3HC7A 3DVAA 4B3RB 1YUBA 4MWBA 1JKXA 2P69A 1XJ5A 4KXNA 1LVUA 2GXUA 4COKA 4CCSA 1GQQA 3L6DA 1G6Q1 5EZYF 4TSKA 4LGMA 3RK1A 2J33A 1N3IA 2DCMA 1FPMA 3IUBA 4NH4A 3HB7A 4C4OA 1JG7A 1UK8A 4WFQA 3FJOA 1OV4A 5IAKA 3BS4A 4LBVA 4QASA 4TVBA 2D2XA 3OCXA 5FUQA 2EFEB 3BWXA 2FA9A 3TOSA 2VP4A 4WA8A 3DZCA 3SR4A 4WJLA 5HUHA 5K3EA 1IIRA 1ADCA 1U2DC 5A4JA 5CB4F 2D5LA 1VOTA 4QC2A 2ID4A 1PJ2A 1TM7E 2IPNA 3KKQA 3LS2A 1E2MA 1X3SA 1G3MA 4Q4JB 4U3JB 5BT9A 3RVPA 3TZHA 3WIEA 3EQZA 2FUEA 4A2WA 1VECA 1M34A 1OH7A 3I9JA 2Q28A 3P4UA 1YE8A 4R41A 3RS9A 3NRCA 3UXMA 3TG8A 2GERA 1QC5A 2UZ1B 5PGMA 4B6GA 1DB3A 5K0TA 5MGNA 1IQRA 2IEDA 2YH2A 4I1PA 4D8VA 4AKHA 3E7DA 5AVJA 2D1TA 4GXQA 4KGVA 1SQSA 5FWYB 5LQRA 4XR4A 4MLPA 1TFRA 2UZIR 3OICA 2PUFA 2QENA 3CUKA 4ZEVA 2VHYA 1NG1A 4OX9Y 2ZCUA 5JANA 1UDXA 3TINA 5IBCA 1S4MA 4R3UC 4R6WA 4R84A 2FPMA 4ILEA 5G0UA 1RHMA 2VYVA 3HGTA 1DFIA 2UYQA 3C85A 4NTZA 1I5EA 3UC5A 1AKMA 4HYQA 2G04A 4GAEA 1WOPA 4GWGA 3O9MA 3AHGA 2FQYA 3UUWA 4BQEA 2YYZA 2FSFA 2K7ZA 2YXLA 4BNLA 3KU1A 1P60A 4PLGA 1QPBA 1T0PA 3QFHA 5KNCD 2FPRA 3H6HA 4HO1X 4RV5A 5J2TF 5TQ2A 4ZAYA 3UJ9A 4D9GA 2I6XA 4DM7A 5BORA 1BQEA 1FFYA 3FYTA 5BYKA 3GBSA 5TQ2B 5EHXA 2FPLA 4GOND 3OMLA 3EUAA 3HCEA 3LNCA 3ECCA 3IT3A 4QGBA 4RL4A 4WXRA 1QTQA 5B53A 1UD8A 4GICA 4NBWA 5FUYA 1XVAA 1TQ2A 3JD4A 1NW4A 3UYLA 4YR7A 1H2BA 4XXHA 4XM1A 3ETEA 3QFRA 5T3UA 1VQKB 4P2BA 1P4MA 3RYHA 3NGMA 3O0TA 1UK6A 4D4HA 3BMQB 1V26A 5A8AA 4HVCA 1UBJS 5T64A 4Q9HA 4MKRA 3H2KA 1IY2A 2WJ3A 2WTBA 3ILXA 4DA6A 3H99A 3WIOA 5HBGA 4UHBA 5CGQB 3C87A 4RE5A 1RZRA 1OWNA 4TWIA 2IU6A 3NDPA 4AZ0B 2Q1WA 3WNVA 3UAWA 2AOTB 2FG7C 4IXMA 4MO9A 3HL0A 4HLNA 4LOIA 2R44A 4R40A 5JT1A 1X3LA 5KPDA 3D7SA 3BORA 2XWSA 3WQRA 1VM6A 3ZGYA 2R5FA 2Q2NA 3T3PB 3OHMA 4MWGA 2B78A 3A4MA 3ZQ6A 5JRDS 2UKDA 1WXHA 2VF5X 3GUUA 4MHSA 4R2WA 4BXOB 2WIAA 3KYCB 3VDQA 5B12A 2QVCA 4K9LA 3PA6A 3Q3HA 1XCOA 3BQJA 3LC0A 1C1DA 3OTIA 4ZVPA 4IYJA 3CC4B 2J32A 3ONUA 3EZFA 4Y2VA 4RVHA 1CFJA 1JHZA 2A5JA 2Y68A 4V0MA 5DWQA 5IHPA 1Y34E 1KERA 3ABSB 3D1LA 3HXLA 3A37A 4E1BA 1XRPA 1CUUA 2VQEB 3A14A 4QHYA 4PSVA 4M2LA 1N6OA 3LX5A 4C6RA 2CXQA 4PS1A 1KTVA 2BONA 4QEZA 2ECPA 3WFIA 4MVJA 1B73A 1IH8A 2FP3A 1JLMA 1UKYA 2D5CA 4QYXA 1KSGA 2DXIA 5LQUA 4MUNA 1FNSA 3EJWA 3WDMA 4X8IA 1UMKA 1DKLA 3ZIDA 3PKZA 5LLSA 2IDKA 1H4QA 4PBRA 1W85B 3CWZA 1GQYA 1OB2A 2EZ4A 5GM2A 2ZI4A 1EXVA 3R7BA 2XQVA 2AW5A 4IIYA 4EJSB 1R74A 3NT4A 2ZT7A 3HWRA 3QXGA 4N5MA 1YFZA 3EC2A 3H4VA 4P1VA 3AHFA 3B6JA 2WJYA 3OVMA 4X7BA 3KHTA 1CP3A 1L9XA 1G4AE 4HAZA 3A1EA 4GLLA 4KX5A 1YZYA 2R65A 1JDUA 2BR3A 2WKPA 4WPGA 3K09C 5G0VA 4ZJUA 1H2RS 1CC1S 4IJUA 5LP1A 3PDIA 2VBVA 4K87A 3MEQA 2X14A 1AKUA 2A8YA 5DKFA 1MLDA 2FVYA 4YLGA 2M98A 4B9AA 4EVRA 4E2ZA 1KJIA 2ZU0C 4Z9AA 3B1ZA 2GRAA 4MKIA 4LXGA 4GIBA 4JI4B 4W1RA 1LRKA 5TGTA 2PRZA 4DMKA 5HM8A 1K0UA 1O5TA 1O8BA 4LDQA 4IINA 2C42A 4LTDA 3V46A 4YIHA 3NZEA 1VPTA 1UBNA 2RGNA 2FZ4A 4ZCSA 5KI6A 4K2HA 3GVJA 3WQQA 1QE0A 4PE5B 1BE1A 1PBTA 4YXFA 1NJID 1W9MA 3VKUA 4RSHA 5MN4A 2YDXA 4HEA1 4NZMA 3GLSA 3A3KA 1AH2A 1T1JA 1I3MA 1Y42X 3VYVA 5BRAA 1EDEA 1OFGA 4QDOA 2DBVO 4Q4AB 2XQIA 3KYJB 4JJGA 3BHMA 5M2QA 4NYJQ 3F2VA 4ALIA 1F2DA 1FDWA 2WA1A 4BNHA 2JFUA 3D8HA 3V00A 2NSDA 5T4BA 1EM8B 4W99A 2HJSA 3PS9A 1UZUA 4HWKA 1OZ0A 1ZWKA 1ZL2A 1IN7A 4PC7A 3F6PA 4LZOA 1SBCA 2NM0A 3IDAA 4WXPA 4NENB 3RIXA 1S8FA 1NQXA 2GUWA 3PUMA 2AV6A 1MTZA 2JAHA 1WB6A 4INAA 4C0KA 2Q0QA 4YRGA 1V5WA 3ZNQA 2RCYA 4E11A 1DKQA 3FWPA 4OSPA 4B3BA 5C37A 1AV6A 2CGEA 3DR3A 3K09A 4R5HA 1WB5A 4QEDA 1LNQA 1Q0PA 5HYVA 1Q0LA 1YRYE 2QAJA 3GRVA 3SBOA 1EG2A 1VCMA 1XQWA 2WIFA 1I7QB 2P6RA 2I3AA 4S1OA 4DSNA 4ZC1A 2ANBA 4K8OA 3AT1A 4H4CA 4XSGA 5DIFA 5AVUA 2R2AA 4Z4IA 1BWPA 4ZARA 4EJSC 2PYDA 2REQA 3Q3AA 4LHVA 4L3VA 4AU1A 2JLUA 4UCQA 2WHPB 4LNUB 2BM9A 2Q4TA 4XMYA 1QIGA 3QXCA 3T94A 1NXSA 5BW6B 2R66A 4CKBB 4M7RA 4BO9A 1JSZA 4C0AC 3A6ZA 4MVXA 4AXXA 1OIXA 1O96A 7MDHA 5E4YA 2NVBA 2WWRA 4HWGA 4MLCA 3K20A 4OQNA 4TTAA 1SCQA 5ANRB 4ZEWA 4C05A 5CH8A 3FXAA 3L7MA 5KKNB 2AX3A 3FPGA 2AZDA 1BFUA 4X1OA 1GNTA 5ALJA 1P9LA 2DKOA 3DV0B 4CW7A 1R66A 2WTMA 1PR2A 4XTRA 4MHTA 2HO5A 2BBWA 4DUPA 4EUSA 1I4WA 4J4TA 2FOIA 4UMFA 3EOBI 4F5WA 2Z5LA 4EKIA 4CIWA 5TRDA 2YV4A 3CSUA 2G9NA 3AI2A 2EYUA 3T34A 1K4MA 5IJZA 2EU8A 1U7ZA 3Q1KA 2HQ1A 3U4HA 3PGXA 1OYWA 1SEVA 5AKLA 4D82A 3RBAA 1M2VA 5JD3A 4P86A 4IG4A 1MH1A 3V8QA 2WMYA 3F5SA 1G5FA 4RY2A 3UMFA 4PSAA 1RVV1 4WNIA 3U44B 5DNWA 1CX9B 3PQ5A 3ZH2A 2NO1A 1WKVA 1Q1QA 5ER9A 3RDPA 3KKPA 3VO8A 1JQDA 4P7GA 4XB2A 4W5TA 2JD2A 1WNTA 4MIYA 2QN6A 1XRQA 6Q21A 4QOJA 4XLZA 5FA8A 3V8BA 3CX3A 3BN3A 1SBNE 3R3ZA 1P1BA 2NTNA 4B5KA 4HFRA 4FMDB 1U28C 2VDWB 3NJ8A 4LJ9A 2BEWA 5ETJA 1F06A 3EA5A 1DE0A 4RD4A 4NDZA 4NNPA 4UC0A 1M1YA 1WKCA 2JEOA 3JASB 5L45A 3N8GA 5CH5A 1VJGA 1UR5A 3DEKA 2IF0A 1FU8A 3T61A 4M0MA 4RHFA 2JEYA 2I34A 3LT5A 2C4HA 3QEOA 1NT2A 2J6BA 1J0EA 4I55A 2IEZA 4JNCA 5DTMA 1YZTA 4DTIA 1XMVA 3QE0A 1L4NA 2WFZA 2AEMA 5K2OA 3NE5B 1C7EA 4YQFA 2OCYC 5EIEA 1Z6YA 4L5IA 2C7RA 3WMFA 1WM1A 1K1EA 1WZUA 2FEOA 3L1IA 1FUIA 4D8WA 4P4TA 1KJ8A 3PIIA 3PJRA 4R9UC 2IP2A 4MGHA 5L8VA 4HLQB 4LXUA 3WFZA 2ASVA 3I9KA 2OZEA 2Q6IA 3E9NA 2P65A 1DCTA 4OM7A 5D87A 1I4TD 1H0KA 4H27A 3NHSA 4LE1A 3WRYC 3ZWVA 3QNMA 3PFCA 2GKSA 1RYMA 4PXAA 4UOEA 4DV3B 3NYWA 2B3DA 3PC3A 1WP6A 1GG8A 2FPGB 3ZHUA 1ZD8A 4B4DA 3H11A 1OR8A 3MJTA 3MOIA 4BX3A 2P1DA 3AKYA 2JLXA 1O7JA 5JHGB 1QS0B 5A5FA 5HQ3B 1ZO8A 5C5DA 2GF9A 3AETB 2BDTA 1OYVA 3QQPA 4P5PA 4D99A 3TECE 3SAJA 1YCFA 4Q7LA 1MQ8B 4G09A 1F0PA 2QE7A 2UUOA 3R5XA 4XWYA 3V2IA 3L77A 1MAAA 4BBPA 3WK4A 1LUAA 2HA6A 1WAMA 2PGJA 3I5UA 3NCHA 3P71T 3SZ3A 3IIEA 4OMUA 3V8EA 1B14A 2AFHA 4XI9A 4BIIA 4UEOA 2G9ZA 4HUQA 4UEWA 2VTBA 3CKKA 4FIDA 1X70A 2A9PA 4C3UA 2X0FA 3I4LA 3WGGA 2JIMA 1D6MA 3T52A 1QLJA 2QORA 3SCZA 1G8PA 1Y8ZA 2ZSKA 3EDYA 4F2GA 3EF1A 2H1LA 1YASA 5T8KC 2L0XA 2XOEA 2JI6A 3NALA 4IMJB 1NQWA 3W5BA 3EEFA 2P6NA 3ONVA 1SOMA 2QA5A 4YJ3B 1KI3A 1F6WA 2XMCA 4CF3A 3IJPA 4YP1A 1HX7A 1X7YB 4ND2A 5B6IA 3GLVA 1FDTA 5LIPA 1BWSA 1QVZA 2QZ4A 2UYGA 3GD7A 2MR5A 3Q0EA 3CN9A 1LKZA 2D3LA 2H4FA 3VVCA 5K03A 2ZETA 1T43A 1XC7A 2PX0A 3W6OA 2RHHA 5C1PA 4KSYA 5HOQA 1RAEA 4R1PA 2NO5A 4PHHA 3ZD7A 4HF7A 3N0WA 3P52A 3SLGA 3SX2A 4E2WA 3HABA 2EHJA 4ZCRA 4CIAA 2X4GA 4FT2A 4JXKA 4MR8B 4P0PB 1V6AA 3IVGA 3HCWA 2YVQA 3OTHA 3NHMA 1E6UA 1UFOA 4GXTA 1E96A 2VZEA 1P29A 1ZEJA 2FPIA 2YJNA 1IG3A 3CM0A 3E27A 3HJBA 3L7BA 4GW3A 3KZ1E 5DEIA 2HHAA 4X8LA 4IR7A 5EMMA 4F84A 2UU9B 3SJZA 1CQZA 3OPVA 1WCIA 2L19A 2NZUG 3DZJA 4KUEA 3SM3A 3ZHQA 4I66A 4P5DA 3HR7A 1M90D 3R5HA 5T4HA 1P0QA 5BWNA 3RJMA 3W04A 3UTDA 3S81A 4AMBA 3GU3A 4EHNA 2XJ9A 2IE8A 4OFWA 1P2DA 3IHLA 2ARKA 4UASA 5DHAA 4F1JA 1BMQA 2BUAA 3E9DA 2H8GA 2I3ZA 1XA0A 3DCIA 1GNPA 4U2KA 1ZLYA 3U61B 1NMSA 2X40A 5CLLA 1E6WA 2V59A 3UYKA 4FYMA 4BNTA 1Q6YA 2G0AA 4RL6A 1V4NA 3G2IA 1KAQA 4IX9A 2DFTA 4O59O 4U5QA 4YP7A 1AY0A 3RIMA 5G4LA 1NDHA 4WV3A 3V1YA 3FGPA 4S1PA 5AXAA 4JKYA 1U5BA 3D0OA 2NPOA 5SY4A 4JB3A 3TEJA 3OZXA 3TIXB 4MPDA 3UN1A 5JR3A 4W5QA 1V96A 4WLVA 1DKOA 2VDKB 3AX6A 1ZXBA 3NBKA 4XVQA 3JAWA 1XA4A 1Y8AA 3I58A 1SIWA 3VU9A 1RMYA 3LUCA 1DC8A 2P9JA 1A72A 1OD6A 3QJ5A 3WAKA 4DWOA 3VR2A 3H7AA 1SUCA 3FWNA 2V6FA 2OK8A 2GXAA 2DHCA 1BE0A 2HDOA 4H6VA 3URMA 2XCOA 4UVEA 2Q3JA 4EMTA 1D04A 4YFVA 4JQZA 3SS9X 2Y1LA 4BMPB 2GCIA 3UICA 4B6EA 5BR7A 1K27A 1Y4UA 3SDBA 3HN6A 3WRXC 3KS9A 2GJ8A 2Q2VA 2W98A 4K3UA 5AHWA 3H6KA 1H93A 3CPWB 4L8YA 1GGHA 5K8LA 4FWBA 4I5IA 1MNAA 4RMIA 2J9RA 3QF4A 2G63A 3LLVA 3OPYI 5GJWC 2JJ1D 2CSUA 3HVHA 3NWPA 2X23A 4BO2A 1IAVA 2W2VA 4OQLA 3D59A 2DBYA 1DKPA 2PZEA 3IT0A 4KXQA 4KGZA 4PFQA 4PYOA 3ZE6A 1L5RA 2W2MA 4B3FX 3Q12A 5AESA 4KQIA 2R6CA 1OQAA 2ETXA 1Q91A 3STUA 3LNTA 4D8XA 2BJVA 2IXDA 1NKSA 3KQQA 1JFLA 2WU8A 3DT9A 3GMSA 3FAKA 1FVOA 3K32A 3P9QA 3LRPA 3OZTA 3HV2A 4HDCA 4NENA 3F67A 3KKNA 2X53S 1LBIA 3LQ1A 4M99A 3SWWA 1A4XA 1RLTA 2CF4A 4KMMA 1UDAA 5ALMA 1OF1A 5GTDA 2WJPA 1T2FA 1JJBA 4YT5A 2QLFA 2HL6A 2RC6A 4LV5B 1K8ZB 1MC5A 3G2JA 5CH3A 1GQFA 2ORWA 2QN2A 3KUKA 3ILSA 5D3MA