4RD4A

Structure of aif2 gamma from sulfolobus solfataricus bound to gdpnp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
413
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 109
structure length 413
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd4A01
1MRNA 3ZQJA 4JJKA 2QTZA 2CCGA 2KBEA 3EW9A 3LNCA 2DFLA 3G82C 4JLKA 4XWKA 2VP6A 4DZZA 1Y3AA 3PEYA 4ILEA 2FSGA 4F4CA 3MHPA 3HYRA 4A8JA 1AZSC 1YU9A 2AL7A 2QTVB 3UWOA 5C46F 3IEUA 1CLUA 2RGEA 2X3UA 2OXCA 1KJWA 3T61A 4JL8A 4QM6A 2NOAA 1E2NA 2O0HA 4NCIA 2BM1A 2GCOA 3LX5A 2RGDA 2G1KA 2JLSA 5JLJA 4GOKA 1BJKA 3CCVB 1TEVA 2LCFA 4JKYA 1NN5A 1NLZA 3T06B 5IRCD 2IHYA 2P0EA 4P32A 2C98A 3CR8A 3W2HA 4M9SA 2F3TA 1CRQA 4P4SA 2X19A 4JMPA 4BFZA 3TNFA 3ZD6A 3NHAA 1JAHA 2QRNA 2VNKA 5DLQC 5AUPB 4BFUA 5D3MA 1SXJA 3ZZTA 3DMDA 1KHTA 1KJYA 1VYVA 2OSBA 2QSYA 5J4YA 3B5JA 1NG1A 2R6AA 3DVLA 4Z8YA 1G6HA 3T35A 4C0QC 1X8LA 3QKUA 3GJXC 4TZ0A 3C4JA 1QHYA 4A0FA 2F7SA 4Q47A 2X1VA 4C0HA 4RD3A 2QDXA 4NTZA 3KX2A 2KBFA 1OW3B 5FBVB 2ZJ2A 3ADKA 3D7MA 5IHPA 4KFTA 3CC7B 2ANBA 4URYR 1A4RA 3MJRA 4XD7A 4QHSA 1NDHA 4WIAA 1ZUNB 3FKSA 2XITA 3B13B 5UKDA 3B1VA 2RGBA 2XNJA 3A1WA 4UJ3A 3CF2A 1LW7A 1Z6TA 4IOLA 1KNXA 1EFTA 3KKMA 1OXUA 1FQJA 4JLJA 1TMKA 3ECCA 4PQYA 3SNHA 3C8UA 4AC9A 2E87A 1ONBA 2IYVA 3I1FA 3CH4B 4GPTA 2PJRA 5CDFE 3CONA 2ECKA 1EESA 4DCSA 4Q7LA 2ODWA 4LI0A 2AXNA 3BWDD 4RY2A 1XNJA 3TUZC 2XGJA 3AGPA 2VP0A 1IBRA 2R6CA 4ZIRA 4J0QA 2GAOA 1QGZA 3K0FB 3I8XA 1KTVA 3CRW1 3VR4A 4AWXA 2DFNA 3H1TA 1BO6A 2QMEA 3MSXA 4LX0A 2ZTSA 3K70B 4LY6A 4H1VA 2NG1A 2W6ID 3DOFA 4JYBA 1R5OA 4TTQA 1DVRA 3X1WA 5J4LA 1OH8A 3GJ8A 4LYAA 4OHZA 2NQ2C 4HAXA 1ZUIA 4JLMA 4YDHB 3C7KA 1GAQA 3P32A 5JJLA 2AKYA 2CVFA 1EG7A 4MKFA 5DISB 4ERNA 2BSAA 1KAGA 1ZD9A 4IHQA 2GXSA 1YITB 4JLDA 4KVAA 3VAAA 5TMPA 2JLUA 1K8RA 1WB9A 2XSZA 2JLYA 2GXAA 1E9BA 1P7CA 3WXMA 1ZIPA 4FIDA 3I73A 3QF4A 1ZJ6A 1I7PA 1SVLA 2P2LA 2VEDA 5GADl 2CNWD 2F1RA 4LK2A 3U44A 4LHXA 1TADA 4UXJA 4ESHA 1NMYA 2ZRMA 3DL0A 5SZKB 3SYNA 3WNCA 3THOA 3FHTA 1UEJA 2WSSD 3C5HA 1Z83A 1G17A 2WJIA 1GL6A 1OPXA 3IPXA 3OEHD 5KYKA 3LBHA 1E0JA 3THYB 1Z2AA 4Q7KA 4TLDA 4LDJA 1FP6A 1GR1A 3KQLA 4NYJR 3T1QA 4RKFA 1UBGA 4G1UC 3OZVA 5L3VA 1VQ7B 1KI6A 3EZFA 5EXPA 2C9CA 1E63A 4LYJA 3WP1B 4QBHA 1W36B 1R2QA 2EVWX 5JI2E 1M1KD 1GUAA 2WJHA 4PPNA 4MRSA 2P6RA 3KB1A 2BIFA 2ZRLA 3B1WA 2XXAA 2ZAMA 3CB4A 1N8RD 4IOMA 1L7VC 3K9HA 4IOKA 3W8NA 1AJEA 2DHRA 2QM7A 1S1CA 2JA1A 3O8BA 2F9LA 3E70C 5FA6A 3B85A 3W5JA 1HT1E 1GRRA 1N6PA 4AG5A 3UKDA 2AWNA 5TDHA 2D2FA 3GD7A 1TQDA 4UJ5A 4LHVA 1H85A 1QFJA 3AB3A 3I4LA 3THXA 3EXAA 1E2EA 4Q1FA 4Q7JB 2O8DA 1XCMA 4BLOA 1D6JA 4B33A 2GF0A 4XVQA 1LY1A 2AR7A 2ZEJA 5B30A 1KK2A 1Z08A 4XIGS 4IVRA 4MYHA 4YMVA 1NBMA 3F0TA 4DDVA 1FUKA 2IUSA 1GP2A 3GJ7A 4Q02A 3A58B 4ABYA 1FFHA 2O0KA 1DO2A 4OBEA 3AF4A 1KQSB 1YJ9B 4MKHA 3W9YA 1HUQA 1H65A 1RVDA 2H5EA 3RWMB 4DLUA 4MYCA 4MKIA 1Z2CA 4RSGA 4Q1BA 2WWIA 3S1AA 4YMTA 2ORIA 3B8HA 2O52A 3GPLA 1RKBA 5DN6A 1GRQA 3ONWA 1SVMA 2FX3A 1W47A 1CIPA 1T91A 5KSZA 3Q7QA 1KI7A 4I1UA 2VHQA 1E1RA 3UWKA 1J99A 5CYOA 4YMWA 3SJZA 1BH2A 4Q21A 1G5PA 1AQYA 2MSDB 1S3SA 3OE7A 1YZKA 1ESNA 4G1VA 2GEVA 2Z4SA 4TL9A 5C4MA 5F3WB 2ZM5A 1Q1BA 3F3YA 1W4BA 2Z43A 2G0TA 1Z07A 2J0VA 5GV7A 2H57A 3CNOA 1E79A 3CCEB 2P3SA 1G8GA 3QSYA 3BB3A 5HKKD 5JS8A 4DUGA 1R8QA 4R2HA 4B6FA 3KQNA 4CGZA 4BEJA 1JA0A 1V5WA 3SFVA 4QL3A 1W7AA 4PAOA 3CW2A 3NH6A 4WZBE 3OFNA 2O8CA 1KJZA 1JJVA 1P73A 1YZTA 1UDWA 3IIKA 3OJWA 2QM8A 2GZAA 2ZR9A 1QHHB 2QMOA 3U3RA 3E2IA 3H86A 1P62B 4BQSA 4RZ3A 1QBKC 1W44A 3VU9A 3ZIAA 2O8EA 2HEIA 2JAQA 4MA4A 3QVVA 2UVQA 1Z22A 4PAQA 2D06A 3KKOA 4AKGA 4EIWA 3T1TA 2XB2A 3TAHA 1CJUC 1H8HA 3H84A 1E2KA 3MRSA 2W00A 4CEIB 3SHWA 3GLIA 2VHCA 1CRPA 3WRYC 4R9UC 4OI4A 3BK7A 1IM2A 1F2TB 4BZXA 3FPAA 1N6RA 5CLQA 1W4RA 3QPWA 5FOUA 5G53C 2JASA 2XJ9A 3QKRB 4RFVA 2IYQA 2VSXA 5FI1B 1NVWQ 3CRQA 4V0OA 1F2UB 1E2QA 3WNDA 3U4QA 1Q1EA 2YWGA 2GVDC 2G88A 2WKQA 4EH1A 2ATVA 3L8ZA 4GZLA 5EUMA 3UG6A 2ORVA 1WQ1R 2RGNA 3FE2A 4IDPA 4YAWA 2A5JA 4W5WA 3CCLB 1XD8A 5AJYA 4GP6A 3P20A 1K73D 3HJNA 3KB2A 3P26A 3OW2B 2CDNA 3CPJB 3LXXA 1RFLA 1RW4A 4PQRA 2WKRA 1IAQA 4OYHA 5BXQC 5KO2A 2NO9A 4B2IA 1T5LA 3LWNA 3BFXA 1OV4A 3OZUA 121PA 4CIDA 3I61A 4B3DA 1SXJD 4CRWB 4B2LA 3ND9A 2QP4A 1DE0A 1KKMA 4MYUA 1UMKA 5JWRA 3AP2A 4JVMA 2EWWA 2HT6A 3E20A 1L4UA 1OE0A 1NVVR 4RCZA 2WIAA 3BERA 1ELOA 4JVSB 3I55B 421PA 4C43A 1JBKA 3BFVA 2D7CA 4TT3D 3CNLA 2WWHA 4A36A 1MO6A 3A1VA 3TK1A 1KI2A 3Q72A 4QGHA 2GHIA 4XD7D 1J90A 4B4DA 2VNJA 2A3RA 3MCAA 1PLLA 2OCYC 3RRMA 2PBRA 3FKSD 2OLKA 4NYJQ 2GZDA 3DEFA 3WMEA 2IUUA 3CRZA 3R8CA 4IKEA 2F3RA 4PZLA 4PQFA 1HQCA 2TMKA 4FCWA 4GDFA 1YJ5A 2OILA 5JSZB 3O8CA 1A5TA 4KYUA 4KVGA 1FX0B 3CNNA 2DFKB 5H1YA 2QBYB 2OCPA 4MH0R 4RFSB 1R4AA 2AHOA 1K9MD 1GG2A 2REOA 1EX7A 3DMNA 2VQSA 2NIPA 5LD2C 4CEJA 1T6NA 4LYFA 1OT3A 2CL0X 3UANA 1JXMA 1TPZA 2F1HA 1F6BA 2Q6TA 1VTKA 1E1QD 2W58A 4NU0A 1G7TA 4KODA 1DDIA 3JQQA 1W0JA 4GMXA 4ACBA 2A7QA 2IS6A 2D2EA 3QXJA 1TLLA 1U0HC 2CE2X 2ZU0C 1XCPA 2PLRA 3MWLA 1G3QA 3GLHB 3T1OA 2VHUA 1IJEA 2GK6A 5KNBA 4W9MC 4OJKA 3KQHA 2ZUBA 1ZD1A 2V54A 2H1LA 4RD1A 3X1YA 4C9BA 1Q21A 3GLGE 5HR5A 3BH7A 2VZLA 4PO1A 2DERA 5FPHA 4QM7A 1KGDA 4LJYA 5KNDA 2ZI3A 4LBWA 3I32A 4TQAA 4LJAA 4URWR 3AVPA 5KUTA 3Q9LA 2QU8A 1W1WA 2IYUA 3CUEF 5EE0A 1ZCAA 2VYFA 2QQ0A 1XPRA 4EAQA 3ZVRA 2ONKA 4GOJA 5FUWA 1CP2A 1UM8A 1DG3A 3D31A 5E95A 3IO5A 4Q03A 2I4IA 4UNRA 2BGIA 2P6UA 3QJYA 1OYWA 2IYYA 5F2EA 3CZPA 3I56B 1KZGB 2DB3A 3UMRA 2FE4A 1DADA 4WZ6A 3K9GA 3CC4B 1SXJC 2IS1A 4OHVA 5EP2A 2IS4A 4LHWA 4IOJA 2OK7A 1GNQA 4Q9KA 4JLNA 4JBYA 3SJCA 4B48A 5JRZA 4OQFA 5D3QA 1KMHA 5EP4A 4A4DA 4F93B 3LQQA 1J9ZA 1KO8A 1KZ7B 2QPTA 3V9PA 2UZ3A 2VA8A 2C9YA 3PUVA 2GILA 4B34A 5KOYA 2FEOA 4A82A 4C7OA 2CXXA 1NY6A 5J5CA 1GOTA 1YQTA 2JLWA 3X1XA 3GCGA 2W83A 3CMAB 2MSEB 1RRGA 4MRPA 1AGPA 1JR3A 3RWOA 4V0LA 3I72A 2C8VA 3VNUA 1PLKA 4DCNA 1TU3A 4RZUA 4TQ9A 5FBLB 1NMXA 2ZJOA 4OJQA 2C96A 4OK6A 3AKEA 3OJXA 1U0LA 1VHLA 3K0CC 1UKYA 2G1JA 2KI5A 5BN5A 4U9UA 4WVFA 1FRQA 1GJRA 2ZROA 4MRRA 3EIHA 5J40A 5FH9A 1NJFA 4JKIA 1KDRA 1TU4A 3KTAB 3UPUA 3EIQA 2OAQ1 1XWIA 5GJBA 1II9A 5GJVC 1MO3A 4BLRA 5JZVA 3MG9A 1F20A 3AF3A 4M0LA 4NZYA 2OXRA 1D2NA 2BMJA 2ERXA 4EFLA 5BN3A 1YR6A 3W5VA 3IO3A 1TNDA 3CH5A 2FA9A 2QEQA 1JQLB 2RHDA 4TL8A 4D4KA 3C15C 1VQ9B 1DOAA 1Q82D 2WWFA 3OHMA 2PL3A 5FFMA 3EG5A 4OI0A 3GJ6A 1BS1A 2CNWA 3KJGA 2ODEA 3AM1A 5DN6D 2V6IA 1B2RA 4GL2A 3H2YA 2BEKA 4K1XA 1GL7A 1E1RD 1PUIA 1VG9B 2DWPA 5H70A 4D4JA 2VO1A 2WSSA 1J2JA 4HE6A 1R0WA 3GLIB 4EJSB 3AUYA 2QA5A 3OE7D 1Q20A 2MMCA 3MLEA 5LB2A 3RC3A 2FGKA 4RZ2A 2ATXA 4KCGA 5M04A 3PG5A 3AUXA 4WA7A 3ZZUA 3GJ4A 3ADDA 4K8OA 1IN6A 4HLUC 1E79D 2J1LA 1MKYA 4DUGD 3SE0A 4MDFA 5TXGA 4L4UA 2FGJA 2VNIA 1G6OA 3QKSB 3QXXA 1NKTA 2Q9AA 5GVRA 1UBEA 1XMIA 3A36A 3B1XA 4L9WA 3ZVMA 4Q1CA 2CNDA 4HZUA 3W6NA 1IQPA 4WZAE 5EP1A 3ZQ6A 1IN4A 3MAAC 3BORA 2KB0A 4KLNA 4MGYR 4DCTA 1NG9A 1LF0A 5J4HA 1ZNWA 3DOEA 1NVVQ 3K0FA 2OFOA 4QNMA 1JJ7A 3BOSA 3ADCA 1B0UA 1N0VC 4Q1AA 4U7DA 3AVXA 1E64A 1H8HD 4P4TA 4RVCA 3MFYA 4XTCS 5KNCA 1SHKA 4UKDA 2FDCA 2QRZA 2Q9BA 2VTKA 1F3OA 2EW1A 3BAFA 3NTUA 2B7CA 1IHUA 2OBLA 4US2R 1RYHA 2MSCB 1D5CA 1HT2E 1I4DD 2IBMA 2Q3MA 1GKYA 5B57C 4HZIA 1E2IA 4POAA 4DIDA 4G5OA 4DC9A 3R20A 2QAGC 1SGWA 3EZ7A 3G4SB 4TLCA 3RYTC 2ZI9A 3GMTA 1K5DA 1UJ2A 1TVCA 1QHIA 4K81B 3BXZA 3W3AA 3NBZC 2NPIA 4NCNA 3LXRA 4Q1EA 1P2UA 2CJWB 1FL9A 1KI3A 1R5BA 1XD2B 3EX7C 2ZXUA 4OHXA 5FPSA 1D9XA 2RHMA 3ASYA 1JB9A 4IW3B 2DBYA 1DBSA 3CBQA 1XTJA 4X8OA 1PZNA 3TQFA 3PIRA 4BLSA 4TLAA 1OXSC 3MMPA 4FK8A 1J8YF 3AQ4A 1KO1A 4JBXA 1LS6A 5FOXA 1Q1QA 1NSFA 3LW8A 4QXAA 4YMSA 1R10A 1O3YA 2F43B 2QTLA 5EE3A 3HWSA 1KDTA 4AY2A 1KK1A 5JMTA 3W5HA 2R44A 2FZ4A 1G16A 5HKKA 2N46A 3O8RA 4EKDA 3REGA 3EPLA 1OXXK 2YOHA 4LZZA 1RE0A 2ZITA 4FMDF 3OZXA 2W0SA 2OFXA 4NE2A 4M22A 4HUQB 2I1QA 4NYIR 2RKOA 3JVUA 4M1SA 2BMDA 4PAMA 5CLLA 5DNYB 5E4FA 1FMJA 1NJGA 1VCMA 2F9MA 3FWYA 2ZRNA 3QE2A 5BW8A 2V9PA 2X8AA 4YAUA 1LV7A 1W5SA 1XEXB 1GVHA 1U81A 4LCBA 1SM4A 1NVUQ 4JLAA 2F55A 3V4RA 1QFZA 4NBSA 2D62A 2Z0MA 2GJKA 2B21A 2Z4RA 4E07A 1GVNB 5C18A 1QF9A 2FOLA 1KSFX 3D3QA 2ZI4A 2OO7A 3RVBA 4DJTA 4IFEA 2HF8A 2YC2C 4PHTA 2OTLB 2VP4A 1MRSA 4QGFA 5DYGA 5J4KA 4B73A 1BX1A 1QVFB 4GNKA 1W0JD 1I2MA 5TY0A 4URUR 4WOPA 4FN5A 1QRAA 2AN9A 4L8GA 1VG8A 1OH7A 1XPUA 5CIQA 1Z0DA 2YWFA 2WAXA 4V0MA 3FMIA 4D4MA 3TVDA 4NL4H 4RKEA 2SHKA 5L3QB 1E6CA 2ZYWX 5FI0B 3R7WA 5GVSA 2B7BA 5FR2A 3LDAA 2EQBA 3CCUB 3U3JA 2QP3A 2QNRA 3U3OA 4HB0A 3W3ZB 1NN3A 3LVRE 5H59A 3RNLA 1VQLB 1XXHE 4Q9IA 2RGNC 1TX4B 1D2EA 3E1YE 3PENA 5DI9A 4DLTA 4M9QA 4Q4JB 3NDPA 1ZYUA 4D4LA 1P9NA 2R8RA 1E2GA 1FTSA 4R2IA 2BCJQ 1NRJB 2YVUA 3KKPA 2GF9A 2W2TA 5HZHA 3EAQA 2QMUA 4B3XA 1U9IA 4ASUD 3LVQE 1PJRA 4QGGA 4TWZA 2J7PD 3RS3A 3NDBB 4DQKA 3W2IA 2GJ9A 4BPRA 2QTFA 2XTNA 3GFTA 4N1AA 3TR0A 2V55B 2R6GA 2YJTD 1XPOA 5TV2A 1T8UA 4A92A 2PMKA 2A5DA 4PC7A 4BASA 1CJMA 3LY5A 3HU1A 4HAYA 3PQCA 4OHYA 1E96A 1R8SA 2CL7X 1VIYA 1WBBA 3DKVA 3EZ9A 4TT3A 2VP5A 1AKYA 3CX8A 5B58C 2EFDB 3L0IB 1BYIA 5AUOB 2ODBA 2ZJ8A 4CEIA 2G6BA 2QE7A 2ODNA 3GJ3A 3FGNA 5JHGB 3OAAA 3CCJB 4HSEA 1F2TA 3P1JA 3C14C 2WV9A 5EE5B 1WE2A 2BVNA 2BBOA 2W0MA 3EZ2A 4MITA 2YWEA 4ZGQB 3PJRA 4TL6A 2C99A 2FG5A 3C16C 1W5TA 4ZI2A 1F2UA 1JR3D 1N5LA 4ZDJA 3K0CA 4I1OA 1YZLA 2QI9C 5G3YA 3R9XA 4CEHB 3KUCA 3RS7A 2JLXA 1QVRA 1QX4A 3PCRB 1FPMA 2F1JA 3IQXA 4PGOA 1P5ZB 2BMEA 3GJ5A 3QEJA 2OTJB 4P31A 1ZD8A 1E1QA 2VLIA 3EPJA 1W49A 4LJ4A 2PH1A 1G8PA 1IOZA 1KI9A 1XE1A 4D25A 3IGFA 1S3GA 4M1OA 1Z63A 3SYLA 1OB2A 4DSOA 1EFUA 2QENA 3CO5A 3Q5EA 2VF7A 4TMTA 1XTKA 3ZVLA 521PA 3V76A 3UIEA 2IYZA 1X6VA 1P9WA 1LB1B 1OJLA 5DHAA 2BV3A 1A2BA 4G5RA 2AK3A 2FF7A 1B23P 3MWJA 1M6NA 4MGZR 2ORWA 3THWB 4BGDA 4EQ6A 1M74A 2FSIA 4B3BA 2XNCA 4LGMA 2HMAA 3LO8A 4KHZA 2W2XA 2Q3HA 1DAEA 3WRXC 4I1VA 3ZS8A 4FWIB 1TUIA 3K09C 4HLUA 2QMHA 4Q4AB 2BHRA 2WOOA 4JSTA 3CD6B 1E0KA 3LVBA 1JECA 2BCGY 4YDSA 4Y9RA 1YRAA 2VBCA 1R0YA 3FJOA 1G9XA 4M1WA 2BOVA 5JSZA 4TYWA 4QFMA 1IY2A 4FMDB 3IDQA 1FX0A 3OIVA 3QXSA 4Q4LA 5FUVA 3T5DA 1Z47A 4DCUA 621PA 1UDXA 3MD0A 2R9VA 1JPNA 4D2IA 4US0R 1GNRA 1Z0AA 3Q7PA 2QT1A 1HH4A 1ZM4A 4KXFB 4ZKEA 3UMSA 4B3CA 4B6EA 5JEDA 2BN4A 1PVOA 2O8FB 1SQ5A 2FU5C 4PPQA 1BYUA 4M1KA 1SVSA 2P5SA 3DHWC 5G3ZA 4N3GA 3ZBTA 3K70D 4I99A 1E4VA 2UKDA 1G3UA 1FTNA 3KXKA 5CM9C 2V3CC 2GETA 4TYYA 3GLHA 4CDGA 2HF9A 2JJ2A 2XTZA 1XFAA 1ZU5A 1FNBA 4NYIQ 3X1ZA 5FOSA 5THXA 2YNMA 2IW3A 2BGJA 1TL7C 4Z51A 2ZI5A 2ZRGA 1I2DA 4PR0A 1N5KA 2QAGA 2JATA 4ITRC 4LHZA 2ZUCA 3QBTA 5CIWA 2VL7A 1DAFA 1EWQA 1G18A 5CITA 5JS7A 3ZVNA 1RRFA 3CMEB 2ZSFA 4PC6A 2J59A 1T8TA 2IUTA 4LJ5A 3WMGA 4RD0A 4QJ5A 1QGAA 2BDTA 4OKSA 2FH5B 4I81A 3I3SR 3L0PA 4DDWA 3DPUA 3LBNA 2ZJYA 2ZREA 3KXLA 4DSNA 2XZPA 1SVKA 3IQWA 4C0SA 3GP8A 1SVOA 3WY9A 4LJ9A 2QY9A 2D3WA 3O8DA 2QEXB 4PPFA 2RB4A 2B5OA 1LVGA 1UPTA 1IONA 3BB1A 4EDHA 4LOAA 1W36D 1QUFA 5GV8A 1KNQA 2J7KA 1OH5A 1X1SA 1Q44A 3BS4A 2PX0A 3M4YA 1HEIA 2BJWA 1YHNA 3A1SA 1MABB 5G40A 1OLOA 3HYTA 1MH1A 1GTVA 3QEOA 3FKQA 1KK0A 3GFPA 4LBYA 5JBQA 3QG5A 1SVIA 4QRHA 2RMKA 4AD8A 5P21A 1S0UA 1ANKA 3GLGB 3AVWA 2G83A 1IN8A 3BE4A 3NKVA 4NDZA 4PZZA 1GRNA 1U0JA 1ZIOA 4GRAA 2REBA 4Q00A 4A8JB 4R71A 2J9RA 1Z6AA 2DWOA 2O0JA 4TMKA 2WSMA 4BLPA 2VYQA 2ERYA 1E62A 5F9FA 5DI3B 2XJ4A 4O25A 4OI2A 2PZEA 3SDZA 2GCOB 3VHXA 1KIMA 3Q5DA 4B3GA 1A82A 2WICA 3DM9B 3X2SA 2IYWA 3EIEA 2B6HA 4P4SB 4E5UA 1GO2A 3OIYA 5KSYA 1BMFD 3GLFA 3KTAA 1QHGA 2CCJA 1E69A 2GKSA 2GA8A 2B92A 4EUNA 3ZS9A 1E0AA 2ZUDA 1R0XA 3ADBA 2WWYA 1E4YA 3K70C 1LTQA 4PSVA 3LLUA 4RJLA 3A4MA 5D3MB 4C0BA 4DT1A 2GQFA 3MWKA 3X1DA 2L0XA 4ZCMA 3JVVA 2V8OA 2ZYTX 4S2EA 4LPKA 4ZI3A 2NO7A 2GESA 2PZFA 2ZR7A 3VFDA 4C0JA 5EUQB 2IYXA 2VPPA 4DLYA 2QPAA 1OGIA 3HDTA 4Q7MB 4A2QA 3A1TA 1FNNA 4HAZA 3ZLJA 3VO2A 3PUXA 4CF7A 2BBSA 1RYFA 2RGGA 3BBPA 2CMKA 2QL6A 4FMBB 1YRBA 1WA5A 1Q3TA 5HXBA 1KKLA 4GP7A 3TIFA 2WMNB 4GSYA 4BRUA 4EJSA 2QGNA 1W46A 2IEYA 2YV5A 5EMNA 4TYPA 5KSWB 1NJID 3BIFA 5CYPA 4D82A 4YQFA 1Y63A 5FPTA 3NBXX 1BIFA 2EFCB 4PPGA 2ZYUX 4OQNA 3SQWA 4PO8A 5TVKA 4DIEA 1ZMXA 4U02A 4KU4A 1XRJA 3QKSA 1Q12A 5DHFA 1BX0A 1VQNB 3QG1A 2IA5A 4ZIRB 2IT1A 4F4JA 3N5CA 4QC2A 2G0NA 1GAWA 4C3ZA 2O8BA 1CQXA 1VYUA 2A30A 4A2PA 4DVGA 3WHKA 1ZM3A 3L43A 4L15A 2QG6A 2V6JA 3EWAA 1C4OA 2NGRA 1W0KA 3IHWA 3GJ0A 4CW7A 1II8A 1C1YA 1EWRA 2ZS8A 1K5GA 4HB4A 3LH5A 1YJNB 1GM5A 1NSTA 1U99A 2QE7D 1US8B 2CVHA 2ZJBA 2HLDA 1NI3A 3OAAD 3PVSA 4Q19A 5DO9A 5DE3A 5KDOA 3W5IA 3P4XA 3B6EA 4Q4HB 1IXSB 4WQMA 4B43A 3LW7A 4Y0AA 2G9NA 3W90A 4M21A 1BKDR 1GNPA 1XCGB 1HY3A 3B1YA 5CK5A 3UK6A 3VR1A 4Z1MD 3I8SA 3EA0A 2CRVA 4WW0A 3R8FA 4D26A 1JEDA 4M1TA 3U7FB 1QGYA 2ZRFA 4WAUA 4KV9A 3U3MA 5C2JB 1TEXA 2REXB 5HTKA 1PV4A 3RSOA 2DY1A 2OCAA 1OXTA 4JJZA 3I62A 4YC7A 4UAJA 4M1YA 1FQKA 2CJWA 5CB8A 4TLBA 3GFOA 1DAIA 5AK0A 4BFWA 4EPWA 4URVR 5CDFA 1S72B 3PV0A 1IY0A 1XD2A 3A4NA 1ZU4A 5FL7D 8OHMA 2XXAB 4GI7A 4LC1A 1EP3B 1H8EA 3IHLA 4RZXA 2IXEA 4B76A 4UNSA 3FOZA 1N5JA 4NONA 3AP1A 3I5YA 3D6TB 1XMVA 4MGIR 3U5ZB 5A0FA 1Z6GA 1DAHA 4ARZA 1X1RA 4US1R 1YR7A 1G64A 2ZE7A 2GXUA 4O3MA 3TQCA 4NCJA 2GCPA 3K09A 1JALA 4AG6A 3WNBA 3THXB 2OUKA 2DEUA 4ASUA 2O8DB 2J7PA 2V4ZA 4OQMA 2GJ8A 3RAPR 3TKLA 3Q8XB 4HUQA 1VCOA 3M1IA 1U9IC 1CF4A 2GRJA 4PHGA 2JJ8A 1SXJE 2HJGA 4HDQB 2NO6A 2VIIA 4TSFA 4JLOA 1FDRA 2OK8A 1GKUB 1XZPA 3H0KA 4BFXA 4DLSA 4UNNA 2P6NA 3UG7A 2HCJB 5DH9A 3I92A 4YAFA 2JIZA 1AS2A 4A2WA 1XDBA 3FFBA 4P0TA 5JFGA 1UKEA 1OF1A 1NIJA 2CEAA 3WBKA 4X8HA 4JSYA 3SQXA 3S1AB 1GITA 2ZRHA 2ZE8A 4B2PA 5EQTA 4NP6A 4IEIA 4LV8B 2OV2A 2WWXA 4H1UA 4C4PA 1IJFA 3SHFA 4GZMA 2BM0A 3FHOA 4II7A 1Q3HA 4B74A 2QUZA 2JJ2D 1EFHA 1XP8A 4E03A 4F7WA 3MWYW 2NTYC 3RABA 1S8FA 4DDTA 2W2VA 1VQMB 1ZNXA 1T9HA 1CJKC 2WWWA 3KL4A 2LKCA 3P4YA 5C1BA 3PXGA 4F92B 5B2ZA 5FOWA 1QFYA 1G291 4HDCA 2X77A 4KLZA 2I1VB 3ZGXA 2GTPA 4EPRA 1P3JA 3KJHA 3QIAA 3CX6A 4M8NE 2RAPA 3D8BA 1LS1A 1G1MA 5JCZA 4M9ZA 3QY0A 4D81A 4UNQA 1EK0A 1T0JB 2FWRA 3A37A 3CC2B 4FXPA 2YYZA 2OLJA 2ZSAA 1GILA 4V03A 4KBGA 2ANCA 3TRFA 1Z6XA 1ZW6A 1G5RA 1UF9A 2WJVA 5BYJA 5JEEA 3PEVA 2IEZA 2VNHA 5C4GB 3VU9B 3NC0C 3LD9A 2HJVA 2FJUA 3NEJA 4F38A 4QJ4A 2A5GA 3CXCB 4YONB 1PUJA 1Q22A 1FZQA 1XJQA 3LRPA 2NPFA 1CULC 2PJZA 2ZR0A 4KO8A 4UQOA 2NO0A 1E9AA 3U7EB 4ON9A 1KC8D 5FUXA 3WHLA 2RGCA 4BLTA 5IK2D 4PC1A 4QBGB 1OFUX 4Q18A 4QNRA 4CVNA 2J3EA 1G3RA 1GZSA 3IPYA 1HE1C 1W48A 1T3LA 1IY1A 1NL3A 2BJVA 3GEIA 3FTQA 4PX9A 2B8TA 2GWHA 1ZM2A 1DDGA 1IXRC 2JLRA 4W5HA 4IXMA 3WMFA 4XWOA 3T34A 1XBTA 3CLVA 4AK9A 1WXQA 1S9HA 1UBFA 4NCKA 1AGRA 1T0HB 1XXHB 3KJIA 3JZMA 1SKQA 2QSZA 3PFIA 4O2LA 4B3FX 2V1XA 2FFBA 4L16A 4M9XA 2IHBA 4CEHA 4HDOB 2E1RA 2IXFA 4Q01A 1CS4C 5E7MA 1KI1A 2JLQA 1P2VA 4MQBA 3NBYC 1Z6YA 1E32A 2CHQA 3PUZA 1VQPB 1T5IA 3KZ1E 1KO7A 2CL6X 1JI0A 1ZM7A 3M6AA 1N6NA 1FNDA 4HLQB 4B44A 2ZJAA 4UNPA 1ZAKA 4X8LA 4LV6A 4DRZA 4RCYA 2WMOB 1O87A 5EXSA 1N25A 5H68A 1G3MA 4URZR 4X8MA 4TYNA 5EP3A 2R62A 1ZP6A 1AN0A 3ASZA 3J81k 3A4LA 1TUEA 2H7VA 1OIVA 5FTKA 1KI8A 2KSQA 1KAOA 3AVYA 2XNDD 5FPYA 3TSOA 2VRWA 4Y7CA 3QBVA 4CZ2A 4DWJA 4TQUS 3DKPA 4CT5A 4D0GA 1FW6A 4G5GA 1KOFA 2A5FA 3THWA 4UXIA 3U3KA 4LJ6A 1EFRA 5AWFC 1SZPA 1E2LA 3REFA 1MT0A 1CXZA 1R7RA 1NBME 3THYA 4ACAA 2FZLA 3L8YA 4DEYA 5JJKA 1DAMA 4UXHA 2HUPA 1QG0A 4LJ8A 1XB2A 221PA 2FFAA 2ZRCA 4H9GA 3KKQA 4TTRA 1QZXA 4Q4AA 5AJVB 5F98A 3FFAA 4W5JA 2ZRDA 2QZ4A 2QT0A 2HYDA 3Q3JB 3VR6A 1XTIA 3OF5A 1EP2B 3Q85A 4JVLA 1AS3A 4D0NA 1G19A 2Q3FA 3EZ6A 4PFSA 2P5TB 3HU2A 2GBLA 5E3HA 4YAOA 1AZTA 3BC1A 1Q57A 5CB6A 4CEJB 4RD4A 2C2HA 2JDID 2BBWA 2FN4A 5CM8B 2XAUA 3VHLB 1HA3A 4HAUA 1CJVC 2N1BA 2O8FA 1C9KA 1T3HA 3EWSA 3AP3A 1CR2A 1DTSA 4TLEA 3PUYA 1W0KD 2I3BA 2BEJA 2GDJA 3K0EA 3TAUA 3QFTA 3QUSA 2A5YB 4WXRA 2AK2A 4TYQA 1AQUA 2Z83A 3O47A 2LWIA 4AF6A 3KJEA 3CPWB 1VYTA 1UADA 3U61B 3QF7A 1VQ5B 1CJTC 1JJ2B 2HLDD 1Z5ZA 2ZSDA 2FFQA 3ICQB 4C0AC 1ZRHA 4AKEA 1RRCA 1U8YA 2NZJA 4GMDA 2GNOA 5JI3E 4IVQA 1Z0KA 4QJ3A 1SHZA 2R6DA 1I4LD 3QXCA 1Q1ZA 2DCUA 1BMFA 1P6XA 2OZEA 1G8FA 2W6JA 3TSZA 1E94E 1R0ZA 1VQ6B 1E2DA 4G01B 1FOEB 1I4TD 1M34E 3KUDA 4P3YA 1HYQA 2PEYA 5JWOA 4NCHA 2CK3A 3QFRA 1W2GA 3TH5A 5J47A 1GIAA 2C95A 5EXTA 4DLVA 4V0NA 3SYKA 3OEEA 3CF6R 5SZIA 3CCMB 3BRWD 2VHJA 4BUJA 3GLIE 1CKEA 3SR0A 1MO4A 4F91B 2DWQA 1KMHB 3GQBA 4LWZA 4DCVA 1TQ6A 4PANA 1WP9A 3B1ZA 3SZRA 2JJ1A 2WTUA 1H8ED 5BN4A 2IC5A 1ZNZA 2J0UB 1OIWA 2FEMA 4F4IA 3RS5A 3ZYCA 2ZS7A 1KK3A 1JEEA 2V7QD 1NNEA 1QHXA 2J41A 4C7OB 1VQKB 4NKRA 3DO6A 1LFDB 4IDNA 3PEWA 4FWTA 3TVTA 1CR1A 4EJSC 2C5LA 3AEZA 2XB4A 4NYMR 4B71A 1JR6A 1G8HA 3RRZA 4Q48A 4XVUA 2BKUA 3UATA 4AF7A 3GLGA 5DGXA 3AKYA 3CWZA 3TGPA 3EASA 1M7GA 1M2OB 2AWOA 4JYCA 4DLZA 2JLVA 2DYKA 2AKAB 1JXOA 3E5HA 4HLDA 1KO4A 5DI3A 4IXNA 4OI1A 2Q9CA 2NMVA 3G0HA 4LC0A 1QHHA 4IJMA 2C77A 4LBVA 4B75A 3U60B 1WCV1 1OIXA 3NXSA 4XOIA 3KDSE 1CNEA 1COWA 1UKZA 1VPLA 4FMCF 4TSFD 5AR1A 1S1MA 1NLYA 4G5SA 5GJCA 4KYIB 2FPKA 3W34A 4PC3A 1S96A 3VNVA 3UMFA 3A8TA 2P65A 1N3BA 1NLFA 4V02A 5FPKA 4KI0A 1EGAA 1E2FA 2EWVA 4EPTA 2JIZD 1W4AA 2ZPTX 3HR7A 3EPHA 2IK8A 4G0NA 3LO5A 1E2HA 1XF9A 1EX6A 1CNFA 3VR3A 5EZ6B 4BLQA 2CCKA 3L0OA 4DLWA 3TJZA 5FTJA 4IDOA 3JQPA 4JIMA 1A1VA 4ZDIA 3QKRA 4E22A 1TF2A 4OK3A 2IL1A 1M8PA 4MGKR 1N6IA 1E9SA 1U94A 5CJ2A 5FTMA 4Z1MA 2VHTA 3KQUA 2ZRBA 1AK2A 2DPXA 5KSPA 3BH6A 3CKLA 3IBGA 2IS2A 4OL0A 2IF2A 1R5NA 3WBJA 5KHOC 2IX3A 4BWYA 4C2UA 1V43A 2DFTA 3CZQA 4MRVA 3G5UA 4U5XA 2VSOA 2Y8EA 3W2FA 1EFCA 1ETUA 3W8RA 3ZH9B 4WBSA 2ZRAA 3W6OA 2HYIC 1VECA 4ZKDA 3BD9A 2KE5A 1VHTA 3QPVA 2YOFA 2WWGA 1IN7A 5AJZA 5FL7A 5FR1A 2VH5R 2GPJA 1KI4A 4RD2A 1Z06A 1EP1B 3LLMA 4TTPA 2FNAA 2BC9A 2WJYA 5ANRB 5DSZA 1UKVY 3CCRB 2PT5A 3AF1A 4HZUB 4TMZA 5L3SB 2VP9A 2Z5FA 1NF3A 1U90A 1E9EA 1G21E 3ZDQA 3BB4A 5TB5A 2YKGA 1T3SA 2GVZC 3VR2A 1Q86D 3PUWA 2YHSA 4HE5A 2QTHA 2HT1A 4DBLC 1E2JA 4GT1A 2HDNB 4MUAA 4KFUA 2BKEA 1JPJA 4OQLA 3AF0A 1OKKD 2PLFA 4G3XA 1YI2B 2ZJ5A 5FL3A 4DLXA 3G71B 1OFTA 3VTKA 2PCLA 5FOVA 1E9RA 3B7GA 4YALA 4D6PA 1AS0A 3QE0A 1OHHA 3RRNA 1P72A 1E9CA 3DDCA 3ZJYA 1QVAA 1XEWX 2BBTA 1US8A 2R65A 2FMXA 1AKEA 2J45A 1KRHA 1FMLA 1XJCA 5EXXA 4ZCIA 1G41A 4C0LA 2GJSA 3FMFA 3VKHA 4LUCA 4Q4HA 4A0HA 2B8WA 1OYYA 3B9QA 1DAKA 5AUQA 4O0MA 2QN6A 2ZI7A 2QBYA 4RFSA 2WM9B 4KITB 1OSNA 3C5CA 3VX4A 4DQLA 1GL9B 1S2MA 3E1SA 1XTQA 2CE7A 2XEXA 2Q21A 3N2EA 4EPXA 5AUNB 4L5BA 3BFKA 2OFWA 1Q7YD 2FFHA 5FTNA 2XNSA 4G5QA 5HCNA 4A0RA 3QXHA 4PHHA 1YIJB 3DZ8A 4HUTA 3QQ5A 4KJZA 4JBWA 1RC8A 3FMPB 5FOTA 1DS6A 4A6XA 4XH9B 2JEOA 3UXMA 1FNCA 2NZ8A 1ZM9A 4CYMA 3WYGA 3KXIA 5TARA 1JR3E 2Q0HA 2GEDA 5FUYA 5SZHB 4M1MA 4F7DA 1KSGA 1CBUA 4AI6A 2J5XA 3OZWA 3HR8A 5LPNA 1Z0FA 2ZSEA 4IDQA 1VG1A 1JA1A 3W2GA 1GAJA 1RJ9B 1YZUA 2EFHB 3OIWA 5FBQB 5G41A 1EFRD 1E0SA 4Q9LA 2WJJA 4N3NA 1HE8B 3SOPA 1K8AD 2QPOA 1J8MF 4D0LB 3N70A 5JRJA 1TF5A 4ZO4A 3NC1C 3LV8A 5KPDA 4HB3A 5AJXA 1W35A 3IUYA 4JLVA 4JT2A 4B35A 1GKIA 1ZCBA 3LAWA 2ZRIA 1CTQA 3G6EB 4DXAA 3NVAA 1VG0B 1QG2A 3SU8A 3K0SA 3LX8A 2C9OA 1VCNA 1U2RA 1KYIA 4BPBA 2A78A 1G4UR 5LD2B 4DB2A 2DR3A 2WHXA 2WPDA 4D80A 1P75A 4AKIA 4KSCA 5IK2A 4YXWA 4FCTA 5FBWB 1JQJC 2CLCX 1XTSA 2KJQA 1G8YA 1W4CA 4IFBA 2RGAA 5K8TA 3U7GA 2EU8A 1P9RA 1W34A 2D74A 4NYMQ 1N2CE 2C03A 2ZE6A 4FMCB 1SULA 4DHEA 4EPYA 1E9FA 3AKCA 2BF4A 3T15A 2IYTA 1S4QA 4TMXA 4Q9HA 2ZYVX 3JZAA 2GK7A 2QROA 1GFIA 3R7WB 1U8AA 1X8JA 1A8PA 1TQ2A 4Z8XA 4TMVA 3ES9A 2IXGA 1NMZA 3AKDA 1J70A 2ASEA 4KFSA 5KU1A 1ZUHA 1RPZA 2VF8A 4R98A 5LB4A 1ZVQA 1VQ8B 4C0KA 1YVDA 3VR5A 2GEUA 3TE6A 4I4LA 1YKSA 3T12A 2W6JD 4BFYA 2YC4C 3TMKA 2CHVA 5B64A 1VCIA 3NEYA 1E3MA 4EFMA 3W2EA 4DB4A 5JJIA 1SXJB 3CPEA 1D1NA 4AKHA 2CK3D 4KFRA 3L2OB 4YHBA 5K8IA 4DKXA 4A0GA 5IT5A 1X3SA 4HLCA 3SFZA 3OEED 1M90D 4K46A 4ZV4A 2IWRA 3SJBA 4TMWA 4FI3C 3W5UA 2WIBA 2XNDA 3QPUA 1NP6A 1YR8A 3FHCB 2X2EA 3PR1A 2RC6A 2A9KA 3SBDA 5E7IA 2WBLC 4LBZA 2JJ1D 3H4MA 3L0SA 3M0EA 2FPMA 3ZBUA 2PT7A 2XOKA 4HAWA 3OESA 3VMFA 4QBIA 5HE9A 2ZQ5A 1DG1G 4AIIA 2AD5A 5BYKA 4FCVA 5DIFA 1XJ0A 1W2BB 2PX3A 4Y9UA 1Z8FA 1CU1A 2H18A 3CWQA 3FYHA 4A15A 2J0QA 3RDPA 3P27A 3NHBA 2OEPA 1KMQA 4BZPA 5JECA 2EIXA 5JWHA 4O2RA 3RANA 3EC1A 2YZ2A 4HAVA 4HEJA 3ICEA 4LPSA 1XMJA 1XXHA 4JS0A 1W36C 3CF0A 1IXZA 2JDIA 2HCBA 1QH0A 3FDIA 1XU4A 1RZ3A 2RH5A 3RS4A 2GBLC 1YZGA 2E9SA 1Q0UA 2ZRJA 4PO9A 2H16A 4ESVA 2OESA 1KSHA 4A1FA 2DETA 5A5GA 1WMSA 1COWD 4P4UA 2G77B 1JAIA 2HXYA 1P60A 4IVPA 4LV5B 2Z6VA 4W7SA 2ZS9A 1N6OA 4Q5IA 3AVTA 3MUFA 2ZIAA 3NG1A 2RGXA 3NIBA 4C2TA 2FSFA 2C04A 1KSJA 1A7JA 2XTMA 2JLZA 4ZGNB 2OHFA 1UAAA 4PHFA 2QA4B 3GEHA 3QF4B 3CIOA 1NN1A 2OAP1 3U44B 1NN0A 2ZANA 3T1VA 4NMMA 5A4JA 2D4HA 2OBMA 1RIFA 2R6FA 5H5JA 1CR0A 4N0EA 4EQ6B 4PC2A 3K8YA 1WBDA 2XZLA 5J4VA 1VIAA 1ZINA 3WP0A 3RS2A 1N6KA 3HPQA 1II0A 2UZIR 3RSLA 4XSHA 4QOSA 1ZBDA 1G20E 4XVRA 4URXR 1KI6B 3QFSA 4RD6A 3U6KA 4I1SA 4MRNA 1DARA 2QORA 1VDZA 1OH6A 2P67A 4S35A 3TW8B 2N42A 4BE7B 5DYIA 4OHWA 2ZJZA 3VQTA 5K8LA 1PLJA 3SS8A 3IBYA 2H17A 1GDDA 2ZVQX 2D7DA 2OT3B 2BMFA 4U00A 4V0ME 2V7QA 3FMOB 1L2TA 2F1IA 1KDPA 4MYTA 1RRPA 4BZQA 5HPYB 2FPLA 3FPKA 2XX3A 3MGCA 3TBKA 1TTTA 1DPFA 3BGWA 4ZDKA 5BWMA 2XZOA 4PSAA 4NPHA 4LHYA 5JCPA 1LF5A 3BJIC 1UFQA 2F43A 3R9WA 2IYRA 3U2QA 3LQRA 2ZU6A 5L3RA 5LBIA 2JGNA 4LSGA 4LRWA 1LNZA 3QENA 4M2LA 1NVXQ 2GCNA 1OHHD 1GWNA 4A8JC 1KY2A 3BH0A 2XSZD 2QAGB 3CPHA 1KO5A 1D2MA 1G7RA 3RHFA 4YMUA 3ETLA 1ZC3A 4B32A 4JL5A 3AVUA 2J46A 2ZVPX 1SVWA 1P61B 1H42A 4M53A 2EYQA 4QHTA 5KDDA 4BFVA 3QFCA 1XEXA 2GXQA 2OBNA 3AH8A 3KFVA 5FTLA 2ZETA 2BPOA 4HATA 1OGJA 4GOXA 2VP2A 2PZGA 3B78A 4EPVA 4JT4A 3EPKA 1EWYA 2IYSA 4XTRA 4MUBA 4G1BA 1BOFA 4HYYA 4B47A 4LJ7A 4DDUA 3HP1A 5F9HA 1ESMA 2IF0A 1SKYB 1G4AE 2RC5A 2AFIE 2J0SA 3VO1A 2F6RA 2OG2A 3VKGA 4QHYA 5L3QA 2IWHA 2J0UA 4GBMA 4BRWA 3NH9A 1DELA 4OK5A 1FUUA 1M7BA 5K8UA 1N0UA 1P2TA 3HPRA 2WZQA 4JLBA 4Q9JA 3KKNA 3LA6A 1F48A 5KTYA 2QP9X 2O5VA 4Q4JA 1Z28A 4Y0VA 1N5IA 5EZ5A 1G7CA 3ND8A 4GFDA 3TW4A 4DLRA 4DSUA 1XD9A 3SEAA 4FD2A 2MMGA 1F5NA 2R2AA 3B2EA 1XTRA 2CHGA 2O8CB 2C78A 3K0AB 3AF2A 1MO5A 1YE8A 4PZYA 5FBRB 2QGZA 5KSOA 1U8ZA 2O8EB 4QGAA 3NBFA 3RC8A 4M4SA 3LFUA 721PA 1WRBA 2W6IA 5LDDC 3GLFB 3U7HB 3QKTA 1DO0A 1NBMD 1ODFA 1P4SA 2HXSA 1OKKA 1CR4A 2WPDD 3AV0B 1N0WA 3B9PA 3K53A 3PEUA 4IRUB 4A6PA 4YXWD 1YR9A 4ZDWA 1HTWA 1MV5A 2AD1A 2QQEA 4DT1B 6Q21A 1D9ZA 4Q1DA 1XEWY 1G3IA 3MJHA 2GAAA 3F8TA 3RLFA 4CT4B 2R6HA 3SJAA 1AMOA 1BQEA 2BWJA 1NY5A 4JVNA 5IDVA 3WYAA 1HURA 2PEZA 3WYFA 1GSIA 4LYHA 5H8WA 2WVJA 1J7KA 2CLSA 3FB4A 3KFXA 4L9SA 4P6VF 2FSHA 3CM0A 1UBCA 1T4GA 4Q66C 4PSKA 5HE8A 3IIMA 3RRYA 3VX3A 3U4QB 4KSBA 1VQ4B 3OIUA 3QVUA 3CX7A 3CCSB 4AURA 3K0AA 3HU3A 3OEHA 4KBFA 3DM5A 1TQ4A 1U98A 3ZC3A 1AA9A 1E9DA 2EFEB 3B82A 4FW9A 1CEEA 2WOJA 1QVGB 1QG4A 1FRNA 2ZI6A 1OFHA 4QBFA 4MDEA 4ZCLA 4BFTA 1VMAA 4V0KA 1JNYA 5EE9A 2YWHA 3QNUA 1MR3F 2OCBA 4BEBA 1KDOA 1WDTA 4Z54A 3CCQB 3NWJA 5KPJA 2JCSA 3RS0A 5KDLA 3C41J 3QOFA 1X86B 4JZKA 2GZHA 3IIJA 3TSWA 4OQXA 5JHHB 3OFND 1DAGA 5EE1A 2PIAA 4P33A 1N6HA 4JLPA 1YZQA 1Z3IX 3GLHE 2O8BB 5L3SA 3A1UA 1ZNYA 2RCNA 1AIPA 2HV8A 5GJWC 1VKJA 2QAJA 4A9AA 3ZIAD 4QKQA 2OE2A 1W2HA 5AN9A 4ZPXA 1II8B 3A6PC 1XMSA 4NH0A 3PITA 3IILA 3V4FA 1M1YE 4AYXA 2IYLD 3AVOA 5L8VA 1KY3A 2XOKD 5SZJA 2H92A 4IEEA 4IDHA 4WXPA 1UEIA 1TF7A 5EJEA 4TN1A 2WKPA 5BQ5A 1QHNA 1FP7A 2YINC 4FINA 1AM4D 3SC3A 3TLXA 4BECA 1S9DA 1EXMA 2ZRKA 5IF9A 1Z0IA 4XSGA 2AFHE 4AYWA 1YHQB 4TL7A 2ONJA 4N0DA 3GEEA 2X2FA 1NIPA 1P2SA 2A2ZA 1E99A 4XJXA 3F5FA 3AGQA 3SN6A 4C30A 2PCJA 3IEVA 3IKJA 1Z0JA 3T5GA 1HV8A 1SKYE 4HI0E 4AYTA 4PTLA 1YJWB 2ZSBA 3QI2A 1E2MA 5HCIA 3ZZ0A 1E98A 1L8QA 2LKDA 3K9LA 4KAXA 1XEFA 3AVQA 2WAYA 3W6PA 3L82B 2FV8A 2CBZA 1F60A 3K9NA 4TZ6A 1IN5A 2VSFA 1X8KA 1Z29A 5CJPA 3DZDA 3JQRA 3VKWA 2BMWA 4E09A 1QDEA 2EFGA 2ZRPA 2NO1A 3SI7A 3CRRA 4ARZB 1DEKA 1WF3A 4EFNA 2V1UA 4YLGA 821PA 1QUEA 4JL6A 2J87A 3FVQA 3V00A 1G7SA 1OB5A 1OXVA 1FNMA 4PXAA 3R9IA 2G3YA 4DSTA 1G5TA 1NKSA 1RJ9A 1MOZA 3ZD7A 1W87A 2H8KA 2OM2A 1R6BX 1M7HA 4R7ZA 3CR7A 2WJGA 3GLFE 1QHSA 3SBEA 1HQYE 5E7JA 1VQOB 5AJWA 3N2IA 1JB1A 4NHOA 1KD1D 1XX6A 3B60A 3EARA 3EC2A 4MKGA 1N6LA 1L4YA 2PMDA 3LBIA 5TR9A 2ZAOA 4HB2A 3K1JA 1YZNA 1ZC4A 1K6MA 1IB0A 3TR5A 3EA5A 3TUIC 2KWIA 3U6BA 4XWAA 4BFSA 3I5XA 2GJAA 3TUJC 3CRMA 2ZE5A 1Q81D 4QG7A 1OFIA 1D8TA 2YOGA 5CK4A 5HZKA 5ELXA 1XZQA 3KQKA 1E2PA 3CRVA 1TAGA 2CLDX 1A2KC 2EYUA 3AVVA 2K5UA 4DEXA 2AXPA 2AX4A 1MABA
chains in the Genus database with same CATH superfamily
3RC2A 1ID8A 3KQTA 3PLRA 1NW5A 2QTZA 4JJKA 4EGQA 4IIHA 3C6KA 3EW9A 3LNCA 2DFLA 5EPOA 4JBNA 3G82C 5BR7A 3NR2A 4XWKA 3UMGA 4LI3X 3A6HA 3HJFA 2PXAA 4UPEA 1V7QA 2R2GA 1XQBA 3PEYA 4F4CA 1IEWA 1AZSC 5L45A 2Q8PA 4WEOA 1SURA 2B9EA 4GPZA 4U7PB 3DMFA 2X3UA 1KJWA 5HFNA 4JL8A 3T61A 4F9GA 1U0BB 1TLFA 4QSHA 1E2NA 4KZKA 1N1DA 3G2HA 1RC0A 3RUIA 1E1DA 1KMCA 1OV6A 3GARA 3Q1KA 3R0QA 4MR7A 2BM1A 3P2JA 1NM5A 1S02A 4EF5A 2I4NA 2RGDA 1K7EB 4PPYA 1QCYA 3ONFA 4Y2UA 1ORWA 3G6KA 1TEVA 3R4VA 4KUGA 1IUOA 2VHWA 4H7PA 1WSBA 1YKGA 4ND4A 3CR8A 3UK1A 4M9SA 4IQGA 2B0JA 4UOZA 3RYFA 4G26A 2LCQA 2QRVB 3S8MA 5LA6A 4YLYA 1L4NA 2X41A 2NSLA 3R5SA 1YB5A 1JAHA 3P9IA 2VNKA 3ZPNA 3JQEA 5AUPB 4BFUA 5REQB 2H65A 5D3MA 2P1ZA 3L4JA 4QQNA 4D56A 1PKEA 2AI2A 1NG1A 2R6AA 3DVLA 3JCZA 3LCJA 5BRNA 3T35A 3THRA 4C0QC 3HG7A 1KARA 1CZHA 3CS3A 4Y2HA 3GJXC 3N2YA 1T36B 3C4JA 4J0EA 1LDMA 5FLYA 3HP4A 5FNZA 3KX2A 4Z4SA 5CVUA 4MV8A 4Z4IA 3L9WA 4J1QA 4OMUA 4EUKA 1PZXA 3D7MA 3VSEA 1F8GA 3CC7B 3QUTA 4JQYA 5C5IA 4JB2A 4ZYLA 3Q2IA 1NDHA 3O8QA 3FKSA 2R8OA 2ZR8A 3DDSA 1ZOLA 7REQA 1QFSA 4OPVA 5UKDA 3A1WA 4UJ3A 3NOQA 4QSMA 3R7DA 3CF2A 1K3FA 1LW7A 2E18A 5FBKA 1ZICA 4NHEA 1EFTA 5TSDA 2RJOA 3IRVA 2H1IA 1AVTA 1OPRA 1ZWKA 3BE8A 1ZI9A 1TMKA 3ECCA 1T2VA 2IIVA 4LRQA 4GKKB 4GPTA 4DPLA 1ONNA 2CUZA 3AY0A 3EFEA 4Y1FA 5CDFE 3OLXA 4WN3A 1ZVJA 1EHYA 4DCSA 2J5QA 1EESA 2LDXA 3CUYA 5JO0A 1MEEA 2YJ5A 3ORFA 4EM6A 3AGPA 2VP0A 5IG2A 3F5QA 5EJ2A 1W5AA 4YUWA 1OQAA 1I13A 4OIMA 4PQGA 1F17A 4QPZA 3I8XA 4CFSA 5AVKA 1KTVA 3CRW1 4QJIA 1RWPA 1BG6A 5HS6A 3MSXA 1SO8A 1Q92A 1TI7A 2D5AA 5HDQA 1PSDA 1VGQA 2XDQB 2W6ID 5IH7A 1MX3A 1TEHA 1ZESA 2FPSA 3BRSA 4JT9A 2GUGA 3R5XA 4LYAA 5I9SA 4OJNA 2NQ2C 2ZJFA 1ZUIA 4N3CA 1QP7A 5ALEA 3OTIA 5JJLA 3WLJA 4YJHB 1QIDA 4EMUA 4ERNA 1WVMA 2GXSA 5HRAA 2C42A 1K8RA 2XSZA 3ICCA 4TTJA 3B9RA 4L07A 1P7CA 1ZIPA 4P08A 4FIDA 4O4LF 2UYHA 1DCTA 2HJWA 2GBPA 2NYAA 3K3PA 5KCZA 2VEDA 3LHKA 5D1NA 2CNWD 1JKJA 2HU2A 3AV3A 4HADA 4LK2A 4D43A 4MV1A 5NULA 1DMSA 3K73O 3TLCA 1L7AA 4I9HA 2HMYB 3DL0A 4M0UA 5SZKB 4WLVA 3WNCA 3THOA 3MWFA 3ZEIA 2JFFA 4GMFA 3FHTA 1VSUA 1UEJA 4Z2AA 5LXTF 1OPXA 3OEHD 3LBHA 3GGPA 4TLDA 2JJMA 4TXJA 2Y77A 4W8HA 1GR1A 2ILTA 1ECJA 1PWXA 1KFCB 4NYJR 4BDSA 4RKFA 2GRAA 3DQQA 4Y1EA 4NLLA 5LJLA 2R4UA 2GN4A 2HWXA 3TLEA 1HKHA 4NNPA 5A4FS 3CXUA 3WADA 1VQ7B 1KI6A 3R44A 1JYEA 5F4ZA 3TMYA 3WLMA 1E63A 3D4OA 3DDZX 3GA5A 3I39X 3OQIA 4G0QA 2WU1A 4QBHA 4IR7A 4UD2A 1GUAA 5D87A 5TPWB 1KQPA 5ADUS 3R5KA 2G09A 3H9QA 2D5BA 4G4SP 4ZOLF 5G0VA 2ZRLA 3B1WA 1U1IA 5BV2P 1N8RD 5ALPA 4G41A 4OA5A 3TRHA 5E6RA 3V1LA 2JD1A 1AJEA 1M0SA 2DHRA 2QM7A 1S1CA 2JA1A 2QRMA 4ROXA 4MWBA 3O8BA 1WWKA 2DPMA 3B38A 1HT1E 1EZ4A 3GIRA 3DA8A 1U4NA 3DWFA 3SXJA 3BJEA 1T4CB 3U62A 1N6PA 3DBHB 4HBZA 4DM7A 4J43A 4TYMA 3VUFA 2D2FA 3S0JA 2IYOA 3SC6A 4AJ4A 4KQHA 4FFVA 1DXOA 1V1MA 2EV9A 4LXHA 2FWMX 2YUTA 3AB3A 2BKVA 4QAJA 2F90A 3N8HA 2PVSA 2WB4A 3OZ7A 1KR5A 5ELMA 1U7ZA 1XCMA 2W11A 5AD1A 1VLJA 3PPXA 1D6JA 3V4LA 4DR5B 5D7NA 3PKIA 3T7AA 4DDKA 3PLNA 2UVDA 4HQFA 5B30A 2CYAA 1KK2A 4XIGS 1A9OA 1EXDA 3HAGA 1R8XA 4YMVA 2H3EA 2QMYA 1HZZC 2Y05A 1WY7A 2H4JA 1FVFA 3F0TA 3UC5A 4DDVA 3VGJA 3VBEA 1K6JA 2JVKA 2IX9A 1I7LA 3M5DA 4P1VA 1P0QA 1ZOPA 4KXQA 3EQ8A 4LNUA 5E1BA 4ABYA 2O0KA 1XDGA 1YJ9B 2FWAA 2NTVA 4JGBA 4MKHA 1RVDA 3VC3A 1DCMA 1YZVA 1U2GA 1ZI8A 3BWEA 4MKIA 2MWMA 2YYSA 1XJ5A 1Z2CA 4RSGA 4DV3B 3IXQA 3TTXA 1X1QA 2O52A 3KB8A 5DX8A 4R1TA 4HDSB 3WLRA 5ICMA 3PSAA 2O2JA 3A9RA 1RCFA 1CIPA 1TT5A 2GEFA 4H16A 3IT1A 4OA8A 1O89A 1JKIA 4YMWA 3SJZA 4ES6A 2AF4C 3ABZA 1W8IA 4UBJA 3ERCA 2QLBA 1E3DA 4XVHA 5HIMA 1GD1O 4CGYA 2HPAA 1YQWA 2O7QA 4J1SA 3GDHA 3F3YA 2YJGA 1Q19A 3HS3A 3CNOA 5GV7A 3PNMA 3R40A 1JA9A 3QSYA 2I80A 5HKKD 5JS8A 4R83A 2RHTA 1R8QA 4R2HA 2BEWA 3H1GA 3A4TA 1JA0A 2F3PA 3DBVO 3LX6A 4UM9D 1JHMA 4BNHA 2PUJA 3H5IA 4WZBE 5DXAA 2Z5LA 1USIA 5CJJA 1JJVA 2AG6A 3GWZA 3IIKA 3U3RA 3R7WB 2QM8A 3FYUB 3GEGA 3IVRA 3D0QA 1FU8A 1P62B 2PWZA 3LQ4A 4BQSA 1L4FA 4RZ3A 5TQ0B 1O9HA 3LPNA 5E8RA 3CP8A 1L5KA 3ZCRA 3EDYA 5BW4A 4M60A 3SXUB 2WJ6A 3HV2A 1U3VA 4PAQA 3QVMA 5JISA 4ZVSA 4WXMA 1DRKA 5DNAA 4ZOEA 1BE0A 3E9CA 4NAUA 4WKBA 3UMMA 3H94A 4AJHA 1Q9SA 1FTYA 4UDNA 2Z1DA 1SCAA 2VDNB 1PQYA 1AGXA 2VHCA 4ALLA 1NWCA 1UZNA 5A2GA 4KPYA 1DKUA 4PW0A 1I5RA 1IM2A 1MZVA 1F2TB 3FZEA 3KHSA 1PYOA 5FOUA 1J09A 1EWKA 4ZU6X 2XJ9A 3PQ3A 3QKRB 4RFVA 1U9YA 2IYQA 2GD1O 3QV2A 3H9JA 2PQ6A 1XZBA 3ZPXA 3KSBC 5KMGB 4HT3B 2Y1LA 3AJ8A 4C7KA 3EB9A 5JAOA 1YB6A 1HL7A 4AUNA 2DOKA 4KWIA 4U7JA 3U16A 1P7WA 1EVEA 1IXKA 3PQ7A 4UREA 5BRAA 2C2KA 4YAWA 4ZYYA 3STUA 1VM6A 4WKNA 4B3TB 5K3OA 5AJYA 3F1KA 4EX6A 3P20A 1MW9X 1G8JA 3KB2A 4ZFNA 4X3OA 4NE7A 3OW2B 2X13A 5FCDA 4L5CA 2O5CA 1RFLA 1RW4A 3L49A 3ETDA 2COUA 2GN9A 3DF7A 4NJMA 4BVBA 1IAQA 4EYSA 1NZFA 2FPRA 4V38A 1IBMB 5BXQC 3GJRA 2NO9A 3NASA 1T5LA 6GPBA 3DBOB 3LWNA 4W1RA 4A23A 4IKPA 5TQJA 4RTOA 1OV4A 2AYYA 2UV8A 4UFNA 1FE8A 2CL5A 4MUIA 4KOEC 3C6ZA 3ZDZB 4CTKA 5HMLA 3O5AA 4UMEA 4CQLB 2NUTB 4OXXA 5AI6A 1NT2A 4XGKA 1EZ1A 4B2LA 3P96A 4F5YA 3G17A 1DE0A 4QUJA 3SSAA 1ONSA 5EERA 3F7NA 2KW5A 5JWRA 5J2TB 1PZHA 2C3MA 3BA1A 2GBGA 3DCIA 4GKBA 2BZ0A 2EWWA 2HT6A 1MGOA 3P0IA 4HQOA 3UEOA 5K6AA 1L5HB 3RKSA 4G5YA 4C3UA 1JFFA 1LPBB 3BWMA 4YGXB 1R5JA 3BFVA 5EKTA 3CN7A 4AN1A 2D7CA 2RHRA 3A28A 3BCRA 4IIYA 3RIMA 3H2IA 3UA3A 5ALIA 2V59A 3TK1A 3H6GA 1RIIA 1K8YB 2RI6A 3Q72A 3BQMB 4MW5A 3IAS1 1SOMA 2OCYC 3MCAA 1UDBA 3EF3A 4RNDB 1JKXA 2YW2A 2OLKA 3FKSD 4NYJQ 3N6RA 2MYTA 2Y93A 1BVRA 3KS9A 3QEBZ 2I4TA 3DEFA 1BE8A 3NATA 1HG1A 2IUUA 1QO7A 3O74A 3CVXA 4X9XA 3SQMA 2C2ZA 2F3RA 1LDEA 4XUEA 4GDFA 3P9XA 2TMKA 3D7SA 4FFPA 4MGHA 1LNSA 1RWOA 3CEPB 4H15A 4MHSA 5CCEA 1KQ3A 1UK6A 3E8SA 1A8IA 5A5FA 2IEIA 1KYXA 2AR0A 2X40A 2YCBA 2QL9A 3A3OA 3BHJA 4P2NA 3N9IA 2J3QA 1VMKA 1WXFA 3I23A 4Y2XA 3PFHA 2HAEA 2OCPA 3Q3EA 2QBYB 4MH0R 1IRXA 5CH3A 1K9MD 2K6GA 1GG2A 2Z98A 1N8NA 1EX7A 3QU9A 2OB1A 1J2YA 5B6JA 4HDRA 4ZVTA 5IU6A 4E5KA 1SCDA 2X6QA 1UD3A 1ND6A 4IILA 3F98A 4MUFA 4YIKA 3UANA 3VI3B 1ZXLA 2F1HA 3F9IA 2Q6TA 3AHHA 3VR4D 1WU8A 2BI7A 1JMVA 4P4GA 3PUJA 2C4VA 4ZCSA 2AEJA 4P0PB 2UXCB 1XIVA 1XCPA 4WMLA 3V8MA 3GLHB 3KQHA 2VHUA 3FPEA 2VUSA 3DFZA 4LOIA 1DJPA 2ZUBA 3Q6RA 3CLTD 3X1YA 1AKMA 4XPZA 1Q21A 3GLGE 5HR5A 3L4KA 1P1FA 2OHHA 2VZLA 3BH7A 3DDUA 1QC5A 1P4AA 1CB7A 3KR1A 4GX0A 4PO1A 4XCXA 5DRYA 2D5CA 2IDZA 4M9UA 1FYXA 5KNDA 1LU9A 2ZI3A 1UPAA 2E0IA 4GLJA 3S4YA 2O20A 3BGIA 2GNPA 2GPSA 3PFKA 4YDRA 4N0MA 2H2WA 4MW7A 4U3JA 3JAMA 4LX8A 3Q9LA 2QU8A 5EE0A 2IYUA 2VYFA 1E7SA 2QQ0A 3SVLA 3JPWA 1D0SA 1JSLA 2A9QA 3NBKA 1MHTA 1NONA 1RCTE 3CNBA 2WIGA 5D00A 4KR3A 1TQHA 3LQYA 3WGNA 2R7LA 4Q03A 5CB0A 1U02A 3EVBA 1X1DA 2KQUA 3QJYA 3F73A 3RVLA 4N7JA 1R37A 2DUNA 4Y6PA 2H0RA 4GVLA 1OFUA 3ZU4A 2IPNA 3KP1A 4WZ6A 3DVQX 2IS1A 2HTEA 2R84A 4LHWA 4IOJA 2OK7A 3PJGA 4IIUA 1GNSA 5ESRA 1T3ZA 4OQFA 4TQGA 5D3QA 3T9CA 2WFMA 3DBLA 1LVHA 4XORA 1VKHA 2HDOA 4EHJA 3WYCA 4BQNA 5C52B 3R5HA 4RV5A 2UZ3A 3QJ5A 2RHCA 2VA8A 3VR4H 1GLNA 4NWIA 2WU4A 5C5CA 2R48A 3LXUX 3AK4A 4QUBA 4B8YA 4W5QA 2Z3VA 1ONPA 3ACDA 4WXHA 1Q50A 5IW8A 1RYZA 4WADA 4E32A 2DT8A 1G59A 2W83A 2H07A 1TJYA 2PD3A 3MMNA 3WIUA 1RRGA 1OWNA 1JR3A 3Q0IA 3TD2A 3K8QA 3UW3A 2GH1A 3VNUA 3UO8B 2CLFB 4RZUA 1LSOA 3DMTA 4ZT4A 5JCJA 4CR8A 3IUSA 1L5LA 2GCIA 4MS1B 4OJQA 4CV2A 4IIJA 4P9SA 4RWEA 4Q3EA 1TCBA 4RESA 1WZIA 1QP8A 3PFNA 2HU8A 3Q7TA 3K0CC 4F4DA 1UKYA 2QUIA 5BN5A 4TS4A 3AESB 1GJRA 4PINA 2Q4OA 4XI9A 5EIOA 1OBFO 5DCUA 4I5FA 4XGQA 1Y7HA 2VXYA 1QGOA 3KZOA 4R84A 2R47A 2HA2A 4WGFA 1XWIA 3HYNA 4GGOA 4YRIA 5I51A 5J58A 3FLEA 3L8CA 5GJVC 4B7CA 2J6HA 3AERA 3C7DB 4BLRA 4CL2A 4NZYA 2FE1A 2OXRA 1HNXB 3W5VA 1QGUB 2H2FA 4JGIA 5KVQA 4KJXA 1JQLB 4OFWA 3GJZA 2VBVA 1CIVA 3USCS 5I7HA 4R1NA 4R68A 3PWSA 4B4UA 3F78A 2R66A 2BLNA 2XVMA 3HI4A 3LF2A 3N7AA 3UB4A 5F5NA 1ZGJA 5L6MB 2BEKA 1O96B 2O4CA 2Y2UA 5LOVA 1PUIA 4NBWA 4V0SA 2AI3A 2X58A 4D4JA 5JY1A 4KHPB 5K0JA 4DNXA 1Q0QA 3O4RA 2VRCA 2WHPB 1XFDA 2WWTA 4OVKA 1W9MA 3SFTA 5AVQA 2MMCA 4IXTA 1CUVA 5LB2A 1N2CA 1MX9A 2ATXA 3JQAD 3TXYA 5A4MS 5TJHA 3WTCA 4G0UA 3AUXA 3I9V1 4FJ0A 3I9OA 3EZYA 1EB8A 4L8JA 1HPLA 1L5FA 2QD1A 3FDZA 3GJ4A 3NHLA 4PLPA 5TGTA 5IKPA 2F1LA 4JYZA 2C58A 2H7XA 4QXRA 1IN6A 1FP2A 1XNHA 1MKYA 5E1DA 4OO3A 2JL1A 5TXGA 2Z9CA 4R1PA 1ZO8A 3LT5A 3QKSB 3L4SO 2BGNA 3TS1A 2ISSD 4HX5A 3ZVMA 3QWHA 4GVXA 3IBCA 1TUBB 3OUUA 4I66A 4Q9NA 5LN1A 5MF6A 4PX3A 3C3PA 3EH2A 5ADWA 4HH3C 3MAAC 3UICA 2KB0A 3SKBA 4KR6A 4DCTA 3AY6A 5LLSA 1XMXA 4M36A 4ILKA 5J4HA 1ZNWA 2AE1A 2J8ZA 1LJUA 3FZQA 5HIKA 2AFVA 1JJ7A 1A98A 1JYSA 3BOSA 4AL4A 3BCDA 2VDUE 5CR9A 3QVSA 4E5NA 2O7NA 3R6DA 3ZWXA 4YUAA 7ADHA 4HH4A 3VPBA 3PC8C 4RVCA 3UMBA 1GKKA 3U17A 4PZPA 4KWTA 3M82A 5KNCA 2VSNA 4LF5B 1XALA 2FLKA 1NNSA 4ZHQA 5IWCA 5JRZA 1EFDN 1NI5A 2VTKA 2Q9BA 1F3OA 2HA6A 2B7CA 2FDRA 4PTZA 5INTA 4US2R 1ULUA 1EDDA 2MSCB 4TVKA 3GA7A 2XADA 3N2ZB 1X7XA 3RTAA 1BLIA 5B57C 5CYGA 5FAKA 4POAA 2G70A 3E1KA 4PFJA 3R20A 5C35A 5JVDB 4MKZA 3LG2A 3R6LA 3K35A 2I7TA 3F6PA 1J8VA 2C2GA 5D2CA 4D02A 3EBLA 1K5DA 1UJ2A 4YRDA 3TTYA 3H8WA 5H3HA 5C4IA 5C0OE 5IKOA 1GFWA 3BXZA 4KQIA 4TUYB 2ZSIA 2BH9A 1P2UA 2CJWB 3PIIA 1LZLA 1PAUA 3TEMA 3LI2A 3IHTA 2ZDQA 3OOCA 4MWTA 4UAGA 3PCTA 1JLRA 1QX3A 1KI3A 2VH2A 3OTWA 4IIBA 2OV4A 1XD2B 3EWIA 2O2EA 2OHIA 2YFQA 4ENQA 1RNLA 3GOHA 4W63A 3ASYA 1JB9A 4BJ1A 5TNXA 1RWXA 1OR8A 4Z4YA 3TIGA 3K9BA 2DBYA 1YRYE 3MINA 4OQDA 3BVPA 1WDLA 3LQ2A 2FW0A 1MC8A 3L93A 4MWZA 1K8XB 3H17A 3LVFO 2WA2A 2VSQA 3MMPA 3NFRA 4N8DA 3UB3A 3I8OA 3L7CA 3ICVA 3B2QA 3W5BA 1Z68A 1JT2A 5FOXA 2VDKB 4P5EA 2UDPA 2ZZMA 1NSFA 1RHKA 3GNLA 2FY8A 1O3YA 1KHHA 2F43B 2BMAA 1KDTA 5JMTA 1ZITA 3W5HA 3WGTA 3IOYA 2N46A 3T5CA 2B8NA 4ZEVA 3REGA 1FA9A 2AW5A 4WXEA 1KZLA 1RE0A 2ZITA 4OAQA 1ZMRA 3R7LA 1W6RA 2FHSA 3TX2A 4HUQB 2VJIA 2I1QA 3JVUA 1D4AA 1OU4A 2JIDA 4HXYA 2BMDA 2PSEA 3EHEA 2FZVA 3INTA 3O91A 3MT9A 5JYCA 4YTEA 3AW9A 1O9BA 5E4FA 1FMJA 1WDKA 4GYKA 4M37A 2BUBA 5D51S 2QZZA 1T5OA 2VK8A 3IX7A 5AT1A 5BYBA 3KZMA 3LZDA 1MQSA 4A8PA 1ZXBA 4YI5A 3UXHA 3IULA 2RGWA 2YH2A 2GMWA 1ESCA 4CTJA 3EDCA 4ZN6A 4MW9A 3K6KA 3UCXA 4NBSA 5JJBA 2JAXA 4FR0A 5IPFA 4E07A 1GVNB 1QF9A 2FOLA 3AI7A 3D3QA 3EGIA 3W79A 4BWFB 5BRJA 4IFEA 2J07A 1Q14A 1OAAA 5J4KA 3QITA 1Q16A 5KTOA 2UXBB 4PYJA 2XUHA 2ET6A 5TY0A 2HN9A 2HBRA 4D9FA 4M9CA 4JA0A 2AN9A 3FPGA 4OREX 1OH7A 5HZMA 1Z0DA 2WAXA 3C1OA 3B7WA 3C6MA 3FMIA 4V0MA 3TVDA 3VPSA 3E23A 2XYGA 4DABA 4RK1A 4F4FA 5HWSA 1J24A 3I1YA 2WR8A 1QF7A 4KLCA 3R7WA 5FR2A 3FVWA 5GVSA 2I6UA 5BR8B 3U3JA 4NZPA 4IIXA 1EBBA 3LVRE 2Y0PA 1D3AA 5KNDD 3RNLA 2L19A 4P6YA 1VQLB 4K87A 3NWOA 3H16A 3GRKA 1TX4B 3AO0B 4YRSA 4IMRA 3H4TA 1D2EA 4I6GA 4UZEA 1ZK3A 4BXOB 2PS9A 1FPQA 3NDPA 1ISHA 1JHZA 1P9NA 3H5LA 2PUTA 4RENA 3G8CA 3GPBA 2HDHA 2YVUA 1NRJB 1OI4A 2SBTA 1X15A 2VDLB 4YDQA 5HZHA 4KIJA 1JPVA 2QMUA 1ODCA 3H2HA 1WOOA 2W6CX 3JRNA 4QGGA 3S5JA 2FZKA 4X6YA 4CJXA 4LTNA 1DIOB 4EJ2A 3GFTA 4DIOA 2R6GA 2YJTD 3KQVA 1XPOA 1XP5A 5TV2A 4N54A 5C1OA 5BNTA 2A5DA 2XQVA 4EZEA 1VHDA 4NC9A 3HU1A 2VDRB 2CT8A 1KERA 3CU5A 3CEAA 2PXXA 3RU9A 1SPXA 3GRUA 2W43A 4JFAA 5IVHA 4I2NA 3K4PA 3KXPA 5CNMA 4LCJA 3T5MA 4TT3A 5L95A 3ZWPA 3CX8A 2O2XA 1POWA 3OPNA 4PFQA 3T5TA 2JIBA 3KFLA 5CT8A 2R8YA 1EDBA 1GGFA 4QDOA 4G0OA 4DCMA 3DS8A 3ET4A 2JRCA 2GM3A 5C9ZA 3PWZA 3FGNA 4HQ0A 3NXKA 3TXXA 5IZCA 3CG0A 3ORYA 5H02A 4U8HA 3P1JA 2WINI 5DHTA 1OXBB 1JFLA 2DUUA 3HSKA 1WE2A 2BVNA 4CQJA 1CQWA 2QV7A 2ZBRA 4MEJA 4N3BA 4EYKA 4CFZA 2A4KA 2FG5A 2V74B 5KYTA 2IGTA 1JR3D 4RKRA 1V5IA 2X0NA 3WYBA 4CTNA 1LC0A 1J49A 1OVGA 5LA6F 5TF0A 4ZDJA 4I1OA 4JAVC 4C01A 4NV0A 4N5MA 5JCJD 5KNDH 10MHA 2X5OA 2K87A 4B7UA 2JLXA 3GLSA 3PCRB 3T9BA 3RC9A 3H83A 4A03A 2F1JA 4LF4B 3NYWA 4PGOA 1GPWB 1N8KA 1P5ZB 3OZTA 4WEQA 2ZYDA 3SZLA 2A67A 1E1QA 4R3WA 5AO9A 3ZE1B 2GB4A 4DVJA 1UXOA 3HVRA 3EPJA 3OT1A 4DCCA 1G8PA 1XE1A 1XZCA 5ADVA 2FP3A 3EQ9A 5EMKA 2DT5A 1E5TA 3M1YA 1X9IA 2QENA 2FXVA 3ANNA 5DM1A 1M72A 3BJRA 4O63O 2DIEA 1QNLA 1UOEA 2Y1FA 1X6VA 3DWGA 3FNHA 3OZCA 4L5AA 3WLPA 5DHAA 1ZGAA 3I9FA 1NOJA 5B1EA 5AVVA 1A2BA 3G1TA 5I9BA 1ST2A 1RQNA 1AGYA 3FMGA 2ZSUA 2NUAB 4TWJA 4OFZA 4QOHA 1B23P 1NFFA 1M6NA 1Q7RA 3HZRA 2I66A 4BGDA 3KZCA 2OCXA 3WICA 1JG3A 3ROTA 2D1FA 4OLJA 1LEHA 3GUHA 4P93A 3UMYA 2JGJA 9GPBA 3WQQA 4ML3A 3FX2A 4LGMA 1E5DA 4NFLA 2Q3HA 1DAEA 3BAZA 4YJ3F 3GR6A 4BAUA 1SC6A 4HWRA 1TUIA 4CKXA 1C29B 1V71A 2BFOA 2FPUA 3K09C 4JMLA 4QJ3A 4HLUA 3WWEA 2QMHA 2BHRA 4MI3A 5CEFA 1U28A 1KP2A 1XMQB 1P6UA 1W2WB 2QN3A 4Y9RA 3HDHA 3PHHA 4OSOA 4YDSA 5A04A 2P3LA 2OP0A 3PXBA 2QN1A 1BVYF 5JSZA 3CW9A 1NNUA 3DD1A 2PMCA 4E31A 3RYIA 4QFMA 1CYEA 1IY2A 1U3UA 2ORYA 3OIVA 4N4AA 4Q4LA 5FUVA 4BLUA 1X70A 2R7MA 3D2LA 2AOUB 1CC1S 3O2JA 3MD0A 5KKNB 4K03A 4Y8VA 2Y6UA 4ZK2A 3E6AA 1GNRA 1J0EA 4ZKEA 1GGKA 3HHEA 4B3CA 1URPA 4QJBA 1PVOA 4NMXB 4NOMA 1KPHA 4PO3X 1V6CA 2FU5C 1JDJA 3TEFA 5C1PA 1KAHA 5A89A 2PGIA 1BYUA 1SVSA 1Z17A 2P5SA 1ZZEA 2Y1WA 1QYWA 3ZDCA 5F4OA 5DX1A 2J31A 5G3ZA 3QEMB 3ASSA 3WLOA 3CCBA 5LQSA 1E4VA 1DT5A 2UKDA 3JVEA 1RZUA 3KXKA 2EDAA 1W9XA 3T3EA 3R0ZA 4RSRA 4CDGA 4TKLA 1IBLB 1X7ZA 2R1ZA 4MLCA 5KNCD 2XTZA 4XM2A 1ZU5A 1FNBA 3K32A 1VPEA 3FBGA 2XCOA 3OQJA 3EDOA 3PQEA 5FOSA 3K1AB 3QVWA 2YNMA 1Z2EA 2NADA 1TL7C 2IV2X 4D3SA 4Z4CA 1B6TA 1H0SA 3DE5X 4PR0A 1N5KA 2QAGA 4NDAA 1X80B 2JATA 3FHLA 4DMHA 3QOWA 3QBTA 1RLIA 3PNQA 4WK4B 3IP7A 1G18A 1UQUA 3PR3A 5CITA 5JS7A 1GXSB 2O14A 2P9GA 2WILA 4INAA 4V2UA 4C4OA 4BBPA 1MOQA 1OILA 3WMGA 1IHOA 4BQIA 1IQUA 1GYRA 2EBUA 3PI6A 4BNTA 1MJGA 4Z1OA 5HBRA 2NXCA 3AJ9A 1X7DA 5ICGA 2UUOA 2ZJYA 4MJ3A 1GGHA 4DSNA 5DLEA 4C0SA 2X8JB 3LZCA 1SVOA 3F6BX 4N0QA 2AJDA 1NR7A 4MVXA 4C4TA 3HUTA 2D3WA 3O8DA 4X00A 3SSMA 1OTHA 1SELA 1TUGA 3PF8A 2AN3A 4INJA 2B5OA 3U9TA 1LVGA 3EVDA 2EQAA 1IONA 2ZYGA 3GQBB 4LQ4A 4ZEXA 4EJ6A 2DGDA 3NHRA 3VZBA 4R5HA 2LUOA 2J7KA 5GTDA 2BH2A 1FJXA 5BN4B 2XQGA 5GGXA 5B7QA 2DM6A 2N0SA 3DQZA 1EEXB 4AUMA 3MAGA 2DAPA 3HCWA 2KLBA 1GNLA 4V0RA 1MABB 1CLEA 1OLOA 1BCSB 3IJRA 3WWZA 4OLAA 2H4HA 4L75A 4LBYA 2I8LA 1W1UA 2RKBA 1EFAA 1FVXA 1QQ5A 2YZNA 3OFSA 1U31A 5DM2A 4DF3A 5JZ9A 1XLUA 1UXJA 4NU8X 3BGOS 4X1YA 4AD8A 3KT8A 4YO7A 4V0QA 3SQNA 3M1AA 3F49S 3NKVA 1IN8A 4CQMA 1KVQA 4JEUA 1AMNA 2I9KA 4Q00A 1EIWA 5KNCH 2WWVD 4ZAWA 4R71A 1JTFA 3LHFA 2HJRA 4DNOA 3T5DA 4GICA 1L9KA 4TV9A 2ADOA 3SDBA 3VJKA 4H1TA 4PG5A 3BEOA 3INYA 3CLUD 4QT4A 2PUDA 4OI2A 1X7HA 3DTVB 1ACLA 4I3GA 2GPAA 3OY2A 4E5PA 3H3FA 4S0XA 3TYXA 3I2IA 3H4IA 1Y5NA 2YDXA 5EVCA 2QQGA 2B6HA 2HA3A 2HCTA 3OIYA 3GLFA 3KTAA 4PYIA 3B6KA 1CS0A 1E69A 5JIBA 1RHMA 4NMWA 2ZUDA 3BMQA 1R0XA 5ECYA 2HSEA 3ADBA 3L6UA 3PTAA 4XL9A 1LTQA 1T5TA 4G86A 4RJLA 3WMXA 4WKPA 4D96A 4C0BA 4N65A 2GERA 4KKXB 1FYDA 5F5XA 4S2EA 2DUWA 3WO0A 2OB2A 1T9AA 1YTLA 2PZFA 4C0JA 4HNAB 5EUQB 1CUEA 4OP2A 2JN9A 4Z4FA 1E6LA 2ISQA 3JSXA 2QPAA 3DLAA 2V4UA 5SYNA 3LY8A 3KC2A 1R3DA 4BMSA 3MOGA 2RGGA 5BSFA 1XHLA 1WDWB 1WIWA 3L46A 4G63A 2HA0A 5BT9A 1JX6A 5FDFA 1MLDA 3TIFA 1NC1A 2RAUA 2WMNB 5I01A 1M0EA 5LBUA 1V1JA 4O4LB 3FW1A 2BP7A 4FFBB 1ZG3A 1W46A 4RF4A 4F4HA 2UUAB 4AX8A 1BEZA 2ZPAA 2QG4A 2WJZB 3UQYS 3AYXB 4R5MA 5KEIA 3C74A 1ODSA 2BZGA 1OWOA 4J3FA 2HSZA 1S2OA 3G79A 4D82A 2P9ZA 4IV0A 1PSZA 2HMTA 3NBXX 4NMHA 2ZYUX 4KVFA 2PANA 4XOPA 4YVFA 5LXTB 3QI7A 4PO8A 4K9OA 4DIEA 4DC0A 1NRIA 3ZD9A 2OXFA 5IS2A 1DKQA 3C3XA 3IUMA 1USWA 3GLQA 2IA5A 3PC6A 3UFBA 3HRIA 4D9KA 5HHTA 4QC2A 2COEA 3DW3X 1VYUA 3WHKA 5IN5A 1JYFA 4ETWA 1BC5A 2V6JA 3EWAA 3FCSB 1C4OA 4K28A 1KH3A 4FGWA 3GJ0A 3ESAA 3W6UA 1EWRA 2CKMA 2EIHA 2VJAA 2EJWA 3ORRA 1E1LA 1HL3A 4UFPA 3LH5A 3QP9A 1GM5A 5P8WA 4RPLA 1IIBA 1V16A 3ELUA 1US8B 2MOKA 1T2NA 2ZJBA 4IYRA 4Q19A 2EL7A 4RVUA 1MQ9A 4MS3B 3WFIA 1UPFA 3W5IA 5LMCA 1XRLA 1TJPB 1CHNA 5EUCA 1B4DA 1EGMB 2INGX 2QX7A 3FYCA 3TCKA 4RXUA 1REQA 4FEAA 3WDLA 4B43A 4F9FA 1NWHA 5AI0A 1JDBB 4ZWNA 3L6OO 1BKDR 3PUKA 1M1XB 3Q6NA 4ZAZA 3VR1A 4Y9SA 3VU1A 1HNNA 3H8JA 3FRHA 3R8FA 1Z34A 4C29A 4B0PA 4Q3OA 3CYFA 4WAUA 1ZJYA 1E3IA 2YZGA 3TOXA 4A73A 3U3MA 1E0DA 4UVHA 1TEXA 1PV4A 1Z88A 3RSOA 2DY1A 3F6SA 1NPYA 1VXOA 1JMKC 1J4AA 4UAJA 1YS7A 2E21A 1LX6A 1FQKA 3KSRA 3LP5A 5J5VA 4CIBA 1Y9ZA 4TLBA 2RBGA 4EPWA 3OPQA 5BMVF 5CDFA 3ZJUA 3RIYA 4F72A 1NVTA 1YQXA 3A4NA 2XKBA 1SD2A 3BMCB 5DZSA 4NBVA 5GAJA 2NV2B 5ICFA 8OHMA 3IVAA 3SY8A 2FSVC 4LC1A 3M5CA 5PGMA 4L4RA 1N2HA 4OX9B 3FOZA 1KTIA 3QKWA 3BIWA 5D84A 1PFKA 3B3AA 4A0RA 4H6WA 2FSPA 2X0JA