4RD4A

Structure of aif2 gamma from sulfolobus solfataricus bound to gdpnp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
413
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 413
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd4A01
1FX0A 2OT3B 3EPJA 4LJ7A 4JSYA 4LRWA 2OFXA 1H8HA 4EJSB 3HDTA 2RC5A 1R0WA 1R5OA 1U0LA 2WICA 1UF9A 3L8YA 1E0JA 3QXJA 4Q9JA 4A2WA 3QF4A 5DNYB 1MOZA 1IN4A 5CLLA 3R7WB 4WXRA 4FN5A 2JDID 2YVUA 3AF4A 1S72B 5TVKA 2IYWA 3DPUA 1S8FA 3F8TA 5KSPA 1IBRA 4XH9B 1F48A 2PZFA 2WSMA 2YC4C 4HAXA 5J4LA 3VR1A 1F2TA 2YC2C 3GFTA 2H7VA 5H70A 2ZTSA 4G01B 4LK2A 4M9ZA 2ZI7A 2ZSDA 5CYOA 1GKUB 3UMFA 3P4YA 2ZROA 1GDDA 4MKHA 5DGXA 4JVMA 4FI3C 3C8UA 2EWWA 5EE5B 2QENA 2XEXA 3EAQA 4L5BA 3T1OA 2GWHA 3SHWA 1W2GA 1YE8A 2YOFA 4C2TA 1HTWA 5KPDA 1OJLA 3RRMA 3VKHA 4C0KA 5JI3E 1IXRC 3LD9A 3CKLA 3DM9B 1KY2A 4OQFA 2IWRA 3H86A 1IJEA 5FUWA 3R8CA 2OLJA 5JLJA 4AKHA 3I61A 1X1SA 5L3QB 4BZXA 3AH8A 2O8BA 4UNSA 3SN6A 3D31A 3CX7A 1HT1E 3UWKA 4XJXA 4I4LA 3CXCB 5KNBA 1JQJC 1GTVA 4BLRA 1II8B 3THWB 2F6RA 4XWOA 3QFSA 3SC3A 1D2MA 1W49A 2XSZA 2REBA 3NBFA 4V0ME 3T12A 1X8LA 2GILA 3FFBA 2B92A 2H16A 3THXA 3X1XA 4U9UA 1RRPA 1JI0A 4P4SA 2W6JA 3QBVA 4DLSA 1Z63A 4D4KA 2GVDC 2NO0A 6Q21A 4M0LA 1E79A 2R6AA 4O3MA 2HXYA 3IKJA 4B43A 2GXUA 5DLQC 4RKEA 1E32A 3JZAA 1N0WA 3PQCA 1NLYA 2XITA 1U8AA 5BYKA 2ZRGA 3GJ6A 5CITA 2WWIA 2IS2A 1SQ5A 2I3BA 3IIKA 1YJNB 2R9VA 2B5OA 2OFOA 2C2HA 4PZZA 4NBSA 4DVGA 2NZ8A 2CLCX 2BGIA 2FGKA 1UJ2A 2ZITA 3FYHA 3LLUA 5SZIA 5LD2C 1XX6A 5JJIA 3CPWB 4YALA 2P65A 1G6OA 1S1CA 2GEDA 2QMHA 2F1IA 2BBWA 2C8VA 1HT2E 1OXTA 1I4LD 1W46A 4CEHB 4Z8XA 1ZJ6A 3T61A 1R5NA 3ZBTA 3TSWA 4HLUC 1XJQA 3K8YA 5FI1B 4DEXA 1W2BB 3O8RA 3I56B 4EPWA 5B2ZA 4QJ3A 3A1SA 1EGAA 1AZTA 1MT0A 1ESMA 1Z6GA 2VHQA 4LOAA 2PBRA 2PCLA 3SYKA 4ABYA 5DN6D 5K8LA 4AD8A 3EA5A 2GAOA 4G1BA 3ZH9B 2CE7A 5EE0A 2ZAOA 2JIZA 3PEVA 1IXZA 1TLLA 2QGNA 4IDOA 5FPTA 5EJEA 1TU3A 2GK7A 2LCFA 2JJ1D 1KTVA 3AVWA 1TL7C 4Q9KA 1UDWA 4DLXA 2QN6A 3AV0B 3MD0A 3F0TA 4MGYR 2IYVA 3U7EB 1FZQA 4A8JB 3AUYA 1R7RA 3OESA 2JLWA 4G5RA 1WE2A 1VQLB 3IO3A 4BPBA 1K5DA 2ODBA 2WWWA 4A0HA 1ZNXA 4NDZA 1X8KA 5KSYA 5L3SA 2ZYTX 1NN0A 3KDSE 2H92A 1S9HA 5JWOA 1XE1A 3K0CA 3UG6A 1US8B 4OI0A 4TZ6A 3ND8A 4PC1A 1QF9A 1E2MA 1XTJA 2V9PA 3ZZ0A 2FX3A 1N5LA 5DYIA 5FL7D 3RWMB 4NYMR 4V0KA 2ZRJA 1N6OA 3OEHA 1ZU4A 4IHQA 2WPDA 1JR3D 3W2HA 3B1YA 5DHAA 2FH5B 1XMIA 3R20A 4Q4JB 1QGZA 4JT4A 3KQUA 2VP0A 2WSSD 3ZVMA 1Z0DA 1VPLA 4CDGA 4Y0VA 5KSZA 1G4UR 1NKSA 4RFVA 2J0QA 2OXCA 1CJKC 3W2GA 2GHIA 4NYJQ 5JEEA 1WB9A 2HUPA 5LB2A 4CF7A 5KYKA 2CJWB 1WDTA 2OUKA 2J59A 2CCKA 1UEJA 5LDDC 3WYAA 4HDOB 4ZDIA 1OIVA 2ZE6A 4HDQB 1Q82D 2GPJA 1ZU5A 3U3MA 3FDIA 2G0TA 2V7QD 4BEBA 3RSOA 1BH2A 1HQYE 3ZD6A 1OH7A 1OKKA 1VCIA 4BFTA 2P2LA 3L0OA 3I55B 5IK2D 2CHQA 2ZU0C 2WTUA 3KJHA 3ZS9A 1Z0KA 1YJ9B 2F1HA 1LVGA 2Q9AA 4BPRA 3I92A 1QDEA 2JGNA 3THWA 5SZJA 1E0KA 1II9A 2OTLB 3CRVA 3DKPA 2OV2A 5HZHA 5GJBA 4QG7A 1YI2B 1OYYA 1FNDA 3CZQA 3H2YA 3K09A 4TTRA 4A8JA 1AQYA 4HB2A 1I7PA 2O8BB 4G1VA 1KDRA 4ZIRA 2ZRLA 4MDEA 5FBLB 2ZRDA 2QMUA 3AGQA 4MYUA 3G71B 2FFBA 3CPHA 2J7PD 3KX2A 2B7CA 1DAEA 1OXUA 1LTQA 2OM2A 1E4VA 2QEQA 3FFAA 5FR2A 4W9MC 2VP6A 2HYDA 2PX0A 2ZVPX 4X8LA 3E2IA 1KOFA 1AK2A 2HDNB 1QRAA 2QTHA 1OXXK 1XPOA 1GG2A 3CF6R 2FWRA 1KKMA 3KFXA 4XTRA 4LBVA 2RGEA 1ANKA 1TVCA 4PFSA 2QA5A 1UBEA 4Q00A 4CT4B 3G0HA 2AK3A 1OH8A 2D2FA 1TNDA 2GXSA 2ZAMA 4B75A 3BERA 2FE4A 4HE5A 1CU1A 4R98A 2P6RA 2IYRA 2RCNA 4NCIA 3TUZC 2Z43A 1ONBA 4BWYA 2NMVA 2YZ2A 4HLCA 1ZMXA 1G3IA 4H1VA 4WQMA 4Q03A 3I62A 1RIFA 1D1NA 5D3MA 1GKYA 2GEUA 3RAPR 1AS0A 1GL6A 1XXHB 1E79D 3ZYCA 3QY0A 4KLZA 2GJ8A 3O8CA 1MO4A 5DYGA 4MRVA 3FVQA 4MITA 1XCGB 1Z29A 3QOFA 2QI9C 4KI0A 4NKRA 2GTPA 1T0JB 4GFDA 4RJLA 1ZYUA 1F60A 1EWQA 3E1SA 1OHHA 4YLGA 5TDHA 2CCJA 4TMWA 2ODNA 5A5GA 4X8MA 3DOEA 4IDNA 3TMKA 2IYLD 4YQFA 1UKEA 3AEZA 1FTNA 1IXSB 5AJZA 3B13B 1NI3A 4BRWA 1P9WA 3T1TA 2X77A 3UK6A 5E95A 3EX7C 1L4UA 1FP6A 1Q86D 3X1DA 4A6PA 3HPQA 4BASA 3KKNA 4WOPA 4KLNA 4I1OA 2JLVA 1TPZA 1PUIA 1IN8A 3TKLA 3RC3A 1X6VA 4YAWA 1XZQA 3LDAA 4JLDA 5FFMA 3EXAA 4WVFA 3WMFA 5L8VA 5TXGA 3EC1A 4LPKA 3EPHA 3KXIA 1QUFA 1FMLA 3QXCA 1N6IA 3MG9A 4DIEA 3K0SA 4JBYA 2ZUCA 3BC1A 1JA0A 3K9NA 1XEFA 1N6NA 4TTPA 2W2TA 1KZ7B 3CONA 5EZ6B 2JJ1A 3CR7A 1KJYA 3QE0A 3LVBA 2QTFA 1L8QA 2Q9BA 1Z2AA 3AQ4A 2XNDA 1BYUA 4G5QA 3RYTC 1QHIA 1WA5A 1XMJA 2IYTA 3EG5A 4G5GA 4LJYA 4DSNA 4AG6A 5AUPB 2HMAA 5JHHB 2ZM5A 2C77A 1G18A 2E1RA 5H59A 1KAGA 3MWJA 1VQ7B 2BIFA 3DVLA 3SHFA 3AF2A 4ACAA 5C46F 2OEPA 3BAFA 4UAJA 3ZVNA 4B33A 1N5JA 4PHTA 1CR2A 1Z6YA 3CF2A 1P9RA 2FEOA 2HF8A 2NTYC 1KO1A 1DAIA 5J4KA 1DS6A 1OH6A 2XOKA 4LCBA 1JR3A 1ZIPA 1RW4A 3CM0A 4LGMA 2DWQA 4B74A 4JLPA 4URYR 1NVVR 2JLQA 4JVSB 3TAHA 4M2LA 4HAZA 3R9WA 4MKIA 3I1FA 4FMBB 3VKGA 1DADA 2HCBA 2ZU6A 2FOLA 4FIDA 1DG3A 3VX3A 2N42A 2E9SA 5GVRA 2QMEA 3LRPA 2WM9B 4LSGA 1H85A 1KK3A 3NWJA 4JLAA 4US1R 1R0XA 1S0UA 3LBHA 4L4UA 3HP1A 4B73A 2IHBA 4C0SA 2DY1A 1TU4A 4RFSA 2YV5A 3LWNA 1FOEB 1VYTA 4HAWA 4TQ9A 3M4YA 1B0UA 2IK8A 2Z0MA 4RY2A 1JEEA 1RJ9A 4QNMA 1WMSA 3GFOA 4DJTA 121PA 1P2VA 1KO7A 4LV8B 3JVUA 3C16C 1QG4A 1GOTA 1NN1A 1S96A 3R9XA 2IYYA 4DLTA 1GWNA 2ZSAA 2CVFA 5C4GB 2VHTA 4EQ6B 5DH9A 2GBLC 2ZJBA 3E70C 4F38A 5AJXA 1FNMA 3QBTA 3B9QA 5BXQC 3GP8A 3WMGA 4RD0A 2FPLA 3G5UA 3QNUA 2CHGA 2F9LA 2AXNA 3K0EA 1VTKA 2AKYA 3DHWC 5E4FA 3T1QA 4S2EA 1DARA 1TEVA 2D3WA 2P5TB 5FTMA 2FNAA 5BW8A 3LX8A 2GDJA 4QGHA 3P26A 2WSSA 2QPTA 4X8HA 1W0KA 1RE0A 1ZCBA 2NO6A 3MFYA 3K9GA 3HU3A 4RZXA 4NH0A 4BGDA 5GJCA 1Z0IA 1IQPA 3UPUA 4OQMA 2CVHA 3RRYA 4GL2A 2HEIA 3OIUA 5EXTA 1HURA 2A5JA 3WHKA 2JJ2A 2QMOA 3W2EA 3GJ5A 2IWHA 1G64A 2C99A 1W44A 3O8BA 1CIPA 1OYWA 3ZS8A 1P60A 2VP4A 1E2QA 5TV2A 4NCKA 4KAXA 3QVUA 4H1UA 1VG1A 1XXHE 3BIFA 1IB0A 4MDFA 1E94E 1G3QA 3CX6A 5KDOA 1R4AA 3ZQJA 5TY0A 2BWJA 3PVSA 1ZNZA 5B30A 1B23P 3IHWA 5FA6A 3GJXC 2O0KA 5FUXA 3WYFA 3VR4A 3NEJA 3GLIE 1XU4A 3X2SA 4DLVA 4FCTA 3WYGA 4IVQA 1QFYA 1C9KA 5UKDA 1XD2B 2BJVA 3VO2A 3W8NA 5DI3B 1J7KA 2JA1A 4TLBA 1W0KD 5GV7A 3IEVA 2CNWD 1ZM3A 1YZLA 1JAHA 2W6IA 3L8ZA 3DM5A 4GP7A 4B32A 2NOAA 4MGIR 3FB4A 4DCVA 1NSFA 2J7PA 3BE4A 4UJ3A 1CBUA 1ZD1A 2GZDA 1E62A 2FMXA 2HF9A 3A1UA 1G5TA 2XB4A 2V4ZA 2XJ9A 2WWYA 2KB0A 1U0JA 2FSFA 1Q7YD 3CH4B 1PLLA 1Z06A 3W2IA 2GKSA 3L2OB 1ZCAA 5J40A 3ES9A 3EZ6A 3TVDA 1N0VC 2Z6VA 4DCTA 1JJ2B 1P5ZB 4TL6A 1Q0UA 2ZJ2A 1Q57A 4B3CA 3CO5A 2R8RA 1JXOA 1OB2A 1US8A 1X3SA 3KZ1E 1GSIA 1KDOA 3O47A 1DG1G 3N70A 2P6NA 2WVJA 4KBFA 4ZI3A 1QFJA 1QGAA 3J81k 4HEJA 5CDFA 4OHYA 4XVRA 4B34A 2I4IA 2PJZA 3DMDA 4XVUA 1JAIA 2OBNA 3D6TB 1F3OA 4TSFA 4DXAA 5BWMA 2RH5A 3GEIA 4PC3A 1IN5A 4TL9A 2WIAA 2C96A 3UIEA 4DLWA 4MA4A 3EIHA 1XTKA 4O2LA 1VMAA 4R9UC 1S9DA 1KMHA 2Y8EA 3WMEA 3K0FB 4TWZA 3NC1C 5JWHA 2FF7A 2A2ZA 1VQ6B 5DO9A 3BH0A 5G3ZA 1NLZA 5JJLA 4F4JA 4URXR 1M7BA 1O87A 2AX4A 3E5HA 3X1WA 1KJZA 2OZEA 4GSYA 4CW7A 1A5TA 4OL0A 3VX4A 5H8WA 3VU9B 2FSGA 2IF2A 1Y3AA 5JSZA 2FZLA 2HYIC 1JA1A 4QOSA 2HT1A 4MUAA 4Q47A 2CDNA 1CNEA 2VF7A 4NYIR 1SHKA 4PSKA 2XAUA 2UKDA 1Z47A 2QP9X 2WWFA 3C5HA 4WA7A 3THOA 1E63A 4KVGA 4YMSA 3RC8A 5FL3A 2ZSBA 1EFRA 3R7WA 3LQQA 2VP9A 1LV7A 4Q01A 2W6JD 4LWZA 1UADA 3RRZA 4PAMA 4XSHA 4HSEA 3I4LA 4Q9LA 2EFHB 3AVYA 3AUXA 4YMTA 2DCUA 2WIBA 4C3ZA 2RGAA 2IHYA 3WNCA 1W4RA 2RGNA 3SJZA 2IUUA 4TMVA 1ETUA 3ZQ6A 3GJ0A 1Q21A 2VL7A 1E0SA 4GZLA 4P4SB 4OQNA 3VR2A 1K8AD 2OG2A 3HYRA 4B2IA 4A92A 1G20E 4RKFA 2O8FA 2G0NA 4QXAA 3WNBA 3ADBA 3BORA 5EP4A 1MO6A 1C1YA 4LBYA 2ZIAA 1M2OB 1Q1BA 4GOKA 3LLMA 1X1RA 3GMTA 1M1KD 3QKSA 2VF8A 3B6EA 3IQWA 1VHLA 4DKXA 5CDFE 1E96A 4O2RA 4PXAA 2JLSA 1TQDA 1YJ5A 1OW3B 3DEFA 3FHOA 1YU9A 1Z3IX 2WBLC 4MUBA 2CLSA 2PMKA 4M1WA 3KQKA 3QEOA 2BBTA 2V6IA 4KITB 3VNVA 2FGJA 3C7KA 4M8NE 3ZDQA 5KU1A 1XD8A 3RS3A 4QBHA 1KI6A 4CEIA 3RS2A 4N0DA 4I1SA 1WBBA 3AM1A 4N3NA 5HKKD 3D3QA 5TR9A 3MMPA 3RHFA 1MO5A 4MKGA 3RVBA 4DCSA 1GZSA 4JL8A 1QVRA 1A4RA 2OBMA 5H1YA 5P21A 2GQFA 2DB3A 1G3RA 3D7MA 3K9HA 1MH1A 1G41A 2BKUA 2ZJZA 2ODEA 4GDFA 3U7GA 2OCAA 2GJKA 2IUTA 3SR0A 1GITA 1XEXA 4Q19A 1FNBA 2VTKA 5ELXA 4I1VA 5G41A 2BMDA 3CCVB 3SNHA 4GNKA 4HB0A 5FOXA 3B2EA 1NBMD 4EJSC 1NNEA 1KI8A 1GL7A 1U9IC 1S1MA 1NY5A 1J90A 4KFSA 1PLKA 4QBFA 2A5FA 2Z83A 2O8DB 1DO0A 1T8UA 1COWA 3IGFA 1Q1ZA 4JSTA 3UMSA 3K09C 4NCNA 4WBSA 2Z4RA 4QBGB 2PT7A 2V54A 2WJGA 2FJUA 2QE7A 2AL7A 3B85A 4ZDJA 1R0ZA 1P2UA 1KI4A 4D26A 2RB4A 3LXXA 3U7HB 5J47A 4KXFB 1A1VA 3LW8A 5IDVA 721PA 3SYNA 3U61B 4IJMA 3KL4A 4OKSA 4UNQA 1D9XA 4Q4AA 4UXIA 3CRZA 3WXMA 2O8CA 3TK1A 3EZ9A 1JALA 1FMJA 1PLJA 1RVDA 3TE6A 1CLUA 2F43B 4JZKA 3BS4A 3H0KA 4GMDA 1N5KA 5CIQA 2A9KA 1OKKD 3B78A 1J70A 4Q66C 4ILEA 4FCVA 5FUYA 4Q7KA 3MRSA 5FBVB 4MRSA 2XGJA 2YHSA 2YWGA 2OTJB 2ZPTX 3Q5EA 2RAPA 4BZPA 2OESA 5CJPA 5EQTA 1IONA 1FQKA 3OAAD 2O5VA 1W5SA 1W5TA 1KJWA 5KHOC 2ZQ5A 1M74A 3OIVA 3EZ2A 1COWD 4AC9A 4LYFA 1HQCA 2D06A 4P31A 2QG6A 5CB8A 1GRQA 1SGWA 2NO7A 2ZRBA 2PIAA 2G1JA 2QNRA 2DERA 1H8ED 5FPSA 2X19A 5CLQA 1W36B 1IHUA 2R65A 3BB3A 4BLSA 1BIFA 5F2EA 3X1YA 4D2IA 4HUQA 4IOLA 2ATVA 4Q21A 4CYMA 1KYIA 4Z54A 1W48A 4OI2A 3RS4A 3BD9A 3IILA 2W6ID 1HE8B 1KRHA 3EWAA 1DTSA 4ON9A 3EZ7A 2CE2X 1JJ7A 1W4CA 2NGRA 3DZDA 4JJKA 4F4IA 3QFRA 1G5RA 4YC7A 1E9BA 2FN4A 4ZIRB 2ZE7A 1MABA 4DEYA 1E99A 4BFVA 4F7DA 4OHXA 5AWFC 3TH5A 4M9SA 5FTLA 1N2CE 3EW9A 3U44A 4U5XA 2QTLA 3NH6A 4A2PA 1QX4A 2WMNB 1QVGB 4WZ6A 4Q1CA 4AG5A 3GCGA 3ZGXA 4P3YA 4PAQA 4DT1A 4E07A 2J45A 4PQRA 1S4QA 4TMTA 3SOPA 5GADl 3OW2B 4JT2A 4UNPA 1A8PA 3MHPA 5JBQA 4PZYA 1NG9A 421PA 2O8DA 1DAMA 2QGZA 4HAVA 3G6EB 1Q3HA 1YR9A 1K9MD 1N5IA 3CMAB 1NVVQ 3QEJA 3KTAA 1NVUQ 3CPEA 1G8HA 1KDTA 2ONJA 1QHGA 4TYWA 1NN5A 2G83A 2LKDA 1L2TA 3FHTA 3T34A 4ZI2A 2TMKA 4AI6A 4G0NA 3FPKA 4NMMA 4XOIA 2BMFA 2RGBA 2BCJQ 4BZQA 3AKEA 1XTQA 2LKCA 2IEYA 5GV8A 4EFLA 1HY3A 1LNZA 1Q1QA 2ZREA 2XXAA 3TSOA 1E9DA 2QQEA 3HR8A 3S1AA 3QSYA 3Q5DA 4G1UC 4N0EA 2A3RA 2F3RA 1E2KA 3AF3A 4A0GA 2ZRAA 4URZR 1KSGA 4ITRC 1KGDA 5FBRB 2IS1A 1E2FA 1JJVA 2GZHA 1RJ9B 1OGIA 3LVQE 5FOVA 3SI7A 4DSTA 3PENA 3PEUA 4ZKDA 4HE6A 4FK8A 4CVNA 2GCOA 4KYUA 2EVWX 1G3MA 1XWIA 4QJ4A 3E20A 3IO5A 3NC0C 1SKYE 2IUSA 221PA 1XTIA 1DEKA 4U00A 4KSCA 5EE9A 3LBIA 1KNQA 2HJVA 2DFTA 1II0A 4BRUA 4DDTA 3TW4A 4TMZA 2IC5A 1KMQA 1EFRD 3MSXA 1VQMB 4NYMQ 4M1TA 3TGPA 1SXJB 1U0HC 4HZUA 5JHGB 3BFKA 4BFWA 5IT5A 4L15A 3EZFA 3ICEA 1BMFA 3I5XA 1EK0A 5BN5A 2FFQA 1KK0A 3GLIB 3AP1A 4RZ2A 2Q9CA 1CF4A 1TF5A 3QI2A 4Q4HB 5AJYA 5JCPA 4IOJA 1CQXA 4IEEA 3NBZC 1FFHA 2VNHA 1AA9A 2BM0A 2FPMA 2ZUDA 1NBMA 1CJMA 1U9IA 2GBLA 2GXQA 2ZR0A 4XD7A 5LBIA 4HATA 1OFUX 2JLXA 2XOKD 4O25A 2J0UB 5E7IA 1GNQA 2FEMA 3ZLJA 5F3WB 4IFEA 2BOVA 1K8RA 2IEZA 2EW1A 1F2UB 2XSZD 2GJSA 3THYB 4NTZA 3GLFE 4FXPA 4KHZA 1XMSA 2EFCB 1Z28A 5D3QA 3CRQA 3VAAA 5JS7A 1S3SA 4QJ5A 2R44A 4K1XA 1YHQB 2QROA 4JMPA 3AVOA 1VECA 4CZ2A 3K1JA 3TRFA 1YZUA 3CD6B 4UKDA 4N3GA 4N1AA 4AKEA 5TB5A 3GQBA 1U90A 3SJBA 2CRVA 2GJAA 3P1JA 1T5LA 4A2QA 4TYYA 4LHVA 4GOXA 1VYUA 4IRUB 1EFUA 3P27A 2FDCA 5KPJA 3Q9LA 3WBKA 2PZEA 3FMFA 4IW3B 3QXHA 5G3YA 1E1QA 1RC8A 1LY1A 3SDZA 3BWDD 1Z5ZA 1AZSC 1KSFX 4HAUA 1TMKA 2J5XA 4C9BA 3QKRA 4P6VF 4JL6A 4C2UA 3MWKA 1E2GA 3THXB 3L0SA 1J8YF 2LWIA 3QKUA 2YWHA 1DO2A 3OEHD 4OJQA 3W9YA 4PAOA 1U8YA 1K73D 5JS8A 4HLQB 3EIEA 3T5GA 3B1XA 2XJ4A 3OF5A 2GCNA 3EPKA 3A1TA 4ZCIA 4GP6A 2R6HA 2WWXA 4PHHA 4C4PA 4ASUD 5BQ5A 4U02A 1SVOA 2SHKA 5FTKA 4DLRA 1AN0A 4Q1BA 1XXHA 1XTRA 3KKOA 1GL9B 4RCZA 1DAGA 3LVRE 2YKGA 1UEIA 5AUOB 3T15A 3DKVA 4DQKA 1M1YE 1NVXQ 2ZUBA 3CMEB 4PQYA 4DUGD 5BN3A 4US2R 1TADA 3GFPA 3GLHA 3IIMA 4EDHA 1SXJE 1XRJA 3H84A 3MWYW 1FRQA 1M7HA 3EIQA 1CULC 1XEWX 4YAFA 2PT5A 4PPQA 5FOSA 4ARZB 2VYFA 5DI3A 1UFQA 2ZRNA 3ZBUA 2GRJA 3KB1A 3LBNA 4Q4JA 1Q12A 3EWSA 3VU9A 1D8TA 3ZC3A 3CCUB 2HJGA 4GT1A 3AKYA 4M9XA 4ZKEA 3K70C 1EX6A 3AVXA 1Q1EA 3OAAA 2ZYVX 5ANRB 1Z0AA 2ZI6A 5JRJA 4QGGA 3AVPA 4PTLA 1KI7A 4TZ0A 3A58B 2RKOA 1N6LA 3LO5A 4AYWA 1TQ6A 1GFIA 1UPTA 2Q21A 1QVAA 3FE2A 2AN9A 4DCUA 1KMHB 3FPAA 2WWGA 5A0FA 1IY0A 1DAHA 1RYHA 3SE0A 4QL3A 4LJ6A 1V43A 2ZYUX 4Z8YA 2WAYA 2F7SA 4V0NA 4C30A 4LYJA 3DL0A 4Q02A 2D7CA 3UG7A 4JKYA 2X1VA 1Z6AA 1E2PA 1OH5A 2PLFA 4C0QC 2ORWA 4GZMA 3FKSD 1SXJC 1E9RA 1V5WA 2OBLA 4PPNA 1DELA 4FD2A 5CM9C 3IBYA 2BMEA 4LBWA 2PL3A 3PFIA 2P6UA 1I4DD 1NJGA 5JZVA 3B8HA 4C43A 1Z83A 4RD1A 3OJXA 2A5DA 3ASZA 3CNLA 3CH5A 4KV9A 4CT5A 2P3SA 1QZXA 2QM7A 4Q5IA 1VYVA 2WJVA 1FDRA 3RSLA 2EFGA 1AKYA 5HE9A 1VG9B 3A1WA 3K70D 1KHTA 1D2EA 4AWXA 1AGRA 5EXPA 2XNSA 4C0AC 3S1AB 3N5CA 4PX9A 1FQJA 4US0R 2XZPA 2J7KA 2OE2A 1LF0A 4EPTA 1W0JA 1N3BA 2AKAB 4OK3A 2BN4A 2IS4A 3NTUA 1OHHD 1EXMA 4AKIA 4OI4A 2RGCA 3RDPA 2IYZA 3RS0A 4A0FA 4C0HA 2VZLA 3ADDA 1BMFD 5EP1A 2BV3A 4M1SA 4F7WA 3C41J 4URVR 3TSZA 2PLRA 2VSFA 4C0JA 4RSGA 3WRYC 3HPRA 2HLDA 3AF1A 1VQ9B 1CJVC 3LW7A 3GLGB 1M6NA 3B9PA 5FOWA 3VHLB 1EWRA 3CRMA 5AUQA 4CIDA 2BSAA 3NXSA 1W35A 3ZZUA 1UBFA 2H8KA 3AP2A 3Q3JB 4YAUA 2ZJAA 3CC4B 1E9SA 1CRPA 5DI9A 3AVVA 3CC7B 2VP2A 3CCMB 4IDHA 2O8EB 4V03A 3Q72A 1FNCA 4P0TA 1F20A 4URUR 4IFBA 4F4CA 4D0NA 3CNOA 4Q7LA 3C5CA 3GEEA 1X86B 5JI2E 4BE7B 2YNMA 2YYZA 1G291 1E1RD 3CCLB 4RD2A 4OYHA 1EESA 1KK1A 3VO1A 1MABB 1W4BA 2JAQA 3AF0A 4TTQA 4UJ5A 5THXA 1KY3A 2A30A 1RRGA 2DYKA 2PEYA 4MKFA 4NONA 2ZI4A 4POAA 4YMVA 2BJWA 3A37A 2QU8A 1FRNA 1C4OA 2C78A 3VNUA 4IXMA 4DHEA 1DPFA 2ZSFA 4DLUA 4V0LA 1BO6A 1YZTA 4MYTA 3U4QA 2PJRA 3WRXC 1JBKA 1ZM9A 2B6HA 4B71A 1G8FA 5KUTA 2J41A 3SEAA 1TTTA 3CB4A 3ZZTA 1OFTA 2O52A 4DDUA 1KC8D 2QAGA 1LF5A 3ZVRA 5EMNA 4FMDB 4ZV4A 2HLDD 4PR0A 3K0AB 4OJKA 1G8PA 1KKLA 2IBMA 3LY5A 1W1WA 1QHHB 1GNPA 2CK3D 3I32A 2AK2A 4CRWB 2W0MA 1B2RA 4II7A 3KQLA 4HLDA 4EQ6A 2OCBA 1TX4B 2KWIA 4DUGA 4XD7D 3VFDA 5HXBA 1XEWY 1W34A 1FTSA 1W7AA 1SVKA 1P72A 4B2LA 2OCPA 1YRBA 2CBZA 3WHLA 3UATA 5M04A 3IIJA 5FOTA 1QG0A 1G6HA 5H68A 2OK7A 4HYYA 4TYQA 1CNFA 3EC2A 4HLUA 2GXAA 3WY9A 2H5EA 5FOUA 1T91A 3CWZA 5AR1A 1CEEA 5SZKB 3TR0A 5DE3A 4QHSA 1AQUA 5L3RA 5E7MA 1VQNB 4V0MA 2QT1A 3TUJC 4W7SA 4JLJA 4D81A 2JCSA 3KJGA 4YHBA 1QHYA 3TQCA 2V3CC 3V76A 3LO8A 4EAQA 4L8GA 1CTQA 1ELOA 1TUIA 1QHNA 4C0BA 2QBYB 2QSZA 1Z8FA 4FCWA 2KBFA 5JJKA 2FSHA 1G1MA 4PC7A 2JATA 4E22A 4TT3A 2WOJA 3BRWD 1SKYB 4RD6A 2R2AA 5HCNA 1QH0A 3O8DA 1ZP6A 1NN3A 2BCGY 1U2RA 4TYPA 1I2DA 4WAUA 4DBLC 1H42A 1Z22A 2CMKA 4KFRA 2L0XA 1P62B 1G7RA 3QG5A 3U5ZB 4DDVA 2PCJA 5CK5A 2OO7A 3M0EA 2A7QA 4ERNA 1E9FA 5KSWB 1T6NA 3VMFA 1OIXA 1JNYA 2VHJA 1P3JA 2PX3A 1TQ4A 2FPKA 2WJJA 2ZVQX 3V4FA 2ZANA 4UXHA 2IS6A 4A1FA 3UWOA 1GAQA 1ZD8A 3L43A 1TAGA 2QTZA 1ZINA 2A78A 1SVMA 2F9MA 4Q9IA 1AGPA 3CPJB 2ZS7A 1KZGB 2H1LA 2JJ2D 2YOGA 2ZS9A 4AYTA 5E3HA 3AVQA 4AKGA 2NG1A 2EWVA 3I8XA 4Y9RA 4F91B 1KI6B 1XCMA 1F2TB 2ZEJA 3KTAB 1FNNA 4GRAA 1A2KC 2C03A 4JS0A 4TLDA 4E09A 2HXSA 3FMIA 4ESHA 1OXVA 2FZ4A 1KI3A 4M21A 1OF1A 2YWEA 4F92B 4QFMA 2AD5A 2WJIA 4Q4HA 2WAXA 1XB2A 4M4SA 2UZIR 4MGKR 4RZ3A 3ADCA 2IXGA 1M8PA 2IYSA 1HA3A 2FFHA 2ZETA 3AP3A 1XTSA 2X3UA 2AHOA 2PMDA 1VKJA 4NP6A 1I2MA 1ZC3A 1YR8A 3Q7PA 1AS2A 1E2HA 2C98A 2QQ0A 1P9NA 4Q1DA 1WF3A 4DLZA 1P75A 1NY6A 1VDZA 2DWOA 5CM8B 4HB3A 1KSJA 2X8AA 2ODWA 2CHVA 2BGJA 4B6EA 3AGPA 2Z5FA 4LC0A 1OPXA 4KCGA 3SS8A 2RC6A 3VQTA 4XIGS 1M90D 4IOMA 2ZXUA 1PUJA 4UNNA 4C7OA 4HI0E 2ZE5A 2IXFA 3KKMA 2X2EA 5FPKA 1NIPA 1HV8A 4GOJA 2C95A 2GCPA 1SXJD 1T4GA 5EZ5A 4DIDA 2VEDA 3BFVA 1E2NA 2R6GA 3DO6A 1U99A 4M1OA 2B8WA 1E2LA 2XX3A 3FTQA 4R71A 1J8MF 1OV4A 3FMOB 4NCHA 3GD7A 2P0EA 2B8TA 2RHDA 1GAJA 2CL7X 4RD4A 2EQBA 2GESA 5SZHB 1MRNA 2VHUA 4ZO4A 1HE1C 1M7GA 1ZUNB 2BF4A 2DBYA 2QAJA 4IEIA 4OBEA 4RD3A 1D9ZA 4QGFA 1MR3F 2REXB 1GRRA 3EPLA 1U94A 1RYFA 2AD1A 1YZQA 1ZBDA 1GIAA 2QDXA 1OFHA 2J0UA 5CJ2A 4YMUA 4C7OB 1R5BA 2VP5A 4PSAA 3FMPB 3TW8B 1KO8A 1NLFA 3NBXX 5C18A 2PZGA 5L3SB 1R10A 2QSYA 2BMWA 3MAAC 1CP2A 2VQSA 3QPWA 4Q1EA 5E7JA 4A36A 3B1VA 1YVDA 2CNWA 4PQFA 2GJ9A 3KJEA 4HDCA 3TAUA 1NL3A 3TJZA 3X1ZA 2WZQA 3WP1B 4OQLA 3I5YA 1TF7A 2QP3A 2OHFA 2ZJYA 2F3TA 4B76A 2XZLA 1QVFB 1ZAKA 3QVVA 5GJWC 3CRW1 2X2FA 2ZRHA 4BFYA 3SJAA 2AR7A 2IYUA 3ECCA 4PO9A 3BJIC 3OIWA 2GF0A 5FBWB 3B60A 3B7GA 3LAWA 4R2HA 4KVAA 4JL5A 1G8GA 1J2JA 2B21A 2YWFA 2GAAA 3L82B 4NPHA 2E87A 3U3KA 1IN6A 1XBTA 2H57A 3LX5A 2XTNA 1LS1A 4DSOA 2J46A 4DRZA 1O3YA 4TN1A 3FJOA 3OE7D 1KI9A 3GLGA 3BK7A 3V00A 1PJRA 1KDPA 1H65A 1JPJA 4QM6A 1G7TA 1CJUC 1G3UA 2C04A 3QE2A 4NE2A 3CZPA 4UXJA 2XZOA 1Q20A 2JIZD 4PPFA 4OHWA 4H9GA 2OLKA 1NF3A 3WP0A 4BEJA 2GVZC 1NVWQ 2Z4SA 1YHNA 1SVLA 1SVSA 2W83A 4MYHA 2VSOA 3VR5A 3PEYA 1KK2A 1T8TA 4BECA 4A82A 4RZUA 1W36C 3WNDA 3CCQB 4JLBA 3QPVA 3DZ8A 4JVNA 3F5FA 1EP1B 4LZZA 1DVRA 2JLRA 1LFDB 4BLPA 3PUVA 4G5SA 4NL4H 1GVHA 2GNOA 5GVSA 3OZUA 2BHRA 3HU1A 3L0PA 3JQRA 4YDSA 3KFVA 3CRRA 3AVUA 2NPIA 1AJEA 1R6BX 2AWNA 1IM2A 4XWKA 3LH5A 2ZI9A 3ETLA 4OHVA 4QGAA 1ESNA 2D4HA 3FWYA 2F43A 2QBYA 2O0HA 3U3JA 2WKQA 4PHFA 2Q3HA 2VA8A 2ONKA 2JLYA 5G40A 3CCRB 2G1KA 1RZ3A 2QP4A 4EH1A 3A36A 3IBGA 1N6HA 3LNCA 4KFUA 4Q9HA 4EPRA 1E2IA 4HUTA 1HUQA 4BFXA 1UBGA 5K8TA 1Z2CA 1R0YA 4NZYA 4DCNA 3W5VA 4G5OA 2J0VA 3F3YA 1W4AA 3NH9A 4B4DA 3A4NA 1W87A 2YOHA 3KJIA 1Z07A 1BS1A 2XNDD 4AIIA 4Z51A 4Q48A 2ORIA 3UXMA 1CR4A 2ZSEA 2IT1A 3VTKA 1TQ2A 2RGNC 3SBEA 1AM4D 2BEJA 1GVNB 3U3RA 5EE1A 4PO8A 5BYJA 3PJRA 3KXLA 3RABA 2YINC 1OE0A 3EASA 4LJ4A 1G17A 4BLOA 4A15A 5EUQB 2VNIA 4PC6A 2D74A 1N6KA 1CXZA 2ZE8A 2KSQA 2R6DA 5JSZB 1ZNYA 3THYA 1G21E 5KNCA 3IUYA 1FL9A 4URWR 2IW3A 3BXZA 1WCV1 4M1YA 5GJVC 2YJTD 3OHMA 1YITB 3GLHB 2WPDD 3K9LA 1FP7A 2OK8A 3OIYA 4CEIB 2N1BA 3A8TA 5KTYA 4ASUA 2OAP1 1NMXA 1R8SA 4IDQA 2CNDA 1Z6XA 2BC9A 4RFSB 3QJYA 2QPOA 2CL6X 2JLZA 4DB2A 1L7VC 4PANA 3NDBB 3REGA 4YDHB 3DDCA 1SXJA 1QBKC 2IYQA 3A1VA 3NHAA 4PO1A 3BB4A 1UAAA 3K70B 3PUZA 2EFEB 1TUEA 4QC2A 1QFZA 3CX8A 4LX0A 2V7QA 1T3LA 3G4SB 4TLAA 1JXMA 5KDLA 3ZJYA 4B3FX 4LPSA 2ZRIA 4IKEA 5AK0A 5C1BA 3I8SA 4MRNA 3QXXA 2GA8A 5HPYB 2DFKB 1L4YA 3EA0A 4B44A 5IK2A 3NDPA 4WZAE 4JYCA 1G16A 3SU8A 4YXWD 3W2FA 3B1ZA 5JWRA 4D80A 1A82A 3GJ4A 3W5JA 2A5YB 4BFZA 4X8OA 3SQWA 1SHZA 4UQOA 4B3BA 4BFSA 3SFZA 2MMCA 2IXEA 5J4HA 3VR6A 4D82A 3P4XA 3H4MA 1NMZA 4A0RA 4B48A 4A8JC 1E98A 3BH6A 2D2EA 1ZNWA 3A6PC 2XXAB 2XNJA 1W2HA 2MMGA 2Q0HA 2W00A 3K0AA 4OHZA 3ZIAD 1XJ0A 2PH1A 2V55B 3VKWA 2P67A 1NJID 2KJQA 3DMNA 4PSVA 1G19A 1FW6A 1VG8A 2H17A 4TL8A 1VCMA 1LW7A 1ZIOA 4PC2A 2HT6A 2QY9A 3JZMA 4BUJA 5L3VA 2NZJA 5FBQB 1UKVY 2CEAA 5AN9A 4OK5A 1VQ5B 4QM7A 4PGOA 4KJZA 2ATXA 4NCJA 1A7JA 1XDBA 3RS5A 3ND9A 4AF7A 2NO9A 1KI1A 2AXPA 1ZW6A 2WJHA 3ICQB 2WWHA 3W5HA 1UKYA 2C5LA 3A4MA 4BLTA 3PG5A 3GJ3A 1E4YA 4IOKA 5DIFA 4TYNA 1MRSA 1ZD9A 2BDTA 4ZCLA 2FU5C 4BFUA 3D8BA 3QF4B 4ZGQB 1Z0JA 1JEDA 3K0FA 3PCRB 3KKPA 2QZ4A 3N2EA 2EU8A 3GLFA 2DWPA 2ZJ5A 4ZDWA 3W3ZB 3G82C 4ZPXA 1Q3TA 2ZRFA 4NYIQ 1IY1A 1XMVA 5J4YA 4DQLA 1D6JA 1H8EA 3NKVA 3T5DA 1SVIA 1MO3A 4I99A 1NBME 1QHXA 4MYCA 1DE0A 1XPUA 4LUCA 3LXRA 1U8ZA 1WXQA 1FPMA 1W0JD 1UMKA 1Q22A 3PV0A 2NIPA 1RKBA 4V0OA 2QAGC 2GCOB 4HUQB 1VCOA 1XPRA 2AWOA 2J0SA 4W5HA 5D3MB 2GEVA 1P61B 3U7FB 2J87A 1KD1D 1ZM4A 4JKIA 3CCJB 3MGCA 4JLMA 3U6BA 2FFAA 3R9IA 2CL0X 4CEHA 1SULA 1G8YA 1HYQA 1YRAA 1UBCA 2GF9A 2VO1A 3IPXA 4D4MA 1BX0A 2MSDB 3KQNA 4PHGA 4AURA 2PEZA 2JEOA 3W6NA 3UANA 2UVQA 3QPUA 4GBMA 3GLHE 4R2IA 4MQBA 4V02A 3LV8A 1ZUIA 1E1RA 2AFIE 1IAQA 5K8UA 2J9RA 3TR5A 2VIIA 1EP3B 2FA9A 3PITA 4TMXA 1E2JA 621PA 1OB5A 3KUCA 1XD2A 3FGNA 5CK4A 3I72A 3U4QB 4M9QA 3V9PA 1Y63A 4EIWA 1GAWA 4XTCS 1A2BA 1W36D 1P2TA 2WV9A 3TNFA 2FSIA 3OFND 3ONWA 2O8CB 4LI0A 3KXKA 4Y7CA 1T3HA 4M22A 3ZVLA 4TLCA 3KB2A 4FW9A 2QL6A 1XNJA 3KKQA 4FMCB 2V1XA 5EXXA 4P4UA 1KO4A 1J99A 5CYPA 4EUNA 5DISB 1EFTA 4DT1B 1EFHA 1II8A 4LJAA 3RANA 4CEJA 2VH5R 2G88A 5B64A 1E3MA 3QUSA 1F5NA 1GM5A 3KUDA 4IDPA 4RVCA 3GLFB 1S3GA 2CK3A 3QG1A 4LHWA 1NJFA 3JVVA 2ANBA 3W5UA 3VR3A 1DOAA 1DBSA 1SKQA 4AF6A 1GP2A 2O8EA 3CW2A 5L3QA 3EARA 4Q1AA 5H5JA 2OFWA 4FINA 1AS3A 4FMDF 5TMPA 1VQKB 3IHLA 4DSUA 1XD9A 4HAYA 4B2PA 1E6CA 1XJCA 2OAQ1 4K46A 1KO5A 4KU4A 1T5IA 2KE5A 4Q1FA 2GETA 1VHTA 1BYIA 1QHSA 3BB1A 1FUUA 4W5WA 4KO8A 5IF9A 5FPHA 3OEED 2BBSA 5DHFA 3UMRA 1AMOA 3MWLA 4IVPA 5LPNA 3SFVA 5IRCD 3GPLA 5A4JA 1IOZA 3NG1A 5KSOA 5F9FA 5FPYA 1SZPA 1E1QD 1NP6A 1F2UA 2QUZA 4L9SA 4OK6A 3PXGA 2RGDA 2ZR9A 4A4DA 1NKTA 1G5PA 5KDDA 2BPOA 1IJFA 3OJWA 4M53A 1T0HB 5FUVA 1JQLB 3C4JA 1BOFA 3L0IB 1YKSA 5HR5A 4JBWA 2A5GA 5J5CA 4TT3D 2G6BA 2RGXA 4FWTA 4JLNA 1LS6A 4ZDKA 4Q4LA 1T9HA 4WIAA 1WBDA 5BN4A 1ZM2A 4TQAA 3RRNA 3JQPA 4WZBE 2N46A 3M6AA 4EJSA 1TF2A 5KNDA 3T35A 3W8RA 821PA 5C4MA 4LY6A 1Q44A 2CXXA 1FX0B 8OHMA 5EP2A 4EPXA 1ZVQA 4TL7A 2VNJA 2ASEA 3W6PA 3CLVA 3BFXA 3N2IA 2AFHE 5HE8A 4U7DA 3SJCA 2DEUA 2VBCA 3PUXA 4A9AA 4CGZA 4XWAA 1NMYA 1GJRA 3TQFA 4KBGA 4TMKA 4EFMA 5FTNA 2VNKA 4P33A 3PUWA 3CWQA 5HKKA 3FHCB 4KFTA 4Y9UA 3B5JA 4AK9A 4MH0R 4B3GA 4B47A 1OLOA 2VRWA 3TLXA 5FH9A 3RNLA 1VQ4B 1X8JA 1EX7A 3Q85A 1Z08A 1G7SA 2J1LA 3E1YE 2V6JA 3CR8A 5F98A 1CKEA 1ZC4A 1UKZA 4IVRA 2C9CA 1KNXA 3FKQA 4D4LA 1RPZA 2DR3A 1XEXB 4LYAA 4Q18A 3QXSA 4PZLA 5AJVB 1MKYA 2CCGA 2O0JA 3ZD7A 1EG7A 1MV5A 2JASA 3CC2B 4KSBA 2V1UA 2WKPA 4YAOA 2FG5A 4C0LA 1N6PA 5JRZA 4ARZA 1XZPA 3ADKA 4MRPA 4YXWA 2KI5A 5C2JB 4TSFD 2QRNA 4LV6A 4D0GA 1OIWA 4QNRA 3OZWA 5AUNB 4PPGA 3I3SR 5J4VA 1CS4C 4GPTA 1P7CA 2QEXB 4DLYA 3VHXA 1D2NA 3DOFA 3M1IA 1EWYA 4E5UA 3MJRA 2OILA 4QBIA 3GJ8A 3NHBA 4OI1A 5JEDA 4JLOA 3HR7A 1BJKA 3CUEF 3PUYA 3CBQA 1YR6A 4HZUB 5EP3A 1ZM7A 4DDWA 1YZKA 2XTZA 4LJ9A 1DDGA 2C9YA 1CJTC 4MGZR 3TUIC 1KSHA 3PIRA 4YMWA 2QA4B 2JDIA 1BX1A 3REFA 2NPFA 1FUKA 3PR1A 3U3OA 3U6KA 1AKEA 1KIMA 3U44B 3QQ5A 1GILA 3MCAA 1CRQA 1NRJB 2MSEB 2W2XA 4GI7A 5KOYA 4Q7MB 3GJ7A 5LD2B 3GEHA 3QF7A 4J0QA 4M1KA 1G9XA 2VPPA 2WOOA 4S35A 4NHOA 3IEUA 3RS7A 4D0LB 4DZZA 1UDXA 3HYTA 3SYLA 2KBEA 3C14C 1RRFA 3R8FA 4QRHA 5JMTA 1VIAA 1BQEA 4P32A 1YQTA 3SQXA 1QG2A 1NDHA 2ERYA 3NIBA 2ANCA 1N8RD 2V8OA 3NBYC 4IXNA 5FI0B 4JJZA 4HZIA 1P2SA 2CLDX 3I73A 2CJWA 1SVWA 3LA6A 4QKQA 1E69A 2ZI3A 2F55A 3JQQA 2BVNA 1GRNA 3CCSB 2ZR7A 3AKCA 5KO2A 4DC9A 1BKDR 3OZVA 5EUMA 2G3YA 1PV4A 2EYUA 5B58C 3CIOA 1H8HD 2F1RA 1DDIA 2XTMA 4OQXA 2ERXA 2DFNA 2VSXA 1XF9A 4LHXA 5CB6A 3CNNA 2ZRKA 2C9OA 3W34A 1J9ZA 4KODA 2W2VA 1VQ8B 1N25A 4B35A 1VQOB 2NQ2C 4D4JA 4TQUS 1E64A 2WJYA 2WHXA 1IN7A 1E9CA 2IX3A 3H1TA 4JBXA 4LHZA 5HTKA 3IQXA 4B3XA 5G53C 4EFNA 4NYJR 2BEKA 1QUEA 1CR0A 2IA5A 2VLIA 2J3EA 3OE7A 3Q7QA 4BQSA 3IPYA 4W5JA 5F9HA 1S2MA 4G3XA 2H18A 1P4SA 4M1MA 1YZGA 4CEJB 4EPVA 3RWOA 2MSCB 4FWIB 1JR3E 2ZS8A 4LDJA 4JYBA 1YJWB 2EYQA 3T06B 4B3DA 2JLUA 1XFAA 1CR1A 3TBKA 5B57C 1M34E 4YONB 1JR6A 1AIPA 4UNRA 2IYXA 3U60B 2R62A 2ZRMA 4XSGA 3OFNA 3W6OA 1N6RA 4LYHA 2IL1A 2RMKA 1OFIA 3IDQA 4ZCMA 2BKEA 1OGJA 3FOZA 4QHYA 2ZJ8A 3OZXA 3QFCA 1VQPB 1I4TD 3W90A 3CCEB 4WW0A 2HCJB 2WKRA 3U2QA 1WP9A 2IF0A 3QENA 2ORVA 2ZYWX 2P5SA 2QPAA 1PZNA 2BBOA 1LB1B 1EP2B 2DHRA 1OXSC 3P20A 3RLFA 3QFTA 1YZNA 2BM1A 4ZGNB 2QORA 4D6PA 4F93B 1JPNA 521PA 2XNCA 3AB3A 3MJHA 1G4AE 5AJWA 1HEIA 3TIFA 3K53A 5DN6A 5EE3A 4ESVA 4AYXA 3V4RA 4ACBA 2JJ8A 1QHHA 4RCYA 4GMXA 3NVAA 5DSZA 2QT0A 1IY2A 1WRBA 1XP8A 1PVOA 3TVTA 2QTVB 2QAGB 3LQRA 4I81A 1QGYA 4L16A 4L9WA 1OSNA 3LFUA 2R6FA 4FMCF 4LHYA 1GR1A 3NEYA 4BLQA 1Z6TA 1GNRA 3QKTA 2DETA 4HB4A 1Z0FA 3OEEA 4LC1A 1NIJA 4LJ8A 4JIMA 4Z1MD 3Q8XB 4KYIB 1GKIA 3BGWA 2QRZA 2RGGA 1R8QA 3K0CC 4LJ5A 4Q4AB 4Y0AA 3AVTA 2ECKA 2G77B 4DB4A 2I1QA 2BMJA 1T3SA 5K8IA 2Q3MA 2B7BA 5JECA 2R6CA 5FL7A 1Q81D 5JFGA 2XB2A 2ZI5A 1P73A 3C15C 2VHCA 4LV5B 2O8FB 2EFDB 3BH7A 1E2EA 3QKRB 4I1UA 1K6MA 1U81A 4D25A 4JLKA 2UZ3A 1NSTA 2DFLA 4WXPA 4TLEA 2FV8A 4AY2A 2OSBA 4JVLA 1KAOA 4NU0A 1OT3A 3PEWA 5IHPA 3BOSA 3HJNA 2QE7D 4EKDA 2NO1A 4R7ZA 2F1JA 2GZAA 2K5UA 4Q7JB 5CIWA 2Q6TA 3CF0A 1P6XA 3HWSA 3GLGE 2D7DA 1E2DA 4QHTA 2EIXA 1GO2A 1JECA 1HH4A 2RHMA 3A4LA 1YR7A 4LBZA 3BBPA 3FKSA 5HZKA 2ZRPA 2GK6A 5FTJA 1RRCA 3WBJA 4JLVA 5TARA 4Z1MA 2W0SA 4O0MA 2REOA 1KQSB 4XVQA 5JCZA 4K81B 1DAFA 1DAKA 1XCPA 4B6FA 4K8OA 2OCYC 1VIYA 4E03A 2HV8A 1ODFA 2ZJOA 1WQ1R 2WMOB 3T1VA 1YIJB 1KI2A 3B1WA 5FR1A 1NG1A 1U98A 1F6BA 1G7CA 2ZRCA 3QKSB 1E9EA 1R2QA 3W5IA 4A6XA 3KQHA 1RFLA 3GLIA 3MUFA 4EPYA 1ZRHA 2Q3FA 2W58A 2OXRA 3SZRA 2G9NA 1EFCA 3MLEA 1K5GA 1VG0B 1JB9A 1N0UA 3P32A 4MRRA 3HU2A 5LB4A 1VCNA 5HCIA 3UKDA 3SBDA 2D62A 1SM4A 3B82A 2VYQA 1JB1A 1E9AA 1W47A 1D5CA 4P4TA 1ZUHA 3ASYA 2DPXA 3QIAA 1UM8A 1GUAA 1TEXA 2I1VB 3W3AA 5EXSA 2QM8A 3ZIAA 3AKDA 1E0AA 4DWJA
chains in the Genus database with same CATH superfamily
1FMTA 1Y8ZA 3EPJA 4WBNF 4IHKA 2GHRA 4OXQA 1LTHR 5T57A 3RHTA 1E1MA 2BP7A 2C5SA 3M34A 4HVCA 4X63A 5HKAA 1BFUA 3TQRA 1LDGA 1PT6A 1GUBA 2J3JA 3L8YA 3M6UA 1UF9A 2PWAA 2VH2A 2C58A 2Y9PB 3L8FA 3M1YA 3OBBA 3QF4A 4GSKA 4KPUA 5FA8A 3A35A 5HDQA 4AVYA 1EK2A 5DNYB 2GBGA 3A2LA 3DMTC 3AF4A 1S72B 1EFKA 1U8FO 1V11A 1Y7PA 4BVFA 4BC0A 4U5QA 3DCYA 5B4UA 2QRLA 2ZUEA 2UZ1B 3I9KA 3MGAA 1F48A 3BGOS 2DCMA 2PZFA 2WSMA 3C3YA 4FJ0A 2L2QA 2YC2C 2WNIA 3GFTA 1QKKA 1Y1PA 3TGLA 2ZTSA 3WK6A 4L76A 5EZSA 3ZDDA 1NR5A 1GKUB 1OFVA 1RTKA 3T53B 2YZGA 4GIBA 3GGDA 4GS5A 2AR9A 5BSXA 1CFZA 5DGXA 5KNCH 3J7TA 3GJSA 4JVMA 4FFDA 4FI3C 2EWWA 3PA1A 3H8WA 1QJ4A 1RKXA 3Q7EA 1R3UA 2QENA 1RLTA 4KX5A 4L5BA 5CBPB 4Z0HO 2BFEB 3IPAA 4PRLA 1PNRA 4EKNB 4I4CA 1W2GA 3SHWA 3BILA 4BKOA 2YOFA 4MV1A 5JAZA 4C2TA 2YV1A 2Z5VA 1HTWA 3V8VA 2R7AA 4TRRA 1D0VA 4CKBB 2V96A 4WK2B 3EVEA 5EFOA 1IXRC 4AJEA 4TRJA 3X0DA 1U8XX 4L51A 5KVVA 3H1AA 2FPUA 3SLRA 1JV2B 3D4NA 1YX2A 2F8TA 2FOXA 4BZXA 2EOAA 5F1PA 2O8BA 1LVUA 4G1EB 3CX7A 2KX7A 3RTCA 4I4LA 5LNK6 3CXCB 5KNBA 1JQJC 2JBHA 2L19A 1GUFA 4U8HA 1ZL0A 2UUOA 1GTVA 4RQTA 5HMMA 4DMHA 3WLIA 3B51X 2F6RA 3THWB 3QFSA 3KDPA 3T12A 1KU6A 2Q5IA 4BN5A 5KYYB 1OLXA 4Q3NA 4Y6RA 4P3XA 2B92A 1Y3HA 2H29A 2COEA 2GFIA 2JKYA 4G6ZA 4KK4A 1DX4A 4M0MA 3K8ZA 1UDAA 5B4VA 3KKZA 3O1IC 1JI0A 4P4SA 1JHOA 2R8EA 3GMIA 2F17A 4D4KA 2GVDC 1XZLA 3E1KA 3N05A 1Y9ZA 3GGPA 3MD9A 6Q21A 1UIMA 1RAEA 3IKJA 4QTTB 4B43A 1Q19A 2GXUA 3GRZA 4QXPA 3UAGA 3WS7A 1PDWA 4RKEA 5JG7A 3JZAA 4HWSA 4E5SA 2OHHA 1NLYA 3PQCA 2NT3A 2A59A 1C50A 2B9EA 4XYMA 1LSOA 5BYKA 2X0IA 3GJ6A 1O97C 1TFRA 1VF7A 4OLBA 1A3CA 2JANA 1LEHA 3S5JA 1QTIA 1GPYA 3RVDA 4NBSA 1V26A 1HVXA 1R8YA 3NGMA 3EVGA 4D5EA 4EM6A 1CUWA 4W6ZA 1XX6A 2FF5A 1KPIA 3AR6A 4ZOLA 3A32A 3W6UA 4EHFA 1I8DA 4EVRA 2HB6A 3OTOB 2P65A 4MYRA 4EENA 1G9TA 2W4QA 1YB6A 3R7BA 4CTKA 1PUXA 1RLOA 2RCYA 4CEHB 2PU5A 3T61A 4O02B 2VOJA 3P71T 4EX7A 5K8CA 5M29A 4NJMB 3K8YA 5F1YA 1XLUA 2UU9B 4A8HA 4Z0PA 2C84A 5CLJA 3I56B 5B2ZA 4BZWA 1MBZA 3MWEB 4BP8A 5LYYA 4LOAA 4FU0A 1ESMA 3TKAA 3FSGA 4YIKA 3VU0A 4ZT5A 2FEAA 1J09A 4IXWA 4MVYA 5BW6B 4AD8A 1BGWA 1L5OA 2CE7A 3BMOA 5EE0A 1MB2A 1IXZA 4Y2JA 2QGNA 5FPTA 5EJEA 1PZHA 1TU3A 2P9YA 4ZVKA 3QWHA 5U9CA 2ID9A 3LFHA 3SG0A 1TL7C 2BI7A 3RQIA 4L50A 1GGMA 1S2DA 4LN1A 5CDTA 3RYCA 3VNAA 4A8JB 4F2PA 1SOAA 1VZ3A 2JVJA 2HEGA 3UHJA 1Z0ZA 2RH8A 3F8WA 5FLYA 2BFFB 3VU8A 1NE2A 1WE2A 1J22A 3QE3A 5HCUA 3K2IA 3ETGA 2CWDA 3OE5A 4BLVA 4NDZA 4RVFA 5L3SA 3F7TA 3IAUA 2OORA 4ZAZA 3FZQA 5HKLA 3GIRA 1DFIA 1NMQA 3PP8A 1E8NA 1K28D 1US8B 3QVGA 3UG6A 4DA7A 1B1AA 1TE2A 3NOVA 4PC1A 4KWEA 1E2MA 4OI0A 2V9PA 2BFCA 4EL5A 2FX3A 2P2GA 2YVKA 1IM5A 2WDPA 3ZWVA 4V0KA 1N7HA 2W2NA 5EQDA 2B1RA 2AOXA 4L4ZA 4KDRA 1JR3D 3W2HA 1SCUA 2ACWA 4Q4JB 3ON5A 3R20A 1QGZA 4XM2A 1DKPA 1AKQA 1GCIA 3S2EA 3HVJA 2VDJA 3MBIA 4GLLA 4I6EA 4RJJA 1CB0A 1VPLA 4IUDS 1SXPA 5BRAA 3LKVA 1WB9A 4BLWA 1R12A 1A96A 5IDQA 1IK4A 1SQ0A 5JQWA 2R8PA 2ZJ7A 1E5DA 5LB2A 1U8UA 4BBAA 5KYKA 3F73A 3CKYA 1VLMA 3B5IA 3R3YA 1HG1A 4LC9A 3AI1A 4HDOB 4N5LA 4ZDIA 2Q2QA 2ZE6A 4HDQB 4N39A 1AHIA 1Q82D 4O59O 4EHJA 1DIOB 1SPXA 2QI9F 3N39C 4RK1A 3PVCA 3OZ7A 3TRDA 3U3MA 4UTNA 2IPLA 3S1SA 5LQSA 2BKLA 2WYOA 1LJUA 4OQEA 3UJCA 4BFTA 3I55B 1WVMA 2PKWA 3F5SA 2EX4A 3WWEA 3FJYA 4IWYA 2CHQA 2C8LA 1NV9A 2R60A 1KIFA 2WF5A 3EXFA 1JF8A 3QLUC 4DCOA 3PQFA 3SZMA 3DNFA 1BCRA 4V1CA 2UYCA 2CV2A 3DA8A 2FW9A 5FOQA 3WICA 2PH7A 3VR4D 1QDEA 1JBEA 5SZJA 2NXJA 1RIIA 1OOEA 3EISA 4P7KA 2X8KA 1II9A 2EKPA 3ONEA 2ZT5A 4IMRA 4GOLD 3HSKA 5AW5A 1IATA 1WPXA 4NARA 4QG7A 1OYYA 1FNDA 4AU1A 3BMNA 3HFSA 3KPUA 4BO6A 1AQYA 1HEYA 1DEAA 1I7PA 4QUZA 4PTYA 3QELB 1NLUA 1P81A 4IYJA 4MDEA 1KDRA 5DLDA 4ZIRA 3VA7A 2BZSA 2RGWA 5FBLB 1QDUA 1JLHA 1MCZA 4HBZA 2J7PD 1K8XB 4OUDA 2YWJA 1V3QE 3IBCA 3KLPX 1F8YA 3V5NA 4Z7QB 1Q0TA 1DAEA 1OXUA 3Q6IA 1E4VA 3CUYA 1EHCA 2HYDA 2PX0A 3VVLA 2COKA 2H00A 1LA2A 1AK2A 4Y18A 5LDGA 2QTHA 4FOOA 1V0JA 2A1UA 3CF6R 4XTRA 2DTEA 3RSFA 3UAXA 1DXOA 2RGEA 3MQFA 1HF3A 1P5JA 4FGJA 2FAXA 4LRUA 3WKEA 2QL5A 4X61A 4MYDA 1WB6A 2FPIA 3E0QA 4B75A 4YUYA 3GWZA 3MS2A 1CUCA 3QK7A 4L75A 4Q15A 4Q9DA 4WOCA 2DUUA 4Q37A 1BH6A 4HE5A 1N2JA 1CU1A 4LE1A 3BXHA 2I8LA 3OFKA 5DCLA 4PQEA 2XMPA 3UUWA 1R6AA 1I33A 1VJSA 2IYRA 4L0CA 1J2YA 4XVCA 1ZKDA 3JSAA 1H3EA 1JHMA 4BWYA 4RLFA 4Q24A 2YWXA 4U8GA 4CN9A 5JZ9A 5AK4A 1H1DA 4HLCA 4KYTA 3RBXA 1FVHA 4NX2A 4YJFB 2CFSA 4Q03A 1M3SA 2PD4A 3B7WA 1KPHA 4MUFA 2C5HA 1D1NA 2FEKA 4JQYA 2VDUE 4ENTA 2GEUA 1GL6A 3EA4A 4X1KB 1E79D 1Z37A 2A3NA 4KAJA 3QBDA 2ZSKA 2VPIA 4H3VA 1KEPA 4M98A 4P54A 4PGFA 4Y98A 5DYGA 4QXRA 3WIEA 3FVQA 4EGAA 1SBQA 2CNOA 1JDJA 2E7ZA 2IU3A 3DUFB 2D5AA 1L5LA 2B5WA 2YHIB 1QZ3A 1EWQA 3PQ4A 4G4GA 4RHCA 4LFCB 4C14A 5HEKA 3JVDA 2EJBA 2J9GA 4TMWA 5EQFA 5A5GA 4X8MA 1VIDA 2BGRA 2E6KA 2X42A 4C7BA 5A5FA 4O4HA 5FNVB 3TMKA 1SHUX 2IYLD 1OLUB 2O3SA 3W3AH 4YQFA 1UKEA 4F9TA 4ZARA 2WTEA 1RZUA 2GPBA 3N2KB 1UBKS 2X77A 5E95A 2CXHA 1FP6A 4H7KA 5I4IA 4G1FA 3EXIA 4BASA 1OAAA 4L02A 4KLNA 5L51A 4ND8B 2JLVA 1TPZA 4NJEB 4UUNA 3EXHA 3C1OA 3RC3A 1X6VA 4QYTA 3LDAA 5K0CA 2HSGA 4Y2XA 3WMFA 4Q34A 4UCQA 5BWLA 5AKEA 3UJBA 1I1QB 3HNOA 3R9KA 3LUFA 5JSYA 3EC1A 3LKDA 5TXGA 3EPHA 3NKLA 4JVOA 2I7TA 3ZGLA 4BMPB 3B3QA 4WKNA 5TPWB 5FADA 1PFKA 3NXKA 2XUOA 4HWRA 1ONPA 1WPCA 2D0DA 3L1IA 2QRGA 2YNMD 4JBYA 3UA4A 4DIEA 4BQPA 3MMSA 2VQ6A 5EZ6B 1KP2A 4EZIA 2R7LA 4ZGBA 2RH9B 2XKBA 3TLYA 1TM7E 1YZYA 3PFWO 4DMMA 5AW0A 1Z2AA 4HFMA 1O94C 1RD4A 3MCZA 5CVUA 1IHPA 4RS3A 4G5QA 4NXMB 1WA5A 1XMJA 1Z2DA 1TA4A 3A7DA 3FVRA 4DNOA 1DMSA 1O03A 4G5GA 4PYLA 3I1IA 2VDWA 3K31A 2HMAA 2ZM5A 3HE3A 4HRYA 1P6QA 2R4TA 4WKOA 3GEGA 1ENZA 3B1JA 3LXMA 1A7AA 1KAGA 4XGIA 5CVEA 3BE8A 3HB5X 5L45A 2BIFA 1CPYA 3DVLA 4HMQA 4V38A 3AF2A 3SHFA 1MA3A 4ACAA 1C2TA 2C3MA 5C46F 5JSHA 4EB3A 1IRXA 3CF2A 3O3OB 2B20A 2I2XB 4ND8A 4BYMA 1KO1A 1ONOA 3EEYA 1DS6A 3QI7A 5J4KA 1OH6A 1IEQA 2XOKA 3VC1A 1NC3A 4E4YA 5CPBA 1ZIPA 3CM0A 1GEEA 1VE3A 1OAOA 3WR5A 4CR6A 5HUQA 1RYDA 2C83A 3DTVA 1IZ0A 4HAZA 3UHPA 4BGUA 5E2BA 3I1FA 1VMIA 3R9WA 1DADA 3VKGA 3DXZA 3PQ3A 5C0OE 1DG3A 2YUIA 5JMPA 3WK8A 2OHXA 5GVRA 3LRPA 1YA6A 1KEWA 2LUOA 3Q2KA 1KK3A 4JLAA 5AVVA 1MQSA 3EEFA 3WDSA 2PMBA 3B6IA 2C2BA 1O95A 4FYWA 4NFYA 3U0VA 1KWGA 3QX3A 5JD5A 3BGIA 1B42A 2W6OA 1S0UA 3PJGA 1JFSA 4L4UA 4LI3X 3HP1A 4B73A 4LFAB 4EUEA 2IHBA 2M1XA 1TIKA 1VYTA 1Y4ZA 4OM8A 4FR5A 4HUJA 4OGFA 1CFJA 4WFQA 3SJUA 5REQB 5IWCA 1JEEA 2V98A 3G9QA 1IXYA 1K7SN 3PQ2A 4DJTA 121PA 3S5UA 5CB4F 3UMMA 1KO7A 4LV8B 3JVUA 4TMFA 1QG4A 1S96A 3Q9SA 4PVDA 5ICFA 2HK8A 3R9XA 1IXKA 4QLBA 4R1SA 3LOUA 1GWNA 3NAQA 5JSQA 3H5IA 2ZSAA 2CVFA 2PVPA 4F38A 1T35A 2GBLC 2WTXA 2ZJBA 3EGIA 4RH1A 5DH9A 3HV2A 4IHJB 3RT1A 3SYTA 4BVLA 2O54A 4WPGA 1RI2A 4RD0A 2FPLA 3DO5A 3HKCB 3QNUA 3K0EA 5JRDS 1DQSA 3P0HA 1H66A 3G9XA 1DMRA 5EJ4A 4JOBA 2Q3EA 3FFTA 1RJEA 1U3GA 3QWIA 4S2EA 3NTQA 3CP8A 2Z5GA 4DYDA 2P5TB 5FTMA 5T64A 1K5PA 3IBSA 2X8JA 2IYFA 4MUEA 4U2KA 3RSZA 4ED9A 4CV2A 5BW8A 3MINA 1VQ1A 3IUBA 2FW1A 2QPTA 5IAGA 3HXMA 4CUKA 4GICA 2DQYA 5EC8A 4NH0A 2EEPA 1GNLA 4G2TA 4BGDA 5JY6A 3DE3X 1IQPA 2CVHA 3FNIA 2XMSA 1AT1A 2HEIA 5H3LA 3IUNA 2GKGA 5CURA 2JJ2A 2CXOA 1P9OA 3RIXA 2G67A 4TXHA 2H2AA 3WI7A 3ANYB 4XB2A 5ITVA 3O8BA 3D3EA 2VP4A 3USZA 3Q88A 3U4IA 4NCKA 2C7RA 3QVUA 2GZ3A 1I30A 4HPJB 3AUTA 2PLNA 1U0GA 1EJBA 3AONB 1N2OA 3KXPA 2BLLA 4H7HA 4LE0A 1G3QA 3PFBA 1R4AA 3U4MA 1ZGBA 1Y1LA 4U39A 5EHXA 5TY0A 2BWJA 2X86A 4CR7A 5CT5A 4RNCA 5K3SA 2YDXA 5JC1A 1EFVB 2K2WA 4UUMA 3HJGA 3WYFA 2XQVA 3VR4A 1NTRA 3F8SA 3X2SA 3Q4GA 3OZIA 3OPVA 3KOOA 4HN4B 4O4HB 3SX2A 3VRHA 2XGOA 1BN7A 2W9XA 4IVQA 1I24A 3UV3A 4LRSB 2QTTA 4U6NA 1HYHA 1WU7A 2X5XA 4ZA2A 5UKDA 4OVKA 4N54A 4ODIA 3W8NA 4RGVA 3FCXA 1J7KA 3BK2A 3FETA 3BFJA 1B0AA 2YWRA 1Y6FA 4CDNA 4F5ZA 5AW4A 4HADA 4TLBA 7REQB 5HOQA 3IEVA 5IEJA 1ZM3A 1YZLA 1G5FA 1NRXA 4KGVA 3L8ZA 2J3LA 4O4IB 3BSWA 4TWIA 3WB9A 2NOAA 3OWXA 4K40A 3TTXA 2CFIA 4E11A 1NSFA 2J7PA 2NU7A 2YVAA 3J7AC 1CBUA 1ZD1A 5HF5A 2HWYA 3LF2A 3WRYA 2HF9A 1POWA 2IHTA 1WUHS 1VJCA 4KR0A 1TDJA 2XH8A 3GRYA 4MXDA 1JQEA 5EKXA 2D3TA 3C39A 4XYGA 5BWOA 2KB0A 3FYUA 4AS3A 1PGOA 3WB0A 5JDIA 4E4RA 2OZLA 1HXHA 5IJ9B 3H5RA 4TL6A 1P5ZB 2BFBB 4FBGA 3OW7A 1W5EA 4B3CA 1SUBA 4NRDA 3SC2A 5C5IA 1H1LA 3KSZO 2R8RA 4BCDA 1D2GA 4LVNA 1X3SA 1US8A 1Z12A 3KZ1E 3QVGB 4QAJA 1ZUWA 4X6UA 3LPDA 1QFJA 1L8LA 1QGAA 1ZN8A 1IUPA 3G8BA 5MN6A 4EG3A 3EHEA 1KEEB 1L5HA 2FWMX 3HMKA 3WNQA 4XX0A 3D8TA 4DRXA 3AY7A 2F3SA 2Q6KA 2Y4OA 2RH5A 3CU5A 3ZLUA 1BHSA 4PC3A 2YCBA 1Q0LA 5EKSA 3OZBA 3HYLA 4QTXA 3FKJA 1U3DA 5D5HA 2P9GA 4HX2A 1VMAA 4EO4A 1QGOA 4K9QA 3K6JA 3DFUA 1G21A 5T4FA 3H0CA 1S9DA 3OUZA 4RMHA 2H31A 1KMHA 2V4MA 4RDJA 2GT1A 2R85A 2WR8A 1O5OA 1WD7A 2OO5C 2PGDA 4OQQA 5JWHA 2Z3VA 3WGYA 2FF7A 4WNIA 2A2ZA 4DSAA 3NUQA 3BH0A 2OBTA 1NLZA 1KZ6A 1SBIA 3A06A 1NOKA 1PJSA 2IDJA 3B7PA 1JKXA 3UJ8A 4DDKA 1O6CA 3ZY6A 4GU5A 1M7BA 4AZ3A 2AQHA 1YBAA 2AX4A 3E5HA 1MEJA 4NJMA 4AJKA 4GSYA 2ZUVA 2Y2UA 4QDZA 1Y42X 2IF2A 4ZXFA 5K0NA 5JSZA 3A2KA 2ZWMA 1Y7LA 2GAJA 1JH8A 2Q4EA 3WGIA 4Y30A 4GW3A 2KS6A 1M1YA 2BGUA 2BFWA 4Q47A 2SNIE 1QSGA 1CZKA 4MMXB 2XWJI 4U1RA 1H2HA 3EDOA 1IULA 2ODAA 2XAUA 2UKDA 5A7HA 4Z7OB 1WXXA 4MLPA 3O26A 4FFMA 1XCOA 3QU9A 3L04A 2ZSBA 3T9EA 1QB7A 4QTZA 1Z2PX 1LV7A 4X97A 2W6JD 4LWZA 1EGQA 2WU3A 1M2VA 4JEMA 3PC6A 4XFKA 3G2LA 3RRZA 3RTEA 5GIPE 3KG2A 1O94D 2RONA 3AVYA 1UBNA 2YXDA 2DCUA 4C3ZA 1C0EA 5CHYA 2RGAA 3M33A 3WNCA 4JI0B 3STTA 1WEHA 4LY9A 3KOXA 4HLNA 4IF4A 4LKRA 3TIVA 3NAMA 1THZA 1UKBA 3ED5A 1TA9A 1K8AD 4FEAA 4ZOAA 6PFKA 5FT9A 4XWWA 4A92A 4RKFA 3RUPA 3FZNA 4NC9A 1AUVA 2E55A 3ACDA 3GELA 4QXAA 3WKCA 1C1YA 1R9MA 2V6FA 2ZIAA 1M72A 2BISA 3BIOA 3L9WA 2I54A 1XU9A 2RJOA 1X1RA 3EWIA 3CIFA 3EEBA 4IILA 1JG7A 3QKSA 2VF8A 5AP9A 3IQWA 2DJIA 4RSHA 2F1LA 3LUCA 1B73A 1O9BA 4O2RA 3V3KA 3KEFA 5C8VA 1AG9A 5GZ3A 1VSUA 4JMQA 4MUBA 1VBMA 1Z3IX 3D81A 3QLVC 1VKRA 2QG9A 1S2IA 3TL6A 4I66A 4HDNB 3C7KA 1H0KA 1TPYA 2VYCA 1UT8A 3E5MA 1X38A 3L6OO 4WLOA 3RS3A 3X1MA 1MRZA 1PDVA 1JLKA 1XIVA 4I1SA 1WBBA 3MTQA 4N3NA 5TX7A 4MKZA 1RHQA 1ECJA 3KSUA 1P1JA 3COPA 3KLBA 5TR9A 1TYCA 2BFEA 2O4UX 1O95D 1HYEA 3G02A 1Q1NA 2EIHA 4MKGA 5TJ9A 2G9QA 2H4FA 3FLAA 4OFZA 5I7OA 3K6SB 2XCTB 1PE0A 1SN7A 3GP5A 3D7MA 3K9HA 2SICE 3N59A 1MH1A 2LIVA 4TM8A 2ODEA 3GROA 3NASA 4WHMA 1U0TA 3DPIA 4HNSA 3WJ2A 2GJKA 1XRSB 2IUTA 4KGDA 4R84A 3AEKA 1XEXA 3SR0A 4R3NA 1NXXA 1FNBA 2BHNA 2IRWA 3GSIA 3HGQA 4I1VA 3RC7A 2Y0EA 3SNHA 1QIFA 4KZKA 3JQGA 4Z4QA 2HA7A 2ZYIA 1KI8A 1U9IC 1JYEA 1S1MA 1NY5A 1UC9A 4RH3A 1PLKA 1SEPA 2A5FA 1K7FB 2BH9A 2Q50A 4WN9A 1T8UA 3M1AA 4OQYA 4P83A 5BWCA 3LPCA 5CLGA 4EHBA 3FSJX 4JSTA 5BUCA 2NV0A 3K09C 4TWBA 2D0OB 4FE3A 1O7JA 1FP2A 2PT7A 2QTMA 5NLLA 2V54A 4ROSA 4JD5A 2JIBA 3HNRA 1W9MA 2FJUA 2P3OA 4L9AA 4M0FA 3TXAA 1P2UA 1RZVA 3VM6A 2WA1A 1DRUA 5BNFA 3BE5A 1QO0A 3C0KA 3ND7A 3NIWA 5E3JA 4IIUA 3AY3A 4E2ZA 5J47A 1P4GA 5E6SB 4IJVA 2Z98A 1FPQA 3IDFA 3G0IA 3H5TA 5JBIA 3ZWDA 2BAGA 3NZEA 4C7MA 3SLNA 1QWSA 4P22A 3WXMA 3G1TA 1FMJA 2Q62A 3TKYA 1L5HB 1RVDA 2JFHA 3TE6A 2DVMA 2WSYB 4IQGA 3SF8B 1N5KA 2A9KA 1OKKD 3L02A 2VDKB 1B16A 2P7IA 2EX0A 2X8WA 1J70A 1TZMA 4DV2B 5JDIC 4KQMA 1ZIDA 3A3NA 3MRSA 4KWTA 1DRKA 3HXOA 2XUHA 4MRSA 3O8OA 1QOQB 1UMDA 3N8DA 3B9RA 5L95A 4FQ5A 4JK3A 2ZPTX 1Z5NA 5K4HA 1MMFB 2ZXUA 2OESA 3RADC 5EQTA 1UWKA 1UK7A 2I99A 4GDMA 1UT5A 3X2EA 1XF1A 4D8TA 1WTHD 2Y6UA 3JXEA 2EBWA 3LT1A 4KQGA 3FROA 2IPOA 1A9OA 2PKYX 3ZNQA 4DEVA 2DUWA 4WOBA 2ZQ5A 1M74A 3NATA 3ITDA 5KHOC 2CLMB 4AC9A 1Q16A 4RPJA 1Q0ZA 5FWDA 2W6ZA 4C07A 4CF4A 2R1TA 3KSBC 1I7DA 2UYHA 4P86A 3PHHA 2G5TA 4G7WA 4R6XA 2G1JA 4NSNA 3Q98A 1HI9A 4RZHA 4TVSA 4TKZA 4DR3B 3KO8A 5EYPA 3EGVA 1IHUA 4Y9SA 4PAAA 1JEJA 3L46A 5JT1A 3EG9B 4MR7B 4EGQA 1CVLA 4MW6A 2ZDGA 5F2EA 3IDSA 4ADSG 3RK4A 2Z04A 4EMBA 4XCVA 1KYIA 3TZKA 3KM0A 2H07A 3BD9A 4M0PA 2W2KB 3CVUA 2X14A 1HE8B 1ZI6A 1V9LA 2HSEA 3GVXA 4TS3A 3N7TA 3RF7A 1VJDA 4D3SA 4ON9A 2Z2IA 4BJHB 5KKAA 4HDKB 2DIEA 5J2TF 3U7QA 4YC7A 2FN4A 4KXXA 1KGSA 2I2AA 3CVVA 1JVBA 1MABA 4GRDA 2CMFA 3UOGA 4QFBA 4TT8A 2HRZA 4M9SA 4WCFB 3EW9A 3Q3HA 1GV0A 1ZK1A 4QICA 3X1JA 2GB4A 4AP6A 4MR8A 4BP3A 3U44A 4EY4A 1M2GA 1T5DX 1QVGB 2G25A 4GLBA 1WSBA 2A1TS 2O5CA 1RYYA 5DM0A 3KZOA 2GCEA 4XLAA 2B8NA 4X6YA 3H9JA 4PQRA 1S4QA 4TMTA 2AA3A 2JIQA 2V6MA 3A31A 4XASA 2OV4A 1QMPA 3MHPA 1IN1A 3NCHA 4CMBA 1T4BA 3LUHA 3V6MA 4EHAA 2HC9A 4D9NA 1PQUA 1YO6A 4XKWA 1N5IA 3B38A 1C4WA 3I09A 3KOWA 5BPFA 3HJTA 1G8HA 2WF7A 2XB8A 1DIRA 1EAYA 3L79A 4F84A 5GONB 5A7GA 3IV9A 5F73A 4TYWA 4G2NA 1A2OA 4NPAA 3SBXA 1S01A 3S0JA 2TMKA 4UBJA 2BL4A 4YV2A 2OZVA 3EGDA 4NMMA 3K6SA 2BMFA 4L27A 2V7WA 1UBSB 2BCJQ 1WM1A 3N9IA 4L85A 2IV3A 1CY7A 2IEYA 2IP2A 2OB2A 3EFBA 4EFLA 2E2WA 3VPSA 2HNKA 2E48A 2XW6A 3PC7A 4TS9A 4BTLA 5THKA 1DWOA 5I9BA 3K0KA 2QQEA 4G9GA 3HR8A 4MPDA 3IR6A 4L4YA 4WERA 3S1AA 4CGYA 4XB1A 2CHEA 2WHQA 1PTKA 3M5WA 3Q5DA 1B6GA 2W2LD 3OKPA 2JFNA 4PYOA 1VI6A 1E2KA 3SR4A 3T5CA 1ID8A 1GAXA 1Z82A 1Z5GA 3JWGA 3CGWA 4S1OA 4A10A 1ZCZA 3T3NA 3KXDA 3EQ6A 3S2ZA 4B5LA 3PZRA 1LBQA 1QIJA 5FBRB 1ORVA 2VUTA 5IH3A 3TZBA 3ZWYA 4AQ7A 5HKOA 2ZYAA 2Q4TA 2FUKA 5CEJA 4EYOA 4XZ3A 1XALA 1HLGA 2HLNA 3DP9A 1U2TA 3SI7A 1X1AA 3DVAB 3Q1LA 4CVNA 3A6GA 4KYUA 1D3AA 4DHWA 5I4BA 3N2LA 1SKYE 2IUSA 3PX2A 2B3TA 2VHVA 4W9NC 1VA5A 1C30A 4HNAA 5LNK1 4OMDA 1KNQA 2WLSA 2G07A 2WD7B 4DDTA 4A8TA 2IC5A 3G7UA 4KQXA 5IUKC 2HQ1A 4MR9B 1PWXA 1FFSA 4M1TA 5AK3A 3G2QA 5TPZA 2WFZA 2YFYA 3BFKA 2PV7A 3AI7A 4LW8A 2AJDA 4C7VA 2BE9A 5KEIA 3EZFA 1CRWG 2CUKA 1QVWA 1U0BB 3I5XA 5K3AA 5BR4A 4CM8A 2FWBA 4TTSA 5I7AA 2ZT8A 2Y66A 3GZNB 3DXFA 1OI3A 4FYXA 1O0BA 3E0XA 2A33A 4UAVA 1NBIA 1F8XA 1T10A 3JQEA 4RUKA 1LLUA 1QRRA 4QARA 1O0CA 1A98A 5AESA 4IOJA 1CQXA 3NBZC 2ZUTA 1E3LA 2QUKA 2FPMA 1CF9A 1NBMA 1U9IA 1VE5A 2B9VA 2CEKA 5HF9A 5LBIA 4HATA 5B6PA 3T94A 2XOKD 1BGVA 2J0UB 2FEMA 1SFRA 2BOVA 4K6CA 4E1BA 2EW1A 5KMGB 1R8JA 1KEVA 3T4PA 4BN4A 2JFVA 5CG1A 5IVKA 1R1DA 1XMSA 1K2VN 4A91A 1Z28A 5D3QA 5JO9A 3FUTA 5E9JA 1JYSA 3QW4B 3HCBA 4FHGA 3TXYA 2P6PA 4R1QA 4KO4S 3O4FA 2O19A 2QV7A 1YBVA 2QROA 4JMPA 4O4LB 4XI9A 4JUFA 2YRWA 1Y7HA 1E7MA 1QRUA 1YZUA 3CD6B 1LZKA 4N1AA 3TNDA 4AKEA 3FBTA 1YE3A 3IJPA 2BT4A 2HIMA 4FXUA 2GQ0A 3AOGA 1EFUA 1E3TA 2AUNA 2E4UA 5B12A 1EGMB 4S04A 2WNSA 3AB8A 5KPJA 3LWDA 5DBHX 3TIXB 3Q9LA 3ZI7A 4BQEA 2FDCA 1V8DA 4IW3B 3QXHA 1HSOA 4GZ3A 3T3MB 4D56A 1LY1A 1MFZA 3JD0A 3SDZA 1KSFX 4HAUA 1FS5A 1ODLA 2EW2A 1GLNA 3I1JA 3GT4A 4GKVA 4P6VF 3PDJA 4JL6A 3V9AA 1TM3E 1QFMA 3ZU6A 2B25A 1J8YF 5ILOA 1ZH2A 1FFGA 2LWIA 3QKUA 1Y0YA 4KVZA 3OEHD 5I51A 2INGX 3LCRA 4FNOA 4I3FA 3C70A 1L5SA 1DUVG 4NENA 5DT9A 1D1PA 4F21A 1GPDG 1L5VA 5JS8A 3G79A 2O6HA 4XAQA 1H6DA 1TYBE 3B1XA 3KSAC 2PJUA 1TLFA 2XJ4A 4GG1A 1IBCA 2OMEA 4QATA 1PQWA 4NJOA 4PHHA 5SY9A 4ASUD 4C4PA 4OHOA 6AT1A 3UJDA 4U02A 4RXUA 5DNWA 3HJFA 2EF0A 1JSXA 5IAKA 3OU2A 3HL0A 1VE6A 3FYUB 1RFGE 3EQ9A 1AD2A 1GL9B 1FRZA 2I22A 3LVRE 4FYJA 5DMHA 1UEIA 3OM8A 4G4SO 3Q6QA 2Q07A 4YJFA 4BO5A 5L3ZA 3KELA 3AT1A 3R3ZA 3X3HA 5BN3A 1WPRA 2C9MA 1R3DA 3GLHA 3K9WA 5ENZA 3TLJA 3LPLA 4US2R 3H4IA 1NJ2A 3F78A 3NUZA 3UB2A 3WGKA 1SXJE 3RSHA 3E22A 3QUBA 4EUKA 4QV2A 4J0IA 4OP7A 1WXIA 5A9TA 1M7HA 3EIQA 5G4LA 3T7CA 1CULC 3N7UA 5FRDA 1VSQA 5TQ2B 2DOGA 3ZBUA 3I01A 3KB1A 4DMFA 2C2YA 1ETHA 4FSXA 1D8TA 3VU9A 3CO0S 3N0TA 2AEMA 4UBMA 4HDMA 4M9XA 4L8FA 1A4UA 1ZJYA 2NYAA 3U0BA 3AVXA 2RHRA 2BFOA 2JAXA 2GS9A 4NU8X 5AT1A 4RF2A 1C9NA 4EAAA 2ZI6A 1QQAA 1KI7A 1Q0HA 5EIXA 1VCHA 3A58B 5EI5A 2O3RA 3ROGA 1T9ZA 1TQ6A 3F2VA 3LC7O 1GFIA 1NM5A 3M5PA 4AYWA 1W94A 1GDHA 1QVAA 2AN9A 1H22A 2R2GA 3FPAA 1F17A 1GKLA 1M34B 5A0FA 3PD7A 5EJ7A 3S3TA 4E6PA 3FTEA 1B3BA 1RYHA 2GEKA 5JXIA 5CDSA 1T25A 4LJ6A 1DKQA 5LBUA 1NUTA 2MJLA 2J3QA 3CJQA 4V0NA 2CVZA 4C30A 3T0GA 2CDCA 3EIOA 2D7CA 3GF4A 2X1VA 1K8QA 3KEWA 2PLFA 2B37A 2ORWA 4GZMA 4IICA 2D6FA 2PYZA 2OR3A 3BWYA 3VU3A 5JYDA 1UJ6A 4UPVA 2QS9A 4RTKA 5DEOA 4CMIA 3NPAA 4O4HF 1I6LA 2EBHX 2XMCA 1QE3A 4BDSA 1F4PA 1NFRA 3IKMB 3KEQA 3VV2A 4LBWA 1GZ6A 3N1UA 1V7PC 1L5KA 4C43A 3RAGA 1N5RA 4IAOA 2A0YA 3D1VA 4U0KA 1XVUA 3CNLA 5JOQA 5AMXA 3OQHA 1XRPA 2D1SA 1X70A 4LZLA 4CT5A 1SUSA 5SYAA 5FDFA 4C3VA 3BNWA 1FJXA 1Y9DA 1VYVA 3RSLA 3I42A 3JQDA 2I6XA 3NORA 4IL5A 1RHJA 3TOVA 4IJQA 4Q9AA 1PKVA 2WYHA 5HE9A 5JW6A 4W9NA 2TSYB 2W6PA 2VSQA 3SZOA 4OFWA 1M54A 2Y1FA 1D2EA 3T56B 3DVQX 5EXPA 3DMFA 1DAPA