4RD4A

Structure of aif2 gamma from sulfolobus solfataricus bound to gdpnp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
413
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 109
structure length 413
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd4A01
1KMHA 4R2IA 3AUYA 1MO4A 2C9CA 2F43A 1GITA 1EFUA 2AWOA 1OH7A 1YHNA 3N70A 3AP2A 5K8TA 4IW3B 2DERA 2Q21A 5GADl 2JLUA 1KNXA 2PT5A 2GEUA 2MSEB 4CT5A 3EASA 2BCGY 4P4TA 3ZBTA 1NY5A 2F55A 2QAJA 3G82C 3HR8A 3GFOA 3CWQA 1HA3A 1Q57A 2CE2X 1DDIA 4PAOA 1T6NA 2QG6A 3ZH9B 4LGMA 1QFZA 2KSQA 4CVNA 2BVNA 3PJRA 1SXJD 3P4XA 4Q47A 3MWKA 4HDOB 2IXFA 2WKQA 2PZEA 3JZMA 3A8TA 5CDFA 1ZM2A 1KI7A 1VG1A 2HF8A 3GEEA 3I73A 1Q21A 4W5JA 2IW3A 2VYQA 5C18A 1YE8A 3NWJA 2GHIA 2FPLA 1NBMA 3K0FA 1KKLA 4DEYA 1JA1A 2A78A 3FJOA 1SVKA 2B92A 3R9WA 821PA 3BAFA 1AIPA 1DAEA 1L2TA 3NBYC 2P2LA 1Q7YD 5AJZA 2KJQA 3ZIAA 3SBEA 3R7WA 3LD9A 3K70D 5KO2A 1YZNA 2QAGA 5FL7A 1JALA 3NC1C 3E20A 1GR1A 1Z6AA 1XPRA 1JNYA 4F4JA 1JQLB 2W0MA 2WKPA 3BB4A 5GJCA 4XVUA 1FL9A 2ZRKA 2QTZA 1S1MA 1UF9A 5DHAA 3KXKA 4M1SA 4QGHA 3BBPA 1OPXA 1KAOA 3MG9A 1KK1A 2MMCA 1FP7A 3LX8A 1A4RA 2ASEA 2JLYA 1ZP6A 3ECCA 1IN8A 1G8PA 2ZE6A 5FTJA 3WYGA 1QDEA 3SJCA 1XU4A 1L8QA 1MT0A 2GVZC 2DEUA 3W6OA 4BEJA 4RCZA 1Y3AA 4GP7A 1SXJC 5DIFA 2WAYA 2LKCA 3AKYA 4DWJA 1Z28A 3CF0A 3RC3A 1S2MA 2ZROA 3SNHA 1VIAA 4U9UA 4M1OA 2XOKD 2P5SA 5EJEA 4MGZR 3VAAA 1GAQA 1N6OA 2BBOA 3CF2A 3QXJA 3QXXA 4HZIA 4IDNA 3IEUA 2PEZA 2ZRPA 4US2R 2E1RA 1N25A 4D4JA 3KQLA 2JLWA 1KZ7B 1Z06A 5TV2A 3W2HA 4I1UA 3MRSA 4LHVA 2JLSA 2P67A 2V55B 2AHOA 3PXGA 1K5GA 1NRJB 3AKDA 2QL6A 2R9VA 3X1XA 4ERNA 3QFTA 1D9ZA 3K70C 3THXB 3C41J 1G7TA 3FMFA 3KL4A 4HAVA 4HUQB 2X77A 2KWIA 4RKFA 2HT6A 3QENA 2Q3HA 1NLYA 2IS4A 3IIJA 4XWAA 2GXQA 2J41A 3ZD6A 3RRYA 1XPOA 4JBWA 4E09A 1G7SA 4CEIA 2ZU0C 4CEJB 3TVTA 1TEVA 1MH1A 2BOVA 2BN4A 2BKEA 2F9LA 1DAHA 4QNMA 4BFVA 1G8YA 1U8ZA 4B75A 4PC6A 1RIFA 3EPHA 4Q7JB 1GNQA 1SVWA 1UBCA 2WMOB 4DB4A 3LXRA 3NVAA 2GCPA 2PCJA 4JL6A 2GAAA 3LVBA 1XZQA 4ITRC 4W9MC 5C4GB 4A0RA 4US0R 5EQTA 3WMGA 1W34A 2WAXA 1QFJA 2C04A 2KB0A 2ZS8A 4Z8XA 4EPRA 1R0XA 1YJ5A 1CS4C 3FMIA 5K8UA 3KDSE 1XCGB 3GJ5A 4IVRA 3W2FA 3KTAA 4JSTA 3WMEA 4M9XA 2JGNA 3C14C 4OYHA 2J0UB 1VIYA 1FW6A 4OK3A 3TRFA 1IB0A 3L8ZA 2NGRA 2GXAA 1TAGA 2E87A 2LCFA 2REXB 5L3SA 3UPUA 1OXSC 3A1SA 4QRHA 4A92A 2H18A 2G83A 3BRWD 1YJWB 5FPSA 1YJNB 3JQPA 2X1VA 3CH4B 3LLMA 5GV7A 2QTFA 4TT3D 1IJEA 1W4CA 4QJ5A 4KFTA 3CC7B 3A1UA 1JB1A 2XZOA 1IY2A 3GJ0A 3BWDD 2GCNA 1SVLA 1E1QD 1Q3TA 4KBGA 1VMAA 2B7BA 2IF2A 2WIBA 3MJHA 4E22A 4NONA 1DO0A 3BXZA 1I4LD 3T06B 2DWOA 4KYUA 1J9ZA 3MFYA 3EPJA 4ZDKA 4Q7MB 3QE0A 3CPWB 3FYHA 3K9NA 4BRWA 1TPZA 4F4CA 1HH4A 2WWWA 1W47A 4FCTA 4HB4A 2FOLA 4IXNA 2LKDA 1W0KA 4L9SA 1EFRD 4HAZA 4BPRA 1DVRA 3OE7D 4II7A 3CW2A 2BF4A 4B33A 3AVWA 2VHJA 2NO1A 1KRHA 1RRPA 5JLJA 1IM2A 3W5HA 2IXGA 1PLKA 3VX3A 4DT1B 4PSAA 3MWYW 1W5SA 2GJ8A 1YRBA 4NP6A 3U6BA 3B5JA 4CEIB 3TUIC 4Q1AA 3TGPA 2OFWA 1KD1D 2FWRA 3MCAA 1H8EA 2RGAA 1AMOA 1U9IA 1QFYA 2P0EA 3LNCA 3KKQA 3QFRA 5DI9A 5B57C 1OHHD 4Q1DA 3D6TB 4MGIR 3G5UA 4N3GA 5IK2A 4A15A 1OH5A 5FTLA 1PJRA 3PEYA 5CLQA 3EWAA 5HXBA 3T1QA 4DLRA 4LYAA 3W2GA 4MYCA 1LS6A 1Z6TA 3OIWA 2PMKA 4V0MA 5EXXA 1KJYA 4TZ6A 2O8BB 4K81B 4CZ2A 4A9AA 2G6BA 1J70A 1QH0A 4WVFA 2VQSA 4KXFB 1AA9A 1R10A 4OI1A 3UG6A 3V9PA 1G16A 4S35A 1E2FA 1ZNYA 2CHVA 4ZGNB 1FQKA 2ZUDA 4LJAA 3NDBB 5CB8A 1NVVQ 4Q02A 2J45A 3IHLA 3KJHA 5DH9A 1FNBA 1SM4A 5AUQA 2Z5FA 1P75A 3NTUA 3IIKA 4LBVA 2R8RA 2DPXA 1NN1A 2B8TA 2ZSDA 5DYIA 1M7HA 1SZPA 3TK1A 4GZLA 3SC3A 1T8UA 1U94A 2P6NA 2V54A 2JIZD 3CNNA 1W36D 1ZM4A 1E98A 2C9YA 3G6EB 1G8FA 1HE8B 4MRPA 4Q01A 1TF7A 2IUTA 4AK9A 3WYFA 4DDWA 4FMCB 1ANKA 2QMHA 3SJAA 3L2OB 3OZVA 1SXJB 1G3MA 4EJSC 2BPOA 4TQ9A 4Q1FA 2OLJA 3UIEA 3AVUA 1N6PA 4FMDF 1KO1A 4JKIA 3AEZA 3GP8A 5DI3A 1WBDA 2WWYA 5EZ6B 2RCNA 3M6AA 4TMTA 3VO2A 3VKWA 4BE7B 5EP3A 1W46A 3RS0A 4UJ5A 4ZV4A 4OQFA 4B6EA 2CRVA 2DYKA 4KFRA 1G8HA 1QGZA 3K9GA 1NBMD 3K70B 1UBGA 5C1BA 1XF9A 3FGNA 1Q3HA 2CLCX 5GJWC 5JBQA 4Q7KA 2BJVA 4A0GA 4PZZA 1BS1A 4AYXA 2DFKB 3W6PA 3KKMA 2QGNA 2F3TA 4WZBE 5FUXA 3VTKA 3GFPA 2YC2C 1C9KA 4HB2A 2BEKA 3ZIAD 2AFIE 121PA 4D81A 3LW8A 1NJGA 3CC2B 2ZI9A 1SVMA 4UAJA 2IXEA 2ZVQX 1FFHA 5FL7D 2QA4B 5KNDA 2HDNB 1NSFA 2WMNB 3T1OA 4GI7A 1KO8A 4ASUD 2PBRA 4JVSB 4PPQA 1W36C 2G0TA 2ZJ8A 2FFBA 4L8GA 4PAQA 4P0TA 1ZYUA 3NIBA 2VP0A 4RZ3A 1R0YA 4DC9A 3RRZA 2GEDA 1YJ9B 4HB0A 4HB3A 4F7WA 2P6RA 3KQHA 1KZGB 1P2UA 1P9WA 1W2HA 4BLQA 5ELXA 2QE7A 2RH5A 4B32A 2EWWA 3QY0A 2QQEA 2FGKA 4POAA 3LVQE 1NMZA 1QG2A 1K9MD 2OCBA 4EH1A 4Z1MA 1YIJB 5AUOB 4I4LA 4OHZA 3CPHA 2J9RA 1HURA 4I1VA 3M4YA 1OT3A 2VSXA 1QX4A 2RGCA 3TW8B 3LBNA 2CVHA 4TN1A 3NKVA 1MR3F 5JRJA 3WBKA 2I3BA 1M1YE 1UKYA 3CR7A 4WW0A 1D9XA 5L8VA 2B21A 3CWZA 1LW7A 2ZANA 3E2IA 3EIHA 3TUJC 3I3SR 1QHYA 2QAGC 4OQXA 1TF2A 4TL9A 5AJVB 3LXXA 2W00A 1KI3A 2ZR0A 1CR0A 4EDHA 1II0A 2AD1A 1AKYA 2J0SA 3P1JA 5JEDA 4DDVA 1SULA 3FTQA 2P3SA 2DY1A 1YRAA 1CQXA 1MRSA 4JT4A 5DE3A 5E3HA 2PJRA 1E0JA 3GD7A 3FWYA 3SJZA 3D31A 4YDHB 2FSGA 4ZDWA 1EWYA 3CB4A 4UXIA 1F3OA 1XD8A 2Z4SA 4DCUA 2D7DA 5JCZA 3T15A 4YMTA 2Q9BA 4OHYA 1Z0KA 1ZW6A 4PPNA 4XSGA 5J4HA 1KGDA 2IA5A 3W3AA 4Q1CA 2XZLA 1G6HA 2JJ1D 4QOSA 4XH9B 1GJRA 4QBGB 4EPXA 2A5YB 1NNEA 3NG1A 1Q20A 3L82B 2F1HA 3THXA 1IXZA 5HZHA 3P26A 3WXMA 2IHYA 1YZLA 1VCOA 2OCAA 2IWRA 3CX8A 5JJKA 2QENA 4BFSA 2HF9A 1TVCA 1MO3A 2AWNA 4N0EA 2OTJB 2IYTA 4BPBA 2ATVA 4JKYA 4F4IA 3AVYA 4C0LA 3CX6A 1KTVA 2ZJBA 1KK3A 2QEXB 2J59A 2EW1A 2P65A 3D7MA 1TADA 1XD9A 2MSDB 4ZCMA 3IQXA 3K53A 1TF5A 4U5XA 2WV9A 4CEHB 4V0LA 4YQFA 3T34A 1FRNA 1VQMB 2N46A 1JXMA 3EW9A 1KI8A 1UKZA 3QG5A 1J8MF 4DLUA 2ZI3A 3B1XA 4IDOA 3QVUA 4QXAA 3RS2A 4Z54A 4C7OB 3X1DA 1EWRA 1Z8FA 4QM7A 4BFYA 5KTYA 1PZNA 4HDCA 3CONA 4L9WA 3EA5A 2QTVB 2NPFA 5EE9A 3ZGXA 1QHSA 4MUAA 1G41A 2WSSA 4EPVA 2V1UA 3IBGA 1ZVQA 3HJNA 3MHPA 5KOYA 1CF4A 4B3BA 2GDJA 4LPKA 5J4KA 3PV0A 4XOIA 1JQJC 1KIMA 3C15C 4EUNA 2O5VA 2VRWA 5BWMA 1E9DA 2E9SA 5KDOA 3KB2A 4IDQA 1XXHA 4P33A 2J7PA 4XVRA 3AV0B 4MRNA 4QG7A 3K09A 3GLFA 1AS2A 3M0EA 4FCWA 4A4DA 4DKXA 2G0NA 4YLGA 5LD2B 1F2TB 1NSTA 2XXAB 2WZQA 2Q9CA 3BFVA 3ZS8A 2VP5A 3OF5A 2GXUA 3X1ZA 5P21A 3OAAD 2FF7A 2OCYC 4LY6A 1EESA 3I62A 2O8EA 2Z0MA 4U7DA 4A6PA 3EZ2A 1M1KD 2AL7A 3ETLA 3T61A 2PMDA 3PCRB 3NBZC 5FFMA 1GNRA 4F92B 4IHQA 3BB1A 2GCOA 4EJSB 4N3NA 3UKDA 1CEEA 3FFBA 3R8CA 2ZRMA 4TTPA 2CJWA 1H8ED 4OK5A 1EP1B 3THWA 3W5VA 1ESMA 2J87A 1TU3A 2QSYA 3EG5A 2DB3A 1VTKA 3PIRA 4TMXA 5JSZA 5FOTA 1GVHA 1XJ0A 2ONKA 1JR3A 3JZAA 1X1RA 5IK2D 1IN5A 5KNCA 4W7SA 2EFDB 2WJYA 4Y7CA 3C7KA 1JPJA 1RYHA 1AZSC 1ZIOA 3CCLB 1N8RD 3CIOA 1UPTA 3HPRA 4Q4AA 5J40A 3RABA 3IILA 1NG9A 3BH0A 2ODEA 2Q6TA 1OJLA 4LZZA 4DDTA 3AUXA 2H8KA 4RSGA 1KK0A 2RGEA 1QHXA 1HT1E 3BK7A 4OI4A 3CPEA 2QPOA 3AF4A 5FOSA 3V00A 1SQ5A 2WSMA 3FMOB 2QORA 3MAAC 4RD4A 4JL5A 1G64A 1WRBA 4IKEA 4TLCA 3A6PC 2V7QD 4DUGA 4Q9HA 2GXSA 2ZI4A 1ZIPA 1GKIA 1XEXA 2QMOA 3NBXX 4OHXA 1Q86D 2F6RA 4PC1A 4HLUA 3VKHA 4QKQA 4NBSA 2QROA 4PO9A 1BMFA 5HKKA 2VHUA 1UBEA 3GLHA 4F91B 4AYWA 1W36B 1S9HA 2ORWA 4P32A 3FHOA 5EP1A 2BMWA 2H17A 1N0UA 4DIEA 2ZYUX 4AKHA 4OI2A 5FPKA 1TLLA 1U9IC 4P4SA 4NCJA 1I4DD 2C9OA 2GESA 4M2LA 2OTLB 5EXTA 3CCEB 2YINC 1FTNA 3RSLA 1AS3A 4JZKA 5FBLB 1E9BA 1HQYE 1YI2B 3ASYA 4PQYA 1KDPA 3K9HA 4M0LA 3FE2A 3UG7A 1QHHA 2PIAA 2EVWX 4HUTA 3W34A 3CD6B 1XJQA 3B8HA 2ZE7A 3U44B 1VQ6B 1NKSA 3FHCB 1KY3A 1OW3B 2ZQ5A 4TZ0A 1W0JA 3LDAA 1VG0B 4FINA 4QGFA 4XJXA 3UMFA 4BZQA 2OCPA 5FPYA 1OB2A 1ZNZA 4D4KA 3PR1A 2UVQA 5KYKA 3T12A 1CIPA 1CRPA 4W5HA 1T0JB 2JLQA 2ZJZA 3ZVRA 1NMYA 1Q22A 1Z6XA 2WWHA 4UNSA 5EUMA 1RW4A 5AR1A 4B48A 1T3LA 2WTUA 2UKDA 4UNNA 1QF9A 3CRZA 1XCMA 4C9BA 2ZR9A 5J4LA 3W6NA 5KPDA 4YALA 1Z47A 2WJGA 4GOXA 1P4SA 2O8DA 5CIWA 1E0SA 2I1VB 1OE0A 3LW7A 2XNJA 2D3WA 1II9A 5JJLA 5TR9A 3W5JA 4EQ6A 2KE5A 4ZO4A 1UJ2A 2B6HA 2VBCA 2IS6A 3CM0A 4AI6A 4B43A 2D62A 2PLRA 3CNOA 4D4MA 1A2BA 3LA6A 5FOWA 4MKFA 2O8FA 1ZBDA 2QQ0A 3W5IA 2WWXA 1E9FA 2ZRBA 1II8B 1T5IA 4NCNA 1KYIA 2ONJA 1OGJA 3S1AB 2QE7D 5L3QA 4V0OA 2BM0A 3LO8A 4I1OA 3GJ4A 4RD0A 1GG2A 2QI9C 2WOJA 5E7MA 2VP2A 4Z1MD 2FEMA 4G3XA 1Z2CA 3KJIA 1NJFA 1WE2A 1SVSA 3T35A 1K8AD 4LHWA 4D82A 1CNFA 4ZIRB 3JVUA 1KI9A 2QUZA 2REBA 2BMEA 4H1UA 4A6XA 3BJIC 2D2FA 3VKGA 4YAWA 4HZUB 1F5NA 1P7CA 1YR6A 2WIAA 3QEOA 1F6BA 3I4LA 3UATA 2ZRCA 1ODFA 2VPPA 4HEJA 5J4VA 2V4ZA 4JLBA 3W8RA 1KO7A 4NTZA 2XNCA 2IX3A 1R2QA 2R44A 4C0JA 2IK8A 3RS4A 5JEEA 2NG1A 3GJ3A 5H8WA 2PCLA 1M90D 2CL7X 4O2LA 3CZPA 2YC4C 4URZR 2IYUA 5KDLA 4AF7A 4WZ6A 1FDRA 4ZI2A 3EA0A 1W49A 4DB2A 4GMXA 3EX7C 4PQFA 2NO9A 1BYIA 1TQ6A 1WXQA 2NO0A 4URVR 2NQ2C 1OF1A 1L4UA 1WF3A 5DGXA 4GOJA 1NN3A 2CMKA 1BX0A 2WJHA 4C0HA 2L0XA 5FOUA 1NDHA 1GNPA 4CRWB 3AVTA 3ZC3A 1F2UA 1DO2A 4DCSA 3GFTA 1WB9A 1IY1A 4PXAA 1W1WA 2AK2A 1ZU5A 1BYUA 3B9PA 1CU1A 1DAIA 2F9MA 2RHMA 2YYZA 3QPUA 1CULC 1KI6A 2H7VA 1YVDA 2VHCA 3PEUA 1D2EA 1E2IA 1AQUA 1CTQA 2FE4A 4BEBA 1H42A 4PGOA 2ZRDA 4HATA 2ZAOA 3RS3A 2ZSAA 4MKGA 2YKGA 1E6CA 2G9NA 1M6NA 3B7GA 2FN4A 2H1LA 2HJGA 2X19A 1EXMA 1Q44A 2RAPA 4D4LA 1YZUA 5DYGA 4B71A 1XRJA 1G21E 2W58A 1NLFA 4XVQA 1XMVA 2JA1A 4KCGA 2BCJQ 2JATA 2QTLA 4LYFA 2CCJA 1FNNA 4PO1A 3W2EA 2RGGA 2GVDC 1OXXK 2V1XA 4ESHA 4TMVA 1D6JA 4LJYA 1XFAA 2WSSD 4NCKA 1NG1A 2A2ZA 4BLTA 1VKJA 3PITA 3B82A 2QM8A 3L0IB 2IYQA 4E07A 1XD2B 5FUYA 5D3MB 3VR1A 4DQLA 2W0SA 4PZYA 3WNCA 4TL6A 4B35A 4DRZA 1E2KA 3B13B 4JLOA 3AP3A 2GQFA 3OEHA 1EG7A 2DWPA 3C5HA 1E2EA 3KXIA 4IDHA 5UKDA 1HEIA 4Q21A 4PFSA 4TL8A 4MQBA 3WP1B 5BXQC 1YKSA 4LBWA 2OT3B 721PA 3G0HA 2B7CA 4JMPA 4OKSA 1YHQB 2ZI7A 2RGDA 2GRJA 4URYR 4KVAA 4EKDA 4I99A 1ZM9A 3QUSA 3RHFA 3IIMA 1G7CA 2H16A 3GEIA 3GJ6A 3GLGA 5CIQA 3WHLA 4QJ3A 3VR2A 2ZAMA 1Z5ZA 2F7SA 2XTMA 1U2RA 4JLVA 1VCIA 4KV9A 1U0JA 3MUFA 4DLXA 1JR3D 1Z07A 3O8RA 1DARA 1M74A 4YMSA 621PA 3QE2A 1N6IA 3NXSA 1KOFA 3DHWC 4MDFA 1T3HA 1MABA 2GF0A 2RC6A 1E94E 3A1VA 3V4RA 2BEJA 2XNDA 1EFHA 4C30A 1EGAA 1CBUA 3W8NA 3W9YA 1J90A 1KAGA 1KSJA 2GAOA 4M1WA 5B30A 2C2HA 4KITB 2BKUA 1VPLA 4MKIA 4MKHA 1P3JA 4A8JA 4DSUA 3K09C 2GBLA 2GJAA 1GKUB 2Q9AA 2W6IA 5DHFA 3CMEB 3H84A 3W3ZB 3ICEA 1TTTA 5FBRB 3LBIA 1NVXQ 4TL7A 1BMFD 1ZUHA 5HKKD 3EWSA 4BLSA 3WNDA 1G291 3CCUB 1NVUQ 1P2SA 2KI5A 3JQRA 1ZNXA 3SHWA 3F3YA 5FBWB 2J0QA 3ASZA 4LYJA 4X8OA 1T8TA 2FFAA 3QIAA 2BBWA 4BRUA 2GPJA 4CYMA 1BIFA 1B2RA 2IYRA 4UNQA 5AK0A 5DI3B 1AQYA 1MKYA 1GILA 1X86B 3WRXC 1SXJE 4EFLA 3MD0A 3JVVA 4QBIA 1R0WA 4HYYA 3MSXA 1CXZA 2EQBA 3H0KA 4NYJQ 4QC2A 3OIYA 4HLQB 2ATXA 3EC2A 2Z83A 1FOEB 2ZSFA 4CT4B 1W0JD 3MJRA 1R5BA 3SHFA 5G53C 3BIFA 5AN9A 2R2AA 1U0HC 3V4FA 2NO6A 1VQ7B 1JJVA 1U99A 1CP2A 4NYIQ 2YOHA 1E4VA 1Z63A 1IOZA 4TQAA 3A4LA 2OBMA 1Z83A 2BMDA 1W4AA 1Q1EA 4P4UA 3Q7QA 4UQOA 3TH5A 4RZUA 5D3QA 1NVWQ 2ZPTX 2OK8A 3HU1A 4HLUC 5FH9A 3ZQ6A 4YONB 2HCJB 1LF0A 2CK3A 4JVMA 1OYWA 3T5GA 5IF9A 2REOA 5A0FA 4RZ2A 4HLDA 1KDRA 5FOVA 5F3WB 4PSKA 2I4IA 4LC0A 4PO8A 3RWMB 3TSZA 1U8YA 1IQPA 2ZR7A 2RGXA 3OHMA 1DADA 3UMSA 1AM4D 2EWVA 2VLIA 4BFXA 1W4BA 4FN5A 3GLIA 1HE1C 4B44A 2SHKA 1T4GA 3CH5A 4LV8B 3TR0A 3GEHA 2HT1A 2Q3MA 4LJ8A 1B23P 2A5GA 4JYBA 4LV5B 2YWFA 3UWOA 5TXGA 4AIIA 5C4MA 2VHTA 1I2DA 2QEQA 4QHSA 5GJBA 1GZSA 4TYWA 4ACBA 1EK0A 4Y0AA 3CRQA 1OFHA 4G5RA 1J8YF 2QTHA 4B47A 4QGGA 3OJWA 2QY9A 1LB1B 3VX4A 3CCSB 1AGRA 4Y9RA 3PUYA 4NL4H 3RSOA 1XTIA 1IAQA 1Y63A 1S0UA 4LHXA 2AKYA 3EARA 4ZDIA 3GJXC 4Q66C 4AURA 2VP6A 3QKRA 4TMKA 1P73A 4L4UA 1X6VA 1IY0A 5C46F 4AF6A 1EWQA 1KO4A 3T5DA 1JEDA 2EFGA 5EP4A 5FPTA 1CJVC 3AGQA 3R20A 2CHGA 4HUQA 4Q19A 4TWZA 4IFEA 2AX4A 2IC5A 2ZRJA 4XIGS 1AZTA 4B3CA 4PC3A 1Z08A 1TMKA 1J99A 1G5RA 2ZEJA 4GNKA 4MGYR 4QL3A 4AKEA 5J4YA 3U4QA 3V76A 3E70C 1Q81D 4PQRA 4N0DA 3I72A 2ERXA 4KI0A 4Z51A 1NVVR 4GOKA 4CEJA 5CYOA 5FTMA 1W35A 3L0PA 2ZM5A 1UDWA 2DFLA 2CLDX 4IVPA 4FMCF 2RMKA 5C2JB 2LWIA 4PC7A 2ZI6A 2ZRLA 3H1TA 4LWZA 1VQOB 1JXOA 4JBXA 4X8LA 2IUUA 3W2IA 3RRMA 2GK7A 4M53A 1FTSA 3I1FA 4ZCIA 1BQEA 1OFTA 3KKNA 1SHZA 3O8BA 4CW7A 2NZ8A 2PX3A 4BLRA 2JCSA 1PLJA 1HQCA 1QBKC 4D25A 1US8A 2GZAA 1OLOA 5AWFC 3ADDA 3CX7A 4QBFA 5EE0A 5AJYA 3SEAA 1N6RA 3B1WA 5GV8A 5A5GA 3WYAA 2J0UA 4Y0VA 3CCVB 1CLUA 1ZAKA 2MSCB 3AF1A 4LYHA 2IYSA 3QPWA 4V0NA 1X1SA 5G40A 4GP6A 2OZEA 3TMKA 3ZZUA 1KKMA 1ZD8A 6Q21A 4DCVA 2EIXA 2ZJYA 1BKDR 1DTSA 1RJ9B 4LJ5A 3K1JA 1W7AA 4BLOA 3BS4A 3RRNA 1XEWX 3U3RA 2VHQA 4P31A 5SZHB 4LBZA 3VNVA 3I32A 1QVFB 4AKGA 4BZXA 1K6MA 1XTQA 4PHTA 421PA 3L8YA 4IEIA 4NHOA 3ADCA 3P27A 2EFHB 4GZMA 3GLFB 4MH0R 5FUWA 1XP8A 2IF0A 2QP4A 2ZU6A 5LB4A 2VNHA 1Q1BA 1CR4A 4UNRA 4WQMA 4TTQA 2UZIR 2VO1A 3OEHD 3PENA 2EFCB 1OB5A 4WA7A 4WXPA 1TUIA 1G3IA 4A82A 5F98A 1P62B 3BERA 3SR0A 1JA0A 4YAUA 5E4FA 3EZ6A 2GCOB 5EP2A 1IN6A 1OH6A 2FZ4A 1VQPB 5AUPB 2XGJA 1GUAA 1P61B 4DT1A 4ARZB 4HE5A 1QG4A 3QF4B 3UWKA 4J0QA 1DAGA 1N5LA 2YWGA 2OAQ1 3OFNA 4JIMA 2ZSBA 2X2EA 5JSZB 3QSYA 3QVVA 1GP2A 4DJTA 2NMVA 1NF3A 3VMFA 3LV8A 2WJJA 2HUPA 3K0CA 1S1CA 2Z43A 3DPUA 2ZRFA 3DL0A 3IDQA 3QKUA 4A0FA 4Q4HB 4Q4AB 4ACAA 4B2PA 3TQCA 1NLZA 2FSHA 2YOFA 1KJZA 4CGZA 2XEXA 2IYXA 3EZ7A 5HR5A 1ZMXA 4HAXA 5DISB 1Z3IX 3AVXA 5JCPA 2JJ2A 2ODWA 2O8BA 3DO6A 3K9LA 4R2HA 4RJLA 3SYKA 1OV4A 2XNDD 4MYHA 3GQBA 5EXSA 2BMJA 1SGWA 2BM1A 1JBKA 2JASA 1XEXB 2A30A 3CZQA 1RFLA 3TAHA 1ZD9A 2O0JA 4TYQA 4RKEA 2Q3FA 1MV5A 1DAFA 3QPVA 1HY3A 2DBYA 4JBYA 1WP9A 1AS0A 1N0WA 4KFUA 2W6ID 1DAKA 4DZZA 2VH5R 3QXHA 5B2ZA 4NU0A 1UEIA 2O8CB 4ZKEA 3PUWA 4BQSA 1BJKA 1FNMA 4C0SA 2D74A 2OEPA 2ZIAA 1COWA 2ZTSA 1N5KA 5FA6A 1E2JA 5JZVA 3U3OA 4D0NA 3TAUA 1ZCAA 2OXRA 1UKVY 4M21A 2RB4A 3B6EA 1N2CE 3KZ1E 4PANA 4BWYA 3C5CA 2J0VA 2YWEA 3QKTA 4TLAA 1DE0A 3TNFA 1YU9A 2ZSEA 4Q4JA 2RC5A 5BN4A 3EC1A 4GL2A 2WBLC 3AH8A 3NC0C 4GSYA 3D8BA 3Q7PA 3VR6A 4EPYA 5JI3E 4BFZA 3FVQA 5JRZA 2JDIA 4M8NE 4UKDA 1WMSA 3UMRA 1MOZA 1Z29A 4IOLA 5CDFE 3QF7A 1H85A 3FOZA 2CDNA 1F60A 1CKEA 1I7PA 2VP4A 2HLDA 1BX1A 4DBLC 3EZFA 3MMPA 1R5NA 1NBME 2OXCA 3CRVA 4M1MA 1AJEA 2V8OA 4KLZA 3VU9B 4KODA 1OGIA 4Q9LA 2CVFA 2ZRHA 4MRVA 5K8LA 3RC8A 1UM8A 2R6GA 4RCYA 1G6OA 3CUEF 3VHXA 4A8JC 3K0EA 3H2YA 1W0KD 1Z6GA 3WRYC 3OESA 3SFZA 2O8DB 2D4HA 4OI0A 1M2OB 3OJXA 2CK3D 3QKSB 1JI0A 1TQDA 3RAPR 5EE5B 1IONA 3CPJB 1X8KA 3HR7A 5G41A 5KSPA 3H4MA 2GWHA 1VCMA 5FR2A 3E1SA 1IXRC 1U98A 2GK6A 1M34E 1I2MA 5F2EA 5FTKA 5CM9C 1E9EA 2CCGA 2ZITA 2WWIA 1N0VC 2VF7A 1JJ7A 1V43A 1E9RA 2OAP1 2GKSA 2YJTD 1U8AA 1VYVA 221PA 4BECA 5DN6A 3RS5A 3P4YA 1Z0FA 2EU8A 4PR0A 1LF5A 5CITA 5GJVC 3TKLA 2C95A 2PZGA 1CJTC 2XOKA 2FPKA 3QQ5A 4G1UC 2DWQA 1LNZA 1GKYA 5KNBA 3C8UA 2OBLA 2C8VA 4D80A 4OQLA 4Q7LA 1KK2A 4NYMQ 1Q82D 2J46A 4DVGA 4LJ9A 5JHHB 1XCPA 3CCJB 2VL7A 1YR7A 3FKQA 1RKBA 4C0QC 3THYA 5DSZA 4QFMA 2YWHA 1E99A 5LPNA 2J1LA 2R6FA 4LX0A 5FPHA 1T91A 5J5CA 3PEVA 1GL6A 4FCVA 1KMHB 4A0HA 1QHNA 2W2VA 3K8YA 4NMMA 4FK8A 1TNDA 5BYJA 1ZCBA 2F43B 1VQNB 1E1RA 2OUKA 4G01B 4GT1A 3LBHA 3UXMA 4C2UA 1XTJA 4F93B 3P32A 2GEVA 2A5JA 4N1AA 2F1IA 4YDSA 3KQUA 1OXTA 1GRQA 1BOFA 4O2RA 2A3RA 2R6CA 1T0HB 4KSCA 1KSGA 3DM5A 3K0AA 3X1WA 1IJFA 1XTSA 2QPTA 4L5BA 1EX7A 3ZJYA 3U2QA 4JT2A 1OXUA 2IL1A 3IO5A 3Q5DA 5H70A 3VFDA 1KO5A 1OSNA 4DIDA 1E63A 1XDBA 1S8FA 1PV4A 2JJ8A 3HU2A 4M1KA 1KMQA 3CC4B 4O25A 3LY5A 3H86A 5LBIA 3RYTC 2P5TB 1CR1A 3SYNA 4A2WA 3LX5A 4CDGA 1YZQA 2H92A 4KO8A 1FNDA 1W4RA 2I1QA 2XX3A 3LVRE 3EZ9A 2QBYA 3ES9A 4GPTA 3K0FB 4LRWA 1HYQA 2RHDA 1UADA 4LHZA 5BYKA 3SN6A 2YHSA 3CRW1 2X2FA 1NL3A 3LRPA 4Q00A 3F8TA 4YXWA 3R7WB 2IYYA 4BFUA 2QAGB 3ADKA 2CL0X 3B85A 5TY0A 1YITB 5E7JA 4DCNA 1G5TA 4DSTA 3CKLA 2J3EA 2CNWA 5KUTA 1XMJA 4TSFA 3CCMB 1H8HA 2ZI5A 4BFWA 3ZZTA 1VG8A 3NH9A 1QG0A 1E1QA 4M1TA 1D2NA 4KJZA 3VNUA 2OFOA 1SKYE 2IYZA 2PJZA 3C16C 4JLPA 3QEJA 5CLLA 2R6HA 4TYPA 3CCRB 1O3YA 1P5ZB 4RZXA 4IXMA 3ZVLA 1G20E 1P9RA 4G0NA 4IJMA 1GVNB 2ZYVX 3AF0A 2IT1A 5EUQB 4B3GA 1OKKA 2C96A 4OJQA 2OG2A 3RVBA 4NCHA 2QRZA 1PUJA 3N2IA 1TL7C 3A36A 1VECA 1N6LA 1X3SA 3RANA 2BGIA 1F2TA 4HAWA 2XXAA 4GRAA 4D26A 5CK5A 1OXVA 2PZFA 3Q85A 3VR5A 1U0LA 4AKIA 2QP9X 1ZC3A 2XJ4A 4K1XA 4ESVA 4Q9JA 1OHHA 2AD5A 3OFND 2GZDA 4IDPA 2CL6X 3FDIA 5G3YA 4L16A 4U02A 2ORVA 3VQTA 1E96A 4D0GA 3W90A 2YV5A 3Q3JB 3I56B 4NZYA 2AN9A 5JWHA 3DKVA 4PAMA 3OIVA 5CJ2A 1R6BX 3ZS9A 3OZWA 4BASA 4O3MA 1E2DA 3LQQA 4YMUA 1DG3A 2GJ9A 4Q4LA 3WP0A 4P6VF 3ZZ0A 4PHGA 2ZJ5A 3SDZA 5IT5A 3OW2B 3TBKA 1P60A 4G1VA 1OIXA 1DOAA 1R8QA 1RVDA 2W6JA 4V0ME 4WOPA 4YC7A 4XWKA 5JMTA 1CRQA 3T1VA 1E62A 2QP3A 2ECKA 3I5XA 2CE7A 2JJ2D 1KQSB 3GMTA 4MDEA 4A8JB 4OJKA 3CF6R 3QG1A 5JHGB 2V6IA 2N1BA 4DQKA 2VNKA 1TEXA 2C98A 1D1NA 3I8SA 3LO5A 1IXSB 4AD8A 2P6UA 1LTQA 3TJZA 2CBZA 5AJXA 1YR8A 2Y8EA 3KTAB 1E9AA 1PUIA 1QZXA 3O8CA 2NZJA 4RFSA 4R71A 4RFVA 3LAWA 2NIPA 1COWD 2ZE8A 4IRUB 2JIZA 1SHKA 1TUEA 3EPKA 5L3SB 4ZKDA 3J81k 3UK6A 1Z0JA 2KBEA 1W48A 4LDJA 2FPMA 4ILEA 4FMBB 2VP9A 4XD7A 1UAAA 2V9PA 5JS8A 1JEEA 3IBYA 4QHYA 1E79A 1W2GA 3Q5EA 2X8AA 4IOJA 1VYTA 3K0CC 4JJKA 4OQNA 3BE4A 2GNOA 3A4MA 5FTNA 2HYIC 1Z2AA 3U3JA 4C3ZA 3WNBA 1D5CA 4R9UC 2JDID 1SKYB 5JS7A 5CYPA 1XZPA 2CHQA 2DETA 1A2KC 2HMAA 4DEXA 1R0ZA 1S3SA 3U44A 2HLDD 2FNAA 1ETUA 4FWIB 3BD9A 5FBVB 1BH2A 1H65A 3TUZC 2CEAA 2VNJA 1N6NA 4LBYA 1R7RA 4MYUA 3W5UA 2JLZA 4AC9A 5HE8A 2R6AA 2VYFA 2BMFA 3R9IA 1B0UA 4X8HA 2HJVA 1GSIA 2J7PD 3QFCA 1K73D 1KDTA 1P2VA 2WHXA 3KUCA 1UDXA 4BFTA 4C0AC 1FMJA 3HP1A 1E2NA 3NEYA 2GTPA 3U7EB 2DFTA 3I55B 1XMIA 3Q72A 1Z0IA 4KVGA 1Q12A 4ASUA 3R8FA 4DDUA 4FI3C 1E2HA 3GLIB 2BBSA 4X8MA 4YMVA 1FRQA 2W83A 1IHUA 4JLMA 2WOOA 1S4QA 4FXPA 1D8TA 4K46A 1S9DA 4KHZA 4QBHA 1ZUNB 3IO3A 5EXPA 2VA8A 2ZRGA 5TMPA 1QHIA 5SZIA 5DN6D 1II8A 2ZREA 1BO6A 1QRAA 4MITA 3X1YA 3S1AA 2YNMA 3KKPA 1GO2A 2IWHA 4WBSA 3QOFA 1M8PA 2OO7A 1VQ4B 4KBFA 3U3KA 3SI7A 2CLSA 2G88A 4KU4A 3F5FA 4URUR 1Z0DA 4M4SA 1FUKA 1L7VC 1L4YA 2ZE5A 3AVQA 5L3VA 3RDPA 3KFXA 3CLVA 1E64A 1FZQA 2WJVA 3QKRB 3EIEA 1E32A 4ZIRA 2FA9A 2WJIA 3SE0A 4MYTA 1E4YA 4WIAA 5ANRB 2C78A 1M7GA 3OEEA 3TSOA 1P9NA 4HZUA 2QT1A 5EZ5A 2ANBA 1FX0A 2FJUA 4DUGD 2OK7A 3TIFA 2V6JA 1E1RD 1KI2A 3SQXA 1JB9A 4LHYA 1G4AE 3HYTA 3U4QB 2B5OA 4B34A 3VR3A 3WBJA 3CO5A 3NH6A 4JLNA 1XJCA 4TTRA 2AFHE 3U3MA 2ZRIA 1E9CA 3LQRA 4IFBA 2PT7A 3CMAB 4B3DA 1EFTA 2ANCA 4FW9A 3CR8A 1Q1QA 1YR9A 4JSYA 1NI3A 3B60A 2FSIA 2JJ1A 2G3YA 5KSYA 1DS6A 1JAIA 1V5WA 3VHLB 3RWOA 1N5IA 4EPWA 2ZUBA 4AG5A 2XSZA 1ZM3A 2BGJA 1E2MA 3QNUA 1CJUC 4QNRA 4Q9IA 3KQKA 1US8B 1OFIA 4CIDA 1QHGA 4JYCA 3SYLA 2N42A 3DDCA 2FG5A 3O47A 4AYTA 5DLQC 3AF2A 1QVGB 2GA8A 2OILA 2XTZA 3Q9LA 3K0SA 4QJ4A 4LSGA 4E5UA 4M1YA 3IPXA 2QSZA 4A2PA 1NIPA 4LOAA 1XX6A 2A5DA 2GF9A 4YXWD 3KJGA 2AXNA 1OIVA 1MRNA 2J5XA 3DMDA 4NYJR 4OQMA 2FMXA 4F7DA 4B76A 1E3MA 4DSNA 5M04A 5CB6A 2ZJOA 3FB4A 2CNWD 4P3YA 1JECA 1KDOA 4C0KA 5JI2E 1GOTA 3DM9B 1IN7A 1H8HD 4TSFD 3U7GA 3HDTA 4LI0A 2C77A 4DLSA 5LB2A 3OZXA 1EFCA 3PQCA 1EP3B 4GBMA 4NYIR 1AN0A 3N5CA 4JL8A 3MLEA 4JLDA 3F0TA 1XNJA 1RPZA 2BSAA 1RZ3A 1SVIA 2IBMA 2ZS7A 1GTVA 1VQ8B 1XXHE 4PTLA 1XD2A 1OKKD 4TQUS 5D3MA 3GLFE 3U61B 5THXA 1YZTA 1J2JA 2IUSA 2VSFA 2UZ3A 1E2LA 4OHVA 3TR5A 2OFXA 3TSWA 3OAAA 3IEVA 1WA5A 1XBTA 1NP6A 3QBVA 2IS1A 3U60B 1G8GA 1MO5A 3IKJA 3WHKA 2IYLD 3AVVA 3B2EA 2Q0HA 3CXCB 1NY6A 2OSBA 5AJWA 2GILA 2XTNA 2QN6A 1X8JA 4NPHA 1HUQA 4W5WA 3ND9A 3BFKA 4B3FX 1XPUA 2A9KA 2ZRAA 4OHWA 2ZJ2A 4DSOA 4KAXA 2WPDA 3HPQA 1A8PA 5B58C 4EFMA 4QM6A 3REFA 1ZM7A 2NO7A 1TQ2A 4AWXA 1JR3E 4I81A 4DXAA 2G1JA 1AKEA 3LFUA 3ZQJA 3B78A 1G7RA 1LFDB 1IBRA 4NH0A 1VCNA 4IEEA 1OYYA 2BJWA 2VEDA 1IN4A 1GIAA 2ZETA 4DCTA 4Q18A 3A37A 1G3QA 3P20A 1ZC4A 1FMLA 2W6JD 2WM9B 3IGFA 5GVSA 4LCBA 2VIIA 4PC2A 5HTKA 4WXRA 2D2EA 3AF3A 3AVOA 2V7QA 5KSOA 1C4OA 1KHTA 2XZPA 3OZUA 1TU4A 5EMNA 4TLDA 4M9SA 4PSVA 4PZLA 1E69A 4Q1EA 1KC8D 2QNRA 1LS1A 1FP6A 5LD2C 3GLHE 2BV3A 1A7JA 1XTKA 4YMWA 1YZGA 4C43A 1R8SA 3PUZA 4NE2A 3HU3A 3E1YE 5CJPA 1NIJA 3ZD7A 1QGYA 1W87A 3AB3A 1FQJA 3M1IA 4Q4JB 3KUDA 5IRCD 1P2TA 4FMDB 4XD7D 3KJEA 3LH5A 3ZVNA 3KKOA 2RGNA 1E79D 4PX9A 2ZYWX 3KX2A 3HYRA 3TW4A 1VG9B 1NMXA 1P6XA 4FD2A 4TYNA 3LWNA 4URWR 4D6PA 1E0AA 1P72A 1DDGA 2VNIA 2C5LA 4OL0A 3QI2A 2OV2A 4QHTA 2O52A 3SOPA 5HE9A 2QM7A 4B73A 4G1BA 1G5PA 1Z0AA 1RRGA 3VR4A 4KSBA 1GFIA 4URXR 3GJ8A 1EP2B 1QVRA 4B2IA 4ZGQB 3SQWA 1XXHB 5GVRA 2QGZA 2QA5A 3FPAA 5E7IA 1N6KA 1E2PA 2BBTA 2FFQA 2YOGA 1VHTA 1WQ1R 1G3UA 4LPSA 5H68A 3SZRA 8OHMA 4MUBA 2OHFA 3G4SB 1RYFA 4ZDJA 3QXSA 1VQKB 2O8EB 2VSOA 4F38A 2QMEA 1N5JA 3CNLA 4XTCS 3C4JA 2PL3A 1QGAA 2AR7A 3N2EA 4DLYA 4DLTA 2GJKA 3ND8A 5EE3A 3THOA 4LUCA 5AUNB 1PLLA 2CJWB 2IYWA 2EYQA 2IHBA 2ZVPX 3THWB 3B1YA 2JEOA 3EIQA 3QJYA 1KJWA 1N3BA 4V03A 1G17A 4Q9KA 4D0LB 4BLPA 5SZJA 5KDDA 2G77B 3ADBA 4EFNA 2AKAB 1WDTA 1JJ2B 3RNLA 3AM1A 3FHTA 1ZNWA 2RGBA 2YVUA 2HCBA 2D7CA 2EYUA 2BDTA 1OH8A 4NKRA 5BW8A 2OBNA 2K5UA 2WWGA 3DOFA 3G71B 2AK3A 4C2TA 4ON9A 4DHEA 1J7KA 4XTRA 3THYB 2R6DA 4HLCA 5JWRA 5TB5A 1UKEA 1R5OA 2R65A 5F9FA 1GAJA 2QRNA 3FKSA 2GZHA 3AQ4A 3PEWA 2WVJA 3A1WA 3D3QA 4R98A 3MWLA 1F20A 2WKRA 3OEED 1S72B 1XTRA 1GL7A 4RVCA 2DCUA 1ZUIA 3DEFA 4NCIA 4TYYA 1X8LA 2W2XA 5H5JA 4G5GA 1SVOA 3GLHB 3I92A 4JS0A 1A82A 1A5TA 4BGDA 4TMZA 1FNCA 1GL9B 2ZS9A 3K0AB 2OLKA 3PUVA 4OK6A 1DELA 3U6KA 2PH1A 1YZKA 2FFHA 1NKTA 4TMWA 1GAWA 4P4SB 1ZJ6A 2ZUCA 4BZPA 1O87A 3DZ8A 4ZI3A 4QGAA 2XITA 1QUEA 4O0MA 2VTKA 3AGPA 3RS7A 4XWOA 1D2MA 1UBFA 4TLEA 4G5SA 1G3RA 3AKEA 5KSZA 5TDHA 3SU8A 1W44A 2JLRA 3BC1A 3NHAA 1QHHB 2JLXA 4AY2A 4M9ZA 3LLUA 1SXJA 1DPFA 2O0HA 1VDZA 1RE0A 2QBYB 2IS2A 2RKOA 4HDQB 1XWIA 1ZRHA 2TMKA 1KY2A 2XSZD 5EE1A 3I8XA 5DO9A 4S2EA 5FR1A 3AP1A 2IEYA 4H1VA 4KYIB 2ZYTX 4C0BA 3CCQB 2FEOA 5TARA 1C1YA 3SBDA 4KLNA 2ZXUA 2WICA 3OIUA 2A5FA 3ZDQA 1FPMA 2FX3A 4A2QA 3NEJA 2D06A 4A1FA 2C99A 4US1R 2A7QA 1CNEA 1VQ5B 2ODNA 5IHPA 3DMNA 3B1ZA 1CR2A 3CBQA 3X2SA 3ICQB 1KI4A 1HV8A 1VQ9B 2NTYC 3KXLA 1T3SA 4LJ4A 4MRRA 3FMPB 4Y9UA 4UXHA 3L43A 4HI0E 2GBLC 2XB2A 2QU8A 1WCV1 3EAQA 4M22A 5CK4A 2FDCA 1LY1A 4YHBA 2MMGA 1I4TD 3NHBA 4GMDA 5HCIA 3ZBUA 4LJ7A 3MGCA 5FL3A 3U7FB 1ESNA 2NPIA 4JVNA 3TQFA 1E9SA 1JR6A 1E2GA 1ZU4A 4EQ6B 4BUJA 4OBEA 1RJ9A 3EXAA 4B74A 4FWTA 5K8IA 4JLJA 2IYVA 4MGKR 2CXXA 2F1JA 3EPLA 4M9QA 5JECA 2O8FB 4YAOA 4C4PA 3CRRA 4AG6A 3CRMA 3PFIA 5TVKA 3A4NA 4Q5IA 2IEZA 2JLVA 1Q0UA 5L3QB 1S96A 4G5QA 2PX0A 3DZDA 2HV8A 4YAFA 4B4DA 1S3GA 1VHLA 1Q1ZA 1KI1A 1MO6A 2JAQA 1DAMA 3R9XA 2BC9A 2BHRA 3B1VA 4ABYA 4FIDA 2FZLA 4JVLA 2ZRNA 3IPYA 1U81A 1JPNA 3GJ7A 4LJ6A 5G3ZA 3Q8XB 2CCKA 2BWJA 5CM8B 2QMUA 4PHHA 1N6HA 3PVSA 1LV7A 2HXYA 3BH7A 3NDPA 2FU5C 3QF4A 4ARZA 4DLZA 3KB1A 1GRNA 3NBFA 4RD1A 3GLGE 1TQ4A 2VZLA 1KNQA 1QVAA 3BFXA 1YQTA 3AVPA 3DOEA 4UNPA 1RRCA 1GWNA 3HWSA 2WPDD 1AK2A 4LV6A 3ZYCA 5IDVA 4R7ZA 1ONBA 2C03A 4NYMR 3TE6A 2DHRA 4WZAE 4RD6A 2H57A 2OE2A 1VYUA 4Q4HA 2OM2A 1E0KA 4TLBA 3ZLJA 3BORA 5F9HA 4B3XA 3L0SA 1NN0A 1G1MA 2XB4A 4RD2A 3REGA 2Z4RA 2QT0A 2QZ4A 4Q48A 3E5HA 3KFVA 3O8DA 4NDZA 3AKCA 1KSHA 1UFQA 1PVOA 4HE6A 4WAUA 1CJKC 3IHWA 2ODBA 2HXSA 4PPFA 3PUXA 4D2IA 1GDDA 1G9XA 1F2UB 4HAYA 1XB2A 3WMFA 4LC1A 3VO1A 2EFEB 1DG1G 1XMSA 4RFSB 4JLKA 3SFVA 4EAQA 2W2TA 4XSHA 5FI0B 4KFSA 2BIFA 2FSFA 2OESA 3MWJA 5JFGA 1A1VA 2XNSA 4Z8YA 1KI6B 2H5EA 2X3UA 2O8CA 1K5DA 4U00A 1NN5A 5L3RA 2YZ2A 3SS8A 1T5LA 2CNDA 3FPKA 3BOSA 4B2LA 1JAHA 3SJBA 3JQQA 5LDDC 1ZINA 1Z6YA 4RD3A 2DR3A 1ZD1A 1R4AA 1OFUX 3PG5A 5BN3A 1T9HA 5JWOA 2FH5B 1G4UR 2AXPA 1ELOA 4TT3A 5FBQB 1UEJA 4H9GA 1SKQA 3A1TA 3UANA 4DLWA 3FFAA 2NOAA 4CEHA 5KHOC 4G5OA 4Q1BA 4UJ3A 3QFSA 4L15A 4E03A 1W5TA 1GM5A 3RLFA 4C7OA 2V3CC 1FUUA 4JLAA 5E95A 5BN5A 1XE1A 4I1SA 1TX4B 1Z22A 4RY2A 4UXJA 4HAUA 4ZCLA 1AGPA 3BGWA 4K8OA 2PEYA 4DLVA 1GRRA 3BH6A 2B8WA 5KPJA 1W2BB 3QBTA 1NJID 5FI1B 1LVGA 5BQ5A 1XEFA 3VU9A 1EFRA 4GDFA 3OE7A 4ZPXA 1G19A 3QXCA 1E2QA 5SZKB 5A4JA 1QUFA 2KBFA 2O0KA 4PHFA 4PPGA 4Q03A 2ORIA 2QDXA 4LK2A 1XEWY 3TVDA 2XAUA 2G1KA 1UMKA 3GPLA 1U90A 1RC8A 4GFDA 5H59A 3KQNA 2DFNA 4HSEA 4MRSA 3QKSA 1K8RA 4EPTA 2XJ9A 5DNYB 521PA 3L0OA 3GLGB 3I61A 1RRFA 4CF7A 1G18A 2HYDA 3ONWA 5KU1A 3DVLA 3U5ZB 3GLIE 2F3RA 2GETA 2WWFA 5HCNA 2FV8A 4EJSA 2RGNC 1KSFX 2F1RA 3WY9A 5HZKA 2R62A 1WBBA 4V0KA 3T1TA 4MA4A 1HT2E 3U7HB 5FOXA 5HPYB 3TLXA 5FUVA 5JJIA 1F48A 3A58B 1OIWA 1MABB 3GCGA 5KSWB 2ERYA 4IVQA 3BB3A 4IOMA 4IOKA 3ZVMA 2QPAA 1EX6A 2J7KA 4JJZA 3IQWA 2ZJAA 1M7BA 2FGJA 3IUYA 2PLFA 2HEIA 2Z6VA 5J47A 1DEKA 4B6FA 4EIWA 3DKPA 1FX0B 3FKSD 5B64A 2VF8A 1VQLB 5H1YA 1HTWA 4A36A 3I5YA 3B9QA 4V02A 2GJSA 1DBSA 1CJMA
chains in the Genus database with same CATH superfamily
1PJTA 3AINA 4H3SA 3PCTA 5TT0A 4K9KA 1MO4A 5FPYA 1VGRA 3JQ6A 3WBBA 3OPMA 4UHCA 3BMCB 1Y5MA 2PUDA 1TA0A 4CTNA 3QA3E 5LMNB 6ABPA 4LVNA 1BCRB 3AJDA 2JLUA 5GZ6A 2Z6QA 2GEUA 4CT5A 3EASA 2BCGY 3GT3A 3N0RA 3RK0A 3V4OA 1SCKA 3S8MA 2WD9A 4I7EA 2F55A 3SF8A 1NYRA 2NYRA 1N2CA 2G0AA 2H1SA 2VJAA 5DGCA 3A6JA 5E8JA 4PX3A 1Y6FA 4MP3A 3GGSA 1SBHA 1T6NA 1H69A 1JBQA 4HADA 2V3WA 3H83A 4ZO8A 5FFNA 6YASA 5KOJB 1QFZA 1NUSA 1V1JA 2BVNA 2KSQA 2PE3A 4DK0A 2PR2A 2ES4A 3EQ6A 3VR6D 4KQ2A 1SBYA 3OKPA 2RKWA 1WV1A 3MWKA 3N8GA 3P4XA 4HDOB 4OXQA 5HA5A 3NAGA 3A8TA 5CDFA 1DTWA 2PD6A 2ZUVA 1C3LA 2HF8A 3KHSA 4TYMA 3WGTA 4BKPA 4RUKA 1OFVA 4BDSA 2IW3A 2VYQA 5C18A 2JGDB 3NWJA 2GHIA 3GVJA 1O7JA 3O4VA 1NBMA 2H4XA 4FYKA 3DG9A 3IR6A 4MIKA 3IDFA 1KKLA 2ZWPA 1IVYA 4DEYA 1ODJA 2VBUA 1TECE 2G5TA 2WU8A 4B83A 4DW8A 821PA 4EP1A 3NBYC 2I7DA 1ZICA 1UOEA 4YBZA 2QTCA 2OC4A 1P3Y1 1B1CA 4X61A 1F4PA 1LDGA 3DKIA 5TMDA 4HEA1 1Y80A 2QAGA 5FL7A 5KO2A 2NP6A 3NC1C 5JARA 2AQ8A 1GR1A 4W7HA 2BJHA 4ZZ3A 2WKPA 1J0EA 2B20A 1M6VB 3VR6H 5BNZA 3G0BA 2QTZA 2Z3ZA 1JBEA 1T2UA 3OLZA 6AT1A 3AFMA 1SQGA 3W1EA 2X0FA 3BBPA 4M9UA 3WL3A 3CVUA 3K35A 1EZ4A 5IHXA 4CQMD 3LGXA 3O8LA 3GVLA 1N4AA 4DEVA 3WKCA 1P4MA 5AQEA 1SD1A 2CYAA 3ANXA 4IX9A 3WYGA 4F97A 3RT9A 2C4KA 1L8QA 2OY0A 1MT0A 1FVHA 1X80A 2P77A 3EMKA 4GU5A 2H08A 5GY7A 4PNZA 4BEJA 4RCZA 1Y3AA 4GX0A 4XQCA 1EZ1A 2VSYA 5DEIA 2WAYA 2A92A 4LZWA 1FY2A 3C6YA 3ASSA 3VU1A 4RTNA 3COJA 4RVGA 3IR5A 3LOUA 2AZXA 4IDDA 4ZAZA 4M1OA 4M46A 2P5SA 2F3QA 4WESA 3CF2A 3FSGA 3C4QA 3KE9A 1AH2A 2ZRPA 3Q2IA 4UE6A 4D4JA 1XROA 3FLMA 4KR6A 2BUAA 2IX9A 2YWCA 3W2HA 4MPDA 3TRKA 2GN9A 4ZTZB 2JLSA 3LQYA 2V55B 3MLBA 1RQXA 4KXMA 1NRJB 1X7HA 3AKDA 4K9MA 4UEOA 1MUUA 1Q77A 4ERNA 8ADHA 3DLTA 2C7VA 4Z4GA 3AI3A 3A8JA 1YFLA 1HDIA 3I1YA 1T15A 1BA3A 2C1EA 3JQ8B 2KWIA 3QNWA 4FHEA 2Q3HA 2XGOA 1GG8A 2IXBA 1Z5VA 4R2WA 2C4TA 4ITVA 3RSCA 3SE7A 2IS4A 4FSDA 3ZKWB 4XWAA 4E32A 4YNBA 2VTBB 5ELMA 5BVHB 4L22A 4P2BA 1E3SA 3UW1A 2J9ZB 4IJWA 3U09A 2H85A 3EQ8A 2CF4A 1EB9A 3E7PA 5K8VA 2FE1A 2BSXA 4KJXA 3R0IA 2ZIWB 3TVTA 2N3ZA 3MTAA 5IM5A 2X9VA 1U8ZA 4HDKA 2F00A 4PC6A 3O92A 3EPHA 5ED0A 2C20A 1UBCA 3MTBA 4DR4B 3AT1A 3C3DA 3LXRA 3AR8A 5I7VA 4FU0A 4RJJA 2GAAA 5ALVA 2X0DA 3VKFA 4US0R 1O57A 5EQTA 2FUKA 1VI5A 5AJUA 1XQ1A 3PGLA 3EUFA 5AXDA 5C37A 4HMQA 1R0XA 4JEHA 3D4LA 1CS4C 1G4HA 4PCAA 4D9CA 1ACMA 1R0CA 4MWDA 3ZZ1A 3U49A 1MAHA 4NJEA 4QPDA 4N8DA 2JFXA 1P39A 4QYXA 5LZ7A 4HXGA 5LP6C 2OGZA 1EVKA 4PRLA 1A7AA 1C1HA 1NXPA 1NUHA 1P33A 1SBNE 1VIYA 2B2CA 2J0UB 2W2KA 4OK3A 4OYHA 2GBCA 2VYND 4EFKA 1YQ9A 4DV2B 4PZPA 2ZUWA 1TAGA 1VGQA 2E87A 2REXB 3ZCQA 1OXSC 4B3SB 3A1SA 4OAQA 4QRHA 2I5PO 2GCGA 1H2AS 3RADC 5KREA 4EA8A 1RAAA 4PRKA 1N3IA 2DQSA 1YJWB 3SZ3A 1IXYA 1RWPA 5JCXA 2X1VA 2XBUA 3V3TA 4X0CA 1LRKA 2BISA 1IJEA 1W4CA 2B8NA 4QJ5A 5CFMA 3ZHCA 1CQPA 3A1UA 2XZOA 1IY2A 4NOLA 3WLEA 1SVLA 1E1QD 3TQIA 2Z2YA 4H1HA 3OX1A 4EHNA 4QQNA 4MUXA 2HWKA 1CRZA 2WIBA 1Y3BE 4OLJA 1QP7A 2PSHA 5DTQA 3S70A 4Y30A 4V1CI 1J9ZA 3MGBA 2VBGA 4Q7MB 4ZDKA 3CPWB 1WLYA 2DUNA 1QGUB 2PXXA 3FYHA 4IRMA 3VJMA 4GNRA 4BNDB 2FOLA 4IXNA 2LKDA 1EFRD 2HLPA 4BPRA 2JIRA 1TT7A 3ODGA 4IV0A 4EKGA 3HCWA 2XXBA 4B33A 2VHJA 1OI2A 3RC2A 3REQB 1WABA 1D03A 1V4BA 3WAGA 5JLJA 1IM2A 3GSIA 3PRJA 4TKZA 4NJOA 4OLHA 3AF6A 1PLKA 4IO1A 5B1EA 5TX7A 4TSRA 2H4FA 4PSAA 4MVJM 3A7EA 4KWHA 2CUTA 5AVSA 4PAAA 1P31A 1FFSA 1R0SA 3I9JA 3N8HA 5A4IS 3L93A 4Q1AA 3TGPA 1GUDA 2OBSA 1PVVA 2OFWA 4YHHB 1AGXA 2BI8A 2FWRA 4R7TA 3MNFA 2FWJA 3KWJA 1AMOA 1QFYA 1DOZA 3DV2A 2GO7A 3QFRA 5DI9A 5I3CA 3U13A 1BU5A 1SWWA 4MR8A 1XCOA 2GJ4A 2WKWA 5LJIA 5FLXA 1MW8X 1W93A 1DJLA 3GT4A 3OJLA 3AETB 2HU2A 1W5AA 2DX7A 2Z3WA 3QWFA 1VMKA 4XCVA 5C1PA 1Y42X 5FTLA 1PJRA 3SVLA 1OH5A 4MQ5A 3EWAA 3ECSA 1A4UA 5HXBA 3ZY4A 4LMAA 1T1RA 1NB9A 1YE5A 2AUTA 1I2AA 4I50B 1K06A 4M8LA 3MSCA 4LYAA 3VH4A 3WWEA 4CLRA 1Z6TA 1TJYA 2QG9A 3ESBA 4A9AA 4CZ2A 1GTL1 5HF9A 5LM3A 3B9RA 2UUPA 2OXFA 1QH0A 3COSA 3F6SA 2VQSA 3IOYA 3B1KA 1UXJA 4P7BA 4EHHA 1RAHA 4E5DA 1MMFB 1QORA 2ZB4A 3DFIA 4UEWA 5AVKA 1W1UA 2H6EA 3GELA 1G16A 2CDAA 4BB0A 2OHVA 2CBXA 1ADBA 4S35A 5CFPA 1E2FA 3IMCA 1Y48E 2CHVA 4ZGNB 3NDRA 4RQBA 1CYDA 1JEQB 1NVVQ 4UD2A 1NGSA 1GPDG 2DFDA 1D2CA 1UWVA 2IIQA 4X1OA 3ONDA 5GAJA 1ZW1A 1FNBA 2ZKLA 4QEZA 4IIDA 3NTUA 1LBIA 2R8RA 1SVNA 4MS4B 2B8TA 1SR8A 4FKZA 3KQMA 1E77A 2C58A 2P9ZA 5BSEA 1M7HA 1SZPA 3TK1A 3S5UA 4FI3F 3OTGA 4QYWA 4JC4A 2P6NA 2V54A 4R41A 4RK1A 3HWRA 4HGRA 4UMDA 5I9BA 4BAUA 4C6SA 3G6EB 4EJ0A 4AK9A 1N78A 4ALIA 1UK9A 4FMCB 3BQNB 3PI6A 3SJAA 5C34B 3L2OB 1DPGA 1SXJB 4FZRA 4L2IB 2BPOA 4ROXA 3ZQKA 3IB3A 4O3FA 3H2GA 3G0DA 4FMDF 1KO1A 2Y6UA 3G8CA 3IJRA 2WLTA 1XZJA 4WY8A 3QBEA 3VPGA 2TMYA 4YV0A 4B8WA 3U61B 5HF5A 4HZGA 2RCNA 4PWZA 4TMTA 3VO2A 3I3OA 1C3VA 4BKMA 5CA1F 1W46A 3HCRA 1WG8A 1QHEA 4UJ5A 1KF0A 2WT4A 3FX2A 3ICOA 4OQFA 4QOGA 5TQ0B 1AMUA 3AI2A 3FTCA 4C20A 5G0UA 1G8HA 5LLDA 3NCTA 4O4HB 4AVZA 4NAVA 4P53A 3K70B 1GAXA 4L74A 1Q3HA 1N9KA 2VJMA 2CLCX 3P9YA 4NV0A 2G28A 4Q0MA 4Q7KA 2XUHA 3EVEA 1CV2A 3W6PA 1ZH4A 4CM8B 3GFPA 2YC2C 1C9KA 5TRTA 2BEKA 4ZYVA 5DHPA 4EHFA 4OQDA 2BRUC 5KNDA 3OQMA 4JJFA 5FA5A 2PRJA 2E4YA 5H3LA 1FW6A 1IWOA 2R96A 4PLYA 2WMNB 3HKDB 3T1OA 2C4MA 4EHLA 3DR3A 2HCFA 1QH8B 1QQBA 1JIXA 1A7UA 2BGUA 2IDMA 4JVSB 2AHRA 4ZAVA 1W36C 3JPWA 1PZMA 2X7HA 5B1IA 3ETDA 4PSUA 4P0TA 5BR1A 3T5AA 4UHHA 4ZHSA 3GFQA 1FQOA 2GEDA 4LYYA 4JB2A 1KEEA 1YK1A 1MJHA 4HB0A 1FUIA 4HB3A 3HDVA 3PFGA 4F7WA 2P6RA 4G26A 5CEJA 5IBCA 5HZGA 3MWGA 4BLQA 3B52X 4OAPA 1ENOA 1MIHA 4IIBA 5CDTA 2EWWA 2XWSA 3QY0A 3QVWA 4HDSB 4POAA 2VDWA 1JG2A 3LVQE 5CVVA 4S1PA 2Z5LA 2OCBA 1R6TA 1XQXA 4Z1MA 5AUOB 4XD2A 1KQFA 3TGWA 4OHZA 1XEAA 4BVHA 1SG6A 5C80A 3L0YA 2YNMD 3AJRA 3BSFA 2Z6AA 3JAKA 3M2PA 3M4YA 1J5XA 5L4LA 1OT3A 1TYEB 2VSXA 3A11A 3K5HA 1C50A 4RLQA 2HW8A 3LBNA 3HK2A 4RHYA 3TFQA 3Q1LA 3NKVA 5B37A 4MS3B 3MGGA 1M1YE 1NB0A 4WW0A 2Z9BA 3QRWA 3FYDA 4RANA 3HFSA 3RUIA 2QUAA 1YRHA 1JFVA 3HKEA 2Q9UA 4RPBA 3EIHA 5FV4A 4TL9A 2JGKA 5LXTA 2ZR0A 4O0LA 1JLLA 2PN1A 1UQTA 3RODA 1WMFA 4I5EA 3FPCA 1L5MA 4DDVA 1SULA 2P3SA 4REMA 3I5MA 2MWMA 4JT4A 5DE3A 3TXXA 4D4GA 1AKNA 2YQ4A 3GD7A 2R47A 4YJGB 3D31A 2FSGA 4ZDWA 1EPUA 1Z25A 5CB0A 5CPBA 1NFFA 2Z4SA 3F98A 3HYNA 2FSUA 2Q3EA 5WRFA 2WHYA 3NATA 3ZWKA 4W5OA 2QIOA 2PYDA 1C1XB 2D7DA 3BIXA 4UBLA 1ZEMA 5EG5A 3OZSA 2Q9BA 3KR9A 4MHSA 1VYHA 3S5JA 3FPEA 1ZW6A 2WNIA 5FJJA 4U6QA 7ABPA 3AK4A 4Y6GB 4Q34A 1KGDA 2IA5A 2X2OA 2NXJA 1EXDA 2O7RA 4WNCA 1G6HA 1FZTA 1Y9ZA 2SBTA 2O5CA 1ZOLA 3NG1A 1ZGGA 3K9FC 2F1HA 3K05A 4W99A 3THXA 4BL5A 5HZHA 2UUBB 2HIHA 2IHYA 5EMMA 1K66A 5JROA 1TJ4A 1H2EA 1YS9A 2JLAA 3Q39A 2G25A 3AWDA 3LC2O 4FTWA 5HIMA 4KQMA 4TUYA 4D8XA 2HF9A 4BNKA 2AWNA 1IL0A 2ATVA 2X85A 3HQ4O 4JKYA 4F4IA 2WU3A 4ESOA 1KTVA 3SICE 4XZ3A 1DX9A 5KU1A 3IQXA 4XPIA 4ZCMA 2OCDA 4UZEA 1M1UA 4HQ6A 2AFIB 2A5LA 3RH0A 3T34A 1FRNA 4YEDA 2IBTA 2YZ7A 3EW9A 4I55A 4MGEA 1OZFA 3QG5A 1Y0YA 4Z4YA 2AG1A 3B1XA 3QVUA 3D7NA 4RAOA 1EWRA 2H59A 1GDTA 3BE8A 3U62A 1RXSA 2I03A 3PNQA 1RXCA 2VAWA 1A98A 4HDCA 5EGSA 1EDDA 2PQ6A 3Q3EA 5E2AA 5EE9A 1RRKA 2I2AA 1RCTE 4QYIB 1I10A 3TTWA 3ZGXA 1CFZA 1G41A 4EPVA 2OECA 2HK6A 3IBGA 3PQEA 3HJNA 1XRNA 4OG2A 3IQEA 3O4IA 4XA8A 4UUQA 2IV3A 3NXKA 4QDOA 4A16A 4BVJA 5JZMA 2GDJA 4R9SA 3UN1A 4KNYA 3QLVA 3OE4A 4XR4A 4AKHA 3JD1A 4RY0A 1JQJC 3MT7A 5BWMA 2WLSA 1CUIA 1RPNA 4IDQA 3EDOA 1RIIA 2NVUB 4P33A 2J7PA 1T26A 4UFNA 1XHEA 3GLFA 4QG7A 1UJNA 3K09A 3M0EA 4JMQA 4UBIA 3B3AA 4G7XA 4QVJA 1X7YA 2G0NA 1V1RB 1B3RA 1F2TB 3FZGA 2WZQA 2Q9CA 1ES9A 3BFVA 3OF5A 1VL8A 2NUAB 3X1ZA 4BP1A 1FK8A 2B30A 2FF7A 2G9ZA 3QWHA 3CBGA 4YRCA 5E4TA 1EESA 2R7NA 3EXHC 2O8EA 4BKUA 3OT5A 2VSNA 4J0KA 5KB3A 3DHVA 3FNEA 1T1JA 1Z2EA 3T61A 5K3EA 1WY5A 3WLFA 5FFMA 2PVCA 2FMUA 4IHQA 4PQGA 1RP1A 2GCOA 2CXOA 4Y6OA 1F9AA 4A3SA 2ZRMA 4OGGA 4F8YA 1QGOA 3KXPA 3NJ4A 4CG3A 4CKWB 3P2JA 3W5VA 1Y8QA 4M87A 1BGVA 2PTHA 3WX0A 1UBOS 2QSYA 4B4OA 4YRQA 5B36A 4IH4A 4TMXA 3ZEIA 5FOTA 4ZGGA 3PPWA 1FRVA 2JVIA 4ZODA 5DXJA 3C48A 3RVMA 2XB8A 4KEAA 1X1RA 2B82A 3L07A 2WI8A 2ZBPA 4XYEA 1WMBA 3T4UA 4BO2A 5IK2D 5KNCA 2WKSA 3GGOA 2E1BA 2EFDB 3COYA 4Y7CA 4UU8A 3H5OA 3LDGA 3I23A 1JPJA 5LCXA 1AZSC 3CCLB 3RABA 4M0KA 3WOVA 4EW6A 2WJZB 2FP4B 2I33A 2ODEA 4LZZA 2OCIA 4GVLA 1GNLA 1QHXA 1HT1E 2I3DA 3BK7A 3V2HA 1JLRA 1M2EA 2QPOA 1R9JA 2CFCA 4PYOA 3WYEA 2WQ7A 3GLRA 4TM8A 5E1OA 4WX2B 3V4SA 4JB0A 4ZEWA 3DAFA 1MB9A 1S6YA 3F3KA 4QODA 2HUNA 1DZIA 3LDUA 1R50A 2XH8A 2ZI4A 1ZIPA 2EQ5A 3F8SA 3LZCA 1ZH6A 3R6LA 4M76B 3GR6A 1C0KA 4QPNA 2XT6A 2QROA 1KR5A 2V8BA 4GX5A 2YJ3A 5HKKA 2YXLA 3OLVA 2C7BA 1W9MA 4PO9A 3M3DA 4F91B 5F4JA 1MAVA 2ORWA 4MVCA 3WJAA 5EP1A 1BDHA 1QQ5A 1GRCA 1D1TA 4P8RA 3TLEA 1N0UA 4DIEA 3D4NA 3S4YA 1H2ZA 2EJBA 4DG9A 5FPKA 1EP9A 1SCBA 1XDGA 5A03A 3DL7A 4P4SA 3Q10A 4OLFA 5IDXA 5M7EA 2GESA 1VB3A 1B16A 4M2LA 5CDGA 2RIRA 2YINC 4NU8X 3RTGA 3E8MA 3VISA 4IZHA 4LTNA 1Z17A 1O5IA 1YBVA 3OTOB 1PJCA 3T95A 5ADHA 3ASYA 3R9WA 1E7SA 2QJFA 4M0LA 4CUKA 2QM0A 1NTOA 1DWOA 4M98A 4A10A 3EFOB 3ELDA 3W34A 1WZIA 1XJQA 3FZEA 2DKOA 4FFSA 4Z6KA 4JI2B 1V3VA 3FUWA 1W0JA 4AUEA 4BMXA 1LSSA 5AM2A 4RSMA 3B2NA 4PFKA 2YZNA 5ILQA 3UMFA 3D3EA 4LXTA 4M60A 1PVDA 1OB2A 3C74A 3JQ7A 5F3RA 4IXWA 3E6AA 3AY6A 3NQ41 1JR2A 2PS1A 5K51A 5KYKA 2HEGA 2ZJZA 4NAHA 5EMHA 1OREA 4TV8A 1IVNA 2VJLA 5DDIP 1WVIA 4UNSA 3WO0A 1XZIA 3PF9A 3RFVA 3ZLBA 4B48A 3I9V1 4KXYA 2J4DA 2WTUA 4Y6PA 5K3BA 1CUBA 1QF9A 1Y1SA 2ZATA 4IV8A 1JFSA 3S40A 4OLAA 1V16B 3W6NA 1L4LA 4P36A 3RYCB 3NIWA 1IHYA 5K0CA 1E2UA 2WJGA 4GOXA 3JWGA 3ENNA 4UUBA 1P4SA 2A35A 1QRRA 4MV4A 1O2DA 1TUBA 4FCCA 5J2TA 2YVKA 4DDHA 5JJLA 4EQ6A 3O38A 2KE5A 4I6JA 4ZO4A 2B6HA 2IS6A 1M10A 3F46A 1J06A 1JP7A 2PLRA 3CNOA 3D6JA 4GZ5A 4URFA 1A2BA 1NBEA 3KLBA 5FOWA 4BAGA 2X5OA 2GPYA 2JVKA 4E2FA 1E0DA 4Q16A 4AQYB 1II8B 1T5IA 3I09A 4WZLA 1D2RA 3L6UA 5ALDA 2ONJA 2QE7D 3EAFA 2ZIFA 5JAHA 1YQDA 1YIDA 4YAIA 4I1OA 4P92A 1N8SA 3GJ4A 4FPXA 4N0MA 1U9JA 3F9CA 4RD0A 1GG2A 1RBQA 5FPPA 4YIKA 2VP2A 4ZC1A 5AVZA 5DNUA 3W1WA 4U2CA 1ZGBA 3NNDA 4FHFA 3KJIA 1NJFA 1V9SA 1WE2A 1TZMA 3PCXA 1IYZA 4N9WA 3CSDA 4N3CA 5I5GA 5D7NA 1R4NA 2IHNA 1TK2A 4P83A 4ZVPA 4CQLB 5KWSA 2MINB 1TGYA 4CCAA 3B6MA 1X15A 4C4SA 2VF4X 4HZUB 1SU8A 3I34X 2C4UA 1H9BA 1P7CA 1P4AA 2XVZA 4MUKA 3KSBC 3LECA 3X1MA 2FUEA 1DWUA 1ODFA 3MAGA 3KQVA 1C7ZA 3WQSB 1KO7A 4NTZA 2IX3A 1FSGA 3PQ8A 2EL9A 2O6HA 3WDSA 4P4LA 3RS4A 3UAWA 3ABOB 3R5SA 2YZKA 2Y2VA 2VNSA 2WFAA 3ZLTA 2PCLA 3NB0A 1L7BA 3LBAA 2XE8A 4HPWA 4AJEA 3H1AA 2WJWA 1JVBA 1S2DA 2PJDA 4M89A 2IYUA 3CINA 5KDLA 4AF7A 5EYPB 4MW5A 3AU9A 4WZ6A 3AWIA 1OWLA 2PSSA 2AUMA 2ZZFA 3M4ZA 4EGSA 4ZI2A 4O2BF 1TK9A 3ZD9A 3A1NA 1UM9A 1W49A 3JQAB 1BDBA 3CNEA 2OD7A 3LCRA 5KWVA 3E9EA 3ISVA 5MN4A 2Y1XA 5IX8A 2UV8A 4PQFA 3UOAB 2F8TA 3GCZA 1WXQA 4URVR 1OF1A 1Z12A 2P4QA 2JEYA 1EA7A 1NN3A 1S8OA 4TKOB 1YQGA 4KNVA 4C0HA 4Q1VA 3CIFA 1N2OA 5K0NA 4CRWB 4E1VA 1F2UA 1DO2A 2JFGA 1YKGA 4A1OA 3S2FA 5IAOA 1JAXA 3B9PA 1XFOA 1DIOB 1WKCA 3A2KA 1OOEA 5HFNA 2PWBA 3TEFA 2D6FA 4WGGA 4LSMA 2JCXA 2A0FA 3ZV6A 2JAXA 2H7VA 1ZQ9A 3PEUA 5LC1A 4G4SO 4L51A 2OQVA 4URHA 3VSBA 1AQUA 3DZJA 3X1JA 3A3KA 1RKXA 3LFHA 2VDUE 3AEXA 4MDHA 1Z6PA 4PGOA 1JU4A 3P2EA 1N07A 1TKCA 3RS3A 5JASA 2JZOA 1HL3A 3U39A 2H2AA 2WY2D 2D5IA 2HJGA 4JFAA 7MDHA 2RAPA 3CG4A 3UHFA 4BHTA 2GVNA 5EJ4A 1Y6RA 1QP4A 2ZCVA 1G21E 1K7CA 4NCXA 3LXUX 2QN1A 3CJTA 3Q41A 3P71T 4IGIA 1T1EA 4XVQA 5B2FA 2HZBA 5J2UB 1R4MA 4IQGA 4IP0A 5AKLA 4NR0A 3WLNA 2YICA 4QOHA 5DPMA 2V1XA 3WQRA 4FYIA 4ESHA 2C7OA 2IZZA 2G40A 4WOKA 1NJSA 3L7JA 1XFAA 4B81A 4E08A 4LDNA 4RYLA 1V1MA 1IBSA 1XR3A 1GQQA 3PITA 1M34A 3GOQA 3R6DA 2QM8A 3HN6A 3L0IB 2RHOA 4LTMA 4ZOCA 5FUBA 4K9DA 5FWAA 1AGYA 2EJUA 4ZXFA 5D3MB 4UZUA 5BRJA 5CB4F 3KELA 1I0IA 2W0SA 4BBJA 2O2IA 4JLSA 1I1HA 2TS1A 2WMDA 4B35A 3U7QB 2G4CA 2P8SA 2VATA 5JH7F 3C3AA 2RG7A 2VUTA 1OC4A 1YBFA 2Z95A 3GH3A 3DO8A 3R24A 4D1YA 5C5IA 4YO7A 3OEHA 2PX8A 4EJMA 3CVXA 1U8FO 4O2AA 3C5HA 16PKA 4DA9A 4BO1A 4GGPA 1TTHA 3GAFA 3HCOA 3TLGB 5KTOA 4PFSA 3KALA 4EO7A 1OLSA 4TL8A 4MQBA 2M1XA 1YKSA 5K0FA 3H5WA 1UXHA 3EEOA 3P9PA 4M8IA 1PI3A 3HLTA 5JNTA 3P94A 4ENWA 2VDPB 2ZI7A 4URYR 3MOGA 1D2HA 1RMQA 4C01A 3U4CA 1P80A 5LOVB 1E7MA 1G7CA 1ZN9A 2H16A 1O0SA 2FSSA 3E8SA 3DC2A 2K87A 3GEIA 1Q6YA 4N6GA 4EF6A 2PNJA 3ERCA 1U1GA 2ZAMA 1Z5ZA 2QTNA 1T9DA 1ACLA 4KQCA 5BUSA 3JAWB 1EVYA 3EC7A 4PYRA 3MUFA 3AR5A 3WLJA 1I0LA 4OTZA 5BOSA 4PBRA 1ZCFA 2XVMA 3HZHA 3S8EA 3O8RA 3VYVA 1WQ4A 1R8YA 4BMZA 1K88A 1Q7BA 5A3VA 3EJ6A 4RF3A 3ONYA 1O89A 1N6IA 1DOHA 2NZVG 1KOFA 2QSJA 621PA 1MABA 5F9MA 2RC6A 4XONA 2O50A 3DBRB 3L3BA 4BRZA 2PZBA 2WE8A 3KWMA 2BEJA 1KH3A 2WUWE 5TGDA 4FEYA 4LS3A 4I3FA 3W9YA 1CUJA 2B6NA 3TYXA 4G2TA 4PXSA 2GKOA 3LUJA 3N6RA 1WW8A 1DQSA 2IOQA 3ONEA 3KHUA 4QVGA 3ODPA 4MW0A 5FWXB 1N92A 1PWHA 2WABA 4DSUA 2CXQA 4BKOA 3PQ3A 1GPWB 3Q3CA 3PYMA 5A06A 4NY1A 1E8DA 2B61A 2Y4OA 1VMEA 3LBIA 4JKOA 3HLKA 4NU5A 5GP1A 2PKQP 1DUIA 4C5CA 1YX2A 3EWSA 4WWHA 4ND4A 1BKYA 5FBKA 1NVUQ 3CCUB 3IUBA 2L69A 3Q4GA 1P2SA 1TIKA 1U1DA 1VFPA 2OQ2A 1Y8CA 5EWLA 3TRJA 4DAOA 4MVJH 1ZNXA 4FN4A 5FBWB 3FUVA 4JP2A 2J0QA 1BCRA 4LYJA 3LNNA 1UBTS 3R5XA 1T8TA 3IUMA 2FPOA 1ICEA 1YMQA 1EVQA 2AC7A 1KR2A 2P3OA 2BBWA 2W2LD 3ENKA 1QZZA 3GUHA 5BPFA 5C5CA 3C6QA 1PW5A 1V0JA 5AK0A 3TZ6A 4RU1A 1GQFA 1LTKA 1GILA 1X86B 5JAQA 3WRXC 3KSAC 1KKUA 1SXJE 4OFBA 1ONPA 4K6GA 4LA4A 3JVVA 3ZLVA 1HO3A 4TZKA 4HYYA 1GY8A 4RH0A 5ERYA 3DTYA 3MSXA 4C06A 1AGNA 4QC2A 3T5BA 1DFGA 1Y98A 1XTBA 1ZMTA 5SV2A 3GVHA 5ALWA 3EC2A 4MQEA 1QIJA 1ETHA 4K86A 5JZBA 1X1EA 4GM1A 2FFRA 4BTLA 1FW8A 1O4VA 5G53C 4ILKA 1I3MA 3ASVA 1CUHA 3A10A 4GI2A 2AQIA 3LY8A 1CP2A 2CVPA 3R0VA 4F3RA 2YOHA 2WDZA 1A77A 1A97A 1RP7A 1U0GA 3A4LA 4XIJA 4OF4A 4AY6A 2SKCA 1Q1EA 1YJCA 3LPNA 4B7XA 4ZMSA 1MC1A 3B5IA 2PKCA 3ML1A 3UJ9A 3FXAA 5D3QA 3VHRA 2ZPTX 4EKIA 2FR1A 2OK8A 1FCJA 3HU1A 3VBEA 3VH3A 2CXUA 3FZNA 2HJWA 2E6KA 2CK3A 4JVMA 3T5GA 4EMSA 3OH8A 3HB0A 3NZEA 5A0FA 5IF9A 4IF6A 3OA0A 3SXPA 4G37A 4HLDA 4BV9A 3PJEA 2E7ZA 2XUQA 4E21A 5C0OE 1M6VA 1YH3A 2PRYA 2X4DA 5ERXA 3A3NA 4BNMA 3RWMB 4S05A 3I0NA 2J3MA 4BN5A 3PTZA 3RIMA 2RGXA 5LSAA 3CW9A 1DADA 4OATA 2EWVA 4JQZA 4FN5A 3ZE0B 2XMBA 1HE1C 4G67A 3UGTA 3AM4A 1XLUA 1RR6A 4LV8B 4YB8A 3UJNA 2KS6A 2JGAA 3F4BA 3GEHA 3OCVA 1NNSA 1V5GA 3CPSA 2JFWA 4AZ3B 4XIFA 2YWFA 3L8MA 4W9NA 2A58A 5C4MA 2UYCA 1B15A 4DVJA 2HPZA 4H4CA 3L9WA 3LPLA 1ULBA 3DO5A 3FFXA 3IOCA 3NTOA 4UAGA 5BSTA 1OFHA 1O97D 1NP3A 3VAZA 4B47A 2FVYA 1V7PC 2R00C 5PNTA 2DJ5A 3DXFA 3QVJA 4WV3A 1J39A 1XDSA 3PC8C 4U7JA 4ETWA 4Y2UA 1LB1B 1SUBA 3AY0A 2KW5A 3PNLA 3UKJA 3CISA 5IXJA 5T8KA 3SIPA 1XTIA 4RTRA 2AZMA 1S0UA 3O4JA 1PBTA 2AKYA 5F1YA 1K28D 4D92A 4RDLA 3D7SA 3TI9A 2VP6A 4L27A 3WIBA 4TRNA 3MGKA 5F35A 3ND6A 4Z4HA 5K4GA 1P73A 1Z4IA 2FPXA 1JSLA 4OH7A 5FDFA 4G65A 2QQGA 5C46F 5JDIA 1RI5A 2P1DA 5EVCA 1BS2A 1EWQA 2ILTA 3I01A 3QEMB 2JGLA 2JGMA 2OHIA 3H1GA 2EFGA 2NSJA 5FPTA 4QWWA 1L5WA 4D45A 4MVJE 1RACA 1R37A 3HCCA 5DWVA 2CHGA 3JQ8A 2X4IA 1PWEA 4XIGS 1QF6A 3IS3A 4CT0A 1PJ6A 4PC3A 1Z08A 1MB2A 2ZEJA 4MGYR 4GNKA 3K6SB 3OA2A 4AKEA 2VTBA 3DDUA 1Q81D 3E70C 5BVHA 4N0DA 4ZT7A 4IXTA 2HU5A 2VTVA 3AUFA 2ERXA 2GO1A 4DWWA 3PNMA 3DL2A 4GOKA 2IZ0A 5EIAA 4YJ3B 5FTMA 1W35A 2RARA 3BCHA 3PVDA 3HVHA 3WV4A 4RTLA 2DFLA 2PMCA 4O8CA 1EMDA 7REQB 3FVRA 2AOTA 2AXEA 2LWIA 2ZRLA 2ZI6A 3MTJA 2IUUA 3V8PA 1JXOA 3PX3A 4JBXA 4DWOA 1FTSA 3UJ6A 3VVMA 5C4IA 4J16C 5F5LA 1UC5B 3KKNA 1SHZA 2FPPA 4QUAA 4HF7A 1U1IA 1M76A 4WNIA 1K5PA 2D00A 3TKAA 2JCSA 3LLCA 4DM4A 3UV7A 4J0CA 1U1CA 1US8A 2QSUA 3IL2A 2GZAA 3AFHA 1ZA2A 2J5RA 3CX7A 2V5VA 3ZWAA 1SCJA 5HQ3A 1XZ8A 3SEAA 2H48A 4F56A 7AT1A 3WFJA 3B1WA 5GV8A 5HIJA 1P0FA 2QN3A 2J0UA 3U3XA 1B00A 1Q14A 1C29B 3SLGA 2MSCB 4C7VA 4H59A 4FYMA 2Q1SA 4FLEA 1ZHOA 5CUQA 1JTVA 4XR9A 3RHSA 5LVAA 3L9XA 3U48A 5IDQA 3LUPA 4U9HS 3KOUA 3AY3A 1ZD8A 3P4UA 2AE1A 2QJRA 4DCVA 5DBHX 1Z8DA 5ALZA 5HKOA 5HUHA 4XMYA 5JAUA 4NI5A 4RA6B 4RDHA 4BLOA 1R0BA 2GN4A 2MYUA 3INGA 1DKQA 1E20A 1LBSA 3BS4A 3L46A 1XEWX 4WUVA 3RRNA 2W2MA 3DCNA 3FWKA 4ZCSA 5SZHB 3VNVA 3DE2X 3I32A 4XQGA 4AKGA 4NESA 3TLJA 1NVFA 3FCAA 4KQGA 3ZWDA 1JG1A 2ZCUA 4LXIA 4BZXA 4DQ0A 1Z2OX 4NHOA 3P27A 2B2XA 2A59A 3DHNA 1NC1A 3LLVA 3NHUA 1ULHA 5CM2Z 1M66A 2WAMA 4P26A 2V4UA 3KZVA 3R77A 4CFZA 1XP8A 1SCIA 1TIPA 2QP4A 1JHMA 4KX3A 1Q1BA 3R9XB 1ZD5A 4BNDA 3L7OA 4UNRA 4L1KA 4JOCA 1H94A 1SD5A 2JVJA