4RD4A

Structure of aif2 gamma from sulfolobus solfataricus bound to gdpnp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
413
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 413
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd4A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd4A01
4A0HA 2AFHE 2REOA 1Q82D 1XXHB 1Q1QA 3BGWA 3NBXX 4QHSA 1N25A 3BK7A 3CW2A 4TT3D 3EPLA 2HLDD 3SYKA 2PBRA 4NHOA 2W83A 3QFSA 4BPRA 2CNWA 4HB4A 3IQXA 3CCJB 2ONJA 1II8A 5G53C 3CD6B 5AWFC 2HXSA 2P5SA 1GUAA 4QNRA 2RGEA 3W2IA 1OKKA 4B6FA 3UPUA 1HTWA 1R0XA 2OESA 2QPTA 2WKQA 4F92B 1A82A 1ZCBA 2BJWA 1X8LA 3QF7A 3U6BA 2DFNA 3Q3JB 3CCQB 4ZCLA 4WQMA 4C0SA 2C95A 2IXFA 1CIPA 2IXGA 2LKDA 2IHYA 1VQ4B 4LYHA 3B7GA 1KSJA 1G6HA 4V0NA 4U9UA 1OH5A 4NYMQ 2JLSA 4XH9B 2ZAMA 1GRNA 3MSXA 1AIPA 2EFGA 3ICQB 1TUIA 4R9UC 1T3LA 2HJGA 1JA1A 2RCNA 2IYYA 3B8HA 3CCEB 3CM0A 4HI0E 4PO1A 2QTZA 5CYPA 5C18A 1YHNA 3V4FA 1SQ5A 4FCVA 4POAA 4FMCF 1YI2B 2REBA 2YV5A 4I99A 4LJ7A 1TEXA 5TB5A 4ZCIA 3DDCA 2FE4A 4Q1EA 5J4LA 1KNQA 3VR6A 3A1TA 1XTRA 1CNEA 2YJTD 1OH8A 4BLTA 4Q7JB 2XNCA 2IHBA 4UNPA 2QP9X 2NMVA 1W4AA 1IY2A 2RKOA 1K5DA 3AKDA 4YMWA 1A2KC 1CXZA 2QEQA 1SXJB 4Z54A 4UXHA 1KO5A 2GCNA 4DSUA 3ES9A 2ZE7A 3TVDA 3KZ1E 4B6EA 5CDFA 1WRBA 3UATA 5FOVA 1IN8A 4A9AA 1P2VA 2Q3FA 4UNSA 5DI3A 1XMVA 2AWNA 4LSGA 4M1KA 1UF9A 2J41A 5DN6D 2C77A 1FMJA 3BFXA 3UG7A 5JEDA 2IK8A 1UKEA 3ZLJA 5F2EA 3UG6A 2O0HA 4D6PA 2YWEA 1NJID 1AKYA 3IEUA 3QJYA 3AVOA 4Q4HA 1NVVQ 5FTNA 3SDZA 3THYB 1KO8A 3BWDD 4PAOA 1Z0KA 4TL6A 2PCLA 5IRCD 1ZM9A 4JBYA 4YXWD 3K70D 2CVFA 1Q3TA 2CHGA 4E03A 2BKEA 4LV8B 3NH6A 1R10A 1TVCA 3REGA 5L3QB 1PLJA 1Z6GA 1F3OA 2WKPA 2XOKA 4QXAA 3OFND 1NN0A 5HTKA 4N3NA 2W6JA 4A2PA 4AKIA 1T8TA 1E0KA 4IEIA 3VR1A 3DKPA 1UDXA 4MUBA 4PC3A 1JAIA 1P9WA 1NLZA 3IBYA 3PUXA 1XCPA 5J4YA 5IK2A 2VNKA 1FMLA 3EW9A 1P5ZB 3I73A 1E1RD 2FOLA 4WZ6A 2EW1A 4AF6A 5JI2E 4AY2A 3E70C 2GAOA 2ZXUA 5EP4A 1RFLA 3LDAA 4G1UC 3ZVMA 1JECA 5KPDA 2A3RA 4D81A 2OCAA 1G7TA 1CULC 4LV6A 3W3ZB 2A78A 2XTZA 1G17A 1G19A 4YMSA 4TMWA 4P3YA 1W0JA 1WXQA 2C5LA 5G3ZA 2IYZA 4D0NA 3HYRA 2ZSDA 1GITA 4UXJA 3AM1A 2F43B 3SBDA 1AN0A 2WJVA 5B30A 4NDZA 1RZ3A 4OKSA 1R0YA 2HXYA 3DHWC 4L5BA 5GJCA 5KSZA 3ZQJA 4B71A 3VR3A 1R5BA 2AD5A 4OQNA 4UNRA 3IQWA 4NL4H 4R98A 1KGDA 5TVKA 1IJEA 3EPJA 2ZJYA 1ZRHA 4TMKA 2P65A 1S3SA 1E96A 2GXUA 1XB2A 2Q9AA 2NTYC 1WE2A 1EFUA 4IDHA 3AVWA 4TYQA 1GVHA 5SZIA 1JEDA 2IBMA 3EZFA 3OEHA 2ZU6A 4WZBE 3HWSA 3EASA 3LLUA 2QROA 2HT1A 4KO8A 4UNQA 2WWXA 4HAWA 1Z08A 2RGDA 3FPAA 2QL6A 4WXRA 3GJ5A 1U8AA 2JLYA 3SJZA 1E94E 3PVSA 3KJEA 2FSHA 1PV4A 1QVGB 4LHWA 1E0JA 1PLKA 4LY6A 2ERYA 3H86A 5D3QA 1ZIPA 1YJ9B 3BB4A 3MWJA 2NG1A 4D0GA 1QBKC 3QOFA 4LHVA 3GLHE 4LBWA 1E2KA 3IKJA 1QFZA 1DS6A 4BFXA 4D4JA 4DSNA 1FX0B 1KRHA 3W8RA 4BWYA 2VA8A 1QHHA 2OAQ1 1VYVA 5CLQA 1JQLB 4AI6A 5H59A 3Q5EA 1FNBA 4M1YA 4NCNA 1EFCA 4LJYA 4DDUA 2XB4A 4KSBA 1KJYA 4XOIA 4JZKA 1QVFB 2EVWX 1TUEA 2JLZA 4C0HA 2XXAA 1GL7A 4CT4B 2X3UA 5IK2D 1XEWX 2FX3A 1KHTA 3TQFA 1I2DA 1P2UA 521PA 1XNJA 4ZDWA 3LFUA 4YAUA 1LS1A 3T34A 4QKQA 3CLVA 1ANKA 2FV8A 1SKQA 1NVUQ 2JLXA 4O25A 1JEEA 1T3HA 4TSFD 4R71A 4HDOB 5DIFA 4JLBA 4GPTA 4MKIA 4TL9A 4YONB 3H84A 5KDOA 4ILEA 1ZM7A 5JFGA 2PJZA 1QG2A 2C99A 1CKEA 2IEYA 2NQ2C 3AVYA 5IHPA 2QDXA 2ZRJA 2WZQA 2QY9A 2KBEA 3KFXA 3SR0A 4A82A 5BN5A 721PA 5JSZB 1MO5A 2J5XA 5JWRA 3I8XA 1AGRA 3GEHA 1E64A 4NP6A 2FPMA 1TLLA 1XD9A 3B1ZA 4QBIA 1VQKB 1KK3A 4N3GA 1TTTA 1SVWA 2P0EA 1AQUA 3A4MA 3ZQ6A 4AYTA 2WWIA 1H8HD 4HAXA 4TZ6A 3A1UA 1SHKA 2QPAA 1M1KD 3QBVA 1RJ9B 4FCTA 3DZDA 1B2RA 3MHPA 3DOEA 4Q4AB 1ZU4A 2XSZA 4B34A 3U7FB 2HCJB 1G20E 4L9SA 3EA0A 4FK8A 4LBVA 3ZZ0A 4KXFB 2CE2X 4MYTA 1EFRA 1R8QA 4G3XA 4ZKEA 1DAMA 1RIFA 2EQBA 2V1UA 4BE7B 2DFTA 1SXJD 3K0CC 3ZBUA 3EZ9A 2ZRLA 3X2SA 1BJKA 2FZ4A 1W0KA 4QJ5A 5KU1A 5CM8B 1XJ0A 3UANA 4EDHA 1Q0UA 1I4LD 5EZ5A 4NYIQ 3A4LA 2WV9A 1S8FA 1OFTA 4Y9RA 3LBHA 4IKEA 4C0JA 4WZAE 4QGGA 2R6FA 3REFA 2QMUA 2ZJ2A 4HDCA 1FTNA 1XZQA 1N6HA 5FBQB 3SHWA 2VEDA 5FUVA 4BZXA 5TMPA 2FZLA 3W2HA 2ZRNA 1ZNXA 1PUIA 3QKSB 3THXA 4D25A 1H65A 5KYKA 2QTHA 2BMFA 4TT3A 1GRQA 3BBPA 3MLEA 3K0EA 1ZUHA 4JLJA 3A58B 2LCFA 3P32A 1ZU5A 3S1AA 4OQFA 2B7CA 2LWIA 4M22A 1GAJA 1KKMA 2BKUA 4ZCMA 4C43A 1G41A 1Z07A 3KQLA 3I61A 1E3MA 1M8PA 3HPQA 1XTKA 5DYIA 4PTLA 3AF1A 2O8DA 3K53A 1EWYA 1W47A 2ODNA 1OXUA 1VG9B 5FUYA 2QMHA 3RRMA 2JLUA 4JKYA 3U44A 2BVNA 1V43A 3MAAC 3TUZC 3ZZTA 4PPNA 5FPTA 3PEWA 2QBYB 1QG0A 1KIMA 1U94A 5P21A 3FMIA 4BFVA 2IYLD 3I1FA 1VCMA 1NN1A 2PL3A 3CZQA 2IYWA 1FNNA 3JZAA 4KVGA 4EPRA 5KDDA 1RJ9A 3I8SA 4HLUA 5DGXA 5F3WB 3HYTA 4DSTA 4BFUA 3ZD7A 1G8GA 1E4YA 1KSHA 1EX7A 3DM9B 4OHWA 4EPVA 5J40A 3W9YA 2F3RA 1L4UA 1S2MA 2C78A 4IOKA 4B2LA 3DPUA 1UFQA 4G5SA 1OKKD 1X3SA 1Z28A 2PEYA 2PZEA 2VP4A 4CGZA 2VHCA 4PZZA 5IT5A 2BBOA 4L8GA 2GXSA 4GL2A 4HLCA 5FPHA 2VL7A 4CEJB 3GLFE 3EZ2A 3K9NA 4F7WA 2GZHA 1HT2E 2FA9A 2OV2A 1J99A 2ZI9A 1IN6A 4Q9KA 1XTIA 2OM2A 3LW7A 2Z5FA 2O8CB 2XNDD 2XNJA 3ONWA 2W0SA 2H8KA 1GIAA 1VHTA 4GDFA 1KMHA 4XD7A 3NEYA 5FTJA 1OIVA 2CBZA 4RFSB 1ZM3A 2Z4RA 4GZMA 2J45A 1JR6A 2J1LA 3RS3A 3LAWA 4DLRA 2OFXA 1FP6A 3CX7A 4Q1DA 5FI0B 3RANA 1RYHA 1K5GA 4QRHA 3B1XA 1M7HA 2QTLA 3ECCA 1VECA 4MKGA 1MKYA 3U4QA 2D62A 4PR0A 5AUQA 4M9QA 3QFRA 1HQCA 3SE0A 3U5ZB 5CK4A 2XOKD 3GLFB 1Z6XA 2R9VA 1G16A 4N1AA 2QZ4A 1G7CA 3NC1C 5J5CA 4BZQA 3KQUA 4M1MA 1BH2A 1HQYE 3N5CA 1JJ7A 4RD4A 4A1FA 3OZWA 1VCOA 5CLLA 3I72A 3LLMA 4C2TA 1N6IA 1DPFA 2ODEA 2W0MA 2BOVA 5EXXA 2JJ1D 2ZRHA 1AS3A 1DE0A 2HUPA 2EYUA 2DCUA 1CTQA 2D2FA 4B4DA 4LZZA 2CMKA 4FMDB 1WF3A 1W87A 3CCRB 3MD0A 4U7DA 2HCBA 2Q21A 3U4QB 1KI6A 3T1QA 1YZNA 1WQ1R 4TTQA 1NMZA 3N2EA 3SEAA 4KHZA 3UXMA 3OZUA 3C5CA 5CYOA 2AX4A 2G1JA 3RNLA 2H18A 4FMDF 3VX4A 3F5FA 1PLLA 1D2EA 1W2BB 4DB4A 2GNOA 4JL6A 3PUVA 5BXQC 2GJSA 3ZJYA 3AVTA 3ZZUA 4F7DA 4TL8A 1W0JD 3VX3A 3G6EB 2ZSBA 3GLIB 1HUQA 4GBMA 2VIIA 2OLJA 3K09C 4JL8A 2EFDB 3TAHA 3ZIAD 1N5JA 1SVOA 4YDHB 4KI0A 3CNNA 1N6PA 1T4GA 3SHFA 3QQ5A 5C1BA 1O3YA 3G71B 2Q9BA 1K8RA 4QGAA 2REXB 4IFBA 2OTLB 3B85A 4UXIA 3QFCA 4TMTA 3ADCA 5KOYA 3QE2A 1KI4A 3QE0A 2WWGA 5EE5B 3I4LA 2AK3A 2RAPA 5BQ5A 5KHOC 5FTMA 1JALA 1Q57A 4XWKA 3LH5A 2PJRA 3LO8A 2QMOA 4EKDA 3SYNA 1W5SA 1NVXQ 1TX4B 5JJLA 2OO7A 3KDSE 3CPWB 4TTRA 4DUGD 1XD8A 1D8TA 2EU8A 1W5TA 1XP8A 2JLQA 4Q5IA 1VIAA 1YR6A 1YJWB 2VSOA 1S96A 3MJRA 4O0MA 1CU1A 1F2UA 1JJVA 1P2TA 3FHOA 3GJ7A 1GL6A 3DVLA 4MRNA 2ZR0A 4X8LA 2CLDX 4RD2A 4BFWA 4DCUA 3UWOA 1E6CA 2VNIA 3QBTA 2QBYA 2CL7X 4ZDJA 2F9MA 4EFMA 2R6AA 1G21E 4G1BA 1AJEA 4EAQA 2VNJA 1U0HC 3J81k 3QI2A 1XTSA 1WA5A 2IC5A 1Q20A 1W36D 3FTQA 2ZYUX 4A8JA 4HEJA 4RJLA 4OHZA 5C2JB 3AP3A 1S3GA 3WYFA 3LO5A 1FTSA 4JVLA 4OL0A 3AVPA 5EP2A 2V55B 1TF5A 5CB6A 1EP2B 2GESA 3B82A 1Z22A 2DBYA 3U3JA 2V9PA 3JZMA 3QXXA 2XZLA 3U44B 2ZJ5A 4NYJR 1CNFA 1X8JA 2HJVA 2I3BA 3MGCA 5E7JA 4QHTA 1J8YF 4LBZA 1GJRA 3BXZA 4RKEA 5FI1B 5KSYA 1W36C 2VTKA 1Z47A 3PFIA 2OBMA 2PCJA 4FWTA 2AL7A 4DC9A 3GLGE 4RVCA 4YMVA 2RC5A 1VQLB 1SXJE 3EIEA 4GRAA 5DISB 1VMAA 3OAAA 3SZRA 1TMKA 4ZI3A 1U99A 5K8UA 5G40A 2DR3A 3RS0A 1J7KA 2VO1A 1OSNA 2WJYA 4ASUA 3GQBA 1D6JA 1G3QA 2J9RA 1EP3B 4A2WA 4MDEA 3FOZA 1OPXA 1UKZA 3QKSA 3U3MA 4DLZA 3THXB 4FXPA 3KB2A 4V0LA 5HCIA 1CR2A 3UMRA 2AFIE 5EE3A 2J0SA 5JBQA 3LVQE 3K0SA 3K70C 1RVDA 3WNDA 4YAOA 1F2TA 1JR3A 1Q1ZA 1QHNA 2RH5A 4AKGA 2EYQA 4GFDA 3CC2B 4F4IA 4QJ3A 1FUKA 4A8JB 3CZPA 4LX0A 3CXCB 5A5GA 5FTLA 3LQRA 1G64A 4JL5A 3VQTA 4XVRA 3UWKA 2RGCA 4CRWB 5KPJA 3ZD6A 1KMQA 3FMFA 4PPGA 2IL1A 2JDIA 2ORIA 2NPIA 4LHZA 1Q3HA 4JBWA 1X1SA 3CWQA 1XCMA 5ANRB 1TL7C 2F1IA 3GLGB 2ZM5A 2D06A 2BV3A 1OXSC 2VF8A 5DHFA 1ESNA 3QKRB 2BMJA 4M9ZA 3T1VA 3CX8A 4LHYA 4R2HA 1JXMA 3CRMA 2FN4A 1RRGA 1XRJA 4FINA 4LWZA 1ZW6A 3FJOA 1H8HA 5F9FA 2H7VA 2OAP1 3GJXC 1DDIA 4ZPXA 2ZREA 3ZYCA 1QDEA 2ZJOA 1FNDA 5DH9A 3FYHA 2W6IA 2N42A 1KO7A 1T5IA 4A6PA 5LBIA 4BFTA 1XPOA 6Q21A 3RWOA 1SHZA 1RRCA 4D0LB 2W58A 4Z1MA 4TQ9A 3P26A 2IS4A 2WTUA 1NN5A 1NI3A 4GI7A 1H42A 2GETA 3IBGA 3KKNA 1G3IA 4IFEA 1G3RA 3EC2A 2Z43A 3C7KA 1Z0AA 4B43A 3R7WA 2IW3A 5JHGB 3PUWA 3RS5A 1YKSA 1D2MA 4CT5A 4RZ2A 4P6VF 4BFYA 1IN7A 4EPTA 4LUCA 1W36B 4JLNA 3L0SA 4F38A 1DBSA 2WWHA 1VIYA 3SJAA 4Q00A 1A1VA 1T6NA 4I4LA 1GILA 2J7KA 4PO8A 4ARZA 3GFPA 1VYTA 3C14C 5HE9A 2ZSFA 3AGQA 2DYKA 4I1OA 2YKGA 5AUOB 2FEMA 1VQ7B 5HZKA 4PC7A 5TR9A 1J2JA 1G4UR 3D8BA 2GF9A 1NMYA 4ASUD 1JPJA 1BX1A 3TW4A 3B1YA 1TQ4A 2QE7A 2QM7A 3PG5A 2IF2A 1DAIA 2L0XA 1FOEB 1SM4A 4ITRC 4DWJA 3LW8A 1HEIA 3FWYA 2I4IA 1YZGA 4Q21A 3TGPA 3VNVA 3QXJA 4Y0VA 2X2FA 3M1IA 3TH5A 3OJXA 2VP2A 1Z0JA 2IT1A 2LKCA 3AEZA 5B2ZA 4Q47A 4HB2A 3CPJB 4TYWA 1N6RA 1UBEA 3PJRA 3TUIC 3W34A 1DAHA 1CR0A 1E0SA 4ZO4A 4PC6A 3KQHA 3K9LA 1P60A 4PHGA 2X1VA 1IBRA 3A1VA 5KUTA 1LS6A 4QGFA 1WP9A 1J9ZA 3OIUA 2P6RA 4ZDKA 1U8ZA 3GD7A 3WHKA 1LF0A 2ZTSA 4S35A 2GCOB 2IYTA 4EPWA 4D2IA 1TAGA 4HUQB 1E2JA 2GPJA 2HF9A 3I32A 5CJ2A 1ZUNB 1G8FA 1T9HA 3SS8A 2GEDA 3JQPA 1J8MF 1ZNYA 2VSFA 4KYIB 3LD9A 5FOUA 2OCYC 1NVVR 4V02A 5JMTA 1OXTA 4CDGA 1KDOA 1OGJA 1BIFA 1G5TA 1GDDA 2WMOB 3IILA 1D9XA 3AH8A 4BLRA 3QG1A 4TYYA 3GLHA 2YZ2A 1ESMA 4DDVA 2VQSA 1FRNA 4CEJA 3AP1A 1R4AA 1E0AA 2WPDA 2X19A 3ASYA 4Q02A 1ZP6A 3CR7A 2CNWD 3FHCB 5H8WA 2GJKA 4WOPA 4XIGS 3FE2A 1IXSB 2OZEA 4GOXA 4RKFA 5KNDA 2OCPA 2HF8A 5E4FA 4MUAA 4HB3A 5GJWC 1X6VA 5BWMA 2GDJA 3Q8XB 1XMSA 1N8RD 2FEOA 1T8UA 3BE4A 3RS7A 2ZPTX 4YALA 4QJ4A 3ASZA 2AN9A 2BBSA 5E7IA 3OIVA 2P6UA 2QE7D 1BOFA 4RY2A 2J59A 4BEBA 1KJZA 1KDRA 4HDQB 2OK7A 2QUZA 1SKYB 5AK0A 1YJNB 3LX5A 4M2LA 1XD2A 4LDJA 4QC2A 4L16A 5B57C 1WBBA 4LC0A 2B5OA 4DQKA 3QFTA 2C04A 2R62A 1W1WA 4FMCB 4ESHA 2ZYVX 4KFTA 1II9A 5C46F 4CW7A 1G7SA 3MG9A 4XJXA 3ETLA 1DAFA 5F98A 3I3SR 4AWXA 5DI3B 3EA5A 1UBGA 1XJQA 4LRWA 4D26A 1DTSA 4PC2A 3IEVA 5EE1A 3K8YA 4LGMA 2O8DB 3I5XA 2PIAA 5SZKB 2O8EB 1Z83A 8OHMA 1E99A 1XXHE 1GAWA 4I1SA 2KJQA 2GK7A 1TQ2A 4W5WA 2ZYWX 3R9IA 4M0LA 2IS2A 3S1AB 2KSQA 4IVRA 2K5UA 3NG1A 2WMNB 4DHEA 4C0QC 4DUGA 2GWHA 4C2UA 1ZD8A 2RHDA 5AUNB 1COWD 3F0TA 4RD6A 3CUEF 4H1VA 1QHGA 4AYXA 3QEJA 2JJ2A 4JMPA 3L0OA 3T12A 2DY1A 3ZGXA 1CP2A 3OEEA 5K8IA 2FGJA 2GZDA 1VQOB 1M7BA 4E5UA 2OXRA 4KFSA 1JNYA 2X8AA 1VQ6B 2KB0A 2BM1A 1K6MA 3OFNA 4MYCA 1MRNA 2W6JD 2GXQA 4UKDA 2ZETA 2F1HA 3HPRA 4NPHA 5L3SA 4F4CA 4I81A 1YJ5A 3KJIA 5FL7A 421PA 4EQ6B 3Q9LA 1R6BX 2IXEA 2JAQA 2VYFA 1R7RA 2ZJAA 4YMTA 1NY6A 4FMBB 3IDQA 2VHTA 3BAFA 2E87A 5BYJA 2VYQA 1OXVA 1YR8A 3VO1A 1N5KA 3A8TA 2AXPA 2CXXA 4Q4AA 2G77B 2HEIA 3CRQA 4QBGB 4OQLA 3CCSB 1Q21A 3THOA 1PJRA 5JECA 4JLPA 2JA1A 2QAGB 4QM7A 2C9CA 4AG5A 4TMZA 3LBNA 3BIFA 4TLDA 4HE6A 5JSZA 1VQ5B 4LJ6A 2QGZA 4F91B 3NDBB 2A30A 3MWLA 4BECA 4TN1A 1YZKA 1WB9A 4LPSA 1Z2AA 5EXTA 1CR4A 1CJVC 1E1RA 4Q1CA 3BRWD 3RRNA 3SOPA 1CRPA 5JWOA 1QGYA 4AIIA 2J3EA 2ZANA 3VU9B 3KJHA 3CPHA 1PUJA 1UKVY 4C0KA 2BBTA 1AMOA 2A5YB 2XXAB 2FSGA 2BGJA 3B9QA 4HAYA 1XD2B 3FKQA 1NDHA 5E3HA 2RC6A 3LNCA 1DAKA 3CC4B 3T61A 4YHBA 1NBME 1YZTA 1KD1D 1E9EA 1GOTA 3Q7QA 2FH5B 1UJ2A 5HE8A 1RC8A 2DHRA 4KU4A 2QG6A 1Z29A 4Z8XA 2GAAA 2ASEA 1N6OA 1S1MA 2NZ8A 2ORWA 5FOSA 5H70A 4PAQA 2JJ2D 4G0NA 1KC8D 4OJQA 3SYLA 3I5YA 2HDNB 5IDVA 4U5XA 5DYGA 1KI9A 5L3RA 1UAAA 3AVUA 1RYFA 4BRUA 3KUCA 2X2EA 1E9BA 3WRXC 1W2HA 5FOWA 4Q7KA 3QVVA 4Z1MD 1AZTA 3IHLA 3O8DA 1BMFD 3THWA 1FQKA 4JLKA 1SVKA 2WOOA 2ZRIA 1Z0IA 4C30A 4DB2A 4IRUB 2CCKA 3TR0A 1E2LA 1NBMA 1FNCA 5FA6A 4RD3A 2QQEA 3ZS8A 5KNCA 3MWKA 3BORA 3WP1B 5FTKA 1KQSB 4DCSA 1KZGB 2ZRCA 3W6OA 2CEAA 3SC3A 1NLFA 2WBLC 4NCKA 4BFZA 4B3DA 2NO9A 4MGKR 2GCOA 1QHSA 3X1DA 1L8QA 4NYIR 4B2IA 1HURA 4NCIA 1Z3IX 1HE1C 4YAFA 1N0WA 2ZE6A 3TJZA 4JVSB 3RHFA 3MFYA 2MSCB 2H5EA 2IF0A 1VTKA 3TR5A 3L0IB 4B76A 1E62A 1MABB 1FFHA 2CNDA 5GV7A 2HMAA 3CKLA 3GJ6A 3W6PA 1E9RA 2QNRA 4OQXA 4KODA 2F55A 1P62B 4KLZA 4U00A 5D3MA 1JJ2B 3WMFA 2QTFA 4HATA 3Q5DA 4Q4JB 3QVUA 1YZLA 1MO6A 2YOGA 3PEYA 4OBEA 4JIMA 3ADBA 4D82A 3N70A 2PH1A 1N0UA 2JGNA 5AR1A 2QQ0A 2QAJA 2Q3HA 3W5UA 2OT3B 1L7VC 1AS2A 1GO2A 4OI2A 2P6NA 1Z6TA 4JLOA 4KCGA 3AF3A 3OW2B 4JVMA 1LF5A 2CLCX 3NHBA 4HLQB 3A36A 4P32A 1HV8A 4G1VA 3PR1A 4C9BA 4CYMA 1W7AA 3LXRA 3TW8B 4QOSA 1S0UA 1ZCAA 3FKSA 4B3FX 5TV2A 1BYIA 1GWNA 2VF7A 1ELOA 3W2EA 3OE7A 5GVRA 4GP7A 3KJGA 3BH0A 1AZSC 2WAXA 3BB3A 3LY5A 1S4QA 4GOKA 4LK2A 1ZIOA 2BJVA 3B60A 2ZS7A 3CCVB 1BMFA 1MOZA 2IS6A 3RC3A 1TF7A 2CJWA 2XGJA 1G291 4Y7CA 2CK3A 4IDOA 4PPFA 4WA7A 2IEZA 1YVDA 5FUWA 1VPLA 2EWWA 4GT1A 1XEFA 3CMAB 3H1TA 2QAGA 3PV0A 5E95A 5FBWB 4F93B 3PUZA 3E20A 3JVVA 4GNKA 3KKQA 2D7DA 2XZPA 2IA5A 1DADA 1U0JA 1Q44A 4NCJA 3KXIA 1IM2A 4B47A 2ZVPX 3QXSA 3A37A 2WSMA 1N6LA 5JEEA 5A4JA 2RGAA 1LVGA 1O87A 2PT5A 3PQCA 3V9PA 1ZNWA 2ZR7A 1Z0FA 4TWZA 5TARA 5CDFE 5EE9A 2G1KA 3VR4A 1IY1A 4C7OA 4B3BA 4ZDIA 5AJZA 1ZC3A 2CL0X 2BF4A 1CEEA 3IPYA 4BGDA 1W34A 4ZV4A 2GJAA 5KSOA 2YWFA 1Z63A 3OJWA 1G1MA 1KJWA 4C0LA 2H57A 3UMSA 4DCNA 4W7SA 4FWIB 1P3JA 1VG8A 2TMKA 1IXRC 3SNHA 5FBVB 3R9WA 1GRRA 4Q9JA 4MGIR 3DOFA 2GKSA 4XVQA 2FFHA 3HR8A 2CCGA 3KTAB 2D2EA 2QP3A 2ZYTX 4IXMA 1DVRA 4Q66C 4FI3C 2O0JA 3HJNA 2Z83A 4URWR 3ZBTA 5FPSA 3TBKA 4Q9HA 4XD7D 4YAWA 2B6HA 2MMGA 4LOAA 3NXSA 5AJYA 4URXR 4V0MA 4DLYA 2GXAA 3R8CA 3TSWA 2WJGA 3NVAA 1VQ8B 4OQMA 2O8EA 2V3CC 2B8TA 3P20A 4DXAA 3ZH9B 1U0LA 4O3MA 1XE1A 4O2RA 1KAOA 1TADA 2D7CA 1SXJC 1XZPA 3H4MA 1QF9A 4Z51A 5IF9A 4A15A 3ZC3A 1NN3A 5HR5A 2BHRA 3AQ4A 3NHAA 1H8ED 1QRAA 4IDQA 3SBEA 3DMNA 2QAGC 2ZRKA 4V0ME 1IQPA 4JLAA 3VKHA 1OGIA 2EFHB 1Z8FA 4L15A 1I7PA 3GJ4A 1NKTA 2ERXA 3BD9A 1W4BA 4IVQA 2YOFA 4K46A 1DDGA 1A5TA 3TKLA 4JLMA 4ZIRA 1TU3A 2ZE8A 3RRYA 5FUXA 1OIXA 3TQCA 3D31A 5EQTA 3GJ8A 1DAEA 5EMNA 1N5LA 1W2GA 3NTUA 1XMJA 4IJMA 3LA6A 1G8HA 1F2UB 3EZ7A 1A4RA 2QSZA 2V8OA 2O8FA 4CVNA 1HA3A 4HUTA 2RMKA 3IHWA 5G41A 1PZNA 3ZIAA 4BFSA 1FRQA 2JEOA 1BO6A 2W2XA 3ND8A 1D9ZA 3VFDA 3B6EA 1GKUB 2VHQA 1DG3A 5FL7D 3O8RA 1T0HB 2GQFA 3L8ZA 1WDTA 2DPXA 1CR1A 2J46A 3BH6A 3RRZA 2ZI4A 2A2ZA 4OK5A 5HZHA 4N0EA 5D3MB 5CB8A 3RAPR 1NG1A 4UQOA 4BPBA 3EPHA 5J47A 3CMEB 4HUQA 4M1TA 5JWHA 3I92A 2CVHA 1T5LA 2O0KA 1VQNB 3U7EB 4DVGA 1R0ZA 3EIHA 1JXOA 1T3SA 1Q1EA 4TLAA 3DL0A 4ABYA 3SU8A 2VZLA 1HYQA 1Z6YA 1W35A 4RSGA 4GMDA 1RRPA 4B32A 1NIJA 2ZRAA 3GMTA 3FMPB 1GNPA 1G7RA 3FB4A 1B23P 2WAYA 2PT7A 3B5JA 1UPTA 1B0UA 1R8SA 5LPNA 4PAMA 1DARA 4KFUA 1JPNA 2NO6A 3K1JA 1M7GA 3NC0C 4P4SA 5C4GB 3T06B 4LV5B 1QGZA 4A8JC 1KI6B 3B78A 5EUMA 1E79A 2C9OA 4G5RA 4Q48A 4ON9A 4EUNA 3U61B 1XEXB 1XJCA 2JLWA 2MMCA 4CEIB 1FP7A 1AKEA 1GNRA 2VH5R 4L9WA 2ZSAA 1WCV1 2IWRA 2IYSA 5GJBA 3MMPA 1IONA 2PLRA 4KFRA 4WAUA 4JLVA 4B74A 3I55B 2FNAA 2VPPA 2VP6A 3MJHA 3WMGA 5KNBA 1HH4A 3AKCA 2PMKA 5L3VA 1XPUA 2FF7A 2J7PD 4LJ4A 1VG0B 2QT1A 4KSCA 2KE5A 4B2PA 2XZOA 5CK5A 3GLFA 5CJPA 1RKBA 2D3WA 2I1QA 2QTVB 1MO4A 3HDTA 2Z4SA 4EPYA 1SVLA 3WMEA 4KITB 1W48A 4NYMR 5J4KA 4IOJA 2XTNA 3VNUA 4Q1BA 4P4UA 3WBJA 1E98A 2AXNA 4DLWA 4JT4A 1KDPA 4ACBA 1N2CE 2OG2A 3IUYA 4B3CA 3AF4A 2JCSA 3IPXA 1NLYA 4DLUA 4EJSA 4RFSA 3TK1A 5JI3E 4V0OA 1Q1BA 2HT6A 2WIAA 3VAAA 1E2EA 3V00A 5JCPA 1KI2A 3PEVA 3R20A 1PVOA 1OT3A 1MR3F 4PQFA 1UEJA 1KKLA 2JIZA 4LPKA 3VU9A 1YR7A 4RFVA 5M04A 2V7QA 4IDNA 4KLNA 2CHQA 3R7WB 4J0QA 2J0QA 3AP2A 4US2R 2ZEJA 3EC1A 3Q7PA 4TZ0A 3LVBA 1EG7A 2QM8A 4NE2A 4RZXA 5HPYB 3HU3A 4M53A 3QY0A 4MKFA 2R6GA 3QKRA 1KNXA 1R2QA 3B13B 3E1SA 1A2BA 1S9DA 1EFHA 1IN4A 1IXZA 5SZJA 4LJ5A 4TYPA 1EX6A 1QZXA 2G0NA 5E7MA 4NONA 3OE7D 3IIMA 4NBSA 3BH7A 4Q9LA 4HAVA 1P9NA 5AJXA 2DEUA 4LCBA 3K70B 3KL4A 2B92A 1NP6A 1U90A 1TEVA 3FHTA 3FPKA 3IIKA 4IOMA 2HYIC 1E79D 3MCAA 3H0KA 1NIPA 1OIWA 2R65A 4HZIA 4Q01A 1TPZA 2WM9B 3OEHD 3VMFA 2IYXA 3LV8A 4HYYA 1FW6A 2I1VB 4E09A 1HY3A 3C4JA 1K73D 1FNMA 4G5OA 3AB3A 4QBHA 5DNYB 5L3SB 3QEOA 4AKEA 4K1XA 2DWQA 1C9KA 4PHFA 2WJIA 4OHYA 2Z6VA 2J7PA 1YZQA 2Q6TA 3D7MA 3L8YA 5DI9A 4CEHB 2IX3A 3K0FB 2XNDA 5FOXA 4G5GA 2C98A 4URZR 2UZ3A 4D4KA 4EFNA 1QFJA 1F2TB 4WBSA 4XSHA 4ACAA 1NMXA 3EXAA 1N0VC 1G18A 5A0FA 2F3TA 5GJVC 3WNCA 1P2SA 2C8VA 1VQMB 1I4TD 2FWRA 4BASA 4MA4A 3U3KA 4NMMA 2ZJ8A 4XVUA 1YR9A 1OB5A 3FKSD 4DSOA 4TL7A 2HLDA 2Q9CA 3DKVA 4JYCA 1E2PA 1Z0DA 2QPOA 2ZE5A 1E4VA 3X1XA 3ZS9A 3AVXA 3DZ8A 3GJ3A 1KI7A 1YITB 4LJ9A 1JBKA 1ONBA 1BQEA 1D1NA 4CEHA 4PHHA 2BMDA 1L2TA 3OZVA 2DFLA 3L0PA 2FGKA 4IXNA 3GJ0A 2BSAA 2ZJBA 2BDTA 3PIRA 2H92A 3QXCA 4PANA 3CX6A 4P31A 1GR1A 4KYUA 4QG7A 4JBXA 5FL3A 1P61B 1DAGA 3D3QA 5FFMA 2W00A 4W5JA 3MRSA 4E07A 1X1RA 3QPVA 3CF6R 3HU2A 1EP1B 3ZVLA 4AURA 1MV5A 1E9FA 3V76A 4QL3A 1C1YA 2Z0MA 3FFBA 4PQRA 2DB3A 2B21A 4ESVA 3GCGA 5EXSA 2OK8A 1G5PA 1QH0A 1QHIA 4C0BA 4TMXA 2QRNA 2YYZA 3FFAA 4DLXA 3KUDA 1UDWA 5HKKA 5H1YA 5LB2A 3PEUA 1JAHA 2AK2A 4B73A 2N1BA 1WBDA 3T1TA 1UMKA 1NVWQ 3BOSA 3U7GA 1ZD1A 3M0EA 4URYR 2BM0A 5FR1A 1CLUA 5AJVB 3QPUA 1GKIA 1KK1A 2ZRDA 3BS4A 2FFQA 1LB1B 1F6BA 1GG2A 1Y63A 621PA 3R9XA 3ADDA 4RD0A 1ZINA 3B2EA 5GV8A 2R6HA 1W49A 4DKXA 2WOJA 2A9KA 1GVNB 3EZ6A 3JQQA 4TLCA 1DEKA 3WBKA 4G01B 3GLHB 4UNNA 1Q22A 1VCIA 2E9SA 1ZUIA 3MWYW 5TDHA 2WIBA 5CM9C 2VNHA 1OFUX 2FPKA 2GHIA 2RGBA 3KXLA 3QKUA 1W0KD 3T5GA 1GTVA 2P3SA 3QF4A 3F3YA 4FN5A 1KOFA 2QI9C 2V54A 3GLIA 4MYUA 5CITA 1KTVA 3KQKA 4OK6A 3TSZA 1KY2A 1BKDR 2E1RA 4BQSA 1NSFA 3WY9A 2HYDA 1QVRA 2JATA 1EWRA 1JQJC 5DN6A 5EE0A 3AUYA 3PITA 2VHJA 4HZUB 4XSGA 3LVRE 3CNLA 5JHHB 3X1WA 2GCPA 2ZS9A 1QGAA 1AS0A 2ONKA 1SVSA 1U9IA 1KO1A 1E63A 2GEVA 2C03A 2ZRMA 4MQBA 4A92A 3NKVA 1EWQA 4D4MA 4A4DA 4BLQA 2QORA 3U7HB 3O47A 1HT1E 4B33A 1Q86D 3VR2A 1UKYA 2BWJA 4X8HA 1NKSA 3FMOB 4TTPA 4MDFA 4JS0A 4PZLA 2G88A 1XMIA 3SFZA 3VTKA 1OJLA 2O8BA 1Q7YD 4YQFA 2AD1A 1LNZA 1E2HA 4LBYA 3LWNA 1ZAKA 5DLQC 4M1WA 2A5DA 1MO3A 4PO9A 5DO9A 4WXPA 2CRVA 1BYUA 1EGAA 3QIAA 3QG5A 4FIDA 1Q81D 3HP1A 4JJZA 3MUFA 2NIPA 1OE0A 2WPDD 4CIDA 1KO4A 3GP8A 2P67A 2W2VA 2O8BB 1Z6AA 1X8KA 3VO2A 2BEJA 2ZRPA 2YWGA 3E2IA 4DLVA 3A6PC 4G5QA 4FCWA 4ZGQB 1UBCA 2XEXA 4MRSA 4FD2A 1LV7A 3LQQA 1QFYA 2DERA 1JI0A 4KV9A 1KMHB 2QENA 5G3YA 4ARZB 2F6RA 2O8CA 3WRYC 4N0DA 3QF4B 3OHMA 3EIQA 4C0AC 1YIJB 1QG4A 4EFLA 3OEED 3OIWA 2VHUA 3Q85A 4KBFA 1DO0A 1I4DD 4HZUA 3TE6A 2G3YA 1J90A 1Y3AA 1KDTA 4QNMA 1E2NA 2YC4C 4IHQA 1W46A 1X86B 1ZNZA 4PSVA 1OV4A 2PLFA 1P9RA 1CRQA 1E9DA 2ZAOA 2ZU0C 2ZR9A 4GZLA 4NCHA 3ZDQA 2NOAA 4U02A 1ZJ6A 5L3QA 1Q12A 2NO1A 1KSFX 3CF0A 4IVPA 1NL3A 5JS7A 3BB1A 3KXKA 2OLKA 2FFBA 2PX3A 4QM6A 5DSZA 2GJ8A 2CL6X 2OHFA 4NKRA 2IYUA 2F1RA 1IHUA 2YC2C 3C8UA 1KAGA 3NEJA 4BRWA 3GLGA 2WWFA 2C9YA 4Y9UA 1KSGA 4HAZA 3W5HA 4ZIRB 2WHXA 2R6DA 2V6IA 4JLDA 5DHAA 5JCZA 1II0A 5EZ6B 4AG6A 1M74A 2PZGA 3L2OB 2QEXB 4BUJA 3OZXA 2W6ID 1ZD9A 2JJ1A 4OI1A 3SQWA 5EP3A 2DFKB 4A36A 5TY0A 1SVIA 3F8TA 2H17A 5GVSA 4A0FA 3EARA 4OYHA 4YMUA 2ZITA 5UKDA 4KVAA 3W2FA 1ZBDA 2N46A 3QKTA 1M6NA 1UADA 4AYWA 2XTMA 2GF0A 2AHOA 1US8A 2NGRA 2CCJA 2SHKA 3T35A 1UEIA 3K09A 2OILA 3T5DA 3T1OA 1DELA 2GVDC 4AD8A 2UZIR 3D6TB 2VLIA 1GL9B 1EXMA 4TSFA 3W6NA 4OI0A 1E9SA 2QGNA 3TIFA 1MT0A 2QMEA 3VKGA 4NU0A 1NF3A 2FDCA 2GBLA 1M1YE 3AGPA 4WIAA 3K0FA 1U98A 1TU4A 1XF9A 3EPKA 2QSYA 3CCLB 3JVUA 5B64A 5TXGA 3QNUA 5EP1A 2FFAA 4Z8YA 4DQLA 2F1JA 1US8B 1GNQA 1D2NA 3P27A 2ODBA 2BC9A 1IY0A 2JIZD 3CC7B 4QFMA 1S9HA 2EWVA 1IJFA 1GSIA 1YZUA 2GVZC 3QXHA 2VP9A 1H85A 4FW9A 3WNBA 4MITA 4OJKA 1EFRD 4DDTA 3CONA 5FOTA 2QRZA 4OHXA 3W5IA 4PGOA 4NH0A 1KY3A 3W8NA 2NO0A 1AK2A 1YU9A 1YRBA 1XX6A 1SKYE 2ZVQX 3AKEA 3CBQA 5CIWA 2IWHA 3K9HA 3TNFA 2ATXA 1A7JA 2VRWA 4LC1A 4URVR 2YINC 1Z2CA 4KBGA 1E69A 2ZROA 3OIYA 2A5GA 3SQXA 1YE8A 1II8B 1VQPB 3G4SB 4IEEA 2ZI3A 5LB4A 3RLFA 1N6KA 1W4RA 1V5WA 1KZ7B 1FZQA 2FJUA 1RW4A 3EAQA 1ZYUA 2ZI6A 4BLSA 1F60A 2G9NA 3G0HA 4HB0A 4PSKA 2GJ9A 4HLDA 3U60B 1NJFA 4Q19A 3RSOA 1U81A 3DMDA 2VP0A 1OW3B 4BEJA 5FBLB 1KI1A 1QVAA 2IS1A 5J4VA 2ZS8A 5JRJA 1IOZA 4M1OA 1P7CA 3IIJA 1YHQB 1HE8B 3TLXA 1NNEA 3OESA 3GLIE 1SVMA 1OHHD 1XDBA 2XNSA 4QBFA 5LD2B 3CH4B 2XJ4A 2IYRA 3U6KA 1MRSA 1CQXA 2ZRGA 3GEIA 3TUJC 221PA 3X1ZA 3B1VA 1UBFA 3G82C 3GFOA 1UM8A 2BPOA 5K8TA 4PZYA 5FR2A 3QENA 3FVQA 1FX0A 2KWIA 3CRW1 2OFOA 2BGIA 3U3OA 4A0GA 1SULA 4IOLA 5JS8A 4LJ8A 3RWMB 4LYAA 4TQAA 3KQNA 3W5JA 2AWOA 4TMVA 4M9XA 3JQRA 2O5VA 3IO3A 3BERA 3HU1A 1KI8A 1N6NA 4EIWA 4CF7A 1U2RA 3LX8A 4E22A 1EESA 2BEKA 1M90D 4GMXA 4EJSB 3C41J 5FPKA 5LDDC 1K8AD 2BIFA 1QHHB 1GAQA 4WW0A 4A0RA 2BBWA 2WSSA 3GEEA 4KAXA 4EJSC 2GK6A 1VG1A 3GFTA 2IUUA 2R44A 1KK2A 3O8BA 1GZSA 4D80A 1LFDB 5DE3A 1IAQA 3P1JA 5EXPA 2EFEB 1A8PA 1QUEA 4B3XA 1CJKC 2ANBA 2IUTA 2FPLA 3AVVA 1ZM4A 1N3BA 1VCNA 1U9IC 4PQYA 1TQDA 4HSEA 1OFHA 2OEPA 2IUSA 2F7SA 3FGNA 1G3UA 1XEXA 5JRZA 1IN5A 4JSYA 5GADl 1CJMA 5SZHB 1LTQA 2JASA 2OCBA 2CHVA 2VP5A 2WWWA 4JKIA 3TVTA 4Q7LA 1XFAA 4P4SB 4AF7A 1NJGA 2G6BA 4HAUA 3AUXA 4M1SA 4UJ3A 5B58C 2O52A 1G8PA 4XTRA 1COWA 1C4OA 4TYNA 2V6JA 2G83A 2A5JA 4P0TA 1XTQA 2RHMA 3RSLA 4R2IA 3U3RA 3CO5A 1YRAA 4NYJQ 2ZI7A 3A1WA 1F48A 1WMSA 4DLTA 4ZI2A 2F43A 1N5IA 2FU5C 2D4HA 4V03A 4AK9A 1DOAA 2CK3D 3W2GA 3WYAA 2WJHA 2UVQA 3LBIA 1VKJA 1FPMA 3CRVA 1F20A 4M9SA 5CIQA 3PUYA 2OFWA 4XTCS 4M4SA 5BN4A 1E2MA 3CH5A 2O8FB 4PHTA 3ICEA 1CJUC 1T91A 4TQUS 2ZQ5A 4OK3A 1GKYA 1QUFA 2V1XA 4WVFA 3EG5A 2R8RA 2J0VA 1XBTA 4P33A 5FBRB 1E9AA 3CNOA 1EK0A 121PA 3SI7A 4B48A 3CWZA 4K81B 3NBYC 3P4YA 4JT2A 4US1R 1ETUA 3CCMB 4L4UA 1VDZA 4Q1AA 5H68A 1M34E 3NIBA 3PENA 2VSXA 3X1YA 1AQYA 5HCNA 4RD1A 4XWOA 2WSSD 3KFVA 3KX2A 5BYKA 1K9MD 2OBNA 1OB2A 1XWIA 1L4YA 4GP6A 1E32A 2XB2A 2XJ9A 4A2QA 4URUR 1GP2A 4JYBA 3VR5A 2NPFA 2ECKA 2FMXA 2XAUA 4LHXA 2KBFA 4M21A 2CLSA 2ZJZA 4MGZR 2P5TB 3HR7A 3ZVRA 3Q72A 4Q18A 1ODFA 2UKDA 4H1UA 2ZUDA 4C3ZA 2YNMA 3SFVA 2ATVA 1AGPA 1XEWY 1P72A 2YVUA 2MSDB 3NBFA 3RS2A 1G3MA 1W44A 3C5HA 4MKHA 3DEFA 4B75A 1VYUA 3CIOA 1P75A 2X77A 4II7A 2R6CA 1OF1A 1RPZA 1E2FA 4Q4LA 2AR7A 2ODWA 2OSBA 2QA4B 2XITA 4RCZA 4DJTA 4OI4A 1NG9A 4B44A 2G0TA 4YLGA 3G5UA 4PSAA 5FH9A 2KI5A 4ZGNB 1GFIA 1XCGB 2QN6A 2DWOA 2PMDA 3KTAA 2OXCA 2ANCA 3B1WA 3E5HA 2DETA 5EJEA 2QP4A 5ELXA 2WWYA 1TNDA 3EX7C 4JSTA 2EIXA 3QPWA 3N2IA 3RC8A 5JJIA 4MYHA 3TRFA 3W5VA 4YDSA 4DCTA 3LXXA 5HXBA 1VQ9B 1VHLA 4MRRA 2GBLC 2IYVA 1H8EA 3BFKA 1AA9A 5KSWB 4EQ6A 3L43A 2WKRA 3A4NA 1E9CA 2PX0A 4DIEA 5AUPB 4GSYA 1EFTA 4OHVA 2BN4A 2P2LA 3IO5A 4QGHA 4X8OA 3UMFA 2H1LA 5J4HA 5LD2C 4DEYA 2Q3MA 3CCUB 3ZVNA 4X8MA 4CZ2A 1E2QA 5JLJA 2NO7A 1NY5A 3RYTC 4DRZA 1AM4D 2BCGY 3GPLA 2Y8EA 3BJIC 2GRJA 1R0WA 5KSPA 2RGNA 4GOJA 4P4TA 3CF2A 2OTJB 2GZAA 2BMWA 1F5NA 4I1UA 3AF0A 1JB9A 3TAUA 4C7OB 4V0KA 3E1YE 2RGNC 3OAAD 1KK0A 1S1CA 2J87A 3W3AA 4YXWA 4Q7MB 1E1QA 1LY1A 4S2EA 3VHXA 1CBUA 2FG5A 2W2TA 3L82B 4PX9A 4QHYA 1FQJA 2YHSA 3QUSA 2JLRA 3DO6A 1Z5ZA 1IB0A 2EFCB 3IGFA 3WYGA 2AKYA 3UKDA 2ZI5A 3PXGA 5KO2A 2XX3A 1XPRA 1JR3D 3FDIA 1LW7A 1ZMXA 3NBZC 1XXHA 2BMEA 4DDWA 2MSEB 5C4MA 1J70A 4TLBA 2QU8A 4HE5A 2ZSEA 2RB4A 4DEXA 3VHLB 2WICA 3NH9A 1OYYA 1W4CA 4UJ5A 4IW3B 1QHYA 2CJWB 2J0UB 1FUUA 4MRPA 4NTZA 5K8LA 2RGXA 2GILA 5L8VA 1JB1A 1SGWA 3ADKA 2JDID 3UK6A 3AKYA 1KYIA 1QX4A 3NWJA 1G8YA 5F9HA 5EUQB 4TLEA 1G5RA 4PFSA 3UIEA 5FPYA 4PPQA 3KKOA 1E2GA 4DLSA 1GM5A 3BC1A 1RRFA 5H5JA 3RS4A 3CPEA 4DBLC 1D5CA 3DM5A 4BZPA 4H9GA 2JLVA 4Q4JA 3TSOA 1XU4A 2QT0A 3M6AA 2AKAB 2B8WA 2IYQA 1DO2A 4US0R 4IDPA 3SJBA 4Q1FA 1G4AE 2OBLA 3A1SA 3EWAA 1OHHA 4M8NE 4MRVA 2ZIAA 1MABA 3K0AB 4MH0R 3P4XA 3EWSA 4RCYA 2ZUCA 4LJAA 4I1VA 4CEIA 1R5OA 1R5NA 2FSFA 2A7QA 2GA8A 1XTJA 4K8OA 4RZ3A 4DT1A 4EPXA 2V7QD 1T0JB 1SZPA 3VKWA 1DG1G 1OYWA 4YC7A 4B35A 1P6XA 3R8FA 2CE7A 1RE0A 5JZVA 5THXA 3K9GA 4HLUC 3AV0B 2Q0HA 4EH1A 4Q03A 3NDPA 4Y0AA 4LI0A 4BLPA 4JJKA 4D4LA 3TMKA 4C4PA 1MH1A 4AC9A 4DZZA 2BCJQ 2DWPA 3QSYA 1FDRA 3CR8A 1M2OB 4XWAA 3CRRA 3M4YA 2VBCA 3PCRB 1E1QD 2QA5A 4W5HA 1TF2A 1ZM2A 3BFVA 2PEZA 2ZRBA 4PXAA 4RZUA 4F4JA 3WXMA 3O8CA 2YOHA 4DT1B 3V4RA 1I2MA 4MGYR 2CDNA 1P4SA 4ZKDA 5HKKD 3KKPA 3K0AA 4DCVA 3OF5A 3H2YA 2OE2A 4PC1A 4BLOA 2WVJA 4ERNA 1JA0A 1QHXA 2RGGA 3RABA 5JJKA 3U2QA 3WHLA 2D74A 1P73A 1TQ6A 2OUKA 2B7BA 4R7ZA 3KB1A 821PA 2ORVA 4LYJA 1BX0A 1E2DA 3W90A 2F9LA 4KJZA 4NZYA 3I56B 2ZUBA 2V4ZA 2YWHA 1NRJB 3THWB 1CJTC 1OFIA 4LYFA 5AJWA 3CRZA 2HV8A 1KI3A 2GTPA 1CS4C 3KKMA 3AF2A 1G9XA 3WP0A 1BS1A 3B9PA 2J0UA 4O2LA 2C2HA 4JVNA 4AKHA 1G6OA 4Q4HB 3THYA 3T15A 1OH7A 2XSZD 3AVQA 1OH6A 3C15C 1ZC4A 4UAJA 2PZFA 1OXXK 4Q9IA 5KTYA 1JR3E 3I62A 1FL9A 2R2AA 3LRPA 2C96A 2FSIA 1E2IA 3K0CA 1U8YA 2WJJA 4W9MC 5AN9A 2GEUA 3SN6A 5BW8A 2H16A 1S72B 4A6XA 3CB4A 5KDLA 2A5FA 3C16C 3RDPA 1NSTA 5BN3A 2JJ8A 2NZJA 1SXJA 2ZRFA 4B3GA 1NBMD 1OLOA 1YQTA 4DIDA 1Z06A 3ND9A 1ZVQA 3RVBA 3SJCA 1CF4A
chains in the Genus database with same CATH superfamily
4A0HA 2REOA 2Q3JA 1GQFA 1FX1A 2Z30A 1Q1QA 3NBXX 5DNWA 3RV3A 3UT6A 3QBEA 2GJPA 4PSCA 1PJ6A 1ZOPA 5T6BA 3FLMA 3LL4A 2FR0A 1SUWA 5ABPA 2GJ4A 3AILA 2FLWA 3IQXA 3CCJB 4MWEA 2ONJA 5KNDD 1N2GA 3ZW9A 2M6RA 1EEHA 1ILEA 2L18A 1DJPA 5AWFC 4E46A 2P5SA 5K0SA 5HZAA 4ZMSA 1GUAA 3HKEA 5DNUA 1Z62A 4EYOA 2UYCA 4NLLA 2GM4A 2BJHA 3HB4X 1T8YA 3B5EA 4XLCA 1J2RA 1R0XA 3HCCA 3NV7A 2FCRA 4PIVA 2J08A 2XGOA 1P4MA 1TC2A 3MXTA 4LTMA 1Z34A 3Q3JB 4ZO6A 2WF8A 4CMEC 2LKCA 2DX7A 2IXFA 3VUFA 1EG2A 2GRAA 3FUWA 3QPDA 5A62A 3D1LA 3B7GA 4F0JA 1G6HA 1XZ8A 2QN9A 5T4EA 2YNMD 3IUPA 4RJIA 3DAPA 1V2HE 4HNQA 4MMXB 3UXEA 4WNAB 4EJFA 2PZLA 2JLSA 4QWMA 2PVCA 3QQPA 3MSXA 1TGVA 4Y6LA 2B4TO 1AIPA 4KR9A 4G2TA 1B6SA 4L76A 3FDZB 1YJCA 4MWGA 4F72A 2Q3BA 2WVGA 3I39X 1M2VB 1T2EA 3REQB 3ZWBA 5H3LA 1WTCA 3OPNA 4WMLA 1UD2A 1UXOA 3KYBA 3N2GB 4TTSA 5F51A 2BUCA 1YHNA 3KETA 3B6ZA 4LDNA 1YQUA 2CSXA 2YNMC 4JN6B 1KJ9A 2WPNA 4POAA 2AOUA 2NUAA 3IUNA 1QU2A 1VF7A 4UBLA 4BL5A 3PX7A 1OLXA 4L4RA 2AFIB 4ZCIA 1I7LA 2GX6A 2P4HX 3DDCA 3JQCA 5EERA 3A1TA 2OGWA 1R8XA 2AI2A 3U40A 2B69A 1OH8A 2XNCA 2GAJA 4UC0A 1NVKA 2L42A 1W4AA 4NXMB 3EF0A 2RKOA 2HAEA 1DX6A 3EIXA 5F7ZA 1FXSA 4N39A 5E2AA 1TK3A 1F0NA 1LBSA 4Z5XA 3MF4A 3ES9A 2NU9A 4B3MB 2CDCA 3UHFA 1UC5B 3FLBA 5E6TA 2XT6A 3ZWVA 4FDLA 4LG1A 4MCAA 1E2BA 3UATA 1I8TA 4A9AA 4L8YA 3F5QA 5I48A 1XMVA 1YI1A 5C5IA 3W2TA 3VHQA 4Y1EA 3UG7A 4UREA 5JEDA 1ECFA 1UKEA 5AI0A 1T3ZA 2YWEA 3V4SA 4D6PA 2DSNA 5I5EA 5JXGA 4O0LA 2I34A 5A71A 4FOTA 5ENVA 3GNSA 3THYB 1NVVQ 2Q99A 4Z2YA 4X60A 3ZGZA 3M2PA 1Z0KA 4TL6A 3SQLA 5IRCD 3PU6A 3VYVA 1GTMA 1CD5A 1Q3TA 3CUKA 1UMBB 1N32B 2B3DA 2PAFA 5F7JA 4S2UA 2OCLA 2XOKA 1F3OA 2H31A 1NVAA 1Q7RA 1XPJA 1Z74A 3R5TA 2FVGA 3Q3VA 4B80A 5C35A 2FZWA 3OFND 5HTKA 2TSYB 2W6JA 2HLNA 3A27A 5ED0A 4A2PA 3ZCTA 2O2JA 3BE6A 3SNKA 1T8TA 4AKIA 3MJVA 2UV8A 2ONZA 4KXLA 1WIWA 4YYEA 1JAIA 1UDAA 2I9PA 3KU4A 3PUXA 5HA5A 1OBHA 1XCPA 3CVVA 2B2XA 2WABA 1P5ZB 2FOLA 5B4TA 4PPYA 2VZEA 1WZUA 2H4HA 3AT1A 1T34A 3KZVA 5D3ZA 1KJ8A 4YVFA 4CLHA 5J3JA 3E70C 4QUBA 4Z0PA 4AY2A 2GAOA 2ZXUA 2FQXA 1RFLA 5EP4A 1GQSA 3BMCA 5KPDA 3ZQ4A 4ID3A 4B8YA 5BVGB 4AP5A 3WYCA 3WE7A 1CULC 4LV6A 3R6TA 3W3ZB 2A78A 3T7CA 1ZI9A 1E1NA 8MHTA 4MICA 4U3JB 1W0JA 1GITA 3HCWA 1QP0A 5GINE 5B30A 5HRUA 1RZ3A 1AC5A 1R0YA 4I8DA 2HXYA 1EVLA 4J94A 4MO9A 4EG5A 1JT9A 3DHEA 3DKKA 3V2HA 2AD5A 1JDJA 1QWOA 3D6VA 3HB0A 4GP9A 3RSCA 1QFSA 4PNPA 4NL4H 2C2KA 4ALLA 4UNRA 4KR7A 2UZ1B 1J23A 1W9MA 4U7WA 3EPJA 2IU3A 2BFEB 5JR3A 4UBNA 3I76A 3FGZA 4UCXA 1WE2A 2QF7A 1PL0A 1MIOA 3AVWA 4TYQA 1PNQA 2WAMA 5FOQA 3VPBA 2X8JA 5KYXB 3EZFA 1BXRB 5HUHA 4KXYA 5EZYF 3LLUA 4FYPA 1NWHA 2QROA 3RF6A 4KO8A 2HT1A 3O90A 1OC2A 1F17A 2NWQA 4YRMA 4K9MA 4LOKA 2WWXA 1EQ2A 4OHCA 5TJ9A 2P4UA 4I5DA 2BHNA 1Z08A 2CN1A 2JRLA 1F0PA 4BN5A 2I4NA 1YA6A 3GJ5A 2BCEA 3SJZA 5I8WA 3MTIA 5J1SB 4ZP1A 1E0JA 3FYUC 3NI2A 2FLKA 4C22A 2F48A 3H86A 3DEHA 5D3QA 4I50A 1ZIPA 2FK8A 2BRUC 3VTZA 4D0GA 3AV3A 3QOFA 3S2YA 4LBWA 2PTGA 4P3NA 1DS6A 1FW8A 3T0GA 1BDBA 1G6Q1 3U7QA 1JQLB 2NSJA 4N41A 2QM3A 1WPGA 5DHQA 2CMHA 1R18A 2JW5A 3ENNA 4AI6A 1FNBA 3KEOA 3I6QA 1O08A 1YVPA 1U4OA 3NR2A 1PGNA 3F2IA 2NQTA 4LJYA 1YLOA 4YRTA 4KSBA 4P86A 2G72A 3PHLA 4D02A 2E1PA 2DIEA 3GU3A 3IRVA 1YRLA 1OLUA 5CR9A 2HADA 4C0HA 3OTIA 1CUBA 3SEJA 4CT4B 1DBPA 3T9EA 3F3MA 3O0TA 2FX3A 2JFPA 4DGQA 3I8OA 2X9LA 3RUHA 1EM8B 1XNJA 5CJJA 4RHTA 1RD4A 1VJ1A 4QKQA 2WZNA 1QTIA 2X8BA 1ZQ9A 1W5BA 3VSCA 3VYUB 2JLXA 1JEEA 3A28A 1T3HA 1EXDA 1QANA 4J16C 4R71A 4JLBA 4TL9A 2CVPA 1NBWB 1JLLA 1GGVA 2YZNA 1XFOA 1ZM7A 2PJZA 2C99A 1FFEA 5EJ6A 2R4TA 3VHXB 5IHPA 1NPYA 1G9TA 1PNTA 2ZRJA 3I2KA 1D1SA 3OWOA 2KBEA 3HYLA 3A06A 1B42A 4DCPA 5BN5A 1CC1S 5JSZB 4D8XA 5IASA 4JUIA 1XD9A 3B1ZA 4QOGA 4HF7A 1XRSB 4F3CA 5AIBA 3R0JA 4JU9A 1BGWA 2GHQA 3VPGA 5KYUA 3A4MA 3GVCA 2W98A 2WWIA 3B6MA 3ZQ6A 4ZVSA 2B1QA 2M6SA 2ZUTA 4CMKA 5JNLA 4E3ZA 1SHKA 2A86A 4LF4B 4TZ6A 4LX8A 4ZEMA 3QBVA 1RJ9B 1NAIA 1KRXA 3DEYX 4EBBA 4FCTA 5IJ9B 2ZSHA 3DOEA 4FVTA 4ND4A 4UFOA 1ZU4A 2XSZA 1RWOA 2HCJB 2L69A 2OVFA 4LBVA 3A6ZA 5H02A 4KXFB 1ZUWA 2CE2X 5FWAA 3SLKA 1DAMA 2EQBA 2V1UA 1WSRA 2C9MA 2WNIA 4LVOA 1PGPA 3ZBUA 1PHPA 1SK9A 1N1DA 3TBHA 3X2SA 5FIUA 4BMDA 1BJKA 5LWHA 4JYZA 3BTOA 1JIVA 1W0KA 4QJ5A 1T9KA 6REQA 3UANA 3FI0A 4O5OA 4IQ4A 2W2QA 5EZ5A 4W9NC 2WV9A 1S8FA 3BQ9A 1WLYA 1ZA2A 2D1FA 4L6CA 3R5SA 2H9AA 4PBRA 1N6HA 1LPBB 4MHTA 5DGCA 3KE9A 2V6MA 3W2HA 2VUUA 3F6YA 2OKCA 3I01M 1YVUA 3PQ5A 4BBZA 1I80A 4DADA 3NOVA 4E7OA 2YJ4A 3M3DA 1SKMA 2DPHA 5JNRA 1EFKA 4OO3A 1PL7A 2IXBA 5E7QA 3HBMA 3T54A 3G5LA 3I23A 3ZOZA 5IP5A 1KKMA 1ODIA 1JS1X 1G41A 1QK3A 3MWDA 4QLOA 1PIWA 3OKCA 4YBRA 5EIBC 5H16A 3ZCUA 1HEUA 1XTKA 4PTLA 4CIYA 2GO7A 2LIPA 2O8DA 1GGKA 2FPPB 4RXMA 3TQOA 1EWYA 4YRNA 1B6GA 1ZGGA 1IH8A 2HQRA 3BEOA 3K9BA 2VDWA 4KDEA 1RTTA 2IHZA 3DDWA 2CNOA 1PDVA 3KR2A 4JKYA 2BVNA 3MAAC 4LZAA 1TMOA 3VZSA 3ZZTA 4PPNA 4BU1A 3FTNA 1RHQA 4BO9A 3OOCA 2P4QA 2D9RA 2BYTA 2QBYB 1M83A 1KIMA 2DGDA 2XYPA 3HLTA 3SXUB 2Q27A 1YA4A 2NSHA 3OFKA 9ABPA 4C3UA 3G9QA 4BP9A 3JZAA 1RJ9A 4J7UA 4HLUA 4JU8A 3ZD7A 1U8FO 4NX2A 4DG9A 5AW7A 3ZWNA 1DOZA 5EWMA 2C0CA 4L72A 1A4IA 5DGIA 2VC2B 4JOBA 1E4YA 2AG0A 1KSHA 3O4FA 1EX7A 2PGAA 3QXGA 4UHHA 2IOHA 1GZUA 4AXXA 4EELA 4I9HA 3ZWOA 2F3RA 2GPTA 3FZEA 4LISA 1Q0ZA 3NBKA 1NQ5A 4B2LA 4RMHA 5BN5B 2PMEA 3VC2A 5MN4A 4MOWA 2NU7B 1APBA 3ETHA 1Z28A 4PYKA 4B0PA 3NHRA 4JQSA 3L04A 3WGOA 1ZD3A 4YJ3A 2GOYA 3OQIB 4PZZA 1DLIA 3E9MA 4OG2A 2GXSA 4GL2A 3NM6B 2Z2XA 3IFSA 2A6PA 2E49A 4ZQEA 2I4MA 1G1AA 4KPFC 3EZ2A 1W9XA 2DHDA 2MJLA 5K0EA 1ZGAA 5JXIA 1N9ZA 2OV2A 3RSZA 1J99A 2ROQA 3FFWA 2ZI9A 1V8PA 1XTIA 2FB9A 5HW0A 3R24A 3PXAA 3LW7A 4IRXA 3LGXA 4UDXX 3RTDA 2Z5FA 3V4VB 3HJFA 5IVKA 3ONWA 2GCEA 3IUEA 4OHKA 1UAYA 4O1MA 1KMHA 3PQ2A 1YJQA 1T2NA 3HJAA 4RFSB 2XIJA 2Z4RA 4R1PA 3Q98A 2J45A 4KIFA 2E3JA 3K4PA 5L51A 3LAWA 4KC0A 1FU7A 2OFXA 4Q1DA 1XQ1A 3S81A 3GHHA 3IAS1 5DLEA 1RHRA 2ZP1A 1AXEA 1QHFA 4B8WA 1J5XA 1I5EA 5IAGA 1ZN8A 3OETA 4FDTA 4R41A 3U4QA 1OWPA 2DQSA 4M9QA 3SE0A 1KJQA 3U5ZB 1TQHA 2XOKD 3G9ZA 5LMUB 3L7DA 3PQEA 5AW1A 2R9VA 2QZ4A 2D7JA 1M0WA 3NC1C 2Q1XA 4BZQA 1KYZA 3N5CA 3LBAA 1SBCA 2VPTA 3ZLUA 1YI8A 4A1FA 3H4TA 2XE8A 5CLLA 1GV1A 2Z9DA 4ND6A 1DPFA 2W0MA 3A04A 4FOLA 3AXSA 2RDMA 4F46A 2A84A 1MJFA 3MRXA 4DMUB 1UXJA 2YVAA 1DX4A 4RMGA 1Y7IA 2EOAA 4B4DA 1Z4JA 4CLRB 2C2BA 3QHPA 1E6WA 4FMDB 2XCUA 4G8DA 4TM8A 2B0JA 2FW6A 4AMBA 4C87A 1Q15A 2I76A 2PUBA 3F7NA 3BK1A 4W4TA 3QX3A 3O3NB 4DCJA 3UXMA 3CESA 1C7QA 2AZ4A 2JA2A 4FD3A 4R8SA 1PL6A 1YA8A 3VX4A 5I7WA 1L7DA 3EQ8A 1PLLA 1T1RA 3OF3A 3NWEA 1FRVA 4X94A 1PR0A 2JAXA 3AERB 4ND3A 4OGKA 2P0YA 3M9XA 5BNFA 4NVRA 1U6JA 3PX3A 5ICCA 3ZE1B 1W0JD 3W5CA 3E8MA 5BUSA 1I2BA 4JL8A 3HYCA 4O08A 1KZ9A 5THKA 3SBXA 4V3CA 3CH7A 5DOVA 5KAPA 5JMPA 4MJ3A 3SE7A 1SVOA 3HDQA 4KI0A 3TN7A 3V4OA 1S2IA 3VVMA 1ESCA 1T4GA 3JRNA 4MJLA 3ZIUA 3QQ5A 1O3YA 2Q9BA 5IUKC 1XVUA 1HFKA 2REXB 1YQ9A 2JGFA 1OBVA 4P36A 3HXKA 5HUJA 3PF8A 1ISRA 1BWRA 1KI4A 3KWLA 5BQ5A 3I4LA 2RHOA 3SGLA 3NLLA 2C83A 3ZCXA 4XWKA 3FPFA 1I7DA 1LGYA 3S5JA 5K3FB 3AJEA 3QFHA 3LO8A 2QMOA 4RX1A 1K7XB 3VMMA 3SSMA 1V0FA 3U9TA 3PQ7A 3EXHC 5FRDA 4II2A 3QGMA 3H8VA 1JTFA 4EO9A 1J33A 1D8TA 3PDCA 1XP8A 4ROTA 3OF2A 3KKEA 4X6YA 2IHJA 3L8CA 1VIAA 2PSDA 3QY9A 5A06A 1SD2A 4N7BA 4QOFA 4P35A 4JI6B 3ZHYA 4B8ZA 3GRKA 1CU1A 2ZSKA 4D1YA 1OV6A 1OC4A 1Y8AA 1G8AA 2FEAA 1PFGA 1OTYA 2I3AA 1GL6A 1F6WA 2JD2A 2PX8A 2ZR0A 1S8AA 3KD2A 3OM1A 3TQSA 5C1OA 3PT5A 4P84A 2IBSA 1GT91 4DTIA 3F73A 1WF6A 1FIUA 4RLZA 4RD2A 4BFWA 1XKQA 4DCUA 1GPYA 1DT3A 2P2NA 1XYGA 3GRPA 4HCJA 4GZ3A 2CFCA 4HFRA 4UASA 1WOPA 2R6AA 2WTXA 4LRXA 1T2FA 1UZUA 1ZJWA 3E5NA 2F4VB 4C4OA 4EAQA 3FNEA 3BIOA 2VNJA 1U0HC 1L5FA 5IYPA 1CZKA 1F8XA 2BDUA 2IC5A 1Q20A 3HU5A 5JBNA 1IEXA 2FEPA 3GGSA 4Z2AA 4IIXA 1J39A 1H0RA 1BNCA 3GEGA 4FKBA 3LO5A 1FTSA 1VQ1A 3RASA 5A3JA 5D85A 1TF5A 4KN8A 4HGQA 2DBYA 1C41A 1Z22A 3IV9A 3LRTA 2OPBA 2EKQA 3JZMA 3QXXA 5COBA 4BATA 3V1KA 2ZJ5A 4XLAA 1RSZA 4JP5A 4NYJR 1X8JA 3H83A 2O54A 4XDZA 4HQRA 5E7JA 3LCRA 4ZAXA 4DJJA 1TO6A 3FPSA 1EJ2A 3H8JA 5BV7A 2OAEA 4BP3A 4RKEA 1OX5A 4U6QA 5KSYA 2AOUB 3WTCA 1CUIA 1OA1A 4DC9A 3GLGE 2B35A 1JLMA 3EIEA 3KTOA 3R6GA 5DISB 5E1MA 4EB6A 1TVKA 3OAAA 4WLFA 3E82A 1ULSA 1SB8A 2BR5A 2OV8A 5G40A 1SH7A 4I6GA 2DR3A 3SQNA 5LYJB 3NKFA 5JCJA 3ORFA 5I9MA 3GQBA 2J9RA 3ESXA 3NGXA 3ZTTA 1YL5A 1SUPA 3DD5A 1V8ZA 3THXB 3I2JA 4FXPA 4GUDA 3HWX1 5BV0A 1MF7A 2J0SA 2I8CA 2FW8A 2MYNA 1O9BA 3C6ZA 3LVQE 4FFNA 3K0SA 2ZXHA 1T25A 3AUJB 2G28A 4YAOA 1BHSA 1Q1ZA 1QHNA 1W2WB 3E4DA 1S5PA 1VCHA 5MGNA 4WFKA 3UTCA 4QJ3A 4F4IA 5G0WA 5CEJA 5EKDA 3CXCB 4YA6A 4LZPA 1OMOA 4BX2A 4EHDA 4JL5A 2V7TA 1G64A 1XALA 2IYPA 2Y2UA 4NRDA 4WSOA 3UWKA 4CRWB 5KPJA 3E35A 2QX9A 2IL1A 4Q34A 2HH9A 2JDIA 2ORIA 2WFMA 4LVCA 5AMXA 3UMCA 4E5NA 1Q3HA 3L4SO 4UEJA 1H6BA 4JBWA 3CWQA 4MR9B 4XX1A 4XQ0A 3WLKX 1NGSA 4KL8S 3GOQA 3R0QA 5ANRB 3TXXA 1AV6A 2P2GA 5DHFA 4BGEA 1ESNA 1CF2O 1RLJA 1XYVA 3C45A 3NHSA 3T1VA 4B9EA 4CMCA 3O95A 2G71A 5HNKA 1AQ6A 5EMLA 1RRGA 1XRJA 3AO0B 2FHSA 4FINA 4P98A 1R6DA 5CLFA 3JYNA 5F9FA 1RAEA 1XRRA 2OAP1 1N33B 3DR5A 4IMIB 1T1EA 5AVZA 2ZREA 5IG2A 1W30A 3ZYCA 1CUSA 2AZMA 3MRTA 5DTEA 5LP1A 3C87A 4DAEA 2E4XA 1DXHA 3G0OA 4YJFB 1BPLA 4FKZA 3FYHA 3FRHA 6YASA 1GN9A 2N42A 1KO7A 4A6PA 2AG5A 4J1TC 1W76A 3RTEA 1SHZA 4QUEA 3BH4A 1ZK0A 2AQHA 1IAVA 4OTZA 4TQ9A 4BO1A 3MERA 4J0IA 2WYOA 3TUJC 4C6HA 4FCCA 1BDMA 1KFKB 5LU9A 3J81A 3WDKA 1NPDA 1ENOA 5J35A 1Y1PA 5BVHB 3EC2A 3MJ4A 4FSDA 1UKBA 3KVRA 3BZBA 4AX4A 4JBHA 3UYLA 1NXVA 4B43A 4GBJA 1EDDA 3FCSB 4K28A 3RS5A 1YKSA 1D2MA 4CT5A 3VR5H 1IHXA 1RKVA 1UINA 2VBIA 4BFYA 4WOCA 3E2MA 3EEFA 3KQMA 4F38A 2WWHA 5KYGA 1NRIA 2PAAA 5EMHA 3WRXA 1A1VA 3JQ6A 3K2IA 3BD7A 4I4LA 4KAFA 1UP4A 2J7KA 1TZ2A 4ARZA 3GFPA 3GT7A 4R0NA 4XUGB 2JFVA 3C14C 1SB9A 4K3VA 2DYKA 4I1OA 2N0SA 4UZUA 1H94A 4NOMA 4Q3LA 2Q7OE 3S2ZA 4YCMA 3PE4A 2F2TA 2I22A 2A4MA 3AERA 3E58A 5HZKA 3DTVD 2G7ZA 1J2JA 4E1VA 2JL1A 5KVSA 2HCRA 3DAHA 4DE5A 5AW9A 3EDYA 3R5HA 4ASUD 1JPJA 3IVRA 2QX7A 1BX1A 3AJAA 3B1YA 3KQPA 1K2WA 1TQ4A 2QE7A 3PG5A 1EXVA 1IN1A 2IF2A 5AK4A 2X1HA 3V1TC 1SHTX 4RF5A 3OLYA 2WU0A 3OM8A 3SKBA 1HEIA 1TCVA 3LPLA 1YZGA 2NSYA 4Q21A 2B9EA 3FB1A 1Z38A 4WLOA 1Q7GA 3KE8A 2QLMA 1RQ7A 5B2ZA 4Q47A 4HB2A 1AKNA 1N6RA 4G0QA 1T0BA 3N9IA 4QTXA 3PJRA 1VE6A 1E0SA 4ARVA 3IAXA 5IT4A 2VJOA 5IAAA 4R5HA 3MPOA 2Q1WA 3R7SA 2XMBA 4BMYA 2DQKA 4LRSB 4PHGA 2NQ8A 1JDSA 2BZSA 1Q6YA 1YZFA 1XZKA 2X1VA 2OBRA 3K4HA 1I7QB 3L8GA 1WPRA 1OZ0A 1QIIA 5HS6A 5EXEA 3OIUA 3WKBA 4BKMA 5JD3A 5KYWA 1QGOA 3WHKA 1LF0A 4RPLA 1ML3A 2GCOB 2FRDA 1NQXA 1Z6QA 4D2IA 1TAGA 5ALUA 1E2JA 1TYBE 1QCDA 1EKXA 4KIUA 5KQGA 3QNMA 5AT1A 4ZQBA 3A3KA 4E13A 2II6A 3WK6A 2H9YA 2XHEA 3SS8A 2O4CA 3N8DA 4PAWA 5F4OA 3WYBA 3ZDYB 3LD9A 2OCYC 3C7DB 2ZQZA 3MS4A 4LIPD 2DPMA 3KLBA 1OXTA 4UU1A 1RHKA 1T1IA 4KXUA 4XOPA 1G5TA 1I7NA 1OPRA 2WMOB 3HGMA 1D9XA 2B8JA 3BN3A 1JF8A 2XUPA 5LL6P 2O7QA 3WQBA 2YJ5A 4PLGA 4TXMA 3LDUA 3LPAA 3AP1A 4XXHA 2X19A 4HQ6A 3ASYA 3EUWA 3CE6A 3MOGA 5FO0A 2NU6A 3OQIA 1ZL2A 3IBTA 4NEHB 1OB0A 2X4DA 3V1YA 4BMNA 1BJRE 1BFUA 4FEEA 2NU7A 2ZIUB 1Z8DA 4GOXA 4OJNA 5KNDA 1FS6A 2OSVA 1MJGM 4RL4A 1WV1A 2HF8A 3TINA 1LDGA 3HJGA 3WMRA 4HB3A 3OIDA 5GJWC 4F97A 2DR2A 1N8RD 1B2LA 2FEOA 3BE4A 3J7TA 3MUNA 4DEVA 1UD3A 2MINB 1YSCA 3ZPNA 1YQXA 3O21A 4YALA 2ZTHA 3ESAA 4GAEA 4OXYA 4QJ4A 2AN9A 4TQGA 5BSFA 1PU2A 1E1MA 3OIVA 4X44A 4NECA 2QE7D 1T9ZA 3PE3A 4BEBA 1HDIA 2OGTA 5BSKA 4AS1A 1ND6A 3QOXA 2OK7A 4WZKA 3AX6A 1AHNA 1LZLA 4LDJA 5EOVA 5H4GA 2O1XA 3QVJA 5B57C 1WBBA 3S2FA 1AT1A 4NBTA 3TIGA 5LMZA 4XDHA 3QFTA 2C04A 2R62A 1W1WA 2NTVA 3L79A 4YAGA 1G7SA 4XJXA 2DFDA 3U9SA 4AWXA 3ZQUA 1F7UA 4EMBA 3EA5A 3KZNA 4UPEA 1SCUA 2FPPA 4MV8A 4K9NA 3T8YA 4RSHA 3HEBA 2O8DB 3I5XA 1O8BA 2PIAA 3WIBA 4ANFA 2O8EB 2YL2A 3RRJA 4RIEA 8OHMA 3H94A 1GAWA 2QZ9A 3BZWA 3DWFA 4BNNA 2KJQA 5LKRA 2AMFA 4E12A 2XXJA 1WKCA 2ZYWX 3D8RA 4RL6A 2W48A 3NG1A 5A9TA 4DHEA 5BY2A 4K9QA 3HY4A 3OLZA 3WJAA 4MP8A 2WMYA 3V2UA 1CJBA 1UFOA 1VL2A 1ZD8A 2VWQA 3N39C 1COWD 4IIVA 3F0TA 1EE9A 3DMYA 4RNCA 4PCAA 1U1IA 4EKIA 2VHVA 4E31A 5BQOA 1R0CA 4JMPA 3NEAA 2Y1LA 5BWBA 1F9AA 1DEAA 2FGJA 1VQOB 1C0IA 2GZDA 5DGHA 2PNJA 4ARIA 1E3SA 4HVCA 1U0TA 4NFLA 2VJBA 1YQWA 4MYCA 5E3JA 3JQ9A 2PO5A 4C3VA 4D3FA 4D98A 1G0OA 6REQB 4EY6A 3G2MA 2F1HA 3HPRA 3G7UA 3H2JA 4AICA 4C7MA 4I81A 1YJ5A 3KJIA 421PA 4HNAA 3Q9LA 1R6BX 3AY6A 5IJZA 1NY6A 3U13A 5INTA 5C52B 3KQSA 1D1PA 1LLFA 2E87A 2JBAA 2B3TA 1VSVA 1A8UA 4KJXA 3KSDO 1YR8A 4WZBA 4TTVA 4UDYX 4DJ5X 2AXPA 4IIJB 3A70A 3ICOA 3QUQA 2JHPA 2EX1A 2GWRA 4KWCA 1SKUA 1KDYA 2OPHA 3TD9A 5BOVA 4OQLA 2F3UA 2B34A 1Q21A 1LW6E 1V7ZA 3THOA 3A11A 4LGVA 2R8XA 5FLKA 1QYRA 5AH0A 1WEHA 1JVBA 1KJIA 1YOBA 1NF9A 2ZQYA 4LA4A 1OFUA 2MSKA 4MA0A 5F3DA 2PRYA 5NULA 4AG5A 5A3QA 1MDFA 4F9GA 2QAIA 5FLXA 5JSZA 4J1SA 1VQ5B 1T10A 5ALSA 4DBZA 5EWJB 1W94A 1ZBQA 2XQKA 2XZDA 4GXRA 4QO7A 1KDZA 3NDBB 4EKNB 1I0LA 2VNAA 1C7IA 2NXCA 4UUBA 1Y6FA 4F3RA 4Q1CA 3RRNA 4UMDA 1PI3A 3SOPA 4PBTA 3DFIA 3ENWA 2NTEA 4XI9A 3FDXA 3N53A 3AHFA 5JZOA 3CWCA 1G59A 4AIIA 1TYEB 3NDIA 4A8PA 4BMVA 3KJHA 3N76A 4YJHB 1HNWB 3P19A 3G2KA 1E4OA 4N5HX 3LHDA 4C0KA 5CG1A 4G4SO 4Y6OA 2BGJA 1EXWA 3B9QA 3DCNA 3PK0A 3GUZA 2IP4A 1A95A 1MTOA 3OZCA 5GONA 1NTRA 4YHBA 1NBME 1V0JA 5L4SA 1NXPA 2FY8A 1GGNA 3B70A 2ODQA 3AR8A 3K2EA 3MMXA 1JXQA 1TA0A 2FH5B 2YUTA 3ID6C 3Q7QA 4LDQA 2DHRA 1I5RA 3GOHA 4JIGA 4TV8F 3VPCA 4YYZA 1Z35A 1QKJA 2GAAA 2YIJA 3GAMA 4GE0A 2ORWA 3Q3IA 2WT8A 2ZK7A 3SC4A 4ZO7A 2HM7A 1L5VA 5TC4A 1DMSA 3I5YA 2HDNB 5L3RA 3BCHA 4MW1A 2P2CA 1RYFA 2XCLA 4L9RA 3NOXA 4BRUA 5A1JA 4DJEC 1YC2A 1Y8RA 2X2EA 3GNTA 5CA0A 3WRXC 5FOWA 4POOA 1ZR4A 2PXXA 2MCFA 3V6MA 4Z1MD 2EKZA 2VK2A 4GZ5A 1AZTA 4BNFA 3IHLA 4BO3A 3GG9A 1T1SA 4PTZA 3HXQA 4EB3A 4JLKA 1SVKA 1ZX1A 1RYNA 1P4RA 4C30A 4HDKB 3S2EA 4IRUB 1Y6GA 4B9AA 3JTMA 3LYUA 1I3LA 1P18A 2HBQA 4UVDA 2NN3C 3ISTA 1NBMA 2ZBPA 3ZEIA 5IVHA 2Y27A 2X5KO 4Z4RA 3TPZA 2BFEA 4A91A 1M1NA 2QQEA 1XRMA 2ZT5A 2EHDA 4Q93A 1J06A 4BO8A 5KNCA 3MNFA 2ZL6A 5G0UA 3SG0A 3UQZA 2UZ1A 3QITA 5FTKA 4UMFA 4PNEA 2O3RA 2ZCVA 2ZRCA 3W6OA 1QV7A 5LDHA 3ZWPA 4ZCSA 2Y0PA 4B3DA 3S29A 1OAOA 3JARB 4F85A 3X1DA 1B8VA 2LVBA 3F2VA 4PO3X 4NCIA 2HBZA 1Z3IX 3IDOA 1QQ5A 3L0CA 4QVJA 1N0WA 4IGEA 4QO8A 3UAYA 3TJZA 1J42A 4AZSA 1KC3A 5ITSA 4KXVA 1CZUA 3RHFA 2JFNA 2FZCA 1X80A 4FFRA 2IF0A 4CT0A 3MWEA 5BVGA 3L0IB 3V1MA 1SU4A 1MABB 3RYFA 1FFHA 2CNDA 5GV7A 2HMAA 1HC7A 4LDPA 2OXFA 1OZHA 3AZPA 1E9RA 3MTEA 2QRPA 1XVIA 1RLOA 4AJPA 2H85A 5CA0B 4YK7A 2O2YA 3MIZA 1JBQA 2O1WA 5DBGA 2QTFA 4X7PA 5B3AA 3WMFA 2RHBA 3IR5A 1RJEA 1EU1A 3G5TA 3RG8A 2PA0A 3AEUB 4R9SA 5AVRA 3KEGA 3QWBA 1PP4A 4JIMA 3N70A 4A2WA 5AR1A 3QVXA 4HLNA 2QAJA 5F9MA 3W5UA 3U1BA 1JHQA 1AQIA 3AL0C 2R8ZA 5TS2A 2XLCA 3H5OA 4XYGA 1VPEA 3G23A 1Z75A 1Z6TA 3K7EA 5LQKA 3OW2B 4P1ZA 1LSJA 3ODPA 3FZNA 5KMGB 2J85A 1LF5A 3BHNA 2CLCX 3CJQA 3FLEA 3LIIA 4KQWA 4HLQB 4QU8A 3UV6A 5C8YF 1FFWA 4C9BA 4CM4B 1XMOB 4DC1A 4XQFA 1UMCA 3O26A 5K0BA 1S0UA 1E6KA 4GI2A 1L5GB 4B81A 3DBHB 3TDMA 2B99A 1BXGB 2FPUA 4Z3OA 3E9ZA 1Q0SA 4HP8A 4GP7A 3KJGA 1ZOSA 1XZFA 2OBFA 3IRUA 4ZZ3A 1WXWA 3A6GA 3QVSA 1IUKA 2LR0A 1ZIOA 2YJ3A 1RBZA 2WKWA 5CNKA 1E1LA 3O8OB 5JS1A 1COZA 3AW8A 3JXEA 4FC7A 4RZHA 4L4ZA 2Z58A 3VC1A 4R40A 2G5PA 3PEEA 5JVDA 1Z9BA 1QQBA 2QI9F 4DCGA 3NDRA 5JPCA 2A1TR 4I3GA 2XVAA 4C21A 1BKYA 2IEZA 3KPWA 1VPLA 4G37A 2EWWA 1J09A 2IIBA 1K75A 3V48A 4XWWA 1FC0A 4F93B 1V5IA 3PV0A 4X3CA 3H65A 3E20A 1P0CA 2H5IA 3JVVA 3OPOA 1U3WA 2WHPA 3PUZA 3AFGA 3Q0IA 4R2WA 2AFIA 3ZI0A 4BZZA 4FW8A 1U0JA 4NCJA 3KXIA 2JEYA 4MV4A 2NUAB 4B47A 1O57A 3A37A 3DD1A 4M0CA 3C2QA 5E1DA 2WSMA 1N6LA 1T4CB 1ZH6A 3N2GA 5A4JA 2RGAA 5FTWA 1KU6A 2PT5A 3BSWA 4GL4A 3GLTA 1XOIA 5TNXA 4DV2B 2JBAB 2C9ZA 1X3LA 3AM4A 4IO0A 5CDFE 3A1DA 5BNWA 2G1KA 2R6R1 2F1KA 3THSA 2CVQA 1TKAA 3KZXA 1Z15A 2BF4A 2BFBB 5CA0F 1CEEA 1W34A 4ZV4A 1PT5A 1RE1A 2NXJA 3QW4B 4IV5A 4QGSA 3T7IA 1JIUA 3H3JA 5I4BA 3H18A 2H57A 1SKBA 3IT2A 3GBPA 3K8OE 4XRRA 1VFNA 2POCA 4RIFA 1JPVA 4QVAA 3FKJA 3OEYA 3MJTA 2W4MA 5IAKA 3TEMA 1P4AA 1IXRC 3SNHA 1GN8A 4EEZA 4FIZA 5FBVB 3R9WA 4Q9JA 2D1YA 1E5LA 3DOFA 1L7QA 1PWHA 2FFHA 2WD7A 1TK2A 2O2ZA 1C1XA 1CEXA 1UPBA 2QP3A 2XB6A 3CHYA 2HMTA 4UHEA 4Q66C 4FI3C 4XQEA 1IHMA 1ZS9A 2GF2A 1I18A 1WTHD 3HJNA 1WCIB 1JJIA 4MI1A 1YR1A 1NDQA 2MMGA 2VJMB 1ONPA 3ZE9A 2P1RA