1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
3GEHA 3GEEA 1WOSA 1X31C 3GSIA 1YX2A 1XZQB 1WSVA 1NRKA 3AD8C 1V5VA 1WORA 4P9SA 3TTGA 1WOOA 2GAHC 4PAAA 3TFIA 5L46A 1VRQC 1WSRA 3TFJA 1XZPB 1WOPA 1VLYA 3AD7C 1VLOA 1XZQA 1PJ7A 3GEIA 3GIRA 2GAGC 3ADAC 1PJ5A 3TFHA 3A8KA 1PJ6A 4PABA 1XZPA 3A8JA 3AD9C 3A8IA
chains in the Genus database with same CATH superfamily
2QL7B 3IS9A 4Y9RA 1KVIA 1RHQB 4OZ1A 1S6PA 1S97A 3ENWA 4YR3A 4RNFA 3OOCA 1T03A 2X53S 3E01A 4KHRA 5J3OA 3WBJA 5KG2A 4CLTA 2W9BB 1I5OB 1FFWB 2ACMA 3WYAA 2FQQB 4BLBA 4HH1A 4O4RA 4X62F 3GE9A 2WK4A 3H3VD 1DQ8A 2OSQA 5KFVA 2J7KA 4JI2F 2GAGC 3DU6A 4LK0A 2G2YA 2R7XA 1VQKB 1W0KA 3RU0A 1I3OB 4RD2A 3MMAB 4C11B 1Q8LA 3CXCB 3GJSB 2DEIA 2K3IA 5K14A 2XTJP 2OPSB 3SYZA 4O4GB 2MGZB 2C1EB 2WYRA 1AMOA 1HQEB 4IH7A 3EDQB 2B5JB 4H4MA 4DPYA 2LQJA 2YPZA 2MZQA 3T6BA 4JI3F 4WIIA 1OPZA 3RAMA 3SCJE 2UVUA 5ETQA 2AYBA 1UD5A 1FJCA 9RUBA 4YXWA 1EQ0A 2CAJA 2YH1A 4RW4A 5CZXA 5D4DA 2Z56B 3AH6A 2DNGA 3CT9A 2IRXA 3BQ1A 2R2TA 2C2WA 4DQQA 2A6EA 3PENA 1H6KX 3GIJA 3G86A 3IG1A 2BEFA 3S1TA 4RPFA 2H4YB 1KEKA 1C0AA 5IORA 2C2ZB 2OEJA 3I5BA 3Q24A 1WC3A 1YSJA 3DOMB 4F4ZA 2D3NA 2CVEA 2IM1A 3S1NK 1VR6A 2NREA 2EXUA 4NRUA 3LWMA 3R1LA 3K5LA 4HTJA 4Y52C 3VCDA 3NAIA 3ILOA 2QLWA 4NLRA 1IBMJ 4R5PA 4DFMA 2Y3YA 2VU5A 1Q9SA 4OPSA 5B7WA 4U95A 3C6UA 2B3TB 2ZBPA 3AOBA 2QDXA 2F4NA 4ICLA 1PO6A 1J5EF 2XYHB 3THVA 5A6PA 2X7IA 4FBTA 2E5JA 2KI2A 1WSRA 2H1YA 1P1LA 3PO2K 4CP5A 1TKDA 1Q16B 2UVVA 3NBPB 5LMUJ 1WHWA 2HFZA 2R7ZC 4JOUA 2ZH7A 2QA4B 2DNRA 1QSLA 3BS9A 3FKIA 4A93K 1CQNA 4J9QA 3FPPA 2L3MA 4RW6B 4NLGA 3CMAS 4HYKA 4OYIA 4OHVA 3OSPA 2VBTA 1YHQB 1F3VA 3VGSA 2MQQA 2O1PA 3ILJA 1S0UA 3JQPA 1OY8A 4LF9J 4P71A 1M90T 2W9AA 3V2UC 4FM9A 3QWUA 1PC5A 1P1TA 1KK1A 4WWVA 4LFCF 2M7SA 4K0KJ 1YBUA 1OHHA 2ZH9A 4L75A 1NXIA 4IH5A 2ZC4A 1YVFA 4JMQA 4R0JA 3GP9A 1QUFA 4NZ6A 3THPA 5DGAA 3TQ1A 1OY6A 5L38A 4NZ7A 1Y5IB 2PC6A 3NS5A 2R7UA 2PIAA 2HRUA 3TA0A 2E5LJ 2Q6IA 1R89A 3O44A 3Q86A 2DGWA 3CQZA 4PPZA 1TWFK 1VDHA 4ETZA 4X64F 3NGSA 2DCLA 3IBWA 3H0GC 4NCGB 2OK7A 1BGXT 3T19A 3OQ2A 4USKA 1Q79A 5J2QA 1ZM4A 1PAEX 2RS8A 4DSFA 4KRWA 4GTLA 3TI0A 3DI6A 2IA6A 4AXIA 2WSCC 4OYPA 3TAMA 3R7BB 3VO2A 1Y11A 4LF4F 1CVJA 1S1XA 1UJ4A 1NU4A 3PRVA 3OTEA 2O5DA 2XNRA 2H9ZA 3EPIA 2Q3PA 4Z4VA 1IBLJ 3FKSA 4YR0A 3O1LA 4UTGA 2MZ1A 2G2ZA 3D28A 4JI0J 1F60B 2F7VA 2QEXB 4OZNA 4BS2A 2V7QA 2HS3A 1VQ8B 1VBZA 5TR9A 3DHWC 4WP3A 1KQSB 2EFNA 2OP5A 2XGJA 4ZVGA 4QIWL 5L9NA 3WX4A 3FBEA 4YUDA 1QUPA 2FTRA 1VRTA 1RWMB 1SJQA 4ETXA 3L95X 4G7OA 1RKJA 5HL7Q 3Q2TC 3GTGK 3AHPA 4C98A 4XNFA 4LF7J 4QIGA 3G05A 1MSWD 1XXCA 2WB1D 4LF6F 1G1XA 1WF2A 1S9EA 4WK3A 2AQ4A 1WP6A 4OOVA 4P7VA 3HP6A 2FY8A 3QO9B 2V63A 2JA5K 4AYBL 3GJTB 3RZDK 4J9PA 3FBBA 1HD0A 4AD6A 1C0TA 5H1SV 3M2RA 4CLPA 1Q1KA 2CJAA 1GTEA 5B6IA 1HW9A 2XCPA 2DRBA 1OGIA 2E1BA 2HQDA 1O24A 5D0HA 2R93A 4RW9B 2X6WA 3JTPA 2NUHA 1C1BB 1W7WA 2HURA 4I2QA 5F8HA 3LTOA 2BJDA 3G8QA 4A3IK 1N5VA 4NLSA 2ZZMA 1K83C 4IRDA 3JSBA 1WCMC 4F0HA 1APSA 3VALA 2FVPA 4DV2J 2PT0A 3CC7S 3M3YK 1XN9A 1X4EA 1VQMB 3DXBA 4RBTA 2V8HA 3TZYA 4XN0A 5JFEA 3MR2A 2XMTA 1HBMA 1FDRA 3SJPA 2CJXB 5AXLA 2EG2A 3MGJA 4CT8A 2I5JA 1YJNS 5KG7A 4P72A 3PW4A 4DR5F 4BBSK 2R93K 1N6QA 4HE6A 3FMWA 1XTZA 2B9XA 2J0SD 3UR0A 3AD7C 2DITA 4L8JA 2HMIA 3QNWB 4JB8B 5RUBA 3QX3A 3LO3A 3LWLA 2GPJA 4MK7A 5FNZA 4DR7J 3QT6A 2VICA 1KS2A 5D77A 1S77D 1NEEA 1DAXA 4USVA 2KT3A 2RH6A 4IOCQ 1CG2A 1U2FA 5CAAA 1W2BB 2HQ3A 1UL3A 2XGPA 2FVSA 2J76E 2EVZA 1NUEA 2IYGA 1T95A 1KHWA 2D3UA 1ZBTA 5DQIA 1Q4RA 5T7LA 5AXNA 2J5AA 1HL6A 4FXDA 5D3GB 2HIYA 4E8UA 4KGKA 3ITHA 1CEZA 2ZDPA 4W98A 3MEGA 5IYCC 4DXLA 4EFAC 5IP9C 1U26A 2XYPB 7FDRA 3W5HA 4A8SA 2ALZA 3ENAA 4AF6A 2DXFA 2QGGA 3T1HJ 1NDLA 1PBAA 2VPXB 2DGTA 4LUBA 4IO1A 3AJDA 2F1LA 3B78A 4ZCLA 4OI0A 3KEWA 3GTPK 4HI2A 1JLEA 4M5IA 4CO1A 3HVTA 1VJEA 2XWXA 3R5CA 1FKAF 2J7UA 2GHVC 3QO9A 3RBXA 4EZ9A 1XMOJ 2UXCJ 4LSNB 2HBRB 1WOSA 1HBNB 4CNZA 3Q23A 2P6TA 5IYNA 4ED2A 1NK4A 1NK5A 5CHPA 4X06A 2VBZA 4OV1A 2XMKA 3FRZA 4Q5VA 2NVYC 2HMAA 4EZ6A 1IBKF 5DJBA 1JLQA 5C24A 1W25A 5AXKA 2YNFB 2R92C 5BR8F 4UF4A 2NS1B 1X60A 2ZUAA 2DRDA 1M1GA 4YHHF 4TYBA 1T9UA 2WHOA 5ETKA 5B0CA 3UVJA 3A8KA 1HMVB 4LFAF 4G1VA 3BREA 1Q8BA 1QFJA 3JQMA 2ASLA 2V6AA 3GSDA 2EK6A 2CJQA 2JA6K 2XZPA 2OGUA 2E1PA 1M5KC 5DM6Q 5HMZA 3CNQP 3JXOA 1L3SA 3MPDA 3TZZA 3AXMA 4Z4UA 1UA1A 2HHTA 3R5AA 4B3MF 1AYEA 3D2WA 1NH7A 2CJ9A 2N4DA 4X7FA 4C8NA 4PWDA 3MOJB 5G0RA 1TUGB 2QE7A 3L7UA 1KZLA 2HQCA 2C28A 2B6AA 4QVAA 3TO8A 3PVXA 5KT3A 2V4QA 3VV2B 1CULB 3BY2A 1A9NB 2KN4A 4DR1J 1DTQB 3D4JA 3KK1A 1RWVB 3ZBTA 1BXNA 2C2DA 1N54B 3DOLA 2BRKA 5KOWA 1DG1G 3Q8UA 2MGZA 2DPJA 2R42A 1VK3A 4OYXA 5KG3A 1Q5YA 1T8EA 4J0QA 1J5OA 4Y2CA 1N0VC 2JWNA 2HHWA 3TFJA 2VB6A 4NOHA 3KLGB 2LLZA 4IKAA 1BWEA 4FS1A 1GJRA 2R8IA 1N5YA 1H2UX 2YWGA 4RPBA 3QSYB 3GTQC 1HYSB 1UD4A 4KSEB 1HNWJ 4OI1A 5EWEA 2MKKA 3PYDA 3BN7A 2P9EA 4XLEA 3M30B 4ACBA 3CD5A 3CWJA 3ZZZA 4LFBJ 1UVLA 4GKKF 4QW8A 1Q7YT 1B3TA 5GMDA 3DU5A 3KLHB 4I69A 1GXTA 4USUA 3ITHB 3QIPA 2XI2A 1O26A 3Q89A 3MMCA 3D1HA 3DRRA 5F3ZA 3QLHB 3A8EA 1QE1B 3H94A 3G4SS 3W3SA 2VJJA 5IOLA 2C3OA 1FESA 3JQKA 1UW9A 4N8NA 4A3GK 3PDNA 1QJHA 4J3NA 1OQ6A 3V4MA 2HQGA 3DOKB 4OIQA 4C3MA 4BDPA 3CJ0A 3A12A 3C8YA 4BC9A 3M8PA 1LEOA 3LQ6A 1KONA 2BVNA 4X8IA 2DNQA 5C2GA 4M1KA 2F5GA 2ZHAA 5L46A 1Q8KA 3VAKA 3I4HX 1U6ZA 5DG7A 4P1VA 2W8KA 1S0VA 4NI2A 2HHUA 3H59A 1Q5VA 5D4NA 1LK5A 3PV8A 1KOOA 3M4OC 3NE5B 3F73A 4KKSA 2GZOA 1DTTB 4BY7K 4DSKA 4A8KA 3WIUA 4X05A 4XM3A 4NYOA 5J1NA 3CCVB 5AE2A 3GILA 4A3MK 4DNRB 1FFGB 3H4DA 3JB9k 4G0WA 2DXEA 2IPOB 4KE5A 3GIMA 2MKCA 3GYGA 1U45A 4GKJJ 4F7DA 5IYBC 1NB0A 5LSOA 1NSPA 4PC6A 3AQOA 3UD3P 2XWYA 3A3GA 1CJUB 1O0PA 3CMES 4WPAA 1KD1T 3BQ0A 4RLEA 4PC3A 1WF1A 2YKOA 4RDLA 2I1RA 2R3VA 4DX8H 2KT5A 3DRXA 2XQCA 3MZIA 2GIRA 1Y10A 1JLFB 2JA7K 5E33A 1EAYC 2VA2A 1HWKA 1K83A 1SKWA 3PX4A 2WW4A 4L73A 3GTLK 5D0RA 4PKDB 3OP1A 1O8BA 3OREA 3UD5A 4C48A 2GVDB 4K1XA 5IT4A 1IQTA 1GXUA 4C3LA 2C2EA 2NVXK 4J9KA 2VG5A 4DCJB 2O01C 3QGIA 3ZO7A 4HIZA 2V31A 2AEFA 1EH1A 2K06A 5T14A 3BN4A 4ZPBA 1LOUA 3JYTB 5A88A 4RKUC 5I3UB 1RCXB 2M52A 4KAWX 4PG7A 1U1QA 3GWCA 1FDDA 2XSJB 3UW1A 4B9UA 4OX7A 1FK9A 3IM9A 2N3OA 1WELA 3FFIB 3HFZB 3HSZA 4DL2A 1S7IA 2ZBVA 1U4BA 4DR7F 2B0GA 3HFVA 4ASUA 4TQSA 3DRPA 2LDYA 1F60A 1X31C 5A8KA 4LR8A 4DV4F 3T6JA 2ADBA 3W2WB 1UETA 3ASQA 4LJMA 4O3QA 2D6FC 4AF7A 1U1RA 3CVKA 1X9MA 1EK8A 2EG1A 5DM7Q 5DGBA 3LGHA 1VQYA 1E6YA 5C25B 3VAHA 5LXYA 3H98A 3MDFA 3KK2A 3IRWP 1VQKS 1K28D 1QUVA 3IWNC 1GAWA 1Y3JA 1S72B 2GREA 3TJAA 4JI2J 2FC8A 2HHXA 3PACA 3S2DC 4OZ5A 1YJ7A 1OS5A 5D8HB 4XPCA 2NZ4A 5C3EK 1HD1A 2VUMK 4F2SA 1RT5A 3RBZA 5IK2A 2DGQA 2PLFA 1TELA 2GSOA 3L7OA 4Q8FA 3MM9A 1GH8A 4XD7A 4AXJA 4YAFA 5D15A 5FLMK 3OVBA 1DHMA 1SFOK 5IP7K 1F5CA 1JXEA 5IC6B 1RGVA 2AX1A 3TR5A 3ZUGA 4YHHJ 2QMXA 5C4JK 1VQSA 4RW6A 1SXLA 3D67A 1DTTA 1X5TA 1RWWB 2QA4S 8ATCB 4RR5A 3MXHP 4DS4A 1XQIA 3TOQA 4UAJA 2V5HG 3KJVA 2Y8YA 1UZDA 1N5QA 2JFDA 3HD2A 4QR1A 4YY3F 4MEXA 2MQNA 1BUXA 1RZMA 1KOHA 1R9TA 3A13A 1LWFB 4XIUA 3OR2B 2RILA 1REGX 3DLKB 2OTJB 4O44A 2JJ1A 5D78A 2VD3A 4KV8B 2E2HK 3PW5A 2W8LA 1LFPA 4B3RJ 2IJRA 4QWAA 1J2VA 2LXFA 2YPYA 3MFIA 1DQAA 1JLFA 3VNVA 4KAIA 1RA7A 3CCES 2LKZA 3QWPA 3FSIA 3D26A 2LEAA 5BXIA 3C2PA 3ISNC 4DJBA 4GRSA 4YFKA 2GVDA 2FB0A 2B56A 2BA9A 4EEYA 2JA7A 3J7AN 4Y52K 1WC5A 1S9FA 3PO3C 4KHMA 2VKRA 2NSCA 3FVYA 4Q0BB 5B0GA 4DF8A 1JMTA 1RT1B 1BDFA 3KDNA 3A1PA 3H3VL 1ZH5A 3G8SA 3CAGA 2DNYA 2CIMA 2VUGA 3SCIE 4XLNA 2R7WA 3TAQA 3S01A 1KWMA 4ZVOB 1R43A 1N07A 3NKYA 4ZJOA 4RUAA 3GSIA 3QT7A 4TLQA 4DX6A 1TVCA 1F1BB 4ZVPB 4L72B 1XXAA 2PEHA 2DIUA 4BC7A 1GE9A 4TN1A 1VJWA 3SSQA 1QFYA 5KW9A 1IXKA 5IT0A 3X3UA 2BKOA 3MEDB 1N06A 4OZLA 3M6UA 3PNIA 4I2PB 3P4UB 3L7PA 3R6LB 1TZ0A 3KLGA 1LWEB 2HS4A 3H5YA 3J7ZT 4J7CA 2AU0A 2D3O1 1FKOA 1UMJA 3TAPA 1HQUA 4P3IA 1S1VB 2KXHA 4YEAA 4LSLA 2FLPA 2E2IA 4ZPCA 3MD3A 1S1VA 2KXNB 2D9PA 2ZBRA 1OSDA 1VC6A 1IBLF 2KVIA 1SM4A 5HXBA 2K1RA 1KR4A 4URQU 3HOWK 4ITSA 4PXBA 2FX3A 3PR5B 3PHEA 2VOOA 2BANA 2BQUA 3DDNA 1A8PA 2DGSA 2EFGA 3HHKA 4A3LK 3N6MA 3M05A 2L08A 2YKPA 2RQ4A 1QVGB 4PWWA 2ZH6A 4URGA 1L5UA 3Q6QA 3V81B 1I50A 4QWEA 1NJIT 1WOPA 2F3JA 5H9FJ 3LP0A 1NDCA 2ZE2A 2G0IA 3Q83A 5KFHA 3MUMP 1S1TA 2LXIA 3CW2A 5KOXA 3J81U 4YDXA 2B7BA 5LMNF 2B5JA 4H4MB 4RZRA 1VJSA 1S12A 3TJ8A 5CH7B 1XIQA 4PPDA 5F8GA 1D1NA 4O4GA 4ERDA 2E2JC 2W25A 2ZOGA 1SKRA 2CW5A 3JSRA 2WVBA 3WY9A 1NAQA 3CJKB 1YITS 1VQOS 5KFKA 1IKVA 4DR2J 4RU9A 1H42A 4H4KA 4A3LC 3H4BA 3GFZA 3I4MK 5FL7A 4FNIA 1SC6A 4DR6J 3M2VB 2XS5A 3ENVA 3OTOF 3GG1A 4R71A 4P2FA 3ZZ0A 4XMYA 2MYFA 2FVRA 3NWGA 4QIEA 4NEYA 1H74A 3PO5A 1RBLA 2VFRA 3MR5A 3PFOA 5J2PA 5J2NA 2RHSB 2DVIA 1RT6A 3QZ7A 3IRXB 1RT2B 2WSFC 5KG4A 1AXQA 1FERA 4B44A 2ZKUA 3DLKA 2JA5C 2QL5B 4OINA 3I4NK 1JK9B 3AVTA 4ELVA 3E2EA 1T0TV 4QUZA 1N36F 2KTQA 3W2EA 1RT7A 1T9VA 2OMLA 2R7SA 5CYQB 4CT9A 4R5PB 3SV4A 4NLXA 1CC7A 4XONA 2VG7A 2FDNA 1N36J 5JBQA 4ZPTR 3UI3A 1F7UA 4G7HA 2AP6A 2HHPA 1FKPA 5CXTA 2AGQA 2OPRA 2Y3PA 4I56A 4HVZA 2PI5A 2QMUB 3V6JA 1N32J 4QZVB 2EKYA 2JVRA 4PRFA 3I56S 2RU3A 2F1FA 4KKOA 1IKWA 4DV5J 3ZZOA 4F7VA 1Y1WC 4B3TJ 2QLBB 1OMSA 1N32F 3VAIA 5KT7A 4FVCA 4I4BA 4GTFA 3GTKK 4AVZA 3HHDA 2K3KA 2BR0A 4OX8A 4R8UB 2BMWA 3DLEA 4WKYA 2LFVA 3VA7A 4YEJA 3ETMA 3LOUA 4PG4A 2X1FA 3CJRA 1IJFB 3FEYB 5SUHA 4ANDA 5KFIA 2RT3A 4DZDA 1PJ5A 4K7QA 4Y7NC 3CF5Q 3TA1A 2VNIA 3TP2A 2U2FA 4MIAA 3ZTOA 3A1YG 2E5LF 2BE2B 3HOYK 3AVXA 2GJKA 1WQFA 2KFZA 1HQ2A 4GO7X 1FRXA 3MURP 1SVDA 2EI5A 4Y9UA 2XMVA 1S9GB 1TKXB 3BH7B 3M32B 4FF4A 4OL8A 4QR2A 4J37A 2PE8A 4QJVB 3FZ2A 1VQ4B 3LVBA 4ZGQB 2HS0A 4NI2B 4AYBD 4DU8A 2XLKA 4G7ZA 2MQMA 3Q8QB 4H9GA 2GNKA 1UD3A 1FDNA 2DXDA 3EZ5A 2ZJQQ 1WUUA 4PR6A 2HGNA 2E1MC 1O2BA 3NGDA 5B08A 3D6MB 1JLBB 2RKIB 3N0VA 3MOZA 4HT7A 1C1BA 1GXLA 1R0CB 1I1GA 1BMFA 3HCXA 5GAEU 4ER8A 4YY3J 3CJ3A 4YB6A 3W2FA 2O66A 4ATNA 2YX7A 5EHHA 5JJBA 2LA4A 4NLYA 4M5DB 2WAQL 4NLOA 5F9LA 4HR2A 2ZXHA 4M5DA 1U6BA 1WCMA 4OJGA 4LF7F 3KHRA 1NK9A 1B4BA 3W9IA 5AN9A 2MSTA 3U1MA 3GJRB 4OZJA 3CC2S 3ONQA 3S8SA 4ZDNA 1NKEA 3ICLA 5FIUA 1S9EB 3SXLA 4USTA 4J9VA 2DY1A 3R6KA 4KDDA 4C3HK 1EQRA 2I8EA 1KQSR 4MYTA 1QD1A 3S1QC 2X1GA 1TL3A 4P22A 4QW9A 4Q43A 4LF2A 2JC1A 2AW0A 3O6QA 1GTHA 2I38A 2B63A 4L3NA 3MMLB 4C7QA 4TNOA 2ATLA 4JI3J 3HKZL 3IC1A 3MAAB 3VZIA 5TV2A 1I3QK 3G6XA 3K5OA 3GCWP 2NXCA 4H4OB 1WF0A 1HNVA 3FEZA 3ILLA 4NRTA 3NL0A 2NZCA 4HACB 1VBXA 3CJ2A 3VAGA 1VQ8S 1WTFA 4IG3B 2MJUA 1O51A 3FC9A 4ED7A 2V50A 4PC2A 2ASYA 4EK2A 3HKWA 4K4WA 3S0XA 2O5JA 1XFOA 4DL0C 1ZTTA 3J81k 1N34F 3CIZA 4Z4SA 5HQ8A 3CCLB 1KC8T 4XL9A 2BJ1A 4USHA 1FJGJ 5EX0A 1K8AD 2IIHA 1ZAWA 3HHLC 2FY1A 3Q8RB 1N34J 2W2QP 1RKIA 5EWGA 2ATCB 4F0KA 2JEIA 3CCUB 3G82B 3UQSA 3KMQA 4FK8A 2G13A 4JK1A 1PAUB 1RTZA 2DIEA 3PR4A 5HQLA 1VC5A 4IFYA 2ASDA 1JNYA 2WVCA 4QPXA 1UW4A 5DDRC 3IRXA 3N28A 1VBYA 2V4JB 1CULA 1FRKA 2V67A 3OE7A 2YNHB 2C78A 1H72C 2JFKA 1BQMB 3C66A 1R0AB 3P45B 3OEHA 2M8DB 4DMZA 4KB4A 3W5YA 4EU0A 1OJ4A 2JX2A 4N56A 3CCRB 3DRSA 3PJWA 1MRZA 5CYJA 1LQ9A 1G4CA 2E5HA 3SZ2A 3F44A 1H38A 4DL6A 4G6IA 1RT4A 3ILIA 5A8AA 1FJ7A 4FP9A 1REVA 4BXXK 4G7WA 3ZBUA 2NXNA 2MZTA 4DR3J 4RWWA 4EBDA 1ZM3A 4Q7JB 4AUKA 3PW7A 1YWXA 1VMBA 3KJQB 5L1KA 4MEYA 1HYSA 2X51A 2CQ2A 4TXSA 4RNNA 1BQNB 1TWCC 1IQZA 1B4SA 3H5UA 2HNDB 2R7TA 4S0MA 3RZAA 4ILDA 3TQEA 5ADZA 1O27A 4JV5J 2HWIA 2R9VA 1UFLA 1NJYA 2P3MA 3DMJB 3GZ7A 4ED0A 3DLGA 1UPMB 5HJYA 1RTIA 4USMA 2OPPB 1HI8A 5BYRA 2GSNA 1BPLA 3W2VB 3CO0P 2DO4A 2OPPA 4BY7C 3CMAB 4F4YA 1QVGR 4OYAA 4A48A 2FGCA 4OP7A 1RHJB 4HHUA 5A8WA 1IKXB 2HRTA 1H2VZ 1JVIA 1MWZA 4WFYA 3D3CJ 1L3KA 3WC0A 1X4CA 3W2HA 4A8YA 3ZNJ1 5IXUA 5KFGA 4AT1B 4LOWA 2CJYB 3OR2A 4ZH4A 1NPKA 5H5JA 1RBAA 1C4CA 4KT0C 3SQGA 1J6VA 2ZTGA 4ID5B 2Y0SL 4IOBA 1IE0A 1KHVA 5CCLA 1MG7A 4MFBA 3PKYA 3V6DA 2D9RA 1HMVA 3KG1A 4W92B 4CO0A 4D3GA 5GADU 2A3JA 2ZUEA 5HROB 1RAJA 1X4AA 2Q1LA 4Z2XA 2DGVA 4RW9A 2IMWP 4A3DC 1UTAA 4XAKA 3GFHA 4YB1P 2W7PA 4TVAB 3HD1A 2E2JK 4GQNA 4XLFA 2KM8B 1N5YB 1WPCA 1SC3B 2ZWOA 3OL6A 2HZVA 2RUSA 5B09A 4DU7A 2XO7A 4B9NA 3SEJA 3MPWA 3RAQA 3QJLA 4JV5F 1WEXA 3DXSX 1LW2B 2CPJA 3NLCA 4N47A 1T9YA 1FVSA 2ZKTA 1Z2ZA 4LIRA 3FMBA 2CQDA 1MW7A 1R5BA 4U9UA 4XORA 4C2MC 3P5TL 3W65A 1HA1A 2W24A 2XS2A 2HLDA 1FT8A 3AD8C 5KG6A 4GTBA 2CQPA 3CP2A 3VQSA 4I2PA 4Z4ZA 2I6WA 4ECRA 3R6GB 3KK1B 4U96A 4GTCA 4DSIA 2DEJA 2ZD1A 2H4WB 2QL9B 1DJ0A 4NEZA 3I4NC 1FEHA 3FKIC 2OELA 1VCTA 1J98A 2MJNA 1RP5A 4ZVQB 2BZ2A 2E9RX 3AY0A 1CQXA 5HK4A 5THXA 1P9YA 1OB2A 4J9NA 3I55S 4LF9F 5D4PA 3K7AC 3RAXA 3CSKA 5T7LB 3GTPA 5C42A 2JIZA 1FEEA 2ZVSA 2F1MA 2DO0A 2JHEA 2KJVA 3DRSB 3HI9A 4NPOA 5HLFA 3OHBA 4ZCMA 2GJIA 3BDEA 2COLA 4FXVA 4K5SA 3IAM9 4ZS6A 2QFJA 3NGRA 3TX0A 4DV3F 2IVFB 1N0UA 1XNQJ 4X4VA 4LF5F 1H98A 1U7LA 3RB4A 1RYRA 1VGXA 1T6ZA 5KFBA 1XZQA 1X4HA 2R8HA 4N41A 2X0KA 3QYYA 3RZOC 1UEUA 3PUNA 1RT7B 2J0QD 5C4JC 2IBKA 1CC8A 2RGRA 1MU2A 2PA8D 2JLGA 4YOEA 2W7VA 2DCUB 2CXEA 2GC8A 2Y0BB 3KJNB 1K8AT 1S10A 3RJMB 3SCLE 2HFVA 4ZV4A 1Q95G 1H2TZ 4EO6A 1U1PA 4YB5A 4XPEA 2BDPA 4XDDA 4NASA 3MMBB 1I6VA 4LRDA 4TLRA 3LPEA 2QN6A 4RCZA 3PO4A 2AGOA 2HSEB 4OQJA 5E0OA 1I50C 4ZJQA 1RLDA 1DBDA 3P96A 4KASA 2AHOB 1H73A 1KKHA 1AROP 2LQBA 2RDDA 2HNYA 1S49A 3O5TB 1TKTB 1FD2A 2XNJA 1FE4A 4IUFA 3BR8A 4GMKA 1SI9A 5J2PB 1I18A 2Y1JA 2MY8A 4TY8B 3PO3K 5M3MK 3OTBA 2D1CA 2XI3A 3T41A 1FXRA 3QFRA 3C6UB 2B63C 4QYZK 3ERED 3NG8A 3RBEA 3VZHA 1USOA 1A7GE 4H4KC 1FFSB 5HAOA 3GVKA 3LAPA 5CABA 4QYZJ 5A0YB 2MSSA 1F9NA 1FRJA 4DWIA 3AH5A 2CDQA 1KRHA 2YNIB 3FJ2A 2YWEA 1W0JA 4ZP7A 4OLOA 2W9CA 4YAWA 4II3A 2XCQA 3HOUC 1N6QB 2C2NA 3PVDA 3FGVA 2HG4A 5FLXY 3S1NC 4DCOB 4ZMMA 3WODA 3R3TA 2IRUA 3TVYA 2CPEA 4CQ1A 4B43A 4DN0A 2VQFJ 1F5BA 1TTHB 1CQMA 2FIUA 2HFOA 1IJFA 4NCBA 1RBOB 3CCQS 3S1QK 4I67A 1Q81D 4YAOA 3BKUA 3OTDA 2H5IB 4OPVA 3IBFB 1VIOA 3LALA 2ZD1B 3M8QB 3VHQA 3TFHA 5HLFB 3U27A 1HZEA 2P5VA 3W8GA 2GV1A 3P27A 4L74A 2R6HA 2EFPA 4NCNA 3CB4A 2ZTNA 3MCSA 4B4DA 1N88A 1C0UB 3QFCA 1T05A 4DV1J 1JX4A 3EUNA 3AA8A 1FKOB 5CCMA 4DK1A 4MK9A 3I0RB 2D69A 3P26A 3CCJS 2NUUG 1VHEA 2XBPA 2WSSA 2P6SA 3SMZA 1EIYB 4Q7AA 4DUYJ 2LMIA 4UZCA 3KG4A 4NYZA 2VZLA 3MCAA 4JUZA 1N5SA 1EP3B 3UDEA 1Y1WA 3E8OA 5HMWA 4DV2F 2CFAA 5T41A 1JLCB 4P2NA 2D41A 1CLFA 2RC5A 4KQZA 5HL8A 3BDPA 2JN9A 1TWFA 4IR9A 4WWSA 4JI8J 1B70B 4JV0A 2PMDA 4KY3A 2WVDA 3SFGA 5FO1A 2JLEA 4YS2A 1DRZA 4WE1B 1NJID 2JJ2A 4CH1A 1U48A 3N01A 2V7WA 4P2SA 3GTQA 1TKZB 3J81Y 2J6UA 1YGYA 5M2PA 5JVOA 4A3JC 7FD1A 4AH6A 1RCOB 2V2KA 2NV4A 2OYNA 4XCHA 5HSPA 5CA5A 3OAAA 1RACB 3K5PA 4CM0A 1F9FA 2HGLA 3GCXP 1W26A 1MABA 4P74A 1UD6A 3M8SA 4GTAA 5L39A 4ZIVA 2PE3A 4G7XA 3QT5A 1VHIA 4E2FB 4B3OB 2Z8QA 1RAFB 4DPUA 3B4MA 1T3OA 1RB0A 5IYDC 3S15C 1TUWA 2DHSA 3PIPQ 3R97A 1TFWA 2C2KB 3I32A 1ZZNA 5LT5A 3AAWB 2Y1RI 2BM0A 1VQOB 3D0GE 2DH9A 4JYAJ 3L4JA 4I1TA 1HQUB 2R7VA 2FLNA 1S57A 1W9XA 4DLGA 2VUMA 5IV3A 2DHGA 4MJKA 3ZTQA 4USWA 4P9SA 3AOAA 4ED1A 3CCEB 3ETOA 2WR8A 4PXDA 3K7RA 1VH2A 4WYWA 5DG9A 4YP3A 1WDTA 3OVSA 3GTGA 2ZOMA 5F4MA 2C22A 1X5SA 4FF3A 5EDWA 2QMWA 2BABA 2BKNA 3S15K 4F50A 1PIEA 1LW0A 3AOCA 2DR5A 1YRXA 1D0EA 4ED8A 2AEMA 4BPRA 4PXCA 1J6XA 4M5MA 1YNJA 4I7FB 5M5YK 1NZ8A 4WU2A 4X7CA 1ZA2B 4PQAA 1LXJA 3RZDC 3JQJA 2CA9A 1RQRA 4F36A 3LQVA 5HVFA 1Y3KA 1JJ4A 5K9FA 2V4JA 1PILA 3OPKA 1GQEA 3PA1A 5IYBK 1UJ6A 1C2PA 3KWMA 4X66F 2B8PA 2JL9A 4LSLB 3DMJA 4CLWA 4NXNJ 3TFIA 3OLAA 1VQ6S 3MUTP 3S1RK 3F41A 4QWCA 2PFDA 1G6BA 2FVCA 4GFQA 1KQ4A 3UDVA 3LA0A 3M9OB 8AT1B 1RAEB 2NQPA 1YJNB 3M6XA 2CNDA 1YJRA 2EEYA 2YWHA 1KRPA 4C45A 2EFOA 3CIMA 4TU8A 1TWHA 1LXNA 1VLOA 3IN5A 3GTLA 3DN9A 5THWA 2RE1A 1FXLA 1FE0A 1NK8A 4G3IA 3G2XA 3C6TB 2FHMA 4NOIA 4EUVA 2R7RA 4WZTA 2JEFA 2QSFA 5IWAJ 1VRQC 1KQGB 1EFWA 3CXCR 4CNYA 4F3QA 1BLUA 1QE1A 4IFVA 4K4YA 4WK1A 3R27A 2VNHA 2VFTA 2V6UA 1RAHB 5IM0B 1MMLA 4PAAA 4G0VA 2M70A 1IB0A 3RY8A 4J90A 1Q0NA 2FYXA 1SFOC 3NP5A 1YJWB 4BLGA 2KRRA 2MLXA 2ZZTA 1NSKL 5DG8A 2AJ2A 1NSQA 4I2QB 1I50K 4DL5A 1Z1ZA 3TUIC 3W2GA 2YVSA 2DNLA 2VUMC 2XHWA 4JV1A 2V8PA 3W2VA 2GQQA 3A3PB 2J8AA 2GIFA 2IMOA 4G5GA 3NCRA 1AFJA 4B17A 3J7YI 2LEBA 1RT3A 3NMRA 1KTQA 3OFFA 4TMXA 3GV8B 1TVRA 1RAAB 1MMDA 3BGFA 3LPYA 5F8NA 5A6WA 3KHGA 1RISA 5C5JA 2X1AA 3IFEA 1WORA 4IG0A 3T01A 4FKYA 4J9UE 4DI6A 4HT5A 1BLIA 1F93A 2ASJA 2RD5C 3CJQA 1VQ7B 3TUZC 1Y1VC 5A89A 3S6EA 2YKQA 1X7VA 1TL4A 4M94A 5L1IA 2B4PA 2XYGB 3W8PA 1REVB 3NCPA 2R2RA 1MROB 1S72S 3HFKA 2YKNB 1GAOA 3R6JA 2K7KA 5HBMB 4ECVA 2YKNA 1E62A 4HHHA 3PO2C 1YK9A 2WBRA 2LA6A 4X4TA 3G6ES 5KT6A 2E9TA 3JTNA 3PYGA 3EGZA 1FK9B 4U67Q 3T1AA 5F3TA 2RKIA 3PJXA 1XZPA 3OL9A 1YIJS 2E2HC 2KT2A 1D8YA 2RB7A 2ROGA 2E2IC 2E5IA 5GV7A 2HBQB 1S0MA 3MMAA 4ZITA 4KPCA 3OTOJ 3PA2A 3ET6B 2RRAA 2MQOA 2DYIA 2RHQB 1O6XA 1SH2A 4GTEA 4PYDA 1RWXB 2PA8L 2KJWA 3CE8A 1NJWA 4A3CC 3IP0A 2KFYA 4O3RA 1M5PC 4LJZA 2HLUA 2FHOB 4ACAA 1A0OB 2DHXA 2FJAB 4B9MA 1IS1A 4UT4A 3PRBA 2O67A 5IT9Y 4RWXA 2O3DA 4J91A 2M8HA 2OMOA 4X4QA 2HZCA 2J9EA 1JLEB 3IXQA 2MY7A 4NZ0A 1YI2S 1WJ9A 1WKLA 3MEEA 4M2LA 2W01A 3N6NA 2P5MA 1EZZB 2YKMA 2UUBF 4HDGA 3OJWA 1MLAA 4GVBA 4BXXC 4ECSA 1ICEB 3CQZC 3KLHA 3HPOA 1XR6A 4NL5A 3U1NA 3J80U 2N4CA 1WOOA 3AJ2A 1K73T 2C42A 2OUGA 1IKYB 1KBRA 4KB7A 4DV6F 3BYPA 1U8WA 3JSMA 4LMZA 2UZAA 4N3GA 2PDAA 3TVZA 3CCZA 1RAOA 2AD9A 3GTOA 3CC2B 1NK6A 4ZP8A 1TWGK 3QATA 1ZYQA 5D3GA 3PEHA 1FWKA 2JA8K 2WCXA 1WKKA 3K8VA 2HLTA 1ZZFA 2WRMA 5MAOA 1UD2A 2DH8A 2CADA 1K44A 2P8TA 1HBUB 2JEGA 4B9VA 1QAXA 4G1PA 3RW7A 3Q8SB 4CLKA 1U0SA 1HBMB 4DPWA 4C0OC 1NDHA 4ZLLA 1CNFA 4WZMA 2HGMA 1NB2A 4CH7A 1NO8A 2HVDA 4U7UD 4ZCKA 2KHDA 1NJZA 5L1JA 2KWAA 4TN2A 3WX8A 1NKCA 1EARA 4HI1A 5K8NA 5IOQA 4G65A 4P52A 4C6AA 3FCVA 4KO0A 5M3FK 3I6PA 3T1YJ 4A3GC 1QFZA 2KYZA 1WU8A 4UOGA 5ETOA 3SFUA 3IWXA 5AT1B 2HQFA 1EFRA 2BXJA 3P5BP 2BM1A 1AFIA 1IQ0A 4KC5A 2HHHF 5F41A 2AJ0A 2APOA 1N8RT 2AZ3A 2RNEA 3LP1B 3JTOA 5FIIA 5KFXA 3G4CA 1YRUA 4XTTA 1FRHA 3BO4A 4LBVA 3P6YC 2G0CA 2QFIA 5DS7A 1JJ2R 3BM7A 2VKZG 4RJLA 2HHSA 4P12A 2EK1A 1K83K 4K5RA 4OJHA 1VC0A 4Q0BA 1NLKL 2EKNA 4DG1B 2AT1B 3KUGA 4MYUA 2WW8A 3TYTA 3O2IA 4DDQA 1JLCA 3TRGA 1YLXA 4X07A 4USIA 4DR1F 2XZWA 4YELA 4RUHA 1HNWF 2D3LA 3TAMB 4K2JA 1WHYA 4ILRA 5F8JA 3GONA 2LXUA 5D6GA 2YQ1A 2Z2LA 2F43A 4EI2A 2B4VA 2Z2MA 2PFFB 3FBCA 2WJYA 3ET6A 4X84A 4LQ9A 3R7SB 4EBCA 3G4AA 3WQPA 2QRRA 1QLNA 3ZTRA 4LVNP 3HVTB 3T9NA 2ERRA 4IQXA 1GMUA 3T5LA 1YZ6A 4UY8T 3BGLA 1T05B 2RQKA 3QGPA 2OKQA 4GVBB 2NVTC 4UOHA 4OMFG 3QJPA 1EQMA 1OPIA 3GTOC 2K2PA 5LMNJ 2CK3A 4Y00A 2B4UA 2BJ7A 1BWVA 3SQOP 3I96A 3PG9A 3WXMA 4QCLA 4Z7CA 4DUYF 4UQGA 1UZHA 4CYUA 1IUJA 2CWKA 1EP1B 3E01B 1X9SA 2FC9A 1ZXOA 1P8GA 3W9HA 3VAMA 1U1LA 3T5JA 4B9TA 5KFQA 1V9OA 1HHQA 4Z4RA 1RDRA 1KN6A 4JP8A 4O2DA 4I6YA 4DQSA 5AJ3J 3J7YU 3N0CA 1ZETA 5FLMC 4DPTA 3CO9A 2VBXA 1QH0A 1XZPB 2PD1A 3KHLA 2HEKA 5IFMA 3CC7B 5AJ3F 2VONA 1X5PA 4NLWA 4RDKA 1AZSA 5IYWA 1W35A 3GTMK 2O5IA 2C4TA 5LXRA 1Y1VK 4FXWA 3V7AA 3M8PB 2D74B 4XO0A 4ZVUB 5EX3A 4LSNA 1P4MA 5HZBA 2D3ZA 2M5SA 4HEA9 1IR1A 2D7SA 5IYCK 3SI8A 1VQ4S 5I3UA 1BQEA 2M3DA 1R9TK 3G71B 2N7CA 5GAGU 4O0NA 2PMZL 1OYDA 2R92A 1VQMS 3Q8YA 3VF0B 3MMBA 4U9RA 3S7RA 3OSNA 4K4SA 5KFLA 5K20B 5HANA 3N3YA 3B6BA 2QLXA 3LP2B 1NZAA 3CCWA 1SV5A 5LJ5Y 3DYAA 2V8GA 4JI4J 2M88A 1VRUA 4C3HC 1LKZA 4TMTA 1R8HA 3JAMU 3RW6A 2VPWB 1GMWD 1B2RA 4NLDA 4CLSA 5IOSA 1QGZA 4P6VF 1HNZJ 2DNMA 2NSBA 2OK8A 2QT7A 3L09A 4C3KA 1FTRA 3MTKA 3CCQB 3D3BJ 3UN2A 2E7XA 5F8LA 4KM8A 1ZPVA 3S2HK 1QVFR 2AEJA 1GMWA 3HVAA 3W66A 4N76A 1IJEA 4LVOP 2DOGA 4Y2IA 1JNZB 4A8WA 3WNCA 3BQ2A 1U1KA 2B6AB 2G2OA 4I7FA 3OBIA 1E6YB 1G2EA 5KT2A 1EHWA 4KTQA 4NNJA 4WJ3M 4A3KK 5A0YA 2DERA 1GEHA 4RD1A 4NWBA 1V3ZA 2HZAA 4DG1A 2BOAA 2JRSA 4A3CK 3CULA 3TWZA 1AB8A 4YFNA 1BQMA 4J9SA 2E2HA 1T6XA 1BD6A 3KLVA 3KYLA 2MMYA 1FX4A 1NNDA 4DZ6A 1WEZA 3OL8A 1Q82D 1FDBA 1D2EA 2JOQA 4ZVHA 1OIAA 3HHLB 3NY0A 2HRYA 4LLGA 3HOWC 4WFAQ 3WBZA 2ZJRQ 2DD8S 3AA9A 4N5SA 2WONA 2BPOA 2RJZA 2VQEF 3WBKA 3ZC4A 2CUYA 5ETLA 4RD4A 2E2IK 4DV6J 4FYYB 3CCMS 1N08A 1KQKA 4IRCA 1B4AA 2V4DA 3B4DA 3KOAA 1TWCA 4QIFA 4ECZA 2VV5A 1HNZF 4P3YA 4FBUA 3KK2B 3GU0A 1RAGB 2YWKA 1FXDA 4X7EA 1GFWB 3FEXB 3GTQK 3CESA 2LECA 3BSAA 3RTVA 1DFDA 1UWBA 1HBOB 2OTJS 4IFVB 5KFFA 5CZVA 1UWBB 4ED3A 3QIPB 2BF4A 2EFQA 1WIHA 2M5YA 3TEGA 3DRRB 2JZ5A 2ZVIA 3VGVA 2D74A 2ZNZA 1SMYA 3CDUA 1V5VA 2R7ZK 4KGXB 4NA1A 2DNZA 1CJVB 2OAUA 3C15B 4Z37A 4A3FC 4DUTA 5JVHQ 2RRNA 2M9KA 3PEJA 3H0GK 3I55B 1EP4B 1WI8A 1R7IA 3ZXWA 4NYPA 3SQGB 3QGGA 4EGLA 1BE4A 4KN4A 4G1QA 3V6HA 1K9MT 1VIXA 4OYWA 4II2A 4KHPF 3CJ4A 2BUNA 2KL8A 2MTLA 2F4VF 1YJWS 2V69A 5I3QA 1RT1A 1NPRA 1ZM2A 1A6LA 4DF4A 3QFTA 3SV3A 4J9MA 3K5NA 4Z4TA 5IYRA 4LF1A 2PSZA 2DR8A 4LF8F 2ZUFA 1Z2LA 5KFMA 2XM3A 2UUBJ 2Q6KA 4KB2A 2HWTA 3SCKE 2AGPA 2WJVA 4WYLA 1PBUA 3ONUA 3DYAB 1BX0A 1TVRB 4DQRA 3ASSA 2WVEA 3JSYA 4PG6A 4WXOA 5IQQA 3BZQA 3GEIA 4C0HA 1IR2A 2P8IA 4BWMA 1JIHA 4CLLA 3G6VA 4WCEQ 1Y7PA 5FJ4A 4EO8A 4WIQA 2KVQE 2BE7D 3DDYA 3C16A 3HOZK 1S6QA 5H9EK 1KK3A 2OTLS 3R1HA 4LC0A 4IQMA 1OSCA 2QO3A 2IJFA 4F25A 1BX1A 3SSRA 3EDRB 1WG4A 2CQCA 2CFAB 2LP4A 2BANB 1WKJA 3M30A 4MKYA 1U6FA 3JYTA 4UZBA 4RJVA 5E7OB 5IQ6A 1U0HA 2OTLB 4OOXA 2OI2A 2WOMA 5K5MA 3CD6B 4G1BA 1JXLA 3HHLD 3BBFA 5H59A 1R5OA 2HWHA 2A10A 2DGUA 1QVFB 5DN6A 4DSJA 1F7VA 1WHVA 3ASRA 2FHKA 3CCLS 1XC9A 3HOYC 3MMPA 3HOZC 4KMAA 1SIZA 2M0GB 2ZOFA 1N05A 3HHLA 4ILLA 1QM9A 4TU9A 4IOAQ 3DDKA 5LMUF 1HQMA 2X3UA 2Z57B 2WB4A 3GFYA 2RSQA 4PG8A 2I1LA 3QGHA 2K1RB 1SJ1A 2FJVA 2MDAA 2KM8C 5ETRA 4C0SA 5J2MB 2ZHOA 4FYXB 4PC1A 5M2UA 4KYZA 2ZHBA 2ZDOA 1JOEA 5KFAA 1ELOA 4F02A 4WZLA 4NLVA 4WQMA 4ES3A 2R93C 1N8RD 5CYQA 5KT4A 1C4AA 2F40A 1G7CA 2OBSA 3MM7B 1GNKA 3BO3A 2CYYA 1D8ZA 2CFXA 3E3XA 1H3DA 4F3MA 2YBVA 1RHRB 3FBFA 3OFGA 2CQ0A 4WILA 2DNKA 2VJUA 2CRLA 3AVYA 1FRLA 7AT1B 1RWNB 1RTIB 3DGPB 5C2CA 4DFPA 3QRRA 5F4JA 5J2QB 3V4IB 2VC0A 3SDEB 2GSUA 4K4UA 2V8VA 1D9DA 3CCRS 4ZKAA 4KR0B 5FA6A 4X65J 4IG3A 1QAIA 2V8DA 2EWHA 2NLWA 2MHEA 1SJ3P 4RL1A 3AVWA 5LL6d 1H85A 1S1UA 1X4FA 1R8AA 3PHTA 3O8WA 2UV8A 2YTCA 4DBQA 3G4SB 1RXOB 2QN6B 3P3DA 4ECTA 5CD4A 2WZPP 1EB0A 1W87A 2YU9K 1D8TA 1Y9OA 2KXFA 4CLFA 3GLJA 3AGPA 4X6AK 2NCKL 2KG1A 2ZZEA 2V9WA 4JI1F 4WJ4A 5B0AA 4G1IA 2UUCF 2GHPA 2XZOA 4MTPA 1RLCL 1M1KD 2V9KA 5IP9K 1UV7A 1U8SA 3Q38A 4H4OA 2RMLA 1OGJA 2RH3A 1YNNA 1TQLA 1VK8A 4K50A 2IM3A 3MUVP 2BACA 3KMSA 3UCZP 3TARA 2DR7A 1IJEB 4KKUA 1SUQB 2DBBA 3OUYB 3HSGA 5BSYA 2KRBA 4X7DA 3VGUA 3GIIA 2YNIA 1VS3A 1RABB 3S2HC 4I68A 3U02A 1HWIA 1GAQA 1OB0A 2BW7A 5AXMA 3NAHA 2MLYA 1I6HC 4K4VA 3H0PA 3L3CA 4M53A 1N33F 4Y2MA 3MI7X 4V19X 3UFCX 3PRDA 4U8VA 1D3WA 4X4OA 4BY1C 3BP8C 2FJXA 4FS2A 5HATA 5HJXA 3R2DJ 3H8YA 4AQYJ 2L9WA 4L6V3 1UVIA 1F9EB 1KP6A 2MKYA 4QV2A 3UNGC 1KD1D 2OPSA 3CRZA 3J80Y 5KFUA 2HFUA 1JKHA 2Z30B 1BGWA 2XSJA 1FWLA 3MTJA 2XHCA 2I5JB 1G7RA 4USJC 5CQGA 4UUXA 1S1XB 4MKBA 4ZPAA 4Q44A 3CJ8A 3KDOA 1UAWA 2G0JA 3CCMB 4F67A 2DT9A 1NMEB 1WQGA 3EWGA 3I56B 2ZH5A 2W4CA 4OHZA 2E7VA 1UJ5A 2YWFA 1QGYA 2Z2YB 1FRMA 2VBYA 4ZLJA 3J81j 3OFNA 4H54A 3TTGA 3RBDA 3FK4A 2G4BA 5GAHI 4QVJA 2XLIA 1E3ZA 1L0WA 3BYRA 4DV5F 5TRDA 4O0IA 2KB2A 2VH7A 3PY8A 3W60A 2LU2A 4TYAA 1NK0A 3WNDA 3PYFA 1JA1A 5KAKA 2PHCB 1RTDA 1UP1A 1KMHA 4DOZA 4IR1A 3OL7A 3MAAA 3W61A 4MIBA 3FUYA 2VNJA 1MMNA 1EX8A 4HL9A 3A35A 1PC4A 3MMJA 5DZ7A 2R8KA 4UY85 3NS6A 4A47A 2CQ3A 4ECXA 2F8HA 3N79A 2UUWA 3MFHA 3FZBA 1SKYB 2E1CA 3WHIA 2WOMB 1FKPB 2GMHA 4OJ1A 1HNXJ 3PJ9A 3GPAA 2X8KA 1RE1B 2GMJA 4X2BA 5EN1A 4XKVA 3S16K 3WNBA 4CLZA 5AE1A 2HKEA 2F9DA 2X6YA 4QOTA 1XK8A 3IGNA 3QJJA 4K4ZA 5E3RA 1UVJA 2GS8A 3ELHA 4A8MP 1TWFC 3M6VA 3KLIB 2BYCA 1TK0A 1H7WA 3OW2B 3H2UB 3KNGA 3SIPB 1K9MD 2LQ5A 3H40A 4QWDA 3RR8A 2OEKA 1UVKA 2VIHA 3EICA 1S79A 3HF5A 2E9ZA 4LK1A 1R31A 4ZN3A 1E6VB 4DV7J 3LPXA 1S4FA 3D1OA 3C3LA 5G4DA 5ETPA 4O44B 3GTYX 2HNYB 3UPFA 1GX6A 3BO2A 2CDRB 2W7OA 3DLJA 4QBUA 2HVEA 2CPDA 3OFHA 4QHYA 5A76A 3CCSS 1TAQA 3HZEA 2CPXA 3DCAA 3KNAA 3HXAA 3M6WA 1UFKA 3NGTA 5EWFA 1VQNB 3H2LA 3NGKA 4N3NA 2B7CA 1JB0C 4IDKA 2EW9A 2PEBA 2FJEB 3U7JA 2HAFA 5CDFA 5C42B 2MKJA 2GX8A 3HSJA 2K8GA 1G7TA 3IMQJ 1K0TA 3LW5C 4PXEA 1SBRA 3DKDA 3T5HA 2ZFHA 3TZXA 1IBMF 5DS0A 3GR1A 3OKXA 4FN5A 2ZWPA 1R6YA 5H9FK 1GR1A 4ZHRA 4A8QA 1HNXF 1FJGF 2OFHX 3Q6RA 3ADAC 4PWDB 1RU0A 1E79A 5KFSA 5DQHA 4DX5A 3I5CA 3ASPA 2QGFB 5JUMA 2IBOA 1O2AA 2XB2D 1XZQB 3RG6A 4GC6A 5GAEI 1ITPA 3ZZTA 5HMXA 1TAUA 3GTGC 3U1LA 5D0GA 3LGMA 1VYAA 3Q0AA 1AZSB 1PJ7A 3MEKA 1UVNA 3C46A 2CQHA 3Q22A 2UXDJ 5FJ8K 1YCLA 3IGVA 3RB3A 1TWHC 1U1OA 4A3EK 1Y1WK 5AE3A 3M8QA 1HBUA 1IKXA 4DR4J 2R2UA 2FGOA 3MPYA 2HK3A 2JNJA 3CTAA 4CRJA 3EGWB 4IFYB 4RO0A 2RUGA 3GV5B 4BWJA 1KSPA 2QZ8A 1T03B 4GTDA 3AGQA 2UP1A 3T1HF 1NJXA 3IBCB 5A8WB 4A46A 3M4XA 5L9XA 2IRYA 1D09B 3TEHB 3ZZPA 2A18A 1HBNA 3PXGa 4ZPWR 1S99A 3V6DB 5LM7E 3NNAA 1BMQB 4XK8C 1C1CB 1WWHA 3US5A 2FJDB 3NNCA 2XULA 2NVTK 4Y7NK 1JLBA 1ZUNB 2M4MA 3HAGA 4Y3CA 4WZKA 6FDRA 3ISXA 1CNEA 4PQUB 4FYWB 2YNFA 2AJQA 2Y0SD 1I94F 1LWCA 3BC9A 1WSVA 3UVJB 3DHXA 2XOKA 1HLWA 1GO2A 2ZL5A 4WE1A 2H51B 3LAJA 4N7TA 4ZVSB 1HA3A 3Q3AA 5FD1A 2J6TA 3HJVA 4N8OA 3G6YA 4O3SA 2OBTA 2RAQA 1EFTA 4LBIA 2MEWA 2YY3A 2I9SA 1RHMB 2BX6A 5EMNA 3I1FA 3FSYA 4KKTA 1WC0A 5H9EJ 4X4RA 5KT5A 4OZ2A 4OLPA 2C3PA 4X64J 3KTQA 4NLQA 2B9EA 1ROFA 3OV7A 1TMJA 4O3OA 3ZZUA 1U0HB 4C8ZA 3S2DK 4JI1J 3DOMA 2MXYA 1LV5A 1ZS6A 4ZP9A 3TVKA 2UU9F 3QRPA 2CJBA 1TL7B 4Q45A 2NVQC 1K73D 2GVZA 4NA2A 1SCJB 3DOLB 4K4TA 3D68A 3O3LA 1B23P 1SJFA 5TMFA 4QFMA 4CCHA 2GGPA 2OJ3A 3QPIA 2J8SA 1Q78A 1S6QB 4OX9J 4OYZA 1HWJA 2IFXA 1G51A 3AVUA 2FZGB 1T11A 1NPPA 2XCOA 5C3EC 3PYEA 4RD0A 5EUHA 3UDCA 3UN3A 2QTWA 2VDIA 2A1BA 2YX1A 2E1AA 3CP8A 3PKMA 1QX4A 3HX9A 2VF3A 2K7JA 4LR7A 1CJKB 1D9AA 3MWBA 2F65A 3G82A 2DR6A 3JQRA 5EGHA 2ADCA 3CJSA 2PO4A 3MCMA 2VL1A 2FZKB 4YR2A 5C44C 3SZZA 4LIWA 2FHJD 2GA7A 1EFUA 3I0SA 4EBEA 5ETTA 1XE1A 1YQHA 2F63A 1L3VA 2KVOA 4N77A 1CJTA 2AJ4A 4B3SJ 3KLEA 2EBGA 2YX4A 5IC4B 4M8LA 1Z4UA 2FD2A 3D54A 2WAQD 2C3YA 3TZWA 5K8PA 4PC7A 3ZZYA 3T51B 2FHJA 1Y5LB 2Y8WA 3X1LB 2VYQA 1AUDA 1RTHB 2MB0B 5TMCA 1S6UA 2HW3A 3EVOA 4ZGNB 4TMWA 5HZAA 5J2MA 2EC0A 1KFDA 4F4XA 3S16C 1JLGB 1RJJA 2OD4A 4RM0A 2J6SA 4JI8F 4YALA 3QMQA 3QSYA 1PJ6A 2QSWA 3AB2B 4P73A 2V2QA 1YJ9S 2QLFB 5KFNA 4BBRC 4RNMA 2CPHA 2BOPA 3GJQB 4DV3J 3W62A 2LZJA 4IO9Q 3V76A 2CJKA 1M1HA 4LF5J 2B7BB 2F9JA 4GT9A 1XJWB 2OSRA 1JWWA 3MM6A 1RWOB 4DV0J 2QEXS 1SQGA 1HPZA 5KG5A 5ETSA 3W63A 3OZVA 3V5RA 4B3FX 2MKHA 4HE5A 4ZHRB 4AFFA 4HTIA 3QSIA 2IYIA 5KG1A 1PKUA 1HNVB 1NH8A 5CYMB 5KSWB 4KH0B 4M5KA 2QX0A 3WIVA 2ZL6A 3I9V9 3K5MA 3HK2A 2HAIA 3S14K 3M2UB 1UA0A 1MU2B 3BPSP 5JVGQ 4M95A 1OY9A 3RB0A 1TK8A 1U2CA 1EXMA 2B4OA 2PN6A 4OIOA 4A93C 4C3IC 3ZIAA 2IDLA 4RBUA 4LRCA 3EPGA 4JI4F 3CPXA 2WB1L 2DH7A 4ES2A 2XMWA 1Y0RA 3FPKA 3VO1A 2GGPB 1EFCA 2XG8A 2ZH8A 1TL3B 1QAYA 4IRKA 1ZPWX 4TSFA 2JDIA 1FTCA 2IHR1 1R6VA 3OPFA 2R9LA 2GVZB 5K8MA 4UOCA 3W2WA 1O28A 1OO0B 4M63A 4FYDA 2VFUA 1VQPS 5HMYA 3BNWA 4A3JK 2GO8A 5CHCB 2ZL7A 5LSRA 4C3JK 4RW8B 4OIXA 4KV8A 2VG6A 3I0RA 1DLOB 5HKKA 4Z4YA 2RVJA 1E1RA 4F2RA 3NEKA 4G6VB 3A3OB 5A2QU 1AA1B 4ICLB 1J5OB 2A6MA 4JBCA 2N82B 2FZCB 3OFEA 1S59A 1X4DA 4NBSA 2A2DA 3OJUA 6FD1A 2PMWA 3BP3A 2Q66A 4LR9A 4ID8A 5I3PA 2DY9A 4NXNF 2GO9A 4XLAA 4X4SA 3Q8VA 4KPYA 4A3DK 3ES9A 2X3DA 1T6YA 2ZBCA 4F26A 4CWBA 4E0FA 3IR7B 4B3GA 3POTB 2XY7A 2C5HA 4C2MK 1LWEA 4B9SA 4XSZA 3H90A 1UPPA 4CQJA 2ZEJA 2FUG9 5DETA 1HQEA 2WVFA 4DPXA 4KARA 3MR6A 2AX0A 1RTJB 3UE2A 3BSNA 1JQWA 4KMDA 3LANA 4XLHA 5F0WA 1LNQA 3CCVS 3T9ZA 3NWRA 1T9TA 4YFXA 1EKSA 4DR4F 4FXUA 2B8QA 4P10A 4M5HA 2EFVA 4MK8A 3SLNA 1IBAA 3MCOA 1U25A 3W1YC 5IS2A 3SBMA 2Q6LA 1QAJA 4TT3A 1Y4ZB 2CPIA 4NE9C 3NUHA 1K1SA 3NOCA 4P6QA 4MKAA 3GR0A 4XOTA 2DKOB 1X4GA 4B3XA 2GJFA 4Z1MA 5B0FA 2H5EA 5FO0A 4WJBA 2VBUA 1HIYA 2J0WA 2BN4A 3OEEA 1MN9A 2CZ9A 4KFBB 3BY1A 3JS9A 3ISZA 2V68A 2XMUA 2JLFA 4U6PA 5TY0A 4C11A 1SC4B 3U2QA 4F8RA 4ZPDA 1TWHK 1VI7A 1HR0J 5E5NA 3R7NB 4TQRA 4QPTA 3KLEB 2XMAA 4B3RF 3SDEA 1VFJA 1XMQJ 1T5EA 1JXVA 3NBPA 2KU7A 2X6XA 2CPYA 2NXEA 1E3XA 2HK2A 3DRYA 3IR6B 2KHCA 2A68A 4IYQA 2XCRB 5BYQA 3CCJB 1WACA 1S0OA 1VQ9S 2KO1A 1E63A 3GDZA 1Y0HA 4FF2A 5LMZA 3OXGA 1R27B 2Z0GA 4W90B 2ZZQA 2B9YA 5C4XC 1VRUB 4RDJA 3G71S 1NBEB 2RRBA 3BCFA 2NVYK 1HKAA 3ZZRA 2BQRA 4BY1K 1R3NA 2VASA 2ZXIA 3F56A 1C0UA 2XGQA 2VG6B 3OD2A 4ZVRB 3OZWA 1KNZA 3EYZA 2HNZB 1CS4A 3C16B 1IKWB 4OI4A 2R7ZA 2FVQA 4KMHA 4XLPA 2ZH1A 1U2RA 4NLTA 2GW8A 3POTA 4QJVA 1SUQA 1BY9A 3FJOA 1T94A 3PX6A 2IC3A 4MAKA 2QV6A 2Q79A 4WP8A 1Q8IA 2R8JA 1RT5B 3V81A 1PYSB 3R5GA 2YNHA 3M8YA 1TL5A 3MM9B 3LNNA 5CD4H 3M9NB 1J5EJ 8RUCA 1K0VA 1O25A 4J9OA 5GV8A 4LFAJ 3NRBA 2ILZA 4GZYA 5GADI 1FO1A 5IM0A 3CDBA 2VQEJ 3TANA 4YB7A 4FPIA 2C3MA 2CQBA 3MR3A 2XZTB 2C2OB 3ULHA 4BKWA 3KL9A 2ILYA 3P8BB 2R92K 3TJ9A 1SL0A 1HHTP 2C77A 2PMZD 2I2YA 2ZH3A 1DURA 4GKJF 1FCAA 3TUJC 4Q2LA 1EI6A 3K58A 3LQEA 1NDPA 1YJVA 5FLXU 4LRFA 3A4TA 4YQWA 4RNHA 2NYHA 3BQJA 1XBWA 1GVHA 1IN0A 4Y28C 2R7OA 3EVMA 5E3PA 1R8PA 2B63K 3G96A 1VJQA 2BRLA 1TWAA 2MQPA 4CTAA 4RU2A 2M2BA 2BQ3A 3MM5A 4AL5A 2NVYA 3S1MK 5D4OA 2WTFA 3DLGB 1FNBA 3MCNA 3GVLA 4I6AA 1QGAA 1NK7A 1V5IB 3MAQA 1IWGA 2UXBF 4B08A 4DV7F 1U24A 4X66J 1NHKL 4C43A 1BJKA 1DARA 2CPFA 4BBRK 3N4WA 1FRNA 2R7QA 1DCHA 1HNIA 2PGCA 3H25A 4ZVEA 5ETVA 2R4FA 4ANEA 3RB6A 4HDHA 4ROXA 3EXYA 4M5JA 1BHNA 4KIAA 2Y9HA 2B51A 1QG0A 2OHDA 4DL4A 1FX2A 3W5XA 3RRGA 2IDEA 3GIKA 4NMXA 1T7PA 5HBMA 1WDDA 4OI6A 3NS7B 1ZBSA 4C8MA 1NBMA 3VWSA 2AZ1A 1XNQF 3A8IA 4DR5J 1RA6A 1J9ZA 1WEYA 1HHSA 2KG0A 1HI0P 1OWXA 3DM2B 3RUBL 3BH6B 3CJ5A 2PMHA 1DTQA 2BVZA 1M90D 4DN9A 4A3BK 4ED4A 2AF6A 3SKBA 4V19J 1LWXA 1Q53A 2E29A 3BV8A 2ZZGA 3CCTA 1DLOA 4KBIA 3KG0A 4MFBB 3CQZK 1IW7A 3G6EB 1W2IA 2GMLA 3DC2A 1E6VA 1Q7YD 3W5VA 4Q4ZA 1AW0A 2ZJPQ 3M1VA 3R5DA 3QZ8A 1S6PB 3MHPA 4NLPA 2HCJB 4M4SA 2W4PA 1YZ7A 2AYMA 4GVLA 4EWTA 1C1CA 2UXBJ 1S48A 2GJ2A 3IR5B 2XS7A 1F3FA 1S9GA 3MEGB 4CYUB 4CLYA 1FVQA 5E3CA 2W6JA 3HLUA 4XR6A 1DCPA 4D3HA 4CO3A 2UV8G 4ECYA 3RGIA 2VG5B 1DDIA 5BJRA 4ECWA 1SH0A 2GQCA 1SJ4P 2A0FB 2XMJA 4KMUA 2BBEA 4LBYA 2R2SA 1RU2A 4P5BA 4NCGA 5KFCA 4OYMA 2UVRA 3BR9A 4WFXA 3GTKA 2W2PP 5KTQA 1SL1A 3CJKA 5HO4A 3CMQA 1TMMA 2OO4A 1TKZA 2IA0A 2HVZA 4A4JA 4XDCA 4P26A 1EETA 2DNNA 3TA2A 2RQCA 3HOXC 3P49B 3QAUA 2BSAA 2C5BA 2CQ1A 4LF8J 1I94J 3WQZA 3MECB 4Q2MA 3DFEA 2NVXA 2ZM6F 4P75A 5I42A 3MR7A 2EBEA 3D66A 3GTLC 1QTMA 2OH2A 5BYSA 1JLQB 1HWLA 4QU7A 2WONB 2VOPA 5MLCV 4ILMA 4QWBA 2ZZNA 3EQLA 1GMVA 4MKVA 2UUAF 4E0DA 1RI7A 4YG2A 2DHAA 3SZYA 4B3OA 1TFYA 4ALZA 2GCFA 1KK2A 3BF4A 1WCMK 1FNOA 2DGXA 4ZJLA 2VBVA 4WTOB 4Y6IA 4UW2A 4OHWA 2UUAJ 3MEEB 2NPIA 4RD3A 4JI5J 1ZA1B 1SKUB 1H7XA 1WC1A 4BBSC 2B43A 4KHPJ 1PG5B 5DDQC 4WKRA 2XZDB 3GTMC 2CWXA 1NCLA 5IOTA 3M3YC 4OYOA 1JA0A 4QQBA 2LEPA 2ZBUA 2NR0A 3Q2SC 3I87A 2J9CA 1VQ7S 2MQLA 5HP1B 4I6WA 3OVAA 1XPPA 2DNHA 3W5UA 1UWAA 3MPUB 4A3IC 2PPBA 1VOMA 3PZPA 5E6TA 2V6SA 4TKOB 3FOEA 3I0SB 1G3OA 2ROPA 1PKVA 3B8HA 3DLEB 4DDFA 4ED5A 1WHXA 5JXSA 4Y0FA 4P2MA 1VQ5S 1MWQA 3CCUS 2C4UA 3EVWA 3K7AK 3QBCA 4W4MA 4OHXA 1TUVA 4DR6F 3FQLA 2JH3A 1XR7A 3M2RB 3RZOK 1FNDA 1NDKA 3GTPC 2NVQK 1ZOTA 1JJHA 1W34A 3T3FA 3JSTA 5DLGA 1ULRA 4ZN1A 4LRAA 4JI7J 2HHQA 4B48A 5IP7C 2AMCB 4C97A 1E1QA 4Y2KA 2V7XA 4B02A 2HVHA 1SQEA 4F4WA 3PM9A 2W2OP 4ZOSA 1WG1A 1YJTA 3KXDA 4C2MA 4JI7F 3HKZD 3UCUP 3VMFA 4DQIA 3HULA 3K8WA 4RW8A 2OPQA 4P6YA 2DB1A 2POKA 2CG4A 2YU9C 5F8IA 5E41A 2AYEA 3PX0A 5DDPC 1M5SA 1I3QC 1HI9A 5C4XK 5KNLA 3CD6S 1ZVUA 1E43A 1TV6A 1JLAB 2CNLB 1HBOA 3OR1B 4PWUA 4L76A 3GQBA 1IL2A 3JSMB 4DS5A 2V2VA 4HHJA 3MECA 3CMEB 3WZ0A 1JNRB 1H0HB 3HOVK 2JA5A 2KH9A 3S1MC 3DI6B 2RDJA 4J9RA 3CGIA 5IYQA 3CPWR 5M5XK 4RNOA 1F20A 4EYHB 2V2ZA 1YX2A 3VR1A 2V6TA 2H5JB 4RCYA 5EGEA 5F8MA 1P6TA 3OJSA 4PEOA 1YIJB 3CUNA 1NSAA 1RTJA 3AFGA 4OZ3A 2AJ1A 2YNGA 2VBSA 3DRPB 2FPHX 3QRQA 3H42A 3HXMA 3R5JB 2BJ3A 3GTMA 2YH0A 2W6IA 3BSCA 1RUSA 5HQMA 2IVMA 5J1EA 3KUEA 3HM9A 5IZHA 3KJVB 3HOUK 3M9MB 2Z6BD 2E5GA 3AB4B 1VRTB 3HOVC 2MLZA 1HARA 1XQBA 3W64A 2MZJA 2FVGA 1RQPA 3K0JA 3DGPA 4WZEA 1CPZA 1S1WA 3QQCD 2GQFA 5KFRA 2OEMA 1TWAC 1WNEA 3N9UC 2H48B 2XSFA 2AV5A 2A2CA 4YHBA 3VNUA 4YN3B 1VQ6B 2OLWA 1QUEA 3RYLA 4ENOA 3FDSA 1UFWA 2CKWA 4BLAA 1F6TA 3A3NB 1AT1B 4JI6J 2FQTA 5KFOA 5KFTA 1VLYA 5J35A 1Q86D 2ROEA 4WBFA 1TWGC 1MNEA 3MMCB 3LUYA 3CPWB 1INNA 5HP1A 4LBHA 4B47A 4XN3A 2RS2A 2GIQA 2I0XA 2WPDA 3EZUA 4A3FK 4U7CA 2EC2A 2WZ1A 2ZNYA 2BMBA 1VQNS 3DXJA 3PTWA 4F4KA 1U47A 1RWKB 3WDOA 4DSLA 4MQ9A 1B64A 5DZ6A 3VTIA 3OZUA 2DR9A 2Q6CA 2VJVA 5C24B 3IO1A 2MHNA 2P9CA 2HFSA 3M8WA 1XR5A 2V7UA 3F0NA 5HVHA 3HZGA 4Z7YA 2KZZA 2DRAA 2XMMA 2MQ8A 5FDLA 4IW3B 2PA3A 3FSXA 3M8RA 3ONYA 4Q5SA 1U1NA 3R9LA 3UCGA 3EJMA 2XNDA 5A8KB 2L9DA 3ZC3A 4C3JC 1FA0A 4C8YA 3D0HE 2HYIB 1UD8A 3C14A 3KLFA 2IVYA 2CQGA 5KFYA 5IT9U 4YMEA 1WG5A 2RC6A 1P27B 3HVWA 2VHGA 1CJUA 1FNCA 2KYXA 4O3PA 2P2CB 1UCNA 2IC3B 2Y1IA 3MM6B 2V7TA 1CJKA 3OXFA 1LW0B 4Y34A 3W9JA 4TKTA 2G9OA 2DEUA 3N6LA 1HW8A 1S7HA 1BQNA 2X85A 3U6KA 3PCOB 3BPDA 2YQ3A 1LK7A 4LBZA 4ANCA 4X4NA 5B0EA 4RPDA 1K47A 2J9DE 3VAFA 3KFWX 3FCHA 3GTKC 4F4AA 1VQLB 4O3NA 1GT8A 2BKPA 4OFZA 1TP7A 3K17A 3SJZA 2GHWA 5GAGI 2UXCF 1N4LA 5EGYA 3I5AA 3K2YA 5E2QA 2V7VA 2NVXC 5LOQA 2GFFA 4TMVA 2LDIA 4EH1A 1RWUA 2D3OR 3D0IE 2SXLA 4ZVTB 1DDGA 4FYVB 2BJ8A 3TUPA 4X4UA 3A3BA 1RWPB 1TWGA 3S17C 1L3TA 3BKFA 4K0KF 3QIDA 2MKSA 4CO5A 2NPFA 4DX7A 3MM5B 2VNKA 3RRHA 2XO6A 4OPOA 1RT6B 2Q6BA 1G7SA 2A6HA 1TKTA 4ZLNA 4LF6J 1WTHD 1DZ5A 3ZPNA 1NB9A 3N0BA 1FWPA 2UUTA 1KTVA 3C19A 2C2RA 4QYRA 3V4IA 4DV4J 4CLUA 4XSXA 2QE5A 3FRYA 1X9WA 3OR1A 3OTCA 2DJWA 2VQFF 2W9CB 4WU3A 4OIPA 3FQKA 2RU9A 5U47A 3CCSB 3VVUA 1GX5A 4OJ3A 3UN5A 1UEKA 3GYNA 3HMJG 5CYMA 1K1QA 1EP4A 1J27A 2Z58B 3FKIK 3GEEA 2QMUA 1XERA 2Y1LB 4KH1B 4NLUA 3ISND 5E3QA 4OX6A 1LWFA 3G87A 3HSDA 3BUEA 4CM2A 1KFSA 1EJ7L 3KJFB 1X5OA 2G1HA 4PUOB 3PIOQ 5KFDA 5FDLB 3BGRB 2L9NA 1FI4A 4IG0B 1S76D 4F3OA 1IWAA 2C3UA 3IG1B 1XB2A 3Q8PB 5HN0A 2DHHA 5J1EB 4P7TA 1F5AA 1JKHB 2CW0A 4RW7A 3BEGB 3HHNB 1ZAXA 2DK2A 4I0WA 1V0FA 3EMTA 3MEDA 1U09A 2EIXA 4G0UA 2MKIA 1IVZA 4YFUA 2E44A 2N3LA 2YWWA 3MHYA 5KFPA 3PW2A 1VQLS 4F04B 2LQ8A 1D1UA 1T9WA 2F8EX 2IM2A 1QY7A 2DGOA 4XQFA 2CQIA 3D6HB 1E64A 4DLEA 2BV3A 3CDWA 1FF2A 3OHAA 1JJ2B 2DYAA 4C9DA 3BBCA 1SKSA 4OYBA 2HBZB 3IWLA 4ZP6A 1XMQF 3LP0B 2BJ9A 1HVXA 2XY5A 4QR0A 4C8OA 4LFBF 2J9DA 1S6OA 3QFHA 5KG0A 2DPIA 2UXDF 3CD0A 5A8RB 2J0XA 2ZUGA 4E98A 3GQCA 4EYIB 4PYAA 2JC0A 2R8GA 2ZE2B 4CDIA 3T1YF 1YHQS 2YXLA 2DCUA 5CJ9A 4Y65A 4K8RA 2ABYA 3BGUA 3EGVA 1YITB 2RDIA 1SPBP 3IA0A 5F9NA 3GYXB 2JVOA 1JJCB 5BR8J 4Z4WA 5DO2A 4KGMA 2FLOA 4A3KC 1YI2B 3DLHA 2QYCA 2OFGX 2ZM6J 4ZLPA 3OT9A 1V6HA 4A8OA 3D6FB 5LJ3Y 4HKQA 3FOFA 2CF4A 3EM1A 3VAJA 2BE2A 1I7PA 3AQPA 3OW2R 4L3KA 4UQTA 4CH0S 1FRQA 5I42B 4WFNQ 4C8LA 3DNCA 4MMOA 1PGZA 2ACYA 1ZTWA 1TKXA 2QIFA 1XMBA 3GG0A 5M2RA 5HI7A 2VODA 1OYEA 3LAKA 4XOPA 1ACMB 1RT2A 5B0DA 1FX0A 4M5GA 4ZK7M 3HHEA 2ZH4A 1ISEA 1YTYA 3MM7A 1M5HA 1FD8A 3LP2A 1MWYA 4AL7A 4V1Ak 1Q82T 4AQYF 1WTBA 2AKWB 3DLBA 2ZITA 1HI1A 3B54A 4OHYA 3GTJC 1RADB 2EBBA 3MPVA 3NCQA 1YDLA 2DIVA 2OBRA 2B7CB 4IDKB 2JA8C 1FNMA 4XLCA 4PABA 1T02A 1VHFA 1FHTA 2C2MB 1Y5NB 4PUOA 3FKBA 2BE9B 1DY3A 2KDOA 4JYAF 1QTNB 3CEDA 2FJWA 2A6OA 2IAJA 2A69A 4GC7A 1I6JA 4QIWD 4LBPA 4OZ0A 2ZC3A 2IJNA 1WC4A 3HDSA 4WF9Q 1TLLA 2CC2A 2RQMA 1U02A 2MPUA 2VFSA 2Q6OA 1B99A 1XNRJ 5A2QY 5D0EA 4OX9F 4LT6A 2NXJA 1Y1VA 1F2HA 2L48A 2UUCJ 3VQTA 1KVKA 3H5XA 3OLBA 4J9LA 3L9ZA 1KK0A 5B0BA 4DR2F 3J7Z5 1XMOF 1SIWB 1RAIB 5IWAF 3CMMA 2CZVC 1TWAK 2FLLA 3IS9B 1P9QC 1QDUB 3C14B 3KLFB 3BJYA 1SL2A 4WP9A 6AT1B 4KN7A 2VBWA 3GEHA 5LSLA 1TUIA 4DV0F 1CS4B 4ECQA 3VVTA 4DHVA 1RTDB 4DL7A 2VG7B 1VQPB 1WQHA 4BBYA 1LW2A 3UO0A 4UZEA 1J6WA 4Y7CA 1R8BA 5GMKa 4CZCA 2QG9B 1YBTA 3H5SA 4BCAA 4RD6A 2W9BA 3C6TA 4R0EA 3HOXK 4FPRA 1EP2B 1PCAA 1UKUA 3KHHA 2BW2A 3AD9C 5DQGA 5IYPA 3Q39A 4B3MJ 2V34A 1V3RA 4O23A 2X1BA 3MAHA 2JA7C 4RX6A 1M5OC 3CD7A 4TMZA 1O5JA 2IY5B 4NMLA 4P25A 4DCPB 1OB5A 2XCAA 1X0PA 2KFNA 3UNYA 1KC8D 1XNRF 4JI0F 2HQIA 3N5FA 2ZFZA 1NM2A 4GO5X 3NOGA 2HPUA 4MH8A 3LH2S 3HJFA 3S17K 3QE2A 3NGUA 2CPZA 4LREA 1MN7A 1VQ5B 1RT3B 3QLHA 4ZCIA 3NNHA 4A3MC 3AODA 5GVQA 1C0TB 3Q3QA 1NB7A 1SFOA 1VGYA 4NXMF 1R5NA 4M5NA 2QA2A 3CDEA 4LSZB 3DOKA 2YU9A 4JV2A 2IM0A 4P2XA 2GK6A 4ZPVR 1B7FA 3GFXA 3GIRA 4Y2AA 5JMNA 3OXLA 1R0BG 2VDHA 2VPYB 2OD6A 3JU4A 1X8DA 1TK5A 4DV1F 3W2IA 1ZM9A 4K4XA 1S5ZA 2G1DA 1FNXH 1YJ9B 4A8XA 4DEZA 4ZVFA 3FCWA 4FNHA 2DETA 1QSSA 2HNDA 2QA4G 2NYIA 2OPQB 4DPOA 1SH3A 2IAJB 1KLNA 3LAMA 2FJBB 1H8EA 2YKAA 2GJPA 2W2MP 4UUWA 5DLFA 2KKHA 1RK8A 1U49A 1HNIB 2JDJA 2FQOA 1KDNA 1S0NA 4ECUA 4OV6A 5F0UA 2BE5A 1JLAA 2HFNA 2WBMA 4RUCA 4PZVA 1XWLA 2XZLA 1MROA 1W2BR 3R2CJ 2BJEA 3BSOA 3D6TB 3RRKA 4FVMA 3H0GA 3I82A 3KLIA 1IR0A 2U1AA 1DD5A 1X0FA 3LF0A 4DUZF 1URNA 3TW0A 1V3SA 1FJEB 4DR3F 3CTRA 3BGOP 3JQQA 3NXZA 1CBKA 1NHVA 3ZFVA 3DM2A 1Q81T 1BS2A 3WC2A 2YQ0A 3BH4A 4M5LA 2JSXA 4DUZJ 2ZBQA 2CNKB 2B9WA 2HIQA 4DFJA 4JI5F 2E7WA 4X6AC 1TTTA 2GQ2A 5K8OA 2MZRA 4U7UK 1KLMA 2PI4A 1B0VA 2HNZA 3QFWA 1TL1B 1M0SA 2YNGB 3FHZA 5M5WK 1HR0F 4C4WA 5KFWA 3T5KA 4KO0B 4HACA 3M7VA 3QAEA 3JAMY 2BGJA 3W7BA 3H2VE 1SJRA 4X65F 3BCDA 3M1VB 4IH6A 1ZYRA 3D1QA 1N48A 2W1BA 1N52B 3KUHA 4DK0A 4FF1A 2CNNB 4M0LA 3HO1A 1I51B 4U8YA 2X3GA 1S1WB 3CJTA 2ZZFA 2QJ3A 3HT3A 1I6HK 3DGVA 5DRKA 4WXWA 3LP1A 4X62J 3TX8A 2W4DA 1UVMA 1KVJA 1S1TB 2AJFE 4FKXA 3CDAA 4DQKA 3AXKA 1NKBA 2WSEC 2VPZB 2H54B 4R8UA 2XNCA 2RIJA 4RBVA 2HHHJ 1UMKA 5KFZA 1TV6B 1DQ9A 1R9TC 1AIPA 5DSZA 2F8MA 2N7YA 2GJRA 4OI3A 4RLZA 3RR7A 2CNOB 5K14B 3T56B 1BJTA 3M2VA 4CO2A 2HBYB 4ES1A 1YLOA 4ZA1A 1RSCA 4R25A 1KQFB 1JB9A 3SSSA 4B3TF 5KFJA 3PW0A 3OEPA 1JQGA 1ZAVA 4TY9A 1IKVB 1FDAA 3E1YE 1SB6A 2VJIA 4LR2A 1R0AA 4FZVA 4CIOA 3H20A 3A8JA 4XKWA 1TR0A 4MT1A 4BHQA 2P9GA 2QA1A 3DLLQ 1YJUA 1T9XA 4M1XA 2PIIA 3UD4P 2Z4PA 4NA3A 3GTJK 4K59A 1D9FA 3KKFA 3SEOA 4NCAA 1XXBA 5HVGA 4UZUA 4DSEA 5C44K 2XEXA 3G8TA 4QU6A 2CQ4A 1RT4B 4A8FA 4KFBA 3EXCX 4UOFA 1OQ3A 5J2NB 2VA3A 2LVWA 4FDFA 2HVIA 4Q8EA 3I4PA 1COWA 1IM6A 4TY8A 1F9HA 1RHKB 1H8HA 5DDOC 2JA6C 2UU9J 5J1PA 3EGNA 2HHVA 4HLBA 5IV4A 3DDIA 4QIVA 3THTA 1EWYA 4KGZB 1HWUA 4DQLA 4RMFA 2DNPA 5SZTA 5F4OA 1Y0YA 1M5VC 2QLJB 1S1UB 3E20A 4X0CA 3PFEA 2CG8A 4KGVB 3ZNUA 1Q86T 1I3QA 1SC1B 2QTLA 2XLJA 4P5AA 4DQPA 4PCQA 1O2FB 3EZOA 2OPRB 3H7HB 4X4PA 5A8RA 2AIRB 1LFWA 2HMIB 2DISA 2LYVA 1TWCK 5TJ3A 1B0PA 2W2NP 2XY6A 2RF2B 3E51A 1VISA 4YDDB 5BSXA 3D5MA 4WZQA 4ED6A 3MM8B 4RW7B 2NXUA 4GKKJ 1USMA 4J5OA 4FWTA 3N5BA 2KZMA 3T00A 3FFIA 1TL7A 3BGRA 3ZTPA 5ETNA 1RTHA 1WI6A 2VZ9A 5I4MA 1KLMB 1T3NA 3V6KA 3S14C 4UZFA 5GMEA 3V4GA 4RW4B 2MZSA 2WZNA 1IM4A 1SV5B 4URSA 1Q7LB 4C3IK 1VF7A 2UVWA 3FNNA 1WC6A 4WTYA 1RU1A 3J7A1 3CW2C 4B3SF 4F0MA 5KFEA 4ZIWA 3EE3A 4A3BC 1O29A 1QSYA 3T53B 2V94A 3ZTSA 2XC9A 1PYOB 2D9OA 3BB5A 3PUMA 1URRA 2JA6A 4K2XA 1RQ0A 2BGIA 4ELUA 3HVRA 4LFCJ 3VGTA 3M32A 3M4OK 1SQFA 1IKYA 3QFSA 4NX9A 4FZBA 1EKRA 5L8RC 3TNVA 1S4EA 3HT0A 3GB0A 3D9BA 2YKMB 1VQ9B 2DNOA 3M8ZA 1X4BA 3CC4B 1YRTA 4LQYA 3AVVA 2ZBIA 3R5BA 3I4MC 4AE5A 2GAHC 3GMGA 1R8CA 5IYDK 1DCOA 3OW7A 4AC9A 4LQ3A 1F0XA 2L41A 3M2UA 3B82A 2QYGA 5ETMA 3EX7B 2CVIA 2DTJA 3IM8A 2CZ4A 3K59A 4OOSA 3LO8A 1EETB 2VFVA 3GVJA 3MD1A 3OPOA 1BQXA 1GK8A 3CC4S 3SLDA 1KJZA 4OIRA 3I31A 4B9LA 2V0NA 1RYSA 2J7WA 1YKWA 3OJXA 5C7PA 1CSJA 3ENQA 1ZQ1C 5GAHU 4LF4J 3H9NA 3ASTA 1S4MA 4G1QB 1YG0A 3BBBA 1N33J 4OI2A 1NRKA 2F4FA 1V0EA 2H65B 5D4LA 1G7CB 4EMDA 2V4RA 3T02A 4CI0B 2AHOA 2QTZA 3I9ZA 4YAUA 3AJ1A 4A3EC 9ATCB 2JEJA 4TU7A 1XEZA 2LU1A 4NXMJ 3IPJA 3UDLA 3K89A 2GK7A 1IBKJ 2OIHA 4PQUA 3W5ZA 4CO4A 4JI6F 1PSDA 2ZH2A 4CTAB 1LWCB 2AWZA 1N56A 4WFZA 2Q43A 4C0BA 2CBXA 2F4VJ 2E1RA 4KATA 1WD6A 3LGNA 3BKTA 2JJ4D 1HPZB 2HDNB 3R8YA 4AL6A 1AUSL 4HH0A 4PGOA 1HFEL 4I64A 4LBWA 2H3EB 4PG5A 4RUBA 3MM8A 4ELTA 4DL3A 1CJVA 2W7AA 3C15A 3D7SB 4DNTB 2B5OA 2CRVA 1L3UA 1I8DA 2LCWA 1SKQA 3VR6A 3L4KA 1NHUA 1U1MA 3UR3C 2LQ9A 1BC6A 5G0RB 3AT1B 2E66A 2XNQA 4KJIA 1F2GA 1VHOA 3K57A 1RHUB 4KC6A 3L4BC 2RF2A 4LRBA 3U6BA 4ID5A 1TL1A 2AYGA 3QT8A 3GTOK 1AB4A 1M1KT 4KKOB 1B7YB 1IHMA 3IAS9 1UEVA 1CJTB 3MF5A 2ALYB 1IBCB 1YBAA 4MIWA 5E3AA 3OUYA 1N5TA 4C8KA 4DFKA 3S1RC 3UWTA 2EPIA 3KK3A 3NMAA 1VBKA 2VC1A 1B0TA 5L1LA 3KK3B 5HROA 2QC3A 5C25A 3GV7B 1Y00A 1FRIA 1TU0B 3GTJA 5ITHA 4WFBQ 5E68A 4KM9A 1JLGA 3G9CA 2Z2ZA 1PYTA
chains in the Genus database with same CATH topology
3GEHA 3GEEA 1WOSA 1X31C 3GSIA 1YX2A 1XZQB 1WSVA 1NRKA 3AD8C 1V5VA 1WORA 4P9SA 3TTGA 1WOOA 2GAHC 4PAAA 3TFIA 5L46A 1VRQC 1WSRA 3TFJA 1XZPB 1WOPA 1VLYA 3AD7C 1VLOA 1XZQA 1PJ7A 3GEIA 3GIRA 2GAGC 3ADAC 1PJ5A