1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
3TTGA 1WOSA 4PABA 3TFIA 3ADAC 1WORA 3A8IA 1XZQA 3GEIA 3GSIA 2GAGC 1WOPA 1V5VA 1X31C 3A8JA 3AD8C 3GIRA 1WSVA 1VLOA 4P9SA 3TFHA 3TFJA 1PJ7A 1WSRA 1NRKA 1WOOA 1PJ6A 1VRQC 1XZPB 3A8KA 3AD9C 1PJ5A 3GEHA 3AD7C 2GAHC 1YX2A 5L46A 3GEEA 1XZPA 1XZQB 4PAAA 1VLYA
chains in the Genus database with same CATH superfamily
5J2QA 2NYIA 3O8WA 1HNZJ 1KZLA 3BSAA 1PKVA 2W4DA 2LXIA 4NOIA 4HHJA 2VU5A 1W2BR 4F4KA 1L3UA 1XMOF 3B82A 3M9OB 2B9YA 2VBUA 5HMYA 3HLUA 3IMQJ 1IKWA 3M9MB 3LP0B 4MKYA 1KTVA 5BYRA 2XI2A 1AMOA 2ZWOA 4LF7J 3ZBUA 1YVFA 3LWLA 3T01A 5H59A 1BQMA 3MZIA 4JYAJ 2LFVA 3D6HB 3GFYA 4CO4A 3G6EB 1N07A 5M3FK 4LIRA 3UNGC 4OIPA 4RR5A 2F8MA 2QTWA 4F2SA 4OV1A 4P73A 2J9CA 3M2UB 1FJGF 5HAOA 2DD8S 4I6AA 1QD1A 4A3IC 4G7WA 1IKXA 2ATCB 4LFBJ 2OBRA 5AT1B 2HFUA 4PG6A 4QPTA 1QX4A 4O3NA 1NHVA 1KVIA 4AQYF 4BKWA 5C4JC 2VICA 2AEMA 3N9UC 3O2IA 1ZYRA 3ENWA 1M5SA 3SKBA 1RHRB 2VQEF 3OE7A 1WPCA 2XB2D 2WHOA 2KJVA 1RI7A 4KPCA 3PW7A 1A9NB 4FF1A 3OTBA 3KNGA 4R0JA 2HVEA 5TR9A 4O3RA 5HJXA 2RDJA 1DDGA 3Q8SB 2XSJB 5C44C 1HBNA 1X4GA 3AOAA 3O6QA 1IHMA 3RB0A 4A3EK 4IFVA 4O3QA 1OYEA 2QGFB 3M9NB 4P6YA 4U9UA 4F7DA 3H59A 4OI6A 2CKWA 3R9LA 3DOMB 4DV3F 3GTPC 1OYDA 2IAJB 2ROEA 2XULA 2E44A 4FZBA 4CLTA 5IYQA 3QLHA 3KJVA 1ZBTA 5CH7B 4ECRA 1KEKA 4ZVTB 3OREA 4GFQA 2R2TA 4Y52C 3MCSA 1VQ7S 2GNKA 2HRTA 5D0EA 3AGQA 4DK1A 3KLVA 1XN9A 2B63A 3ZUGA 1IBCB 3AOCA 1F9EB 4USUA 1EKRA 4ZN1A 1WHWA 1UEVA 4M5DB 4KC6A 2E7VA 2B9EA 2QE5A 3I0RA 1T0TV 5H9EJ 3C46A 1Q16B 3IRXB 2NXNA 3HT3A 3TZXA 5M3MK 4DV4F 1G2EA 1IN0A 2LQJA 4UUWA 2IVFB 3CWJA 4NEZA 1R27B 4LF6F 4PKDB 2PHCB 2FX3A 1HVXA 1IR2A 1D8TA 4RDJA 4Y2KA 2E2HK 1Q78A 5IT4A 1KBRA 1RWNB 1VQNS 3BR9A 1K83A 2WB4A 2FC8A 5B0DA 1T3OA 2AHOB 4G1QA 3PZPA 5E7OB 4YMEA 2YKMB 4Q7JB 3WODA 3SCKE 1ZZNA 3FEZA 4WTYA 3G82B 1H85A 2KHCA 1JLQA 1E6YB 4DMZA 1BQEA 2R92C 1GAOA 2ZM6J 3JSTA 4QWAA 2ABYA 3ASSA 2OTLB 3A8KA 4WPAA 3IRWP 3OL6A 4K4XA 3AQOA 2AF6A 4F4WA 1HWKA 2UU9F 2BYCA 2AW0A 5KG0A 2G2OA 5I3QA 5GMDA 2MLYA 3F73A 3F41A 2CPIA 3CJ5A 5KNLA 4X06A 3UQSA 1UMKA 1XB2A 2E66A 1YK9A 4PQUA 1SJ1A 2JRSA 2YKAA 4GQNA 4RPFA 1Q8IA 2G0CA 4OFZA 4O44A 4F4AA 2XMMA 2HNYA 4F26A 3FRZA 4EZ6A 1L0WA 2ZOFA 3QFRA 3FRYA 5GAGU 1BWVA 4U7UD 4EZ9A 4JI6J 1S6QB 1Q7LB 2FIUA 1RTJB 1AUDA 5L38A 5A8RA 3P45B 1H98A 3D54A 4OX8A 1VQLB 3D28A 1LV5A 2OK7A 2FZKB 2J0WA 1FJCA 2MEWA 1WC4A 1VQOB 1RAJA 3M8QA 1YIJS 2CNLB 1WHVA 1BMQB 1DJ0A 4M5GA 4Q44A 4XCHA 1QY7A 1U2FA 1YLXA 3IC1A 4ZVFA 2MZSA 3W9JA 4OX9J 3E01A 3GE9A 1NH8A 5HO4A 4K4WA 3D4JA 5JFEA 2RRBA 1FWKA 4W90B 3Q6RA 5DLFA 1VF7A 3SCJE 3V2UC 1BD6A 3T51B 1O24A 4NLQA 3W63A 3S1NK 3JAMY 5A6PA 1VOMA 4HL9A 5I42A 1VRTA 4PYDA 1PYTA 1EP4B 4JB8B 3NOGA 5J2QB 3N01A 3L4KA 2UUTA 3S14C 3E8OA 3QQCD 4ZPVR 1PBAA 4XONA 2QV6A 2LYVA 4U8VA 3ZNJ1 3G6ES 4IDKA 4WU3A 1VBZA 5CHCB 3CQZK 4FF4A 1KVJA 4NLPA 5B0BA 2C2WA 1ZVUA 4RNHA 2XOKA 4K2XA 3S7RA 4ZVEA 3T9NA 4OZ2A 2Y0SD 2L41A 2DIEA 4XLAA 4OYIA 4DSJA 3QRRA 1BQMB 4EBDA 3OEHA 2HHPA 3CC2B 1JNRB 1MN9A 2DO0A 2BA9A 4Z4RA 2C2RA 1CC8A 1IL2A 1GXLA 2B3TB 2GW8A 5GADU 1GXUA 2EPIA 3OL9A 4CLFA 3MEGA 1TK5A 2C3OA 2MQLA 4V1Ak 3CCSB 4ZVGA 2IVYA 3T6JA 4X4QA 2QMUA 1IKXB 1XXCA 3M7VA 1NK4A 5IFMA 4A3BK 2DH8A 4HDHA 4DPYA 1KD1T 1TKXA 1U25A 2AEJA 2WYRA 5D4DA 1FX0A 4FXVA 2JEFA 3EQLA 2VJIA 2CJKA 1SFOC 4AXIA 2DR8A 1VQPB 1VC5A 3KJQB 4A3FC 3HKWA 4B3OA 2W9AA 2EWHA 1YJNB 3NWGA 2J7UA 1HBNB 1ICEB 4X4OA 4FM9A 2C2OB 4BDPA 1EX8A 1S4FA 2ZOGA 4IFVB 4C11A 1GR1A 4YDXA 4II2A 4TT3A 3C6TA 1HNIB 5GMKa 4DQIA 2QDXA 2IMWP 2JFKA 3HFZB 2ZL6A 3HSZA 3V6JA 3BKFA 1O51A 1N06A 4H4OA 3GTPA 1YITB 3KJVB 1SI9A 2DBBA 3VZHA 3BNWA 3OTCA 2MHNA 5C7PA 3H5XA 2K1RA 3T5KA 3JU4A 5KFBA 2I0XA 1RABB 2PEBA 4IRCA 2BJ9A 2ZBCA 1YJVA 1NDKA 2RKIA 2WB1D 1BLUA 1NH7A 2ZBUA 1FXDA 2RNEA 1EQ0A 1QJHA 4P6QA 1F2GA 1HW8A 3MTJA 1DRZA 1FRQA 3T1AA 2FY1A 4F0MA 4QYZK 4OIQA 3A12A 4IH7A 2AYGA 3I0RB 4A3LC 1OMSA 1GAQA 5IQQA 4IRDA 1NHUA 4XIUA 2XC9A 4ZCIA 1P1LA 3NGUA 5GV7A 5DS0A 2DRBA 3GIIA 3RU0A 4X4RA 2HQFA 4NYOA 2C5HA 1F9NA 3TVKA 3A3GA 1Y5NB 1R9TC 2GAHC 2HYIB 2X6YA 1XE1A 2OTLS 2D3UA 4LBZA 2JEJA 4G1QB 4DFMA 1WI8A 1EKSA 2RUGA 4P72A 4K50A 1D8ZA 3HOYC 4X2BA 3CDUA 2M5SA 3GJQB 2E9ZA 2RVJA 3NMAA 2BE7D 5KG2A 4ER8A 2JL9A 4RD4A 1JLQB 4H9GA 5EGHA 4J5OA 2DTJA 2RUSA 2R92A 2GVZA 3IBFB 3CDEA 5A8WA 1XXAA 2RRAA 2FVGA 2VA2A 1N88A 1KP6A 3GG0A 3BP3A 4G3IA 2CJQA 3S15C 1RT4B 4A3GK 4AL7A 3O3LA 2RS8A 4ECVA 4HIZA 2HLDA 3R5AA 2BE9B 3VV2B 3OTOJ 4WILA 1U1OA 2CF4A 4Z1MA 2EI5A 2RT3A 2HZCA 2FTRA 4B17A 1NAQA 1HI8A 4H4KC 4CCHA 4G0VA 3PJ9A 1ZOTA 2F4VF 4PQUB 4Y00A 4K4VA 3PW4A 2V4JA 2JA5C 1I3OB 4P3IA 4O44B 4P2NA 1FJ7A 4CIOA 3GTMC 3GTOA 1IJEA 5C4XC 4KAIA 1VQLS 3T5JA 2BABA 2DB1A 5A8AA 1WC6A 1JXLA 2HNYB 3DLKA 4JI3F 3M8ZA 3L09A 3NGRA 3HOVK 1RT3A 1VQOS 4RBUA 4DPTA 3UNYA 4HHUA 4KFBA 4USVA 2VFTA 5B0CA 2M2BA 2YWKA 5A8RB 2A6EA 1N34J 3SV4A 3RR7A 1O8BA 2ASJA 3I96A 1QVFB 3DFEA 3GYGA 2JA6K 3AVYA 4K4UA 3PENA 4K4ZA 4DU7A 1WF1A 2G1HA 3M8QB 1JX4A 4URGA 4LQ3A 1V0FA 1Y0RA 4ZCLA 1NU4A 2WCXA 5C3EC 4RW6B 2VNJA 4FYWB 2NSBA 3K5MA 1WACA 3K8WA 1HD0A 1HHSA 2OEKA 1HQUA 2MKJA 1X0PA 5HROA 3E01B 1O6XA 3CCVB 3UN5A 5AE1A 3M2RB 3GVJA 1FWPA 3G6VA 1QSSA 2VG6A 3BY2A 3S1RC 2DXDA 4YAFA 5I42B 5D8HB 1VRTB 1L3VA 4X84A 2QC3A 3AOBA 1D9DA 4HE5A 4P7VA 4ZVUB 3CD0A 3CRZA 3IR5B 4ZH4A 3CC2S 2C2NA 2MKHA 2VNHA 2BKOA 4YQWA 2CG4A 5GVQA 1FDAA 4IDKB 4A3CK 2HG4A 4DR7F 4XNFA 3DRSA 1B0TA 1WG5A 2MQNA 2KHDA 1Y1VK 2YNFA 2CWXA 1VHIA 3AA8A 3FQKA 2XZLA 4JI0J 3H94A 1UEUA 3CCSS 1H72C 2OD6A 3T19A 4H4MA 3CJKB 5EHHA 3VQTA 1V3ZA 4FBUA 5FLXU 3NNCA 1NEEA 3T9ZA 2R93C 3JQKA 2VB6A 1SV5B 1RT7A 1DAXA 3N5FA 2GK6A 4K4SA 3FOFA 5IOSA 2DCUA 3PHTA 1F0XA 4DN9A 3M32B 4EU0A 1A7GE 1YI2B 3K8VA 3LO8A 1XIQA 2OPSA 2QMUB 3AD9C 2BR0A 5EMNA 1YJNS 1KQ4A 1H7WA 3R6LB 3RZDC 3V76A 1T6YA 1BXNA 1TKXB 1IJFA 4DV0F 3I87A 4RX6A 1WG4A 3SJPA 2F5GA 3PX0A 3D1QA 5TMCA 1B0PA 2IY5B 2C28A 4KB7A 1B64A 3CCEB 4CLLA 2EBEA 1YITS 1SFOA 4B3OB 4QIVA 4DUTA 4GC6A 4LR9A 2W2NP 2M0GB 4ECWA 3OEEA 2F3JA 1WSVA 2B9XA 1TK8A 3KTQA 2D7SA 4NXMF 4IQXA 2XS5A 3G2XA 4C11B 5B09A 4Z4ZA 3C6TB 2OPPA 3BJYA 3G8SA 2FVSA 2HHSA 4KHPJ 3PX4A 2VPXB 2OMOA 3QX3A 2XMUA 3NCQA 4TU9A 4H4OB 2JVOA 2XCPA 4IH5A 1WWHA 4NWBA 2W9CB 1HMVA 1WCMC 3KHLA 2K1RB 2WONA 2XMJA 3QIDA 5IV3A 3HXAA 5FL7A 1KQSB 1TKTA 4TYAA 4X62F 2DR9A 2GGPB 2RKIB 1I18A 1O2FB 1S57A 2VDIA 3H98A 1UW4A 2HWIA 2LQ9A 3CCJS 2GCFA 4X7EA 2MPUA 4E98A 2GJKA 5DO2A 3P5BP 1U2CA 2NR0A 5KFXA 1TFYA 1UA0A 3FCHA 2ZTNA 3R5JB 4ASUA 4MK7A 3CJ3A 4LUBA 5IYNA 2R7QA 1UPPA 3OW7A 4JOUA 4M5HA 4Z4SA 1Q7YD 1MRZA 1QAYA 3TX8A 2VOPA 3HVRA 2FQTA 3ENVA 3W2WA 4A3MK 4XOPA 3S17C 2YY3A 2DNHA 4NLUA 1RBAA 5KFKA 2XGJA 3W9HA 3V6DA 1FRXA 3MMLB 1CG2A 4A47A 1EH1A 5HZBA 1Q82D 1QVFR 5IP7C 1KKHA 4OQJA 2KT2A 1Q8KA 2F1FA 2Q3PA 3PVXA 4ILMA 2V6UA 3G4CA 1FO1A 1U4BA 4MYTA 2HFNA 3HDSA 2O5DA 2PE8A 1DZ5A 5HZAA 3DM2A 2GVZB 4NOHA 5A8WB 1X4FA 3PXGa 3QZ8A 3GPAA 5IC6B 4BXXK 3BZQA 2DNQA 2I1LA 1D0EA 3OXFA 4M5LA 4BY7C 1TKDA 2HFVA 1NSQA 1HR0F 3B78A 1AA1B 1UW9A 3M8WA 4MKVA 1PAUB 3OFNA 2MKYA 5E33A 2HWHA 3EXCX 5ETRA 2HS4A 2D3NA 2V8GA 3MMCA 5A6WA 2EG1A 3TR5A 4CH0S 4LF4F 1YHQS 3Q8RB 4PC1A 4NCBA 1Y3KA 2V4JB 3NCRA 4RL1A 1TL1A 3EYZA 4M63A 1MN7A 3QNWB 2JA5A 3P3DA 4LF2A 4C3IK 3GTMA 2V7TA 1LNQA 3DLKB 2W4CA 2DEJA 2BOPA 4ZIWA 4K59A 1Q95G 3KOAA 2DGVA 4RDKA 2PIAA 4OIXA 3ZIAA 3CGIA 4A46A 2J6TA 1RCXB 1PYSB 5THXA 4KFBB 5CCMA 3MHYA 1FRJA 1PAEX 3HVAA 3DI6A 2DY1A 5CYQB 3OAAA 4PABA 4QU6A 4JMQA 2XZTB 1PG5B 2QTZA 3WYAA 4E0DA 2W2PP 1IBLJ 2E5LJ 3BGUA 3DOKA 3CCVS 4RD1A 4Y7NC 2NVYK 1NM2A 3GEEA 4TY9A 2ILZA 1RDRA 1UCNA 1OY9A 1N33J 2GSOA 4C3HK 3PDNA 1BDFA 1J5EF 1FE0A 1NB9A 2JA7K 4LF1A 4DK0A 4Q45A 5H9FK 3K7AC 4OI4A 4NI2A 1NRKA 1N5QA 4NXNF 4OJ1A 1HQUB 1U2RA 5HROB 5K8MA 2B63K 2PI4A 4B47A 5AXMA 3PO2C 2H51B 3K5LA 2OD4A 4I0WA 3ILJA 3LUYA 3KK2A 1WJ9A 2X53S 1RE1B 2VG6B 4WP3A 1I6JA 1WNEA 1U1QA 1EXMA 4JI2J 2CPEA 3LF0A 2V94A 4A8MP 2ZVIA 3FK4A 1XNRJ 3ISND 1K0TA 1NJIT 4I2PA 2C3UA 4OI0A 4A93C 1YBUA 2VFSA 4B9VA 1YZ6A 1T94A 3DRSB 4G0WA 1RYRA 1XJWB 2YNFB 5LMUJ 2MKIA 2Z4PA 4ES1A 2F4NA 4FKXA 2G2ZA 2V5HG 2HRYA 1U1KA 1K83K 3HOZK 3TVZA 3WY9A 2V8DA 4DX8H 2BDPA 3IM8A 4H4MB 1EP2B 1QUVA 3HOXK 4RW8A 5D0HA 4P52A 2HFZA 3H4DA 1KQSR 2J0SD 3JS9A 3MEDA 4ZJQA 1RT7B 2R93A 3T53B 1TL3A 5D77A 4JI5F 5I4MA 3SLDA 3N0VA 3DNCA 2DCUB 3R5GA 3PCOB 1NDLA 3SDEA 3VZIA 3CCES 2DNPA 4UOFA 4ENOA 2GO8A 1KJZA 3HVWA 4K0KJ 2OPSB 5I3PA 3WC0A 3OJUA 2ZTGA 2OLWA 3EVMA 1NPKA 2D3OR 1MMLA 2UV8G 4OZJA 3BPSP 3VAGA 2WVEA 5LOQA 3JQPA 1IJFB 3OR1A 1AUSL 1W26A 4A3KK 2PD1A 1R6VA 1P27B 5HQ8A 4OHXA 4WFBQ 2DR5A 3CTAA 2HZVA 2V8HA 1JVIA 1SUQA 1QFJA 3POTA 3R6KA 1TWHK 4K8RA 4ZVSB 3WIVA 4IO9Q 1TQLA 2EFGA 1RHMB 2Z57B 4OYPA 3BDPA 2LECA 3RRKA 2QL9B 2VJVA 5IWAF 2OPPB 1UVIA 1MMNA 3DRRA 3D0GE 2XY5A 4RMFA 1WORA 5KAKA 1H7XA 3RAMA 3IBCB 2DOGA 5JVHQ 1QAIA 1QTMA 2BM1A 1PKUA 1HMVB 3I1FA 3KWMA 2WONB 4AYBL 2MJNA 1WCMA 3H2UB 3QAEA 4LIWA 2PSZA 1LK5A 3QT8A 1TKTB 2AU0A 2FVCA 4EWTA 1A6LA 4A8WA 3PFOA 1HA3A 1X5OA 2PMHA 3MM9A 4NYZA 3GTQK 5AXNA 2ZVSA 4JBCA 5FIIA 1HKAA 1N36F 2WSSA 4F3OA 2N82B 3PG9A 5M2RA 3ENQA 4GRSA 3G96A 2NV4A 3CCRB 2PA3A 3QJJA 4QR2A 3UCZP 4XLPA 3D9BA 4P3YA 1LQ9A 2OTJB 4M2LA 3N6LA 3W5ZA 4URQU 2DNNA 3W2WB 5L9NA 1R0AA 3QFHA 2VASA 5KFPA 4AUKA 3R1HA 4TLQA 3U6BA 4N3NA 4DR6F 3HOUC 3V6DB 4B3SJ 3FJ2A 3G8TA 2OAUA 3MECA 3Q39A 4P10A 3Q38A 4R5PB 5HKKA 4QWEA 4QU7A 3G4AA 4ED0A 4B3FX 3B54A 4B3TJ 1JWWA 3PACA 1ULRA 1FA0A 3HCXA 2QA4G 2ASDA 1QH0A 3HZEA 2VFUA 3ZZTA 4FP9A 4RPDA 2X3UA 3AT1B 1RCOB 4DV2F 4XMYA 1G7TA 4G65A 4DR1F 1S12A 3DM2B 4B3MJ 2AJ0A 1BX0A 3UW1A 2IBOA 3T02A 3BYRA 4ZKAA 5FDLA 1BE4A 2LQBA 4JI7J 2X3DA 4ITSA 2J9EA 1EHWA 3DDKA 3AJ2A 5KFTA 4HI2A 2ZD1A 3TJAA 3W2GA 1KVKA 4RW9A 3BGRA 3MMCB 4A3IK 3HKZL 3KHGA 1FE4A 1TL1B 3CJ0A 2X1AA 2GZOA 1HBUA 5IT9U 3BO3A 1Y7PA 5C4JK 3R7NB 1GEHA 3CXCB 4UUXA 3WBZA 4TQRA 5LSRA 3UR3C 3IM9A 3K58A 4C8LA 3LAJA 5IYBK 3IGVA 3DI6B 3MFIA 2GFFA 2W7PA 5BR8J 4B3RJ 3T1YJ 2POKA 2D74B 1YLOA 3V5RA 3CDBA 5C44K 4X4VA 4C8NA 3DOKB 1EETA 2FQOA 4CWBA 4DFPA 3MI7X 4KDDA 1VK3A 2CQ2A 4HI1A 4Q2MA 8ATCB 3DLGA 3VVUA 1S1VA 4ZCMA 3OD2A 2WBRA 4LF9F 2MHEA 4NI2B 4NRUA 2JSXA 2YX1A 1T03A 2E2IK 1NSAA 1FFSB 2YH0A 4ZLJA 4DV5J 3MOJB 4ELTA 2PE3A 1LOUA 1T9VA 2ZHBA 3A3BA 2O01C 2CQ4A 2KL8A 2J5AA 2CWKA 4RW7B 1RBLA 5LL6d 4DR3F 1DBDA 1UWBA 3KK2B 2QLXA 3GTKC 5HANA 1I6HC 1FXLA 3A1YG 2IM0A 2WZNA 2CYYA 1RHKB 3GTJK 5IS2A 3ZPNA 3RBEA 2JLGA 4UQTA 2R8GA 4I2PB 4NLDA 2HQDA 2IIHA 4ZLPA 3DU6A 3H0PA 3CT9A 1C0UA 3GG1A 2LA6A 2RSQA 1SL2A 2MQOA 2Z56B 2HVDA 4TMZA 4JI8F 4M5NA 1E3XA 3OKXA 1NK5A 1F5CA 4I7FA 4I67A 1FEEA 4LFAF 3MWBA 4J9NA 1CNFA 3MM8B 5HMZA 1YKWA 4RW8B 3I4MK 5HQMA 2R9VA 3EDRB 1AIPA 2OGUA 4K2JA 3FKSA 1TL3B 1IM6A 1N5YA 1TWAK 3PFEA 4BLGA 3M8PB 1KN6A 1S1WA 2YKNA 3RJMB 5HSPA 4OPSA 4XLCA 2R92K 3MR6A 1WF2A 3TARA 3OL7A 3SDEB 4AC9A 1IWGA 4OPVA 5EWEA 4OPOA 2AJFE 3EWGA 5IYCK 1DQ8A 1C1CA 3NS6A 5HJYA 3MEKA 1BGWA 2BE5A 4YEAA 2OEMA 2NVTC 4OIRA 5KFWA 4C0SA 2XHWA 4A8QA 3OR1B 1VQYA 4KSEB 5JUMA 1YJ9B 2HGLA 2R8HA 2HDNB 4PWWA 1WELA 2GAGC 3HHLC 1CC7A 3P6YC 1R8PA 4NLWA 4LF8J 3V4IA 1ACMB 1SUQB 4WWSA 3POTB 3GTOK 2XTJP 3BV8A 5F9NA 4MIAA 2CW5A 5DETA 3W60A 4B48A 3MXHP 4ZPTR 3HMJG 2B7BA 1HFEL 1M1GA 2R4FA 4B9SA 4KMDA 1M1KT 2B4PA 4YN3B 1YCLA 3MURP 3TX0A 1BHNA 3HVTA 2A0FB 2XY6A 4XPEA 3DRRB 4L75A 3HXMA 2BMBA 2KTQA 3NOCA 1YRXA 3Q0AA 1D2EA 2V31A 2X8KA 1N8RD 2E1MC 4Y9UA 3CCRS 1KQFB 1TWFC 1JJ2B 4DPXA 4WFXA 2W7AA 4F4ZA 3VR1A 2UUCJ 1C4CA 2J6UA 2C3YA 2OTJS 3AVUA 2P9GA 5F4JA 1VQ9B 3MM9B 2LEPA 2HQCA 5K20B 4IO1A 2EKNA 3GTLC 3IAM9 1WEZA 4RD3A 5L9XA 2VA3A 1FXRA 4YB7A 1NO8A 4MIBA 4P71A 3E3XA 4EH1A 2MQQA 1XMOJ 3N0BA 3CXCR 2A6HA 4P2XA 4AXJA 4F3QA 1SB6A 1X4HA 2ROPA 2ZH3A 2QFJA 2DISA 1R0AB 5FIUA 4F0HA 2FGOA 1IBKF 2YX4A 3TO8A 2NZCA 4LOWA 3S14K 2BRKA 3UD5A 5B6IA 4XN0A 3OVSA 1XNQF 3MECB 5CYMA 1YWXA 4YY3F 3H4BA 2EFNA 1H2TZ 3B4DA 5DG8A 2WVCA 4W92B 3US5A 1O26A 1FKAF 2W7VA 2W2OP 2IC3B 3M6VA 3PNIA 1N56A 3BR8A 1IR0A 2EVZA 2MKKA 3FNNA 1XC9A 1TTHB 3SQOP 4RUBA 1SIZA 4W4MA 1FJGJ 4PYAA 3WBKA 3J7YI 5HBMA 4X7CA 1RJJA 4GO7X 2KXNB 3BC9A 4AQYJ 2Y0SL 3MEEA 2AYBA 5FDLB 4DSLA 3WZ0A 3S2DK 2BOAA 1IKVA 1VQ4B 4ILDA 3BF4A 3A3OB 2C3MA 2VQEJ 1H42A 3ZZRA 4DQQA 2ZD1B 1HWJA 4WJ3M 3DHWC 1AB8A 2FLPA 4LF5F 4RW9B 3BGRB 1X4DA 3MM6A 2DH7A 1VQKB 2Z30B 2GC8A 5D4PA 3FCVA 4KT0C 2P5MA 3I55B 4DV6F 3DLHA 4D3GA 1HBUB 4DPUA 3NLCA 2CFAA 1X4EA 1Y10A 2ZUAA 5GAEI 4RNMA 4DV3J 4KR0B 2KXFA 1XXBA 1VQSA 2K06A 1UJ6A 3WNDA 1LXNA 3MGJA 3I5CA 4QR1A 3BY1A 4NZ0A 3J7ZT 3CCQB 3BCDA 2HLTA 4A3FK 3GYXB 3CD6B 5DLGA 2J8AA 2JDIA 4QIGA 4DQLA 3CMAB 2E1PA 4R8UA 5D6GA 1S49A 2CPFA 4KJIA 4XOTA 5DJBA 1Q86D 1HWUA 3TTGA 4CLYA 2YH1A 1EETB 2HCJB 3W8PA 3R5DA 1VDHA 2DERA 1O5JA 4WP8A 3NL0A 1VISA 2CPXA 2B4OA 3VCDA 3DLGB 2ZH8A 1MW7A 2N4DA 4GTCA 2WZPP 1S1VB 2FZCB 4J9VA 1VI7A 4O3SA 2QA1A 2E5GA 1T03B 5EN1A 3K2YA 4DV4J 3TFHA 1Q0NA 2DR6A 2X6XA 1T9UA 3WQPA 4LF6J 2CK3A 1CSJA 2VL1A 2D69A 3HX9A 3G86A 3Q6QA 1Q81D 4OHYA 2VNIA 1VBKA 2WB1L 2XNCA 1W34A 4PPZA 2FHJA 1R89A 5E3CA 3QFWA 4WFAQ 4A3LK 2OYNA 4WFZA 1EIYB 2JLFA 3I6PA 2LDYA 3FVYA 3RG6A 1WKKA 2BE2B 5AXKA 2DGTA 2BJDA 1C0UB 2MZQA 4F8RA 2Y1IA 3U1LA 2ZH1A 3T56B 3SSSA 5HP1A 5F3TA 1IQ0A 4L8JA 2KFNA 1ISEA 4I7FB 5SZTA 1WOPA 2HNZA 4X4SA 4DDQA 2PA8D 2FJWA 3FKIC 1B3TA 1JJ2R 2UU9J 3FQLA 1YJWB 2CPYA 4P75A 2RRNA 3VAIA 2KYXA 1DLOA 4HT5A 1B70B 1S1WB 2YKNB 1RAIB 2RF2A 1YJ9S 5L39A 2W6JA 2D41A 1FJEB 1S99A 1KC8T 2PLFA 1T9XA 3SCLE 1YJUA 1KWMA 2BQ3A 2V7UA 1UVLA 1C1CB 3ZTSA 3S15K 2JA8K 4CNYA 4OINA 3GVLA 4YAOA 1JJHA 3VAFA 3KK3A 2R7ZC 1COWA 2H5IB 2RDDA 3NGTA 5KFMA 2AMCB 3MCOA 2W8KA 1T5EA 1KMHA 2MXYA 2VUGA 1Q8BA 3HHLA 3D0IE 1JJ4A 4AT1B 1TWGA 2U2FA 2DNRA 2JA5K 1NBMA 4YFUA 2B7BB 4ID8A 3W5HA 3CIZA 3CP8A 2ZC3A 4ACBA 5F0UA 2VKRA 3D2WA 3CB4A 3TA2A 4AL5A 3LTOA 3W2VB 2L08A 1XMBA 1FKPA 1AYEA 7AT1B 2D9RA 3HVTB 1R7IA 2YX7A 3I9ZA 1ZPWX 3QSIA 4ZVPB 1YBTA 3M6XA 1YG0A 4P22A 2AWZA 2W25A 2V0NA 2CAJA 3TRGA 4JI1F 4ECXA 1UMJA 1HHTP 3JSYA 2LXFA 4RKUC 1JNYA 1B7YB 1TWFA 5DM7Q 2R2SA 4I6WA 3M4OK 3KK1A 3CD5A 2CQBA 3ZTOA 2NYHA 2WR8A 3IGNA 1PO6A 1MU2A 1APSA 1R3NA 5J1PA 2ALZA 1OO0B 4QPXA 3EICA 1JLBA 3LP2A 1RT2A 3GIJA 3R6GB 3THTA 4J0QA 3MMBB 5FJ4A 1RA6A 1N4LA 3IS9A 4FKYA 2GA7A 3Q23A 2GPJA 4U7CA 4RLZA 2HQGA 1IVZA 3AVWA 2XS2A 1G51A 2RB7A 2GIQA 4CTAB 1OJ4A 2VQFF 2ZH4A 2C2MB 4OZ3A 4RDLA 2MQ8A 4DSEA 1TUWA 2WK4A 2CPZA 3BM7A 1QUPA 1Z2LA 4LREA 3ITHA 1JOEA 3TJ9A 5CYMB 2WPDA 2HHXA 5CHPA 2ACMA 2GMLA 2LLZA 2D1CA 2YQ1A 1BJTA 5KG7A 4OMFG 2D6FC 1J2VA 3AVVA 4M94A 3PA2A 2B0GA 2QT7A 5HBMB 3DXBA 4U9RA 4II3A 2W2QP 4X05A 1VIOA 1Q79A 1LEOA 3MEEB 4DQPA 3I55S 4A3EC 2ZDOA 1TU0B 2NPIA 4JP8A 4KH0B 3GVKA 1U26A 4K4YA 1IKVB 1I50K 3SIPB 2WSEC 3Q8QB 2IRYA 5KFFA 2VBVA 2D9OA 4L3KA 3CCQS 1RACB 1GMWA 5EUHA 5J2MA 1LWCA 2A69A 1ZM4A 3CE8A 2AYMA 3MM6B 4G7ZA 3KJNB 3CD6S 5GV8A 2AZ1A 3H2VE 5G0RA 3DGVA 2ZKTA 1R8AA 4MTPA 3SXLA 2ZH7A 1N5SA 2FJXA 2RC5A 2CZVC 5F8HA 4IG0A 5GMEA 1RUSA 1TL5A 2B7CB 4KB2A 1SVDA 4KRWA 4DNRB 5KFHA 1H2VZ 1RU1A 3MOZA 4ES2A 1I8DA 2XYHB 2ROGA 4DLEA 1IBMF 1EK8A 5LMZA 4LC0A 4J9QA 3GSIA 4XM3A 2C22A 3VGSA 3HJFA 3CCZA 4R8UB 1FFGB 1Y11A 3TEHB 1NBEB 5K8NA 2VPYB 1G4CA 3RZOK 3GYNA 4WF9Q 3HI9A 3SMZA 4ZVRB 2YXLA 4F02A 3ET6A 4B9NA 3T5HA 1IQTA 3H7HB 1PC5A 3EM1A 3I5BA 5ITHA 2RQ4A 4A48A 2A68A 3NGSA 1QM9A 4S0MA 1SXLA 4XLFA 1NK0A 4LMZA 1I6VA 2FJAB 2AJ1A 1WUUA 3AVXA 2R7UA 2MQMA 1VHOA 4G1IA 4WQMA 1QDUB 4NCGB 4KN4A 2BPOA 2VG7A 2ZZQA 4LRFA 4YDDB 2JJ4D 1S6PB 4DCPB 2FUG9 1HQMA 2RAQA 6AT1B 5L1KA 1MSWD 3GCWP 3QWPA 1YRTA 3L9ZA 3J80Y 3Q3AA 2RH3A 4RU9A 4UZCA 4Q7AA 3TAPA 1YJWS 5K14A 2WW4A 2QO3A 2JVRA 5G4DA 3C14A 4JV2A 4RNNA 1F7UA 3N6MA 1NHKL 4J9SA 3HD2A 5HP1B 1VJQA 2ZZNA 5B0GA 2FZGB 1FESA 1KK2A 2Y9HA 4UAJA 2F4FA 3JSBA 1RT1A 2HNZB 3M6WA 1NNDA 4F2RA 2QSFA 4DR2F 1Y1WK 1HNWF 1RT6A 4DUZF 5IP7K 3RR8A 5TV2A 3FKIA 2KVQE 3Q3QA 1DLOB 2KWAA 3QT5A 2GHVC 1MMDA 4WFYA 2SXLA 4EYIB 3TQ1A 1E43A 3LGNA 3PV8A 2F4VJ 1I51B 3GDZA 1G1XA 2NZ4A 4LLGA 2VOOA 1K8AT 2DHSA 3DDIA 2UVRA 5M2PA 3WX4A 3H3VL 2OIHA 4JI3J 2ZDPA 3HHNB 5C2GA 3KK3B 4Z4YA 1MWYA 1CQNA 3KLIA 2FGCA 5DZ7A 2XCAA 1ZETA 5A8KA 2VKZG 3HHKA 3D0HE 5TRDA 1UJ4A 4IOBA 4WXOA 2QA4S 1NJZA 4FF3A 3HHLB 2CQGA 5KG6A 1FD2A 1U0SA 1W0KA 1NJXA 4WU2A 4KKTA 1GMWD 2NVQK 4MFBA 4W98A 1F1BB 4P2FA 3W8GA 1P8GA 5IYWA 1EFCA 2YPYA 2WSFC 3IR6B 3K89A 5L1JA 1PC4A 2R7OA 3JAMU 1FKPB 5DGBA 1VGYA 1ZS6A 1E1RA 4QYZJ 2H3EB 1JLAA 5IC4B 4WTOB 2HFSA 3UI3A 1W25A 2PMWA 2HQ3A 3HPOA 1KS2A 3PW2A 2ZBQA 3UDCA 2OPRA 7FD1A 2ZBIA 5HI7A 1RWXB 4G5GA 2QYCA 3LALA 3LQVA 2HW3A 3AJDA 1IQZA 1USMA 4J9MA 3T6BA 3ZC3A 4YR3A 4DI6A 2Q6OA 3KK1B 4CLSA 3MTKA 1VJSA 3SEJA 1Y0HA 1BLIA 1R43A 4YB5A 2DRDA 2C4TA 2MJUA 2XCRB 4UZBA 5A0YA 1MU2B 1BWEA 4MEYA 4ZLNA 1JLBB 4RUAA 3LP2B 1RT2B 2E9RX 4YR2A 1I7PA 4M1XA 2CQIA 4DR7J 4G6IA 4C0BA 3IWXA 1A0OB 1EFUA 5KT7A 1SPBP 4TMVA 2CJAA 3IS9B 5DM6Q 2DNZA 3BYPA 3LAMA 2E7XA 2FC9A 1WI6A 2Q6CA 1QFYA 2EFQA 4H54A 1WD6A 3LPXA 2QMXA 1N52B 1EP3B 2EFOA 4LBPA 4GO5X 2D3ZA 4N56A 3JSRA 2J8SA 3IPJA 3ITHB 4A93K 4RJVA 1ZTWA 1BUXA 1ZAVA 2C2EA 1HA1A 3OL8A 2FVQA 3O5TB 1NDPA 2KFYA 3PEHA 2Z2ZA 2R7XA 4NLRA 5CA5A 3DKDA 4XSZA 1M0SA 1YGYA 1RQPA 4MJKA 2NREA 1EFRA 3PIPQ 4PCQA 2BZ2A 4BBSK 4XKVA 2OBTA 4DV0J 5A2QY 3GP9A 2KB2A 2GSUA 1AXQA 3GFZA 3CMES 1JB0C 5C5JA 1I3QK 1RHQB 4LVNP 3IP0A 5CZXA 3S01A 4DPOA 2DY9A 4TNOA 3CP2A 2PIIA 4A4JA 4B9UA 2AX1A 5J2MB 1NK8A 1LWCB 4C6AA 3MFHA 1H74A 2CC2A 1PJ6A 4NXMJ 3OXGA 2WAQL 3WX8A 1FI4A 1SC4B 2ACYA 4NLSA 2CQPA 1XQBA 2UXCF 1IBAA 2PC6A 3M1VA 2UUAF 4WCEQ 1BQXA 4IG0B 5C24A 3P8BB 2AGPA 3Q22A 3I4NC 3TFJA 3RTVA 2BJ3A 4NYPA 1NCLA 4TXSA 3C15A 4CO0A 1WEYA 1UD5A 2WOMA 3OLBA 2V2ZA 1CVJA 2UXBF 4FXDA 5FJ8K 4O3OA 2Y8WA 4XDCA 4X62J 4Q0BA 4USKA 2VUMK 4ZP8A 1IE0A 2EW9A 3ET6B 2HK3A 3RB3A 4OI2A 4J9LA 4UOHA 2FVPA 4WXWA 3S1MK 2R9LA 4EBEA 4M5JA 4BC9A 4B08A 3N28A 5E3PA 3ZFVA 4NLOA 3H5UA 4R25A 1X5TA 3CCLS 1JLFA 1GQEA 3CTRA 1S79A 4DV7F 2EC0A 4UY85 2VG7B 4G1VA 5IQ6A 5CDFA 8RUCA 4PWDA 4JI4F 3T5LA 1F60B 1WHXA 4L6V3 4J7CA 2HHQA 1S1UA 3A35A 1HQEA 1WU8A 3E1YE 5J2PA 4E0FA 3I82A 2J7KA 4ILRA 1T9TA 2CDRB 6FD1A 4WZMA 5K14B 3EZ5A 3C14B 3W3SA 2P2CB 2DEUA 2V34A 3OPFA 2KXHA 3SLNA 1KTQA 3EGZA 2DNKA 1B0VA 3AFGA 2DEIA 4LSLA 4IG3A 3TYTA 4WIIA 1URNA 3HOUK 1RT1B 5ETNA 3ENAA 4PWUA 5IP9C 2BJEA 3ASRA 3C2PA 1RT6B 3C19A 3W5UA 3H0GK 1HR0J 2R7VA 4DR5F 4X4NA 4EEYA 1T11A 1RLDA 3TP2A 3CULA 4RPBA 4DS5A 4F50A 3HOVC 2CA9A 2KFZA 2ZUEA 1RSCA 3MPVA 4FNIA 1EWYA 2CBXA 2ZH2A 3A4TA 2AD9A 4AF6A 4LF4J 5DDQC 3IR7B 3O1LA 1RQRA 4ELUA 2F1LA 3M4XA 2MLZA 1C0AA 1K28D 3LQEA 5IYRA 5KW9A 3WNBA 4ETXA 4ZS6A 3H40A 5JMNA 3NMRA 1KLMA 3W5VA 4PC6A 4USIA 5A88A 2BQUA 3VAJA 3GWCA 5M5XK 1UPMB 4XO0A 2W8LA 2V50A 3FZBA 4OX6A 1GK8A 4LSZB 1QSLA 3QFSA 2FDNA 3KLIB 2Y8YA 2E1BA 1HIYA 5A8KB 1S72B 4CM0A 1XQIA 4C0OC 4Z4VA 2R42A 1CQXA 2Q43A 4JV1A 2MYFA 4RJLA 1MROA 2MMYA 3K17A 2DETA 3M05A 3FJOA 4NEYA 2W6IA 1U1PA 4MFBB 4ECYA 4DX5A 5KFSA 1RTDA 1WEXA 1J5EJ 1UD8A 4DV1F 1D8YA 1Z4UA 1CLFA 4C2MC 1TP7A 5M5YK 4ZVHA 1LWXA 3TOQA 1IUJA 3HM9A 3RUBL 4NXNJ 4FDFA 1WOSA 1JLAB 3KHHA 1NK6A 1SL1A 2JN9A 4MQ9A 3L3CA 2QLBB 1WC3A 2OPRB 2VBWA 2XYGB 4GKJF 3WXMA 2C2ZB 2BN4A 3PW5A 1N5VA 2X3GA 5AE2A 2EK6A 2OELA 3R1LA 4A3CC 5FNZA 1K73T 2CRVA 4LR7A 1NUEA 2VODA 1Y1VC 5IXUA 2WVBA 2V4QA 2FPHX 1UJ5A 3Q8VA 4PPDA 3P26A 2Q79A 4GT9A 3R5BA 2VBTA 1YDLA 1HBMA 4C45A 1IKWB 2N3LA 1H73A 2HHHF 3PRDA 3UN2A 1KOHA 3P5TL 1Q4RA 1SJRA 2CDQA 4ROXA 3HHDA 1UAWA 3WIUA 2HBQB 4YS2A 5LMNF 1PYOB 2V2VA 4UZUA 5KFDA 5KT6A 5J1EA 3GJRB 5T7LA 1KK1A 4HYKA 1ZA1B 1SH3A 3NNAA 1CJVA 4RZRA 4YHBA 3W65A 3S8SA 3JYTA 4LFCF 1ROFA 3QYYA 2QG9B 3QFTA 2DIUA 3K5PA 4IW3B 3N6NA 1KR4A 4C8OA 1NKEA 4JI5J 2GREA 1BQNA 2G1DA 2V68A 4MIWA 2KJWA 3ILIA 1HZEA 3QWUA 2JX2A 4WK3A 1UVJA 4LSNA 1VQ8B 4I2QA 5LT5A 3M6UA 3RBDA 1CS4A 3IFEA 5KTQA 4BBRC 3M2VA 2HBYB 3DLEA 1UWAA 2XLKA 1RA7A 3OEPA 2PI5A 1BMFA 5T14A 4DL3A 4MEXA 2GO9A 5BSYA 1PCAA 3GQCA 4KHMA 2AT1B 3JQJA 1QVGB 1C1BA 1UKUA 2HHUA 4XLNA 1K9MT 1MG7A 2G13A 4KY3A 2IDEA 2F7VA 1N08A 2FHKA 1N05A 1U6ZA 5LJ3Y 5HK4A 4FPIA 4Y6IA 3D66A 3X3UA 3QLHB 2N4CA 4OI3A 2JNJA 2WW8A 3AH5A 4UT4A 5IWAJ 3M1VB 5C24B 1AZSA 1I94F 1TELA 2B8QA 3J81Y 1DDIA 1EFTA 3C15B 3BS9A 1KD1D 3EDQB 1TWGK 4WYLA 3ISNC 2WOMB 5LJ5Y 5M2UA 3M8YA 2OSRA 4E2FB 3SZZA 4DS4A 2IMOA 2VF3A 3CEDA 3HJVA 2BANA 3CD7A 2F43A 3I4HX 4Q0BB 1LW2A 2GQFA 1HYSA 1VR6A 4X65F 4N76A 3OZVA 2HHWA 1N36J 9RUBA 3AAWB 2G0IA 4RCZA 1AW0A 4A3MC 3BQJA 2FD2A 2MZTA 4EUVA 1VHFA 2CVEA 3PR4A 2IRUA 3WC2A 3D6FB 5KFCA 4XDDA 4V19J 3IG1A 1S6OA 2GJFA 3PYDA 1JLFB 2WRMA 1N5TA 5JVGQ 1CBKA 2QIFA 1ZH5A 2BUNA 4LBIA 3OVBA 4OZLA 4X6AK 2L48A 5BXIA 4M1KA 2DPIA 1JA0A 1S5ZA 5KT4A 3AD8C 1JK9B 4PWDB 4DR4F 4X8IA 4GVBA 4DR6J 3HF5A 2LZJA 3JSMA 1FNBA 4GKKF 3KUGA 1CULA 4N7TA 1S1UB 4TQSA 1HQEB 1FNCA 5JVOA 1JJCB 5J2PB 4BXXC 4ECQA 4DSKA 4FYXB 1FHTA 1FFWB 3IXQA 3HK2A 3NGKA 3IWNC 3DRYA 5BYQA 1VJWA 3D3BJ 1DFDA 2VZLA 4HTIA 3A13A 4DV2J 1KQGB 4DR1J 3DLJA 3FOEA 1NJYA 4TY8A 2EEYA 3OT9A 1BJKA 4LSLB 3CMMA 4IG3B 2OEJA 2HGNA 4K5SA 2ZKUA 2EKYA 5L1LA 4OI1A 3JQRA 2CJBA 3PHEA 2F1MA 3BKTA 3SFGA 3GU0A 4P5AA 4C3IC 3ZZUA 2JHEA 1YRUA 2RQKA 9ATCB 3F44A 4NPOA 3FCWA 3BSNA 1S72S 5CD4A 3QBCA 1H38A 4Y7CA 4PG5A 3DYAA 2XSJA 2GS8A 1FVSA 4PR6A 4DPWA 2EC2A 3SZ2A 3UDLA 2HPUA 1KLMB 2NVYC 2HBZB 1FF2A 1S97A 2AQ4A 1VBXA 4WKRA 5J35A 4ERDA 4C3HC 3DOMA 1NK7A 2KH9A 1IS1A 5KG4A 2YQ3A 2JA7C 1LFWA 5DRKA 3NEKA 4CO5A 4DNTB 5ETSA 1T95A 3HO1A 4YB6A 5KFAA 2OJ3A 4DWIA 4OYWA 1MROB 1HNXF 1S0OA 3L4JA 1G6BA 1Y00A 1RK8A 3LWMA 2CQ0A 1LWFA 1RTDB 3MR5A 4P12A 2HFOA 2RU9A 3UO0A 4DQSA 4OYZA 4LF9J 4C2MA 1M90T 4ZPWR 4I1TA 2NVXC 2BBEA 3U7JA 3ETMA 3ULHA 4L74A 1X9SA 2A2DA 1FRNA 4WZEA 4Y2MA 3IRXA 4EMDA 2AJQA 2KN4A 1V5IB 1D1UA 3WDOA 4ED7A 3NNHA 2B5JA 1H0HB 4DR3J 1PSDA 1FDDA 2QTLA 4C3JC 3W5XA 1U09A 1V6HA 5KFVA 3GB0A 1QVGR 4WBFA 3T1HF 2RILA 3KNAA 1TV6A 1VQ6B 5KFQA 1HQ2A 2KI2A 2DPJA 3BBCA 3I31A 1Y1VA 2BACA 4R0EA 5E3RA 3HOZC 2HMAA 1N32F 2FJDB 2W7OA 1HBMB 2EBBA 3OFEA 3DLLQ 3F56A 2YWEA 2MSTA 2DYIA 2KM8C 1KONA 1V9OA 3HOXC 5DG7A 2UZAA 4MKAA 2QYGA 4CRJA 3QT7A 1UA1A 1OQ6A 2RJZA 3I4PA 2HNDA 3ILLA 4JI8J 3D68A 1HWLA 5DG9A 4RWXA 5J1EB 5T7LB 4NZ6A 2OUGA 4LFAJ 1VQNB 5E0OA 1CJVB 5E68A 4C97A 2QN6A 2M52A 2JEGA 1P1TA 3VHQA 3R6JA 1SC1B 3MEGB 3JYTB 1VQPS 3BGFA 1OHHA 1FDRA 1Z1ZA 4TYBA 4FWTA 4OYAA 3W2FA 4A3KC 2HS0A 3HOWK 2PPBA 3JB9k 1XEZA 4I2QB 2HRUA 1CS4B 4F3MA 3M2VB 4ZPDA 2W9BA 2FJVA 1T8EA 3MMAA 3PTWA 4MK8A 1TWHC 4ZP9A 3DLEB 1AFIA 2B56A 1VFJA 3CJTA 2PA8L 2KU7A 3NWRA 1Y4ZB 2K3IA 2DNGA 2XI3A 1C1BB 5KG3A 3O44A 4KKOA 2FLLA 2CUYA 2IHR1 3CJ4A 4KGMA 4CH7A 3PJXA 2YQ0A 1SMYA 1TAQA 4FNHA 4LVOP 2L3MA 1EQMA 3LW5C 2QEXB 1AZSB 3AB2B 1J9ZA 3GTQC 3K59A 2CG8A 3W9IA 2AP6A 4O3PA 1IWAA 3NKYA 5IM0A 4Y3CA 2OO4A 2FHMA 1UD3A 3V4MA 4LK0A 1C4AA 3CO9A 2GQQA 3Q86A 3BCFA 2BANB 1LW2B 1ZA2B 2YNGA 3AXMA 4KO0A 2V7XA 1HYSB 1YIJB 5CD4H 3BQ1A 2H9ZA 5EWFA 3PO3K 3CNQP 1LWEA 5TY0A 3CIMA 3LA0A 4KM9A 1FCAA 3EGWB 4E8UA 1UFWA 1YTYA 3U27A 3FBBA 5DZ6A 4G6VB 1AROP 3ZTQA 3GSDA 3ZZZA 3NCPA 4J9UE 3IG1B 5MLCV 5GAHU 2ATLA 3SZYA 3BB5A 4HTJA 1R9TA 5KFYA 4NCNA 2UXDF 3MPYA 4IYQA 1RQ0A 1SKYB 2XY7A 3VGUA 4CH1A 1IBKJ 2RU3A 3B4MA 3OJXA 1ZXOA 3A8JA 3CMQA 2IJFA 3MUVP 4GVBB 2XG8A 4WZLA 3JSMB 3M3YK 1EB0A 3IA0A 1CULB 4BHQA 4OHWA 1XNQJ 4L76A 1UFKA 2JJ1A 4YY3J 4RW4A 1ZTTA 4TU8A 2J7WA 1QAXA 1EARA 1RU2A 2HIYA 1Z2ZA 2A3JA 2OBSA 4GTLA 2MZRA 4ED8A 3RW6A 3HKZD 4DL6A 1N0UA 1FVQA 4Y2AA 4TY8B 4HKQA 3EZOA 4ECTA 2QX0A 4ACAA 2Z2YB 4IKAA 1UP1A 2XZDB 3GLJA 2V8PA 1DCOA 1S1TA 2RE1A 2F63A 4H4KA 5KFJA 4OZNA 4C9DA 5ETOA 3V7AA 4U7UK 4X7FA 4MYUA 4RD2A 3G87A 4KC5A 2R6HA 4A3DK 4ZA1A 1IJEB 3ADAC 4LF5J 2I38A 1OB2A 2DT9A 1FKOA 5KT3A 1JKHA 5IYBC 1RT3B 1CNEA 3QSYA 2G0JA 3MDFA 4KBIA 2CJ9A 4HDGA 4EGLA 3DYAB 4K1XA 1FRMA 3GV7B 4DV6J 3OTEA 2Z8QA 3K5NA 4FK8A 1T9YA 4QHYA 2A6MA 4DU8A 3EUNA 1HNIA 1SH2A 1OGJA 3C6UA 5AJ3F 2NVYA 3LVBA 1NXIA 4PGOA 2YWWA 1A8PA 1FERA 4NASA 3W2IA 1FRHA 4ED5A 1YX2A 1S0VA 4X4PA 2A2CA 5C25A 1UFLA 4B3GA 2JA7A 3CC4B 2E2IC 4ZJLA 2HSEB 2OHDA 4M5KA 4X64F 5F8GA 3BQ2A 1R5NA 1XMQF 1LWFB 5HVFA 4OHZA 3HAGA 3OLAA 2DCLA 5K8OA 1FNMA 3ASQA 4YAWA 1L3KA 5CCLA 1VQ6S 1BC6A 3GILA 3PUMA 4P9SA 3U2QA 3VO1A 2QL5B 2BSAA 1G3OA 3W2EA 2NVXA 3DN9A 3GTJC 4X7DA 2BW7A 2XMTA 5IK2A 5AXLA 1XZQA 2YTCA 2JLEA 2B5JB 4OYXA 4BLBA 3I32A 3NE5B 3EXYA 5KT5A 2C5BA 1ZYQA 3OPKA 4WJ4A 4X66F 3ZZOA 2ZUFA 2AX0A 3KJFB 5KFRA 1QFZA 1TV6B 3C3LA 2M4MA 3CVKA 2M3DA 3NBPA 2QLFB 2PMZD 5D0GA 2CPDA 4ZCKA 1Y0YA 1R5BA 2ZC4A 3V4GA 2VPZB 5B7WA 2IA0A 5IYDK 3QFCA 5ETTA 5GAHI 2V6SA 4XR6A 4LBYA 3I4MC 1T02A 1YI2S 3L4BC 3CPWB 1VLYA 1MWZA 1RAOA 2HNDB 1TWAC 3KXDA 1JLGA 3C66A 1JLCA 1DD5A 4GMKA 2R8JA 1EZZB 1B4BA 4TMWA 4RU2A 3OPOA 4DOZA 2IRXA 1W2IA 2QN6B 5IYCC 5TMFA 1B2RA 2BVZA 3BPDA 5L8RC 1RT4A 3EPGA 1SC3B 1PJ7A 4J9OA 5DN6A 3R2CJ 4DQKA 4KQZA 3J81k 1NJID 4FXWA 1M5HA 3CDWA 1QG0A 4U8YA 1DTQA 3QT6A 5U47A 2X7IA 2ZNYA 3DMJA 2RGRA 4BY1C 2R8KA 5HLFA 2W9BB 2IBKA 3MMAB 1XFOA 1HI1A 3GTOC 3CJRA 1DTTA 2LKZA 4LBHA 2P6SA 1TWHA 4A3JK 1QGZA 4CP5A 4DUYF 4NA2A 4KKSA 1RAEB 4Z4WA 1W35A 3FHZA 4OX7A 4LBWA 3DXJA 1HARA 2QEXS 3UE2A 1EP1B 4Q43A 3SSRA 4KKOB 3T41A 1YNNA 5D15A 2QLWA 2B6AA 2AV5A 1WQFA 2VYQA 4PG4A 3THVA 4DLGA 5EX0A 4ZGQB 3HSDA 4M4SA 2M8DB 4WP9A 5KFUA 3QJLA 5A89A 3OFGA 3W66A 3CC7B 4YFKA 4YG2A 3LNNA 2HMIA 3TZYA 4M5MA 1UVMA 3BREA 3GTQA 4RW6A 3KYLA 1KRPA 4P2SA 2IYGA 1WIHA 5IM0B 3BKUA 1U1NA 4KMUA 4JI1J 1F7VA 2IM3A 4DF8A 4TMTA 1OWXA 2QZ8A 4GTAA 3ZXWA 2GK7A 3CJ8A 3PYEA 2VPWB 3KDOA 4CT9A 4PG7A 3M2RA 1CJTA 1UEKA 5E2QA 2YNGB 4KO0B 1WTHD 2P9EA 3ETOA 2VBYA 4P7TA 4ZMMA 1OGIA 2Q6BA 3KMSA 4MAKA 2K7KA 2B43A 5KFZA 1YZ7A 4NRTA 1LWEB 1NMEB 2EIXA 1J6WA 1UD6A 1T6XA 4YFNA 3V81A 3G4SB 1EQRA 3LANA 3E51A 2JC0A 2OSQA 1RAHB 3ZZPA 2XLIA 4OV6A 3R2DJ 1VMBA 3RGIA 4X0CA 3D5MA 2X6WA 4HE6A 1U02A 3H90A 4CLZA 3QATA 2O1PA 5EX3A 3HD1A 1S4EA 4QFMA 1K0VA 1HWIA 1LKZA 1S9GA 1VBYA 2Z58B 3ZO7A 4OJ3A 2VQFJ 1FTRA 2HBRB 1SJQA 3ISXA 5THWA 1GFWB 4EYHB 3CJKA 3OP1A 3V6HA 1SH0A 1QGYA 1OIAA 2CJYB 4RW4B 3D7SB 4QJVA 3SBMA 1SV5A 3ZNUA 3S2DC 2BGIA 3BO2A 2C4UA 4RWWA 1RKJA 1VC0A 3R97A 4YB1P 3ERED 2KZMA 1WF0A 1YSJA 2VBSA 4XLHA 3M32A 3H42A 2KRBA 4ZPAA 3MUMP 4LQYA 3E2EA 1RAGB 4C43A 2A10A 4N8OA 4TLRA 5L46A 3CCTA 4TSFA 4BS2A 1MABA 2LMIA 1S1TB 2NUHA 3FFIA 4TKTA 4Y0FA 4PC2A 2E2JC 2EFPA 3ONYA 1RB0A 4FVCA 1RTZA 4QQBA 1FKOB 4P1VA 3TFIA 3D26A 1JKHB 4NZ7A 3QSYB 2G4BA 2HAIA 1FD8A 2CZ9A 3CC4S 3R3TA 1F93A 4OIOA 4NX9A 5HXBA 2XZOA 4FYYB 5FA6A 1N54B 3MMJA 4J9RA 5GAGI 3GFXA 3CPWR 1U48A 1GJRA 2DYAA 3C6UB 1IBMJ 3S2HC 2YVSA 4QV2A 4QWDA 2K8GA 4RCYA 3OQ2A 2PO4A 1TL7A 5FD1A 5C25B 5KFEA 3SFUA 2CIMA 2W9CA 2JFDA 3GTPK 2CJXB 4PXBA 4AFFA 3SYZA 4F25A 1D9AA 2HQIA 2E2IA 3DCAA 5B0AA 4OOVA 4QVJA 1X5SA 4Y52K 1JXEA 2XS7A 2GGPA 4RBVA 3I4NK 1L3SA 1U8SA 1DQAA 1ZAWA 1VGXA 4QWCA 5E41A 5B0FA 3VA7A 1WG1A 4TKOB 2V4RA 2ZJPQ 2BQRA 2V9WA 4G7XA 4KAWX 2GMJA 3GTJA 4A8OA 4XLEA 4USWA 5F9LA 1XZQB 1TMMA 4P26A 4OHVA 2V63A 2J0QD 3RZAA 2QGGA 3GV5B 1L3TA 1SJ3P 4BCAA 3CCJB 2J9DA 4ELVA 5F8NA 2F40A 3NBPB 3AA9A 2H4YB 4N47A 2BXJA 5CQGA 1HBOA 2VH7A 3GEHA 2X1BA 4Z7YA 3U1MA 1PGZA 3Q24A 3HFVA 3JTPA 4CT8A 4K7QA 1QSYA 2CRLA 3QGIA 4OOSA 1J6VA 3J7YU 3Q89A 1RWUA 2KM8B 2YPZA 1OPIA 3CPXA 1H6KX 1PBUA 4UZEA 3VGVA 2P8IA 4BLAA 2ZNZA 1JLGB 1AFJA 1JLCB 1TWAA 1U7LA 3MEDB 3GTGC 3NRBA 2HGMA 3UD3P 1LXJA 2C3PA 4DR2J 4JV5F 1KSPA 1HNWJ 1O28A 5KSWB 4FYDA 4DUZJ 1F3FA 1Q9SA 2DHGA 4A8KA 2KZZA 3NGDA 1QGAA 3VQSA 3T00A 3CJ2A 4ILLA 5GADI 2JA8C 4X07A 4CNZA 4U96A 4Y2CA 4Y34A 2BM0A 4PUOA 4UOCA 1TWCC 2RHQB 3BO4A 1DHMA 1JQWA 4NLXA 3NUHA 1DTQB 4MT1A 4KH1B 3DMJB 2JIZA 2DNMA 2BV3A 2F8HA 2MY7A 5HLFB 3EGNA 5GAEU 4KE5A 4LJZA 2YNIA 1F20A 2JZ5A 4Z2XA 5IP9K 2P6TA 3Q83A 4OJHA 5K9FA 4I64A 4QIWD 4IRKA 1DTTB 4FPRA 4C8YA 4XKWA 2DGOA 4DL5A 1CPZA 4ZIVA 2KG1A 2BX6A 2DGXA 1HHQA 4ED3A 4CLKA 2VHGA 2V7VA 4WZKA 2Q6KA 1VQ5B 2CQ1A 2Y1RI 2J0XA 1SBRA 3CC7S 2Y3PA 2FJEB 3SJZA 3KG0A 3G6XA 4AVZA 5CYQA 1KNZA 3CW2C 2ZBVA 1YHQB 5ETMA 2WBMA 1T9WA 1FX4A 2UUBF 2P3MA 4CQJA 2B6AB 2XQCA 4DX6A 3MM7A 4TN1A 4NMLA 1D3WA 1X60A 2F9JA 3FBCA 2M7SA 1NPPA 1L5UA 4IOCQ 4DF4A 4ZPBA 4XN3A 3ZZYA 3M4OC 4HACA 2NUUG 1E64A 4PXCA 2BGJA 1GMVA 1WSRA 1DARA 2HMIB 3J7A1 1M5VC 2AIRB 1YJTA 1JLEA 1SIWB 3G4SS 1G7CA 1V3SA 1R0BG 3TEGA 3FMWA 2PDAA 2BJ7A 4YHHF 2CVIA 3BN4A 1RU0A 3N3YA 3HZGA 2H54B 1CJTB 4EBCA 2B4UA 2HVIA 1T05A 1TKZA 4C4WA 1RGVA 3FPPA 5H9EK 1HNZF 4C2MK 4WYWA 5IZHA 3RBZA 4Q2LA 5HL7Q 3V81B 1M1KD 3VWSA 2BVNA 5CYJA 1H3DA 3W64A 1TFWA 3NAIA 2Z2LA 4EO8A 4P2MA 4BC7A 4YXWA 2K3KA 1FT8A 4IOAQ 4WZTA 2I2YA 2GX8A 4LF7F 2CADA 4HH0A 3GIRA 3EZUA 4WZQA 3MM5A 4Q8EA 4JYAF 4B3XA 1QTNB 1S9GB 4XSXA 4OYMA 2DH9A 2JJ2A 4AH6A 1SKUB 2QA2A 2VC0A 4PAAA 3RAXA 1E62A 5C42A 3QRPA 5FO1A 2UVVA 4QJVB 2D9PA 3P4UB 4DJBA 4ANCA 2DGUA 5M5WK 1N6QA 5E5NA 2FYXA 1I50C 1PIEA 5DGAA 4LFBF 2AGOA 1O25A 1TLLA 1LK7A 3GCXP 2VBXA 4QOTA 2QFIA 1P6TA 3PYFA 3BH6B 3FZ2A 1GO2A 3N79A 4M8LA 1W7WA 3PO4A 4FS1A 3S1QC 3MPUB 5AN9A 1R8BA 3RB4A 1YBAA 4NCAA 2LCWA 4C8ZA 3JTOA 3FFIB 3CAGA 1CEZA 1X31C 4DFKA 4UTGA 2XGQA 4KMHA 2ADBA 2DGQA 4J9PA 1F5AA 2CZ4A 1XPPA 2L9NA 4GTDA 4GTBA 3ONUA 4GTEA 1TUVA 1HPZA 2EBGA 2GVDA 2HK2A 4BBRK 1SKRA 1FTCA 4Y28C 4DCOB 2F8EX 4NNJA 3GFHA 1F2HA 3DRXA 4DG1A 3VAKA 2A6OA 1X8DA 4LT6A 1SFOK 4LBVA 1GAWA 3TA0A 1GX6A 2APOA 2ZH9A 2UXCJ 2X1GA 2UUAJ 1Q7YT 3JQMA 3MHPA 1WHYA 3LH2S 1TVCA 2AJ2A 3RZOC 1B7FA 3WBJA 2VC1A 2Q6IA 1XR7A 4CYUA 2FVRA 4L3NA 1Q8LA 2XLJA 2ZHAA 4ID5A 3VNVA 1HW9A 1TL7B 4ALZA 2UXBJ 3TA1A 3DOLA 1Q82T 1B4SA 2PN6A 3H8YA 2IDLA 3FKBA 3TUJC 4CLUA 5HVHA 5CJ9A 2R7SA 5ETPA 3ISZA 3W5YA 1T7PA 2LEAA 1WTBA 4WJBA 1IW7A 1D9FA 1URRA 4RLEA 1OB5A 3OV7A 4AL6A 1GT8A 2XYPB 5E3QA 3KKFA 2B4VA 1OSDA 5L1IA 1UWBB 1JXVA 3BP8C 3D1HA 4DCJB 3J80U 3AODA 2FLNA 3GTKA 3GMGA 4QBUA 2HS3A 3KLFA 2ZZMA 3UN3A 4UW2A 4DV7J 3SCIE 4JI4J 2ZFZA 1QE1A 4KYZA 5H5JA 1TL4A 3PIOQ 3LPEA 1HBOB 3HFKA 4QZVB 2JEIA 4QW9A 4F4XA 4ED2A 2I6WA 2OH2A 3PO5A 4KPYA 1VIXA 1R9TK 3LP1A 4R5PA 3S16C 1Y1WC 3OBIA 2ZM6F 1O0PA 1RADB 1JB9A 3H5SA 1M5OC 3OZUA 4DSFA 1RWWB 3PKMA 5FLMC 3HOYK 2DITA 3D67A 3Q8YA 2EXUA 4F36A 5LXRA 4PRFA 1VK8A 1N5YB 4XQFA 4B9TA 1MWQA 3GTGA 3H3VD 2KG0A 1U1RA 1WQHA 1UTAA 1NKBA 3C8YA 1R31A 3KLGA 4WFNQ 4RBTA 4DR5J 2GSNA 1NDCA 2Y1LB 2ZEJA 2KVIA 4OJGA 1YNJA 4ED6A 2CXEA 1FDBA 1IB0A 5D4OA 2OFGX 1S77D 4QIFA 4PUOB 3BEGB 1IXKA 4Q5SA 1VQ5S 1TTTA 1NJWA 1O27A 3EMTA 4KKUA 2ZUGA 2GHPA 4I6YA 4M53A 4RUCA 1TWCA 2IJNA 1KOOA 1V3RA 1SJ4P 2XZPA 4D3HA 3K0JA 1J27A 4Z37A 4YUDA 3NP5A 2BEFA 3AD7C 2H5EA 2N7CA 2YNIB 3NS7B 4HVZA 4IR1A 2E29A 4K4TA 4LRDA 4JI6F 1SM4A 4ZJOA 1F6TA 2L9DA 3V4IB 2YU9C 3PRBA 2NVQC 3VVTA 1NZAA 4Q8FA 5C4XK 3GTMK 3R27A 2E7WA 3ASTA 2XNDA 2R2UA 1IR1A 2XMWA 2CPJA 5B08A 3SV3A 2LA4A 1X5PA 1VQ9S 2Y3YA 5IOTA 3F0NA 2XEXA 4DBQA 2D74A 3CW2A 1VYAA 3L7UA 1VJEA 4GVLA 3MM7B 1RWKB 4NA3A 2QL7B 3AQPA 1KC8D 4DV1J 4OX9F 4HACB 1RBOB 2RS2A 4ZLLA 1OSCA 2H5JB 1TMJA 3TW0A 3MCMA 3IN5A 4O2DA 1N0VC 1JLEB 1ZZFA 1FK9A 2M9KA 1G7CB 4RNOA 4KASA 5C3EK 4GKJJ 2BJ8A 2DGSA 2C1EB 2MDAA 1RISA 4FN5A 4BWJA 3MR3A 3GTLA 1NDHA 3DC2A 1O2AA 4RW7A 5KFLA 2KDOA 4HT7A 5FO0A 3FBEA 2W1BA 1T05B 1TKZB 3VR6A 1K44A 4WWVA 3H5YA 1KK3A 3CCWA 3FEXB 4M95A 2R2RA 2NVXK 3S6EA 3QGPA 2VFRA 3FMBA 4KM8A 2HHHJ 3S1RK 4A8XA 2PT0A 3OFFA 3TZWA 2EG2A 1KLNA 3C16A 4YELA 4C3JK 3OTDA 5LMNJ 2O5JA 3EVWA 2XMKA 3NAHA 3MM5B 3OZWA 3G8QA 2C2KB 1CJKA 2C78A 1S48A 5IOLA 4WKYA 1T3NA 1VQ4S 4IR9A 3JXOA 1NB7A 1UVNA 3N0CA 2VFVA 4QUZA 3TAMA 2YWFA 2OKQA 2GJRA 4LFCJ 3OJWA 4V19X 5C42B 1JNZB 3H20A 3MM8A 4DN0A 5HN0A 4BBSC 3AXKA 3LGMA 4USHA 1X9MA 1V5VA 3VO2A 1RWOB 2CQ3A 5FLXY 3UCGA 2A1BA 1VQKS 5A2QU 1N6QB 1WOOA 4DL7A 2RMLA 1I3QC 2R93K 3M8PA 1LW0A 4KMAA 2KT5A 1PJ5A 4IH6A 1I50A 1I1GA 3AJ1A 2V2QA 2RH6A 1KDNA 3MMPA 2WVFA 2WAQD 1TR0A 5DQIA 2R7TA 3DU5A 4C3MA 3LO3A 2I1RA 1W87A 5F4OA 4O0NA 4X4TA 3G71B 4FYVB 2DIVA 2XMVA 1QAJA 3CESA 3R7SB 2MKSA 4M5IA 3IBWA 4PC3A 3CMAS 1FRIA 1REGX 1QUFA 3A8EA 2XBPA 3RZDK 3PVDA 3W62A 3FPKA 3ES9A 1SC6A 2W2MP 1FDNA 1YJRA 2ZBPA 2ZJQQ 3QAUA 2CFAB 1HPZB 2GVDB 2V67A 5CZVA 1NB0A 1JA1A 2ZL5A 2DXFA 2LQ8A 1M5PC 4DG1B 1TK0A 3GIMA 3VMFA 3BSCA 4JUZA 3RBXA 5A76A 2LQ5A 3TANA 2R7WA 2VUMC 2UVUA 1I94J 3ZTPA 2B5OA 4NLGA 2G9OA 3UCUP 4F04B 2FJBB 4A8SA 2DKOB 4PQAA 4CYUB 4J37A 4HLBA 2YBVA 4ID5B 4AD6A 4YR0A 3S1MC 1ZM2A 3DOLB 2E2HC 2WJVA 3IWLA 2AKWB 1WCMK 4X65J 1WKJA 2AYEA 2X85A 1SJFA 1MLAA 2DR7A 2BW2A 1H8EA 1RZMA 1X9WA 3SEOA 3DDNA 3Q2TC 6FDRA 2DVIA 3ONQA 1UL3A 1EFWA 1RKIA 2HIQA 3KLFB 1NPRA 4FXUA 4LRBA 3E20A 1RAFB 3OJSA 1FNOA 4DR4J 1FRKA 1ITPA 1QE1B 3VNUA 3CCMB 1RWVB 1E79A 2IYIA 4GKKJ 4HHHA 1CQMA 1CJUA 2ZE2A 3PRVA 2GIRA 5LXYA 1D09B 3S17K 1ELOA 2UUWA 1KHWA 5DDRC 2MSSA 4ZPCA 3TJ8A 3LP1B 4ZN3A 3KG4A 3CUNA 5IT0A 3QE2A 3H0GC 3Q8PB 4ECSA 3N4WA 1Y1WA 1QUEA 5TJ3A 5EDWA 2IC3A 1SKQA 2V69A 4ZVQB 3ILOA 2OP5A 1UV7A 4LR2A 3BDEA 1U6BA 2K2PA 2F9DA 3J7Z5 4OLOA 2JOQA 1FNXH 3PA1A 2RF2B 2DHHA 3OTOF 4Q5VA 2GQ2A 3KLGB 1RWMB 2C42A 3PJWA 4LR8A 1U47A 5F8MA 3W61A 4B44A 1KQKA 2V9KA 2C77A 4TVAB 4KV8A 2QRRA 3KL9A 2DNYA 4BY7K 2MKCA 3N5BA 1W0JA 4K5RA 1X4BA 4ICLA 2ADCA 2NS1B 2R7ZA 2ERRA 3AH6A 3QRQA 2VG5A 3CSKA 1OB0A 2LU1A 2CNKB 1UD2A 1KFSA 3L7PA 4U95A 3BN7A 1SKWA 2C2DA 1USOA 4ZGNB 2YU9A 1Q1KA 3UVJA 2ALYB 1N34F 3KUEA 3VAMA 3OW2B 1OQ3A 4RM0A 3QJPA 1XWLA 1RXOB 2A18A 5KFNA 2QSWA 2ZZFA 3I56B 3M8SA 4FZVA 5DDPC 3S1NC 3W2HA 4C0HA 2JWNA 3NG8A 3QPIA 3TVYA 2OFHX 1HL6A 3ZZ0A 1HNXJ 5D78A 1H2UX 4OLPA 1UVKA 4QVAA 4ECUA 2N7YA 1K8AD 2YKQA 1XZPA 5T41A 4Y7NK 1OS5A 1XR5A 4WE1A 3GR0A 5ETKA 1BPLA 5CAAA 2B51A 3EVOA 3CQZC 2RHSB 3MUTP 4KGVB 1FK9B 2DRAA 1E63A 1RTHA 5EGEA 2JH3A 4NA1A 4CM2A 2FLOA 1C2PA 2WTFA 3K7AK 5KFOA 1O2BA 3OHAA 4R71A 2KVOA 4B02A 1Q53A 4ZOSA 2XO7A 3FSXA 4J91A 4YALA 3T1HJ 4F4YA 2UV8A 2IVMA 3PO2K 1UETA 3CJQA 1N32J 5ETQA 4ETZA 4J3NA 2IPOB 4RO0A 3QZ7A 1VQMB 3D1OA 3GJTB 1M5KC 2V4DA 4TU7A 3KEWA 4Y9RA 2AZ3A 4JI0F 3C16B 3JQQA 2BE2A 5F41A 5D3GA 5LM7E 4XORA 3Q8UA 4PXDA 2H48B 4LJMA 2EK1A 3FC9A 1DY3A 1J98A 4A3BC 4P25A 3AHPA 4CQ1A 3R7BB 1TUGB 1CJKB 5DS7A 1UD4A 5J1NA 4C8MA 2JC1A 4DQRA 3TAMB 4CZCA 5D0RA 3KDNA 2PMZL 3TWZA 3G71S 3QMQA 2Z6BD 4ED4A 4AE5A 3PYGA 1XBWA 1U0HA 2DNLA 3TI0A 1ZBSA 2M8HA 2XCOA 3UDEA 1LW0B 3BGLA 1U1MA 1I3QA 3SI8A 2CQHA 4NBSA 3LOUA 1WP6A 4C48A 1N8RT 2KT3A 4KARA 1RWPB 3IO1A 1S10A 2GMHA 4Z4UA 3U6KA 4HH1A 3CJSA 2HLUA 1S0NA 3P27A 1REVA 5DQHA 1U1LA 4ATNA 3UPFA 3OXLA 5G0RB 7FDRA 2CNDA 2KKHA 1P9QC 2FHOB 3J81U 1DURA 4UOGA 3FUYA 1LFPA 4BY1K 1TWGC 4IUFA 4PC7A 2HURA 4KHPF 3L95X 3RW7A 4XL9A 3AVTA 5DSZA 1NB2A 4UZFA 4ZHRA 2NCKL 1FWLA 1HNVA 1U6FA 4ECZA 3P49B 4J9KA 5B0EA 3W2VA 3ASPA 2VUMA 4N41A 4HEA9 3VGTA 4HR2A 2I5JA 3HSGA 3QO9A 3OOCA 3TUIC 2ZXIA 2MLXA 3BUEA 4CDIA 2YNHA 3MAQA 1JQGA 4ZK7M 5SUHA 1Y3JA 3L7OA 2LU2A 2BMWA 2E2HA 1G7RA 2OI2A 4FVMA 3H25A 4FS2A 1VH2A 4TN2A 5MAOA 4GC7A 4X6AC 1M1HA 1BX1A 4DXLA 2N3OA 3QGHA 1RYSA 3CCMS 4B9LA 4DX7A 2F65A 3RAQA 3HHEA 4F0KA 1BY9A 3SQGA 2DHXA 2RDIA 3DHXA 2P5VA 4ZVOB 3AY0A 3IAS9 2UXDJ 3MMBA 1XR6A 1D1NA 2Y1JA 3GONA 1R8HA 3H9NA 3J81j 3NY0A 3OW2R 2D3LA 2B8PA 2IM1A 4A3GC 2ZH5A 5D4LA 3EE3A 4LQ9A 1Q5YA 2JDJA 4CTAA 1CJUB 2ZE2B 1S0UA 4M0LA 3MAAA 2FY8A 3MR7A 4F7VA 4KATA 2E1AA 1J6XA 2X51A 3B8HA 2ZBRA 4XPCA 3BBBA 3KFWX 2H4WB 4YOEA 4NLYA 3DLBA 3FDSA 4GTFA 2OPQA 4OYOA 3BQ0A 1GE9A 3H0GA 2P8TA 5K5MA 1U8WA 1FNDA 4KGZB 3UD4P 2YKPA 5F0WA 1FX2A 4KTQA 1S9EA 3DRPA 1VS3A 3AGPA 4JV0A 4O4RA 1RP5A 5IV4A 3EJMA 1Q86T 5I3UA 2V7QA 2V8VA 1IKYA 2DGWA 2R3VA 1J5OA 5BSXA 2LVWA 5J2NA 1ZQ1C 4EI2A 2MGZA 4TMXA 4KGXB 4KV8B 1TUIA 5KG5A 3OR2A 2RD5C 3I0SA 2WVDA 2JA6C 1K1QA 4C7QA 4ICLB 3H2LA 4G7OA 3I56S 2ILYA 2ASLA 1IM4A 3KMQA 2ZXHA 2I8EA 2VG5B 2XO6A 2PEHA 3HP6A 3DDYA 3OUYA 1TVRA 4CLPA 3VF0B 1INNA 2MZ1A 5F8JA 5AJ3J 1Q81T 3UFCX 2E2JK 2B7CA 3UVJB 3DXSX 5IT9Y 2OK8A 1VRUA 2DO4A 1IBLF 2E5LF 4MMOA 2PFDA 3BH7B 1WC1A 2V7WA 2BKNA 3UWTA 1N33F 4X64J 4ANEA 2U1AA 3ZC4A 4N77A 1R8CA 1SQEA 3MD3A 4B9MA 1SKSA 3QIPA 3LAPA 1ZM3A 2KYZA 4XTTA 1XMQJ 3LQ6A 3R5CA 3BSOA 4F67A 1DG1G 5ETLA 1FEHA 2NQPA 3T3FA 3AB4B 1DQ9A 1XZPB 3S2HK 4N3GA 2J9DE 2GIFA 4WE1B 1NK9A 5E6TA 1S1XA 2H1YA 2R8IA 2M5YA 2VV5A 2XGPA 1VQMS 3MF5A 5KG1A 3CQZA 2PMDA 1H8HA 4N5SA 1XTZA 2ZH6A 1RTHB 3FEYB 3K5OA 2XMAA 4QYRA 1B99A 2VJUA 2HVZA 3MR2A 1ZAXA 2ZWPA 2J76E 1Q5VA 5A0YB 1P4MA 3LPYA 4JI2F 3W1YC 3MPDA 1DCHA 2XZWA 3EX7B 5BYSA 1NLKL 1ZM9A 3PW0A 4OZ1A 4X66J 3G05A 2IM2A 4NCGA 4NMXA 3MCAA 1XNRF 3DGPA 4OL8A 3CO0P 4PG8A 2YKOA 2MB0B 2GQCA 1S6PA 1GNKA 2O66A 2FQQB 3CDAA 4U6PA 1WC0A 3KUHA 1B23P 2I9SA 2O67A 4DZ6A 2WSCC 4ZP7A 3GTKK 4I4BA 1I6HK 2RC6A 2BRLA 4DZDA 4YEJA 5K8PA 5F8IA 5LMUF 4CI0B 3V6KA 1GTEA 2EFVA 4OZ0A 1KFDA 4PXEA 4I68A 4G0UA 2BKPA 5D3GB 2QLJB 5BJRA 3ELHA 2NXCA 4ZV4A 5EWGA 4NL5A 2O5IA 2NXUA 4LK1A 4IFYA 4CLWA 3PX6A 3HOWC 3PEJA 3OSNA 4OYBA 3TUPA 1YJ7A 4Z4TA 2IFXA 4C98A 1K73D 1VLOA 3GIKA 3WHIA 1RLCL 3KLHA 1U24A 1E1QA 1EAYC 1WC5A 2LXUA 3MAHA 1U0HB 4B4DA 4NE9C 1E6VA 5IYPA 4K0KF 4PZVA 1MNEA 4LRAA 4L73A 2E5IA 3GTGK 2ASYA 5AE3A 2V2KA 4URSA 4DL2A 1GVHA 4B43A 3M30A 3CCUB 3BH4A 3PM9A 5EGYA 2FB0A 2HWTA 1R0CB 4DUYJ 3RRHA 2LDIA 2WJYA 5J3OA 1AB4A 3KHRA 2OMLA 1X4CA 1REVB 2AJ4A 1BGXT 2RQCA 3SSQA 2CFXA 4A8FA 1VRQC 1TWCK 1RTIA 2NVTK 3HULA 3RY8A 2XSFA 2ZL7A 4XK8C 2NXJA 4DL4A 4X4UA 3NS5A 5H9FJ 1RT5A 2XHCA 4U67Q 4FBTA 3FBFA 3EPIA 1KRHA 3KLEA 1S59A 5JJBA 2YWGA 2Z0GA 1WTFA 3A3NB 2DK2A 2DHAA 3GTYX 4YAUA 4ZHRB 1C0TA 1HNVB 2Q66A 4QIWL 2X1FA 5IORA 4UF4A 5D4NA 4O4GA 4QR0A 5DQGA 3PO3C 2G2YA 2I5JB 2HKEA 1SQGA 3QO9B 2QA4B 2XM3A 2K7JA 1U49A 2YNHB 1EJ7L 1K9MD 5HVGA 4CO2A 5RUBA 2KRRA 1GXTA 3OFHA 4DEZA 3FSYA 2BJ1A 4OP7A 1TWFK 2E1RA 4A8YA 3M8RA 5JBQA 4BBYA 3PY8A 2RIJA 1NZ8A 3I9V9 1S9FA 4MK9A 1VCTA 2XNQA 2CW0A 2GJPA 2XCQA 5H1SV 5CABA 3M3YC 5IOQA 3SQGB 1NSKL 2RQMA 4P5BA 3GTLK 3LP0A 2KO1A 1WQGA 3GQBA 1N48A 3WQZA 2DNOA 3BBFA 2X0KA 2ZHOA 2GJ2A 4EO6A 3A1PA 1S6UA 4USTA 5KOWA 2UVWA 2J6SA 4DSIA 4B3SF 3W7BA 5LSLA 3S1TA 1NKCA 2NSCA 2W4PA 3KG1A 4J90A 4RUHA 1F9FA 4B3TF 3MAAB 1U45A 2Q6LA 2M70A 1EI6A 1S4MA 4DFJA 3PUNA 4WIQA 2Z2MA 4ANDA 3M2UA 2LP4A 3TQEA 2DXEA 1Y9OA 3K7RA 2FHJD 3RB6A 1QLNA 2E5HA 2COLA 4B3MF 2OPQB 4ED1A 2HHVA 5KFIA 3FSIA 1VC6A 4A3DC 2ZZTA 1TAUA 4I56A 2IJRA 2ZITA 4USMA 4JI7F 1Y5IB 2AEFA 2NPFA 2UP1A 1S9EB 3DRPB 2NLWA 3FGVA 4RNFA 4UY8T 1K1SA 4KHRA 4UQGA 3ICLA 5HL8A 1R6YA 5I3UB 1RHUB 2HZAA 2P9CA 1IKYB 2ZOMA 2E5JA 1J5OB 4CO1A 5F4MA 3VTIA 8AT1B 1X4AA 3S0XA 1XERA 1RAAB 5J2NB 1FRLA 3HT0A 5HATA 2CQDA 2MGZB 4YFXA 4RD6A 4ZDNA 2GV1A 2HVHA 3GZ7A 1W2BB 3BGOP 3OR2B 2QE7A 4G1BA 3I0SB 1JMTA 1JIHA 4XD7A 1X0FA 2JA6A 4IQMA 4DHVA 3TAQA 2MTLA 2YWHA 2IAJA 4O23A 2CPHA 2W01A 3S1QK 4Q4ZA 3QGGA 2VONA 3OUYB 2VZ9A 1TZ0A 1TVRB 4G7HA 1T6ZA 1SL0A 3G6YA 4EFAC 3CMEB 5BR8F 1DCPA 4B3RF 1NSPA 3T1YF 2B63C 1R5OA 3R8YA 1VRUB 3D6MB 1WKLA 3MCNA 1S76D 2L9WA 3MD1A 3PKYA 2PGCA 4BWMA 5F3ZA 2H65B 2VBZA 2AGQA 1OPZA 1OY8A 3LAKA 3RRGA 5ETVA 1I5OB 4Y2IA 1UZDA 1B4AA 2WZ1A 1RHJB 4M5DA 3QIPB 3HHLD 4LRCA 2ZFHA 1GTHA 4FF2A 1VQ7B 4CO3A 3Q2SC 2E9TA 5HQLA 4DV5F 5DDOC 4QIEA 2CNNB 4PEOA 1S1XB 3LGHA 3UDVA 2LEBA 1HI0P 2XNRA 5LSOA 4GZYA 1ZPVA 4C3LA 2ZJRQ 1PILA 4C3KA 3EGVA 1WDTA 4Y65A 1K83C 5IYDC 4ES3A 4QW8A 1HD1A 1OY6A 2AHOA 2E1CA 1O29A 1HI9A 3THPA 1AT1B 4AF7A 2VJJA 4OOXA 5HMXA 2IA6A 5ADZA 2VDHA 4Z7CA 3WNCA 4G1PA 1G7SA 2YKMA 3DGPB 3D3CJ 2Y0BB 3ZBTA 3G82A 2VD3A 3A8IA 1F60A 1S0MA 4USJC 1GMUA 2HHTA 5KT2A 1K47A 4DL0C 1E6YA 1VQ8S 4P6VF 1X7VA 4KB4A 4L72B 3NXZA 3CF5Q 1M90D 3CCLB 4KIAA 2QJ3A 5F8LA 3HSJA 5CXTA 1GX5A 2W24A 3UR0A 4N8NA 4IFYB 1HLWA 1WDDA 2MY8A 1KK0A 1BQNB 4NLVA 2CNOB 3K57A 3CCUS 3VALA 4JV5J 4C8KA 1E3ZA 4LSNB 1XK8A 1W9XA 4NLTA 2BF4A 3S16K 3KLHB 4MH8A 3TZZA 3D6TB 4A3JC 1BS2A 2GHWA 4YP3A 3A3PB 2V6TA 5E3AA 3FKIK 1E6VB 5FLMK 1VHEA 1UZHA 3RYLA 3GR1A 3VAHA 4KN7A 3GEIA 4ZP6A 2Q1LA 1SCJB 2D3O1 4OZ5A 2NXEA 1S7IA 2XWYA 3M30B 4I69A 4O0IA 3TUZC 5HMWA 4P74A 3ZTRA 2CQCA 1S6QA 4AYBD 1RTJA 2QMWA 4LF8F 2ZZGA 3X1LB 4BPRA 3GJSB 3OVAA 1Y5LB 4WK1A 1RTIB 4DDFA 2R7RA 2MQPA 2R7ZK 2HEKA 3JTNA 1GH8A 2DJWA 3OSPA 3J7AN 3B6BA 2UUBJ 3U02A 1RT5B 4MKBA 3MPWA 4RD0A 3OHBA 2XWXA 2ZZEA 2PFFB 4JK1A 4ZITA 3P96A 3KLEB 1F9HA 2YU9K 2B9WA 4QWBA 3GV8B 2M88A 1ZUNB 1C0TB 1KHVA 2MZJA 1YQHA 2V6AA 2VNKA 5KOXA 1S7HA 4O4GB 5KFGA 4XAKA 2XNJA 2GJIA 2UUCF 3PR5B 2HAFA 2VIHA 1P9YA 3TNVA 1F3VA 4YHHJ 1V0EA 1F5BA 4EK2A 2O3DA 1EP4A 5C2CA 3I5AA 4QCLA 4KGKA 5JXSA 3U1NA 1SQFA 3G9CA
chains in the Genus database with same CATH topology
3TTGA 1WOSA 4PABA 3TFIA 3ADAC 1WORA 3A8IA 1XZQA 3GEIA 3GSIA 2GAGC 1WOPA 1V5VA 1X31C 3A8JA 3AD8C 3GIRA 1WSVA 1VLOA 4P9SA 3TFHA 3TFJA 1PJ7A 1WSRA 1NRKA 1WOOA 1PJ6A 1VRQC 1XZPB 3A8KA 3AD9C 1PJ5A 3GEHA 3AD7C