1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminomethyltransferase
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
1NRKA 1WOOA 4P9SA 3GEIA 3TTGA 1XZPB 1YX2A 4PABA 1WSRA 3A8JA 1VRQC 3ADAC 4PAAA 3TFIA 1XZQA 1V5VA 5L46A 3AD9C 1X31C 3GEEA 3TFHA 3AD7C 1PJ7A 2GAHC 3AD8C 1XZPA 1VLYA 3A8KA 1WSVA 1WORA 3GSIA 1PJ5A 3A8IA 3GEHA 1PJ6A 1XZQB 1VLOA 1WOSA 3TFJA 2GAGC 3GIRA 1WOPA
chains in the Genus database with same CATH superfamily
4NX9A 2AW0A 5IORA 3D6TB 1XNRJ 1EETB 1KOHA 2COLA 5FDLB 1VQLS 3BJYA 3S14C 4KRWA 2PMHA 1RLDA 2QSWA 5K14A 4QU7A 2ZH4A 3L09A 2YX7A 4II2A 4NI2A 2FD2A 1IBMJ 2VBZA 1NO8A 1T02A 5FLXY 2EFOA 3G96A 5HJXA 2FJXA 2Q6CA 4QBUA 2AEFA 3VGVA 4DCOB 3G4SB 5H9EK 4DV4J 3CJ3A 2J9CA 3I1FA 3GCXP 3UFCX 1D8ZA 2RQKA 3J7AN 3V6HA 3V7AA 1VQ7B 1LWCB 3O6QA 1D9AA 2B9XA 4OYPA 3H0PA 4KGVB 3ZTSA 2JEFA 4B9UA 2L48A 3HKZL 1FRXA 3KG0A 3KK2B 3ONQA 1TKTA 1FI4A 4EBEA 4FYYB 3OW2B 4ZLNA 2EW9A 3BR8A 5HN0A 5A8RA 4B17A 1XZQA 3RJMB 1WP6A 1H42A 5LJ3Y 4PWDB 2Y0BB 1BQXA 1YCLA 2LA4A 2RIJA 1DQ9A 2W6IA 2XO6A 1H38A 1LEOA 2GJKA 1AW0A 2AZ1A 3D6MB 4M5JA 2BQUA 1U24A 5J1EA 4DR2F 4P22A 4O4GA 5HXBA 1WG1A 2V31A 1W9XA 3IRXA 4DV7J 3U6BA 1N48A 3Q86A 3M2UA 2ACMA 2FLPA 4LIWA 1XR6A 2M88A 3MECA 1SV5A 3CCZA 2J8AA 1FD2A 4WZTA 3CD6B 1PGZA 4DFPA 2QDXA 2G0JA 5E3RA 2V2QA 1IBMF 2R8GA 2XYPB 4WE1B 7FD1A 4YDXA 1R5OA 1N5VA 1P9YA 2DGTA 3TARA 4DUTA 2BZ2A 4B9VA 1SJQA 5BYSA 1QE1B 3I0RA 1X4EA 1ZTTA 1Y1VC 1EWYA 5D4PA 3RU0A 1ZAXA 2BRLA 2VF3A 1FFWB 4DV6J 3OEPA 4DV4F 2MYFA 4ZN1A 3OR2B 2KO1A 5T7LB 1YQHA 3PVXA 3CF5Q 3DRXA 1GTHA 4ILDA 5IQQA 2P6TA 2YPZA 1TK0A 1UPPA 3HSZA 4OIXA 2FLOA 4I67A 3GVLA 1VLOA 5ETQA 1R7IA 1RBLA 1RHMB 4ZPWR 1UAWA 2J7UA 2V94A 4C3JK 1NDPA 1GVHA 3I6PA 4WXOA 1ZYRA 3BNWA 4DN9A 2EPIA 4YR0A 2I5JB 4EK2A 2J0SD 3OD2A 3J81U 2CPJA 5KFAA 2KJVA 5LOQA 1KVJA 1F60A 4M5IA 2PFDA 4Q44A 2F9DA 1I18A 2QL7B 4GVBA 2JLEA 1UA0A 1I50A 3PO3K 1FKOA 4TU7A 4K0KJ 1NSQA 4C98A 2I2YA 1JNRB 5HANA 3NL0A 4DV7F 3R8YA 4H4KA 3CDEA 2QFIA 2C2DA 2HZCA 1WKJA 3CE8A 2NUHA 4BBSC 3MR5A 4WP9A 3MAQA 4IH7A 3NGDA 1WQFA 1VMBA 1HI9A 4B48A 3ET6A 2DHAA 1S0VA 2NXUA 3GTOC 1YJRA 1CVJA 2QA4B 1T9WA 1GMUA 3UDLA 3J80Y 1BUXA 1D8TA 2DHGA 4TLQA 4BXXK 5CYQB 2F4VF 1NDHA 4P2SA 4N76A 2XI3A 3GSIA 4PKDB 1ZM4A 1JWWA 4QCLA 2PA3A 3BP3A 4LBZA 3VZHA 4BLBA 2CNNB 1PYTA 5HAOA 1QX4A 3VALA 3H2UB 1IWGA 3OUYA 4F7DA 5E3PA 3PW2A 2ZVIA 3MHPA 5EX0A 4DN0A 4LQYA 4PC3A 1S9FA 1VC0A 4QOTA 5M5XK 1FESA 1GAOA 3BREA 3ZXWA 1BQNA 4N3GA 3N6LA 2GJRA 2KFNA 1KK2A 4DQPA 1B0VA 1DY3A 2BJ8A 4Z4ZA 4B4DA 1SI9A 2DEUA 4N7TA 4DR3J 1PJ5A 4QWDA 3KNAA 1H3DA 2AJQA 3HHLA 1UJ4A 4ICLB 1Y00A 1WDDA 4M1XA 4CLYA 4P3YA 2VFSA 3G6XA 1AB4A 1U2FA 6AT1B 3BQ2A 3EE3A 4GFQA 3EVMA 4FS2A 4A8XA 3M30B 1EFWA 1I3QA 2V50A 1U1KA 2HAIA 2X6YA 4DF8A 1UW9A 2HYIB 2KZZA 5KG0A 1NJWA 1PC4A 4G6IA 4OZ5A 1T95A 2MZQA 1IKVB 5KNLA 2VA2A 2J5AA 1PJ7A 4LQ3A 4RLZA 5EWFA 3CP2A 2DNRA 4ID8A 4O0IA 3R5CA 3N4WA 2DT9A 5CH7B 2X85A 5KFKA 1R8BA 2B63K 4RR5A 2HHSA 4QPTA 4DQQA 3UDVA 3MMCB 2E9ZA 5JVOA 4JI1J 4CYUA 2WAQL 3EDRB 2X51A 8RUCA 1BQMA 1RAIB 1REVA 2XNDA 2N7YA 2ZZTA 4O3RA 1WC3A 2YNIA 1I6VA 2MKYA 1NK8A 1Y0YA 1Y9OA 4C3IK 3FKIC 3S1MK 1BLUA 3PW5A 5IQ6A 2J6SA 2HHPA 2DPIA 1JB0C 2XSFA 1TMJA 5CABA 2ZZNA 4Z4TA 1RU2A 4ZITA 4Q8FA 3ENWA 3LP1A 3VZIA 3GPAA 2LDIA 4BY7C 4ED0A 4A8SA 4R0EA 2WB1L 3HOWK 3VMFA 2AGOA 3GVKA 1ZA1B 3GV5B 2HZVA 1VQ6S 5CYMB 2R2TA 2XMUA 2UV8A 1QTNB 1AZSB 1J5OB 3DFEA 1QGZA 4FKXA 2L9WA 1F9NA 1DTTB 3A8JA 3DKDA 1VR6A 3AVXA 1SCJB 1H98A 2XZWA 3TVKA 2M4MA 4RDKA 4JI0F 4CLPA 5FL7A 1MWYA 1IKXA 1M5PC 1RQRA 3AJ2A 3N28A 3NCRA 3JQQA 1KRHA 2EFNA 3LP2B 4WU2A 4FF1A 4ZVPB 4LF8J 2D6FC 2ZFZA 3CD0A 2UVRA 3G2XA 3S2DK 4U8YA 4QQBA 5F9NA 2VU5A 1O25A 3JU4A 1ZS6A 3MM8A 4OLOA 4JI1F 1HYSA 5LMUJ 2VZ9A 4UY8T 3AT1B 2HEKA 1OPZA 1RT2B 2OTJB 4WTOB 3NWGA 4XQFA 2B8PA 4LQ9A 2E1BA 5F4JA 2GK6A 1UVNA 2VJIA 4GKKF 2WVBA 3FQKA 1GX6A 3G8SA 1WEYA 4NLSA 1LFPA 3Q8VA 5C24B 1MWQA 2DYIA 1N6QA 1Q1KA 4OYWA 3GJTB 4A3MK 2I5JA 2VNHA 1TVRB 2BYCA 4Q8EA 3GV8B 2OTLS 2C2OB 4RM0A 2XY6A 4DDQA 3T5KA 2Y1RI 1KN6A 2CNKB 1C0UB 4ECWA 1T11A 1LXNA 3G86A 3ZZUA 2MJUA 4V19J 4O23A 3SCLE 5F8HA 4G1IA 2C2WA 4F4XA 4ZVFA 4Q7JB 3FC9A 3BYPA 4DL5A 3QPIA 2R42A 3NY0A 1WPCA 3I4NK 4M94A 1VF7A 1MLAA 1NDCA 2A2CA 2YX1A 4ACBA 4FBTA 4XOTA 2XMVA 2BUNA 4Y34A 1FFGB 4YHHF 3SJZA 1XMOF 1U45A 3C14A 1E3XA 3OZVA 3GTOA 2GW8A 5CYQA 5C42B 2XMMA 5LMUF 2UZAA 3QT5A 4K4TA 1UEKA 1B23P 4CLUA 4BBRC 2H4YB 1G7CB 4Y2AA 1WHWA 3PO2C 1MRZA 3GTMC 3MUMP 1CS4B 2P9CA 2ASJA 4OZLA 5D8HB 2OPRB 2HVZA 3P3DA 4DNTB 4WFXA 5DO2A 1NK7A 3X1LB 5EGHA 2OI2A 1VJQA 2FJEB 2HGLA 4OI6A 1SL1A 2V4QA 4C4WA 4MK7A 2LLZA 1N8RT 3LGHA 2R7WA 2H54B 1S6UA 2GCFA 3OFHA 2E5JA 1LXJA 1NHUA 2GHVC 1LOUA 1CJUA 3K7RA 4ICLA 3N6MA 4P7TA 1W7WA 3C19A 4QWBA 4AUKA 2HHHJ 5D4NA 2VBXA 2CK3A 5J2QB 2B6AB 1TUGB 2D41A 1RQPA 4L75A 4QIEA 5B0FA 3AXMA 1S4MA 1U8WA 3ETOA 1IVZA 2ROGA 1SFOC 4XLPA 2ZM6J 1IKVA 3KLFB 1EP4B 1WACA 3A3GA 4LFBF 4HT7A 3WX8A 3GTGA 4NA3A 4X4TA 3Q6RA 5SZTA 3QRPA 3FHZA 4FYWB 3DLLQ 3M6VA 3PCOB 3QMQA 3MMCA 1Q81T 3F56A 2C3OA 4X4PA 3SZYA 2F63A 1B4SA 1Q5VA 3W62A 2BE9B 3VAJA 2V4JA 2WJVA 3RG6A 3JTNA 2XSJA 1VQ8B 3BYRA 4NCAA 5IYBK 4C2MC 4XPCA 2DCLA 4IRCA 3PJXA 1EI6A 1OY9A 3THTA 2HW3A 1S49A 4ECXA 1SXLA 3D2WA 4M5NA 3VVTA 1R27B 2DHHA 1RAEB 4LC0A 3OFGA 1N0VC 4W92B 2VH7A 1JOEA 4WJBA 4LF9J 1J5OA 3CDAA 5KT6A 5C4XK 2QMUB 3GJQB 3TX0A 2Y0SD 1S10A 3BSNA 1KTQA 5J1PA 3CC7B 1DJ0A 2G1HA 2NVTC 3VF0B 5HLFB 2MXYA 4JI4J 4K5SA 2CPDA 3MPYA 4OOSA 4ZCLA 1TQLA 1FJEB 3LALA 2XB2D 4KO0B 3GIKA 2DYAA 5EGEA 4KGXB 2PEHA 1BGXT 4UOHA 1T9VA 3TUZC 2W7AA 1RAGB 2VG5B 5DDRC 3S1RC 2RB7A 3DXBA 3PV8A 4GTBA 5KFOA 2C3MA 2DGQA 3QZ7A 4ZLPA 1TTTA 3HVRA 3KK3A 1FRLA 3FBCA 4JUZA 4HR2A 4HI2A 4DFKA 3PJWA 2OMOA 4WK1A 1F20A 3UDCA 3NGKA 3PW7A 2RU9A 4PPDA 1ZM9A 2CQPA 3DHXA 4U6PA 3FEYB 2CKWA 4ROXA 4CM0A 2OEMA 3TA2A 2RRAA 4P72A 1FRHA 2L41A 4DL3A 1TVRA 2VOOA 4DCJB 1S7IA 4MKVA 5LT5A 3GTQK 2RHSB 1W0KA 4KBIA 3DDYA 4LF9F 1FDBA 5D78A 4X4UA 3OQ2A 1RAOA 2GIQA 3D0IE 1C0UA 3K57A 2HS4A 2RF2A 4KV8B 1RKIA 4L76A 3AGPA 4B3GA 5LMZA 4JI4F 5BJRA 3VQTA 3FCHA 3I4MK 3VNUA 5M5WK 1YIJS 1BC6A 3BGLA 2E5LJ 2DKOB 4JV2A 4AC9A 5AE2A 1TWCA 4OYZA 3GYNA 4YEJA 3RY8A 1TKXB 3H4BA 2KVQE 2JHEA 2R93A 1RU0A 2VIHA 3KOAA 4PYAA 2ZH7A 1Q95G 5A0YB 4ED8A 5D0HA 3POTB 3AH6A 3TWZA 4UZEA 1X4BA 1C1CA 2AWZA 2P8IA 4W90B 3KMSA 4UAJA 4M5GA 3HO1A 3NGSA 4BDPA 5KFNA 1LWXA 2V8GA 2BJ3A 2P9GA 3VAFA 3GTMA 2Z2LA 3K0JA 2AP6A 4PG5A 4UZCA 4UQGA 1VQ4S 4CT8A 2A10A 3U7JA 2BJ9A 2E44A 3HZGA 2I8EA 2ZH1A 3PO5A 3OEHA 1MNEA 5H1SV 2RKIA 5AXMA 2E2IA 5BR8F 4WKRA 3RZOC 2YY3A 4OINA 4LK1A 3L7OA 3EXYA 3ZZTA 3QWUA 2R7ZK 3DLKB 1AXQA 2K7KA 4KMAA 2PMWA 1S76D 2HBRB 3M3YC 3FUYA 2R9LA 4ECVA 1YKWA 1U6BA 2NVYK 2QMWA 4O44B 1WDTA 4P1VA 4MKAA 3QGGA 3G6YA 4U67Q 1JLEB 5J2QA 2QSFA 4I1TA 2VUMC 3Q38A 2B6AA 3Q2TC 2WZ1A 4P52A 1PIEA 1WSVA 1OGJA 1LW0A 4N5SA 1MSWD 1HHQA 5KFXA 2MZRA 8ATCB 3VA7A 5A8WA 1NZAA 4F4AA 2Q6OA 2KJWA 3UR0A 3O2IA 2DGUA 4F04B 1PSDA 1SFOA 2B51A 3DM2A 5IYNA 2G9OA 4N8NA 4OZJA 1NJIT 3RBXA 4MYUA 4I2QB 2V6SA 1YJ9B 5KT7A 2DERA 3K5NA 4WFNQ 2WR8A 3OXGA 5LJ5Y 1VIOA 1VJEA 3C16B 3ZTRA 1NPKA 3K5OA 3GTYX 5FIUA 1IE0A 5C4JC 3GTGK 3M2VB 3R7BB 5KG5A 4G0UA 2JOQA 2NVQC 2OFHX 3BQJA 3KDOA 1D1UA 3KLGB 4YY3J 3TZYA 4L3KA 4J9QA 2OBTA 1XN9A 3CCRB 3EPIA 1VQ5S 3MOJB 1F2GA 2NLWA 4WFZA 1ZAVA 2W6JA 1PKUA 4ED4A 1VQSA 4X64J 3U27A 4CIOA 4ITSA 4KTQA 4Z4SA 1J6WA 5KOWA 3MM6A 4MKBA 4U7CA 5D15A 4M5DB 2LDYA 4F3OA 4CWBA 2EBGA 1G3OA 1TUVA 1IKWB 3M2RB 4C9DA 4G1VA 1N06A 1D09B 3S16K 1RT3B 3HULA 3C6TA 2NR0A 1RABB 1F9FA 2ZOMA 1G6BA 2UVWA 4DQRA 4CI0B 4N8OA 1BXNA 5HLFA 3PEHA 4XN3A 1JA0A 1PJ6A 1YBAA 2N4DA 3QGPA 3D3CJ 1Y11A 3T53B 2OD6A 3D1HA 4O3OA 2BANB 1VOMA 3DN9A 4NLPA 3BQ1A 1F7VA 3CT9A 2L3MA 3M9NB 1FX4A 2A3JA 3S1NC 1DD5A 3CCTA 3HCXA 2CQDA 1BY9A 2IY5B 5B0AA 2AV5A 2C42A 3QNWB 5IV3A 3LF0A 4YR2A 3RBEA 1TELA 1FNBA 3IAS9 3OTBA 2HLTA 1CJVB 4X8IA 4OZ3A 4QIWD 3OW2R 2ZUAA 1EQRA 3H90A 2XNQA 2NCKL 1RTZA 1WWHA 4ECZA 4A93K 4Z1MA 4IYQA 1WC0A 2HFVA 3KHLA 1KK1A 1RQ0A 3NG8A 5HVFA 5KT3A 4HKQA 3JTPA 1HWLA 3OR1A 5J1NA 1SBRA 4XNFA 4YY3F 5F8NA 2ZUEA 2RUGA 2AHOB 4XK8C 4C48A 3NGUA 1KQKA 2CQ2A 3P6YC 3AH5A 3H5YA 2FDNA 4X64F 1WCMK 4CH1A 1SQGA 1TK8A 3KJVB 4ZMMA 1T9YA 4IUFA 3ZBTA 3H4DA 4JV5J 2GQQA 3V5RA 3MMBA 3GV7B 4ZDNA 4OIOA 3DLEB 2ZC3A 3H42A 2QEXS 4G7OA 1JJCB 3H5XA 3HVWA 1RTDA 1C1BB 4C8OA 4X4OA 2HIQA 1U8SA 4G6VB 3DCAA 3MM7B 3IR7B 3LH2S 1L0WA 4TKOB 1NU4A 1RBAA 3VAIA 1VGXA 1JNZB 1L3SA 2JEIA 3HOVC 1XR7A 2WCXA 4I64A 5GAHI 1TWGC 5IYDC 1R6YA 3W66A 3L9ZA 2F9JA 1SJRA 4NXNJ 3H0GC 4X6AC 2U1AA 3E01B 1RHUB 3GJRB 5L8RC 3SXLA 3ASSA 1RE1B 3CCUS 3DOKA 2BPOA 2ZL6A 1E62A 3T1YF 2MHNA 3FMWA 3W65A 5KFPA 2UUTA 4ZVTB 4ASUA 4I2PA 4TMZA 2DXEA 4K7QA 4TU8A 4LJMA 5A0YA 3RRKA 1IJFB 1IM6A 3DRPA 2CADA 4M5KA 3POTA 4U9RA 5FLXU 2D69A 4AXJA 1V5IB 2ADBA 2V9KA 2E1RA 1Y4ZB 2C77A 1R9TA 4F25A 4PR6A 1UKUA 2QC3A 2VV5A 1GEHA 4A3DC 1DAXA 1J6VA 2J76E 2E2JK 1KNZA 2R93K 4GO5X 4OHWA 2Q6IA 1VQMB 1FJ7A 2PEBA 1W2BB 4LR9A 1H2VZ 4J0QA 1APSA 4DEZA 3ASQA 1KBRA 3R6LB 4JV5F 2ZBVA 1OSDA 2ATLA 3GB0A 1I6JA 1HMVB 3DLHA 3DXJA 1VRTB 4OI2A 1RTIB 2OMLA 3S01A 3BSOA 4TLRA 1BX1A 2OHDA 4OJ1A 4FNIA 4J90A 2G2ZA 3GIRA 1WOOA 3G82B 4WCEQ 3CMAS 3MTKA 4LUBA 5E5NA 1W26A 5IV4A 1BWEA 3PUMA 3MM5B 2E2IK 2VUMA 1UEVA 4NXNF 3IR6B 2AZ3A 1MW7A 1XNQJ 2MQPA 4UZUA 5C3EK 2D3NA 3TAMA 3JSMB 3OTDA 1NB2A 2A69A 3CIMA 1DBDA 1EB0A 1XQIA 4A3IC 3I31A 2Z58B 2ZBRA 4K8RA 3GILA 2CQ1A 3FBBA 3OFFA 1PC5A 4I2QA 3S17K 1FRIA 3BSCA 1TKDA 3IS9B 3WIVA 3TZZA 2A6MA 3DXSX 1VDHA 4FM9A 2BOAA 3H98A 2VG7A 3CC2S 3C16A 2DGSA 2HMIA 1Z1ZA 1R0CB 3HFKA 5HQ8A 3KMQA 2M0GB 4NLQA 3ASRA 1CPZA 1RWMB 2JA6A 3KFWX 3LAMA 3Q24A 2J7KA 4HTJA 1QAIA 2VYQA 4MTPA 1RTHB 4Q0BB 2YQ3A 1OQ6A 3ZO7A 1B4AA 2VD3A 1HNVB 4WU3A 3KLGA 5LMNJ 1PKVA 3QJPA 3GFXA 4ED7A 3T41A 2CW5A 2ZKTA 3KLEB 2JNJA 4C8NA 5D4LA 2HWHA 1RTJB 2FLLA 3SYZA 1FK9A 2OSRA 1NPRA 4BWMA 2P5MA 5MLCV 3V4GA 1K28D 3ITHB 4QR0A 3GIMA 2MKCA 2HFZA 3ZNJ1 4M5DA 4CRJA 4JI5J 4BC7A 2MQMA 1ZXOA 5J2NB 2G1DA 3M2RA 5G0RA 3W9JA 5IP9C 4WFAQ 2DGOA 3W60A 2JEJA 3CW2A 4ZGNB 2ZHBA 1RUSA 1VQNS 4ILMA 2RVJA 1R0AB 1USOA 5IP7K 2H65B 2XCAA 3ULHA 2R7RA 2X1BA 4B3MJ 3A12A 3D0HE 1HBUB 4GKJF 4C6AA 1OGIA 1F2HA 3I56B 1M5SA 3OXLA 4X66J 1XE1A 3G4CA 3D66A 1VK8A 1FEHA 1YJVA 3AVVA 5LM7E 3C15B 1XEZA 1NRKA 1OJ4A 4Q2LA 3R27A 3F73A 3B82A 1U6ZA 1A0OB 1QVGR 2AJ1A 2J7WA 2LFVA 2V7TA 1S72S 5DQIA 2EFVA 1ZPVA 5KFYA 2GVZB 4PG4A 2M8DB 2XYHB 1CJVA 3OW7A 4YHBA 3H20A 4DV1F 3FCVA 2YNHB 4NASA 2H51B 4ZCMA 4NLDA 3ASPA 4RPBA 3LAKA 2BVNA 2PE3A 3ILOA 3J80U 5FD1A 5CCMA 1G7SA 4A3KK 2HNDA 3R6JA 1RHKB 4QYZJ 2H9ZA 2R92K 5LMNF 1VC5A 4CNZA 5HI7A 1VQ6B 3MEDB 1B2RA 4XLFA 2AHOA 1Q82D 1PYSB 5HMWA 4RJVA 4FPIA 4X2BA 2HHQA 1Y1WC 4OX9J 4C8MA 4RMFA 1Y0RA 2BW7A 2UUWA 1HFEL 3KJVA 1ROFA 3A35A 3D9BA 1XERA 1QFZA 1KLMA 2CZ9A 3P26A 4Z4RA 4QZVB 2LQ8A 2DR5A 4DL6A 1YSJA 1R5BA 1VQKB 3GTKK 1DCOA 5IM0A 2A0FB 3KUHA 1S12A 2VKRA 4Q2MA 2CF4A 1N8RD 2FHJD 4A8WA 2CIMA 4Y7NK 5HZAA 3MI7X 2FX3A 1QAJA 1MROA 4B3MF 3CCVS 4XLNA 3BGRB 3OVSA 1FE4A 3NBPA 4LR7A 4ZVQB 2VNIA 3I82A 1YJUA 3MPUB 4UOCA 5KFDA 3CDBA 1YI2S 4HHUA 2VKZG 2POKA 3H0GA 3CQZC 2K7JA 1NLKL 1BWVA 4DBQA 4YMEA 1BJTA 1TFWA 1N56A 3K59A 3M9MB 2ZUFA 4DPOA 5EGYA 4YB5A 4KB2A 4G7WA 3PYFA 3EZOA 1IJFA 4TSFA 5DRKA 4ZKAA 2HFOA 3HX9A 3UDEA 3EICA 2ZBUA 4TMTA 3ILJA 3M8PA 2DIVA 3MCOA 3OPKA 3VWSA 1BGWA 2YWEA 1AROP 1NB0A 4F4WA 3GTJC 2Y0SL 1YLOA 4K4WA 3AOCA 5DGBA 4OX9F 5L1JA 4C0HA 3QFTA 1NH7A 2DR8A 3AY0A 3THVA 1RWVB 3RGIA 4RNMA 1LWFB 1VRTA 3IAM9 2JRSA 2B7CA 4OZ1A 4KYZA 1YTYA 2HHVA 1AA1B 1R9TK 5KFBA 1D0EA 3OJUA 1S6OA 1N34J 3UN5A 3QSYA 4LK0A 4FXVA 1U1RA 1RLCL 3GFHA 1LWEA 4IKAA 2F7VA 1HPZA 1HHSA 1O6XA 1CJTB 1T05B 3G82A 2W8KA 5AXNA 2K1RB 3DOMB 3KLVA 2EWHA 4RDLA 4ZN3A 1WQGA 3EZ5A 1HR0J 3TOQA 2NVXC 3WC0A 2UXDF 3MR2A 3E3XA 1N5YB 4ECYA 3HK2A 2F4NA 1SKUB 3HOYC 2BA9A 4A3EC 4A3LK 4XDDA 2F8EX 3H5SA 2DXDA 4DWIA 4YAFA 1RAJA 4YAUA 4U96A 2N3LA 4NLWA 1RBOB 2JX2A 2Z57B 2CJ9A 2UXBF 2EG2A 2BQ3A 4PZVA 4H9GA 1A6LA 3LANA 2B4VA 1UD8A 2V4RA 3MZIA 4IG0B 2V4DA 5TR9A 3H8YA 1TWAA 3W2GA 2XGJA 2ZD1A 1QAYA 1WI8A 2RDDA 4Q0BA 5GAEI 4OI1A 4NZ6A 1WD6A 2HRTA 2LXIA 3ASTA 3V6KA 4B44A 4M5MA 4TYAA 2HVDA 4EZ6A 3MMLB 9RUBA 3KLEA 3AA9A 4RZRA 1VBZA 1ZZFA 3JQPA 2FUG9 5F3TA 5HMXA 3OP1A 3GFZA 4HH0A 3CAGA 2DD8S 4CNYA 1TL4A 2VQFJ 1FE0A 3ITHA 3ES9A 2IBOA 2W9CB 2DGVA 1O2BA 1F5AA 5T41A 4RNHA 5KFGA 1HARA 2JA6K 1O2FB 3UVJB 5J2NA 1O28A 2JEGA 2QN6B 1K47A 1N34F 1QUEA 4RPDA 8AT1B 2IYGA 3I9V9 4LF6F 3VR1A 4NCNA 5JJBA 5HL8A 4K50A 1IWAA 4MIWA 3JSBA 5M3MK 1KKHA 1YITS 4LVNP 4X62J 2WBMA 3KLHB 3DRYA 2QFJA 2MKHA 3QLHA 3R1LA 1RZMA 2VA3A 3FQLA 2MEWA 2IM3A 1FWLA 1X5TA 2MQOA 2DH8A 3CB4A 3QAUA 5DDOC 2MGZA 2AJ2A 1FWKA 1MU2A 1JLGA 1UPMB 3WBZA 3T02A 2FVGA 2GVZA 4NLOA 3HHEA 5F8MA 3EVOA 2WJYA 1E6VA 4MKYA 1IW7A 1MG7A 5LSOA 4N3NA 2HHUA 3AVWA 4WPAA 2Q3PA 1F3FA 2D3OR 2OFGX 3R7SB 4BCAA 1VJWA 4F2SA 1J98A 1R8AA 3MURP 1EJ7L 4R25A 3SMZA 5C5JA 3RB0A 5GMEA 3ZPNA 4RUAA 1SQEA 4OX7A 4ZPAA 4QWAA 2R8JA 1S57A 1OQ3A 3R2CJ 3US5A 1S1XA 1HBOB 1V9OA 3MEGA 4XONA 5A8AA 4TNOA 2E7WA 3S7RA 4B3OB 3GEIA 3HD2A 3KJNB 2VQFF 1WHVA 2NPFA 2EC2A 4C8YA 2V7XA 1S6PB 1OY6A 2F5GA 1HI8A 1JQWA 3WYAA 1N32J 3TA1A 2V7QA 4OMFG 4MQ9A 2QGGA 4EBCA 1GMVA 4B9LA 2JVRA 2OBSA 3NNCA 3EWGA 3OVBA 2AF6A 2D9PA 2P3MA 4P6QA 5HVHA 2NREA 3UO0A 4E0FA 2FPHX 1QSSA 3T19A 3HSDA 4X62F 1NM2A 1T03A 2WSFC 4UUXA 2PFFB 3M32B 1UWAA 4NWBA 4FKYA 1XXCA 4A48A 2PE8A 5HZBA 2VZLA 2CQBA 2F1FA 3IWLA 3RBZA 1RT7B 3AB2B 3RB6A 1YWXA 4KSEB 1GAWA 4ECQA 3HAGA 4BBSK 3S15K 1KDNA 4GQNA 2E5GA 2GS8A 4C3JC 2GSNA 4RD2A 4H4OA 3UR3C 1GQEA 2BJDA 1NK9A 3OZUA 2YWFA 2ZXHA 1KQGB 3T3FA 1IQTA 4PAAA 4RW9B 2V8DA 4FYVB 1INNA 2C4TA 4NPOA 4UQTA 2HLDA 4RW8B 4A3CK 4LIRA 3PO3C 2RGRA 5G4DA 2V7UA 2SXLA 4P7VA 1HWUA 3QFCA 1FDDA 3MFHA 4CT9A 4B3RF 1PO6A 3LO3A 4LBIA 2CPHA 1M1KT 4ZP7A 2GMJA 5J2MB 3SCIE 1R8HA 5B0EA 1NK4A 2Y1LB 2B4OA 1EQMA 2CRLA 2VPWB 3GTJA 1LWFA 3MM9B 1HQ2A 3CJ0A 1YIJB 5I3UB 2MY8A 3HLUA 4CH7A 4BXXC 4I6YA 2Q79A 4P2NA 1VFJA 2W4DA 2ZE2B 2QA1A 2B3TB 4WJ3M 1KOOA 3OBIA 2M5YA 3DC2A 1NB9A 3N01A 3OPFA 1Q86D 1F9HA 2VJVA 1FXDA 2ADCA 1IS1A 2NVXA 1JJ2R 3MD1A 4LF4F 3BBBA 3D6FB 4NLXA 2VG6B 2CRVA 2HKEA 4NYOA 1U49A 4F0HA 5H59A 4ATNA 5I3QA 1NK6A 3JB9k 3HF5A 3CJSA 2MKKA 1XMQF 2RD5C 2VOPA 4DL2A 2OKQA 3I55S 3M05A 3J7YU 1W34A 1QGYA 2PA8D 1C0TB 2EFPA 3OT9A 3EVWA 4FXWA 3UNGC 2C2MB 1HQUA 4CO1A 2BE2A 2F8HA 1TAUA 1WOSA 3TAPA 3OPOA 4WILA 5D0GA 1WTHD 4WZEA 2W2QP 1QVFB 4FDFA 1M5KC 4NEYA 3CCMB 1T6ZA 1S77D 1IM4A 1X60A 1RT5B 3CJ5A 3CJ2A 2I6WA 4PUOB 4RO0A 2W9CA 1TWAK 2OPQB 5ETTA 4ILLA 2QN6A 3A8EA 4ZS6A 2X0KA 4URSA 4M0LA 2YPYA 1ZM2A 1X4FA 3R5DA 1K8AT 3CGIA 1M1GA 3HD1A 2RC6A 2B63C 1RA7A 2X1GA 5KT2A 3CCSS 2GSUA 5HBMB 1KQ4A 1KP6A 3A1YG 5DGAA 2ZKUA 4ED3A 4DR4F 3KLHA 3O8WA 4O3NA 2WSSA 1SM4A 4IO9Q 2HDNB 2XHWA 2BE5A 4OJGA 3S1MC 5K8PA 4OHZA 1Q0NA 5K14B 3BC9A 1O26A 2K3IA 4NXMF 3V4IB 2YWWA 2VICA 4DPWA 1AUDA 4KY3A 1Z4UA 1FVQA 1TLLA 4TN2A 3ZZ0A 4K1XA 3RAMA 1F5BA 1WOPA 4DR7J 3ISND 3TYTA 3HOWC 2O3DA 1KC8D 2VJJA 5L1KA 3D0GE 5EWGA 4IQMA 5H9FK 2UUCJ 3HKWA 1KQSR 3TEGA 2A6OA 3SCKE 1NJXA 2FHOB 3OFNA 3N0BA 4Z4UA 3UN2A 5E41A 3NEKA 2XTJP 2BOPA 4X4VA 2ZL5A 4KDDA 3HZEA 2VUGA 2YKPA 1EXMA 4IH5A 3TJAA 1EFRA 1U47A 3GTLK 3AQPA 1TKTB 3W5VA 2ZDOA 2YBVA 5CHCB 1IJEA 3TX8A 4KM8A 3Q8UA 1RCOB 5A8RB 1XZQB 3OV7A 2FVSA 1TR0A 4DV0J 2AYEA 1HQEA 1UW4A 3LGMA 1OYEA 4WZKA 2VFVA 2MKIA 3AJDA 1O8BA 1F5CA 4NLUA 5F41A 1QLNA 3S2DC 3DU5A 4J9LA 2BN4A 1BHNA 3NP5A 3M8YA 5J1EB 2MQQA 2OAUA 3MR6A 4O4GB 1I6HK 2CQ3A 5L9XA 1S0NA 2Q1LA 1XZPB 1SKYB 3WBJA 3M2UB 3NUHA 1VQPS 3GWCA 2QO3A 1SV5B 5DETA 1R6VA 3C3LA 1F93A 5K20B 2NXNA 1FKPB 3FNNA 1HQMA 2L9DA 2Y1JA 1M5OC 2A2DA 1GFWB 1ITPA 4DR5F 3L7UA 4DLEA 1ULRA 3GDZA 1TMMA 3EX7B 1XR5A 2DNKA 3UQSA 2WVFA 3RB4A 3ZC4A 2RE1A 3SKBA 4RD6A 4A3MC 3GTPK 2RSQA 5J3OA 4ZIWA 5CZVA 3I0RB 4DR7F 1HZEA 4RW9A 3B6BA 4MAKA 4I7FB 1YG0A 5L1IA 5GAGU 3JQRA 1WTBA 3WQZA 4YAWA 4RW8A 1U1OA 4K4SA 2IMOA 2UUCF 1YVFA 4X7EA 5IWAJ 2RNEA 1NKCA 2KXHA 4R8UA 2QEXB 4P12A 2UV8G 3WDOA 3OZWA 5KFQA 2XY5A 5D0EA 1U1NA 3BBCA 3J7ZT 2LXUA 1WF0A 1VI7A 5J2MA 2MZTA 3IFEA 4EBDA 1VBXA 1JQGA 5C44K 4JBCA 3I4NC 2ZH6A 5GADU 1EP3B 4ZP6A 3MM9A 1CULA 4HE6A 3ZNUA 2XLKA 2Z8QA 2CVEA 2XCPA 2K06A 1Z2ZA 2CDQA 3DRRB 5F8LA 1FX2A 4NEZA 4PQUB 4X05A 2V8PA 1QFYA 2KM8C 1F60B 4FK8A 3KUGA 3ISZA 1SC6A 3UD3P 3HJVA 4GVBB 4KH1B 1H72C 5L9NA 2BM0A 2RILA 5AE3A 2KM8B 2BGJA 3SFUA 1NHKL 3P8BB 4K2JA 4LR2A 4MEYA 4Q5VA 5GMDA 4LF7J 5B6IA 2GNKA 3GEHA 1UD6A 3M8WA 2VG6A 2RMLA 1U26A 3MEEB 4O3SA 1EP1B 3K8VA 3G8QA 5DSZA 1QDUB 4QWEA 3GMGA 2RRNA 4KKTA 4WP8A 2M8HA 5K5MA 2EK6A 2V2ZA 5D77A 2VFTA 3EXCX 2FIUA 1B0PA 3OTOF 1Q5YA 2FVPA 1N88A 1C0AA 1IBLJ 3G4SS 3SEJA 2E29A 1J2VA 5KG6A 4ZCIA 1W2BR 2OH2A 2AD9A 1C0TA 2DXFA 4A8KA 1VQOB 5DQHA 2P8TA 5IWAF 3ADAC 1VQ7S 4KN4A 1Q9SA 2CWXA 1E6YA 4QIGA 3CCWA 1GTEA 3FKBA 2WTFA 4RWWA 2D3LA 2HBYB 1WORA 2MY7A 4FBUA 3OUYB 3QFHA 3G8TA 3D26A 1S1WA 5CJ9A 1GE9A 2NZ4A 3ENAA 3HXMA 4PXCA 5L38A 2OPPA 2W9BB 3LPYA 4Y28C 4A3BK 1RT5A 1ZAWA 4IG3B 2KFZA 4OYXA 4Q43A 4GMKA 2BKPA 4XAKA 2V67A 4NLGA 4PUOA 3OL6A 1TL1A 1BQNB 2IPOB 1LQ9A 1G1XA 2Q6LA 3BR9A 2ZZGA 2VFUA 1OWXA 1LFWA 2OPQA 4QR2A 3FPKA 4O2DA 4ZVRB 2VBUA 3UI3A 4HACA 1GXTA 4NLYA 4ZK7M 1HVXA 2V8VA 1DFDA 4FVMA 1I3QC 3BP8C 4J91A 1MWZA 3OTCA 4YR3A 5HBMA 4XCHA 4KPCA 5IOQA 4ZP8A 3IO1A 5IYPA 1UETA 1T3OA 2QZ8A 1TK5A 1M1HA 2B63A 1FRJA 5DN6A 3CD6S 3NAIA 4DQIA 4LF7F 4OPSA 2MZJA 2BE7D 5IYBC 3V4IA 4AF7A 2IYIA 3I5BA 4CM2A 3LQ6A 1ZM3A 2X3UA 4F3QA 1TU0B 3ENVA 4QIFA 2IVYA 2XLJA 1IBLF 3AA8A 3T1HF 2WYRA 4YALA 4OZ0A 3L95X 2DNNA 1N5SA 4WZMA 1L3VA 3N6NA 1HD0A 2ZITA 3JQMA 3A8IA 2QT7A 3I96A 1JB9A 1UP1A 4CYUB 5IS2A 4OV1A 1BQMB 1REVB 5C4XC 2DNPA 4K59A 1OS5A 5JVGQ 1W35A 2GJFA 2DNZA 2YXLA 2YNIB 1WF2A 2PDAA 2PPBA 4DU8A 1QFJA 2KN4A 2GA7A 3SQGA 4RL1A 3A8KA 2BJ7A 3RRGA 2ZH8A 1Q8BA 2DO4A 4FXUA 3KK1A 3QT6A 1YJWB 1HIYA 1SKSA 3LOUA 1VQNB 3KJQB 4A46A 1JK9B 4RU2A 3LP1B 2RUSA 5KT5A 2ASDA 3HJFA 2W2PP 4OV6A 2BMBA 3OLAA 2DJWA 3H9NA 4A8OA 4ZJLA 4NZ7A 1DARA 1JXLA 2C3UA 4C8KA 2C2NA 4ZIVA 4DR1F 2DNGA 2HCJB 3TEHB 3S6EA 3TFIA 1NBEB 3GG1A 2W9AA 4HT5A 3WIUA 4QW8A 1XZPA 2EFQA 4MFBA 1GH8A 3CJKA 4IFYA 1Y3KA 2JDJA 3K5MA 4J9SA 4ANCA 2E7VA 1WNEA 1FKPA 2VBTA 1IKXB 3LP0A 4F2RA 2QA2A 2J6UA 2QA4S 4LT6A 1PCAA 4X4NA 1I3OB 3BO4A 1GMWD 1CLFA 1U7LA 3DOLB 2EXUA 2EIXA 2FVQA 4CP5A 3OTEA 1TWFA 1QD1A 2D74A 1WC1A 1UFKA 4I7FA 3R3TA 1NAQA 1U1MA 1A7GE 5CA5A 3IWNC 3GTQC 4FPRA 3HVTA 3MM8B 1XB2A 2F4VJ 2X1FA 2FZGB 1HYSB 2D7SA 2BW2A 3F44A 4LBVA 2QRRA 1N07A 2DNMA 4S0MA 3V2UC 4KE5A 1TL7A 1HA1A 1JLFB 3HKZD 2DNYA 3CRZA 3T6JA 3I4MC 2ZH2A 2C3YA 3HM9A 3ZTOA 1HNIB 3QX3A 1SVDA 2XZOA 3GLJA 3QIPB 4QVAA 3Q3QA 2GJPA 1N6QB 1DG1G 2G0IA 1U2RA 4EH1A 3FJOA 3DRRA 2P6SA 3GIJA 4PQUA 3LO8A 4FYDA 3CPXA 3SSQA 1FHTA 3PRDA 3HFZB 3W8PA 5GMKa 7AT1B 2BXJA 2IAJA 2ZWOA 4ZHRA 5CAAA 3PRBA 2IC3B 1YI2B 1X0PA 4OJHA 5D0RA 3QGIA 2NZCA 2OPSB 2O5IA 2FGCA 3M3YK 2VJUA 3LWMA 2XNRA 4RW6B 1H7WA 1U02A 1S0MA 1S6QA 4HTIA 3M6UA 1OYDA 2LQJA 4Y65A 3WBKA 1QUPA 4JB8B 3PW0A 4J37A 2VPXB 4OLPA 3OLBA 5E3CA 3LQVA 1I8DA 1R43A 3MEEA 2XI2A 1D2EA 2LXFA 3H7HB 1P1TA 4B47A 2CWKA 4YB6A 4A3GK 2DNLA 4F50A 4TMVA 3C14B 4OPVA 2R7ZC 4PC1A 1HBMA 3SLNA 1S4FA 1GNKA 2DOGA 3H2LA 1T6XA 1H2UX 1RGVA 1NSAA 4JV1A 2NVYC 5F8JA 2AX0A 3W2WA 3S1QK 2CPYA 1NEEA 4JI2J 4XLCA 1UVIA 1WG5A 3CCQS 1C2PA 2H4WB 3RW6A 1S79A 1VQYA 4HHHA 1ISEA 2W9BA 4KIAA 4IG3A 4LF1A 1UD3A 1BS2A 1FXRA 4Z4WA 2G13A 3GJSB 4ER8A 3CNQP 1MN9A 1ZTWA 4F4ZA 3G6EB 1SB6A 1CSJA 2ZBPA 3Q2SC 1S1TA 1ELOA 4I6WA 1DZ5A 4C8ZA 5IT0A 2YWGA 3RZDK 4RX6A 1J6XA 1UJ6A 1VHEA 2C4UA 4USVA 1CJUB 3QO9A 4BLGA 2MQLA 3BZQA 3K2YA 5IFMA 4A8QA 3LQEA 4KHMA 1Q16B 3N79A 4IFVB 3VAKA 3KWMA 2HGNA 5F0WA 1YJ7A 3EMTA 1IQ0A 5M5YK 5ETPA 2JSXA 3GTGC 1RT6A 1H73A 3D7SB 2XZPA 1X4GA 3PA2A 4F0MA 2FVRA 1KTVA 4JI0J 1ZH5A 4ES1A 4DFJA 2R7VA 4ELVA 1CEZA 4DS5A 1NXIA 5FJ8K 2E2HA 1WHXA 1SH2A 1Q8LA 1FJGF 2EKNA 5F4MA 4Q4ZA 5GVQA 1FNXH 2CJKA 2QLWA 4LLGA 4DK0A 1ZETA 3MAAA 1IHMA 4ETXA 4FNHA 1HWJA 1K83K 2GREA 2ABYA 4GTDA 2OTJS 3B78A 4Y2IA 2KZMA 2CNDA 5A89A 1DHMA 4FZVA 2UXCJ 2G2YA 2R7QA 4KHRA 1U48A 2GHWA 4J9MA 4AXIA 2RC5A 2V4JB 4JI2F 2DTJA 2HBZB 2XSJB 2R7UA 1K44A 1K0VA 4GKKJ 2YTCA 1R0BG 2X3DA 3GVJA 4FF3A 1S4EA 3GONA 1R5NA 4E0DA 2HG4A 2KT2A 2XHCA 3EJMA 1RAFB 1M1KD 2OK8A 2DR6A 1S1VA 1FKAF 3TFHA 1PILA 3D3BJ 3R1HA 2W01A 2UVVA 2HVIA 3CMMA 4WWSA 2W1BA 4ZV4A 1OPIA 4OYIA 4LBWA 3HHDA 4D3HA 1K1QA 4C0SA 3DGPB 1SJ4P 2DY1A 1FTRA 4M5HA 4ZVHA 1GX5A 4NYZA 4A93C 1M0SA 3W5XA 1WKLA 4XLHA 3KEWA 3VO1A 3HOUK 1RHQB 4TQRA 4XLAA 1EKSA 2RRBA 1IL2A 2YU9A 7FDRA 3ZZOA 3M8RA 2O01C 2D3ZA 1RXOB 2AYBA 5KSWB 2BSAA 3D4JA 3I4PA 5H9EJ 4B02A 1WCMC 4KM9A 3DOLA 4WFBQ 4M4SA 4YHHJ 3CTAA 1UD2A 1XMOJ 1RDRA 2A6HA 5LXRA 2BX6A 5ETRA 2R9VA 2XWXA 2Q6BA 3TVYA 2H5IB 2VC1A 2HNYB 2UXCF 3PYGA 5KG1A 5E7OB 1J27A 2FJAB 4GVLA 3GTQA 2ZEJA 3KK3B 4MIAA 1JLFA 4GZYA 4M8LA 1N33F 2CJXB 2HIYA 1HNIA 2IM1A 4G7XA 2XOKA 1XJWB 4F4KA 1TWFK 4RW4B 1AIPA 5AE1A 3QIPA 1YBUA 3GQBA 4OIPA 3EUNA 2ZC4A 3DLJA 2HHWA 3EDQB 1URNA 3AFGA 3CTRA 3SV4A 4RD0A 2DISA 5KFLA 4ZPDA 5DQGA 2GVDA 2IC3A 1PYOB 2AIRB 3CCLS 1WJ9A 3H25A 3VAMA 2CJAA 2GO9A 4KAWX 4LF2A 1EFTA 2OPSA 4RW6A 1IXKA 5FIIA 3PHTA 2RF2B 4WK3A 1UJ5A 4OYBA 3PXGa 1FF2A 1SKRA 2IDEA 3DI6A 1K8AD 4YQWA 1RWUA 1TWCC 3G4AA 5AT1B 2K2PA 4YFUA 4QHYA 2VC0A 2PI4A 1NSPA 2PMZD 3OFEA 5KFSA 5MAOA 2KG0A 3PENA 1Y7PA 1U25A 1X5SA 4ETZA 4LR8A 2E2JC 3EQLA 2OIHA 2R93C 4LFBJ 2WBRA 2X7IA 1JJ4A 4WYLA 1TWHK 2YX4A 1X8DA 1MABA 1U0HA 4A8MP 3IN5A 2LEBA 3UPFA 4QU6A 1NNDA 1JVIA 4LRDA 1Q82T 2R7ZA 3CO9A 3OSNA 2RQ4A 2LEAA 4QVJA 5IYWA 1C1CB 2FJWA 3NKYA 3VAHA 3X3UA 3IMQJ 4PC6A 4RDJA 4E8UA 2NVYA 2CXEA 2G4BA 1LW2B 1WSRA 2E2IC 4CLKA 4QWCA 3AXKA 3IC1A 5C3EC 2XZLA 2ZZMA 3K8WA 2HMAA 5ETSA 3GYGA 1U0SA 4PG7A 2RKIB 2O5JA 2ZZEA 3BV8A 2WONB 2BBEA 3DLGA 1ZOTA 4P25A 3Q8PB 4ENOA 5TRDA 2O66A 3S17C 4C0OC 5DZ6A 1WF1A 2J0XA 3SBMA 1KJZA 3CC7S 3PIPQ 2HVHA 4IFVA 4RW7A 5HP1A 1DDIA 4KGKA 5DG8A 4AT1B 2ERRA 5KFMA 3QJJA 2ZUGA 1FCAA 2I38A 2V2KA 1PG5B 4HLBA 3HT0A 1LW0B 2YH1A 4NCBA 5HKKA 3I55B 5A8WB 1HNZJ 5LL6d 1O0PA 5J35A 1C4AA 4E98A 1DCPA 2W4CA 4DQKA 3U02A 2R8KA 4C3KA 1NDLA 3E51A 3DM2B 4LF5F 1QVFR 3TAQA 3E20A 2JA7K 2JA8K 1S9GB 2YNFB 2GQ2A 4J9KA 1RHRB 4KPYA 2E2HK 2JA5A 2VQEJ 2R4FA 1X31C 2CJYB 3P49B 1Q79A 5IP7C 4WJ4A 2FHJA 5ADZA 1IKYA 2NXJA 4XKVA 5F8GA 2PO4A 3CCSB 2NSCA 3KNGA 4CO0A 2RS8A 1DTQB 2DGWA 1E79A 4I6AA 2R2SA 3MM6B 4OP7A 5THWA 3IA0A 1FDAA 2KYXA 1XK8A 3T00A 4P2XA 4MK9A 3U1LA 3W8GA 4IRKA 3DGPA 3HHKA 2W2NP 4XKWA 2BABA 4TXSA 3C6TB 2XMKA 2F1LA 4ANDA 1TUIA 4A3KC 1E64A 1XWLA 1XXBA 2UU9F 4MT1A 3TUPA 4PXEA 5HMZA 2A18A 1IR1A 3AD9C 2KRRA 2R92C 1HNZF 3NRBA 2WOMA 2JLGA 5DLGA 3MD3A 1QUVA 3ENQA 4DSLA 4OL8A 2D3UA 4RBVA 5IYCK 3CWJA 3NS7B 1OMSA 2XO7A 2VNJA 3W5UA 3FBEA 2GGPA 4KKSA 1N05A 5CD4H 4OYOA 1F7UA 3LW5C 3KTQA 3FMBA 1WCMA 3GTKC 1GT8A 2HNYA 3BY1A 1V6HA 1U4BA 3CPWR 2YU9K 2VQEF 3MF5A 1HNWJ 2HRYA 2AJ4A 3P45B 4Z4VA 2C5BA 4Y7NC 1QGAA 1YNJA 3J81k 3OR1B 3A3OB 4RW4A 2J9DE 3ZFVA 2XNJA 3IGVA 1FRKA 1H85A 4PCQA 3LPXA 4USHA 1XXAA 5AN9A 2OELA 4BLAA 4OI0A 2JVOA 5BR8J 4C3HK 5TJ3A 1N5QA 5K9FA 3K89A 4OZ2A 3CXCB 3MMBB 4NCGA 3KXDA 1ZQ1C 4Q45A 5A8KA 4OHVA 5ITHA 1RTDB 2JZ5A 1JJHA 3DGVA 3OAAA 4EMDA 1FDRA 3TQ1A 3PA1A 2V7WA 1N0UA 4WIIA 3MFIA 3R2DJ 1UL3A 3AJ1A 3T1AA 3ILIA 3W63A 1O51A 1FX0A 4USMA 4J9VA 3G71S 2FVCA 2B9WA 2ROEA 3KG1A 1VHOA 1Q7YT 1GAQA 5GV8A 1WTFA 2V34A 3HOZK 1AYEA 4IRDA 4P2FA 3TJ8A 3TQEA 3DOKB 4B9TA 4DS4A 2C2RA 1YJ9S 3ZZRA 4I2PB 2ZZFA 5FO1A 1HHTP 3BCDA 4KFBB 4Q7AA 3D1QA 4WZQA 4M63A 3ZIAA 3CULA 1F9EB 3S2HK 2XLIA 1R9TC 1YHQB 3DRPB 2CPZA 2HK2A 1HNWF 2FJDB 2AGQA 3TTGA 1XIQA 4OQJA 2MZSA 5KG4A 5DG7A 4USWA 1LW2A 3LGNA 1NJYA 4EEYA 1Z2LA 4ZP9A 4KB4A 3ONYA 4NRUA 1UWBA 1RAAB 2ASYA 2LMIA 4Y7CA 4P2MA 1FRNA 2XULA 3Q89A 4A3LC 5B0GA 2WONA 2ZJPQ 5AJ3F 4B3TF 4LSNA 2QLJB 4XDCA 3CP8A 5KTQA 2R7SA 4KC6A 2XCOA 2H1YA 2CZVC 3ISNC 4ZLJA 4WIQA 3PY8A 2QLXA 4USIA 3HVAA 3ONUA 5F9LA 1RYSA 2HGMA 5B08A 3EGZA 1TVCA 1VHFA 2GK7A 2MLYA 3NXZA 3W61A 1S1UA 3Q39A 4G65A 4L74A 3V6DB 1R8PA 3BO3A 2R6HA 1EARA 4AL5A 1RT1A 2GIFA 4A3FK 2B9YA 1IB0A 3TAMB 1TP7A 1JLBA 3PG9A 1KHVA 4X7CA 4XL9A 2HK3A 1BPLA 2VL1A 1R8CA 4AF6A 2DCUB 2UUBJ 3W2IA 2WPDA 6FDRA 2AJ0A 3CJQA 2JA6C 1S9GA 1AMOA 2Z2MA 2YNFA 5GV7A 1V3RA 1D8YA 1Q8KA 4M95A 1S59A 2VG7B 3GQCA 2HMIB 1UD4A 2ZNYA 1FTCA 1X0FA 3DRSB 4Q5SA 3FGVA 4A8YA 3CMQA 3U6KA 4G1QA 4UW2A 1Q8IA 1UA1A 2Q43A 3PRVA 4DR6J 3FCWA 2V8HA 1RWOB 2XQCA 4X7DA 1XNRF 4JI8J 1RT4A 3IG1A 2B4UA 4QYRA 4TY8A 1FK9B 2HWTA 4ED1A 3BUEA 1DTQA 3C6UA 2OYNA 4CLZA 1SIWB 3W2FA 4PC7A 2JA5K 3CW2C 1VQLB 4R0JA 5BYQA 2I1RA 4W98A 4AFFA 1T9XA 3J7Z5 2M7SA 3QAEA 5G0RB 1NSKL 1TUWA 2XS7A 1UFWA 2R7OA 5KFTA 4EZ9A 1SKQA 1X9MA 4JI6J 1Q86T 2XZDB 3PTWA 1OB5A 4MMOA 4PPZA 1L3UA 2YVSA 3FPPA 2EBBA 1KZLA 3LUYA 2BV3A 3N5FA 2D9RA 2GJIA 1E1RA 3SIPB 1TAQA 4AL6A 4ZVOB 3MGJA 4I69A 5EMNA 4OPOA 1EKRA 1OHHA 2R92A 3IGNA 3R9LA 3T1YJ 2UUBF 2IIHA 4NL5A 4Y52K 3L4JA 4N41A 2QJ3A 4P6VF 1RWPB 1SJ3P 4IR1A 1DLOA 4YFNA 1Y3JA 3HSJA 3RAQA 1GK8A 3AVYA 3UD5A 2QMXA 2CZ4A 1F1BB 2RDIA 2OLWA 4LSLB 4X84A 2HNDB 5CCLA 3GTKA 2ALZA 3B4MA 3ISXA 4DX7A 2C78A 2K3KA 3G87A 2HURA 4P75A 3JS9A 5IZHA 4DR6F 1VQMS 4JI8F 2CQHA 2B7BB 1NH8A 5IXUA 3DYAA 4WQMA 2Y8YA 4HH1A 1QTMA 1KLMB 2DNHA 3S15C 1OO0B 1XFOA 1NKEA 2KDOA 1K73T 5CYJA 4H54A 2CQ0A 2QIFA 3L4BC 1NKBA 5IM0B 4KJIA 1UMKA 3EGVA 4OI3A 2QE5A 4JI6F 4HHJA 1TV6B 1CG2A 1Q78A 2X1AA 3GIIA 1H7XA 2V2VA 3CDWA 4A3CC 4G5GA 4DV6F 1MROB 4KKUA 3E8OA 3THPA 2V9WA 3DMJB 1B64A 3NBPB 5CD4A 3HSGA 1Y0HA 2G2OA 3NWRA 1O24A 2ZBCA 1HNXJ 2M52A 5KFFA 4RUHA 1RA6A 3FSXA 1UVLA 4DX6A 3PR4A 2ILZA 3GCWP 3CJ8A 4J5OA 3M8ZA 3R97A 4KASA 5DJBA 4DMZA 1KC8T 3KHRA 1P1LA 4DV5J 3WX4A 4KFBA 4TMXA 2HWIA 3MHYA 4WYWA 1V0EA 2L08A 2X8KA 5K8OA 5KG3A 1XC9A 3BH6B 4C3MA 3NCQA 3PIOQ 2ZH9A 3EM1A 3M1VB 3SSRA 4MH8A 2PIAA 3P96A 1Q7LB 4Z7YA 2QTZA 2MTLA 4P5AA 4U7UD 2M70A 3M8PB 3MXHP 4K0KF 3P5TL 1VRQC 1H2TZ 4BWJA 2MMYA 3FZ2A 1S7HA 1EETA 3Q0AA 1F3VA 3O5TB 3HOXK 3KHHA 4QFMA 4BY1K 2ZBIA 1IBCB 5FDLA 3SDEB 1N54B 1V3ZA 4KR0B 1FT8A 4XPEA 2DK2A 4N47A 2DETA 1I1GA 2B7CB 3WNBA 5BSYA 2XMWA 4JOUA 4UOGA 3QSYB 3WXMA 2RH3A 3ZUGA 3ERED 1LWEB 2LCWA 1HPZB 3J81j 5FLMC 1PBAA 5RUBA 4XOPA 4Z7CA 2DB1A 2XGQA 2HQ3A 3V6DA 1H74A 2FQTA 1NHVA 3QT8A 2DO0A 2ILYA 3GZ7A 3I56S 2W7OA 4FN5A 1N52B 1YBTA 1R89A 4KATA 2N3OA 3K7AK 4GKJJ 2EEYA 2R7XA 4C8LA 1HNXF 4NLVA 2WSEC 4IR9A 1QVGB 3FEXB 2AQ4A 1LWCA 5JXSA 3CVKA 3R6KA 1SQFA 2QV6A 3IBFB 4X0CA 1ICEB 3JAMY 5CZXA 1FA0A 4PWWA 3KK2A 2DCUA 4YOEA 4I0WA 2IBKA 4DV5F 3CCQB 5LSRA 4RJLA 1UZDA 4RBTA 1TWAC 1UTAA 4JI7J 3A3PB 4RUBA 3PM9A 4PWDA 4UTGA 3T51B 4DV1J 1LV5A 1L3KA 2W4PA 4XD7A 5L39A 4EUVA 4C7QA 4TT3A 1GO2A 4PG8A 3DRSA 4DR3F 3MMJA 2C2ZB 2ZD1B 4U95A 4UF4A 1VCTA 2XEXA 3MMAB 4B9NA 2J9EA 4AH6A 1A8PA 1YRXA 1T9UA 2HNZB 3T9ZA 1SPBP 3OXFA 2CW0A 3S0XA 1GXUA 4USJC 4II3A 2APOA 3MMPA 3RRHA 1RKJA 3RR8A 2AJFE 4J9PA 2JC0A 1YZ6A 1N4LA 1VQKS 2PGCA 2HQDA 4IDKB 4IW3B 3L7PA 2PMZL 5D4DA 2ZH5A 2HHXA 4WE1A 3SLDA 4A3JK 3TP2A 4M2LA 2DGXA 1QE1A 2E66A 3R6GB 4YS2A 4LFCJ 1UZHA 1DQAA 3HHNB 3WZ0A 1I5OB 1I7PA 4DCPB 2L9NA 3OR2A 1IBAA 3RYLA 1E63A 4F67A 4QPXA 3U2QA 2CJQA 3QLHB 5T7LA 2RDJA 5D6GA 1Y1VA 3VHQA 1RWNB 2J0QD 3GTLC 1UEUA 4NOHA 1A9NB 4DG1B 5ETKA 2HS0A 2J0WA 1G2EA 4M5LA 2MGZB 1MU2B 1L5UA 1JLGB 1AFJA 4JI7F 4RPFA 4YDDB 4Y9UA 3TZXA 1E6VB 4Y2KA 4LSLA 2A6EA 3FRZA 4LRFA 2PSZA 1V5VA 1UFLA 4NZ0A 3VO2A 2LEPA 4LFAJ 2KXNB 3Q22A 2NS1B 4DPUA 1I6HC 2Z56B 2ZZQA 4J9UE 3U1NA 2ZWPA 2IM2A 2AYMA 2JH3A 2E1AA 2B7BA 1S1XB 3D67A 3MEGB 3GU0A 1RWXB 2B5OA 3RZAA 1KEKA 4QUZA 2ZBQA 3BN7A 4WF9Q 1T3NA 4DQLA 2NUUG 2HQCA 3HMJG 3NNHA 2LU2A 5KG2A 2MKJA 3MEKA 1HWKA 1F6TA 2VDHA 4CQJA 1AB8A 3UW1A 4LF8F 3GTPC 2XCRB 1I50K 4U9UA 4ZPTR 3MCAA 5CDFA 4WBFA 3W2EA 2PI5A 1TV6A 1VYAA 1IR0A 2WB4A 5KFEA 4LFCF 2VFRA 2UXDJ 4ES3A 3DMJA 1T03B 1FNOA 5EN1A 3A4TA 4PQAA 1T0TV 1YLXA 3PKMA 3UD4P 4YN3B 2CG4A 4ID5B 4RLEA 2FHMA 2IMWP 2ZNZA 1X4CA 4KB7A 3P4UB 1HKAA 2RQCA 5C7PA 4MEXA 2RU3A 3VV2B 5C44C 5DDPC 3CC4S 4G3IA 4P74A 1UVJA 5L46A 3K17A 1WEXA 2UXBJ 4H4OB 3E2EA 1JA1A 4DU7A 4PRFA 5ETNA 4IOAQ 1M90D 3OHBA 4EYIB 5KOXA 3M1VA 3VGTA 2AX1A 1P8GA 4LFAF 4ECUA 4TQSA 3FRYA 2Y3PA 2OTLB 4ZPBA 3A3NB 2UVUA 3M4OC 3ZTQA 3CCLB 4P71A 5KW9A 3M30A 4X4SA 4OHYA 1VJSA 2XY7A 1CNEA 5E6TA 3SDEA 1EFUA 2DEJA 4HDGA 2JDIA 2AMCB 4B08A 3E1YE 3Q8SB 3PVDA 3D68A 3Q83A 1KHWA 3HFVA 1Q53A 4QIVA 2W8LA 4ERDA 4LF6J 3Q8YA 3PR5B 4L8JA 5IT9Y 4KMHA 3CDUA 1YRTA 1D9DA 2MSTA 1RWKB 3FFIB 1SUQB 1I3QK 4PWUA 3VCDA 2V6UA 2Z2YB 4NLRA 4JMQA 1WC5A 4ZPVR 3IM9A 4DZ6A 4DFMA 3MDFA 2GMHA 3ICLA 2FY1A 3V4MA 2E5HA 5A2QU 4ZA1A 1TFYA 4GT9A 5C25B 4B3SJ 3S14K 4A3BC 5B0BA 5IK2A 1LK5A 2KH9A 1IUJA 4PEOA 3CSKA 1S5ZA 5IOLA 1NPPA 1NK5A 3N3YA 1M5VC 2PMDA 3FKIA 2KI2A 4DSJA 5TMCA 1S97A 4DPYA 1O29A 2CQGA 3I87A 3W5YA 1VIXA 2OP5A 4NLTA 4MK8A 2RH6A 4Y3CA 4OX6A 2KHCA 3R5AA 3CUNA 1HQUB 3V6JA 5CYMA 2BE2B 2HFUA 3OEEA 2KWAA 3MMAA 1AZSA 3I5CA 2HHTA 3T5HA 1DTTA 2HHHF 2HNZA 2X3GA 2A1BA 5EDWA 1T94A 4UY85 3BQ0A 3AAWB 3T5JA 3QFRA 4CTAB 4R71A 2OEKA 4OJ3A 4DUYJ 3IRWP 1K0TA 1PAEX 3G6VA 3D28A 2YKOA 3SJPA 3B54A 3KLIB 2W24A 2ZM6F 3PZPA 4IDKA 4K4VA 1FDNA 2OJ3A 4B43A 3CO0P 4AYBD 2ATCB 1FERA 2BEFA 3GSDA 4GRSA 3LP2A 3BCFA 4URQU 1QG0A 4LMZA 1H6KX 1G51A 3DNCA 1GMWA 3VVUA 4NRTA 3DHWC 2CFAB 2EKYA 2E9TA 4X65J 1VBKA 2EG1A 2CG8A 1RT2A 4Z4YA 1G4CA 1RADB 2BRKA 4ZLLA 3NMAA 1WC6A 2QLBB 2O67A 4Y00A 4B3SF 1JXEA 2PC6A 2HQGA 4DG1A 3W5ZA 4U8VA 5KFUA 2V69A 5C24A 2ZOFA 5KFZA 1RSCA 1EP2B 1GR1A 1Q7YD 2QL9B 4RD4A 2F8MA 3GTLA 2IVMA 3CJRA 4ELUA 4W4MA 2ZXIA 4EGLA 4TMWA 2AEJA 5TV2A 2QE7A 2MQ8A 2FQQB 2XNCA 3H40A 1Y1VK 1B70B 4TU9A 4F0KA 3FBFA 3N0CA 3MPVA 4HIZA 3UE2A 3BGFA 3H59A 3ZZPA 4EWTA 2H5JB 4IOCQ 3BKFA 4B3RJ 2DY9A 3GEEA 2F1MA 3AOAA 2ZTGA 2PD1A 3AHPA 4X4RA 2E1PA 4DUYF 3OL8A 5EWEA 3OVAA 2QX0A 3UWTA 3C8YA 5D3GB 2KL8A 3LWLA 1IJEB 4L72B 3BPSP 3H3VD 4L3NA 2Z4PA 3AGQA 4K5RA 2QG9B 1JLCB 1HQEB 1JLAB 3DDIA 4UZBA 5A6WA 2WRMA 2CA9A 5M2RA 2GIRA 4A8FA 5C2CA 2RS2A 2DNOA 2Y1IA 1QSYA 4IOBA 2GHPA 3GTPA 2NSBA 4LBHA 3ELHA 5A6PA 5C42A 1WKKA 4X65F 1JJ2B 4BHQA 2KTQA 1USMA 4F36A 1HL6A 1G7CA 2YKMB 4P10A 5EX3A 1RU1A 4L73A 3EPGA 1XQBA 1CS4A 4ID5A 1R31A 4LF4J 3PNIA 4GC6A 2OPRA 4GTCA 4KARA 5HJYA 1W87A 1VLYA 1TTHB 5KFJA 1R3NA 3BM7A 3WHIA 1VHIA 3QIDA 3GTOK 4X7FA 4DOZA 2XMTA 1XMQJ 4RCYA 3IR5B 1BQEA 2IFXA 1FRMA 4ZGQB 5KT4A 5F0UA 4OIQA 1RK8A 1IN0A 3DDNA 4RU9A 2I9SA 2RHQB 1JMTA 1HBNB 2R7TA 4XTTA 4NA1A 2X53S 1BE4A 2EBEA 3FOEA 3PKYA 2YWHA 1RWWB 4MIBA 4R8UB 5K8MA 1W2IA 4LOWA 1UV7A 1AUSL 3CXCR 1RB0A 3CCMS 4ZOSA 2BMWA 1N36J 3OJSA 2XS5A 4J9RA 2ZJQQ 1WQHA 3OE7A 1S0UA 3JSRA 1JKHB 2WVDA 2OUGA 2E5LF 5CQGA 1CULB 3KLFA 4CO2A 1EP4A 3G71B 3L4KA 4A3GC 3GR1A 3EGNA 2KG1A 4QW9A 2NXCA 1B7FA 2LP4A 4P73A 3WNCA 2Y9HA 3J7YI 2VASA 4PXBA 1WG4A 5HMYA 2BKOA 3TNVA 3LAJA 2HAFA 1HLWA 1TL3B 3FFIA 2GJ2A 1SUQA 2GMLA 3CCES 2W7PA 5EUHA 1V3SA 4TY9A 3IXQA 5I4MA 4DR4J 3S1QC 4QIWL 3QE2A 5C25A 3RW7A 3RUBL 2AEMA 2E9RX 1X4DA 4WWVA 4USKA 4NXMJ 4C45A 3KG4A 4Y2CA 2DIEA 2IRXA 4C43A 4NMXA 5FJ4A 2FJBB 4QYZK 1VQ4B 3BO2A 4C2MA 4OFZA 2LQ9A 4OX8A 3RZDC 4GTEA 1KQSB 4KAIA 1BMQB 3TUIC 1BJKA 2MDAA 1FD8A 3CMES 2QYGA 2EK1A 2F4FA 1E6YB 4ZCKA 2QMUA 3BY2A 1QY7A 4WTYA 3DDKA 2B56A 3PFEA 1N36F 1S1WB 4O0NA 1VQ9S 4CTAA 4ZJOA 2OPPB 3TANA 2KYZA 3FKIK 4DL7A 2DPJA 4FYXB 3KLIA 1TL1B 3MPWA 2BR0A 4YEAA 3RAXA 1NB7A 2PHCB 1H0HB 2Z30B 2G0CA 4HACB 2FJVA 4KO0A 2Z6BD 3G9CA 5E3QA 4BY7K 1Y5LB 3I9ZA 2Q6KA 1KS2A 3HHLD 2KT3A 1K83C 3W64A 5AXKA 2VG5A 1K73D 4DSIA 4ZVGA 2XS2A 2IA6A 3EGWB 4FF4A 2CFAA 1EHWA 2FTRA 2HFSA 1O2AA 1TKZB 1OIAA 3Q23A 4GTFA 4DHVA 5JBQA 4NMLA 2C2KB 4C3IC 5M3FK 3M9OB 1VRUB 2GV1A 3RR7A 4K4XA 4DR5J 3OL7A 3MOZA 5DG9A 1YZ7A 4M1KA 3W3SA 3NCPA 2AGPA 1YRUA 3F0NA 1P27B 2PT0A 3M6WA 4WKYA 3LA0A 1VQ5B 4I68A 4JK1A 3CCJS 1N5TA 4XIUA 5T14A 3TW0A 3SZZA 2ZL7A 4Z2XA 3N5BA 3TA0A 3TJ9A 4UOFA 2QTLA 1JXVA 2F43A 3V81B 4Y0FA 3OJWA 3SQGB 2JC1A 1HA3A 4KV8A 4OOXA 3HOUC 3CESA 2HS3A 3BGOP 3KK1B 3OHAA 5D3GA 5ETMA 2KHDA 4LREA 2CJBA 3GYXB 1DCHA 5FA6A 1W25A 1OB0A 1VISA 4AVZA 4IH6A 1JLCA 2JWNA 2FLNA 1JLAA 2LVWA 5GAGI 5B0CA 2CYYA 3H5UA 3W1YC 4CO4A 1QSLA 4HL9A 1TKXA 5I42B 1VS3A 1MMNA 1QH0A 1B4BA 3HXAA 4LJZA 5TMFA 3PYEA 3BDPA 4MFBB 4GC7A 3BPDA 3CJKB 2FC9A 2YKMA 2VHGA 4IFYB 5LSLA 1SC3B 1NMEB 3QBCA 3SEOA 2D3O1 1KFSA 3LP0B 1TWCK 2XC9A 4YB7A 1MMLA 1MMDA 2HRUA 3FSIA 3FDSA 1TWFC 5GADI 1FFSB 2AT1B 5C2GA 5GAHU 4AD6A 5DLFA 4GO7X 2B5JB 2LKZA 4Z37A 5LXYA 3OTOJ 1KD1T 1VH2A 1YJNS 2D74B 2BJEA 2WZNA 3R5JB 1VQOS 1X7VA 3I4HX 3HVTB 4A4JA 3JYTB 1YX2A 1HBNA 3K58A 3A13A 2VBSA 3DLKA 2EVZA 4BBRK 3PHEA 1CBKA 1ZBTA 4O44A 3PO2K 1TL7B 4QJVB 2WVEA 3GTMK 2B43A 2IJFA 1JLEA 2R8IA 2R2UA 5B7WA 4CLSA 3R5BA 3PX6A 1JKHA 4ZPCA 3WY9A 4EYHB 2UUAJ 1HI0P 5BYRA 3IPJA 3AD8C 3D5MA 5I3PA 3PYDA 5IC4B 2M2BA 4B3FX 1TWHC 1RI7A 1ZBSA 2UP1A 4KHPJ 2GQCA 1SL0A 2V63A 4B3XA 2IAJB 4ZHRB 1U1QA 1VC6A 3AB4B 1TL3A 2BACA 4KKOB 3CCUB 5FO0A 4TYBA 3MUVP 1QUFA 2GPJA 3AODA 4C11B 3NGTA 4G7ZA 4D3GA 4UZFA 5M2UA 4CLWA 1S6QB 2IJRA 3BGUA 3O1LA 4PG6A 4XSZA 1CNFA 3W7BA 1IR2A 3K5LA 4EO8A 2DIUA 2B8QA 2HBQB 5B0DA 2XBPA 4JI3J 3M2VA 3PJ9A 3SSSA 3NS6A 2XG8A 3BH7B 3PDNA 1SFOK 5JMNA 2DH7A 1B99A 2DH9A 1EIYB 1V0FA 3J81Y 4LRAA 2GAHC 1H8EA 3T1HJ 1NZ8A 3C2PA 1KLNA 1HBMB 3FEZA 4ILRA 1SC1B 3W2HA 1YDLA 4B9MA 3CD7A 2ZOGA 1IKWA 2YH0A 2ASLA 4C3LA 4K4ZA 3W2WB 4KT0C 1B3TA 2F3JA 5A76A 2V5HG 4CDIA 3SFGA 2WK4A 3T6BA 1RT3A 1YJWS 2M3DA 1KONA 4V19X 4WZLA 4G1PA 2BDPA 2VBVA 3OJXA 3VR6A 4USUA 1K9MT 2YWKA 4XN0A 2NV4A 2BGIA 3CMAB 2UUAF 3MPDA 4C2MK 3LNNA 2FYXA 3P5BP 1KQFB 3AQOA 4DSFA 4P6YA 2BANA 4F26A 1XNQF 3EYZA 2VBYA 3GP9A 1S1TB 4KHPF 4LRBA 3ZTPA 4G0WA 4DR1J 2JA7C 2JA8C 3QO9B 3HDSA 2CNLB 1NCLA 4CLFA 1EK8A 2OSQA 1BMFA 1LK7A 1TKZA 2E2HC 2IRUA 4RKUC 2P2CB 1K83A 4PC2A 3MTJA 1S0OA 2K8GA 1RT6B 4JI3F 1P9QC 4YXWA 2MHEA 5IYRA 4RD3A 3CC2B 3GR0A 4XO0A 2VDIA 2B9EA 1VRUA 2NVTK 4RNNA 4PXDA 1PAUB 2XZTB 4X07A 1FNMA 2CDRB 3IM8A 3TI0A 4ZVSB 3T56B 3PX0A 1CJKB 3M8QB 3MAAB 1KWMA 5DM7Q 4DUZJ 4RUCA 4O4RA 2I1LA 3S1RK 4O3PA 3PW4A 4OYMA 4JI5F 5BSXA 3DLEA 4DL4A 2CQIA 2W2OP 1FEEA 2FQOA 1HI1A 4PABA 3V81A 2XCQA 4OI4A 1C1BA 3MM7A 4HVZA 3OL9A 4FXDA 1OY8A 2YKQA 3DU6A 2WSCC 4P5BA 3AVUA 3S1TA 2KVOA 1FNCA 3TUJC 2FY8A 5IOSA 3TVZA 4DZDA 4A47A 1Y10A 1BDFA 4DNRB 4X66F 3I0SB 9ATCB 3E01A 2DHSA 3UCGA 2CC2A 1S1VB 1KVKA 5IYCC 5KAKA 2YNGB 3FZBA 1TWGA 2W2MP 1KRPA 3KL9A 1RP5A 5I42A 3ZZZA 2N4CA 4DLGA 2IHR1 3N0VA 3QYYA 2CQCA 4CLTA 1S72B 1Y5IB 2YU9C 2KFYA 5FNZA 1WU8A 2V6TA 3QATA 3IBCB 1JLQB 4OYAA 4YG2A 2ZTNA 5KFRA 1FRQA 4NE9C 5A88A 1Q81D 2GX8A 2JN9A 2EC0A 3KYLA 2DR9A 3HP6A 1T7PA 2JL9A 2B5JA 4RNFA 2CPEA 3MUTP 2GAGC 4H4MB 2GO8A 2YKAA 1DURA 2IA0A 5H9FJ 1RACB 2MSSA 2NYIA 5F8IA 5EHHA 1T9TA 2HZAA 2Q66A 4C3HC 5JFEA 4DUZF 2HVEA 3QGHA 3W9HA 3JAMU 4Y2MA 2HFNA 3JYTA 5DS7A 4DF4A 1E1QA 2IJNA 1HMVA 3RTVA 5E0OA 2RAQA 2GQFA 4AE5A 2HQIA 3WQPA 1X9WA 1RTIA 2C28A 3W5HA 4AYBL 4QJVA 3O44A 4CZCA 3NGRA 5CXTA 4ZVUB 3G6ES 1LNQA 2ZFHA 2OEJA 1LKZA 3MM5A 2N82B 2A68A 4XORA 4LBPA 3CCVB 4JP8A 3HOZC 1UVMA 1EAYC 2WVCA 2LU1A 2ZHOA 4JYAJ 4G1BA 5M2PA 2X6WA 2V7VA 3JSMA 3QRRA 5THXA 1IBKJ 4LBYA 2JLFA 3RZOK 2DRBA 3BKTA 2GVDB 4KKOA 1WC4A 1TWHA 2LZJA 3B8HA 2PLFA 4RBUA 4C11A 1ACMB 3S2HC 4DV3J 5ETVA 3SZ2A 3IS9A 4EI2A 3CC4B 3KHGA 2LQBA 2VODA 3H2VE 2F65A 3RBDA 4G0VA 1UMJA 2AU0A 3W2VB 3DI6B 1QJHA 3Q3AA 4WFYA 3JQKA 4HEA9 2VUMK 1AFIA 3M7VA 1K1SA 3ETMA 3FSYA 3K5PA 1SC4B 2F40A 2IDLA 1F0XA 3VGSA 1RTHA 4O3QA 3TZWA 2XGPA 1IQZA 1HNVA 1FJGJ 2H5EA 1U1PA 2Y8WA 1RTJA 3QFSA 3QQCD 1T6YA 1RYRA 1VBYA 3IP0A 2XMJA 1SL2A 1U0HB 3CJ4A 5L1LA 3H3VL 2P9EA 4B9SA 3MCSA 3BS9A 3FK4A 3M8SA 3KJFB 2XWYA 2HLUA 2D1CA 4R5PB 1XBWA 1ZA2B 2J8SA 1COWA 5E68A 5C4JK 3MR7A 1R0AA 1PBUA 5IYQA 2NYHA 4NA2A 3D1OA 1WEZA 2FC8A 3UNYA 1HR0F 2JIZA 5DS0A 4RCZA 2NVQK 3A3BA 2NXEA 3VAGA 4ES2A 5GAEU 5KFWA 1HBUA 1J9ZA 1KFDA 4A3FC 3VGUA 2OO4A 2BM1A 1O5JA 3QFWA 4JYAF 3JQJA 2C22A 3C15A 4F3MA 1IBKF 4TVAB 3QRQA 3DLGB 3TRGA 4P3IA 2LECA 1JIHA 2ZJRQ 4KC5A 2MQNA 4ED6A 5JVHQ 4ACAA 2JJ1A 4DV3F 3DLBA 4ED5A 3T9NA 2OD4A 1WHYA 1ZVUA 4RW7B 5HP1B 2GFFA 2YNHA 2DEIA 4QR1A 2JA7A 1ZYQA 1G7RA 5CHPA 4XSXA 2QTWA 3AOBA 4TN1A 4EFAC 2CVIA 4BKWA 4ECSA 2DVIA 3MEDA 4E2FB 3WC2A 2EI5A 2M5SA 1FJCA 3T01A 3MAHA 1CJKA 1UD5A 3M8QA 3NOCA 3S1NK 1EX8A 1B7YB 1Q4RA 4YFXA 1UCNA 2JA5C 4L6V3 2V6AA 4DQSA 1E43A 3MCMA 1T8EA 1HWIA 2HQFA 3SV3A 2RT3A 1FO1A 4FF2A 1Y1WA 4K4UA 4WP3A 3S16C 5IOTA 1NDKA 1GJRA 4I4BA 2ZH3A 2WW8A 1RISA 2KKHA 1W0JA 1HW8A 1KK3A 1NUEA 4HE5A 1N33J 2RQMA 1D1NA 3FJ2A 2R3VA 2BJ1A 1IKYB 4MJKA 3OSPA 3U1MA 2WZPP 3WODA 1NBMA 1FVSA 1EFCA 3BGRA 2GC8A 4J3NA 1YITB 3A1PA 2PIIA 3I0SA 2HPUA 3PACA 2QLFB 1SKWA 1BD6A 3BB5A 4YAOA 1X5OA 1CQNA 2YNGA 3EZUA 1T5EA 1XTZA 4HDHA 4Y52C 4DJBA 4USTA 2N7CA 5U47A 2BVZA 3QJLA 2DITA 4BC9A 4GTAA 2NPIA 3MWBA 3IWXA 5F4OA 5A2QY 4KN7A 4C0BA 3I5AA 3QT7A 1H8HA 1OSCA 3CQZA 2DRAA 1KK0A 4DI6A 1JLQA 5IT9U 3QSIA 3KUEA 3CEDA 1SIZA 3W9IA 2KB2A 3HOVK 1NJID 3FKSA 2PA8L 4P9SA 5E33A 2B0GA 1TWGK 5IYDK 2WOMB 1EH1A 4CO5A 1C4CA 4J9NA 5HQMA 1YNNA 3H0GK 3BBFA 4X6AK 1HD1A 4H4MA 2KXFA 1WUUA 5J2PB 3KDNA 3M6XA 5H5JA 1SH0A 4DPTA 2D9OA 4ALZA 3LTOA 2GGPB 2WAQD 3QWPA 1RCXB 3C46A 1CQXA 2CUYA 1N32F 4ECRA 2VPZB 1YJTA 1HW9A 1S9EB 4ZVEA 2ZVSA 2MB0B 2E5IA 3NS5A 1CJTA 1T05A 2CNOB 1N08A 2K1RA 4NOIA 3DOMA 1FNDA 2KVIA 5IT4A 3NLCA 2OBRA 1EZZB 4KGMA 3OOCA 4A3DK 1N5YA 4HYKA 4FP9A 4RNOA 1J5EJ 4N56A 5HQLA 1D9FA 3PEJA 4YP3A 2WB1D 2FGOA 3GFYA 2ROPA 4F8RA 4NCGB 5DZ7A 4DPXA 2IRYA 3VTIA 1FWPA 5ETLA 5A8KB 5DDQC 4GTLA 1O27A 4G7HA 3T5LA 4PGOA 2RJZA 4IQXA 5IC6B 4LSZB 4UUWA 4V1Ak 2GSOA 3FVYA 2R2RA 5E2QA 2J6TA 3JXOA 1M5HA 1DDGA 3W2VA 4IG0A 4EU0A 2YKNB 2M9KA 2YQ1A 3O3LA 4M53A 2O1PA 5FLMK 3QZ8A 2LYVA 2I0XA 5HROB 3B4DA 4YELA 5KFIA 3J7A1 4URGA 3BF4A 3Q6QA 2E7XA 4LRCA 2QGFB 3HOXC 3GG0A 4BY1C 1CQMA 4CLLA 3AVTA 4LVOP 3LVBA 4A3IK 1X9SA 4LF5J 1BLIA 1G7TA 2ACYA 4YB1P 4XM3A 4AL7A 2V68A 2IVFB 3TO8A 1SJ1A 3UVJA 1I94J 4OZNA 1VQ8S 1CC8A 3SI8A 1B0TA 4FS1A 4R5PA 1DRZA 4IO1A 3CIZA 2ALYB 3IBWA 2QL5B 4F4YA 5KFHA 1SH3A 3K7AC 1OB2A 3I32A 4DX8H 2MZ1A 1UWBB 2WW4A 3NE5B 2JFDA 1RJJA 3CCEB 1J5EF 4DSEA 4DX5A 3LAPA 2DHXA 2BKNA 4FVCA 4NNJA 1X4AA 4LSNB 1WELA 2VBWA 5HK4A 2IM0A 2VONA 1VK3A 4YFKA 3PO4A 4XMYA 4OIRA 3HT3A 4NI2B 4DV2J 1SMYA 2PN6A 3PFOA 5B09A 1XPPA 5IP9K 1QM9A 2BF4A 4DL0C 4KMUA 3M4XA 4KQZA 1UVKA 3BEGB 3NOGA 3NAHA 1AT1B 4CQ1A 1S1UB 5TY0A 1XMBA 1NK0A 3UCZP 2UU9J 1X5PA 2C1EB 1JX4A 5F3ZA 4EO6A 1RT1B 4DSKA 4QV2A 4FWTA 3LPEA 2R8HA 1SJFA 2AKWB 2DBBA 4KH0B 3MR3A 2Z2ZA 4HI1A 3CMEB 4J7CA 2C3PA 4CO3A 2KRBA 4NYPA 1JLBB 2CFXA 1M90T 1HBOA 4RWXA 5KFVA 4K4YA 3P27A 2V0NA 2WHOA 3Q8RB 2XYGB 2AYGA 1VQ9B 4B3OA 3WNDA 3CPWB 2MLXA 3KKFA 4FZBA 3CD5A 1S6PA 1YK9A 2P5VA 6FD1A 1U6FA 4A3JC 1RHJB 1I94F 4Y9RA 1KD1D 2CAJA 3JTOA 1KSPA 4ZJQA 4AQYJ 4TKTA 2FZCB 1U1LA 4G1QB 2Z0GA 3L3CA 3JSTA 3NMRA 3RB3A 3N9UC 1I51B 1WIHA 1P4MA 4JV0A 3R5GA 3IRXB 3C66A 4KMDA 3M32A 5DM6Q 1RT4B 4DK1A 3IG1B 1FXLA 1YGYA 4TY8B 1D3WA 3MECB 1RT7A 1Y1WK 3C6UB 1TL5A 2KT5A 3JSYA 3TFJA 5K8NA 3R7NB 4OOVA 2ZDPA 3HPOA 4N77A 3HI9A 3UCUP 5BXIA 4DV2F 4J9OA 5JUMA 2O5DA 4BS2A 1P6TA 4K2XA 5HVGA 1Y5NB 4ECTA 1ZZNA 4KGZB 1RAHB 4X4QA 1NJZA 4Y6IA 3ILLA 4C97A 1KMHA 3CCJB 2NQPA 3FOFA 4WXWA 5HSPA 2B4PA 1KR4A 1X4HA 4XR6A 4UT4A 2JJ2A 2FB0A 4YUDA 2XM3A 4PYDA 5J2PA 2H3EB 2LQ5A 4RD1A 1DQ8A 3VQSA 2U2FA 4F7VA 5KFCA 3D6HB 4ED2A 4ZH4A 2C2EA 5D4OA 3CQZK 2H48B 1YHQS 2FHKA 3BKUA 1REGX 1DLOB 4DV0F 4ANEA 1I50C 4X06A 5I3UA 2HSEB 2KU7A 2LA6A 3PX4A 1ZPWX 3VNVA 1S9EA 4AQYF 3D54A 4U7UK 5HO4A 4P26A 3CJTA 5KG7A 3BDEA 3AD7C 5AXLA 2MJNA 4H4KC 1BX0A 2W25A 2JFKA 2W7VA 1FKOB 2EFGA 2ZE2A 4ELTA 1EQ0A 3NNAA 3V76A 3M4OK 4BBYA 3H94A 2CPIA 2JJ4D 1ZUNB 1U09A 3GTJK 3DYAB 1VQPB 3F41A 4CCHA 5AJ3J 4B3TJ 5ETOA 3Q8QB 1K9MD 4OHXA 2GZOA 4NBSA 3ET6B 3S8SA 1E3ZA 3OKXA 3UN3A 2MKSA 2XMAA 2MPUA 2C5HA 2YKNA 4MYTA 2BQRA 1L3TA 4XLEA 2X6XA 3SCJE 1YJNB 3BN4A 3MCNA 1MN7A 5HROA 2NVXK 2OK7A 2ZHAA 2DRDA 5HATA 1S99A 2OGUA 3ZBUA 3HOYK 2QYCA 1CC7A 3ZZYA 4A3EK 1TZ0A 2VB6A 2CPXA 1JNYA 2VPYB 3ZC3A 3OREA 2DNQA 5E3AA 2E1CA 2E1MC 3TR5A 1URRA 5SUHA 3PUNA 3SQOP 1VGYA 1U2CA 2MLZA 2YQ0A 4I56A 2DR7A 3HHLC 3BH4A 2VNKA 2CPFA 2CBXA 4F02A 4DXLA 5HL7Q 2QA4G 3G05A 3BSAA 1QAXA 2FZKB 3HHLB 4CH0S 1GXLA 3CCRS 4DR2J 2Y3YA 1WI6A 3GE9A 4BPRA 4DDFA 2J9DA 1S48A 2CQ4A 1KVIA
chains in the Genus database with same CATH topology
1NRKA 1WOOA 4P9SA 3GEIA 3TTGA 1XZPB 1YX2A 1WSRA 3A8JA 4PABA 1VRQC 3ADAC 4PAAA 3TFIA 1XZQA 1V5VA 5L46A 3AD9C 1X31C 3GEEA 3TFHA 3AD7C 1PJ7A 2GAHC 3AD8C 1XZPA 1VLYA 3A8KA 1WSVA 1WORA 3GSIA 1PJ5A 3A8IA 3GEHA