1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
b'LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
1WOOA 3TTGA 1VLOA 1PJ5A 1WOPA 2GAHC 3AD7C 3TFIA 1WSRA 4P9SA 3GEEA 3TFJA 4PAAA 3GEIA 1WOSA 1WSVA 3AD8C 3GSIA 1NRKA 3GEHA 1PJ6A 1XZQB 4PABA 2GAGC 1VLYA 3A8JA 3GIRA 1V5VA 1XZPB 1PJ7A 1YX2A 3ADAC 3TFHA 3AD9C 1X31C 5L46A 1WORA 1XZQA 1VRQC 3A8IA 1XZPA 3A8KA
chains in the Genus database with same CATH superfamily
1GMVA 3CIZA 4X4UA 4YDXA 1F5CA 5IYRA 2FLOA 4B17A 1QLNA 3MPUB 5IXUA 2VG7A 3M6WA 3I1FA 2OEKA 2W25A 1VQ8B 2KRBA 2PE8A 1HPZB 5K8OA 1KRHA 3GTPA 4RD1A 3HHNB 4C3HK 5IYBK 4ZV4A 3NAHA 3RB4A 3HHLD 4OX9F 4DXLA 3DOMA 3RAMA 2DR5A 1N32F 4F36A 3SYZA 4YELA 2D3ZA 2K06A 2B4VA 3MD1A 3GZ7A 3C6TB 2OEMA 2VONA 2D9RA 1VS3A 3GTQA 1GAQA 3DN9A 1MU2B 1KK3A 2ZOFA 4DSIA 2HEKA 3DMJB 3CTAA 1FJEB 4RJLA 1BQMB 2AHOB 3SJPA 4U9UA 3UCUP 4L6V3 5L46A 1RTDB 1KNZA 3FKBA 3BY1A 4QCLA 2RRBA 4XOTA 3QGHA 1TL4A 4H4MB 3OTEA 1S57A 1OGJA 2RC5A 4RD0A 5HK4A 5HAOA 4TT3A 2BM0A 5U47A 1R9TC 1K73D 3T56B 3DLHA 4LRDA 1S1XB 4IOCQ 2C78A 4XD7A 2QSFA 2D7SA 4J9UE 3UR3C 3C15A 4C8MA 2HQ3A 2QEXB 5KFEA 3CCRS 2QZ8A 1BJKA 2PMHA 1JJHA 2AV5A 1DURA 1GXUA 4PYAA 4BWJA 3G71S 3GTLK 1UJ4A 4ZPVR 3R6GB 3L4KA 4FK8A 3RRKA 4NZ0A 1VBZA 2MZ1A 4P73A 4MAKA 2E2JK 1IVZA 2CQCA 1ACMB 3LP0B 3S1NK 5A76A 1JLQB 1I6HC 3JSMB 4DL5A 2OBRA 2KFZA 3FEYB 2GW8A 1CQMA 3QBCA 4OHWA 3GEIA 1CULB 1FNDA 2OYNA 2R8HA 2GK7A 1BD6A 4FN5A 3VZIA 3TFHA 2UUWA 2MXYA 2CIMA 2ZHAA 4XLAA 5C24A 3ZNUA 2NLWA 2HFOA 3LP2B 1X4BA 1YHQS 3IR5B 2DRBA 4Y7CA 4Z4TA 3RB6A 1RHQB 5D78A 3R5AA 1NZ8A 5IYPA 2OPSB 4DDFA 2ZH2A 2NZ4A 3MMCB 2W4DA 5A8WA 2CF4A 1EI6A 1EP4B 3M8WA 5KT3A 1QH0A 1RZMA 4XOPA 3DRYA 4ELUA 1QTNB 3MMBA 2DNRA 5EWEA 4CLPA 2ZWPA 5HLFA 1RWXB 1S6PA 3V2UC 3HAGA 1TVRB 1CJKB 3MD3A 2CVIA 4D3HA 4LBPA 4JI4J 5IP7C 3KHLA 4KAIA 3IGVA 1REVB 2CAJA 3OJUA 2JWNA 5DG9A 9ATCB 3WX8A 4EBEA 1Y3KA 1XNQJ 3SSQA 3GU0A 4EYHB 4J9PA 3KG0A 3N28A 3S1RC 2XSFA 2PIAA 4OIOA 1JNRB 4ID8A 3MPDA 3W5ZA 1C0AA 3VGSA 3OSNA 1RWMB 4KKOA 2R7RA 4WE1A 2YNHA 3Q2TC 1HBUB 1Y5IB 2IBOA 4C0OC 3S15K 3ZPNA 4XPCA 5HSPA 4IKAA 1CJUB 2OPQB 3SEJA 3J7AN 4XM3A 2F8HA 2V8VA 4PAAA 1YJ9S 4ILRA 5LJ5Y 5FL7A 5GMDA 3M6XA 2XS2A 3S1MC 1EFCA 1K9MD 1B3TA 1FDAA 3ZC3A 2YKAA 1TWCA 1FRQA 3FSXA 3HOYC 4NL5A 5KG4A 5IK2A 2KU7A 1VF7A 2QLJB 2X3UA 1TWGC 3W8PA 2HRUA 2RSQA 4DPWA 5M2RA 4TU7A 3O2IA 1AIPA 1AROP 3Q0AA 4OYMA 1DD5A 1YIJS 4CO0A 2ZZMA 3WIUA 1C1CB 3TFIA 1BX0A 1WSRA 1DTTB 1HBMB 3MTJA 3PNIA 3T6BA 4L74A 4ZS6A 3GTMA 1NPRA 3U2QA 2OGUA 1JKHA 5HKKA 2DNLA 1E6VA 3FKSA 2D1CA 3PCOB 2ZITA 5LJ3Y 2WR8A 3S1QK 5I3QA 2IAJB 1RAGB 4TY8A 4W92B 4H4KA 3HP6A 4I6AA 4XCHA 4B47A 4ES1A 2PDAA 4DL7A 3M3YC 5AE2A 4B3GA 4OX8A 3G8TA 1TLLA 4J9RA 2AJQA 4RW7B 4DL4A 3TUZC 5DDOC 1RQRA 2XYGB 3Q8RB 2AP6A 2E5LF 2COLA 2FQQB 2HQDA 3AD8C 4O3SA 2ZTGA 3KDOA 4C4WA 3UCZP 1I50C 4ZHRA 3BP3A 1B4BA 2ZD1B 3BS9A 4F4YA 1NEEA 3KUEA 4EO8A 3S16K 2EPIA 4NLRA 3W9IA 4LBHA 4AH6A 1ZM3A 5F3ZA 2OPPA 1JXLA 4QU6A 2XCPA 4LF6F 4GKKJ 2CK3A 1KK1A 3DM2A 3W3SA 2G0IA 2RQMA 2VD3A 2JIZA 3HVTA 5TMFA 1FD8A 2B5OA 4PG8A 1JLFA 4X64J 2WW4A 2XC9A 3FKIC 4DR4J 3EMTA 5KFQA 4QV2A 4MYUA 3CCUS 1Y0YA 1FRNA 1F1BB 3MR3A 4RW4B 2ASJA 1GJRA 1DFDA 1NH8A 4EU0A 5LT5A 1VQ4B 3TYTA 3W2VB 3PM9A 3PKYA 3OLBA 1AZSB 5FDLA 2CJAA 2VUGA 4USHA 4Y52C 2JFKA 5CYQA 4F26A 1SIWB 3HHLC 1QG0A 4JI1F 3P5TL 2NVXK 5GAEU 2GHPA 2FJBB 1TL1A 3QAUA 4LR2A 1Y1WK 2RAQA 2VJIA 3GTOA 4Y9UA 2VUMK 2ROEA 4O44A 1RKJA 3U1NA 5C4JC 1RT5A 4ED1A 3Q86A 5L1KA 3A13A 3E2EA 1T9TA 1IKVB 2Y0SL 1BMFA 3ONUA 2ALZA 4A4JA 1W0KA 4GC7A 4JP8A 3CCES 3DU5A 4B9TA 5KFAA 1RTIB 4F50A 1GAWA 3DLGA 2Z0GA 3PEJA 4LLGA 2IA6A 1RHUB 3LUYA 3PY8A 1F20A 4UAJA 3GYGA 1GO2A 1NBEB 3CJKA 4A8OA 2UXDJ 3HOVK 3CC4B 3B78A 5K14A 1QUFA 4B9LA 5IP9C 3N6MA 3M30B 4IG0B 4PZVA 1C4CA 4MKBA 3H8YA 1MROB 1TZ0A 4DR5F 1VQ5B 1TAQA 4WIIA 2ZBVA 3PW7A 1XQBA 2EC0A 1GTEA 2RU3A 2HPUA 4RU2A 1X7VA 1U0HB 5DRKA 2XZTB 1RU1A 2W7AA 1TVCA 2RMLA 2P6SA 3RB3A 3AJ1A 4A3KC 2R42A 3H5XA 1RLDA 1TKTA 2Y8YA 2MPUA 4B3XA 4ETXA 2C2DA 3DHWC 2LXUA 2FJWA 3PRVA 1U2FA 4JV5J 2LVWA 2CW0A 1RT1B 3OQ2A 1EJ7L 4WFAQ 1HQUA 3ZTQA 4KB4A 4FYXB 5DDQC 2V9WA 4PG4A 2P3MA 2BJ8A 3CF5Q 2QGFB 3K5OA 3RRHA 2G2OA 1BXNA 4G0VA 3AODA 4LR9A 1TV6B 1RACB 2XSJB 2V8PA 2VBUA 1P9YA 3U7JA 3KUHA 4NA3A 2RDDA 3MM7B 1B0PA 1ICEB 4DFJA 3HSDA 1FFSB 2YWGA 5M3MK 1VK3A 5A2QY 4X06A 1RA6A 4PRFA 1P6TA 1CS4B 4OJGA 2U1AA 1RU0A 3VR6A 3MWBA 4WPAA 4JI6J 4XNFA 1CPZA 1KS2A 3QFHA 5H9EJ 1S12A 2DPIA 3GTKC 2YNGA 4GTFA 3GSDA 3KHGA 4UUXA 1LK7A 2WONB 5KOWA 2JA6C 3I6PA 2GJRA 3HOXC 4L3NA 2E1PA 3TA0A 1VH2A 2FTRA 1YQHA 3OVAA 2CQBA 3SFGA 4FS1A 4J9NA 3Q8SB 3FFIB 1O2BA 3FJOA 3R97A 2W24A 1GVHA 4ZPAA 4LFCF 4XIUA 1BWEA 3OXLA 2K3KA 3IRWP 4BWMA 1HI9A 3P3DA 1VJWA 3NWRA 3BR9A 3MFHA 4KH0B 2FZGB 4RPDA 3ELHA 3WDOA 2XB2D 4DX6A 3FZBA 1TWFC 4DV1J 2V7WA 4DWIA 2GS8A 2E1RA 1XMQF 4DQPA 1QSLA 4J91A 5F8IA 2H54B 4Q2MA 3CD6S 2XCRB 3HLUA 1SC6A 2QFIA 3PX6A 5HP1B 2KL8A 4Q7JB 1GXTA 1SVDA 2B5JB 2J0SD 2ZNYA 4CLWA 1SKWA 1FFWB 2VJVA 1N36F 3OAAA 2WOMA 2HNDA 2BW2A 2ILZA 3LOUA 4OJ1A 2VBTA 4KQZA 2CNLB 2GVDB 2JVOA 4C11A 2PO4A 5KT7A 1RQPA 1LWEB 4OZ5A 3CAGA 3TFJA 1HMVA 4OYWA 4ECWA 1BQNA 1MN7A 3Q6QA 3BCDA 5JVOA 1Y9OA 3OP1A 3FK4A 3FDSA 4DUYF 3VALA 4ECSA 1SBRA 1PO6A 3M8QA 3SEOA 4M0LA 3NS7B 2I8EA 3MMJA 4BPRA 1FF2A 1RWNB 3C2PA 2GMHA 4IFVB 3IM9A 1JJ2R 2CPHA 2GV1A 1R5BA 1SFOK 2DNZA 4DPTA 1D09B 1L3VA 3AA8A 4KHRA 2A18A 2B9EA 4MTPA 2C28A 2E9ZA 1O27A 1F5AA 1FRLA 3HJVA 2UU9F 1DARA 1WC0A 3EVWA 1CEZA 1JIHA 3THTA 3MHPA 4RD3A 4TYAA 2JA7K 5G4DA 1J2VA 4JYAJ 1C0UA 3WX4A 4HT7A 5A6PA 5B0AA 3GJQB 1IKYB 3MXHP 3Q3QA 2YY3A 3F44A 3PJWA 2VQEF 1GTHA 4AXJA 2FUG9 5A8KA 2GIRA 2MSTA 3M1VB 2MMYA 2VBSA 2W9CB 2BXJA 4URGA 3H0GA 3IFEA 4B9UA 3KOAA 3EPGA 3ASPA 4R71A 2I1LA 2RKIB 2KHCA 1X5SA 1VRUB 2MQNA 1FT8A 3QSYB 4I0WA 3PW2A 2MJUA 3H90A 2XY5A 4C2MK 1YSJA 3D66A 2HVIA 2VDHA 4F4ZA 3CMQA 5FIIA 1T02A 1IBAA 1NDPA 1FXLA 3T01A 4R8UA 1AUDA 1TWHK 1VQPS 2GGPB 2BRLA 2C2WA 3MUVP 4A8YA 4Y9RA 4RM0A 5B0CA 5CZVA 5D0EA 3DYAB 1VOMA 5IOLA 1QE1A 2UXCJ 2ZFZA 4ASUA 1FKOB 3OR1A 3UVJA 4PC7A 2BGIA 2BJ1A 2DNKA 2IMOA 1CC8A 1UW4A 3Q22A 5KG6A 3BV8A 3HOUK 1S0MA 1K8AD 1YZ6A 2BJEA 2NVYA 5KFLA 3QYYA 4GKJJ 3GTYX 1E64A 4DOZA 2HYIB 4ILLA 2A6OA 1WEYA 4DR1J 1R8HA 1FO1A 2DO0A 4ZH4A 2P9GA 2QRRA 1S6OA 1Q78A 2HHUA 1G1XA 3HKZL 4LQ3A 4X65J 3WHIA 2ZZFA 5H59A 1FDDA 3QZ7A 3G6VA 4OYAA 2V6SA 2NXUA 2RNEA 1EHWA 3W2IA 2M0GB 2OEJA 2WW8A 3GLJA 3PHTA 3R9LA 2HBYB 2CVEA 5KFGA 4CNYA 4P3YA 4N5SA 2QA4S 4DCPB 3JQRA 1AMOA 4DUZJ 4BLBA 3CCMS 1EAYC 5HVFA 4WU2A 2IMWP 3T1HJ 1EH1A 3OE7A 1NDCA 2W4CA 2ALYB 2W2OP 2DB1A 1L3KA 4I4BA 2CNDA 4IH7A 3KLEA 5JFEA 2QJ3A 4C3MA 4B3RF 3JQJA 1KD1D 4DN9A 4A93K 1S1TB 5KFNA 1RADB 4KGVB 3Q39A 3R6KA 1QSYA 2WK4A 1RXOB 3GONA 2Y1RI 4DQRA 1U2CA 3V81A 4PWUA 2ZWOA 1BMQB 4OYOA 4W4MA 1TWAA 2FHJD 1HR0F 4UY8T 3I4NC 4NLXA 4ELVA 2E5GA 1M5OC 3KG4A 5A2QU 1Q53A 3FBBA 4LVNP 4QPXA 1VHOA 2V7XA 3P8BB 5L8RC 5DDRC 4OX7A 2GCFA 2UUCJ 1QVGB 3PW0A 4U9RA 1EP1B 2ZBRA 2UV8G 3DRPB 3W66A 3PW4A 3PZPA 3EYZA 4PGOA 3MCMA 2EFVA 3K59A 1EXMA 3GG1A 1IQZA 3NBPA 2WJVA 4EFAC 1IWGA 1H2UX 2YU9K 1NSKL 1P9QC 2XNRA 2XMTA 3IAS9 3H4BA 3EICA 2GSNA 2E9TA 4G7XA 4K1XA 2HBRB 1FKPB 4KHMA 4MIAA 3TI0A 4C43A 5J2PA 4RW9A 1H2VZ 1UFLA 4U7UD 1S0OA 1U24A 2X3DA 3MEEB 4F02A 3QX3A 4MMOA 4LSZB 3H42A 1RAIB 1MMLA 2W9AA 2NCKL 3FMWA 4FNIA 4F3QA 3ILJA 4CH1A 2HVHA 2VC0A 2XM3A 1USOA 4XLPA 3PRBA 3CCVB 5I3UA 4LSLA 2XOKA 4E0FA 3TAMB 3ZNJ1 2VOPA 1UVJA 4LF9J 4TMWA 1SB6A 1H73A 2K1RA 4UOFA 3OREA 1JMTA 4JUZA 3L9ZA 4TMVA 4Y2AA 4YAOA 1S1WA 5FJ8K 1SXLA 2E7VA 2CPFA 4YN3B 1BQEA 5IOQA 3VAFA 1R6VA 1HI8A 1I8DA 4M5LA 4OX9J 1B99A 2F8EX 1N32J 3GTGA 2I38A 3FCHA 4ZLJA 3KLFA 1EARA 3SXLA 4OPSA 4XLCA 5IT9Y 4QYRA 4ZVFA 1N54B 4JOUA 3R2CJ 3I5AA 4DR3F 1BGWA 1XR7A 3W60A 3HD1A 1Q82T 2LA4A 2DGSA 2G4BA 4NLTA 3P6YC 4ZVPB 5DO2A 3VGTA 3QE2A 4Q0BA 1LW0A 2FGOA 2MYFA 2K7KA 3IO1A 3IP0A 4CLTA 3CPWB 3M2RA 3GJSB 2D3O1 3QWUA 4FXUA 1EFWA 2G0JA 3IA0A 4OP7A 2VG6A 3UD4P 1VQ9S 5IT0A 5BR8F 2CJ9A 2ACYA 2CQ4A 4N7TA 1OSDA 4NLUA 1P27B 4DV4F 3PEHA 2W7OA 5I42A 2QFJA 4QBUA 4A3JC 4B9VA 1TL5A 5J2QB 4M5DA 1OJ4A 1S7IA 2J9CA 3OSPA 4GVLA 3BM7A 3C6UA 3FZ2A 1Q8KA 3Q23A 1U1KA 3UDVA 4G7HA 3R5GA 4DV6F 2QIFA 2C22A 1R0AB 5FO0A 1IJFB 3W2FA 2OD6A 4OZJA 1ZYQA 2MZRA 4CQ1A 4NCBA 5KFIA 1HD0A 3OT9A 3T53B 2R4FA 2E5IA 3UFCX 3CC2B 2KTQA 3QZ8A 2WSSA 1Q9SA 4YAFA 5KG0A 3TWZA 2AKWB 4Y3CA 3FNNA 3G82A 4ED8A 3MM6A 5A0YA 2ZJPQ 5MLCV 2CJYB 2DXEA 3V4GA 2HS4A 3CCJS 1KQKA 2W2NP 3J7YU 3BDPA 4CO1A 2PC6A 4HHUA 3NGRA 1SH0A 4ECYA 1FK9B 1G3OA 3UO0A 2DVIA 1NRKA 1KLMB 2NVQK 2BVZA 4PC6A 2KFNA 2Q6OA 4ILDA 4TU9A 1E1RA 4NLWA 4RZRA 3S0XA 4X66F 5DG7A 1UW9A 1V5IB 3OTOF 2BMWA 3CDAA 2CRVA 4B9SA 1GMUA 4ENOA 4XDDA 4WYWA 1VIOA 4ED3A 1BC6A 4QR2A 4BCAA 4JMQA 1VC6A 4I7FB 1JJ2B 2V50A 5ETRA 4DEZA 4FVCA 1MNEA 1X5PA 3MGJA 2GNKA 2R7ZC 2OPQA 1SIZA 2FYXA 4DSJA 2IYIA 3DLKA 2FJEB 3GR0A 3ISND 4P12A 2FVRA 1HNIA 4ZPWR 3H5UA 3WQZA 2IIHA 1WTHD 2W1BA 3HSGA 5IYCC 3RBEA 3RAQA 4RNNA 1FNCA 2AYEA 4C48A 1O28A 2WBRA 2QGGA 4CTAB 4M63A 4OV1A 1NHUA 4OI1A 2PA3A 4D3GA 2XI2A 2EEYA 1SV5A 4AVZA 3WNCA 4Q44A 3IXQA 1RK8A 1FDBA 4WP8A 2RGRA 1HNWF 4PPDA 1C1CA 3MM9B 3Q89A 2HMIB 1DTTA 3BGFA 4A8WA 1U1RA 2HHWA 2R7SA 3TZZA 3OFEA 1U8WA 1KC8T 5HVGA 2PFFB 3BSNA 1ELOA 4AF6A 3GFZA 2CQPA 4PG6A 3G71B 3JQKA 4C8NA 2Y3PA 2VF3A 1PYTA 5DDPC 3KLGA 2CJXB 2X1BA 1N52B 1ZH5A 3IBWA 1RLCL 4WZMA 2BEFA 3M8PB 5IC6B 2GHVC 4HTJA 1RWVB 3I0RA 2ZJQQ 4OZ3A 1SH2A 5D4PA 1HNVB 2JJ1A 3T5HA 7FDRA 1UP1A 1F3VA 2HNYA 4DI6A 1R9TK 3N79A 4FXVA 4XAKA 5CJ9A 3CDUA 2D9PA 2UV8A 2PLFA 2RF2A 1UZHA 4JI5F 3O44A 2ZKTA 1VMBA 5TV2A 1PILA 1S59A 4OJHA 1RT4A 2RVJA 3PENA 5TMCA 2B8PA 4ED2A 5IWAF 3V6DA 4OL8A 3QFSA 1G6BA 3ZBTA 3K89A 4MEYA 2XGQA 3M4OC 5AJ3F 2KFYA 3AT1B 4CM0A 3O8WA 2PEHA 1PSDA 4GVBB 3HFVA 2BABA 5I3PA 3AVTA 2E5LJ 2OMOA 1N6QA 3CXCB 4X8IA 5C3EK 4RW4A 2HGNA 4A3FC 5FLXY 3Q8PB 2V31A 1MLAA 1RT2A 2H9ZA 4S0MA 4B3MJ 4B3OB 2GPJA 2RQKA 2D3UA 2FJVA 3ZTRA 4LF6J 3D0HE 2NQPA 2QL9B 4KKTA 5C2GA 4LF4J 3M32B 2BJDA 2OMLA 1K73T 3OZUA 1NSAA 1S9EB 3V5RA 3GTQC 4XK8C 3UE2A 3EVOA 2DO4A 5BYRA 4ALZA 2P9CA 3MEDB 3TQ1A 2IPOB 5IT9U 2MQMA 3LAKA 4P2NA 3NL0A 1Y3JA 5D3GB 2LQBA 4I1TA 1V9OA 3W65A 4A3BC 2CZVC 3KNGA 2XO6A 2OP5A 3BQ2A 1NJYA 4GTCA 5ETKA 3PRDA 1TWGA 4UZCA 4RPBA 4FP9A 1ZAVA 5AXMA 2PD1A 2E5HA 2AX0A 1YJ9B 2ZBCA 2H5EA 2FY8A 2LU1A 2J5AA 5IP7K 2BF4A 4PWDA 4KB7A 4JI1J 1NSPA 4LRCA 5D0HA 3GVJA 2QLFB 3F0NA 3M30A 4ECUA 3NE5B 2V7VA 3IBCB 1HYSA 3S1RK 2OJ3A 1WDDA 1UD2A 4KO0A 1E43A 5F8NA 4A47A 2N4CA 1FX4A 2LDIA 2F5GA 4P9SA 4RL1A 3ZZ0A 1TKXB 5CQGA 4X7CA 2YWHA 3H25A 3GTJK 2XBPA 2PMZD 3LPYA 4HLBA 1NHKL 3HHDA 5E7OB 2F4FA 1F6TA 2C2MB 1YIJB 1M1KT 2YTCA 4ZLLA 4B3TF 4XKVA 3OL6A 2JH3A 5ITHA 3NMAA 4LFBF 1HQEA 4IOAQ 4NLOA 5GAHI 3DLBA 4P10A 4A3CC 3V6HA 4FXWA 3RZAA 2R92C 3S1MK 1YBAA 2BX6A 2HS3A 2Y0BB 1N8RD 4DR5J 1A7GE 3R7BB 4F2SA 2HZCA 4ZPBA 1JB0C 2UP1A 1S6UA 4Y2MA 3J81j 3HOYK 2GQ2A 1OIAA 3W7BA 3SSSA 1SKUB 2MTLA 3K5MA 1WKKA 5HMXA 3FKIA 3GIIA 5C7PA 1U09A 1CJTA 4BBRK 1T8EA 2VJJA 3V6JA 3D68A 1YLXA 1JVIA 4ES2A 4GRSA 2O1PA 4LBZA 5KFZA 1H7XA 1BJTA 2DNHA 2CNNB 3NNCA 1FWLA 2YWEA 3D3BJ 4CLZA 1VQNS 4TLQA 2ABYA 2ADBA 3D6MB 5E3PA 1LWCB 1UVNA 3AB4B 4Y6IA 4U7CA 3BN4A 4QIWD 3BN7A 4J9SA 2DRAA 4IG3A 1B64A 3A8IA 2ERRA 5BXIA 4X07A 3CCUB 2E5JA 3MR7A 1WC6A 3GILA 1PCAA 4QWEA 1S1VB 3R5CA 3HO1A 3HHLB 3LTOA 3ETMA 1SI9A 1I50K 1QGYA 3QFCA 4BLAA 3S7RA 5KFRA 3US5A 2YKMB 4RW6B 1QTMA 1ZA1B 3SDEB 1Q1KA 3KLIA 2HHTA 4BS2A 4WZLA 4X4VA 3ZXWA 1AUSL 2B5JA 4QUZA 2J9EA 3DDNA 2HRTA 4LFCJ 2WAQL 1CJVB 1ZPWX 4ATNA 2KVQE 2M8DB 4ETZA 1O8BA 1TL7B 2F1FA 1UV7A 4HIZA 3ZZUA 3ISNC 3LQ6A 1LW2A 5B09A 3QAEA 1YI2S 4QWAA 1NK4A 5KFVA 3CGIA 2FVCA 2YKOA 1KFDA 3OPFA 2P5MA 3TW0A 1XMQJ 3LF0A 3QO9A 1I51B 8RUCA 4K5RA 1NJXA 2QSWA 1J6WA 2BGJA 3AGPA 3B6BA 4LIWA 3CCEB 4PWWA 4BHQA 2B0GA 2V4JB 3DRSB 4IFVA 3H2LA 4G0UA 3BBCA 3GTMC 2V6TA 2VNJA 1OGIA 3SJZA 5TRDA 1BDFA 2Z8QA 1RTJB 4PQAA 5F8MA 3TANA 1IKWA 2KJWA 2BJ3A 1F2GA 2PI4A 3NNAA 3CULA 3OW7A 2X1GA 2G1DA 1M5PC 1S10A 4H4KC 2DITA 2C5BA 4PXDA 3M6VA 4MKVA 1RT7A 4LFAF 4DUYJ 1XNQF 3SCLE 3MUTP 4KV8B 3DRRB 2ZM6J 1NJIT 2BE7D 1QGAA 1QDUB 5LL6d 3M1VA 4X6AC 2DKOB 1RAFB 2ZDPA 4K5SA 3RZOC 5J2MA 5D8HB 3W2GA 3NS6A 4H4OB 1XE1A 3WYAA 2UU9J 5FLXU 4B9MA 4ERDA 3WZ0A 4FBTA 2JA6A 5IP9K 2Z2ZA 5KNLA 1USMA 3VGUA 4CO3A 3BKFA 2AZ3A 1D9AA 3NWGA 4HACB 5H9EK 2WSFC 3NS5A 2PN6A 2VQEJ 3RAXA 2BE5A 4A3KK 3GB0A 5F8HA 5F4OA 3FQKA 2ZUAA 4G0WA 2ROGA 2YH0A 3DYAA 1FTCA 2V4RA 1RSCA 2ZH9A 3H0PA 3HPOA 4QR1A 1DY3A 4NMXA 4DLEA 4CZCA 2GJFA 1H6KX 4FNHA 2Q79A 1UZDA 4DL0C 3WXMA 2F63A 4WF9Q 4KARA 4KM8A 4RLEA 1N5YA 4E0DA 4UT4A 2DHGA 1X9WA 4NI2A 2QN6A 1UMKA 3UW1A 4P6QA 1EETB 1X5OA 1RT6A 2N82B 4MJKA 1XK8A 3KYLA 3JAMY 2YKNB 4NLDA 3GTOC 4XQFA 3MR5A 3E01B 5IV4A 4B3SF 3Q24A 3MECB 5L1JA 1T6YA 4ZN1A 2O5IA 1VYAA 3GTKK 1RGVA 2V69A 3SZZA 2HHPA 3PYGA 3P27A 3Q2SC 1Q7YT 4DFKA 3G6EB 2MZJA 3VF0B 4UY85 1WORA 3UPFA 1YJUA 2M7SA 1PC4A 3F41A 4UQTA 2ZVIA 1Q7LB 1QJHA 2B9YA 5LXRA 1U4BA 3CIMA 2R2SA 1T6ZA 2R8IA 2HIQA 1KHWA 1HNXF 4ITSA 1GMWA 1PC5A 1YDLA 4GKKF 1X4CA 1NK7A 4CYUA 3W64A 1YKWA 2OSQA 1S49A 2GX8A 4PC2A 4Q45A 2WRMA 1YJNS 4EMDA 1TWFK 2CWXA 2VFVA 5DJBA 2KH9A 2ZZQA 4A3LC 2WVBA 3L4BC 1LEOA 5FLMC 4ZN3A 4X0CA 5C4XC 4OINA 4M5GA 5E3AA 1RHRB 1YZ7A 2KG1A 4WIQA 2O66A 1KTVA 4P7TA 4V19J 4GTBA 2C2OB 3V6KA 4WKYA 2LZJA 4X4QA 2JA8C 2AGOA 2CPXA 3ZO7A 3KDNA 1HR0J 2XZOA 2GZOA 2M8HA 1H74A 2K7JA 2CPZA 3D26A 4K2JA 4N41A 4IDKB 1TUGB 1K83A 3CCSB 2DGXA 3SLDA 1D9DA 3KJQB 2W9BA 4DG1A 2VBXA 3FOFA 1I3QA 4U95A 2X6YA 4XONA 1PYSB 4QHYA 1V3SA 1LOUA 4LC0A 5THWA 1T95A 4KR0B 2XHWA 1NK6A 4OMFG 5ETPA 4N3NA 4AT1B 1FJCA 5GAEI 2J0QD 3NOGA 4UTGA 3S17K 3HT3A 3NP5A 3VWSA 2MHNA 3AXKA 3VR1A 3KJVA 4NXNJ 4EO6A 4AC9A 1OQ6A 3S01A 3UNYA 4ZVOB 1VQPB 4MT1A 3ENVA 3MM8A 1M90D 1FWKA 3DOLA 3CCWA 4BC7A 2FZKB 3M2VB 1GAOA 1OS5A 2AT1B 5KOXA 1YITS 1R5OA 2DNNA 4OHVA 2FVQA 3A1PA 2H65B 4A8QA 4IFYA 2MLXA 1WC1A 4F3OA 5A8RA 3ERED 2DH8A 2O67A 2RIJA 4FZBA 1Q81D 3A1YG 1TKZA 1DQ9A 4OHZA 4C8LA 2YNIB 1HBNA 2VDIA 3CD7A 1TUVA 4I6YA 5LOQA 3QIPB 5IM0A 5J1EB 5CD4A 5RUBA 3W5VA 5M2PA 1FNMA 1EKSA 1SJ4P 1KP6A 4DV2J 1D2EA 2GA7A 2ZKUA 3AVVA 3VQTA 3A4TA 4U8YA 4B4DA 1SCJB 2K3IA 4ACAA 2GAHC 3H7HB 4KASA 4ANCA 2QE7A 3D0IE 1LWFB 3HJFA 4X4NA 5CYJA 2R9LA 1OY6A 2DIEA 3NOCA 3GQCA 3I0SA 2XNQA 4TU8A 4DX5A 1CSJA 2DH7A 1Y0RA 2OTJS 2Z6BD 2QA4B 1HFEL 1XC9A 1RKIA 1DTQA 1KDNA 3CDEA 2LQ9A 3CCMB 4ZIVA 3CRZA 5KFPA 2X8KA 1KN6A 5B0EA 3DCAA 1SL0A 3W9HA 2E1BA 2B4OA 3SMZA 4ZCMA 2J9DE 4DR3J 3KK2B 4WXOA 4M5JA 2LXIA 2D69A 2C3MA 4NRTA 3MOJB 5AE1A 1CVJA 2AZ1A 2I9SA 2PI5A 1N48A 1K47A 2KXNB 2BANA 4F67A 2IM2A 1M5SA 3CJRA 3ITHB 4H9GA 3KLVA 1YJVA 2OD4A 4G1QB 2JJ4D 3W2WA 1DJ0A 2D3NA 5AN9A 4FYWB 5G0RB 4R0EA 3T1YJ 3GYXB 3UD3P 3GCWP 5LSRA 1W9XA 5BR8J 4HTIA 3N01A 2BKOA 2NUUG 4I2QA 4DV4J 4KN7A 1J5OB 5KG1A 2OK7A 1W26A 3ZTSA 2HFZA 1FK9A 4MK8A 2ZH4A 4BBSC 5EX3A 2POKA 5B6IA 4DUTA 4DV6J 3DDYA 1R7IA 5KFFA 3OZVA 3W62A 4HYKA 1XBWA 2BR0A 3I4NK 2OLWA 2Q6KA 5BSXA 3D3CJ 4BC9A 2BQRA 1L3TA 1G7CB 4PYDA 3JAMU 1LFWA 1SJ1A 2V6UA 1G7SA 1IM6A 1LXNA 5CABA 4ZOSA 2YKPA 1FJGF 4G65A 3E3XA 2NVYC 2EKYA 4OFZA 2B6AA 4KDDA 1GX6A 1VFJA 1FRXA 3RU0A 1XZQA 2EG2A 2HQFA 4TN2A 4ED4A 1LQ9A 3NGKA 2X51A 1PJ5A 4Y00A 4CI0B 1KQ4A 3L7PA 1RHKB 3WBZA 4X66J 1N56A 2UVWA 1SQGA 4KIAA 1TTHB 3VNUA 4WK3A 3OTOJ 1VQ7S 2DR8A 3HD2A 3IG1B 4RUAA 3OJWA 4TMXA 2MSSA 1VQ6S 3OW2R 2R2RA 1VHFA 3QT7A 2IHR1 2RD5C 1S9GB 2EC2A 5F9LA 1S6QA 2JSXA 1X5TA 3FJ2A 2X85A 2B63A 2JC1A 1K1SA 5C42A 1TL3A 2D3OR 4KTQA 1KOHA 1HWUA 1QAJA 2WSEC 1JLCB 3J81Y 2KVIA 5D0GA 1KR4A 3BGRA 4CLFA 2V94A 3BPSP 3N0BA 2GMJA 1Q5YA 1TWAC 2RILA 2BE2B 3BGLA 2FLNA 2YXLA 4DJBA 2E2IK 3L7UA 3T6JA 3U1LA 2G13A 1MWYA 1X4DA 2W8KA 5HL8A 3AH5A 1RWWB 1D0EA 1NHVA 1VQ9B 3C16A 2PMDA 1RU2A 1YRUA 4XLEA 3L4JA 2OTLS 5I4MA 1HHTP 2QLXA 4E98A 1E6YA 4TVAB 1OMSA 2CG4A 4M5HA 3S2DC 2CQ3A 2R2TA 3LP1A 2C2NA 4GKJF 5KFUA 4LK1A 2OELA 5LMNF 1O24A 4EUVA 2C5HA 4LSNB 1G51A 3CCVS 2E2HK 1FVSA 3IWXA 1IXKA 3CCZA 4QWBA 4KFBA 1UCNA 4C0SA 1E79A 1XN9A 1WTBA 5E0OA 3KNAA 2XMAA 4WTOB 3OUYB 3FHZA 5B0GA 4G6VB 2BSAA 3CP8A 4LT6A 3CCJB 1XFOA 4FPRA 3J7A1 4HKQA 4JI5J 4DUZF 1APSA 5JMNA 2GREA 2NXJA 3TUIC 1VRTB 2E2JC 3GTJA 2KRRA 3H4DA 4UUWA 4RW8A 1CNFA 5FA6A 4O23A 4DCOB 4DQIA 1JNZB 4KAWX 2JRSA 3MEDA 1NH7A 5AJ3J 3LQVA 1AFJA 1UEUA 1WWHA 2C2RA 3TZXA 3LPXA 4I2PB 4PG5A 2IC3B 4JV1A 5IS2A 4ROXA 5ETMA 4MYTA 3M8ZA 2GVZB 4HE6A 2HFVA 2UUBF 2NYHA 4A48A 2A68A 5HI7A 5SZTA 4DS4A 3C19A 3EDRB 2XEXA 3UCGA 3VCDA 3CJ4A 2Y0SD 4GO5X 1NZAA 2HAFA 1WCMK 1R0BG 2XNDA 1JLGB 4O3NA 4DR6F 1VK8A 4X05A 2Z2LA 5E6TA 1RTHB 4ICLA 1O29A 3NGDA 4RD4A 5D15A 1EP2B 3PUNA 1HIYA 3PJXA 1T6XA 2AEJA 3BSOA 3MEGB 2B4UA 3ASSA 5LMUF 3N5FA 5KFXA 1C1BB 2WZPP 1Z4UA 3O1LA 3CDBA 4YR0A 1J6XA 3HULA 3N0CA 4NLYA 2OPRA 3AQOA 1YJTA 2R7ZK 2FHJA 3IC1A 2GO8A 1WKLA 3FCWA 4OI4A 3BQJA 1R5NA 4P52A 4TKTA 1T05B 3N9UC 2DCLA 3I9ZA 1S4FA 3G4CA 1NO8A 1LFPA 4RBTA 3JYTB 3RJMB 4DMZA 2RQCA 1SUQA 3K5PA 3PG9A 4ZVEA 1L0WA 3S15C 1T3OA 3NY0A 3T51B 1T5EA 1PJ7A 1VQMS 3NUHA 2L3MA 1FCAA 5CYMB 2XGPA 1HW8A 2VB6A 3CMAS 4LF9F 2KYXA 2DYAA 4DPUA 3I5CA 1RT3A 3OTBA 1QSSA 5MAOA 1K0VA 2HDNB 2CQIA 4B3TJ 4Q4ZA 5J1PA 4LFBJ 2QE5A 2VG5B 3BUEA 5DZ6A 4WJ4A 3NKYA 4EH1A 2M52A 2DNYA 3KK1A 1NXIA 2QV6A 1KZLA 2VG7B 3W2EA 3M4XA 3SI8A 2IM3A 1XTZA 3GDZA 2MZTA 4KHPF 2HRYA 2V9KA 3G4AA 2RRNA 3AOCA 1KLNA 5KSWB 4DK0A 4FKYA 2CW5A 4ZP9A 1RI7A 1SC4B 3DOMB 1WDTA 2HQIA 3ASTA 3JQQA 3FVYA 4K0KJ 5SUHA 1YJRA 2QC3A 4FWTA 3DLEA 2R93A 1T9VA 1C0TA 5ETLA 2CQ0A 1A9NB 3LGHA 3LGNA 4MKAA 5H9FJ 3GIMA 2CFAA 3S1QC 1O26A 3V76A 4ACBA 2R9VA 1RBLA 3HHKA 3B8HA 3QLHA 3EJMA 2AYGA 4DQQA 4UOHA 2FHOB 5CA5A 2EXUA 2EI5A 3N6LA 2J7KA 5GAGI 3ZTPA 3Q8YA 5KFYA 1G7RA 4RCYA 3ISXA 1S4EA 4CH0S 2ZH8A 4KJIA 5HROA 3J81U 1HI1A 1UVIA 4FVMA 3M4OK 1U45A 4XORA 3CCLB 1T3NA 4P25A 1JA1A 1HWIA 2GIFA 3H5SA 3BO4A 3GTPK 2CUYA 4PCQA 1Q8IA 2ZL6A 1CC7A 3BH7B 3SQOP 2EK1A 1CQNA 2QA4G 4ED0A 4B9NA 2F1LA 3KKFA 2UXBF 3MUMP 4WWSA 4U7UK 3IGNA 3IS9A 4U67Q 5A8AA 2FHMA 4ECVA 3E51A 4DR2F 1QUEA 3UI3A 2AJ4A 2JEGA 4IRDA 4A8SA 2MGZA 2I6WA 1URNA 2MDAA 1MW7A 1XEZA 2R92A 3C14A 4G1VA 3MM5B 3ADAC 5EN1A 1S5ZA 4FM9A 2QL5B 4UF4A 4UOGA 1P1TA 5E2QA 1TMJA 2BQUA 3RBZA 1FJ7A 2DD8S 2HBQB 3HVWA 4LMZA 1O25A 3J7YI 1VRQC 1NAQA 4K4YA 2NVXC 1VQSA 3WNBA 3W63A 1W25A 2NXNA 3T5KA 2BN4A 2DETA 4X4PA 2IVFB 2E7WA 2CWKA 3GIKA 5LM7E 3VAGA 1F9EB 2FVSA 1M0SA 4YOEA 4RPFA 1GQEA 3MMBB 1U1PA 1NPPA 3ET6A 2WBMA 4U96A 4F4KA 5HLFB 4XN3A 1S6PB 4H54A 2XTJP 2DNPA 2YVSA 4LFAJ 3K58A 1FE0A 3OVSA 1CG2A 5KG5A 2WB1L 4PXEA 1SKSA 1DQAA 1N5VA 4LF7F 2DY1A 4K7QA 2ZUGA 3LAPA 1WJ9A 5DQHA 5BSYA 4WFZA 1VCTA 2UVVA 8AT1B 4IRCA 1EP3B 1X4HA 1U1OA 2AD9A 2ZTNA 1D9FA 3BH4A 1VQNB 3QFTA 2H3EB 1FNOA 4A3CK 1V3RA 4JK1A 3G4SS 2EFOA 2FC8A 2ZH6A 4OLPA 2X1FA 4KKOB 1RABB 4WE1B 2FD2A 4PR6A 1LWXA 5EHHA 3RB0A 2YNHB 1VGXA 1RAJA 2L9WA 3C46A 5E5NA 1H72C 3A8JA 1ZTWA 1XERA 1JLEA 2HURA 4YS2A 4KPYA 4Z7CA 2AMCB 1F60B 1EZZB 1FEEA 4HL9A 2KJVA 3BPDA 3G2XA 3OEPA 1WC4A 4P75A 2C3PA 4J0QA 5LSOA 3HKZD 2KT5A 2XMKA 2VPWB 4OJ3A 1ZZNA 4QJVA 2CJQA 4Z4RA 4AXIA 4L75A 1MWZA 3L09A 4WP3A 2A1BA 2W2PP 3BBBA 1WNEA 1GMWD 1HI0P 1DLOA 1B0TA 3IAM9 2D41A 3KHRA 1GXLA 2GMLA 2B9WA 3PKMA 3D6HB 2ZC4A 5EX0A 3HF5A 5J3OA 3VNVA 2OFHX 4HDGA 3ILLA 2XMVA 5DS0A 2ZE2A 1KHVA 1R27B 2E66A 4LF8F 3NGSA 4LRFA 4DX7A 1YI2B 4B3SJ 2BOAA 7FD1A 9RUBA 1JKHB 5HBMA 3HCXA 1E6VB 1FEHA 2V34A 1UFWA 2OUGA 1L3UA 3DI6A 3PJ9A 4QVJA 3I55S 2ZZNA 4ZVRB 3GJTB 5IYDK 3D6TB 4TY8B 4NCAA 3E20A 4DV0F 1YNNA 1EFTA 3UNGC 2MKIA 4DX8H 3G96A 2ACMA 1U02A 1KSPA 2VL1A 2HK2A 2LP4A 1M1GA 2W6JA 5DQIA 5EGHA 1WI6A 1UFKA 1HNXJ 4B3MF 1KVIA 3QMQA 2NREA 4NEYA 5IQQA 1N08A 1TWCK 3R5JB 1PKVA 2IA0A 4YB6A 4ZHRB 4GTAA 4LF4F 1K44A 1N5SA 3MMAA 1COWA 2Z4PA 4F0HA 3OPOA 2B3TB 1WD6A 2MKYA 1RWUA 2OPPB 3DM2B 4IDKA 3LW5C 5GADU 1U6FA 4YP3A 1BX1A 4USIA 3HVTB 2XMJA 2DR9A 1JLFB 1N34F 2LEBA 3QIDA 3FOEA 4USMA 5FNZA 3K7AC 3I4PA 4DSKA 2R6HA 1B70B 1TQLA 1VR6A 4R5PA 1S79A 4ZVGA 4ILMA 2Z57B 2RT3A 2B9XA 4YEJA 4DQSA 4BLGA 3MEKA 1NK8A 4ZJOA 3OJSA 1SH3A 1N07A 3PR5B 2NXCA 3OV7A 4JI7J 5FDLB 2GQFA 2C3YA 3LGMA 2DEUA 1WELA 4OZ0A 4EBDA 3U1MA 5CYQB 2XMUA 1WEZA 1UAWA 4L3KA 3A3GA 4X6AK 1YTYA 2HWTA 4ED6A 1TL1B 1J27A 3HT0A 4ZLNA 2HG4A 2F65A 5JVHQ 4Q7AA 4O44B 1H2TZ 1VQKS 2FIUA 2BZ2A 1RT5B 3KXDA 4OI2A 1WI8A 2E29A 2JA5A 3P96A 2JOQA 2AJ2A 2B43A 3W61A 2ZC3A 4KSEB 2JNJA 2GJPA 3NMRA 2D74A 2A2DA 3CE8A 3HXAA 4EK2A 2XZWA 3HDSA 4MFBA 1ZA2B 2MY8A 3CJKB 5DZ7A 1VC0A 4M5NA 3CJ5A 2A6MA 3IRXA 4ZP7A 1KFSA 1KWMA 4RD2A 4A8MP 1MRZA 4F7VA 5K14B 4KYZA 2WVCA 1R43A 2EFGA 1GX5A 2ZHBA 2B7CB 2B7BA 1FE4A 2JJ2A 3AA9A 2KKHA 1TWHC 4KKUA 2EFQA 4XO0A 2IM1A 2ASYA 4L73A 3KK2A 1NLKL 1DCPA 3RTVA 3GTOK 1JNYA 4GT9A 1JLAA 1HQUB 1YJNB 4I6WA 1H3DA 3EUNA 3CB4A 3Q8QB 3CW2A 4JV2A 2HMAA 2CA9A 3NCRA 3HXMA 1BWVA 1F7UA 4AQYF 3RW7A 1U48A 1HHSA 3DOKA 1XZPA 4DZDA 3MMLB 4WJ3M 2J7UA 4AD6A 1XXBA 4RNHA 3VAIA 1UD5A 3SQGB 4EWTA 2C4UA 5TJ3A 4RNFA 2V63A 2QDXA 4FS2A 2YNFA 4NX9A 2BPOA 5F4JA 2MHEA 4KN4A 4BDPA 1ITPA 5KFHA 5CDFA 2C77A 1HLWA 1BUXA 1NKCA 1RYSA 5HVHA 1WG1A 5K9FA 3PVXA 4BBYA 3BC9A 2J8SA 1ZZFA 2LDYA 1S97A 4XSZA 3TQEA 4NLGA 5FLMK 1CNEA 2QMXA 4GC6A 4A93C 3AXMA 4WXWA 3CJ0A 1O5JA 4QW9A 2DHSA 1KQSR 4LBVA 2RC6A 2HK3A 4UQGA 4KMUA 2EG1A 4OHXA 1REGX 2Y8WA 5HQMA 3ILOA 1FI4A 3OEEA 3G6ES 3VAHA 3K8WA 5D77A 3JTNA 1KEKA 2OKQA 2YBVA 4EGLA 4GMKA 5ETTA 4XN0A 1IR2A 2GSUA 1HA3A 1B0VA 2I5JA 4HHJA 4OZNA 2M3DA 3VO1A 4PUOA 2NV4A 1YITB 3A3NB 4O4RA 1TK5A 2JLFA 1YNJA 3ASRA 4C3LA 4DCJB 1NU4A 4M95A 1FJGJ 3OTDA 4NCGA 2WOMB 2HNDB 5DS7A 4UZFA 3FSYA 2ZUFA 4C11B 1N5TA 1TR0A 1IQ0A 4ZVUB 3T19A 1Y1VA 4M1XA 2ZM6F 1HMVB 2DERA 2X1AA 2P2CB 2PFDA 5CZXA 3AD7C 4MK9A 3CMES 2HQCA 1DQ8A 2HQGA 4I56A 3M8QB 4MEXA 2Q1LA 4GTLA 4AE5A 4USWA 2N3OA 1U6BA 3R1HA 2DT9A 4FDFA 4CLKA 2IJRA 1OO0B 3NNHA 2HS0A 2OIHA 2Z2YB 1S0UA 1KVJA 3V4IA 3GSIA 3QNWB 3PACA 1Q82D 3EZUA 2OTJB 1HW9A 1WHXA 5A89A 2H1YA 1H8HA 5ETNA 4CNZA 2VU5A 3I4HX 4QPTA 1B2RA 3CCSS 1SKYB 1C0UB 3PXGa 3QRPA 1H38A 1S0NA 2KZMA 1Y5NB 1GNKA 3PO3C 2IRYA 1WU8A 4C3JK 1UWBA 2LA6A 2DISA 1D8YA 4P26A 2DCUA 1IWAA 4RX6A 4JI2J 5A8KB 1RP5A 3R1LA 1VQOS 2LKZA 1JK9B 3TX8A 3RY8A 5JVGQ 1PJ6A 1BLUA 1H8EA 4B02A 3R7NB 4DFPA 1K83C 2UUTA 2NSBA 1I3QC 2P6TA 1UD6A 1W0JA 1IW7A 2A6EA 1JQGA 4NYZA 3R8YA 5EMNA 2V7TA 1EFRA 2HFSA 3CQZK 4C9DA 2KB2A 2QMUB 2QX0A 3UR0A 1PKUA 1WC3A 3ZZYA 2EBBA 4GO7X 1QE1B 1XMOJ 2P5VA 2DNMA 1Q81T 1RA7A 3OR1B 1IBLF 3UVJB 5LMNJ 3PO5A 5ETVA 1MABA 2JDIA 4GTDA 3TR5A 3CDWA 2M88A 3KK3A 4JI8J 2CPEA 1ZAXA 1RYRA 3ZZPA 3GP9A 2BKNA 2F8MA 2ILYA 3SCJE 2AEMA 1EQMA 3S6EA 3H0GK 1RUSA 4WTYA 2HBZB 5C25A 4P3IA 1D8ZA 1XR5A 2F9JA 1KMHA 2X53S 4TN1A 2ZBQA 2GC8A 2HNZA 1UTAA 3IWLA 2RUGA 2M9KA 2XLKA 5C44K 4FZVA 3AVXA 1OPZA 5D0RA 2KYZA 1AB4A 2A0FB 4FYDA 2NVTK 4ZVTB 2P8IA 5T7LB 2EBEA 4CIOA 2D9OA 1KKHA 4HT5A 1RTHA 2N7CA 3KLEB 1VQ7B 3DLJA 5KG2A 1SJ3P 4G7ZA 5CAAA 5F41A 5IOTA 4BY1K 1VQ6B 4WP9A 1R8AA 4KMDA 4C8ZA 2DRDA 4W90B 4NYPA 3KJNB 3V81B 2ZZEA 4PXBA 3I4MC 3J7Z5 1BY9A 2UUBJ 3OXGA 2NVYK 3NGTA 2ZUEA 4TQRA 1GT8A 4A8XA 2NVQC 1ROFA 2YX1A 5IV3A 4ID5A 2DGWA 5K8PA 2KWAA 3MAAA 2IBKA 1BS2A 2ZL5A 2AQ4A 1FX0A 3ZZOA 2HHSA 2L08A 1QUVA 3JTPA 2GIQA 2HLDA 4TNOA 4DR6J 1T03A 4A3EK 3NLCA 4OPVA 4OZLA 3MZIA 4DL3A 4Q8FA 1DG1G 3HSZA 2PA8L 1Y4ZB 2N7YA 1WHYA 4C3IC 5J1NA 4NXNF 1KC8D 3BF4A 4YMEA 3PA2A 1IKXA 2MKCA 5L38A 5LMUJ 4PEOA 3OPKA 2MLYA 3UN3A 2BJ9A 5GAHU 1UPPA 4PXCA 3D1HA 3ISZA 2PSZA 3NBPB 1HPZA 3BO2A 2OTLB 4BY7C 5B0BA 1F3FA 4UZEA 5M5XK 4ZDNA 1VBYA 5J2PB 4RW9B 2B56A 3GTLA 4KGZB 2EK6A 5ETOA 1U8SA 5CHPA 3MPYA 4QYZJ 1TWAK 3PIOQ 1WOOA 3Q6RA 2DGOA 1X4FA 3A8EA 3WBJA 3OXFA 2F3JA 3C6TA 3R2DJ 5IYQA 4DV2F 1R89A 1MU2A 3DMJA 1L3SA 1RE1B 1BQMA 2AHOA 1IR1A 2CNKB 3TEHB 2G2ZA 5I3UB 4LSLB 2FDNA 3MR6A 1EQRA 4OIPA 1RTDA 3HOWC 2V2KA 3ES9A 1OPIA 1N4LA 3D7SB 2K1RB 4H4MA 3ASQA 3MDFA 4C3KA 3G9CA 4NLSA 4QIGA 4A3DC 4Y2IA 1S1WB 2V8DA 4KHPJ 4JI3F 3S2DK 2F9DA 1Q86T 1VIXA 3NRBA 4YAUA 5FO1A 5HL7Q 3D2WA 1S1XA 3K57A 3I82A 4P22A 5JXSA 4MH8A 1W34A 3G6XA 3CCQS 3LALA 8ATCB 2OBSA 1OB2A 3KLFB 2C3OA 3PHEA 5L9XA 1SPBP 3J80Y 3MTKA 2WAQD 4NEZA 4KB2A 1BPLA 2E44A 3QGPA 4UW2A 4URSA 4FXDA 1NCLA 3TJ8A 4M8LA 4EZ6A 1Y00A 3M9OB 2B63C 1HWKA 3CD5A 1R31A 1XWLA 3LP0A 4W98A 2FQOA 4PC1A 2XZPA 2DR6A 2LXFA 1JLQA 3JSMA 1YBUA 2MQOA 4YR2A 1LW0B 4Q0BB 2H4WB 3T1YF 1MMNA 2FVGA 4NASA 2J7WA 2HKEA 4JB8B 1EIYB 3M2RB 3U02A 1XXAA 2BM1A 1NM2A 3N4WA 5C3EC 3FQLA 1UVMA 1CULA 2VG6B 2QLBB 1ZOTA 3IR6B 3MM5A 2ZOMA 1LV5A 4LR7A 1Z1ZA 3ILIA 2AIRB 4JBCA 1DAXA 4ZJQA 3GFHA 4LR8A 2ZJRQ 2JL9A 5I42B 3LP2A 4M5DB 1HBOB 4K59A 1TK8A 3UWTA 2AJ0A 3C6UB 1WTFA 3SKBA 3ENAA 3GTGK 2MB0B 1KQSB 2OPSA 1DCHA 4YB7A 3MMCA 3R27A 2UXBJ 1EWYA 2XCAA 3CSKA 1NSQA 1EP4A 3X3UA 4A3IK 1UPMB 4QFMA 1M1KD 3QQCD 2EFNA 4DR2J 2MZQA 1QM9A 2HHQA 3GJRB 1ZS6A 1G2EA 3LAMA 3HKWA 1S72S 4NBSA 3RR7A 1VC5A 1TVRA 1CJKA 4DV5F 3WIVA 3T3FA 4DU7A 4XTTA 4X7EA 3G82B 4AFFA 3MM6B 2KXHA 5A0YB 4F8RA 5HQ8A 1VQMB 2ASLA 2XWYA 1REVA 4KGMA 1YJWS 4CLYA 3CMAB 4OOXA 1I5OB 2VBZA 1GK8A 3TZYA 4Z4SA 3BP8C 5F3TA 2B51A 4OI3A 5L39A 2IDEA 1VISA 3JU4A 3W5HA 3S1TA 2FVPA 3HOZC 2R8GA 1NB2A 5KW9A 2DGQA 5C2CA 3EGVA 4NZ6A 2FQTA 2VBVA 4X4RA 2LMIA 1HBUA 1UD3A 3K5NA 3QRRA 3OD2A 3HVAA 3MAQA 3H20A 1CJUA 3PYDA 3VHQA 1YWXA 2DPJA 2C4TA 4ZGQB 1ZBTA 3GTJC 1T9UA 4KGKA 4L76A 4GZYA 3SCIE 1YRTA 1T9XA 4ER8A 4N8OA 4Z4UA 1JXVA 3J81k 3PO2C 4O3QA 2X6XA 6FDRA 4XLHA 4K4SA 1WP6A 1F60A 4OLOA 3DLKB 5F4MA 2VIHA 5H9FK 4P2MA 1W7WA 3RBXA 3DXSX 2QTZA 4LF7J 2B8QA 1HNIB 5IC4B 2MJNA 3FUYA 3TRGA 3BB5A 2VC1A 3KTQA 3GWCA 5J35A 3PX4A 1SJFA 4NXMF 3WBKA 4KT0C 3PW5A 4NRUA 2KZZA 3H3VL 1V0FA 1F2HA 2MKJA 4YR3A 4CCHA 4AUKA 2O3DA 1HBMA 2RQ4A 4DR7F 1SV5B 4N77A 4BBRC 5KAKA 3T9ZA 3A8KA 3MOZA 1TKDA 1ZXOA 1E1QA 1WG4A 1Q8BA 4IW3B 2J6UA 2DIVA 2ADCA 1PBAA 1V0EA 2IAJA 3G6YA 4XMYA 4RNMA 4RCZA 2CQHA 1QAXA 3VTIA 2YQ3A 1EKRA 2F40A 4J7CA 3UQSA 1UL3A 3HFKA 1MWQA 4C45A 2NSCA 4IQXA 4RW7A 2VNKA 2WSCC 1KOOA 3N3YA 3S14C 2MKSA 3KLGB 1NDLA 2LEPA 3B54A 2NVXA 2ZD1A 3I0RB 1Y1WA 3FCVA 1AYEA 4DSLA 2HNYB 4X62F 4NLQA 1NB9A 3ZZTA 2VUMA 1T94A 2G1HA 4LF8J 1S1UB 4ZPDA 3QWPA 1SKRA 4GTEA 2CZ9A 2RHQB 4TYBA 3LPEA 3KJFB 2RF2B 5IT4A 1KBRA 4OX6A 3KUGA 4ZMMA 1B7FA 3CJSA 2V67A 1RT4B 2Y1LB 4ED7A 2VA3A 1ZM2A 1NPKA 4DQLA 4DV0J 2HVZA 4OYIA 3P45B 4MKYA 3V6DB 1I6HK 3GYNA 1RQ0A 4NNJA 1NJID 1AT1B 1RAEB 2FJAB 3TUPA 3GCXP 2JLGA 3W2VA 3EWGA 3D1QA 2XO7A 3RYLA 1MSWD 1N6QB 1AW0A 4LQYA 2EWHA 1AZSA 2DGVA 2DYIA 5BYSA 1ISEA 4USVA 2A69A 1RT2B 1J6VA 1J9ZA 1JXEA 1QVGR 3I5BA 1Q4RA 4FKXA 4PABA 2R93C 4WFXA 1ULRA 2X3GA 3OHAA 4K50A 2YPZA 2YWFA 3R5BA 2E1CA 3CCLS 2BMBA 1SQFA 3GG0A 4HE5A 2V4DA 4AL7A 1N34J 4DNRB 2LQ8A 4P74A 3J80U 4LBIA 2J0XA 2ZNZA 5HO4A 4ZCIA 5HZBA 4AL6A 2BV3A 1IKVA 1W2IA 3D6FB 2OI2A 4P5AA 3N6NA 3G4SB 3IM8A 2XNJA 4YB1P 2D6FC 1F93A 2V2ZA 1RTIA 3KFWX 3Q3AA 4F2RA 4Q8EA 2KG0A 3MFIA 2Q6LA 1IQTA 2VQFJ 2Y9HA 5BYQA 3OFFA 4DN0A 1UJ6A 3QFRA 4IG0A 4O4GB 1MROA 1BLIA 2VPZB 3D9BA 2HHXA 1OY8A 3CO9A 2RS2A 4PWDB 2GSOA 1U0HA 1E3ZA 1T7PA 1GFWB 3VAMA 3RZDC 1TAUA 2VICA 4J9MA 4HI1A 2WJYA 1RCXB 1HYSB 4F4XA 2B7CA 4LRBA 1IN0A 4AYBL 1RHMB 4MQ9A 4KO0B 1VJEA 1UA1A 3BZQA 3TTGA 3DFEA 1XPPA 1RT1A 3MCAA 3SZ2A 2YH1A 4LBYA 1Q7YD 3ZIAA 1NJWA 3M8YA 2R7UA 2IJFA 4OYZA 3HI9A 2CXEA 2G2YA 1ZTTA 2HWIA 3K17A 4X7FA 2V7QA 1NB7A 1HQEB 1TV6A 2VOOA 3CT9A 2XSJA 1E63A 4G5GA 2PGCA 3MM7A 2BVNA 2GO9A 2WCXA 5F8JA 2DGUA 4CWBA 2JHEA 2V68A 1TWGK 3I55B 1CS4A 4L8JA 4K0KF 1YVFA 3OL7A 4C97A 5TY0A 4CT8A 3I32A 3M8SA 4FF1A 2X0KA 2JFDA 3BNWA 3PYEA 1NJZA 2HVDA 2VFUA 5JBQA 2NUHA 4YUDA 5FIUA 2MQPA 1Q79A 4M5MA 3CPXA 3SQGA 2FJDB 3AB2B 1CJTB 1TFYA 2WONA 2VODA 2NR0A 3UDCA 1FWPA 1GR1A 4PKDB 3DDIA 5AT1B 3R3TA 3CPWR 2W6IA 1X60A 4DL2A 2XS5A 2XCOA 3VAJA 4GFQA 3FFIA 3UN2A 2HIYA 2DNGA 4QU7A 2AJ1A 3THPA 3M3YK 3CC7S 3LH2S 3CJ8A 2W7PA 4MIWA 4C8OA 3HZEA 5FJ4A 2M5SA 1K9MT 1JWWA 4AQYJ 1SFOA 2R3VA 2VA2A 5CCMA 1QAYA 4YHBA 4IG3B 2KI2A 3THVA 2A2CA 1IBMF 2CPJA 5H1SV 4P1VA 4IR1A 3T41A 2JA7A 2ZBUA 2ZHOA 5HP1A 1U47A 4J37A 3OBIA 4IH5A 4LUBA 2GQQA 1WEXA 2ZOGA 2XULA 4KMHA 1X31C 5HQLA 3W8GA 4Y2KA 3CVKA 2HAIA 3R7SB 4PPZA 3Q8UA 3KLIB 1QX4A 4K8RA 3IWNC 4V1Ak 3UN5A 1R8BA 3FKIK 2NXEA 3GVLA 3QT8A 4DL6A 4P2SA 4G1PA 3TVZA 2GVDA 4USTA 1N5QA 1RAAB 1LWEA 2UVRA 3H2VE 4C2MA 5ADZA 3SCKE 3SBMA 2CDRB 3K7AK 5H5JA 1WF2A 4ZA1A 3V7AA 1TU0B 3G87A 1VQKB 1LW2B 1IBCB 5DLGA 4P6YA 1WOSA 4DSFA 3QO9B 3LWMA 3NGUA 1TWHA 1YJ7A 4LF5F 2YPYA 4Y52K 3RG6A 1TMMA 3WNDA 2AEFA 2DK2A 2QLWA 1S0VA 1WHVA 2VV5A 1I94J 1FXRA 3CQZA 4WQMA 1WKJA 2ZVSA 1HNZJ 4HH0A 5JJBA 1IKWB 1IKYA 4LOWA 3S17C 5C4JK 2APOA 2MKKA 2EFPA 4KY3A 1R6YA 2PT0A 4M4SA 2HZAA 3RW6A 4TMZA 4QQBA 2FC9A 4F4AA 1ZVUA 2W9CA 1RT7B 2ZFHA 3ZBUA 1IJEB 1HL6A 3DXJA 3JSRA 2RKIA 3KL9A 1X9SA 1VRUA 1SL1A 1VBKA 1N33F 3QSYA 5DGBA 1VDHA 4UZUA 2OK8A 2H4YB 2I0XA 1MN9A 3D5MA 3QT5A 5KG7A 3MCOA 1NK5A 3PR4A 2GJIA 5DQGA 3BBFA 5J2MB 3MI7X 4ZITA 4A3GC 4USJC 2XS7A 5IFMA 2F1MA 4NA2A 2DNOA 2GGPA 3VVUA 2JEJA 3FPPA 2WVDA 1FNBA 1SM4A 4HDHA 4FYVB 1FVQA 3DGPB 2V6AA 2XZDB 3LWLA 4ZGNB 3M05A 1RHJB 3P4UB 1FKOA 1T11A 2F4VF 1SC1B 2XYPB 3ZFVA 1IR0A 4ZCLA 4QWCA 4QR0A 2QL7B 5KT6A 5L1LA 2QMUA 5HJXA 4HVZA 4LBWA 2RH6A 2AJFE 2Q6CA 5CHCB 3MPVA 2QYGA 4CT9A 5KTQA 2VFSA 3EVMA 1VHIA 3IR7B 1N5YB 1HHQA 1I3OB 5HMWA 1R0CB 4NI2B 4CO4A 1PAEX 2QN6B 2VHGA 3S2HC 1PYOB 3QJJA 2UUAF 2MQ8A 3FMBA 1RT6B 3HX9A 2DJWA 2KN4A 2V8GA 4OYXA 1VJSA 1EK8A 2QTWA 1WOPA 5KFTA 3EPIA 2ZXHA 2NPIA 2NZCA 3U6KA 3HMJG 1UMJA 4NZ7A 4OIQA 2JA6K 1U49A 2VNIA 3HOXK 2JA5C 3FC9A 1IBLJ 3FRZA 1X0PA 2VBYA 1I1GA 4LJZA 3CXCR 2AGQA 2YU9A 5L9NA 4M1KA 2P9EA 3NG8A 5JUMA 1S1TA 4ZJLA 5K8NA 4Y0FA 1LNQA 4JI0F 2V2VA 5T7LA 1XB2A 4J90A 1Q0NA 1V5VA 1P4MA 2E1AA 4MK7A 3POTB 4QIEA 1WIHA 1DBDA 1H0HB 2KVOA 2KM8C 3PDNA 1FKAF 4Z4WA 1A0OB 4Z4YA 1HKAA 4OYBA 1OWXA 1VLYA 3GIRA 5KFCA 1YK9A 4CYUB 4YEAA 4U8VA 3M7VA 4DPYA 2WVEA 2ROPA 3CMEB 2F4NA 4F0KA 2XWXA 3A3BA 3CMMA 3CO0P 3DGVA 4YHHJ 1F9NA 1VHEA 4I67A 3DRPA 3BSAA 3FPKA 2Z2MA 4WFBQ 4F04B 1NKBA 5GADI 1FDNA 2Y3YA 1M5VC 2FLPA 4WBFA 4LRAA 3UDLA 4CRJA 3CW2C 3GEHA 5DETA 1YRXA 2J8AA 4ZP6A 4JI7F 3OLAA 2JDJA 4JV0A 4Y7NC 1A8PA 3W9JA 4DFMA 2GK6A 2IFXA 2VH7A 1FKPA 2CPDA 3HK2A 4N76A 2YQ0A 1YGYA 1C4AA 2WZNA 1BE4A 1AB8A 4PG7A 3MEEA 4E2FB 2FZCB 3GV7B 2W9BB 4KPCA 4DG1B 4DV3F 2WYRA 2U2FA 2G0CA 4O0NA 1S7HA 1KK0A 1VQOB 1ZBSA 3CJ2A 3AJ2A 2J6TA 3OFGA 2A10A 2PIIA 2SXLA 1K0TA 4HI2A 5HANA 3TZWA 3TAMA 3BDEA 1U1QA 3OJXA 3EQLA 3OEHA 4KM9A 2YWWA 2JVRA 3AVYA 1SJQA 3IMQJ 2JZ5A 3G05A 3KJVB 1KTQA 1CLFA 2V5HG 2FPHX 3WY9A 1ZETA 1S76D 1NK9A 2H51B 4AF7A 3MM8B 3KEWA 4C0BA 3PO3K 4FF4A 1RAHB 3DOLB 4XKWA 1KVKA 2MQQA 2BW7A 1WQGA 3BO3A 5J2NB 3CJQA 3SV4A 4FF3A 2J9DA 3X1LB 1MMDA 1IBKF 2E2IC 4IFYB 5A8RB 1J5EF 1ZUNB 1T0TV 1U25A 5DM6Q 3A3OB 3O3LA 1TKZB 2LLZA 1HBNB 1D1UA 2VFTA 2N4DA 3PYFA 1FERA 1K83K 3DNCA 1XNRF 2P8TA 2NS1B 5IYNA 5IM0B 4PQUB 5HATA 3SZYA 1I3QK 1FDRA 3IN5A 2PHCB 1RISA 1B4AA 5IOSA 2IYGA 5D4NA 2HVEA 1AFIA 3RRGA 1F9FA 3TA2A 3R5DA 2CC2A 1Y1VC 5GV8A 5GAGU 4IH6A 2R8JA 2L41A 4A8KA 4JI3J 1Y10A 3I0SB 2E2HC 2PE3A 1I6VA 4U6PA 3I56S 2D3LA 1TP7A 5M2UA 1SC3B 4RDKA 5KFDA 1DTQB 3O6QA 5IYWA 1QFJA 5J2QA 4XSXA 4IUFA 3VZHA 5HMYA 4X4OA 4CM2A 2DIUA 2XGJA 3BEGB 4KATA 3D1OA 5DG8A 4ZPCA 1HVXA 2O5JA 4B08A 4I64A 1R0AA 4YXWA 1IJFA 2MY7A 3LA0A 2L9DA 1HBOA 2QMWA 3EZ5A 5ETSA 4FYYB 2WPDA 1Z2ZA 3T00A 5KFBA 1JLBB 2DEJA 1VBXA 4OOSA 3TNVA 4IOBA 2BANB 4WILA 2GJ2A 3GFYA 5K20B 2EKNA 2J0WA 3SFUA 1B7YB 3TA1A 4BXXC 5E33A 1Q5VA 1WHWA 3PUMA 4NCNA 3W2WB 4ZLPA 4LJMA 1WSVA 4NWBA 1K8AT 2ZXIA 1RBAA 4KBIA 4WWVA 4I2QB 1KLMA 4OZ1A 3MMPA 4AL5A 4CP5A 1Y5LB 3AVUA 1XXCA 1C2PA 2IRUA 1U6ZA 3EGNA 3GR1A 1U0SA 3AQPA 4Z7YA 3I4MK 1WCMC 1URRA 4LIRA 1INNA 2IVMA 1P1LA 3H2UB 4HEA9 4Z4ZA 1FHTA 4DV7F 2CQ2A 1PGZA 5DGAA 4QYZK 2WB1D 2J6SA 3LANA 1UVLA 4C8KA 4I7FA 4R25A 1NB0A 2F43A 1RJJA 4DV5J 2GAGC 4USKA 4K4VA 5D4OA 5T41A 1IUJA 4C3IK 4F25A 3VAKA 2WB4A 3M2UB 2B6AB 3D0GE 2RRAA 1KD1T 2GHWA 2VKZG 4ECZA 3LAJA 3OHBA 4C8YA 1XZQB 1IS1A 4WZEA 1R9TA 4LK0A 4EYIB 2QA1A 1Z2LA 2HHHF 2HCJB 4CTAA 4WFNQ 5AXLA 4BY7K 1R8PA 3GPAA 1QFYA 4A3MC 3D67A 3CCTA 1EX8A 2M2BA 1T9WA 3A12A 3BGOP 2VZ9A 3MHYA 2VFRA 1VQLS 3JSTA 4G7OA 1HZEA 5KT5A 3MM9A 4YFNA 2HMIA 1UEVA 1JQWA 1S6QB 2XYHB 3N0VA 1QD1A 4K2XA 4RUCA 4YFUA 3CCQB 2RHSB 3K5LA 3D4JA 4JI2F 3EGZA 5D4DA 4F4WA 1UETA 3SV3A 5C42B 2AWZA 1TL3B 3VQSA 2ZL7A 4C3HC 5IYBC 2C2KB 3BGRB 4BKWA 5THXA 4YQWA 4OOVA 1WUUA 3CCRB 3HOWK 1MG7A 3B4MA 4NXMJ 1FESA 2YX7A 6AT1B 3M8PA 5B0FA 4HH1A 4J9VA 4OPOA 4XPEA 2R7OA 4I68A 1HNVA 1TUIA 4A3DK 2FHKA 3TAQA 4DR7J 3AY0A 4DNTB 2OBTA 4NPOA 4YDDB 2VASA 4ECXA 1LXJA 3KLHB 1XMOF 3C16B 3EM1A 1VQ8S 1S1UA 2ZZGA 4I69A 1E6YB 1X9MA 3LP1B 3I9V9 4JI8F 4CO2A 2B63K 4RKUC 4NLPA 4CLUA 4GVBA 1H7WA 2OHDA 1ZPVA 3HZGA 1FTRA 2KT3A 3WODA 1YHQB 3NCPA 4ZP8A 4Y28C 3RGIA 2OAUA 4KFBB 1Q16B 3HSJA 1K28D 1VQYA 3MF5A 4WU3A 3GTLC 1S72B 3ULHA 4B3OA 4RBVA 4OV6A 4X62J 4A3JK 2V0NA 4MIBA 5A6WA 3GTPC 2M4MA 1D3WA 4Q5VA 3ZUGA 3M32A 1WC5A 3QGIA 1YJWB 3MCNA 2CZ4A 4K4UA 1S9EA 2X7IA 1FXDA 3S1NC 3NXZA 1KRPA 2XLIA 2CKWA 2LQ5A 4DSEA 2IY5B 3WQPA 3MCSA 4P71A 5D3GA 2IM0A 2C2EA 4RW8B 4GQNA 2NPFA 5DM7Q 5HJYA 1WACA 2DHXA 1G7TA 2QEXS 2ZDOA 2DY9A 3M6UA 4TY9A 2CG8A 3QATA 2BRKA 1NKEA 1QY7A 1O2AA 4TMTA 2W2MP 1U1NA 5CH7B 3OKXA 3T1AA 3W2HA 1CBKA 4DQKA 3LQEA 3VGVA 5AE3A 4ECTA 2UVUA 5CCLA 2LCWA 4USUA 1NUEA 2AYBA 5B0DA 4O4GA 1S9FA 3NAIA 5KFMA 2YWKA 2XY7A 4XLFA 3HOZK 3DHXA 3CWJA 1W2BR 4YY3F 2AGPA 1TKXA 2XMMA 2W7VA 3S8SA 1SQEA 2A6HA 2ZH5A 3DDKA 2XMWA 4ED5A 3EX7B 3MPWA 3BH6B 2BA9A 4ICLB 3V4MA 1N0VC 1S77D 3OVBA 1WQHA 2V2QA 1JB9A 3PX0A 1CQXA 1I7PA 2VYQA 4N47A 3JQPA 3GIJA 2ZH3A 4UZBA 3OR2B 1FRIA 4TSFA 5KT4A 1M5KC 2EIXA 3W5XA 4UOCA 3U6BA 2OPRB 3PO2K 1T9YA 3GV5B 4A46A 1OYEA 2W8LA 3G8SA 1UA0A 5IYCK 3BY2A 3I96A 4QIFA 3J7ZT 5EWGA 3HM9A 1I50A 3CEDA 3F73A 3TX0A 4KKSA 3D54A 4ZK7M 2RDIA 1UVKA 2QA2A 2DNQA 3H98A 2W2QP 4Q2LA 1SUQB 2RJZA 4O2DA 2DOGA 3BYPA 3CP2A 4YAWA 1VJQA 1S48A 2E9RX 1RT3B 2RE1A 4OYPA 3ONQA 3R6JA 3GEEA 3MR2A 2F7VA 1FRHA 4LVOP 1EQ0A 2ATLA 3G86A 1LWCA 2Q3PA 2CNOB 4M5IA 3KK1B 2M5YA 5F0WA 1WPCA 5LXYA 1XQIA 2Z58B 2ZBPA 3QGGA 3ZZRA 4CDIA 4M53A 1Q8LA 5E3RA 2XY6A 3FSIA 1TELA 1RDRA 4NOHA 1RB0A 2EVZA 2H48B 1S1VA 2DXDA 3JS9A 3S14K 3B4DA 5TR9A 3HHLA 1OY9A 2W4PA 5E41A 4J9KA 4G1BA 4YB5A 3DLEB 5K5MA 1NDKA 1C0TB 1K1QA 2YKMA 4RW6A 1SKQA 3SDEA 4ELTA 3TO8A 1TK0A 2CFAB 2OH2A 2WVFA 3BYRA 2XNCA 4PC3A 3UDEA 2R7QA 5IYDC 1CJVA 3QLHB 2K2PA 4DBQA 2DBBA 1TL7A 1FRJA 4DPXA 4P7VA 3T9NA 4K4TA 1HWLA 5B7WA 3K7RA 4OI0A 3BKTA 4G3IA 2FGCA 3GV8B 3S16C 2DXFA 2FY1A 3PIPQ 3TARA 3C15B 1PBUA 1VI7A 4V19X 3D28A 5KFKA 3QPIA 3ZTOA 1TWCC 3JSYA 5HROB 4A3FK 4Z37A 1IBMJ 3F56A 4P2FA 5B08A 2CJKA 2DR7A 1F5BA 3FGVA 2MEWA 1D1NA 1EB0A 2KO1A 2V4JA 3DRSA 1JA0A 2E7XA 4EBCA 2C3UA 3WC2A 4Z4VA 5AXNA 4KMAA 1RTJA 3K8VA 4ES3A 4RNOA 5CD4H 3GTQK 2ZBIA 2HSEB 4HHHA 2Q66A 1Y11A 3MURP 2I1RA 2R93K 3IS9B 5M5WK 2A3JA 4CLLA 4A3BK 3QJPA 1NDHA 1EFUA 2CQ1A 4ECQA 2ZEJA 3JSBA 2MGZB 1N36J 3EDQB 3TJ9A 4LREA 1QAIA 3C14B 3SIPB 1OSCA 3DRXA 5C5JA 4QZVB 5C24B 5F8GA 4Q5SA 4KV8A 4JI4F 3DRRA 3HVRA 4J3NA 4DK1A 3R6LB 3RUBL 2HLTA 4IO9Q 2YX4A 2WZ1A 2V7UA 1IJEA 5HN0A 1S4MA 4LF5J 4ANEA 3U27A 5HXBA 1Y1WC 3P49B 1OQ3A 1H85A 1N0UA 3GQBA 2VPYB 2VUMC 3BQ0A 4XDCA 4X7DA 1LKZA 4H4OA 4B44A 2BYCA 1KONA 1B23P 5A8WB 1F0XA 3JQMA 2BQ3A 2AW0A 4NA1A 1TUWA 5E3QA 1H42A 1YLOA 3GTKA 3K0JA 1VLOA 5GMEA 3DKDA 1GE9A 1VQ4S 4RDJA 4DF8A 2O01C 3RZDK 4C98A 4RD6A 4HACA 4QIVA 3LNNA 4P6VF 2BUNA 4Q43A 5KFSA 4WYLA 4II3A 1HARA 4C0HA 2JC0A 4M94A 3OW2B 4X84A 2BOPA 4NLVA 3PFEA 4FF2A 3ET6B 3HOVC 3DGPA 1FA0A 4DS5A 2VNHA 4F0MA 4RU9A 4B48A 1XIQA 2Q43A 4KH1B 4NOIA 2MKHA 1N33J 3DLLQ 4G6IA 4KRWA 2QG9B 4P5BA 3BR8A 4A8FA 2R92K 1U1LA 2RS8A 5BJRA 1TWFA 1EETA 5D6GA 3CC7B 2R7WA 4WZQA 2YKNA 4M5KA 3OZWA 3PFOA 1I6JA 1BHNA 1O51A 1X8DA 4IR9A 3E01A 4CH7A 4OIRA 4J5OA 2M70A 3C66A 4B43A 3MECA 5ETQA 1JLEB 2F4VJ 2Z56B 3CC4S 1O6XA 2OFGX 1RBOB 4M2LA 1VQ5S 1R8CA 1KK2A 2XQCA 3H94A 2EW9A 4LF1A 4QJVB 4WK1A 2FB0A 4ZVSB 3DC2A 3CD6B 2CQGA 3HHEA 3PV8A 1L5UA 1P8GA 1IB0A 4ZPTR 2VJUA 3QT6A 1U1MA 5GMKa 3RR8A 3NCQA 1DLOB 1W35A 4XL9A 4K4XA 5F9NA 3KMSA 2XZLA 2UUAJ 2G9OA 1N8RT 3POTA 4YFXA 3TUJC 2RU9A 3OL9A 1WG5A 2O5DA 4NE9C 2ZE2B 4YFKA 4KC6A 1FRKA 3QFWA 1UJ5A 2QYCA 3OFHA 1NMEB 5HBMB 5E3CA 4X64F 2L48A 3DI6B 2DH9A 2YQ1A 4OIXA 4FBUA 4DR4F 1FFGB 4HR2A 4JI0J 3SLNA 3H59A 2PPBA 1RWKB 4ZCKA 2KXFA 5KFWA 3O5TB 2HLUA 1JJ4A 2OO4A 4WCEQ 4B3RJ 5LMZA 3SSRA 3H40A 4J9OA 2PA8D 3W5YA 1LK5A 2Z30B 1VGYA 5T14A 2BDPA 5M5YK 3MMAB 4FPIA 4OI6A 4N8NA 2CPYA 2Y1JA 4RUBA 1ZM4A 3GTMK 4C6AA 1UKUA 2LFVA 4RUHA 2VZLA 4Y2CA 4TQSA 2BBEA 1N05A 3L3CA 1QVFR 2CYYA 2J76E 2C1EB 4X4SA 2HZVA 4WZTA 3B82A 2BACA 2NYIA 3K2YA 4R5PB 3M8RA 5L1IA 2VQFF 2C42A 4X4TA 2ZH1A 3W5UA 1W2BB 1S99A 3BKUA 3OFNA 3M2VA 1SFOC 4IYQA 1OHHA 5EUHA 3Q38A 1O0PA 2EBGA 2UXDF 3KG1A 1ZYRA 5GVQA 1BGXT 2LQJA 2XCQA 2JA7C 3LVBA 4DV3J 3GVKA 1NBMA 4TXSA 5J2NA 3RZOK 3T5LA 5M3FK 2YNIA 1FRMA 3ICLA 2HHVA 2WHOA 3QIPA 5J1EA 3ENWA 5LSLA 1WF0A 4KE5A 4KC5A 4DLGA 3P5BP 4A3GK 4QWDA 2PMWA 3T02A 3VVTA 3DLGB 4JV5F 1DRZA 4PQUA 4C3JC 1KJZA 1LWFA 2V8HA 2RUSA 4C2MC 1OB0A 2ATCB 2D74B 2HGMA 2IRXA 4RMFA 1QFZA 1AXQA 1GEHA 4WJBA 1WQFA 4MFBB 1E3XA 1HQMA 3WC0A 2PMZL 1Y7PA 2MZSA 2DHAA 3IRXB 2K8GA 1IBKJ 2KM8B 1J5EJ 1A6LA 5DN6A 5IQ6A 4O3OA 1TKTB 4ZIWA 4K4ZA 4WKRA 3M9NB 5IZHA 2B7BB 3JB9k 3E1YE 1PIEA 3FBEA 4JI6F 1XNRJ 1DHMA 2JEIA 2DEIA 2UZAA 4N3GA 1IHMA 1G4CA 2AYMA 1JX4A 3CQZC 4TKOB 1JJCB 1XMBA 1YX2A 2C2ZB 3S2HK 4YALA 3FBFA 3TJAA 4DF4A 3HOUC 4XLNA 1OB5A 4X2BA 2JLEA 4N56A 3L95X 3ITHA 1JLAB 2FX3A 1JLBA 4G1QA 5DLFA 3EXYA 2DHHA 3CJ3A 2KHDA 3E8OA 5G0RA 2JA5K 1N88A 3TP2A 3N5BA 3ZZZA 3OOCA 1WF1A 2CPIA 4NMLA 4IO1A 2N3LA 3H0GC 1J5OA 4J9LA 3HFZB 3DOKB 5KFJA 3EXCX 1XZPB 2YNGB 4E8UA 5EWFA 4DV1F 4DHVA 3RBDA 1SJRA 2QO3A 2X6WA 2YNFB 1SL2A 4R0JA 1DCOA 3BREA 4QIWL 2IJNA 5C44C 2KDOA 4A3LK 2CRLA 4G1IA 1E62A 4RWXA 2CFXA 3AD9C 1G7CA 5C4XK 4EI2A 3FEZA 1V3ZA 2NVTC 3OL8A 1XJWB 1F7VA 1BQXA 4L72B 2Y1IA 3BQ1A 3GFXA 3CUNA 1TFWA 1OYDA 4BY1C 1X4GA 3LO8A 2H5JB 2OSRA 3VA7A 1HA1A 4RJVA 1V6HA 4Z2XA 3GMGA 2E2IA 4F3MA 2JA8K 2CBXA 4O3RA 3M2UA 4J9QA 3C3LA 4F7DA 3I87A 1RAOA 2XHCA 2JN9A 1FNXH 2IVYA 1O2FB 3KWMA 4Y7NK 1I94F 4K4WA 4CO5A 3CNQP 2FJXA 1HNZF 3IG1A 4Y34A 4A3EC 2I5JB 4DV7J 1R3NA 4Y65A 4PUOB 1S9GA 7AT1B 1Q95G 2CDQA 1YCLA 1U2RA 3AVWA 3G8QA 1FD2A 3A35A 4JYAF 2AF6A 2FLLA 3P26A 1BQNB 1ZAWA 1HWJA 3Q83A 2WTFA 4NCGB 1M5HA 2E2HA 2YU9C 2CADA 1JLCA 4URQU 2H5IB 3H3VD 2BE9B 5HZAA 1Q86D 1I18A 2E1MC 4RO0A 1N06A 3M9MB 4G7WA 4RBUA 2DGTA 1H98A 3W1YC 1NK0A 4C7QA 2BE2A 5KFOA 4QOTA 3AJDA 4OZ2A 2VKRA 3IPJA 2HHHJ 5E68A 5K8MA 1M1HA 3UD5A 2B4PA 4YG2A 5EDWA 3VMFA 1AA1B 4ANDA 3KMQA 2ZZTA 1X0FA 3QSIA 3I56B 3V4IB 2HFNA 3BSCA 3TEGA 2LECA 1HQ2A 2GQCA 1RWOB 4RDLA 3NEKA 3TAPA 3AHPA 4TLRA 3PA1A 1PAUB 3QJLA 1RTZA 2Q6IA 5DSZA 2JEFA 4WZKA 1HNWJ 2R8KA 2UXCF 3KLHA 4DU8A 3Q8VA 3CTRA 2R7TA 2CQDA 3T5JA 4ZVQB 1XR6A 1DDIA 1UWBB 3AH6A 2GFFA 1Y0HA 2HGLA 4LSNA 2DCUB 3CJTA 5F0UA 6FD1A 1NNDA 3FBCA 5IORA 3A3PB 2W01A 1Y1VK 4QW8A 1M90T 4CLSA 2JX2A 1SMYA 2VPXB 1B4SA 4KGXB 1DZ5A 4DR1F 2GJKA 2CJBA 4R8UB 3AAWB 3IBFB 1WCMA 3OUYA 4X65F 1QUPA 1HD1A 3OTCA 5GV7A 2LEAA 1F9HA 1J98A 4ZVHA 2AX1A 3AOAA 3JTOA 1VRTA 4OHYA 3VV2B 2RDJA 1D8TA 3H5YA 2XI3A 1UD8A 3QRQA 2HW3A 1IE0A 1RCOB 2QT7A 3T1HF 3H9NA 1U26A 2R7ZA 1X4AA 5HMZA 1RWPB 5IWAJ 2KT2A 1IM4A 2MLZA 2LU2A 4IQMA 1ZM9A 1JOEA 3KK3B 4I2PA 2IC3A 1PG5B 2RB7A 4P2XA 3JXOA 3I31A 2ZH7A 2AU0A 3CESA 4P72A 2GVZA 3AOBA 3EZOA 3DXBA 4BXXK 4OQJA 1UWAA 1DDGA 4RWWA 4II2A 1UD4A 1FX2A 4O0IA 4RLZA 1W87A 5C25B 3BGUA 4NYOA 5A88A 3BJYA 1TTTA 2HWHA 4RR5A 4BBSK 5F8LA 4XR6A 3GTGC 3ONYA 4YHHF 2MQLA 1YG0A 2V4QA 1JLGA 1X4EA 2HNZB 1KQFB 1IL2A 3ENQA 3TVYA 4A3IC 3EGWB 4B3FX 2UUCF 4LQ9A 2RH3A 5KG3A 2R7VA 2YKQA 3C8YA 3MAHA 2LYVA 5EGYA 5AXKA 5EGEA 3MEGA 2XLJA 3ZC4A 5KT2A 2BKPA 3TVKA 1C1BA 4DDQA 2VBWA 3LO3A 3ETOA 1VQLB 2R2UA 4IRKA 2I2YA 4CQJA 2HFUA 2QTLA 4LF2A 3KHHA 3VO2A 3FEXB 3OR2A 1QVFB 1GH8A 2ASDA 1U7LA 4DZ6A 4AYBD 2BJ7A 1T05A 4ECRA 1YBTA 2IDLA 5D4LA 5CXTA 4EZ9A 3PO4A 3JYTA 4ID5B 2Q6BA 3DU6A 3EE3A 4DPOA 3CC2S 3BCFA 3MAAB 3TOQA 3PTWA 4WFYA 5FD1A 3L7OA 2L9NA 3FRYA 4Z1MA 1QGZA 4YY3J 2PEBA 4QVAA 1T03B 5CYMA 4O3PA 1KQGB 2DTJA 1UEKA 2XG8A 4EEYA 3GE9A 1ZQ1C 3AFGA 4A3MK 3PVDA 4ZKAA 3CD0A 2VG5A 1IKXB 3AGQA 2R7XA
chains in the Genus database with same CATH topology
1WOOA 3TTGA 1VLOA 1PJ5A 1WOPA 2GAHC 3AD7C 3TFIA 1WSRA 4P9SA 3GEEA 3TFJA 4PAAA 3GEIA 1WOSA 1WSVA 3AD8C 3GSIA 1NRKA 3GEHA 1PJ6A 1XZQB 4PABA 2GAGC 1VLYA 3A8JA 3GIRA 1V5VA 1XZPB 1PJ7A 1YX2A 3ADAC 3TFHA 3AD9C