1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
1VLYA 1WSVA 3A8JA 3TFJA 3A8KA 1NRKA 3GEIA 3GSIA 2GAHC 1WSRA 1V5VA 1YX2A 1X31C 4P9SA 1VRQC 1WOOA 3TFIA 1PJ5A 3GEHA 3TFHA 3GEEA 4PABA 1XZPA 1PJ6A 1XZPB 1WOPA 3ADAC 1VLOA 3AD8C 1PJ7A 1XZQB 1WOSA 4PAAA 3TTGA 1WORA 1XZQA 3A8IA 3AD9C 3AD7C 5L46A 3GIRA 2GAGC
chains in the Genus database with same CATH superfamily
4A93K 2V2VA 5L9XA 3OEHA 2DNMA 3SDEA 2I1LA 2F3JA 1TWHA 5C4XC 4WP9A 1A6LA 3MM9B 3UFCX 3G82B 1S0MA 2LEAA 4RDJA 2CJBA 4P73A 2JLEA 1RK8A 5KFZA 1XNQF 4BBSK 5HBMA 3GTYX 4KN4A 1JQWA 3ZUGA 2QMUA 1I3QC 2F4VF 4WIQA 5B7WA 2AQ4A 4EBCA 2AEFA 1SC6A 4I2QB 2KT2A 2YWHA 3KLHB 3VAFA 1MU2B 2MJNA 4DSJA 1FKOA 3T6BA 3MMBA 4FYYB 3GTPK 3Q86A 1R8PA 1VQOB 1R0BG 4EYIB 3GTKK 2ZH4A 5HL7Q 2AV5A 3KLVA 3EPIA 2GAGC 1RWMB 2BRKA 3FZ2A 3ILJA 4F4AA 5KFMA 4DS4A 2AYGA 1VQ8B 4DL6A 3I1FA 4RCYA 2NXUA 3D0HE 2GVZA 1Q8KA 2GA7A 2OGUA 4PG4A 1T5EA 2QZ8A 4DUYJ 3QNWB 4LOWA 1P6TA 3KLGB 3VGVA 5LL6d 3WIUA 3CXCR 4WCEQ 2RDDA 3CJSA 3GIRA 1ZA1B 2XCRB 2KRRA 1G7CB 2VBUA 2KXFA 2L9WA 2NS1B 3ZIAA 1VRQC 2E9RX 2VOOA 1Y11A 4XMYA 3QAEA 4Z4WA 1RU1A 1IBLF 4WILA 2Z56B 1ZYRA 2QL5B 3KJVB 4C3JC 3Q6QA 2XEXA 3M8QA 5IOQA 4KQZA 4RBVA 3L09A 4RCZA 1GMVA 2DXDA 1TL1B 3EXYA 3MMCB 2OMOA 5GVQA 4ZDNA 3QZ8A 1TELA 2OEKA 2XLJA 1T94A 3NCRA 5BSYA 3VAKA 2ZHAA 2PFDA 1ACMB 4ZVRB 1RXOB 2J76E 3OW2B 2VHGA 4IOAQ 2PA3A 1WCMC 2C2MB 4KGMA 2VH7A 1DAXA 4Q5SA 3SJPA 1BWVA 2I0XA 1YJRA 4LK0A 4B08A 1RTDA 2DOGA 4TT3A 3P3DA 3WBZA 1IQ0A 1AUDA 1KK0A 4NCAA 5IV3A 4ZLNA 2VB6A 2RH3A 4RW9B 2ZM6F 4LF1A 4Y3CA 4L3NA 3Q24A 3QBCA 2DIEA 2MKYA 2IRXA 3ZZTA 3CVKA 3PXGa 3CWJA 5KFWA 2MZQA 3MR2A 2C77A 3K8WA 3D1QA 2CPEA 3G8TA 2XGQA 4UUXA 4NXMF 1RAIB 1QE1A 3OXLA 1UVMA 1RT7B 1X0PA 2M0GB 3FOFA 4DWIA 1COWA 1K28D 3ZC4A 3QJLA 1RACB 1ZXOA 5F8LA 2ZC4A 2C1EB 2RT3A 1S1UA 2HBZB 3VVTA 5I3UA 2IVFB 4X4PA 4DNRB 2DGUA 1SXLA 5AE2A 4XOTA 4FBUA 1B70B 3OD2A 4LBIA 3K5PA 5EGHA 4B17A 4L6V3 1T9YA 4DFJA 1MABA 4PXBA 3LA0A 4GTEA 4B9UA 4NE9C 1BMFA 3R1LA 2G13A 4Y52K 2PC6A 1K9MD 2UVRA 3BNWA 4WU2A 1PG5B 4ACBA 3QT6A 3I4PA 2AZ3A 1NXIA 4M5KA 3MEKA 3HZGA 4X4NA 1KP6A 2JJ1A 2HZAA 1FDBA 1HPZB 2W6IA 2NYIA 1LXJA 3UCZP 4DR5F 1WC0A 1TL4A 1MMNA 2VBZA 1FK9B 2X1BA 2G0CA 2DNNA 2JVRA 4U8VA 4M5NA 2ZH8A 3D3CJ 2Y1IA 4JK1A 5K9FA 5IYCC 2YWWA 1YJ9B 1FNDA 4G7XA 5I3PA 3NEKA 5DZ6A 4LFCJ 4O44A 2V34A 3HT3A 2VZ9A 4YB5A 5IQQA 3CCTA 1K8AT 2NZ4A 1T6ZA 3FZBA 2YKAA 4G6VB 3ERED 4R8UA 2QSFA 2F7VA 3P4UB 2HNDB 3PEHA 4HDGA 1MG7A 3EVMA 3D0GE 1HA3A 2J0WA 4CLZA 3LW5C 2JC1A 5A8RB 4X6AC 1LEOA 2B8QA 2XULA 5TMFA 3GTOK 4OJ1A 2R2TA 4CH0S 4KMDA 5RUBA 3VZIA 4MKAA 2HPUA 4FDFA 3I0RA 3Q3QA 4ILRA 3HHDA 2QN6B 4KHRA 4LF9J 5C4XK 1UZDA 4NA2A 4YDXA 1X4BA 2BEFA 1S7HA 4YXWA 1S4FA 3Q0AA 2F1FA 3BV8A 3GILA 3BSCA 4NRTA 1HNXF 2A6MA 2BA9A 2HS4A 1SKYB 1C0UA 1URNA 3QJPA 3FCVA 2XS2A 2CPFA 5AXMA 4DXLA 2E7XA 1AUSL 2RAQA 4ZIWA 2EFQA 2H51B 4AXIA 2R6HA 1KVKA 3TA2A 5KFBA 2XSJB 4AL5A 3K17A 1Y3JA 4NLPA 3QX3A 2VDHA 3O44A 2VOPA 4ZVUB 2RVJA 1GXTA 4RW9A 2YPYA 3PNIA 2GZOA 4X66J 2EC0A 2X3GA 2BE9B 3FMWA 3LVBA 1NBMA 4KY3A 4RW4A 3TNVA 4QIFA 1VGYA 3OFGA 3DRRB 1RCXB 3KLFB 4LIWA 3Q89A 1QSYA 1H0HB 1FWPA 4M1XA 1BXNA 2QV6A 3NBPB 4GVBB 3M05A 4JYAF 1VBXA 4TKTA 3VVUA 1U02A 2ROEA 2C3MA 1VIXA 2MHEA 1Q86D 2M8HA 5M3MK 1RGVA 4G7ZA 1YRTA 3HFVA 3IM9A 3THPA 1WSRA 3NXZA 3P45B 2DO0A 1WF2A 2V6SA 5H9EK 3M8ZA 4WJBA 1FJCA 2X6WA 2YNFB 3DLGA 3CCRS 3LWLA 4WYWA 1YDLA 2MKHA 4B48A 3UDEA 1SMYA 1KBRA 5DM7Q 5IYPA 1JLAB 1KVJA 1JJ2B 2OTJB 2MQOA 2YKNA 3ILOA 1QE1B 2R7TA 2WONB 4XM3A 1U1PA 2CNDA 1VQMS 1RT5A 1H38A 4ECSA 1VC0A 4G3IA 4ZPBA 4OFZA 5GAEU 2H5EA 3GSIA 1U6ZA 2VDIA 4R5PB 3ISND 4GO5X 3A1YG 1G51A 5D0HA 2CPXA 4PCQA 3CCES 4DR6F 5HAOA 4DJBA 1K83A 2C2RA 1WPCA 4OX9J 2E29A 4NLXA 2RQMA 3ICLA 3KLIB 3GQBA 3PHTA 1DARA 4N7TA 3W2VA 1BD6A 1RUSA 5D0GA 3C15A 3RB6A 2HNYA 1ROFA 1Y1WK 4K5SA 5G0RA 3H7HB 2YNGB 2E1AA 4ZK7M 4NRUA 2DGOA 4G1QA 1UA1A 5KFVA 4ZCIA 4NXMJ 1UJ5A 2E5LF 3NY0A 4HHHA 4PG8A 4WTOB 3UVJA 4AT1B 1X5OA 2J0SD 5HJXA 3TZWA 4X7DA 4YAOA 2CRLA 3W2EA 4W90B 2MZSA 3M9NB 1NKBA 4M5IA 2XCOA 3B4DA 4JV2A 1XQBA 2HFUA 4NLSA 4KJIA 4N3GA 1FJEB 3CE8A 1IN0A 1IJFA 2AWZA 4DCJB 4FPIA 4XO0A 3OJUA 1DCOA 4P2NA 4IFYA 2Z58B 2KG1A 1WF1A 3ILIA 4QIGA 3W5XA 4Y7CA 2KJWA 1KQ4A 4F3QA 3LP2B 2WVEA 4O0IA 5KFXA 1NSAA 2OPRB 2GW8A 1T95A 2AW0A 1RSCA 2WJVA 3HKWA 2B6AB 1S0UA 5IOSA 3A12A 2JX2A 3T56B 5EN1A 2ZFHA 1RT3B 4ES2A 2JDJA 2HVZA 1H2UX 4IRDA 4YR2A 2DR6A 4A3MC 1C1CB 1R27B 4ERDA 4LUBA 1VQ4B 4L75A 4C0OC 1T9WA 3T1YF 4BLAA 2KT3A 3G4SB 2DETA 1O2FB 1N07A 4PPZA 1ZM3A 1JB0C 2WSSA 1H7WA 4LSLA 4DFPA 5C3EK 4L76A 5J2QA 1Q16B 5BYQA 1S59A 1TZ0A 4LMZA 1CEZA 4DQIA 3CCMS 2XNRA 5HBMB 3I31A 3I5CA 4RD0A 2PMHA 2QT7A 3CQZC 1OSCA 2G4BA 1P9YA 3HXAA 2OI2A 1E79A 3BM7A 4XNFA 3TEGA 2RQCA 2Z4PA 2FC8A 1SFOK 1JLQB 3M1VA 1P27B 4DDQA 4RD6A 3TVZA 3O8WA 4Z1MA 3V4MA 1UV7A 3WNBA 1FNMA 5CHCB 3ZTOA 1T03B 3SFGA 2YWEA 2CG8A 1TTHB 3QIPB 5JMNA 3S1NC 3HD2A 1JVIA 2E2HA 1X60A 3SZYA 1QFJA 1SV5A 2MQNA 4WK3A 3RW6A 4P22A 3QIDA 1INNA 3Q38A 1FI4A 1RT1A 3H2UB 4LF7J 3W5VA 1MROB 1EP2B 2A68A 5T7LB 2B43A 4ZPWR 4DR2J 3U6KA 3I4MK 3R5BA 5KT3A 4XONA 2MTLA 2XI3A 1S6PA 3CCJB 1LFWA 4ZVPB 1I1GA 4IRKA 3JTNA 2CFAB 3IRXA 1TL1A 1RAEB 3IM8A 2HZCA 2OYNA 4UW2A 4MH8A 4Y2KA 3I9ZA 3MOJB 4F4ZA 3PIPQ 4EWTA 2VBXA 1WQGA 1SV5B 4BBRK 4J3NA 3AVVA 1VQ7S 2HFZA 1DD5A 1QSSA 2OEMA 1SI9A 1CQMA 3JAMY 2C2EA 4X6AK 4Q8FA 2KZMA 4FS1A 4DSLA 4RBTA 1ZM4A 3R6KA 1NB9A 2ZZEA 3W2WA 3T5LA 1HARA 3S14K 4AL7A 2POKA 2CQ2A 3MR7A 1CS4B 5H9EJ 4UZBA 2KJVA 3CD7A 4RW6A 3JSMB 1GXLA 1FDRA 2BGJA 5CCMA 3D54A 1U4BA 1CVJA 3UVJB 2R7RA 2ALYB 1ITPA 1RI7A 1MWZA 1QGYA 3BDEA 3ADAC 1I6JA 1ZBSA 2PDAA 2V2ZA 4PG6A 1NSPA 2C4TA 3KUGA 2G2YA 3T5HA 5AE1A 1YI2B 2C3YA 4LBYA 4MAKA 3HHLC 4U7UK 4I6YA 3H2LA 2ZZGA 1Y7PA 3UO0A 4DR5J 1NM2A 1EARA 4CIOA 1ZUNB 2VJIA 4U8YA 2MHNA 1ZA2B 2NVQC 1K8AD 2BJ8A 5HO4A 4WE1A 4USMA 2UUWA 2VG7B 1NK8A 4TMTA 3H59A 5DDPC 2OPQA 2X1FA 4C98A 1TVRA 4RD4A 5ETNA 3T3FA 2IYGA 2JLFA 2BOAA 2F4NA 1SKWA 4M0LA 3CJ3A 3KLIA 3A8JA 3W64A 1FEHA 1YRUA 2HQIA 3OVAA 2JJ2A 4XIUA 2E9TA 4C4WA 2RH6A 3EGWB 1BX0A 3PW0A 2MLZA 1ZM9A 3MMJA 5F8GA 4IR1A 8ATCB 4NL5A 2ABYA 3Q8SB 1HWLA 4IRCA 1RTJB 5BXIA 3SEJA 2CQGA 2GGPB 2V4JB 3TJ8A 4U95A 3OTOF 5M3FK 4XKWA 5HROB 2KVOA 4YELA 3FGVA 1VK3A 1XK8A 1U8SA 2KKHA 3H20A 1Y5IB 3M1VB 4HHJA 3NE5B 2BR0A 2M3DA 3GTQC 1SJFA 4HH1A 3ISZA 4LBZA 5KT7A 4AC9A 1HW9A 4QWAA 1S0OA 2XY7A 1S9GA 2HMIA 3ASSA 2GVZB 2XMVA 4TKOB 3WNDA 5KNLA 1TWHC 3CCMB 4RX6A 1U1MA 3TTGA 4OI6A 1FXDA 2RC5A 1E43A 5C24B 2BRLA 1YJWS 1KLMA 3UDCA 4K4UA 3WXMA 4C8NA 4K50A 3R5GA 2YNHA 3MM5B 1R6VA 5DG8A 2OTJS 5IYNA 3NGKA 1X4FA 4CLWA 1S4MA 1QDUB 2GMLA 2OELA 5I42A 3N79A 4Q5VA 1SM4A 3QFCA 1UEKA 1N48A 2XO7A 1H98A 1N32J 1TMMA 4OZ0A 5FIIA 5H5JA 5M5XK 3UCUP 1HBMB 1S48A 3FKIK 4RU2A 4UQTA 4X05A 3KDNA 2X53S 1W34A 4JYAJ 4WZEA 1C4AA 2IM3A 3B54A 3Q3AA 2HAFA 3QZ7A 2VG6B 2OAUA 1NRKA 1QJHA 5M5YK 4X4SA 1DQ9A 2UUCJ 4ANEA 3MURP 2KDOA 1BQNB 5KFFA 2PFFB 4KIAA 4LF4J 1S1VA 4EO6A 1R31A 1GFWB 3G87A 1AB4A 9RUBA 2AT1B 1PILA 1JIHA 3DDIA 4C0SA 3HOYC 4TN2A 5ITHA 4A8MP 3GG1A 1N08A 3D67A 4X07A 4G0UA 2XI2A 1TWFK 3HHLD 1S4EA 1K0VA 4F02A 2QEXB 2NUUG 1VMBA 5D4DA 1QY7A 2V7UA 3HHNB 3OLBA 4LSZB 1SUQB 2YWFA 4PUOA 3W9JA 4FYDA 2W25A 1KQFB 1F5CA 3I56B 4H4OA 4J7CA 1VJEA 2DHXA 1KLNA 1I94F 4IG0A 3M9MB 2LYVA 4RUBA 4ICLA 1YIJB 3HOVK 3RG6A 1CQNA 4DL4A 2BJ7A 3EWGA 2Z57B 3IMQJ 2CZ4A 4A3FK 4RPDA 3K7AC 1JA0A 3HOUK 5IYWA 2MQPA 3QIPA 5E3PA 2VG7A 3PR5B 1RHQB 2G9OA 2UXBF 4KKTA 3MGJA 1FX0A 1HNVA 5C44K 3H42A 1IR1A 4YALA 3MM6A 1FD8A 1SBRA 2EBBA 3CT9A 2RS2A 4WXOA 2Y3PA 1U2FA 1F20A 5T7LA 2XZWA 5HQ8A 3KK2A 2AEJA 2E5LJ 3ZNJ1 2MEWA 3NGDA 5L1JA 4P5AA 2R92A 2XMMA 4WXWA 5GADU 1E1QA 4X4OA 1IBAA 2XWYA 4BWJA 1EFTA 5TY0A 3MXHP 1KWMA 5LXRA 2AJFE 3OV7A 2XG8A 4IO1A 5A2QU 1D8ZA 2J9DE 1TKZA 4F25A 4LSNB 5B0CA 1BQMB 1Q78A 1JNRB 4H4MA 1R5BA 1X4CA 5L1IA 2HQ3A 1HMVA 4FPRA 1RWWB 1HQUB 2XTJP 2MPUA 1BHNA 3N4WA 4QBUA 2VIHA 4TQRA 2LQBA 3LQEA 5L8RC 2MGZA 1HZEA 1IKVA 4YFXA 3ENVA 1LW2B 3VALA 2HQGA 5F3TA 1URRA 1KOHA 1KZLA 4J0QA 5DQHA 5BR8F 3PCOB 1T3OA 1S72S 2LXIA 4CT8A 5EWGA 2CPDA 3PACA 5C2CA 1M5SA 3GTMK 2W2MP 5A8AA 3NS7B 2OTLB 2C3UA 3T1YJ 2UUAJ 1LXNA 3KK3B 1JWWA 4KMAA 1B23P 4NOIA 3H0GC 3PJXA 3QT5A 4YFUA 3GONA 5C42B 4AL6A 4TQSA 4OZJA 3HVRA 2GK6A 2HDNB 1X4GA 2OK8A 1LW2A 5EWFA 3OTOJ 3DM2A 4LF6J 1EH1A 2FJDB 5ETKA 3M2VA 3P6YC 3M2UA 5CZXA 3CCJS 5KT2A 3AFGA 1ZVUA 2RSQA 4D3HA 5HQLA 4UTGA 2V9WA 3GLJA 1HVXA 3O5TB 3UQSA 4B47A 3OFFA 3T41A 2KFYA 2ZFZA 1N5YA 3VAJA 4DSKA 5FLXY 2R7ZA 1YNJA 4MIWA 3EVOA 3D6FB 3BBFA 3RJMB 2BW2A 1EX8A 3EMTA 3UE2A 3T02A 3NWGA 3FBBA 4ECVA 1N05A 4K7QA 3CCWA 1GMUA 1TK8A 5K8MA 3S16C 3K57A 1VHOA 2FJAB 3UD3P 3FJOA 4RNOA 3V5RA 4QFMA 2WB4A 2VZLA 4FM9A 1D8YA 4NMXA 1MMLA 4J5OA 5FJ4A 1YJ9S 3W2IA 2ZH6A 5DZ7A 2G0JA 2FVSA 2F9JA 3DU5A 1SB6A 4MTPA 1SFOA 1D8TA 4CO0A 4A8YA 3D68A 4ANDA 2KHDA 1RT7A 2HAIA 4I64A 4DV4F 4XLHA 3LP1B 2GJRA 3OJXA 2C2KB 2ZJPQ 5IP7K 1X9WA 4NYOA 1F2HA 3AB2B 4G0VA 4R5PA 2HMAA 3OJSA 5DSZA 4PQUB 1X4DA 3OP1A 4P72A 3ISXA 1LWCA 4OZ3A 2KG0A 2W7AA 4GRSA 1HL6A 2WAQL 5LMNF 5E3CA 4C2MK 1JLBA 5KFTA 4ETXA 2E1BA 3S1QC 4DBQA 3KNAA 2FY8A 1VBYA 3QFRA 1XEZA 1K83K 3DLLQ 2R93A 2BV3A 1JLCA 2YH0A 5AXLA 1N52B 2AX0A 2OBSA 5CYMA 3OTDA 4NZ6A 3KG1A 4DK1A 3AD9C 4F26A 3UW1A 3FFIA 4OHXA 3I9V9 3SMZA 1KJZA 4U9UA 1FDNA 3AOAA 2LEPA 4Q7JB 3DGPA 2IBKA 1H72C 5A6PA 1JLEA 5H9FJ 1K83C 2VNJA 3AD8C 1BQNA 4WKYA 4GKKJ 3CJ2A 2ZTGA 3TVKA 2HIYA 1DTQB 4I7FB 2UXBJ 3EGNA 4ECYA 5B08A 3OVSA 4O2DA 3G96A 4HI1A 2BM0A 1U0SA 3H9NA 3M6UA 1N4LA 5KG3A 3LQVA 1MRZA 1RT6B 2QSWA 2DCLA 1QG0A 3V7AA 3KG4A 5J2PB 2R93K 3WBKA 5CD4A 1WEYA 4A8KA 2Z2ZA 4JI3F 2AYEA 5J1EB 2XOKA 4B02A 1ZZNA 4Z4UA 4M5MA 3KUHA 4X7FA 1U6FA 4FK8A 4A3FC 1PSDA 2F5GA 1G7SA 2CJ9A 3M30B 5IM0A 1MMDA 3GTKC 2OP5A 2QN6A 4NYZA 2ZJQQ 1CQXA 1AROP 5CAAA 3KFWX 4J9MA 3L7PA 4K59A 4IH7A 4CLTA 4C8OA 2I9SA 2JA6C 4OINA 1S7IA 2EXUA 5J2MA 4MQ9A 1RBLA 3JQQA 3BPSP 1NDCA 3GV8B 2YNHB 3MM5A 4M95A 3BGFA 3VNUA 1FX2A 4DPOA 4Y28C 3KTQA 1VRTA 1NZ8A 3GIKA 2WRMA 4X64J 4LRAA 3P49B 5D77A 4OYBA 2MZ1A 1WQHA 3LAPA 2CJKA 3TQEA 1NLKL 3NOGA 3KLEB 3G9CA 1UWBB 1K47A 4EZ6A 3TJ9A 1FNOA 3MMCA 3OUYB 3U2QA 3FQLA 2FYXA 1T9UA 4B3RJ 2LZJA 4QYZJ 3IS9B 3W1YC 3CMAS 1RA6A 3ONUA 4B9LA 3ZTQA 4YHBA 1ZTTA 2DH8A 3TUPA 1E6YB 1TQLA 2IC3B 5JVGQ 2BABA 2V0NA 3FK4A 1CJUB 2ZOGA 3ULHA 2KT5A 3L7UA 2CNNB 4RWWA 4I2PB 2RU3A 2FGCA 4P25A 1TWHK 2M52A 1AB8A 3ASRA 3GVJA 2B6AA 2EPIA 1R9TA 1V3RA 3ITHA 3QMQA 2R92C 1V5VA 4BXXK 4Y9UA 3MF5A 2DGSA 5ADZA 1NZAA 4QPXA 2IYIA 3H3VL 2D3OR 4PWUA 2BOPA 4FNHA 1XMQF 1IKWB 3PX0A 3RBZA 3OW7A 3R7NB 3FPPA 4LF4F 2AEMA 1HNXJ 5GV7A 1TV6A 2F1MA 3NRBA 2RF2B 1NJWA 5IYDK 1YJ7A 4ECWA 4LSLB 3NS5A 2CJAA 3ITHB 3T9ZA 5J2QB 1GAQA 4TSFA 2WYRA 5IYBK 2A1BA 3U1LA 4KAIA 2NXJA 2IJNA 3M8WA 3BKTA 3S15C 2E1CA 5J2NA 2LQ5A 3VAGA 3KEWA 1MSWD 2FVPA 3D9BA 4BBRC 4BXXC 1GK8A 1RKJA 2WCXA 2OFHX 1R0CB 2W7OA 1U0HB 3E8OA 4KPCA 2BDPA 1DQ8A 4QR2A 2J6TA 3MM8A 4P74A 1IWGA 1KK1A 1Y9OA 2CPJA 2IVMA 3PO4A 3I5BA 1B0PA 2XZDB 3G4CA 3M3YC 2B63A 4LF2A 1XB2A 2N82B 4PC7A 2XMUA 1A9NB 3QAUA 4GTBA 1D3WA 4WPAA 1FXRA 4LRBA 1M90T 1I6VA 4GC7A 4A48A 4RW4B 5FLXU 4XSXA 2BMWA 1FO1A 3A4TA 3M8PA 4DZ6A 1HBNA 2FJEB 3EDQB 3ZZRA 4C48A 1DZ5A 5HI7A 3KUEA 3J7Z5 3OSNA 1T05B 1FRLA 1VQSA 1LWFB 1X9SA 3QQCD 3THTA 4I69A 4RD3A 1ZAXA 2ZBVA 2YKOA 1Q1KA 5EUHA 3HKZD 1V3ZA 1BGXT 2EFPA 4OI0A 1SIWB 3HOZK 2WVCA 2AMCB 2RIJA 4LBVA 3V4GA 5F0WA 2DKOB 3CC7B 4HE5A 2BANB 5CD4H 5EX3A 2O67A 4N3NA 5F8JA 1OHHA 2FIUA 4RNFA 3CTAA 1VI7A 3H25A 2ASYA 2VG5B 2UP1A 5GADI 3FSXA 1NDPA 3CC2S 3DRSA 4P1VA 3DOKA 2RMLA 5KOWA 3FCWA 4FXWA 5JVHQ 4N5SA 2WW8A 4YAFA 1VQKS 5CZVA 2RKIB 1R0AA 2UUAF 3ZNUA 3NCPA 2ZKTA 4A3LK 1HIYA 4QR0A 3MCMA 4CO3A 2DRAA 4QJVA 2CW5A 2C2OB 2QMXA 3GFZA 4P26A 1M5OC 3K5LA 2MKJA 4IH6A 3UDLA 2XLIA 2YQ1A 4ES3A 1SKUB 3J81j 3ZZYA 1EHWA 3OR1B 2EG2A 2EBEA 2W9CB 4LF6F 3HCXA 4FNIA 2F8HA 3CD6S 1HBUA 4DUZJ 3EICA 2GVDA 1YBTA 3S2HK 1MWYA 1WELA 2HRUA 3S15K 2CW0A 3R6GB 3IG1A 5B0AA 3KHGA 4X64F 1D1NA 1WG5A 3NAHA 4NA3A 5L38A 1RTIA 1WEZA 2N4DA 1QSLA 3H5SA 4LFBJ 2XNQA 4II3A 2A18A 3OZUA 4X4TA 4F2RA 4RUAA 2C3PA 4TVAB 1B64A 3CPWB 3RUBL 2XMTA 2MLXA 4RNMA 1E1RA 2UU9J 2F1LA 4C2MC 2YKMB 3W62A 3T5JA 2J9DA 4DOZA 1KDNA 2MY8A 3RGIA 2EK1A 3QT7A 1OPIA 4OV6A 2E2HK 3S8SA 3JTPA 3IRWP 2VICA 3FBEA 3PG9A 4RO0A 2GIQA 3DXJA 3KK3A 3SLDA 2I1RA 2ZL7A 4FXUA 4XLCA 4X4UA 3DLKB 2LA4A 1REGX 1KNZA 3F56A 3IR5B 2D3ZA 4DV4J 1FNCA 3FMBA 4FKXA 3ES9A 1M5VC 5KFDA 4HACB 2CJXB 1RWKB 4NX9A 4J9UE 1UWAA 3ASTA 3ZTPA 5G0RB 1XMOF 1HHTP 1TU0B 5D0RA 3NMRA 2FHOB 2MKIA 3C14B 4ZVGA 3M9OB 4FYXB 3CMEB 4MYUA 4USIA 4ES1A 3I0SA 2WZNA 4OP7A 1EKSA 1D9AA 1W0KA 3TUZC 3MMBB 1WC4A 3IAS9 2H1YA 2HQCA 3CCUB 3TX8A 2R93C 5HMYA 3T00A 3T19A 5KT6A 1O2BA 4KSEB 4ILDA 1IB0A 3MCNA 2YU9C 3BUEA 2K7JA 1UD8A 2DH9A 1OB5A 3D6TB 2FUG9 2EIXA 3NGRA 5LXYA 4LF7F 4ZHRA 2ZH9A 3G86A 2RB7A 1D1UA 3VGSA 4XPCA 4GTDA 4M5HA 3I96A 4HTJA 1BQEA 4GKKF 3EUNA 1JNYA 4MEYA 1UW9A 4IFYB 3MMPA 4KBIA 2QJ3A 4OIXA 2X6XA 4UT4A 4R0EA 2FC9A 2A0FB 1QVGB 4EMDA 3CCQS 2OPRA 1MN9A 3OFHA 3OT9A 1XPPA 1TKXB 2KYXA 2YKNB 1UTAA 3QFWA 2GSUA 4GFQA 2JHEA 4YY3J 1RTDB 2N7CA 1WP6A 1SC3B 1K1SA 2ROPA 1NDHA 4O3SA 4QYZK 2GPJA 1S6QA 4DV5F 4ZN1A 3VQTA 3HVAA 3TVYA 3WY9A 5BSXA 4YP3A 5JBQA 2KFNA 1JXVA 1B4BA 5H59A 1L3VA 1RAGB 1B2RA 4USTA 2DGVA 1FRXA 1EAYC 2R8HA 4NLOA 2D3NA 4W98A 1YSJA 4J9SA 4BC9A 3UD4P 1YJTA 5CCLA 1UA0A 2V6AA 3EGZA 3GYGA 1Q81T 1YITB 3CIZA 3MTKA 1W87A 1SJQA 4RW7B 2WK4A 5IQ6A 2DNQA 1EJ7L 3SBMA 4FN5A 1U1RA 1NBEB 1WOPA 2HK3A 5J3OA 1S1XB 1Y3KA 1S9FA 1YI2S 2O5IA 4NLDA 1KLMB 3QFSA 1G7CA 1VISA 2JA8K 4YFNA 3K2YA 3LGMA 4BPRA 3GEEA 2Q6IA 1FFWB 1K44A 4LBWA 4KHPF 5SZTA 4K2JA 5KFNA 2ASJA 1BQMA 3PENA 2H3EB 4TU7A 5GAHI 4KO0B 4FXVA 2VBTA 4CO1A 3PX6A 2AGPA 3MPWA 2V7WA 1UL3A 2GIRA 3ENQA 1HI8A 2XQCA 3G05A 5F9NA 3GDZA 4KYZA 2L3MA 1N54B 3Q8UA 2V4RA 5IYCK 3TFIA 3IN5A 4IFVA 2XY6A 2ZBQA 2R2SA 2DERA 2JFKA 2X1AA 4AF7A 2BBEA 4NZ0A 2HFNA 3B6BA 2IPOB 1S6PB 1S49A 4M5DB 1IBMF 2B63C 1TWCC 4DHVA 1Z1ZA 4KRWA 2Y1LB 4JI8F 1XNQJ 2LXFA 4DUTA 1EK8A 2W4PA 1KR4A 4KGVB 4RNNA 1FE4A 3G4SS 2R7ZC 5HVHA 1TUGB 4ZPVR 1SUQA 1R0AB 3BY2A 1FWKA 4ZITA 2WR8A 1F5BA 1WC6A 3DLHA 1Y1WC 2JH3A 3HI9A 2B9XA 3PW2A 3GFHA 3LP1A 2ILZA 3QSYB 5FIUA 5D4LA 1L3UA 4FKYA 5SUHA 5LSRA 2DTJA 5DG7A 1PC5A 1GX5A 3IWNC 3CMES 3CB4A 4XR6A 1ZPWX 4P10A 1ZS6A 1N32F 2DYIA 3HJFA 3FKSA 4OZ5A 3C6TB 1CJTB 3GJTB 3D3BJ 3OEPA 1U1QA 1SH0A 5ETQA 1TKTA 5B0EA 5HQMA 1BDFA 1YKWA 1AYEA 5A89A 2B0GA 3JSRA 1PKVA 5LJ3Y 4FF4A 1LK5A 1TKDA 1XC9A 4K4XA 2UUCF 3S1QK 2HLDA 4F3OA 4YUDA 1XTZA 2X51A 4DK0A 1U49A 3GCWP 5EGEA 3AB4B 5KFLA 4ER8A 4F0MA 2CKWA 1XZPB 3RZAA 3GJRB 4ZP8A 4EEYA 1PO6A 3IWXA 2OSRA 1WTFA 5TV2A 4OOSA 1R5OA 1FKAF 5ETLA 2UUTA 4PABA 3FBFA 3CDEA 3FEYB 4ECZA 2XMKA 1EXMA 3N6NA 3NNCA 4GKJF 1TMJA 4C2MA 4FYWB 5HATA 2DEUA 1RT1B 3QRQA 4A3KC 3P27A 4GVBA 4FF3A 7AT1B 4FZVA 4RJLA 3H8YA 2L08A 2RS8A 1MNEA 5GAGU 2MDAA 1X9MA 2UZAA 2UXCJ 4YB1P 2CNKB 5ETTA 2RRBA 2ZM6J 1BLIA 2V7XA 2XSFA 2QGFB 1FFSB 4E2FB 3QGHA 2ADBA 1VJWA 4YAUA 4ID5A 2A3JA 1HWJA 1L3KA 1USMA 1RCOB 1WTBA 2VBWA 2CYYA 3MEDA 1N0VC 2DCUA 1EP4A 5D15A 3FBCA 2MLYA 4IOBA 3N0VA 5D4OA 3O3LA 3UNGC 2DRDA 3SSRA 5MAOA 1Y00A 4O3NA 2WJYA 4PUOB 2QL9B 1RHMB 2JA6K 3A35A 2Q6LA 3J80U 4A8XA 1BS2A 2WVDA 1QAYA 3QWPA 2V2QA 4Z7CA 5CJ9A 6FDRA 4KKUA 4DX8H 2WTFA 4YB6A 1F9NA 4XORA 2DHGA 2HVHA 3K5OA 2MY7A 2MMYA 4A8QA 2RDJA 2LECA 3AY0A 4WZLA 4XN0A 4J9KA 2HGLA 1OB0A 2DHHA 2NSBA 2AGQA 1U09A 1Q8IA 2G1DA 2CQ3A 3BSOA 1OGIA 4I68A 4WE1B 3CD5A 4OZ1A 1SJ3P 2VF3A 4BC7A 2CPIA 3U7JA 1M1KT 1OIAA 4QYRA 3AVUA 4JP8A 3ZC3A 1W9XA 2JEFA 1YBUA 2Y0BB 3IFEA 4ED7A 1G7RA 2I6WA 2R4FA 2ZOFA 3DC2A 3NG8A 1W7WA 5BR8J 1HQUA 4BY7K 1I6HK 3H5YA 4GTFA 1WF0A 3C46A 4J9PA 2DD8S 1WI8A 2UU9F 5IORA 2HWHA 4LFCF 4ZN3A 4C8ZA 1HHQA 3G71B 2W1BA 4U9RA 3R9LA 4FVCA 4Y2IA 5KTQA 4KGZB 3CF5Q 4ZVFA 4URSA 5HN0A 4F0HA 4YR3A 1WHYA 3T1HF 2ZH1A 3FPKA 4XQFA 4OYZA 4NCGA 4C43A 4II2A 3MM7A 2B7BA 5J2MB 3TEHB 4OHYA 5FLMC 1KS2A 3F41A 4LR2A 3C3LA 1A0OB 3N9UC 2JA8C 2E5JA 2CQ1A 3K7RA 5LSOA 4YG2A 3D0IE 4B3XA 3ELHA 4CLPA 3O1LA 4JBCA 1F9EB 3HFKA 3V6KA 4GTCA 2K8GA 3RZOC 3I87A 2RUSA 4HYKA 3L9ZA 3KMQA 4H4OB 4C11B 3CCSB 1KFDA 3JTOA 3OL8A 3G71S 2PMWA 2NPFA 3BBCA 2YKMA 4WF9Q 3BCDA 1OGJA 3D2WA 4CH7A 2ZE2B 5TJ3A 3VAMA 4K4WA 1FDDA 3PJWA 1J6XA 4NLWA 4A3BC 1SKRA 5DGAA 3MM8B 3SZZA 2ZUFA 3DDKA 1ZQ1C 4I56A 1HBMA 2VUGA 2RGRA 3GCXP 2BACA 3WX4A 1SH2A 2BJEA 4RR5A 4W4MA 2M8DB 1CJKB 1UD6A 3PIOQ 4QIEA 5LMUJ 3KWMA 1OYDA 2Q6OA 1EP3B 4Z2XA 4X7EA 1GQEA 2QIFA 8AT1B 1KK2A 2LQ8A 4OPOA 1UPMB 2JJ4D 5IOLA 4QOTA 4XL9A 4DV2F 4B44A 4BY1K 4J9NA 3J81U 2CQHA 5KAKA 4DV7J 2GHVC 1IW7A 3NOCA 4JI7J 3LO3A 4C3IC 3ZZ0A 3MHPA 2A10A 3US5A 3S1RK 4LQ9A 4MKYA 3TZXA 3OREA 1YJUA 1J5OA 3FRZA 1WUUA 3C6TA 1HNIA 2RF2A 5HMWA 4DPWA 4P7VA 5E3AA 4NLVA 1Y5NB 4AXJA 2FB0A 3CIMA 1C0TB 4ID5B 2P3MA 2XS5A 2PEBA 1RLDA 2XNCA 1NDKA 3JSYA 4WWVA 1G2EA 1Q81D 4A3IK 1FRNA 3CJRA 5A8WB 3POTA 3HMJG 4AQYJ 4OV1A 5BYRA 4RPBA 1C1CA 4KFBB 3U1NA 4XN3A 1TVCA 1H8EA 1TWFA 2QC3A 4A3EC 4Q45A 5AXNA 3TWZA 4RL1A 4CLLA 2CZ9A 1HNVB 3CCLS 3T51B 3FKIA 1RZMA 4DR6J 2W2PP 2IHR1 3N3YA 2CQCA 2G0IA 3N5FA 1G4CA 1PCAA 1VQPS 1E62A 2XHWA 1F3VA 3DYAA 3H5XA 3H90A 2W9CA 1FRKA 1U1OA 3HOXC 3PKYA 1RT4A 3QGPA 5D4NA 1JLGA 2C2WA 1S9EB 2DGWA 5I3UB 1UFWA 2OD4A 2RC6A 3VR6A 1NAQA 1Y10A 5JVOA 2VL1A 3GTPC 4JI3J 2KO1A 1FF2A 3E01A 2AU0A 2CPZA 3TYTA 5DETA 2PIIA 2SXLA 3WDOA 4LF5F 4ELTA 4RM0A 2NCKL 2W4CA 2FVRA 4XCHA 1VJQA 5KT5A 3OSPA 3MUVP 2VJUA 1R3NA 1RT6A 4Q4ZA 5FO0A 1KHWA 4BBSC 3CQZA 1LK7A 2VBYA 1LV5A 4LR9A 2H5JB 2RJZA 5KSWB 1GTEA 4LRFA 2UXDF 4C11A 3G8SA 4QU7A 1B0TA 2DJWA 3GZ7A 2C22A 1N6QB 2HHWA 3A8IA 3OEEA 1OY6A 2QE5A 2OPPB 4O3OA 3BO4A 2E2IK 4DR3F 3CC7S 2BANA 4OI4A 1ZBTA 4RW7A 1KN6A 2B5JA 4Y6IA 4ED5A 2E1PA 4CQ1A 1RAHB 2B7CA 2YNFA 3DLGB 4QV2A 3FVYA 4B3RF 5ETRA 4R8UB 1RWUA 4NCBA 2VJVA 2MQQA 4N56A 1I18A 3VAHA 4F4XA 1FHTA 2V8HA 1YTYA 1NKEA 4BY7C 2WVBA 3W2WB 3RAXA 1SFOC 5KFHA 2V8VA 1N5TA 4KE5A 1M90D 1VQYA 2D69A 2HHXA 1EQ0A 2P6TA 1CJVA 3MAQA 3IC1A 1UD5A 2GJKA 1WTHD 4C9DA 2PI5A 1KD1T 2E2IA 1Q7YD 4YAWA 3QLHB 1SJ4P 1VHEA 4XSZA 1R8HA 1K1QA 3GMGA 5KFUA 3JQJA 3HK2A 4JI0F 3R7SB 3ONQA 3H2VE 3LWMA 2AJQA 3CCEB 1Q82T 1CG2A 3OXFA 1XMQJ 1NK9A 1X4HA 4K0KF 3CXCB 4N8NA 3C2PA 1RJJA 3MCSA 4QWBA 1N36J 1IJEB 4G1QB 1VQ8S 4YEJA 2LXUA 4N47A 2OH2A 2IAJA 3MM7B 2FTRA 5KG7A 1FD2A 1VCTA 1TFWA 1WIHA 1J98A 4KTQA 1O6XA 1I51B 5L9NA 3FOEA 1TAQA 3VO1A 2R7SA 1EFUA 2J0XA 4KH0B 4MIBA 3H4BA 2OEJA 2C5HA 1IE0A 3DI6B 1TWCK 3VQSA 1DCPA 2ZXIA 1NJXA 1YK9A 2ADCA 2QRRA 3DGVA 1XBWA 1UEUA 4GKJJ 3EJMA 3A3BA 1FT8A 4UZUA 1IJEA 4FVMA 1IKWA 2AJ2A 2VNKA 2EFGA 4KB2A 2FJBB 1YX2A 2XB2D 2X3UA 3PV8A 1W2BB 4ZCMA 3RRHA 3TA0A 2L41A 1Q0NA 4CLKA 1S6UA 2N3OA 1JXEA 1M0SA 4QVAA 4CLSA 4ID8A 2Q6KA 1XE1A 5IM0B 4UOFA 2QG9B 4G5GA 3R5CA 4G1PA 4NLQA 3MEGA 4J9LA 3BCFA 3NWRA 2F63A 2YVSA 1TL5A 4P6QA 5B0GA 1U24A 3EPGA 2I5JB 3CRZA 4EI2A 5K8NA 1YIJS 3C16B 2W8KA 2QDXA 1ELOA 2NVXA 5HROA 1DTTA 1DQAA 3ZZUA 1JLGB 1BJKA 3V2UC 1RADB 3ZFVA 4AQYF 2KM8B 1JLEB 1JJCB 2VYQA 3SSSA 1XR7A 2J7KA 9ATCB 2R42A 1WOSA 5DS0A 4ICLB 1RTHA 1VYAA 4L72B 3NCQA 3CMAB 4WP3A 3U02A 4KO0A 3J7A1 1GVHA 3LNNA 5A0YB 1VBZA 3WZ0A 2ZZQA 4JB8B 1N0UA 4F67A 1VLOA 4PQAA 2A6HA 2M4MA 3EXCX 3VHQA 3JYTA 3PHEA 4FF1A 4ED1A 1IKXB 3MPYA 1G6BA 1YNNA 2H48B 3MFHA 3VV2B 4UOGA 2VQFF 4A93C 5IV4A 3NBPA 1JLQA 2GQCA 4ZCKA 2CJYB 3CCSS 4AYBD 1EIYB 4P3IA 3POTB 2DR5A 4KKSA 4FZBA 2ZH7A 2ATLA 4RLEA 2DRBA 4BY1C 3V6JA 5IT0A 3PYEA 1RHUB 2QX0A 1YJVA 2C42A 4GMKA 2WB1D 2QLXA 3CJKB 4ENOA 4YOEA 2DNLA 5HZAA 5DLGA 2UUBF 3IO1A 4YN3B 2BXJA 2JA7C 3KNGA 1K73D 2VODA 5KFGA 4PC1A 2DEJA 2FGOA 1JX4A 3TUJC 4ECUA 1UD4A 3QO9B 1RAAB 3JQPA 4NPOA 3SQOP 1NSQA 1DBDA 1HMVB 4EO8A 2VJJA 2QLBB 3IBWA 2QTWA 3PO3K 1VQMB 2XCPA 1E63A 4ED4A 2MQMA 3DYAB 4X65J 4QIVA 2NXNA 3D5MA 2VG5A 2KHCA 4G1BA 3MEEA 1RWXB 2BE7D 2H65B 3EZOA 2NVTK 3QLHA 2D41A 3LGHA 4TU8A 1I7PA 1WNEA 2HHPA 5EDWA 1WCMK 5B09A 4LJZA 1XWLA 4Z7YA 1DJ0A 1J6VA 2APOA 3W61A 5IC4B 4UF4A 4J9RA 3GE9A 2E9ZA 4PPDA 5FNZA 4FP9A 1DCHA 4JI1F 1KKHA 1P9QC 2BJ9A 1EZZB 2B7BB 1WACA 2GJIA 3D1HA 5KFAA 3E51A 1X4AA 1W25A 1RAFB 3M4OK 1TLLA 1BE4A 1EB0A 3GTOC 4OYWA 1NHVA 4I6WA 1TWGK 1LW0B 4DV7F 3OL9A 1TUIA 1I6HC 5EMNA 1UFLA 2I8EA 2C4UA 2CNLB 3SV3A 5E0OA 2ZZFA 1K9MT 2Z30B 3AA9A 3GV7B 3KXDA 4XTTA 4J90A 1V9OA 1CJVB 3OPKA 5KFCA 4I67A 1VQNS 4G65A 4LFAJ 3SKBA 1SQGA 3HAGA 1MW7A 4MKVA 5GAGI 1QUVA 4OOXA 1CNEA 4R0JA 1KHVA 1RABB 3IXQA 3PTWA 3RAQA 2FLNA 5I42B 1PKUA 1TKZB 3A1PA 5B6IA 5CYQB 2IDEA 4Y7NC 2PIAA 5KG0A 1ZTWA 2MQLA 4QJVB 1EP4B 2NLWA 5C4JC 1FRIA 2QTLA 1O51A 1RWNB 1XXCA 3C14A 4RKUC 2C28A 2IAJB 2CFAA 1PYSB 1U1KA 4K5RA 1Q9SA 4PYAA 3AGQA 4X0CA 3E2EA 4PR6A 1FTCA 3KLHA 2HHHF 3SLNA 2VPWB 3QE2A 2A2CA 3DCAA 4MFBB 4DDFA 2KH9A 4EBDA 2XZLA 1G7TA 5THWA 4USHA 3DI6A 1LWXA 3TJAA 1KQKA 1I50K 4OMFG 3S2HC 1RQRA 4DL5A 4OYPA 4NNJA 2E5GA 3GTLA 2HQFA 5CYMB 3EM1A 1KVIA 2CF4A 2DNKA 3OFEA 2HRYA 1UFKA 3MM6B 2MZRA 2U1AA 4MMOA 1F93A 2GAHC 4ECXA 4KB7A 2QA4B 5AE3A 4DV1J 4JMQA 3HOVC 1ZAVA 3OJWA 3HD1A 4LF5J 4NYPA 2HNZB 3BY1A 2DBBA 5DDQC 4KAWX 3M6VA 3M2UB 3D7SB 4H9GA 2CQPA 1Q7LB 4F50A 3KK1A 7FDRA 4C3JK 2EKNA 4USVA 2CQBA 2I2YA 2E66A 2AHOA 2KXHA 1T03A 4ZPCA 5KFSA 4MIAA 1C2PA 2ACMA 4BHQA 1U45A 5KFYA 1NK4A 2VC0A 4NEYA 4DQKA 4LR8A 5IP9K 4I6AA 3GPAA 3S17C 3JSBA 2LQ9A 3KLFA 1KRPA 1RP5A 3TAQA 1S72B 3EX7B 3TANA 4P52A 3PYDA 1XZQA 1CLFA 2WBMA 2GQQA 5IWAF 4JI2F 2B4UA 3WQZA 1D2EA 5KFPA 1FFGB 1SC4B 2DNHA 1K73T 5HMXA 3KYLA 4MT1A 4NASA 2CC2A 3OOCA 1S1UB 3N0CA 2AP6A 4B3SF 2P9CA 4DR4J 1YITS 1O24A 2UVWA 3I4NK 5IOTA 2QO3A 1VQ5B 4OPSA 1QGZA 1ISEA 1DURA 4JI6F 1V6HA 4DSFA 2UUBJ 3CQZK 3S0XA 1LFPA 2IRUA 2PEHA 1U1NA 3PEJA 1GO2A 2FJWA 3JAMU 2Q79A 2COLA 2BSAA 3B82A 2RRNA 1QH0A 4B3OB 3D28A 1CS4A 4L74A 3DXSX 1VBKA 2B4PA 2DGXA 3TAMB 3H40A 1YHQS 5DN6A 2X1GA 3CDBA 3TRGA 2EK6A 3BQJA 3SYZA 1LWEA 4QHYA 3ZBTA 1UVIA 4O4RA 1TUWA 3KJFB 2O5JA 1TWGA 3OLAA 4DN9A 1IBMJ 5T14A 3DOMB 1HQEA 2Q6CA 2HBQB 4KC6A 5HVGA 3GTQA 4DR1J 1IVZA 1VHIA 1YBAA 3DRPB 1JA1A 1B99A 3M2VB 4M5JA 3CC4B 2LEBA 4IOCQ 1QFZA 1I3QA 1VF7A 5KFJA 1S79A 1A7GE 1FRQA 3GV5B 5JFEA 2E7VA 1KD1D 3DDNA 1GJRA 3GTKA 4DX6A 3MMAA 3HHLB 2QE7A 2C5BA 3S1MC 2DT9A 1SKQA 1SC1B 2V94A 1X31C 1HFEL 3A8EA 3PFOA 3L95X 3BC9A 5JXSA 3OTEA 4H54A 1AT1B 2C2ZB 3BQ2A 4JI1J 1N34J 2JN9A 3VO2A 5F9LA 2GQFA 4JI5F 4M4SA 3CJTA 3P96A 4ZMMA 3Q6RA 1C0TA 2VA3A 1L0WA 3HXMA 3FRYA 2HGMA 2M7SA 2QTZA 2FJXA 5D0EA 3L4JA 4JI4F 5ETVA 1KFSA 1KTVA 3OXGA 3D26A 1EQMA 4GC6A 1GNKA 3BB5A 1L3TA 4XDDA 1VQPB 3AH5A 3NGTA 3HOWC 4ILMA 1UKUA 2XZPA 3BKFA 4M63A 4RUHA 2V8GA 2HEKA 3S16K 4RBUA 1IKYB 3G82A 4F7DA 2CPHA 4KMUA 4J9VA 2YNIB 4LLGA 1GX6A 2OSQA 5M2PA 4Y0FA 3PO2K 3IA0A 5IZHA 3THVA 1OY8A 4C6AA 2HHQA 1JQGA 3MMLB 2D9RA 4DU7A 4UQGA 2CUYA 3DOLA 1FVSA 5C25B 1JLAA 4CCHA 3UR3C 1LW0A 2D9PA 1ZAWA 4Y2CA 2FVGA 1GT8A 2HFSA 1SPBP 4IYQA 4Z4SA 2UVVA 2IM0A 1VFJA 5E7OB 4FWTA 2DR7A 3A8KA 1O2AA 2XYGB 2UXCF 5F3ZA 2JA7A 5IYDC 4X4QA 1O27A 4OIRA 5J1NA 1HW8A 2VQFJ 3LP0B 3UR0A 2F40A 3C16A 2B4VA 1JLBB 3I55S 3KL9A 3SI8A 4NI2A 3M8PB 3D4JA 4ASUA 4N77A 3TX0A 1UVJA 2ZEJA 4Y7NK 1TKXA 3PY8A 2MZTA 2VA2A 3QGIA 5K8OA 5DDOC 4B9MA 2L9DA 3D1OA 3RRKA 3LAKA 2O1PA 3JQMA 2EI5A 3MR3A 3ET6A 4Q0BA 3J80Y 1U48A 3ZZOA 2D9OA 3A3OB 3BYPA 1NB0A 4A4JA 2FLPA 4DV1F 4M53A 1S1VB 1Y4ZB 2LDIA 2BYCA 3GU0A 2HKEA 3D66A 5C2GA 5JJBA 3MEDB 1VQ9S 3MPDA 2BPOA 1PJ6A 2GC8A 2F65A 4B9TA 5HLFB 3PO3C 1IM6A 4HDHA 2P8TA 1MN7A 3CDAA 1W2BR 4WFNQ 4YDDB 4HR2A 3KKFA 3Q8PB 4CZCA 2KRBA 2GMJA 1B3TA 4PC6A 2O66A 3HPOA 2D74A 4DPXA 5HP1A 2XC9A 1FESA 3BP8C 1ZZFA 1OYEA 1SCJB 5B0DA 4LQYA 1JXLA 3QWUA 1NJID 2M9KA 3QPIA 3Q23A 5DDRC 4ZVQB 2GREA 4OL8A 1Y0RA 3BBBA 1BC6A 4JI2J 5BJRA 3N01A 4R71A 1GXUA 1J5EJ 5DG9A 1FDAA 1Y5LB 2CK3A 4TLRA 4B3SJ 4Y65A 4DR4F 4CTAB 3UD5A 4ZJQA 3TARA 2KYZA 1F60B 1SJ1A 3ZO7A 2QA2A 4PYDA 3QFHA 4JI6J 2HNYB 3AVWA 3MDFA 2W8LA 3NUHA 2VNIA 1H2TZ 2FJVA 1BLUA 1IR2A 1EWYA 4RW6B 4XAKA 5K20B 5CHPA 2RHSB 5CYJA 2NVYK 2HNDA 1QUPA 1U1LA 3W7BA 2HBRB 2FQTA 4KN7A 2GHWA 2P8IA 2CQIA 4P3YA 4CRJA 1T05A 4IR9A 4TU9A 5MLCV 1G1XA 3R6LB 4OLPA 3TFJA 3B78A 5A2QY 4JOUA 5HZBA 4ZPAA 2HSEB 1QFYA 4LFAF 1TL3A 4MKBA 3GTGC 3RB3A 2MSTA 3OR2B 1IBKJ 3TO8A 2JFDA 3RRGA 1IJFB 4HEA9 2ZH3A 4DV3J 4ZH4A 3AOBA 2XMJA 2WBRA 4TYAA 4TLQA 3S2DK 1VIOA 3AJ1A 2XLKA 2YWKA 3DOMA 3DXBA 4M1KA 5IT4A 2XSJA 2OPQB 5HANA 1WG4A 2E2JC 4LQ3A 5LSLA 1FJGJ 4DQLA 2V67A 4E8UA 2R9LA 3V4IA 2FLLA 1RISA 2W01A 1IUJA 4H4KA 4AF6A 4ZLPA 5L1LA 3LH2S 3HHEA 4OYMA 2ZD1B 4A3CK 1KQSB 3BZQA 2CNOB 3HT0A 2GMHA 3CJ0A 3X3UA 2V6UA 2NXEA 3J81Y 4ALZA 2DIVA 2JEGA 4DV2J 1HNZF 2QFJA 5F8IA 1NKCA 4ZP7A 3NP5A 3CD6B 4ZIVA 2K1RB 3MI7X 4ZLLA 1JKHB 2DR8A 3A13A 1BMQB 4FBTA 1XZPA 1IXKA 4JI7F 2JC0A 5CQGA 4A3CC 2WZPP 4KGXB 2QLJB 4UAJA 2MZJA 1YJNB 2J5AA 5CYQA 5C3EC 5K14A 3FEXB 3NLCA 5IYBC 2ZD1A 2DNGA 5GAEI 6AT1B 2C78A 1UZHA 4DV0F 3S2DC 4AD6A 1KRHA 2VPYB 4RU9A 2G1HA 1MU2A 3VCDA 3RZOK 1AZSB 4LRDA 2JEIA 1H7XA 4C8YA 2LA6A 1I8DA 3H4DA 4A8SA 1WDDA 2AZ1A 2PA8L 2QYGA 1XZQB 1QUEA 1XJWB 3MCOA 4UY8T 4OHZA 2QMUB 3QJJA 3AOCA 3OTCA 2A6EA 3Q8YA 4W92B 2EWHA 5GAHU 5H9FK 1RKIA 3HSDA 3FDSA 2P5MA 4QIWD 1N33F 4ZVEA 2JEJA 3W5YA 2HG4A 2ZWOA 3M2RA 3TP2A 4DCOB 2X6YA 1QLNA 2OK7A 4OPVA 1PJ7A 3ISNC 1FKPA 4KFBA 3MECA 4KATA 1JNZB 4ECRA 4I7FA 2WSCC 4X62F 4Q7AA 4WZKA 4AUKA 2OFGX 1D0EA 4ACAA 1TK5A 5I4MA 3HJVA 4NCGB 3RBXA 3KLGA 3FCHA 4C45A 2G2ZA 4RLZA 3CTRA 3UWTA 2XS7A 4Y9RA 1LWEB 3IRXB 1X5TA 4MJKA 1MLAA 2V6TA 5AXKA 2QL7B 2IRYA 4V1Ak 2HK2A 5FD1A 5L39A 4ELUA 1HQEB 1OS5A 1TVRB 4CI0B 4DQPA 4A3JK 5FLMK 4QIWL 4HACA 4OZLA 4TN1A 5D3GA 2ZTNA 1WEXA 3HVTB 4CO5A 1FVQA 1VRUA 3OTBA 3H3VD 3IGNA 1NK6A 3D6HB 4K2XA 3OHAA 3HOXK 4DUZF 2X85A 3JYTB 2E5IA 4USWA 3CCUS 3W2GA 1UMJA 3NL0A 4DR3J 2IY5B 2HVEA 2RE1A 3GR0A 2RHQB 1XN9A 1JLFB 1XIQA 2VNHA 4G7OA 2Y1RI 4LFBF 4HH0A 1CC8A 3W65A 2CADA 1V3SA 5GMDA 2D74B 2EEYA 1U7LA 4ZPTR 1I5OB 3IS9A 2X7IA 3EYZA 1TWGC 2FQOA 2W6JA 1F1BB 2IM1A 3PW7A 4OJHA 1QAXA 3S7RA 1N34F 3BS9A 4F36A 8RUCA 1T3NA 3QRRA 1BQXA 2GX8A 2KVIA 1WCMA 4K4TA 2Z2YB 3HM9A 4TYBA 2ZBCA 2V2KA 4I2PA 1QAIA 5F4OA 2M70A 3CO0P 1WSVA 2AYBA 2IBOA 3EQLA 1VQLS 5J35A 3GR1A 2KFZA 2DVIA 1UP1A 4Z4RA 1GTHA 5LJ5Y 2B5JB 4KH1B 5A8KA 1B4SA 2I5JA 4JI0J 4YQWA 1I3QK 1R9TK 4UZFA 1EFWA 1N88A 4L73A 1GR1A 2YX4A 1UMKA 3MMAB 1XMOJ 4P71A 5BYSA 1KEKA 2LDYA 2RQ4A 3BH6B 3AGPA 5HK4A 3HP6A 4JV0A 1VRTB 1PIEA 3KJVA 1FA0A 3VGTA 3AJDA 3CD0A 1Q82D 4DFKA 1C4CA 3AQOA 3SCIE 1O28A 1TTTA 3RW7A 3OL7A 2B8PA 3BSAA 3CDWA 1PYOB 2MSSA 1D09B 4JV5F 4J37A 3K8VA 1S97A 2ALZA 4MK9A 3LPXA 1U0HA 5DQIA 4V19X 2VG6A 3OR1A 1D9FA 1CULB 4Q8EA 5AJ3J 3NS6A 5LMZA 1AZSA 2A2DA 2DY9A 1NJIT 4ED0A 2BJDA 4DQRA 4S0MA 3J7YI 4HL9A 2QEXS 1HBUB 5F41A 3PO2C 3MM9A 1FRHA 3PKMA 2D7SA 1VC6A 1RB0A 1CC7A 3E01B 2VFUA 2Z8QA 3TW0A 2A6OA 1VOMA 2V63A 3WQPA 3CEDA 2F8EX 5GMKa 1WJ9A 3BGRA 3IR7B 1CBKA 1K0TA 3NGSA 1EQRA 2KXNB 4ED3A 5KFIA 4C3LA 1AIPA 3BYRA 3S01A 4OYXA 2QMWA 1TL7B 4OYOA 3V4IB 3R1HA 2D1CA 3G6ES 3VAIA 1I50A 4ATNA 1XNRF 2F4VJ 3FNNA 3IGVA 1IWAA 3PO5A 3E1YE 1S99A 3KK2B 4GZYA 4M5LA 3GWCA 2ZWPA 1NPPA 2GJPA 2EBGA 5FJ8K 3J81k 3JSMA 5J1PA 2V8DA 2LU2A 3BREA 4C3KA 3DGPB 2P9GA 3PRVA 1F7VA 3C19A 1OWXA 4OJGA 1TWFC 3BH7B 2BMBA 1AFIA 3GTMC 4DLGA 1NUEA 1OQ3A 1N5VA 3DHXA 1N33J 4TXSA 1RT4B 3H0PA 4UZCA 2V5HG 2AJ4A 2R7QA 1RAJA 4DL0C 1IL2A 1BY9A 1GE9A 1DHMA 5LT5A 2LU1A 5B0FA 4IG3A 1MWQA 1E64A 2YBVA 4X62J 3WODA 3J7YU 3ZTRA 4AYBL 3C66A 3ZXWA 1PAUB 2EFVA 1J5EF 1HPZA 3DRXA 3RB0A 3DRRA 3V81A 4MYTA 2V69A 1JJ4A 1HBOA 3GFXA 1FNXH 4C3HK 1M5PC 2J0QD 2W2OP 1YRXA 4Y34A 2ZBIA 4A3GK 4ZVHA 1VQ4S 2DITA 5A6WA 2JLGA 3BF4A 4PG5A 3SIPB 3OQ2A 3GTMA 1VC5A 4DMZA 2RNEA 2DHSA 2DR9A 5A76A 2NVXK 2OD6A 1HBNB 1HQ2A 4WJ3M 5AT1B 2R8JA 4QWCA 5IXUA 4K1XA 4C8MA 2WONA 4P12A 4RD2A 1RWOB 3AHPA 4JI8J 2OBRA 3S1NK 3CW2C 1H2VZ 3V76A 4DZDA 3EZ5A 1OB2A 5U47A 1IBKF 2CWXA 1T02A 4Y2AA 5HJYA 2R8IA 4O23A 4DS5A 3ONYA 5IFMA 2E5HA 3U6BA 1HWIA 3CW2A 3KG0A 2D3LA 2DXEA 5M2UA 3QFTA 1YZ6A 2CVEA 2FZCB 4PZVA 2HQDA 5M5WK 4ZOSA 2W9BB 2DNYA 2I38A 4QPTA 3M8RA 3SCLE 2QA4S 4BLBA 1VQKB 4OX6A 4RDLA 4F4WA 2ATCB 3PFEA 4ZVTB 2DNOA 1XXBA 3TAMA 1FTRA 1O0PA 4KB4A 3DLEA 3UN5A 5HSPA 1TFYA 5KFQA 1HQMA 2NVXC 5D8HB 4O44B 3RB4A 5F8HA 4RDKA 4ECQA 2PE3A 2ZBRA 3JB9k 3F0NA 4M8LA 1Y0YA 1WOOA 4RW8A 2PPBA 2BM1A 3Q2TC 3BPDA 3GIJA 1E3XA 2OPSA 3E3XA 2VUMC 4RD1A 1UD3A 1BX1A 4AVZA 2HURA 3HOUC 1RQPA 3N0BA 2Z2MA 3BP3A 2KB2A 4DU8A 3IPJA 3O6QA 2V4QA 2EFOA 3S1RC 2OIHA 3BGLA 4YS2A 4DR7F 2ZBPA 5E5NA 1HNWJ 2R92K 5C44C 2XYHB 1CJTA 2V9KA 1S6OA 2BZ2A 3LOUA 3HLUA 5J2NB 5EGYA 1SIZA 2JL9A 5DLFA 4U6PA 2FX3A 4ECTA 3T5KA 3H0GK 4WZMA 5C4JK 3R5JB 1YGYA 4LVNP 4WFZA 5AJ3F 4ED8A 1HD1A 3SCKE 2GJ2A 2Y8WA 1NK0A 2HHHJ 1KSPA 2OPSB 4ZJLA 1NCLA 4DX7A 2GK7A 4YHHF 4E98A 1ULRA 1S1TB 3DNCA 4NMLA 4F3MA 5DGBA 2PN6A 1O25A 4KASA 4KKOB 4ZV4A 3QO9A 1XXAA 4OIPA 4AFFA 3PRDA 2VONA 5I3QA 5HP1B 1RWVB 1UCNA 3LANA 1EFCA 1TV6B 4LIRA 2JA7K 4A8OA 4RUCA 3FFIB 1F6TA 1RQ0A 2EW9A 2CIMA 3VZHA 1XNRJ 1R9TC 1RHKB 4NWBA 2C3OA 3DMJA 1M5KC 4PQUA 2GJFA 2NPIA 1IQZA 2DGQA 4MFBA 2FVCA 2W9AA 1GMWA 1N8RD 1T7PA 2M5YA 2ZUAA 2HHSA 4KKOA 2ASLA 1VLYA 5TRDA 1ZETA 1IKXA 3RU0A 3W2FA 2YXLA 2P6SA 2Q43A 2ILYA 3TAPA 3CC2B 3NKYA 3HX9A 4LC0A 2NZCA 2K06A 3N6MA 3EDRB 3T1AA 2ZVSA 3LP0A 3H94A 2E44A 4TMVA 1TWAA 3G6YA 2MKKA 4XLFA 1NJYA 2MGZB 4BKWA 1RHRB 4DL3A 5IWAJ 2HCJB 3H5UA 3R2DJ 3DFEA 3SV4A 1I3OB 1B4AA 4ZGQB 4RJVA 5DM6Q 3J7AN 5DRKA 3RR8A 1TUVA 2ZNYA 1NSKL 3V6HA 2WZ1A 4O4GB 1YWXA 3C15B 1QGAA 3LF0A 2RILA 3N5BA 1ZYQA 3CAGA 2B9WA 3GTLK 4CM0A 4DNTB 5E2QA 1RT5B 4C3MA 3NAIA 4U7CA 3T1HJ 2P5VA 3SFUA 2AD9A 1WKKA 4WIIA 4BS2A 1YVFA 1C0UB 2C2DA 3W5HA 2D3UA 1NPKA 1FXLA 2HWTA 2GSOA 1R8BA 1LWFA 3AA8A 1JLFA 3X1LB 2AIRB 4LR7A 1VGXA 2GQ2A 1C0AA 1FNBA 3TA1A 4CTAA 1SL0A 1WKLA 4N41A 3G2XA 2HMIB 4HVZA 2L9NA 1GAOA 3DLEB 2OKQA 4PXDA 3V81B 2YU9K 4F8RA 1PJ5A 3TFHA 3W8GA 4DR1F 3BQ0A 2B51A 2DCUB 4L8JA 1I50C 2BE2A 1APSA 2DHAA 3W8PA 4J9QA 3CC4S 2CG4A 3W60A 2D3O1 1S1WA 4PGOA 2GHPA 1RBOB 1N06A 3T01A 4DLEA 1S9EA 3CDUA 4OOVA 2XZOA 2V7TA 1ICEB 3CSKA 1J2VA 4KM8A 4WKRA 5ETSA 2KU7A 3EGVA 4K4ZA 5LMUF 4EGLA 3GTPA 2ROGA 1RBAA 1S1TA 4USUA 2HFOA 3AJ2A 1VQ9B 4C3HC 3DN9A 3VR1A 4JI4J 5M2RA 1Z2ZA 4NI2B 2V7QA 3AVTA 3GB0A 4N8OA 3OE7A 1E6YA 4H4KC 5L1KA 2LVWA 1Q4RA 3CP2A 1Y1VK 2E1RA 1TWAK 3CJ4A 4TY8A 4G7WA 4A3GC 4A3BK 1HI1A 3SQGA 5CH7B 4DF4A 1RHJB 4KARA 1Y1WA 4WTYA 3W5UA 2PO4A 4TY9A 5KG5A 2HLUA 3MR5A 4DF8A 2FHMA 3PUMA 1QAJA 3G6EB 4Q43A 1VR6A 2ZXHA 5F0UA 4WZTA 2PMZL 3PJ9A 1RYSA 2JWNA 5E3RA 5K5MA 1QM9A 1J5OB 5T41A 5A8RA 2HRTA 4K4VA 4DR7J 1GEHA 4ZLJA 2V4DA 5HVFA 3BEGB 1FKOB 1JB9A 4WFXA 4HKQA 2IIHA 2BJ3A 3K0JA 4NEZA 5KT4A 2R9VA 3HKZL 4ZHRB 3RBDA 4TY8B 3MR6A 4GTAA 3AD7C 4ZP9A 4C0BA 3GJQB 2MYFA 3HZEA 4PKDB 2O5DA 4ZA1A 2HHVA 2N3LA 4HT7A 3DHWC 2CQ0A 2CZVC 2K3IA 3I32A 4KGKA 1NNDA 4QR1A 4AE5A 3QRPA 2K3KA 2K7KA 2FPHX 3UPFA 4LJMA 2XWXA 2XMWA 2NVTC 5D3GB 4G1VA 3MAAB 2CQDA 1TKTB 1NK5A 3Q39A 2KI2A 4RZRA 3PRBA 2WOMA 4KC5A 4P2FA 4QCLA 1O26A 4Q2MA 3M8QB 4HE6A 5LM7E 2J9EA 4P5BA 5IYRA 1REVA 4A3EK 3UNYA 2CDQA 5E33A 1XQIA 2NR0A 2JNJA 4B3FX 3W9IA 4KT0C 2ZUGA 3B4MA 2PLFA 3M4XA 2RD5C 2R2UA 3DKDA 3HOWK 5KFOA 1UW4A 4NOHA 2YQ0A 2ZHOA 2WSFC 4B3TJ 1O5JA 4QWEA 4XOPA 1XERA 4CYUB 2IMOA 2LMIA 4BBYA 3MAAA 4OI2A 4K4SA 4P2XA 1R8AA 2LLZA 1NJZA 3CGIA 2B5OA 1WWHA 3MZIA 2NVYA 1RTJA 2UXDJ 1FX4A 2AKWB 2FQQB 5E68A 1VQ5S 1R89A 4A46A 2Y9HA 4I2QA 2B3TB 4P9SA 5IT9Y 2CDRB 2MKSA 1RU0A 2Q6BA 1WD6A 1OMSA 3PVDA 1M1HA 2V68A 3LO8A 2C2NA 5L46A 4IUFA 1VQOS 2HVDA 1IKYA 2FVQA 2NUHA 3BH4A 3M6XA 5D78A 2DPIA 1YJWB 1USOA 2FZKB 1H73A 1X5PA 1P1TA 1QVFR 4DSIA 1B7YB 5DJBA 2LKZA 4WU3A 4Y2MA 2HVIA 2YPZA 3AAWB 1F9FA 1U25A 5J2PA 4ZPDA 4CO4A 2PE8A 3P5BP 5IP7C 1D9DA 2ZBUA 4OZNA 3RZDK 3ENAA 5KFRA 4G6IA 5G4DA 4DG1B 4XD7A 3MUTP 2J7WA 1H8HA 5KW9A 1IBCB 1C1BA 1NB2A 4KV8B 3CPWR 4M2LA 1NH8A 2YNGA 1H3DA 1XR5A 4XLNA 1HWUA 1XMBA 3ZBUA 3GFYA 4DQSA 2JA6A 2RKIA 1P4MA 4A3MK 1U2CA 1DY3A 2CFXA 3BSNA 4A3DK 4ANCA 3OZWA 4CDIA 2VKZG 3TR5A 2X3DA 4K0KJ 2KZZA 2DNZA 1Y1VA 4R25A 4WJ4A 1NHKL 1N36F 1SVDA 1NK7A 3W63A 5HXBA 1JJHA 3LUYA 3CCLB 3VGUA 1B0VA 2J8SA 3EZUA 2H54B 1KC8T 2VPXB 3GTQK 3WHIA 3QSYA 4WFYA 1Q7YT 1VQ6B 1FJ7A 3BGOP 2VFRA 4LVOP 1IS1A 4BLGA 4WZQA 2F4FA 2IDLA 2Z6BD 3FKIC 2GFFA 5A8KB 1FK9A 1HLWA 2UV8A 1SH3A 4P7TA 2V31A 2FHJD 2Q1LA 3O2IA 3KDOA 2GGPA 2AYMA 1J9ZA 4L3KA 4Q44A 3QSIA 2F43A 2EFNA 3VMFA 4CLYA 3UN3A 4ZS6A 3CJ8A 5E3QA 4HHUA 3OBIA 1HNZJ 3FC9A 2BX6A 1U8WA 2LCWA 2PT0A 3U1MA 1WHXA 5GV8A 1NH7A 1Q79A 1A8PA 4Z4YA 2XO6A 3LGNA 4X06A 5A8WA 1KC8D 3JSTA 2M5SA 3GTJK 3QATA 1T8EA 2O01C 2B7CB 3R3TA 2IA6A 3Q22A 1N8RT 2DO4A 4O3PA 1L5UA 2EVZA 1DG1G 2WSEC 2AJ0A 4DV0J 2J6UA 1KMHA 3OVBA 4B9SA 2H9ZA 3OPFA 2HLTA 1LQ9A 4HIZA 1OPZA 3UDVA 4C7QA 4G7HA 1JJ2R 2ZC3A 3S6EA 2QGGA 1YJNS 3BJYA 4N76A 2BVZA 2HW3A 3R97A 1EKRA 3CJQA 1KQSR 5D4PA 3K5NA 4FYVB 1BJTA 4C8LA 3HOYK 5ETOA 3LQ6A 3G8QA 2JA5A 1FRJA 3KJQB 2HFVA 4DL2A 2E2JK 4DUYF 3DLBA 1Y0HA 2AF6A 2CBXA 4FF2A 5JUMA 3I82A 4IDKB 3GTJA 3CO9A 1RYRA 4PXCA 1S6QB 2IVYA 3PX4A 1VS3A 4X84A 4YEAA 4ZJOA 2WAQD 3WX8A 3OL6A 2JZ5A 4O3QA 1IHMA 4USKA 1IBLJ 1AXQA 2MJUA 3DMJB 3OAAA 1MROA 4OHWA 3SCJE 4NXNJ 1FRMA 2HGNA 2VKRA 4DG1A 2HIQA 2NSCA 1F3FA 3ET6B 1NPRA 4Q0BB 2FZGB 3GVKA 3R5DA 1UVLA 5ETPA 3TZZA 2XYPB 7FD1A 5CXTA 1S5ZA 3JXOA 3TI0A 1RT2A 4B3TF 1FE0A 2HHUA 2JSXA 3MTJA 4DI6A 4BDPA 5DO2A 1SQEA 5IP9C 4GQNA 2BGIA 1YCLA 1RTZA 1HKAA 2W9BA 4TMWA 2BVNA 4PC2A 4X65F 2B9YA 1PAEX 1QTMA 2K1RA 3N28A 3MPUB 1C1BB 3BQ1A 3OHBA 4A3LC 1S0NA 1R43A 3VWSA 2FLOA 3I0RB 2X0KA 3W5ZA 2R7VA 1VRUB 3CJKA 4GO7X 1HYSB 5K14B 2L48A 1LKZA 1SQFA 4NLUA 3CCVB 3MEEB 3GTGA 4OHVA 4EBEA 5B0BA 1U2RA 2CA9A 1PBUA 2PMDA 3BN7A 4A3DC 3ZPNA 2YWGA 2FHKA 1NB7A 4FXDA 3MUMP 4I4BA 3BKUA 3IAM9 3BGUA 1EI6A 1OJ4A 4RWXA 4A3JC 4RW8B 1JK9B 1CJUA 1WHWA 2MQ8A 1JKHA 3R27A 3WNCA 2XNJA 2H4YB 4WK1A 1XFOA 1M1KD 1YG0A 2MB0B 3HFZB 2ZDPA 4WQMA 2GIFA 3M7VA 4MK8A 1TP7A 1RTHB 2QFIA 4YMEA 4XPEA 2IA0A 4C3IK 5C5JA 3FEZA 3JU4A 1ZOTA 4B9VA 4G1IA 3OFNA 4F0KA 3PW4A 4JUZA 2XMAA 1Q8BA 4ZGNB 4IW3B 4A47A 3LTOA 4X8IA 4XLPA 1GMWD 3B8HA 1YLOA 2V4JA 3KHLA 1TL7A 2DNPA 5IC6B 4DX5A 1EP1B 3D6MB 1AMOA 3LP2A 1ZM2A 3T53B 4Q2LA 4OQJA 2RDIA 3CNQP 4DPUA 2KN4A 3A3PB 3M6WA 3MD1A 2GVDB 3FKBA 2GO8A 3TUIC 4IG0B 2BF4A 3DU6A 1GH8A 1Q5YA 2B4OA 3DLJA 2KM8C 2W24A 4IKAA 3JS9A 3K5MA 3WBJA 2CJQA 2NXCA 3I6PA 3CPXA 2VFSA 2JA5K 3TOQA 3CCQB 1WHVA 3G4AA 3HF5A 4OLOA 5HKKA 1P1LA 4WYLA 4IFVB 2YX7A 4DV6J 3C6UA 1WC5A 2X8KA 2KWAA 2BQRA 4B3OA 1BUXA 1IQTA 3VTIA 1U26A 2DIUA 4TMZA 2VV5A 2VU5A 4M5GA 3VA7A 2HS3A 2HYIB 2XGJA 2IFXA 4I0WA 1SJRA 3HDSA 3RYLA 4TMXA 1EETB 1WKJA 2Y0SL 3KHRA 3CESA 4X4VA 2V8PA 2DB1A 3DLKA 4LF9F 1AW0A 1E6VA 3MPVA 4B3GA 2RU9A 1RDRA 1T0TV 2JVOA 3NNHA 2UVUA 4UOHA 5KFEA 2BUNA 1CSJA 1X8DA 2HZVA 3PM9A 3J7ZT 1RE1B 2WHOA 2Y3YA 5F4MA 2XZTB 4K4YA 2E7WA 2QYCA 4TNOA 3RTVA 4IH5A 2YU9A 3RBEA 3KJNB 1W26A 3K59A 4E0FA 2J8AA 1RWPB 1WC1A 4DFMA 3M2RB 1EETA 4WBFA 1T9VA 2XNDA 1WG1A 2P2CB 1W2IA 1M1GA 1CJKA 3CCVS 2XGPA 3CMMA 2VQEJ 3R2CJ 1VDHA 4X66F 3FQKA 4M94A 3KK1B 3T9NA 4P6YA 3G6XA 3GTOA 1RT2B 4EFAC 2AHOB 4DPTA 4LF8F 2OHDA 3VF0B 5DS7A 3M32B 1UAWA 3P26A 3PA2A 4I1TA 2V50A 2WPDA 2G2OA 3M8SA 1IKVB 4UY85 4CH1A 3GYNA 4CM2A 4OIOA 3R8YA 4OYAA 1VQNB 1J6WA 3LAMA 1VQ7B 4KV8A 1R7IA 3NGUA 4LBHA 1HNIB 2CWKA 3W3SA 4NXNF 3A3GA 4NZ7A 1EFRA 2ASDA 2JOQA 2W2NP 2AJ1A 5GMEA 1T6YA 3I4MC 3EE3A 5LMNJ 4G0WA 1QTNB 4O0NA 2BKNA 1WI6A 3S17K 1T9XA 1DDIA 2RQKA 1AA1B 2CVIA 3GP9A 1W0JA 3K7AK 1KTQA 4YR0A 3M8YA 3DRYA 3S1MK 3I5AA 4QUZA 2HWIA 3S1TA 4P6VF 5FA6A 1V5IB 2GS8A 4EH1A 5FDLB 4NCNA 3PR4A 4MEXA 1YHQB 2GV1A 4QVJA 4F7VA 3WYAA 4LK1A 4OIQA 1F60A 2PD1A 3JQKA 1T11A 3M30A 3PVXA 1O29A 1HBOB 2YKPA 3BGRB 1TAUA 1OY9A 1SL2A 3SXLA 3I55B 4J91A 1RAOA 5HL8A 1Z2LA 4PWDA 3ASPA 5D6GA 3Q8QB 2J7UA 1HHSA 2BKPA 2R8GA 2R2RA 3FSIA 2QA1A 2QLFB 3C6UB 1N5QA 4A8WA 3ILLA 2HNZA 3I4HX 3BR8A 4PAAA 5FDLA 4BCAA 2ZE2A 4WFAQ 2QA4G 4GTLA 4JI5J 4RNHA 3KLEA 3H98A 1TWAC 2B9EA 1DFDA 3CP8A 2BJ1A 1H42A 1VJSA 2PMZD 1WC3A 2R7OA 3BR9A 2VASA 4ZKAA 4IQXA 4F4KA 3SJZA 1KONA 2JIZA 1CNFA 4NLRA 2CRVA 5E6TA 3FHZA 6FD1A 2H5IB 1E3ZA 4Z4VA 1B7FA 3GEHA 4OJ3A 3OPOA 3FSYA 2R7XA 2N4CA 1TL3B 2ZOMA 2U2FA 2BN4A 4HLBA 2OO4A 2LQJA 3HHLA 3CMQA 1HR0J 2M2BA 4KM9A 3HO1A 4M5DA 1F9HA 3LPEA 4KHMA 4UOCA 4CWBA 4A3KK 3GTLC 2BW7A 4UUWA 1S76D 3QYYA 1X4EA 4XKVA 4Y52C 4ILLA 3L7OA 3PZPA 5IYQA 3TZYA 4NLYA 1HNWF 5IT9U 1W35A 1U6BA 2XBPA 2Y8YA 1RA7A 3UCGA 4DPYA 4EYHB 4OX8A 2WVFA 3Q8RB 5EHHA 4QU6A 1IR0A 1RTIB 2CAJA 2Z0GA 3PYGA 3EVWA 4V19J 3BO2A 4CLUA 2ZKUA 5H1SV 2E2IC 3BO3A 3BDPA 4DV6F 2GNKA 4IQMA 3GTGK 3E20A 4B3MF 4USJC 2ERRA 4X7CA 3SZ2A 1HA1A 2PHCB 4YHHJ 2Q3PA 4RPFA 1Q8LA 2P9EA 1DLOB 2RRAA 1UVNA 2ZNZA 4IO9Q 5KG2A 1YQHA 2CXEA 5K8PA 2DPJA 1QVFB 1QX4A 2JA5C 1HI9A 1DTTB 3ZTSA 3GIIA 2BKOA 1S0VA 1H74A 1F7UA 3RR7A 3QGGA 3SDEB 4OX7A 2R3VA 2ZH2A 1KOOA 2GSNA 2DISA 2ZL6A 2F8MA 3DRSB 2FDNA 1LWCB 1QD1A 3IP0A 4CNYA 4YFKA 1V0FA 1KQGB 3RZDC 1FEEA 3G6VA 2VUMK 3HSZA 1X7VA 4XLAA 1HI0P 3GJSB 3GG0A 3I56S 3IR6B 2R7ZK 3OUYA 1NU4A 4IG3B 4DL7A 2VQEF 4Z4ZA 4Z4TA 2FY1A 2BE2B 3OR2A 1BWEA 2VFTA 5HLFA 1FKPB 3P8BB 2NVQK 4ZP6A 1R5NA 2LP4A 4LF8J 4KPYA 4URQU 2ZDOA 4DR2F 5C24A 1FERA 3NMAA 2WW4A 5F8MA 2XM3A 4NBSA 2IC3A 2Q66A 3NNAA 1VHFA 3AVXA 3PUNA 2UV8G 1VH2A 4CQJA 2ZHBA 4ZVSB 3K58A 3DDYA 1BGWA 4HTIA 2YNIA 1XR6A 2XY5A 1NHUA 3GQCA 2NV4A 1R6YA 4PXEA 3HOZC 3IBCB 4PWWA 5CA5A 4PWDB 5EWEA 2W7PA 2EC2A 2ZJRQ 2BQUA 4O3RA 4P2SA 3W2VB 1P8GA 4CLFA 1L3SA 4XDCA 1N6QA 3F44A 1UVKA 2IJFA 5CABA 3ENWA 1VK8A 3AT1B 5AN9A 3WC0A 4LSNA 4OI1A 3LPYA 1TK0A 4PEOA 3W66A 3ASQA 4QQBA 2BE5A 2EG1A 2KVQE 3AODA 3HSJA 2AX1A 2IM2A 2W7VA 4U7UD 2Y1JA 4DCPB 2R7WA 4B4DA 5DQGA 3S14C 4XK8C 1TR0A 2YKQA 2OTLS 4O4GA 3CUNA 2HBYB 2VBSA 2ACYA 1RU2A 2VC1A 4P75A 4NLGA 1H85A 4D3GA 4DV3F 1PYTA 4QWDA 4KMHA 2DXFA 2OMLA 5EX0A 4CO2A 3VNVA 3OZVA 2GCFA 3FJ2A 3Q83A 3HSGA 3QT8A 2OUGA 4LT6A 4QZVB 4ETZA 2VD3A 4OZ2A 5KFKA 1FJGF 4WWSA 2PGCA 3Q8VA 1RLCL 5FO1A 4XLEA 4ITSA 5TR9A 3ETOA 3V6DA 3PYFA 3Q2SC 3ZZPA 5F4JA 4PRFA 4HT5A 1PC4A 2YH1A 2YX1A 4ZVOB 2KL8A 2O3DA 4HI2A 4NLTA 3AXMA 1WU8A 2NQPA 2ZZMA 1TWCA 1U47A 2QLWA 2DY1A 1RT3A 2D6FC 1DRZA 5FL7A 2WOMB 1YZ7A 3DM2B 4K8RA 3SEOA 1S77D 2FD2A 1REVB 3K89A 2EKYA 4U96A 3OKXA 3TQ1A 1UPPA 5C42A 2E2HC 5ETMA 1Y1VC 3MWBA 2ZZNA 4ED6A 1HR0F 2VPZB 1UETA 2CPYA 4DN0A 3GSDA 3V6DB 3LAJA 1S12A 1DLOA 4F04B 1LOUA 5C25A 2H4WB 4PG7A 2DNRA 1AFJA 3CULA 3N6LA 2VUMA 1JMTA 3MEGB 3DRPA 2ZL5A 1NMEB 3HVTA 4DEZA 4QW9A 2ZZTA 3BN4A 3P5TL 3AVYA 4KR0B 4EZ9A 1S10A 4FS2A 3JQRA 4AH6A 3SQGB 4EUVA 1LNQA 1UD2A 1FCAA 1CULA 2W2QP 3GEIA 2R7UA 4B43A 3L4KA 3DOLB 3I0SB 4CNZA 3MD3A 3R5AA 2A69A 1J27A 4X4RA 1F2GA 1PGZA 4E0DA 3KOAA 4B3MJ 1E6VB 2J9CA 3U27A 4NA1A 3L4BC 4H4MB 5HMZA 2AGOA 2KTQA 2DH7A 2MXYA 2VFVA 3MAHA 2OBTA 5A0YA 1NEEA 5LOQA 1UJ4A 3PW5A 2YQ3A 5THXA 2Z2LA 2DGTA 4A8FA 1S1XA 2XHCA 4J9OA 3MECB 1Q95G 4ROXA 4EK2A 2GO9A 3WC2A 3KHHA 2XCQA 1KK3A 5KG1A 3T6JA 2ZH5A 2Y0SD 3M4OC 3GYXB 2PSZA 2JDIA 1M5HA 1CPZA 2FHJA 5IS2A 4KDDA 3UI3A 1YLXA 5KG6A 3F73A 3I4NC 4IDKA 4F2SA 2J6SA 2IJRA 3H0GA 1QVGR 4B9NA 3C8YA 4U67Q 4X2BA 3ZZZA 1S1WB 2VBVA 2ZITA 1DDGA 3GIMA 3KMSA 1T9TA 1I94J 3GTJC 4JV1A 3OW2R 4GVLA 2NYHA 2DEIA 1JLCB 3A3NB 1G3OA 3LALA 4QW8A 3HVWA 5C7PA 2E1MC 4F4YA 1WQFA 2OPPA 1ZPVA 4URGA 1UEVA 1O8BA 2R8KA 4C0HA 4DQQA 3MHYA 3AXKA 2CQ4A 1HD0A 4Y00A 4LREA 4C97A 4ED2A 4MK7A 4C8KA 3RY8A 4A3IC 2LFVA 3M32A 3CJ5A 1HWKA 2B56A 1SKSA 1F0XA 1ZH5A 1T6XA 4P2MA 2RUGA 4WFBQ 3L3CA 1NO8A 2F9DA 4ZCLA 4YY3F 3IBFB 1FWLA 1N5SA 3MOZA 1OO0B 4ELVA 1UJ6A 2MKCA 4DV5J 1Q86T 1VQLB 2YTCA 2ZVIA 2PI4A 2BQ3A 3R7BB 1OSDA 4DSEA 2WB1L 2HS0A 2YY3A 2ZUEA 5CDFA 1SL1A 3HULA 2IMWP 2B63K 4Z37A 5E41A 3CCZA 4UZEA 1S57A 3PA1A 3PDNA 1HYSA 3W2HA 4BWMA 2JRSA 3HHKA 3FUYA 5J1EA 1F5AA 4YB7A 3DOKB 1QUFA 4OI3A 5TMCA 4LRCA 1Q5VA 1GAWA 3CCRB 4CP5A 5IK2A 2K2PA 5KG4A 2DK2A 4OYIA 1H6KX 2W4DA 4OX9F 1IM4A 1N56A 5A88A 3MFIA 3ETMA 2DYAA 1NDLA 4RMFA 1WDTA 1Z4UA 3UN2A 2NVYC 2N7YA 2PA8D 2OLWA 3MCAA 1Q53A 3AH6A 4CT9A 1S9GB 3R6JA 4LBPA 3WIVA 4KHPJ 2V7VA 1BPLA 1R8CA 3M3YK 2M88A 1X0FA 1VQ6S 1PBAA 4JV5J 5F8NA 1WORA 1JOEA 2XCAA 2NREA 5KOXA 1X5SA 4EU0A 1N5YB 3W9HA 1DTQA 1UWBA 1V0EA 4CYUA 4WP8A 3IG1B 2OJ3A 3SSQA 1OQ6A 3GVLA 2HHTA 3IWLA 4PC3A 3AQPA 3RAMA 4GT9A
chains in the Genus database with same CATH topology
1VLYA 1WSVA 3A8JA 3TFJA 3A8KA 1NRKA 3GEIA 3GSIA 2GAHC 1WSRA 1V5VA 1YX2A 1X31C 4P9SA 1VRQC 1WOOA 3TFIA 1PJ5A 3GEHA 3TFHA 3GEEA 4PABA 1XZPA 1PJ6A 1XZPB 1WOPA 3ADAC 1VLOA 3AD8C 1PJ7A 1XZQB 1WOSA 4PAAA 3TTGA