1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
1WORA 1NRKA 1V5VA 3TFJA 3GIRA 5L46A 1WSVA 3AD7C 3A8IA 3TFHA 4PABA 4P9SA 2GAGC 1XZQA 3ADAC 1XZQB 3AD9C 1YX2A 3A8JA 1VRQC 3GSIA 1X31C 1XZPB 1WOOA 3TTGA 4PAAA 1WOPA 1WOSA 1XZPA 1PJ6A 3GEIA 3TFIA 1PJ7A 1VLOA 1VLYA 2GAHC 3A8KA 3AD8C 1PJ5A 1WSRA 3GEHA 3GEEA
chains in the Genus database with same CATH superfamily
5CHPA 3AB4B 2PC6A 5IT9U 3A8EA 4RPBA 3MAQA 3JSMA 3I4MC 5DM7Q 4P52A 5K8MA 4KMUA 1TL4A 1U0HA 4KH0B 5T41A 5HJYA 4XL9A 1M5PC 3J7ZT 3VAHA 1CBKA 1JLCB 3IFEA 2CZ9A 4DV7J 1TWFA 4LQ9A 1NJIT 4Q44A 4K7QA 1DQAA 2GX8A 1T5EA 2CWXA 1T6ZA 2UUAF 1JNRB 1QUFA 1HMVB 1I6HK 4C3LA 3KDNA 3I0RB 2E2HC 2ZH5A 5HMYA 2RKIA 4FYYB 4OOVA 1F20A 4QIFA 1UPMB 2DCUB 3WC2A 1V6HA 3WC0A 4P9SA 5M3FK 2W2QP 3A4TA 1G51A 2MPUA 4QYZJ 3AVYA 2R7WA 2FDNA 2IM2A 2A6HA 2CW5A 1GE9A 1X5PA 4MK7A 3JQQA 1H0HB 2DRDA 2ZZMA 2YU9A 4YS2A 3ZTOA 1VQKB 4I1TA 6FD1A 5KFAA 1FCAA 4NZ7A 2Y1IA 3ADAC 1YITS 2G0JA 2N3LA 3GJRB 4O44A 1N32F 4OIQA 2P5VA 3RZDK 1KTVA 5EGEA 4AE5A 1EETA 1Q7YT 4EBCA 1SQGA 1NDPA 5GAGI 2QTLA 2OK7A 3NP5A 3PENA 1N52B 4WFYA 3NCPA 4ED1A 3B8HA 3OT9A 4I6WA 4J9NA 3BGRB 4N41A 2C3PA 2XSFA 1NPPA 3W7BA 3IGVA 2CZVC 3QX3A 4JI0J 1E3ZA 1S99A 1DBDA 3I55B 1Q4RA 1K73T 4X7EA 2GQFA 5C24A 1HI8A 4OYOA 4RW4B 5IYCC 3QLHA 4Y00A 4B9LA 3HOXC 4TU7A 1RTIB 2Q6KA 1TL7B 1QGAA 1Y0RA 2B6AA 4KMDA 3GTPK 2QMUB 4QIWL 3I6PA 2AEJA 5CXTA 4J9LA 3LO3A 3MEEB 2MQ8A 4QR1A 4C3HK 3CXCB 5C44C 1QSYA 1T03B 4C3IK 3DMJA 2KJVA 4DR2J 2D74B 4DN0A 2CZ4A 4BBYA 3CJSA 4RBUA 3NAIA 2OTLB 1T6YA 3VO1A 1HHTP 2BSAA 2F63A 2B4UA 3MPUB 2HHTA 4DPWA 4Q5SA 5ETLA 2J0SD 1UPPA 4GT9A 2HBYB 2YVSA 4N5SA 3H0PA 1X4FA 5EGHA 1CJTA 5DLGA 4TMTA 2HKEA 1UL3A 1WQHA 3S2DC 5BXIA 1RBAA 3D6FB 2B8QA 4USVA 2OPPA 1MMLA 2MSSA 3C6UA 1OHHA 1R6YA 3U1NA 2JFDA 2KO1A 3GTMC 2QMUA 2KYZA 1IXKA 3TUJC 1WKLA 4NOIA 3G8QA 1E6VA 4NYPA 4NLDA 4GTLA 1GMWA 4GTEA 3CJ2A 2CJBA 3I56B 4DS5A 2BMBA 2DBBA 4TN1A 2V0NA 1K9MD 1R0AA 3OPKA 3M4XA 4M5HA 1OSCA 2NCKL 1WI8A 3WBJA 3N5FA 1DTQB 2AWZA 3LP0B 3TFJA 5GADU 1SKSA 1TWGA 5L9NA 3CP8A 1YTYA 2X6WA 2FUG9 2VJUA 4A8MP 2GJ2A 2BBEA 2QTWA 2CQ2A 4I2QA 4P73A 2RB7A 4R0EA 2O5IA 4P25A 1TL3A 2LFVA 2EBEA 2LA6A 5A8RA 1HNIB 1WD6A 1ZM9A 4RNOA 4ECTA 1MSWD 2XGJA 3CD5A 1FE0A 5EUHA 1QSLA 3JSRA 2CRVA 4K0KJ 2QEXB 4EWTA 5KFEA 2HNYB 4BC9A 1OYDA 2PO4A 4FYVB 4Z1MA 1X9WA 2CDQA 1DTQA 1KOHA 1QSSA 5L9XA 4ZVUB 3VNVA 3PO5A 4QJVA 2E9ZA 1DLOA 2MMYA 2IM0A 4Y9RA 4F04B 3ENWA 5KFCA 1YG0A 1HNVB 3OE7A 2HQ3A 5EWEA 4BWJA 2J0XA 5J1PA 2R7QA 1FE4A 3G87A 1DCHA 1AW0A 4YB7A 1IHMA 2PIIA 4X66F 4YY3F 3G8SA 2WYRA 1V5VA 1ZM4A 1HNIA 3GTMA 3NG8A 3HHNB 4CO2A 2UUBF 1WG5A 1UWAA 4WZMA 3DOKB 5L1JA 1WTFA 5A76A 5L38A 1RT6A 7FD1A 2FHJD 3PA2A 5A2QU 4UUWA 4DG1B 1NJYA 4QWCA 4BY7C 1FRMA 2XNJA 2LKZA 3EUNA 3MFIA 2HNYA 1SJ4P 5EDWA 2YKAA 1TWHK 2GJPA 3AVXA 2FYXA 2XZTB 3RBZA 1QFYA 3OR1A 3G6EB 2YY3A 1X8DA 4QQBA 4C8LA 2PE8A 3OXLA 4CH1A 2E29A 4OJHA 5L1KA 2AHOB 3KK2A 3ISND 3N0CA 1NK7A 3MEGB 2RSQA 4O3NA 2E1PA 3M8WA 2PFFB 3IR5B 4XTTA 4Q2LA 1N5TA 1QAYA 2C22A 2Z2MA 4DJBA 1MRZA 1GMUA 5FIUA 4ROXA 2V7WA 3P6YC 3TVZA 3HX9A 1N48A 1GTEA 3OTOF 1X9MA 3WIVA 2FD2A 4MIWA 4XN0A 5B6IA 2YKMB 1RU0A 3KLHB 2VPXB 3W64A 1XERA 3H5YA 2VZLA 2VG5B 5C25A 1IQZA 4LR7A 2G2YA 2F5GA 2FQQB 1K83K 1CLFA 3FCWA 4OI0A 3ZNJ1 3QRPA 1LWEA 4ZDNA 1R27B 2CPFA 4CO0A 3HOZC 2X85A 3B54A 4DPUA 2ZBQA 3DHWC 3BR8A 1O24A 2RQCA 1TVCA 3SI8A 5EWFA 1VQMB 2AMCB 4C8KA 2WBRA 3AVWA 2YNGB 2HHHJ 2L41A 1DFDA 3OVBA 2IC3A 5IC6B 5HBMB 2WBMA 4M2LA 3ZPNA 4Q4ZA 5H9FJ 3L7OA 1F3FA 4R8UA 2AV5A 2BN4A 1S6PB 3UVJB 2UXCJ 1SBRA 1SH3A 3DXBA 3QQCD 2DHAA 1U8WA 3TVKA 5KFOA 4LK1A 3PUMA 4WFNQ 3CDUA 1UVNA 3V5RA 1RYRA 1Q95G 1TKZB 1FRLA 5H59A 3H5XA 3T1HF 1LOUA 3W2GA 4G7OA 3RB0A 2KJWA 3Q89A 2DR5A 4HI2A 4J91A 3NE5B 3MECA 2DO0A 4I2PA 4AUKA 3CMMA 2GSNA 4NEYA 3ZZUA 1FWPA 2GVZA 3HOUK 4A3KC 3CCSB 1T9WA 2DXDA 3OD2A 3S1RK 2A0FB 3Q8YA 3GJSB 2YWKA 1NK9A 2MHEA 1MN7A 1ZS6A 4OIXA 1D0EA 3MM7A 3VVTA 4MIAA 5L1IA 5C2GA 6AT1B 2IMWP 1RAFB 2DYIA 1FJEB 5DS7A 1X4GA 5CD4H 2ADBA 3IP0A 2FJEB 5E41A 4ZCIA 4A3EC 2LQ8A 4RUHA 4CLTA 4KGKA 2EK6A 4JV1A 4WJ3M 2J0QD 1EKRA 4NLXA 2DITA 4RWWA 1T05A 1FX0A 4OLPA 4ILLA 1S57A 2RJZA 3QJJA 1WSRA 3O5TB 4I7FA 5I3UB 1K9MT 4ZGNB 3LVBA 2PA3A 4ED8A 4NWBA 5FJ4A 2CJXB 4A8FA 3BDEA 1JKHB 4HR2A 3EDQB 4ZCLA 2RHSB 2R92K 1XNRJ 1V5IB 4BHQA 1HYSB 4ZGQB 4GKKJ 1VRQC 1JNZB 4K2XA 3SDEA 1ELOA 3V6JA 1SCJB 4EUVA 4KC6A 8RUCA 2LQBA 1PO6A 3BH6B 3W9HA 1TWAK 4ICLA 3FRYA 5F8MA 2DISA 1ICEB 2GMLA 4PABA 4USJC 5DS0A 2O1PA 1VHFA 1VGXA 2ZM6F 1JXEA 1M5SA 1R9TC 4X84A 5KT4A 4EI2A 1G7SA 3A3NB 3OL6A 1U7LA 1U6BA 3CC2B 3BS9A 4MQ9A 1PYOB 2V8HA 1H2TZ 4MIBA 5FIIA 5IOSA 1EFWA 3IWLA 5D0GA 2B5OA 3OFFA 2MQLA 3DRRA 3CIZA 4J9MA 4AQYF 3N5BA 1U6ZA 2Z30B 3A3GA 1Q7LB 5KG4A 3E2EA 5IYDK 1M90T 2DGWA 2ATCB 4U67Q 2JA7C 4RU9A 3WBKA 4MT1A 3PO4A 3DLKA 3PIOQ 5E6TA 4UOCA 1SV5A 4WZLA 2B5JA 3KJNB 1U2RA 3MMBA 4OPSA 2LEBA 3MR3A 1KQSR 2M3DA 2KI2A 2GZOA 4CP5A 1S12A 2ROEA 3NOGA 3ELHA 1R8PA 3Q8VA 5AN9A 2CPHA 3HT3A 4OX9F 4YDXA 2J9CA 1BXNA 4GQNA 3CVKA 4XDDA 3BCFA 1BQNB 2FVQA 2BJ3A 3ONQA 1KHWA 3J81j 5CCLA 2QDXA 4RW9A 4XNFA 4K0KF 2V7VA 2HVDA 4RM0A 2PFDA 3ZIAA 4OX9J 4DV2F 2CPDA 2KT3A 4NL5A 1S97A 1JLQB 2WVDA 2DNOA 3KHLA 2ZVSA 2AW0A 4RX6A 3W2VB 4X7CA 2HHQA 1N0VC 3I9V9 2YNFB 3V6DA 3D0GE 1IJEB 4A93K 2DH7A 3LAKA 4CO4A 4KT0C 1IQTA 2WVEA 1UTAA 4RNMA 4DNTB 1K83C 2HAIA 4ZHRB 1HBMA 4C8YA 1J9ZA 4G7HA 3MCSA 5KFVA 5IYPA 4YMEA 2VASA 1LW0B 4ASUA 1JMTA 3DU5A 1WCMC 2ALZA 1VRUA 2HHSA 3D1HA 1NJID 1UA0A 4IOBA 4KC5A 2ZFHA 1F2GA 1Y1VC 3PJWA 4DCOB 2RIJA 2ZUEA 4E2FB 1RDRA 3ICLA 3OPFA 4DU7A 2GAGC 4ED7A 2L9NA 3IGNA 2FLNA 2E5IA 3QSYB 3ZFVA 2DR7A 2JDIA 2ZZTA 4WYLA 5HL8A 3SSRA 1TELA 3PHEA 2JDJA 4A3JC 4Q2MA 3DOMB 4FF2A 2Y1LB 4Z2XA 2FLOA 4PRFA 1TWFC 2XS2A 2AJ2A 1GAQA 4PUOB 3M2UA 5KFIA 2B4PA 1HWLA 2M2BA 2BACA 3ASPA 3BC9A 2VQFJ 1U4BA 1B4SA 2EEYA 3PEHA 3FCVA 4L6V3 1ZBSA 1WWHA 1FRHA 4OJ1A 2CW0A 3WZ0A 2Q6OA 3SLDA 1S9EA 3WX8A 1R6VA 4FS1A 1RADB 5B0GA 4E98A 1Y0HA 2KRRA 5ETKA 4O4GA 4KJIA 2NYHA 2LZJA 2HVIA 3CJTA 5C42B 4CLSA 4JI4J 2XZWA 2UVRA 3DOLA 2XCPA 1VQNB 1ZM3A 3QIPB 2UUAJ 1XXAA 3JQRA 2QL7B 1SFOK 3G82B 4RW4A 1C4AA 4KM9A 1LXJA 4B4DA 1FRJA 1WUUA 4EU0A 4WZKA 5EGYA 3CAGA 2J6TA 1N56A 3OZWA 1HA3A 2MHNA 3RB3A 1RTZA 4AT1B 5KFMA 5KOWA 1FJ7A 1FRNA 4PQAA 1RWWB 2JSXA 3JB9k 4KPCA 2EFGA 1NNDA 3V2UC 2CFAB 1Q82T 4WF9Q 1FVQA 2O67A 3VWSA 3GONA 2UUTA 3M2VA 5T7LB 3AD8C 2B9XA 1MU2B 1YK9A 3JQKA 3GTQA 2VYQA 2BW7A 2DY9A 3HZEA 1AXQA 4NRTA 4DV2J 2PMZD 3U2QA 4OZJA 4TVAB 1EIYB 2BJ7A 3LAMA 3MMAA 1IBMJ 2HEKA 1T94A 1YQHA 2ALYB 1SJ3P 4ZPBA 2V31A 5HP1B 3BSAA 2K1RA 1UD6A 2C3MA 3D67A 3EVOA 2IDEA 1UFWA 3G82A 2CYYA 4DI6A 1IKVA 1IL2A 2V6UA 1AFIA 1ZETA 4B3TF 2AGQA 2V4JA 4XLCA 2DHGA 2NSBA 4OYBA 5KG0A 2FTRA 3TX8A 5B0CA 2XI2A 1VH2A 3L7PA 2HMAA 1FKPB 3CULA 1DRZA 1HFEL 4Z4YA 2CQ1A 3BEGB 1WF2A 3KLGA 4F4KA 1JLAA 1L3UA 4HYKA 2LXUA 4CTAA 2BEFA 4U7UK 4TNOA 3JTOA 2B7BA 4DBQA 1UZDA 2BYCA 2DR6A 1MW7A 2CG4A 1SPBP 2AEFA 3BKUA 3U6BA 5D3GB 2JC1A 1VDHA 4WU2A 1RT2B 2WB1L 2BGIA 3IG1B 4LF6F 5HZBA 5EX0A 4OZ0A 1W9XA 2B4VA 3FEZA 3ZBTA 4XKWA 2VDHA 5K8OA 4ZVOB 1I8DA 4NLTA 2R42A 1BD6A 4YP3A 3I0RA 4DV4F 1P4MA 2HYIB 4Z4ZA 1QY7A 4GO5X 1VQSA 4DMZA 4YR2A 3NNHA 4C4WA 2A6MA 1JLBB 1TKTB 1ROFA 5M2UA 2D7SA 3BKFA 5GV7A 2JJ4D 2ZKTA 1NB0A 5M3MK 2V6AA 4HVZA 2XTJP 1Y1WA 2AQ4A 2YQ3A 2XWYA 4DUZF 3GTQC 3Q24A 2AX1A 3HHDA 5L8RC 1RLDA 1RI7A 1FNMA 4FYXB 3V81A 3RAQA 1FK9B 1RT2A 1IM4A 1VK3A 1FKAF 5IS2A 4CO3A 3HCXA 3CCQB 3CDEA 3NOCA 4OPVA 4KV8B 4DF4A 4CH0S 1IWAA 3L9ZA 1TAQA 3WY9A 3HP6A 3P5BP 3M9NB 4FNHA 4KB2A 1HQ2A 4IRCA 1D8YA 2KXNB 4BLAA 4Q5VA 2BPOA 3EDRB 4XLEA 3GVJA 3I4NC 4JUZA 4ZMMA 1LWCA 4M95A 2J7UA 4EBDA 2NPFA 5HANA 3FBCA 4UZBA 3I4MK 1MG7A 3QLHB 3P45B 2AJ0A 2QA4B 2B6AB 3CMAS 3QATA 1V0EA 4UZFA 2X3UA 2FVGA 4ED0A 1N33J 2C28A 3FFIB 1PCAA 2GQQA 5DJBA 1HQEA 2H4WB 4C3KA 1FNOA 4H9GA 1H73A 3N28A 3EJMA 3FBFA 1N34F 4WTOB 2H5JB 2K3IA 2IHR1 3HI9A 5MAOA 3LF0A 1T03A 4BC7A 1REVA 3GR0A 1M1KT 3ULHA 4R5PB 3GG0A 4CNYA 2DEIA 3KLHA 4BPRA 2R92A 1QVFR 5TR9A 2MZTA 4NNJA 2PPBA 1A6LA 3F41A 2CIMA 1SFOC 1TWFK 2OUGA 2ZH9A 4RNNA 2E1MC 2H3EB 2I6WA 1Y1WC 4GRSA 1GQEA 3IBCB 4QR0A 3NCQA 4HT7A 3ZTQA 2EFPA 4FXUA 4JV0A 2BM1A 4FNIA 4BCAA 1JLGB 3TJ9A 3AOCA 4J9QA 3TUPA 1S48A 1LW2B 2Q66A 4OHVA 3W5ZA 4K4WA 3MFHA 1HBNB 1XNRF 1NMEB 4TN2A 3UR3C 3BDPA 2KL8A 2BVNA 2Y3PA 3R1HA 2WVFA 4P2XA 5C7PA 1PJ6A 1S76D 3FSXA 4WE1A 4GKJJ 3IRXB 3WBZA 4DEZA 1HIYA 4B9UA 5CAAA 1RAAB 3MURP 4ITSA 3MMLB 2V5HG 2CJAA 1KLMB 3CD6B 2CNNB 3ENAA 1GAWA 2O66A 3LGMA 3NWGA 4NE9C 3PW7A 3G9CA 4CQ1A 5BYRA 3D6HB 2WPDA 1Y10A 3CCMS 3FGVA 3LPXA 1C1BB 2GJRA 2DO4A 5EX3A 1YNNA 1RT1A 5IYCK 1VQKS 4C3JC 5FJ8K 2GHWA 5KT2A 3ENVA 4OZNA 1C0AA 3MI7X 4ETZA 3DNCA 1TU0B 1U1NA 3PTWA 2JA5A 2A2DA 2KKHA 1DQ9A 3CJKB 3TJAA 4URSA 2OTLS 3RW7A 3W8PA 5DDPC 1QGYA 4U96A 2JA5C 4QIEA 2WSFC 1JLEA 2YKNA 1RWNB 3Q23A 5C3EK 4FKYA 3SSQA 3W66A 3OR2A 3DN9A 2ZJRQ 4JI4F 1LNQA 4UY85 1O0PA 1YJWB 3H3VL 2MKYA 4DL7A 1H2UX 3AJ1A 2IJFA 2ZUAA 4H4KC 4QVJA 3FK4A 4LR8A 3CO0P 1C1BA 3POTA 1JJ4A 4EO6A 1YBTA 4ECUA 2ZH1A 1A9NB 3C16A 4OHZA 1WHVA 4NBSA 3Q22A 1M0SA 2FZCB 1OS5A 2UXCF 4DK1A 1L3VA 4URGA 1X4CA 2CNOB 5B0FA 3D54A 5HQLA 2V2VA 2RAQA 4A3BK 5C2CA 4DG1A 3UCUP 1W0JA 4QIWD 2A3JA 1T3OA 3S8SA 1UJ5A 3SZYA 2IYGA 3MR2A 4P2SA 1VK8A 2RF2B 3NXZA 2R8HA 3DDNA 2JEJA 4WQMA 2YNIB 1UCNA 3A8IA 4A3JK 3GQBA 4WFZA 1GFWB 3A35A 4C3HC 2LXFA 2VFTA 2OTJB 2XMWA 1MWQA 1NK6A 4ZP7A 1S9GA 1G2EA 2LDIA 4GC6A 1U1OA 2B7CA 1VQ4B 2DCUA 1KKHA 4RW7B 4FN5A 4XDCA 5C4JC 4P2MA 2MLYA 1RCXB 1AROP 4F26A 1WOOA 1VOMA 2E9RX 2MKJA 3I5CA 4C97A 3OL8A 2NVTC 1N5YA 4FM9A 4CYUB 2R9VA 1ZBTA 4NEZA 1Y5NB 4XLFA 1TVRB 3AODA 4OYWA 6FDRA 2DGSA 5K5MA 3K7AC 3AGQA 1NXIA 2HVEA 1APSA 2E5LF 5CZXA 3M4OC 5F8HA 3FZ2A 1IW7A 1H85A 1T02A 5C5JA 1HD1A 3GTJA 3SQOP 4LLGA 1DTTA 4NA2A 2YBVA 1QAXA 3DLKB 3MMCB 3H94A 2UVWA 4YFKA 3MCOA 1XZPA 3B4MA 4ECZA 4ZP8A 3MMBB 2PMZL 2MQQA 4RD0A 1ZPVA 3ZTRA 3K17A 4QU7A 4DR3F 3UPFA 2XCRB 5CYJA 2RU3A 1Q81T 2E44A 4N77A 4GTCA 1B99A 5GMKa 2W24A 1O26A 2DK2A 3VAIA 2D3LA 4XK8C 3MUMP 1UVJA 2BQRA 3BM7A 4LF8F 1P1LA 4A3EK 2WAQD 3H5UA 1TVRA 4UTGA 3GEHA 2PN6A 5AE2A 3ZNUA 4Y7NC 2HZVA 3IR7B 4X0CA 1SB6A 4LBIA 4FK8A 1Z1ZA 1DURA 2JEIA 4LC0A 4OFZA 2Q6CA 4PWUA 2G4BA 3MMCA 4HE6A 5IQQA 4LFAF 1X4DA 5HAOA 5J2MA 2R9LA 5E3CA 1XZPB 4KTQA 3DGPA 3OQ2A 4G1QB 3G71S 4DR6F 2RQ4A 3R5AA 4JB8B 2XHWA 2X6YA 1XJWB 2DOGA 3UDVA 4X4TA 1N36J 3D9BA 4IO9Q 3QJPA 3QSIA 2CKWA 3M8QB 3UQSA 4RLEA 4LSZB 1NLKL 2UXDF 4DDFA 2RS8A 3CCTA 5JMNA 2HW3A 1HW8A 2R7XA 1DARA 2LQ5A 3TR5A 2XYPB 4DR4J 1WOSA 3TUIC 4EFAC 2FVSA 1YWXA 2XZLA 2HGNA 1NH8A 3EVMA 3MPVA 3BPSP 4F3QA 2GAHC 1N36F 1XNQF 3C2PA 4V19J 3F56A 1DD5A 4FYWB 4RUCA 4J9OA 1FXLA 2MQNA 5IC4B 1QX4A 2DRAA 3E1YE 3LP0A 4DK0A 4RBVA 3OXGA 1F2HA 1PGZA 5CYMB 4UUXA 4UOHA 2GHVC 4R71A 3R27A 4RDLA 1PC5A 2YWEA 3QFTA 1VCTA 2MSTA 4ZPDA 3VF0B 3M9OB 1MROB 2D41A 3PM9A 2DGXA 2P9CA 3IA0A 4O4GB 4JK1A 4IOCQ 4PR6A 1IS1A 2VJIA 2OPQA 1J5OA 3CMQA 1N8RT 2GNKA 3SDEB 5LMUF 3GSDA 1S0VA 3T41A 2RDDA 4J9VA 3CDBA 3PX6A 5AXLA 3M8ZA 3UN5A 1PYSB 2X1BA 4H4OB 4GO7X 2B51A 4ICLB 4JI8F 1RTHB 3OZVA 4P1VA 2F4VF 3ZO7A 1NHKL 2MKIA 2JLEA 5K8PA 4JV5F 4C11B 1IR2A 2HSEB 2G2OA 3QRRA 4F4ZA 3Q6RA 1NJWA 2E5GA 5KFRA 2AF6A 1O51A 1GVHA 4IO1A 1YBUA 2GSUA 2RVJA 3QZ7A 1ITPA 4RPDA 1J2VA 2CADA 4IG3A 1XK8A 1ZAVA 4A3DK 4C8MA 2CQ4A 4TXSA 2DYAA 3R2CJ 2R7OA 1BY9A 3GCXP 4CLKA 3ASRA 4G3IA 2MY8A 3M1VA 1QTMA 3T3FA 5KSWB 4IH6A 3M30B 2IDLA 1WTHD 3AQPA 3PYGA 3JQPA 2GGPA 1H6KX 1X31C 3HHLD 2ZBVA 4G7ZA 1VQ9S 4PAAA 1UD3A 2GIQA 4WP9A 2QEXS 1HPZB 1G3OA 2VIHA 2I0XA 2D1CA 3D1QA 3C14B 4F3OA 1TQLA 2K1RB 2EBBA 2M8DB 4DR6J 4Y2IA 1JB0C 1VHOA 1FNXH 3T5LA 2CFXA 4KMAA 3PRDA 1GXLA 4LQ3A 1F6TA 2CPIA 4JI7J 4F4XA 3CCZA 4KAWX 3R5DA 3RRKA 5CYQB 1M5KC 2AHOA 4LRFA 4ZVRB 2R7ZC 4PC3A 1XMOF 4NLYA 3HXAA 1Y9OA 4XOPA 4FPRA 4JBCA 3CF5Q 4DNRB 4RLZA 4LF2A 2JZ5A 4LRCA 1U45A 4NXNF 1KFDA 1NKCA 2ZWPA 4B9TA 4A3LK 1S72S 5E33A 1IJEA 3W60A 2GVDA 2AYGA 1EETB 4B3TJ 1AUSL 2VJJA 4XM3A 4GVLA 2BR0A 4A3FK 4X4UA 1N6QA 3RW6A 2E5HA 1KQKA 3MAAA 2V7QA 4JI5F 1TR0A 1S6QB 1QGZA 2IMOA 3QO9B 1DQ8A 5IV4A 5G0RA 3TYTA 4RD4A 4CH7A 1E43A 3FKSA 3G6VA 5C24B 3GIKA 3G4CA 2OPRA 4KHPJ 1UETA 2QYGA 3H2LA 2FVCA 5DZ7A 5KTQA 4DX6A 2RS2A 3OJUA 4O0IA 2KG1A 4DQKA 1SQEA 1FK9A 4DX7A 3Q6QA 5AE3A 5GV8A 3BNWA 1Q79A 2ATLA 5A0YB 2MLZA 1R5NA 3PRBA 2KFNA 1M5HA 2VNHA 1TFWA 4RW6A 2D3OR 1X4HA 3Q8RB 3KNGA 3ZZZA 2Q79A 1W7WA 2APOA 1S9EB 1T95A 2AZ3A 5IYBC 2FB0A 1JJ2B 3KLIA 3T9NA 4K5RA 1KTQA 4MYTA 4QWEA 2MDAA 4CLYA 3QFHA 4Z4WA 3MM8B 1RZMA 5K20B 3OEHA 2G9OA 1Y4ZB 2DT9A 4OJGA 2UUCF 4KR0B 5FLMK 1R8CA 5DRKA 3KUHA 1FTRA 2FJXA 1G7CA 2VFSA 4HL9A 5FO1A 2Y0BB 4F25A 3B82A 2YNHB 2RHQB 1X60A 3JQMA 3O3LA 1HNXF 3OVSA 4H4MA 3M32A 5I3PA 5IZHA 4P5BA 3KG1A 4U95A 3CDAA 3NNAA 1EHWA 4I64A 4NCAA 4YEJA 4ZS6A 2RE1A 5CZVA 1QH0A 1FXDA 1T9TA 3FEXB 1FDAA 4KQZA 4Y2MA 1WEYA 3TZXA 4NMXA 2ZOMA 5DLFA 4O0NA 3QJLA 1XNQJ 3T9ZA 4IUFA 5BSXA 4OZ3A 2C42A 1QM9A 3TANA 1GXUA 4NMLA 1IE0A 1F7VA 4KATA 1MU2A 1FEEA 2MJNA 1QLNA 1BS2A 2AEMA 2QFJA 2BE9B 3FSYA 2VHGA 2ASDA 3H0GA 2CBXA 1T05B 1WKJA 2VDIA 4I69A 3EYZA 3GB0A 3ENQA 3Q8PB 2Y3YA 3W2IA 1XR7A 4WZEA 1U2CA 2BJ8A 3HF5A 1F9HA 2DB1A 5C44K 1RHUB 5AE1A 2W8LA 3HD2A 3DU6A 1NJXA 1HBNA 3CJ8A 3G6ES 2HFUA 3EICA 4DPXA 2OLWA 4PC6A 3CJQA 1B70B 4EMDA 2YPYA 2UUBJ 1WTBA 4KFBB 3CQZA 2W1BA 4WK3A 3CPXA 2DGQA 2CC2A 3CCEB 4WU3A 3SBMA 4CLLA 2HNZA 3ZZYA 5LXRA 2V4QA 1WC1A 4FP9A 2XI3A 4XO0A 5KT5A 2IRUA 2F43A 2NXEA 1JX4A 3G2XA 2NVYC 3TA0A 2B7BB 2QGGA 1RBOB 3MR6A 3FQKA 2DNNA 4A8WA 1R0BG 3M8RA 4OYZA 3OLBA 4IG0B 2HFOA 4OYMA 3OV7A 5M5XK 3D26A 3CCMB 5ITHA 4MK9A 3IG1A 1O2FB 3OAAA 4NA1A 2ROPA 2DGVA 3K2YA 2VG7B 1KK3A 2GO9A 4AC9A 3HOVC 3PFOA 4PCQA 3HHLB 4G6VB 3R6KA 4LBZA 1X5OA 2ZZNA 2J9DE 2DHHA 3M6UA 2HNDA 1IBLJ 4ZVSB 3GYGA 3R3TA 3ZZTA 3TUZC 4GTDA 4YN3B 3D6TB 2E2IA 1NK0A 1GMWD 2FJWA 2KM8B 4FVMA 3FCHA 4Z37A 2Y9HA 1NZAA 3MPDA 3TEGA 1TWAC 3P96A 3MEGA 1RT4B 2V8GA 4Z4TA 4I6AA 2WAQL 3PRVA 2EFVA 2HIYA 3GDZA 2M8HA 3C16B 1SKWA 1HA1A 3NMAA 1R9TK 4MEYA 3WODA 5F9NA 5ETTA 2WR8A 1QD1A 2B43A 2HHHF 5HVGA 4RW9B 1BLIA 5LSRA 2OK8A 4A3CK 1DAXA 3S16K 4JI7F 1IKWB 2V2ZA 4HHUA 2M5SA 5LM7E 2BMWA 2X1FA 2QZ8A 2FC8A 3LAPA 4TLRA 2R8JA 3CGIA 1UVLA 4NCGA 5GAHI 3TNVA 3KG0A 1DJ0A 2GS8A 5RUBA 3BQ0A 2I9SA 2XS5A 4GFQA 1UZHA 1YNJA 4UT4A 2H48B 2IBKA 4OV1A 4O2DA 1F1BB 4J3NA 4DXLA 2BOAA 2J8SA 3BB5A 4YAWA 2EVZA 2YX4A 2RUSA 2WSSA 4ACBA 4LFBF 2C2ZB 3GTYX 1MMNA 1R5BA 5J1EB 2W7PA 3LPEA 2V8VA 9RUBA 5IYBK 1A7GE 1S9GB 1LEOA 4OYXA 4DQIA 1SKQA 5BJRA 3NCRA 5HKKA 1GTHA 1U1RA 2BABA 3GFYA 4LF9F 1VQ4S 2VKZG 5AXKA 3S7RA 3OBIA 1MWZA 3TOQA 1QG0A 3NKYA 1YZ6A 3UVJA 1PKVA 2JC0A 3LGHA 1N5YB 4HACA 2ZBPA 2ZZFA 1YHQB 2J9DA 4J5OA 4YR3A 2FY1A 5HK4A 4F0HA 2XZOA 2E7WA 4LIWA 3RU0A 4F4WA 1X9SA 1TWGC 2H4YB 1DHMA 4WIQA 3PYFA 1SL2A 3G71B 1T9VA 2DHXA 2MKSA 3CDWA 2N82B 2JL9A 2X51A 2ERRA 3MXHP 4I2PB 4USIA 4LSNA 1R8AA 1YBAA 4AYBD 4NA3A 2ZTNA 4M5NA 5KFUA 5CHCB 5KFTA 2XMTA 2OMLA 3BGFA 3TQEA 4IW3B 4L8JA 4WYWA 4LBPA 3LW5C 4RUAA 2DY1A 2W4DA 4DPTA 5ETRA 5B0EA 1DZ5A 2MB0B 5GVQA 1SL0A 2QIFA 3VZHA 1OQ6A 1NB7A 3CCWA 2C2OB 5L46A 3HZGA 1E6VB 1FDNA 1F93A 2DNRA 3HKZL 4JP8A 4OZ2A 2CK3A 3HHKA 3ISXA 3M8PA 4B9SA 1UVMA 1R0CB 4AD6A 1WI6A 4ZVQB 4GTFA 2BJDA 4AF6A 4UZUA 2EBGA 2HQFA 5E3RA 3H25A 2QN6B 5J2MB 4UOGA 3SCLE 2F4NA 4BLBA 4R25A 1Y3KA 1WDDA 3H90A 1U0HB 2VBUA 1PJ7A 2WZPP 3CW2C 4DV0F 3TARA 4KDDA 5HP1A 2KVQE 4M5KA 5D0HA 2HBZB 1IKVB 5A8RB 1ULRA 1HBOB 1Z2LA 1M1GA 4Y65A 4TY8A 3V6KA 1Y7PA 3OHBA 1EH1A 3AH5A 2R7ZK 4KKTA 2EFQA 1L3SA 1RQPA 2R7UA 1TV6A 2ZEJA 5M5YK 3N0VA 4P7VA 2NVQK 3X1LB 3NNCA 3BSCA 3QAEA 4DR3J 2VPWB 4DSLA 3UDEA 1RTJA 4HTJA 3FEYB 2BUNA 1JK9B 2VH7A 3DFEA 1H7WA 1K0TA 4OQJA 1PBAA 1X0PA 4ES3A 2LU2A 2E1AA 3G8TA 5HLFA 3MGJA 3ASTA 4J9UE 5HROA 7FDRA 3KLEB 2ACMA 4N47A 4RMFA 2JA7A 5TRDA 4ZCMA 1RU2A 4TU8A 1P1TA 3ILLA 4KGVB 3C8YA 4G0WA 3OPOA 1VBYA 2WOMA 2XO7A 4D3GA 4DOZA 4Q7AA 3OTEA 2OP5A 4DV5J 1DDGA 4JI6F 4PYAA 3DXJA 1G1XA 5IYQA 3M6VA 2OEJA 5H9EJ 2NLWA 2PA8D 3OR1B 5KT6A 5F0WA 4M0LA 4C8NA 1SKYB 2GPJA 3MF5A 2YH0A 3JYTB 2UXDJ 4OPOA 3MOZA 1TL7A 2W9AA 1RT7B 1G6BA 1NUEA 2WVBA 1YZ7A 1B4AA 1JXLA 4U7CA 1DCPA 4X65F 3HOZK 4H4KA 2R93A 5D6GA 2VUMK 5HMWA 4OOSA 2W9BA 2HHVA 2Z4PA 3W2VA 4KPYA 3RGIA 3OW2B 1FFSB 4ZIWA 3QFWA 4O4RA 2OFHX 1ZTTA 1CEZA 4G1IA 3TI0A 3BO4A 2V9WA 3PIPQ 5DDQC 2CA9A 4GZYA 4FKXA 2VG5A 5C25B 1JWWA 1OGIA 2ZD1B 3BYRA 2R7ZA 1LW0A 4J9SA 4QPXA 3CPWB 2CVEA 4PXCA 3HM9A 5ETQA 2EIXA 1IBKF 4ZP9A 2VA3A 1TLLA 4B3RJ 4X4PA 1TMMA 1U49A 3ERED 1LWFA 1V9OA 4ZN1A 1UD8A 1XIQA 4DWIA 5T14A 2YQ0A 1JLFB 3HOXK 2X6XA 3ASSA 2DJWA 2AYBA 4P3IA 1AA1B 3KJVB 2CPJA 4ZPWR 2VBWA 1REVB 4EBEA 3T01A 4X4RA 3MHYA 2C2WA 3PEJA 2AKWB 3HSJA 4J90A 1M5OC 4OX6A 3DDYA 4XLHA 3C19A 5IFMA 1ZZNA 4DSKA 2QG9B 5CH7B 4U8YA 3R6JA 3ZZPA 3MWBA 3PW4A 2BJ9A 1HWIA 5FD1A 4I2QB 4KSEB 3C6TA 5JXSA 2M0GB 1RYSA 3TVYA 1JLGA 3AJ2A 3QFRA 5C42A 3GTQK 4C43A 5G0RB 5IYNA 3S2HK 3BGUA 1JJCB 1OMSA 5KW9A 1LWFB 2YWGA 3BYPA 2F1MA 3KK3A 5LMUJ 2CPXA 4DR1J 1OO0B 4RDJA 5KFDA 2MKHA 3EX7B 3OL7A 4TYBA 1KC8D 1TKDA 3KTQA 5MLCV 4LF6J 2H51B 5CD4A 4Y7CA 2DPJA 4BLGA 4LF9J 4KKOA 3QWPA 1YJWS 5E3AA 1NK8A 2D3UA 2P5MA 4C0OC 1UFKA 1SVDA 1HNVA 1S7IA 2J9EA 2GMHA 4DHVA 2AD9A 1IJFB 4B3MF 2DNYA 1NB9A 2VBZA 1K28D 5D15A 4J9PA 1I3QK 4ZPTR 3DI6B 3TA1A 3HK2A 2B56A 5F8LA 1TWCA 3I96A 2VBVA 1HHQA 3DLJA 2F8MA 3DOKA 1TK8A 1RKJA 2NVQC 1EFCA 3H59A 2XGPA 2NXCA 3P3DA 1WP6A 3TQ1A 4I7FB 5I3UA 4LJMA 4DSIA 4YFXA 2PT0A 1QVFB 5BYSA 3KLVA 1F60B 3V4IA 1HW9A 5J2PB 2NQPA 1EQRA 3FOEA 3Q3AA 1NM2A 3ET6B 4H4MB 1JJ2R 4A3GC 1TWCK 5A8AA 3AA9A 1RUSA 3UD4P 4IDKB 2G0IA 2QC3A 3BBBA 4JI1J 2JA8K 3CJRA 4OI2A 5DQIA 3CSKA 1N32J 2QSWA 2JEGA 3E51A 5GAEI 2BW2A 3EM1A 2OYNA 4PXEA 1S7HA 2DETA 1HYSA 4PKDB 4WKRA 1FKPA 4TKOB 5HSPA 2DNQA 4TMVA 3HLUA 4FYDA 1B7FA 1KR4A 4EEYA 3AGPA 1K83A 3D1OA 2FIUA 1RT5A 3J80U 1IN0A 4P3YA 3SJZA 1T6XA 5TY0A 3OL9A 2GQCA 1QUEA 3M05A 3CCES 3CC4S 1WELA 3CCVS 1ZM2A 4RWXA 2XMJA 4OI4A 3AQOA 3M2RB 1RAIB 4ERDA 4NLQA 1UD5A 2QLFB 3CTAA 1FI4A 1YIJB 4NCBA 3MUVP 5FL7A 1W26A 4LFCF 4P75A 4HI1A 3A3OB 3K89A 1ZZFA 4Q45A 3CUNA 4LBVA 2XY7A 1D9AA 4X62F 2U2FA 4OIPA 3J7AN 3IO1A 1IBMF 1GAOA 2PMHA 4NX9A 1YJNB 2HIQA 2QX0A 3HFKA 3GSIA 2NXJA 4FXVA 4IFYA 2W6JA 1EKSA 1RWPB 1SQFA 3CE8A 2CQIA 3SZZA 3PR4A 3S1NK 1GJRA 2H65B 1YLOA 1KVKA 1U6FA 2DXFA 1A8PA 5KFXA 1FX4A 2E7XA 3ISNC 3MDFA 2C3UA 3S1NC 3A1PA 4AXJA 3RRHA 2YQ1A 3AFGA 2VFVA 1XPPA 1T9UA 2ZH4A 2WSCC 3S1QK 2HWIA 3M9MB 4P12A 5GMEA 1KD1D 1AT1B 4YB6A 4AQYJ 4XKVA 4F36A 3ILOA 3HD1A 3HKWA 3AVUA 1B64A 1M1KD 3FPPA 3D3CJ 1W2BR 2JWNA 5LMNF 1URNA 5D4NA 2FLPA 2QGFB 5G4DA 1D1NA 2L08A 2YH1A 2GQ2A 2LCWA 4DR7J 4PC7A 4IFYB 2NXNA 1XR5A 4AL6A 3Q2SC 2VBYA 2QO3A 2HBQB 5KFLA 4YAFA 4QW8A 2FJAB 4ID5A 2VU5A 2XMUA 2ZM6J 5IXUA 3GCWP 1XEZA 1HNZF 1HZEA 1OB5A 1GMVA 3TP2A 3U1LA 3IWXA 1IUJA 1K1SA 1I50K 2NXUA 4M5MA 2XHCA 4JYAJ 1SIZA 2I1RA 5J2QB 3SLNA 3TZYA 3E3XA 2K7KA 3X3UA 4Q0BA 3OTBA 3W5VA 3MAHA 2KHCA 4DR5J 3R1LA 1YIJS 3UD5A 1RXOB 2HMIA 2QE7A 2ZJPQ 1UA1A 2XWXA 1QUPA 4G65A 1WCMK 1NDKA 4Q8EA 3THPA 3MUTP 3P5TL 3PO2C 2B0GA 1HVXA 3JSYA 2L48A 1NHUA 2B8PA 4J9KA 3DDIA 4CZCA 3QRQA 2DR9A 1L3KA 1S1WA 1YJNS 4K2JA 1LFWA 1T11A 3WQZA 1V3RA 4BBRK 2P2CB 3BH4A 1WNEA 4BY1K 3PW0A 3BZQA 2NREA 4DFPA 3BO3A 2CQ3A 4ID8A 2VICA 4BXXC 3SFUA 3M8QA 4Q0BB 3FC9A 4YFUA 2BKPA 4F4YA 3BGOP 1S72B 2IRXA 4A3FC 3GTJK 2XS7A 3LO8A 1EFUA 2ZXIA 4QUZA 2RRAA 2R8GA 4TMWA 3CCJS 3PACA 3CCRS 3QIPA 1I6VA 1UKUA 2CVIA 1LXNA 3KYLA 3E01B 1VC6A 2GSOA 4WXWA 1O25A 3GTKC 2MGZB 1WC5A 3FOFA 1YRXA 1PAUB 1WG1A 4LR2A 1EJ7L 1RT1B 1I7PA 1SC4B 4C0BA 3CMES 3FSIA 3EQLA 4JV5J 1KLNA 2A18A 3DRYA 4ENOA 2P6SA 4ECQA 2RD5C 3DRRB 1QDUB 2ZHBA 2DPIA 2MZRA 4RD2A 4Z4VA 2Z2LA 2XSJA 2E2HK 1S1TA 1J5OB 4G7WA 3AVVA 2ZBRA 3KK1B 1Y1WK 3W9JA 4PZVA 3JS9A 5F0UA 1K1QA 4C3MA 3ZC4A 4L76A 4WBFA 2WZ1A 3LQEA 1IBKJ 2NZ4A 1VF7A 2R8IA 4UAJA 3SMZA 3C66A 4YY3J 1HNZJ 2HS4A 4U9RA 2QLXA 1B23P 4DFMA 3WNBA 5A8KB 3CJ0A 3TZWA 2PE3A 4OHYA 1PYTA 4A8QA 5K9FA 2NPIA 5BR8F 2ZTGA 1BQNA 4RCZA 1OY8A 2V2QA 3ZUGA 5F4MA 2HZAA 3CC4B 1KWMA 2SXLA 5K8NA 3H4DA 3LOUA 4PG7A 4JI1F 3NS7B 3RY8A 2VUMC 2EKYA 3R6LB 3HULA 1NKBA 3AHPA 4TLQA 5BR8J 2DGTA 4LMZA 4M5IA 1HQUA 3FRZA 2F8HA 3JAMU 2GV1A 1LK5A 2OBSA 1B3TA 4B3OA 1CJVB 3IM9A 2M4MA 1NPKA 2DKOB 5AXMA 4LJZA 3H9NA 3MTJA 4NZ6A 4QCLA 1Q8LA 1VHIA 1GX5A 2MKKA 1URRA 4PEOA 3I5BA 3UW1A 1N5VA 1FJCA 3OTOJ 1IKYA 5E2QA 4DV3F 3WX4A 1YKWA 1RABB 1NK4A 3HDSA 1H72C 1Y00A 2JA5K 4A47A 4UOFA 3C15A 3VHQA 1JLBA 1TKTA 3S0XA 3LGNA 2XYGB 5A6WA 3KHGA 1XN9A 2KZMA 3IS9A 2I1LA 3E20A 3QSYA 1FD2A 1T9YA 4ZJOA 4NYZA 4DV3J 3US5A 4XLAA 5A2QY 2R7TA 4XLNA 1BQMB 1KQ4A 2KT2A 4C8ZA 4L75A 4FDFA 4MK8A 4PUOA 1X5SA 3BY1A 2G13A 4E0FA 2YTCA 4LF5F 3KLFA 3R8YA 3I4PA 4RKUC 1YITB 5KG6A 3GTPA 4KE5A 4A93C 1HMVA 5E68A 1RAOA 3KDOA 5J1EA 1IBCB 1DTTB 3PV8A 3EZOA 2KN4A 2KU7A 3D28A 1XMOJ 2Y0SL 2CJQA 3THVA 5KNLA 1Q81D 4P6QA 2VNIA 1JB9A 3QGGA 2JEFA 3ILIA 4YR0A 1XBWA 4RW8B 3PY8A 3AXMA 4ECSA 3NY0A 3AD9C 1RQRA 2XG8A 2FHMA 3NGDA 1QE1A 4JI3J 3M8SA 1VS3A 2AYMA 3SV4A 1RHQB 4XOTA 2ZH6A 4NLUA 1I6HC 3CESA 1VBZA 2VBSA 4GTAA 3CD7A 2C2DA 1KOOA 1WACA 4XONA 4HHHA 2KFYA 3CIMA 1ZQ1C 3BF4A 2CNKB 5EWGA 2Z6BD 2UU9J 2C2NA 2Z0GA 2DNMA 2BQ3A 2OSQA 4A46A 1HQMA 1YGYA 1WHXA 2Y8WA 5T7LA 2CXEA 2MLXA 4WZTA 1JNYA 4U9UA 4HT5A 5DG8A 3DGPB 4G1QA 3BQ2A 4Y3CA 3OOCA 5I4MA 2JA6A 3BSOA 1FFWB 3GTKK 2Q1LA 4FXDA 2W25A 4LF4F 1MMDA 4ZVFA 3DRSA 2XLKA 4PQUA 2L9WA 3HOWK 4ATNA 2N4DA 4HEA9 2IFXA 4ZITA 2UP1A 2C2KB 4YG2A 3WIUA 4ED2A 2V9KA 1R7IA 2X3DA 2MZ1A 3DYAA 2YKQA 4Q8FA 3LALA 1C1CA 2G1HA 4YXWA 3MEEA 4AF7A 3P26A 3GYNA 1WF0A 4OJ3A 1RWKB 1N07A 4ANEA 3K8VA 2CQDA 3FKBA 1U09A 3MTKA 2VC1A 1JLAB 4FVCA 2Y1RI 1N5SA 3AB2B 4ZV4A 4KHRA 2QFIA 3SXLA 4ALZA 1LFPA 3RYLA 4MTPA 4MKYA 4DFJA 2AJ1A 2IBOA 4PXDA 3PA1A 1KP6A 4LIRA 4C2MC 2F65A 2ZH2A 1R9TA 2XMKA 1OSDA 2M52A 5KFWA 3V76A 2QRRA 2DIUA 1UD4A 1N06A 4UQGA 3H20A 4PQUB 2XCOA 3W2EA 4A8YA 4AVZA 3DLGA 2OEKA 5J2NA 2XM3A 2W2PP 4U8VA 2FHKA 3AVTA 4KGZB 1Q9SA 2D9RA 5KFNA 4BBSC 4C98A 2C4TA 4A3CC 3S16C 5CABA 3UCZP 1KQSB 1FJGF 1VYAA 1V3SA 1EWYA 4B48A 4XCHA 4Y2CA 5D4PA 3OR2B 4NYOA 2E2HA 4Y28C 2DGUA 4IG3B 4IQMA 2V7XA 4KGMA 1NPRA 4CO1A 2F3JA 1VJEA 1HNXJ 3NBPB 5GADI 3JTNA 3PO3C 2ZBIA 4P22A 4YOEA 4LBWA 1YHQS 4ELVA 4TQRA 2LLZA 2QL5B 4ECXA 4B3FX 2VG7A 2MY7A 4WJBA 2HHXA 1FDBA 3KOAA 1QVGB 4RBTA 1J5EJ 1FEHA 4Y0FA 1TWHA 3PXGa 2D9OA 1U1PA 1TK5A 1XTZA 1UFLA 2HK2A 3S1TA 1EFRA 1KHVA 1WG4A 3DRXA 2WOMB 2KXHA 5J2PA 3ET6A 3N79A 5FNZA 3IBWA 2V69A 2R2TA 3V4GA 2W6IA 2B63C 5KG2A 3S17C 2YNIA 1REGX 3N6NA 2H1YA 2GJFA 2PEBA 2RMLA 3NBPA 5F8IA 1USOA 5JVHQ 2BKOA 2KVOA 3OZUA 4G1VA 1E6YB 4AYBL 1KVIA 1F9EB 1MLAA 3FKIA 1SKUB 3WNCA 2HG4A 2K3KA 3ITHA 2V2KA 3NMRA 3HO1A 3IPJA 3LPYA 1OIAA 1B0TA 4ZLNA 1JQGA 4JI8J 4OP7A 4LBYA 5A8WA 2M70A 1NDHA 3B78A 2EC2A 2OKQA 1CJUA 5E5NA 5E0OA 2QLJB 3IC1A 2ZE2A 3GTGK 2OPSA 3WXMA 3MHPA 4K4VA 3LP2A 2QA4S 2KTQA 3LANA 1TTTA 1F0XA 5HQMA 4M5DA 1NBEB 2JLGA 1RWXB 4ZP6A 2CNDA 1I3OB 1BUXA 1LW2A 2XLIA 3MEKA 2NVXC 4K4UA 4A3IC 2UUWA 1H3DA 4FXWA 3RBDA 2QTZA 3ES9A 1S0NA 3EE3A 1RKIA 5IP7K 1B2RA 4I0WA 3OSNA 3MECB 1L3TA 1GX6A 4WFBQ 4OIOA 2NVXA 2GVZB 2E1RA 2A6OA 1RHMB 3A12A 4M5GA 3H2UB 3GEEA 5KFQA 4I67A 3VGTA 1JOEA 4W92B 3TX0A 3MM7B 5I42B 3FBBA 4K4ZA 3RJMB 1G4CA 3W2FA 1EX8A 4ANCA 3BGLA 1LKZA 3J80Y 5KFKA 4O3RA 3M3YK 3IAS9 2DNHA 3H4BA 4QIVA 4LFBJ 3T5JA 3QFSA 3UR0A 2E7VA 3BN7A 5F8GA 4XR6A 2MYFA 2V7UA 4WIIA 2GO8A 1KQGB 2IAJA 2I38A 2W9CA 4EYHB 4LOWA 3IN5A 4P7TA 2E2JC 4B02A 4HKQA 4PWDB 3CJKA 2HHUA 1HD0A 2HWHA 2ZZEA 1ZYQA 1UW4A 2KG0A 2YX7A 3DLEA 5JVOA 3SIPB 1BX1A 1N54B 3VQTA 3BBCA 1V0FA 3HOWC 1S6PA 4YHHF 2VL1A 3MEDB 2RH6A 1TKXA 4X05A 3IBFB 1NSQA 1VIXA 2H9ZA 4O3QA 4CCHA 4B9VA 2Z8QA 1PAEX 4M8LA 2JFKA 4QWAA 1IJFA 2VPZB 1N34J 3WQPA 4X8IA 2BJ1A 5HN0A 4URQU 1I51B 2L9DA 3VGVA 1DDIA 4FS2A 1FRQA 3CCVB 4QIGA 1S1WB 3IR6B 3W2WA 2UV8A 1TWGK 2KDOA 3CRZA 5KG7A 1HARA 3OFGA 3PJXA 3J81U 4PWDA 2BOPA 3R5BA 4GKKF 3HHLC 4WP3A 3GTLA 3GTGA 4G6IA 2V67A 4DX8H 3ZTSA 1I50A 2XQCA 3K7RA 4F0MA 4M63A 4DV0J 2OD4A 3PVXA 1R31A 4G0VA 2ZL6A 4ZOSA 4P71A 4ZPCA 4CLUA 4UQTA 2OPQB 1F5CA 4A3MK 2E5LJ 3WDOA 2MXYA 4CRJA 3L95X 3K5NA 3AXKA 5JUMA 1Q82D 3F0NA 2CF4A 3HKZD 2BDPA 3N3YA 1W25A 4IR1A 3TFHA 3ZXWA 2BKNA 5GMDA 5D4OA 4RU2A 2W7OA 4C11A 4LK0A 4JI0F 1FNBA 2MGZA 1LV5A 4IG0A 2VB6A 4GVBA 4WTYA 1NJZA 4NASA 4Y2KA 1EP1B 2JIZA 3RAXA 5IP9K 2BRKA 4NRUA 2WK4A 3GVKA 3UDLA 4I6YA 3S01A 2A10A 4C7QA 5DO2A 3H98A 3JSBA 3Q8SB 2OIHA 4P10A 1O29A 3QZ8A 1UVKA 1S0UA 3Q0AA 1W34A 4AL7A 3QT6A 3TJ8A 4LRDA 4ILMA 4DLGA 2Y0SD 4QBUA 3K5OA 3R5JB 2PMDA 2GGPB 3FJOA 4J37A 2QJ3A 2G2ZA 3V6DB 4BBRC 1ZUNB 1MN9A 4CWBA 4CO5A 1EAYC 2VNJA 3C14A 3O6QA 3CP2A 2OH2A 4KO0B 1C4CA 4X2BA 2MKCA 3V4MA 4USTA 2EI5A 1VQPS 5IWAJ 4ZHRA 2C2MB 2WZNA 4BXXK 3HFZB 1KRHA 4WK1A 4P6VF 4FBTA 1FVSA 3HVTB 2P9EA 2QA4G 4HH1A 2V7TA 2M88A 4A8SA 3CPWR 5CYQA 1D8TA 4B3RF 2DR8A 3A3PB 3NS6A 3OTCA 5U47A 3GJQB 3SEJA 2VJVA 1I94F 3P8BB 4IFVB 1SUQA 3TZZA 2NVYK 1RT3B 1VQLS 1FF2A 3BP3A 1SFOA 2YKOA 4OZ1A 3SJPA 3KG4A 3QAUA 4P74A 3LUYA 4ELTA 1CJVA 4EH1A 1ACMB 1SV5B 1UJ6A 2B5JB 3HXMA 2F1LA 4HH0A 4IR9A 2LDYA 3VMFA 2W4PA 1C0TA 5F3TA 1NEEA 4WILA 4F50A 5I3QA 3H0GK 4HDHA 2AU0A 2H5EA 1SIWB 4LREA 1ZOTA 1M90D 1OYEA 2JNJA 3BBFA 1QAJA 1Q1KA 1UEVA 2ZZQA 2B9YA 2F9JA 1SI9A 5IORA 3LQVA 4YAOA 1SUQB 2EKNA 4GMKA 1J6XA 2YU9K 4MH8A 3MPWA 2MJUA 2WJYA 1Z4UA 5B09A 1RHKB 2OPRB 1VJQA 1CVJA 3NGRA 4YB5A 5K14A 1JLQA 4HACB 1RK8A 5F8JA 3HSZA 2HRTA 2LU1A 4IKAA 5SUHA 1SMYA 4A3GK 3LQ6A 1HKAA 4AH6A 1VC0A 1EARA 2CQGA 3LAJA 2HLUA 3Q2TC 2M9KA 4RW6B 3PX0A 2H5IB 3Q8QB 5LXYA 3D0HE 3UN2A 2BXJA 4PG4A 2ROGA 4J0QA 4C6AA 3SFGA 3EPIA 3BN4A 2JJ2A 2CRLA 2EWHA 3ZZ0A 1I3QA 4AFFA 2IPOB 3I87A 1BHNA 1UP1A 3RB6A 2XY5A 2IM3A 3GWCA 3KWMA 3MMAB 1CULB 2KZZA 3DCAA 4PPDA 3VVUA 1WIHA 3PJ9A 3HSGA 1QJHA 4PPZA 4ZVTB 1KVJA 1FRKA 3W63A 5FLMC 3BQ1A 2X7IA 1NDCA 2CAJA 3M32B 2UV8G 1CNEA 2N3OA 2CPEA 3T5HA 2I5JA 1BMFA 3OW2R 1C2PA 5F3ZA 4QFMA 2UUCJ 3Q83A 1FRIA 2RGRA 3RAMA 1J6WA 4QYZK 4WXOA 2FC9A 1UW9A 4YELA 3W1YC 4DPOA 2JA6C 3PZPA 3LH2S 2F9DA 2C3YA 4MMOA 1FFGB 3S1MC 4YHHJ 1X4EA 3M1VB 1TK0A 3W9IA 3M30A 3MMPA 3DOLB 1J27A 2XCAA 4DUTA 3RBXA 3TFIA 5D3GA 4F67A 2N4CA 2C2RA 1VLYA 4DV1J 4QWBA 2XC9A 3UDCA 2PI4A 1N88A 2F40A 4IH7A 1WPCA 1O8BA 3W5HA 2OPPB 3GV5B 2ZH8A 3KUGA 4X6AK 5L39A 3MM9B 3MMJA 1WJ9A 3TAQA 1HBOA 3D4JA 5KFGA 1AZSB 4KM8A 5CJ9A 1GR1A 4GTBA 3OHAA 3NL0A 4OI3A 1WF1A 3LP1A 3U27A 4K50A 3IM8A 1NSAA 3A13A 2CNLB 3N0BA 2G1DA 4GC7A 2HHPA 3DLHA 3IRWP 5DDOC 3EZ5A 2CFAA 1R0AB 1TFYA 3L4KA 4LFCJ 3CCSS 3MCMA 3CJ4A 4NCNA 4DV7F 1CQMA 2R4FA 2ZKUA 3GTJC 3OFNA 2OEMA 2WW8A 4DR1F 2WHOA 2JRSA 3J7Z5 4KHMA 4DUZJ 5A89A 3GG1A 1UAWA 2NVXK 2R6HA 1I3QC 3MOJB 3UO0A 3BSNA 2E1CA 5KAKA 1Z2ZA 3R9LA 4FF4A 4PG6A 5HLFB 3W5XA 1MWYA 3JSTA 1VQ5S 5HROB 4LRAA 1NRKA 1CPZA 3ISZA 3EPGA 2K06A 1ZH5A 3DC2A 5THWA 2Q6LA 1I6JA 4MEXA 4A3IK 3ETMA 1QUVA 2EFNA 4L72B 1J5EF 2UXBJ 1NZ8A 4WWVA 3GPAA 1UJ4A 4EZ6A 1FDDA 2ZH7A 1S5ZA 2L3MA 3QPIA 2CPYA 4ED4A 2LA4A 4HE5A 4U6PA 3ZBUA 3MM6A 2P6TA 2XB2D 5HVHA 4XSXA 1BQEA 3OJWA 3G6YA 5LL6d 4X4QA 3LA0A 1WC4A 1DLOB 1KONA 1N08A 4FWTA 1OY6A 1BQMA 2CPZA 4LSLA 3BR9A 4HLBA 1RCOB 1RT7A 2WRMA 3NS5A 2E2IC 1USMA 1MABA 1CS4B 3T53B 5A0YA 1JVIA 2PHCB 3KLFB 1S1XB 3FKIC 4OHXA 1WHWA 4RD1A 2EPIA 3JAMY 2BE7D 2FVPA 2HRUA 1YJ9S 3DRPB 1YI2S 4QR2A 1FJGJ 4B3XA 1VQ6S 3QT7A 3I32A 4DCJB 4DR2F 1VHEA 4TMZA 4P6YA 4WFXA 4DR5F 4LFAJ 4ER8A 5ETNA 3IXQA 3MM6B 5HQ8A 4YQWA 2YPZA 3D68A 3CJ5A 3K5LA 2KYXA 3QBCA 4ID5B 4UF4A 2RRBA 1NKEA 3R6GB 1N5QA 2U1AA 4OX8A 5ADZA 3FVYA 1KRPA 2V63A 5CQGA 5C4XK 1RQ0A 5KG1A 2MQOA 5IQ6A 1B4BA 1U1KA 1RP5A 5KG3A 1YDLA 1VQ8S 1CSJA 1X0FA 3CW2A 3PDNA 4HHJA 1ZAXA 1KEKA 2C77A 2VOPA 3DMJB 3VR6A 2Q3PA 3GZ7A 3VA7A 1FA0A 4MKVA 8AT1B 3DRPA 4G5GA 3D2WA 4ED6A 3S1QC 1RISA 1YX2A 3VR1A 4C2MK 4ZVEA 4ACAA 1L0WA 1SKRA 3VAFA 9ATCB 3TEHB 3LP2B 5D0EA 1RLCL 3HOYK 4YEAA 5KFBA 2X3GA 1T0TV 4CT8A 1CJKB 2F8EX 3KXDA 3T19A 3MZIA 1HR0J 1YCLA 3K58A 1I94J 4KB4A 3HOUC 4N76A 2GJKA 1VIOA 5ETSA 3GMGA 1C1CB 2CDRB 3CCLS 4Z4SA 4ZN3A 4X4VA 5FA6A 1DCOA 1H8HA 1KC8T 2XULA 1ZTWA 2K8GA 2KB2A 1RWUA 3OEPA 2V8PA 4PWWA 1SJRA 3HVRA 3FBEA 5DQHA 4E0DA 1S77D 2GK7A 1NAQA 2AGPA 2IA6A 2FHOB 1INNA 4DX5A 3CCQS 2QMXA 1KD1T 1K44A 4A3BC 3EGWB 1S10A 1E64A 3CMEB 1F9NA 2C5HA 1EQ0A 3BO2A 1JIHA 2FQTA 3RRGA 4ECWA 1F9FA 1YJVA 2DHSA 1M1HA 2ADCA 5TV2A 5THXA 3WYAA 3CC7S 4O3PA 2W2NP 5J2NB 1Y3JA 5SZTA 2A1BA 4NXMF 5GAHU 2ZOFA 3HHLA 2FX3A 4P72A 2QN6A 1XC9A 4KYZA 1HWJA 2HNDB 2GREA 2GA7A 1F60A 2HFNA 3AJDA 4DUYJ 3V4IB 1YJ9B 3VAMA 3V7AA 4L74A 2OFGX 4WE1B 4XQFA 3SV3A 3K0JA 3W3SA 4DN9A 2XGQA 1FKOB 2ILZA 3NAHA 2HQGA 1XQBA 3MR7A 1QAIA 5DSZA 1S4EA 4QJVB 3MEDA 1TKXB 1H38A 4CLFA 3S2HC 2WJVA 1ZVUA 2NVTK 3I4HX 4ILDA 2HLTA 4RD6A 2YWHA 2KH9A 3H3VD 3RG6A 1AMOA 1RT5B 4DV6F 4YFNA 1B0VA 4KASA 3T1HJ 2MQPA 3PVDA 2RT3A 4YDDB 1CNFA 1E1RA 2BZ2A 1XZQA 2OSRA 3NWRA 4RJVA 4MJKA 3W2WB 3VV2B 3AOAA 1RA6A 3GTOK 4XIUA 1RT6B 1WU8A 3UE2A 3RTVA 3M2RA 4OI1A 5TMFA 2DERA 1KK0A 1VBXA 4WFAQ 5D0RA 1TMJA 2Z2YB 1VGYA 4BDPA 3MCAA 4ZK7M 1J98A 4L3KA 2B9EA 3JSMB 4I4BA 1EP2B 4S0MA 1WC0A 3W61A 2F7VA 2E2IK 1RJJA 2JA7K 5IP7C 4DQRA 3KLEA 2HVZA 2R2UA 1NU4A 2DH9A 3AY0A 3OVAA 3G05A 4K4XA 1IKYB 3PW2A 3GV7B 2XLJA 2YX1A 5KFYA 4ECRA 2P8TA 2RKIB 3D3BJ 3TRGA 4TMXA 4JI2J 1VQ7S 4X64F 1UVIA 4IOAQ 3G4SS 1TWCC 3T56B 2F4FA 3DGVA 2JA8C 2XCQA 3OREA 3IS9B 4DQLA 2UXBF 4Z4UA 4LF4J 3QIDA 3GU0A 2O3DA 4K4SA 3KJQB 3HJVA 1IR0A 3U7JA 3JYTA 2FVRA 1M5VC 2BE5A 2OPSB 2RF2A 2RRNA 4N56A 2E1BA 2OMOA 4X7FA 3SSSA 1VQPB 4K1XA 1HWKA 4O3SA 4O3OA 2XZDB 2QV6A 4N8OA 5H1SV 3PO3K 1AB8A 3LTOA 4UZCA 2VONA 1EP3B 2V4RA 3CQZK 2EXUA 5JBQA 1VQNS 2NV4A 2RQKA 4ED5A 1VQLB 2VA2A 1CC8A 3GTMK 3T1AA 2D3ZA 1X5TA 3BUEA 3A1YG 3Q86A 2DTJA 2B7CB 4KO0A 3CCLB 3BGRA 3N6MA 2NUHA 4WCEQ 4O23A 2PIAA 4RW7A 2ZHAA 4UZEA 1S0MA 2HGMA 3PKYA 1U48A 4RW8A 4TSFA 1OJ4A 3GIRA 2N7YA 2UZAA 5FDLA 2GK6A 2C1EB 2XBPA 5C4XC 3UN3A 3EVWA 1WDTA 3FPKA 1N33F 5TJ3A 1PJ5A 5IM0A 3VALA 4QW9A 4ZLJA 4IFVA 5E7OB 4C0HA 2ASYA 4CLWA 4RD3A 2HAFA 4OL8A 3FHZA 4G7XA 3K59A 1NK5A 4PG8A 5HMXA 1KBRA 2RU9A 2COLA 4YALA 3R7NB 3PG9A 2BM0A 1IKXA 1VBKA 2JHEA 3THTA 1GXTA 3QE2A 4WWSA 1KSPA 1SL1A 4USKA 2AYEA 2MZQA 1BGWA 3HSDA 1UD2A 1R3NA 1I18A 5BSYA 1N8RD 2YNFA 1OPZA 5B0DA 4TQSA 1VQ8B 3SCJE 2D6FC 4XORA 3O2IA 5E3QA 1C0TB 1F5AA 3F44A 3RZAA 3DLEB 5EMNA 2X0KA 2VODA 5H9FK 4OV6A 3HOYC 4X6AC 5HXBA 3M7VA 3GQCA 5LOQA 3L4JA 5B08A 2RILA 2RDJA 4DLEA 3OXFA 4U7UD 4RO0A 3DRSB 3L09A 1EP4A 1EB0A 2IVMA 4P26A 3EGVA 2NS1B 1XXCA 1XMQF 3DYAB 2E9TA 1ZA1B 2AZ1A 4F0KA 3T02A 1WC6A 5HATA 4RDKA 4H4OA 4A3KK 3S15K 1VRTA 3SZ2A 1RTHA 3CTRA 1YSJA 5K14B 3S1RC 1S6OA 2RDIA 4LF1A 3CEDA 1KDNA 3B4DA 2ZOGA 1GH8A 3S15C 1VFJA 1FT8A 5B0BA 3PW5A 4BS2A 3GFHA 3LWLA 2G0CA 2PA8L 2M5YA 3TA2A 2HK3A 3CC2S 1S9FA 2VUGA 5M2RA 3AAWB 4JOUA 2D9PA 3GFXA 2JX2A 1EI6A 3C46A 5CA5A 2ZBUA 4AXIA 3OFHA 5B7WA 4N3NA 3KK1A 3G4SB 1VQ9B 2GIRA 4II3A 2BA9A 3GTOC 3KMSA 2HFZA 2J7WA 1ZXOA 3NEKA 3KUEA 1YLXA 5DGBA 2GW8A 3GIMA 3CC7B 3H0GC 3KJFB 4USWA 1O6XA 5H9EK 2I5JB 4ZCKA 2ASLA 2HWTA 2ZITA 1S0OA 2LVWA 4K4YA 1FNDA 4M53A 4C8OA 3P49B 2P9GA 2UVVA 4KHPF 2XMMA 1K47A 3FNNA 3TTGA 1I5OB 2VNKA 1H7XA 1B0PA 3M2VB 4TU9A 1S1UA 5IWAF 3IMQJ 1O2AA 2GC8A 3BREA 2HVHA 4KGXB 3PYEA 2I8EA 4JYAF 2V6SA 1HQUB 2NSCA 4CM2A 1BX0A 3WNDA 3WHIA 3AH6A 4KIAA 4DQPA 4ILRA 3IAM9 1HWUA 1N0UA 4YAUA 2HHWA 4X4SA 1W2BB 1SH2A 4WKYA 2DNKA 3BJYA 2QLWA 1N6QB 1FESA 3I0SB 4G1BA 1S49A 4CLZA 1CQNA 5A88A 2XOKA 2XNCA 2J76E 4CNZA 1U02A 4OINA 2K2PA 4NXNJ 5J3OA 3O1LA 1XFOA 3C15B 4YUDA 3EMTA 3KK2B 1U24A 1WSVA 2VG6A 4K5SA 5KOXA 3CJ3A 4ZPAA 3Q38A 3VAKA 4B3SF 3KNAA 2E2JK 1RT3A 2FHJA 4KKUA 1RWOB 1JLFA 3NRBA 4KBIA 2XEXA 1YJUA 2C4UA 1WQFA 4RCYA 2PSZA 2OTJS 2O01C 2ASJA 2M7SA 4NOHA 2ZHOA 1ZYRA 2W7VA 5A8WB 4ECVA 4IYQA 2FGCA 3FMWA 2ZNYA 1K0VA 3GV8B 4CLPA 2CJKA 3HVAA 5AJ3J 2WW4A 1U0SA 1JA0A 4XPEA 2BF4A 1S4FA 1FERA 3C6TB 1U1LA 4IRDA 3OLAA 1TP7A 4NI2B 4M94A 4DV1F 4CQJA 3KHRA 4QU6A 2A69A 3FZBA 2DNZA 1SJ1A 2VG6B 3KL9A 5JVGQ 2OBRA 4ZVGA 3HT0A 4F4AA 2YNGA 5HBMA 1QE1B 7AT1B 2YNHA 2AJ4A 4JI3F 4RL1A 3RBEA 3QMQA 4F7VA 3W2HA 8ATCB 1Q8BA 1HLWA 3M8YA 3T6JA 4E8UA 1WCMA 5IOQA 3V81B 1Q7YD 3MR5A 3U02A 5KFPA 3AA8A 1BWVA 1NHVA 4TY9A 1CS4A 4DR7F 2R3VA 1VQ5B 2VZ9A 1I50C 3FJ2A 2BANB 3MCNA 1RU1A 2C2EA 3DM2A 4XMYA 4NLVA 4Z7CA 2Z56B 1PSDA 1NSKL 2HS0A 4USHA 3ETOA 3W5UA 3BV8A 2CG8A 3T00A 3H5SA 3DI6A 4RNFA 3S17K 3V6HA 2W9CB 2QL9B 1EFTA 2CQ0A 1XR6A 1CULA 3PKMA 4LF5J 4FPIA 2AX0A 3TAMA 3DDKA 2WB1D 2PLFA 3RR7A 2WONB 1EXMA 4Y34A 1GNKA 4OYAA 2XY6A 2JVOA 4NLWA 2VBTA 2LXIA 3KMQA 1RHRB 1VLOA 4C0SA 4IDKA 2XNQA 5AXNA 1NDLA 1IWGA 3PUNA 1H42A 1F5BA 2R8KA 3I5AA 2MTLA 5TMCA 3B6BA 3JXOA 4KFBA 2Q43A 4B3MJ 2VFUA 4W90B 2A2CA 4X62J 1TUIA 2CJ9A 3AT1B 1LWXA 1KFSA 2EG2A 4UY8T 1HI1A 2NZCA 4PGOA 3KEWA 3OSPA 1FWLA 3H7HB 1Q8KA 2PI5A 4LQYA 2C78A 2Z2ZA 3CWJA 3MM8A 3ILJA 3MPYA 4X64J 1HBUA 3OTDA 3M3YC 4DR4F 1KNZA 3ONYA 1AB4A 2MZSA 4LVNP 4A8KA 3VZIA 2DGOA 4D3HA 5IT0A 1VC5A 1U25A 4B47A 1C0UA 4I68A 3KKFA 2QA2A 4XN3A 1WC3A 4CI0B 3T1YJ 3VCDA 1W0KA 1IQ0A 4ZLPA 2ZBCA 2OJ3A 1MNEA 3NGTA 3CD0A 1SJQA 3DLBA 2XSJB 1SC3B 1FRXA 2NR0A 4OHWA 1RTDB 5HI7A 2HQIA 2UVUA 1S1TB 1RBLA 5DETA 1UMJA 3PCOB 2K7JA 4K8RA 2W01A 4V1Ak 2DEUA 4F7DA 2J8AA 2HRYA 4DL5A 1EZZB 1KLMA 4KH1B 4ECYA 2FPHX 1Q0NA 5D8HB 4NZ0A 2CQBA 3GYXB 1JXVA 1IVZA 2DVIA 4KMHA 1YJTA 4GVBB 2CQHA 1K8AD 4G0UA 3FKIK 1RT4A 2HDNB 5KFJA 3S2DK 1UV7A 4PXBA 1Q53A 4OOXA 4L73A 4Z4RA 3OUYA 4F2SA 3H8YA 2ZNZA 3RZOK 2R7RA 1IBAA 3JQJA 1WOPA 5KFHA 1Q5VA 1NBMA 3RZOC 2LYVA 1XMBA 1F7UA 3ASQA 3U1MA 5D4DA 2ZL7A 5IV3A 1Q16B 1S1VB 1VMBA 2JA6K 4G1PA 5JJBA 4A4JA 4NCGB 4WZQA 1FKOA 2VQEJ 2X1GA 1SJFA 1HNWF 1YI2B 1OB0A 1UMKA 3ONUA 5IK2A 1RA7A 3DXSX 3NUHA 1ZAWA 1JLCA 2E5JA 2KT5A 2CQCA 3OJSA 2CQPA 5LSOA 1CQXA 3HMJG 3CCUS 2A6EA 1TL1A 3TWZA 3AOBA 2HLDA 4BBSK 3OJXA 4C3IC 1RWMB 4LF8J 4Q43A 4B9MA 5HZAA 3HVTA 2PDAA 4X66J 3PX4A 4KV8A 3ITHB 1NSPA 1O5JA 4M5LA 1YRTA 1P8GA 5IP9C 4OZ5A 3I56S 3S14C 2O5DA 5LT5A 1LQ9A 4B17A 4X7DA 2ZDOA 2F1FA 4DU8A 4XPCA 1NCLA 1WHYA 2J7KA 1BGXT 4ES1A 2J0WA 2DNGA 2ZUGA 3FDSA 1LWCB 5IYWA 5DZ6A 3ZC3A 1NH7A 1JA1A 3MM5B 2OI2A 1LWEB 1WQGA 4UW2A 1BJKA 4F8RA 4QHYA 4L3NA 4Z7YA 1FD8A 4R0JA 3TAPA 2WVCA 1GO2A 2R7SA 1HBMB 4GKJF 2P3MA 1TL1B 2GMJA 3UI3A 3VQSA 2WSEC 1W35A 3FFIA 2WTFA 2Y1JA 1L5UA 1S79A 1RB0A 1VRUB 2X53S 1OB2A 4ZVHA 2PGCA 3J7YI 1XB2A 2VQFF 3GTLC 1Q86D 1XQIA 3GTKA 1VQ6B 2OO4A 4FF1A 4EK2A 4R5PA 2FQOA 2B63K 2ZXHA 5I42A 2BE2B 3KFWX 3ZTPA 1P9YA 3QNWB 2HCJB 4IH5A 2N7CA 1D3WA 3Q8UA 5LMZA 2V6TA 2ZC4A 4Y9UA 4Y6IA 5L1LA 3MM5A 1KQFB 1GK8A 4KN7A 4ES2A 4N8NA 4XAKA 2B63A 3EWGA 5FLXU 2W7AA 2R2RA 1G7RA 1WEZA 2BRLA 4A8OA 2IAJB 3VAGA 4DQQA 4EZ9A 4ZJLA 1TZ0A 3QYYA 2RUGA 2GIFA 2ACYA 3RZDC 1R5OA 1R89A 4MAKA 1YJ7A 3PYDA 2LP4A 4F2RA 1BE4A 1FTCA 1H74A 2LQ9A 3QT8A 4DV5F 5KFSA 2XNDA 3NGKA 3GTGC 5ETVA 4K4TA 1DG1G 5ETMA 3GJTB 1U2FA 4X4OA 4DDQA 4MKAA 3OKXA 1FX2A 2W2MP 1KZLA 5F9LA 2IVYA 4J9RA 5DM6Q 2YU9C 2HQDA 4C45A 2HFSA 4W98A 5FLXY 2KFZA 4TY8B 5A8KA 4II2A 4DS4A 1PC4A 3CD6S 4LT6A 4QZVB 2LQJA 1S59A 4DV6J 2D3O1 1IKXB 2J5AA 3NGSA 3NGUA 1TTHB 3K8WA 2KWAA 5KFFA 4JI2F 5IYRA 5FO0A 5IT9Y 1TWHC 4ZH4A 3UWTA 3T5KA 4B3GA 4B44A 2R2SA 4V19X 5F8NA 3T6BA 1RTJB 4LSNB 4ANDA 3J7A1 4LF7F 4X65J 3OEEA 4M1KA 1JLEB 2Y8YA 3G4AA 1JKHA 1RGVA 4A8XA 3C3LA 3T1YF 2W2OP 1EP4B 4OX7A 2C3OA 2J6SA 4C2MA 3QGHA 3DLGB 1Y5LB 5BYQA 3ZZRA 3VGSA 4DCPB 4DUYF 2JN9A 5ETPA 3GFZA 2V4JB 2DIVA 2VV5A 3LP1B 4RZRA 3I55S 1ISEA 5JFEA 1ZA2B 2VBXA 3CO9A 1T9XA 1OGJA 2OAUA 1VQ7B 1ZPWX 2EFOA 3KLGB 4ZA1A 2QA1A 1TUVA 1R8BA 1I1GA 2FJVA 3GIJA 3UNYA 3GE9A 2WB4A 4DZ6A 5A6PA 1E3XA 1F3VA 3SCIE 1IR1A 2JLFA 5DDRC 2J6UA 2X1AA 4LR9A 1AUDA 4RNHA 4O44B 1MROA 4F02A 4OMFG 3W5YA 3U6KA 3CQZC 1N4LA 4N3GA 4H54A 4JI6J 5IOTA 1FXRA 4X07A 2V8DA 3BH7B 2W9BB 3SQGB 2VUMA 4WPAA 1T7PA 4C9DA 2BV3A 1VQOS 1TV6B 3J81Y 3S14K 1SC6A 2DCLA 4LUBA 5F41A 3PNIA 5HO4A 2XMVA 5F4JA 4NLPA 2OELA 3H2VE 1Y1VK 1J6VA 3G6XA 1S4MA 3CMAB 1EK8A 4PG5A 4KKSA 2VFRA 4NXMJ 1E79A 1IB0A 1YVFA 2R7VA 1KK1A 1HI9A 4BWMA 2IRYA 1E1QA 4LSLB 4CYUA 1RTIA 3PR5B 5F4OA 2Z57B 1RAGB 1E6YA 2F4VJ 1Y11A 1U47A 4LVOP 2VKRA 3PFEA 1SXLA 4A3LC 1FNCA 1IM6A 1S1XA 2AIRB 2YXLA 4LRBA 1DY3A 4FZVA 3SQGA 1PIEA 4PC1A 2E66A 2D74A 1RHJB 4JV2A 3J7YU 4MFBA 2RC5A 3CCJB 1HPZA 1PBUA 2IJRA 3A3BA 2FLLA 5CDFA 5KG5A 2IIHA 1VJWA 3N4WA 1CJUB 3KHHA 2W8KA 1H98A 5EN1A 4M4SA 3K7AK 4BY7K 2DIEA 2QT7A 3I0SA 5FDLB 1AFJA 1CJTB 5DG9A 2DNPA 4DL6A 1IBLF 1TUWA 1D9FA 1K73D 4XLPA 4OI6A 4QVAA 1Q8IA 3CCUB 4JI5J 2P8IA 4KRWA 3C6UB 3A8KA 2H54B 5IM0B 1YJRA 3ZZOA 3J81k 4NLRA 3OW7A 4N7TA 4OIRA 2FJDB 1D2EA 3O8WA 1HQEB 3QT5A 1XXBA 4C3JK 3MD3A 4ZVPB 4J7CA 2D69A 4IRKA 3HJFA 2AJFE 4K59A 2PEHA 1O27A 2IVFB 1VR6A 4JMQA 2CUYA 2A68A 2XNRA 4MFBB 2Q6BA 4R8UB 1VI7A 3GLJA 4YB1P 4KKOB 2GVDB 2KXFA 3Q39A 3VO2A 3D6MB 2NVYA 2V68A 2C5BA 2R92C 1XWLA 2QLBB 4RPFA 2OBTA 1RWVB 1U8SA 2ZD1A 3IWNC 4CDIA 1FO1A 5E3PA 2I2YA 4KARA 4NI2A 1TL3B 2GFFA 2FY8A 3VGUA 1TKZA 2MQMA 3R7SB 2VQEF 4C48A 1HNWJ 3SYZA 4YHBA 4HDGA 3D0IE 1VJSA 2BJEA 1G7TA 1P6TA 4NLGA 2KVIA 2HFVA 1KMHA 1D09B 4DL0C 3EGNA 5ETOA 1UWBB 4P5AA 1RE1B 3I82A 1BC6A 1K8AT 4KY3A 4DQSA 3KJVA 4CM0A 1QVGR 1D1UA 3GTOA 1QFJA 5D77A 4DL4A 2ZFZA 3SEOA 2V4DA 2GCFA 3F73A 3UCGA 1COWA 2FZGB 4WP8A 2PD1A 3CT9A 3P27A 1TUGB 4OYPA 3EZUA 3T51B 3VTIA 2BANA 4DL3A 3GTPC 3EXYA 5CYMA 2NYIA 1KK2A 2B9WA 1N05A 4TT3A 1HR0F 2V34A 3M6XA 2YKPA 3N6LA 2AT1B 3CXCR 4B08A 1JQWA 5IOLA 1U1MA 2ABYA 1T8EA 2ZWOA 5AT1B 3UFCX 3R97A 3BY2A 5D78A 3GIIA 3KK3B 3LNNA 5AJ3F 1HI0P 1G7CB 2VC0A 3JU4A 1UWBA 3VAJA 2DH8A 3G86A 1P9QC 5DQGA 2ZH3A 2RQMA 4CIOA 2YKNB 4DFKA 3MM9A 2JOQA 3TW0A 2JH3A 2LMIA 1AZSA 4ZPVR 1Y5IB 3K5MA 2CWKA 5C4JK 2DEJA 3FMBA 4B3SJ 1CG2A 2R93C 3FQLA 5HJXA 3R2DJ 3HAGA 3CNQP 4DF8A 1Q5YA 3JTPA 2ZVIA 1BLUA 4HIZA 2IJNA 3I9ZA 2R93K 5M2PA 4USMA 3HPOA 3GILA 4ED3A 5J1NA 4B43A 2X8KA 1B7YB 1D8ZA 3BCDA 2ZJQQ 3BP8C 2FJBB 3LWMA 3D66A 3W65A 3GP9A 2ZUFA 3G96A 4EO8A 5DGAA 1JJHA 4B9NA 3MD1A 1V3ZA 2BQUA 1HL6A 1X4AA 4DL2A 4LF7J 2YKMA 3L3CA 2KRBA 1X4BA 3HOVK 5LSLA 3HVWA 1C0UB 3W8GA 2VPYB 2OGUA 2ZC3A 1OPIA 2W4CA 3AD7C 3GTLK 4LBHA 2KM8C 3DLLQ 2ZE2B 2ZZGA 2AGOA 3EXCX 2XO6A 1OQ3A 4W4MA 1NB2A 4RR5A 2PMWA 3I4NK 4M5DB 1RTDA 1Y0YA 2ILYA 2EC0A 4QV2A 3QFCA 4CT9A 2HNZB 4M5JA 2IM1A 4TKTA 3A8JA 5GAEU 1EQMA 2LEPA 2JJ1A 3DKDA 2IC3B 2QE5A 2DRBA 1YRUA 1NO8A 2HZCA 4XSZA 4Y7NK 3D5MA 4P2FA 2KHDA 3OP1A 4KB7A 4EYIB 4DSFA 1XMQJ 2IY5B 3BQJA 1X7VA 1BJTA 5KT7A 4DV4J 1E63A 2O5JA 5J2QA 3QGPA 5LMNJ 2VF3A 3OUYB 3GVLA 1BDFA 3N9UC 1LK7A 4Y2AA 3I1FA 4DZDA 4BY1C 2B4OA 2RC6A 2B3TB 4ZIVA 2VD3A 1O2BA 3MAAB 1U1QA 1S6QA 3QO9A 4DPYA 3K57A 2LEAA 1S1VA 3CCRB 4DSJA 1P27B 4NPOA 2WCXA 3FUYA 4NLSA 4OYIA 1OY9A 3PHTA 5IYDC 4HTIA 3H40A 4QPTA 3EGZA 4ZKAA 3W62A 1BQXA 5DN6A 3R5CA 2Z58B 3HFVA 1KJZA 5DG7A 4EGLA 5GAGU 1RAEB 5IT4A 4KAIA 4DSEA 4RJLA 1W87A 1RAHB 2MZJA 1RSCA 5HL7Q 1TL5A 3DM2B 1TWAA 1HHSA 3GR1A 1AYEA 4QOTA 5J35A 1WORA 1SM4A 3TO8A 3KLIB 3P4UB 4USUA 3R7BB 2IYIA 4MKBA 3E01A 1IKWA 2BX6A 2HGLA 3DOMA 2HBRB 1KS2A 1Q78A 3R5GA 1VQMS 2NUUG 3M2UB 3TAMB 3RUBL 2XZPA 3OFEA 1VISA 3RB4A 1SH0A 4OZLA 2AP6A 4PYDA 1R8HA 2EK1A 3Q3QA 1SC1B 2WONA 3HHEA 5EHHA 1CJKA 2ZL5A 3BPDA 1R43A 4RUBA 3UD3P 1GT8A 1TAUA 1CC7A 3BKTA 5HVFA 2RNEA 3O44A 1Q86T 5C3EC 4WJ4A 1PILA 2V50A 4BKWA 5LJ5Y 2HMIB 5M5WK 4M1XA 4A48A 3SCKE 4A3DC 4F3MA 3GEIA 2IA0A 3E8OA 1A0OB 3S6EA 2EG1A 3IRXA 1FHTA 2DD8S 1S6UA 1FDRA 2YWWA 2OHDA 4NLOA 4ZJQA 2VOOA 2LECA 2HPUA 1UEUA 1BPLA 4Y52K 1VRTB 2V94A 1HBUB 2BE2A 2FGOA 5CCMA 3H42A 1UEKA 5HMZA 3QGIA 4Y52C 1H8EA 4TYAA 2UU9F 3VNUA 2QYCA 2AJQA 1PKUA 4QWDA 2ZDPA 1OWXA 2HQCA 3UNGC 2Q6IA 5LJ3Y 2BVZA 1QTNB 2FZKB 4ETXA 3PO2K 4I56A 2RH3A 2QMWA 4MYUA 4Q7JB 2QSFA 1PG5B 5B0AA 4KN4A 3D7SB 4AL5A 1D9DA 1O28A 1VQOB 3DHXA 2D3NA 4FZBA 1T3NA 1RACB 1RAJA 3M6WA 3SKBA 3N01A 3S1MK 1KN6A 4B3OB 1BMQB 4A3MC 3NLCA 2HS3A 2HURA 4P2NA 3M4OK 5D4LA 4X06A 4QYRA 2XYHB 4FF3A 1GEHA 3RR8A 1U26A 2XMAA 1BWEA 1E62A 2CJYB 1VQYA 1XE1A 5KT3A 3L7UA 3POTB 4X4NA 2OD6A 4ZLLA 2GHPA 2BGJA 2MEWA 1AIPA 1WKKA 3QWUA 4FBUA 3I31A 2DXEA 5KFZA 2DNLA 1XZQB 1H2VZ 4PC2A 2GJIA 3M8PB 4IQXA 2YWFA 4XD7A 4OLOA 2POKA 3CB4A 5H5JA 1W2IA 4ELUA 2JVRA 1S1UB 3K5PA 1Y1VA 4CTAB 3L4BC 2EW9A 1QFZA 1FWKA 1WEXA
chains in the Genus database with same CATH topology
1WORA 1NRKA 1V5VA 3TFJA 3GIRA 5L46A 1WSVA 3AD7C 3A8IA 3TFHA 4PABA 4P9SA 2GAGC 1XZQA 3ADAC 1XZQB 3AD9C 1YX2A 3A8JA 1VRQC 3GSIA 1X31C 1XZPB 1WOOA 3TTGA 4PAAA 1WOPA 1WOSA 1XZPA 1PJ6A 3GEIA 3TFIA 1PJ7A 1VLOA