1YX2A

Crystal structure of the probable aminomethyltransferase from bacillus subtilis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
358
structure length
358
Chain Sequence
LKRTPLFDLYKEYGGKTIDFGGWELPVQFSSIKKEHEAVRTAAGLFDVSHMGEVEVSGNDSLSFLQRLMTNDVSALTPGRAQYTAMCYPDGGTVDDLLIYQKGENRYLLVINASNIDKDLAWMKEHAAGDVQIDNQSDQIALLAVQGPKAEAILKNLTDADVSALKPFAFIDEADISGRKALISRTGYTGEDGYEIYCRSDDAMHIWKKIIDAGDAYGLIPCGLGARDTLRFEANIPLYGQELTRDITPIEAGIGFAVKHKKESDFFGKSVLSEQKENGAKRKLVGLEMIEKGIPRHGYEVFQNGKSVGKVTTGTQSPTLGKNVGLALIDSETSEIGTVVDVEIRKKLVKAKVVKTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 101
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2005-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1yx2A04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1yx2A02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1yx2A01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1yx2A03
3ADAC 3AD9C 3GEHA 2GAHC 1XZPB 3TTGA 1PJ6A 5L46A 3TFJA 1X31C 3GEIA 3GIRA 3AD8C 3A8IA 1XZQB 1PJ5A 1WOSA 1VRQC 3TFIA 3A8KA 1WOOA 1VLOA 1XZPA 3AD7C 1PJ7A 1WOPA 1NRKA 1WORA 3GEEA 4P9SA 1XZQA 1V5VA 1WSVA 1VLYA 3A8JA 1YX2A 3TFHA 1WSRA 2GAGC 4PABA 3GSIA 4PAAA
chains in the Genus database with same CATH superfamily
3Q6QA 3RB4A 2DNKA 3POTA 5LOQA 4WTYA 4XD7A 4IFYA 4GTCA 4OX6A 3KG0A 1S6PB 3T3FA 5TV2A 3ZZPA 4ZVSB 4KBIA 3AODA 4GTDA 4X4VA 3MEGA 4I2PB 1NB0A 2QA4B 1YJNB 4X62F 1RT4B 3GFYA 2JEFA 3BH6B 1RTJA 2ZUAA 2NZCA 3RG6A 3PW4A 3T6JA 1HW8A 5C44K 1OGJA 1JLQA 1KVKA 2PO4A 2RKIB 2KT5A 1YJTA 5TJ3A 3ZTSA 2FHJD 2QT7A 4RD2A 4OYBA 5HZBA 2GPJA 2M5YA 2YH0A 3T1YF 2DXFA 3FZBA 1RCXB 3JSMA 1RWUA 3CAGA 2X6WA 5A89A 2VBXA 5H9FJ 3TOQA 3WODA 5KFSA 4JI6F 1SFOC 2BJ7A 5H5JA 3D9BA 2DTJA 2Z6BD 2V4RA 2DCLA 4DPXA 5K5MA 2WZPP 4TLQA 3EXCX 2VZ9A 1OO0B 5AJ3F 1IBCB 2HMIB 3C14A 5GAGU 3TW0A 1N08A 2KVOA 1KTQA 3DCAA 1I6HC 1Y5NB 3BPSP 4O44A 3GTPK 2OIHA 3CP8A 1U4BA 3MPYA 4DDFA 1OWXA 4IFVA 1K83C 4FBTA 1EXMA 2L9WA 1SQGA 1T0TV 3M8QB 4LRBA 4A48A 5FNZA 3R5AA 3C46A 1FI4A 3PYFA 4WFXA 5M5YK 1H73A 4WE1A 4WF9Q 2E2IC 1OSCA 3H3VD 1UEVA 1FJEB 4OIOA 2G13A 4LVNP 4N77A 1HBMB 1DZ5A 4GTLA 4KN4A 2EFPA 3BUEA 3PY8A 3MR7A 4I56A 5HKKA 3DLEB 5THWA 4FKXA 4X05A 1LXJA 4YDDB 3LUYA 5I4MA 4C9DA 1CLFA 4TNOA 1TWHK 2FHKA 3DGVA 2I1RA 2EFGA 4N8NA 4L74A 4RDJA 4WU3A 4P74A 4DUZJ 2P9EA 1BQMA 2IVMA 2K8GA 1FNMA 2ZOFA 1DARA 3GTJK 2OPRB 1U47A 1X31C 1YBUA 3S1RK 1T9UA 1Q7YT 2H1YA 4UUWA 2KWAA 3KK2B 2Q3PA 5B0GA 2DNLA 3THVA 3QFHA 3N5FA 1RA6A 5HBMB 1P1TA 3VNUA 2PMHA 1T02A 2CJ9A 4NOIA 1WHYA 4DZ6A 5KOWA 4ZVPB 3GQBA 4Y2KA 1U2RA 4X6AK 4ZPAA 2X6XA 3I9V9 5B0EA 2EBGA 3MOJB 3BBFA 3MPDA 2E1BA 5KAKA 3AVUA 4CLZA 4C3LA 3CDAA 2J8AA 3DI6B 1S97A 1KVIA 5L1JA 2BKOA 3T51B 2ZNZA 2CKWA 3PW7A 2FVRA 4X2BA 2ZWOA 3PA1A 2W9BB 1ZPVA 2CG8A 3E3XA 2BW2A 1QAYA 2NYHA 1G1XA 3FPKA 3O3LA 4OZ5A 3CMQA 2XYPB 5EWGA 1JVIA 2EIXA 3HXAA 3A8EA 2L9DA 2GIRA 3L09A 3DKDA 2HVDA 2NS1B 3SQGA 2OPQB 1TFYA 1O6XA 3AA8A 1RAFB 2YBVA 4Y2AA 1VQ8B 1SKSA 2CADA 1U1QA 5LT5A 2ZOMA 3GCXP 5L9NA 1YLXA 3R7NB 4YUDA 3RBXA 3VA7A 2PSZA 5FIIA 1U0SA 3R9LA 4NA2A 2JA7K 4TMWA 4ZVUB 5EN1A 4ANDA 1TR0A 4PR6A 3KLHA 4YB1P 1KK2A 1NHUA 1PGZA 4A3DK 5AE1A 4ED7A 1XMOF 4F2RA 4TYAA 2CVIA 3M6XA 3S1NC 4KFBA 1GJRA 2X85A 2XGPA 2B6AB 5KT6A 3GIJA 3QAUA 2PT0A 2XZPA 2IC3B 3T01A 1FNCA 3HSZA 4XN3A 5AN9A 4WWSA 2DNYA 1FFSB 2VICA 5FLXU 1USMA 4FS1A 5AXMA 1SV5B 2ZJQQ 2AJ2A 4FYDA 3HP6A 1DURA 3D54A 1O2BA 1WTFA 3Q22A 2XMVA 3OVSA 3M30B 3AVYA 5CH7B 4KGMA 4NZ6A 2JA6K 5DDQC 3HHKA 3BO3A 4K50A 2CFAA 3QSYB 2KT3A 3B6BA 4DUTA 4KRWA 3NG8A 3I56S 2AKWB 3AVTA 4P7TA 1VIXA 4ZLJA 1W9XA 1HL6A 4HEA9 1E1QA 1VQ6S 2VNJA 1R9TK 1F9EB 3IR6B 4HYKA 1VQNS 4ZVFA 2HVHA 2Z56B 2VOPA 1FTRA 3QJJA 3CVKA 4F4WA 3QMQA 2WSCC 5M2RA 2W7AA 4I67A 4XLFA 1HBNB 1F9NA 1YI2B 2CJQA 2AEFA 1REVA 1HNXF 3PX6A 4N3GA 2RH6A 3BNWA 1WC0A 3MM5A 2YPYA 4QBUA 2W8LA 3FCVA 2RS8A 1AMOA 2OH2A 2EKNA 3ZZZA 1Y1WA 4OYIA 1HBUA 1LWEB 4RNMA 4ZPTR 2ZHAA 1FJGF 5L9XA 1HPZB 2MQ8A 1E62A 2WRMA 1VC0A 3HJVA 5GADU 1RQPA 3GTKC 5D0GA 2R7ZC 5IT4A 4A3JK 1Y1VC 1UD2A 4LJMA 4HT7A 1WEYA 4ILLA 4QWDA 2EVZA 3IWNC 4Z7CA 2CQ3A 1VQLS 1Q8BA 2X51A 3PV8A 1UMJA 1R5BA 2B9WA 1RHQB 3SZYA 2MLXA 3W2WB 2WW4A 4CIOA 4EYIB 1I94J 3LOUA 3OR2B 3R2DJ 4N3NA 2BABA 3L7PA 3GTLC 1N5QA 2D6FC 2HLUA 2LDIA 2C3PA 3M8PA 4X07A 4NE9C 2AJ1A 3CB4A 2G1DA 3AJ2A 3OFFA 4HVZA 4NZ0A 5HI7A 2GGPA 1F5AA 5GADI 2QYCA 4GC6A 3SMZA 1FKPB 1N34F 4DX8H 1DTTA 1DCHA 3NE5B 1FRMA 1IXKA 4CT8A 1RTZA 4C8LA 1H2TZ 3M4OC 4P5AA 2KZZA 3MMBB 4LVOP 4UY8T 3JQKA 3OUYB 2AJQA 3CXCR 3LP1A 1BS2A 1RP5A 1JB0C 3IRXA 3RRHA 4NI2A 1Q7YD 4LFAJ 1RA7A 1LW2B 3TP2A 3LANA 4YHHF 4J91A 5L1KA 1HQMA 3CMEB 3QLHB 1K1SA 1YITB 3S1MC 1RAGB 1R5OA 3V81B 2DT9A 4IH6A 3U2QA 5A8RA 4PCQA 3NCPA 4K4SA 4AL5A 4X4UA 1JIHA 2CQPA 3CJ2A 3C2PA 4LSZB 3TO8A 5HSPA 1QAJA 3M7VA 3ITHB 3FK4A 4FF2A 2J6TA 3PDNA 4LLGA 3LQEA 1KR4A 1Y5IB 3CD0A 3IS9B 4DCOB 1NRKA 3OV7A 3QT5A 4A8YA 1KZLA 4AYBD 2DRBA 2KYZA 2E9TA 1UD8A 4Z4RA 4BS2A 4P2SA 5IP9K 2QA2A 3V76A 1S1WA 3QNWB 4OHXA 5DETA 1KOHA 2RQKA 5M2UA 4PPDA 3PIOQ 1F60B 1GR1A 5F3ZA 4YFUA 1HQEB 4U9UA 2UUBJ 1X9MA 1HWKA 4NLUA 3EICA 2WTFA 3KTQA 2VUGA 4RD6A 2XZTB 1WPCA 1SJ4P 5ETMA 2U2FA 3JSBA 4RUCA 3GONA 1N6QA 4OX7A 1RWVB 4EBCA 5BSXA 3HVTB 4N41A 2J5AA 3A3GA 1UETA 2OPSA 3FDSA 3GG1A 4DL7A 1DCPA 2HHSA 1IVZA 2HGNA 1DTQA 3K5NA 5I3UB 2CQBA 4OV1A 1FK9B 2ALYB 5JVGQ 1OIAA 1M1GA 5LJ3Y 4QYZK 2CQDA 1TMJA 1SIZA 2DKOB 2BMWA 1VC6A 4ILMA 3W1YC 3AHPA 2V8PA 2W25A 3FKBA 4IRDA 1JLFB 3WBJA 1S79A 2D74B 2PA3A 2LEAA 3NLCA 1WJ9A 4LOWA 2GS8A 4WP9A 1OQ6A 2P8IA 2EBBA 2KO1A 3W2HA 4DS5A 3MMPA 4UAJA 3AXKA 4CH7A 4PG8A 2RH3A 1CJUA 3MUTP 1BWVA 3KLGB 2UXDJ 5GAHI 2XMKA 3Q86A 3MM9A 4FKYA 1PBAA 2CC2A 2F63A 3EVOA 4XCHA 1UJ6A 4CQ1A 4CYUA 5AE2A 1CPZA 5LMUF 1ZAWA 4A3EK 2APOA 3V6KA 1NDLA 1RTHA 3NBPA 3PRVA 4CLKA 1FTCA 3DHWC 1JOEA 2O5DA 2YWGA 3AH5A 1W0JA 1R0BG 3Q2TC 2M9KA 2FLNA 3OTCA 4XTTA 1R3NA 5K14A 2DCUB 5BSYA 3L7UA 1XN9A 3L95X 4X6AC 4KO0A 2YX7A 2MGZA 4CLPA 1ROFA 1CG2A 2D69A 4Q43A 3UDLA 1CBKA 2UXCF 4XIUA 3FKSA 3H2VE 1TKZB 3C66A 2HFSA 1F5BA 3KK1B 5A8KB 2A69A 1OSDA 5HVFA 4MK7A 3BP8C 2GA7A 1C1BB 2QTWA 1RTIA 4LUBA 2R9LA 4LBZA 3DM2B 1N4LA 2ZBIA 3DDIA 1UZHA 5D77A 1XNQJ 1D2EA 1U1KA 3OW7A 2PD1A 2QGGA 2YKQA 1TWAC 1FF2A 3DOMB 2V94A 2CNLB 3W5UA 4KB2A 3OHAA 3EPGA 4XLCA 2VL1A 4MMOA 4ITSA 1T7PA 5ETVA 1S12A 1TV6B 3SDEB 5HROB 5IYDK 4K4UA 2XLJA 2CQ0A 2O5IA 4OV6A 2L41A 3HI9A 1TL5A 3A35A 4JI8J 3FOFA 4X7CA 3PYEA 3F56A 1EETA 4YY3J 2A3JA 4KKUA 2YPZA 1UCNA 2DO0A 1RHRB 3I0SA 2MLYA 4QIFA 3ZTQA 4M8LA 5DS0A 1RWWB 4YMEA 5J2NB 2V31A 2X7IA 2HQFA 3M1VB 5C3EK 3P5BP 3ASQA 5AXLA 4QYRA 3OL7A 4F4KA 5A8KA 3GTYX 2VYQA 4TMVA 4O3PA 1VF7A 2IHR1 2BANA 2JA6C 2H4YB 3MMAB 2YY3A 4YFNA 5KOXA 1J5EF 1IBLF 3DU6A 4G1IA 1E43A 3W5HA 2O5JA 3P8BB 3TQ1A 2E5LJ 3W9JA 4QR0A 4RUHA 5T7LB 1QDUB 1UEUA 5CCLA 3I5AA 1S1UB 4DV5J 4OHZA 3V6DA 3EQLA 1EFUA 4O23A 4I69A 2KFNA 2BUNA 2UUCJ 1QY7A 5IOLA 1WG5A 3D1OA 1HNVB 1XQIA 4DQKA 5IYPA 3H3VL 2FY8A 1Q16B 2QFJA 4RPDA 4II2A 5HK4A 2HDNB 2LYVA 4MFBA 4OX9J 1AZSB 4JV2A 4X65J 3ZZUA 4KARA 4P5BA 1DBDA 1VQPB 1C0UB 1KSPA 4FWTA 1AXQA 1NPPA 1S72B 4WZLA 3OTBA 1VBZA 1WOPA 3FKIA 2VUMA 1TWFK 2XCQA 3NWRA 4DJBA 1K47A 1G2EA 4WFNQ 2GIFA 1JB9A 4G0UA 2B7CA 4BC9A 5FIUA 2DH8A 2H51B 1M0SA 2OK8A 2K1RB 5IC6B 3LWMA 3I1FA 4NYOA 3R2CJ 1NK4A 4CI0B 2G2YA 4USIA 2AX0A 1TWCC 3DOLA 3Q0AA 1IKVB 3H2LA 4QWCA 3TVZA 3NGRA 2BV3A 1HI8A 2MKYA 3M2RA 3QFTA 2BJ3A 4O0NA 3CCVB 3H5SA 1D1UA 4ELUA 4P73A 4KAWX 3KDNA 3ELHA 2A10A 2RGRA 3MGJA 1FEHA 3PO2K 4JV0A 5BJRA 1TVRB 2E44A 2J0XA 5IYCK 4N7TA 1FFWB 1YJWB 3AVWA 2DD8S 4WTOB 3IAS9 3GJRB 3LQ6A 3KG1A 1FRQA 3JS9A 1F0XA 2MDAA 2HQDA 4C3JC 3DN9A 2HNDB 1QD1A 1UJ5A 1KFDA 3MCSA 3SCJE 1SH2A 4OJ3A 1PJ6A 2CIMA 5A2QU 1KS2A 1S99A 2LVWA 3AY0A 4JI0J 1FXRA 4A8FA 1Y3KA 1BLIA 2E2HA 1GH8A 1FDDA 5M3MK 4P7VA 2AGPA 4DFJA 3O6QA 1AUDA 2UVWA 1G3OA 2CNNB 1JJCB 4ZK7M 3AXMA 2OBSA 1GT8A 3ERED 1U0HB 3GMGA 5GAEU 1WDTA 4OJGA 2GO8A 4I2QB 5F3TA 3AVVA 2HNYA 5F41A 1E6YB 1UFLA 4KPYA 1T9XA 4BY1C 2AZ1A 2D9PA 4XSXA 2YKMA 2VDHA 1S7IA 1XMBA 3ZPNA 3WXMA 3EUNA 1V3RA 4V1Ak 3R7SB 4XONA 2H5IB 4H4OB 2KDOA 3AB2B 3TARA 5J2QB 1IE0A 3GZ7A 1XC9A 1G7RA 2HSEB 1Z4UA 1JKHB 5E68A 4RD4A 3J81j 1RT5B 1GX6A 1LWFA 4LF9J 4RBVA 3G86A 5I42B 4G65A 3KWMA 3DXJA 3HD2A 1E3ZA 3A3NB 3JXOA 2C22A 3CD6S 1B0TA 3BSCA 3MM7B 1N07A 2OYNA 1RDRA 3DRRA 1UW9A 5GAEI 4PQUA 4ZJLA 3CSKA 2AYEA 1KDNA 1B0PA 1U6ZA 5HZAA 4FF1A 2P2CB 2ZL7A 2XM3A 3S8SA 1EFCA 4HHJA 3I4MK 3CJKA 3UN5A 1MMDA 2XB2D 2GSOA 2L08A 4ANEA 5KFTA 3BV8A 5ETPA 2P9CA 3N0CA 2FJEB 3I5BA 2ILYA 3W2IA 3TUIC 4WIQA 3W65A 2W7PA 3T19A 1SJQA 3TX0A 4BBSK 4B9SA 2JNJA 4LBYA 5D8HB 4R5PB 5ETRA 3W2EA 2XMWA 5KT7A 3BM7A 2UUBF 4JI5J 4RZRA 4NYPA 4WZTA 5L39A 4Q8EA 3A8KA 3BDEA 4MKYA 4DLEA 1HBOA 3S2HC 2PE8A 3HXMA 4P6QA 2RDJA 1B4BA 2N82B 2O1PA 4ATNA 3GPAA 3TAMB 2XQCA 1XZPB 5K8OA 4DV0J 2H9ZA 2QGFB 3H4BA 3JTOA 4JYAJ 3GLJA 3HFZB 2FZGB 1KD1T 1EHWA 3V6JA 1UA0A 4QR1A 4C3IK 3KUHA 2DGOA 4N47A 3WNCA 3ZUGA 4RW6B 1MN9A 4H4MA 4QIWD 2P6SA 2MQNA 3MM6A 5L1LA 2YKAA 2JLEA 5IYBC 2GV1A 3CQZA 1UPMB 4C45A 4O4RA 5F8HA 5J35A 4BY7K 4MTPA 4C2MA 1RAOA 1S76D 3NMAA 4ECSA 2JA5A 2D41A 5J2MB 1R0AB 3BQ2A 2C28A 4QW8A 4DNTB 2ZHOA 3JAMY 4A3EC 1RE1B 1UW4A 4OYOA 2NPFA 4B9UA 3QT7A 5HVHA 3UN2A 5IWAF 1TK0A 1H7XA 1XTZA 4LJZA 1HI0P 1S4EA 1RT2A 5KFHA 3EVWA 4KKOB 1WCMC 3Q8QB 3GJSB 5BXIA 4O4GB 1N5YB 2HFZA 1PJ5A 1LK7A 1KQKA 2FY1A 1NBEB 1ZA2B 4AE5A 1SC6A 2GHPA 1S0OA 2HNZB 3OFGA 3D0HE 1NJYA 3E20A 3CCMS 4B17A 1Z2ZA 4ELTA 2WB4A 4F02A 5KFQA 1YHQS 2AJFE 1UP1A 3GIMA 3HHLA 1NSQA 2DVIA 1VHFA 3H25A 4I4BA 4OIRA 1B64A 4U7UK 4E0FA 1MN7A 1Y0YA 3R8YA 2VG7A 4PAAA 4Y65A 2XWYA 3I0RB 4WJ3M 1N0VC 5KFUA 5L1IA 4J9KA 4RMFA 3NEKA 3CJSA 2BQUA 3G05A 1Q81T 1I51B 2EW9A 4F3OA 5CJ9A 3Q8UA 4CP5A 3OPOA 4U67Q 2WYRA 1HNZJ 2UXBJ 4Z4SA 1NO8A 1UV7A 5A8WB 2N3LA 1VRTB 2VBVA 1WQGA 4KHMA 3ZTPA 3K8VA 2YQ1A 5DM6Q 4ZVQB 3MPWA 3N79A 4P2NA 1RT1B 4KY3A 3I32A 1MWZA 3CWJA 3TQEA 3A1YG 3TJ9A 3FPPA 2IJRA 2DHAA 1CS4A 1J6WA 2OTJS 4RW8A 3BC9A 2RHQB 3FEZA 4JI8F 1SFOA 2Z2MA 1FRJA 4D3GA 1WOOA 3ZIAA 2OMOA 1PO6A 2GJPA 4B3SJ 4USVA 3S6EA 1RSCA 1QVGR 2VFSA 4EK2A 5C3EC 1R8AA 4I0WA 2R92C 4YELA 3RZOC 1X4CA 5JVHQ 1FO1A 5HJYA 1TL3B 5F8JA 2VG6B 2R8KA 2YKNA 2F43A 2V7TA 2VD3A 3CC2S 1TL1A 2LDYA 4UZCA 4J37A 3MCNA 3OVBA 1JJ2R 1K83A 1EIYB 1W34A 2KFZA 4M5HA 3G6YA 2AMCB 1YQHA 2ZBCA 4A4JA 1SMYA 3HOWC 4M2LA 5HJXA 1JNZB 3ULHA 3NS7B 3SEOA 2E2IA 4B9VA 1VBYA 3AVXA 2E5LF 2BKPA 4DXLA 4DNRB 1N48A 4DV5F 5KSWB 3LGMA 3J81Y 2QL9B 1U2FA 1L3TA 2J0WA 4HH0A 3AB4B 2UUCF 4Q8FA 2UV8G 2QMUA 2Y3YA 3VTIA 1Q8KA 1Q53A 2N7YA 2J9DE 2V4DA 4YOEA 1BY9A 4OX9F 2ZUFA 2NUUG 3H20A 4X65F 3RBDA 3S15K 4P3YA 4IRCA 3CXCB 3T53B 4USUA 1TWFC 3RYLA 3O44A 1PIEA 2GJIA 3K5PA 5IM0A 3FMBA 3Q38A 1EI6A 3GEHA 4ZITA 2V7UA 2R8JA 3QIDA 3HDSA 4WZMA 3GEIA 4YAFA 3SJPA 4OLOA 2D1CA 4NLWA 1QFYA 1QX4A 4LBIA 2ROPA 4KR0B 4ZCIA 2AP6A 2E1CA 3UVJB 3G87A 3Q8PB 2NXCA 4KATA 1FJCA 2VNHA 1XERA 4X84A 3BQ1A 3ETOA 3O5TB 1HA3A 2E2JC 2QFIA 4HACA 3LA0A 2WCXA 4DK0A 1LV5A 1WDDA 3C15B 4G7OA 1H8EA 3H0GK 1T05B 1S1XB 4PC2A 3AAWB 3PO2C 1SIWB 1JK9B 2RQMA 5C25A 4XK8C 4DR3F 2M2BA 2NXNA 3W7BA 2B9YA 4OYMA 1TUGB 5DGBA 4UOGA 1MRZA 1ZTTA 3Q6RA 4N76A 1Q1KA 1RWMB 3FBEA 2RRBA 1KD1D 1QLNA 5BYQA 1FD8A 2YWFA 4U7UD 1XR7A 4USHA 1IR2A 4YR0A 2WHOA 3GR1A 2ZOGA 4ZN3A 1BGXT 4B3OB 3SBMA 1TKXB 2XY7A 1M5OC 2NVXK 3IO1A 4H4KC 3HK2A 2ZXIA 1TWGK 2PI5A 2Q6BA 4RW7A 3CMMA 1S0MA 3C8YA 4JI0F 5C2GA 1ZAVA 3TTGA 3RAXA 1XJWB 4KT0C 1C4CA 2XLIA 2MMYA 3D2WA 2BJ1A 5EHHA 2KXHA 2NCKL 1FWPA 3ZC4A 2M88A 2HEKA 4F25A 1IM6A 5A76A 3SV4A 3H40A 1D9FA 3GV8B 1NB7A 5FLMC 4PYAA 2XWXA 4BKWA 1JLGB 3IWXA 3P5TL 1S9FA 4TT3A 3CJTA 2XYGB 3TZWA 3HAGA 2GVDB 5FDLA 3M8RA 2W1BA 1WI8A 2HAFA 3RW7A 3NAHA 1CQXA 1EP1B 1U8SA 3KLFB 4YAWA 2QN6B 3I4NK 1IL2A 4MK9A 3FOEA 4GTFA 4ETXA 3MZIA 2ACMA 2ASYA 2H5EA 2PIIA 1NSPA 4DPTA 4LF9F 1YBTA 3M8WA 4JBCA 1QFJA 1Y5LB 1SKWA 3ISNC 1QUFA 2AEMA 4G5GA 2HQIA 2VC0A 2DNNA 4CTAB 4DR2J 2D3NA 2YQ0A 2XS7A 1MU2B 4K4TA 1Q81D 4P6VF 1E6VA 3LP0A 1RT3B 2FX3A 2FGCA 3JB9k 1U6FA 3G6VA 1YRUA 1H85A 4USJC 5E33A 3PO5A 3KJQB 2N4DA 1T9YA 2J9EA 4BBSC 1UWAA 3NOGA 3N0VA 2KL8A 2DXDA 4OZLA 2MZRA 3KXDA 3KNGA 3HT3A 2DIUA 4RKUC 4DL4A 2E5IA 1UFKA 1YKWA 2E7WA 1REGX 3B4MA 4JI5F 3BGRB 1HQUA 1UD6A 5E2QA 4M63A 1UVJA 4P10A 5KG1A 1I3QC 4NCBA 4M0LA 1SL2A 4KGKA 3ISZA 1EWYA 1O24A 3JQQA 3E8OA 4EO6A 3OEHA 1WELA 2H48B 2R7ZA 2C3MA 2EPIA 4DV0F 2HHHJ 4JYAF 1Y1VA 1Q9SA 2YNGB 5HLFB 4M5GA 1JLAB 5T41A 4OFZA 1APSA 3PVDA 2AX1A 3DLJA 4RW9B 3KUGA 3RTVA 4CLLA 4DDQA 2DEUA 5GVQA 4DG1B 3FBBA 1YCLA 3C6UA 3DRYA 2M3DA 2MZQA 2NXUA 3QZ8A 2MHNA 1KHVA 2NR0A 1XXCA 2BJ8A 3FJ2A 3MECA 3H98A 3GTLA 4RJLA 1RJJA 3PHTA 3CCTA 1ZZNA 4A3IK 3R27A 3MAAB 3D0IE 4LREA 2RS2A 4MYTA 4ZVHA 4LK0A 4IO1A 2OFGX 2E66A 1U1OA 4RBUA 4ER8A 5M5XK 3DC2A 2FJWA 1RQRA 2M8DB 3KYLA 4ZA1A 3HZGA 5EUHA 5CD4A 5G0RB 1SUQB 3V7AA 2DHGA 4TYBA 1JX4A 3PVXA 3R6JA 1EKSA 4XLAA 1O28A 1EQ0A 1H42A 5B08A 2RRAA 5E3CA 2MQQA 2MJNA 4RD1A 3CJ5A 2ZVSA 3MHPA 5TY0A 3SZ2A 3EX7B 4B3RJ 3J7ZT 1F6TA 2MEWA 3DMJB 2QO3A 5EX0A 1RT6A 3I56B 3W5VA 1X4DA 2ZZFA 3ENQA 1VISA 8ATCB 1FKOA 2VQEJ 1ZPWX 4RLZA 3CIZA 5IS2A 4CM0A 2HHQA 1Q79A 3L4BC 4LR7A 1XZQA 2J6SA 2VONA 1VQNB 4QJVA 1IJEB 4OOXA 2U1AA 1U8WA 4KHRA 2V69A 3QT8A 2IFXA 5CD4H 1QGZA 1F9HA 4YFKA 2F8MA 2PEBA 2I5JB 1LWCB 2WVFA 2E1RA 3OTDA 1J27A 3VWSA 4PXDA 2CJAA 4R71A 1N5SA 4TY8A 2RDDA 1RBOB 4Q5VA 4A3FC 3GTMC 4C0HA 2DGTA 2XNRA 4NLGA 2UXBF 3FFIB 1FNDA 2P8TA 3R6KA 4DSIA 1G7TA 4TQSA 3PHEA 3V4IB 1JLCA 2VBYA 7AT1B 2UV8A 1SH0A 2F4NA 5JUMA 1UEKA 4I7FA 1L3KA 1K1QA 1HYSA 2WBMA 1WSVA 4P22A 2CPZA 2EK1A 1VQLB 1CJKA 3W60A 4IG0B 3CD5A 1SQFA 2C2OB 2YTCA 3BBBA 4B3MF 2WZNA 2B63C 4XPEA 3P49B 3VCDA 4C3HK 1VHOA 3SFGA 4RUAA 4DL2A 1BQNA 4B3GA 1TTHB 2ZH8A 4J9PA 5EWEA 1V3SA 1PSDA 1VRUB 2UZAA 3RRGA 1QFZA 1CULB 1NJWA 2FLOA 2BJ9A 1UWBA 3QRQA 2A1BA 3TA0A 1DRZA 4WFZA 1KRPA 2HZCA 4DSLA 2FDNA 3WHIA 4Z4ZA 4A8OA 3W5XA 2MKHA 2E7XA 2GCFA 1MW7A 4LR9A 4BHQA 2Y1IA 1GTEA 1TL7A 4ACBA 1UD4A 3RRKA 4HI1A 1VDHA 4LBWA 1ZYQA 2ROEA 1BMQB 4EYHB 1IBAA 2HK3A 3DLGA 1XE1A 1MROA 2ZFZA 3UDCA 4QIWL 5CAAA 2NVYC 3CIMA 4WZKA 3O1LA 4O2DA 3UD4P 2HLDA 4I6YA 1UVMA 5GMKa 3RR7A 3W3SA 2BM1A 5KFVA 4A3CK 4X8IA 2HWHA 1HWIA 5IZHA 3BGFA 5KFYA 4ZHRA 4KKSA 1D9AA 2JDJA 4RDKA 3N6MA 3HZEA 1GMVA 3M2VA 3VGSA 3LVBA 1VMBA 1IKXA 2ZL6A 3Q8RB 4C3KA 3C3LA 1M5SA 3QBCA 1S0NA 4K0KF 4CO3A 2KJWA 5KTQA 4JI2J 3H0GC 3THTA 3S1QK 3OFHA 2OEMA 2FJVA 2ZD1B 3THPA 4FNIA 2HYIB 1EFRA 2R2RA 4EUVA 1KLMA 1ISEA 5H9FK 2ZH4A 2XSJA 3GB0A 4A8QA 1S0VA 4NNJA 3BS9A 2DRAA 4CM2A 2QJ3A 1X60A 2A0FB 3D3CJ 2DR8A 1CJVA 2RMLA 2A6OA 1ZXOA 1TWAA 3J80U 4RM0A 1WEZA 2QE7A 1HIYA 2V67A 2HQGA 4IQXA 3ENWA 2NVXC 2VPWB 1NU4A 5D4DA 4I64A 1L0WA 2RE1A 4IDKB 1TWGC 1QE1A 2DEJA 3NMRA 4CO2A 4ACAA 3K2YA 3PO3K 4B9LA 3OZVA 1F7VA 4KMHA 4NCGA 2X0KA 2KHDA 1NMEB 3VGVA 3WIVA 3RAQA 1IN0A 4F0HA 3DLBA 4W4MA 3CTRA 4M5MA 5AJ3J 2OI2A 2MZTA 3DOKA 2V7QA 3G6ES 1F9FA 3MAQA 4DZDA 4XR6A 1VQKS 4BXXK 1XR6A 2WZ1A 1T94A 4B3XA 5IQ6A 3FVYA 5ETLA 2W9AA 1MG7A 4J9SA 3I87A 2MHEA 4DMZA 3BKUA 4B47A 3D4JA 5HN0A 1C1CB 2P5VA 4LSNA 2GO9A 4OL8A 4BCAA 3NAIA 5LJ5Y 1OPIA 3OEPA 1BQXA 3FEXB 2DH7A 3GFHA 2DERA 4LIWA 4YQWA 3KMSA 3FEYB 4GC7A 1S9GA 4HTIA 1LNQA 1Y1WK 4A8SA 2QSWA 3LAKA 3P26A 3IAM9 5DRKA 2Z8QA 4NLVA 1RYRA 5KFIA 5ITHA 4M5LA 2ZFHA 5LMNF 5IT9Y 2YQ3A 4BWMA 3FQKA 2WONB 4HLBA 1SJRA 3K7AK 4C8YA 5B09A 4PWDA 2MXYA 1IQ0A 2V8VA 4NLXA 2G4BA 3AFGA 1VR6A 4G1VA 3OLBA 4Y52K 4X4NA 2OPPB 3CJ8A 1EP4A 3LGHA 2LQJA 2CQCA 2RF2A 4WFAQ 4M5DB 2LA6A 1QUEA 1BWEA 1N5TA 3PUNA 3HOVC 2GQQA 1X7VA 4FYYB 2R7UA 2NLWA 1TWCA 1Y10A 2ZUEA 1KBRA 2QA4G 1ZAXA 1BXNA 2EG1A 5CZVA 4AL7A 3SFUA 2AF6A 3MEDA 3PEHA 3K58A 1TELA 2A6EA 1PILA 5HAOA 5B0DA 3PX0A 2C3UA 3VO2A 1M5PC 4IH7A 3KK3B 1RAIB 1FD2A 2E1PA 4TU7A 1A7GE 1RT7A 3N28A 2JX2A 2ZBVA 3PJ9A 1NJZA 1USOA 2XMMA 1G7CA 4IYQA 5DGAA 2HRTA 3I55S 1FESA 3CW2C 1H7WA 3R6GB 3RAMA 3DRPB 3UW1A 1VOMA 4EI2A 4NPOA 3UNGC 4WILA 4HKQA 3KLIB 2AGQA 1IJFA 5F8MA 5B0AA 4OX8A 2FVGA 3FSYA 5EGEA 4Y7CA 2BGIA 4XORA 5HANA 1FJ7A 2L9NA 3R6LB 3OJWA 1W87A 3IPJA 3C6TA 1QVGB 5F9NA 4MH8A 3GFXA 2MSSA 2ADBA 4N5SA 3EVMA 3ZTOA 4WYLA 5SZTA 5H1SV 3PW0A 3M32B 2Z30B 2R4FA 4KJIA 3H9NA 2XCRB 4DSEA 1URRA 4J9RA 2JJ2A 3NGDA 3FCWA 5KT2A 1CNEA 2CQGA 2B8PA 3TRGA 4DCPB 2X1BA 4J9LA 1HR0F 1MMLA 4PGOA 3NGSA 1S6QB 5DZ6A 1T95A 2JN9A 4EZ6A 4B3RF 3M3YC 2VJIA 4G0WA 4A3MK 2XGQA 4MK8A 8RUCA 2VQEF 2AEJA 1IKWB 1H74A 3CCUS 3N0BA 4FXWA 2AHOA 1VJEA 4AD6A 1OMSA 3JQPA 1WNEA 4YR3A 5HMXA 3H0PA 1J6VA 1A8PA 3TANA 5GV8A 3BH4A 1YWXA 2R7VA 4ZH4A 6AT1B 3EWGA 2YNIB 4R8UB 1Q95G 4DR4F 3E51A 1HWUA 3T5JA 1HD1A 3EJMA 1BX0A 4GVBA 3DRPA 5KFCA 2VPZB 2EK6A 3C16B 4ZGQB 5HMZA 1YLOA 2D3OR 4QHYA 1FDAA 3CP2A 1RYSA 2BXJA 1EQMA 2ZITA 2FB0A 2IBKA 1HNXJ 4ID5B 2VG5B 1GMUA 3MOZA 3TZYA 4F4YA 4TMZA 2ZZNA 4LK1A 2E1MC 2VF3A 2CPXA 3JTNA 3LPXA 2R2UA 3AD7C 1Q5YA 3FC9A 5CYMB 2IM1A 1DJ0A 2IBOA 2ZH7A 4ED3A 1X4HA 4RWWA 5DS7A 1E63A 3KJVA 4MQ9A 2NQPA 1HNWJ 1UFWA 1KK0A 2ZE2A 1JNYA 1QSYA 2OELA 3QIPB 4Y34A 2ZM6J 3WBZA 5KW9A 1UAWA 1FNBA 2IDLA 5KG7A 5C7PA 4XKWA 4NRUA 3BQ0A 4FP9A 2HGMA 3AOAA 4K4VA 3KUEA 1FWLA 4OZ3A 3PJXA 4KV8B 4B9MA 4L72B 3BO4A 2W4DA 1SVDA 4Y2MA 3BGLA 3L4JA 4X4SA 2ZH5A 4GTBA 3AA9A 3M2UA 1JLEA 4NLRA 3QX3A 1WC5A 4C0OC 2HG4A 2VNIA 5J2PA 2MKKA 4A3GC 3PYGA 4PG6A 2ZZTA 1C0TB 1HZEA 4AF6A 1SKQA 5KFPA 4A3CC 2E9ZA 4AF7A 3D68A 1SJFA 1UL3A 3DXSX 2BE9B 1IBMF 4E0DA 2DNOA 4X66J 2UUAF 4XM3A 5KFFA 2VA3A 2IIHA 3S2DK 2V6TA 2DK2A 2IYGA 1RK8A 1S1TA 2B56A 4OZ0A 3LP2A 3KLEB 5KFEA 1RABB 1WCMA 4FM9A 4F36A 4NYZA 1OY9A 1Y3JA 1T03A 4C6AA 4ZCMA 4DSJA 4U6PA 2JC0A 4DPYA 2ZC4A 4FS2A 2F9JA 4HI2A 2D9RA 1D09B 4Z4WA 4JI2F 1RHUB 4CWBA 3MURP 5C4JK 2X3UA 3ENAA 2YNHB 2C2DA 3BGUA 2WR8A 4G1QA 3FQLA 3LPYA 5HMWA 2B9XA 2FIUA 2E29A 1VLOA 4KGZB 5C24B 5KFBA 3OJXA 2MY7A 4YAUA 5C4XK 3VGUA 2B4OA 3I9ZA 1CJTA 2W2QP 3TZXA 1GTHA 1RGVA 2GVZA 1JLBB 2N4CA 2POKA 1TL4A 1ZA1B 3WIUA 2AGOA 2DYIA 2DR9A 3FHZA 1GK8A 1RHJB 2WOMA 4RW4A 4TMTA 1AT1B 3O2IA 4UZEA 3VV2B 1IWAA 2GMHA 2VFTA 2GW8A 4DL3A 4BC7A 4PRFA 1I3OB 1HQ2A 3BBCA 2NYIA 1IKYB 3IN5A 1OYDA 4G6IA 4EH1A 2OHDA 9RUBA 1FXLA 4QWAA 1S1VA 2FQQB 3OBIA 2R93C 1U24A 4DSFA 2R7XA 4Y7NC 4WKRA 2GJRA 3NKYA 4NLPA 3KKFA 2BX6A 3OVAA 2PMZL 3VZHA 2RU9A 3F73A 2R92A 1NZAA 1U1PA 2X3DA 5BR8J 3EZUA 5KG5A 2HHWA 2KH9A 3L9ZA 5FD1A 5C42B 1KWMA 2EXUA 3WX4A 2ZBUA 4F26A 1K73T 3MTJA 2FC8A 1L3SA 3TYTA 3VAGA 1S6PA 3FKIK 5E0OA 2VUMK 1D8TA 3VR6A 4I2PA 3OSNA 2R7QA 1RT4A 2O01C 1U48A 4L76A 3Q3AA 4NXMJ 2CYYA 2RT3A 2YU9A 4IW3B 2RKIA 5A2QY 4DN9A 1KQFB 3A3PB 3ZNUA 5GAGI 4G7ZA 1RQ0A 4EBDA 4RCZA 3LQVA 1DDIA 2F9DA 4KYZA 5LMUJ 2FHOB 3CCMB 5JVOA 1R7IA 4ETZA 1S59A 1VQYA 4KKTA 2UUTA 3QT6A 1YHQB 1ZOTA 4Y52C 3DU5A 1GXTA 1LEOA 3CUNA 2XI3A 3JSRA 2DR6A 5F4JA 3KOAA 2ZZQA 4Q44A 5THXA 1GNKA 2B0GA 3GU0A 1CVJA 2BSAA 3ET6B 3QAEA 2OGUA 3HOYC 2HMIA 2VQFJ 3MCOA 1T9VA 2UXCJ 2VFRA 7FDRA 4MEXA 2BEFA 3PCOB 2NVTK 3CJQA 3QJLA 3QJPA 2VASA 2RJZA 3R5JB 5KFOA 3QO9B 1ZBSA 3WQZA 4K4XA 1JXEA 1X5PA 3M8QA 1AB4A 2C2ZB 3UDVA 2E2HK 2B4VA 1FRNA 3ZFVA 5IP7C 3OP1A 4BBRK 4HIZA 4A93K 3IG1B 1D9DA 3S17K 4LSLB 3OZWA 1HMVB 1QAIA 1EB0A 1HBMA 2E1AA 2OTJB 1K0VA 3D28A 2GQ2A 4OI3A 2PPBA 1H38A 3HOXC 2VOOA 4AFFA 3DLEA 1RLCL 5SUHA 1N52B 2ZC3A 1WG1A 4Z37A 3L3CA 4LC0A 2EG2A 4C8OA 1YZ6A 1NH7A 3CE8A 4M5JA 1AW0A 3SSQA 1T6YA 4RD0A 3US5A 2IAJB 3GTQC 1WG4A 3MCMA 5FA6A 4K8RA 1R6YA 3A8IA 3CC2B 2FZKB 4X4PA 4IH5A 2OPRA 5FO1A 3MD3A 4X7FA 1D1NA 2W6IA 5IYNA 1FDBA 1WQHA 2ZXHA 3CO9A 2X6YA 3KK2A 4ZPVR 2R42A 1B2RA 1YG0A 2V4JB 2CNDA 2XCPA 2HQCA 3HF5A 1U1RA 5HBMA 2CWKA 1H8HA 4IOAQ 1YRXA 4DBQA 3X3UA 2CBXA 4DV2J 3N01A 4IG3B 1TUIA 1F5CA 2C2MB 2CNKB 3GYNA 1AFIA 4Y2CA 3BSNA 5E3AA 2F8HA 2F1LA 4QQBA 5GV7A 5AXKA 4ES2A 2XSFA 1LK5A 2Q6CA 4ZPDA 4Y9UA 5KT4A 4ZV4A 2W6JA 1J5EJ 1IBLJ 2EFNA 2MSTA 1U1NA 4Y00A 3DI6A 1SJ1A 3T41A 5KT5A 1R31A 1X4BA 1RWPB 4TLRA 5KFDA 3E01B 2W9BA 4UT4A 3CDWA 3SIPB 2NVQC 2KG1A 1H98A 4AL6A 4A3KC 1RXOB 3NXZA 3KMQA 2DNHA 1TKTB 4OI2A 2V7WA 3GJQB 3SZZA 5HMYA 1WP6A 1PC4A 3G82B 4JV1A 2OAUA 1SL0A 3IBFB 2ZH1A 3PTWA 3IM9A 2OPQA 2V63A 2UUWA 1EH1A 1Z2LA 4KPCA 3V2UC 4Y28C 3VAJA 1SJ3P 1OGIA 2VJUA 3TFHA 3DLKB 2AU0A 3PRDA 3VAMA 4PC6A 1VQOS 3OW2B 2FVPA 3SLDA 3AH6A 2BN4A 2HRUA 1SC4B 2LKZA 1WF2A 5KFNA 2F7VA 3CCJS 1O29A 3T1AA 2B7BB 3CTAA 3CQZK 2B6AA 5FL7A 2J7WA 4C2MK 1YDLA 2Y1LB 4WJ4A 2IC3A 1SC1B 2JA5K 2DJWA 2HVEA 1TU0B 4UUXA 2QLXA 3F0NA 2R7SA 2IMWP 3R7BB 5GMEA 5HL7Q 5D78A 1QTNB 4GVLA 2HVIA 2JDIA 4DFKA 3G96A 1I3QA 3MR5A 1SV5A 2IRYA 2ZZGA 4F4XA 1S0UA 4NA1A 1HNWF 3M30A 3PEJA 2R2SA 5CYQB 3MFHA 2ZM6F 3MFIA 2LMIA 1DLOB 5KFZA 3QGIA 1I50C 4DCJB 2KG0A 3QSYA 2JVRA 3GG0A 3KL9A 1KP6A 2HWIA 1F93A 3M8SA 4MIWA 1K73D 4LF8F 4KHPJ 2GIQA 2YX1A 3F41A 1WHWA 2ADCA 2XMJA 2MJUA 2OEJA 2LQ5A 4WFYA 1MABA 1RWNB 4PG7A 4ICLB 1OHHA 4NA3A 4ZLPA 4NOHA 2V7XA 5MLCV 1HNIB 1S9EB 3IGNA 4EEYA 4DS4A 4DV7F 3PENA 4R0JA 5K8MA 2QYGA 2I6WA 1GAQA 1N88A 1HBNA 3Q89A 2HIYA 2YNFB 1VC5A 2WVDA 1NPKA 4C11B 1WORA 2I8EA 4DF8A 1SPBP 4X66F 4F7DA 1NK9A 2Q6OA 2CJBA 4JUZA 3JQJA 1KVJA 4ELVA 2V2KA 2VODA 4DPWA 5DM7Q 1WUUA 2VZLA 2J6UA 4CLWA 4ZVTB 5HP1B 1LWEA 4CLSA 1SXLA 3HOUC 1HPZA 5CZXA 3PIPQ 2A18A 3DRSB 2QC3A 3PZPA 5TR9A 2HW3A 1SKUB 1B4SA 1NSKL 3SYZA 3JAMU 5A88A 3FRZA 4GO7X 1SFOK 6FDRA 1QGYA 3OR1B 4C8MA 3BP3A 1RWKB 3VVUA 2YWWA 5F9LA 4ZIVA 2F8EX 5C44C 2QG9B 3W2WA 1U02A 2OFHX 4TKOB 1U2CA 3OR2A 2CVEA 5IORA 1TUWA 2PIAA 4LRDA 1N33F 1I6HK 4ICLA 3TVKA 5EDWA 2E5JA 3GTMA 4RD3A 3IP0A 5D0HA 3TEHB 2BPOA 4S0MA 4TY9A 3AGQA 1K83K 1FT8A 2NREA 3LWLA 4WZEA 2BACA 1GX5A 4A46A 4ZVRB 1FKPA 5IT0A 4FF4A 2E2IK 5FJ8K 1N56A 2W4CA 3HCXA 1VS3A 4C97A 1J5OB 5CCMA 3MMBA 3PKYA 3TA2A 3OUYA 1RADB 1XEZA 3Q83A 4DV3F 3GTPC 4JMQA 1QVFR 1LW2A 4G6VB 4A3LK 2Y0SD 3QLHA 2B63A 1NKBA 2CPFA 4PUOB 3V81A 3SJZA 5BR8F 4FF3A 3ASSA 3MEEB 3MMCB 4QU7A 5A0YB 2M7SA 2AYGA 4MJKA 4UQTA 4URQU 3ITHA 2VC1A 2FZCB 3MPVA 4PEOA 5K20B 4B9NA 4AT1B 3GQCA 3IS9A 3T5LA 5A6PA 3CD7A 4Z1MA 3HULA 4NXMF 3PR4A 1BUXA 3ZNJ1 1TWHC 4ZKAA 1GMWA 3VVTA 1U49A 3NRBA 3OXFA 3I4HX 1RTDB 2EFOA 1COWA 3QWUA 5IWAJ 1F60A 2NVYA 3GTJC 2X1FA 4Q0BB 4RL1A 3TWZA 3U27A 3S1RC 2P9GA 3MR2A 1HQEA 1GAWA 1URNA 4FZVA 7FD1A 2V2ZA 2XBPA 1VQ7S 5IOQA 3KHRA 3W2VB 2I2YA 1SC3B 2KKHA 1E1RA 3HHLD 1XMQF 1R89A 3BF4A 3MM8B 1HVXA 4LF2A 2JH3A 1FRXA 2G2ZA 3ILIA 4IOBA 4EMDA 1YNNA 1VQ5S 2QTLA 2K7KA 2VQFF 2Q43A 2KJVA 3HVTA 4C8NA 2ZDPA 2ZUGA 1RI7A 4YALA 2GX8A 1T3NA 2HFOA 1OB0A 2C2KB 4NLTA 1RB0A 3J81U 1PAEX 4KC6A 1NXIA 2IY5B 2JOQA 1EZZB 3JYTB 5TRDA 1GFWB 2CRVA 1HARA 4BBRC 5I3UA 1FK9A 4ENOA 4OPSA 2F3JA 4LF6F 4YFXA 4OIPA 1IUJA 5B6IA 5CA5A 2ZKUA 4CZCA 1MWQA 4J3NA 2Z2LA 1JLFA 3GYGA 2D74A 2JJ1A 3MF5A 1U7LA 2VPYB 2R7TA 4WIIA 4G7WA 2PI4A 3LO3A 3IWLA 1Y0RA 1YX2A 1W25A 2ZBQA 3KLGA 3G8SA 4K5RA 4P26A 1A6LA 5IYWA 2DGWA 2V9WA 2JA7C 2MKSA 2XCAA 1LXNA 2W7OA 2HMAA 2CNOB 2RVJA 4G1PA 3QSIA 5LSLA 4A3DC 1RWOB 2HCJB 1KQSB 4XLNA 3LGNA 1LW0B 4YR2A 1OJ4A 3BO2A 3MEKA 4OZ2A 1ZBTA 2DCUA 4UZBA 4UY85 4FXVA 1B70B 3TFJA 1YJ9S 1BJKA 4DV2F 4BPRA 4DV4J 5KNLA 3K5MA 3DGPB 5HQLA 1TKZA 2M70A 2LEBA 3DHXA 3KK1A 1WKJA 4RDLA 2XI2A 1H2UX 4C8ZA 1C1BA 2OTLS 3DM2A 2QTZA 4HDHA 1JXLA 4DR6J 2C5HA 3OKXA 3BR9A 1RKJA 2CQ4A 4XLPA 3RJMB 1VQSA 3DYAB 5B7WA 2VNKA 1EFWA 2E9RX 2CFXA 3NGTA 5E3PA 1TFWA 4JI3J 4JV5J 3DOMA 1YRTA 2NXEA 3OJSA 4X64J 2BE2B 3HHEA 1R9TC 3GV5B 9ATCB 4P72A 2CXEA 4G0VA 5AXNA 2ZH2A 4DR5J 3N3YA 1TV6A 3SDEA 5HROA 1BMFA 2B5JB 3POTB 4KH0B 1FEEA 1AIPA 4IFYB 1VHIA 1RBLA 4YN3B 3P6YC 2CA9A 2R7ZK 2A68A 4PC3A 1VBKA 1Y1VK 2K3IA 5IQQA 3KNAA 3MEGB 3M6UA 3WC0A 2PHCB 1UVLA 2OO4A 2Z2YB 4M5NA 1RTJB 5EWFA 3FBCA 1MNEA 1F3FA 1C2PA 3D6FB 2V6AA 5HQMA 4KB4A 1V3ZA 2VBUA 3PFOA 1JLQB 5J1NA 3EE3A 3CCLS 5J2NA 2JA5C 2HHPA 3H42A 3N9UC 3M1VA 2LP4A 3BJYA 3OL9A 2IA0A 3K8WA 3GEEA 4DX6A 3GTLK 2LQ9A 4KE5A 5JJBA 2VU5A 1GAOA 3K59A 1VGXA 4GRSA 5DDPC 2E5GA 4A3JC 3JSMB 3PO4A 3MDFA 1P6TA 4DR3J 3MMAA 2W2PP 3BGOP 2WK4A 1VQMB 2I9SA 2Y9HA 4J7CA 3K17A 2QEXS 5D3GB 5T7LA 4KN7A 4WU2A 3G6XA 1S1UA 3M4OK 3TVYA 3C14B 3D5MA 4KHPF 2BOAA 3ASRA 1K0TA 1HNVA 2V5HG 4O44B 1HHSA 3HX9A 4BBYA 4P71A 4LF4F 3G6EB 2EWHA 3BR8A 5IK2A 3CW2A 4IFVB 4ZLNA 1VQKB 3MR3A 3S1MK 1AZSA 3FNNA 3U1NA 2HIQA 1RHMB 2IDEA 1C0UA 2FQTA 1NK0A 4R0EA 2E5HA 3AQOA 4Q7AA 5F0WA 3RBZA 4WE1B 4CDIA 2B51A 2OKQA 4LQYA 4FVCA 2XOKA 2D3LA 2HLTA 1BHNA 2K1RA 2Z4PA 2X1AA 3A13A 4LFBJ 3UQSA 1EP2B 3G71S 1DQAA 2WJYA 4O3RA 1DFDA 3DLLQ 2HHTA 1IKVA 1EJ7L 4DQRA 2HWTA 3NNCA 1BQMB 1GEHA 4WK3A 3GTOK 1QAXA 2RB7A 1V5VA 5K8PA 2MZSA 1N32J 1R5NA 5E5NA 1TVRA 3ETMA 3KEWA 5D3GA 4FNHA 4YB5A 2Q79A 3R1LA 3M6WA 1FRKA 4OYAA 5E3QA 3QPIA 1TAQA 2CJXB 2NPIA 2F4FA 1VQ9S 5IP9C 2HNDA 2CPYA 2M52A 1UJ4A 4K59A 5M2PA 1R8HA 1OY6A 4DQQA 1Q7LB 4ZVEA 1I1GA 1J98A 3BYRA 1FVSA 4V19J 3WC2A 3GYXB 2IRUA 4XNFA 2OP5A 2PA8D 3BYPA 1FERA 1Z1ZA 1H2VZ 4KSEB 3SV3A 1XK8A 3MAHA 3R5DA 4RJVA 4QIVA 2DIEA 4OZJA 3E2EA 1U0HA 1G4CA 4CH0S 3CMAS 1INNA 2HKEA 2F1MA 4I2QA 3OD2A 1ZM2A 3SQGB 1E6YA 4A3LC 3ZC3A 2XZOA 4MKVA 5ETKA 2ZNYA 2IJFA 1JMTA 2PFDA 2ZVIA 4L3NA 2GFFA 2D9OA 3I55B 1XNRF 2B43A 5TMCA 3IMQJ 4ED5A 1TQLA 1TAUA 2RC5A 2GHVC 1IR1A 5E41A 4NXNJ 1P27B 4H4OA 1W26A 4GMKA 4XLEA 4YDXA 5J2QA 4D3HA 1X0FA 3KLHB 1B7YB 6FD1A 1Y4ZB 1RWXB 1JKHA 3TUPA 2HS0A 4FBUA 4WXOA 1RT5A 2RSQA 4K4YA 5CHCB 3J80Y 4K7QA 5I42A 4KDDA 3CEDA 4KFBB 3QYYA 3MM7A 3H8YA 3UD5A 4JK1A 2YKPA 4E98A 4XAKA 2DY1A 4YP3A 5A8AA 3EZOA 2GMJA 1NK5A 1Y7PA 2R9VA 5DO2A 4KGVB 1NHKL 4I6WA 4OYPA 3MTKA 4HT5A 3QZ7A 3L4KA 2ZH3A 3MR6A 1N05A 5CXTA 2GQFA 3CCUB 1RACB 2CFAB 3Q23A 8AT1B 2UVVA 4PG4A 2HHUA 4CO1A 5ADZA 4R5PA 1B0VA 1TWAK 3H90A 2KXFA 3QFWA 2AYBA 1RKIA 2C2RA 2GNKA 4B3FX 3A8JA 1LFWA 3W66A 5DLGA 2RDIA 4N8OA 5H9EK 3QGPA 3HSDA 3IXQA 1XQBA 2OD4A 1Q8IA 3ILLA 2H65B 4ZCKA 1Y0HA 5A6WA 2YWEA 1RAAB 1BE4A 3TAMA 1XZPA 4J9MA 3IR5B 4TKTA 1X5TA 3CCQS 1TUVA 5DDRC 2HHXA 4Q5SA 3NGUA 2LU2A 5JXSA 3A4TA 1W0KA 4DQLA 3U02A 1O2AA 4CLUA 4Z4UA 1REVB 3D6TB 4RW6A 1P1LA 3CNQP 2JA8K 3MM5B 3B54A 2ZZEA 3CCWA 5BYSA 4GZYA 3DDKA 3IBCB 2KU7A 2DISA 2FGOA 2MQMA 3HOZK 4Q2LA 1FX4A 2DB1A 2VJJA 2NUHA 4EWTA 1HBUB 4J9OA 5IYDC 2CPJA 4XSZA 2WAQD 5J2MA 1R0AA 4EBEA 4DI6A 3W5YA 2BYCA 4GKJJ 1NBMA 3SI8A 3ZZ0A 4O3OA 1T9WA 3UI3A 1W2IA 1UA1A 1WHVA 2XMAA 3TZZA 4LR8A 1FDRA 4KKOA 4ECVA 4O4GA 1N5YA 3JU4A 1VCTA 2WW8A 1EX8A 2AD9A 4B3MJ 2R93A 1TLLA 2ZJRQ 3FGVA 2LU1A 4RNNA 2HNZA 2HRYA 3M8PB 2VFVA 4PWWA 3KHGA 4UOFA 2K3KA 5EGHA 4DV4F 2VHGA 3OL6A 3IA0A 4ILDA 4GT9A 2M5SA 2GGPB 2ERRA 2AIRB 3UWTA 1DTTB 1DCOA 2OJ3A 2Y0SL 3I0RA 2R8IA 3FSIA 4DR6F 4KQZA 1J2VA 2K06A 4QZVB 1UD5A 1VQ4S 2HBYB 3W61A 2ATCB 3LP1B 1D0EA 1N5VA 3IRXB 4NI2B 4Q7JB 4IOCQ 4DUYJ 3NCRA 4JV5F 4JI3F 4Z7YA 3ZZTA 3CCZA 1IW7A 2E7VA 3J81k 2G0JA 5A8WA 1VRTA 3MPUB 2KRBA 4X64F 1IR0A 3ASPA 4U8VA 2IPOB 5A8RB 1TWCK 4NLSA 1RT1A 4DR5F 3EPIA 3W64A 4ES1A 1K8AT 4OOVA 4GTAA 2AQ4A 3LNNA 3OSPA 2L3MA 3VZIA 4LR2A 2XZDB 1BX1A 3RY8A 4K0KJ 2JEJA 3LF0A 4HH1A 4FN5A 3PACA 1VI7A 3H5XA 1TL3A 2FLPA 5IOSA 1YVFA 4C3JK 3CCSS 2VG6A 4YB7A 2ZBRA 2ZWPA 1S1WB 1GXUA 1ZVUA 2DPJA 1JJ4A 2XMUA 4HTJA 2Y1RI 4LBHA 4P25A 2AYMA 4AQYJ 2HK2A 5IT9U 3OXLA 2SXLA 2Y8WA 3OEEA 3AGPA 5IYCC 1O8BA 2HQ3A 4KGXB 2CUYA 2ZJPQ 1DG1G 4L8JA 1N6QB 3R5CA 1KLNA 3OXGA 4Q45A 1NDHA 3OT9A 2D3O1 4PXBA 3W8PA 2CQHA 2GAGC 1KTVA 5J1EB 2KI2A 3S16K 2RHSB 2Z58B 4C7QA 4BY1K 2OPSB 2Y0BB 2VPXB 1BQEA 3IM8A 1DTQB 2PN6A 3V4GA 5L8RC 3G2XA 4ID8A 1ZUNB 4ERDA 3GTQA 2XTJP 4C8KA 1HWLA 2EFQA 1S57A 2VJVA 1OY8A 2Z2ZA 4YEAA 3U1MA 1QVFB 4RR5A 4FK8A 3Q3QA 5AT1B 2QZ8A 4DV6J 2JHEA 3BCFA 2YXLA 4E2FB 2B8QA 3M05A 4KM9A 5D0EA 4DWIA 4QWBA 1Y00A 1SBRA 2HFVA 3GWCA 1H6KX 4BWJA 3UVJA 5CDFA 1CJUB 3EYZA 4LFBF 5KFWA 2FVCA 2OBRA 2MQLA 3MM9B 1FVQA 1NSAA 1ZM9A 2C5BA 3GTOC 4CYUB 2GK6A 3C15A 3IR7B 1VIOA 4OIXA 1T05A 1S1XA 5FJ4A 1RTHB 3NBPB 4IKAA 3BSAA 3OAAA 5HVGA 2X8KA 3HM9A 3I6PA 4ILRA 4ZPBA 2RRNA 4U8YA 4F0MA 5IV4A 1N32F 1ICEB 1UKUA 1V9OA 2FHJA 2QRRA 3BY2A 1NB2A 1IWGA 3KFWX 4H54A 4DR7J 5K14B 1VK3A 1N54B 2ASLA 4QFMA 1NAQA 2Q6IA 5GAHU 2Q66A 4KO0B 1I6JA 2MGZB 3S0XA 1X8DA 4L75A 2LXIA 5J1EA 2AZ3A 5LMNJ 4F4ZA 4B3OA 4X7DA 3W9IA 1R8CA 3I4MC 5IOTA 2C1EB 1TKXA 3UR0A 3A3OB 3T5HA 3S2HK 1B23P 1N0UA 3PUMA 4WP8A 1RTIB 4CNZA 2BRKA 4KAIA 4JI1J 3UE2A 4ZVGA 3PM9A 3SKBA 2HFNA 1XXBA 2R3VA 1XB2A 2WPDA 1O5JA 2Q6KA 2V8GA 3OPKA 5KFKA 1JJHA 3QRPA 4M95A 2HS4A 5IYBK 2CAJA 2VBWA 5KFGA 1JLGA 2QV6A 3CO0P 3AOCA 2F65A 5DQIA 4B48A 4L73A 2GVDA 3KG4A 2YH1A 2IMOA 2C2EA 4AXJA 4DUZF 3BKFA 4K2JA 4IR9A 2CPDA 5ETSA 4QWEA 2G9OA 4NL5A 3GTKA 3KLFA 4NXNF 1NHVA 1UMKA 4C3IC 1EETB 1VLYA 3RZDK 2QN6A 3KDOA 2ASDA 3CT9A 1WCMK 1DHMA 3I0SB 2IVFB 3GTGK 1I50A 1YNJA 3O8WA 3ZBTA 1SL1A 2V7VA 1YIJS 2LECA 4BY7C 2JEIA 1A9NB 2V50A 1SB6A 2VB6A 1YGYA 2AV5A 4CTAA 2H54B 3OLAA 2QL5B 3GVKA 2DO4A 1MU2A 2VV5A 3HKZD 3HO1A 2BANB 3TUJC 1KFSA 1RT3A 3FRYA 1C4AA 5H59A 2X1GA 4P9SA 3VGTA 1RU0A 2A2CA 2XY5A 4E8UA 4CH1A 3ADAC 4HHHA 5DSZA 1AUSL 3H2UB 5IYRA 3WX8A 4J9QA 1K8AD 4A8WA 4II3A 3V6DB 5KFXA 2QMXA 5ETNA 1HR0J 4C4WA 2KRRA 3CDBA 4MAKA 3BGRA 1G6BA 1VH2A 1YJRA 1B4AA 4HE6A 2YWKA 3GDZA 1JQGA 1KKHA 4MFBB 4M1XA 1VQ6B 1UVIA 2KM8B 4ZN1A 2J76E 3VR1A 2RD5C 3TI0A 2RUSA 4DPOA 3GILA 4I6AA 1AB8A 2KXNB 4RPFA 3FUYA 3PA2A 2YNGA 3ENVA 3TUZC 2JA8C 5HLFA 1JLAA 3M6VA 4O3QA 3WYAA 4DR4J 5U47A 3TX8A 5DQHA 4RW9A 1VQOB 2B7CB 4LMZA 2WBRA 2DIVA 3HOZC 2COLA 3A12A 3Q24A 1BC6A 4DG1A 2GJKA 4OI0A 3PXGa 4PZVA 1DQ9A 4ZDNA 2FVQA 2R92K 3RZOK 3CCJB 3PR5B 5H9EJ 3TEGA 3DOLB 3CC7S 2AWZA 1T8EA 3CC4S 3M2RB 3MAAA 2JLGA 4M5IA 4PABA 4QV2A 1WKLA 4M4SA 3VQTA 5KG4A 3K7RA 2FUG9 2N3OA 4GKJF 3CPWB 2HBZB 5M5WK 2PMZD 4QU6A 1M5VC 2ZHBA 3HPOA 4CLFA 3HOWK 5G0RA 1SUQA 4X4RA 4WFBQ 3J7AN 4IR1A 4USWA 3G9CA 3M8ZA 3WNDA 1S48A 4LF5J 2YU9K 2K2PA 4LQ9A 4X06A 1QUPA 1KRHA 4P1VA 3CCES 5JBQA 2PA8L 4C98A 1NK8A 3DMJA 3QFRA 1T3OA 4XL9A 1FRIA 3GTPA 4WYWA 3J7A1 5D4NA 1JXVA 1RAJA 4C0BA 3BN4A 1F20A 1IJEA 3ISXA 4Q2MA 3UN3A 1Q78A 2BQ3A 1ZYRA 2GSNA 4NLDA 3GFZA 2MLZA 4MKBA 1YZ7A 3NS6A 1X0PA 2I5JA 1EP3B 5DZ7A 4ECRA 1S6OA 3VO1A 4KC5A 1OB5A 1LWCA 2HNYB 4ZIWA 5CYJA 2XLKA 2BOPA 3QFCA 1X4AA 1MMNA 3WZ0A 2YKMB 4DUYF 4BLGA 3TJ8A 4ECUA 2M4MA 4F7VA 4QR2A 3I82A 3FFIA 1TWHA 3DXBA 2E2JK 4LFCJ 4ZS6A 3I4PA 2FTRA 1D8YA 4Y2IA 1KC8T 2JIZA 5CHPA 3G8TA 1GO2A 2PFFB 1SCJB 2WVCA 1ZM4A 1IBMJ 5E7OB 1PJ7A 3V4IA 3S15C 1ZETA 1XBWA 3QATA 5AE3A 2UUAJ 4WPAA 2W01A 1NCLA 1W2BR 3GTJA 4N56A 4XKVA 2CDQA 2MKJA 3ONYA 3QGGA 4RWXA 4A8KA 3RW6A 1LWFB 1HLWA 2O66A 3VF0B 5JMNA 2XULA 3DRRB 4IG0A 1N06A 3OW2R 4PQUB 1I94F 5B0FA 2IVYA 2RUGA 5FLXY 1VJSA 1V0FA 1KJZA 1UVKA 1EK8A 3MUMP 4XQFA 3OHBA 3CJKB 3RB6A 1XIQA 3D6MB 3P4UB 1HD0A 2P3MA 2QSFA 1VRUA 2V2VA 3H59A 1CULA 4OINA 4RCYA 2NSCA 4RNHA 4AQYF 3CRZA 1R6VA 4UTGA 4CCHA 4LQ3A 1NJIT 2ILZA 1O51A 2MTLA 2N7CA 4P75A 1T6XA 2VBSA 2M8HA 4B02A 2QMWA 4PKDB 2ZTNA 3S14K 3S16C 3PX4A 2AW0A 1KMHA 3QGHA 5HQ8A 1JNRB 1PC5A 4LFAF 1PBUA 1BGWA 1VRQC 4BDPA 1HBOB 1MWYA 3IGVA 5FLMK 1T5EA 2BMBA 1OQ3A 2LA4A 3CPXA 4UW2A 1IBKJ 1NJXA 2OLWA 1P4MA 2LEPA 2JA7A 1B99A 4XN0A 3VNVA 4ZJQA 4LT6A 2DHXA 2WAQL 3CCRS 3UPFA 4LF7J 2B3TB 3G4SS 2XS2A 4CT9A 2MQOA 4FZBA 1CC8A 4H4MB 1PYSB 2Z57B 3V6HA 3MM6B 4DV6F 5KFAA 1S10A 3GIRA 4NBSA 1MLAA 2RAQA 3D1HA 3J7Z5 3SEJA 2DH9A 1QUVA 2BRLA 1H0HB 3K0JA 1WC1A 2R6HA 2ZD1A 3EDQB 3RU0A 3B82A 2QA4S 1YJNS 1FCAA 2OSQA 2BVNA 2L48A 3I4NC 2WB1D 4AVZA 3MUVP 1V0EA 2W4PA 4U7CA 2DXEA 2JA6A 4Z2XA 1RT2B 4QVAA 2IRXA 5F8LA 4OMFG 4JI7J 4J90A 1MSWD 4PC7A 3OPFA 3SCLE 1VQ7B 4F3MA 4DR7F 1JA0A 2A6MA 3KHHA 1AA1B 1R9TA 2NSBA 3HLUA 1H3DA 4KB7A 4Z4TA 1FNXH 1VQ5B 4IDKA 4DN0A 1I3QK 2JWNA 2C2WA 3HHLB 3OJUA 5DLFA 1LWXA 4NMLA 4WJBA 4G7HA 1AROP 2G0CA 1X9WA 5HATA 3NP5A 1E79A 3PG9A 4ZCLA 2VG7B 3M9MB 2WSSA 4KM8A 4P2MA 1S7HA 4QPTA 3W62A 4PPZA 4JI1F 3QRRA 4ECQA 3CJ3A 2PC6A 2P5MA 4QW9A 4HDGA 1VFJA 1RCOB 4X4QA 4OOSA 1HFEL 2KTQA 2J9CA 4UOCA 1Q8LA 1O26A 3GCWP 3UFCX 1NEEA 2UXDF 3D26A 4DFMA 3QWPA 5C2CA 3GR0A 3EGVA 1C1CA 4NCNA 2C4UA 4QYZJ 3RZAA 3RZDC 1X5OA 4OPVA 4OJHA 1CS4B 4RW8B 2OMLA 1DDGA 3GTGC 1EFTA 1ZQ1C 3BN7A 2VKRA 4F67A 1FE4A 3NCQA 3UNYA 3BKTA 4ALZA 4NZ7A 3P96A 3V5RA 1M90T 3KJNB 4FVMA 3F44A 2LQBA 3AD9C 3BSOA 4Z4YA 3ZBUA 5EGYA 2CPEA 1RBAA 3ZZYA 2FVSA 2XC9A 2DNMA 5MAOA 1LQ9A 2YKNB 1UPPA 4A3IC 3P27A 3WY9A 3T9ZA 4WXWA 3LH2S 1TL1B 3T1HJ 3CULA 1YJ9B 3N5BA 2WONA 2JFKA 1FX2A 4CO4A 1WD6A 4WWVA 4EGLA 2V2QA 2JLFA 3ILOA 2YVSA 1EQRA 1OB2A 3DNCA 3R5GA 3W9HA 1WTBA 2HBRB 3JSYA 1HHQA 2D7SA 2OTLB 3Q8YA 1QM9A 1XNQF 1KC8D 3T9NA 2OPPA 1VBXA 2LLZA 5HL8A 1CSJA 3IFEA 2XG8A 3SXLA 2LXFA 4U96A 2NV4A 4J0QA 4M5DA 5DG8A 1I18A 4A3FK 3JQMA 3GTMK 2FJDB 4JB8B 2QMUB 1IB0A 2JC1A 4DL0C 2Y1JA 3NUHA 1PKUA 1Y9OA 5KFMA 4B08A 2LFVA 4AYBL 2ATLA 3P3DA 4OHVA 4KIAA 5L46A 5F8IA 3OFNA 1IHMA 1D8ZA 4TXSA 3ONUA 3ISND 2UU9J 3KHLA 4DFPA 5IM0B 4YY3F 3KK3A 3D67A 4URSA 4M1KA 1RAHB 3VHQA 2ABYA 3CDEA 4USKA 4ZP7A 2C2NA 1VQ8S 1X9SA 5M3FK 3ASTA 4TU9A 1WOSA 4PYDA 1TP7A 4GKKJ 2KB2A 1NJID 3OTOJ 4B9TA 2B63K 1SM4A 4IQMA 4HACB 3CCLB 3JQRA 1ZM3A 2XO6A 4ZLLA 4NRTA 3KLIA 2QL7B 3HFKA 2AT1B 4FYXB 3B8HA 1RUSA 2M0GB 2J0QD 3ILJA 2HPUA 1GVHA 2BGJA 5C25B 1KK1A 2AJ0A 5LXYA 2BQRA 1O27A 5F4OA 2R8HA 3JSTA 1GE9A 2BKNA 2DNRA 2EEYA 4ECYA 4DL5A 3M32A 4ES3A 2YU9C 3L7OA 4ZPWR 2NXJA 5C5JA 1P9QC 4O0IA 5F4MA 5F8GA 5D4OA 4U95A 4KMDA 3S01A 2QEXB 2BF4A 4F8RA 4LF5F 2IYIA 4C3HC 2FJAB 3IC1A 4CRJA 4RU9A 1KQSR 5G4DA 1NUEA 2LQ8A 1RU1A 5L38A 4JI4J 1BLUA 1S6QA 2G1HA 1YTYA 3LW5C 2V0NA 2XHWA 1U1MA 2HAIA 2NVYK 1IKWA 2X3GA 4RW7B 4FXDA 2EBEA 3AJDA 3BDPA 4DQIA 1E3XA 3RGIA 2DPIA 2ZEJA 4P6YA 4LF8J 4BLBA 2FQOA 1IS1A 4P52A 3N6NA 2JJ4D 2J9DA 4A8XA 2PEHA 3EGNA 3M9NB 2YNIA 4R8UA 3T56B 3SCKE 4FYWB 4TSFA 2ZH6A 2UVUA 3NOCA 1WF0A 2BR0A 3EGZA 4DHVA 4A3BK 3TNVA 2I38A 3HHDA 3WDOA 2A2DA 1S77D 3I96A 1PYOB 3B78A 3C16A 1KNZA 4WKYA 4OZ1A 4RNOA 3EDRB 5FDLB 3BPDA 4DV7J 2J8SA 3G71B 1EAYC 4DOZA 1QSLA 3CF5Q 1YI2S 1HI9A 4LFCF 5F0UA 3SLNA 1PG5B 3RB3A 3QQCD 1Q0NA 4TN1A 4ID5A 2ZKTA 2ZTGA 2Z0GA 2VG5A 1U6BA 3HKZL 5K9FA 4XPCA 2W7VA 2CDRB 4GQNA 2DBBA 2CZ9A 2Q6LA 5CYMA 4M53A 2DY9A 1FHTA 5HXBA 3CD6B 1KONA 3AD8C 2YWHA 2PDAA 1F2GA 4ZMMA 1X4GA 3S1QC 4EU0A 1E6VB 3LP0B 4IUFA 3Q39A 5FO0A 1BD6A 4RBTA 1VQ9B 2A6HA 1BDFA 4OYWA 3QIPA 4OYZA 4A47A 2C3YA 4K5SA 4WBFA 3WBKA 3SQOP 3CDUA 1F7UA 3PKMA 3G8QA 2HFUA 3H4DA 2DETA 1W7WA 4TQRA 4RUBA 4KV8A 1V5IB 3S14C 3NWGA 4NEYA 5CQGA 1CNFA 4DL6A 2J7UA 1N33J 1CC7A 4WZQA 1HQUB 1M1HA 1FKAF 2C77A 2W2OP 2DHHA 3CMAB 4PG5A 4XLHA 2FYXA 4B3TJ 3VQSA 3SCIE 1C0TA 1UTAA 1L5UA 2MKIA 2X53S 1O2FB 5ETOA 1GQEA 1M90D 3PO3C 1N8RT 1IBKF 4ED4A 1SKYB 2Y8YA 1A0OB 3DRXA 5ETQA 1WQFA 2B5OA 3PYDA 4J9UE 5KFLA 3UCUP 4OJ1A 4PC1A 2J0SD 1U26A 4FDFA 5JFEA 3HFVA 3KLEA 4LF7F 1J6XA 4DV3J 4ECZA 3C6UB 3CMES 4BXXC 1YITS 1WACA 4M94A 3CJ0A 3TJAA 3DLHA 4DEZA 3P45B 4ZGNB 3GE9A 3N4WA 2R7RA 2HZVA 3MECB 4AC9A 2ZBPA 4I68A 4ECTA 3EMTA 5D4LA 4V19X 3GSDA 3MWBA 2YNHA 1HI1A 1JWWA 4J5OA 1P9YA 3T5KA 1QH0A 4XOTA 1ZH5A 2RU3A 1GMWD 5C24A 2W2NP 1TK8A 1F2HA 1RAEB 1QTMA 1LFPA 4DQSA 3HSGA 4CNYA 4XMYA 2XZLA 5B0BA 5KFJA 2WJVA 1Y1WC 3FMWA 4Y3CA 2IJNA 4HHUA 2CW5A 4KH1B 4JI7F 4OIQA 2OSRA 3OOCA 4QCLA 3DDNA 1JLBA 1RT6B 2GZOA 1VGYA 1WC6A 2OEKA 2KVIA 2XNJA 1FKOB 3K5OA 4L6V3 1KOOA 1XZQB 4DV1J 1ZS6A 1T9TA 1XPPA 1TZ0A 3HOVK 2DYAA 4UZUA 1G7SA 1KQGB 4ECWA 3NY0A 3K7AC 2I1LA 4QJVB 5J1PA 1GXLA 3TA1A 4K1XA 5I3PA 4ZP6A 4G1BA 4K2XA 3OREA 1IKYA 2EC2A 4L3KA 3CCQB 3PFEA 2V6UA 1XMQJ 3CJ4A 5DG9A 1TWFA 4PXCA 1PYTA 5D15A 4W92B 3J7YU 4B4DA 4URGA 3BQJA 4DU8A 2MZ1A 1X4EA 1LKZA 4B43A 4UF4A 3MMJA 3G4AA 4TY8B 3HVWA 1B7FA 3U7JA 2VDIA 5KG0A 3FSXA 5C42A 4HR2A 2YX4A 3I5CA 2P6TA 1JLCB 2CK3A 2CZVC 4EFAC 3EZ5A 3TR5A 4YG2A 4LF6J 3RBEA 3BZQA 4FXUA 4JOUA 4EZ9A 2QLBB 1I6VA 1FDNA 4I7FB 1HYSB 3OTEA 1B3TA 1YJ7A 2JSXA 5K8NA 1CJKB 2O3DA 1Q5VA 2DHSA 4P2XA 1V6HA 3J7YI 1LOUA 3D66A 2ZL5A 2W2MP 1KK3A 3U6KA 2DR7A 2ALZA 1WKKA 2G0IA 1BQNB 2BE7D 3HKWA 3VAHA 3M3YK 4NMXA 2PMWA 1QSSA 4DK1A 2CPIA 4XDCA 1XFOA 2H3EB 3T1HF 2JFDA 1SKRA 5LXRA 5KG2A 2HURA 4H4KA 3D1QA 1NKEA 1UWBB 1JQWA 2W8KA 4H9GA 3HD1A 2C42A 1UD3A 4DR1J 4F04B 2RQCA 3FJOA 2VBZA 5LM7E 4RNFA 4KMAA 1PCAA 2DGXA 3SSSA 3R1HA 3LAPA 2QIFA 3NNHA 3ET6A 4ED1A 4O3SA 3OFEA 2JEGA 1TL7B 3Q8VA 2GQCA 2FHMA 4USTA 1VQ4B 3X1LB 3UCZP 1FRLA 2BA9A 1HNZF 3DLGB 3H5YA 1MROB 5DJBA 4A3MC 4DU7A 3WNBA 1YSJA 3QO9A 1N36J 1BJTA 4G3IA 1QJHA 1XR5A 3C19A 4P3IA 1WU8A 1NDCA 5KG6A 3GTOA 2QLJB 2F40A 1J9ZA 1ACMB 4ZHRB 5IXUA 2Y3PA 3K5LA 2J7KA 5CABA 5T14A 2V68A 3D6HB 2XYHB 2OD6A 3IG1A 3M2VB 3DDYA 4LSLA 1S6UA 4C43A 2UU9F 1HMVA 4ZP8A 4TVAB 1IKXB 3AT1B 2RILA 3U1LA 4B3SF 2DOGA 1M1KT 5IYQA 4ANCA 4ASUA 1DQ8A 2WB1L 5DQGA 3AQPA 1KEKA 3ICLA 4UZFA 3W8GA 1W2BB 3HHNB 4GKKF 2HGLA 1DD5A 1C0AA 3OTOF 1HW9A 2HS3A 4DX5A 3LAJA 1K28D 2GJ2A 2IAJA 2FJBB 1JA1A 3CCSB 1KLMB 3W5ZA 3ES9A 2XSJB 2RC6A 5F8NA 1EARA 3AOBA 1VYAA 1S49A 1CJVB 2V4JA 4UQGA 1N8RD 2KHCA 3LAMA 4OI1A 4NX9A 3PNIA 2QLFB 4B44A 3GVLA 4Z4VA 2CPHA 4IG3A 5HO4A 2Q1LA 4K4WA 2C78A 4CLTA 1VHEA 1AFJA 4OQJA 4K4ZA 1Q82T 3GIIA 4JI4F 2XEXA 4KTQA 4NLOA 2ZDOA 4A3GK 1ELOA 2DRDA 1QE1B 2XNCA 4OHYA 4PXEA 3D0GE 4XDDA 1O25A 1NKCA 2XHCA 3K89A 4LIRA 4NCGB 4ED6A 1FFGB 1R43A 1K9MT 1KQ4A 3E01A 2VH7A 2KN4A 1YK9A 4ECXA 2VKZG 1SQEA 1T6ZA 2GC8A 2MZJA 4OI6A 2GJFA 3DOKB 3RUBL 2F4VJ 1TKTA 4DPUA 4IRKA 3FBFA 3NL0A 4A3BC 5DDOC 4Y0FA 3G82A 2W9CB 3ONQA 4LF1A 1VJQA 4LF4J 1BPLA 3U6BA 1U09A 1TTTA 4I1TA 1VQPS 4ZOSA 1TMMA 2ASJA 1S72S 3PW2A 4OPOA 1F1BB 2JVOA 4Y6IA 4LSNB 2WSEC 2LCWA 3SSRA 3K57A 3DLKA 4ED2A 4G7XA 4RX6A 4X62J 2UVRA 3S2DC 2B4PA 3PJWA 2VBTA 2RQ4A 2JL9A 4HE5A 2KT2A 1WSRA 4LBPA 1NPRA 4O3NA 3GSIA 2XMTA 2JZ5A 1S9GB 2EC0A 1WC3A 1YJVA 2B7BA 1EKRA 2WSFC 1XXAA 1FE0A 2C4TA 3BH7B 5LSRA 4C0SA 1DY3A 2BJDA 4F0KA 3PRBA 2CG4A 3CCVS 3T1YJ 1Y11A 3UCGA 2MY8A 2H5JB 1KHWA 2IM3A 5C4JC 1VQMS 4DF4A 4JI6J 1CQNA 3UD3P 2CW0A 3NS5A 1RZMA 1NM2A 1NLKL 2CF4A 2DNZA 2WVEA 1IM4A 2QA1A 4PWDB 3QE2A 1YJWS 3VAKA 1FX0A 1WHXA 2KFYA 1ULRA 5CYQA 4CLYA 2FC9A 3HJFA 1DLOA 2KVQE 1I5OB 5C4XC 4WP3A 3EXYA 4OLPA 3R3TA 5LMZA 3UR3C 1U1LA 2R93K 1EP4B 2W24A 5BYRA 2W9CA 4Y7NK 2RF2B 2MB0B 4EO8A 2DGVA 2CWXA 4ROXA 4WK1A 4YHBA 4GTEA 3RB0A 4AUKA 2EFVA 4CQJA 3S1TA 3OE7A 5J3OA 2IA6A 4LRAA 2RIJA 3S7RA 3TAQA 2FJXA 4YXWA 1HNIA 1S9EA 1VJWA 3VALA 4F3QA 4B3TF 2BVZA 4J9NA 2XGJA 1M5KC 3MEDB 3CESA 1TVCA 2DGQA 1U45A 4OP7A 1ZZFA 1TKDA 2YNFA 5TMFA 4C11A 2C3OA 4NASA 5IV3A 3MCAA 4PQAA 1QG0A 2V8DA 2G2OA 3HMJG 2CRLA 4PWUA 1HWJA 2WVBA 4GFQA 1YBAA 1RT7B 3AJ1A 3H94A 4XOPA 1G7CB 1S4FA 2MQPA 4CO5A 5RUBA 2FLLA 2HZAA 3PW5A 1KN6A 1IQZA 1M5HA 1XNRJ 4MIBA 1YJUA 3E1YE 5HP1A 4MT1A 2PMDA 3OZUA 2AJ4A 1YIJB 1I7PA 3BEGB 2KM8C 2GREA 3NGKA 4DR2F 2R7WA 1IJFB 1NK6A 3MHYA 3DRSA 1E64A 4MEYA 1WEXA 4JP8A 4F50A 4USMA 1Q86T 1P8GA 3FKIC 2F5GA 2VUMC 4XO0A 3C6TB 2V8HA 2JRSA 4C3MA 1FWKA 2GAHC 3OR1A 2MKCA 1WIHA 3A1PA 4MIAA 2I0XA 1RISA 2VA2A 3GJTB 1W35A 2BJEA 1IQTA 1DAXA 4P2FA 5IC4B 1CQMA 1NK7A 3LTOA 4P12A 4Y9RA 1PKVA 3N6LA 1WF1A 4OHWA 2EI5A 4ED8A 3HOYK 3TAPA 4AH6A 4ZPCA 4W90B 3GP9A 4F2SA 2VFUA 1OPZA 1ZTWA 2NZ4A 4IO9Q 2XNQA 3V4MA 4DSKA 2LZJA 1M1KD 1PAUB 3ZO7A 2AHOB 4OI4A 3VAIA 4DV1F 4Q4ZA 4QPXA 5GMDA 4YS2A 1NZ8A 3ZZRA 1HHTP 3MXHP 5IFMA 2GK7A 2D3ZA 4YAOA 5IP7K 1F3VA 2DGSA 4NLQA 2HHHF 3H7HB 3FZ2A 3GV7B 3EGWB 2GMLA 4TU8A 1J5OA 2FPHX 4R25A 1RU2A 3ZZOA 4UOHA 2R7OA 2XO7A 4ED0A 3DFEA 2BM0A 3B4DA 3HSJA 1D3WA 3HOXK 2NVTC 4GVBB 5D6GA 3R5BA 3KLVA 1R8PA 1NH8A 1FA0A 3H5UA 4PUOA 3Q2SC 4LRFA 4A8MP 3D3BJ 4NEZA 3LO8A 2E2HC 4J9VA 3RR8A 3MEEA 3W63A 3MMCA 3GTQK 2CQIA 4NCAA 3H0GA 1OS5A 3CC7B 3IBWA 5A0YA 4RU2A 3CC4B 3M8YA 4A93C 3VMFA 4DX7A 1XMOJ 3G4CA 1Q82D 4DLGA 3S17C 2BE5A 4X0CA 3MI7X 2DNQA 2RNEA 2CQ1A 3LPEA 4LRCA 3BY1A 4ZP9A 5E6TA 3LALA 3W2GA 3S1NK 1HKAA 3UO0A 1JJ2B 2KYXA 1K9MD 1UZDA 1WTHD 4WCEQ 2IM0A 3KJVB 4OYXA 1XWLA 3CCEB 2DNGA 2NVXA 3BCDA 1RTDA 2CQ2A 2ZE2B 1I8DA 4F4AA 5KT3A 4Q0BA 1TWGA 4ZVOB 3BB5A 3MD1A 1WWHA 2MPUA 1S4MA 2BBEA 5KG3A 3EM1A 3QFSA 1L3VA 2KZMA 1O0PA 2CJKA 3UDEA 2NVQK 4DR1F 1WI6A 1QGAA 5DG7A 2QX0A 3W2VA 2UP1A 4A3KK 3MM8A 1FRHA 2K7JA 4OZNA 3HVAA 2EKYA 3CJRA 4MYUA 2PGCA 3M2UB 1JLEB 2BZ2A 2V4QA 1RLDA 1VK8A 2OUGA 3M4XA 5J2PB 3HT0A 4C48A 2XY6A 1SH3A 2B4UA 3A3BA 1K44A 5ETTA 3WQPA 5D4PA 3JYTA 2V34A 4HL9A 1N36F 2GSUA 5EMNA 2BDPA 1S5ZA 3IRWP 5E3RA 2R8GA 2F1FA 4KMUA 4RO0A 4X4OA 5LL6d 4NLYA 2OK7A 1S1TB 2DITA 3LP2B 2ROGA 3TFIA 1T11A 2GHWA 2R2TA 1UVNA 1NDKA 4WQMA 4YEJA 2PE3A 5D0RA 1T03B 1Q4RA 4BLAA 1CEZA 3T6BA 2DNPA 2H4WB 1FXDA 4DQPA 1FJGJ 2YKOA 3T00A 2V6SA 3W2FA 3KJFB 2DR5A 2XZWA 1WC4A 2ZH9A 4M5KA 4ZJOA 4X4TA 2HHVA 4TN2A 4AXIA 4CO0A 4QVJA 2ACYA 3GTKK 1SI9A 4G1QB 5KFRA 2QDXA 4W98A 4QIGA 3R97A 3ZTRA 3GVJA 1G51A 1OYEA 3GIKA 2B9EA 3FCHA 4FYVB 3T02A 1LW0A 1I50K 3MMLB 1R0CB 4QUZA 1AYEA 3CQZC 1FNOA 5EX3A 1CJTB 2V9KA 3CPWR 5B0CA 4RPBA 4C2MC 2GVZB 2XNDA 4RLEA 4KASA 1NNDA 1X4FA 2BW7A 5LSOA 2FD2A 4U9RA 2MYFA 4X7EA 2O67A 2WOMB 4RW4B 3DGPA 4YB6A 2DEIA 4QIEA 3CGIA 1U25A 1NB9A 4MKAA 1RHKB 1H72C 1N34J 3VAFA 3JTPA 2DGUA 3Q8SB 5DN6A 2CJYB 2XCOA 2IM2A 3OL8A 5I3QA 3M9OB 1X5SA 2HBQB 2OBTA 4FPIA 3BREA 1ITPA 2D3UA 3D7SB 1S1VB 1R27B 3DYAA 2VIHA 1HA1A 3GTGA 1Q86D 4TMXA 1L3UA 1TK5A 3NNAA 3ZXWA 3CCRB 2ZZMA 3OQ2A 1NDPA 2CZ4A 4YHHJ 3G4SB 4LBVA 2BE2A 4NWBA 2F4VF 1R8BA 2HVZA 2QE5A 2PLFA 4QOTA 3HHLC 4FPRA 4GO5X 2XS5A 2QLWA 2LXUA 3HVRA 2B5JA 3I31A 3HOUK
chains in the Genus database with same CATH topology
3ADAC 3AD9C 3GEHA 2GAHC 1XZPB 3TTGA 1PJ6A 5L46A 3TFJA 1X31C 3GEIA 3GIRA 3AD8C 3A8IA 1XZQB 1PJ5A 1WOSA 1VRQC 3TFIA 3A8KA 1WOOA 1VLOA 1XZPA 3AD7C 1PJ7A 1WOPA 1NRKA 1WORA 3GEEA 4P9SA 1XZQA 1V5VA 1VLYA 1WSVA