3W2GA

Crystal structure of fully reduced form of nadh-cytochrome b5 reductase from pig liver
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
total genus 75
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2gA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2gA02
1CNFA 3W2HA 4B47A 1YI2B 5H5JA 1S0UA 1BX1A 3MHPA 2AHOA 4HE6A 3U6KA 4RD2A 3ZBTA 4PC1A 4ACAA 2C78A 4LBVA 3B8HA 1KRHA 2DERA 1FRQA 3AGPA 1VQLB 1VQ4B 4TMZA 4B48A 1KC8D 2VNHA 3SJZA 2HDNB 1VQ5B 1BJKA 1JJ2B 4EH1A 2GQFA 1N0UA 2VNKA 2HCJB 1NJID 2CNDA 1GAQA 1H85A 4RD4A 5THXA 1XB2A 1GAWA 2BVNA 5TV2A 3MCAA 3OZWA 4ZCLA 2BGJA 1VQ9B 1ZM2A 1KK3A 2XNCA 2OTJB 1ZM3A 4YHBA 4WQMA 3AVWA 2GPJA 3G6EB 3CCRB 1QGZA 2PMDA 4ZGNB 2BSAA 1JNYA 1K9MD 1G7CA 3G4SB 2DETA 4RCYA 4M53A 2CRVA 3WNBA 4MYUA 3CMAB 4AF6A 4TMTA 1QVGB 3CD6B 3LRXA 3QSYA 4PC3A 4BPRA 3I55B 3VNVA 2BPOA 4QFMA 2EFGA 4FN5A 4TMXA 1FDRA 4RD0A 4Y7CA 4M2LA 4N3GA 4H9GA 3CCJB 3CW2A 2QN6A 1EXMA 1VQMB 3AGQA 3LVBA 2XEXA 3WXMA 1IJFA 1EFUA 5AN9A 1QGAA 4Y9RA 3CC4B 4Q7JB 1IJEA 4YAOA 4ZGQB 1G7SA 3JQQA 2BGIA 3QFCA 3B78A 4RJLA 3U2QA 3CC7B 1ZM4A 1K73D 4P6VF 5TR9A 3B82A 1OB5A 3E20A 4B43A 1KTVA 2YWEA 1S72B 1QVFB 5EMNA 3OJWA 1VQKB 4P3YA 1B2RA 4ZV4A 3WNCA 5JBQA 3FJOA 4G1BA 2EIXA 4C43A 3AVUA 1K8AD 3JQPA 1ZM9A 1Q86D 1AIPA 2BM0A 3LO8A 2D74A 4J0QA 1F60A 1E63A 3VO1A 1W34A 2DCUA 5GV8A 1KK1A 3JQRA 1JA0A 1M1KD 2QDXA 4TMVA 3ZBUA 3CCSB 1DG1G 3P26A 4PC7A 1F20A 5H59A 4FWTA 4M0LA 2DY1A 3G71B 1FNMA 1YJ9B 2PLFA 2QMUA 1DDGA 4U9UA 1VQPB 3VNUA 2C77A 2YWFA 4TN1A 2QEXB 4LBZA 4MYTA 1N0VC 1J9ZA 4PC2A 2XNJA 3WYAA 4Y9UA 4RD1A 1M90D 1EP1B 1CNEA 1QUEA 1TLLA 3W2GA 3CCVB 1EWYA 1QG0A 4IW3B 2BM1A 1Q7YD 2RC6A 1YITB 1NDHA 3W2FA 4C0SA 2HMAA 1QFZA 1OB2A 4YAWA 1ZUNB 3QFRA 1YIJB 1EP3B 1G7TA 2X3UA 5FA6A 3VMFA 3AVTA 1QX4A 5GV7A 4R71A 1VQ6B 1TTTA 2ZITA 1VQ8B 2QA4B 4ZCIA 1EP2B 1TVCA 3W5VA 1KK2A 3OW2B 1N8RD 3W2EA 1JA1A 3I56B 2VNJA 4AF7A 1KQSB 3CCEB 1E62A 1AMOA 1UMKA 4G1VA 3WBKA 1GJRA 1Q82D 1DDIA 1E64A 3AVVA 1QFYA 2OTLB 3W2IA 1U2RA 1WDTA 3CC2B 1W2BB 1EFCA 4M1KA 2YWGA 3W5HA 3WNDA 5TY0A 4M4SA 1XE1A 3FPKA 3CB4A 1D8TA 3P27A 1YHQB 1DARA 4YAFA 4TMWA 3U6BA 2B7CA 1YJNB 2BV3A 3ZC3A 2DEUA 2VNIA 1H42A 2VYQA 4N3NA 1B23P 4K1XA 2PIAA 3CCLB 4LBYA 4UAJA 3QFSA 1KK0A 3VO2A 5HXBA 4G5GA 3QFTA 4YALA 1OGJA 1QH0A 4LBWA 1Q81D 4RD6A 2NPFA 1I7PA 2BN4A 4RD3A 1FNCA 3W5UA 4B44A 3MMPA 3A1FA 2B5OA 1W35A 2QTZA 1G7RA 2QTLA 1R5OA 3E1YE 5DSZA 2OK7A 4AC9A 4NCNA 3CMEB 3ZZTA 2FX3A 4NBSA 3QE2A 1CQXA 1JB9A 4F7DA 1IB0A 4FK8A 3ZZUA 3WBJA 1ELOA 1HA3A 4B4DA 1YJWB 2BF4A 3CRZA 3CCUB 3AVYA 1OGIA 2E1RA 3CPWB 1R5BA 4B3XA 4ACBA 2R6HA 2VZLA 2OK8A 3AVXA 1R5NA 4ZCMA 3LYUA 3CXCB 1QFJA 4DQKA 2RC5A 4RCZA 1GO2A 3WY9A 3CCQB 4YAUA 1QUFA 3OJXA 4PGOA 1KD1D 2B7BA 1BQEA 1SM4A 3J81k 1SKQA 2BMWA 5KSWB 1GR1A 1FRNA 3PENA 1KJZA 1W87A 3I1FA 3V76A 2YWHA 1VQNB 1BX0A 3ES9A 1A8PA 1D1NA 4PC6A 2J7KA 1FNDA 1VQOB 1FNBA 4QHYA 1D2EA 1EFTA 3ZZ0A 4LC0A 4HE5A 3OZVA 1VQ7B 3OZUA 1TUIA 4DQLA 1GVHA 3CCMB 1QGYA
chains in the Genus database with same CATH superfamily
1PJ4A 3IA7A 4Z7OB 1O5IA 4QPPA 3AHEA 5JAPA 4BGEA 5TQ2B 5CD1A 1BHQ1 3SJCA 3B13B 3X43A 3NALA 1OBHA 1KZ7B 1JR3E 4YASA 4D3XA 4WJKB 4KR3A 3I0MA 1VI5A 1QFSA 4CJXA 1DMSA 2VDVE 3BSSA 1JEAA 2WWYA 1EE9A 1VMIA 3EXEA 1DOAA 3LQFA 4S0XA 5FHRA 2IV3A 1M2VA 3UOAB 1J7KA 1DUSA 1K4KA 3BKWA 3WGJA 4UHBA 1OFIA 3ZU4A 1MJNA 3VZQA 3O73A 4MQFA 3K8YA 1POWA 2W43A 4DRYA 1KRHA 3AP3A 4OQLA 4WNCA 3AGPA 1D6SA 2GA9A 2VNHA 3NXKA 1ZD9A 4G2TA 2F8MA 4U0KA 3UJCA 4PCVA 4X7DA 1UBKS 4AL4A 3AV0B 2CJWB 3Q3IA 4QXOA 2Y77A 1CRWG 1FOEB 2GQFA 1N0UA 1Z7EA 1M10A 3WRVA 3JQ9C 5I8WA 2HCJB 3B48A 4Q4AA 1KEEA 2BEVB 2PUHA 2VHTA 1QANA 4PYJA 4LNUB 2YW9A 1XV5A 1FYEA 1X1QA 3IPXA 1XC7A 1YAHA 2DKOA 3DO6A 3EXIA 4O4IF 4TLBA 1PT5A 4XTRA 2EKBA 2F2TA 3V46A 1LUAA 3FFXA 4CMAA 4CTMA 2Q1TA 4XM2A 1ZFNA 1GPWB 1XYYA 4JJEA 4IIHA 4LI0A 5TV2A 4RY8A 1UBEA 2QRZA 3OZWA 3MUNA 4I8XA 2ODPA 4BQFA 4MQ6A 3SIRA 2EHDA 2N0SA 2W2NA 3F7MA 3PL1A 7REQA 3LXXA 4DKJA 3R7AA 4JDPA 3PRJA 1T0JB 5K8TA 2GPJA 1YMQA 2OBBA 3Q9SA 1MHTA 4DMGA 2GTIA 2WD7B 3D4NA 1MB2A 3RVNA 2J0SA 5LQJA 5DSXA 2AZ4A 2WA2A 3AHDA 3O4HA 3LP6A 1Z6YA 3OC0A 1NQAO 1U8ZA 4UBMA 4BU0A 5BOSB 4Q9DA 3EBOA 3FAZA 1Q83A 1K9MD 1G7CA 1Z6AA 1QVAA 1GSAA 3R8CA 3P9ZA 3PL5A 3AYXB 4P3NA 3ICQB 1N2CB 2HF8A 1M2OA 4D5EA 5IDYA 3I0NA 2RBGA 4IDPA 1RAHA 4Y67A 2CRVA 1G3QA 3BJRA 3EZNA 4RHXA 5KTKA 3USES 1DC3A 5IN4A 3HP4A 4BNJA 3E6AA 3MWGA 1QKIA 1BPLA 2JVIA 3K1JA 3N6RA 1CLEA 3QQ5A 1OFUX 1HXHA 2P7IA 1IOZA 3FF1A 3GFFA 5TT0A 1PLJA 4FCWA 4N39A 5AD1A 3IURA 3HBLA 3LGSA 5DLPA 4XXHA 1SXPA 5K3OA 1ZWLA 4OAOA 5EP1A 4Q3BA 2A9JA 4BJHB 3AETA 3HCNA 2BEJA 3IV9A 4ZIRA 2P5UA 3I45A 1KSGA 3PUJA 4ZOEA 3CCJB 2RGRA 3UPUA 4GE0A 3L7DA 2EAUA 2PCLA 1C3VA 4L5IA 3DOOA 3JWEA 4N5LA 3ZD9A 4KPYA 4TWZA 3A37A 1ZN8A 3A58B 5I7SA 1TGVA 1W6RA 1X1RA 4LX0A 1XJ5A 4D8UA 4DMMA 3GIWA 5I4KA 1JBKA 3ZDZB 1WZNA 4ARZA 3E1GA 1WCV1 1PT7A 1OAOC 2QY9A 3DE0X 3UHFA 3W5CA 1M72A 2IF0A 3JTMA 4Y1EA 3EULA 5FOUA 3TW4A 1A27A 3L5OA 3ZDFA 4D26A 4NXNB 2XNKA 4ZT4A 4BO7A 2F55A 1ADBA 1TIKA 3EOZA 4EB6A 2RGWA 4LXQA 4RJLA 1ZGCA 3UJ7A 4IFTA 5EIXA 5SICE 5KYXB 1G3UA 1OZAA 3CPHA 3LZCA 4O2BB 1UDWA 1NF2A 3NYWA 2DLDA 4EK9A 2WTEA 4BJ1A 4YO8A 1NG1A 3BH6A 5IH3A 1L7NA 1OYWA 3Q12A 4BKMA 4ZAWA 2EFEB 2NGRA 5JYEA 2WILA 2ZE8A 1Y8CA 4GZ5A 1AK1A 3OM8A 5GM2A 3NHWA 4V1CB 6AT1A 4BO6A 1PT6A 4ZV4A 2WFLB 4LMBA 2JAOA 4ARBA 1RBYA 4H3VA 2W6OA 1AO0A 3HVJA 4RY9A 3AJDA 9MHTA 5JFOA 4KH0A 5CVCA 1EDBA 5A05A 3PDCA 3ZWNA 1YI1A 2A7QA 5F4ZA 3BTUA 2DM6A 3VR3D 1FS6A 1HEIA 3TBKA 2YJ6A 3OU2A 2O0JA 3GMIA 4TLEA 2HJHA 1F17A 1USUA 1FDOA 1USGA 4FN4A 2XAAA 3RS8A 4MUKA 3W3AD 3AM1A 4DR1B 3R3HA 4XKVA 1R12A 2VEDA 1QO7A 1UFKA 4L8VA 1RZUA 4MKRA 4WUVA 3CEPB 1XTIA 5D3KA 1JHOA 1V7QA 2O3TA 1ISMA 4FNOA 4M9UA 1ZH4A 4LJSA 5CJ2A 3SVZA 1FFEA 2HTEA 4YXWD 1QV7A 2LBPA 4JLWA 2JFFA 5AI6A 2JCGA 1Z2EA 4OK6A 5JH7B 2MIIA 1YE8A 2W2MA 2A5LA 3IQFA 5FQOA 3LP5A 2QUHA 1X38A 1T4GA 4DB2A 3HYLA 2ZYDA 2X0IA 5K1ZA 4B6EA 5K01A 3KALA 2DWCA 3MTGA 1U2SA 4GVLA 4XQ0A 4EG6A 1YBMA 3U37A 3UXMA 5K0NA 2MYPA 2WOJA 3WADA 1JF8A 5IARA 3WO0A 5E95A 3EUEA 5BYJA 1Z8NA 4BFUA 2PFSA 3LQQA 2V8OA 5EJ8A 3TOZA 2DY1A 3G71B 2Q50A 5DLDA 4RHCA 3FROA 4GZ6A 3WQSB 4MLZA 3GJQA 4PZLA 1U3VA 4LRQA 4AJKA 1RXSA 3NNNA 4IFBA 2Z9BA 3HTXA 1E2EA 1XI2A 1P3JA 2YWFA 3HVRA 1P5ZB 3AX6A 2IW1A 4MYTA 4C3ZA 6LDHA 4MS4A 2P4EA 1D8AA 4UARA 1FVHA 1V95A 2QDKA 3LCRA 3V6MA 3VTAA 3WL3A 5L6MB 2HLNA 4XQCA 2QNIA 2D5LA 2VXYA 2P0EA 1GKYA 1GV1A 3TZKA 2WIKA 1CNEA 4FD3A 2BJVA 1YR9A 4N3BA 2IP2A 4J49A 2O6HA 3RG2A 5T7BA 1EWYA 3BZBA 1IBSA 1F5NA 2I4MA 4LNAA 5BN3A 3MJVA 4GP7A 4HGPA 5HBGA 2G8LA 1QLJA 4MQLA 3RG8A 3CNQS 3SS9X 4TKVA 1XDWA 2D0IA 5CB4B 4Z3OA 5KOJB 4UBLA 4XWTA 3KZXA 3OT1B 2FW0A 4P7JA 4V38A 1VLQA 2BLNA 5HQTA 1S7GA 3QVGA 4MEJA 3A4IA 5BVGA 1KEWA 4BEVA 3N2IA 4MI1A 5JDCA 3A3NA 2WKSA 1GQYA 1VJ0A 1SBQA 4X8LA 1JEQA 2R00C 4P33A 1I3LA 1KAGA 4QOEA 4Z51A 2R65A 3TH5A 3BB3A 1J42A 4L3VA 1N8SA 2F7SA 4MB6A 4IEFB 2PL3A 4BEJA 3FLEA 3CO5A 3L8DA 1NZJA 1AY0A 1NW3A 3KKPA 3PDUA 3HM9A 2XYQA 3DAGA 2C29D 4A10A 3RFCA 3NETA 1SNYA 4ICIA 1YI8A 2ORYA 1UD8A 5LM3A 3BH7A 2Z98A 3AI3A 1PSZA 2A1TS 4GMKA 2FY8A 2MJLA 1UXGA 4AXBA 2XXAA 5ALXA 3RT1A 4QM7A 2OO5C 1GEGA 3FG9A 1Z4QA 3OHSX 5H1YA 1E1MA 3WAKA 1CKEA 3L7MA 2CFCA 4NAUA 4RACA 1ORWA 4MPRA 4N01A 4Z4QA 4OLBA 4IXWA 5GV7A 1RRVA 1K75A 2XIJA 2PY6A 4H7DA 1QVVA 1RI5A 2O2SA 2QK4A 2VJOA 2DHRA 2IGTA 3UCEA 2ASVA 5I7VA 3I2KA 1PX0A 2WZDA 3AF6A 3EZYA 2WE8A 3IO5A 2QGGA 4H3SA 2P40A 3ZHYA 2BAGA 1T1IA 2DRIA 1Z4MA 2Z9CA 3A1DA 3PFHA 2O48X 4CM6A 1KK2A 5A71A 4ER3A 5GIPE 4UVHA 2QYOA 3ICWA 2O2GA 5IWCA 2JFHA 3MTJA 4LDQA 4GZLA 1KQSB 2DT5A 3F2IA 1PK8A 5C4IA 2AN9A 1R88A 1RJEA 1Z4LA 2IY7A 3PTZA 2BKVA 1EK0A 5GPBA 1G17A 1TW3A 2OYSA 3NDIA 5ICGA 2X86A 2DP4E 3AUJB 3D3WA 1DAMA 3TZEA 1NC3A 5LLTA 4M0EA 2B9VA 1U98A 4US0R 4EO7A 1QR6A 1PR4A 1G8FA 3V2IA 3VKGA 2JFXA 2EJUA 3FI0A 5KZMB 2F8LA 2VUIB 4FONA 3Q8LA 2I3BA 3C5VA 4JC5A 4QRHA 4ERXA 2DFKB 3V5NA 2QB5A 4F5WA 1I2MA 3L8MA 3WAGA 1OX4A 1W5FA 1L1FA 4C0KA 4M4SA 5D00A 2DFNA 1Z75A 4DJDC 4URWR 2JHAA 3HKCB 5B3JC 1F1JA 3A8TA 1G4HA 1CP3A 2XF8A 3WOVA 5B64A 3OOYA 4B76A 5EP4A 5F2KA 2YV4A 4K9OA 4C0AC 5TB5A 1EFRD 2I33A 3AY3A 5K0FA 2NOAA 4RTMA 1JT9A 4YECA 5D6NA 1NJ8A 2VYVD 3VYUB 5EZSA 3ZHUA 2XYGA 1DJLA 4LWZA 3KPYA 4YDSA 4CG3A 1KC1A 3L6EA 1TADA 1DIRA 3SIPA 4ZVLA 1IWBB 4Y98A 4OJQA 2P9YA 5JAOA 1T9GS 5FOWA 2MSCB 1ZGAA 4YJ3B 4D99A 1SVUA 2KI5A 3PFGA 2P2DA 3STHA 2X2EA 3ZCUA 1N2HA 2HN9A 2RGYA 4KB5A 1D5WA 3DAFA 3MOSA 3OLZA 4C5CA 4LUCA 1NMSA 2QXYA 3H9JA 1B41A 4N0MA 4I4NA 3FPCA 4BNDA 5E0OA 3VO2A 3DEFA 4X45A 3R0XA 4WLUA 5EQTA 2CL7X 2EEPA 4IGAA 1ZR4A 3FJ1A 4UNSA 5LUAA 4CMIB 1SCIA 4OG2A 1C30A 1ZOOA 2ZJFA 1BVRA 4Q4JB 3B53X 2A0XA 1G38A 4I7EA 3TTXA 3CCFA 1ONSA 2CF6A 1VG8A 2HPHA 3AHFA 1R5JA 2PZ8A 4KYTA 3QI2A 2ZSHA 3ABQB 3UMGA 3VHQA 2BN4A 4KAJA 4QQNA 2HMSA 5HYVA 1FNCA 1O77A 4C2AA 2VK2A 4H6VA 5BSWA 3OQJA 2O3UA 2DSNA 3HA3A 1Z56C 5F5XA 3L77A 1RE1A 1T6YA 1EYZA 1E8NA 3FETA 4LKRA 4NRDA 1OJ7A 4E21A 4P36A 2OGWA 5K3AA 2QTZA 1HH4A 1V8BA 3NBYC 3UWMA 2HK7A 2UYHA 3HXOA 1HI9A 2Q3CA 5LZ5A 1RXUA 4CEJA 2VL7A 4MVJP 5M04A 3NUGA 2ACKA 3THSA 1G8MA 1NXPA 4B33A 5FI5A 4GRIA 2WLSA 2ZBFA 4QA9A 2JGEA 4BVFA 3VVMA 3IELA 3OIYA 3KEMA 1F7VA 2XA9A 2I2FA 1CQJA 1H4QA 2FLWA 1BZYA 5K8UA 4OUDA 1WOPA 2GLTA 3EMBA 4LSZA 1IK6A 1JFSA 4WECA 4J8PA 2CLFB 2JZCA 4MVWA 5AW2A 1DX4A 1LC0A 2AMJA 5I4IA 4JT4A 3E3LA 5KX5F 4UUBA 1XMXA 4ZA2A 1BQ3A 1PX2A 4OI1A 4BLUA 2YNMC 4BNVA 4BX2A 3LCMA 5GJCA 1NTRA 4ZOQI 3EIQA 3CP8A 2QVZX 4JP1A 2C2WA 2B0CA 5LP6B 2O14A 1PQYA 2AFIE 3IMFA 3OSUA 1V8FA 1ZIYA 4BVAA 3H6KA 1S5PA 5CAEA 1XTKA 3CRZA 3OA0A 3VPAA 1UJMA 3D4PA 3NT5A 2RHHA 2G04A 5K3EA 4YUZA 4D8WA 1F0PA 2IOYA 4INPA 3WWOA 5J2TA 4ACBA 3ZDXB 4X1KA 3AKYA 3IODA 3RYCA 2CXHA 3NNDA 1PG0A 3NDRA 4UU1A 4LRXA 4IV5A 4EW2A 5B1YA 5HF6A 3MVEA 2D00A 1ZGJA 3T7DA 1Z26A 3A3GA 1U8EA 3EZ9A 3AERA 3UJ9A 2YXLA 4BNKA 1NM5A 4EA7A 4KZPA 2PMKA 1DEAA 2RK3A 3REOA 4WDRA 1P0QA 2P35A 2QJWA 4RCZA 3GZJA 5KREA 1AG9A 3TK1A 5KVSA 2X4GA 1S3GA 3RWOA 3W6UA 3QY9A 3NIFB 3A9CA 2I66A 1M6EX 3OJXA 1KZHA 4MTLA 5FXMA 4EKGA 4FHDA 5K09A 2NV0A 1QPBA 3QLUC 5E6RA 1BEUB 5FV7A 2BFAA 4TS4A 3RK0A 3SYTA 2PUFA 1VLOA 1SKQA 5KSWB 1JSLA 1ZESA 2JH8A 3IQHX 4D4MA 5CW1A 1L4MA 1R8SA 2O8BA 1DBWA 1Y6RA 4QKQA 3OCJA 3L8FA 1QIGA 4B3BA 3BCSA 2CLCX 1ZKMA 1V45E 3I5MA 2PT5A 4PRLA 4IMRA 3H9EO 3OMXA 1A8PA 4MRPA 4A23A 4DYHA 2F6RA 5IF9A 4PAGA 2DFVA 1ZNZA 2Q0XA 1Q3HA 4TT8A 1U3FA 1DT5A 4DIFA 4QHYA 1E5LA 5FEUA 2WJ6A 4HWOA 1TVMA 2FSVC 3IP5A 3SZLA 4DC9A 3CN7A 1I6KA 2VRBA 3KYDB 2XKKA 1HX7A 3ZE1B 1LS6A 2VHXA 1AKUA 2Y2UA 1UDXA 2IQ5A 1HNWB 1K88A 1JN0A 4UNPA 4URZR 1YIAA 3MLAA 2A3RA 1KE2A 4D9IA 2CNWD 3I73A 3UPDA 5JSZB 1Q6ZA 1Z35A 2OP0A 4I9UA 1U28A 1T9GR 3MHPA 3LT4A 2Q1UA 1QH1B 2DPXA 5FNZA 1M67A 4DN6A 2W93A 2RG1A 3FMPB 2B98A 4GBJA 4NK4A 4R9VA 2ZBGA 3PUMA 1EDEA 4GPEA 2FPIB 3HZHA 4FDAA 4R01A 2C78A 1X9IA 4RDXA 5K4GA 2PUDA 5MN6A 1NT2A 3DB1A 3WK9A 1JAZA 4G5HA 3F47A 4CCYA 1WP6A 4FOPA 2XW6A 1C0KA 1QYCA 3JARA 1FRQA 3S7ZA 1VECA 4CLRA 3W6NA 5J3JA 1OFUA 1OFTA 4C4ZA 3E05A 3L07A 1NI5A 3EC2A 1LRKA 3G8BA 3LG2A 3CEJA 2RGAA 2Q3MA 1EFVB 1S7CA 2WYVA 5AHOA 1D04A 2CBXA 3PPYA 4Y1RA 3F9RA 3ISXA 3JQ8A 3TRHA 2Y2VA 5TSDA 2IYVA 2YIVX 2SKEA 3D54D 5KOHA 2D4HA 3P5BA 1M6NA 3FWKA 1B0UA 4MQ5A 3T1VA 3V8EA 4TYNA 2X42A 1PQPA 2IHBA 3K6RA 3TTUA 4RD4A 1P62B 2ZL5A 4JUFA 4LCJA 3ZW7A 4O59O 1U04A 1K27A 1U3UA 4MUXA 4N7BA 4V39A 2DR3A 1VMAA 3A6EA 4GSYA 4J1TC 4RELA 3PQ8A 2HU2A 3ZCQA 2PN1A 4IVRA 4EATA 4EOGA 1N34B 2M1XA 1M2WA 5H81A 2I1WA 3PGA1 3S2GA 1B6RA 3VR4D 4UM9B 3HMKA 3DKPA 1GQQA 2ZJ4A 3O90A 3OFSA 5E38A 1HSZA 1WSBA 1YB1A 4GOLD 1T4MA 4DREA 1ATZA 1XCPA 1MRSA 2AQ8A 4IKOA 4K1LA 1HOXA 1DCKA 1P9LA 3T3IA 3IUJA 4X84A 2W83A 4B82A 4NYMQ 1QCDA 4WZTA 1OHHA 5EMKA 4IJ6A 1RMYA 4YPFA 4K3UA 2FFBA 4EHNA 2XBLA 2J3MA 2JLVA 1T8YA 4AJ9A 4DG5A 1J21A 3JZIA 4JUIA 4QTYA 1Z0DA 1QLWA 3PDIA 5AKIA 1A96A 3M3PA 2OYCA 2Q5HA 2YV2A 3SYKA 3V6LA 4B0OA 3HEAA 1SKBA 3CR8A 1LY1A 2GESA 3BMCB 3WNBA 2D1QA 2RAPA 3F7OA 4QUIA 3WLRA 4AO8A 3UMSA 2OXIA 2RGNA 1FBTA 4L2IB 1GR0A 2PFGA 2RGCA 3AJ9A 4I9FA 4NMXB 3R6DA 3UPTA 1U7UA 3FTPA 3JU4A 3VV2A 3D0OA 2QA5A 1WEHA 4FN5A 3ZD7A 1Q21A 2G28A 3D7SA 4NBWA 2JJYA 4Z9XA 1UWLA 1VYVA 2GETA 3TKAA 5KKCA 4QJ3A 1YR1A 3EUAA 3OOJA 4F0JA 4HEQA 1QHSA 5CIQA 1G8AA 3GDOA 2Q7OE 4OBWA 5HFNA 3MFYA 5B55A 1S8AA 1CDEA 3L7OA 3QLTA 1ATIA 4QPJC 3T3DA 5K45A 4PAAA 1L5RA 2JJMA 1DO8A 3TL6A 3SEAA 2B2XA 5EJ5A 1QR2A 1SU8A 1YFZA 2PKQO 2JCBA 3DMRA 4KFUA 3EWNA 4WK0B 5CX1B 3RAPR 3SP1A 1ICEA 1ZUIA 2WIFA 3AVPA 4MYCA 3R7LA 3OJLA 4KLCA 5K3SA 3TNDA 3UH0A 3DBIA 2CUTA 1GRQA 5C9ZA 4WASA 2AN1A 4TXMA 3MJ4A 4ZAXA 4RH1A 2WYRA 4RVOA 2JGIA 1V3VA 5H16A 3STYA 3KV3O 3AUYA 3I39X 1ZI8A 4HWGA 2A6PA 5FTNA 5AIBA 3FLMA 2V31A 3CCCA 1ST3A 4KYUA 1SVIA 1QVFB 4M1TA 2ODTX 1IN6A 3HXQA 2FFRA 5C7LO 2QMEA 2WICA 4GNRA 4GOMD 5LQDA 3GH1A 2HIAA 1NQXA 1W4AA 1K92A 2Q27A 4NFSA 4A73A 2ZVQX 3TINA 5HZKA 2EFHB 3ACBA 5I7OA 2IEYA 2JLWA 3WLNA 5HKKA 3ZVNA 3HFSA 2XB4A 5IXJA 4HRYA 3UA4A 4BJ3A 5E3IA 1ZJJA 3DC7A 1G0NA 1T8SA 1ZVJA 4ZU1X 3SBDA 1U3GA 3EVCA 3ORSA 3TXAA 3PCRB 3F71A 2V03A 2PZEA 2X8JA 2W98A 4GDFA 3FVTA 4G0XA 5BYKA 3A7DA 1RBZA 3CLSD 4TTTS 4Z2AA 1WWKA 2HCBA 3BMOA 5FWXB 3P9KA 4JHXA 4Z9AA 1SWVA 3O8RA 2CKMA 3ISVA 2C95A 3ANXA 4MPTA 4R7TA 4ZQCB 2I1VB 3LO8A 4EY4A 4Z7QB 5EUCA 4J0QA 1E1RA 4LJ4A 1SA0B 2LW7A 3C7AA 3ILVA 4U7HA 1JBQA 4U3JA 4BNYA 2PIDA 1YS9A 3BH0A 3C43A 1V4BA 3DQZA 3ZS9A 4AJ4A 2QPLA 1R0WA 1OMOA 3DFMA 3C3MA 4P7KA 4XGNA 3PGVA 4EB0A 5TIIA 1R0XA 4E3WA 1YFKA 4X65B 1G6HA 5M5BA 1YMUA 2HNAA 2AVNA 2J1LA 4TUYA 2FPLA 5BYBA 5HZGA 3Q3EA 4IXDA 1O96A 1P7WA 2NAFA 3IMGA 1FJHA 4URFA 4X90A 4EECA 1EAYA 4L5AA 5KQSA 2H6EA 4DC1A 4CHTA 1DRKA 3R8FA 1CRLA 2BR5A 5JSYA 4OJKA 2JEOA 1DRUA 2GRAA 2PGLA 2C88A 1X80B 3G8AA 2WZCA 3QMWA 2QBYA 2AFVA 1SOMA 2P9TA 1T0BA 3H19A 4MO2A 1F20A 3CZ4A 3RSLA 5ISMA 2ODNA 5HBRA 5LP6C 4CW7A 4HATA 5C2JB 4P0QB 1U2DC 3JRWA 2FMFA 2JCVA 1IQPA 3PDHA 3S2FA 5FULA 2HRDA 4DSZA 4YRQA 1DVRA 4IIDA 4U2KA 2CNNA 2DTXA 2H2HA 2Y1KA 3T7CA 3IGFA 1DAIA 1PQWA 4TSFA 1Q11A 4WACA 5LQKA 4OLJA 3JAMA 3IE1A 3CEAA 2VAMA 3TDKA 2XNJA 2YDXA 2ALJA 3FNEA 2PHZA 4OAQA 5IDQA 4RD1A 3NBKA 4QRDA 1FFHA 3ZPNA 4FMDB 4FP9A 4YP7A 2R5FA 3LRPA 1A5TA 2HJWA 2XB9A 3DS8A 3KJHA 5CLJA 4NEGA 2C84A 3LWBA 1YGPA 1T36B 3I1JA 3P52A 4QUDA 4BBZA 1YBFA 3L1HA 4EHBA 3V4RA 3ROXA 1EB8A 1C7QA 1IAVA 3PGKA 3T56B 5L45A 5LXTB 1O4VA 3DVRX 5A3SA 5DTJA 1IRIA 1PJ3A 2WU1A 1O6ZA 4UEQA 2WJZB 3AF0A 1BS1A 3TQTA 4KVZA 1F3LA 1PK7A 3OSZA 2V98A 4KK3A 1ZK1A 3KWMA 1FUYB 1XYGA 2IZZA 4D4HA 4XQEA 5JWHA 2YYSA 4RDIA 3H8JA 4C0SA 2Z0MA 3WBFA 5BV2P 2UZ1A 3WGOA 5LU8A 5JCOA 1UINA 2ARKA 3UAZA 3BL6A 1WKCA 1Y1LA 3S8YA 2IPLA 3MEQA 2C4VA 2FOIA 2EW1A 3GYGA 3W79A 1TM3E 5ICSA 4XGKA 1D1PA 1RLMA 3A3YA 4E46A 2YHSA 5HIKA 1A76A 4KQMA 2ILTA 4PYKA 2ZYSA 2R1VB 5EGSA 4PZUA 1XJ0A 1SPBS 5FI0B 1TEHA 2R8ZA 3I2GA 1OCEA 5B2ZA 1CZLA 1OLXB 2PUBA 2HOQA 1G55A 3JV7A 2IA5A 1IN7A 2V55B 4H7KA 1GZUA 2O8CB 4ZT2A 4M98A 1P4JA 2YOGA 3GGJA 5EE0A 2RKWA 3E53A 3LLVA 2X7XA 2GDJA 1GNVA 4BFXA 3AVQA 4UNNA 3ZE8A 2QL7A 3MCTA 2VQFB 4UE3S 2H4HA 4YJHB 2GNOA 4EB3A 2RI6A 1FX0B 3G1WA 4RA6B 4I2VA 2C7GA 2D2XA 2YL2A 1G291 1LU9A 2B1RA 1Z28A 1H9BA 2MINA 4KMOA 4WLOA 5E9WA 4BFCA 2GD6A 2R7NA 1JA1A 5BQ5A 4CTNA 2B2CA 1I7QB 2G36A 4YMIA 2XQFA 2BJHA 1HZJA 2P6UA 3UK1A 1M34E 2WNSA 3HKBB 1C2YA 1U9IC 3LNNA 1A9OA 4D25A 1Q1QA 1XQ9A 2OSVA 4BUZA 4JT2A 5EZYB 1BE8A 3TZBA 1DBSA 3UHPA 3VISA 4BQQA 2EL7A 1SVSA 1ECJA 1JU3A 3L1JA 4RVHA 3RS9A 3DL7A 3WGMA 1SUCA 1WXEA 4D97A 1UANA 3A6PC 1L3BA 1KMNA 2XVXA 3AEKA 3FNGA 3U4HA 3MJCA 3GCZA 1UOEA 3JQBC 2VN8A 1CD5A 3VA7A 5IAJA 1Z3IX 3DC2A 3B85A 2GSDA 3PXBA 4KRXA 2G06A 3JR7A 3BYZA 4RCVA 5HQJA 4BMDA 2GO1A 1ZIOA 3ZQ6A 2Q6IA 4YAGA 5JTUA 1IULA 3BILA 3UIEA 1HDXA 2IUTA 3LUDA 1H0SA 2JGNA 4ZVMA 2DXIA 3TEJA 4X62B 1UAAA 4YCLA 2OCYC 4LEIA 4XIJA 3T9EA 1KFEB 4H0FA 2Y1LA 1YJBA 3SJPA 3RC3A 3WTCA 1X1EA 3T3NA 1CQIB 1YX2A 4D3YA 3QX9A 4I1IA 5IK2D 5J2UF 1OA0A 3NDBB 1XEXB 1C0EA 5E2AA 1YJNB 1R4NA 3IXLA 5IYPA 2HQ1A 2P1DA 2FFJA 4Q3KA 3L8CA 5HK9A 4RADA 4OYHA 1JDBB 1CZRA 1N7HA 3ND6A 3RASA 1JMYA 1PU2A 3G13A 3AFMA 4X8OA 3RREA 3EZFA 3KK0A 4Q05A 2EARA 3D3JA 5FUWA 3ER9A 2EBFX 5A4AA 1S8NA 2OM2A 1NRJB 2YWXA 2FAXA 3A9WA 4Q7EA 1K4MA 1P0MA 3C6XA 3IQZA 1SVOA 1VHQA 5ALZA 5AO9A 1CJSA 1VSBA 3U3RA 2PA3A 1I7LA 1GPBA 2OHIA 3H7AA 3O21A 3T7IA 3S40A 5JPCA 2ZTGA 2ZCJA 2VATA 5FLEX 5K05A 4IIGA 4MB0A 5EJMA 3BZWA 4EP1A 5FL7D 3PX3A 1JEYA 3E7PA 3GXBA 4C88A 1I4DD 3AKCA 4KKXB 3T15A 1NVXQ 2RHDA 2ZJZA 3P2JA 4N5IX 4UM7A 4P3PA 1EVLA 3ZW8A 2ZT7A 1J8FA 1ZNQO 4OCZA 4MGYR 4JAVC 1KL7A 1RLOA 5FKJA 2RGXA 4I5GA 1PT8A 3O9ZA 4C14A 4IX9A 3NHZA 3X2EA 1N9KA 1VHJA 2IHVA 2YX1A 3D1JA 5TQ0B 3RRMA 3IB6A 5AKHA 4HY3A 3MOGA 2AX4A 2CY0A 2HK6A 3KUXA 1SCUA 4MJLA 3RABA 4F2DA 4JI7B 4NJMA 1XN1A 4JQYA 4PGMA 2I2WA 3HM2A 3I9LA 1E61A 1YDEA 3GFBA 4JJIA 4A82A 5EJEA 1LQTA 1IYZA 2YXEA 4H17A 1G20B 4BVJA 1QGUA 3QX3A 1XRRA 2NXNA 3OQPA 4ROSA 4CNQA 1OBFO 2QR5A 2BCGY 3EZXA 4FGLA 3E5MA 2Y1XA 4OQPA 3QKUA 4QOHA 4N7JA 4AMBA 3NCTA 3ZY4A 5IRCD 2DT8A 1T5EA 3VDMA 2J3IA 5JD5A 1CQXA 4UUNA 5AI0A 4OP1A 1JB9A 3AIKA 3GBPA 3T5GA 2PNFA 4G9EA 5BNIA 2J4CA 3JZDA 4K40A 5CURA 3G8DA 2ZUTA 4G7WA 1CE8A 1ZVVA 4KE9A 2OYRA 2ZANA 2KYRA 1XXHA 2OUIA 3IBTA 5BR4A 3MILA 3N70A 1L9KA 5IKMA 3MC1A 2ZJ1A 5B1EA 2QQFA 4Q3AA 3OE7A 4ZU6X 5AXBA 1HZZA 5KVQA 4F97A 4N0PA 4V3CA 3NHLA 3CPWB 1SG9A 1U02A 2XTMA 2VCHA 1R50A 2QL9A 3NLLA 5U4QA 2QVBA 2ZTNA 1JE0A 2XX3A 3PUHA 2H4ZA 2WAXA 3UGQA 1QMGA 3WHLA 4WCVA 4DMHA 3ZY2A 3EAQA 4MA5A 2NTJA 2VDJA 3AL3A 4XONA 2JDIA 1WDWB 1XLUA 3ZIUA 2PGOA 4BMCA 1MGOA 3M4XA 2DJ5A 3FPSA 3N8NA 3I52A 2ZJ7A 2AK2A 2NTEA 2I7DA 4I55B 6GPBA 1U0OC 4NEHB 4DMCA 1EVZA 3QNWA 1NB0A 3R3WA 1JDSA 3REFA 4F11A 3QMMA 4TLMB 4J7UA 4MCIA 4MJ7A 3NONA 1X1BA 3R8XA 3RRJA 2IFTA 3BRWA 5AKGA 1UMDA 2M2IA 2O2EA 1JHZA 4MVXA 5E2IA 1JIJA 3EJWA 5ADHA 4KRFA 1ZEMA 2IGBA 3L7IA 3U56A 2G67A 3FM9A 1DXYA 3H5OA 3JD3A 4KTTE 4D43A 5FPKA 2GN0A 2XUAA 4WNAA 4R1NA 4Z4HA 4O5AA 5BR1A 1Z7BA 2VOEA 1SQSA 3GNTA 2VBVA 1TVKB 1E59A 1UL1X 3H3JA 4W99A 3TTVA 2MU1A 1Z6ZA 1MQ9A 2GYYA 3B2QA 1DFGA 1X2EA 1WOOA 2ZG6A 2NU8A 4UCXA 1CZHA 1E5DA 3SE0A 3QELB 3H4MA 1H2EA 1YZNA 1NFFA 3CSSA 3QOYA 3P9YA 4R1OA 4EENA 3IDOA 4QU9A 1P61B 1PV2A 4DGSA 1EE2A 2QRPA 4P2BA 2C2OA 1A2QA 4IZOA 2O7SA 4URHA 1JKJA 4I5IA 4MVJA 2OL4A 1L5FA 4F4HA 5B3KA 1CNFA 1XO1A 3C5EA 3I92A 3HSKA 3N8GA 1Q7GA 4GBMA 1JA9A 4AP9A 5A9SB 1Q44A 2EFJA 2ZJ0A 3DD5A 4XB2A 4QQKA 2UYOA 3VI3B 4C3UA 2VDPB 4G4IA 4KI0A 1Q0ZA 1JJ7A 2NXJA 4NX2A 4RV5A 4ZGGA 1G8GA 3QOWA 1MC1A 4JU8A 4MLPA 3PQ7A 1MPXA 4LJKA 4JLMA 3IJPA 1YS6A 2KMLA 3KP1A 4MR7B 1YCHA 4UUOA 2FX2A 4JLNA 1WR8A 3A4MA 1LTKA 2ZT8A 2ZWIA 1SBCA 5T8KC 2J3QA 4A5OA 4OXIA 1OY1A 5HIMA 1KYZA 1KDYA 3GJTA 3VDXA 1G59A 1BQ4A 2HDNB 1EVKA 1JQ3A 2COKA 4JJFA 4QEZA 1JU4A 4QOFA 4BTVA 4DWOA 3EHEA 3B3GA 3SNHA 1X7XA 2ZIUB 3OCWA 4XLLA 5C1BA 4M8NE 4WI1A 2FSUA 2P9QA 4X71A 4GEKA 4HCJA 1P0CA 3OEYA 3OX1A 5BSVA 1NJID 2WTXA 3CESA 1SVWA 2XCOA 3AHIA 3GFTA 4YROA 1K5PA 4KLRA 3RC9A 1UD3A 1DCFA 3N2NA 3ORRA 5ILQA 4EI2A 4JBLA 3Q3GE 1VL2A 1DHTA 2V9CA 3TSWA 1RYZA 2QMYA 4KVFA 5HA5A 2ASEA 1MG5A 1ODJA 2WWWA 3NX4A 4B6SA 4A0GA 2VXCA 3DO8A 4RPKA 5AK4A 1OOEA 4IH4A 1YH3A 3AUAA 3KOXA 4K9DA 5DGCA 1KK3A 2GJ9A 4CU5A 3LJKA 3TJMA 5DCYA 1MBZA 3HACA 4XPIA 1KBQA 1VPVA 2FUCA 4GMDA 3UGJA 5ER9A 2O57A 3HDTA 1FDIA 4QU0A 5J4YA 1W0KA 4DWJA 5ESDA 4F45A 5JFGA 4V1CI 2Q0HA 2VAVA 3C4VA 3CUSA 4X94A 2HK8A 2NACA 2A33A 3GRZA 4YRFA 5KNCA 1AUQA 4J2OA 2UXBB 3SJ7A 1SKMA 1F3OA 1EJ6A 2Q2VA 1G3RA 4XLAA 1X7HA 1V5FA 3LQEA 1UZLA 3BD7A 3DDCA 4FT4A 1ECFA 4JQSA 1E5VA 3OZRA 2D2VA 3DBRA 5TGZA 2VKQA 4BCDA 1NW4A 1P2GA 1E2DA 4TMTA 3P20A 2WBLC 3HNPA 3L1IA 3K5WA 1HKUA 5G1OA 4R84A 2BP7B 3I55B 2R2GA 4ENVA 1Z5NA 3WJ7A 2OD2A 4I1VA 1GTVA 1VPTA 2H1FA 2DX7A 4MV4A 4PG5A 1JLLB 1K2WA 1QYDA 3DT9A 4KDRA 4MWSA 4FYYA 1JQEA 3IIEA 5IYZA 4KVGA 2GNPA 2VYCA 4M2LA 4RD0A 4ARCA 2GBIA 2AE2A 4N1AA 3UMCA 1RIFA 4IHQA 1L7VC 4F92B 1L8OA 5FBVB 1ACMA 4AIRA 1EGAA 4JC0A 1KAMA 1UJ5A 3IT3A 1OPXA 2X0RA 2ZJYA 4PO1A 1N7GA 4YJKA 3RJMA 1EXMA 2J67A 3HDJA 4BV8A 4OB7A 1VE1A 3GLHA 4RJKA 2HI0A 1KFJB 2G70A 2X1VA 1WXHA 2XEXA 3ZV7A 4MA0A 2PLRA 5FWDA 3BY2A 3U9LA 4GL2A 4LS3A 2IEIA 3WB9A 1DT3A 1UOPA 4XUCA 3DP7A 4RZXA 2QRNA 4KK4A 5JCXA 2PM8A 3Q2OA 1VG0B 4HH4A 1VL0A 2WWFA 1U0NA 2XWBF 3AKDA 1KI3A 3F5DA 3GD7A 4EDHA 3CA8A 4YV0A 4I5DA 5GOTA 4EKNB 3ANLA 1JPJA 1LX7A 1NA5A 5CVEA 1JDBC 5AKLA 4PZYA 4HH1A 5BNZA 1L9XA 1J2UA 3QFCA 3S1AA 3T3EA 1WKVA 5BORA 1MC8A 5JJCA 1FLNA 1PEKE 1W96A 2F1JA 3KYCA 4HGRA 4MHOA 4UTZA 4CR8A 3UK0A 3UMMA 1K73D 4XOUA 4P6VF 4LC1A 3K9HA 2JIMA 1ODCA 2BZGA 2V3WA 3S28A 4NYIR 3TS1A 2EJCA 5DK6A 4JIMA 4B84A 1RMQA 1AKQA 2JH3A 3WLIA 4CG1A 2PU7A 3A32A 1EXWA 3BQMB 3G88A 4WPGA 3AEUB 1Z2NX 3LY7A 1UBTS 5DM70 3EDMA 2V4UA 2CV0A 5CA1B 4JP8A 2GA8A 3FH0A 4DR5B 1BKYA 3I61A 1OE0A 1XNGA 1RADA 4LISA 1B2RA 4FB4A 2A1IA 2GPYA 2H9IA 2MT9A 5E0KB 1AHPA 5A5FA 5BN1A 1MIOB 2DCMA 3E61A 5JBQA 2B69A 2Q0SA 4OI4A 1XDSA 3V9PA 2QP4A 4M0DA 3D5TA 1PR9A 3C8MA 4JLPA 4C43A 1AHIA 1R74A 4WXPA 1U2TA 1CZKA 1K8AD 4YAIA 3ND5A 3AHHA 1F2VA 3UFBA 2CZGA 3PD7A 4UDNA 5JCJA 4BV9A 2OR3A 4RKFA 2D54A 3JQGA 1QPGA 4YX9A 1E2FA 4JDUA 1CETA 4M49A 4AZ3A 1Q9SA 1HL3A 1F60A 5BUQA 2R8BA 4RDLA 2FJUA 4K3VA 1ESZA 2J9RA 2OHHA 1UKZA 3Q6MA 3VO1A 3VC2A 4G07A 2AOTB 2X6QA 1T3ZA 1R9JA 1P75A 3CRMA 5AJWA 2DCUA 4GC9A 2FH5B 3SD7A 3RVQA 5E8JA 2CW5A 2Z2KA 3TOVA 3FDFA 3N0TA 2OQVA 1TQ8A 1ZMXA 4QUEA 1QJCA 2J3DA 4IIJA 2VJNA 2QDXA 1K63A 5CHYA 1VIVA 1KO7A 5EE5B 4NFLA 3NDJA 3HBFA 3L05A 3RU3A 4A0RA 5BVHB 4UDXX 1E66A 4B9AA 4RAQA 2ZL6A 2A92A 3FMIA 2Z3VA 4B8WA 5C8XA 3QBJA 1DXOA 3DQQA 4X6XA 1E3JA 4CDMA 1YF3A 4R0MA 4LOAA 3ZE2B 3BC1A 2EL9A 3HCEA 4C3VA 4HBZA 3RBZA 5BUZA 4BC0A 4OP7A 3LCJA 2PNJA 2LV8A 3BULA 2CJPA 3BDVA 1PSWA 1GNTA 1XZAA 5FUQA 2JGMA 2HWUA 2OGTA 3HGQA 4G0NA 4GX1A 4KQKA 4PVDA 4F8EA 3HUUA 1N5RA 3VPFA 4BASA 2Q99A 4KR7A 1A5SB 2V1XA 4QULA 5TLSA 1LFAA 4A6EA 3V1MA 4TRNA 2OZLB 4NY1A 3UXEA 3ASPA 2C5GA 4LMAA 4X8MA 2EERA 2NTVA 5EOVA 1ORHA 3I8XA 3ZY6A 2P4HX 2QG6A 3DXXA 3PR1A 5H4GA 4X7MA 4LY3A 3ZE6A 4BP3A 4BTLA 4X3OA 1UJNA 4L72A 2OKGA 4Z9FA 4M89A 4LZWA 4BNMA 3IX7A 1J0XO 1DQZA 1KJNA 3LT0A 4RFSB 4X5OA 5ALNA 4YQEA 3HJAA 4MRRA 4DBVO 3Q8KA 1XRLA 4O5OA 5I6DA 1QTRA 1SC3A 3DF9A 3QENA 1P2BA 1QK5A 3DMTA 3I09A 1QHHA 1WMFA 2PA0A 1OB2A 2O1SA 2I3DA 3ZCPA 4UXIA 4PY2A 3UENA 2C2GA 3QHPA 4NFHA 1TO2E 3RS4A 1I2ZA 1MPTA 1QYXA 2GYWA 1Q3KA 3I3OA 1NQOA 4ABYA 4PS1A 1P0FA 4P58A 2FWIA 4EJSA 5AVRA 1CVLA 3G2PA 5H3CA 1I3NA 3WV4A 4BFVA 4K9MA 1HNXB 5EHXA 1KU6A 4BB6A 4QJ5A 3F4LA 2X3UA 3PR2B 4E5YA 4E5DA 3ZU5A 4EG0A 3QKRA 1LPOA 4CKEB 2CXTA 1R6XA 2C4KA 3R5XA 2OBXA 4N6GA 5F73A 3IEKA 4FHEA 2V6GA 4L74A 4AZWA 1GTSA 2GPTA 2ZJ8A 521PA 3VR3A 4QWWA 4ZEXA 3WIBA 5CLFA 4TV8A 3MWEA 2IE8A 1JHYA 2JCXA 4YBRA 3BZUA 1TKRA 4XLFA 1CXZA 1FDSA 1Y1TA 1HDCA 2CXSA 4KKSA 3JVUA 2QVLA 3W3AA 3E22A 1L4UA 1DV1A 1TVCA 2AJTA 4A8JA 3GLUA 1RQXA 2JIQA 1QRAA 4JJ7A 5F21A 1XAJA 3ZJ5A 4WKPA 3IAFA 5GZ3A 3M4JA 1UPCA 2A0YA 4D82A 2WZNA 3L7BA 2J46A 3DE6X 2P5TB 2JA2A 3UQZA 2QNRA 2F8SA 3F96A 4EG7A 1DG3A 5AW5A 3SMQA 5CBPB 3BMQA 5CR9A 4GU5A 3UBTA 4ALNA 1SUBA 2JW5A 5HILA 1UWVA 4V0OA 4QT0A 5ALPA 3TVTA 1MN6A 2ZB2A 4WGGA 2WM9B 1GYPA 3P7MA 1QFYA 4R2KA 3RSFA 2ADMA 2D1SA 2F48A 1CUJA 3IUEA 4GW3A 4HQLA 2AR0A 3Q7QA 3WK8A 4B8YA 5IKPA 2RGUA 4J2HA 4H7FA 1NJSA 3ZGYA 4DRXB 4KUHA 4QARA 4UHDA 3HP7A 4B31A 1CRQA 4INJA 3UEOA 1ND6A 1Y7TA 2JI9A 2M1ZA 3FSRA 3GZNA 3J7AC 4OB8A 4YCMA 4IH1A 2Y1DA 1VIMA 5BPHA 1GTZA 4PCLA 3ANYB 4IPTA 3N6XA 3T7KA 4DNQA 4W9MC 1UK8A 4QFCA 4FFNA 4FNMA 4JVOA 3DP9A 2ATIA 3OIGA 3TIXB 3RF6A 3YASA 1N7JA 1ORTA 2QM7A 1UD6A 5IAGA 2C99A 3OICA 3W2TA 4S1VA 5KTSA 1G8JA 1RPNA 2Q0QA 4H1VA 5J5VA 5EMJA 2UUBB 3O4JA 3OPYA 3KJFA 3EPJA 2VDQB 1SUSA 2VJKA 1C3OA 1UWKA 1ZOIA 2D1FA 2GF0A 2GAFA 2H1LA 3DTYA 3KFLA 2GCOA 4I4TF 4PSUA 3Q0EA 5F12A 4JBWA 1CYDA 3NANA 5ICMA 3HBJA 3QW2A 1AS0A 3SQNA 4RVSA 3LCUA 2WW8A 3EGDA 3H65A 4RSGA 2F1MA 1AXGA 2FCRA 4MS1B 3PITA 3HSYA 2WWRA 1ZY2A 4ZN6A 1Y4AE 2QJRA 3FVQA 3PPIA 2NYVA 1MCZA 4H1TA 4QGAA 1LK0A 3UJ3X 1X1TA 5EMLA 3H5WA 1CUIA 3UAXA 3RH0A 4BFLA 1ADFA 3H13A 1AUXA 1HETA 2A1UA 3OAAD 4R2XA 1CJBA 1NJ1A 1WL8A 4B71A 1KMQA 1N6PA 2ZULA 1L4LA 3FMGA 5L3QA 2J3JA 4RDCA 1ISRA 1BDHA 4R3UC 5BURA 4KYVA 4IYRA 4QODA 1HDEA 1XWWA 4XUDA 3TM5A 4RD3A 3W5UA 1NVGA 2PZLA 1J1UA 3O7MA 2XUFA 2YVKA 1NVAA 3KJXA 3X1XA 4GX0A 1T43A 3SZRA 1NW6A 1GU1A 4WZ6A 3W5DA 5A89A 3R09A 2JFYA 4NDZA 5LB2A 3NT2A 1TO6A 4HB2A 1KJYA 4QUGA 2PMEA 2OPBA 3JAKA 3BD8A 3RUEA 3UTCA 1UR5A 4B1FA 4C5AA 2QTLA 1H5UA 1N6IA 1IC6A 2BHLA 1NOKA 2WNIA 3F3MA 3SFVA 5JMOA 4DNRB 2IVZA 3H2IA 5JDIA 1QPZA 3P4UA 4CEHB 1GPAA 2GAJA 3F4KA 3PXXA 3ADPA 4TZTA 1RJ9A 3X1MA 2VF8A 4TTAA 1ISGA 1L5SA 2Q3FA 3QPVA 3CSUA 5J2TF 2N1MA 1Q3TA 3JD0A 3GJSA 4EO4A 2DUMA 3G59A 5IANA 3FFBA 3EOAI 4LCEA 5K8CA 4CHGA 1YB2A 2B25A 5EIOA 4PLTA 3D7KA 2DQ4A 2KPOA 1VCNA 3TMYA 1KI2A 3DV0A 3KWJA 3O47A 2AF3C 2Q6KA 1U90A 2I76A 4N5MA 1Z74A 1XZFA 3P0RA 2GT1A 3FZYA 3LUFA 3C1AA 1WEKA 2ZVJA 3BXHA 1GZ7A 1U0JA 2NV6A 5BNTA 1Y1SA 3OC6A 4HZUA 2QSUA 3OPMA 1D1QA 4GGPA 2RAVA 5E7QA 7AT1A 1M1YE 5B3JA 1L7BA 2GYUA 3H5VA 4MUEA 1B3RA 1E43A 1T1GA 2EGUA 1X3LA 2I03A 2OC9A 1IIRA 2QN8A 3IOYA 4PLCA 4KFTA 1FFSA 5DH9A 3DOEA 3WLKX 4MWDA 5IM4A 4LRWA 1KBZA 2HIMA 3GEIA 1U7TA 3MK31 4CMEC 2PGJA 4NV1A 1NBWB 1E5XA 1P2FA 3LC2O 3RS0A 1DKRA 1VYTA 2GFQA 4II7A 4YAEA 2PYDA 1US8B 1P4GA 2O0MA 1GP2A 3G7SA 3IVCA 4WA7A 4OGFA 3F5MA 4ARVA 4DLRA 4EWLA 4ZKDA 2VLIA 2DQYA 1COZA 1B26A 1W76A 4ENUA 1TD1A 3VH1A 1ZPDA 3PWSA 3A36A 3GIRA 2P3QA 4QLOA 3SEQA 3EXHB 1W85A 3THWB 3C4JA 1BRMA 1WMSA 2H4YA 3B9RA 2BEKA 3ZKAA 1RKVA 5EC8A 1KJZA 3KR1A 3FDZB 3GCDA 1UJBA 2MSNA 1CDZA 3RKRA 1QNFA 3PKJA 2ZI4A 1H94A 4XKWA 4XRGA 3VU0A 5BSGA 1Z47A 1U1FA 3ORYA 5CG1A 1GPNA 3ODGA 1A1SA 4MUFA 1KYXA 1RWVA 1WTCA 2O1XA 4YRRA 5KQMA 2FMUA 4UU8A 1I4WA 2ZIXA 4JD5A 3HL0A 2VIIA 4WBSA 3WLLA 4Y2HA 2GD0A 5AUQA 3KZ1E 4LDNA 5A88A 4CI9A 2WVJA 1A8UA 2SICE 4L0MA 4P5EA 5DOZA 4ZV7A 3LFHA 1GRNA 4LF9B 1IG0A 3AUKA 3AR9A 2CCKA 1W5EA 4DQLA 1XVUA 4M0KA 3ASVA 5G02A 2YZNA 1HQYE 1P5HA 1ZUWA 3QLVC 4L8YA 2IXAA 2PGXA 3FOCA 3O8OB 1FP7A 3CF4G 5BUSA 4ZWNA 4C87A 5B4TA 2QU8A 3ROQA 4BMNA 4ESVA 3HO8A 4AS2A 2AF4C 4GVPA 1OGYA 5HWSA 4RPLA 3ZNQA 4B46A 2GD2A 4J6EA 4KRYA 4N41A 4HE6A 2K2WA 4C08A 3LH5A 5F77A 4C4RA 4D9MA 4N03A 1Q1EA 2W6MA 2ODBA 1V7PC 4O4HA 1IY9A 1MP0A 2JKYA 2XNSA 3ETHA 2LWIA 2QTVA 3U31A 4DDUA 4LBVA 3UAOA 2CFRA 3RTCA 5KWEA 4TL6A 4X1YA 1P0PA 3PUIA 3NU1A 3UW3A 4TT3A 5I9BA 3F73A 2NADA 2X2PA 5FI1B 3UMFA 5BT8A 4II2A 3QQPA 4JJ4A 2Q5JA 4AJEA 1KOLA 1ESNA 3I30X 3O4RA 2C2HA 1TC2A 4RU1A 4ZYTA 1NNEA 1E5TA 1V7CA 1UH5A 4X06A 4EB8A 1VQ5B 4KFSA 1XMSA 4Y6QA 4EITA 3U3XA 2XCSB 1MJ5A 4BL5A 4KI7A 2ZXFA 2XZLA 3TJRA 3GLIA 2G80A 3O1JC 5EKDA 2ZIAA 3BSWA 2FZEA 4JC8A 4R31A 4EJ6A 4HXGA 2DGDA 3V2GA 1H85A 2FUNB 1JKMA 2I6SA 1GAEO 1Q74A 2QTGA 2VYNA 1XB2A 1TUEA 3ICCA 5LYJA 3SZMA 3VNRA 4ENQA 3CIOA 4NICA 1QGED 1BAPA 1MJGA 3QE4A 4RGBA 4BKOA 5K20A 5KYYA 1KJ8A 1XQVA 1Z5WA 4MQEB 2J33A 1U11A 2QZPA 5K2MA 4I1YA 1D2HA 2NT4A 3NBFA 3L9WA 3E4DA 3OP4A 4TN5A 4D0GA 1X7GA 4IWYA 4L9AA 4ZVNA 2PJUA 1JWAB 1WM1A 1KP3A 1RHKA 3RSQA 1XTUA 2ONCA 5UKDA 3LBHA 3OG9A 1Q2XA 1V0EA 2XCUA 4A2CA 3WB2A 4N12A 2Q6LA 3IP1A 4URVR 2D8AA 2HJGA 1FB5A 4LDPA 4DLWA 1GY8A 1CJUC 1BMFA 5GVSA 2W7TA 2FTKE 1P17A 2ZU6A 3MT8A 4Z4VA 3VR5H 3K9WA 3ZXUB 2JFOA 4CDGA 5GONB 2AYYA 4GKBA 1BD4A 4YB8A 5DWVA 4EA8A 5C1OA 4G41A 3WGIA 3SSAA 5NULA 1F0NA 1EFDN 4UTRA 2F43A 5BN4A 4FU0A 3ZS8A 2QZ9A 4K9QA 5BV8A 1ILWA 2ANBA 4HR7A 4YJ2F 1CQZA 4YP1A 3LA8A 1WUJS 4M6WB 4W4TA 3M49A 1IXRC 3KG2A 4PFJA 5KYUB 3VNAA 3MTBA 3EXAA 1A9YA 4C4SA 2H85A 4FVTA 5KYNA 1EFAA 3HDHA 5CT9A 4ZPJA 3UA3A 3I12A 1MQSA 1O87A 4H35A 5LMNB 1GADO 1VL1A 3L04A 4AUKA 4C20A 3I9OA 1UJCA 4G0QA 3GZTB 4D3ZA 1Y80A 1E58A 1T25A 1OLUA 1KYVA 4L0QA 3H0EA 4CQLA 3QU4A 1XZMA 1E1LA 3SF8B 1GQSA 1Z0FA 1O95C 1YC2A 2YOFA 1SK8A 3G5AA 2NQ8A 1ZAKA 5TRTA 4F2PA 2O8EB 4N8EA 4E6EA 1X7DA 2AFIB 4L08A 2NVUB 5JNVA 3EHDA 4QBKA 1OUMA 2VT2A 3HWX1 3QG1A 3ADCA 1E4VA 2FPRA 2Y0PA 1X0VA 4PONA 1CY8A 1MVNA 3JVEA 3UH1A 1PE0A 3AR4A 3CGWA 3LUGA 2EX4A 2WYHA 4AM8A 1DZIA 1G5RA 2EJBA 4DLKA 4Y0AA 3N5KA 4RSMA 1TCVA 2YVQA 4JNCA 3TJZA 9ABPA 4PV7A 3V4OA 1KDZA 5IU6A 3C3DA 4MWZA 2P5YA 4Q19A 4JYZA 1KTVA 3DMFA 1IJKA 3IERA 1MT0A 3BGIA 1UD5A 4AUEA 2WF6A 2JLAA 1C4WA 1VJ1A 1K4YA 3TXYA 2ZU0C 4GOXA 2JKZA 1GKLA 4QO8A 2GX6A 6REQB 1EKXA 3HJGA 2W0SA 1UBUS 3BK2A 5AVJA 2YIDA 1J2YA 1NT4A 1RKQA 1REQA 1JSRA 1RXEA 4NYIQ 3VH2A 3BOSA 5DGXA 4OL9A 5A4DA 3EFEA 1EDDA 4W5TA 1KFCB 4ND8A 3HCDA 3I28A 1XX6A 1I0LA 1CBUA 4TUYF 4W9NC 2CK3A 2BFFA 5EZQA 5G4KB 2HRZA 2QX9A 3WLOA 1WPGA 3OPXA 4RL4A 2QLJA 1BWRA 1CG6A 3MCVA 3PEFA 4DE5A 2GPBA 2CWDA 4LYYA 5EUBA 1PZNA 3JALB 3I9KA 4DCUA 4EY5A 1QBKC 3HCRA 3IT2A 4ZALA 4WJLA 3IAAA 4L8WB 1Q16A 3OKFA 4OA5A 3EXG1 4RF4A 4IFIA 2O8DB 3WIDA 3SICE 1RWKA 2V7QD 3B1ZA 3FF4A 2K7FA 1T3GA 4Y2YA 1TYBE 1JFFB 4HX5A 4CQMB 4F04A 3COZA 5GV8A 1DJPA 1WQ1R 3E3NA 3VJMA 1JR4A 2VO1A 5K4AA 1E3QA 2OZEA 2B5VA 1U0EA 1MX1A 2ZYHA 3AQIA 4PSAA 3UKJA 4B34A 4IKEA 3ZHCA 4OFBA 4Q47A 3G7NA 3JQFC 2DSTA 3QVVA 1X8KA 4OMDA 4JKYA 4PYQA 3NNSA 1XZBA 4XORA 1VRWA 3BWYA 3HVIA 1Q19A 2FMHA 2BRUA 2JCYA 4NCBA 4HXEB 5JO9A 2OV8A 3BXZA 4BO0A 2AXQA 2IU6A 3AEXA 3HEBA 4R8MA 2WQ6A 4PX9A 1TT5B 2IYXA 3DTVA 4I14A 4JZYA 2F1RA 3EIUA 5AOVA 2GEVA 3V7YA 3WGYA 1DWPA 2V4MA 3B9QA 2WJIA 3TFQA 1D9XA 4GI3A 3ABRB 3OESA 2UVQA 4IQ0A 4IUBS 1FFBA 4GD3Q 3JQAB 4MSUA 1W47A 3DV2A 1NMYA 4X05A 1U9JA 2UV8A 4E5UA 1QX3A 1FNMA 4PTLA 3TRIA 3KEWA 3F5FA 1ESDA 3EGIA 3SXJA 5JNWA 3PTAA 1J1IA 1EVJA 2WC1A 4IZHA 4HADA 3VNUA 3P71T 2B61A 4MQMA 2NSLA 2R4UA 4ON9A 3V8PA 1FIUA 2YN0A 1J9ZA 5TGTA 1GOTA 3ANSA 5HCNA 1Z0UA 2YFKA 3HHEA 3PS9A 3CSDA 4ME6A 4XOPA 2X5OA 3K31A 5EXDA 3ICEA 1BS9A 1RI2A 2WHEA 1BFDA 4HPXB 3SY8A 3WKEA 3ZKWB 4NU8X 2XWPA 5DN6D 4QTZA 3EXFA 3CCVB 4I1OA 2BTEA 2OFOA 4FDTA 4BWFB 4FYIA 5FL3A 5KCZA 5JALA 3OZTA 1JDUA 5KNBH 1D6MA 1YVDA 4HEA6 3CT4A 3R40A 5AVVA 3AZPA 4IW3B 1CYEA 1SH7A 2V5AA 3O4GA 5BN5B 1MX3A 1T8PA 4YQYA 4CYMA 4XVUA 3WQZA 3EXHC 3LNCA 5G1NA 5T67A 3WWPA 3T54A 1AU9A 3T7SA 1GT91 2FQQA 4QUHA 4QVKA 3I2IA 3A28A 4MGIR 1YVUA 3H9CA 1KVUA 4DDVA 4QPZA 3LPDA 3D5QA 4OXKA 1FY2A 1YHZA 3TQQA 3KLMX 4NU6A 2GTHA 4LQCA 3CY6A 2LRHA 1AGPA 4MITA 3PQFA 1ZZGA 4R1UA 1KEUA 2CLLB 3WX0A 3SVTA 1W0JD 3A0RB 4KQ1A 5J1TB 3OTHA 1CUHA 1DEHA 5A4JA 3DDHA 2WZBA 4EDFA 2INGX 4IWXA 2JFUA 4LHSA 5E3HA 2J9FA 2VHYA 1WW8A 1A8SA 2FPMA 4EHDA 1GVNB 5ALIA 1WU7A 3IHKA 2NU9B 5IKEA 1ZX1A 1XZ8A 2ONKA 5JSHA 3LM8A 2PQMA 1ZD4A 3GJ5A 1TVEA 3OTGA 1IHOA 1TRHA 2PS1A 1KAEA 5T57A 8AT1A 4CV3A 2CDAA 1BCSA 1SKYE 4EHLA 2C9DA 1XROA 1BE1A 2K6GA 2LUOA 4W5QA 1EUYA 2NPIA 2W6ID 3T38A 1Q12A 4HDMA 2ZP1A 1BH6A 3ECSA 5DX1A 1HDRA 3RSGA 2EKDA 1KKMA 1MVLA 3O3OB 4D3DA 4HZGA 1BE0A 4GX5A 4WBNB 3EDYA 4JJ6A 3BX1A 2WJJA 4GM0A 4UXHA 3NTQA 3QYPA 4HAOA 2W2OA 4X20A 5BMVF 2P2SA 3O8BA 2BFCA 2PUVA 3IUMA 5IBRA 1D6NA 1J8QA 3L6CA 5HUJA 2DUNA 4H7HA 2ZYGA 3A8KA 1VE7A 4PPGA 2Z9DA 3BQNB 3GUUA 4OHVA 1A4UA 1BKSB 1Y4DE 1FPQA 2PO5A 1XZNA 4JBXA 3LNTA 4G1VA 1XL0A 2A5GA 2Q9UA 1PR2A 2X77A 3IHWA 3QJGA 4MUGA 4M1MA 2OM6A 1SHZA 2M9MA 3OY7A 3M6LA 1D6JA 4CL0A 1D1TA 2D7JA 3P2EA 5TEVA 1FVXA 2QE7A 1D0SA 2WSMA 3CEHA 3DE4X 5FUVA 4MV7A 4BX9A 1RR6A 4FYJA 1U0SY 4XDZA 3DFZA 5IAEA 2DYIA 1JDNA 1E2KA 2FRDA 3DDSA 1WF6A 4W63A 2RARA 3IE2A 1U2RA 4ZT5A 1WDLA 3ZNNA 5DASA 1L5ZA 2B8JA 2WIJA 4U2GA 4YJFA 3FHTA 5AXAA 4G8JA 3HVKA 4YWJA 2R97A 2PRJA 1PWEA 1GA6A 1R3DA 3IAEA 3MN1A 4GKAA 2PLWA 3LX4A 1CU1A 4DCSA 4CKBA 1W29A 3L8EA 3II6X 2PL9A 2Z8YA 1C8BA 1DS6A 1BXRA 1OFVA 3DM5A 4QQRA 1G2IA 3ABIA 3ROPA 4B2IA 1SIBE 3VHRA 3CNEA 4EG1A 1BVHA 4ZZ2A 4TSKA 5JFTA 2HBRA 4EKYA 3N5CA 3WISA 4IUDS 3ZDEA 3U6BA 4CN8A 4U00A 3HVHA 5EG5A 3ZPXA 1L1RA 4OHKA 3R9WA 5CVTA 5HSGA 4RVDA 4C04A 3TD9A 4ILKA 5JD4A 1OLSB 1QSGA 3WL6A 5HPYB 4QT4A 1J0BA 10MHA 4LJAA 1DELA 5ES3A 1QORA 5K5EA 3OFNA 2W6CX 3DCJA 1TXGA 2XMBA 1ACJA 4H7EA 4OBXA 1KIAA 4RESA 4JGGA 1COWD 1UM9A 3ACCA 1AZSC 2PQ6A 1KZ4A 3CX6A 2OXTA 3ESRA 1AMUA 1H42A 1U9CA 1DFIA 4TKUA 4RA9B 3PKIA 3DPUA 1YKSA 4KQWA 1JXOA 3MG9A 4QOSA 4QC2A 2F90A 2ZATA 1QV9A 1B23P 1XJCA 2GR9A 4HLCA 1KYIA 5C51B 4LXTA 2XDYA 3I6YA 3EGWA 4ER7A 1H1LA 2QIOA 2PRZA 2ZYUX 3K0SA 4XKJA 1N06A 1BE6A 5D7NA 4PS0A 2I4TA 1RPZA 1SHLA 3C0KA 3T5DA 4QDZA 3TLZA 5JVDA 2FN7A 1SZDA 1ZH6A 3R75A 4JLSA 1QC5A 3PE3A 1S4MA 1L1EA 4QDTA 4K6OA 5HF8A 4FMCF 4REOA 1SUWA 4D79A 2JBAA 4M9QA 4DCJA 4EMTA 3G5UA 1KH1A 5ESRA 4RDKA 5EZ5A 2IU0A 4TTRA 1J1ZA 1C41A 4X9XA 3F46A 5JQGB 4KO4S 5K2OA 4B44A 2V6IA 2FN4A 1E96A 2NQ2C 5FPSA 3UFXA 2ZB3A 1VMKA 3OKAA 3NHBA 3WA7A 3T4EA 4UFOA 5AM2A 1M6WA 1PJ8A 3A8JA 5CDFE 2X14A 2WHQA 2D5AA 4Q3EA 2YS6A 1ORVA 1JSXA 5A4MS 4F93B 3CLHA 3WE7A 2Q6TA 2PRIA 3D7MA 4LPSA 4NJEB 5FHQA 3VV3A 2BTQB 4F2GA 1J90A 1SCQA 2CL6X 2XQIA 4UD2A 4DR6B 4JELA 1AQJA 3NYQA 5LOVF 4UATA 4NCNA 2OWDA 3BHMA 5A2GA 4REQB 4UTXA 2TMGA 3KTOA 3QYAA 3SBOA 4RJJA 3P9RA 3VX3A 4TX1A 2BT4A 2Y1CA 3A4NA 2WU8A 3KSMA 3KS9A 4CM8B 3WRYC 1XHLA 3SX4A 1E6KA 4RX1A 4LV5B 3CBGA 4B7UA 3O38A 3FTFA 3N58A 2J5QA 4HN2A 3GRRA 1YRQA 2ZRKA 3PC8C 3F9IA 3I2YX 5AMXA 4C0XA 5CCXA 1DL5A 4YCJA 2HLDA 1HA3A 4XUEA 5I47A 1NVKA 4L51A 4OU5A 1OR8A 4X63A 4AROA 4BCCA 1XG5A 4X7CA 4Q1BA 1OGIA 3EARA 5HKLA 5DNVA 1RM3A 3FFTA 1XD9A 3N8HA 5GJVC 4KBYA 3SYLA 2IYUA 2AB0A 3NB0A 2G83A 5DMHA 2Q8NA 3X1WA 1UT8A 4LQLA 1C1DB 3LYUA 1XRPA 2BGUA 2VHWA 1THGA 3FUWA 4KGDA 3CXCB 2NUPA 3K2EA 2XIQA 4WSOA 5A3VA 3VAYA 4BRSA 4CF3A 3WYEA 2XNDA 1N2SA 3NRJA 4S05A 1GA4A 1QH8B 5DM60 1CJTC 2E1PA 2BELA 2CLIB 4TLLB 5JNUA 4HGZA 1M1NA 2FWBA 5AJTA 4HV4A 5JBIA 5NLLA 5IK2A 1W19A 2YBEA 2H0QA 4NENA 4WH0A 4EYSA 1L7MA 2PRKA 1SK9A 1I36A 1WXDA 4YI3A 2CD7A 2HKIA 4WLFA 2VK1A 3S1SA 1GZSA 4RK4A 4D9JA 3KTAB 4MVJF 3FYSA 5IAOA 1O8BA 1W87A 1K1EA 2GAIA 3SI7A 5JS1A 1F2TA 3FSGD 4FEYA 2ICAA 1V5EA 2GILA 1ZRNA 2XGGA 1EG7A 1DXQA 4KZKA 2IDZA 1I7SB 1VIDA 4HDAA 1WZUA 2Q4TA 2QS9A 1HWYA 2AT1A 3COVA 3DLIA 3I8OA 3UANA 4IHJA 9LDBA 5HRAA 2B4RO 4O2AA 3U60B 1GZVA 1PGNA 1YNOA 2GBLC 3LVRE 5KIAA 3FCOA 3D3NA 2FVXA 3DG9A 4LXXA 1A95A 4WAUA 3FGPA 4J4BA 5FL7A 1M34B 3FHLA 4V0KA 4CIWA 4YAKA 3ZX4A 1T4CA 4AMZA 4JXKA 5IN5A 1LPSA 5GQSA 3KC2A 1C4OA 1Z29A 3ZGVA 1IXYA 3KE8A 2D1RA 3HBMA 4XNFA 2AG8A 4OKNA 1X1SA 3KKNA 3VO9A 4X6LA 5DYGA 2ZKIA 3WA6A 2A9KA 2C4UA 4DGQA 3DGEC 3RNLA 3IXQA 6CHYA 4XLCA 3KIPA 1XZKA 5TPZD 4DCVA 2X23A 1XVTA 2PX6A 2K5UA 5A9TA 3C3JA 2GKSA 2PKWA 1RI3A 3X1YA 2WE7A 3H1TA 2E5FA 3R3XA 1EZ4A 5L9AA 5AVXA 4G36A 3WSWA 4X95A 1QRSA 4PLWA 1GL3A 2VPYA 3PSHA 4PQFA 2GJ4A 4ALIA 3GRFA 3MHTA 3PU6A 3A6JA 5C4MA 1C3EA 3NHPA 1Y37A 8MHTA 1KC8D 1KFKB 4C01A 3LDGA 4XYLA 4OYRA 2J0UB 1NJ2A 1PGOA 3TBFA 5CP8A 3ZHTA 3OEEA 2QTFA 4GKKB 2VZEA 2PPVA 3B6KA 2A0KA 4FUQA 4TQUS 4B32A 4FFSA 1K08A 3NHRA 4MARA 5J5CA 5FX2A 5BT9A 4P2NA 4DR3B 3CBQA 4G4SO 4DHEA 1HG0A 3DUFA 2G40A 4IHKA 3O26A 5I01A 2QZ4A 4NYJR 5KMGA 3ASZA 4X91A 2JKVA 1UDCA 2PZMA 1O6BA 3A1SA 1AN0A 3HKDB 3ZWWA 1M66A 4QL3A 3SJAA 5KWVA 3M83A 1NY6A 1LXCA 2OQ2A 2WP8J 2ZS9A 4FBGA 4IM7A 2J59A 4UNIA 5LZ8A 1IY0A 4IJKA 3ROTA 3WMRA 4D02A 8GPBA 2D6FA 1NU6A 4ZDJA 3ZWQA 3PFBA 2XAUA 6PFKA 1VQ9B 1ZM2A 2IYNA 2PK3A 3UMRA 2WJ4A 2E9SA 4ZVOA 1QM5A 4BNLA 1OU4A 2HU7A 2AYXA 1Z0IA 2M32A 1M6HA 5AJXA 3RJ5A 4YV2A 5BRAA 4PAMA 5AQEA 3CCRB 2D0DA 1QP7A 1UT6A 1XR3A 4Q4HB 4I99A 5L3RA 1TD9A 2G9UA 1R0ZA 2ID4A 3G5TA 3MQ2A 1SXJD 3TE7A 5IYZF 2G9NA 4CKCB 5K0TA 2OP1A 3FUVA 4OAPA 2PUWA 4MQUA 2PSHA 3N2KA 4MP6A 1I0ZA 2XQJA 2ETVA 2IZ7A 3BXOA 3GDWA 3GJ7A 4PFQA 4B4UA 2GVZC 1I94B 2PJZA 5LNK6 5EHGA 5FWAA 4R9UC 4CL3A 3PYXA 3A7EA 4MKIA 1TJNA 2JS7A 3OQMA 5BYAA 1H66A 3K2BA 3WQBA 2AKYA 1Y3IA 1PYGA 2HSZA 1U0TA 1CQWA 1CUFA 1PTJC 3GX1A 4NLLA 3FZQA 4LSWA 4PYOA 4RJ2A 5FUBA 3R7NA 4ETIA 1Z0SA 1MAUA 4JENA 1F48A 1EUQA 2I91A 5AM4A 1TB4A 4CM1A 4EBBA 1II0A 2WZPP 1RKUA 4MQFB 3TBHA 4DHWA 3DOIA 4YP5A 3BMXA 1J23A 3ZCRA 1LX6A 1G5FA 1JH9A 4HI0E 4G8BA 4CM4A 4UTVA 1YRYE 3T3PB 3BDIA 2W2QA 2UUPA 4MLCA 4HDRA 3CW2A 1XJWA 1NVVR 1SBIA 1Y3FE 4HDNB 1TE2A 4R1TA 3LT1A 4OQDA 1PBTA 4OQ4A 4MW1A 3LVBA 4GC5A 1KEEB 3NC0C 1NF3A 2Z5VA 4Q4AB 3AESA 3Q98A 1LZKA 4R2WA 2BHNA 2C8JA 3QKSB 3RJ9A 2GXAA 3UB3A 1J56A 1P2TA 1X1DA 2E6KA 1RKXA 2Y66A 3C7DB 1VZ2A 1J09A 3Q7EA 3ROFA 1ZW6A 2LTAA 2PZJA 3D6NB 3NOQA 4R2JA 4V03A 3P9PA 3ONDA 2XOKA 5DO9A 5TC4A 1N2BA 3ZBQA 1KGDA 2I3GA 4INAA 2C8LA 2OV1A 4M3NA 4F5ZA 1NOJA 4JWTA 4NWIA 2CHVA 1ZGZA 3TKLA 1RWQA 2P7HA 3W3ZB 3NRBA 2F4NA 4ARAA 3E3AA 1KWGA 3G3EA 1CEEA 1CS0B 1ZONA 2FZKA 3DKIA 3LCCA 3RYIA 1POXA 4AI6A 2GJ8A 2HFKA 4L5CA 5EY5B 4E6PA 3NKLA 2X1LA 1WBJB 2RD2A 2QLTA 3LFUA 1RZ3A 1Q91A 2P5SA 3HN7A 3PJDA 2UKDA 4MI3A 2DMRA 3UV7A 1WQ3A 3HLTA 3D4LA 4IJMA 2VT6A 2D06A 5LLDA 1BOFA 4B3SB 3PNMA 3IDAA 1XTRA 1I33A 2QORA 3TDMA 4UOZA 3PGLA 2Q4DA 4IUYA 2P2GA 4NS1A 1TCCA 1RHJA 3OT5A 3GFGA 1XFAA 2QSYA 3NBAA 4PO8A 4R54A 3K3PA 4TS1A 3V8QA 3UC5A 2FJPA 3IULA 3JWHA 4ZC1A 1AUOA 1SEVA 4BNHA 3RUIA 1Z17A 2VT7A 4IIJF 1UK6A 2PSEA 5IWAB 1E3XA 2OBNA 3QV2A 5FBWB 2I2BA 3Q9UA 1SQ6A 3CYFA 5J47A 3COPA 4BLQA 1BYIA 2WYOA 2OHFA 5K8VA 4PLFA 3QFHA 2D3WA 2CC2A 5EWLA 3HWSA 3TZQA 3KR9A 4XL9A 3SQMA 1N3LA 5TE9A 5K0LA 4BIMA 4M8KA 4EPXA 4KR6A 2J3EA 3RLFA 2FV8A 2VK8A 1ICIA 1ABFA 2WVAA 3L92A 5CFMA 2O0HA 3D3EA 1IBLB 1M9NA 2FWPA 5DI3A 1WNTA 1GRCA 2EZTA 3SQOA 3SZUA 2FDCA 1YULA 3HJNA 4KAXA 1AQYA 4ARZB 1QTQA 1RAEA 3G0OA 1OZ0A 2RJNA 3OLYA 4II3A 2ZREA 1ULAA 4CVNA 1GFZA 3NHSA 3ESCA 4YHHB 2XHZA 4TMVA 1BC5A 5ITSA 4X07A 1N9GA 3KRTA 2QTRA 1U0RA 1RABA 4CT4B 2ORIA 4BXOB 3LUKA 4DBLE 1TJPB 1NXTA 3ILYA 4GE3A 4GMHA 2I6TA 4PLGA 1P6QA 3N6VA 1YU6A 2C5EA 2O52A 4BECA 1BKDR 2FMTA 1ZJ4A 1ZJ6A 4YQFA 2BHSA 1YJ9B 4CQNA 4UDOA 3UGKA 2WF7A 4OB6A 4ALMA 1HQDA 2JHCA 3PYLA 2VWGA 2V6JA 3DGFC 3FPFA 4V0MA 3P0IA 3SQLA 3VU9A 4BV2A 4TZ6A 4YMUA 5ALUA 5CEFA 3WB1A 4XIFA 3EVBA 3VHXA 5G0WA 1THTA 1UKVY 5F9FA 1X7WA 1LBSA 1K9SA 2JI8A 4JB0A 2FUKA 3WIUA 4CLOA 3L4SO 5BQXA 2Q49A 3TLAA 4TTJA 3EGOA 4OJMX 2NG1A 4MK4A 3KKOA 2FQYA 1NAHA 4IOJA 4CKWB 1R64A 1UAYA 4BRZA 4MV5A 4ZOLA 3USCS 1TJ3A 3BGDA 4JJZA 4M1EA 4EL0A 4FKMA 3ZWBA 3VU8A 3DZGA 3CM0A 5LD2B 4KC0A 1R10A 1EPUA 1NN5A 1SR8A 1FMLA 1M8FA 2FEWB 2WTNA 4KV9A 4XYMA 1P74A 2JK1A 4GLOA 3R3UA 2XVAA 2D7CA 4GI1A 2ZRMA 4RNDB 4Z8YA 1KZ1A 5KTTA 2GK7A 1WV1A 1E69A 1N6OA 2FNAA 1ADYA 3DO5A 1J49A 2PSFA 3IPAA 2ZI6A 4UMDA 4TV8F 2AN3A 4LGVA 4LWOA 1OAKA 4AW9A 1U63A 1U8CB 3NM4A 2F3PA 1GZ6A 3QTBA 4G0WA 4NMMA 4AO7A 3IE0A 4COOA 1VDMA 1DWOA 1UKYA 3PFWO 1YIOA 3TI9A 2CXRA 1OLOA 2W8BA 2ZYTX 5LQMA 1F2UA 1TKBA 4KXNA 4R69A 3KR0A 2ZRAA 1A9ZA 2XVYA 3QPWA 3CVVA 1XPRA 2VOJA 5LR6A 3IBSA 3Q8WA 1E9CA 4IIFA 2VWPA 4R2MA 5G0SA 3RYFA 4F3YA 3TNLA 4Y6RA 2GXSA 4I50B 3NVKI 1TZMA 3PXDA 4QXPA 1FRFS 5DI9A 3CU5A 3V8VA 4DABA 4AMVA 1A1VA 1YO6A 1ZN2A 1QYIA 1YQEA 4HYQA 4GDMA 1NF9A 4K6GA 3R0QA 1EP2B 3EWSA 4A1OA 1NOIA 4PGFA 4ZJZA 1KS2A 3KT6A 5KINB 3IAM6 4LA4A 4F21A 4MS4B 4V0RA 3TCNA 2XADA 5AOCA 5FTMA 2HSWA 2WWHA 3ZQUA 4CPDA 5CCDA 4DA9A 4LKOA 3NHYA 5JAHA 1QOPB 2C8KA 4PNEA 1L7XA 5IC4A 1Y98A 4IP0A 5DNCA 2ZWVA 1B6GA 1BOOA 2B8WA 4CM9A 4WK4B 3PJFA 3M81A 1NDQA 5AHRA 1A8HA 5G4LA 3C7CB 4BNUA 3QVGB 1MABB 4U39A 2PAFA 5BVGB 1EBUA 2ZWOA 3HPRA 4LZOA 2R9VA 2ORVA 3PC2A 4OPMA 4XVRA 4RPHA 2ECFA 3EW7A 4BAGA 3WNVA 1E0SA 3MT7A 3U0VA 1PCXA 2B3TA 2I62A 5GM1A 2XUDA 1PEDA 5JCPA 3UAYA 4D9FA 4ZI7B 1D8TA 1BFKA 5EIHA 2REQA 2HBQA 3HGTA 4WJZA 1HE4A 3QX7A 3OO1A 1CUCA 3EAFA 4KLNA 2HA7A 4UUPA 5D5HA 1QRUA 1WE2A 1XEWY 3H5AA 4P0TA 3K1YA 1PDWA 1AX9A 2YFYA 4EKDA 1JQJC 1F0YA 2B7CA 1A3CA 3HCWA 4IDDA 3WK5A 5HUQA 2XXAB 3AOEC 3H3XA 4KN6A 3OJCA 1V96A 2ZIVB 2FPGB 3EIOA 4LSMA 2PMBA 3BFPA 3BWXA 1RYEA 1ZLYA 3RIXA 4QDOA 3TGPA 5C7OO 5BXYA 1AKYA 3ONYA 2VP6A 1TYCA 1T1JA 3A26A 4PYIA 3DONA 3D43A 4YN3A 5TPWA 3AF1A 3IAS1 4XB1A 5JUWA 5JI2E 3LHIA 4BQEA 4PX3A 1VBMA 3C6YA 5JS7A 2AEMA 2OCLA 5I7WA 2ILVA 5CYFA 5BRNA 2GN9A 2JZOA 2OCAA 3ND8A 4QTTB 3UG6A 4DLAA 3W1WA 3GGGA 3AR6A 3NHAA 1HRDA 3HB1A 4D4LA 2C4TA 3DFIA 1U1IA 2B6NA 3R6GA 4F72A 4TROA 5IHPA 3DFFA 3FGZA 3RUFA 3H5TA 4OOXA 3WJAA 4E1BA 3MF4A 5CITA 1LNZA 4LPKA 3SK0A 3OQ1A 2OZKA 1WJGA 1Z0AA 1S1CA 2NPFA 1I6WA 1C9KA 2NZJA 2AMYA 3ADBA 3G8CA 3SYNA 2A9QA 1IUKA 1RLTA 5KJFA 1MLDA 1GAXA 4AF8A 2FI1A 3S70A 4Q93A 3GGPA 3VRHA 3IIJA 1Y7IA 1O58A 2VDNB 3Q88A 2D13A 1XA4A 1XDUA 4YH1A 1FFWA 4QVIA 1OX4B 2BJWA 1CQPA 4TQAA 2X76A 1GG2A 3ECCA 1ADCA 3L8GA 2O2ZA 2TYSB 3JD4A 4OM7A 5HRCA 2IS2A 2R5NA 5KTYA 4O4IA 2P1ZA 4EF5A 4DV1B 1E2JA 2QPAA 3ROMA 4EHAA 3K0EA 5ANRB 3NJRA 2RE8A 4M86A 4QM6A 1H9CA 1SUAA 2FSFA 4RENA 1V8ZA 3PVSA 5JMPA 5A04A 5I9NA 1TIPA 1L6RA 2ZYVX 1V1RB 3E27A 2E48A 4P93A 3RU2A 3SHOA 3LRTA 1BHSA 2P0YA 1WUKS 3H9UA 4IDNA 4FYMA 1HRKA 3ZZNA 2PYIA 1O3YA 2V0CA 3QPCA 4WEQA 1PBNA 4YY3B 4F5EA 1G9XA 1YZTA 4DIDA 5KWIA 2BF4A 2Q5CA