3W2GA

Crystal structure of fully reduced form of nadh-cytochrome b5 reductase from pig liver
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
271
structure length
271
Chain Sequence
b'TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
molecule tags Oxidoreductase
source organism Sus scrofa
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
total genus 75
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2gA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2gA02
1VQ4B 2EIXA 2OK7A 5THXA 2BPOA 3MMPA 4B4DA 3E1YE 4G5GA 4P3YA 1QVFB 1FNDA 1D8TA 4NCNA 3OJXA 2OTJB 1KC8D 3FJOA 4LBWA 2BM0A 4G1BA 3G6EB 2BGIA 3G71B 2QTZA 3CC4B 2VNKA 4J0QA 1CNFA 3JQQA 1G7RA 1YJWB 1K9MD 1F20A 4Y7CA 2YWFA 3AGPA 1ZM4A 2B5OA 3CC7B 1DDIA 1KJZA 2ZITA 1I7PA 4AF6A 1VQ7B 2BVNA 3SJZA 3ZZ0A 1R5NA 1FRNA 1EP1B 1H85A 3AVXA 3W2FA 2QA4B 1VQ8B 2AHOA 1N0UA 3CCRB 3P27A 3FPKA 1QVGB 1FRQA 1G7CA 2QDXA 2BN4A 4FK8A 3J81k 1EWYA 1R5BA 3QFTA 4DQKA 3B82A 1QGAA 3U2QA 4DQLA 4B3XA 4U9UA 2BMWA 1AIPA 1GAWA 2VYQA 1W2BB 2QEXB 3AVUA 2B7BA 3AVVA 1QGZA 3ZZUA 1GJRA 1VQ9B 1KK0A 4M1KA 3I1FA 2DCUA 4C43A 4MYTA 3OZVA 2XNJA 3ZBTA 3QFCA 2FX3A 1VQNB 1B23P 1NJID 3CCEB 4TMTA 1K8AD 2QTLA 3CPWB 3CCSB 4EH1A 1GVHA 1ELOA 1E64A 1TLLA 5HXBA 2YWEA 1F60A 1ZM3A 5GV8A 3OJWA 3CCUB 4ZCIA 1W34A 1J9ZA 4UAJA 2BM1A 2BF4A 2PIAA 2GQFA 1TVCA 3OZWA 4Q7JB 3VO2A 2XEXA 1VQLB 4P6VF 1QUFA 2BV3A 1BJKA 2CRVA 5DSZA 3ZZTA 1KTVA 1WDTA 4TMWA 4B47A 5TR9A 4AC9A 4NBSA 2HCJB 4WQMA 1KRHA 1D1NA 4HE6A 1EP2B 3W5VA 2YWGA 2NPFA 3WXMA 1G7SA 1FNCA 2HDNB 5TY0A 4B43A 1D2EA 1G7TA 1EFTA 4B48A 3JQRA 1VQKB 4RD4A 3CCMB 3W5UA 2QMUA 1ZM9A 4C0SA 1YJNB 1YJ9B 1XB2A 2C77A 4ACAA 1OGJA 3WY9A 2RC6A 1DDGA 1EFCA 1SM4A 3ES9A 5KSWB 3CD6B 1YHQB 1FNMA 1ZM2A 3VNUA 3JQPA 1GO2A 1KK3A 1M90D 3I56B 1KK2A 1TTTA 1KQSB 2BGJA 3WNBA 4M2LA 4YHBA 4TN1A 1A8PA 1W35A 1QH0A 4R71A 1YI2B 1FDRA 3U6BA 3W2IA 2DY1A 3W2HA 1IJFA 2C78A 1S0UA 4M0LA 1DG1G 1N8RD 2R6HA 2GPJA 4PC1A 3CCJB 4BPRA 1XE1A 2PMDA 1ZUNB 4ZGQB 1KK1A 1OGIA 1R5OA 3LRXA 3AGQA 3U6KA 4PC3A 2DEUA 1JJ2B 2HMAA 4M53A 1QGYA 3WNDA 2BSAA 1GR1A 5TV2A 2DERA 1N0VC 3CRZA 2RC5A 3LVBA 1YITB 1H42A 4RCYA 2OK8A 4LBVA 3CW2A 1QUEA 3VO1A 1VQOB 1VQ5B 3AVYA 4N3GA 1BQEA 2PLFA 4YAWA 4TMVA 3OW2B 4RD3A 3CCQB 3WYAA 4YAFA 3CMAB 4RD1A 4K1XA 1EFUA 2CNDA 1GAQA 4PGOA 4ZGNB 1JB9A 1S72B 3PENA 1CQXA 4RD6A 1NDHA 3B78A 4MYUA 3OZUA 2EFGA 4QHYA 3W5HA 1EP3B 4QFMA 3WBKA 3QFRA 1YIJB 4ACBA 3LO8A 4AF7A 2D74A 5GV7A 4RD0A 3E20A 4IW3B 5H5JA 1M1KD 3QSYA 5FA6A 2YWHA 4PC6A 3W2GA 3ZBUA 1OB2A 2J7KA 1EXMA 4F7DA 1QG0A 1BX1A 3CCLB 3CMEB 1JA0A 4LBZA 3CC2B 2VNJA 2VZLA 4ZCLA 1SKQA 1E62A 4HE5A 1Q81D 1BX0A 5JBQA 4FN5A 4H9GA 1JNYA 3CXCB 1QFJA 1FNBA 2VNHA 4FWTA 1DARA 1Q86D 1E63A 2QN6A 2VNIA 4LBYA 3ZC3A 4M4SA 3CCVB 4PC7A 4TMXA 1AMOA 2X3UA 1IJEA 2DETA 1Q82D 2XNCA 1QX4A 1VQMB 3P26A 4RCZA 3LYUA 1W87A 5AN9A 2B7CA 3QFSA 1KD1D 3QE2A 4Y9UA 1QFYA 3VMFA 1CNEA 1HA3A 1IB0A 1Q7YD 3AVWA 3MHPA 3AVTA 2E1RA 4Y9RA 3G4SB 4N3NA 5EMNA 1UMKA 1U2RA 3I55B 3WNCA 4YALA 4RJLA 4TMZA 4G1VA 4ZV4A 3B8HA 3CB4A 4RD2A 2OTLB 1VQ6B 1TUIA 4ZCMA 1VQPB 4YAUA 1K73D 3VNVA 1JA1A 3W2EA 5H59A 3A1FA 3V76A 4YAOA 4PC2A 1QFZA 3MCAA 1OB5A 3WBJA 4LC0A 4B44A 1B2RA
chains in the Genus database with same CATH superfamily
1PBTA 5EWJB 3DOJA 2Q29A 3WB9A 3NE5B 4YPVA 1L1RA 4RGVA 1NRWA 4JD5A 2QJFA 5EWMB 3LWZA 2QRNA 1A9YA 3V46A 4R2HA 3G0HA 4AKSA 4LXIA 5JROA 1WXXA 3HVKA 1N0IA 1TNDA 2ECFA 4QZVA 1JIUA 3O73A 5F5LA 4DR6B 5IMBA 3EGXA 1I9CA 4M0EA 4HQNA 3RPEA 4ZT2A 3BXXA 4HGNA 2O7SA 3OJXA 1WNTA 5LXTA 1FU8A 4ZICA 1T6BY 2CHFA 3RT1A 4JY7A 2FSHA 1QVWA 4GPZA 5DIFA 2FMXA 5EMJA 4AP9A 1CUXA 2J59A 3VR5A 3G71B 1PS0A 4EZBA 4ZOBA 2QMQA 2IDKA 1NTOA 2NIPA 1QG2A 3SPXA 2DY0A 4CPDA 1ML4A 1NZJA 1LXCA 2FFHA 2ILTA 2VQDA 3RJMA 4Q4JB 3RGGA 5BSYA 2QRGA 4C06A 4IUCS 2Y2UA 5J2TF 5GZ1A 5T5QA 4HUTA 1LH0A 3LA8A 1DKNA 3HZRA 5B6IA 2AD5A 2RSLA 3NXKA 1YOBA 2UZ3A 4HFRA 3EA4A 4F5EA 2MSKA 4CDMA 3SHOA 5LZ4A 3R09A 2VF2A 2YMLA 3TQTA 3REGA 1GZ6A 4A0SA 2QYSA 4OJYA 2AFHE 4PYMA 3N7UA 2ZITA 1GR0A 3GLFA 1X6VA 1AURA 1XQ1A 2WSMA 4XLFA 3HDTA 5CPBA 3A3OA 2AFIB 5ES3A 2XMPA 4GPIB 3N28A 4LZAA 1ISSA 2QA5A 3FDZB 4FD2A 2AUNA 2NZJA 4R8VA 3HWRA 1WQ3A 4HRVA 1P6UA 1GPLA 2AGVA 1L7BA 3EGEA 4E0FA 4MS3B 2HTEA 2WNHA 1DTWA 4RVSA 4NJEB 1ZDMA 1VQ8B 3C5VA 3F7NA 4OK3A 4BVGA 4LY9A 4RVHA 4Y9DA 1J9GA 3MHTA 3BRQA 1AV6A 3FVRA 3ETCA 3G05A 1MAWA 1AUQA 4P4NA 3AIMA 3A10A 3UK7A 2EJTA 3G9XA 4F04A 2P0EA 4J94A 3PCRB 4D3ZA 2GKOA 4I81A 1GL7A 1G20A 3A9TA 3DB1A 2XQVA 1L7RA 2A0WA 3MERA 1N2SA 2FUCA 2YRFA 2LVBA 1TTHA 4S1PA 4UCFA 3KEGA 4XUEA 1YC2A 3QFTA 3KM0A 1JR6A 4DIFA 4N0MA 1C8BA 4YBRA 5BVGA 3QU4A 4L73A 4UBKA 2VI5A 3QE3A 5JWHA 2XYVA 4BJ5A 4GE0A 2GERA 3LT2A 3QPWA 1Y42X 4L57A 2HGZA 5BP7A 1NZDA 3DXZA 3I37X 2RAPA 2W2LD 5IX8A 4RTPA 4NI5A 1D09A 5JANA 3D3EA 4BVEA 2WT8A 5GM1A 3AVUA 3DFKA 3H7IA 3AVVA 5IWAB 4RVUA 1U9JA 3DLAA 3FIJA 1LDEA 3FUTA 3IIKA 3SG0A 4G0MA 3AF5A 1YTUA 2GAAA 3EISA 4QUJA 4K9PA 1VKZA 4X7DA 2BGMA 4F1JA 3PV0A 4D8WA 3NBQA 5FD8A 5AXBA 3H18A 3RWOA 2IOFK 3TNJA 1A1VA 3ZZ1A 4K6OA 1G3IA 1QVVA 1LK5A 1U90A 3WLQA 5LQMA 2GTPA 1YLOA 5KIAA 1Y5MA 2C8VA 4I1OA 4ENTA 1RWBA 1B0UA 3ZDQA 1Y6FA 3PE3A 1A8IA 3NNNA 4NC9A 5KMGA 2XUGA 3LK7A 5C7YA 1ZESA 4PHFA 1JDPA 1K3TA 4FZVA 4RMNA 4QDUA 5EUQB 1GKLA 2XGGA 3SC2A 5EJ4A 3UBMA 2C7BA 1GYQA 2OD7A 4X5OA 3O8CA 3I9V6 5CDYA 4GQIA 1CUHA 3TTTA 4LY3A 3CCEB 2AMLA 1K8AD 1DRVA 5JAQA 4HAUA 5CDHA 2I2FA 3BK2A 4B4WA 2FXVA 2R8OA 1QNLA 3Q2OA 4ARZA 4KO1S 4UE2A 2ZWIA 2NUTA 3OF2A 3OFVA 3RSFA 1ZC3A 4WBSA 1T9GS 2G1KA 1K3UB 2R6R1 2YYYA 5IBRA 3KQLA 4RTOA 2XDWA 3LPCA 2FPPA 2W2NA 3R6WA 5AM1A 2P4HX 3W6NA 5JMTA 3AF6A 3QEBZ 5TRDA 1WDLA 4QC2A 4AY2A 2OXEA 3KL4A 3PGVA 1BDIA 3D3WA 4N6OA 1BMQA 1IN4A 1RLJA 2BF4A 2NSYA 1X3SA 1UBMS 3R6DA 4ITRC 3WGHA 3G8CA 4Q7JB 4LCEA 3JAKA 3CLRC 2XEXA 1T8TA 1L5KA 1X7XB 4EW3A 4NDAA 1OU0A 2H92A 3TLEA 3RV4A 4QG7A 3OM1A 1RWWA 1UIRA 4NENA 1LSJA 5EIAA 3VTFA 4CCSA 4X66B 5LZ2A 4R8KA 1RBMA 2YQ4A 3MWKA 1YXMA 3IIEA 5D3KA 4G6ZA 2G9QA 4F6RB 1NDUA 1Z4JA 2KMLA 5EE0A 1K4YA 1D1NA 1C29B 4F86A 3RUEA 2F43A 4JVLA 4Z4IA 1V1RB 5CGZA 3TM4A 4LAFA 4A73A 5K45A 3DLHA 3PRHA 3DV2A 5BR4A 1RJEA 1N5RA 1NXWA 1OPXA 4ECAA 2WJ4A 1AHPA 1D04A 3EZ9A 1VHWA 1H0RA 4URXR 4Q15A 1FTSA 2AG6A 3HJFA 2IP2A 1F51E 1XU7A 3ZLBA 3C1AA 4DNOA 3QKWA 5KNCD 1ZD2P 4GR9A 2ZQYA 4KPUB 3DDYA 2NO7A 3L01A 4B32A 1XCOA 3R3YA 2YW9A 2W2TA 4LOJA 1KS2A 4TYPA 1E2GA 1NB0A 1L8LA 1O94C 1VM6A 1UDWA 2HD4A 2JF0A 3EDRA 3L0SA 1GVNB 1OI7A 4HAWA 3TSZA 2HQSA 3WLNA 3NIWA 3I2YX 3EHDA 3RFCA 3DLPX 3ZU2A 4D74A 3A6HA 1VCNA 3C6KA 1UBEA 4FI3C 3VDRA 1IDOA 3GUYA 3SC3A 5JC8A 3KTFA 5KSZA 4UPEA 2J3DA 3HXTA 3TZKA 1LVUA 1SMKA 3IA2A 3LX6A 721PA 1WCV1 4F3TA 4U2BA 4Q4LA 4FFBB 5TMBA 4AZWA 3MWGA 4TKZA 4BNHA 4FHCA 1K6XA 1AC5A 2Q1TA 5BQFA 2OAEA 1PNRA 4GWKA 4B46A 5LQRA 2Z2XA 5EJIA 4LJKA 4BJHB 1KH3A 1UMCA 2QORA 3SQMA 3D4IA 3D0OA 4HWOA 4PAMA 4NXMB 5A5GA 5C7OO 2PXCA 5ADUS 1P62B 3OQIA 5IS2A 2EHJA 3HY4A 2IK8A 2YJ3A 2JDID 3B3QA 1F48A 2M6RA 1ZM2A 2ZKIA 1V0FA 1Z0IA 4WI1A 5LBIA 1K7YA 2PPLA 1TYBE 1GGNA 1KK3A 2OB2A 1G5TA 2IZOA 2OXRA 1XZPA 4MKRA 2K2WA 3ANNA 3W90A 3CC8A 3DMFA 4K6GA 5KSYA 1OBHA 4YHBA 3GNSA 4TSFD 2J41A 3FVQA 2XWJI 3IO5A 1Q7CA 1LDYA 1HEYA 1ISFA 1U5AA 2BRUA 4M1OA 5EKUA 5C81A 1EK1A 1DAKA 1R8SA 4TL6A 3RRZA 1CTQA 3DNFA 3RIHA 4YDQA 1ZOIA 1CVIA 2CWWA 1Z12A 4XR6A 3SX0A 4JDUA 1N6HA 1MH1A 4ND8B 4KQHA 4W6QA 4O8ZA 9LDBA 3TVTA 1ZZEA 2RKBA 3K2QA 2VWGA 2HPHA 3LP5A 4ZPJA 5HOQA 5LSAA 1E3MA 3DMPA 1WAMA 4G5YA 1DV2A 1IU9A 2LIPA 4G5FA 1SB8A 5JT1A 5B1YA 1HT0A 1R0KA 1YQQA 5EWLA 3OOSA 4O2AB 4B1FA 3HXQA 8OHMA 4JYZA 5E38A 3BBPA 1P1JA 4REOA 3RVQA 3TBFA 1F3LA 4CUZA 3SKBA 3NZEA 4LXUA 2Q6KA 4RK0A 4C1NA 3U60B 1OXXK 3D7MA 1OGIA 5IYZF 1KE1A 1RIFA 3EYWA 4L28A 2P7IA 5TPWB 5CP8A 3AJ9A 4ZTBA 3SX4A 1E89A 2EFDB 3JZFA 1CE8B 1WULS 4J0EA 1J9EA 1K1EA 2O3QA 3UH0A 3T9DA 2VYVA 2JHPA 3G2PA 3SN6A 3R6KA 5FADA 2OV3A 1P4GA 3TMAA 4C7JA 3CZPA 4A0FA 5FOXA 4NBRA 3R9XA 1E3DA 3DZBA 2V8BA 2VAPA 1UXKA 3KB8A 3O3NB 2HNAA 4L74A 1GARA 3L7MA 2DQZA 4P5EA 2VP9A 1ZJWA 1EJ0A 2HWUA 4R2JA 3UK1A 1T5EA 2LZJA 1NL3A 2O0JA 2ERCA 1GZDA 4N5HX 4P4SA 1XTKA 4MP8A 3HGMA 4S0XA 1U2PA 5DJ5A 1NFFA 3KQSA 1Q77A 1G9SA 4JV5B 1W9HA 3VNAA 1JQLB 4FGKA 3P20A 3PQ7A 2VP6A 5ALGA 1N2HA 2D1YA 4EUHA 1ULHA 1EUQA 4COOA 1Z9BA 3S2FA 2B6HA 4FILA 4PSDA 3GBSA 4P32A 4Q7MB 5IVHA 1EX1A 4WJKB 3SYLA 3MGGA 5E4YA 3CZ9A 3E1GA 2ZRNA 1YQXA 2GAJA 1B8PA 3S70A 4DLPA 1HQKA 3FNRA 3LKBA 2XQFA 4QYSA 3HCDA 4JP5A 4LKOA 2F8SA 2IOQA 2WSLA 4NU6A 4ZANA 1KPGA 2CNDA 1XMPA 4FYWA 1K8YB 3HYCA 1Z4QA 2GRJA 3IEKA 1P81A 4BNYA 4C1BA 4P8RA 2O0KA 3HH8A 5LYYA 3U7HB 2CNNA 3HBLA 1IHMA 4PGOA 3A1NA 1HUQA 4H7FA 3SJUA 1ZM7A 1BCSA 1B4DA 5AKLA 3WHIA 4D0RA 1E5QA 4DJDC 1P45A 3IIJA 1TJ4A 2QD1A 3FTQA 3OQBA 3SHQA 2JI8A 4ZZIA 1YHYA 3D0QA 4UFOA 1C14A 2OP1A 3I6IA 3S55A 3N2GB 1VCHA 2R11A 4R84A 3V3TA 4MYUA 1XZAA 3SJBA 2ZQ5A 3SC2B 1I1NA 4CM6A 4ZI7A 1T2AA 5A4AA 1HURA 2BEUA 1Y4AE 1GCIA 5GOZA 1PDWA 3K9NA 4BLWA 1ODIA 2I3BA 3X1ZA 5KVAA 2VJYA 4ZU3A 2Z6AA 4M8SA 5ULLA 4A0RA 2WRZA 3F3SA 3RSLA 3OM8A 2J9RA 3FKQA 3LHSA 4XI9A 3E20A 5G0UA 1G8MA 3NHLA 5H5JA 4NE7A 1M73E 4INPA 5A2QA 5KW9A 5D7NA 1I2ZA 1TFUA 5IM5A 3SLRA 5B4TA 2F3RA 1FW8A 3WRXC 2V55B 2J7KA 5CYGA 1QVZA 2QRKA 3O2QB 3QWIA 4BN4A 1K08A 2Z1NA 3GY0A 3OX4A 4OHKA 2A5YB 4TTRA 3C6YA 3PHIA 3OCVA 4BGDA 4QYIB 1U11A 2GJPA 1JR3E 1N2XA 3HZHA 1BS9A 4FDUA 2RGWA 2ZAGA 1CG6A 1BHO1 2WJPA 3HJRA 3PP8A 2PY6A 4ZO7A 2WINI 5KTOA 1I7SB 4OLBA 1JKXA 3EXEA 1A7JA 4XNFA 1KVQA 1XYYA 1X7XA 4JOQA 5FTKA 3KAKA 4C6RA 4GBED 1R0WA 1PFWA 1T5LA 2FE4A 5G4KB 4CLRB 4TLAA 3A6DA 5JJBA 1E1CB 3ICVA 2QU7A 5DGTA 2IBTA 1DINA 2G71A 4GOND 3PD0A 1D1TA 4IKOA 4MR8A 2Y0EA 4R1NA 1PFGA 1E1MA 1VSTA 1H8ED 1G0NA 2RGEA 3EVCA 3QKUA 4GQBA 3T4XA 3QLVC 2WKRA 3HCBA 4HLUC 4GMFA 5AI8A 1D2NA 5AI4A 1GLGA 5GGXA 3CXCB 2CXQA 4LJLA 3QUQA 2L18A 4J7UA 3NTOA 2V1UA 3VJMA 1MIOA 1YJ5A 2VG8A 4CMIA 5JI3E 3OOCA 2O3TA 3E84A 3DEFA 3FGNA 2QN6A 3IO3A 3LZCA 2NU6A 3K8QA 4HMQA 3FBWA 3FUWA 3PXBA 1NURA 2HSJA 4R9NA 1XRNA 4RV5A 4IDDA 4C4ZA 3CCVB 3H4VA 1TM7E 3A7DA 4KYIB 1AMOA 3BS4A 1QTNA 3WRVA 2GHQA 2AOUA 3MCTA 4E6PA 4IVPA 5JALA 4LYEA 4UARA 5BSVA 1XTUA 2VHCA 4RDLA 1F2DA 5IG2A 3QPDA 1WCWA 3MJVA 3N58A 3CX7A 1RLIA 1M5TA 3TS1A 3TXXA 3A37A 4D44A 1YR1A 2HBRA 3N8DA 1WWKA 1XMXA 2I4NA 2ZIGA 1I4WA 1JILA 2GNPA 3QNWA 4ND5A 1JFTA 4RA9A 5DGDA 1WCYA 4BAUA 3ZVMA 2FG6C 5M29A 4IKEA 1PZXA 3MFYA 1KAMA 4EK9A 4GX0A 5TQJA 2ZXUA 2GARA 4XB1A 3RVMA 5KJFA 3DBOB 3B12A 4YRCA 1Z4PX 1Z88A 1RLUA 3C43A 4YALA 2ST1A 2FZKA 3UMVA 4BNLA 3CPEA 2KLHA 3E5NA 5KWVA 3HKDA 3Q3JB 1GDHA 1WBJB 3R5JA 2H63A 3NVMB 1QYCA 4OM7A 2EX0A 2V9PA 5TT1A 2QWXA 1T0UA 4RJLA 5F1OA 1JSLA 1CD5A 5ENZA 5B4VA 4LMRA 1TEZA 3E61A 3G2LA 3WLHA 1RRVA 1XLTC 4EHIA 2MTBA 4KMMA 3G0GA 1T3SA 2AW3A 3PYMA 3CNLA 5K3DA 5NULA 3K9FC 2CC2A 3OQVA 4IF6A 4FHEA 3AC0A 3SLGA 4LVCA 1CJUC 3W77A 1T9DA 3W06A 5B2ZA 4NMHA 1NX9A 3GLKA 1VQPB 4C6HA 4YAUA 2ZDGA 2XUHA 1JF8A 4DCSA 1W52X 1BD3A 3NHZA 2OZEA 4F3CA 1SKMA 5SZHB 4PQRA 4YJGA 4BGVA 2YYAA 4GP9A 2A5JA 4F6LA 1WXHA 121PA 2Y0DA 3GMIA 1OX4B 2YZKA 2YFHA 2ZRCA 4KC0A 2VDQB 4LI0A 1T25A 5EXXA 3OKAA 4DY4A 3QU7A 4D0SA 4OBXA 1NSTA 5K3AA 5FWYA 1M6EX 2IBSA 1UOQA 1PR4A 4FFBA 4U7HA 2EIXA 4F97A 2IPNA 1DQNA 1YR2A 3AM3A 3G0DA 1LBQA 2D3WA 4RGBA 5AQ1A 2PD3A 4GYWA 5JZ9A 1JXMA 4N9WA 1GTG1 4HNVA 4F93B 1Z2AA 3PXCX 2WU8A 3AUTA 2QS9A 3FMIA 2X23A 3G2IA 3MD0A 1U99A 5CW2A 3MMPA 2WYIA 1XELA 2Z08A 2CLHB 4LYYA 4RIHA 4MGZR 4DCCA 1E8MA 1JWLA 1C9MA 3BAZA 5SY6A 4CF4A 2WWGA 4I55F 2FSSA 1CZKA 3T4EA 3TW8B 3V4FA 4B3CA 1FNDA 3KOMA 3ZI4A 2QQGA 2ODAA 2X2EA 4PCAA 4KFCA 1ND5A 1AS3A 1ZGCA 3RYTC 1JQKA 1KZYC 3FH0A 4MW9A 5DMXA 2PJRA 3PGA1 1JDUA 4Z4YA 1H69A 2YJ5A 3EZYA 3H5OA 5DLPA 1VG0B 3M34A 1P2BA 5KKNB 1QYVA 3PIRA 2DLCX 1I3CA 4LISA 2FPKA 1P73A 3L1JA 3LH5A 4JL6A 1F20A 1L5LA 2DKNA 4E2FA 2O9JA 5M04A 2AOXA 3E1KA 2FCAA 3TPCA 1H4TA 3A36A 1ADYA 3BWMA 4FFWA 4IRXA 3OCZA 1UZAA 5IC5A 4B3BA 2IGTA 3L4BC 3D8NA 2GTHA 1OILA 2HJRA 4L0QA 4NYJR 2PS1A 4G0OA 5CD9A 1KC3A 4QVGA 1K63A 2HA4A 3WYFA 4MO2A 1D8AA 2X40A 3VUFA 3V1YA 1M34A 1HE8B 2GF9A 1XAIA 4JWTA 4OVKA 1QGOA 3WLOA 3PA6A 1ISIA 3LGAA 2VDRB 3RS9A 4K6MA 1SWWA 3Q9NA 1KVSA 4OMFG 5LA6A 1BPLA 1KFCB 2Q6LA 2J4FA 3H2GA 4WFJA 5F4BA 2HHLA 1N5JA 3IDQA 3W2FA 1KYQA 1R9GA 2A9FA 2ONYA 5AM0A 4MARA 1I14A 1RWQA 2W7TA 4ROTA 3SS9X 3UYKA 4W5QA 5D6OA 2HRZA 3FFAA 4AN0A 3IE2A 4JJEA 3AF2A 4L72A 5AD1A 4L16A 2J0EA 5CBPA 2WF8A 1D7OA 3QBJA 2XXJA 4YC7A 1JH9A 4D9BA 1WORA 1G7CA 2IP4A 3RIGA 5H81A 2ZXFA 4GZ3A 4OI4A 4PFKA 1U5BB 2VVTA 4DSNA 5BWNA 2QX7A 1ZKDA 1K8ZB 3AI3A 3DVAA 3IXQA 2C88A 3AHEA 4KIGA 4YAJA 3BMQB 1DB3A 1KI2A 1P4SA 4PIVA 3OWOA 3FOBA 2H5EA 4NICA 2NTYC 1M2WA 2VNSA 3SF8B 5HWSA 1I01A 4M7WA 4D41A 4FUQA 1WDKA 1LD3A 4XDGA 3T0GA 2CLOB 2VHJA 1OXBB 3HCNA 5DWQA 1YVPA 1GL9B 1Z6PA 2Y1KA 1O96A 3SICE 4X07A 1XCBA 4MV0A 2IHTA 2DWUA 2C3PA 2JLUA 1T4DA 2P6UA 4ALNA 3O8LA 5GJWC 2H3EA 5EP4A 3QVKA 2WIBA 3Q8LA 4BMOB 1T24A 1GTMA 1PKEA 2JI6A 2HF7A 4YRJA 1GEGA 2ZU6A 4EX7A 2I9KA 1ZEJA 4QUKA 1T91A 2JFGA 3JV7A 5HSGA 1GTVA 1U8EA 4IEIA 2D5IA 3O21A 2WJAA 3P9NA 3R24A 2EG5A 1YZVA 4WDQA 3ZJVA 4D9MA 2D1SA 1KZ9A 2HK8A 5DF1A 3AEQB 4HVCA 3NBUA 2HY7A 3UH1A 4XIJA 3QKRB 2C31A 1NU6A 3JQ7A 1RS0A 4IZHA 4U3JB 4UNPA 1B6TA 1FYFA 1E9RA 1E9VA 1SO8A 5JAOA 4H31A 1KQ3A 1M74A 1B8VA 5T6MA 2PWBA 3IVXA 1X92A 2QOEA 3AY0A 3DXXA 4PZYA 5HVNA 1B23P 1XMOB 1SOUA 2D2IA 4IQFA 4B3TB 4QREA 4I6JA 4TMTA 1MGOA 4PZ9A 1VLJA 4X3CA 2YICA 3E6AA 4P4UA 4GT1A 4G63A 2VPXA 1AF4A 1X7WB 4XWWA 4JR1A 3LQFA 1P1HA 1ZD3A 2Q99A 1IHXA 1JPVA 2FQWA 2I7CA 1EGQA 4LOKA 4GWGA 3TIXB 1GFSA 3NH9A 3KOZA 4FONA 1B7GO 1J06A 3M82A 2XVMA 2N46A 2OD9A 1CIJA 1P74A 3B1YA 5DM0A 3HB4X 4I4NA 1ZNZA 4KKXB 1G16A 2PZ8A 3GGDA 4F9TA 5ITSA 2PBLA 4HN9A 5KTRA 4QBTA 4KRFA 1OOEA 2PIAA 2GQFA 4ZI7B 5A4FS 3TIIA 4MUJA 3UOWA 2CXHA 4IM7A 2O2GA 3RRNA 3WDSA 4EG6A 4J43A 3K6RA 2XZLA 1P9WA 1AGNA 1TJNA 2OM2A 2H8KA 4XR4A 3WDKA 4YJ3F 2X5NA 3OLXA 1KDRA 3O74A 4WE3A 5C4MA 3BWXA 2V7TA 1BFKA 3EGDB 2B8TA 3WLSA 4OJMX 4GMGA 2X42A 2HWWA 4XIFA 1GNVA 1VJGA 1CJCA 2JJYA 1OXKB 2WMNB 1X7YB 1PR2A 4PXSA 5AVQA 3ADBA 1XZHA 3EEFA 2QUBA 4NIMA 4BRZA 4MW6A 2Q41A 2Q9UA 2Z3WA 3FTEA 4RJJA 2QL7A 4PIPA 2AHRA 1E9BA 5FT9A 1Y6JA 4EHNA 2EYQA 4B3SB 4F8YA 1DO2A 2PVPA 4AG5A 4WASA 3D7NA 1H2YA 4FYJA 5T67A 4X90A 4CU5A 4Z4UA 1EWTA 1TC1A 2XGSA 5DM70 3LVFO 1BX3A 1N7JA 1HOXA 1VSUA 6YASA 2OXTA 4NJEA 1TK2A 4LN1A 3TZHA 2G63A 1I33A 4FYVA 1C3OA 2JAXA 4H3KB 3U9SA 2CHGA 3EOBI 3DTVB 1PJ5A 2NV4A 5FWDA 2MINA 3HDVA 4RHFA 3PC4A 4CT4B 1GZVA 3LPLA 1LA2A 5A1JA 2C2BA 1XKXA 3IUPA 4XD7D 2EARA 4I4TF 4XEUA 5HBRA 2Q1SA 1TMKA 1CRPA 2ZSUA 4RA9B 5DCLA 1Z6YA 2ZE7A 4ZXPA 4EHHA 5CTJA 4ISBA 1BKSB 1TA9A 2VT3A 1OZGA 3ZGOA 3SM3A 1LNQA 1UC8A 2P67A 3QXHA 2KQUA 3TWOA 2XCTB 5HCUA 3ZD9A 4RPIA 4YREA 2XDAA 2IXBA 3IA7A 2V98A 2ZWAA 4DR5B 3PHJA 1E2HA 3L7DA 4CLHA 2I3ZA 3FNIA 2LCQA 2NU7B 1LLCA 1I1HA 1R15A 1L7NA 3M1LA 1OFUX 3EXHA 5P21A 3DCIA 1UEJA 2BZGA 1IZ7A 1ZI6A 2BBTA 1SCAA 3H1PA 3LIIA 3CQ9A 3IP8A 3IVGA 4IMRA 4C78A 5CFMA 8LDHA 1P2UA 2A5DA 2II6A 3D4LA 4MEBA 1IHOA 3CB2A 4NTZA 1I6KA 4N9QA 5CNIA 2JAOA 3MJHA 4FOTA 3INNA 3JQAB 3MT0A 2QMYA 3L0YA 2CL7X 4FI3F 2QTCA 5DGXA 3U4HA 1EAMA 5K8UA 1I7DA 2O0HA 1PW7A 4FJ0A 4OL0A 3ZIDA 5A88A 4DBZA 1J00A 1VB5A 2YOHA 4FYIA 5I7EA 1UINA 4KSBA 3VR4H 1A2BA 3WYCA 3AYXB 1Q1BA 3M0EA 1M6NA 4J3FA 4MRMA 2Y1OA 1ZNYA 2JAHA 1I3LA 1KPIA 2IEAA 3G2NA 4GS5A 4AK9A 1X38A 3DAYA 3LVRE 3PHCA 2ID8A 1ZP6A 3R3VA 5HRAA 4DAOA 4AYWA 1M6YA 2Y0BA 1UC5B 3UJDA 1AZSC 1QYXA 1PSWA 1Z34A 3NHSA 4U00A 1ZHHA 4X7BA 5CPFA 3C2QA 2QP9X 5C5IA 3JTMA 1Q17A 3LY9A 2H1SA 2BE7A 1WQ4A 5LZ7A 5I7OA 1ORWA 2COUA 2W43A 3OP1A 2DF8A 3EB9A 4QE3A 1H9CA 2OC4A 2PLWA 5CT9A 1Z4MA 2A30A 5I9SA 2O3SA 4DLWA 1WB6A 3KU4A 2G8NA 1C7ZA 3FOAA 3HYNA 1PLLA 5CX1B 5HS6A 1E2KA 2IQIA 4J0IA 1GGHA 4TN5A 4WKBA 4ME6A 4YDHB 2HDWA 2G9RA 3HPQA 5LD2B 5A0FA 2ZT7A 3TB6A 3QOWA 4JT8A 4N4AA 1PL0A 3AFGA 1XVTA 4MZXA 3N2KB 2BHNA 2EGUA 4P36A 5IAGA 4EY7A 5ABPA 3GEDA 5G2OA 1CQJA 1GA1A 3MD9A 4PO3X 1N9ZA 4OLJA 5KVVA 3CRZA 5HXAA 4BX2A 4D02A 1EDEA 1ZINA 5EKSA 5HKAA 1P5JA 2H31A 1ZCAA 3OETA 3E53A 4B84A 5LDDC 1YRBA 1EQAA 1Q44A 1BVYF 2VA9A 1JDBB 5TS2A 1HNXB 1SZDA 3KKLA 1XJ0A 4R69A 3PEYA 4J90A 4X1IA 4ARIA 4IGKA 2NQ8A 2BCJQ 3HB5X 3JQFA 4FNMA 5DX1A 2BGWA 1OIXA 1GGJA 4D9CA 4KX5A 1MJGM 3M4XA 5FBHA 3BGWA 3AR3A 4GOMD 1GV0A 5KTTA 4BLSA 4R9SA 2OUIA 1P72A 5IDYA 3TD2A 2CV1A 3CWCA 3CY6A 3IR6A 1NPYA 1IG3A 3BWVA 4C0KA 5BWLA 4YAFA 2ZTHA 2OGWA 1M2NA 3IAM1 4L7VA 5EZYF 3EXG1 3TLJA 3A25A 4UE6A 2Q0HA 5HM8A 5IH7A 4PYJA 3IP5A 2ZUSA 4X64B 1DEAA 3HUEA 3RBAA 2ZAOA 1BRTA 4PSKA 2WQ7A 3I9V1 3ZHTA 2LCIA 3EA0A 3ZY3A 3V2UA 1OC4A 2QJOA 3HJHA 3O92A 1AO0A 4RVNA 4J2OA 3U48A 4YIHA 3N2EA 4YK7A 5KJ6A 4M89A 2VJJA 1FSZA 4XD7A 2HEGA 1DU4A 3OZFA 5JPDA 4JLAA 4WNAB 4XKVA 1V4VA 2RI0A 1Q0TA 1YOVB 5JSYA 3D0KA 1R8QA 4I5GA 3KLNA 2GM4A 4I6EA 2PNJA 1C1DB 1YJQA 3EY4A 1KVTA 3MMSA 1PHRA 3TLYA 4CLXA 4DV1B 4RZXA 4DUGA 3VRHA 4UD6A 3T5AA 4UEWA 3LO8A 2FUG6 4Z0PA 1ZXLA 1OU4A 2VL7A 1GM5A 1B8UA 3MG9A 5CB4B 1YB7A 2HMTA 1EUZA 5DKFA 4YWJA 5LB2A 1LLFA 3IEXA 8MHTA 3IELA 3JU4A 4IW3B 3L41A 4IF4A 2W8BA 3BJIC 2ZI3A 2D2EA 1ISRA 1D03A 1ZD9A 3MUEA 1OB2A 3MINB 3UKDA 2J09A 1NYQA 4M88A 5EMKA 1KWKA 2ZPUA 4JUDX 4D9JA 1J8FA 1JG2A 3F2IA 1G19A 1XCGB 3KR0A 3MSXA 1KVRA 3KRTA 3N2YA 4GDMA 3ICEA 1G60A 3DMGA 4M7PA 3LUFA 1NA5A 3PXDA 1UIMA 4WVFA 4BP3A 1HNWB 2VHTA 3LUGA 1D5WA 5GONB 1GAEO 1NR1A 2NLOA 5JQGB 3KLOA 1V48A 4HL6A 5GONF 3HU1A 4IVQA 3R75A 4BMPB 3THYA 2X22A 2YS7A 5DDIP 3E7FA 3U3XA 1F8FA 5HTOA 1DL5A 2BH9A 3ORYA 1K5HA 2CXSA 3IT3A 3V7WA 2XCSB 1RP1A 1Y8RA 5DHSA 3PUVA 4A6EA 2TECE 1P4MA 1XEWX 2PUHA 1LTQA 1UC9A 3I9LA 4WCFC 3E15A 4PYIA 4RE6A 5JCPA 2W6CX 4NHEA 5JWOA 1BWQA 1HDCA 1ZMOA 3PFBA 4R1UA 3TLZA 3W4JA 1MXHA 5HS4A 3A35A 1DKUA 4KFUA 1F9EA 3VNQA 4X8LA 4KYTA 1XZCA 2OP0A 1YDGA 3EH2A 5MGNA 4EG7A 5LN1A 3NIDB 2HKIA 1DXOA 3LTEA 4IDHA 2XDQB 3QKRA 2X6RA 4OUKX 2E48A 1UKBA 5FNVF 1YJCA 3QW4B 1WEKA 3CNNA 2ZBRA 2CDNA 4R01A 3UCFA 2A78A 2YW2A 3QFSA 3D3WB 5EJ7A 1AQNA 4JL5A 1LBSA 2QE7D 2W6ID 1O3YA 4JCCA 4HYQA 4OK5A 3L3BA 3VMFA 3OSZA 1JZSA 3UHOA 3DKKA 1PEKE 1Q7YD 3MWJA 4M87A 2P3QA 4ND3A 1H1TA 1LZLA 5GVRA 3RK4A 2QTMA 3VAZA 3Q15C 2PYDA 1KO5A 5DLEA 4B9EA 1TTPB 1X9IA 3AVQA 3FVTA 4MKIA 4EA8A 1NN5A 3M1IA 4TV9F 5PNTA 4NXNB 4GC5A 4Y2UA 5JO0A 4ZTZB 4LOAA 4J4HA 1UMKA 3WRYA 1SZPA 1VZ3A 1U1DA 2GLUA 1XPRA 5HQ3B 4L8JA 2WU1A 2M9MA 2Z43A 3JQGB 5JNTA 3ZX5A 3H2YA 4QOSA 3N6RA 4XCQA 3P5SA 2QRVA 1ADJA 1YQUA 2GFQA 1C30A 3NFRA 3G23A 1B41A 1JPNA 1MABB 3QNMA 1UD3A 4F5YA 2QZPA 1IUOA 2Q4RA 2Q6OA 2DC1A 3BKXA 4WN9B 4C6TA 2I54A 1TO2E 4EJ0A 4HTFB 5EHGA 3BX1A 1LTKA 5BT8A 3A58B 2DR2A 4XVUA 1HDRA 3FRIA 1KF0A 3GELA 1P8JA 3L49A 4NAHA 5DK6A 2R7MA 1WUKS 4TKUA 1T34A 1IATA 4O4IF 3OE7A 3G9ZA 2NO4A 3PRYA 1A7KA 1IY2A 4PRLA 2LDXA 3ZH9B 2HXYA 3CEPB 1ZQ9A 5FL7D 3ZGNA 4C4RA 1VGQA 1S02A 2MJLA 2PM8A 2QU8A 5LZ8A 5CA0B 1B1CA 2HV9A 4QUZA 1CUBA 2BEKA 3NG1A 3P9CA 3PXXA 4DM3A 5L45A 1BDHA 4Q93A 1CUAA 4KKVA 4YP1A 4DDVA 3RC9A 2HR1A 1H0HA 3SC6A 1KY2A 2KX7A 3SE7A 1SHZA 3INTA 2QG9A 2BKAA 5LVAA 2PRKA 3GJTA 5JSKA 4B2IA 4C29A 2CKMA 1KRXA 1P19A 2D2FA 3BBLA 4ZJUA 3CR3C 3LHFA 4UHHA 1SUEA 2PSFA 5JYBA 4C0XA 3OQIB 1ZCJA 2QTVA 1WOYA 4LXQA 3NFYA 2OB1A 1E1KA 4AJNA 3UT5A 3FJOA 4YUXA 4LBWA 4PE5B 2WD7A 3NIGB 2PGOA 2VF4X 3TDMA 1TQ2A 1ZJJA 3DUFB 4F9FA 2J3KA 1N1EA 2Z58A 1ONBA 5FTWA 1JIJA 1I2CA 1O9GA 4CTJA 1NOKA 3BH0A 3Q0IA 1D2CA 4J0QA 1E2FA 1OLXB 3KQMA 1P75A 4MLPA 4Y18A 1RVV1 1V4BA 4GZ5A 3RTDA 3V4VB 3MQ4A 3IBGA 5FP0A 4OB7A 3OY2A 3DOCA 2PO5A 3BMNA 4HWRA 4OHWA 3WVNA 4LF4B 2SCUA 3S8YA 3I9FA 3M3PA 4XWGA 3W6OA 3KYJB 1WF6A 2QUHA 5FPQA 3ZBQA 3GLIA 1YVRA 1MJNA 4V0KA 4Z9XA 2VTKA 3KJIA 4RIIA 5KTPA 5JASA 3GVLA 1IXYA 5TF4A 4DWOA 1N2IA 4MGEA 2ZSAA 3HJBA 1RHQA 4G67A 2C95A 2YIDA 1U7XA 1E2DA 1J4AA 5A4DA 1IZ9A 3A04A 2OVFA 3WYGA 4EFDA 1S8AA 1U0RA 2YN0A 2ZJBA 3VZPA 1VYUA 3D81A 2Q1XA 4U0KA 1HZZC 3G8DA 2IEDA 4HDMB 3L7IA 3RJ5A 1KYVA 1Y80A 2BLLA 4KOAA 3ESCA 2H1IA 4MV1A 5CFZA 1NYTA 3JATA 4F4DA 4MLDA 2QD5A 5JFGA 1SD5A 3M2TA 3T5BA 1M6WA 3I9MA 4BVKA 5TEVA 1G3RA 1W2WB 3V4ZA 2PJZA 4MWEA 4ZV9A 4TMFA 5DNAA 4GNRA 2V5VA 4MRSA 3HO8A 4PNEA 1PJLA 2ZYTX 1NXOA 2I4TA 3E27A 4MB0A 4PHCA 3RGWS 1CS0B 3DOFA 3RUAA 1F1JA 4OGGA 3ZIUA 2L69A 3ZWQA 2JIRA 2KBFA 3NIFB 3EHEA 3QU9A 5HF6A 4UQPA 2PMKA 3R0VA 1YUMA 1ZC4A 4M7RA 4RS3A 4NYIQ 4CM4A 5LMCA 2W6JA 5J2UA 2AOTA 2IYWA 1WV0A 2QN3A 4HRAA 3DMNA 1CUSA 5CRIA 5EYPB 3KR9A 4RPJA 2TRSB 4CMGA 1B93A 3HU3A 2OY0A 2ZI5A 4E5DA 1KA9H 3E05A 1X13A 4O4HF 2BE9A 2AL7A 3KB2A 3WTCA 1JHYA 2ERYA 1VQ9B 2RHCA 2HMYB 4DTIA 2O19A 3GPDG 1ISHA 4IXNA 4V1CA 4I8XA 3ZE1B 1WD5A 2W4QA 3GFBA 4RK7A 4PLCA 1C30B 2BKLA 3LS2A 2CD7A 3WLJA 5KYWB 4PRKA 3PT9A 4N1AA 4IGFA 1Z15A 4ZZ1A 1BU5A 2F1JA 1CWUA 1QHHA 2ESRA 2EKDA 2YS6A 3OZVA 3B6KA 1SOWA 5E8JA 3VR1A 2ZUTA 4CJXA 3CVWA 2CE7A 3PEUA 2XNJA 1MOPA 1T9CA 3LRPA 1SC1A 3LQ2A 1XWIA 4DJFC 4HDKA 3OEWA 2NU7A 2AG5A 3QQPA 1NVKA 5F4MA 3LX4A 4I4TB 5CEEA 4JI7B 4HUJA 3KT8A 3QM1A 3JCZA 3OI7A 1P2FA 1O0SA 1EFVB 1SCNE 3ZEAA 2RGAA 2WYUA 1Q3HA 3CRQA 2YJ6A 1GVHA 4AX4A 3P52A 3SMQA 4C0QC 5I48A 4JMPA 2GDJA 5T3UA 1CHNA 3C4JA 3IRVA 2G25A 4B3MB 1IN5A 5C8XA 5B58C 2AD1A 3BJEA 3SLNA 5GV8A 2K2QB 2IXAA 2P2SA 1JP7A 4Z1MA 3S2GA 4NZPA 3G2OA 1TB4A 3C3CA 3F90A 3LLVA 3DWEX 1VIDA 2JC3A 4IGAA 4ZU1X 5LP1A 4KEAA 3WZLA 1RBYA 3HB9A 5AOAA 5D51S 5CEJA 2RHMA 2VTEA 1U3GA 2YWJA 3DHEA 2C1ZA 3KJNA 2Z1DA 3GBPA 2PTHA 3PR2B 4P92A 4TV8B 4QVIA 1ZGHA 2X4GA 4R2WA 3UWMA 1ISGA 1XZEA 2VP5A 2YXDA 3HU2A 4FBLA 4TL9A 4DS3A 3FVWA 5DSZA 3ZZTA 1DDOA 1OLSA 1N33B 2PL9A 1DCKA 3DFFA 2XNKA 4KQEA 4P7JA 3CLUC 1WZCA 5L46A 4B47A 1E43A 1BOFA 4MB6A 4W5JA 4DCPA 4IFEA 1EFKA 1PT6A 2GCPA 4IEFB 3KXDA 3JTEA 4DIDA 2P3OA 1DKPA 3FPHA 4MUAA 4E31A 3PK0A 4FT2A 4GX1A 3D26A 1FQJA 1NW7A 1UZMA 1BXGA 4WADA 2B78A 1NF8A 1O95D 4TXMA 4RQTA 4E5VA 2YWGA 4I5DA 3DQQA 1JU3A 4LZNA 3R7WB 1PX2A 4YGXB 3VHQA 4EW6A 4JH0A 1NVWQ 2IV7A 3WXMA 3WO0A 4UXIA 1GD1O 1G7SA 2EATA 3EG9A 2H4HA 2JIOA 3P2MA 1NMQA 1IJBA 2VJKA 4UNQA 5DBOA 4QM7A 2IHNA 4TLDA 3FMFA 1K98A 2MR5A 3RKUA 3VHXA 2J9FB 2A88A 3GP8A 1D2MA 4RZHA 2V7BA 5HF5A 3I04A 4LYFA 3NOOA 5ALRA 2VHYA 3NKFA 4YRAA 2CL6X 3ZNOA 4TV9A 2IS4A 3AKZA 3NEJA 4CKCB 4K6KA 3IUSA 2AJTA 3VDMA 1NW3A 4QTTB 3CCMB 1KFKB 2E82A 3H2KA 2O23A 1ZM9A 3R0ZA 1W4LA 5E6RA 1CR4A 2QLMA 1WXGA 3PPIA 1YHNA 2WIDA 5EMMA 4H3VA 3QRWA 2AFHA 2PUGA 2WU0A 3ISTA 3THWB 2YWXA 5AT1A 2XT0A 4ACAA 2JIBA 4FZJA 4Q4AA 3UFXA 3VBEA 3A6PC 3AONB 3DUWA 1MV5A 3TLXA 3IBFA 3IDZA 1UC4B 2X7JA 5KSWB 1ZD8A 3ELBA 2FUKA 1RPNA 2PPVA 1M1YE 4WNYA 2O8FB 2CHVA 2FEOA 5CLJA 4UXHA 2OA0A 2RKOA 1W0JD 4D98A 4OPVA 2IHJA 3EGXB 2OOKA 3QLEA 4GSKA 3NWBA 2C1XA 4TS1A 3SSMA 4DBLE 2OKCA 1COWD 4DANA 1FLAA 3CWQA 3RFTA 4TYQA 1JGTA 2QR5A 3IB6A 5JPIA 2QM8A 3V3KA 3DDSA 4X1YA 4ZEVA 3TFQA 3VR6H 1RI2A 3T3NA 5EKTA 3BGOS 4E32A 3BRSA 4UJ5A 1G2QA 1WLSA 2VPPA 3GGPA 2Q5LA 4H35A 4GZMA 1Y5RA 4HEJA 4H6PA 4MYCA 5FCDA 4GI1A 1IM8A 4FNOA 5E1OA 3S2UA 3WICA 1YI2B 3HNRA 2DULA 1KJIA 3G02A 4E08A 5KWEA 4K81B 4G2NA 4CT5A 3BF8A 3UANA 1XD9A 4HR7A 4OOEA 4J6EA 5JS1A 1QQ7A 4JYAB 4KN5A 4P7GA 1RKUA 2P5YA 3T1VA 2JLBA 1JECA 2OG2A 4KACA 4J03A 2IE0A 3A26A 1KO8A 3RHFA 3ZNPA 3ZTTA 4RSGA 4Q7QA 4MVJH 5JAUA 2XR1A 1JS1X 2PX5A 5KWIA 3GL9A 2AN3A 3WRXA 1N6RA 1GPUA 3HABA 5IXYA 3KBOA 2XHZA 3H87A 3AB8A 5C31A 1JT2A 1RAGA 1OD6A 2GESA 3ACDA 5AW3A 1XG5A 3CCBA 1KK1A 4IJVA 3N2IA 5DRYA 3IT0A 2NYUA 3JQDA 1ABFA 3N0TA 3NC0C 1XA3A 2DYKA 3DPIA 5F35A 2R66A 1L5RA 1G42A 2BFBB 2YDXA 2ZSJA 3ANMA 3AHGA 2NNLD 2CBZA 2RCYA 3I04M 1GZUA 3BEDA 4MYDA 2CMGA 1V45E 4ID3A 3L4KA 1N0VC 1AA9A 3D6MA 3RYCA 1XQYA 2R8BA 4QPPA 4Q9LA 3VH3A 5T57A 1CRLA 1VECA 1DXHA 2DHDA 2Z4TA 1C0PA 3EZ2A 3MT9A 2OO5C 4P9NA 4IXMA 1ZCZA 2AEFA 1K89A 2C2XA 2ZJ1A 1BD4A 5GZ6A 1USGA 1YZGA 5JMPA 3FKJA 3I45A 4QPJC 4D79A 4DG5A 2WWFA 1W9MA 2CLEB 3V33A 3T3OA 2CVFA 3JWHA 1AUOA 1UBTS 2G40A 4NEGA 3LLUA 3UN1A 3IOBA 3BZBA 5DLYA 4FQ8A 1QPZA 5JNSA 1KFBB 4BQFA 2GHIA 5DOZA 1N2CB 3SKYA 4PQYA 7YASA 5HBGA 1Z3IX 5K6RA 4YAWA 1NQTA 2Q46A 2C20A 1U1FA 3IVCA 5CH5A 1RC0A 1QFXA 4BVBA 3KXLA 4OP1A 4UOZA 3A6FA 3FMGA 2EBWA 2UYGA 3IBCA 1EFUA 1TYZA 2DPLA 3K73O 4Q00A 4S1VA 4X93A 2HLNA 4ZVSA 3ZCRA 2QN9A 1E2IA 3JQ9A 4MO9A 4C5BA 1PDVA 4BLUA 1JR2A 2I3AA 4A27A 4Y2SA 3I6YA 3NBKA 3QH4A 1QDUA 4NR0A 1RRFA 5FRDA 1NVMB 4NFSA 1I6LA 2E1PA 1J8DA 4HZIA 1YU6A 2QQEA 3BXEA 5KTMA 1N75A 4IDFA 5G3ZA 4O5AA 3M5WA 2ZJ5A 3HCCA 1RLOA 3WHKA 4QXRA 3ZUPA 5DPMA 2EFGA 3W5HA 1XF1A 5ALHA 2HJVA 1QB8A 1FP2A 2OZLB 5KOHA 4I4CA 2VYVD 4BNVA 4IIGA 4F9GA 3N39C 3QPAA 2PR2A 1KEEB 1FX1A 3GDFA 3MS7A 3F6SA 2J5XA 3W7AA 2ANCA 2NP7A 3BL8A 3O9VA 5GV7A 2UVDA 2O5EA 1RKVA 2CXXA 3D54D 3AYZB 4EUKA 2NMVA 4LZPA 2CMHA 3CEAA 4AS3A 4IHAA 1KH1A 5AOBA 3W7BA 2G80A 2FJPA 5DP1A 1I2MA 2QX9A 2DT8A 3QXXA 1FW6A 1F9AA 2CF6A 2VXOA 1EXMA 2XIQA 3ESDA 1K7EB 2AZMA 2XOKD 4OFBA 1FVFA 1EBBA 4RM0A 1JHXA 1ZMRA 2A0XA 2F7SA 2FPIA 2ZSKA 4O4IA 3WB0A 4E2YA 3HWWA 3R3ZA 3DPUA 2VCHA 3JAKB 3ROGA 3NJRA 5LLDA 1WSBA 3O1IC 4UD2A 2KBEA 3DD1A 3G2MA 4RELA 3ZHOA 4KI0A 4O2BF 4PCUA 3PJDA 4HFJA 5CXUA 3AKYA 2R00A 4W9NA 1R0LA 4ZCLA 1RZVA 1XC7A 2Q2NA 3GQBB 2HQOA 1Q92A 2FRDC 2XTZA 3C1TA 4X1OA 3KXIA 3RE1A 1JSXA 5JG7A 1AHHA 3ZQKA 2BP7B 2COKA 2FYTA 3CKMA 2P9BA 1WBBA 5KX5F 3D6UA 4RDHA 2ZXHA 3R3UA 4IFTA 2GCIA 5C51B 1U7ZA 4YRGA 2I1LA 1X80A 2Q3MA 3IT2A 1GSAA 4HNAB 5COBA 3DE3X 3ST7A 4Z0HO 1P7YA 5H1YA 1ADGA 1F12A 2FVXA 4HXEB 4CMEC 3UC9A 1EZ1A 1P1CA 2AFRA 4XUDA 2COEA 1Q86D 2YHSA 4BJ3A 2O8BA 2QDKA 3NBMA 3FAZA 1UBRS 3ZCXA 2ZVPX 3GDHA 3RAEC 2RBEA 1WRBA 4H6XA 1ZIDA 4M6WA 4PC7A 4L51A 4MW5A 3HM9A 5DEIA 3ZWNA 3HEMA 5CLGA 3SI7A 5JXIA 3P26A 1UODA 2Z0MA 3N0XA 4WCFB 4J2TA 5G1OA 1AQJA 2O0LA 2QTRA 1SVWA 1QRSA 2HK9A 3DQPA 2WHEA 4EGSA 1W5EA 1HFEL 2Q6TA 4OAOA 1CNEA 4OYHA 1FDWA 4YASA 3HE3A 2ZRFA 3GN2A 4IIDA 1TGVA 3NHUA 2B4QA 4UVDA 5E7MA 5EVCA 5KREA 3OM0A 3N9IA 1FX0B 5HQTA 5KDLA 2RGBA 5MN6A 3HVHA 2E1RA 3NAMA 4FYXA 4EP1A 1Z6GA 2ZXEA 4XX0B 5EMNA 5TPZA 1V9LA 3RLFA 3WXBA 2ABWA 5B1HA 2V45A 2XUOA 3PXEA 2CHQA 4RESA 3VYSB 4EGQA 3F8WA 4Q66C 2G09A 2J7PA 3PDIA 4AJ9A 4AZVA 2FUNB 5A3JA 3UPUA 2JGFA 1L4NA 1EX7A 2YV3A 4FEEA 4RF5A 5DU2A 2DFVA 4WIAA 1NIJA 3V7NA 1Z45A 1QYWA 2GZMA 3FIUA 3LM8A 1AO3A 3P19A 1GQRA 5K0NA 2CLLB 4R31A 3A32A 3HG7A 4H0NA 4DIEA 1TUBB 2FPGA 4D97A 3PDCA 2JHGA 2O06A 3F3KA 4K6FA 1WOMA 3Q7TA 5H3CA 1N0WA 2W2LA 5I4IA 1QQAA 5KO2A 2DSTA 1D6SA 2VTVA 5KYYB 5LZ9A 1F8GA 3S8MA 3W2EA 2VRNA 4RAQA 2Z2KA 2H0RA 5H59A 4G4IA 1YDEA 3GJ6A 2QLNA 1H1LB 1Z7EA 2QSYA 1P1BA 3BWBA 4OBEA 1OB5A 1NUPA 2P0AA 2XMDA 3UV3A 3ADKA 3FHJA 2WUGA 3WQSB 4MB2A 3NCHA 1QAQA 1UK8A 4KX3A 4ZVTA 5KYGA 2VBGA 1VPLA 2PA3A 2FMTA 1W0CA 3K9WA 3HJCA 4I55B 1GCUA 2OQ2A 1L6RA 2HF8A 1HTBA 4RKQA 4MVJD 3JARA 3CTMA 3KWJA 4MPDA 3N76A 4A5SA 1WXWA 2IUEA 4YYEA 1C0EA 3V7UA 3JQBC 2PHZA 1VKRA 3MAGA 4F12A 1JJAA 4U39A 2PA0A 1IBSA 4HYYA 4IIUA 4ZVVA 3CNHA 1NRIA 1QWSA 2P5TB 1ORVA 3F6RA 3RHZA 3TQSA 3VSEA 5J3JA 2GEJA 3LWNA 1QVFB 4C04A 5ELXA 3ZYZA 4X05A 5KSPA 3EEOA 4JR0A 2H1HA 1EHIA 3WL8A 2BEWA 5FFFA 3EQ7A 4E46A 5FOSA 1A97A 1GT91 2Y1DA 4XJSA 5LCXA 4EPYA 2I5PO 4V3BA 4YUWA 4BV2A 4CM9A 1EXWA 1Q7BA 1YGYA 4ZVOA 2BGIA 5LA6B 2WA2A 2QTZA 2O7NA 3B9RA 1KGDA 1XCPA 2PJDA 2BC9A 5K2OA 2GBLC 3HA5A 4Y2VA 2WT9A 4R2IA 4JKOA 3QKSA 4FFDA 4G25A 4KLCA 1J56A 5ICCA 2QRMA 2J3QA 4CWAA 4K9NA 2ZJ2A 4AMUA 1IUKA 4W6ZA 1LTHR 1ULBA 1XNGA 2ACEA 5FIUA 1PV1A 3O7WA 3AGPA 4L76A 1ZM4A 3RUPA 1YS2X 5HZHA 1Y1RA 3JYOA 3NV9A 3RFFA 2ATEA 3HN6A 1S4MA 2HUPA 3HYTA 3GGCA 4MW1A 3OEYA 1Z6XA 4MGYR 5J59A 1FFDA 2N47A 1QORA 3QFFA 2JKZA 3LKZA 4RJ2A 1L4LA 3MILA 2JJ2A 5CM8B 1XTQA 1PTJC 5JEEA 3AJ8A 2FSVC 1U6JA 2Y1LA 1RYMA 1DX9A 2SNIE 3L8CA 1WIWA 4OXXA 2JA2A 2WWHA 3PFIA 5EINA 3SS8A 1KI6B 3C3EA 4KXLA 4TKMA 3TBKA 1O5OA 3E9CA 3ZE8A 3ZU5A 1Z5ZA 4DSUA 4G2TA 2AHOA 4JXZA 1XQBA 1C7JA 3M6AA 1IK4A 3JYHA 1VA5A 3EIEA 1UD2A 1TCCA 2ZYSA 3EIOA 4N8DA 3TSYA 1O97C 1OX4A 4UM9D 3M3HA 3CNBA 3HEBA 3RV3A 4EY5A 3DL7A 5AVUA 5KVSA 2C7QA 3GN1A 3HHEA 3NDRA 5BSXA 2RJ3A 4Z86A 4WZKA 3SQWA 1DQSA 3WGZA 5DHPA 1XEAA 1XROA 1DIAA 1S9DA 1P0QA 2QN7A 4FK8A 1EUDB 1ML3A 1W94A 5AHOA 4Z9AA 1JJVA 1A5SB 4Q3EA 2Q4DA 3N8IA 4TWJA 5CFOA 2AH5A 4BFCA 4ZMRA 2EX4A 1ETHA 2EZTA 5JZBA 3OX1A 1DC8A 3A1VA 2B4YA 4IDGA 2PZKA 1M54A 1G38A 5BR1A 4C7KA 3ZQ6A 4D8XA 4HLCA 5E4JA 4CIDA 1QG4A 4DBLC 4YUYA 4J0GA 2IPAB 1DWUA 3H6GA 2W9XA 3K5IA 3T06B 2ODEA 4L7QA 4QLAA 2R6DA 3OD1A 4KWHA 2CV2A 1UDBA 1OROA 3K0SA 3MBOA 4CUKA 3VH2A 2I78A 3G0OA 2P6MA 5D3MA 2P6NA 1F7UA 2IZZA 1E69A 4QUEA 1A9XA 2QB5A 5L9AA 2O8EA 2R48A 1UXIA 2P1DA 1EIZA 1UDCA 4TWIA 3VMMA 4J75A 3W6ZA 2O05A 5JH7F 4G0UA 4OUDB 1TCVA 3GUCA 3RVNA 2V0GA 5ESXA 2BUAA 2HCBA 2ET6A 2HQRA 3FF4A 2VKQA 3GMTA 1OLUB 4KWIA 3LTNC 2OHIA 3LT4A 1KY4A 1P2GA 1NXTA 3ACCA 3MELA 4MUYA 1WVMA 2JLRA 4REQA 4K9DA 4TWBA 3ZBTA 1UMBA 5FV7A 2FRXA 2VK2A 3AERA 1EDBA 4IPTA 2XIJA 4MWDA 3ZV3A 3W5CA 1A8HA 1E98A 1P9OA 4Z4SA 2FX3A 1VQNB 4HB3A 1EGMB 1B00A 3HKEB 2CMKA 2EHDA 3ROXA 3T1OA 3NDPA 4YRPA 5DTMA 1Q7TA 5HZKA 1PWEA 5FWXB 1EWVA 1P17A 2B21A 4EH1A 3BZUA 3KYBA 1T26A 4KR0A 4LZWA 4YMTA 4GOOD 1E64A 2XCLA 4WINA 2GUWA 4A2PA 1ESZA 2GN9A 1TUEA 4WLOA 4LDZA 2Q0QA 4DWJA 1L5QA 3ASPA 1WHTA 2HSGA 3D5EA 2P9CA 1KHTA 2VDNB 1OTHA 1P2VA 1NJ5A 2EJVA 2IYXA 3H2JA 3MXOA 4HN2A 4ZCIA 4O4JA 3TQFA 4ZHSA 1YQTA 3H8SA 1G8PA 1X9HA 1BVRA 1G4HA 2ZRBA 2PUJA 2NTEA 2ZJ4A 3USCS 1OAAA 2R1UA 4AF8A 3I53A 5ECDA 1E0AA 3BMQA 3NOXA 1VPWA 4P6VF 1SAYA 1R4AA 1R88A 3BK7A 3I2GA 3QEMA 4ZAGA 1LPMA 4YY3B 1HQCA 4GC9A 3INYA 2G0TA 4V1CI 4J76A 2AKAB 3BQJA 4FFMA 3TR6A 4EHAA 3H5IA 1A8SA 3PFCA 3VPXA 1VLYA 3H5RA 5BV7A 1DX6A 3IAFA 4FE7A 1GNRA 1PJZA 2FFRA 3AUYA 3QMPA 4MYHA 1JYEA 2XY4A 4O63O 5EZ6B 5TJHA 5CFRA 2WF5A 3EVTA 4H7HA 3V8BA 1EJ2A 1OVMA 4IRUB 3FF1A 1NUTA 1UMDB 4FB4A 2SECE 4JQYA 2BFPA 3D1VA 3ZR4B 4A6PA 4ZJZA 4XQCA 5LLSA 1MOSA 1XZLA 3EEQA 3I6BA 4IJKA 3JRXA 1KAQA 2CUNA 2UYCA 1ZWKA 3BRWD 5LP6A 2W2XA 1KR2A 3IVAA 3KQTA 2WVGA 2ZB4A 5E6UB 2ZJFA 1U02A 2NPOA 3A05A 2ZWVA 3BULA 2O3UA 3A3BA 4YCBA 3PXAA 1JNXX 3KUKA 3ZH2A 3HNOA 3R7NA 2GKGA 5EQJB 1AZTA 2ODWA 3M6WA 4TTVA 1N6LA 2XEDA 4WZBE 2H07A 2RAUA 4TZTA 4PTZA 1SBCA 1VFNA 5L53A 1VQKB 1BVUA 4PLPA 4YH1A 4ZI5A 3MWYW 3TX2A 3OT4A 3REOA 3DM9B 2QMUA 3QLJA 3N3BC 1E2UA 2ZPAA 3PDHA 4HB0A 3AV0B 2X0IA 4PLTA 3ZDYB 1ICEA 2VNAA 2YIMA 3F97A 3IQGX 2DPYA 1A98A 3SHFA 3GRPA 3DOIA 4TXLA 4EG1A 1VMEA 1WLYA 2JCXA 2ZBVA 1NW9B 2JL1A 3DL2A 2OVBA 4YCLA 2A5FA 5EKXA 1U8AA 2RC6A 1X19A 2O2CA 2IZ0A 3C7TA 4JJ7A 4MEJA 3BZWA 2O2EA 4QD3A 3B3FA 2CUTA 4AZ0B 2O8CA 5FFMA 5U9CA 1TAUA 1JAXA 4JEHA 2VHZA 4M98A 2I7XA 2X8JB 4B4UA 2HHCA 2ZI7A 1RADA 3H9EO 1XCLA 1YHQB 2IDMA 3AI2A 4YMVA 3DVQX 3RR2A 2DQKA 1WSAA 2JAUA 3ITKA 1H2ZA 1BWPA 2FN3A 5ALMA 2WYOA 3M6VA 1T2UA 2NU9A 2XWPA 3AL3A 5GP1A 1AKTA 1Z73A 3LF2A 4LI3X 4K7JA 2E4XA 2M98A 1YJ8A 1SXQA 4E3WA 4MR8B 4WGGA 4B7ZA 2Q4BA 1ZJ5A 5HDQA 1A9TA 2FZ4A 2ZTUA 2ZROA 4FKMA 2PX6A 4CN9A 1X1EA 3TG2A 3H1FA 1M1XB 1OZHA 1S3IA 4XFJA 1JQDA 1RXWA 1IWOA 2ZL7A 2FXIA 5FR2A 5DNCA 1CEEA 1PP4A 4RQBA 2QRUA 3RC8A 2HLPA 2JEOA 3SR0A 5C1DA 4HGQA 2F48A 3KHKA 3KVYA 1TT7A 1U9YA 1XXLA 2IW1A 3OCXA 5CT5A 4POOA 1P33A 1U0LA 3VOBA 1NVAA 1TD9A 3HYRA 5I4BA 1E1RD 3X2FA 1LFDB 4IUDS 4CF3A 2VJNA 2YXLA 2YZGA 4XYGA 5ERGB 3F47A 3N0VA 1GUFA 5KWSA 3V4RA 2X6QA 1IEVA 4PC1A 1RR6A 4UUQA 2VHQA 2XGOA 3WB2A 4B76A 3UMYA 3U5TA 3GJXC 2ONKA 3LKVA 5AW4A 5DM2A 3FNBA 2H00A 3RIMA 3TLAA 2Y0PA 1LNSA 2AIRA 1AS0A 4LXTA 4PZAA 4CL2A 4PZUA 4UBNA 1AQUA 2JLQA 3OJCA 3OZIA 3FLMA 4I3HA 4C9BA 5J5AA 2PKEA 1MRSA 4Q01A 3CPJB 5FWXA 4KR3A 3PNVA 4O2AF 2PT5A 2Q1YA 2R85A 4U7GA 5TQVA 4PG7A 2QVCA 1R50A 4J1QA 1G5HA 1TGYA 4EJMA 4WBNF 5K03A 1WZEA 4RACA 2WSSA 4RH3A 3N7TA 1JXQA 4FHGA 1H42A 4RCYA 2IH2A 3ZWBA 3VV3A 2RMKA 3D3QA 1RLMA 1OXTA 1H6BA 1ZD4A 1ZVKA 3PQ4A 4MWSA 4N8EA 4Y9TA 2XYHA 3K6KA 1RZRD 2J3JA 1V4NA 3ODPA 3Q3VA 2QTVB 4OH7A 3EXFA 2BEWB 1UZUA 2PKYX 4YJ2F 1XLWA 3P0FA 4WBNB 2J1LA 3X1JA 4TYYA 1L7VC 1R64A 2DCMA 4GZ6A 2PL1A 2PH3A 2G8LA 1VQOB 4PAOA 5SZIA 4BNXA 1VQ5B 2VQFB 1XRSB 4NEHB 5COQA 1SGWA 1GGKA 3G85A 1AZLA 3I3SR 5EG5A 3PFHA 3IUNA 1ADBA 2IY8A 3CCQB 2XXAB 3DULA 2ZYUX 3RYFB 2Y05A 4MTCA 4BTLA 5CURA 4H0CA 4AWXA 4LF9B 4XVCA 1GWNA 1Z0UA 1E0KA 2NUAA 3GLIE 4X3PA 4HB2A 4JGBA 2AV6A 2I76A 2ZBEA 5HKKA 4LJYA 4DMLA 1ESMA 1XFOA 1VFPA 2F3TA 2IWRA 4M37A 2K6GA 3RREA 4EARA 3DTYA 3HLYA 4ZJYA 3TE6A 1FCJA 6ABPA 1RYYA 1YBAA 3AUKA 3GA0A 4DLSA 3RTAA 1JI0A 2FW0A 2XTJA 2JIQA 3PENA 3FCXA 4F3KA 1T9HA 4KXMA 1CY4A 3H84A 4MYSA 2DBRA 3EH1A 2ZYRA 4GQAA 1GU1A 4BQNA 2LXNA 5B1DA 1E5TA 4ZVMA 2NPIA 2OCAA 1SVKA 1C0LA 1NBWB 3GJ0A 5BQOA 4JI6B 5FLYA 4GMHA 3NAGA 3ZHSA 1OFIA 5J5VA 5D1HA 3AHDA 5H8WA 3CUSA 5BSFA 5FTNA 4YTEA 1FUKA 4ENQA 4P98A 5C8DA 3LG2A 2WFLA 3GNQA 5LBUA 4BAGA 3ZJTA 4X6LA 3ASUA 2PT6A 3BRWA 3BIJA 2DIEA 3QENA 5FA6A 5AO9A 2X0EA 1ZH6A 1DV1A 1TIKA 2PS0A 3CX6A 4DIUA 5BUCA 3SSNA 1GPH1 1RI3A 2CNWA 4N39A 1SCUA 2LD4A 1QG0A 3OCUA 3EIWA 1L7DA 4FGSA 3I42A 4BNUA 4I4IA 1S7CA 4YV0A 4QDZA 3DBLB 2CW5A 1T5OA 2VNJA 3H16A 4OPOA 2V59A 1UMBB 3G2QA 4I5EA 4Q9HA 5K0JA 1D6NA 1CEQA 4HX5A 2XZOA 1CCWA 1WABA 1WP9A 1HEUA 4ZVUA 4KQ9A 2RIRA 4KAAA 4LC9A 2FW7A 2Y66A 3PTLA 1QX3A 3WBFA 4DYDA 3A6GA 2V7WA 1LX6A 2H2GA 3K1JA 5H9WA 3QFHA 1TA0A 4YROA 1UFQA 5LYJB 1GLNA 1TAQA 1J8YF 5FYDA 3SXPA 3S40A 1UJ6A 5FEUA 1XN1A 1W73A 1TT5A 4LBYA 3IXLA 1NVVR 1WHSB 2GPNA 1KEPA 1KP2A 5BMVA 3F3YA 4HX9A 3VGJA 3QPVA 5CVTA 1J5EB 4NV0A 3TKLA 5AM5A 4B40A 2GM9A 5EUMA 1U4NA 4EYOA 2VF5X 4LHXA 5THQA 4DLXA 1SU7A 4Z49A 3R2JA 1VCMA 4NCHA 4NZYA 3QEAZ 2B35A 4RPKA 1GOTA 2CLFB 4H2DA 3L7YA 4JBGA 4F4CA 1IB0A 2A59A 4GI3A 4FBMA 4MUMA 1CC1S 1DRWA 1NNI1 1XLVA 2PU7A 1T9AA 1YRHA 1LPAB 1RQ7A 1CKEA 2H18A 3HBFA 3JASA 5D8DA 4PX5A 5DGIA 4RY0A 1UKZA 3RVJA 4EDFA 3GGGA 1R8YA 2YWDA 4MS1A 3SDZA 3OP4A 2CYCA 1QH8B 4RVOA 3WK4A 2RH8A 3ASZA 3DXFA 2OPHA 1C3JA 4MI3A 1DT3A 3AVPA 4XL9A 4RK4A 1GPJA 2IXDA 3UB3A 1JRLA 1HDGO 1GGVA 1W8DA 1N08A 2G4LA 1UP7A 2L0XA 2ZIEA 1PG5A 4NZZA 4YLYA 5LMNB 1D2HA 3Q72A 4K9KA 1BQ4A 1J0AA 3HZOA 2DLNA 3R5TA 4BEWA 1XL0A 1ZMBA 1EGHA 1NJGA 3F8TA 1DMSA 1U8TA 1A5BB 1J20A 2GN6A 6REQB 2C4UA 3WGMA 3WV5A 4FXPA 2F3QA 2REQB 3LFUA 3KXKA 1C1DA 3CXUA 2ZTGA 5GOTA 1GAXA 3PGMA 1AMNA 3KKMA 4O4HB 3TFWA 2Y9PB 2HB6A 4G37A 4I9GA 4IILA 4HX2A 4NHOA 1Z17A 3SEAA 4BP8A 4UE3S 1ZN7A 3RUDA 4OJNA 5AUQA 1EDDA 1E0SA 3DTVD 3V76A 3K9GA 3HB1A 2DUUA 3C97A 4YRSA 4KIJA 3FPJA 2HIAA 2G5GX 1Z83A 3R0IA 1XKLA 2B82A 3DOUA 1VQ4B 4ZO8A 4MR9A 3T53B 4XLTA 1A96A 3WKEA 2R0QC 2JGRA 1SXJA 4E5NA 2W6OA 1GNQA 4AZ3B 2OCIA 3CKLA 3HFSA 1EVIA 3KHUA 4PX9A 3G8AA 5JSHA 1NBEA 2GN0A 1DWQA 4PYQA 2B8NA 2CCJA 4IH9A 4NSNA 1MEJA 3WK6A 5I3CA 1Q12A 5EIBD 1RZRA 4HPWA 2PWZA 4YJKA 3VHRA 4B4DA 2WD9A 2AKYA 4LTDA 3TL3A 5J47A 2C0PA 2BEUB 5M5BA 2YWBA 2P2YA 3KHTA 4X1IB 5AVJA 2VZ0A 4LRSB 1RD4A 3RQSA 1EFPA 1CY0A 3K6SB 4JZYA 4QODA 1G66A 2XQIA 3F9RA 3MLAA 4PYRA 4RVCA 3TI9A 3VTAA 3VPFA 2ZP1A 1EE9A 3OX2A 4Q7EA 3SOZA 1ZISA 5KHAA 4DM4A 2OD2A 4FFNA 2W6NA 3QVUA 3WLFA 1TQ6A 3NYRA 3E1SA 4ALLA 4P58A 5EHNA 4GUAA 3PBKA 3QYAA 3RODA 1Q6YA 2C4KA 3CUKA 1ZYUA 2VJOA 2FR1A 3CRW1 3K0KA 4FFSA 1M2KA 4I55A 4IIJA 2EG9A 3GAZA 4LHEA 3IURA 4QDOA 4EMUA 1QCZA 4DKJA 2OESA 5LP6C 2O7QA 4MMXB 1SXJC 1T0BA 3A1CA 3H13A 4Q1VA 4BU0A 3CC7B 2Q3BA 3LQQA 3Q6QA 3IJPA 5CLFA 1VDZA 3PE4A 4BMCA 4HF7A 3WLRA 4DF3A 4HKTA 3EDCA 1J2TA 4KLRA 3EXFB 4J3NA 2VWHA 4I1PA 2VJQA 1X7DA 2XCIA 1U0GA 3F6PA 1EE1A 2REQA 4WZBA 2QVBA 5KB3A 1RQLA 2JFUA 4AF6A 5HRCA 2HO4A 3RT7A 2DVMA 4K3UA 1L3IA 3WK9A 4BLOA 2C97A 2HRDA 4FLFA 4JIGA 1V1MB 4HIZA 4YCAA 1MOQA 3SHWA 4R54A 3AVXA 2XHEA 1TFRA 3ELUA 1FF9A 2ZBFA 4PAGA 4F06A 4JBHA 5BSWA 5C46F 1QZ3A 4L5CA 4QLOA 5KHOC 4X6UA 2PYZA 2JLYA 5HA5A 4BU1A 2VP3A 4LKRA 3FPKA 2BMVA 5ALUA 5FBZA 3ZGYA 2BZ1A 3HA3A 4Q3LA 3E9EA 4E5UA 1GTSA 1XTIA 1KI9A 4NX2A 3BE4A 3VR2D 3ZK8A 4II3A 4YONB 2GM3A 2BGLA 4MTLA 2AVDA 4UZSA 4RZIA 1QHHB 2J3IA 4OYYA 4DQLA 2Y4OA 1SEPA 1U0TA 2H4YA 4S2EA 3LBAA 1YZQA 1ENPA 4CT0A 3IYLW 3OESA 3HV2A 4LMAA 1QJCA 4H7KA 5FPKA 3HP7A 5DCYA 4N0PA 5IP5A 1Y9EA 2JRLA 2OYNA 1VL5A 4IHJA 3HU5A 4J4BA 1AKVA 4K40A 2GAFA 1XRMA 2VCEA 4BV3A 1Z47A 3I05A 5BRAA 1NG9A 5C8YB 1MPXA 3V1NA 1P91A 5T41A 1QGZA 1DIOB 4AMZA 1D2RA 4AUKA 3ZZUA 4TPKA 5I45A 4CEJA 5AVKA 3HXOA 2FQ1A 1CY8A 2W2KB 4KO3S 1HNZB 4Y98A 1JMVA 2D7CA 1BHQ1 1HMPA 1UWLA 4PNHA 1J5XA 1KK0A 3UIEA 1MEEA 2WJ6A 3KXPA 1P9RA 4G0ZA 3H11B 3N5KA 3GZ4A 3UAWA 4NL4H 3NCTA 3SHTA 1N4AA 1A2QA 1K5DA 2G67A 2YY7A 1GY8A 1XTSA 3I28A 1FVOA 3QBTA 4LJ7A 3P9KA 2CJYA 4M9UA 3A6EA 1TM1E 4EVSA 3DZCA 3QFCA 1NZFA 2XE6A 2CNOA 3QX9A 4N0EA 5KEIA 4LFAB 4HDAA 1XZFA 1NJID 5JBNA 1RMQA 3HV0A 1Y7IA 3QJYA 4MRPA 2GZ2A 4ZOCA 3LL4A 4GECA 2P5SA 4V2IA 1ORTA 1P2TA 2JI7A 1SHKA 2W0MA 2WI8A 2XBUA 1UL1X 3AF1A 2JCGA 3FFWA 1JAIA 2IS6A 2XWSA 4EYGA 9MHTA 2D5AA 3KZXA 4RW0A 3ZE9A 3NDIA 3FUVA 2GNAA 3G2JA 4JLSA 4WZAE 2DE0X 3K0AA 4BBAA 4YJHA 2XX3A 4KE7A 1CQJB 1II0A 4C4YA 2A0YA 1JHAA 1NMXA 3PUIA 3DLCA 2XE8A 3CO5A 2GK3A 4CZ2A 5L7YA 2JFZA 1IXZA 3AINA 4GYYA 1MENA 4G86A 4CFZA 4QEZA 1S2GA 3BORA 3U4CA 2Y6VA 4OQNA 4QQRA 3G1UA 5F7OA 3SKVA 4TUYA 2X0FA 1RMYA 1DTEA 3DD5A 2QTGA 4Y6GB 2XUAA 4L0MA 3LDAA 1NUHA 3K0EA 2PTGA 3CA8A 3H0CA 3AM5A 3EW9A 5L4NA 2FDXA 2FSPA 3LY8A 4UBIA 3STXA 2LP4Y 3HXLA 3CW8X 4CQNA 1RQRA 4HH1A 4AZTA 1EP2B 1GUZA 2JLAA 3SGLA 4H27A 1Z8HA 1PR1A 2P4SA 5E3HA 5LWQA 2Z30A 3QVLA 4HDRB 3KQOA 4NBNA 4Q02A 1SQ5A 3EAQA 2P11A 3IVMA 4WL0A 4DGQA 1N1MA 1PEYA 4JLJA 1LI4A 4G9EA 4E12A 4MIOA 3HO1A 1FYDA 1PGJA 3KV3O 4EBBA 4XA8A 4BC1A 5TY0A 2CLMB 3L40A 5TQ2A 1H2EA 1QP7A 4XYEA 3I92A 3DP9A 5HUHA 3B70A 3ORQA 2R8YA 3IEUA 4K2AA 2SHKA 5JXJA 1G7TA 4GHWA 1BEZA 2VSQA 5DWVA 2GKSA 2QRQA 5B53A 4HNUA 5A71A 2X7XA 3QMVA 4FS8A 1C7IA 1FFBA 5IC6A 5IEJA 1QHEA 3K0CC 4C0SA 3LX8A 3HJNA 4AP6A 5BN1A 4FNGA 1IOVA 2CVQA 4IXWA 4E22A 4K05A 1NT2A 3LY5A 3PEFA 2NADA 5C34B 3OZEA 4V1CB 1B6GA 1XGKA 1P9LA 4MV6A 4OI2A 2R1TB 5AXCA 5K09A 3T3DA 1LDMA 2JAQA 3FNEA 3NM4A 2FP4B 1YL5A 1MCZA 1JHRA 5KX5B 3SZMA 2J33A 3HDYA 1K3FA 1NHWA 2MU1A 4Q1DA 4ZQEA 2P9ZA 1RAEA 2ZIZA 1FMLA 1BCSB 2QYOA 3DKIA 3VSDA 1G63A 5IVDA 1HG0A 4OQDA 3TCKA 1AA6A 4W8GA 3A3GA 1C1XA 1RSZA 3PF9A 2GEFA 4G5HA 2P8SA 4M9SA 4RDCA 4US0R 1IH8A 3QPBA 3TOXA 3DB2A 3NX4A 5HDBB 3L8YA 3A2MA 3W9UA 2RJNA 3Q6MA 3CFYA 1M7HA 3WNBA 2G1UA 4ER0A 2Z8XA 2X0JA 3BMOB 5FOVA 3CF2A 5AK6A 4H7JA 3EBLA 4Q5IA 4RTJA 2R4QA 3HCEA 4WY2A 1DCTA 4Y1RA 4OHMA 4RTSA 1LRLA 1YFJA 5FOQA 4ZT5A 2WE7A 3IOYA 4PWZA 2PKRA 3DV0B 1CY1A 3IAS6 4F45A 1C9NA 3PFFA 4QTYA 1GADO 1XZJA 2BFFA 1BTOA 3AX6A 4N8SA 4DJEC 1I7LA 1TQDA 3PNSA 1IJFA 1ZCFA 2JZOA 2SKDA 2B6NA 3TDKA 2V7EA 3B9PA 4M0LA 4ZT7A 2YKGA 4PHTA 4RETA 4D2IA 4D81A 1DPGA 1ZL2A 2QAIA 3SEZA 1U3FA 3KS9A 2FMUA 4UAUA 5AKHA 2XDQA 3W3AH 4NNOA 2Q5IA 4G1EB 4CM1A 1J2UA 2PGLA 4XWAA 3JQ7B 4U3JA 1EINA 4HLQB 1J24A 5FBQB 1JSCA 4R2LA 1WU8A 1QC5B 1NNLA 1YKSA 3KU1A 4G23A 5G0TA 5JEDA 3BJMA 3NASA 3LY7A 2ZJYA 1YF3A 4F2HA 1KIAA 1UJNA 1MO3A 3LSTA 4HD8A 3ILXA 3Q41A 4WECA 1C5KA 5ERYA 7REQA 5JQWA 2P68A 4Z4WA 4O33A 3RC7A 4X24A 3B7GA 3TTVA 2HADA 3UWSA 5HKOA 3A8IA 5MDHA 2X2PA 3SEQA 2FQXA 3QXCA 4DGSA 4PO1A 2H2WA 4MR7A 4D0GA 1GR1A 2YVUA 2FCRA 3Q8XB 4Y1FA 1I4DD 2OBSA 5SYAA 4MA0A 1NBHA 1RVDA 3TEMA 2FX5A 2OXFA 1KY5A 3PITA 1XZBA 2FLVA 3FNGA 1YJXA 4LVNA 1QFSA 4NJMA 5AIBA 4JHXA 3PD7A 5SZKB 4QBIA 3A4MA 3K0HA 1IY0A 1R5JA 1XRLA 1LV7A 5I7UA 2Z9CA 3EGCA 4OYLA 1WDMA 4QYMA 1E4EB 4EHBA 4CI9A 4HVAA 5A6SB 3CVUA 3U4MA 3FOCA 1I3MA 1QOPB 2WAXA 5ADHA 4CQMD 3GLFB 2DKOA 3QBVA 1FUIA 1QWOA 5MHTA 5EEHA 3ZE0B 1IL0A 2B9VA 3PCXA 3F7MA 1FDTA 4XGRA 2MMGA 3FSJX 3TJMA 3JD4A 4FU0A 4ODIA 5CAEA 5K0CA 3ZE7A 3GT7A 5A4MS 4D26A 4RD1A 3UMSA 2KHZA 3BMOA 3QKSB 4GO1A 4GM0A 2C7PA 2HX1A 4FLEA 4AFNA 4BO9A 3GGOA 2ZCUA 4MAMA 5CVUA 2WE8A 5KJCA 4AYXA 1KY3A 4Q18A 3A2NA 4H7DA 2IU4A 4BQRA 1DAHA 2ISCA 1X1BA 3GYGA 1ULZA 1XQ9A 3NU1A 2CB0A 3KZMA 3VO9A 1ZIOA 1S2MA 2AN1A 1DLIA 1T35A 4Z4TA 3LQRA 4AM8A 4PVDA 4L15A 5CVEA 3HSSA 4B82A 1JFFA 2PX4A 2VJMA 1SUCA 1YA4A 5IKMA 3UEOA 2J87A 1E3SA 1R37A 2YV2A 4RIEA 5DIZA 3JR3A 5TQ2B 3KSRA 3S6JA 5IKPA 3QWHA 5JSFA 2AF4C 5F2NA 1R7RA 5I5EA 2QZ9A 5EXTA 2ECPA 5ITWA 2IU3A 1JAHA 5EJEA 3L4BA 3CX3A 2XB8A 1LPSA 1MG5A 2XODA 1FYWA 2WA1A 4XLZA 3QYJA 2WIFA 5LJLA 1FFXA 1R6BX 2AYZA 4OQPA 3GFOA 1NONA 4P9SA 1ZG3A 4UEQA 3VPAA 3DFUA 3OQMA 1ZH0A 2YWHA 3IJEB 2W2KA 1IK6A 1L4MA 4FXOA 5FF9A 4BQSA 4CKZA 4WY5A 1EFAA 3F7TA 3LCRA 1GG5A 3KBBA 4LRWA 5E4FA 4GLBA 5D87A 5ECWA 4DK1A 4QWWA 3PFKA 2O8BB 4DDKA 5C0OE 3L7KA 2BY4A 5EHZA 2PUBA 3C3BA 5HJ7A 3OJLA 3JAMA 3ZXSA 1JLKA 1L7AA 1RAHA 2O2YA 4YT4A 2C2MA 5AK0A 5FUXA 4IWYA 4WRRA 1M0WA 2PG3A 3S27A 2BSXA 1Y1PA 2BGNA 3MBKA 4L4UA 1E62A 5EZSA 2WV9A 1FXSA 4YUVA 1VLZA 5TGZA 3DMDA 3WMGA 3ZWXA 4PXYA 4UUPA 2IOFA 2G36A 2Q2WA 4WA7A 1JU9A 5L3RA 4KXNA 4M0FA 4P86A 1L5MA 3ICPA 4KGVA 4M1SA 4QRHA 1Z22A 2G5TA 3SOPA 5JD5A 4R1SA 3RSOA 5JQGF 4YAKA 2QT1A 3A0UA 5ITZB 3K0FA 4MA4A 1G8FA 2WZCA 3D7LA 1XAHA 3OFJA 3OMXA 1TKCA 4URHA 2BMJA 1HV8A 2WSIA 4MQLA 4X7MA 1FLVA 3WNQA 3WRWA 1A5ZA 2CBGA 3WMEA 4CXMA 1A50B 4RJTA 3LUHA 1UAYA 4QJBA 4DMKA 3K70C 1JMKC 3AILA 3IIIA 3L04A 3OTWA 4JOCA 4QASA 5AJHA 1TECE 2X85A