3W2GA

Crystal structure of fully reduced form of nadh-cytochrome b5 reductase from pig liver
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 75
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2gA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2gA02
1VQOB 1BX0A 4PC6A 1YIJB 4M53A 2CRVA 4C0SA 1GAQA 5TV2A 4TMZA 1D1NA 1M1KD 2B5OA 5KSWB 3U2QA 1GVHA 3ZBUA 1JNYA 4LC0A 2XNJA 4Y7CA 1IJEA 4R71A 1EFTA 4RD3A 4PGOA 4LBVA 5AN9A 3QE2A 1YHQB 3MHPA 4PC7A 3LO8A 1FDRA 2QTLA 1R5BA 2B7BA 1Q81D 2BF4A 1QUEA 3AGQA 4ZGNB 3U6KA 2QTZA 3AVWA 4RD6A 1D8TA 4FK8A 4QHYA 4Y9RA 1S0UA 2BSAA 3AVTA 1KK0A 3OZVA 1EP3B 1H85A 3E20A 3CCVB 1VQPB 4J0QA 4LBZA 4RCYA 4M1KA 1SKQA 1EP2B 1JJ2B 3I56B 3CCLB 4B3XA 4G5GA 1BJKA 1G7CA 1OGJA 2BVNA 1CQXA 1QH0A 4B44A 2PMDA 1G7TA 1FRNA 1ZM4A 3FJOA 1B23P 2VZLA 1BX1A 2HMAA 3CCJB 4ZCLA 1VQ7B 2R6HA 4EH1A 4QFMA 4ZCIA 5JBQA 1N8RD 1M90D 1HA3A 3W2IA 4ZV4A 1W2BB 1QVGB 1Q86D 2DERA 5H59A 2BGJA 3CCUB 3MMPA 2C77A 2QN6A 2OTJB 1IJFA 1ELOA 3CC4B 1KRHA 2C78A 1ZM3A 3JQRA 4M0LA 2VYQA 3B78A 3CC7B 3U6BA 1KTVA 4C43A 1FNMA 4RD0A 3ZC3A 2BGIA 4DQLA 4TMXA 1GAWA 1H42A 4LBYA 3CB4A 1G7SA 3QFTA 3JQPA 3PENA 1GO2A 4AF6A 1VQ8B 1TLLA 5DSZA 4MYTA 3CRZA 4YAFA 3I1FA 4TN1A 1Q7YD 3VO1A 3JQQA 1EFCA 1F20A 4FN5A 2PIAA 1QUFA 3OZUA 1YI2B 1ZM9A 2YWHA 4YALA 3V76A 5TY0A 1G7RA 5GV8A 2BMWA 2AHOA 1KQSB 3ZZ0A 3CCQB 1KK3A 1KD1D 4G1BA 4N3NA 1B2RA 3G71B 1E63A 1YITB 3CMAB 4PC3A 3WBJA 4AC9A 1EXMA 3A1FA 4WQMA 4G1VA 2XEXA 3WNBA 1F60A 3AVUA 3W5UA 1W35A 2EFGA 3CW2A 4YAOA 3QSYA 2GQFA 1VQKB 4TMTA 4FWTA 3CD6B 1JB9A 4RCZA 1FNDA 1YJNB 1YJ9B 1EFUA 1AIPA 1Q82D 2BN4A 2VNKA 2DETA 5THXA 3P26A 3AVYA 3CCMB 1AMOA 3AGPA 1VQNB 1U2RA 4AF7A 3CC2B 1EP1B 1E64A 2VNJA 1R5NA 4Q7JB 4ACBA 3SJZA 1IB0A 2QMUA 1DG1G 3ZBTA 3OJXA 2VNHA 3W5HA 1I7PA 4NBSA 2QA4B 1S72B 1NJID 4RD4A 2BM0A 1VQLB 3ZZUA 5HXBA 3B8HA 1QVFB 4P3YA 1QFJA 5GV7A 1VQ9B 2ZITA 1KC8D 2D74A 1J9ZA 4BPRA 2YWEA 2HCJB 1N0UA 3WY9A 1GJRA 1NDHA 4TMWA 1VQ6B 3QFSA 1UMKA 3OW2B 1XB2A 3WNDA 1VQ5B 2FX3A 4B4DA 2BM1A 4B48A 1GR1A 3AVXA 1KJZA 2VNIA 3QFRA 1KK1A 2RC6A 4N3GA 4ZCMA 2GPJA 4YAUA 5TR9A 3QFCA 2YWGA 4ACAA 4MYUA 1DARA 4YAWA 1VQ4B 1FNBA 1FRQA 2B7CA 4PC1A 4RJLA 4DQKA 1OB5A 2OK7A 4U9UA 4RD1A 3P27A 2QDXA 3WNCA 4IW3B 1CNFA 3I55B 5H5JA 1SM4A 4M2LA 3VO2A 1EWYA 4K1XA 4UAJA 1QG0A 3G4SB 3WXMA 3ES9A 4M4SA 1QGAA 2E1RA 4TMVA 2BPOA 1D2EA 1E62A 3CCSB 3LRXA 3ZZTA 2BV3A 2RC5A 4F7DA 1R5OA 4H9GA 1QGYA 1XE1A 4LBWA 3WYAA 1FNCA 5EMNA 2YWFA 2DCUA 4PC2A 3WBKA 2HDNB 3W2EA 2XNCA 3OZWA 1YJWB 3LYUA 3CPWB 3LVBA 4B47A 3G6EB 3MCAA 4ZGQB 3W2FA 1KK2A 1DDGA 2OK8A 4HE5A 5FA6A 4NCNA 4Y9UA 2CNDA 1BQEA 3CCEB 3CMEB 2J7KA 3W5VA 1A8PA 1W87A 1W34A 3B82A 1QFYA 1TTTA 3W2HA 3AVVA 4HE6A 2DY1A 4B43A 2X3UA 1WDTA 2DEUA 3W2GA 2PLFA 1K8AD 1ZUNB 1QX4A 3FPKA 1JA0A 1VQMB 1K9MD 3VNUA 1OB2A 4RD2A 1TVCA 1TUIA 3VNVA 4P6VF 1QFZA 3E1YE 2OTLB 1DDIA 1OGIA 1JA1A 3CCRB 3OJWA 1K73D 1QGZA 4YHBA 3VMFA 3J81k 1CNEA 2EIXA 2QEXB 2NPFA 3CXCB 1ZM2A 1N0VC
chains in the Genus database with same CATH superfamily
3NNSA 3EXHA 3MJDA 3UFBA 2BKEA 1GOTA 4RUKA 3D4NA 2VT7A 5E2BA 4F2WA 1KQGA 1QYWA 1D4OA 3HXMA 3L49A 4C7VA 1P8JA 1SCNE 5JYDA 2R68A 4NK5A 4Q82A 4C0SA 2P35A 4ZQEA 1RXSA 1L3IA 2H2IA 3TR6A 4JP3A 3VYSB 1EX1A 4BIMA 4U2DA 4MROA 3DA8A 1HE3A 5ENDA 5FA5A 4DM4A 3EA5A 4WY8A 4EMTA 3C6MA 1JSZA 1JDNA 1SKBA 1IOZA 3HI6A 1QIDA 3ANNA 3H2GA 3HGQA 3SI7A 4N7JA 3RIEA 4ZK6A 1LLDA 4LFAB 4AXXA 4ZK2A 3KSMA 2BUCA 4TSFA 1QAQA 3O1JC 2VL7A 3UMFA 3L7JA 4KWEA 5JAMA 3WKAA 2H4XA 4OXXA 4KR7A 1HDYA 3OMWA 4RGYA 4YP7A 1ZHOA 2TMKA 1M2OB 2J9FA 3ZHOA 3ETEA 5HZBA 5ECYA 3V1LA 5CB8A 4UPEA 3W7BA 1I51A 2YOGA 2BH9A 4LGVA 4OP3A 1E79A 2CXTA 2YVAA 2CT8A 1LLQA 2QTTA 3DZBA 1HYHA 2NYVA 1OZFA 2UVDA 4LF6B 4G9BA 5JAHA 3FI9A 2ORED 3H9BA 3CGWA 2Q5JA 2WYVA 5SZIA 3HA7A 4F06A 3ECSA 1XC7A 2WZDA 3U4AA 5IVPA 2BMAA 4AP5A 4RD6A 1SZPA 4AFNA 2FRDA 3DEZA 3PV0A 2XYPA 3D6AA 3NC4A 1D8TA 3H8VA 3TOZA 4DS3A 1ZW1A 4EO7A 5IJAA 4EG5A 3PPWA 4H31A 1N2GA 1NGSA 2XB8A 1YQTA 1SCBA 1KH1A 4DW8A 4B83A 3AHIA 1H65A 1P6XA 2YZGA 3KAPA 1JG3A 2JKZA 1XZPA 3KKZA 3TQHA 3A0UA 5CA0A 5JJCA 4Y0AA 4UNSA 8MHTA 1K6MA 3CLUD 3E23A 2FW0A 3MS7A 1F8UA 2YNMD 2L42A 1H85A 1KH2A 3MK31 1M5RA 1KQOA 3PRKE 1WCIA 2HNKA 4A8PA 4FTWA 4EW2A 3MOGA 1VQPB 4DXDA 1GAJA 1MA3A 2DHQA 2RHLA 4Z3KA 4ZI2A 1W5AA 4AS1A 2R8RA 2TMGA 3LW8A 5C1OA 2Z3VA 4FYJA 1XTUA 3JQ7A 1QFMA 2G9UA 1VKZA 2D1RA 2EEZA 4WKOA 4TXMA 5BMVA 2XMBA 5AK4A 3TOVA 4PS0A 3DWGA 5CVDA 5HZKA 3E1GA 4QFCA 4ZAZA 5ADHA 1X1SA 2QXUA 4HDNA 3GLFE 4O4JB 3KZNA 3O03A 4A5SA 1X1RA 1NKVA 1JJ2B 1NNSA 1DXOA 1RXYA 3BWCA 2QW1A 1HO3A 3KYJB 4IFBA 4RKQA 5EYPB 1SUCA 3TMAA 1BJKA 2RI6A 3GPBA 2REXB 3LKZA 5CBKA 3RG2A 2OCLA 2PMDA 4JBIA 1EG7A 3LRPA 3V8VA 3QY9A 3I62A 2XT0A 4PEVA 1Y6RA 4TLMB 2QP4A 2BFDB 4J3NA 3VNAA 5F77A 2DFTA 3EC7A 4Q02A 1OWNA 2C20A 1C7EA 3CWCA 1LY1A 4HXGA 2OKCA 4BFWA 4DLSA 1FIUA 2Z30A 1B0PA 1QR6A 4H6XA 1OILA 3NHUA 4J4HA 5E1BA 1L5RA 3KQWA 4E33A 4BCDA 3KB2A 2PEZA 1L1QA 3PFFA 1PJ8A 1ECGA 5JBQA 4RVUA 3ZVKA 4BMVA 4ARIA 1M90D 1HEYA 1REQB 2PUTA 3VR2A 2WD7A 4CPDA 1L6RA 4H4DA 3OE7D 3USCS 4OIMA 1N6IA 4KQ1A 5GMOA 5CJ2A 1W96A 2PWZA 1K8XB 5JJ5A 1YB6A 1YXMA 3EMBA 3GLHB 4GXQA 3GNQA 3OPYB 1TKCA 2WWXA 1HWYA 3EQ6A 3VOBA 3CC4B 1C0EA 2Z4SA 3GP3A 4I1OA 4WY5A 1XFAA 4QT0A 1NU6A 2E82A 4C7BA 5AM3A 3HPQA 5F3WB 3Q2KA 3DOOA 3W4KA 3PJRA 2QZSA 2D1FA 5KX5A 2YYAA 4M83A 4N0EA 3BDAA 4U5QA 1O7JA 4B6GA 3GY0A 5L3SB 4EEZA 4C7JA 3BCRA 4O2AA 1HE4A 2QS9A 1GNLA 1E18A 4R31A 4FZ3A 3VV3A 1DAPA 2CLEB 2QORA 2CJXA 4D2IA 4OX9B 2E6UX 1DKMA 1EM8B 4RTQA 1C7RA 1UMBA 1Y3AA 1JHAA 2IKQA 4HJRA 4HQ6A 1L7VC 1YO6A 2L2QA 2YJ4A 4N01A 4CT5A 1NW5A 1NG1A 3JTEA 4L73A 2CKMA 4ZEWA 4DMHA 1IWOA 1HQCA 3HY6A 1P81A 3EEBA 3LHIA 3JWIA 5KOJB 5ALTA 5MF6A 4YAFA 5DW0A 5BV8A 5CA1B 2Z58A 4DA8A 2F1RA 3E9QA 4FYMA 3UK7A 2WE8A 3VDQA 2FDRA 3QVSA 5CLJA 4D02A 4DNPA 3WISA 1YKGA 1VHTA 2ZT7A 1HEIA 1J99A 1NOKA 2GSDA 2EATA 1R16A 2RAUA 3DUWA 3NALA 3QKSB 1SZDA 4NULA 4U2KA 3P8ZA 4EGJA 2DCMA 1LA2A 3CPEA 3SQMA 1F20A 3G9QA 1E94E 5E2AA 3OZUA 2BTQA 1R4NA 3BMOB 5DPMA 3ABQB 3HZRA 1W9HA 2XNHA 1WMDA 2C4TA 3DV2A 4LYEA 1DXQA 4YUYA 1OFHA 1DIGA 2F1JA 1Z22A 5EUMA 1YVDA 3ZIAD 2A5DA 4V2IA 4CLRA 3GJTA 3N6RA 3NVAA 3OHSX 2QU8A 1KYVA 2QLMA 4J16A 2C31A 1L7BA 2CDAA 4BTVA 1E7SA 4N65A 1B2RA 1S4MA 3UMCA 5ES4B 1P5RA 1KFJB 2WJYA 4RHUA 4B9EA 5AQEA 5G2OA 1KWGA 5LNK1 2MSLA 4E2XA 1N06A 1ZP6A 3QMVA 2JZOA 3OQOA 3U61B 1EXMA 2QU7A 3BXPA 2J9XB 5AK0A 1KSFX 1SG9A 3CLSC 2XEXA 4HNSA 2I6TA 3HY3A 1TAHA 1JR4A 5LQJA 1RMYA 2ODQA 2P1ZA 2Q62A 2VVTA 1KU6A 3OCXA 4JLVA 4DLRA 2D3WA 2QJRA 4JLUA 4LRUA 5IW8A 1I10A 4MUHA 4TX1A 2REOA 3GC6A 3GUVA 1TW3A 3DBLB 1XTPA 4IHKA 2ZB8A 5F4ZA 3L93A 5HKKD 1ABFA 1VHDA 4XRGA 2EZTA 3H94A 4HDKA 3D1VA 2G5CA 1W0KA 3IUYA 3D5EA 1O8BA 2EF1A 4M38A 3OI7A 1ZUD1 4XKJA 5ED4A 3VI3B 3J81A 5FPSA 1Q92A 2X2EA 1Q21A 2NV2B 4GX2A 4HH1A 1X7WB 3DDOA 4I14A 3QI7A 4IV0A 1TJ5A 2WYUA 1G20B 1U0SY 3GLVA 5D5HA 5COAA 3ED1A 2AS0A 2IJGX 2LKCA 2XT6A 2VQEB 5F23A 4DAEA 2HWWA 2Z4RA 2WT4A 4BNKA 4D9FA 3OLQA 3QVLA 4IPTA 2ZM5A 4GI1A 2RJ3A 3KJXA 2Q2NA 1TM5E 3PTLA 1N2CE 3I8XA 3ZWDA 4F38A 1GKLA 4EKIA 1C4OA 4QQ8A 3P4UA 4Y1GA 1H05A 2GTHA 4L5YA 1U11A 3AM1A 3BXEA 3OQ6A 4RE6A 5K0NA 1Q1AA 3G0GA 3LSTA 3C6ZA 3RCBA 1GFZA 2BW0A 3WXBA 1W49A 1DBWA 3LFTA 1P3DA 1YUNA 4DV0B 4M9CA 5F9FA 1TUBB 4UM9B 2REQA 1XR3A 2IYSA 2B4TO 3DFMA 4EQ6A 7AT1A 5FBHA 3MILA 1VIDA 3AXSA 5I45A 2ZYVX 5BV0A 2FRVA 2P7IA 2XB6A 3HFSA 1V16B 3GNTA 4NY1A 3WC4A 3BYZA 4V0QA 4KREA 2J7PD 2FPPB 3KSBC 1LPSA 3PX2A 3G2QA 5E1OA 3ZHCA 1NNLA 3MTGA 2MSEB 3BA6A 1L5LA 3ZDBA 4J90A 5IWAB 2IOQA 4MHSA 2BONA 1HT2E 2WUVA 4BFXA 1E32A 1XNGA 1V6SA 4G0XA 1UD6A 3K5IA 4CKBB 1J00A 1H2FA 3B8HA 1FJ2A 1JJFA 1GCIA 1ULBA 2VYVD 3Q87B 3DW1X 1Z45A 3Q7EA 4AVZA 2O3TA 2PZKA 2P2SA 4ADSG 2ZBDA 4XGIA 1SOWA 2C2MA 3NANA 4BNDA 1N75A 2O1XA 1IAVA 2POQX 3AR6A 4EYOA 2XADA 3KEOA 3TQIA 4V1CI 1SVMA 2VI5A 4MVJM 3EGOA 4ZN6A 2IVFA 2K2QB 1Z4LA 2H1LA 5IN4A 5CDGA 4JBXA 2O2SA 2PZBA 2ARKA 2Z2XA 4ZOAA 5IM5A 2ZJ4A 1CZLA 1N0UA 3V8MA 2PK3A 5JNSA 3ESZA 2JGEA 3B6EA 3W6UA 3LHSA 4QX6A 1XZ8A 2W2TA 2F48A 1UFKA 3KYBA 4P7JA 2VUTA 3WY9A 1YB4A 1FUIA 4BO0A 5IPFA 2XMSA 4BZXA 1OAKA 2GBPA 4OSOA 3A1TA 3SEQA 1QG2A 2HGSA 5JEEA 2R25B 4HP8A 2GAFA 3GUUA 4GWLA 3T0FA 1W36B 1K7SN 2DUNA 5JYBA 1AK2A 1E4YA 1VQ5B 4NBRA 1HR0B 3Q98A 4XIIA 1JZSA 2D5LA 2OXFA 2JBAB 4ZOBA 2BM1A 2WWIA 4YMTA 2GRJA 4OX9Y 1W88B 1V96A 1WULS 2VLBA 4MVJG 4XWTA 5FOXA 2E4AA 3QOWA 4XORA 4X20A 1AKVA 4O08A 2XDWA 2RHWA 4PAGA 4UZEA 2V4ZA 2VJMA 4KXMA 4ZOLB 3NHLA 3TMYA 4QM7A 4WNAA 2HREA 2L17A 4OI1A 2FQ1A 5LZ8A 3E35A 4ZODA 3DXZA 1H23A 1K0FA 1Q7CA 2Y8EA 3M6IA 4RHXA 3WRWA 1Z5PA 1VL6A 5LU9A 2ODEA 4GLFA 4NF2A 4OQFA 3EISA 3NHBA 5BYBA 2F90A 1NF3A 4ATNA 5JZOA 2MSDB 3FLAA 1Q0TA 4I50A 5DS0A 1SOMA 1NUAA 1SBNE 2WR8A 1FDOA 1WD7A 2RHTA 3DTVB 4KRGA 5DHRA 5DIFA 4ROXA 5EIBC 4ZTBA 2YY6A 1XKQA 4HKTA 4KE7A 4H7EA 3SQNA 1O4WA 3IVXA 3WV5A 1OHHD 4FGSA 1DCKA 2QM3A 4A26A 4JNCA 2E18A 1HNXB 4J8PA 1J21A 5B57C 3GUYA 1ZJWA 4BNMA 5CK5A 1Y1LA 4JI0B 1RMTA 2WT9A 4U39A 4H3KB 5IFKA 4IHJF 1XEXA 4L8GA 2JLCA 2GA9A 2ZT8A 3AB3A 3IQEA 4LJKA 3WI7A 4BKRA 3G2KA 5B1SA 4K1XA 4JEHA 2SCUB 2VTKA 2J5RA 2XYVA 2FE4A 3DV0B 3IDSA 5H83A 1B0AA 2UYOA 4LSWA 2IV2X 4HT3B 3PPYA 2O8VA 2DQKA 5EHIA 4G5HA 3L7CA 4O5OA 3G4SB 4OGKA 1YR1A 2WOOA 4OQMA 2AFIB 4PYMA 1TEZA 1E0AA 4KVZA 3AH8A 2XUZA 3H84A 1AE1A 5EJ6A 3E9NA 3RVMA 3V8NA 3HADA 4YONB 2RJOA 3BFKA 4PGAA 4IWNA 4K26A 4IV8A 4M3NA 4PGFA 2OMEA 4ZI5A 1LTHR 1X1CA 3RFFA 1SY7A 1S8FA 5E7JA 2YV5A 5LIRA 1GQYA 4JHLA 4JWTA 4OF4A 2H57A 3H04A 4LXIA 2DH6A 2VDRB 1GRVA 2KI5A 4KN5A 3ZWMA 4X06A 2YJZA 4M7PA 4X93A 5T4BA 5A4MS 1QRUA 3KD3A 1F38A 5K0BA 4P5EA 1U5BA 2JHFA 2W2OA 3I2YX 1GA1A 4R69A 4O4LF 1GRQA 3M2TA 5BSEA 3RC9A 3EF1A 3BWXA 3HMQA 2V1UA 3SHOA 4CM8A 3OZWA 5TE9A 3LYUA 1Y82A 1NLZA 1KS9A 5L45A 4OM7A 1KZLA 3L82B 1VXRA 3QRWA 3UWOA 4CM1A 4JYBA 4D3DA 4EG0A 2FMTA 1J23A 1UPCA 2N1BA 2A5LA 4MS3A 3V1MA 5K2OA 3UHAA 2P3MA 1NF2A 2X8JA 4GRAA 1K97A 4FP9A 3ET4A 3SNKA 1XRRA 4CR8A 2AJLI 4IY1A 4FFDA 4AJ1A 1N1DA 3HB7A 3NAZA 1CUAA 3EXG1 1DIHA 3LKDA 2X7XA 5MGBA 5F2OA 1U0FA 2BEVB 1XLTA 2KE5A 2QR3A 2W43A 1MB4A 4EVRA 1GGFA 2NTNA 3BMQB 4JHXA 4Q3DA 1QP7A 2HQBA 1CUVA 3KTOA 1AQLA 2O8NA 4P0TA 4JENA 4BO3A 1Q17A 1DUVG 1W1UA 4WXRA 5GZ6A 1DJMA 5JSUA 5JRJA 1G38A 1E9RA 2N9UA 2ZIUB 4PZEA 5E2IA 5I3CA 5JY1A 3FSJX 2KLBA 2CNLA 3ISTA 3ANTA 3SBXA 3SC3A 4Z4HA 2JGRA 4MO2A 2QN3A 3D8NA 3LRTA 3ICEA 2BKUA 1T9ZA 4IX1A 4NPAA 1EQ2A 3USZA 1Y4AE 2O1EA 3C48A 3H9NA 5HKAA 3ZUPA 1K9MD 4L95C 3RKSA 4BO1A 5K0FA 3M83A 3Q5DA 3TGLA 5DHFA 4QYIA 1MO2A 4IL5A 1YGYA 1OXUA 3QKTA 1U98A 2FWMX 1LI7A 5B58C 5L4NA 2D2IA 1XRMA 1IXYA 4H7KA 3PT5A 1K73D 4RM0A 3VAYA 3OMXA 4EGCB 4PZAA 2EHDA 2IELA 3RWMB 4CM3A 1VC2A 2EZ8A 2Y1FA 2YJNA 4P4SB 4AKTA 4AECA 2CE7A 4DY4A 5C3MA 5BSGA 3FTDA 2QNIA 5THQA 4Q4HA 1ZM2A 1KS2A 1P4GA 1MAHA 1PL0A 3O82A 4KUHA 1G3MA 3AUFA 4WCVA 1KKUA 1BX0A 4RM2A 2ZVQX 3I6YA 2X6WA 2HCBA 2R85A 1T4CB 1X80A 3I3SR 3OKAA 5F9MA 2D00A 4WCFB 1VHJA 1RJGA 5IMBA 4YGYA 4K8RB 1VLVA 5GQSA 2QRMA 5DM4A 4UHKA 4RIHA 3PUZA 3A8KA 4AN4A 5EP1A 5AXDA 1UXGA 4EJ0A 4RDHA 1MIOA 3VYWA 4BE4A 4UDYX 3NASA 1KY4A 3JD2A 2CUTA 3MB5A 5DP1A 2PLWA 5DB4A 3W8NA 2HD4A 5CYOA 4C2BA 1N8TA 3ZH9B 2RGYA 4G56A 1KQFA 1DP4A 1R5JA 2WSLA 1VGQA 4JQOA 5EZ6B 5IK2A 1CS4C 1RXUA 3TZKA 4F9EA 3WFIA 3U09A 1ATZA 3B6IA 2AT1A 5J59A 3ZD6A 4XQFA 3MHPA 1LS6A 2R87A 3BC1A 4LMPA 4OYLA 3THXA 3D6HA 4JJEA 1PYGA 2VA8A 2GM4A 4CEHB 5JPIA 2GO1A 3D6TB 4RTNA 3DSRA 1Q81D 4H17A 2BF4A 2ZBVA 4AD8A 2QBYB 2K7ZA 2IDKA 2NLOA 3CW9A 1XTKA 1RYFA 2Q1TA 4DWWA 3FBWA 5FFNA 1BW9A 1INLA 3B7PA 4OLHA 3LPNA 2G71A 3CTPA 4EF5A 1KR2A 5ALMA 3T9FA 1Y3HA 3W5JA 3IQXA 1U1IA 3J80A 5HZAA 1RYNA 2OCBA 4PTLA 1D9ZA 3JYPA 1Y8QA 5JQWA 5UKDA 3H2BA 1SUWA 4KB5A 5FL7D 3H1TA 2I54A 4GL4A 3PDWA 1QDEA 2BR3A 2F7SA 2VSXA 3WO0A 3GJXC 4EB8A 1CQPA 4TTJA 4WESA 4YMIA 1SQ0A 3I9V6 2EF0A 4M1EA 2XZDA 1V8PA 2WJ3A 4R8LA 4TL6A 4D3ZA 4CKZA 3GA5A 1X1BA 3PWSA 4GS5A 1M1NB 4JIGA 1QDLB 4L4RA 4PG5A 3INGA 1WZEA 3JQAA 5FWYA 1N77A 1GL6A 2PR7A 4EX7A 2JS7A 4LN1A 4OQEA 5HUHA 3GFFA 3B5IA 3MIIA 5DWQA 2VWPA 4X6YA 1O95D 2G40A 3GLIA 1T9GS 1SU4A 1RKUA 1NQ5A 3OX1A 1MKYA 2R84A 2G82A 3E7WA 2O8DA 1TGVA 4OQNA 4HDAA 3E53A 3WBBA 2XTZA 2GLXA 2HIHA 3WL6A 5B7GA 3MJEA 1P9LA 1WSAA 2GJ9A 1MQSA 3OCWA 5FI3A 5BN4A 4UUPA 1SCAA 5IAGA 1FFWA 3NQ41 4KJZA 4KLRA 5I7FA 3N0WA 3TYXA 3ESAA 1HEUA 3GR6A 3PC8A 4JT8A 4M1WA 1GARA 1L7XA 1NRJB 2LXNA 2ZQYA 3BUSA 3K53A 1E2PA 3QVVA 1S01A 3X43A 3OURA 2YWJA 5EKSA 1JG7A 5JO0A 2GKOA 4AB1A 2BOVA 2HM7A 3OEEA 4UHCA 4QFMA 1C2TA 5B12A 1XXHB 3D0QA 4EDHA 5B53A 3CO5A 4KO1S 2GCIA 4YRSA 5KTSA 3IMCA 1MX5A 1GZ3A 3Q7RA 3T94A 4D99A 4C4AA 3RS5A 3FVRA 3GFTA 1G98A 2W6JA 1DKRA 3OT1B 1L8QA 3IQFA 2YVQA 4CM9A 3QPVA 2DERA 5I8WA 4DM3A 4QA9A 4TWZA 1KYTA 1H4QA 5CJPA 2I6GA 2ZBUA 3ML1A 4J1TC 4PSVA 1C9JA 4KH1A 1QVWA 4WASA 5IC5A 2CZCA 3EIUA 2QYSA 2R00A 3B20A 5NULA 3UJCA 3AFNA 4N48A 3FCYA 1ZONA 4B73A 3DL7A 2CFTA 3LA8A 2BFBA 3MT8A 3OJ0A 4LGMA 2C9CA 4X3CA 3JD0A 4YCJA 3U7QA 5C5IA 1KDYA 4P12A 2AWNA 2Q6VA 1T43A 4GOND 4EY5A 2ZUDA 3BGDA 2GD1O 3NTUA 4LZOA 5CCBA 1L4KA 3TTSA 1SVIA 2XD9A 3HQ4O 3MWEA 3V8QA 3KV1A 4FX5A 3ZPXA 3WLPA 4BIIA 4YXFA 3EOAI 2C7BA 1A5BB 2ODPA 4NOMA 1R8SA 2JFPA 2ZRPA 3CINA 3M7IA 4IDOA 5EESA 2JIMA 1AUQA 3CRNA 1MEOA 3ACBA 3NOXA 3RIXA 2VNAA 4DBZA 4F11A 4ND1A 5CEJA 5C53B 4FYHA 1VECA 2A9JA 1HQDA 1ZK2A 1VQ8B 2CY0A 4LKRA 1KDVA 3L0YA 4A0HA 3V55A 2YMLA 2QL7A 4C21A 4Q1FA 2DPHA 4DEYA 2FW7A 3BE8A 3H1EA 4TN1A 1G17A 2VN8A 3UOAB 3UXMA 3BXXA 4U2GA 2P2DA 5KYNA 3Q8XB 4N0PA 2OBFA 3MN1A 4ZCTA 1P75A 1LZKA 3I6QA 4KPUA 3G17A 1ZXLA 3IULA 1KRWA 2PGJA 1QRTA 3IELA 2V7GA 5I01A 5KQSA 1EFCA 4PQRA 1V5VA 2PIAA 5KCZA 1L7RA 1DJOA 2PO7A 4AUNA 1CRPA 5TF4A 1I6MA 2QRHA 2PKCA 4R3UC 1UBFA 5ITSA 5F1OA 1AA6A 3KJFA 1CIPA 1SOUA 5FF9A 3V76A 3OP1A 2WF7A 2P5TB 5GV8A 2V98A 4LRYA 4Q7KA 4H2DA 3ISJA 4RK1A 5JCJD 4DDWA 2M6RA 3ONFA 2JH8A 1JG6A 3AP1A 5AXCA 4C78A 1U94A 2OOSA 5DBEX 3G71B 4MVJA 4ZT6A 3CJRA 2ICAA 2QOEA 3OZCA 1VSTA 1ZK3A 1LDMA 2ZCVA 1BGXT 4ZVSA 5CA0B 5LP6A 4PYQA 2WTBA 4XD7A 3BWVA 1D4ZA 1TPZA 4EK9A 5BWNA 3M9WA 1YX2A 1KMCA 3MBIA 1WCIB 2P0YA 4KZKA 4MP3A 3M3DA 3UHFA 1VMDA 1LPPA 3NTVA 1HXHA 3ETLA 5LDDC 4AKIA 3PG5A 2CBGA 4X7CA 3DBIA 3ITDA 3DZKA 3DMDA 3EARA 4CMBA 3JQ7B 5KYYA 1XTJA 2WC1A 4FSDA 4X00A 5EOVA 1RZRD 1L4LA 1K9SA 1KY5A 4EKNB 3ZIAA 1CY0A 2ONYA 3C4QA 3PNQA 3R20A 1U1GA 2W2VA 1MF7A 1IQPA 2WSYB 2GEUA 3BH7A 4HDNB 4JVNA 2ZIZA 4B0OA 1GPMA 4X8HA 1VG0B 2VLIA 4HUTA 4TWIA 2IU6A 2DSNA 2F64A 2OQIA 3ZE6A 4GYYA 4EUNA 1SVSA 1PR4A 2OLKA 3G6KA 1MV8A 4QWWA 2J3DA 5JXIA 3R3XA 3JR7A 1XZDA 4OA8A 3VPCA 1JHDA 3GZJA 5EEHA 4CXMA 1QZXA 1G1MA 2HPAA 3KQVA 1Y9EA 1WSBA 4XR6A 1GQQA 1LLFA 1GZ7A 1SBIA 1MO5A 2WLSA 3EBLA 3PQCA 4MQ4A 4QPJC 5C81A 4Z4FA 3HCAA 3BSYA 3NEJA 5FA8A 4LFCB 3IPAA 2BY4A 5G1NA 1WKVA 4YRPA 2Q7OE 1J0CA 1OBFO 4DGSA 2GN0A 2DFPA 2JLVA 5IBQA 1YT5A 3ADKA 2HRBA 3D7NA 1N36B 2WD7B 3BSSA 1E64A 3HCDA 2KPOA 4Z9BA 4Q7JB 3MWGA 3ONYA 3EWSA 4HAYA 2SBTA 3M1AA 4AS3A 1S02A 2HLDD 2QRNA 2VK2A 3ZI0A 2FCRA 3HCBA 1GRNA 2ZWIA 3ZGXA 2WSBA 3E3MA 1IB0A 3MTQA 5F51A 2KS6A 4O2RA 5LQCA 1XNJA 5G02A 4HMOA 3PLNA 3IEXA 5REQB 1EG2A 3FOWA 3HB4X 4XYBA 4N0QA 5K0CA 1KYZA 5ALJA 1JAIA 3O26A 2VT2A 1FDVA 4DMMA 4BFCA 5C4MA 2QTBA 1N25A 3RNOA 4AAYA 4YELA 3RT1A 3IL2A 4F3RA 3GRUA 1LRJA 1M6HA 1G5FA 1HM5A 3C43A 5JBNA 3WTCA 1I3LA 4ZCRA 3GLFA 4I5GA 2COEA 1KO1A 1TC1A 3F96A 4N5LA 2J3QA 3ZY3A 1UMBB 4KAXA 1BYIA 3V4PB 1XJWA 3PQDA 5KPJA 3ZX4A 3CG4A 3ZV3A 3GQBA 4MS4B 1TZCA 3PQFA 4B7UA 5JNLA 5EXTA 3CBGA 1JSXA 5ILGA 1BU8A 4UOZA 4F1JA 1RR6A 3EZNA 2JIOA 2YN4A 1V41E 4EFLA 4IIHA 2DQ4A 4LSMA 3BH4A 1XT6A 3R77A 4G36A 4NYJQ 4LXUA 1Z4NA 2OHOA 4KLCA 3TUIC 2BIFA 4IR7A 1DC5A 1VE9A 2A9KA 5HKOA 1FPQA 3ICOA 5CT8A 1VRVA 2RK4A 1YIDA 2AFHE 2PKQP 2ZSAA 5CDSA 4JODA 2JEZA 1L5QA 1TFUA 4I1RA 1KWKA 3QFSA 1G9XA 4NCBA 4RK0A 1R4NB 1T4BA 4J2HA 3K1TA 1YAHA 1EE2A 3K94A 4BMSA 3CU5A 1D5WA 3V9AA 4PM4A 3IODA 3QQ5A 2W7TA 2FEMA 1RLUA 1VCOA 1YK0A 1QH8A 4RMNA 3A4VA 4JGIA 4CLRB 3LYAA 3K20A 2G9NA 1JMYA 2E3JA 1G9SA 1UM9B 2N42A 2YIMA 1YI1A 2EKZA 2ZUVA 3EZGA 3PF8A 3A3BA 4R01A 1AS2A 2B1RA 1L5NA 3ZGYA 4DLXA 4EI7A 4EYEA 2WHRA 1D8AA 3WLIA 3C6QA 3CF6R 3SXPA 4CEJB 4YAUA 4R41A 4BJ3A 3LK7A 3RKUA 3V34A 4YCAA 2GNPA 4XW2A 4ACAA 3E05A 1C9DB 2G80A 2Y0DA 4AJPA 1FS6A 1NURA 1PGJA 4YAWA 2BP7A 3DNFA 5BN3B 4LOJA 1S2GA 5IJ0A 3PI6A 4NCIA 4FT2A 4RBNA 1N3BA 2IU0A 5DGTA 1G5TA 4BNYA 4JGGA 3AJEA 1NPDA 5K3AA 4L78A 2ZZFA 2DECA 1E3TA 3W5SA 1JZTA 4RD1A 1JHVA 2AQKA 4FT4A 3W34A 3IQGX 2WWVD 2YV3A 4BX9A 3ACCA 1JMVA 1O94D 1SHKA 2I4MA 4RTKA 3NP9A 3I04M 4HDKB 2V9CA 1I5EA 1ZGGA 1E58A 1SUDA 4YJFB 3VSAA 5BWLA 4RJ2A 2H18A 2OAQ1 1CY1A 2G04A 1B76A 5HIMA 2F8MA 3OG9A 5DISB 2GCGA 2R8OA 2ZJAA 3EPPA 4G8DA 1HBJA 1I30A 4EPRA 1A88A 4UVIA 4ZVKA 2R6JA 2VP6A 1ZVJA 3DZFA 3EXHC 4PXAA 4WXYB 1TAUA 2ONJA 5CIQA 1CR4A 2HJRA 3MWDA 1QGAA 1XDBA 1CY7A 1JQKA 2TRSB 1UJNA 1BA2A 2QI9C 2YRFA 4KYIB 4YECA 4UHEA 1A9XB 1V7PC 1SKUA 1RQ7A 5BNFA 5KHAA 1Z15A 5ENZA 2Z83A 4N0DA 1NNEA 2HA4A 4OK6A 4JLBA 1WP4A 2QN2A 3IXLA 3F8TA 4QQRA 1SB8A 4GECA 4QBHA 1YVRA 2J30A 5AK3A 1R27A 4CR6A 3HEMA 1OXMA 1JDJA 1MQ9A 4N1AA 3BA1A 4EUSA 1UAGA 2F3RA 3I4CA 1W7AA 1UBEA 2REQB 3HDGA 4JJKA 2ZCUA 3LUGA 5ER9A 4FILA 4QUJA 1NUSA 5AR1A 1OFVA 2IITA 2FF7A 2GGSA 1SZJG 3JQDA 4GGOA 3CNHA 1U1EA 1U5CA 3ULKA 2DLCX 4UPDA 1Z38A 1BO6A 1F1JA 4RJJA 4MQEA 1LU9A 2CXUA 2J4DA 4K7JA 3MJ4A 3U48A 4ZXPA 1QE5A 2CYCA 2ZVJA 1K7EB 1TKAA 1E1CA 2QVBA 2FMKA 3NTOA 4QGAA 5COBA 4KV9A 3T53B 5KNCD 3MCAA 3G1TA 5LPNA 1F3LA 3GGPA 3QYJA 2BH2A 4LV8B 621PA 1KO8A 4CU5A 2C2KA 4D4IA 2FRDC 1QGOA 4X05A 5ILOA 1RXCA 3AHDA 4MUYA 1DAKA 1ZL2A 1HL3A 3BE6A 3PFGA 1UQTA 4H4EA 4URWR 4DMGA 1KYQA 1YQWA 1EUZA 1UAYA 4BNDB 1IXKA 1Q0UA 5B4UA 3QKWA 1T6BY 1I13A 4Y9UA 3D31A 2C03A 5FWXA 4ARBA 1T8PA 3ZHSA 3KD2A 1IUKA 2CL7X 3DDZX 1F6DA 1YQQA 2B5VA 2QLJA 3Q9SA 4L3WA 1F17A 1W34A 1Y34E 3NYWA 2ZL6A 3WGGA 3SY8A 4D9EA 4H1WA 2NSLA 3VU3A 5E8RA 4ZIRA 4M60A 4NJMA 4HE6A 4KKSA 5F76A 4RU1A 4BVBA 1BN6A 5FOQA 2CJWB 4AJ9A 1JAZA 2QMQA 3NOVA 1BXRB 1DTWB 2BHTA 1F8FA 1EM6A 4KMOA 2KJQA 4CMAA 4KQ6A 5K8IA 3GJQA 3WL8A 1TVMA 3H2ZA 2D4HA 1YFLA 1PLLA 1MW8X 4YCLA 3IDQA 1MC4A 1VM6A 4A16A 4YMGA 2IYXA 4U9HS 5ULLA 4RD2A 1I3NA 4KN6A 4UM5A 4KQXA 4XIFA 3W1VA 2C5HA 1ISPA 2Z2ZA 1T3ZA 1WSDA 4X20B 2BGMA 3SE0A 1ZNZA 2ISCA 5T3YA 3E1YE 421PA 4XUCA 1O6GA 1QZ3A 3H1BA 4KIGA 3DLAA 5EGSA 1JA1A 2H2GA 1NMSA 2AD5A 2VFAA 3EIFA 3PD7A 1Q19A 1NXOA 4BKUA 4F93B 1F14A 1W76A 5DVZA 1ADCA 5CG1A 3JY6A 4A3SA 3ADPA 2C00A 1HKHA 3CRRA 3LH5A 3N2NA 3DFFA 2XSZD 3E9YA 2NZYA 3BVPA 3N3AC 5E6SA 3SEZA 4HNTA 5I7OA 3CXCB 3QH4A 2JJMA 1NLYA 2Q4OA 4I50B 3UEOA 1TUGA 1HETA 3K8OE 2J5XA 4G89A 4P34A 3HZOA 3BD6A 3KSRA 3FPEA 1TQ8A 1EXWA 4ZZ0A 1ZRSA 2A7QA 2KLHA 3A04A 3LY5A 4GC9A 3S0JA 4JKIA 4P08A 4JI2B 1SA0A 3G23A 3N2ZB 4QU9A 2ZE6A 5J40A 2P5SA 2LD4A 5TV2A 1YNOA 3IAFA 2CE2X 4BUZA 4FUQA 2JJ2D 3VDNB 2I3BA 1JDTA 4WUVA 4UZSA 5D5PA 1VKOA 5I7VA 4DV1B 1M76A 5KSWB 4NCAA 1Z5UA 4GXTA 1JPVA 3C3WA 2PA0A 5C8VA 1AV6A 4RPJA 4MKRA 3NXSA 1YBFA 2A5FA 2HWXA 3KJNA 4H7IA 3VC1A 2LUOA 2R8BA 2WJWA 1EFTA 1A97A 4I3GA 3DLHA 1EKXA 4ID9A 1PN3A 4G0VA 4XPZA 1WY5A 3GI1A 2UYQA 1XX6A 1P2DA 1XMJA 2I87A 3V7WA 3PRYA 2JAXA 4B8YA 3D3NA 2FF5A 3KXIA 4GOOD 1BH6A 4O8ZA 2A1TS 2P40A 4LRQA 2ZXUA 2OYNA 4QELA 1EK0A 3VYRB 3TUZC 5GGXA 2B8JA 3QFFA 2V6IA 2V9ZA 3S4YA 4GKJB 2UZ1B 3H13A 2FG7C 4EY4A 4H0FA 1NT4A 2Z56A 2ESRA 4XOIA 3CVUA 2IYZA 2MHCA 2ZRCA 3RSZA 4KR0A 3UGJA 3GPDG 5JFGA 3W3AD 1KA9H 2NZJA 1U0JA 3EEQA 4ODIA 3EVCA 4M8NE 1BKYA 1K89A 1UBTS 1TADA 4ZQBA 1IUOA 3A25A 1G55A 1Z7BA 1ZH0A 1KOFA 4OGFA 1U5BB 4KTVE 2G67A 4ESVA 4WLNA 1R18A 4Y6LA 3IAS6 2CJYA 1TQDA 2QRLA 4CM8B 5DN6A 1PVOA 3WL3A 1Y4DE 5ARDA 3AOEA 3L1KA 4XJSA 1VLLA 2DT8A 5KTKA 1KMHA 4P1VA 1WZCA 2AGVA 3ASSA 3IVAA 5HIKA 4BO7A 5K4GA 2WIKA 1UBKS 4GXNA 4MS3B 4RTMA 2BEUB 3MJVA 4A27A 1MB0A 1CUJA 3C74A 1HMYA 1H1TA 3CZ4A 5TEVA 4AG3A 3F67A 5JARA 4J43A 2Z4TA 2HR1A 3PHGA 5J4YA 2FLVA 3N8GA 4UE6A 1U8XX 1FYEA 2GM5A 4E0BA 3L07A 4J16C 3S5JA 4LYDA 4D3XA 1R7RA 2VBIA 3HM2A 4J0FA 2G76A 3PR1A 4R9NA 5EWMB 4CQMB 5DZSA 3D8HA 4YUXA 4X62B 3NHRA 3CUVA 2AH5A 2HWUA 1YJ8A 5EP2A 1CYEA 1YMVA 1MGPA 1RTKA 2A0YA 2D7JA 2GZMA 1G7CA 2VHWA 5CX1A 4BQRA 4D82A 1GPH1 4O2LA 1K86A 1C7IA 4AZTA 1ZNWA 1FLAA 2FN4A 2QQEA 3UTDA 5TS2A 3EDQA 4MCAA 4C22A 2RI1A 3FCSB 4L9SA 2HDOA 3BBPA 1G8KA 3OQ1A 4LWOA 4X66B 1YQEA 4K9QA 3H1PA 4TM8A 2ZUTA 8LDHA 3LL4A 1WCXA 4AZWA 3O84A 1NY5A 1TM7E 4LJYA 2R6HA 4XGKA 3S8EA 2Q1XA 4OYYA 3VV2A 1OSNA 1BMDA 1UH5A 3Q3GE 4B4WA 4EUEA 1RQ2A 5L3VA 4QOSA 3OQNA 4QYIB 1N8RD 1I2DA 3H18A 2VR1A 2JN9A 4IXNA 2X9QA 4X7FA 4AJEA 2O0KA 3OPXA 1XCPA 4OREX 2WKQA 1TQHA 3QEKA 1N0IA 1ZC4A 2Y0PA 3DOCA 1U0NA 2Q5HA 1CVRA 4PR3A 4JY7A 5JE8A 4ICIA 3ZJ5A 3TJMA 4ZANA 3E9ZA 5MHTA 1U4NA 1KORA 4GP9A 2ES4A 2J67A 2VRNA 1QHFA 2JATA 3EYAA 4UNNA 1EU1A 4Y6OA 3W3AH 5T3UA 2VYQA 3R5JA 1A77A 4HH0A 2ZL5A 4F4UA 3ZEAA 1FMCA 4LNHA 1P18A 4N49A 2BGIA 1JEJA 1MZVA 1X80B 1TMKA 2FR1A 3P9PA 4LZLA 1LI4A 3W1EA 1GAWA 2Q2WA 1JSLA 3K4HA 4LBYA 1R6VA 4BGIA 1P1RA 2KVOA 3PPVA 2FXIA 1OLXA 3DO8A 4ARZA 1JHUA 5LZ4A 1EK2A 2CF5A 5D3KA 1ZSVA 3K1JA 3Q40A 4ZVQA 2NUBA 2Y0EA 3AP3A 5K4AA 1OX4A 3RFCA 4Z9YA 4H7FA 3MRVA 3F5SA 5B1DA 2DYIA 4WK6A 5HMMA 2D0OB 3BKWA 4NS4A 3I1FA 3UFXA 1IVSA 3AY0A 4WNIA 1EHIA 2HK8A 3UV3A 3X2EA 3IRVA 4PRZA 1CE8B 2MMGA 3TSAA 2IS1A 1CJUC 2UV8A 1WY7A 5HEKA 1PFKA 1ZCBA 2RGXA 3KQNA 4Z4YA 3THXB 4C2UA 3C3BA 4R5MA 4K3VA 4WZBE 3SR3A 2UUBB 1W4BA 1UDXA 1E96A 2V7QD 1HE2A 4UCFA 4I4TF 5A7FA 5CB4A 1N2BA 4A0QA 3CUTA 3A9CA 4QUHA 3TL6A 3ZHQA 3PNBA 5JROA 1BW9B 1I2ZA 2BFFA 5EWJA 4EFKA 2EERA 2ZULA 5TY0A 2BMJA 2VP4A 5BSFA 4LI0A 4NPHA 4TTVA 4V3BA 1MQAA 2GD6A 4OOSA 1AOXA 1BN7A 1XI2A 4IICA 4PLFA 1Y8QB 4B34A 1ACMA 3PUMA 3B1VA 4OB7A 3KZ1E 3A27A 3K09C 2FN7A 4RY2A 4XIYA 5ALPA 3JAMA 2M5SA 2PBLA 2AKYA 3EIHA 2EQBA 1Q14A 3GN1A 3KQHA 1BH2A 3OZIA 3RYFA 4WESB 1TW2A 1VA4A 1UBSB 1GTVA 2FOLA 2WICA 2ZUCA 4LXYA 4Q21A 3RYTC 1DC3A 2IX3A 1K1EA 2DFNA 3SJPA 2W6OA 4MMXB 3TLEA 4OBXA 5ABPA 5HXAA 4R8RA 3KG2A 5IBCA 2N3ZA 4B46A 1ZO8A 5C5EA 2QVXX 3B1XA 1U04A 3MMZA 3PP8A 4ZWNA 2WHPA 1RWKA 2DBZA 2B3DA 3UGKA 1E3WB 4J6FA 3WMWA 1KSGA 1VQKB 2GZ1A 3C7TA 3CD6B 1SVWA 2O8DB 2XRYA 4DCSA 3SXUB 3T1YB 4HCJA 5HBRA 3F7MA 3V97A 1V35A 3GJ4A 4MQFA 2HZ7A 4JR1A 3ENNA 2A9OA 3VR6D 3WLMA 1JP7A 3HR7A 4DM7A 1YBAA 4YCMA 1UDBA 1WUHS 5I7UA 2CVHA 4PGMA 2IYLD 3ED5A 4AMBA 2WVJA 1L9XA 1Y5IA 4RV5A 1XU9A 5ESWA 2ZRMA 5P8WA 4CG2A 1BDHA 4MGKR 2H5IA 1M2VB 5BV1A 1KFKB 1V8OA 2UYGA 3NRJA 4HS9A 1GU0A 1NUTA 1GKKA 1NOIA 1Y4UA 1MJNA 1T8UA 5D3MA 4PSAA 2DFLA 1W93A 5G41A 3SJBA 4DIDA 5KCMA 3HXQA 1AQYA 3MSXA 3KTFA 3OWXA 2QUJA 3BWYA 4F2PA 1IHPA 4PW0A 4OI0A 1VOTA 2RHOA 2XCQA 1JR3D 1E5QA 2G5TA 3MCZA 3E3LA 3RSOA 4AF7A 2K4MA 1E89A 3TNYA 5H4GA 3NOQA 3D0OA 1XQYA 3V42A 3A0RB 4A92A 4ETMA 1MBZA 5A1JA 1LVUA 2XKAA 4MAAA 4JLPA 3DKVA 4I9GA 3SAJA 3D3EA 1E60A 1G8PA 1PSZA 2BE7A 1PEDA 3ENZA 3GH1A 3I04A 4N5NA 3WA6A 3LQ6A 3W3ZB 3EVAA 4RWEA 1SCUB 1NFFA 2VXYA 3UKOA 2PUBA 2XF8A 2KMLA 2PY6A 3GRFA 3H42B 4YQFA 3P5SA 2X9VA 3I5YA 1IY1A 4HWOA 3IPYA 3ESRA 1PO7A 1TVKA 2ZRIA 4YNBA 1XMPA 1I7NA 3FYDA 4KVGA 3REGA 2ENWA 4P36A 4D9GA 3MWEB 5HXBA 1PJ3A 1GPBA 3EA0A 1WX1A 5H0IA 1NN3A 4CLEA 3MUEA 4P3YA 3BZWA 2PM8A 4ER6A 3FH0A 1FXSA 3M2PA 2EJBA 3CJTA 4L5AA 1ZH6A 1VQ9B 4EB6A 3COWA 4KXYA 2EC5A 3L7MA 3U80A 1BGWA 3B9QA 3IEUA 5BNZA 4TVSA 4RMIA 2VP2A 3B2NA 3DLIA 3K0CC 1RACA 4LG1A 2ET6A 4XIJA 4WOJA 2JG3A 1PK7A 4PG7A 2W0MA 2PZ8A 3RC7A 3NX4A 3WWOA 3M6WA 1CB7A 3ESBA 1X7ZA 3GMSA 2QRUA 3OF3A 2GDJA 2OCKA 3O0DA 3ZTTA 2R6ZA 4V1CA 3CX6A 1BU5A 4YV2A 5JNTA 3R0VA 4IDDA 3OSUA 2P62A 1E9VA 3WJ2A 3A26A 4EI8A 1TB4A 4Y3UA 3O95A 2ZE5A 1Y8RA 2JAOA 3QYAA 1SH7A 1JWBB 1M3SA 3T5DA 1DU4A 5KREA 2NU7B 4J7CA 3A3YA 4M9UA 3PB3A 4TWJA 4ZO7A 3WKEA 4QDKA 3DNMA 3MGGA 4NZYA 5IAOA 1AQNA 4K87A 1II0A 4Z49A 5JVDF 2I8AA 3BMCA 5GONA 1XLTC 2VZEA 1LBSA 3JVDA 2PMFA 2ZRGA 2I2BA 4I19A 1PP4A 3O75A 1ZI8A 4UREA 4CW7A 2PUCA 2EDAA 1FQOA 2C5FA 5DK4A 2VNIA 1WZIA 3I92A 1NMQA 5HM6A 1JEDA 1IWBB 2YIDA 1QV7A 4XWGA 2V45A 1Z9BA 3DUFB 1CB0A 1EJ2A 1WVIA 3PSHA 4RPIA 3BSFA 5DCWA 5LP6B 3PNSA 2YMMA 3QY0A 4BB5A 2IYUA 5EZYA 5HE9A 2ZJOA 2JLQA 2FSVA 1DS6A 4PN3A 3UKJA 2VP3A 4R4JA 5IT5A 5FJJA 1LTQA 1M67A 3G5AA 4PZPA 1YL6A 2VF8A 3W8FA 2FWBA 1O03A 3REOA 2A35A 2B7CA 5KYYB 3QOXA 3L79A 1XHFA 4BQIA 1NXXA 5FPYA 2NZWA 1PR9A 4BZZA 1KIFA 3A2KA 1T3GA 3KPJA 5ALHA 2ABWA 3RBAA 1PJTA 4IRUB 4D4GA 4BEWA 1JHQA 1FK8A 1OXTA 3N1UA 4HB3A 4WBNA 4QYTA 2R44A 1TM1E 4NMWA 3EC2A 5FTWA 3LBIA 1BWPA 2TMDA 4LNAA 4MMYB 1DZ3A 1CUSA 2MCFA 3TG8A 3BD7A 4ZO6A 1IJBA 2OENG 3HBAA 3EQ7A 4LYHA 3IDZA 3W90A 1EINA 1BG6A 2PWBA 3TFQA 4E7PA 1YE5A 4BNIA 4BCBA 2O2CA 3CZAA 4HTAA 4HWRA 4A1FA 2E1RA 3WWPA 1QPBA 4I08A 5IAKA 2J4CA 3UIEA 2H00A 4AX8A 1PWHA 3ZOZA 5EN4A 4IZ6A 1G3RA 4ZEMA 2CHEA 3RSHA 2K6GA 7REQA 1QH9A 4DMUB 3SDBA 1YAJA 3B12A 1X38A 2C2OA 2FTKE 1HDGO 1ETHA 5E4YA 5KHLB 1Q7BA 3VPDA 4FEAA 5LNK6 4U7DA 1X3LA 3O7MA 1R6XA 2JGIA 4N6OA 4NEQA 3SMVA 4DLVA 4AKHA 4A03A 3TVDA 4BAUA 1J4AA 1HZJA 4LRXA 5HZGA 2HZBA 3C1OA 2YWFA 2Z09A 2ZTGA 1T5HX 1XDWA 4BRUA 2PQ0A 2K87A 1YZTA 1TNDA 2HU8A 4PC2A 2IYWA 5IU6A 2BR5A 2P68A 2O2EA 4Z6KA 4MRMB 3MIZA 2XMGA 3MGBA 1VJTA 1FF9A 2IXDA 1R00A 3WLEA 5KJ1A 1IPFA 3IURA 3LVBA 2O48X 4HGYA 4PIPA 1E9DA 4IQ0A 2AL7A 4YAEA 4Z0TA 4FFPA 3DLBA 3OCYA 2V6BA 2X2OA 1K6IA 3OM1A 4IXDA 1PIWA 2C59A 3L5OA 4B71A 4YRBA 5FO1A 4BC1A 2YZ7A 1TQ6A 2TMYA 3W4JA 4KDFA 2Q3FA 4BLRA 1C3JA 3GBSA 1QP8A 4BY9E 5H81A 1FZQA 3W9YA 2XB2A 1ICIA 1JEYB 1QS0A 1Y37A 2EJCA 2GJ8A 2HJVA 3U4HA 1T29A 4U0JA 5EZQA 3IPCA 1W87A 2OXEA 3LWNA 2W8BB 2ZEJA 3HCCA 5AHKA 4FOOA 4BB6A 1SZCA 3TNFA 5J63A 4BU1A 4C0QC 3DKKA 1IC6A 4N39A 3OEHD 1Q74A 3HVUA 4KI7A 4P3NA 4EFMA 5KKNB 4C6TA 1JFSA 2X3UA 4YAGA 1NYLA 3JYLA 4GRDA 5LB2A 1XALA 1HC7A 1QYDA 3K2IA 4P4TA 2PLFA 3B38A 1ZOIA 5A3JA 5KNCA 2ID8A 2VS1A 4AYWA 1OJ7A 4G2TA 4MEAA 1EQUA 1U5AA 4QJ4A 2I5PO 2WJAA 5JYCA 4RW0A 5AVKA 4RKEA 2A92A 1Z83A 5FBRB 2O2JA 3VU0A 4L6CA 3FZGA 4QPNA 5DBOA 1I6WA 2R5WA 3L6RA 4S0XA 2VYNA 1NX9A 4WXMA 2DTDA 2VJPA 2OBTA 1Y48E 5FOWA 5B3JA 5CPBA 5IRCD 3VJKA 2BT4A 2GNAA 3EUFA 3G3EA 2ECQA 3CXRA 3EBOA 4CF3A 1MV5A 4JVSB 5E0OA 3VSEA 4A2QA 4E6PA 5DM2A 4KIJA 5JI2E 3BWBA 1DEXA 1U99A 4FM9A 2PUAA 4XB2A 2QX7A 2IW1A 3GEDA 4QXAA 1JQAA 3UANA 4REOA 4B7XA 2PV7A 3C98A 4HDCA 3J81k 4DLWA 1CVLA 3PS9A 2VOJA 2OBNA 3FMPB 2VBSA 2BP7B 2CXSA 5L3ZA 2IE0A 4Z9AA 5IJ0B 3FMFA 5K5EA 4ENQA 1XZNA 2G70A 4PNEA 4W9MC 3VVLA 3UBTA 1ZCAA 1K7CA 2ATIA 4RNDB 3UMGA 5H9WA 2CUZA 4XSHA 4DR3B 4BGDA 5FEUA 1RXVA 3QG1A 4UEWA 4EHBA 2PGXA 5DULA 4MOWA 1UP7A 4O2BA 5B2ZA 1E3DA 4Q4JB 1VSVA 1NAHA 1AHHA 4KC0A 4OU5A 4U2BA 2R00C 3O3NB 2HRRA 1OE0A 3GLSA 1IJEA 5SZKB 4DXHA 4RJTA 4DIOA 3FNRA 4X1YA 1CR0A 4JMPA 4XFJA 1ONBA 4MIOA 6ABPA 2XSZA 4OFWA 4HZIA 1Y3DE 5DGHA 2AFHA 5E6RB 3WMRA 1EHCA 1KGSA 3BS4A 3D5TA 3DJYA 4FNMA 1VCIA 1F51E 1D6JA 1NBMD 1T0BA 3C1AA 3QKIA 4TS1A 1SVNA 2NXWA 4TV9A 1WEKA 4CHTA 2X85A 1T8YA 4IMPA 4MS1A 2WZNA 1U7XA 2ZI7A 2P2LA 1SUIA 2QTLA 1UUFA 1GTRA 1IQ0A 3NS7A 1YDFA 3LQ4A 2B7BA 4YO7A 4IDCA 4AJLA 4EUKA 4ZALA 3AGQA 4NZOA 2KYRA 1G4UR 4HTFA 3ZCSA 1ESDA 4NH4A 3C8ZA 5JD3A 1EEHA 3CZ9A 3HFRA 2GN1A 2WHXA 5BWCA 2F1LA 4D6XA 1H2ZA 3RS4A 3BIWA 3L8ZA 3WGLA 4F12A 5LKAA 2XZLA 3VVCA 5HIIA 1QOPB 3DMRA 4ZYLA 2IP2A 3PD1A 1WB5A 5GWXA 4DE5A 3T4PA 3ID6C 2P9CA 4RACA 1I8DA 3ASRA 5FI1B 1H6AA 2WDPA 3O3CA 4KQFA 4QODA 2WZBA 4ENWA 5CA1F 3ETGA 4ZKEA 4MQEB 1FUKA 1PJSA 3FBGA 3WDLA 3D2BA 5IBRA 4WWVA 4BRZA 2HPHA 4RIEA 4S1WA 4RSMA 4XTRA 4C0AC 1Z0FA 1E1CB 2M32A 3IUBA 2NSJA 3RTBA 3L7DA 4G1FA 2NIPA 1V47A 2IIBA 4IYJA 5IH3A 3ZW9A 3SSNA 1THMA 3IUPA 4ZO9A 5D1HA 5J5AA 3NH9A 5CU7A 3UJHA 5JRDS 5LMCA 4HYEA 3TZEA 1SEPA 3HC7A 3QU5A 3LCUA 2B4YA 1E9CA 3NWBA 3LUBA 5FLKA 3M0EA 1Z2PX 4GVLA 1C3OB 2NP6A 3AF6A 2IRWA 3FROA 1A27A 3DE6X 4FCTA 3ZH2A 4L22A 4WNCA 4BX8A 1PTJA 1ADYA 3C8UA 3O83A 1C7QA 1D2CA 4GM0A 4QD3A 4BO6A 5JSZB 5LP6C 2WIFA 2KQUA 5I5GA 4K6MA 1RI2A 1XBTA 2J6HA 1M6VB 2P7HA 3GFOA 4OXKA 3HRKA 3SF8B 3ZHXA 1QH0A 4EA7A 1NJ2A 4D4LA 1ZSNA 4ZIRB 3B1WA 4NJMB 3RF6A 4RPDA 1K4MA 3IOMA 4A9AA 3DHWC 4PQFA 1ODSA 4KLNA 3G1UA 4NAHA 3A9WA 3I64A 4ZAXA 1OV6A 3CCJB 2A94A 3WMFA 2OSVA 1AKUA 2XYRA 3PUIA 1DKOA 5DYGA 1UR5A 3V1TC 1IYZA 3K0FA 4RDIA 1DBIA 4MJ7A 5DLEA 2Q1WA 3DOJA 5LVAA 5HBGA 1LFAA 2HIGA 4X8IA 1N7HA 2YXEA 2CLIB 3CA8A 1XQ1A 4OV6B 3L1UA 2BEWB 1FL9A 1RE1A 3RFXA 1JQDA 2RHDA 5E7IA 2BMDA 2QZ9A 4OP2A 4ZQFA 1NZDA 3PL5A 4BUCA 1IY0A 2DPLA 4BVHA 4XLEA 4PBRA 3KJEA 3PCTA 1D03A 4KK3A 1N5RA 3L0IB 5L7WA 1VCNA 2YW2A 3QVXA 1X9IA 4HMQA 3DF9A 2R7MA 1P5FA 4Y1FA 3SP1A 3ZKWB 4ER5A 5E6SB 3CYFA 3O8BA 5H7XA 3K4QA 4PPGA 4I2VA 4I4NA 3T7SA 1YZFA 1NG9A 1QIEA 4OYRA 3JWGA 4TPKA 5TRTA 4NBLA 3WK9A 4C43A 5IJXA 4IKOA 1OIVA 3ZC3A 1SD5A 1KO7A 1V0EA 1C4WA 1XF1A 1BEEA 1GY8A 1ODFA 1SA0B 4N03A 4OJNA 3EYWA 4XASA 5AM2A 2OC4A 4R1NA 5DTMA 2O3UA 3ZE0B 1NVVQ 3KM0A 4LVOA 2WVGA 5A3SA 4DIMA 2H92A 3M81A 5TMBA 3CB4A 5J4HA 2BI7A 4D4MA 1XYGA 3ITEA 3TLKA 2GBLA 2IXTA 4Y2PA 4EUHA 3C0KA 4UULA 5B37A 1T2EA 1QIFA 5LA6B 2ZJ0A 4KMMA 4RMGA 4GQIA 4UASA 4AMUA 5B6IA 1LI5A 4NFSA 2YR0A 3BGIA 1K5HA 5IP5A 4ROSA 4CE6A 1O4VA 1KHHA 2OB1A 3HN2A 3DZDA 5FTKA 4E03A 1Q7GA 2P6PA 2X1MA 2CLDX 3FGZA 1CF4A 4GMHA 5EKDA 5CT4A 5KQGA 3R7BA 4D8WA 1MRZA 4H7JA 4JOSA 3TW4A 4PN7A 2GX6A 1LK7A 4P26A 1JIKA 1VIAA 2JBWA 2Y1OA 3HDYA 1N5DA 3K0EA 3OLWA 4N3CA 3DDWA 4OSEA 3IBSA 1Q57A 4N7MA 4W9NC 1Z5OA 2HQSA 4C2AA 3IDFA 1XVUA 1QUFA 3OBBA 1YRYE 1PVDA 3WLAA 4D4HA 4PO3X 1DB3A 4MLZA 1KJ8A 4QOIA 1A7KA 3SHVA 3R3HA 4GMGA 3VZRA 4X6LA 1DHRA 3GOQA 3CHYA 2BEJA 5IVKA 1F0PA 1K3FA 4ARCA 3P32A 2ZT5A 3WRXA 2GERA 5FOSA 2ZI6A 3DTNA 3ASVA 3VAZA 5JJLA 5HWSA 1R0YA 3ZZ0A 2QNRA 1EDBA 3QEAZ 4WLOA 2WFLB 4NZNA 4X90A 1R15A 3T12A 3UGQA 2ANCA 2B30A 3PT9A 1PYOA 1DG3A 1WS6A 2H2HA 2QENA 5JXHA 1UAAA 3CUYA 3WBJA 4L76A 1P4MA 1BWRA 1NUHA 5KJCA 2FRXA 4ENSA 4CG1A 5H80A 1NU8A 4ZDJA 5A5FA 3AF5A 4WQMA 1KMHB 3DB1A 5JD6A 1LPOA 2GZAA 2C9OA 1NW3A 4G9GA 4Z5XA 2ZM6B 2QY9A 4Q9KA 2YZ2A 3B53X 3BIFA 3PKIA 4KXXA 2DH5A 4IOKA 4OB6A 5TEWA 1BSVA 1L5YA 3NIDB 3C6XA 3COZA 3G9XA 1J7KA 2AC7A 3GGGA 4XDYA 5TGDA 5BW4A 3AF4A 1JHOA 1DEKA 4WZEA 2O0LA 3H4IA 4CV1A 4AMVA 4ZAFA 4F4CA 4TMTA 4FWTA 2X0DA 2JFFA 2PLRA 2V03A 1Z6AA 4JAVC 4JOQA 2R7NA 4DHEA 2X58A 2V5VA 3GBVA 4D0NA 3RAFC 2F1HA 2W8ZA 2ZYUX 3R5HA 4YRDA 4EJ6A 1AH2A 3OIFA 3R0QA 1FNDA 4L8WB 4MRAA 4OMCA 2G6BA 4J1NA 4ZOLF 5CX1B 1Z73A 2C04A 2FSUA 3LF1A 1Q82D 2FUKA 1WB4A 2O8CA 4BVEA 4JCCA 1KRXA 4ZT4A 1E7MA 4KUGA 2JVIA 1B6RA 2IF0A 1A3CA 3A1NA 3L8MA 4HYYA 1FU8A 1I3KA 4GPBA 4WK2B 1FMFA 2JB9A 3IKLA 3MMSA 2FQYA 3AVYA 1G6HA 2QD5A 2PRZA 3IEPA 1UK9A 3WJ1A 1RAHA 2GZSA 3RYHA 2VSFA 2H5JA 2G77B 1U2EA 4N76A 4MX8A 4Q3CA 4A91A 2ZTUA 4HBGA 3PGXA 2OBRA 2Z5LA 4RVFA 1O58A 4RF3A 4TTAA 2JLYA 2LWIA 3AR3A 5E3HA 4IG4A 3FPSA 3ND9A 3MTBA 3QE3A 4O3MA 3DMPA 3VJLA 2QM0A 5TLSA 1AGPA 5HJ2A 4PG8A 4X71A 4PVDA 3NHYA 4ZAYA 1I7PA 1THGA 4X84A 4YPVA 4FHEA 3C3JA 1QRSA 2D7DA 3OHPA 1ZN9A 1BS2A 1J90A 1AK1A 2C58A 2DWOA 3BE4A 4MA0A 4IJ6A 2C92A 2JFNA 2Q1UA 3DOFA 3A9UA 4DUGA 4PPQA 3ZLVA 5FP0A 2PS1A 3PEYA 1W94A 4FNAA 2Q27A 4JSRA 3I12A 4MKZA 5AUOB 1Q6YA 2PA3A 3IQWA 3T1TA 1LSUA 1ZN8A 3RD5A 3ROXA 1DRJA 3P5BA 5LQDA 1I80A 3ER9A 1Z0DA 3QYFA 4FONA 4F71A 1GFWA 1MCZA 4ZTZB 3Q7SA 3UB2A 3L1VA 3C3DA 2M1XA 2Z3ZA 2PZGA 4B87A 1J42A 1NW6A 2OM6A 2PQ6A 1T6XA 4BMDA 3GJRA 2WJIA 1NSTA 2GUWA 5LL6P 1ULAA 2R5NA 3BREA 3UFXB 1Z4PX 2QUKA 4J0IA 2WKSA 3EGWA 4O0MA 4DG9A 4E88A 2C4UA 2COUA 4UTXA 5JH7A 2B8TA 4N8DA 4QXPA 4UHJA 4POOA 1GJRA 3GG9A 4C2TA 3ONWA 4PAMA 4PY2A 3EN0A 3IT2A 1GUYA 4E5DA 2QIPA 4W5HA 5CB4B 1G0NA 2FSIA 1IVNA 5FBVB 1QB7A 1XMSA 3UAXA 5IS2A 2VTBB 2UVPA 2LNDA 2FX3A 4ID3A 4QU5A 1VRWA 1QTNA 5LD2B 3FI0A 1H5NA 3DBRB 3U17A 4PF1A 2BFFB 5EWJB 2HWKA 2AW5A 3F3KA 3AVXA 3UENA 4PE5B 4EOGA 3OFVA 3WQHA 2NOAA 3QV1A 4MLPA 2VXOA 4LA4A 1PKXA 1RXEA 1E7QA 3LNNA 2G0AA 2R62A 3CE6A 1PX0A 1FLDA 3PJGA 3EZ6A 4OOVA 1B7GO 3NUGA 5ED0A 1L1FA 4DIBA 4O1HA 4RAOA 4CMKA 1KZ1A 3F97A 3S1SA 2YWGA 1VI5A 5KVCA 1EBUA 3RFUA 4BE7B 3GP5A 2F3QA 3CISA 3FNGA 3RYFB 5L6MB 1WVMA 1DLJA 1PG2A 1X0XA 3EY4A 3LC7O 4TQUS 1EFAA 3A11A 2BBWA 3G7NA 2XVMA 5IUJC 1Z3IX 2QUHA 2J9GA 3Q7IA 4ITUA 2D5AA 2GXAA 1W44A 3AEZA 2QG4A 3HXOA 1FQJA 1TM4E 2WHPB 2Y0BA 1Y1QA 2WTEA 3R8CA 4ZU6X 5HK9A 3R6KA 1PZHA 2QRZA 3KTAB 2XQIA 3KT0A 5ANRB 2GPNA 3U7HB 2QJFA 4Y6RA 4JDUA 8AT1A 4F91B 3FOEC 1FDSA 3VO2A 2JGFA 1WDMA 4HDOB 5JZMA 4QEDA 4K3UA 5TQ0A 1UD8A 2HA7A 2ZUWA 2XVYA 3K1AB 4JH0A 1N1EA 3VYVA 3U3RA 3ZGVA 3BQJA 5JAUA 2R2GA 1ZYUA 2BMEA 4TSRA 1QG0A 4MW4A 4UHDA 1R88A 1PZNA 2JCBA 3WXMA 1JDUA 1G8FA 1GDDA 2JLAA 2QE7D 1I3MA 3HKCA 1ZD9A 1D0SA 2GLUA 3N9IA 3RODA 4M4SA 1ZR2A 2RB5A 3H5NA 1UWVA 3T0GA 5LLDA 3D6NB 2CXQA 3NH6A 1DJNA 2XF2A 2X6QA 4TTRA 1UFOA 4B3JA 2WWFA 4XLLA 1WORA 1GNQA 1RRPA 3RREA 2GF2A 5PGMA 5BOVA 4OOXA 1SXJD 4L16A 1M75A 1FFCA 3L7BA 4R5HA 1FXWF 3LRXA 2GMWA 1L5GB 1GCUA 1F06A 1VHEA 3W0LB 4X65B 4EGAA 3OFNA 4QLAA 3AR9A 1H2YA 2GYVA 2RBGA 2VJKA 1DQNA 5I51A 3LQKA 4NECA 1VJRA 4DK0A 4KOAA 2XBUA 1SIBE 4C89A 5FTMA 3V7UA 4HEA1 3CJQA 3FE2A 1JHZA 5E3JA 1OU0A 3O2JA 3HWWA 5AOBA 1D0VA 1ONSA 2JJYA 2NU8B 1UBCA 2CKDA 3R0ZA 4OHPA 3N8HA 3LQYA 3IS3A 3LHFA 4JU9A 1BC5A 1XK7A 5AJXA 2EU8A 2XUJA 3P20A 5FUXA 3BXFA 2PS9A 3Q3AA 2C0PA 1TVKB 3KVOA 1SEVA 4O4HA 4OQPA 2NU9B 1L9KA 2XTNA 1NJ1A 3WAGA 5HOEA 5BNTA 2WV9A 1A2QA 2AMLA 2OBYA 1AA9A 1A9OA 4HE5A 1CHNA 1C1DA 5FA6A 2C96A 2MT9A 3NBAA 4IVNA 4JT4A 4TTIA 2I3GA 2OV3A 4EB6B 2GN9A 3D0KA 5LQRA 1MD9A 4L8VA 3H4MA 1D07A 4KX5A 3TLMA 3BH0A 2E4YA 1VP9A 2DX7A 4UNIA 3AOEC 1X7ZB 1GL7A 3DGFC 4A23A 2PX4A 2LW7A 2QR2A 3KEFA 1N5MA 3ZDFA 1NVDA 4AJJA 1DZIA 1O9BA 3SC4A 5AW1A 5KVQA 1OFTA 1MP0A 1VG8A 3WWYA 4MDFA 4PCUA 2FEAA 4MPRA 4BGVA 1SUAA 3ETJA 2HF9A 3GK3A 5FLEX 4QM6A 4ZI7A 1QX4A 1FC0A 4EAAA 4JVMA 3GMIA 2AI2A 4G8JA 3HDVA 4IIFA 2H1IA 4AMGA 1BS1A 1QIIA 1WCV1 5BWOA 3VZSA 1T0IA 2BSXA 2FYTA 3JQGA 5GONB 4A7PA 1IY8A 2NUPA 2R1VA 2EP8A 3Q6IA 3S2FA 5B4VA 4K8OA 1H4SA 1KVQA 1X94A 1L4HA 1EEXB 1PT8A 3ZNNA 2AYXA 3W77A 2OTLB 3WS7A 3ESCA 1ECFA 3PKJA 4PAOA 3VHXA 4ZQHA 5F7JA 4P7GA 4H08A 3NGXA 3D43A 5JMPA 4AROA 3NI2A 4DV5B 3PD0A 2P9JA 3EA4A 3HACA 2OCYC 4QOJA 3IUMA 4OHXA 4AY2A 3T5TA 1F0YA 2C9YA 3GRRA 3E6AA 5HVNA 1U1FA 3HN7A 1BZYA 5JQGA 1NSYA 5LXTF 3RUDA 4OUDB 2I65A 2WJ4A 2RHMA 1T0UA 1YHZA 2WJVA 3NHMA 2A4MA 4HXFB 3JWJA 5A5VA 5AW2A 2XB4A 2Z3WA 5JS8A 2QLLA 1HK7A 4NTZA 2B5OA 1L7DA 1D5CA 4LJAA 4L75A 4WBNB 1E4EA 1LK0A 4MYSA 2E87A 3ZCTA 5I47A 2LZJA 3DWEX 3IUNA 1MOZA 3EWNA 1NE2A 3DT6A 5CCDA 1BHSA 4BFLA 2DF8A 2WWWA 2BMVA 2QNBA 5EINA 1T1IA 4U3JA 5FPHA 1VJ0A 4MAMA 3R4VA 3ZE2B 2B35A 3A1EA 6REQB 1SC1A 4H27A 1UT5A 4DMCA 2GS9A 2HYIC 2W6CX 4MQ6A 1UPAA 4BP8A 2GCPA 4MDYA 3RRBA 4EX6A 4J9VA 4KIWA 4UEJA 1V5GA 2XYQA 3EAQA 2C5AA 4R2LA 1BE1A 5I8ZA 3TR0A 4B40A 5HNKA 1N1MA 3LVRE 1DWUA 1X8KA 3PVDA 2QT0A 4RHFA 3JVVA 2BDUA 3ZS8A 3P71T 2CMDA 1NR1A 3NR2A 2D06A 4R0NA 2WQZA 3LKBA 4WBXC 5FD8A 3Q8LA 1JVBA 3NPMA 3TVTA 4U2EA 3ZGOA 2VJBA 3BC9A 2ZYWX 1DJLA 3HKDB 4B4OA 1CUDA 4P38A 3O3OB 4N8EA 3FYCA 2VPPA 1QANA 5HP4A 5JFTA 1XQWA 1IIBA 2ZAIA 3L8EA 1W4CA 1RFLA 1YTUA 1APBA 2X9NA 1MC5A 4M54A 3WGJA 2FUG1 3NZEA 1UMDA 4C03A 1U8EA 2WYWA 1U0BB 3EZYA 3BSWA 5A06A 3V7YA 1P6UA 3A32A 1K75A 1R0WA 1MHTA 3QEMA 4TT3D 4ZHQA 2JANA 3IDOA 3OE1A 2D2EA 1TYAE 4HDQB 3UVEA 2Q3BA 4IFIA 4J0EA 1O0SA 1XCJA 4EEKA 4WZZA 2PJUA 4KFSA 2B21A 1XIVA 3R3SA 3CH4B 2VRCA 1QS0B 2ZB2A 1UDWA 2FSHA 4POAA 3JZMA 1CEQA 3ILXA 2F43A 3FYSA 3PPXA 5H8WA 2BGGA 3BKXA 1CQXA 2I6QA 2R79A 5B6JA 3NLLA 1GEGA 1SUPA 3WTBA 4DARA 3T5PA 3GZTB 2EZ4A 1YULA 1FRNA 3CEHA 3ONEA 3RJTA 4C6TB 5LC1A 3ABRB 1MO4A 2RE8A 5CA0F 4CEIA 4KRYA 2O2YA 6LDHA 1QRAA 4MRSA 2E6KA 4M9QA 2NQ8A 2W0SA 1P1HA 1VQ7B 1SQGA 2PU5A 3KZOA 5DIZA 5FFMA 1W19A 3WZMA 2A2ZA 3WQBA 5K0SA 3AHFA 4Q6WA 2XRFA 4UQPA 4JMQA 3A14A 4DHWA 2D9RA 2R4TA 3DD5A 3LVQE 3INTA 2VBCA 3R0XA 3R5XA 5I7RA 2BI8A 3AWIA 4GOXA 3VKWA 5HRAA 2GILA 4FD2A 3G2HA 4G0ZA 4K9PA 2VPTA 4DR5B 5KKCA 3FY4A 3P0IA 3HJTA 5E3IA 3RR2A 1X19A 3LLVA 1PGPA 2MTBA 4WK0B 4MWBA 5TS3A 4RH1A 3RYIB 2W48A 4BFVA 3MMPA 2O06A 3HXTA 1PNRA 2QN6A 3IP9A 5CNMA 1E2JA 1OI7A 2HHLA 2JBHA 2ZIXB 3QFHA 1N3YA 3LZ6A 4QDTA 4RDCA 1C7ZA 4IHQA 4TZ6A 2ISQA 4E07A 5ADVA 2WB4A 4WAUA 1FPMA 3QNMA 4RFSA 4M0LA 1OWLA 1IBRA 2W90A 2XA1A 3CLSD 3JD3A 4Y1RA 3SJUA 3ZXUB 4OHBA 1DPFA 1NZJA 4F6RB 4PG6A 4L74A 5BN5B 1FNMA 5FIUA 4QVJA 1AQUA 1L7MA 1T36B 3DEAA 1ZOLA 1W4RA 2A78A 3L6OO 4JJ4A 4YA6A 3UXYA 2IHBA 1F2DA 2QD2A 2X4IA 3S2SA 5CAEA 1QTQA 4JYAB 3E27A 3VXKA 2J3EA 4U9IS 3G1WA 2GQ0A 4OJTA 4FHZA 4ALIA 5CJJA 4AKGA 4O2BB 3FFAA 4YV1A 3AINA 1CUCA 4HNHA 4TSKA 3M5DA 5JAIA 5AVUA 1NVXQ 1PT5A 4R1OA 1VL5A 1RCFA 3OJOA 3QMWA 2XCSB 4HSGA 4UW9A 5LLTA 4AY4A 3L3BA 3O4HA 3BN3A 1JQEA 1T34A 4B9AA 1WHTA 2C2ZA 4EG6A 3DB2A 1K6EA 4X1YB 4QGSA 2IPAB 3ZDZB 5GADl 3M1YA 4JUIA 1OWMA 3FYTA 1WBJB 3NB0A 4OMDA 1HTTA 4QEZA 4EGSA 2ZYRA 1XMQB 1R37A 4UBMA 1O6ZA 2OHIA 2VK4A 3DAFA 3GSIA 3PXAA 2VXCA 4P84A 4PSCA 4KR9A 3M4YA 2X5KO 4U7WA 3S27A 3KWLA 5DEOA 4FN5A 4DMRA 3UPTA 2RGWA 3OZ7A 3IALA 3UT5B 4H1TA 2SKCA 5U1PA 4XJVA 5TT0A 1UD3A 3S7TA 4QBIA 3MWLA 2IV3A 4NXMB 3GAZA 5HUQA 3JATB 2ZE7A 1PKEA 2X41A 3SK0A 4BNTA 2YIJA 4IQFA 4OFZA 4EGFA 3THYB 3R7WA 3A06A 1WOYA 5J2UA 3T56B 1XA0A 4MR7B 1LS1A 1VL1A 4KAAA 4QTXA 4IDPA 1V9LA 4TKLA 1ZVQA 5TB5A 1VPWA 2F3SA 4YN3A 1KVRA 2J08A 1PQYA 1PWEA 3D8BA 5AD1A 1J2UA 3IE0A 3CPSA 3E0XA 3HH8A 2OBLA 3GFQA 4TZKA 2GK6A 1KIMA 2WMYA 3FUWA 2VT3A 3DAPA 3PCXA 3V4ZA 3IQHX 2QL9A 3M9XA 3N0VA 1T1JA 4BOYA 1STOA 1C9NA 3DKPA 5CW1A 3CPXA 1KQPA 3G0IA 2IIPA 4B85A 3WK5A 1HLFA 1EB8A 3FDJA 1GQRA 2BBTA 3GAAA 3LDUA 4WKPA 4BEBA 3ABSB 1D09A 3T9DA 1YDHA 1R2QA 1LDBA 3TLZA 3SXUA 4DDMA 3AO0B 4G5RA 2X14A 3INNA 4V24A 4IWXA 3LZCA 4RGBA 1P2VA 4D42A 1AQIA 1PJ5A 5D7BA 3ZJ4A 2V3CC 3IHTA 5C3UA 4PYLA 3B1JA 3D3WB 4HGOA 1T8TA 4EYQA 2FSVC 1A2KC 2YHSA 2JJ1A 4M1SA 3RTDA 1JQ5A 1O5IA 2ODAA 3SJ7A 4BX0A 3B3GA 3R6LA 4DJFC 1O08A 1Z37A 3P9QA 2NAFA 3BICA 3K71B 3C14C 5IM4F 5JAQA 3VR5H 1QC5A 1DO0A 3ZCUA 1F2VA 4J29A 3Q5GA 1AHPA 3G9UA 3L0OA 4R3NA 4ALMA 2J9YB 4C4PA 3ZVRA 3LDAA 3C41J 1OR8A 1KVUA 3K0FB 1Y5MA 2VWHA 2CLHB 2YQ5A 3A4NA 4P35A 3T54A 1UFRA 2J3IA 4RFLA 4E32A 1U02A 3GEPA 5EJAA 4E21A 2VYFA 4X1OA 5KINB 2QMHA 1P2GA 4MVWA 2FOIA 4OLJA 4YREA 3FPAA 1FJXA 3EVFA 1WP6A 221PA 2IYYA 1NYRA 3VM6A 2VF7A 3AM4A 4FDVA 4DKXA 1L7OA 1XDSA 3CT6A 1OI3A 2EFDB 3F6RA 4WJZA 2X7JA 2JGDA 3BRSA 3DVLA 4TV8A 1T9BA 1Z2NX 4X1IA 1M1XB 3MOSA 5IN5A 4YDQA 4KL8S 4UNRA 4UNQA 3ZXIA 4FFMA 1YR2A 5I9IA 3WLJA 1CDOA 2P11A 3QKRB 1T5BA 3Q1KA 3LBHA 3ZBTA 4PPFA 3FPLA 3WNQA 3KKKA 1Z0SA 2OR3A 4NBSA 4UXJA 3QW2A 4IOJA 4WDQA 2HMTA 3U26A 5A3QA 5FUQA 1QCZA 2V7TA 1C4XA 1JHXA 2ZS7A 4XQ9A 5AW4A 4CMCA 1Z62A 3P0RA 1ZCFA 2HLHA 3K9QO 3LNTA 1XDZA 4M36A 7MDHA 3RVQA 1POXA 3IMKA 5AW3A 2CNOA 2UUPA 4B4KA 4B3SB 3EGCA 3R41A 4Z54A 3ME5A 1N08A 5HR5A 2QZPA 3MXTA 2A88A 1YRLA 5IARA 2OO5A 5H82A 1LJ8A 5LZ7A 2IW3A 5EMMA 4FLEA 3LY7A 1MH1A 3PUNA 4M89A 1B8UA 3LAWA 1M7BA 1T3SA 1A0OA 1TM3E 2WNSA 2P9GA 4PCLA 4BE9A 1T25A 3QOFA 4XGRA 3TLGA 4CDNA 5CFLA 1JL3A 4MGYR 1BFKA 3HABA 1EWVA 2IS2A 2ISSD 1XU7A 1JXAA 4D5EA 1I32A 3FNFA 3OO0A 2YCBA 5ALWA 4NNOA 3LDFA 2W58A 4LMRA 3ROFA 3TW0A 4JL6A 1TMGE 1N9GA 1WSVA 5ETJA 1ZMBA 3OW2B 3RYCB 1XZCA 9MHTA 1FTWA 4N5IX 1ZCZA 4DABA 1XQVA 1J24A 4MIYA 5B3LA 5G4KA 3DE4X 1F6WA 2I34A 4QG3A 4DNRB 3S40A 4OMFG 4HRAA 4R8KA 1PDOA 1U31A 2XE7A 2ZSDA 1EBBA 4ZCMA 1MPXA 3NBKA 4UVHA 4DNXA 5J47A 5K8UA 1Y80A 5EPUA 5JWHA 3SZGA 3TQFA 4EECA 1QO0D 1YQGA 1FSPA 2AV6A 2OILA 3GRYA 3MJHA 4I36A 4W5JA 1T5EA 1USKA 1K5DA 3OU6A 1CVIA 4OQZA 2OPHA 1Z7GA 5KAPA 3LT2A 2CLMB 5HHTA 3JPYA 4N9WA 4WKCA 4QARA 1OOEA 3KYCA 2OG1A 4UHHA 3D4OA 4A36A 5B3JC 2EG5A 2HEGA 5BV2P 1YMUA 3T35A 1EIZA 2FCAA 3P27A 2BJWA 3R0JA 3ZV6A 2IGBA 2Q4TA 1U6IA 1P0FA 2I2XB 4FSHA 2QL6A 2UDPA 3R7DA 5KYWB 1Y6JA 4V0ME 2OGTA 1IPEA 3GG2A 2AHRA 3R3UA 1NQWA 2HCRA 2PWAA 3PXCX 5JAZA 4HNQA 3K9CA 3O9ZA 3K2EA 4PQEA 2A6PA 4LWZA 4AZ3A 4C01A 3U39A 3F5QA 1PFWA 3EWIA 4YMWA 3VPFA 1PKVA 4QVAA 1NXTA 1S5PA 1EZ1A 2OO7A 3DLCA 2O8CB 1GADO 4ED9A 2AMVA 3G2JA 1ZJJA 1RYMA 3BMXA 3QE0A 4DXAA 3JD1A 3QLUA 1U3WA 1J22A 1N7GA 3IVMA 3PNVA 4Y6PA 4MPJA 4YRRA 3COVA 3IKVA 4JJ7A 5JS7A 4WOCA 2CLOB 2R86A 1JG4A 4NOLA 2Z57A 2JC3A 1WB6A 2Z8XA 5T57A 2VBUA 2QLFA 3RYHB 4EHKA 1VL2A 1JR3E 1L5MA 2RC5A 2I67A 2J07A 1HT3A 1JXOA 2NVUA 2P2GA 1CETA 4DNTB 1R5OA 4XB6B 5FXMA 3ZCQA 5BRJA 1NJFA 1Z4IA 1US8A 5FWNA 2Y1LA 3GWZA 1AXRA 2PO5A 3N2YA 2Q6TA 1U0EA 2IODA 4BNWA 1GV1A 2DUJA 5CIWA 2NU6A 1XO1A 4KWIA 3T0IA 5ICFA 3HVRA 4NQRA 4IUDS 1OMOA 5F64A 3AKEA 3H0EA 2WP0A 4MGZR 2HBZA 1PJAA 3MFYA 5AKKA 2GRAA 1R9JA 2QTHA 2VQ3A 1JKJB 1OH8A 1YJWB 4V0OA 2H17A 4NJEA 5KTMA 4PAWA 3R76A 5BXQC 2W00A 3E2IA 4ASUA 4FB4A 9GPBA 1B3BA 4W5QA 1E1RD 2ZPTX 4B47A 1M7GA 5BSYA 2R7AA 4YRMA 3GARA <