1T5EA

The structure of mexa
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
231
structure length
231
Chain Sequence
TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance protein mexA
publication title Structure of the periplasmic component of a bacterial drug efflux pump
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 61
structure length 231
sequence length 231
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1t5eA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1t5eA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5eA02
3BDOA 1YNJC 2JE6I 4BA1I 2YYZA 1GHKA 3OPOA 3WB1A 1CTMA 1OXSC 1B9NA 1GHJA 1Z6HA 2E75C 3A7AB 3KLRA 3M4YA 3VR3A 3W3AA 2PPBC 2IT1A 3ND9A 2QF7A 2A6HC 3PUWA 3PUYA 4H0LC 2A69C 2AWOA 2V4DA 1VCIA 3PUVA 5KNCA 1H9JA 2JEAI 4RCNA 1GUSA 3A7LA 2O5JC 2A6HD 3VR4A 3NE5B 2A69D 2D62A 3VR6A 1Q12A 1Y69U 1GUOA 2EDGA 1HPCA 2B8GA 4G7HC 1VDZA 3T51B 2BE5C 5BN3A 1B9MA 1I6VC 1PMRA 5BN4A 1OXXK 3VR5A 3ND8A 3A8JE 2BE5D 2A68C 3M7NA 5A35A 3U9SA 1A6XA 4LJZC 1LACA 1LABA 1OXVA 1FR3A 1Q1BA 2A6EC 3PUZA 2E74C 4LK1C 3I73A 1G291 3FPPA 3OOCA 4KN7C 2A68D 1K8OA 5JJNB 2NN6I 3TZUA 4DK1A 3I4LA 5BN5A 2BA0A 2AUKA 2A6ED 3AB9A 1ZKOA 3LWUA 3WB0A 3VA7A 4KHZA 3SDZA 1YNNC 3N6RA 5JJEB 3A8KE 3T53B 4XIGS 1CI3M 2JEBI 2ZT9C 1FYCA 4JBWA 2K7VA 1O7LA 1ZYRC 3OW7A 5C0XG 1K8MA 1HCZA 4DNRB 3PUXA 2K32A 2K33A 1OXUA 4OO1H 2BDOA 2CW0C 1DXMA 2PCFB 5C0XH 4H13C 3WB2A 2D2CC 3QIAA 1DCZA 1GUTA 2L5TA 1Y8PB 1H2SB 3A8IE 3DXJC 3H94A 5D5QA 1Y8OB 2PNRC 3P20A 1V8QA 3CRLC 4TKOB 1Q1EA 2JXMB 3EQLC 3MXUA 4H44C 2BA1A 2EJMA 3HGBA 1IW7C 2DNCA 5D5PA 3WDNA 4DNTB 3CRKC 1H9RA 2DNEA 4GYCB 2R6GA 2Q8IB 4BA2I 5K36G 1CFMA 2NN6G 4KKUA 1EWHA 1IYUA 3BG3A 4KI0A 1IW7D 4OO1G 3FMCA 1VF7A 1TU2B 3L7ZC 3GD7A 2F93B 5K36H 2LMCB 2AUJD 3VR2A 2EJGC 3LNNA 2NN6H 1SMYC 3T56B 4IFDG 3PV0A 3QG1A 4XTCS 1H9MA 1O78A 5KNDA 2F95B 3M85A 4OGQC 1GJXA 4KKSA 2B8FA 1TKWB 1E2VA 1E2ZA 1ONLA 1Q90A 1V43A 2EVBA 1DD2A 4TQUS 1Y8NB 1GUGA 4IFDH 3IKJA 1OXTA 2D5DA 3D4RA 4PV1C 1T5EA 4G7OC 3I72A 4KN4C 5JEAG 4GZYC 5KNBA 1H9KA 3GQBA 1HQMC 3QJYA 4L8JA 1RSOA 1BDOA 4IQZA 3MFYA 1Z7TA 1IYVA 2EJFC 5JEAH 4I7ZC 2O5IC 4DK0A 4KMUC 3RLFA 2E76C 3BRCA 3IFTA 2KCCA 4KKTA 2DN8A 1E2WA 5JJJB 4JK1C 1GUNA 1HTPA 1H9SA 4HR7B 3SE0A 2F1MA 3D31A 4G7ZC 1H9SB 1QJOA 1VF5C 2KA7A
chains in the Genus database with same CATH superfamily
2VQEO 1RFYA 2JA7B 3FD9A 2Y69C 1VLYA 4DV4L 3CCEV 1PNLA 4LFBO 2B2WC 3FB7C 5B3SC 3ZIAA 2XNDA 3T4AC 4DV7L 2LKVA 1FGBD 4I50A 4XQNA 3ZRWA 2ITDC 1G7TA 1N34L 1NTGA 1E79A 2DY7A 4EQ5A 5C8YB 4J15A 4A3KB 4JI4Q 4KL1A 2Q8TA 1QVGA 3ABKB 1K0SA 3J80i 4C1NK 3TS2A 3OUFA 5LGNA 1EWHA 1WTVA 1PKXA 1K3RA 3I56V 1XNQQ 5KMGB 3WWVA 4P2ZA 3A5ZB 3I70A 1E0BA 1MRZA 1NB0A 1RF2D 3FP9A 2NBFA 2UUCB 1BQQT 1KC8C 5LP6B 2CK3G 1HNXO 2A73B 2ZE7A 2PYLA 5DS0A 3GTKH 2PF4E 1GM8A 5KHIA 2CGOA 4MYUA 4X7CA 4LNQA 1VQ7A 1PTOH 2N74A 4WBNA 1L8DA 2ITCC 4PV1B 4YHHQ 4CDFC 2NZOA 1E43A 1VQ8A 1JA0A 4WFGA 2LW1A 1WTHD 4JMQA 2BTOA 3MZ5A 3K0YA 4PQXA 3DLLA 1LUWA 5IK2A 2SDFA 3A3BA 1GOZA 2N04A 3PIP3 4H33A 2DERA 2NWGA 3BQJA 3RYIA 2H5XA 4XXEA 4PDVA 4LFCQ 4QUFA 2HLDG 2WSSA 4HJ8A 2CQOA 4PZ8A 3CCSB 1SROA 1ZLZA 1ASZA 5KRUA 3HB3B 3FKSA 1OHHG 1YHQA 3ZJZA 4XM3A 1TWHH 1HNZB 1HA6A 4LMQD 4X0CA 2ZKOA 4UZUA 4JI5L 2GSMB 1YTFD 3SJPA 1AI4A 2E5LB 3TQYA 4TMVA 2WLMA 2Y48A 1H85A 2WIIB 1PH7A 5EAYA 3KDFA 3T1CA 2Q2TA 5KGUA 3TGUH 4FK8A 2ZR2A 3DTUB 1NBWA 4ACAA 1PZID 3SJBC 1B9NA 3DDYA 1PFMA 3M4YA 3VR3A 2PW7A 2Z1CA 2C4UA 3ND9A 2K5QA 3TEHB 5FLXL 3QE2A 3F7YC 2X6GA 1S5LZ 1QFZA 3A8KA 2EQSA 4IUVA 2CF4A 3B8HA 5J3BA 1IBKL 4OPVA 4JI1B 1SNDA 1XPRA 1QLEC 3CXCU 1K8OA 3IC7A 1NY4A 5EKIA 1QNMA 4U3JA 2PZWA 3STLC 1WTRA 3CRAA 5JVDA 3JQQA 4ICGA 5M3FH 2Y0SE 1ROPA 4X62L 2D2CB 3ZN1A 1GN3A 2Y4UA 3OHXC 4J6HA 2R72A 1ZEQX 4X1YB 3SR1A 2R92H 2GA4B 1D5AA 2QEXA 4DR2Q 1EYDA 4DR1Q 2UUBO 3L9AX 3HKDA 1PZKD 1Y4MA 2DQ3A 1B8AA 1R3LC 2PPBC 1UD5A 3E8BA 2VL6A 2A6HC 3I5DA 4QVAA 1A62A 1XWEA 5B6IA 4LF4Q 1WFQA 1Q86C 1WB7A 3AK3A 1CHPD 4DR5Q 1DF5A 1UAPA 2UU9Q 3G05A 1EZJA 4NXMO 4DV7B 2ADPA 3ASOB 2YXLA 1FJGB 3CXCA 4GLAC 3JATA 3CQZB 4BY7B 2IH1C 3PQIA 5DEHA 1M93A 3A74A 3AGQA 4DUZL 4FFBB 1G51A 1BQ0A 3WU2Z 1WOSA 1HUNA 3T56B 3L74H 4BBRH 4X3TA 2F4VL 4MVUA 1SMYD 2EVBA 3PO3H 1EIFA 2XAJA 3ABMB 4CJ0B 4F88A 3A54A 1JR0D 4A3FG 1Y6XA 4DGZA 4J11A 3ML0A 4X20B 4POGA 2CNDA 5LMUQ 3H9NA 3Q3AA 4R4OA 1L0LH 1F77A 3FX7A 4JV5B 3L73H 1UEBA 3CMEB 3UDIA 3EIVA 4TQFA 1KAWA 3AVVA 2XWBB 3DEPA 2RF4A 3UO3A 3HR0A 2B8GA 3MHPA 1KD1C 2WYRA 3CMAV 4X1KA 2J0TD 3BH4A 4HNAA 2BE5D 2CDYA 3OZVA 3OZWA 4RA8A 3V7AA 2Y0SG 4AI8A 5CBGA 5EPLA 4B44A 1IBLB 4RUFA 1HHVA 1TAEA 3J81i 1PYSB 1UNSA 4JYAQ 4H13C 1VQ4B 1R6KA 3ZBTA 2LS01 4TKOB 2DYSC 1F51A 4HBNA 4K5XA 4JI5B 1XNRL 1G6PA 4P6YA 1G1XB 5M3FG 4O2DA 1FX0A 1ZL8B 2HMAA 1FXKC 2EJRA 3CPWB 4TUYA 1VQPA 1BE3H 3GQBA 1PYBA 2VQFB 2EIJC 1VQ9A 4UP9A 1K73W 2VZAA 4DV4O 1KK0A 1W3SA 1V55B 3VQXA 5IYPA 1TWFB 1CQXA 4IJLA 1NQTA 3M4OH 2UXNA 5JJKA 3FRPB 3FPUB 2OQKA 1I4XA 2P67A 3AK1A 4ULLA 4ZRZA 1GUOA 5EZYA 4DNIA 2IJIA 4A3LH 3B40A 2A7WA 1N34O 3SPCA 2HHHB 2RCVA 5EC2C 4DR3O 5D14A 4KN7C 3DMUA 2A68D 3UE0A 2BA0A 2B39A 5A2QL 1MZFA 1ZKOA 1NB9A 5IP7H 1QVCA 4X3UA 2YC0A 5CBEE 3JQPA 4X65Q 1STAA 1N33Q 2PCFB 2FFKB 5B1OA 1B44D 3BFRA 4JAUA 2Q6KA 1RCVD 3MC0B 5EIBC 4GQNA 5E4WC 4UCSA 1VARA 3ASRA 4R71A 3W7TA 3E22B 3A35A 4A3JG 1YIJA 1S72A 1FFXB 5J35A 1JVMA 4JI8Q 4OX9L 2E2JB 3L75H 1HVXA 2F0IA 1QUQB 4LF7Q 2X6CA 2F4NA 3HOZG 5EYPA 1SNOA 1H9JA 1KU9A 4BAYA 1PV0A 4Z1MA 1Q12A 1SZTA 5FNZA 1VDZA 1MD2D 2NNUA 3ASQA 5CB4B 3PUZA 2Z0SA 2QDLA 1EY7A 1BMFG 2VNUD 2NN6I 5ELOA 2EY5A 4HMIA 1WPBA 2PI4A 2M5SA 4XIGS 2ZXIA 1AJNA 4CH5A 4BIOA 3QWNA 2GREA 4PGOA 4P2NA 1GVHA 1N36B 5GADC 5BMVB 2FXQA 2V7QG 5I2XA 1VQHA 1AR5A 4BY1B 1B3QA 5FNVB 3TDQA 4WCEV 2X3UA 3H15A 1RKNA 4K0KQ 3L0OA 2DOGA 2JN4A 3ZMTA 4IL6Z 3VR2A 1F23A 2Z4HA 2F4VB 1GJXA 3VYRA 1EP3B 1Y8NB 3CC4V 1PRTD 2JJ2A 4W4LA 4LUZA 1HR0O 1SNPA 1DLBA 1QH0A 4A3MB 1KB9F 4M4SA 3BHPA 1NBMA 1WOOA 3NENA 1L0XB 4HSVA 1KAAA 4IGGA 3DGEA 1IBKO 2CVRA 1Q9SA 3N2GA 1SQGA 3RNUA 2AWOA 3MFGA 5C4XH 2PI2E 2JEAI 4HTHA 3CCLB 4QGUA 5FJ8H 4HN7A 1EYAA 4K2KA 3I2ZA 2C9OA 3H91A 1T6YA 4IN3A 1BO0A 3OKXA 3E2EA 4A3IB 3FPPA 5DEDA 3W5OA 5HFMA 3O65A 4X62O 1WVLA 3N52A 5T1IA 1TGOA 4GKJL 1F7YA 1DXMA 4WJWA 1PLFA 1I94Q 2NR5A 4X8IA 3J80c 2LFNA 3HOUG 1G2TA 4NYKA 2BOBC 3ZC3A 2CQAA 5CV5A 4XTCS 4MHEA 1O9GA 1FNUA 2PI5A 1BT8A 3ZHTA 5D3DA 4PMWA 2AGAA 2XUMA 4X06A 4C2MB 4I9WA 4RFBA 4K35A 1TY2A 2ZINA 4HIMA 3BVZA 5IGCA 1Q86D 2F0UA 2XT9A 1XMOL 2ZTCA 3W7XA 3JU4A 2ZZQA 4G1VA 1M57C 3RYHB 5M3MH 2QM7A 1XTCD 2AMCB 1EY5A 1YVCA 3I4OA 3Q4HA 1I4RA 3VMFA 3ASNB 4M53A 1B50A 3KF6A 4DR6O 1QCBD 5LL6X 3K6OA 2ZXWB 4UCRA 3CW2C 3QO8A 4DUZO 4U3FH 2D9RA 1XILA 4K2LA 1LLRD 2Z3YA 2BN4A 1XREA 1JJ2B 1US6A 4OOSA 3ZMVA 5KUMA 2AKWB 5J2TA 2YIDA 2BOSA 2I46A 4A75A 4DV1O 3J80E 3CCEA 2LMCB 2UXCL 3EN2A 3A5UA 1C0AA 4BBSG 3ZBHA 3C3LA 3ZN0A 2ZTGA 4Q20A 1WU8A 1AE3A 1UE5A 2YWHA 1G7SA 4CKBA 1WB8A 1RODA 2W6JA 1IJFA 1VLOA 4OX9B 4YJ3B 2AHYA 2D3LA 1N0NA 4QGPA 3E5SA 4J7JA 1U4PA 5C0XI 2QKSA 4Z4UA 2K14A 1U97A 5FLMH 3I56A 4DV2B 4OIJA 4RJLA 2BCOA 1WAZA 2LY7A 2VBVA 1Y1VH 2PQAA 4KHZA 1VQ6B 4L5TA 1SN8A 3S24A 1JWSD 4Z4ZA 3ABKC 3U6KA 1BLIA 1W34A 1XNRO 4TN1A 4C7UA 1F60A 3JALB 1NH2D 3VNUA 1DYQA 3D3QA 1FYJA 5C6AA 2Q8VA 5CV8A 1TU2B 1CPYA 4MTOA 5LP6C 3WOEA 1Y14B 4ZUJA 4X64Q 3H1KH 2F95B 2FYUH 2B2TA 3PIPA 2ZXOA 1N32O 1NMGA 4A3BH 2HCIA 2KENA 2V7TA 4PV1C 5AJ3L 1QVFA 2ADQB 1WOPA 3QOLA 3IFTA 4G1BA 4RUEA 5LYJB 4JI2O 3G4SA 4F6RA 4AQYQ 1BVSA 1EUJA 1GO3E 5EBWC 2JA7H 2VRZA 1RPOA 4DV0L 4LUVA 1TXYA 3GVJA 3KLWA 5EJWA 1YEZA 3CCJB 1VQDA 1VQKA 3K81C 1EY0A 4POFA 5C4ZA 3JARB 1UD6A 1MSGA 1KK3A 4OWXB 1KDCA 2PMZB 1TLLA 3IAYA 3DC5A 5L3EA 3SYCA 1K73C 4GKJB 4LFBQ 1SKYB 1O80A 4ZQ3A 4A3KH 1STGA 1UD3A 3AFPA 2R6GA 3G67A 1DJRD 3UM7A 4KY5A 3CCQV 5EKLA 2DQ0A 5ELDA 3CC2V 3BA8A 4UV9A 3NPPA 4D6TH 1JX9A 4PC7A 1YLOA 3CP0A 4DV6L 1F2MA 3QJYA 1VQEA 1NJIW 3OE7G 1S77D 1X59A 3OWFA 2F1MA 1XMOB 5FO7B 1N0VC 4UCOA 1E1TA 1BPLA 1PZJD 1XDCA 1G6ZA 3VA5A 3QG5A 3W7SA 4X66L 1OGIA 2MGSA 1P16A 2EDGA 1V1PB 4I4TB 2ZXPA 1E3XA 1X3EA 4DXWA 2CTRA 4DUYL 4BWAA 1SA0B 4PD4F 2ZDIC 4K6DA 3HRZC 2XZOA 5DNFA 2DIEA 2B2YC 3J81c 5CA3A 2VUMG 2IJJA 4K6LA 3PIOA 4B3SQ 2E74B 2YV5A 5IYNA 1IL8A 3KCXA 1TWAB 2RSNA 3E35A 4M1KA 1Y1VG 2D2CC 3U6BA 1S0UA 5AN9A 5C3EG 2HCCA 1ML0D 1EBOA 4WJ4A 3IGAC 3QO7A 4RPBA 3ZYYX 5CV6A 2UXCB 2WLIB 3TJTA 2X0KA 4UP8A 4DAPA 1Z2GA 5EPJA 1TS5A 4X3SA 2V7UA 1N0UA 2CBXA 2Q6OA 4TVAB 4RWUA 2OCHA 1H95A 4JK1C 1LT4D 1AN8A 1GHKA 1QFYA 3S1MB 1N0JA 2RN9A 2YDEA 4WFBV 1QNKA 1VCIA 2V1DA 4TV8A 4XOTA 1THZA 3EHBB 3ASOC 2HVKC 1ZUNB 3JC66 3L2PA 1PV4A 1XXGA 4LJZC 2UXDL 4XDLA 3OOCA 3W5VA 2OCEA 4EB6B 3BC9A 1YNNC 2K5VA 2QWRB 3RT3C 3H1IH 1ENFA 2ENBA 2K32A 3TETA 4RHSA 1FNWA 3JAMc 2NVTB 4DXFA 2P06A 4XL9A 2Q9LA 2C4TA 2GDSA 3EXAA 3H1HH 2SEBD 4HIOA 1S3OA 3ABMC 4HE6A 4L5SA 4LF6O 3TZDA 5DN6A 3CMAA 4U7OA 3F2CA 4LF5B 3BU2A 3PO2B 3ABLB 4OWWB 2R70A 2VBUA 3ETGA 1MJCA 5HGTA 3OD4A 2HJDA 3A8TA 1PVOA 1PDQA 2PZTA 1ESRA 4P9PA 1X3GA 2K01A 4JAVA 3THOA 2LZJA 3OP1A 1GUNA 4GNXB 1AMOA 1HTPA 4O4IA 4G7ZC 4JYCA 5JCOA 2F66C 1U4MA 1JB9A 4DV0B 3Q6RA 2B2VA 1EFRG 2UUBQ 4TQDA 4Q7JB 2E75B 5H5JA 2CH4W 1LM0A 1E3PA 2HIXA 4R4TA 2M9VA 3KF8B 1CP9A 4GKKO 2PO4A 4GX0A 2OTLV 1YZ6A 1DG1G 3URYA 2Q6IA 2ZTDA 2KSDA 4MTKA 2UXBL 1XMQO 3M8AA 1AP6A 3CQZH 4BY7H 1VQLV 1RTNA 3H94A 2EXDA 2WWWA 2JGDA 2B2WA 1JCKB 4RDKA 2Q8IB 1RSOB 3GWOA 5J1ZA 1VQNB 1SNMA 4KI0A 5IP9H 1HNZQ 1H9MA 4RGMA 3V2TA 3IFDA 3IKJA 5BR8L 1STNA 4A3GG 3FJOA 3I7FA 3EJIA 1ENCA 3OTOO 4DAYB 2Q2HA 4QV2A 4UUJC 3HOYB 4ZGNB 4RAIA 1HW7A 4X66B 4G6IA 3B6YA 1I08A 4NTYA 1GM5A 5C44B 4HIZA 3VR5A 3A3GA 3HKEA 2F0FA 2IM9A 4JI1Q 2N88A 4TV9A 1Y1WB 2F4IA 4TMWA 1FYCA 1ZYRC 3ZRSA 4DV3L 1LTLA 4GN5A 2C78A 5G3LF 2VYQA 2NYZD 5FLXN 3U11A 3OEHA 4CH4A 2B7BA 4M8AA 4AF7A 1JB3A 1O7IA 3CF5A 2QKIC 4FN5A 3F5TA 1LTBD 1YTFB 3CCMB 3CAMA 4UVAA 1C8CA 4V190 1PM9A 1GO3F 4ZOLB 1WN7A 1K33A 2E2IB 3AVTA 1GN6A 2MK3A 1LO5D 2IU3A 1TWFH 3I55B 1SAPA 2VBSA 2BDNA 3K5LA 2PE3A 4NTWA 3Q6SA 4KD4A 3T1HL 1JORA 5LGTA 4L5QA 1VP7A 4DV4Q 4HMJA 2WLJA 3CCSV 1V5VA 5BN4A 4LWSB 2DW4A 1NR4A 1KTKA 4B3ML 2CCZA 3NXSA 4FLTA 4DV7Q 4M0LA 1H38A 3TS0A 3CC4A 4I50B 3L9DA 2K5WA 2K1EA 2RCNA 4NXNL 5CN0A 1K8MA 4CBVA 2DUDA 3CPWU 1N34Q 3BNWA 4DQKA 3SYAA 4BXXH 3GTMB 1KECA 4RGNA 2BVNA 2IU0A 1O7YA 5CORA 2UXXA 4B3TB 4DV6O 2VXWA 4BY7G 1S5DD 1IW7D 1FS0G 3B82A 3I4MG 1G4YB 1HJPA 2NLJC 2XAFA 3FYEB 5IYCO 1VQMB 4O4JB 1SLJA 2KKWA 4E2LA 2A8VA 1A32A 1EFCA 1Q90A 2JJ1A 4P72A 5DLQE 3SLNA 4DK6C 3AG4B 5KNBA 4J8QA 4P73A 3CC7B 1AZQA 4MW3A 5KHJA 5H1SE 5IYRA 1U2RA 3D8GA 3S2DB 3T1YB 5IYDH 2KG7A 1KQSB 3TREA 4ABNA 4DUYO 1VQ8B 5EK0A 3UDGA 1SC5B 3LSQA 2ZQMA 4NMZA 3CRMA 1L0WA 1HP8A 4DAMA 1KP3A 1LT3D 2GTAA 1V54B 1W0JG 1KDBA 3BZDB 1J5EL 5IWAL 3GTPB 1NJIC 5KA5A 2K75A 2UXBB 2Z6KC 4EEQA 4QIWE 2Y0IA 1SEBD 2EYLA 1JOOA 1EIGA 1VMCA 2AZ0A 2QWNB 4DW0A 3G6BA 1Q1EA 2ODMA 4BY1H 5CA0A 2IX0A 5JH7A 3GTLB 1X4TA 1EL0A 1HNWL 3K7UC 4JI5Q 1ILPA 4AC9A 1B1ZA 3W5HA 1FNMA 3CP8A 3OEEA 4YY3L 1KIXA 4XONA 4UV8A 1CKNB 3SK5A 3D4RA 1IYJB 1PA6A 2EIXA 1I8DA 1X54A 3H0GB 2MO1A 4A3MH 4RH6A 3ZIAG 4YWMA 2XNDG 3LGJA 2QTLA 2EFGA 4YAWA 3BDLA 2RC6A 1Q82C 4BR6A 5M5XB 1EEFD 4JI4O 2K52A 1Z5VA 2UXDO 1OB0A 4GS3A 4HJ7A 3OMNB 3ASNC 1R6NA 1E79G 5LXTA 2FMCA 1XNQO 2ZJRA 4O4HA 5J9PC 3S17B 4A3IH 4CS4A 1A6XA 1IBKQ 4FDBA 2R93B 2NB0A 4J7KA 4DV1B 2RKSA 1W0KA 5LMNB 5IT9c 4U3JB 5IJ0A 3JAKA 3F7VC 2WJYA 1EYCA 2UUAL 3GTGB 4A93B 1WTQA 3T16A 5B66Z 1GAQA 3F8TA 4LH6A 2R9RB 2RDFA 1TA8A 2PGGA 4X62Q 4PA4A 3BG3A 1VF7A 1BHBA 1TVKB 3HKCA 1EFID 2ICIA 1NNXA 3CMEV 4ZGQB 4RCZA 1PH9A 3H3VI 4WQMA 3APOA 5A2QN 2NZ1D 3V05A 1D8TA 4KN4C 2QEXB 4FF3A 4C2MH 4HIKA 3ZRVA 4LFCO 4C3JB 4HCSA 2QTZA 3DWQA 1C7YA 1JQ0A 1RQPA 2WSSG 2J7KA 4IIJA 1A3UA 1Q6UA 4YCWA 3JASA 3FKSG 1FXKA 3APQA 4S3SA 1EU3A 1O9HA 4RQEA 4N9PA 3S16B 1EU4A 1WTWA 1VQ4V 4B3MB 1OXVA 1FR3A 3L3OC 5F2DA 2NVQB 1NVPD 1YHAA 2OCCC 2IPKD 4XD7A 3CXCB 3P3NA 2K7VA 3JATB 4I7AA 2HD3A 1EZ8A 4K8ZA 3U50C 2L55A 1AI7A 1VQFA 1HRJA 1JJGA 4A3DG 1TUBA 4KXRA 5GONA 5IT9E 1D5MC 4I55B 1DZ1A 4DUZQ 5BR8O 3RZOB 2KEEA 2DOSA 2OQ0A 3FKIG 2AUJD 3LNNA 4NVPA 1WCMB 5A2QE 2F0SA 3U58A 2B8FA 2F4VQ 4OONA 2W0FC 4HCEA 3BCCH 1BXTA 4UCVA 1GK9A 1I7PA 3RYFA 4YAFA 4RGOS 2ATWA 4GOPB 3RBZA 3PUWA 4A3MG 3STZC 3J7AV 3AVYA 1JJ2U 1QZHA 4IPGA 4XNFA 5KSWB 2QDOA 1Q81W 2CRVA 3CCQA 4CBCA 4ZK9B 4X1KB 3IRBA 3U9SA 3CC2A 4DV3O 3I73A 4QQBX 4D7TA 4B3FX 4DR2O 1A3TA 2FJ2A 3NTIA 4DR1O 2A19A 4XT3B 2OYQA 2K28A 1M90D 3TMEA 1YI2B 4F87A 5KEEA 4Y7CA 2EY2A 2Z5UA 2DNCA 2ZL6A 1VS0A 4UPAA 4LF4O 1XNRQ 3EVKA 2QCPX 4YY3B 3ZJYC 2UU9O 4CZZA 1E2VA 3NTHA 1PH1A 4QVJA 3STBD 3FYIB 5L3FA 5EQ0A 5BSYA 4DPGA 2PYJA 4B48A 3T1HO 1PRTB 2BTQA 5ELFA 1RL2A 3WXMA 4CC6A 1RJTA 1E1QA 1CA5A 3RN2A 4FFKA 3GVKA 1N32Q 2L6LA 2CWAA 4P30A 1PFSA 4IOAA 1R6TA 3JYCA 3LNMB 1EWYA 1Q8IA 2Q68A 3HOXG 2F0DA 1EZ6A 2XTIA 1I4PA 2FX3A 4MS2A 3H01A 3FFQA 4B7EA 4NXNO 4H0LB 4CS3A 5C3WA 2EIKC 3GTQB 4ROXA 3CPFA 2E74C 1G7CA 4EH1A 1CT1D 4RG1A 4Q6GA 3W7UA 2OTJB 2C5HA 1U4LA 3X3MA 2FVGA 2WJVA 1D6EC 1VHOA 1GD7A 3U2QA 2F1LA 2UUAB 2XAQA 1SRUA 2R7ZH 2V31A 4G28B 5EMNA 2BDOA 2G9DA 1SQXH 1QX4A 1BSMA 3ZHSA 1WPXA 1OCOB 2EYFA 4GYCB 1I4HA 3PUNA 3M7GA 1DOMA 4JI7B 3K0DA 3GDEA 3P1HA 3BZKA 3M85A 4DR4B 5LMNW 1SNCA 1DGSA 3K57A 1VQJA 3WNCA 1ZWIC 1ZSPA 3DC6A 3CCLV 4LW1A 2DJGC 2D3OW 4IPHA 1YIJB 4KKTA 3FB6C 4RD4A 3SE0A 4OX9Q 3OE7A 4BA1I 2AQ2B 3MHBA 2YWGA 1COWG 4K8XA 1PNMA 3ULPA 1J5EO 1V1OA 5IWAO 1BBXC 1JFFA 4XYOA 2V7WA 5KYIA 4A4IA 3ZZTA 5BN5A 2BM1A 1QCEA 2I1LA 1TWAH 1AH9A 4LF6B 4YCVA 1M4VA 2BOCC 1HNWO 3CB2A 3ZRXA 4YJ2A 2ATKC 3CCVB 1A15A 1S5JA 1D5ZC 1SSOA 3ABLC 5JVG3 4N23A 1Q8KA 3CW2A 4IFDG 1EN5A 2B63B 4M1UB 3AG3C 3KG2A 2P90A 4UXNA 3AGPA 4Z4VA 1SM4A 2F0KA 5IJ9B 3HKZB 4GNXC 4ZI7B 4PC2A 2OTLA 1JQYD 3C2PA 1R1BA 3NBHA 1Y74A 1VQOA 1PH4A 4MVRA 4QB4A 2IH3C 3O9OA 1QR8A 1J95A 1E62A 1VQLA 3S1MH 1GHJA 2E75C 4Y7NH 1SE8A 3N2GB 3EFFK 3S9WA 5M5WH 1NTZH 2O5JC 1MSHA 3S2HB 1SE3A 2H4OA 4I0XB 1KKCA 3UT5B 2OYNA 2WAQB 4LR3A 2A6ED 4A76A 4NR1A 1S5CD 3OAAA 2X69A 4AILC 1WLEA 4GKJQ 5L3BA 2XHBA 4JI8O 5L3CA 4LF7O 2NVTH 4AF6A 4IHJB 1F2ZA 2BA1A 1D5XC 1NH2B 3WBKA 3P32A 1AP5A 1N9WA 2R7ZG 1KMHA 3G80A 3CHXA 4PDLA 3OW2U 2X6BA 2NN6H 1WTPA 3PO2H 1BJKA 2YIBA 1NSNS 5C8YA 4IUNA 2VWJA 4Z1MG 5CV4A 2JK8A 4DK3C 5KMGA 5L3DA 1F9PA 1XI1A 3KLRA 2ASBA 1XMOQ 3PUYA 4JI0B 5LP6A 1VQ6V 1P4RA 2Q2UA 3VR4A 2Z6BD 4K0KO 4XR6A 1CKMA 2V7XA 1NR7A 3BY6A 2E1BA 1KTVA 3U10A 3ZZ0A 3MMPA 1K5QA 3FEWX 1AW7A 3AB9A 4PNYA 4N3GA 1EQTA 1GN4A 2VB3X 4DU9A 4UB8Z 4QNHB 1K28D 5KYLA 4OOVA 3F1ZA 2JJ2G 2PZSA 1GM7A 4JCVE 4HZ3A 4DV5B 1QHTA 3AFQA 1NBMG 1EQVA 3E3XA 5THXA 4QJFA 5K36G 2X53S 3MEFA 3BVMA 4QHYA 3CCSA 2A9HA 2E8GA 2UXCQ 2I5MX 1H8EA 2F0EA 4UHVA 4PMBA 1Y76A 4DR7L 3SPGA 1KHIA 5I4DA 3CCJV 4F6EA 4JTAB 3P26A 1B70B 3FB8C 1MGSA 4WFFA 3Q38A 1I94O 3CRRA 4A3CH 3HOYH 2RC5A 3CRZA 3IJ4A 4MVSA 3E1YE 5C44H 1YDXA 3H09A 1U96A 2WPDA 1GKHA 1DTOA 4CKCA 5KHGA 3OTFA 1RD9D 4F7XA 1GUWA 1WDTA 1L1OB 1Y1WH 2J7ZA 5EBLC 3S14B 1IKMA 1FNDA 2N05A 1DM0B 1BX0A 3GB7C 3SJAC 3L71H 3CCRB 1G7RA 2UUCL 4JI3B 1CKOA 4K5WA 2ZDIA 2IW5A 3BABA 3TK1A 3AG4C 2B2YA 5C0XJ 3ZUGA 2ZM6L 5JPMC 3TXSA 1A3VA 1H9KA 2E2IH 1H2MA 1K34A 1TIID 3D3RA 5E6TA 2A74C 3DUZA 4X1YA 3G4SB 2X6XA 1LTTD 1FAFA 3SPHA 3MHSC 1RIPA 4DV0Q 3JD2A 1V54C 1IHMA 1QU7A 1VQKB 2QE7G 4QPKA 3OR6C 3NP8A 3GV3A 1MSWD 1F2YA 2IL8A 3RZDB 2OBRA 1OCZB 2JA8G 1D2BA 1KYOF 2HCJB 3S1QB 3S15B 1KXLA 3T53B 2E2HB 1D5NA 4LFAL 3TP5A 3QVNA 1NZ6A 1TUEB 1EN6A 2E5LL 2JQOA 5C0XH 3GTMH 3HKBB 4X7EA 3A8IE 2KB1A 2EYHA 5FO8B 3UDXA 1R9TB 3SK6A 1KRHA 1IJEA 1FFTB 1LTRD 2F93B 4OPSA 1EOVA 4R1JA 1SMYC 1D1KA 3CRCA 1ONLA 3EVQA 4ZCLA 2KVMA 3KK7A 5KAIZ 4C3HB 4CJ1B 4GZYC 2WA4A 3SYPA 4DV6Q 1YJ9B 1BDOA 2VJJA 1PJ7A 2EJFC 3D4DA 5LMZA 3GWKC 3D0FA 1EP2B 5DSZA 3HKSA 3K5MA 5GROA 4R7CA 3JD3A 1KMIZ 3S2DH 2IJ0A 3BDOA 1F9QA 3BZCA 2L0CA 4JBMA 3SYQA 2BF4A 5IYCG 3RN5A 3G6EB 2QGNA 5BZBA 4FLWA 4X20A 3I4NG 4K5VA 1PHJA 3HOWG 2BE5C 4YHHB 1QVGU 4A3CG 3CMEA 2AHZA 5LHHA 4DUYQ 3TBIB 3GTPH 1MI2A 2HFEC 1UE7A 1W0JA 3U0ZA 4GZRB 2JS5A 3VQWA 4E0FA 2EYJA 2VB2X 2SNSA 1TTTA 5I9OA 3C1EA 3ZCCA 2KUMA 1UD2A 2CW0D 3QO5A 3BA9A 1E64A 4YIOA 2IX1A 3GTLH 5TY0A 2EJGC 2KCNA 2YIAA 3MAQA 2WLLB 1STHA 3WQZA 4DR7B 1OXTA 1AJQA 4WF9V 4A3EG 4OXPA 3OMGA 1KDAA 4CS2A 1D8LA 3BVGA 1M4UA 2BSKA 5M5XH 3AVUA 5L37A 4FF1A 3OPOA 1ZL8A 3VDYA 1B04A 2RJZA 5ELNA 4OPAA 1CQFA 1FJGL 3NWTA 4Z4TA 1T9HA 5JEAJ 1B9MA 3S17H 4ME3A 3C3SA 2A68C 1S3JA 4PA9A 2R93H 2RBMA 1S40A 2UXDQ 3ASTA 3D26A 1PFNA 3SR2C 3BPZA 2Q0AA 3LVBA 2B3GA 3K03A 1VQNV 1YITB 1GTOA 4A93H 1HCZA 2YTVA 4PA7A 2JA5G 1PXUA 4Z9CB 1GUTA 2LGWA 1BCPD 3LUTB 4MZ9A 2ZE5A 4U68A 5LHY1 2WV6D 4C56C 1CFMA 1WA8A 2H1EA 4ME5A 4JV5L 2ZM6B 1E1OA 2JGUA 1YXBA 1GUGA 3VO2A 4UY8C 4GOPC 4C3JH 3VQYA 4P9OA 3S3WA 5JEAH 3CCUB 4B3SO 5JOBA 2M6YA 2AZ2A 5IGFA 4I7ZB 5H5NA 5AFWA 4ZYSA 4FM1A 3E22A 1IBLL 2Z8LA 3I3CA 1FFXA 3S16H 3ZEDA 4C3IH 1LR1A 1EY8A 2AQ3B 4RDLA 2NVQH 1E1RG 4CHTB 4J9YB 1G8ZD 3HEJA 1B3AA 2P22C 4FP5D 3M7MX 3ULLA 1WP8A 3IL8A 4LFAB 2JIZA 3E86A 4LC1A 3HFZB 2UXBQ 4DR5B 1XEQA 5LBQA 2HEPA 4MTGA 3A55A 3CCMV 3MXGA 2Y69B 5CB4A 2CUGA 4XQFA 3OFNA 3RZOH 4AYBE 3SEJA 3AU7A 3MA2B 2L11A 4R50A 2VQFL 3IC9A 3I55V 4YXWG 1WCMH 1PRTC 2ZL5A 4ZKIA 5BMVA 1PH2A 5DECA 5BR8Q 4WJ3M 3E0JA 5FNVA 4LF9L 4K1XA 4II2A 1L2FA 4KMUC 5B1BB 4A3FB 4HSPA 1OO9B 4Y9RA 1YJWB 2HHHL 2F43A 5ITZA 4H0LC 3JSNA 5IYBH 3LDDA 2OWOA 4CJ2C 3W7WA 5L3GA 5LMUB 3OJWA 4B3RL 3JCUZ 5GV7A 2KHIA 4NTXA 4RWSC 3HOVH 3CS5A 2HQEA 4W4KA 5C93A 1UD8A 4IFDJ 4L87A 5DN6G 1RDPD 3TSSA 4BIUA 2Y0SB 4CGYB 5BXZA 2F0PA 1VQMV 1OCOC 2K5DA 1VF6A 4DV3Q 4X05A 2A79B 5A89A 4P6VF 1Q81D 1JWMD 4XT1B 1Y8PB 5LHIA 1L0NH 1P4MA 2PNRC 2LFSA 1BGYH 1QR9A 3OGIB 3LWEA 3Q24A 3CC7V 1AIPA 5IODA 4JYAB 2YS8A 5JAVA 1I18A 1IHZA 2DY1A 5IYQA 2XRSD 3ERSX 4X7FA 2Z6KA 1VQ8V 2D5DA 3PSIA 1B2RA 1FNVA 1RQRA 2F0OA 4P26A 1IXMA 2P3MA 4JOIC 1BCCH 4IUPA 2L12A 1EIHA 5FPOA 4ZUIA 4HR7B 2RDGA 2KOLA 1HZCA 2WB1E 1W35A 3K80C 3SEBA 3M3YB 1CTMA 4XOPA 2PMDA 4QCLA 2KQXA 4OO1I 2BH2A 1PNKA 1H2KA 3T1HQ 2OEOA 4KP4A 1M56B 3BCDA 1K3EA 5KLVH 1HNZO 4B9XA 1XJVA 2BE3A 4EGVA 4N8FA 2AQ1B 4IUUA 2KHSA 2E5LO 1N36L 4HJAA 1ENAA 4B3MQ 2WP8J 4AYBG 4KHPL 1SYCA 4ZCIA 3RYHA 3BVOA 4C3IG 3J81k 3FDTA 3GTJB 4NXNQ 3NK9A 1PKVA 1SYDA 3GTOB 1UE1A 1V8QA 1J6QA 1K3BC 4FJCC 2DEUA 2MPMA 3TP7A 4R6ZA 1EFUA 2OK8A 4X65B 3QFCA 3GV6A 1N33B 2QW7A 1JOQA 2R6HA 2CFMA 1QILA 5H6QA 3ZMSA 5BSXA 2K5HA 4JI1O 3EROA 1HZEA 4CQJA 3LQEA 4RO2A 4A3JB 4RD0A 5CA1A 3WNBA 3LO8A 2JVDA 1IBML 1UFIA 5TR9A 2RDHA 3UO2A 1Q3LA 1Y69U 4G7HC 3HOZB 1COWA 1PL4A 3OEHG 5CV9A 1J5EQ 5IWAQ 2VNJA 3ABTA 1VQBA 3HOVG 4Z4WA 1NVPB 1N07A 1V0EA 3SDLA 3QF7A 1V9PA 1S5ED 3FAVB 1YNXA 1VQIA 1Q6IA 2QEXV 4C43A 5I6YA 1VQ6A 5JH7B 1BNZA 2B7CA 5J3OA 1PL0A 2R92G 1HNWQ 2B63H 1FKAO 2WB1G 3JALA 1P7BA 4LBWA 3ABUA 4YY3Q 4JI6L 2XZPA 3N2KB 4AH6A 1WSRA 4DV7O 1KKDA 4LF9B 1Z7TA 3BY2A 1FJGO 2PIAA 2NV4A 4ALPA 4JVZA 5FL7A 4X64L 2YYZA 1BQZA 2ARHA 2ZNIA 1CNEA 2EULA 3S2HH 2EZOA 2F0LA 4LF8L 4B3RB 2A69D 2YWEA 3D6CA 3P7JA 2CGNA 4JYYA 5I9PA 1VQ5B 5LYJA 1NAPA 3HP3A 5IYZA 4WZLA 3ZBUA 2RNBA 5IY5C 2JJQA 2O2LD 3K0XA 5JJIA 3CCJA 3OMCA 1K92A 2JJ1G 2YTXA 1SQQH 2I5HA 3J80L 2Y4TA 2VQEL 4JV5O 4TSFA 1KRTA 3HGBA 4KKUA 1CSPA 3HPLC 4LFBL 4BBRG 3HOUB 5FIUA 3L7ZC 1S5BD 2GUZB 3PO3G 4TRDA 1JC7A 3R2TA 2KCTA 2X6YA 2DETA 4G27B 2N3SA 1V1QA 1AILA 4B9WA 2HIVA 3KJPA 2O5IC 3CJHA 2OIEA 1IBLO 5H59A 3RLOA 1PTOF 4DV2L 3E89A 2DGYA 1A2UA 4P71A 3H3VC 1FD9A 5IE9A 1X56A 3DWPA 4YIPA 1L1OC 1LT5D 3A0RA 4JI5O 1YI2V 1W2BA 1PMRA 3VYSA 5COYA 2EIJB 4LK1C 4KHPB 1SR3A 1HNXL 2JRIA 5H6RA 2C35B 4RM0A 3OEEG 1V1PA 4I4TA 4RCYA 2VQFO 1FXHA 1LTAD 2CTWA 3JCZA 1HFGA 4X1IA 5HZBA 1NU1H 1OB2A 2HP8A 1SA0A 1Q7YD 5TV2A 1CXZB 1SYFA 5M9OA 2VJIA 4Q0FA 2Z9HA 1PH6A 2ZD9A 1NI8A 2F23A 4FK5C 4NKLA 1RHPA 2RHSB 2HHHO 1WYDA 4BBSB 1PP9H 1BUVT 3NHHA 2WLIA 4ASUA 1W0KG 5F4OA 2QR4A 2F3IA 1IBMB 2OTJV 4PMCA 4XDKA 1P8LA 1PFBA 1BX1A 1B4OA 3H3VH 4A3LG 4JYBA 1B23P 3VYUA 2LFRA 1OCZC 5E7NA 2WAMA 1FGUA 3RMHA 4WZTA 2F0HA 1N4CA 1FPOA 1WJZA 1NDHA 2R9IA 1TWCB 4TWKA 1K4CC 3CESA 3S14H 5IP7G 4MVOA 2BGJA 1MZEA 4OPHA 4II3A 2YXYA 1EQQA 3VBBA 4H44C 3OZUA 2ZBVA 4EB6A 5IYDO 5LOVB 2EBOA 4XBFA 1AROP 1YIJV 1LUVA 3U4VA 1QG7A 4JI6B 2OT2A 4WRDA 4YAOA 2Q7EA 4J10A 1SKQA 5CMDA 2FB5A 1JMKC 1K7DA 1JJOA 1JOYA 1HDJA 4R9WA 5J2UB 4F4LA 4X64B 1EIYB 1YVWA 4O2BA 2KA7A 3R2IA 3SHLA 1N36O 5JPNC 4MVMA 4EVOA 3R3OA 4RCNA 4LF8B 3A7LA 1PRTF 3RZDH 2D0OA 4OL7A 4UZEA 2M00A 4GNXA 4ID6A 4AQYB 2QE7A 4G7WA 3CCVV 2F4VO 2B9ZA 3Q22A 2WLKA 2VBTA 3S1QH 1GAXA 2E2HH 5IGGA 5J39A 3OW7A 4RAUC 4YHBA 2OF1A 3AEIA 1P49A 5HKKA 3KF8A 5JQGB 2EYOA 2VQEB 2L5TA 1QVFU 1SJED 2ZT9B 1R9TH 2TSSA 3CWBH 2EJMA 1O7ZA 4BW5A 1K8AD 2HDLA 4LFBB 3DXRB 1BF4A 1BL8A 3X2QB 4GT1A 4NXML 3JAWB 4ZKBB 5KNDA 3F2UA 3OT7A 4C3HH 2R7FA 5LL6Y 4MSWC 2F0JA 2BM0A 4QF4A 3KBXA 1RSOA 4JAAA 2IJHA 4B4DA 1EP1B 1VQNA 5E3FA 1KLUD 1M90W 2KECA 2DN8A 2FL4A 3D31A 5C4XG 5IYWA 1YNJD 1AJPA 5FJ8G 3S1RH 3VR6A 2IX3A 2OBSA 3S1NB 2HT1A 3W2DA 4XLEA 2P6JA 4P3IA 4WFEA 3ERQA 3A8JE 5CMUA 4FZ1A 1HNXB 3P27A 5JJNB 3TXQA 4CH6A 3J81L 4H9GA 3KFUA 5HXBA 1MHWC 1WTHA 4IYHA 2Q6AA 2G9HD 3R65A 2VUMB 2F0GA 4LF5L 3K0GA 4BIZA 1CZWA 3RGBA 3U4ZA 1R3JC 5D5PA 2KQ3A 3Q39A 4DNTB 1Q43A 1E1QG 1H42A 2Q6LA 1QB5D 3AEVA 2EPBA 4ZBMA 4HE5A 2ZCEA 1CA6A 5C3EB 2ZITA 2LW7A 2P4VA 4XDXA 1IURA 1K4DC 2Q69A 1JICA 3ISXA 4OGQB 4I7ZC 1VQOB 4JC0A 1RM1B 3FHWA 2WINB 1KRSA 3KCYA 2RHQB 4JW0A 2JE6I 3GIRA 3K9SA 2WZPP 3DHQA 1WP6A 5M3MG 1D2EA 4IUTA 3R6KA 4ZOLA 2F0MA 1HPCA 3RYCB 5BN3A 3ZHUA 3MXNA 2QA4B 3PJSK 1JA1A 3A8IA 4OPOA 1CZGA 2B5UA 3MXPA 1DARA 1I5XA 4YELA 2A5HA 4JZ2A 3PUXA 4LWSA 4OX9O 1II3A 3JAML 1IW7C 2MP1A 3WDNA 3SK4A 2PLFA 4N3NA 2ILMA 1MJEA 1W6JA 3ULJA 1GAWA 2XOKA 4DV2O 4DR3L 4MW8A 5B1BC 1C9OA 1WSVA 2D3NA 4GLVB 3ZMZA 4NPSA 2YWFA 3SLDA 4DK0A 4FLYA 3UDFA 1SKVA 1VQMA 4O4JA 2HDNB 4C3HG 4JPBW 2BGIA 1B6QA 5FLMG 1ZTEA 3CC7A 1FXVA 3E8FA 5K1XA 3CP1A 3CCRV 3E8HA 5FO0A 4OOXA 4F7DA 1KQSA 3ITPA 1AP0A 5DM73 2UUBB 1YJNB 4N8X1 2JEXA 1E1RA 3A0JA 4K14A 1SS3A 3W2FA 1K8GA 4PC6A 5GAEC 2A3QA 4G7XA 2XVSA 3GVMA 2QGGA 4OIKA 2AWNA 3P20A 2QN6A 3BEHA 1I5YA 5EBMC 3D3IA 4QJFB 3WBJA 3VO1A 1NTKH 1XHZA 1M1KD 4Z1VA 4NXMB 3LQ6A 5FOBB 3PF4A 4A3BG 4PI2A 3G4SV 1O78A 1K83B 4FXUA 3OW2B 1TKWB 4YXWA 2IW3A 1AI6A 1Y76B 5GTIZ 4DR7Q 4OXSA 3AG2B 2X0LA 1VQKV 5TRDA 5FKAC 4A3FH 4GKJO 4DKAC 2EY1A 1H9SA 4A3GB 4RPDA 1Y66A 1M56C 3D36C 2JA7G 3M4PA 2K5NA 1CNFA 3OAAG 1IDSA 1CKNA 5KNCA 1S4MA 4BS9A 2F0WA 3FVQA 2AHOB 3NE5B 3U9OA 4UVCA 2QJ1A 4QFMA 1KUQA 1EFWA 1NRKA 1ZM2A 4DK1A 1HR0L 3FB5C 1SRYA 4B3TL 2JEBI 4A3KG 3OJXA 2HJFC 3V76A 1OJHA 2DMXA 5KX5B 3ICXA 4GUNA 1XMOO 2D74A 3SJQC 1HXYD 5KA6A 1YJ9V 2UUCQ 4J7ZA 4ZCKA 4K8JA 1TQOA 3NWSA 2NZHA 1A8PA 3T1YL 1DD2A 2QM4A 2VY3A 2ZM6Q 3G6EV 3HZXA 2ZNJA 4XYQA 2IHFA 1MA1A 1SBBB 1TVKA 3WG7B 3K06A 4DW1A 2W0XA 3M3YH 3JD1A 3AG1B 1AZPA 2IT1A 2C2AA 2R9VA 3G71B 2EILB 4UVBA 1GKFA 2VZLA 3PIO3 4MTXA 1R3IC 3SPIA 1Q46A 2SNMA 2UXCO 3CD6B 5HZAA 1X6OA 4H37A 3NTKA 3JD0A 1SESA 2F3VA 4DV4B 3GTJH 4IFDI 3ZHQA 2XIWA 4LFAQ 1H8EG 3GTOH 1I4GA 3VYTA 2E5LQ 1LYLA 2ZR3A 2OBTA 2XNJA 3JQRA 2G5DA 3UI2A 1V55C 4DAVA 4KJOA 2IHEA 1BCPB 1UWVA 2MUYA 3F2DA 1I3QB 2CH7B 1UE6A 1QGZA 1D7QA 1N34B 4FLUA 1OCRB 4DXGA 3ZZUA 3B8MA 2Y0PA 4DR6L 3X3NA 4DR3B 4P1VA 1RPRA 3GP7A 3I4MB 1VMGA 3MVVA 3W1BA 4I55A 4PC3A 4G7OC 1U5KA 3CMMA 2WPDG 1K9MD 2MQHA 1HA3A 4DRXB 3ZPNA 1GRJA 1XB2A 1CSQA 4WFN3 2EJ7A 2B5OA 4A3JH 2RA4A 3N27A 1I50B 2PTMA 4DV1L 2F0NA 1YITV 5FLXc 3HOZH 3UQ8A 4EFBA 2GVAA 5LMNL 4KD3A 1R5OA 4GOPA 1A2TA 2RQXA 5LA6A 3H6MA 2BH8A 4LF5O 3LSSA 4RLZA 2ZIOA 1X3FA 4NKGB 3NBIA 1M90C 1QUEA 4OEMB 5E1AC 1QG0A 1AB3A 1ZM4A 3ER0A 2YEVA 4XLAA 1MABA 4DV0O 3ZHVA 2N55A 3CCUV 2PZUA 2LJ2A 4YALA 5EPKA 1YI2A 2WACA 5M5YB 3CEIA 3STBC 1BR9A 2OIGA 4HIDA 2XASA 4WORA 5KHHA 1MG1A 3VQVA 1ESFA 1PTOD 4IURA 2LXJA 1NR2A 3TN2A 3BRCA 4WFHA 4FLVA 4HAMA 1QOHA 2BSKB 3QFRA 1N8RD 3CU7A 4KJNA 2B2UC 2EINB 4IPCA 1G2SA 1VF5B 1TY0A 4RQFA 1FJGQ 3ZRWB 1XL4A 3A1PA 1E24A 1A63A 1OXXK 2A06H 1WJJA 1QWYA 1N32L 5FLXE 1SE4A 1QVGB 1G291 4LUOA 1HR0B 3VA7A 4EKWA 2HR3A 2CC2A 5CGKA 4OWTB 4ZHQA 5IT9L 4TOIA 4JI2L 3R8BA 1IBKB 1NS1A 3BCFA 2JXMB 5IOCA 5IP9G 2OTJA 3UKMA 1SQVH 1SYGA 2Z0AA 3HOUH 1WA8B 4FNFA 1W59A 1XUQA 4X66O 1VQ7B 2E2JH 2R7DA 4WBNB 1UUPA 1EY9A 4FMTA 4JV5Q 4YCUA 1YJWV 4QE7A 3NELA 1KL9A 2HVJC 2XZLA 1JCHA 4J9ZB 2YICA 4X62B 3CE2A 4IYIA 3JAMi 2IJKA 1KC8D 2KVOA 5BY1A 4K8IA 5K1PA 3B78A 2GK6A 3BS1A 1OCCB 4DFAA 4O2AA 1P7GA 4B7KA 4APVA 3RYIB 4PJ0Z 4PHZA 2Q73A 1IBLQ 4FXKC 3Q6QA 4RHRA 3BDCA 1ET6A 1SZXA 3QNEA 1ZM3A 4QIWB 3OUSA 2KHJA 4JOIA 1WNSA 4IT5A 3W1GA 4LNUA 1YHQB 2C77A 4IO9A 1KNEA 3G6JB 2HG5C 2YU9B 1FVIA 1SQPH 5FK9C 4FM0A 4I5SA 4E6IA 4R8CA 2Q7HA 4UP7A 5C3XA 3KDFB 4BA2I 2GN5A 2IY5B 4A3DB 2VQFQ 4BW9A 5T1GA 1E7ZA 3W2EA 1XE1A 2ZE8A 4DR6B 1JJCB 2RMKB 2C5BA 3FKIB 2L35A 3K04A 3CCVA 4HAEA 2LQTA 4DUZB 4RDJA 4BBSH 2WLHA 4LF9Q 3ZHRA 1T6XA 2ZXWC 1SMXA 1QQCA 5ELBA 1XQ8A 1OB5A 1JB7A 3TP6A 2PW5A 2BPOA 5JJLA 5IJ9A 2RSOA 2HHHQ 2EIFA 2QF7A 4ZI7A 5ITZB 3CKIB 2DYRB 2GQFA 1M9NA 4P2CB 4B3TO 4B3RQ 2YI9A 2NVYB 1TWCH 5JVDB 1SYBA 2OK7A 2A6EC 2JEUA 5LL6S 2Q67A 4R8NA 3TZUA 1H8HA 3EA6A 4P74A 4JZGA 3SDZA 2ZT9C 5KNLA 3SVMA 1KABA 5EKKA 3T4ZA 4BXXG 1BHAA 1Q90D 4JI7L 2N49A 4GX5A 3C46A 4I0XA 2ZZGA 3WB2A 1VMPA 2W6IG 3DXJC 1PH5A 3UT5A 4DR4L 3MXUA 3X2QC 3T1YO 4MTFA 1U4RA 3RY8A 3HKDB 5GTHZ 1EY4A 3RN4A 3GD7A 3K5OA 4XKVA 1PD3A 2KCMA 3ETEA 1F2LA 3QG1A 3QFTA 1Y67A 2SOBA 1STYA 5CV7A 1FRNA 4IHJA 2XRQD 2JDIA 3CPXA 2FINB 4KTAA 1XNRB 4LH7A 4PDMA 4G5GA 3TRZA 3J80N 2UXBO 5IYDG 1RP3B 3HS0C 4LBYA 2JIZG 1OV9A 1J9ZA 3D4WA 4GN3B 2P4KA 2A6HD 2PYKA 4WFAV 1LTID 2WA3A 4A5UB 4LF6L 3OFNG 3HOXB 1PYWD 3EFXD 3MCAA 1N32B 4TMZA 4NP5A 3C3TA 1N36Q 1NCVA 3AQQA 3UE1A 4MYTA 4KHPQ 1JE5A 1WD0A 1IB0A 2DN9A 4JI2B 4BY1G 2JA6B 1G91A 1ZM9A 5FPRA 5L46A 2ZXHA 5IE8A 1R3KC 4PZ6A 3K7AB 2CHBD 2WFWA 1JA8A 2F43G 1X65A 1HR0W 4PAAA 2KEDA 4GKKL 4PDRA 2ZE6A 1SF9A 4OGQC 3K58A 1RM1C 1LT6D 1S0VA 1A8VA 3ICEA 1XMQL 3CRQA 2DE0X 1VQ5V 5LMNO 4JASA 4NCNA 4HNAB 1TVCA 5CA1B 4UCUA 1I7FA 3E9HA 1IBMQ 2RDCA 3S1NH 4KHVA 2PY5A 2XAHA 4A3IG 3QR8A 3M9BA 1KD1D 1DOKA 1NUCA 3ZX6A 4FLZA 1V0FA 3AVWA 1ELOA 1AVMA 3OTOL 1SQBH 2JYOA 4M2LA 2VUMH 2ES2A 2F03A 4OO1H 2EYPA 3PGZA 2L9HA 4XLCA 1B2TA 1L1OA 2JS3A 4TUYB 1VQPB 1OTCA 2I0QA 1SXTA 1IVSA 1VQ9B 5A88A 1QBZA 3H1LH 1PPJH 2CWPA 4U673 1A0IA 2Z4IA 5C3EH 2QTSA 2YTYA 3CCRA 4FXGC 2OCCB 4KKSA 1NR1A 4JI6Q 4B3MO 1XFOA 4JI0L 3O13A 2ZZEA 5EZYB 3P30A 4NNJA 2N78A 4RKLA 3R93A 3L70H 2O4XA 1XBLA 2GJRA 4PZ7A 3K9AA 4QUZA 2V1CC 3OYYA 1U0LA 1B53A 4LF8Q 4FIPC 1NE3A 1K5SA 1GO2A 4OELB 1BOSA 5IYZB 1QNUA 4N9TA 4EQOA 5B5EZ 4LBVA 4IALA 4DV5L 4L5RC 4U7NA 3NQTA 3LWUA 1IZ6A 1OGJA 3J7AF 3E8GA 4NB3A 4JBWA 1ICFB 2XGTA 4P3YA 3GO5A 4MVQA 2PMZE 4J80A 3DWAA 1EEID 4Q5VA 2VQEQ 5CDFA 1T6ZA 1J8IA 2BMWA 3SK8A 1IL2A 1S72B 5IYBO 3AG2C 3I91A 3Q23A 5EIBD 3HKBA 2R7ZB 2XN9C 1G8MA 1VQAA 2CE4A 5EYPB 3JSLA 4XN0A 2DWEC 3VNVA 4IZ8A 2CW5A 3CJHB 1EWCA 4DV2Q 2XAGA 2KBNA 3QO2A 2HUGA 3W3AA 3A8JA 3C1FA 4EFEA 2V4DA 2K03A 2Q7GA 1ORQC 2WLNA 1YJ9A 4GLXA 1GR1A 2CK3A 1W2BB 2DCUA 4FF2A 5EC1C 2OXPA 3AVXA 4YY3O 3G6EA 4RCOA 2AUKA 1HNXQ 2MJ8A 3SXHA 2X6LA 1HFNA 2QKAA 1WI5A 4JI3L 5F2VO 4BPRA 4ZCMA 5C5MA 2CW0C 1LTGD 4X1IB 3MHHC 5IGEA 3CHBD 2ZTEA 5ISRA 2V7VA 4O4LA 2X6WA 5FL7G 3CRKC 1HQRD 2GBOA 5IIFA 2EIKB 4OO1G 3B8NA 4GKKB 4K3AA 3AG7A 5F4JA 1K83H 2F3WA 2HLDA 4ODGA 1LTSD 5B1AB 1IX9A 4JF3A 3J81N 2K04A 1Q82W 1L0YB 3WG7C 1G6UA 1R4PB 1XPOA 4UZFA 3AG1C 5C4HA 4CDCC 1XMQB 2HQLA 1OHHA 2KCCA 4A3GH 3ONAB 2CKZB 2EILC 1SETA 2UUAO 1UJWB 4JTDB 2WLLA 3PUMA 1OXSC 3KEWA 1R4QB 3M99B 4CH3A 5JVH3 4LWCA 4PA3A 4KY6A 1TVXA 4TSFG 3M7NA 4JI7O 1LACA 1HTLD 1DK1A 4DR4O 2B1IA 4Y7NB 3RFRA 3OTOB 2MO0A 2ZZFA 2NTTA 5M5WB 3CTAA 1BCPC 5A9GA 2LXKA 4TT3G 2NPFA 1YF2A 4X07A 4JI4L 1BBUA 4IJHA 1OCRC 5D65A 1NMFA 3FPKA 1YITA 1IYUA 2BSAA 1DOLA 1M8AA 1XNQL 1SFOB 3E0EA 3PENA 3J81E 1V43A 1AEXA 4PABA 1RTOA 3T13A 1M5IA 1YEWA 2VNIA 2MFIA 2VNKA 5JJJB 4YHHL 2B29A 3JAMN 1Q7YW 3Q4HB 4KFMA 3L72H 1GH6A 1DDGA 4O2BB 3KF6B 2QTOA 2H3OA 2GHYA 4FLXA 3ASSA 2K9PA 2ALYB 4X3KA 4I9QA 2QWOB 3AG3B 3CCUA 4PA6A 4J1MA 1I6VC 1LUZA 5G3LD 3NQIA 4NDXA 2K50A 4P25A 5KUKA 4FM2A 4X8AA 5J2TB 1D1NA 4LFCL 1TS3A 2NVXB 2F0QA 2JA8B 3CCEB 4B3GA 4QY7A 4WZKA 2XTAA 4QE9A 4QUCA 4WWVA 4N21A 1X55A 2R9AA 1I3QH 1UEAB 4ASUG 1VQOV 3CP2A 5C4JB 1CK1A 4NXMQ 5CBHA 3I4MH 3I90A 3SJZA 2D0PA 5CC4A 1SERA 4KLKA 1FD7D 3V96A 2YUAA 2QA4V 3JAME 2EINC 2DJFC 2R3ZA 3I56B 2BCCH 1VF5C 4YEJA 1I50H 3RUZA 1FDRA 3LDEA 4IUQA 4C1NI 5TISZ 4DF7A 4O0AA 4DV6B 2PQAB 3PUVA 3SGIA 1PJ6A 2FMMA 2ZXRA 3BJUA 1NT2B 1SQFA 3K59A 2JA9A 4LC0A 1W87A 3I4NB 3HOWB 3I8ZA 2M2LA 1YJWA 2QKCA 2K4KA 3R66A 3R6JA 2E3CA 4UDUC 1O7LA 5TSSA 2YIBD 1Q81C 4QMGA 1WTOA 4XN3A 1WD1A 2EIMB 4DUYB 2QGQA 4DA2A 1FL0A 4LF5Q 1YZBA 4JPRA 3OWEB 5AJ3Q 1QVFB 4JI0O 3Q8DA 2NN6G 3BAAA 3PO2G 4AHCA 2XSCA 3G7LA 1I6HB 1JPXA 5IGDA 2PNHA 5M5YH 1X3PA 1FNBA 1IXRA 4YWKA 3TCUA 4F6RB 5EGTA 2LSSA 4TMXA 3LDCA 4O1NA 4DR2L 5GW7A 1JWUD 4DR1L 1OCCC 4Z4SA 2X7RB 5JJZA 2GJKA 2LGQA 2QDXA 3ONUA 3OSOA 1Y8OB 3KLSA 4A3EB 1YX2A 1TUIA 1MNGA 1K8AW 1YJNV 3DSQA 4YIJA 4DO2A 2YI8A 4DV5O 4LF4L 4OP7A 2K6AA 4DR5L 3MXNB 1CM9A 2UU9L 2ZTNA 2L4NA 2X6AA 1QFJA 4FVMA 1S5FD 3D36A 5JJEB 1KZLA 5I6WA 3OGCC 3ASPA 4NBSA 1K73D 4JI4B 4UCTA 2UXDB 1F9RA 1KK2A 1AR1B 3CRLC 4LCUC 2WKDA 2JA5B 1CEZA 4FFBA 1H2NA 1GJRA 4H02A 3QB3A 3SPJA 1XNQB 4ZKCB 4PG3A 4GX2A 5JWPA 3H9VA 4NW2A 2TMPA 1YCIA 1JMCA 5E79Z 1QLNA 4DR3Q 3LSUA 3F5WC 4L6TB 4XLHA 4JBKA 1TWGB 3PVDA 1F4NA 2XWJB 4X66Q 2VS1A 5LMUL 1ET9A 1K0RA 1VHEA 1YBYA 4EQNA 3HOYG 2DYRC 4CKEA 2G38A 2OT5A 3PCOB 3A7AB 1Z6HA 2E76B 1X32A 5C44G 2QSAA 3RLNA 4JI3O 4RD3A 3C90A 3CX5F 1DF4A 2ID0A 1H2GA 4YWLA 1Y1WG 1LABA 2RVLA 3J7AU 3ETQA 4ABMA 1H2LA 4LFCB 1SNQA 1VF6C 2YU9H 2HDMA 4AIMA 4XDJA 4ILWA 3K8AA 3GVLA 3T2MA 4JYAL 2K33A 1VQ4A 4CDEC 4FWTA 3DEOA 1ZAUA 1IKLA 3H0GH 3J7A5 4A3DH 1MKHA 3EBEA 5I2YA 5CBFA 1BMFA 4RD6A 3FKIH 3WOFA 3P3PA 3FAVA 2QM8A 3CPWA 4JGSA 2IWHA 3G71V 4O42A 1TR5A 4R4IA 1D2DA 1KK1A 2YSUB 1UD4A 4TV8B 2VW9A 2V7QA 3CD6V 1H9SB 1KLGD 4H7BA 4B08A 3OR7C 3N2KA 5BR8B 2A69C 2Q2IA 3A0BZ 4DQLA 3GTGH 2NVYH 3T51B 4P9SA 1EN4A 1HH2P 4B3XA 3A2FA 3WB0A 4XMYA 1HR0Q 2XOKG 3A8KE 4B3TQ 1URFA 5C0XG 1YNND 4ZAIA 1EXMA 4X65L 1VQ5A 1X9NA 1N33L 3CMAB 1BS3A 1N08A 1EWIA 2W6IA 1VQCA 1GMGA 3E83A 1DONA 1S76D 4DV3B 4O4IB 1Y0RA 4G4KA 4YHHO 1E22A 4DR2B 3T1YQ 1T5EA 5IGBA 3A0HZ 3RW0A 4DR1B 5IT9N 1GN2A 4L8JA 1JR9A 4J0QA 1TT2A 4HEDA 3GTKB 1F4MA 2GUZA 4JI8L 1PTOB 1QUQA 4LF7L 3W2GA 2Q0OC 3WB1A 2LO1A 4QL5A 5IY0A 1M1KW 4LF4B 2EX3A 2F52A 1KP2A 3HOXH 2UU9B 4J41A 2WR8A 4X6AH 2JP1A 1Q1BA 1XX8A 1XYIA 2JGDB 2K1BA 3T1HB 4DR7O 3CYOA 1XHXA 5B3SB 4EX5A 1Z9FA 4AYBB 4FPPA 1ILQA 1Q7YC 2B2UA 3NEMA 2ZJQA 2JA6H 4P12A 4C3IB 1PH8A 1CQVA 4V0BA 1I0HA 1UMKA 2DNEA 5GAHC 3K7AH 4K0KL 4NXNB 1TWHB 3KLSX 1VQGA 3A56A 4DR6Q 3H0GG 4YAUA 1QE6A 4L63B 4LAAA 1PH3A 4WZEA 1R5BA 1HQMC 1BCPF 5KAFZ 5A8AA 3KOJA 1PJ5A 1E2WA 3NUCA 4KUMA 3HAGA 4Z4YA 1T5XD 3HKEB 3BY1A 1MSDA 4BWGB 4TV9B 4DV1Q 2UUCO 3DM3A 3CCLA 1I5FA 2PI2A 5LGUA 4B43A 2R61A 2R93G 5LMNQ 2FHTA 5KIXA 3P75A 5LA6B 1EOTA 5CR3A 2ZM6O 2FMLA 2E1RA 4A93G 4Y52H 3PA2A 1VQ7V 1DDIA 1ZYRD 1LNQA 1I94L 3B77A 1CHQD 3HOVB 2EYMA 2QMUA 3DM1A 1J5EB 2YEVB 5IWAB 5M3FB 3KUPA 3W2HA 2BV3A 4X89A 1BQEA 3ONYA 1SYEA 1HUMA 2EXZA 3AMUA 5J22A 4XORA 1OZ0A 3PV0A 2J4XA 4C3JG 1SJHD 4IFDH 2R92B 3WYAA 2WB1B 1WOCA 3Q0AA 5JEAG 5LOVA 1P84F 5FA6A 1HNWB 3RLFA 4LFAO 4PI0A 3GTQH 4DR5O 4RKBA 1YHQV 3CC4B 2DYIA 3PMFA 1ASYA 1BKBA 3ZS8C 4UFZA 5GQOA 4R4QA 1VIBA 4CDDC 4E4EA 5J2UA 2DY8A 5EBCA 2JK5C 1K9MW 3OIPA 1YSCA 3WFVA 5JBQA 4ZHQB 1WORA 1QLEB 1JJ2A 4RMFA 4R8IA 4JI2Q 3QIAA 1K8AC 2M7WA 4DYLA 5IDJA 1WCMG 5B1AC 2C2WA 5ELEA 2KJXA 1JT8A 2JA6G 2ZL7A 5LMUO 4EQPA 5JQGA 1K97A 2MHVA 4BBRB 2KG7B 2EOTA 3PO3B 4KV6A 1XOUA 5LHGA 4GCZA 3WY9A 4G2KA 1Q6HA 3K08A 3DXRA 2I5LX 4JI8B 4YJ3A 2GJPA 5HURA 3AK2A 3TP8A 2AW9A 4LF7B 2YXHA 1BZKA 3JAWA 4FZ0A 1YNJC 1HA5A 1EZVH 2H8PC 5IYBG 1XQBA 3CSXA 4HYOA 4O2AB 3KJOA 1GUSA 3RD4A 1WTXA 2D62A 1QUFA 4I65A 1JE4A 2NUCA 1MABG 4JYAO 3QOJA 2AXTZ 1AI5A 3T4DA 5CA0B 2PQEA 4LNUB 1QGYA 3J7YW 4D7SA 1W6KA 4U9UA 1NJID 1HZBA 4IPDA 1N8RW 3SYOA 2Z6BA 3AYHB 1Q5OA 4QIWF 5D5QA 2ZIMA 2GTSA 3K79A 1HWYA 1LV9A 4K0KB 4QPJA 4RD2A 3GSIA 1KJZA 5CBAE 5AG2A 1N05A 5K36H 2B1GA 1AE2A 1K28A 1Z5WA 1EYGA 1S4ZA 2CH4A 3ES9A 4MVZA 4ZIBA 3K5NA 3I72A 1W2BU 1EFTA 1NKDA 5LXTB 1ENVA 4LP8A 2VWKA 3MDSA 4TMTA 3RWRD 2RCFA 2QDBA 3LX0A 4O4HB 3HKZE 4AQYL 1EQRA 3SJCC 2EZVA 3M4OB 3OIQA 1Q82D 1HZ9A 2HKOA 3J81j 5DAUA 3H1JH 4FXDA 5C5LA 5IJ0B 3JAKB 1JNYA 2UUAQ 3JARA 4X65O 5KHKA 4J42A 3BYTB 1N33O 1TS2A 4IOCA 4GX1A 1KC8W 2GPJA 4NB5A 3KL9A 2GK7A 3QSYA 5EBDA 3RYCA 4DN4M 4MT8A 1TS4A 3M4QA 1W9XA 3HKCB 2QA4A 1AFPA 1I94B 2WAQE 4JI7Q 2RQ6A 4DR4Q 3PN1A 4TT3A 2XNAC 3K3WA 4MN3A 1SE2A 3WNDA 5GV8A 5ELCA 1MMMA 3I1FA 4H13B 1SFOH 3HG9A 2DYSB 3E9IA 2FKXA 4PELA 2I07B 5HY6A 4PC1A 2LP7A 1C48A 4MIUA 1QGAA 4IIJB 4ZV4A 3JASB 4MNOA 1FXKB 1STBA 3G48A 5D3IB 5E1FA 2FTKA 1ZXTA 2Q8RE 2E2DC 5DM6V 5DM63 2JN9A 2X8KA 4XLFA 4LF6Q 1MOFA 4HJ5A 3KZIZ 4FYDA 3ND8A 1FRQA 1GM9A 3E6ZX 1TUBB 2DJVA 5E4XA 5GONB 1R73A 1VQPV 1EM1A 3I4LA 2EIMC 2NVXH 5KW9A 2B2TC 3N6RA 1VQ9V 2JA8H 4LF9O 3W2IA 4B3SL 2N8NA 2MNAA 4DNRB 1EY6A 1EFRA 3ETDA 2D9UA 1H2SB 1ZUQA 1C4QA 5CYUA 4OHJA 1E3ZA 4GN4B 1YJNA 1M1KC 1BBWA 2IBZH 1H9RA 2B63G 5C4JH 1XPUA 1E63A 3B09A 3RYFB 4B3RO 4LBEC 3HKZG 5IY5B 4ACBA 4GKKQ 4X7DA 1B7YB 2P5OA 1YHBA 1GXDC 4RGTA 1U9RA 2GVBA 2F0TA 1JOKA 4X88A 3B2EE 1VJSA 3MEHA 2EE1A 1XMQQ 2CTQA 1KNAA 1H8HG 3CCQB 1QJOA 3KKYA 3OW2A 3CC2B 2ZBUA 2XEXA 3SKBA 2O57A 5B1NA 5C4XB 3MWYW 5IYCH 5HFLA 3VOUA 2WAQG 2ICEC 3I4NH 3HOWH 2CAZC 5A35A 1VEWA 2P7TC 3NR7A 4UB6Z 1STEA 1R5NA 2AHOA 1MIUA 3OTOQ 1S72V 4JBJA 1HZAA 5F4MA 2JDIG 4KY7A 4JTCB 2K05A 3BYYB 4ZLTF 1I6HH 4AVZA 5HGQA 2BTQB 1Q86W 5KX5A 3IFXA 1Y0YA 4IW3B 1FNCA 1E2ZA 4KK7A 4KHPO 4Z4RA 4JI0Q 2NN4A 2E76C 4LBZA 2ZJPA 1XTDA 4A3EH 3OM3B 2VS0A 3KYHC 4FF4A 4P75A 1GVPA 4MTNA 3S15H 1WP7A 4Z2WA 4JG2A 5GAGC 2WKCA 2UUBL 1L1FA 3RVZA 2QILA 3JD4A 3J7ZC 3UCSC 1MBYA 5M3MB 1Z47A 5NUCA 1CUKA 2EZPA 3QTCA 3OMAB 2QWQB 5H2FZ 1QZGA 4XQJA 1IZ3A 2A0LA 3G71A 3ZMUA 4DV5Q 3PF5A 1B06A 2P5ZX 1CI3M 3RVYA 3CXHF 3F2BA 3RR5A 4B47A 2WZNA 1OXUA 2PUSA 2F0VA 3CD6A 1DCZA 2Q5ZA 1J9OA 2JA5H 1Q3EA 3EQLC 1IBMO 2A1AA 4HJ9A 1X3QA 3QFSA 1HNZL 5K5PA 1N06A 1KD1W 1I4QA 2MW2B 1WPCA 5H9CA 2H94A 1K9MC 2W6JG 4TQUS 2VNHA 1TWGH 4XQQA 4IQZA 1IYVA 2CH7A 3OMIB 4DAYA 4Y9UA 2DWDC 4C0SA 4H44B 4FO2A 1JFFB 2C5CA 2NTSA 3S3XA 2XNCA 3MD0A 2L1BA 4G57A 4DRXA 2ETNA 4RD1A 2GV9A 2EY6A 2QEJC 2XGJA 2Q4PA 1SDFA 3NSWA 4UAIA 1M57B 1IXBA 2CTPA 4YJ2B 1D1IA 4JI1L 1NTMH 4JI6O 3D6WA 4X9QA 1Y1VB 3KBGA 4R4CA 4B3SB 4JI3Q 1ICWA 1AR4A 3S1RB 4TSSA 3E20A 3PA1A 5FO1A 4XKWA 4X64O 1XL6A 4UAJA 2OTLB 1KBHA 3D8CA 4CC5A 2X85A 4O4LB 1F9SA 5JCOC 3MTSA 3NBHB 1Y74B 2QWPB 4LF8O 4P22A 3FMCA 2B2VC 3NXWA 3W5UA 3CCMA 1VQLB 5FO9B 4AQYO 1UPGA 1PTOC 1ZX3A 4A3BB 3CB4A 3MFYA 4F8MA 2JSOA 3I55A 1N8RC 2L15A 1S5HC 1F20A 1KQSU 3B4SA
chains in the Genus database with same CATH topology
2YYZA 3S2DB 3QO2A 3T1YB 2HUGA 3W3AA 3C1FA 4EFEA 4ABNA 2ZNIA 2V4DA 2K03A 2JA7B 2Q7GA 2F0LA 1VLYA 4B3RB 2A69D 3D6CA 3P7JA 4NMZA 4GLXA 5I9PA 2CK3A 2B2WC 5LYJA 1NAPA 4FF2A 3HP3A 2OXPA 1LT3D 5IYZA 3ZIAA 2XNDA 3T4AC 2LKVA 1KDBA 1FGBD 2O2LD 4I50A 3BZDB 4RCOA 3GTPB 2AUKA 2MJ8A 3SXHA 4XQNA 2X6LA 1HFNA 3OMCA 2UXBB 4EEQA 5C5MA 1SEBD 2EYLA 1JOOA 2CW0C 1EIGA 1E79A 1LTGD 1VMCA 2DY7A 4X1IB 3J80L 5C8YB 4A3KB 5IGEA 4KL1A 2Q8TA 3CHBD 4TSFA 1Q1EA 5ISRA 5CA0A 3HGBA 4C1NK 4O4LA 2X6WA 2IX0A 3CRKC 5JH7A 1HQRD 5IIFA 4KKUA 1EWHA 3GTLB 1X4TA 4OO1G 1WTVA 3HOUB 1EL0A 3L7ZC 1ILPA 1S5BD 1B1ZA 4GKKB 5KMGB 4TRDA 1JC7A 3R2TA 3I70A 1E0BA 2F3WA 3CP8A 3OEEA 2HLDA 4ODGA 1LTSD 2X6YA 4XONA 2K04A 1RF2D 1L0YB 2NBFA 1G6UA 1R4PB 3SK5A 3D4RA 2UUCB 1BQQT 5LP6B 2A73B 1I8DA 3H0GB 2PYLA 5C4HA 4B9WA 1XMQB 4RH6A 5KHIA 2O5IC 1OHHA 1PTOH 4WBNA 2KCCA 3ONAB 1L8DA 1PTOF 3BDLA 1A2UA 1OXSC 3KEWA 5M5XB 1EEFD 3H3VC 1R4QB 1E43A 1Z5VA 1OB0A 4CH3A 3DWPA 5JVH3 1WTHD 4JMQA 2BTOA 3MZ5A 3K0YA 4PQXA 5LXTA 4KY6A 5IK2A 2SDFA 1LT5D 1TVXA 3A3BA 1GOZA 2FMCA 1PMRA 3VYSA 4O4HA 3PIP3 5COYA 3M7NA 3S17B 4CS4A 1A6XA 1LACA 1HTLD 4LK1C 2R93B 2NB0A 4KHPB 2NWGA 4Y7NB 4DV1B 2RKSA 1W0KA 3RFRA 3RYIA 3OTOB 4XXEA 2ZZFA 4QUFA 2NTTA 5M5WB 1V1PA 4I4TA 5LMNB 2WSSA 4U3JB 5IJ0A 3JAKA 1LTAD 2WJYA 1EYCA 1BCPC 1HFGA 3GTGB 4A93B 4X1IA 1WTQA 3T16A 5KRUA 1SA0A 4LH6A 1SYFA 3FKSA 5M9OA 2RDFA 1TA8A 2PGGA 5D65A 4XM3A 1HNZB 1HA6A 2VJIA 4LMQD 4UZUA 4Q0FA 1IYUA 3BG3A 1VF7A 1TVKB 1DOLA 3HKCA 1EFID 1M8AA 2ICIA 1SFOB 2E5LB 3J81E 2NZ1D 1V43A 3V05A 1AEXA 2WIIB 4NKLA 1RTOA 3T13A 1RHPA 1M5IA 1YEWA 4KN4C 4FF3A 4BBSB 5KGUA 4C3JB 1BUVT 3NHHA 4HCSA 3DWQA 5JJJB 4ASUA 4O2BB 1PZID 3SJBC 1B9NA 3DDYA 1PFMA 3M4YA 1IBMB 3VR3A 2PW7A 2Z1CA 3ND9A 4FLXA 4PMCA 2K5QA 4X3KA 4IIJA 5FLXL 1PFBA 4I9QA 1B4OA 1A3UA 3VYUA 2X6GA 3JASA 4J1MA 1I6VC 4IUVA 4S3SA 5G3LD 1EU3A 1O9HA 3NQIA 4N9PA 4NDXA 3RMHA 3S16B 1EU4A 2F0HA 1WTWA 4B3MB 4JI1B 1OXVA 1SNDA 1FR3A 3L3OC 4FM2A 1TWCB 5F2DA 1K8OA 3CESA 2NVQB 5J2TB 1TS3A 2IPKD 4XD7A 5EKIA 2NVXB 2K7VA 2F0QA 3JATB 4U3JA 2JA8B 1EZ8A 4K8ZA 4B3GA 2PZWA 4QUCA 1WTRA 4II3A 5JVDA 2L55A 1HRJA 1TUBA 5GONA 5IT9E 4H44C 1D5MC 4I55B 1DZ1A 4EB6A 2R9AA 1UEAB 5LOVB 3RZOB 2KEEA 3CP2A 5C4JB 1CK1A 3OHXC 2AUJD 4J6HA 3LNNA 2R72A 1QG7A 4NVPA 1WCMB 1ZEQX 4X1YB 4JI6B 2F0SA 3I90A 2OT2A 3SR1A 4WRDA 5A2QE 2B8FA 2GA4B 2Q7EA 1D5AA 5CC4A 4HCEA 5CMDA 1JMKC 1EYDA 1BXTA 1JJOA 3L9AX 4UCVA 3HKDA 1PZKD 1FD7D 3V96A 3RYFA 4R9WA 5J2UB 3JAME 4RGOS 2R3ZA 4X64B 2PPBC 4O2BA 1UD5A 4YEJA 1VF5C 2KA7A 3R2IA 3RUZA 4IUQA 4C1NI 3SHLA 2A6HC 3PUWA 4DF7A 5JPNC 4DV6B 4EVOA 3PUVA 3R3OA 3J7AV 4RCNA 3SGIA 4LF8B 3A7LA 2FMMA 1XWEA 1PRTF 2ZXRA 4XNFA 4OL7A 2M00A 1NT2B 1SQFA 3K59A 4ID6A 1CHPD 4AQYB 1UAPA 4ZK9B 4X1KB 2QE7A 3G05A 3I4NB 3HOWB 3U9SA 3I8ZA 4G7WA 2M2LA 4DV7B 3I73A 3Q22A 4D7TA 4B3FX 2YXLA 1FJGB 1A3TA 2FJ2A 3NTIA 5IGGA 2E3CA 4UDUC 3JATA 1O7LA 4XT3B 5J39A 3OW7A 4RAUC 5TSSA 2YIBD 2OF1A 2OYQA 1P49A 4QMGA 1WTOA 4XN3A 2K28A 1WD1A 5HKKA 3TMEA 3KF8A 3CQZB 5JQGB 4BY7B 2EYOA 2VQEB 4DUYB 5DEHA 2L5TA 4DA2A 1SJED 4F87A 5KEEA 2TSSA 1M93A 2EY2A 2EJMA 1O7ZA 3OWEB 2DNCA 4FFBB 2HDLA 2NN6G 3BAAA 4LFBB 1I6HB 4AHCA 2XSCA 3G7LA 5IGDA 1BF4A 2QCPX 1HUNA 1X3PA 3T56B 4YY3B 3JAWB 4ZKBB 5KNDA 3F2UA 4F6RB 5EGTA 4X3TA 1SMYD 1E2VA 2EVBA 3NTHA 4CJ0B 4O1NA 4F88A 1JWUD 2F0JA 3A54A 1JR0D 4QF4A 5EQ0A 3KBXA 1RSOA 4DGZA 2PYJA 5JJZA 2GJKA 1PRTB 4X20B 5E3FA 1KLUD 2KECA 2BTQA 5ELFA 2DN8A 4CC6A 1RJTA 3OSOA 1F77A 4JV5B 1Y8OB 3D31A 1E1QA 1CA5A 3KLSA 4A3EB 3GVKA 1YNJD 1Q8IA 3DSQA 4YIJA 2F0DA 1EZ6A 2YI8A 4TQFA 3VR6A 1I4PA 2IX3A 3S1NB 2XWBB 3DEPA 2B8GA 3FFQA 3W2DA 4XLEA 2K6AA 1CM9A 4X1KA 2J0TD 3ERQA 3BH4A 4HNAA 4CS3A 2BE5D 3A8JE 5C3WA 4RA8A 2ZTNA 2L4NA 3GTQB 2E74C 1HNXB 4FVMA 1CT1D 5JJNB 4Q6GA 4CH6A 3J81L 5EPLA 1U4LA 1S5FD 3X3MA 5JJEB 1KZLA 1IBLB 1HHVA 2WJVA 1TAEA 1D6EC 2G9HD 2UUAB 5I6WA 1UNSA 2V31A 2VUMB 2BDOA 2F0GA 4JI4B 4UCTA 2G9DA 4H13C 2UXDB 1CZWA 3RGBA 1F9RA 2LS01 3CRLC 4TKOB 2WKDA 2JA5B 4FFBA 4HBNA 5D5PA 2KQ3A 4K5XA 4DNTB 2EYFA 3QB3A 1Q43A 4GYCB 4JI5B 1I4HA 1XNQB 3M7GA 4ZKCB 1QB5D 2EPBA 1DOMA 4JI7B 1CA6A 2ZCEA 4NW2A 5C3EB 3P1HA 2TMPA 3M85A 4DR4B 1FX0A 1SNCA 1DGSA 4XDXA 4TUYA 4L6TB 3K57A 1JICA 4XLHA 3GQBA 2VQFB 1TWGB 2XWJB 4I7ZC 1ET9A 4KKTA 3VQXA 2WINB 4EQNA 3SE0A 4CKEA 1TWFB 3OE7A 2JE6I 4BA1I 2AQ2B 3A7AB 1Z6HA 2WZPP 3DHQA 3FRPB 1WP6A 3MHBA 4IUTA 3FPUB 1I4XA 1X32A 4K8XA 4ZOLA 2F0MA 4ULLA 1V1OA 4ZRZA 1GUOA 1HPCA 5EZYA 3RYCB 5BN3A 2ID0A 3MXNA 1BBXC 1JFFA 4XYOA 5KYIA 1LABA 2RVLA 2HHHB 5D14A 4KN7C 3DMUA 2A68D 3ETQA 5BN5A 2BA0A 2B39A 5A2QL 1ZKOA 4LFCB 1CZGA 1SNQA 2HDMA 3MXPA 4YELA 4X3UA 4LF6B 4ILWA 3GVLA 1M4VA 2A5HA 5CBEE 3PUXA 1STAA 2K33A 2PCFB 2FFKB 1II3A 1B44D 3CB2A 3JAML 4YJ2A 3DEOA 1ZAUA 1IKLA 1A15A 1IW7C 1S5JA 1RCVD 2MP1A 3WDNA 1D5ZC 1SSOA 5I2YA 5JVG3 3SK4A 3MC0B 1BMFA 5EIBC 1W6JA 4IFDG 2XOKA 3WOFA 2B63B 4M1UB 4GQNA 5E4WC 4UCSA 2F0KA 5IJ9B 3HKZB 2IWHA 4ZI7B 4O42A 1JQYD 1TR5A 3C2PA 3E22B 1UD4A 2D3NA 4TV8B 3A35A 3NBHA 4DK0A 4FLYA 2V7QA 1FFXB 1SKVA 4QB4A 4O4JA 2E2JB 1H9SB 1KLGD 4H7BA 1HVXA 2F0IA 4C3HG 4B08A 1GHJA 2E75C 3N2KA 5BR8B 5EYPA 3N2GB 2A69C 1SNOA 1H9JA 3S9WA 1KU9A 2O5JC 4Z1MA 1MSHA 1Q12A 3S2HB 1VDZA 3T51B 1MD2D 1SE3A 5K1XA 2H4OA 5CB4B 3UT5B 3PUZA 3ITPA 2WAQB 1EY7A 1AP0A 5DM73 2VNUD 2NN6I 4LR3A 2A6ED 2UUBB 3A2FA 3WB0A 4XMYA 2EY5A 4HMIA 1WPBA 1S5CD 1E1RA 3A8KE 2M5SA 3OAAA 4K14A 4XIGS 2X69A 4AILC 5C0XG 1YNND 2ZXIA 4ZAIA 4CH5A 3QWNA 4G7XA 2XHBA 2XVSA 1N36B 4OIKA 2AWNA 3P20A 5BMVB 5I2XA 4IHJB 1F2ZA 2BA1A 4BY1B 1D5XC 5FNVB 2W6IA 3TDQA 1DONA 1KMHA 1XHZA 1RKNA 3CHXA 3VR2A 4NXMB 2NN6H 5FOBB 4DV3B 4O4IB 1WTPA 4G4KA 2YIBA 4PI2A 1O78A 2Z4HA 1K83B 2F4VB 1NSNS 5C8YA 4FXUA 1GJXA 4IUNA 1TKWB 4YXWA 2VWJA 2IW3A 4DR2B 3VYRA 1Y8NB 1PRTD 2JJ2A 1T5EA 5IGBA 4DR1B 5CV4A 4L8JA 1TT2A 1SNPA 4HEDA 5FKAC 3GTKB 4A3MB 3BHPA 1NBMA 5KMGA 1PTOB