1T5EA

The structure of mexa
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
231
structure length
231
Chain Sequence
TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug resistance protein mexA
publication title Structure of the periplasmic component of a bacterial drug efflux pump
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 61
structure length 231
sequence length 231
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1t5eA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1t5eA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5eA02
3D4RA 2A68C 3W3AA 5BN5A 1Q1BA 2A6EC 4XTCS 3SDZA 4HR7B 3L7ZC 3A7AB 3GQBA 3BG3A 2JEAI 2JE6I 2EJFC 1E2ZA 2D5DA 2PCFB 5KNBA 1B9NA 2EJMA 3WB2A 1T5EA 1YNJC 2EDGA 4TQUS 2K7VA 4DNTB 1OXXK 1GUTA 2BA1A 3CRKC 4OGQC 2E74C 2AUKA 4H0LC 4KN7C 1PMRA 1CTMA 3OW7A 1HPCA 1OXVA 3MXUA 3VR6A 1FYCA 2BDOA 1H9JA 2B8FA 2O5IC 1OXSC 1TKWB 1DCZA 1VF7A 2V4DA 2F95B 3D31A 4I7ZC 2O5JC 3AB9A 1Y69U 3SE0A 1Y8PB 1GUGA 4OO1H 1H9RA 1GUSA 1HCZA 2JXMB 3M7NA 2D2CC 3I4LA 1OXUA 1H9SA 1LABA 5BN4A 3A8JE 2A6HC 1VF5C 2A69D 3N6RA 2R6GA 3PUWA 1ONLA 3QG1A 4OO1G 1QJOA 4KKTA 3WDNA 2D62A 4IFDH 1Z7TA 4DNRB 3VR5A 1O7LA 3BDOA 5D5PA 1CI3M 3H94A 3PUXA 5JEAH 3FPPA 1LACA 1BDOA 1G291 1DD2A 4JK1C 1TU2B 4G7HC 2EVBA 4H44C 3RLFA 2A69C 3QIAA 2E76C 3LNNA 4DK0A 1E2VA 5JEAG 4BA2I 3NE5B 2A6HD 3HGBA 1GUOA 1H9MA 1VCIA 1IYUA 2BA0A 3KLRA 2NN6H 2QF7A 3I73A 2Q8IB 5A35A 1GJXA 2DNEA 1K8OA 1SMYC 1HTPA 3LWUA 3ND9A 1Y8NB 3WB0A 1IYVA 3I72A 3P20A 3QJYA 2NN6G 1Q90A 3ND8A 4RCNA 3FMCA 1V8QA 1OXTA 2LMCB 4TKOB 3VR4A 4KHZA 4GZYC 3PV0A 1Y8OB 2KA7A 3WB1A 2AUJD 4G7OC 3A8KE 4KMUC 3OPOA 1Q1EA 2ZT9C 2K33A 2EJGC 4LK1C 4G7ZC 3A7LA 1GHJA 2NN6I 5JJEB 2DNCA 4IQZA 5C0XH 3EQLC 3T51B 1DXMA 3VR3A 1V43A 1ZKOA 4L8JA 4H13C 1B9MA 3PUYA 1HQMC 2F1MA 1IW7D 4KI0A 3OOCA 4KKSA 3VR2A 2BE5D 5C0XG 2F93B 4KN4C 1EWHA 2JEBI 1CFMA 1H2SB 3MFYA 1GUNA 2CW0C 1E2WA 3U9SA 3M4YA 3CRLC 3IFTA 3A8IE 1GHKA 3BRCA 1RSOA 1Q12A 1O78A 1H9SB 2B8GA 4DK1A 1IW7C 4KKUA 3IKJA 5D5QA 2BE5C 5BN3A 3VA7A 5JJNB 4PV1C 3M85A 4JBWA 2PPBC 2PNRC 4LJZC 3PUVA 2A68D 3DXJC 1VDZA 3T56B 4BA1I 2IT1A 2A6ED 5K36H 4XIGS 1A6XA 1Z6HA 2L5TA 3GD7A 1YNNC 5KNCA 2KCCA 4IFDG 4GYCB 1H9KA 2YYZA 1ZYRC 2K32A 3T53B 3PUZA 3TZUA 5K36G 5KNDA 2E75C 2DN8A 1FR3A 5JJJB 1K8MA 1I6VC 2AWOA
chains in the Genus database with same CATH superfamily
2ZL6A 1URFA 2GPJA 3DTUB 4LF5O 3QE2A 1GAWA 1KTKA 1BBUA 2B2TC 3DGEA 3AVVA 1QG0A 4PZ8A 1ASYA 2WACA 4K1XA 1DOKA 4RG1A 4PC1A 2QTOA 4AILC 1YHQV 3B09A 1PTOF 4B3MO 4RLZA 3BDLA 2A79B 4X64O 1O7LA 3KF8B 5IT9c 5M5YB 2G38A 2DGYA 1SETA 1DARA 3LX0A 1Y66A 3CCQB 2NN6G 4RD2A 1EQQA 1Q46A 1M4UA 4YHHL 1JOQA 4Y7NB 1IZ3A 2C4UA 4YAFA 4PNYA 1H2LA 1ENVA 1TWCH 4IOCA 4IFDH 3CJHA 1V9PA 3K06A 3QNEA 2YSUB 4JI3Q 1WTHD 3I70A 3E0EA 1ENCA 4F88A 4U7NA 3PO3B 3JAML 3HKBA 3KDFB 3JYCA 3VNVA 2B2YA 2TSSA 5JAVA 3S3WA 2Q8RE 4R4TA 1TUBB 5C3EB 2E5LQ 4X20B 1I4PA 4MTKA 4BWGB 2MK3A 3SK4A 3FVQA 4UPAA 4DR7B 1VQCA 2DYRB 1ONLA 4KKTA 3JAMi 2WFWA 2F0NA 2GK6A 2O57A 3RLFA 1DF5A 1RD9D 1JJ2A 2TMPA 1Q81C 2PY5A 1E3ZA 4LF7B 4M53A 3RYIA 4N9PA 4L5RC 2BCCH 4XR6A 2N8NA 1Y8OB 3MEFA 3TXQA 3VQVA 4UP7A 1BHAA 3HOWB 5LMNB 1W3SA 2K5DA 2Q68A 5JH7A 4DR2L 3CPWB 3CMEA 1GUNA 1N08A 4B3SL 3PO3G 3R93A 3OYYA 2FX3A 3CCVB 1GHKA 2FXQA 1DOLA 1BJKA 4MW3A 5FLMH 2FINB 3LSSA 3D3RA 4RKBA 4JGSA 5C3EG 1NB9A 5KYIA 2EZVA 5ELOA 1Z5VA 5DS0A 3VYSA 5JPNC 1TS5A 3A7AB 2HLDA 3EVKA 2YTXA 4BIZA 2JGUA 3I56A 3UDIA 4ZCLA 4AIMA 3KLSA 1V1QA 3ULPA 1TIID 3NUCA 4A3IB 5CBGA 5ITZB 1BPLA 5FO1A 3U6KA 3WDNA 4I9QA 3QOLA 5F2DA 5BSYA 2PLFA 3ONYA 2WV6D 3HOWG 4WJ3M 2DNEA 2UUBL 3R6KA 4EQOA 3TP6A 5BXZA 5JBQA 1V55B 3OIQA 1SR3A 3FMCA 4YWMA 4CGYB 3E1YE 4FM1A 2ZBVA 4OXSA 1IBKQ 5TR9A 4TSFG 4FXGC 2K4KA 2KBNA 1UWVA 4PQXA 1YZBA 4AC9A 2YXHA 1SAPA 5JJNB 1WPXA 2IWHA 4DV0L 2PUSA 4MN3A 2PO4A 1H9KA 5LP6A 4DV3B 5CBAE 3RN4A 3DUZA 1LLRD 2MHVA 1E22A 3R65A 1CKMA 3CCEB 4OGQC 2L11A 4A3IG 3FPKA 4IPCA 2XZPA 4XT3B 3EVQA 4B47A 4DR5L 3RN2A 1M57C 2YC0A 2ZTGA 4A3MB 1S0VA 1SYDA 2YWEA 5H2FZ 3DLLA 4FXUA 1WTXA 5FNVA 1RHPA 3G6JB 1EFRA 5IY0A 1SNPA 2HKOA 3K3WA 1GN2A 3W1BA 1KRSA 3R8BA 2KB1A 1PHJA 3CCRV 5B1NA 1BOSA 4U68A 2JA8B 5EZYA 5FK9C 2W6IA 4JI7O 3GTPH 4XXEA 4QL5A 5IODA 1KTVA 3FRPB 2NN6I 4GKJB 3M9BA 3U4VA 1SM4A 3DHQA 2WLHA 1TLLA 2K5HA 5NUCA 2OK8A 5KX5B 2F0SA 1I94Q 2JJ2G 4PI0A 2A3QA 3BC9A 4Z4YA 5DM73 4TOIA 5LA6A 4BA1I 2R9IA 4GNXB 1YTFD 2P90A 4DXGA 4X89A 3LQ6A 5K36G 4NTXA 1S72A 3T1CA 3PA1A 1EY0A 4EB6B 4CH6A 2XAGA 4NCNA 3GTJB 1WB8A 3F7VC 1O9HA 2B1IA 3JAKB 2VWKA 4C3JB 4B3SO 3DM3A 5AFWA 4A3MG 3I2ZA 2H94A 3BVOA 3T4AC 3AG4C 2V7UA 2RDHA 3Q8DA 2RKSA 1C9OA 4PA6A 4ROXA 4QQBX 5C93A 3OSOA 3T1HL 2JA8G 3HKDB 5IK2A 4XQQA 4CH5A 1X54A 1MI2A 4X07A 5IP7G 1PTOB 2RDCA 2NR5A 3BNWA 2F52A 3PIO3 2K5NA 3CPXA 1FAFA 1ZUQA 1V8QA 4OX9B 4TKOB 4L5TA 3AK2A 4CKEA 1N9WA 2AHOA 3PV0A 3LNMB 4QB4A 5TY0A 2Y0SB 1CQVA 1DK1A 1IBKL 2DNCA 5JVH3 2HCCA 4F6RA 4DR6Q 2ZBUA 1CQXA 1ICFB 4MSWC 5COYA 2HP8A 2UUBO 1Q12A 4H44C 1C8CA 3GTLH 3RN5A 1TAEA 4CJ2C 4HIKA 1DTOA 4C3JG 5K1PA 4O4LA 1U2RA 4JI2Q 2ZIMA 3AG2C 2Q2UA 1EY4A 1HNWQ 1FNMA 2VNUD 3A54A 1E1QG 5BR8B 4J0QA 4NBSA 2Q0AA 1P7BA 3SEBA 4XQJA 2NBFA 4DV0O 5JJKA 3MWYW 4PZ6A 2PYLA 3S15H 2EYOA 4CJ0B 2ICIA 1RP3B 3CJHB 4AF6A 1HUNA 1YJ9V 2Y0SG 1Y6XA 1VQ7A 1I3QH 1K8AC 3VA5A 1NR7A 3HKBB 4LF5B 1VQ8A 3SYPA 3MA2B 2V7XA 5CORA 1DONA 2I5MX 1LTAD 3B2EE 4ULLA 4KY6A 5H59A 3QFSA 2BTOA 2R93H 4LAAA 5C5LA 1WNSA 3PGZA 5K5PA 2Q69A 4B3MB 4JBWA 3OGCC 4X64B 1VDZA 2WB1B 2A9HA 3DC5A 3KEWA 1H2GA 3PUNA 1IURA 3N52A 1XEQA 4A3LG 1K83B 1JJ2B 1ICWA 2N49A 1YI2V 4RH6A 3CRCA 4PA7A 2E74B 3RYIB 5LHIA 4EVOA 4FVMA 1MD2D 2K7VA 1KC8D 3CW2C 1D1IA 4Z9CB 2E1BA 2YTVA 1UD8A 1T6ZA 1NAPA 2AHZA 2K6AA 5JH7B 2QN6A 2ZQMA 1K5QA 2W0FC 3CMEB 4RCYA 1M56B 1G291 3BVZA 1VQ9A 4ACAA 1PKVA 2Q0OC 3ASQA 4P6VF 1HFGA 3S17B 4RQFA 5B3SC 1R3LC 2NVQH 1F9QA 5CC4A 5BMVA 4FFKA 1U0LA 1JOYA 3K0DA 1XPRA 2B5UA 2K33A 4QPKA 1NDHA 2Y0PA 5JJEB 3T1HO 2ODMA 2KHIA 3I56B 1AE3A 2WB1G 3JATA 4DR4Q 3WOFA 4EH1A 4TQFA 1VQPV 5JJIA 4JCVE 4YIJA 1PFNA 1S5DD 1O7IA 1P4RA 3NXSA 2BN4A 2VXWA 1IBKO 3BYTB 1J9OA 3OR7C 2A06H 3WWVA 1CPYA 1TY0A 3J80E 1OB2A 4O4HA 1B53A 3G48A 2WB1E 3LDCA 2VYQA 1JWMD 5CB4A 3A3BA 4XLCA 1U4RA 4K0KQ 2HIVA 1V1PA 2DOGA 2JK8A 3HR0A 2CC2A 4P26A 4Y9UA 1SMYD 3K08A 3FB5C 4O2AA 4UCVA 2YIBD 1BQZA 5LL6Y 2HLDG 1XOUA 3OJWA 3WNDA 5LP6B 3HRZC 2RN9A 1B50A 2A19A 5C3XA 2KHJA 1SF9A 4EQNA 1CKOA 2AQ2B 2H5XA 1JQ0A 4K3AA 1KHIA 1KU9A 3A7LA 4R50A 3A35A 3E9IA 3I4MH 2K5QA 1RIPA 1H2SB 3A3GA 1D5NA 2F43A 1ZYRD 3APQA 5LMZA 4B9XA 4R6ZA 3CC4V 3U58A 3K5MA 5FNVB 3JQRA 3PUZA 4LUVA 5FLXE 5IYPA 1MZFA 4GKKQ 2CBXA 1PH2A 2J0TD 4A3JB 2A74C 3AK3A 4WCEV 2Q2IA 3JD4A 1SYBA 5EZYB 4DV7L 2F0IA 1Q82C 1NBMA 4IW3B 5IWAL 1XNRQ 1I94O 3RWRD 4WF9V 1JE5A 3OTFA 4I50B 3MXPA 2OK7A 2JA7H 3K79A 5DECA 4HAMA 4UZEA 1FDRA 4B3RQ 1Q90D 3U4ZA 2L4NA 1SROA 4RAIA 1FRQA 2Y4UA 2WA3A 1GO2A 3SPHA 5LA6B 2MFIA 1GJXA 1JE4A 2C2WA 2E2IH 1S72B 2XOKA 2ZE5A 3KBGA 3J81N 2IX0A 5B1AB 2XTAA 1Q1EA 2E2HH 1SKVA 4RDJA 1SERA 4BBRB 2Z0SA 1A2UA 4P73A 1EFRG 3FYEB 4JI8L 3CCUV 1VQ4V 3WQZA 1E3XA 1NB0A 4A3JG 1L1OA 4JAUA 3S1RB 1PL0A 1V54C 3W2FA 1EIGA 2W6IG 2ZE8A 4DK6C 2F03A 1IXBA 2DN9A 4MVUA 1K4DC 1S40A 4G28B 1PFMA 5DLQE 4JI7B 4DR6O 1KKDA 1RODA 1H9JA 1QNUA 2AHOB 1N4CA 3RGBA 3CCLV 2VBVA 3I8ZA 4KHPL 4LBYA 4F4LA 3G6EV 1K4CC 4FNFA 4N8X1 4ZYSA 4F6RB 3D0FA 2QDLA 3CYOA 1BL8A 2VNJA 2R7DA 4DQLA 4DRXA 1KK2A 4L63B 2DUDA 2N3SA 2Z6KC 4PMWA 4BBRG 1RM1B 4HMJA 3N2KA 5A2QN 2ARHA 1V55C 2RHSB 2PI4A 1HXYD 4CDEC 4H13B 2CW0D 2DJVA 4B3SB 4A93B 2C5CA 2D0PA 3MHSC 3CTAA 1HA5A 1CK1A 1TGOA 1D1NA 5M3FH 4X7DA 1CP9A 3DXJC 4YCUA 4A3KG 5D3DA 5CMUA 2BM1A 3H0GH 3B8HA 4LCUC 4BPRA 1VQ7B 4DV6Q 1E2ZA 1LTLA 1T5EA 4HZ3A 4DO2A 3OMGA 1FRNA 3A74A 2QGNA 1X3EA 2Z4IA 4L5SA 1IHZA 1VQ8B 4A3BH 1BBWA 1QCEA 3QO5A 1KC8C 1YSCA 5JJZA 2DETA 2ZIOA 2BSKA 1JR9A 4EFEA 4PC7A 1TU2B 4DV7O 4FYDA 2VS1A 2MO0A 1CSQA 4IPGA 3IC9A 2XUMA 4A93G 1VQFA 1Q86D 1WOPA 3RYFA 3GO5A 1G91A 3HOZH 3IC7A 3ABLB 1HNZQ 1L0XB 1HZAA 1WTWA 2CF4A 4C2MB 4Z2WA 3OOCA 3I4NB 2YXYA 1I5YA 4WFEA 1W87A 2L9HA 3TZDA 1S77D 2YEVA 3QWNA 1BO0A 3U0ZA 4QMGA 1I7FA 2C77A 1STGA 5C8YA 1VQ9B 4GNXC 5EJWA 1NH2B 4AQYL 1K3BC 3E20A 1DLBA 2EDGA 2LSSA 1QFZA 4RPBA 4JI8O 4P72A 5BMVB 1COWA 3ZRVA 2AUKA 2ZDIA 1SE8A 4DR4O 1CTMA 1L0LH 4MZ9A 1AFPA 5GV8A 3A0BZ 4PABA 3CPWU 3N6RA 4WORA 3JATB 4IFDJ 1NNXA 1JJCB 2GTAA 3LDEA 4P30A 2Q6AA 3Q4HA 5JEAG 4AHCA 2FL4A 3VO2A 2HEPA 1AB3A 1SMYC 3PO2B 2B29A 4KHPO 4QIWF 3E83A 1DJRD 4B3FX 4A4IA 2FHTA 4XLFA 1PJ7A 1N36L 2QDXA 1JJGA 2SNMA 4IQZA 4K0KO 4O4HB 2L12A 5F2VO 2VWJA 4RD3A 5CB4B 1F4MA 4HJ5A 4KL1A 4II2A 4XOPA 2ADPA 4A3EH 4I0XA 1B4OA 4KKUA 2B3GA 3CCMV 3ZHQA 1V1PB 2F3WA 2BGJA 1ZYRC 4NKGB 1BUVT 1XTDA 2DN8A 4O2AB 3APOA 5IGDA 1I6VC 1R4PB 2PF4E 3NP8A 4OEMB 5ELCA 1OCOC 5LHHA 4OPSA 3E22A 1LTSD 3E8GA 1STYA 4DV6L 2ZL5A 1PPJH 4FZ1A 1KRHA 3KYHC 5T1GA 3E8FA 4B9WA 1STBA 3I4LA 3S14B 2DYIA 5BN4A 3N2GA 1XHXA 2IJIA 3CRMA 4KXRA 3LSUA 3PO2G 4I9WA 4GKKO 1XUQA 1FXKA 2BTQA 3ONAB 3J7ZC 1E1TA 4ZQ3A 2QF7A 3F7YC 2MQHA 2OYNA 1B3QA 4A3FB 1PVOA 3CB4A 4R8IA 4H33A 1IBKB 4DV1Q 3FFQA 2JS3A 2PQEA 2X6XA 1KLGD 2B2YC 4K5XA 2EFGA 3O9OA 2D9UA 3CC2V 4KI0A 1NY4A 2PI5A 2K01A 2EY5A 2XGJA 5EBWC 3B8NA 3WBJA 1PZJD 4RJLA 1WCMH 5F4JA 4XL9A 2D3OW 3AG1B 2CE4A 5GW7A 3H91A 2LFNA 5A2QE 3OUSA 2WLIA 4K6DA 3KUPA 1JA8A 1E63A 3BZKA 1H95A 2ZM6L 4UCUA 1KRTA 1XYIA 1K9MW 2E74C 1PXUA 2HIXA 1YJ9A 4RA8A 2F43G 1G4YB 1QG7A 3OE7G 1SYCA 1JFFA 1RJTA 3E6ZX 4A3FG 1JJOA 3IL8A 2OCCB 4AQYO 4LF8Q 3ASSA 1M56C 2RQ6A 2BCOA 1L1OB 3WFVA 3CWBH 1R3IC 1DGSA 2SOBA 5M5WH 2Q5ZA 4XNFA 1YJWV 4LFCL 2AHYA 1SQGA 1QVGU 2ZXHA 1IXMA 5ELDA 2VRZA 2OT5A 1I94B 4LH7A 4LNUA 2D3NA 1E1OA 2CW0C 2CUGA 2N78A 5M3MG 1GAQA 1QILA 2ZZQA 2KCTA 2NLJC 1PLFA 1B06A 4Z1MG 4ZK9B 1GJRA 2XOKG 3ASNB 3SLDA 1N36O 1YF2A 3A8IA 4UZUA 1BCCH 3D4RA 4DRXB 4TMTA 4KD4A 1D1KA 1EWCA 4DUYL 2GN5A 3N2KB 1H2NA 2HVKC 1P8LA 3ETQA 3MFGA 4J11A 2G9HD 5DEHA 1WOSA 5G3LF 1KDAA 4JG2A 1BQQT 2FMLA 1WAZA 1FX0A 4XKWA 1G2SA 2MNAA 4FIPC 1WJZA 3OW2A 1E2VA 1TS3A 4DV6O 4KP4A 4M2LA 5C4XB 2NN6H 4V190 2YXLA 1UAPA 1VQPA 5LP6C 3AFPA 1OXTA 2LW7A 4DFAA 2ILMA 1ZM4A 2JK5C 2QSAA 1W6JA 4LK1C 1Q86C 2NB0A 3DEOA 2WAQB 4DR6B 1SBBB 1H8EA 4P2ZA 1EXMA 4OL7A 4MYTA 1LT4D 3FPUB 4O2BA 3U9SA 1Z9FA 3SPCA 4B4DA 1KK0A 3O65A 1Y0RA 2BSKB 1XWEA 2XAFA 3ZHSA 2BPOA 1HR0Q 3CCQV 3I7FA 4KUMA 1E24A 1X3PA 4HR7B 4MNOA 3WB2A 3TQYA 2P3MA 3RYFB 5M5YH 2CCZA 3SK6A 2W0XA 3L3OC 3HOVB 4E0FA 4UP8A 4LF6L 5IE8A 3T2MA 2B2TA 3PSIA 2X3UA 5C4XG 1GRJA 1V0EA 4WZLA 1G8ZD 4NP5A 4PDVA 5EMNA 1KDCA 1LACA 4F7DA 2YEVB 2ZM6O 5GADC 4LF8L 4X6AH 4Z4ZA 4Y7NH 3GTOB 5EPLA 4A3GB 3V2TA 2YDEA 1Y67A 5C8YB 1IVSA 1GR1A 2WAQG 3RLOA 3OM3B 4J10A 1Z5WA 5GAGC 2FFKB 1LO5D 4RUFA 2RDFA 1MA1A 4QIWB 3PO3H 4YY3Q 2Z6BD 3A8KA 1E2WA 2K9PA 3KFUA 5J2TA 2X7RB 3HEJA 2YI8A 5C3EH 3PIP3 4LR3A 4LFCO 3L2PA 3HKEA 4ZKIA 2WAQE 3MHBA 1F2YA 3EIVA 4DV7B 3Q4HB 4Z4TA 4NMZA 3ZYYX 3HOVG 4V0BA 2C5BA 2IY5B 1STEA 3AU7A 4P9PA 1SE4A 5IT9E 1CZWA 2BOBC 4XLAA 2EOTA 2BOSA 4A3GG 3CCVV 2F0EA 3OWFA 4G4KA 2EPBA 4IURA 4NXML 5D5PA 1YBYA 4RDKA 4JPBW 1TWFB 3W2GA 2EVBA 4ZGNB 4I0XB 5C6AA 4DUYO 4BBSB 5KAIZ 3HOWH 3A1PA 4JI6L 4PDLA 4DF7A 3W5UA 3CCUA 1VQ6A 1VQ4A 1COWG 2H4OA 3K04A 1RM1C 1X4TA 4J6HA 2DYSB 3E22B 5L3GA 5A89A 1S0UA 5C44B 4JI8B 2HDMA 3EQLC 4HAEA 1N32L 4DR4B 2LZJA 4H13C 1HQMC 1Y0YA 4X8IA 5FJ8G 4RUEA 3N2GB 3T56B 3NTKA 4DV1O 1AW7A 4J9ZB 1I4XA 3CCJA 1K8MA 3G6EA 3NTIA 1FXKB 2BTQB 4QIWE 4DXFA 4ODGA 4Q20A 4TWKA 1FVIA 4CC5A 3NBIA 4A3IH 4G1BA 5EAYA 3PF5A 3SR1A 3CC7V 4U673 4JI5Q 4CS2A 4E6IA 2QWOB 1AZQA 1ZL8A 1XMQL 1G1XB 4K0KB 2RC5A 4BBSG 1KD1D 4DYLA 2A69D 1OCZB 4X1YA 1AMOA 1E62A 3VR5A 1GN4A 4XDKA 3ICXA 4PHZA 5HXBA 4JK1C 2ZR3A 4XONA 2RF4A 1HH2P 1XB2A 1ZAUA 4WBNA 5FA6A 4YJ2A 1WP8A 5C44G 3CCEV 2WA4A 4KV6A 3OTOL 1X3GA 2P06A 4MIUA 4DAVA 5KYLA 3OMIB 2UXBL 1YJ9B 4LF8O 4Q5VA 4JI4Q 1OJHA 5IYWA 2I0QA 1TVXA 1J5EL 4FK8A 1JFFB 4JF3A 4IUUA 3VA7A 5K36H 2QEXA 2IJJA 4XIGS 4GKKB 5CV6A 3A2FA 1ZEQX 1J9ZA 4XTCS 4KHVA 2EJFC 1B9NA 1QFYA 1OHHA 1JB3A 4LFBQ 2V1DA 1IBLL 1R6TA 2QR4A 2I1LA 1D2BA 1H9RA 1CHPD 1HA6A 2JA8H 2UXCQ 2VBSA 2NZHA 1A15A 1SZTA 4LNUB 1SA0A 4HIOA 3K57A 5IP7H 1EZJA 3ZBTA 5LMNQ 4HE6A 3ZRSA 3URYA 4DUZQ 3OMAB 1S5ED 3I72A 4IJHA 4X1IA 4WFFA 1VQNA 1HRJA 5GAHC 3C3TA 5IYDO 3ZPNA 1W0JA 1QR9A 2F0VA 1JB7A 4CC6A 1SFOB 4ZCIA 3CRLC 4JI6O 1XQ8A 4DK1A 1EN5A 1KL9A 1FFXA 3GTJH 4FDBA 1F7YA 4C3JH 2AWNA 4WZKA 4AQYB 1K73W 3AYHB 4Z4SA 1UPGA 4P71A 5H5NA 3L7ZC 3SJCC 1IBMQ 1YZ6A 4NXNQ 1VQPB 1Q6HA 2J7ZA 3VR6A 2DERA 5LYJA 3KZIZ 1N0JA 2NTSA 1A63A 2ETNA 1C48A 1KK3A 1PZKD 1YVCA 1KJZA 4UY8C 4QFMA 1EU4A 1WTOA 2N74A 1KK1A 1JX9A 3VYUA 4R7CA 1OCRC 4C0SA 3BVMA 4FXKC 1KB9F 2WLNA 1BCPD 1XMQO 3HOXB 3CMAV 4XD7A 1JICA 1N36B 1MJCA 5F4OA 1X65A 2C2AA 2EE1A 5CA1B 3Q0AA 2VW9A 1PNKA 4B48A 4Y52H 2B1GA 1TWAB 1QVFU 2EYJA 2EY2A 3OWEB 4XBFA 3J7AF 1K28D 3DC6A 1F51A 1YLOA 1Y1VB 1EU3A 3A8IE 5I6YA 4EFBA 2PPBC 3DEPA 2CQAA 5IGCA 1Z6HA 4A3LH 3CD6V 3Q39A 1QU7A 4GN3B 3RMHA 2J7KA 4DV6B 4UFZA 1SNOA 5TISZ 4FLZA 3JC66 1WTHA 5CBEE 4YY3O 2BMWA 1J5EO 2OYQA 3NBHA 1MKHA 3OIPA 1Q7YW 2JSOA 5H5JA 1R1BA 4MVRA 1LT3D 2PIAA 3HOXG 4MVSA 2KEEA 2YI9A 5J2TB 2OCCC 3B77A 1W35A 2IJKA 1WPCA 2CH4A 1PNMA 3SYQA 1IBLO 4ZI7A 1TUEB 1KAAA 4DW0A 4PZ7A 2LFSA 1AI6A 2E2HB 1CQFA 4KMUC 4GX0A 1Y1VG 3FHWA 3I55A 1ET9A 4QY7A 5JCOC 3F2BA 4OELB 4EEQA 1K83H 1LUZA 2F0DA 3CMEV 2EILC 5IYZB 4DW1A 1BF4A 4X3UA 5EBMC 1CSPA 2A6ED 4K8IA 1A6XA 2YIDA 1QNKA 3CP2A 1B6QA 1ZM2A 1LUVA 4G2KA 2K05A 2ZM6B 3HPLC 5HY6A 1L0WA 4DV2L 3ASNC 5K1XA 3I91A 3CCUB 1VQ6B 1VQ4B 4IUNA 2PZTA 3I56V 1VP7A 1X9NA 1E3PA 2D74A 2VQEL 3S17H 3L71H 3SEJA 3CW2A 2PI2A 4IOAA 1JT8A 3TP7A 2YTYA 1M90C 4B7EA 1ZUNB 1D5XC 1KD1C 3BA8A 1BX1A 2A69C 2SNSA 5IYRA 1QNMA 2PYKA 5GAEC 1NJID 2XRSD 3ZHTA 1XDCA 3KLRA 1HFNA 1WLEA 4D6TH 1VQJA 3ABKB 4JI5O 2X6GA 2HFEC 3CCJB 3G6EB 2XNCA 1XE1A 5B6IA 3G67A 3SGIA 1NKDA 2XZLA 3A8KE 3AG3B 3AGPA 2AMCB 1SE2A 1TVCA 3PF4A 1ZL8B 2B7BA 2GTSA 4K14A 3VR2A 4X62L 2X85A 2FKXA 4FWTA 4JYAQ 4W4LA 3CAMA 1AI5A 2EIJC 1JA0A 3TK1A 3HS0C 2JA5B 3CU7A 2M2LA 1VQLA 1WVLA 4PV1C 5BR8Q 4X1YB 4XDLA 3Q6RA 2GSMB 3OAAG 3H0GB 4WBNB 4YJ2B 4CDCC 3UT5A 2K5WA 4DN4M 1WJJA 1CHQD 4RDLA 4JBKA 2QGQA 2YICA 3H1JH 4DU9A 4ME3A 3ETEA 2G9DA 3QO2A 4JW0A 1U5KA 2FMCA 2Q2TA 2X0LA 2K1EA 3PUXA 4QJFA 3D4WA 3ERSX 3S1NB 5I9OA 5H9CA 2CGNA 2ZXPA 1BKBA 2QEXB 5KEEA 3E8HA 3NWTA 2ZXWB 2CKZB 4DV1B 1PRTB 4LFBO 1XXGA 1PYSB 3OUFA 2LGQA 2P67A 1HZEA 1A0IA 1KNEA 1XJVA 1ZSPA 4IIJA 5B1BB 2UXCO 1T9HA 2JA5G 2GREA 5L37A 3VR3A 1QLEC 4FK5C 2YIAA 4YJ3A 2HCJB 4A3JH 2OCHA 2UXDL 1AIPA 3NPPA 3VNUA 4DUZO 2M00A 1EIFA 4UZFA 2EINB 2A8VA 1SA0B 3GV3A 4TMZA 3T53B 3FYIB 1S72V 4X1KA 5LXTA 4LF9Q 1A62A 3AVYA 1EYGA 1JWUD 1BQEA 2ZZEA 4X1IB 1VQNB 1TVKA 1PD3A 2O5JC 1SEBD 3RR5A 1RTOA 2IPKD 5GV7A 2EXZA 2ZL7A 2ATWA 1F9SA 2LP7A 4LF8B 2F4VL 1UNSA 3D6WA 1K5SA 1B3AA 4OPOA 1IBMO 1FFXB 4TN1A 2A6HD 1SZXA 4BBRH 2OBRA 4PA3A 2F0UA 3K0GA 2OBSA 3L9AX 5E1FA 1OHHG 2KJXA 1UUPA 2FVGA 1VJSA 2UU9Q 1OTCA 1NZ6A 2VY3A 3MC0B 2F0JA 3EA6A 1KMHA 5KMGA 1JOKA 4ZAIA 3S1RH 4RGMA 2DYSC 4CKCA 4EKWA 1A3VA 2CW5A 3ZBHA 5LGNA 2ZTCA 5GTHZ 3UDGA 4HJ7A 4DAMA 4P2CB 5IIFA 1CZGA 2VQFQ 1G2TA 2EIKB 1R5BA 3KL9A 3Q23A 1HZCA 4A3KH 2WLJA 3ZHVA 5KNCA 1X3FA 1ASZA 4E2LA 5KNDA 2Q2HA 3A0HZ 3CESA 4KY7A 1FXKC 4X62O 1W0JG 1QVCA 4LH6A 4J9YB 1EOVA 2JN4A 2P22C 2BSAA 1ILQA 1YNXA 3BFRA 1IKMA 4J8QA 2ZJRA 1EYDA 4AVZA 1G7RA 1ZM9A 2PW5A 1OCZC 2PE3A 3J81k 2KG7A 1FXVA 4GN4B 1IYUA 5ELFA 4A93H 2XASA 1VQ7V 1SYFA 2EULA 1FXHA 5IP9G 2Z6KA 1I50B 5C4ZA 3CRQA 2EY1A 2IH3C 4UV9A 1GXDC 1N34L 4UCSA 4POGA 5KHKA 3NBHB 3W2DA 3VYRA 2JN9A 3CC7A 4DV5L 4RD0A 3E3XA 2Q6OA 1ZX3A 2ITCC 1EY9A 2P5ZX 3G71A 3VOUA 4I55B 2A6EC 5CR3A 1XMQB 3ZHRA 4ZI7B 5IYDG 2R72A 1QGYA 4X66L 3MXUA 4RGTA 5EPJA 4Q6GA 2IH1C 4R4OA 1THZA 3I55B 3CCEA 3OMNB 3KKYA 3NR7A 4YHHQ 5ELNA 5HGQA 5JEAH 4FN5A 3ASOC 2WJVA 1VQ9V 1PH5A 1XNQL 4X0CA 1PRTD 4II3A 3IFXA 4C2MH 4D7SA 1X32A 1STNA 5LMUL 1N8RD 2VZLA 1NJIC 4RCNA 2LO1A 5FNZA 2EYHA 3QFRA 1EQTA 2UU9L 4ZCMA 1WA8A 2F4VO 1JWSD 4YY3B 4ZLTF 3UI2A 4LBEC 3DWQA 1S76D 3HOYB 4HBNA 2UUAL 2VQFL 4ZOLA 5E7NA 1CM9A 3P7JA 2HHHL 5KX5A 1UE7A 5CA0A 2IW3A 4UUJC 1IXRA 2BH8A 1IBLB 2XTIA 5C5MA 4FLUA 3RZDB 2KECA 4JYAO 2AZ0A 2VL6A 3TCUA 1N33L 2ATKC 3EROA 2JDIA 3JAKA 3PO2H 4UAIA 1Y74A 5EKKA 5J9PC 1DOMA 1QH0A 2YUAA 3CE2A 3P27A 4DR2Q 3QIAA 1VQLB 1WSVA 3NE5B 2L55A 4MTOA 3AVUA 4RD4A 1WSRA 4B3SQ 2V1CC 4YWKA 4IUTA 5HFMA 1QLNA 3CCSV 3UT5B 2BF4A 1XL4A 5EIBD 3HOYG 2YIBA 1IDSA 2IW5A 5DM63 3MAQA 2E2JB 1CFMA 4NPSA 4LC0A 2AW9A 1FNDA 2Q73A 2KQ3A 2LFRA 1PV0A 4XN0A 4QJFB 4P3IA 3ZZUA 1CKNA 1UD2A 5EC1C 2Z3YA 3S14H 1A3TA 1SXTA 4JI5B 2PI2E 1NTKH 1PYWD 3STBD 3U10A 4WFGA 2UUBQ 5IYBO 5C3WA 4GOPC 4IIJB 3CMAA 1BNZA 1HCZA 3W1GA 3FEWX 1MJEA 2ZTNA 1OXUA 4A3FH 2RA4A 4QE7A 4YJ3B 1EYAA 1HJPA 4LF9O 3K8AA 3A0RA 1GKHA 4X66O 1FYJA 3BPZA 5EKLA 4PD4F 2WPDA 2MJ8A 4R8NA 1Q90A 4B3TL 4X1KB 3WNBA 5LXTB 4DV0Q 3CD6A 3Q3AA 4OONA 1GHJA 2F3IA 2X6AA 2EYLA 4YAUA 4JV5L 4AF7A 1MRZA 1YTFB 4JI4B 1TVKB 5M3MH 4FLTA 2FB5A 5LMUO 4J7ZA 2GUZA 2UUCL 1CXZB 4X3TA 4DR5Q 4DR1L 4YAOA 2NYZD 1S5HC 1M1KC 4N3NA 2UU9O 4HE5A 1CNFA 4UV8A 3TDQA 1OB0A 3GTKB 1G7SA 3FKSG 2XNDG 1F9PA 4JI0Q 5C4JB 2VZAA 4R4IA 1YNJC 4LFBB 1IL8A 2QM4A 1I4RA 1WOCA 3ZN0A 2VB2X 2VQFO 1R6KA 1Y69U 5KMGB 2UXCB 2HHHO 3M7NA 2IX1A 1Z47A 1I5XA 4RM0A 2JA9A 1VQMA 5KHHA 3S16B 4DQKA 3ZJZA 2F0OA 3F2DA 1MZEA 4DUZB 2JP1A 1AP6A 1K33A 1HTPA 2DJFC 3CS5A 3OW2U 2F0GA 3CXHF 1VQIA 3ABKC 3P26A 1AVMA 2LY7A 1V54B 2G5DA 4CKBA 4PMCA 3J80c 4LWSB 4UVBA 4WFN3 1FNCA 3AG3C 4B43A 5J3BA 4JTCB 4C7UA 1V43A 1NCVA 3TP8A 1EIYB 2HCIA 2CAZC 3IRBA 2EYFA 2EQSA 3T1YQ 4HJAA 1EWIA 5JVDA 2PMZB 4GYCB 2B2UA 2KG7B 1IBMB 4NXNB 3T1HQ 1I08A 4TQUS 3W2IA 4KD3A 2FJ2A 1K3RA 2DY1A 1RQRA 2XWBB 4LFAL 1B23P 5C4XH 2X6LA 4LC1A 5IYNA 5KRUA 4R4QA 3E35A 2OWOA 3MXGA 1MABA 4TT3A 3H94A 1QOHA 4XYOA 2XN9C 2DWDC 3CC7B 5KUMA 4BA2I 1M1KW 3FAVB 3G71B 3H3VC 3LWUA 4AI8A 2K28A 2ZXWC 3A8TA 1PRTC 5JVG3 1GO3F 2IU3A 1TWGB 4OOVA 1N8RC 1BZKA 4X62B 1MIUA 1M93A 4YHHO 4XM3A 3T4DA 1Q81W 4BIOA 5B1BC 1XFOA 3RLNA 4G7WA 4MTNA 4M1KA 4UXNA 2BV3A 4B3TO 5CV8A 2BOCC 2YYZA 2XAQA 2EINC 3HOVH 3ZRXA 1BQ0A 3B40A 1MBYA 5EYPA 2RBMA 1PZID 4JYBA 3ZX6A 4JI0L 2GJRA 2CGOA 1TWHB 5ELBA 4R4CA 3GTOH 1WA8B 4A3GH 1AJNA 1F23A 1QJOA 2GA4B 1LR1A 4JAVA 2Z8LA 3CEIA 1VQOB 1WOOA 4I50A 3J80N 3VYTA 4DK0A 4ZOLB 1YITA 4MW8A 2N55A 1STAA 1Z2GA 4K8XA 1NTZH 5CA0B 4DR7L 5E1AC 2ZINA 3TSSA 2AGAA 3NWSA 1JMCA 1T6XA 4YEJA 2QM7A 1G7CA 2XRQD 4N8FA 5EIBC 5IY5B 1ML0D 4N9TA 1EN6A 3C3SA 5FJ8H 4FLXA 4DR2O 2X0KA 3JQQA 3BRCA 2B8GA 4DAPA 4LF7L 5FO8B 2EIKC 1Y74B 3BDCA 3T1YL 4KJOA 4FJCC 3K9SA 1LV9A 3G05A 1ELOA 3TEHB 4OHJA 3GQBA 2L35A 2X69A 1TWFH 1GH6A 1YVWA 3VO1A 1Q8IA 5IGFA 4BBSH 3THOA 1L0NH 5CBFA 2F4VB 5FLXN 3STBC 2Z1CA 5L3EA 1SMXA 4U3FH 3UDFA 4C56C 3AFQA 3S9WA 3VQXA 1FS0G 4Y7CA 5C44H 3E89A 2HQEA 4Z1VA 2ICEC 4POFA 3SK5A 4LFAO 3E9HA 1CKNB 1HHVA 5I2XA 1WTQA 1KZLA 5KGUA 2JDIG 3GDEA 1OCOB 4QUCA 4JYAB 3K81C 3NSWA 4R71A 4LUZA 3S2HB 2VNIA 1XMOL 2F4IA 1U4PA 3CMAB 4IUPA 4C43A 2WLKA 3ZN1A 1XBLA 2A68D 3VDYA 1V0FA 2NZOA 5H6QA 2VS0A 2JEXA 5CV5A 4ZV4A 5C4HA 3RVYA 1P16A 2CK3A 1AJPA 1DF4A 5IYCO 3ZMSA 3DMUA 3M4QA 4FXDA 3JCZA 3CD6B 3M3YB 2KSDA 3OR6C 5I4DA 2JXMB 4DR5O 1GN3A 1G6PA 3D8GA 1QZHA 1D7QA 1Y76A 1MNGA 3MHHC 1YIJA 2GUZB 4JI0O 3WB0A 1AZPA 3UKMA 1SYEA 2GV9A 2WKDA 4UB8Z 2Y0SE 1YCIA 4B3GA 2CWPA 2Q7HA 4JVZA 2IHFA 3ERQA 1QWYA 2ENBA 4YIPA 1FNBA 4J42A 4DV4L 4J15A 1M8AA 4DV7Q 4WJWA 2DWEC 5IWAQ 3K5OA 1VQMB 1HA3A 4LF4L 1B44D 2WPDG 3SLNA 3Q24A 3TN2A 4LF9B 1FD7D 4XLHA 2B7CA 4X66B 1STHA 4R9WA 4GKJL 1X6OA 5H1SE 2EZPA 3Q6QA 1FNUA 4DNIA 3EXAA 2L1BA 3IAYA 4KY5A 2CTRA 1DCZA 4OWWB 5CMDA 1PH7A 4HIDA 2KCMA 1EN4A 1S5JA 3T1YO 2XHBA 4TVAB 2WYRA 3V96A 2XT9A 2Q7EA 4GT1A 1GVHA 1N0UA 2OEOA 3LO8A 1S3JA 4JI8Q 5JVDB 5A35A 1HR0W 3J81c 1HUMA 2UU9B 2OQKA 4MVMA 4UDUC 1SFOH 1I4HA 4ABMA 4M8AA 2CH4W 5IYBG 1SJED 4CZZA 2QWRB 2XWJB 1PH8A 1IW7D 3V76A 5C0XG 1ZM3A 2VQFB 3SJPA 2W6JG 1K8AW 1G7TA 2HHHB 3SYCA 2GDSA 1NS1A 4QVAA 3BJUA 1SNCA 1R73A 1B1ZA 4KHPQ 3ML0A 3W7TA 1SRUA 3EHBB 4OX9L 4ME5A 2LXJA 4TQDA 4IT5A 4WFHA 1XMOO 5IJ9A 3KOJA 4U9UA 4TV9A 3ASTA 2ZE7A 1Q8KA 1K92A 5KHGA 4UAJA 1SQXH 1NVPD 2RNBA 3HOXH 3CCSA 2QWNB 3K80C 3I4OA 3ES9A 1D5AA 3L9DA 4MT8A 1SJHD 1F77A 2RCNA 3R3OA 1HNXQ 2ZR2A 4B3XA 4LMQD 3NXWA 2P7TC 1TR5A 1TWAH 3F5WC 1Y1VH 3DM1A 5EYPB 3A5ZB 1Q81D 3OE7A 3OFNA 3A5UA 4RMFA 4PELA 3ZIAA 4IUQA 2XNAC 1MABG 4TUYA 3HOUB 4TT3G 5GONA 2BGIA 4MTXA 1RSOA 4TMVA 2F0LA 1RL2A 3H9NA 1AH9A 3ZHUA 3Q22A 1B70B 1KECA 2Z6BA 1HWYA 2GJKA 1YITB 2GHYA 1CUKA 1GO3E 4BR6A 4NKLA 2QTSA 4DV4O 1CA5A 1YDXA 3R2TA 2KKWA 4Z4UA 2NVXH 3AEIA 3ZMUA 3M4OB 4YCVA 1FNVA 3ASPA 4Z1MA 3J80L 4YHHB 4LF4O 4X64L 2IHEA 2F1LA 4IJLA 3LVBA 5LL6S 2DEUA 2Y69B 2B2VA 3JD2A 1SQPH 3I1FA 2CNDA 4GKJO 4ICGA 1SNDA 2QA4V 2KVMA 4CBVA 3BH4A 2YU9B 1QUEA 1VQ6V 3NQIA 1S5FD 2WKCA 3HOUG 5D14A 3J80i 1VQEA 2JEUA 2QKAA 2KA7A 4PA4A 4RD1A 1AI4A 2PQAA 4AQYQ 4K6LA 3FP9A 4C3IB 4LNQA 2MGSA 3MFYA 3U6BA 4H9GA 3STLC 5IYQA 5JCOA 2K52A 1IHMA 1AR5A 5JEAJ 4A3KB 2EJ7A 4KFMA 2F0KA 1A32A 4FF2A 1F2LA 3CCJV 2A68C 2RDGA 3SDZA 1SDFA 4MVOA 3ABTA 4FF3A 1BGYH 1TXYA 4RGOS 1OXXK 3CRKC 2ZTDA 4YELA 1GAXA 2XVSA 2QGGA 1WDTA 4DGZA 4HSVA 3LQEA 4YXWA 2OTLB 2NVYB 1HW7A 1UEAB 4Z4RA 1LT6D 4JTDB 2EYPA 2QJ1A 3MEHA 3D3IA 4PI2A 1I18A 4K8JA 1N36Q 4DR2B 2E76B 1BDOA 1Q82W 2R92B 5T1IA 2I5LX 3UO2A 5A8AA 3AGQA 1HNXL 1ZWIC 1JB9A 4QUZA 1I6HB 2WLMA 4C3IG 3VR4A 2QDBA 3SHLA 1F20A 2JA5H 4OWTB 5GQOA 2K14A 5L3CA 2F1MA 2VUMB 2XSCA 3ETGA 3JASA 3IFTA 4XKVA 3HKZB 2F66C 1J95A 5BN3A 4X65Q 1NQTA 1NSNS 2ES2A 3JAME 4ZKBB 1LTID 2QEXV 1Y76B 2HR3A 2JA6B 3CXCA 4GX5A 4FF4A 4Q7JB 1YIJB 5JJJB 3T16A 5LMNW 1JC7A 4QCLA 1I8DA 2ITDC 1Y1WB 3H09A 2UUBB 3S1NH 1FGUA 4FP5D 3CQZB 5IWAO 1ORQC 2R92G 4W4KA 3G4SV 3K59A 2EIXA 1H9SA 1T6YA 4H02A 4OO1G 2R6GA 3QG1A 2F0HA 4ALPA 3BDOA 1HP8A 1QFJA 4FMTA 5EPKA 3QF7A 3NENA 4MS2A 4RCZA 1GN6A 1RQPA 2OTJA 2A73B 4XDXA 2CK3G 5HZBA 2RMKB 1U9RA 4PA9A 3KLSX 4DV0B 2VUMG 2ZT9B 1EFID 1F9RA 4A5UB 1VQNV 4H7BA 4ZRZA 1S5CD 2GVAA 3HKZG 3GWKC 1P7GA 2DOSA 3BCFA 4PMBA 1KAWA 4J7JA 2ZM6Q 4NNJA 2JA6G 5IY5C 3SJQC 4DR5B 3OEHA 2DY8A 2Q7GA 3GWOA 1IW7C 2P6JA 2R7ZB 4P9OA 1Y1WG 5DN6G 1PM9A 1DG1G 4YALA 1HZ9A 2QTLA 3H9VA 4JI0B 4WZEA 4QV2A 3HKZE 1GOZA 4KN7C 3BVGA 2Y4TA 3QO7A 2F95B 3ASRA 1EFTA 1NMFA 2CDYA 1EOTA 2GVBA 4LFCQ 1IJEA 1VF5C 2ZNJA 5CA3A 1R5NA 3C2PA 2Q6IA 1E7ZA 3J7AV 3W2EA 1WB7A 2PGGA 4CHTB 1H9MA 4A3DB 1A8VA 3F1ZA 1MSDA 4JI7L 5IYCG 1KC8W 5IP9H 2WLLA 3R66A 3OD4A 4S3SA 1EL0A 3B6YA 1MGSA 1WU8A 4P1VA 3GVJA 1R3JC 3OJXA 5IJ9B 3Q6SA 4TV9B 1K8AD 1XREA 2EIFA 1NE3A 2N05A 2R7ZG 4IUVA 4CBCA 4DUYQ 1HNXO 3T1YB 4R1JA 1NTGA 4F8MA 3CCSB 1EEFD 4XORA 3SYAA 4X65L 2N04A 1YJNV 3CP8A 5J22A 4JOIA 4A3CG 1FPOA 3T1HB 3E0JA 1FYCA 3GTGB 5IYDH 1K28A 2ALYB 2CRVA 4UCTA 4M4SA 1OCRB 3F2UA 1BCPF 2JIZA 3CSXA 1X56A 1S4ZA 2O5IC 5GTIZ 2QMUA 3BEHA 3OZWA 3KBXA 2HDNB 4TUYB 4A3DG 3U2QA 5GONB 2I07B 2RCVA 2K50A 3VMFA 1I50H 5IT9N 1RSOB 1UD5A 3S1MB 4LP8A 1GMGA 2Z0AA 1XMOB 3I55V 3BY6A 5M3MB 1PL4A 3S24A 2XAHA 3PQIA 1WP6A 3M85A 3OZUA 1ILPA 4LF6Q 2PZSA 2O4XA 3QR8A 5LOVA 3W7SA 2LS01 4OXPA 3OFNG 1OGIA 1TT2A 4J41A 3BG3A 1SC5B 1D5MC 3ZIAG 3SPGA 3J81L 1HPCA 2WIIB 3UM7A 1S5BD 3BZDB 3GP7A 4JI3L 3SE0A 1FKAO 4K5VA 3E5SA 1OCCB 2D2CC 5B66Z 2PQAB 2UXXA 2A7WA 1D8TA 3LGJA 3JCUZ 4OO1I 2E5LL 1EY5A 3J81i 2EILB 3M4PA 4FM0A 1EFCA 2B2UC 3X2QB 3HOYH 4LUOA 4DV4B 2X6CA 3JQPA 2QE7A 3MVVA 4ZUIA 1E79A 1JMKC 2OIEA 4LF4B 2PMDA 1C0AA 1VQLV 1V5VA 2HJFC 3RZDH 2Y0IA 5EBLC 3PUMA 1NU1H 3GTMB 4IHJA 2KCCA 2MP1A 1TUIA 3OMCA 2QEJC 1CT1D 4NXMQ 4ZCKA 1XPOA 2XZOA 3SXHA 1BLIA 2MUYA 5A2QL 4BY7B 1JOOA 4U7OA 2HD3A 4JI6Q 3D31A 3CKIB 3UE0A 5E3FA 4X65O 2L6LA 1Q3LA 4RPDA 5IJ0A 1Q82D 4P2NA 3K0YA 1QE6A 1QVGB 3J7A5 3JASB 1H8HA 3ZEDA 1N32Q 4P12A 2ZZFA 1KXLA 2DCUA 3S1QB 2RQXA 1IB0A 3K6OA 2BM0A 2EIJB 1H85A 3CXCB 2E2JH 2V7TA 4PV1B 1Q6IA 4YXWG 3WOEA 2CTWA 2PZWA 1VQHA 3F5TA 2Q6LA 1DDGA 1Q3EA 1VEWA 1WTRA 4XMYA 4JZGA 4YAWA 3D6CA 1AILA 4L87A 5CA1A 2R9VA 1DYQA 1H9SB 1NUCA 1XMQQ 1VLOA 2LKVA 4BY7G 2MPMA 2OTJB 2WINB 1JORA 2JEAI 2JE6I 2VNKA 2ASBA 4OOSA 4DNTB 4X3KA 4QPJA 4K2LA 1GUGA 1B2TA 3OTOQ 1S4MA 5LGTA 1JJ2U 3M7MX 4C3HB 5JJLA 4GOPA 2PTMA 3K5NA 3E2EA 2CVRA 4DPGA 4CDDC 1QLEB 2UXBQ 2Y69C 2V7WA 1GUOA 3A8JA 3MD0A 4JI3O 3RY8A 1J5EQ 3KCYA 3ULJA 4APVA 3EJIA 1VQ5A 4HIZA 4B08A 4K2KA 2RSOA 3GVKA 2VJJA 1QQCA 4NTYA 5HGTA 1UE1A 3GTKH 2E5LO 5IWAB 4HJ9A 2J4XA 5C4JH 1QUQA 1IJFA 1IX9A 2JRIA 5D5QA 4JTAB 1IBLQ 1BS3A 1QVFA 5FIUA 3GB7C 1Q86W 5A88A 4OIKA 1FJGQ 2CTQA 3H1IH 2E75C 4ABNA 3RNUA 3ICEA 5IYZA 1JR0D 4BW9A 2CH7A 1JCHA 1WTPA 2K03A 4AH6A 2WLLB 1KABA 1I94L 1MHWC 2GBOA 3R6JA 4C3HG 5M5XH 5DEDA 4HN7A 3S16H 5CV4A 2QA4A 3G7LA 3BHPA 4I7ZC 3WNCA 3AB9A 1E1RA 2XEXA 1PV4A 3OEHG 1BCPB 1KMIZ 1RCVD 1VQKA 4GUNA 3OAAA 4DA2A 3A55A 5CBHA 5D65A 4G7HC 2E76C 5D3IB 1EP2B 4BY1B 3S2DB 3GTQB 4FLYA 2OT2A 1E43A 2LGWA 3JU4A 4DK3C 4G27B 5HZAA 4D7TA 3F8TA 1S3OA 4TSSA 2EJGC 3C1FA 3BY2A 1R4QB 1NR2A 4N23A 4CQJA 1DXMA 2YWHA 3BAAA 4KKSA 1NT2B 4KHPB 1HZBA 4JI1Q 4MTGA 3G71V 1OO9B 1I7PA 5J1ZA 1XILA 3LWEA 5LL6X 4FZ0A 1C4QA 4EGVA 3W3AA 5E79Z 4DR6L 1LUWA 3SK8A 3CMMA 1EFWA 3G80A 4HJ8A 4B44A 2B8FA 4ILWA 1KQSA 1UFIA 3D26A 5IT9L 5KLVH 4LF6O 4BY1G 2AXTZ 4HNAA 4JI2L 4QGPA 1GM8A 1B8AA 1HNXB 1DD2A 1HNWL 5IE9A 4XOTA 1QGZA 1TWGH 3SJAC 3CRZA 1AP0A 5L46A 1VARA 5LOVB 1K8OA 1MSHA 2JIZG 3CB2A 3QB3A 1IYJB 1KP3A 5FL7A 4QE9A 4X9QA 2ZT9C 4ZIBA 3WXMA 3HZXA 5KSWB 1PTOD 1P4MA 3T51B 3DXRA 3MZ5A 1K9MD 4O4JA 1AR4A 2DMXA 3M4YA 4P22A 1VQOV 3PA2A 3MDSA 3STZC 1TWHH 1RKNA 4MTFA 1FJGL 3G4SA 3BS1A 1VF6C 1Q1BA 5J39A 2F0QA 2KUMA 2KVOA 4KK7A 3CPFA 3ASOB 1PRTF 1O9GA 2C35B 2R7FA 4MYUA 3X3NA 5IGGA 3ZBUA 3OEEA 1F2ZA 4G7XA 1BT8A 1YHQA 3K7AH 2DJGC 3HKCA 3KJOA 2VJIA 4NXMO 3IGAC 3JALA 2F3VA 3HGBA 1U96A 2H3OA 2ZJQA 3H1LH 1KBHA 2WR8A 4IHJB 2YV5A 3AG7A 2DYRC 5JPMC 2JJ1A 3GVLA 3CHBD 3ISXA 4DV2Q 3RUZA 3TS0A 1K34A 1MG1A 1N32O 2EIMB 4NDXA 1PH9A 1GTOA 4EQPA 5IJ0B 3SYOA 2E8GA 3U11A 4YCWA 4JI1L 2VQEQ 3OGIB 2X6WA 1VS0A 1QR8A 2QE7G 4BS9A 4DXWA 4DR4L 1D5ZC 2BA1A 1BVSA 2BE3A 1R9TB 1E79G 2RSNA 4QHYA 3UQ8A 3OW7A 4UVAA 2IU0A 3FB7C 4FM2A 2L15A 4G6IA 5FOBB 3FB8C 1TS2A 2GJPA 1EEID 1I4GA 3ULLA 4RGNA 2GQFA 1NBWA 4JPRA 4RQEA 5M9OA 4QNHB 4ZHQA 5JWPA 2C4TA 2B2WA 4X62Q 3T4ZA 5EBDA 4XLEA 1P49A 1AP5A 3S2HH 2LMCB 4UP9A 1EZ6A 1GKFA 4JC0A 3RBZA 1WN7A 3PENA 4K0KL 3OTOO 1YJNA 4P9SA 4JI2O 1LNQA 1HNWO 1JVMA 2QKCA 4KN4C 2UXBO 2NVTH 1H8HG 5KHIA 4X65B 2Q67A 4O4LB 3CX5F 5CV7A 2QTZA 2EZOA 1L1FA 4GOPB 1SQQH 2M5SA 4LW1A 4G57A 2B2VC 1EFUA 1UD4A 2DIEA 3M3YH 3BYYB 3QOJA 3CRRA 1I5FA 3WBKA 3KCXA 4GLVB 2I5HA 1D2EA 1PKXA 2NVXB 3BU2A 4G1VA 4I55A 1VQ5B 5KIXA 4FO2A 4XYQA 2DE0X 4ZUJA 5CYUA 3ZMZA 4PC6A 1K8GA 2RC6A 4GKKL 1OCCC 1FJGO 2D62A 2KOLA 4C1NK 3SR2C 1VQMV 5HKKA 1XL6A 1QUQB 3D3QA 3NK9A 2R70A 1QVFB 4GX2A 3TJTA 1XNRL 2UXNA 1XPUA 1EM1A 1EUJA 2NV4A 2UXDQ 2RJZA 5F4MA 1WYDA 2ZNIA 5IYBH 3N27A 1Q5OA 4OPAA 2CH7B 3X2QC 4B3RL 1K3EA 4G7ZC 3BCCH 5C0XH 2JVDA 2WAMA 2QA4B 2DY7A 3D4DA 2QDOA 4OPVA 2GK7A 1VQKB 3ER0A 2L5TA 1R6NA 3PIOA 2QWQB 1U4MA 3SPJA 3FKIB 2B63B 2R6HA 2Z4HA 3SKBA 2F4VQ 4HCEA 4JI3B 1W6KA 1GVPA 3GVMA 1TKWB 4LFCB 3K58A 4JI1O 4ID6A 4UCOA 3A8JE 3UCSC 4CS4A 2E5LB 1BR9A 3I3CA 2JQOA 1KKCA 1UJWB 3W5VA 1UMKA 3GIRA 3LNNA 2M9VA 1X59A 1EQRA 4X7CA 3EFXD 3CCRA 5LHY1 4P25A 3J7YW 3SVMA 1QB5D 3CP0A 2QCPX 3WY9A 1E1RG 4WZTA 3ZUGA 3OP1A 2C78A 4CDFC 3K03A 2ZZGA 4Q0FA 2EYMA 4DUYB 4L8JA 3PUYA 1KQSB 2OCEA 5DAUA 3LDDA 1PTOC 1SS3A 3FKIG 5HFLA 4K8ZA 2B63G 4HEDA 2FMMA 3I4NG 1K9MC 2C9OA 4HNAB 2X6YA 4OP7A 1PDQA 1E64A 1XTCD 1G6UA 3QSYA 2ZD9A 1H2KA 3RVZA 3AVXA 1D6EC 1KIXA 2OBTA 1A8PA 4N3GA 1PYBA 1AROP 1VQAA 1RPRA 2YS8A 1BBXC 1NTMH 1D2DA 2CHBD 2F0TA 2DQ0A 2NUCA 3DXRB 3J81E 1AI7A 1SN8A 3WU2Z 1Z7TA 4O4JB 4XDJA 3FKSA 2XNDA 1FNWA 1H2MA 1RF2D 1KUQA 1N34Q 1YITV 2RCFA 4J1MA 4O1NA 4FFBA 3HOUH 1L0YB 3ITPA 3TRZA 4DV5Q 3G4SB 1M90W 3MHPA 2Y48A 2VBUA 3OPOA 1AR1B 1QX4A 1KD1W 5IOCA 4BXXG 4DR3Q 1ZKOA 3D36A 2BE5D 2NNUA 1XNRO 1SKQA 4X66Q 5KA6A 4R8CA 1YHQB 1W2BA 4G5GA 4LF6B 4U3JA 1SRYA 3ETDA 3HKCB 3GD7A 3H15A 1HNZL 3TZUA 4B3RO 3BABA 2ID0A 3JALB 3M4OH 4Z4VA 3NEMA 1TWCB 5FL7G 1KLUD 4DV2O 4WRDA 3P1HA 2OXPA 1EP3B 1XNQQ 1GM5A 5DSZA 2DW4A 1R3KC 1OXSC 2V4DA 5LMUQ 1C7YA 1QUFA 1Y14B 4XN3A 2NTTA 4RHSA 2YU9H 5A9GA 2VQEO 4L5QA 1BCPC 1KDBA 1TS4A 4DNRB 2IJ0A 2QILA 3ZRWA 3K0XA 5I6WA 1N06A 3SJBC 3TP5A 4GN5A 4C3IH 2UUAQ 1XHZA 3ABMB 1K73D 4JOIC 3OEEG 1U4LA 2HHHQ 1YHAA 2OTLV 3EBEA 3M8AA 3KJPA 2AKWB 2MO1A 4TMXA 1NBMG 4LWSA 1G6ZA 1VHEA 4GLAC 4KLKA 1WP7A 1WD1A 2RVLA 1N33Q 1XQBA 1QZGA 3ZC3A 4IFDG 2P5OA 2F23A 1QCBD 4NXMB 2NVYH 2LJ2A 1D8LA 1YI2A 4ZHQB 4OWXB 3ABUA 2JJ1G 3LUTB 2PZUA 3CXCU 1LTTD 5EK0A 4J80A 1NR4A 4JI6B 3MTSA 4GCZA 4O42A 4ZBMA 2R92H 4JYYA 4K35A 3BQJA 1YJNB 3W2HA 4OO1H 3KG2A 1NH2D 4DAYA 3KF6A 2ZXRA 3PUWA 3HG9A 1QGAA 1N32B 3H1HH 1I6HH 2B39A 3NQTA 5KW9A 1YIJV 1LYLA 4HCSA 3KK7A 4NW2A 2XNJA 1BMFA 2VUMH 5J35A 2R9AA 3P20A 1SKYB 1SNQA 4IZ8A 3Q38A 3FAVA 3C3LA 1N07A 3X3MA 1Q6UA 2JA6H 4DR3L 1VMGA 5EQ0A 3SPIA 3RZOH 3TREA 4RO2A 1Q7YD 3O13A 2YWFA 1Y1WH 1EZVH 4DV1L 2EY6A 2UXDO 5CDFA 3UE1A 3CHXA 2KENA 5TSSA 3WG7B 2WSSA 1NI8A 5FLMG 1FL0A 3CQZH 1J8IA 3P30A 3CP1A 5J3OA 1F60A 2QKIC 3B8MA 3S3XA 2PYJA 3J81j 4KJNA 2H1EA 2K1BA 3OTOB 1PA6A 4JI2B 1Y8PB 4B3TQ 1HNWB 1HNZO 1TQOA 4I5SA 4UVCA 5EBCA 2JGDA 4I7AA 4XT1B 2UXBB 1CI3M 4AYBB 3QG5A 4ZKCB 3E86A 1M9NA 3P3NA 2HG5C 4JV5Q 5IYCH 1ESFA 2LQTA 1J5EB 4O4IA 3AMUA 2VB3X 4I65A 1KNAA 5B1OA 4HIMA 4ASUA 1MOFA 1VQOA 2UUCQ 2Q4PA 2AQ1B 4DR1Q 1ESRA 2V31A 1LTRD 1AE2A 3V05A 2R7ZH 1T5XD 2ZXIA 1IKLA 1F4NA 1ENAA 3MXNA 1PH1A 2F93B 1PJ6A 4X7FA 3IJ4A 3GTPB 1HQRD 5AJ3Q 2EIMC 4Z4WA 3CC4A 1K7DA 1FJGB 3DWAA 4A3CH 3QFCA 4PDRA 1EQVA 4TV8A 5B1AC 3AK1A 4GS3A 4EX5A 4NR1A 1DZ1A 1SLJA 3CCRB 2QM8A 4ZGQB 3AQQA 4QVJA 3H3VI 2XIWA 4XQFA 3C46A 1GUWA 3NELA 1K0SA 4AYBG 4YWLA 4A3DH 3ZZ0A 1NRKA 1L8DA 1LM0A 1SYGA 3UO3A 4B7KA 2AZ2A 3L74H 1ENFA 3RYCA 5JOBA 2OQ0A 4LWCA 4CH4A 1G51A 4IO9A 3W7WA 3C1EA 3FB6C 2K04A 4CH3A 2CQOA 2HVJC 4HMIA 4NB5A 4RWUA 3DSQA 4FF1A 1ROPA 3C90A 3TETA 2FTKA 4AYBE 4YIOA 4RKLA 1VMPA 1SQVH 2RHQB 1QBZA 3OZVA 3GTGH 4WFBV 4OOXA 1X3QA 1R5OA 4RFBA 1N34O 1NJIW 4CS3A 4JI1B 4HSPA 1DDIA 2BE5C 4LFAQ 4DV5O 2K5VA 1FR3A 4P3YA 4IFDI 3JSNA 4DR3O 4UB6Z 4FFBB 4IALA 2LW1A 3MMPA 3GTLB 1PMRA 4JBMA 3G6BA 3L73H 3CCLA 4P75A 4JYCA 1MMMA 3S1MH 3JSLA 1TY2A 1HR0L 2NZ1D 4LBZA 2A6HC 1HVXA 1OV9A 4RD6A 4F6EA 2E2DC 1DM0B 1AJQA 3ZMTA 3K7UC 1W2BB 4MHEA 2FYUH 4U3JB 5L3DA 1M90D 4FLVA 5L3FA 1RDPD 2BA0A 1XX8A 2ZE6A 1XNQO 3QO8A 3ND9A 1LTBD 3W5HA 5BSXA 3TXSA 3S15B 3M7GA 3PN1A 4F87A 1BSMA 1K73C 1I3QB 1O7YA 1PH6A 4CJ1B 4WFAV 4IL6Z 4I4TA 1HDJA 3WYAA 2JJQA 3EN2A 2E3CA 1SQFA 3JAWA 1PP9H 2WLIB 5AJ3L 2UUAO 3ABLC 1NMGA 3ZRWB 1EY8A 4H37A 2R93B 1TTTA 2JYOA 2A1AA 4H0LB 4YY3L 3HAGA 5M5XB 1GUTA 2W6JA 1UD3A 5DNFA 4MVQA 4IPDA 4DR7Q 3P75A 2BH2A 1YEZA 1N33O 4IPHA 4PC2A 2PNHA 3RYHA 3W7UA 5TV2A 4A3MH 3FPPA 1XNRB 1A2TA 2F0WA 2R9RB 1O80A 3ONUA 4RAUC 3TMEA 3H01A 4B3RB 1W34A 1PH4A 1OZ0A 4LF7Q 2WZPP 1YI2B 4NVPA 5CN0A 5JQGA 4GZYC 1H38A 2D9RA 3HB3B 1HTLD 4DV2B 5J2UA 3GTMH 2O2LD 2WP8J 1YEWA 2F4NA 1QHTA 2KEDA 4HYOA 2NVQB 3LSQA 1W0KA 2C5HA 1I4QA 5CGKA 1B7YB 4DAYB 1O78A 3KF6B 5BZBA 3IKJA 2VQEB 3W7XA 2R93G 4BY7H 1S5LZ 4E4EA 5FPRA 1Q7YC 3BCDA 3R2IA 4C1NI 4YHBA 2IL8A 4QUFA 2F0PA 3I90A 5FLXc 1O7ZA 3S1QH 3B82A 3OW2B 3JARA 1EWYA 3OKXA 1LABA 3B78A 2EX3A 4GX1A 1N0NA 1K97A 3SDLA 1K0RA 3KLWA 1XMOQ 4JI5L 2OTJV 1YX2A 5CV9A 3AVWA 1PTOH 4Y9RA 5EGTA 1Y8NB 4HTHA 4NB3A 4L6TB 4PGOA 1YHBA 4O2BB 2A0LA 1HR0O 3WB1A 3ZZTA 2V7QA 2Q9LA 2KCNA 2SDFA 1PNLA 4JV5O 4UHVA 1W59A 2H8PC 2F0MA 3CCMA 5IGEA 5HURA 2JGDB 3JD3A 1G8MA 1CNEA 1BMFG 4X05A 1WD0A 2PMZE 2UUCO 4DR1O 3I4MB 4BAYA 2HMAA 4DV3Q 4O4IB 2SEBD 3NTHA 3CRAA 2K75A 4C3HH 2D5DA 1NR1A 4JI4L 4X8AA 2R3ZA 1VF7A 4PDMA 1TA8A 2M7WA 1Y4MA 5BY1A 3DDYA 1MSGA 3K7AB 3QTCA 2Q8VA 4O0AA 2N88A 3AG1C 1LTGD 3MXNB 4A75A 2WSSG 5FO9B 4NYKA 1H8EG 3P32A 5I2YA 3CC4B 4DV4Q 4KTAA 2HJDA 4J7KA 4LFBL 1GM9A 2UXDB 3I73A 4TV8B 2JA7B 4IN3A 3CF5A 1EBOA 3FJOA 5EKIA 2UXCL 4LF4Q 3ABMC 4G7OC 2WWWA 2VBTA 3FX7A 1JNYA 3CC2A 4GKJQ 5H6RA 3L0OA 3HKEB 2KQXA 2E2IB 1L1OC 5LMNL 4OIJA 3I4MG 1YNND 4DUZL 4PC3A 1HNZB 2NPFA 2OIGA 2X53S 4LJZC 1N8RW 3RYCB 5B5EZ 4F7XA 4ASUG 1VF5B 3HKSA 1KP2A 2ZITA 4M1UB 1NVPB 4BW5A 2B2WC 5LBQA 2EJMA 5FO0A 2BDNA 4P6YA 1VHOA 1SE3A 5C0XJ 3L72H 3BA9A 3QVNA 4BY1H 3S2DH 2VNHA 1U97A 3GTQH 5FPOA 1KQSU 2CFMA 1KYOF 2JA7G 2YWGA 2OTLA 3JAMc 1IBML 3FDTA 1PFBA 5LHGA 4NXNL 1W9XA 4O2DA 4X7EA 5EC2C 1ZTEA 3RFRA 2AQ3B 1VQGA 2B9ZA 3L70H 1YJWA 2B5OA 5G3LD 1IL2A 1A3UA 2HQLA 4OX9Q 5KA5A 4X3SA 1Q43A 3VQYA 1EIHA 2IX3A 2NVTB 3V7AA 3CCLB 2EJRA 3FD9A 1SNMA 2K32A 3A0JA 5KNLA 3WG7C 2XGTA 1WORA 1P84F 1AN8A 5M3FB 2PCFB 4DV3L 1B2RA 3T13A 2X8KA 1PH3A 2A5HA 3W5OA 1L2FA 5DN6A 3PIPA 1SQBH 4I4TB 1N34B 3OHXC 1M4VA 3JAWB 4X88A 4A3BB 4JI4O 2QWPB 3K5LA 4DV5B 3AVTA 1BHBA 3ZJYC 2IJHA 3F2CA 4DR7O 4KHZA 1VIBA 2I46A 4DR3B 2QW7A 1VMCA 4GQNA 4LF5Q 3NHHA 3KF8A 4LBVA 1GD7A 3HOZB 1MSWD 2ZTEA 1BXTA 3RYHB 1UE6A 3OT7A 3PUVA 5M3FG 2OF1A 4LF7O 4B3MQ 4K5WA 4EQ5A 4X64Q 2D2CB 4MVZA 3CCQA 2BVNA 1J6QA 1N0VC 3B4SA 2ZDIC 3EFFK 4OGQB 1EP1B 1EY6A 4TMWA 3H0GG 1XNQB 5KNBA 4QGUA 5LMNO 1VF6A 2Q8TA 5LMUB 5JQGB 3JAMN 4FLWA 3GSIA 2EBOA 1M57B 3TGUH 3J7AU 5J2UB 4A3BG 2R61A 5E4WC 2L0CA 1JCKB 1H42A 1EZ8A 4GZRB 5ELEA 2XAJA 5I9PA 4TRDA 1V1OA 1E0BA 4JZ2A 2Z5UA 1Q9SA 3PMFA 3KDFA 1VCIA 2UUAB 2Q8IB 1UEBA 1ZXTA 5AN9A 1TUBA 4X20A 1UD6A 1CA6A 4OPHA 1FFTB 3PCOB 2EXDA 3HOZG 2ADQB 3JD0A 1CEZA 4NXNO 1BX0A 1AEXA 1N33B 3JARB 3U9OA 1JQYD 4DKAC 2PNRC 1SSOA 1R9TH 5E4XA 4FPPA 4BWAA 3L75H 2AWOA 4M0LA 5LYJB 3A56A 2D0OA 2X6BA 4JASA 4A3EB 3K9AA 4PJ0Z 1M1KD 3RD4A 4JYAL 4LBWA 4RCOA 4N21A 3AG4B 2ZXOA 3BY1A 1W0KG 3VQWA 5BR8L 3CPWA 5L3BA 1YNJD 1GUSA 4TSFA 3CCVA 1YXBA 1BE3H 3RW0A 1LT5D 3D36C 2CTPA 3IFDA 4DV3O 3ZS8C 3CCMB 3H1KH 2KHSA 4A76A 4WQMA 2IM9A 3QJYA 3ND8A 1UE5A 1EYCA 5TRDA 5LGUA 1VQ5V 1US6A 2JS5A 1OGJA 3QFTA 3RT3C 1ZLZA 4LF5L 3BZCA 5ITZA 3HFZB 1EWHA 4H44B 5IGBA 1F2MA 3HP3A 4A3EG 1RTNA 1VQ8V 1IZ6A 1YNNC 1WPBA 2WJYA 4PG3A 1VLYA 2HDLA 4B3ML 3AG2B 2E1RA 2DQ3A 2V7QG 1VQBA 1II3A 5AG2A 1WCMB 4H0LC 2LXKA 1HR0B 2ZCEA 4B3TB 3JD1A 3VBBA 1OB5A 3CC2B 3GV6A 1VQKV 3PVDA 1FGBD 1GM7A 4LF9L 4JV5B 3P3PA 1JA1A 3TBIB 1I0HA 5DM6V 2JJ2A 4XQNA 2HT1A 2IBZH 4JAAA 1M5IA 4RHRA 2P4VA 5KHJA 2UUCB 4DR1B 4GLXA 3H6MA 1EY7A 2AUJD 3AEVA 5KUKA 3U50C 2E75B 5KAFZ 5FKAC 1B04A 2MW2B 3SJZA 2D3LA 1WTVA 1B9MA 5M5WB 3FKIH 2B63H 3I4NH 1X55A 2P4KA 5FO7B 5FLXL 1XI1A 1RPOA 4I7ZB 2V7VA 3D8CA 1PJ5A 4WWVA 1FD9A 1WCMG 4OX9O 5BN5A 4X06A 1YJWB 2Q6KA 5ISRA 1OXVA 1PFSA 4JBJA 1WI5A 2BDOA 2CWAA 4JI7Q 2HUGA 1JPXA 3E8BA 5IDJA 4IYHA 2Z9HA 2ZKOA 4PAAA 4GNXA 2WZNA 3PJSK 2M6YA 4EB6A 4NTWA 2F0FA 3DWPA 5B3SB 5E6TA 4P74A 2ZJPA 5BR8O 1QVGA 1IYVA 3TS2A 1VQDA 2PW7A 3ZCCA 5THXA 5C0XI 4ACBA 1N05A 4IGGA 4BXXH 4IYIA 4UCRA 1WFQA 1E1QA 4RWSC 1RFYA 1SESA 5GROA 4QF4A 1ET6A 3RZOB 1GK9A 2JEBI 3ZMVA 3UDXA 4BIUA 3HKDA 4JMQA 2NWGA 4LFAB 2QKSA 2NN4A 2IT1A 4WJ4A 3MCAA 1W2BU 3M99B 3H3VH 3I5DA
chains in the Genus database with same CATH topology
5CV5A 2Z4HA 3ZYYX 5C4HA 4V0BA 2CK3A 4HCEA 1KTKA 4JI3B 2B2TC 1STEA 3AU7A 1SE4A 5IT9E 1W6KA 3DMUA 1CZWA 4FXDA 1TKWB 3M3YB 2WACA 4XLAA 4LFCB 3K58A 2EOTA 1DOKA 5I4DA 4ID6A 2BOSA 2JXMB 4AILC 4UCOA 1PTOF 3A8JE 2F0EA 3OWFA 4G4KA 4CS4A 2EPBA 4IURA 3BDLA 2E5LB 3D8GA 1BR9A 1O7LA 5D5PA 3I3CA 1TWFB 5M5YB 2EVBA 5C6AA 2M9VA 3LNNA 4BBSB 3EFXD 3LX0A 5LHY1 4DF7A 3J7YW 3SVMA 1QB5D 3WB0A 1AZPA 2H4OA 2NN6G 1SYEA 2QCPX 2GV9A 2WKDA 1X4TA 1M4UA 4J6HA 3E22B 4B3GA 1JOQA 2Q7HA 4Y7NB 3ERQA 1QWYA 5C44B 4JI8B 2HDMA 3EQLC 2ZZGA 4HAEA 4Q0FA 2ENBA 2EYMA 4DR4B 4DUYB 4L8JA 2LZJA 4H13C 3PUYA 1HQMC 4PNYA 1M8AA 5DAUA 1PTOC 4WJWA 4K8ZA 4HEDA 2FMMA 4IFDH 2C9OA 1V9PA 4HNAB 3K5OA 1WTHD 3I70A 3N2GB 2X6YA 3T56B 3NTKA 1ENCA 1B44D 1PDQA 3Q24A 1AW7A 4F88A 1I4XA 1XTCD 3TN2A 3PO3B 1G6UA 4LF9B 1FD7D 1K8MA 3NTIA 3JAML 2BTQB 4XLHA 3HKBA 4DXFA 4X66B 1D6EC 1STHA 2B2YA 4ODGA 2TSSA 4CC5A 4R9WA 3NBIA 5JAVA 2Q8RE 1FNUA 1TUBB 3SR1A 5C3EB 4X20B 1I4PA 2L1BA 3IAYA 4BWGB 4CS2A 4KY5A 3SK4A 4E6IA 4U673 1AZQA 1BBXC 3FVQA 4DR7B 1DCZA 2CHBD 5CMDA 1S5JA 2F0TA 4K0KB 2NUCA 3J81E 2A69D 1ONLA 2XHBA 4X1YA 4KKTA 1Z7TA 4O4JB 3VR5A 2F0NA 3FKSA 2XNDA 3V96A 3ICXA 4PHZA 2GK6A 4JK1C 2Q7EA 1FNWA 3RLFA 1RF2D 4XONA 1RD9D 1ZAUA 2TMPA 4WBNA 4YJ2A 2PY5A 1E3ZA 2OEOA 4LF7B 5JVDB 4J1MA 5A35A 3RYIA 4O1NA 4FFBA 1L0YB 1HUMA 4N9PA 2UU9B 3ITPA 4KV6A 4UDUC 4XR6A 1I4HA 1Y8OB 4M8AA 4MIUA 4DAVA 5KYLA 3OPOA 3VQVA 1SJED 3HOWB 5LMNB 5IOCA 2K5DA 2XWJB 5JH7A 1ZKOA 1IW7D 5C0XG 2BE5D 2VQFB 4Q5VA 1GUNA 3R93A 1TVXA 2HHHB 4LF6B 1GHKA 1JFFB 1DOLA 4U3JA 4IUUA 3VA7A 1SNCA 3HKCB 2FINB 3D3RA 5K36H 1B1ZA 4RKBA 4XIGS 3GD7A 4GKKB 3TZUA 4ME5A 3BABA 5CV6A 3A2FA 5KYIA 2ID0A 3JALB 1ZEQX 4TQDA 2EZVA 1Z5VA 5JPNC 1TWCB 3VYSA 4XTCS 1TS5A 1KLUD 3A7AB 4KHVA 2HLDA 2EJFC 1B9NA 5IJ9A 4WRDA 4TV9A 3P1HA 2OXPA 1OHHA 1JB3A 2JGUA 5KHGA 1OXSC 2V4DA 3KLSA 1D2BA 1H9RA 1CHPD 1TIID 4XN3A 2NTTA 3NUCA 4RHSA 1HA6A 4A3IB 5ITZB 1BPLA 1BCPC 1KDBA 3WDNA 1A15A 1TS4A 4DNRB 4LNUB 1SA0A 1D5AA 4I9QA 2IJ0A 2QILA 3QOLA 3K57A 1SJHD 1F77A 3R3OA 5F2DA 4LMQD 3NXWA 2WV6D 5I6WA 3SJBC 3URYA 2DNEA 4EQOA 1TR5A 3TP6A 3TP5A 1S5ED 1XHZA 3I72A 3OIQA 3FMCA 4CGYB 4FM1A 3DM1A 4X1IA 5EYPB 1HRJA 1U4LA 3OE7A 3OFNA 4FXGC 3ZPNA 1W0JA 3ZIAA 4IUQA 2F0VA 2XNAC 4TUYA 4CC6A 3HOUB 5GONA 4PQXA 1SFOB 3CRLC 1G6ZA 1XQ8A 1RSOA 1SAPA 4DK1A 1WD1A 5JJNB 2RVLA 1FFXA 2F0LA 2IWHA 2AWNA 2PUSA 4MN3A 4IFDG 2P5OA 2PO4A 3Q22A 1H9KA 5LP6A 4AQYB 1QCBD 4NXMB 4DV3B 4ZHQB 5CBAE 3DUZA 2GJKA 1LLRD 2MHVA 4NKLA 3L7ZC 2PZUA 1CA5A 3SJCC 1LTTD 4OGQC 1NR4A 2L11A 4JI6B 3R2TA 3MTSA 2KKWA 4O42A 2J7ZA 3VR6A 5LYJA 2XZPA 4XT3B 3EVQA 3M4OB 2NTSA 1FNVA 1C48A 4OO1H 4Z1MA 3J80L 4YHHB 4DAYA 1PZKD 2ZXRA 3PUWA 2ZTGA 1EU4A 4A3MB 1WTOA 1SYDA 3HG9A 5LL6S 1N32B 4FXUA 1WTXA 5FNVA 1RHPA 2B2VA 3G6JB 1EFRA 3VYUA 2B39A 3NQTA 1SNPA 3BVMA 4FXKC 1SNDA 4HCSA 3KK7A 4NW2A 2KVMA 1BCPD 3R8BA 4CBVA 3BH4A 2YU9B 4U68A 1BMFA 1BOSA 3HOXB 2JA8B 5EZYA 4XD7A 3NQIA 2R9AA 1S5FD 1JICA 5FK9C 3P20A 1N36B 2W6IA 2WKCA 1SKYB 1SNQA 4XXEA 5D14A 2EE1A 5IODA 4IZ8A 2KA7A 5CA1B 3Q0AA 3C3LA 3FRPB 3X3MA 2NN6I 4GKJB 1TWAB 5EQ0A 4K6LA 2EYJA 4C3IB 3DHQA 2MGSA 3MFYA 5NUCA 2EY2A 3OWEB 5KX5B 3J7AF 1K28D 5JCOA 2F0SA 1Y1VB 1EU3A 3A8IE 4PI0A 5JEAJ 3BC9A 3O13A 4A3KB 5I6YA 5DM73 4EFBA 2PPBC 3DEPA 2CQAA 2EY6A 4TOIA 5LA6A 5IGCA 4BA1I 5CDFA 3CHXA 1Z6HA 2F0KA 5TSSA 2WSSA 4FF2A 4DXGA 5K36G 1J8IA 1F2LA 3RMHA 1EY0A 4EB6B 4DV6B 2A68C 2RDGA 4UFZA 4CH6A 3SDZA 1SNOA 1SDFA 4FF3A 4FLZA 4RGOS 1OXXK 3GTJB 3JAKB 1O9HA 3CRKC 4YELA 2VWKA 5CBEE 4C3JB 2QKIC 2XVSA 5AFWA 4DGZA 4HSVA 2PYJA 4YXWA 2OYQA 3NBHA 2H1EA 2K1BA 2NVYB 3OIPA 4KJNA 3OTOB 3T4AC 1HW7A 1UEAB 4JI2B 2JSOA 1LT6D 1Y8PB 2RDHA 2EYPA 2QJ1A 1HNWB 1TQOA 2RKSA 1LT3D 3MEHA 5EBCA 4XT1B 2UXBB 4PI2A 1I18A 3OSOA 4K8JA 1CI3M 2KEEA 4DR2B 4AYBB 1BDOA 3HKDB 3QG5A 2YI9A 4ZKCB 5IK2A 4XQQA 2R92B 5J2TB 5T1IA 4CH5A 1WPCA 1ESFA 1MI2A 1PTOB 1J5EB 4O4IA 4ZI7A 3AMUA 2VB3X 4I65A 1KNAA 3PIO3 1KAAA 4ASUA 1V8QA 1I6HB 4OX9B 4TKOB 2AQ1B 4C3IG 3VR4A 4CKEA 2QDBA 3PV0A 1ESRA 3SHLA 4QB4A 2E2HB 2V31A 1CQFA 2Y0SB 4KMUC 1LTRD 1CQVA 3V05A 2DNCA 1ET9A 5JCOC 1T5XD 2ZXIA 1IKLA 2F1MA 1ENAA 2VUMB 4EEQA 3MXNA 2HCCA 5JVH3 2F93B 4F6RA 2XSCA 2F0DA 3GTPB 5COYA 3JASA 3IFTA 4XKVA 1HQRD 5IYZB 3HKZB 2F66C 1Q12A 4H44C 5BN3A 1C8CA 1NSNS 1FJGB 3DWAA 4X3UA 3JAME 1BF4A 4ZKBB 1LTID 1TAEA 1EQVA 4CJ2C 2A6ED 4K8IA 1A6XA 1QNKA 4TV8A 3CP2A 2JA6B 4FF4A 2K05A 4C3JG 5K1PA 1DZ1A 2ZM6B 5JJJB 3T16A 4O4LA 5K1XA 1JC7A 4QCLA 1I8DA 3I91A 2ZIMA 1EY4A 2VNUD 3A54A 5BR8B 1Y1WB 4IUNA 3H09A 2Q0AA 2UUBB 2XIWA 4XQFA 4FP5D 3C46A 1GUWA 2PZTA 3SEBA 3CQZB 4XQJA 2NBFA 1NRKA 1L8DA 3K59A 3TP7A 1H9SA 1SYGA 4OO1G 2R6GA 3QG1A 1ENFA 3MWYW 3RYCA 2F0HA 3BDOA 2PYLA 5JOBA 2EYOA 4CJ0B 5EPKA 1D5XC 2ICIA 3BA8A 3QF7A 4CH4A 2A69C 2SNSA 2PYKA 2XRSD 1HUNA 2A73B 3C1EA 2K04A 4XDXA 4CH3A 3KLRA 1U9RA 1HFNA 3KLSX 2X6GA 4HMIA 4DV0B 3VA5A 3DSQA 4FF1A 3HKBB 1EFID 1F9RA 4LF5B 3SGIA 2XZLA 3A8KE 4H7BA 4ZRZA 1S5CD 4RKLA 1VMPA 3MA2B 5CORA 1SE2A 1DONA 3BCFA 4PMBA 4K14A 3VR2A 1LTAD 3B2EE 2X85A 4NNJA 1X3QA 4ULLA 4KY6A 4RFBA 2BTOA 4CS3A 4JI1B 4HSPA 4LAAA 5C5LA 1WNSA 4DR5B 3OEHA 2DY8A 2Q7GA 3HS0C 3CU7A 5K5PA 2JA5B 1IW7C 2M2LA 1WVLA 2BE5C 4B3MB 4PV1C 4JBWA 4X1YB 4X64B 2R7ZB 1VDZA 2WB1B 3KEWA 3N52A 3H0GB 1FR3A 1K83B 4JI0B 1ICWA 4WBNB 4RH6A 4YJ2B 3UT5A 2K5WA 3JSNA 4IFDI 4DN4M 1CHQD 3RYIB 4FFBB 4EVOA 4IALA 4FVMA 1MD2D 2K7VA 1GOZA 3GTLB 4KN7C 3BVGA 1PMRA 1D1IA 4Z9CB 2E1BA 2F95B 1UD8A 4DU9A 1NAPA 1EOTA 2G9DA 3QO2A 2K6AA 3JSLA 5JH7B 1TY2A 2FMCA 2NZ1D 2A6HC 1VF5C 1HVXA 2ZNJA 2E2DC 3PUXA 3D4WA 1DM0B 3C2PA 1G291 3BVZA 3S1NB 4MHEA 1PKVA 5I9OA 3J7AV 2ZXPA 4U3JB 2PGGA 4FLVA 1HFGA 1H9MA 4CHTB 4A3DB 1RDPD 3S17B 5KEEA 2BA0A 1XX8A 3NWTA 4DV1B 1PRTB 3ND9A 1XXGA 1F9QA 1LTBD 5CC4A 4S3SA 1EL0A 5BMVA 1MGSA 1HZEA 3S15B 3GVJA 1KNEA 3M7GA 3PN1A 2K33A 4F87A 5IJ9B 3Q6SA 4IIJA 4TV9B 5JJEB 1I3QB <