1T5EA

The structure of mexa
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
231
structure length
231
Chain Sequence
TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the periplasmic component of a bacterial drug efflux pump
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Multidrug resistance protein mexA
total genus 61
structure length 231
sequence length 231
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1t5eA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1t5eA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5eA02
4HR7B 5JJNB 2K7VA 2O5IC 4OGQC 1H9KA 1LABA 4PV1C 3N6RA 3I4LA 1IYUA 1TKWB 3BRCA 2QF7A 1Q1BA 1Z6HA 1K8OA 4BA1I 2D5DA 5BN3A 2A68D 2A69C 2PNRC 4KN7C 3M85A 4LK1C 3IFTA 3WB2A 3FPPA 3GQBA 1GHKA 3PUYA 5A35A 1DD2A 2BE5C 3OOCA 1VDZA 4GZYC 2A6HD 3WDNA 2AUJD 3VR5A 3QG1A 4DK0A 1GUGA 2DNEA 2DNCA 1K8MA 3OW7A 1HTPA 1IYVA 3VR6A 2NN6G 4JK1C 3SDZA 1TU2B 3FMCA 3QIAA 1OXUA 2DN8A 3ND8A 3M7NA 2A68C 2F95B 1O78A 2K33A 1T5EA 3VA7A 2F93B 2ZT9C 4KI0A 2D2CC 1BDOA 5JEAG 4XTCS 4IQZA 4H13C 1IW7C 2A6ED 1DCZA 3SE0A 4L8JA 1HCZA 1GJXA 5JJEB 3L7ZC 4KMUC 2EJMA 4KKUA 4KHZA 2Q8IB 1V8QA 1OXSC 3A8JE 1B9MA 1E2WA 1E2ZA 3KLRA 5K36H 3CRKC 5D5QA 1GHJA 1HPCA 3AB9A 2K32A 3PUVA 1A6XA 4DK1A 1IW7D 2A6EC 4IFDH 2O5JC 1Q12A 1ONLA 2BA1A 2IT1A 2EVBA 2BE5D 3CRLC 1YNJC 3HGBA 3GD7A 3QJYA 4H44C 5BN4A 5C0XG 3NE5B 2A69D 1Y8NB 4KN4C 5K36G 3OPOA 1Y8PB 1FYCA 4KKTA 1CTMA 1GUOA 1ZKOA 3BDOA 1CFMA 4G7HC 2EDGA 2R6GA 3BG3A 2AWOA 2A6HC 3U9SA 2JEAI 3PUZA 1RSOA 4BA2I 1H9MA 3LNNA 1DXMA 1FR3A 1ZYRC 1V43A 3PV0A 2L5TA 1H9RA 1VF5C 3A8KE 3A7LA 1I6VC 3TZUA 3T56B 1G291 4I7ZC 1GUTA 1HQMC 2JEBI 3VR4A 1VF7A 3DXJC 1OXXK 3VR2A 1Y8OB 1H2SB 4TQUS 1H9SB 2EJGC 3H94A 3A8IE 5KNCA 3WB1A 3D31A 1QJOA 2B8GA 1Q1EA 1VCIA 1Y69U 3W3AA 2E75C 1OXVA 1LACA 3PUWA 5KNDA 2E74C 1O7LA 2LMCB 3T51B 1GUNA 5C0XH 2BDOA 3T53B 1SMYC 2CW0C 4LJZC 1YNNC 4H0LC 4OO1G 2YYZA 4XIGS 4G7ZC 2AUKA 2KA7A 1Q90A 1H9JA 5BN5A 5JEAH 4IFDG 4RCNA 2EJFC 4DNRB 1Z7TA 3EQLC 4GYCB 3RLFA 2E76C 3I73A 3I72A 1EWHA 2JE6I 1PMRA 1E2VA 1H9SA 3D4RA 3M4YA 2NN6H 2PCFB 3MXUA 3ND9A 3PUXA 4G7OC 1B9NA 2F1MA 3VR3A 2D62A 4DNTB 5D5PA 3MFYA 2B8FA 2BA0A 3LWUA 4TKOB 1OXTA 4JBWA 4KKSA 1GUSA 2PPBC 2JXMB 3P20A 3WB0A 2NN6I 3A7AB 5KNBA 5JJJB 4OO1H 1CI3M 2KCCA 2V4DA 3IKJA
chains in the Genus database with same CATH superfamily
3SK8A 1ZLZA 1Z5WA 2ARHA 2YIAA 1IJEA 1N34L 3ZN0A 3K81C 2ZE8A 3I4LA 4DRXB 2IW3A 2RHSB 1NDHA 3ISXA 1PFNA 2QTOA 2V1CC 3GVMA 4LK1C 1ROPA 2IU0A 4JI3B 1LV9A 1VJSA 4CH4A 2ZTDA 4LF7Q 1BR9A 1HNZO 1DTOA 1TY2A 4IPDA 3U4VA 2DW4A 3NQIA 2GK6A 4DV7B 5B1OA 1FRNA 4GNXC 2F0KA 1VQ7V 4LF5Q 1YTFD 1EBOA 5B1BC 5H6QA 3SDZA 1PH5A 1WI5A 3H9VA 1VQGA 1QH0A 3T4AC 5IT9N 1JWUD 1FXHA 1KABA 1T5EA 4DU9A 1A62A 1HR0Q 5GV8A 4QIWB 4XLEA 2DJFC 4YJ2A 4IQZA 3L75H 1VQ8V 4ZCMA 3CPXA 2ASBA 1GJXA 2C5HA 3CCJV 3WNCA 2K5NA 5GADC 1T6YA 3ABUA 4AQYB 3LVBA 3RNUA 2R6HA 1K8AW 5JBQA 3CRKC 4LF8B 4FJCC 1CKNB 1X56A 4YIJA 2QDOA 4FLUA 1ESFA 4CKBA 2HFEC 4XOTA 5HZBA 3QJYA 1IHMA 1COWA 1HFGA 4A3JB 1Y0RA 1SR3A 3S24A 2ZTNA 5IWAQ 4X8AA 2RDCA 2A73B 4C3JH 2JA8G 3K80C 1QVGA 2LFSA 4I5SA 3N2KB 1QU7A 2N78A 5EBDA 3UDGA 5IP7G 3PF4A 1NE3A 4H7BA 4YJ3B 1QVGB 2M5SA 3RYHB 4HIZA 4IYIA 3SJAC 2EZOA 4PA3A 4RJLA 2K5WA 4CHTB 5F2DA 1I08A 4K5XA 2PW7A 4N23A 1AB3A 1A15A 5KHGA 2CF4A 1Q8IA 3FYIB 1GAQA 1SFOH 4DV4L 4LBZA 2Z0SA 4EB6A 4GKJO 1VQJA 2HIXA 3ZJYC 2AMCB 2NZHA 4NDXA 3T1YQ 1XPOA 4AF7A 2BSAA 4YWKA 3E35A 3T1CA 1Y14B 3MCAA 1PHJA 4LFCL 1PFBA 1TT2A 3CCRB 4RGTA 3CC7A 2HT1A 2Z8LA 4JGSA 5L46A 1UMKA 5J2UB 1G8ZD 1RCVD 3AG4B 3I3CA 1ZL8B 1KDCA 4JBMA 4NPSA 3E86A 3RZOB 2ZBUA 4P71A 1RQRA 4LF7B 4Y52H 3CB2A 2NN6H 2RKSA 2JN9A 1NB9A 2FHTA 5K5PA 1Z5VA 2ETNA 2LFNA 4P30A 1B53A 1UEAB 3A0BZ 3F2UA 2JA5B 4DR7O 2UUAB 2JA6H 4XN0A 2JN4A 1MZFA 3STBD 4RUFA 2VQFO 4OX9O 1EQRA 2QKIC 3HOVB 4Q6GA 1J6QA 3AQQA 1LTAD 3QE2A 5EC1C 2BM1A 1WCMG 3E22A 1FGUA 5KLVH 3JC66 4I50B 4DGZA 4TV9A 3A7AB 3T1YL 2QE7A 5CBAE 4R6ZA 1Q86D 1PYSB 3W1BA 1QVCA 5KNBA 2EX3A 4DV4B 1XOUA 4DV4Q 2QN6A 2CC2A 3C3TA 2Y0SB 1BF4A 4XDXA 3A74A 1QVFB 2NPFA 1ZM2A 4JAAA 1PTOH 5E7NA 1W35A 1EN4A 4FPPA 2UXDB 4ZOLB 4DV5L 1QNKA 3NTKA 5EZYA 3VBBA 4WFHA 1NTGA 4NKGB 1M57B 2RDFA 1IKMA 1UNSA 4KN7C 3CCUA 4LF6O 4ZOLA 5IT9E 2YU9B 4UCTA 4WZTA 2XRQD 4RD2A 1PNKA 2M00A 4JPBW 4RGMA 2ZDIA 2IL8A 2XZPA 4X66L 4A3GH 4GZYC 1WU8A 3LO8A 4U3JA 4JI4O 2WLIB 4DKAC 3CCMB 4JI0Q 1DZ1A 5LMUB 2EIJC 4B3MQ 1NKDA 5EIBC 1JA0A 3HOVG 2ZZGA 5C0XI 4A76A 3K9AA 1P49A 5IJ0A 3V76A 4DV0Q 3UE0A 5KX5B 1ZTEA 5LOVA 3J81E 5LMNO 3CRCA 1SYBA 1BQQT 1N8RC 3T4DA 1X59A 2X6XA 1N0NA 1X4TA 4X65L 2X6LA 3W2HA 4O2DA 5C0XJ 1CPYA 4N3GA 4O4HA 3SE0A 1KC8D 3BVMA 3BFRA 2D9RA 2YWGA 3DWPA 4QGUA 4PZ8A 4HCSA 3SPHA 3CE2A 2QA4V 2EJMA 5BY1A 4EVOA 4M1UB 1EP3B 2P7TC 4TSSA 5CB4A 3KJPA 3ZHVA 3DC6A 4O4HB 1G51A 2QA4A 1WD0A 3CCJB 3I56V 3S1MH 3ZBHA 2W6IG 4BW5A 2QEXB 1IYJB 4LBEC 1GHJA 3HKSA 5D3DA 1EN6A 1AZQA 3SJBC 2Z6BA 3N2GB 4PDMA 4E2LA 1VQOV 4J80A 5IT9c 2DUDA 2QEXA 4DUYL 4NMZA 3HOXB 2FKXA 2QTSA 4DR2O 2UUCL 3WXMA 1D5NA 3T1HB 3HOUG 3M7GA 5AN9A 3BCCH 1FAFA 5ELFA 4K14A 1Q6IA 4MTXA 1J9ZA 4AVZA 1JE4A 3B8MA 4R1JA 3LUTB 3J81i 1Q86W 1FJGL 1DXMA 1UPGA 1VQLB 3UQ8A 1HR0W 1YJ9B 1VIBA 2RQ6A 1SE8A 3U6BA 1MD2D 1HVXA 1STAA 4JYAB 1XJVA 1GUTA 3W2GA 1MSHA 1GM7A 2ITDC 2GVAA 4IGGA 4Y7NH 4WCEV 1OXXK 2BH8A 5EPLA 2FXQA 4DFAA 4AQYQ 1ASZA 2EJGC 1OCRC 4DR3O 2AW9A 4TMTA 1L0YB 3G7LA 3MXNB 5JVDA 1J5EO 1L1OC 3ZPNA 4ZRZA 5IGGA 3W3AA 4ZYSA 1J95A 3BDLA 1NRKA 1R5BA 3MHSC 4CJ2C 4O4LA 4UY8C 1HDJA 2K03A 4X7DA 1A3UA 2HLDG 1Z9FA 3TXQA 1YDXA 3HKCA 4WFBV 2VL6A 5E4WC 3GTPB 5FLMG 1X65A 1X3PA 1E62A 3OGCC 1XNRO 1FNDA 4DNRB 3PF5A 1OHHG 1YZBA 4K0KO 3RLFA 5FLXE 4A75A 3W2EA 4DV7Q 3ULJA 4WRDA 2HVKC 1VQDA 3NUCA 1VQKB 1PYWD 1KMHA 3RZDB 4JI7O 5F4OA 2N88A 1VQ8B 2GN5A 1M56C 5L3DA 3HFZB 1GVHA 2XZOA 4LFAO 4X07A 4DXWA 2F0WA 4JI0B 4YAWA 2F4VQ 1FJGO 3PIP3 3I56A 3A8KA 4JF3A 5H5NA 4BWAA 3CU7A 4RKBA 4EFBA 3DDYA 5HXBA 4XKWA 4I4TB 1GUSA 5LHIA 1I4RA 4UCUA 1SE3A 4RHSA 3A5UA 2PI5A 4J0QA 5JJJB 1B3QA 5LP6B 5IYCH 1VQNB 1HZBA 2PZUA 4XMYA 5J2TB 3WYAA 3CMAA 2YEVA 5LXTB 3ZZTA 3W5HA 1WTXA 1NTZH 4UP8A 2L0CA 3QFCA 2E2JB 1GO3F 1YI2B 1Y76A 4C3HG 3TS2A 2HCJB 3GTGB 1KIXA 1K5SA 2JA5H 1JFFA 1Q6HA 3L70H 3W5UA 3P30A 5JAVA 1GM8A 1W2BB 2X6WA 1L1OB 3OD4A 1PP9H 1EFUA 2EYPA 3UCSC 1UD2A 2ITCC 3ABMC 1FDRA 3LWEA 5M5YH 1W0KA 4CKCA 3F2DA 3HOZB 1Z47A 1IJFA 3AGQA 1L1OA 1G7TA 4LAAA 2WLNA 5C5LA 4IYHA 4HE5A 5JJIA 5LGNA 1QBZA 1S4MA 4OWXB 1EFWA 2B63G 5BR8O 3U50C 4Y9UA 5FNZA 3HOUH 4LBYA 2LGWA 4UZUA 3G6EB 1K0SA 4QL5A 3A8TA 4II3A 1WVLA 2PF4E 3ITPA 4RM0A 1XPRA 1JCHA 3GVLA 2X53S 3PN1A 1YJWB 1SFOB 1DARA 3LX0A 1STEA 1I7PA 1AR4A 2XZLA 2J7ZA 2Q8IB 5DLQE 2GUZA 4U3FH 4A3BH 1HH2P 1JQYD 1PRTC 2EXDA 4DV1Q 5B3SB 3TRZA 3KLRA 2C2AA 1PL4A 4DUZB 2ZZEA 1KQSB 3GTLB 2K5QA 4R8CA 3PO2H 5BMVB 3PUVA 4X64B 4XR6A 2A06H 4H44C 1S0VA 1XNRQ 1LLRD 3ER0A 2IHEA 1I4GA 1VQIA 1N0UA 1YZ6A 5AFWA 3T1YO 1SLJA 5I2XA 3S9WA 4LFBL 3VQWA 1PDQA 2CH7B 3IC7A 1ZKOA 4II2A 4RG1A 3TS0A 1V1PA 3P26A 2L9HA 2MQHA 1VMGA 3TGUH 3GSIA 2YTYA 1JT8A 1RSOA 4K3AA 3OSOA 3CRRA 2OYNA 4F7XA 4LFAQ 3A7LA 4H44B 3W7UA 5B6IA 4K8IA 2Q0OC 1VQFA 2JEBI 3VOUA 3CPWB 3FKSA 5FLXL 4MVMA 3ABLC 4G1VA 4LFCQ 4S3SA 3ZIAA 4X06A 5C8YB 4IOCA 4RDLA 4HSPA 3RN5A 3PMFA 2EIMC 4DV5B 1BT8A 2NNUA 1JR9A 1AROP 2C4UA 4F8MA 4XKVA 2IX3A 1GUNA 2MFIA 3HS0C 1I5YA 3T53B 2CWPA 1STHA 2GTSA 2QKAA 4N21A 3ZC3A 4YCUA 3F2CA 2CQAA 3R93A 2I1LA 2QW7A 3BH4A 2AQ1B 1FD9A 3GTGH 2IPKD 3HB3B 5I2YA 1QB5D 4X20B 1ORQC 3J80E 1SQFA 2OWOA 4A3JG 3STZC 1EY7A 3CD6B 4WFEA 2IM9A 3ERSX 4F7DA 5HKKA 4X62L 3T4ZA 5HURA 4B3TL 2WJYA 3W7TA 4DW0A 4LF9L 3AG7A 1XTCD 2HHHQ 1YJWV 4K1XA 3F2BA 4AQYL 2RNBA 3UT5A 2CGNA 3JARA 1YJ9V 1XNQO 1KK2A 1R5NA 3JATB 3R3OA 5A2QL 1XNQL 3IGAC 1DK1A 1TTTA 4IFDI 4PC2A 2XOKA 3SKBA 1PJ7A 5FNVA 4DR7B 5M5WH 5EC2C 4YXWG 1LT5D 4G6IA 2N3SA 4P6VF 4M0LA 3AFPA 3I4OA 1BMFA 1Q7YW 4HJ9A 2W6JG 3SPGA 2F66C 1QFYA 4KUMA 1JMKC 2JEXA 2R92G 4DV7O 4YWLA 4LUZA 2F0TA 1WOPA 1GRJA 1GOZA 2GVBA 3FRPB 4A93B 1LR1A 1P16A 3GTKH 1AR1B 1OGIA 1SKYB 3N6RA 1K97A 4CDDC 1VF6C 4G27B 1SNCA 2JVDA 1QUFA 1IDSA 4C2MB 2LY7A 1ZXTA 3IC9A 1TS2A 4FF1A 4MVZA 3MC0B 2UXDO 3A54A 1EYCA 1MHWC 2WZPP 2HQLA 3ASNC 4CH3A 2BE5C 3J7YW 2R93G 1TWAH 5EIBD 5FO1A 5IY5C 3H15A 2AUJD 4ZKCB 1F23A 2NVQH 1GVPA 4IHJB 2MPMA 1NI8A 2B2UC 4UHVA 2P4VA 4TV8A 5JOBA 3VR6A 4DAYA 5ISRA 1PA6A 3HKEB 4GKKQ 2ZM6B 1PZID 1N34B 1Y67A 4OPHA 1TU2B 3K57A 4DUZQ 1OXUA 4BY7H 2XRSD 3CCVV 4PA6A 5DEHA 3I55B 3F5TA 4DQKA 4TV8B 1KDBA 4DAYB 1PH8A 3ZBUA 1O78A 2NVYH 3ASNB 2BTQB 4WBNB 4GQNA 3BJUA 1PYBA 4MHEA 4OONA 3CC4B 5JEAG 3DWQA 2OK7A 1IHZA 3JAKB 4N8FA 4BBRB 1Y1WH 1JMCA 3D8GA 1JR0D 2N05A 3AGPA 5ELEA 3APQA 3K59A 5CV8A 1BL8A 3THOA 2D3OW 2EYFA 4RGOS 1NCVA 4Z4UA 1SNDA 1B06A 2EIXA 1BOSA 3QFRA 5EPKA 1YNJD 1P84F 1TQOA 1QUQA 4GKJQ 4X88A 1TUBA 4E4EA 3MDSA 3NSWA 1ASYA 5DNFA 2HQEA 4JI1L 2FYUH 4X89A 2ZE7A 4X62B 1IW7D 3LSQA 5C4JH 2VQEB 4EFEA 4LFBB 3MAQA 1EY4A 1N9WA 1FNCA 5LL6X 2PYLA 4FLTA 1KLUD 1VQ4V 3C90A 2K4KA 2K52A 4B7EA 4TV9B 1NR4A 1ICFB 3JU4A 4KY7A 2GDSA 4IO9A 3PUNA 4U673 1ENFA 2EILB 2IH3C 5ITZB 3SLNA 2MO0A 4IPCA 1CZGA 1THZA 1FR3A 1ZYRC 5FIUA 4YHHB 1CQVA 1HNXO 1ICWA 4IPGA 3JD3A 4LC0A 2EY2A 2VZLA 3WQZA 1SQBH 2YS8A 2K04A 3R6JA 5IODA 2UU9B 3I8ZA 4TQFA 2ZXWC 1XMOB 2VBUA 1TAEA 3AG2B 3K0GA 4DR1B 1BS3A 1HUMA 1WCMH 3OEEA 3KF6B 1E79A 4QVJA 5LP6C 2O2LD 4PA9A 3KEWA 3K0YA 3E0EA 2OIEA 3A8IE 4PZ6A 1LT4D 3M4OB 3TBIB 3DLLA 3D31A 4CC6A 4RDKA 4OOVA 4LF7O 1I4XA 3IJ4A 3OUFA 3RYIB 1JNYA 4RLZA 4LNQA 3HOYH 2EBOA 3CX5F 5JH7B 3HOYG 3PO3H 4OOXA 2Q6OA 1YITB 3HKZB 3EBEA 4GT1A 1S40A 3GTLH 2J0TD 1YLOA 1YNNC 4QVAA 4DV2L 4K8XA 5LMZA 2BSKA 1D1IA 3STBC 1GD7A 1TWCB 2DY8A 5B1NA 4QV2A 1MSWD 3NQTA 2K01A 1IBMO 1KP2A 4GYCB 4J6HA 2EYOA 4LWSB 1Q6UA 4I0XA 4LP8A 4NBSA 2Z6KA 4YXWA 5CDFA 2KHJA 2R61A 2JE6I 3JAML 4FFBA 1VQ6A 2EJRA 1YIJV 4RO2A 1I4HA 1UD5A 2ICEC 2FINB 4K0KB 1AP6A 4XONA 2Q5ZA 2F43A 3N52A 5M3FB 2DQ0A 2WLLA 4DV3O 4LF9B 2BN4A 3JD4A 3ULLA 4M53A 2EFGA 2YV5A 3CCQB 1KAWA 4LWCA 4C1NI 1KL9A 2R7ZB 1KB9F 3N2GA 4OP7A 4E6IA 3AMUA 1AJNA 2NVXB 1HZAA 2F0UA 4LF6B 1G91A 4Z2WA 3SPJA 2QR4A 4HMIA 4JI7L 4RCYA 4OO1H 3A8IA 1MNGA 5LHHA 3BCFA 3E20A 3C3LA 4GX5A 1VHEA 4JI4B 4NXNQ 2E2JH 3FYEB 2XUMA 1AI5A 3R66A 3BCDA 3WY9A 1BKBA 1EY8A 1QG7A 3KK7A 3R2IA 1EM1A 3HOWH 4B48A 3KJOA 3GTPH 4JYBA 2DEUA 1TKWB 2KKWA 2PQAB 1CNEA 1Y4MA 1Y1VB 3CCUV 3ERQA 3H3VH 1AVMA 2CW5A 3RZDH 4BIOA 2A69C 1QR8A 1V9PA 5M3MG 4BXXG 3SYOA 4EKWA 3JAMc 4PJ0Z 1HNXL 1M4UA 2B2VA 1Q8KA 4A4IA 5IWAO 2HDMA 4CJ0B 2MO1A 4XQJA 1H8HG 4ZV4A 2UXNA 1R73A 2PTMA 2QSAA 1E1RG 2IWHA 1LNQA 4L5SA 1XL4A 4GOPC 2Q68A 4Y7NB 2V7TA 1ET9A 3OW2U 2SNSA 2IHFA 3D3QA 1JB7A 1HNWO 3A55A 1A8PA 2BF4A 3PO2G 3E9IA 1PXUA 1BHBA 4LNUB 3EVKA 3N27A 1BMFG 2UU9L 4H13C 3I56B 1JWMD 3G71V 1B1ZA 1D5AA 2Q8TA 1AR5A 3K9SA 4FLXA 2G38A 2ZIMA 1R5OA 4OPVA 4PGOA 4R50A 1N8RW 1WFQA 4QUCA 3DXRA 4DV0B 2CE4A 3ETEA 4OGQB 4V0BA 4YCWA 2IU3A 5IY0A 3BY6A 4I9WA 5K36H 4XQNA 3OWFA 5FOBB 1BE3H 1DDIA 4XLCA 2QM8A 3OT7A 2QDXA 4PDLA 5M3MH 3CMAB 4BXXH 3BAAA 4RPDA 2LGQA 3JCZA 1Q12A 1BX0A 1TWAB 1XE1A 4X66Q 2NVQB 1GN3A 2XT9A 1CM9A 3OYYA 1VQHA 2ICIA 1GUOA 3SPIA 4PI2A 4MN3A 1I94L 4P25A 2NTTA 2KUMA 4ABMA 1KK1A 1YJNB 2WA3A 5DS0A 1D6EC 1MBYA 1RHPA 1U5KA 2V1DA 3PJSK 4J7ZA 5HZAA 3CCMV 4DV0L 2RBMA 2VNIA 2JP1A 3C3SA 1F9QA 3JALB 2UXCB 3LGJA 5C3WA 1OO9B 1YI2A 1WTWA 2CCZA 4OX9Q 3M4QA 4FF2A 1XNRB 3ZUGA 5CGKA 1QVFU 1PNLA 4DV6L 4X1YA 3E1YE 1F9PA 3PGZA 4TMVA 4J7KA 2R93B 2HKOA 3DM1A 3FKIG 3OHXC 1II3A 1VCIA 2Q6LA 3SLDA 1WOCA 1XTDA 5IGCA 4GKJL 4RFBA 2RSOA 2C9OA 1VQ6V 3J81j 1E43A 1PH9A 3L73H 3AEVA 1EY9A 2RQXA 4O42A 4UPAA 2E5LL 1SMYC 2XAQA 3BPZA 1ZUQA 5IGFA 1Q3LA 1YJWA 2JA7H 1FJGB 2JYOA 4D7TA 4GOPA 2A79B 4X62Q 2OYQA 4QE9A 1D5ZC 1FNVA 1PLFA 5CN0A 3DHQA 3KBGA 3NTIA 3NXWA 1I5XA 3OJWA 3CESA 1JC7A 2TMPA 3AU7A 5C6AA 2BGJA 1KQSA 1SQVH 1FNMA 3S1RH 2R7DA 1QVFA 2F0DA 3WNDA 1TS4A 2Q2UA 3H3VC 1C4QA 2DY7A 1XYIA 2BV3A 2KG7B 4GCZA 2AZ0A 1K7DA 2EQSA 1AI4A 3RYFA 1ZM9A 4JBKA 3CP1A 5IP9G 3RBZA 1EWYA 3TMEA 3IAYA 2RC5A 5DM73 2G9DA 1EIYB 3ML0A 1TWFH 1WN7A 2BA0A 2FMMA 1R6NA 3ETGA 5BMVA 1QZGA 1FXKB 4GX0A 3VNVA 2FFKB 2SOBA 2D0PA 1C8CA 1IKLA 3E9HA 3RYCA 3B09A 5LA6A 2JEUA 3R6KA 1GN2A 2PNHA 1KQSU 1SA0B 3S1MB 3AG4C 4A3BG 4JI2O 3U11A 1L2FA 1H2GA 3CS5A 4XDKA 2BM0A 2N55A 3E89A 1KBHA 5AJ3L 1CK1A 5I9OA 5GROA 4DR6B 1N32O 3LQEA 2QILA 1VQ9V 2GJPA 4ZBMA 4DA2A 3K08A 4DXGA 4UCVA 3ASQA 5ELOA 4CDCC 4Z9CB 2RA4A 5C4JB 1JOOA 4MTGA 5H59A 4A3EG 3M8AA 3U10A 4G7WA 1B4OA 2I0QA 5IYZB 1KKDA 4WQMA 3BA9A 1M56B 2AGAA 4DUYO 1AMOA 3M9BA 1IXBA 3PUYA 5IOCA 1E79G 2E2IH 2ZL6A 5KEEA 5IP9H 4B3SO 4HIMA 2DYSC 4V190 1E3XA 4F6RB 1SS3A 2DWDC 2UXDL 2VBSA 3CEIA 1LT3D 4DR7Q 2OT5A 4EX5A 3VYTA 4WZEA 4KFMA 4PMCA 1AW7A 1PNMA 4F6RA 2VBVA 1XX8A 3JSNA 1S0UA 1E24A 4YIOA 4FM0A 2WSSG 1GAXA 1N34O 3ASSA 2LFRA 3T1YB 2F23A 1SAPA 4QY7A 1BGYH 1ENVA 4I65A 1HNZQ 1WNSA 1LTRD 3RY8A 1L8DA 1SRYA 3Q4HB 3CRMA 4IIJA 1VLYA 3B40A 4KKUA 1B7YB 2WINB 4K6LA 2BE3A 4YAFA 4NTXA 4YY3B 1YIJB 3SHLA 5IGEA 2UUCQ 1N32L 1EZVH 4B3RO 4YJ3A 4JCVE 3IL8A 2JGUA 4H0LB 1WPBA 3RW0A 1QOHA 2DQ3A 1OZ0A 2ZTCA 1EY6A 1B50A 3TETA 3FB5C 1SBBB 2VNUD 2JGDA 3OEHG 4ZKBB 1KU9A 4JMQA 1JQ0A 1F2ZA 4BPRA 2A69D 4J15A 4RAIA 1HNWQ 3UKMA 4FZ1A 1S76D 2QCPX 2VQEO 4LFBO 1YEZA 2EDGA 1TWFB 4EB6B 4U9UA 1XFOA 4TMZA 2D3NA 2ILMA 3DSQA 3OMIB 3H9NA 4TN1A 1AP5A 2ZJRA 3T56B 1KC8W 1X3EA 4FLVA 1Y74B 2V7WA 1A3TA 1MIUA 3W5OA 2YIBA 3QR8A 1CA5A 3VR4A 2W0XA 1G7CA 1M4VA 2ODMA 4JYCA 3MZ5A 1ZM3A 2LS01 5KHKA 3LDDA 1NMGA 2QGQA 1SJED 4PABA 4UB6Z 3WB1A 4XDJA 2B8GA 1R3JC 2GV9A 5L3GA 2DYRC 3JQRA 4HMJA 4DV3Q 2B2TC 3F1ZA 3PUWA 1VF6A 4DV1L 3FFQA 2OTLV 1XXGA 4FFKA 5JQGA 2WLMA 2P6JA 4U7NA 3STLC 1AE3A 2ID0A 3CC7B 2A74C 3T51B 4BW9A 1MOFA 2B2YA 3K7UC 4HYOA 3CCRA 4IOAA 3BNWA 4I4TA 5KUMA 2A19A 2ZXIA 4EEQA 1K9MD 5L3FA 1XHZA 2Y4UA 1SZXA 1ZL8A 2GK7A 2B1IA 4O4IB 3UO3A 2WB1G 1R9TH 4RAUC 3WG7B 1TUBB 4LFBQ 2EXZA 3HKDA 3PUMA 1YHAA 1E63A 2QJ1A 3BZKA 3S16H 3CHXA 3EFFK 4AHCA 3GWKC 4M1KA 1BXTA 1JPXA 2VJIA 1YNND 3ZX6A 3G71B 5FJ8G 2SDFA 3CMEV 2F0PA 5JJZA 5C4HA 4K5VA 1S4ZA 3O13A 2NN4A 5COYA 4CGYB 5CV9A 2QWQB 4X7CA 1J9OA 1BSMA 2ZZFA 1BBWA 4X9QA 2R9VA 4P2NA 4A3CH 2PPBC 2L4NA 2GJRA 1W6KA 2HVJC 4UZEA 2MUYA 3CC7V 3K5MA 4TWKA 1U2RA 3WB0A 2DIEA 1C7YA 2WYRA 3NPPA 4MW8A 4FLWA 2KCCA 4A3KH 3A8JA 1CQFA 2AHOA 3ABTA 1FVIA 4TT3G 1DDGA 3OP1A 1JE5A 4HR7B 5JJNB 1K34A 1OCZB 4DW1A 2K7VA 1Q7YC 4L87A 1N36O 2E1RA 4Q7JB 3CCUB 3RD4A 2QTZA 3VMFA 5IDJA 3KCXA 2YUAA 5IJ0B 4NP5A 5K1PA 2P5ZX 3KF6A 1F9SA 3IFDA 2MGSA 3GB7C 2OCCB 3CCMA 2UUAQ 3DTUB 3I55V 1JOKA 1Q81W 2EIMB 3GP7A 2DNCA 4XT3B 1K8MA 4NXNO 2VQEQ 3I4MH 4FF4A 4WJWA 2H8PC 1QGYA 3GIRA 4FWTA 4RD3A 4QB4A 2C78A 1WJJA 1NQTA 2RSNA 3QIAA 1VQ6B 1SXTA 1NBMG 2Z6BD 1GAWA 4GN4B 3M7NA 4A3CG 2A68C 4ZK9B 1UD3A 1K4DC 2BCOA 1NH2D 2OBTA 2K33A 4J8QA 3TZDA 2ADQB 2HMAA 2R7FA 2VB2X 3V96A 2F93B 4FXGC 2N8NA 2AQ2B 3AVTA 1V55B 2P4KA 1WTHA 1STGA 4XTCS 4Z4TA 2FX3A 4MYTA 5BZBA 5IGBA 1RSOB 4Q20A 4X1IB 5CB4B 1HNWB 1MMMA 4DO2A 2QA4B 4FNFA 3I4NH 4ZGNB 3CCJA 4Z1MG 3HPLC 5JCOC 4DAMA 4DUYQ 3GTMB 1PD3A 3ZMSA 4FM1A 1NY4A 1VQKV 5IYQA 1HZEA 2NYZD 1E2WA 3ONUA 1FGBD 4JVZA 5I9PA 1HNXB 3ASPA 2L1BA 4BBSG 3SYQA 3QNEA 2V7VA 5E1FA 3PIOA 1O7IA 3T13A 1E0BA 4DV0O 4PC3A 2UU9O 1ILQA 2A6EC 1A32A 1WA8B 1A8VA 3K5NA 4DK6C 5C3XA 3VO1A 4X3TA 4BY1H 2W0FC 4LFAL 3SYAA 5C3EG 4IFDJ 2E2IB 4HNAB 2NVYB 3CMMA 3AG3B 1K8AD 1M57C 4G7HC 1HNWL 1H8EG 1BQ0A 1EFID 4MT8A 1H38A 3HAGA 4R7CA 1VQPB 3J7ZC 1YJ9A 1QCEA 2HDNB 1NJID 5IYBG 3Q24A 4WFFA 4CH5A 3I4NB 4QUZA 2L55A 1S5LZ 3DMUA 5EQ0A 4CBCA 1VLOA 2QM4A 4X65B 3OAAA 4X3SA 1PRTF 5BSYA 2IX0A 1W0JG 1VQ9B 5B5EZ 3VR2A 4JI5Q 3LQ6A 2R7ZG 3CD6A 1H2NA 4JI8Q 4ICGA 1I18A 2CTWA 4CKEA 3ABKC 2K5VA 5J39A 1JORA 3I4MG 1CZWA 2BH2A 1LACA 1B23P 4JV5L 2XIWA 4I55A 1VQ8A 5C0XH 4A93H 1Y66A 5KAFZ 5LYJB 1N36Q 4A3MB 2CW0C 5LGUA 4NR1A 4LJZC 3TDQA 1TUEB 2V7UA 2WLHA 1XMQQ 4KHPQ 4OO1G 2VQFQ 4DR4Q 2VYQA 2PO4A 3DWAA 3EQLC 4ULLA 4PD4F 1KD1D 1PRTB 3HOXH 4MS2A 1PKVA 1PV4A 5M5WB 5F2VO 4JI2L 3AVXA 2ZXOA 2H4OA 1WCMB 4HCEA 2QM7A 5LP6A 4A3JH 2ZQMA 4LH7A 1SKVA 1F60A 4ZKIA 2QGGA 2BCCH 3A3GA 4E0FA 4GN3B 1EEID 4NXNL 5BR8Q 4B9WA 2WKDA 1VQPV 3OMGA 1HXYD 3LWUA 3UDIA 2D3LA 1YJNA 1SJHD 2NV4A 1BBXC 4GLXA 1OXTA 1F77A 4HTHA 4KKSA 3V05A 2DETA 2DY1A 1XDCA 2FB5A 3JASA 1DOLA 4EQOA 1VQNA 2JXMB 2ZT9B 2JS3A 3K6OA 3OTOQ 4YHHL 1X9NA 3ZN1A 1B2RA 3JALA 3ABMB 1I7FA 4LF5O 4WZKA 2LW1A 4ZHQA 4X1KB 3JASB 2LSSA 3HOWG 4IALA 1P8LA 1YXBA 3CMEA 4KD3A 5HY6A 1SKQA 3CP8A 5J2UA 3I5DA 4HJ5A 1H9KA 1SQGA 2YDEA 3BVGA 2VQFL 2F0HA 2K75A 3FAVA 1JFFB 4DK3C 5H5JA 1T9HA 2H3OA 2HEPA 1IBLO 1Z6HA 1WTHD 2JJ2A 3QFSA 4OWTB 1R9TB 1GN4A 1LTBD 1HA6A 4ASUA 4ZAIA 1EYAA 1PH1A 4KY6A 3CP2A 3OOCA 3Q6SA 2Q73A 4RWSC 1UD6A 2A6HD 2J4XA 4A3DB 3QG1A 2NLJC 4MVQA 1QUQB 1SDFA 4B3RQ 1Y1VG 1U0LA 3CTAA 1LTGD 1MGSA 1WLEA 2WACA 2YI8A 2C35B 5EKLA 4G5GA 4XYQA 4I50A 2XHBA 4AIMA 3J81L 2UXCQ 2XWBB 2XEXA 2A7WA 5B1AB 4N3NA 2EYMA 4HJ8A 2X6AA 4A3EB 3EA6A 4LUOA 3ZMTA 2B7BA 5CBFA 2IH1C 4NXML 3KUPA 3Q39A 2OBRA 1EFCA 5TISZ 4JI3O 2G5DA 4DN4M 3TQYA 3S17H 3I1FA 4JAVA 1FNBA 2GUZB 4C2MH 2B29A 5JJEB 2F4VB 3RWRD 3KZIZ 3KG2A 4P9PA 2EYHA 1XHXA 4J10A 4P22A 2ZE6A 2OQ0A 4L6TB 1ZAUA 3RYCB 3PO2B 1WB7A 4DRXA 4HE6A 3APOA 4KD4A 2UXBL 4O0AA 2K32A 5B3SC 4AI8A 3MVVA 1A6XA 2DERA 1E3ZA 3TJTA 1STYA 1ENCA 4YY3O 3QO7A 1WSRA 1IBKO 1V1PB 3NE5B 1RIPA 1Y8NB 3CCVA 2HIVA 1TWHB 2GTAA 1CTMA 5F4MA 3CF5A 1SE2A 3L72H 1D7QA 2OTLA 2JJ2G 4DR1O 2J7KA 2F0GA 4UP9A 3BYTB 3CPWU 4IUUA 4LF8O 5EGTA 3KFUA 1U9RA 1VQMV 2C5BA 2GJKA 1KLGD 3HOXG 3QOLA 2ZBVA 3FJOA 4ZQ3A 4EGVA 3ASOB 2PY5A 4XN3A 1W2BU 3W2DA 1OGJA 4IUQA 3ETQA 3BA8A 2KBNA 2M7WA 5DEDA 3SR2C 4CDFC 1QWYA 4JI7Q 5KNDA 3ZMUA 1HUNA 2W6IA 1AI6A 2YI9A 5H2FZ 2RDGA 4B3ML 5LMUL 2EY1A 3FKIB 2PYJA 3CQZB 1KD1W 1KMIZ 4JI1Q 4C3JG 5C4XH 3B82A 4QPKA 2CVRA 2VS1A 3X3MA 4X20A 3JATA 4YIPA 1UE6A 1K83B 2MHVA 3BDCA 1H2MA 3W7SA 3BC9A 1EFRA 3I72A 4LF9O 1B2TA 2K1BA 3NBIA 1HRJA 4A3DG 5EK0A 4JI2B 2PCFB 2I46A 1K28D 1EFTA 4BBSB 5E1AC 2WB1B 3Q4HA 4IIJB 2QWRB 3OZUA 3ND9A 2I5MX 2PQAA 4GS3A 4L63B 3RYHA 1J5EQ 3BEHA 1X32A 1JJ2A 4UP7A 4DR6O 1HR0B 3TK1A 2B8FA 3H1KH 5JWPA 4Z1VA 5I6YA 1UE1A 1I6HB 4P26A 3JD0A 4DR7L 4MTOA 3CC4V 3FP9A 3VA5A 3P3PA 4NCNA 4ASUG 5GAGC 4BWGB 3HOVH 1IX9A 1PH2A 4EH1A 2KEDA 1CI3M 4DPGA 2K50A 1QFZA 3AG2C 4B3SB 4LC1A 3C46A 4ODGA 5T1IA 3GTMH 3CPFA 4OPAA 5B1BB 4XL9A 1D2EA 4GUNA 4C3IG 1MJEA 2Q2IA 3OAAG 1F2MA 1CP9A 1LABA 5KA6A 5IYPA 1HP8A 4LNUA 2ZJPA 2KVOA 3D3RA 1Q1BA 3D0FA 2QKCA 5IYDO 2EIKB 1GUWA 3WB2A 3FPPA 4M8AA 4DUZL 5EMNA 2F3IA 4OXPA 4YY3L 4DF7A 1QFJA 1B6QA 1FKAO 3P1HA 2Q69A 4O4IA 2EY6A 5ELNA 5TY0A 4DR6Q 3MEHA 3VYSA 5GONB 3NWSA 2XSCA 2UU9Q 5M9OA 2UUBL 3OM3B 5CA0B 1AEXA 3SEBA 3FMCA 1Q46A 3PO3B 2CDYA 4BR6A 3FX7A 1SF9A 1NS1A 2YC0A 4B3RB 3G6JB 4HAEA 2WWWA 2XAFA 3S3WA 2R70A 1EN5A 2XN9C 3JAKA 3OZWA 5LMNW 3F5WC 2R72A 4PI0A 4Y7CA 2EILC 1ZYRD 2QMUA 4ACAA 3FEWX 4RHRA 5CV4A 3ZMVA 2G9HD 1GKFA 1QVGU 4ZUIA 5FPOA 1SZTA 1EYGA 1Q81D 5IYDG 3D26A 2E5LO 2Y0IA 1WTQA 4LMQD 5FK9C 4RCOA 2YXHA 2SEBD 1JB9A 1B9MA 3CRQA 5EZYB 1BQZA 1SNMA 4POFA 1BVSA 1W0KG 1NTKH 4IUNA 1KNEA 3BYYB 3L3OC 4DK1A 3EJIA 4IFDH 3LDCA 5LMNB 2WAMA 4Z1MA 2IT1A 2PYKA 5BR8L 3U0ZA 1CKMA 1YNJC 3ZJZA 3OTOB 2WB1E 1NVPB 4XXEA 4G7XA 3CXCU 3V7AA 2E3CA 2EY5A 3J7AV 3AG3C 3JQPA 1PZKD 5M3FG 1DLBA 1KKCA 4LF8L 1WD1A 3A1PA 1NBMA 2B39A 1TWGH 3PV0A 4J9YB 3CCQV 2P3MA 1VF5C 3TZUA 3WOFA 5C3EB 3GTQH 2F4IA 4AH6A 1XMOQ 3DEPA 4FN5A 3P75A 2XGTA 4TT3A 1WTPA 2IBZH 4LBVA 1Y1WB 4JYYA 4KP4A 1CA6A 2E5LQ 4GX2A 1K73W 3OMCA 4TQUS 1KC8C 4LWSA 5IT9L 4ALPA 1RTOA 1PH7A 2IJJA 4QCLA 2RJZA 4UV9A 1JB3A 4CC5A 4JI6O 2Y0SE 3S1QH 3DM3A 1OB2A 1EZ6A 2P67A 4M2LA 1BCPD 3OIPA 2NVTB 3DC5A 3CSXA 1FS0G 3ZHRA 4P12A 1K9MW 4I0XB 1EZJA 1BHAA 1IL8A 1SERA 1H9JA 5M5XH 2HHHL 2KCNA 1RTNA 1TWHH 5CYUA 4KJNA 4C0SA 2E76C 4FDBA 1B04A 5A2QN 2QEJC 3KDFA 2XWJB 4R8IA 3HRZC 1N33B 4UCSA 1YI2V 2X7RB 1AIPA 3S2HH 3K7AB 4FMTA 1SSOA 4O2AA 4UAJA 3KDFB 3D36A 1PKXA 2DYIA 1TIID 4ZLTF 4XLFA 4BIUA 3J7AU 1XNRL 4X7FA 5ELDA 5L3EA 4JBWA 5IGDA 2WV6D 2VWJA 2FJ2A 4IPHA 2F43G 4MNOA 2WA4A 1N34Q 1QGZA 2JK5C 2FTKA 5I6WA 1S5BD 3UE1A 3W7WA 4KHVA 4ZI7A 2O57A 4TSFA 1VQ5A 2V4DA 1RM1B 4R4CA 1M1KC 3M3YB 3KBXA 1M8AA 5J3BA 1VQPA 4G7OC 1M93A 4DR4B 1LUVA 5D3IB 3WNBA 5EKIA 4PV1C 1A2TA 3A2FA 1VQ5B 1X6OA 4DUYB 4IZ8A 2F0SA 1H85A 1P4RA 1KK3A 2XNDA 1RF2D 1TWCH 1N0VC 1GR1A 2D5DA 2EPBA 4JAUA 2WAQG 3QO2A 5LYJA 1KTVA 3M85A 3IFTA 4W4LA 1XEQA 3JYCA 1NSNS 3KCYA 1JA8A 1JX9A 2YICA 5IYBO 1RQPA 4RD1A 1IYVA 5LGTA 1S77D 1FFTB 1KRSA 2BTOA 4DK0A 3K0XA 2ZTGA 2ALYB 1OCCC 4PV1B 1NB0A 3ES9A 2KJXA 3OW7A 2DYRB 3HOYB 5LL6S 3DXRB 5EBWC 3OEEG 2DWEC 1HA3A 1AN8A 1PM9A 1XQBA 1OV9A 1CT1D 2JSOA 4X65Q 3GTJB 4NNJA 1EEFD 4PNYA 4P3YA 4WJ4A 3L0OA 2JJ1G 3O65A 1EFRG 3J81N 3NEMA 4CH6A 1KRTA 2ZM6L 1VQOA 4J41A 3AVVA 3U58A 3S1RB 1IW7C 3ASRA 4IN3A 4JI5O 2LXJA 2RVLA 5J2TA 3PCOB 4O2BA 5KGUA 1FNWA 1I5FA 4CQJA 1OB0A 2EYLA 1L0WA 1EQVA 4X64Q 1D5MC 2L11A 1BNZA 4O2BB 4HIOA 5D5QA 4G2KA 1WTRA 5FL7G 3DGEA 4BAYA 1EOVA 5C5MA 4GLAC 2OEOA 5C4XG 2BPOA 4B3GA 4JZ2A 2EVBA 3F8TA 3HGBA 4ACBA 3A0RA 5C0XG 1F4MA 3D8CA 4MVSA 1XMQO 4KHPO 4P3IA 1Y0YA 1NMFA 1QCBD 1I8DA 2F0EA 2I07B 3EROA 1XQ8A 1FPOA 1X54A 3D4DA 2M9VA 1LT6D 4OX9L 1XB2A 1PTOC 1F2YA 1LM0A 4HZ3A 2KEEA 1NR1A 3S15B 4C3HB 3CC4A 4APVA 2VUMB 1Q90D 2L5TA 3PENA 3A8KE 5LMNQ 3BVOA 3H1IH 3NR7A 4I7ZC 2F1LA 1OCZC 4IUVA 3UI2A 3G6EA 1GJRA 3KF8A 1K9MC 4X1YB 4GOPB 3J80c 3HKZE 1FJGQ 5EJWA 3TSSA 3PIO3 2ZL7A 2CGOA 4NB3A 3KF8B 2XVSA 2F0LA 2ES2A 1UFIA 3SJCC 1GO2A 3OE7A 2X6CA 1Q1EA 5J9PC 1XL6A 1OCCB 4JTDB 1WP6A 4UB8Z 5GW7A 1WDTA 1KNAA 4HN7A 1U97A 4B08A 2ZCEA 3SJPA 2B2TA 3MHPA 2CK3A 1BPLA 2GBOA 4X3UA 5NUCA 2B2WC 4Z4WA 3BHPA 1X3FA 3D6WA 1QE6A 2KQXA 1ET6A 1TS5A 2A1AA 2KA7A 1M90C 3ICXA 2M6YA 2UUBO 1D8TA 1BO0A 1PPJH 4OX9B 3W5VA 4NTYA 4B44A 1IZ6A 1X55A 1XWEA 4K8JA 5DAUA 2PQEA 4L5RC 5C44H 4FIPC 3H0GH 2YSUB 3PQIA 3RYFB 4P75A 2OTJA 1TVCA 3D4RA 2P22C 5IY5B 3JAMi 3HZXA 4OXSA 2QEXV 1FX0A 2QDLA 3GO5A 2IJHA 3BZCA 5C44B 3GTQB 4WFAV 3G67A 1UD8A 1B9NA 2WLIA 1HQRD 4QPJA 2CH4A 2WFWA 4P74A 1L0XB 2ATKC 5D5PA 1FXKA 4NYKA 2JDIG 4LR3A 1EIHA 1I50H 1O80A 1YEWA 2VY3A 3U6KA 1D5XC 4TKOB 3VO2A 2AHZA 3JCUZ 5F4JA 3SJZA 1R3LC 1VQAA 4XQFA 2R3ZA 2Z9HA 3UM7A 5J22A 2XAJA 1TY0A 4LFCO 5KX5A 5LOVB 1E1RA 2VNJA 2PZWA 2VW9A 3E8HA 1BX1A 3CCVB 4RDJA 4DR5L 2EOTA 3PIPA 3VDYA 2QKSA 4C3IH 1VMCA 4ME5A 4LBWA 2CTRA 1ZSPA 2OTLB 1CSPA 3CC2A 2C4TA 1KHIA 3AYHB 3TEHB 1XUQA 5JVG3 2X6BA 1EY5A 4A3IB 3O9OA 2EJ7A 2VNKA 2PI4A 4BY1B 2VUMG 4DR6L 4BS9A 2VQEL 5IYZA 4DQLA 3GTKB 5M5YB 4FK8A 2WLJA 2ZXRA 1EUJA 5CBGA 1EWCA 1AJPA 1KDAA 3NENA 5GTIZ 4RA8A 3CCQA 3VNUA 2ZXPA 1V0EA 1G6UA 1N8RD 3MA2B 3I90A 3F7VC 2F4VO 2DNEA 4PDVA 2YWFA 2WR8A 1HTPA 2F0VA 3TP5A 2ZTEA 1PVOA 4C7UA 3MMPA 4Z4ZA 1T5XD 4NVPA 2QWNB 5CR3A 1S5HC 3J81c 4JYAQ 4X6AH 4YELA 4FO2A 1WA8A 1XNQQ 1T6XA 1K73D 2CKZB 4I7AA 1N07A 1NU1H 1KAAA 1KTKA 1VQ7B 4RPBA 5IYRA 2D2CC 1BDOA 5CORA 3M7MX 3NTHA 5EKKA 5CV5A 1IBKB 3U4ZA 4TVAB 2RCFA 5BXZA 5KAIZ 4DR2B 2A6ED 1TLLA 1DCZA 4DXFA 4C43A 2YWHA 4M4SA 1WP8A 1D2DA 4LF4L 4B3SQ 1QUEA 4X3KA 3ZRSA 1L1FA 2OTJV 2JA8B 3A8JE 1HJPA 2MP1A 3CYOA 1Q5OA 3KLSX 3S1NH 3AB9A 2R93H 1QNUA 2Y48A 2HP8A 4JTCB 2E5LB 3ZRWB 1GO3E 5FKAC 3ONYA 1S5JA 3X2QC 5LHGA 2BE5D 2ENBA 1AZPA 1N33L 4ILWA 3H6MA 1FRQA 5IYCO 1LTID 4I9QA 1K3RA 3CJHA 4CZZA 2AQ3B 2WIIB 2E75B 1B3AA 4I55B 4KKTA 1J5EB 3E2EA 1H42A 1SYCA 2LXKA 3QO5A 1GH6A 5AG2A 3BDOA 4DV6B 5IYCG 3J81k 3BG3A 1VQKA 2NR5A 1TVKA 2JEAI 1PJ5A 3R65A 1I0HA 1VQMA 3E83A 4EQ5A 1H9RA 2RDHA 1HW7A 3MHBA 3X2QB 3GTOH 3ZRXA 1SETA 1H8EA 2BTQA 1G291 3JAWB 4X62O 3ZBTA 1B70B 5LBQA 3AFQA 3CCEV 4IJHA 1VF7A 3DXJC 1VQ5V 5KHHA 3FVQA 2DE0X 2Q4PA 3CWBH 1H8HA 2KECA 1GTOA 3K0DA 4PELA 3CW2C 3QOJA 3S14B 2PI2E 4F87A 4O4JA 2JIZA 1I94B 4Z4SA 3J7AF 4JC0A 3UDXA 1QX4A 4P72A 1V5VA 3K06A 4JI7B 2IJIA 1RD9D 4W4KA 3SXHA 4Q5VA 4GX1A 3ZEDA 4NXMO 2E1BA 3CCSB 4YHHO 3GTJH 3G71A 1QQCA 4DV7L 2BDOA 3E22B 2ZIOA 1SMYD 3QVNA 5CA0A 2F3WA 2P06A 3H91A 3C2PA 1O9GA 2UXBB 2F0QA 2JA5G 1XMOO 4JI6B 5BN5A 1K3BC 3CCSA 2JA6B 1BLIA 3HKDB 3B78A 5D14A 3VQVA 1Z7TA 2VXWA 2AHYA 3E5SA 2XAHA 3V2TA 4B3XA 4GNXB 3K7AH 1AILA 2LW7A 4KXRA 3SJQC 2KHIA 1W2BA 1CUKA 3CCLB 1PMRA 2A5HA 3X3NA 3M4YA 2F0MA 2B2UA 5FO7B 1DONA 2HCCA 1M1KW 2HD3A 4R8NA 1QR9A 2WSSA 1EOTA 3FB7C 1GKHA 1O7YA 2UXBQ 2JA7B 1G6PA 2N49A 2PZSA 1G7RA 3MTSA 1PTOB 3H01A 1SNPA 1ZUNB 5HFMA 4DV2B 2RC6A 4HSVA 2K1EA 3EIVA 1GMGA 1OCOC 4JOIC 1RDPD 2Q7HA 3DUZA 4PQXA 4JYAL 2WLKA 3AK3A 4LH6A 4RCZA 3E0JA 3L9AX 2EZPA 1PZJD 3HOZH 2CAZC 2Q8VA 4I7ZB 2AZ2A 3B8HA 1WJZA 4NXMQ 4TUYB 5JH7A 3G4SB 5H9CA 3IKJA 2VBTA 1FFXB 1DG1G 2Q2HA 2WAQB 4P6YA 3C1FA 4PMWA 1MSGA 2O5IC 2B3GA 2AWNA 1YVWA 2Q6KA 1XMOL 5FPRA 2E8GA 1AI7A 1YHQA 2KG7A 4MYUA 1QILA 4J9ZB 2M2LA 3TP8A 3EXAA 1K8OA 3JD1A 4PDRA 4X7EA 4FF3A 1STNA 3R8BA 1QLEC 2ZINA 3BABA 4FFBB 3WOEA 4HIDA 1H95A 3H1JH 3CCEB 1YTFB 4FXUA 1PTOD 1VS0A 3Q0AA 2EE1A 1HFNA 4FZ0A 1QLNA 3S1QB 2WLLB 4MTFA 1S5FD 1JVMA 3OIQA 1K83H 3CCEA 2HR3A 1SQXH 5LA6B 3ZHTA 1DJRD 2KOLA 3BVZA 4KJOA 2OQKA 3I4NG 1F4NA 1SA0A 2B2YC 3GTOB 1YITV 5L37A 4B3SL 4UDUC 3A56A 3SK6A 4K0KL 4H33A 3OTOL 3S16B 3OTOO 3MEFA 1M90D 1SYDA 1VQLA 5JVH3 2F0IA 5IWAB 3IFXA 3I70A 1SYFA 2QWOB 4L8JA 1HCZA 4A93G 2Y69C 3ZZUA 3MXGA 2LZJA 4KMUC 5I4DA 4X66B 1EXMA 4OIJA 4WFGA 4YAUA 3PSIA 4JI8B 1V8QA 1BZKA 5FO0A 5BSXA 1OXSC 1HR0L 3K04A 4MTNA 2B7CA 4JI5B 3JSLA 4KY5A 3FD9A 4BIZA 1NVPD 1P4MA 3K03A 1W9XA 2PE3A 4JI1O 1QNMA 3PA2A 2CWAA 2X69A 2DN9A 4JG2A 4UAIA 3HR0A 4RQEA 3Q6QA 2OIGA 3KKYA 4TMWA 2BA1A 3CKIB 5KIXA 3CRLC 1K5QA 4JV5B 4YALA 2L12A 4HNAA 2OK8A 2X85A 4MVOA 3G05A 5FO9B 1I3QB 1TS3A 1VQ9A 1FXKC 4MSWC 4LF4Q 3OPOA 2VZAA 1Q9SA 4R4OA 5ELBA 3P3NA 4K2KA 2JA7G 1NTMH 5AJ3Q 1VARA 4DV5O 2X8KA 3HKBA 4XDLA 4PA7A 2CTQA 3ZHUA 3WBKA 2QDBA 2TSSA 4L5TA 4DR1L 4GN5A 2UUBQ 4K2LA 3HOWB 1CKNA 2E74B 1Y6XA 5DECA 4K0KQ 4LF4B 4MVRA 2BGIA 3I2ZA 5LL6Y 3BY1A 4K5WA 1M90W 3FPUB 2UUCO 1EY0A 4DR2L 4UXNA 1VQEA 2L6LA 1Q82C 2X3UA 1YHQV 3OEHA 1G2TA 4UVBA 3UO2A 1AJQA 4CS3A 1F7YA 2WJVA 4GZRB 2OXPA 1OB5A 1QJOA 2NVXH 3SVMA 1BJKA 3CXCA 1Y69U 3N2KA 4LF7L 4FK5C 1I4QA 1SESA 3ZRVA 2PLFA 1ML0D 1AE2A 1K73C 5J3OA 2LMCB 4XM3A 1R6TA 3S2DB 2VS0A 2XNJA 5M3FH 4H0LC 1VQNV 3ETDA 1XNQB 2AUKA 4WORA 5JEAH 2K28A 4JASA 3RVZA 2VNHA 4RCNA 4A3IH 1Y1WG 2R9IA 1J5EL 1H2KA 2UXXA 3OKXA 2ZDIC 1C9OA 2K05A 4YCVA 4BY7B 1EWHA 2WZNA 3A0HZ 2X6YA 2LKVA 4R4IA 5IK2A 1BCPB 1H9SA 1DF4A 4DAVA 1IXMA 1NT2B 2F0OA 4XLHA 5A8AA 2L35A 2F1MA 4UUJC 1S5ED 3TXSA 2D62A 2CTPA 1U4LA 1UEBA 1I4PA 5CC4A 2YTXA 1WTVA 3ICEA 4YHBA 5EAYA 4DR5B 1IVSA 5EPJA 3ABLB 3KOJA 4OO1I 3I55A 2JA9A 1M5IA 4Z4RA 3ZCCA 3WWVA 4X1KA 1BCPC 3M4OH 4OPOA 1NBWA 4DV1B 5JPMC 2JRIA 5GONA 4PC6A 1SRUA 4OPSA 2Z1CA 4R4QA 4JI6L 4A3LH 2NBFA 4A3GB 4NKLA 3ASOC 1EIFA 5E3FA 1D8LA 4WZLA 4C1NK 5TR9A 1U4PA 2Q6IA 4B3MB 5LMUQ 3J80N 4OWWB 3B4SA 2ZM6O 3M3YH 3AVUA 2ZR3A 1BBUA 4FYDA 3JAME 2QF7A 3CD6V 2F0NA 1KUQA 2GPJA 1ZEQX 4FP5D 5IYNA 5JPNC 2GQFA 4AYBB 5TV2A 5B66Z 4ME3A 5A35A 1DD2A 3SEJA 1RM1C 2H5XA 2I5HA 4IT5A 1UWVA 4IURA 3VYUA 2BMWA 3WDNA 2FMLA 3PO3G 1W34A 1O9HA 1GUGA 4RH6A 2RN9A 2EYJA 2N04A 2K14A 1URFA 1EP2B 1QG0A 1FL0A 2PW5A 2HUGA 5ITZA 3CAMA 4PHZA 2F0JA 3FKIH 1Q82D 3URYA 4QJFA 2YXYA 2PMZE 4X64L 4JBJA 2Q2TA 1R3KC 4RGNA 1WTOA 1SQQH 4UV8A 2OT2A 1JJOA 1L0NH 4UZFA 3ONAB 4B3TB 4KI0A 2JA6G 2W6JA 2QE7G 3AEIA 1XMQB 4KHPB 2HCIA 2L15A 2R9AA 1G7SA 1KZLA 1YVCA 1Q81C 2MW2B 3QSYA 3GVKA 1NJIW 1DM0B 3CP0A 1JJCB 1MSDA 3Q38A 3CPWA 1YCIA 1DGSA 4IUTA 1PH4A 3A35A 1E2ZA 1DYQA 3TP6A 1ILPA 3H1LH 1JCKB 1I94Q 2HLDA 3CHBD 5C8YA 2EIJB 5EYPA 1SC5B 1HNZL 2LO1A 2R92H 4AQYO 4P1VA 1DOMA 2IW5A 5IJ9B 4Z4VA 3W2FA 4TQDA 4MTKA 4QIWF 3TN2A 1HZ9A 1Q90A 5A2QE 1Y8PB 5TRDA 1BUVT 1E3PA 1FYCA 2IJ0A 1A63A 1VEWA 5IJ9A 1WB8A 3W7XA 3U9SA 4JI8L 4A3GG 5A88A 3CCSV 1LYLA 3CC2B 2OCEA 1V43A 4AC9A 1YHBA 1QGAA 4R4TA 5G3LF 4JI6Q 1P7GA 4CBVA 4TMXA 1R4QB 2BVNA 4AYBE 3FHWA 1Q86C 1XMQL 4KHPL 3KLWA 3E3XA 2ZKOA 1SM4A 3H94A 3FB8C 2B5UA 1LO5D 4P9OA 4JOIA 4R9WA 4HJAA 4QGPA 1IBML 3G6BA 5GV7A 1C0AA 1E7ZA 2JA8H 1N4CA 2E2HH 1VQ7A 1V0FA 3PVDA 3M4PA 3MXNA 1S3JA 4JTAB 1YJNV 3IRBA 5IP7H 2KCMA 1YIJA 2A9HA 4CJ1B 1PL0A 5KMGA 4JPRA 5H6RA 1VQ4B 2JDIA 1Q43A 4QFMA 1S3OA 3LSUA 2CQOA 3RN4A 4DV5Q 4O4LB 3OMNB 4FXKC 4G7ZC 1IBKQ 5T1GA 1JA1A 4IFDG 3JQQA 1FYJA 2R92B 1MA1A 1WPCA 1AH9A 5CMUA 5DM63 1SYEA 1I3QH 4LFCB 5JVDB 2HG5C 1LUZA 4GLVB 1OTCA 2EIFA 1PJ6A 2ZNJA 3B77A 1GK9A 1E2VA 3OTFA 1JJ2B 2Q8RE 3RMHA 4LF8Q 2JS5A 1EP1B 3J80L 5IIFA 3Q6RA 3ZYYX 2EULA 4UVCA 3T1HQ 1Y74A 3GWOA 2EIKC 5CA1B 5KHIA 5FLXN 1VQLV 4J11A 3P27A 1U96A 3L9DA 1LTLA 3S1NB 3AK1A 4MIUA 3AVWA 1TVKB 3ZRWA 3D3IA 4XYOA 1U4MA 2RCNA 2ZR2A 5CA1A 1ZM4A 4QUFA 2MNAA 4B3TQ 4P9SA 3S3XA 2ZL5A 3ABKB 1NAPA 2XNAC 4RKLA 4DR4O 4DV2O 1R6KA 3CJHB 2WPDG 4IUPA 5C4ZA 4WWVA 5JQGB 4GKKO 3OUSA 4IW3B 2PI2A 3NELA 1HZCA 2KCTA 1SE4A 3OW2B 3JAMN 1TXYA 4O1NA 2JQOA 2HHHO 4QIWE 4QMGA 3QB3A 4RWUA 3TP7A 2ZJQA 2ATWA 1VQOB 2X0KA 1PRTD 2BDNA 1KP3A 3BRCA 2ADPA 5BN3A 2DOSA 2PNRC 2Z5UA 1TGOA 1YF2A 1W59A 5J35A 1QLEB 3GQBA 2GSMB 4ZCKA 1Y76B 3L74H 3AK2A 5KSWB 5GAHC 1N33Q 3SR1A 3GV6A 4ZCLA 3Q23A 2H1EA 3T1HL 3TCUA 4HEDA 2Y4TA 4NB5A 1R1BA 3FDTA 1FNUA 1P7BA 3FPKA 1I6HH 1OCRB 2DN8A 3CCLA 3BS1A 1HHVA 1OJHA 3K5OA 1XBLA 2BOSA 1KYOF 1TWGB 5C3EH 5LMUO 4XD7A 4PZ7A 3W1GA 4DV2Q 1ELOA 2K5DA 2NB0A 4JI3L 1K4CC 3VA7A 5IYWA 2ZT9C 2YXLA 4A3MG 2UXDQ 3ZHQA 1YBYA 5CV7A 5G3LD 5IYBH 4DR5Q 2XNCA 2VJJA 2ZXHA 3CB4A 4PC1A 1NUCA 3MWYW 3L7ZC 3RVYA 3R2TA 4KHZA 5HGTA 3RLOA 2DYSB 2OF1A 3OGIB 4OOSA 2SNMA 3HG9A 1JJGA 1WPXA 4CS2A 1CQXA 4U3JB 1D1NA 2C2WA 1S5DD 3MFGA 2FVGA 1JICA 2GA4B 5GAEC 1LTTD 2O5JC 2UXCO 4N9PA 4QQBX 1ONLA 3NP8A 3OMAB 5A9GA 1ZWIC 3MHHC 5DN6A 2PMZB 2RHQB 1PH3A 2HJDA 4LW1A 2Q0AA 4YEJA 5KYLA 1WP7A 2V7QA 2R6GA 2AWOA 4K35A 2A6HC 1PH6A 2F03A 4XORA 5CV6A 2BOBC 1H9MA 3S2HB 3KLSA 3T1HO 4RD4A 1IZ3A 2KHSA 4X05A 5KW9A 2YIBD 4PG3A 1MJCA 5JJLA 3HKZG 5EBMC 3OZVA 1X3QA 1CHPD 1HQMC 2UXBO 2Z6KC 4OEMB 4C3IB 1AP0A 1UAPA 1NH2B 1YHQB 2Q7EA 2PZTA 3E6ZX 3OR6C 3SGIA 2BOCC 3SK4A 2B9ZA 1V54C 1OCOB 1TA8A 2OTJB 5GQOA 4ZIBA 4AILC 4H9GA 4LF4O 4B4DA 1F9RA 1V1OA 4CS4A 1VMPA 1VQBA 1JWSD 1WYDA 2RF4A 2UUCB 2O4XA 1Y1VH 4YY3Q 1TUIA 1IB0A 1COWG 1OXVA 4A3LG 4B3RL 4XLAA 4GKKL 5GTHZ 2UUBB 1MI2A 1O7LA 4N8X1 3LDEA 2VWKA 1MKHA 3C1EA 3SK5A 4LF6L 1Z2GA 3G6EV 2IX1A 4BA1I 4JI2Q 2R9RB 3ZMZA 1XILA 5H1SE 5HFLA 4WFN3 4H37A 4P2ZA 2RCVA 5B1AC 4C3HH 2F0FA 1SYGA 4YJ2B 3Q8DA 1UE7A 3I73A 3U2QA 1Q3EA 2YWEA 2NZ1D 2XGJA 3WG7C 2DMXA 2WPDA 4A3FG 1K0RA 3MXUA 3A5ZB 4DNIA 3PUXA 4IL6Z 5FL7A 4POGA 4C3JB 4DNTB 1KD1C 1N32B 2KSDA 4WJ3M 2C77A 2CRVA 3T2MA 3CRAA 3NK9A 2B63H 4NW2A 5C44G 3UT5B 3HKCB 3ZIAG 3NXSA 4JI0O 4ZI7B 1T6ZA 1EU3A 4DR3L 1E64A 3HOUB 5KUKA 5EBLC 4DR5O 4QE7A 5FNVB 2DCUA 3LSSA 1E22A 5M3MB 2DJVA 2E2DC 1EYDA 3RFRA 1ENAA 3B6YA 3D6CA 5K1XA 3SYPA 1S5CD 4XIGS 5EBCA 1HWYA 3HKBB 1WOSA 4KLKA 1XPUA 4RUEA 5LHY1 4OGQC 4DV1O 3QWNA 1VQCA 3JARB 3S2DH 3CXCB 1GN6A 3D36C 5E79Z 2XAGA 1PFSA 1RODA 1K92A 4ID6A 4A5UB 3E8FA 1HNZB 4KTAA 3I91A 2F4NA 1N05A 3T16A 2A68D 3KYHC 2ZITA 3SDLA 3A3BA 1FD7D 4EQNA 5JEAJ 3E8BA 4YAOA 4A3MH 1EQTA 4LF5B 1VDZA 4DV4O 4JV5Q 1QZHA 3FKSG 4YWMA 5L3BA 4ZUJA 4XNFA 1XREA 1PV0A 2E76B 3SPCA 2NN6G 5J1ZA 4JK1C 3VQXA 1RPRA 3K58A 3GV3A 2Z4HA 3K8AA 2UUAL 4BBSH 4JI1B 3HKEA 1IURA 1G1XB 1K28A 4D7SA 5THXA 5M5XB 1N32Q 4FXDA 3QG5A 4G28B 3VQYA 3OJXA 4XT1B 1D2BA 1W3SA 1UJWB 3HP3A 1KJZA 5FJ8H 5BR8B 4BY7G 2Q9LA 3CW2A 3CMEB 4MW3A 1M9NA 4X0CA 1L0LH 1OHHA 4JI4Q 3NHHA 4LF5L 5C4XB 5FO8B 4F4LA 3JAWA 2P5OA 1SROA 2KVMA 3FAVB 5E4XA 1BCCH 3CCLV 1AFPA 1H2LA 3RR5A 1HPCA 5KYIA 4LF6Q 2C5CA 4WBNA 1ZX3A 4RQFA 3CRZA 4O4JB 3H0GG 1CSQA 3RLNA 1IBLQ 4Y9RA 4DV6O 4ROXA 3GD7A 4BBRH 5BN4A 5E6TA 2Y69B 2D74A 4C56C 3Q3AA 2V31A 3RZOH 2GREA 3CMAV 2A3QA 1IBMQ 2MJ8A 1V1QA 4BA2I 3PUZA 3JD2A 1DOKA 4JZGA 3LNNA 3ASTA 5ELCA 4QF4A 2VUMH 2UXCL 5KNCA 1K8AC 2NVTH 3TREA 3DEOA 4XQQA 1RP3B 2B1GA 1CXZB 4KL1A 4DYLA 2I5LX 2QWPB 1I94O 3GVJA 1RKNA 2K5HA 1W87A 1NR7A 2Z4IA 1TVXA 4GKJB 4D6TH 2LQTA 4G1BA 1IBKL 1Y8OB 3H3VI 1J8IA 1I50B 3L2PA 4F6EA 4QJFB 1WAZA 1CHQD 4NXMB 1DF5A 1N36L 2Q6AA 4Q0FA 1R4PB 3HEJA 5L3CA 5A89A 1HA5A 4HIKA 1YX2A 2XTAA 1WOOA 1B8AA 1Q82W 1ESRA 2E75C 2WAQE 4DAPA 2EZVA 1JOQA 2E74C 1KK0A 2CH7A 1V55C 3W2IA 1PTOF 5D65A 2AHOB 3L71H 1BQEA 1EZ8A 2GHYA 1U4RA 4DV6Q 1IBLL 1R3IC 2QGNA 3AG1B 1C48A 3G80A 2Z3YA 1SNOA 4KK7A 3WBJA 1K33A 4ABNA 2Y0SG 2PUSA 4OL7A 2ZM6Q 3K79A 3UDFA 5CBEE 5HGQA 1X3GA 3B8NA 3QTCA 2V7XA 2B2VC 2HJFC 1MRZA 2CHBD 5IE8A 1FFXA 2ZXWB 1TR5A 4ZGQB 2B5OA 2UUAO 1A2UA 2EINB 3H09A 5FLXc 4PMBA 4DR4L 2VQFB 2HDLA 1US6A 1YITA 5TSSA 3J80i 5CMDA 3AG1C 2VB3X 2VRZA 1YSCA 2CK3G 1N06A 3VR3A 3OFNA 5CA3A 4FM2A 1N36B 1SQPH 2DOGA 1SEBD 2WKCA 4N9TA 4K6DA 1PFMA 4A3DH 3EN2A 3K5LA 1D1KA 4K8ZA 2KQ3A 4H02A 2B2WA 5EYPB 5DM6V 2IY5B 2D0OA 4HJ7A 3I4MB 2AXTZ 2EINC 4NTWA 4FLYA 4TOIA 2WP8J 2E2HB 2NN6I 4JW0A 4A3IG 5KNLA 1G8MA 4OIKA 3M99B 5KHJA 4X1IA 2P90A 3OR7C 4UFZA 5JCOA 1NZ6A 4RD6A 4NXNB 4B47A 1E1OA 1IXRA 1STBA 1RJTA 1YNXA 3G48A 4FVMA 3B2EE 3FB6C 1A3VA 1HR0O 2R7ZH 1IYUA 2CFMA 1XI1A 4EQPA 4RD0A 3BY2A 4P73A 4JI3Q 3HOZG 1GXDC 5IE9A 4O2AB 4B3FX 1SMXA 2K6AA 4G57A 3F7YC 2HHHB 5FLMH 3OE7G 3P32A 4A3EH 1MZEA 4B3TO 1K3EA 1K8GA 4A3BB 1GHKA 1B44D 2DJGC 3S14H 4A3KB 2QTLA 3RUZA 4IJLA 2N74A 5DN6G 2YTVA 3VR5A 1NNXA 5C93A 3CC2V 4AYBG 4QNHB 4DV3L 4OHJA 2NTSA 4Z4YA 3WFVA 4BY1G 2F52A 2CH4W 2JGDB 4BBRG 1HNXQ 5KMGB 4PAAA 2CW0D 4TRDA 4A3KG 3ND8A 1VF5B 1QHTA 1VQ4A 1V54B 3QF7A 4FLZA 2F95B 4ZCIA 1E1TA 1EWIA 1SNQA 2OBSA 3OWEB 4JI4L 2Z0AA 3QFTA 3P7JA 4UCRA 4X66O 4JI8O 1RPOA 1MABA 1UD4A 4DR2Q 3J7A5 2V7QG 5DSZA 4HAMA 3PA1A 4U7OA 5FA6A 2NZOA 2D2CB 1E1QG 5KRUA 3BQJA 3ZZ0A 2JJ1A 4AF6A 2OCHA 4PA4A 4KV6A 4LUVA 3D4WA 2ZZQA 4JV5O 4IHJA 3EHBB 2FMCA 1LUWA 4B43A 1VQMB 2PMDA 2F4VL 2MK3A 2YU9H 3OW2A 1NJIC 4X65O 3OFNG 1FXVA 4U68A 3MXPA 1WSVA 2RMKB 3K3WA 5LMNL 4J7JA 2OCCC 4UCOA 3ULPA 2KB1A 4KN4C 1VHOA 1MABG 1UUPA 4HBNA 5K36G 3RN2A 1CNFA 3E8GA 4H13B 2ZNIA 4XOPA 3ZHSA 1F2LA 1HTLD 1SN8A 4JI5L 4JYAO 1CFMA 2AKWB 3WU2Z 3U9OA 3SYCA 2YEVB 3CXHF 1W0JA 5LXTA 5CBHA 1UE5A 4LF9Q 1EQQA 2YIDA 4DUZO 2H94A 1MG1A 1RFYA 2CNDA 1I6VC 1GM5A 4DR3B 5IWAL 2FL4A 2X0LA 1LTSD 1A0IA 1S72B 5KA5A 4X64O 2Y0PA 2D9UA 2XTIA 3CQZH 3NBHA 1N0JA 4L5QA 3ZS8C 1RL2A 1KXLA 1H2SB 4LCUC 4QHYA 3A0JA 1H9SB 2F3VA 3Q22A 2XASA 2NUCA 3NBHB 1S72A 1BCPF 4GNXA 1S72V 4MVUA 1M1KD 2DGYA 4J1MA 1KRHA 4OELB 1F20A 2PGGA 2XNDG 1JJ2U 3BU2A 4ZHQB 5JJKA 3I7FA 4WF9V 3KL9A 1W6JA 3H1HH 1O7ZA 2KENA 3CCRV 3RT3C 2JJQA 1CEZA 3GDEA 2YYZA 2Q67A 2LP7A 4J42A 1E1QA 4R71A 3S17B 2EJFC 4JI0L 4TSFG 1WORA 4A3FB 3BZDB 3NWTA 4RMFA 1GM9A 1G6ZA 1G2SA 1EL0A 2K9PA 4LFAB 1N08A 4PC7A 1JOYA 4DR1Q 4A3FH 1EU4A 2NWGA 4MZ9A 4GKKB 3EVQA 2X6GA 2PIAA 4G4KA 4P2CB 4DR3Q 1IBMB 2CUGA 4UVAA 2XOKG 4YHHQ 2IJKA 2A0LA 2B63B 5IYDH 3RYIA 4CDEC 3MD0A 2JK8A 3MFYA 1Q7YD 1EIGA 2Q7GA 4F88A 1F51A 2LJ2A 1VP7A 1G4YB 4XBFA 1IBLB 2CBXA 1NR2A 4DV3B 2JIZG 3H0GB 4TUYA 4B9XA 1KECA 3G4SA 3S15H 2BSKB 3P20A 4B7KA 3G4SV 2A8VA 4B3MO 4X8IA 1IL2A 3AVYA 3LNMB 1N33O 2ZE5A 3QO8A 2ZD9A 1CKOA 3EFXD 3VYRA 3RGBA
chains in the Genus database with same CATH topology
3SK8A 1Z5WA 2YIAA 3I4LA 4DRXB 2IW3A 1PFNA 4LK1C 4JI3B 1LV9A 1VJSA 4CH4A 1BR9A 1TY2A 3NQIA 2GK6A 4DV7B 2F0KA 3SDZA 3T4AC 1JWUD 1KABA 1T5EA 4DU9A 4QIWB 4XLEA 4YJ2A 4IQZA 1GJXA 4AQYB 3CRKC 4LF8B 4YIJA 4FLUA 1ESFA 4CKBA 4XOTA 3QJYA 1COWA 1HFGA 4A3JB 2ZTNA 2A73B 3N2KB 5EBDA 4H7BA 4YJ3B 2M5SA 3RYHB 4HIZA 3SJAC 2K5WA 4CHTB 5F2DA 4K5XA 2PW7A 1A15A 5KHGA 1Q8IA 4EB6A 4NDXA 1PFBA 1TT2A 4RGTA 2Z8LA 3I3CA 1G8ZD 5J2UB 1RCVD 1KDCA 3RZOB 4LF7B 3CB2A 2NN6H 2RKSA 2FHTA 5K5PA 1Z5VA 2LFNA 3F2UA 1B53A 1UEAB 2JA5B 2UUAB 4XN0A 2QKIC 4Q6GA 1LTAD 3E22A 4DGZA 4I50B 4TV9A 3A7AB 2QE7A 5CBAE 5KNBA 2EX3A 4DV4B 2Y0SB 1BF4A 4XDXA 1PTOH 2UXDB 4ZOLB 1QNKA 3NTKA 5EZYA 2RDFA 1IKMA 1UNSA 4KN7C 2YU9B 4ZOLA 4UCTA 1DD2A 2XRQD 2M00A 4RGMA 2IL8A 2XZPA 4GZYC 4U3JA 1DZ1A 5LMUB 5EIBC 2ZZGA 5C0XI 1P49A 5IJ0A 5KX5B 5LOVA 3J81E 1SYBA 1BQQT 2X6XA 5C0XJ 1X4TA 2X6LA 4O4HA 3SE0A 3DWPA 3BVMA 2EJMA 4EVOA 4M1UB 4TSSA 5CB4A 4O4HB 1WD0A 1GHJA 3HOUB 1AZQA 5D3DA 3SJBC 3N2GB 4NMZA 3HOXB 3T1HB 3M7GA 5ELFA 4K14A 4AVZA 1JE4A 1DXMA 3UQ8A 2RQ6A 1STAA 1MD2D 1HVXA 4JYAB 1GUTA 1MSHA 1OXXK 5EPLA 4DFAA 2EJGC 3G7LA 4QCLA 1L0YB 5JVDA 3ZPNA 4ZRZA 5IGGA 3W3AA 4ZYSA 3BDLA 1NRKA 4CJ2C 4O4LA 2K03A 1A3UA 3HKCA 5E4WC 3GTPB 1X3PA 4DNRB 5FLXE 3RLFA 4WRDA 3NUCA 1PYWD 1KMHA 2N88A 2XZOA 2F0WA 4JI0B 4BWAA 3CU7A 4RKBA 4EFBA 3DDYA 4XKWA 4I4TB 1GUSA 1I4RA 4UCUA 1SE3A 4RHSA 5JJJB 5LP6B 2PZUA 4XMYA 5J2TB 5LXTB 1WTXA 2L0CA 2E2JB 4C3HG 3GTGB 1JFFA 5JAVA 2X6WA 2EYPA 1UD2A 3LWEA 1W0KA 4CKCA 3HOZB 1Z47A 4LAAA 5C5LA 4UZUA 1WVLA 4II3A 3ITPA 1SFOB 3GVLA 2X53S 3PN1A 3LX0A 1STEA 2XZLA 2J7ZA 2Q8IB 1JQYD 1PRTC 3KLRA 3GTLB 4DUZB 2ZZEA 2K5QA 5BMVB 3PUVA 4X64B 4XR6A 4H44C 1LLRD 5AFWA 3S17B 1I4GA 3S9WA 5I2XA 3VQWA 1PDQA 1ZKOA 4II2A 1V1PA 2L9HA 1RSOA 3OSOA 4F7XA 3A7LA 4K8IA 2JEBI 3FKSA 5FLXL 4S3SA 3ZIAA 5C8YB 4HSPA 3PMFA 4DV5B 2IX3A 4F8MA 4XKVA 1GUNA 3HS0C 3T53B 1STHA 2CQAA 3BH4A 2AQ1B 2IPKD 1QB5D 4X20B 3J80E 1SQFA 2OWOA 1EY7A 2IM9A 5HKKA 5HURA 2WJYA 1XTCD 3UT5A 3JARA 3R3OA 5A2QL 3JATB 4IFDI 2XOKA 5FNVA 4DR7B 1LT5D 4G6IA 1BMFA 2F66C 1JMKC 2F0TA 1GOZA 3FRPB 4A93B 1SKYB 3N6RA 1SNCA 2JVDA 4C2MB 2LY7A 1ZXTA 1TS2A 4FF1A 3MC0B 3A54A 3J7YW 1EYCA 2WZPP 4CH3A 2BE5C 5EIBD 2AUJD 4ZKCB 4IHJB 2MPMA 2B2UC 5JOBA 4TV8A 4DAYA 5ISRA 3VR6A 3HKEB 1PZID 2ZM6B 1N34B 1TU2B 3K57A 1OXUA 2XRSD 5DEHA 1KDBA 4TV8B 1O78A 4WBNB 2BTQB 4GQNA 4MHEA 5JEAG 3DWQA 1IHZA 3JAKB 4BBRB 3D8GA 1JR0D 5ELEA 3K59A 5CV8A 3THOA 2EYFA 4RGOS 1NCVA 1SNDA 5EPKA 1BOSA 1YNJD 1TQOA 1TUBA 3NSWA 5DNFA 2HQEA 4X62B 1IW7D 2VQEB 4EFEA 4LFBB 3MAQA 1EY4A 5LL6X 2PYLA 4FLTA 1KLUD 4TV9B 1NR4A 3JU4A 4KY7A 4U673 1ENFA 5ITZB 1CZGA 1FR3A 1ZYRC 1CQVA 4YHHB 1ICWA 2EY2A 5IODA 3WQZA 2K04A 2UU9B 3I8ZA 4TQFA 1XMOB 4O1NA 1TAEA 1HUMA 4DR1B 3OEEA 1E79A 2O2LD 5LP6C 3K0YA 4TQUS 3KEWA 3A8IE 3M4OB 1LT4D 3TBIB 3D31A 4CC6A 1I4XA 3HOVB 3RYIB 5JH7B 3HKZB 2J0TD 1YNNC 4K8XA 1D1IA 1TWCB 3NQTA 2DY8A 2K01A 4J6HA 4GYCB 2EYOA 4YXWA 2R61A 5CDFA 2JE6I 4FFBA 1I4HA 1UD5A 2ICEC 2FINB 4K0KB 4XONA 2F43A 3N52A 5M3FB 4LF9B 4C1NI 2R7ZB 3N2GA 4E6IA 3AMUA 2NVXB 2F0UA 4LF6B 1G91A 4HMIA 4OO1H 3BCFA 3C3LA 4JI4B 3BCDA 1EY8A 3KK7A 1QG7A 3R2IA 1TKWB 2KKWA 3ERQA 1Y1VB 2A69C 1V9PA 1M4UA 2B2VA 4XQJA 2HDMA 4CJ0B 3RZDB 2PTMA 2IWHA 4Y7NB 1ET9A 3A55A 1PXUA 4LNUB 4H13C 1JWMD 1B1ZA 1D5AA 2Q8TA 4FLXA 2ZIMA 4QUCA 4DV0B 4V0BA 5K36H 4XQNA 3OWFA 5FOBB 4XLCA 3BAAA 1Q12A 1TWAB 2NVQB 1CM9A 2ICIA 1GUOA 4MN3A 4PI2A 2NTTA 2KUMA 1D6EC 1RHPA 1MBYA 2RBMA 2JP1A 1F9QA 3JALB 2UXCB 5C3WA 4FF2A 1OO9B 1WTWA 1XNRB 5CGKA 4X1YA 1F9PA 2R93B 3DM1A 3OHXC 1II3A 1VCIA 5IGCA 4RFBA 2RSOA 2C9OA 1E43A 1EY9A 2RQXA 4O42A 1SMYC 3BPZA 5IGFA 1Q3LA 1FJGB 2JYOA 4D7TA 2OYQA 1FNVA 1D5ZC 1PLFA 3KBGA 3NTIA 3DHQA 3NXWA 3CESA 1JC7A 2TMPA 3AU7A 5C6AA 2F0DA 1TS4A 3H3VC 1C4QA 2DY7A 1XYIA 3RYFA 3TMEA 3IAYA 5DM73 2G9DA 1WN7A 2BA0A 2FMMA 5BMVA 2SOBA 2FFKB 1C8CA 1IKLA 3RYCA 5LA6A 1SA0B 3S1MB 3U11A 2N55A 1CK1A 5I9OA 4DR6B 2QILA 2GJPA 4DA2A 4DXGA 4UCVA 4Z9CB 2RA4A 5C4JB 1JOOA 3S1QB 3U10A 4G7WA 1B4OA 5IYZB 3PUYA 3BA9A 5IOCA 5KEEA 4V190 1E3XA 4F6RB 1LT3D 3VYTA 4PMCA 1AW7A 4F6RA 1XX8A 3JSNA 4FM0A 3T1YB 1SAPA 4I65A 1WNSA 1LTRD 1L8DA 4IIJA 4KKUA 2WINB 1VLYA 4XYOA 3PIP3 4K6LA 3SHLA 4YY3B 5IGEA 4YJ3A 3IL8A 2JGUA 1WPBA 1QOHA 1EY6A 1B50A 1SBBB 2VNUD 4ZKBB 1KU9A 4JMQA 1F2ZA 2A69D 2QCPX 2EDGA 1TWFB 4EB6B 2D3NA 3DSQA 3T56B 4FLVA 1A3TA 2YIBA 1CA5A 3VR4A 1M4VA 3MZ5A 2LS01 5KHKA 1SJED 3WB1A 2B8GA 2GV9A 4HMJA 2B2TC 3PUWA 3FFQA 1XXGA 5JQGA 2ID0A 2A74C 3T51B 4BW9A 2B2YA 4I4TA 2ZXIA 4EEQA 1XHZA 2GK7A 4O4IB 4RAUC 1TUBB 2EXZA 3HKDA 2QJ1A 3CHXA 4AHCA 1BXTA 1YNND 2VJIA 2SDFA 2F0PA 5JJZA 5C4HA 4K5VA 1S4ZA 3O13A 5COYA 4CGYB 5CV9A 1J9OA 2ZZFA 2R9VA 2PPBC 2L4NA 1W6KA 2GJRA 2MUYA 3K5MA 3WB0A 2DIEA 3NPPA 4FLWA 2KCCA 1CQFA 4HR7B 5JJNB 2K7VA 3RD4A 5IJ0B 4NP5A 5K1PA 1F9SA 3IFDA 2MGSA 1JOKA 3GP7A 4XT3B 2DNCA 1K8MA 4FF4A 4WJWA 4QB4A 2RSNA 3QIAA 1SXTA 2Z6BD 3M7NA 2A68C 4ZK9B 1UD3A 2BCOA 2K33A 4J8QA 3TZDA 2VB2X 3V96A 2F93B 4FXGC 2AQ2B 4XTCS 1STGA 5IGBA 4X1IB 5CB4B 1HNWB 4FNFA 5JCOC 3GTMB 4FM1A 1HZEA 1E2WA 1FGBD 5I9PA 1HNXB 2L1BA 5E1FA 3T13A 1E0BA 1ILQA 2A6EC 3K5NA 5C3XA 4X3TA 4IFDJ 2E2IB 4HNAB 2NVYB 3CMMA 4G7HC 1EFID 3HAGA 3Q24A 4CH5A 3I4NB 2L55A 3DMUA 5EQ0A 2QM4A 4X65B 3OAAA 4X3SA 1PRTF 2IX0A 3VR2A 1I18A 4CKEA 5J39A 1JORA 1CZWA 1LACA 2XIWA 4I55A 5C0XH 5LYJB 4A3MB 2CW0C 4LJZC 3TDQA 4OO1G 2PO4A 3DWAA 3EQLC 4ULLA 1PRTB 1PKVA 5M5WB 2ZXOA 2H4OA 1WCMB 4HCEA 5LP6A 4LH7A 3A3GA 1SKVA 4E0FA 1EEID 2WKDA 3OMGA 1HXYD 3LWUA 2D3LA 1BBXC 1SJHD 4GLXA 1OXTA 1F77A 4HTHA 4KKSA 3V05A 3JASA 1DOLA 4EQOA 2JXMB 3K6OA 4CBVA 3JALA 1I7FA 4ZHQA 4X1KB 3JASB 4IALA 4KD3A 3CP8A 5J2UA 1H9KA 1SQGA 3BVGA 2F0HA 1JFFB 2HEPA 1Z6HA 1WTHD 2JJ2A 1R9TB 1HA6A 1LTBD 4ASUA 4ZAIA 1EYAA 4KY6A 3CP2A 3OOCA 3Q6SA 4RWSC 1UD6A 2A6HD 2J4XA 3QG1A 1SDFA 1LTGD 1IYVA 1MGSA 2WACA 4A3DB 2YI8A