1T5EA

The structure of mexa
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
231
structure length
231
Chain Sequence
TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the periplasmic component of a bacterial drug efflux pump
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Multidrug resistance protein mexA
total genus 61
structure length 231
sequence length 231
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1t5eA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1t5eA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5eA02
1GHKA 3BRCA 3QJYA 3WB0A 4DK0A 4LJZC 3T51B 2V4DA 2LMCB 3ND9A 4DNTB 3VA7A 2B8FA 4JK1C 4IFDG 1EWHA 1GUNA 5KNBA 4PV1C 1H9SB 2BE5C 5D5PA 1Y8OB 1IW7D 3PUYA 3M85A 1HQMC 2E75C 4XIGS 1CI3M 2EJGC 1H9JA 3EQLC 1SMYC 2JXMB 5BN3A 2JEBI 5C0XH 3VR6A 3VR3A 5A35A 4KI0A 3PV0A 1E2WA 1GUSA 3PUWA 5JJEB 5D5QA 3DXJC 3OOCA 3I72A 1GJXA 3BDOA 1H9SA 1OXXK 2K7VA 3M4YA 4OO1H 3PUXA 5KNCA 1VCIA 1GUTA 2A6HC 2D2CC 2DN8A 1IYVA 1DD2A 5JJJB 1I6VC 1OXUA 3A7LA 1LABA 3D31A 3VR2A 4OO1G 1YNJC 1E2VA 2BA0A 3I4LA 1GUGA 2A68C 1Z6HA 4G7OC 2DNCA 3IKJA 3VR4A 1QJOA 1K8OA 3FMCA 1OXTA 1G291 1H9RA 4H44C 1E2ZA 2EDGA 1ONLA 1TKWB 1ZYRC 2E76C 3P20A 3PUZA 3U9SA 4G7HC 1O78A 4RCNA 2BA1A 2BDOA 1Y8NB 2A6HD 5JJNB 2E74C 2A6ED 1ZKOA 2JEAI 4BA2I 3T53B 2K33A 2F1MA 2Q8IB 3TZUA 5KNDA 3H94A 1A6XA 2AUJD 3QIAA 4HR7B 4LK1C 1HTPA 1DXMA 1TU2B 2K32A 3A8JE 2AWOA 3AB9A 4GZYC 2EVBA 3FPPA 4TQUS 2BE5D 1B9NA 2KCCA 3L7ZC 3N6RA 1IW7C 3MXUA 5C0XG 2EJFC 3I73A 1HPCA 1Q1EA 1Z7TA 2NN6I 3OPOA 4JBWA 2CW0C 1IYUA 2O5IC 4KKUA 1CFMA 4H0LC 5BN5A 4I7ZC 1GHJA 2NN6G 2L5TA 2JE6I 3QG1A 1B9MA 2D5DA 1VF5C 3BG3A 3T56B 3WB2A 2AUKA 5BN4A 4XTCS 2PPBC 4IFDH 3CRLC 3OW7A 4KKTA 3D4RA 4KMUC 2PNRC 1FR3A 2YYZA 4G7ZC 2NN6H 4IQZA 4BA1I 1OXVA 4TKOB 2ZT9C 1Q90A 3A8IE 3CRKC 3SE0A 5JEAG 2A69C 4KKSA 4KN4C 1DCZA 3VR5A 4GYCB 3HGBA 1LACA 2PCFB 2D62A 3A8KE 3W3AA 3KLRA 5JEAH 3MFYA 4KN7C 2QF7A 3A7AB 1Q1BA 1Y8PB 2KA7A 3GQBA 3SDZA 2EJMA 4OGQC 1H2SB 2F93B 3PUVA 2O5JC 1Q12A 1H9KA 5K36H 1GUOA 3ND8A 3WDNA 1CTMA 1VDZA 3M7NA 1HCZA 2A68D 1V8QA 3IFTA 1VF7A 1T5EA 1OXSC 2A69D 1H9MA 3LNNA 1O7LA 4H13C 1BDOA 1K8MA 1V43A 3RLFA 2F95B 4L8JA 4DNRB 2IT1A 3GD7A 3LWUA 4KHZA 4DK1A 3WB1A 3NE5B 2DNEA 1RSOA 2R6GA 1PMRA 1YNNC 1FYCA 2A6EC 1Y69U 5K36G 2B8GA
chains in the Genus database with same CATH superfamily
2B2WC 1LUVA 2JGDB 2KBNA 1AZPA 1KQSB 1E0BA 4DR1O 1GRJA 2MFIA 3T51B 2CDYA 3JALB 3OE7G 2M2LA 4X1KA 3VQXA 1Z5WA 1PZID 1ZTEA 4DR3B 2CTWA 1PKVA 1EWHA 1EYDA 3CWBH 4XDXA 1JMKC 2YIBD 4AQYQ 4QVAA 4XN0A 1ENCA 4DPGA 1YTFB 3CCLA 1B23P 3OMCA 3TGUH 1HQRD 1CZGA 2OWOA 3TRZA 3PUYA 3N2KB 4KHPB 1L0XB 1PL4A 1YI2V 1PZKD 2E75C 3HB3B 1CI3M 1VQPB 4V0BA 2B63H 5BN3A 2JEBI 1VQ5A 2RCFA 4IUVA 1WPCA 1NCVA 1AEXA 3A54A 4RJLA 2MK3A 4HNAA 4GX1A 1X56A 1WVLA 2F0EA 2DN8A 3AG4B 1E24A 3TBIB 4LR3A 2CFMA 5JOBA 4EX5A 2CE4A 3ISXA 5IGEA 3JASB 2Q8VA 4QNHB 5LP6B 2F0NA 5JWPA 2I0QA 3KLWA 1M8AA 3QB3A 5IY0A 1X59A 5A9GA 5H9CA 5L3DA 3QWNA 4KY6A 1PLFA 4OPOA 4UB8Z 2UUCB 2OBRA 4BPRA 5FLXc 4ZKBB 1O78A 4GN3B 1IBKO 4LF5L 2ZTEA 2HQEA 3QFRA 4BY1B 1HZEA 3UO2A 1U4LA 4JI2L 1JOYA 4XLAA 4QIWB 3R66A 4DV3O 2ZR2A 3X2QC 5B6IA 1CKOA 3OSOA 3HOWG 5LA6B 5GAHC 3SK6A 1Y76B 2JSOA 4DR7Q 5EC1C 1B04A 3BC9A 1XPUA 4JYAQ 3VA5A 1VQGA 3DSQA 1G8ZD 2BH8A 2L0CA 4KHPO 5I4DA 4CH6A 5K1PA 1W87A 4FVMA 5J2TB 1BZKA 1Q81W 3Q39A 4PC3A 1FNUA 1X54A 2X69A 4GZYC 4B3TB 4N8X1 4XL9A 3W5VA 2F66C 4TT3G 2F0FA 3ZZ0A 4YWLA 1WTXA 2QWNB 4PMWA 1N32L 5C3EB 3H91A 4IYHA 1C8CA 1QH0A 3HKCA 2XSCA 4DUYL 1EY8A 3H1LH 3LUTB 5C4XH 1FVIA 2N88A 3B09A 4JTCB 4QJFB 4XTCS 2JIZA 4GNXA 1HR0B 1V54B 1M57B 3ZS8C 4Q6GA 1N0NA 4E4EA 3OW7A 4XLCA 1SNCA 4FNFA 3K6OA 4R4IA 1WA8A 5C3WA 3S1NB 1PTOH 4EH1A 4KP4A 5ELNA 4UDUC 1ROPA 3BVOA 5A8AA 5FO1A 1Q90A 3A8IE 1T6ZA 1PRTF 4IPGA 2OCEA 1K8AW 5B3SC 2UXDQ 5LMUL 1W0JA 3AGQA 2NWGA 4KN7C 1EIGA 5BMVA 2KA7A 2N8NA 1I4HA 3CCMV 2VXWA 4BXXG 3LQ6A 1SQFA 3CS5A 1ZM4A 2GN5A 1C0AA 2CWPA 3B82A 3NR7A 4QIWF 4YY3Q 4LFAL 1Q86D 2ZJRA 1YF2A 2JA5B 1GMGA 1U0LA 2JJQA 2F0DA 2WLJA 3C3LA 4MVSA 3TP7A 2D3LA 4YHHB 1RCVD 2PQEA 3CW2C 3JSNA 2F52A 2M6YA 1V43A 1BHBA 2VNJA 5IY5B 3KF8B 4O2DA 4XLHA 3WB1A 2C5BA 4RKLA 2WSSA 1K9MW 4HCEA 3VBBA 2Z6BD 4DAPA 1EYAA 1HR0Q 1BL8A 3LQEA 1G7RA 4UZFA 5DLQE 3JASA 5LP6A 5HXBA 2QEXV 4R71A 5LL6S 3GTKB 1LO5D 1VQLB 3K06A 2D74A 4XOPA 1F9QA 1TIID 1AJQA 2EPBA 3D8CA 1MZEA 3BA8A 4NTXA 3D3IA 4X1YA 2UU9O 2ID0A 3E9IA 2YIDA 1IXMA 1FD7D 2DEUA 4IN3A 5C3XA 5LMUO 1OGJA 1QGAA 1XXGA 3T13A 4K3AA 3F1ZA 2BM0A 3IFDA 1QLEC 2JA5G 3AG3B 4X3TA 4LFCQ 3S14H 4PAAA 3B40A 1YJWB 2XTAA 4IFDI 1ZM3A 2UUBL 3H1JH 2UXBQ 1QUEA 1CQVA 3DXJC 3B4SA 1GJXA 2QILA 4PHZA 4A3EG 3PO3B 3D36C 3A0BZ 1H9SA 3ABLC 4LFCL 1M90C 1KECA 1QG7A 2WP8J 3TZDA 1KK2A 2XWJB 3KLSX 4JAUA 5CBFA 4CBVA 1U4RA 4B3MQ 4MTXA 2CNDA 2G9DA 1KB9F 1LV9A 1SE2A 2X6AA 2DWDC 1UE6A 2BA0A 3P32A 2A68C 3ZHSA 1WTHA 3GIRA 4IHJA 2LJ2A 4O4JB 4CDDC 1E79G 4R8IA 1K28D 4Z4RA 1SEBD 2UUCQ 4A3LH 2KOLA 2RSNA 4FZ1A 1EP2B 4FYDA 2EDGA 3ZBHA 4MT8A 1N0VC 1Q7YD 2ZIOA 4N23A 1Q9SA 1WB7A 3U9SA 1Q7YW 2Q4PA 4L6TB 3CCMB 4G7HC 1HR0W 1V55C 4RH6A 1PH3A 1IBLL 1PV4A 1I5FA 5JJNB 1BQ0A 4X65Q 1ZEQX 3OGIB 4DR3O 2Z0SA 4JYBA 3AVXA 1K73D 4ZQ3A 1N33B 3MAQA 2B3GA 1ASZA 2LXJA 2JA7G 4ROXA 2BN4A 1SSOA 2WLLA 2K32A 3KK7A 2JA8H 1R5BA 2FMLA 1BPLA 4RLZA 2EVBA 4KD4A 4PZ6A 4A3JH 4O1NA 4FF1A 3NTIA 2QGNA 1A0IA 4PNYA 2I07B 4YELA 3PO2G 5B1AC 1SZXA 4Y9RA 5C8YA 2QGQA 3OPOA 2EZVA 1DDIA 1BF4A 1S5JA 1E1QG 1SR3A 4XQJA 3JAMi 4LFBO 4NB5A 5DN6G 4YXWA 1AB3A 5JAVA 4N3NA 1BO0A 3RYHA 4XT1B 1WTVA 2DERA 4UZUA 4XXEA 4Y7NH 4DR4Q 3RN2A 3BG3A 2OIGA 3T56B 4WFBV 3G4SV 2JS5A 1Y74A 4GZRB 4FLXA 2YI8A 1QVFB 3FKIB 2K5VA 1FXVA 2L4NA 2DWEC 3FHWA 4A76A 1WTQA 1NI8A 2PNRC 1KRHA 4JI3B 4BA1I 1ZAUA 5CBAE 5A2QE 2XNDA 4NBSA 5ELEA 4P2CB 3OEEG 1EN6A 1W3SA 2L1BA 2JA5H 4WBNB 1HHVA 4A5UB 4PI2A 5IE8A 3HOYB 3S17B 2WLIA 4RUFA 3CC2B 4HJ5A 1UMKA 4LFBB 1YIJA 3LGJA 1Z9FA 4A3GH 2AHYA 1IHMA 3IJ4A 1NVPB 1D5AA 1SM4A 2ZDIA 1UPGA 1GKHA 4M1UB 2NVYH 3CCLV 1XMOO 3RZOB 2Q73A 1PPJH 4B3SQ 3GO5A 5CV9A 4TV8A 1ILPA 1EOTA 5LXTB 3ASPA 1YZBA 1NR4A 2DYSC 4XNFA 3J81L 4CS2A 2VRZA 2O2LD 2Z9HA 3GWOA 1T5EA 3D36A 2R72A 1A62A 1JB3A 5HFMA 1T6XA 1YJNB 1YHAA 3LVBA 2PQAA 1F7YA 1FD9A 2RC6A 1SMYD 3MVVA 2WLNA 1F4MA 1JPXA 4HMJA 3SGIA 4DR5B 4G5GA 1K0RA 1LTLA 3CP8A 5DEDA 1R4PB 4R4QA 4F87A 3I56A 3W7UA 1CQXA 1C4QA 1Z2GA 2CW0D 2A9HA 3K04A 2AHOB 2LMCB 4BIUA 4JK1C 4B3SB 1JE4A 2HHHQ 5EKIA 3ETGA 5E79Z 1KC8D 3T1YQ 2QE7A 1VQNA 1TWCB 2ZL7A 1YIJB 1TWFB 2MO0A 4PA4A 3SYCA 3A8JA 2LP7A 3R6KA 2EJGC 3CE2A 2Z4HA 2XAQA 2HR3A 1Q81D 5FLXE 5C0XH 3T2MA 1VQDA 2K1BA 3AU7A 5A35A 1I94Q 3HOWB 2QTOA 3HKEB 3T1YL 5JJEB 5FL7G 5GONA 2PI2E 2WB1B 5E6TA 3CCRA 2GTSA 2E2HH 3I4MG 4QQBX 3CPWB 1HJPA 4BW5A 5LXTA 5KNCA 5H6RA 1VHOA 3GVLA 1CHPD 1OXUA 4X8AA 3D31A 5IYWA 3CC7V 1JORA 1I4XA 4ZCKA 3G48A 1AI5A 4OO1G 4UXNA 2I1LA 1GUGA 1WLEA 3M3YH 1XOUA 3T1HO 5J2TA 1AP5A 1VQ8A 2DW4A 1TTTA 1NUCA 3GTMH 1H8EA 4A3DG 4WJ3M 3SKBA 2ZNJA 1D5ZC 4CKBA 5I2XA 1IHZA 4X07A 4FJCC 1L1OA 4MTGA 2EXDA 3K0YA 4EVOA 1HNXB 4DV0O 1DDGA 4II2A 4P74A 4YY3B 4OX9L 1AMOA 4C56C 3LDEA 2CBXA 2ZIMA 3SPGA 1M56B 4JI5O 4AHCA 4P6YA 2KG7B 1AR1B 4K5VA 1LNQA 4BBRH 4BA2I 1M93A 4K35A 4HIZA 4P71A 3H0GB 4ACBA 3TZUA 4Z4TA 5IYBH 1AH9A 4LNUA 1BQQT 4F7XA 2K52A 3L71H 1AR5A 1IL2A 3RYHB 4CZZA 1V5VA 3EJIA 3KJOA 2DE0X 5L3FA 2ZBUA 4OWXB 3DEOA 1SQQH 1AZQA 3OMAB 2AZ2A 3N52A 1LTGD 3F7YC 3Q23A 1VQKA 2O4XA 3EA6A 2HT1A 2OCCB 1LTAD 2EY2A 3LSSA 2NVQH 3FJOA 3S1RB 4ZCLA 5LHGA 2E5LQ 3FVQA 2QM8A 1SKYB 2RDHA 2X0LA 2GHYA 1EIHA 2E3CA 3EN2A 5BSXA 4OWWB 2ZE6A 3I7FA 1HTLD 4DFAA 4DUZL 2GVAA 4APVA 2KSDA 2JA6H 2QA4A 4A3CG 1EIFA 1EU4A 1CFMA 1TWFH 3H01A 2WACA 3MWYW 2JA7B 4I55A 4D6TH 2F0IA 5LOVA 3H09A 1OCZC 4PZ8A 2E2DC 4Q0FA 1KLGD 5M5WB 3QG1A 1VMGA 4K5XA 3PIO3 4Y52H 1TWAH 2XGJA 2CH7B 5ITZB 2LFRA 5DNFA 4KKTA 2F43A 3GWKC 3WFVA 5EGTA 4X66O 3CCEB 2NN6H 2F03A 1EXMA 1HR0O 1HW7A 3I5DA 1IBMO 2SEBD 3R93A 1EEID 4K2LA 4ULLA 2Q8RE 3P26A 2NZOA 5FNVB 3QFTA 1K28A 1QILA 3ONAB 2VNUD 3S1MH 1BHAA 2RN9A 2ZKOA 2EIJC 3VYSA 4XLFA 4QPKA 2Z1CA 4BAYA 1QNMA 1UD3A 4I7ZB 1OHHG 1PKXA 1STAA 2Q2IA 2QKIC 4RWSC 3ABUA 3BQJA 1SE8A 1K8AC 1YJ9A 5AJ3L 1KK1A 5IGFA 1H9KA 2BH2A 3J7ZC 4I55B 1ET6A 2DYIA 1VDZA 1SYGA 3IRBA 3TN2A 2C2WA 2QDXA 1V8QA 4XM3A 4JW0A 2ZBVA 5KNLA 4GN5A 4K8IA 2C5CA 1H9MA 2ZM6B 1D2DA 4JV5Q 2CK3G 4XONA 3Q6SA 2PYLA 1G7TA 2P3MA 3C3SA 3NE5B 2EIFA 3JYCA 1DOKA 1YNNC 3NWTA 3HOYH 1MNGA 1SF9A 2ZZGA 4UCTA 4NTYA 1QZHA 1WJZA 1MABA 3ZX6A 2B8GA 4K14A 2IU0A 5NUCA 3CEIA 5CBHA 1BBWA 4NTWA 3VA7A 3TP5A 5CDFA 1AVMA 4KY7A 2K50A 3F2UA 4CBCA 1NBMA 4JI2O 2DETA 2B7CA 4PV1B 2C4TA 5CV4A 4I7AA 3I3CA 1P8LA 3AG2B 4B3SO 5IE9A 1EP3B 3V96A 4JI7O 2WFWA 1KDAA 4C3HH 1R9TH 1DOMA 1XNQO 4NKGB 1HQMC 4XIGS 1NR7A 2ADQB 5IYPA 3TS2A 1IB0A 1J8IA 4MSWC 4M2LA 2OQKA 5IYZB 4K0KQ 3S2HB 3U4VA 4KI0A 2HJFC 2JDIG 5LYJB 2IM9A 1YCIA 1F2YA 3K5OA 1TAEA 2LS01 4IALA 1QR9A 4QUCA 1F23A 3ERQA 2KB1A 2UU9L 1DD2A 1VQ7B 4IYIA 3U2QA 1BBXC 1NBMG 1SE3A 4RD6A 1SNOA 2N55A 3AG1C 4BY7B 2YTVA 1J5EB 1XHXA 1Z47A 5C4XB 3A2FA 2M00A 4H37A 3CCQV 4MVQA 2W6JA 3OZWA 2R70A 4YWMA 4KD3A 1K5QA 4BBSB 1AI4A 4F4LA 1GR1A 1N0UA 1GVHA 4RHRA 3H1HH 3T1YO 1HR0L 3CCVA 4IOAA 1BMFG 1Q86W 4TMXA 2L9HA 4LW1A 2QKSA 2VZLA 3OEHA 3NPPA 4NXML 5KSWB 2ADPA 4DUYB 1OO9B 2K5DA 3NUCA 4ZCMA 4X3SA 1J5EO 4YAOA 2HP8A 5ITZA 1BX0A 5T1GA 5IWAB 2R92B 4AYBB 2ZJPA 4Z1MA 2QM4A 3EBEA 4GNXB 3TDQA 3JU4A 1XI1A 2JA9A 4QGUA 4LK1C 1UE1A 4MTNA 5BXZA 1N36B 3W2DA 1AN8A 1ZL8B 1LT6D 2HHHL 1KMHA 1QNKA 1UEAB 2CQAA 4YJ2B 3ZRVA 2F0TA 1XTDA 3CX5F 1WSVA 2XOKA 4N3GA 4XMYA 2NZ1D 2R7FA 2UXXA 5DAUA 3L7ZC 5CB4B 1IW7C 2Q0OC 4QB4A 3GTJH 3J7A5 4TMTA 1VQJA 2UXBO 3EHBB 3I73A 4UCRA 4B3RO 1Q1EA 2XASA 2NN6I 1BSMA 2IX3A 5IGGA 4UUJC 2B5UA 1M1KW 4JI1B 3Q6QA 3BY1A 3DEPA 4H0LC 4DAYB 3OTOL 1Y1WH 3W7SA 3E0EA 1Y76A 4Q20A 4GOPC 2JA7H 3S16H 4JI0B 2ICEC 1SFOB 1QOHA 2WPDA 4BBSG 4DR1L 4OX9O 2PGGA 1G4YB 1MBYA 2RNBA 1SNQA 1Q7YC 5CV6A 1PTOF 1V1PB 2F0LA 3OTOQ 4G28B 4P1VA 1HA5A 2R7ZB 1QNUA 3HOVB 3QSYA 5JEAG 2NTTA 1D1KA 1NY4A 3MHHC 4O4LA 1LTBD 4NDXA 2ENBA 1D8TA 3NWSA 4MVMA 1F2MA 2K6AA 4DF7A 2A5HA 4ZK9B 1QU7A 5ELDA 1S5LZ 3S1QB 2B9ZA 3B2EE 2HHHO 1XB2A 3GQBA 1M90D 2P5ZX 4XYQA 4HJAA 4X89A 4FLWA 1WOSA 5H1SE 3ZHUA 5L3GA 1R1BA 1JWMD 1KTVA 2C78A 1I50B 4NPSA 2NVTB 3KF6A 4QL5A 4HNAB 3ZMUA 2MP1A 2XT9A 2VQEO 2F3VA 4ZYSA 1UJWB 2GJPA 3JC66 4XLEA 2V1CC 2EULA 4K1XA 1VQOV 3JAWA 4P6VF 4DNRB 3PF4A 2R3ZA 4HN7A 4B3FX 2R7ZG 2OBTA 4FLTA 4QIWE 2BF4A 1Y69U 3JAKB 4XYOA 4IIJB 1G1XB 2V7TA 3FAVA 1H8EG 1Y1VH 1YLOA 2F4IA 4UP9A 4XQNA 2RQ6A 1GHKA 3WB0A 3VMFA 2XRQD 1EZVH 4X1IB 4QY7A 1CPYA 5LMZA 4FLVA 2BGJA 5EBWC 4RFBA 1YXBA 1K5SA 5C3EG 2J7KA 1YNXA 5B1NA 3CCMA 1T6YA 2VBSA 4C7UA 3CP1A 1Q6HA 4GX0A 4YJ3A 1XMOB 5FO0A 4RCYA 4LF7O 1S5FD 1SROA 4C2MB 2HJDA 1JJCB 1Y67A 2WPDG 2LW7A 3E86A 1H8HG 4NXNO 2XNJA 4ZGNB 1K83H 5IWAL 4YAUA 1GUSA 3HOZH 3CC7A 2VUMG 1I8DA 3MMPA 4MZ9A 3G6BA 1NZ6A 3BDOA 4DV2L 1Q82C 2K7VA 5IT9L 2G5DA 4XQFA 2QE7G 3CQZB 2J0TD 4LNUB 1QUFA 4R7CA 2BGIA 2WYRA 5JJJB 4NB3A 1EY5A 5I9OA 2K9PA 1AI7A 1SKVA 3FD9A 2W0FC 4W4LA 5F2VO 5IJ9A 1ESRA 1EY6A 1SJHD 1E2VA 1VQ4B 4JI8O 1XMQQ 4H13B 1E3ZA 3FP9A 3VR4A 2H3OA 3ASNB 3FMCA 1OXTA 1STNA 4GLAC 3L9AX 3T4AC 5LMUB 4OP7A 2XOKG 4X88A 4G7XA 4H44C 1PJ6A 3QE2A 3WNCA 1VQ6B 5EIBD 1VQ9V 2UU9B 2HFEC 2ZTNA 3DDYA 3H0GG 4DV5Q 4HJ9A 4CH5A 1CQFA 4MTKA 2N74A 4GKKQ 2BTQB 1Y6XA 2A6HD 2M7WA 5K1XA 3P3NA 4O2BA 2EQSA 4GN4B 1OTCA 2EBOA 4OHJA 4B3SL 1JJOA 4BY7G 3HAGA 4LFAQ 4C3IB 4FFKA 2JRIA 3QIAA 1ZM2A 1FFTB 5IJ0A 3K9SA 1ZLZA 4WFFA 3E2EA 5DM63 4LFBL 3M8AA 4QUFA 2BSKA 3E35A 2NVTH 4P25A 4B48A 2AWOA 4IO9A 1CZWA 2P5OA 5IWAO 4LF9Q 4UCOA 3H3VH 5C4ZA 2F0QA 3NSWA 3K58A 3HOXH 1NU1H 1GVPA 1JCHA 1HNZL 1KP3A 2ZINA 4DV4B 1GXDC 2OTJA 2IHFA 5C44B 2V31A 2EJFC 2LZJA 1XE1A 5LHY1 2XNDG 4Y7NB 2ZTGA 3G7LA 4D7SA 4LUOA 4XN3A 4JPRA 4B3MO 4EB6A 4JI8L 2IU3A 2L5TA 3VO1A 3SJZA 2D5DA 2ATWA 3IGAC 4MYUA 3CPWU 1UD8A 1F2ZA 4FK8A 2GQFA 1F51A 3VQVA 3AK2A 1L8DA 4AILC 3B8HA 3MHBA 4JC0A 3SK4A 4DUZO 1PJ5A 2WAQB 5DSZA 1O7ZA 2JQOA 3UDFA 1QZGA 2K4KA 4YCUA 1XJVA 2PE3A 4JV5B 4QVJA 5EMNA 2B2YA 3NENA 1YJNA 2RJZA 3S2HH 3SE0A 2TMPA 1SXTA 3DTUB 4ZRZA 4NXNL 1DCZA 1VQFA 2IHEA 5GTHZ 4GYCB 1RIPA 1LACA 2ZE5A 2AQ2B 2YUAA 2GUZB 1RPOA 1HH2P 2F0JA 3J81c 3G4SA 2A8VA 4CS4A 2E5LB 2FJ2A 4X66L 1YI2A 5KIXA 2BSKB 4ZBMA 2K28A 2NV4A 3D4WA 3ZRWB 3U58A 1JWUD 4RWUA 2QR4A 3Q3AA 1YHQV 1J95A 4RM0A 2QA4B 3ZC3A 1CTMA 2CH4W 5CA0A 3QOLA 4DKAC 1N36Q 4X64Q 1KKCA 1L1FA 3ZZUA 3EROA 5LP6C 4Y9UA 4NP5A 1TUBB 2FB5A 1LT5D 2RDFA 4IUPA 2QCPX 2B29A 1QFZA 2VL6A 4LF5Q 1G6ZA 1I5YA 4OX9Q 3HKBA 1K8MA 5KHKA 3D4DA 1EZJA 4PI0A 3CCRB 3EVKA 2P4VA 3PA2A 4G6IA 4QHYA 5EYPB 5C4JB 2R6GA 4UP8A 3HKEA 3SK5A 4E6IA 2B2UC 2L6LA 1W2BU 5I2YA 2CF4A 1FYCA 4LF8Q 4B08A 1H38A 4KHPL 5K36G 3AQQA 3R65A 1OHHA 5TISZ 2Q9LA 1TQOA 2F0KA 3W1GA 3ZN1A 4DV1O 3OMIB 5EZYA 3K5MA 1KIXA 2A79B 1NTKH 3R6JA 4FM2A 2B8FA 4DXFA 4UVAA 1JJ2U 1U2RA 4UZEA 1X6OA 3L2PA 3PO2B 3J80E 5GV8A 2ZXRA 3JD2A 5J3OA 4XDKA 1H2MA 2NR5A 5G3LF 3WWVA 2LW1A 2BV3A 2EX3A 4A3JG 2X7RB 3K7UC 4G4KA 4RCOA 2Q6IA 5FPRA 2JA8G 1WTWA 1AFPA 2B7BA 1RF2D 4UFZA 4A3KG 2ASBA 3OOCA 4BWGB 4K6LA 4HCSA 2VNIA 1H95A 3SYPA 4UV8A 3A0JA 1K83B 5GAEC 3I4OA 5JPNC 3CRQA 1K73W 4XR6A 4GLVB 4P2ZA 4RHSA 4NXNB 3PUMA 1UWVA 3CU7A 5FLMH 1THZA 2X6LA 4LF4L 4CJ1B 1VQHA 1ASYA 2RSOA 2YWEA 3MZ5A 4FP5D 4JYCA 3NP8A 3DM3A 1JOKA 2KHSA 5IP9G 2QA4V 4AQYB 1YHQB 1H2GA 4LWSB 1TKWB 5ELCA 1HA6A 2A06H 1WOCA 3N2KA 5IYZA 1PYBA 4DQKA 3UT5A 3CSXA 1VEWA 1L0LH 4JI8B 3JARB 2ZL6A 1QGYA 2A6ED 4IUTA 1R3JC 4FXUA 3AVVA 1QVCA 2QM7A 5LOVB 2AHOA 2ZL5A 3H94A 4YHHQ 3J7AV 3ASQA 2B2YC 3OW2U 3BNWA 3AFPA 1S40A 4LF9B 3D26A 3OTOO 2GJKA 1XWEA 5KA6A 4A3BH 3GB7C 4EFBA 1N34L 4OONA 2PPBC 3CHXA 4DW0A 1VF5B 3QF7A 4PDLA 3OR6C 1FRQA 1B9NA 3SYOA 3F8TA 3KDFB 4R8CA 1AJPA 5M5YH 1XPOA 1PH8A 3BDLA 4P2NA 4F7DA 4DQLA 1CEZA 1FGBD 4LF6L 2EILC 5C0XG 1NDHA 4JBWA 1I3QH 1LUZA 4JYAL 3H3VC 1WCMB 2O57A 4TV8B 5CV7A 4PA3A 3TMEA 2AGAA 5M5WH 3OT7A 1ICFB 4LH7A 2I5HA 4ZOLA 1GHJA 2IBZH 2CTRA 5F4JA 3M3YB 3JD0A 4U9UA 1VQLA 1XNRO 1Q6UA 1WSRA 2R6HA 1NR2A 4B3RQ 1CP9A 4JAVA 3TQYA 4J15A 2E2HB 2P90A 1XMQB 4KMUC 1TWAB 4PA6A 2WKDA 2QDLA 4LH6A 3KEWA 4IQZA 1OCRC 3I55A 4GT1A 3BU2A 3FB5C 1VQIA 4B7EA 2ZT9C 1PYWD 1QX4A 1NMFA 1EYGA 1UD4A 2F0VA 5M3FG 4PA9A 4NYKA 3BZDB 1ZYRD 4RUEA 2F3IA 2VQEL 1QBZA 1JQ0A 2DYRC 4BWAA 3V76A 2E74B 4HIOA 2AHZA 2GV9A 3SPJA 1W35A 1TR5A 2L35A 2FHTA 5IT9E 1XYIA 4LF6B 1Y8PB 3JQQA 4DAMA 4C0SA 3H3VI 1FNWA 3CCUV 2DOSA 5JQGB 4X1KB 2CH7A 4U3FH 1N32B 2FVGA 2WJYA 5M3MB 4A3GG 1FL0A 1KU9A 1YVWA 5JH7A 1PRTB 4RAUC 2KQ3A 5LL6Y 4P3YA 1NRKA 4YWKA 5CBGA 2WAMA 4DV4O 2E5LO 1QFJA 4PC7A 3SLDA 1HZAA 1OXSC 3E9HA 5J35A 3RVZA 4L8JA 1LR1A 3FYIB 1VQ9B 3H0GH 1KNAA 1A15A 3CCLB 5KAIZ 2K5HA 3CCEA 2FX3A 1SQGA 4IT5A 3ASSA 1EQTA 3BRCA 1SDFA 2E8GA 1BCPC 3K0XA 4A3MG 2HKOA 1UAPA 5FKAC 2H1EA 3K7AH 1PH6A 4RGMA 2LGWA 2PTMA 2NVYB 3HKZE 3WOFA 3JAME 1XUQA 3RW0A 4RD2A 1VMPA 5IDJA 4B4DA 2MO1A 1KK0A 4JI6O 3CCSB 5IYDO 4WZKA 4K0KL 4O4IB 3K5NA 2X53S 4GUNA 4KL1A 4DV7L 1B2TA 1UNSA 2R7ZH 4DNIA 1IVSA 1YIJV 2JXMB 2EOTA 3JCUZ 1LM0A 3AG1B 4ILWA 1T5XD 2DYRB 4PC1A 1E2WA 4IUQA 1I94B 1JA0A 1D6EC 5JH7B 1E1QA 5B5EZ 2IH3C 3I4NH 1N33O 1RDPD 1HP8A 1FNMA 1OB2A 1YITB 1S5HC 4PC2A 3W5HA 1LTTD 1B2RA 2P06A 4DXGA 1XNRL 3SR1A 2VZAA 2NLJC 4LF9O 1NB9A 1XDCA 3ETEA 4P12A 1VQ5V 1U4PA 5DEHA 3IKJA 3JAMc 3ABTA 2MJ8A 3A0HZ 3FFQA 3QG5A 1LLRD 1H2NA 2VQFB 1YBYA 2QTSA 1N07A 3FPKA 1EZ6A 1ONLA 1SNDA 1X32A 3P20A 3J81N 4JI1Q 1AIPA 5IYCO 1NH2D 4DK6C 3N2GA 3W2IA 2ZZQA 4JI0Q 1WTRA 2ICIA 1IDSA 2ATKC 2UUBB 4AH6A 4WFEA 1XILA 4X62Q 1IBKQ 5IYDG 3NELA 3AVUA 2Q8IB 2OCCC 3X3MA 1KYOF 1A6XA 3GTGH 4JI2Q 1E62A 5L46A 2Y4TA 1HTPA 1E1RA 4Z2WA 3W7XA 4ZLTF 4DW1A 4X64B 3TXQA 4LBVA 2KCNA 1DLBA 1IJEA 2N04A 4TQFA 5EIBC 3CPWA 3MDSA 1E79A 4CJ2C 4Y7CA 3RZOH 1VQPA 5GONB 2UXCL 1SESA 3WBJA 3W7TA 2JN9A 1PV0A 4CS3A 2EXZA 4IPCA 5M9OA 4DV0L 3E6ZX 1FXHA 5EBCA 5C4JH 1QVFA 3CXCU 4OPVA 1VMCA 2D9UA 1P84F 1Q5OA 2JS3A 2EJRA 3TXSA 2C77A 4I7ZC 4LMQD 2YDEA 4ODGA 3F2CA 1BT8A 4BXXH 4KUMA 2BPOA 1E63A 1KDBA 4MS2A 4RQEA 2XEXA 4FM0A 1A8VA 1IJFA 2X85A 2RHSB 4KJOA 4DUYQ 4HIMA 1Y1WG 1F9SA 4V190 1N32Q 2YU9H 3CC4V 1TVKB 3ZBTA 1OCRB 3G71A 4LBYA 3ETDA 3I56B 2CUGA 1WJJA 4LF8O 4DR5O 3A0RA 2B1IA 1JR9A 1SS3A 3MD0A 1WCMG 3CRKC 4KKSA 5IT9N 1SQPH 1IXRA 3HFZB 3CCSA 1J5EQ 1JICA 3DWAA 4JOIC 4IUNA 1OCZB 1HA3A 1OB0A 4LFAO 1HNZB 1S72A 4NR1A 5KUMA 3HKSA 2E76B 2X6WA 4MVZA 4DA2A 2DMXA 3SDLA 2NYZD 3OUSA 4JPBW 3I4MH 1EFID 4J9ZB 2OT5A 4K8JA 4F88A 4DV1L 1WTPA 1M90W 2P7TC 1NAPA 3OWFA 3ZPNA 2ZM6Q 1YITA 1YNJD 1XREA 1PRTD 4MHEA 4QFMA 4KXRA 1EY0A 3I90A 3J7AU 4IOCA 3I55B 1KL9A 1XHZA 2Q2HA 1F77A 4A3EB 3PO3G 4WBNA 4UP7A 2K01A 1RSOA 2PI4A 4P9SA 1EOVA 1WTOA 3F2DA 2A6EC 4PMCA 3W5UA 4DK3C 3N27A 5M3MG 3S9WA 5EPLA 3OMGA 1EU3A 3U6BA 3BVZA 5IJ9B 1M56C 2RVLA 3RZDH 1UD2A 3OAAG 1XTCD 2IJ0A 2OTLB 1B3AA 2DYSB 1SC5B 4MN3A 1DF4A 1FKAO 5M5XH 1PH2A 2UU9Q 4B3RB 4DV3L 4A75A 3BY6A 1AE3A 3MC0B 2PO4A 4UB6Z 5D5PA 1Y8OB 3KF8A 2ZDIC 1S5DD 3IAYA 2HCJB 1PH1A 1LUWA 2RC5A 4YALA 4J8QA 3TP8A 2UXBL 2E1RA 1D5XC 3HKDA 1GJRA 2NBFA 5HGQA 1PNKA 2BMWA 1EWIA 2F0UA 2GA4B 3CMEA 4J11A 2K1EA 4C1NK 2DGYA 1VCIA 4TT3A 1IYVA 1KD1C 4IGGA 4JBMA 4O2AB 3A7LA 3S14B 2LFSA 2VB3X 1FFXB 2ZXIA 1N36O 2B2VA 1YNJC 3AEVA 4B3ML 2H5XA 1GKFA 2OYQA 1LYLA 2WV6D 4IIJA 4LF5O 3A74A 4X7DA 1WD0A 2UUCO 1CK1A 3GTPB 1QE6A 3S1RH 2DJFC 2R9VA 4U673 2RDGA 1N8RC 1IBKB 4LF8L 4LBWA 4RD3A 1JJ2A 2ILMA 1TXYA 2F0GA 1I7PA 2YIBA 3P30A 3QO7A 4P73A 4DR4B 1CHQD 1MI2A 1SNMA 3ZHRA 4ZUIA 2LFNA 3T1HL 4A3LG 2DUDA 1C9OA 4XDJA 2ZXOA 3G6EV 1S72B 1K8AD 2F23A 4X62B 3EIVA 2OT2A 5CMDA 1W59A 4FMTA 4BBRB 3RYIA 2BOBC 4A3FB 1WP7A 4JOIA 4RMFA 1TA8A 1G2SA 3GTQH 1LT3D 3M9BA 1B3QA 1M4UA 3P1HA 2VBUA 2KCCA 3ZHQA 3BS1A 2N78A 1I94O 3WU2Z 1NJIW 1KMIZ 1GH6A 5CC4A 3D6CA 3W1BA 3GTOH 1YDXA 4QPJA 3IL8A 1Z7TA 5JJKA 4A3GB 4LUVA 4HAEA 1CNEA 3JAMN 5JVDA 2F4VO 2OTLV 2QEJC 4JI7B 4XOTA 4P22A 3BYYB 5D65A 5BN5A 1HNXQ 4OOSA 1PL0A 2Q7EA 3C3TA 4H44B 5B1BB 3NBHA 3S17H 3ZN0A 1STBA 2A74C 4DV2Q 1FS0G 4L5RC 4MW8A 4CGYB 4TUYB 2JJ1G 3HZXA 1KKDA 5DS0A 3CRLC 2PMZE 3HRZC 3ZMTA 5LGUA 3CTAA 1DM0B 3FKIH 1WOOA 2IPKD 4K6DA 3SPCA 1OCOB 1R3KC 1FRNA 1B70B 1EQVA 2RCVA 2LKVA 3PMFA 2D0OA 1IBLQ 3ABLB 1JMCA 2YC0A 1D5NA 4BR6A 3OTOB 1PH9A 3RN4A 4JI1L 3CESA 3UT5B 4I9QA 4WZEA 4DR3Q 5CGKA 4A3IB 4JI4B 2V7QG 2Y69C 3DGEA 3IC9A 5KMGB 4YHHO 1CKNB 1Q1BA 2PMZB 1HRJA 1QLNA 3T1YB 3QFCA 3PUVA 2K75A 2GBOA 4DAVA 1NQTA 3LDDA 4R8NA 2ES2A 1ESFA 4AF7A 1MD2D 3G4SB 5M3FH 3CCQB 2IX1A 2L11A 4PA7A 4C3JB 1ENVA 2OYNA 1JFFA 1OCCC 2IW5A 2JP1A 3AG7A 4P9OA 4QGPA 2KCMA 3RD4A 1AP0A 3NK9A 3SHLA 4A93H 4TMVA 2WZPP 4FFBB 4RD4A 3CRRA 2DJGC 2Z6KC 3E8FA 4DV7O 1COWA 3F2BA 2F0OA 3CAMA 2SDFA 5TR9A 4DR2L 3C1FA 4A3BB 5IY5C 4IZ8A 4AF6A 2EYFA 3OAAA 2VNHA 1AE2A 2ZXWC 4J1MA 2ETNA 1V55B 2Y48A 3SJQC 2RA4A 1Y14B 5C4XG 3SR2C 4DR2Q 3VQYA 1WOPA 2BCCH 4AYBE 4TRDA 1BX1A 1N08A 2BE5C 4CC5A 4JI1O 2RDCA 4LFCO 3J80N 2AZ0A 5I6WA 4FLYA 4DR6O 4WCEV 5KLVH 4C3JG 4KLKA 2VUMH 1MSDA 3STZC 5IYQA 1HNZO 2GVBA 1WD1A 4E2LA 3H9NA 5JJLA 2B63B 3CCSV 3NHHA 1U97A 2Q69A 4JI6L 1N34O 3STLC 2H8PC 3HKBB 4R4OA 5EKKA 4ZI7B 4X1YB 3ZMSA 5FNZA 4Z9CB 2FKXA 4DGZA 1LABA 2UXDO 3CC4A 3HOVH 2RF4A 2Q2TA 1M57C 4FZ0A 5KHHA 1ET9A 1SFOH 4TSFA 4G7OC 2OK8A 3TEHB 3ABMC 5CYUA 2IWHA 1D2BA 5KW9A 4GS3A 1SRYA 2LO1A 1H9RA 1VQ7V 1XFOA 1E2ZA 1CXZB 3FB6C 1S76D 4B3TL 4HYOA 4IPHA 3TS0A 2XAGA 4ABNA 2X0KA 1EL0A 3I8ZA 3Q4HA 1IURA 1V9PA 3A8IA 4N8FA 3J7AF 1RPRA 1BVSA 4PC6A 3OW2A 5EPJA 5LMNO 3CRZA 3DC6A 5BSYA 1Y74B 3PIPA 4OIJA 4ALPA 1I4RA 1VQMV 5C44H 1YJ9B 1WPBA 1SLJA 2H4OA 4X64L 4DAYA 1RJTA 1X4TA 1DXMA 3J7YW 3CC7B 1A2TA 4WFN3 1FXKC 3A8JE 4A3KB 3HOXB 4JBJA 1GM5A 2R93H 1WFQA 3ZIAA 1VQ4A 5IYDH 3HPLC 1PD3A 3CXHF 1XNQQ 5H6QA 3X2QB 1WDTA 1EWCA 1TWHB 3J81j 3WG7C 2Z3YA 1VJSA 3T16A 1Q3EA 1UFIA 4JF3A 4WFGA 2X6YA 5B1BC 4R50A 4IPDA 4LUZA 5A2QL 1KC8W 2UXCQ 1EFCA 3CD6A 2XGTA 1NJIC 4N9TA 3VDYA 2O5IC 2R92H 3WQZA 1E1RG 4JI4O 4MYTA 3RLNA 4RGOS 1EBOA 2K5WA 2R93B 3CMAV 2WLLB 3ASRA 5J1ZA 3WOEA 3C90A 3OFNG 1QVGB 2AQ1B 2UXNA 3FAVB 1V1QA 1W2BB 3ONUA 3PSIA 3RN5A 2N05A 1VLOA 1TS4A 1WB8A 1B7YB 2M5SA 3ZRXA 4I4TA 2WLHA 1EFRA 1EP1B 2GK7A 1GO3E 2OEOA 3W2HA 3Q0AA 1S5ED 1YJNV 1WPXA 2XAFA 2QN6A 3SJPA 1OXVA 2YEVA 4X66Q 2PZWA 3A1PA 1N9WA 3TREA 4GKJL 2JJ2G 5FA6A 3S3XA 1MHWC 1EY9A 4XDLA 2WA3A 4X62O 1WNSA 5JVH3 1Q82D 2QTZA 5EJWA 4GOPB 3EXAA 1N05A 1FX0A 2JYOA 4QE7A 2E75B 1P7BA 2LY7A 4OGQC 1Q6IA 2F93B 4LF4Q 3D6WA 2OTLA 2YTYA 4L63B 1R6NA 3E8BA 2UUAB 1MJEA 4Z4WA 2QTLA 4EQNA 2B2UA 2OTJV 1JE5A 1CA6A 1O9GA 1GK9A 4C3HB 1IL8A 4AI8A 1M4VA 3K08A 5J2UB 1JC7A 3CYOA 2KJXA 1KAWA 2N3SA 5L37A 4RDJA 1NKDA 4LP8A 1RM1C 4GKJO 1IBKL 4JI5Q 1MOFA 1D2EA 1STEA 1S77D 1V1PA 2I5MX 5C5MA 4TWKA 5E1AC 3CMMA 4MTOA 2EFGA 1QCBD 1PMRA 5D14A 4TVAB 5HGTA 5KX5B 4K0KB 4YIJA 5KHJA 2WJVA 3FKSA 3SLNA 1FGUA 2D3NA 1NNXA 1QB5D 2X6BA 2D0PA 4YY3L 2EIKC 1SYEA 4RGNA 4DUYO 4LAAA 3U0ZA 1RL2A 1YX2A 1N32O 1P49A 3UQ8A 5HZAA 3BHPA 3SPHA 4M8AA 5KNBA 1KNEA 1QHTA 3Q4HB 3X3NA 3CJHB 3K7AB 2Q6KA 1KABA 1U9RA 4KFMA 3T4DA 4J7KA 2EYHA 5J2UA 1SMYC 2TSSA 1VS0A 5CA1B 3JD1A 2VYQA 3VR6A 4K0KO 5IYCH 3PV0A 2WR8A 3PUWA 2WAQE 1N4CA 4OXSA 1HNWO 4OOVA 4BS9A 2HLDG 2HVKC 2Q67A 3ASTA 4RPDA 1TT2A 3PUXA 5M3FB 3OZUA 1JA1A 3L9DA 1Q8KA 3CMEV 3JALA 3QO2A 4POFA 1FJGQ 1GN2A 2QEXB 2A19A 4XKVA 3K3WA 5BR8L 3U10A 4EB6B 4DV4Q 1EQQA 1K8OA 1SA0A 3ICXA 2PQAB 3CMAA 2Q6AA 1EUJA 1D5MC 5CBEE 1WORA 3S2DB 1MSHA 4JYAB 4MVUA 3PUZA 1I18A 2KCTA 3ASOC 4I4TB 4OELB 1UE5A 5EPKA 4YJ2A 4DR5L 3O9OA 3NXSA 1V0FA 3CB2A 2C4UA 3NTHA 1TVXA 4A4IA 3RWRD 1Q8IA 4ASUG 1H8HA 4M1KA 3KKYA 3WNDA 3GVKA 2QWOB 1YI2B 2MPMA 3CJHA 2DCUA 1Y0YA 4M4SA 4XT3B 4ZAIA 4DV3Q 2Q2UA 3K0GA 3S3WA 1EYCA 1PYSB 2ALYB 3SK8A 4L5SA 1K92A 2NVQB 1HZBA 2PMDA 2X8KA 2I5LX 1Y1VB 4LNQA 1VQ6V 4F8MA 1VQMA 1VQOA 2EY1A 3CCJV 2BE5D 3DM1A 4UV9A 2BDNA 4RPBA 3A3GA 2WAQG 2Y0SE 1PH7A 1SA0B 2XZLA 1WCMH 2ITDC 3MXUA 3VYRA 4UAIA 2CTPA 3UE1A 1EFUA 4DR2B 4NMZA 5KUKA 2R9AA 1OZ0A 3I1FA 2WIIB 1GTOA 1UEBA 1VQ7A 4LF5B 1A3UA 3GTQB 2EIJB 3WG7B 1B9MA 4DR1Q 3SYAA 4F6RB 1RFYA 1Z5VA 4EKWA 1RQRA 3AFQA 3E83A 4JASA 1IBMB 2F4NA 2UUAQ 3E22B 2HMAA 2MW2B 4Z4UA 5DM6V 3T4ZA 2ZITA 4J42A 3OKXA 2YYZA 4NXMQ 3M4OB 2R9RB 3UI2A 4L87A 2DY8A 4ZKCB 3G71V 3HOZG 1GOZA 4A3CH 5LMNB 4RDKA 4GKKO 4X8IA 2AW9A 2KENA 4NKLA 5E3FA 3KDFA 3VR5A 5C4HA 2BOCC 3H1KH 1MMMA 4WJWA 4X7EA 1KD1W 2XTIA 5FJ8G 3JQPA 1F60A 3E1YE 3ES9A 1G2TA 3RYFA 2C5HA 3A3BA 5GROA 4JI4Q 3WDNA 1SYBA 5H59A 2E2IB 4X1IA 3BFRA 1Q82W 5FLXN 3FPUB 3ABMB 4YIOA 3UKMA 1TS3A 4LWCA 5FOBB 1DF5A 1VF7A 1Y1VG 1QR8A 3BCFA 3BZCA 1KRSA 3S1MB 4X62L 3RLFA 3W2EA 1A2UA 3L0OA 5LYJA 2VQFL 4JZ2A 3K0DA 4LWSA 4WFHA 4YEJA 5LHHA 1WP6A 2GREA 4JGSA 3ER0A 5BZBA 5EAYA 1L2FA 4TN1A 1IBLB 1HUNA 3CKIB 4A3JB 3U6KA 1TS2A 1STHA 3Q6RA 4X9QA 1PTOD 2W6IG 1GAWA 2RQXA 3KF6B 1NS1A 2XWBB 1JB9A 4UPAA 4OOXA 2HQLA 1MIUA 1EIYB 2HIXA 2V4DA 2ZJQA 2G38A 3CC2V 1IKMA 3WBKA 3KFUA 4AQYO 1D1IA 4YHBA 2MNAA 4FFBA 5EBLC 4FO2A 3UE0A 3PO2H 4J9YB 1W34A 1TWHH 3JARA 3HG9A 1VARA 3I2ZA 1QWYA 3ZUGA 1IXBA 3CXCB 1IW7D 1JFFB 2QWQB 4B43A 2GK6A 1YEWA 1K4DC 2ZXWB 4O4LB 1N06A 1PFBA 3CCQA 4LF7Q 2UUAL 3TK1A 5B1OA 1YHBA 4DV5B 1GAQA 1BCPB 1G6UA 1WU8A 2Q0AA 4ZKIA 1KBHA 4WQMA 4XORA 2NZHA 1TS5A 3OEHG 3M4YA 4QMGA 2EINC 1JVMA 3ZYYX 2HEPA 2JA6B 2IH1C 3DC5A 3JAKA 1ZUQA 3JD3A 3OIPA 4HSPA 3H15A 5LMNL 1RM1B 4JI5B 5EZYB 4BW9A 2VQEQ 2Z5UA 2EJ7A 2YS8A 3CRAA 4B3MB 1JNYA 3BCDA 3JQRA 3QFSA 1EZ8A 1HUMA 2RHQB 2F4VL 2ITCC 2SOBA 3RNUA 1DGSA 2EY5A 1PRTC 3PO3H 1KJZA 5TY0A 3MCAA 4BIOA 1ZYRC 2CAZC 3S15B 4A3DH 1QG0A 5I9PA 2R93G 3ABKB 1GN3A 2BDOA 2OK7A 4BIZA 2JDIA 1SMXA 1SJED 4DV1Q 4A3DB 1FNDA 1SETA 5THXA 3KLSA 1RTNA 5EBMC 2FL4A 5BR8O 1PJ7A 3VNVA 4FK5C 4FLZA 1TWGH 4L5TA 3CCUB 2Y0IA 3URYA 2Y4UA 3DWPA 4DR4L 2XUMA 4DV3B 1RD9D 1FPOA 1TU2B 4OEMB 1Q43A 4WZLA 1YEZA 4Z4VA 4RGTA 4QF4A 1HNWL 4B3GA 3B6YA 2GUZA 2CWAA 1K7DA 4CH4A 1HFNA 4G2KA 1FYJA 5BR8B 2PI2A 5EKLA 1WYDA 2AQ3B 1E1TA 2YV5A 2B2TC 1SYCA 4HMIA 1XNQL 1HPCA 2DIEA 1J9OA 5E1FA 3RYIB 1XMQL 1SZTA 1N34Q 2P22C 4X20A 1BCPD 2ZXHA 4TOIA 4ZIBA 2CK3A 3UDGA 1B8AA 4ID6A 1B53A 5C0XI 4KY5A 1EM1A 2JE6I 4JI8Q 3PJSK 4EQOA 2VS0A 2V7VA 1PH4A 4MW3A 2PZTA 4JV5O 3FDTA 5TRDA 5AJ3Q 3ERSX 4FXDA 5IGBA 3DHQA 4X06A 3W7WA 3A8TA 2KVMA 1FXKB 5KYLA 2B2WA 5LMUQ 1K3BC 4UHVA 2A69C 3R3OA 3E3XA 5IYCG 3M4PA 2PZSA 1Y4MA 4YCWA 4DYLA 1N34B 2XZOA 3TP6A 4DU9A 4G1BA 1NB0A 4II3A 1NTZH 2GTAA 1VQLV 2FYUH 3E20A 2RKSA 1VQKB 2F4VB 5I6YA 3JATB 2CQOA 2NB0A 4LF9L 5LA6A 1R3IC 5L3CA 4JVZA 4A3IH 1JB7A 3HOWH 1KRTA 4YAWA 4H02A 2ARHA 5B1AB 1GUOA 3P75A 3J80i 3HKDB 2EZPA 2YWGA 2QJ1A 1TWCH 4U68A 1FAFA 3C46A 1L0NH 2Z6BA 3OM3B 2IX0A 3M7GA 2P67A 2CC2A 2BVNA 5J9PC 5JVDB 1IZ6A 2G9HD 2YTXA 4DV5L 4A3FG 3S2DH 4NXMO 2ZZEA 3LWUA 2ZR3A 3ZCCA 4K5WA 2F0PA 4WRDA 4DK1A 3PIP3 4GKKL 2UXCO 2PZUA 4PDMA 1V1OA 2WINB 1E3XA 1ORQC 4XBFA 5LL6X 5LBQA 3ZJYC 1L1OB 5KA5A 3ZBUA 4LF4B 1E43A 4C2MH 1PP9H 3B77A 3HKZB 2JGUA 3QOJA 4EFEA 1W9XA 3K59A 2EIXA 2WLMA 1I4GA 3ZRWA 4TMWA 5C93A 1KZLA 1M1KD 1L0WA 1I3QB 4A3MB 3GTOB 5KHGA 3ZMVA 5IP7H 1K3RA 4LF7B 2EE1A 2JVDA 3N2GB 3K81C 1OGIA 4Q5VA 5KX5A 1W0KA 3HEJA 5M5YB 4U3JA 4JI3Q 3E8HA 1VQ8V 3EQLC 4B3TO 5AG2A 4MVRA 2B2VC 3VR3A 5B3SB 1ELOA 3BY2A 2QDOA 4JG2A 2P4KA 1I94L 3K8AA 5D5QA 4LF7L 2L12A 4GLXA 3J80L 4DV6B 2SNSA 3QTCA 4PABA 2D2CC 3KBXA 2E2JB 3ULPA 4IURA 2ZCEA 4DV7B 1K9MD 1AP6A 1I5XA 2EYLA 4X64O 4ZUJA 4WWVA 2DOGA 1OCCB 3B8NA 3S1NH 1VHEA 2RCNA 2N49A 4DR3L 3AG3C 3BVMA 4AVZA 2OTJB 1VQNV 1X3GA 2IW3A 4HIKA 1DZ1A 3CF5A 1OJHA 2X6XA 1AW7A 1K97A 2QDBA 4O42A 1KDCA 1TVKA 2BE3A 3R2TA 4HJ8A 1I0HA 3BYTB 4BY1G 2XAHA 1PFSA 2IY5B 1D8LA 3MEHA 2BA1A 4X7CA 2KEEA 4I50B 2Y69B 1S4MA 1F9PA 5IYBO 1ZKOA 2KHJA 2XNAC 4MNOA 1Y0RA 1VQPV 2DY7A 4QJFA 5F2DA 3CCJA 3DXRB 1ML0D 3JAML 1W2BA 3BVGA 4FF3A 4DN4M 1YSCA 3ZJZA 4ZGQB 3O65A 2DQ0A 1SKQA 1N36L 4YCVA 1TUEB 1ZX3A 1HNXL 4FF4A 3ULJA 3PGZA 4B3TQ 1OCOC 2IJHA 5HURA 3RUZA 3UDIA 3T1CA 2CHBD 4RA8A 4DR6Q 4K2KA 4X3UA 3BH4A 3OW2B 1CKNA 5GAGC 1YJWA 2A73B 2QWPB 1HNZQ 2JA8B 4ZV4A 4OXPA 3QO5A 4LF6Q 5M5XB 4IHJB 4O4JA 1UD5A 1RHPA 3JSLA 2JK5C 1JT8A 4P26A 3OGCC 1HNWQ 1BXTA 2YXLA 2LGQA 4N21A 1B1ZA 3MA2B 4RO2A 4LFAB 2GPJA 2CW0C 3UDXA 1N33Q 4Z4YA 2FTKA 1KXLA 1MJCA 1MSWD 1PA6A 2NPFA 3VO2A 4CC6A 5DECA 3BZKA 4J10A 4Z1MG 3PUNA 4G7WA 1E1OA 1RKNA 1M9NA 4U7NA 2WB1G 1B44D 5FO9B 3HOVG 1H2KA 4F6EA 2ZQMA 3PVDA 2K04A 4X7FA 3D8GA 2F0MA 2PIAA 1BS3A 4JCVE 3DXRA 2WA4A 2Q5ZA 3MHPA 1BMFA 1J6QA 1QQCA 3H1IH 5LGTA 4TKOB 1IBMQ 3M7MX 1XX8A 4HE6A 4JI0O 3UCSC 3TETA 2ZE8A 4R6ZA 2W6JG 1HNWB 1QFYA 2D62A 1QUQA 3I4MB 3HOUB 4G27B 3K03A 1YNND 4I65A 4JI6B 4J0QA 3IC7A 2K03A 2LXKA 4HSVA 3OEEA 2A3QA 5JJIA 2KQXA 2X3UA 3CRMA 1XMOQ 1BNZA 5J39A 3APQA 1SRUA 4CDEC 3FB7C 4BY7H 1XL4A 3PA1A 3SJAC 3AK3A 3QR8A 4FM1A 3HS0C 1KAAA 1ZXTA 1YZ6A 3VQWA 1VQ5B 2MUYA 3LNNA 1SERA 4ICGA 5IYNA 3CCEV 3S15H 3BA9A 4YXWG 5DN6A 3GD7A 3FX7A 1I6HB 4OWTB 4DO2A 4KTAA 1DARA 5CORA 4H7BA 3ZHVA 3E0JA 3QJYA 4X65O 2GJRA 4JZGA 3CCJB 1A8PA 3CB4A 2UUAO 1MABG 1X3EA 2WKCA 5C44G 3CC2A 2YU9B 1FJGB 1US6A 2SNMA 4FDBA 3Q24A 4JI6Q 3E89A 1VQ9A 3ULLA 2VUMB 1K34A 4JI7Q 1SQVH 2RMKB 5GTIZ 1R6TA 4KJNA 2UUBQ 4X65B 1R6KA 3KL9A 5H5JA 4YAFA 2EIKB 1A3TA 1SYDA 2VBVA 1BGYH 1ENAA 1LTSD 1AI6A 2PNHA 4H9GA 2B63G 3AG4C 2BM1A 2JEUA 1OXXK 2QW7A 5JQGA 4AQYL 1T9HA 4JI7L 3MFGA 2AWNA 3RYFB 1QGZA 3P3PA 3L70H 3VR2A 1JOQA 4A3KH 1TY2A 1PHJA 3L72H 2ZM6O 2OF1A 1SBBB 3NBHB 5EQ0A 1IKLA 5C0XJ 1IBML 2W6IA 4GKJQ 5A88A 5E4WC 4BBRG 3I4NG 3KG2A 3L73H 1B06A 2YIAA 2BSAA 4DR6B 4PDVA 3J81i 4DV6L 4OGQB 1QVGU 4IFDJ 1B6QA 1NSNS 2FMMA 2F43G 3CP2A 1Q3LA 1HXYD 4IJHA 1R5OA 1V0EA 4U7OA 2QKCA 3ZZTA 2E74C 3L74H 5C3EH 3BCCH 1PH5A 2Q7HA 2K33A 2VWJA 1YJWV 1X3PA 3P7JA 4RG1A 2YWFA 1HZ9A 3PIOA 5GV7A 4Z4SA 5A89A 4HR7B 4XQQA 4UCVA 1IX9A 3GV3A 3AYHB 1I4QA 4LC0A 3BDCA 3AB9A 1P7GA 4JYYA 3W2FA 1I08A 2YXYA 2B1GA 1IYJB 4C3IG 4CDFC 4QUZA 2WZNA 5KYIA 4LCUC 5GW7A 5G3LD 3I4NB 4X3KA 2GSMB 4PELA 2Q6LA 1TUBA 2E5LL 1A63A 1FDRA 4PDRA 1S0UA 2C35B 4DR6L 2KECA 1EFTA 5CMUA 1EWYA 4LFCB 1H42A 4J41A 2D9RA 2ZNIA 2F1LA 4KKUA 3T1HB 4Z4ZA 2BOSA 2ZXPA 4PMBA 5JPMC 4NCNA 1VQCA 3NEMA 2K5QA 2OXPA 1KQSA 4I0XA 4ZHQA 3JATA 1VF6A 3RVYA 4I50A 1VF5C 1WP8A 2UXBB 3CHBD 5E7NA 1M1KC 3KYHC 4LF8B 2EYPA 4TSSA 2HG5C 1W0KG 1S3OA 1KP2A 1EY7A 3MXNA 2BCOA 2ZTCA 5IIFA 2YI9A 4OX9B 2EYOA 1K0SA 1R5NA 2Q68A 1YVCA 2J4XA 1N8RW 3HKZG 2V7UA 1JQYD 4POGA 4Q7JB 3HGBA 2PCFB 4IL6Z 4RD1A 1NVPD 1PTOB 1EN4A 3A8KE 3M99B 3RGBA 2Y0PA 3KLRA 5KEEA 4GNXC 3WYAA 4A3FH 2QF7A 3A7AB 1XQBA 5BR8Q 4DV4L 2PF4E 4XD7A 4LFBQ 1TGOA 3GTMB 3AVYA 1K4CC 1H2SB 4A3MH 1FJGL 1MA1A 3EFFK 3H6MA 1JA8A 4JV5L 2O5JC 4A3BG 2EIMC 4O2AA 4X20B 1BBUA 3ND8A 4QCLA 3D3QA 3MXPA 4J7ZA 5FL7A 1U5KA 1HCZA 2NTSA 3GV6A 4CKEA 1NMGA 2VQFQ 3HR0A 4RD0A 4IJLA 2OQ0A 1STYA 5M3MH 3SXHA 1F9RA 4YHHL 3HOUG 1HVXA 3ETQA 3U4ZA 4P9PA 2IT1A 2XN9C 1VQ6A 3E8GA 2C2AA 1ZWIC 4MTFA 2J7ZA 2CTQA 3E22A 3JCZA 3AMUA 4IUUA 1DJRD 1WAZA 4F6RA 4IW3B 1GUWA 5IP9H 3J80c 2K5NA 2PW7A 1SNPA 4DK0A 1XEQA 1Y1WB 2F0WA 4CJ0B 3STBD 3OHXC 3KCXA 4QE9A 4DNTB 3PF5A 2OCHA 1DG1G 1BCPF 2NN4A 1GN4A 1GUNA 5LHIA 3A55A 5IOCA 4E0FA 1BQZA 2Y0SB 1NE3A 5IGCA 2LQTA 3AG2C 2C9OA 4H33A 2OBSA 4EQ5A 3L3OC 5IGDA 3M85A 2DY1A 1VQAA 1RSOB 4JYAO 4KV6A 4DV1B 4I5SA 3TCUA 3BEHA 4P72A 3J81k 3OIQA 1VQOB 1STGA 2Z8LA 4O0AA 5ELOA 5CA3A 4S3SA 3SJBC 4O4HA 4JI3L 2K14A 4M0LA 1KK3A 4DXWA 2A6HC 1GUTA 5CV5A 2MGSA 1P4MA 1FNBA 1Q46A 4OPAA 3GVJA 1XMOL 2F4VQ 1CKMA 1WN7A 2ZE7A 1XMQO 1GM9A 1PNLA 1RP3B 5JBQA 1B4OA 4JI5L 2HDLA 3CD6B 3PCOB 2VWKA 3FKSG 3S1QH 4LC1A 3C2PA 1G8MA 2XIWA 2MHVA 1MZFA 4YJ3B 2X6GA 3OYYA 2Q7GA 3BJUA 3A35A 2D3OW 2XVSA 3K80C 4RCNA 3VYUA 4U3JB 2HCCA 3EFXD 5FO7B 4JI2B 5KGUA 3LSUA 2Z4IA 2PYJA 3GP7A 5BMVB 3GTPH 4RDLA 1E3PA 1E22A 2EYJA 2HCIA 2JEAI 4UVBA 4X05A 2ZT9B 1QVFU 3DMUA 1XL6A 4XKWA 3GDEA 2NVXB 1S4ZA 1LTRD 2QMUA 4WF9V 3VOUA 4GCZA 3W2GA 4R1JA 4B9WA 3FPPA 5IT9c 4TQUS 3A8KA 2Y0SG 1R9TB 2OIEA 3OE7A 3Q38A 2WLIB 2AKWB 2HDNB 4DR7L 3RT3C 3UM7A 1S0VA 2A0LA 1KLUD 3NXWA 2JJ2A 5JVG3 1DONA 1GO3F 5EYPA 1HFGA 3GTJB 4DV2B 2A1AA 4HZ3A 1VQ8B 5FLMG 1MG1A 1IYUA 3SYQA 5HY6A 2QKAA 2YXHA 3CCUA 1O9HA 5AFWA 1HNXO 3F5TA 2QWRB 3GVMA 1BLIA 1A3VA 5LMNW 1UUPA 4W4KA 3JD4A 4HE5A 2PYKA 1AR4A 3ITPA 3OFNA 3TSSA 5BN4A 3WXMA 2AUKA 3SEBA 1N33L 5KMGA 4DR1B 3H9VA 4X0CA 5BY1A 4G7ZC 3RZDB 3I55V 1VP7A 4GKJB 1DTOA 5ELBA 5H5NA 5CB4A 3A5ZB 2VBTA 3MXGA 4KN4C 4WORA 1XNRB 2CW5A 4JBKA 1VQNB 1XPRA 3K9AA 5A2QN 4HBNA 5LMNQ 1IZ3A 5J22A 3APOA 4BBSH 1H85A 1N0JA 1GAXA 3DUZA 3Q8DA 3ZIAG 4FXKC 3K57A 2PUSA 3SDZA 4TUYA 3GTGB 2EJMA 3KJPA 5IODA 4UVCA 1ENFA 3AGPA 1Q12A 1DOLA 1ILQA 2EYMA 2EY6A 5K36H 5ISRA 4X65L 1SQBH 2YSUB 1E64A 2A68D 3ASNC 3MTSA 3RYCB 3CRCA 2JGDA 4CKCA 1I6HH 1N8RD 4JI0L 2IJKA 1PFMA 2JN4A 1VQKV 4PQXA 2KHIA 5HKKA 3O13A 2HIVA 4B3XA 1MSGA 2WLKA 4K8ZA 3FEWX 3PQIA 1X9NA 4GKKB 3NQIA 2UXDB 1OB5A 3NQTA 4DV5O 4CQJA 4DV7Q 2R9IA 3P27A 1Q81C 1JCKB 2CCZA 5D3IB 1OV9A 4FIPC 3LO8A 2I46A 2P6JA 3BPZA 3LSQA 4JTDB 2V7WA 1PM9A 2DN9A 1YITV 3PENA 1II3A 2HDMA 2R61A 3ND9A 5FPOA 4P3IA 3A56A 3Q22A 3AEIA 4K8XA 1O7IA 3DLLA 5IJ0B 3ONYA 4DR2O 1M5IA 4O4HB 2Z6KA 2PY5A 4HAMA 3J81E 1NTMH 5LGNA 2WSSG 2HHHB 2VNKA 4GQNA 1H9SB 1MGSA 3JAWB 3I70A 5CR3A 5C5LA 1NR1A 3OMNB 4N9PA 5K5PA 5T1IA 1GD7A 3CCVB 3KCYA 1S72V 3G6EB 3GTKH 3RFRA 2QGGA 1JJ2B 4PZ7A 5IWAQ 2VQFO 2FINB 4WJ4A 5FK9C 2E2JH 1SE4A 4B3RL 2XZPA 4Z1VA 1NTGA 2W0XA 4CH3A 3RYCA 4CDCC 4A93G 3RBZA 3BABA 3I72A 4FLUA 4RCZA 4A3IG 2D2CB 4NXMB 4LF4O 4OO1H 3CCRV 2VQEB 4TV9B 1KC8C 5HZBA 1F20A 4PGOA 1W0JG 3R2IA 2MQHA 3OJXA 4OIKA 3ZMZA 2DNCA 1J5EL 4A93B 1PZJD 4FF2A 3D3RA 2R7DA 3HOYG 5IYBG 1I4PA 1G291 4NW2A 1NT2B 5F4MA 4C3JH 1JJGA 2CKZB 1XNQB 5FLXL 2E76C 1F2LA 1VQBA 1TLLA 4AYBG 3B8MA 4RQFA 1ZUNB 3G67A 2RBMA 2JIZG 4B44A 1GM8A 4OPHA 1X3QA 5EC2C 4AC9A 2B39A 1KD1D 4RAIA 2K05A 5H2FZ 1NH2B 4ASUA 3CC4B 2KEDA 1PXUA 3U50C 3CXCA 1L1OC 2ZM6L 2HD3A 4ZI7A 2AUJD 5CN0A 5JCOC 5GQOA 2GDSA 3GTLH 1HZCA 4EGVA 3LNMB 2Z0AA 2WB1E 2NNUA 3A5UA 1R73A 3VYTA 4B9XA 1KQSU 1TY0A 4J7JA 4WZTA 2BTOA 3F5WC 4JI3O 1KTKA 3CPFA 2UUBO 2V7QA 5FNVA 3G6JB 5FO8B 5CV8A 2KKWA 3G80A 3EVQA 5HFLA 3CQZH 4FWTA 1BE3H 4DV0B 3MXNB 4ME5A 4HJ7A 2VJJA 2CGNA 4EQPA 1YHQA 3HOZB 1ZL8A 3ABKC 1KUQA 1WA8B 1NBWA 4J80A 2HLDA 1BOSA 3CCVV 4GX2A 2VJIA 3MHSC 1P4RA 1RQPA 1CT1D 1O80A 3R8BA 1AROP 1X55A 3CW2A 1ZM9A 3U9OA 2VS1A 1FFXA 4DV2O 2CH4A 3V05A 1K9MC 2JJ1A 2YICA 2VY3A 4ME3A 5COYA 5TSSA 2V1DA 3RLOA 4JI4L 1PFNA 3M4OH 1G7CA 4IFDH 1LT4D 4JAAA 4JTAB 1YTFD 5IK2A 3SVMA 4ABMA 4DUZQ 4DV6Q 1FR3A 5FJ8H 2VW9A 3CP0A 1IBLO 4B47A 1P16A 4BY1H 2XAJA 2KUMA 1VQMB 4DR7O 1I50H 2UUCL 3C1EA 4NXNQ 1PNMA 4R9WA 5JEAH 2F0SA 1A32A 2Q8TA 2M9VA 4CHTB 1Q90D 4PD4F 1MRZA 3VNUA 1SN8A 3FRPB 4MIUA 3HKCB 3K79A 5L3BA 4WFAV 1GN6A 3K5LA 1BJKA 1RODA 2FMCA 1G91A 1DYQA 1F4NA 1K33A 3RR5A 1XQ8A 2YWHA 2DJVA 3UO3A 1C7YA 4LF6O 5KHIA 4DR7B 4M53A 2A69D 4H13C 1H2LA 2IJJA 3CMAB 1BDOA 3FB8C 4B7KA 1VF6C 1BR9A 2FFKB 3ZRSA 4UAJA 1TWGB 4JMQA 2AMCB 4DUZB 3OR7C 4R4CA 1PVOA 2IL8A 2B5OA 5GADC 2JK8A 4G57A 5E4XA 4AIMA 3OUFA 3G6EA 3S24A 4LJZC 4R4TA 5IP7G 5ELFA 5CA0B 2XNCA 3B78A 4IFDG 3GTLB 1CM9A 2X6CA 1KHIA 3KUPA 1GM7A 2KG7A 2F3WA 2WWWA 1QCEA 2F0HA 1URFA 3AK1A 3KZIZ 5B66Z 3M4QA 5C6AA 1QLEB 2JA6G 4PV1C 2EIMB 3FYEB 4YY3O 3V7AA 2H94A 1YJ9V 1EFRG 5EK0A 1JWSD 1EFWA 3NBIA 3S16B 1BQEA 2V7XA 1H9JA 1HDJA 1JX9A 1E7ZA 1SYFA 2VB2X 3DWQA 1CSPA 4QV2A 1X65A 3HOXG 1NJID 1EQRA 1J9ZA 4C1NI 3MEFA 3OP1A 2L55A 4X66B 3LWEA 2EINB 1ICWA 2HVJC 3U11A 2PLFA 1SQXH 1C48A 3SJCC 3SPIA 1I6VC 3ML0A 2PI5A 4TQDA 3I91A 1HWYA 1S5CD 4FXGC 3WNBA 4FPPA 1BCCH 1R4QB 3I4LA 4DR4O 1U4MA 1G7SA 1XNRQ 1Z6HA 3ZHTA 4A3EH 5L3EA 5D3DA 1QJOA 4KHPQ 1CUKA 1K8GA 4X6AH 4P75A 3WY9A 2DQ3A 3W5OA 4KHVA 1EEFD 4TMZA 3QNEA 3NTKA 5JCOA 1L0YB 3CD6V 3OTFA 2Q6OA 5IYRA 1JOOA 4UCSA 5CA1A 4O4IA 2ODMA 3G71B 4HEDA 1VQEA 1FXKA 5KAFZ 1UE7A 1Y8NB 1B50A 1U96A 4UCUA 1QVGA 1W6JA 4ZCIA 3T53B 2F1MA 5KNDA 4C3HG 1D7QA 1AILA 1G51A 4I0XB 4ZHQB 2E1BA 2QEXA 2NUCA 3CMEB 3L75H 1FNCA 5AN9A 1QUQB 1CA5A 1FNVA 2XHBA 1I7FA 4DRXB 1CNFA 1S5BD 4L5QA 2YEVB 1V54C 4O2BB 4FN5A 3HP3A 3OZVA 4PJ0Z 4OL7A 3E5SA 1CSQA 3N6RA 4TSFG 2NVXH 2IJIA 1VQ4V 2ZTDA 2CRVA 1ZSPA 4NNJA 2CVRA 4I9WA 1TVCA 2AXTZ 4KK7A 1MKHA 1R3LC 5KRUA 4H0LB 4MVOA 4LBEC 4EEQA 3ASOB 1XBLA 4G1VA 2HUGA 4HTHA 3RMHA 2KVOA 2EILB 1Y66A 3IFXA 1SAPA 3LX0A 2NN6G 3AVWA 1LTID 2PW5A 3TJTA 5EBDA 3BAAA 3STBC 1FJGO 3V2TA 2QSAA 1BUVT 4UY8C 1PTOC 5JEAJ 1EY4A 3WB2A 3SEJA 4OPSA 3OD4A 2A7WA 3D0FA 4ACAA 3D4RA 5C8YB 2EZOA 1X3FA 2L15A 3KBGA 1GO2A 4NVPA 2BTQA 2ZD9A 3LDCA 3GSIA 1RTOA 4DR5Q 1D1NA 2XRSD 5TV2A 1Q86C 3THOA 3HOUH 4RKBA 2UXCB 3FKIG 3W3AA 4D7TA 1UD6A 3OWEB 2ZZFA 1W6KA 3QO8A 2JEXA 3QVNA 4DRXA 2FXQA 1DK1A 3MFYA 4PG3A 1K73C 1K3EA 4C3IH 1WTHD 1COWG 3PN1A 3CPXA 5FIUA 3RY8A 2B2TA 4HIDA 4GX5A 5DM73 2UXDL 1EN5A 1VIBA 1S3JA 1TUIA 4ZOLB 3OJWA 4LBZA 3AVTA 1JR0D 1WI5A 1VLYA 1AJNA 3M7NA 3IFTA 5F4OA 3KOJA 4P30A 1PDQA 3ZEDA 5JJZA 3T1HQ 1BKBA 4GOPA 4OO1I 2CGOA 1O7LA 2R92G 3F7VC 4YIPA 3I56V 2F95B 4C43A 5J3BA 4DV6O 4KHZA 3G05A 3ICEA 2DNEA 2LSSA 4DV0Q 1G6PA 4TV9A 1O7YA 2E2IH 4J6HA
chains in the Genus database with same CATH topology
2B2WC 1AZPA 1E0BA 3T51B 3JALB 2M2LA 4X1KA 3VQXA 1Z5WA 1PZID 4DR3B 1PKVA 1EWHA 1EYDA 4XDXA 1JMKC 2YIBD 4XN0A 1ENCA 3OMCA 1HQRD 1CZGA 2OWOA 3PUYA 3N2KB 4KHPB 1L0XB 1PZKD 2E75C 4V0BA 1CI3M 5BN3A 2JEBI 4IUVA 1WPCA 1NCVA 1AEXA 3A54A 4HNAA 1WVLA 2F0EA 2DN8A 3TBIB 4LR3A 5JOBA 5IGEA 3JASB 5LP6B 2F0NA 1M8AA 3QB3A 3QWNA 4KY6A 1PLFA 2UUCB 4ZKBB 1O78A 2HQEA 4BY1B 1HZEA 1U4LA 4XLAA 4QIWB 3OSOA 5LA6B 3SK6A 2JSOA 1B04A 3BC9A 3DSQA 1G8ZD 2L0CA 5I4DA 4CH6A 5K1PA 1FNUA 4FVMA 5J2TB 2X69A 4B3TB 4XL9A 2F66C 2F0FA 1WTXA 4PMWA 5C3EB 3H91A 1C8CA 3HKCA 2XSCA 1EY8A 2N88A 4XTCS 2JIZA 1HR0B 3ZS8C 3OW7A 1SNCA 4Q6GA 4FNFA 4XLCA 5C3WA 3K6OA 3S1NB 1PTOH 4UDUC 3A8IE 1Q90A 1PRTF 1W0JA 2NWGA 4KN7C 1EIGA 5BMVA 2KA7A 1I4HA 2VXWA 1SQFA 2JA5B 2F0DA 3C3LA 3TP7A 2D3LA 4YHHB 1RCVD 2PQEA 3JSNA 1V43A 4XLHA 3WB1A 4DAPA 4RKLA 2WSSA 4HCEA 2Z6BD 1EYAA 3JASA 5LP6A 5LL6S 3GTKB 1LO5D 4XOPA 1F9QA 1TIID 2ID0A 2EPBA 4X1YA 3BA8A 3NTKA 3S15B 4IN3A 3C46A 5C3XA 1FD7D 1XXGA 3T13A 3IFDA 4X3TA 4IFDI 1CQVA 3DXJC 1GJXA 2QILA 4PHZA 3PO3B 1H9SA 1QG7A 2WP8J 3TZDA 2XWJB 3KLSX 4CBVA 1U4RA 2G9DA 1LV9A 1SE2A 2BA0A 2A68C 4R8IA 4IHJA 4O4JB 1K28D 1SEBD 2KOLA 2RSNA 4FYDA 2EDGA 2ZIOA 3U9SA 4L6TB 4G7HC 4RH6A 5JJNB 1ZEQX 4ZQ3A 1N33B 3MAQA 1SSOA 2K32A 3KK7A 1BPLA 4KD4A 2EVBA 4O1NA 4FF1A 3NTIA 4PNYA 2I07B 4YELA 5C8YA 3OPOA 2EZVA 1BF4A 1S5JA 4XQJA 5JAVA 4YXWA 1WTVA 1BO0A 3RYHA 4XT1B 4UZUA 4XXEA 3BG3A 3T56B 2JS5A 4FLXA 2YI8A 3FKIB 2L4NA 1WTQA 2PNRC 4JI3B 4BA1I 1ZAUA 5CBAE 2XNDA 5ELEA 4P2CB 2L1BA 4WBNB 1HHVA 3S17B 4PI2A 3HOYB 4LFBB 1D5AA 4M1UB 3RZOB 3GO5A 5CV9A 4TV8A 1EOTA 5LXTB 1NR4A 4XNFA 3J81L 4CS2A 2O2LD 1T5EA 2R72A 1JB3A 3MVVA 1SMYD 4HMJA 3SGIA 4DR5B 1R4PB 3CP8A 4F87A 1C4QA 2CW0D 2LMCB 4JK1C 4B3SB 1JE4A 5EKIA 2QE7A 1TWCB 3OIQA 1TWFB 2Z4HA 2EJGC 5FLXE 5C0XH 2K1BA 3AU7A 5A35A 3HOWB 3HKEB 5JJEB 5GONA 2WB1B 5LXTA 5KNCA 3GVLA 1CHPD 1OXUA 3D31A 1JORA 1I4XA 4OO1G 1GUGA 5J2TA 1NUCA 1H8EA 1D5ZC 2ZNJA 4CKBA 5I2XA 1IHZA 3K0YA 4EVOA 1HNXB 4II2A 4YY3B 4C56C 2ZIMA 4K5VA 4AHCA 4BA2I 1M93A 4HIZA 3TZUA 3H0GB 4LNUA 1BQQT 4F7XA 3RYHB 3EJIA 1AZQA 4GZYC 3DEOA 3N52A 3Q23A 1LTGD 2O4XA 3EA6A 1LTAD 2EY2A 3S1RB 3FVQA 1SKYB 2RDHA 2E3CA 1HTLD 4DFAA 2JA7B 2WACA 1EU4A 1CFMA 3MWYW 4I55A 2F0IA 5LOVA 3H09A 4Q0FA 5M5WB 2E2DC 1KLGD 3QG1A 4K5XA 3PIO3 2XGJA 5ITZB 5DNFA 4KKTA 2F43A 5EGTA 2NN6H 2F03A 2SEBD 1HW7A 3R93A 1EEID 4K2LA 2Q8RE 5FNVB 2VNUD 1QILA 3ONAB 3VYSA 4XLFA 2Z1CA 1UD3A 2QKIC 1STAA 4RWSC 5IGFA 1H9KA 4I55B 1ET6A 1VDZA 1SYGA 3TN2A 1V8QA 4XM3A 5KNLA 4K8IA 2C5CA 1H9MA 2ZM6B 4XONA 3Q6SA 2PYLA 3NE5B 3NWTA 1DOKA 1YNNC 2ZZGA 4UCTA 1MABA 2B8GA 4K14A 5NUCA 3VA7A 3TP5A 5CDFA 4KY7A 3F2UA 1NBMA 5CV4A 3I3CA 3V96A 1KDAA 1DOMA 1HQMC 4XIGS 1J8IA 3S2HB 5IYZB 4KI0A 5LYJB 2IM9A 1F2YA 3K5OA 1TAEA 2LS01 4IALA 4QUCA 3ERQA 1DD2A 1BBXC 1SE3A 2N55A 1SNOA 4BY7B 1J5EB 1XHXA 1Z47A 3A2FA 2M00A 2W6JA 2R70A 4KD3A 4BBSB 4RHRA 2L9HA 3OEHA 3NPPA 4DUYB 1OO9B 2K5DA 3NUCA 2R92B 4X3SA 5T1GA 5ITZA 5IWAB 4AYBB 4Z1MA 2QM4A 3TDQA 3JU4A 1XI1A 4LK1C 1N36B 3W2DA 1AN8A 1LT6D 1KMHA 1QNKA 1UEAB 2CQAA 4YJ2B 2F0TA 2XOKA 2NZ1D 4XMYA 5DAUA 3L7ZC 5CB4B 1IW7C 4QB4A 3I73A 4UCRA 2NN6I 1Q1EA 2IX3A 5IGGA 4JI1B 3DEPA 4H0LC 4JI0B 2ICEC 1SFOB 1QOHA 2WPDA 1MBYA 2PGGA 1SNQA 5CV6A 1PTOF 1V1PB 2F0LA 1HA5A 2R7ZB 1QNUA 3HOVB 5JEAG 2NTTA 1D1KA 4NDXA 1LTBD 4O4LA 2ENBA 3NWSA 4ZK9B 1F2MA 2K6AA 4DF7A 2A5HA 5ELDA 3S1QB 3B2EE 3GQBA 4XYQA 4FLWA 1JWMD 1I50B 2NVTB 4HNAB 2MP1A 2F3VA 4ZYSA 2GJPA 4XLEA 3JAWA 4DNRB 2R3ZA 4HN7A 4B3FX 4FLTA 1Y69U 3JAKB 4XYOA 4IIJB 2F4IA 4XQNA 1GHKA 2RQ6A 3WB0A 2XRQD 4X1IB 4FLVA 4RFBA 2B63B 5C4ZA 1XMOB 4YJ3A 1S5FD 4C2MB 1GUSA 1I8DA 3BDOA 2K7VA 5IT9L 4XQFA 3CQZB 2J0TD 4LNUB 5I9OA 5JJJB 1EY5A 5IJ9A 1SKVA 2MHVA 1ESRA 1SJHD 1EY6A 1E2VA 1E3ZA 3VR4A 3FMCA 1OXTA 1STNA 3L9AX 3T4AC 5LMUB 4G7XA 4H44C 5EIBD 2UU9B 3DDYA 2ZTNA 4CH5A 1CQFA 2BTQB 2A6HD 5K1XA 4O2BA 4OHJA 1JJOA 3HAGA 4C3IB 3QIAA 5IJ0A 5DM63 4QUFA 2AWOA 1CZWA 2P5OA 4UCOA 2F0QA 3NSWA 3K58A 2ZINA 1GXDC 4DV4B 5C44B 2V31A 2EJFC 2LZJA 5LHY1 4Y7NB 2ZTGA 3G7LA 4D7SA 4XN3A 4EB6A 2L5TA 2D5DA 1F2ZA 1UD8A 3VQVA 3MHBA 3SK4A 1L8DA 4AILC 2PPBC 2WAQB 1O7ZA 4JV5B 2B2YA 2RJZA 3SE0A 2TMPA 1SXTA 4ZRZA 1DCZA 4GYCB 2AQ2B 1LACA 2F0JA 4CS4A 2E5LB 2FJ2A 5KIXA 2K28A 3D4WA 1JWUD 1CTMA 3QOLA 5CA0A 4NP5A 3EROA 5LP6C 1TUBB 1LT5D 2RDFA 4IUPA 1G6ZA 2QCPX 3HKBA 1K8MA 5KHKA 3D4DA 4PI0A 4G6IA 5C4JB 5EYPB 2R6GA 3SK5A 3HKEA 4E6IA 5I2YA 2B2UC 1FYCA 4B08A 5K36G 1OHHA 2F0KA 1TQOA 5EZYA 3K5MA 4FM2A 2B8FA 4DXFA 3PO2B 3J80E 2ZXRA 5G3LF 2EX3A 4G4KA 4RCOA 5FPRA 1AFPA 1WTWA 1RF2D 4UFZA 3OOCA 4BWGB 4K6LA 4HCSA 1K83B 5JPNC 4XR6A 4RHSA 4NXNB 3CU7A 2X6LA 4CJ1B 2RSOA 3MZ5A 4FP5D 3NP8A 1JOKA 2KHSA 4AQYB 1TKWB 5ELCA 1HA6A 3N2KA 5IYZA 3UT5A 3CSXA 4JI8B 3JARB 2A6ED 4IUTA 4FXUA 5LOVB 3J7AV 3H94A 2B2YC 4LF9B 2GJKA 1XWEA 4EFBA 3CHXA 4QMGA 3QF7A 1B9NA 3BDLA 1FGBD 5C0XG 4JBWA 3H3VC 1WCMB 4TV8B 5CV7A 3TMEA 4LH7A 4ZOLA 1GHJA 3M3YB 1NR2A 2E2HB 1XMQB 4KMUC 1TWAB 2WKDA 4IQZA 4LH6A 3KEWA 2ZT9C 1PYWD 1UD4A 2F0VA 3BZDB 1ZYRD 4BWAA 2GV9A 1TR5A 1XYIA 5IT9E 2FHTA 4LF6B 1Y8PB 1FNWA 5JQGB 4X1KB 2WJYA 1N32B 5M3MB 1KU9A 5JH7A 1PRTB 4RAUC 2KQ3A 1NRKA 1OXSC 4L8JA 1KNAA 1A15A 1SQGA 1SDFA 1EQTA 3BRCA 1BCPC 1UAPA 5FKAC 2H1EA 3JAME 2PTMA 2NVYB 3WOFA 1VMPA 4O4IB 3K5NA 2X53S 4KL1A 1B2TA 1UNSA 2JXMB 2EOTA 4ILWA 1T5XD 4IUQA 1E2WA 1I94B 1D6EC 5JH7B 1E1QA 1RDPD 1LTTD 4DXGA 3SR1A 5DEHA 1U4PA 3IKJA 2MJ8A 3FFQA 3QG5A 1LLRD 2VQFB 1EZ6A 1ONLA 1SNDA 1X32A 3P20A 3N2GA 2ZZQA 1WTRA 2ICIA 2UUBB 2Q8IB 3X3MA 1A6XA 1HTPA 1E1RA 4ZLTF 4X64B 2KCNA 4TQFA 5EIBC 1E79A 4CJ2C 5GONB 2EXZA 5M9OA 4CS3A 3E6ZX 5EBCA 1VMCA 2D9UA 1Q5OA 4I7ZC 4LMQD 4ODGA 1KDBA 4KJOA 4FM0A 2X85A 1F9SA 4V190 1TVKB 3CRKC 4KKSA 1JICA 3DWAA 4IUNA 1OB0A 1HNZB 2X6WA 4DA2A 2NYZD 1EFID 4K8JA 4F88A 1WTPA 1NAPA 3ZPNA 1YNJD 1PRTD 4MHEA 1EY0A 3I90A 1XHZA 1F77A 4A3EB