1T5EA

The structure of mexa
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
231
structure length
231
Chain Sequence
TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance protein mexA
publication title Structure of the periplasmic component of a bacterial drug efflux pump
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 61
structure length 231
sequence length 231
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1t5eA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1t5eA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5eA02
3WB2A 5D5PA 1ZKOA 1QJOA 3M7NA 1Q12A 1GUOA 2BE5D 3A8KE 1Q1BA 1E2ZA 1K8MA 2NN6H 3TZUA 3VA7A 1GUSA 4H0LC 2EDGA 4OGQC 5KNCA 1H9MA 1HCZA 2Q8IB 2A6ED 4TKOB 1HPCA 2PCFB 4JBWA 4G7ZC 1SMYC 3FMCA 2K32A 3MFYA 4HR7B 2F95B 4XTCS 3PUXA 2DNEA 1YNNC 1G291 1V8QA 1VF7A 1IW7C 3PUWA 1TU2B 2A6HC 2IT1A 3PV0A 3GD7A 4OO1H 4KN7C 3SE0A 1HTPA 3D4RA 3A8IE 3PUYA 1Z6HA 1O78A 1Y8OB 3QJYA 3CRLC 2A68C 2AUKA 2LMCB 1V43A 3HGBA 2R6GA 2PPBC 4IFDH 4G7OC 1H9JA 1DD2A 2D62A 1OXVA 2JE6I 4LJZC 1Y69U 1ZYRC 3VR6A 3KLRA 2EJMA 1E2VA 3FPPA 3OPOA 1OXXK 1PMRA 3L7ZC 4H44C 4RCNA 5BN5A 3ND9A 1E2WA 3BRCA 3W3AA 2A69C 3A8JE 1T5EA 4IQZA 4GZYC 2F1MA 3LWUA 1H2SB 2PNRC 1H9KA 1IW7D 1B9MA 3T56B 3BG3A 4BA1I 5KNDA 1Z7TA 2A6HD 1GUGA 4KI0A 1IYUA 1O7LA 3T51B 3PUZA 1K8OA 2AWOA 3RLFA 2NN6I 1CI3M 2EVBA 3VR2A 3IKJA 2A68D 1A6XA 1CTMA 1H9SA 1GUNA 1B9NA 1Q1EA 2EJFC 5BN4A 3MXUA 2F93B 3WDNA 4G7HC 1GHKA 1Y8PB 1LABA 2E74C 2ZT9C 4L8JA 1H9RA 5D5QA 5JJJB 5JEAG 3SDZA 5KNBA 3WB0A 2A69D 2AUJD 1HQMC 1VDZA 2DN8A 1TKWB 1VCIA 3P20A 3BDOA 5C0XG 3D31A 4H13C 3A7AB 2BA0A 2CW0C 3ND8A 1ONLA 1DCZA 1FYCA 3QIAA 4XIGS 4TQUS 4GYCB 5JJEB 3H94A 2D2CC 1Y8NB 3M85A 1RSOA 3IFTA 2BA1A 2E75C 3AB9A 2D5DA 4KMUC 1DXMA 4KKSA 3QG1A 1BDOA 2K7VA 1OXSC 5A35A 3NE5B 4BA2I 2NN6G 1IYVA 1CFMA 2BDOA 1VF5C 4KKUA 2JEBI 3T53B 1YNJC 2E76C 3I73A 4KKTA 4DNRB 1Q90A 3GQBA 4KHZA 3LNNA 1OXTA 2K33A 4DNTB 2JXMB 2O5JC 3VR4A 2BE5C 1GJXA 2QF7A 5BN3A 3M4YA 2YYZA 1H9SB 1I6VC 3N6RA 3DXJC 1GHJA 3I4LA 4DK0A 3PUVA 5JEAH 4I7ZC 4DK1A 2O5IC 4PV1C 2A6EC 3A7LA 2KA7A 5K36G 5C0XH 2JEAI 3OW7A 3EQLC 3VR5A 4OO1G 3CRKC 4KN4C 3OOCA 5K36H 1EWHA 3U9SA 1GUTA 2V4DA 2B8FA 4IFDG 1LACA 3VR3A 2L5TA 5JJNB 3WB1A 1OXUA 1FR3A 2DNCA 3I72A 4JK1C 2KCCA 4LK1C 2B8GA 2EJGC
chains in the Genus database with same CATH superfamily
2NZHA 3CCMB 3JCUZ 2BTOA 5EYPA 4GLAC 1XNQO 4NMZA 3P3PA 2EILC 3QO8A 5CBFA 1C0AA 4NVPA 3D4RA 4PDRA 3W7WA 4DQLA 2CH4W 4LC0A 1GKHA 2B5UA 1OCCB 5CB4B 2WB1G 4FXKC 1BVSA 1VQBA 2EVBA 3A0RA 2N78A 1Q1EA 5BN4A 1BBUA 2DWEC 1X54A 4C2MB 1S5DD 2K5NA 2WAQE 2CH7A 1XHZA 2YTXA 1PH8A 1MI2A 1M57B 5EBDA 1FFTB 4OPOA 4UZUA 2JA8G 1BT8A 4ZUIA 5HXBA 2XWJB 1SE8A 1SNOA 5CBHA 1VHOA 4JYAB 2ENBA 4Z1VA 1ML0D 3KF8B 1K9MC 3OOCA 3K8AA 4FFBA 3F2UA 1FNBA 3JATA 5H6RA 2L12A 1LUVA 3LGJA 4PC3A 3KLSX 2QDBA 1ZLZA 3SK5A 2BTQA 3OKXA 1K28A 1YJNA 2O4XA 5IWAQ 2VBUA 1C7YA 2PTMA 2C78A 2UUAB 2P7TC 3B6YA 2LS01 4YIPA 2XZPA 3LO8A 3V76A 4QCLA 5BR8Q 4WJWA 2HD3A 5JJKA 5L3GA 3A54A 1WDTA 4K2LA 3Q8DA 1IW7D 2JA9A 4DKAC 1E1TA 5LBQA 3ASQA 4DV7L 4EQPA 4C3IG 1F4MA 3VBBA 4F88A 1D2DA 3OW2A 3WOEA 5H59A 4A93G 1FYCA 3SJZA 4O4IB 4DNIA 3CCQV 4DV1B 5IWAL 2ZL6A 3JC66 2BOBC 2E76C 1S5FD 2B9ZA 4NKLA 5BR8L 2WJVA 2D2CB 1D1NA 2B2UC 3JAWA 2EPBA 5JJLA 3ABLB 1RCVD 4WZTA 5I9PA 4LF6Q 2P6JA 1STNA 3Q0AA 5M5YB 1GM5A 1N36B 3ISXA 1AN8A 1B23P 1BQ0A 3E22B 2YWEA 4UPAA 4LH7A 4HJ5A 2AQ1B 3STLC 3I4OA 1Y8OB 2DE0X 5IGEA 4RM0A 4EX5A 5IYDG 4J11A 1SQXH 3ZRWB 2Y0SG 2VWJA 4AF6A 2Q6OA 1H9KA 4LR3A 3HOWB 1OHHA 2JN4A 3CCSB 4U3JB 4A3BB 4O4JB 1AR4A 1II3A 4LF6L 1LABA 5K1PA 4JYAO 1I4HA 1YDXA 3APQA 4DV4Q 3QOLA 3BFRA 1ELOA 4JI0L 2PE3A 3X2QB 3O9OA 1JB9A 1SM4A 1WA8A 2K5DA 1YNJC 3GTLH 1Q90A 3PO2B 3DXJC 5CN0A 2DJFC 3CYOA 4ZV4A 4CS3A 1IURA 2WLJA 4C3HG 5FOBB 3JAME 5JJNB 1PJ6A 2F43A 3T1YB 1G6ZA 3JAMN 5JPNC 3TREA 3OZUA 4DV4L 4B43A 4MW8A 1FJGQ 1QZHA 4PG3A 2IT1A 4TMZA 4DR4Q 1R6KA 2EYJA 2QTOA 3ASOC 1FXKC 1YHQA 3MAQA 1BF4A 1I4XA 2BGJA 1E1RG 3LWUA 1H2SB 4U7OA 1MZEA 3RGBA 2EIJC 3ETDA 2ZZFA 2JQOA 3K0XA 4CDDC 3NQIA 2NBFA 2B63H 1I94B 1YI2B 2P22C 1O7YA 1PNMA 1N36O 1V55B 1JQYD 4P3YA 1V54C 1FJGL 4DW1A 4XDKA 4A3LG 2Z0SA 4DV5L 4JTAB 3JQQA 3ZZ0A 1RP3B 2QDLA 2IJ0A 1S5ED 3NTKA 2LW1A 5IP7H 3I55V 1N8RD 2C5BA 2I1LA 5IYCH 2UUBB 1A2UA 3CMEA 1Y74B 1H2MA 4V190 4YALA 3E3XA 4DV3Q 4ILWA 1E1OA 4B3SQ 5DECA 4M2LA 1BUVT 1MMMA 3DWPA 3HKBB 4UCVA 4TOIA 4IUNA 4P2CB 1JE4A 4LP8A 4WZEA 3B82A 4DV6B 4DXGA 4A3MH 1GUNA 1K33A 4YHHQ 2EYLA 3JARA 3HKEB 1OCOC 1K3EA 1JOYA 1K5SA 1WCMB 3ZYYX 1DOMA 4DV3L 1VQPV 1U97A 1VMCA 2BA1A 4YJ2B 1R3LC 4XDXA 4B3SL 4BBRB 1W0KA 3PIOA 2QKCA 3T1HO 4H13B 1DYQA 4ULLA 2OK7A 3SHLA 3AG1C 4O2BA 1IHMA 2EZOA 4JI8L 2YI9A 1PH9A 1L0NH 2ZXWB 3RUZA 4TWKA 2ZD9A 2BSKB 1BE3H 1STAA 4YHHL 4YWKA 1YJWB 4G7WA 5L3CA 2EDGA 5FL7A 2ITDC 4TKOB 3JYCA 1EEFD 4JYYA 1CNFA 2LW7A 2PW7A 5LYJB 2B2VC 1K73C 3DDYA 2VZLA 1I94O 2MUYA 2JA7H 3LDCA 1QVFU 2EYPA 5FNVB 1V43A 2OWOA 2DQ0A 3ZZTA 1F2MA 2F0QA 4P30A 2PI2A 5ISRA 3ICXA 3AMUA 5IP9G 1NTMH 2B1GA 3CC7V 1G7RA 1Y66A 2CW0D 5J39A 4A3FB 3EA6A 3BCCH 4TV9A 4FZ0A 3OMGA 1YVWA 2PYJA 2ZNJA 2B29A 1MOFA 5IT9E 5E4WC 3RZDB 2EOTA 3T13A 3C90A 2GTSA 3G6JB 4LBYA 4B44A 2YIAA 1N06A 1SA0B 3CMMA 1TVKA 1GD7A 1MRZA 1M9NA 1QUFA 4RDKA 2QTSA 3IFDA 1I50H 1MABA 4B3TB 3BVZA 1NB9A 4DV6O 4ZOLA 3OEHG 4LC1A 1ENAA 4GNXA 4DR2O 1UNSA 1YBYA 4HEDA 4NXMO 1S3OA 1YNNC 5KMGA 3HKZB 4NPSA 3C1EA 2QILA 1CT1D 4PABA 3WOFA 1XMQL 2A68C 3CPWU 3MXGA 4MT8A 5EZYA 3CP2A 2UXCQ 2FMMA 3H9VA 3S15H 2QGGA 1XL6A 1R9TB 2QE7G 1LT3D 1NBMG 4JBKA 1EZ6A 1SE4A 1XREA 4O2AB 4DR5Q 4DU9A 4PA3A 2BVNA 1TUBB 4F6RB 1V1OA 3WB0A 1JWUD 1SYDA 2OCHA 3TCUA 4K0KO 4NYKA 1N8RW 1FXHA 5EAYA 4MZ9A 3AEIA 3D36C 1IJFA 1LTRD 2R7FA 3M4YA 3L73H 1RDPD 2UXCL 5M3FH 4WFEA 3FB6C 4A3KH 4RLZA 4TMWA 2KENA 2F3VA 4MVUA 1NDHA 1D5ZC 4DR5L 2ZTNA 4OGQC 5KW9A 2WA3A 5IYRA 1GO2A 3KG2A 1K83H 2K32A 3D26A 1PKVA 1K9MD 1P4RA 4GX1A 1S76D 2OBRA 2Q4PA 3G80A 4NB3A 3JD4A 3SE0A 3L2PA 4FLZA 4WZLA 2R6GA 4BPRA 1FNUA 1QLNA 5DEDA 1ZM9A 5HZBA 1ZM2A 2JN9A 2UU9B 1WOPA 4R4TA 2I07B 4GZYC 1CZWA 4GX2A 1FPOA 2DCUA 3H3VC 3H9NA 1A3TA 2F93B 1NBMA 4LWCA 3DM3A 3OEEA 4H44B 3TXQA 3HOVH 2HCIA 4R8IA 4K14A 3B8HA 2DN8A 4DR6B 4YJ3B 3GTOH 2D0OA 4B3TO 4TQUS 1LTAD 4FF3A 1RSOA 3AK2A 1PFSA 4WF9V 4H37A 1VQKB 2Q2TA 1V5VA 2DYSB 1RPRA 2GK7A 2HHHB 1VQ8A 1BX1A 3UCSC 3H15A 3K0YA 1MNGA 4X6AH 1HR0Q 4A3DH 2E5LB 4FLYA 4YCUA 4PV1B 4G7XA 5FA6A 1YJNV 3K08A 2N3SA 3HR0A 2IWHA 2C77A 1YHAA 1P7BA 2L6LA 3TRZA 3V96A 4J0QA 4O4LB 2LFNA 4A3JB 3VR6A 1R5BA 4MTXA 1X3GA 4P71A 4A3CH 3L71H 2EYFA 4QF4A 1G4YB 3SEBA 1M57C 4DV2O 2J7ZA 4DR3Q 1KD1C 1ET6A 4RMFA 1H9RA 4BAYA 1HR0L 5JEAG 5LXTB 3M4QA 5B1AB 4FMTA 1DCZA 3BS1A 3Q24A 1DF4A 1VLYA 2XGJA 1XXGA 2B2TA 1VQOA 2RC6A 1X3EA 1Z9FA 4XLEA 2K33A 4IPGA 3I4NH 3HOYB 3ZBHA 1EY7A 3PUVA 4R6ZA 4XQFA 1Q3LA 4RD2A 4X20A 4L5SA 1EU4A 3CX5F 5HFMA 5JWPA 2UU9O 1YNJD 4DR3L 2EJGC 2V7VA 1NVPD 3G05A 4EGVA 5LHGA 3BCFA 4JBWA 3BHPA 4CZZA 2A79B 2Q7HA 3EN2A 4DR6O 1MIUA 1PTOB 3AFQA 4DRXB 1W2BU 3FKIH 3CPXA 5KIXA 1OXXK 3N2GB 3A3BA 5C8YA 3KBGA 5EC2C 2GJPA 2X85A 2E2IB 2HHHO 1SERA 2CHBD 4LBZA 3PF4A 2M00A 2MGSA 2Y69B 4QVAA 3UO2A 1BQEA 4NR1A 4ZKIA 2NTTA 1G2SA 2F1LA 2D2CC 5IGCA 2XAQA 2JIZG 4YIJA 3RYIB 3GO5A 3ABLC 2ZZGA 3BPZA 1N33Q 3U2QA 1B70B 2IX3A 2WPDA 4XR6A 5BN3A 3FAVB 5C44G 1S3JA 1K9MW 2JEAI 3RVYA 3OE7A 1EFTA 4TSFG 4HE5A 2X6GA 5J35A 1QVFA 2N55A 1KKCA 2BGIA 2EZVA 4JI1O 4B3RB 1BHBA 3JQPA 2WV6D 1QCEA 1C4QA 1EFRG 3ZHVA 1KK1A 1W35A 4DPGA 2NZ1D 1G291 5L46A 3P32A 4X62B 4IFDI 4NTXA 4HYOA 1N33L 1YHQV 3OIPA 2NVXH 1Y76A 1SYCA 4FO2A 1XBLA 1KAAA 5BN5A 2FHTA 4I0XA 3NR7A 2ZXPA 4X7FA 1J9ZA 4P73A 3JASA 4JI7B 2C2AA 2Q2HA 1UEBA 1DK1A 5C0XG 4XLHA 4QE9A 1I18A 1QCBD 3BZCA 1WOSA 4I4TB 2V7UA 4BA2I 2WA4A 1FL0A 1STEA 2GV9A 3BH4A 5FLMH 1UE1A 3QNEA 2ZIMA 4UCUA 3P75A 4PZ8A 4LF8B 3CMEV 3I5DA 2RA4A 4RJLA 1IL8A 1QNUA 1EYDA 4Y7CA 2GJKA 5JQGB 2J0TD 3I7FA 4HR7B 4UDUC 1B8AA 2DEUA 3BA8A 2EFGA 5CA0A 1VMGA 1XWEA 3K7AH 4XN3A 4NKGB 2BTQB 3PUYA 2VUMH 1EM1A 4II2A 2JE6I 1HNXQ 3H1IH 5J2UB 2ZR3A 1Q8IA 4GN3B 3V7AA 1XTDA 1V55C 1E63A 1WOOA 5DSZA 1LTGD 2CC2A 2QM8A 1O9HA 1EQRA 2OIEA 5I2XA 3AG3B 5D5QA 1XDCA 4C1NK 5JVDA 2HT1A 1WTHD 3MZ5A 2QWPB 4RCZA 1JOKA 1VQGA 1SNDA 5BMVB 3KF6A 1DJRD 2FTKA 5LMUQ 1ROPA 4K6DA 2PQEA 1R3KC 1FS0G 1XPRA 1VQAA 1HNXL 4X62O 1XTCD 3R2IA 2X6AA 1D7QA 1P7GA 1RL2A 3TP7A 3JAWB 1LYLA 2QGNA 2QGQA 3D3QA 1XL4A 4B3FX 5TRDA 2XNDG 5DEHA 3NBHA 4FLWA 3OUSA 1WOCA 1VF6C 2JJ2G 4JI7O 2HJDA 1N34O 2ZTDA 4POFA 5IWAB 2KHSA 3AG2C 3OZVA 5LMUL 5GV7A 5LGTA 1JA8A 4X1KA 4CH6A 4JV5Q 1D2EA 1JE5A 2IU0A 1SKVA 3PN1A 3GVJA 2QW7A 3ZJYC 1AIPA 4MVRA 1YEWA 5BR8B 3DWQA 4XXEA 4JI3B 5JVG3 1GAQA 3ULJA 4QVJA 4KHPQ 2A68D 5EPKA 4GN4B 1PH6A 5DM63 3UDFA 4LF5L 4H13C 4YEJA 1L0YB 3B4SA 3BY6A 3HKCB 2F03A 3I70A 1GVHA 5FO1A 1W34A 1L0LH 4JV5L 4HZ3A 1XB2A 2YI8A 5IYBG 3I4LA 1D8TA 3Q6SA 2TMPA 2MO0A 3SEJA 4KHPL 1ZKOA 2JS3A 4LF6B 1E2ZA 3WYAA 1UD4A 2KCTA 4JAUA 4QPKA 3ERQA 2B2WA 1ILQA 2JJ2A 1G8MA 3GTLB 5C3XA 4GCZA 2NB0A 4M1KA 4FM2A 2UXNA 2QTLA 1SMXA 1KRSA 3ULPA 1NR7A 3G6EB 4TQDA 1AP0A 3L75H 4CGYB 2KVMA 3R93A 4R4CA 4HBNA 1K8OA 4OX9Q 1CQXA 2CGNA 2FKXA 2Q8VA 1RQPA 5CV9A 2H5XA 2QMUA 4UVCA 3SPJA 2OQ0A 4D6TH 3CCLA 1A8PA 5JJEB 1YTFD 4DV7O 1G51A 2WLHA 1BPLA 4BIUA 2YIBA 1ZSPA 1T9HA 1AJQA 2WSSA 2C9OA 4KHVA 4CDCC 4W4LA 2NVYH 1PNKA 2X7RB 3T1CA 5IWAO 1KL9A 4LMQD 4PDMA 4Q0FA 2HCJB 1F2LA 1VQ9B 4DA2A 2F52A 2B63B 1W2BA 4OX9L 2KCCA 5BR8O 2XZOA 2B8GA 3ZRSA 5M3MG 4Q5VA 3A8KE 1QFYA 2RN9A 1N07A 1E64A 1HPCA 5JH7A 1M4UA 1XNQQ 4WJ3M 1HJPA 2F95B 1Q82C 4X88A 1FJGB 4J15A 2RCNA 2OF1A 5FNZA 4C3HH 4IN3A 3DM1A 1BL8A 4DR4B 5CV7A 4OONA 1NU1H 1I8DA 3WXMA 1U4RA 1Q86C 4PAAA 4XONA 2R6HA 3W2FA 3H1JH 1KLGD 5EK0A 2NUCA 2CW5A 4Z4WA 1WAZA 2YIDA 2QA4B 1Y8PB 4LF4B 1FRNA 3HKDA 1HQRD 1L2FA 2CWAA 4EFEA 1MD2D 3ZMUA 1V9PA 2HR3A 2ZIOA 1KQSB 4LF6O 1CA6A 4FLUA 1KD1D 1P49A 3GTPB 3M8AA 1Y4MA 3K80C 3EVQA 4DNRB 2F4VQ 1WNSA 4JI0O 1VQ8V 2V7WA 2YU9H 4EQ5A 4DK1A 4A3GH 4JTDB 2X6CA 3L0OA 2IBZH 1Y1VG 1BS3A 2FVGA 1BX0A 4GS3A 4I65A 1X3QA 1VQ6V 4A3LH 1M90D 5KX5A 4UY8C 1PVOA 4G7ZC 1IBKQ 4RD6A 2DWDC 1WP8A 1K8GA 2IX1A 2YEVA 4B3SB 4B9XA 3LQ6A 4DV4O 4UCSA 3SR2C 1D5MC 4H44C 4P2ZA 2F4VL 3ASNB 4IPDA 1JMCA 3B40A 2EBOA 2D3LA 1UD6A 5CA3A 2FJ2A 2RNBA 4L5RC 1MSDA 2QEXB 3ZMVA 3TDQA 1B7YB 2D9UA 4J8QA 2DYSC 2JA7B 4MTOA 1BMFG 2XAJA 4X7EA 3H09A 1K0RA 3D6CA 1VQOV 5HGTA 1BDOA 4OPVA 1RJTA 2IW5A 1YIJA 1NR1A 1JNYA 1CFMA 3FRPB 1KC8D 4JAAA 2O57A 1FJGO 3CCUA 3E5SA 1QUQB 4PV1C 1DG1G 2V7QA 2JJ1A 5IGDA 1JWMD 2V4DA 1UFIA 3D3RA 2VJIA 3W1BA 2NN6I 1HRJA 3CKIB 1BCPD 3CB4A 3R65A 5J3BA 4I50B 5H2FZ 1M56C 3OFNA 2Q7GA 1WB8A 3AG7A 4R4OA 1HTPA 1QZGA 1COWA 4LFAB 1CK1A 2FX3A 2Q6AA 3BYTB 1PZJD 1I50B 1MJCA 2OQKA 3CRAA 3FB7C 5JJZA 1MSWD 1PFMA 1PH7A 1BO0A 3CPFA 4MIUA 4ZLTF 2ZXRA 1SLJA 1Y14B 3RLOA 1BMFA 3CCMA 3P7JA 4N8X1 2HIVA 4CKCA 4DV3O 1XMOQ 2XRSD 2F4NA 2AHZA 4B3SO 3A7LA 4C2MH 1EIFA 3ETQA 3CCVA 4JI6L 2ZDIC 1EU3A 4Z4TA 2L11A 3BC9A 4RKBA 4LCUC 5FO7B 4XOPA 1CQFA 1AI4A 3K0DA 1SYBA 1JR0D 1PTOC 1H8EA 3E2EA 3PUMA 2XEXA 3SYCA 1X4TA 1KLUD 4WWVA 4YHHO 3SYQA 4Z4UA 4A5UB 5A9GA 5M3FB 3AQQA 3LSSA 4A3KB 1KU9A 1L1OB 2UXCB 1E43A 1XMOL 1N0UA 4L63B 1BXTA 1KD1W 4MVOA 1KP3A 1MKHA 3MXUA 1AROP 1K83B 1E3XA 3KF8A 2RQXA 1FFXB 4DR5B 1EY5A 3BDOA 1GR1A 3GV3A 2ZM6L 3Q4HA 3A3GA 3SK4A 2A19A 4R7CA 1IBML 1IYVA 4LFBQ 1RSOB 3JD0A 2F0KA 1PXUA 3A74A 4KLKA 3VYSA 1M90W 4POGA 2VBSA 3BA9A 2YUAA 5C4HA 1TUEB 4AQYB 3HOVB 3WFVA 1VLOA 2XVSA 3OTOQ 3HOWG 1AR5A 1GO3F 2Z9HA 1DF5A 1K8MA 3OT7A 2PI2E 4I7ZB 1PRTB 3B8MA 1QVGB 2EXZA 4XT3B 1Q7YC 1U9RA 3E1YE 3PUWA 2M5SA 1QE6A 2OTJB 4IHJB 4MTNA 1R5OA 3WY9A 2B3GA 4BXXH 4LFBL 4O4IA 2ILMA 3DC6A 4LF9Q 2OT5A 1JX9A 2DYRB 3PO2G 3TMEA 1DOLA 3K59A 3UM7A 1XMQO 3K0GA 4A3DB 2DMXA 1NCVA 1HFNA 3OAAA 1B4OA 3NTHA 3OTOL 1EIGA 1FKAO 4RCOA 1KC8W 4JG2A 2PGGA 5EKKA 1PA6A 2F0PA 1QU7A 1V0FA 2ZXIA 3E22A 3K9SA 3ASSA 1I4PA 1XJVA 2RHQB 2RJZA 4LF9L 5IJ0B 2RF4A 3DMUA 5AJ3L 3BVGA 3CB2A 3KYHC 1S4MA 3DLLA 2EJRA 4M53A 3ZRWA 2UXCO 4FXGC 2WZPP 5KHKA 1S4ZA 3CCSA 4U3JA 3KBXA 4O4JA 1TVCA 3CCEB 4IUVA 3CHXA 1SQBH 3S24A 4DR5O 2WIIB 3I4NB 4FVMA 3TGUH 4G7OC 1LM0A 2JDIG 2GSMB 1XILA 3QFCA 2ZZEA 4ZKCB 4U673 1VQFA 3BU2A 1A3VA 3LUTB 3HRZC 3G71A 4DR3B 1K8AC 4LBVA 1T6XA 4NP5A 1PZID 3FKIB 1XX8A 1QLEC 1SZXA 1CEZA 4I5SA 3ONYA 2AWNA 3KZIZ 2NWGA 4G6IA 3HOZH 2K14A 2B7CA 4DO2A 5JEAH 1FNMA 1KTKA 3O13A 2UXBQ 1WTPA 3I56A 3TBIB 2R93G 1GN2A 4MW3A 2CDYA 2ZNIA 5EQ0A 3UO3A 4PC6A 4C3JB 4DR2Q 1SC5B 1CQVA 1K3BC 1ESRA 1WYDA 1YITA 1Z6HA 1YI2A 4DK6C 4BBRG 4QJFB 4CDFC 2CQOA 5EKLA 4P6VF 2KOLA 1Y76B 3APOA 2HIXA 2UXBL 2HDLA 3NP8A 4JOIC 1SDFA 3FYEB 4J7KA 4O4HB 3IRBA 4RHSA 4OXPA 5NUCA 1SQVH 5JCOA 4QL5A 1XPUA 1Y74A 1GRJA 2I46A 2NVXB 2RMKB 3DEPA 5KYIA 1HR0O 3PO3H 1PZKD 3F5TA 1N33B 2N04A 2K4KA 4QIWB 1XQBA 1I6VC 2CCZA 2M7WA 3ONAB 2XUMA 3OJWA 3HKBA 5CMUA 4QPJA 5K36H 4IFDG 3KCXA 1WPBA 4XQNA 4HSPA 1WTOA 3M85A 2VY3A 1SESA 1XFOA 4MVQA 3RYFB 3OGCC 2BPOA 1P4MA 2BH8A 2R7ZG 2Q8IB 3J7AF 5CBAE 3MC0B 5C44H 4JW0A 3HKEA 3LSUA 4DR3O 3PUXA 4YY3Q 5CA0B 3VNUA 2KCNA 1YJ9B 4YJ2A 3J80i 2L15A 1BQQT 3E83A 1NAPA 3W2EA 3ZHQA 3WNDA 4FJCC 3GDEA 1JFFB 3VMFA 4IJHA 2YWGA 3K7AB 3CC4B 1HA5A 4EH1A 2BSKA 5F2VO 4GN5A 1ICWA 2XNJA 2NTSA 4DUZQ 4KKSA 4YY3L 5LGNA 3I73A 2B7BA 3MHHC 2PNHA 1JICA 5LYJA 2HDNB 1W6KA 1DDIA 1HHVA 5C0XH 4CHTB 3FPUB 1PH4A 1G1XB 2ZJQA 4ZKBB 5GTHZ 1OO9B 2XRQD 5FLXE 4ZBMA 1Q1BA 2BV3A 2WB1B 1QH0A 2LKVA 1HNWQ 3NBHB 4ASUG 2YICA 4DUZL 2A9HA 4N3GA 1RIPA 4LNUA 3VQYA 4IALA 2V1CC 2VQEL 2F0OA 4ZQ3A 4IQZA 1WP7A 2HLDG 3AVXA 2PNRC 1N33O 3T56B 5DAUA 5KSWB 3K58A 1LTLA 1TAEA 1M8AA 2FMCA 4PA4A 1Q9SA 2UUCL 2B1IA 2W0FC 2F66C 1PH2A 5K5PA 1E1QA 2AHOB 3ND8A 1HNWL 2KEDA 1YIJV 5B6IA 3U58A 1SS3A 1N0JA 1TS5A 5LMUB 2OTLB 3CHBD 1TGOA 4PC2A 1ESFA 3K7UC 3L9DA 4K8XA 2BE3A 3ZIAG 2QR4A 1RM1C 2DGYA 4Y9RA 3LNMB 2ZTEA 3I91A 1N4CA 1QHTA 1RFYA 4O2AA 3S1RH 3AVYA 1PH1A 3DC5A 1TUBA 4F6RA 1K0SA 1O7ZA 4TT3G 4PELA 1PTOD 4GKKL 4GUNA 4UFZA 2BCCH 3SYAA 4KV6A 5CR3A 1JA1A 1OCZC 1TWCH 2LGWA 5CYUA 1NY4A 3CRZA 1CA5A 4IYHA 4P9SA 3L3OC 1AILA 2R92H 1NB0A 5B1NA 2F3IA 3SDZA 3I1FA 1GH6A 2MNAA 3H1LH 3OW2U 1XHXA 3QIAA 3CCMV 2QDXA 3CS5A 4CJ2C 5H6QA 3CCLB 3QB3A 3NE5B 4E4EA 4B3XA 2KKWA 2PZUA 3MHBA 1R4PB 1EWIA 1D1IA 4A3JG 4KN4C 1S40A 3SPHA 4PHZA 3QVNA 3A2FA 3KLSA 3A35A 1HNXO 1U4PA 2RDGA 1VIBA 2EXDA 3M7NA 2PQAB 5DN6A 1N08A 2Y0SB 4WORA 2BCOA 2WLMA 2SDFA 1S0VA 1DOKA 5IYBH 1CHQD 1C48A 2NVYB 5ITZB 4YJ3A 2EIKB 3KK7A 4A3EG 4TT3A 1E24A 1VQNB 4LBWA 4AIMA 4P22A 3DSQA 2YWFA 2V31A 2DERA 5LMUO 3BAAA 1VQKA 1YZBA 2FXQA 2K52A 1B9NA 1SFOB 2DJGC 4OX9B 1JMKC 4IOAA 1SQFA 4C3HB 2NV4A 2WB1E 3E86A 2C2WA 5C3EG 4PZ6A 4LF5O 3I4MH 4JZ2A 3T53B 2SNSA 2O5JC 1SBBB 1VHEA 3MD0A 4O4LA 3PA1A 3CXHF 1EYAA 3ETEA 4JV5O 1GAWA 5BSXA 2HQLA 1SR3A 2Q6KA 1DDGA 2KEEA 4KHPO 1A8VA 1R6NA 2IJHA 2GUZB 1XNQB 3HOYH 4ME5A 5LXTA 4J80A 3AEVA 1UD5A 3RN5A 2YU9B 1K4CC 1WLEA 1K28D 4A3GB 3QTCA 1SF9A 3KLRA 1HR0W 3L9AX 1PH5A 2Z5UA 5M3MH 4KK7A 3AG4B 2VQFQ 5FO9B 3A0JA 2BOCC 3BG3A 2Q73A 3WG7C 1L0XB 3CCRB 3MVVA 3R6KA 3TEHB 4L8JA 1QNMA 3SR1A 2ITCC 4I9QA 3MEFA 1OV9A 5IYDO 1DXMA 4F87A 3QO2A 3CSXA 1IVSA 3CC2V 2NYZD 4KKTA 2E2IH 1OGJA 2YYZA 2IPKD 3N6RA 2F4VB 1SNCA 3AGQA 3K03A 3R2TA 4I7ZC 1PRTC 4WZKA 3EQLC 2VQFL 3MXNB 2CFMA 2Q2IA 3N2GA 4FK5C 1IXMA 4X1YB 4LK1C 5TY0A 3CCSV 4GKJL 3IC7A 1TWHH 1SMYD 5B5EZ 2CF4A 4OX9O 1IBKB 1R4QB 1Y1VH 5FKAC 3HEJA 1STHA 1NJID 1CXZB 1ZYRC 3RYIA 1F77A 3DTUB 1NTZH 4JGSA 4E2LA 5IYQA 1VQ5V 3F2DA 4QFMA 2GK6A 3CP0A 3AVTA 5LP6B 5JJJB 1SQGA 1I4RA 2ZQMA 1A2TA 3S3XA 1KQSU 4QV2A 2B2TC 4XN0A 2Y0SE 1EQVA 3C1FA 1F9SA 3K06A 1OGIA 1B06A 1Z5WA 2D5DA 4QUFA 1KYOF 2JK5C 1EY8A 3L74H 2Z4IA 4IO9A 2NN6G 4KKUA 2X0KA 3K57A 4OELB 4DUYQ 4KL1A 3BVOA 3CRMA 4FXUA 4RHRA 1CKNB 2E74B 1VQ7B 3FHWA 3CCVB 4X64Q 1ENCA 2EIMB 5FO0A 5C4JH 2R9IA 2JA5H 1GOZA 4A76A 1VEWA 4FK8A 1BGYH 4OO1I 5KHGA 4MTFA 1YI2V 1ZM4A 2W6IA 2DJVA 4LJZC 1WTQA 2FMLA 1E2VA 4I4TA 2IH1C 3JSNA 1FDRA 4P9PA 5CBEE 4DUYL 2UUAQ 4FXDA 1SQPH 1PPJH 2F4VO 4P74A 3V05A 2WFWA 4X64L 3NWSA 1VCIA 3TZDA 3ZRVA 1DLBA 4KD4A 1MGSA 5H5JA 1T6YA 4DV7Q 2QEJC 3Q4HB 5JQGA 3J81i 2KG7B 2RHSB 1AJPA 1PRTF 1IBKO 1A62A 1EWYA 3B8NA 4XLFA 2AQ2B 4R9WA 1PL0A 3QSYA 4ZIBA 2UUAL 5J2UA 2DNCA 4WQMA 1GN4A 2XIWA 4G4KA 3MDSA 1OHHG 3A8KA 1I5XA 2ZJRA 5BXZA 3MTSA 1F9RA 3FKSA 3TS0A 3BEHA 2A5HA 4IUQA 2XWBB 4HNAB 4N3NA 2GN5A 1M1KD 4UCTA 5BMVA 1G7CA 2X6BA 1HZBA 1ZAUA 3E20A 3W5VA 3S2HH 4DV1L 4IYIA 4P12A 2Q67A 4RAIA 3IKJA 3V2TA 1IX9A 2IH3C 1VQHA 1K8AW 4GLVB 1ZEQX 3NWTA 3Q23A 1FXVA 3QE2A 2Z6BA 5T1GA 1YJWV 2F43G 2XNCA 1AI5A 5KAIZ 1WSVA 3SJAC 4Y9UA 3H91A 1N36L 5ELFA 1N0NA 4LFBB 1SRUA 1JR9A 3UDXA 2ODMA 1EQTA 4ZCMA 3OYYA 1LV9A 4JI0Q 2E75B 1ZL8B 4TV8B 5JEAJ 4XOTA 4DR7Q 3OMNB 4HIZA 1H8HA 3P27A 2PZTA 2PI4A 1GMGA 1V0EA 3OTOB 1NJIW 4IZ8A 4JI6O 1G7SA 4GX5A 4R4QA 5BY1A 3D3IA 4U9UA 3F1ZA 3ASPA 5H9CA 3OUFA 3T1YQ 1XOUA 4JOIA 3HKCA 3K81C 4WRDA 5IE9A 4LF9B 3KFUA 4PI0A 3QO5A 3P26A 3PUZA 1CI3M 2K05A 4DR7L 4PMBA 2LQTA 2B63G 1O80A 1XMOO 3RMHA 4N9PA 1N0VC 5G3LD 2R72A 2EQSA 3G71B 1CUKA 4S3SA 3RY8A 2EINB 2K5HA 1KECA 3ZUGA 1D6EC 3VQWA 2RCFA 5GAEC 3IGAC 4HIKA 3T1YL 3VOUA 4BY1G 3DGEA 3R3OA 2O5IC 4MYTA 2R9AA 3CRRA 3T1HB 5IT9L 1EY4A 5IYCG 1GJRA 1NS1A 1NKDA 5H1SE 1X3FA 3G6EA 1I7FA 1TS4A 2X6YA 2GREA 4DV5Q 1X55A 2QCPX 3CW2C 3H1HH 4JK1C 3I56B 2ZJPA 4OOVA 1QNKA 3W1GA 3UKMA 1QVGU 3FDTA 5IJ9B 4CH5A 1OCRC 5KUMA 1BLIA 3Q6QA 2ZE8A 3HOZB 4LBEC 1AP5A 4AC9A 4QNHB 4EVOA 3KCYA 2TSSA 4OP7A 4P72A 3U6BA 2KHIA 4F7XA 1YITB 3IFXA 2KVOA 1BR9A 1E2WA 4L5QA 2A69C 1NH2D 4A3MG 1W0KG 4LFBO 4RUFA 4EKWA 5LOVB 3MEHA 4JBJA 2A73B 4QIWF 2X53S 1VQ9A 2HQEA 4N8FA 4Z4RA 5HKKA 3A7AB 3NPPA 4HSVA 3SXHA 3GVLA 3DWAA 3VDYA 3OTOO 4XD7A 4Q7JB 5KEEA 2UUBL 3Q6RA 2NVTH 3M3YB 5FL7G 4NW2A 1VQLB 1NMFA 1RODA 2Z8LA 2I5MX 4LWSB 1NUCA 3ZMSA 1XUQA 2UXBB 2F0DA 3OMIB 1JC7A 5C0XJ 2C5CA 1WD0A 5CMDA 2B2WC 1XEQA 3W7UA 3T4AC 4LF9O 1M1KW 2OCCB 1U5KA 3GTPH 4JAVA 1Y0YA 1NTKH 4JI8Q 3PO3B 2PZSA 4XBFA 2QA4A 1QUEA 3PGZA 5LMZA 4DR2B 4HJ7A 3BNWA 1EXMA 3VYUA 3H3VI 4NXMB 1JVMA 1MZFA 2E76B 2VB3X 4IUPA 1KQSA 1DZ1A 4XQQA 4RCYA 4WJ4A 4PQXA 3JAMi 3N2KB 1GN6A 3A8JE 1VQKV 5J9PC 2M2LA 4FLTA 4B3MQ 3GSIA 3UE1A 4X3SA 2AWOA 4BIOA 4UZEA 3K04A 5C44B 3ERSX 1Q6UA 3CPWB 2JGDB 4XL9A 1KK2A 1W9XA 1MABG 1JT8A 2I5LX 2H8PC 3VNVA 1YNXA 1KBHA 3AGPA 3G4SB 5M5WB 1WTXA 4OEMB 4K0KB 1V1PA 4X3TA 4UP7A 3EHBB 3OJXA 1H9SB 5B66Z 4WFHA 4ICGA 1EOVA 4B3ML 3CAMA 2CTQA 2L55A 3U9SA 1FD7D 3M7MX 1KDCA 3S1MH 1MBYA 1G8ZD 3OWFA 5C4XH 2EIKC 1UD8A 1FD9A 2QEXA 3SK8A 5JJIA 2FL4A 3PA2A 1PHJA 1EY6A 3MFYA 4BR6A 4CC6A 4NDXA 2LMCB 4YY3B 4IFDH 4H9GA 1NVPB 2OK8A 4RCNA 1WORA 2HVJC 4DAYB 4LNUB 3FB5C 1IYUA 1M93A 2K28A 2K01A 1XMQQ 2VNJA 4X1IB 1QUQA 3QFTA 4UVAA 4HMIA 1VQMB 1JOQA 3TS2A 2FINB 3TETA 5JOBA 2UXBO 2WYRA 5K1XA 1QFJA 2XASA 3C3SA 1WVLA 2EYOA 1DGSA 4RKLA 4X06A 4NXNQ 3PIP3 3CU7A 1CNEA 2YV5A 4I50A 4MTGA 1NR2A 4DUZB 3ASOB 2XOKA 4K8IA 5M3FG 4Z1MA 2ALYB 1SETA 2WKDA 1Z2GA 2F0VA 2VJJA 2EIJB 3HOUG 3CD6B 1AMOA 1SYFA 3TSSA 4IPCA 1EN4A 1SZTA 2JA6H 1SQQH 2GPJA 2YDEA 3TZUA 4R4IA 3E0JA 1SE2A 4DGZA 5CORA 5KYLA 1MA1A 1GN3A 3CCJB 3SJQC 5LMNW 3OEEG 4NXNL 4KN7C 4YXWA 3JAKB 2PPBC 3ZPNA 1TWAH 3NQTA 4GOPB 3CXCB 2F1MA 4A3IG 3FX7A 3IJ4A 3G48A 4K35A 1MG1A 1N32Q 4Z4YA 3S1RB 3T2MA 5ELCA 4DV2B 2N05A 1HQMC 3CMAV 1RPOA 4TMTA 3JALB 1STBA 2QDOA 2QWOB 4QY7A 1TWCB 1G6UA 1QGZA 2JXMB 5EPLA 2BE5C 4CBVA 2DY8A 2RCVA 4YY3O 2ZITA 2R92B 1PFBA 1IXBA 4RWSC 1KP2A 2WJYA 4UV8A 4JI4Q 1L1OA 1N32L 1OCOB 5EBCA 2MQHA 1H2LA 3S17H 3QFSA 3ABUA 4G1BA 4B7EA 2A74C 1QWYA 3OSOA 3D4DA 1FFXA 4GQNA 2A06H 3PV0A 1ICFB 2NN4A 1A0IA 2CUGA 1E79A 3ZHTA 4II3A 4PC1A 5LP6C 5CV6A 4DUZO 1FYJA 1CP9A 3I3CA 4A75A 1ILPA 4PZ7A 2NLJC 3T4DA 1UD3A 2ZR2A 1PJ7A 4YHBA 4R50A 1JJ2B 2VQEO 4JI4L 1YLOA 1A63A 2C4UA 5TSSA 1NI8A 1T5XD 4GYCB 4DYLA 3DXRA 2HUGA 1KTVA 1EFWA 2UUCO 4I7AA 4XT1B 5AG2A 3JD1A 1UJWB 3A0HZ 1Q43A 2CBXA 2BDOA 2E5LL 1QVGA 3I4NG 1N05A 2GBOA 4QB4A 1HNWO 2OTJA 1KAWA 5KRUA 4C43A 4R71A 4IHJA 3TJTA 5KHIA 1OCCC 1N8RC 1TIID 2HVKC 1HZAA 3S2DH 3ABKB 2LO1A 2E8GA 4I9WA 1G91A 3I4MB 4JI1B 5I9OA 4RD1A 3S14B 4PMWA 1FAFA 1ORQC 2DY7A 4PGOA 4BY7G 3ZBTA 4XDLA 1RTOA 1JPXA 4UXNA 4ZYSA 3S1QH 1K7DA 3L70H 2WPDG 4GKKO 4KI0A 1D5AA 2E2JH 3S1NB 4F6EA 2F0HA 3HKZE 4WFGA 3BABA 5IJ0A 1S77D 3A5ZB 2QKIC 3OE7G 1JB7A 2ICEC 3ZMZA 1TLLA 1TWFH 3AB9A 1UPGA 2Q6IA 1WI5A 5M3MB 3URYA 4XORA 1VQ4B 3M4PA 3CCEA 5LA6B 4UV9A 1I3QH 3ABTA 2BN4A 1IBLQ 4CDEC 1VF5B 5C3EH 4FN5A 2AXTZ 1H38A 2P4VA 1X3PA 1F51A 4E0FA 1QR8A 1D8LA 2DUDA 1U2RA 5IYBO 3OMAB 3J81k 3STZC 4B3RQ 3HGBA 2QWRB 1JJGA 1E62A 2G9HD 3SKBA 5GONB 2RSOA 2WWWA 5FK9C 4F7DA 4YAOA 1IBLL 2VQFB 1WU8A 3Q38A 1TWHB 4C3JH 2DIEA 1PP9H 3KUPA 2PUSA 3J7A5 2MW2B 4OGQB 2BM1A 5EJWA 1X9NA 4PC7A 2X8KA 2A69D 3MHSC 1Y1VB 2CW0C 1C9OA 1WTRA 4EEQA 3NEMA 4IURA 2E75C 4TSSA 2OT2A 1KJZA 4U3FH 2K7VA 5IYPA 5LHIA 3D8CA 1IHZA 4B3RL 3W5OA 4FFKA 5B1OA 1A32A 1C8CA 5CA1B 5T1IA 5FLMG 3ML0A 3G6EV 1UUPA 1YTFB 4QJFA 3HG9A 4G27B 2EE1A 2F0WA 3OR7C 3F7YC 4UZFA 3ITPA 5IT9c 4O4HA 4LF8Q 3N52A 2DNEA 2IW3A 2VUMG 3X2QC 5IIFA 1A3UA 1HXYD 3A8IE 2CKZB 1N34B 1EN6A 4LW1A 2WLKA 1EP2B 3BDCA 4O0AA 2WP8J 5A89A 4WBNB 3VYTA 2WLLB 4TUYB 5IY0A 4AILC 4HJ8A 5GW7A 1ENFA 5C4JB 2CH4A 2JA5B 2EINC 4OPHA 2JYOA 1VQ9V 1Y1WG 2ZL5A 2W0XA 1GO3E 4LF8L 4X65Q 2K75A 3RYFA 2G9DA 2M9VA 3SVMA 1S5HC 1S72B 1QG7A 2A3QA 4QGPA 2YIBD 3LQEA 1WPCA 3G7LA 4FDBA 2K1BA 4LFCQ 4OO1G 2R9RB 4DUYB 1CM9A 1YJ9A 1S5LZ 2L5TA 3S3WA 2DN9A 3A5UA 5DLQE 2NN6H 4QHYA 4X64B 2VQFO 2WLIB 2QA4V 1JFFA 4CC5A 4I55B 1B2TA 1K73D 4ROXA 1SKYB 4CQJA 4X65L 2CK3A 5HZAA 4JI5Q 2MFIA 5IYWA 4GKJO 3CC4A 1W59A 4L6TB 1EFCA 1FNDA 2EJMA 2HFEC 1A15A 4N21A 5THXA 3W2DA 3ND9A 2JEXA 2VW9A 1OTCA 1K92A 4BA1I 4LFCL 2IJJA 2K04A 4MVMA 5JCOC 4IT5A 3SYPA 1WB7A 1GHKA 1PM9A 4CS4A 3H0GG 2ATKC 5KNBA 1F23A 4JI3Q 1UD2A 2Y48A 2EY2A 5GAHC 5J2TA 2AZ0A 5J3OA 1WFQA 4JI5L 2I5HA 4X66Q 4LF5Q 4DV7B 2JA8H 5IYNA 4DNTB 1JCKB 3S2HB 3CW2A 2Y0IA 4DN4M 2OCCC 4MYUA 5FJ8G 1B53A 4MN3A 1NTGA 1L8DA 3IL8A 2OYNA 2QEXV 1WP6A 3FYIB 4JI2Q 1NRKA 5LGUA 4JI3L 1YNND 4LUOA 1VJSA 3ZN0A 2F3WA 2XTAA 1B6QA 2A6HC 5CDFA 5IY5B 5CV4A 2AHOA 4P3IA 3CQZH 2IHEA 4X66L 4AH6A 1BCPB 2B39A 1AP6A 3ZHRA 4BBSG 4JC0A 3NBIA 3KJOA 5LHY1 5KNDA 2OTLA 3CC2B 1H85A 1NSNS 2WSSG 1GM9A 2ZXWC 3WDNA 3T4ZA 3W5HA 4DUYO 1AE2A 4C3IH 1O9GA 4JI2L 3LDEA 2BA0A 4A93H 4KXRA 3BDLA 4X64O 3QG5A 2YC0A 1BOSA 4UHVA 3HOXG 5IODA 2ZBUA 1WSRA 4DK0A 3TK1A 4MSWC 3BZDB 2IJKA 4JI0B 2B8FA 2HDMA 4DR7B 4IPHA 2ZZQA 1ZUNB 4MS2A 2BE5D 3A0BZ 2Z3YA 4LUZA 2H94A 2LJ2A 2UUAO 4JYBA 3K6OA 1VQ5B 4EFBA 2CTWA 4J1MA 3BQJA 3TP8A 2A0LA 1Q5OA 2BH2A 4K2KA 1UE6A 4OXSA 1D1KA 3K5MA 2KJXA 2WAQG 4DV4B 3U0ZA 5TR9A 5IYDH 1TY2A 1GUGA 1LR1A 4DV0Q 2VNUD 1ZX3A 1YF2A 1Q6HA 2ZL7A 3UDGA 4AYBB 4NTYA 3VO2A 4JCVE 1ZTEA 4JPBW 4DV1O 4U68A 1QGYA 1TWGH 5GAGC 2PQAA 4Q20A 3G6BA 1F9PA 3NHHA 4LF4Q 1PJ5A 5E7NA 3RNUA 3KEWA 1BQZA 1LNQA 1U0LA 3VQVA 4A3GG 1SFOH 5ITZA 2ID0A 2J7KA 3SJCC 3P30A 1O7IA 1K73W 4DV0L 1VQNA 4ACBA 1FR3A 5H5NA 3A55A 4FLXA 4DV5B 5BSYA 5JPMC 4DR4L 1QG0A 4X9QA 4B3GA 4X8AA 1K97A 4QUZA 4GOPC 4RFBA 4BY1H 5GROA 2NVTB 1XNRQ 4DR1Q 4B08A 4XTCS 2AKWB 1KRHA 2XAGA 4LF4L 2CQAA 3MFGA 1PLFA 3ZZUA 4IFDJ 2ADPA 2Z4HA 5L3FA 4IIJA 4FPPA 5IE8A 1XE1A 2JK8A 2CRVA 3WNBA 1E7ZA 2ZINA 1J8IA 3AK1A 4DW0A 3GVMA 4MNOA 4KFMA 2AUJD 1VDZA 2V7QG 2JJ1G 3BY1A 3CJHB 2R93B 4DR7O 1XNRL 4DR1L 3PVDA 3E9HA 1E1RA 3AG2B 4APVA 3IAYA 3VQXA 2OTJV 2Y4TA 3OFNG 2GUZA 2EZPA 1WD1A 1V1PB 3VO1A 5DM6V 3SPIA 1COWG 4DV3B 2E2DC 2OEOA 3T1YO 4YAWA 3W7XA 4YAUA 5CBGA 4UP9A 3RW0A 2JGUA 4GT1A 5IDJA 3CCQB 3CCRA 5JAVA 5F4OA 4JI8B 1SN8A 1R1BA 2LFRA 3IC9A 3QR8A 2R70A 2FB5A 2PO4A 3NELA 3D0FA 2B2YA 2GQFA 3A56A 3ZX6A 1LO5D 1EZVH 1YVCA 4YHHB 3LVBA 4DAMA 3AYHB 2JJQA 3S1MB 3R66A 1UMKA 4B3MB 5C4XB 3W2IA 3EIVA 4LFAQ 5DS0A 1NQTA 2PIAA 3MXNA 1E0BA 1EZJA 3A8TA 4X1YA 5LMNQ 4XIGS 1H42A 4DV5O 1RTNA 2P5ZX 3P1HA 3CCEV 1H8EG 2R7ZB 3ES9A 1JB3A 1TA8A 3ABKC 1HZ9A 1AI6A 1FNCA 4OIJA 3F2CA 2UUBO 2ES2A 3VR5A 5L3BA 1QR9A 2K50A 4LFAL 3SLNA 1HTLD 3AFPA 5IT9N 4AYBE 3TXSA 5B1AC 3K9AA 1HNZQ 4JI6Q 2XAFA 5LMNL 2ETNA 3TQYA 5LP6A 3EVKA 2AMCB 3E6ZX 2D62A 4OWXB 2FYUH 5KGUA 4AVZA 1QVCA 2QSAA 4H7BA 2JA6B 5LHHA 2D9RA 2RDHA 1KB9F 5FIUA 4PA6A 5A88A 4P25A 4CH4A 1A6XA 1SSOA 1XMQB 5IP9H 5C6AA 1NR4A 2WINB 4XYOA 4G1VA 3U9OA 4UAJA 1Q81C 5B3SB 1CKNA 4CKBA 1VQ7A 1HNZL 4X05A 3NXSA 1SYGA 1OB0A 1TWAB 4YCVA 2AQ3B 1WTVA 4NXNB 4WFBV 3AVWA 3S9WA 3ICEA 4P9OA 4Z4VA 1VF5C 4H02A 1SKQA 2L1BA 5ELEA 4JI8O 1SEBD 4K5WA 2ZM6Q 3C3LA 1XI1A 2SOBA 1U4LA 1ZUQA 3J80L 3GTGB 4OWWB 4PNYA 3CRKC 4KJOA 4ZAIA 4ZI7B 1IBMQ 1IYJB 1D5XC 1YSCA 3WNCA 4B3MO 2Y69C 5CGKA 2F0GA 2PCFB 1TTTA 2BOSA 3ZJZA 4AQYQ 3OAAG 5IGBA 2X3UA 3HOUH 3JU4A 3U50C 3BCDA 1KABA 1UEAB 2F0LA 4BXXG 2QWNB 3CRLC 4YAFA 2PMZB 3NXWA 3I55B 4EB6B 4KUMA 2ICIA 1OZ0A 1KDBA 2LXJA 2DOGA 4RGOS 5KNLA 1SROA 1QX4A 3OEHA 2KG7A 2GVBA 3B09A 3S17B 4X0CA 3HAGA 1K34A 4HN7A 1N32B 2PLFA 3W2GA 3HPLC 3FJOA 3VA5A 4GLXA 2W6JG 5LL6X 3OZWA 4AQYL 4A3IH 1PFNA 2QE7A 5A35A 4RPDA 5DNFA 4YWLA 2MHVA 4FYDA 3DXRB 4A3BG 5A2QL 2D74A 1FNWA 2VNIA 1AH9A 4E6IA 4HNAA 1YJ9V 1KNAA 5IYZA 3J81j 2OIGA 2MK3A 3WB1A 3O65A 1CPYA 4JI4B 3RYHA 1H2NA 2KQXA 1VQPB 2UXDQ 5AJ3Q 3RLNA 2HG5C 4PDLA 3CC4V 3A1PA 2K5QA 4LUVA 4QUCA 3KDFB 3WU2Z 3RZOH 2HEPA 3CXCU 1VQ6A 3E8GA 3L7ZC 2E1BA 1IZ6A 4RWUA 2PYLA 4NXNO 4HCEA 3S2DB 2A6HD 2EY5A 1LTTD 3A8JA 5F4MA 4GZRB 4ABNA 1X59A 3RYCB 1B3AA 5GV8A 4ZK9B 3E8HA 1ZL8A 4TV8A 3ZS8C 4RO2A 5HFLA 2C35B 1M56B 1S5BD 1L1FA 3R8BA 1EYCA 3I90A 2UXDL 3LSQA 2W6JA 3ASRA 5E1AC 1AE3A 1OB2A 2ZT9B 3HOZG 1IL2A 2Q69A 3S1QB 1DTOA 1HR0B 2E2JB 1HA3A 5D65A 2XGTA 3STBC 3CC7B 2MP1A 2K03A 2K5VA 5C93A 4JBMA 4ZHQB 3RT3C 2VYQA 4A3EB 2R7DA 1BBXC 5IK2A 3VA7A 1TWFB 3AG3C 5KNCA 3I2ZA 1M90C 3OP1A 4D7TA 4YWMA 1N32O 3HKSA 4D7SA 1TU2B 3W2HA 1ASZA 5FLXL 2PMDA 3KKYA 1H9JA 1I3QB 2ARHA 2Q7EA 1Y69U 3RN4A 1LT4D 4DK3C 2GA4B 5C3EB 2OTLV 3PIO3 1I5FA 1VS0A 1JJ2U 4C0SA 3CWBH 1EOTA 2Q68A 4U7NA 3QWNA 1F4NA 2BF4A 3ZN1A 4BY7H 1MJEA 4P26A 5E4XA 4PA7A 1PYSB 3H94A 2ZTCA 4JI4O 4TMXA 2LSSA 3GTMB 3PO3G 2K9PA 1I6HH 1G6PA 1BBWA 5IJ9A 4DXWA 3HB3B 3WBJA 3VR4A 1KC8C 2PMZE 4Q6GA 3UDIA 1LT6D 3CRCA 4DF7A 5K36G 1JQ0A 1WCMG 2E5LO 1IBLB 4B48A 3HZXA 3CTAA 2C5HA 2Q8TA 1TVXA 5IY5C 4NTWA 5L3DA 2BM0A 4FP5D 4FM0A 3M3YH 5LOVA 1BCPC 1HFGA 1Q82D 1PD3A 4YELA 3T16A 1PV4A 4X07A 1TS2A 2YXYA 4J9YB 2RSNA 4BIZA 5DM73 3CMAB 3CCLV 1Q86D 5M5XB 2AHYA 3PENA 2H3OA 1VQLA 5EKIA 5EYPB 4B4DA 1ASYA 3OD4A 1R3JC 2MPMA 4LWSA 1U4MA 2RVLA 3RN2A 2RKSA 1M4VA 2QKSA 1HZEA 1PNLA 4DQKA 1NBWA 3KL9A 3SJPA 3GIRA 1CKMA 2N49A 5E3FA 1E22A 3ABMB 3GTQH 2Q9LA 2WZNA 4Y52H 2IJIA 1EL0A 3LNNA 4RDJA 4OOXA 5D14A 1IKMA 4A3FG 1WTWA 2A6EC 2F0UA 2D0PA 2FFKB 1VQNV 2NPFA 1EWCA 2B2UA 2CH7B 5BZBA 3I72A 3N2KA 2Q6LA 2JIZA 2CAZC 5M5WH 3TP6A 4XKVA 4IJLA 1R6TA 4JASA 1EP1B 4OWTB 4ID6A 3CPWA 1N9WA 3AVUA 2JGDA 1G7TA 2XNAC 1E1QG 4TSFA 4H0LB 3JCZA 4FFBB 5EIBC 2Y0PA 4FWTA 3JATB 3G4SA 3UQ8A 3MMPA 1EFRA 2KQ3A 4Z4ZA 3QO7A 3U4ZA 1THZA 3SPCA 3SK6A 4J7JA 3VR2A 1H9SA 1J5EQ 2Q0AA 1Q6IA 1ZM3A 3HKZG 1YJNB 2VQEQ 1TXYA 3M4OH 1GUWA 4UB6Z 3OHXC 1IBLO 4WFFA 1IJEA 4CJ1B 1VQEA 3B78A 4X65B 2UUCQ 3WQZA 4IUTA 3PSIA 1QB5D 3GTJH 5J2TB 5E1FA 4KHZA 2P06A 4JPRA 1GJXA 2QF7A 1Y67A 2QJ1A 1Y1WH 4RGTA 2PY5A 1QOHA 4B3RO 3OW2B 4LFCB 2QM7A 2EX3A 1R73A 1BCPF 4NBSA 1FX0A 4EQOA 3KJPA 2AGAA 4DAYA 2ZE6A 5E6TA 1J5EL 3D4WA 2BDNA 1VP7A 1GUOA 3CP8A 2V7TA 1HNXB 1H9MA 3CCRV 1H95A 4X1IA 1DM0B 4G5GA 1JJCB 5C3WA 1VQMA 2JA8B 1QLEB 3G67A 4W4KA 4OO1H 2QM4A 1E3PA 2NR5A 1UE7A 4JI5B 4BW9A 4G2KA 5TISZ 2XAHA 4K8ZA 3BRCA 3RFRA 1RF2D 1FXKA 3MWYW 1BJKA 4KY6A 4GKKQ 2R92G 3ETGA 3CCUV 3CD6A 5FPRA 2PW5A 4C56C 2X69A 4R8NA 4UCOA 3CQZB 1XQ8A 1RHPA 4K5VA 4J7ZA 5DN6G 2YWHA 1B2RA 2F0NA 1Q81D 4X66B 4LF5B 4RGNA 3CCJA 4LF8O 3H0GH 2UXXA 3DEOA 1KK0A 3ASNC 2ZXHA 3JAKA 1Q82W 4KD3A 4CH3A 4TQFA 2KHJA 2HKOA 4GOPA 3GWKC 3E8BA 4C3IB 2RC5A 3CXCA 1I7PA 4PA9A 4L5TA 4A93B 4JV5B 1Q86W 4ABMA 4LF7Q 3J7AU 3ULLA 3KLWA 4QIWE 1WA8B 3S16H 1KZLA 3U4VA 5F2DA 4JI2B 2VNHA 1F20A 4O42A 1SE3A 5FJ8H 1JOOA 3GVKA 1I08A 3KOJA 4ZCIA 3QJYA 4KHPB 2JSOA 3RVZA 5LL6S 3JALA 2CE4A 4Z4SA 3J81L 2XNDA 4X65O 2BSAA 5M9OA 2VRZA 1LTSD 2NZOA 1BCCH 1CTMA 3FVQA 1S0UA 5FPOA 1VQ7V 4LFCO 1DARA 4LF7L 3CCVV 1CSPA 1YZ6A 3PMFA 1F60A 3NTIA 4BBSH 1YHQB 4LNQA 3OIQA 3I4MG 3CEIA 3QG1A 2Z0AA 2WACA 1I0HA 4XLAA 4QE7A 4HIMA 2E2HH 1KKDA 1PKXA 1YX2A 3K79A 1LT5D 4XYQA 1MSGA 3WBKA 4HAEA 1KUQA 4JI5O 4HMJA 5F4JA 5L3EA 2EJ7A 2KECA 2KCMA 3AK3A 5GADC 1U96A 4P6YA 1TWGB 2ZE5A 3FP9A 4RH6A 4ZRZA 1HCZA 1SNMA 3B2EE 3HOXH 3ZCCA 2D3OW 1JJ2A 1Q7YD 3J80c 2X0LA 3HOYG 4M4SA 5ELOA 1OB5A 1NMGA 1VF7A 3JQRA 3GWOA 3UT5A 4A4IA 5B1BB 1SJHD 5E79Z 3L72H 4JI3O 2B2VA 3A8IA 3LX0A 5CV5A 4UB8Z 3CMEB 1VQIA 3W3AA 1STYA 4JTCB 1EEID 5B3SC 2OBTA 1W0JG 4X66O 4IIJB 4TRDA 1WPXA 3H1KH 2V1DA 4DV0B 4BY1B 1GK9A 1QQCA 1WTHA 3S14H 1AZQA 4RQEA 1FNVA 3P20A 1BSMA 1P16A 3F2BA 2KB1A 2P5OA 4DAPA 4PMCA 4ZCLA 2Q5ZA 1J95A 5CV8A 4HJ9A 3PF5A 4JI2O 4FM1A 3S1NH 1L1OC 3JARB 2AZ2A 3OW7A 1EIHA 3W7TA 3CRQA 1XNQL 3TN2A 5EBLC 4OPSA 1HUMA 3PQIA 3EFFK 1OXUA 2RBMA 1AZPA 2PI5A 4J6HA 5I2YA 3GTKH 1Y0RA 5EPJA 4A3MB 1ENVA 3STBD 4KY5A 2R3ZA 1EY9A 4CKEA 4ZUJA 1XNRB 4DR1B 4O2BB 4PJ0Z 3EFXD 1O78A 1IKLA 4GKJQ 2LY7A 1T6ZA 4X8IA 3SJBC 1KIXA 1VQ4A 5LA6A 3C46A 1RM1B 1HUNA 1W0JA 5HURA 1K8AD 1AI7A 2OCEA 2LP7A 1Q81W 1D2BA 3C3TA 3SPGA 3I8ZA 2GJRA 3GP7A 3MCAA 4XNFA 3EBEA 4MVZA 1OXSC 2Z6BD 5JVH3 4KP4A 2JP1A 2NVQH 3JSLA 1QFZA 3M9BA 1WJJA 1OCZB 3D36A 2W6IG 3FEWX 2KA7A 2DYRC 3K5LA 1AR1B 2Z6KC 1K3RA 1IBKL 5EC1C 1ZXTA 5HGQA 4TV9B 2N88A 3VR3A 4UVBA 5GONA 3WB2A 2JA5G 4DXFA 3J7YW 4G57A 2QKAA 4DV0O 3ZHSA 5EMNA 3F7VC 2F0EA 4ODGA 3G71V 4DR4O 5IYCO 1TVKB 2Q0OC 3H3VH 1IB0A 2L0CA 4RQFA 1PMRA 1KDAA 4ZCKA 1KMIZ 4K3AA 1GXDC 4Y7NH 5ELDA 1Z5VA 4LF4O 4IL6Z 4ZOLB 1TY0A 4X3UA 2F0MA 5CA1A 4GNXB 5FLXc 3PJSK 5TV2A 5A8AA 4LAAA 4B7KA 2ZT9C 4FF2A 5KMGB 2K5WA 4K6LA 1EFID 3I56V 1NH2B 1Q90D 1Y8NB 5EZYB 5LMNB 1B50A 4KJNA 1KNEA 2VXWA 3Q3AA 5KUKA 2XTIA 1XNRO 3ZEDA 4DR1O 1AW7A 4HIOA 4JYAQ 3PCOB 3FKSG 1Q7YW 2HJFC 3JAML 5C5LA 1YITV 2VBTA 3M7GA 2VWKA 2VNKA 4WBNA 1KMHA 2WLLA 4TUYA 2CNDA 2P90A 3S15B 2R61A 1LTBD 1QJOA 1EIYB 1QBZA 4RA8A 2A6ED 4XMYA 1HNZB 5KHHA 4JI6B 4HAMA 2NNUA 1SNPA 4PDVA 4JYCA 3OGIB 1SYEA 2AUKA 4DAVA 2YXLA 4TVAB 1TQOA 5CB4A 4LH6A 3OPOA 5C5MA 1GKFA 2CGOA 4WFAV 1VQLV 4JYAL 5EBWC 4WCEV 1TT2A 2G38A 2F23A 2VBVA 1S72A 2HMAA 5KAFZ 2Q8RE 1GTOA 2L9HA 1MHWC 1EN5A 5EIBD 1BNZA 5IGFA 3D8GA 3FFQA 3HOUB 3FPKA 1XMOB 4FIPC 3NENA 4R1JA 4HE6A 4DV1Q 1H8HG 3FD9A 2WAMA 2WLIA 2KUMA 5GTIZ 4I55A 2PYKA 2ZM6B 1IZ3A 1HH2P 4QMGA 5L37A 3WG7B 2OYQA 2XT9A 1N36Q 1WN7A 1Q46A 3X3NA 2RDCA 1X65A 1IBMB 1JA0A 5IYZB 1YEZA 3D6WA 1WJZA 2H1EA 4A3IB 3PIPA 4AHCA 5J22A 4P75A 4LFAO 3SLDA 3RYHB 2KSDA 3RWRD 4TMVA 1VQ8B 4RD4A 1GM7A 1KHIA 3GTOB 1J9OA 1JJOA 2EY1A 1OXVA 4RPBA 3G4SV 5LMNO 5IGGA 4C7UA 4PD4F 3ER0A 1VQ6B 2YS8A 2F0FA 3T51B 3H01A 4N23A 1PL4A 3ABMC 1JWSD 3C2PA 2WLNA 1UWVA 4ZGQB 4JZGA 5M5YH 4FNFA 3RZOB 3ZHUA 1GM8A 4XM3A 2P3MA 1CHPD 1NZ6A 2GVAA 2DYIA 4MTKA 1HNZO 2VB2X 2LXKA 5EBMC 2JEUA 2LZJA 1BHAA 4UAIA 3CESA 5FO8B 4RUEA 4H33A 3B77A 3LWEA 4YIOA 3HOWH 3CC2A 4H0LC 4A3BH 1W3SA 2IU3A 4AYBG 1VQOB 3T1HQ 1VQMV 2UXDB 4Z2WA 1PTOF 3K5NA 1EP3B 1XPOA 3Q39A 1DD2A 5HY6A 4X20B 3FB8C 2EILB 3E0EA 4RG1A 2VZAA 3PO2H 1HA6A 3W5UA 1HVXA 2R9VA 2OXPA 5KHJA 2JRIA 2QWQB 3CD6V 2ZM6O 1I94Q 1HWYA 1R5NA 1G2TA 5IP7G 1PYBA 4OHJA 3T1HL 1IBMO 4J10A 2PF4E 5C8YB 4J9ZB 1RQRA 1H2GA 3CCJV 1VQ5A 1HDJA 2JEBI 5KA6A 1IDSA 4AQYO 3R6JA 5D3IB 2UUBQ 4FF1A 5J1ZA 3J80E 4BWAA 4BY7B 3SDLA 2X6LA 2EY6A 5IOCA 1I94L 3J80N 2RQ6A 1I6HB 2YSUB 4QQBX 2ATWA 1NNXA 1SMYC 3UE0A 3OTFA 1EYGA 2X6WA 2CTPA 2E1RA 1CSQA 2P67A 4R8CA 4HTHA 1QVFB 1NJIC 4DV6Q 1MSHA 3E9IA 4P1VA 4NXMQ 2VL6A 2F0SA 3HS0C 3K5OA 4KTAA 1OJHA 2SNMA 3J81c 5CC4A 2JDIA 1FRQA 1B04A 3U11A 4G28B 4JMQA 4YCWA 1VMPA 2ZBVA 4UUJC 4J41A 1BZKA 4HCSA 3CP1A 4I0XB 3AU7A 2UXDO 3J7ZC 2G5DA 3JD2A 5A2QE 3JASB 4UP8A 4NCNA 4DV6L 2JA7G 4N9TA 4K0KQ 5A2QN 4DR2L 2R93H 5JBQA 1LTID 2Y4UA 4NXML 5D5PA 5C4XG 2L35A 4X3KA 1Q12A 3MHPA 4X89A 4DFAA 2V7XA 3MXPA 4HJAA 2BMWA 3GTQB 2EULA 3BVMA 2DW4A 1V1QA 1VF6A 3GD7A 3CJHA 1YCIA 1WCMH 1W6JA 5D3DA 5LL6Y 3EXAA 3FPPA 1RD9D 1P8LA 4BBRH 1SXTA 2ZKOA 2XOKG 1I4GA 4K0KL 3RBZA 5C4ZA 4Z1MG 2K1EA 1NT2B 3CF5A 3OWEB 1FGUA 3IFTA 2ZCEA 2E3CA 3P3NA 3ZMTA 5COYA 3CCQA 4B47A 3K3WA 2X6XA 1PRTD 4C1NI 1D5NA 4YXWG 4K8JA 4IW3B 2VUMB 4ME3A 3M4OB 4OOSA 2IL8A 5JVDB 4B3TQ 2JA6G 1LACA 1F2ZA 4J42A 1YJWA 2EYHA 3BY2A 2N74A 5B1BC 3KF6B 1HP8A 1SNQA 1I5YA 2ZTGA 2R7ZH 2A1AA 5FNVA 2HP8A 2ZXOA 3GTJB 4A3FH 2I0QA 1URFA 1IW7C 2PZWA 5ELBA 1E3ZA 1Y1WB 1ZYRD 2WKCA 3NUCA 2XHBA 1X32A 5AFWA 3N27A 1EUJA 1M1KC 3RZDH 1VQ4V 1F9QA 4NNJA 5FLXN 3CE2A 3F5WC 1B9MA 2ASBA 2YTVA 4B3TL 3E35A 1FXKB 2A7WA 1DONA 1J5EB 2VQEB 4GX0A 3GB7C 1OCRB 4A3KG 1PH3A 4HIDA 4X1KB 1X6OA 1P84F 2O2LD 1Q8KA 1Y6XA 4MHEA 4RD0A 1VQDA 2UUCB 3GV6A 4DV2Q 1K5QA 1SA0A 3GQBA 5I6YA 2RDFA 3AG4C 1V54B 1AFPA 2Z1CA 3F8TA 2IM9A 1E79G 2IHFA 1HNWB 1EWHA 1GUTA 1NE3A 4UCRA 5KA5A 3DHQA 1R9TH 3TP5A 1GAXA 4ZGNB 1FVIA 3H6MA 2MJ8A 2B2YC 1V8QA 2F4IA 1CZGA 3DUZA 3H0GB 2KBNA 3HOVG 1VARA 3GTGH 5I6WA 1PV0A 4DV2L 2UU9Q 4TN1A 1LUZA 3X3MA 1TS3A 4V0BA 4OL7A 1HZCA 2LFSA 2XZLA 1F2YA 4FZ1A 3ONUA 4ASUA 3S16B 3JD3A 4GKKB 1JCHA 3BZKA 4DR6Q 4Z9CB 4ZI7A 3D31A 1ONLA 4M8AA 3WWVA 3E89A 4KMUC 4B9WA 2HLDA 1VQCA 4QGUA 4A3DG 4RAUC 3W7SA 1VQJA 1XYIA 2F0JA 3ZBUA 4XLCA 2C4TA 4O2DA 2HHHQ 1OXTA 4KY7A 2UU9L 4OPAA 1GHJA 1KK3A 1EBOA 4F4LA 2M6YA 3I55A 2N8NA 4EB6A 1EZ8A 3THOA 2E5LQ 1S5JA 4MVSA 5AN9A 4BBSB 2JVDA 2A8VA 3AG1B 4DR6L 4A3CG 1AB3A 4LF7B 4M0LA 3FMCA 2E2HB 3JAMc 1Z47A 3EJIA 1J5EO 2Q2UA 2ADQB 1M5IA 3VYRA 2EIXA 4GNXC 4F8MA 3ZIAA 3UI2A 4RGMA 2XSCA 2EIFA 4FLVA 2HHHL 4K5XA 3UT5B 1W2BB 4JI1Q 1CKOA 3OR6C 1UAPA 1S72V 1X56A 2DETA 1S5CD 1GVPA 3U10A 4EQNA 4X7CA 3RLFA 2SEBD 2CTRA 5JH7B 2WR8A 2QTZA 3HOXB 4G7HC 5I4DA 2K6AA 2YXHA 4ACAA 2E74C 2EYMA 2CVRA 2EIMC 2JS5A 1TKWB 1LLRD 2H4OA 2QN6A 1KXLA 2GTAA 1VQPA 3J7AV 2MO1A 2Z6KA 2CWPA 2F0TA 1I4QA 4WFN3 4JI1L 1SJED 3HKDB 3KDFA 3E8FA 4FF4A 4A3JH 3FKIG 1B1ZA 4AF7A 1HW7A 1YXBA 2L4NA 2WAQB 1TR5A 1GUSA 1F7YA 1STGA 1QILA 3RYCA 4BW5A 4JVZA 4P2NA 3BYYB 3LDDA 4PI2A 3OM3B 4L87A 1L0WA 1ZWIC 4IOCA 3QOJA 4IGGA 3HP3A 1PYWD 4A3EH 1T5EA 3RR5A 2GHYA 2P4KA 4AI8A 5KX5B 4X7DA 1TUIA 1Z7TA 1O7LA 4C3JG 1FGBD 3ZRXA 3ASTA 3GTKB 1PDQA 5GQOA 1RKNA 5EGTA 5G3LF 2HCCA 3CC7A 4RD3A 2YEVB 3QF7A 1UE5A 4ZHQA 2LGQA 2ZE7A 4IUUA 2GDSA 4O1NA 4LF7O 3NSWA 3BJUA 1J6QA 4CS2A 2DQ3A 4XKWA 1PTOH 2DOSA 4XDJA 4BWGB 5KLVH 3MA2B 1EFUA 4BS9A 2IX0A 1JORA 1EQQA 1B44D 1SRYA 3GTMH 2ZDIA 1SAPA 2XN9C 1B3QA 1YIJB 2B5OA 3QFRA 1YHBA 3RD4A 4CJ0B 2NVQB 4DRXA 4X62Q 1ET9A 1BKBA 3CCUB 2YTYA 1EY0A 2OBSA 4ALPA 3U6KA 3PUNA 3SGIA 1AVMA 3HFZB 2IY5B 4K1XA 3M99B 1H2KA 2AW9A 4GKJB 2F0IA 3SYOA 3Q22A 3J81E 1LUWA 4JI7Q 1N34Q 1W87A 2EJFC 3J81N 1Q3EA 4RDLA 3EROA 3OMCA 2J4XA 4OIKA 5M5XH 4X62L 4CBCA 2DY1A 3FAVA 4Y7NB 4M1UB 3ZC3A 1KRTA 4NB5A 4JF3A 4XQJA 1R3IC 1IXRA 2VS0A 1AEXA 2D3NA 5C0XI 2VS1A 1QGAA 1AJNA 2CK3G 1US6A 1K4DC 3CMAA 5ELNA 3NK9A 4JI7L 3AVVA 1N34L
chains in the Genus database with same CATH topology
1G8ZD 2CAZC 3OWFA 1HRJA 3CKIB 1BCPD 2BTOA 5EYPA 3TP6A 1UD8A 4XKVA 4I50B 3SK8A 4NMZA 3OFNA 1EY6A 2Q7GA 3MFYA 4CC6A 4ID6A 4NVPA 1HTPA 3D4RA 1COWA 4NDXA 4LFAB 2LMCB 4YY3B 1CK1A 4IFDH 2XNAC 4TSFA 4FFBB 5EIBC 4RCNA 3BYTB 1PZJD 3JATB 1I50B 3UQ8A 4LNUB 1EFRA 5CB4B 2KQ3A 4FXKC 1IYUA 1M93A 3SK6A 2K28A 2K01A 2EVBA 3VR2A 5JJZA 4X1IB 1H9SA 1Q1EA 5BN4A 2Q0AA 1PFMA 4HMIA 1JOQA 4C2MB 1GUWA 2FINB 1BO0A 3OHXC 5JOBA 1S5DD 5K1XA 4MIUA 1XHZA 4ZLTF 2ZXRA 1WVLA 2EYOA 1DGSA 1MI2A 4RKLA 5EBDA 1BMFA 4CJ1B 3PIP3 3CU7A 4X65B 3WQZA 4UZUA 4I50A 1NR2A 4DUZB 4IUTA 4ZUIA 2XOKA 1QB5D 3P7JA 4K8IA 5J2TB 5E1FA 4KHZA 2XWJB 4CKCA 1SNOA 1GJXA 2QF7A 4Z1MA 2QJ1A 2XRSD 2WKDA 4RGTA 2PY5A 2F0VA 4JYAB 2VJJA 2ENBA 3A7LA 1ML0D 1QOHA 3ETQA 3OOCA 4FFBA 1EU3A 2L11A 1SYFA 4LFCB 3TSSA 3BC9A 4RKBA 3F2UA 2EX3A 5FO7B 3JATA 4XOPA 1BCPF 1FX0A 4EQOA 1CQFA 4DAYA 2L12A 1SYBA 3D4WA 1JR0D 2BDNA 1GUOA 3CP8A 1PTOC 3TZUA 3KLSX 1HNXB 1H9MA 1H8EA 3E0JA 2QDBA 1SE2A 3SK5A 4DGZA 4X1IA 1DM0B 2BTQA 5CORA 5KYLA 5C3WA 2O4XA 2JA8B 1X4TA 1KLUD 2PTMA 2UUAB 4OO1H 2QM4A 4KN7C 4YXWA 2LS01 3JAKB 5M3FB 2PPBC 4JI5B 4BW9A 3ZPNA 2XZPA 4A3KB 3NQTA 4QCLA 1KU9A 4WJWA 4K8ZA 3BRCA 3RFRA 2UXCB 1E43A 3A54A 4K2LA 2F1MA 1RF2D 1IW7D 3MWYW 4L63B 1BXTA 4KY6A 3MXUA 1K83B 4EQPA 1E3XA 4C3IG 3S1RB 3KF8A 2RQXA 4F88A 1FFXB 5FPRA 5ELCA 4DV2B 4DR5B 2PW5A 1HQMC 4C56C 3WOEA 2X69A 1EY5A 3BDOA 3GV3A 4R8NA 1FYCA 3JALB 3A3GA 4UCOA 3CQZB 3SK4A 1STBA 4O4IB 1XQ8A 1RHPA 4DV1B 4K5VA 1IYVA 2F0NA 1TWCB 2F0KA 1G6UA 1PXUA 2E76C 1S5FD 3VYSA 4X66B 4LF5B 2JXMB 4RGNA 2BE5C 5EPLA 4NKLA 4CBVA 3DEOA 2WJVA 2B2UC 2ZXHA 3BA9A 3JAWA 2DY8A 3JAKA 4KD3A 2EPBA 5C4HA 4CH3A 4TQFA 2R92B 1PFBA 4AQYB 1RCVD 4RWSC 3HOVB 5I9PA 2WJYA 4C3IB 2XVSA 1STNA 3Q0AA 5M5YB 5EBCA 1N36B 4A93B 4JV5B 1K8MA 1PRTB 1KZLA 5F2DA 4JI2B 1AN8A 2A74C 1QWYA 3E22B 2EXZA 4XT3B 4O42A 4LH7A 3OSOA 1SE3A 1U9RA 3D4DA 2AQ1B 1FFXA 3PUWA 2M5SA 1JOOA 4GQNA 1QE6A 3GVKA 3PV0A 4IHJB 1Y8OB 4KHPB 2JSOA 3QJYA 1E79A 5IGEA 5LL6S 3JALA 4II3A 4O4IA 5LP6C 3J81L 5CV6A 2XNDA 3TMEA 2VWJA 1DOLA 3K59A 5M9OA 1H9KA 4A3DB 4LR3A 3I3CA 1ILPA 1LTSD 1OHHA 3HOWB 4U3JB 1UD3A 1NCVA 1HFNA 4A3BB 1CTMA 4O4JB 3FVQA 3OAAA 1B4OA 3NTHA 1II3A 1LABA 1EIGA 5K1PA 4RCOA 1I4HA 5FPOA 3QOLA 2PGGA 5EKKA 5TSSA 1T5XD 2F0PA 4GYCB 3PMFA 3NTIA 1V0FA 2HUGA 2ZXIA 3OIQA 4XT1B 3QG1A 2WACA 4XLAA 1Q43A 2BDOA 2K5DA 1YNJC 3E22A 1Q90A 3PO2B 1LT5D 1I4PA 4QB4A 4XYQA 1MSGA 5KRUA 3DXJC 4IHJA 4HAEA 2RJZA 5IJ0B 5KHIA 4HMJA 3DMUA 4CS3A 3BVGA 4C3HG 3CB2A 2KECA 5FOBB 1TIID 3JAME 5JJNB 1TWGB 2F43A 4FXGC 2WZPP 3T1YB 5KHKA 1S4ZA 1G6ZA 5JPNC 4RH6A 4ZRZA 1HCZA 4U3JA 3KBXA 1SNMA 1G91A 3B2EE 3I4MB 4O4JA 4JI1B 5I9OA 4IUVA 3S14B 3CHXA 1VF7A 4PMWA 2IT1A 2WIIB 3UT5A 3I4NB 4FVMA 1SJHD 2EYJA 4G7OC 2DY7A 2B2VA 3MAQA 1RTOA 1BF4A 1I4XA 3LX0A 5CV5A 3W3AA 1STYA 2ZZEA 4ZKCB 1EEID 4ZYSA 3LWUA 1H2SB 4U673 3RGBA 4KI0A 1D5AA 4IIJB 4TRDA 2ZZFA 1A3VA 3S1NB 2F0HA 4DV0B 3HRZC 4BY1B 1QQCA 3BABA 3NQIA 4DR3B 1AZQA 5IJ0A 1FNVA 2NBFA 3P20A 1I94B 2QKIC 4NP5A 2ICEC 2P5OA 4DAPA 2P22C 1O7YA 4PMCA 1PZID 3FKIB 1JQYD 3AB9A 5CV8A 1XX8A 5M3MB 3URYA 4XORA 2AWNA 5LA6B 4FM1A 2NWGA 4G6IA 2IJ0A 5JEAH 1KTKA 1S5ED 3NTKA 3JARB 3O13A 1WTPA 3OW7A 1EIHA 3TBIB 3TN2A 2UUBB 1A2UA 1HUMA 1OXUA 2RBMA 2ZNIA 4V190 1AZPA 1X3PA 4J6HA 5EQ0A 4E0FA 5I2YA 5EPJA 4A3MB 4ILWA 4KY5A 4C3JB 2R3ZA 1EY9A 4CKEA 4ZUJA 1XNRB 4DR1B 1CQVA 1BUVT 1ESRA 3DWPA 4O2BB 3EFXD 1Z6HA 1O78A 1IKLA 3HGBA 3HKBB 4UCVA 2LY7A 4TOIA 4IUNA 4P2CB 2G9HD 1JE4A 5EKLA 3SJBC 2KOLA 5GONB 2RSOA 5FK9C 4DV6B 5LA6A 2HDLA 3C46A 2VQFB 3NP8A 4DXGA 1SDFA 1TWHB 1HUNA 1GUNA 1W0JA 5HURA 4O4HB 2DIEA 2EYLA 3JARA 3HKEB 3KUPA 2PUSA 4RHSA 1D2BA 5EJWA 5NUCA 2X8KA 2A69D 5JCOA 3I8ZA 2GJRA 1Y1VB 2CW0C 3GP7A 1WCMB 3ZYYX 1WTRA 1DOMA 4EEQA 4XNFA 2I46A 2NVXB 4IURA 1VMCA 2BA1A 2E75C 4TSSA 4YJ2B 2OT2A 3DEPA 5KYIA 4XDXA 2K7VA 1OXSC 2Z6BD 5JVH3 1PZKD 4BBRB 2JP1A 1N33B 1W0KA 1IHZA 3JSLA 1C8CA 1DYQA 5CA1B 4QIWB 5T1IA 4ULLA 3SHLA 1I6VC 4O2BA 3ONAB 3FEWX 2KA7A 1UUPA 3K5LA 3HKBA 1ZXTA 2YI9A 5K36H 4TV9B 2N88A 4IFDG 3RUZA 3VR3A 3HG9A 1WPBA 4XQNA 4HSPA 1STAA 5GONA 3M85A 1WTOA 3WB2A 2EE1A 4DXFA 2F0WA 3J7YW 3RYFB 4G7WA 2EDGA 5FL7A 4G57A 2Q8IB 3J7AF 4TKOB 3ITPA 1EEFD 5CBAE 4O4HA 3MC0B 3HKEA 3N52A 3PUXA 2DNEA 2F0EA 4ODGA 2PW7A 5LYJB 2B2VC 2IW3A 3DDYA 2MUYA 5IIFA 1A3UA 1HXYD 3A8IE 2EYPA 5FNVB 1N34B 1V43A 1TVKB 2OWOA 5CA0B 2L0CA 3BDCA 2KCNA 2WP8J 1PMRA 4YJ2A 4WBNB 1KDAA 3VYTA 1BQQT 1KMIZ 4TUYB 1GXDC 5ELDA 4AILC 1NAPA 1ENFA 1F2MA 2F0QA 1Z5VA 4ZOLB 5C4JB 1TY0A 3ICXA 4X3UA 5ISRA 2F0MA 5CA1A 2JA5B 3AMUA 1JFFB 4LAAA 2JYOA 2ZT9C 4FF2A 5KMGB 2K5WA 2CW0D 5J39A 4A3FB 3EA6A 4K6LA 4TV9A 1EFID 3K7AB 3OMGA 1HA5A 1Y8NB 2PYJA 1ICWA 2ZNJA 5EZYB 5LMNB 2NTSA 1B50A 4KJNA 3RYFA 4KKSA 5IT9E 5E4WC 2G9DA 3RZDB 2EOTA 1KNEA 3T13A 2VXWA 2M9VA 3I73A 3SVMA 3G6JB 1QG7A 1JICA 3ZEDA 1AW7A 5LYJA 1W6KA 2YIAA 2YIBD 3G7LA 1WPCA 1HHVA 2K1BA 1SA0B 3JAML 3CMMA 4CHTB 1TVKA 3FPUB 5C5LA 5C0XH 4OO1G 3M7GA 2VWKA 4DUYB 1CM9A 3IFDA 4WBNA 1MABA 2L5TA 1KMHA 4ZKBB 4TUYA 1OO9B 4B3TB 3S15B 2R61A 3BVZA 1LTBD 1QJOA 2XRQD 5FLXE 1Q1BA 2NN6H 4ZOLA 4RA8A 4X64B 1ENAA 2A6ED 2WB1B 1JFFA 4CC5A 1UNSA 4I55B 4HEDA 4XMYA 1B2TA 2LKVA 1HNZB 5KHHA 1SKYB 1YNNC 4JI6B 5KMGA 1SNPA 2CK3A 3HKZB 3C1EA 2QILA 1CT1D 1SYEA 3WOFA 2A68C 2AUKA 4DAVA 3MXGA 4L6TB 2YXLA 4LNUA 3VQYA 1TQOA 5CB4A 5EZYA 4IALA 2EJMA 3CP2A 4LH6A 3OPOA 1A15A 2F0OA 2FMMA 5C5MA 3W2DA 3ND9A 4ZQ3A 4IQZA 1R9TB 1TT2A 2PNRC 4BA1I 3T56B 5DAUA 1LT3D 2K04A 3K58A 1TAEA 2Q8RE 5JCOC 1M8AA 1EZ6A 2FMCA 1SE4A 2L9HA 1GHKA 4O2AB 4CS4A 5EIBD 4DU9A 1BNZA 2F66C 1TUBB 5IGFA 4F6RB 3D8GA 5KNBA 1V1OA 3WB0A 1JWUD 3FFQA 1SYDA 5K5PA 3HOUB 1E1QA 3ND8A 1XMOB 1UD2A 2EY2A 2KEDA 5J2TA 2KUMA 1TS5A 5LMUB 4I55A 4DV7B 3CHBD 4DNTB 1JCKB 1TGOA 1LTRD 3S2HB 3M4YA 4DN4M 1ESFA 1RDPD 2PYKA 2ZM6B 4K8XA 1B53A 4QMGA 4MN3A 2OYQA 1WN7A 2F3VA 3X3NA 1L8DA 1IBMB