1T5EA

The structure of mexa
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
231
structure length
231
Chain Sequence
b'TELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQSAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSPISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERAGDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug resistance protein mexA
molecule tags Transport protein
source organism Pseudomonas aeruginosa
publication title Structure of the periplasmic component of a bacterial drug efflux pump
pubmed doi rcsb
total genus 61
structure length 231
sequence length 231
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1t5eA03
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1t5eA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1t5eA02
5JJNB 3N6RA 1GUSA 3VR2A 3VR6A 3ND9A 3FPPA 1E2ZA 2D2CC 3MXUA 4RCNA 2A69C 1OXSC 3QG1A 3T51B 1IW7C 4DK1A 4KMUC 3M85A 1E2WA 1H9MA 1EWHA 1H9JA 5BN3A 2F95B 5KNDA 4G7OC 1E2VA 1B9MA 4OO1G 4GZYC 1K8MA 1Y8PB 2DN8A 3H94A 2QF7A 3BDOA 5KNCA 1GHJA 4XTCS 1OXXK 1YNJC 2BA0A 3NE5B 3WB1A 4TKOB 3IFTA 2E75C 1Y69U 2F93B 1PMRA 4KKTA 2YYZA 1LACA 4DK0A 1RSOA 5JJEB 3L7ZC 3VR5A 1K8OA 3PUYA 1ONLA 3SE0A 2JEBI 2DNEA 1Q1BA 3OW7A 4KKSA 3A8IE 1BDOA 3BG3A 1GUGA 1Q12A 2A6HD 3RLFA 4BA1I 2AUKA 3KLRA 3T56B 2ZT9C 1Q1EA 4H0LC 4PV1C 2EJMA 2K33A 4IFDG 1CFMA 4JBWA 1HQMC 3P20A 3PV0A 1DXMA 3I72A 1ZKOA 4DNTB 3M4YA 1Q90A 1IYUA 4HR7B 4G7ZC 1V8QA 1G291 2E74C 1VF5C 3MFYA 4G7HC 1A6XA 3PUWA 2D62A 2IT1A 1FR3A 2JE6I 3WB0A 1GUTA 2PCFB 2Q8IB 3VR3A 3LNNA 3PUVA 4KKUA 3OOCA 4OO1H 2A69D 1FYCA 3A7AB 1Y8OB 2NN6I 2K32A 3IKJA 4H13C 5KNBA 5C0XH 1DCZA 4H44C 1SMYC 3BRCA 2L5TA 3HGBA 3D31A 2A6EC 5D5QA 4KHZA 4XIGS 2O5IC 2BE5D 4IQZA 5C0XG 5JEAH 1ZYRC 3WB2A 1OXUA 1V43A 2JXMB 3PUXA 5A35A 2K7VA 1GJXA 3VA7A 1TKWB 1O7LA 3LWUA 1HCZA 4I7ZC 4IFDH 3GD7A 5BN5A 2EJFC 2O5JC 2LMCB 2BA1A 1TU2B 3I73A 4LJZC 3ND8A 4KI0A 4KN7C 1CTMA 3VR4A 5BN4A 1I6VC 1CI3M 3GQBA 1GUNA 1VCIA 1Z7TA 2PNRC 2BDOA 2JEAI 2EVBA 3W3AA 3A7LA 1HPCA 3AB9A 2E76C 2A6HC 2KA7A 2NN6H 3SDZA 1OXTA 3A8KE 5JJJB 3QJYA 4TQUS 3CRLC 1T5EA 1Z6HA 4GYCB 4L8JA 3A8JE 3EQLC 2CW0C 3M7NA 1IYVA 1GHKA 1B9NA 4BA2I 2A68C 3DXJC 1H9RA 2EDGA 1LABA 2DNCA 1DD2A 3I4LA 1H9SA 1OXVA 1Y8NB 4DNRB 2D5DA 3QIAA 2A68D 1GUOA 4JK1C 4OGQC 2NN6G 2V4DA 1YNNC 1H9KA 2KCCA 1O78A 3OPOA 1HTPA 3T53B 3D4RA 3TZUA 2AUJD 1IW7D 2R6GA 1H2SB 2AWOA 3CRKC 2PPBC 1VF7A 4LK1C 1QJOA 5K36H 1H9SB 3WDNA 5K36G 2F1MA 2BE5C 4KN4C 3U9SA 2A6ED 3FMCA 5JEAG 1VDZA 3PUZA 2B8FA 2B8GA 5D5PA 2EJGC
chains in the Genus database with same CATH superfamily
5FIUA 5IYBH 4DUYB 3MXGA 4DV4Q 4NTYA 5M5XH 4JBKA 4TMZA 4ZCKA 1EZVH 3OFNA 1H9MA 4A3MB 2B9ZA 2E2HB 2X6CA 3SJQC 1R3IC 4X7FA 3ABKC 2RA4A 1VIBA 4KHVA 5GQOA 4BY1B 4RO2A 3AQQA 3BEHA 2OQKA 3HS0C 4DR1L 3UO2A 4TKOB 1ZEQX 4Z1VA 1K8GA 3QFRA 3CCVV 1PMRA 4J15A 1I5YA 4BWGB 4C3JG 3S17B 1AI6A 4O1NA 1BX1A 4HIMA 3ETGA 3RYFA 1IL8A 1YHBA 4K8XA 1DZ1A 5JH7A 1ONLA 4ZRZA 3F2CA 3CRRA 2K5DA 3NPPA 4UUJC 2R72A 4X66Q 2B39A 3M9BA 4PDLA 3DXRB 4KKSA 1K3EA 1YJ9A 4QIWE 3GTGB 3E22B 1JX9A 3OGIB 3QG5A 1Q7YD 1X3EA 4JI5L 3W2FA 3KLRA 4C3HG 3G4SA 1MZEA 3AK2A 1PP9H 1GR1A 2K33A 3RR5A 3T16A 1VQHA 1RTNA 3J80c 3KJPA 1Q6IA 4MVRA 2F3IA 3RYIB 2VYQA 1S4ZA 3CTAA 4FLYA 2PNHA 1KK2A 2PO4A 2UXCB 4B3RL 1KZLA 3H15A 5KEEA 3A7AB 4H13C 3ICXA 3HOYH 5H2FZ 2A1AA 2ZR3A 4NVPA 2Y4TA 1MA1A 5IGGA 3OZWA 4DV1Q 1HZBA 3CCRV 1CZGA 3D6WA 4XIGS 4JI4L 2EILB 3K58A 3ABMC 1ZYRC 1TVKB 2F0EA 3ASRA 4RDKA 5A35A 2ZJQA 3FKSG 3GDEA 4UV8A 4DR1B 3CCUB 3DUZA 1WU8A 4JZ2A 2R92B 1JQ0A 4WZTA 1Q8IA 4UXNA 1O9GA 2Q69A 4DW1A 3VQVA 5IE9A 2CH7A 4H13B 5CDFA 1E1QA 1X32A 5IT9N 2W6JA 2J7ZA 5T1GA 1TR5A 1C7YA 1VQ8B 4X66L 2QE7G 2DW4A 4K1XA 1Y4MA 3RYCB 4HSPA 1JB9A 5CB4B 1V0FA 2W6IG 2B1GA 4CZZA 5A2QN 3CRZA 4O4IA 1ENAA 5H6QA 2QDLA 4H7BA 4QF4A 2EZVA 2ZJPA 1PH2A 3W2HA 4MTKA 3CE2A 1G6UA 1ENFA 4Y7NH 3UE1A 1NH2B 1TVXA 1HZ9A 3OEHG 4CGYB 4JW0A 2Q68A 2IJ0A 4A3LG 4FN5A 5JEAJ 4BIOA 3RZOH 4RM0A 3MWYW 4M0LA 2JIZA 2VQEB 2I5HA 1NY4A 3MEFA 2K9PA 4R6ZA 1OGIA 4Q7JB 1PTOB 2A68C 4JI6L 5JCOC 3DSQA 1H9RA 1QILA 1KAWA 3U2QA 5LHIA 3MCAA 1NS1A 4TRDA 3ZN1A 3JAMN 2Q0OC 5JVDA 3OWFA 1UD3A 3I56V 2V7WA 4DR2L 3PO2H 4JI5Q 2NVYB 5M3MB 4O4LB 5I6WA 1VQNA 2JJ2A 2VUMG 4A3GH 4DR7Q 4A3BH 3D4RA 1NE3A 4OWWB 1U4LA 1AP0A 3TZUA 5B6IA 1SEBD 5IP7G 3OR7C 4X89A 4PV1B 3W1GA 2R9IA 1GXDC 2GK7A 3MAQA 1K73W 5A89A 4TQDA 5M9OA 1B3AA 1KKDA 2F4VO 5F4MA 1QVGA 5FPOA 4TMXA 1M56B 1EYAA 3W2IA 2GA4B 5IGCA 3S2DB 3W7WA 3KL9A 2D3NA 3KFUA 2DOGA 4FJCC 5D5PA 1FFXA 1XNRO 1VARA 2EJGC 1X3GA 3PMFA 5KYIA 3ND9A 1E2ZA 2XAFA 1QFZA 1SLJA 1WOCA 4LMQD 2QWOB 2ENBA 2Y0SB 1QG7A 4DK1A 4UHVA 3P32A 4OWXB 5GAGC 1H9JA 2CHBD 1WB8A 2WPDG 2ZZQA 3JD0A 2A79B 2CAZC 1Q82W 3JU4A 4WZEA 3M7MX 1A3TA 4PDMA 3DEOA 1BLIA 4II2A 1I5FA 3MHHC 1STHA 1AR1B 4DR7L 2YWEA 5LA6B 4JI6Q 1GHJA 1RQPA 2JN9A 4GKJO 1V55B 1FGUA 3QR8A 2PZTA 2L12A 3HOWG 3LSSA 3I7FA 1YIJA 3F5TA 3OT7A 3DM1A 2L35A 1W9XA 1Q43A 3HOZH 1DARA 1SN8A 4G4KA 1MABG 2E2JH 2ZE8A 2R93B 3GTMH 4TWKA 1X6OA 2BOSA 4JV5Q 2X6YA 1EEID 1KKCA 2BV3A 3CCVA 3BCCH 1S0UA 1XB2A 1CM9A 1U97A 3G6EA 3BABA 5EBLC 4P22A 4YAFA 3OW2U 1HJPA 1Q3LA 4P71A 2M7WA 2HLDA 5IYNA 3J81i 1F9RA 4HR7B 4J6HA 1XNRQ 1B3QA 1GN6A 2DY1A 2OTJA 1I94Q 2F0IA 1IBKL 4LF5L 1EIGA 1MJEA 1N32Q 1VQOB 1THZA 3E8BA 2GJRA 1EP3B 1VQ4B 1P8LA 3DTUB 2E2HH 1ZTEA 3OWEB 3E20A 2Q8IB 3PUVA 1PRTC 1UJWB 2DGYA 2UUBO 1Y8OB 1EP2B 3ZRWB 2MP1A 1OGJA 2P7TC 1DCZA 4DRXA 2CQAA 2IH3C 3KLSX 4M53A 1PZKD 1RKNA 3PN1A 4KLKA 4UP9A 2NZOA 4JG2A 3EFXD 1EY7A 1SQBH 3S17H 3J81L 3RMHA 3PF5A 2WYRA 4R4OA 2K5WA 4CHTB 1HRJA 2Q6KA 3AG4B 1EWIA 4FLTA 3RYHA 1OCCB 1SE3A 2E5LO 1PFNA 3E2EA 1IBLB 1JFFB 1IURA 4X8IA 1HCZA 1PHJA 1CKOA 3BFRA 2VZAA 1VQ6A 2X53S 4C56C 1SJED 2CH4W 3GTGH 4UCTA 2OTLB 1KIXA 3F2UA 3CCJA 3SJPA 2I46A 4C43A 2F43G 2VQFQ 1CI3M 2K04A 3PIOA 1BMFG 2UUCB 5F4JA 1NTKH 1NR1A 4NKGB 3G6EV 4IUTA 4X8AA 1SBBB 4FLXA 3SLDA 1IHMA 4NXNB 1PZJD 3KCXA 2ZM6O 3BCDA 4CDCC 5J39A 3AVTA 5H5NA 3SDZA 1R4QB 2PYJA 1KYOF 2GBOA 5KUMA 1S5HC 3ASQA 3UKMA 2UXCO 2B2UC 4L8JA 1N32L 2QWNB 3EQLC 3WNCA 1OB5A 1I0HA 1ZL8A 3LO8A 2ID0A 3NTIA 3HOYB 1VLYA 2HT1A 3PO2B 3ZPNA 1RL2A 5IGEA 5GAHC 5JAVA 4DR1Q 4U3JA 3HKEB 3ZBUA 1H9SA 5CBEE 3ZYYX 5BR8L 1BSMA 4MNOA 4GNXB 4B44A 1R1BA 4WBNB 2ETNA 3SK4A 2SNSA 2FJ2A 1H85A 2H94A 5IOCA 3TBIB 1G91A 2R92H 5EBMC 4KP4A 2DQ0A 2FX3A 1QUQA 2PMZE 4FK8A 2EBOA 1S5FD 2OBRA 3IJ4A 1PV0A 4R8CA 3VQXA 4X64B 5JWPA 1QLNA 1VQ6B 1K4CC 4K5WA 4LAAA 2G38A 4RGMA 4UAIA 5E3FA 2QDOA 1IBML 4M2LA 1Y1VG 2C9OA 5GTHZ 3ABTA 1MABA 4J0QA 2EY5A 1R5OA 3G48A 3L0OA 4Y7NB 3FMCA 1EFRG 4K8ZA 2VQFL 4I55A 1QZHA 1AIPA 4B3ML 1SQFA 2ICIA 4K14A 2N78A 1SNOA 3VR6A 1ICWA 3ERSX 3N6RA 4N9PA 4X65Q 4PA7A 4UP8A 1K5QA 1VHOA 1OXSC 3K6OA 4O4JB 4IPCA 4NMZA 1KD1C 4V190 3TS0A 5IYBO 3BH4A 5BN3A 3CC4A 1XILA 2WAQE 3ZRWA 2B63G 1I6HB 2DE0X 4EFEA 4NXNL 5LHGA 1N33B 4P74A 4Q5VA 3G71B 3S2HB 3P3NA 2X6AA 5C4XG 4JI8L 2WSSG 4UZEA 2BOCC 4YJ3A 3W7XA 2WPDA 1YNJC 2LY7A 3I3CA 4B3MO 3KK7A 3BVGA 4JTAB 1KP3A 1DDIA 1VQMB 1UMKA 2MGSA 3L2PA 2XAHA 4GX1A 3T1YB 1PRTF 4KKTA 3M4OH 2FVGA 1O7IA 4ALPA 2JA9A 3OE7A 4YCVA 4UP7A 1AZQA 1K8OA 2WR8A 2HCIA 4XLCA 3D3IA 4BA1I 4IOAA 2JSOA 2RDHA 2P90A 1KNEA 3RFRA 3I55A 3GTOB 4X65B 2K28A 5GONB 4ZBMA 2Q4PA 4ICGA 3VA5A 2H4OA 1HNZQ 2X85A 3S2DH 1B04A 2OWOA 3X3NA 1VQLB 5D14A 3C1FA 1PH1A 3R65A 2VJIA 3P75A 1F4MA 1IDSA 5B1OA 3AG1B 1XHZA 4QHYA 3CRQA 1TGOA 3ERQA 4YXWG 5DNFA 2KOLA 2PCFB 2VXWA 2H8PC 1B4OA 4IFDJ 1FGBD 1SFOB 3AG3C 5DLQE 1EFUA 3AG7A 4QIWF 3ZN0A 1NMGA 4A3DG 1VMGA 4PDVA 1E3ZA 4RD4A 3VNVA 1G51A 5KAFZ 2ZJRA 5L3EA 1QR8A 4A76A 4JI0L 4DR2Q 1Y74B 1U4RA 1GVPA 1CPYA 3CCRA 2OT2A 4J8QA 2O5IC 5DECA 4OWTB 2Q6OA 1XMQQ 4CJ0B 2YC0A 4R4QA 3K0XA 1X59A 1PNKA 1BHAA 3A55A 4LW1A 2IJIA 3CC2A 4DR5Q 4R8NA 1WDTA 2R93H 4ZGQB 3V96A 3GTMB 2V7QG 4F7DA 2C78A 1NAPA 2PMZB 1CQFA 3E0EA 3HZXA 3Q22A 4UPAA 3AG3B 3WNDA 4WJ4A 5JPNC 1K97A 4JI2B 4KN7C 4DAYA 1NB0A 3VR4A 2ZZEA 3Q4HB 1EU4A 3D4WA 3AG1C 4MVOA 2BGIA 2Z8LA 2JYOA 3NWSA 4L5RC 2QA4A 3IC7A 4G57A 2C2WA 4A3JB 2JK8A 4JI8Q 4GLXA 3C90A 5LMNW 1ENCA 5FO8B 2Q2IA 1GN2A 2QMUA 5JJJB 1BQZA 2HLDG 4CBCA 2GJKA 1DM0B 2PZWA 2WKCA 4TQUS 3J81N 3H91A 4HAEA 1YHQA 3G4SB 1RF2D 1QR9A 3PIO3 2ATKC 2JEUA 4MT8A 3CRCA 2QM8A 4FM1A 4PAAA 2KHJA 2YTYA 4DR5B 4A3MG 1Y1WG 2ES2A 2OTLA 3I4NB 1PVOA 3H1JH 1GM9A 3CPWU 1IBMB 1EXMA 2WJYA 3CCSB 4J80A 3ASPA 1VQCA 4UDUC 4B3TL 1WD1A 1YEWA 1JMKC 2A0LA 2W0FC 1COWA 4P3IA 2QWQB 2OYQA 3J7AU 4P6VF 3SKBA 3OPOA 4AIMA 2X0KA 1YVWA 2HJDA 4B3GA 4WRDA 2UXNA 1AI4A 1MJCA 2B1IA 1NR4A 3G6BA 1KD1D 1C48A 4QUCA 3JAML 3HOXH 1VQMA 3CRKC 1EQQA 2G9DA 4DQLA 2FMCA 4A75A 1GO2A 3W2DA 2CH7B 4YHHO 1N33L 5L3BA 5IK2A 2FXQA 3CP8A 2K5QA 3G7LA 3NQTA 5AG2A 5ELFA 5C5MA 4UV9A 3S1NB 4A3DB 4I7AA 2ZXOA 5LGUA 3E86A 1HW7A 2DEUA 4DV3Q 1QVFU 3FB8C 3ABLB 1BKBA 1LM0A 4A93H 2RVLA 2EIKB 3LDDA 4JI7B 1VQEA 5H59A 1A3VA 4FWTA 3MXUA 4QPKA 5C44H 4X7EA 2OCEA 1VF5B 3KZIZ 4O2AA 3JD1A 1IW7C 3RZDH 3QOLA 1EN4A 3K0DA 3D36A 5KW9A 4JI2Q 3I4NG 3ZZUA 4GZYC 5IT9L 3H94A 2EX3A 3T1YL 1B2TA 2ZM6Q 4XTCS 2L6LA 3JATB 2XUMA 2GSMB 4A3EH 2WWWA 3E9HA 3ZUGA 5M5YH 1O9HA 4J9ZB 3OTFA 4YHHB 2JDIG 1KK0A 1FNUA 1T5XD 3C3SA 2CWAA 4U7OA 1TS2A 3URYA 4P6YA 1IJEA 5M3MG 3RT3C 3KEWA 4EGVA 3ZMVA 2BSAA 2BSKB 4CJ1B 1WA8B 1NR2A 3CRAA 1WTOA 4YWLA 2XT9A 2QDBA 3CCEB 1XMOB 5A2QE 4DAYB 1J9ZA 4OX9Q 4FDBA 2E8GA 3RYCA 1G8ZD 2WAQB 3ZHQA 3FKIG 2OK7A 2YIBD 3T4ZA 2VQFB 3FDTA 2OCHA 1VQ8V 1SRYA 4OPOA 2CKZB 1PFMA 1NB9A 2ZXWC 5AFWA 1S72B 2F4VL 1VQ9V 3CCLB 4J41A 4G1VA 3B2EE 5ITZB 4DNTB 1MHWC 4APVA 4GT1A 1S5ED 1AE3A 2X0LA 1MMMA 3MHSC 4X3KA 3Q4HA 1G1XB 1EFRA 1JE5A 1BJKA 1EY6A 4LFAL 3CP1A 3LVBA 4I0XA 2D62A 2X69A 1JE4A 3OTOO 2FTKA 4B3SB 3OOCA 1LTSD 2B63H 4IUPA 2QWRB 4NTXA 2JJ1A 1MSGA 3FKIH 4XQNA 1JWMD 4R7CA 1WYDA 5EPKA 4FXKC 1E1QG 3GVMA 4Z2WA 2UXBO 2XNCA 2HD3A 5FLMH 4N23A 4OX9B 1OCRB 4A3IG 4FZ1A 3M4OB 1S0VA 2RQ6A 3WB2A 1LT5D 1TS5A 4LC0A 3S1MH 4HIOA 4NB5A 5JPMC 5A2QL 1F20A 4TV9A 4I7ZC 2NWGA 3CCQA 3H0GB 1PH3A 4LWCA 2O5JC 4NDXA 1E0BA 4DUYO 1ASZA 3BJUA 4DK3C 1LTLA 1VQPB 2YI8A 4LP8A 4DRXB 3GIRA 4QMGA 1JOYA 3AYHB 1Z9FA 1K3RA 1TWGH 4K6LA 4DV1B 4TUYA 2FHTA 3TN2A 3BVZA 5K1XA 3RN4A 4Y9RA 1U96A 1PA6A 3OMGA 4HMIA 2IX0A 3QO8A 1R9TH 2OTLV 4JYBA 4YY3L 4KFMA 4HJAA 2D9RA 1M57C 4XQQA 4A93G 4JI3Q 3QO5A 4IGGA 1Z6HA 3E0JA 3ER0A 3UDFA 1HNXB 2ZTGA 2NPFA 2CFMA 3JAWA 4F6EA 3G6EB 3I4MG 3QWNA 4BA2I 1H42A 4DR4Q 4LF8Q 3CD6A 2IX3A 3MD0A 1OZ0A 2VBUA 1SXTA 1WTRA 3J7AV 3G71V 5ISRA 2NVTH 4U7NA 1XNQQ 2NVQH 3ETDA 4A3FH 4XN3A 2Z0AA 1MZFA 4LC1A 1GH6A 4QNHB 2JA6B 3A54A 2F4VQ 2YV5A 1VQLV 3CMMA 3T53B 2OBSA 4WWVA 3ZHRA 2YTVA 3NTHA 1HNXO 3TDQA 4DV0L 4UB8Z 2B7BA 4ROXA 1CHQD 1K73C 2Q2TA 2BH8A 2X7RB 1L0XB 2Y0SE 5FK9C 4LK1C 1U2RA 5H9CA 1HNZL 2WAMA 1GTOA 2A06H 4MW8A 4LFBO 3SYPA 1CXZB 4O0AA 4TV8B 5C3EH 2EYPA 3B8MA 2X6XA 5IJ9B 3CMEA 5KNDA 3AFQA 3BCFA 1BOSA 2F3WA 3M3YB 2KSDA 3CPWB 2DCUA 4NPSA 4MVZA 1M56C 3I8ZA 3VR2A 1AJNA 3KF6B 5H1SE 4A3BG 2EY1A 2F0HA 2KVOA 1K28A 3K7UC 1EWHA 3MXNA 4ASUG 3OJXA 1CEZA 5JQGA 3NQIA 3SXHA 4EKWA 1NU1H 4AF7A 1Q5OA 2L15A 1QBZA 1OJHA 1WLEA 3S3XA 3SPGA 4HE5A 5FNVA 2WB1E 3K0GA 2PZSA 1QUQB 2XNAC 1DF4A 3WQZA 3A5ZB 1KTVA 1KMHA 1TQOA 1TY2A 2Q8TA 3ZRXA 5IWAQ 4RWSC 1XDCA 1CZWA 4A3EG 3KG2A 1ZUNB 5J35A 3CX5F 3W7TA 1L0NH 3X2QB 3I55V 3EIVA 1W2BA 3PJSK 2LZJA 3JD4A 4DR2B 2XTAA 3OM3B 3CD6B 2QKCA 2HDNB 4DXGA 3CRMA 1G8MA 4C3IG 3E35A 4DGZA 1JR9A 4JI6O 3WY9A 2EYJA 1TLLA 2MHVA 2PW7A 3CCJB 2FFKB 1N36Q 2NVXB 1WB7A 2D0PA 1UE1A 4JI3L 1PH7A 4JI7Q 1K34A 2BGJA 2QGQA 4BBSH 3MTSA 2Z6KA 4RGTA 1H2MA 4X1IB 5EKKA 3GTJH 3FFQA 1BUVT 1J8IA 1HXYD 1IXRA 4KHPO 2ZDIC 3G05A 4RD0A 4GOPA 1V8QA 2A5HA 5C44B 2Z6KC 1M90W 3ZJYC 2WKDA 4GNXA 3MFYA 4AQYQ 1PJ7A 1A6XA 1FXKC 2JEXA 2BSKA 1KXLA 3Q0AA 3E89A 1PL0A 3WB0A 3KDFB 3PF4A 1YXBA 2NN4A 1D5MC 1QH0A 1G4YB 2A69D 1FYCA 2K32A 3JAKA 4H33A 4X66B 4GKKO 2CW5A 2F0DA 5KHJA 5KYLA 4DR3B 2XOKA 1XWEA 5M5YB 3CCMA 1SMXA 4EQPA 5C4XB 2PI4A 4CS4A 5JJKA 4GX5A 1OXUA 2GDSA 2V7XA 1LUZA 2J0TD 1N34B 3N52A 3A0BZ 1ZXTA 3L72H 4JI4B 1RP3B 4RPDA 2DY8A 3J81j 4RDJA 1KDCA 2BA1A 3FX7A 4XLAA 1XNRL 1E79G 3GTPH 1PNLA 3RN2A 3ZJZA 4X06A 4TMTA 4R4CA 1P4RA 1VCIA 5B66Z 5IJ9A 1HNXL 3P27A 1R3KC 2LXJA 2MJ8A 5L37A 3S24A 2JEAI 1IYVA 1EWCA 4HN7A 3K80C 2V31A 1C9OA 1II3A 4JYAQ 1P84F 3OMIB 3SR1A 4ZCIA 4KL1A 3H9NA 2RHQB 2SNMA 4YIOA 2QGNA 2WLMA 1H8EA 3A1PA 1E24A 1JJCB 2YWHA 2R7DA 4DXWA 2QEXB 2MQHA 3RLOA 4TSFG 1I50H 3T1YQ 3SPIA 4LFAB 2VBSA 3PUNA 3DXJC 5FO1A 3FKIB 3EROA 4DNIA 4JASA 2KB1A 4JI1O 3MMPA 1LLRD 3P26A 3STBC 4GOPB 4XR6A 4O2BB 4BWAA 5ELCA 4F7XA 3S1MB 3CHXA 3PENA 3CC7V 1X54A 1SQQH 2LP7A 3T1YO 1CNFA 1R5NA 2DJVA 1OCOB 3Q6RA 4YHBA 2GREA 1VQBA 5FPRA 1G6ZA 4DV1O 1JMCA 3VQWA 5KHHA 3I4MB 3H0GH 1B70B 2OF1A 4EEQA 5L3CA 1EWYA 1M4UA 1F2MA 1Q7YW 5M5WH 3BDCA 3S1QH 4H0LB 4AYBE 4BBSB 4UY8C 1EL0A 1V9PA 4DR4B 4OPHA 5IWAB 3TQYA 3U0ZA 4MTOA 2ZTNA 4QVAA 4A3CG 3J80N 4Z9CB 3STZC 5C8YB 1IL2A 1MRZA 1YNND 4HMJA 4L6TB 1R9TB 4IHJA 3C2PA 4BY7H 4DV1L 3CCRB 4JZGA 2UUAO 2K5HA 1N8RC 3EVKA 2BTQB 1IX9A 2EIMB 1KQSA 5FKAC 2OIEA 2KENA 1PYBA 4QGUA 4Z4SA 3J7ZC 1MSWD 2EYMA 5EC2C 4LFBL 1HR0B 2J4XA 1F4NA 2RDFA 1CK1A 1N34L 2ADQB 4DKAC 3SEJA 4A3CH 1OXXK 4A3FB 2A8VA 4P75A 2L9HA 5BSYA 4FVMA 5LL6Y 3CMEB 3ZBTA 5L3GA 1S4MA 2GUZB 1B44D 2GVAA 4ME3A 4MVQA 3FKSA 3CQZH 4QCLA 3PUYA 3SJZA 3C1EA 1WTWA 4IIJA 1XPOA 3HKEA 1US6A 2P22C 4CKEA 1WTXA 3TEHB 1GUGA 2CDYA 2OCCC 3HKDA 2MK3A 2WZPP 1VQ5V 3RLFA 2Q67A 3OW2B 3S14H 4LF4Q 3VO2A 2IY5B 5IJ0A 5E6TA 4H0LC 4BBRG 5DM63 1Z47A 4RFBA 3M3YH 4LF8B 1BO0A 3M4YA 3ZHVA 1Y1VH 5J3BA 5CA0A 3S16B 3ONAB 5KRUA 2ZXHA 1G291 4H9GA 3BYYB 3NWTA 4X62B 1ZM4A 4GNXC 1YITB 1G6PA 4JI3B 1FR3A 2L1BA 4C1NI 4JVZA 1V1PB 5C4ZA 4WFN3 5EIBC 3OAAA 1VHEA 3SDLA 1WAZA 4KXRA 1KRHA 3AK1A 3UO3A 3ZMUA 1SNCA 2X6LA 3KF8A 5CMUA 2HCJB 4HTHA 2HHHL 4K0KL 2R70A 3CCLV 4XDXA 3EVQA 1PH4A 4PABA 5HXBA 3T2MA 4ZLTF 1ESFA 3AU7A 2JA8G 1XL4A 1GVHA 1SMYD 1KC8D 3RVYA 1I5XA 4FNFA 1I7FA 3U6BA 1AEXA 3JQQA 2KG7A 5EJWA 1BQQT 1J6QA 1Y76B 3B78A 2LFNA 2C77A 4B4DA 1HA5A 5CV5A 1YHAA 4EB6A 4QPJA 1CTMA 4KUMA 2UXXA 4JI3O 1WP6A 3WBKA 1MSHA 1PH9A 3HKCB 2RCFA 4L5SA 1K9MW 1P7GA 4CH3A 4LFBQ 1YTFB 5LOVB 3LWEA 4DV4L 1OTCA 1YJWB 4PI2A 4RDLA 2NTSA 4DV3B 3CD6V 2CQOA 1CT1D 2Y48A 2VNHA 3A8KE 3I55B 2C35B 3D6CA 1T5EA 1JOKA 4KD4A 4UCRA 3RN5A 5CV7A 4ZHQA 2ICEC 1GM7A 4X3TA 5KA6A 4Z4RA 3UDXA 3HG9A 4DV0B 3CS5A 1LABA 1X9NA 1JCHA 1L0LH 1Q81W 5FL7A 1U5KA 1TWFB 1XPUA 1PKXA 1B7YB 2B2TA 5COYA 1XE1A 5ELDA 4QUFA 3GVKA 1PDQA 3SPHA 4TMWA 2AGAA 1HR0Q 2FMMA 1SERA 2B29A 2JA7G 2XOKG 3AK3A 3EXAA 3Q6QA 1SYEA 2GPJA 3GV6A 4Z4UA 4ZYSA 1V54B 1NUCA 5M3FB 1E63A 1JNYA 2QKAA 3BY1A 1IW7D 2B2VA 3UCSC 2KKWA 4P2ZA 2BCCH 2VY3A 2ZBVA 3KJOA 1KABA 1WP8A 1QJOA 4HJ5A 2F0GA 4PA9A 3AVXA 1SS3A 4AILC 4F6RA 2R61A 5IODA 4KN4C 3U9SA 2QWPB 2ZL6A 1E79A 2A6ED 3DM3A 1VDZA 5BN4A 1IYJB 4WFGA 2KECA 4GN3B 4DV2L 2PGGA 1DK1A 4WZLA 1PFSA 5LMNQ 4II3A 4L5QA 3NXWA 1PJ5A 4YELA 4M1UB 1JA0A 4RHRA 1OHHA 2XASA 3JARB 5IGBA 3E1YE 4JBJA 3K5LA 1YJNA 4DV4B 3CWBH 1LTID 5BY1A 4OPSA 1OV9A 1NDHA 1TY0A 4GZRB 5CV6A 1VP7A 1FNBA 1VQ9A 2IBZH 1M5IA 1QLEC 3AEIA 1O7ZA 4YALA 3I70A 1TVKA 4PA3A 1Y69U 3SK5A 4HCSA 2X6BA 3GSIA 1Q81D 3OMNB 5J2UB 2N8NA 3J7AF 1LACA 4G7XA 4ODGA 1VQNB 1UAPA 1YJ9V 4E0FA 3FB6C 2D3LA 2GJPA 2ZR2A 1ZUQA 3R66A 3Q39A 4FK5C 3OKXA 3DWPA 3LX0A 5F2DA 3VR5A 5M5WB 5FLXL 2DYRB 3QTCA 4B3SL 4XDKA 4ACAA 1D7QA 1EOTA 3A8IE 1ET9A 4F8MA 4Y9UA 5IP9G 2JGUA 2CTRA 3BC9A 2JA5G 4FXDA 4O4LA 1VQKV 5CC4A 3JALB 2HHHB 1DOKA 4JMQA 1DTOA 1Y74A 4K0KB 2PUSA 1LO5D 2A3QA 2QILA 2RC6A 1PH8A 1EZJA 2Q0AA 3HB3B 3CCJV 3AGPA 3CP0A 3L9AX 1FAFA 2QE7A 2VBVA 3ZCCA 1FD7D 3J80i 4C3IB 4LFCL 3PUWA 2XGTA 4DK6C 4X65L 4OGQB 5B1BB 3HKBA 4K6DA 1N33O 5EZYB 1AROP 4JYAB 4MW3A 1WCMG 1D2EA 5I6YA 1PM9A 1D5NA 1RM1B 4UCSA 3S3WA 2WFWA 3NSWA 2VUMH 1I8DA 3T1HQ 1FPOA 2JK5C 2OK8A 3GVJA 1STGA 5IYZA 2BE5D 4CS2A 4R9WA 3BHPA 5IYBG 1AMOA 2RCNA 1IBMQ 3WXMA 2HEPA 3D0FA 4RUFA 2Y0SG 1M57B 4LFCO 1URFA 1B06A 1SQVH 4JTDB 2VBTA 1KDAA 2CGOA 3CQZB 5CR3A 1S3JA 1YITA 1FS0G 1YI2B 1S5CD 3A2FA 1RPRA 1WSRA 4N9TA 4IFDH 1N4CA 1HZEA 5BN5A 4M8AA 1CSPA 3L70H 3BQJA 4KY5A 2HHHO 3APQA 4MVUA 2OTJV 3NR7A 3S14B 3E5SA 2JJQA 3GWOA 1LTTD 4A3IH 3GTQH 1L0WA 3GQBA 1ICFB 1JJ2B 3VOUA 1EYDA 1NBWA 1ZX3A 3D36C 1TIID 3W3AA 4P9PA 1SKVA 4ME5A 2HG5C 4YIPA 4WCEV 1ENVA 2YUAA 1E64A 3ZRSA 2YDEA 2N05A 3I5DA 1KLGD 1NMFA 1PTOH 1SE4A 2EILC 4BY1G 1DG1G 5T1IA 2ZT9B 4JF3A 1OXTA 2ZXRA 1EP1B 2R9RB 3JARA 4R8IA 2WA4A 3J81E 4A3JG 5D3DA 4JGSA 1QU7A 1EIFA 1GKHA 3FRPB 3JAME 3VMFA 4DW0A 1EY0A 1Q6UA 1JA8A 1R73A 2NVYH 3EFFK 3VDYA 5EKLA 3HR0A 2M6YA 1JJ2U 1WOOA 4PC3A 5G3LD 4PD4F 3K06A 4F6RB 1GO3E 3PO3H 1H2KA 4J7ZA 1WOPA 2CH4A 3QIAA 2WSSA 2QA4B 3EBEA 4JK1C 2NN6G 2CC2A 4Y7CA 5LL6S 2TMPA 1O78A 1D5ZC 4MYTA 3VBBA 1HTPA 1TUBB 1VF6C 4FYDA 1XOUA 1JT8A 3OSOA 4XT3B 3H3VH 5HKKA 1EEFD 3JCUZ 5CN0A 1N0VC 1RPOA 4DR5L 4BY7G 1EQRA 4OONA 2ZXWB 2UU9L 3BZKA 1W35A 1H2LA 2N49A 1VQOA 5KNLA 1W2BB 1F2ZA 3G80A 5HGQA 1KMIZ 1MNGA 2C2AA 1WCMB 1P7BA 2WLIB 4PJ0Z 5DN6A 2GN5A 2HVKC 2NZHA 2V7VA 4EQ5A 2LW1A 2H3OA 4TSFA 3OFNG 1KK1A 2RSOA 3H9VA 3QB3A 3X2QC 2HKOA 1UWVA 2B8FA 4PG3A 4CH6A 3TP5A 3J80E 1GUSA 4KJNA 2F0KA 2D2CC 1SQPH 2ZKOA 1S5JA 4JI2L 1HH2P 1E2WA 4HCEA 4PMWA 3UDGA 1N9WA 2YEVB 3AMUA 4LUVA 2V7TA 1SC5B 5H5JA 2QN6A 4UCUA 2IW5A 1DDGA 4KY6A 5KNCA 2VWJA 3A56A 3VO1A 1YZ6A 5GROA 2IJKA 1E7ZA 1QWYA 1NBMG 2RCVA 2EYOA 3GP7A 4IO9A 2QGGA 2DYSC 1TWHB 2YYZA 1N06A 2D2CB 4LWSB 4X7CA 3H6MA 1QOHA 2A74C 4DAVA 1KRSA 3ABLC 1F9PA 1MBYA 1JICA 4L63B 5GW7A 1R4PB 2KCNA 5LMUL 5IIFA 1PLFA 3Q3AA 1QB5D 1Q1BA 2V7QA 2B2TC 2DNEA 1A32A 1KL9A 1EFCA 2PI2A 3RWRD 4XLHA 4C3HB 1Q12A 4JI1Q 2K1EA 1STEA 2UU9Q 4LFCQ 3ASSA 4MTXA 1UD5A 4LF5B 4LF4O 1M4VA 2O2LD 3JAMi 5C4HA 1HTLD 1A3UA 4F88A 2ITCC 4OL7A 2R6HA 3HOVG 3P20A 2K03A 4BXXH 4N8FA 1M1KW 2PW5A 1HHVA 4DV3L 2RQXA 4C2MB 4IT5A 2ZNIA 3RD4A 5EBWC 3C3LA 2KVMA 4YIJA 4ZKCB 1ILQA 3FHWA 2QW7A 4EQOA 5KMGA 5KNBA 4LF7O 2EYFA 2I5LX 3MFGA 4ZUJA 1FJGB 5C0XH 3BRCA 1S5BD 3SHLA 2ZXIA 2XIWA 1XFOA 2GV9A 4XBFA 2UUBB 5IJ0B 1KHIA 4X1KA 5D5QA 1SYDA 3GTKB 5M3FG 1QNMA 3JAWB 3W7SA 3K5NA 4OO1I 1LNQA 1VQ5B 1JVMA 4GLVB 3E83A 1K3BC 4AYBG 3BY6A 3DWAA 4ID6A 5EGTA 1K9MD 3O65A 3JYCA 2CVRA 2UXBB 4HSVA 3OTOL 1N36O 2X6GA 1AI5A 4QQBX 2EXZA 1WTVA 2D0OA 3BPZA 2PLFA 2JRIA 3KBGA 1AB3A 1J5EQ 4NNJA 4BIUA 1EY5A 2VS1A 2D3OW 3MZ5A 1UNSA 4NKLA 1FNWA 1SNMA 2E76C 2ZM6L 5LMNL 3W5UA 3OAAG 2A6HC 1VQPV 3Q23A 1CA6A 2BTQA 4C3IH 4A3LH 3PO2G 4PC1A 2ZTDA 3TZDA 2NBFA 5C3XA 3CJHB 3WG7B 2UXDQ 1AH9A 2VQFO 1L1OA 1K5SA 1E3PA 2WLLB 4WFBV 4XXEA 1B9NA 4HNAB 4CDEC 1TA8A 2KJXA 3ASOC 2EIXA 2VUMB 3F8TA 1DD2A 1HR0O 2ZE7A 1Q81C 1Y8NB 1UFIA 4RCYA 3D8GA 2F0VA 4J1MA 5BR8O 1HNZB 2A68D 2PYKA 5HFMA 3FYIB 4KHPL 4OGQC 5IYQA 2XNJA 2E75B 4RPBA 2W6JG 4JI5B 2BCOA 3VYSA 2B2UA 2OQ0A 1FRNA 1G7TA 3LNMB 5BMVA 3D3RA 4G5GA 4LF6O 5DM6V 4BW9A 1FD9A 4FLVA 5F2VO 2ZZGA 1NNXA 1O80A 4RAUC 5EKIA 1G7RA 1SF9A 2NV4A 3STLC 1XTDA 2AWOA 2R6GA 3LGJA 3SK8A 4HAMA 1D1IA 1FNCA 4LFAQ 4U673 2VQEL 1XPRA 4DV5Q 3GTQB 1K8AC 3OUSA 3ZHUA 4DU9A 3CMAA 5JVDB 5BZBA 1BQEA 4IOCA 1N32O 2CBXA 2YU9H 1KP2A 2JIZG 4LF4B 4LF5O 5GAEC 3L7ZC 3HKZE 3ML0A 1H8EG 1F60A 4D7SA 1Q9SA 4RMFA 4AYBB 1S40A 5LYJA 2EULA 1FNMA 1I4GA 1KNAA 4QL5A 2E5LQ 1FXKA 4YAUA 5JCOA 5TV2A 1JPXA 2F4IA 1QLEB 1Y8PB 1S5DD 4DR4L 2JJ2G 4DUYL 3OMAB 4FLZA 1SSOA 5JJLA 2UXDL 4LF6L 4DV5O 1AE2A 1T6YA 3PO3B 4LFAO 1QVCA 3TMEA 2R93G 2KHIA 4DUZO 3NE5B 4GCZA 1BPLA 4J7JA 1UD2A 4YEJA 5G3LF 1LUWA 1XBLA 2EIKC 3KCYA 4DAPA 1ZWIC 1HNWO 4B3TO 1Y6XA 1XMQB 2F23A 1BZKA 1D6EC 2QKIC 5ELEA 4CKBA 2YIAA 5IGDA 1NJIC 4YWMA 3W2GA 1QVGB 2AQ1B 1PH6A 3GTOH 3HOWB 4GX0A 4B3FX 5HURA 1YJWA 2YXHA 1NTGA 2GTSA 2X6WA 3N2KA 3KDFA 3MXNB 1OCZB 1GAXA 1BQ0A 1LTAD 1XJVA 1WVLA 1YNXA 2M5SA 1F51A 1YIJV 1U4PA 1Q3EA 3T56B 5IT9E 1Q1EA 4J42A 2OT5A 3CCMB 4KD3A 1SYGA 4JBWA 1Y76A 2DJGC 2SOBA 2E2IH 5CA1B 4DV7L 4P9OA 3PV0A 1SFOH 1EQVA 5IYRA 1HA6A 1V54C 4ZCMA 4XDJA 3AGQA 1QVGU 5LA6A 1L0YB 3E8GA 4HZ3A 4MSWC 1DOLA 4FXUA 3W2EA 2DUDA 4JOIC 4WJWA 4XD7A 4ACBA 1CQXA 3A0JA 3L3OC 3DWQA 4X62O 1ILPA 3B09A 3R8BA 5FLMG 4LNUB 4NR1A 4MTGA 3PVDA 3JALA 1K28D 1E22A 1T9HA 1TS3A 3D31A 3V2TA 4ZK9B 4DUYQ 3JATA 2BPOA 1TWHH 4FLWA 4X6AH 4JYCA 3K79A 2CNDA 2XZPA 4LH7A 4G6IA 1E3XA 1A62A 2HQEA 2K7VA 3HKZG 4X3UA 3ZS8C 2GHYA 3QNEA 1KAAA 3BYTB 3H09A 4EVOA 4FF4A 4B7KA 1UEAB 1N08A 2P5OA 2F3VA 4Q6GA 4YHHL 2C5HA 3B77A 3SYAA 1WPCA 4GQNA 1EUJA 4C3HH 4A3JH 2B2WA 1NCVA 3K5OA 4GN5A 2GUZA 4LF7Q 2QDXA 1Q46A 3RW0A 1K8AW 5JQGB 1HZAA 2BDOA 3MEHA 2TSSA 3OD4A 1HPCA 4PDRA 1Q7YC 2CTPA 1HP8A 4J10A 4OP7A 3EJIA 3WG7C 1XQ8A 3UQ8A 1FVIA 1EFTA 4B9WA 4AQYL 2YICA 1JFFA 2HQLA 1OB0A 3M7NA 3QFTA 1GHKA 5IYZB 5ELOA 2KBNA 3CXCU 1S76D 4IPGA 1M8AA 4U68A 1I3QH 4FLUA 3GTKH 1A2UA 1E1TA 3F7YC 2Z9HA 2Z5UA 4BBRH 4DNRB 2M9VA 1PRTB 4RH6A 5C8YA 1Z2GA 3S15B 4DR3L 2A7WA 1QVFB 3TXSA 2F0QA 1EY4A 3CSXA 4IJLA 1AJPA 3K04A 4DR4O 5THXA 1V1PA 4OHJA 4NCNA 3KBXA 4A3DH 3FB7C 4LR3A 4PC6A 1VQ7V 3F5WC 3JSNA 3Q38A 5LMUB 2QTZA 1YJ9B 1D1KA 1EQTA 2K01A 2PPBC 1VF7A 2FL4A 3JSLA 4OPVA 4NXMB 3I90A 2VNUD 2B5UA 2RDCA 3RYFB 2AHYA 2OCCB 4ZV4A 4P2CB 1WD0A 1H9SB 4PZ8A 2BM1A 2EIFA 1SA0A 1E1OA 2YIDA 1BCPF 4K3AA 2CRVA 4PQXA 4YXWA 3RZDB 2M00A 5L3FA 2ZE5A 3NELA 4L87A 1E43A 1BXTA 4XYOA 3W5OA 2Z0SA 1YI2A 3U4VA 3QO7A 4DV6B 5CGKA 2HCCA 3QF7A 2R9AA 1EFWA 4PHZA 5LHHA 4YY3B 2HIXA 5EPJA 2ZCEA 3CB2A 5L46A 3OMCA 2AHOB 1V55C 2LQTA 3D3QA 2WLKA 4LNUA 5KHKA 2DYIA 5TY0A 2EQSA 4QY7A 3HKDB 2LSSA 3OTOB 4B3SO 4IN3A 4Z4ZA 4MN3A 3BZDB 4GN4B 2B3GA 2EJ7A 3GTLH 3HKBB 1I4RA 4F87A 5DM73 3T4DA 3CW2C 3KUPA 4O42A 4EQNA 4LF7L 3CHBD 1ZM9A 2N3SA 3RVZA 3AVUA 2VB3X 4C0SA 4BXXG 1CKMA 5HY6A 1M90C 3M4QA 3W1BA 3ASOB 2CW0D 4JV5B 5J1ZA 4JI4O 2AMCB 1M1KC 4IL6Z 4F4LA 2EYHA 2VB2X 3S9WA 3G6JB 3VYUA 2QEXV 2AUKA 1KRTA 3TXQA 2YU9B 4PV1C 3NXSA 2NYZD 4OPAA 1YSCA 3K5MA 3CXCA 4U3JB 4O2DA 1B6QA 5C4JB 1KK3A 2WLNA 2WAQG 2AHZA 2E74C 3A0RA 1SESA 4FIPC 1XNRB 2RF4A 2XTIA 1ZL8B 2JE6I 1H8HA 4RGNA 1GUTA 4RHSA 3V05A 2K1BA 2E3CA 3BA9A 1NZ6A 2NN6I 3CC2V 5IP9H 2F4VB 4H44C 2WA3A 3HPLC 5IWAO 5DEHA 1YI2V 2LFRA 4DR6O 3NTKA 1UE6A 3HOVB 1KQSU 3N2GB 4B7EA 1IHZA 1PTOC 4HJ8A 1EBOA 3SYOA 3CMAV 3R3OA 3SPCA 1XXGA 3CF5A 1RQRA 2ZITA 5IDJA 1JR0D 1QQCA 1QGYA 3OZVA 3I91A 4MYUA 2JA6G 3U50C 1BX0A 2K4KA 3HOWH 3LSUA 3K3WA 3LWUA 4CH5A 1W3SA 1EN6A 2ODMA 4I65A 2JS3A 3ZZ0A 1YHQB 4Y52H 4X1IA 4DR2O 3I73A 5E1AC 2VW9A 2EINC 2CWPA 1VQLA 2CE4A 1XEQA 4DV3O 1VQKB 3M7GA 5IYCH 3CC7A 3HEJA 1UEBA 4UAJA 1I6VC 1QZGA 1Q86W 1Z7TA 4ZQ3A 2F1LA 4ABNA 4UFZA 2E2IB 3K59A 3P7JA 4LF4L 2G9HD 1AFPA 3AB9A 4XN0A 2P3MA 1IJFA 4XLFA 4QFMA 2V7UA 2KUMA 3EA6A 3TETA 4RWUA 5FO0A 4DXFA 3ZRVA 4X05A 3ABUA 4UVBA 1X4TA 2RN9A 4FXGC 1FFXB 5CORA 1L1FA 2ARHA 1K83H 2EDGA 2RMKB 3KF6A 2HDMA 5FNVB 2BVNA 4X7DA 1PYSB 2AQ3B 1W0KG 2JA6H 1H2GA 2MO1A 4CS3A 4RAIA 3A8KA 3ULJA 1XNQO 4OX9L 4BBSG 2MW2B 1Y0RA 2NNUA 4UVAA 3JD2A 3MDSA 3AEVA 2N74A 1NH2D 1SYCA 1HUNA 4X64L 4A3GG 4LF9L 1OB2A 1RCVD 2QEJC 1BL8A 4EX5A 1YJNV 2IX1A 4OXPA 1GRJA 3TP8A 3CC4V 2K50A 1W34A 3I2ZA 3HKCA 3K0YA 4JI2O 1IZ6A 3RY8A 4PI0A 4B3TB 1GM5A 4Z4VA 2PI2E 1STAA 5K36H 4LF8O 1BE3H 4J9YB 2BE5C 4WORA 1WJZA 3GTPB 5D3IB 2W0XA 5JEAG 3OEEG 2F0UA 1S3OA 4E2LA 1BGYH 2HHHQ 1KB9F 2UUAQ 5LMNO 1X55A 4RCNA 5BMVB 4HIZA 3E6ZX 4KMUC 4OO1G 3D8CA 3NP8A 2DN8A 1FYJA 3CCLA 4K8IA 1IBMO 3BU2A 1I3QB 1D2DA 2QM4A 1PTOF 2Q8RE 2JDIA 2SDFA 1VQNV 4L5TA 5CV8A 4A3KG 4DV2B 5KA5A 2XEXA 2EIJC 2F0TA 2GK6A 3A35A 2PTMA 3V76A 2JGDB 3STBD 4XT1B 1FKAO 3CXCB 4JTCB 4RQFA 1Z5VA 3ONUA 1L1OB 3ULLA 5J22A 4UZUA 1N0NA 1SYBA 4BY1H 4G7WA 4LF9Q 2YTXA 4FF2A 3P3PA 1YJWV 1AILA 5DS0A 2H1EA 1N05A 3CPXA 1L1OC 1N36B 5CBAE 4YY3Q 1X65A 3HP3A 4X62L 1YZBA 3GTJB 1I08A 4DV6O 4FM2A 2VJJA 1G2TA 1I7PA 3DMUA 3HOYG 2ZT9C 3DDYA 3JCZA 2EJMA 1X3QA 3ITPA 4POFA 2XNDA 2RNBA 2RC5A 5IYDG 2F0NA 2UXCQ 3SYCA 1BHBA 2K5VA 4RD6A 1N0UA 1IKMA 1TUEB 4NXMO 1IKLA 1JWUD 3KLWA 4DV2Q 3H01A 4UCVA 1VQ6V 1RD9D 4ZKBB 4G7HC 1YTFD 1YVCA 3NBIA 5C4XH 3CMAB 5JVH3 3FAVB 2R9VA 2ZTEA 1F7YA 2AZ0A 1UUPA 3NK9A 5C44G 3ASNB 1CUKA 3CCEV 1SRUA 3IFXA 4ULLA 1FFTB 5JOBA 3U4ZA 1S72A 3THOA 3A8JA 2P06A 2Q7HA 5IYWA 2JP1A 4KY7A 2GVBA 3QSYA 2N04A 1TT2A 2XHBA 1KLUD 1XMOO 3ZC3A 1O7LA 1RM1C 1WFQA 4YWKA 4PMBA 5H6RA 1P16A 4YY3O 2R7ZG 1MI2A 1WA8A 4ILWA 1N34Q 4X1YA 3PUMA 3FPKA 1HUMA 3SJAC 1BCPC 4LF9O 3PA2A 2I07B 3HOXG 2F0OA 4B9XA 3OE7G 3FB5C 1D8LA 2K52A 2NB0A 4RKBA 1W6KA 3AG2B 5B1AB 1PL4A 1W0JG 2PI5A 3U11A 1E1RA 3V7AA 4I7ZB 2DERA 3ZMSA 1NTZH 3HKSA 3OYYA 1B50A 5B5EZ 1FJGQ 2ZXPA 1Y67A 2PYLA 2EZOA 3ABMB 3ZHTA 3PO3G 1I18A 1EIHA 4AQYO 1PYWD 2N88A 5IY0A 3QJYA 4IFDI 3F7VC 3CRLC 4K5XA 3A8JE 4NW2A 5IY5B 4OIKA 4DF7A 4Q20A 4I55B 2CW0C 4KTAA 5C3EG 2F0FA 3J7A5 1DGSA 1F2YA 2Y0IA 1SQXH 2KEEA 1N34O 1VQPA 3JASB 3HOVH 5C93A 3N2KB 4R50A 4RCOA 4CBVA 1N36L 4PA4A 2KHSA 3KF8B 5DAUA 1TXYA 2F0MA 1I4XA 2EINB 4MIUA 1GUOA 3C46A 3BS1A 2C5BA 4TT3A 3I4MH 3ZMZA 1EYGA 2ALYB 1WTQA 2Q6LA 3LQ6A 2EIJB 4G28B 2QSAA 2UUCO 2CK3A 1KQSB 3GB7C 3IFDA 5C0XI 5EBDA 5M3MH 4R4TA 3CKIB 2GTAA 3OGCC 3DC6A 1K9MC 1LTGD 1G7SA 1SDFA 1XQBA 1D1NA 3JC66 4K8JA 5JVG3 4B3RQ 4BY7B 1QHTA 4X64O 1KU9A 4ABMA 4H44B 4NTWA 1H2NA 5CB4A 4JI0O 1EZ8A 1XX8A 2JN4A 4UCOA 1HA3A 1SAPA 4ASUA 4XLEA 5EBCA 4TQFA 1FDRA 3G67A 1MG1A 1H38A 3H0GG 3NENA 3W5VA 1HZCA 4FP5D 4FMTA 4IUUA 2BM0A 2E74B 5A88A 1RJTA 1G2SA 3WOEA 4RQEA 4PC7A 5GADC 4G7OC 2F95B 1UE5A 5CA1A 2B2VC 2XSCA 3ABKB 1K83B 5I2XA 5IGFA 4XKVA 1QUFA 1I4PA 4ZOLA 1SZXA 1KECA 2ILMA 1OO9B 2QF7A 2Z3YA 1XMQO 1NSNS 1VQ7B 3P30A 1HNWB 2LS01 3BDOA 4GKJL 4GX2A 1VQIA 4IYIA 3IL8A 1C4QA 1CP9A 3IFTA 5L3DA 5LGNA 1BBUA 1W0KA 1KTKA 2P4KA 4DV5B 1V5VA 2Q9LA 4IUNA 2AW9A 4LF6Q 4UB6Z 1GMGA 1RSOA 1BNZA 1HQRD 2DETA 3U58A 3S1RH 4G27B 3I4OA 4B48A 4JYAL 1QE6A 3J81k 5BR8Q 3O9OA 1CNEA 1B23P 5CBHA 3OW7A 1I4QA 3NHHA 3WOFA 4BR6A 1A0IA 5EMNA 2L0CA 4LFCB 1HR0L 3S16H 4O4IB 2IL8A 5KX5B 2HFEC 1ZM3A 2EZPA 4BIZA 1MOFA 4XQFA 2G5DA 5E4WC 3FPUB 1N32B 2E2JB 3P1HA 1LT4D 4PC2A 3L75H 2JGDA 2Q73A 2A19A 4U3FH 5DSZA 1R6KA 1YJNB 1ZKOA 4Z4WA 1PFBA 2N55A 4DR6Q 4Z4TA 3PCOB 3R2TA 2GQFA 1I94B 4JYAO 2R7ZH 1QFYA 2XRQD 4E4EA 5JBQA 1RFYA 2C4UA 2QTOA 1VQJA 5BXZA 2IT1A 3VR3A 1BBWA 3UM7A 2WB1G 3D4DA 4OO1H 4FFKA 4LBEC 1R3JC 3K9AA 4X1YB 3GVLA 1RDPD 3IKJA 4ZAIA 3KOJA 3WU2Z 3I1FA 2IWHA 4B3MQ 4Z1MA 1FNVA 1FRQA 2FKXA 3SYQA 4QJFB 2QKSA 5GTIZ 4DUZB 4P72A 5BR8B 4IQZA 2Q2UA 3LQEA 2IHEA 2P5ZX 1Y0YA 1VJSA 1U9RA 3PUXA 1KD1W 4PMCA 3UT5B 2YXLA 3TP7A 1N8RW 1D8TA 1GM8A 2MNAA 4B43A 4AHCA 3GD7A 2PQAB 2EJFC 1ORQC 3U10A 4BPRA 1TU2B 5LMUQ 3QVNA 4KI0A 5EPLA 1YIJB 5IYCO 1VQGA 2JS5A 2I5MX 4MTFA 4CC5A 1CA5A 5CMDA 3CB4A 3A7LA 2FB5A 2XGJA 1MIUA 4QVJA 2L55A 2DMXA 3VYRA 4POGA 1DJRD 1WOSA 4NP5A 3GO5A 5A9GA 2KQXA 1YHQV 1B1ZA 1IBLL 1TWFH 5J2UA 2K75A 1VQ4A 1PJ6A 2JQOA 5KX5A 1SNPA 5I9OA 3JAMc 5DEDA 3TREA 2PF4E 1IXMA 4JI5O 1VQ9B 4DAMA 1R6NA 2VQEO 1DF5A 2R3ZA 3I4LA 2DWEC 3OUFA 4K5VA 2D5DA 4K0KO 4UZFA 4JV5L 4QE9A 4ZKIA 4DV7O 3BA8A 5M3FH 1AR5A 3C3TA 2ADPA 5KUKA 2W6IA 1Y1WB 1RSOB 4I0XB 4N3GA 4HIDA 2ZD9A 3K7AB 1JOQA 1K7DA 4OXSA 4A5UB 2Q8VA 4LF7B 3OJWA 5A8AA 1M90D 1QGZA 1J9OA 4GLAC 3UI2A 4I4TA 1FXVA 4MVMA 4MHEA 1H2SB 1YITV 3DEPA 2FMLA 3WFVA 1IBKB 2Z4IA 2IU3A 1R6TA 3FVQA 3RZOB 2PQAA 4ZOLB 3SPJA 1N07A 2Z4HA 4B47A 1WNSA 1IB0A 2HMAA 1PD3A 4BW5A 1X3PA 2E1BA 1T6XA 1A15A 2FINB 5KMGB 2VRZA 1GN3A 3CCEA 4DV2O 2I1LA 4NXMQ 3OEHA 1HFNA 3DXRA 4TV9B 4K0KQ 3W7UA 3ISXA 5EIBD 4DV0O 1GKFA 1WSVA 4DV4O 4X1KB 4P73A 1E1RG 1W0JA 4YAWA 2F0JA 4DA2A 5C3WA 2R7ZB 3T51B 2J7KA 3M85A 2ZNJA 1IXBA 3K08A 4K35A 1KJZA 3OP1A 1K33A 2WLHA 1E2VA 1B9MA 2DY7A 4WBNA 2ZL5A 3MC0B 5LMNB 1K8MA 1LV9A 5EYPA 5K1PA 5AJ3Q 3HOUB 5J2TB 2XAGA 4JI4Q 3B82A 2NZ1D 2JVDA 2OYNA 2VZLA 1Q86D 1I6HH 3CESA 2BOBC 2EXDA 4NB3A 1GUWA 4I50B 1BT8A 2YIBA 1WJJA 1OCZC 4XOTA 2YS8A 4JPRA 4DK0A 5CA0B 1Q8KA 4KV6A 5I4DA 3S2HH 2Q2HA 1SETA 3CEIA 3M8AA 1YNJD 3E9IA 1UD6A 3J80L 1XYIA 1JJGA 3ASTA 3GV3A 5C0XJ 3SE0A 4CKCA 1IBLO 1I94O 4U9UA 1ZLZA 2E5LB 2JEBI 4IJHA 1EIYB 2IH1C 3UE0A 4X9QA 3CJHA 1RODA 2ZIMA 4P1VA 4I9WA 4XNFA 2A6HD 4N21A 1I4HA 5HFLA 2SEBD 1PH5A 3SEBA 5CYUA 2PY5A 4PGOA 4ZCLA 3ZIAA 5LYJB 2Q7GA 4FPPA 1XNQB 1JA1A 1FJGL 1S5LZ 4AQYB 1J5EO 1T6ZA 3TP6A 4FZ0A 3I72A 3O13A 4G7ZC 4NXML 2QR4A 1NRKA 1IYUA 1LUVA 1EYCA 4JI8O 1HDJA 1MKHA 4KK7A 2O57A 2ZINA 3BNWA 4HJ7A 2E5LL 3AFPA 2YEVA 2X3UA 1QG0A 5C6AA 3A0HZ 5GONA 3IRBA 1A2TA 1DYQA 2A6EC 2Z6BD 2EPBA 2YSUB 4IW3B 4DQKA 5HZAA 1SNDA 3BDLA 3KYHC 1XTCD 3L73H 2Y69B 1V43A 2F0SA 1YDXA 3L74H 3R2IA 4DR5O 3S1RB 4KHPQ 5B1AC 1TKWB 3VA7A 1A8VA 4A3IB 1EM1A 1WN7A 2LGQA 1QCEA 1J5EB 2WLJA 4X3SA 4I5SA 4LJZC 3JQPA 3RBZA 3R93A 3ND8A 1IBKO 1F9QA 2ATWA 1FXKB 4YCUA 3ZEDA 2A73B 5NUCA 4LCUC 2HJFC 1NJIW 1GUNA 3T1HB 1RIPA 2HIVA 5D65A 4NXNQ 1HFGA 4XKWA 3SLNA 4DUZL 4IPDA 1YEZA 4ZI7B 1SROA 1OCCC 4D7TA 1TUBA 4PZ7A 5KHGA 4DV7B 1EU3A 4A3FG 5ELNA 1NVPB 4NXNO 5DN6G 1TWAH 2WACA 3PGZA 4GYCB 1W6JA 4I4TB 5EAYA 4P9SA 2E76B 5LXTB 1SNQA 3WNBA 1NI8A 1W2BU 5IE8A 4IIJB 2DWDC 2PIAA 1NVPD 3W5HA 2AKWB 4KJOA 3H1LH 5I2YA 4LF5Q 4JI0Q 2KCCA 5GV8A 5K5PA 3I4NH 2UU9B 1XMQL 1WPXA 4FM0A 2D9UA 2B2YA 5KLVH 2UXDO 1NJID 2A9HA 4YJ2B 3CC2B 1F77A 1WCMH 2XRSD 1VMCA 3HOZG 1NT2B 4M4SA 4TN1A 4IYHA 3IC9A 1VQAA 5FLXc 1YX2A 3LUTB 1NBMA 2CGNA 4X07A 1V1OA 4S3SA 2AZ2A 1OCRC 4JI1L 3KLSA 5HZBA 4X62Q 4CQJA 4RD3A 5FJ8H 3HOXB 2IM9A 3VNUA 1CKNB 1ML0D 1RHPA 2LW7A 4YAOA 1EY8A 3CCMV 2RBMA 4OEMB 4I50A 1EZ6A 2LFSA 1I94L 2B8GA 1IBKQ 5CA3A 1B8AA 5IT9c 3T1HL 2Q7EA 3S1NH 4X65O 4RUEA 1TUIA 1XI1A 2JA5H 3ZMTA 4W4KA 3R6KA 1VQMV 1AN8A 1ZSPA 4A93B 1A8PA 3FAVA 3T4AC 2UUAB 4XMYA 5GV7A 1O7YA 1TAEA 2JA8B 1GO3F 1VF6A 2B7CA 1Z5WA 4R1JA 4NBSA 2BE3A 5J3OA 4YHHQ 2UXBQ 1K8AD 4PNYA 1IVSA 1YBYA 1PKVA 2F03A 1Y1WH 2E75C 4GUNA 2IHFA 4MVSA 1FNDA 4B3TQ 2IPKD 3K7AH 2DOSA 4O2BA 2RHSB 4TSSA 3HAGA 3WWVA 2QEXA 2YXYA 5JJEB 4C3JB 3OTOQ 4A3EB 4DUZQ 5LMUO 2WB1B 1MD2D 1DONA 2DYSB 1BS3A 1YLOA 3RNUA 1XHXA 1BVSA 4GKJB 1TWCB 1HWYA 3ZZTA 2IW3A 3BG3A 2V1DA 4DR1O 2UUBL 2ZIOA 1C0AA 1RTOA 2BTOA 5IYPA 4C2MH 2QA4V 3RLNA 3B8NA 3OEEA 4O2AB 1SJHD 1BCCH 1VMPA 1CKNA 1CFMA 4E6IA 4FF1A 1B53A 3HKZB 1Q82D 3NBHB 4DV0Q 3A5UA 1NQTA 4DR3O 3ICEA 5JJIA 1Q90A 1SQGA 3B4SA 4M1KA 4X66O 2B2WC 1VF5C 1IBLQ 4IHJB 2XAJA 2PE3A 3ZIAG 3QFCA 1JJOA 5KIXA 2HDLA 2HVJC 3J81c 4HNAA 3HOUH 1X56A 1GJRA 4KKUA 1VLOA 4LUOA 2DJFC 4CC6A 1XMOL 5I9PA 1WTPA 3FEWX 4CH4A 3SGIA 4XM3A 1VQDA 4KHPB 4MZ9A 3HGBA 5E7NA 3CMEV 3CCSA 3PQIA 2CF4A 2JA7H 1S72V 1NTMH 4KHZA 2Z6BA 3WBJA 3B6YA 2NR5A 1JB3A 4IPHA 3H1HH 3G71A 5C0XG 2B63B 2UXBL 1PPJH 4O4JA 1ET6A 3CCSV 4ZI7A 2JXMB 1FL0A 3JASA 3DGEA 4DYLA 4IURA 1D5XC 3ULPA 2UU9O 1PRTD 4FF3A 3CP2A 4JPBW 5CBFA 1R3LC 3RGBA 4LH6A 4DR6B 4DN4M 2VQEQ 1VQ7A 3R6JA 2RKSA 4GKKL 3E8FA 2LMCB 4WQMA 1A63A 2VNIA 3TRZA 1PTOD 4DR7O 2ZM6B 1VEWA 5E1FA 1P4MA 2F0LA 4LBWA 2VL6A 1OHHG 2CTQA 2XNDG 1AZPA 4QJFA 2UUBQ 4O4HA 1WI5A 3OZUA 4QB4A 4LNQA 3DHQA 1FX0A 4CDFC 1AVMA 3E8HA 2LXKA 4P2NA 2ASBA 2JJ1G 3CPFA 4QIWB 3E3XA 5IYCG 3RYHB 2NN6H 5JJZA 1TWGB 2Y69C 1F9SA 1QCBD 5AJ3L 3OW2A 4XL9A 3K8AA 4AH6A 4J7KA 3M4PA 5FO9B 4HYOA 4RD1A 5CV9A 4JV5O 2Z1CA 2ZTCA 2IJJA 1VQFA 4DV7Q 4WZKA 3CC4B 1V0EA 3MA2B 1ELOA 3CAMA 3MHBA 1YNNC 1M1KD 3AVWA 1G7CA 2R7FA 3H1KH 5TISZ 1L8DA 2VNJA 2NVTB 2RDGA 4HJ9A 1SKQA 4RJLA 4LBZA 2B2YC 4Z4YA 2NVQB 3L71H 3LDEA 1SE2A 2QCPX 3H1IH 4YCWA 4JI0B 2XZOA 5LXTA 4I9QA 1N8RD 1KC8C 4GKKQ 4EFBA 4JAAA 4J11A 3A3GA 3JQRA 1AW7A 4W4LA 5FLXN 4BAYA 4OOXA 1P49A 3FD9A 4MS2A 3WDNA 5K36G 4WFAV 5LP6A 1BCPD 2FYUH 1K0RA 2QTLA 2QM7A 4JI8B 3E22A 5TR9A 1DLBA 1YF2A 2YWFA 5CV4A 3SVMA 3FPPA 1TWAB 4P3YA 2A69C 3A74A 3OHXC 4HEDA 5C3EB 5JH7B 3GWKC 1K73D 1QNKA 5ITZA 2P67A 4ZIBA 4JAUA 2YI9A 2ZDIA 3ES9A 1X3FA 4K2KA 4V0BA 1MSDA 2C5CA 2HR3A 1JWSD 3HFZB 3EHBB 5ELBA 3PIP3 3I56A 1JQYD 2BH2A 3F2BA 1VQ8A 3CXHF 4EH1A 2F93B 4PELA 2WIIB 4RD2A 4WJ3M 2DYRC 3VYTA 1PV4A 1HNWQ 4RGOS 3OIPA 1STNA 1EN5A 3OR6C 1H8HG 2XAQA 1Q86C 5IYDH 1VS0A 4NYKA 2F52A 3NEMA 4QGPA 2WJVA 3BY2A 3IAYA 4AVZA 2LKVA 2LGWA 1V1QA 3DLLA 1W87A 3ONYA 3X3MA 2CUGA 1BDOA 1PXUA 3U9OA 2P6JA 2VNKA 3BAAA 4O4HB 1IZ3A 4LF9B 1LYLA 1HNZO 5EK0A 2ZL7A 2EY2A 5FA6A 5LOVA 2XWJB 1C8CA 4IFDG 2NVXH 1N0JA 1K0SA 4JCVE 1ZYRD 1BMFA 1DXMA 4OIJA 4C7UA 2JA5B 3VQYA 4MTNA 5FJ8G 3CPWA 4DPGA 3APOA 4X20A 3SR2C 4AF6A 4TOIA 1WTHA 3QE2A 2L11A 4X64Q 1Y66A 4H37A 5IP7H 4HIKA 1N33Q 1WORA 4B3RO 2JA8H 1M9NA 5LMZA 4H02A 2F43A 1QUEA 3MVVA 1BF4A 5HGTA 4LBYA 1SMYC 1JOOA 1FXHA 2HP8A 3Q6SA 5E4XA 3F2DA 4DR3Q 3EN2A 2F0WA 5FO7B 2UUCQ 4DV5L 1SKYB 2OEOA 4DO2A 4G2KA 3FJOA 2MFIA 3QO2A 1STYA 4LUZA 1JB7A 1CQVA 4C3JH 2PMDA 3HOUG 3M99B 4GS3A 3BZCA 1VQOV 1SA0B 2AHOA 5B1NA 2PZUA 1BBXC 4XORA 2MPMA 1HNWL 2KEDA 5J2TA 3K03A 5B3SC 1EY9A 3WYAA 1TWCH 3T13A 5B1BC 3FYEB 3JAKB 4FO2A 3B40A 4RKLA 4P30A 1KDBA 1SR3A 4JI7L 3CCVB 2PNRC 4OELB 2OBTA 4Z1MG 3TCUA 1F23A 5CBGA 3G4SV 5EC1C 1M93A 1SYFA 2EY6A 1FJGO 1VQ5A 1QVFA 2BF4A 4RCZA 2EOTA 2VWKA 4OOVA 3MXPA 1Q6HA 2BDNA 4XYQA 1CHPD 4IALA 4FFBA 5E79Z 2HUGA 5TSSA 4X20B 3LDCA 4BBRB 5M5XB 4A3MH 1HR0W 3S15H 5IYDO 2K05A 2WP8J 5FNZA 4D6TH 4JI7O 2JA7B 1OXVA 1MGSA 1K92A 2OXPA 4X88A 1I50B 4QE7A 4WFFA 1EFID 5KAIZ 2V4DA 4WFEA 4JI1B 1H9KA 1R5BA 4RLZA 3UDIA 2ITDC 2XVSA 2VS0A 3BVMA 3AG4C 4OOSA 1JCKB 1U4MA 3PIPA 1GD7A 3ZHSA 2ZQMA 2OTJB 1TVCA 4XONA 5LGTA 4ZHQB 1WP7A 1QGAA 5TRDA 1S77D 3MHPA 1CSQA 3AVYA 2RJZA 3A8IA 1F2LA 2F1MA 2X8KA 2M2LA 4G1BA 3S1QB 4LBVA 3H3VC 4HBNA 4QUZA 3A3BA 2BN4A 2H5XA 5JJNB 1LT3D 1NKDA 4JYYA 2UUCL 2WINB 5C5LA 2R92G 3H3VI 3OIQA 3QG1A 4YJ2A 4QV2A 3RUZA 4AC9A 1ASYA 1XMOQ 3U6KA 2AQ2B 3CC7B 4XDLA 1B2RA 1QX4A 3GTLB 5LP6C 4DV6Q 2KQ3A 1ESRA 2YWGA 2NLJC 3Q8DA 5LP6B 4CJ2C 2BA0A 3WB1A 1LTBD 3BVOA 3DC5A 1WPBA 5FL7G 1VQKA 5KSWB 1D2BA 1LTRD 1HNXQ 4GKKB 3HRZC 2XN9C 1J5EL 4X0CA 5AN9A 4RG1A 5LL6X 1AJQA 2PQEA 4ZUIA 3JD3A 3TGUH 3N27A 1VQ4V 3PSIA 2BMWA 3L9DA 1LT6D 1H95A 1XUQA 2Y4UA 4P25A 1U0LA 3FP9A 2ZZFA 1TS4A 4A3KB 3NUCA 3TS2A 3LSQA 2LO1A 2NTTA 3IGAC 2Q6IA 4DR7B 4A4IA 2EE1A 2K6AA 5C4JH 2WLLA 3B8HA 4IZ8A 3I56B 4Q0FA 3N2GA 3AVVA 1ROPA 3QFSA 1HQMC 4JAVA 1TTTA 1PZID 2KCTA 2Y0PA 1JC7A 1Q90D 3CCUA 2EIMC 3TK1A 4B08A 2F0PA 2DQ3A 1JJ2A 4JI6B 2IU0A 3CCQV 4TUYB 1WTHD 3CYOA 1STBA 2L4NA 4YJ3B 4C1NK 1GAWA 3LNNA 3CW2A 1J95A 4WFHA 1UD8A 1Y1VB 2V1CC 4PZ6A 4TV8A 1AP5A 1AR4A 1L2FA 1XNQL 4IUVA 2L5TA 4R71A 4K2LA 5KHIA 5KGUA 2OIGA 1QFJA 4GKJQ 1AP6A 2O4XA 1JORA 1DOMA 1W59A 5IY5C 2K14A 4XOPA 5JEAH 1Q82C 3T1CA 4DFAA 3RYIA 3ZX6A 1COWG 1XREA 4A3GB 1GJXA 4A3BB 1OCOC 1E62A 4FFBB 2AWNA 2WZNA 4AI8A 2CK3G 1Y14B 3AG2C 4JOIA 5EZYA 2C4TA 3KKYA 3K57A 1ZM2A 3CCUV 4ZGNB 4GOPC 2IJHA 2ZBUA 5BSXA 2B5OA 3QOJA 2K5NA 1BCPB 2QJ1A 4TT3G 2F4NA 1K4DC 1QNUA 3D26A 2KCMA 5FLXE 4DV6L 4B3MB 4LFBB 2EVBA 4WF9V 1KC8W 4P12A 1NR7A 2LJ2A 4UVCA 5B3SB 2DIEA 4P26A 4CDDC 2UUAL 1UD4A 2E2DC 2ZE6A 2WLIA 3UT5A 2KA7A 2MO0A 2WV6D 5LBQA 4B3SQ 4DR6L 5EQ0A 2NUCA 3J7YW 2Q5ZA 4XQJA 2P4VA 1ZAUA 3SJBC 1D5AA 1GN4A 3ETQA 4LF6B 3ETEA 2EFGA 3PA1A 4R4IA 5F4OA 4PA6A 3ASNC 3TSSA 1SZTA 2XZLA 4JBMA 1YCIA 3NBHA 3A8TA 2DNCA 1KBHA 3Q24A 2AXTZ 5IWAL 2Q6AA 1SM4A 2D74A 1EOVA 4OX9O 4B3XA 1SE8A 1PNMA 3K81C 1HVXA 1UE7A 4TVAB 2I0QA 3SK6A 1LR1A 5EYPB 3CCQB 4LWSA 4N8X1 2E1RA 4IUQA 4TMVA 4BS9A 4A3KH 2CCZA 1BR9A 4EB6B 3K9SA 1GAQA 3T1HO 4HE6A 2XWBB 2AUJD 1XL6A 3HOZB 2RSNA 2EYLA 2DN9A 2KG7B 2EJRA 1UPGA 1KUQA 3CU7A 5LHY1 4JC0A 4RA8A 4LF8L 3TJTA 3SJCC 1AI7A 1GK9A 4N3NA 4B3RB 2UXCL 2CTWA 3ZBHA 1GOZA 2QTSA 3F1ZA 5FOBB 2MUYA 5J9PC 2F66C 3PUZA 2UXDB
chains in the Genus database with same CATH topology
4DUYB 3OFNA 1H9MA 4A3MB 2E2HB 2RA4A 4KHVA 4BY1B 3HS0C 4TKOB 1ZEQX 1PMRA 4BWGB 4C3JG 3S17B 4O1NA 3RYFA 1IL8A 4K8XA 1DZ1A 5JH7A 1ONLA 4ZRZA 2K5DA 3NPPA 2R72A 2B39A 4KKSA 3GTGB 3E22B 3QG5A 3KLRA 4C3HG 2K33A 3T16A 1RTNA 3RYIB 1S4ZA 4FLYA 2PO4A 2UXCB 1KZLA 5KEEA 3A7AB 4H13C 3ICXA 4NVPA 5IGGA 1CZGA 4XIGS 3D6WA 3K58A 1ZYRC 1TVKB 2F0EA 5A35A 4DR1B 3DUZA 2R92B 1Q8IA 1O9GA 3VQVA 5T1GA 5CDFA 1X32A 1E1QA 2J7ZA 2W6JA 1TR5A 4HSPA 3RYCB 5CB4B 1V0FA 4QF4A 1ENAA 4H7BA 4O4IA 2EZVA 1G6UA 1ENFA 1TVXA 4CGYB 2IJ0A 5JEAJ 3MWYW 2JIZA 2VQEB 1PTOB 2A68C 5JCOC 3DSQA 1H9RA 1QILA 4TRDA 5JVDA 3OWFA 1UD3A 2NVYB 5M3MB 4O4LB 5I6WA 2JJ2A 3D4RA 1U4LA 1AP0A 3TZUA 1SEBD 1GXDC 2GK7A 3MAQA 4TQDA 5M9OA 1B3AA 5FPOA 1EYAA 2GA4B 5IGCA 3S2DB 2D3NA 5D5PA 1FFXA 2EJGC 3PMFA 5KYIA 3ND9A 1E2ZA 5FLXE 4DAPA 4LMQD 2Y0SB 2ENBA 1QG7A 4DK1A 1H9JA 2CHBD 2ZZQA 2CAZC 3JU4A 3M7MX 1A3TA 3DEOA 1BLIA 4II2A 1STHA 5LA6B 1GHJA 2PZTA 2L12A 3DM1A 1W9XA 1Q43A 4G4KA 2R93B 2BOSA 2X6YA 1EEID 1CM9A 3BABA 4P22A 1Q3LA 2HLDA 1F9RA 4HR7B 4J6HA 2F0IA 1EIGA 2GJRA 3OWEB 2Q8IB 3PUVA 1PRTC 1Y8OB 2MP1A 2CQAA 1DCZA 4DRXA 1PZKD 1RKNA 3PN1A 3EFXD 1EY7A 3J81L 3RMHA 2K5WA 4CHTB 1HRJA 4FLTA 3RYHA 1SE3A 1PFNA 1IBLB 1JFFB 1HCZA 2X53S 4C56C 1SJED 4UCTA 3F2UA 2I46A 1CI3M 2K04A 2UUCB 4IUTA 1SBBB 4FLXA 4NXNB 1PZJD 3BCDA 5J39A 3SDZA 1R4QB 2PYJA 2B2UC 4L8JA 3EQLC 1IYVA 2ID0A 3HOYB 3NTIA 1VLYA 3ZPNA 5IGEA 5JAVA 4U3JA 3HKEB 1H9SA 5CBEE 3ZYYX 4WBNB 3SK4A 2SNSA 2FJ2A 5IOCA 3TBIB 1G91A 1S5FD 3VQXA 4X64B 4K5WA 4UAIA 4RGMA 4LAAA 5E3FA 2C9OA 1MABA 2EY5A 4Y7NB 3FMCA 4K8ZA 4I55A 1SQFA 2ICIA 4K14A 1SNOA 3VR6A 1ICWA 3N6RA 4N9PA 1OXSC 3K6OA 4O4JB 4NMZA 4V190 3BH4A 5BN3A 1I6HB 4EFEA 1N33B 4Q5VA 3S2HB 4CJ2C 3KK7A 2LY7A 4YJ3A 2WPDA 1YNJC 3I3CA 3BVGA 3PO2B 2MGSA 3T1YB 1PRTF 4KKTA 3OE7A 1AZQA 1K8OA 2HCIA 4XLCA 2JSOA 2RDHA 1KNEA 3RFRA 3GTOB 4X65B 2K28A 5GONB 3VA5A 2H4OA 2X85A 1B04A 2OWOA 3X3NA 5D14A 3C1FA 2VJIA 3P75A 1XHZA 1TGOA 3ERQA 5DNFA 2KOLA 2PCFB 2VXWA 1B4OA 4IFDJ 1FGBD 1SFOB 1E3ZA 1U4RA 2OT2A 4J8QA 2O5IC 3A55A 4R8NA 3V96A 3GTMB 2PMZB 3HZXA 1NAPA 1CQFA 3Q22A 5JPNC 4JI2B 4DAYA 4KN7C 3VR4A 2ZZEA 3D4WA 1EU4A 2Z8LA 3NWSA 2JYOA 4G57A 4A3JB 4GLXA 1ENCA 5FO8B 5JJJB 2GJKA 1DM0B 2PZWA 4TQUS 2WKCA 3H91A 4HAEA 1RF2D 3PIO3 4FM1A 4DR5B 3I4NB 1IBMB 2WJYA 4UDUC 1WD1A 1YEWA 1JMKC 1COWA 2OYQA 3OPOA 4B3GA 4WRDA 1NR4A 1C48A 3JAML 4QUCA 3CRKC 2G9DA 2FMCA 3W2DA 5IK2A 2K5QA 3CP8A 3G7LA 3NQTA 3S1NB 5ELFA 5C5MA 4A3DB 2ZXOA 1HW7A 2RVLA 4JI7B 1A3VA 3MXUA 4O2AA 1IW7C 3QOLA 4GZYC 5IT9L 3H94A 2EX3A 1B2TA 4XTCS 3JATB 1O9HA 3OTFA 4YHHB 1FNUA 1T5XD 3KLSX 3JAME 3URYA 1TS2A 3KEWA 4EGVA 1NR2A 1WTOA 2QDBA 1XMOB 5A2QE 2WAQB 3RYCA 1G8ZD 2YIBD 2VQFB 3FDTA 1PFMA 5AFWA 3B2EE 5ITZB 4DNTB 1S5ED 4X3KA 1EFRA 1EY6A 2D62A 2X69A 1JE4A 4B3SB 1LTSD 3OOCA 4IUPA 2JJ1A 1MSGA 4XQNA 1JWMD 5EPKA 4FXKC 4OX9B 3M4OB 2RQ6A 3WB2A 1LT5D 1TS5A 5JPMC 5A2QL 4TV9A 4I7ZC 2NWGA 3H0GB 2O5JC 4NDXA 1E0BA 2YI8A 4DRXB 4QMGA 4K6LA 4DV1B 4TUYA 2FHTA 3BVZA 5K1XA 3OMGA 4HMIA 2IX0A 4XQQA 1Z6HA 3E0JA 1HNXB 2ZTGA 3JAWA 4BA2I 3QWNA 2IX3A 1SXTA 1WTRA 3J7AV 5ISRA 4XN3A 2JA6B 3A54A 3CMMA 3T53B 3NTHA 3TDQA 1CHQD 1L0XB 5FK9C 4LK1C 4TV8B 2EYPA 2X6XA 5IJ9B 5KNDA 3BCFA 2F3WA 1BOSA 3M3YB 3VR2A 3I8ZA 2EY1A 2F0HA 2KVOA 1EWHA 3MXNA 5JQGA 3NQIA 3SXHA 1Q5OA 5FNVA 2XNAC 2PZSA 3WQZA 1KMHA 1TQOA 1TY2A 2Q8TA 4RWSC 1CZWA 2LZJA 4DR2B 4DXGA 4C3IG 4CJ1B 4DGZA 2EYJA 2PW7A 2MHVA 2FFKB 2NVXB 3MTSA 4RGTA 4X1IB 5EKKA 3FFQA 1BUVT 1J8IA 1HXYD 3G05A 1V8QA 2A5HA 5C44B 2WKDA 3MFYA 1A6XA 3Q0AA 3WB0A 1D5MC 2A69D 1FYCA 2K32A 3JAKA 4X66B 2F0DA 5KHJA 5KYLA 4DR3B 2XOKA 1XWEA 5M5YB 4EQPA 5C4XB 4CS4A 1OXUA 2J0TD 3N52A 1N34B 1ZXTA 4JI4B 2DY8A 1KDCA 2BA1A 4XLAA 1VCIA 5IJ9A 2MJ8A 2JEAI 1EWCA 4HN7A 2V31A 1II3A 3SR1A 4KL1A 2SNMA 1H8EA 3TN2A 4ABNA 4LFAB 3DXJC 3FKIB 3EROA 1LLRD 4XR6A 4O2BB 4BWAA 5ELCA 4F7XA 3S1MB 3CHXA 2RDGA 5FPRA 1G6ZA 3VQWA 5KHHA 3I4MB 2OF1A 4EEQA 1F2MA 1M4UA 3BDCA 1EL0A 1V9PA 4DR4B 5IWAB 3U0ZA 2ZTNA 4Z9CB 5C8YB 1YNND 4HMJA 4L6TB 1R9TB 4IHJA 3C2PA 2BTQB 5FKAC 2EYMA 1HR0B 2J4XA 2RDFA 1CK1A 1OXXK 4A3FB 2L9HA 4FVMA 1B44D 3FKSA 4QCLA 3PUYA 3C1EA 1WTWA 4IIJA 3HKEA 2P22C 1WTXA 1GUGA 3HKDA 2WZPP 3RLFA 5IJ0A 4H0LC 5DM63 1Z47A 4RFBA 4LF8B 1BO0A 3M4YA 3S16B 5CA0A 3ONAB 5KRUA 2ZXHA 1G291 3BYYB 3NWTA 4X62B 4JI3B 1FR3A 2L1BA 4C1NI 1V1PB 5C4ZA 4WFN3 5EIBC 3OAAA 4HTHA 2X6LA 1SNCA 3KF8A 2R70A 4XDXA 3EVQA 4ZLTF 1ESFA 3AU7A 1SMYD 4FNFA 1I7FA 1AEXA 5EJWA 1BQQT 2LFNA 5CV5A 1HA5A 4EB6A 1CTMA 1WP6A 1MSHA 3HKCB 4CH3A 5LOVB 3LWEA 2NTSA 4PI2A 4DV3B 1CT1D 3A8KE 3D6CA 1T5EA 1JOKA 4KD4A 4UCRA 5CV7A 4ZHQA 2ICEC 4X3TA 3HG9A 4DV0B 1LABA 5FL7A 1TWFB 2B2TA 5ELDA 5COYA 4QUFA 3GVKA 1PDQA 2FMMA 1SYEA 3GV6A 4ZYSA 1NUCA 5M3FB 2B2VA 1IW7D 2KKWA 1KABA 1QJOA 2F0GA 4AILC 4F6RA 2R61A 4KN4C 3U9SA 1E79A 2A6ED 1VDZA 5BN4A 2KECA 2PGGA 4II3A 3NXWA 4M1UB 4YELA 4RHRA 1OHHA 3JARB 5IGBA 3K5LA 4DV4B 1LTID 5CV6A 1TY0A 1M5IA 1O7ZA 3I70A 1TVKA 1Y69U 3SK5A 4HCSA 3J7AF 5J2UB 1LACA 4G7XA 4ODGA 1UAPA 4E0FA 2D3LA 2GJPA 3DWPA 5F2DA 3VR5A 5M5WB 3LX0A 5FLXL 3QTCA 1EOTA 3A8IE 1ET9A 4F8MA 2JGUA 3BC9A 4FXDA 4O4LA 5CC4A 3JALB 2HHHB 1DOKA 4JMQA 4K0KB 2PUSA 1LO5D 2QILA 2Q0AA 3L9AX 1FD7D 2QE7A 4C3IB 3PUWA 3HKBA 4K6DA 5EZYB 4JYAB 5I6YA 4UCSA 3NSWA 1I8DA 3GVJA 4R9WA 1STGA 5IYZA 2BE5D 4CS2A 3BHPA 2HEPA 5CR3A 1KDAA 3CQZB 1S5CD 3A2FA 4N9TA 4IFDH 1HZEA 5BN5A 4M8AA 4KY5A 3S14B 3E5SA 1LTTD 3GQBA 1EYDA 3W3AA 1TIID 4ME5A 5I9PA 1SKVA 3RZOB 1KLGD 1SE4A 1PTOH 5T1IA 1OXTA 2ZXRA 3J81E 4R8IA 3JARA 5D3DA 3FRPB 1EY0A 5EKLA 5G3LD 4F6RB 3QIAA 5LL6S 2WSSA 4JK1C 2NN6G 2TMPA 1O78A 1D5ZC 1HTPA 1TUBB 4FYDA 3OSOA 4XT3B 5HKKA 1EEFD 5KNLA 1F2ZA 1KMIZ 1WCMB 5DN6A 4TSFA 2RSOA 3QB3A 2B8FA 3J80E 4CH6A 3TP5A 1GUSA 4KJNA 2F0KA 2D2CC 1S5JA 1E2WA 4HCEA 4PMWA 3AMUA 4UCUA 5KNCA 4KY6A 2VWJA 3A56A 1QWYA 2EYOA 3GP7A 1TWHB 2YYZA 3H6MA 1QOHA 2A74C