2VBSA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with po4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
132
structure length
132
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 25
structure length 132
sequence length 132
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbsA01
3CTAA 5FO0A 5TRDA 5A89A 2OYNA 1MRZA 2VBVA 1T6ZA 2P3MA 4UZFA 4UZEA 1P4MA 1NB9A 3OP1A 2X0KA 1T6YA 1N07A 2VBSA 1N06A 1NB0A 1T6XA 3BNWA 5A8AA 1N05A 1N08A 1Q9SA 5FNZA 3ZUGA 2VBUA 1S4MA 2VBTA 5A88A 5FO1A 2I1LA
chains in the Genus database with same CATH superfamily
3ZBUA 4E0FA 2NPFA 4X7EA 3Q3AA 1QUFA 4YAOA 4B3GA 3CCQB 2YWEA 4FK8A 1HVXA 5DS0A 1WP6A 1QGAA 4YELA 3DDYA 4BPRA 4WQMA 5DSZA 3WY9A 1VLYA 4G1BA 1Q9SA 2ZXIA 2Q6LA 4TMWA 2PE3A 3MMPA 2VBTA 3P27A 2C77A 2D3NA 5TV2A 3CC4B 1VQ6B 3OW7A 2YWFA 5LMZA 4WWVA 2ZBVA 3W5VA 4II2A 2DYIA 4H9GA 3WNBA 1PJ7A 1T5EA 2B5OA 3BY2A 3CTAA 4XKVA 5L46A 1TTTA 4L8JA 2W6JA 2V7WA 3OKXA 2ZL6A 5CDFA 4Z4SA 1G7CA 1WU8A 3ASTA 2DY1A 2QDXA 3Q6RA 1ZM2A 2WPDA 1UD3A 1U2RA 4WZKA 1PKVA 3A35A 1N06A 2XNJA 1GVHA 4XQFA 2OK8A 4XN0A 3ASQA 1E3XA 1V5VA 2PMDA 4QFMA 2X85A 2F4NA 2R6HA 4OOXA 4RDJA 5A88A 3KL9A 1KK2A 1KJZA 1WOOA 1PJ6A 1WOSA 3BC9A 2XZPA 1W34A 4RDLA 1UD4A 4X06A 1MABA 2RC5A 1G7TA 1FNMA 1T6ZA 2GK7A 2BVNA 4LBYA 2ZTNA 1TVCA 1QGZA 3OP1A 4RJLA 4RPDA 1K9MD 3ZBTA 3ZIAA 3OEHA 1T6XA 5FL7A 4ZV4A 5A8AA 1YIJB 2B7BA 2CK3A 3JQRA 1KTVA 4B44A 2VBUA 3QSYA 3VNUA 3AVWA 1G7RA 1UD6A 1PJ5A 4ASUA 5KW9A 3MCAA 2VZLA 2WJYA 1VQKB 2VNJA 3ES9A 2V4DA 4U9UA 4XLHA 1OGIA 3LVBA 3QFSA 4TSFA 4WZEA 3VO2A 5KNLA 3CCMB 3V76A 1SKQA 1AMOA 1OB5A 3OFNA 4QVAA 4C0SA 1GO2A 4XLCA 1DDIA 1Q82D 1I18A 1B23P 2V7XA 2JIZA 1I8DA 3CXCB 4ZGNB 2BV3A 2X8KA 1QVFB 5AN9A 3ZUGA 4Z4VA 4G7WA 4M53A 4NBSA 1YJNB 4Y9UA 4P22A 2BM0A 1W0JA 3MHPA 1CNFA 3VO1A 2GREA 3A3GA 2DIEA 4LC0A 1BQEA 4DQKA 2FX3A 3AVTA 2BPOA 1RQRA 2V7TA 1I7PA 3A8JA 4N3GA 4QV2A 1NB9A 4YAUA 4XMYA 2EFGA 2C2WA 1N07A 1NB0A 4X7FA 1UMKA 1JA1A 1UD8A 3ASPA 2WR8A 4OOVA 4Z1MA 1QG0A 1N08A 3AVXA 1XE1A 5GV7A 4AF6A 4ZCIA 2OBTA 2V31A 3WYAA 4J0QA 3PUMA 4M4SA 4P6YA 4RD6A 3ONUA 2DCUA 2DOGA 3PENA 4NNJA 4XLAA 1QVGB 1GR1A 2V7UA 2XNCA 3I1FA 1VQ4B 1ELOA 3LO8A 1KRHA 3JQPA 2CW5A 2YWGA 2HDNB 4TMVA 2D9RA 4YALA 5A89A 3U6BA 2VJJA 1N8RD 4HE6A 1KC8D 1K8AD 4XR6A 3OW2B 1E63A 3A8IA 4FXUA 4XONA 1XFOA 1P4MA 1VQ7B 2CNDA 1D8TA 3BCDA 1NRKA 3H94A 4RD1A 3WNDA 2YWHA 4Z4ZA 2DEUA 4P2NA 2ZL7A 3CRZA 1NBMA 4PABA 3VNVA 1BLIA 2C4TA 4QVJA 1WORA 1J9ZA 3W2GA 1YITB 1S4MA 4P9SA 1EP2B 3CD6B 1IJEA 3ISXA 4G1VA 4X7DA 2X3UA 2E1RA 1OHHA 3PUNA 1WTHD 1YJWB 1FRQA 2B7CA 4YHBA 3ASRA 4WZLA 4ROXA 1EP3B 2WZNA 3G6EB 1E79A 1FDRA 1EP1B 4HIZA 1Y0RA 2HCJB 4UAJA 3CP2A 1QFJA 3A1PA 2XZOA 4RPBA 3ASSA 1W9XA 1YI2B 1CNEA 4Q7JB 4M0LA 1E43A 2QE7A 1EFUA 3BNWA 1N05A 1N0UA 3OZVA 3PA2A 5THXA 3Q6QA 4LBVA 2XZLA 3H9NA 4AVZA 1DDGA 2D3LA 2X6YA 1WSVA 3ZZUA 1IHMA 2J7KA 4TMTA 5IYNA 1S0UA 5F4OA 4B43A 4C43A 2QMUA 1SKYB 3BY1A 4B47A 2DETA 4UZFA 1RQPA 5IYQA 2V7QA 4R71A 1IJFA 4IW3B 3R6KA 4P12A 3VR6A 3W2EA 4YAWA 3AGPA 1FNCA 3I55B 4MYTA 2XNDA 1FRNA 3WNCA 2VNHA 2XOKA 3ZZ0A 1G7SA 4XLFA 3CC7B 2BM1A 4B48A 4Z4WA 4YXWA 4P25A 4M1KA 4XNFA 4YAFA 3CMMA 4M2LA 4XD7A 5F4JA 1NJID 2CBXA 1YLOA 4TMZA 3GSIA 3FKSA 3OE7A 2ZTGA 2QEXB 1E62A 1VHEA 2XEXA 2JJ1A 1BPLA 4RD0A 2F1LA 4XL9A 1VJSA 3NE5B 4Z4UA 4TN1A 1EWYA 5H59A 2DERA 3GVKA 4TKOB 2ZZQA 1UD2A 4ACAA 3CC2B 4OPVA 2JN9A 5IK2A 3WXMA 2ZZGA 1DARA 2VJIA 1VQPB 4ZCLA 3QFTA 5IYWA 3OZUA 3QFCA 1BMFA 2PLFA 4PC7A 5JBQA 1F20A 1ZM3A 5TR9A 4PAAA 3FPPA 2BGJA 2ZZEA 3FPKA 1JJ2B 1E1QA 4PC6A 1R5NA 1IB0A 1KK1A 1OB0A 5IYPA 4QUZA 4DK1A 1XB2A 4EH1A 1DG1G 3CCSB 1ZM9A 3W2FA 3W2HA 2GQFA 1H8HA 1CQXA 1AIPA 2NV4A 1KZLA 2BMWA 4G5GA 2AHOA 4ZCMA 5FIUA 2OBRA 3B8HA 3W2IA 4P26A 4DK0A 3AVYA 1H85A 2WZPP 3Q39A 4YEJA 3VMFA 1BX1A 2WJVA 1R5BA 1YX2A 3SLDA 2WSSA 3CP8A 5HKKA 2X53S 3WBKA 1Q86D 4F7DA 3B82A 4X0CA 3I56B 4XOPA 2BSAA 2RC6A 2VBVA 4Y7CA 3GVLA 3PVDA 3CESA 4X7CA 5BSXA 1VQ8B 4ACBA 1VQ9B 2C5HA 2FVGA 4PC2A 3G05A 3U6KA 2Q6OA 2X0KA 1H42A 4X07A 2BF4A 4PC1A 2QGGA 4RCYA 4Z4TA 4DNRB 4JMQA 4MYUA 5HXBA 2OTJB 5J3OA 2W6IA 1QH0A 1TLLA 3T53B 1K28D 2E1BA 5DN6A 2VYQA 2JDIA 1TUIA 2ZZFA 4OPSA 4DQLA 2I1LA 1W87A 1NDHA 1WSRA 4N3NA 1VF7A 1M1KD 1EFRA 3QE2A 1QUEA 4P3IA 3CCUB 2OYNA 4G6IA 3OZWA 5TY0A 4DNTB 4RM0A 3CCJB 4XOTA 3SKBA 3PA1A 2XGJA 3AVUA 2C4UA 2C5BA 2CF4A 3CCRB 4II3A 2CRVA 1FX0A 1SM4A 1KK3A 4XN3A 1Y0YA 2VBSA 2F1MA 3SJPA 2ZBUA 3T51B 2QTZA 2WYRA 4G7XA 5HZAA 4GQNA 3LQ6A 1E3ZA 1VQMB 1FNDA 1QGYA 2F43A 4TMXA 4B4DA 1W35A 4UZUA 3WBJA 1ZUNB 2BGIA 3P26A 3BH4A 1WOPA 1V0EA 1FNBA 3HAGA 4Y9RA 3G4SB 2D74A 3T56B 3LQEA 4AC9A 3D26A 1MRZA 3Q38A 1QX4A 1VLOA 2VNIA 2C78A 1N0VC 4QHYA 4UZEA 1VQOB 3GIRA 2ZL5A 1VQLB 1Q7YD 3CCLB 1GAWA 2R9VA 3KEWA 5BSYA 3CPXA 3OJXA 4K1XA 1GAQA 3ZC3A 3G71B 4RDKA 4P3YA 1W2BB 4X8IA 5E6TA 4XKWA 3CB4A 3WQZA 3W5UA 1BX0A 1YJ9B 1H8EA 3ZZTA 5GV8A 3CCVB 1VQ5B 1V0FA 4Z4RA 3ONYA 3SEJA 2OBSA 4WZTA 2HLDA 4RD4A 5HZBA 5FO0A 2Z6BD 3U2QA 5TRDA 1F60A 1HA3A 2ZITA 4RLZA 2GK6A 1VQNB 2X6XA 3SLNA 3R6JA 3CCEB 2LZJA 1D1NA 4NCNA 1JB9A 2PIAA 1OB2A 1KMHA 3JU4A 4KKSA 4OPOA 3CPWB 2KVOA 2GJKA 2M5SA 4PGOA 4B3XA 2GJPA 5J35A 4HE5A 1BJKA 3OJWA 1YHQB 4XLEA 4B3FX 3CW2A 3V7AA 2V7VA 2VNKA 2ZXHA 5KSWB 2OTLB 2JJ2A 3QFRA 2BN4A 3BCFA 1KD1D 4OOSA 1Q81D 2X6WA 4ZGQB 2GPJA 3AVVA 1XQBA 1EFTA 2P3MA 1K73D 4RD2A 1A8PA 3OOCA 2EIXA 4CQJA 1COWA 4PC3A 1KQSB 2Q6KA 1M90D 4LBZA 1GJRA 1OGJA 3AGQA 4RCZA 5H5JA 3BQJA 1JNYA 3SJZA 3GVJA 3A3BA 3GQBA 3CMAB 3JQQA 5F4MA 5FO1A 4Z4YA 3B78A 1W0KA 3ZPNA 4P6VF 1EXMA 3E20A 4KKUA 2QTLA 4LBWA 2QN6A 1EFCA 4XM3A 1HZEA 1ZM4A 1E64A 4X05A 4AF7A 1JA0A 1UD5A 1QFYA 1R5OA 3W5HA 5IYRA 4FWTA 3A8KA 2OK7A 3LNNA 4RD3A 3FJOA 1T6YA 2GJRA 4FN5A 4KKTA 4TT3A 5EMNA 5FA6A 1S72B 3OAAA 1QFZA 2HMAA 1E1RA 1VHOA 1WPCA 5FNZA 5B6IA 2CC2A 3OPOA 3RY8A 3OEEA 1B2RA 1WDTA 3E1YE 4P1VA 2QA4B 2Q6IA 3J81k 1KK0A 3CMEB 4OP7A 1D2EA 4XORA
chains in the Genus database with same CATH topology
3CTAA 5FO0A 5TRDA 5A89A 2OYNA 1MRZA 2VBVA 1T6ZA 2P3MA 4UZFA 4UZEA 1P4MA 1NB9A 3OP1A 2X0KA 1T6YA 1N07A 2VBSA 1N06A 1NB0A 1T6XA 3BNWA 5A8AA 1N05A 1N08A 1Q9SA 5FNZA 3ZUGA 2VBUA 1S4MA 2VBTA 5A88A 5FO1A 2I1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTA A;  5FO0 A;  5TRD A;  5A89 A;  2OYN A;  1MRZ A;  2VBV A;  1T6Z A;  2P3M A;  4UZF A;  4UZE A;  1P4M A;  1NB9 A;  3OP1 A;  2X0K A;  1T6Y A;  1N07 A;  2VBS A;  1N06 A;  1NB0 A;  1T6X A;  3BNW A;  5A8A A;  1N05 A;  1N08 A;  1Q9S A;  5FNZ A;  3ZUG A;  2VBU A;  1S4M A;  2VBT A;  5A88 A;  5FO1 A;  2I1L A; 
#chains in the Genus database with same CATH topology
 3ZBU A;  4E0F A;  2NPF A;  4X7E A;  3Q3A A;  1QUF A;  4YAO A;  4B3G A;  3CCQ B;  2YWE A;  4FK8 A;  1HVX A;  5DS0 A;  1WP6 A;  1QGA A;  4YEL A;  3DDY A;  4BPR A;  4WQM A;  5DSZ A;  3WY9 A;  1VLY A;  4G1B A;  1Q9S A;  2ZXI A;  2Q6L A;  4TMW A;  2PE3 A;  3MMP A;  2VBT A;  3P27 A;  2C77 A;  2D3N A;  5TV2 A;  3CC4 B;  1VQ6 B;  3OW7 A;  2YWF A;  5LMZ A;  4WWV A;  2ZBV A;  3W5V A;  4II2 A;  2DYI A;  4H9G A;  3WNB A;  1PJ7 A;  1T5E A;  2B5O A;  3BY2 A;  3CTA A;  4XKV A;  5L46 A;  1TTT A;  4L8J A;  2W6J A;  2V7W A;  3OKX A;  2ZL6 A;  5CDF A;  4Z4S A;  1G7C A;  1WU8 A;  3AST A;  2DY1 A;  2QDX A;  3Q6R A;  1ZM2 A;  2WPD A;  1UD3 A;  1U2R A;  4WZK A;  1PKV A;  3A35 A;  1N06 A;  2XNJ A;  1GVH A;  4XQF A;  2OK8 A;  4XN0 A;  3ASQ A;  1E3X A;  1V5V A;  2PMD A;  4QFM A;  2X85 A;  2F4N A;  2R6H A;  4OOX A;  4RDJ A;  5A88 A;  3KL9 A;  1KK2 A;  1KJZ A;  1WOO A;  1PJ6 A;  1WOS A;  3BC9 A;  2XZP A;  1W34 A;  4RDL A;  1UD4 A;  4X06 A;  1MAB A;  2RC5 A;  1G7T A;  1FNM A;  1T6Z A;  2GK7 A;  2BVN A;  4LBY A;  2ZTN A;  1TVC A;  1QGZ A;  3OP1 A;  4RJL A;  4RPD A;  1K9M D;  3ZBT A;  3ZIA A;  3OEH A;  1T6X A;  5FL7 A;  4ZV4 A;  5A8A A;  1YIJ B;  2B7B A;  2CK3 A;  3JQR A;  1KTV A;  4B44 A;  2VBU A;  3QSY A;  3VNU A;  3AVW A;  1G7R A;  1UD6 A;  1PJ5 A;  4ASU A;  5KW9 A;  3MCA A;  2VZL A;  2WJY A;  1VQK B;  2VNJ A;  3ES9 A;  2V4D A;  4U9U A;  4XLH A;  1OGI A;  3LVB A;  3QFS A;  4TSF A;  4WZE A;  3VO2 A;  5KNL A;  3CCM B;  3V76 A;  1SKQ A;  1AMO A;  1OB5 A;  3OFN A;  4QVA A;  4C0S A;  1GO2 A;  4XLC A;  1DDI A;  1Q82 D;  1I18 A;  1B23 P;  2V7X A;  2JIZ A;  1I8D A;  3CXC B;  4ZGN B;  2BV3 A;  2X8K A;  1QVF B;  5AN9 A;  3ZUG A;  4Z4V A;  4G7W A;  4M53 A;  4NBS A;  1YJN B;  4Y9U A;  4P22 A;  2BM0 A;  1W0J A;  3MHP A;  1CNF A;  3VO1 A;  2GRE A;  3A3G A;  2DIE A;  4LC0 A;  1BQE A;  4DQK A;  2FX3 A;  3AVT A;  2BPO A;  1RQR A;  2V7T A;  1I7P A;  3A8J A;  4N3G A;  4QV2 A;  1NB9 A;  4YAU A;  4XMY A;  2EFG A;  2C2W A;  1N07 A;  1NB0 A;  4X7F A;  1UMK A;  1JA1 A;  1UD8 A;  3ASP A;  2WR8 A;  4OOV A;  4Z1M A;  1QG0 A;  1N08 A;  3AVX A;  1XE1 A;  5GV7 A;  4AF6 A;  4ZCI A;  2OBT A;  2V31 A;  3WYA A;  4J0Q A;  3PUM A;  4M4S A;  4P6Y A;  4RD6 A;  3ONU A;  2DCU A;  2DOG A;  3PEN A;  4NNJ A;  4XLA A;  1QVG B;  1GR1 A;  2V7U A;  2XNC A;  3I1F A;  1VQ4 B;  1ELO A;  3LO8 A;  1KRH A;  3JQP A;  2CW5 A;  2YWG A;  2HDN B;  4TMV A;  2D9R A;  4YAL A;  5A89 A;  3U6B A;  2VJJ A;  1N8R D;  4HE6 A;  1KC8 D;  1K8A D;  4XR6 A;  3OW2 B;  1E63 A;  3A8I A;  4FXU A;  4XON A;  1XFO A;  1P4M A;  1VQ7 B;  2CND A;  1D8T A;  3BCD A;  1NRK A;  3H94 A;  4RD1 A;  3WND A;  2YWH A;  4Z4Z A;  2DEU A;  4P2N A;  2ZL7 A;  3CRZ A;  1NBM A;  4PAB A;  3VNV A;  1BLI A;  2C4T A;  4QVJ A;  1WOR A;  1J9Z A;  3W2G A;  1YIT B;  1S4M A;  4P9S A;  1EP2 B;  3CD6 B;  1IJE A;  3ISX A;  4G1V A;  4X7D A;  2X3U A;  2E1R A;  1OHH A;  3PUN A;  1WTH D;  1YJW B;  1FRQ A;  2B7C A;  4YHB A;  3ASR A;  4WZL A;  4ROX A;  1EP3 B;  2WZN A;  3G6E B;  1E79 A;  1FDR A;  1EP1 B;  4HIZ A;  1Y0R A;  2HCJ B;  4UAJ A;  3CP2 A;  1QFJ A;  3A1P A;  2XZO A;  4RPB A;  3ASS A;  1W9X A;  1YI2 B;  1CNE A;  4Q7J B;  4M0L A;  1E43 A;  2QE7 A;  1EFU A;  3BNW A;  1N05 A;  1N0U A;  3OZV A;  3PA2 A;  5THX A;  3Q6Q A;  4LBV A;  2XZL A;  3H9N A;  4AVZ A;  1DDG A;  2D3L A;  2X6Y A;  1WSV A;  3ZZU A;  1IHM A;  2J7K A;  4TMT A;  5IYN A;  1S0U A;  5F4O A;  4B43 A;  4C43 A;  2QMU A;  1SKY B;  3BY1 A;  4B47 A;  2DET A;  4UZF A;  1RQP A;  5IYQ A;  2V7Q A;  4R71 A;  1IJF A;  4IW3 B;  3R6K A;  4P12 A;  3VR6 A;  3W2E A;  4YAW A;  3AGP A;  1FNC A;  3I55 B;  4MYT A;  2XND A;  1FRN A;  3WNC A;  2VNH A;  2XOK A;  3ZZ0 A;  1G7S A;  4XLF A;  3CC7 B;  2BM1 A;  4B48 A;  4Z4W A;  4YXW A;  4P25 A;  4M1K A;  4XNF A;  4YAF A;  3CMM A;  4M2L A;  4XD7 A;  5F4J A;  1NJI D;  2CBX A;  1YLO A;  4TMZ A;  3GSI A;  3FKS A;  3OE7 A;  2ZTG A;  2QEX B;  1E62 A;  1VHE A;  2XEX A;  2JJ1 A;  1BPL A;  4RD0 A;  2F1L A;  4XL9 A;  1VJS A;  3NE5 B;  4Z4U A;  4TN1 A;  1EWY A;  5H59 A;  2DER A;  3GVK A;  4TKO B;  2ZZQ A;  1UD2 A;  4ACA A;  3CC2 B;  4OPV A;  2JN9 A;  5IK2 A;  3WXM A;  2ZZG A;  1DAR A;  2VJI A;  1VQP B;  4ZCL A;  3QFT A;  5IYW A;  3OZU A;  3QFC A;  1BMF A;  2PLF A;  4PC7 A;  5JBQ A;  1F20 A;  1ZM3 A;  5TR9 A;  4PAA A;  3FPP A;  2BGJ A;  2ZZE A;  3FPK A;  1JJ2 B;  1E1Q A;  4PC6 A;  1R5N A;  1IB0 A;  1KK1 A;  1OB0 A;  5IYP A;  4QUZ A;  4DK1 A;  1XB2 A;  4EH1 A;  1DG1 G;  3CCS B;  1ZM9 A;  3W2F A;  3W2H A;  2GQF A;  1H8H A;  1CQX A;  1AIP A;  2NV4 A;  1KZL A;  2BMW A;  4G5G A;  2AHO A;  4ZCM A;  5FIU A;  2OBR A;  3B8H A;  3W2I A;  4P26 A;  4DK0 A;  3AVY A;  1H85 A;  2WZP P;  3Q39 A;  4YEJ A;  3VMF A;  1BX1 A;  2WJV A;  1R5B A;  1YX2 A;  3SLD A;  2WSS A;  3CP8 A;  5HKK A;  2X53 S;  3WBK A;  1Q86 D;  4F7D A;  3B82 A;  4X0C A;  3I56 B;  4XOP A;  2BSA A;  2RC6 A;  2VBV A;  4Y7C A;  3GVL A;  3PVD A;  3CES A;  4X7C A;  5BSX A;  1VQ8 B;  4ACB A;  1VQ9 B;  2C5H A;  2FVG A;  4PC2 A;  3G05 A;  3U6K A;  2Q6O A;  2X0K A;  1H42 A;  4X07 A;  2BF4 A;  4PC1 A;  2QGG A;  4RCY A;  4Z4T A;  4DNR B;  4JMQ A;  4MYU A;  5HXB A;  2OTJ B;  5J3O A;  2W6I A;  1QH0 A;  1TLL A;  3T53 B;  1K28 D;  2E1B A;  5DN6 A;  2VYQ A;  2JDI A;  1TUI A;  2ZZF A;  4OPS A;  4DQL A;  2I1L A;  1W87 A;  1NDH A;  1WSR A;  4N3N A;  1VF7 A;  1M1K D;  1EFR A;  3QE2 A;  1QUE A;  4P3I A;  3CCU B;  2OYN A;  4G6I A;  3OZW A;  5TY0 A;  4DNT B;  4RM0 A;  3CCJ B;  4XOT A;  3SKB A;  3PA1 A;  2XGJ A;  3AVU A;  2C4U A;  2C5B A;  2CF4 A;  3CCR B;  4II3 A;  2CRV A;  1FX0 A;  1SM4 A;  1KK3 A;  4XN3 A;  1Y0Y A;  2VBS A;  2F1M A;  3SJP A;  2ZBU A;  3T51 B;  2QTZ A;  2WYR A;  4G7X A;  5HZA A;  4GQN A;  3LQ6 A;  1E3Z A;  1VQM B;  1FND A;  1QGY A;  2F43 A;  4TMX A;  4B4D A;  1W35 A;  4UZU A;  3WBJ A;  1ZUN B;  2BGI A;  3P26 A;  3BH4 A;  1WOP A;  1V0E A;  1FNB A;  3HAG A;  4Y9R A;  3G4S B;  2D74 A;  3T56 B;  3LQE A;  4AC9 A;  3D26 A;  1MRZ A;  3Q38 A;  1QX4 A;  1VLO A;  2VNI A;  2C78 A;  1N0V C;  4QHY A;  4UZE A;  1VQO B;  3GIR A;  2ZL5 A;  1VQL B;  1Q7Y D;  3CCL B;  1GAW A;  2R9V A;  3KEW A;  5BSY A;  3CPX A;  3OJX A;  4K1X A;  1GAQ A;  3ZC3 A;  3G71 B;  4RDK A;  4P3Y A;  1W2B B;  4X8I A;  5E6T A;  4XKW A;  3CB4 A;  3WQZ A;  3W5U A;  1BX0 A;  1YJ9 B;  1H8E A;  3ZZT A;  5GV8 A;  3CCV B;  1VQ5 B;  1V0F A;  4Z4R A;  3ONY A;  3SEJ A;  2OBS A;  4WZT A;  2HLD A;  4RD4 A;  5HZB A;  5FO0 A;  2Z6B D;  3U2Q A;  5TRD A;  1F60 A;  1HA3 A;  2ZIT A;  4RLZ A;  2GK6 A;  1VQN B;  2X6X A;  3SLN A;  3R6J A;  3CCE B;  2LZJ A;  1D1N A;  4NCN A;  1JB9 A;  2PIA A;  1OB2 A;  1KMH A;  3JU4 A;  4KKS A;  4OPO A;  3CPW B;  2KVO A;  2GJK A;  2M5S A;  4PGO A;  4B3X A;  2GJP A;  5J35 A;  4HE5 A;  1BJK A;  3OJW A;  1YHQ B;  4XLE A;  4B3F X;  3CW2 A;  3V7A A;  2V7V A;  2VNK A;  2ZXH A;  5KSW B;  2OTL B;  2JJ2 A;  3QFR A;  2BN4 A;  3BCF A;  1KD1 D;  4OOS A;  1Q81 D;  2X6W A;  4ZGQ B;  2GPJ A;  3AVV A;  1XQB A;  1EFT A;  2P3M A;  1K73 D;  4RD2 A;  1A8P A;  3OOC A;  2EIX A;  4CQJ A;  1COW A;  4PC3 A;  1KQS B;  2Q6K A;  1M90 D;  4LBZ A;  1GJR A;  1OGJ A;  3AGQ A;  4RCZ A;  5H5J A;  3BQJ A;  1JNY A;  3SJZ A;  3GVJ A;  3A3B A;  3GQB A;  3CMA B;  3JQQ A;  5F4M A;  5FO1 A;  4Z4Y A;  3B78 A;  1W0K A;  3ZPN A;  4P6V F;  1EXM A;  3E20 A;  4KKU A;  2QTL A;  4LBW A;  2QN6 A;  1EFC A;  4XM3 A;  1HZE A;  1ZM4 A;  1E64 A;  4X05 A;  4AF7 A;  1JA0 A;  1UD5 A;  1QFY A;  1R5O A;  3W5H A;  5IYR A;  4FWT A;  3A8K A;  2OK7 A;  3LNN A;  4RD3 A;  3FJO A;  1T6Y A;  2GJR A;  4FN5 A;  4KKT A;  4TT3 A;  5EMN A;  5FA6 A;  1S72 B;  3OAA A;  1QFZ A;  2HMA A;  1E1R A;  1VHO A;  1WPC A;  5FNZ A;  5B6I A;  2CC2 A;  3OPO A;  3RY8 A;  3OEE A;  1B2R A;  1WDT A;  3E1Y E;  4P1V A;  2QA4 B;  2Q6I A;  3J81 k;  1KK0 A;  3CME B;  4OP7 A;  1D2E A;  4XOR A; 
#chains in the Genus database with same CATH homology
 3CTA A;  5FO0 A;  5TRD A;  5A89 A;  2OYN A;  1MRZ A;  2VBV A;  1T6Z A;  2P3M A;  4UZF A;  4UZE A;  1P4M A;  1NB9 A;  3OP1 A;  2X0K A;  1T6Y A;  1N07 A;  2VBS A;  1N06 A;  1NB0 A;  1T6X A;  3BNW A;  5A8A A;  1N05 A;  1N08 A;  1Q9S A;  5FNZ A;  3ZUG A;  2VBU A;  1S4M A;  2VBT A;  5A88 A;  5FO1 A;  2I1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...