2VBSA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with po4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
132
structure length
132
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 25
structure length 132
sequence length 132
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbsA01
1NB0A 1P4MA 2X0KA 4UZFA 2VBVA 5FO1A 5FNZA 3CTAA 2I1LA 5A8AA 1T6YA 1S4MA 1T6ZA 2VBUA 1MRZA 3BNWA 1N05A 1N07A 2VBSA 3ZUGA 1NB9A 1T6XA 1N06A 2OYNA 5A88A 5A89A 3OP1A 1N08A 2VBTA 4UZEA 5FO0A 1Q9SA 2P3MA 5TRDA
chains in the Genus database with same CATH superfamily
4Z4SA 4FK8A 3CD6B 2GK7A 3LQ6A 4YALA 2FX3A 1ELOA 2JJ2A 3CTAA 1IJEA 2I1LA 2QN6A 1E1QA 3FJOA 1JB9A 2ZL7A 1TTTA 2RC5A 4ZCIA 3CC7B 3U2QA 5IYNA 4P3YA 1VLYA 2BPOA 5CDFA 2X6WA 1KZLA 5FL7A 4OPOA 5IK2A 2ZBVA 2X6YA 1QVGB 4QFMA 4G6IA 1GO2A 5FA6A 1UD6A 3OPOA 3FPPA 2R9VA 1QGAA 2XZPA 4RDLA 4TT3A 4XR6A 5TY0A 2X6XA 1Q82D 2DERA 2VNHA 1SM4A 4UZEA 1FRNA 4ACBA 1KQSB 1QGZA 4X7CA 4G5GA 3CCMB 1KK2A 1A8PA 1VF7A 4RCYA 4RLZA 2W6JA 2M5SA 1VQOB 2W6IA 1UD5A 1S4MA 1Y0YA 5L46A 3VNVA 1QH0A 1D2EA 2QTLA 2QE7A 3A8KA 1B2RA 1VQMB 3P26A 2D3NA 4M53A 4P26A 2OYNA 3MMPA 4WZLA 3R6JA 1COWA 3AGQA 3NE5B 2BMWA 2PIAA 2CK3A 5B6IA 1K73D 1KMHA 3AVXA 4UZUA 4ZCLA 2OTJB 2OBSA 4PC3A 4R71A 3QFRA 4EH1A 1FNMA 2X0KA 3ISXA 2E1BA 3ZC3A 2F43A 1PJ6A 3RY8A 4XLEA 1K9MD 1TLLA 1WOPA 1T6YA 2X3UA 4QUZA 4JMQA 1QGYA 1W87A 3Q3AA 3W2EA 5DSZA 4QVJA 3ASPA 2CBXA 4P12A 4RCZA 1N07A 4M2LA 1SKYB 1E1RA 4FWTA 4RD3A 4X7DA 3PA2A 3QFSA 2BV3A 2NPFA 1G7RA 3ASRA 3OZWA 4PABA 4OOVA 4LBZA 4X06A 2C78A 4G1BA 1EXMA 4GQNA 4Z4UA 1QFZA 4ACAA 3WNCA 2B7CA 2GJPA 3WY9A 2XNDA 3A1PA 4P25A 2DOGA 4XN0A 4Z4ZA 4MYTA 1UMKA 1DDIA 1GAQA 1E64A 1BJKA 3OW7A 1EFRA 3LVBA 3CCUB 2BM1A 3SJZA 4X0CA 1E3ZA 4XLFA 2VBUA 5HKKA 2D74A 4C43A 4IW3B 5J35A 3CPXA 3SKBA 2B7BA 4RD1A 2X85A 2YWHA 3CCRB 1RQPA 2C4UA 1R5OA 2C4TA 3H94A 3DDYA 1UD3A 1H85A 2ZXIA 1SKQA 1FNBA 1GAWA 1E62A 1TUIA 3ONUA 4FXUA 3OEHA 4X7EA 4Y9UA 5E6TA 5KNLA 2QTZA 1E3XA 1WSRA 4H9GA 3BY1A 1QFYA 1XQBA 1P4MA 1N0UA 4UZFA 2HCJB 3Q38A 3ASQA 1R5NA 1I7PA 1V0EA 3WBJA 4XNFA 1YJWB 1VJSA 3ZBUA 2ZZEA 4NNJA 5IYRA 1WDTA 3CCJB 2D3LA 3BC9A 1BPLA 4X7FA 4P6VF 3G05A 3AGPA 1EFTA 1AIPA 2XNCA 5F4OA 3W2GA 3PUNA 2GJKA 3CC4B 2V7UA 4ASUA 3WQZA 4P6YA 2BVNA 3GSIA 2HMAA 2BM0A 4AVZA 3V7AA 4XONA 4TMVA 2DCUA 4B43A 5IYPA 3CP2A 4YAWA 2WJYA 1M90D 4NCNA 4YEJA 1KK3A 1YLOA 2P3MA 1BX1A 5DN6A 1QVFB 2ZITA 1OGIA 3MHPA 4ZGQB 1W35A 3QFTA 4RM0A 4DNTB 4YXWA 3B8HA 3W5UA 2OTLB 4B3GA 3V76A 4TMZA 1WSVA 5BSXA 4PGOA 3JQRA 5FIUA 3ZUGA 1NB9A 3CMMA 2LZJA 4NBSA 1T6XA 4OPSA 4Y7CA 4ZCMA 1EFUA 4P9SA 5AN9A 5A88A 3CESA 4P22A 3CRZA 3U6BA 1H42A 2CW5A 5GV7A 3KL9A 1YI2B 2FVGA 2QMUA 2VZLA 4X8IA 3AVVA 1UD2A 4TMTA 1OB0A 3R6KA 4XLAA 2F1LA 1G7SA 1G7CA 2VNKA 3ZZUA 2WJVA 3JQPA 4XM3A 2OK8A 5FNZA 2XZOA 1H8EA 4Z1MA 3VMFA 3VR6A 3OEEA 2QA4B 3P27A 1CNFA 2WZPP 1MRZA 5IYQA 1N8RD 4F7DA 1W0KA 2HDNB 4RDKA 1WOOA 4G1VA 4Z4TA 1J9ZA 2DYIA 4Y9RA 4YELA 4B4DA 5A89A 2X53S 1KK1A 5JBQA 1YJNB 2V7XA 2XOKA 1HA3A 3Q6QA 3ES9A 1UD8A 1K8AD 1IHMA 1UD4A 3D26A 1QG0A 4LBVA 3WBKA 2YWGA 4HE6A 3CMEB 1QUEA 3U6KA 4II3A 3WXMA 3CMAB 4XORA 3FPKA 3OE7A 4ZGNB 5LMZA 2Q6IA 5TV2A 2F1MA 2WR8A 2GPJA 1M1KD 1B23P 1EFCA 5HZBA 3I56B 1OB5A 4UAJA 3T51B 1BLIA 2WSSA 1WORA 1JJ2B 2HLDA 3CXCB 1VQ5B 5BSYA 2BGIA 3T53B 1N08A 1VQPB 2DETA 5FO0A 4XOTA 4XL9A 5H59A 1PJ7A 4YAFA 2DEUA 4G7WA 4P3IA 3AVWA 1D1NA 4PC2A 2CRVA 2VNJA 3GIRA 3OJXA 4XMYA 1YJ9B 2DIEA 3CW2A 4OOSA 2WZNA 3B78A 2JJ1A 1H8HA 4TSFA 1YITB 2V31A 4RD0A 1S0UA 1VQ8B 3BNWA 1OGJA 2R6HA 3J81k 3ASSA 5GV8A 5TR9A 1AMOA 1DG1G 1EP3B 1CQXA 3ZZ0A 1VQ6B 2NV4A 2OK7A 1JNYA 1Q81D 3OZVA 3ZIAA 4X07A 1KD1D 3E1YE 3T56B 5TRDA 1E43A 4J0QA 4DNRB 4AF6A 3CCVB 1V5VA 1FNDA 2PMDA 3LO8A 3PENA 2XEXA 3GQBA 4RPBA 4AF7A 1YIJB 3W2FA 4RDJA 4DQKA 3H9NA 3ZZTA 5EMNA 2OBRA 2BN4A 4RD2A 3CC2B 2ZTNA 1JA0A 2QGGA 2VBSA 5H5JA 3Q39A 1YHQB 4B48A 1W34A 3BQJA 4PAAA 5F4JA 2BF4A 2PLFA 1Q7YD 1D8TA 3B82A 3I55B 4B44A 2JIZA 1E63A 2BGJA 1ZM2A 2C5BA 5KSWB 1OB2A 2ZZQA 4XKVA 1ZM4A 3PUMA 3BY2A 4Z4VA 4Z4WA 1XB2A 1I8DA 5DS0A 4RD6A 4P1VA 4HE5A 4ROXA 5HZAA 3CP8A 3QE2A 3WNDA 4FN5A 3CCSB 3W2IA 4WZTA 1WU8A 3GVJA 3CPWB 4YHBA 5F4MA 2C2WA 2OBTA 4DK1A 2AHOA 1F20A 1WPCA 1EP1B 4WQMA 2EFGA 2VBTA 2CNDA 3BCDA 4M1KA 1YX2A 1VQNB 1OHHA 4II2A 3SJPA 1VQ4B 3ONYA 3A3BA 3G6EB 1BMFA 4P2NA 4WZEA 4L8JA 3A8JA 2C5HA 3GVLA 2YWFA 1IJFA 2GQFA 3AVUA 3LQEA 4LBWA 1ZM9A 4B3XA 2ZL6A 1VQLB 1DARA 1N05A 3GVKA 3PA1A 2QEXB 2V7QA 4PC6A 2CC2A 3ZBTA 3G4SB 2Z6BD 2C77A 3W5HA 1QFJA 4XOPA 1WTHD 4TKOB 2V7WA 4RD4A 4N3NA 3ZPNA 1G7TA 2CF4A 2F4NA 3VO1A 2QDXA 1VQKB 4M4SA 2V7VA 3SLDA 1DDGA 5J3OA 2GJRA 2RC6A 1FDRA 1NRKA 1EWYA 3HAGA 1NB0A 4TN1A 5THXA 2VBVA 3CCLB 4KKUA 3OFNA 3CCEB 2Q6LA 3QFCA 3WYAA 1VHEA 2JDIA 1NJID 4PC1A 2Q6OA 3AVTA 4KKSA 1I18A 2E1RA 2ZBUA 4XLHA 1VQ7B 1QX4A 4YAOA 2GK6A 2GREA 1GR1A 4AC9A 2XNJA 1E79A 4OOXA 1WOSA 2VNIA 4XD7A 1U2RA 1EP2B 4N3GA 1GVHA 2X8KA 3BH4A 4LC0A 3QSYA 1ZUNB 1Q9SA 3G71B 4TMWA 2V4DA 1CNEA 4XKWA 2WPDA 4C0SA 4DQLA 1XE1A 3OZUA 1KJZA 1IB0A 1NBMA 1F60A 2VJIA 1S72B 4KKTA 1PJ5A 4WZKA 3Q6RA 3LNNA 4OPVA 3SEJA 2Q6KA 2PE3A 4G7XA 2J7KA 4LBYA 1ZM3A 2DY1A 3OP1A 3OJWA 1PKVA 2VYQA 4QHYA 1Q86D 1T5EA 3OAAA 1VLOA 1KC8D 4Z4RA 4XLCA 5HXBA 3OKXA 1KTVA 3JU4A 4QV2A 5FO1A 1FNCA 2VJJA 3OOCA 5A8AA 4B47A 4YAUA 3BCFA 1HZEA 1MABA 3CB4A 4X05A 1W2BB 1FX0A 4RPDA 2BSAA 4Z4YA 1K28D 1KK0A 1BQEA 4XN3A 3KEWA 2V7TA 3A35A 1VHOA 1N06A 1W9XA 4OP7A 3W5VA 2XZLA 4QVAA 4WWVA 3AVYA 2D9RA 3A3GA 2KVOA 1KRHA 3MCAA 1N0VC 4ZV4A 1V0FA 1HVXA 3JQQA 4K1XA 4CQJA 4E0FA 2XGJA 3OW2B 1JA1A 2EIXA 2WYRA 3E20A 3FKSA 1WP6A 2YWEA 4MYUA 3SLNA 4XQFA 2JN9A 5IYWA 1GJRA 1XFOA 3VNUA 1T6ZA 2ZZFA 2ZXHA 1R5BA 3CCQB 1NDHA 4RJLA 4B3FX 3ASTA 3A8IA 3VO2A 4U9UA 1BX0A 1FRQA 4BPRA 1Y0RA 4M0LA 4Q7JB 2ZTGA 3WNBA 3W2HA 1VQ9B 4PC7A 2B5OA 4DK0A 4HIZA 3PVDA 4TMXA 5KW9A 3I1FA 2ZL5A 1QUFA 1TVCA 1RQRA 2ZZGA 1W0JA
chains in the Genus database with same CATH topology
1NB0A 1P4MA 2X0KA 4UZFA 2VBVA 5FO1A 5FNZA 3CTAA 2I1LA 5A8AA 1T6YA 1S4MA 1T6ZA 2VBUA 1MRZA 3BNWA 1N05A 1N07A 2VBSA 3ZUGA 1NB9A 1T6XA 1N06A 2OYNA 5A88A 5A89A 3OP1A 1N08A 2VBTA 4UZEA 5FO0A 1Q9SA 2P3MA 5TRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB0 A;  1P4M A;  2X0K A;  4UZF A;  2VBV A;  5FO1 A;  5FNZ A;  3CTA A;  2I1L A;  5A8A A;  1T6Y A;  1S4M A;  1T6Z A;  2VBU A;  1MRZ A;  3BNW A;  1N05 A;  1N07 A;  2VBS A;  3ZUG A;  1NB9 A;  1T6X A;  1N06 A;  2OYN A;  5A88 A;  5A89 A;  3OP1 A;  1N08 A;  2VBT A;  4UZE A;  5FO0 A;  1Q9S A;  2P3M A;  5TRD A; 
#chains in the Genus database with same CATH topology
 4Z4S A;  4FK8 A;  3CD6 B;  2GK7 A;  3LQ6 A;  4YAL A;  2FX3 A;  1ELO A;  2JJ2 A;  3CTA A;  1IJE A;  2I1L A;  2QN6 A;  1E1Q A;  3FJO A;  1JB9 A;  2ZL7 A;  1TTT A;  2RC5 A;  4ZCI A;  3CC7 B;  3U2Q A;  5IYN A;  4P3Y A;  1VLY A;  2BPO A;  5CDF A;  2X6W A;  1KZL A;  5FL7 A;  4OPO A;  5IK2 A;  2ZBV A;  2X6Y A;  1QVG B;  4QFM A;  4G6I A;  1GO2 A;  5FA6 A;  1UD6 A;  3OPO A;  3FPP A;  2R9V A;  1QGA A;  2XZP A;  4RDL A;  4TT3 A;  4XR6 A;  5TY0 A;  2X6X A;  1Q82 D;  2DER A;  2VNH A;  1SM4 A;  4UZE A;  1FRN A;  4ACB A;  1KQS B;  1QGZ A;  4X7C A;  4G5G A;  3CCM B;  1KK2 A;  1A8P A;  1VF7 A;  4RCY A;  4RLZ A;  2W6J A;  2M5S A;  1VQO B;  2W6I A;  1UD5 A;  1S4M A;  1Y0Y A;  5L46 A;  3VNV A;  1QH0 A;  1D2E A;  2QTL A;  2QE7 A;  3A8K A;  1B2R A;  1VQM B;  3P26 A;  2D3N A;  4M53 A;  4P26 A;  2OYN A;  3MMP A;  4WZL A;  3R6J A;  1COW A;  3AGQ A;  3NE5 B;  2BMW A;  2PIA A;  2CK3 A;  5B6I A;  1K73 D;  1KMH A;  3AVX A;  4UZU A;  4ZCL A;  2OTJ B;  2OBS A;  4PC3 A;  4R71 A;  3QFR A;  4EH1 A;  1FNM A;  2X0K A;  3ISX A;  2E1B A;  3ZC3 A;  2F43 A;  1PJ6 A;  3RY8 A;  4XLE A;  1K9M D;  1TLL A;  1WOP A;  1T6Y A;  2X3U A;  4QUZ A;  4JMQ A;  1QGY A;  1W87 A;  3Q3A A;  3W2E A;  5DSZ A;  4QVJ A;  3ASP A;  2CBX A;  4P12 A;  4RCZ A;  1N07 A;  4M2L A;  1SKY B;  1E1R A;  4FWT A;  4RD3 A;  4X7D A;  3PA2 A;  3QFS A;  2BV3 A;  2NPF A;  1G7R A;  3ASR A;  3OZW A;  4PAB A;  4OOV A;  4LBZ A;  4X06 A;  2C78 A;  4G1B A;  1EXM A;  4GQN A;  4Z4U A;  1QFZ A;  4ACA A;  3WNC A;  2B7C A;  2GJP A;  3WY9 A;  2XND A;  3A1P A;  4P25 A;  2DOG A;  4XN0 A;  4Z4Z A;  4MYT A;  1UMK A;  1DDI A;  1GAQ A;  1E64 A;  1BJK A;  3OW7 A;  1EFR A;  3LVB A;  3CCU B;  2BM1 A;  3SJZ A;  4X0C A;  1E3Z A;  4XLF A;  2VBU A;  5HKK A;  2D74 A;  4C43 A;  4IW3 B;  5J35 A;  3CPX A;  3SKB A;  2B7B A;  4RD1 A;  2X85 A;  2YWH A;  3CCR B;  1RQP A;  2C4U A;  1R5O A;  2C4T A;  3H94 A;  3DDY A;  1UD3 A;  1H85 A;  2ZXI A;  1SKQ A;  1FNB A;  1GAW A;  1E62 A;  1TUI A;  3ONU A;  4FXU A;  3OEH A;  4X7E A;  4Y9U A;  5E6T A;  5KNL A;  2QTZ A;  1E3X A;  1WSR A;  4H9G A;  3BY1 A;  1QFY A;  1XQB A;  1P4M A;  1N0U A;  4UZF A;  2HCJ B;  3Q38 A;  3ASQ A;  1R5N A;  1I7P A;  1V0E A;  3WBJ A;  4XNF A;  1YJW B;  1VJS A;  3ZBU A;  2ZZE A;  4NNJ A;  5IYR A;  1WDT A;  3CCJ B;  2D3L A;  3BC9 A;  1BPL A;  4X7F A;  4P6V F;  3G05 A;  3AGP A;  1EFT A;  1AIP A;  2XNC A;  5F4O A;  3W2G A;  3PUN A;  2GJK A;  3CC4 B;  2V7U A;  4ASU A;  3WQZ A;  4P6Y A;  2BVN A;  3GSI A;  2HMA A;  2BM0 A;  4AVZ A;  3V7A A;  4XON A;  4TMV A;  2DCU A;  4B43 A;  5IYP A;  3CP2 A;  4YAW A;  2WJY A;  1M90 D;  4NCN A;  4YEJ A;  1KK3 A;  1YLO A;  2P3M A;  1BX1 A;  5DN6 A;  1QVF B;  2ZIT A;  1OGI A;  3MHP A;  4ZGQ B;  1W35 A;  3QFT A;  4RM0 A;  4DNT B;  4YXW A;  3B8H A;  3W5U A;  2OTL B;  4B3G A;  3V76 A;  4TMZ A;  1WSV A;  5BSX A;  4PGO A;  3JQR A;  5FIU A;  3ZUG A;  1NB9 A;  3CMM A;  2LZJ A;  4NBS A;  1T6X A;  4OPS A;  4Y7C A;  4ZCM A;  1EFU A;  4P9S A;  5AN9 A;  5A88 A;  3CES A;  4P22 A;  3CRZ A;  3U6B A;  1H42 A;  2CW5 A;  5GV7 A;  3KL9 A;  1YI2 B;  2FVG A;  2QMU A;  2VZL A;  4X8I A;  3AVV A;  1UD2 A;  4TMT A;  1OB0 A;  3R6K A;  4XLA A;  2F1L A;  1G7S A;  1G7C A;  2VNK A;  3ZZU A;  2WJV A;  3JQP A;  4XM3 A;  2OK8 A;  5FNZ A;  2XZO A;  1H8E A;  4Z1M A;  3VMF A;  3VR6 A;  3OEE A;  2QA4 B;  3P27 A;  1CNF A;  2WZP P;  1MRZ A;  5IYQ A;  1N8R D;  4F7D A;  1W0K A;  2HDN B;  4RDK A;  1WOO A;  4G1V A;  4Z4T A;  1J9Z A;  2DYI A;  4Y9R A;  4YEL A;  4B4D A;  5A89 A;  2X53 S;  1KK1 A;  5JBQ A;  1YJN B;  2V7X A;  2XOK A;  1HA3 A;  3Q6Q A;  3ES9 A;  1UD8 A;  1K8A D;  1IHM A;  1UD4 A;  3D26 A;  1QG0 A;  4LBV A;  3WBK A;  2YWG A;  4HE6 A;  3CME B;  1QUE A;  3U6K A;  4II3 A;  3WXM A;  3CMA B;  4XOR A;  3FPK A;  3OE7 A;  4ZGN B;  5LMZ A;  2Q6I A;  5TV2 A;  2F1M A;  2WR8 A;  2GPJ A;  1M1K D;  1B23 P;  1EFC A;  5HZB A;  3I56 B;  1OB5 A;  4UAJ A;  3T51 B;  1BLI A;  2WSS A;  1WOR A;  1JJ2 B;  2HLD A;  3CXC B;  1VQ5 B;  5BSY A;  2BGI A;  3T53 B;  1N08 A;  1VQP B;  2DET A;  5FO0 A;  4XOT A;  4XL9 A;  5H59 A;  1PJ7 A;  4YAF A;  2DEU A;  4G7W A;  4P3I A;  3AVW A;  1D1N A;  4PC2 A;  2CRV A;  2VNJ A;  3GIR A;  3OJX A;  4XMY A;  1YJ9 B;  2DIE A;  3CW2 A;  4OOS A;  2WZN A;  3B78 A;  2JJ1 A;  1H8H A;  4TSF A;  1YIT B;  2V31 A;  4RD0 A;  1S0U A;  1VQ8 B;  3BNW A;  1OGJ A;  2R6H A;  3J81 k;  3ASS A;  5GV8 A;  5TR9 A;  1AMO A;  1DG1 G;  1EP3 B;  1CQX A;  3ZZ0 A;  1VQ6 B;  2NV4 A;  2OK7 A;  1JNY A;  1Q81 D;  3OZV A;  3ZIA A;  4X07 A;  1KD1 D;  3E1Y E;  3T56 B;  5TRD A;  1E43 A;  4J0Q A;  4DNR B;  4AF6 A;  3CCV B;  1V5V A;  1FND A;  2PMD A;  3LO8 A;  3PEN A;  2XEX A;  3GQB A;  4RPB A;  4AF7 A;  1YIJ B;  3W2F A;  4RDJ A;  4DQK A;  3H9N A;  3ZZT A;  5EMN A;  2OBR A;  2BN4 A;  4RD2 A;  3CC2 B;  2ZTN A;  1JA0 A;  2QGG A;  2VBS A;  5H5J A;  3Q39 A;  1YHQ B;  4B48 A;  1W34 A;  3BQJ A;  4PAA A;  5F4J A;  2BF4 A;  2PLF A;  1Q7Y D;  1D8T A;  3B82 A;  3I55 B;  4B44 A;  2JIZ A;  1E63 A;  2BGJ A;  1ZM2 A;  2C5B A;  5KSW B;  1OB2 A;  2ZZQ A;  4XKV A;  1ZM4 A;  3PUM A;  3BY2 A;  4Z4V A;  4Z4W A;  1XB2 A;  1I8D A;  5DS0 A;  4RD6 A;  4P1V A;  4HE5 A;  4ROX A;  5HZA A;  3CP8 A;  3QE2 A;  3WND A;  4FN5 A;  3CCS B;  3W2I A;  4WZT A;  1WU8 A;  3GVJ A;  3CPW B;  4YHB A;  5F4M A;  2C2W A;  2OBT A;  4DK1 A;  2AHO A;  1F20 A;  1WPC A;  1EP1 B;  4WQM A;  2EFG A;  2VBT A;  2CND A;  3BCD A;  4M1K A;  1YX2 A;  1VQN B;  1OHH A;  4II2 A;  3SJP A;  1VQ4 B;  3ONY A;  3A3B A;  3G6E B;  1BMF A;  4P2N A;  4WZE A;  4L8J A;  3A8J A;  2C5H A;  3GVL A;  2YWF A;  1IJF A;  2GQF A;  3AVU A;  3LQE A;  4LBW A;  1ZM9 A;  4B3X A;  2ZL6 A;  1VQL B;  1DAR A;  1N05 A;  3GVK A;  3PA1 A;  2QEX B;  2V7Q A;  4PC6 A;  2CC2 A;  3ZBT A;  3G4S B;  2Z6B D;  2C77 A;  3W5H A;  1QFJ A;  4XOP A;  1WTH D;  4TKO B;  2V7W A;  4RD4 A;  4N3N A;  3ZPN A;  1G7T A;  2CF4 A;  2F4N A;  3VO1 A;  2QDX A;  1VQK B;  4M4S A;  2V7V A;  3SLD A;  1DDG A;  5J3O A;  2GJR A;  2RC6 A;  1FDR A;  1NRK A;  1EWY A;  3HAG A;  1NB0 A;  4TN1 A;  5THX A;  2VBV A;  3CCL B;  4KKU A;  3OFN A;  3CCE B;  2Q6L A;  3QFC A;  3WYA A;  1VHE A;  2JDI A;  1NJI D;  4PC1 A;  2Q6O A;  3AVT A;  4KKS A;  1I18 A;  2E1R A;  2ZBU A;  4XLH A;  1VQ7 B;  1QX4 A;  4YAO A;  2GK6 A;  2GRE A;  1GR1 A;  4AC9 A;  2XNJ A;  1E79 A;  4OOX A;  1WOS A;  2VNI A;  4XD7 A;  1U2R A;  1EP2 B;  4N3G A;  1GVH A;  2X8K A;  3BH4 A;  4LC0 A;  3QSY A;  1ZUN B;  1Q9S A;  3G71 B;  4TMW A;  2V4D A;  1CNE A;  4XKW A;  2WPD A;  4C0S A;  4DQL A;  1XE1 A;  3OZU A;  1KJZ A;  1IB0 A;  1NBM A;  1F60 A;  2VJI A;  1S72 B;  4KKT A;  1PJ5 A;  4WZK A;  3Q6R A;  3LNN A;  4OPV A;  3SEJ A;  2Q6K A;  2PE3 A;  4G7X A;  2J7K A;  4LBY A;  1ZM3 A;  2DY1 A;  3OP1 A;  3OJW A;  1PKV A;  2VYQ A;  4QHY A;  1Q86 D;  1T5E A;  3OAA A;  1VLO A;  1KC8 D;  4Z4R A;  4XLC A;  5HXB A;  3OKX A;  1KTV A;  3JU4 A;  4QV2 A;  5FO1 A;  1FNC A;  2VJJ A;  3OOC A;  5A8A A;  4B47 A;  4YAU A;  3BCF A;  1HZE A;  1MAB A;  3CB4 A;  4X05 A;  1W2B B;  1FX0 A;  4RPD A;  2BSA A;  4Z4Y A;  1K28 D;  1KK0 A;  1BQE A;  4XN3 A;  3KEW A;  2V7T A;  3A35 A;  1VHO A;  1N06 A;  1W9X A;  4OP7 A;  3W5V A;  2XZL A;  4QVA A;  4WWV A;  3AVY A;  2D9R A;  3A3G A;  2KVO A;  1KRH A;  3MCA A;  1N0V C;  4ZV4 A;  1V0F A;  1HVX A;  3JQQ A;  4K1X A;  4CQJ A;  4E0F A;  2XGJ A;  3OW2 B;  1JA1 A;  2EIX A;  2WYR A;  3E20 A;  3FKS A;  1WP6 A;  2YWE A;  4MYU A;  3SLN A;  4XQF A;  2JN9 A;  5IYW A;  1GJR A;  1XFO A;  3VNU A;  1T6Z A;  2ZZF A;  2ZXH A;  1R5B A;  3CCQ B;  1NDH A;  4RJL A;  4B3F X;  3AST A;  3A8I A;  3VO2 A;  4U9U A;  1BX0 A;  1FRQ A;  4BPR A;  1Y0R A;  4M0L A;  4Q7J B;  2ZTG A;  3WNB A;  3W2H A;  1VQ9 B;  4PC7 A;  2B5O A;  4DK0 A;  4HIZ A;  3PVD A;  4TMX A;  5KW9 A;  3I1F A;  2ZL5 A;  1QUF A;  1TVC A;  1RQR A;  2ZZG A;  1W0J A; 
#chains in the Genus database with same CATH homology
 1NB0 A;  1P4M A;  2X0K A;  4UZF A;  2VBV A;  5FO1 A;  5FNZ A;  3CTA A;  2I1L A;  5A8A A;  1T6Y A;  1S4M A;  1T6Z A;  2VBU A;  1MRZ A;  3BNW A;  1N05 A;  1N07 A;  2VBS A;  3ZUG A;  1NB9 A;  1T6X A;  1N06 A;  2OYN A;  5A88 A;  5A89 A;  3OP1 A;  1N08 A;  2VBT A;  4UZE A;  5FO0 A;  1Q9S A;  2P3M A;  5TRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...