2VBSA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with po4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
132
structure length
132
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOFLAVIN KINASE
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
total genus 25
structure length 132
sequence length 132
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbsA01
1N06A 1MRZA 5A8AA 5A88A 1T6ZA 1S4MA 1T6XA 1P4MA 2VBVA 3OP1A 5FNZA 1Q9SA 3BNWA 4UZFA 1N08A 1NB0A 1N07A 2VBUA 5A89A 3ZUGA 2I1LA 2VBSA 5FO1A 5FO0A 3CTAA 1T6YA 1NB9A 2X0KA 1N05A 2P3MA 4UZEA 2VBTA 2OYNA 5TRDA
chains in the Genus database with same CATH superfamily
1N0UA 1Q86D 2J7KA 4TSFA 3QFRA 3CMEB 1EFCA 3WBKA 3G05A 1EP1B 4DQLA 1W35A 3CP8A 3FPPA 2QEXB 4ASUA 4G6IA 2XZLA 2QTZA 3HAGA 2GK7A 1KC8D 3W2IA 1N07A 1W87A 1QFJA 3U2QA 2C4TA 3I1FA 1D8TA 2ZITA 1FNCA 1AIPA 1YITB 3JQRA 2BF4A 1BPLA 2JJ1A 2LZJA 3FKSA 1G7RA 4X0CA 4B3XA 5IYNA 3CMAB 1BX0A 3B82A 3MCAA 1R5OA 2ZZQA 3MHPA 4YELA 2GJRA 3VNUA 4NBSA 4G5GA 1KD1D 1I8DA 5THXA 1FNDA 3VO1A 1MRZA 2Q6KA 4XLFA 3CCEB 4F7DA 2ZZEA 4U9UA 3WNCA 1T6XA 4XR6A 3OJXA 3JU4A 4XLAA 1Q82D 1RQRA 3W2EA 1DARA 3ASQA 3CCVB 2QDXA 1NB0A 4LBZA 1Q81D 2QE7A 3V7AA 4RD3A 3W5VA 4ZV4A 1TTTA 3ZPNA 1R5NA 4Z4WA 4G1VA 1S0UA 2M5SA 1VLYA 4YEJA 1EP3B 4QHYA 3CCQB 1EWYA 1KQSB 4CQJA 4P1VA 1AMOA 3CPWB 1A8PA 1BMFA 4PC3A 3WNBA 2XNJA 2ZZGA 3OAAA 3BY2A 3ES9A 2WPDA 2V7TA 1KJZA 1PJ7A 2RC5A 3AVUA 4XMYA 3GVKA 3ASSA 4TMVA 4WZLA 2XZPA 1VQ9B 1P4MA 1YJWB 3E20A 1DG1G 2CK3A 3AVVA 1G7SA 4XOPA 1IB0A 2BGJA 3CCLB 3ZBUA 4DQKA 2VBSA 4X8IA 4ACAA 2GPJA 5DSZA 3P26A 3D26A 3OOCA 3VMFA 1KTVA 1S72B 2X0KA 1UD5A 2DY1A 3PA1A 4XNFA 5TRDA 4EH1A 3Q6QA 4XD7A 1GAWA 5AN9A 1Q7YD 3CCUB 3E1YE 4OPVA 5TY0A 2Q6IA 4E0FA 4GQNA 2JN9A 2WJVA 2XNDA 1YIJB 1BLIA 1KZLA 4FN5A 1VQ8B 1WSRA 2V31A 2Q6OA 4OOVA 4BPRA 1NBMA 5BSYA 1EFUA 1U2RA 2DYIA 2BM1A 4ZCLA 1EFTA 1ZM3A 2DIEA 1RQPA 3ZUGA 3CXCB 1EXMA 3R6JA 1JNYA 4XLCA 2E1RA 2YWGA 5H5JA 1F60A 3GSIA 1N05A 1BX1A 2P3MA 4B43A 3VO2A 5FIUA 4C0SA 5B6IA 3PA2A 3R6KA 5IYQA 1QG0A 2GQFA 3SJZA 3OW2B 1CQXA 1S4MA 4ZCMA 2WSSA 1CNEA 3A3BA 2F1MA 1COWA 1FNMA 5IYRA 1QGAA 2Q6LA 2V4DA 4KKUA 1VHOA 1IJFA 1DDGA 3BCFA 4M0LA 1GVHA 4XQFA 4II2A 1PJ6A 1B2RA 1WP6A 3OPOA 4YAWA 3I55B 2VBUA 2FX3A 2ZTGA 2OTJB 2B7BA 2NV4A 3ASPA 3T51B 4N3GA 2V7VA 2ZZFA 1T6YA 4B47A 1JB9A 4L8JA 2CNDA 2HLDA 2X3UA 4Y9UA 5J3OA 5HXBA 4PC7A 1QVGB 2V7XA 3A8KA 4Z4UA 3FJOA 2ZTNA 4Z4YA 3ZBTA 4H9GA 2D9RA 2QGGA 3G6EB 3BH4A 3LNNA 2BMWA 1K73D 3A35A 4OPSA 3H9NA 1UMKA 1VQNB 2D3NA 4RDKA 1DDIA 5IYWA 2W6IA 2B7CA 2BVNA 4RJLA 5FA6A 1XFOA 4X07A 3CC7B 1I7PA 2R6HA 2CW5A 2VJJA 2VNHA 2JJ2A 1XB2A 1T5EA 1G7CA 2PE3A 4X7EA 4AF6A 4X05A 2YWEA 3SLDA 4X7FA 1N0VC 1YJNB 4QUZA 1D2EA 4P26A 4PC2A 4RDLA 4XLEA 3CCMB 1PKVA 3PUNA 3W5HA 3W2HA 2GJPA 2BV3A 4K1XA 2C5HA 1N08A 2C5BA 4N3NA 1K9MD 1BJKA 1HZEA 5F4MA 4XLHA 1VQOB 3AGQA 2WJYA 3G4SB 3CTAA 3CMMA 4P3IA 4Z1MA 4HE5A 1WOSA 2HDNB 2CF4A 4TN1A 4DK0A 1M90D 2PLFA 2C78A 2EFGA 4DNRB 4R71A 2HCJB 3AVTA 3ZIAA 3AVXA 3OE7A 4YHBA 3ZZ0A 1G7TA 1NJID 2ZXHA 2ZXIA 3LO8A 2GK6A 5DN6A 3VNVA 4YAOA 4WWVA 3ZZUA 3KL9A 3OZWA 4KKTA 4ZCIA 1YLOA 4Y9RA 1UD6A 1WSVA 1VQ5B 1H8EA 4OP7A 3CCJB 2V7UA 1QGYA 2VNIA 1VF7A 4YALA 1JA0A 4II3A 4LBYA 1XQBA 4PABA 4XONA 1FDRA 4YAFA 1IJEA 5JBQA 4RD6A 2VBTA 1ZM4A 2DCUA 1WPCA 4RCZA 2XZOA 3ZZTA 1UD3A 2YWHA 4XKWA 1HVXA 2PIAA 4AVZA 1VQPB 2YWFA 1YX2A 5BSXA 2XNCA 4Z4ZA 3W2GA 4RD2A 1UD4A 2PMDA 2X8KA 2ZL7A 4FK8A 4MYTA 4RD0A 2AHOA 5J35A 3U6BA 5H59A 2QA4B 1QUEA 1B23P 4P2NA 3WQZA 3LQ6A 5F4JA 2OK8A 4UAJA 1QFYA 3A8JA 1TVCA 1UD2A 3CW2A 3CCSB 4X06A 4WZTA 1M1KD 4PC6A 4P3YA 1FX0A 1IHMA 3JQQA 1VJSA 2HMAA 4TT3A 2W6JA 2CRVA 1WU8A 2VYQA 3A3GA 4B4DA 4P9SA 4PC1A 2VNJA 3GVJA 4B3FX 3ZC3A 5HZBA 3QE2A 3A1PA 1ELOA 4Z4RA 3SJPA 1E63A 4ZGQB 1E3ZA 1HA3A 2WR8A 2ZL5A 3WBJA 4DK1A 2F1LA 3CESA 3CRZA 4PAAA 1Y0RA 1VQLB 2DEUA 1E3XA 2X53S 1TLLA 3FPKA 4XL9A 4G1BA 1GO2A 5GV8A 5LMZA 2I1LA 2ZBVA 4NNJA 3SLNA 3ASRA 3BCDA 2WZNA 2B5OA 2QN6A 3CB4A 4TMZA 2VZLA 1WTHD 3QFTA 2F4NA 1F20A 4TMWA 4Y7CA 1QX4A 3GVLA 2VNKA 1H85A 1KRHA 3NE5B 1JA1A 4RLZA 1KK3A 1MABA 1GR1A 4ACBA 5A8AA 4M53A 3CD6B 3Q6RA 1YJ9B 2VBVA 2VJIA 1XE1A 4OOXA 3T56B 3T53B 4P22A 3WY9A 2X6XA 5KNLA 1ZUNB 4XOTA 1E43A 3P27A 3CP2A 2V7WA 5L46A 1SM4A 4Z4TA 3WNDA 2C4UA 3Q39A 1D1NA 3QSYA 1H8HA 1ZM2A 3OEHA 1JJ2B 3QFCA 3Q38A 4OPOA 5E6TA 3B8HA 4IW3B 4MYUA 2D74A 2NPFA 4QFMA 4X7DA 1SKYB 4M2LA 4P25A 3CCRB 1N06A 3WXMA 1E62A 1TUIA 5A88A 1T6ZA 5IK2A 1Y0YA 3JQPA 2C2WA 1W34A 4WZEA 1EFRA 2DETA 2CBXA 1Q9SA 3BNWA 3ONUA 3SEJA 3GQBA 4P6VF 3BC9A 4RD4A 1VLOA 4P12A 3GIRA 4RD1A 3KEWA 4RM0A 5KW9A 5CDFA 4XKVA 3LVBA 2V7QA 4B44A 2CC2A 1NB9A 1WOPA 1QGZA 2X6YA 3ASTA 2OYNA 4HIZA 2JDIA 4DNTB 3AVYA 3PVDA 2BSAA 3MMPA 1QUFA 1SKQA 4TMXA 2R9VA 1K28D 4TKOB 4NCNA 1W9XA 4AC9A 1QFZA 3OKXA 3W2FA 2OTLB 1GJRA 3OP1A 1J9ZA 4RCYA 1I18A 5FL7A 2KVOA 4LBVA 4HE6A 2XEXA 1E64A 1QH0A 2C77A 2BGIA 4XN3A 4FWTA 1BQEA 1KK2A 4AF7A 1QVFB 1WOOA 3W5UA 2F43A 3B78A 4B48A 2DOGA 3CPXA 4G7WA 1OHHA 2WYRA 1H42A 3DDYA 4QVJA 3AVWA 4C43A 1K8AD 3OW7A 1KMHA 4M4SA 1E1RA 2QTLA 5IYPA 3BQJA 3OZVA 4YXWA 2BPOA 4JMQA 4B3GA 1OB0A 2JIZA 4XORA 4M1KA 4FXUA 5KSWB 1WORA 1OB2A 1E1QA 2FVGA 1NDHA 1FRQA 1N8RD 3PUMA 4UZFA 3J81k 1GAQA 2OBRA 4ROXA 1EP2B 1ZM9A 2EIXA 2X6WA 1CNFA 5A89A 1YI2B 3OEEA 4Z4SA 1VHEA 1VQMB 2X85A 5FO0A 5F4OA 3I56B 3WYAA 1KK1A 4J0QA 4TMTA 3QFSA 5HZAA 4YAUA 4KKSA 2WZPP 4UZEA 4LC0A 1FRNA 3RY8A 1UD8A 1VQKB 1V5VA 3SKBA 3Q3AA 1OGIA 4Z4VA 4LBWA 4G7XA 3ISXA 4XN0A 3CC2B 1W0KA 3A8IA 2QMUA 5TV2A 5FNZA 2ZBUA 1OGJA 2BM0A 3V76A 3U6KA 4OOSA 2GREA 2OBSA 1NRKA 2OK7A 5FO1A 2E1BA 5TR9A 5EMNA 4ZGNB 1VQ6B 5DS0A 4RPDA 4X7CA 3H94A 3ONYA 4RDJA 5GV7A 3OFNA 2DERA 4RPBA 2Z6BD 1V0EA 1PJ5A 4WZKA 3CC4B 1V0FA 2ZL6A 2XOKA 4WQMA 4XM3A 1WDTA 2XGJA 1YHQB 3AGPA 3BY1A 1FNBA 1OB5A 4UZUA 1W0JA 1VQ4B 2BN4A 2RC6A 3G71B 4P6YA 1E79A 4QVAA 4QV2A 1VQ7B 3LQEA 4Q7JB 1KK0A 2D3LA 4PGOA 1W2BB 1R5BA 3OZUA 3OJWA 3VR6A 2GJKA 5HKKA 2OBTA 3PENA
chains in the Genus database with same CATH topology
1N06A 1MRZA 5A8AA 5A88A 1T6ZA 1S4MA 1T6XA 1P4MA 2VBVA 3OP1A 5FNZA 1Q9SA 3BNWA 4UZFA 1N08A 1NB0A 1N07A 2VBUA 5A89A 3ZUGA 2I1LA 2VBSA 5FO1A 5FO0A 3CTAA 1T6YA 1NB9A 2X0KA 1N05A 2P3MA 4UZEA 2VBTA 2OYNA 5TRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N06 A;  1MRZ A;  5A8A A;  5A88 A;  1T6Z A;  1S4M A;  1T6X A;  1P4M A;  2VBV A;  3OP1 A;  5FNZ A;  1Q9S A;  3BNW A;  4UZF A;  1N08 A;  1NB0 A;  1N07 A;  2VBU A;  5A89 A;  3ZUG A;  2I1L A;  2VBS A;  5FO1 A;  5FO0 A;  3CTA A;  1T6Y A;  1NB9 A;  2X0K A;  1N05 A;  2P3M A;  4UZE A;  2VBT A;  2OYN A;  5TRD A; 
#chains in the Genus database with same CATH topology
 1N0U A;  1Q86 D;  2J7K A;  4TSF A;  3QFR A;  3CME B;  1EFC A;  3WBK A;  3G05 A;  1EP1 B;  4DQL A;  1W35 A;  3CP8 A;  3FPP A;  2QEX B;  4ASU A;  4G6I A;  2XZL A;  2QTZ A;  3HAG A;  2GK7 A;  1KC8 D;  3W2I A;  1N07 A;  1W87 A;  1QFJ A;  3U2Q A;  2C4T A;  3I1F A;  1D8T A;  2ZIT A;  1FNC A;  1AIP A;  1YIT B;  3JQR A;  2BF4 A;  1BPL A;  2JJ1 A;  2LZJ A;  3FKS A;  1G7R A;  4X0C A;  4B3X A;  5IYN A;  3CMA B;  1BX0 A;  3B82 A;  3MCA A;  1R5O A;  2ZZQ A;  3MHP A;  4YEL A;  2GJR A;  3VNU A;  4NBS A;  4G5G A;  1KD1 D;  1I8D A;  5THX A;  1FND A;  3VO1 A;  1MRZ A;  2Q6K A;  4XLF A;  3CCE B;  4F7D A;  2ZZE A;  4U9U A;  3WNC A;  1T6X A;  4XR6 A;  3OJX A;  3JU4 A;  4XLA A;  1Q82 D;  1RQR A;  3W2E A;  1DAR A;  3ASQ A;  3CCV B;  2QDX A;  1NB0 A;  4LBZ A;  1Q81 D;  2QE7 A;  3V7A A;  4RD3 A;  3W5V A;  4ZV4 A;  1TTT A;  3ZPN A;  1R5N A;  4Z4W A;  4G1V A;  1S0U A;  2M5S A;  1VLY A;  4YEJ A;  1EP3 B;  4QHY A;  3CCQ B;  1EWY A;  1KQS B;  4CQJ A;  4P1V A;  1AMO A;  3CPW B;  1A8P A;  1BMF A;  4PC3 A;  3WNB A;  2XNJ A;  2ZZG A;  3OAA A;  3BY2 A;  3ES9 A;  2WPD A;  2V7T A;  1KJZ A;  1PJ7 A;  2RC5 A;  3AVU A;  4XMY A;  3GVK A;  3ASS A;  4TMV A;  4WZL A;  2XZP A;  1VQ9 B;  1P4M A;  1YJW B;  3E20 A;  1DG1 G;  2CK3 A;  3AVV A;  1G7S A;  4XOP A;  1IB0 A;  2BGJ A;  3CCL B;  3ZBU A;  4DQK A;  2VBS A;  4X8I A;  4ACA A;  2GPJ A;  5DSZ A;  3P26 A;  3D26 A;  3OOC A;  3VMF A;  1KTV A;  1S72 B;  2X0K A;  1UD5 A;  2DY1 A;  3PA1 A;  4XNF A;  5TRD A;  4EH1 A;  3Q6Q A;  4XD7 A;  1GAW A;  5AN9 A;  1Q7Y D;  3CCU B;  3E1Y E;  4OPV A;  5TY0 A;  2Q6I A;  4E0F A;  4GQN A;  2JN9 A;  2WJV A;  2XND A;  1YIJ B;  1BLI A;  1KZL A;  4FN5 A;  1VQ8 B;  1WSR A;  2V31 A;  2Q6O A;  4OOV A;  4BPR A;  1NBM A;  5BSY A;  1EFU A;  1U2R A;  2DYI A;  2BM1 A;  4ZCL A;  1EFT A;  1ZM3 A;  2DIE A;  1RQP A;  3ZUG A;  3CXC B;  1EXM A;  3R6J A;  1JNY A;  4XLC A;  2E1R A;  2YWG A;  5H5J A;  1F60 A;  3GSI A;  1N05 A;  1BX1 A;  2P3M A;  4B43 A;  3VO2 A;  5FIU A;  4C0S A;  5B6I A;  3PA2 A;  3R6K A;  5IYQ A;  1QG0 A;  2GQF A;  3SJZ A;  3OW2 B;  1CQX A;  1S4M A;  4ZCM A;  2WSS A;  1CNE A;  3A3B A;  2F1M A;  1COW A;  1FNM A;  5IYR A;  1QGA A;  2Q6L A;  2V4D A;  4KKU A;  1VHO A;  1IJF A;  1DDG A;  3BCF A;  4M0L A;  1GVH A;  4XQF A;  4II2 A;  1PJ6 A;  1B2R A;  1WP6 A;  3OPO A;  4YAW A;  3I55 B;  2VBU A;  2FX3 A;  2ZTG A;  2OTJ B;  2B7B A;  2NV4 A;  3ASP A;  3T51 B;  4N3G A;  2V7V A;  2ZZF A;  1T6Y A;  4B47 A;  1JB9 A;  4L8J A;  2CND A;  2HLD A;  2X3U A;  4Y9U A;  5J3O A;  5HXB A;  4PC7 A;  1QVG B;  2V7X A;  3A8K A;  4Z4U A;  3FJO A;  2ZTN A;  4Z4Y A;  3ZBT A;  4H9G A;  2D9R A;  2QGG A;  3G6E B;  3BH4 A;  3LNN A;  2BMW A;  1K73 D;  3A35 A;  4OPS A;  3H9N A;  1UMK A;  1VQN B;  2D3N A;  4RDK A;  1DDI A;  5IYW A;  2W6I A;  2B7C A;  2BVN A;  4RJL A;  5FA6 A;  1XFO A;  4X07 A;  3CC7 B;  1I7P A;  2R6H A;  2CW5 A;  2VJJ A;  2VNH A;  2JJ2 A;  1XB2 A;  1T5E A;  1G7C A;  2PE3 A;  4X7E A;  4AF6 A;  4X05 A;  2YWE A;  3SLD A;  4X7F A;  1N0V C;  1YJN B;  4QUZ A;  1D2E A;  4P26 A;  4PC2 A;  4RDL A;  4XLE A;  3CCM B;  1PKV A;  3PUN A;  3W5H A;  3W2H A;  2GJP A;  2BV3 A;  4K1X A;  2C5H A;  1N08 A;  2C5B A;  4N3N A;  1K9M D;  1BJK A;  1HZE A;  5F4M A;  4XLH A;  1VQO B;  3AGQ A;  2WJY A;  3G4S B;  3CTA A;  3CMM A;  4P3I A;  4Z1M A;  4HE5 A;  1WOS A;  2HDN B;  2CF4 A;  4TN1 A;  4DK0 A;  1M90 D;  2PLF A;  2C78 A;  2EFG A;  4DNR B;  4R71 A;  2HCJ B;  3AVT A;  3ZIA A;  3AVX A;  3OE7 A;  4YHB A;  3ZZ0 A;  1G7T A;  1NJI D;  2ZXH A;  2ZXI A;  3LO8 A;  2GK6 A;  5DN6 A;  3VNV A;  4YAO A;  4WWV A;  3ZZU A;  3KL9 A;  3OZW A;  4KKT A;  4ZCI A;  1YLO A;  4Y9R A;  1UD6 A;  1WSV A;  1VQ5 B;  1H8E A;  4OP7 A;  3CCJ B;  2V7U A;  1QGY A;  2VNI A;  1VF7 A;  4YAL A;  1JA0 A;  4II3 A;  4LBY A;  1XQB A;  4PAB A;  4XON A;  1FDR A;  4YAF A;  1IJE A;  5JBQ A;  4RD6 A;  2VBT A;  1ZM4 A;  2DCU A;  1WPC A;  4RCZ A;  2XZO A;  3ZZT A;  1UD3 A;  2YWH A;  4XKW A;  1HVX A;  2PIA A;  4AVZ A;  1VQP B;  2YWF A;  1YX2 A;  5BSX A;  2XNC A;  4Z4Z A;  3W2G A;  4RD2 A;  1UD4 A;  2PMD A;  2X8K A;  2ZL7 A;  4FK8 A;  4MYT A;  4RD0 A;  2AHO A;  5J35 A;  3U6B A;  5H59 A;  2QA4 B;  1QUE A;  1B23 P;  4P2N A;  3WQZ A;  3LQ6 A;  5F4J A;  2OK8 A;  4UAJ A;  1QFY A;  3A8J A;  1TVC A;  1UD2 A;  3CW2 A;  3CCS B;  4X06 A;  4WZT A;  1M1K D;  4PC6 A;  4P3Y A;  1FX0 A;  1IHM A;  3JQQ A;  1VJS A;  2HMA A;  4TT3 A;  2W6J A;  2CRV A;  1WU8 A;  2VYQ A;  3A3G A;  4B4D A;  4P9S A;  4PC1 A;  2VNJ A;  3GVJ A;  4B3F X;  3ZC3 A;  5HZB A;  3QE2 A;  3A1P A;  1ELO A;  4Z4R A;  3SJP A;  1E63 A;  4ZGQ B;  1E3Z A;  1HA3 A;  2WR8 A;  2ZL5 A;  3WBJ A;  4DK1 A;  2F1L A;  3CES A;  3CRZ A;  4PAA A;  1Y0R A;  1VQL B;  2DEU A;  1E3X A;  2X53 S;  1TLL A;  3FPK A;  4XL9 A;  4G1B A;  1GO2 A;  5GV8 A;  5LMZ A;  2I1L A;  2ZBV A;  4NNJ A;  3SLN A;  3ASR A;  3BCD A;  2WZN A;  2B5O A;  2QN6 A;  3CB4 A;  4TMZ A;  2VZL A;  1WTH D;  3QFT A;  2F4N A;  1F20 A;  4TMW A;  4Y7C A;  1QX4 A;  3GVL A;  2VNK A;  1H85 A;  1KRH A;  3NE5 B;  1JA1 A;  4RLZ A;  1KK3 A;  1MAB A;  1GR1 A;  4ACB A;  5A8A A;  4M53 A;  3CD6 B;  3Q6R A;  1YJ9 B;  2VBV A;  2VJI A;  1XE1 A;  4OOX A;  3T56 B;  3T53 B;  4P22 A;  3WY9 A;  2X6X A;  5KNL A;  1ZUN B;  4XOT A;  1E43 A;  3P27 A;  3CP2 A;  2V7W A;  5L46 A;  1SM4 A;  4Z4T A;  3WND A;  2C4U A;  3Q39 A;  1D1N A;  3QSY A;  1H8H A;  1ZM2 A;  3OEH A;  1JJ2 B;  3QFC A;  3Q38 A;  4OPO A;  5E6T A;  3B8H A;  4IW3 B;  4MYU A;  2D74 A;  2NPF A;  4QFM A;  4X7D A;  1SKY B;  4M2L A;  4P25 A;  3CCR B;  1N06 A;  3WXM A;  1E62 A;  1TUI A;  5A88 A;  1T6Z A;  5IK2 A;  1Y0Y A;  3JQP A;  2C2W A;  1W34 A;  4WZE A;  1EFR A;  2DET A;  2CBX A;  1Q9S A;  3BNW A;  3ONU A;  3SEJ A;  3GQB A;  4P6V F;  3BC9 A;  4RD4 A;  1VLO A;  4P12 A;  3GIR A;  4RD1 A;  3KEW A;  4RM0 A;  5KW9 A;  5CDF A;  4XKV A;  3LVB A;  2V7Q A;  4B44 A;  2CC2 A;  1NB9 A;  1WOP A;  1QGZ A;  2X6Y A;  3AST A;  2OYN A;  4HIZ A;  2JDI A;  4DNT B;  3AVY A;  3PVD A;  2BSA A;  3MMP A;  1QUF A;  1SKQ A;  4TMX A;  2R9V A;  1K28 D;  4TKO B;  4NCN A;  1W9X A;  4AC9 A;  1QFZ A;  3OKX A;  3W2F A;  2OTL B;  1GJR A;  3OP1 A;  1J9Z A;  4RCY A;  1I18 A;  5FL7 A;  2KVO A;  4LBV A;  4HE6 A;  2XEX A;  1E64 A;  1QH0 A;  2C77 A;  2BGI A;  4XN3 A;  4FWT A;  1BQE A;  1KK2 A;  4AF7 A;  1QVF B;  1WOO A;  3W5U A;  2F43 A;  3B78 A;  4B48 A;  2DOG A;  3CPX A;  4G7W A;  1OHH A;  2WYR A;  1H42 A;  3DDY A;  4QVJ A;  3AVW A;  4C43 A;  1K8A D;  3OW7 A;  1KMH A;  4M4S A;  1E1R A;  2QTL A;  5IYP A;  3BQJ A;  3OZV A;  4YXW A;  2BPO A;  4JMQ A;  4B3G A;  1OB0 A;  2JIZ A;  4XOR A;  4M1K A;  4FXU A;  5KSW B;  1WOR A;  1OB2 A;  1E1Q A;  2FVG A;  1NDH A;  1FRQ A;  1N8R D;  3PUM A;  4UZF A;  3J81 k;  1GAQ A;  2OBR A;  4ROX A;  1EP2 B;  1ZM9 A;  2EIX A;  2X6W A;  1CNF A;  5A89 A;  1YI2 B;  3OEE A;  4Z4S A;  1VHE A;  1VQM B;  2X85 A;  5FO0 A;  5F4O A;  3I56 B;  3WYA A;  1KK1 A;  4J0Q A;  4TMT A;  3QFS A;  5HZA A;  4YAU A;  4KKS A;  2WZP P;  4UZE A;  4LC0 A;  1FRN A;  3RY8 A;  1UD8 A;  1VQK B;  1V5V A;  3SKB A;  3Q3A A;  1OGI A;  4Z4V A;  4LBW A;  4G7X A;  3ISX A;  4XN0 A;  3CC2 B;  1W0K A;  3A8I A;  2QMU A;  5TV2 A;  5FNZ A;  2ZBU A;  1OGJ A;  2BM0 A;  3V76 A;  3U6K A;  4OOS A;  2GRE A;  2OBS A;  1NRK A;  2OK7 A;  5FO1 A;  2E1B A;  5TR9 A;  5EMN A;  4ZGN B;  1VQ6 B;  5DS0 A;  4RPD A;  4X7C A;  3H94 A;  3ONY A;  4RDJ A;  5GV7 A;  3OFN A;  2DER A;  4RPB A;  2Z6B D;  1V0E A;  1PJ5 A;  4WZK A;  3CC4 B;  1V0F A;  2ZL6 A;  2XOK A;  4WQM A;  4XM3 A;  1WDT A;  2XGJ A;  1YHQ B;  3AGP A;  3BY1 A;  1FNB A;  1OB5 A;  4UZU A;  1W0J A;  1VQ4 B;  2BN4 A;  2RC6 A;  3G71 B;  4P6Y A;  1E79 A;  4QVA A;  4QV2 A;  1VQ7 B;  3LQE A;  4Q7J B;  1KK0 A;  2D3L A;  4PGO A;  1W2B B;  1R5B A;  3OZU A;  3OJW A;  3VR6 A;  2GJK A;  5HKK A;  2OBT A;  3PEN A; 
#chains in the Genus database with same CATH homology
 1N06 A;  1MRZ A;  5A8A A;  5A88 A;  1T6Z A;  1S4M A;  1T6X A;  1P4M A;  2VBV A;  3OP1 A;  5FNZ A;  1Q9S A;  3BNW A;  4UZF A;  1N08 A;  1NB0 A;  1N07 A;  2VBU A;  5A89 A;  3ZUG A;  2I1L A;  2VBS A;  5FO1 A;  5FO0 A;  3CTA A;  1T6Y A;  1NB9 A;  2X0K A;  1N05 A;  2P3M A;  4UZE A;  2VBT A;  2OYN A;  5TRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...