2VBSA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with po4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
132
structure length
132
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
total genus 25
structure length 132
sequence length 132
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbsA01
1T6ZA 1N05A 3OP1A 1S4MA 1NB0A 1P4MA 1N08A 5A89A 5A88A 1N06A 2P3MA 1NB9A 2OYNA 1MRZA 2I1LA 1N07A 2VBUA 2X0KA 2VBVA 4UZEA 3CTAA 1Q9SA 5FNZA 2VBTA 1T6YA 5FO0A 5TRDA 1T6XA 3BNWA 4UZFA 5FO1A 3ZUGA 2VBSA 5A8AA
chains in the Genus database with same CATH superfamily
4X8IA 1EP1B 1G7RA 2DCUA 3GVKA 2WZNA 2R9VA 1KJZA 3LO8A 1NB0A 1TUIA 4XLHA 2ZXIA 2WJVA 4FN5A 2X6XA 4TMTA 3ZZ0A 3V76A 4TSFA 1JNYA 1WSRA 1VLYA 2WR8A 3T53B 3AVYA 4XLEA 4WZKA 3BC9A 3WXMA 4UZEA 5JBQA 1I7PA 2WZPP 2XZLA 4P1VA 4OPVA 3WBKA 3ONYA 4ACBA 5FA6A 2C4TA 3B78A 1IJFA 4Y9RA 5H5JA 4Z1MA 1NJID 1V5VA 3ZPNA 1W2BB 4PC1A 4G7XA 4QUZA 1QX4A 1SM4A 4B43A 4ZGNB 5IYPA 3AVXA 1E43A 3ZZUA 4X05A 5DS0A 1BPLA 1W9XA 1TVCA 4XM3A 4YEJA 2C4UA 1XFOA 5HXBA 1E1RA 3OAAA 2X8KA 3FPPA 1NDHA 1NB9A 2VNKA 4B3FX 2LZJA 2OK7A 3W5HA 5THXA 4XOPA 4XLAA 1B23P 1T6YA 1WU8A 3AVVA 1EWYA 4MYUA 4OPSA 2YWHA 1TLLA 5KNLA 4UZFA 1W0KA 3NE5B 1KRHA 2HDNB 3LVBA 3KEWA 2YWFA 4WZTA 4TN1A 2ZITA 1S0UA 2C5HA 4OP7A 3A3GA 1RQPA 2XNJA 2CF4A 3W2FA 1NRKA 1N05A 3OZVA 3JQRA 3CCMB 4XOTA 3U6BA 4XD7A 3KL9A 5F4MA 1PKVA 4Z4UA 1QFYA 3QFRA 1VJSA 2GQFA 1VQMB 2QMUA 4RCZA 4Y7CA 4PC2A 4Y9UA 4Z4RA 1QVGB 4PABA 2Q6KA 1Q81D 1ZM9A 4ACAA 3VR6A 1DG1G 2C78A 1GR1A 1EFUA 4RDLA 4XNFA 1IB0A 1BX1A 1V0EA 3A35A 4QFMA 3CCLB 1VLOA 1D2EA 1DDIA 3QFTA 3Q6QA 2V7XA 3QFCA 4NCNA 4FK8A 2ZZQA 4JMQA 3CCJB 3OE7A 4XN0A 1OB2A 5TR9A 4XN3A 1KK3A 1VQ5B 2HCJB 1T6ZA 3ASRA 1EXMA 5L46A 2BGIA 1UD5A 1CQXA 1FNDA 4RLZA 2Q6LA 3SLNA 3PA1A 3OW7A 3PUMA 5LMZA 4J0QA 1U2RA 2DIEA 5GV8A 1KTVA 2PIAA 4RD4A 3ZC3A 1H42A 2OK8A 2QTLA 4TKOB 3CP8A 4YAOA 4ZCMA 1VQOB 1UD6A 1W35A 1GVHA 3BH4A 5E6TA 5CDFA 3ZIAA 1OB5A 2ZL6A 3DDYA 4B44A 1EFRA 1IHMA 1E64A 1K28D 1GAQA 2VNJA 3CP2A 4PC6A 3W2HA 1UD2A 3W2IA 1QFZA 3GVJA 1I8DA 2KVOA 3WBJA 1YHQB 1JA1A 3ZBUA 3E1YE 5KW9A 3SJZA 2CW5A 1NBMA 3WYAA 1YJNB 2DETA 5HZAA 2BM0A 4X06A 3SEJA 1FDRA 4B3XA 5FIUA 4DNTB 2JN9A 1Q82D 3CCSB 1R5BA 4M4SA 4LBZA 3SJPA 2BV3A 4ZGQB 5FO0A 3G05A 4B48A 2CNDA 2D3NA 2F1LA 5DSZA 2BM1A 3JQQA 4F7DA 1VF7A 3OJXA 4II2A 5F4JA 1VQ8B 1T5EA 1RQRA 2ZBVA 1XQBA 4NNJA 1FNMA 2Q6IA 4M2LA 1KZLA 1MRZA 2OBRA 2XZOA 1R5NA 2JIZA 2GPJA 2WPDA 4WWVA 4Z4YA 1KD1D 3SKBA 1I18A 3G71B 4QHYA 3CCQB 2QDXA 1EP3B 5IK2A 3AVWA 4NBSA 3AGQA 4AF6A 2VNIA 2NPFA 2V4DA 2GJRA 1W0JA 3R6JA 4X7EA 1QGYA 2AHOA 3GQBA 2D9RA 1FRNA 1WTHD 4RD1A 2WJYA 4AC9A 2E1RA 4N3GA 2GJKA 3G4SB 2XZPA 1VHOA 2BVNA 4KKSA 4B3GA 3U2QA 2FX3A 3GSIA 1QGAA 3CPXA 1J9ZA 2EFGA 3E20A 3Q39A 4P25A 4K1XA 3OPOA 2XNDA 3CCVB 4E0FA 2B7CA 4XR6A 4B4DA 2XEXA 1YJWB 4G1BA 4WZEA 1BMFA 1GAWA 4QVJA 3H94A 3ZZTA 3ISXA 2BF4A 1JA0A 4WZLA 1HZEA 3OFNA 3W2EA 1WPCA 4DQKA 2ZTNA 4DK0A 1QG0A 2EIXA 1KC8D 4ROXA 4XLCA 1WOPA 4YAWA 5TRDA 1VQKB 4FWTA 3VNUA 3MCAA 3BY1A 5KSWB 1UD4A 1UMKA 1KMHA 3P27A 4RPBA 2C2WA 4UAJA 4MYTA 1EP2B 2X0KA 4X0CA 3ASSA 4LC0A 3PA2A 2OBTA 4G6IA 2V7QA 3LQ6A 3RY8A 2DY1A 4P12A 4QV2A 3W2GA 1BQEA 1G7SA 5F4OA 3GIRA 2CK3A 2ZL7A 1QGZA 1ZM3A 3CCEB 4RPDA 2RC6A 5B6IA 1UD3A 3AVTA 5HKKA 1WORA 2ZXHA 2CBXA 2X85A 2X3UA 4YAFA 1QH0A 4C0SA 1GJRA 1T6XA 3CMEB 2QN6A 5IYRA 1M90D 1WOSA 1KK1A 4XLFA 2D74A 2RC5A 4Z4ZA 3I1FA 4Z4WA 2X6YA 1TTTA 4AF7A 1DDGA 1PJ5A 5J3OA 2C5BA 2GJPA 3HAGA 2QGGA 4TMWA 4Z4VA 3CMAB 1VQNB 1AIPA 4HE6A 2P3MA 2PMDA 4P9SA 4DK1A 2XOKA 3ASQA 4H9GA 4KKTA 2YWGA 4XMYA 2D3LA 3ONUA 1CNFA 1ZM2A 3PENA 3LQEA 3MHPA 4TMVA 1OHHA 3ZUGA 1AMOA 3CC7B 2PLFA 2PE3A 4N3NA 1V0FA 3VNVA 4YALA 2XNCA 2VZLA 2GREA 1N08A 2ZZGA 2M5SA 2B5OA 3OKXA 4UZUA 3U6KA 1E3ZA 3OZUA 2BMWA 4CQJA 2V31A 2DERA 2VJIA 1XE1A 4P3IA 1PJ6A 2NV4A 3CC4B 1VQPB 3OOCA 4C43A 3JQPA 1Q9SA 1COWA 4RD0A 1JB9A 2BN4A 2ZZEA 3BY2A 2VBTA 4PC7A 1K73D 2OTJB 1BJKA 2WSSA 4M53A 2CC2A 2BGJA 3BNWA 4HE5A 2BSAA 1WOOA 5FO1A 3CPWB 4U9UA 5GV7A 1EFCA 2HLDA 3WNDA 4X07A 3QE2A 1G7TA 2X53S 4G7WA 3ZBTA 3OP1A 3CXCB 4B47A 3CW2A 1OGIA 2B7BA 2F4NA 3WY9A 4OOSA 5A88A 3A8IA 2DOGA 4OPOA 1WSVA 3T51B 4XQFA 4X7CA 1S72B 1KK2A 2OBSA 1H85A 1FRQA 3A3BA 3Q38A 4BPRA 1VQ6B 4M1KA 2YWEA 3A8KA 4P6VF 4RM0A 1K8AD 4Q7JB 1IJEA 2E1BA 3CB4A 3FJOA 4RD3A 2VBSA 4Z4TA 1E63A 2CRVA 5IYWA 4RJLA 1E79A 1H8EA 2OTLB 1YI2B 3T56B 5BSYA 1YITB 3LNNA 1CNEA 2JJ1A 1VQ9B 4GQNA 2QE7A 1HVXA 4IW3B 4L8JA 5TV2A 3W5UA 2R6HA 3FKSA 4II3A 4P3YA 4EH1A 4YXWA 3GVLA 3VO2A 5A89A 5H59A 1N06A 2QEXB 4XL9A 1YJ9B 2W6IA 2OYNA 2GK6A 3ASTA 1KK0A 3BCDA 4RDJA 1H8HA 4KKUA 4XKWA 5DN6A 2VBVA 3SLDA 2Q6OA 1B2RA 1A8PA 3P26A 2GK7A 3ES9A 4XONA 1YLOA 2XGJA 3JU4A 4M0LA 4AVZA 3J81k 4P2NA 1YIJB 1Q7YD 4HIZA 4Z4SA 3FPKA 2VNHA 3V7AA 1ELOA 4WQMA 1Q86D 2HMAA 1K9MD 1QFJA 1S4MA 1F60A 4P6YA 3MMPA 4ZV4A 4PC3A 2VJJA 1OGJA 2WYRA 1QUFA 1BLIA 2JJ2A 1D1NA 2V7TA 3WNBA 2QTZA 4ZCIA 5IYQA 1VQ7B 4RDKA 1E1QA 5TY0A 1N0VC 1N8RD 1JJ2B 3B8HA 4YELA 3WNCA 3H9NA 1SKYB 4PAAA 5HZBA 1Y0RA 3PUNA 5AN9A 2BPOA 2DYIA 2ZZFA 4FXUA 1XB2A 1UD8A 3AGPA 4DNRB 1ZM4A 1GO2A 3BQJA 3OEEA 1WDTA 3B82A 1N0UA 1FNCA 1VQLB 2F43A 4YAUA 4G5GA 3OJWA 1YX2A 4OOVA 1N07A 1QUEA 2VBUA 2Z6BD 4TMXA 4TT3A 5FL7A 3VO1A 4R71A 1E3XA 1ZUNB 3OEHA 3VMFA 4G1VA 1EFTA 5IYNA 2ZBUA 1WP6A 2V7WA 3R6KA 3AVUA 4LBVA 2QA4B 4DQLA 2J7KA 3G6EB 1FNBA 1P4MA 3D26A 5BSXA 1HA3A 3OW2B 3A1PA 4ZCLA 1QVFB 1MABA 3CMMA 3QFSA 3I55B 3PVDA 4P26A 1D8TA 1SKQA 2FVGA 1W34A 1BX0A 4RCYA 3CD6B 3I56B 3CTAA 1VHEA 5J35A 1G7CA 5FNZA 3A8JA 1OB0A 3OZWA 4X7FA 4LBWA 4YHBA 4X7DA 1PJ7A 3Q3AA 3W5VA 1FX0A 1F20A 5A8AA 3WQZA 4RD2A 4ASUA 1VQ4B 4TMZA 4XORA 2V7VA 2ZTGA 3CRZA 3BCFA 4RD6A 2W6JA 3ASPA 2F1MA 4OOXA 1R5OA 2JDIA 4P22A 1Y0YA 2I1LA 2X6WA 2VYQA 2ZL5A 3Q6RA 4XKVA 5EMNA 3CESA 3CCRB 2DEUA 1KQSB 3CCUB 4LBYA 4PGOA 1W87A 1DARA 3CC2B 4QVAA 2V7UA 1M1KD 1E62A 3QSYA 2C77A
chains in the Genus database with same CATH topology
1T6ZA 1N05A 3OP1A 1S4MA 1NB0A 1P4MA 1N08A 5A89A 5A88A 1N06A 2P3MA 1NB9A 2OYNA 1MRZA 2I1LA 1N07A 2VBUA 2X0KA 2VBVA 4UZEA 3CTAA 1Q9SA 5FNZA 2VBTA 1T6YA 5FO0A 5TRDA 1T6XA 3BNWA 4UZFA 5FO1A 3ZUGA 2VBSA 5A8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6Z A;  1N05 A;  3OP1 A;  1S4M A;  1NB0 A;  1P4M A;  1N08 A;  5A89 A;  5A88 A;  1N06 A;  2P3M A;  1NB9 A;  2OYN A;  1MRZ A;  2I1L A;  1N07 A;  2VBU A;  2X0K A;  2VBV A;  4UZE A;  3CTA A;  1Q9S A;  5FNZ A;  2VBT A;  1T6Y A;  5FO0 A;  5TRD A;  1T6X A;  3BNW A;  4UZF A;  5FO1 A;  3ZUG A;  2VBS A;  5A8A A; 
#chains in the Genus database with same CATH topology
 4X8I A;  1EP1 B;  1G7R A;  2DCU A;  3GVK A;  2WZN A;  2R9V A;  1KJZ A;  3LO8 A;  1NB0 A;  1TUI A;  4XLH A;  2ZXI A;  2WJV A;  4FN5 A;  2X6X A;  4TMT A;  3ZZ0 A;  3V76 A;  4TSF A;  1JNY A;  1WSR A;  1VLY A;  2WR8 A;  3T53 B;  3AVY A;  4XLE A;  4WZK A;  3BC9 A;  3WXM A;  4UZE A;  5JBQ A;  1I7P A;  2WZP P;  2XZL A;  4P1V A;  4OPV A;  3WBK A;  3ONY A;  4ACB A;  5FA6 A;  2C4T A;  3B78 A;  1IJF A;  4Y9R A;  5H5J A;  4Z1M A;  1NJI D;  1V5V A;  3ZPN A;  1W2B B;  4PC1 A;  4G7X A;  4QUZ A;  1QX4 A;  1SM4 A;  4B43 A;  4ZGN B;  5IYP A;  3AVX A;  1E43 A;  3ZZU A;  4X05 A;  5DS0 A;  1BPL A;  1W9X A;  1TVC A;  4XM3 A;  4YEJ A;  2C4U A;  1XFO A;  5HXB A;  1E1R A;  3OAA A;  2X8K A;  3FPP A;  1NDH A;  1NB9 A;  2VNK A;  4B3F X;  2LZJ A;  2OK7 A;  3W5H A;  5THX A;  4XOP A;  4XLA A;  1B23 P;  1T6Y A;  1WU8 A;  3AVV A;  1EWY A;  4MYU A;  4OPS A;  2YWH A;  1TLL A;  5KNL A;  4UZF A;  1W0K A;  3NE5 B;  1KRH A;  2HDN B;  3LVB A;  3KEW A;  2YWF A;  4WZT A;  4TN1 A;  2ZIT A;  1S0U A;  2C5H A;  4OP7 A;  3A3G A;  1RQP A;  2XNJ A;  2CF4 A;  3W2F A;  1NRK A;  1N05 A;  3OZV A;  3JQR A;  3CCM B;  4XOT A;  3U6B A;  4XD7 A;  3KL9 A;  5F4M A;  1PKV A;  4Z4U A;  1QFY A;  3QFR A;  1VJS A;  2GQF A;  1VQM B;  2QMU A;  4RCZ A;  4Y7C A;  4PC2 A;  4Y9U A;  4Z4R A;  1QVG B;  4PAB A;  2Q6K A;  1Q81 D;  1ZM9 A;  4ACA A;  3VR6 A;  1DG1 G;  2C78 A;  1GR1 A;  1EFU A;  4RDL A;  4XNF A;  1IB0 A;  1BX1 A;  1V0E A;  3A35 A;  4QFM A;  3CCL B;  1VLO A;  1D2E A;  1DDI A;  3QFT A;  3Q6Q A;  2V7X A;  3QFC A;  4NCN A;  4FK8 A;  2ZZQ A;  4JMQ A;  3CCJ B;  3OE7 A;  4XN0 A;  1OB2 A;  5TR9 A;  4XN3 A;  1KK3 A;  1VQ5 B;  2HCJ B;  1T6Z A;  3ASR A;  1EXM A;  5L46 A;  2BGI A;  1UD5 A;  1CQX A;  1FND A;  4RLZ A;  2Q6L A;  3SLN A;  3PA1 A;  3OW7 A;  3PUM A;  5LMZ A;  4J0Q A;  1U2R A;  2DIE A;  5GV8 A;  1KTV A;  2PIA A;  4RD4 A;  3ZC3 A;  1H42 A;  2OK8 A;  2QTL A;  4TKO B;  3CP8 A;  4YAO A;  4ZCM A;  1VQO B;  1UD6 A;  1W35 A;  1GVH A;  3BH4 A;  5E6T A;  5CDF A;  3ZIA A;  1OB5 A;  2ZL6 A;  3DDY A;  4B44 A;  1EFR A;  1IHM A;  1E64 A;  1K28 D;  1GAQ A;  2VNJ A;  3CP2 A;  4PC6 A;  3W2H A;  1UD2 A;  3W2I A;  1QFZ A;  3GVJ A;  1I8D A;  2KVO A;  3WBJ A;  1YHQ B;  1JA1 A;  3ZBU A;  3E1Y E;  5KW9 A;  3SJZ A;  2CW5 A;  1NBM A;  3WYA A;  1YJN B;  2DET A;  5HZA A;  2BM0 A;  4X06 A;  3SEJ A;  1FDR A;  4B3X A;  5FIU A;  4DNT B;  2JN9 A;  1Q82 D;  3CCS B;  1R5B A;  4M4S A;  4LBZ A;  3SJP A;  2BV3 A;  4ZGQ B;  5FO0 A;  3G05 A;  4B48 A;  2CND A;  2D3N A;  2F1L A;  5DSZ A;  2BM1 A;  3JQQ A;  4F7D A;  1VF7 A;  3OJX A;  4II2 A;  5F4J A;  1VQ8 B;  1T5E A;  1RQR A;  2ZBV A;  1XQB A;  4NNJ A;  1FNM A;  2Q6I A;  4M2L A;  1KZL A;  1MRZ A;  2OBR A;  2XZO A;  1R5N A;  2JIZ A;  2GPJ A;  2WPD A;  4WWV A;  4Z4Y A;  1KD1 D;  3SKB A;  1I18 A;  3G71 B;  4QHY A;  3CCQ B;  2QDX A;  1EP3 B;  5IK2 A;  3AVW A;  4NBS A;  3AGQ A;  4AF6 A;  2VNI A;  2NPF A;  2V4D A;  2GJR A;  1W0J A;  3R6J A;  4X7E A;  1QGY A;  2AHO A;  3GQB A;  2D9R A;  1FRN A;  1WTH D;  4RD1 A;  2WJY A;  4AC9 A;  2E1R A;  4N3G A;  2GJK A;  3G4S B;  2XZP A;  1VHO A;  2BVN A;  4KKS A;  4B3G A;  3U2Q A;  2FX3 A;  3GSI A;  1QGA A;  3CPX A;  1J9Z A;  2EFG A;  3E20 A;  3Q39 A;  4P25 A;  4K1X A;  3OPO A;  2XND A;  3CCV B;  4E0F A;  2B7C A;  4XR6 A;  4B4D A;  2XEX A;  1YJW B;  4G1B A;  4WZE A;  1BMF A;  1GAW A;  4QVJ A;  3H94 A;  3ZZT A;  3ISX A;  2BF4 A;  1JA0 A;  4WZL A;  1HZE A;  3OFN A;  3W2E A;  1WPC A;  4DQK A;  2ZTN A;  4DK0 A;  1QG0 A;  2EIX A;  1KC8 D;  4ROX A;  4XLC A;  1WOP A;  4YAW A;  5TRD A;  1VQK B;  4FWT A;  3VNU A;  3MCA A;  3BY1 A;  5KSW B;  1UD4 A;  1UMK A;  1KMH A;  3P27 A;  4RPB A;  2C2W A;  4UAJ A;  4MYT A;  1EP2 B;  2X0K A;  4X0C A;  3ASS A;  4LC0 A;  3PA2 A;  2OBT A;  4G6I A;  2V7Q A;  3LQ6 A;  3RY8 A;  2DY1 A;  4P12 A;  4QV2 A;  3W2G A;  1BQE A;  1G7S A;  5F4O A;  3GIR A;  2CK3 A;  2ZL7 A;  1QGZ A;  1ZM3 A;  3CCE B;  4RPD A;  2RC6 A;  5B6I A;  1UD3 A;  3AVT A;  5HKK A;  1WOR A;  2ZXH A;  2CBX A;  2X85 A;  2X3U A;  4YAF A;  1QH0 A;  4C0S A;  1GJR A;  1T6X A;  3CME B;  2QN6 A;  5IYR A;  1M90 D;  1WOS A;  1KK1 A;  4XLF A;  2D74 A;  2RC5 A;  4Z4Z A;  3I1F A;  4Z4W A;  2X6Y A;  1TTT A;  4AF7 A;  1DDG A;  1PJ5 A;  5J3O A;  2C5B A;  2GJP A;  3HAG A;  2QGG A;  4TMW A;  4Z4V A;  3CMA B;  1VQN B;  1AIP A;  4HE6 A;  2P3M A;  2PMD A;  4P9S A;  4DK1 A;  2XOK A;  3ASQ A;  4H9G A;  4KKT A;  2YWG A;  4XMY A;  2D3L A;  3ONU A;  1CNF A;  1ZM2 A;  3PEN A;  3LQE A;  3MHP A;  4TMV A;  1OHH A;  3ZUG A;  1AMO A;  3CC7 B;  2PLF A;  2PE3 A;  4N3N A;  1V0F A;  3VNV A;  4YAL A;  2XNC A;  2VZL A;  2GRE A;  1N08 A;  2ZZG A;  2M5S A;  2B5O A;  3OKX A;  4UZU A;  3U6K A;  1E3Z A;  3OZU A;  2BMW A;  4CQJ A;  2V31 A;  2DER A;  2VJI A;  1XE1 A;  4P3I A;  1PJ6 A;  2NV4 A;  3CC4 B;  1VQP B;  3OOC A;  4C43 A;  3JQP A;  1Q9S A;  1COW A;  4RD0 A;  1JB9 A;  2BN4 A;  2ZZE A;  3BY2 A;  2VBT A;  4PC7 A;  1K73 D;  2OTJ B;  1BJK A;  2WSS A;  4M53 A;  2CC2 A;  2BGJ A;  3BNW A;  4HE5 A;  2BSA A;  1WOO A;  5FO1 A;  3CPW B;  4U9U A;  5GV7 A;  1EFC A;  2HLD A;  3WND A;  4X07 A;  3QE2 A;  1G7T A;  2X53 S;  4G7W A;  3ZBT A;  3OP1 A;  3CXC B;  4B47 A;  3CW2 A;  1OGI A;  2B7B A;  2F4N A;  3WY9 A;  4OOS A;  5A88 A;  3A8I A;  2DOG A;  4OPO A;  1WSV A;  3T51 B;  4XQF A;  4X7C A;  1S72 B;  1KK2 A;  2OBS A;  1H85 A;  1FRQ A;  3A3B A;  3Q38 A;  4BPR A;  1VQ6 B;  4M1K A;  2YWE A;  3A8K A;  4P6V F;  4RM0 A;  1K8A D;  4Q7J B;  1IJE A;  2E1B A;  3CB4 A;  3FJO A;  4RD3 A;  2VBS A;  4Z4T A;  1E63 A;  2CRV A;  5IYW A;  4RJL A;  1E79 A;  1H8E A;  2OTL B;  1YI2 B;  3T56 B;  5BSY A;  1YIT B;  3LNN A;  1CNE A;  2JJ1 A;  1VQ9 B;  4GQN A;  2QE7 A;  1HVX A;  4IW3 B;  4L8J A;  5TV2 A;  3W5U A;  2R6H A;  3FKS A;  4II3 A;  4P3Y A;  4EH1 A;  4YXW A;  3GVL A;  3VO2 A;  5A89 A;  5H59 A;  1N06 A;  2QEX B;  4XL9 A;  1YJ9 B;  2W6I A;  2OYN A;  2GK6 A;  3AST A;  1KK0 A;  3BCD A;  4RDJ A;  1H8H A;  4KKU A;  4XKW A;  5DN6 A;  2VBV A;  3SLD A;  2Q6O A;  1B2R A;  1A8P A;  3P26 A;  2GK7 A;  3ES9 A;  4XON A;  1YLO A;  2XGJ A;  3JU4 A;  4M0L A;  4AVZ A;  3J81 k;  4P2N A;  1YIJ B;  1Q7Y D;  4HIZ A;  4Z4S A;  3FPK A;  2VNH A;  3V7A A;  1ELO A;  4WQM A;  1Q86 D;  2HMA A;  1K9M D;  1QFJ A;  1S4M A;  1F60 A;  4P6Y A;  3MMP A;  4ZV4 A;  4PC3 A;  2VJJ A;  1OGJ A;  2WYR A;  1QUF A;  1BLI A;  2JJ2 A;  1D1N A;  2V7T A;  3WNB A;  2QTZ A;  4ZCI A;  5IYQ A;  1VQ7 B;  4RDK A;  1E1Q A;  5TY0 A;  1N0V C;  1N8R D;  1JJ2 B;  3B8H A;  4YEL A;  3WNC A;  3H9N A;  1SKY B;  4PAA A;  5HZB A;  1Y0R A;  3PUN A;  5AN9 A;  2BPO A;  2DYI A;  2ZZF A;  4FXU A;  1XB2 A;  1UD8 A;  3AGP A;  4DNR B;  1ZM4 A;  1GO2 A;  3BQJ A;  3OEE A;  1WDT A;  3B82 A;  1N0U A;  1FNC A;  1VQL B;  2F43 A;  4YAU A;  4G5G A;  3OJW A;  1YX2 A;  4OOV A;  1N07 A;  1QUE A;  2VBU A;  2Z6B D;  4TMX A;  4TT3 A;  5FL7 A;  3VO1 A;  4R71 A;  1E3X A;  1ZUN B;  3OEH A;  3VMF A;  4G1V A;  1EFT A;  5IYN A;  2ZBU A;  1WP6 A;  2V7W A;  3R6K A;  3AVU A;  4LBV A;  2QA4 B;  4DQL A;  2J7K A;  3G6E B;  1FNB A;  1P4M A;  3D26 A;  5BSX A;  1HA3 A;  3OW2 B;  3A1P A;  4ZCL A;  1QVF B;  1MAB A;  3CMM A;  3QFS A;  3I55 B;  3PVD A;  4P26 A;  1D8T A;  1SKQ A;  2FVG A;  1W34 A;  1BX0 A;  4RCY A;  3CD6 B;  3I56 B;  3CTA A;  1VHE A;  5J35 A;  1G7C A;  5FNZ A;  3A8J A;  1OB0 A;  3OZW A;  4X7F A;  4LBW A;  4YHB A;  4X7D A;  1PJ7 A;  3Q3A A;  3W5V A;  1FX0 A;  1F20 A;  5A8A A;  3WQZ A;  4RD2 A;  4ASU A;  1VQ4 B;  4TMZ A;  4XOR A;  2V7V A;  2ZTG A;  3CRZ A;  3BCF A;  4RD6 A;  2W6J A;  3ASP A;  2F1M A;  4OOX A;  1R5O A;  2JDI A;  4P22 A;  1Y0Y A;  2I1L A;  2X6W A;  2VYQ A;  2ZL5 A;  3Q6R A;  4XKV A;  5EMN A;  3CES A;  3CCR B;  2DEU A;  1KQS B;  3CCU B;  4LBY A;  4PGO A;  1W87 A;  1DAR A;  3CC2 B;  4QVA A;  2V7U A;  1M1K D;  1E62 A;  3QSY A;  2C77 A; 
#chains in the Genus database with same CATH homology
 1T6Z A;  1N05 A;  3OP1 A;  1S4M A;  1NB0 A;  1P4M A;  1N08 A;  5A89 A;  5A88 A;  1N06 A;  2P3M A;  1NB9 A;  2OYN A;  1MRZ A;  2I1L A;  1N07 A;  2VBU A;  2X0K A;  2VBV A;  4UZE A;  3CTA A;  1Q9S A;  5FNZ A;  2VBT A;  1T6Y A;  5FO0 A;  5TRD A;  1T6X A;  3BNW A;  4UZF A;  5FO1 A;  3ZUG A;  2VBS A;  5A8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...