2VBSA

Riboflavin kinase mj0056 from methanocaldococcus jannaschii in complex with po4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
132
structure length
132
Chain Sequence
VKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPIKILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ctp-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Transferase
molecule keywords RIBOFLAVIN KINASE
total genus 25
structure length 132
sequence length 132
ec nomenclature ec 2.7.1.161: CTP-dependent riboflavin kinase.
pdb deposition date 2007-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01982 CTP-dep_RFKase Domain of unknown function DUF120
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 2vbsA01
2VBUA 1T6XA 1T6ZA 2OYNA 4UZEA 2VBSA 2P3MA 1S4MA 1MRZA 3ZUGA 2I1LA 2VBVA 5A88A 3CTAA 5A89A 1N08A 3BNWA 5FO0A 4UZFA 2X0KA 5FO1A 1N06A 5FNZA 5TRDA 1N07A 1N05A 5A8AA 1NB9A 1P4MA 1Q9SA 2VBTA 1T6YA 1NB0A 3OP1A
chains in the Genus database with same CATH superfamily
3CESA 3WQZA 4DNRB 3HAGA 1WORA 3ZBTA 2OYNA 3FKSA 4MYUA 3GQBA 4Z4SA 5TV2A 3OPOA 3T53B 2V7UA 3OOCA 3MCAA 4QUZA 4ASUA 1FRQA 2C5HA 2Q6KA 1W87A 3B82A 4ZV4A 4FK8A 2M5SA 4RPDA 1YITB 5F4OA 5IK2A 1S72B 3OAAA 2XGJA 1CQXA 4RD0A 5F4JA 4TMWA 1G7RA 1B23P 4RD2A 1NB9A 2BMWA 2JJ1A 1IJEA 2QTLA 5TY0A 2EFGA 4XN0A 1QFYA 1ZM3A 2BPOA 3WYAA 3OP1A 2WJVA 3GIRA 4DK0A 5L46A 1ELOA 3U6KA 2GJKA 1E43A 1VF7A 5FA6A 2DEUA 1R5OA 3U6BA 2Q6IA 3V76A 4PABA 2ZXIA 1V0EA 1KD1D 2BSAA 1PJ7A 1KK0A 3KEWA 3SLDA 2VJJA 3CTAA 4PC7A 1K9MD 4RDJA 5KSWB 3A8KA 1T5EA 2Q6OA 4UZFA 1VHOA 1A8PA 3SJZA 1ZM9A 5E6TA 2XNJA 1JA0A 3T51B 1N05A 4LBZA 3B78A 2F43A 1J9ZA 2VNIA 2WZNA 4P3IA 4PC6A 1DDIA 3LO8A 4OPVA 2F1LA 4G7XA 4ZCLA 1VJSA 4P6VF 1T6XA 1XB2A 4Y7CA 1E79A 1WOSA 4XONA 1QGYA 1Y0YA 1BX0A 1E3XA 1OGIA 3CCEB 3BY1A 4RDLA 3ASSA 5FO0A 2QA4B 3QFTA 4WZLA 2V7XA 2BM1A 2RC6A 4YAFA 3H94A 4XM3A 1D8TA 1WDTA 3AGQA 1I8DA 2LZJA 2WSSA 4XLFA 4AF7A 4P2NA 3G05A 4II3A 2QMUA 2CW5A 1NRKA 2GJPA 1GAQA 4XOTA 2B7CA 3Q6QA 3I56B 1GO2A 1KZLA 4II2A 1SKYB 3ZPNA 5TR9A 2BGJA 1DDGA 2C78A 5A88A 4B3FX 5HXBA 5HZBA 1OGJA 4X06A 4ACBA 5BSYA 4WWVA 5J3OA 3JQRA 1TUIA 1R5BA 1RQRA 3PA2A 1FNMA 3ISXA 4KKTA 3T56B 1I18A 4Y9RA 1BMFA 4XLCA 1ZM2A 1JA1A 3A1PA 3WNDA 4X7FA 1IB0A 4LBWA 1OB5A 3E1YE 1WSRA 2PLFA 3VR6A 3CMAB 1Y0RA 1QGAA 3RY8A 1QX4A 4XR6A 3SJPA 2XNCA 4X05A 3SEJA 3CCRB 5FIUA 1H8EA 3FPPA 1WU8A 2R9VA 1M90D 4ZCIA 2X85A 2HLDA 3PUNA 4C0SA 3AVTA 2QGGA 3CMMA 2CBXA 2ZBVA 3GVLA 2ZZEA 1COWA 2GPJA 3Q39A 3Q6RA 1EFCA 4YAUA 2X6YA 4H9GA 4MYTA 4ZGNB 4YEJA 2XEXA 3ZZTA 4DK1A 3QFRA 5B6IA 4XD7A 3A35A 1VQ4B 4XMYA 4Q7JB 5LMZA 4LC0A 2HDNB 1YHQB 1SKQA 4OOSA 2DIEA 2E1RA 3MHPA 4JMQA 3H9NA 1NJID 3QFSA 4RM0A 2OBSA 1G7TA 2GK6A 2DYIA 3VNUA 4RCYA 5H59A 4RD4A 1E62A 1KJZA 1YI2B 1TTTA 4Y9UA 3W2IA 1Q82D 3MMPA 4ACAA 3VMFA 3A3BA 5IYRA 4ROXA 4ZGQB 1W2BB 1YX2A 2F1MA 3VO2A 4R71A 3CXCB 1D1NA 1OB2A 3LVBA 4Z4ZA 4LBYA 1FNCA 1N07A 2ZZQA 1YLOA 3OZUA 4M53A 5FL7A 2C77A 1QFJA 1JB9A 1XFOA 2VBTA 3CC7B 1QG0A 3W5HA 3CP2A 5AN9A 1VQ9B 3AVVA 4PAAA 3PUMA 1GR1A 3CC2B 5IYPA 1F20A 3JQQA 3WY9A 2VBUA 2C2WA 1ZM4A 2V4DA 1T6ZA 4Z4TA 4UZEA 4L8JA 1GAWA 3R6JA 1QUFA 1KTVA 4DQKA 4RDKA 3W2EA 3WNBA 1W35A 4WZEA 3PENA 1B2RA 3W5UA 1FRNA 1M1KD 2ZL7A 2ZITA 3CCJB 2X6XA 2YWFA 3NE5B 4RD3A 3V7AA 2NPFA 4XOPA 5TRDA 4HE6A 1XE1A 4XLAA 4U9UA 4QFMA 5DS0A 2V31A 1V0FA 4OP7A 5HZAA 5KW9A 3ZIAA 4M0LA 4QVAA 4NBSA 1E64A 3GVJA 3OW2B 4QHYA 4YALA 1VQ6B 1YJWB 2DERA 1K8AD 2D74A 4OPOA 1VQNB 1EFTA 3I55B 4RCZA 2VZLA 1NDHA 4FXUA 1AIPA 4XLHA 2Q6LA 4P22A 4Z4YA 3G4SB 3QE2A 3AGPA 1G7SA 4OOVA 1N08A 4XORA 4G6IA 4Z1MA 3PA1A 4PC1A 5IYWA 1H8HA 2NV4A 1GJRA 4BPRA 2J7KA 1EWYA 2R6HA 2DOGA 4P25A 3OW7A 4RPBA 1EFUA 4EH1A 5KNLA 4TKOB 3U2QA 4LBVA 1W0KA 4B3XA 5EMNA 1KK3A 3DDYA 1FNBA 1VQMB 2VBSA 1PJ6A 5GV7A 3VO1A 3CCLB 4F7DA 1TVCA 2JN9A 3ZUGA 2X3UA 5A89A 3BNWA 4XQFA 4QVJA 1FDRA 2V7WA 3CCVB 2BVNA 4G5GA 3BH4A 2HCJB 3CCQB 1N8RD 3AVWA 2EIXA 3G6EB 2XZPA 1Q86D 1K73D 2OBRA 2YWGA 3BQJA 4E0FA 1W9XA 4NCNA 3AVUA 4Z4UA 1QGZA 1BX1A 2W6IA 2ZTNA 2C4UA 1KK2A 1UD2A 3BC9A 1HZEA 3BY2A 3FPKA 3LNNA 2CF4A 1TLLA 5F4MA 3FJOA 3CPWB 1MRZA 2X8KA 1R5NA 2ZXHA 2YWHA 4G1BA 2Z6BD 3LQEA 3ONUA 3QFCA 1UMKA 2OK8A 1JNYA 4B47A 4B3GA 1QH0A 3OJXA 1EP1B 4P6YA 1WOOA 1MABA 3JQPA 1BLIA 4B48A 2ZZFA 1CNEA 4KKUA 2E1BA 1H85A 1K28D 1T6YA 1IJFA 3ZZ0A 4M2LA 2FVGA 1U2RA 4RJLA 4TMTA 4WZKA 4X7CA 1OHHA 1Q7YD 2WPDA 4Z4RA 1AMOA 2JIZA 2BM0A 1JJ2B 2QDXA 4P1VA 3CMEB 3OZVA 3SLNA 1Q81D 1EFRA 2D9RA 4XKWA 4TMZA 3Q38A 2VBVA 3BCFA 4YAWA 3CRZA 3GSIA 5J35A 1HA3A 2JJ2A 2PMDA 3ASPA 1VQ8B 4X7DA 1VQLB 1EP3B 2D3NA 2X6WA 1SM4A 1F60A 2DY1A 4N3GA 4XKVA 2QE7A 2W6JA 4X7EA 4YAOA 1VQOB 4B43A 3QSYA 4G1VA 5IYQA 4TMXA 1IHMA 3D26A 4UAJA 1QUEA 1EXMA 2PE3A 4Z4VA 3A8JA 1YJ9B 5HKKA 1ZUNB 1QVFB 3E20A 1H42A 4PC2A 1E1QA 1PKVA 3W2GA 2CNDA 4FWTA 4TT3A 3GVKA 1I7PA 2B7BA 4P9SA 2I1LA 4OPSA 3OJWA 1VHEA 4RLZA 2WZPP 4NNJA 2ZTGA 4M1KA 3CCMB 2VNJA 3SKBA 1UD6A 1VLYA 3WNCA 2BF4A 3ZBUA 2ZBUA 1VQ7B 4J0QA 3AVYA 1Q9SA 2XNDA 3ONYA 3ASRA 4PC3A 3KL9A 3ASTA 3P27A 1WOPA 2RC5A 3A3GA 1E1RA 2VNHA 2WYRA 4HE5A 1E63A 4RD1A 3CCUB 1KQSB 1XQBA 2GREA 1UD5A 2VYQA 3CW2A 4G7WA 4OOXA 1GVHA 4TMVA 2VJIA 3J81k 1HVXA 1VLOA 4WZTA 2V7TA 3W5VA 1N0VC 1CNFA 1WTHD 1WSVA 4C43A 4QV2A 2X0KA 3WXMA 1BQEA 2B5OA 3LQ6A 1KC8D 2CRVA 3ES9A 3OZWA 4AVZA 2WJYA 3A8IA 4B44A 4CQJA 4Z4WA 5A8AA 1P4MA 2YWEA 5JBQA 3OE7A 5IYNA 2BGIA 4IW3B 3OEHA 4XNFA 4ZCMA 1PJ5A 1UD3A 1RQPA 4YELA 4P12A 1DARA 2QTZA 2P3MA 1UD8A 1YJNB 2CK3A 1OB0A 4XLEA 1NBMA 4XN3A 3CD6B 4RD6A 3OKXA 2OK7A 4K1XA 1FX0A 2JDIA 5FO1A 5H5JA 1N06A 3B8HA 5FNZA 1QFZA 1W0JA 3CB4A 4DNTB 4X8IA 4HIZA 2QEXB 3OEEA 3CCSB 2X53S 2DETA 2XZOA 1KRHA 1NB0A 3AVXA 3P26A 3CPXA 4YXWA 1KMHA 3CP8A 2ZZGA 1KK1A 4FN5A 4TSFA 2C5BA 2D3LA 2XZLA 2WR8A 2AHOA 2ZL5A 4WQMA 2FX3A 3ZZUA 2BV3A 1G7CA 4YHBA 2GK7A 1VQKB 1DG1G 2C4TA 2GJRA 2KVOA 3ZC3A 4AC9A 3CC4B 5DN6A 1S0UA 2OBTA 2DCUA 4XL9A 1VQ5B 2HMAA 3ASQA 5GV8A 5CDFA 3VNVA 4TN1A 3JU4A 1QVGB 5DSZA 1BPLA 2XOKA 3WBKA 3OFNA 1E3ZA 1VQPB 1V5VA 2VNKA 2ZL6A 4KKSA 4PGOA 2PIAA 4GQNA 4P26A 1W34A 3Q3AA 2GQFA 1S4MA 5BSXA 2CC2A 2OTJB 4AF6A 4UZUA 4X0CA 4P3YA 1WP6A 4M4SA 1EP2B 3PVDA 1D2EA 1N0UA 3BCDA 3WBJA 1FNDA 3I1FA 1WPCA 4N3NA 1YIJB 4B4DA 1UD4A 2BN4A 2QN6A 3R6KA 2V7QA 5THXA 3G71B 4X07A 4DQLA 2OTLB 1BJKA 2F4NA 2V7VA 3W2FA 3W2HA
chains in the Genus database with same CATH topology
2VBUA 1T6XA 1T6ZA 2OYNA 4UZEA 2VBSA 2P3MA 1S4MA 1MRZA 3ZUGA 2I1LA 2VBVA 5A88A 3CTAA 5A89A 1N08A 3BNWA 5FO0A 4UZFA 2X0KA 5FO1A 1N06A 5FNZA 5TRDA 1N07A 1N05A 5A8AA 1NB9A 1P4MA 1Q9SA 2VBTA 1T6YA 1NB0A 3OP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBU A;  1T6X A;  1T6Z A;  2OYN A;  4UZE A;  2VBS A;  2P3M A;  1S4M A;  1MRZ A;  3ZUG A;  2I1L A;  2VBV A;  5A88 A;  3CTA A;  5A89 A;  1N08 A;  3BNW A;  5FO0 A;  4UZF A;  2X0K A;  5FO1 A;  1N06 A;  5FNZ A;  5TRD A;  1N07 A;  1N05 A;  5A8A A;  1NB9 A;  1P4M A;  1Q9S A;  2VBT A;  1T6Y A;  1NB0 A;  3OP1 A; 
#chains in the Genus database with same CATH topology
 3CES A;  3WQZ A;  4DNR B;  3HAG A;  1WOR A;  3ZBT A;  2OYN A;  3FKS A;  4MYU A;  3GQB A;  4Z4S A;  5TV2 A;  3OPO A;  3T53 B;  2V7U A;  3OOC A;  3MCA A;  4QUZ A;  4ASU A;  1FRQ A;  2C5H A;  2Q6K A;  1W87 A;  3B82 A;  4ZV4 A;  4FK8 A;  2M5S A;  4RPD A;  1YIT B;  5F4O A;  5IK2 A;  1S72 B;  3OAA A;  2XGJ A;  1CQX A;  4RD0 A;  5F4J A;  4TMW A;  1G7R A;  1B23 P;  4RD2 A;  1NB9 A;  2BMW A;  2JJ1 A;  1IJE A;  2QTL A;  5TY0 A;  2EFG A;  4XN0 A;  1QFY A;  1ZM3 A;  2BPO A;  3WYA A;  3OP1 A;  2WJV A;  3GIR A;  4DK0 A;  5L46 A;  1ELO A;  3U6K A;  2GJK A;  1E43 A;  1VF7 A;  5FA6 A;  2DEU A;  1R5O A;  3U6B A;  2Q6I A;  3V76 A;  4PAB A;  2ZXI A;  1V0E A;  1KD1 D;  2BSA A;  1PJ7 A;  1KK0 A;  3KEW A;  3SLD A;  2VJJ A;  3CTA A;  4PC7 A;  1K9M D;  4RDJ A;  5KSW B;  3A8K A;  1T5E A;  2Q6O A;  4UZF A;  1VHO A;  1A8P A;  3SJZ A;  1ZM9 A;  5E6T A;  2XNJ A;  1JA0 A;  3T51 B;  1N05 A;  4LBZ A;  3B78 A;  2F43 A;  1J9Z A;  2VNI A;  2WZN A;  4P3I A;  4PC6 A;  1DDI A;  3LO8 A;  4OPV A;  2F1L A;  4G7X A;  4ZCL A;  1VJS A;  4P6V F;  1T6X A;  1XB2 A;  4Y7C A;  1E79 A;  1WOS A;  4XON A;  1QGY A;  1Y0Y A;  1BX0 A;  1E3X A;  1OGI A;  3CCE B;  3BY1 A;  4RDL A;  3ASS A;  5FO0 A;  2QA4 B;  3QFT A;  4WZL A;  2V7X A;  2BM1 A;  2RC6 A;  4YAF A;  3H94 A;  4XM3 A;  1D8T A;  1WDT A;  3AGQ A;  1I8D A;  2LZJ A;  2WSS A;  4XLF A;  4AF7 A;  4P2N A;  3G05 A;  4II3 A;  2QMU A;  2CW5 A;  1NRK A;  2GJP A;  1GAQ A;  4XOT A;  2B7C A;  3Q6Q A;  3I56 B;  1GO2 A;  1KZL A;  4II2 A;  1SKY B;  3ZPN A;  5TR9 A;  2BGJ A;  1DDG A;  2C78 A;  5A88 A;  4B3F X;  5HXB A;  5HZB A;  1OGJ A;  4X06 A;  4ACB A;  5BSY A;  4WWV A;  5J3O A;  3JQR A;  1TUI A;  1R5B A;  1RQR A;  3PA2 A;  1FNM A;  3ISX A;  4KKT A;  3T56 B;  1I18 A;  4Y9R A;  1BMF A;  4XLC A;  1ZM2 A;  1JA1 A;  3A1P A;  3WND A;  4X7F A;  1IB0 A;  4LBW A;  1OB5 A;  3E1Y E;  1WSR A;  2PLF A;  3VR6 A;  3CMA B;  1Y0R A;  1QGA A;  3RY8 A;  1QX4 A;  4XR6 A;  3SJP A;  2XNC A;  4X05 A;  3SEJ A;  3CCR B;  5FIU A;  1H8E A;  3FPP A;  1WU8 A;  2R9V A;  1M90 D;  4ZCI A;  2X85 A;  2HLD A;  3PUN A;  4C0S A;  3AVT A;  2QGG A;  3CMM A;  2CBX A;  2ZBV A;  3GVL A;  2ZZE A;  1COW A;  2GPJ A;  3Q39 A;  3Q6R A;  1EFC A;  4YAU A;  2X6Y A;  4H9G A;  4MYT A;  4ZGN B;  4YEJ A;  2XEX A;  3ZZT A;  4DK1 A;  3QFR A;  5B6I A;  4XD7 A;  3A35 A;  1VQ4 B;  4XMY A;  4Q7J B;  5LMZ A;  4LC0 A;  2HDN B;  1YHQ B;  1SKQ A;  4OOS A;  2DIE A;  2E1R A;  3MHP A;  4JMQ A;  3H9N A;  1NJI D;  3QFS A;  4RM0 A;  2OBS A;  1G7T A;  2GK6 A;  2DYI A;  3VNU A;  4RCY A;  5H59 A;  4RD4 A;  1E62 A;  1KJZ A;  1YI2 B;  1TTT A;  4Y9U A;  3W2I A;  1Q82 D;  3MMP A;  4ACA A;  3VMF A;  3A3B A;  5IYR A;  4ROX A;  4ZGQ B;  1W2B B;  1YX2 A;  2F1M A;  3VO2 A;  4R71 A;  3CXC B;  1D1N A;  1OB2 A;  3LVB A;  4Z4Z A;  4LBY A;  1FNC A;  1N07 A;  2ZZQ A;  1YLO A;  3OZU A;  4M53 A;  5FL7 A;  2C77 A;  1QFJ A;  1JB9 A;  1XFO A;  2VBT A;  3CC7 B;  1QG0 A;  3W5H A;  3CP2 A;  5AN9 A;  1VQ9 B;  3AVV A;  4PAA A;  3PUM A;  1GR1 A;  3CC2 B;  5IYP A;  1F20 A;  3JQQ A;  3WY9 A;  2VBU A;  2C2W A;  1ZM4 A;  2V4D A;  1T6Z A;  4Z4T A;  4UZE A;  4L8J A;  1GAW A;  3R6J A;  1QUF A;  1KTV A;  4DQK A;  4RDK A;  3W2E A;  3WNB A;  1W35 A;  4WZE A;  3PEN A;  1B2R A;  3W5U A;  1FRN A;  1M1K D;  2ZL7 A;  2ZIT A;  3CCJ B;  2X6X A;  2YWF A;  3NE5 B;  4RD3 A;  3V7A A;  2NPF A;  4XOP A;  5TRD A;  4HE6 A;  1XE1 A;  4XLA A;  4U9U A;  4QFM A;  5DS0 A;  2V31 A;  1V0F A;  4OP7 A;  5HZA A;  5KW9 A;  3ZIA A;  4M0L A;  4QVA A;  4NBS A;  1E64 A;  3GVJ A;  3OW2 B;  4QHY A;  4YAL A;  1VQ6 B;  1YJW B;  2DER A;  1K8A D;  2D74 A;  4OPO A;  1VQN B;  1EFT A;  3I55 B;  4RCZ A;  2VZL A;  1NDH A;  4FXU A;  1AIP A;  4XLH A;  2Q6L A;  4P22 A;  4Z4Y A;  3G4S B;  3QE2 A;  3AGP A;  1G7S A;  4OOV A;  1N08 A;  4XOR A;  4G6I A;  4Z1M A;  3PA1 A;  4PC1 A;  5IYW A;  1H8H A;  2NV4 A;  1GJR A;  4BPR A;  2J7K A;  1EWY A;  2R6H A;  2DOG A;  4P25 A;  3OW7 A;  4RPB A;  1EFU A;  4EH1 A;  5KNL A;  4TKO B;  3U2Q A;  4LBV A;  1W0K A;  4B3X A;  5EMN A;  1KK3 A;  3DDY A;  1FNB A;  1VQM B;  2VBS A;  1PJ6 A;  5GV7 A;  3VO1 A;  3CCL B;  4F7D A;  1TVC A;  2JN9 A;  3ZUG A;  2X3U A;  5A89 A;  3BNW A;  4XQF A;  4QVJ A;  1FDR A;  2V7W A;  3CCV B;  2BVN A;  4G5G A;  3BH4 A;  2HCJ B;  3CCQ B;  1N8R D;  3AVW A;  2EIX A;  3G6E B;  2XZP A;  1Q86 D;  1K73 D;  2OBR A;  2YWG A;  3BQJ A;  4E0F A;  1W9X A;  4NCN A;  3AVU A;  4Z4U A;  1QGZ A;  1BX1 A;  2W6I A;  2ZTN A;  2C4U A;  1KK2 A;  1UD2 A;  3BC9 A;  1HZE A;  3BY2 A;  3FPK A;  3LNN A;  2CF4 A;  1TLL A;  5F4M A;  3FJO A;  3CPW B;  1MRZ A;  2X8K A;  1R5N A;  2ZXH A;  2YWH A;  4G1B A;  2Z6B D;  3LQE A;  3ONU A;  3QFC A;  1UMK A;  2OK8 A;  1JNY A;  4B47 A;  4B3G A;  1QH0 A;  3OJX A;  1EP1 B;  4P6Y A;  1WOO A;  1MAB A;  3JQP A;  1BLI A;  4B48 A;  2ZZF A;  1CNE A;  4KKU A;  2E1B A;  1H85 A;  1K28 D;  1T6Y A;  1IJF A;  3ZZ0 A;  4M2L A;  2FVG A;  1U2R A;  4RJL A;  4TMT A;  4WZK A;  4X7C A;  1OHH A;  1Q7Y D;  2WPD A;  4Z4R A;  1AMO A;  2JIZ A;  2BM0 A;  1JJ2 B;  2QDX A;  4P1V A;  3CME B;  3OZV A;  3SLN A;  1Q81 D;  1EFR A;  2D9R A;  4XKW A;  4TMZ A;  3Q38 A;  2VBV A;  3BCF A;  4YAW A;  3CRZ A;  3GSI A;  5J35 A;  1HA3 A;  2JJ2 A;  2PMD A;  3ASP A;  1VQ8 B;  4X7D A;  1VQL B;  1EP3 B;  2D3N A;  2X6W A;  1SM4 A;  1F60 A;  2DY1 A;  4N3G A;  4XKV A;  2QE7 A;  2W6J A;  4X7E A;  4YAO A;  1VQO B;  4B43 A;  3QSY A;  4G1V A;  5IYQ A;  4TMX A;  1IHM A;  3D26 A;  4UAJ A;  1QUE A;  1EXM A;  2PE3 A;  4Z4V A;  3A8J A;  1YJ9 B;  5HKK A;  1ZUN B;  1QVF B;  3E20 A;  1H42 A;  4PC2 A;  1E1Q A;  1PKV A;  3W2G A;  2CND A;  4FWT A;  4TT3 A;  3GVK A;  1I7P A;  2B7B A;  4P9S A;  2I1L A;  4OPS A;  3OJW A;  1VHE A;  4RLZ A;  2WZP P;  4NNJ A;  2ZTG A;  4M1K A;  3CCM B;  2VNJ A;  3SKB A;  1UD6 A;  1VLY A;  3WNC A;  2BF4 A;  3ZBU A;  2ZBU A;  1VQ7 B;  4J0Q A;  3AVY A;  1Q9S A;  2XND A;  3ONY A;  3ASR A;  4PC3 A;  3KL9 A;  3AST A;  3P27 A;  1WOP A;  2RC5 A;  3A3G A;  1E1R A;  2VNH A;  2WYR A;  4HE5 A;  1E63 A;  4RD1 A;  3CCU B;  1KQS B;  1XQB A;  2GRE A;  1UD5 A;  2VYQ A;  3CW2 A;  4G7W A;  4OOX A;  1GVH A;  4TMV A;  2VJI A;  3J81 k;  1HVX A;  1VLO A;  4WZT A;  2V7T A;  3W5V A;  1N0V C;  1CNF A;  1WTH D;  1WSV A;  4C43 A;  4QV2 A;  2X0K A;  3WXM A;  1BQE A;  2B5O A;  3LQ6 A;  1KC8 D;  2CRV A;  3ES9 A;  3OZW A;  4AVZ A;  2WJY A;  3A8I A;  4B44 A;  4CQJ A;  4Z4W A;  5A8A A;  1P4M A;  2YWE A;  5JBQ A;  3OE7 A;  5IYN A;  2BGI A;  4IW3 B;  3OEH A;  4XNF A;  4ZCM A;  1PJ5 A;  1UD3 A;  1RQP A;  4YEL A;  4P12 A;  1DAR A;  2QTZ A;  2P3M A;  1UD8 A;  1YJN B;  2CK3 A;  1OB0 A;  4XLE A;  1NBM A;  4XN3 A;  3CD6 B;  4RD6 A;  3OKX A;  2OK7 A;  4K1X A;  1FX0 A;  2JDI A;  5FO1 A;  5H5J A;  1N06 A;  3B8H A;  5FNZ A;  1QFZ A;  1W0J A;  3CB4 A;  4DNT B;  4X8I A;  4HIZ A;  2QEX B;  3OEE A;  3CCS B;  2X53 S;  2DET A;  2XZO A;  1KRH A;  1NB0 A;  3AVX A;  3P26 A;  3CPX A;  4YXW A;  1KMH A;  3CP8 A;  2ZZG A;  1KK1 A;  4FN5 A;  4TSF A;  2C5B A;  2D3L A;  2XZL A;  2WR8 A;  2AHO A;  2ZL5 A;  4WQM A;  2FX3 A;  3ZZU A;  2BV3 A;  1G7C A;  4YHB A;  2GK7 A;  1VQK B;  1DG1 G;  2C4T A;  2GJR A;  2KVO A;  3ZC3 A;  4AC9 A;  3CC4 B;  5DN6 A;  1S0U A;  2OBT A;  2DCU A;  4XL9 A;  1VQ5 B;  2HMA A;  3ASQ A;  5GV8 A;  5CDF A;  3VNV A;  4TN1 A;  3JU4 A;  1QVG B;  5DSZ A;  1BPL A;  2XOK A;  3WBK A;  3OFN A;  1E3Z A;  1VQP B;  1V5V A;  2VNK A;  2ZL6 A;  4KKS A;  4PGO A;  2PIA A;  4GQN A;  4P26 A;  1W34 A;  3Q3A A;  2GQF A;  1S4M A;  5BSX A;  2CC2 A;  2OTJ B;  4AF6 A;  4UZU A;  4X0C A;  4P3Y A;  1WP6 A;  4M4S A;  1EP2 B;  3PVD A;  1D2E A;  1N0U A;  3BCD A;  3WBJ A;  1FND A;  3I1F A;  1WPC A;  4N3N A;  1YIJ B;  4B4D A;  1UD4 A;  2BN4 A;  2QN6 A;  3R6K A;  2V7Q A;  5THX A;  3G71 B;  4X07 A;  4DQL A;  2OTL B;  1BJK A;  2F4N A;  2V7V A;  3W2F A;  3W2H A; 
#chains in the Genus database with same CATH homology
 2VBU A;  1T6X A;  1T6Z A;  2OYN A;  4UZE A;  2VBS A;  2P3M A;  1S4M A;  1MRZ A;  3ZUG A;  2I1L A;  2VBV A;  5A88 A;  3CTA A;  5A89 A;  1N08 A;  3BNW A;  5FO0 A;  4UZF A;  2X0K A;  5FO1 A;  1N06 A;  5FNZ A;  5TRD A;  1N07 A;  1N05 A;  5A8A A;  1NB9 A;  1P4M A;  1Q9S A;  2VBT A;  1T6Y A;  1NB0 A;  3OP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...