1FRQA

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
296
Chain Sequence
b'HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVAVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
molecule tags Oxidoreductase
source organism Spinacia oleracea
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
total genus 100
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frqA02
3QSYA 1GAWA 1N8RD 2BGJA 4ZGQB 4P6VF 4PC7A 2DERA 1YI2B 4P3YA 1SM4A 1QVFB 1EWYA 1Q82D 3CB4A 3I56B 4U9UA 4ZGNB 4IW3B 2XNJA 1YJNB 4NCNA 5H59A 1KK0A 3CMEB 4FWTA 1W34A 1JA0A 1YHQB 1VQ8B 2ZITA 1QX4A 3ZBTA 1QGAA 1J9ZA 4ZCLA 5JBQA 3W2FA 4NBSA 1M1KD 4RD0A 1BQEA 4Y7CA 2R6HA 1IJFA 3MMPA 1D8TA 4ACAA 1VQMB 1TUIA 4RCZA 4HE5A 1DG1G 1DDGA 2C77A 1VQNB 4LBYA 4B44A 1QFYA 3CCEB 3OZWA 1OGIA 4TMVA 3ZZTA 2QEXB 4RD4A 2OTJB 2FX3A 1B23P 4PC2A 2VNHA 4YAOA 4Y9UA 2B7BA 4DQLA 3VNUA 1QUFA 2C78A 3WNBA 2XEXA 1OGJA 1GAQA 4MYTA 4M0LA 3ES9A 1VQPB 5KSWB 1EFCA 3W2GA 4PC1A 1Q81D 3LO8A 4K1XA 2CNDA 4FN5A 4YHBA 4YAUA 2BM1A 1VQ6B 4PC3A 4Q7JB 2VNJA 3AVXA 3MCAA 4EH1A 1TVCA 4FK8A 3VO1A 3CC4B 1W35A 3ZC3A 4N3GA 1E64A 4B48A 1QFZA 2RC6A 1AIPA 4G1BA 1JA1A 3AVUA 2AHOA 5TY0A 2OTLB 1ZM2A 2BN4A 1ZM3A 4J0QA 1QGYA 3AVYA 1R5BA 1XB2A 2VYQA 3CCQB 1KK3A 1KK1A 2BVNA 1VQ9B 3CW2A 4RD2A 4AF7A 1N0UA 2J7KA 1JJ2B 5H5JA 4RJLA 4Y9RA 2PLFA 2E1RA 2GQFA 4YALA 5FA6A 4ZCIA 3AVWA 5DSZA 3ZZ0A 2BM0A 1YJWB 3OJWA 1QFJA 4N3NA 3B8HA 2BGIA 1KK2A 4TMXA 4QFMA 4BPRA 2DCUA 1EP1B 4F7DA 1FDRA 3LVBA 1CNEA 1KJZA 1DDIA 1XE1A 3CCMB 1NJID 2QTZA 1ZM9A 1BX0A 1TLLA 1OB5A 3W2IA 3CMAB 2DEUA 4LBWA 3A1FA 2NPFA 2PIAA 3CPWB 1EP3B 3FPKA 4ACBA 4M53A 2QMUA 1N0VC 3ZZUA 3QFCA 1U2RA 5TV2A 1GVHA 4B3XA 4ZV4A 1D2EA 4ZCMA 2QA4B 1KD1D 2D74A 3CRZA 3VNVA 3OW2B 3PENA 5TR9A 1YITB 2EFGA 4M1KA 4AF6A 3CD6B 3W5UA 1YJ9B 4TN1A 2HDNB 1ZM4A 1KC8D 1G7TA 2X3UA 1I7PA 1Q7YD 3CCSB 3CC2B 3AGQA 1CNFA 2YWGA 4YAFA 1FNMA 4B4DA 3FJOA 1K9MD 1KTVA 2B5OA 5GV8A 1FNCA 1QG0A 4AC9A 1VQ7B 1FNBA 3WNDA 3G4SB 3ZBUA 4RD3A 3CC7B 1VQOB 1VQ4B 1FNDA 1M90D 4LC0A 2RC5A 3WNCA 1R5NA 1ELOA 4UAJA 1H85A 1GO2A 4MYUA 2DETA 3U6BA 4B43A 3AGPA 4LBVA 4RCYA 4YAWA 3CCUB 3OJXA 4WQMA 2HCJB 1B2RA 1D1NA 1ZUNB 1BX1A 3P26A 4PC6A 1WDTA 3WY9A 1NDHA 2OK7A 1EP2B 5THXA 1E62A 3CCVB 1TTTA 3OZUA 2HMAA 3JQQA 2QTLA 1K8AD 1GJRA 2VZLA 1S72B 1VQKB 3G71B 1CQXA 4M2LA 1F60A 2DY1A 4C43A 1IB0A 2PMDA 3SJZA 3LYUA 1EXMA 1DARA 4G1VA 2YWEA 3QFTA 1F20A 2VNIA 1H42A 1YIJB 3JQPA 4DQKA 1AMOA 1OB2A 3B82A 3P27A 1QGZA 1R5OA 3MHPA 3CCRB 3U6KA 4PGOA 3E20A 4TMTA 3WXMA 1UMKA 4C0SA 2EIXA 2BMWA 2OK8A 3V76A 3I55B 3CXCB 1QH0A 2CRVA 1KQSB 4M4SA 3QFRA 4HE6A 3W2EA 4G5GA 3I1FA 3W5HA 1JNYA 3LRXA 2QDXA 1FRNA 1KRHA 1E63A 4TMWA 4B47A 3E1YE 4LBZA 3WBJA 3AVVA 1EFTA 1EFUA 3W2HA 2XNCA 1W2BB 4H9GA 4QHYA 1JB9A 4RD1A 3B78A 1G7RA 1QUEA 3J81k 3U2QA 3VO2A 3OZVA 2BSAA 1FRQA 1G7CA 2BPOA 3WYAA 3VMFA 1W87A 2VNKA 1QVGB 1A8PA 5GV7A 1VQ5B 2YWHA 3QFSA 3G6EB 4R71A 3AVTA 4RD6A 1GR1A 5EMNA 3WBKA 1K73D 5AN9A 1IJEA 2BV3A 4TMZA 1G7SA 2BF4A 1BJKA 1VQLB 1S0UA 3W5VA 1HA3A 3CCJB 2B7CA 3QE2A 2GPJA 2YWFA 1Q86D 1SKQA 3JQRA 3CCLB 5HXBA 2QN6A
chains in the Genus database with same CATH superfamily
3NFYA 1X7DA 1XWIA 4RJ2A 3VR4H 4H7IA 3R3YA 2AN3A 2P9EA 3RVLA 4ZN6A 3CPXA 2JGKA 1G1MA 3EF0A 1I3CA 4NPCA 2CJWA 4YRJA 1OC2A 3ADPA 4XDYA 3RU2A 5G2OA 4P6VF 3AR9A 3TW4A 4GM1A 4BZPA 1JDBC 1PJ7A 4BX2A 3OA2A 1Q5PA 3KQWA 4GVLA 4YFYA 1XPUA 2V6IA 4YJ2B 3MWDB 3CEJA 3O74A 2GCNA 3DDHA 1GPNA 4DNXA 2RHCA 2FSGA 4NZMA 4R2MA 2PUTA 5LYJA 3MSXA 3SDBA 2ZYUX 4Q7QA 1EPUA 5JV5A 4F6LA 3X1JA 4PPYA 1Z4OA 2AN1A 3AUJB 4E0BA 3CMEB 1VHOA 3TR0A 4EEZA 5AM2A 4KAAA 3RLIA 3Q39A 4GE3A 3A9RA 1PTJC 1UKCA 1M7HA 2F4NA 5CIYA 5IDQA 3OZIA 3OD5A 5KJ6A 5IC6A 4ZCLA 5JBQA 1NI3A 4Z5XA 4KVAA 3MYYA 2M1XA 4QUIA 2ZIZA 1NUQA 5JCXA 1PWXA 3O2QB 4MRNA 4LQDA 4G8JA 5EIWA 3RVKA 1RE0A 3ASVA 3CSDA 1EXWA 3OC6A 4PHHA 4RESA 4ERXA 1FDUA 3PC3A 3WLTA 2JJ1A 1LDYA 3IQDB 3O4FA 5LWQA 3WL3A 4NNPA 5BUSA 4HIZA 2OBYA 2R6FA 3CRW1 3UOAB 4CF3A 1MC4A 1JQBA 2CFOA 5ECGC 1QQBA 3K9WA 3DKVA 4ZDJA 3WR5A 1I9GA 4JNCA 2I1LA 4MW6A 4BUJA 4JDPA 3T51B 4P4SB 4HYEA 4MINA 4WACA 2WV7A 2X0IA 3QEAZ 1OZAA 3E9EA 4WY5A 4RANA 1NW8A 1QR6A 3FNQA 2GWHA 3HZHA 3KFVA 1I2BA 3ODPA 2RK4A 1SOVA 5A3JA 4FOPA 3AM5A 3NCHA 1V4VA 3D0OA 4X1KA 4ARUA 4C14A 2IGTA 3VV2A 4AU1A 5BYKA 1Q17A 3U4QA 1JILA 1VJSA 1P6XA 3LC0A 4RW0A 4A2QA 4BN0A 1R0RE 2D59A 2PRIA 3V8BA 2ZBUA 1XIVA 1I1OA 1UMDB 1RACA 1DTEA 2DMRA 2LKDA 3DBRA 5G1NA 4AJEA 3DCYA 1N2HA 1KXZA 3FRJA 3PNSA 4O2BB 1RABA 3V7NA 2NU7B 2XADA 1HTTA 2XVAA 2W43A 4MUNA 3OE5A 4YDQA 2B21A 3KQLA 3KLOA 2O3UA 4RD4A 2BHSA 2G9ZA 3KXLA 3LPAA 2HBQA 5JZMA 3VM6A 4ENWA 1O58A 1HZJA 4O2BA 1T5EA 5ELMA 2X85A 4EDHA 5C32A 3ZV6A 5CFRA 1LLDA 4Y9UA 2AQKA 4BJ1A 1O77A 4CUJA 3KJGA 3VNUA 2H57A 3TQFA 1GXSB 2C3PA 3AOGA 3DMYA 3Q0EA 3WRVA 4BVKA 4JT8A 2XBMA 1YDFA 2R8XA 1Y1QA 3R2JA 2ZRGA 1MJHA 1L5QA 1BC5A 2IIVA 3RY8A 1I13A 2ZRFA 3PGVA 1KPHA 1XCPA 1YB2A 2GZHA 2FW8A 2Y1FA 3AH8A 5JASA 3A2NA 2ZIWB 2INGX 1FFAA 4BFZA 2AOWA 3UMMA 1YU9A 3EUAA 1YTUA 2H6EA 2H4XA 4G89A 2GCPA 1JQKA 5ALUA 2X5XA 3U3KA 2BJVA 4EP1A 1QTNA 2QR5A 3IP8A 1RXEA 1OYWA 1ATZA 3IPLA 1C3OB 2NP6A 1Z07A 5A4DA 2J3LA 3ZQ4A 4DCSA 1ULAA 2ZSDA 3GFTA 1JEYA 1EFRD 4PCAA 4NYMR 4B4VA 1SO8A 1GOTA 1XZGA 5ALWA 2A9QA 4GPIB 2GJ8A 3OTWA 4FK8A 3OQ6A 3RD5A 3TRHA 3M9XA 2UYHA 2WBLC 5DEIA 3DUFB 4ARSA 3U7GA 4I4LA 3ZK9A 2OOKA 4B48A 3K96A 3SAJA 2FWAA 3TZLA 4E08A 2IT1A 2XZTA 3HHEA 4TXHA 4Q9HA 5E6UA 4IIJB 5IARA 1VJ1A 1Q6ZA 3K09A 1F0PA 1Q0QA 3N2GB 5FRDA 3AR5A 3L8HA 1KZHA 3SKXA 5GVRA 1XJ5A 1GTMA 4QRHA 1WO8A 2OHOA 3QUCA 4L0MA 2VCHA 4XSVA 5JDCC 1GUYA 3HYNA 3WYDA 5JNWA 2O2CA 4IG4A 5CHEA 4KNVA 1ICEA 2HBRA 5IDXA 3HP7A 1UDRA 3UWMA 2O7SA 2ORIA 2Q5LA 5C7IO 1T3ZA 1B6GA 4OX9B 2V7EA 4Y2RA 4OLHA 3LA6A 4Q9DA 3DMTA 2BCEA 2GN9A 2NSLA 1V43A 2VPWA 4PZEA 4ZQCB 2CF5A 3IAM1 3AF5A 1BSVA 2BISA 1IQ0A 3EXHB 4HH0A 4ZQHA 1BJTA 1BS2A 4IHJF 3T3EA 5JDIA 2D3LA 2RHBA 5EMJA 2NXCA 2GOYA 3HDVA 1VQ9B 2UZ0A 3SEJA 1R10A 3CJQA 3H42B 3I9V1 5KTMA 5HKBA 4IQ4A 4Z86A 2PUAA 5BORA 4TT8A 2QX4A 3IAS6 4PCLA 4OXRA 1WQ3A 3ZWYA 4GKBA 4Q7LA 1QIJA 1VJTA 2VRCA 5JRZA 1PP4A 2QU8A 3IUEA 3TGPA 2JFXA 2NMVA 1Z4NA 3R40A 2FG7C 1PQYA 3FYCA 1I0ZA 2QMOA 3NDBB 1JEYB 3ZZ0A 3L3BA 4CEIB 4EFDA 1YJWB 3HSYA 5FOWA 4KRXA 1S2MA 4OHMA 4JROA 3VKVA 5CD1A 1QKKA 3LY8A 4N5LA 2V0GA 1G21E 1MC1A 1G6HA 1IRXA 1KR2A 2EXXA 3ETHA 5CA0B 1VJCA 1RZRD 1A9XA 2VF2A 4Z4FA 5C5DA 3TSZA 2D7DA 4WLNA 2VDMB 3CVYA 1S7CA 3JQAB 3KO8A 3M3HA 5C2JB 3OOYA 5K9ZA 2NGRA 4JHXA 3EVAA 4B6SA 1ULHA 2FU5C 2ZVJA 3ND5A 1JDTA 1JHQA 2W2LA 3OSUA 5LR6A 2REQA 5LUAA 4TYPA 2HMWA 5HYVA 1V11A 1J49A 5IYWA 1HZZA 2QUJA 1JE1A 3QYAA 3RJMA 4RZUA 1SXGA 3WQHA 1LA2A 3EUEA 2DZDA 3NV7A 5K45A 2QBYB 4A8HA 4UU0A 1KEEB 2OXRA 4EKEA 2AFHA 6ABPA 4M0KA 4N12A 3KHKA 4P1VA 1FRFS 2Z43A 1DT5A 2CXQA 2VHYA 3DTVB 3KP1A 4B3MB 4LZJA 1FVFA 2GJAA 3MUEA 4QUAA 5T4EA 3S28A 3N2NA 4FYHA 4YRPA 3UPDA 3V34A 4FFSA 3ZDEA 1R4ZA 4D8YA 1EKXA 1GRRA 1QQ6A 2FJPA 3C15C 1CIPA 1KAQA 1L7OA 2J9XB 4GR9A 4XH9B 4AMGA 1GZUA 3WMWA 4AUNA 2RHDA 1F8YA 1YGPA 4NMXB 1SFRA 4N48A 4WDQA 2YC2C 1ID1A 3QFCA 2VKTA 4ER0A 4IO1A 3HCPA 4TXJA 1YBHA 3CX3A 1ST3A 3EBOA 4P7BA 4ARIA 3WKDA 3U9LA 1D2EA 1IN6A 1E1KA 1VL6A 2BM9A 4NAVA 1E2QA 1OXBB 5JSYA 721PA 5CIWA 5LSAA 3T7IA 1J70A 1FSGA 2K4MA 2P7HA 1JQJC 5NULA 1FU7A 4Q4CA 2I4LA 1X1AA 2ODQA 3N9IA 5EE3A 4PXSA 4ZU3A 4OP2A 3VC1A 2B2NA 3P7MA 1ECFA 3WFIA 1W5SA 3GLFB 1R66A 2AIRA 2VDLB 4Q7KA 5IZCC 4P33A 1C9NA 4Q4DA 2YV5A 1JFRA 2ZJ8A 3C6XA 3JARA 4O4LF 1SG9A 3EZXA 4P7KA 4PZPA 4QUBA 3R7FA 3S55A 5MN6A 1E6UA 2BGTA 2FG5A 2HSWA 1EJ0A 1SCJA 2QRNA 3H9QA 5EJ9A 2B35A 4OK3A 1UPFA 3H2IA 1V35A 3F5SA 5D85A 2X8JA 3DA8A 4M46A 4TT3A 3U17A 1RJWA 4HDSA 3OX2A 3E8SA 2JCBA 2VQSA 4OJQA 5KDDA 3NX4A 3E7XA 3OOJA 2HADA 2H31A 2EFJA 3WKBA 3JVVA 4DDHA 5EINA 4UW9A 4R2HA 4NYJQ 1W88B 4RK7A 5L3SB 5FOSA 2XD9A 1P39A 2WM3A 3H3JA 4F1JA 1E1CB 2H5EA 1L7MA 3QPAA 4YAKA 1EVYA 2KBEA 2J3JA 2EW8A 2VUIB 3AESB 2HNKA 1Y3BE 3T38A 5ESDA 5DRYA 2OV1A 3AW9A 1II8B 4O4IB 4D81A 3JVIA 3UATA 3F8SA 2VJMB 1OV6A 1JG4A 1EUDB 5IJWA 3OETA 1CUWA 2FGJA 4P5PA 2ERYA 2R5NA 2VBCA 4IXTA 3ND6A 4ZAGA 3ZDZB 1XA4A 2KS6A 1BYUA 1E7QA 1WHTB 1PNQA 3DFIA 3EGWA 2G71A 1XQ9A 2VH5R 1GFZA 1N2CB 3VHXB 4GAEA 3AI2A 4DWVA 2M6SA 4BO8A 1ISRA 3X1WA 1FDOA 1YK1A 4GWLA 5CFLA 2O19A 1T2EA 3LDHA 1SWWA 3VNSA 3LFHA 1V0EA 3RSCA 2Z5LA 4BE4A 2O0JA 3KZ1E 3ED5A 1WZEA 1DKRA 5IEJA 2NO5A 4NJEB 2BKEA 1WDTA 4E4RA 1GXSA 3TF5A 1H1DA 4ZYVA 3D0RA 3ORHA 1EP2B 1Y5RA 4K9SA 4YUAA 3P2EA 4JOCA 3H2ZA 4C6HA 3A37A 1KNQA 4RK1A 2FFAA 4GD3Q 1JIVA 5KJFA 2ZYSA 3KOOA 3WWCA 2ONKA 2OGUA 3IR6A 3KAPA 3ZGXA 1G8MA 3GT7A 4G5RA 1D1PA 3PDJA 3R4VA 4QREA 3UH1A 3NHFA 1Z2EA 3VGPA 2CDNA 3TFQA 4GICA 5FI1B 3CH4B 3WGQA 4A0HA 3UMFA 5IT4A 3WNZA 4Q9KA 5FUWA 2FFHA 3K9LA 3ZZMA 4TVSA 5AW2A 1KOGA 1XMXA 1ZLXA 1IE3A 2LRHA 1KJIA 4X1OA 4E5SA 5CH3A 1ZOLA 1OSNA 1FNSA 3PIDA 4TRJA 1YKSA 2P2DA 2QLTA 4M9QA 3TLKA 2JARA 2WU0A 1V3QE 3C1AA 3KHTA 2CXXA 1EINA 2I3DA 2HCRA 5JXGA 5DYNA 2YWEA 2HXSA 1SCAA 3VC3A 5A04A 3GD5A 2VFAA 3D6TB 4P4SA 3KYDA 3QI2A 3GGSA 4FGKA 4L6AA 3OZCA 1GPDG 2YFKA 3PR1A 4Q0MA 5K3DA 3IP1A 4HYTA 1M72A 4JN6B 3UT5B 4AW9A 4B7UA 5C8ZA 5TSDA 3C8UA 4LHEA 5BW5A 4W5QA 1AX9A 4A2PA 3OM9A 3LWZA 4MS1A 3WLAA 2DX7A 3H87A 4R2LA 1HDGO 3DPUA 1YZNA 2E4UA 3MBIA 3ZE0B 2PJUA 1RRMA 3G0IA 2NUPA 3JQCA 4UHHA 2CLOB 2I2CA 4F9EA 4PQFA 3V4SA 3O4RA 1ONOA 3A35A 1DZ3A 2G5GX 2PUJA 1NVXQ 2GN0A 2R97A 1P77A 2DC1A 3B2EA 3M82A 4BGIA 1YZYA 3H2BA 4GECA 2CBGA 4RF4A 5EY5B 4COOA 2X58A 4EW3A 3CWZA 4DLRA 2QGZA 1N78A 4H0CA 1CRWG 1CUAA 3MWGA 4MVJH 1EUZA 3GMTA 3PXGA 1FYWA 2WWWA 2WDZA 1V8OA 4DNPA 3O0TA 3A1NA 4ZGGA 2XUQA 1T6YA 1ZN2A 2FWIA 3MG9A 4E09A 2F9MA 3CVWA 4TMWA 1A5SB 1D6SA 4WZBA 2YWDA 2R5WA 2ZJ5A 3ONVA 1L7DA 3CXRA 1P19A 2GTIA 3QX9A 2XUIA 3PRHA 3FSEA 3ICPA 4JR2A 4OA8A 3T54A 3K70C 1LDMA 2V03A 3CKLA 1CQPA 3BF7A 4QPZA 1N2IA 4MKXA 5BNFA 3W3AD 4E12A 5FAKA 2C9BA 1QUEA 4INZA 2QT0A 3J81k 2C95A 1PEKE 4OQLA 2OHXA 5EIXA 2ZUSA 3D4IA 3EIOA 2O6HA 3PDHA 5DK6A 3ZQJA 4DA9A 2R7MA 1B00A 1FLDA 1T1RA 5KZMB 1E4EA 4V38A 4ENQA 2NYVA 3K9FC 3H4VA 4EM6A 4NDNE 1NQAO 1SPBS 2VCYA 4QTTB 5DHSA 4U00A 3RBZA 3VVBA 1KYXA 3IDQA 5DX0A 3PNBA 4LDZA 1BGXT 1V7ZA 4MULA 3LAWA 4L0QA 1GG2A 4OG2A 3FVVA 1PVDA 2VNKA 1KKUA 5DI3B 3G7SA 3KFLA 4GX1A 4ML3A 4QOIA 1VQ5B 3FETA 1P2UA 3T7CA 4A2CA 4BS9A 3ANNA 2EHJA 3CLTC 4IDEA 3DEJA 4E51A 3HDJA 1SZCA 4D3XA 4XQFA 5GMOA 4Y67A 1YR7A 1ZMTA 2E82A 3NW9A 3DSRA 4G6ZA 5AXAA 5FUXA 3L7IA 2QJOA 4PG8A 3ELYA 4CKZA 4V02A 2ZPTX 4J1TA 3REOA 2AD5A 3T94A 4KITB 2CFTA 1XMIA 2CHVA 2XCUA 2WJZB 2JW5A 2BF4A 1OOEA 1ECLA 4K81B 4ROTA 1CETA 4DQ0A 3H19A 2C7OA 2VHVA 3QNWA 1E6WA 4MP3A 1ORHA 1Q84A 3CCJB 1AKYA 1G8FA 1U7HA 1Y3FE 3O3MB 4HCJA 5IKOA 3BY2A 5LJLA 4Z4IA 1VPEA 2JFGA 2OL4A 4GI7A 1NTOA 2CHQA 1ISMA 1MVLA 1ZLYA 2A7QA 2LNDA 2XUJA 1NVMB 1E9BA 2ZJ3A 3FH0A 4N3CA 3G68A 3TQHA 4BNJA 4EDFA 1RYHA 1Z29A 2I6SA 3IAHA 4UPVA 4AK9A 4TXMA 1Q7EA 5BT8A 1QQ7A 2XLCA 3KYCA 4U9HS 3ICEA 1DE0A 2F8LA 1AF4A 3HGQA 4Z0HO 4Z8YA 1V5WA 3RHZA 1C8LA 1UAGA 3SJBA 4ECAA 2YRFA 3R44A 2A2ZA 2P69A 3IT0A 2HU8A 3OPYA 4PLHA 5G0WA 3OPYB 1UOEA 3EVBA 4XQ9A 1OFUA 4EPWA 4UM9B 1RWXA 2FW1A 4HLDA 1HORA 3JYOA 4PS1A 2IYTA 2YYZA 3WLRA 1E77A 2FX2A 3G6WA 1Y9ZA 4X1IA 4FNOA 5F1OA 3TD6A 3EFHA 3SEZA 3WOHA 3ASRA 3CB4A 4LZNA 3QKRB 4AN0A 4L85A 4CMIB 1HTBA 1SHKA 3ONNA 2XNJA 4M87A 3AHCA 2QLJA 5JAIA 3U5ZB 1MD9A 2VWHA 4D3SA 4IY1A 3MRSA 5GJCA 1RYFA 4AMBA 3RAPR 3RSGA 4NU6A 1KEEA 1PL8A 3ZK7A 2GXSA 2QBYA 4YPFA 4LWZA 2D5CA 2KWIA 1H9CA 2OKCA 1TZMA 2RKOA 1CP2A 1PFUA 2OD2A 1K3TA 1CD5A 5JD4A 1YQDA 3N0RA 4RPGA 4GC9A 2EKPA 1G8KA 3G9UA 3RFXA 1NXQA 1R37A 2GZ2A 4RQTA 1U4NA 3C4QA 1I32A 3OE4A 3TTSA 1JSRA 4CGYA 3I1YA 1A77A 1G3MA 1TAGA 4YP0A 1TCAA 1JVBA 3KUKA 4FNMA 4IDBA 5B58T 3CONA 2WD9A 4Z4QA 2H7YA 2XA9A 2OCYC 2XOXA 5BN5A 2C5AA 2P65A 1CC1S 2EBFX 1GP2A 4DHEA 3A9SA 1NZFA 4AUEA 1QP8A 3PNQA 1D04A 2A86A 3QXJA 4IHKA 2XCQA 3LL4A 1EDOA 2ZAIA 1VE1A 3N75A 1HZZC 5IH7A 4EUSA 4DR5B 1ZBDA 3DEZA 1AVTA 1WVMA 3EXEB 3DF9A 1EUCA 4I5IA 4F06A 2I87A 5C51B 2B6HA 4IILA 1SOUA 4HNSA 3ABZA 2ZWMA 3SKYA 3WIDA 4CIXA 3GCXA 5T6MA 1IH8A 4JJFA 3HJRA 3PUWA 2GZ3A 2B4YA 1DAEA 2HOQA 2AUNA 2ZXHA 1X1RA 3RI3A 3SEAA 3ZOZA 1USGA 2O23A 1FCJA 2GASA 1DB3A 3IESA 4H1VA 4YRQA 5DIFA 5L3QA 5L6MB 4FFOA 1ZEJA 2QX8A 2IS6A 3GO4A 3KV1A 8ABPA 4IFTA 2CNKA 5B4VA 1USIA 1YIAA 3CH6A 3FNRA 1ONNA 2ZJ6A 2WB2A 2JB9A 3FMVA 5CB8A 3HA2A 2IYXA 4YPVA 1GARA 3DGFC 4ZEWA 2JIZD 4EPTA 1QYVA 5DXAA 1KEPA 2IP4A 2VYFA 2CB9A 4H4DA 3AWDA 3IOCA 3L7DA 1Z0JA 3SHVA 2VJJA 4BNXA 3RBXA 4Y2JA 3F9IA 5FPHA 2WILA 4LV5B 1W8DA 5BW4A 3ASQA 3ZHSA 1ZK2A 4ZMSA 1PZNA 3ELWA 2QORA 3N5CA 4FCWA 4AG3A 4MUMA 4BUCA 3OP1A 3FUXA 4XYLA 1S6YA 1X7GA 4L2IB 4KNWA 3BRWA 1OGJA 1U1CA 3GNSA 4DCNA 4WXEA 3N2GA 4K46A 4OPVA 1BWPA 2EF1A 3LX8A 3FJYA 3LL7A 4EFLA 3KLMX 4XSGA 3QMPA 1SBHA 4GMFA 4J7UA 4Q19A 1XD9A 3P0HA 4BN4A 1PKEA 1AHNA 2AEJA 1ZUD1 1QO7A 4DSZA 4XFKA 1XXHE 4H6XA 5FPQA 4EQZA 2PJDA 1ZGJA 2QLNA 3NP9A 4YUVA 4O3FA 1R88A 4E88A 1N5MA 4I55F 3DTTA 3IE1A 2RHTA 3STTA 1TMGE 3EEQA 2XXAA 3AUKA 3KQHA 3INNA 4B34A 5E9JA 2EOAA 5FOXA 4BJ5A 3JXEA 4P3PA 4B3SB 1KC1A 2PL9A 1F8XA 3BGOS 4X63A 1JTFA 4Z0TA 3JQGB 4HBGA 3WHIA 2E4ZA 4K40A 5KTKA 3C8HA 2V6FA 1XJQA 2QQ0A 2OP0A 3MGBA 2GZDA 4NH0A 4HWRA 1J1IA 1YK0A 2W00A 1Z0AA 4XCQA 4ZPJA 5A9RA 1ZKDA 3VAAA 1HYQA 4OMUA 2PBRA 4D4JA 1W4AA 2QGNA 1NF3A 4V0LA 3SYTA 1QFZA 4R2WA 4KXVA 1II9A 4ZYYA 3PQ8A 4WZKA 2OM6A 4RADA 5DX1A 4DEYA 2FQ1A 2VC2B 4FINA 5I4IA 1XI2A 3AVUA 1JJ7A 1L5MA 3CMCO 4GGPA 1N8SA 3K05A 3T3OA 4TVOA 4Q39A 3KTDA 2BN4A 2QP9X 4PV7A 1RXVA 5EEHA 2HF8A 2WWXA 2Z95A 4GLJA 4P25A 2WUWE 3CO5A 1KHTA 1GSAA 4LJKA 4RENA 4W6QA 4WK6A 5A02A 1KXJA 1JAYA 5D8DA 4M9SA 2VYQA 1CE8B 1E20A 2RAPA 4S2EA 4UJ5A 3RJ5A 3BGWA 2OCLA 4OGKA 4EKDA 2W6JA 5EXPA 1BQ4A 5ETJA 3QWIA 1XTTA 3ZCTA 4K9MA 2L69A 3L1JA 4HNRA 1U8TA 3DBLB 3LOPA 3BEOA 4JP5A 4N1AA 2J7KA 3HBFA 5CDHA 1H05A 1TC1A 4M7OA 3KUDA 5HEKA 5HMMA 4LYHA 2DRIA 3SQMA 3ILXA 1BN7A 4ARCA 2FZEA 3GG9A 3HSSA 1K6JA 4WJLA 4FQ7A 3WQRA 2HLDD 4JHLA 1DKMA 3OWHA 3P4YA 5J2UF 1R50A 4ALMA 4GL4A 3L05A 1H9BA 5CFZA 1ABEA 4E5VA 1J5PA 3FZNA 1TF5A 2QPTA 1WHTA 1IBSA 2WT8A 2COKA 1XPOA 1X38A 1P31A 1GADO 3DZDA 3AB7A 4QASA 3W9YA 3E9NA 5FEMA 4KK4A 3WK7A 1CS0A 1Y80A 3NIGB 4BMVA 2QR3A 1BO6A 3EZ6A 3ZLJA 1J2JA 1EI9A 3QU7A 4C2TA 1O4VA 4QWWA 4JXJA 1P2DA 1HE5A 4A6XA 4EGSA 4PY2A 1UBJS 1Z9BA 1R0XA 1K5GA 1UMBA 4KR3A 1AGRA 3KBOA 1ZIPA 3OP4A 3T4PA 3VRHA 1AH2A 3JAMA 5AJZA 1TNDA 1DKUA 2W2MA 4X6UA 4B71A 2R6GA 2C61A 5IJ9B 1D4AA 5D84A 4P26A 4LVCA 1N3IA 3M3DA 1X15A 2ANBA 2X1VA 2X5KO 4FEGA 4HGNA 3SMQA 4BKUA 4L8LA 5JI3E 5KNCH 1QFSA 1SJ9A 3IKMB 3PNKA 4PYOA 4O25A 4QVKA 3K94A 4XEUA 5EQJB 4X54A 1FA9A 3E0QA 5HILA 2WTEA 3MXOA 4GPAA 3VKHA 2WC1A 3V8PA 2QMQA 2XECA 4QO7A 4EQ6A 4CKCB 3GGDA 4WY8A 1YR1A 1JKJA 3L7MA 3H75A 3R9IA 3DMGA 4CL8A 4ZPXA 3ADBA 5H9WA 3HXQA 4AQ7A 2OBMA 2I7VA 3CLSD 2XMBA 3NHKA 4Q9IA 5GM1A 4TYWA 2QRVA 2QW8A 4G4JA 3GCDA 1K7EB 3K4HA 1N2OA 4CTMA 4KPEC 1HE4A 2WKWA 5ALDA 5CG1A 1FFCA 1EVJA 1AURA 2CDAA 3EFEA 2HMTA 1B7GO 4B3XA 2X3YA 2ZXIA 4MAFA 4KNYA 4CTNA 2HPZA 1ZJJA 3K4QA 3TRDA 4BNKA 1W0KA 2V8BA 2GESA 4WH0A 2AEEA 2PCJA 3LI2A 2ZZQA 3L41A 4G5SA 3BOSA 4LF8B 1OWLA 3O6VA 4MLCA 3W7VA 2HJHA 2HREA 1UBCA 3ZVMA 3EXHC 1UFOA 3H86A 3G2JA 5AKHA 4BO0A 3IKLA 4URZR 5GIOE 4CCSA 3W5UA 2X9VA 3SSNA 4KX5A 2VVTA 4N8SA 4G23A 2YVLA 1KKLA 1C30B 2ANCA 2F62A 1LH0A 3EUFA 3HYLA 4X3OA 4MWCA 1XVLA 2XUGA 3ZVRA 4UOEA 4RL4A 4KOEC 4ZQIA 2I7TA 1YCGA 4CIYA 1VHTA 5JEEA 1PFQA 1RKXA 2H4ZA 4ME6A 1K9MD 2WLTA 3EAGA 4W1PA 4XUDA 1R00A 2YWRA 4V24A 4DR3B 3L84A 2B0CA 3ESAA 4OI2A 4JFRA 1N32B 2WOJA 4MKHA 3TIXB 3U62A 5FOVA 2ZB4A 5J47A 4N39A 3TAXA 2QQ5A 4XD7A 4IMPA 4KXYA 3EQ2A 1E9CA 3ZBUA 2PZEA 2YZ7A 3VX4A 1KO8A 3Q1LA 1K7SN 1SVKA 1JAHA 4REQB 1MB0A 4PAQA 4RFLA 1BXKA 1C3JA 3OTGA 2R6CA 4K8OA 4PQRA 1XZCA 3CUSA 3NRCA 4C4OA 4CEJB 4LMPA 3SLKA 1CV2A 1DC8A 3GRFA 5IFLA 5JANA 1E6EA 1SD2A 2IEDA 1XCJA 5JW6A 4L4UA 2VK4A 4C0XA 2ZRLA 2CVHA 3O90A 1CYEA 1G3QA 1ZU4A 2W2LD 3ECSA 3O82A 1NVBA 1O96A 5CA0A 1LPNA 4IYRA 4YECA 4RPBA 4WUVA 1SC4A 4LOJA 3GD7A 2ODBA 1IBLB 2P6PA 1LFAA 4JKIA 4ZAZA 4JQZA 3C3AA 4MS3B 1XSEA 4LMRA 4YAWA 2QUKA 1MABA 2REXB 3F7MA 4OU4A 3QVOA 3SXUA 4W82A 3C3YA 4CMGA 4B4WA 1EBUA 3O3CA 1KBOA 4WZAB 1Y5IA 3IVGA 4JX9A 3ZXUB 3JYQA 3E2IA 2HLHA 4XCXA 5DX8A 3MRVA 5AQEA 2JJ1D 1K5DA 4ZT2A 1YWGO 2PXCA 5AKLA 3WJ2A 1QF6A 2V5VA 3K70D 1REQA 4G0QA 5LBTA 3A70A 1D0IA 5I48A 1QHSA 4YEDA 4S3MA 4LYAA 4WASA 4AMVA 2C4VA 1EQUA 5FI5A 3V4FA 4FFLA 1QE0A 3PFFA 3ZHRA 4PZ9A 5EZ5A 4HDOB 2DFLA 1TJNA 2BHRA 2RBKA 1IMJA 3IPRA 1M34A 2DSNA 3VVLA 7GPBA 3AINA 4EHBA 4MS4B 4D3YA 4EIWA 3WRYA 2VZLA 1NNI1 4AZSA 2VJBA 3MVEA 5LQAA 4BEJA 2QD4A 5AUPB 2YY7A 1RQRA 2BELA 2BR4A 5FO1A 3NKVA 4C88A 4BLSA 1H2AS 3U37A 1CCWA 2YUTA 4NEHB 4UVHA 2OLEA 4UATA 4BMNA 3D7NA 3GJQA 3JD3A 4IGFA 7YASA 3OEYA 4NCXA 2WJGA 2P9CA 1SN7A 1C4WA 3QFTA 1P8AA 1NFQA 4CQMA 4EG4A 1PU2A 3H4IA 4J16A 5LZ5A 4D9CA 1UKAA 3LT4A 1TQ4A 2A4MA 1PFGA 2P2NA 1JU9A 3OT1B 2ORWA 6GPBA 3RAFC 3BSFA 3FCOA 2R87A 2XUFA 5CT4A 4YDSA 3DL2A 3DTVD 4UCXA 1AZLA 2JJ2A 1OB2A 3KSZO 3RSHA 1SHLA 3DFZA 4ZK6A 5JADA 1RRCA 1U2QA 4LRUA 2P79A 1T0IA 2IYOA 4GMXA 4WCFC 5IJZA 1M7BA 4PGOA 1V5VA 3WXMA 3PYLA 4WN9A 3RRNA 1CY0A 5CA1F 5H83A 3D3EA 5FTNA 3U61B 2QM8A 1V39A 1IPHA 4YCMA 1KJ8A 2P6NA 1J9GA 4BB0A 5F98A 5AI5A 5LKRA 4RORA 3I8OA 3JQ9C 4TLMB 4OGFA 1VKOA 2NPOA 2G88A 4ZRMA 4O2AA 1HURA 2Q49A 3L43A 2HQRA 3CM0A 2V4DA 1IUKA 4Q47A 5CAEB 2D8AA 3GAZA 4PBSA 3R5HA 3VDQA 5DYTA 4A82A 4JC4A 2X6RA 4PAGA 3WL8A 4R1NA 3PNOA 1CJSA 1HZEA 2EKDA 3MGGA 1XL0A 2XTZA 2HSDA 3WX0A 4DS3A 5EJAA 3HB5X 5BQPA 4BQQA 3QEMB 1F3OA 2W37A 5TIIA 4G5FA 4MJXA 5EL0A 4LBZA 3KX2A 4YRKA 3GAAA 4BVAA 2AFIA 2HKIA 2F1IA 4M36A 3C5CA 3V4VB 5I7FA 1ESCA 2H16A 1F0YA 4PTYA 1YDMA 3A1WA 1R6AA 2XQVA 4RETA 5T64A 2VPPA 3VHRA 2OFFA 1TUGA 2R5FA 3LNTA 1CUXA 5BSXA 1LBIA 2VZEA 3K1YA 1ZGGA 1V9CA 4MKGA 3QHAA 1JAIA 1G6OA 4MICA 4R9UC 4REOA 5E2AA 1SQFA 4CLXA 4F71A 4G97A 1S4MA 5LQMA 4AWAA 4YXWD 2JEZA 4CKXA 4ABTA 4F04A 4DIOA 3KL4A 2BDTA 1OI4A 2DPYA 3UT5A 5B3LA 4PFKA 2NSYA 3E70C 4EW1A 2WF7A 4C6TB 3DV0A 4DEVA 2P2YA 4HNGA 2V6JA 4M0DA 3WYAA 4RKRA 1GUDA 4BGDA 1C81A 1W87A 3UXYA 4E5KA 2OXFA 3MZ0A 1QPGA 3RUPA 1TQHA 2GKOA 4GZ6A 3ZY4A 4EF6A 4ZHSA 4QXAA 1NUAA 2ZL5A 4CU2A 5K6RA 3LHDA 2A94A 3ZHOA 3DBOB 3GFVA 2OO5C 1CJCA 1ND5A 1PJRA 4PYQA 1EFVB 1D7AA 2VJDA 3ZIAD 1T9KA 2HDWA 1ZN8A 2AG8A 5K7SA 3S5JA 4KTVE 5ALMA 4MVCA 2QX6A 5AN9A 4FCTA 4GSLA 2WYRA 3D31A 1FP2A 1UL1X 4IEEA 3ZLUA 5EJ4A 2BKLA 1YB1A 2BHLA 3FPAA 2EW1A 3R7LA 2XAUA 4ZOLB 1E4OA 4TQGA 5JPCA 1FTNA 3FOAA 3L5KA 5CXSA 1UC5B 2FPSA 4KBGA 4HGQA 2AJCA 3OU2A 3A6KA 3KKLA 3W7BA 4PM4A 5ICFA 2Q0XA 2GWRA 1EBFA 5I7UA 4DV5B 4FSDA 4KWHA 3U1TA 4QYMA 4N0DA 3I0MA 4ZA2A 1W1IA 4S1OA 2OB2A 4DR1B 5CAEA 2HMUA 2NUAB 3UM9A 3JVDA 2YIVX 4QLAA 4W5NA 1CUZA 3RREA 4OAOA 3D8TA 2LIPA 5CW1A 1E2NA 3T41A 2MIIA 2VF8A 3O26A 4FXOA 1GQRA 1CDDA 4JT4A 5BOSB 1CUFA 3DZGA 3B6MA 4EFNA 4PLVA 1DMRA 3FBWA 1PFYA 3FBTA 1PNRA 4LZOA 1BXRA 4JVMA 2G8LA 2Q5IA 2ZIFA 1L4UA 4Z4EA 4DLXA 1AQYA 2Q1YA 5DN6A 4P3YA 2PUGA 3CVJA 2DTEA 3HEMA 2Z57A 4N0EA 2W8ZA 5FJJA 1QV6A 1YQWA 1Q15A 3W34A 3G7UA 2RHLA 4PRLA 5A4KA 5EE5B 2PLRA 5IVDA 5HIAA 3K92A 1XVVA 1ZMXA 4NPAA 4AQYB 4YBZA 1DPGA 3MS2A 1RMYA 4KV7A 3GDFA 4YCLA 2BMEA 1TIKA 1W34A 3WYEA 3H1PA 3L46A 5TQ0A 2ZITA 1ODLA 4ZVTA 3RQIA 4DRYA 1A69A 3PDUA 3VO8A 4EECA 1LEHA 5HQJA 1QDEA 5KOHB 2D2FA 2XQJA 4IQGA 1UJ5A 4IIHA 4TT3D 1JWBB 3F6SA 3C5EA 3L0YA 2OZVA 3GFSA 3LU1A 4TOIA 4MV4A 1XU7A 3ESXA 3DXFA 5DWDA 5FUBA 4M9CA 1VIYA 3DT8A 4HDSB 1U0JA 2OD9A 4FFMA 5EE1A 1NULA 4LFCB 1CY6A 1F2DA 3I37X 2BTQA 4NCBA 2HD4A 1OAAA 2XJ9A 4LC9A 4PWYA 4HK4A 3D9QX 4F12A 1ZX1A 4ACAA 3BHIA 5KNCD 1SU7A 3ZU6A 4DB2A 2BZGA 3E35A 4CWAA 3VR5D 2BGKA 2Q4TA 1DMSA 4XD2A 3G2IA 3RUCA 1RLJA 4E2XA 4V3BA 2ZXUA 3HKDB 4MRSA 4Y9SA 1EXNA 4R4JA 3UFXB 4DM7A 2XRFA 4PPFA 221PA 1M2WA 3DEHA 3KQQA 3RT7A 2Q7DA 3STWA 4PSUA 2UVPB 1ISSA 4LYGA 1OGYA 1GZHB 2B1QA 4MMXB 3PGLA 5LUBA 3RRXA 1YZFA 3BYZA 1VXOA 1DBSA 1P7YA 3CV3A 3EGDB 4ZHQA 1KEKA 3GI1A 4EHLA 1FY2A 3AEKB 1C0EA 5BR8B 3OZWA 4MB0A 1EJBA 2R8PA 3SF0A 4G8DA 4RTJA 4PO9A 2FSVC 2V65A 4MR7A 4CNQA 5CLJA 1X8JA 3JALA 1B23P 1W1WA 2ZQ5A 2NZYA 3OPNA 3DPIA 4CN8A 1IY9A 1T0BA 1KSFX 1HPLA 3DMTC 4YROA 2I4NA 4JJ4A 5FEUA 5UKDA 4YCNA 2Q45A 2XXJA 1SBQA 1O87A 1VB3A 4INOA 4MB6A 4OVKA 2FCRA 2GJ4A 2J07A 3AFHA 5C18A 3GEEA 3M3PA 1RJDA 1IN4A 1L9XA 4XEHA 1R15A 2GF9A 3PQ3A 4YA6A 5CTAA 4YYZA 5LZ2A 1CZOA 3GLUA 4C7JA 3CMMA 2XXBA 3NHMA 3MJ4A 1APBA 2JA2A 2FUG6 2Z83A 1E7MA 4FX2A 4ZAWA 4OBXA 3R0ZA 3EARA 3RS5A 1EZ1A 3ABOB 2KVOA 3FLAA 2J30A 1HQCA 2TMDA 4I1UA 4NOLA 1RJGA 4HLCA 5TS2A 2GVNA 4M1OA 4DJTA 3Q2IA 1NBEA 1U5BA 3DPSA 2GARA 4WINA 4C9BA 3B3JA 3UAZA 1ADGA 5C52B 2EAUA 4LRYA 3R23A 1NDQA 5DCUA 4IJ5A 2G83A 4C07A 4DPMA 2I2DA 1GUAA 5HR5A 4MMZB 2JJ2D 1CW2B 3HFSA 1WOOA 2BEWA 1UBGA 1HDIA 4KK3A 4BTEA 4BLUA 2OGWA 2NVOA 3SN6A 4C5AA 3NUGA 3ZV4A 2WICA 5HJ5A 2JFBA 5E7QA 2WUEA 4TTPA 2X15A 5EHQA 3E3AA 2JBAB 4XNFA 3CW8X 2BJWA 3KHSA 1H4TA 3F6CA 3I05A 4POAA 4RZHA 4MXDA 3II6X 3FI9A 2ZETA 4JY7A 3N2ZB 1XALA 1YJCA 4YWHA 5FCDA 2G1KA 2JATA 3TB4A 2E87A 4E13A 4ETWA 3QKRA 4NYJR 3PUIA 4JYPA 4PGGA 3WICA 2B9EA 3DD5A 3NVAA 4PFJA 3WC4A 4AUMA 4EVQA 5LPNA 4YUWA 1G6KA 2G3YA 3ACCA 4IZOA 3OLZA 1VSTA 3QUTA 4W7SA 1TJ4A 1QYXA 1WZIA 2I1WA 3NDJA 4O29A 1Q3KA 1Z63A 2DQ4A 2H0AA 3D7LA 2W11A 1GGKA 5HA5A 2BVNA 2NXJA 3FMOB 3AEKA 3MWJA 4RTLA 5KQRA 1P6QA 1HO3A 3H11B 1ENOA 5H5JA 1LSUA 2VBUA 2GD6A 2QY6A 2C9ZA 1O8CA 1YBFA 4WLEA 3CSUA 3PUKA 2O5RA 3RYFA 5BQXA 1W7AA 1PNVA 2D3WA 4I36A 3TNLA 2ZSIA 4ZV9A 4JKYA 2AN4A 1TCCA 4LRSB 3HI6A 4I9GA 5EQFA 4RELA 4BO7A 4ZVMA 4Y98A 1MN6A 3ZZNA 5HKAA 2OV4A 3IHKA 4KHPB 1OXUA 4TYNA 2VPYA 1JR6A 2C4TA 3KZKA 5TQJA 1IY2A 1ZH4A 2RGYA 3E5RA 3R5TA 1ZRSA 1N1EA 2XTMA 5AM0A 2OZEA 4EJSA 1OA1A 3KB6A 4MDEA 5JBIA 3BCHA 4D92A 3R5FA 3IR5A 2PSFA 1T9BA 3KE8A 1DEXA 3R7SA 4DJJA 3LNCA 3KL9A 5HGJA 2RG1A 1PE0A 1TE2A 4N9QA 1IN8A 1WDLA 4FKBA 5F4ZA 3GDWA 5F7ZA 1GRNA 5F73A 1SA0B 1L5LA 1MEEA 3K6JA 4OQZA 4G0XA 2RBGA 3PNLA 1KQGA 1W5TA 1PEYA 1GTSA 1EP1B 1ATIA 4HDQB 2QSUA 2AJTA 4K2AA 3SXPA 1E92A 2JF0A 3ZNPA 1N34B 1KOJA 2GT1A 3AV0B 2RJOA 3GJ0A 2W2KB 1NUPA 2DM6A 1CJTC 3LVBA 3HJGA 3RG8A 3KWLA 1JDVA 1UIRA 4Q4LA 4C0HA 3EBLA 1FUIA 1NQXA 1U8CB 2NXNA 3JAKA 3CX8A 4CG1A 2H5JA 3QHQA 3LT5A 1LY1A 1ZRNA 5HFJA 3VYRB 3DFUA 3ICQB 3H83A 1J22A 3NHWA 5AM3A 1BX0A 1D2RA 1HOTA 1XJCA 1XK7A 3L7BA 2PQ6A 3QRWA 4EY3A 3LH5A 3V97A 1PK8A 5K4GA 1UXKA 4L7VA 2DWCA 1FP6A 1L5YA 2IFTA 3UN1A 1GGNA 2QLFA 1ZSNA 3HV0A 3P2YA 4NWIA 1JLLB 1NIPA 4QIHA 2JCVA 2QWXA 3T1NA 3BCDA 3HDYA 3IOEA 4P3KA 2WR8A 1TAQA 4QOSA 1C9JA 1NDUA 1IBRA 3Q40A 4GPTA 4RIHA 4D0RA 3KPVA 5AJVB 1F5SA 1QRDA 1TL7C 3NAZA 2GCOA 1TGVA 1X8LA 3EDCA 5I4CA 1U2RA 4JB8A 1RQNA 1H69A 1GVHA 1W2GA 1J8DA 1UJMA 3ON5A 5CBPB 5T5QA 2X4IA 4MRVA 1GILA 4WZBB 4ZHQF 4EK9A 2BRUA 2VPQA 4XGNA 2VTVA 3DH0A 1DJPA 3IHLA 1RVDA 3RS9A 4NU5A 3NI2A 3CUWA 2DR0A 3NAMA 5GWXA 3AW8A 3W6ZA 4ADSG 4C4YA 621PA 4M1KA 1PGQA 5HTKA 4TKVB 2XHEA 3KR1A 1D1QA 3PDWA 1PRYA 4BP3A 1FYDA 3LQ6A 2IITA 2WIJA 1M5TA 3OIVA 1GCOA 3R0XA 4PYNA 1UWVA 5KYGA 1KJ9A 5CJPA 3RSOA 2F1KA 1WDWB 4HGRA 2BBWA 1Q7YD 4L75A 4UTXA 3T9DA 5KU7A 4DMMA 1MHPA 2A92A 3CUKA 5LIPA 4P9SA 1TK2A 2PX5A 1AUVA 2D2IA 5C3UA 1YBVA 3FF4A 3GYBA 1DFHA 3RU7A 3C3EA 1A8QA 5I5EA 1N77A 3FFAA 1MG5A 3LYLA 4WJZA 4ETMA 1W19A 3VC2A 6LDHA 4MYDA 4OK6A 3IB3A 3DMFA 5JS8A 2DBZA 3SC2A 2WB4A 3AESA 3FCYA 3NTUA 4OQXA 5FFMA 3BTVA 3BJMA 3KJQA 1Y7PA 4QUEA 2C2KA 1O5OA 1C1YA 2IKQA 3H2JA 4E5PA 1AUPA 5IBPA 1J5XA 1R8YA 3I9KA 4LTNA 3TUZC 5HIMA 5LXTA 3A0UA 3A05A 1KNXA 2ON6A 3LLMA 5JCZA 5KNCA 3SHWA 2EQAA 1JEJA 1U3FA 1IULA 1F2TA 3A1DA 1TEZA 1VL5A 3UTCA 1WHSA 1LK0A 1NJ8A 4JCOA 4M86A 1A7AA 4M1QA 3RTDA 5C5IA 1EX6A 5HXAA 2OO7A 1WAMA 3FOEC 2BMDA 2Y1XA 4O1HA 3ZHUA 1C7JA 3EZLA 4LJYA 1J20A 5BWLA 3QJGA 4OI4A 1L9KA 3WTCA 2VHTA 4QU5A 1X7HA 1E2LA 1MX9A 1OWNA 5FIUA 2CKMA 2DUMA 4J29A 4B87A 3ZGZA 1I4OA 5DT9A 4PGMA 2DYIA 1JJIA 2NZVG 5A6SB 1ADFA 3CCUB 1U04A 1U0TA 4XRGA 1P62B 1NVEA 4P54A 4WESB 3LSYA 3U1BA 3WLFA 3GJTA 3REGA 1Z4LA 2Y0EA 5L3QB 4J7XA 1OAOA 3MT7A 2J85A 4NJEA 3ICWA 2AOVA 5SZJA 2RJNA 1R3DA 3OAAD 4DSNA 3SDSA 4IIXA 4F8JA 5MN5A 4C0BA 2ZBGA 4Z1MA 2FKAA 3D8RA 1YI8A 5KNDH 5EUCA 3STHA 2H1RA 1XCGB 4MQBA 2WZBA 3S1AB 3L8FA 1EA7A 7ADHA 3HVHA 3I5UA 1C0LA 2NYUA 4MO9A 4EG6A 4YRMA 5BPFA 3CCVB 1TTTA 5CMLA 2XODA 3TLGB 3JQQA 3MS4A 4KKUA 4WK2B 2IDJA 1HX7A 1A7UA 3GJ3A 3DL0A 3KOWA 1M2VB 3KUCA 2V7TA 4WVFA 4BRWA 4ALJA 4FYVA 5JT1A 1U80A 1GY8A 1E7RA 1EU1A 1XAHA 3G71B 1P4RA 1TT5B 1V3TA 1XQ6A 2V7QA 1Y33E 2XB6A 3MOGA 4LA4A 3GXBA 5DHAA 2WHRA 4DC9A 4OBEA 1U8YA 3SBEA 3ZW8A 4GMKA 2Q4BA 2R79A 2AFHE 3ACDA 2OV3A 2BMVA 1STOA 3CH5A 3DJFA 2W2OA 4LWQA 3ZCPA 5JJBA 2NZWA 1ULUA 3DQZA 3BJZA 4CG3A 2GYYA 1RKQA 4OAPA 1YMQA 4UCFA 1U3TA 3NNDA 3AL2A 2YRXA 3C87A 3OFND 3T3PB 1NBWB 2F00A 2JCSA 3V8VA 3WK4A 1ZD5A 2XF2A 2I55A 4DLUA 4C21A 2DBRA 1F17A 1WPCA 1HH4A 4CLOB 4IVQA 4G9GA 3KOYA 4D42A 1GNLA 1AKUA 3MWEB 3UK7A 4C3ZA 2MINA 4YV1A 5CT5A 1Q91A 1KERA 1UKEA 2JCXA 4J1QA 2WA2A 1E61A 3RSSA 5A8AA 4X0CA 4PICA 2ODTX 3HNRA 3MS7A 2KMLA 5D1NA 4YRRA 4DZTA 3QIAA 5CNJA 2I03A 3LK6A 1F38A 3EJWA 3I1JA 4QXOA 3P2OA 5JWHA 2GJSA 1M34E 5K20A 1JEAA 1K6EA 1N6NA 2POCA 1PW5A 3ONWA 3U3MA 4CCWA 1B8UA 2WAXA 1CFZA 4FIZA 3LY9A 2BI8A 4WLOA 1N2EA 3D02A 5AKGA 4GKJB 2L42A 4OXIA 4B6RA 1CVIA 1Z4KA 4FOTA 4MW0A 2CRVA 1PJ5A 4KO3S 3TJRA 4ZTZB 4U8HA 1RZRA 4GX5A 1ZVVA 1JH9A 3AI7A 3P19A 4KEAA 3I6ZA 3E23A 1M83A 4N5HX 3GJ4A 2QVGA 1LU9A 2VZ0A 4P84A 4Q03A 4HX5A 2VUUA 1XU9A 5IWAB 1SXJA 1FDTA 2DQYA 4GEGA 3OMXA 4QPDA 1HC7A 3N5KA 1W47A 4EGQA 2JCGA 4JUFA 1XC7A 4GUDA 4IS2A 4D4GA 1JIIA 1T5TA 5JZOA 1BNCA 2Y77A 5K0ZA 3ZDRA 4RD1A 4PHGA 3S1LA 1ILEA 1WSAA 1LW6E 1P74A 1KGDA 2R7NA 4DMLA 3WL5A 1G5IA 2FB9A 4JMQA 2IX9A 2HEGA 2GPNA 5A1TA 2RHGB 1IG0A 4TTQA 5EA2A 5I4KA 1T9CA 4EY8A 3LNNA 3B70A 2LKCA 2C83A 3AEQA 3TH5A 5IM5A 2F8TA 3BD7A 2RGEA 4X0EA 5E6RA 3TZBA 3C43A 2HQ1A 3RWOA 4N9WA 3ZWNA 1COWD 1NW7A 2DWPA 2X0RA 3R5KA 4AWXA 4EBFA 5IN4A 1F6DA 1W5FA 2OENG 3M6XA 4UULA 4C87A 5KTYA 5J4KA 1MHTA 3FLBA 4OKNA 4PLCA 1MFZA 1HDXA 1DQNA 3U3DA 1QVGB 3OKFA 2FH5B 5KHAA 3P2KA 4KGDA 1PL7A 4FT4A 4TZ6A 1NE7A 3T56B 2QXTA 3QMVA 5EXXA 4MA4A 2C57A 3ZE6A 1QYCA 3G6KA 5AKZA 3NWPA 2PZMA 2WQ7A 4B76A 3WBKA 2XDWA 4I2NA 1E89A 1ZITA 2IUSA 5LZ8A 2WHYA 3D3WB 1Z0IA 4XPIA 4Q9JA 1KA9H 2FMUA 4PR3A 4TMZA 4IIEA 4QGGA 2JGLA 1EFLA 2CVFA 3BUSA 3SK0A 1IOZA 3X43A 4HAUA 1D6MA 1JAXA 1KI4A 1RS0A 3FCEA 3I5AA 3NPAA 3TD2A 1T9AA 2FOIA 2LP4Y 2PV0A 4KDCA 5EKDA 1Z6ZA 3QE2A 4B6GA 3S2IA 2WT4A 2B78A 2IZ1A 2WWHA 3E3OA 4WNYA 3V4OA 1AMUA 3C8MA 3S27A 2VTEA 4DE5A 2X8AA 2PR2A 2QSJA 3CE6A 1EX1A 3H9BA 3TMAA 1WV0A 3GK3A 1RPJA 5AW9A 2G5PA 3FNEA 1JMVA 2WTXA 4AY5A 3KQVA 2Y1CA 4TWRA 4BX8A 2ONYA 4EO4A 4Y2PA 5JY6A 2IA5A 2QYHA 2DUJA 2PU7A 2CUTA 3GZNB 4YMHA 3HYRA 4B33A 5IANA 3S2FA 2ZRJA 3KCNA 4YLEA 4E5NA 1NC1A 3BMQB 2Y4OA 2P91A 4NTZA 4ZREA 3RU9A 3D8UA 4KJXA 1RI4A 1KVRA 2IV2X 3MT9A 4KVFA 3QLUA 3HKCB 2XT9A 1CQZA 2OFOA 2YWJA 3ILHA 1H2XA 2BLNA 4PXAA 4R16A 3JVUA 3O4HA 4B2YA 1TTQB 4UM9D 1QQAA 2H00A 1ZY2A 4L5AA 4BP9A 1DCTA 1JKJB 2WP8J 4V0OA 5EIBC 3WK5A 3BE4A 3AYZB 5KVSA 1RJFA 1XT6A 4UXJA 2Y93A 1RAAA 4RDIA 5KMGB 3TBHA 2NAFA 1YJ8A 2GFQA 2BEUB 2FZ5A 2R6R1 2IQIA 5EKTA 1MUUA 3FYTA 1JA0A 1SURA 1TYEB 2C94A 4D82A 1YIDA 2G80A 1Y1KE 4TS1A 2MOKA 5ALEA 1JDNA 1N5DA 4XVCA 2PUBA 5JISA 1OH7A 3ABSB 1XDZA 4EA8A 4IRMA 2GSWA 3KJFA 5KPJA 5EXEA 1HR0B 1C1XB 1F8FA 2FSPA 4NDZA 3V32A 2B4TO 2I8LA 2A5DA 3RYIB 4DZZA 1AOXA 2JLWA 3KQYA 4BVGA 4CM7A 1KDYA 3PXUA 5BNZA 3K2BA 3RNLA 3OQ1A 1PUXA 1HRDA 4QEKA 1R16A 2YINC 2P3OA 3EPLA 1IJFA 1WX1A 1P75A 3QYFA 4GT1A 4M1EA 1M0EA 2AUMA 3I6MA 2BUBA 4RMNA 2JLZA 5B12A 3LRPA 3O1HB 1GZ4A 4LMBA 3MELA 1ZAYA 1ZH2A 4H7JA 4RGVA 3CR8A 4U63A 2UUBB 4YP7A 4KXNA 5FNVA 2X5OA 3SXJA 4UNRA 2PH3A 4CXMA 2HPHA 4AJPA 3R3ZA 5JYBA 1OWMA 4S04A 1JWAB 2VHZA 2PVPA 3D0KA 5J3OA 3Q7SA 4MYRA 1L6IA 1R8XA 4JUBA 4KQ1A 1R0SA 1JDJA 2C77A 2V7GA 2VOEA 1K3UB 3TCXB 1RAIA 2HWWA 4UHEA 1N2JA 3PQEA 1ZXLA 4OL0A 5T41A 1W9XA 4DSTA 4B44A 3CUUA 4J3FA 5KJEA 3R6JA 4HAOA 1FXWA 3IVCA 5D51S 3BZBA 4ZQFA 1SXJE 4J8PA 2EARA 4KSBA 1HUQA 4E3ZA 1X3LA 2J9ZB 3KDPA 4GOKA 1BE1A 3QVKA 4MVYA 1VSBA 3FGPA 3DE1X 4EL5A 3A4IA 2K5UA 2V9ZA 1V2GA 3IUYA 2V97A 1HQKA 1H0RA 3U0BA 5IJAA 1RHMA 5KYYB 5AKEA 4F1KA 1EK5A 1XZJA 2KM1A 3DE0X 4X71A 4YAOA 2A4KA 4URHA 4OHFA 4RVUA 1NRIA 3EC1A 3OJOA 4I9HA 4WV3A 2QRQA 4ENUA 1O0CA 4JJGA 4PG4A 4ES6A 5LBUA 2W4IA 6CHYA 1H9AA 3PUMA 1L3IA 1Z74A 3OOWA 4FI3C 1UADA 5A3RA 4UNSA 1SVUA 2E2WA 5LBIA 5JAMA 4JFAA 1UAAA 3N0WA 3KVRA 4F5DA 5JS6A 4WN3A 3IEUA 2R1VA 4UUPA 3KTAB 1Q81D 1KY5A 2PAAA 4OGGA 1IXRC 2WMDA 5B2EA 3HXLA 3V7AA 3PX3A 4M7RA 1EH5A 2GAJA 3Q6MA 4JJ7A 5IT5A 4JL6A 3I0ZA 4XLLA 1QVAA 2J9YB 3MCAA 1CULC 1QIFA 1VLHA 1QGDA 2WTUA 1WXGA 1RXWA 1W5EA 1ZESA 2PR7A 4UAVA 1QH8B 3WGLA 4F86A 4AMUA 2SCUA 1G55A 2SCUB 4ER3A 1Z5WA 1BRTA 2H5IA 2CFSA 1ONSA 1AKWA 4RVFA 5G0TA 3W79A 4CMAA 1KYQA 3QXHA 4IFEA 3T8YA 1EGHA 4MKZA 1XMVA 1KARA 2KHZA 3EEBA 3T0GA 1JA9A 2C9OA 3VR5H 4CT4B 4DVGA 4JI5B 1WCIA 2BMJA 1G8AA 1IB6A 1TVEA 1WE2A 2REBA 1NL3A 4KQGA 3T7RA 3L9XA 4AS2A 4HADA 4CZ2A 2B92A 3HJHA 2P0EA 2IPAB 4FPXA 4R8RA 1JYEA 2O3RA 1VMIA 1BCSA 2X22A 2XOKD 5LCXA 1R3UA 3USES 4DY4A 4EEKA 2OHVA 4H3SA 5IW8A 4BMZA 5ITZA 4BTLA 5HCIA 4PSCA 4TS3A 1YASA 1I14A 5CHYA 4DQXA 4LX0A 1A82A 1C14A 2H1OA 1NVVQ 3QA3E 1I18A 4LZAA 2J0QA 4XASA 4CM8B 3GOQA 3D6NB 5B64A 5DGIA 2HGZA 1WUJS 4JEUA 2QRHA 2JAHA 5ALNA 4ZT6A 3EG5A 4UQLA 5HPYB 4AF7A 1CS4C 5KTRA 4DV2B 2FX5A 3ER9A 1YUNA 1Z2DA 1GTVA 2NU6A 5FL7A 3AUAA 4FE4A 4IG9A 3OEWA 2X14A 1HEUA 4OHRA 4BMDA 4UBKA 4R2KA 1F9AA 2O0HA 4BLVA 2F55A 1RYZA 5BN4A 1ITZA 6AT1A 4KFCA 3B9PA 4FR5A 4Q9AA 1LBEA 4YALA 2QY9A 4DKJA 4JKOA 4JLAA 4BNNA 1I9CA 2ACEA 3H5NA 4TXNA 2YQ4A 5FUYA 1UCFA 1XRSB 1EFKA 1X1DA 4NR0A 4PIPA 2OKGA 4N5MA 4XOPA 2BCGY 3OZBA 2I2AA 4A0QA 3X1ZA 1CEEA 3B8HA 1BE0A 3CPEA 1SUEA 3NBXX 4TMXA 2PBLA 2R4TA 2ZCVA 3IKVA 3UAXA 3QVGB 4AZ3A 1E2IA 5B5SA 4AZ3B 1HE2A 2AOTB 2QLBA 5KINB 4QXMA 1TOAA 4GYKA 5ESWA 3TZ6A 1V8BA 6REQB 3HJAA 1T2AA 2ZQZA 3E9DA 3KR2A 4U6SA 1WSDA 3PHLA 3UPTA 3DM5A 1QYIA 4MEBA 3WKCA 1P29A 4GZ3A 5JWOA 1C7RA 1KJZA 3G2MA 2NYRA 3PF9A 5E4YA 3CCMB 4RX1A 1ZI6A 5K6TA 2B1RA 2Q99A 1DWQA 1VHLA 2ACWA 2IIPA 2HF9A 4TYMA 4PO3X 3L1VA 4H3KB 3TI9A 1GSHA 2ZUBA 2QVYX 4FB5A 3CMAB 5DCWA 2ZL6A 5HE9A 4DMUB 2P7IA 4MLPA 3IRVA 1U6KA 2P4SA 3A1FA 1JQ5A 5HZBA 3A58B 1V3VA 4XFDA 3VA7A 2V1UA 1ZUWA 5ITWA 1S2NA 2VUTA 3QLUC 3TBKA 1OZFA 3G3EA 4LF5B 4QGBA 3OPVA 4PLZA 5DTMA 3PE6A 4ACBA 1E3ZA 1X1TA 2AHRA 2JHGA 3ONYA 1KEWA 1OCEA 1R6DA 1T5SA 2E18A 3DGEC 2FAXA 1TPYA 3EDYA 3WJAA 1QIMA 2NTJA 1GKYA 2WU1A 3B20A 3O38A 3NOXA 4LRWA 2DUNA 4QFCA 3Q5DA 3OJCA 3D26A 5H0IA 1DUSA 2TRSB 4DA0A 3LXUX 3JQ8A 5E0OA 4O63O 5CDUA 3GEPA 5HF8A 2QRZA 1KD1D 3VU9A 3JWGA 1GA6A 4ZI2A 3WWEA 1QU2A 1ZS9A 1VYUA 3NBQA 3OW2B 4PG6A 1Q2XA 2QR2A 4G0YA 2WU3A 1U1EA 4D9NA 4WCFB 2ZRCA 4R0NA 2CVQA 2VDWB 3YASA 2H29A 3N3AC 4RZ3A 1UBTS 1OFTA 3HJBA 4C7BA 2EFCB 2AFVA 3DG9A 1ORVA 3L40A 13PKA 3MYRA 3QW2A 2GH1A 3CZ9A 1ORDA 3IRUA 4QD3A 5FR1A 3B85A 1WQ4A 1QZXA 3HUUA 4HAVA 2RGNC 3FE2A 1QOZA 5KUTA 3E4CA 1ZMOA 4D44A 5IXSA 2BDEA 1GNVA 4HGOA 2RSLA 1PJ6A 1UBLS 4B4DA 2CN1A 3I73A 5IWCA 3ZWDA 3CYFA 1Z4QA 5I9BA 3K8YA 5CCBA 1XVUA 4RYLA 3HTXA 3FI0A 1TQ6A 3ESRA 3MF4A 4H7PA 5FA8A 4Q1BA 3GH3A 1LLUA 1T8PA 4XSHA 4EGFA 1F2UB 3KQOA 1U9IA 3KOMA 3F78A 5EIFA 1E1MA 3K73O 5DIZA 2NO4A 1U3CA 3G4SB 2DLDA 4NXNB 4E5MA 4CGZA 3ANMA 3AT1A 2VLBA 1F4LA 3OE7D 3C4VA 2OGTA 4CU5A 1E2UA 1Y1LA 2ZG6A 5DVZA 3KJIA 4IDPA 4AJHA 2OSVA 2R6DA 3WGHA 3RKUA 1N6KA 1TIPA 4UZFA 1VDMA 1Z6AA 1W49A 1Z82A 4URWR 4KTTE 5ECWA 4P32A 3UCEA 3R9KA 5I8PA 3CR3C 1PFKA 2YCLA 1T3LA 3OIDA 4GI3A 1RD4A 5LYYA 1WOMA 3U6BA 1NW5A 2RAUA 3RYHA 4MUEA 2PG3A 3HCCA 3TKAA 4ZICA 4TSRA 3EGVA 5K1ZA 2GK7A 2FEOA 1EK0A 2PV7A 3FTQA 2XNDA 5FBLB 4EVIA 4BU0A 2ZM6B 4NENA 2ZRIA 3TG8A 2GPAA 3KQNA 2I9KA 4MQMA 1J2YA 1NVVR 3QH4A 3AETA 3EIFA 4NH4A 1VIMA 3I3SR 4CEHB 2EFHB 2C4HA 1E5DA 2R7LA 4BRSA 2KI5A 4C0LA 2ZRPA 4XLTA 2F43A 3SQXA 1G2OA 3RC9A 2YIJA 1S01A 5B6IA 4YMWA 5IPFA 4KI7A 4WBNA 5IAOA 1O1YA 3EH2A 1LXCA 1XQYA 2P9FA 1X9GA 3AIKA 1N06A 3VH4A 4A4DA 2J4CA 3FPSA 2KX7A 2CJFA 2G06A 4D99A 3BH0A 1R7RA 3PKIA 4QYTA 4BQSA 4DTIA 2ODNA 5A5DA 5CD9A 2HMAA 4XUCA 1ZD2P 1Q0RA 2QMHA 4E31A 1TM2A 4K03A 2J0UA 1IZ7A 1E7WA 3LKVA 1N4AA 4IF4A 2QPAA 2AC7A 5T4BA 9ABPA 1V2HE 3K1ZA 4MLDA 4BO1A 4WWVA 2DOKA 2WVAA 4KKSA 3C6QA 2QTVB 3DZ8A 4MSUA 5K0SA 1WBDA 1E0AA 2WKSA 1NQOA 2P3LA 1X92A 4BQFA 3VZDA 1LUAA 3QA9A 3MGAA 1J33A 1UP7A 2G5TA 1CB7A 2VT7A 3CUVA 1YR8A 1Z5NA 4MW1A 4V03A 5LZ7A 3QOXA 2YY5A 2W6JD 2XQKA 3G0GA 4M37A 1M75A 5BN1A 1GG5A 4F7WA 4Q66C 4AJ2A 1Z0SA 1EDDA 5FPYA 1VL1A 5KCZA 4J0GA 1TZ2A 3X2EA 4EI9A 2JFWA 3EGXB 1GIAA 1HT2E 1LNZA 1W4CA 2G67A 3ENQA 3D5EA 4M0MA 3I2IA 2ERCA 1I6MA 5EMLA 2BFCA 1KAMA 2CSUA 1IG3A 4MV0A 1LF0A 3CCRB 3MQ4A 4G2TA 4XARA 5SY9A 4E1AA 4DJFC 5LM3A 4OUDA 2ZSFA 4JYAB 1L8QA 3FGNA 4R9VA 3OEED 5DNVA 1UMKA 1EFPA 1M1XB 2EF0A 5J5CA 2YJ4A 4QEZA 5HWSA 2B36A 4EPYA 2RGWA 2P90A 3OHPA 4JLBA 1V1MB 2B30A 7AT1A 3EQ6A 4IR7A 4XFJA 1R9MA 5DLDA 3ZPXA 3U44B 2QMEA 4KLAA 1U8AA 4LY6A 2W2XA 1AG9A 4U2GA 4ZI5A 4NZNA 4WKCA 4L57A 1Z0DA 4GMDA 1D6JA 4NC9A 4UNPA 3TNFA 3ZU3A 2P5SA 3GC6A 3TRJA 1W93A 2GD1O 3EY4A 4BQOA 5C8VA 4MGKR 4ERNA 3QU9A 3TVTA 5IJ0A 4LF4B 3E1GA 1TA4A 1AJEA 1JNYA 1OAOC 2XB4A 2VJOA 2Q2QA 2CDBA 1C29B 1ZO8A 1NBMA 1C0IA 4ANFA 1NVGA 4IRXA 1HNXB 2A9JA 3HBMA 4BCDA 4C7MA 1Z83A 1VCHA 5CDSA 1SU4A 4NQZA 3B1FA 1Z34A 1X6VA 3JSAA 3GRZA 3AM3A 4G5HA 4ZU1X 1KDRA 4JEMA 3O95A 1R6TA 3RPEA 2VZ9A 4OIMA 4G9EA 1INLA 4YDRA 2F3TA 2CLKB 4NV1A 1RT9A 2LDBA 4LW8A 4WKNA 1N36B 4CQMD 2WYIA 5IM4A 1XDWA 5KC8A 4EUFA 4P7FA 4CLEA 5I7VA 1MT3A 3VZRA 2O2IA 1XTBA 3R3SA 5D87A 3SICE 2G09A 3K9QO 4RLHA 4QDXA 2IOYA 3D2AA 5AJXA 3KT3A 1SZPA 4XB1A 2CUKA 1Y6RA 3VAZA 2B9VA 1ODFA 1SHJA 2D7CA 4QOHA 3VMFA 3MJHA 1YFZA 3A4YA 4RA9B 4U02A 3ZDBA 1LPAB 1LJ8A 1T0PA 1CUIA 1KDOA 1T2CA 2EERA 4FHGA 2YCBA 2OXEA 3TWOA 1TYZA 3V1MA 3QEBZ 3PX2A 4EHKA 4B3HA 1C2YA 1GT6A 2IHKA 1D4FA 4IGAA 2JANA 4J4TA 4FKMA 4OYRA 3OWOA 3BBLA 3JYNA 1J09A 3RTCA 3QXCA 5LKAA 2Q8NA 2YWHA 2OTCA 2FQQA 5H3HA 1YRYE 3D4NA 4PZZA 4R71A 3ROPA 2GDJA 4PU0A 1M66A 4H6PA 4A0GA 4D7AA 3HGTA 4DBVO 2J3QA 3MIZA 2A0FA 1BMQA 1F48A 3A3YA 3F8WA 3GLHE 4XZ3A 1LCIA 5B1DA 3BE8A 4IQ0A 2X8JB 2LUOA 4N5IX 4PYLA 5IRCD 2CVPA 4JYCA 3V33A 4ABYA 1UP6A 1YS2X 3WLPA 5IKEA 4R1SA 2B83A 1Y8QA 4IIFA 2HT6A 4LYJA 1AC5A 1D9XA 4G4IA 4IIBA 4NJMA 4R05A 5E2BA 3KQKA 1B93A 1AE1A 1PWEA 2PD4A 3Q0IA 4F8YA 2VBFA 1QXSA 1NSYA 1QAQA 3TJZA 3ZDDA 1RBQA 3VYTB 4GO1A 2ZBRA 1YVEI 2J3MA 5KTOA 1G0NA 2GN2A 5LP6C 1W59A 2A1TS 1I1QB 1YNOA 2AD1A 3AC0A 3AMVA 1GQQA 2UZIR 2AFIE 4RK4A 4MRMB 5EE9A 3S44A 1BFDA 4KIWA 3UC5A 4KQKA 1VRVA 3BRWD 1KYWA 1ACJA 3V2GA 5KVVA 1DZIA 4YR9A 2FSFA 4K28A 4TRMA 1G8JA 4XKVA 4R98A 4XVUA 4QOFA 3JZFA 3WLJA 3UG7A 3V6LA 4I6JA 3RIMA 1SQSA 4JJKA 4OREX 1G8YA 5A7GA 4GKKB 3IBSA 1B41A 2Z0MA 3P52A 2YZ2A 2WWYA 3E15A 4RHUA 3UMJA 2ZYRA 1MO6A 1EWYA 2DWUA 3KPJA 3H2SA 4I0WB 3SI7A 4HVLA 3AKCA 1Z15A 4CLOA 3RS7A 3VYWA 1G4UR 1YJNB 1HKUA 4QX6A 2NU8A 1MU0A 5A3QA 5IYZA 1MAWA 1W46A 2GCOB 2GK6A 1PIWA 3X44A 1P2BA 1JFLA 2JI6A 4PAMA 4IXDA 5CA1B 4V2UA 2VP4A 2WP0A 1UC8A 2D1FA 2YHAA 2AJDA 3HCNA 2J5QA 3GBSA 4TWBA 1XEXA 4FEEA 1CSEE 4BEVA 1QHYA 1T1GA 4FXPA 5CX1A 3MT0A 3OLWA 1QGAA 3VZCA 1XEFA 4F4HA 2DBYA 1GUBA 3R0VA 2XR1A 1G38A 3LYAA 1SUWA 4TTTS 4DARA 5T7BA 1P17A 3PXDA 3HCRA 1FXUA 3ETLA 3LA8A 4OOFA 4ZI7A 3B6ZA 1NKTA 3CZPA 1XRRA 2E1BA 4QQNA 1MRNA 2QL5A 2WE8A 3B6JA 4J2HA 4DWWA 4XR6A 3G1WA 3IP5A 2ZZEA 1FUYB 2FPGB 1MRZA 3AR3A 3R5SA 1TUBA 4R01A 2FZKA 2EYUA 5BSRA 5ADWA 1XZIA 3GQVA 5KOJB 1KY2A 1OI2A 4RFSB 3HVIA 2Q6KA 3PEFA 3MFQA 1M0SA 2VBSA 2J0EA 1VQMB 1G98A 2J08A 5C9ZA 2Q62A 5IAEA 2PYIA 4NBNA 3NBYC 4Z8XA 2R1UA 4V39A 4Q1AA 3I2YX 1E0DA 4TV9A 3QF4A 3ZE2B 2F3RA 4JOQA 4N41A 2FMHA 1DDGA 4EY7A 1GHTA 4K7JA 5FAXA 5H16A 3OZFA 5G0UA 5JAQA 1I6LA 3RFTA 3K5WA 3FTFA 2XE6A 1I3LA 4WKPA 1L5SA 3HVUA 3CT4A 3U7RA 2GR9A 2AG6A 1U99A 4HNUA 1OGIA 3C4JA 1I5EA 1TZKA 1RBZA 3QTTA 5FPSA 5IK2D 2ILTA 3EXHA 2O8CB 4Q1EA 1SCUA 1QJCA 1VE7A 1U2DA 4LTMA 4QBHA 2OTJB 3VUEA 4AY3A 1FTGA 2Y67A 2QSZA 1U1IA 4QPCA 2HBYA 2WMOB 3PK0A 4CM4A 1PR0A 2VQDA 1RAEA 2J32A 4Q6WA 5C3MA 5THQA 1PTKA 3HY6A 4RIEA 5TPWB 3IE2A 4GDFA 5TF4A 1R0BA 1XHFA 4MB2A 4ND7A 3UMGA 1Z17A 1DXOA 3TOZA 3G2QA 3HWSA 2RGGA 3MWKA 3LG2A 2PWAA 3LV8A 2B8TA 2X0NA 2NXWA 1S1MA 2QL9A 5MHTA 2AA3A 1P61B 2NUTB 1JEEA 3LUGA 4BNDB 2R00A 4OX9Y 3P0FA 3SC4A 3W0LB 1HEYA 5KSWB 2AZXA 2RHHA 4C0KA 2I33A 4PPNA 5E7JA 4CM9A 1XDUA 3EXG1 2P6RA 2JVJA 2VIIA 4HDRA 4F2PA 3QEKA 2NP7A 4FN5A 3LSTA 2OCKA 2NOAA 3HM2A 3IQEA 1RHRA 2C03A 2Z9CA 3DLIA 3ZEIA 4MH0R 9LDTA 4M8IA 5ADVA 1RWNA 4TTAA 3DLHA 4IGIA 2R4UA 2W6ID 4TTJA 3U3RA 3BCFA 3BILA 3BXHA 1FJGB 1YDHA 2YIMA 3UK1A 4F6RB 1E64A 2QE7D 1TADA 3IUBA 1BS9A 2A57A 1W4RA 4KPGA 1N1DA 4IH4A 2IEAA 1ZSYA 1UOQA 1XLTC 1SBYA 3J81A 1E6KA 3E3MA 3CFYA 4TLBA 2XY4A 3IVRA 2WFLA 3NEYA 5FKJA 1OY1A 3UWPA 2I6UA 2DFTA 2MMCA 2QRPA 1HF3A 3U3OA 4EKYA 4DMCA 5KX5A 1JHVA 4D9EA 1BVYF 1BFUA 3NXKA 5DGCA 3UT0A 1ZM3A 3VR3D 1FSSA 3KQPA 4RAOA 5B57C 5BVGB 1MA0A 3HP1A 4BXOA 1U1DA 3LW7A 3EQ8A 1YULA 5JAZA 4DR7B 1ZD8A 2FW0A 3BGVA 3TNDA 5H70A 4WWHA 3UPUA 3DFKA 5BSFA 2VF5X 5CDGA 3IPXA 3STXA 4BFUA 3LCCA 3CP2A 1GV0A 5EVJA 5EXDA 1WIWA 1NSFA 4LXTA 3UA4A 3V1UA 1T5LA 3OCZA 4YAGA 4BC0A 1TZCA 3D64A 3H9GA 4D9BA 4IIVA 3E27A 1P80A 4UTNA 2UAGA 5AVZA 1DHTA 1DAKA 1YVUA 2Y27A 2PEZA 2ZS9A 3JALB 1IHOA 3OFJA 2I78A 5KCMA 3RH0A 4FGJA 3KEOA 4Z6KA 2OC4A 4KIGA 2D0OB 2FA9A 2WJ3A 4I14A 2EP7A 5CNIA 5BV1A 3NDRA 1XD2A 4YFVA 4MDFA 2DP4E 4L08A 2JI8A 1B42A 1DVRA 2H2WA 4HWOA 4LVOA 3F5QA 1THZA 3WDKA 5LZ4A 3P9NA 4M88A 3AY6A 4N3NA 5G1OA 4BB6A 5D2CA 2PMBA 5ALOA 1J42A 2WUFA 4BFVA 4P3NA 4DLTA 1RPZA 4J3JA 4IMRA 2ISCA 1VMDA 3TS1A 2CUZA 3NDIA 1FTQA 1A3CA 2VHCA 3OHSX 4DTCA 1JECA 2YMQA 3A31A 2AC4A 1NX9A 2OPBA 3LBAA 4H17A 4DBZA 4RZSA 2CNLA 2PNFA 2A8YA 1J56A 4JODA 4V0RA 5J1TB 1K27A 3T34A 1DDIA 5SY6A 5K99A 5KWEA 1MR3F 2JLAA 5KWJA 2BTQB 4RUKA 1W1UA 4NFHA 3MQFA 3UJ8A 2B3DA 1G2PA 4ETIA 1LC3A 2QJTA 2QTGA 1HV8A 1T5BA 1CUEA 1DIAA 1TLLA 4O0LA 3WLMA 3BNWA 3W2IA 3HA7A 3EC7A 4LOLA 1GA4A 4WEQA 4G2NA 2VCEA 4GXRA 1YR3A 4I5GA 2J48A 4MR9B 1F6BA 2I34A 4XTRA 1L5WA 4BASA 5MGBA 1M8FA 4ZAXA 3PPXA 1NYQA 1G3RA 3OLCX 2OV2A 2GRAA 2HA7A 2XKAA 4HN2A 1UD8A 1Z3IX 4FJ1A 1NMSA 1N0VC 4IYJA 2AXQA 1QIGA 4HPXB 5J5VA 4BB5A 1AA9A 2ZJYA 3WK6A 1TM7E 4CL2A 3WLNA 4ZODA 5HRUA 5IUJC 3H8WA 4X7MA 2GXQA 4NV0A 3C24A 3DNMA 2R8BA 1FQOA 3BAFA 1IY0A 4TL9A 3AM1A 2ECKA 2R48A 1E2KA 2E4VA 2VP9A 2QI9F 4J07A 4MPDA 3EOZA 2WRZA 2NVBA 2QXYA 2WE7A 1GVNB 1R18A 2Z6BD 1GG8A 2EFGA 1L4LA 2GD2A 4MW7A 4RBNA 4CMEC 1EUCB 3M6FA 5IKPA 3W5JA 4HQNA 3PQDA 2R62A 3KTOA 2WYUA 1EE9A 4AG5A 2HDNB 3DHVA 3ROQA 4CUZA 1Z12A 5I6DA 3A6PC 2DU8A 1YRLA 2F1LA 2HTEA 3CKKA 2HSJA 5AMXA 2D4HA 3WQZA 1E2MA 5TQVA 5JTTA 2ID7A 4N03A 1JE0A 1Q0HA 2NPIA 2O2HA 3DE3X 4MQEA 3NHAA 1RW4A 3W3ZB 7REQB 3Q1KA 3QBVA 4FEAA 1R9NA 2J3EA 1Q0PA 4PFQA 3E3NA 1XNGA 2R8RA 4DY6A 4V0ME 5FBRB 3WQQA 1FNCA 1JPUA 2Q0HA 2QZSA 2RGAA 4QQ8A 3EVDA 1L5OA 3TL3A 4JEIA 5DO9A 1E32A 2OZKA 4RD3A 2VKQA 3SSOA 3EAQA 1FTSA 2A30A 3WLEA 3VSAA 1BGWA 1B1CA 1OLSB 3UV6A 3RYIA 5I45A 3WV5A 1RWBA 2KSQA 1YR6A 2GEUA 3ACBA 3CLKA 3LQYA 2AF4C 1DTWA 2EJCA 5F5XA 3U56A 1T9GS 3AUUA 1PV1A 1OVMA 4IHQA 1DWPA 1ELOA 1OLXB 3DQPA 4DJEC 5B1SA 3U4DA 2ZI3A 2FN3A 4CYMA 4AZTA 4RCVA 4LXYA 2CL0X 1FIUA 1E3IA 2RBEA 4LXXA 3P0RA 5AQ1A 3WIEA 2P9ZA 1IWBB 5B58C 1U5AA 4HDAA 2OQVA 3U7QA 2DKFA 4GBMA 1B0AA 1W6RA 4DWJA 1X70A 3PEEA 3PC8C 4ZQEA 4DYDA 1XWFA 1WULS 2XCTB 1KI2A 3D8BA 1NNLA 3FA2A 4O2AF 5IDWA 5A1JA 5EMKA 1UMCA 3P26A 3B1JA 3DWIA 1RRPA 3SFTA 4F5WA 1T91A 3CZRA 3ICVA 4BNHA 1ONBA 4L3VA 1VLJA 1L4FA 2OK7A 3KEGA 4AL4A 3TLJA 2FEMA 2H1SA 2OA0A 5JMPA 5A3SA 1Y4UA 4P2BA 4OGWA 1H8HA 2DULA 4LGMA 2VJIA 1YX2A 2GAAA 3JQAD 2IIBA 5DYIA 2RHWA 2QP4A 3C85A 3WK9A 2P6OA 3E7WA 5ALYA 1HQDA 2CGEA 2ZVDA 3W4KA 3QMMA 2IHJA 4KSCA 1ISIA 1GGJA 4QPPA 3PJDA 3UMSA 5EZYF 2E1PA 3K2IA 4I6GA 1KP9A 3W6UA 4EMTA 2XCRB 2W6NA 4R0VA 4NPHA 5LQRA 1SIUA 1V7CA 3EMBA 1SEVA 3H0EA 1I33A 3O92A 1VL2A 3L5OA 3PPWA 4X44A 3RSFA 5KNLA 1SBZA 3IQWA 4CHGA 1UINA 3A06A 2VUHB 4L28A 1QOPB 4NULA 1YL7A 1IAVA 1E2EA 2QZ4A 1L7BA 4UUQA 4NBUA 3LY7A 4GBJA 3ORSA 2EW2A 4WN9B 5EPEA 4UREA 4E7PA 3SMVA 2PSSA 4KQJA 3HEBA 1UBHS 1J8MF 1NRWA 1C3XA 2AOXA 3D4PA 2A5FA 3HFRA 4KQ6A 4NIMA 2LCQA 2IS2A 3H0KA 2Z2XA 1TD9A 1PZMA 4Z9BA 5C31A 3D0QA 3LUFA 5BSGA 3R6LA 5JNUA 2GFHA 4XR9A 2JFQA 3EAFA 5DM2A 2GRJA 4E14A 1SCKA 1UT6A 5BR4A 1NVDA 1Y9AA 3HCFA 4JZYA 3V7UA 1D2GA 1YZ3A 1Z7WA 4MR8A 5JAUA 5FYQA 3R9XB 3OFKA 3HU2A 5FA5A 1PVOA 4GOXA 4YI5A 4F4DA 4QVJA 2P1RA 1BXRB 2UXBB 3Q6RA 5EHNA 4DRZA 2NU8B 1XCBA 1YQQA 4NJOA 1QRSA 4INJA 4W1RA 3P5SA 4KWEA 4EZEA 3U40A 3ORQA 2OK8A