1FRQA

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 100
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frqA02
1YIJB 1TLLA 4B43A 1KD1D 4LBZA 3WBKA 2OK7A 1EP1B 3P26A 4U9UA 1FNCA 4PC3A 3CC4B 4Y7CA 5DSZA 2BF4A 4ZCLA 2VNIA 3AGQA 2DCUA 1XB2A 1XE1A 4RCZA 3WXMA 1ZM4A 4YAWA 2PLFA 2QA4B 3U6KA 3OJWA 3LO8A 5HXBA 1HA3A 1W87A 3ZBTA 4RD3A 4TMZA 2QDXA 4IW3B 4Y9RA 2PMDA 1FNDA 4RD2A 3VMFA 1ZM9A 4P3YA 4QHYA 3WY9A 1DG1G 2VNJA 1R5OA 3CMAB 4ZGQB 4M53A 1QFYA 4TMVA 1FNBA 3CCUB 3CB4A 2BGIA 1BX1A 1VQPB 3AVVA 3I56B 1YJ9B 1KTVA 4RD0A 4YALA 3CC2B 4BPRA 2R6HA 1TUIA 4G1VA 1KRHA 1VQ9B 4M4SA 4FN5A 1GJRA 3W2EA 1GAQA 3ZZTA 1GR1A 2FX3A 1U2RA 1EFTA 2XEXA 3CXCB 1ZM3A 3CMEB 3VNUA 1SKQA 3E20A 4ZV4A 4LBYA 3PENA 2BGJA 1QFZA 1Q86D 4J0QA 4TMTA 5TY0A 4B3XA 1SM4A 1EP3B 1M90D 2BSAA 1TTTA 1VQLB 2EFGA 4PC7A 1WDTA 4G5GA 1ELOA 4LBVA 2BVNA 1D8TA 1F20A 4HE5A 1A8PA 3CRZA 4RD1A 4K1XA 4C0SA 1CQXA 4ZCMA 1F60A 1JB9A 1NJID 1N0UA 2J7KA 1YJWB 4C43A 4ZGNB 4RD4A 1Q82D 1B2RA 4YAUA 4PC6A 3CC7B 1VQ8B 2DEUA 3QSYA 4ACBA 1AIPA 2YWEA 4M2LA 3W2HA 4LC0A 4UAJA 1JNYA 1EP2B 3LVBA 1UMKA 1QG0A 1DDIA 3W5HA 4AF6A 3OW2B 1R5BA 4P6VF 2GPJA 5EMNA 2C77A 1QFJA 1Q7YD 3WNDA 4QFMA 3CCLB 1OB5A 3WBJA 2DETA 4B4DA 3V76A 2QMUA 1JA0A 5THXA 1E63A 4N3NA 1G7CA 2GQFA 3CW2A 4TMXA 5KSWB 3CCEB 1G7RA 1DDGA 1K8AD 3JQRA 4AC9A 1J9ZA 1H85A 1IB0A 1IJFA 4NCNA 3SJZA 2QTLA 1G7SA 1QVGB 3CCQB 1E62A 1H42A 2EIXA 3E1YE 3W5VA 1FDRA 3CCJB 4H9GA 3ZZ0A 4EH1A 5FA6A 2B7CA 2X3UA 1ZUNB 2OTLB 4ACAA 2BPOA 1CNEA 3WNBA 1QGYA 3W2IA 2HDNB 1JJ2B 3CCRB 2E1RA 3OZVA 2QEXB 2YWGA 2BN4A 3MHPA 2BM1A 1VQMB 1ZM2A 3J81k 2QN6A 1EFCA 1QGAA 3WNCA 5TR9A 4YHBA 1BJKA 4N3GA 3B82A 4MYUA 1VQOB 1BQEA 2AHOA 5TV2A 1QGZA 3G6EB 2OTJB 1KK0A 1OB2A 4F7DA 1S0UA 1S72B 1VQKB 3AGPA 3A1FA 4LBWA 2RC5A 1YI2B 3OZUA 2HMAA 3P27A 3AVTA 3I55B 2NPFA 3WYAA 4YAOA 1IJEA 4Q7JB 3JQQA 4RJLA 4G1BA 3W2FA 1G7TA 1KJZA 1VQ6B 3FPKA 3G4SB 3I1FA 2ZITA 1KK1A 3ZBUA 4TN1A 4Y9UA 5JBQA 1KQSB 3JQPA 2BMWA 4PGOA 4MYTA 1E64A 3CCSB 4FK8A 1KK3A 4NBSA 3AVUA 4RD6A 2YWFA 4DQLA 2VNKA 1N0VC 1FNMA 4M1KA 3W5UA 1YJNB 4PC1A 2VNHA 3W2GA 2BM0A 2XNCA 3LRXA 1M1KD 2QTZA 3B78A 1QUEA 1OGJA 2CNDA 5AN9A 1VQ7B 3QFTA 1VQ5B 1CNFA 1FRQA 1B23P 1W35A 2VYQA 1Q81D 4HE6A 2DERA 3AVWA 2PIAA 1FRNA 2HCJB 1NDHA 4B44A 3CCVB 2XNJA 5GV7A 3B8HA 3OJXA 3AVYA 1K73D 3FJOA 2OK8A 4FWTA 3U6BA 3VNVA 2RC6A 3U2QA 2DY1A 1K9MD 5H5JA 4R71A 4B48A 1QH0A 1N8RD 1GAWA 3AVXA 3QE2A 4YAFA 1AMOA 4ZCIA 1VQNB 1KC8D 4DQKA 1BX0A 1D1NA 3QFRA 2B7BA 1GO2A 2VZLA 3ZC3A 1D2EA 1R5NA 3ZZUA 1YHQB 1JA1A 1EWYA 1OGIA 2CRVA 3ES9A 4WQMA 3LYUA 1KK2A 1I7PA 4AF7A 1GVHA 1YITB 3CPWB 3QFCA 4M0LA 5H59A 3G71B 1W2BB 1VQ4B 4PC2A 2BV3A 1EXMA 1TVCA 1EFUA 1QUFA 3MCAA 2D74A 2B5OA 4B47A 3MMPA 1W34A 3QFSA 4TMWA 3OZWA 3VO1A 1QVFB 2C78A 2YWHA 1QX4A 3VO2A 5GV8A 1DARA 4RCYA 3CD6B 3CCMB
chains in the Genus database with same CATH superfamily
1NJ2A 2EFCB 3KZXA 3QKSA 5GGYA 5BYAA 4L15A 4WOKA 1IZ7A 3T54A 1WXHA 2WUFA 5EIFA 3PNOA 2EKZA 1IDOA 1DO2A 5IW8A 4ZGGA 3ME5A 3EPLA 2ZQ5A 4ZVOA 4KKSA 3WBKA 1ZGHA 4JBWA 4Q39A 4OB6A 5KVAA 1PEYA 1WB4A 2CLDX 1E8MA 2XMRA 4IKPA 1I3LA 2FW1A 2Y76A 1EP1B 1HOXA 3G9XA 1O57A 4KQXA 4MW6A 1OXTA 2I03A 3DMDA 3AHDA 2H3EA 4CFYA 2Q4DA 4ALKA 1Y8QA 2X2PA 3PS9A 2J3IA 3FDZB 4LWOA 4J0GA 5JPDA 2R47A 2ZZFA 3F7TA 4Z6KA 2V7WA 3NGXA 3C6ZA 2GZRA 2I65A 3EIWA 2P2YA 1C4KA 4PHCA 4Y6QA 1TM5E 4E31A 3OLZA 3TI7A 1H5NA 4B8ZA 3IKMB 4FP9A 2DCUA 2H8GA 1O87A 3IUPA 1U4NA 2IKQA 5FTKA 2NUAB 3PRHA 3CKLA 4QTTB 5CX1A 1CX9B 3CEMA 2CLMB 2KQUA 1GR0A 3JQBC 4TKVB 4Y6SA 3ZY3A 5FI5A 5ALWA 1XYYA 3GFPA 4LX8A 2QTCA 4RQTA 4NMWA 2JFXA 4AL4A 2OCYC 2Q49A 1XQ1A 2O4UX 4DSZA 2AG8A 1K98A 4EI8A 4EMSA 5EP1A 1OAOC 3K09C 3ZV4A 1BEEA 2B5VA 4AX8A 1SB9A 3BJZA 4B6OA 2DUJA 2GZ2A 5KVSA 1PN3A 3E22B 1FTWA 5FLXA 4N0MA 2BFCB 5IM4F 4WZAE 4GMFA 4X7EA 3D3NA 4H3SA 2F9LA 2X9VA 4TQGA 1J9GA 3IAM1 4DIOA 2JK1A 3CPHA 1DG1G 3BE6A 1L4HA 1KOLA 4QOGA 5KYWA 3A11A 4HDOB 1C4WA 2X6RA 2JH9A 3MBIA 4NNPA 4F2WA 4Q9JA 4I50A 3DE0X 1A04A 4X8OA 4EYGA 1T4CB 1I2ZA 3A27A 1Y9JA 3KUUA 4JLVA 5FNZA 3M6UA 3G3EA 4EYKA 4PRLA 1Y80A 5K7SA 4LHVA 4V0QA 1SNYA 2DHEA 2O8VA 4CETA 1XL0A 4RD0A 1KBZA 3OOSA 1JNXX 3U9TA 4YJDA 4CF3A 5BUCA 5JASA 5KQGA 1PZHA 1ZSNA 2PDAA 3CZCA 2AH5A 3D7NA 1PNTA 3F6SA 3FWYA 3UHPA 2G5TA 1QBKC 3H2ZA 3OLXA 2GUGA 1GJRA 1E7RA 4OUDA 1TMKA 3D2BA 1BRTA 3HR4A 1XLWA 3I2YX 2OFFA 1EGMB 1TLFA 1UJCA 1XC7A 2PZBA 2QYOA 2X9QA 3WFZA 3V7AA 1KI4A 1P5JA 1TJ3A 5JO9A 3T35A 4BNNA 1I7QB 1I6WA 3JY6A 2DJ5A 3BXOA 1HUQA 1AQLA 4H2DA 4CM5A 3IUNA 1GL3A 3FMOB 3K20A 1R10A 5TS2A 3MQ2A 4IKOA 1TRKA 2EWMA 1J8YF 1GXSB 3R9XB 4KQKA 1KS2A 4FOPA 1RU3A 5LIRA 2LDBA 5K8JB 5TY0A 5JJIA 4H0NA 2I4MA 2EKDA 3LP8A 4FMDB 4JEMA 3HVHA 3LOQA 1QHFA 1QHGA 3KL2A 3RKRA 3AM5A 5CDSA 1GTSA 5HQ3B 1TPZA 3AOGA 1WDTA 4ZCTA 1U1CA 6GPBA 2AG6A 1JSXA 4MWBA 2I5PO 2IXAA 2Q0QA 3LX5A 4K6MA 2GKOA 1NVFA 2Z95A 3QJYA 1LSSA 3RIXA 3V2HA 3B7GA 4XPIB 4I9GA 2XBUA 1T5OA 1LDEA 1CRZA 3FLAA 3N2ZB 1B0AA 1ODFA 4GR5A 1GZ3A 2XD9A 4I4TF 4Z0HO 3WAKA 3VHLB 1YDMA 2ZWOA 4C87A 1ZH8A 3EQ8A 3THXB 3T53B 4QXOA 5AO9A 5KJ6A 2V6BA 1X1SA 5LXTA 5I7WA 3ZCRA 3N87A 4S35A 3WA7A 3A3OA 2KYRA 2NU7B 3DTNA 2NP6A 2R66A 4GBGA 3L3BA 4UMDA 5CK5A 3NM4A 1L7XA 4BVEA 2AX4A 4DR3B 3L77A 5AHKA 5J35A 1X3SA 2GTIA 3DFFA 1LC3A 1Y1KE 3EHEA 2R00C 4K6FA 4O4LA 4OAQA 3CC7B 1N05A 5DP2A 5CDGA 3HXMA 1TIBA 1E3EA 1NSTA 3HFJA 3MT7A 4LHSA 3V8PA 2GK7A 3PDHA 3NBKA 4JOBA 3BEDA 4M0EA 4UBIA 4YQEA 5DISB 4DMMA 3PWSA 4CF7A 1U81A 1AV7A 4HXEB 3RSZA 3HKDA 4BO0A 4QUEA 4EY4A 3LDAA 1NL3A 1NMQA 3EG5A 3UPDA 4Z1OA 4XLEA 1YIAA 2VQ6A 1ADBA 4FFBA 1DDIA 3ECSA 4HZUA 4HXGA 4KP7A 4WZZA 3ZE8A 2XD4A 5C8YA 1TZ2A 1ZK0A 1KVTA 1XEWY 5EJIA 2Y99A 4LIPD 4P80A 3T3EA 5EIWA 1NVMB 3BK2A 4PTYA 1YU6A 3HWSA 4YT4A 3KQPA 1XQ9A 2LP4Y 4OQEA 3UB2A 5AKIA 3ITEA 3IPLA 1TMYA 4KYVA 1A88A 1WDKA 4Y2QA 1UKBA 5AOAA 4WFKA 3TQTA 5MHTA 2YYYA 2AUTA 4JQSA 4H3VA 4UZSA 4QUHA 4QFMA 1ONSA 3HCNA 2B1QA 1T5EA 3AJRA 4IJKA 4OY3A 2CJWB 1XMOB 1U63A 2P4QA 4JNKA 3CJTA 3ZWQA 3ORHA 1QTNA 3I2GA 4QULA 5BUQA 4YMLA 4CM7A 2JCSA 3K9HA 4XN0A 4HDSA 3REQA 1YR6A 1R6DA 4LSGA 5SY9A 1QNFA 1EHIA 1CP3A 4UUBA 1SXHA 3QUQA 4N6NA 5IYZB 4P26A 4JLDA 2W8BA 5MF6A 3H97A 3BG5A 1X0VA 3FKJA 1Z39A 1VCIA 1LEHA 1KMMA 3P0EA 4JOQA 1HQDA 4Q9AA 1FSPA 4ES6A 2C7QA 1ADJA 4HG2A 1JEDA 2EEZA 2IZ0A 2ATEA 4AC9A 1U3DA 2ZSKA 3BHNA 4DW8A 1T8TA 2CFCA 4PM4A 2X8JA 2ONJA 3BDAA 1WP6A 2WAXA 3N2GB 3RIHA 2OGSA 3IEVA 1M73E 1QG6A 1VOTA 5IT4A 2WF5A 4MS4A 3ZHZA 1PL7A 3SJZA 2PXHA 4OSOA 2IH5A 2X86A 5TF4A 4YDQA 2HRQA 3AFIA 1D9XA 1G7SA 1QVGB 2ZRFA 1DAEA 1YONA 3EQ7A 4GW3A 1TVEA 1EGAA 3MT0A 4HRVA 3WQRA 1KMHB 5K8CA 1JECA 2BD0A 3UJ3X 4EVQA 3GJQA 2E6KA 3KP1A 5F9FA 4RMGA 3AVPA 2C42A 4ZDJA 3MHTA 4B87A 2XJ9A 1H2FA 3WKCA 1A50B 2OCIA 4C0AC 3PFKA 4P12A 4M87A 3KKOA 1E60A 1NF3A 3H4MA 3NBQA 3SYMA 4N65A 2AD5A 4BNDA 3HRHA 1R00A 2PA0A 3FYUB 3UFBA 5A4IS 3OZSA 1G3MA 2FEXA 5AW9A 4MA5A 3H3XA 1NE2A 2FSUA 2OBMA 3LPLA 4R16A 5JRJA 1HNXB 4BIIA 4X97A 5DYWA 3C85A 3ASSA 2YWGA 2XYVA 4LUCA 2G82A 1C4XA 3GCDA 2LZ0A 1U7HA 2ZVJA 4DK1A 1V8DA 3ESDA 3MYRA 5ERXA 2QX8A 5B58C 5HM8A 5J47A 1Q1ZA 1BYIA 1RCUA 3GLHE 1FDVA 4RKEA 2D7JA 3DW3X 4AYWA 2QN6A 2AG0A 3ZKAA 1AXEA 3GVCA 1ZINA 3MT9A 1TYDE 3RC2A 3UMJA 3VYSB 4GZMA 3WMGA 2VXCA 3ZEIA 4B82A 4ENSA 5AFSA 4IUBS 1P9WA 3LL4A 3O93A 4O4JB 3KZNA 4WKCA 4X66B 4B3RB 2OY0A 4MYUA 3N7AA 2MSWA 2PX3A 2SCUB 3E3LA 2P9QA 5E6TA 3BE5A 3DZDA 4JI1B 3R24A 4DYDA 1IXKA 1HX7A 1RTTA 3WJ2A 3UC9A 3AJEA 1WQ1R 3DCJA 1UAGA 4YRTA 3OA2A 1QQAA 1VQKB 4A6DA 5I51A 3F73A 2P2SA 2J31A 5KTTA 2FOLA 3U26A 4NU0A 2NMVA 1JHPA 9ATCA 5G0WA 4JJZA 3QLVC 4CL2A 1FXWA 1Y98A 4DMRA 1ORIA 4TSFD 4DB2A 4EVSA 2NPFA 2X5JO 1RJFA 3IA7A 4JB8A 3B3AA 3GGPA 5L7YA 3PFWO 3NANA 3FCSB 5AKEA 8OHMA 1KQNA 2Z3ZA 1RYZA 4YHHB 1P0PA 4N5DA 1II0A 1CR6A 4UEQA 1P2SA 3VJLA 4A73A 3LUJA 1DU4A 1GPMA 3W2FA 1E3WA 3CX3A 4V0MA 2NZVG 2X5NA 4RL4A 4DS3A 1HNWB 2Q3EA 5HCIA 3I1FA 2Z43A 1SXIA 3DW1X 4XORA 2JIDA 2BOVA 4J16C 3M89A 1U9YA 2ISCA 1N2BA 5B4TA 3IT1A 3WP0A 1VL6A 2YV3A 3DDSA 3K8QA 3CX7A 3M83A 2XLCA 1EPUA 1E1RA 1J2RA 2R8OA 4JK3A 4NCHA 1AKTA 1H1TA 4BJ5A 3KLNA 4AQYB 5EJ8A 3QEAZ 4TKUB 1ESDA 3EQ9A 4RPIA 5AJYA 5TGTA 1RZ3A 3RJ5A 4LZZA 5EP2A 2VC2B 4H1UA 5FBVB 3BGVA 4CMHA 3KUCA 1JAHA 3ZJTA 4EM6A 3WRVA 4NDNE 4BC0A 1U65A 4MH0R 4FFLA 3DBRA 1TIPA 2PAFA 2JGIA 4QQ8A 4XVRA 3WL3A 1SCUA 4TXNA 1I30A 1JPVA 1A97A 4PC1A 2PT6A 1SKYB 2WSBA 1OLUA 3DQZA 4HXFB 2VHXA 3ZU6A 2EKPA 4OHOA 2JHCA 1KO8A 3N8IA 4UHDA 3TX2A 5A6SA 2RH8A 1GL9B 1WWKA 2Q3FA 5JS8A 1GYQA 4JKIA 3VOSA 3Q9NA 4ZVMA 5IXSA 1GTVA 1OGJA 2H1VA 2PYZA 4J0CA 1VJGA 4WLOA 3HNOA 3OD1A 3W3AH 5DNEA 2XY4A 4CL8A 1N5LA 1UBOS 1T9BA 3OCXA 1XEXB 4K8OA 4KODA 3OVMA 1BVRA 5EJGA 2Z2ZA 1Y63A 3BRQA 3UHFA 1EIWA 3H2IA 1TD1A 2JA1A 4QRIA 3VU9A 3Q6IA 4EITA 4P34A 1ZSVA 3CLTD 1O58A 4K6CA 3VZCA 2IYFA 1BE0A 1A9SA 2XQFA 3CMCO 4XWGA 5FULA 4F46A 4HH3C 4MWDA 1IY0A 1XZDA 4JCOA 1RXUA 3PVSA 2VCYA 3GAFA 5ALIA 4ENTA 5JZMA 1E2JA 4MWOA 2FVXA 2PKWA 5B2ZA 1NDHA 2VH1A 4LSWA 3M6AA 1TUBB 3HDYA 3U13A 4F2PA 2J5RA 3QA3E 1NFFA 4AS1A 7REQB 5FUVA 2ACKA 1WHSA 2WJIA 2WTEA 3EGVA 4LOJA 1BD4A 1RFLA 1IAQA 5JC8A 3KQKA 2HU7A 2IZ7A 2GN9A 1V41E 1F06A 1X7XB 2JIOA 1MB2A 2B69A 4G0NA 1X9HA 8ADHA 2VNAA 2JCGA 1G8SA 1Q12A 3FSJX 3S0JA 3R76A 2J5QA 1BQ3A 1Z0ZA 2IJGX 1THMA 3OLCX 5CFRA 5GZ1A 2X1HA 4WLVA 1I7SB 4Q3DA 1W59A 2DBVO 1TEHA 1FQJA 3OP4A 5KO2A 1PK9A 4DDWA 2HPAA 3O8NA 3R7NA 3IE2A 2FPXA 3RI3A 5H3LA 5IHXA 3DPSA 4IIFA 2HMUA 2YFHA 2I8CA 3UK7A 1UC8A 5KQPA 2QYSA 3TINA 3PC8C 4E12A 5HRAA 4MV4A 4E70A 2JFZA 3KELA 1FX0A 3KEWA 2F43B 4ZI7A 4RULA 1LLFA 3KZVA 2XODA 4X0CA 1JKXA 1EE9A 4M54A 3BY1A 1XRSB 1R0KA 3AEYA 3HYNA 1GCUA 1XDUA 5IMBA 4YTEA 3CR7A 4ZCSA 1UF9A 5G1PA 4S1OA 2L18A 1LZLA 2WU1A 1W48A 3CUKA 1P2TA 2ZIXB 3E4CA 2QAGB 3VVMA 1U94A 1OV4A 4U7WA 2PEYA 4XDGA 3V8VA 1FBTA 4DNTB 3VDNB 3PFHA 3AR9A 4FZRA 2YN2A 3MWEB 4M1MA 1Z28A 3HJGA 5JJBA 3HDJA 2GBPA 2JCBA 2YQZA 4GX5A 1HZJA 5G0UA 3OUTA 4EEZA 3M2PA 5T5QA 2Q1YA 3QELA 1I4WA 3EDQA 1FMJA 1YR1A 5FAXA 5AM2A 4JA2A 1R0SA 1Y5MA 1NRJB 2WSSA 4IR7A 2O2IA 3SLGA 4D25A 4OG2A 3SSMA 1E7SA 3G8CA 2ZRBA 3T7SA 2C4TA 3R3HA 3EXHA 3THOA 4LNUA 4DBZA 4V1CB 1GA4A 1OFGA 3PL1A 3QI7A 4MUYA 3PVCA 4D5GA 3AIKA 4RMIA 4MYCA 3L49A 4OBXA 1LKZA 4EUNA 2HT1A 1K3FA 3BORA 5FPPA 4F4UA 3LXUX 4E2ZA 4ZALA 4EFDA 1FFGA 3QXHA 5ARBA 5EZ5A 3TTYA 2AWNA 3P9ZA 1XZGA 4LG1A 5IM5A 3R3WA 4R05A 2FOIA 4PLYA 1LNZA 3A1EA 1HLGA 5AW1A 3AINA 4DR2B 2JHAA 3QYPA 3HYCA 3H9JA 1REQB 3H5RA 4EY5A 4KXUA 3MAAC 2NTNA 1I9CA 3RLIA 5D8DA 1A77A 1BGXT 4UDNA 1DIHA 3OX4A 2CXHA 1JLRA 4IUCS 3GFSA 3RF7A 1XN1A 3ASUA 4TWIA 4YREA 5HK9A 4UE3S 4OREX 3HR7A 1BJRE 1SUWA 1T1IA 2VZ9A 3MWGA 3TJZA 3O8QB 3Q10A 1EVZA 1LK5A 4O6VA 4QOSA 4DIUA 1XJ5A 3ENKA 4WK4B 1YA6A 3HR8A 3R41A 2WWFA 3VVLA 4IYJA 2CXNA 5K3SA 3BIJA 1Z0IA 2CNOA 2YJGA 3OMLA 3K9GA 2H7CA 2VTBB 1OXBB 3W79A 3M2TA 2XB4A 1KHTA 4PHGA 2I76A 3DZBA 3L84A 2NO7A 2V7TA 4JJ6A 1NBIA 3TGWA 3WRYC 2VSNA 2QL5A 3GT4A 4GZ6A 4ZXPA 3VOTA 4US2R 4K46A 1RJGA 4MIEA 4IZOA 3EMBA 3E3NA 2P6MA 1GSAA 3CLVA 2QI9F 1V4NA 2G25A 4CIXA 3OTIA 4ZEWA 2PZEA 1G55A 2HYDA 3CLTC 4DBLC 1AK1A 2FPPB 2P68A 5FX2A 3SZLA 1JAYA 2CK3D 3HGMA 2QUAA 4Z4TA 1TFUA 2OO5C 2YYAA 3QVGB 4HAZA 3WICA 2JGRA 5AVRA 3EXG2 3ZK7A 4REQB 1JHZA 1EMDA 3PGMA 6ABPA 3FOCA 1ZBQA 5C1OA 1DJQA 3VMMA 2ZR8A 3HPQA 1U0SY 4FLFA 3DNFA 1QH9A 1YL7A 2I78A 4INPA 4CM3A 3IUYA 3O8LA 1ZA1A 4DCPA 5KYNA 1RWNA 3VMFA 3K05A 4QPDA 4KWTA 3EPJA 4IUDS 4P3YA 3HO6A 2HZ7A 3PBKA 1CDDA 1FFXA 1JT9A 1JQKA 4MCJA 1PJCA 1XZCA 1DAFA 2CE2X 3BSWA 3WQHA 3EA4A 3OU6A 2F3RA 3W4JA 2Y0BA 1G8AA 3URKA 1LS1A 4C0WA 1N3IA 3CY6A 4OIMA 3W9SA 5TRDA 4TMVA 3KPVA 1HVXA 1UD2A 1E2FA 1EJ2A 3O6VA 3K92A 1IEVA 3F3KA 3SJ7A 3UICA 1L6IA 2GA9A 5EHIA 2OV2A 1SC3A 2H7XA 4JENA 3EMDA 4ECAA 5JQGB 2LPMA 2C54A 1JZSA 1AD2A 3DCYA 3KE8A 3P9SA 4FHEA 4IIVA 4J0IA 4OLJA 4ZAVA 3CW9A 4BUCA 2JK0A 1RWXA 1C81A 2ENWA 2VBSA 4M4SA 1ZH0A 1F3OA 1QGUB 2A7QA 2UYYA 3HUEA 3H65A 5HUHA 7MHTA 5TQ2A 4G6ZA 4JZYA 4P5EA 4FYXA 1GAQA 4MAMA 2H2WA 4RYLA 4CMAA 4D2IA 4C3VA 4DXHA 1EWQA 1EFTA 1V95A 3SHQA 3RKUA 1ULAA 1MABB 1WHTA 2WKSA 4LISA 4YDRA 5F1PA 4QFCA 2XMPA 4P3IA 1NJFA 3IQEA 4CV1A 4IBOA 1JR3E 3EGCA 1Y4ZA 3JYOA 4J2HA 4MRRA 1VRWA 2FZ5A 2ZJ1A 3N59A 1B41A 4UREA 1Z7WA 3FZYA 3B1ZA 4IFEA 2DFPA 1MB9A 3A1SA 4O08A 1AGPA 3WQQA 4P58A 1ESEA 2J4DA 4RIIA 2QAIA 4UTNA 5DGTA 4K6OA 1XQVA 1R2QA 4J07A 5SZIA 5F1KA 4CCYA 2XE7A 3GHHA 1R4NA 3KQQA 3GCGA 2DBYA 1ZD5A 2DLNA 1V0EA 1XLTA 2P0AA 1CD5A 1QCYA 1GYPA 4Z8YA 3LXRA 5TT0A 5I8ZA 4DDTA 2WYIA 2E4UA 5IC5A 4LGVA 4MO9A 2WFLA 1W5FA 1E1MA 4KYIB 2PCLA 4HAIA 4Z9BA 3U4DA 1XHEA 2HO4A 4E5VA 4JLKA 5IKOA 4DR4B 1A8PA 2A9KA 2CXUA 4TXMA 1SXJE 1GU0A 1JF8A 3QEJA 4ZOLF 1R0YA 2NYUA 3BHMA 3GARA 5ETJA 4A2QA 4U7PB 3V8QA 5LMNB 3GRCA 3C97A 3MCUA 2HPVA 1CQXA 3C3BA 4U1RA 3USCS 4AVYA 4F84A 2VJDA 2QENA 4YBZA 1ZHHA 1Z33A 4EZBA 4JJ4A 1QIMA 4BV8A 3WYGA 4GC5A 1IY8A 2CMFA 3H1AA 4NH0A 2M1ZA 4C7KA 4F2GA 5BWOA 3A7DA 3PCXA 3IAS6 1M1ZA 3HY6A 4IDDA 2RAFA 1DG3A 1NLMA 1Z5OA 2DF8A 3HBAA 4IHJF 3ILSA 1Y8CA 1EG7A 2G80A 2JLAA 4HY3A 4DC1A 4C43A 2BFBA 4P7FA 5DJ5A 5A3RA 1UBRS 1E59A 2B8TA 2P2CA 2VDNB 2R8BA 3PWTA 1Y3FE 2H2AA 4BWGA 1L5FA 3FUUA 4N5LA 4DLTA 4P08A 1Q7EA 3OQMA 3KVYA 1UD8A 1WDMA 1VQ8B 1X9GA 2VJYA 1QH8B 4FNMA 1CZRA 2DEUA 3CVOA 3TG2A 2XYQA 4NOKA 2DFDA 1M6VA 4YA6A 1Z68A 4QC2A 1T2FA 3R7AA 2WQ7A 3RQIA 1ZK4A 4MVJA 3KQNA 1TAHA 2WP8J 4H35A 4KIWA 2PCJA 3F67A 1U90A 3D5TA 1N77A 1JEYA 3X2SA 1ZS9A 5WRFA 4B3SB 3W5HA 1RXCA 3TE7A 4AZ0A 3OTQA 4F12A 2C92A 3UBTA 1Z5GA 5JSZA 4RM3A 1XVUA 5EMNA 3U5TA 5GY7A 5FJIA 1ZQ9A 5CW2A 1EX6A 1P61B 2JFOA 3ESCA 2GM4A 3QKUA 2XXJA 3E18A 2G4LA 1C41A 1U99A 4J49A 3ZE0B 3TNFA 5CLHA 3T6KA 3JWHA 3LXXA 4WXYB 5AXBA 3I1IA 3BYZA 4I36A 2YIVX 3R9KA 4OQLA 5ITSA 4M98A 1KVSA 8AT1A 1E63A 1Z7BA 1JIJA 1XJCA 1E9SA 2Q2VA 4PPNA 5GJCA 1KFCB 3EGEA 5K8TA 1OX5A 2ZE7A 5K0NA 3E2PA 4ZICA 2V55B 3HP7A 4HDNB 2CLOB 3GLKA 3LIPA 3WMEA 2F3UA 2HO5A 3RO7A 1GZUA 2R68A 1IONA 2NUTA 2ZI7A 1KSFX 1OH8A 2B6HA 4GMDA 4M49A 2BM8A 4D7AA 4KWCA 1Y1LA 5MGNA 4GC9A 1XR3A 4G7WA 1FLNA 1IXRC 1N3BA 3WLHA 5GONA 1JU3A 2RSLA 4LJ8A 2X6WA 3N0RA 4NL4H 5GQSA 3T1NA 2P6RA 1JJBA 2WA2A 3IGFA 1L8XA 2L19A 2H6EA 3Q38A 3FPEA 2PS1A 2O8DB 2WTXA 5C1IA 2R5WA 4Y2TA 4Z4VA 1M6HA 1P74A 1S9DA 1T2VA 1C9EA 2IFTA 3E58A 1J97A 3EGXA 3FNRA 3DMPA 4I7EA 3DDCA 2DY0A 3HP4A 5EEGA 1NW7A 4P5PA 1JVNA 2ASVA 3KPJA 3HM9A 1J24A 3COPA 3OC0A 3H5NA 5FEUA 3FMVA 3ZZ0A 1W36D 1DG9A 4BYGA 1TK9A 5TXGA 1TEXA 1IQPA 2J4FA 4LJ9A 4NTZA 2C5SA 5B4UA 2XGGA 4J9UE 3C3WA 1KAGA 4RHTA 1N6NA 3C7AA 1IEWA 1PTKA 3MWFA 2GZSA 1IM8A 4YEDA 5DCUA 2CXOA 4B2LA 5IJ0A 1YBMA 3B13B 2BDTA 2AZDA 4LF9B 3ANSA 3KOXA 1TKCA 2DWCA 1N2CA 2A57A 2GZHA 4HWTA 5TPWB 2VP5A 4EVRA 2ZZNA 2VF5X 4KWEA 3RG2A 5B2FA 3QIVA 2O19A 5BQPA 3DLCA 1N4AA 2WDPA 4DNFA 3ZPNA 1RD4A 3DBIA 1H6DA 2WG1A 2G17A 2G83A 2YICA 4JB2A 1ZM2A 4BO2A 2YN4A 1JDBB 5C7IO 3KFXA 3WHKA 4QXMA 3RODA 5LUAA 1RTKA 3NGMA 4KWHA 1G6KA 4Q12A 2A1TS 3I76A 1ZOPA 5T67A 1FA9A 2E2WA 1YHNA 1V7PC 3B82A 3EIFA 2JJ1A 4ODIA 5EL0A 3PIRA 3FVRA 3H7AA 4I55A 4ZO4A 4F6LA 4F9EA 1RAHA 3A35A 1FYDA 1IN8A 2ZAGA 3G6EB 1JX6A 1P0FA 2H0QA 1KK0A 3JQ8A 2D0IA 1K5GA 2I1WA 2JFWA 3CIOA 4MVCA 5C3UA 3F4KA 2F90A 3WMXA 1DC4A 4BX9A 5IEJA 4OHYA 1AJEA 2HSZA 2ZL6A 3FMIA 1ODIA 1RE1A 1P39A 3FSGA 3PRKE 5HUQA 1EUCA 3HKCA 3JARA 3WK4A 5K9ZA 2XCRB 1WSAA 1YQTA 3LPNA 1PTJA 4EQ6A 2ECKA 4AJ2A 1XVVA 1LFDB 3Q40A 3QHQA 5L40A 3WYAA 4RF2A 5IYRA 4S3MA 3MRSA 3OZRA 5E9AA 5IAOA 2B21A 2O7RA 4LAFA 2H1WA 5E3IA 2P4HX 2O2DA 2AW5A 3NIDB 4YCNA 3A3BA 5CM9C 3KSAC 2HQBA 5DHAA 4AMUA 4EG4A 4HEJA 2VT2A 2WZQA 1LSJA 1QCDA 2Q46A 1ZN9A 2B78A 2YR0A 3ENNA 3GUVA 4YRFA 5EVJA 4KE8A 2P41A 2Z2IA 1GRRA 5J23A 3HZHA 3T3NA 3VUEA 1QTRA 1UOQA 3HDHA 1XF9A 2WM9B 3E3MA 5ALMA 2VDLB 1QMGA 1EVLA 1KQSB 4L5JA 4NYIR 3UFXA 9GPBA 3HCEA 2A94A 3RGGA 5JT1A 2YY7A 3B3JA 1QQBA 1RWPA 4ZO7A 2P6PA 1TMGE 4RFSB 1EUDA 2BMWA 2I66A 3H9QA 1RYNA 2RG1A 3ESBA 3PTLA 5G4KA 4HN2A 2R6AA 3K70D 4KKVA 1H8EA 2OV3A 3H2YA 1CV2A 2NQ2C 1H9BA 4L16A 3EDCA 1GPBA 1YQ9A 2IXEA 2DOGA 4LCBA 4NULA 1JEQB 1C3EA 3EPRA 4X7MA 3CC8A 4YUWA 3R75A 4X7RA 1UZMA 1J90A 1MX1A 2AC4A 2B1IA 4GSYA 2JHPA 1SXQA 4ND8A 4G97A 3LUAA 2V8BA 1QV7A 4JIGA 4CE6A 4ZDKA 2PMEA 3OIGA 2XZTA 1NQVA 2ON6A 2WYOA 2RCNA 1C3XA 2J9ZB 2Z57A 3DO8A 4XGNA 1R18A 1ZJJA 1T0JB 2CCGA 4W1PA 3AOEA 5HQJA 4LJAA 3ZCVA 4EHKA 4XWKA 3L7MA 2I4LA 3SP1A 2PSSA 4PYNA 1FL9A 1QUEA 5KI6A 4UHFA 3ESRA 3OO1A 4IEIA 3UGJA 3U7FB 2R3SA 3AEXA 3GA5A 3RTGA 4NENB 1VQ5B 2I4TA 1KP9A 3A3YA 2TMYA 4F3NA 3Q6RA 1Q9SA 2VWGA 3HO8A 4PAGA 1LJLA 5KHAA 3S2GA 1KO1A 3A3PA 3A9TA 4DMGA 5KTPA 1FTNA 1HETA 4P83A 3IJPA 2JFGA 1XA3A 2H52A 4IOLA 4Z7NB 5LD2C 4BS9A 4YECA 5IZCA 4BPBA 1L8LA 3E1KA 2XZDA 3FFWA 3DTYA 2H07A 1QKKA 3VTKA 4MUIA 1DIRA 2PIAA 4HQFA 3FOFC 1HYEA 3W0LB 2FUG6 1F48A 3CG4A 1LW6E 1ULHA 4TM8A 4YJHB 2I6UA 1NA5A 2P40A 3ASZA 1P7WA 1TQ8A 2FUNB 3E84A 4TV9B 1QZ3A 3EDOA 2HF8A 3LM8A 4IAOA 1KH2A 3VNBA 1NBWB 1NN0A 1XZIA 2EYUA 1O0SA 2IQ5A 2XCQA 4G36A 4GOOD 4LZPA 4U2EA 2O8DA 4LZNA 1NP7A 3WVNA 1XALA 1T3TA 2A1UB 4LOKA 2DTEA 1Y81A 4RW0A 4OYRA 1W36C 4N48A 1T9CA 4FXPA 4UD6A 5ITWA 2HRZA 4RPDA 3KV1A 4ITVA 4TL6A 3L5KA 3IXMA 5DN9A 1UJ5A 4XTRA 2C61A 4XGKA 5D5QA 2Q4OA 2O7SA 2OESA 5EZ6B 1TB4A 1VCOA 3NTUA 1E9BA 3T1OA 2WD9A 4JBGA 1GCIA 1JJAA 4MQEB 1FS6A 4MI6A 4RGYA 5CFMA 5KWSA 3RC3A 4DG8A 2BDEA 4GEGA 3IPCA 3G9UA 2ZUCA 3ZW8A 5F3WB 1H6AA 1PE0A 5HKOA 1KKLA 3DV2A 5JAOA 3D1LA 1GL6A 4B3TB 1RR6A 4WAUA 1PBNA 4PONA 1I7LA 3TQSA 5EWLB 1KYQA 4WSOA 1O96A 3SXJA 2PKEA 4NCAA 1L5QA 2D9RA 1MP0A 4KQGA 4RVFA 1ZNXA 4E08A 5CD1A 1BW9A 1O7JA 2D2EA 2FB9A 4L3WA 3OU7A 3PE3A 4PTLA 1V5WA 3JALA 4FLEA 1VIMA 2XHEA 1WSDA 2OBSA 1JDVA 2E5LB 3ASYA 3LDFA 4BVLA 1GAXA 1PS9A 1U3GA 1Y0YA 3JVDA 3ZUGA 2VP4A 1WUJS 5EC8A 3B2QA 1GA6A 1RYEA 4N39A 1GPWB 1KY5A 2Y1WA 4PIPA 4GSLA 4TL9A 3U1TA 4DV4B 3P97A 3ET4A 1NF9A 3OWXA 1IBCA 1ZUD1 4V39A 2BTQB 2YYSA 1IH8A 4AZ3A 4M9UA 5BW8A 2VYCA 2YIJA 4P8RA 3IAAA 1Z73A 3LHSA 5P8WA 3SFTA 4IGFA 1R8SA 2WT8A 4JP5A 1U7DA 4WMLA 4KRYA 1EDDA 1YQEA 3DEIA 4BNFA 3RS7A 4K5QA 1OIVA 3PITA 4EW2A 2OHJA 3UJCA 1AN0A 2OBFA 2IEBA 3KE9A 2H9YA 1M34A 4CVNA 1YS6A 3GBSA 2BE7A 1EFUA 1D1TA 3ADOA 3FLBA 3KM0A 1PKVA 3GLFE 4X8IA 5DW3A 3ONYA 2H48A 4WUTA 5F2EA 1FPQA 1D1SA 3AETB 3GDOA 3SLNA 4KIJA 4LWPA 3JZDA 4X6LA 3SYKA 1LC0A 1BD3A 1XA4A 1A2BA 2D5AA 2XUGA 4MLPA 3S70A 1YFJA 3CS3A 4BYMA 4ESHA 4LC9A 1L4LA 1YU9A 1UPBA 1Z4OA 2B82A 4TUYF 1RWQA 5KIAA 3I3SR 1EB9A 3FUCA 2P7HA 2R1VA 3JATA 5A05A 1USKA 3AUKA 4PQFA 3VDQA 5EHZA 3VO2A 4P22A 1IB6A 4QU0A 2QG6A 3S2IA 3K70C 5HX7A 2C3MA 3ZCPA 1A1VA 4RNDB 5GPBA 2QSZA 3HSSA 1IFXA 3COSA 2GBFA 2X5KO 2WVAA 3FY4A 3IOMA 2NUAA 4B7CA 1PYOA 1YULA 4U7GA 5EKDA 4YCCA 4YRZA 1YRYE 3THYB 2FPIA 2PYIA 1Z4JA 4LV5B 1QV9A 2PGAA 3MWDB 1S5PA 1Z6QA 5FD8A 3FAKA 3O95A 5TRTA 4L4RA 2HNKA 5CM2Z 3RAFC 2JLXA 5FOVA 1U7XA 2I3BA 1CQIA 3B6KA 4JKYA 1NSYA 1R6TA 4M0PA 1VG8A 2WF6A 5CX4A 4ZAZA 2J0VA 3SAJA 3EVFA 4Q4HB 3SXPA 1JH9A 2LBPA 4KV7A 3RJZA 4MYDA 1AQ6A 4UCQA 4ZVRA 2E37A 3CRW1 1WUIS 2AWOA 4AKGA 1TVMA 1ZY2A 2ZU0C 3VTAA 2XYPA 3FPGA 3LKZA 2TSYB 3E5HA 4HWGA 2EFJA 4PHFA 2C8JA 4QDZA 2ZZGA 1DFGA 4MUNA 2C5GA 3TK1A 3ONFA 2BAGA 2WFMA 2WKPA 3RLFA 4QYXA 5ELLA 1JQ5A 4BXOB 1DO0A 1Y42X 3TO5A 1PJ2A 3TOZA 4FW8A 1QM5A 1NAIA 3ONVA 1UFOA 2F1IA 4M8LA 4OK3A 5ESXA 3SHOA 3ILXA 3VRHA 4WCFB 3VGPA 4CM4B 5ICSA 1Z7GA 1I2BA 3DBLB 2OOSA 3CR3C 3R6TA 5CPBA 1J49A 1P2DA 5CA0F 3HN6A 4ZTZB 4POAA 4A26A 4IQ8A 4PAQA 5KDLA 2VK4A 3WL8A 3U3KA 1BKDR 5JCPA 4FFRA 1N8TA 4JC8A 2M1XA 4YMUA 5JR3A 5JS7A 4QHYA 2D62A 2BKEA 5E1BA 2PUCA 1NIPA 3EC7A 2XV1A 2OGUA 3X1KA 2GVDC 4WPGA 2FMXA 4LXYA 4XLFA 1VKRA 5EKXA 3IDOA 3EEFA 2BGUA 1J0BA 4CDRA 4HDKB 3ZHBA 5LYJF 3ONUA 1QO9A 2APJA 1R0RE 2FX5A 2PWAA 5DBHX 2J0QA 3G2QA 4OFXA 3ABIA 3UHJA 4EJ0A 1DKNA 1YNOA 4GP6A 5FQNA 5CEEA 2VIIA 2GETA 4I1UA 5JNUA 4C4PA 4LMAA 1BX1A 1VQPB 2AFHE 3G13A 4JX8A 4L3OA 4PSAA 5BWMA 3BZWA 4ICIA 2G6BA 4WNAA 2DFKB 3L8YA 2FZKA 4UVHA 4UNRA 2JATA 4AUMA 3CC2B 5HQ3A 4G1VA 4I5DA 3VPAA 2FQYA 1KI6B 2ZKLA 3K0FA 5EFOA 3A25A 4Y1RB 4A82A 5B3JA 3OPOA 1PJQA 1MC8A 1E1RD 2CDRA 4EKIA 2I6XA 2LW7A 4J7XA 4C3ZA 1FP4A 2Q3BA 3LBHA 4FR5A 3A2KA 3SMQA 1QMPA 3ZY5A 1PR6A 4O4IA 4TSKA 4WJKB 4JUCA 4I9NA 3AP2A 3JQDA 1QWOA 3LCMA 3QU5A 4WK0B 3CVVA 1GNRA 3AMVA 3UANA 1FYVA 3C39A 3FOBA 2OCPA 5BSYA 1YAHA 4ARCA 4RS3A 2FEPA 4MWGA 1IDN1 1EA5A 2Q5JA 1XYVA 4E21A 3PDWA 1T9DA 2FE1A 3AEUA 1V48A 3I4FA 4ZU6X 3LC7O 3OZBA 2ZT5A 3B2EA 1FFBA 3GL9A 1V9SA 4PC7A 5CFLA 3UAYA 2FLVA 4RIGA 2X77A 1GGFA 1VJ5A 4KRXA 1F20A 1ODTC 2X8LA 3E9DA 4OFWA 4WNCA 2DQ4A 2IHVA 3HB1A 4CG2A 1NXSA 3FTNA 1HY3A 4UXHA 3HM2A 1WULS 4WZAA 3NV9A 4QUBA 2ZJOA 1NR5A 2Z6BD 3B89A 3W4KA 1R3UA 1Q17A 3P20A 4F0JA 5A02A 3MQ4A 2G36A 1Z88A 3G0GA 2IYWA 5U4QA 1RXVA 3TUZC 4CKCB 3KAJA 4Q48A 1PJBA 1RRVA 3RS9A 2EJUA 4LECA 3QUAA 1MQAA 3T4EA 1YRHA 3KZMA 3E5RA 2P4SA 3DB1A 4JLAA 1JSCA 3P96A 1WR8A 1U3VA 1ZRHA 2XDWA 2Q4RA 2W58A 3C8MA 1N5OX 2Z4SA 5J63A 1KEKA 1C4OA 1KSGA 1JE0A 3IVXA 5AJVB 3INTA 2ZIZA 5JDIA 2NTYC 3PGJA 4HB4A 4KR2A 5AI6A 2ZJAA 4RJIA 1S2NA 2HIHA 2FMHA 3OCYA 5F4MA 2UUBB 5GIPE 1M5TA 2GRJA 2EFHB 3ND5A 2O1SA 2FSHA 3QKTA 1Y1TA 4LVUA 2VH5R 5AK6A 3BX1A 4LC0A 4L51A 3K0CA 2H2HA 4IXDA 1UMBB 1Y48E 2BJHA 1TXGA 3MTDA 3O3NB 2MYPA 3UUFA 2Q1XA 2Q50A 5BVHA 3EVBA 1QLWA 1U04A 3H8JA 1XV5A 4EF6A 1B76A 3PPVA 4EIWA 1GZSA 1Q1EA 3OPYA 3TB6A 4PXSA 1F8FA 3ILYA 2IPLA 4RHEA 5BW6B 5LP6F 1R5BA 5A5VA 4QDJA 3UJ8A 1ZLXA 1IZ9A 1XA0A 2WU0A 3BOSA 3PQDA 3O4VA 1PFUA 2AC2A 3MRXA 1BXRB 2R8YA 1WEKA 3JYQA 4K6HA 1VI2A 1UH5A 4ZRNA 1LD3A 3GQVA 4IJMA 1XE3A 1HDGO 1U98A 4YJGB 1K08A 2RI1A 3D6AA 4W4TA 3ZGLA 3RRZA 4DN6A 2I3DA 3K1JA 4PCVA 4RHYA 3UUWA 1WMFA 1CQWA 4XOUA 4BMZA 5JSUA 2MSDB 1C14A 1JDNA 4LF6B 3A6GA 3IB3A 4MWCA 1L5HB 4PPYA 1RACA 3GT7A 5KNDA 2XQKA 3AQIA 4V0RA 3A4MA 5DO9A 3BF8A 4GL2A 2DVMA 4L8JA 4KG7A 4GH5A 4UULA 1OYVA 5G0SA 1IBLB 4C01A 2ZCJA 4C7OA 4QDOA 3CE6A 1EUQA 1KRXA 4BP8A 2PZGA 2RHHA 4A8HA 4ARVA 5ICGA 4YLGA 4L7VA 4DQVA 1YT5A 1Z2PX 4QD3A 5LB4A 3VYWA 4ZI3A 3PNSA 1Y8ZA 2ACWA 4MB6A 5B64A 3ZD6A 2WSSD 4GOMD 3FPAA 4IIXA 4KKTA 3RS0A 2XUIA 3CTPA 1T3HA 1Z8HA 1BHQ1 4NCNA 2BMFA 1DSSG 4C0KA 1PFYA 1GIAA 4W9MC 5AH0A 1MOZA 3WWZA 2AOVA 1X3LA 2C5AA 1RYBA 2CHGA 3VC7A 5IZ4A 5LDDC 3DOOA 1NLYA 3HXQA 1F12A 3HBFA 2YTZA 3W5VA 2N0SA 1TW3A 2VG8A 3ABQB 4IQGA 2P8JA 2WDZA 2PT5A 1XTKA 2VQDA 1W581 5HRUA 5KOIA 1CZHA 3S2EA 1R4AA 3BK1A 4GQIA 5KMGA 3VHRA 4B85A 3DWFA 2AJTA 4BNVA 2WMDA 4AJOA 5AVXA 5IDQA 3KYDB 2GDZA 4KMOA 4P84A 4EA6A 4DGQA 1QR2A 1X8LA 2ZBUA 4L8VA 1W9MA 3ND6A 3T7JA 5BN5A 4ND6A 3CUVA 4W5WA 1QGYA 4ZVLA 1MX5A 2HDNB 1Q95A 3JTEA 2RGWA 3HGQA 3DZJA 4ND2A 1FY2A 5JSFA 1JDTA 2HMTA 1ISJA 1C5KA 4LXUA 1U3CA 1T3SA 1VKNA 1XCBA 4AECA 5JS2A 1VQMB 4G0QA 3TLYA 4EA7A 1KU6A 3QE9Y 3EMKA 2D1TA 4O2BA 2J9XB 1QGAA 3P4YA 2NO5A 3Q3IA 3M49A 1P6XA 1NVXQ 2J0EA 4R31A 3F6PA 3M1LA 1GCGA 4B31A 4EAAA 1NTOA 4HWOA 4CIWA 2QGGA 2PJZA 2F17A 4PSDA 4X63A 3SEAA 5KYGA 4D4KA 3LJKA 4LKRA 2W00A 4N9QA 3EGWA 2OHFA 2EP8A 2GVZC 2OD2A 3UGKA 1RS0A 5JY1A 2HA3A 2C2WA 4FS8A 4CLXA 1ULTA 1M72A 3A9SA 1QPGA 4Q66C 3IJEB 5A7GA 5CDFA 4AZSA 5M5BA 1JWLA 2IIVA 2YWBA 2H4WA 2CBXA 2GD6A 1Y8RA 4LHZA 4EHBA 2VAXA 4XWTA 4JBIA 4IIJA 3SBEA 1C9MA 4C3OB 1BGVA 4GPTA 1XTPA 1NVDA 4MKGA 1WF3A 3HV2A 2JBWA 4GEKA 5AK4A 4EPRA 4JL6A 3D9QX 4MMYB 1MTOA 2Z6UA 4BBZA 2H0RA 2QBYB 1P4GA 3BUSA 3DEFA 2NVBA 2WHPA 6CHYA 2D06A 4J0EA 2GNAA 4OBEA 3JWGA 3NNNA 4M8NE 5HF5A 2OM2A 1VSQA 3VR6H 1Q0LA 3ZJ4A 3EZ7A 4TN1A 4UTZA 4YGYA 1FPMA 3EIHA 5FL3A 5D51S 3KWFA 1W29A 3ZGYA 2V8OA 4FILA 4RC9A 1D2GA 2AEFA 4EG8A 4EY3A 4F4FA 3NIWA 4P2GA 1HFJA 4FC6A 5AXDA 3T06B 3PEEA 2ODNA 4L9AA 4PF1A 4ZRDA 3LSTA 4HWKA 2IEYA 3WDMA 4E14A 2IX3A 3NPAA 2Y2VA 2QUHA 4G8JA 4RD6A 4E7OA 2IZ6A 4L2IA 1NG9A 3D3WB 4ISBA 2YWFA 1Y6RA 3VNQA 1A4IA 1QB8A 3A37A 2VNKA 2A4MA 2RH9B 1KRWA 1ZJ4A 2EC5A 4R2XA 3L2OB 3F3SA 2QT0A 4MPJA 3VPCA 2ZS7A 5LYYA 1CUIA 1T4DA 2PU7A 1DKRA 2XEDA 5IBCA 4FZ3A 2EP7A 3Q15C 1HOTA 4R9VA 4XJXA 5K03A 1TM3E 3CKYA 1U5BA 3R6JA 1UKYA 1KEEB 2JC3A 1U2EA 3JAWA 3NG1A 4FFOA 2QTZA 4H6XA 2R60A 5KAPA 3SJAA 3T99A 1B8OA 1V1MB 4QLAA 4DMUB 1QHXA 2AEJA 1ZAYA 1XZFA 1W5SA 3HYSA 4FDAA 4JELA 3WFJA 4Y2HA 3HUDA 5LCXA 4AJJA 2CVHA 1J22A 2EZTA 3CRMA 2O3TA 4BHTA 2DQZA 2HM7A 2ORIA 2P9EA 4HK4A 1R74A 2HPHA 2HQSA 3SHTA 2WIKA 1YZLA 2Q5EA 4XRGA 4TYPA 4MJ7A 1VYUA 1CWUA 3AVWA 1JG1A 1OBCA 1YQWA 2FWAA 4KDEA 5FWXB 4QM6A 4QHTA 2XDAA 4RKYA 2H1SA 3F47A 3CLHA 2QYHA 4YYEA 4EUFA 2WG0A 5DF1A 2V0CA 4WECA 4RTMA 1NYTA 3F6BX 5JCZA 3IDFA 2HX1A 3EXHC 2ZI6A 3K6KA 3OFVA 3PG5A 2EW8A 5ALDA 4YRSA 4KGDA 2ARKA 3S7TA 3LQ4A 3TR5A 1O5IA 4KI7A 3L9XA 1JQBA 3ST7A 3G2KA 2B34A 3PNYA 1QE0A 2HGZA 3F8SA 1EFRA 4B3DA 3TFOA 1W44A 3GRZA 2CDBA 3ZBPA 3D0KA 3OCZA 3NQ41 2GDJA 4IV0A 2WVGA 3C3JA 3LPDA 4CIAA 4KB5A 1N2HA 1XTZA 3AI7A 3OQIB 1I10A 2BFPA 2XCOA 4AJ9A 5EOVA 2ZIXA 2XUOA 4CFSA 4PHTA 2QR5A 3JZMA 4YPVA 1OCEA 3FTCA 2ORYA 3GMTA 1NN1A 1U02A 3T34A 3F90A 1KMNA 2D4HA 3HZZA 4HMOA 4WW0A 3MWEA 3CUUA 4R0NA 1G9SA 4GI7A 4ZEOA 1IUPA 1QCCA 1SURA 1TK2A 1E77A 2WR8A 2AI1A 3AM4A 3C6YA 3CUSA 4HADA 4J0JA 4CQLA 4CHGA 3QBTA 5J5VA 4OU5A 4BWYA 1MR3F 3ZHVA 1SVKA 1U2GA 4IH4A 4BASA 4FM9A 1MHPA 1VKZA 4ENVA 3OF2A 4KE9A 1LVUA 3BMCA 2QVCA 2ZPTX 3Q8WA 5HJEA 2QRNA 3HLYA 2I91A 2XITA 5CYFA 2BEVB 4MVJD 3UGQA 2O7QA 1T2UA 1HSZA 3AM3A 3CH4B 5AOVA 1QKIA 4B8WA 1VBNA 3G6WA 1X38A 1PLKA 1PJ4A 1W5AA 3FKSA 1KE1A 1WUHS 4Y9DA 2F3TA 5AVQA 4NSNA 1VI6A 1AKRA 5M04A 1OZAA 4P9NA 1AQNA 1IOZA 1E2HA 2DP4E 2GTHA 1GGMA 1OC4A 2OCGA 2C4KA 5I9BA 3TL6A 2VFAA 1UKEA 4CV0A 3T5PA 4MRAA 1U3WA 2ZJZA 1MOQA 3KU4A 4HHEA 1OHHA 4OOSA 4PRZA 1NU8A 1WZEA 1YC2A 3G02A 5EJ2A 1CR4A 3SX0A 1CVRA 4G5SA 4KC0A 4K9NA 4PO8A 3S29A 4Z4FA 5JD3A 2PH3A 1PWYE 2QSUA 4MWSA 2JFHA 4GWGA 4Y98A 5DBEX 1FJ2A 2FKNA 1WOMA 5J2TF 4BNXA 1L4NA 1O0BA 3TLGA 2XWSA 1VQ1A 3EEIA 2GPNA 4UUAA 5AWFC 1OU0A 2NAPA 1AM4D 1MMFB 1SQSA 5F2KA 2QNRA 5H80A 4CJXA 3K0BA 5L3SA 1G20B 3KHTA 1S2IA 2AUMA 3IOYA 4HRYA 1T3LA 2GM3A 1M76A 1VLJA 1TF2A 5K3FB 5K0JA 2QPOA 4E5KA 5IU6A 4MR7A 4CEJB 4LRSB 5ALEA 1QUFA 2XDQA 3MCVA 1H23A 2PA3A 4QJBA 1TX4B 1IK6A 4XJTA 3IBSA 2WHEA 4LTDA 4RJ2A 2D74A 2ZTMA 4HAWA 2DB3A 1KAMA 3W7AA 4KR6A 2V9ZA 5C80A 1Y1QA 3LLCA 5DT9A 3TRKA 4RM2A 2D2XA 1QLHA 3RNLA 5EYPB 3RKSA 3EG9A 4HTFB 1FF9A 2EYQA 5ILQA 3GVXA 3S2YA 3T9EA 1J8QA 3SC2B 5JMTA 3FYCA 3UAWA 3LFTA 3R0ZA 1ODJA 1OYYA 1ZRMA 1TKRA 4REMA 3U1VA 5HP4A 2C1EA 2XMSA 2PX0A 4HNGA 1OH7A 1K6MA 1LTQA 3UUEA 2I7XA 3CCMB 4FI3F 3FNIA 4IOJA 1YR3A 4LMPA 4TWRA 3GLVA 4B4KA 4MW7A 2Q5HA 3KQTA 1MENA 4J1TA 2VAMA 2D7CA 4S2UA 5A4AA 1ZD4A 3QVGA 4XWYA 2A9FA 3RASA 2WSIA 1EVYA 2IHZA 4IP0A 2IUEA 1VHOA 4G0PA 1T34A 4I4NA 4HVAA 4MROA 4UUOA 1JGTA 4UU7A 2O2ZA 1DV2A 2BCEA 4EW1A 4XOTA 4ZD6A 3KDSE 3CV3A 3UUGA 2XZLA 2B99A 4QGHA 1ODLA 1AE1A 4U9UA 1FU7A 4ZT5A 2E49A 4IHAA 4MPRA 4P4SB 4X65B 1UWLA 3MZ0A 4G6IA 1RRCA 2NP7A 3T9DA 4CIYA 3UWDA 3U44A 4KOEC 1RJWA 1PJTA 4GRAA 5T4BA 1ZD3A 2ODAA 4X1IB 3ROZA 4R2IA 4A27A 2DHRA 2F3QA 3GPIA 2VNIA 1VE7A 1L7DA 1ZH2A 2RHLA 4TQUS 3CVYA 4N40A 2RHTA 3HTXA 4BE4A 4BLPA 1XB2A 4D92A 3II6X 4NOLA 3CEPB 2GPWA 4H3KB 1W5TA 3P9KA 4QPCA 4EPXA 5FNVA 4DA4A 1AURA 4WBNB 1XLTC 2PMFA 2GXUA 2QA4B 1T29A 2JJ1D 2PLAA 4LJYA 1FS4A 1N5JA 3CQ9A 3GT3A 3OOYA 5EKUA 2CHVA 3ESYA 3ZE6A 3ZLJA 2CBZA 2ZYUX 4WN3A 2ZRAA 4FD3A 1DRWA 1W87A 2YMPA 3UG6A 2XUKA 3CU5A 4MA0A 4NONA 4OO3A 4AN4A 1FX1A 4BGVA 2OENG 1SKYE 4S1WA 1QYCA 2ZUSA 3B52X 3FSGD 2IZ5A 1ZYUA 4IRMA 1QDUA 3TTUA 3H2HA 1C50A 1ZHOA 1UWVA 3NBMA 3CN9A 1V8BA 4JP2A 3A28A 3PD1A 2XVMA 3OQVA 1ACLA 4JOSA 4UW9A 4WVFA 1UAYA 2FHPA 4UCWA 3TM4A 4N76A 2I6GA 4DMFA 4LVOA 4W99A 4MDFA 3RUHA 2PZJA 2HLNA 2O4CA 5E38A 3HB7A 4ILEA 4CZ2A 3BGIA 1NNSA 1P5HA 1XKXA 4JR0A 3ZDXB 5JE8A 1O3YA 1RPJA 3TEMA 4C4XA 4F96A 2P5UA 1IOVA 3T3MB 1K6XA 2PKXA 1PX2A 1U4SA 1SUFA 1ZICA 3HQ4O 4JLSA 3H1TA 2MIIA 3KB8A 3LY5A 4BQQA 3B5EA 2JIZA 3FXAA 1IMOA 4W8GA 4QM7A 3MLBA 4EI7A 4YI3A 1SCQA 1KJQA 1NQOA 1R88A 3ZD7A 1KC1A 2GJAA 2IUSA 2VZ8A 4I3HA 3A7EA 1Q22A 4MW5A 3W90A 4DL9A 5L3VA 3PKIA 1W4BA 1THGA 1QGED 2Y1DA 5CXXA 3CMEB 3WI7A 1XRLA 1H8ED 5FOUA 2B2NA 1YJ5A 2J9YB 3IVGA 3RQSA 4P6YA 1M2JA 1KMIY 1DZIA 3IT3A 5CYPA 4DC0A 5CJJA 2XRMA 2EJVA 5KQSA 3AR3A 4ATNA 4MHOA 3KK0A 4HH1A 4L6IA 4FPXA 1ID8A 1SM4A 3PTZA 4P53A 3WO1A 4CU5A 3ADDA 4C08A 1IATA 1G9TA 1CCWA 3AV0B 1PR0A 3LP6A 4MVXA 1ORWA 1D2MA 1DHTA 4BLQA 4EBBA 1DEXA 2COEA 1A9QA 1GN8A 2ZDHA 3REOA 2GM5A 3NEYA 4XYLA 4RFLA 3C5CA 2NZ8A 3CN7A 4LBVA 4BMDA 2IY8A 2WY2D 4B79A 3H1GA 1ZNZA 4Y0AA 5IT0A 3BEOA 4WLUA 4MVYA 2XGMA 1ESCA 3KQOA 4H6VA 2GPSA 3QFFA 4XR6A 2DKOA 4A6PA 2YV1A 5AW2A 5G53C 4YRCA 2ZP1A 3EOBI 5T6MA 4B9AA 4GI2A 4I1VA 4K1XA 3BREA 4TKOB 1VPTA 1MO6A 1HE4A 3FRIA 5JRZA 1GKYA 1Y3DE 2M98A 4H4DA 5B1YA 1JB9A 1K7EB 1UR5A 5C9ZA 1JDSA 1VE5A 4QE3A 2XUDA 1A98A 4RTJA 2FQWA 3UT0A 1G8MA 2RI6A 3KKPA 2Q3DA 5HK8A 3ZI7A 4MUEA 4XASA 5JG7A 4UNIA 3HCWA 1PSZA 2R7NA 1JA9A 4FFVA 5K51A 3ZWYA 4L0QA 1DGQA 1VRVA 4ZOEA 3HB5X 2WHQA 4GXNA 1QRSA 4QVJA 2ZRPA 2X1VA 4NECA 3SNHA 1WV0A 3L8FA 4PGGA 4M36A 2IU3A 1VTKA 1RAFA 1SVLA 3CPSA 4L5CA 4B3JA 3PEWA 3TL3A 3GQBA 1UODA 1VP3A 1RBMA 2IP2A 3NBYC 4H59A 4O2AF 3ASRA 2J7PA 5FB3A 3ZH2A 3QMVA 2X0EA 2HJRA 5BT9A 1E3QA 4X1OA 1OI3A 4HDNA 2OWDA 3SGLA 1U2TA 1XXHA 1EP2B 1J0DA 1E2IA 1L5ZA 4I3GA 4MR9B 4GR9A 1SD2A 4O1MA 4JBYA 5CG1A 8MHTA 1JIVA 1Z0DA 1COZA 1G5FA 3BCUA 1YZHA 4UQLA 1UFRA 3L1KA 4WUVA 4FW9A 5H81A 1WETA 3B1XA 2FEKA 3F2VA 4DMKA 1XVAA 3WNDA 3GLGB 1SVSA 2X6XA 5IKMA 4NJMB 2G0AA 1ZISA 4UE2A 3C4VA 2H1HA 1G8YA 1QYRA 1X1RA 3TIXB 2ZU6A 4CI0B 2WUDA 3BSYA 3LX8A 3PZBA 4V2IA 3GLIE 4UJ3A 3BGOS 1EJ6A 3IQFA 1L1EA 4H16A 2PFKA 3DF7A 5AKYA 4F3KA 4C2UA 5BQFA 1IXSB 3CVUA 1DC8A 1W7AA 2GN8A 1GTZA 4PLWA 5IVKA 3PQ3A 4QKQA 2EL7A 1OWMA 2SICE 1AA9A 3RREA 2XADA 4C4OA 2F4NA 2G72A 4GXQA 3OSUA 4PZ9A 3U3MA 1B3BA 3COZA 3NHAA 5ARCA 1XTRA 3RRJA 1S3SA 3G1UA 3W8DA 1PK7A 5INTA 5JJ5A 1MH9A 3QXSA 4J0HA 1I4TD 1N7HA 1SOMA 3CNLA 4JT8A 3IOEA 4G5YA 3OTWA 5CAEA 5H8WA 3CJRA 1PTJC 3L0DA 2XNKA 3V1KA 2EJBA 2VYFA 1UPXA 3GYBA 3HP1A 4W5NA 3MJ4A 4CMEA 1A2KC 1KWGA 1YDFA 4U3JB 2SKEA 2CV1A 1IHMA 1IB0A 5LUBA 4POOA 1PQ4A 2FXIA 4PG6A 4JWTA 3BICA 3U4QA 2N47A 3ER9A 5M3BA 4X7CA 3LBYA 5AICA 5EXTA 5G40A 5I4BA 4UFPA 3GF4A 3SJCA 4YMIA 1MZPA 1GG2A 2P9JA 5FCDA 1A95A 1CW2B 1EEHA 2GEVA 1FP7A 3R20A 1H2YA 2BWJA 2VBFA 3CINA 4GM4A 5EJ9A 1SHUX 3KJFA 3O94A 4QICA 1KDYA 3QI2A 3RSHA 3THWB 1FOEB 3GA7A 4J76A 2XA1A 5G02A 3D43A 2C83A 3ZXIA 4UTVA 5AKGA 4DEYA 4XQEA 4E5DA 4MVJM 4YUAA 2GZDA 3KBOA 4MQFB 3TXAA 1EH5A 3F6RA 4FINA 1C9JA 3T9BA 3X43A 1JAZA 4F2DA 1BXGB 1P5ZB 1T36A 3Q9SA 3CCRB 1HI9A 5A5GA 1SKAA 2JAPA 3AWIA 1HG1A 4YCBA 3ONWA 2C99A 3KQUA 1OXUA 4CLOB 3OECA 3GJRA 1QC5B 1KYZA 2NN3C 4UHEA 1JQDA 1L5SA 1OROA 1XZLA 221PA 1D2NA 2PN1A 5GINE 1P72A 4L8WB 2JI8A 3V46A 1HMYA 2IEDA 4GP7A 4URFA 4YRQA 3RM3A 4YRKA 2RD2A 3K1ZA 2ZRCA 1D5CA 3P9YA 4AG3A 3C2QA 3I2HA 4E2YA 5LB2A 3R7SA 1T0BA 1DAHA 2DFVA 1E7WA 4N3GA 4URZR 1NXWA 1EHYA 3AOEC 3OMWA 4DLBA 3EEYA 4LQ4A 4EZEA 4D4HA 4N41A 4BECA 4UVGA 1A9OA 5DIZA 1B16A 1AF4A 2E87A 3AIMA 2V59A 1Z2CA 2Y93A 2Z09A 1SGWA 2YBEA 4IRXA 5FRDA 121PA 1I1HA 2DTXA 5DSTA 13PKA 4BKMA 1ZD9A 1O6CA 2R6FA 4UASA 3A1FA 1Q50A 2O2GA 1M2OA 3T1QA 1YK0A 1DVRA 1ZI8A 1JLLB 3DZIA 2ZYHA 2W8ZA 4LVNA 3EZ9A 5IZCC 2G04A 4OEHA 5CLGA 2RKBA 1BOFA 4ZAYA 2AXEA 4NOMA 2ZIVB 4UM7A 4N82A 1UK6A 3EA5A 1NZJA 3TW8A 2A0WA 5FLYA 2ZRGA 5ANRB 3WWPA 2KBFA 5CB4A 5DX0A 4NFLA 1WW3A 3IR5A 3NUGA 2IBSA 3ID6C 3RAPR 4YEJA 4PV7A 1XJ0A 4B8YA 3KAQA 2JAWA 4CLRB 1DKMA 5DHSA 3AR2A 3DAOA 4M99A 2VSXA 4NAHA 4XMYA 3K94A 4ARIA 2GR9A 3AJ8A 1XTUA 4CMGA 5JJCA 1CERA 1KK1A 4CM9A 2IYTA 2WTNA 1KDVA 2C84A 2ZTNA 4IXNA 1RI1A 5EMHA 2UYQA 4RV9A 3CXUA 4CKWB 4HDQB 1YZFA 4CG3A 2A5FA 2O0MA 5DCYA 1I13A 1YUBA 4MV6A 3ZI0A 1QFMA 2OXFA 2I62A 1KYIA 1RJDA 4IHKA 4G2NA 4OQZA 4TMYA 4OHMA 3WWYA 1G38A 4BO1A 1ESMA 1H66A 3KEQA 4BMCA 3O0TA 1MT0A 2HJ9A 3PJDA 1T0PA 2H59A 4I0WB 2IE0A 2QD4A 2DWUA 4O33A 4P3PA 3DZ8A 1E2UA 1E2DA 4YR7A 4L6AA 1NFQA 1LLDA 2PSFA 2RJOA 3BJEA 3SVLA 3NTVA 1CEYA 2XWJI 4J1NA 2FGKA 1JBEA 1YS7A 2CDAA 2BFDA 4XXHA 3FCCA 2CVZA 3L1HA 1UINA 3FF1A 3CZ4A 4KSYA 5CH3A 1XT6A 4TRNA 3RVPA 2FPWA 4JS0A 4WJLA 4INAA 5IX8A 2W2OA 4HDRB 4JT4A 2Y1KA 1SY7A 1TU3A 3IB6A 2ZQYA 3VGJA 3T95A 4EELA 4Y2RA 1XKLA 5AN9A 2FSIA 4QATA 3H3FA 4CTJA 2A1UA 5DLDA 1RW4A 4F5DA 1UWKA 1KMQA 4OPMA 4YUYA 4YAEA 2C9OA 5I47A 1F4PA 3LO5A 1OBHA 1USGA 5FWXA 4B3BA 1AT1A 4PLVA 4BB5A 4CN8A 4D0RA 5CB0A 3ISTA 2HQOA 1AH2A 2VYQA 3DL7A 4BMNA 2HDWA 2PPVA 3SBDA 3E1GA 4X07A 4HE6A 3TW4A 3KLPX 1BMDA 3AV3A 2O3SA 1UDXA 5ALHA 4E1BA 3HV0A 4ETWA 1G5HA 1Y5IA 4Y9TA 1N25A 4PLZA 3RUEA 3O4HA 3PFBA 4R7TA 3RD5A 2CFTA 2MOKA 4HX5A 3ZVRA 2P91A 3WMWA 2NM0A 4WESB 5HZAA 4XKVA 3CCVB 3OCWA 1IN7A 2NU8A 5E4JA 1OIXA 2H1RA 4L27A 1AUQA 1UK9A 4PTZA 5EZYA 4D99A 5LQCA 1E7YA 1MXHA 1WXXA 2IQIA 2L69A 1PJSA 4AY5A 4JI8B 4KRFA 2JD2A 3O4GA 3WGOA 3HJNA 3TTVA 2G1PA 3GW8A 4F6CA 1XNRB 3NHYA 3K16A 4GOND 1SRQA 3AVYA 1NNI1 1XOIA 1ESNA 3SEZA 1B93A 1S6YA 4FSDA 2J41A 2ZB3A 2XZPA 3KLMX 4ZVVA 4KX5A 1W25A 3PA2A 2IGTA 1AKQA 1ZGJA 2X0JA 3I73A 2AN9A 4KAJA 1JIXA 1PLLA 4LF7B 4HWPA 3TGLA 2WK1A 3PK0A 1UXJA 2JLSA 1BX3A 1ZA2A 2QOEA 2F9FA 3MRVA 4M60A 2NSHA 3LKVA 1B6SA 2ZCVA 4BZZA 1RC8A 1D04A 2GS9A 3PNMA 2FPOA 2N42A 1GG8A 3GGDA 3MVEA 2BEUA 2B1GA 4XQGA 2IU4A 2PWZA 3AVXA 1N2GA 5JSKA 3WGZA 1Y34E 2FLWA 2IDMA 3V5NA 3H9EO 3FX2A 3GBVA 1J5XA 1NT2A 1Y82A 1KAOA 1TQ2A 3S1AB 1CUFA 2PSEA 4QEDA 4BGIA 3UKDA 4AAYA 4TS3A 1YZUA 3EDYA 4IDGA 2ZUTA 3C3KA 5C46F 2VZLA 4C6TB 1U31A 4INOA 3QLTA 2FMIA 2O8FA 2QUZA 1D2EA 3ZZUA 2VCHA 4UHBA 3IFSA 4B7ZA 2Q1TA 3EW7A 4D26A 3QLUA 4RJKA 1P4RA 1P4AA 5DNCA 1EQAA 1R5JA 3L6DA 3NALA 1ORTA 1ZL2A 3LCRA 3DEYX 1G5RA 2PHZA 5K0FA 4WWVA 3LLUA 1DMSA 4F85A 2BC9A 4IVQA 1I6LA 1N2EA 2BI7A 2J9FA 2VDWA 2VOEA 3EVNA 3LVQE 2JL1A 3GEDA 3RYTC 3V55A 4QJ3A 1UBKS 2Y8EA 3QNMA 3M3DA 3VDXA 3WBFA 1OLXB 1U7WA 3CEJA 3A8KA 2O3RA 3COWA 1VQ4B 1N7JA 4ZFNA 3LTEA 2BV3A 4R1MA 1E6MA 5FOXA 3RUDA 5A2GA 5KNDD 4XIJA 3ZE1B 3TSCA 1XWWA 1MIOA 1AKVA 821PA 2K7ZA 3FUWA 2GCIA 2OCDA 4TS9A 4QTYA 2GYWA 1KZ9A 4LCJA 3PHHA 3H5VA 1EQUA 2ZJ5A 5BMOA 2FVYA 1JBQA 1JVSA 2M2IA 2I4IA 1JKFA 4CMIB 1TECE 3ZG6A 2FEMA 2XMGA 3N3AC 2G5CA 4GLLA 3UWPA 1SHLA 3E5NA 1E2QA 1NYRA 4H7PA 3CNBA 3LRPA 4OSPA 1C0IA 3LH5A 5E1MA 1HZZC 1UWCA 4F21A 2PBFA 4LE1A 3WLRA 2DKFA 4JVNA 2IW1A 4LE2A 4A0QA 4S2EA 4RA6B 3V4SA 1Y7TA 5COAA 5DNUA 1NVGA 3IURA 4DG9A 3DL4A 2E48A 1JV2B 1L5MA 1E9VA 1GQQA 1WP4A 2VHZA 2EG5A 3RRMA 4CKEB 3F4BA 1PL0A 3LC0A 3C4QA 3KSRA 3PHLA 1H5QA 1F0NA 2CUKA 2HHJA 1JXOA 2YHIA 5JZBA 3MJCA 4DCCA 1N3YA 1MQ8B 3WZLA 3HAGA 2YVKA 1IG3A 2AQHA 3AY7A 2Q2OA 5B3JC 5FWYB 5DGCA 4F9FA 2XTZA 3CBQA 1LK0A 4WCFA 1KAQA 3P26A 1R4MA 1Q0PA 1QO7A 3BJIC 3QBVA 5K0GA 4JUBA 4ENUA 1KQFA 1V5FA 5REQB 3RRBA 3W4IA 2AMLA 4MQLA 4TTJA 4UBNA 5DPMA 4L4ZA 3RU3A 3CB2A 3CLUC 2BF4A 4XQ0A 2C7BA 4BLOA 1BDIA 4MW0A 4CF5A 2FK8A 5GVSA 1NY6A 1Q16A 3JRXA 1I5EA 1UKZA 2QN8A 4UTPA 3QWAA 4MKXA 4NC9A 4RV4A 4A16A 4DUZB 1PRYA 3ONDA 4OKSA 3WJ1A 3RYCB 3KKZA 1X6VA 2XGOA 5I7HA 5LQDA 2FJPA 3OOCA 4Y3UA 2FW0A 2WYWA 3U4MA 2TRSB 5ELXA 4FC7A 4UC0A 2X40A 5KW9A 1XWIA 1BA3A 2QJOA 1QF9A 4K9MA 5I9LA 4D43A 2DKNA 3P52A 2JDIA 3GELA 5E2AA 4AYXA 1NZFA 1CY8A 1KI6A 2I8AA 2VF8A 3GNSA 4YROA 1IU9A 4ECEA 4Y1RA 2QDXA 4U2BA 5DRTA 4AXBA 3U4GA 1GADO 2QX9A 4DHEA 4RD2A 1POXA 2PUWA 5BNTA 4B3MB 3BTVA 1CYEA 1SQ5A 4KDFA 2VDRB 1T4GA 1J07A 2C0QA 2CYBA 2XH8A 1N08A 3DDYA 2AEEA 1Q7RA 3U80A 1T1SA 5FYQA 3AJ9A 3LY9A 1T9GR 3GUHA 3TBHA 5A9SB 4YN3A 2PQ2A 2YJZA 3GLRA 4WY8A 1P4SA 3D2LA 3HI4A 1W5EA 4FFWA 4LTMA 4TQ9A 3RVSA 3EXAA 1WSWA 3SQXA 5JDIC 4JXJA 4D9FA 2ODPA 3GFVA 4ZQIA 4B84A 1MU0A 2CSXA 1YR9A 4EDFA 4MQ6A 1WUYA 5FPYA 1T8PA 3OE1A 4R1UA 4R84A 5DI3A 1YVUA 1JE1A 2KM1A 1E1DA 1AQYA 4G7XA 3OJCA 1K75A 2DHDA 1DBVO 4Z4ZA 3NJRA 3PCRB 3W2EA 4ZI5A 3LFUA 2QU7A 3KJEA 3WYNA 2FX3A 2YW2A 4NEGA 2XEXA 1IPEA 1ZNWA 3IO5A 3K0CC 2IXBA 1XD2A 3MUNA 4QOIA 1HE5A 3RC8A 1PJ3A 3ITNA 3OJ0A 4FONA 5CGZA 1ZESA 4D3DA 4JY7A 2YHUA 5D3QA 5TMPA 1W96A 1XMSA 3CXRA 4Q21A 3W06A 1B7GO 1T2AA 3VC1A 4CKCA 3LCUA 5TEVA 1TM4E 2HK8A 3JVUA 4NJOA 2FETA 2Q21A 1RXSA 2V3WA 4OM8A 4Y2YA 4C03A 4EO9A 1HXHA 1ZMOA 3LZDA 4NOJA 3FPFA 4J0QA 3SYLA 4UEWA 3QGMA 1M2VA 5H70A 1EDOA 2GMWA 2QL7A 2ZWPA 5CIQA 3UT6A 1EP3B 4F6RA 1CIVA 4Q3LA 1C0LA 2ADOA 3KVOA 4EHLA 2R2GA 1GUAA 1TTTA 2C1ZA 3G7UA 2NOAA 4RQAA 3KOUA 5FWNA 3CVJA 4I9UA 3TW0A 5MN5A 2XTMA 3EF3A 5JVDB 3KOMA 2BVNA 2J46A 2NVOA 3LFHA 4TZTA 4BKQA 4DT1B 5D7BA 3SLDA 1N5KA 2E85A 3N74A 5EIEA 1F8XA 1ND5A 4JU9A 2C9CA 1U8FO 2Y92A 3DVAA 2X6QA 4ZYTA 4C76A 1IUNA 1Z0JA 5J58A 3H4TA 3ECAA 2DM6A 3HC7A 4C0SA 3JR7A 2OR3A 4IX9A 3WQSB 1UMBA 2Q0HA 4C7VA 4ZCMA 4DANA 2O8EA 1E58A 4QX6A 1KIFA 4BQSA 5F2OA 4LXXA 4PCLA 5AKHA 2X5XA 3AERA 4O1HA 5ALUA 1M1XB 4V1CA 2DG2A 1LRJA 3LQFA 5F5XA 1U1EA 2PUVA 2ZT7A 3F5QA 5C81A 4J4BA 1NJID 1I3NA 1QOPB 5LOVB 2EF0A 2J7KA 3LA8A 1LDYA 2X0RA 1C9YA 1NN5A 1UDCA 2AHRA 2IU0A 3V97A 1IOLA 4U4AA 3QWIA 1WUTA 3VVCA 1BXRA 3ZU3A 2IOFK 2GREA 1HBJA 2H92A 2ES4A 2HBZA 2HUNA 3FSEA 2IHKA 4YAUA 2LKDA 1II8B 2QVGA 2ZB2A 3L18A 3M70A 4RVHA 4TTAA 5DXFA 3DUFA 5I7UA 1H4QA 1EFRD 3I6ZA 5IK2A 2VXBA 1K5PA 2WJHA 3GRAA 3QVSA 4I6EA 4TOIA 5LL6P 2BSQA 2GK4A 3S4YA 2RGXA 3CUWA 2OP0A 3KALA 3QSYA 3OKXA 3R3SA 4EB6B 1AIPA 2QPLA 2ANBA 1Y7HA 1SHKA 3PGVA 1Z2AA 1CQJA 1KQ3A 1CZLA 2VAPA 3Q11A 3RVQA 4GKKB 1XRJA 1VHJA 2ZUDA 3D2AA 2IOQA 4DCGA 2GZMA 4U39A 1TZCA 1DLIA 2QQEA 4NV1A 3M5CA 4NJEA 3PJRA 3C5VA 3EB9A 3FPJA 3W1WA 3AUJB 1TD9A 1Z25A 3TTTA 4ED9A 1EKXA 3LZ6A 2LTAA 2QHXA 1M1YE 5EESA 1P1RA 1E7MA 4MJXA 4UAGA 4FFMA 3RT1A 1BE6A 3I3OA 3IEUA 1W4ZA 2JBAA 1MO4A 3QX8A 1K1EA 4IIEA 1T5BA 4Z1MA 2IZ1A 3I9V1 4M1EA 5TJ9A 5TDHA 2WIJA 3H4VA 4MKFA 4L75A 3R5HA 1YK1A 2XNDA 2DETA 1Z5NA 1ISHA 2AOTB 2FWNA 3RVJA 2I33A 2LRHA 4QNMA 2ZIUB 3AY6A 5ER6A 1L9KA 1JA0A 2ZRJA 4UMFA 3C45A 3IEKA 1AS2A 1S2MA 2W4IA 1O6BA 2Y6VA 4MVJH 3NXKA 4P36A 3EODA 1EG2A 1IBKB 3F2IA 2WUWE 2IODA 4MITA 3BHJA 3OQ6A 3CW2A 2ZIEA 3IT0A 4N01A 1EU1A 1GGHA 1AQIA 5LA6F 5CDTA 1OHHD 4FNOA 3PUNA 1X7ZB 3MTAA 4MP8A 5CFNA 4LJKA 4JMLA 4PZZA 1U7PA 1SQ6A 4X64B 2Q3MA 4M0FA 1F0KA 1E8DA 2BMDA 3FI9A 4Q18A 4S04A 1MW8X 5DMHA 1E9RA 2X15A 3C6BA 4YCSA 3UENA 5HNKA 4C5BA 4HI0E 3IPXA 2GQ0A 2AR9A 2GPAA 3SX4A 4EJSB 1ZIDA 3A26A 2KE5A 1LI7A 2EZ4A 1XRRA 3E7XA 2ID8A 2VJPA 1HF3A 5BV0A 1FJGB 4CEIA 4F9GA 1PEAA 1RRPA 5DULA 1X70A 2DPYA 2YOGA 5JV5A 1SMKA 1NBMA 1CFJA 3WWEA 1M0WA 5LP1A 4H9GA 1YV9A 1MTZA 3PA6A 4P0QB 4QDTA 2OD9A 4B0PA 2R0QC 3SLKA 2IEIA 1CJVC 1SBYA 1T0UA 2O2YA 5C31A 1EI9A 2GF0A 4Q9DA 3L8ZA 1QZUA 3RG8A 2Q5OA 1WVIA 3DEJA 3HU3A 4RLZA 4OI4A 3IOBA 1H1DA 4HSGA 3OZVA 2VQFB 1U2PA 1HEIA 1XTIA 3AF5A 1ZHFA 4BQRA 3TI9A 4ZGBA 1VXRA 2AE1A 5CDHA 4LYHA 3J7AC 1VF7A 5EIBC 4B4OA 2WJJA 2WAAA 3CW8X 8GPBA 8LDHA 4JYMA 4PO1A 3ROFA 4F3YA 3OJOA 3PHIA 1G8HA 1UFVA 1TM2A 5AI8A 5TR9A 5H3HA 3X1XA 5CXQA 1VLQA 1GQ2A 3FOZA 3T0GA 4FN4A 3A3NA 1ZIYA 4HLUA 3SX2A 2QM8A 2A67A 5A4KA 3BWXA 4C88A 1WL8A 3U4IA 4QU5A 1T2DA 5TV2A 3ZWKA 4BJ3A 4GYJA 5BOSB 3NFRA 5DXAA 2JA2A 2PS3A 4R81A 2R96A 5EUBA 1Q3TA 3ZLTA 4D9GA 4D9CA 2QT1A 4I81A 4C4ZA 1G2OA 3MWLA 4B2YA 1KTIA 3AGPA 2C5FA 3KZOA 2VP2A 4NLLA 1X15A 3P4UA 1YI2B 4TWZA 3I34X 3NPMA 2PANA 1MO5A 2ET6A 1T6XA 1SUIA 2PZMA 4YMVA 4M8KA 2JGKA 1G4UR 1HDCA 3IKVA 3D6TB 1RCFA 1VJRA 1DRJA 1SRRA 2KS6A 3D0RA 1E9DA 3ZCQA 2AJBA 3DUWA 1K8YB 1LVGA 1UIMA 3RIGA 4FB4A 1ZRNA 1KEPA 5LVAA 4UZUA 2BEWB 3IAEA 1PG2A 2XMBA 2YV4A 3IQIX 3OT5A 4MMZB 4BFSA 4E2FA 4F3TA 4MTCA 2A5YB 4B3CA 2AVDA 2HAEA 3PRJA 3CESA 2WHYA 4OM7A 4R83A 1KEEA 2O54A 3V48A 2B20A 5AW6A 2QZ9A 4E5UA 2DR2A 4L7QA 1Y7LA 5TGDA 4DPMA 3DLHA 1KDTA 1MB0A 1T2EA 4E33A 1L1QA 5LD2B 3ORQA 4DDKA 4A5SA 2RDMA 2BP7B 2PU5A 1NRWA 2HRRA 2YC2C 5D1HA 1YI0A 1GPUA 1HRKA 2QV7A 2H3HA 3IP5A 2A4KA 1WCYA 4LI3X 4KO3S 4F38A 1TA0A 3T9AA 3U81A 1SBHA 1NVVQ 2GGSA 1E0KA 4KXMA 4OF4A 4B81A 2VJMB 3WYFA 4DQLA 1DC5A 3R3UA 3ZW7A 5JD5A 5FWDA 2A5GA 4OMFG 4Z4UA 3C16C 1NU6A 2JIZD 3P8ZA 1XJQA 3QWHA 1W19A 2FWMX 4KU4A 3IRUA 3PQ8A 4X93A 2RGUA 5DGXA 3RE1A 4FR0A 3PQFA 4NR0A 4HAYA 3RHZA 1VG9B 4BCDA 4EENA 2BZSA 3I01M 4NABA 3MAJA 4JMQA 4NYJQ 3EX7C 2PRJA 3P45A 1W36B 2EIHA 1TKBA 2OAQ1 4GZ3A 1XEWX 2QLTA 3T3PB 5L6MB 5AJWA 1I5OA 3VH4A 2ZZQA 3U61B 2ZJ0A 3U48A 4DKJA 2AR0A 1XZ8A 1KQPA 2V7EA 4CM1A 3COJA 3MJDA 3SZOA 2YH2A 1UEXC 1R7RA 1ISIA 1DWPA 3WB9A 2PQ6A 1R0WA 3PD0A 1STOA 2EZUA 3PXAA 4IDOA 3EGDA 1Z8FA 2DZDA 3QVMA 3J80A 2QRGA 3HZOA 1QIKA 3AKCA 3QKSB 3RBAA 3WK9A 2FLKA 2AI3A 2WPDA 2W6ZA 5KNCD 3D4OA 3DYVA 4K88A 5A0VA 3MJVA 2DTDA 4FUQA 4GBJA 2Q0XA 3H13A 1XCMA 3E7FA 2R62A 1PUIA 2ZB7A 4GQNA 2Y4NA 3HA5A 3I72A 3NMUF 3OI7A 4FHCA 2CVQA 4M0KA 3A8TA 2IVFA 5L7TA 1K92A 1Y8QB 4TS1A 1Y9EA 4EJFA 4A0RA 2QTNA 2DBZA 4C2TA 1GDDA 1UPAA 3ICCA 2QLJA 1TYZA 1