1FRQA

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
total genus 100
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frqA02
2VNHA 1FDRA 3QE2A 5AN9A 2B7BA 3QFRA 1J9ZA 1QGAA 3W5VA 2QDXA 3ZZUA 2XNJA 3WNBA 2CRVA 5EMNA 1KQSB 4P3YA 3CB4A 4YAUA 2D74A 3AVVA 2RC6A 4ZCIA 4G5GA 1G7SA 3CCUB 1OB5A 1CNEA 1KD1D 4HE6A 1IJFA 1QFZA 3CC2B 5KSWB 1SKQA 4B47A 1W87A 1VQ6B 4ZV4A 1N0UA 3OZUA 4TMTA 4TMWA 4R71A 4G1VA 4LBWA 1FRNA 1N0VC 1ZUNB 4PC6A 2VNJA 3VNUA 1VQ5B 1BJKA 2DETA 2BVNA 1B23P 3FJOA 1GR1A 1VQPB 1QUFA 1N8RD 3E1YE 3W5HA 1E63A 1ZM4A 4TMXA 3U6BA 1S72B 3A1FA 1OB2A 1EXMA 1EP1B 4RJLA 5TY0A 1R5OA 4WQMA 1OGIA 3LO8A 3CPWB 3WBKA 1NDHA 4LBVA 4BPRA 1JNYA 1R5NA 3G6EB 1FRQA 4RCYA 4MYTA 1H85A 1VQ4B 3WYAA 4ACAA 1FNCA 2QMUA 2BV3A 1UMKA 3CW2A 4M1KA 1DARA 3ES9A 3OZWA 4YAFA 3P27A 3W2IA 4RCZA 1VQLB 4AC9A 4N3GA 4ACBA 2YWEA 1A8PA 1JB9A 1GAWA 2HCJB 2QN6A 3QSYA 3CC7B 3AVTA 2QA4B 4RD3A 1KTVA 3MCAA 1KK1A 4Y9RA 2DCUA 3JQQA 3VO2A 5THXA 2HDNB 2BGJA 2YWHA 1S0UA 2VZLA 1E62A 1G7RA 3VO1A 1E64A 2PLFA 2BSAA 1WDTA 4NBSA 2DERA 5TR9A 1YIJB 4PC2A 4C43A 2R6HA 3QFCA 1F60A 3G71B 2X3UA 2XEXA 4Y7CA 2NPFA 4M0LA 1QVGB 1D8TA 1CNFA 3U2QA 1FNDA 3W2EA 2OK8A 2DEUA 4B43A 1ELOA 1IJEA 3ZZTA 5JBQA 3AVWA 1BX0A 1VQKB 1XB2A 4M2LA 3B8HA 1TUIA 1FNBA 1Q82D 4TMZA 1KRHA 3JQPA 2PIAA 2EIXA 4B44A 2FX3A 1VQ8B 3WY9A 1DDIA 4P6VF 4TMVA 4AF7A 1VQOB 4RD1A 4U9UA 3WNCA 3I1FA 1YJWB 1W2BB 1D2EA 3CCVB 4Y9UA 3JQRA 2E1RA 4QFMA 2BN4A 4EH1A 5DSZA 2QEXB 2OTLB 4YAOA 3CCLB 4FK8A 4J0QA 4ZCLA 3ZZ0A 1YJNB 3P26A 3PENA 1KJZA 3B78A 4K1XA 1YHQB 1NJID 1AIPA 1AMOA 2YWGA 1YITB 1EFTA 5H5JA 2RC5A 2DY1A 3WNDA 3AGPA 1GJRA 4RD4A 1HA3A 2BGIA 3CCMB 1SM4A 4RD0A 3B82A 1GVHA 4IW3B 4RD6A 3V76A 1ZM3A 2QTLA 2QTZA 1TTTA 1K73D 1M90D 1EFUA 1JJ2B 1QVFB 2CNDA 2C77A 1EFCA 1K9MD 2GQFA 1VQNB 3CMEB 4QHYA 4H9GA 2PMDA 1ZM9A 4FN5A 3QFTA 1JA0A 3CCJB 2BM1A 1QX4A 1EWYA 1JA1A 2BF4A 3WXMA 3I55B 1W35A 3AVXA 2AHOA 2GPJA 5GV7A 1KK3A 4YAWA 3MHPA 3CCQB 4TN1A 1Q7YD 1K8AD 3OW2B 3G4SB 3AVUA 3I56B 4DQLA 4LBYA 1IB0A 3E20A 1I7PA 4ZGQB 1F20A 3SJZA 2J7KA 2VNKA 5TV2A 4PC3A 4ZCMA 2EFGA 4HE5A 3W5UA 4B48A 1FNMA 4M53A 3AGQA 1QGZA 3CCEB 4Q7JB 2BMWA 1U2RA 3CCRB 1G7CA 1ZM2A 1EP2B 3MMPA 1QUEA 3CD6B 1GO2A 1VQMB 2OK7A 3OJXA 1G7TA 1TVCA 1BX1A 2YWFA 4MYUA 3CXCB 3J81k 3ZBUA 3VNVA 3AVYA 2BM0A 4DQKA 4ZGNB 4YALA 1M1KD 4C0SA 4F7DA 4LBZA 2ZITA 3W2GA 4M4SA 3VMFA 1D1NA 3LYUA 1KK2A 4NCNA 2C78A 3ZC3A 1H42A 3LRXA 4LC0A 3OJWA 4PGOA 4AF6A 5GV8A 1VQ7B 3OZVA 2BPOA 4FWTA 2XNCA 1B2RA 2VNIA 1YI2B 1QFJA 2B5OA 1EP3B 1QFYA 1GAQA 4B4DA 4PC1A 1W34A 1CQXA 4G1BA 3CCSB 1VQ9B 3WBJA 3W2FA 2B7CA 3QFSA 1QG0A 1KK0A 4RD2A 1YJ9B 4PC7A 1BQEA 4N3NA 5H59A 4B3XA 3U6KA 3CMAB 5FA6A 1R5BA 3ZBTA 1Q81D 1XE1A 2HMAA 1DDGA 1OGJA 2VYQA 3CC4B 1TLLA 1QH0A 3LVBA 1KC8D 1Q86D 4UAJA 3W2HA 5HXBA 4YHBA 3CRZA 1DG1G 2OTJB 1QGYA 3FPKA
chains in the Genus database with same CATH superfamily
4BP1A 3KT8A 5JZMA 3B52X 3KYDB 2FSVA 5EA2A 1OB0A 3OM1A 4MVCA 1N0HA 2ZI9A 1N5KA 4G5FA 2H85A 3IGFA 2ZB3A 3T7CA 3IRUA 1Y6RA 3W9YA 5TVKA 2ZVDA 3BEOA 3OE4A 3NPAA 3W5VA 3GLIE 4C1NA 3ABZA 4Z9AA 3NH6A 4PQEA 1K4YA 2PGXA 1TPYA 1KXJA 2E48A 5HQ3B 3RTBA 3OUUA 5J40A 3A7EA 5A3RA 2P6OA 3SI7A 1Q1ZA 3CWCA 2BKUA 1QHHA 4P3YA 3OPYA 1BMQA 1X8LA 2GZSA 4Q1DA 3RPEA 3EC2A 3B3QA 4KDRA 4CI9A 2RGRA 5F98A 1YLOA 1I51A 3JYHA 4QECA 2A3RA 5CLHA 4AQ7A 1JFSA 4FEYA 3OZTA 4RZHA 2IYUA 1NYTA 4B85A 2NTJA 3M8KA 5SZHB 1KO1A 2R66A 2VSYA 1FP4B 1GGFA 2PKEA 3IOBA 4RFLA 1EFVA 3PFCA 1TE2A 1OU4A 4RKWA 2CDRA 2PKQP 4Y6LA 4BFYA 2G1JA 1WHTB 1N6IA 2PH5A 4MH0R 1P1HA 3RRZA 3UJ9A 2E85A 1WOYA 4DDUA 4N5MA 3SDSA 2ZS9A 3E5MA 4N0MA 3DKVA 3ZX4A 1UT5A 4EHLA 3LSTA 4LPSA 1ZH6A 3WB0A 4EABA 4DUZB 4R9RA 1Z73A 3E22A 3P9CA 2QW0X 1EWVA 1V8ZA 2PZGA 1D1PA 2QP3A 3FHOA 3INYA 3N9IA 3K0FB 1GN9A 1QOPB 1UCFA 1OBVA 1X1DA 3EISA 5IYNA 4G86A 4QFDA 4HAXA 2GJ9A 1N0VC 2A2ZA 3D4PA 4NAUA 1RAAA 5EOVA 1T5TA 3OAAA 3P2KA 2RIRA 2C2MA 4ESHA 4ZI7B 2GHQA 1I33A 2CDAA 2ZI7A 1R3UA 2QBYB 5FPSA 4KWCA 3U7GA 3SY8A 1CF4A 1N8RD 2JKVA 4LGMA 4QAQA 5FNVF 3NRJA 3V4RA 1ZOOA 1NNLA 2XRYA 2LDBA 2GN2A 3AHEA 3EGVA 4FBMA 4WOJA 4K6FA 4BPBA 3HLKA 4FBLA 4QQFA 2DKOA 3AHFA 2Z5LA 3U6BA 2AH5A 3P9YA 1S1CA 4O8ZA 5AJVB 1BFDA 1NXOA 3ELUA 5EP2A 5T4EA 4E6PA 2BR5A 3RT7A 1U7TA 1GAXA 3LGSA 4TVOA 4UUQA 4B8ZA 4QUZA 3K94A 3ZUGA 2VTKA 3B6ZA 3KHUA 2QU8A 4RM3A 3PQ7A 4IYJA 1VL5A 3LGXA 2JFZA 5EMJA 1OGIA 1LVUA 2X23A 4JXJA 2YOGA 3MW8A 3MFQA 4WX2B 1PS8A 4JLSA 3KKNA 1NXTA 3N0XA 2ZLBA 2EX0A 4LBVA 2WTNA 1LCIA 1QDEA 4Z0PA 1W2GA 1C7JA 1SHUX 1U9IA 2R6JA 3QVWA 1XF9A 3GEMA 4XJXA 5JS1A 3GCZA 1OWNA 1ZRMA 3Q15C 4ZDJA 4ACAA 4OX9B 2QMUA 4BEJA 4RELA 3VPXA 1N75A 1JQLB 3IE2A 3TR6A 5DTEA 1Y1PA 5JS7A 1YQEA 3M3DA 1AKEA 4TKUB 1VKOA 1JKMA 3STYA 1ECLA 3OE7D 4GGMX 5E4TA 5E4YA 4RQTA 3H5LA 1MDBA 3GFRA 5JSZB 1A8PA 2H7XA 3MQ4A 3OZXA 4PIMA 4KTVE 1IK4A 4RHCA 2M6LA 3JRXA 1VJGA 1Y8AA 2GOYA 1XCPA 1I4OA 4V2IA 2WPDA 1PS0A 3BD6A 4B73A 4D9JA 4PYJA 2AG1A 4FM9A 1UFKA 1RR6A 4UNSA 4URHA 4AP6A 5EUCA 5LXTF 2EP5A 5FPHA 3KYCA 2W43A 3RBVA 5CD1A 1NBEA 4YXWD 3IDFA 3NUZA 1RYDA 1GILA 1WXDA 1Y33E 2E18A 3ZK7A 5HIKA 5K8IA 4PZZA 4KQWA 3SIXA 3DDCA 1XTUA 2G1UA 2PZBA 1SQSA 5JH7A 3VZPA 2V7QA 1HDCA 2X8AA 1JVBA 1JTEA 3UM9A 3QKRA 3KU4A 1CV2A 4UCFA 5KNDA 1EGQA 4LTMA 4P5EA 1ZMBA 3W8DA 3SC4A 4HH1A 1D0VA 3CRW1 2GARA 2F8MA 4O4LB 4ZC1A 1CEQA 3UBMA 1NONA 2YWHA 1OD6A 4LYJA 4DYDA 3GCWA 2X15A 5FHQA 3SM3A 4MUEA 4OLHA 4OP1A 2WJ4A 1TZJA 2CNKA 3QJGA 4RVGA 5E3IA 3LYHA 4G4SO 2FR0A 4QARA 4Z8YA 1GZDA 4X1OA 4ZAVA 4I2VA 4QM7A 1HY3A 1VMKA 2GTHA 5F52A 5BQPA 3GJ7A 4QYIB 1PR9A 4W6QA 4B80A 1QV9A 5G0TA 4E2XA 2KE5A 1DIRA 1W73A 4FBGA 3UK2A 3JQAD 3T5DA 2NU6A 2JGIA 2EFEB 4D9NA 4XVUA 5GJVC 3WDMA 1SKYB 1KYVA 1OXSC 2QUKA 4MKHA 4ZAYA 1CS0B 1ODSA 1QGED 1U04A 2AMVA 2VAVA 1JYSA 4A2WA 4KFCA 3GAZA 2WWYA 3TZ6A 5EJAA 1F5NA 1TA9A 1S02A 3MUEA 3UW1A 4B45A 1QMGA 2PZKA 4HX5A 4ETWA 1KL7A 4NDZA 4ZIRA 2W00A 4FYJA 2ZRQA 3FZNA 1WE2A 4TLDA 3ZV6A 3N2GA 3KDAA 5K0FA 3E0QA 3AFIA 3UF0A 5B6PA 2X5XA 5JAZA 2FW0A 2LBPA 2O20A 5I9MA 3N2IA 4ZMSA 4ESVA 4X64B 1G8MA 3NANA 4C3ZA 2N1MA 3GOQA 1KKMA 3SJCA 3FZGA 4EY6A 3D4OA 3TL2A 4DDVA 2JZCA 3DBLB 3F90A 4MKZA 4L22A 3UGJA 3UGTA 2IGBA 3G0OA 3BIJA 3ZGNA 2N75A 4IH1A 4JY7A 3RFFA 1KRHA 3AJAA 1FTGA 3ZHRA 3Q7QA 3JPWA 3CN7A 3KL9A 2Y1CA 4B44A 2GEUA 3LLVA 2FUKA 4XD7A 3ASTA 1JEOA 2REQA 3BXOA 3H8JA 3IDOA 4HS4A 1J0XO 2YNMD 1T3HA 4LY9A 3U3OA 1SN7A 5A9TA 2NPOA 2EDAA 5AI8A 3HKDA 5EMKA 3V2GA 2VDWA 5BN3B 1AH2A 2Q4TA 3NV9A 4KR9A 3UJNA 2PX3A 2Q7DA 1FBTA 3CLTC 4CKWA 5T67A 4DZTA 2WVAA 5IYPA 1SCJA 2FK7A 3G8DA 4FMBB 4ZA2A 2R44A 3M4NA 3OZDA 5DOVA 1TYDE 1JDVA 1PUIA 3CX3A 3CUKA 2JRCA 1TEHA 2GM3A 3WJ7A 5LZ4A 4H7IA 3RFTA 2C3MA 2NZWA 4LY3A 5AH0A 3MSCA 3WL7A 2V3VA 2EAUA 5TGZA 2OAP1 3RFXA 2AJCA 5ENZA 3ZW8A 4BTEA 2DHCA 1G4AE 1A8IA 5ISMA 3OCUA 3UJ7A 3EIOA 2QEXB 1MIOA 4FK8A 1RC0A 2JJ1A 4Q37A 1XZQA 1OW3B 3WGGA 2OBRA 4CNQA 5CR9A 5AKZA 4UAVA 4DDMA 4CXMA 3AX6A 3LQ2A 4BY9E 3B78A 4B4WA 8ATCA 3EGEA 3GFBA 5LMZA 1H4QA 2FG5A 1JWBB 1DINA 1IM2A 4L02A 4L75A 3WBBA 4AMGA 3ADBA 4JI0B 1SUSA 4NKRA 1F17A 2EBWA 1LVGA 4ALJA 2YZGA 3A4NA 3K73O 4YRKA 1FW6A 2QL9A 3CR7A 1JVNA 3G2LA 5E6RB 2R62A 2HSWA 1CY6A 1VHJA 4Q9DA 4TYPA 4C0QC 5IT9A 2AEJA 2VPTA 1F6BA 3DXFA 3P0HA 3WYGA 4D9IA 1JPNA 1NW5A 3VHRA 2H48A 3R6JA 4D02A 1L7XA 3WWOA 5L95A 3IUQA 1ZIPA 3ZLBA 1M66A 4KRGA 1U7UA 3LX6A 3SMVA 1GJRA 2MIIA 3NHZA 2JLZA 2D1YA 3ZNQA 2WWTA 3RWOA 1K7SN 2NVUA 3CPXA 3CKYA 3GZJA 3FW1A 3KVYA 1F0PA 3R3JA 1DAFA 5AXDA 2BTEA 4YRRA 2E5FA 5IBCA 1JDSA 4P3IA 4G0MA 4JJ7A 4V0MA 2MYNA 5HZHA 1BXKA 4H60A 1FL9A 4I4CA 5EQDA 3ZVNA 1KJ9A 3PIRA 1W36D 1PWEA 1U3TA 3NOOA 5JQGA 3FWNA 4ND8A 1KJIA 4R2KA 3RU2A 3ZGOA 5AVZA 2H1OA 1OLSA 2YV3A 5BQOA 1ORVA 3FPFA 2AI1A 4A1FA 1USVA 2NTNA 4CW7A 3GMIA 4Y8VA 4AM8A 2SBTA 4OU5A 2O5CA 3QPUA 4RZUA 1E2MA 1BDJA 4DR4B 4XL9A 1P91A 4GS5A 4C6RA 1BMFA 1R18A 1TA0A 4UEQA 1JIKA 1I6MA 2EL9A 4N5NA 1RCFA 1O8CA 4RQAA 4IJ5A 3JWPA 4HH4A 4D57A 4E5PA 3FCEA 2AG6A 3BSWA 2ILTA 3RTAA 1NTRA 3L05A 3RJ9A 4KPFC 3ROEA 1MH9A 5CVUA 1W9XA 1JFVA 2A14A 4R1TA 1WXEA 1C1XB 3SF8A 3UCFA 5JECA 5KO2A 1TAQA 3HZRA 4E0FA 1D03A 4OL0A 4N0QA 4BVJA 1GZ6A 1XZDA 4Q4HB 5CDSA 4ABYA 4FN5A 3C3BA 5IARA 3LG2A 4ZYZA 2W6NA 3UYKA 2WAAA 3PE3A 3CGWA 5K6AA 1Y81A 2IPOA 3BWBA 1UDAA 1H22A 4J91A 4PINA 3QX3A 5F9FA 2X22A 3TIGA 5TRDA 3QNUA 4G9BA 3KR1A 3DFMA 3PXXA 2GXSA 2BFPA 1OJ7A 7REQA 1NN1A 3QVKA 4RSGA 1RWQA 3MJSA 4B1FA 1JS1X 2C42A 1I7LA 2OY0A 2RGYA 3DC7A 3O6VA 2XZLA 2HC9A 3LUAA 4Q9LA 3MQ2A 1X77A 4CLXA 2Y4OA 3LF1A 6REQB 5FWDA 2FWJA 3OZGA 1T3SA 4RO0A 4WEOA 4BMXA 1GZ7A 2M32A 2QG4A 3GL9A 3HKEA 4LCJA 1IB0A 1J7KA 4UREA 4HWKA 3STUA 3JAKB 1PBNA 1JYFA 4CR8A 1FMFA 1V37A 1I24A 3CSDA 2O52A 1L7RA 5DVZA 2CF4A 1F20A 1UC5B 2OCYC 3AUFA 3I6YA 5A7FA 5JO0A 5HVNA 2GHIA 2V4DA 3AI2A 3VYSB 3WWZA 4FFWA 2W37A 4YV2A 1M34A 3AIKA 4X90A 4DM7A 2YUIA 521PA 1PWYE 1Q7EA 2XY4A 2EFGA 4HE5A 4EUEA 3AB8A 1V6AA 4KDFA 1Y5NA 2HX1A 3IULA 4O2LA 5AKLA 3W8EA 4M53A 3DWFA 3FRJA 3OZEA 1TQ2A 2OFOA 3ZH9B 3EPLA 3C5CA 1L8LA 2Z2KA 1MX1A 1XZMA 3DVQX 3AM4A 4DJFC 2C3OA 3PGMA 5DBHX 4MKIA 4TZKA 1REQA 4PFSA 1HSZA 2MU1A 4JBWA 5BR8B 2LGJA 1W9MA 3MCTA 3D6AA 4H4EA 3HKBA 5CGZA 3A6PC 1IBSA 5K0JA 1Z8FA 3DT8A 2CLHB 5KTYA 2A9OA 1PLKA 4NCKA 1E43A 3A0RB 3R6TA 4RF3A 2WICA 4AUKA 4ENPA 4Z54A 5A9SB 4H35A 3N3BC 4OGWA 4YALA 3JWEA 4UPVA 4G36A 2D2EA 4NV0A 4P08A 5K3AA 3T7DA 3TX6A 3UWKA 1Y8ZA 1UMCA 3ZDDA 3EZ9A 2ZITA 4E1AA 3N3AC 5JJKA 2CSUA 3VMFA 4II3A 4U7WA 1H5UA 1Z36A 3DCIA 3OFND 5AXAA 4EHNA 5B36A 2CVPA 3OZSA 4HKTA 4J94A 1F2UA 1JJVA 3BFPA 3CZ5A 4CCAA 3ZQ6A 1PNQA 2YTZA 2GVDC 3AEUB 3B5IA 3E0XA 4GLBA 4RMGA 1IULA 5DT9A 3VR6H 3UPTA 3VO9A 1YB6A 1UKAA 4QGBA 5KTNA 4FFPA 3EXIB 1W0CA 1NX9A 2J9FB 4GX5A 4RGQA 2OMKA 2VEDA 3UCXA 1Z22A 4URZR 5ALTA 3VOBA 1CR1A 3O73A 1SC1A 4O1IA 2Q5LA 5K3FA 4GWGA 4FT2A 1QRTA 1U8AA 3DTVB 3M7IA 3JQ9A 5G53C 4NYMQ 3OW7A 1CJKC 4C2BA 2EW8A 2BGWA 2DVMA 1VFNA 1YWGO 4N3AA 3GUHA 3RVDA 3O4JA 2P0EA 1LPAB 3DDNA 1Y63A 1QVAA 3L49A 3OTWA 1GTMA 2AQ8A 4CQNA 1KO4A 3QFHA 2H11A 2PG3A 1QANA 3BXZA 3EOZA 3I72A 3OZ7A 4RABA 3CCSB 3L7OA 5H70A 3DE2X 3VR5D 3VDXA 3IESA 1IPHA 4P4UA 2H1VA 2DJ5A 5FBZA 2Q7OE 4ZQBA 3WBFA 3E9ZA 2F7SA 3ZWQA 3AW9A 1MAHA 2GBGA 2R8EA 1JT2A 1YRHA 1Y6ZA 1LUAA 2NPIA 3T3EA 1FS4A 4DAEA 1T24A 4DGQA 2J07A 3BXEA 1P2BA 2X2EA 5D7BA 2R1TA 3TI9A 1Q81D 2DZDA 4PG4A 3WNZA 3O1LA 2QTTA 4QDJA 2FKAA 3PFWO 1Q17A 4UBLA 3RM3A 3L6DA 3H0CA 2MSWA 8LDHA 4MGZR 5FLYA 2VYQA 4E6EA 3MB8A 1T4BA 1UZUA 3KQQA 3MJFA 4ND6A 2VP6A 1EFDN 1QTRA 3H4IA 2HWYA 3OKXA 4UM9D 4X62B 5T5QA 4RTRA 5DCUA 3TE7A 1M73E 1SHTX 2ZIWB 4DUGD 4CODB 1QHHB 1DPFA 4CLRB 1I2AA 3EZNA 4ND3A 4YV0A 4LXIA 2DBQA 4LOKA 1WB9A 2V6FA 1P6QA 4NH0A 1Y9ZA 3T41A 3W5DA 2E4XA 5JCOA 4LWQA 3AR2A 4DCJA 4YXFA 3VDRA 5TC4A 4ZCPA 3GPBA 3OOEA 2B94A 2YW9A 2XADA 3AYZB 3DCNA 3MWYW 3OPOA 3A35A 3GQBA 1GUDA 4HQ6A 4W7SA 2ZSJA 2B8WA 1JSXA 3NBMA 3LYLA 4IV0A 3TLGB 2UUAB 3SFTA 3P19A 3S29A 3C5WP 1J9ZA 4ZJZA 1X7XB 1XNJA 5JPCA 5D1HA 4G2NA 3ZWVA 1HWYA 1IQRA 1C4XA 4TQAA 1ZXLA 3Q9UA 5F77A 3U7FB 3V1NA 2JHAA 1KQSB 3BTSA 3OKPA 4MUKA 5JG7A 1JX6A 2VF5X 2VP3A 2ONKA 1NLZA 2ETXA 2VP2A 3ETGA 1FRVA 1X39A 1XLWA 1I32A 2V5UA 2D0PB 3BEDA 3P32A 3KCNA 3OM0A 2GAFA 1JAIA 3LY7A 3TZHA 3CFYA 1XAIA 1DS6A 2CBGA 3OT1B 5EIXA 1GUFA 1OB5A 2E4YA 5H3CA 4YRMA 2C4TA 3BD7A 3PT9A 1L7EA 4JELA 2ZUSA 2R7KA 3AEXA 4MO2A 3ODPA 1IJFA 1MXFA 3AR9A 3Q0IA 4FGWA 3V7YA 2B9VA 2CEKA 2O8VA 3I45A 4RMIA 3SJUA 1KF0A 1HYHA 4B47A 3CS3A 1QYCA 2V7XA 2Q3DA 5F5NA 1GPKA 3BE5A 5JXJA 2PGOA 2HIHA 2NAPA 2BFWA 3PHIA 4QQRA 5EJMA 2IV3A 3ZD7A 1XCJA 2CFRA 2GUGA 4GLJA 4C7OA 1WQ1R 3TZEA 3VSCA 2PU5A 2PRIA 3FVWA 2GEVA 2UVPA 4RHEA 2BFFA 5I7FA 2NV0A 3AXSA 1L4KA 2AA3A 2QGZA 2Q4RA 1USKA 3AUKA 3KPWA 2EEPA 1NGSA 2HA4A 2J3JA 2QJRA 4RJ2A 3Q10A 3I8XA 2IWRA 4EHAA 4EZIA 5GVSA 1N6PA 2ERYA 2QTAA 3WR5A 1QIEA 3FJOA 1UEIA 1WORA 2I3DA 3ONVA 3A9SA 3EGCA 4M8LA 3RCBA 3AUYA 4L51A 1GL7A 1CRQA 1V39A 4M0MA 2VP9A 1QO9A 1UKZA 3KDPA 3P9IA 5CD9A 1T5BA 1K9VF 1MAUA 1ZIYA 2P2CA 3I34X 3CEPB 1K8XB 1MT3A 3IVAA 3NDIA 2DQYA 1GTG1 2OVBA 2X9NA 1V3QE 4TKVA 4N9WA 5CHYA 1BYIA 4J1TC 2OE2A 3K2QA 2NU9B 3THRA 3FWKA 4ES6A 4DREA 1OXMA 3MCUA 4HB3A 3UT5A 4BC1A 4AULA 5JYBA 1V1MA 3QIVA 1RC8A 4B5LA 1VKNA 5E9AA 4EB6B 3GLIB 4BE7B 3U7IA 3K5HA 4ZQHA 3EPHA 4MR7B 4EPWA 4Z1MA 3F3SA 4MCIA 5AHKA 4MYTA 1KO8A 1M6NA 1YUMA 1KEWA 2OO7A 3W3ZB 1Z74A 3UJHA 2IHZA 4CM4A 5LU9A 2JK0A 3H9BA 2CFSA 1ZZGA 4DLRA 1LDMA 2BV3A 2WAXA 5J2UA 5M7EA 4K9KA 1W6RA 5E2BA 1PFWA 2QI9C 2XLBA 4GLFA 5AOCA 3MTAA 3TS1A 4RCZA 4ISCA 4NZZA 2NUTA 5LLTA 1XEXB 5JNRA 1QSGA 3J7TA 3NETA 4J0DA 4PANA 1KI1A 3CRNA 4A23A 1S96A 4MOWA 2B8NA 2E82A 4KMRA 5B12A 4XLCA 1VCHA 4FHDA 1JWLA 4BLRA 4MQUA 1DQSA 3OD5A 1HNZB 4WY5A 5HHTA 4O8CA 4TM8A 1IN6A 2H1LA 2JLVA 1Q7GA 2BFAA 1I1QB 2W4IA 3CXRA 1M33A 2HA5A 2IYAA 3OC0A 3TLKA 1DGQA 3IQDB 3HJFA 4L07A 4CN9A 5A8AA 4W5TA 3EX7C 3RJTA 4FD2A 3EMDA 1N2CE 3C8DA 3V7WA 1CIVA 1CUVA 2Q4EA 3A6EA 4CMJA 2ODPA 2JAHA 1CULC 4XARA 1NWCA 4FFOA 3BRSA 3B2EA 4G5QA 4O25A 5TF4A 4I9FA 4Q5IA 5IHXA 1PGQA 5KCZA 2VYND 1E5VA 2BJHA 2C97A 4KUHA 5KTPA 4FOPA 2PWZA 3DOFA 3OT4A 2ZUEA 1NASA 2COUA 3H2ZA 3VHXA 2PTGA 3HXTA 3L9WA 4L9SA 4TKMA 4G5XA 4GBMA 1UOPA 1VRVA 2YYZA 3KUUA 4P32A 2J5RA 3C41J 4Q15A 4DCCA 4UVEA 3QELA 1VKHA 1AXGA 3MAJA 1VPTA 1NVKA 3P2OA 6CHYA 4YUAA 2FJPA 1PEDA 4MPDA 5HBGA 2CV0A 5KQPA 4YRNA 4Q47A 3DV9A 3MJ4A 3C1OA 2W2TA 3CRVA 5FNVB 1UD4A 3VR3A 1H69A 2WHXA 1JG7A 1S3GA 1TO6A 4YROA 4DV2B 1A2BA 1EEHA 4CEJA 4JJ6A 1D04A 2IQ5A 5DYGA 2C2YA 4JHLA 2FAXA 3I9NA 2E6KA 2W6CX 3HZZA 4KMSA 5DWDA 1J8DA 4H59A 5WRFA 3LDUA 2G4VA 2NPFA 3B2NA 1ML4A 3RVJA 4YELA 4B31A 1U7OA 4BC0A 4N18A 4PNHA 5BSEA 1RT9A 2O2DA 3ETEA 1CNFA 1BXRB 3BWEA 1EFAA 3SS7X 2BFDB 3GLFB 4HHEA 4UMEA 2OV6A 3R09A 4O5AA 1D6SA 1SGWA 4EFMA 3HFGA 4TGLA 3NWBA 1ZOIA 1V2GA 1HTTA 1I1HA 1TJ3A 1EGMB 2QKYA 4KVZA 5DBIA 1R9NA 3QKSB 4OIFA 4RJJA 3SJAA 4CM1A 1JXAA 1J97A 3I28A 5DBOA 2C5AA 4B4VA 4B83A 2FQWA 3BIWA 2NU7B 1QGDA 1X8KA 2VDLB 2BDUA 5CA0A 1FFXB 3SDBA 5KQRA 3T99A 1T8TA 1Y8RA 5FEMA 3PNYA 2FEKA 4N0DA 1SBCA 1YZGA 4B2PA 1PLJA 3GFFA 3L6OO 2C8LA 3U26A 3RGGA 1ZITA 3U56A 3FMVA 3L0PA 4KXWA 1ESNA 2Z2IA 1B26A 4IGAA 5DNCA 2I1LA 3OPXA 2OL4A 1O5OA 1ZJWA 3QIAA 4PWYA 1AGNA 1JQJC 1PD0A 1T1IA 2AXNA 1RU3A 2YWCA 2WYVA 3O4FA 3SN6A 2AMYA 2G6TA 1DDIA 3OFNA 4MA5A 4F8JA 4BXOA 3RLIA 3GJ6A 1Z3IX 4L76A 4FDTA 5DTMA 4XWOA 1ZGHA 2P3OA 2GGSA 1A88A 1KVTA 3PDHA 4D6YA 4EAAA 5LB4A 2BFEA 4IOJA 4UBIA 2J09A 3I1FA 2LVBA 3IT2A 4UBJA 2GBLA 5CPBA 3TMKA 4YONB 1Z7BA 5JWHA 1NHGA 2YXPX 3E27A 5DEOA 1UL1X 2NO7A 2OUIA 5B4UA 1XCMA 4G4GA 1QTQA 3NIDB 2FN3A 2E1RA 4JITA 1EBFA 3LZDA 4RLFA 2L69A 4JZYA 4FKMA 2OPBA 4DEXA 3KXLA 4RPGA 4ZKEA 2VF7A 4P81A 3GSIA 3A27A 2WSYB 3G5TA 3W77A 5BOSA 3H16A 2C8KA 2H4FA 4FMCF 2G9NA 3COZA 3EVAA 4QPNA 4DLAA 3EA4A 4EJSA 1TU3A 2ZTVA 1RJGA 4Z3KA 3EC1A 2JBAA 3G2MA 2Q3FA 3H5IA 2F43B 4IDDA 2OM2A 5F2KA 4IH4A 2A33A 3NT2A 3EIFA 4HPXB 2YYSA 4M9SA 2L19A 4KYTA 5DZSA 2R7NA 2XMGA 1IEWA 3P2EA 2C84A 3AUJB 1Q6YA 4DCUA 1NBOA 3DFUA 3IL2A 5B1SA 1BU8A 4TVSA 1VLYA 1XE3A 2HTEA 3FJYA 4JQYA 2EDCA 2CHEA 3GIDA 2HF9A 2EW2A 3K0EA 3N74A 4F38A 1M5TA 4N7RA 2RC5A 4XM2A 3K0AB 4CBVA 4KMOA 2C8VA 2CKMA 4R54A 1RFLA 1T0HB 2UYQA 4MDHA 1FJXA 2ZRNA 2K6GA 4Z9XA 5U4XA 3DHEA 4QUDA 1YQXA 3IE0A 3AVOA 5E1OA 1ODCA 5IXJA 1VPVA 2YV1A 1CUHA 2CLOB 4RPDA 2X1HA 3KOOA 1P5RA 1JHDA 1RHUA 2P2NA 2QOEA 2ZUTA 4X8IA 1OAKA 4F46A 2GSDA 2V97A 5LZ7A 4L1KA 3CVJA 2VYVA 2ZULA 2A3NA 3OFKA 1R6TA 1KPGA 3CY6A 4JDUA 3SVTA 1O4WA 1GVHA 1G63A 2IYFA 3IO5A 4FGSA 4NFYA 5CM2Z 1RXWA 4QNNA 2OQ2A 1FZQA 4M9CA 3I52A 1I4DD 1E2IA 2SECE 2B36A 4P98A 2ZROA 3LUCA 4YLYA 2VAWA 2JJYA 4Z4RA 4C14A 3GH1A 2ZAOA 3V00A 4FHCA 4RKEA 3L8CA 2KW5A 4IDHA 4J7AA 4WCVA 1UM8A 4YRCA 2DUMA 1YCFA 2GQFA 1WIWA 2EFCB 3FVQA 1BFUA 2GJRA 3MC1A 3WRWA 4CM6A 3DP7A 1WMEA 2C0PA 2HMUA 2I80A 3OIGA 3ZE0B 1PJQA 3ZWBA 5CFRA 5AQEA 5FTLA 3FHCB 4Q4JA 3HKEB 1FFGA 3B6JA 5HXAA 1ZS9A 1XTPA 3PNBA 1DE0A 3JVVA 3OFSA 1H3EA 1N2BA 4PAAA 3WGOA 4AWAA 1ECGA 3ZCRA 1RAIA 3MJTA 4I4TA 4OHVA 1NN0A 1POXA 5FQNA 5KZMB 2EYUA 4UEKA 5BSRA 5C4MA 1IU9A 1NC3A 2FZCA 3ONFA 3CSSA 4X8OA 4KG7A 4DWVA 4W5QA 1RRKA 2AVNA 3H05A 3LKBA 3TTVA 1GGHA 3EVNA 4LJ9A 1W7AA 2L2QA 1JLLA 1XRNA 4OJQA 2OECA 4CL3A 3U4IA 2YWBA 4NAHA 3FOWA 3AVXA 1XKLA 1Z08A 4S2UA 3F1KA 1U3DA 4TN1A 5KX5B 3OW2B 5CAEB 3F46A 4QOSA 5IP5A 4PG5A 1Y7HA 4WZLA 5AVXA 1RLOA 3WGMA 1MG5A 3X44A 3G88A 2EP8A 2ZL6A 3PA1A 2JI7A 2VAMA 4X6XA 4LBYA 3QVJA 3GEHA 3PL5A 5EJ7A 2CGEA 3M6AA 3UXYA 1MCZA 2SCUB 2UVDA 2VRWA 3H1PA 2CC2A 2POQX 4QO8A 5HOEA 2IKQA 1WHSB 4M0PA 4KSCA 3M5DA 4BNDA 3KTAB 1UP4A 5EHZA 5K09A 3QPDA 5JFGA 2P3QA 2P2DA 1AUPA 1PVDA 3TDNA 2YIDA 1LSUA 4HAUA 5I5GA 3WWPA 1C41A 4ZCMA 3TIVA 5C35A 3UGKA 4MK4A 4O02B 3UT5B 3ODGA 4B6PA 2VBFA 1VL6A 3DE0X 3FFWA 2GKOA 2I8LA 2EFDB 2JVJA 2H2FA 3BMXA 3T1QA 1PBTA 2XNDA 2W9XA 3LPMA 3MWJA 5JDCC 3UHFA 2VDNB 4AURA 3DEKA 3QMPA 1TMYA 1QVWA 3AI1A 3LLMA 4G0ZA 4BL5A 3UYLA 5JCPA 2PZAA 3FPGA 1W1IA 1AURA 1VQMB 1KJNA 3A4YA 3WTBA 4HNTA 1AXEA 1EQUA 5CVDA 1NF8A 4D5GA 5EJ5A 5JYDA 5I47A 4LDQA 4ZICA 4RORA 3SVLA 4V1CA 1JWAB 5BVHA 4CU2A 3GUVA 4DKXA 4F1WA 5I6DA 1KE2A 1CIJA 2EQBA 1S89A 2XE7A 3TL3A 3WRVA 3C5EA 1JEDA 4MARA 3EG5A 4TV9F 5JBIA 2VH5R 2XGMA 4K9RA 4JQZA 1Z5GA 1TU4A 1RYZA 2VR1A 4ON9A 4ENWA 1I18A 1N7HA 1XAHA 2PT7A 4AN1A 2AJTA 2GFHA 4TYQA 5IPFA 2P9ZA 5JJLA 2JFHA 1QYVA 3IDAA 3VPSA 4AG6A 3VU1A 5LP6F 3NQ41 5JSKA 2QZPA 2PS3A 2FEMA 2ZK7A 4ER0A 9LDTA 5FOWA 2QMYA 3KZNA 3QEOA 4IO1A 5AVVA 4B7ZA 2RHOA 1EU1A 4ROTA 1P44A 2CKDA 2IYPA 2VJPA 3O3NB 5LOVF 1DEHA 4QLBA 4FCCA 1C50A 5CT8A 2W6PA 1L7QA 5T6MA 5IJZA 1ODKA 5BN4A 4ALNA 2V1UA 1JSCA 4D92A 2LCIA 1DCTA 4PLCA 1KI6B 3B6IA 1XKTA 4NMLA 1Z0IA 4A15A 5B7GA 4J3NA 1NDQA 2JGEA 3C87A 5JZBA 4BIIA 3RBZA 3CP2A 1JDBC 3RUEA 3N8HA 3CKKA 1CG6A 1VI5A 4P0PB 4PY2A 4TWRA 3FM9A 1VCMA 1S7GA 1SCNE 4NDNE 3VOTA 2DPHA 3KYDA 3NCHA 3ANMA 2W8ZA 3PQFA 4MQLA 3BB3A 4LX8A 4E2FA 1TZ2A 5BW5A 4YBZA 2CB0A 2FWBA 4EEZA 3M83A 3X2EA 1VJ0A 3JYOA 1KK0A 4DPLA 1PTJA 1XVUA 1PZHA 3SS9X 1W0JD 4XGRA 2YNMC 3E6AA 4PFKA 5CJ2A 1PL7A 2E3JA 2XGGA 4A7PA 4CLRA 2OAGA 3PHGA 5HJ7A 4IIJB 1YA6A 3K9BA 4DQ0A 4UD2A 1PZXA 5JYCA 2O2YA 4URWR 3SLKA 1A9XB 4LG1A 3NTOA 1LNQA 1KYZA 1TVKA 3PCXA 3D2CA 4DV4B 1ADYA 2QIPA 1TJNA 3GF4A 4CMAA 1XRPA 2ZSEA 4FJ2A 1BXRA 4UTZA 3I2JA 5LBTA 3S28A 1CR6A 1DJNA 1E3TA 3LLSA 4U00A 1HZZA 1VGQA 2YZ7A 4OYHA 1EDOA 2DWCA 1U4OA 2YRWA 2CL7X 1QH0A 1W29A 4OHXA 1J5EB 2K2WA 2ZB7A 3ADDA 2ZOSA 3LTEA 4BKOA 4IH9A 2HBRA 4HDNA 2V55B 1DAIA 3CUEF 1UDCA 2VDMB 2ECKA 1LXCA 3OZAA 4FS8A 4N5DA 4CU5A 1EGHA 4BRUA 3IKTA 3WQRA 2NP6A 3OF5A 1JXMA 1PYDA 2G28A 2E9SA 5DNWA 2YFKA 4B6QA 4U6NA 1LPSA 4HXFB 5C31A 2A5YB 2VK2A 4XW2A 4LDRA 1RQ7A 3GIRA 5JXWA 5KNBA 3BWCA 3OIDA 3V8NA 1ZMOA 1UK8A 2VH2A 4I14A 1QE0A 2G82A 3ZJVA 3D0QA 3KOXA 5KREA 1M6WA 1IUPA 4QV2A 3OIUA 4KLRA 4WNIA 2QRVA 2X7JA 3C8HA 4QOFA 4GBGA 4Y30A 4JEUA 7ABPA 1JI3A 5IC4A 2DSNA 4FGUA 3I39X 2WKQA 4PHGA 4U5XA 5AOAA 1NU8A 1L4GA 2Z3ZA 1IOWA 1CBUA 3LV8A 5INTA 4BQOA 4F8YA 4MUYA 3VR4A 2AZ4A 4LKOA 2X0KA 4DIEA 3ENQA 5IYRA 4JX9A 3GEBA 1W36C 2YHIA 3OOSA 3S0JA 1LPBB 4BHTA 3E1KA 4LDZA 2BHNA 2XMZA 4OV6B 2VJAA 1PJCA 1FU7A 4EJFA 1ZK1A 4FFMA 2PEYA 1RJDA 4WXHA 5EYPB 4HR7A 2OMEA 3K8YA 5ALFA 2VT6A 3D54D 3EUEA 4BNVA 1GWNA 1DUIA 1XEWX 1ISFA 2ZU0C 1IOZA 2A6PA 1Z5UA 2ZUBA 3A6DA 1ZX1A 3PUKA 4BO7A 1WD5A 2OLEA 3DHWC 4RDHA 4MAMA 1QORA 2X5KO 2EEZA 3ZV3A 4JV5B 2P2YA 1P2FA 1EXNA 3WP1B 4OQNA 2AOUB 2NU8A 2J4FA 2P2ZA 2OCDA 3A4VA 3LS2A 1RWXA 4OOFA 3RIXA 2EZUA 2PT6A 1BDHA 2IYYA 3H3XA 2C31A 4CMGA 2X3FA 1D5CA 1JE0A 2NO0A 4RCVA 4WLFA 5DE3A 4BO4A 2FY8A 4BCDA 3V1LA 5KHAA 1VSQA 1XRMA 4RLZA 5EVCA 4ZIRB 1RZUA 1QRDA 2Y2VA 3B1VA 1UM9A 3KVRA 1BDIA 5JSZA 5AIAA 4HUTA 4E09A 2XD4A 1ZUNA 2XZDA 1EAMA 4K2HA 3UQYS 4K6HA 3O8CA 3M4XA 1IVSA 1P7PA 4G1CA 1R37A 4RHFA 2PGDA 3FVRA 5ITVA 4RIIA 5IXSA 1B3RA 4FFVA 4JVOA 1KEEA 3F6BX 3ILXA 3KT3A 3D6MA 3GNTA 6GPBA 3F96A 5CW2A 1FSPA 2FFBA 2Z5VA 4QRIA 2IV2X 1WMDA 4U3JB 1U8XX 3G1TA 4R83A 2VHXA 1X3SA 2W6JD 3NHAA 5HE8A 4B40A 4Q1CA 1DXQA 4NOKA 1D2AA 4JUFA 5GAJA 5C3MA 1XZKA 4PCLA 1XJQA 1YJXA 3NYWA 3KLPX 1MB0A 2HSDA 3HU1A 3PXEA 4DDTA 5B2EA 2GVZC 2C3PA 4FR2A 3OCYA 1QLHA 4ZOAA 3Q7RA 5LJIA 1X92A 2WTBA 4I36A 3MHTA 4Q7EA 1M1ZA 2VXCA 1WV0A 1FYVA 1NT4A 5LC1A 4B34A 3LUBA 4MCAA 3G2IA 4MI9A 1SXGA 1Z39A 3GLKA 3K0SA 1EINA 2VN8A 2WNHA 2DG2A 4L8FA 2QWXA 3OA2A 4UDOA 2WG0A 3RRMA 4DV0B 2JHFA 4D0SA 1B6TA 3ZTTA 5AWFC 1U02A 3VOAA 4BGVA 3B1WA 2VJYA 4RQBA 3FUWA 1E4OA 4CL8A 4D6XA 5HM6A 5KJ1A 2FQXA 4L28A 1H1LA 2I4LA 3CIOA 4OL9A 1XLVA 1JG2A 4W8HA 3VHXB 1PFVA 4K46A 1BC5A 5KDOA 6Q21A 4MQEA 1ADJA 1W9HA 3RYCA 1WVGA 2FOXA 1RPJA 2HJ9A 4F8EA 5JISA 2QLBA 5I01A 3R2JA 3V2IA 3PA6A 3G0HA 4XX0B 4IPTA 5C46F 1EDBA 1HC7A 1F8YA 1NXWA 1QV7A 1G42A 4GXQA 4WTOA 3AVTA 4ARZB 4EG1A 3KQMA 2NP7A 4RW0A 1W47A 3T1VA 1DBPA 1JEEA 4X7RA 3CONA 4GHWA 3I1YA 2BIFA 2OV2A 2IW3A 1US8B 4WXPA 3UT0A 2QV0A 3A6LA 3QU2A 1KK1A 3K6RA 1M8GA 3DEHA 4Q0MA 1I2ZA 2ZJ8A 2XHEA 3KQUA 2IXGA 2FUG6 4TQUS 1O7JA 1EFKA 3TJMA 1IZ9A 3G0IA 4CIXA 1K75A 5IW8A 4TL8A 1TQ4A 2Y6VA 1NJSA 2QZ9A 5DW0A 3K9NA 2GI4A 1KBOA 3F5QA 3WNVA 2Q1XA 3G8BA 3N6XA 1Y4UA 4UNRA 1Y0YA 4LV5B 1SG9A 2CBXA 1SQGA 2ATIA 4D46A 2FNAA 2BSAA 1OTYA 3K72B 3QWAA 4MRVA 3RSOA 3U5ZB 5AHRA 3A25A 2KWIA 3MD9A 3ZDZB 1PJRA 4F72A 4QPJC 4RTOA 3IDSA 1GPDG 1U99A 2G04A 2P4QA 4HDCA 3TD2A 4G0OA 3U9LA 5TS3A 4E7OA 5IDWA 3IOMA 2ZL5A 2IUEA 4F11A 5HUHA 2BTOA 1CUJA 3AKZA 2A35A 3TOCA 4YRZA 3H1AA 3JVEA 4YH1A 1AT1A 3HGMA 3MPUA 2HPVA 3JASA 4IHJA 4Z8XA 3GDHA 3IPRA 3STTA 5BQXA 3DFZA 3TJZA 4R5HA 2C7OA 3ON5A 4RQUA 4INZA 1GRVA 2Q8QA 4Z4VA 4O4JA 3M6UA 4QPZA 3TQHA 2OSVA 4IR7A 3VKFA 4AS3A 3NNNA 4RKFA 3O74A 1GQ2A 2Q5HA 3FVTA 5EMLA 2DFTA 2WUGA 3K8ZA 4HTFB 4LXQA 3PCTA 4HWOA 2OK8A 4OY3A 3PS9A 1E7QA 1ZNZA 3L4JA 4JMLA 4B43A 1PJSA 4H15A 1DBVO 3U7EB 1EZZA 4B81A 4CFSA 2IYZA 1CS4C 3PC8A 4V1CI 1YJAA 4ZPJA 1R27A 3DFFA 3GJ5A 5KVCA 4L3WA 1WB6A 3S5JA 2P27A 3D8RA 2X5OA 1CZOA 3ZWPA 4GU5A 3B8HA 1TUIA 1EG2A 3NEYA 2AN4A 2QX8A 1MXHA 1U7HA 4WERA 2HK8A 4V0KA 3OUTA 1SD5A 4WKGA 4ZZ3A 1NVEA 2IZZA 1K98A 3KX2A 4CMHA 3OWXA 1CJUC 2JFOA 5AJZA 2IH2A 1D5WA 1QKJA 1P9OA 3MGAA 5E7JA 3I4CA 1PFUA 1NJ2A 4H08A 1Z47A 4MB2A 2B7LA 3RB8A 4EAQA 4YRAA 3QBEA 4RTMA 2P9JA 2DXIA 3ACCA 5BSFA 3UPUA 3EEIA 3OICA 2W2OA 1FQOA 5BQ3A 3QU4A 5IT4A 3RAEC 4IJUA 5ALRA 2PJZA 4ND8B 4MGEA 3WNCA 2QN8A 1DEKA 4PQGA 5FT9A 2SICE 1TPZA 3JU3A 2O05A 4H6VA 1TMGE 4L6AA 3OF3A 4M38A 5CIWA 2VDPB 3NO4A 2KM1A 2C03A 4RIHA 1B74A 1N5LA 5HKAA 2D1TA 2Y92A 4WCFB 2GAOA 2ZAMA 1W4AA 3T0FA 5BUSA 3D7LA 2VCYA 1XZGA 3VNAA 2RARA 4J2OA 1YJNB 5HIJA 3OQBA 3P2YA 2O07A 1MOQA 2ORVA 3ZU3A 1SURA 4EUKA 5IUJC 3M34A 3MJRA 3PUJA 3QMVA 3K70C 5FBWB 4J7CA 1AIPA 2V7UA 5ELXA 2ZREA 1AMOA 1ODLA 1O5IA 2RJ3A 3EVTA 1EFTA 4OOXA 4QASA 1YT5A 1AU9A 1XROA 2I22A 4PZDA 1Y1LA 4LE0A 1YDMA 1NW6A 2DWOA 3HEBA 3VR6A 4MLCA 4QX6A 1U3WA 4R40A 4EUFA 4R2WA 1L3IA 3ISTA 3F9RA 5A5GA 3LP5A 4JC4A 1G4HA 1XF1A 4J9UE 2XQFA 2HRDA 4X8HA 4DIFA 3A1WA 4X8MA 3QWFA 4MAAA 1G8SA 2DLDA 4URUR 2DFNA 4BNIA 4WL0A 1JDZA 2ORED 3TSZA 2PA3A 3HUEA 2XF2A 1RQRA 2OAQ1 3MGCA 3OA0A 4ZOQI 1OZHA 3UFBA 1QKKA 2PNJA 1F9EA 5GTDA 2BL4A 3GFQA 3DDWA 3AL3A 2BFBA 6LDHA 2IEDA 6YASA 3E5RA 4PBSA 3W9UA 1XNGA 1M2NA 1SBTA 1TO1E 3GGSA 2QE7A 3IPLA 3ONDA 4J3JA 5FF9A 3SXUB 4EUSA 2VHYA 3M89A 5JJIA 4YB8A 1SHJA 3D7RA 3MTBA 1CEYA 2YZMA 5TEVA 4UBMA 4Y2XA 4NG4A 2ZPTX 4ZEOA 3BBLA 3JVDA 1VLHA 1IPFA 2ZI4A 3KRTA 2ZI6A 3JU4A 4FXUA 2F1RA 2AIRA 1KTIA 3HBJA 3UV3A 1TAUA 1GTRA 1EFHA 4RDLA 1IXSB 2R85A 5TE9A 2JI6A 4AJ4A 2PIDA 5CEFA 4OPVA 5KUTA 1P2SA 2VI5A 3ZTWA 2QN9A 5IJWA 4S1OA 4Z0TA 4DIDA 4R1PA 1OIXA 1WZEA 3UJ3X 1X7ZB 4P2GA 2XVAA 2E1BA 3UTDA 3KEFA 2QTVA 3I73A 5E6UB 3KYIB 2BMAA 2OZLA 1BU5A 3FKJA 3H2SA 3HDTA 3PC6A 1TKCA 4KQJA 3VNQA 2VJIA 3I55B 1F2TA 1FPQA 3WSVA 4OH1A 2O19A 3LCUA 1N6LA 2V1XA 4X1YB 4YO7A 3W6NA 5AJWA 4YPFA 4EF5A 5BXQC 4MR8B 3BE6A 2O0HA 3M2TA 3WB2A 4EZEA 1Q7YD 5EN4A 5BSGA 2C00A 3G2NA 4FC6A 1FK8A 1SVIA 1MLDA 2QZJA 2VYVD 1UOQA 2VQDA 1GKUB 5SYMA 4D1YA 1UC9A 3I23A 4LJAA 2WYIA 4NJMB 4YAEA 1KH1A 4IMRA 2GETA 4N82A 1NP3A 2ODBA 3B5EA 3RYTC 3GDGA 5T6BA 1Z17A 1Z5VA 2QA5A 4QU0A 4HDRA 1A8QA 2O8CA 3CMCO 1T3LA 5HTKA 1RZRA 2ZYUX 2VNKA 3EQ7A 4BMOB 1J8VA 4Z7JA 1R0WA 1R6XA 1YIOA 5KPJA 3R5FA 5IBQA 3ETNA 2H00A 5A71A 4KWIA 3QWBA 1YZUA 1YRAA 2PRJA 1BFKA 2VJOA 3VNBA 2HDOA 3HVKA 3WLNA 1QP4A 1DV2A 2YCBA 2ZYWX 2P1RA 3IXLA 3PL1A 1DKQA 3QLEA 4O2AB 4DT1B 4HMOA 3IEMA 4JR0A 1N77A 1PL0A 3DE1X 1W2WB 3HDQA 4GF5A 3CLRD 5HMLA 3M9XA 2V96A 2J5XA 3SQDA 3G1UA 3V3KA 4C05A 3DV0A 2BD0A 1Z0ZA 3QVLA 3K2BA 4BWYA 1PJAA 4TRRA 4HQLA 4KR7A 1RBMA 2OK7A 1G20E 2SKCA 4TVBA 1Q19A 3RRJA 3KR0A 2ZYDA 5KNBD 4LYEA 3UUEA 4YJ3B 1MJHA 2Q2NA 3FPHA 3J81k 2C07A 2D1SA 5A3VA 4BE9A 3VSEA 2W0SA 4NYJR 1K8RA 5IKPA 3BVPA 3T8YA 3F49S 4RPKA 1EXVA 4UDXX 3NTXA 3LLCA 3HBFA 5EJ8A 3T3MB 3HLYA 1AKRA 1UIRA 1ZP6A 2G0NA 3IQGX 4Y9SA 4RM0A 4BNTA 3ZJTA 1XEFA 4G1UC 3WHPA 3IMFA 4XX0A 4NSNA 3HK2A 1ZH4A 4OHUA 4DMMA 1PZFA 2AV6A 3V80A 4YMIA 3OU7A 3SBDA 3NM6B 4GSLA 2NV6A 3H1TA 3ZD6A 2VRCA 1H42A 1BCSA 4J49A 3NLLA 1YGYA 5DEIA 5ANRB 1UBCA 2HK9A 1VQ7B 4LV6A 4UEWA 2FPRA 4DY4A 4E88A 2IP2A 1T8RA 3IELA 2B6NA 1JIVA 5B4TA 4O3MA 2OHVA 2BPOA 4FWTA 3RRXA 5GZ1A 3MILA 1KS2A 4FKBA 2HA6A 5CK5A 1QK4A 1YI2B 2ZFUA 3P5SA 3VMMA 1J5XA 2OBNA 1VA4A 3NV7A 4LY6A 4Q01A 1QYXA 2G76A 3G3EA 1DTEA 1IB6A 1T2DA 3FPCA 3BZWA 2VT7A 4R7ZA 1G8PA 1RNLA 2DUJA 4PBRA 5B4VA 2CDCA 1YD7A 1CUDA 2H7YA 5EXPA 1VQ9B 1J2TA 1JDBB 2J41A 3UB2A 1Q0HA 3QG5A 4HDAA 2OBXA 5I9SA 4YJ2A 1K97A 1YL7A 4EDFA 4D42A 2GN8A 2VYFA 3AFNA 2J7PD 4WJLA 5K0TA 1PQ4A 2FPGB 2VSNA 3DOEA 5AKGA 1IZYA 2ZUWA 4J6EA 3NFRA 3ZBPA 2OP0A 2YZNA 3F0TA 4XD2A 4C2AA 3CMAB 2H4HA 2QR5A 4JP1A 5FA6A 2P6PA 4PO3X 3CUYA 1X80B 2YJ6A 2YOHA 3C4VA 3PUHA 4OJNA 1XDDA 3VC1A 4CM9D 4R01A 4M76B 5IYQA 2Z8YA 3LQEA 1H65A 4QATA 2OD2A 3DFIA 2ILVA 1Y7PA 3FDFA 2WZQA 2EKZA 5E8RA 4UTXA 2W93A 1WLSA 3PIDA 4QUAA 1JG6A 4OXYA 3H11B 3ZI4A 3LBIA 3NHUA 2M1ZA 5B6JA 4YFYA 2MSDB 3NBQA 2B34A 4N41A 2I87A 1NUTA 3O1JC 5E3HA 3VVCA 3Q7TA 5KAMA 3MJVA 2RKWA 2YWRA 3QBDA 3HB9A 1U6KA 1A9TA 2VHQA 3ADOA 3IUNA 5A1TA 2GLTA 2YICA 4QC2A 1CE8B 1CLUA 1Y7IA 1N1GA 5EJ4A 4ODIA 5DM4A 1RPZA 2I3GA 4BNLA 2VSOA 2DGDA 4IQFA 4AMZA 1N5DA 1PQUA 4EJ0A 1HDRA 3M49A 2IY9A 4NNPA 5ADWA 3ONWA 4N9QA 4WLEA 2GHTA 4DZRA 3K4PA 3LVFO 2Q9AA 4ENTA 5HZKA 3V6LA 5EKUA 3M1YA 5JFTA 3MINB 4WSOA 4BS9A 1SY7A 1K3TA 4YY3B 1HR0B 5BV2P 1KXZA 3L02A 2Y77A 1MB3A 4FOLA 3WGIA 4HV4A 1M2KA 3A32A 2RK6A 1TI7A 1L5MA 2REXB 1AKWA 2X6YA 3LPCA 4MLPA 5JRZA 3WTCA 2WZCA 3RS2A 2JJMA 1MC8A 3COWA 3SKVA 3F2VA 4LSZA 2SNIE 2LNDA 5JD6A 4JDPA 3AESA 1L4BA 4CF5A 1A8SA 3FTPA 3H5VA 3K31A 4L9WA 4AECA 1IHMA 2MCFA 4Y9DA 5L7TA 4HN9A 4KWTA 1L3BA 1SC3A 1EG7A 1S2IA 4EB6A 1YDGA 1KDPA 5K8UA 1V4BA 3BMCB 4H6WA 1QFZA 1PJ4A 1PSWA 1Y1QA 2QMOA 1GGEA 3SR0A 1DIOB 4F9FA 2ATEA 2EWWA 3GZTB 3OLXA 1SBZA 3B3FA 1D6NA 2C2XA 4IUYA 2ZBUA 1E8MA 1YZYA 2WSSD 4XLEA 2ZT6A 1BCRA 3EQZA 1NX6A 1ZK4A 1DLJA 1CP2A 1HE8B 2V03A 1YS1X 3QKTA 4CLEA 3BWMA 4ER6A 1DQNA 2IZ1A 2CHQA 1E2UA 1EVYA 4QUJA 5FH9A 1MO2A 1XDBA 2XZTA 4N6OA 1PJ3A 1C7ZA 2XA2A 2ZE6A 3BK7A 3MM4A 3PNOA 1UOOA 2HK7A 1IAVA 2WD8A 3TL6A 3L07A 5B3JA 3ZNOA 4W99A 3LT2A 3QXCA 4V3CA 3VJRA 3OEEA 5DHUA 4MPPA 5B58T 3REQA 1OH7A 1GR1A 1EVLA 3OQHA 3B70A 4UKDA 4AP5A 2A1UA 2OGZA 3RU9A 3HYCA 5LJLA 1XJ0A 3L7LA 4JP8A 4OJKA 1ZHFA 4GYYA 1EX1A 2R6DA 2ZTMA 4IJ6A 4FHZA 4CL2A 4HX9A 1BKYA 1XA3A 4YQZA 5LXTA 4TYMA 1ZESA 3QX8A 3K1JA 3PXCX 5JI2E 4MVJD 1GKIA 2PV7A 2VHEA 3GRKA 2BYTA 3E3NA 1ZD2P 3A58B 5LIPA 5HF8A 1E69A 2J0UA 5EXXA 3VPBA 2BEWB 2E0IA 4GI7A 1X1SA 3PPXA 4I55A 4PYIA 2ZI5A 2NIPA 4BXOB 1KYWA 4XVCA 1XU4A 3C48A 3NOQA 5CJPA 2UZ1A 3HFRA 3N0RA 4Q16A 5FOUA 5EGNA 3M4ZA 1AKMA 4OI4A 2ZBPA 3COYA 4JI7B 2WF8A 1ZAKA 1NI4B 1QYDA 2NX2A 2XRMA 3QGMA 4HTAA 4KQIA 3OJEA 4E12A 1E2KA 1X7YB 2QT1A 2ADFA 4EG0A 2CCGA 2ZSHA 4M86A 2NACA 5ECDA 3QF4A 3AKDA 2CJYA 3SIPA 1GQFA 4D41A 5KYKA 2XCRB 5HZAA 1EA7A 4BEBA 2H4WA 4EX6A 1CQIB 2VDRB 3QLVC 4YCLA 4CYMA 2ZTLA 4KDEA 2WMOB 3DMPA 3K2EA 3H6GA 2X53S 1I3OA 1V4VA 2B4YA 2BMDA 3HPRA 5JVDB 1VSUA 4GIBA 5BUZA 2I8CA 5K3BA 3OSZA 4XRRA 1Z2NX 4AO7A 4MW0A 1H4VB 4MWCA 2C3YA 1FYWA 2B21A 3L1VA 1OI7A 5JSFA 2WJGA 3FPJA 3D6JA 1QIDA 2EW1A 1XK6A 1JSLA 2B4RO 1TZCA 4BRWA 4MINA 2IXAA 3UVEA 1NN5A 5TSDA 1C9KA 1Z33A 3M4JA 2KB0A 4G8DA 4C30A 2W2VA 4DA4A 5MGNA 4FVTA 1UD5A 3CR8A 2WUWE 3IDZA 3SX4A 3T3PB 5KOYA 4ZOEA 1XZAA 1P8JA 3R5KA 1TTQB 1E0DA 3MJEA 1NVXQ 2QUAA 4DA8A 3EXHC 5D87A 5K0ZA 1I4LD 1Q92A 4L8GA 4LXUA 1SBYA 3DZGA 4W7HA 5REQA 2XUFA 3DE5X 2WQZA 3EH1A 4BFZA 3G1WA 2J08A 1XMOB 2IPMA 2HBZA 1R15A 1M1UA 2GX6A 4UATA 3UUFA 4TKOB 4YRTA 3SYRA 3DXZA 3TOVA 4XVRA 4BN5A 3GRFA 4F12A 4KITB 1CF9A 2R8YA 3NWPA 1DBIA 2WJHA 4IL5A 1B15A 1RMQA 3UH0A 1WOPA 3PQDA 5LDHA 3ZCTA 1COWD 3VU9A 2OCAA 1E7WA 1J8QA 3GHHA 3RNLA 4PC2A 4CFYA 1YR1A 3FOCA 3RS3A 4CG2A 2EWMA 1XI2A 1AJEA 2WJVA 4C0LA 4LRWA 5AKHA 3FAKA 3JQEA 2C4NA 4WCDA 3WJAA 3JZAA 5FYQA 3G71B 3D4IA 8GPBA 4KXXA 2VT3A 5EXEA 4JGIA 2GD2A 5AM0A 3RSGA 3UATA 4DIMA 2Q6LA 1UJMA 1U2TA 3BERA 3OMXA 5EIOA 4DSOA 1K89A 1ZH0A 1HL3A 5E6TA 5BT8A 2CE7A 4XPIB 3VSDA 4OHYA 2XNSA 4RWEA 2C5FA 2B20A 3V33A 2WJZB 2C58A 3RV3A 3UJ6A 1GRCA 2HU7A 3ZTYA 3KYBA 2FPPB 1HGXA 3IODA 1NUUA 2H0QA 3LBAA 2PZLA 3SSNA 1NVWQ 1CP3A 3GPIA 4V3BA 5ILGA 4NCAA 1B6RA 3ZZTA 5CW1A 4LRSB 3VR3D 1GG8A 4M1MA 4V0NA 4EHBA 4KOAA 2AW5A 4OHFA 3AU9A 4LE1A 3HJHA 3G9XA 2RGNA 4Z4IA 1Z5WA 4JBXA 4GICA 1MJGM 2JLYA 3MJCA 3DJYA 3I8OA 1Y82A 3T38A 1Q82D 3IPCA 3KKQA 1KZHA 4Q9JA 2JA2A 4YMHA 1BJRE 3E9YA 4BNUA 1YR3A 3I12A 4PPYA 4R68A 3T7RA 2EIXA 1KWKA 3INNA 5MDHA 1J70A 4Z49A 1CR4A 1CFZA 5J3JA 1X9GA 4Q7QA 4KO2S 3PXDA 3D8BA 4NULA 3TLMA 2DHRA 4D4JA 2J85A 2YMPA 3BJZA 1RXVA 4P6VF 4TV9B 2ZRDA 4HZGA 3VDMA 2GNAA 3NJ8A 3TFOA 2G07A 5DLDA 3CKMA 1BDBA 1FP4A 1XKXA 5I9NA 1K2VN 4NE9A 1P4MA 3QW4B 4UEOA 4ZAXA 3TRDA 1XTBA 3FIUA 2I4MA 3EZYA 2ISSD 1UBTS 4MUMA 5IAAA 4XLFA 4A3SA 3Q8KA 3F71A 2FMIA 3R77A 1NPDA 1TJ4A 2QK4A 2PUFA 4L0QA 1P4GA 2HFJA 3OQIA 1MABB 4RK5A 5L8VA 3NDRA 3RKRA 4F6LA 1PHRA 2VKQA 3PSHA 5L53A 4J0QA 1HEIA 3L7MA 1VPLA 1KDVA 3E18A 4MPJA 2DF8A 5BN3A 3L7BA 1ZK3A 3DKIA 1CRWG 2WTMA 4CM8B 4HZIA 4XNFA 1QCCA 4J3FA 2YR0A 4L78A 2EL7A 3PJGA 5GADl 2OXCA 2D54A 1XDGA 4PLZA 1YHQB 4PGFA 2I2DA 1DXHA 3A37A 2ODWA 2Z4RA 1FSGA 1V95A 1IEXA 4LVNA 2GHRA 3DONA 4REQB 3D7KA 3J81A 3E7FA 3UFXB 4QVGA 1UPTA 1O54A 1SVUA 2IIBA 1YK0A 3DEAA 1E2PA 3JYLA 3KOYA 3OY7A 3E03A 1T9KA 3UAXA 1P1JA 2PUTA 3AV3A 3IV9A 1I3KA 1QIFA 3WNDA 3JQBA 3STVA 1CE8A 3DF9A 5EQJB 1MIOB 4JROA 4RD4A 3H4VA 3L41A 2G1KA 3HKCB 1P1FA 1UBNA 2O8NA 1P18A 2BGIA 1WPRA 4DQVA 3ZGXA 3KB8A 3ORQA 4WGFA 4DE5A 2DFVA 5LYJA 2QJFA 1YI0A 1R6UA 1J23A 1QM5A 2X3YA 5LMUB 2YKGA 2QMHA 4NZMA 1KSHA 4J0CA 5IBPA 3RSQA 2BE9A 4OQEA 1YU9A 1Q12A 5EWLA 5J5CA 3KEMA 4IDFA 4EJ6A 1T6XA 1XHLA 3BFXA 3ANSA 3DEFA 4YA6A 4M9UA 4BWGA 3ZWXA 1CJMA 1I01A 4M1QA 2VQ6A 3P9SA 4OBBA 3NNSA 3AUAA 1VBNA 1G98A 4HEHA 4EG8A 4NICA 3VKGA 1SD2A 1Q1AA 4GPEA 1KJYA 3UMJA 4MR8A 2P6MA 2I4TA 4CMEA 3VR2A 4XUCA 3ZHYA 3N2GB 2JKZA 4BVAA 4ZGGA 3ZIAA 3OKFA 1CY7A 4BMYA 2R7AA 1YS2X 2OFXA 4YDHB 2RGCA 2BTQA 1NZJA 3FLAA 3EB9A 3JV7A 3S8YA 5A4KA 4XVQA 4L27A 2PGLA 1JIIA 3HCEA 3Q11A 1LLUA 4JENA 3VYWA 2VHJA 3BJEA 3WKCA 1PJ8A 5JE8A 4Y6OA 1ZD4A 4ZQIA 1CJTC 3KR2A 1R0KA 4HLUA 6ABPA 1SUPA 4ZZ1A 3LTNC 2IOYA 5ECYA 1E1MA 2GZHA 2VS1A 1FTWA 1QX4A 3L8ZA 1J0CA 2CNNA 1WKVA 1AX9A 2RHDA 3F5FA 3KJEA 3ZWDA 4CIAA 2P79A 5JJBA 3NBYC 1AQYA 4ZJPA 4ZEVA 3Q85A 5GV7A 4N7JA 3IFSA 4ZEWA 1HMPA 1OZGA 3U9SA 3KYJB 1BHO1 1M2OB 5JEEA 1R0YA 3M1LA 4IILA 1W30A 1M1YB 1TJYA 2H31A 3GP3A 3H42B 3I3SR 2PUDA 2J87A 4DQLA 1VMAA 2IDJA 2FCRA 1OHHA 4Q4HA 2CV1A 5ALDA 3ZQJA 4CV0A 3NGLA 3FA2A 2H7VA 3MTEA 1NW9B 2HSGA 3OFVA 2AX3A 4R1NA 4YLEA 3AJRA 3KT0A 5JZVA 1AS3A 4LVCA 3R3XA 4YIKA 5TV2A 1THTA 2X5JO 1TCBA 1WNTA 4LHVA 1O95C 2N0SA 4CCYA 5IJ9B 5K5EA 5LPNA 3B2QA 4BUCA 1J90A 2ZRBA 2ZRGA 4FTWA 4O59O 2XTJA 2C5SA 1EUDB 5HNKA 1TUEA 2CY0A 3E4CA 4J43A 4WOBA 4K81B 4RDKA 1E79A 1FLNA 1A76A 1X9IA 2I54A 2HCBA 4H7FA 3QU5A 3O26A 3ITEA 4TM7A 2WIGA 3Q2IA 1QGOA 4IHQA 3DZ8A 3C6QA 3B6KA 3NORA 5DNEA 3ZDAA 2VHZA 3O92A 221PA 3G0DA 3PQCA 3OLYA 2NUPB 4JGGA 5HGJA 2YIVX 1DRUA 3N0VA 5EXTA 2CMKA 4MWEA 3RK4A 4CHTA 4NS4A 4Z5XA 4DABA 4EA8A 5IFKA 4P4NA 3U48A 4BX0A 1DAMA 1F51E 1YBHA 5LU8A 2XQGA 3H7IA 1I7SB 3J80A 3WFIA 1M34E 2BE7A 2BM0A 4YECA 5SZKB 5IKEA 2GN1A 2HB6A 3IIKA 4G0NA 4C4ZA 3OLCX 3GJTA 1UEXC 3ZXYA 3RNOA 4M8SA 1FVFA 2Q4BA 2JFFA 3Q87B 2HRRA 3HU2A 4ERNA 2M1XA 4NRDA 5AIBA 1O08A 2BMEA 1CQZA 5JQGB 1NM5C 4JJ8A 1NBIA 1LTKA 4BO8A 1WA5A 1XMJA 4ZJYA 1QMPA 1SOUA 1IIRA 5EE0A 5LKAA 4EYQA 2RD2A 3IAFA 4IJVA 3GLFE 1XLTA 1JW9B 3A4TA 5UKDA 4IXTA 1O77A 5F9MA 2BUCA 4CGZA 4WZBE 1ZI8A 5DT2A 5LA6A 3SICE 1H6AA 1ECFA 3AR3A 4FN4A 1QQ5A 2LV8A 4G7WA 4GNRA 3GLQA 1URPA 5KYYA 1VSTA 1D2RA 3EZ2A 4AJOA 2R8OA 4JXKA 1OI4A 4BATA 3SU8A 1EP3B 4Z4TA 1N5MA 1QFYA 1VP3A 4OQDA 4RMHA 4JJAA 1GDDA 1ZINA 1HYQA 1SOWA 2CT8A 5AYVA 3EARA 1SRRA 1WQ3A 4IRUB 4IS2A 2IZ7A 4DV6B 1ZRHA 4Q18A 5AJHA 2O6HA 3KLNA 5JDIA 4M1WA 1QQAA 5G40A 4JMPA 1FFBA 5EJGA 5LBIA 2JIZA 3QFSA 1GKYA 1GU1A 1LPOA 1NSTA 1GCUA 1SCKA 2GF9A 2J3MA 3C15C 4OXXA 4FNGA 4HRAA 5HUQA 2I99A 3O8NA 1WU7A 3LK7A 3R0QA 4GC9A 3WRXA 2RBGA 4HZUA 4MW4A 1BQEA 2QORA 2ZAIA 1IG0A 1LLFA 2F3PA 2JZOA 2WNSA 3HR7A 3M33A 4URXR 4LJSA 4E2YA 2BWJA 2IHTA 2J33A 4IP0A 4ADSG 2JS7A 2O0MA 7GPBA 3NBUA 2W2LD 4JJ4A 1Q3KA 2ZJ2A 1JGTA 4QDKA 4H16A 3A6GA 1JTFA 3CF4A 1B16A 4G6ZA 5A2GA 2H7CA 5B1EA 2V45A 3QBJA 1N5OX 1ZNQO 1XJ5A 5D00A 5ARDA 1JPJA 3FCCA 3IV7A 3C74A 4MGIR 3HO6A 2IVFA 5HF9A 1DOHA 4FWIB 4H6XA 4QJBA 5FHRA 4AY5A 1OREA 4JP2A 3SCZA 1A8UA 1KI8A 1X7GA 1DAEA 3GJSA 1T26A 2GZDA 3LRPA 4HNAA 2XOXA 1L5KA 2H6EA 3TPCA 3JVIA 5KMGA 2O5EA 4QDUA 1ZCZA 2IBMA 3MWEB 2UZIR 5TQ0A 1Y6QA 1RTKA 1GCOA 3DZIA 3BOSA 2NO5A 3I32A 3SSMA 1VL1A 4HUJA 2J0VA 1FDRA 1U9IC 5F4MA 1YRBA 2OYCA 3CP8A 2WHPA 4MMZB 2HADA 5ALPA 3T1NA 3CZQA 2HXGA 3X1MA 2ODEA 1GU7A 4IVRA 4KWHA 3L0SA 2C96A 4FE7A 1SB8A 4PPNA 5CH8A 4CIVA 4J1TA 4QBHA 5JAPA 3SEQA 5LQNA 2DQKA 1BCRB 3H9EO 3I5UA 5HQTA 1WJGA 4L5IA 2A5DA 3WNBA 2DR0A 4AICA 1QHFA 1ZBQA 3AC0A 1G8HA 1Q1BA 1VF7A 3FLBA 1CB7A 4X1IB 2EXXA 4B3SB 2DLNA 2JD2A 2HHAA 1XTKA 4NZPA 1HE5A 4JKYA 1R4MA 3O4HA 1N1EA 1D4OA 3TZKA 2D0OB 2EG9A 4XWTA 5K0SA 5DWVA 4DNFA 1K7XB 2I7TA 2RC6A 4ZCIA 3KEGA 1NKVA 2J6BA 3LX4A 4N54A 1WG8A 5H3LA 3RVKA 4CF3A 4NZYA 1KEVA 3GLHA 4F4UA 1E3ZA 3LCCA 4WFIA 5FLXA 5LMNB 4FPXA 4A8PA 3Q3VA 4EI8A 4J0EA 3NB0A 3KKKA 3JCZA 4U2GA 3ZGVA 2XKKA 2UYGA 2P5YA 4CZ2A 4RDCA 1JHZA 2YJTD 1NV8A 3LUHA 4D98A 1NATA 3S81A 1K7FB 1C4WA 2KLBA 4RGYA 2GESA 5TT0A 3SS8A 4BQFA 3GRZA 1Q50A 4GW3A 3Q8LA 1CEXA 1EFPB 1N2XA 2QD2A 1E9AA 3BXHA 3I04A 3PQ2A 4JZKA 3TRHA 1KS9A 4S04A 3PLAE 2P2SA 2EF1A 4OP3A 4U02A 2EC5A 1OVGA 1UOEA 3U44A 1N9GB 5KOHB 4C7VA 1L4NA 1VRWA 4IXWA 3GMDA 1Y1KE 3WI7A 3WLOA 1R8YA 1MN6A 2JB9A 2XKAA 4P3XA 4GUAA 1T9ZA 1DMRA 1WPGA 2Y1WA 5KYVA 3TRKA 3TXYA 3WOHA 2M5SA 2VVTA 4CM7A 1ZD9A 3DM9B 1X87A 4ALKA 4PS0A 3ECAA 4FYVA 2Z04A 5KWIA 4I1PA 3NYIA 4LTDA 2I1WA 4WPGA 1JXOA 3ABRB 2JAXA 4IEIA 1U2GA 3QA9A 1MVNA 1XX6A 3CVOA 3MRSA 3RSLA 2H16A 2FWRA 4TLCA 4ATNA 3ZY6A 2O2CA 3VHLB 5KBYA 3T5GA 4DR7B 2HDWA 4MWZA 2OAEA 1FS5A 2QM0A 2B8JA 2W2MA 5AVKA 1A69A 4EJSC 2V0GA 2BFCA 1QLJA 2G9ZA 3AERA 3M3HA 3V8MA 3KSAC 5BN5B 1MEEA 4N49A 2WF7A 2WB2A 5ICMA 3QENA 1TK2A 1CUAA 1RRGA 2HJWA 13PKA 2Q0QA 4YRPA 4G65A 5DFAA 2DTEA 2R79A 4PO9A 4AJIA 3TH5A 1IQ0A 3DEIA 4GL4A 1SWVA 2GTPA 3AFOA 4N8DA 5J2TF 3X1JA 4CIWA 1FRQA 5AI9A 3ZHCA 2F17A 4RVNA 1ULAA 4OU4A 3G02A 5GZ3A 2UYOA 4BX8A 2J9XB 1UADA 1R0RE 2ZSUA 1KDRA 2GN4A 3LH5A 4BX2A 5IASA 4GM0A 3THXB 1DARA 1IWPB 2C4HA 3ZWAA 4B8YA 1HFWA 1Z83A 3E8MA 2PUBA 3SQMA 3QYJA 4E5YA 3P27A 1OBOA 2ZJ1A 4RMJA 5A4IS 3W6UA 1JHUA 1IBRA 1YOBA 3PC3A 4FIDA 2C5GA 4ZU6X 1ADCA 2VAPA 4FX2A 2FJUA 3K9LA 3RYHB 2HHHB 1WWKA 3BL6A 1XZNA 1ZBDA 3ONUA 1JB9A 5BSYA 3KOWA 2HHLA 3WLIA 4M88A 3GQBB 2OYSA 5KJFA 4BV2A 1YZNA 3H99A 3OCXA 1EP9A 3HDVA 3UMGA 3PTAA 1WTCA 5MFZA 1Q14A 4PAQA 5CGQB 1L5SA 4P5DA 2R84A 2QL6A 3AHJA 1QE3A 1E1QD 4ABTA 4AIRA 2OCGA 2VA9A 2W71A 4XPZA 3AY0A 3OJCA 1R0SA 1S3IA 5BWBA 5H4GA 3JD4A 1N78A 4JK3A 1L4HA 5KJEA 3ZHVA 1WHTA 3NUQA 3L6UA 1L5FA 1NQUA 3FOAA 3DZBA 3MGKA 4BX9A 2G6BA 4RVUA 2XB9A 3WMXA 3MCAA 4DV5B 3BFKA 3HYTA 3FNBA 4I19A 2P6UA 3DKPA 4PF1A 2DCUA 1BROA 1W44A 1MJFA 2GZMA 2I03A 3VO2A 1YRLA 1RKUA 2QROA 2ZQYA 1NIJA 3R0IA 5L7WA 3N53A 4NOJA 4GUDA 1S2GA 4XMYA 4QUEA 5DM1A 4F5WA 4WW0A 3A8IA 3JALA 1M2VA 1U8CB 1G7RA 3TZCA 3VO1A 4JL6A 5I7WA 2GCEA 2V8OA 1LH0A 2FI1A 2ROQA 3WKAA 3V7AA 3PNQA 3EC7A 3DT9A 2ATCA 4YJFB 2ZIZA 3V4VB 3E9QA 5AVOA 5I9TA 2HRZA 4CT5A 1A5AB 3DJFA 3FNQA 5EKXA 4ZHQA 2A1IA 2DFDA 2GPAA 3VSBA 2BLNA 4I7EA 3J7AC 4O3FA 1G0NA 2P9HA 5L3SB 1UD2A 4RC9A 3DW3X 5BMVA 3BMOB 3LC0A 5BNFA 1ZC3A 1ZR2A 1LDNA 4Y7CA 2NO9A 3OVMA 3AKEA 2PVPA 5CT4A 3U0VA 2R87A 1CUFA 2WJ3A 3ZK8A 4FHEA 4N4AA 1WBDA 3Q98A 1FTNA 1NVTA 4U9HS 3DAPA 2X8WA 2IEZA 3W2EA 3IBTA 1YZVA 2XMRA 4XJTA 4Z4FA 1NMSA 2V5AA 3BWVA 4FYXA 1L5YA 4J9VA 1Q57A 4L5BA 3K2IA 3VH1A 3L0IB 3RTDA 2B98A 4X7BA 5HG0A 2XVYA 3TINA 2C2ZA 1GSOA 2R65A 3BAFA 4AJ1A 1DBRA 4KU4A 3GVKA 1AN0A 1QOQB 1JFFA 1YZ3A 2YOFA 1ZVKA 3HB1A 2BBWA 4FGKA 4Q3EA 5AM2A 3KBOA 4OAQA 3PJDA 4OO3A 3L40A 4V0QA 4OHPA 1HH4A 3H0KA 2ZUVA 3BGWA 3I4LA 1FTYA 2V7QD 3KS9A 4GD3Q 4HQFA 1H0SA 1A5SB 2O6LA 3SQNA 3T06B 3USCS 1XXHB 3P4XA 1YNSA 3V8BA 2X86A 2AXQA 2IX9A 1JN0A 2ZETA 4ND5A 5HA5A 3TF5A 3HQ4O 2IGTA 3VPAA 1E1DA 2JJ2A 2L0XA 4PLPA 1CZNA 4N3BA 1VQ8B 1GSAA 1I4TD 2X0RA 4MB0A 2W7TA 4K8RB 2LXNA 3ZW9A 4CM8A 4PAMA 4X5OA 5ERGB 3EGXA 1CNMA 2O4CA 1ODJA 3B85A 3FUCA 3PFKA 5F7XA 1A97A 2XLCA 4Y1FA 4KI7A 4W8GA 2B30A 3WGYA 2FETA 2MOKA 1U4NA 4GG1A 4Q12A 2DPXA 1ZVJA 2ZB2A 3T94A 4NZ9A 1P1RA 3UMFA 1FOEB 3ZS9A 1HRKA 1N3IA 2KHZA 4E0BA 2ATXA 1SJ9A 4Y9UA 3AF3A 1HM5A 2IZOA 3FAZA 3NBAA 3OMWA 2IEGA 4PLFA 2IYLD 5A4DA 1NMXA 1W5AA 2FMTA 2Q5OA 1L5WA 1Z63A 1KOGA 1FQWA 5B3KA 1A0OA 4HUQA 1G5TA 3M82A 2I1VB 4KRXA 4GT1A 3URKA 4H1UA 1YU6A 4IUDS 5GIPE 4ZRMA 1JFRA 1Z06A 3E9EA 5G3YA 3SFZA 4Z99A 3P0IA 2XRFA 2FMKA 3C5VA 2GTIA 1GCGA 1D3AA 3DXXA 4BUZA 3ZE6A 2AOTA 2XA9A 5EIHA 5DGXA 5DK6A 1J4AA 4R84A 1H4SA 4R8VA 2B4KA 2QX4A 4OK6A 4YTEA 5LL6P 2Y9PB 1HQKA 1W581 3CZCA 4PICA 4F6CA 1WW3A 3IQXA 4A8JA 1M3SA 1J0BA 3ID6C 2QTVB 2WIBA 1IEQA 4UZEA 2ETVA 1T34A 3LD9A 3QELB 1VHLA 4GGPA 1P4SA 3PYXA 2OWEA 5LN1A 2JJ2D 4ED9A 2R9VA 4G7XA 1C3EA 4MEBA 3F6CA 3PR1A 1CHDA 5D84A 1PQPA 4IDQA 3H0EA 3ZZ1A 5K20A 1WOOA 4GKBA 3BFJA 2VZ9A 5DLQC 2HBYA 3RIGA 1AM4D 3P52A 3Q5EA 4EYGA 3AWDA 2PO5A 3L4SO 5BSUA 3JQAB 5GOZA 3ISVA 3V8RA 2G77B 2Q27A 2VP4A 1VIMA 1FLAA 2BZGA 3AMVA 3U39A 5F4ZA 3JW8A 4PN3A 4IX9A 4F9GA 4JYPA 3N28A 2JHCA 3BJRA 3OC6A 4GKVA 2QTZA 1D9XA 4Z4UA 2IEAA 3AEYA 3DBLA 4IQGA 4OJTA 1JDUA 4P38A 2FPKA 3HEMA 3CH4B 2D00A 4NCHA 4MRMB 2FTKE 4HPJB 3FWYA 2QLJA 1LDEA 1JJ2B 2XKBA 3EH2A 1ULZA 2ZRCA 5LR6A 1GAJA 2F59A 3CT6A 4HY3A 3TUIC 2GJSA 1U11A 2PTHA 2QM7A 4UUNA 5TARA 3UC5A 3W8NA 5ICSA 5KIAA 2JLQA 5KNCD 3P1JA 1SELA 4XSVA 5CNJA 4ZVRA 2EJCA 4FFNA 1FJHA 1QRUA 1RXSA 1JA9A 1G6HA 1IHXA 1QE5A 3Q7EA 3WGVA 3GG2A 1F06A 2N47A 2W83A 3ACDA 3DWEX 3OE1A 4QXAA 4IAOA 3BKWA 5LQUA 5JROA 1PUJA 2PRSA 3TBHA 2WIFA 2VSQA 4MZDA 3ISXA 3U31A 1SCIA 2NNWB 2LRHA 3DVRX 5LOVB 1PKEA 2N46A 4CMIB 4PX9A 4AZSA 1U7DA 2QRUA 3ICOA 2YHSA 3PX2A 1USUA 2GLUA 1PJ6A 5BYKA 4MS1B 2EJUA 1GQYA 1YB7A 1USGA 1AA9A 1YB1A 2AKAB 5EJIA 4CQLA 3EQ6A 5KNDH 1V7QA 3CO0S 4FZVA 5DM60 1PDWA 4FMDB 2XYPA 1NQWA 1C3JA 3UK0A 3ZIAD 3GV0A 2V5VA 6NULA 2GSWA 821PA 2FVYA 3AHIA 2PQ6A 3ENZA 1AA6A 3PRHA 1G5FA 2CFCA 3ZLJA 4PM4A 4BDTA 4LZAA 4HP8A 2EOAA 3WWDA 2Y05A 1UPFA 3H83A 4GFDA 4CV1A 1AQIA 1CC1S 3K6KA 1EHIA 2VJNA 1C2TA 3KWMA 4IEEA 1JUDA 1ESMA 1L4UA 2JASA 4YRQA 2FZWA 3L43A 3TQCA 1JLLB 1P80A 5HKKD 3A9WA 2D7JA 2WZNA 3FHJA 5EL0A 3IQWA 4HWRA 2HJSA 3H5RA 2QRKA 3W6OA 2OEPA 1HE3A 5E9WA 5AKXA 2A58A 1ZEJA 2PSDA 2VAXA 3LP6A 1E3QA 1IHPA 3BDVA 3NOVA 3IUPA 4PTLA 3WNQA 3ASZA 3ZE1B 1OWPA 1VIYA 3ZR4B 1K5GA 4HAYA 3C5HA 1WCXA 3OECA 1VI2A 3GGCA 5FFMA 1T36B 1BPLA 1Z2CA 2AFIA 1P1BA 5SZIA 4BWFB 4CETA 1KI2A 3NHFA 1IXZA 1KYYA 2GCPA 4D4MA 3UXHA 3N1UA 5U1PA 1O57A 4N65A 3DQZA 1BX1A 1X86B 4BNZA 3D6UA 3EA5A 4MYUA 3AT1A 3KUDA 1JL3A 1O94C 1WDLA 3AVYA 3THOA 4MCJA 2PL3A 5AW3A 4QTTB 3O5AA 4UCWA 1WEHA 5K0CA 1S2LA 1NJ6A 1QO0D 3K5PA 2YVKA 3UWOA 2PDAA 5LCXA 4JI3B 3H9QA 4UZSA 1ZGZA 3T1HB 3CLUC 1B8OA 3BK1A 3D6NB 1ZNXA 3E9MA 2Z56A 4RFSB 1QP7A 3L4BA 1P9RA 4TN5A 4EP1A 4NCNA 3AINA 3EVBA 5ALSA 3DG9A 1KYXA 4ARAA 1PD1A 2C9YA 3T9FA 4HVTA 2LD4A 3FCAA 2NXNA 4C4PA 1AKUA 1ZUHA 2AFHB 1DCFA 3TYXA 1Q1GA 1RSZA 4OVKA 2FN9A 2HPHA 2Q3JA 3BIXA 1R12A 3IPYA 4GPBA 4M22A 3ZD9A 4ER7A 1P1KA 5DI3A