1FRQA

Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
296
structure length
296
Chain Sequence
HSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN:NADP+ OXIDOREDUCTASE)
publication title Probing the function of the invariant glutamyl residue 312 in spinach ferredoxin-NADP+ reductase.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 100
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1frqA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1frqA02
3G6EB 5H5JA 4Y9UA 2HMAA 4ZCMA 1R5NA 5FA6A 1NDHA 3CMEB 2QA4B 3CB4A 3J81k 3ZBTA 1N0UA 3G71B 3CC7B 1M1KD 1IJFA 1FNBA 1IB0A 2BGIA 1BX0A 1YJ9B 3OW2B 3CCUB 1OGJA 2X3UA 1JA0A 4U9UA 2B7CA 3JQPA 1FNCA 1EWYA 5TV2A 3ZC3A 1ZM2A 1GR1A 2BM0A 3CC4B 3MCAA 2XEXA 1VQ9B 3VO1A 5GV7A 2HDNB 2PIAA 3VNUA 2OTLB 3AGQA 3W2IA 2QTZA 4QFMA 1S0UA 1AMOA 1JNYA 1W2BB 4BPRA 1Q7YD 1FRQA 3E20A 2FX3A 4H9GA 3WYAA 4QHYA 1VQMB 2YWFA 2BMWA 3LRXA 1R5OA 2GQFA 3CCVB 3AVTA 3JQQA 3W5UA 4LBVA 3WBJA 1OB5A 3VNVA 4PC6A 4TMXA 4G1VA 1IJEA 1B2RA 1G7RA 2E1RA 3U6BA 1AIPA 4ZCIA 3ES9A 1F60A 2VZLA 1JB9A 1FNDA 3ZZ0A 3I55B 3B82A 1Q81D 2YWGA 1G7SA 1CNEA 3CRZA 1KK2A 4AF7A 3QFTA 5TR9A 2GPJA 1I7PA 4C0SA 1EP2B 3AGPA 2DERA 3CCSB 1KK0A 4M0LA 5TY0A 4YALA 3OJXA 5GV8A 1QGYA 4N3NA 3W2FA 2RC6A 2QTLA 4LBZA 3AVVA 4G1BA 1QVFB 1DARA 1E62A 3W5HA 1QUFA 1QGAA 3OJWA 1OGIA 1ZM3A 1TTTA 3U2QA 1GAWA 3A1FA 1E64A 1B23P 1G7TA 4EH1A 1E63A 3P27A 3B8HA 1VQ4B 1VQOB 1GO2A 2OK8A 3OZUA 3CCJB 4RJLA 4FWTA 1VQ7B 1KJZA 1UMKA 4NBSA 4G5GA 5EMNA 4ACAA 4TMZA 1VQNB 3WNCA 3MMPA 2QEXB 2BF4A 3CXCB 1K73D 3QE2A 3W2HA 4WQMA 3QFSA 1KQSB 3CCQB 4B4DA 2EFGA 4MYUA 1VQ8B 1YHQB 3CCLB 1QGZA 2XNJA 1KRHA 4LBYA 2DETA 3CCEB 2YWEA 4P6VF 2DEUA 1JJ2B 4RD3A 3P26A 1QFZA 4C43A 1KC8D 1H85A 3OZWA 4ZCLA 3WBKA 5KSWB 1QFYA 1W35A 2OK7A 2VNJA 4Q7JB 2PLFA 1G7CA 4YHBA 1R5BA 4IW3B 1D1NA 1EP1B 1WDTA 3G4SB 2EIXA 1TLLA 4TMTA 1FRNA 1SKQA 1U2RA 4B3XA 4LC0A 4RD1A 2BV3A 1KK1A 4N3GA 2BVNA 3W2GA 1SM4A 1A8PA 3JQRA 4PC1A 2CNDA 3I1FA 4M4SA 3LVBA 1W87A 2BM1A 3FPKA 4YAFA 4R71A 4B44A 4TMWA 1EXMA 3ZBUA 1ZM4A 4RD4A 3OZVA 1F20A 3QSYA 1K8AD 2R6HA 1Q86D 4HE6A 3B78A 1Q82D 1BJKA 1VQ5B 4B47A 1GVHA 3QFCA 3PENA 1BX1A 1EP3B 2ZITA 1VQPB 1M90D 1QUEA 2DCUA 3CCMB 3AVUA 1VQKB 3CCRB 3SJZA 3I56B 1VQLB 4NCNA 5THXA 3VO2A 3ZZUA 1TVCA 2BSAA 4RCZA 1NJID 1FDRA 4TMVA 5JBQA 4PC7A 4M53A 4FN5A 1CNFA 3WNBA 1DDGA 2J7KA 3FJOA 3E1YE 2RC5A 2NPFA 1D8TA 2VNKA 2QN6A 1HA3A 4YAOA 1KK3A 4M2LA 4ZGQB 1K9MD 2PMDA 1D2EA 1N0VC 1EFCA 3WY9A 2HCJB 4DQLA 3CD6B 1TUIA 5AN9A 3QFRA 1YJNB 2YWHA 3W5VA 4J0QA 4PC3A 2BN4A 1ZUNB 4Y9RA 4F7DA 2VNHA 1YI2B 4TN1A 1QVGB 4ZV4A 2BGJA 4ZGNB 4AF6A 1DG1G 1FNMA 1GAQA 3CMAB 3U6KA 3W2EA 3CPWB 4M1KA 4ACBA 5H59A 1ELOA 4HE5A 1QX4A 1QG0A 4PGOA 3CW2A 3V76A 2QDXA 2C78A 1JA1A 5DSZA 3MHPA 4RCYA 1QFJA 4DQKA 4UAJA 1OB2A 4RD6A 4MYTA 2B5OA 1QH0A 2C77A 1CQXA 4YAWA 1S72B 1BQEA 1YJWB 3AVWA 2BPOA 3WNDA 2VNIA 4RD0A 4B48A 2QMUA 1EFUA 2D74A 2VYQA 1GJRA 1EFTA 2CRVA 3VMFA 3ZZTA 1KTVA 1DDIA 3LO8A 1N8RD 4LBWA 3LYUA 2AHOA 2B7BA 4FK8A 1W34A 2OTJB 4YAUA 3WXMA 1YITB 1XE1A 2DY1A 1KD1D 4RD2A 3AVXA 1XB2A 5HXBA 2XNCA 4K1XA 4P3YA 1H42A 3CC2B 1YIJB 4Y7CA 4PC2A 3AVYA 1ZM9A 1J9ZA 4AC9A 1VQ6B 4B43A
chains in the Genus database with same CATH superfamily
3A1WA 4QGFA 1Z38A 5BVGB 2IS1A 1G2OA 4HVAA 3RS4A 2JLRA 5DHAA 2OHOA 4Y9UA 2A9OA 1LI7A 4R1NA 3KQWA 4JT8A 4E4YA 2IODA 3C6BA 2ZXEA 2UV8A 3ZPNA 2IHKA 1P8AA 3DSRA 4HB2A 2QTCA 3A3GA 1ULUA 4P92A 1BWQA 1CHDA 1L7NA 1R8XA 2I8CA 1CLUA 2QMZA 4I1YA 1IXYA 1ISRA 4P5DA 3AJDA 3REFA 3S68A 4G0OA 4IRXA 3ETDA 4U39A 4L28A 4U7GA 4TYPA 4YCSA 3EYWA 3QPWA 5A4KA 4K6FA 4N9QA 5DKFA 3ZZNA 2JI9A 3BD7A 2BCGY 1NVTA 3QI2A 4AJ1A 4QD3A 4GZ3A 5JY6A 2PGXA 3PX7A 5J58A 3QEMA 2H4JA 2RSLA 3CLVA 4Z49A 3BMNA 4UKDA 1OIWA 3KR0A 4EL0A 5DHTA 1D2CA 5BSKA 1PZGA 2IPXA 2R6DA 2FOIA 2Z3VA 4JDUA 3EZNA 4ZAZA 4LZOA 1UM8A 3A14A 3UWOA 2F17A 4ALIA 4XYLA 3NYRA 1GARA 1YX2A 2VBUA 2V7EA 3R3ZA 2NO6A 2ZRBA 3OIVA 1G17A 3S5UA 3HR8A 2QQGA 3UG6A 1G4HA 1IM5A 1VQ9B 4IV0A 1LJ8A 4XE5A 3KQYA 3DUWA 4L6CA 5HA5A 5E6UB 4ARIA 1TKCA 4BEBA 4PR0A 4PLWA 5BN4A 1I0IA 5GV7A 3R0VA 3UT0A 4J0FA 2BFOA 4ZOEA 1CY6A 3PVDA 1Q7BA 3ZK9A 2GJ4A 3L0SA 3ODGA 2W48A 3VSAA 3WGGA 4L4SA 3ZU4A 1FYVA 3HKEB 1SIOA 4RKEA 3R9XA 1LDBA 3HE3A 4G5OA 1XRLA 1QVVA 5FEMA 5EIBC 2G6BA 1L0BA 3IALA 6REQB 1AQIA 1OASA 2AQHA 3BQJA 2DX7A 3AF0A 4AW9A 3KJIA 5AM2A 1NXXA 1WHSA 2E1PA 3PNOA 4I08A 5H1YA 1TAHA 2HB6A 3ASYA 4R7ZA 4MRRA 1Z8HA 3JYQA 3DS8A 3NAMA 2FAXA 1UP7A 3LWNA 3BG5A 4C5BA 4RTJA 2D06A 2IDKA 2OQIA 1K88A 2W2OA 2Y77A 3LRXA 1WMBA 1YZUA 4NOJA 4MHSA 3R7SA 2XUHA 4DLRA 3ZGNA 1TU4A 2GFIA 1WIWA 3BD6A 4IDPA 1TO2E 1RVDA 3Q6MA 3RTGA 3OICA 2GETA 3HB9A 3OETA 3OI7A 1UZAA 3H9NA 2HNKA 2IXDA 3OPNA 4UC0A 4BGDA 3RF7A 3ZKWB 2LD4A 3RC2A 1MRNA 1X9GA 5BWCA 1VE3A 4K26A 4WY8A 4GNKA 3HLTA 4IDQA 2GO1A 5K0ZA 1N3BA 3OT4A 4RE6A 4KQ2A 5B53A 2ET6A 3G9QA 1TLFA 1U0EA 3BIOA 2QZ4A 2XVYA 3DO6A 3FVQA 3S2ZA 3F1LA 4KFRA 3IRUA 5ALQA 5JD6A 2J3JA 1WSDA 1FFCA 3STYA 2JI6A 4X7CA 3MUFA 4FHEA 4JJFA 2CF5A 4O0LA 4BLPA 4ZIRB 3ZYCA 2WHPB 2AOWA 2F1JA 4KXMA 3QW2A 5EEGA 2H4WA 1KEUA 4OAOA 1DAFA 3DYIA 4E70A 2A9FA 4QJIA 2DERA 3IRVA 5JS8A 4ITUA 3DONA 5JJ5A 4FCWA 4HRXA 4ZQIA 5KBYA 1M2VA 1Q2UA 3HR4A 3KJXA 3P9PA 3PUMA 1ES9A 2JNWA 1XTZA 3NHBA 4M1QA 4YLEA 4GMFA 3QU4A 3OLWA 3T4UA 3OW7A 1BFDA 1A8HA 1FQJA 1RJFA 2FWBA 3WLEA 2VHYA 1NQ5A 3U9LA 2C7PA 3W06A 3A1EA 5ARBA 4BNTA 4C9BA 4EG0A 3QEAZ 2B9VA 1UJCA 1RAIA 4OAPA 3UIEA 1GQOA 4MVCA 5A3SA 3R7WA 4M1SA 3RJMA 1DARA 4A8TA 4EFKA 1VHQA 4IICA 4B6OA 3WSTA 4DIEA 2QIOA 3IQHX 2VWPA 1QGAA 3OJWA 3GLSA 4KXUA 4DK0A 4RK1A 3TWOA 5KSPA 2ESRA 4Q9HA 5LP6C 4KR3A 5KHAA 5A3JA 4MR8A 1TZBA 1DDOA 1QVZA 3CE6A 1W1IA 4V0QA 2WE7A 3ESDA 1MGPA 4M9CA 1O6FA 1N5RA 1RXUA 5IMSA 3UHJA 2YC4C 4N9WA 1H93A 1ZVKA 5CTAA 1JFFB 1G7TA 3KL9A 1AV7A 1OLSA 1UKBA 3WK8A 1RT9A 3SXPA 1MVOA 1Z4KA 3TK1A 5BW4A 3H9GA 1TFUA 2PEYA 4PXYA 3WE7A 5JSYA 1CV2A 1PL6A 4GXRA 3JYOA 3AESB 4O2AF 1SPXA 2XBLA 1WPGA 2XUZA 3PP8A 4ZTUB 3RSHA 1K89A 4AJ9A 5LXTB 5CW2A 5I9TA 3CHYA 1MEOA 1Z7WA 2J3EA 4RENA 1UJMA 5HIAA 4OOVA 1S2GA 1M34A 3CZ9A 2BGNA 3DG9A 2SCUA 3DFKA 4GBED 3TS1A 3JVDA 3K0BA 2Q1TA 3NEPX 4A27A 1ZJWA 5KVCA 2FWJA 4P5PA 3N87A 4F11A 1YCHA 4K81B 5DM1A 1T1SA 3ONDA 3WYBA 4EECA 4X8LA 3N6RA 1Y4SA 3OJFA 4I4TF 5AJYA 1R00A 5E8RA 2XGMA 5A5DA 2AMYA 1MW8X 2D5CA 4JXXA 2DOKA 4NMXB 1Q17A 4PX3A 2FWAA 3H42B 1U2QA 2BEUA 2QVGA 1NKTA 2RHJA 1NNUA 5HFAA 4ECEA 1LS6A 4RTLA 1QIDA 2A9PA 4LXYA 4RABA 5HWSA 3K09C 3RTCA 1XRRA 5BPHA 4ZI3A 2YRWA 3ZE7A 2XNJA 5DM2A 1KRHA 1ML3A 1SHKA 1TI7A 2EDCA 4GPIB 4ZALA 1O0BA 2QN8A 2OCIA 2C8VA 1ORIA 1ZH8A 5AKHA 3CTAA 3EW9A 5DM0A 3WGTA 4N8EA 2OUIA 3DJFA 5FBVB 2D3NA 5JZ9A 3SKBA 3KKOA 1JPNA 4K9PA 3K6SA 5DSXA 3H0KA 2RHRA 4QICA 3RU2A 3T5AA 1BVHA 4ZZ0A 3ORSA 1KC8D 3ZCPA 3D6FA 4Q3OA 4NCBA 1PL0A 3ZZMA 1MJGM 4A8JA 1E60A 3DV2A 4F56A 1PJAA 3L46A 2EW8A 1CZKA 4N5MA 5CNKA 4AXBA 5KKNB 4R7GA 3KWMA 3VU9A 4RVDA 5JH7F 3MILA 3NFRA 1CQJB 1MA0A 1TZCA 4UBLA 4CKWB 1OAKA 1D5CA 2Q8PA 3PD7A 3NONA 5BQ3A 1LF0A 3QF7A 3YASA 5HKBA 2XODA 1G64A 5EMMA 1R5BA 1VRVA 5DGTA 5KYGA 4F5DA 2RI0A 5LFAA 1WZCA 2FMHA 2RFLA 1BRTA 3DAYA 1YQXA 4KRGA 2PIDA 1VA4A 4MWCA 1PI3A 3HWWA 1V41E 1CC1S 3RPEA 2CXXA 3PHCA 3MTJA 4NZNA 4M6WA 2YUTA 4PGMA 3FTPA 1WXFA 5ALLA 1TCVA 4BU1A 4D9GA 3G2LA 3VYUB 3UHFA 4PANA 2DAPA 4OHUA 4HY3A 5F4JA 2J9YB 2Z9DA 3CKKA 1LBSA 4QYIA 3WJ2A 4DGSA 1YNSA 3PBKA 4MGYR 5B36A 4YS6A 1SC9A 3COWA 1DNPA 4P80A 4R4JA 3VZRA 4ITRC 4N39A 3OQPA 1NJ6A 4S0XA 5JCJD 1Y1SA 2CZCA 5F64A 2FLVA 1ATIA 1T5DX 2IBSA 1YQUA 2IS6A 3AFIA 3MFYA 3ECCA 3DXXA 1C9JA 4JLWA 3ZOZA 4X65B 2FN8A 2PT5A 3E18A 3WDSA 3IS3A 1M2GA 1N75A 3QSYA 3PCXA 2IC5A 4RM2A 2BGRA 1QK4A 1LNSA 1Z33A 5B7PA 4J03A 2Y1LA 5IUJC 1E98A 2AN3A 5LUAA 4Q93A 1PHRA 3QMVA 1E7MA 3P45A 3WL3A 3PC6A 1J0EA 1CW2B 2BFWA 5I01A 2DBYA 1GILA 3A7DA 4TL7A 2A94A 4YP9A 3U9TA 5JQGA 2Y1EA 4OI0A 1K8ZB 2PAAA 4WK6A 2X5OA 2WU8A 1R6VA 3N8KA 1NUTA 2ORIA 1K86A 2ZRHA 2XTJA 5JZVA 5D6OA 2IPMA 2XCIA 3DL7A 2V98A 1QG6A 3KM0A 1WDKA 4P58A 4K9NA 2Z1MA 4IFEA 3GNLA 5AIAA 4H7IA 5EYPA 2O52A 1XL1A 3MN1A 3O4RA 1WSVA 1E1MA 1U9CA 1PG5A 3D4OA 3PYMA 4UU0A 4BBJA 2JD2A 2B2XA 2WILA 1KVTA 3JWGA 3EVGA 2DPHA 3SZRA 1BGVA 3VKUA 1M0EA 1YNOA 3FZYA 4MUIA 2Z5GA 3NBMA 3IAUA 3ESQA 4NPCA 3U37A 1U1IA 4XL9A 3VHQA 1W4BA 4PYJA 1G8KA 1T0IA 1RAAA 1RR6A 2WB4A 3D7SA 2J5BA 3QUTA 4RL4A 5DU2A 3RVQA 5L4LA 3KIPA 2ZIFA 1U1FA 4XFKA 3A3PA 3NBYC 4OHOA 1NM5C 1YZYA 2J7KA 2QT1A 5CFPA 3IAAA 1WKCA 4WNAB 4MQLA 5DB4A 2BGWA 1K9VF 2H00A 4R2MA 5D3KA 3T9AA 5CEJA 3RRYA 5JPCA 3AIIA 4IVQA 5C5CA 1UFOA 3HRHA 6PFKA 5FUXA 1E8NA 2TECE 2GA9A 3RUIA 2VF2A 2IXAA 4OHZA 1D7AA 2G09A 3K16A 1Y1PA 1RJWA 4FHDA 5JEEA 3ZDDA 2PX5A 4V0SA 3Q3IA 1Y81A 2I7XA 4KHZA 4BNVA 2UUAB 2W2KA 1UT6A 1LLQA 2BEWB 4J3NA 1TKBA 5KX5B 1ESEA 2J32A 4MWZA 1WSBA 1OE0A 3FDJA 4IWXA 5E0KB 1H2FA 2JFFA 2ZJ7A 5FQOA 2ODWA 1AKMA 3TX2A 1SY7A 3ABZA 2V6IA 4ZMSA 3NC1C 4DQLA 2HWYA 3L0BA 4GRIA 4JIGA 5HTKA 5IDVA 3UJ7A 3MWLA 4JJAA 1ZISA 2R1UA 4FXOA 1I5EA 2Q5IA 3FMIA 4TTJA 1IYZA 3ENNA 4JD5A 2C59A 2QD2A 3RVDA 1UC8A 1NBHA 3ZX5A 2WUEA 3QVKA 5IF3A 4S35A 1S9HA 2JFHA 2F8SA 1C3JA 4JI8B 3UJCA 1ZKDA 5I47A 1ZOLA 1AGXA 1W4CA 1Z39A 5E6SA 4TQ9A 2VNHA 4MUXA 1SO8A 3WGJA 1N1DA 3KYCB 4M76B 4Z86A 5LA6F 3OQVA 4AZVA 4OHRA 1NP7A 4IH1A 4XVHA 3WXBA 2P41A 2G88A 1ONPA 2ZQYA 3KQNA 4K9SA 2XF2A 1KI1A 1WU8A 2FRDC 2L0XA 2G08A 4IDCA 5KMGB 1FA9A 3QWHA 5A7FA 3D6JA 3NAQA 1VE6A 4GYYA 2BBTA 3KBOA 4W5OA 3PIIA 4Y9SA 3JWEA 3BMOA 3V8BA 4AMBA 1ODFA 2I34A 4OCZA 1UQUA 3BXOA 2YL2A 2ZUSA 1IZYA 3AI7A 4X6XA 2WTAA 3TQTA 3W8FA 1GCOA 4O4JB 4ZI7B 1TUBB 2AT1A 2ST1A 3I9OA 4HDMB 1VJTA 4RVOA 3GMSA 4UXIA 4D9CA 1JBQA 1UEJA 1LLCA 1P1BA 1ZK0A 3EC2A 4WVLA 3LHDA 4LNUB 2UXDB 3BORA 4ENQA 4RA6A 5DP2A 5CA1B 2XLBA 1TK2A 2OV3A 1Y3DE 2YIJA 5FRDA 1YA6A 1YQDA 3QVVA 1Z2OX 4RQTA 2ZCVA 5DSZA 2XMPA 3Q3HA 4FFRA 4YXWA 4TQGA 3T5CA 2QXTA 3WMWA 1AQYA 4KQCA 2VZ9A 2LZJA 3WKEA 4REQB 3TQIA 3ZTTA 2WJAA 1UPAA 2P5SA 3OY2A 1P75A 4Q0MA 3VSBA 1VL1A 3JZAA 4UM7A 1SQFA 1IXRC 1UUFA 3LC2O 1RWMA 1C3OB 5TXGA 1R9JA 3PI7A 1YJBA 1VLHA 1W46A 2FQQA 2IQ5A 3K4PA 3L3BA 4DCCA 4D9MA 3IAM6 4Z0HO 3SR0A 5H82A 1XF9A 5FL7D 1NMQA 1JSZA 3PFWO 4RM0A 1JQBA 1QRAA 2J07A 3W7VA 1K8YB 3B13B 3OMXA 1VFNA 1C7ZA 5SZIA 2LKCA 3PA8A 3F5QA 3RS3A 3ZWMA 2Z0MA 4BTLA 1UEIA 3ZBQA 5J3JA 5LZ9A 2QTHA 4GEGA 2CRVA 1Q7CA 1YJQA 4LJ8A 5B57C 1JHQA 2O4CA 2YJ5A 1RM0A 4MAMA 4JUIA 1KYXA 4LYAA 4BDTA 4XN3A 3AUFA 3OZGA 4KPYA 1HFWA 1RWKA 3JZFA 1V35A 4QYMA 2ATVA 1QBGA 1SVIA 2R8RA 4WKPA 4ISCA 5DYGA 4AT1A 2IDMA 4ILKA 2XDWA 1EEHA 2X76A 1KP9A 4XLAA 3T1TA 3NC0C 1GU0A 1LPMA 4P35A 3DEAA 1GCAA 2MJLA 1W34A 1F0YA 1T24A 4YAUA 2VP5A 4K6OA 1CIJA 2XY4A 4OBXA 5ALUA 4CDMA 3H18A 4MQBA 5FEUA 5HVNA 1LNZA 2DE0X 2X77A 2ZPTX 3G1TA 3OIFA 1WB6A 2A5YB 1I2ZA 2C3UA 4JP2A 1DX4A 3A9UA 2F6RA 4HDNA 4ZAFA 2R66A 3GUZA 3SNHA 2BFDB 4HDRA 3PXAA 5HIKA 2D3WA 1UMCA 3PB3A 4X3CA 2P3SA 4AY6A 1OLOA 1QONA 4RMHA 3CUWA 4B45A 1VOTA 3ITNA 4C6TB 1W0JA 1CP3A 4C4AA 5KDOA 1JIKA 3K1AB 4P4UA 3AY6A 2JGFA 2O20A 3LBYA 3LY9A 2LCIA 1A96A 1XJWA 1RBYA 2GN0A 3E2PA 3F9CA 3OFVA 4ZVNA 2WSYB 1O08A 1THMA 4MRPA 5K8LA 3A9VA 3WFIA 4RPGA 2QQ0A 4MTCA 2REOA 3G6EB 4N65A 3V55A 1V7ZA 3SFVA 3AUKA 1ONBA 4CMGA 4EMSA 1GZ5A 3PC3A 2BFMA 2BFCA 2GM4A 5G02A 1KXZA 5A1TA 1JIXA 4I1RA 1PKVA 3IP8A 3NKLA 3Q3EA 4GI3A 1WBJB 3ETJA 1Z7EA 1T8SA 2NUBA 1FY2A 4DILA 2VQFB 3ZBTA 3CC7B 3IP7A 3GROA 4HQFA 3CEAA 3MJDA 1XD9A 1KARA 1NYTA 5ADHA 2X4LA 3OOYA 1W36B 1I2CA 2EKDA 5EJEA 4EIWA 1RZRD 4LF7B 1BGWA 2R5FA 1YJ9B 2WJ4A 3H2HA 2ZW9A 4I5GA 3QLUC 3TSWA 3NTRA 3ND6A 4JLOA 4XX0B 2RB5A 4OK5A 5FTJA 5JTTA 3T1VA 5MDHA 3KB8A 2JGMA 3CM0A 1BXZA 3UT5A 1XGKA 4HAWA 2RHWA 4HWSA 1OHHD 1E7RA 1G8GA 3GLHA 4US2R 3QYPA 5I7RA 2Q49A 4R2LA 4UNRA 3EPPA 2OGWA 2GEBA 3EMVA 2HZ7A 5BYAA 2XGGA 4MJ7A 1U02A 1DRUA 3EUWA 5KNBH 1J2UA 2F8TA 3JQ7A 3KKMA 2P9FA 3ZV3A 4YRPA 1W52X 1YE8A 1VDZA 3FNGA 3F5FA 4QDTA 3VI4B 4EKYA 1KDPA 5GJBA 2FR8A 3SBOA 4JLSA 2XEXA 4BJ5A 2FUEA 2VHEA 3A3OA 4N40A 1ISHA 2HT1A 1U1CA 2VHVA 4ASUA 4QGAA 2HDNB 5F35A 1ZPDA 3UJAA 5DNUA 1SUSA 5ALFA 1E6CA 1P91A 3PT9A 4V0OA 1WX1A 1K6EA 3IBFA 2VJCA 2ZBUA 3PA6A 3QQ5A 3GA5A 4MUJA 4R16A 3F8SA 3QPBA 4U5XA 1UL1X 1EIZA 1PX2A 1AMOA 2OVBA 3KRTA 3A6GA 3L0PA 2UVQA 3O3OB 5BV0A 3KTAA 3UB4A 3ERCA 2O7RA 3BSFA 2NZYA 2NVWA 4IDGA 5HJ2A 2GHRA 1O6CA 5DHPA 4QOFA 2ID9A 3CBQA 3KAKA 4QXOA 3P9ZA 3GCZA 1SIWA 3K70C 1TEVA 4TXHA 2AUMA 3R7FA 1BO6A 4AXXA 3SLNA 1I7DA 3JASA 5ALDA 3LFUA 3A4LA 2QUIA 3I8XA 3RSQA 4DCPA 4YR7A 1U0GA 4MUKA 4LFAB 1AX9A 1CXZA 2ZRNA 3KSZO 4BN0A 2NU7A 2REQB 3R7AA 1THGA 2O0LA 5IT4A 2JCSA 4E7OA 5KEIA 4OYRA 1AJEA 1YJ5A 2IBMA 3WQQA 2IHNA 1G21B 3X43A 3AO0B 2NT3A 2E9SA 3HY4A 1RYYA 4L3WA 3H87A 4RVGA 5AJZA 1J99A 4RMGA 2GJKA 1A9RA 2ZUUA 3KKEA 2QTBA 3W9BA 1Z0AA 3T95A 3EWAA 4EZBA 4POOA 1N0IA 3A11A 3C85A 5M34A 1W25A 3KE8A 5A5FA 1DMRA 4R2JA 4W1SA 1RHRA 4PR3A 5AK0A 2XRZA 3T7CA 4ENTA 2XV1A 3E5NA 1KEEA 2WTMA 4LF9B 1OWOA 3DXYA 3W5BA 3CH7A 3GRPA 3I55B 5BW6B 1X7YB 4Q9KA 1TFRA 2NACA 4YPFA 2CMKA 3NWBA 3U62A 4X66B 1A1SA 4J2HA 1OA1A 3AVPA 2H18A 4XQ9A 4G36A 1OPXA 1QORA 1Q84A 3S2GA 2Z95A 3QEJA 3DE4X 4PO1A 5AVYA 2XMBA 3WTBA 3CCSB 1UQRA 2FUCA 4AL4A 2WHRA 3M3PA 2V0GA 1RADA 1K5DA 3AEYA 4ZKEA 1KK0A 1NQTA 1USGA 2GCOA 2HTEA 2VHQA 3C5VA 1I4TD 2QP3A 3CE9A 3Q98A 4XYEA 4PLPA 5CVJA 4AMZA 1RD4A 3MWEA 5IJZA 4RU1A 3SZMA 1CU1A 2EZTA 1YKSA 3RANA 4XQEA 1OFGA 4JX8A 1C9EA 1YBHA 3TAXA 3UPTA 3GP5A 3UHOA 1FU8A 1KC3A 1Z74A 4PE5B 1RWPA 5COQA 4CKZA 4CTKA 3CZ4A 1P2GA 3AVVA 1S1CA 3DEJA 3QUAA 2NUAA 2O1SA 4JQSA 4K87A 3TEFA 1E62A 1N2CB 4IOMA 5JAZA 1FF9A 5CLIA 4P4SA 1X2BA 4XM0A 2Q4TA 4YT5A 4CG2A 2A7QA 2Q45A 1KYYA 5ICCA 1GSOA 1CJMA 1Q1GA 5K3BA 4I55B 1Z47A 2IEBA 1ZINA 5JDIA 2QTTA 2A57A 1IOZA 1A50B 3HGTA 5K2MA 5KCZA 2OXFA 3PR1A 1H69A 2UYQA 4B84A 4AY5A 2CLLB 1U3WA 3HCAA 1RP7A 5DHSA 1R10A 2WZBA 3HBJA 4NHEA 4WERA 4CLXA 2XB9A 4YI3A 3SFZA 5K0CA 9MHTA 4QU8A 5AJHA 1IE3A 3V9PA 2N75A 1A5AB 3GG9A 5KW9A 2WINI 4EHKA 2IYSA 1UDRA 1L8OA 1UMKA 1PUIA 2O5CA 5BOVA 1N6RA 2OBLA 4DM7A 1WP6A 5B12A 4G5GA 1G16A 2O1WA 4V2IA 1W30A 5KOJB 3JAMA 4I7EA 1I3NA 1R6UA 1MORA 3CFYA 2OZVA 5KWVA 4EJSB 5FCDA 3W5AA 1BA2A 4GOND 3TXAA 4CCYB 4DPLA 1GUFA 1D1TA 5KJFA 2GKOA 3UAGA 5KPJA 5B6PA 4DNRB 3IMCA 3VZSA 5HZMA 4FFBA 3ZUGA 1U7ZA 4K6HA 5C35A 1OH7A 3CEHA 5CPFA 4EHFA 1TTQB 5LZ5A 3RABA 3L0CA 3L06A 3NP9A 3TD6A 3B2NA 3AFMA 2Q27A 3ZLTA 1C80A 2PUGA 4OBWA 1NQXA 4ZYTA 4CM1A 1KEVA 1KQSB 1Z6AA 1U8FO 3RUCA 3W5JA 3TZLA 5B7NA 3TFWA 2R8XA 3GP3A 5BSYA 1GGEA 1QKKA 4PZZA 2JZCA 1G20A 3GVPA 1XLTA 1DJLA 1HDRA 1ZJ5A 3I23A 5EIHA 4D02A 3PVZA 3S1SA 5C8YB 2A9QA 2A4MA 3N2YA 3GUUA 4PCUA 1VP9A 2HBZA 2FN9A 2WWWA 3KZKA 5C81A 2D4HA 3ZCXA 3WA7A 1Q1EA 4ZO4A 2PX0A 4L57A 4RMIA 5F7JA 4UPEA 2OBSA 2P1DA 4UW9A 3ZCUA 3L6OO 2QUZA 3OA0A 1L5WA 4PQEA 2B8JA 5DRYA 4ESHA 3F6BX 1NMZA 3C1UA 3N2LA 4P31A 2OZPA 1VPVA 1M34E 1LBTA 2WVAA 3MSXA 4QSHA 2Z2KA 1PQWA 1W35A 3R44A 2PWPA 3NIGB 2O2CA 4N0MA 2JARA 3IO5A 1UC5B 3U4CA 2OB2A 5KJCA 3QOWA 3FYUA 4CYMA 4RULA 4YVFA 4GVLA 3EZFA 2YYSA 4J75A 4C76A 1EP1B 1RWWA 3AF5A 4EJ0A 5CA0B 2WMOB 3GWZA 2UZ4A 3T7JA 1IWPB 5CHYA 5KNDD 1GNRA 5IK2A 1UXIA 1WV0A 4TVOA 3WBFA 2BGLA 3RAFC 4LC0A 2RB4A 3BREA 3ICEA 4PHFA 4D4JA 4OX9B 2GGSA 1XDGA 3EPHA 3DM9B 3NIBA 4LV5B 5KYXB 3C3AA 4RD1A 1SBIA 2AFRA 3AETA 1JKFA 4FD2A 3QBVA 4IV5A 1U81A 4P08A 1H1DA 4CMEC 1J97A 2AB0A 5CDHA 4UU7A 3S8YA 1AO3A 3IILA 4GDMA 4JB3A 4NULA 4DSTA 4FOSA 4WXRA 2JFYA 1OROA 2P3LA 1RHMA 3SVZA 4TKUA 1F8XA 4IIYA 1BHSA 1AY0A 4QBFA 2V6GA 3IPLA 2C57A 3I1FA 1XHLA 1Y7PA 2WU3A 3PYLA 4Q3CA 1QYDA 4C6SA 2D0IA 2JFBA 2QF7A 2Y93A 3ESZA 2Y1XA 4KO2S 3FPKA 4I5IA 4TXLA 4YAFA 4WN3A 5B4VA 1XVUA 5ICMA 2XCRB 3H9EO 4IDAA 4YAJA 4OPMA 3AEUA 1YL6A 2WJIA 5P8WA 3LA8A 5JXWA 4KMSA 3QBEA 5JBNA 1FTSA 5F52A 2H11A 3WO0A 1QH8B 1GPLA 1X7XA 4LRWA 2ZLBA 2NVUA 3X1WA 1GG9A 1T10A 1YFKA 2C4KA 3FAZA 3H5AA 3IUJA 3MJVA 2AC7A 4G4JA 3TD2A 2DB3A 1X7HA 2AFIA 2VUSA 4K9MA 3V6LA 1IUPA 4MW5A 1F38A 4LVOA 4IHJA 4EVIA 1EBUA 1DO8A 3KQPA 2H65A 2VP9A 3AM1A 4MQFA 2GEDA 2QX7A 3RQIA 2PYDA 4M1ZA 4F5EA 1R8YA 3I30X 4DGQA 1CEQA 1OFHA 1SU7A 3WIVA 1COWD 1NNSA 1SPBS 1Z35A 2VYFA 3DZIA 3ZW9A 1JE1A 3QLTA 1FUYB 5DYWA 4A0GA 3ZE6A 1SOMA 4OMCA 5CT6A 5JJBA 1K0FA 3F0TA 1Z5UA 1RWOA 4WESB 5FTNA 4CV2A 5BVHA 2CNKA 2IWHA 2OFXA 2IU6A 1KETA 3NBAA 4IMRA 3M34A 4DLYA 3PA1A 4G0ZA 3DT8A 3NNDA 4FQ7A 4JGIA 1JG6A 5DK4A 2CNLA 5FI1B 5KVQA 1GYPA 4ND2A 1MZVA 2P40A 1R27A 3PGA1 4H1TA 1OYWA 2F8LA 3ZU6A 1RIIA 4BY9E 3HUEA 2Z8YA 2YR0A 4JYCA 1DI0A 3ANYB 4V0LA 1H8HA 1PJ7A 4RIIA 4V0KA 4L8JA 5THKA 3FSGD 1Z0DA 3PQFA 4A4DA 5AI6A 3E1YE 2POQX 1Z0SA 4LX0A 4PSDA 2GWRA 3K32A 4G63A 1B3BA 1PYGA 2NPFA 1VI6A 2MSNA 4RY8A 2P6PA 1OT5A 4DDKA 4KQHA 4RZ3A 5CB6A 2C2ZA 1QANA 1JEEA 3KSRA 4V39A 1HA3A 3EG9B 5E2AA 2AFHB 4H7PA 4C3OB 3B85A 5CFQA 4QPJC 1C0IA 2I1LA 1RWQA 4FTWA 3VKHA 2BR5A 1FFEA 3AXTA 4P7KA 4UAGA 5AK4A 3QTTA 5FHRA 1I4OA 1ST2A 1LB1B 3F97A 1QQBA 2YCLA 5H68A 4PABA 2V0NA 2Q8NA 2EZ8A 1Z12A 1EGVB 4TXMA 1KO8A 2WWFA 4XB6B 4YQFA 5EJ8A 3TLCA 4KI0A 4X62B 1IM2A 1RQGA 5C5IA 3C4JA 3CVVA 4PG7A 4LK3A 5FI3A 3FHTA 3O8CA 3CZQA 5ALEA 4LKOA 3TBFA 4QEZA 5KYKA 3LKZA 3IR6A 3OPYA 3PJDA 3LLMA 2FI1A 5MHTA 4DQVA 1FSFA 2DPLA 2WFAA 1ZO8A 3ZWYA 2XAUA 4PHTA 1ISMA 2BAGA 5I6DA 4DR3B 1NBEA 1P2TA 1YB2A 3CLRD 3UJ6A 1KVQA 4IYJA 4Y9RA 1A9XB 2TYSB 2QS9A 4OG2A 3HU2A 5JARA 2Q3HA 2ZRLA 5AUPB 1LPPA 2IH5A 4J7XA 1QVGB 5LR6A 1FUIA 4UM5A 2A1UA 3T9DA 3ZWCA 4RTPA 2GBPA 4YWJA 1ZS9A 5JDCA 1WPQA 2IUFA 2OESA 2NYRA 2ZU6A 4HUJA 4NS1A 1X42A 5HGJA 1GAQA 3P2IA 4BWGA 4DZTA 3GEPA 3W8DA 3WLAA 2CVPA 1PJQA 2D2IA 3CX7A 2Q4DA 4FKZA 2VHTA 1D1SA 1B42A 3GJRA 1ETHA 4HN4B 5T8KA 2P5YA 3FROA 1WL8A 3IAM1 5JVDB 2O8FB 2QWXA 3NOOA 2WMDA 3M0EA 3RSFA 4PGOA 4CKEA 4DBLE 2QDXA 3I4LA 3LL4A 4HADA 5BMOA 1JA9A 4RACA 3CW9A 2WWTA 5IVIA 4H6VA 2QU7A 5HS4A 1TO1E 4B3DA 4EW3A 4CMCA 4YELA 3L5KA 3CESA 3MHPA 2AZDA 2M5SA 2P7HA 2V96A 5CLHA 1HK7A 4WAUA 4ANFA 3IJPA 1J21A 2CYAA 3PNYA 1OKKA 4M8KA 1YE3A 4ND1A 3A2NA 4AY3A 4YAWA 1P5ZB 1V39A 4D5GA 3EF1A 2R8EA 4MHOA 3R7DA 4EGJA 2HA4A 2EFCB 3T4EA 5H02A 3TCKA 4HZUA 4NENB 3VVCA 2X40A 3NH6A 3MRSA 2C4TA 2A9JA 3PT5A 4AF8A 3OQIB 5IAKA 3WR5A 6ADHA 1LZKA 4MW2A 4RPCA 2WFLA 1ZX1A 2HF7A 3E2IA 3RI3A 4J0GA 1T3ZA 3ZNOA 4KFSA 5TGDA 4Z4GA 2IU3A 4Y6GB 2H1FA 2PHZA 4OF4A 3X0DA 3VMFA 3Q41A 5ECGC 2JGIA 2PD3A 1P44A 3GC6A 2A1TR 2ZJAA 1UT5A 4OPOA 2M2IA 1TCUA 3VSEA 3TECE 3HI6A 1XEAA 3IOEA 2RGGA 3CLSD 5I5GA 4JX9A 1OBCA 1VPLA 2WUWE 4FK8A 4BN4A 4J1SA 3D1VA 5TARA 4EYOA 4D4HA 4WJZA 4DLWA 2DPMA 4NY1A 1Z2DA 3LRPA 4E5YA 4AI6A 3ZY2A 4CETA 1OZFA 4E08A 4N76A 3A6KA 3A8TA 1IHMA 1KD1D 3BBLA 1VIYA 3LHIA 4R6XA 4KREA 5BRJA 3O82A 3SZUA 3I09A 1EWVA 1PJZA 2IKQA 2KMLA 2OP1A 3KSUA 1WU7A 3DZHA 2OCGA 3ASVA 1Z29A 3CG4A 3ADKA 2QTNA 1SUDA 2J31A 3NU1A 2JS7A 2JLSA 3SIRA 5H81A 2IYXA 2VRWA 3GT3A 2R1TA 3QKTA 3FYSA 4OD0A 4OXQA 3SVTA 3S8EA 1GCUA 4IQFA 1WPCA 1MG0A 1WUKS 3M89A 2CLFB 1D2AA 3WZMA 5SZHB 4QG3A 2G83A 4MJ3A 1XDBA 3R4CA 1ZD9A 3CLKA 3FLBA 3KUCA 5HDQA 1U9YA 4CQNA 3QLVC 4WZAA 4OQXA 2E48A 2XA2A 1ADBA 1KZYC 5FBZA 1Y5MA 4CKCB 4NJEA 4JB2A 5A9TA 2H8GA 3AU8A 4BE9A 1KNQA 3ADOA 2AG1A 3SOZA 3QXJA 1VJSA 2ZYWX 3IV7A 2CWWA 3ZQUA 5KIAA 4GPBA 4F3TA 1R2QA 3B7GA 5DLDA 4XB2A 2ZYUX 2PSFA 4C7OA 2VJBA 2Z8XA 4NE7A 1CCWA 2EFDB 1SZJG 2Y68A 2ZS9A 4KXNA 2G63A 1NKVA 2VLBA 1XMOB 3GZTB 5KX5F 5JQWA 1QQ5A 2D13A 3URMA 1N2BA 1PWEA 1I2MA 1L8XA 2ZE7A 2LDXA 3JQPA 1MV8A 3B1ZA 3D81A 2XECA 4F6LA 2C2GA 3JYLA 4HDSB 2BI7A 1DUVG 1KDZA 1K3FA 1ACMA 4ID3A 5DBOA 4YONB 3OFNA 5JCPA 1IUKA 1Y5IA 4XSGA 3KHKA 3M6VA 3NTLA 1ZK2A 3SS8A 1K63A 2MYPA 3ESXA 1ECLA 1Z4IA 1JDBB 1V11A 2HJWA 2VHJA 2ZVDA 3GJSA 2RGBA 4GLFA 3HKCB 2OQRA 1ZUHA 3AEQA 4MIKA 2O2XA 2YFYA 4MIEA 3I6BA 2M9MA 4BFVA 4C0AC 5B2FA 1E20A 3P2YA 3C3EA 3PUJA 3W8NA 2G4CA 1WW2A 1DOHA 1ZN8A 2Q9AA 2OXRA 1T4GA 1RRKA 3G23A 3VR4H 2XE4A 4HRAA 1E59A 2B1JA 2BKXA 5LWQA 3TGWA 4IIEA 4XH9B 3BE6A 1AS3A 2OTLB 3EBOA 2PO7A 5EXPA 5CT4A 1GPJA 2W2LA 1NJ2A 2F62A 2OSBA 3KB1A 1TAUA 3I64A 2LUOA 1BCSB 1S9DA 2HXGA 3WICA 4IIJB 4EKEA 1G9TA 5D85A 2DUMA 1XPRA 3IOYA 2A35A 4I4IA 2GZ3A 4Q5IA 3LWBA 2XKAA 1SG0A 1SBTA 2Z4SA 4URZR 2HA2A 3M3DA 5K20A 4EX7A 2YYZA 4H60A 3DL2A 1NP6A 5LM3A 3WGZA 2CHUA 2C2MA 5E1BA 1WCWA 4CG1A 3L8CA 4D46A 2I9KA 4JUBA 1NT2A 4ZI7F 3JQGA 2VSYA 1Q1ZA 2IE8A 3A9TA 5HR5A 1KJWA 4TUYB 5IM5A 1P2VA 1ODCA 3GLHE 2FP4A 1V26A 2EFYA 3LUAA 4NATA 2XYQA 4PN7A 2YY6A 2JLWA 1NVKA 4JYPA 2QW0X 4A8PA 5AESA 2CDNA 4OHBA 2DM6A 1N77A 2GXAA 1B74A 2E6UX 3NETA 5EQJB 3UUFA 1GZ4A 3GJZA 4CXMA 4Q6BA 3HHPA 4F9TA 1G8HA 1SCKA 3Q7EA 3RIMA 2BFBB 4CMAA 5EWMB 4JI2B 4IFBA 4YNBA 3BFVA 4E3WA 2AEMA 4Y7DA 3T3MB 4GFDA 4WN9B 3LCCA 1P0PA 4GKVA 4TVSA 5KJ6A 4PFKA 1HEIA 1VKOA 1VDMA 3H9JA 4QNMA 4W4TA 3UMVA 4E7PA 10MHA 4JEMA 5C8DA 1B6SA 2JPDA 1FCJA 1LPBB 1TF2A 4BX9A 4OHYA 3CCFA 4GBGA 1O6ZA 3UO8B 3V4RA 1UJ4A 1FFXB 4EW6A 2P6NA 3RAEC 3AB8A 5DM60 4CQLB 4XWTA 4EDFA 3EC1A 2BZ0A 2IHTA 4WRRA 1CG6A 2J4CA 4MINA 1JQ5A 1L9KA 3ZCQA 5JBIA 1JHVA 1HDYA 3L84A 4D9FA 2ODAA 4YHHB 2YIMA 3P0RA 1PR1A 2QAIA 2EBFX 3CU5A 4UDOA 3GFPA 5ITWA 1JR3A 5IYZF 4HH4A 1UOPA 2B9EA 2R62A 1MAHA 4RLHA 5CT8A 3SPXA 4B35A 3H6GA 5LQNA 3FVWA 2X7JA 4E6PA 2WJ3A 3ZR4B 4HDQB 1DWUA 4RIEA 3RW9A 3EEOA 1W581 4GMXA 4B8ZA 4PZ0A 3LPCA 4RJJA 2XMQA 5I9SA 4UZUA 4KKXB 1Y5LA 3W5IA 3K6JA 1U7WA 3UWMA 1LH0A 3B53X 2YS7A 1THZA 1VL5A 3JZDA 1ZM3A 3G0GA 3OTIA 3QPAA 4MITA 4XPIA 3EZGA 5K1ZA 5ICEA 3AONB 3SMVA 2HBRA 3DKIA 2PR2A 1SB8A 4TZ0A 3DYBA 3MELA 5HE9A 1E3ZA 5D2CA 3OIYA 3G0DA 3V32A 2PZEA 4MKRA 1TGVA 4PNZA 1U8UA 1U2GA 2PXXA 4O6VA 4NNOA 2CMHA 5DIZA 2AOVA 3H11A 2CXPA 1QOQB 4K8OA 3RUHA 3V4PB 4HDKA 4GOKA 2RK4A 3FOZA 1OXTA 5CM8B 1F6DA 2DXIA 1W1UA 3E3OA 1KJZA 3OX4A 2H7CA 1DWOA 2C4WA 2ZRIA 1Q15A 4FDLA 3VTKA 4Q7LA 3ZCRA 1AGPA 4NBSA 5A2GA 5FO1A 4XQFA 4QQKA 1EZZA 5F2EA 3ZG6A 2CJXA 3FI9A 5K6AA 1ZU4A 3ROQA 2HW8A 2JIDA 3VYSB 4LOAA 3GNTA 4PFJA 2CBXA 2NO7A 3K92A 4KWIA 2GEJA 2FXIA 1A69A 1TYEB 4KTTE 5FNVF 3K15A 3CO5A 1ZCFA 1BS9A 1LRJA 1W8IA 4NX2A 5EP4A 4KTVE 3T3DA 1MPXA 4BO0A 3KETA 1Z6GA 4A03A 4YXWD 4QDZA 1S3IA 4G0MA 1W73A 4HH0A 4I3GA 5LYJB 1M8PA 1H4TA 2ZQ5A 1KQNA 4CLOB 4C4RA 3HH8A 1NT4A 4Z3DA 1VMKA 5BURA 1CYDA 2XE8A 3GG2A 2YZGA 1M67A 3Q3JB 2VP2A 3QKSA 2W6QA 4Y6OA 3MD9A 3V1UA 4D3YA 4YT8A 1HE4A 4LXTA 4Q4JA 1ORVA 1JT2A 4DKXA 4Y1FA 2C9YA 1W88A 2NSJA 3KOXA 1XEFA 1R50A 2CLHB 2IP4A 2B5WA 2H3HA 4Z53A 2QAJA 3ZXYA 2BR3A 4O5OA 1L4MA 1IUOA 1ZAYA 2LE0A 3SEFA 1H66A 3GD7A 3RUFA 1L4EA 4OBEA 5AHWA 2ZVPX 1P81A 1VTKA 4M88A 4UUNA 3U44B 1PL7A 3EFOB 3CUTA 3K0CC 2BOVA 3PPYA 3Q2KA 3QQPA 4OFZA 2YYYA 5H70A 2QLLA 4PQGA 2ZJ6A 4B2PA 1VJRA 1LY1A 4RW0A 1CFJA 5AXCA 4ENSA 2Q4RA 3FGOA 4XJTA 3UFXB 2Z2JA 4GX5A 3V9AA 3R3UA 2O7NA 1W2GA 3SBXA 5G4KB 2V6FA 3VISA 1CVLA 2ZJ3A 3GHHA 3G4SB 1XJ5A 2FPIB 4FSHA 4MS1A 3ZN2A 1IH8A 4GMKA 1DKNA 4FFSA 1QSGA 1RSZA 1NA5A 1NW7A 2PXHA 5IARA 4CT0A 4OQDA 3EH2A 2H1CA 2R8PA 3IKTA 2ZWMA 4Q00A 4EHIA 3DBHA 5HIJA 3KYDB 1QQ7A 4HQOA 3E9DA 5AJUA 5KAPA 2J7PA 3A7EA 4TZ6A 2JIQA 4YAIA 3FX2A 1G20E 3LNTA 1XMXA 2C2WA 1JQEA 4TLBA 3WG9A 5IKMA 5CK5A 3D4LA 1KO7A 1KSHA 2BM9A 2YZ7A 1JKXA 1W0JD 3A32A 4B8WA 4KYIB 1Q0HA 2JHCA 4IJ5A 3RKRA 1CY1A 1KIAA 3T5DA 4DCTA 2NMVA 1DWPA 3EEFA 4TLMB 1BEUB 1V2GA 5ESWA 4M4SA 2ZYGA 3LVBA 3GAZA 1DELA 1PGNA 1J5PA 3A4VA 1N3YA 4UVIA 1JTEA 1PVDA 1EXMA 1QZXA 2CFCA 3HJNA 4R1PA 3U3XA 1REQA 4DMFA 3H9UA 1W6UA 1F20A 2IWRA 3U4HA 4F21A 2GPNA 3OT1A 1JQ3A 1OXXK 4PZUA 3I9V1 2IX3A 4GM1A 3IA7A 2CHVA 4MRAA 3V8QA 4GRDA 2IU4A 1PTJC 2B3TA 4UE2A 5BNWA 4M86A 4D79A 4B47A 1WMEA 2X8JB 4EUKA 5JNTA 1GTG1 3BXGA 1E2BA 5TF4A 1CZRA 5AQ1A 1P0QA 1T2AA 1CERA 5C3MA 3B5EA 1AT1A 5CB4A 3GLGA 2PUHA 4X3PA 2ZTUA 2P35A 4MYHA 1XEXA 4Z4VA 5A8AA 5AO9A 2HRDA 5IKXA 5A3VA 3X44A 4ZDJA 1A7UA 1Z7GA 1WOSA 1VQKB 2PJUA 4OUKX 3KR9A 3BXZA 1W85B 2UUBB 2WG2A 1E1KA 1KSFX 4TS4A 2C8LA 3I45A 3S0JA 1S6YA 3HZHA 1ODKA 2VH5R 2YXDA 4XR6A 5A03A 3QUCA 1BU8A 5HTOA 3LH5A 3GRZA 4CG0A 2CYBA 3T7TA 2H2WA 4ZDIA 2EJTA 2IF0A 2IYZA 2OA0A 1OY1A 3KJQA 1CUUA 2EC5A 3M2TA 4YDSA 2GJ9A 1XRSB 4I55F 4Z8YA 2X86A 3OY7A 1KZ9A 5FI5A 1GEGA 1F51E 2KLBA 2RHLA 3I39X 3GYGA 2JLXA 1GGVA 2SKEA 5BQPA 2XVAA 5KTYA 2FQXA 1C7QA 3B1WA 4ASUD 4PYKA 2JFUA 5TQ0A 4D42A 2Z8YM 2JZNA 3R9KA 3TLMA 4C7MA 1QG4A 2FN4A 2C9MA 1ZGJA 1HOXA 3I6YA 3H83A 1XYGA 2Q2VA 3GGJA 1CS0A 1M1XB 2J67A 3EQ8A 4OL9A 4M2LA 3PNMA 4H27A 2AFIE 2YMMA 3IUQA 3V7AA 3ZGVA 1T1GA 1UMBA 2BY4A 2GCGA 4AJOA 2NP7A 2WKSA 1ZG3A 1O94C 3L5OA 1QU3A 3WA6A 1H0HA 2WIAA 4ARAA 4E1BA 4QUHA 4B3JA 4FNGA 1PFUA 3HSSA 4BP8A 1PGOA 4WZBA 3ZS8A 5CFMA 1G5IA 1M54A 5AP9A 3QFRA 3R6TA 3JX9A 2Y6UA 2GRAA 2F55A 4YRJA 1B0PA 3BMQB 2UYGA 4AD8A 4WA7A 1H9AA 3GJ3A 4AZ3A 1XZJA 2QAGA 3S27A 3ZI4A 5B37A 3N6VA 5LZ7A 3C4VA 1GFWA 4GE0A 4LMAA 3DOOA 5K6TA 3EGXB 4ZV9A 1U0OC 1O5TA 4FE7A 4BP9A 4CT5A 2QKYA 1H2HA 2XADA 2PEZA 5GONB 1VJDA 5E2IA 2ONKA 4E15A 2VBFA 3WKBA 5K0JA 2C0PA 5F4BA 1YI2B 3NW9A 5CNIA 3L07A 3DV9A 2YWRA 4JKYA 1X94A 4NJOA 1FLVA 5C8YF 4I4TA 5EZ6B 3EDMA 4R3NA 2JK0A 2JN9A 1T3TA 1DG1G 2ZBPA 3EVTA 2Z6BD 3HNRA 3W2EA 1GP2A 3REQA 4I8IA 2EX1A 3VRHA 2E7ZA 1J4AA 1ZW6A 3A0RB 3DB2A 3K3PA 3TEMA 1RWBA 5EY5B 1IONA 1IMJA 3GGPA 1CVRA 4HPWA 5BW8A 1XYYA 5ER6A 5HRUA 4EPYA 1G60A 1YB5A 1J09A 3R0XA 4MK4A 5AJVB 1AGYA 3LCUA 3BE8A 3LOQA 3TTWA 1ZMRA 1DTWB 3EXHB 4PBSA 2I2WA 3OF2A 3GAMA 3Q72A 5BN3A 1BIFA 4TRNA 1P17A 1H4SA 5AW2A 5EXXA 1U4NA 2JW5A 4YYZA 4KE9A 3B9RA 4BO1A 2CUNA 3MSCA 1AKYA 3O1IC 5CA0F 2ZOSA 3BUSA 1NI3A 1OB2A 5I3CA 5LOVB 4CL3A 3HFGA 4EUFA 1I8DA 2QDKA 2C77A 5JAHA 1CQXA 2G9QA 1E9VA 1A9OA 2C4UA 3TI9A 5F1OA 1U6IA 4HUQB 5CIWA 2FFJA 3G8CA 3HJBA 4BQSA 3JR7A 1NMYA 5CD1A 4RFSB 4QTYA 4DCMA 5IJ0B 3NCHA 1U8TA 3EXIA 3M49A 4XLTA 3WGHA 3FDIA 1KY5A 4KDCA 2O7SA 1AKWA 3T3EA 4CMBA 3GGDA 2FN3A 4F06A 4QPZA 2B8TA 2NO0A 2XUDA 4G5HA 4JJZA 3T7KA 2NUTA 2WT8A 4CODB 1W5FA 1PKEA 1D4AA 2LRHA 3P2OA 5AVKA 4BZXA 3GFTA 1GNTA 2PZFA 3ASTA 3W05A 1VLYA 1G5FA 1DJNA 1KA9H 1OVMA 1ZP6A 1Q22A 2Y1CA 4TL8A 4Y2SA 3RAJA 4ETIA 5A9RA 1V71A 2DR0A 3P0HA 2I3ZA 2NXJA 4RSGA 4XWGA 3NG1A 2YXEA 4K8RB 4YUVA 2DFTA 4W63A 4MV9A 3UUEA 5EZYB 4K9KA 3ZE9A 4LK2A 2PBFA 2QLTA 3O1LA 1TZMA 1DJQA 5LJIA 4XKWA 3FOAA 3ROZA 2KQUA 4D8VA 1ITZA 3KUDA 1DKMA 3UMJA 3MQ2A 3Q3GE 4YJ3A 5HXBA 3VXKA 4P22A 1SNYA 2J1LA 3FWPA 4R7TA 4YX9A 2BTQA 1L4BA 1Z4MA 1T6XA 3STWA 1G1MA 4LOIA 2C1ZA 3H2JA 3IE2A 4MPJA 4OLHA 2OEPA 1TQ8A 2H06A 4YASA 1DE0A 1S89A 2W6NA 3WB9A 2IOQA 2H1VA 4WXEA 3FBTA 5K8VA 2HWWA 4A2WA 1QLWA 3RROA 3W9UA 5K3AA 5IKEA 2JJ1A 4FZJA 4LZNA 4XDZA 1EZ4A 5BV2P 2EJCA 1CUVA 1UANA 4D44A 4OGFA 4B9AA 3ESAA 4ZCPA 1YU9A 1XXLA 2AYZA 1HLGA 2P67A 2GHTA 2PZMA 4KGZA 4F84A 1HR0B 4KXLA 3DHYA 1QHEA 2Q0SA 2G4LA 3LJKA 4OGGA 5EZSA 1TJ3A 3RS5A 5JOQA 5JYDA 1M6WA 2PTGA 5J40A 2RBGA 3IQDB 5HCUA 2PKYX 2X4GA 2R11A 1P62B 2ZDHA 2P9JA 5GMOA 1GA4A 4QUIA 3T5TA 4PVCA 4EJFA 5F3WB 1QB7A 1KO5A 3TQQA 2VSNA 4LXHA 3GYBA 2BSQA 4BFLA 4OOXA 3I9MA 3ISTA 3NTUA 3ZXIA 1VB3A 1RYZA 1JPUA 3SXJA 1FMTA 1WVGA 3AR5A 4G1EB 1ULAA 4DSZA 4YMVA 3NT4A 1IRXA 1M72A 4FILA 3S2YA 1ZGAA 3VYTB 4BFZA 2QYTA 1YH3A 4PLYA 4Y98A 5BN4B 1W1WA 3DDCA 1ZHFA 4CEHA 3AJAA 3PCRB 4TV8A 4BZQA 4FMDB 3U4MA 1AG9A 1A04A 1ZH0A 4KEAA 2AJCA 1EE2A 2HL6A 2PV0A 1UP4A 4L74A 5CDFA 1VXRA 2B4QA 4AURA 4DCJA 1TA4A 2NUPA 1XRJA 5FBHA 1CD5A 4Q39A 3K0HA 2D8AA 2ZREA 2PUTA 2HGZA 4HS4A 3IXLA 5HCNA 2B1RA 1I4WA 2P8SA 3FDZA 2FZVA 4RAOA 2AD1A 3EMBA 1MTOA 2WZPP 1B0AA 2EP8A 2PWBA 2NGRA 1WHSB 4P4GA 4WZAE 3IXQA 1G9SA 1F06A 1WSWA 3DOUA 4A1OA 1M6EX 5GJVC 5DO9A 2OD2A 2FEAA 5DCLA 1JDZA 1AKRA 3I9NA 4ZWNA 4K2AA 2XQIA 3WRXC 4RTKA 1L5RA 4KBGA 2PIAA 1P1FA 2DY0A 3VHXA 3IEKA 5J2UA 1VPDA 4AYXA 4G0VA 2FYTA 3SNKA 3WIBA 4RK5A 3RWBA 1PVOA 2CCGA 2J33A 5T64A 4DT1A 5CMLA 5AVJA 1Q0TA 4YREA 4CTJA 1S0UA 2JCYA 5CR9A 4QGBA 3A6HA 4DIMA 2P4UA 4DJFC 2HLHA 2D5BA 3RK1A 3CR8A 2NIPA 1NPDA 3E20A 4JHLA 2D1RA 4R68A 2VRCD 4YT2A 2QP4A 4IZHA 3VO9A 4N0DA 4BAUA 1DG9A 2W42A 1BVUA 1PO7A 4FBGA 4Z1OA 5CVUA 3M7IA 2CKDA 3EIWA 1JFTA 1R0LA 1JDPA 3G02A 5JVDF 1EB8A 1WQ3A 4G0XA 2W5UA 2X58A 4RMJA 2ZR9A 1IY0A 2V7XA 4BX2A 1NPTO 2BD0A 2HDOA 3QMMA 1Y3CE 2I4NA 4LBVA 1Y1QA 1KMCA 3D6UA 3JVIA 3L6BA 4UHKA 1PK7A 4YTEA 1YVPA 3NHUA 3AR8A 1PZHA 4Y9DA 5FTMA 1TEXA 4PLGA 2BRUC 4MQ5A 4TLAA 1VC2A 2IQIA 1SCJA 1SVMA 1GPH1 2DC1A 3FNFA 4K5QA 1M2VB 3U3RA 3UAZA 2VSFA 2PTHA 3UMSA 4IGKA 1RQPA 3P4XA 5E7IA 1YFJA 5BWMA 1Y34E 3A8KA 1UT8A 2FMUA 2AFVA 2CHGA 2BZ1A 3I2KA 2BZSA 1WKVA 3QY0A 4P84A 5D1HA 3WKDA 2Q3CA 3ROFA 2D0OB 2R00C 1WQ4A 4Y2UA 1W0KA 4YROA 1QHHA 4UTVA 1PWHA 1XNQB 4QVAA 1H8HD 5FWAA 2BEVB 5CDTA 4DR2B 1BRMA 1Y0RA 1WY7A 3W8EA 3BICA 3AGPA 1E9RA 1H0SA 1H23A 2ID7A 1UJBA 4BXOA 1D6SA 1T9GR 2YZ2A 3JTMA 3QVWA 2HJ9A 4MR8B 4U0JA 4C2TA 1JXAA 1KQPA 3B7PA 3PA2A 4DCOA 1J2TA 3UTDA 2YJGA 3OJCA 5GV8A 2G72A 2RIRA 3CLUD 3O7MA 4RM3A 4RXMA 4ARCA 1YZVA 4N3NA 1OLSB 1R16A 1ZL2A 3ETLA 2XH8A 1PJRA 3IODA 4LXQA 4MYSA 4C5AA 2UYCA 4GOXA 1QHSA 2VF8A 4JCOA 3ETGA 1U2EA 3FIJA 3HEMA 1NSYA 1YDFA 3ABIA 1ECBA 4FLMA 3EVCA 2WAXA 1MUUA 3EIOA 1B2LA 1Z28A 3IBGA 3TINA 1GLVA 2C2KA 1TD1A 4IQ8A 1L9XA 1P6XA 4AP9A 1VG0B 2PUCA 2WUGA 2WLSA 1JUDA 3I0MA 2RHGB 1NBMA 4HNRA 3NIDB 3HFJA 4PZAA 2Q5OA 5JJKA 1M34B 1P4RA 2VHXA 3MMSA 4LVUA 5KOHA 1J24A 2RH4A 2SCUB 1UJ6A 1YCGA 3ONEA 2IL1A 2P3QA 3H84A 1BS1A 3NDPA 4PHGA 4R8KA 1F9AA 4Z9FA 3IOMA 2WWHA 2P27A 1UH5A 1B6GA 3A36A 1UC9A 5ITZA 1N2ZA 2F1KA 1TQDA 2XD4A 3IBTA 3FNEA 4Z4RA 4OTZA 3VSCA 4OVKA 4DR4B 1JSCA 3OZUA 3OD1A 3JAWA 2FPKA 2PBZA 3KTOA 3ST7A 2BEUB 2CWDA 2OE2A 3WVNA 1OJ7A 3AP3A 3E9CA 4M9RA 1K7EB 5LZ8A 3ZQ4A 4BGIA 5EUMA 1E2DA 2V03A 3OM9A 3EW7A 1L7BA 3HRKA 4YB8A 1JKIA 2AGVA 3IQEA 2FPSA 4OI1A 3T06B 3O6VA 1PYDA 3B6EA 4E32A 1JWLA 2GKGA 1T2UA 5HHTA 5EIAA 1JR3E 4LJ6A 4OH7A 4YJFA 1NXWA 3ZDBA 3FKSA 1CTQA 2D1YA 1QGUA 1L7XA 3H9QA 4NXMB 3EOAI 1T9BA 1Y7TA 2M6SA 2C00A 2XUKA 4EM6A 4P1VA 3K6SB 1AHIA 2CXUA 2IK8A 3H5RA 2W90A 4UOEA 3QE2A 3BQMB 1DADA 4DMKA 1JU3A 3TUZC 4WHMA 3RY8A 4ZJYA 2XUPA 1M7HA 2VLIA 1VL6A 3EIXA 1YT5A 2ZT7A 4HD8A 2XXAA 3K9QO 4A8JB 3T7DA 4INZA 1U1GA 1NBOA 1CK4A 2WRZA 3K0AA 3NV9A 3B1XA 1XTBA 2AOUA 2FFQA 4MXDA 4HX9A 3VU9B 3K53A 1OKKD 5JJLA 1E0KA 1MCZA 1KQGA 3DUFA 3A6DA 4TYYA 1T9DA 1BHO1 1SBQA 4YDRA 3SX0A 4KKUA 2BW0A 3RCBA 3VV2A 1JAZA 2OM2A 4YJHB 1RLIA 1JDUA 5DBGA 1NX6A 2VPQA 3L0DA 3F7MA 3L6RA 4RD3A 2WV9A 4TWJA 3JD3A 3HAGA 5M29A 4DMLA 4GXNA 4M6WB 4LY6A 3WLFA 2HV8A 2JAXA 4N3AA 3L6CA 1NAIA 1DBPA 3WZLA 4L8GA 4D56A 2XNDA 4ZCLA 3OCUA 1Y1RA 4X45A 3HCBA 4Z4FA 3RIXA 4EPTA 4QYIB 1HPLA 3K4QA 2GAJA 1BMTA 1NUHA 4IIJF 2FDRA 1NIJA 5TDHA 4D9NA 2R7NA 1QM5A 3LWDA 2NSDA 1HRKA 1XNJA 2VBCA 1GRNA 2ZZQA 1USUA 1Y3AA 1U2ZA 1J39A 2C9OA 2ODNA 1G98A 3C15C 3C6ZA 3LUHA 3QVGA 4FGZA 4REMA 3ISJA 3VR5H 4CCAA 2AOXA 4URHA 3TTUA 4JNCA 2LW7A 4DLTA 4KP7A 2G36A 3TLGA 3CP2A 2EKZA 4JDPA 2IXEA 1L6IA 1PD0A 1UAGA 4BQIA 1RYMA 3RC8A 1E1QD 1K6JA 4NS4A 3PFKA 3U60B 2AMVA 4D1YA 4RKQA 4YCLA 4MGHA 4ER0A 3W2GA 3N8IA 1F14A 3OWHA 3WAJA 3B9BA 4BJ6A 2V54A 4EP1A 1I5OA 1U6KA 4K05A 4BMDA 1II8A 2LR0A 3INNA 4KN9S 3N05A 3E5RA 1I6KA 1M83A 1Q83A 2BFNA 3ABQB 1ZCZA 1EDOA 2VL7A 3T1QA 3TTXA 2J85A 3FXAA 3L7BA 4YMGA 1QC5A 1HE5A 3HN7A 5JQGB 3LXUX 4MIOA 4QOGA 2B98A 2QM3A 2QD3A 4RORA 4R71A 5EP2A 3UG7A 4YUXA 4OYLA 3JQFC 3OHSX 4FFNA 4RD4A 1P7ZA 4YJKA 1NVBA 2H8KA 1B73A 2Q9UA 5EYPB 1YUBA 3ZY6A 1BGXT 1MAVA 4B1FA 4EPVA 3L4JA 4ZT5A 2WTXA 4O08A 1RYDA 3GZ4A 3PRKE 2FPPB 4FBLA 1XIVA 3PENA 2O8VA 4DANA 1PD1A 1X1QA 1CB7A 2ZWVA 3B3JA 3KLNA 3UM9A 3MMZA 2KWIA 2R7AA 5I7VA 1U0TA 2WEKA 3U7GA 1BXRB 1TPZA 2CN1A 4KPUA 1BNCA 2OBMA 1EK5A 1ABBA 3P0FA 1FE8A 1I6WA 1X1DA 2ENWA 4DC9A 1E43A 4Z4ZA 5BT8A 3IEIA 2E37A 2WHQA 3DQPA 4AMYA 4BE7B 4DRZA 5THXA 5B1EA 3AIKA 1UIRA 2EXXA 5CVVA 3QG5A 5F5XA 4RCZA 3OFND 1YJXA 4DV3B 2W2KB 4KNWA 4ALNA 1US8A 2PGDA 3RVSA 2BMVA 1TM2A 2FMIA 4M53A 2MSDB 2R5WA 3C1TA 3G59A 1X2EA 3WDMA 4TYQA 3L8EA 2J3MA 3IJRA 3PUXA 1AZWA 1M6VA 4Z54A 4U6SA 2P9HA 3CH5A 1D03A 4UZSA 3D2AA 2VAVA 1USWA 3UJ3X 4II2A 3N70A 1D1QA 1QGDA 2HKIA 3QV1A 4MW9A 1T0PA 1NJ5A 1Z5NA 2ZPUA 3L04A 1N57A 5E9AA 2DLCX 2NO4A 1PNTA 2FMXA 4G97A 4JBLA 4HAXA 1OX5A 1H6CA 3GJ4A 4XVRA 3CLHA 4UJ3A 1T6ZA 3DBRA 2FW9A 3ZTWA 4EDHA 4E94A 3PGXA 3L1KA 3DW1X 1K9MD 3U7JA 4Q24A 1KI8A 5E6SB 1Z7BA 2DJIA 4CF4A 2DT5A 3GLGE 3RF6A 3LP6A 3WLQA 3EFHA 5AXDA 1XZMA 3EBLA 1BYUA 1EI9A 1MB3A 2HK8A 3ILXA 2HYDA 5BVGA 2FSUA 2FG7C 3JQ9C 2XBUA 4PHCA 1PQYA 1OFUX 2WYHA 4TXNA 4UXHA 1W0CA 1W47A 3DLCA 2ZR8A 2DPXA 2P3OA 1I4EB 1YJNB 1DQYA 1SXJC 5BQOA 2YWHA 2ASVA 2HT6A 3BKWA 3KXIA 4M0EA 4L22A 3P1JA 1JAXA 3BMOB 3BTVA 3HCOA 3ZDZB 1RVV1 2P6UA 3H13A 3GR6A 5J3OA 1CUJA 1DOZA 4NOMA 5M3BA 3D5TA 2OV8A 3RRJA 1TL7C 1YS6A 1Y8CA 1YHYA 1RCFA 2QSYA 1DKRA 4G89A 2J9RA 3PHBE 2D9RA 4JUDX 4R2KA 5LYJF 3ONUA 1B4DA 2PWAA 2IEYA 2IH2A 4RA6B 1E9SA 1ZH2A 2F48A 2YMPA 5B58T 5L7YA 4Z7QB 4A82A 1ZMXA 3KTDA 1HDGO 2YX1A 1BFKA 3GF4A 2CVZA 3LHSA 7AT1A 1C8BA 2Q3FA 1HEUA 3CR7A 1RFLA 1T34A 4ER6A 1U0NA 2X41A 1XTSA 4M1KA 4DYHA 3EGEA 2ZJ0A 3EZ6A 4RETA 1E4OA 5FOTA 5MGNA 1KOJA 1CIPA 2Q5LA 4EO7A 2NZ2A 4TTAA 3BGIA 4HMPA 4XARA 2ZE6A 5K0BA 2FQWA 3OU6A 5E0OA 1CY2A 5EC8A 1VGVA 1ZUNA 4FYJA 3V76A 1L4GA 4X95A 2G4VA 4OP3A 2W4QA 4WZBE 4W8OA 2L69A 2ISCA 2YVAA 3M5DA 5EJAA 4EI2A 1R9MA 3L1JA 1KOLA 3RG2A 4D57A 2QPAA 5KHLB 3LPDA 4Y6RA 2XJ4A 2YHAA 5E6UA 1EG7A 4IF6A 3OOEA 1J5EB 2POCA 3AY0A 1JR3D 1I6LA 4HWTA 4HSGA 3L82B 3NWPA 3L1IA 1F4VA 4KO8A 2QZPA 4NDZA 2XZOA 1E9BA 1H3FA 5TMPA 4HNSA 4MGKR 5BRNA 1L2TA 5EIXA 4RD0A 1XCGB 1NUUA 2CFRA 3GJQA 2D74A 5JHGB 4DIUA 4E2YA 1VGRA 1K08A 2B1IA 3ZCTA 6REQA 1PJ6A 1Z0KA 3QEKA 3DVQX 1GJRA 3CF6R 5T3UA 1WR8A 3CNBA 1H4QA 2PKQO 1FDUA 2LIVA 3BE5A 3H5IA 2OKGA 1HDCA 3S2UA 4HDNB 3P52A 2XX3A 3EXG2 2PBRA 4FOTA 5EKTA 4HDRB 5FXMA 3QVSA 1UMCB 1C1DA 4YRZA 2PVCA 1UJ5A 4E5NA 4F4DA 2GTIA 3O38A 3FNBA 4DDUA 3DAHA 4DLZA 2EBHX 3EC7A 1IJBA 2A0XA 2IUTA 3OIUA 5D3ZA 2AH5A 1N6OA 3A31A 4C0LA 3ZKWA 4GZMA 2EW1A 2ZAYA 1QLHA 4MW0A 2Q7OE 3EPLA 3MCTA 2QJRA 1I7LA 2ZSUA 2AMFA 1EJ0A 5GPBA 1NV9A 1SXIA 2H9IA 3R75A 1HF3A 1K6IA 4MWGA 3RHTA 2R1ZA 4EKDA 4ZMRA 2BFCB 1WJGA 3Q9UA 5AKXA 3NR2A 1YZQA 4OAQA 3TKAA 4QA9A 5EVJA 4BB9A 1Z83A 2GJ8A 2VJPA 3UGTA 2FHPA 4NBUA 3IOBA 5HM8A 2XXJA 1BS2A 4WCFC 4EPRA 3FPCA 1EX1A 2FLWA 2VDQB 1OD6A 2ZS8A 2OHGA 3AI3A 5EZYA 4RLSA 4AC9A 1AGNA 1IBRA 1TCBA 5ELLA 1XA3A 1VRWA 3ANMA 3C5CA 4OXKA 5KZMB 4L1KA 2I6GA 2WQZA 4G0WA 1IHXA 2XCQA 3GA0A 4H3KB 5CXXA 4ZVOA 1FVFA 2NZJA 2GEUA 4PYOA 1X77A 4FMCB 2WP8J 4MEBA 3B1JA 4UPVA 1IHOA 4A73A 7ADHA 5KNDH 3S40A 1NI5A 2F1RA 1C41A 4NZ9A 1V9LA 3IKJA 4IKPA 4QM6A 1K97A 3DMDA 2E4YA 2I3AA 3OEYA 3RG8A 1PJ5A 3WMFA 1IFXA 3UT5B 4AUKA 4CN8A 4Z3OA 2OL4A 3NWEA 2GBCA 5HZGA 3CMEB 3GLHB 3PFGA 3WJAA 4D4GA 1AMNA 4YGYA 3TAHA 1DGQA 4TRJA 5FFMA 5K4AA 4HAVA 3K0SA 2Q6LA 3MLEA 3JQ7B 2WTEA 4W1RA 4EQ6A 4QDKA 4PAGA 4EELA 3EAFA 3LRTA 4LGCA 1QO7A 4N6GA 2VJMA 1DLIA 4RQAA 3GRYA 1ZI9A 2XI4A 4ZEWA 1KE1A 4JCCA 4ABYA 4E03A 3B6IA 2C42A 1BW9A 3OO1A 4RH1A 3TH5A 1WUYA 4DPMA 4JP1A 1L7QA 2MR5A 3H17A 4CM9D 4N4AA 4UUQA 2YBDA 2H08A 3C8UA 3T38A 4JXZA 4ML3A 1IN5A 1HZZA 4DF3A 4JLKA 1H9CA 3DPUA 4PYRA 5TE9A 3DMPA 2PANA 2WU0A 3Q40A 1EWYA 1VLJA 4JC0A 4OB8A 4OOFA 3K5HA 1GRVA 4YAGA 3JWJA 5EGNA 4R41A 3QJGA 3CIOA 3KTAB 2I8LA 2VZEA 1I32A 2C3OA 1JR4A 3KL4A 2C4VA 1I0LA 3QUQA 5IAGA 1RJGA 1UZLA 4PICA 1ESDA 3DL4A 3K9FC 1LK7A 3FUXA 1KYWA 2FN7A 2J7PD 1R4ZA 1C1XA 3H4TA 4HOYA 4QTUB 3DE6X 3BIWA 3M1LA 4JFRA 5GONF 5KYNA 3GRCA 3JASB 1PFGA 1O97D 4LJ4A 4YJDA 5K0TA 3RT7A 3IB3A 3HDGA 3AGQA 1U4SA 1ZI6A 2C9DA 2NU7B 1U4OA 2PRIA 4KLRA 1OWNA 3V8NA 4H31A 2FSSA 3C7AA 3KB6A 1Z26A 4FGJA 3H05A 4OGWA 5TJ9A 5DDIP 3VTFA 4CNQA 4E09A 3NBKA 1E9FA 2A5FA 1TM3E 2YTZA 5CX1A 5DTMA 1M0SA 2FY8A 4R98A 1HKUA 2OCBA 1EFKA 3LU1A 4RSHA 3RYHB 3TRJA 2XUQA 3M8KA 3UMCA 1AUPA 3AY3A 3F78A 4ENUA 2RAFA 3P71T 4FDVA 4EYKA 1KFBB 4H9GA 1OYOA 1O9BA 1J2YA 3Q3AA 1LPNA 1TKRA 2CV1A 4QUBA 3UUWA 1KEEB 2XDQA 2Q1UA 3IQXA 2HPZA 1GAEO 4MP3A 4N12A 2M6LA 1U99A 1LBHA 3GUHA 4RY9A 1FVHA 2CHQA 4R01A 3UBMA 1YUNA 3PC4A 1ZR2A 5CDFE 5JD3A 1YAHA 2VKTA 4L76A 2BF7A 2AWOA 3AHCA 3HXLA 4MKXA 5TNXA 4XLCA 1OB5A 1HLPA 4F4UA 4ZTZB 3QA9A 2JLBA 4G1VA 1NZFA 4LJYA 4ZDWA 3UYKA 3V42A 3HCEA 5E1DA 1X92A 2R6FA 3QG1A 5IZ4A 5HNKA 1A1VA 5K5EA 2C7VA 1AIPA 4ZCIA 2GCOB 2YN4A 1GG8A 3PLAE 3MWEB 5ES4B 4V0NA 4ZGBA 3TIVA 4NI5A 4U7WA 4G23A 1GAJA 1O5OA 4OMDA 4ZZIA 3FH0A 2PZJA 1U28C 4QTTB 4KL8S 4RIGA 4AN1A 1A5TA 3LY7A 4BNZA 4DWJA 1G0NA 5KYWA 1GVNB 5FYDA 2DFDA 2NUAB 2R96A 3Q1LA 4QOHA 1LV7A 1ECPA 1HLFA 4GT1A 5CURA 5CDUA 4IZ6A 2V6JA 5CFNA 4DJ5X 2Y1DA 1LW6E 4ZQCB 4P4SB 3GGGA 4N8DA 4F3RA 1AH2A 1CRLA 1AHNA 3G7NA 2QZ9A 4YCAA 1M33A 2E82A 3MGAA 2D62A 5DGDA 3WKCA 5CG2A 3HKDA 1ZJ6A 4FHGA 1O1YA 2E1BA 1OWMA 2H9YA 2VJKA 1JMVA 1RQXA 1TO6A 1ICEA 1NJ1A 3VAZA 1V8ZA 3LG2A 2GCIA 4BHTA 2YV5A 2ES4A 2WPDA 3IJ5A 2LP4Y 5EZYF 3DHEA 1IC6A 5EP1A 3FYCA 6NULA 1VA5A 2DWOA 5JASA 3C87A 3UT6A 4GF5A 3W9SA 2ZG6A 2B20A 1SHUX 4ZYVA 1LPOA 2V7PA 2HK6A 3EHDA 1XEWX 4OMFG 5TEWA 1QUFA 2WK1A 1S3GA 2P2GA 3CV3A 3NI2A 5FA8A 3VNAA 4R9RA 2WQ6A 1UFQA 4HNHA 2HBYA 1IU9A 2F2TA 4W1QA 2P2DA 4TWZA 3ZY5A 3IBYA 4D2IA 2XB8A 1UDWA 4JP5A 4XGKA 2ZRMA 1RLMA 1VECA 3BHMA 2DWCA 1U7XA 2DBZA 2NO1A 2EKQA 2H2AA 4F2GA 2AEEA 1DU4A 1W9HA 2X6WA 3G0IA 1H2ZA 3FYDA 3REGA 3A27A 4HUTA 1A9QA 1XQVA 1E0SA 2R60A 4FFBB 2IOYA 2WM9B 3ZHZA 5LQAA 3CCJB 3ZD6A 4BNYA 4RDJA 1RI2A 1JV2B 1VQ7B 4P82A 1P7CA 3MM4A 3IAHA 4LGYA 3K9WA 4BAGA 3BCHA 3BHJA 5LIRA 5IFLA 1V1JA 2BUAA 1I9GA 721PA 5I7OA 1QJCA 3WIOA 4NBWA 4RIFA 2KLHA 1TYDE 2ZEJA 4RY2A 4KV9A 3GVKA 4M22A 1G20B 3ZV4A 3PFIA 3IBSA 3SIPA 4ACAA 1Z5VA 3N5CA 1MABA 1KMQA 3F73A 2YVQA 3MGBA 2LDBA 3HSYA 1R9GA 4N5LA 1NJ8A 3Q7IA 1RPTA 4PRYA 3CRQA 5CXUA 1HG0A 5B58C 1M0WA 2O48X 3QXXA 2ZZEA 4PYNA 1O57A 4L9WA 3FCYA 2G77B 2NO5A 5E7QA 2II6A 5I5EA 1FYEA 4LDQA 4B6SA 2RARA 1W2HA 1ZXLA 1WDMA 3J7AC 5A4AA 2CE7A 4OGLA 3MTGA 1NBME 1ZWKA 4BEJA 4RWEA 2CL7X 2JJQA 1M2KA 1UWKA 2QN2A 5L4SA 3Q15C 3D2CA 4EI7A 5CXSA 1C9KA 1QGZA 2CJWA 3WQHA 2JGEA 2GBFA 3AR4A 2D7DA 1T9HA 2VHZA 3ZD7A 1LV8A 2Y0PA 4J1TA 2O14A 3FYUB 5BSVA 1QTQA 4DR6B 5KX5A 4LC1A 4OJQA 1XN4A 4P0PB 2FXVA 4Q1VA 2C7BA 5ETJA 4R2WA 5FUVA 4LQDA 4QLOA 4D45A 3FFWA 4ME6A 3R7LA 4PX2A 1OWPA 3NHLA 4C7BA 4M9UA 2QLFA 2QR3A 3E5MA 3TRKA 2FDXA 1U9IC 3LUPA 4IUDS 1JEYA 2ZIZA 3V7YA 5B3JA 3F47A 1IN1A 1U3GA 2BM8A 3AETB 2JFQA 4NOKA 1RC8A 2QBYA 2OOSA 3QTBA 1OFTA 2IPLA 2O8DA 4BEVA 4BLQA 1SKUA 4M0PA 3DTVA 4N03A 4YFYA 1KJ8A 2IZ1A 2ZYVX 2O0JA 3DGFC 2W8ZA 4QYSA 5DHQA 5M04A 4TKUB 2H1HA 1RBZA 1W29A 3X1YA 5GOZA 3SYRA 4EHHA 3M70A 4RK0A 1WDTA 3N1UA 4X6LA 1U7DA 4H4EA 5IFKA 3L8HA 1WRBA 3KYCA 3JYNA 1SKQA 3FSRA 3LXRA 1F6WA 4JJ8A 1SXJE 1UF9A 4M0UA 3RFXA 3AEUB 3F6YA 3WK9A 4CM9A 3NEYA 1Q3KA 3S6JA 4EY4A 3HL0A 4GBJA 1XA4A 4ICIA 5C3UA 3WLKX 1G55A 5CM2Z 1X7XB 2Q5FA 3KKKA 3PGKA 3INYA 4G1UC 5T7BA 2XYHA 1BEEA 4EEXA 3DF9A 2AFIB 3DTNA 1WB4A 3LYAA 3PXEA 4QT0A 4YRKA 2Z5LA 5K45A 4GVXA 3RD5A 4IVRA 2WU1A 2WSBA 5A2QA 2C2HA 3THOA 2VO1A 4IHJB 1O5IA 2HA7A 4ZI7A 3H3FA 3PEEA 3CNQS 3D3KA 3DA8A 2JJ1D 4MQFB 4U7FA 5DTEA 4F92B 2C1EA 4JYMA 5DLYA 1YLOA 4I50A 3LDUA 4K6GA 2PZ8A 3ZBUA 2EQ5A 4CQMA 1U04A 1CJKC 2AK2A 1E6LA 2R6CA 4MI1A 4G65A 4BQEA 5BVHB 1TUEA 3AFOA 4KVGA 1ZIDA 3GEHA 2XKJE 3TIIA 1SIUA 3CX3A 3AXSA 1Q77A 1Q7GA 4NSNA 3ZWVA 5K9ZA 2B4AA 1H6DA 2FRXA 1MTZA 2G1UA 4JGBA 3G2PA 4O1HA 2CLIB 4D8TA 4AZWA 3SC6A 5JALA 1KZHA 4MMYB 4N01A 4HEHA 5D86A 3KQTA 3NKFA 4OREX 1NIPA 3PRJA 3GK3A 2YJNA 1KBZA 3ILHA 4RTRA 4DNFA 4LDZA 3GLTA 2C2XA 2X9GA 2BKVA 2OBYA 3LDHA 4AO8A 3SJZA 3I56B 1Z5WA 3WZ2A 1DSSG 1R3DA 4BLTA 7MHTA 1CIVA 2XCTB 3LDGA 2WJWA 2BSAA 1NMXA 4ARBA 2BHRA 3T9BA 3X2SA 1D2MA 1FDRA 4UQOA 4B3MB 3WDLA 3ASSA 3P9IA 3KVNA 4H7EA 5TGTA 3VAAA 4CU5A 1O6GA 3H97A 4BB0A 1D1PA 4H6WA 5G1NA 5IYZA 13PKA 2BL4A 1ESNA 1R74A 2HV9A 4MQ6A 2NU6A 3ONNA 4P3PA 4KGXA 4AULA 1PZMA 4F97A 1JSXA 2J3IA 2VDUE 1T36A 2C1XA 3FZNA 3P0JA 1P1JA 5F2OA 1AUXA 3OPYB 3SJPA 3IIIA 1RACA 3SYTA 3TIGA 1KK3A 3R76A 2PZAA 1IQRA 2SKCA 2QVCA 2B1GA 1ZK1A 1H3NA 3RKSA 1Q20A 3I5MA 5HEKA 4ZJPA 1NOJA 1UDCA 4KIGA 1D2EA 3MHTA 1DZ3A 4FCCA 3HJCA 4F6RB 2V65A 2HCJB 3OPOA 2MWMA 3GVCA 3IURA 2GFQA 3AUJB 3TQHA 3AHHA 1QH9A 1QIIA 4EGFA 3KJGA 3VBCA 1YR3A 2Q0HA 3LOPA 5DHFA 4KE7A 4LW8A 5DXJA 1JTFA 3KQUA 1EFHA 4PCAA 1KZ7B 3F6SA 3QBDA 2FSVA 1SIBE 3D7NA 2J5XA 2ZKLA 4JP3A 4LTMA 1CNMA 3KQSA 3T54A 4R8LA 1RYFA 5DCUA 3AUSA 3CZ5A 4RELA 1KPIA 3QA3E 1J2RA 1W49A 2Q4BA 3WWEA 4H3SA 1L1RA 4F7DA 2MYNA 1Y6JA 4CKEB 1Q91A 1ZD8A 3ZYZA 4G0UA 3BGDA 3O8LA 2DFLA 2RHCA 3G85A 4PG6A 3JQDA 1CUZA 2XCLA 2GF9A 1NULA 3CPHA 2O23A 3O8OB 5COBA 1L7PA 2HJGA 3MTBA 4KLAA 5EP3A 5FNVA 4DMUB 4XRGA 4YRMA 1VIVA 1NVVQ 4FGWA 5IYQA 2VYVD 1NVXQ 3Q8WA 1DBWA 1XZKA 4J0JA 1VSVA 1Q92A 2EZ4A 1X9HA 2X0IA 2DWUA 4GVPA 3A70A 3AL3A 5I4CA 3W90A 2VK1A 4ACBA 1UD8A 1OR8A 1Q7RA 1WDWB 1HE3A 2PRKA 4HP8A 3RLFA 3ZV6A 5HSGA 3SK0A 2CL0X 1W0KD 5DRTA 2A0FA 3TO5A 4DE5A 1TUGA 5B1YA 5LDGA 3RWMB 2O3TA 4HZUB 4Z99A 5DTQA 3EDRA 3H2SA 5IASA 4NESA 4HATA 4LYJA 3AR7A 1ZVJA 2EFEB 4TRMA 1JJAA 2E6KA 5DCYA 4C2BA 2HNAA 2WFLB 4G4SO 4MDHA 4KFUA 4KXFB 3JD2A 5DI3A 3ZQKA 5C5DA 3OQMA 5I9BA 5FOSA 5CFRA 1PBTA 3BB4A 4RCYA 3EOBI 5FLYA 3THYB 2C83A 3MXOA 1IB6A 4B83A 4L0MA 4NMMA 1