The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
118
|
sequence length |
371
|
structure length |
371
|
Chain Sequence |
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase
|
source organism |
Homo sapiens
|
publication title |
Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb |
molecule keywords |
Aminomethyltransferase
|
total genus |
118
|
structure length |
371
|
sequence length |
371
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.1.2.10: Aminomethyltransferase. |
pdb deposition date | 2004-11-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01571 | GCV_T | Aminomethyltransferase folate-binding domain |
A | PF08669 | GCV_T_C | Glycine cleavage T-protein C-terminal barrel domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Aminomethyltransferase beta-barrel domains | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Aminomethyltransferase beta-barrel domains | ||
Alpha Beta | 2-Layer Sandwich | Gyrase A; domain 2 | Probable tRNA modification gtpase trme; domain 1 | ||
Few Secondary Structures | Irregular | Aminomethyltransferase fragment | Aminomethyltransferase fragment |