1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
3TFIA 1PJ7A 1XZQB 1X31C 1XZPB 1WOOA 3GEEA 3GEIA 3AD7C 3TTGA 3TFJA 1WORA 3GEHA 1VRQC 4PABA 3GIRA 1NRKA 3A8IA 1V5VA 1WOPA 3TFHA 3ADAC 1PJ6A 1WSVA 5L46A 1VLYA 2GAGC 4P9SA 4PAAA 1WSRA 3A8KA 1PJ5A 2GAHC 3AD8C 1XZQA 1WOSA 1XZPA 3GSIA 3AD9C 1YX2A 3A8JA 1VLOA
chains in the Genus database with same CATH superfamily
1RT5B 1G1XA 4X4OA 3ILJA 3MI7X 2PT0A 4DR3F 3W8GA 4IO9Q 2ZEJA 2MQNA 5HQMA 3EDQB 1PYOB 1IKVA 2DYAA 1RISA 3BGLA 2C2RA 5HMXA 1O51A 3PJWA 2H4YB 2CG4A 2LEPA 4CWBA 4GTDA 3M9MB 4PABA 2JEJA 1DQ8A 3Q24A 2DEJA 2YU9A 2PA8L 4KGMA 4KKOB 4HT5A 3CCJB 1YZ7A 3BYRA 3HOVC 4P71A 5KT2A 3DCAA 1EZZB 4A4JA 1KMHA 2CRVA 2EK1A 4HE6A 1FVQA 2HIQA 2OAUA 4RW8A 1CQMA 2QTZA 3CCRS 3I5CA 2HHTA 4DN9A 1SBRA 5B09A 3ISZA 1WHWA 2HGMA 4PUOB 4XD7A 1VLOA 3GTQC 2HFSA 1EKRA 2CJQA 2Y3PA 1TWHK 2P8TA 3I0SA 2FIUA 4LBPA 2Y0SD 1RAOA 2AV5A 3V76A 2CW0A 4DXLA 3ZZZA 5HJYA 3ETMA 2DGWA 4G65A 2CKWA 5C3EK 1SMYA 3P96A 4UOGA 4KH1B 4QFMA 1RU0A 3TTGA 1MN9A 3DDNA 3CMAB 3CVKA 3DRRB 1TKZA 1B3TA 5IT0A 3PCOB 2LYVA 3PX6A 2BJDA 4PPZA 4R5PB 1RCXB 3A13A 3D1OA 4ID5B 1UMJA 1DJ0A 4A47A 2DR5A 2P3MA 5TMCA 3BY2A 4QWBA 1I51B 4CDIA 2HYIB 2W7PA 3EGNA 4LF4F 1L0WA 2JA5A 4JI6F 1G51A 3Q8PB 4TY8A 3ADAC 5HJXA 2QEXS 1C0UA 2YKMB 3M2RB 4ZITA 4RD2A 2KM8B 2OBRA 1U1KA 1N36F 4USIA 2CNLB 2VG6B 4ED1A 3W5ZA 3PYEA 3MR3A 1SKRA 5I3UB 2C4UA 1QE1B 4FXVA 1X9SA 1NDHA 4NCNA 5HK4A 2DNPA 1WTFA 2JL9A 4AE5A 4DV0F 5IYCK 1QVGR 3OL7A 2HHHF 3GILA 4W92B 5KW9A 1CULB 5IOLA 2RMLA 1GMUA 1S1UB 2YWWA 3ZBUA 1G7CA 1GNKA 1QY7A 2M52A 1M5OC 2VNJA 2BV3A 4A3GC 1G7TA 3W8PA 2PGCA 2AZ3A 3GG1A 1YHQB 4X4SA 3GQBA 3BGRB 4EH1A 5M5XK 2JA7A 4DQQA 3TFHA 1YZ6A 4B3SF 3OEHA 1PC4A 4ZPAA 4KM8A 3R5JB 4MIWA 3P4UB 1WF0A 3QT6A 2HNZA 4WJBA 3TX8A 1K83K 1JLAB 4P6VF 3OHAA 1Q8IA 5D78A 3DLBA 2FHKA 4OP7A 2BEFA 3NL0A 4W90B 4IKAA 3EZUA 2VG7A 2V4JA 2QA2A 4X62J 3IBFB 4LFCJ 1I6HK 3VGSA 2V94A 4I7FA 1YJTA 4DV3J 2C5BA 1TWGC 5KFYA 2R92K 3S15C 1FRHA 4AVZA 1U2RA 1IM4A 3LP1A 1GMVA 2F40A 2E1CA 1CC7A 1S9FA 4FS2A 2OPPB 4M5DA 4C8NA 2FLPA 2X51A 1V0FA 3QGHA 3HK2A 3GYGA 4CQJA 2XZOA 4BC9A 1RTJB 4IYQA 3W2VB 3S0XA 3C3LA 1KK0A 2ZL5A 2CAJA 5IK2A 1RWNB 4B3RJ 4V1Ak 4IQMA 3G87A 1BXNA 1HWLA 2PDAA 1YI2B 2RIJA 2BF4A 3G9CA 5F8GA 2HVZA 2GMLA 2Z2YB 4G1VA 2HQ3A 2VNKA 2HVEA 2NYIA 4Z4WA 3KUHA 5GAGU 4RDKA 2UXDJ 5K20B 2MZRA 3MMCB 4P25A 1IBAA 1WP6A 4F36A 1E3ZA 1I7PA 3FMBA 3PXGa 2LQ8A 4B9SA 1LK5A 5J2QB 3GTMC 1NJID 2QMXA 4LREA 3H0GC 5HANA 1CJUA 1IR1A 2Z30B 2QE7A 3CJ0A 1OMSA 1JJ2B 1JX4A 2E1RA 1H73A 3O5TB 3T56B 3CXCB 2NVQC 3CJ2A 1AUDA 3BJYA 2BABA 1JWWA 5FDLA 1GMWA 4ILLA 1BUXA 5C25B 3FCVA 2VUMA 1TL5A 4JI8J 2I0XA 2A0FB 1NBEB 5ETMA 1FTCA 3M9OB 3GTOA 3PW0A 3JXOA 3PFEA 1MSWD 4EYIB 4JP8A 3AOCA 1JLGA 2IYGA 4JI3F 2JJ1A 4Y7NC 4DR1F 1WC5A 3T6JA 5J1EB 4ES2A 3CTRA 4C8KA 3O2IA 4B43A 4OIRA 3GTPA 3AH6A 3MAQA 4ID8A 3CB4A 4DEZA 3QFCA 3IGNA 3TAMB 3JSMA 3DRXA 4B3FX 3FRZA 4CO3A 3H59A 2I5JB 1XEZA 4M1KA 5F8IA 1RB0A 1IHMA 5F41A 2AHOA 4RNHA 3V6HA 3TZYA 4II3A 1N08A 3DYAA 1UVMA 2CQPA 1EHWA 3SCIE 4RD1A 3J7A1 2BGJA 3HF5A 2R6HA 3KUEA 3L7OA 1BD6A 4IOCQ 4NLTA 1K73T 4YY3J 4DR6F 5ADZA 3I5BA 5KT4A 4N56A 1UA1A 4X62F 1N07A 2HNDA 3SSSA 3LOUA 3IC1A 5LMNJ 3GLJA 3I55B 4ED7A 5I42B 1JLQB 2QJ3A 4G0VA 2XS2A 4R25A 2W4PA 2XC9A 1S9EA 3ZC3A 5DZ6A 3IPJA 1FEHA 2GO8A 6FD1A 4RD4A 1KVKA 4RW7B 4RNNA 2ZXIA 2LP4A 1G3OA 3RW6A 3D9BA 2HG4A 2DY1A 1FD2A 1VQLS 2JA8C 3S16C 1KC8D 1JXEA 4WKRA 3OEPA 5KFWA 4RBUA 2DNOA 5LOQA 3QT8A 5E33A 5LSLA 2BX6A 2Q66A 3M8RA 1Q53A 2K3IA 5KFKA 3R97A 2F4VJ 4DL2A 1GEHA 1WC0A 1YITS 4DV5J 2KTQA 3SV3A 2RGRA 3BDPA 4USTA 1VQ8B 4TSFA 4WP3A 1GXUA 3U27A 1VFJA 1TUGB 4G5GA 4R8UB 1Y1VC 3FBFA 2BE5A 1JB0C 4TLQA 3D7SB 2VOPA 3VWSA 1DTQA 2CG8A 2HMIB 5LJ3Y 5KFCA 5T14A 1S59A 2NUUG 3ET6B 3WBKA 4RW6B 2ROGA 3PV8A 2PIIA 4URGA 2YWGA 1QAIA 1TWFA 2O67A 2EW9A 2DO0A 3AH5A 2D41A 1NH8A 2ZDOA 5FL7A 1X5OA 4NRTA 1FDBA 3VNUA 4G1QA 4O3SA 1CEZA 3AD7C 4P5AA 5EWEA 2J9EA 2C2OB 1R8HA 5IFMA 4G7OA 4Y9RA 4JI8F 3ZZYA 3W5YA 3LANA 2NVYA 4HYKA 3T1HJ 2R7UA 4CZCA 5JVHQ 4MKVA 4QWDA 4ECUA 4WE1B 3AODA 2BMWA 3HHEA 2LLZA 2NXNA 3CJRA 2O5IA 2XG8A 4I2QB 1T03A 5H9EJ 1SFOA 3H2VE 3GYXB 3QO9A 4Y2CA 1QAXA 4CLYA 4C2MA 3Q22A 3H5UA 2GFFA 1S1VA 5KFRA 2KWAA 3GTKA 4KTQA 4RU9A 1UWAA 4DJBA 2MTLA 3OZWA 4QVJA 4E8UA 3W7BA 1SKUB 2B6AB 1QG0A 4F7VA 4R71A 3QNWB 2VYQA 1TWAC 2HFZA 5M2RA 4JYAJ 3AA8A 4C3JC 2CW5A 4HIZA 4I0WA 4GO7X 5F4OA 3ZO7A 2V31A 5DDOC 3DOKA 3PHEA 1PJ5A 4YY3F 2RF2B 1SH2A 1R0BG 1AIPA 3IGVA 1EP4B 1S76D 1ULRA 3FC9A 1NJYA 3OLAA 3PRVA 4I67A 4FNHA 5DLGA 1R9TK 1TAQA 4P2SA 2IIHA 1HWIA 1U1MA 3OR1B 4TY9A 1P9QC 4EWTA 4ZHRA 4OZ1A 5LMUF 2WHOA 4NXNF 3S2DC 3KDOA 4KB7A 1ZM4A 4M53A 1T9WA 4OYAA 3EICA 3E51A 1I1GA 3C66A 1QLNA 2OI2A 4DDQA 2QIFA 3HVTA 3D6MB 3OXLA 4EEYA 3CCTA 3K2YA 2F4VF 1NM2A 3CT9A 1S1TB 2ILZA 4GVBB 4DV5F 1RLCL 5K8PA 4NLSA 5JJBA 4KO0B 3ISXA 1Q5VA 2QSFA 1FNMA 3K5PA 3CRZA 2CFAB 3JQQA 2JRSA 3NOGA 1IQ0A 1H3DA 2ATLA 3PO3C 4LF8J 4BS2A 3N9UC 1FDNA 2CQBA 1EIYB 3CD7A 2CA9A 4K1XA 3QE2A 3BGUA 1EP2B 5DM7Q 2C5HA 2OHDA 3PW2A 2HRYA 3NWGA 4MFBA 3TRGA 3DDYA 1RDRA 2JEIA 4B9TA 2HCJB 3DLGB 3IN5A 3A3GA 1HNWJ 2N4CA 3KLVA 3S2HK 2HHSA 2ZUFA 3T1HF 2XCOA 3MCSA 1F3FA 3VR1A 2X85A 4RCYA 1QUFA 4XLFA 3G4SS 3T02A 1KR4A 5E3CA 4IRDA 2DH8A 1EJ7L 4OYWA 3GG0A 3GV7B 4U7CA 2WW4A 3LW5C 4LF5J 4B9VA 5KG6A 3CMEB 1WG1A 1RKJA 4A3IK 3HOWK 4ZJQA 2IDEA 1CJVA 3U6KA 3ONUA 4BWJA 3ENWA 3C19A 4ZVRB 1WEYA 4XLHA 3NGSA 1N54B 4PC2A 3W5UA 1C1CA 1V3ZA 2YNIA 3EPGA 3DC2A 3QFRA 1E6VB 5KG7A 3GIKA 2I1LA 1ZTWA 2P5VA 2QLWA 2KG1A 1T95A 3RR8A 2RH3A 1U6FA 2KKHA 4U95A 4H4MA 4OV6A 2D3NA 4LRBA 4OYBA 4JYAF 3M9NB 3GTJA 1HBOB 4OLPA 3RJMB 4XORA 2DOGA 3VVUA 1X31C 4KKUA 1XN9A 1MU2B 1ICEB 2LKZA 1U1NA 3A1YG 3FDSA 3K7AK 3FPKA 2UXCJ 4DUTA 1FX0A 1VJWA 4KFBA 1IBLJ 1VIOA 1X8DA 2ZBCA 2CQ1A 4RJVA 1YBAA 1BWEA 3R9LA 4DV6J 4OX8A 2C28A 5KFPA 4F8RA 1N06A 3GIIA 4PQUA 3OTOJ 1I3OB 4KR0B 4C3MA 2D3UA 3OR2A 4ILRA 4DV1J 3IG1B 2XMUA 4YN3B 5ETQA 3D5MA 2OFHX 3FK4A 1DBDA 2A2DA 4QV2A 4NXMJ 3LPEA 2EG1A 1R8PA 1T6YA 3UNYA 4X4RA 4FZVA 7FDRA 1Z2LA 4G1BA 2DGXA 2QC3A 4Q8EA 2LU1A 5KT6A 3ISNC 3V6KA 1FXLA 1XMQJ 4PXCA 2DK2A 4MEYA 2L9NA 1D09B 4ED8A 4NZ6A 1U09A 2LQ9A 2XMMA 2HGNA 2ZZFA 3G71B 3M7VA 4WFXA 3D0HE 2M9KA 4Y00A 1I6VA 3TEHB 2WVEA 5F8NA 4K2XA 2VQFJ 2M4MA 4Y2AA 1S72B 2KU7A 4WXOA 4Z4ZA 3E1YE 4Z4YA 4UT4A 2FVRA 1OB5A 5C42A 3VA7A 1TUIA 3B82A 2C3YA 4JV0A 3TNVA 1OY9A 3L95X 3G4AA 4KIAA 2XCAA 4Y9UA 1B2RA 2R93K 3M32A 3KLIA 3K17A 4M5MA 3DNCA 3WQPA 2HW3A 3OUYA 4LIWA 2GNKA 1JJCB 1UPPA 4TT3A 3C6TA 3TUJC 2DIVA 2VONA 2YPYA 3W60A 1S6QA 3V5RA 5A8RB 3IWNC 1IBKJ 5A8WB 3QT7A 4K7QA 1UCNA 1HNWF 4WK1A 2VBYA 3WX4A 5H1SV 2BMBA 9ATCB 1RTHB 1AFIA 1FF2A 4YMEA 3V4IA 4KY3A 3OVBA 2W7OA 3KLHB 4M5NA 4DX7A 1R0CB 2V50A 2ADCA 4P3IA 1P9YA 1DLOB 2UV8A 5AN9A 4TKOB 2EPIA 3CQZA 2Y1IA 4TVAB 4RNOA 2DNNA 2A68A 1TWCA 1NDKA 1EFTA 3A8IA 1FNCA 4UZUA 4RUCA 4YB6A 1P27B 1YQHA 2G2ZA 3SXLA 1S4FA 1VQ5B 1LWFB 1S7IA 2FY8A 4HLBA 2KN4A 5L9NA 2CIMA 1ZA2B 2FQQB 1HA1A 4EK2A 2W9CB 2L08A 1ZTTA 3FZBA 3C15B 3VAFA 3GPAA 1FDRA 4ACBA 1UTAA 1NK4A 5HZBA 1F7UA 1RU2A 1UAWA 2QLBB 3EE3A 2UXCF 1N32F 5HO4A 3MECA 2BQUA 4ZS6A 2GSUA 4KV8B 4LR8A 3S7RA 2DXDA 1KRHA 1NH7A 3DLJA 3J81j 2D3ZA 3T9NA 3CJQA 4UY8T 1O6XA 4OINA 4A3MK 3FEXB 1T0TV 3CDUA 2UXBJ 4OFZA 3MCOA 3QRQA 1FJ7A 2EBBA 2JSXA 2DD8S 3D6TB 1BLUA 4LSLB 5AXKA 3OTOF 3PYFA 4GFQA 1NPRA 3POTA 4DV1F 2D3OR 3KK3B 4X7CA 2Q6CA 4F4ZA 5IT9Y 3PR5B 1F0XA 3B54A 3VZHA 1F2HA 2H4WB 5F8JA 2CPJA 1T05B 1FKPB 4GMKA 4WKYA 4KHRA 2VUMC 2PA8D 4CLUA 5DRKA 2JFDA 3TI0A 4X4QA 4ZA1A 1ZXOA 5CABA 3CULA 4RPFA 3PRDA 4PXEA 2AZ1A 4WK3A 4F4KA 3R27A 4IH7A 3D0GE 1F9NA 2HRUA 2BOPA 3UDVA 2L3MA 1O2BA 1SJRA 2CPZA 2FYXA 3FKSA 1NK7A 3W2WB 5K14A 5L1LA 1JLCA 3JTOA 2EG2A 3QWPA 3EDRB 2MDAA 4RX6A 4EU0A 4WQMA 5AE3A 3AD8C 3HOXC 4U67Q 2Y0BB 3MURP 4BXXK 1E6YA 1G4CA 4DSJA 1JVIA 3US5A 4F50A 1B7FA 3AQOA 1IKYB 3TVYA 1JLEA 1K44A 3N28A 3T00A 5TMFA 1K8AT 3RB6A 4HH1A 2XLIA 3D2WA 3GTLC 2C2WA 2F1LA 4KGZB 1PAUB 2B63A 2HFUA 4K4UA 2O5JA 1IBKF 1LW2A 1UVJA 1TL3B 3HPOA 3PDNA 3HOYC 2IA0A 4PRFA 2CPIA 2PMDA 1XFOA 1XMBA 2W9BB 3HD1A 5J2NA 4XKVA 3JSYA 4MKYA 1IR0A 3HHLB 2ZH9A 1RTZA 1UETA 1WC1A 4CH1A 4KYZA 3JQPA 2DNHA 2Y1LB 4JI2F 5CHPA 2FQOA 4MMOA 3THVA 2NUHA 2E2JC 2CNNB 2YKQA 4RUAA 4UOHA 2ZOMA 4B3OB 1CJKB 2MXYA 5AXMA 4LR7A 3LGNA 4KB2A 5C24B 1FK9B 1RTIA 3MM9A 3NCRA 4E98A 2V4QA 2CC2A 3FQKA 2HIYA 2QLXA 2D3LA 2X3DA 5KFAA 3ZTPA 4X4NA 5KFDA 2J6SA 2O1PA 4L75A 1GX6A 1RT3B 1W2BB 1R8AA 2F4FA 4LF7J 4H4OA 3P49B 4M94A 4LF6J 2AYGA 3MTJA 2CNOB 2PLFA 1HPZB 4D3HA 2X6WA 3CGIA 4YG2A 2WCXA 3RBZA 4IUFA 2C2NA 4CT8A 3ENAA 2XNQA 2IVFB 4J9VA 2PE3A 4BKWA 1XB2A 1J5EJ 4F4AA 1X4FA 2B7CB 3LO8A 3OEEA 1DTTB 2GV1A 4YFKA 4IFVB 2Z2LA 1FKOB 4QWEA 2UXBF 4RKUC 4GC7A 2JH3A 1QSYA 1RJJA 4DX8H 3B8HA 2WOMB 1M90T 1XNRF 2IBOA 4AXIA 1NKEA 2RB7A 1U0HA 1IR2A 3S14C 4IR9A 4X4TA 4A3KK 2Y9HA 2OJ3A 2YKNA 5HI7A 4RW9B 4ANCA 3MMLB 2WAQL 4K0KJ 2BXJA 2F43A 1IKVB 3S1MK 1ZQ1C 3NUHA 4AYBL 5BYSA 5KFZA 1MN7A 3LWLA 2DR7A 2SXLA 4I6AA 2R7ZA 4F3QA 4FBTA 1CLFA 5LXYA 1NNDA 1Q0NA 2OMLA 3IXQA 1XZPB 3KHGA 2IJRA 3M8QA 1SFOC 3LAJA 3HI9A 2VC0A 5FJ8K 3KLGA 2EC2A 1SV5B 3CPWB 2CQ3A 2ZM6J 3G8TA 1XWLA 2C77A 2ZBRA 4CLZA 2DPJA 2KT5A 3CTAA 1S10A 1GTHA 2Q6IA 1RWXB 2QN6A 1SI9A 3UO0A 4WP8A 3IBCB 5JMNA 3I0SB 3BQ0A 1W34A 2AF6A 4O23A 1FEEA 3SJPA 1HW8A 1CQXA 1Y5IB 3U6BA 2VBXA 2FJVA 1JOEA 1VC6A 1TL4A 2QA1A 4WYLA 2RDIA 2R4FA 1PO6A 1RQPA 4X6AC 3GSDA 2DHXA 5L9XA 3BH6B 3N5FA 2QFJA 4OHWA 3RAXA 3PENA 5CAAA 5A2QY 4QIGA 1TKZB 2XCRB 1N56A 3UCUP 4G0WA 4WP9A 3J7YU 4NCAA 4NMXA 3MMAB 2IVMA 3L4KA 2HZAA 1PC5A 4YAFA 3IFEA 4WZMA 1QH0A 3V4MA 2FJAB 3VNVA 4G7WA 1SH0A 3KDNA 4FN5A 3CCMS 3I4PA 1UJ6A 2J8AA 4FDFA 5IYRA 1URRA 1ZZFA 1XQBA 4TY8B 4BPRA 1M1HA 2YX7A 1C0UB 4ZPDA 2HHUA 3HVAA 1FE0A 2E2HK 1U1QA 3SMZA 5CZXA 3A3BA 4OL8A 3CCUS 3CJKA 1R8BA 3CC7B 4MK7A 1U1PA 5TR9A 1N88A 3RZOC 1RWMB 4RBVA 1WI8A 2V6AA 3QX3A 4EO6A 4HHHA 5FA6A 4WXWA 3CD5A 4X65J 3DI6A 3CC4S 2QA4G 1AROP 3TA1A 4BWMA 2E2IC 1X4DA 4DUZF 2HBYB 2PHCB 1GT8A 4AD6A 4S0MA 3RZDC 2HWHA 2LFVA 4KGVB 1AZSA 1Y5LB 3DMJB 4N3GA 1MG7A 4MIAA 3OSNA 5B08A 1G7CB 1Q8LA 3HXAA 1M1GA 1VCTA 2YU9K 1TL1A 4CO0A 1M5SA 2VA2A 2VC1A 3HULA 8ATCB 3QBCA 2BBEA 2IRUA 1WNEA 4II2A 1RAAB 5GADI 1ZA1B 3IRXA 1U02A 1WC4A 4NE9C 3MM8A 3MEGA 1UV7A 1LFWA 2RSQA 5HN0A 5KTQA 3W65A 1TKXA 4XM3A 3PVXA 3M2UB 4OJ1A 2K3KA 1HI0P 2DGQA 5IP9C 3EM1A 1XJWB 4K0KF 5D4PA 3BUEA 2EFNA 2VG7B 1AB4A 2V4JB 3KHRA 1M1KD 3FPPA 2GJFA 3G6YA 3GJTB 4X06A 2WVBA 5EUHA 3TARA 3DXBA 2HS3A 4I7FB 2JEGA 4BLAA 2BJ1A 1VK8A 2JA6A 1S6UA 1FCAA 1H0HB 2K1RA 4J9PA 3T9ZA 4F3OA 4DQPA 1IW7A 2BE2B 2EWHA 1VYAA 2CJXB 2GMHA 4M5DB 4RO0A 3AD9C 1IQZA 3MD1A 2JVOA 2R42A 1JMTA 3EZ5A 3VAMA 1OYDA 3GCWP 3D28A 3ASTA 3K59A 3SFGA 1SXLA 2JA5K 4CYUB 2MQOA 1TKTA 4EBCA 4IRKA 1F2GA 1LEOA 2Y8WA 1YNNA 3CCQS 5JBQA 1WD6A 4OZNA 2E1PA 2BM1A 3OLBA 5JXSA 4ETXA 3J81U 2DISA 5I3PA 4KC5A 3GCXP 1VHEA 3OD2A 4ECRA 4G6IA 3CD0A 3H2UB 5HQLA 3NCPA 2B5JA 3PO4A 4FP9A 1TV6A 3BN7A 4C48A 4MIBA 1CS4B 3AVVA 3V6DA 3HVRA 3W62A 1PKUA 3N6MA 1RP5A 4Z7CA 5LSOA 3EQLA 4C6AA 1J9ZA 1RLDA 4ECTA 1PSDA 4A3KC 3C8YA 5CCLA 1HMVA 2QGGA 4LBIA 1O25A 1YG0A 3PKYA 4BY1K 4P5BA 1X4BA 2XNRA 1N05A 1CJUB 3S1RC 3CE8A 1YK9A 2ZBUA 2B4PA 5E3PA 4IDKA 3A3OB 3SDEA 2J76E 3DGPA 4IG3A 4J91A 2BANA 2FLLA 3ZPNA 5IM0A 5FDLB 4YB5A 3ICLA 4CNYA 2NZCA 2JA7K 4NYZA 2FJEB 3FEYB 1UVNA 4B3MJ 3W9JA 4HI2A 3PW4A 2J0QD 2XLJA 3ZZ0A 1S1XB 2E1BA 3DRPA 2YKAA 3EZOA 2HK3A 4ZP9A 2M5YA 1JLGB 1J27A 4X65F 1SC3B 3BR9A 1NK5A 1U24A 4KGKA 5DQIA 1NMEB 2VDIA 4IO1A 4QW8A 1WCMK 1GXLA 2PFDA 3CO9A 1FHTA 3FSXA 1KDNA 2OKQA 3T41A 3BH7B 3DRYA 2ZH1A 2B9EA 4XCHA 1I5OB 3JQRA 4G6VB 3K0JA 4ZCLA 2VPWB 3U02A 1WI6A 1LWEA 4UOFA 1I50A 1YJRA 3U2QA 3UR0A 3SQGA 2HPUA 5KFNA 4A3FK 3HO1A 2AHOB 2EKNA 3W2GA 3VO2A 3VCDA 1T3NA 3GTGC 2XO7A 1WF1A 3PA1A 3OXFA 2ZJQQ 4BC7A 3I0RB 2NQPA 5HL7Q 3KLFA 2GVDA 2YXLA 1RAHB 5KG5A 4HDHA 4A3EK 2DHAA 2HNDB 1SM4A 2CJBA 2QL7B 2O5DA 2IMWP 1YRXA 1XXBA 1B70B 3BGOP 2OBSA 1BQNB 1VRUA 3PIPQ 4LR9A 3QRPA 2E2HC 1U1RA 3G2XA 4LMZA 2V7TA 1IE0A 4NPOA 2E5LF 2Z4PA 2YH0A 3M8WA 4AFFA 2MKCA 3UW1A 2PN6A 4L74A 2GJKA 4ROXA 3OJXA 4BBSC 3BGFA 1TWCC 3AA9A 3FKIC 2FVCA 3S17K 2FPHX 4V19J 3WXMA 2PIAA 5B0BA 2C2KB 1V5IB 3MUMP 2R8GA 2COLA 4XTTA 5KFVA 4Y52K 1DARA 4JOUA 2HS4A 1M0SA 2V9KA 4XNFA 3I1FA 1K8AD 3UVJA 3CSKA 5KFMA 3O8WA 1LK7A 1FESA 3QSYA 2BACA 2V2KA 3CJ3A 4ZN1A 1UWBA 1S1WB 4N5SA 5ITHA 3M8YA 2ZH8A 5E3RA 3GV5B 5E3QA 2Y3YA 3S1TA 2R2RA 1RBAA 1RGVA 1VQ7B 4QZVB 2OPSA 3GTOK 2Q6BA 1K0TA 1OQ3A 1N34J 2BW2A 1RT7B 4CT9A 3NGDA 5IWAJ 4MTPA 2FVPA 1W7WA 2CZ9A 2AJFE 5KFQA 3S1NK 4ED0A 1DURA 3HFKA 1HYSA 1OWXA 7FD1A 3GTPK 4H54A 4PWDA 2YVSA 4DN0A 2V7VA 1FJGJ 1H8EA 3TFIA 1TL7A 4USJC 4JV1A 2MJNA 4G1QB 2BQ3A 1UZDA 5E3AA 1WHXA 4QQBA 2IMOA 2DRBA 3K57A 3M2VB 4DS4A 4C11B 1DRZA 5A0YB 3N3YA 3MAAB 2ZUAA 2JN9A 2OEMA 2HHPA 4B3MF 3LALA 3I4MK 2R7RA 2VJVA 2X7IA 4TN1A 1I94F 4XSXA 1U25A 1E43A 2LXUA 1YHQS 3BYPA 4CM0A 3H90A 3GTQA 3MEKA 4PEOA 1W9XA 4DG1A 2X53S 4CLPA 2AYEA 4OYZA 3CIMA 4L73A 3HT0A 2LEBA 2VKZG 1T03B 2D74A 4J9LA 2YNHA 3QO9B 3ONYA 3LA0A 4CO4A 3HHLD 4BBRK 2XZLA 1WOPA 3KFWX 3P45B 1S1VB 3MMBA 5CZVA 1XQIA 3H5SA 3OREA 3MPVA 5IYBC 1N5TA 1A8PA 2DEIA 4NI2B 2CPEA 3I96A 2DXEA 4QOTA 4TKTA 5EX0A 3CJTA 1M90D 2ZHAA 4CRJA 2HQFA 4NA2A 2J6TA 4ZV4A 2ASJA 1YJVA 5D8HB 4KC6A 5FO1A 5DM6Q 1YJ9S 4O4RA 1FD8A 3RB4A 4ERDA 4ELVA 4FYYB 2GX8A 3SZYA 3HFVA 3R7SB 1WOOA 3GEEA 4LBVA 2K2PA 3PKMA 2NVTC 2NREA 1Q16B 4X4PA 2RDDA 2HHQA 2OMOA 1KFDA 3CCRB 3IR7B 4A8FA 3WYAA 4J90A 4MAKA 2NYHA 1LXNA 3RY8A 1O8BA 2VQEJ 4WJ3M 1DHMA 1PKVA 3M8SA 1GK8A 4WFZA 1IJFB 4ZHRB 1S0MA 4J0QA 1NRKA 3PO2C 3CCEB 4RM0A 5TJ3A 4UW2A 4BLGA 5ETOA 2DNLA 1QVGB 4EUVA 4DR4J 4JI5F 1TWFK 1K0VA 5F8MA 2ZFZA 1KLMA 2BA9A 2DITA 3VZIA 3U1MA 2J7KA 4DSEA 2FVSA 1RQ0A 1VC5A 5KOXA 3PVDA 4UF4A 4OI0A 4XOPA 1X60A 4YB7A 2NVYK 2VIHA 1Y3KA 4KHPJ 3TFJA 1ZPVA 1SL1A 4B48A 1Q8KA 2FUG9 3QSIA 1H42A 1QTNB 2IHR1 1L3TA 1N34F 4J37A 1VISA 5IWAF 3M6WA 4RWWA 3MGJA 3S1QC 3QGPA 2B4VA 1U47A 5T7LA 3CJ4A 2MZSA 3A35A 1NJXA 2JJ2A 1W35A 2RVJA 1FJGF 1TWGA 2HSEB 4B9MA 3KOAA 3I5AA 4MFBB 1Y1WC 3NP5A 3GTKK 4ZVSB 5C4JK 1RT1A 3A8JA 4X7EA 5RUBA 2F9DA 3K5NA 2H1YA 3JQJA 4OHYA 3HSGA 2BJ9A 1TTTA 4CLFA 1HQUB 3T1AA 2IJNA 5KSWB 3M6VA 2KJVA 2M88A 2DNYA 4C45A 3HSDA 1RT4B 3UCGA 1SJQA 4C97A 2LECA 1JA0A 5HKKA 1TKDA 2VFRA 4DV2J 5LJ5Y 4FYVB 2OUGA 1KHVA 4Q4ZA 2KFZA 4DR5J 4CO5A 1MLAA 1DCPA 1CJVB 2R7QA 4USVA 3TW0A 2OTLB 4ZP8A 2AGPA 2IFXA 2HFVA 1C1CB 1UD3A 2YNIB 1WQFA 3A3PB 1U7LA 2WB4A 1VK3A 2G1DA 1Q82T 1VOMA 1SIZA 5CXTA 1IS1A 2YNFA 2CBXA 5F4MA 1GAWA 1NUEA 4YR2A 4QHYA 3I55S 2YX4A 5DQHA 1HNVA 3X1LB 1MROA 2YQ1A 4OYIA 5FIUA 4KATA 1QGZA 4Z4RA 3VV2B 1H2TZ 3SV4A 1LXJA 3H0GA 4A3JC 2YNGA 3GTYX 3JQMA 3AAWB 4KN4A 1S97A 1NB7A 4DCOB 3LO3A 2D1CA 2FHOB 2V6UA 1FVSA 2DBBA 1K9MT 5DDPC 4DZDA 4KFBB 5GV7A 4JV5J 3ZTOA 4OI1A 4A8QA 3CDWA 3GE9A 3ASSA 3ILIA 1X7VA 2E1AA 1SUQA 3M30A 2DR8A 4ZPBA 1DD5A 4R0JA 1ZH5A 3Q2TC 5L1IA 1XK8A 3BBBA 4K5SA 1F60A 3AGPA 3RZAA 4O4GA 3EVOA 4PQUB 3UWTA 4ED2A 2RRBA 3HCXA 3OR2B 2PFFB 3WIUA 4NLDA 4ZLNA 2WZ1A 1VQ8S 3UN3A 2WONB 1RUSA 3ENVA 5KFJA 1KSPA 3V81B 3TUIC 4NNJA 4ZVOB 2Q43A 1TZ0A 4UZEA 1SH3A 4DPXA 3I9ZA 3MM6A 4YP3A 4OPOA 1OSDA 2D6FC 5ETSA 2M3DA 4ECSA 4XPEA 4CH0S 3RRHA 3W2IA 2OYNA 2GHWA 3PW5A 1R3NA 2FGCA 3HXMA 4KHPF 1G7SA 5F4JA 1Y10A 2CK3A 3R5DA 3N4WA 1F93A 4EMDA 4A3LK 4QIEA 5C42B 2B9YA 3DOMA 3OKXA 5D6GA 3WX8A 3RG6A 1HW9A 2E1MC 3O6QA 4UTGA 1KQ4A 4A3DC 2KVOA 5M3FK 5T41A 3M32B 1DCHA 1RHKB 2MLZA 3O1LA 1R31A 4OI2A 4DFPA 2Z2ZA 4M2LA 1WHYA 2HVDA 1YJ7A 4GVLA 2FZCB 3TVKA 3LPXA 2CPHA 2WJYA 2K7JA 1S6QB 4P22A 4DS5A 2ABYA 2MGZA 4ZJLA 1TVRA 4F7DA 3H42A 1URNA 2Q6KA 2X6XA 1NHVA 1YTYA 2FD2A 4QCLA 3FEZA 3GTJK 1N5YA 2OK7A 1HBUA 2E5IA 4P2NA 2RRAA 3QFWA 2PMHA 1KZLA 1NJWA 1SQEA 4B3TF 4K4VA 1V6HA 4K8RA 2V2QA 4ED4A 4RPBA 4RBTA 1AW0A 3VAIA 1KEKA 1BS2A 3AVYA 4KSEB 5IC4B 2QMUB 2EKYA 2ZNZA 2N3LA 3C16A 5FLXU 5EX3A 3FGVA 2HS0A 1OSCA 1VIXA 4YXWA 4P2MA 2BM0A 4KKOA 1CC8A 4ANEA 1B23P 3T19A 3M4OK 2B3TB 2KFYA 3IA0A 2G9OA 1Y1VA 1FNOA 2G2OA 4DX6A 3RRGA 3AOAA 1WTBA 4F0KA 3H8YA 3ZZUA 3MUTP 3PR4A 3M3YK 3LAMA 2X3UA 3MEDA 2V8VA 3QJLA 4B9UA 4PUOA 4P73A 4AQYF 3DXSX 3CW2C 3GJRB 2DNMA 1UFLA 2DJWA 4LRFA 2JLFA 2XNDA 1GMWD 1VBZA 5KG4A 5TY0A 1HBMB 3D0IE 2RC6A 2NVXK 2IAJB 4G0UA 1KS2A 4HTIA 2MQLA 4NLUA 4JV5F 4DR2J 2UVUA 4PC3A 3CJSA 1VQLB 2ZITA 4UY85 3PYDA 1GH8A 5AE1A 1GJRA 3DRRA 1E1RA 1O2AA 4WYWA 4L76A 1D1UA 3OP1A 2EIXA 1WSVA 1NHKL 4KMDA 3VQTA 3MFIA 3BSNA 4CLTA 3POTB 4ID5A 4YR3A 3MR7A 1N48A 1FDAA 4AYBD 4WWVA 2MKIA 3X3UA 4CI0B 4N3NA 3CDEA 2R7OA 1VHOA 1HA3A 1B0VA 1IBMJ 4JV2A 4USWA 2LVWA 1KK3A 1HVXA 2ZJPQ 3M2RA 4RJLA 4QYZJ 1AB8A 4KBIA 2MHNA 3OFFA 2HAFA 4RWXA 2GAHC 1QUVA 3LQEA 3VAJA 2JOQA 3TANA 1J5OA 2DGTA 2OLWA 3JSRA 2ZTGA 2ZC3A 1S9GA 1K28D 5KOWA 1U2FA 1QE1A 4YEAA 2DH9A 3HAGA 4PQAA 1T6ZA 3FMWA 5K14B 4C0HA 1JLCB 4DL7A 1MMNA 2JC0A 3EUNA 3SZZA 2GK7A 3T51B 5L1JA 1NPKA 2RHSB 2RU9A 4DL5A 1E6YB 3BH4A 3UCZP 3ASRA 1WU8A 4NOIA 1Q7YT 4OI3A 4LVNP 3CQZK 1S1UA 1JLEB 3EVWA 2I2YA 1WSRA 2F4NA 1T3OA 3EXYA 2KXHA 3IO1A 3LPYA 3L7PA 4CCHA 2WSFC 4QU6A 4C3HC 3V7AA 4PG4A 2E9RX 3B4DA 4ZP6A 4G7ZA 2KYXA 3BGRA 3CMES 1P1TA 2W2MP 1CNFA 3ILOA 3V4GA 2IM3A 5A88A 1LW2B 3VAKA 1NK6A 1DFDA 3OPFA 1QDUB 2EBEA 4AH6A 3PA2A 1JLAA 1XR7A 3AB2B 5AJ3F 2VFSA 2VF3A 4XONA 2CQGA 2VV5A 2E9TA 1H38A 4DF8A 3PACA 5FLMK 4PYAA 2CQIA 1Q7LB 3CUNA 2VFVA 4JBCA 5IP7C 3HZEA 1A6LA 4OZ0A 1JXLA 4KE5A 2XZPA 3J7Z5 1X4AA 3ZZRA 4C3IC 1JLFB 3R2CJ 3MM9B 5C44K 3P8BB 2CDRB 4RDLA 4U9RA 1ZM2A 4ACAA 2R7XA 1ZM9A 4DPTA 2PEHA 4P7VA 2HMAA 2OK8A 4DSKA 3V2UC 3ITHA 3EVMA 4FVCA 1CSJA 2F65A 1BGXT 1GAOA 3KJFB 4JI4J 5AE2A 2CQ4A 3HOUK 4O3OA 2ROEA 2MMYA 4CNZA 4AL5A 4DDFA 2RE1A 2QL5B 2W01A 4DR2F 1KQSR 2M8DB 4QIWL 5EGHA 4NZ7A 2XWXA 3UE2A 4LSNB 4LF2A 5BR8F 1VRQC 1X9WA 2J5AA 3TQEA 5J2QA 3B6BA 1UVKA 3G71S 4G7HA 4TN2A 2PO4A 4DSLA 4RR5A 2KRBA 3UN5A 1IBMF 1S72S 1WORA 4DOZA 4QIVA 1VQ6B 4GRSA 3ZBTA 3Q6RA 3Q0AA 4EYHB 1VBXA 2V7QA 3HHDA 3L9ZA 5C25A 2B63K 3SEOA 5HQ8A 2AGOA 1TK5A 3R6GB 1XR5A 1Q5YA 2QZ8A 2LXIA 1GX5A 3KK2A 4AF7A 4P2XA 2W1BA 2KXFA 4WWSA 1FXRA 3M8QB 2MKYA 1O29A 1OHHA 3Q23A 1ZAXA 1KN6A 4DPYA 3DHXA 3KLGB 1F20A 3T01A 2FHMA 2C1EB 4ZLPA 1TLLA 4G1IA 1HQMA 3NAIA 3G82A 3N5BA 4A8YA 5CJ9A 2ASLA 3QLHB 1X4EA 3AJ1A 5DO2A 3LUYA 5CCMA 2ZD1A 3D66A 4ILDA 2BJ7A 5IXUA 2I5JA 3LGHA 4MJKA 2ZBVA 3K58A 4LQYA 1F5BA 2AYBA 5KG0A 4YELA 3AVXA 4TYAA 5B0FA 1KVJA 3BQ2A 1OY6A 3LVBA 1VQ5S 3HKZL 2XEXA 3ZTSA 2WR8A 4M0LA 4PC7A 3HKWA 3W64A 2NLWA 3QAEA 3SZ2A 3OBIA 3NMRA 5KT5A 4BY7K 3LAPA 2FZGB 4DMZA 2VG5A 4ES1A 2XY5A 2L9WA 2EFQA 1WG4A 4PG6A 3D3BJ 2EC0A 4Y2MA 5I42A 1JLQA 1H2UX 4NCBA 3R3TA 3MTKA 2HEKA 3GSIA 2H5JB 3QJPA 3MUVP 3R8YA 2BOAA 5G4DA 1JNZB 1RXOB 2NSCA 4OV1A 3FSYA 1Q82D 2ASDA 5KAKA 5KFHA 3HHKA 1WG5A 3BR8A 5HMYA 1S5ZA 1UJ5A 2PPBA 4YALA 4DX5A 5GAEI 2A2CA 1WPCA 3NE5B 2PSZA 3ELHA 4DPUA 1E3XA 5ETLA 3ZNJ1 1YKWA 1U4BA 1YLXA 1EETA 2DR6A 1R0AB 3EJMA 4ICLB 2RILA 2ZBIA 1ZOTA 4LUBA 3E2EA 1S12A 3I82A 4WFAQ 2ZNYA 1K9MD 1VC0A 2R7ZK 4USMA 1UZHA 1R9TA 4P6QA 5LM7E 4A3BC 1REVA 3W5HA 2W4CA 4FPRA 1N0VC 1Q9SA 3BSAA 4ITSA 2BRKA 4C0OC 2HMIA 2WBMA 2BJEA 2XS5A 1FRIA 4YFNA 2MLXA 4MK9A 4A3CK 3SKBA 1VQPB 1D3WA 2YKPA 4DFMA 2RKIA 2XTJP 3MEGB 1JQGA 4NOHA 1BQMB 1EFWA 2HK2A 2GHVC 3SFUA 3W9HA 1TKXB 4CO2A 3CCLS 1X0PA 4MEXA 4X7FA 3PZPA 5KG2A 1UD8A 2KVIA 3CP8A 4LC0A 4P72A 4OHVA 4K4YA 1KONA 2HFNA 4O0IA 1HBNA 1UD4A 1FI4A 5M3MK 3E01B 2UUTA 2OH2A 3NEKA 3ULHA 1TMJA 5FD1A 5F0UA 2K1RB 4CH7A 4WE1A 4DQRA 5HLFA 1FNXH 2Y8YA 5IOQA 5B0AA 1FX2A 1SJ1A 4I2QA 4Z4SA 3W2EA 1TK8A 1OPZA 1NDCA 2BYCA 3L09A 1YVFA 1YX2A 2W6IA 4H9GA 4YR0A 1TKTB 1IKWA 1D9AA 3BKUA 1H2VZ 4DBQA 4ED3A 5D4LA 1JB9A 2G2YA 1UP1A 2BSAA 4RLZA 1E64A 3BY1A 2P9CA 1N33J 4X4UA 1PGZA 4J9QA 5BYRA 1SJFA 2N82B 4ZLLA 1T02A 3I4NK 3NGTA 3MEEB 1BY9A 1TV6B 2RAQA 3H94A 1S7HA 2W2NP 3V6DB 5KFBA 3UD4P 2JEFA 2RF2A 4ZVFA 4OIPA 1O28A 1S0NA 2B8PA 1WOSA 5K8MA 3PNIA 1HMVB 3IBWA 1QVFR 3AXMA 3EPIA 5A8KA 3W66A 4TMTA 4R0EA 1Q81D 2OPQB 5CQGA 2ZWOA 4WFYA 1S79A 5ETPA 2E5JA 1LKZA 5L1KA 2YKOA 2AEFA 1UVLA 1CBKA 2VNHA 4IDKB 2C78A 3OSPA 3OR1A 2X0KA 3SDEB 3DGPB 3DLKA 3QFSA 2GGPA 3SJZA 4QPXA 2BANB 5IM0B 4TYBA 4ZVQB 3BC9A 1TQLA 5LXRA 1TWHC 4FF1A 1DCOA 3CJ5A 4KQZA 3W5XA 1YBUA 2I38A 1OB0A 2YWHA 1KQFB 3RB3A 1RWVB 4PWUA 5C3EC 2ZVIA 3AY0A 3GTLA 2KVQE 1S1TA 3QWUA 4ALZA 2DB1A 3HOZK 5D4OA 4YUDA 3JAMU 1Y0YA 4KO0A 3D26A 3CF5Q 2G13A 3FCWA 5HROB 1BJKA 1VQOB 4NA3A 1RHMB 4I4BA 2JA6K 1ZYRA 4G7XA 1LQ9A 2CFAA 1IWAA 4LRAA 1PG5B 1TUVA 2I1RA 1LWEB 3BSOA 1EP1B 3Q3AA 2BVNA 4AUKA 4LFCF 3SQGB 3W2FA 4KMHA 4DV3F 3ILLA 4K59A 3OFHA 2YQ3A 1VQNS 2LDYA 3OAAA 3SYZA 1RAEB 3KLFB 3CCSB 3EGWB 2GVDB 1BQEA 1I3QK 2WW8A 3A8KA 4F04B 3Q86A 5IYCC 1A0OB 3MPYA 1W0JA 1IVZA 3OW7A 1HQ2A 4NLXA 3R2DJ 1VRUB 2AX1A 3OTDA 4B3RF 2QL9B 4X84A 1XE1A 4YAUA 3C2PA 1VQ4B 4X66J 5IYDK 5F9NA 3DLEA 2GPJA 2QT7A 2X8KA 1PBUA 2ZZMA 4A93K 2WBRA 3DM2A 2ZE2A 1YSJA 1Y4ZB 3GMGA 2R7WA 1EX8A 4ZMMA 2LQJA 1T94A 1LV5A 1Q7YD 1E63A 1F6TA 2UXDF 4EZ6A 1BC6A 4KASA 1WF2A 4BBYA 5EN1A 3WNBA 4YEJA 5C4XK 3UVJB 1K83C 3R6KA 3NG8A 5HBMA 1GFWB 2CJ9A 1VBKA 5TRDA 3DDKA 4RPDA 3QSYB 3CESA 4DZ6A 4ELTA 5E0OA 2KZZA 4RMFA 1EARA 4P52A 1HBOA 5HMWA 2IY5B 3K8WA 1MU2A 5BJRA 5H9FJ 1I6HC 2Z58B 2JX2A 1EFCA 2DERA 4UQTA 2R92C 2RC5A 3CC7S 2G4BA 2YPZA 3BO2A 1VF7A 2AW0A 2VPYB 1COWA 1JIHA 1JJHA 2JVRA 2PMZL 1R6VA 1VI7A 1BX1A 1ZBSA 2A69A 1OB2A 5EMNA 4PWDB 1RWUA 4UAJA 2DCLA 4M5HA 4FWTA 3FNNA 2MZTA 1BX0A 4K4SA 3T5KA 5D3GB 4ECZA 1I50K 1C1BB 3AGQA 3EGZA 5JVOA 1GTEA 5FO0A 2ZH7A 3QZ8A 2HLDA 2KM8C 1DDIA 4ZJOA 1Y5NB 4USKA 4DCPB 5F3ZA 2Z2MA 3OE7A 2GQFA 4TNOA 1GQEA 4GTCA 2KL8A 2C2ZB 4F67A 3TA0A 4P1VA 3OFNA 2YNHB 4OZJA 5ETVA 4ZPCA 2B56A 3F44A 1BHNA 4QR0A 1TAUA 2E5GA 3MMBB 1Y0HA 2B9WA 4O44B 4ES3A 1C4AA 3DOLB 4JB8B 2CQHA 2KT2A 1VQMB 4ECXA 2XSJA 2HHWA 1FT8A 5LMNF 2CDQA 4RD6A 5HL8A 4HR2A 1XERA 2IC3A 2N4DA 2J7UA 3AOBA 1NPPA 1NCLA 1QD1A 2AGQA 4CTAA 5A8RA 5MLCV 4YHHJ 4ZIWA 3SSRA 2ZVSA 3KG4A 3MPUB 4P9SA 4A46A 2CUYA 3OPOA 4JI7J 5D4NA 4PG5A 3VGVA 2GIRA 4FF4A 2Q6LA 4YDDB 2NCKL 3C14B 3KLHA 3G05A 2QMWA 2LA4A 2XCPA 1QSSA 3HVWA 1OGIA 4P75A 1FA0A 1T8EA 4OX9J 2E2IA 1BWVA 2HNYA 1AFJA 4C0SA 1U8WA 1NAQA 1NSPA 3FBBA 3LNNA 2GW8A 2YWFA 4IH5A 4LFBJ 2DVIA 1JNRB 2V7XA 3QYYA 3HOVK 2W9CA 1RHRB 3A8EA 3BKFA 3I32A 2AKWB 2P8IA 3CCMB 1RT2B 1IKXB 3Q8VA 2DRDA 1Q79A 3GONA 4J9NA 3PUNA 5C5JA 2AJ0A 2MQ8A 1MWYA 4Z4UA 3GTQK 3KL9A 3GWCA 4B17A 4M1XA 5LMZA 5CYQA 2E9ZA 3CCUB 5IOSA 1Y3JA 3HT3A 3FRYA 4RUBA 3H4DA 1YJNB 4FF3A 5SUHA 1AT1B 3D1HA 2WB1D 1PYTA 1S57A 1EWYA 2GJRA 3P5TL 4UOCA 2XMAA 1S0OA 1RT6B 3MM5A 5AXLA 1RT1B 5IYQA 3CC4B 5A76A 3GFXA 2HLUA 3KK3A 2EFVA 3OL6A 1IBCB 1SPBP 1QTMA 1WWHA 3WY9A 4YFUA 2CZ4A 3MAHA 5JFEA 3KUGA 4DQLA 3UNGC 1WTHD 3TAQA 1CJTB 4ZVEA 2EK6A 4OZ3A 1ZAVA 4W98A 1J6VA 2XZWA 3RYLA 4X0CA 2F1FA 5EWFA 3O3LA 2EEYA 4WFBQ 2JDIA 4HACB 4N8NA 2V8HA 2JJ4D 4B47A 2W7AA 1OGJA 3W2WA 4HHJA 4A8OA 3BF4A 3UDCA 2OIHA 2JC1A 1T7PA 1XTZA 2BKOA 3PHTA 4CP5A 5H9EK 2V68A 2K06A 2YNFB 2XY6A 2RQKA 2X6YA 4IOBA 3H3VD 2PI4A 4I2PA 1FRKA 2R2UA 3LQ6A 3IM8A 3JQKA 4N47A 2ALYB 4FKXA 1WACA 2CQCA 2IM1A 2KHCA 4RL1A 2YNGB 3SI8A 3BSCA 2B4OA 1X4HA 2XO6A 3GV8B 3OL9A 3VF0B 3BNWA 4BCAA 2OTJB 1K47A 3NLCA 4KH0B 4A3GK 2DR9A 3OFEA 4TQRA 1I6JA 2BE9B 2APOA 2Q79A 2MB0B 1SUQB 2B7BB 3M30B 3NGRA 4JI7F 1F5AA 2W9BA 1NDLA 2XNJA 4YQWA 4EGLA 2X3GA 1F60B 4O4GB 1ZPWX 2GC8A 4GZYA 1RHJB 5GVQA 3M8PA 4PKDB 2C3UA 2BQRA 3OQ2A 2GK6A 2GJPA 1IN0A 1RTDA 4LF4J 4JI6J 2V2ZA 4NYOA 4B3OA 1RAGB 2XMTA 2W9AA 2DGUA 2DNZA 3MM6B 3BCFA 3M4XA 1TWGK 2UUCJ 3S15K 4YB1P 3BZQA 2FHJA 3FVYA 4PC1A 1N36J 3ZZTA 4C7QA 4LF8F 3ZFVA 2NV4A 2Z8QA 1VJEA 4WPAA 2V8DA 3ZXWA 2F3JA 1RT3A 1KBRA 2MHEA 3GYNA 2IRYA 3N0CA 3GTGA 1OYEA 3NBPB 4ZCIA 3UDEA 5I4MA 4DV0J 3CC2S 4U8VA 1QFJA 2HHHJ 3BO4A 3GFYA 2OGUA 2UZAA 4FZBA 1R9TC 3KTQA 2GVZA 1J98A 4Q5SA 1LW0B 2B7CA 1DTTA 3OTCA 2H5IB 1G6BA 2F9JA 1FKOA 3T6BA 3QIDA 2V4RA 3KLEA 2MKHA 4K4XA 5B7WA 5E7OB 3SSQA 1H6KX 2E2HA 1KP6A 4LF5F 2LMIA 2MGZB 1V9OA 2WOMA 1TVRB 5HP1A 3OJWA 2V8GA 5GMKa 4WF9Q 3FKIA 4K4WA 2H48B 1KOOA 1N5YB 3GTMK 5A2QU 4RW9A 1HBUB 3H0GK 3LTOA 2BVZA 4I64A 4QPTA 2XI3A 3SCJE 5BSYA 4BDPA 4DL6A 1MABA 4ECQA 3MR2A 4LLGA 5B0GA 1U48A 2NVQK 1REGX 4B08A 1L3KA 3C16B 5ETKA 1GR1A 4OOXA 3H40A 6AT1B 2CRLA 1Q8BA 1QUPA 1XZPA 2R9LA 1R89A 3KNGA 2X1AA 1HD0A 1UD5A 4L3KA 2R7VA 1K73D 1KWMA 2YTCA 2IVYA 1SV5A 1IBLF 1KQKA 4KM9A 2Q3PA 2CPFA 2GQQA 2OD4A 2O01C 2W8LA 4Z1MA 2XZTB 4Y7NK 2NZ4A 4M5GA 3MEDB 2VJIA 3CCVB 4DV6F 2VUGA 3IS9A 1HR0J 4CLWA 5I3QA 1YGYA 4ECVA 5K9FA 4QIWD 3IR5B 3GIRA 1EB0A 3S2HC 3NAHA 5THXA 3CCES 4X2BA 2HZVA 2LEAA 1R5BA 5KFEA 1D8YA 1EK8A 2XMJA 3AQPA 4NXMF 4NEZA 3KJQB 3PEHA 1RE1B 2AD9A 1NLKL 2MEWA 2L9DA 4IH6A 4A3IC 1EFUA 1YNJA 3HOWC 2MZQA 1XMQF 5M5YK 1GVHA 2JIZA 3MMAA 4A8XA 1U0SA 2HFOA 4NLWA 3RAMA 1HI1A 2KG0A 2W8KA 2YWKA 3UR3C 1C0TB 5FLXY 1RAFB 4Q2LA 3PO5A 3P26A 4I69A 2VQFF 3E3XA 1YWXA 2QSWA 2RUGA 5KFLA 3UD3P 1S6PB 3KXDA 4F4WA 2UUCF 3VR6A 1ELOA 2GJ2A 1TMMA 2CWXA 4WZLA 2HBQB 1J5OB 3K7AC 1WHVA 4FYXB 2F5GA 1S9GB 1YCLA 1AUSL 2F7VA 2VL1A 5MAOA 3CD6S 3QFTA 5BSXA 2GA7A 4I6YA 2JA8K 3S16K 4C4WA 1S4EA 2AIRB 1VH2A 4JI3J 1NB2A 2RQCA 1GO2A 2ZH5A 4DR1J 1XMOJ 3HJVA 1U49A 1Z4UA 1Y7PA 4GC6A 1O2FB 1R5NA 1UKUA 1KNZA 3PTWA 5KT3A 4TQSA 3DMJA 5L39A 5F3TA 3N6NA 1TP7A 1SC1B 3T53B 2ASYA 2BR0A 4TMZA 3C6UA 3HKZD 4NYPA 3TVZA 4AL7A 1Y1VK 5M2PA 3TJ8A 4EBDA 2WSEC 4RU2A 2OTLS 3P5BP 2KO1A 2NR0A 2DCUA 4B4DA 3J7ZT 5AT1B 3M2UA 5GADU 1ZVUA 1IQTA 4DV4J 4PXDA 4FYDA 4XSZA 1IJEB 3Q83A 4DR6J 1KD1T 5D4DA 4QR2A 5KFSA 3MMPA 3QIPB 2R7TA 5IOTA 2ALZA 5DDRC 2V67A 2HVHA 4NLRA 1WCMA 4RDJA 5GAHI 1V0EA 2G0JA 5C2GA 4N41A 2J6UA 4YAWA 1QGAA 2DHGA 1WEXA 3JYTA 2BZ2A 4OIOA 4JMQA 2R93C 2BE2A 4LSZB 1V3SA 2F63A 2MQPA 4J3NA 1YJ9B 3K5LA 2WVCA 2ILYA 2OEJA 5IZHA 4AXJA 2HWIA 1AYEA 3KEWA 4N7TA 4RNMA 1K1QA 2B8QA 4ZK7M 4CYUA 1HR0F 3ITHB 2I6WA 2L48A 2XZDB 2FB0A 1VQKS 1Y1WA 4KN7A 3B78A 2KXNB 3GQCA 1BMFA 2ROPA 3H20A 4RNFA 1RACB 4LFAJ 3RAQA 1JLBA 1C4CA 1PAEX 5EGYA 5CD4H 1XR6A 1USMA 2QTWA 3M8ZA 2AMCB 2QFIA 1MRZA 1TWAK 4DNTB 1CS4A 4C3JK 2D9RA 1UW9A 2PI5A 1WDTA 1X5SA 2QA4B 1D9FA 4Q45A 4PGOA 3MPWA 2V5HG 3GVLA 5B0CA 1BPLA 3E20A 3QJJA 1FTRA 1ZUNB 3BCDA 3NS5A 2J9DE 2MSTA 3G6XA 3ZZPA 1TK0A 2RT3A 1VS3A 4RW8B 4Y3CA 4JUZA 4XOTA 1F1BB 2OSRA 2WPDA 1FRLA 4Q8FA 3KK2B 3S2DK 1U45A 4J5OA 5J2PA 1S1XA 1NJZA 3ZUGA 1N6QA 2C22A 2H3EB 3DHWC 4A3MC 5D0GA 1XMOF 3Q8RB 1E62A 3Q2SC 1DZ5A 4GTFA 3K5OA 3G82B 3H5XA 2GQCA 1VDHA 4X05A 3W1YC 2B5OA 1LWXA 3ZC4A 3MCMA 4CQ1A 5CD4A 1FRMA 1HIYA 2EVZA 4U6PA 2ZJRQ 3S8SA 2ZD1B 3CEDA 2C3OA 3QAUA 2V2VA 4HTJA 1BLIA 4DHVA 4GTAA 1X5TA 3OZUA 3RBEA 3KYLA 3D67A 3WHIA 4P74A 4OX7A 3PO3K 3VALA 3P27A 5HZAA 4DFJA 1SKWA 3I0RA 3BB5A 1HKAA 1XXAA 4DV4F 2FDNA 4OZ2A 2CVIA 1M5VC 3RB0A 3Q6QA 1BE4A 1R5OA 5G0RA 2BJ8A 3M1VA 2Z6BD 3GFZA 3UPFA 2FY1A 2W2OP 4YDXA 2VG5B 1O27A 3CO0P 4KAWX 3OW2B 3OJSA 4LF7F 1ROFA 3SLNA 3TA2A 1BQNA 4LF6F 2J7WA 1QSLA 4BXXC 4M95A 3NY0A 1U6ZA 3IR6B 5KT7A 5LMUJ 4X64J 1T9XA 5KG3A 4NXNJ 3TWZA 3LQVA 2MJUA 1QUEA 1J5EF 2YH1A 2OBTA 1J6XA 3A1PA 4JI1J 4ED5A 3WNDA 1JJ4A 3CPXA 4ZLJA 1KK2A 1RZMA 1R43A 1EETB 2XOKA 3S01A 4LFAF 4Y0FA 2RU3A 4ZVPB 1GAQA 2HNZB 3HJFA 5IYWA 3VAGA 1S1WA 3R1LA 2CVEA 3AVWA 3I56B 2IBKA 2AJ2A 1REVB 3DU6A 2L41A 2MKSA 2OSQA 4C43A 4OPSA 3P6YC 1YIJB 3PY8A 1RT7A 3M6XA 2KHDA 1FFSB 5HVHA 4DQSA 1RAIB 2OFGX 3PUMA 4IFYA 4C8MA 1LFPA 2RKIB 3NS6A 2ZHBA 3LP1B 4BLBA 5HATA 2D9PA 2RS2A 4P2FA 2IDLA 2XHCA 3PG9A 3HDSA 3HLUA 3FJOA 3HSZA 3M2VA 2AJ4A 1HBNB 2ZM6F 4C11A 2DTJA 2O3DA 3AXKA 4M5JA 5A0YA 3MAAA 1WKLA 2VOOA 1OS5A 4DL3A 2GHPA 2IM2A 3OTEA 2VA3A 2BKNA 4DQIA 1HWJA 1NHUA 1P6TA 4X07A 4XK8C 4C8ZA 5HLFB 4LVOP 4ZVUB 2HQGA 3CW2A 5DQGA 1HARA 2HQIA 4N76A 2C3PA 3Q8UA 3KKFA 1USOA 5GAGI 4IG0A 2P5MA 2KT3A 4EZ9A 4QJVA 1RA7A 2W2QP 1U8SA 5LT5A 2RS8A 4WZKA 1DAXA 1QM9A 2IYIA 1L3VA 3W3SA 1IKWB 3U1LA 3IP0A 3DRSA 1YDLA 3AFGA 5H59A 2OP5A 4L72B 4OHZA 8AT1B 5U47A 4TMXA 3QRRA 4NI2A 3LP2A 1BJTA 4OX6A 1UPMB 3S1MC 4LK0A 4CLLA 1RYSA 3SCLE 1YJWB 2VPXB 4CM2A 2PMZD 1SKQA 2V7WA 3EYZA 1DDGA 3R5BA 5DN6A 2Y1RI 2J9CA 3CAGA 3G6ES 1D0EA 3EGVA 2YX1A 4ASUA 1FFGB 4TU7A 3MM7A 2G0IA 5JUMA 1XBWA 4YFXA 1FWPA 4EI2A 2XS7A 3R1HA 3G6VA 1N5SA 1FE4A 2RH6A 2F8EX 1BGWA 5A8KB 4FS1A 2OO4A 3HHLC 1HI9A 1VQ9B 4Y6IA 2GSOA 2A6HA 3VAHA 5A6PA 1ZS6A 3O44A 3LP0A 3F0NA 3J80U 4ZH4A 1QFYA 3DLKB 1IJFA 2GGPB 4X64F 3SIPB 1SQGA 4UZFA 3OPKA 4Q5VA 1WC6A 3KHHA 3OTBA 3QQCD 3SEJA 2IJFA 2XMVA 2VHGA 3JSMB 4JI1F 1YRUA 4J9MA 2UUAJ 4ILMA 3BREA 3FKBA 4A8SA 2R8KA 3AJDA 4J9RA 4IOAQ 4ECYA 3RBXA 1RABB 4PZVA 3DU5A 1FNDA 4XN0A 3FFIA 1SJ4P 2KRRA 1JKHA 2C2MB 3DYAB 4Y2KA 4KPYA 2RQMA 3BPSP 2Z0GA 3CCJS 3BDEA 1Q78A 3BN4A 4HKQA 2RDJA 1VQ6S 2XB2D 2LU2A 2NXCA 4JK1A 4ER8A 2H65B 1FDDA 2M70A 3RBDA 4MKBA 2C42A 4QBUA 1FRXA 1H72C 2ZBQA 1MWZA 1IXKA 2ZH6A 4Z37A 3RUBL 3EX7B 5A8AA 1S9EB 1HHQA 5CYJA 1NSAA 1QJHA 3ENQA 5E41A 1MNEA 1NKCA 2XBPA 2OPRA 4I6WA 1X9MA 3TX0A 5GMEA 2CNDA 3CMQA 2Z56B 3KJVA 4GTEA 1UA0A 4RW4A 2QG9B 2YY3A 3CMAS 1TELA 3OVSA 3BEGB 1HQUA 1H98A 4DR7J 2CFXA 1E1QA 1IM6A 3D4JA 2X1BA 2FJBB 3KJNB 2UP1A 2HURA 1ITPA 5F0WA 3HSJA 2KB2A 3H9NA 1RT4A 2QYCA 2CJKA 5D0HA 5LL6d 1T11A 2LDIA 3G8QA 5IV3A 4N77A 5L38A 3DLEB 4CIOA 3DM2B 2YU9C 2ZE2B 2VUMK 4KGXB 3JAMY 5DDQC 5EDWA 2YBVA 1NO8A 2VKRA 1EFRA 1DTQB 2WZPP 1YLOA 5HBMB 1M5PC 2CJYB 4Z4VA 3OL8A 1KQSB 1EQMA 5GV8A 1R8CA 3HOXK 1FRNA 1Z1ZA 3NMAA 4NASA 1D8TA 3HFZB 2A10A 5K5MA 2CZVC 1N32J 2HGLA 4XL9A 3SLDA 4M8LA 1KD1D 4XPCA 3GTLK 2ZZTA 2NPFA 2B4UA 3A12A 2J9DA 5KFFA 4DU8A 3MR5A 3K7RA 4TU8A 3ZTQA 1T6XA 2LA6A 1HNIA 1HD1A 2POKA 3MPDA 3HOYK 1TFYA 3I6PA 3PRBA 2ZZGA 2V8PA 3VGTA 1MMLA 4QIFA 4KMAA 1RI7A 4F4YA 2JA5C 1HQEA 2QYGA 4MKAA 3CIZA 2WONA 4C3KA 1RK8A 3JS9A 1FXDA 2GCFA 3V81A 5EGEA 4DK0A 3S6EA 5DG8A 3GFHA 2M2BA 2CXEA 2UUWA 2E2JK 2UUAF 2BJ3A 1M1KT 4N8OA 4XLAA 3R5AA 1B0PA 4C8OA 3R5GA 2NVXA 1VQPS 3SQOP 2E66A 3UD5A 3DDIA 3VQSA 3DN9A 1NSKL 4XKWA 3DOKB 3IWLA 2LQ5A 1XZQA 4BY1C 2VH7A 1YRTA 1N52B 3VMFA 2FJDB 2MZ1A 2CPDA 2ZH4A 3MZIA 4OYXA 1KHWA 2XSJB 3B4MA 5A89A 1VQYA 1D9DA 1RU1A 5A6WA 1YI2S 1O0PA 1TTHB 2JA7C 2F8MA 2IC3B 2ZZNA 2FTRA 2JHEA 4NZ0A 3TO8A 1GE9A 1W0KA 4TMVA 1LWCA 4CTAB 2F8HA 3E8OA 4RZRA 1CVJA 4L8JA 2VZLA 1A7GE 4EO8A 2R7SA 2G0CA 3DXJA 1FKAF 3OFGA 3I4HX 4DR7F 1N8RT 1HHTP 4WZQA 1B4AA 4GKJJ 1X0FA 2KYZA 2P6SA 3HVTB 3RRKA 4F26A 1FRJA 3KG1A 4NWBA 1WCMC 3S14K 3R6JA 4OLOA 1M5HA 3P3DA 1TUWA 3BV8A 4Q7AA 4JI2J 4WILA 4ECWA 4F0HA 4F2RA 4O3RA 1P4MA 2QLFB 2HBZB 1JNYA 2MLYA 2QMUA 3CDAA 4XAKA 6FDRA 2HNYB 3VHQA 3KK1A 3K5MA 2DKOB 1J2VA 1MMDA 1CPZA 3PEJA 4A3FC 4QWAA 2DNGA 5ETTA 2XGJA 1PJ6A 4P26A 2RD5C 2VNIA 2QEXB 2DT9A 2XGQA 4XDCA 1B0TA 1VQSA 4OYPA 3VTIA 3WIVA 3CCWA 2ZOGA 3T5LA 1SFOK 3GR1A 1F9FA 3AJ2A 3TYTA 2ACMA 4C2MK 1UJ4A 2CYYA 4A3EC 4OZ5A 5CYMA 4DCJB 3WC2A 1NU4A 1TU0B 2B43A 3ES9A 1HBMA 3FJ2A 3BP3A 2B51A 4F25A 2EFPA 5CYQB 1FWKA 3TZZA 2RRNA 2IAJA 4KJIA 4KDDA 5IYPA 4WCEQ 1WDDA 2R3VA 3KWMA 4FYWB 5C7PA 3S17C 2MY8A 2ATCB 5CDFA 2CQ0A 4X6AK 3H98A 1B7YB 4DSFA 4C98A 1JJ2R 3MM5B 4JI0J 3TZWA 4Y52C 1MW7A 4TMWA 1UFWA 2XYPB 3CXCR 4EBEA 2GIFA 4CLKA 2XSFA 1FERA 1XNRJ 2FGOA 3IWXA 3TP2A 2NPIA 5J2MA 1VQOS 4NCGA 3GVJA 1RWKB 1T5EA 2W2PP 1RWOB 1RHQB 2VICA 1HFEL 2VJUA 4H4MB 3T1YJ 4LF9J 3MWBA 1UMKA 4F02A 3GTOC 3H7HB 4OJ3A 2RNEA 4LF1A 4DV7J 2K7KA 3OOCA 2DPIA 1UL3A 4ATNA 2VBUA 2VODA 3D1QA 2F1MA 2V7UA 5SZTA 5BXIA 3S1NC 3ISND 3CCSS 4HI1A 3CCLB 3RZOK 3MR6A 4LRCA 3N6LA 5E68A 1OJ4A 1OY8A 3PM9A 2VBVA 2MZJA 3AHPA 2NSBA 1D2EA 4J7CA 2VD3A 3GTPC 4B3XA 2OELA 5KG1A 4I2PB 4L3NA 4DNRB 2QO3A 2CWKA 1G2EA 2E2IK 2V6TA 2YWEA 1UD2A 2A3JA 2Q6OA 1Q95G 4P6YA 4RCZA 4F0MA 3MCNA 4Q2MA 1VQ4S 3RZDK 2VQEF 1VRTA 4WJ4A 2WVDA 2J0SD 5J1NA 4C9DA 5D15A 1QVFB 3I4MC 2WSCC 2ACYA 2R2SA 2ZOFA 2P9GA 3HMJG 2C2DA 3BQJA 1DQ9A 3LF0A 3WBJA 3OW2R 4DR4F 2QLJB 1TWHA 4NA1A 1FFWB 2U1AA 4GKJF 4LQ9A 3UI3A 1WJ9A 4DK1A 2BRLA 4BBRC 3KMSA 5IP9K 1U26A 3BQ1A 3NNAA 3M8PB 4H4KA 2XM3A 2DHSA 5KFUA 1RTDB 5DS0A 3R5CA 1W2IA 2GSNA 1EH1A 1PJ7A 1NSQA 4RLEA 4PCQA 3GR0A 2ZC4A 4K5RA 4E0FA 1JLFA 1Y11A 4DLGA 2FC8A 4PAAA 1N5VA 4Q0BA 1F5CA 3AT1B 2AQ4A 3KLIB 4J9SA 3OUYB 3WC0A 4OOVA 3UQSA 3C6TB 4NL5A 2XULA 2QV6A 4M5KA 3K8VA 3IMQJ 2GS8A 4NLOA 2ZHOA 4DUZJ 1RT5A 4GKKJ 2H9ZA 2WB1L 2CF4A 2GVZB 3I31A 1K1SA 4URSA 1CNEA 3V4IB 4WZEA 1SL0A 2U2FA 3KLEB 2VBWA 3FOEA 4FKYA 1C0AA 2R8IA 3NCQA 4DV2F 2D9OA 2N7YA 4JI0F 4LSNA 3WZ0A 1TWFC 1UW4A 3JB9k 4DR5F 3QGIA 5HP1B 2ZBPA 5DGBA 4DLEA 1RAJA 2G1HA 3NGUA 1HI8A 1UEVA 3G86A 1PCAA 2X1GA 4O3PA 4YOEA 4PPDA 1KTQA 3S1RK 2NVYC 1U6BA 1VQMS 2KI2A 3D6FB 3T1YF 4LF9F 5IV4A 3LH2S 1K83A 1NDPA 3GB0A 4ZPTR 2HHXA 4GO5X 2VJJA 1Q1KA 1RCOB 2ZKUA 4DV7F 1LOUA 3H3VL 1E79A 1VQNB 1HL6A 2DIEA 3DFEA 3EXCX 4KT0C 4L6V3 4NLQA 3MECB 3HM9A 1INNA 2J8SA 3A4TA 3Q8QB 5FJ4A 3HD2A 2VFTA 4HDGA 4PWWA 4P10A 4C2MC 2R92A 4Y28C 3GTKC 5F9LA 2KDOA 5C4JC 3V6JA 3IAS9 3IS9B 3QLHA 1Y9OA 3FCHA 4AT1B 4R5PA 4Y65A 4U9UA 3TOQA 3TUPA 2PC6A 1XIQA 3QATA 2R2TA 1FX4A 4USUA 5IT4A 5B0DA 1YITB 4PC6A 2W7VA 4J9UE 4X4VA 2FJXA 4NBSA 3VGUA 9RUBA 4FM9A 4DQKA 2YKMA 3F41A 3GTGK 1T9TA 2JLGA 2K8GA 2NS1B 2VG6A 2GJIA 1R7IA 4FNIA 4EFAC 4ZVTB 3LAKA 2MKKA 2R9VA 1HNZJ 1P1LA 5I3UA 2A18A 4OIQA 1Y00A 2ZZQA 4IRCA 1Q86T 4GQNA 3ERED 3GJSB 3MHYA 3NKYA 4K2JA 3RU0A 4OI4A 1QAYA 1CULA 5CA5A 5B6IA 2B0GA 1S0VA 4FK8A 3IRWP 3R7BB 1CQNA 2E7XA 2GREA 1YJNS 4BBSK 1TWCK 3FKIK 2JZ5A 2EI5A 5F8HA 2R8JA 3K89A 4XLEA 1N4LA 2H5EA 5GAEU 2Z57B 2XY7A 2DH7A 1R0AA 2VBSA 2IPOB 4GKKF 4ICLA 5HMZA 5M2UA 4FPIA 4LT6A 5D77A 2EFOA 1KKHA 3QGGA 2LQBA 5J1PA 3QT5A 3R7NB 5J2NB 3THPA 4NLYA 1PBAA 5L8RC 2VFUA 2X1FA 3NNCA 2J0XA 4LBHA 3W2HA 2QE5A 3NRBA 4MQ9A 2DNQA 3A3NB 3MF5A 5IC6B 1WELA 2DNRA 3C6UB 5GMDA 2WVFA 4OJGA 3RTVA 3AB4B 2VB6A 1ZM3A 5DSZA 4ETZA 4I68A 4OJHA 2WSSA 1L3SA 2ZH3A 1BQMA 1WKKA 2DCUB 3LGMA 1VGYA 2OPPA 2UVRA 1S6OA 4QUZA 1RTIB 4XDDA 1GXTA 1NB9A 1HHSA 4Y2IA 3SBMA 4J9OA 2LCWA 4W4MA 4LIRA 4YHBA 2CQDA 4K50A 1RTJA 3W2VA 3E01A 3MD3A 4M4SA 4H4OB 4A3LC 4LBYA 4ZVGA 3U7JA 2V4DA 1UEUA 1V3RA 4RD0A 2XGPA 4OPVA 3JYTB 2E5LJ 3BBFA 1OPIA 2ZUGA 2XLKA 2OTJS 1FNBA 2MQMA 2GZOA 4TLRA 1JXVA 1OIAA 2QX0A 4KB4A 4B44A 3CP2A 2Y0SL 4ZGQB 3MMCA 2M0GB 1WEZA 2CADA 5JVGQ 3M6UA 1I3QA 5DETA 1EQ0A 2W25A 3BS9A 4KRWA 1SQFA 3GTJC 5EWGA 3MCAA 4Z7YA 2WK4A 2EBGA 1NXIA 3D3CJ 1JLBB 4ZCKA 2ADBA 3KMQA 1U0HB 3BM7A 4IR1A 3Q89A 2YKNB 5IYBK 2JFKA 4B9NA 1NK0A 2KZMA 3MEEA 3GIJA 1N8RD 3W5VA 4WIQA 4XMYA 5L46A 3MOZA 5KNLA 2DO4A 1IWGA 3M4OC 3WODA 1HNZF 3FQLA 4QU7A 2N7CA 2OPQA 2NXJA 2BW7A 1CG2A 4DWIA 3MHPA 2NVTK 5HSPA 3HX9A 2I9SA 1HWUA 4OI6A 1QFZA 1SC6A 2MPUA 3N0VA 2PA3A 3M3YC 3KHLA 1HLWA 2D69A 3FZ2A 2IM0A 4NEYA 5J1EA 2JWNA 1RYRA 3VO1A 2D3O1 2WYRA 2XQCA 1L3UA 4D3GA 4OYMA 3PO2K 1RBOB 4B3GA 4QYZK 2QN6B 3TAMA 5KFXA 1SCJB 1I94J 1XPPA 1T9UA 5J2PB 3G4SB 1SL2A 3HZGA 2NVXC 4GTBA 4P7TA 4U96A 2A6EA 2R8HA 1N6QB 2ZL6A 2E44A 3KNAA 2HAIA 4RUHA 2HVIA 3J7YI 4XO0A 2GAGC 4M63A 5HROA 2E7WA 1W26A 4UZBA 1BQXA 4OIXA 2EXUA 4LOWA 4LQ3A 4C3LA 4FXUA 4WFNQ 4A48A 2XNCA 1NK9A 2YQ0A 2IRXA 3GZ7A 1FJEB 4B02A 3Q8SB 8RUCA 1AMOA 3FSIA 4Y34A 4HVZA 1B99A 2WZNA 3S1QK 3GEIA 1HZEA 4WTOB 1DG1G 3VVTA 1W25A 4RW7A 5IQQA 5G0RB 3CJKB 3TEGA 5ETNA 4AL6A 2FVGA 3M1VB 1APSA 4UUXA 1Y1WK 3PIOQ 2XCQA 4LBZA 5E6TA 3EWGA 3OV7A 3CCVS 1XC9A 2VPZB 1ZZNA 3L7UA 4QR1A 1F3VA 3DI6B 3CQZC 1SIWB 2AYMA 4FXWA 4JI4F 3L4JA 3FOFA 2MKJA 3JU4A 4M5LA 1W87A 1AZSB 2MY7A 3HHNB 5CH7B 3ETOA 2DEUA 4KKTA 1TL1B 4JI5J 4R8UA 1O26A 4LR2A 1WKJA 2XMKA 1UVIA 2CQ2A 1G7RA 1EP3B 1KQGB 3RR7A 1KK1A 1EQRA 3ET6A 2CNKB 2XHWA 4Z2XA 3T5HA 3CMMA 2W24A 4B9LA 4RW6A 3H4BA 4O0NA 2V63A 2J0WA 1KJZA 3IRXB 4K4ZA 3MM8B 2GQ2A 2A6OA 4F2SA 3ASQA 2MYFA 3Q3QA 1BMQB 1OQ6A 4P3YA 3RW7A 2C3MA 5FLMC 2DGOA 2CPXA 3L3CA 4A3JK 2FLOA 4KKSA 3PX4A 5TV2A 3H2LA 4IFYB 2VDHA 4RD3A 2DGVA 4C8LA 2BDPA 2W6JA 4ZKAA 1O5JA 3M05A 5C44C 3QPIA 2FX3A 4M5IA 3DLLQ 2O66A 1M5KC 3BPDA 5IYNA 3CC2B 4NRUA 1JA1A 1Y0RA 5D3GA 1ZBTA 4USHA 5HXBA 1C1BA 1VBYA 4FXDA 5D0EA 1JK9B 1NK8A 3J81k 1B4BA 4XLPA 3HOUC 3NNHA 1IUJA 2VZ9A 3G8SA 2UU9J 4URQU 1EXMA 1RHUB 2B6AA 2WJVA 2AWZA 3Q39A 1PILA 3NXZA 4ZPWR 3OT9A 4KAIA 3HP6A 4I56A 3T5JA 1P8GA 4IG0B 5K8OA 3NS7B 4DU7A 3QFHA 2B5JB 4QJVB 2FJWA 5B0EA 2BUNA 1EI6A 3CNQP 4KPCA 4LBWA 1FWLA 3NOCA 1FRQA 4ZGNB 3G96A 4E2FB 4ANDA 2M8HA 3DRSB 2PE8A 4O44A 2H54B 1NZAA 3GVKA 1EP4A 3DOLA 5EHHA 2GO9A 2V0NA 4YS2A 2WTFA 3LP2B 4UZCA 5IQ6A 3DKDA 2DHHA 1NBMA 2ZWPA 3JSTA 3TZXA 3CWJA 2B63C 4A3DK 2MSSA 3W63A 2FHJD 2LXFA 5KFTA 4IG3B 2KH9A 3MDFA 1S48A 2DXFA 3FBCA 3MM7B 4HL9A 1VHIA 3NGKA 1RSCA 2XYGB 3EMTA 3DRPB 2FLNA 2C2EA 2BE7D 1S49A 4U7UK 2CJAA 2HZCA 2V34A 4C8YA 2XWYA 1DY3A 4XR6A 3GJQB 3C14A 3LP0B 3CJ8A 2BGIA 4H4KC 1ZETA 4U8YA 3THTA 3J81Y 4GVBA 5FNZA 3H25A 1RKIA 4NLVA 2JDJA 3C46A 1DQAA 4WIIA 1VJSA 1TVCA 3TAPA 1W2BR 1S0UA 2M7SA 2NXUA 1S4MA 4O3QA 1HWKA 2UUBJ 4WU2A 4XLCA 1AXQA 4WTYA 1F9EB 2ERRA 4HH0A 1X5PA 3CCZA 3ONQA 3FFIB 2QA4S 1JKHB 2D7SA 2DRAA 3N01A 4ZDNA 2P6TA 4FVMA 1Z2ZA 2A6MA 4ZP7A 4BY7C 1RT2A 1IKXA 2HHVA 3QZ7A 4ZPVR 2V9WA 3BO3A 2I8EA 2P9EA 5KFOA 1EAYC 4DL4A 2QTLA 3DLGA 1WIHA 5DS7A 3D6HB 3GEHA 5M5WK 1AA1B 2B9XA 1VGXA 1N0UA 2A1BA 4G1PA 1UEKA 2VU5A 3CD6B 4HEA9 1YBTA 3OJUA 4O3NA 1RT6A 3J80Y 4QW9A 2OPRB 1WUUA 1I8DA 2V69A 3KJVB 4NX9A 1Q86D 3ZTRA 4UUWA 2R93A 2AJQA 4RW4B 4IW3B 2VBZA 1U1LA 5IS2A 2PD1A 7AT1B 1E6VA 2LZJA 1HNXJ 2HQDA 2RQ4A 4ED6A 1CJTA 4GTLA 2WRMA 1U2CA 2UU9F 4B3TJ 3OZVA 2R7ZC 1U1OA 4LRDA 1NEEA 3IM9A 2Q1LA 1D8ZA 4PYDA 1V5VA 4AF6A 1N33F 1UWBB 4ENOA 4CO1A 3CPWR 4F3MA 4DFKA 4HACA 3MMJA 2OPSB 4A8KA 3PW7A 5DZ7A 4A3CC 3ZZOA 2OD6A 2CPYA 2AJ1A 3T3FA 2DIUA 1YJUA 4PR6A 4OHXA 1JQWA 4LK1A 1KRPA 1T9YA 2AX0A 1VMBA 4MYTA 4I1TA 2HQCA 1QAJA 1HYSB 3D54A 3GTMA 2KJWA 1SKYB 4AQYJ 3OXGA 1TL7B 3N79A 4ZVHA 3OVAA 3F56A 5H5JA 2JNJA 2XI2A 3IG1A 2ZH2A 5E2QA 4ELUA 2PEBA 2FZKB 4C3HK 1S99A 3H0PA 4LJZA 5HVFA 2B7BA 4OQJA 1HNIB 5KFIA 2ZUEA 1RWPB 4DG1B 5HAOA 1KOHA 1S77D 5KFGA 1O24A 3L4BC 5ETRA 1RWWB 2HWTA 1VQKB 3PJ9A 2C4TA 1HQEB 2D74B 1T9VA 4DPWA 5FIIA 4K4TA 3I56S 2E29A 2DYIA 1D1NA 3LWMA 1RBLA 5CHCB 4LJMA 4KHMA 1UD6A 1YIJS 2NXEA 2PMWA 5LSRA 3U1NA 2UUBF 4NMLA 3KG0A 3CDBA 5IP7K 2QRRA 4FF2A 3I4NC 4OZLA 2GIQA 2AP6A 4WU3A 3AVTA 4WBFA 2RJZA 1BDFA 4C3IK 1OO0B 4Y7CA 1NKBA 1TR0A 5THWA 4IQXA 4Z4TA 2DY9A 4HE5A 3BKTA 3NBPA 1XZQB 4XIUA 5A8WA 3N0BA 5K8NA 2QGFB 3G4CA 5DG9A 4MYUA 3MXHP 4MH8A 4YAOA 2ZXHA 1LW0A 1RTHA 1B64A 1F9HA 3R6LB 4G3IA 2RUSA 2N3OA 4X66F 4QWCA 3TR5A 3JTPA 2JLEA 1NJIT 1DLOA 1LWCB 1TFWA 1QGYA 5IT9U 2W4DA 4CLSA 4A8MP 1H74A 4C0BA 4WZTA 2FC9A 1KLMB 5AJ3J 1H7XA 1LWFA 1HNXF 5AXNA 3HOZC 3FHZA 1EKSA 3F73A 4NLPA 1QX4A 3OHBA 4DUYJ 3TQ1A 2JA6C 2Y1JA 1Q81T 2AU0A 3C15A 3KK1B 1YJWS 4FBUA 1XNQJ 1VR6A 4TXSA 2E5HA 1H85A 1ISEA 1IB0A 4QVAA 2XYHB 4GT9A 5J3OA 4KMUA 4KV8A 1WC3A 1NB0A 3TJ9A 2BN4A 5T7LB 4X7DA 1B4SA 1VQ9S 3UFCX 1I3QC 3D68A 2E7VA 3FBEA 3WBZA 5BYQA 4LSLA 3SCKE 5CYMB 3GIMA 3ZIAA 2HKEA 4P12A 1WQHA 4E0DA 2XMWA 1SKSA 4DR3J 5DGAA 3IAM9 2OEKA 2M5SA 5IYDC 4Q44A 4A8WA 2MQQA 5H9FK 4ZN3A 1NZ8A 1A9NB 4A93C 1T05A 1FKPA 3GDZA 1FJCA 1F7VA 1VJQA 3TJAA 2ZTNA 3DGVA 3PYGA 2HBRB 4O2DA 5BR8J 4UQGA 2AT1B 4DPOA 2ZZEA 2WAQD 1J6WA 3H5YA 4HT7A 4AC9A 1X4GA 4DI6A 1R27B 5J2MB 1C0TA 1MWQA 5C4XC 3PJXA 3NWRA 2VBTA 4NCGB 4DF4A 5E5NA 3BBCA 1X4CA 2BPOA 3GU0A 3MFHA 4J9KA 3WQZA 1S6PA 3RGIA 1Q4RA 5C2CA 1KC8T 3WNCA 2ZKTA 4Q43A 1ZAWA 1HNVB 2AEJA 1IKYA 1MROB 4MK8A 3UDLA 2DETA 4Q7JB 2UVWA 1PYSB 2RHQB 1TWAA 4DSIA 3ZNUA 2UV8G 3J7AN 1L5UA 4XQFA 3PX0A 4YHHF 4BHQA 3BP8C 5F8LA 4ZOSA 4XN3A 3FUYA 1TL3A 1VHFA 4ZIVA 1XXCA 2QDXA 1RQRA 4V19X 2DGSA 2P2CB 5HVGA 4HHUA 5DG7A 5DJBA 1I50C 4OYOA 3HHLA 1VRTB 3CCQB 4A3BK 4OX9F 2ZL7A 3MOJB 4ZCMA 3TUZC 1IL2A 1VLYA 1R6YA 4F4XA 1SC4B 4PXBA 1VQ7S 3DLHA 4NLGA 1CJKA 4PG8A 3Q8YA 1N5QA 5C24A 2HDNB 5IORA 4LFBF 1FK9A 3Q38A 1IJEA 1C2PA 4KARA 1RADB 2UVVA 2V6SA 4MT1A 3ASPA 3I87A 4TU9A 3QIPA 1KFSA 4OMFG 5J35A 2HLTA 3I9V9 2H51B 4DUYF 4U7UD 3QMQA 4PG7A 4QYRA 5D0RA 1ZYQA 1WQGA 3W9IA 3UN2A 1H8HA 1HPZA 1XNQF 5GAHU 4XLNA 1KTVA 2GMJA 3PFOA 1H7WA 3DOMB 2AEMA 2KFNA 4DL0C 2DNKA 3GP9A 2FQTA 3G6EB 4Q0BB 5DLFA 1ACMB 1SB6A 1SVDA 4IFVA 1KLNA 1RA6A 3JTNA 2BKPA 1KVIA 1SJ3P 2ZFHA 3AVUA 2VASA 4OOSA 1PIEA 3W61A 2IA6A 1FO1A 3WDOA 4X8IA 1UFKA 1LNQA 2ZDPA 2EFGA 4B3SJ 3JSBA 2FVQA 2HRTA 1I18A
chains in the Genus database with same CATH topology
3TFIA 1PJ7A 1XZQB 1X31C 1XZPB 1WOOA 3GEEA 3GEIA 3AD7C 3TTGA 3TFJA 1WORA 3GEHA 1VRQC 4PABA 3GIRA 1NRKA 3A8IA 1V5VA 1WOPA 3TFHA 3ADAC 1PJ6A 1WSVA 5L46A 1VLYA 2GAGC 4P9SA 4PAAA 1WSRA 3A8KA