1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
3TFHA 3TFJA 3TTGA 1WOSA 1XZPB 1YX2A 4PABA 3A8JA 1VLOA 1VLYA 2GAGC 3GEEA 3TFIA 1XZQB 3GEHA 3AD8C 3AD9C 1VRQC 3GEIA 5L46A 1WOPA 1PJ7A 3ADAC 2GAHC 1PJ6A 3A8IA 1WORA 1XZPA 1WSRA 3AD7C 4PAAA 1X31C 1PJ5A 1WSVA 1NRKA 1V5VA 1XZQA 4P9SA 3GIRA 3A8KA 1WOOA 3GSIA
chains in the Genus database with same CATH superfamily
3QIPB 4ZVEA 3DYAB 4U9UA 5IWAF 2O1PA 2ZM6J 4LBPA 1WHXA 4DSJA 5M5YK 3SZ2A 2HRYA 2XCPA 3ENVA 4GTEA 2G0CA 4AH6A 3ZZ0A 1X5SA 1RCOB 1RA7A 3OPKA 5CCMA 3NAHA 4HR2A 1N34J 1U09A 5B0DA 1CJKB 4QBUA 4HACB 4IO1A 5B08A 2ZUEA 1NJID 1S1WB 5HVHA 2HZAA 1U6BA 2R7VA 3GVLA 1W2BR 3R5AA 1YI2S 3H25A 5D6GA 3H5XA 1YIJS 2ZH3A 2DHGA 5DG8A 1Y00A 3OHAA 4N76A 2FLPA 2XMUA 1P1LA 1X4HA 3PFEA 3GIIA 2RMLA 4ILMA 1U2CA 1AIPA 2V7XA 1NKBA 1NKCA 4KASA 2V7WA 2ASLA 3QNWB 2KI2A 4X06A 2MQQA 3OBIA 4EYIB 2W7AA 2YU9C 3ASPA 4A93C 4QW8A 2DNNA 4KHPJ 4G0UA 2AGQA 3THPA 4G65A 3ITHA 2M2BA 4M63A 2NZ4A 1S76D 4IDKB 5IYDC 1RAOA 1TL1A 3VGSA 1PKUA 5ETQA 2L48A 2HGMA 3QO9B 3MURP 2V4QA 1MWQA 4FXUA 3KKFA 3MEDA 4C48A 3PR4A 4ZLLA 1N33F 5H9FK 4OZ3A 3MPUB 4M5IA 1XK8A 1N32J 4FNIA 1TK5A 3KG4A 1Z4UA 3B54A 2ZBRA 1UEUA 1VYAA 4DR7F 1QE1B 5HANA 2CK3A 1H42A 3DCAA 4II2A 2DIVA 2M8HA 3CCRS 3ERED 2PPBA 5F9LA 4PQUB 3GMGA 3WBJA 1D0EA 2MGZB 3H42A 3N3YA 1XBWA 2GMJA 4MEXA 3DI6A 3K7RA 1IN0A 1NLKL 1PBAA 4N47A 2VG7B 2MDAA 4NLQA 3HO1A 1SQGA 3D54A 4RNMA 1VQOB 3BYRA 4A3IC 4FK8A 2R7OA 3I9ZA 3Q89A 5BSXA 2EWHA 4WBFA 3KJVA 1N6QB 1N33J 1NMEB 2BXJA 2BA9A 3CCJS 2YH0A 2HWIA 1WUUA 4NCGB 3BBBA 2JN9A 5K8NA 1S1VA 4Y65A 1S0NA 1XR5A 3C6UB 3VZHA 1S9GA 2MKIA 4LF8J 5L1JA 3MFIA 4DPTA 5D78A 4XONA 4KARA 4IFYB 2W9BB 1TL3A 1FWKA 4JI6J 1UEKA 2Z57B 4WTOB 5DG7A 5M5XK 4R0JA 3EPGA 3C6TA 3MR7A 2E5HA 4KV8B 4ZHRB 2B4OA 1U1PA 2A10A 1ICEB 2IPOB 4O23A 4FKXA 2CG4A 2NLWA 5K8PA 1IUJA 2IVMA 4ELUA 3PTWA 1HNWF 1RQPA 2VG5A 1Q78A 3AB4B 1DCOA 3DRRB 4Z4TA 1TWFA 2AHOA 3EJMA 5F0WA 1GVHA 4CWBA 1D1UA 2YQ0A 4ERDA 1UV7A 1YRXA 4DPUA 1M5PC 4KJIA 5HL8A 4DSLA 3I5BA 4EUVA 4ZCKA 4NXNF 1LWCB 5BYRA 1FD2A 2BPOA 4KKOA 1A7GE 4NXMF 1QFZA 4C3JK 3A3GA 4PGOA 3RZDC 1S6PA 3MPYA 3A8IA 4TVAB 3M8ZA 3LGHA 2KHCA 3SEJA 2VICA 3M1VB 4ZLJA 3QX3A 4A8QA 4I6AA 4QR2A 4H4MB 2B9XA 1U24A 4OJ1A 2V4JA 2RT3A 5LJ3Y 1Y0YA 1JJCB 2DHSA 3ILJA 3IS9B 4E8UA 4KN7A 3GR0A 1JMTA 1LK5A 4KHRA 3WYAA 3WIUA 5BYQA 3CJ0A 3DLKB 4OYOA 4LF6F 2HNZB 4LSNB 2PA8D 1SH3A 2RUSA 1RYRA 3BBFA 2X51A 3R6JA 2YBVA 2MY7A 4CQ1A 2FJVA 1OJ4A 1IM4A 3ILIA 3Q2SC 4MKYA 3OPFA 3W5ZA 5EGEA 4F50A 1S77D 1DCPA 1JKHA 5AXMA 2VA2A 2OEMA 4E98A 4OPSA 2BJ8A 1TK8A 1JLAA 1VIOA 3LP1B 3S16C 3MMLB 1UVJA 3GONA 4HDHA 4KH0B 2ILYA 2AX1A 4DSEA 4FDFA 4KSEB 3KMSA 4OX6A 2P9CA 2L3MA 1OPIA 1AUDA 3TA2A 4C9DA 3DDKA 1F60A 1JJ2B 2CXEA 1E1RA 3TW0A 5G0RB 5GMEA 1NNDA 4LF6J 2L9WA 4FBTA 3TTGA 4YAUA 1O8BA 3D6TB 1R0BG 1YBUA 4F4XA 1KFSA 1ZZFA 2KWAA 3HKWA 2NXUA 2HBYB 2FJXA 4IFVB 3THTA 8RUCA 2FB0A 1WJ9A 4A8FA 1HW9A 4JV5J 3IFEA 1YNJA 2EEYA 2JOQA 1HWJA 4OJ3A 2OP5A 1E6VA 3OR2B 4I7FA 3H5UA 4QV2A 3SJPA 1WORA 3BGRA 2JH3A 2RU3A 3PG9A 5IYNA 4IRCA 4OL8A 1SXLA 2R92K 2L41A 4EU0A 2D3NA 1FD8A 3CW2A 1TKTB 3LAMA 3QE2A 1MWZA 1R0AB 3JAMY 2E1RA 5CD4A 2B51A 2XS5A 2OPRB 2JWNA 1JNRB 2VFVA 4RD6A 3AJ2A 1R9TA 3W2WB 3DLLQ 1WTFA 2FLOA 4RBTA 1B99A 1PG5B 2HKEA 3UDCA 2VG6A 5MLCV 4B9SA 2OKQA 3HOYK 4QIFA 2UVRA 4TMWA 3AT1B 3GB0A 1GQEA 4DV7F 2C2ZB 1S49A 2PMZL 4MFBA 2ZNZA 2D1CA 3KLEA 5AJ3F 1NPPA 1HNVB 3GEIA 4QU6A 2ZDOA 2QGFB 5I3UB 2UXBF 3BSAA 5E68A 1RKIA 4JV2A 3GTYX 2YNHA 4KFBB 5LMUF 2F1LA 2KFZA 3CD5A 4ZITA 2R8JA 3O5TB 1R9TK 2VBUA 1XNQF 5IYCK 1IKXA 4A3MK 1Z1ZA 4Z7YA 1NK7A 1GAQA 3D3CJ 5C24A 2CJAA 3I1FA 1O0PA 2IAJB 1AFJA 1N52B 1RAEB 4WZLA 2CPXA 1FNBA 2F8HA 1Q16B 2IVFB 3LPEA 1H73A 2DRBA 3J81Y 1HA1A 1MW7A 5LXRA 1WWHA 2JIZA 3M32B 2JA6A 3ZIAA 1ZS6A 5D3GB 4KAWX 3SIPB 5IOQA 4RX6A 4Z1MA 1KP6A 3QSIA 3MMCA 3HF5A 1JXVA 3HLUA 2WRMA 1U8SA 2QYGA 1RT3B 2AF6A 1ZYQA 1T95A 5KFGA 4N3GA 2QG9B 3ILOA 1XNQJ 2KH9A 4DV3F 2ZH1A 2P8TA 2DOGA 1Q86T 2XNRA 2QE7A 1RHKB 2DGOA 5B7WA 3OJWA 1JXLA 2BDPA 2QO3A 1UP1A 4USMA 1QG0A 4OZ1A 2OBRA 4B17A 1GH8A 4K2JA 2V8PA 4LBZA 4K50A 1D1NA 2EBGA 1O24A 3MPDA 4NNJA 1NHVA 3KFWX 1WDDA 4P22A 2CZVC 1RADB 3MWBA 5J2QB 4LF5F 3MUVP 1T94A 2ZH4A 4DI6A 3L4BC 1J98A 5C42A 2OPPB 2VOPA 2V67A 3ASQA 3HOXK 4X66J 3D67A 2ZZTA 2ZVIA 5HO4A 3ENAA 2BEFA 3I55B 1MMDA 4KH1B 3G8SA 4IRDA 1JJ2R 1UEVA 4C3JC 1XMOF 4X4UA 1N5YB 2UV8G 2LA4A 2QIFA 4LBHA 2CVIA 3NOGA 3VV2B 3AA8A 4C0OC 2YKAA 2DGSA 4YDDB 1RUSA 3KLGA 4DV3J 1IKVB 2HFVA 2MQ8A 3A3PB 1S99A 2V8VA 2IA0A 4AYBL 2DBBA 2BJ9A 4P5BA 1YJVA 3MM6A 1YJ9B 2MY8A 4RMFA 4A3LK 1YK9A 1ROFA 5KFIA 4IQXA 3DU6A 1KLNA 4N5SA 5F3ZA 2QN6B 2CJ9A 3MR3A 1SQEA 2F63A 1WOOA 3MEGA 3MMPA 1T05A 4NLWA 3CMAS 2VB6A 4LF5J 1WCMA 4LF9J 3BO3A 2CPDA 2K06A 3T5KA 2NVQK 1EQ0A 4CYUB 3GYGA 1Q5YA 1XXBA 4Y2KA 3H3VD 1R31A 2FUG9 4ZGNB 1XMOJ 3QPIA 1MU2A 3MAQA 3N0VA 4XOTA 1PC5A 1X7VA 1JK9B 3MM7B 1VQ6S 3J7A1 3NUHA 3OLAA 2Y1RI 1S0UA 4NLUA 3TA0A 1VK3A 4HT7A 4ZVHA 1WCMK 1YRTA 1L3UA 4A3FC 2YX4A 4ZCIA 3GR1A 4Q0BA 1CVJA 1DTTB 1ZAWA 4YXWA 3PA1A 3JQMA 2CQCA 5GADU 4GVLA 2LEBA 1SPBP 1DTQA 4TY8A 3CCLB 2WB1L 1QAYA 1VISA 5DS0A 5IT9Y 4DV0F 2B7CB 2PEHA 5CXTA 3VAFA 1BWVA 4TMTA 4C6AA 3MCOA 1OYDA 1Y0RA 2DR8A 3CULA 4OX7A 4XSZA 2F43A 4PKDB 1T5EA 1YITB 2ERRA 1RU2A 5IT4A 3GTLK 2GAGC 2CQPA 2Q6CA 3QFTA 1SH0A 1G3OA 2M7SA 1G7CA 1FE0A 3KHLA 1TMMA 3I4NK 4OI2A 2QMUA 1GMUA 3OPOA 2R92C 3R5GA 5E3QA 1RA6A 3QGHA 4ELVA 4LBYA 2JEJA 2OIHA 4NLVA 4R8UB 3MM9A 1CS4A 4YOEA 4PG4A 3J80Y 1QUFA 4DL0C 1J9ZA 2PIIA 1UWBB 4IR9A 2JC0A 2OFHX 4M1KA 3GPAA 1ULRA 5KFPA 5DZ6A 5THXA 4ANCA 1AFIA 3HCXA 4KGXB 4CNZA 1GAWA 2G2YA 4NOHA 3J7ZT 3CDUA 4NRTA 5DG9A 4DUTA 3ILLA 1S12A 1VRUA 4WJBA 4PUOB 4P73A 1HBUA 4B9LA 3RR8A 1T7PA 4Z4ZA 4URQU 2PE3A 1K83A 3CUNA 1S1UA 4BWMA 1X4GA 4GTAA 5B0GA 2BGIA 1RK8A 3JTNA 3NOCA 2HNYB 3MGJA 1QGAA 3Q8UA 1X60A 2PA3A 2RH3A 1NK8A 3SSSA 4P2FA 5IYCC 3C8YA 4RKUC 2MLZA 4A3MC 1N48A 4ETZA 4LREA 2QL9B 5GVQA 3D28A 2E2HA 4OYXA 1FJEB 2OPSB 2AT1B 1HWKA 3IP0A 1YRUA 4IG3A 4KTQA 3RZOK 1WDTA 4CZCA 3A8KA 4NLYA 2XC9A 4LRFA 4BC9A 1X5PA 2Y0SD 4C3MA 3VNVA 3VCDA 3ZTPA 4F3MA 3DDNA 1IJFB 2F65A 1W0KA 4B02A 3GTGK 4C11B 3GIMA 3TR5A 4QCLA 1PAUB 5F41A 1NO8A 4AQYJ 5J2NA 1SKSA 3FSIA 1I6HK 4EYHB 2E2HK 5GAEU 2QL5B 3DKDA 3FEZA 1TWAA 1CJTB 3VR6A 2D74A 1M1HA 4Y3CA 5CHCB 2AD9A 2KN4A 4XDDA 3BREA 3V5RA 3FSXA 4JK1A 2HVIA 4XORA 2LKZA 1HQMA 3DLJA 4N7TA 1U25A 4YFXA 1VBKA 1XN9A 2IHR1 4HL9A 2Y1LB 2ZUGA 2W9CB 3K5LA 5A2QY 3HKZD 4FYVB 4P6VF 5IYQA 3MMBB 4PZVA 3RB0A 1V9OA 2ZTGA 4MAKA 5FO1A 2RQCA 3VO2A 2XMVA 2WOMA 1WHYA 4UQTA 3U1NA 2H5IB 4MK8A 5HP1A 1OB0A 1TWAK 1UD3A 4X4SA 1G7RA 3BGOP 5KFCA 2VYQA 4UY8T 2ATLA 4CLKA 4EGLA 2NUHA 5KG1A 3MECA 1RWUA 2EG1A 4ECXA 3LPYA 1USOA 2JDIA 3TJAA 4E0DA 2CA9A 5FLXU 4RDJA 2X6YA 2CQ0A 3ITHB 3OW2B 1H6KX 2DIEA 2B8QA 4KPCA 3H9NA 2LEAA 1WKLA 1TWCA 1UAWA 2BQRA 1JLCA 1A0OB 1HQ2A 4J37A 2QDXA 4A3LC 3MEDB 4KMUA 4NLDA 3SJZA 1Y5NB 5ETSA 2D6FC 3CCWA 5GV7A 5L38A 1SJ4P 4J5OA 4KAIA 2BV3A 3DXJA 5U47A 3FPPA 4I0WA 1W35A 9ATCB 4X7DA 7AT1B 1S4EA 2CYYA 1Q4RA 4B3OA 3CAGA 1B64A 4NLSA 1T03A 3QFRA 1XZQA 5CYQB 2IVYA 1KK0A 4B08A 1YJ9S 3I96A 2U1AA 4NLXA 3DI6B 3EXCX 4FXVA 1YG0A 2RDDA 4KYZA 1S0VA 2B4PA 2YY3A 4USUA 5BYSA 4ZPCA 1T6XA 3ZZYA 2UU9F 1P4MA 2AYEA 3CXCB 4BHQA 2CFAB 1RQ0A 2M70A 1K0VA 3LOUA 2BQUA 2QFJA 3T5LA 8ATCB 3W9IA 2MTLA 2YTCA 4KDDA 2EKYA 2F3JA 3IBWA 1JXEA 1S9GB 2YNIA 1KRPA 1FKAF 4BS2A 5D77A 4DR2J 3DRYA 3JYTA 5C4XK 4JV1A 3CCSB 1TL3B 3H5YA 1VC0A 5J1NA 3MPWA 5FIIA 1BWEA 4FS1A 5CHPA 4YELA 2C28A 2DTJA 3GTLC 2E29A 1WEYA 2YPZA 4KN4A 2FZKB 1LWFB 1QUEA 5HATA 2WYRA 5M2RA 2XWXA 3G82A 3I4NC 2LXUA 1IVZA 3W2IA 3OAAA 1DHMA 2AGPA 3QIDA 1NK0A 5GAHU 4Y6IA 1BXNA 3UN2A 4RU2A 3DRSA 4LFBF 2V9KA 3W5YA 2VG5B 3DMJA 3HD1A 1JNZB 4MKBA 4A3GK 3VMFA 1VOMA 1FRHA 3VZIA 2AHOB 5DDOC 2DR9A 1YITS 2AEJA 4XNFA 2H3EB 5HL7Q 4YY3J 4KO0B 2RSQA 1FDAA 5ETNA 3UR0A 1N36F 4UOCA 3LP0B 1VQKB 4FVCA 2O5JA 4A3DK 4WQMA 1YZ7A 4KKOB 1HBMA 2ZD1A 2DNOA 4OIXA 1U6FA 5K5MA 4N3NA 1OY8A 3P27A 4FZBA 4OLPA 1YJWB 4EK2A 5AXNA 2MKJA 3GTOA 2VBVA 4G1IA 2EFQA 4P5AA 4KE5A 2VA3A 2R8GA 2AWZA 1RT1A 4LFBJ 1K1SA 2V4JB 5L8RC 1Q8BA 5EGYA 1U2RA 4P3YA 2VFTA 4ZVGA 2H65B 3RZOC 4CO0A 1BUXA 4OHXA 3OR1A 3OW2R 4F0MA 2DGXA 3GTGC 2G2OA 4CM0A 1QJHA 2JZ5A 4TYBA 4QWDA 1N36J 1B23P 3CC7B 4LF1A 3GTOK 4RUAA 2R7RA 1JKHB 3OJUA 3MAHA 1I6HC 2VBXA 2G9OA 1N08A 1UL3A 3BN7A 3R5JB 1JLAB 5KFFA 1TFYA 1R8BA 3NGSA 4LQYA 3I82A 3JU4A 1JLEA 1VQMB 1TVRB 3PDNA 3F0NA 2B7BA 3R2DJ 3M30A 3LALA 4B3MF 2C78A 3V4GA 5ITHA 5KW9A 4LOWA 2GC8A 2V9WA 2XY6A 1I50K 2FTRA 2Z2LA 3MOJB 3FRZA 2ZOMA 2FVPA 1F60B 1H2UX 1LW2A 2KT5A 3JQQA 5L46A 4DPYA 3G71B 1KN6A 4OQJA 2BKPA 3M2UB 1Q95G 3E3XA 3FCHA 4HTJA 1FDNA 4QIGA 1W9XA 3CXCR 5SUHA 2KFYA 5DM6Q 3BGLA 1NK4A 1RWNB 4C2MC 1Q82D 3A8JA 3LTOA 4GKJJ 2CNKB 1FXDA 1UPMB 4R0EA 5F9NA 3OFNA 4WZKA 4OYAA 1X31C 5I4MA 4G1PA 1E6VB 5CD4H 1T3NA 1KK3A 4QWEA 3JSRA 1KQKA 3HVTA 1D2EA 4LF4F 3BGRB 4O4RA 1FTCA 4CH0S 2XI3A 2QSFA 2RNEA 1EP2B 3IRXA 4ZCLA 1URRA 1HYSA 3IRWP 3H4DA 3EDRB 4M5HA 4USHA 3AVXA 4O3PA 1DFDA 4ETXA 1S72B 2XGQA 2RE1A 1APSA 5AN9A 1BQMA 3GTJA 1NK5A 4FBUA 1EP1B 3QLHB 2WVDA 3BR9A 2ZBIA 4OHVA 1S59A 3GCWP 2RRAA 2E2IK 3V2UC 2CFXA 2GJPA 2VG6B 5IYBK 4TT3A 3R2CJ 2JSXA 4RLZA 2NVYA 1F5BA 1IQTA 4CDIA 4DPWA 3HI9A 1M5HA 2YKQA 2QA4B 1NSQA 3KLEB 4A3KK 4DUZF 5IOLA 3DLGA 4OZ5A 4HLBA 1KOOA 5SZTA 2YNHB 2WR8A 1FNMA 1HQUA 4LF4J 2MHEA 2HCJB 3AY0A 2MKKA 1VQ8S 3Q8VA 2PHCB 4IW3B 1UD8A 4P72A 1QUPA 3EZUA 3QT5A 5KFLA 4B3TF 2IA6A 3T02A 2QC3A 2RQKA 1IKXB 1F9EB 3ELHA 4NEYA 1JQGA 1UVMA 5JFEA 1S79A 3JS9A 2BOAA 2ZHAA 4NWBA 4LSZB 3Q8SB 4QIWL 1EXMA 4X4NA 1NM2A 4A8OA 3V81A 4DS5A 2RUGA 2DYIA 2IM3A 4BXXC 1MN9A 3IN5A 3Q8QB 2R7TA 3SV3A 3TO8A 5C2CA 2E5IA 4M5GA 3TX8A 4WFNQ 4JI1F 5C4XC 2YNGA 3HHLA 2FJEB 3VR1A 4WP3A 3D0HE 4O44A 2A2CA 1UA1A 4U96A 1S10A 1J2VA 5EN1A 2ZZNA 5A6WA 3MMCB 2O01C 3DXSX 2QLBB 4FPIA 4NA2A 3R7BB 4C4WA 1Q81T 5ETLA 1G6BA 2ZEJA 4GTBA 3RR7A 3HSDA 3T1HF 1SFOA 3N5FA 4B3TJ 2D3O1 4C97A 4L8JA 4UZUA 1FK9A 1NZ8A 1RDRA 3GSDA 1OQ3A 4YALA 1SKRA 2EFGA 2XO6A 2GA7A 1QTNB 1WI6A 2W7VA 4Y7CA 3TVKA 1M1KT 3ISNC 4A3GC 4ASUA 2ZL5A 2CQGA 5GADI 1HR0F 1Q1KA 1SJQA 5FL7A 4YR2A 2XMWA 1N56A 4YR0A 2VJIA 4OOSA 1X4FA 2GJ2A 4JI1J 5IP7K 4Z4WA 5C42B 1RTHB 2JEGA 1IBLF 3SQGB 1BX1A 1FRQA 4A3DC 1SFOK 5CAAA 5HJYA 4KIAA 2B9YA 4GZYA 3R1LA 4J9RA 2ZC3A 3PKMA 2WZNA 2XBPA 2ROEA 2XZOA 1VQ7S 1O2BA 3G05A 3W2HA 2FQOA 4A46A 2HHVA 3KLGB 3R97A 1I6JA 2HS4A 2VDHA 3GZ7A 3NNCA 2QTWA 1WG5A 2N3OA 2XB2D 4NLRA 4KGMA 1XR7A 5FNZA 1OGJA 1H74A 1R8HA 1VQKS 2OBSA 5EWGA 1QAIA 2ATCB 4NL5A 3LP2A 5A8WB 4LIRA 3SCLE 4RNNA 1KVKA 1T05B 1S6UA 1RHQB 3HX9A 4OI3A 4C8ZA 5B6IA 2WSSA 4ED3A 3EQLA 2HBQB 3PM9A 4JOUA 3E01B 3U2QA 2CJYB 4GQNA 4PXEA 1VQLB 3NWGA 4UTGA 2F4VF 4G1VA 1JX4A 1H3DA 4RU9A 4GC6A 2HBRB 4WU2A 3T1YF 3BQ1A 1EFUA 2UVUA 1BX0A 4OZLA 5HROA 3KHGA 1I50C 4TN2A 1SUQA 4ECUA 2N3LA 5D0GA 3W2VB 2LU1A 4N77A 4Q0BB 1X4BA 3GVKA 2HQ3A 4DBQA 1RTIA 5A8KA 3SDEA 2E1MC 1P8GA 2R3VA 1LXJA 3MHPA 3GTQK 1DTQB 2XWYA 4TY8B 4JI2F 3CGIA 3GCXP 1FT8A 1VQMS 1FX4A 4RBVA 2GNKA 2GVZA 4UZCA 3KHRA 1MABA 2OSRA 2PSZA 4ZVUB 5GAEI 1VK8A 1KRHA 2ZL6A 2X53S 1TKZA 1S1XB 1SC4B 1UD2A 1G7CB 3T1YJ 2HLDA 1F9HA 1LWXA 1ZBSA 2P3MA 1RAFB 3MCNA 4FF2A 4RW7B 3G4CA 4PC6A 1GXTA 3MM9B 2LDYA 1IKWB 2Z8QA 1NUEA 4RUHA 3BUEA 1KLMA 3AJ1A 2RILA 1JLGB 2E2IC 5ETVA 2MLYA 5CJ9A 3RW6A 2VJJA 1JNYA 5IYBC 4OI4A 2QLWA 1ZZNA 4OINA 4DDFA 3KJFB 1ZM9A 1HW8A 1VRUB 2E7WA 5F8GA 2DEUA 1S1UB 2BANA 2DH8A 2HLTA 4WU3A 2LQBA 3TOQA 5C25B 2A18A 4X6AK 2FGCA 1S72S 1KFDA 1EZZB 3VALA 1K8AD 4I6WA 1TWHA 2JJ4D 3OVBA 1GAOA 2XSFA 2V63A 1KC8T 5F4JA 4DR4F 5LXYA 1CJVB 2H5EA 5KFDA 5TMFA 1SKQA 3PJXA 3A3OB 1VQNB 2HNDA 4AL6A 1ZA2B 1FDRA 2YX1A 3NMAA 3KNAA 3WXMA 1AZSB 2RF2B 3AOBA 3KNGA 3EVOA 4Q8FA 4IG3B 1LEOA 4LR2A 3CP2A 4RDLA 1WF1A 4P2MA 3ZPNA 1SB6A 2WZPP 5HLFA 3QGPA 3DLHA 1BE4A 3EGVA 1XZPA 4JI4J 5H5JA 1UCNA 2C2DA 3JQRA 2HWHA 3G4AA 2EK6A 2N4DA 1TWHK 2V31A 2BMWA 4AF7A 1IQ0A 4Y28C 5J2NB 5LM7E 3LGNA 4OYZA 4MIAA 5BR8F 1DQAA 1MN7A 4HH0A 3OFEA 4ED0A 4DQRA 3T3FA 4RW6A 4DR4J 1OS5A 1BD6A 2AYMA 2F9DA 4K4XA 1JLBA 2Y8YA 4W4MA 1FRNA 4O3QA 1GE9A 4Y2CA 4U7CA 3CCUB 1TQLA 3K5NA 2HPUA 1H7XA 2DNPA 3IWNC 5DJBA 2OBTA 4PRFA 1LWEB 1U2FA 2AU0A 4FVMA 5J2PA 2D9RA 5IP7C 2JC1A 4ZK7M 5HP1B 2G4BA 4OPOA 3OEHA 1KOHA 5H9FJ 4IOAQ 4CRJA 4KMHA 1ITPA 2X6WA 3MECB 1S7HA 3ONYA 2QEXS 2D3OR 2DR6A 3GG0A 2F5GA 3CIZA 2MYFA 1R6VA 3RBZA 1U1LA 3SCKE 5JVHQ 2CAJA 1KS2A 1CPZA 2GK7A 5MAOA 3CE8A 1WHVA 1R27B 1RXOB 1IBMF 3W2FA 5GAHI 2HVZA 3FZ2A 4BLGA 3LWLA 4ILDA 1JLCB 1Q7YD 1H98A 4BBRK 1GK8A 1C0UB 3LUYA 3M2RB 5C44K 4FP9A 5B09A 1IBCB 3BKUA 2QLFB 1I3QA 2E7VA 2VZLA 5ETTA 1UD5A 1TFWA 1VJQA 4WTYA 4O0IA 2WHOA 2Q1LA 4J3NA 2LU2A 4FZVA 4MIWA 2V8HA 2UXDF 2OEKA 2X6XA 2P6SA 1FESA 2RRNA 4GRSA 2ZZFA 3QWUA 1QM9A 4HE5A 4XSXA 1YJUA 4B3OB 2EFNA 3AFGA 1G7SA 4P25A 3M9MB 2QZ8A 3WY9A 1SKUB 1XZQB 5D4DA 2HURA 2KG1A 1WG4A 4MQ9A 2V5HG 2VNHA 4F25A 3QSYA 1GMWA 3M9NB 4RCZA 4ZLPA 3NGKA 4B3XA 2VFSA 2BGJA 1IBMJ 4Q7AA 1WPCA 2AKWB 4ZPWR 3VA7A 1T9TA 1OY9A 4WILA 5DDRC 4L75A 1D9FA 3RRGA 2G0IA 1Y5IB 1X9MA 2W7OA 1TU0B 2D3ZA 4N8NA 2Z58B 4PYDA 1EH1A 3TZZA 1NCLA 1FFSB 3GTQC 2UXDJ 3BV8A 4XIUA 2NPIA 3CPWB 1HA3A 1X5TA 2RS8A 2RH6A 4OZNA 2M9KA 1PYSB 2HHUA 3NEKA 3K5PA 1FRLA 3FBBA 4XLFA 4Y34A 4RR5A 3KK1A 1WOSA 4XMYA 3WX8A 3LQ6A 1IE0A 2J76E 3AXMA 5IP9K 1TK0A 4PG5A 2W01A 2V2ZA 3NGTA 2ASDA 1F5CA 1A6LA 6AT1B 4GC7A 3QT6A 7FDRA 3G82B 2HHPA 1YHQB 3J7AN 5IYPA 1F9NA 4ECWA 3TJ9A 3CDBA 4JI0F 2F8MA 4ED7A 3DRSB 3NAIA 4R5PA 2MQOA 5BSYA 1WSRA 3DMJB 2Z2ZA 1S5ZA 4X65F 4KMDA 2DH9A 4NYZA 2X7IA 1NDPA 2HW3A 4LC0A 2LXIA 4JI8F 4XN3A 3P96A 1S4MA 3BR8A 3M4OC 3C3LA 2QRRA 4JV0A 4CP5A 2JEFA 1TMJA 4C3KA 5IC4B 3J81j 3OFHA 2R2SA 2ZFZA 4JI7F 2DNHA 4QIEA 2R7UA 1RU1A 3I0RA 3W66A 4P2SA 2R4FA 3UI3A 2WCXA 3QRQA 4EI2A 2ZOFA 2ZD1B 1H85A 4L76A 5RUBA 3RB6A 4X6AC 4JI3F 1T9XA 3UQSA 2XLIA 4UZEA 2OK7A 1RHRB 4Q2MA 3V76A 3BP8C 1M90D 1FO1A 1VQ9B 2VF3A 2XS7A 3UO0A 3O8WA 3PXGa 4JI0J 1FNOA 3Q86A 2HSEB 5E3PA 3SSQA 5J2MA 4Y7NC 2C2KB 1FTRA 7FD1A 5T14A 4J9PA 4X65J 3G86A 5CZVA 3K8WA 4HHJA 4YB5A 3J7YU 4G7WA 2XHWA 4RD0A 3FKSA 1ZOTA 3JTOA 2ZOGA 4AL7A 3OR1B 2D7SA 4UOHA 1O2FB 2XGJA 2WAQD 3EVWA 2JA8C 2G1HA 4ZDNA 3K8VA 3HHKA 1TWHC 5IM0B 3BY2A 2PGCA 1HNXF 2CKWA 3RBEA 3OZUA 2CJXB 2VQFF 2A0FB 1BQNA 3L7OA 3NS6A 1QDUB 4WIQA 4G7OA 5EWEA 4ZJQA 1UVIA 2UUWA 3TI0A 1WKJA 1U1KA 4P2NA 2XYHB 2NYHA 4MJKA 3CCVB 3H2LA 3PW4A 2MJNA 1JLEB 1HD1A 2GGPA 2JLFA 4AXIA 2KO1A 4K0KJ 4PG8A 2B7BB 5T41A 2P5MA 4F0HA 2WJVA 1CQMA 2FX3A 1RLCL 1DG1G 3W7BA 3BQJA 3OSPA 4X64J 2Y3YA 3L4JA 1EQMA 1LW2B 2B43A 2C4UA 5F8LA 2D9OA 1J5OA 2OELA 5K9FA 1NJWA 2Q43A 3S14K 2RQMA 3A1PA 4FNHA 2AYGA 4PWWA 4PR6A 3TAMA 2R7XA 2GJIA 2NS1B 4FN5A 2RKIA 2GSOA 1CULB 2GHVC 2IBKA 1HNXJ 1X4CA 2HHTA 4K4VA 3DOKA 2X1GA 3LAJA 3IM8A 2RJZA 4W90B 3H2VE 4J91A 2K3IA 1G51A 3BQ0A 2WVFA 1UW9A 4ZGQB 3P49B 3D3BJ 3FSYA 4ZVRB 2LLZA 2Z0GA 1N4LA 1KMHA 2EXUA 4J9LA 4P6QA 3CPWR 3KG1A 5CYMA 2XLKA 1EFRA 1X5OA 3T19A 2PMWA 4I2QA 3IRXB 1FJCA 1VMBA 3RTVA 3UN5A 1HYSB 2OTLS 2ZH8A 4DFJA 2CW5A 2JX2A 1QX4A 3TQ1A 4V19J 4BBRC 3CCRB 1TWGK 3TUIC 1FEEA 4M5DB 2VFUA 5C44C 2QL7B 3BBCA 2DCUA 2V7UA 4A3CC 1VQSA 5LMNJ 1FNXH 4Q43A 3QRRA 1EJ7L 4X2BA 1AXQA 3BH4A 2NREA 2KDOA 3W60A 3UCGA 4ED1A 2VKZG 3ZFVA 2ZUAA 3WIVA 5EMNA 2LA6A 1VHOA 2HBZB 4KB4A 2AQ4A 2DCLA 1IBKJ 1LXNA 1U02A 2WK4A 2V7TA 1OWXA 5KFJA 2JEIA 2D69A 2YWFA 2ZBVA 2RRBA 3H40A 3DLGB 3PENA 3CCJB 4ZH4A 2KU7A 5E33A 2KKHA 4H4KC 1HQUB 3QAUA 1HBOA 3GJSB 4J9UE 3RUBL 4H4OB 4DLGA 3M6VA 2DIUA 4J9NA 2XI2A 3S17C 3OQ2A 1IQZA 2YQ1A 1S6OA 1OYEA 2J6UA 1HARA 3EX7B 4FYXB 2V4RA 4XLEA 4NBSA 1NPKA 2I5JA 3V81B 2LXFA 2PFDA 5D15A 4ES2A 2GO9A 4PCQA 2BR0A 1YQHA 3G8QA 3N0CA 4DQPA 3PZPA 3FFIB 3LF0A 4KATA 3KK3A 3PEHA 2R7ZK 1SIZA 3D1HA 2YNGB 2MZRA 3HHLB 4M1XA 4KGKA 3POTA 4O44B 4LK1A 2VU5A 3M8SA 3PVXA 2NVXA 3DDIA 3J81k 3J7Z5 1Y1VC 3W65A 1GXLA 3NY0A 2M52A 5DRKA 5IP9C 5C5JA 1LW0B 4K4WA 5FLXY 4W98A 1U8WA 1BGWA 1N07A 1EFWA 1FFWB 2I2YA 1KD1T 2WSEC 3VAHA 4JI5J 3KLFA 2E1PA 2A6EA 2WVCA 3N9UC 2CQ2A 1FK9B 1VLOA 1HFEL 1RLDA 2XCOA 1DY3A 1NK9A 4NZ0A 1N5TA 2MHNA 1GMVA 1TL4A 3PJ9A 1WQGA 3V6DA 2XMKA 2CWXA 3D6HB 2MJUA 5HMWA 3JQJA 1L3VA 1UW4A 2NVXK 2FJBB 3AVUA 1VBXA 2E7XA 1VI7A 3PW2A 3K0JA 2C2OB 3GEHA 4RBUA 4KKSA 3FQKA 3O2IA 4F04B 1YHQS 1KWMA 4F7VA 3ZZUA 2HGNA 1VJEA 1H72C 1WQHA 2AJ1A 3EPIA 3W3SA 4BWJA 1WEZA 2W8LA 3R3TA 3VQTA 1NJXA 2H48B 3M8PA 4G1QA 3RZDK 2BABA 2MEWA 1RAJA 3H20A 4QJVA 1K73D 3MMAA 2N7YA 4ZIVA 1E79A 3S1NK 2WBMA 1WC0A 2J7WA 1UTAA 1DQ8A 2OMOA 2XCAA 3ZXWA 1Q7LB 2W6IA 4Y9UA 4FYWB 3NGUA 2ASJA 4ES3A 2LFVA 4YHHJ 2VONA 2DHXA 3SSRA 5E2QA 4YFKA 2NUUG 2IMWP 4QR0A 3KJQB 1N34F 2A6MA 3S0XA 2YQ3A 3I6PA 3OJSA 1FWPA 1HNIA 1OSDA 4RD3A 1HQEA 4A8KA 1KK1A 1VQ9S 4R71A 2LQ9A 4LF7J 3M4XA 3KHHA 3Q23A 2H4WB 2P5VA 1J5EF 3GJRB 4IR1A 1RT7A 4DHVA 2AMCB 4I56A 4XLCA 4WZMA 2X1FA 4TU9A 1VFJA 2C2RA 1F3VA 4JYAJ 3K57A 4NMLA 3QT8A 3NWRA 1J27A 4FF1A 3S16K 1QSLA 4KHPF 1MROA 3OVSA 1DRZA 5TY0A 1YDLA 5HROB 1VBYA 1XMQJ 4DK0A 1SUQB 2COLA 3PW0A 3QZ7A 3A35A 3MCAA 4F8RA 3NRBA 1N8RD 1TKXA 1N32F 3S14C 3P6YC 2K7JA 2K2PA 4OHWA 1D09B 1OMSA 5DDQC 3CCVS 4F7DA 1C4AA 4HEA9 4OZ2A 3RU0A 2E1CA 3JAMU 4QOTA 4ILLA 2GVZB 1WSVA 4U9RA 4F4AA 2ZTNA 1MWYA 1J5EJ 2LVWA 2CRVA 1OGIA 4B3FX 1QAXA 2R8IA 4X62J 3MMJA 1HZEA 2E5GA 1TKZB 1WC3A 3KTQA 5IQ6A 1NSKL 2OI2A 3H90A 4A8MP 3HVRA 2CJQA 1QLNA 2XNDA 5CA5A 3QJLA 4WFXA 1TWGC 1ELOA 4MKAA 3CDEA 2BKNA 1E3XA 3BPDA 4UUWA 3VGTA 3AVVA 1PJ7A 2GAHC 1KQSB 2XLJA 2ZZQA 5D4NA 2XM3A 3HSGA 1QH0A 1KLMB 3T00A 2GVDB 4I69A 1TAUA 2RAQA 2KYZA 2X3UA 3BSCA 2KTQA 2FHJA 1EK8A 4LF8F 2B63K 2CG8A 3WODA 2BRLA 1CJKA 2XY5A 4HACA 5KFXA 2N82B 5E3CA 1V5VA 2BANB 1AW0A 1E43A 4JI6F 4DCPB 1PSDA 3GEEA 2BZ2A 2LEPA 3GFYA 3R6GB 4ID5A 4B4DA 3MAAB 3C16A 3LVBA 1UVKA 5ETMA 2HNDB 4C3LA 3QZ8A 3TRGA 3Q38A 4UUXA 4LSLB 4C98A 2V6AA 1E63A 4Q5SA 4Y2IA 1NB2A 4DL3A 2ZJRQ 2DNZA 4WXWA 4HHUA 1D8YA 5IK2A 1DJ0A 4CM2A 1AROP 2F4FA 3ENQA 4DQKA 1HWUA 5DQHA 3SMZA 1XMBA 5HLFB 3PVDA 3OTEA 3N79A 1S48A 4K4SA 3S7RA 3G6XA 2R7ZC 5M3MK 1VRTA 4B3GA 2OFGX 5A0YA 1PJ6A 4Q7JB 4ACBA 2ROPA 2FYXA 3FBFA 4B9MA 3HAGA 2RU9A 1QE1A 4ZPTR 1I18A 4DMZA 5D0EA 3Q6QA 2NR0A 1UJ5A 3QAEA 4HKQA 5F8JA 1Q9SA 4J0QA 3OVAA 2FY1A 1QY7A 1LFPA 1YWXA 3QJJA 4RW6B 2IDEA 1DDGA 1QSYA 3QWPA 3I4HX 2GX8A 2B5JA 2XMAA 1HIYA 1E6YA 2UUAF 1N5QA 1UMKA 1CBKA 1OPZA 2WVBA 3PCOB 2CRLA 2Q6KA 1LFWA 2M4MA 3QFCA 9RUBA 1O26A 4ID8A 1VQPS 2NVXC 1SVDA 3LO8A 2DJWA 3HPOA 3C14A 3MZIA 4U95A 1P9QC 4NX9A 1UJ4A 2NSCA 3TEHB 4QPXA 1VLYA 4YDXA 4M5LA 3OLBA 2IJFA 2XCRB 4WYWA 1FKPA 1U4BA 4X4TA 5KFBA 3MI7X 1X9SA 1O25A 2DNLA 3OREA 1M5OC 4ZP6A 5M2PA 3HOWK 4HYKA 5F8HA 4G7ZA 5DSZA 3GTPA 2IYGA 4XLPA 3CMAB 2W9BA 2MZQA 3BN4A 4NI2B 5D4OA 1OB5A 2R8HA 4X4OA 1DLOA 4GTDA 2DISA 2UUAJ 3S1NC 5F0UA 3DRPA 4C45A 4ZHRA 3CDAA 3VAJA 4BLBA 2V6TA 4USKA 4WXOA 4AD6A 3S8SA 1ZM2A 3LNNA 3R6LB 3T41A 2AJ2A 4M2LA 4C43A 1WU8A 1EI6A 1VQ6B 1VJSA 3BPSP 3GTPK 4AF6A 3OFGA 2BJEA 3DRRA 4XDCA 2K7KA 1F1BB 4QZVB 1KQSR 2ZVSA 2I9SA 1CNEA 4JV5F 4DSFA 2H9ZA 4OZ0A 2LZJA 4G1BA 2B9EA 5D0HA 1FXLA 2NXJA 4DL7A 2J5AA 1LKZA 1XQIA 4LMZA 3HXAA 2FY8A 1XTZA 2NQPA 4QW9A 1Z2LA 1U1OA 4YS2A 2IIHA 4KHMA 3GILA 2L9DA 2B6AA 1MMLA 4E2FB 3PUNA 2PMDA 1QTMA 4NA3A 3J7YI 2R2RA 1WP6A 2VV5A 2XSJA 3M1VA 3ADAC 4A3FK 2OPQB 2QA1A 2C1EB 2RQ4A 1HI9A 4KBIA 2KT3A 1D8TA 1FRKA 4H4MA 4OYBA 3FDSA 2VPWB 2R92A 1RQRA 1GFWB 2XZWA 4LBWA 3TUJC 4OV1A 2CPHA 1SQFA 5BXIA 1AT1B 4QWCA 2AYBA 3DLKA 3KK1B 3D7SB 2PC6A 5M3FK 2BW7A 2WZ1A 5A8AA 1NRKA 1C4CA 4FYYB 2E5LJ 3KMQA 4U8YA 3TZXA 1WELA 2N4CA 1BC6A 5D8HB 4ZKAA 3B4DA 4O0NA 2ZXHA 2Q6BA 4A48A 1KEKA 3CC2S 2Q6LA 4LRAA 1X4DA 2FVQA 2DO4A 4EMDA 2J6TA 2CQ1A 2AJFE 3W5VA 3RB4A 4HH1A 1RWOB 2DXFA 3RB3A 2KM8B 2VNKA 1G4CA 4A8SA 2Y1IA 4TQSA 2IY5B 4IH7A 5HQLA 4DL4A 5K8OA 2UVWA 3HOUK 3EYZA 1TTHB 3VQSA 2AZ3A 1W87A 5TJ3A 5C3EC 4G0VA 2E44A 5TV2A 2B63C 2PE8A 5B0CA 2YNFA 4WJ4A 3I0RB 1IR2A 2IM2A 1U0HA 2C42A 2XGPA 3HVAA 1P6TA 2PIAA 3DFEA 1H2VZ 2EIXA 2QYCA 1X9WA 1UVLA 4YAFA 2EFPA 2BACA 2GMHA 3CJRA 4KR0B 1KTQA 4DN0A 4ZP8A 4CH7A 1K44A 4P7VA 2DEIA 3D1QA 1KKHA 4MYTA 1MNEA 1R5BA 4A8YA 2HZVA 4IO9Q 1FVQA 4LVOP 3OTOJ 3EGNA 3KLIA 4RZRA 3NL0A 1SL0A 2WONA 4K4ZA 5AT1B 3JTPA 3OOCA 5K14B 1DZ5A 1RT5A 2BE9B 3S2HK 1RABB 4IKAA 2D9PA 2OPRA 1K9MT 3DN9A 2XTJP 4DEZA 2VPYB 1D3WA 3ZZPA 5GMDA 1BQNB 4EO6A 1JB0C 1H38A 4X66F 4DJBA 2EK1A 1D8ZA 1ZPVA 1B3TA 1EP4A 3M2VA 1C0AA 4NCAA 1M5VC 5EX3A 3KUHA 3HJVA 1NB9A 2PA8L 2GGPB 2I38A 4AE5A 4FS2A 1Y1WC 2GIFA 2C5BA 1FKOA 4P10A 3AVWA 1TUGB 2B0GA 4KFBA 4JMQA 1ZTWA 4P26A 3JSMA 5ETKA 2NSBA 2JHEA 4DQSA 1NB7A 2EC0A 1S0OA 3RYLA 1M0SA 1F2HA 1TV6A 2V7VA 1WOPA 1J5OB 2FLNA 3BNWA 1AB4A 2XULA 5HN0A 3G4SS 2F8EX 4EFAC 3TAMB 2RKIB 3HM9A 1IJEB 3DOMA 3C15A 3DHXA 2ASYA 5CYJA 3OZWA 3DOKB 2G2ZA 4LF9F 1U6ZA 1VQ5S 3MD1A 4M94A 4G6IA 2ZBPA 1GO2A 4IG0A 3EXYA 3HOWC 4XKVA 2AJ0A 4LLGA 4GTCA 5E3RA 3M3YC 2E1BA 5LOQA 1W26A 5CYMB 1HNZJ 1VH2A 1ZH5A 4DR6F 4YAWA 3JSBA 4I2QB 3P8BB 3PO3C 1Y9OA 2DR5A 2FQTA 2CQ3A 1GTEA 5TRDA 3US5A 2CZ4A 3N4WA 4DU8A 3L7UA 2E2JC 1HPZA 1XWLA 1HI8A 2DGWA 2GW8A 1UFLA 1Y7PA 5DZ7A 1R43A 4AC9A 2KRRA 2ACYA 2ILZA 4WF9Q 3D6MB 3SYZA 4N41A 3PKYA 2OYNA 1QAJA 1VS3A 3VGVA 3H98A 2AGOA 2VH7A 3GTPC 4R25A 3TANA 1ZQ1C 2CWKA 3ES9A 2W25A 4DPOA 1WKKA 4D3GA 2RB7A 4BC7A 4A3JK 4PXBA 2O5DA 4WP8A 5J2QA 1RT4B 3OT9A 1FERA 3A13A 4CLSA 2JA7K 1HBOB 1IBAA 1W7WA 4DR6J 2X8KA 2W2QP 1HBNA 1ISEA 4RW9B 3CEDA 3OUYA 4RJVA 3F56A 5HMZA 3EMTA 2M5SA 2DT9A 2WSFC 3BY1A 2IYIA 5J1EB 2Q6IA 4DZ6A 4HDGA 4OYPA 3ETMA 2VFRA 5TMCA 2YWWA 3W2EA 3GTLA 4DV2F 2I5JB 5IFMA 5LMZA 4CIOA 5E5NA 2GSUA 3FKIK 1REVA 4RPDA 4ZVOB 4Q8EA 3CQZK 3FQLA 1GNKA 1F20A 3KK3B 1HMVA 5HQMA 3W64A 1O28A 1KSPA 5FIUA 2V2QA 2VC0A 1Y5LB 3K17A 3D5MA 2O66A 1KTVA 3BP3A 2FJDB 1OO0B 4DR3J 4LRCA 3VHQA 2VBWA 1S4FA 2MQNA 1VC6A 2DETA 2HIYA 4P2XA 4XAKA 2HHWA 1SKYB 2FJAB 1VR6A 3OFFA 2JJ2A 1I94J 3LPXA 3KLFB 2B4VA 1MG7A 4CO4A 4B47A 1UJ6A 1FXRA 1YNNA 1Q86D 1WC1A 4IYQA 4RNFA 4DV2J 5GAGU 3GWCA 3UR3C 1HVXA 3R5CA 3V6DB 4Q2LA 4PG6A 3FPKA 3HOUC 2QTLA 4PC3A 4NASA 4B9UA 4WK1A 2RHQB 3W9HA 5KT2A 4QU7A 3ENWA 4PWDB 1I3OB 4B9NA 2W4DA 3Q39A 3TUZC 1DTTA 3IC1A 1IB0A 4EBDA 2P2CB 3ASTA 2ROGA 1NJIT 3HHLD 3TNVA 1U7LA 1SC6A 4AQYF 4L3KA 3LAPA 2DKOB 3T6JA 1FFGB 4G1QB 3UVJA 3GIKA 3GTGA 2R7SA 2R93C 3EGZA 1EAYC 2VUMC 4I2PA 2BM0A 4QJVB 3PX0A 1RWMB 2YWHA 1C0TA 3MMAB 4ZN1A 1WHWA 2MKCA 2KZZA 5IQQA 1K1QA 5HMYA 2HZCA 5DM7Q 2HHXA 3LQEA 2GQ2A 2QMXA 4ATNA 3GV5B 2BYCA 4AVZA 2L9NA 3W8GA 3UD5A 4JUZA 5IS2A 4X0CA 2YVSA 2ZHOA 4B3SJ 2RC6A 4XPEA 1INNA 3L7PA 2F9JA 3N28A 4USTA 4ZPAA 1PGZA 2HMAA 3GFXA 3S2HC 5M5WK 1HQEB 1UVNA 3CWJA 5HQ8A 4ED4A 3B82A 4I4BA 3UCZP 2Z30B 3DM2A 3E20A 2MSSA 3HD2A 2HFUA 1RTZA 3L95X 2HFZA 4I1TA 2DR7A 5KOWA 1U0SA 2XYPB 1LOUA 2DNMA 4YN3B 3RRKA 1TVCA 4PUOA 3TAPA 2W7PA 3CCEB 3T56B 4C2MA 4OIOA 1R8CA 2HQIA 3QYYA 2IRYA 1BQEA 2ACMA 4UAJA 1Q0NA 2HFOA 4KRWA 2V34A 4I64A 1MROB 1BLUA 2FJWA 2EBEA 2ZE2A 2JNJA 1WQFA 4YB1P 5A8RA 2VJVA 5L1KA 3H3VL 2GCFA 2GQQA 3R1HA 5KT4A 3H0GK 1C2PA 4EO8A 3MEKA 5DQIA 5G4DA 3A8EA 3G87A 2JLGA 1NH7A 3MCMA 3OXGA 3AOCA 1TKXB 2AW0A 4HVZA 2Z6BD 1FX2A 2OPSA 4PWUA 2QGGA 2EW9A 4P71A 4CNYA 1YBTA 4C8KA 3NBPA 1J6WA 4CTAA 2B9WA 1Q5VA 4C2MK 4DF8A 1UFWA 3EICA 2VC1A 4DF4A 4XLAA 1BGXT 3WNBA 2R7WA 4M53A 4C11A 4A4JA 4NCBA 1X4AA 3HFZB 4K4TA 3D9BA 2C77A 4FM9A 2KXFA 1XXAA 1CC8A 1WI8A 1BY9A 1QVFB 4XK8C 4DG1A 3SXLA 4F36A 1B2RA 2W4PA 1TL1B 3CTRA 2WVEA 1BHNA 1CJTA 1X0FA 4P75A 4K4UA 1EETA 1SJ1A 4KMAA 2MZJA 2DNGA 2W8KA 1F3FA 3OEPA 2ZHBA 1VQ8B 3M6UA 3H59A 4ED8A 4RW4A 2VODA 2EVZA 1VIXA 4DNTB 4NLGA 4X7EA 4W92B 2DNYA 2W9CA 3JQPA 2RD5C 4ANEA 3GTMA 3HZGA 1RI7A 1HKAA 2YKPA 3MMBA 3KXDA 1HHQA 4DR2F 4A3JC 1XPPA 3BC9A 4F26A 2B5OA 2AZ1A 3SLDA 2V8GA 3IA0A 4KC5A 2OMLA 2YKNA 2ZBCA 1NDCA 2JA7C 1WACA 1VQYA 1CQNA 2CPEA 4DUYF 5HK4A 4L74A 4ID5B 1CEZA 2J7UA 4Y00A 4ZP7A 2VNJA 3KEWA 3Q2TC 3N6MA 4QUZA 3C16B 2HDNB 2C2NA 1PCAA 1RAGB 2K3KA 2JA5C 5JJBA 2V2VA 2BMBA 2F1FA 5IV3A 1JLFA 1BPLA 2V68A 3SFGA 3GTMK 2OSQA 3ETOA 5IWAJ 3FKIC 3KJVB 1FX0A 8AT1B 3R5DA 4XD7A 3RJMB 3CQZC 4MMOA 5KOXA 5DO2A 3CMEB 4XKWA 1S1VB 4FWTA 3R5BA 5FA6A 1O2AA 3HK2A 4BXXK 5A6PA 3JSYA 1DDIA 4MKVA 4C8YA 4AL5A 1VRTB 2MZ1A 1QFYA 2R7QA 4YY3F 5A0YB 2HS0A 3IBCB 1UKUA 3WBZA 3CP8A 5IXUA 3OJXA 1I5OB 3ZTQA 4OFZA 1XIQA 2X1AA 2BW2A 3C6TB 4CLPA 4UOFA 1Y4ZB 5LJ5Y 5KT5A 3VNUA 2GHWA 2V4DA 4DUYJ 2GZOA 4RWWA 2Y0SL 4KGZB 2HK3A 3LH2S 4ICLA 2B5JB 2GQCA 1E6YB 3FJ2A 1EWYA 5CYQA 3DDYA 2IFXA 4E0FA 1EFCA 4CLZA 2HQFA 3P4UB 1FRJA 3BKTA 4WFAQ 4AFFA 2HVDA 3FRYA 4USVA 1N0UA 3UCUP 4LRBA 4EH1A 1VQ7B 3EZ5A 3EZOA 3S1TA 2CFAA 3I56S 1IR0A 3C14B 3D0IE 1V6HA 4IQMA 4DFKA 3MF5A 4XN0A 3HHDA 1REGX 4CLUA 1S9EA 1T9VA 1KVJA 1FKPB 2YH1A 3TVYA 2DGUA 3BYPA 1VDHA 4DR7J 4QYZJ 3GV7B 2DNRA 1S7IA 3HKZL 3PRVA 3PW7A 3QRPA 2J0WA 4YEJA 2KVQE 3H8YA 1S6PB 4Z4UA 4MTPA 1L3TA 4DX7A 1DLOB 3D26A 3DU5A 2RIJA 4QPTA 2K1RA 5JMNA 1RWXB 4DQLA 3DRPB 4J90A 2ABYA 4LBIA 1LWFA 2ZBUA 1NH8A 1DD5A 3CJQA 1UD4A 4ZPVR 4O3OA 4ZA1A 4XPCA 2U2FA 3W1YC 2PDAA 1RJJA 4BBSK 1JOEA 4GVBA 2QFIA 4FXWA 2APOA 3G6ES 2VBTA 2PMZD 5IOTA 2H1YA 4WE1A 1QVFR 4S0MA 3IWLA 2AEFA 1I50A 1IKYA 1VJWA 4WYLA 3KLHA 2BSAA 2W2PP 4PYAA 3ZO7A 1YJNS 2VASA 3W5XA 4GKJF 3WNDA 4KO0A 1GR1A 5EX0A 2BE2A 4PC1A 3LP0A 5FLMK 2XYGB 1VHFA 3Q0AA 1Q8KA 4OI1A 2C4TA 4K5RA 2B6AB 2HWTA 1RSCA 1FRMA 3BZQA 3G96A 3H0GC 4OV6A 1J6XA 2BVZA 2KT2A 3DOLA 4DV5F 2XSJB 1TWFK 4ZJLA 2HFNA 2C3OA 3CJKA 1R3NA 2BOPA 1BJKA 3SKBA 2NV4A 4LUBA 1UWAA 2BBEA 4P12A 1O27A 1HNWJ 4C8NA 3H4BA 1TUWA 2JFKA 4X4VA 3LQVA 2KYXA 4DZDA 3CCES 3TUPA 4M8LA 1NK6A 4F4WA 4CLTA 3C46A 4OZJA 2CDQA 2MKHA 1KR4A 3FKBA 3PFOA 4KKTA 2J9DE 1N05A 1K47A 4WFBQ 2I8EA 4X7FA 3E1YE 2E2IA 4ZCMA 1IXKA 3DXBA 3MFHA 4DLEA 4ANDA 4NXNJ 1U1QA 3ZUGA 4I7FB 2P9EA 4HE6A 1YJTA 2IRUA 4NXMJ 2IM0A 1MMNA 3CIMA 4K4YA 1CJUA 1GMWD 2CQIA 1FRIA 5KFEA 5KG2A 2VPXB 4URGA 4BY1C 2VBSA 1FVSA 1H8HA 4X84A 2A1BA 4K7QA 4DV5J 2IC3A 3T6BA 1TVRA 1RWKB 4B43A 4IRKA 2EC2A 2V0NA 3ONQA 3UD3P 3CCQS 4OYWA 1EIYB 5T7LA 2E1AA 2V6SA 5K8MA 3HHNB 4EZ9A 1AMOA 2YNFB 4JP8A 1TLLA 3WC2A 3ZNJ1 3SCIE 3GTKA 1U0HB 1X0PA 3M2UA 4MFBB 4G5GA 4ZVFA 2OLWA 1JVIA 3PACA 1B0VA 2MKYA 1X4EA 1ZBTA 5KFSA 3AVTA 2DVIA 3LAKA 3MHYA 2YX7A 4AYBD 2HLUA 2OGUA 3TA1A 3GIJA 4M95A 2Z2YB 2CQ4A 2MQMA 3GTMC 5C24B 3VAGA 5DLFA 4C3IK 3KLIB 2ZJPQ 2MKSA 3GTKK 4RDKA 2WONB 1H2TZ 3NNHA 2OK8A 4K2XA 1PYTA 3GQBA 3OL6A 1RAIB 1RT5B 2C3UA 3CO9A 3A3BA 3QLHA 2HMIA 4JBCA 1NBEB 1SBRA 3SCJE 2AJQA 1V3RA 4LRDA 3QFSA 3M7VA 4WIIA 1FA0A 3VAIA 4CT9A 3BJYA 3NMRA 2LQJA 1UD6A 4IOCQ 3PV8A 1QGZA 2ZH6A 1EP4B 3CD6B 3M2VB 2V8DA 4QR1A 3GJQB 4WZQA 2Y0BB 1JB9A 1R89A 3OTBA 3CMES 3G2XA 2OO4A 3K2YA 1FKOB 1TAQA 2GQFA 3M8YA 4HT5A 4A8XA 2VJUA 3JSMB 4DR1F 1VCTA 3I31A 1V3ZA 2ZL7A 2RVJA 2BJ3A 1F7UA 2QEXB 4I67A 3UNGC 2KG0A 3MTJA 1PIEA 1QD1A 1TV6B 2Z56B 2QX0A 2M8DB 2WB1D 4MYUA 2DH7A 2HQGA 2XZDB 3I5AA 1SL2A 3UDVA 1TELA 2X0KA 3C15B 3DOMB 3V4MA 3SI8A 2W2NP 3WX4A 5D4LA 3MM8A 2PI4A 1TKDA 4IG0B 4RD2A 1FNCA 2CZ9A 3TP2A 4DV7J 4Q45A 2D3LA 1TUIA 1S1TA 5E7OB 4B3RF 5AJ3J 2EKNA 1VQOS 1BQXA 3D6FB 2UXBJ 5HJXA 3SBMA 3ISZA 5LMUJ 1KJZA 4DR1J 5GAGI 2J8SA 1G7TA 2DPJA 1W34A 1HPZB 1V5IB 5THWA 3MM6B 1T02A 6FD1A 2CADA 2Z2MA 3BDPA 4BBSC 3SLNA 1R6YA 4H54A 2CIMA 3MEGB 2DY1A 2EFOA 4J9OA 5DDPC 1QVGB 5J1PA 4P1VA 4DK1A 3BDEA 3BO4A 2JA6K 4DSIA 4B9VA 4QHYA 2R42A 3VVTA 4GO5X 2KXNB 1F7VA 2ZBQA 2W2OP 3WNCA 2QLXA 4F67A 3RG6A 4CLYA 3PA2A 2BJ7A 4NEZA 1MU2B 3GTQA 1RTHA 3X1LB 5FLMC 3SQGA 4B3RJ 1TTTA 4YG2A 4RD1A 1HBNB 4H9GA 1V3SA 2WSCC 3VGUA 2MQLA 3HFKA 1NU4A 3OUYB 3TFJA 4LJZA 2WBRA 2V50A 2GMLA 2W4CA 3HFVA 1KONA 4ECTA 3CD0A 1GX6A 2A69A 1U1MA 4M4SA 3ZZRA 1TWFC 4QFMA 1XXCA 3T51B 1FWLA 1REVB 3CJ2A 4TYAA 3Q6RA 2I6WA 2ZUFA 1RBOB 3M9OB 3R27A 2CJKA 3DC2A 1HMVB 2X3DA 5GV8A 5L9XA 1HI0P 4NZ7A 1I1GA 5A8WA 2NCKL 1RYSA 4ACAA 3PUMA 3FMBA 2FHMA 5C4JK 3AAWB 2AP6A 4PPZA 1BJTA 4YFNA 3M6WA 2CUYA 4NA1A 1SC1B 4Z2XA 3IM9A 4EWTA 5KG3A 4TQRA 5E6TA 2AEMA 4F4ZA 3MUTP 1OB2A 3U1MA 4LFCF 3E01A 2R8KA 1Q81D 5ETOA 3HSJA 3AODA 1LK7A 4GFQA 2QMUB 2DERA 5IYWA 4B44A 1NAQA 1O29A 5EHHA 4YP3A 1NPRA 3L9ZA 3P5BP 1ZPWX 3F44A 3O3LA 1M1KD 4TU7A 3FGVA 1CS4B 2OTJB 1USMA 2OH2A 3U6BA 3T53B 2PEBA 3T9ZA 1YLXA 4DQQA 2FHKA 4C0HA 3PO4A 4BBYA 3GLJA 3M4OK 3QT7A 3W2VA 2CNDA 2CQDA 2BF4A 2FZCB 2Y1JA 4JI4F 1S57A 4PXDA 3DHWC 5C2GA 3CJTA 3I87A 1HBUB 4YEAA 2W1BA 3IAS9 3TX0A 4BY7K 2IMOA 5KFTA 2ZKTA 4Y2MA 4IH6A 3HSZA 4QIVA 3NE5B 3B78A 2HHHF 3GP9A 2A6HA 3CCMB 2F40A 4LFCJ 3UVJB 4C8MA 1R8PA 4U67Q 2KVIA 3FHZA 1AA1B 2ZXIA 4I2PB 3MUMP 1C0TB 1GX5A 4ZS6A 2VKRA 5HSPA 3HP6A 4O2DA 2W6JA 2BX6A 3ONUA 3GQCA 2HS3A 1S1XA 5IC6B 2DY9A 4TMXA 4DL6A 2M88A 5H9EJ 4C3IC 4Y7NK 3TZWA 4J7CA 3OSNA 1H8EA 3GTKC 2F4NA 2KXHA 3Q3AA 3B6BA 3BH7B 1H7WA 1YVFA 4RW7A 1Y3JA 1JA1A 4XQFA 4PC2A 2CPJA 1VF7A 1IKWA 1QSSA 1T6YA 1BMQB 3I0SA 1P9YA 1FRXA 4DNRB 1EFTA 5EGHA 2JA8K 3DM2B 1JLGA 2CNNB 3P5TL 4Y2AA 3HOYC 2H5JB 4DV0J 1JWWA 2J8AA 2HHHJ 4GO7X 3FBEA 2P8IA 4RLEA 4RUCA 3T9NA 5KFAA 1YZ6A 3MEEA 4O4GA 1QVGR 3RW7A 5GMKa 4JB8B 3WQPA 1CSJA 1FDBA 1NJYA 5CABA 2D74B 5HVFA 5C25A 3CW2C 2ZE2B 4PG7A 1IWGA 3W2GA 5A8RB 3AJDA 4AXJA 4F3OA 3ICLA 5FDLA 5B0FA 3M8QA 1PBUA 1R9TC 1CJVA 5HKKA 4U7UD 3CB4A 2ALYB 1W2IA 3N01A 1RWVB 1E62A 4J9MA 2ZH7A 1EB0A 2NXEA 1L5UA 3CD6S 2QV6A 1AZSA 2GFFA 2RF2A 3BEGB 2OTLB 4ED6A 2E9ZA 3TJ8A 4Q44A 3BM7A 2WOMB 3NBPB 2KB2A 4CTAB 3V6KA 2HAIA 2GHPA 1IS1A 1RP5A 2HFSA 1K83K 4TU8A 4ZV4A 3I32A 4ED5A 2J9CA 4DOZA 1OQ6A 4Z37A 3F41A 2KFNA 2J9EA 2NYIA 2CDRB 1L3SA 3AD9C 5E41A 3B8HA 4AT1B 1AB8A 3ZC4A 4DFPA 4RNOA 1U49A 4P9SA 2OD6A 4WPAA 2GSNA 3HXMA 1SM4A 2CVEA 2BQ3A 4DG1B 2H54B 1LNQA 2J7KA 1NDKA 2VDIA 1RE1B 3EE3A 4H4KA 1EETB 3KUGA 2O5IA 4J9QA 4NPOA 4KC6A 3FMWA 2DITA 2W24A 4A3CK 1ZAVA 1RTDA 4NYPA 4RW4B 4G6VB 4DV1F 1B7YB 1YX2A 2WTFA 1IL2A 3K7AK 3NCPA 4ECZA 2JA6C 2BKOA 2DPIA 3HZEA 3Q8RB 4WCEQ 3FVYA 1HI1A 1NDLA 4AUKA 1LWEA 2D41A 1U26A 4OI6A 1WIHA 1T03B 2YKNB 4J9SA 1RGVA 1I7PA 5F8IA 4A3BK 2JJ1A 3HOXC 2B8PA 3E2EA 3TAQA 3H0PA 2PT0A 3CPXA 1KC8D 1IW7A 3TARA 3W63A 1BS2A 4TSFA 1Y1VA 2AIRB 3BQ2A 3S17K 2AJ4A 3IMQJ 1JLFB 1S97A 1E1QA 3V6JA 3VAMA 1RISA 2UZAA 1NEEA 3D66A 4DV1J 3RAXA 5DETA 2LQ8A 3RAMA 4YB7A 1C0UA 4DS4A 3M2RA 2YNIB 1SCJB 4DSKA 1OY6A 2PI5A 1XR6A 4DU7A 3I55S 2FVCA 3B4MA 2X3GA 1F5AA 2C2MB 2V6UA 5C4JC 3JYTB 2V69A 3O44A 2FHJD 2Y3PA 2ZWPA 4CI0B 2HHQA 2I1LA 1Y1VK 4ECQA 4NLTA 4NZ6A 2NVQC 3CO0P 2MXYA 3P3DA 4ICLB 1PILA 2XCQA 2H4YB 1SMYA 1S0MA 4DL2A 3AA9A 1TWCK 3TFHA 3TQEA 1N5SA 4UF4A 3V4IA 1Y11A 1U47A 2FQQB 3M6XA 3PX4A 4DL5A 4WFYA 4X4RA 3HDSA 3MOZA 3K5OA 2YXLA 1AUSL 2GV1A 3CJ8A 3DGVA 4PPDA 2XO7A 1WCMC 2LECA 1ZXOA 1Q8IA 1HLWA 3E8OA 2LYVA 4K5SA 1S9EB 5D4PA 4LR9A 5FJ4A 2DRDA 1B4SA 2M0GB 2DO0A 1T11A 1JLQA 2FHOB 2KZMA 4BY7C 2XG8A 3FOEA 1HBMB 4WZEA 4WKYA 1U1NA 3PRBA 3QFWA 4WP9A 2ZZEA 1HWLA 1Q82T 4FYDA 3D4JA 2HHSA 2OTJS 2OEJA 2FD2A 2XMTA 1NHUA 1EQRA 3PW5A 4OOVA 3FZBA 4KM8A 2HG4A 4Q5VA 2K1RB 3KDOA 4K0KF 4ZVPB 1DAXA 3CT9A 1FI4A 1GTHA 1RT1B 3IGNA 4U8VA 5JVGQ 1EKSA 4RUBA 1OIAA 2UU9J 4X64F 2YPYA 3PR5B 1XNRF 3CCLS 4GT9A 4GVBB 2DD8S 3S15K 1B7FA 3CCMS 5DQGA 1IWAA 4WE1B 5E3AA 2BUNA 2JLEA 2KJVA 5KT7A 5FO0A 1NJZA 3L4KA 1BLIA 1IKYB 3KG0A 2GREA 3K59A 3KLHB 1SC3B 1SI9A 1FNDA 4M5NA 4TMVA 4RCYA 4ROXA 2OAUA 1NXIA 2UUCF 4GKKF 1RBAA 1KK2A 2BE2B 5IZHA 5IYRA 3AGPA 2HGLA 1XB2A 1RZMA 4ZP9A 4XLHA 4DX5A 3GFZA 2CQBA 4ALZA 3FEXB 3EGWB 1JJHA 2WW4A 4FF4A 3H2UB 4OIQA 4QIWD 3T5JA 3M30B 1UZDA 4ZMMA 3AH5A 2J0QD 1QUVA 4CO3A 5KFHA 3CMMA 5KSWB 5L1LA 1RT6A 3WC0A 1HHSA 3DOLB 3OZVA 1Y10A 3DGPA 3M05A 2YKMA 3CJKB 2O3DA 5KFYA 5I42A 4F2SA 1R5NA 1XNRJ 3G8TA 1YCLA 5LMNF 3TVZA 1NKEA 3GYNA 4C0BA 4NCNA 3EVMA 2XHCA 1TWGA 3AD8C 5L39A 4C3HK 1K83C 3HULA 4DN9A 1EHWA 4QQBA 1IBKF 4RJLA 4MT1A 3PY8A 3IWXA 1S9FA 2UUCJ 4GKKJ 4BKWA 3QATA 3KK2A 5HBMA 3RRHA 1Q79A 4CLLA 2FIUA 2MPUA 5IM0A 4ES1A 5HVGA 3CRZA 2FPHX 3HVTB 2RHSB 1CJUB 2PLFA 5F8NA 1F2GA 2DB1A 3TZYA 2E2HC 4ZJOA 1GEHA 4F0KA 3ASSA 2ZJQQ 2LMIA 2YWGA 3W8PA 3IG1A 3BSNA 4V1Ak 1Y0HA 3H5SA 2IC3B 3W61A 1GXUA 1BQMB 2MQPA 4ZVQB 3BS9A 3ISXA 1E3ZA 1KZLA 5T7LB 3K7AC 4NLOA 3AQOA 4C8LA 4ZIWA 1UPPA 2VIHA 1VQ4B 2VD3A 2CC2A 5KG7A 3AQPA 3L09A 2ADCA 4MK7A 4ZVTB 4YUDA 2RS2A 4RD4A 1CULA 4A3BC 1TWAC 1SJRA 1NBMA 1B4BA 4YR3A 4XOPA 5D0RA 3IR7B 4Y9RA 3WZ0A 2DNQA 2R7ZA 3TWZA 3DNCA 3A3NB 2P6TA 3QBCA 1KQFB 1SV5A 3S01A 4JI5F 3CESA 4BLAA 4ZLNA 5ETRA 1WG1A 4L3NA 4DQIA 2VBYA 3GE9A 2KHDA 2DXDA 2CNOB 1KVIA 4B3MJ 3PYEA 2VBZA 1RCXB 4C7QA 2IDLA 3MPVA 3PYGA 1I51B 2B4UA 4M5DA 3P45B 1G2EA 4L72B 3VF0B 4NMXA 2DGVA 2DXEA 4N8OA 2QJ3A 3NG8A 3IBFB 3U1LA 2HMIB 2A6OA 2C3YA 5M2UA 2DK2A 4DPXA 1P27B 2YWEA 3P26A 3D0GE 1RT2A 4DV4F 2DGTA 4Z4SA 4TMZA 3SFUA 4MIBA 1VQPB 3K89A 5EUHA 1OSCA 3OL8A 2MSTA 3AGQA 4Y52K 1C1CA 3S6EA 2ZITA 3GJTB 2WAQL 2DYAA 1ZAXA 3AB2B 2XS2A 2FGOA 4PC7A 3MR2A 1T9YA 1TWCC 2GJRA 3V7AA 2XZLA 1FEHA 3FBCA 3GTJK 1VHIA 3SZYA 3IPJA 4H4OA 5HZAA 3BCFA 1O6XA 2AV5A 4G0WA 4YHHF 1JIHA 1E64A 3ASRA 1K28D 1VHEA 2MB0B 2NVYK 2UVVA 3AH6A 3MM5A 4TLQA 1L3KA 1YJ7A 3EDQB 3HOZK 1NSPA 4ZPBA 2CJBA 5KNLA 4I68A 2XOKA 4DV4J 3MM8B 1R0CB 1O5JA 3O1LA 1RTJA 4KGVB 4LF7F 3FFIA 4K8RA 2CQHA 3NS5A 5F8MA 1S1TB 3S2DK 2YKOA 3QGIA 3CSKA 4DUZJ 4LK0A 2E9TA 2DNKA 4XO0A 4JYAF 3Q24A 3R7SB 1LW0A 3R7NB 5DS7A 2X85A 1XC9A 5AE3A 2VHGA 2OHDA 1XMQF 2L08A 3D68A 5KFVA 2MMYA 3LP2B 3S15C 3AXKA 4XTTA 4LFAF 3Q3QA 3ET6A 3CCSS 4X4QA 3NP5A 3TFIA 3UNYA 3WHIA 4A3EK 4IUFA 2D3UA 1U1RA 4O3SA 4Z7CA 3DLBA 2NVTK 4CCHA 3HT0A 4PXCA 3W9JA 3BGFA 1WC5A 5BJRA 2CPFA 2Q66A 2RC5A 4DX8H 4UY85 2UUTA 4FF3A 4X62F 1AYEA 1JJ4A 3ZTOA 1SL1A 5LSOA 1NSAA 5DN6A 4DFMA 3HMJG 4QYRA 4KT0C 3LWMA 1FCAA 3DLEA 1K8AT 2HK2A 3T1HJ 1CC7A 2C2WA 3KDNA 1TL7A 3T5HA 4K59A 3CC2B 1ZA1B 5HI7A 1RTIB 2DEJA 5A8KB 3SDEB 2Q3PA 4LFAJ 1P1TA 4F4KA 4M0LA 1F9FA 3BSOA 2SXLA 4OX9F 4LQ9A 3Q8PB 5TR9A 3VO1A 4OYIA 2Y8WA 1PKVA 2CNLB 4ZOSA 4C3HC 1MSWD 1XEZA 5KFNA 4X4PA 1HR0J 1XJWB 3ZBUA 4FKYA 1C1BA 4RW8A 3L3CA 1YJWS 1R5OA 2N7CA 1EP3B 1IBLJ 2KJWA 3GTOC 2XZPA 4LBVA 3X3UA 4RPBA 4YQWA 1HD0A 4G7XA 4GTFA 3N6LA 1EX8A 2B63A 4C0SA 2E66A 3H7HB 1DURA 3I9V9 1KD1D 4X8IA 4NLPA 4PAAA 1FJ7A 2HYIB 4ECRA 2BRKA 5CDFA 3CJSA 3PIOQ 3UD4P 3CCTA 4M5MA 1BDFA 4USJC 4CLFA 1S6QA 3EWGA 1UA0A 5H59A 3D1OA 4MH8A 3QQCD 2P9GA 3FK4A 2W9AA 4OHYA 3QIPA 3SEOA 3DYAA 1KBRA 1YGYA 4O3RA 2FLLA 4C8OA 4OIPA 2HQCA 3IXQA 1R7IA 4CO5A 3CC7S 4K1XA 4OX9J 1DARA 1SH2A 4LVNP 5C3EK 1T0TV 4EZ6A 3UE2A 3PO2K 4QVAA 1S1WA 2UV8A 2CBXA 2GS8A 5F3TA 2JRSA 4J9VA 4YFUA 1V0EA 1FJGF 4U6PA 3ZNUA 5CCLA 2XEXA 1JA0A 3PHEA 3KUEA 4M5KA 1CG2A 3LW5C 2V2KA 3J81U 4OJGA 4ZPDA 2F4VJ 2OD4A 4L73A 4OI0A 3MR6A 2JVOA 3NS7B 3ULHA 3NLCA 1VQ4S 4NE9C 1SIWB 1F0XA 2YWKA 3FJOA 1CLFA 3G71S 1N06A 2MLXA 3UFCX 2HVHA 2ZC4A 1KHVA 1Y1WA 2MZSA 1Q7YT 3C19A 4IDKA 3OTDA 1EKRA 4PEOA 1EARA 5IORA 3I0SB 3QO9A 1XZPB 2HAFA 2GVDA 4F3QA 3MXHP 2XNCA 4ILRA 3W5UA 4XM3A 5CZXA 4JI2J 2VQEF 2X1BA 3KLVA 4QWAA 2ZKUA 1FJGJ 5HXBA 1FDDA 3UW1A 4ZVSB 3MEEB 5IV4A 3A1YG 4Y52C 4O4GB 3G4SB 3TYTA 4A3KC 3C66A 4J9KA 3PRDA 1RBLA 4O3NA 2VZ9A 4Y0FA 4LR7A 5E0OA 4PQUA 1KDNA 1Y1WK 3A4TA 1VQ5B 3GTJC 1JLBB 2IRXA 2MGZA 1J6VA 3LANA 4KPYA 5FDLB 3FC9A 3OHBA 3M8QB 1TZ0A 1R8AA 3MAAA 2QA2A 4RPFA 1VGYA 2VG7A 4LSLA 4GMKA 5B0EA 2NVYC 3E51A 5IT0A 2QA4S 2LP4A 5KFOA 3HOZC 5J2PB 2C2EA 2NXCA 2QLJB 4N56A 3IR6B 2O67A 2XQCA 1N6QA 2JL9A 5F4MA 1A9NB 1O51A 4NCGA 3ZTRA 2VQEJ 2XNJA 1XQBA 1F93A 1H0HB 2HQDA 3C6UA 1B0PA 3ZZOA 1D9DA 3UN3A 4USWA 5A88A 3S2DC 5KG4A 5DGBA 5KFUA 3PYDA 1U45A 1JQWA 1KHWA 2GJKA 2HRUA 2W2MP 2OJ3A 3M3YK 4IFYA 2JVRA 5JUMA 2IJRA 4BCAA 1YBAA 1HHTP 2B3TB 5AXLA 4EEYA 1RAAB 1XFOA 3PO3K 4MK9A 2A3JA 3CDWA 2PFFB 2FC8A 4KV8A 2ZH5A 1YTYA 1WTHD 2E2JK 4CT8A 1RTDB 4B48A 2BE7D 2BM1A 1KQ4A 3AD7C 4OPVA 1RKJA 2Y9HA 2C3PA 3HHLC 1K0TA 3EUNA 1I6VA 3CD7A 2R9VA 4ECSA 4A3EC 1PC4A 2FZGB 1RHUB 3K58A 2NVTC 2KRBA 4OMFG 3M8WA 3CTAA 2FVRA 5CQGA 4A8WA 3U27A 5A89A 2E5LF 5DGAA 3BCDA 3HVWA 4ENOA 3UPFA 2FDNA 4IH5A 4YAOA 1M1GA 1SFOC 3QSYB 4DWIA 1LWCA 5IT9U 3R8YA 1SJFA 2R2UA 1Z2ZA 5BR8J 2G0JA 5J35A 5KG0A 3UDLA 4NI2A 1M90T 3ZTSA 3I4PA 3QGGA 5A76A 4GTLA 2WPDA 3Q8YA 2DHHA 3CC4B 3NGRA 1B70B 2LCWA 4ZN3A 1NZAA 2DHAA 4RO0A 5B0AA 1M5KC 4B9TA 3O6QA 3GIRA 5HZBA 3G9CA 3OL7A 1ZM4A 3F73A 3A12A 3Q22A 4XR6A 3Q83A 3IS9A 5K20B 5KFQA 3CNQP 4QYZK 5C7PA 3J80U 1IR1A 1XE1A 4PQAA 2HNZA 4LSNA 2UUBF 2EPIA 2WJYA 3GSIA 4YHBA 4Z4VA 2H51B 5FJ8K 2VPZB 2ZZMA 1TUVA 1WEXA 2ADBA 3N6NA 2DGQA 4URSA 3G6VA 3ZC3A 1ZETA 3C2PA 3PYFA 1BMFA 4WWVA 3GV8B 3V4IB 4LQ3A 1I3QK 4P7TA 4R5PB 2QA4G 5KFKA 1HWIA 3LP1A 2RDJA 4ELTA 4TY9A 3ZZZA 2R93A 3OTOF 2VOOA 2VUMA 4UZBA 4F02A 2UXCF 4X07A 2PD1A 2M5YA 4KB7A 5EDWA 3OL9A 3M8RA 3S1QK 3NCRA 1DBDA 5LL6d 2OPQA 5ADZA 3NXZA 1VQLS 3KWMA 1JLQB 4CO2A 4LF2A 3PO2C 5G0RA 4P52A 3MCSA 3BO2A 3NGDA 5JVOA 4XLNA 3ISND 2UUBJ 2XY7A 3MR5A 4G7HA 2CF4A 2IBOA 1Y3KA 4IFVA 3EM1A 3FOFA 1WF0A 4RM0A 2R93K 2VUMK 4LJMA 1QFJA 4FXDA 1T9WA 4OP7A 2RDIA 1RB0A 2CPYA 3CCZA 3OR2A 5J2MB 2K8GA 5LSRA 2NZCA 1T9UA 5KTQA 4TKTA 4UW2A 1YLOA 2UXCJ 2R9LA 3RAQA 5KT3A 2HVEA 2C22A 3LGMA 1TKTA 3OXFA 1V0FA 1WC4A 1R0AA 5I3QA 4Z4YA 2ZZGA 5LSLA 1TR0A 4UT4A 3OV7A 3T1AA 2EBBA 3HOVK 3PEJA 1ZM3A 3W2WA 2VL1A 3VWSA 1WC6A 3GDZA 5A2QU 3SQOP 3N5BA 1UMJA 1COWA 3U6KA 3WBKA 4CO1A 5ETPA 4KY3A 3JSTA 5KG6A 3GFHA 3QMQA 3FCVA 2G1DA 1RWPB 3N0BA 1WTBA 5JBQA 1HNZF 1Q8LA 1HNVA 3T01A 3HHEA 3S1RK 5I3UA 4NOIA 2EFVA 1RT6B 1CNFA 1ZUNB 3DGPB 3QFHA 2YKMB 2C3MA 5I42B 3U02A 4RWXA 2HRTA 3RBDA 1XERA 3MDFA 1WNEA 4OHZA 2A2DA 1I8DA 2J0XA 3K5MA 5B0BA 3CJ4A 5CH7B 3VVUA 3I4MK 5HAOA 3S1MK 1M5SA 4UOGA 2IAJA 4JI8J 2NXNA 3VTIA 1W25A 3FUYA 1RAHB 1VGXA 2OUGA 5KFWA 4DR5F 4X7CA 4YMEA 5K14A 4OOXA 5KFRA 3R9LA 3KK2B 5FD1A 3BH6B 5HBMB 4JI7J 1PYOB 1ZVUA 3I5CA 4QWBA 2CPZA 2Z4PA 3M32A 1B0TA 2HIQA 5D3GA 4WWSA 1VQNS 2V7QA 4FPRA 4JI3J 1QGYA 3HT3A 3WDOA 1N0VC 2XNQA 3AOAA 2AX0A 2DRAA 3IG1B 4ED2A 1YI2B 1RT3A 2JA7A 3NNAA 1YIJB 4G3IA 2DCUB 3RZAA 1UZHA 4XCHA 5AE1A 1VC5A 1PO6A 2R2TA 4A47A 3MTKA 3KL9A 2JA5A 1IM6A 3CMQA 3CF5Q 3RBXA 2YU9A 4X05A 4DDQA 5I3PA 1TL5A 3IAM9 4DR5J 2POKA 3FKIA 5AXKA 2QTZA 3G6YA 3CQZA 4DR3F 1IJEA 1A8PA 1T6ZA 2BN4A 3AVYA 2A68A 2VQFJ 2OPPA 5HMXA 1URNA 2GO8A 1T3OA 3CJ3A 1SV5B 1D9AA 3FCWA 1WF2A 3QJPA 4TNOA 5KT6A 1I94F 5H1SV 1ZYRA 1T8EA 3WQZA 1N5YA 4HIZA 3RGIA 4DCJB 2JA5K 3CCUS 3R6KA 3IO1A 3NKYA 4I6YA 4F4YA 4KB2A 4OX8A 2YU9K 3PHTA 3IR5B 1TP7A 1HL6A 1K73T 4A93K 2E5JA 4HTIA 1UETA 1IKVA 4F2RA 1VRQC 5IYDK 3D2WA 4OYMA 1OHHA 4TXSA 3H94A 2LQ5A 2ZNYA 4HI1A 3VAKA 4D3HA 1K9MD 2QSWA 1G1XA 1N88A 1FF2A 1RT2B 2C5HA 4BPRA 2BJDA 4P3IA 4OLOA 4KM9A 1RWWB 2QN6A 3POTB 4L6V3 2WW8A 4M5JA 4WK3A 1GJRA 3W5HA 4LIWA 4UQGA 1LV5A 4XL9A 2QT7A 3I56B 3PJWA 5AE2A 1ACMB 1C1CB 1PAEX 2WB4A 4LT6A 3OE7A 3MD3A 3CC4S 1RHJB 4RNHA 1YKWA 4CYUA 2FVGA 4PABA 1U48A 1RT4A 5LT5A 4II3A 1SJ3P 4EBEA 3GYXB 3JB9k 2BVNA 1NDHA 3BB5A 1DCHA 4DX6A 1I3QC 4IOBA 4DCOB 2E9RX 2B56A 4RW9A 6FDRA 2F7VA 2FC9A 3MM7A 2XMJA 5J1EA 4WJ3M 1W2BB 3JQKA 4B3SF 2I1RA 2XMMA 3OD2A 2CW0A 3BF4A 4OIRA 4A3IK 3MM5B 1PJ5A 4TN1A 3S1QC 1IHMA 2KL8A 1LQ9A 4BDPA 3CVKA 1N8RT 1ZTTA 1RTJB 3THVA 1L0WA 2LDIA 3PNIA 3BKFA 3CJ5A 2RGRA 2Q6OA 2R6HA 2B7CA 3G6EB 5J3OA 1WD6A 1DQ9A 3M8PB 2PN6A 4HHHA 3GU0A 4WZTA 3PO5A 5KAKA 2V94A 2J0SD 1NB0A 1NHKL 4QVJA 2ZDPA 5L1IA 1F6TA 5JXSA 2J6SA 4NRUA 1YJNB 3ZBTA 3KJNB 2GIRA 2ZH2A 4DV6F 3U7JA 2HEKA 2KVOA 2NPFA 2F1MA 2MZTA 2XZTB 4KKUA 3ET6B 2EI5A 1MLAA 4CH1A 3LO3A 1HNIB 4R8UA 1VBZA 3OKXA 5KG5A 1FE4A 1B4AA 3H0GA 2Q79A 3HOVC 2EG2A 4WKRA 1UWBA 4HI2A 1RACB 5F4OA 2FVSA 4PWDA 4Z4RA 2PMHA 4LR8A 3SV4A 3FNNA 4P6YA 5IOSA 4YB6A 1RT7B 3BGUA 1Q53A 3OW7A 1MRZA 3KOAA 4ECYA 2QMWA 5KFMA 2GIQA 2QE5A 3S1RC 3OP1A 1RHMB 2KM8C 3NCQA 2VUGA 2PO4A 3LA0A 2I0XA 3W62A 3DLEB 5KFZA 4EBCA 3ZZTA 4TLRA 2BE5A 5L9NA 2ZWOA 3DRXA 2J9DA 2HNYA 3SZZA 4DV6J 2CPIA 3GG1A 3V6HA 4KQZA 4DXLA 4ER8A 1TL7B 4UZFA 2ALZA 4ITSA 1YJRA 2IM1A 3OEEA 3GVJA 4USIA 1FHTA 3I4MC 4NYOA 4CLWA 2VNIA 2ZM6F 1YSJA 4CQJA 3S1MC 3IGVA 4MEYA 1N54B 3TEGA 2UP1A 4RL1A 4OJHA 3PX6A 2ZH9A 2IJNA 2G13A 4P74A 3UWTA 5EWFA 1C1BB 3UDEA 4V19X 4RW8B 4TKOB 1X8DA 1RU0A 1N5VA 3AHPA 3OTCA 1CQXA 3CCQB 2JFDA 1IJFA 4Q4ZA 2GK6A 1W0JA 3RY8A 4ECVA 2BJ1A 3FEYB 3PIPQ 3OXLA 1UFKA 5DLGA 4U7UK 3KYLA 2GPJA 3JXOA 5H9EK 2M3DA 1S6QB 1GT8A 1KQGB 2JDJA 2ZFHA 1SKWA 4BY1K 4WFZA 2GJFA 1KNZA 3HJFA
chains in the Genus database with same CATH topology
3TFHA 3TFJA 3TTGA 1WOSA 1XZPB 1YX2A 4PABA 3A8JA 1VLOA 1VLYA 2GAGC 3GEEA 3TFIA 1XZQB 3GEHA 3AD8C 3AD9C 1VRQC 3GEIA 5L46A 1WOPA 1PJ7A 3ADAC 2GAHC 1PJ6A 3A8IA 1WORA 1XZPA 1WSRA 3AD7C 4PAAA