1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
3AD7C 4PAAA 1XZPA 1WOPA 5L46A 3A8KA 1XZQA 3AD8C 3TFHA 1WOOA 3GIRA 1VLYA 3A8IA 3AD9C 1WOSA 1XZPB 4PABA 3TFJA 1WSVA 1WORA 2GAHC 3TFIA 1WSRA 1VLOA 1NRKA 1V5VA 3ADAC 3A8JA 3GSIA 1X31C 1PJ5A 1VRQC 1XZQB 2GAGC 3GEHA 1PJ7A 4P9SA 3GEEA 3TTGA 1YX2A 3GEIA 1PJ6A
chains in the Genus database with same CATH superfamily
4GTCA 3Q23A 2CUYA 2HK2A 2V9WA 2BPOA 5HQ8A 3VAMA 3A13A 4E98A 3QLHB 3ENVA 1IBMF 5IYBK 4P9SA 4P6QA 1S7HA 3T3FA 4DQQA 5BJRA 4BY1C 4KB4A 3P5TL 3QAEA 2VNHA 1HR0J 1B3TA 3LANA 1HQMA 2UUAJ 1R3NA 1EKSA 3NUHA 4UOFA 3V81A 4GTEA 5HJXA 4CTAA 1ZVUA 4YP3A 3CMQA 4I7FA 4UOCA 1UCNA 2QO3A 2FHMA 2Q66A 1VQPS 5CD4H 2ZKUA 2R8KA 3S1NC 4RZRA 4LQYA 1VR6A 3W66A 4MFBA 3HSZA 1H42A 3DLGA 1S77D 3PO4A 4A93K 4LR9A 2Z6BD 5C42B 1AFJA 4BKWA 3RZDK 3MFIA 2UUTA 1IBMJ 4RW6A 1RAFB 1I1GA 4CNYA 3BREA 3AD8C 1F2HA 4IFYA 3BH4A 2LA4A 3QGIA 4X7DA 3V4IB 4N3NA 1X8DA 2P8IA 1MNEA 2V7UA 5IFMA 2DNPA 4B3OA 2MKJA 2RH3A 3DDNA 2H51B 4HHHA 3GYXB 3KLEA 4Y9UA 4NYZA 2ZHAA 4X4RA 1XNRJ 1YZ6A 3WBJA 2D9OA 3LP1B 2K1RB 3CTAA 1TFWA 1UFLA 2XSFA 1HI1A 3CCVB 5IQQA 5AJ3F 2HIYA 3NP5A 3UO0A 4USIA 3FKSA 2UUCJ 2FLLA 3L7OA 2VPWB 3L4JA 1HBNA 3OPKA 2E1MC 1CJUB 4QIVA 4RW8A 4B3OB 2VHGA 1LWXA 1R9TA 3V4IA 3M6WA 5LT5A 1EQ0A 1CC7A 3CJQA 1MROB 2DH9A 3J7YU 3CDWA 2GJRA 3C3LA 1Q8BA 2OMLA 3DLEA 4RO0A 4O2DA 1Q81T 4YAOA 4DPWA 5ETRA 2NVQK 3GG0A 3B54A 2B9WA 5CXTA 1QJHA 4K2XA 1CLFA 4GVBB 3RZDC 4ECQA 1FF2A 2IRXA 4A3GC 5I3UA 1NJXA 2GJFA 5B0BA 1GMVA 2IBOA 1WJ9A 4TYBA 3U02A 4OI0A 3W7BA 2B4PA 3C15A 3G6VA 2OK7A 1R27B 2E9ZA 1X4EA 1X5SA 2X7IA 3ERED 1YBUA 2VKRA 2DXFA 2B7CA 3FNNA 2CZ4A 1RACB 2QX0A 5HROA 2ZH6A 3ILOA 1W2IA 4ICLB 3TFHA 1N36J 1RTJB 3LPXA 3T9NA 3JAMY 4JI8J 4BY1K 2XYHB 2BJ7A 1GJRA 1RWUA 4OX9F 3DU6A 3RZOK 5HMWA 4G1QB 1T6XA 2EXUA 1SIZA 3LO8A 1PJ6A 3W2GA 2CWKA 2FHKA 3PO2K 2NZCA 3Q89A 2VBZA 5F8IA 1HIYA 3BGLA 5KT5A 4UZUA 2Y1RI 3LGHA 2IM2A 4XLFA 2UP1A 3SXLA 1T0TV 3W9JA 3PV8A 1XMOJ 1XNQF 4ED4A 1KVIA 4Q2MA 2MGZA 4URGA 4P3IA 1HNZF 2FHJD 4LRDA 4B9TA 3HHLD 3S2HC 2V68A 1YTYA 2J9DE 4NA1A 4KIAA 3K5LA 2R92C 5CA5A 1YK9A 1AB4A 1LWFA 3GG1A 2KO1A 3MM9B 3MOJB 4EO6A 3BPDA 4RUCA 2AYMA 2X6YA 2RMLA 3HX9A 3Q0AA 2CPFA 4CDIA 3NNCA 3UDLA 3M2VB 2E1AA 4LBWA 3PJWA 2FZGB 1K1SA 4K0KF 5K8MA 1D8ZA 2HBQB 3GSDA 4BBRK 3FBEA 3IS9A 3A1PA 2C3UA 1VLYA 3MCAA 2KKHA 3HSDA 1X4GA 5FIUA 4WZLA 3T19A 3QT5A 3US5A 3L4BC 4C6AA 2RU9A 4PWUA 3HOZK 3TZXA 4TMZA 3W2EA 1CSJA 2MKHA 3OHAA 3GIIA 4C48A 2ILZA 3PO5A 1ZOTA 2B51A 4KC6A 5DGAA 3HXAA 1Q79A 4NXMJ 3CCMB 1N6QA 3BYRA 4DR1J 3PA1A 1A7GE 4BLBA 1SH0A 5CH7B 2ZDOA 1Q5YA 4ECTA 1S9EB 2Y9HA 1KOOA 1WTFA 1RAAB 2UV8A 2ZFZA 3GIJA 2UUWA 5DO2A 4KHPF 2V31A 5HMYA 2VICA 4AL5A 1N5VA 2HNDB 4I2PB 3V76A 3DDYA 2AEMA 2XY5A 3V7AA 1S9EA 4J9NA 2RRAA 5KFSA 4PC6A 3NS6A 1LKZA 3GTPA 3WNBA 4UTGA 1VHIA 4IUFA 4Y2MA 1LOUA 3R5DA 2AJ0A 2B56A 1YI2S 4XIUA 4DUZF 4WE1B 5T14A 2H54B 1W0JA 2BE7D 5KFYA 2OPQB 3BN7A 2N82B 3ONYA 1RU0A 3RR8A 5KG6A 2LLZA 3T53B 1BC6A 2GQCA 3PIPQ 2X3UA 2OPPA 3W2VB 4B48A 5DQHA 3FMBA 2JFDA 1VQYA 5C4XK 4DZDA 1NSPA 4G7OA 2ZZMA 2W7PA 4QU7A 2CPXA 1Y4ZB 1S72S 5DN6A 3RAMA 3UW1A 3DLKB 4WTOB 3EICA 3R6LB 4A8FA 2Z0GA 2MZQA 3AH5A 4LR2A 5K14B 4CZCA 4FYXB 1YJUA 1SM4A 1WQFA 2KTQA 2BOAA 2CQPA 2RRBA 1U1OA 2KJWA 1FRXA 3FMWA 4OINA 4KASA 4WYLA 1M5KC 3DN9A 1FE0A 3FGVA 2L48A 2N3LA 4ID5B 3CJSA 2RH6A 2YWEA 4F4XA 1VIOA 4OFZA 4OHXA 3BV8A 5LJ5Y 5DDRC 4DU8A 3I0SA 3QRQA 5F3ZA 1CVJA 4KAWX 4LQ9A 1U0HA 3L9ZA 1UFWA 2I0XA 2HFVA 5KT6A 1VS3A 1WC1A 2RQCA 1U02A 2ZZTA 1IS1A 2AWZA 3HKZL 4GKJJ 3IWLA 3C2PA 3CDAA 1N32F 4A3BK 3AAWB 3A3BA 3K17A 4RD6A 5KFNA 4O0IA 3JSBA 1DG1G 3QT7A 4WZKA 1YZ7A 4DV3F 3OE7A 4M5LA 1MMDA 3HHEA 1TZ0A 2EK1A 2YU9C 1K9MD 2CJXB 4PKDB 3VO1A 4Q8EA 2W4DA 2DO4A 3CJKA 2CNNB 2F4VJ 4ACAA 4DCOB 1V3SA 3MUTP 4RD1A 3U1MA 3Q8QB 3VHQA 1FWKA 4CLKA 4FXVA 4KGVB 3IGVA 4NNJA 2CQCA 1S48A 3JQPA 3QATA 5EGEA 1T9VA 2E5LF 5C5JA 3HHLC 2AQ4A 4ZP6A 3QNWB 1WCMK 4DSLA 2YNIB 3MTJA 2PPBA 4P73A 2WOMA 2ADBA 1NNDA 4OYOA 4WJBA 1KJZA 2Z57B 3TNVA 1HHTP 2GO8A 3UNYA 4X6AK 1O24A 3CCJS 3RAQA 1RWWB 2D3NA 4KE5A 2N4CA 2QA4S 2OFHX 1TWHC 3FHZA 3R8YA 2IC3A 3KL9A 4RW8B 3AOBA 3N6MA 4CLWA 2I1RA 4GKKF 1NSQA 3OV7A 4KMAA 2OI2A 3PY8A 2J0QD 4BBRC 1FXDA 1NZAA 5T7LA 3OL9A 3JSTA 1R8AA 5B7WA 4HTJA 1HD1A 1OJ4A 2ZD1A 5HLFB 4Y6IA 5KFDA 5GAGI 1ZTWA 1B4BA 3G6XA 4C8LA 3DCAA 1TMJA 3M6XA 4LF5F 1NB7A 2RAQA 2FVQA 3UD5A 5DG9A 4LF8J 2Y8WA 2YKQA 4LVOP 2AW0A 1SFOA 3G8QA 3RW6A 4DL2A 1TAQA 4B3MF 4JI6J 1UAWA 4M5NA 2BRKA 3EX7B 4FF1A 2VUMK 3ZC3A 1JLAB 2V2QA 3UQSA 3M30A 1I50C 5E3QA 2A69A 4C3JK 1J6VA 1VHFA 3W60A 3CCRS 3NEKA 4QW8A 4WZTA 3OTEA 1V9OA 2OTJB 4GMKA 3L4KA 2YKAA 1ITPA 4AQYJ 2BKPA 2V6AA 3DYAA 5GMKa 1JA0A 4O3SA 3BSCA 1W9XA 1IBLF 3LQVA 3I82A 2XOKA 2XB2D 3CMAS 4RNNA 5TY0A 4FNIA 5L9NA 1AMOA 1QFJA 3LAJA 3BB5A 3UR0A 3EYZA 3DYAB 3HHLA 2YNFB 1WPCA 4HH0A 2YNHA 3AD7C 2P2CB 3PFEA 3CCUS 1Y1VA 1QUEA 1X9SA 3P8BB 4A3JK 1KFSA 5D4OA 1RAHB 3JSYA 1J5OB 3OXFA 1JIHA 2UUBF 4OYXA 4F3OA 3KLVA 1R8PA 4URQU 3D7SB 1HNXF 1NDKA 1NRKA 1F3VA 4FS2A 4J9OA 3D2WA 4FPIA 1WG5A 1OPZA 1FKPB 2Z8QA 5FDLB 3A3OB 5EX0A 2CJBA 5HATA 4ZA1A 2NVYK 3IBFB 2W01A 2JL9A 3KG1A 5LMUF 1VQ6S 4AQYF 3UN5A 1TKTA 4K4VA 5T7LB 2DRAA 4HEA9 4ZPDA 1TTHB 2UXDF 2ZFHA 4KGMA 1QSYA 4B3GA 4XKVA 1RSCA 4DV6F 1U6BA 3M8QA 2HHWA 5FNZA 5KFOA 3GFHA 3OOCA 3BM7A 5KG3A 3CDUA 2AHOB 2O01C 1UP1A 2VIHA 4IG3B 1J5EJ 5U47A 2VPYB 2PDAA 2GHVC 4DLGA 5LXYA 1KQGB 4DV1J 1U4BA 2E7XA 1D8YA 4P12A 3CULA 3KHRA 5L1JA 1EH1A 5KT2A 1AZSA 3SMZA 2NXCA 4MKAA 3F73A 1EP4B 4AVZA 2HHPA 3W5UA 4ZCIA 2FIUA 3PDNA 4HYKA 4JV5F 2MJNA 2BJ1A 4B08A 4R25A 3A35A 4Y2CA 4L3KA 1QY7A 3PTWA 2GSNA 1XJWB 4DU7A 4NLYA 1KQSB 3AVVA 1JA1A 3CJKB 4MEXA 3A12A 1FXRA 1U48A 4YG2A 1QVFR 1OSCA 1IKVA 4CO2A 4C0BA 3U27A 2KU7A 3MGJA 1HNIA 5KFBA 3HM9A 2JHEA 3V6JA 3H5YA 4AYBL 1FFWB 4M94A 3OUYA 3VNUA 3MD1A 3I96A 3PYEA 5F4JA 5LMNF 4N47A 2ZZFA 1F9EB 1SKWA 2DGXA 1SKYB 1UVJA 3D5MA 3TX8A 3CUNA 4ROXA 3WQPA 4IG0B 3GEHA 1VOMA 2LYVA 1C1CB 3MEGB 1EX8A 3KJQB 2HFSA 4PXBA 2IVFB 1Z4UA 4J91A 2MKSA 2MKYA 4ID5A 5C25B 2GPJA 2OTLB 2YU9A 1CQNA 3TAQA 5L1IA 1V5VA 4NLSA 4OHWA 1URNA 1U0SA 3BO2A 4I1TA 1WHWA 2BE9B 5KT3A 1N33J 2HEKA 2C22A 1RT7B 4O0NA 4ZP7A 1VQ9S 2WSCC 5A8WB 3S1QK 1DDGA 4B47A 2U2FA 5JVGQ 4XPEA 2A6EA 3BY2A 4X4VA 2HVEA 4OLOA 3S7RA 2M5SA 5CZXA 1ZUNB 4DN9A 1KLNA 3A3GA 5C25A 2HPUA 1TAUA 3V4MA 3R5GA 3G87A 3DDIA 1X5OA 4N7TA 1MW7A 1S9FA 1SIWB 1S1VA 1HNVB 3U6KA 5FO0A 3T5LA 2XY7A 2W4CA 2VASA 4TMTA 2G13A 3W8GA 3SIPB 2ATLA 2F4VF 1OB2A 2J76E 2RT3A 4QWAA 5A2QU 2HHHJ 4USTA 3CCLS 1RT1A 1HPZB 4WE1A 4HE5A 3ZUGA 1F5CA 1Q53A 5F9NA 1CJKA 1REVB 2NXNA 4C45A 3A8KA 3OUYB 2VNJA 2PMDA 4DX8H 2J6TA 2BGJA 4YB7A 3LW5C 3A1YG 3MTKA 2Z30B 1WF0A 3CCTA 1TUWA 5ETSA 4UZEA 4U95A 2R7RA 4LFBJ 1U2CA 1IKVB 4IDKB 2ZZEA 4A8KA 5ITHA 3H5UA 3J7ZT 3KLHA 1XC9A 2FY1A 2B43A 2KHCA 4DL7A 1IR2A 1C0TB 1KC8T 4P5AA 2C2DA 2WZNA 3KK1A 2F9DA 4UUWA 4CYUA 5H9EJ 3N0BA 1IBLJ 1NBEB 2R2TA 2DXEA 1WC5A 1USMA 4EO8A 4FYYB 2QN6A 2AJ4A 5H59A 1N5YA 3SV3A 2HW3A 2M52A 3AA8A 1GO2A 4LF7J 1W7WA 1HWUA 3FVYA 1F9NA 4ECWA 4KFBB 5D0GA 3C46A 2QTLA 3KK1B 4RU2A 1VGYA 4PRFA 3I1FA 5B0CA 3R3TA 3BGUA 3HKZD 3OFGA 1W87A 1VC5A 5ETPA 1LNQA 2WB1L 4I68A 1IM4A 3MEKA 4NLUA 5E3CA 4RPDA 3BC9A 1X9MA 2R7UA 3CMES 1U1NA 3S1MC 3MPDA 1HD0A 5IV3A 4WJ3M 1F2GA 4WFBQ 1U24A 4CLPA 4TT3A 4EUVA 1V0EA 1VQKS 1WI8A 4AL6A 4FBTA 3V4GA 1YLXA 2XMVA 3TJ9A 2CADA 3R5JB 3J80Y 2M70A 4NLOA 5A76A 4XLHA 4OI1A 4E8UA 2D9RA 1FEHA 2OSQA 3C6TB 3MMBB 5CABA 3S2DK 2AF6A 2ALYB 5DGBA 3TUJC 1S6QB 3R5CA 4JI1F 1TWFC 4Q7AA 5AE3A 3C14A 3EWGA 3MOZA 3GQBA 5AXKA 4K5SA 2DNQA 3ZXWA 3IN5A 4IR1A 4S0MA 3HSGA 4QIWL 5IYQA 4C3MA 4Y65A 2YKMB 4DJBA 3RBDA 1VH2A 1FFSB 2R93K 3V6KA 2GMJA 3FKIA 1QFYA 2W9BA 2JDIA 3WX4A 3MI7X 4HTIA 1VRQC 4ZVUB 4IOAQ 1Y1WK 3GR1A 2V9KA 2GJ2A 3UPFA 4QWDA 3W2WA 2M7SA 3BKUA 4DV4J 3AJ2A 4LR7A 1CS4A 2MPUA 1I7PA 1LEOA 2NUHA 4PG8A 4OP7A 4CH0S 1UD8A 5FLXY 2GAGC 3TA0A 1BLUA 1GTEA 1U7LA 5M2UA 2HLUA 3MUMP 3TARA 4FF4A 3QFSA 3H90A 5H9EK 1NKEA 4WIIA 4FWTA 3I4PA 3DRPA 3HHLB 2WTFA 4TLQA 2DHXA 2KJVA 3NE5B 3OSPA 4QU6A 4J90A 3RB0A 4DG1B 4DS5A 1VRUB 1OB5A 3ZNUA 1GQEA 4B9SA 3DGVA 1JOEA 4ACBA 4DV5J 3GILA 3LQEA 1S10A 1V0FA 4RCZA 2CQGA 1FRNA 4KTQA 3NRBA 4EFAC 4QIFA 4M1XA 4HL9A 4KMUA 4Q45A 4OJGA 2RGRA 5FD1A 2DK2A 3W5VA 4UF4A 1U09A 3S1RC 4YHHF 1KBRA 4XQFA 1TK5A 1Y1VK 2EBEA 3ZTRA 1VQLS 2LQJA 1CNEA 3MURP 1HBUA 4HACB 3M30B 1H7XA 4CT8A 2JA6A 5SUHA 3RAXA 3I9ZA 4ZGNB 2CQIA 2CWXA 3QFRA 4NLPA 2FVPA 3G8TA 1UD6A 5K9FA 3HKWA 1T9XA 1PGZA 1S6PA 1MLAA 1PJ7A 1NM2A 2M3DA 4KV8B 2A6MA 2PN6A 1U1LA 1YJWB 2BYCA 5HP1B 3QIPB 3GJTB 1P27B 4A8QA 4A3FC 2ZNYA 1RWPB 2G2OA 4TMWA 3EZ5A 2DGVA 3IP0A 1KFDA 2U1AA 1PO6A 4MFBB 1N36F 5EUHA 4EZ9A 5CZVA 1X4CA 3NS7B 1QTMA 4KH0B 2BXJA 3PW7A 4OYMA 3HK2A 2AYGA 2HHXA 4A47A 2PD1A 3IBWA 4MIAA 2E2JK 3MEDA 1UKUA 2AJFE 4O3OA 2XLJA 3SEOA 1WSVA 3ASQA 3CIMA 3NL0A 5IWAJ 2E2IK 2F1LA 2HFNA 3QGHA 1Y11A 2HHHF 2WAQL 1D1UA 1VQ9B 3E1YE 4TKOB 2N3OA 2DPIA 1QUPA 2F3JA 1D09B 2LU1A 4WZEA 3SI8A 1XN9A 4B3FX 1TWCA 4CLLA 4ZN3A 1JLBA 4GKJF 5FIIA 4DQIA 3GQCA 2V7VA 2KXNB 4GC6A 2W25A 1DD5A 1RCOB 5IOLA 3M8YA 3I55S 2OTJS 4ZPTR 2B63A 4DR7J 4L3NA 5L8RC 4ATNA 2GA7A 3CQZK 2RE1A 2KWAA 2E2JC 5M5WK 1FWPA 1KQKA 5EGYA 4DUYF 4RD0A 1L3SA 2VQEJ 2ERRA 1HL6A 3CAGA 5EHHA 2A18A 4KN7A 1VQPB 3LVBA 3T5KA 3Q3AA 4UZCA 2HS3A 1VQ8S 2IIHA 4KC5A 2AJ1A 2B7BA 3MECA 1TMMA 3I0SB 3HOXK 3ELHA 2D3OR 4PYAA 3ZIAA 1IQTA 4G0VA 4ECZA 3CRZA 5L1LA 1TWHA 4ID8A 3ISND 4WFNQ 3NNAA 5GAEI 2PMWA 1X4BA 2DEJA 3CPWB 2P9GA 2C2NA 2JC1A 2MHEA 4C7QA 4N8OA 1F93A 2HHVA 2ZBIA 4ED0A 2CFXA 2FC9A 5C24A 3KNGA 3BQJA 5C44C 1RT4A 4XD7A 3FOFA 3J81k 2NPIA 3ULHA 1FX4A 4P26A 4OHYA 1TL7B 3JYTA 1KHWA 2ACYA 8RUCA 4GTAA 3HXMA 1TUIA 1R5BA 2ASJA 2N4DA 1KONA 2DHHA 4NZ0A 1TVRB 3FBBA 3EGVA 1Y1VC 2X3DA 4DN0A 2NS1B 2JNJA 1WORA 4NE9C 5HBMA 4ES3A 4RUHA 1QTNB 1VK3A 5HLFA 2ZH4A 5TR9A 4KO0B 4WK1A 1XB2A 4F2SA 1BQEA 2HWHA 1WQHA 3VGTA 4GO5X 2IRUA 4RW7A 3ILLA 2ZJPQ 3M9NB 3KK2B 1TWFA 3JQMA 3QZ8A 2KZZA 1Q5VA 1Y3JA 4KQZA 4OMFG 2WB4A 4C8NA 4FS1A 2V8DA 1DCPA 1RYSA 1JB0C 2J6UA 2AX0A 4ZJQA 2HQIA 4DZ6A 4EEYA 2V5HG 3TA1A 4K5RA 3OW7A 2G1DA 1UJ5A 1HBMB 3N28A 4MT1A 1RA7A 3MAAB 2DNYA 2NCKL 5AJ3J 1B99A 3MHPA 4KO0A 1QG0A 1U1MA 1WIHA 3KDNA 3BKFA 4QYZJ 3RZOC 5IP9C 3UI3A 1N6QB 4PG6A 1L3VA 3ICLA 2AT1B 4CLUA 1BDFA 2JA5A 1PIEA 2X1AA 2AGPA 2VG5B 1JXVA 4M4SA 3OZUA 4RM0A 2XMWA 3G4SS 1O5JA 4TN2A 3S2HK 4HDGA 3BGFA 2CFAA 4Y52K 4O4GB 2QEXB 3O1LA 3N6LA 2C2KB 1TWCC 4QVAA 4KH1B 1TQLA 3GIKA 3BY1A 5E3AA 2YWGA 1G51A 2P9CA 2EVZA 1TL1A 2ADCA 1S76D 4X66F 5IYRA 3U6BA 2MLXA 3DKDA 4YOEA 2HSEB 4RWXA 2GVZB 2YQ1A 4KKOA 3CCWA 4GQNA 4AFFA 4MIWA 2NR0A 4OIXA 4Z2XA 3MECB 2H4YB 2ZEJA 1FDNA 3IG1A 3TQ1A 2NQPA 5E6TA 1M5VC 2XNDA 2J8AA 1K1QA 3SQGB 3H7HB 4LQ3A 5C3EK 3OVSA 2W8KA 2VUMA 2NSBA 1U6FA 4YAWA 4M5JA 2WONA 3AD9C 3J80U 1JNRB 1OY6A 4DV7J 2ROGA 3CC7S 3TUIC 4HDHA 2EBBA 4C4WA 2HRUA 1RTJA 1SC4B 3M7VA 3T1AA 1ZM3A 2V34A 3LF0A 4QBUA 3CXCB 4JMQA 2C42A 3GFYA 5KT4A 3RU0A 4UW2A 4DUZJ 2ZTNA 3ZZOA 2XNCA 1HNWF 4YAFA 4ZIWA 2CVEA 4YS2A 1O0PA 1KK2A 3N01A 3C15B 1JLBB 1JLQB 1OO0B 4LIRA 2RILA 2EFGA 3BO4A 2VPZB 5CDFA 3KXDA 6FD1A 3SSRA 1TV6B 4KT0C 5LMZA 6FDRA 3QGPA 4O4GA 4BY7C 2CFAB 2X1GA 3HHNB 5EMNA 1D9DA 3SFUA 1YG0A 5DSZA 3DLEB 2XI3A 1J2VA 2BQUA 1S5ZA 3MEDB 1Q82D 3W8PA 2P8TA 1UVLA 1OGIA 3SCJE 5G4DA 3FJ2A 5C3EC 5L39A 3H5XA 4F25A 1R7IA 4DR6J 2OPSA 4G5GA 2XM3A 1XXBA 4L74A 1UZDA 3GTJC 1J6XA 2ZC3A 4PG7A 1H2TZ 4BC7A 3R2CJ 4ED7A 3MAAA 2DIEA 2Z2MA 1U45A 3C16A 1SV5B 1IM6A 3BSAA 3VV2B 1VQ7B 5B08A 5A0YA 1RWKB 1NJYA 4AXJA 4LUBA 2XMAA 3MMAB 3O44A 1EFWA 2NVXC 4IH5A 2CW0A 3I4NK 2Q6OA 4DNRB 4HKQA 1Q0NA 5H9FK 3RB6A 1CNFA 2CA9A 1TL5A 3EDQB 3LOUA 2EFOA 3KK2A 3RRGA 3CMEB 2ZUFA 3G6YA 2M9KA 1I3QA 1K83A 1EETA 1I50K 2VD3A 2WAQD 1UWBA 5KFLA 5J1NA 3ETMA 4CQJA 1XEZA 3CCSS 3Q24A 2VB6A 4GO7X 2YWKA 1RT4B 3OL6A 3DC2A 2DB1A 2V6SA 1RHUB 4ZH4A 4ZVQB 2MQLA 5IM0B 1C4CA 3MMCB 4QJVB 2I9SA 2ABYA 1O2BA 3HD2A 4X07A 1HZEA 4WBFA 2BA9A 1M1GA 1KOHA 3UE2A 1W25A 3BP8C 1RAEB 3JS9A 1S0VA 3UDEA 2HQFA 4J7CA 2UUAF 4H4MB 1A8PA 1GXLA 3DOLB 2JA8C 1KQ4A 3ONQA 3PZPA 4ES2A 3PR5B 5KNLA 2ZH1A 5KFZA 5CYMA 3V81B 4TVAB 1WF1A 2MGZB 2APOA 2H5EA 1XMQF 4EI2A 1S0MA 4ZPCA 4RCYA 1JLCA 4DPYA 3MPYA 3CD6B 1F60B 2AGQA 1W26A 4ELVA 2BE2A 3KLIA 1I50A 3G71S 4U8VA 5HANA 2VJIA 1YNNA 2UVVA 4EBCA 1D1NA 1FTCA 3I0RA 1EP2B 5HXBA 3OHBA 1APSA 4NZ6A 1R0AA 3DMJA 5KFHA 4R5PA 3TAMA 3DM2A 2X0KA 2ASLA 2YNGB 1NK9A 1RWMB 1HHSA 1G7CB 2VG7A 4YN3B 2DETA 1Y00A 4XO0A 4N56A 5D3GB 3MPVA 4C3KA 4LBVA 4YFXA 3K2YA 4ED8A 1DCHA 4DR3F 5HAOA 3Q38A 4ZVRB 2QGFB 4MMOA 2CJAA 2FJVA 4WXWA 2BBEA 1PYOB 1X4FA 3HOUK 3GVJA 5DZ6A 2UXBJ 2HHUA 3M3YC 2QLBB 4A3LC 4G0UA 1M5PC 4L73A 1K73D 3W2IA 3GJRB 1N0UA 2B6AA 4A3DC 3C6TA 3MMBA 4JV1A 4KGZB 1P8GA 2ASDA 1RT3A 2FLPA 2DYIA 2GQQA 3HOVC 4BLGA 1FRIA 3IR5B 2QRRA 4F0KA 2VONA 2ZVSA 1X7VA 4JI0J 3QYYA 4ZKAA 2VQEF 2L41A 4PXCA 5KG5A 3DOLA 2R7SA 3VGVA 3PVDA 4J5OA 2DY9A 4QQBA 3QWPA 1NAQA 1IWAA 5F9LA 2W2QP 4JI7F 4Q43A 1D2EA 4NPOA 2R9LA 4F8RA 2DH8A 1SJRA 2WVCA 3MMCA 1T5EA 2NXUA 4NMLA 1HWIA 4J9SA 4LMZA 1H72C 2X6XA 2DPJA 3FUYA 1FNBA 4ER8A 3CD6S 2IJRA 4V1Ak 2V4JB 1CJTA 4DV5F 3M6VA 3MM5A 3R9LA 4RDLA 1J27A 1CPZA 5B0EA 3MFHA 3EXCX 5GV7A 4I0WA 3AGQA 3KLEB 2X53S 2RUSA 1NZ8A 1D9FA 4LSLB 5KG7A 2GVDA 3DRYA 1IHMA 3CESA 1O6XA 2MTLA 1DZ5A 1XK8A 1I3QK 1K83K 4UAJA 5KG2A 4G1PA 4ZLLA 2KT5A 3W5ZA 3QBCA 2VUGA 5C7PA 3TX0A 2O5DA 3SCIE 3WDOA 3OT9A 4K4ZA 4DX7A 3R6GB 2F1FA 1BWVA 3T00A 2VDHA 4IDKA 3HVWA 1QAJA 4LK1A 2KVQE 4H9GA 2J7KA 5B0DA 5FLMK 3S16C 4BWJA 3TVKA 4F2RA 4NI2B 1YJNS 2DXDA 3GYNA 3CP2A 2RHSB 4C3IC 4WJ4A 3PW0A 4ANDA 3DRPB 3QQCD 4DHVA 4BBSC 2YBVA 1HPZA 2J8SA 3GYGA 1UVIA 1T3OA 3RY8A 4DV6J 1OIAA 3WNCA 4MH8A 2UU9F 2C5BA 5CQGA 3ES9A 4PWWA 4JI1J 3G86A 1MRZA 2JSXA 3M6UA 2C3MA 2GIQA 3FCWA 1S99A 3FBFA 3I56B 1IQ0A 2MQQA 2HVZA 2MQOA 2X1FA 5KFIA 1XR5A 3TEGA 2GZOA 1LK7A 2XMMA 1FD2A 2WPDA 3HVTA 4E0FA 3AQPA 3DLHA 1JLQA 4X4TA 4A8YA 4DQPA 3OSNA 2MXYA 5RUBA 3W5XA 1YHQS 2UVRA 4PQUB 1T9WA 4FM9A 2CBXA 2G0JA 4ZVFA 3IAS9 1PILA 2C1EB 1HNWJ 2LQ5A 3Q83A 2IAJB 2AJQA 1WEYA 4RKUC 4TXSA 4J9QA 2ZL7A 4YFNA 3KTQA 3CXCR 3TVZA 1Y5LB 4C3LA 1Q7LB 4M5GA 1SC3B 5D0EA 1CQXA 1UTAA 2KL8A 4NLQA 5KFTA 1RT5A 2I5JA 3CJTA 2DEIA 1BXNA 3KYLA 1QLNA 2HYIB 1MMNA 1RABB 4EZ6A 4EK2A 1LFPA 1Z2ZA 5J1PA 4OIQA 1O27A 3GB0A 4F0MA 3GSIA 4YQWA 4RPFA 2GMLA 2CNLB 3NLCA 2VBYA 1KS2A 4ILMA 3WBZA 3PR4A 1PG5B 4B02A 4M95A 4XN0A 2VYQA 1KK1A 3JXOA 4ENOA 1NK0A 2HHSA 2LZJA 2D74B 4C97A 1VDHA 4X4OA 4FF2A 1SKUB 4LRFA 3HZEA 3H2UB 3SJPA 1H73A 2PLFA 4TN1A 2AV5A 2FVRA 5ETKA 3QPIA 4QZVB 4B3XA 5LSOA 1XZQB 2HG4A 1SC1B 4LF9J 3KLGA 4NYPA 3S2DC 1IKWB 3K5MA 3HOYC 2D41A 1I51B 1UWAA 1WU8A 2GX8A 2PI5A 2NPFA 3U7JA 1HYSA 2YU9K 3BH6B 3U1LA 3OTOJ 3QT8A 1JLEB 1O51A 4DSIA 5F8GA 2MB0B 5GMEA 1ACMB 3W2FA 3CCRB 3VMFA 2A0FB 1VGXA 1J5EF 5IT9U 4TU8A 2R7VA 1U2RA 2E9RX 4ITSA 3QSYB 1ZYRA 2WBMA 3BBCA 3NWRA 1HBMA 3B4MA 4AYBD 1WDTA 2QA4G 1I3QC 1JB9A 1K83C 4LF2A 4TY8B 3W62A 4U67Q 3VAIA 3MR5A 5KT7A 2K3KA 4C0SA 1PAUB 2ZC4A 2P6SA 4B3TF 2DIUA 3PX4A 3T56B 3G96A 2MSTA 3JQQA 2VJUA 3OEPA 5IYDK 4ZVGA 3H3VD 1ROFA 2CQBA 2OSRA 1Q86T 4PPDA 1WC0A 1BQMB 1R6YA 4WILA 2JVOA 1SJ3P 2EBGA 2HQCA 4LF1A 3WYAA 3PW4A 5J1EA 3BBFA 3H0GC 2V2KA 1UEKA 1FERA 1VBYA 4RD2A 1R0CB 4LBIA 4P2NA 5FDLA 2I8EA 2W7OA 1U49A 3FKIC 2E66A 2DGTA 5D0RA 4CM2A 2EFPA 4HT5A 3N3YA 3OZWA 4C0OC 2MHNA 3OBIA 1RWNB 2XI2A 1RKJA 3DXJA 3D3CJ 2RDJA 2LEBA 2B8QA 1HMVB 3P4UB 4L72B 5DDOC 4X62J 4A3LK 2JA5C 5A6PA 2HDNB 3KUEA 3IWXA 3H98A 3CMAB 4OQJA 2RQMA 1YQHA 4XM3A 3FFIA 1XMBA 1BS2A 2MZ1A 3H94A 4A8WA 2YY3A 5CCLA 3IAM9 2GQ2A 4I64A 2ZL5A 4C0HA 2KT3A 2R7OA 1RTIA 5KFVA 2H1YA 1VQLB 1LK5A 5KW9A 4UQGA 2X6WA 1YJRA 2N7CA 3GTGA 4W98A 4FK8A 2V69A 4F02A 1T95A 1RQPA 1RE1B 1I8DA 1TWCK 2BZ2A 1GEHA 2HURA 3R7NB 2R7WA 4GFQA 2KHDA 4N76A 4HT7A 3MEEA 2YKPA 1VHOA 2RHQB 4JUZA 1NK7A 3R97A 2V4QA 2IM0A 2BJ9A 2JH3A 2LDIA 3P45B 2I1LA 4DR2J 4F4KA 3AOCA 2CPIA 3AT1B 2AYBA 4UOGA 2PA3A 1INNA 3TAPA 1VLOA 2VDIA 2RB7A 3MD3A 4C8OA 4YXWA 1C2PA 4MAKA 1C4AA 2XZOA 1HQEA 2GHPA 3PO3K 2BN4A 3HOZC 3G82A 4I2QB 2F7VA 4KKSA 2WYRA 3IA0A 3WIUA 3P5BP 3W5YA 2LXFA 1N8RT 3E01A 2JN9A 1CEZA 3HI9A 4RMFA 1JLGB 1WEZA 1F5AA 1JNYA 5H1SV 3MR3A 2VG6B 2C2RA 3TYTA 3EGZA 4HI2A 2HK3A 1BQNA 2JEFA 2X51A 1DJ0A 4QOTA 2ZM6J 3QT6A 4AXIA 1KDNA 4OIPA 4RJLA 4GZYA 3TI0A 1VC0A 2GREA 3J81Y 4GC7A 1PSDA 3V6DA 1S1WA 2OKQA 4X4NA 1UA1A 4BCAA 3CGIA 1VF7A 3EVOA 2ZH9A 3VR6A 5BYSA 4RW9A 4B9LA 2OBSA 1SXLA 4W90B 4X66J 1ELOA 5CJ9A 1H8EA 2ASYA 2A10A 1EKRA 4ED2A 3GTGC 1K73T 2OH2A 4TMXA 4ES1A 1MABA 2YKNB 5K20B 2NZ4A 1B70B 2DNNA 4WK3A 1RQ0A 2EI5A 5D4NA 2W6IA 1TL3A 4KV8A 4O3PA 1FNXH 1RHQB 2FDNA 2BKNA 3WBKA 4LSZB 4RW4A 4DBQA 1N33F 3DFEA 2B6AB 1D3WA 3GTJK 3KOAA 3BS9A 2AGOA 4X64J 1HQ2A 1J5OA 1TKTB 4I2QA 3H59A 2R8IA 2ZOFA 2D69A 2K3IA 4NLWA 2D9PA 4Q4ZA 4JI4F 2P9EA 2B63K 5F8NA 1JQGA 4RNOA 4DL5A 4HHJA 1V5IB 2DNMA 1SL0A 1CJVB 3PYFA 4DWIA 3W2HA 2ZNZA 3RRKA 2YNHB 4ZLJA 3G05A 3MEEB 4BY7K 1TWAA 1FRJA 1TWAC 1N5SA 2XNQA 4ZGQB 3G82B 3R7SB 2BVZA 4LFCF 3F56A 5F41A 4ZVPB 4DSEA 3M8PB 3HMJG 1XMOF 4A3EK 3NAIA 4D3HA 3MPWA 3CCSB 1U1PA 3AVXA 3CC4B 1U8WA 4FN5A 4KSEB 2M0GB 4DG1A 2CF4A 3IRXB 2SXLA 3CD0A 3FFIB 2YNFA 3FCHA 2GW8A 3ITHB 4UOHA 1LW0B 2PFDA 2J5AA 1DURA 3LGNA 2LFVA 3KWMA 1UW4A 3HJVA 1YBTA 2L9DA 3MM7A 3H2LA 3EPGA 2QV6A 1MN7A 3M8PA 1REGX 2QT7A 3CTRA 4BHQA 3SDEB 4Y34A 4GTDA 3ENAA 4MK8A 4Z4UA 3EZUA 3HOWK 4ZS6A 1HA1A 1UD4A 2W9CB 3CC2S 1S1UA 2CQDA 5J2QA 1CJVA 1O2AA 3ZPNA 1NO8A 4Q2LA 4A3MC 4R0EA 1ZTTA 4J37A 4Z4ZA 3J7YI 1ZPVA 3EPIA 3WHIA 5DG7A 5CAAA 4NASA 4IRKA 4ZK7M 2KVOA 4OLPA 4IQMA 4IFVB 2ROPA 2ZXIA 2F9JA 1Q81D 1SVDA 1RWXB 4II3A 2CJYB 2F8EX 1SKRA 5IYNA 4ALZA 2R3VA 3C19A 3R2DJ 3GZ7A 2CKWA 1FDRA 3CSKA 3Q8VA 4LSNB 5KG4A 3GTOK 2E2IA 4TU7A 2KFYA 3HLUA 3BKTA 5A0YB 4RJVA 2IDLA 3M2RA 4TY8A 4PGOA 3QO9B 3ONUA 5IP9K 3LNNA 5BYRA 1YDLA 5LJ3Y 1HHQA 4X4SA 1N54B 4PXDA 1UEVA 3W64A 2BABA 4G6IA 2DGSA 3BCDA 3PG9A 4MQ9A 2D7SA 4DCPB 3WY9A 3GFXA 5GAGU 1V3ZA 1DTTB 3GCWP 1SL1A 3V6DB 4Q44A 5KAKA 2ZBUA 4P10A 4Y7NK 1WF2A 2XLKA 3QJPA 4C3JC 3GWCA 4UZBA 1RBOB 5F8JA 1I5OB 1H2UX 2LEPA 1HYSB 1Y0RA 1QUFA 2GC8A 3NOCA 5L1KA 2BR0A 3IGNA 3HVRA 4RNMA 1UD5A 1RU2A 2HGLA 5L9XA 5LSLA 1FCAA 3OPOA 1IKYA 4KJIA 4CRJA 3JQJA 4Z4SA 1T9TA 5DLFA 1WEXA 2F8HA 4P3YA 4XLNA 4Y00A 3S17K 2DYAA 2JOQA 3UN3A 4C8ZA 4G1VA 3RTVA 3POTB 1WCMA 1I18A 1Q8LA 2HNZB 1VBXA 1WI6A 2RS8A 4K7QA 1G6BA 1S1TB 3IM8A 3Q22A 2V4RA 1OSDA 4CM0A 8AT1B 1OWXA 2HNYA 3HFVA 4M5KA 1H8HA 1RT1B 1FJEB 2LECA 2FX3A 3T1YJ 2GGPA 1YITB 4ECYA 3TFIA 1VBZA 3BP3A 2L9WA 1C0UB 1Q95G 1IVZA 4A3BC 1U8SA 2FYXA 1FESA 1RBLA 1VJWA 2KI2A 1T3NA 4UZFA 4DQLA 2PIAA 1MMLA 3N6NA 2FD2A 4J9KA 3AODA 1K0VA 3DLKA 1SKSA 1W35A 3D0IE 4JI3J 5DLGA 4G1QA 4ZPVR 2UVUA 4KY3A 3IMQJ 2CZ9A 3E3XA 4KAIA 1TL1B 4USHA 2CJKA 3P6YC 3UCGA 1X4AA 2EIXA 4O23A 2KRRA 4BBSK 3TFJA 4Y2IA 5A8WA 3C8YA 2JWNA 1WELA 2Z2YB 2O66A 1TLLA 5LSRA 2VQFJ 1ZQ1C 3SJZA 2Q43A 2OK8A 1NHVA 4A3MK 3IR6B 4OZ0A 4TNOA 2YXLA 3NOGA 5BXIA 3S1MK 2EW9A 4ZHRB 5KFEA 5TRDA 3BPSP 2GS8A 5JVOA 2BE5A 1FXLA 1M1HA 2LP4A 1WQGA 2CNDA 2H48B 1FT8A 3MEGA 3VGSA 1D0EA 3GDZA 2PSZA 3CCUB 3RBEA 3Q3QA 5BSXA 1NUEA 2VOPA 3NKYA 2JJ4D 4XNFA 1Q9SA 1FVSA 3A4TA 5GAHU 3M1VB 3PX0A 3NCRA 4R8UB 4ED3A 1I6VA 1QDUB 5TV2A 5G0RB 2R8GA 1NK8A 2QZ8A 3MR6A 4P6YA 4DK1A 1AXQA 4LSLA 1VQOS 2UVWA 1WG1A 1FDDA 5GADI 4PR6A 1BWEA 2J7WA 3IRWP 3WC2A 3QSYA 5HKKA 1H74A 3WXMA 4GTFA 1OGJA 3QFCA 3FQKA 3A3NB 1QE1B 3L3CA 2HVIA 4PXEA 3FRZA 4XLPA 5FJ8K 3GFZA 1K0TA 4MK7A 1NB2A 3PUNA 4Q5SA 3O2IA 3SZZA 1EHWA 2GFFA 3C66A 2DGWA 5HO4A 3CT9A 3AB4B 4WFXA 3VVUA 1YNJA 4JI8F 4I4BA 4DPUA 3B78A 2CJQA 1TVRA 3TZZA 2VF3A 3L7PA 3RUBL 2NSCA 4DV2F 2CNOB 4FYVB 3TTGA 2DT9A 1G3OA 1SMYA 4DQRA 2Y3YA 3I55B 3NY0A 3UCUP 3SEJA 2ZOGA 4IYQA 3W1YC 4IG3A 2VU5A 3S15K 3BR8A 3IS9B 3OKXA 1SQEA 1X4HA 1SQGA 4DV0F 1XNRF 1EFUA 2D74A 3FSIA 4DR4J 5I4MA 1RTHA 2V67A 3I6PA 4ZVTB 4NMXA 2NREA 1VQ5B 1S4FA 1FRLA 1RQRA 4LT6A 3D4JA 2R7ZC 1AW0A 4X65J 5IYCC 5DQIA 2ACMA 1JK9B 4USUA 1ULRA 3DRRA 2PGCA 4LFAF 3I5BA 1P1LA 4C2MA 3CIZA 4M5DB 3SFGA 1EB0A 3DOMB 1K9MT 1RUSA 3QFTA 2IPOB 2E7VA 4X65F 3TUZC 4PWDA 2MQNA 4Y0FA 2HAIA 3VZHA 4QYZK 3G4CA 3DDKA 4R5PB 1Q82T 4RPBA 5ETMA 3JAMU 4YUDA 1T8EA 5F0WA 3GEIA 3MAQA 2R92K 3Q8PB 2QYCA 2PO4A 2C2ZB 4OX9J 4ED5A 2BE2B 2FLNA 4QWEA 2XHWA 4HIZA 2E9TA 5FJ4A 2FJXA 4DL6A 3D68A 3TQEA 1KK0A 3OW2B 4USKA 1MWQA 1U47A 1G7CA 4KPYA 1NDPA 4PWDB 2YWWA 1RAJA 3DM2B 2XZLA 5IQ6A 1R31A 3MDFA 4AL7A 1P9QC 4K4YA 2FQQB 1LXJA 2RF2A 2X8KA 2QTWA 3CDBA 5GV8A 4ZCKA 3TUPA 3R1LA 4IRCA 3KLIB 2AD9A 2VBUA 3W61A 2DHGA 2ZDPA 2HHQA 2QE5A 2IHR1 3LP2B 2NV4A 4NCGB 4NOIA 2BW7A 2GK7A 1CJUA 2IVYA 4DV1F 2HWIA 4U6PA 4N5SA 1ZZFA 1I6HK 3T02A 3LA0A 3RR7A 3GLJA 3I4NC 1G2EA 5DG8A 4LR8A 2OTLS 3OVAA 4OI2A 1EFCA 4Q0BB 1N52B 3KMQA 4OX8A 3KHHA 4P2XA 4M8LA 2EK6A 4M5HA 3VNVA 2XCAA 3PJXA 1AFIA 2NVTK 5CHCB 3OAAA 4KMDA 4DX5A 2GVDB 3NBPA 3MCSA 4QR0A 5CYJA 4LF6J 3OJSA 4F26A 3L09A 4ELTA 3D54A 1NK4A 2ZD1B 2EWHA 4NLGA 4XK8C 4A3CK 1EFTA 4DR2F 2GJIA 3M2UA 4Q0BA 4U96A 4LVNP 4G1IA 4DUYJ 5EX3A 3AJ1A 3RJMB 4LF6F 5A8RB 5E68A 2PHCB 4Y7CA 1RTDA 2V7XA 1E6YA 4B4DA 2DNOA 4RNFA 3WC0A 1F3FA 4CTAB 2XS7A 4Z4TA 2MKCA 1MU2B 5KTQA 1EI6A 1DDIA 2LEAA 1D8TA 4AT1B 3VAHA 1VQ4S 2W2OP 2AEFA 1DLOB 1H3DA 1KRPA 4ANCA 5JBQA 2WW8A 5FA6A 4K59A 4A3EC 1UEUA 2KN4A 5HMXA 2B5JA 1Y7PA 1TU0B 2OPSB 3NWGA 4I7FB 1F6TA 1DY3A 4MEYA 3GTQA 1RLCL 3H8YA 3N4WA 2PMHA 3QAUA 1PJ5A 3FPKA 1WKKA 4GTLA 1VQNB 2XLIA 2OHDA 1ZXOA 3LP2A 3SCKE 3VTIA 1RA6A 3EVWA 2Z4PA 3CB4A 5F0UA 1Y3KA 1IQZA 3GIMA 3MM6A 3MPUB 1XPPA 2KYXA 3GTQC 2C3YA 1ZYQA 3PJ9A 3UN2A 3D9BA 5D3GA 4ZLPA 3W2WB 4OJ1A 3E20A 1NEEA 2MQ8A 4KKTA 1TWGK 2M88A 4YDDB 4F0HA 5DETA 1NSKL 1QX4A 4V19J 4J9UE 3QMQA 4USVA 4M5DA 1FKOB 2Q79A 3P96A 1S0UA 3F41A 1T05A 4J9LA 1WP6A 3AGPA 3MR7A 1TK0A 4XR6A 2G1HA 5IP7C 1W34A 4DLEA 4M53A 3J7Z5 4U7CA 2B0GA 2DOGA 2JJ1A 2O5IA 3NGRA 3C6UA 4OZLA 4Z1MA 1BMQB 1RT2A 2EFQA 3VAGA 1NPRA 4Y52C 2Z58B 4K4SA 3GV5B 1H2VZ 4XSZA 1O25A 5IC4B 2BJ8A 1BJKA 1F0XA 4CNZA 1P4MA 1RHMB 4YEAA 5DJBA 2XY6A 4H4MA 4PG4A 1J9ZA 1S1TA 2D3O1 4MIBA 1RI7A 2RDDA 3ZZTA 2HS4A 4DPTA 4JV0A 5K8OA 1NH8A 2AMCB 2H3EB 2BUNA 2F8MA 3D6FB 2KH9A 4F7VA 4OJ3A 3HPOA 4IR9A 2BQ3A 4ZPAA 3N0CA 4ED6A 4CO3A 3EJMA 3IO1A 4FVMA 4AE5A 3PIOQ 2H65B 1IKYB 2MDAA 1YHQB 2L9NA 3NMRA 4II2A 1BY9A 4DL4A 1UJ4A 2HCJB 5THXA 1QE1A 4YEJA 4DPOA 2MYFA 1KRHA 4LOWA 4DQKA 3MF5A 1EETB 5ETLA 3TJ8A 4CI0B 4KARA 2QN6B 2OPQA 4KPCA 1Q1KA 4ZIVA 5L46A 3S15C 2CNKB 2XS5A 4YR0A 3I87A 1YJNB 3P27A 4CLTA 2DNRA 1ZH5A 1IN0A 1K8AT 2LA6A 2LXUA 1PAEX 3CCZA 1GX6A 3AVUA 1AUSL 4CIOA 1OQ6A 5IYCK 1QH0A 2E44A 4YB1P 1FEEA 3THTA 4DX6A 2CXEA 1IBAA 3H9NA 4B44A 1UVNA 4ED1A 4NLTA 1HLWA 5HBMB 1FA0A 1Z2LA 4ZPWR 3M1VA 4G6VB 3CPXA 1VFJA 3S8SA 3S16K 4NWBA 3KG0A 1N07A 3THVA 4YALA 4M2LA 4HR2A 4FYWB 4OOVA 3CC2B 2WBRA 5JXSA 3ZC4A 1UD3A 2DCUB 4P2SA 4NCAA 4NRUA 4NOHA 1E1QA 4JI6F 5C2GA 3BF4A 3OL8A 4CO1A 2D3ZA 4ZHRA 1ZAVA 3MCOA 2Q6LA 4BPRA 4KN4A 1Y10A 3HZGA 3BGRB 2ZE2B 1XE1A 3CNQP 2OD4A 4LFCJ 5IORA 3S14C 1GE9A 3CJ0A 1QAIA 3LAMA 1KTVA 2O5JA 1YJ9S 2ZZNA 5KFFA 4ZCMA 5BR8J 4G7XA 9ATCB 3JQRA 1F9HA 1SH3A 4LF8F 2ATCB 3BDPA 2XO6A 4CLFA 5D4LA 4WFYA 3SCLE 3F44A 2M5YA 3ITHA 1FK9A 1RT2B 4ELUA 2WSFC 3SQOP 4OHZA 1Q78A 1N34J 2WVFA 5DS0A 3NNHA 3JSRA 3Q8UA 1KC8D 3MUVP 3BSOA 3MCNA 4GT9A 2VA3A 3OR2B 1XQBA 4XTTA 1S6OA 4ERDA 2HNZA 5D6GA 2CG4A 2E2IC 4USWA 1LQ9A 3AA9A 5F8LA 2N7YA 2DNGA 2WK4A 4DSJA 4KBIA 2A6HA 3AJDA 3B8HA 3SSSA 8ATCB 4JV5J 3M8WA 3E51A 4ICLA 1M1KD 1COWA 3B82A 3VALA 1HWLA 1XXCA 3UVJA 3ZFVA 1S4EA 2OO4A 4DF4A 5IK2A 1UW9A 3KUGA 2F43A 2NXEA 3DXBA 3MM6B 3K58A 4G7ZA 3EDRB 1SQFA 4O44A 1RGVA 3BCFA 3OJXA 3KLFB 5MLCV 2KYZA 5GMDA 3PFOA 2VBTA 3H40A 4P7VA 4TKTA 4K4WA 4JP8A 4IQXA 3RB4A 2MEWA 1TVCA 3OXGA 4PC3A 1KVKA 2GQFA 4XSXA 2Y1JA 3O8WA 2CAJA 1SKQA 5D77A 3DGPB 1VQ5S 5A88A 4RBUA 4A48A 1DLOA 2YKOA 3FZ2A 2JLFA 3QO9A 3LQ6A 4DR7F 1RDRA 2FPHX 1TFYA 4U7UK 1MROA 3LGMA 1S79A 3CO9A 2BDPA 5J2PA 2VQFF 2QL5B 1NDHA 2HS0A 4PUOB 2J9CA 2AHOA 1JXEA 4YY3J 1G7TA 1Y0HA 2MZJA 2E29A 1HBNB 4EGLA 1OY8A 4WWVA 4LBZA 2MMYA 3L95X 4BDPA 1FDBA 1IR1A 4BXXK 1T11A 3OTDA 1DHMA 2VFSA 1RHRB 2J6SA 1NPPA 3KKFA 5H9FJ 3Q39A 5IWAF 4E0DA 2HWTA 1ZS6A 3GTPK 3UD3P 4DS4A 5HP1A 2AZ1A 2WJVA 4PQAA 5J2NB 2Q3PA 1S49A 4J0QA 3GE9A 3LWLA 4JI3F 2AKWB 3ZBTA 1AROP 2R7QA 1X5TA 5C42A 1DRZA 4BC9A 3DLGB 1H85A 4X4QA 1FD8A 5C4JC 3ISZA 1TL7A 3OFNA 4FBUA 2H9ZA 1O26A 1P9YA 3KJVB 1TWFK 2XNJA 1XR7A 2YX4A 2CPDA 2BANB 2XEXA 2LKZA 3D1HA 3GPAA 5D8HB 5J2QB 4ECVA 1LW0A 3CEDA 3RG6A 5KFGA 3E2EA 1S0OA 1VCTA 4ZOSA 4B3RJ 1JJHA 3FEZA 2D3LA 1N8RD 2F63A 2E1RA 1H7WA 1FTRA 5ETTA 3D1QA 4OYWA 4RBTA 3MM7B 1N06A 2RF2B 3Q6QA 3I9V9 2MY7A 4B17A 1R43A 1T7PA 2QEXS 3PEJA 3BUEA 5B09A 1DCOA 3W65A 3GU0A 4LBYA 3P26A 4ZDNA 1R9TC 4QFMA 1ZBTA 1JLFA 1N56A 2C2WA 1HWKA 2BKOA 1UVKA 3H20A 2V8GA 2H4WB 2ZBRA 2CQ3A 1YJVA 3CQZA 2Q6IA 3AHPA 2Y0SD 1KQFB 4DR4F 2OGUA 1Q7YD 3TJAA 1YI2B 1PBUA 1AT1B 3H0PA 4HVZA 1F7UA 2CDRB 4O3NA 2LU2A 1LWEA 2WCXA 1TELA 2MZTA 4B43A 3W63A 4CP5A 4X06A 4DR5J 2BSAA 2C4TA 5KOXA 2HBZB 5GAEU 4IRDA 4D3GA 3ZTPA 2K7JA 4Z37A 2RDIA 3VQTA 1UFKA 2H5IB 4OIOA 1H98A 1JJCB 3MZIA 3MCMA 4KGKA 4NLRA 2E5GA 1RK8A 2ZUGA 3FC9A 2CQ1A 4M63A 2PC6A 3VAFA 3GTLK 5C4XC 4DR5F 2CPZA 1VC6A 4KB2A 4LLGA 5KFXA 2B63C 4XLAA 2AYEA 2VA2A 4RW4B 4X4PA 4RW9B 1VRTB 4WP8A 3TR5A 2GK6A 2CPEA 1FX2A 4LFBF 4N41A 2OEKA 4E2FB 2YQ3A 1YKWA 5M3FK 1E43A 5J2PB 5ADZA 2YKNA 4Q8FA 3M3YK 2PA8L 2WR8A 1A6LA 1Q16B 6AT1B 3N5FA 5HZBA 3UCZP 5A8AA 3QIPA 1S7IA 1TL4A 3FZBA 1VI7A 2QE7A 4Z7YA 1CC8A 3AQOA 1E6VA 3HHDA 5IS2A 2R2SA 1NJID 1NXIA 1R5OA 1EWYA 1NKBA 2XNRA 3S1NK 4OZ2A 1EARA 4FKXA 2DR9A 3KNAA 4RUBA 4WTYA 4P22A 2CVIA 1QVGB 3GCXP 4MKBA 4QV2A 1HQEB 2Q6CA 1FJGF 5HI7A 2A6OA 1GK8A 1HBOB 1XBWA 3BSNA 4UQTA 4L8JA 3UVJB 2CC2A 1B4SA 1UJ6A 5G0RA 3ADAC 3R1HA 1EZZB 1JLGA 3ET6A 4DFKA 3DOKB 5DRKA 2LCWA 1QD1A 1QSSA 4K2JA 4DPXA 4IO9Q 1XFOA 2J7UA 5THWA 1FKAF 2F65A 3OLAA 1C1BA 2JLGA 1VBKA 1X0FA 2KZMA 3G4AA 3WIVA 2COLA 4GVLA 1VRUA 1XR6A 4JI4J 3N5BA 1YCLA 2CQ4A 5B0AA 1H6KX 4KR0B 3M4OC 5I42B 4DV3J 2R6HA 3TRGA 4XOPA 2VFUA 1UETA 4P75A 2XMJA 1Y1WA 5E0OA 1KQSR 3LUYA 1SI9A 1N08A 2J9DA 2RQ4A 2DR8A 7FDRA 5J2MB 5L38A 1WHXA 1UMJA 4QIEA 3HT3A 1GH8A 4RR5A 2JDJA 3NCPA 1BGXT 1PKUA 2MZSA 1QGYA 1ZPWX 5IP7K 3MWBA 4ETZA 2JFKA 3BGOP 5HVFA 4F3QA 3SZYA 3M8SA 2ZITA 3HSJA 4YB6A 4A8OA 4KMHA 2CZVC 2BQRA 2B8PA 1TWGC 4HH1A 4N8NA 2QLFB 4CT9A 3DLBA 4P2FA 2HRYA 4DV7F 4LF9F 2NVYA 2J0XA 1RCXB 3PXGa 2R7XA 1HARA 5HVHA 1RT6A 1H38A 3ZTOA 1FRHA 2HFZA 1NLKL 1PCAA 4P2MA 2OEJA 3T01A 3ZBUA 3HT0A 4FDFA 1G1XA 2A2CA 4RD3A 2YPYA 3OJUA 3HOXC 2HNDA 1UPPA 4I2PA 1YITS 4I67A 2DD8S 1SFOK 3VO2A 1F7VA 4A3GK 2CG8A 2YPZA 5M2RA 4YR3A 2KG1A 3POTA 4DNTB 4WZMA 1VQKB 2NVYC 1NKCA 1TKZA 2ZJQQ 4AF6A 4CH1A 2HBYB 2J0SD 2HFOA 3PW5A 2RNEA 2FVSA 1HW8A 3UD4P 2HMIB 1Y0YA 1L3KA 4F3MA 5IYDC 4A8SA 4LBHA 2AU0A 5H5JA 3CCLB 2QMUA 4OPSA 3OPFA 2Y8YA 4KATA 1IKWA 4A3JC 2EPIA 5D4DA 1P1TA 2DNKA 4IW3B 1U1RA 3FKIK 4WFZA 3GTLC 1M90D 3VCDA 4DR6F 3R6JA 1NJZA 3MMLB 3SLDA 3RBXA 2M4MA 3OTOF 3EZOA 2VBVA 4ILLA 2VODA 1RWOB 1N0VC 3H0GK 2DVIA 4KM8A 4NBSA 3BBBA 1KKHA 2XHCA 1CULB 1C0AA 1E64A 2UXBF 3KDOA 2G2YA 5HJYA 3GONA 3KEWA 2NVTC 3CJ8A 3Q2TC 1CJKB 1REVA 1RT5B 5DM6Q 2EEYA 4DF8A 1GMUA 3ZZUA 1FKPA 4ZVHA 1OHHA 1RT3B 5E2QA 4NRTA 1SC6A 4IO1A 1RHJB 1SJ1A 2VFRA 3HOYK 2RRNA 4IFVA 2GSUA 2V63A 1KTQA 4X62F 3TWZA 2IAJA 2ZBQA 2VFVA 3TW0A 5HK4A 1WOOA 3KHGA 4DFPA 5E33A 1GMWA 4WPAA 3KK3B 1YJ9B 2OYNA 2FQOA 4X7EA 2J0WA 3GTMK 1T6YA 3PYGA 3H4BA 4P6VF 1WKLA 4OPVA 5KFJA 2W9CA 1AYEA 3VWSA 2C78A 1NHKL 2YNGA 3T1YF 3VVTA 4NEZA 2C4UA 1FRKA 3UWTA 1A0OB 4DCJB 5J2MA 3DMJB 2V0NA 1KEKA 5I3PA 3GTPC 4PG5A 2VNKA 3SDEA 3FBCA 1N5QA 2DR6A 1DQ9A 3K89A 5F4OA 5AE2A 3K59A 3T5JA 2EFVA 1PC4A 5JFEA 5B0GA 2CRVA 1F60A 1WD6A 1BMFA 2QL9B 1QAXA 2XYPB 1TWHK 3R6KA 1O29A 3R5BA 4M0LA 3QSIA 5GVQA 4G3IA 3QE2A 3HULA 2DY1A 1YBAA 5CYMB 1NK6A 2BRLA 1PKVA 2RKIA 2PA8D 4JI7J 2RS2A 1F9FA 1YLOA 4QUZA 3T6JA 2ZZGA 1FVQA 3FEYB 3QIDA 1KP6A 5A89A 3L7UA 2BF4A 5JMNA 3J81U 3CCEB 4I6WA 4DR3J 4CO4A 3R5AA 2QFJA 5CCMA 3ASTA 1RU1A 4JI0F 1SBRA 2CK3A 1E3ZA 4JYAJ 1BJTA 2R7ZK 3Q2SC 2KFZA 1RTZA 2YQ0A 2VJJA 1PYSB 3S0XA 3LO3A 1FNOA 1GX5A 1YWXA 2PMZD 3GMGA 1E6YB 2V94A 1S0NA 4DDQA 4FNHA 5A8RA 1R89A 1TK8A 4QWBA 1IJFA 2FTRA 3WX8A 2D3UA 3GIRA 1UWBB 4XLCA 4X6AC 4C2MK 3X3UA 1UD2A 3J7AN 3ASRA 5FLMC 2IA0A 3RGIA 5IOSA 5HZAA 3A8JA 2XQCA 4KKUA 5IYPA 5JVHQ 1Y1WC 2ZL6A 5E41A 4ETXA 1I94J 4PYDA 3G6ES 4K4UA 4P72A 1RB0A 5J35A 4F4YA 3WODA 3GTOC 5EN1A 4OOSA 1XZPB 3CMMA 2DCLA 2IJNA 4L76A 2FZCB 3GTKC 2CPHA 1SV5A 3PRBA 5EWEA 1S72B 3KMSA 1WOPA 4WIQA 2HMAA 2JA7C 4ZVEA 2IC3B 3P3DA 2DJWA 2WW4A 2DNLA 3DNCA 4X0CA 2ZBPA 2EG2A 4C3IK 1TKXA 1JQWA 4XPCA 3EUNA 5D4PA 3IBCB 3ENQA 3M8QB 3H0GA 2CQ0A 2MSSA 4F50A 3CW2A 5KOWA 1LFWA 1UV7A 4TU9A 4QPXA 1EAYC 2OMOA 2FQTA 5DZ7A 3T1HF 3GV7B 3VF0B 2P3MA 3RYLA 4FZVA 4KM9A 3DGPA 3VA7A 3HOWC 2NVXA 2MLYA 4OI6A 2C77A 3QGGA 4QW9A 2PE3A 2HZCA 1KK3A 3G2XA 2F4FA 1KZLA 2HIQA 5EGHA 4ECSA 3RW7A 1IUJA 1U1KA 3W5HA 3GTJA 2EKNA 5K8NA 2C3PA 3O5TB 2VBWA 1R0AB 1UA0A 3CWJA 1JJ4A 3NGTA 2QMXA 1U0HB 2FGCA 2WSEC 3OR2A 4RX6A 3GTMA 2UXCJ 3ZZRA 1NJIT 3K5OA 2CYYA 2CPYA 5AN9A 3LAPA 1VISA 3IPJA 1SJFA 3D0HE 4O3QA 1N32J 1T9YA 1R8BA 4Z4RA 2ZH7A 4PAAA 2IA6A 2VPXB 3S14K 3DOMA 1RHKB 3LTOA 3HDSA 2OELA 3SQGA 2ZH3A 1NPKA 3I0RB 4FKYA 3D66A 3DRRB 3NGUA 3QRPA 4DFMA 3PM9A 3K5PA 1HNXJ 2RSQA 4P74A 1ZA1B 3GTKK 2L3MA 1JWWA 4A3FK 1UZHA 3N9UC 3TVYA 1JLCB 3ZTSA 5TMFA 3Q8SB 1YGYA 4XONA 1S1XA 3VZIA 2BEFA 2IRYA 2BANA 3PHTA 4JB8B 5IM0A 4W92B 3G9CA 2DTJA 4ECRA 2Y1IA 3HOUC 4N77A 1IBKF 1HW9A 2B4VA 5K14A 4DDFA 3HO1A 3FDSA 1Y5IB 4DSKA 1B4AA 4A3IK 4WP3A 1HI9A 2F4NA 1LV5A 2VG5A 1KMHA 5EDWA 2R7ZA 4XDCA 3H5SA 1FDAA 4P52A 1RYRA 1YJ7A 4LC0A 3AFGA 2W24A 3MMAA 4KYZA 3P49B 3BH7B 5KFQA 2WVBA 2DNHA 1JXLA 2HFUA 3U1NA 5DM7Q 1N48A 1N5TA 2ZJRQ 2FC8A 2QA4B 4MKYA 3HF5A 3C16B 1K47A 2OBTA 3DU5A 1K44A 4Y3CA 1GAWA 2W2MP 1CG2A 1QUVA 1SH2A 1S6UA 1O28A 4NYOA 4ZP8A 3TO8A 2I2YA 1L3UA 1VYAA 3JTNA 2ZH8A 5CYQA 2DHAA 3QWUA 1SUQB 2KFNA 3D26A 4OYIA 2W7VA 2IM1A 1BQXA 3PVXA 4F4ZA 3BEGB 3JSMB 1IL2A 1YX2A 1E63A 1WTBA 4CH7A 2R9VA 2YNIA 5LMNJ 4OI4A 2R2UA 2BGIA 3ILIA 4OZ3A 1BUXA 2NVXK 2BVNA 2YWFA 2VC0A 4XORA 5E5NA 3G71B 2OAUA 3DLJA 5D0HA 4PEOA 4ZN1A 3KG4A 5KFUA 4A3KC 3ASPA 2BJEA 2XSJA 3GTMC 1B2RA 3FQLA 5IT9Y 4J9RA 2ZVIA 1XWLA 2HKEA 4WU3A 1KD1T 5E3PA 2V8VA 7FD1A 5DDPC 3AOAA 5KFMA 2BM1A 3KLGB 1WDDA 1TP7A 1TV6A 3PA2A 2XG8A 2XWXA 3IM9A 2ZBCA 4IOCQ 5C24B 1FRMA 3CD5A 4RLZA 4L6V3 4CO0A 3PRVA 2WZPP 3A8EA 4XL9A 1WACA 4RD4A 1M90T 1JKHB 2M8DB 1YJWS 2JA5K 2B7BB 5HSPA 1V3RA 2I5JB 3J7A1 1OB0A 1DARA 4I6AA 1FFGB 3GTQK 2ZHOA 3TEHB 1RXOB 3K7RA 1NBMA 3S01A 2E7WA 3VR1A 3EGWB 5D15A 1PC5A 2OLWA 4O3RA 2Q6KA 2CW5A 1EQMA 3B4DA 5TJ3A 4ZV4A 2HNYB 3IG1B 3KJNB 2KRBA 1GMWD 3UR3C 2RIJA 2ZBVA 2B7CB 4X7CA 4KKOB 5JJBA 1EQRA 4TQRA 2Y3PA 3M05A 4USJC 4NA2A 1HR0F 4HI1A 1X4DA 3FEXB 3PW2A 4CLYA 3OL7A 2XMKA 2NVQC 2XSJB 5A8KA 2R8JA 3GV8B 2WZ1A 2DCUA 2ZM6F 2JEIA 3WNDA 2NXJA 2B5JB 4XCHA 2B4UA 4JI2F 4B9UA 4WQMA 3GEEA 4QIGA 4OZNA 3GVLA 3OR1B 2ZH5A 4GTBA 3JSMA 3BNWA 4ZPBA 4WFAQ 4YMEA 2AEJA 2R92A 4CCHA 1R9TK 4QR1A 4J9PA 1JVIA 4OX7A 5I3UB 1KLMB 3M8RA 2J9EA 5DQGA 2EG1A 1U2FA 2OJ3A 4NLVA 3V5RA 5IT0A 3OD2A 3LALA 5IZHA 2IMWP 1RTDB 3UNGC 3RZAA 4EU0A 3G6EB 2A2DA 2QLWA 1W2BB 4C3HC 3LPYA 1T6ZA 4GRSA 3B6BA 1RKIA 2JVRA 1WWHA 3T9ZA 4RDJA 4Z4WA 2UUCF 3M2UB 4JI5F 2VKZG 2K1RA 4A93C 2V2ZA 1TUGB 4DI6A 2VL1A 1XQIA 3NBPB 4XMYA 1WNEA 4PC1A 1I6HC 2Y0SL 1BPLA 4DQSA 3LWMA 1I3OB 1X5PA 4LJZA 5DS7A 4RW7B 4FXUA 2CRLA 2DRDA 4KGXB 4TSFA 2V4JA 5C4JK 2IDEA 3JYTB 1EP1B 2QDXA 3LP1A 5J3OA 4A8MP 3MMJA 4DSFA 3HVAA 5HVGA 1TR0A 3LPEA 3OLBA 2HQ3A 3M32A 3TZYA 3IFEA 3CCJB 1FRQA 4FP9A 4A3KK 4G1BA 3I31A 4OI3A 1KSPA 4NCGA 2E5IA 1RADB 3FSXA 3NG8A 4RW6B 2UXCF 4K50A 5K5MA 4KHRA 3UDVA 2FGOA 4L75A 4MK9A 2EC0A 3OQ2A 1M1KT 4FZBA 1OS5A 2V7TA 4IH6A 2WVDA 2RKIB 3BO3A 1NH7A 2P5MA 4B9MA 1S1XB 2LMIA 3HCXA 4ECXA 3GP9A 3NCQA 3C6UB 3O6QA 1M0SA 1RP5A 5B0FA 5E7OB 2P5VA 2YX1A 2UXDJ 4ZITA 3Q86A 4A4JA 3OFFA 2IBKA 3H42A 2ZH2A 1R6VA 4YAUA 1DAXA 2E2HK 3EVMA 5AE1A 1VIXA 1S9GA 2M2BA 3R7BB 1N34F 1QVFB 1BX0A 1FKOA 2XZDB 5HQMA 5CD4A 3D0GE 3CDEA 2DGUA 5GAHI 2JC0A 3O3LA 3D67A 5BR8F 2PMZL 2F5GA 2MKKA 4OOXA 3I4MK 1GAQA 3M4XA 5LOQA 2KXFA 4K8RA 4KB7A 2XULA 4C43A 2JA6C 4H4KA 5IC6B 3BN4A 5AT1B 1U1QA 2GJPA 5C44K 4NXNJ 4OV1A 1NB9A 1YRUA 2MQMA 2FY8A 3QFHA 4NLDA 1FNMA 4ZLNA 1VQMB 1RTHB 1RISA 2G0IA 1BLIA 2MKIA 3CJ3A 2RC5A 2QYGA 1NSAA 1ZAXA 2AP6A 5I3QA 4DV0J 3QZ7A 5JUMA 4WU2A 2B5OA 2K2PA 2DNZA 1Q8IA 4TYAA 2XZTB 1CBKA 1YIJB 1KN6A 2QLJB 3OFHA 2JLEA 4W4MA 1HKAA 2BMBA 2ZXHA 2LQ8A 4MYTA 5KG1A 2R8HA 3H25A 2FLOA 3X1LB 3Q8RB 2XCPA 4UUXA 4OIRA 1X9WA 3OVBA 2A3JA 4PPZA 3RBZA 5KFKA 1S4MA 3BR9A 4RLEA 2BMWA 2OIHA 1IJEB 1TTTA 3CJRA 4LBPA 4EBEA 2XYGB 1VQ4B 2GNKA 2XMTA 2Y0BB 4P1VA 2QMUB 1VK8A 2PFFB 1F5BA 2B9XA 1N5YB 4AUKA 4HACA 4AH6A 1XZPA 1HBUB 4WWSA 1QVGR 4CLZA 5KSWB 4FF3A 3QRRA 2DITA 4HLBA 2GHWA 1RAGB 4KHMA 5D78A 2ZHBA 3HHKA 2XZWA 1VHEA 1YRTA 1S6PB 4Z4VA 1T03B 4IFYB 1X0PA 3ZO7A 1C0TA 3AXMA 1DBDA 1WC6A 4UT4A 3BQ0A 1U25A 1FJCA 2W4PA 2M8HA 1IE0A 5IXUA 5ETVA 2BJ3A 2FHOB 3CCQS 3HOVK 1L3TA 2NYHA 1IJFB 4DEZA 1J6WA 4U7UD 4NCNA 2Z2LA 4KDDA 3A3PB 3OTCA 4YELA 2CJ9A 4YFUA 1ZBSA 3I5CA 5F8MA 4C11B 1Q7YT 3D6MB 4OV6A 4LF7F 2IMOA 1FI4A 3VGUA 2RD5C 5LMUJ 4DXLA 4G7WA 3Q8YA 4UY8T 3QJJA 4R8UA 1RT6B 2DO0A 2RQKA 3W9IA 2HZVA 3S6EA 4KHPJ 2KG0A 4OL8A 5IOTA 2XMUA 2QMWA 1A9NB 2KT2A 5MAOA 3OTBA 2RVJA 2NUUG 3NS5A 1S59A 3QLHA 3CC4S 1BHNA 4BWMA 3S1RK 3PHEA 4F67A 1S1VB 1R5NA 5DDQC 2OEMA 3ETOA 1FWLA 4LF4F 3K7AK 2VNIA 4B9NA 3S17C 5F4MA 3I4HX 4NLXA 4P7TA 1R0BG 2XC9A 4KRWA 4WF9Q 2FVGA 3HFZB 3PCOB 4C2MC 1TUVA 1NDLA 1VQSA 4B3SF 1V6HA 2DR5A 2YKMA 1B7FA 2C3OA 4NA3A 4R0JA 4JOUA 1H0HB 2DISA 3SBMA 2GCFA 1CS4B 1LW2A 4BXXC 2QA1A 2RUGA 4YFKA 4CWBA 5M5YK 2WONB 3IWNC 2W9BB 2JEGA 4ASUA 3IC1A 4C9DA 1M5SA 4P25A 1KD1D 1B64A 4MJKA 3RB3A 3DRSA 3PENA 3KK3A 5LL6d 2VFTA 4TQSA 3MM8A 4Y28C 5CHPA 3OEHA 3EXYA 1G7RA 2JZ5A 3C14B 3FRYA 1RAIB 1C0UA 5LXRA 2MLZA 1S6QA 2DIVA 2WHOA 3D3BJ 2GGPB 1KNZA 4F36A 3T51B 5FL7A 2HVHA 1GT8A 1DTQB 2V7WA 1JJ2R 4B3MJ 4RU9A 2A1BA 4LF5J 3F0NA 1UMKA 3EQLA 4EBDA 4LK0A 4ZMMA 3H3VL 1J98A 1LWCA 4MYUA 1WOSA 2VH7A 5B6IA 1T02A 2V4DA 1T94A 3E8OA 4JI5J 1ZM4A 1HI0P 4LRBA 3FK4A 4QYRA 2YX7A 2Q1LA 1LXNA 5A2QY 4URSA 3DHXA 3CCVS 2XZPA 1DTTA 4ZVSB 4GKKJ 4DMZA 4NCBA 1ZM9A 1VQ6B 3ASSA 4KFBA 1OYDA 4JI2J 3OXLA 1N05A 3KLHB 2MY8A 4YR2A 1SL2A 3VQSA 3AVTA 2DGQA 3JQKA 2KDOA 2KB2A 2FUG9 3AXKA 3M9MB 1OMSA 4I56A 2VBXA 3HFKA 4X7FA 1SUQA 4JYAF 1MN9A 4H4OB 2B3TB 2ILYA 2XCQA 1IWGA 1UVMA 3KFWX 4PCQA 2DBBA 2HHTA 1TKZB 3VAJA 2A68A 2LVWA 1AA1B 4X4UA 1HFEL 3ENWA 1OPIA 5K8PA 1VQOB 1ZM2A 4ZVOB 1WC3A 1U26A 1W2BR 1SB6A 2PI4A 1IW7A 1FHTA 1CQMA 2HZAA 3I5AA 5AXMA 1FJGJ 2UUBJ 2FJBB 1RLDA 2R2RA 3GTKA 2KXHA 3DRXA 2V50A 4LSNA 1I94F 2HQGA 4DV4F 1F20A 3ZNJ1 3LP0B 4NXMF 3PKYA 2IYIA 2Y1LB 2E1PA 1JNZB 3IR7B 3GTYX 3BYPA 2F1MA 1PYTA 1E1RA 4LREA 3PRDA 2V7QA 2R42A 1HNVA 2B4OA 2VJVA 1WHYA 2AJ2A 2DERA 1EK8A 4A3CC 1USOA 3NGDA 3PACA 3OW2R 2IFXA 4Q7JB 4QR2A 3FCVA 2LQBA 3FPPA 1QFZA 4JBCA 4N3GA 2VV5A 2VZ9A 3KUHA 1ZETA 2FJAB 1EIYB 1TWAK 2ZWPA 3W9HA 3JB9k 1VQNS 4WZQA 2G4BA 1U6ZA 2HLTA 3D6HB 3HD1A 3TP2A 1SFOC 1C1CA 1GFWB 2JIZA 4G7HA 1AIPA 1RT7A 5SZTA 3K0JA 1BD6A 4P5BA 4PABA 2IYGA 4FYDA 3CJ2A 3VAKA 2W9AA 2C28A 3N79A 2BOPA 1S97A 1OYEA 3S1QC 3CD7A 2QSWA 4LFAJ 3IRXA 2V2VA 7AT1B 3JTOA 2E2HC 2PEBA 4TLRA 1UPMB 4DR1F 2E2HA 3SZ2A 1FE4A 1C1BB 3DI6B 4C11A 1WUUA 3M4OK 3KJVA 2QLXA 1NB0A 1HBOA 3CCMS 5FLXU 4PC2A 1P6TA 1IKXB 1QGZA 4DL3A 4TMVA 1YJTA 2K7KA 1QSLA 4OYZA 4X64F 3AVWA 3CE8A 5LM7E 2ZUAA 2GIFA 3DOKA 2HQDA 2O3DA 1HQUA 3GTGK 3KJFB 1T03A 2JA8K 2OPRB 3PKMA 2RC6A 1AB8A 2B9YA 5J2NA 5HL8A 5HL7Q 1RZMA 2DRBA 5E3RA 5KFPA 2EC2A 4EYIB 3GTOA 1EP4A 2AZ3A 1AZSB 1YSJA 3EM1A 4Z4YA 4OHVA 4QIWD 2W6JA 1WKJA 2C2EA 3PO3C 4G65A 1HI8A 2YVSA 2E1BA 1CJTB 4C98A 2W8LA 1NU4A 4XN3A 1X60A 2DKOB 4NZ7A 3SLNA 1TKXB 5IYWA 2ZWOA 1E6VB 4RBVA 4AD6A 1TL3B 2YH0A 4DL0C 3HAGA 2C2OB 3DHWC 2FJWA 3CO0P 3SYZA 1S1WB 1GR1A 3CCQB 4NEYA 4USMA 2MQPA 4ZCLA 3M2RB 1XXAA 1HA3A 3A8IA 2V6UA 2MJUA 1NK5A 5M2PA 4AC9A 3HP6A 5ETQA 1AUDA 4C8YA 2OFGX 4RNHA 1WSRA 2JEJA 1WC4A 1BQNB 2R7TA 1YRXA 3PO2C 1X31C 4O4RA 1QM9A 5HMZA 1BX1A 4H54A 2Z2ZA 1BE4A 2W1BA 1IXKA 4A46A 2HVDA 1VRTA 1HQUB 4C3HK 1L0WA 4QCLA 2W2PP 3CW2C 2KVIA 3ZTQA 3TANA 3K57A 4RDKA 2XCRB 1OQ3A 4X2BA 3R27A 2C2MB 2POKA 1ZZNA 5IOQA 2RU3A 3WZ0A 4ILDA 2MZRA 4BS2A 3JU4A 4F4WA 2V6TA 1M5OC 3H4DA 1VMBA 2VG6A 3LAKA 2EKYA 2AX1A 2GSOA 2BW2A 2UZAA 3CJ4A 1ICEB 3PX6A 1S1UB 2CQ2A 1R8CA 3FSYA 4WXOA 5KFCA 1EJ7L 1FX0A 2BV3A 2C5HA 1LWEB 3TAMB 3D1OA 1N4LA 3EE3A 2OP5A 5BYQA 4DFJA 5HQLA 2WJYA 1SJQA 3FOEA 1WTHD 2HGNA 2NLWA 2AIRB 2H5JB 2OD6A 2O1PA 1E79A 2E1CA 1NJWA 4EYHB 1S9GB 2W7AA 3DI6A 1XERA 1B23P 4RWWA 1D9AA 4PZVA 3MHYA 3QJLA 1TKDA 2ZOMA 2HGMA 2BX6A 1B7YB 2VOOA 2DR7A 4NL5A 3K8VA 5IT4A 3JTPA 2WVEA 1IB0A 2FZKB 4OZ5A 5C2CA 2LQ9A 3THPA 1HMVA 3AVYA 4WP9A 4B3RF 2Q6BA 1FNDA 1KHVA 3MR2A 3HJFA 2R4FA 2QFIA 4I69A 2DEUA 3NXZA 5EWFA 2ZE2A 2JX2A 4Y2KA 4OJHA 1GXUA 1NMEB 4B3SJ 4QJVA 3D28A 1FNCA 4QPTA 2V8HA 3LP0A 2BACA 2D6FC 4YDXA 3Q6RA 1VJQA 3D6TB 1VQ8B 3M32B 4ZJLA 4K1XA 4F7DA 2QGGA 3KHLA 2VZLA 1JLAA 1XMQJ 3NGSA 2KM8C 4X05A 3TA2A 2P6TA 1KR4A 1QAYA 2JA7K 3IXQA 2LDYA 4EMDA 2OUGA 2GAHC 5A6WA 2JRSA 4K4TA 2UU9J 5AXLA 4YY3F 2QIFA 3PEHA 2I6WA 1SJ4P 5BSYA 4PUOA 2WB1D 5TMCA 1Z1ZA 2VUMC 5ETOA 4MTPA 4U9RA 5EWGA 2RJZA 1VQMS 1CULA 2IJFA 3ISNC 5HN0A 4XKWA 2BM0A 5IYBC 2FB0A 1E3XA 4CLSA 2QG9B 5F3TA 2HBRB 2HRTA 3J81j 3RRHA 4ECUA 2VC1A 4DUTA 1MWYA 4DK0A 3V2UC 4Q5VA 1KLMA 4DOZA 2FVCA 1JJ2B 2F40A 3OP1A 3ZZ0A 1NHUA 4M5IA 2HAFA 3MXHP 2E5HA 3NMAA 4M1KA 2CPJA 4F04B 2WOMB 4DV2J 3PYDA 3DXSX 3OR1A 3AB2B 1DQAA 4PC7A 2G2ZA 1EP3B 2GO9A 2HMIA 3I32A 2QC3A 2R93A 3UDCA 3OFEA 4OX6A 1W0KA 3T5HA 1B0VA 4CYUB 1MSWD 4X8IA 2OPRA 2ZZQA 4XLEA 2QTZA 2ALZA 3ZZPA 3G8SA 3SV4A 3E01B 2XBPA 5A8KB 1KWMA 3AY0A 1URRA 4QWCA 1JLEA 1WCMC 4J9VA 2L08A 3K7AC 1IKXA 4NX9A 2QA2A 3KLFA 1F1BB 4FPRA 2IY5B 4O44B 3EGNA 3M2VA 4OYAA 4RL1A 3CF5Q 1LWCB 2WSSA 3H2VE 3T1HJ 2X1BA 4QVJA 2GIRA 3M8ZA 4OZ1A 2VBSA 4Y7NC 1DQ8A 4LIWA 4U9UA 1NCLA 2CDQA 1OY9A 1EFRA 1ZAWA 1Y9OA 4U8YA 2XTJP 2XWYA 4YHBA 4EH1A 4FXDA 1DTQA 2KM8B 3FJOA 4A3IC 1FK9B 4LRCA 3SSQA 1L5UA 1ISEA 2DHSA 4IH7A 3DLLQ 1RJJA 4QHYA 2GV1A 3PUMA 4CQ1A 1VJEA 2PEHA 3CC7B 4HE6A 1RTIB 5KFAA 1JKHA 5IV4A 3MM8B 2R93C 1DFDA 3ZZYA 4R71A 4M5MA 2GVZA 3CCES 3BGRA 4C8KA 2IM3A 3SKBA 1HVXA 1XIQA 4ANEA 1Q86D 4G0WA 3GTLA 3HVTB 4J3NA 2Z56B 4HHUA 4IOBA 4YB5A 4OPOA 2FJDB 4K0KJ 1QGAA 1GVHA 3TOQA 1LW2B 3NGKA 2EFNA 1O8BA 1K8AD 4FXWA 5HROB 3OREA 1GAOA 3W2VA 2E5JA 2GJKA 2HLDA 3BQ2A 3K5NA 2ZKTA 2DH7A 2DGOA 2FJEB 1FJ7A 5I42A 3M9OB 1GTHA 2JJ2A 3CQZC 3U2QA 3MMPA 1WHVA 1G4CA 4Y9RA 1O2FB 5KG0A 4UY85 4H4KC 5KFRA 4YHHJ 1HNZJ 2K06A 4MKVA 1XNQJ 4GVBA 2XGJA 1GNKA 3BJYA 4ILRA 3MAHA 4WCEQ 5J1EB 1Q8KA 2OPPB 2X3GA 1MWZA 2PIIA 4IG0A 3OEEA 1IR0A 3S1TA 2LXIA 1BQMA 3T6BA 1VJSA 4F4AA 1VQ7S 1YVFA 3K8WA 4ZP9A 3EMTA 2XGPA 5CYQB 3ET6B 1MU2A 5FO1A 2ROEA 4K4XA 4AF7A 4H4OA 4NI2A 2B9EA 3T41A 1WG4A 4A3DK 1JX4A 2QSFA 1HNIB 2X85A 1B0TA 4OZJA 5M3MK 2GMHA 3CP8A 5T41A 4WKRA 2QL7B 4A8XA 2G9OA 2PE8A 4JV2A 1R8HA 2XCOA 4P71A 1Y5NB 3MM5B 1B0PA 3CJ5A 3W3SA 4OYPA 3BZQA 1PBAA 5M5XK 1YIJS 3I4MC 3CVKA 3BQ1A 1MG7A 2YWHA 1ZA2B 1RWVB 5F8HA 1UL3A 4JK1A 2CQHA 3QX3A 1EXMA 2CIMA 3FKBA 2QJ3A 1K28D 2G0CA 1GXTA 3AH6A 1S57A 4V19X 4TY9A 3TZWA 1FO1A 1RBAA 4IKAA 1IBKJ 1NDCA 2WRMA 9RUBA 5GADU 4OYBA 4XOTA 2OBRA 1BGWA 2ZUEA 1IBCB 1JMTA 4XAKA 3UFCX 1XZQA 4RUAA 3GR0A 4LJMA 4Z7CA 3OJWA 1E62A 1T9UA 1IJEA 4BLAA 3QFWA 3LH2S 4B9VA 2JA6K 4XDDA 2PT0A 4EWTA 3GJQB 5AXNA 3ISXA 1I6JA 4WKYA 4X84A 4B3TJ 2XGQA 4WYWA 1G7SA 4BBYA 3ILJA 1RAOA 4NXNF 4LRAA 2W2NP 1Q4RA 5KFWA 2O67A 2V8PA 3MM9A 1LWFB 2E5LJ 3ZZZA 1KVJA 1SCJB 3DRSB 4LF4J 3I56S 3G4SB 2XS2A 3V6HA 2K8GA 4C8MA 3GJSB 2JA7A 3NAHA 4Y2AA 1N88A 5ETNA 2UV8G 2NYIA 3BDEA 4ZJOA 1SPBP 1XTZA 1TWGA 2FHJA 2D1CA 4I6YA 3CPWR 2ZTGA 3PNIA 1HWJA 3GVKA 3WQZA 1T05B 4PQUA 4CO5A 2IVMA 4J9MA 1S12A 4FVCA 1JLFB 2YTCA 3N0VA 1M5HA 2I38A 3OZVA 2BJDA 2YH1A 2VG7B 2XO7A
chains in the Genus database with same CATH topology
3AD7C 4PAAA 1XZPA 1WOPA 5L46A 3A8KA 1XZQA 3AD8C 3TFHA 1WOOA 3GIRA 1VLYA 3A8IA 3AD9C 1WOSA 1XZPB 4PABA 3TFJA 1WSVA 1WORA 2GAHC 3TFIA 1WSRA 1VLOA 1NRKA 1V5VA 3ADAC 3A8JA 3GSIA 1X31C 1PJ5A