1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
b'VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
1WSVA 5L46A 3GEEA 3TFIA 3GEIA 1V5VA 3AD8C 3TFJA 1PJ7A 1VLOA 3AD7C 1XZPA 4P9SA 1VRQC 4PABA 4PAAA 1XZQA 3TTGA 1NRKA 1YX2A 1PJ5A 1XZPB 2GAHC 3A8IA 3A8KA 3TFHA 1XZQB 3AD9C 3A8JA 1X31C 3GEHA 3GIRA 1WSRA 1WOOA 1PJ6A 2GAGC 1WOSA 1VLYA 1WOPA 3ADAC 1WORA 3GSIA
chains in the Genus database with same CATH superfamily
1RWNB 1RISA 3RB3A 1QUPA 4USHA 4OPOA 3W2VB 3RB6A 5DDPC 1TTTA 5HLFA 3BUEA 2CW5A 5DO2A 5KFJA 1VH2A 2MHNA 5FDLA 5HMZA 4A3BK 1FRMA 3NXZA 2YWHA 2EKNA 3KMSA 2UU9F 3G4CA 4YR0A 1J6VA 5KFHA 4NX9A 2LU1A 1RU1A 5J3OA 4A8FA 4K4TA 1C0UB 1HD0A 3TTGA 2G4BA 4LK0A 5CYMB 2Y8YA 3TZYA 4AVZA 1S4EA 3LAPA 4DQQA 4I2QA 3BEGB 2L41A 2L9WA 4B3XA 4M5HA 1LV5A 1VQKB 3PA2A 4RBVA 4RUCA 2M4MA 2OPSB 3ZZRA 4FS1A 3MCSA 5I3UA 4XCHA 2ZM6J 5KFFA 1T95A 2YU9C 2HFNA 3OR2A 3LGNA 1F7UA 4GVBA 5C42B 1PG5B 2F8EX 4FZVA 4WU2A 4DDFA 2HG4A 1WTFA 3ZZOA 2GSNA 3C6UA 4E98A 1K28D 5LMUF 1WC5A 3UNYA 3O2IA 2UUCF 4Z4SA 5E3PA 4HH0A 3TJ8A 4RM0A 2AWZA 1B0PA 5B0BA 2YY3A 3OSPA 5BYQA 2JC1A 1TUWA 1VQMB 1JLGA 1K83C 1TKXB 1XR6A 1SKSA 1BHNA 4LQYA 3M8WA 1C1CA 2B9EA 3T1HF 5M3MK 3M32A 3OSNA 4WZMA 1F93A 3DOKA 4OL8A 5AT1B 2DYAA 4M5LA 3W1YC 1JB9A 4QZVB 1VC5A 1HBOB 1EFRA 3PCOB 3AA9A 2QLBB 4OYXA 3R5AA 4DPTA 2HWTA 3DFEA 3R5CA 2ACYA 3J7YU 3CXCR 1JLFA 5HN0A 1YNNA 3S8SA 3TFHA 1XZQB 3MHYA 3QFSA 3PENA 2CUYA 4QYZJ 4C3HC 4C2MK 2WVEA 1XN9A 1RTDA 3C46A 2JH3A 4ZK7M 2QIFA 3AB2B 2CPDA 2Y9HA 4X64J 3GB0A 3QJLA 1EP1B 5DJBA 4OYMA 1ZA1B 1N33J 5TR9A 1Z2ZA 3HSZA 2RDJA 3DRSA 2E9RX 2LU2A 1TL7B 1F5AA 2AEJA 5HL7Q 2AYMA 1KK3A 2ZFHA 4JI4F 1TFWA 2G2YA 3OEEA 3ITHB 1VQLS 2F4VJ 2Z2ZA 3G82A 2GV1A 1HA3A 4DUYF 3TAMA 1HW8A 1TWCA 1AXQA 5EN1A 4C8MA 3WX4A 4MJKA 3VAJA 2X3UA 4NZ7A 3SLNA 2DR9A 1CBKA 2DNOA 1NDCA 2XBPA 4CLYA 3VO1A 5GAGU 2R8HA 4X4VA 2R8GA 3GTJA 3WDOA 1MABA 5IS2A 3L7OA 5HI7A 4GT9A 2ZL6A 2J6TA 4PCQA 2HNDB 3PM9A 2HFOA 4A3DC 3LPXA 1R8HA 5BYRA 1D8TA 2E2HK 3BQJA 3OEPA 3TVYA 2XMAA 2VJJA 4HVZA 4DU7A 5K5MA 3LP2B 5E6TA 1K8AD 3M9OB 1YIJS 2EK1A 2NVXC 4W92B 3GCWP 3NL0A 3IA0A 3U1MA 1H6KX 3KNAA 1JJCB 2VC1A 2VBSA 1T05B 2AJ2A 3HHEA 4FYWB 1KP6A 2XC9A 2JL9A 4CO2A 5BR8F 4A8YA 3CUNA 2YTCA 1VGYA 1BLIA 4P1VA 1UW4A 5EGHA 4I69A 2ZWOA 5HQMA 2K06A 1RWXB 1HMVA 2R7RA 2XSFA 2R8IA 2IRUA 4XPEA 2ZJQQ 1Y0HA 3S1QK 2CQ4A 1X9MA 3M30A 3BN4A 5D8HB 3NOGA 2LLZA 1UCNA 3G8SA 1U6ZA 5A8WB 4RW8A 3OJSA 3IRXB 3TAQA 1J5OA 1KRHA 3OTBA 3UCUP 4JYAJ 1LFWA 3V81B 4LBZA 4NYPA 4U7UK 4ECXA 1DQ9A 2A6MA 1O26A 5A8RA 2Z2YB 3UN3A 3MMAB 4KMUA 1U1NA 2YU9A 1T6XA 2KTQA 1NDKA 2R2TA 3G87A 1BMFA 3DRXA 2IMOA 2QFIA 3MR7A 3W9IA 4LF9F 3M8QA 3K59A 2A6OA 4NCGA 5DRKA 3RBZA 3PDNA 2DEUA 3V4IB 4DU8A 2E5JA 1HNXJ 4WFYA 4ES3A 4O0NA 1W0JA 2V8DA 1U1QA 4J0QA 2E2JC 4M53A 2Y3YA 2J0XA 1SQFA 4A3JC 2YQ0A 1I6VA 4CYUB 1K83A 4URQU 2OBRA 1WQHA 3PHEA 3H5SA 5A8KB 3T1YF 2WW8A 2W24A 4NXNF 2FJXA 3UNGC 2C2RA 3ZBUA 3JTOA 1XERA 1O29A 3BBFA 1KZLA 2W9CA 2QL7B 2A6HA 2DJWA 4K4ZA 3N79A 1KRPA 4DV4J 3I96A 3I4HX 1XMQF 2F8HA 4TLQA 1JLCB 4DSLA 2MYFA 4HLBA 3T9ZA 1IQTA 4YFKA 2FZCB 4ANDA 2HQIA 1HIYA 1FRQA 4A3CK 1LKZA 1S9FA 3VGSA 4I64A 5ETTA 4CLTA 3T56B 5D3GA 1OPZA 2NUUG 5D4DA 3CO0P 1LW0A 2UXCJ 4P52A 2PEBA 4PUOA 5KFNA 2FJAB 4Y2AA 1C1BA 4HHUA 2DNHA 4JOUA 3A8JA 4BY1C 1X7VA 2N7CA 1O51A 1FNXH 3JQRA 2FZKB 2YKMB 1HQMA 3SCKE 1AUDA 1MMDA 2AX1A 1NH8A 2XZPA 3KNGA 1Y3JA 4F7VA 4BLGA 2D3O1 4ZJOA 4CM0A 1QVFB 4L3NA 4JI0J 4CO4A 3A3OB 3O44A 4DV6F 2JA8K 3QJPA 2HFUA 1HPZA 4J37A 4J9OA 4MIAA 4GZYA 4Y2IA 2V50A 1Y1WC 3S16K 2E1PA 2WONA 4DR5F 2OUGA 5L8RC 1E64A 2QYGA 4DEZA 5E33A 2B8PA 2MKJA 3NNAA 1NZAA 4DF8A 4IFVB 3VA7A 2KM8B 3DLKA 4USWA 2BX6A 1XPPA 2HPUA 2YX1A 2V6TA 4WJ4A 2CDRB 3J7AN 4C0HA 3DKDA 1X0FA 1LQ9A 3BQ0A 5KFGA 4Z4RA 1ULRA 4HKQA 4B3OA 2J6SA 3D26A 3NY0A 3J7A1 2O3DA 2BJ8A 2ALYB 4I0WA 4O2DA 1TK0A 5LSLA 3UVJB 1FKOB 1H98A 2B43A 1REGX 3SKBA 4JI3J 2EW9A 3FQKA 3PZPA 5KFSA 4UT4A 1QGZA 2OIHA 3PUNA 4X4QA 2F1LA 4W98A 4DV5J 5EWFA 2DNRA 4DR7F 2BRLA 2CFAA 2OTLB 1B70B 1I5OB 4RW6B 2PHCB 1VQ4B 2GAHC 1AFJA 4ELUA 1VJQA 2M70A 3BY2A 4WYWA 1UVMA 2NCKL 3ERED 4YUDA 4C11A 4KR0B 4X07A 2QV6A 2FHJD 5B6IA 1X4EA 1N88A 1K1QA 4Z7CA 1N32F 3CDWA 3BF4A 3NS5A 4CT9A 3HT3A 3CD6B 4ZGQB 1NSPA 2VG5A 1NZ8A 4PYDA 1UEKA 2ZZGA 1T9YA 4JI7J 2E7XA 4DL5A 3DXBA 1KJZA 5HO4A 4I67A 1C0UA 4X65F 1YITB 4ILMA 1BMQB 2C2MB 1VQSA 3AOAA 2ZBRA 5C44K 4NNJA 2WVFA 3RRHA 3CGIA 2V7QA 4G1QB 3VR1A 4FVMA 2FLLA 2VFRA 3CQZK 1I3OB 1X31C 4J90A 2DH9A 5HVFA 2D74B 2XOKA 1PAEX 2QN6B 5DG7A 4C98A 1EQMA 2OPSA 3VQSA 2JDIA 2JA6A 4ELTA 5HVGA 3RR7A 4X4NA 1A7GE 2MKCA 1NJWA 2VQFJ 1NBEB 5C42A 4TMZA 1WC1A 3D1QA 4MKAA 4A3EC 2RILA 2K2PA 3HDSA 2X6WA 5C4JC 3J81U 1RYRA 2JVOA 3R6JA 4OX9F 5ETMA 4ZPAA 4DV0J 5IYDK 2HNYB 1G7CA 3AAWB 3HD1A 4P2XA 5J1EA 3GIIA 3OPFA 2XLIA 3N28A 2F5GA 2DGOA 4ZCKA 2LEBA 2KDOA 1H2VZ 3Q24A 1PC4A 3B54A 4G1IA 1TVCA 1F5CA 5CABA 2RT3A 3M6UA 3GONA 2BQRA 1S9EB 2UUAF 4NCAA 4M95A 2CJ9A 5HATA 1WHWA 1TKDA 1JQGA 3FEZA 2DIVA 1SL0A 1HBOA 4XDDA 4PXDA 3V4MA 4WWSA 1K73D 1RT5A 1T9XA 2OFHX 2XY5A 4AF6A 1Y00A 1VRQC 4WF9Q 1XZQA 1KR4A 4XR6A 2XGQA 3HKZL 4ID8A 5ETSA 1T03B 1W2IA 1TWAC 3VGTA 1RT1A 3N4WA 3QLHA 3OTCA 1TELA 2LQ9A 1X4CA 2E1BA 4RD4A 3IWXA 1N34F 2A2DA 2M88A 3FKIC 4ZVOB 3B4DA 3JSMB 3T5HA 2ADBA 1EFWA 3A3BA 1NSAA 5J1PA 1TL7A 4IH6A 4I6AA 1TWGK 3TP2A 3R5GA 2W25A 3CTRA 1FRKA 1RAIB 4IG0A 4RX6A 1JNZB 5J35A 1HA1A 2XCOA 2BF4A 1Y1WA 5D4OA 1HNIA 2NV4A 1T9UA 5L1IA 4PGOA 2X51A 4RU9A 1CG2A 5CA5A 1KONA 4LF6F 1TFYA 4PC2A 4X7EA 2RQKA 1S6QB 5L9NA 1JA0A 1ZM4A 4OINA 4P6VF 3C3LA 3SCJE 4EH1A 3GP9A 2Z56B 3KOAA 1F9EB 2HNDA 3R6LB 5D4NA 2IPOB 4FYVB 1IBLF 2PI5A 1SJFA 1GX6A 3MEKA 1HNZJ 4KMAA 1QE1A 3VGVA 1FXRA 3BO3A 5B0AA 2ZJRQ 4BBYA 4HR2A 3T00A 3LP2A 2YBVA 4DUZJ 4ZMMA 2IIHA 2OEJA 3C19A 2DTJA 1GMUA 1NBMA 2W9BB 1AT1B 3DLHA 2E1AA 4Y7CA 3MDFA 4CLFA 1S72S 3Q3QA 2FZGB 4FKYA 2D1CA 4F3QA 4YHHJ 4RDLA 1OWXA 3PX4A 2HBRB 2ZL7A 1B0VA 4A3KC 2UUBF 2O67A 4OHWA 2GC8A 3FPPA 1RT4A 5L38A 4KTQA 3H0GC 1R89A 5KG7A 3DRYA 4QWDA 3HO1A 5DDOC 1XEZA 4K2JA 5EX3A 3VAIA 3JYTB 3Q8VA 2OP5A 5A8WA 3P49B 4KJIA 3GTOC 3NNCA 3UI3A 4LSNB 4FWTA 3AXMA 3V81A 2ALZA 2PA8L 3KJVB 3HOYK 3PFEA 3CJSA 1Y0YA 3MMAA 4ZLPA 3QFCA 2HGMA 5K8NA 4OHYA 3A3PB 3HVWA 4MK9A 4CNYA 4I2PB 2KFZA 1Q95G 1WG5A 1W9XA 4ECWA 3I4PA 1Q78A 3QIPA 3V4IA 2MZRA 2DH8A 1RU2A 4C4WA 1RAGB 2HRUA 3D9BA 4QVJA 2Y0SL 1J5EF 3BSOA 2LQ8A 3MOZA 2M5SA 1SQGA 1FDBA 4ZJQA 5BSYA 3GPAA 3K5OA 2CJYB 3F44A 3BC9A 4A3GC 2J7WA 1XTZA 4GKJF 3SV4A 2LXIA 3I4MK 2XYGB 2EBEA 2JA7K 4LFCF 4KQZA 1Q86D 3GWCA 1JLCA 1M90D 4YFUA 4B9VA 2QA4G 2VUGA 3QRPA 1TWAA 4YB1P 2PGCA 4L74A 4X8IA 3L4JA 1H2UX 4KC5A 2BANB 2GX8A 4BBSK 3K58A 3I31A 1CNFA 2CQ2A 3OXFA 3KLGB 4RO0A 3TEGA 2XCAA 3FKIA 1EQ0A 4L6V3 3MD1A 1VJEA 1RWUA 3BSNA 4ZDNA 1JXEA 1SIWB 5T7LB 4JV2A 3LP1A 2QJ3A 1JLBA 4DR1J 4JV5J 4K5SA 3FGVA 4MK7A 4U9RA 4KGZB 3C14A 3TR5A 2Q6OA 2QYCA 5IQ6A 4PQUB 1OB0A 4X4RA 4PQAA 3QMQA 4A3IC 3I32A 3UDLA 1NXIA 2GJRA 2QMUA 4K0KF 4Y2CA 2RRAA 1V3ZA 1BQXA 3W2GA 2BA9A 5LL6d 2IJFA 4M4SA 2GFFA 3HOXC 4XDCA 2N4CA 2HLDA 3JSTA 5KFUA 3D6TB 1DAXA 4Y34A 1U2CA 1UW9A 3K5MA 2ZBVA 4Q8EA 2DB1A 3C15B 1Y5LB 2OH2A 3MHPA 1S6OA 3BDPA 3QWPA 2VPWB 1AYEA 5KFWA 3TRGA 1KK0A 4H4KC 3R1LA 4KT0C 3QT8A 2EEYA 1ISEA 1O0PA 3P5BP 2BBEA 3D6FB 2VDIA 2XGPA 1FKOA 4B3RF 4UZUA 2C3PA 2W8KA 5B0CA 1RTIB 5J2MB 2RB7A 2IM3A 4G7XA 1W2BR 1UVNA 2DNKA 4KV8A 1YQHA 1LXJA 2DBBA 3ZNUA 4NLVA 5JXSA 1TL1B 4ED8A 5A6WA 1HW9A 4FM9A 1KS2A 1HR0F 2AYBA 3CJRA 1XMBA 4F4ZA 4Y2KA 1VQ5S 4RW6A 1UVIA 4XLEA 2DRBA 3H0GA 1PYOB 2V7TA 2G1DA 4Q44A 4G0UA 3WZ0A 4OIRA 2GHWA 3NGTA 3I55S 1WCMK 1SMYA 2MLXA 4Q7AA 2HS3A 2IYIA 4I6WA 3ZUGA 3GTOA 2MZTA 1W87A 3QNWB 5L1LA 3WQPA 1PCAA 4USJC 5F4OA 4YAWA 3CCQS 5BYSA 2R7XA 3W2WB 2DYIA 2X7IA 3AVYA 3D5MA 3L95X 2BE5A 5EWEA 4AL6A 4BWJA 4MQ9A 2M8DB 4DPXA 3NAHA 4LRFA 1FD8A 4OZ0A 1VRUB 1KK1A 4XAKA 2I8EA 1K73T 1YWXA 2D74A 3T53B 3AA8A 1EETB 2QN6A 2EVZA 2WAQD 3M4OK 1O25A 2NXJA 5F0WA 4LSLA 4ZCMA 1L3SA 1UJ6A 4XORA 4RW4B 4KASA 5GMDA 1OO0B 1P9YA 2BKPA 1W26A 2B9XA 4ZPWR 4C3JK 1NUEA 3PY8A 3OQ2A 3UFCX 3IR5B 1S9GA 5F8JA 1K9MD 4OLOA 1BD6A 3SZYA 1VQNS 3SCLE 3UD3P 3SQGB 3W5UA 2R7VA 2GVDB 1PBUA 3IO1A 2IDEA 3KYLA 4C7QA 1XB2A 1EJ7L 1T5EA 1OQ3A 1D1NA 1X4HA 3MM7B 2D3OR 2HLTA 1S9EA 3UDVA 2R7SA 3LAKA 2ZH6A 4B47A 1NJZA 2JVRA 1G7SA 3OXGA 1CJUB 2NPIA 2JLEA 2JOQA 3AHPA 2C4TA 1YG0A 1P1LA 1ITPA 1JLQB 5EX0A 2QO3A 1YI2S 3SZZA 1XZPB 3VQTA 4JI1J 2NXUA 1LWFB 1SM4A 9RUBA 2E5LF 2J0QD 4JP8A 1FEHA 2J9DA 4X66J 2LKZA 3W62A 3LALA 2X1AA 4U67Q 1GVHA 1S0NA 4H4MB 4PRFA 1QAIA 4YP3A 4YS2A 3JS9A 3MPUB 1HNXF 2CPEA 3IGVA 2O01C 1WI8A 5C24B 1VRTB 1N05A 2JLGA 1U0SA 2FJEB 1O8BA 4Y3CA 2DCUA 4F02A 3LA0A 3EVMA 5KFLA 5J2QA 1FRLA 4ACBA 2RUSA 4TN1A 2KVOA 1UD2A 4FPIA 1JKHA 2NPFA 3ZTQA 1Q81T 1Q9SA 4K4VA 1EKRA 4OX6A 1KSPA 4XM3A 2R2RA 2DR7A 3GEEA 2VG7A 3H25A 4H4KA 1N6QB 4B17A 4QVAA 1N8RD 3QSYA 3G86A 3MF5A 1RACB 1SKWA 1VQPB 3LANA 3I9ZA 3FJOA 2VC0A 2YX4A 2FY8A 3WC0A 2XWXA 2KU7A 3CCRB 3KTQA 2UXCF 1E43A 2JDJA 4BLBA 2V8GA 2LZJA 3DOMB 3OLAA 1FI4A 2Z2MA 1HQUA 2Y1RI 1QX4A 1RAOA 4QYZK 2EFGA 3M8YA 4C9DA 3D54A 3OTOF 1KOHA 5IM0B 4N77A 1S1VB 3OL7A 3J81Y 2UVUA 2R8KA 1SFOK 4RUBA 4ZV4A 1U6FA 1Y1VC 4O4RA 2P5VA 1PILA 1R31A 4ILRA 3HHNB 5KFQA 3IFEA 1FWPA 4OFZA 2DH7A 2YNHA 2IVFB 1M1KD 1S0UA 2Q6IA 3LP0A 2ZZEA 2QE7A 3GIJA 3Q8PB 3T5KA 4RZRA 3OTEA 4KDDA 1F60A 1YBAA 2AYEA 2WZNA 4Q0BB 1UD3A 3SJZA 1RABB 2BE2B 3WBZA 6FD1A 3PKMA 1R8BA 5D4PA 3DRRA 2AD9A 3BGFA 4Z2XA 1R8PA 1JLAB 3H5YA 1OMSA 1WNEA 3NCPA 1PO6A 1WF1A 3ULHA 1WJ9A 1V5IB 3AVWA 1HQEB 2XNQA 2PO4A 3A8IA 1Q86T 3DNCA 4I7FB 4ES2A 3TUIC 4B3SJ 1VOMA 3F0NA 5FIUA 3BBCA 4I2PA 5THXA 4UTGA 3PO5A 2FQOA 4N3GA 4TY8A 2X3GA 1WEXA 5M2PA 2GA7A 2CNNB 1RGVA 2LYVA 1X9SA 3EDQB 4B9UA 1A9NB 1FKPA 2BKOA 2CJKA 3EGWB 3MAAB 1MU2B 1U6BA 3QJJA 3CTAA 2DNZA 4J9PA 1X4FA 4BY7K 4K59A 3M8SA 2MKKA 3MMPA 2QDXA 1U2RA 2XM3A 2AHOB 4R0EA 2B7BA 2FLPA 2KJVA 2DR6A 3D3CJ 4PXBA 1NLKL 4G1VA 4OI6A 3UCZP 4JI6F 3JQJA 4H54A 4TKTA 4B08A 1IJFB 1EB0A 3DLLQ 1TL4A 4Y28C 5KG0A 3X1LB 2XZLA 1XBWA 1G7RA 4AQYF 1YJUA 1QSLA 4OHZA 2P8IA 2ILZA 5DGBA 4NI2B 2LXUA 2E44A 4DL0C 2A68A 1REVB 2KT3A 2L48A 4USIA 4FBTA 4CO1A 2VBTA 2BANA 5M5YK 1SPBP 3CD5A 2HHSA 4M1XA 2JEFA 2QMXA 1AROP 4F36A 2E5IA 2FHKA 4XLCA 3JQMA 1MRZA 1RT3A 4NEZA 4PG4A 4CZCA 4HDGA 1QVGR 3KDOA 3GYNA 1HBUA 4X4PA 2X1GA 3IG1B 3AH6A 1HI8A 3S17K 4XLPA 2ZD1A 4XLAA 3ENWA 3M8ZA 1QSSA 3EPGA 5IYRA 3OFGA 4URGA 2FX3A 5CZXA 4DXLA 2FLOA 4E2FB 5C4XK 4U8VA 1VJWA 4HACA 2QGFB 1IW7A 2XMTA 2H5EA 4PQUA 4Z37A 4KKOB 4DK1A 1UPMB 2MHEA 5HMXA 2MZ1A 2OLWA 4DV7F 2DR5A 4H4OA 2ZKTA 4GTFA 2FVQA 5IFMA 1VQ7S 2VONA 1I51B 2G2OA 5SUHA 1TKTB 1RYSA 5C3EC 2X6XA 4X7CA 4P7TA 5CHPA 2VFVA 2DIUA 2J76E 1U26A 5JFEA 3GIRA 3S7RA 3CJ2A 3FMBA 4HH1A 2GS8A 2ZH7A 3PW0A 1ZVUA 3DOLB 1CQNA 3ISZA 2I1LA 2D9OA 3QO9A 3LUYA 5AXMA 3MUVP 4XKVA 3QT6A 3OR1B 4OI0A 2KZZA 3H5UA 3OFEA 4RDKA 3ASSA 2HIYA 5A0YB 1O5JA 1RTHB 3CE8A 2CQDA 1WP6A 3SDEB 2VOOA 1HZEA 3TUJC 2EBBA 4UOGA 3SFGA 1TL3B 2C5HA 4DL7A 3EVWA 3HM9A 3OAAA 3HKWA 1L3KA 3MR6A 3GTQK 4A8SA 2QG9B 5BSXA 2GVZB 4ZP9A 2IC3B 5C7PA 5HP1B 2IMWP 1ZAWA 2V6UA 2VNHA 4PC1A 2ZUFA 4N5SA 4B02A 4TY9A 4PXCA 3K57A 1T3NA 8RUCA 1JVIA 3GCXP 1WHXA 3QAEA 4KB2A 3V7AA 5C25A 2VASA 1U1MA 4XSZA 3FKBA 2MSSA 2MLZA 4NA3A 1E6VA 2OK7A 2KG1A 1S0VA 3F73A 1RBOB 3DXJA 1Z4UA 4I6YA 3P6YC 1EETA 1M1HA 1IKVA 4NZ0A 4KB7A 2XMWA 1RBAA 1EARA 3BBBA 3OHAA 1WACA 2W4PA 4E8UA 1R6VA 1IL2A 3CVKA 3AJDA 2E2HC 2ZL5A 1TQLA 3LW5C 3BS9A 1DCPA 3CJTA 2RRBA 3G96A 5GAHU 1GEHA 1OB5A 1MG7A 1KQKA 4B3GA 4OYWA 2PDAA 2I5JB 2F8MA 3KDNA 1RT7B 4RDJA 1T6YA 3D6MB 4DL2A 4F25A 4LJZA 2CPXA 1HQ2A 3M2UB 3SSQA 3MECB 1RT6B 3BSCA 1KLMB 4ZP8A 4R5PB 1IBKF 3GVJA 2NSBA 5IV3A 4X6AK 3MM7A 3MGJA 3HSJA 1UZDA 4C45A 5GV8A 4NLDA 2CNOB 3D3BJ 3S1QC 2VNKA 2ZNYA 3FOEA 3CJ8A 1VQ4S 4CNZA 1IKYA 4O3SA 3TQ1A 4CLKA 2J6UA 3ZC4A 1CJUA 2Q6LA 5BXIA 2LA4A 1NPPA 4XQFA 3FBEA 1BY9A 5GMKa 2E5GA 3FVYA 1XZPA 1OGJA 4KH0B 2CQHA 2CF4A 3IAM9 4TSFA 3CD6S 2V67A 1FRHA 1DTTA 3O6QA 2W01A 2BE9B 5M5XK 4NASA 4KHRA 4AC9A 2ROEA 5H9FK 3PKYA 3S1RK 5KFXA 5KFOA 3HVTA 4NLQA 2EIXA 1KQSB 3KXDA 1YJTA 1BS2A 2AKWB 5K14B 2FHOB 3U27A 1X0PA 1U02A 2GW8A 4FXUA 1YLOA 4DHVA 4NL5A 1KVKA 1QDUB 4UOFA 3DDYA 1VRTA 4CCHA 3GE9A 3HHDA 4WFXA 1I50C 3S2HC 4FF2A 4X2BA 2HIQA 4J3NA 2V8VA 3BYPA 2I9SA 1LNQA 2V7XA 5KG4A 4RCYA 1M1KT 4YFNA 4W90B 5M5WK 2CZVC 1SC1B 3D1OA 4ICLB 6AT1B 3Q89A 2VPZB 1IQ0A 1VIOA 3IBWA 2ZJPQ 4NOIA 3KUHA 3EZUA 1C0AA 2ZDPA 3NP5A 1GAOA 3MM8A 1TMJA 2BEFA 3IWNC 2YNFA 3FSYA 1U1RA 2GGPB 4EK2A 5IWAF 4IQXA 3L7UA 4ECZA 5H5JA 2ZVSA 3ET6B 4CO5A 1N6QA 3ONUA 3AH5A 1NAQA 2FB0A 5JVOA 5FLMC 1F2HA 1X4GA 3R27A 2BRKA 4KHPF 1DHMA 3KK3A 1WEZA 4EYHB 1NSKL 4G7HA 1BJKA 1GT8A 2WR8A 2XMVA 2VU5A 1M5HA 5A88A 3DOMA 3W5YA 3CMAB 4OHVA 3KJNB 3CF5Q 4YOEA 2DGSA 4JI5F 4PAAA 4O4GB 1WQFA 1JQWA 1IR0A 5K8PA 3H42A 2X1BA 3ISNC 3HULA 4IQMA 2RH3A 5LT5A 3I6PA 1DRZA 1HNVB 4Y6IA 4WILA 1FNCA 4F4XA 1DDGA 4ED7A 2VBUA 2CJAA 2PIIA 2WB1L 3L9ZA 5L1JA 4PEOA 3AB4B 2XHWA 2WSCC 4DFJA 2YNIB 1NO8A 4WKYA 2W6JA 1S4MA 1FVSA 4KYZA 4XLNA 4IG3B 4L76A 2HS4A 4Q8FA 3H40A 3BQ1A 4DPYA 1C0TB 4Q2MA 4P10A 1BDFA 3W2HA 3NGDA 2HBYB 1JLAA 4P5AA 3S16C 4KAWX 4WP8A 4LRBA 4DQIA 2WHOA 2LXFA 1HQEA 5IP9K 4DV3F 3CPXA 1JX4A 4HE5A 1I6HK 2KVQE 3I4NC 3TANA 4USVA 1S1UB 4U7CA 1RAHB 2ZHBA 3PO3K 4A3LC 1VMBA 2F43A 3PRDA 3E1YE 4MKYA 3PO4A 5M2UA 3JU4A 2ZBUA 1FJCA 3MAAA 2D7SA 5HBMB 2X1FA 3BP3A 2MQQA 2RS2A 4Z4TA 2OKQA 2ZZQA 3QIDA 4A93K 2B4VA 1SIZA 5G4DA 2AHOA 1IJEB 3I56B 3MTKA 2R2SA 2XCPA 2B63A 5KFAA 4ZN3A 5TY0A 4GMKA 3WX8A 1N36J 3R9LA 4U95A 3FKSA 2DXDA 2J7KA 5HLFB 4KIAA 4RNHA 5AJ3J 2LECA 1TWCK 3QFTA 1HYSA 4NXMF 2DNYA 4IO1A 5IOLA 4YMEA 5IYCC 3K89A 1UEVA 3OL6A 3OE7A 2J9CA 4A48A 3H2LA 4DV2J 2XS5A 1T11A 1NMEB 1KQFB 4GRSA 1LW2A 3RBEA 3GTJK 4EZ9A 4AE5A 1X8DA 1UA1A 4YEAA 2C22A 3H59A 1WWHA 4LF7J 1UFLA 4YY3F 5A2QU 4A3MK 3VAGA 3KMQA 5LJ5Y 1H3DA 2O5JA 4XTTA 2F9DA 4C8YA 4Y00A 4WQMA 2HSEB 1I50A 4OOXA 2D3ZA 2ZKUA 3IG1A 5I3UB 4DR4J 3OR2B 4GTBA 3DI6A 2ASYA 4DL3A 1GQEA 4GVBB 2A1BA 1GH8A 4DR3J 3B6BA 2LA6A 4ZJLA 2RAQA 2PMZD 3VNVA 3MR3A 4TU8A 1XNQJ 3SI8A 1ZH5A 5IYBC 4ED1A 3PIOQ 3C6UB 2VA3A 4TMWA 4O0IA 1NKEA 4UZEA 2NXEA 4M5NA 2MTLA 3RR8A 5A76A 2NQPA 2R92C 5DSZA 1TKTA 1SB6A 2EG1A 1FX4A 3EZ5A 3MPVA 1S10A 4QR0A 1IKXA 2W4DA 2H51B 1C1CB 4CQ1A 2LFVA 3EJMA 4RR5A 3AOCA 1LK7A 4NZ6A 2ZDOA 3DOKB 4G5GA 1U25A 4LSZB 4LF4F 4C3KA 3UW1A 2J9DE 3I82A 4QIWD 2P6SA 2FTRA 1S59A 4JI8J 1S72B 3NKYA 3AFGA 3UD4P 1A8PA 3S1NC 3BY1A 3BP8C 1RTDB 1GNKA 3DGVA 3SDEA 2YU9K 5I42B 2RGRA 4C0SA 1QY7A 2K3IA 1QUVA 1ZOTA 2C2EA 1FX2A 4FP9A 3RZOC 4C8KA 1TL3A 4ECVA 3DRSB 2BSAA 4XL9A 1X4BA 4XK8C 4I68A 3PX6A 1T7PA 1CPZA 4Z4ZA 3NCQA 4LRCA 4LQ9A 3TJAA 5I4MA 1OYDA 5GAEI 4XLFA 5HROA 1R6YA 1RWMB 3VWSA 3TO8A 4KB4A 1ELOA 3MM6B 4CLLA 5J1NA 4DR2J 2E9ZA 1K83K 3G82B 4B44A 4DWIA 5J2PB 3PA1A 1YZ6A 1F9NA 1S7IA 2Y1JA 5D0HA 4EWTA 4PWUA 3ETMA 2QTZA 1LWCB 4FNIA 1XXAA 1SUQB 2BN4A 4ED0A 5FO0A 1IHMA 2C2NA 1I3QC 2E2IA 3GQBA 2GMHA 3GSIA 1HNWJ 1XC9A 4CLWA 4RNNA 4O3OA 3CDAA 5DN6A 1IQZA 1YBTA 1S1TA 1GJRA 2XNJA 3OJUA 4E0FA 1E79A 4P22A 4RPFA 2CG8A 2R93C 1HBMB 4LK1A 3C66A 4DSEA 3W5HA 3GFZA 4UOCA 3DHXA 2YQ1A 1M5PC 3IM8A 1RHUB 1S76D 4EI2A 3QFHA 4LFAF 2HFSA 3TX0A 1EK8A 1XE1A 3DGPA 2FJVA 2X8KA 2VBZA 4OQJA 5IT0A 4DLGA 1T6ZA 2BM0A 1BX1A 2XZDB 1NJID 2MEWA 3GEHA 3GTMC 1RT7A 4TN2A 2DITA 3GDZA 5KAKA 2KHCA 2F1MA 3QQCD 1OY9A 4LBHA 1JB0C 3CW2C 5HKKA 5LXRA 5KT2A 2WBMA 3JQKA 4LBVA 3SJPA 1VYAA 1NB0A 2AZ3A 2RU3A 4J7CA 3RW7A 1YX2A 1A0OB 2CZ9A 3DLEA 1HMVB 3SZ2A 4LT6A 3M30B 2OPPA 4QW8A 3CC4B 5DLGA 5A6PA 4N47A 4RW8B 4GC7A 4HI1A 5DZ6A 1J5OB 2W8LA 1XNRF 2B8QA 1FX0A 4B3SF 5LSOA 3EMTA 4YFXA 4ECUA 2HS0A 1HARA 2NVTC 3HFKA 5A8RB 4PABA 5LMNJ 1CULB 4FXDA 1QD1A 3LAMA 3AJ1A 5MAOA 5HK4A 3NGRA 1HBNA 1U09A 3W5VA 3CIMA 3CD0A 2H9ZA 2BACA 4QU6A 1QFJA 2C4UA 4Z1MA 3CXCB 4NCGB 1KMHA 4EEYA 2BZ2A 5KG2A 4RD0A 5CXTA 2X6YA 1HWLA 3KKFA 3T6JA 2F63A 2R92A 2LMIA 3G6XA 3P45B 4ICLA 2VICA 3BJYA 3NEKA 3M3YC 4GQNA 2ASJA 2XYPB 1DD5A 5KT4A 3D67A 1RWWB 2HWIA 1Q1KA 4IOAQ 3EGZA 3RZDK 3ET6A 3PIPQ 4ZIVA 1TUIA 2LDYA 4I1TA 4DX6A 3PYGA 3ONQA 4QJVA 2R4FA 2RSQA 3H4BA 3A12A 2CFXA 3PVXA 3L3CA 3W65A 1RUSA 3H94A 3GU0A 3KLEA 4URSA 2FJWA 4C0OC 3N6NA 1ZM3A 4BWMA 7FDRA 3PW2A 1H74A 4OI3A 1KN6A 4GTCA 3DLGA 4O4GA 2XB2D 2HHPA 1RAAB 4FYYB 4PUOB 3PRVA 2GSOA 1KNZA 4N56A 3ZBTA 3CP8A 1TP7A 4HDHA 1F2GA 1LOUA 4YR2A 1C1BB 3I55B 4ETXA 1W34A 1R9TA 1RWPB 2EWHA 2JA6K 1HNVA 3R1HA 2VDHA 1OSDA 1S97A 3AXKA 2E2JK 2H4YB 1SJ3P 4A3JK 1H7WA 1GXTA 3JSRA 3IS9A 2K8GA 4N7TA 4NLOA 2YXLA 3QGGA 3CCQB 5KFMA 2XQCA 4P6YA 1NNDA 3CCVB 3KWMA 1FESA 3K5NA 4M94A 1HPZB 5EGYA 3HAGA 4P9SA 1D9AA 4BC9A 3FEYB 4F4YA 2HVZA 2WONB 2OSQA 4B3FX 1I3QA 2UXBF 3MMJA 5ETKA 2MSTA 2DRAA 1Q0NA 4WU3A 5F8MA 4R71A 5FL7A 4AYBD 4CDIA 4IO9Q 3M9MB 5KFEA 2VA2A 1FRJA 1F9FA 2GO9A 1IBMF 1LXNA 4BBRC 1DG1G 1FDAA 2APOA 2R93A 1VGXA 2XHCA 3HXMA 4ID5A 4ANCA 1VBKA 2UXDJ 4RPDA 2L9DA 3AVTA 1B4BA 2CPYA 3WIVA 2ZC4A 4BY1K 4TKOB 4WK3A 1KKHA 1OHHA 1VQNB 4RWWA 5IYNA 2OMLA 3HX9A 4XMYA 5DZ7A 3S6EA 3GV5B 3GTMA 2PMDA 3Q6QA 2EFPA 2BOPA 1ZTTA 5HBMA 4DCOB 4B9TA 3PNIA 4YG2A 4TMXA 2FVRA 4G1PA 1GAWA 2MKSA 2BQUA 1FJGJ 2P9GA 4DI6A 1IJEA 2CFAB 3F56A 4AH6A 3BPSP 2GIFA 2ADCA 5D15A 1MROA 2GQCA 1Y1WK 3OPOA 5ETLA 4C11B 3K8WA 2F3JA 2UVVA 2FY1A 2EFVA 3PW4A 4MIWA 1YI2B 4W4MA 1WCMC 4L3KA 3A8EA 3UR3C 2C3UA 4WP9A 2VG5B 2NVYA 3DYAB 2R8JA 1D3WA 3Q22A 1J6XA 1SJ1A 1I94J 2ZUGA 3A3NB 2ZH4A 3MOJB 4KO0A 2AIRB 1OY8A 1FWLA 5LM7E 4CLPA 1FA0A 2WRMA 2DNGA 2LEAA 3UD5A 4C8OA 1TKZA 2BGJA 1FTRA 1BWEA 5JMNA 1B4SA 4FZBA 1XJWB 3LTOA 5KFVA 4OPVA 2W7PA 1GTHA 1U4BA 4A3FK 1G51A 1SQEA 2H4WB 2I0XA 1WTHD 2AMCB 2BV3A 3RW6A 3M4XA 1V0FA 4CRJA 1YJ7A 4B3TF 2BMBA 2QFJA 3MEGA 3E20A 2N82B 2UVWA 2Q3PA 3BB5A 2EFOA 4LF8F 1B99A 1GFWB 3MCAA 1MWZA 1R3NA 4K4XA 1G7CB 2VQEJ 3UN2A 1YDLA 3H98A 4F67A 5J1EB 4XN3A 1F3VA 2VD3A 4ZA1A 3O3LA 4ZGNB 1FFWB 1QLNA 3RY8A 3NS7B 4DR6J 1VR6A 1XMOF 3OFHA 5IP7K 2JWNA 4X06A 3V76A 3W66A 4G6IA 3KLIB 3KJQB 2FGCA 2JJ4D 2VFUA 2HHVA 1ZTWA 4PR6A 3OZUA 2ABYA 1R27B 2R6HA 1FRXA 2UU9J 4QBUA 1RT5B 1CJKB 4NEYA 1QGAA 2CYYA 5KFKA 4HIZA 1WC4A 1RT1B 4A46A 3QLHB 2JEIA 5I42A 1WDDA 4IDKA 2AYGA 1PIEA 5F8GA 3J81k 2VKZG 4DV1F 3P8BB 5C4JK 2ZH9A 4DN0A 2YWFA 3EXYA 1D9FA 4QYRA 4NLGA 1IKWB 3VHQA 2VBWA 3M6WA 2V94A 4JB8B 2QGGA 4IG0B 4QWEA 1NJIT 1M5KC 2O1PA 3NNHA 3MM6A 4N8OA 2VJIA 3S1TA 4C3IC 1CNEA 5FO1A 5LMUJ 1UD8A 2ZEJA 5J2PA 1HNIB 1C2PA 3NGUA 2V2ZA 4DMZA 3GTGC 4HTIA 2FPHX 1LWCA 2NZCA 1SUQA 2R7QA 4LR7A 4KE5A 1IWGA 3OBIA 3Q86A 2O66A 5KFCA 4MH8A 4EZ6A 1APSA 3T1HJ 1GE9A 3OT9A 3DDNA 1KVJA 4Q7JB 2YKAA 1JWWA 1HKAA 1B7FA 2RC5A 4RUHA 4QIVA 3SXLA 1P9QC 4ZP7A 3H3VD 1TWAK 5A2QY 4FK8A 2ZTNA 2C2OB 2NSCA 1YJNB 1HBMA 3CCJS 2R9VA 3J7Z5 1QE1B 2D3UA 1CS4A 7AT1B 4ALZA 3FKIK 3KG1A 1NK8A 2ZZFA 1KBRA 1J6WA 1ROFA 2POKA 4S0MA 4R8UB 2DIEA 2Q79A 1AUSL 4LBYA 2DK2A 2GJPA 3WNDA 3D0GE 2HQFA 1XXBA 1DLOB 1HFEL 3CCMS 2ZBIA 1KWMA 4ES1A 3FJ2A 3UR0A 2GPJA 3OV7A 4JI4J 1S79A 2IBOA 3G6ES 5ETPA 1TWFC 3HOZK 4TT3A 2CQGA 1RT4B 4RMFA 1RI7A 3BPDA 1RKJA 2UV8G 1H8HA 3WQZA 5E3AA 4Q45A 4DUYJ 1F1BB 2LDIA 4OZ1A 5DQIA 1BQEA 1KQ4A 4OI1A 1DCHA 2YKPA 2D3NA 2RMLA 3AT1B 2L3MA 2XI2A 5DGAA 1YGYA 2X3DA 4D3GA 2JRSA 3S14K 3FCHA 3T1AA 5F4MA 4UY85 4ITSA 1OS5A 4P26A 2MMYA 4FNHA 2C3MA 3POTB 3M05A 1M5VC 1CULA 3BKUA 3OVAA 4EO6A 1O27A 1YRXA 3JTPA 2ACMA 4KARA 3UQSA 3ZPNA 3DHWC 3ASRA 3H7HB 3GJQB 1FVQA 4QIFA 5FJ4A 4UQTA 1D1UA 5F4JA 2V2QA 4NYOA 1VBZA 4TYBA 3B4MA 1ZM2A 2CPZA 4ERDA 4RWXA 1VQ7B 3ZO7A 4WK1A 3VAMA 3QIPB 2E7WA 4ZHRB 4GFQA 5H9EJ 3PW7A 3B82A 4A3KK 3EDRB 2CQPA 4BY7C 1ZS6A 3BYRA 3UN5A 1R5NA 3GSDA 2E1RA 3H0GK 2MB0B 2ZBQA 1FERA 3LWLA 3CCZA 1VS3A 3GFYA 5D6GA 5BR8J 3Q23A 2YKQA 2DHGA 4C48A 2XS7A 3VGUA 4C3MA 1JJHA 3GTOK 3R3TA 2CAJA 4LFBF 1LEOA 2BJDA 3FC9A 3D7SB 2EBGA 1UL3A 4DSFA 2OK8A 4PG6A 3M8RA 3ILIA 4L73A 2V7WA 1RWVB 4KMHA 1RLDA 4ZIWA 3ZZ0A 5FD1A 2QSFA 1WPCA 4NLSA 4RNFA 2MQ8A 4M1KA 2P5MA 3AOBA 2JNJA 1WG4A 4ED2A 4P6QA 4USUA 4DR4F 3HFVA 3DM2B 2IYGA 5FJ8K 1DQAA 5TMCA 2W2PP 2R9LA 3LP1B 1JLBB 2NR0A 1PJ7A 3OP1A 2ZOFA 3C14B 1NPRA 1I7PA 4ED4A 3ISND 1OYEA 2BMWA 3GTGA 2Z58B 5D0RA 1TUVA 1ZZFA 4A3GK 3HZEA 1AMOA 2XO7A 4LF5F 1S48A 1SH3A 3W9HA 2CJQA 3MPDA 5K20B 2QMUB 2MZQA 1EFUA 4K7QA 2RF2A 4F50A 3K5PA 3T1YJ 1H2TZ 3NUHA 3UWTA 4NXNJ 1N0UA 3WIUA 4X62F 3V6JA 1S5ZA 4NLYA 3IN5A 1HWUA 5EHHA 4PG5A 1NK9A 3SLDA 2HHUA 3ETOA 3G2XA 1XMQJ 5CDFA 1UWAA 3OW2R 3BKFA 5IYQA 1JMTA 3NG8A 2B51A 3MMBB 2XZOA 3RTVA 2HAFA 2FYXA 4WE1A 2NVXA 4P25A 4WPAA 4F0MA 4KV8B 5IXUA 3I5BA 1TV6A 3GTYX 1FCAA 2JJ1A 1U2FA 3RBDA 3LGMA 1WEYA 2RQCA 3GJRB 3CMAS 1TWFA 3DDIA 1DBDA 3CCWA 1FDNA 2WZ1A 1O2AA 2RDIA 2GIQA 1L3TA 3HOXK 4DV6J 1NB7A 3DLJA 5AE1A 2MQPA 4WIQA 5F8NA 2OEMA 2P6TA 4QPXA 2X53S 2C42A 1RWOB 3DYAA 4DR5J 1D8ZA 4DSKA 3B78A 1N08A 4WZLA 5DG8A 3RB0A 4H9GA 3E01A 1TWHC 3KLHA 4Y52C 1IN0A 4BPRA 3GEIA 4DG1A 1U48A 2R7WA 2P9CA 4LMZA 4OJ3A 2COLA 2E29A 3ZZYA 3AY0A 3QATA 3HJFA 5H9FJ 2HQCA 5KT6A 2RH6A 1WOPA 1Y3KA 2HNZA 1ACMB 3QYYA 2YPYA 3BGRB 2HFVA 2V4RA 4FF4A 4CLUA 3OKXA 2CQ0A 4LSLB 1URRA 1MMLA 3SFUA 4GKKJ 2O5IA 2IJRA 1RLCL 1R8AA 1EXMA 1Z2LA 2RQ4A 4M5KA 2KT5A 1DDIA 4NLTA 3FUYA 1H85A 5IQQA 5HZAA 1BLUA 1Q7LB 1S9GB 1GXUA 1N0VC 2XMKA 1YBUA 3K2YA 1I8DA 2IAJA 4DR7J 4DPUA 2HGLA 4WZKA 4OJHA 4B48A 4IR9A 2BOAA 3OOCA 3HI9A 1PKVA 3G6YA 1BGXT 4NE9C 3PFOA 4LIRA 4K8RA 2B5JA 2A18A 3KLIA 1QUFA 1Q82D 4C8LA 2DNNA 2VHGA 4YN3B 3I56S 3AD9C 5DM7Q 2Q1LA 2W4CA 2GJIA 4PWDA 2ZOGA 3M6XA 5KOXA 1CJKA 5F8HA 4Y7NC 4ENOA 4DX7A 3GR0A 5DDRC 4NMXA 1Y5IB 3W5ZA 1COWA 2DGWA 2JEGA 2LEPA 4IKAA 3BZQA 3PJXA 1W25A 4ED5A 3RAQA 2GMLA 4NA2A 4LQ3A 3NLCA 4P3YA 3VZHA 1IKWA 2CPFA 2ROPA 4TVAB 2M9KA 3UCGA 4PYAA 4USMA 1IS1A 2H5IB 2KO1A 4BDPA 3FMWA 5KT3A 3MM9A 1KC8T 2JA5C 3SEJA 1W2BB 1RTZA 1CJTB 4ZITA 2V34A 4OX9J 2DCUB 5ETQA 1RSCA 4K1XA 5J2QB 2W7OA 1USOA 4M5DA 1SJ4P 2CVEA 1QH0A 3JQPA 5E41A 3MCNA 2C77A 3MFHA 1RWKB 5DM6Q 5KW9A 1JKHB 2HQDA 5GADU 4IRDA 4KBIA 3KHHA 1L5UA 2B0GA 2CIMA 5HAOA 5D78A 2YWWA 2KG0A 1M0SA 2VG7B 3QX3A 1EAYC 3FFIB 4IH7A 3GIMA 2ZE2A 4DQLA 4CQJA 4CLZA 3QFWA 3QSYB 2DOGA 4ETZA 4TMVA 2UUAJ 4OYAA 1NK7A 4FF3A 2OD4A 1BE4A 3N9UC 5ITHA 2Y1IA 3GMGA 1Q16B 4YAOA 3M8PA 4B9LA 3D2WA 2WAQL 1IM4A 3J80U 3PYDA 5KFRA 1HQUB 2OPQA 4RLZA 5ETNA 5KT7A 2C78A 2VFTA 1RT2A 2HK2A 4HEA9 4R8UA 3D0IE 1PKUA 3Q8YA 5E3RA 3WBJA 5KT5A 1WKJA 2DNLA 4YDXA 1KTQA 1W7WA 1EZZB 1N34J 1FNOA 1DLOA 3I87A 1QUEA 2BKNA 4HI2A 3C6TA 3W61A 2YNHB 1SJQA 2P2CB 3D28A 1ZA2B 2XEXA 7FD1A 4NOHA 1VHIA 4P73A 5K8MA 2ZH1A 2FQTA 1CEZA 3LP0B 4A8MP 3TI0A 2ILYA 3AVUA 1ZUNB 2GQFA 5B7WA 1EWYA 1F60B 2M7SA 1RA6A 1Q81D 5CD4H 1L3UA 3H5XA 4N8NA 5DQGA 4B4DA 4DSJA 1TWHA 1SL1A 3OUYA 2B9YA 3GG0A 3D66A 1FD2A 2VBXA 3DRRB 3HHLD 4HT7A 4LF6J 3R5JB 5HANA 2V2KA 5HQLA 1SJRA 4WIIA 1IVZA 5IZHA 4M5MA 4DN9A 3MMLB 4V19J 3DLBA 4OJ1A 2V4JB 4JI2F 1ZPVA 3POTA 5IP9C 1TAUA 1BX0A 1M5SA 4OI2A 5ETOA 1IBLJ 2UZAA 2PN6A 4U6PA 2AP6A 4TY8B 3G05A 2HZVA 3QPIA 2DHAA 5E2QA 1BQNA 2WOMB 1J27A 3MEEA 1N5YA 3UE2A 2PIAA 4KM8A 1FKPB 1Q8BA 4QCLA 2KRRA 2B4PA 2YH0A 3TAPA 4ZHRA 3BKTA 1CC7A 4Y9RA 1F20A 1R0CB 3EGNA 3MPWA 1FXLA 3ES9A 1UKUA 2ZUAA 4JBCA 2DHHA 4MIBA 4Y2MA 2ZH3A 2KJWA 1M1GA 2G0IA 2B7BB 1B0TA 2I6WA 3L4BC 5B09A 1IBAA 2RNEA 1IXKA 2XS2A 3CMEB 4GVLA 4J9LA 2PE8A 1FJEB 2UUBJ 4NWBA 1SKUB 4J9VA 2IRXA 4ZVHA 1V3RA 2WTFA 3GVKA 5AN9A 3R6KA 1G3OA 3JXOA 4FVCA 1NJXA 2J8SA 1I94F 1DARA 1S6PA 3Q8SB 3P5TL 3Q2TC 1NKCA 3AQOA 2UUWA 2PD1A 3CJ3A 2VG6A 2V7UA 2BQ3A 1W35A 2OELA 3CJQA 4P5BA 3GTPC 4ZOSA 2ASDA 2HVIA 1RAEB 2P3MA 2LP4A 4C0BA 3T5LA 3TFJA 3QRRA 4U9UA 3CC4S 4KFBA 2ZM6F 3WHIA 1RT3B 4DQKA 3DM2A 2NZ4A 3LVBA 3OXLA 5IYWA 1HBUB 1UVLA 1J2VA 4DBQA 2DPJA 2JA5A 1EP2B 2ZD1B 5KG6A 6FDRA 2AQ4A 3CCTA 3MMCA 5IC6B 4CWBA 2AGQA 3IMQJ 3NBPA 5D0EA 3HOUC 4HACB 4FYDA 2M8HA 3M7VA 3CULA 3S2DK 4AL5A 2PMHA 4MTPA 1I6JA 2BVZA 1FJ7A 1U8WA 3US5A 1TUGB 2E7VA 1OQ6A 2DNPA 1J5EJ 3SBMA 2V7VA 4H4OB 4UUXA 3LO8A 3U1LA 4NMLA 3WNBA 4QOTA 3PW5A 3ZZUA 3PO2K 2C2DA 1BXNA 3SSSA 1MN7A 1UMKA 5CZVA 3W64A 2QTWA 3GILA 3KJFB 2L08A 4GKJJ 4XNFA 2IA6A 3L7PA 4QQBA 1G2EA 1G6BA 3HOVC 4ASUA 4LFCJ 3QO9B 3ZFVA 2C28A 2KB2A 5M3FK 2DPIA 3S1MC 1NPKA 3VV2B 3GTLC 4RBTA 2Q6CA 3D0HE 3MMBA 2W2QP 3VF0B 3VO2A 4OMFG 4M8LA 3AVXA 2ZBCA 4X64F 3I0SA 5F3ZA 4YALA 4ER8A 3Q8UA 3GV7B 1N33F 4HHHA 1A6LA 2VZ9A 2C3YA 3Q2SC 4KPYA 1KFDA 5LSRA 2VFSA 3TVKA 1FF2A 3CJ0A 5I3QA 2K7JA 1QTMA 2F4VF 1S12A 3U1NA 2J5AA 3BH6B 2XWYA 4XN0A 2OFGX 2QMWA 1AA1B 1OIAA 5CYJA 1LWEA 2EPIA 3HFZB 2YX7A 4RUAA 5C3EK 1KEKA 2R7ZC 2Q6BA 4OYBA 2WSEC 3TNVA 4YAFA 4QWBA 3IAS9 2Z30B 3M2VB 4K0KJ 2XMMA 1FK9B 5IORA 5C25B 4DCJB 2A0FB 4P2NA 1Q82T 4YXWA 3CCVS 1T9WA 3MR2A 4M0LA 3TFIA 4GTDA 4O23A 2OYNA 1E6VB 3PYFA 4J9NA 4O44A 4QFMA 2PE3A 3PYEA 4X7DA 2CJBA 2KXNB 2IHR1 2JZ5A 4TYAA 3J81j 1DZ5A 4QPTA 2V4QA 1TAQA 1IKVB 2BYCA 1DTQB 3I0RA 1DFDA 5TRDA 1D0EA 1QAXA 3BGRA 3LOUA 2OJ3A 3SIPB 1UP1A 4XD7A 4ECQA 1R5OA 4ZN1A 4HYKA 4B3RJ 1NSQA 1IB0A 2GHVC 1N5VA 4FN5A 2C2WA 1E1RA 3FSIA 4Y65A 4LC0A 3BQ2A 2NS1B 4ED3A 4IRCA 1QVGB 1HR0J 3OZWA 4XOTA 2DEIA 2RS8A 4Y9UA 3A8KA 3GQCA 1XXCA 2QLJB 1VQ9S 2WW4A 1E62A 3SV3A 3H4DA 1WG1A 3P27A 3CB4A 1CJVA 1CQMA 3TYTA 2VZLA 4KRWA 5HMYA 1TK5A 4JYAF 5F9NA 1FFSB 3F41A 2GSUA 4DZDA 1IKYB 2XNCA 3K17A 3GTPA 4J9KA 1RKIA 3LPYA 2CPHA 3CCSS 4QW9A 4LR2A 4KSEB 4IUFA 3MAQA 2F7VA 2JFDA 1AB4A 4OZNA 2ZH5A 4DNTB 4ZLNA 3ZTSA 3MEDA 3TARA 2XZTB 1TVRB 3I1FA 5THWA 1RQRA 5FLXU 1DTTB 3D1HA 1N07A 1VLYA 1SH0A 1R0AA 4Q4ZA 3HVTB 2Y3PA 2RVJA 3HHKA 2WJVA 2JC0A 3MTJA 2XNRA 3QT5A 1RDRA 3NAIA 4X4UA 3CJ4A 2B4UA 3RRKA 3OHBA 3FZ2A 3LH2S 2UV8A 4ZKAA 2NLWA 1CJTA 1EX8A 2F4FA 4P12A 4Z4YA 4XOPA 2MGZA 4LLGA 1OSCA 1P8GA 3PEJA 2KHDA 3NWGA 1Q4RA 1N56A 5CYQA 4OYZA 2B63K 4TNOA 1NRKA 4DPWA 3MM8B 4CTAA 1FKAF 5HJXA 1KDNA 2DKOB 3RU0A 2YNFB 4DV4F 2KWAA 4AUKA 4FF1A 2Q66A 4KGKA 3FFIA 3PJWA 1CC8A 4F04B 1HWJA 3LQVA 3RZDC 4PC6A 3GTLA 3TW0A 2W7AA 3G4AA 1EP3B 2RD5C 4F2SA 1TMMA 2GAGC 3KK3B 2YNGA 4IYQA 1WELA 1XWLA 2R42A 3S0XA 4G0WA 3S15K 1UPPA 4RL1A 3U2QA 3R6GB 2E5LJ 2R7UA 4ECTA 2VUMC 3IBFB 1ZAVA 4QR2A 1I50K 3S2HK 1YCLA 5K9FA 4AF7A 4FDFA 2HW3A 1Q8IA 2JA6C 1P4MA 1NHVA 4JI0F 1V6HA 2GMJA 2KYXA 4YELA 4LBIA 2KZMA 1O6XA 2R7ZA 1JNRB 3UDCA 1NCLA 4P2FA 3PR4A 4F3OA 3ZZTA 5C2GA 3WNCA 4MYTA 2OO4A 2XG8A 4DCPB 1NK6A 3CMMA 4FPRA 2QA1A 2QA4B 1RCOB 4EBCA 2RHSB 3MM5B 1RQ0A 3GTKC 3VALA 1YJWB 1VK8A 3ZTRA 5FLMK 4M2LA 1B4AA 2G0CA 2HCJB 1SCJB 3IBCB 2F1FA 1F3FA 2V4JA 4CM2A 1YK9A 1M5OC 2ROGA 5D4LA 2B7CA 1PGZA 1C4AA 3BR9A 1DCOA 1L0WA 1N4LA 4OZLA 2YKNA 4HT5A 3OL8A 2KKHA 2W1BA 4JI3F 2CKWA 5D0GA 2NXCA 1WTBA 3ENVA 1OGIA 2WOMA 1H42A 1VI7A 4BXXC 5A8AA 4ZVGA 5GAEU 1U1OA 3IR7B 4DV5F 2N3OA 2AEMA 2Z8QA 3KK1A 1EQRA 1DQ8A 4KY3A 4TU9A 3OTOJ 4IW3B 2XYHB 1SI9A 4G6VB 3ILJA 1YJNS 3W2FA 1Y10A 4KPCA 2C5BA 3DMJA 4PPDA 1WOSA 2Z6BD 1K0TA 3ZZZA 4LUBA 2G1HA 4CH7A 4MFBA 3PV8A 4ZVFA 1ZYQA 4OP7A 3VVUA 1MMNA 3MAHA 3RZAA 5H59A 4WTYA 3S01A 4JI7F 3KUEA 1KFSA 1HYSB 4UZCA 4L8JA 1F7VA 4KATA 5A89A 3K7AK 4LVNP 4LRAA 3PUMA 3NS6A 1X9WA 2GIRA 4X84A 4A3BC 5CHCB 4WFAQ 3I4NK 3FBCA 1LW2B 4G0VA 2V69A 2E2IK 4OIOA 1U1KA 1RU0A 4OI4A 2FJDB 3ASQA 2F4NA 4F4KA 4A3LK 3J80Y 1G1XA 2H48B 1R43A 2HVDA 1T9TA 1Z1ZA 2DO0A 2DHSA 1TZ0A 3OL9A 3HZGA 2FVPA 2VQFF 1SXLA 2LVWA 4GKKF 1USMA 4A3FC 1WOOA 3DI6B 2RKIA 1FNMA 4MEYA 2IM2A 1XR7A 4DV0F 2RUGA 2ATLA 3BGOP 2BJ7A 3CNQP 4X4TA 3CCES 1WU8A 1X5OA 3T5JA 3LNNA 2YWEA 2HRYA 3BO4A 2WSSA 1FT8A 5H9EK 2C2KB 2WJYA 3AVVA 1RAJA 1Q53A 1LFPA 3R2DJ 2NVQK 2M52A 3SSRA 2BJ1A 3BR8A 3W2VA 2ZXHA 4KH1B 5IYCK 3HSDA 3E51A 8ATCB 4JI6J 4GTEA 4WZQA 3CCJB 1IKXB 3LPEA 2DR8A 4Z4WA 3T9NA 4DNRB 3NE5B 4AQYJ 4PXEA 2KRBA 1U1PA 5IP7C 3NOCA 5F9LA 1KVIA 4DPOA 2QC3A 5CYMA 3CCMB 1EP4B 2PPBA 2PLFA 3QGPA 4IH5A 1H8EA 2ZHAA 1WDTA 4NLPA 3N0BA 2VUMA 1X60A 4RU2A 1FHTA 2BXJA 3TEHB 4AXIA 2GQQA 3FZBA 4DK0A 1Y1VA 2XI3A 3G6EB 3DN9A 2BDPA 1O2BA 5E0OA 3IR6B 2ZITA 4C2MC 3R97A 1YNJA 2VNIA 3K7RA 5IYBK 2KFNA 3FBFA 4WXOA 4ZPVR 4O3QA 2HDNB 2VOPA 4IRKA 3E3XA 4WKRA 3EQLA 3UDEA 5HROB 2R92K 1Y4ZB 3HCXA 3GTKA 4PKDB 1EH1A 4J91A 3RBXA 2K7KA 1TU0B 3NGSA 1WC0A 2CQBA 1AB8A 1TKXA 4DV7J 5B08A 2A2CA 4LREA 3M2VA 1FK9A 4O3RA 1RCXB 5CD4A 3OJXA 3HOWK 4OOVA 1IR2A 2D6FC 1W0KA 1YVFA 1YLXA 4XPCA 4WYLA 2ERRA 4OX8A 1HNZF 2PA3A 3R7SB 5GVQA 2JIZA 3N5FA 3S1NK 1QAYA 3EPIA 1H72C 1S1TB 1DTQA 3RAXA 1Y7PA 3OEHA 4DUZF 2CC2A 2HFZA 1VISA 1HI0P 3VAKA 3RZOK 3MD3A 4II3A 3OPKA 3CCUB 2BUNA 2CQ1A 2D3LA 1V9OA 4FXWA 3D68A 2R7OA 1VF7A 2PMZL 4YAUA 1R9TK 1HHSA 3DGPB 3C16B 1K8AT 4CO0A 1AIPA 4YHHF 2DGUA 3BH4A 2QEXB 1PYTA 3JTNA 3IC1A 2A6EA 4EUVA 4EO8A 5ADZA 3ITHA 2EKYA 4A8QA 1YJRA 5LXYA 2AV5A 3NRBA 3CT9A 5EMNA 2WCXA 3VZIA 1D09B 1Q8KA 5IT9U 4OYOA 3Q6RA 3DLEB 1AZSB 2MQLA 3L4KA 3HOZC 4TLRA 5B0EA 4K4WA 4WFBQ 1I3QK 2OGUA 2OPPB 1Y5NB 1GK8A 1MSWD 2K1RB 2UUTA 4C8NA 2MY7A 1JJ2B 4QIWL 2ZVIA 2EI5A 2KM8C 2R93K 3S14C 4PWWA 1TVRA 2P8TA 1NH7A 2FGOA 3GVLA 3A1PA 1HBNB 2A3JA 2B6AB 2VF3A 3EM1A 3WXMA 1QVFR 1IWAA 1F5BA 4LF1A 2GO8A 4JUZA 1VC0A 3GTMK 3IP0A 3LQ6A 1HI9A 3DDKA 2W2MP 3UPFA 2AEFA 1SL2A 2E5HA 4WZEA 2K3KA 1G4CA 2AJ0A 4A4JA 4OYIA 4ZCLA 2CNLB 5IK2A 3HK2A 1T05A 4DZ6A 1ICEB 3EUNA 1B64A 4FYXB 2CNDA 5B0GA 4LOWA 2Z2LA 1YHQB 5IOSA 2MZJA 3I5CA 3MPYA 2O5DA 4RLEA 2SXLA 4JV1A 2DISA 2CBXA 2PFDA 4DJBA 4KN4A 5F8LA 4BHQA 2GJKA 2FUG9 1UAWA 4PC7A 3SEOA 1IBKJ 3CC7B 2QZ8A 4LR8A 4J5OA 1NK5A 4DSIA 2J7UA 4QJVB 3IRXA 2NVYK 2WVDA 3H20A 3W60A 4USKA 2NVTK 4QU7A 5IT4A 3KLEB 1YJVA 3CESA 4ANEA 2HVHA 3GR1A 1WD6A 4C2MA 4QWCA 2UP1A 2ZH2A 3DLGB 3IRWP 4A3CC 2CPJA 3N0CA 1RB0A 3OJWA 3T6BA 1BQMB 3THPA 1FRIA 4TU7A 3HD2A 1S77D 3J7YI 4DR1F 4JV5F 4WBFA 1JNYA 3TVZA 1YTYA 3Q38A 3KHLA 3RG6A 4D3HA 3FOFA 2XMJA 3EGVA 2PSZA 3IS9B 3QWUA 4ZLLA 3M3YK 2A10A 4M5GA 4CYUA 1QGYA 2P9EA 1YJ9S 5A8KA 1R7IA 5GV7A 1QG0A 3MM5A 2JA8C 3P26A 4BLAA 2VH7A 5KFZA 2C3OA 1T94A 3CDBA 2Y8WA 5IWAJ 4F26A 4MKBA 2C2ZB 2R3VA 4ID5B 2HK3A 5AE3A 4KHPJ 2E2HA 3JSBA 4B3MJ 3EZOA 5GAGI 5FLXY 4K4SA 1WHYA 3CJKB 4DQPA 2V8PA 4JI5J 4OV6A 2IA0A 3FRZA 5AE2A 1AFIA 2DHXA 2YKMA 1FWKA 4OZ5A 5L46A 2OHDA 3CC2B 3EE3A 5EGEA 2D9RA 3HHLB 3G8QA 2ZTGA 3VAHA 4N76A 4X7FA 2XSJB 3LGHA 4MKVA 2I2YA 4RD1A 3V2UC 1MROB 1VQOS 3W63A 5HXBA 4FBUA 4YEJA 2H1YA 1TTHB 2JHEA 2V6SA 2YWGA 4YHBA 3BCDA 1Y9OA 3O5TB 2WVBA 1QJHA 3HF5A 2GZOA 1TR0A 1DJ0A 5KFYA 2IY5B 2MJUA 4F0HA 1KD1D 4IFVA 4BBRK 3OFFA 2BVNA 4UOHA 3KLVA 2MDAA 3LQEA 2HGNA 2BR0A 1UJ5A 1XFOA 3V6HA 4KO0B 2WK4A 4KKUA 4DV3J 4Q2LA 3VMFA 1N52B 3KG0A 2VV5A 3W7BA 4ZPTR 1TKZB 5C44C 3EVOA 2OBTA 2N7YA 2EXUA 5KFDA 1RJJA 3HKZD 3VVTA 3MCOA 3CQZC 1V0EA 3UVJA 1RK8A 1VCTA 2YQ3A 4OZ3A 8AT1B 1RHRB 1GR1A 3G4SB 3LO3A 1NU4A 2YKOA 3MEGB 1VQ8S 5E3QA 2M3DA 3ZTPA 4CH0S 4Z4VA 3TWZA 1VQ6S 5IYDC 4P74A 3MR5A 5JVGQ 3Q39A 3V5RA 2CK3A 4YB5A 1X4AA 4M5JA 2CJXB 5FA6A 1JJ2R 2OEKA 2MKYA 1PSDA 2NUHA 4AYBL 4IOCQ 2FC8A 3T51B 3G6VA 4ZS6A 4EYIB 3NMAA 1ZM9A 3CEDA 5LMZA 4NXMJ 4OZJA 4GTAA 4ECYA 3GYXB 4LF2A 3GFXA 3WBKA 1URNA 3N3YA 4NBSA 3CMES 4XLHA 1GAQA 4G1QA 2VBYA 1EP4A 4JI1F 2XLJA 3MCMA 1OB2A 4QHYA 4X66F 1NEEA 1FRNA 1GX5A 4WP3A 3FPKA 2N3LA 2OTJB 5GMEA 4YY3J 2WSFC 3CMQA 4IDKB 2IM1A 3ICLA 2V63A 3JAMU 3BSAA 3N6LA 4ROXA 2Z57B 3DRPB 1UV7A 3PHTA 2JX2A 3O1LA 3KLFB 2EFQA 3IGNA 4RPBA 5CQGA 3JB9k 1VQYA 3QGHA 2HHHJ 1AW0A 4K2XA 1T9VA 2DO4A 1B3TA 2AW0A 2HNYA 5L9XA 1TWGC 4J9QA 1E3ZA 1ZZNA 4ZPDA 2ZXIA 3KK2B 3A1YG 2VL1A 1UEUA 2E9TA 3R7BB 1D8YA 4ZH4A 3G71B 3CO9A 2AGPA 1RQPA 1S6UA 1NKBA 1S57A 1QSYA 2R7TA 4GO5X 2HURA 3ONYA 2Q43A 2MXYA 3R7NB 4MK8A 4AFFA 2RIJA 2WPDA 3ILOA 2V9KA 4ZVRB 3X3UA 1FDRA 2FQQB 4C3HK 4LF4J 2PA8D 4QIEA 4A8XA 2QLXA 1T03A 3THTA 1Q7YD 5ETVA 5DQHA 5KG1A 1SH2A 4YQWA 1C4CA 2VODA 1CS4B 3BGUA 3T3FA 2IFXA 4B9NA 4RD2A 5AXNA 3JSMA 5M2RA 2BGIA 3C16A 4JMQA 4ACAA 3AQPA 2FJBB 3M2RB 4J9UE 4DX8H 3MZIA 4C3IK 3KG4A 1EIYB 2XTJP 1Q5VA 3HHLC 1VDHA 2HBQB 2IBKA 3TA0A 1VQKS 1GMWA 2Y0SD 3SQOP 3PR5B 3GTGK 3H2UB 2G13A 4ZVEA 3OLBA 2AU0A 4NRUA 5HZBA 2RJZA 3KHRA 1WQGA 2DXEA 1S49A 1AZSA 4KGXB 2VNJA 2J8AA 3W8GA 3ADAC 1S6QA 3BV8A 3N6MA 2RDDA 5KFPA 2XO6A 3VR6A 5DDQC 1KLNA 3P3DA 2HMIB 2MJNA 1QM9A 2BM1A 1IUJA 2B3TB 4ZCIA 4G7WA 3ISXA 2K1RA 4EU0A 1VFJA 1QFZA 3MURP 2QLFB 5SZTA 3PRBA 4A3DK 2HHWA 2IJNA 2XMUA 2VYQA 2VJUA 3CQZA 1VQMS 1Q5YA 1HWKA 2Y1LB 4ZVTB 3AD8C 3P96A 2BE7D 4ZPBA 3HOYC 1INNA 5ETRA 4CO3A 1X5SA 2W2OP 3OVSA 4HL9A 4RBUA 1YSJA 3CCLB 4L72B 2B6AA 5K8OA 1PJ6A 3WODA 3N01A 1FE0A 1KK2A 2NVXK 3M1VB 2AF6A 4C43A 4WWVA 5JUMA 1TK8A 4MYUA 2V6AA 5JBQA 1U0HB 4J9MA 2W9BA 2VPYB 4MMOA 3BGLA 1JOEA 4V19X 2FVGA 2ZC3A 2H65B 2B56A 4LFAJ 3I5AA 1O28A 1TWFK 3UO0A 5JJBA 3H90A 4ATNA 3V6DB 3QE2A 4G7OA 4N41A 4NCNA 2QSWA 2R2UA 4WZTA 3DU5A 3D4JA 1OPIA 1YKWA 2GK6A 1WF0A 2HYIB 3TZZA 2DY1A 2ZWPA 2WB4A 2FLNA 3JYTA 4A8WA 3GIKA 1KHWA 4C8ZA 3I4MC 4NCBA 4MAKA 2JA7C 4ILDA 4LSNA 4PG8A 3H3VL 2IVYA 2I38A 2CRVA 3KJVA 1M90T 4TQSA 2JSXA 1XNRJ 2OPRB 1U1LA 3HT0A 3TX8A 4HE6A 1E3XA 3VCDA 2EFNA 4G65A 3HJVA 2B5OA 2J0WA 4BBSC 1NHUA 5F0UA 4V1Ak 1SKRA 1HI1A 1BQMA 3A4TA 4OV1A 1WF2A 2QTLA 5HVHA 2QX0A 4Y0FA 2DETA 4A8OA 3H9NA 2E1MC 5J2NB 3BN7A 4QUZA 3HMJG 1TWGA 2WBRA 1P6TA 2YVSA 3K5LA 5EWGA 1LWXA 5IOTA 3HVRA 4JK1A 5B0DA 2XY6A 3OFNA 4NYZA 1JXLA 1U47A 5IT9Y 2FC9A 1PYSB 3OW7A 3R5DA 4F0KA 3S2DC 4XO0A 4I56A 2KXFA 4F8RA 1SKQA 2BJEA 2IDLA 2ZZMA 4QV2A 2RF2B 1VBXA 2CQ3A 2QA2A 2PT0A 1O2FB 2H5JB 1K47A 3PO2C 2LQJA 1R5BA 5DG9A 1KD1T 5GADI 3WC2A 4B9MA 3KFWX 1BC6A 4B43A 4DDQA 2W9AA 2H3EB 3GLJA 3FBBA 1IBCB 3KLGA 4G7ZA 2B4OA 2DEJA 3CJKA 2VJVA 1UVKA 3OREA 1VQLB 2G0JA 2OBSA 4WE1B 2PFFB 1N48A 1CSJA 1J98A 4M63A 4RW7B 5KFBA 3GZ7A 3GYGA 1RHJB 3QT7A 1TV6B 5T7LA 3H0PA 1VQ9B 4DS5A 3CW2A 4KC6A 3BO2A 2JJ2A 3HHLA 1MNEA 1CVJA 2J9EA 2LQBA 1X5PA 2W6IA 1WHVA 1SBRA 1H73A 3A13A 4ZVUB 1N5TA 1ZAXA 3BNWA 2GHPA 4X05A 2XSJA 3K8VA 4RD6A 2MY8A 4EBEA 4ED6A 4DFKA 2HMAA 4RNMA 2EG2A 4WJ3M 1S4FA 4DLEA 3CCSB 2MPUA 5TV2A 4BC7A 4ILLA 4LRDA 4PC3A 4LJMA 3J7ZT 4ECSA 5IYPA 5H1SV 4GTLA 3DXSX 2PC6A 2QL5B 4YB7A 1BJTA 1NB2A 1QAJA 1WSRA 1UWBB 3C15A 2GCFA 2UXBJ 1RADB 2XULA 2J0SD 2Y0BB 3E01B 2XCRB 3KLHB 1RHKB 1VHEA 4OOSA 4P71A 4DG1B 3EYZA 1YIJB 3IXQA 1F9HA 5B0FA 2QA4S 3JSYA 1N5SA 4G3IA 4DQRA 1IBMJ 1YJWS 3QRQA 5KNLA 1MW7A 1SV5B 2W7VA 2AGOA 2HNZB 4KMDA 1UTAA 3PJ9A 4DFPA 1RTIA 1HHQA 5J2MA 3BM7A 4LR9A 3PX0A 5IV4A 4NLRA 1Q8LA 3M4OC 2GK7A 1RXOB 4PPZA 2DNMA 1FTCA 2V2VA 4R0JA 1TL1A 1MLAA 4A47A 4KKSA 4OLPA 4E0DA 1NB9A 2GJ2A 2H54B 4ZVPB 4GC6A 1R8CA 3FEXB 3FQLA 5BJRA 3ENAA 4C3JC 2GQ2A 4NRTA 4CLSA 1P1TA 1PAUB 4UY8T 2KN4A 2IAJB 2GREA 1K9MT 4DL6A 5E68A 1MN9A 2BW7A 1YRUA 1UD6A 4YB6A 4X4SA 4OJGA 2HHXA 4OZ2A 2RRNA 3CIZA 3KUGA 3EXCX 4AT1B 3K0JA 4QWAA 1S99A 2JA7A 2XNDA 5E7OB 2HZCA 3WY9A 4X0CA 1EHWA 2B5JB 1TWHK 4ZP6A 2HHQA 2V4DA 3I9V9 3U02A 4Y52K 4OIPA 4PG7A 3W2WA 3KEWA 2PEHA 2OAUA 1WORA 3RYLA 2DT9A 3AGQA 1HD1A 3A35A 4PWDB 3AGPA 1SVDA 1VRUA 1T8EA 2F9JA 4FKXA 3RB4A 2RE1A 2RQMA 2B9WA 4DUTA 5JVHQ 3EX7B 5L1KA 4KM9A 1N54B 1Q79A 1Q7YT 1NDLA 5KG3A 2XCQA 4P3IA 3DRPA 3OW2B 5T41A 4A3EK 3KLFA 4RW4A 2DGVA 1SKYB 1JA1A 2MKIA 4G1BA 2V68A 2A69A 2AJQA 2D69A 4IFYB 4B3TJ 2D41A 3MM9B 4LIWA 3TA2A 2CDQA 2NYIA 4LF8J 3SQGA 3KK2A 1UD5A 2GVDA 1YRTA 4M5DB 2UUCJ 4A8KA 4ZLJA 1BUXA 1SC3B 4XONA 2Q6KA 1E1QA 2ZOMA 3ASTA 3SYZA 2B63C 3H8YA 4ELVA 4RW9B 5L39A 4LVOP 2LQ5A 1XMOJ 2OTLS 4UZFA 4L75A 4HTJA 2AZ1A 2Z4PA 2ZE2B 1G7TA 2DGTA 5F8IA 2YWKA 4Y7NK 3HP6A 3CD7A 5E5NA 1YZ7A 1IM6A 3MFIA 1N8RT 5KFIA 3W3SA 2ZFZA 5KFTA 1JLQA 3M8PB 1HLWA 2L9NA 1LWFA 1XR5A 4XSXA 4WTOB 1ZETA 1HL6A 2OPQB 2E1CA 4H4MA 3GFHA 2FVSA 3HPOA 3M9NB 4CP5A 1RT2B 2CQCA 3S15C 2VBVA 2YH1A 1YITS 5KOWA 1L3VA 1P27B 4DV1J 3G9CA 1EFCA 3M2RA 4UZBA 1KC8D 5C24A 2JA5K 3LF0A 3C6TB 1VK3A 1SFOC 3MWBA 1TLLA 1RE1B 2FHMA 4CI0B 2KL8A 2D9PA 2WZPP 2QT7A 4OX7A 4NPOA 1V5VA 5RUBA 4X4OA 2NYHA 1WCMA 1X5TA 2X85A 2WVCA 1TL5A 1WC3A 3ZTOA 5LOQA 2ATCB 1EFTA 3ZIAA 3EICA 4NLUA 4KHMA 1ZQ1C 1E6YB 3FRYA 3T41A 1NM2A 1NK0A 4BS2A 3OUYB 4WXWA 2HMIA 3ELHA 2YPZA 3MI7X 2DERA 2HBZB 2BJ9A 2N4DA 3JQQA 4PZVA 4MEXA 1UFKA 3M6VA 1PC5A 1CLFA 1GTEA 4B3MF 1S0MA 5AXLA 4OHXA 1GO2A 3IM9A 1ZXOA 3CCEB 3RJMB 3BH7B 1VIXA 1FNBA 3JAMY 3Q0AA 2KH9A 1QFYA 3QBCA 2HQ3A 5G0RB 3M1VA 1BQNB 4UF4A 3R5BA 4FS2A 3MEEB 5U47A 5IM0A 3CDEA 1N5YB 4F4AA 1S1VA 1U24A 1U0HA 4UAJA 4U7UD 1S1WB 2PI4A 4EFAC 2DRDA 4Q5VA 3O8WA 2M5YA 1N36F 1UVJA 3V6DA 1BGWA 3CCUS 2ASLA 4Q0BA 4ECRA 1FDDA 3CSKA 5AJ3F 2CVIA 4P75A 2WYRA 1MWYA 2BE2A 1NDHA 4WFNQ 3TA1A 5DS0A 2DY9A 1JIHA 3N0VA 1DY3A 2W2NP 4DV2F 4TMTA 4F7DA 1WKLA 2QEXS 4CH1A 2ZNZA 1HWIA 3QFRA 1N06A 1S6PB 2AJ1A 2CG4A 1DURA 2EC2A 2VG6B 4LF7F 1I1GA 3K7AC 1NK4A 4I7FA 2CPIA 2OPRA 4RCZA 2CZ4A 2KI2A 2HZAA 1U45A 4C97A 5FIIA 1Y0RA 1UA0A 2E2IC 4C6AA 3C2PA 3EWGA 2OI2A 2V5HG 4KFBB 4II2A 1RTJB 2QRRA 2V0NA 3TQEA 2MLYA 4DR3F 4JV0A 1NJYA 2MQOA 3L09A 3E8OA 1T0TV 5J2NA 1XNQF 3OVBA 1MU2A 5LJ3Y 1XIQA 3Q8QB 1S1XB 3U7JA 4LF9J 1BWVA 4P2MA 3HVAA 3MMCB 4K4YA 3S17C 2X0KA 1JLEB 3NBPB 4M5IA 4O3PA 9ATCB 4QIGA 5KSWB 3PXGa 5C4XC 3FDSA 1U8SA 2DVIA 1B2RA 2JN9A 1IJFA 1RZMA 4LBPA 3T02A 3B8HA 5C5JA 4NA1A 3SCIE 2NVQC 3W8PA 4QR1A 3CPWB 2HEKA 5HL8A 2RC6A 3THVA 4WJBA 2M0GB 1MWQA 2DGQA 2ZZTA 5FDLB 4ZVQB 4NI2A 1YHQS 1B7YB 1FXDA 5CCMA 4C3LA 4LFBJ 3TUZC 1REVA 4DQSA 4OPSA 1T02A 4JI8F 3GTPK 4FXVA 3QZ8A 2OSRA 1RBLA 4RD3A 4OIXA 1J9ZA 3U6BA 1OY6A 3N5BA 3U6KA 1GMVA 3BCFA 3W2IA 3NCRA 3CC7S 1X4DA 2VIHA 4I2QB 3I0SB 2JFKA 3QAUA 4RW7A 1N5QA 2HHHF 2QLWA 1SFOA 2ZH8A 4KN7A 2V8HA 2DXFA 1HVXA 3HOUK 3ZC3A 3CWJA 4U8YA 2U2FA 3W2EA 4KKOA 1KHVA 4A3IK 4DR2F 1D9DA 1PJ5A 2G9OA 3GTQC 1NHKL 5TMFA 1LWEB 2HKEA 1VHFA 1ZPWX 2BJ3A 4UW2A 3PTWA 2XY7A 3V6KA 5CAAA 3FSXA 2MQMA 2U1AA 3W5XA 1JLGB 4LF5J 2RU9A 2DGXA 2GNKA 4TXSA 5EUHA 1Y11A 1S0OA 1UWBA 1FE4A 3Q8RB 3HOVK 3ENQA 1UJ4A 1HNWF 4J9SA 3AJ2A 3M32B 3DOLA 3ZXWA 4X62J 3S1MK 3GTLK 4P2SA 3VAFA 1GMWD 3HOWC 2F40A 5IC4B 3DU6A 3NWRA 1KQSR 3OR1A 1FEEA 3CDUA 4O44B 4K50A 3A3GA 1EKSA 2FDNA 1VJSA 5A0YA 1JLFB 4RNOA 3AODA 1SV5A 1RTHA 4ZVSB 4P72A 3ASPA 2EC0A 1U7LA 2KVIA 3I0RB 3TOQA 2DCLA 1VBYA 2XLKA 4RKUC 2AT1B 2QE5A 1QTNB 1FFGB 1RAFB 2NXNA 4F4WA 1E63A 2HHTA 3QSIA 3GG1A 3H2VE 3IPJA 1K0VA 4IR1A 4IOBA 1PBAA 3OD2A 2F65A 1UFWA 2HLUA 3HXAA 4P7VA 5TJ3A 5AXKA 1R9TC 3MUTP 2GVZA 4NLWA 2R7ZK 2IC3A 3HSGA 5HP1A 1BPLA 1VHOA 3CRZA 3NGKA 4WCEQ 1R0BG 4J9RA 2M2BA 3TAMB 4CIOA 3CC2S 1WUUA 2IM0A 1RHMB 1KTVA 3WYAA 3RRGA 5HQ8A 3D6HB 1CJVB 2UVRA 1N32J 2PMWA 4X6AC 1U49A 5KG5A 4O3NA 4AXJA 5D77A 4DL4A 1SC4B 5LMNF 4UQGA 4XIUA 4X65J 3PG9A 2V9WA 3KL9A 2FVCA 3KHGA 2C1EB 4WFZA 3MEDB 1RHQB 4F3MA 2E66A 3W9JA 4UUWA 2QL9B 1YJ9B 1R0AB 2HWHA 2AX0A 2OMOA 4HHJA 2FHJA 3SMZA 4USTA 1IE0A 2KT2A 1GXLA 3S1RC 4DF4A 1VC6A 3ILLA 1WC6A 4IFYA 2I5JA 5F41A 3IWLA 5HJYA 5MLCV 2HAIA 4K4UA 2WB1D 1UMJA 1LK5A 5E3CA 2MGZB 1VLOA 3GJSB 3Q3AA 3DCAA 3M2UA 3PVDA 5CYQB 4CT8A 3MECA 3GV8B 1RT6A 3G4SS 1KLMA 2LCWA 4R5PA 4Z7YA 4CTAB 2CA9A 4ZPCA 4RW9A 1T3OA 2CQIA 1WKKA 3MUMP 2AJFE 1RA7A 3HLUA 5EDWA 2NREA 4RJVA 3MXHP 2G2ZA 2ZUEA 3TUPA 4EMDA 4N3NA 3BREA 2ZBPA 2HRTA 4YR3A 2NVYC 2YNGB 1SC6A 4EBDA 1IR1A 2EK6A 2ZZNA 4BKWA 3DC2A 4U96A 2CWXA 4MT1A 1V3SA 2HVEA 1KQGB 1VQOB 3TJ9A 2DNQA 5K14A 4B9SA 1O24A 3M8QB 4I4BA 3FNNA 2MQNA 3GTQA 3RAMA 1JXVA 2GJFA 3E2EA 1WIHA 1FNDA 4BCAA 4DOZA 1F6TA 2OTJS 1XK8A 3CPWR 1ZBSA 5CH7B 4TQRA 3AD7C 4KAIA 4GO7X 1E6YA 2JEJA 4Z4UA 4LBWA 3R8YA 1K44A 2BABA 2XZWA 3LAJA 3GJTB 2GGPA 5CCLA 3R2CJ 1KOOA 1WSVA 1I18A 3FCWA 2W9CB 3OZVA 4OIQA 2XGJA 2VB6A 2CADA 3FK4A 2UXDF 2IVMA 4YDDB 5F3TA 2VPXB 2Z0GA 1K1SA 4EGLA 5HSPA 1VQ8B 3PEHA 2B7CB 1I6HC 3G71S 4KKTA 1B23P 1VQ5B 2IRYA 4DFMA 2YKNB 1WI6A 1UZHA 1H7XA 2HQGA 5D3GB 1UETA 2VUMK 3Q83A 1LW0B 3FHZA 1S7HA 5G0RA 2DD8S 1VQ6B 3OTDA 3PO3C 3QZ7A 1NDPA 1XQBA 1Y1VK 1XQIA 2AJ4A 4Q5SA 2KXHA 1S1WA 1FJGF 4NLXA 3KK1B 2FD2A 5I3PA 3TZWA 4DS4A 2I1RA 2MKHA 3PACA 2BW2A 1EI6A 2JLFA 5T14A 1OJ4A 4AD6A 3RGIA 2CW0A 5CJ9A 3DMJB 2YNIA 3RUBL 1ZBTA 4A93C 5DLFA 2KYZA 1FO1A 3VTIA 5GAHI 4MFBB 3GTKK 4F2RA 4IG3A 5FNZA 3T19A 1ZYRA 1C0TA 2KFYA 4K5RA 4RJLA 1D2EA 3FCVA 4AL7A 2CWKA 3CAGA 3C8YA 3G8TA 4XKWA 5C2CA 1TWCC 3P4UB 2CNKB 3ZZPA 3DLKB 5IOQA 3NMRA 1RP5A 1JK9B 2ZHOA 2FIUA 2BPOA 4KGMA 1F0XA 3V4GA 3GTJC 4B3OB 1S1UA 4JI2J 1HHTP 4BXXK 1H0HB 3LWMA 1RTJA 3T01A 2CRLA 4R25A 4A3MC 5KTQA 4Q43A 2MZSA 3BDEA 2V31A 5HMWA 4DX5A 2CXEA 3ZNJ1 1CQXA 1H38A 1VQPS 3CJ5A 1S1XA 3QGIA 2RKIB 1JJ4A 3CCRS 2VQEF 1JLEA 5DETA 5DS7A 3CP2A 2RHQB 2OD6A 3CCLS 3VNUA 4OYPA 4KGVB 2VKRA 4DR6F 1UD4A 3TZXA
chains in the Genus database with same CATH topology
1WSVA 5L46A 3GEEA 3TFIA 3GEIA 1V5VA 3AD8C 3TFJA 1PJ7A 1VLOA 3AD7C 1XZPA 4P9SA 1VRQC 4PABA 4PAAA 1XZQA 3TTGA 1NRKA 1YX2A 1PJ5A 1XZPB 2GAHC 3A8IA 3A8KA 3TFHA 1XZQB 3AD9C 3A8JA 1X31C 3GEHA