1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
1WSRA 3GSIA 1XZQA 5L46A 3ADAC 3TFJA 1YX2A 4PABA 1XZPB 1PJ6A 3GEEA 2GAHC 1NRKA 3AD7C 3TTGA 3GIRA 3A8JA 3A8KA 1WOSA 3GEIA 4P9SA 3AD8C 1VRQC 1WSVA 1WOOA 1VLYA 1PJ7A 1WOPA 3AD9C 1WORA 1XZQB 3TFHA 1XZPA 1PJ5A 1V5VA 2GAGC 1X31C 3A8IA 3TFIA 1VLOA 3GEHA 4PAAA
chains in the Genus database with same CATH superfamily
1NSPA 3OFNA 3W5XA 1N52B 2GQ2A 1MSWD 3OZWA 4X62J 3JYTB 1COWA 1R9TK 3KJVA 5AXMA 1PSDA 2HFUA 1S77D 4K4UA 2B6AA 3MPDA 2BQRA 3MPWA 3CJ5A 1VJSA 2ZC3A 3OVBA 4L76A 1KD1T 5J2QA 1O27A 2VBTA 4DSEA 3M32B 3HZGA 4USUA 2XCPA 1FFGB 3SQOP 5LMNJ 2OKQA 2ZM6J 4DS5A 3SDEB 4GRSA 4NLPA 2JVRA 4IQMA 2J8SA 2XZWA 4OYWA 3VWSA 2F3JA 1K73T 2Q6LA 2XO6A 3DGPB 1IQZA 2R3VA 4Q8EA 4LF9F 1IKVA 4G0UA 3DDYA 2MZSA 4A3CK 2HIQA 1GH8A 3CPWB 2D7SA 2WHOA 1BX1A 3L3CA 4ZJOA 4CT9A 1NJYA 2HHPA 3DLEA 2KYXA 2OTJS 2GMJA 4ALZA 2DYAA 4DJBA 1SH0A 4P3IA 4CLFA 2A18A 3V2UC 5KOXA 1VQ7B 2ABYA 3CMMA 2F8HA 2QTZA 1Y1WK 5E41A 3OXGA 3NCQA 5KFOA 5LSRA 4KMDA 2BKNA 1VQMB 2HGLA 3GTMK 1FE0A 2B7CB 2D9PA 3QFCA 1U49A 1KC8D 3QO9B 5CZXA 4WZLA 3EPGA 3HKWA 5CHCB 2A68A 2HNZB 4L6V3 2Z30B 3NGKA 2R2SA 1KQKA 4UY85 2AEJA 2RILA 2LZJA 4RO0A 2KT5A 4O3OA 1XZQA 2LMIA 1ZYQA 3C3LA 4G0WA 4RR5A 4P25A 4CWBA 3BQ1A 3OTBA 1BUXA 2OYNA 5IV3A 2KRBA 4RJLA 3ZZUA 4MYUA 1P1LA 1VF7A 1XNRJ 3MM6A 3LP2A 4JBCA 4F26A 2XHCA 3HZEA 2IDLA 2LEPA 2QGGA 1GNKA 2X3DA 2HFZA 1VQ7S 2BACA 4Q5SA 3W2VB 1SBRA 1EQRA 3H0GA 4FVMA 2LP4A 3AVYA 3RJMB 3MM7A 4Z4RA 3W2HA 2V4QA 5ETMA 1VH2A 4Z4UA 3OL9A 4UZUA 3ZZTA 2MTLA 1ZPVA 5FJ8K 5H59A 3WBJA 1V3RA 4ENOA 4PPZA 2HPUA 2CC2A 1MMDA 5A0YB 2HGNA 1VJQA 2DK2A 1NSQA 4II2A 2CW5A 3AOBA 3AY0A 3WX8A 4PRFA 4NLDA 1CLFA 3ILOA 1TKZB 5RUBA 2R7ZK 2IAJB 1JLAB 1EWYA 4RBVA 4OZ1A 2O66A 2NR0A 5E33A 1E6VA 1SJRA 2VICA 4BBSK 5ETLA 4A48A 2W8LA 4WKYA 3HHLA 2FHOB 3M9OB 4G7OA 3ET6A 3DRSB 5IS2A 2NVYA 4M5MA 1B4SA 5D0HA 3ZFVA 3NLCA 2F8EX 2GIFA 3WC0A 3A3OB 1JVIA 4QYZJ 3HOVC 3CQZK 3QO9A 4MT1A 1PO6A 4KAWX 1FESA 3LNNA 3CC2S 3M6WA 4XLAA 2A6HA 3M6UA 4J9OA 3AD9C 4RBTA 3V7AA 2RUSA 2FLPA 5K8MA 4K7QA 2YWHA 4KM8A 3JQMA 2RQKA 1TTHB 3DLLQ 2BUNA 1ZM9A 4ETXA 3M32A 1QGYA 3AGPA 1AFIA 4ED7A 3MTJA 2EBBA 4L74A 1FJEB 3JSMA 4EO6A 2VC1A 1OPIA 4NWBA 1S79A 4ZPDA 3QFSA 5EUHA 4K4YA 4K5SA 2A2CA 3MMAA 4KIAA 3KJVB 5K14A 4IOAQ 2NUUG 1P4MA 3FFIA 2PPBA 2ZE2B 4ACAA 2DO0A 3MMLB 2W9CA 1S76D 3LQ6A 1H98A 1MN9A 2YKMA 1O29A 2V7VA 3LWMA 2A1BA 3S1NK 1VHIA 4RCZA 4LIRA 2OJ3A 1X4BA 1SUQB 4A3BC 3MURP 3BH4A 4NCGA 3P8BB 2SXLA 2X85A 4X0CA 4BXXK 2I6WA 2GSNA 4ECXA 5EWGA 2YX7A 1RTHB 4ED0A 1FX0A 1FWPA 4Y34A 4RJVA 1HNXJ 3V6KA 1Y0RA 2CKWA 2UXCJ 2DKOB 4IOBA 1S1XB 1YJ9B 2Y8WA 2WSCC 2RRAA 3OR1A 2G1DA 5A6PA 4OI0A 1UEKA 5C4XC 3D5MA 4A3KK 3MCMA 5EGHA 2LDYA 1YG0A 2F9DA 3WC2A 2YWGA 2DRBA 3MFHA 2FJXA 3IS9A 3QFRA 3KWMA 3G82B 4QIEA 1TWAK 4ZIWA 3T5JA 4A3IC 4F7VA 3LOUA 1U6FA 5CZVA 2PMZL 4QU6A 1VHOA 3D2WA 2YPZA 3GR1A 3AFGA 4NYPA 3UCGA 1H7WA 4F2RA 1Y00A 3DCAA 4OHVA 5B0FA 2QTWA 4WJ4A 1LWCB 3CJ0A 3G6EB 1NKCA 1J5EF 4DR1F 4ILDA 3J81j 2G2YA 3BP3A 1MROA 2Q3PA 2AX0A 2VFVA 3WODA 1UD6A 4HHHA 1TFYA 4O2DA 2JNJA 3GEIA 2MQMA 1O2AA 2KM8B 1SV5A 1IJEA 5DDQC 2V7QA 3VAKA 1QSSA 3DOLB 1S6OA 2YKNB 3W2EA 1UA1A 2VOOA 2HLDA 3W2WB 1S4MA 4K4SA 4C8YA 3NBPB 1N33F 1EK8A 5B0AA 2DEUA 3DMJA 1SIWB 2L48A 2XMUA 4N8OA 2Y1RI 3M1VA 3KLIB 2HVEA 1IBMJ 3OSNA 1QY7A 3MHYA 5EMNA 1I6JA 1C0UA 1G4CA 1KFDA 2FVCA 2D3OR 2DT9A 2VFSA 2AGOA 4HH0A 4DG1A 3CDWA 4DBQA 3TO8A 4DMZA 1VBYA 3M3YC 4IFYA 1VQ5S 1KONA 3GILA 1ICEB 4AYBL 4J7CA 4HKQA 2B63K 1TVRA 4WILA 2IBKA 5C44K 5HANA 4QFMA 1H8EA 2GV1A 3VAMA 2NLWA 1UFWA 3O3LA 1E79A 4M5LA 4DQQA 1XEZA 3Q2TC 2AJ1A 1RTDB 4DDQA 2MSSA 2DY1A 2GREA 2WB4A 4DPYA 4QR0A 4TU8A 1BQNB 3WXMA 3UE2A 3DRSA 4E0FA 3GEHA 3GTQC 1RP5A 4YS2A 2ZZEA 2DNQA 3V4IA 1WC6A 1UPPA 2XEXA 3M30A 3FSXA 3B4DA 3NEKA 2FIUA 1N5YA 4DV3F 1PYOB 2PA8L 4KV8B 3T41A 1HQEB 1BWEA 5KFJA 3S16K 3I96A 2Q6KA 3W9IA 2ZE2A 2DGQA 1FRJA 2CJ9A 3G8QA 2QMUA 5BR8F 2OFHX 4DV6F 1VC5A 1PBAA 3SYZA 1VJEA 3TZWA 3ULHA 1Q16B 2CQ4A 5HROA 3N6MA 1J6WA 4JI3F 1F9FA 1Y11A 2E44A 3FCWA 1B70B 3BKFA 2W9CB 3WQZA 2CPZA 1TWCA 1FJGF 5IV4A 1JLQA 3H2UB 1T3OA 5KG7A 1BLUA 2YNGB 4TN1A 1Z1ZA 2NVTK 2CPXA 5HVGA 1DARA 2O5DA 1SC4B 3NRBA 2R92C 1FRQA 1IKXA 1UPMB 1B99A 1WHWA 2BGIA 2M52A 2ILYA 4IG0A 1TTTA 1GMWA 4I1TA 3CCLS 3PW4A 2MQLA 4WU3A 1OY6A 3V6JA 2ZZNA 1HA1A 1RT5A 5G0RB 3UPFA 5B0BA 2HURA 1R27B 3GTOA 2HRUA 1KK2A 1NH7A 2LA4A 3W3SA 3KOAA 1M90D 4LQYA 3JSYA 3NMAA 3LO8A 4K0KF 4PUOB 4P71A 1K83A 1ZTWA 4USVA 5D3GB 3HOXC 2EBGA 1VLYA 2BE7D 2WPDA 1FO1A 4MEXA 3U1LA 1WDDA 3JSRA 1HFEL 1SC1B 1EAYC 5KT3A 1KTQA 3PO3K 5E0OA 4JI6J 2X6YA 4HTIA 3VNVA 1FJGJ 3MOJB 2P5MA 3E20A 5FO0A 1I7PA 1V5VA 3CB4A 2P6TA 4ED6A 1D8YA 5E3RA 2X1FA 4KYZA 2KG0A 5IYWA 1EIYB 3GPAA 4XL9A 5C42A 5TRDA 4CNZA 4JI4F 1HQMA 2W6JA 1S9GA 5M2PA 5LOQA 4W98A 2JJ2A 1ZPWX 4QVAA 5GAHI 1K73D 5KFVA 5I3QA 2ZL6A 2EG1A 1RHRB 3LANA 5D3GA 1V5IB 3D1OA 2Y0SD 4FS2A 4F7DA 4G1QA 3POTB 4LRBA 1INNA 3PFEA 3PO2C 4DN9A 4ANEA 2V4JB 2B4VA 4M1XA 4R71A 4Y52K 2AGPA 5D77A 3OXLA 3Q24A 4DL5A 1E64A 3CW2A 1N36F 2Q66A 1M1HA 1G3OA 2B9XA 4OHZA 4KJIA 1K8AD 5BXIA 1PYSB 2OHDA 2W7VA 5A76A 2PLFA 1JLGB 2QEXS 4FBUA 1YCLA 2CG4A 4IYQA 4C3MA 4I68A 5KFAA 5LMUJ 1FKAF 4RW4B 4DFJA 1Y1WA 5CDFA 2FYXA 4F4KA 1KLNA 1HBOB 2HHTA 2UXBJ 1S59A 3DXJA 3BN4A 4YAWA 2KRRA 3G4SB 1OO0B 3FRZA 4IG0B 4P12A 1VOMA 2WSEC 5GMEA 4FPIA 2Z8QA 4XLHA 3HOWC 3CCVS 4LBVA 2QMUB 4AC9A 4USIA 2DIVA 5JMNA 1N33J 3HSZA 1Y0HA 4UZBA 1N6QA 3GJQB 1CSJA 3SZZA 1ZM3A 1S1VB 4C3IK 3AQOA 2M9KA 3EQLA 1HWKA 1YBTA 2JA6A 2GFFA 1NK6A 4LJZA 1SMYA 5ETQA 3N4WA 3LH2S 2E5LJ 3NNHA 2V94A 3KLEB 4Y7NK 1N5YB 5E6TA 2FJBB 1OGIA 2M5YA 1XJWB 1RAGB 3BGFA 2OP5A 1IVZA 1N0VC 3U6BA 5THXA 1P1TA 2W7OA 1MMLA 5FLMC 3CO0P 3MMBA 2I5JA 2XGPA 4DR7J 1WTHD 4ZCLA 2NVQC 3BSCA 2V0NA 2YWWA 4PQUA 2ZH5A 3LWLA 1EFTA 1FDBA 1KMHA 4IR9A 3HKZL 2VPZB 3SLNA 5J2QB 4P9SA 5F4OA 2DEJA 1WEZA 2K7KA 1TL1A 1CJKB 2B6AB 1R0CB 3AHPA 4WFBQ 2V67A 3LGMA 2G1HA 4P2SA 2E5JA 4I2QA 2FQOA 3PRVA 3HVRA 1WIHA 1XR5A 4HIZA 3WY9A 1OY8A 4I7FA 2DB1A 3CJ3A 1FNMA 4MFBA 5M2UA 1W9XA 1S6UA 3T5LA 3V76A 1DURA 2V6SA 1H7XA 1X4DA 2D3UA 4X4VA 1S9EB 4E98A 1Q8KA 4XLNA 3S15K 1J98A 5F0UA 4ZKAA 4Y28C 1KQGB 2CJKA 2R7RA 4MIWA 4JK1A 2YBVA 3RZDK 3D66A 3TVYA 5ETKA 2BOAA 2OK8A 1I6HC 4RU2A 2ZUGA 4D3HA 1EKRA 5BJRA 1SJ4P 4P7VA 4FF1A 5BSYA 3CQZA 4ZMMA 4C0OC 2F43A 4RD6A 3L95X 4DN0A 1ZZNA 1S72S 3IFEA 2VFRA 1GMUA 4M5DB 4HHUA 1HLWA 2EKNA 1X4CA 2FHJA 3SQGB 2K06A 2W2OP 1EARA 2V2QA 1CJVB 3CIMA 3NGDA 4EWTA 4OV6A 2HFNA 2GVZA 2PMHA 2IA6A 3CCWA 3IBWA 2CWKA 1IR0A 4XMYA 1FK9B 3G6XA 4GVBB 3IWNC 5HMYA 1L3TA 2MSTA 4M63A 1OYDA 1UZHA 4RX6A 5GAHU 4EEYA 5DLGA 2O1PA 3KL9A 2CZ4A 3I0SA 2V8DA 1ZM4A 1H72C 2A10A 4WF9Q 1LW2A 1I94J 2VDHA 2BM0A 5IQQA 1JQGA 4XNFA 2VJIA 2K7JA 4J9PA 1U09A 2CFAA 3PO4A 3LQVA 3OZVA 3OTCA 2C2EA 2XYGB 1T9TA 1I50A 4WPAA 3NWRA 1KOOA 2J7WA 2DNGA 3J7AN 1J5EJ 1CPZA 3WNDA 1W2BB 1S48A 1BE4A 4PG4A 3PKYA 1J5OB 2O3DA 3KLHB 3JU4A 5F0WA 4FP9A 4OQJA 4NCAA 1C1BB 2E2HA 3BUEA 3GG1A 4FS1A 5IOLA 5K9FA 2WB1L 4F0KA 1Q8LA 2I1LA 4ZVTB 4BHQA 1UWBB 2XMVA 3PZPA 1LV5A 1RA6A 2JHEA 1REGX 2GO9A 4ZITA 1M5PC 2VODA 3FPKA 2B4OA 3KLFB 1C2PA 1WHVA 2XMMA 3CDBA 2KHDA 4BC9A 1G51A 4JP8A 2AF6A 5K5MA 3E01A 4KKOA 1RBLA 1DBDA 3IG1A 2JA7A 1DFDA 1UVKA 3UNYA 2R7QA 4UQGA 4DR2F 2YQ3A 1ZYRA 4LF4J 4KGZB 3UI3A 1Y9OA 5CYJA 2H3EB 1WJ9A 1X9MA 2FGCA 2G0IA 4C8MA 2LKZA 4C2MC 1LFPA 4N7TA 3GTLK 3HXAA 2CA9A 1AFJA 3MMBB 2D9RA 5DSZA 1JJCB 1DQ8A 4AXJA 3I0RB 4Q4ZA 1NSAA 1MU2A 2WONB 3QIPB 3CJQA 3M8WA 2ZHBA 2DRAA 3FK4A 5FLMK 3VR6A 2MKCA 3HSDA 2OK7A 1P9QC 2H5EA 1QFYA 3T9NA 2VV5A 4LRFA 3TQEA 4ELUA 2KT3A 1TKTB 3H2LA 5G4DA 3K7AK 4Y7NC 4LF7J 5D0GA 3LF0A 1Z2ZA 3TVZA 3BPSP 2IYGA 1F60A 3W2FA 3DXBA 3QPIA 1E1QA 5FD1A 2IM1A 2RS2A 5DGAA 1RKIA 3I32A 2JFKA 3K8VA 1YJWS 1FWLA 4NXNF 4LRAA 2D69A 1XERA 5F8HA 3CMES 1ZTTA 5I3UA 5DS0A 3D6HB 3DYAA 2R8IA 1Y1VK 2G0JA 1RT7B 1U6ZA 5KFCA 2CPEA 3H25A 3VQTA 2HVZA 4MK9A 1GAOA 3QSIA 1KVKA 2OD4A 3TTGA 3V4IB 2Y1IA 3TEGA 4LBHA 2CPJA 4ED4A 3J7A1 3RG6A 2ZJRQ 1QTNB 3CCES 2ZBCA 3EYZA 4ECVA 2HVHA 2OBSA 1VBKA 1T11A 4TKTA 5FIIA 2BMBA 1WQGA 2ZZFA 2WVBA 4AT1B 4QJVB 2W24A 2FVSA 2R2RA 4UW2A 1OSCA 3W63A 1OB0A 3OJUA 5ETTA 1T9VA 4XKWA 1JLQB 4WK1A 2ZZTA 3G87A 1TL7B 3H3VL 4P2NA 3ZZPA 4GTCA 3R7SB 2XMKA 3BJYA 1NZ8A 1BPLA 2HVDA 1PKUA 2WBRA 1S1TB 3VQSA 4TMXA 2DY9A 4M53A 3R8YA 1SJQA 3OPFA 4EYIB 1QVFB 2XS7A 3DLGA 2LFVA 3CP2A 1TWGC 5IP7K 3T5HA 2BEFA 3OHBA 2JA8K 4FYDA 1WC3A 1J27A 3OEHA 4YG2A 4B08A 2ZTGA 3FDSA 4WP9A 1YNJA 2E1RA 3BBCA 1M1KT 2KHCA 3ETMA 3GTPK 3A35A 3Q8PB 3MD1A 4C3HC 1Q95G 2DXDA 1K83K 2UVWA 1YRTA 1SIZA 2BM1A 5KFKA 3TAPA 4DUZF 4WXWA 1RSCA 2I2YA 5J2PB 3CC4S 3R2DJ 2YU9K 3IAM9 2W2NP 4ZGQB 2B0GA 1IJFA 4X4PA 3SDEA 4GKJJ 2QYCA 4IFYB 2DNLA 3R6GB 4CLUA 4JI4J 1TV6A 5GAEI 3AVTA 1TFWA 4FKYA 4TLQA 3M2VA 5EWEA 2QFJA 3I0RA 4YR2A 5TR9A 1DCOA 2ZHOA 1IKXB 4K2JA 4KT0C 8ATCB 1NB9A 3MEKA 2XCQA 4BBYA 1QGAA 3QJPA 2YNGA 2HZCA 2QFIA 4DR6F 4R0JA 4N41A 2ZOFA 2VUMK 2HVIA 1YJ7A 2I38A 3QGPA 1JJ4A 3G82A 1HHQA 2MJNA 5T41A 2KTQA 5IYRA 3DOMB 5L9NA 2UUTA 2QLXA 4DI6A 5J2NA 4B44A 2MXYA 3RRKA 2JA6C 1XQIA 1JLBA 1U1OA 4K0KJ 1E63A 4XK8C 4YFKA 2IIHA 5A2QU 1RT6B 4UOCA 2EI5A 4Y0FA 3JSTA 1NBEB 3P4UB 2QLBB 4ZH4A 4YB5A 2CQ1A 3LGNA 3P45B 1XXAA 3EVOA 3G6YA 2E9TA 3IA0A 2CNNB 2VBSA 1X5PA 4OYAA 3W60A 1VQYA 4A4JA 4M5KA 4TLRA 3IM8A 4QIFA 5EDWA 2YNHB 4XLCA 1DAXA 3OTOF 1USMA 3SSRA 3BSNA 2OTJB 2CADA 2HIYA 1REVB 2VNKA 3G96A 2GHPA 1OQ6A 3R97A 1WI6A 4KPYA 1JLCA 5HI7A 3D3BJ 4DR5J 3S1MK 2D74A 4O3NA 1U26A 3HAGA 5CHPA 4WFAQ 2XB2D 1IBMF 4BWMA 1VI7A 2RF2A 3OFFA 6AT1B 4C9DA 4UOFA 4DR3J 5TMCA 2HCJB 3J7YU 3FFIB 3CJ4A 4G1BA 4CH0S 4HACA 2DH8A 3HFKA 4YEAA 1PILA 4ZIVA 2HK2A 1GMVA 3X3UA 5KT5A 2ZOGA 2JA6K 5E3QA 2MQPA 1KHWA 3JTNA 1WG4A 1HWIA 5HJXA 1JXLA 5HZBA 4IFVA 2W9BB 5KOWA 2JJ1A 2OLWA 1NK4A 1FCAA 2ZH3A 1WUUA 1BHNA 1L5UA 3RTVA 3M8SA 3D7SB 3K5LA 3MUTP 4DR6J 3EMTA 4A3MC 3RRGA 3PX6A 4ZLJA 2CK3A 1RB0A 4OIPA 1S4FA 2PDAA 2C42A 2FVQA 3Q8SB 4TQSA 1W34A 3HJFA 3R5BA 3I31A 4AL5A 4RNNA 2AQ4A 5KG1A 4AE5A 1Q81T 1RCOB 2P8IA 3FEYB 2RSQA 1P6TA 2PGCA 3K17A 2B8PA 4MKBA 4LQ3A 3GTKA 1MWQA 4G6VB 4MFBB 3CXCR 1JK9B 1RHUB 2ZDPA 3TNVA 4UUXA 1YVFA 2DNHA 2DITA 2LQ8A 5GVQA 2MZTA 2ZVSA 2QJ3A 4RW7B 2FJDB 1EJ7L 4C3KA 3IC1A 1FA0A 4Z4TA 1LW0B 4OHYA 4ATNA 3QIDA 3PM9A 5GV7A 4KASA 5C7PA 3S2DC 1PIEA 1HWUA 1SH3A 3QWUA 3ZTRA 2R7TA 2DR7A 2BANB 1S12A 2YWEA 4PYDA 5L9XA 4HEA9 1SFOK 3UN5A 4JI8F 5AN9A 3LO3A 2FJEB 5K14B 4AQYF 4C2MA 2ZWOA 5IP9C 2BBEA 2ASJA 2C4UA 4URSA 5KT2A 1DQAA 3MAAB 1RHMB 1Z4UA 1CJUA 5LSOA 4F3OA 5JFEA 2BYCA 2ZH6A 4QQBA 3Q8RB 3UQSA 1K0TA 1M5SA 3X1LB 1N34F 2D6FC 5KFHA 1S9FA 5HQ8A 1UMKA 2ACMA 3J7YI 5F8GA 1OYEA 2BW2A 2GGPB 2DPIA 1IR2A 4ES1A 5B0EA 1NCLA 2ZBRA 2FZKB 5K20B 3UDCA 4OMFG 1V0EA 2GSUA 4RMFA 3GTLC 5J1EB 2LYVA 1U8WA 2KB2A 2NQPA 2KI2A 3RZAA 2OBTA 4OZNA 2JOQA 2GPJA 1VQLS 4DEZA 3FMWA 3UN2A 3D6MB 5D0EA 1TWCC 3CCJS 2CVEA 2CPYA 1RQ0A 3GSDA 4BDPA 1JIHA 2VFTA 1HA3A 1TLLA 3L7UA 2C2NA 1JOEA 3TAMB 3U27A 1VQ8S 4AL7A 4C11A 2O67A 2HHVA 1EP4A 4M4SA 2HRYA 2QEXB 2YPYA 1UJ6A 2FY8A 4HR2A 3DLEB 4G3IA 1I50K 3VAJA 3TFJA 1CJTA 2EXUA 4I0WA 2J0WA 1YITS 4MKYA 2GS8A 2I1RA 1Q7YT 1YKWA 3QATA 1BQNA 1QUFA 1J9ZA 1VQKB 3IPJA 4R8UA 1RWXB 3ITHA 4H4MB 4TYAA 3QRPA 1HQUA 5JXSA 4AUKA 4Y2MA 2V63A 3LAKA 1U1NA 4XPCA 1H8HA 4L72B 2ZH1A 1RISA 2C3PA 3MZIA 2Y9HA 3OVSA 1N34J 2V8HA 2OPSA 4ZVEA 3W9HA 3IR6B 5CD4A 2XZPA 3PIOQ 3GV7B 1RWUA 5LXRA 3UNGC 1RTIA 4J9MA 4QU7A 4FN5A 1ZVUA 3TQ1A 3CEDA 3WNCA 1SFOC 5CYQA 5B6IA 2F4FA 1L3VA 2VG7B 2Z57B 2WYRA 4OLOA 1IWAA 3HK2A 1RT5B 1XK8A 3KLFA 3KJFB 2EFGA 4QPTA 3HVAA 1LWXA 3PHTA 3GTLA 4Y9UA 2DJWA 5IT9Y 4B17A 1UETA 3BF4A 4XLEA 3I82A 2X6XA 3GONA 4M95A 4WP3A 2MGZB 1NHUA 4DV3J 4P1VA 1KFSA 1X9SA 1UV7A 2CPHA 5FL7A 3QLHA 3M8QB 1HI8A 3MEDA 4IW3B 4ECQA 5BYQA 1YJNS 3R7BB 2V7TA 3ZTPA 1LWCA 3QQCD 1RTJA 3UR3C 2H4WB 4II3A 2YQ1A 1I6HK 3QAEA 3EXYA 4EO8A 3MAHA 4K59A 1U2RA 2IYIA 2GK6A 3JYTA 4OPSA 5IYCC 4LK1A 3FOFA 1XMOJ 2VG6A 2CJXB 3IRXB 2C2WA 3KK3A 4XCHA 3QMQA 3LQEA 2DYIA 3DRPB 2IJNA 4KV8A 4EYHB 4UUWA 5DDRC 1NB7A 2HWIA 1IE0A 3R9LA 3IG1B 2H4YB 5AE2A 3SFGA 1Y1VA 1XBWA 4RWXA 1Y1VC 2RS8A 2HQFA 1DJ0A 4ZVOB 3RW6A 2KXNB 2ZKTA 3DHXA 4DPTA 1N56A 4UOHA 4DG1B 4FYYB 2ZH4A 1F2HA 1QDUB 3RBXA 2NREA 2W6IA 2B7CA 4OZLA 5F8MA 4ETZA 4B3MJ 3C14B 3CCQB 2PMDA 1XNRF 4RW6B 2HS0A 1GE9A 5F41A 3OOCA 3KJNB 1JJ2R 2JEGA 4USTA 2YNIA 1SKSA 5E2QA 2MLZA 2XYHB 2CF4A 3WX4A 1K47A 4GC6A 3UVJA 1GX5A 4LR2A 2DGSA 3MCSA 3OT9A 1GK8A 2XNDA 1RDRA 3IMQJ 2CG8A 5F4JA 3VZIA 3T1HF 3OTEA 2HEKA 1M5OC 1F3VA 1NPKA 3D6FB 4A8XA 3HFZB 1RE1B 3EGWB 3CSKA 4UTGA 2KL8A 1S0UA 5DDPC 3VTIA 3RB0A 1XQBA 2R7XA 4JV2A 5TMFA 1VQNS 1E6YA 5IM0B 3BQ2A 4K4XA 1CULA 4ANCA 2VBVA 4EMDA 4WZTA 3WBKA 2WZ1A 2OO4A 3TP2A 3ISNC 5SUHA 1Y10A 3CDUA 4ZLNA 5IWAJ 4J0QA 2DGUA 4XN0A 4QVJA 1FDRA 2EPIA 3WIUA 3M9MB 4J9RA 1CJUB 2WSFC 4TY8B 1S9EA 2ADBA 1JXEA 1X60A 4UAJA 4DZ6A 1FKOA 1IR1A 3QYYA 2D1CA 3DHWC 4OINA 4FZVA 3J7Z5 3CW2C 5C3EK 5J2MB 5THWA 3QBCA 1FFWB 2VG6B 4U9RA 5K8OA 5E5NA 3VGTA 3M8PA 1U2CA 1A0OB 4GTLA 1HBMA 2CAJA 3KDOA 1T05A 5ETRA 2X0KA 2DISA 2C4TA 1SKUB 4NLVA 4LREA 3G8SA 1I1GA 3RYLA 2XC9A 1BS2A 3PYDA 1APSA 4QWBA 1BWVA 3N0VA 4FBTA 2E2IC 5GAEU 2A2DA 5DZ7A 1Q7YD 2DERA 4LF8F 2VQFJ 5A8WB 1GAWA 2VONA 4ICLB 4S0MA 3S0XA 5HJYA 4DUTA 1U1KA 1RYRA 3CIZA 3GLJA 2XCOA 4M1KA 4KHRA 3B82A 2H5JB 4ECZA 1W2IA 1N6QB 1G7RA 2VL1A 4OYMA 3FOEA 3P6YC 4KAIA 3I55B 3QRRA 3GG0A 3IM9A 4U7UD 1R0BG 5F8NA 5KFSA 4U67Q 3EGZA 2C77A 1VQOB 2DOGA 1XFOA 3AJ2A 3K57A 2VNJA 3MCNA 5E7OB 2HAFA 3Q22A 4HE5A 3GTOC 3NL0A 1TUIA 2Y0BB 4A8MP 4KKTA 1H73A 4DDFA 4WYWA 3RY8A 3OXFA 4M2LA 2FDNA 4PG8A 2NVYC 4NXNJ 2ZZMA 4NA3A 4ED2A 4LF5F 2HHWA 3LAJA 1ZS6A 3SSQA 1WEXA 1WKJA 1VC6A 2DHSA 4Y2AA 3EGNA 1VQ6B 2Q6OA 1HWJA 3FKIC 3L09A 4NCGB 3T3FA 1VFJA 5CQGA 4OL8A 5HK4A 3MDFA 5KFLA 2NXNA 4WZQA 1S0OA 3T02A 3S7RA 1F5CA 1R8BA 1RAFB 4L75A 3HOZK 2DR6A 4NI2B 1KD1D 2FUG9 4KO0B 1QUVA 2XNRA 4J9QA 4IR1A 5KFXA 2R7WA 3D67A 2BKPA 5K8PA 4TQRA 1F2GA 4RUCA 4A8FA 3GTQA 4X7CA 3DN9A 1FJCA 3UDLA 1F3FA 2BRKA 3GE9A 3I55S 1NXIA 4IG3A 3OPKA 2MGZA 4J5OA 3L4JA 5CYMB 4PPDA 4F36A 3BDEA 3DOMA 4RDKA 5D15A 1WOPA 1FRIA 5IT4A 4OX9F 2ZBVA 2W2MP 3DKDA 1UKUA 4PG5A 3NXZA 5B08A 2C2RA 4ER8A 2QZ8A 3ENAA 2R93K 5FO1A 1LXNA 5KG0A 4B9VA 1NJXA 4LBWA 3MMAB 1EFWA 2GQFA 1WQHA 2BJ9A 2ZH7A 2D3O1 1XPPA 4DSIA 4P74A 3SFUA 1N8RT 2DXFA 3C8YA 1UEVA 3GTGC 2VBYA 3P3DA 4U8YA 4ZHRA 4X65J 5FJ4A 5KG3A 2M8DB 1W26A 2ALZA 2J7UA 3CCSS 3HOYK 1IJFB 5CJ9A 1DLOA 1KBRA 4NZ7A 2XOKA 1RUSA 4GKKF 2E1MC 4X6AC 2J6TA 3ICLA 3KDNA 2G2OA 2WSSA 3TJAA 3BO3A 3DGVA 1N54B 3EDQB 3DFEA 2JEFA 3FPPA 4GTBA 3MR6A 4Z4SA 1WEYA 1UW4A 3W2IA 4PUOA 1X0PA 1RGVA 4NLUA 1I3QA 2VDIA 1LW0A 2HS4A 4DZDA 3B78A 2N7YA 2AX1A 3HVTB 2PC6A 4KKOB 1KEKA 4HL9A 1RXOB 1X0FA 5D4LA 1X5SA 2CQDA 1OWXA 1SFOA 3FSYA 4YMEA 4P6VF 4WFXA 4LSLA 1R5NA 1HNZF 2P3MA 2VPWB 3N6LA 4ECUA 4C2MK 4B3GA 5L38A 2VQEF 4KGVB 4YR0A 5M5WK 1I8DA 1G7CA 3AGQA 1NHKL 4KRWA 4CO2A 3PJWA 1IM4A 3L4KA 2CJQA 4CO3A 1EP3B 4ECYA 2PHCB 4CNYA 4Q8FA 2WJVA 2QA1A 2BOPA 3PXGa 3U02A 3RZDC 1UWBA 3KUGA 1FI4A 1BXNA 2BE2B 4ZP7A 3LAMA 4ZVUB 3M30B 3CPWR 3T51B 3J7ZT 1FERA 2VPXB 1GO2A 3R6LB 4DL6A 2BXJA 1KVIA 4P5AA 3NGRA 4P72A 1C1BA 2C28A 4D3GA 3MR5A 1OY9A 4PWDB 1WKLA 1R5OA 3MM8B 4HH1A 4IH6A 4A3DK 5I42B 4QR2A 1WACA 2X1BA 5IC4B 2OH2A 4X06A 3EE3A 2CIMA 3BYPA 1I18A 3V81B 2VPYB 3K8WA 1B7FA 1DRZA 4KQZA 4XQFA 3ONUA 1FRLA 1Y3JA 1CC7A 4BBSC 2ROEA 3H0PA 1ITPA 4F3QA 3CT9A 2MQQA 3KHHA 2JSXA 3AB4B 2MZQA 5HROB 1FXRA 3BDPA 2V9KA 4X66F 4PZVA 1VQNB 4Z37A 4DV5F 3KK1B 2DHHA 3FZ2A 4KFBA 5HVFA 1EP2B 1PJ7A 4ID5B 2QMXA 3MEGA 4KMUA 3VAHA 5HATA 4QIVA 4TMZA 2BSAA 5A8WA 1DHMA 1HW9A 2OSQA 4J9KA 1YNNA 2GGPA 2K3KA 2VZ9A 4DL2A 2KJVA 1C1CA 3SCJE 4IG3B 3W1YC 4WFZA 3RAMA 4HI1A 3P5BP 4YB1P 3PYGA 4TU7A 4A47A 1BD6A 2GO8A 3KLVA 3HHNB 5F8JA 3D4JA 1TKXA 2FPHX 3HXMA 2HZAA 1K44A 5AJ3J 2H65B 1VQPB 4O0NA 2E1PA 2CVIA 3QZ8A 1UFKA 3HM9A 3GTJK 5ADZA 2JLEA 3V4GA 1QLNA 2GQQA 2FC9A 1JA0A 4NRUA 1NH8A 2UUCF 3IR5B 1UD4A 1Y5IB 3I9V9 4AYBD 4ZJQA 2J9DE 3PYFA 2RDIA 3OBIA 1T05B 4QZVB 1QSLA 4ECSA 2AHOA 2VB6A 1IWGA 1GVHA 1F5AA 1WF2A 2RT3A 2NYHA 2IY5B 2FHMA 2IVYA 1U1QA 3V6DB 5DJBA 2CZVC 4DV1F 2VNIA 1E62A 3PO2K 4N47A 4GO7X 2CQBA 3GVKA 4WZMA 4NLWA 1PC5A 4WYLA 1EB0A 1RHQB 2AYMA 3M9NB 3TFIA 1M1KD 3BGRB 4UT4A 4TVAB 5HP1B 1PKVA 2MLYA 3MXHP 4PR6A 5KFDA 3GV8B 3S2HK 5HBMB 1DTQA 3VZHA 2FY1A 3KJQB 3HVWA 2G9OA 1T03B 4Y65A 3FJOA 4GMKA 2HRTA 2LXUA 2BKOA 2V6TA 1MWYA 2NXJA 2QN6A 2HMIB 5KT7A 2OTLS 2VH7A 2YKMB 1MROB 2Y1JA 4GFQA 5ETPA 2XWYA 3EUNA 3KLHA 4WE1B 4QBUA 3TX0A 2AYBA 1DZ5A 1S1TA 4Z4ZA 4A3BK 1S1WB 3GYXB 4NL5A 4E8UA 3IN5A 3IWLA 2EFNA 2B9WA 2NXCA 4PXBA 1FDAA 2OGUA 5A8RA 2MQNA 3AJ1A 2EFQA 3JTPA 4CQ1A 1JLBB 1TVCA 4X2BA 3SBMA 1VDHA 1LWEB 4JI2F 1Q82D 1O0PA 4P75A 2F9JA 5CD4H 4B3SF 1S7HA 4KC5A 2JFDA 1CBKA 3OJSA 1B4AA 3BKTA 4OI4A 3N0BA 1SCJB 4DOZA 2LQ9A 3FKBA 5KNLA 4DQSA 1N4LA 2FLOA 1WC0A 3FBCA 2OPPA 5CABA 3OEEA 2IA0A 2EC0A 1O2BA 1EETB 4TN2A 3KHRA 1XNQJ 2BX6A 1NK8A 3D1QA 1VBZA 1TV6B 2BJDA 4JV5F 2V5HG 2HBQB 2NPFA 4UZEA 5E68A 2BW7A 2UVUA 1HYSA 4BY7K 1N32J 2N4CA 3HOYC 4ZCKA 4K4ZA 2UUAF 5FDLB 1ZAXA 2I5JB 3UD5A 4C0SA 4NYOA 2R2TA 4O3RA 3N5FA 3MFIA 1VHEA 2BE2A 3W5HA 3MMJA 3CD5A 3P26A 1WKKA 3OE7A 2PD1A 3QGIA 1R8CA 4O4GB 1QGZA 3DLGB 1QVFR 4A3CC 2Z2MA 3B8HA 1UJ5A 1QUPA 2AV5A 2QT7A 3PYEA 3QSYB 4YHHF 4BWJA 2MHNA 3H0GK 3CJ8A 2V4RA 3CCEB 1PC4A 2YWKA 4ZV4A 4UQTA 1SQFA 3K7AC 1UL3A 1RU1A 4FXWA 2HFSA 2EFPA 3VAIA 1T6XA 1K1QA 3U2QA 4X4OA 3NNCA 4PC6A 2C2KB 4X7EA 4DQIA 1UEUA 3HT0A 5EN1A 4IOCQ 3W62A 4O3QA 1XMQJ 3Q8YA 1FD2A 3N0CA 3EX7B 1ZAWA 4C8OA 4CM2A 1X9WA 1O5JA 3M8RA 2L9NA 3HHLD 4N76A 4DL0C 1YHQS 1QAYA 3LP0B 2CQ2A 2JVOA 2R7ZA 2MB0B 5AT1B 2X6WA 5KTQA 1YSJA 2OPRB 2BJ3A 3BYRA 2FLLA 1KN6A 2OIHA 1BGXT 3WQPA 4PWUA 3A8JA 3JAMY 2NVYK 1WHYA 2RGRA 1N07A 3PKMA 1NK5A 4M5NA 2D3ZA 3PRDA 2XMWA 1GT8A 2M70A 1C0TB 2GAGC 1M1GA 4ZVQB 1DDGA 4C0BA 5J1NA 2OAUA 4HI2A 4QWCA 4OX9J 1CQNA 4FKXA 1QAXA 5HMXA 2CWXA 1KR4A 2DXEA 4CO4A 2V9WA 1SJ3P 1D2EA 5GADU 2UV8A 2YNIB 4B9UA 2CRLA 2G2ZA 1YZ6A 3BH6B 1R43A 2E2JK 3PV8A 2KFZA 3ADAC 3BBBA 1RT2B 5ETVA 2QRRA 3BQJA 2J76E 2ZEJA 1E3ZA 3OVAA 4LBIA 2JA7C 4R8UB 4DX5A 4B9NA 1GXTA 3EZOA 4YEJA 1B0PA 1RTDA 3FCVA 2UUBF 4KO0A 1FRHA 2WVDA 2ZBPA 1IS1A 2FJWA 4PXCA 4BPRA 4QJVA 4MH8A 3T19A 1XZQB 2V4JA 2XI3A 1UD8A 1KJZA 4BC7A 1LEOA 2MKYA 1D0EA 4B43A 4H4KA 3ZZRA 2BQUA 3QFWA 4G65A 1AB4A 5IK2A 1SB6A 5KFPA 4LMZA 1WELA 3I9ZA 4DPUA 1DG1G 5I4MA 5CYMA 4U95A 2M3DA 1IBAA 3EM1A 3M3YK 3M1VB 1HI1A 1IB0A 1JLAA 1HIYA 2EFOA 3ZZ0A 2X1AA 2XCAA 2A6OA 4JV1A 2LCWA 5AXNA 3CCRS 2DBBA 3NOCA 2ASDA 1IKVB 2LDIA 4LJMA 4ZHRB 1RU0A 5D0RA 5F3TA 1RT4B 3ZZZA 3H5YA 3MR7A 4YFUA 1UVJA 1O2FB 3CCZA 4I56A 2PE8A 1CQMA 3VGUA 3H0GC 3UDEA 4KM9A 1TWAA 2ZL7A 1EKSA 3GIMA 3CCMS 2KT2A 4G6IA 3Q2SC 2VHGA 4UOGA 5A8KB 2FJAB 1Q82T 3QIPA 3WNBA 3RAQA 4H54A 3D0GE 4KMHA 3AOAA 2Z2ZA 5FDLA 2B8QA 3BREA 5L1KA 3LVBA 1R6YA 4J90A 3Q0AA 3VHQA 4DV2F 4NBSA 1IM6A 4FF3A 4DR7F 5G0RA 2EK6A 4NXMF 4QV2A 4A3EK 3KYLA 4QYRA 2AT1B 5C24A 4DV0J 3DLKA 2H5IB 4XDCA 3CCUS 4YOEA 3QSYA 4JB8B 2DTJA 4QW8A 1IL2A 4RNFA 3SV4A 5DN6A 2DNYA 4PCQA 4OJGA 5HQLA 2J9EA 4WKRA 2ZUAA 4NYZA 4ZCMA 2R93C 3H4BA 2XBPA 2UP1A 4A3KC 2JA5C 3M2RA 4G1PA 3OR2B 1U48A 2M7SA 5HMWA 1ZBTA 3C15B 1BX0A 1FX2A 5C4JK 3W9JA 2F1FA 1KSPA 3ZPNA 3CD6B 1RT1B 2B7BB 3UD4P 3CVKA 2B63A 1S4EA 3DM2A 2HBYB 1S6QB 1CULB 2IMOA 4PGOA 1U0SA 3OKXA 4F0MA 3N5BA 2ADCA 1O51A 2CYYA 3H94A 2BRLA 1ZQ1C 1VQPS 3NUHA 4X65F 4XKVA 1NM2A 3M8YA 3H4DA 2M88A 2VG5A 1TK5A 5JVGQ 3RR8A 1BQXA 6FD1A 4GZYA 4CYUB 3IS9B 2KKHA 3N9UC 4CZCA 2DGOA 4HDGA 5KFGA 3GFYA 4BBRC 2AWZA 4BLAA 1WORA 4B3XA 3PJXA 1YBUA 1K9MD 3SSSA 1NJID 2PIIA 1RI7A 2QMWA 4Z4VA 2X3UA 2VC0A 4CDIA 2XSFA 2MKJA 1U02A 1IBLJ 4O44A 5K8NA 2CJYB 3L4BC 2CBXA 2D74B 4GTAA 5IP7C 5GADI 4WP8A 4QYZK 2RMLA 3S17K 4A8WA 1KQSB 1HNWF 2W4DA 2Z58B 4L8JA 1K0VA 2R4FA 4FXUA 5DS7A 4DCPB 4OJHA 2VA3A 1F7UA 3MPUB 2PFFB 4LIWA 1NK0A 4B3OA 1IW7A 4A8YA 2HHQA 2RDDA 1NDLA 3TFHA 4OIXA 2W7AA 3M2VB 3KLIA 1VQ6S 4XLPA 1CNFA 5T7LB 1GEHA 4CLKA 3G71S 3KG4A 4A3EC 1XE1A 3GV5B 2DNPA 2AW0A 3A1PA 4C7QA 4BLGA 4C8LA 4B4DA 1VQ9S 3B54A 2M4MA 2VA2A 3U6KA 4K1XA 3BGRA 3ENQA 3O8WA 1UP1A 4P52A 4RNOA 3C19A 1C4AA 3DM2B 3G05A 4RD1A 1WU8A 4LFBJ 2WRMA 2KM8C 1FNDA 4YAUA 3K0JA 5A8KA 1L3KA 3T1YJ 1PAEX 1HD0A 5HMZA 1FTRA 4OZ5A 1SKQA 1VQMS 3H8YA 2O5IA 2DH7A 2C1EB 3ZO7A 3M7VA 3CCVB 1SUQA 4CO0A 1NB2A 3AXKA 1JKHB 1S5ZA 1C1CB 4PXEA 3FKIK 5C3EC 3JQQA 3PCOB 5GV8A 1YHQB 4M5HA 4AH6A 3CC2B 4I6AA 4DX8H 2IM2A 4DLGA 2VBZA 2E7WA 2K8GA 3L9ZA 3GIJA 4DL3A 4C0HA 2V7XA 1T6ZA 3N79A 2ZL5A 2XLJA 4RNMA 3S01A 3H40A 4OOVA 4XIUA 4MAKA 3F41A 4I2QB 4YDXA 3CJSA 2AYEA 4OZ3A 4RDJA 3OR1B 5LL6d 1VGXA 1XR6A 1G6BA 1FF2A 2NVXA 2E9RX 1F6TA 1XNQF 1TKXB 1VISA 3MM6B 4JI6F 4OP7A 4OV1A 4Z7CA 3S1MC 1ZUNB 3OLBA 3PY8A 3ZBTA 1VQ9B 4Q43A 1RAOA 1YJTA 3DDKA 1CNEA 3THPA 1MNEA 5BR8J 3BCDA 5FLXY 4DV0F 1MRZA 2NCKL 3LPYA 2XYPB 4JV5J 4IRDA 2XSJB 1W0KA 3POTA 1U7LA 1Q53A 4XOTA 2GNKA 2E1BA 4WBFA 2F1MA 3KHLA 5F8LA 1VYAA 5M3FK 1YJ9S 3FRYA 2MKHA 4XTTA 1RLCL 1YJNB 1T94A 1EFUA 1FXLA 3KK2A 2POKA 3S14C 2CJBA 2RIJA 4USKA 1N32F 5H9EJ 2MJUA 4ZPVR 4X62F 5A8AA 4ELVA 3CAGA 2DNZA 4M0LA 3OSPA 1G7CB 1HNIA 1O28A 4NI2A 1HPZB 3TWZA 3TRGA 4RW8B 4ERDA 3RB6A 1YTYA 2HHXA 1HQ2A 1NDKA 1TUGB 2GZOA 5A88A 1TK0A 4JOUA 3A1YG 3TX8A 4KATA 3PEJA 4FM9A 3MM7B 3BPDA 4ED3A 3EGVA 3JQKA 4NCNA 2L41A 1R8AA 1S72B 4XPEA 2HKEA 4A8KA 3HX9A 1CS4B 4Y2IA 3ZXWA 3C16B 1VJWA 5LMUF 8RUCA 4DL4A 4JYAF 4C8KA 3SXLA 1N06A 3EDRB 1ACMB 1QE1B 3OL7A 4ZPCA 2C2ZB 2A6EA 1USOA 2JDJA 4NEZA 3BV8A 4K50A 1OGJA 2NUHA 1RKJA 5KFMA 2DGXA 2Q43A 1HNVB 2PEHA 4YELA 3E01B 2OBRA 3HOUC 5J1EA 1UZDA 4YAFA 2LU1A 3NBPA 5IQ6A 2P8TA 2OEMA 4FF2A 5IYDK 1EQMA 2ZUEA 2H1YA 1KVJA 5D4DA 1R9TC 1V0FA 3OPOA 3K5OA 1WCMK 2UU9J 1X5OA 5H9EK 4F4YA 2V6UA 5KW9A 3T56B 4TKOB 4X4RA 2JDIA 1R5BA 2XM3A 3MWBA 2R92A 3PX4A 4P2MA 1X4EA 4C11B 4DF4A 2E5IA 3ZBUA 4NEYA 3CCQS 2XI2A 3BGUA 4C45A 1MU2B 2RJZA 3HMJG 3MAAA 3BKUA 4CT8A 1HVXA 4CLTA 2V6AA 3TEHB 3FBBA 1VBXA 3TZZA 4O23A 4DQPA 1N0UA 2YX1A 4X6AK 2RQCA 1A8PA 4YB6A 3CMQA 2XY7A 2FJVA 1GXUA 4Y2CA 5F3ZA 3M4XA 4P3YA 4FNIA 1KK3A 3G86A 3M6VA 2QLFB 3UN3A 1XWLA 4IO1A 1UAWA 1TL3B 3FUYA 2R9VA 4Y7CA 1QSYA 3GQCA 4JI2J 2DCUB 3QT6A 1FDDA 2MPUA 3M6XA 4O0IA 1B2RA 4X66J 3UCUP 3R6KA 3TARA 2KXFA 1R7IA 3VALA 1U24A 2P5VA 1NRKA 2COLA 3TR5A 4FXDA 1NLKL 1P9YA 3SCIE 3VO1A 3EXCX 3U1MA 4KHMA 2AJ2A 4B3RF 1VGYA 1WG1A 4V19X 2BR0A 1WNEA 3OL8A 4FPRA 5TJ3A 1VS3A 1EP4B 1FVSA 3C6TB 3AXMA 4BBRK 2HWHA 1W25A 3M8ZA 2NSCA 5LMZA 2FHKA 3D3CJ 2CDQA 3MGJA 2FGOA 2K1RA 1Z2LA 2HQCA 4NLOA 4L73A 2YQ0A 4OYIA 2V69A 4YXWA 1HARA 4NE9C 2W9BA 4C4WA 4JI7F 4C3JC 2B5JB 3S1NC 2YNHA 3K5NA 3ZTQA 3MPYA 4OI6A 4RW9B 3K5PA 1B0TA 4CH7A 1RU2A 1DTTB 4NA1A 3LUYA 1LWEA 3CMAS 3GB0A 5EHHA 4Y3CA 5IYBK 1RLDA 1S0MA 1LOUA 2UUBJ 2E2HK 3BY2A 3CULA 1XZPA 1WTFA 3T53B 5DETA 3CPXA 1FVQA 6FDRA 3B4MA 4NLYA 2XWXA 1JLEB 3M2UA 2RNEA 1RWKB 3RW7A 1JLCB 4TY8A 4IQXA 4F0HA 3DXSX 2BQ3A 3PUNA 5KFFA 1BQMB 1REVA 5C4JC 2R8KA 3L7PA 3OP1A 4M94A 4DQRA 2WOMB 3IRXA 4F4ZA 3H5UA 4OJ3A 3RGIA 1U1PA 2RU3A 1FEEA 3FSIA 2QC3A 2JA7K 4A3LK 1IKWA 1WSVA 1OHHA 2E5LF 4ZS6A 3MF5A 3TOQA 1E6YB 3CO9A 2ZH8A 4RZRA 3OFGA 4K2XA 1MLAA 1R0AA 1OB5A 3M8QA 2HYIB 4K8RA 3T1YF 4C8NA 2R2UA 2OEJA 3UWTA 4ED5A 2AD9A 2C3OA 1BC6A 3D68A 4AL6A 1NU4A 4DUYF 5SZTA 2ACYA 4LF2A 2Z0GA 3M4OK 4DR2J 1T8EA 1WD6A 3CJ2A 2JLFA 3S8SA 1NMEB 4Q5VA 3NKYA 1T7PA 1P8GA 1RA7A 4AF6A 3MM5B 2QA4S 2OD6A 3GDZA 2ALYB 1I5OB 1RHJB 1NJIT 5HKKA 1XR7A 1RYSA 1CJKA 2RQ4A 3BM7A 4U96A 2RDJA 4P26A 5ITHA 2GAHC 4G7WA 3AD8C 2IRXA 3PACA 3TZXA 3NWGA 3GU0A 2CPDA 1WF1A 4QWAA 3EZ5A 2CJAA 4UZCA 4U7CA 3SMZA 3ENVA 2R7VA 3EPIA 1DDIA 1NEEA 4GVLA 5MLCV 1MMNA 3BCFA 1VRUB 3THTA 1NUEA 3MUMP 4KHPF 1JJHA 1AUDA 3CC4B 1V3ZA 3O2IA 1YJWB 2DNRA 1GR1A 2RB7A 5D78A 3R5CA 3GJSB 2QX0A 3LAPA 5DZ6A 2GC8A 2X51A 3JQRA 1RT3A 4XORA 2O01C 4ECTA 3CF5Q 1RAJA 2KO1A 2HHUA 3DI6B 4TU9A 3R1HA 2RH3A 1JJ2B 3HLUA 3GTMC 2XLKA 4ITSA 3TJ9A 4TMTA 1FT8A 2I9SA 4RPDA 4GO5X 3CUNA 1TWFC 4MK8A 1TKZA 3SCKE 1L0WA 3ISND 2VOPA 2PO4A 2JC1A 2B7BA 1RT1A 4ELTA 1TWHA 4JI3J 1EQ0A 4L3KA 1HBNA 4RW6A 3WDOA 3SZ2A 3NS5A 3KK1A 2PI4A 1GTHA 2FQTA 4F4WA 4FVCA 3G8TA 2LECA 4LFCF 1F93A 3NAHA 5EX3A 2GCFA 3DRRA 4DV5J 3OQ2A 4X7FA 3MUVP 3S1RC 1XB2A 4NLGA 5DQHA 2MQ8A 3GTPA 2FB0A 2JX2A 3P49B 4JI0J 1FNXH 3ETOA 1U25A 3G4SS 4BKWA 4H4MA 1MWZA 3FNNA 3R5AA 4N77A 3MMCA 2HNZA 8AT1B 1W35A 3O44A 4LR8A 2DIEA 2FHJD 2RU9A 3OW2B 1XIQA 4YY3J 5I3UB 3ENWA 2YU9A 4ZVPB 3FKIA 3AD7C 3C6UA 5DO2A 2XY5A 1T9WA 2JLGA 4NOIA 3DDIA 5KFZA 1K83C 3HHKA 4NZ6A 3CJTA 1HQUB 4NPOA 1JNRB 3S1QK 1T9YA 1O6XA 3D6TB 4HT5A 2ZHAA 5M2RA 5HN0A 3OFEA 1LKZA 2G4BA 5L46A 4DV6J 4MQ9A 3AQPA 5C44C 4L3NA 1R9TA 1NPPA 1F5BA 4J3NA 2NVXK 2DEIA 3VF0B 1ROFA 1RT2A 3BB5A 4UY8T 2MLXA 4MYTA 4J9SA 2RE1A 2NV4A 2OMLA 4WIQA 2QL5B 3VR1A 1L3UA 7AT1B 1YLXA 2R7OA 4URGA 4QUZA 3GIKA 2AJFE 2RHQB 1TL5A 4FYVB 1EETA 1HI9A 4Z4YA 1R3NA 2WZNA 1YIJS 4FYXB 3KMQA 4QW9A 3R6JA 1NJZA 3I87A 5H5JA 3QJLA 1TAUA 3BY1A 5KSWB 4OYBA 3QT5A 1TMJA 5TV2A 4V1Ak 4ZVGA 3ZNJ1 4ZVSB 2WVFA 4QPXA 1SL2A 3ASPA 4A3GK 2RC6A 5JVOA 1B0VA 7FDRA 3D26A 5DRKA 5HAOA 2PMWA 1EZZB 2CUYA 5IT9U 3PENA 3MHPA 3CCUB 3MM8A 2UVRA 4ZLPA 2QE7A 3TUPA 1XXCA 2WONA 1WWHA 2Z56B 3BQ0A 1AT1B 2XGJA 2DGWA 1NDPA 1TWAC 5IYNA 3D0HE 3QRQA 1UW9A 4X64J 1RT3B 3HJVA 4U7UK 3NCRA 1SI9A 4J9NA 1GJRA 2B9YA 2BF4A 2AJQA 2PI5A 1IQ0A 4M5IA 2PT0A 3J81k 1D1UA 4WJ3M 3ZUGA 2BVZA 4U6PA 1NHVA 4LVNP 4WWSA 3M05A 1SPBP 1W0JA 1KQ4A 4DFMA 1Y5NB 1TUWA 2EBEA 2VUGA 4WJBA 5DG8A 1N48A 1K8AT 3I4MK 1HBMB 2HQGA 1S1UA 3H2VE 2WVEA 3QWPA 1M90T 4OIQA 1TWHC 3NY0A 5L39A 3VV2B 3KUHA 3GCWP 3MM9A 2UXCF 3TUJC 2GJRA 1YI2B 2KVQE 3QGHA 3AH5A 1K28D 4KKSA 4B9SA 3MI7X 3PDNA 3T5KA 2E2IK 2MKKA 3R7NB 2XY6A 4CLPA 1U47A 5HZAA 2GHWA 2QA2A 1WCMA 4DR3F 4NZ0A 2W2QP 1FEHA 4I67A 1MN7A 2EWHA 3CTRA 1AXQA 1AUSL 4KARA 2ILZA 1VQ8B 1TZ0A 2R92K 5IFMA 2ZD1B 1F0XA 1I50C 1WOOA 5IWAF 1TAQA 2FX3A 2ROPA 1SKWA 2W25A 3H9NA 2HZVA 3LW5C 5EWFA 2AHOB 1PYTA 1R8HA 1PJ6A 4RUAA 4DPXA 2IC3A 1KZLA 2HQDA 1RTHA 4LRCA 2LEAA 4BLBA 3IGVA 1F20A 7FD1A 4TT3A 3J81U 2JN9A 3CQZC 2RF2B 4P2FA 1YZ7A 3MOZA 4X4SA 3NP5A 3PA2A 5T14A 2UUAJ 3GWCA 4WZEA 4OI3A 4WCEQ 1R6VA 1UWAA 2AJ4A 3PFOA 3TVKA 3PW5A 3FCHA 3CE8A 1Q86D 4DR4J 2JIZA 4ZPAA 1U1LA 4P73A 3DRYA 2IDEA 2XHWA 4XN3A 5KFEA 3ISZA 1EHWA 5DM7Q 3ASSA 1QJHA 3I4HX 3IBFB 2RRNA 2EC2A 2YKAA 4GVBA 4FWTA 3MEGB 1LW2B 3BSAA 2BVNA 4WK3A 2DR9A 3F0NA 3Q8VA 3I0SB 2E29A 1FKOB 3AB2B 3GZ7A 4OX6A 4FF4A 3RRHA 1UVMA 4DNRB 1RBAA 1H2UX 2LVWA 3PG9A 3DU6A 3IO1A 3H20A 4NMXA 1UMJA 2HFVA 2VQEJ 2V68A 1YX2A 4EFAC 1FE4A 3S2DK 3I4PA 1N05A 2YY3A 1N36J 3FEZA 2OFGX 5GAGU 3DLBA 3I4NC 3RB3A 4ES2A 3THVA 1NK9A 2B51A 5TY0A 1EFCA 1B64A 1IUJA 4ZVHA 4A3DC 2QN6B 2HMIA 2FVRA 1N08A 2N82B 2JRSA 3T9ZA 1HMVB 1HBUA 2YXLA 4URQU 3MEEA 2WZPP 4NLXA 1RT7A 1ELOA 4A3JK 3J80Y 3OTOJ 3OJXA 2FLNA 2ZFZA 1FNBA 1RADB 2OI2A 3P5TL 1ISEA 4LFAJ 3ONQA 5C42B 3S17C 1NDCA 2GJIA 4OI1A 5C25A 4F4AA 2HHSA 4A8OA 3JSBA 3KG0A 1F1BB 5DG9A 3JQJA 2VJVA 3GCXP 2F40A 1HKAA 1PBUA 2J7KA 2BZ2A 2XGQA 5DDOC 3A12A 2CQGA 4N3NA 1N5QA 2F63A 1PAUB 2GW8A 3IXQA 2C3YA 1NK7A 1QAJA 4DR4F 2V2VA 3ELHA 4DQKA 4A8SA 4OJ1A 2V2KA 4DFPA 3BR8A 4HTJA 4I2PA 3RBDA 4K4VA 5CYQB 2DR5A 4CO1A 1RAEB 4FXVA 1SKYB 4NMLA 5H9FJ 3B6BA 3PW2A 2D41A 1T9UA 3GVLA 5E3PA 2W1BA 3PA1A 2YH0A 1U1MA 5C24B 1GQEA 4IKAA 2HDNB 2UVVA 2UXDF 2X8KA 4RNHA 2I8EA 1CG2A 5BYRA 3OV7A 4QWEA 1GXLA 4YAOA 4OZ2A 3W8PA 1KK0A 3AA8A 3SCLE 3QX3A 2YX4A 5J3OA 3MR3A 4Z2XA 2CNOB 3T1HJ 3HT3A 2QSWA 4OLPA 2Y3PA 2VASA 1C0AA 1H74A 4GQNA 1B7YB 2E1AA 2G0CA 5HSPA 3BP8C 4CO5A 4M8LA 2CQ0A 1VLOA 3ERED 2MY7A 3FHZA 3W2VA 2JH3A 3GYNA 3AVWA 1FTCA 2MHEA 3H42A 4JMQA 1Y5LB 3WYAA 2J0SD 1J5OA 3Q3AA 4ZDNA 3VVUA 4IRCA 3I5BA 3TUZC 3D9BA 2MZRA 3GVJA 1YGYA 2ZITA 1TKTA 2DNNA 3O1LA 2VUMC 3AJDA 1H3DA 4JI1J 2CRVA 4GTEA 3R2CJ 2I0XA 2CFXA 5IZHA 3DI6A 3HOZC 3BS9A 5A6WA 1TL7A 3HSJA 2Z4PA 4DU8A 4A3LC 2GJFA 2DCLA 1RWWB 3O5TB 1BY9A 4RW4A 1CJTB 4RUHA 2R8HA 3F44A 3D54A 3MAQA 2VQFF 3K58A 4RM0A 4XLFA 2UUCJ 2Q79A 2YWFA 3CCLB 5HL7Q 1U2FA 4YR3A 3FGVA 3WBZA 3PR5B 2U2FA 3ONYA 2VKZG 1TWCK 1TWHK 3GTPC 2NXEA 3A13A 3MTKA 2K2PA 2IMWP 1N5VA 3ZC3A 2XMJA 4KH1B 5E3CA 3GIIA 4F50A 4KB4A 4ZN1A 2KN4A 1WG5A 1S9GB 1X4FA 1JKHA 2E2HC 3OREA 1WHXA 1ZH5A 2LXIA 4H4OA 1H85A 4C3LA 1T9XA 2KYZA 2V50A 2B9EA 1Q79A 2DGVA 5DQGA 3BEGB 5L8RC 2IBOA 4F04B 1YRUA 3NG8A 5IP9K 1T3NA 3GTOK 2XCRB 1WSRA 4JI0F 4CTAB 2QTLA 2DVIA 4DK1A 4ZVFA 2RVJA 5B0CA 3SKBA 3ZC4A 3AODA 4LVOP 5KFWA 4ILRA 2W4CA 2JJ4D 1FKPB 3JAMU 2DHAA 3CWJA 3CC7S 5C5JA 2V4DA 1FJ7A 2HSEB 3Q8QB 3DOLA 4NX9A 3MMPA 3DNCA 4LF7F 2F5GA 4A46A 1DCHA 4A3FK 3CJKB 3MCAA 4NASA 2HNYB 3R5JB 4FNHA 2VKRA 2XZTB 1QG0A 3IR7B 4IRKA 4ILLA 5D4PA 4HDHA 4PWWA 3QFTA 3CMAB 4OIOA 4TY9A 1KP6A 1D09B 2RAQA 2X7IA 1R89A 2MY8A 2UZAA 2FQQB 1WI8A 1FX4A 1SJ1A 4NA2A 1TWFK 1U45A 2ZNYA 4LBYA 2QE5A 3BO4A 4X8IA 2LEBA 1HBNB 4PQUB 4Q7JB 3AA9A 1VIXA 2M0GB 2HGMA 2EFVA 1WOSA 1VRUA 5HQMA 1JLFA 2A0FB 1Q4RA 4YP3A 1R31A 2OSRA 1YJRA 2HHHF 1JB9A 1WC5A 4ZJLA 3R5DA 1MW7A 3CC7B 4HLBA 4GC7A 2VIHA 3ILIA 2F4NA 4DUZJ 1HBUB 2LA6A 4K5RA 4KH0B 2BGJA 1S1XA 3NS7B 1CJVA 3E1YE 2FTRA 3I4NK 2G13A 3U1NA 4MEYA 4G5GA 3I1FA 4I6YA 1I51B 3R5GA 2C3MA 4IDKA 3VCDA 1T03A 2PMZD 4U9UA 3DMJB 4R5PA 1UTAA 5T7LA 2QSFA 3W5UA 2WAQD 4PG6A 1U0HB 1J6XA 4DS4A 1NKEA 3PNIA 2KG1A 1SL1A 1M0SA 2BPOA 3FZBA 4XO0A 2J9CA 5MAOA 2CFAB 1GMWD 2GIRA 2PSZA 4XAKA 1NAQA 2Q1LA 4XSZA 3KLGB 2CQHA 4IFVB 4LF5J 2VF3A 2JA8C 5H9FK 4DSFA 3G4CA 5CCMA 2J6SA 2KVOA 4J91A 4O44B 4B3TJ 5IM0A 1KK1A 3GFHA 2WCXA 1B23P 2Q6BA 2KFNA 4C43A 1KHVA 2O5JA 3OAAA 2XMTA 4NXMJ 4FZBA 4GT9A 4LOWA 1G1XA 3GFZA 4ZP8A 5AXLA 3RAXA 5IORA 2R93A 1VIOA 4M5DA 5DM6Q 3EZUA 2HS3A 5J2MA 3GYGA 5KFTA 1P27B 3PHEA 3A8KA 2DCUA 1WPCA 3M4OC 3UVJB 2W01A 1TL3A 4PEOA 2CQ3A 1FDNA 1YJUA 2IAJA 1U8SA 1B3TA 2PA8D 3PEHA 2E2IA 1IXKA 4F25A 2RRBA 2ZWPA 1VQ4B 4X4UA 2EW9A 1OS5A 3MM9B 1C4CA 1D1NA 3OFHA 1VHFA 1FNOA 1S1UB 4OFZA 3MECB 4LSZB 2FZCB 4PABA 3GEEA 5IOTA 2OUGA 1W87A 4CLLA 1MG7A 2YU9C 2Y8YA 3W5YA 1DTQB 4DSLA 2ZD1A 4I69A 4OHWA 3VVTA 2GJKA 4LBPA 3AVXA 2LU2A 5KT4A 4PKDB 4RL1A 1IKWB 2N4DA 3VA7A 5IYBC 1CQXA 2Z6BD 1TELA 4M5JA 4DCOB 3LP2B 3S6EA 2ZJPQ 2LLZA 2OPSB 4X64F 3ASRA 1Y7PA 3Q83A 2XQCA 4LF4F 1S6PA 2XS2A 1RHKB 4JI7J 2HK3A 1TWGK 4JI8J 3CJKA 2CQPA 1QM9A 5DLFA 4FDFA 1D9FA 4DV4F 5E3AA 4OZJA 2CQCA 2IRUA 5L1IA 2OPQA 4BCAA 1KNZA 4PAAA 3HO1A 1IQTA 5D8HB 5KFNA 4ZOSA 4DX6A 3PUMA 2AU0A 3NCPA 1T02A 2YVSA 2E1CA 4YALA 4TNOA 1S97A 2RH6A 3RR7A 3HOXK 4FYWB 1UVLA 5JVHQ 3BGLA 1DTTA 3SEJA 2XNQA 2AIRB 2DD8S 1QX4A 3A3PB 1DD5A 5B09A 4B02A 5CAAA 3KNGA 3QE2A 1RWOB 4LSNB 4OI2A 1ZETA 4U8VA 2BMWA 1JWWA 3JS9A 2QDXA 4ZCIA 1VMBA 2M8HA 2KXHA 2AZ3A 1LQ9A 1TR0A 5FNZA 3N01A 3A4TA 3AT1B 4DV4J 1RTJB 4C8ZA 3BNWA 2ZVIA 1IKYA 3OUYA 4XOPA 5DG7A 4PXDA 2XS5A 2DRDA 4J37A 1AROP 4BY1K 1S0NA 3QT8A 3OW2R 1NDHA 4USJC 1NO8A 3OZUA 1S10A 1YRXA 3Q3QA 4A3MK 4KKUA 3KUEA 1ZA1B 4DR1J 2VD3A 4XONA 4X4TA 1HBOA 4A3FC 1GAQA 4LUBA 4P5BA 1M5HA 4UF4A 1KC8T 5DGBA 1AB8A 3HF5A 2HMAA 2CPFA 4DHVA 1HPZA 1JNZB 4BY7C 3F56A 2QYGA 4YY3F 3R27A 4KTQA 4C3HK 2OTLB 2NVXC 2ZXIA 1K1SA 1SH2A 3CESA 4DV2J 2E9ZA 4ZGNB 3KHGA 5AE1A 1SVDA 3QGGA 5IT0A 4F3MA 3L7OA 4OZ0A 3GTJA 5IOSA 4BXXC 2ERRA 4MJKA 4MKAA 3GFXA 3QNWB 4Z4WA 2R9LA 4H9GA 5LT5A 3LPEA 1D9DA 4B47A 5JJBA 4J9VA 9RUBA 5LJ3Y 4JI5J 2XSJA 3BC9A 4DPOA 1UVNA 2VJJA 2B63C 1KKHA 1LFWA 2N7CA 4TXSA 4RW8A 4DLEA 4MTPA 3W5ZA 3I6PA 4EK2A 3W8GA 4LRDA 1G2EA 1BMQB 4JYAJ 1X4AA 3KG1A 2ZZQA 4KR0B 1O25A 1Q9SA 5FA6A 3MEEB 4XM3A 3J80U 3TA1A 3A3NB 2BJ8A 2DHXA 2C78A 4G7ZA 4F02A 3S1RK 5FLXU 1NSKL 2VG7A 4KE5A 4USMA 3MECA 5F8IA 5IOQA 1GX6A 1FHTA 3RB4A 4G1VA 4KBIA 2PA3A 5IXUA 3SJZA 3S15C 2HLUA 3MMCB 1S6PB 3TI0A 3AH6A 1IBKF 5EGYA 2ZOMA 1PJ5A 2GJ2A 2OMOA 1I3OB 2UU9F 1TU0B 2P9EA 4C97A 2D3NA 2J0XA 3CD6S 1CS4A 3DU5A 2QL9B 4GKJF 1EXMA 2R7SA 5KFRA 2IRYA 2HAIA 4ASUA 3OLAA 4ES3A 4CI0B 4ECWA 5KFUA 2LQJA 3ITHB 3TZYA 2CXEA 1X7VA 2WW8A 1ZOTA 3C66A 1UD2A 3RU0A 3H98A 3OHAA 3H59A 3W64A 4F8RA 2R7ZC 2MDAA 1M5VC 3E51A 1F7VA 1EX8A 3WIVA 4O4RA 2V7UA 1FK9A 1T95A 4KN7A 1TVRB 4DUYJ 2B4UA 4LSNA 1HI0P 2DO4A 5C25B 1S57A 3T00A 2WW4A 1S0VA 5AXKA 2NZ4A 1JMTA 1BGWA 4KHPJ 1VRQC 4MIAA 1R8PA 2XMAA 3HHEA 2BV3A 1JB0C 1IJEB 3TYTA 1EI6A 1Q7LB 2HNDB 4KSEB 3TA2A 2XG8A 4I64A 3V5RA 1KRHA 3C6TA 1W7WA 5DQIA 1F9NA 3C14A 4HVZA 4RU9A 1WCMC 3U7JA 1LWFB 4LR9A 4FK8A 1SV5B 3K59A 2NPIA 2J6UA 2V8GA 4Q0BA 1WF0A 2WJYA 4LF1A 2ZH9A 2HQIA 3GTGA 2GIQA 3HOWK 4Q7AA 2AP6A 4GTDA 2Q6IA 2DR8A 3CD0A 4LK0A 2GVZB 3W2GA 3KKFA 3PVDA 2BANA 5J2NB 2NVTC 2H9ZA 2JEIA 3HFVA 4P2XA 5GMDA 1Y0YA 2J5AA 4CLYA 2H48B 4O3SA 2XNCA 3NOGA 1V9OA 3GTYX 3A3GA 4OYOA 3MD3A 4OOXA 2BJEA 1RWNB 3DRPA 3CNQP 3WZ0A 3W66A 5ETNA 3W61A 2XTJP 3Q39A 3KK3B 1YDLA 1NKBA 2JA5A 2RKIB 2HNYA 4ICLA 3PO5A 1SQEA 3Q6RA 4M5GA 2E66A 4QWDA 3DDNA 1S7IA 3BSOA 3EWGA 3S1TA 4ZPWR 3OJWA 1O26A 4HACB 5KT6A 2BABA 4AFFA 3A8IA 3I5CA 1CC8A 2GX8A 4PC7A 4O4GA 1HHTP 1ZZFA 1H6KX 2RC5A 3CCTA 4EZ6A 2ATCB 2F8MA 2YTCA 2CZ9A 1U4BA 1TWFA 4YQWA 4CQJA 2P9CA 2KFYA 4PC3A 1HNWJ 3TW0A 2VUMA 2VG5B 4GTFA 4H4OB 3NGSA 2QA4G 4CTAA 2D3LA 4RBUA 3DLKB 3HSGA 4JUZA 3US5A 1QAIA 3O6QA 2ROGA 4WIIA 2J8AA 3R3TA 4EU0A 1B4BA 4X4QA 4ACBA 2QIFA 3CTAA 4LFBF 3N3YA 2PIAA 4C3IC 2CNDA 1GTEA 2C22A 1NPRA 2JWNA 4YFXA 1KOHA 4G1IA 3Q8UA 1YWXA 2NXUA 3EICA 3Q6QA 1SL0A 1U0HA 1JLGA 1ZXOA 2JEJA 2DNKA 1AIPA 2GVDB 2ZC4A 2APOA 5A8RB 1A7GE 3DOKB 1Y3KA 1JNYA 5U47A 3ZTSA 2HLTA 2NZCA 4H4KC 2P9GA 4ECRA 3OEPA 4KB2A 1X5TA 4WTOB 4LBZA 1AMOA 4F67A 1V6HA 3HD1A 1DQ9A 3KLEA 2B5JA 3GTKC 2VBXA 2AJ0A 1H0HB 1H42A 3GJTB 4DV1J 4C48A 4IH7A 4NLRA 2CNLB 2KWAA 5CCLA 1BLIA 3PRBA 1URRA 4X07A 4I4BA 2AGQA 4RPBA 3G9CA 4LQ9A 3HD2A 3G6VA 4OYZA 1OSDA 3NMRA 1JQWA 2LXFA 1F9HA 2LQBA 4DCJB 4ZLLA 2DGTA 2RUGA 3ZZOA 3K2YA 1WDTA 2GMLA 3QLHB 1NNDA 4EI2A 4ZVRB 4PQAA 1RABB 2V2ZA 5C4XK 2EG2A 1Q86T 4WQMA 1C0TA 2E7XA 2K3IA 2AMCB 4W4MA 3Q89A 4HHJA 5F9LA 1F60B 2F1LA 2V31A 1RWVB 3K89A 5J35A 4AXIA 4B48A 4P22A 5BSXA 4PC2A 2AYGA 4TYBA 3BZQA 4G1QB 5FIUA 3GTKK 5HVHA 4TSFA 2Z2YB 1UCNA 4DNTB 1JX4A 3MEDB 4MMOA 3FKSA 4UZFA 3DYAB 3D28A 3C16A 1JXVA 2MMYA 2BE5A 5M5XK 4P10A 3W65A 2C3UA 4Y9RA 5GMKa 2FVGA 3ZNUA 4OX7A 2D9OA 4I2PB 1FNCA 2FVPA 3TAMA 1ULRA 1HL6A 1TWGA 1T5EA 2BE9B 2NS1B 4Q45A 4DU7A 4AF7A 3T6JA 1D3WA 4USHA 3DC2A 3EVWA 3C2PA 2YKQA 3DLJA 2JZ5A 1DCPA 1RAHB 3I5AA 2WB1D 2PFDA 4QCLA 5J1PA 3AVUA 1RTIB 4ED8A 2C2DA 3JQPA 2Y1LB 1RWPB 1HR0J 2Z2LA 2V8PA 4DSKA 2IM0A 1XXBA 4ZN3A 3S16C 4K4TA 2IVFB 4QR1A 1VCTA 1KLMA 1AYEA 3CCSB 1XMOF 2OPRA 2YKPA 2QO3A 4YHHJ 2KZZA 2OEKA 2PEBA 2KDOA 2DIUA 1SXLA 1VK3A 3FEXB 4LLGA 3I4MC 1BJTA 1Q81D 1TKDA 2GK7A 1K9MT 2RD5C 3A8EA 5KFQA 4K4WA 4Z7YA 3JXOA 4A3IK 1HW8A 5KG5A 4EBCA 3CJRA 2NVQK 2X3GA 2HW3A 1XN9A 4W90B 1VR6A 2XZLA 3T6BA 2XNJA 1KWMA 2A69A 1Y1WC 3HCXA 4DFKA 5A89A 1OMSA 2YH1A 4IDKB 4EBEA 3UCZP 5D6GA 1O8BA 1RBOB 3G4AA 1N5SA 1VRTB 2AEFA 1S1WA 4EBDA 1YQHA 5HO4A 2KVIA 3JB9k 4N5SA 3LALA 1LK5A 1TMMA 4OIRA 1NBMA 3BN7A 4KDDA 2NYIA 4LSLB 1SKRA 2ZBQA 2ASYA 4DSJA 3D0IE 5HLFA 2E5GA 3C15A 3RZOK 5CA5A 4LT6A 4AVZA 3LA0A 2UXBF 3RBZA 3M2RB 3ZZYA 1W2BR 1BMFA 3GMGA 3V6HA 3P96A 2MKIA 4CH1A 4IUFA 2HHHJ 3M8PB 4C6AA 3IGNA 3N6NA 3QAUA 5B0GA 2Q6CA 3GSIA 2GVDA 2B4PA 2PE3A 5LMNF 4RD3A 2QLWA 2GSOA 5HBMA 1HHSA 4QIGA 4C98A 4J9UE 1HNZJ 1QUEA 1WP6A 3CRZA 4RLEA 4QOTA 4MIBA 3HP6A 4G7HA 1AW0A 1C0UB 3AVVA 3CCJB 1OJ4A 3I56S 4PYAA 4WU2A 1URNA 3SQGA 3EVMA 3FJ2A 3S14K 1N88A 1TL4A 3UO0A 3WHIA 3PW0A 4WFYA 4I7FB 2B5OA 2MZJA 1ZA2B 2DNMA 3BO2A 2L9DA 2IPOB 5IYPA 1E3XA 3G71B 5EGEA 3UDVA 4IO9Q 1BDFA 2BJ1A 4YHBA 4Q2LA 1H38A 5J2PA 5KFIA 1IBLF 1HNXF 3ZIAA 3K5MA 1TUVA 4CYUA 3EJMA 4B9MA 4W92B 3HI9A 2ZUFA 5JUMA 2N3OA 1YITB 3FMBA 1CEZA 1HZEA 4KGKA 1D9AA 2IC3B 3F73A 5JBQA 5KG2A 1QFZA 4Z1MA 3TJ8A 3A3BA 4DL7A 1LWFA 4DX7A 5KFYA 3IP0A 4X84A 1RZMA 1EFRA 2MZ1A 4RPFA 3DRXA 3HHLC 1NB0A 2ZH2A 3PR4A 4V19J 1SQGA 4DPWA 2HFOA 3NS6A 1HQEA 1HMVA 1FWKA 2MQOA 4RLZA 4YDDB 2BA9A 3OD2A 1XMBA 4MKVA 2R6HA 2KH9A 3FQLA 1J2VA 2GMHA 3W5VA 1S6QA 1KTVA 2FC8A 4Y00A 3PO3C 2P6SA 3DOKA 1Q78A 3T01A 4PC1A 3NAIA 2V8VA 3QFHA 4RD4A 2YNFB 3UW1A 1RT6A 2GHVC 1S49A 1A9NB 1Q5VA 4KY3A 2DPJA 1RJJA 1GFWB 3ILLA 1G7TA 5B7WA 1LXJA 1JLEA 3M2UB 3PVXA 2HG4A 3VO2A 1KQSR 2RQMA 3IRWP 4CLZA 3NNAA 1U6BA 1UFLA 2DNOA 1RACB 3H3VD 2IJRA 2U1AA 4E2FB 5D4NA 3LGHA 1OQ3A 4X4NA 3V4MA 4XDDA 5BYSA 3QJJA 3G6ES 3V6DA 2WR8A 2UV8G 1NJWA 3GTMA 4LR7A 3FQKA 4HT7A 3HPOA 4RWWA 5M3MK 2ZBUA 5B0DA 4DF8A 1KQFB 3NGTA 1VRTA 1ZM2A 2K1RB 4CRJA 2DH9A 2L9WA 3HKZD 1FRMA 3VGVA 1LK7A 3GTGK 4A8QA 3HOVK 4RKUC 2IHR1 3OL6A 5KFBA 1LNQA 3IWXA 1Q1KA 2ZTNA 1UJ4A 3HHLB 1DY3A 4LF8J 4B3SJ 4EUVA 1TK8A 1TQLA 3TUIC 3OTDA 4CLSA 3CXCB 4KGMA 2C5HA 5IC6B 4F4XA 2KZMA 1J6VA 1D8TA 3KEWA 5CXTA 5F9NA 1UA0A 1A6LA 1R0AB 4NLTA 4DK0A 2JA5K 2GA7A 3T1AA 1VQ5B 2DETA 1V3SA 2MEWA 1IHMA 4DWIA 3JSMB 3H5XA 3FBEA 3LP0A 1KS2A 4YN3B 1M5KC 2CPIA 1QE1A 5H1SV 1ZAVA 2RKIA 4KB7A 2OELA 3ISXA 2ZBIA 3GR0A 3VMFA 1QFJA 2AEMA 4P6QA 1HNVA 1BQMA 1E43A 2H54B 3HVTA 1XC9A 1FRNA 2CW0A 3GP9A 1Y4ZB 1E6VB 2HQ3A 4X05A 3SZYA 2BJ7A 3SLDA 3CD7A 3JTOA 2ZDOA 2HBRB 4KPCA 1VC0A 2C5BA 3HOUK 5KG6A 1UD5A 4I6WA 5ETSA 3MPVA 3NGUA 2VU5A 2HWTA 2VFUA 3IAS9 1T6YA 4MK7A 5AE3A 2CQIA 1Q0NA 3G2XA 3RZOC 1I3QC 4NCBA 4RCYA 1S99A 1QTMA 2W8KA 4IH5A 4B3TF 2J0QD 5A2QY 4OPOA 4E0DA 4ZA1A 1YLOA 5EX0A 4XSXA 4NNJA 2M2BA 1RT4A 5HLFB 4NOHA 2ZFHA 3LP1B 4P6YA 4QHYA 4N8NA 4CCHA 1UD3A 2EIXA 5F4MA 5L1LA 4PWDA 4KFBB 2MKSA 1PCAA 4CP5A 1RQRA 3C6UB 5CH7B 4LFAF 3FBFA 4G7XA 4DV7F 4NLSA 2W4PA 1FD8A 2XZDB 2R7UA 3QT7A 3PX0A 1S1VA 4ROXA 1VK8A 1N5TA 3E2EA 3PTWA 3KTQA 3E3XA 3ZTOA 2XULA 1QD1A 3KK2B 4O3PA 4Y6IA 1F9EB 4LFCJ 3Q38A 3PW7A 3LPXA 2XLIA 4WZKA 5I3PA 3V81A 1EP1B 5ETOA 2IVMA 3W7BA 4GKKJ 3UD3P 4TMWA 5AJ3F 3FVYA 4KMAA 2P2CB 3PJ9A 4CIOA 2A6MA 4EH1A 1QVGB 3SIPB 1MABA 1OIAA 2DHGA 2ZJQQ 5M5YK 1VQLB 5I42A 3BR9A 1SJFA 1RTZA 3FC9A 1XTZA 1OB2A 4WWVA 2OPQB 3GTQK 3SI8A 4WXOA 2JC0A 2GQCA 2B3TB 2R8GA 5LJ5Y 4ILMA 1D8ZA 1VQSA 2XZOA 2ZNZA 3NE5B 3KNAA 2Y0SL 1HNIB 4DR5F 2WAQL 3TAQA 5LM7E 2A3JA 2YNFA 3LTOA 1FRXA 1SM4A 3PIPQ 4XD7A 2ASLA 4YFNA 3N28A 1OPZA 2QA4B 1AA1B 1KDNA 2V34A 3TA0A 2QL7B 2E2JC 4OYPA 2WVCA 4XR6A 4R25A 1EH1A 1QVGR 1DLOB 2KU7A 1SC6A 3E8OA 2L08A 1T0TV 2C2OB 2BN4A 4RD0A 1IKYB 3OUYB 2F4VF 2QLJB 3GIRA 5LSLA 2YKOA 3GTJC 2VBWA 4ZP9A 3DGPA 4ZK7M 3VNUA 1VQOS 3W2WA 4A93C 1YI2S 3DRRB 4C3JK 4DV7J 2W7PA 1N8RD 1H2TZ 1FXDA 2AZ1A 1VQ4S 1HD1A 1JA1A 3CMEB 1Q8BA 4A3GC 3MCOA 1X4HA 3OW7A 4RD2A 1PGZA 2B43A 1YJVA 3LP1A 2KJWA 2IJFA 9ATCB 2CNKB 1IBCB 3ILJA 4YB7A 2XO7A 1I3QK 2B56A 4ZPBA 4QIWL 1QH0A 4J9LA 2E7VA 1WTBA 4ZP6A 2FD2A 4ANDA 4X7DA 3RUBL 3RBEA 1WQFA 3R1LA 3C46A 2V7WA 4RUBA 3VAFA 1BJKA 2ZXHA 4ZPTR 2WTFA 3KFWX 1X8DA 3SJPA 4BS2A 4DQLA 1HWLA 4RW7A 1KRPA 4N56A 4PG7A 1RQPA 2OPPB 4R0EA 4OOSA 1U1RA 1O24A 3UFCX 4BY1C 3VGSA 2AKWB 2F7VA 2W2PP 3H7HB 2HBZB 4OYXA 3ASTA 4JV0A 2VJUA 4P7TA 4B9LA 3CGIA 4RW9A 1HR0F 4RDLA 4B3FX 1NZAA 3Q86A 3SV3A 4Q44A 1AZSB 1HYSB 1RAAB 2EKYA 5IYCK 2C2MB 4OPVA 3D1HA 3ASQA 4JI1F 5D4OA 2BDPA 3BH7B 5HL8A 2X53S 3S1QC 3BGOP 2GJPA 4OX8A 4G0VA 3TANA 1XMQF 2W9AA 2VZLA 5KAKA 2F65A 2J9DA 3BBFA 1VQKS 4ID5A 1FFSB 3CCMB 4EZ9A 1Q8IA 2WBMA 1X31C 1TP7A 4JI5F 5IYDC 4DXLA 5GAGI 2NSBA 1G7SA 2ZM6F 2YKNA 4AD6A 3OR2A 1WC4A 4B3OB 5HP1A 2QV6A 1ZBSA 1SC3B 2X1GA 2QG9B 1E1RA 4B9TA 3I56B 1RAIB 3GQBA 3HULA 2VBUA 4NLQA 3AAWB 3DLHA 3AOCA 2ZKUA 3IBCB 3UR0A 2VNHA 2L3MA 1KLMB 1FRKA 4B3RJ 3H5SA 4AQYJ 3S2HC 5IYQA 4N3GA 1JLFB 4OHXA 2E5HA 4WE1A 3K7RA 4WTYA 2QGFB 1Q5YA 3Q23A 2WOMA 2IM3A 3KLGA 2UXDJ 4LF6F 3ET6B 3SEOA 1IBKJ 4A3JC 4USWA 2MYFA 1YK9A 2N3LA 3CCRB 3VAGA 3ES9A 3CP8A 2LQ5A 2Y3YA 4WFNQ 2JL9A 3GJRB 2FZGB 2RHSB 2PN6A 3CDAA 4YUDA 1XZPB 1YIJB 4TMVA 4R5PB 3MM5A 4Y52C 4LF9J 3J81Y 1FKPA 5HXBA 5C2GA 2R8JA 2EVZA 5A0YA 1WC1A 3KXDA 1YBAA 4Q0BB 5C2CA 3HHDA 1RWMB 4B3MF 2R42A 4ED1A 1X4GA 5LXYA 1BQEA 2EK1A 4KGXB 2CDRB 2EEYA 4QIWD 4Q2MA 1L3SA 4LC0A 3KMSA 1RCXB 1AZSA 1H2VZ 4NRTA 2F4VJ 1PG5B 1I94F 4CLWA 4CM0A 4EGLA 2VYQA 4KN4A 2HNDA 4LF6J 3CDEA 2WK4A 2H51B 3P27A 3MR2A 4F2SA 4HE6A 2UUWA 2IFXA 5L1JA 1UVIA 1TL1B 2M5SA 5KG4A 1CVJA 1I6VA 1IN0A 3QZ7A 4KC6A 1RK8A 3HDSA 2ATLA 3H90A 4ID8A 4HYKA 2ZZGA 4A93K 4Y2KA
chains in the Genus database with same CATH topology
1WSRA 3GSIA 1XZQA 5L46A 3ADAC 3TFJA 1YX2A 4PABA 1XZPB 1PJ6A 3GEEA 2GAHC 1NRKA 3AD7C 3TTGA 3GIRA 3A8JA 3A8KA 1WOSA 3GEIA 4P9SA 3AD8C 1VRQC 1WSVA 1WOOA 1VLYA 1PJ7A 1WOPA 3AD9C 1WORA 1XZQB