1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Aminomethyltransferase
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
1WOPA 1VLOA 3AD7C 1XZPB 4PABA 1WOSA 3A8JA 3GEIA 3TFJA 3ADAC 5L46A 1X31C 3AD8C 1WSVA 1XZPA 2GAGC 1VRQC 3GEEA 1PJ7A 1WOOA 4P9SA 3A8KA 1VLYA 2GAHC 3AD9C 1NRKA 1XZQA 3TFHA 3GEHA 3TTGA 1PJ6A 4PAAA 1PJ5A 1WORA 3A8IA 1YX2A 1XZQB 3GIRA 1WSRA 1V5VA 3TFIA 3GSIA
chains in the Genus database with same CATH superfamily
2C2OB 2CUYA 4CQJA 4I2PA 2C42A 3NOCA 3MPDA 4MK7A 4TMVA 1XZPA 2G9OA 1J27A 3C6TA 5LXRA 5IT0A 2YWFA 3LP0A 2WSCC 1SKYB 4FXVA 2FX3A 1KKHA 3BBBA 1KHWA 2P5VA 1XMQJ 4C0BA 3IM8A 5IC6B 2UU9F 2EVZA 4FS1A 5GAEU 5E3CA 1AYEA 4Q4ZA 1X4EA 3MCNA 4N3GA 3Q23A 1U6FA 4USTA 5JVGQ 1U1LA 2DYIA 4A8YA 3NMAA 4OPSA 3A3GA 3FQKA 3CDWA 4DOZA 4C48A 2N7CA 5IP9C 4IOAQ 3ERED 4NZ0A 5C2GA 4LQ9A 1RT6B 3DI6B 2ACYA 5KFYA 4DR2F 4LF1A 1KC8D 1P27B 2GHPA 1KLMB 5HMXA 4CZCA 3AJDA 4OJ3A 2IMWP 4WFYA 2ZJPQ 3H94A 3QAUA 4ELTA 4CYUB 3JB9k 4C8LA 1RTIA 1S1TA 3GFZA 2KM8C 4C11B 4FF4A 4ZMMA 5L1JA 3SJZA 3QYYA 2XGPA 4PG7A 1W7WA 1CJKB 4HTJA 3CD5A 2KYZA 2MKKA 2AHOB 3M9OB 1VK8A 2XTJP 4RPBA 2VOOA 3FKBA 2ZKTA 1TELA 1QSLA 3LNNA 2N4CA 5E41A 2HPUA 3VAGA 4WCEQ 3DI6A 2VA2A 2IYGA 1YWXA 1FJ7A 4QR2A 1QDUB 2KWAA 4RUCA 1OWXA 4OZ3A 4BXXK 3NGTA 2XC9A 3TOQA 2HLTA 2FLNA 3QGIA 2IIHA 1FKPB 1OYEA 4DSEA 4RW6A 3H90A 5IWAJ 4UZUA 3PYFA 3EPGA 3ZBTA 2K7JA 4B3SJ 2MKHA 4ROXA 1OJ4A 1WC6A 3AH6A 3QT6A 5IP7C 2HS4A 1T05A 5E3PA 4N56A 3KUGA 3FPKA 3WHIA 2VDHA 3KFWX 1FHTA 3R2CJ 4IH7A 1SL2A 4DUTA 3AVXA 4OX6A 4ED1A 1V9OA 2KT3A 2PA3A 5L9XA 2NZ4A 3G4SS 3FHZA 1M5HA 1FT8A 2RQMA 2N4DA 4KMHA 4Z37A 1YK9A 5IT4A 1S9FA 4JI7F 4RO0A 3V81A 4W4MA 4CRJA 2J6TA 2ZHAA 3K5PA 2AJ0A 5H59A 3GQBA 2R7WA 4K4UA 4IYQA 3WXMA 1D8ZA 1AW0A 1RT5B 1R0BG 3P8BB 5HK4A 5M3FK 1JXLA 1IBKF 2HZAA 2W4PA 4KGZB 4JI2F 1N34F 3DYAB 4DL6A 4A3BC 3HZGA 3CJ4A 2J9DE 3U1NA 2B5OA 4IFVB 5HLFB 1D1UA 4DDFA 2VUMK 1KVIA 4HEA9 2HK2A 1Y11A 1PCAA 2NV4A 2DO4A 3Q8RB 2FZCB 1WD6A 4DNRB 3CCUB 3FKIC 3FOFA 1IQTA 4R0JA 4C0SA 4CNYA 3B78A 3CCMB 4GVBB 2VNJA 2G2ZA 1TU0B 4A3JC 1FFGB 1KK0A 1IJFB 3FFIB 1JJ4A 4JI7J 5BYSA 4F36A 2AGPA 1O24A 3FKSA 3ZZ0A 2PN6A 2A69A 4K7QA 2MSTA 2YKQA 3DRPA 4WK3A 4K50A 3DDNA 2X6WA 3M6XA 4P10A 4KHPF 2CJAA 3KLHA 2UVUA 1TLLA 4C3IC 5G0RB 3EQLA 1T7PA 1NSKL 3OREA 2GO8A 5CYJA 1KQSR 1CEZA 3O5TB 3OZWA 4NXNF 1Y0RA 3AVWA 2WTFA 4OYMA 3OJSA 5J2NA 3NP5A 4Q7AA 2RHQB 5C2CA 4K5RA 3W2FA 2K7KA 3RZAA 1SJ4P 1KJZA 1U6BA 2RILA 2ZL7A 1BMQB 2B4OA 2BJ8A 2Y1RI 4IKAA 4DR4J 1NCLA 5U47A 1VJQA 3GJTB 1WKJA 1RWXB 2GSNA 5GADU 1D9FA 1G7CA 3MAAB 3DOKA 4J9PA 4KH0B 1S6QA 3OPKA 1AT1B 3D1OA 2ZUEA 3L4BC 3G82A 4LSNA 2HQCA 3CCJB 1B64A 2V6UA 4RL1A 3I0RB 3LVBA 4RR5A 3M8SA 3PUNA 2KVQE 1WORA 1Z2LA 5HKKA 2C2WA 4B9TA 3Q8SB 2KVOA 2OPRB 3B54A 1I50C 3GTKA 2J8SA 1P8GA 1UMJA 3OLBA 1IQZA 1RYSA 1S10A 2UXDF 3NCPA 5H9EK 3BYPA 4G6VB 3HOUC 2GHVC 1BX0A 5HBMB 3KG0A 4X4RA 3BQJA 5JFEA 3IM9A 1YI2B 4HYKA 1XPPA 3D6TB 3ZIAA 1X5SA 3OSNA 1WKLA 2H4YB 4ZJOA 2BR0A 1Y3JA 4C2MA 5KOWA 3H5XA 1BQMB 3HVTB 2JLEA 4WZMA 1R5OA 1GT8A 1VQ8B 2OSRA 1P9YA 4KC6A 2A18A 2ZVSA 4JP8A 4L6V3 3R3TA 3LP1B 2C22A 1UPPA 1HA1A 3BV8A 2C5HA 4RWXA 2X7IA 3N5BA 2MZQA 3UFCX 4DV5J 1OSDA 1FRLA 3JSRA 2PA8D 2CWXA 4HH1A 2MY8A 2E7WA 4DSLA 3CC7S 1T9WA 4HR2A 3UNYA 2BKPA 3MR6A 4Q2LA 4TY8B 3CJRA 2CQ4A 2CW5A 3FNNA 4USIA 2KYXA 4LF5J 3H9NA 4X66F 2ZH9A 3G6ES 1S6PB 2CKWA 1JLGB 3K5MA 4Y3CA 1JJ2R 5IWAF 2VL1A 2EEYA 4C11A 1EAYC 4DV0J 1D8TA 4DG1A 1JB9A 1ZTTA 3TYTA 3ZTSA 2JEGA 2QTZA 3DRPB 3CP8A 3J81k 2PA8L 3FCHA 3CE8A 5I3PA 2DGQA 4A3DK 4DR4F 3ISXA 1BWEA 3T1AA 5CA5A 1SB6A 3MMBA 3H0GK 3X3UA 3A3NB 2JZ5A 1NSAA 3C15A 4Y2CA 2CIMA 2FJVA 1GAOA 4HVZA 1ULRA 1L3UA 1NH7A 2WONA 4WZLA 3B4DA 3HOVC 2HYIB 1F5BA 4U96A 3C14A 3CULA 5IYBK 3TARA 1RLCL 1GAQA 3PA1A 4LF6J 2MQOA 1S9GB 3HFVA 2JA7K 2GVDA 1FDBA 3BQ1A 4AD6A 1RDRA 2P9CA 2UXBF 4R25A 4P22A 3HJFA 3NMRA 3MM9A 1E64A 1EQMA 4P2MA 4E8UA 5A8RB 2E2IC 3MCOA 1IKXA 4OP7A 3HSJA 2I6WA 4OZ0A 1D09B 5L9NA 1WNEA 1FRXA 3SXLA 1KMHA 2JFKA 1EP2B 4C3KA 3HKWA 4ZVGA 5C25A 1DCPA 2JA5C 1N48A 5IYCK 2CXEA 1EETA 2ZZNA 4L3NA 4QWDA 3WODA 4L8JA 2JN9A 2D3LA 3EUNA 3NS5A 3TX8A 3DRRB 3T5HA 4A3LK 2ALZA 1AFJA 2YKMB 4JI1J 5HMWA 1IBLJ 1NK9A 4AQYJ 3GFYA 1YITB 3SQOP 2B9WA 1JNRB 3DOLB 1U25A 2A10A 2UUCJ 1XB2A 4Y9UA 1HBUB 3UPFA 2EWHA 2HVDA 2RQKA 1VQ5S 3KWMA 2V9WA 3AD7C 4CH7A 1C0TA 4JI8F 3R5AA 1QUFA 3I55S 2O5IA 4X4QA 5A8RA 1JLFA 4LFBJ 2B4PA 1QVFB 5C24B 4WJBA 2CPJA 4A8QA 3SKBA 5I3UB 3DHWC 3W2WB 3P5BP 2Y0SL 2Z2MA 2IAJB 4BLAA 5HI7A 2MLYA 1SCJB 5KFRA 3W2VA 2W8KA 3OEPA 3MMCA 3E51A 1HLWA 3DLHA 3PDNA 3IMQJ 4KFBA 4KATA 2X1FA 1LFPA 4ECYA 1VJEA 3M8PB 2CNLB 2GA7A 4K0KJ 2HVEA 5AE2A 1WOSA 4CO0A 4HACB 1RU2A 1UMKA 3FEZA 2DBBA 4O4RA 3WBKA 3NBPB 5I3QA 1JLQB 1PAUB 2Z4PA 1NK5A 1QD1A 4A3EK 4RBVA 2ZTGA 4B3TJ 2BJEA 2V8PA 1WC5A 2BMWA 3QFSA 1USMA 5HN0A 2JVOA 4OPOA 4B3OA 1KZLA 4X4VA 4A46A 1B70B 1ZA1B 3EZ5A 4KO0A 5A76A 1SXLA 4RUHA 3MR2A 2BJ1A 1XBWA 1A7GE 1MWYA 5LM7E 5HROA 1TFYA 5BSYA 3QE2A 3KK2A 3ISND 5LMUJ 4QIFA 2XYHB 3MEGA 4X0CA 4P2FA 3D28A 3DLEB 1RYRA 3MXHP 5F8LA 4Y52C 4QVAA 2V50A 4LR8A 1SQFA 1I50A 3JSBA 4JI4F 1GH8A 2LXIA 3H0GC 5CXTA 4PXDA 2RGRA 4MAKA 2P2CB 4E0FA 1LNQA 4OX7A 1VQLB 1DTTB 2DEJA 2E2HC 3CF5Q 5DM7Q 1T11A 2KXHA 4J9LA 1BQMA 2FYXA 1ZUNB 4NMLA 1XERA 1DY3A 4O23A 3CCJS 4FYDA 1OMSA 4JV2A 1Y1VA 5FA6A 3DXBA 2X1GA 3S16C 1WOOA 1NSQA 2QTLA 1IN0A 1EXMA 5IQ6A 5F0WA 2MMYA 2HLUA 3NAIA 3NAHA 2XSFA 4I7FA 4Y34A 4YR3A 2WVCA 1COWA 2YH1A 1HVXA 1UWAA 3RB4A 2DNYA 1NHUA 2GQCA 1BQEA 2BYCA 4M5HA 1EFRA 4EI2A 3LO8A 2C3YA 3LH2S 3LAMA 5I42A 4EMDA 1H3DA 5L1IA 1TKTA 3CIZA 1NKCA 1Y3KA 4YFNA 5FLMC 4A3MC 2ZM6F 4DV5F 3RAMA 4X7CA 3NS7B 1KVKA 3FMBA 5DS7A 4B9SA 4EGLA 2IY5B 4J7CA 1QFJA 1F9EB 2AJ1A 2EFVA 4DX6A 4NYZA 4AF6A 1DJ0A 1WI8A 5HMZA 1VQLS 1PJ7A 1CNEA 2H5IB 1I6HC 3O44A 2CADA 2VG7B 3HOYK 2JJ1A 3GTPA 3QT7A 4YFKA 3OE7A 1KN6A 4G0VA 1XQBA 2KKHA 3SSRA 3VALA 2R8IA 1M1KT 3OV7A 1I3QC 5GAGI 5D3GB 4JI0J 3C19A 3HVWA 4Z4YA 3PX0A 1YJWB 1OQ3A 3RJMB 3EVMA 5GMKa 1H8EA 1HD1A 2LU2A 5F41A 3ETOA 2HFSA 4IO9Q 2HKEA 1RADB 1LW0A 4J9MA 1UFKA 3U1LA 4ED8A 5F8HA 2J9EA 1UPMB 3GZ7A 4YOEA 4MIBA 4A3GK 3GVKA 4ANDA 3KK2B 4PPDA 3ISZA 5IQQA 4UZCA 2RMLA 5FL7A 2P6SA 2NUHA 1ZXOA 4NLGA 1RAAB 2CQ1A 2J5AA 2BVZA 3QIPB 1WIHA 4M5JA 3BB5A 1VQMS 5L1LA 4BHQA 1RTJA 3IWXA 2XLJA 2N3OA 3IP0A 3BGRB 3D9BA 2XZDB 3T1HJ 2RRNA 2CFXA 4A3FC 3PW0A 3CC4S 1I18A 2F9DA 2IDEA 2HLDA 1HNIB 1XMOJ 4ECUA 1Q7LB 2BXJA 4G1QA 2AZ3A 5KFKA 4AXIA 3HMJG 2CNOB 2AF6A 4LF8F 3A3OB 5THWA 3ONYA 1F60B 1FDAA 3K57A 3H2UB 2GC8A 4HTIA 4IDKB 2Z6BD 2XULA 1SM4A 2HWTA 3GCWP 1RSCA 3FUYA 1NJWA 1H7XA 3NGSA 4CQ1A 1TKZB 2K06A 4LF9F 1Y0HA 1KOHA 4NLTA 4YALA 2F63A 4TU9A 2ZH1A 3CGIA 2B7CB 3PRVA 1FX0A 2VFUA 4RZRA 3QLHA 1Y7PA 3J7YI 2MPUA 1I7PA 2VDIA 2NSCA 2MQPA 4WP3A 1CS4B 2E29A 3W60A 4HKQA 3D2WA 3GTGC 1XMQF 4YAUA 4A3EC 3HOZK 5D8HB 1IBAA 3MZIA 2EIXA 3LAJA 4RD4A 4YXWA 2IVMA 1IKWB 3UN3A 1BXNA 3T9ZA 4F4AA 4R8UA 4JV0A 1TL1B 1WQFA 3MECA 4ZVHA 4LIRA 4YDDB 2M0GB 1Q5YA 4OOVA 1HNVB 1N56A 1DBDA 3ONQA 1T5EA 1K0TA 5G4DA 3LGMA 2ATLA 1S72B 3AA9A 4DFPA 4X2BA 4K59A 1DDGA 5KG0A 4DV6F 3DM2B 2FGCA 1FEHA 4QZVB 3QT8A 2BMBA 5HVFA 2CFAA 4FXUA 3RB6A 2FJEB 4DX5A 4AL6A 3GVJA 4UZEA 5KFCA 3UI3A 2MKJA 4CLPA 3IBFB 4F0MA 2IRUA 3KYLA 4ZVOB 3HOXK 5DS0A 2CA9A 4QPTA 4FXWA 1TWAA 2H3EB 3L9ZA 2WJYA 3KKFA 3M8YA 3LPXA 3MR5A 2VNIA 1IB0A 2R92A 1G1XA 4B3GA 2E2JK 3M32A 2E2HA 1K9MD 3PR4A 1C0AA 3AJ1A 1SQEA 2PT0A 5DQIA 2YNHA 2PD1A 1VHFA 1G7SA 4KGMA 4J3NA 1K8AT 2IYIA 3PTWA 2B43A 2BW2A 5IXUA 1WC0A 1FJCA 1Y1WA 3ADAC 3QJLA 3GTJK 5FLXU 2JRSA 3F56A 2ZDPA 4P72A 1N8RD 5HP1A 1VLYA 1HMVA 3TZXA 1FF2A 1NRKA 1VC0A 3QSIA 2JJ2A 1EZZB 2HIYA 1BY9A 1W26A 3D3CJ 5J1EA 3S7RA 1S72S 2X85A 2ADCA 1OY8A 1VQKS 3QSYA 5DQGA 2RS2A 1K83A 2CRLA 2OGUA 1IJEB 1FNOA 2I8EA 3E01B 3OFGA 2AX0A 5M5YK 1SKUB 2E1AA 3PNIA 4DSKA 2GMJA 4USKA 3TVYA 4YEAA 4DSJA 3WC0A 4NLOA 4K0KF 2OELA 3R7BB 2EFGA 2KT5A 2MQNA 4U7UK 1RI7A 3JTPA 3PW7A 2D3OR 2Z56B 2BANB 3FQLA 4ES1A 2ZXHA 5JUMA 1XR7A 3HOYC 4RW7B 3R1LA 5CHCB 1PKUA 1D2EA 1QUEA 4CTAB 3DOLA 3FCWA 2B4UA 5D77A 1RHRB 4X64J 4NRTA 1G7CB 2D74A 3IRXB 3D66A 3BH4A 4QV2A 2ZH8A 4UY8T 3NWRA 2VFSA 1Z4UA 3GJSB 3CTAA 1RHQB 3OHBA 5GV8A 4GRSA 3IR6B 2Z8QA 2Y9HA 3S2DK 3ZZYA 2VYQA 3RB3A 3CDEA 4QJVB 1FJEB 4B48A 4LF7F 1EI6A 1RB0A 2QMUA 4DL2A 2B7BA 2QT7A 2Z30B 1U02A 4O0IA 3N0VA 4PG5A 1A0OB 3QRPA 4YAFA 4LSLA 1FKOB 3FRZA 2VODA 4A3IC 4GKKF 4J9QA 1SJ3P 2CQ0A 4OYWA 3GJRB 1U1NA 3GPAA 3VAHA 2FJAB 2NXEA 2X1BA 3AD8C 2GAGC 5DO2A 3GILA 4QQBA 5TJ3A 1RT3A 4B3FX 2AMCB 2BJDA 1CBKA 2Y0BB 2FJBB 3MEDB 4LR2A 2LLZA 4ENOA 2G0JA 3NNHA 3VZHA 5D4NA 2ASLA 2J0SD 2RHSB 3PV8A 2JH3A 1EX8A 3AHPA 3S14K 4FM9A 4P5AA 4KHMA 1PO6A 1M1GA 2QN6B 4PQAA 1L3SA 4DJBA 2FDNA 1YRXA 3KLEB 5A6PA 3HHLA 1J6WA 3SEJA 4M94A 4OIRA 2ZVIA 1MROB 2DKOB 5IYDC 2QIFA 1S6PA 2HGNA 2JIZA 1RTDB 2HHXA 3AB4B 2ADBA 4XD7A 2M5SA 4JOUA 5B6IA 1DTTA 1CJTB 4M5KA 4X62F 2UU9J 3W2GA 4CM0A 2IA0A 2CDQA 2Z2YB 3H59A 3EE3A 1BQNB 4HDHA 3B6BA 2WRMA 4N47A 4J9RA 3GG0A 2GJPA 3OVBA 4U9UA 4K4TA 1SFOC 4TU7A 1S59A 3GE9A 4GO5X 4MK9A 2MKYA 3CQZA 5L1KA 4HI2A 3CD6B 3A3PB 1OHHA 4YP3A 1O6XA 3G71S 2YKNA 2YNGA 1YNJA 2H9ZA 1RAIB 2WYRA 7AT1B 4HLBA 2XNQA 4H9GA 1NLKL 4TXSA 2DCUA 1S1XB 5IYQA 3RRGA 1J2VA 1HR0J 5KG3A 1OPZA 2HQFA 4ILRA 1TL3B 1JA0A 1CS4A 5A89A 1RGVA 1NK4A 2HMIA 4LFCJ 5GVQA 4WP8A 4NLQA 3MM6A 4J9KA 1QLNA 4DQSA 3PYEA 4WFZA 3PA2A 4ZVFA 1RT2B 5T7LB 2OTLS 3EDRB 4OLOA 2VG6A 2AHOA 2CZ9A 3HFZB 4LUBA 2EBEA 3JQKA 2HFNA 2V7UA 3M2RA 2H65B 5ETOA 2DD8S 2D1CA 4OOXA 2LDYA 2MDAA 2Q6LA 3CJKB 2Y1JA 3NNCA 2XCOA 3DMJA 3US5A 4K5SA 1HWIA 3CCEB 1RAGB 4Y7NK 4BY1C 3CP2A 4P75A 1ZBTA 1IW7A 2YWKA 1Q9SA 4CH1A 1FWPA 3O2IA 1SH0A 3TQEA 3VA7A 2JA7A 1GMUA 2ZL5A 1SJFA 1Q82T 1Y1WC 2X0KA 1N06A 2OD6A 4P74A 2AV5A 2QLWA 4A3IK 4KB7A 4H4KC 1A6LA 1GTEA 3U27A 3ENAA 3QJJA 4XNFA 1X0FA 1XJWB 1IKVB 1NDLA 3VGTA 3E2EA 5HJYA 3HK2A 2X3DA 1UD4A 2EKNA 1M5SA 2WR8A 1RWKB 4K4VA 2XNJA 4MYUA 2QTWA 2OJ3A 3DHXA 2N82B 3BSOA 2ZH7A 5FLXY 4FBUA 3R5CA 1RAEB 1MU2A 4CI0B 4OINA 1I94F 3MPWA 2JC1A 4Q45A 2IFXA 3ISNC 1WTHD 1U1KA 2QO3A 3D3BJ 2C2RA 5FLMK 3LF0A 3VF0B 4N8NA 1H2UX 1HYSA 2CJQA 1WEZA 1VC5A 4QWCA 2RRBA 4Z4RA 2DNPA 2AEFA 3OPOA 4HH0A 4AT1B 4DFKA 1UCNA 4OI1A 4ECXA 4U6PA 2K1RB 4KAIA 3B4MA 3FC9A 1V5VA 3CMAB 4OHZA 1YNNA 1R6VA 4NZ6A 2NVQK 2R3VA 5JXSA 3D67A 1WI6A 2GPJA 5DLFA 2VBWA 4IDKA 1QVFR 2GGPB 1N05A 2YX7A 3MMLB 1ZAXA 3CDBA 1HBUA 3OXGA 4LF2A 2FZKB 3QFTA 1F9HA 3VAJA 3NGRA 2NVYC 3MM8A 4X65J 2QE5A 3PHTA 4TYAA 5EGHA 1XR6A 2BX6A 4B3RF 2HBYB 2XB2D 4DMZA 3F73A 2HVIA 4DK1A 4KR0B 3HVAA 1NZ8A 1XNQJ 5BJRA 2YNIB 3JAMU 4M95A 4B4DA 5AE3A 3SDEB 4LSZB 1RA7A 4GVBA 3LAKA 3T5KA 1S6QB 3M32B 4USHA 3OTOF 3PJXA 2GGPA 4ECSA 2QX0A 4FPIA 2MHEA 4J5OA 3JQMA 3LUYA 4X7FA 1GMVA 5K20B 3ZZRA 1N0UA 2VH7A 2K3KA 2C78A 1KP6A 3KDOA 1RWUA 2GIRA 4KN4A 2AGOA 4B3MJ 2LQJA 2CAJA 1NMEB 1FNXH 1PILA 3QSYB 5AXKA 3OSPA 4ZVUB 4M5NA 2DVIA 1IL2A 5KT4A 2CYYA 1SIWB 2LXUA 2PMHA 4YB6A 3GV5B 1K44A 3C6UB 4JI6F 3WX8A 4DV4J 5G0RA 3K59A 3WC2A 4Q5SA 4OYBA 4PGOA 1S0NA 2VBYA 2RU3A 3BM7A 1XNRJ 2L48A 1MLAA 1J9ZA 1HNVA 2MZRA 2HURA 2OMOA 4YHBA 3T1HF 1QSSA 3GMGA 1GXUA 3PW5A 3LPYA 2KO1A 2ZH6A 4KM9A 3OXLA 3OW2B 4PXBA 4NXMJ 2O66A 4ED3A 2Q79A 3KG4A 2XGQA 4LF8J 2GX8A 3Q0AA 2E2JC 2CG4A 4EO8A 4F4YA 4F0HA 3P49B 4WWVA 2KB2A 4LBPA 1QUPA 3FEYB 3PO4A 1VRUA 2LFVA 1LWFB 1YCLA 1IXKA 1UEUA 2XLKA 4LBWA 3LP2B 1D1NA 4DR5F 4CLTA 2VPWB 4DR5J 2MXYA 3KG1A 3IXQA 3OFFA 2O5JA 4CH0S 2QA2A 2HS3A 4EK2A 3CD7A 3AQOA 4J0QA 1Q0NA 4XDDA 4I2QA 4JI5F 2PI5A 1AIPA 2HNYA 2BQ3A 1TL4A 3UO0A 1FERA 2V68A 3SJPA 4F26A 3AVTA 1IJEA 1ITPA 4ZP7A 1TKZA 2ZNYA 2XS5A 3BC9A 1TL5A 5EWEA 5BXIA 3L7UA 3FSXA 1NKBA 2XQCA 2QLXA 2NREA 4ZHRB 3HVRA 5LMZA 1WC3A 4R0EA 5C4JK 2WBRA 1E1QA 1HWUA 3OEHA 3BREA 1NAQA 3ET6B 1B7YB 1F3FA 4RPFA 2DNRA 4ILDA 1ZM2A 3KJNB 3LAPA 1NM2A 3NLCA 4F2RA 3ONUA 5B0GA 2IC3A 5GMDA 1IKYB 4MTPA 4DZ6A 2OYNA 4LVNP 4A8SA 4ER8A 3MFHA 2HRTA 1VQ7S 3TZWA 5D0EA 5DRKA 5LSOA 3W66A 3W2WA 1ZPVA 3EMTA 1E3XA 4O0NA 4G7OA 1U2CA 4WK1A 1LWCB 2R8HA 1JJHA 1NDHA 4ZA1A 5F3TA 2KZMA 3KMSA 3M9MB 2QE7A 2A1BA 3MAAA 5H9FJ 4TMTA 4X4OA 2R93C 5F4JA 3M2VB 4YMEA 2UP1A 1J5OA 1YX2A 2KZZA 4LFAJ 2VZLA 4ID5A 1WTBA 2C4UA 4C9DA 3U2QA 3MM9B 4YAWA 1WSVA 1JLAA 1MRZA 1NJXA 5H9FK 4Y9RA 4WFNQ 5IK2A 2JEFA 5M2RA 3Q3QA 3MMBB 1I94J 4ZPBA 3DOMA 4DUYJ 2AJQA 5ETQA 3FPPA 1HNXJ 4PYDA 4MIAA 2AJFE 4PEOA 2F9JA 3KLEA 5C44K 2FB0A 1QAXA 3CAGA 3RYLA 3MCMA 4WKRA 4J37A 3N28A 1JLQA 3GJQB 1FVQA 4OV6A 4U67Q 1X4CA 2WPDA 4AL5A 3MCAA 1FDRA 2EFPA 2XI2A 4G1QB 1W9XA 1Y5LB 3QZ7A 4DU7A 1AFIA 1UZDA 1LOUA 5LMUF 4KMUA 4F3QA 1FD8A 2AW0A 3PO3C 1Y4ZB 2QYGA 1VQNS 1Q8LA 1N32F 2YNGB 3DLGB 4DR7F 5ETVA 3PFEA 2B51A 1DTQA 5ITHA 4QOTA 4FKYA 4G1PA 3GYNA 1BD6A 1JLFB 5HVHA 1QVGR 3S8SA 2WCXA 3CCMS 1J6XA 1VQOS 3A13A 4OZJA 3IG1B 2A6MA 2OTJB 1Q8KA 1IWGA 4NRUA 5KG2A 1JNZB 3WIVA 4OZ5A 5A2QU 3I56S 3E8OA 3MURP 1R9TK 1I6VA 1QFYA 2HMAA 4CT9A 2DERA 3MI7X 1VRTB 2M52A 3G6YA 2DR7A 2V0NA 1FXRA 2VPXB 2FD2A 3G82B 1VQPB 1T9YA 4LSNB 2CNDA 3H0GA 1Q16B 4PR6A 4ZGQB 4H4OA 2Q66A 2CPDA 3QT5A 1HNWF 2L08A 4CYUA 5IT9U 2C2ZB 4DL3A 3LW5C 3PX4A 3R5JB 1AA1B 2FZGB 2V34A 4ZPDA 2R92K 4I6YA 4DLGA 3TJ8A 4RW4A 3BY2A 2DNKA 2AZ1A 1Y5IB 4DUZF 2E5GA 5JVOA 1D3WA 1XE1A 3KL9A 2B8QA 4CLYA 1EQ0A 4KKOB 2B6AB 1GMWA 2LP4A 4EU0A 1H42A 2XS7A 1R8AA 3JQPA 3MFIA 4LF5F 4WFAQ 4TLQA 3OXFA 2WB4A 2PEHA 3GTLC 3IBCB 1T02A 1WELA 3KK3B 1YI2S 5EUHA 3EPIA 3W8GA 3R27A 3EXCX 3JYTB 3BBCA 2AWZA 2KRBA 2YX4A 3UD3P 4X64F 2VFVA 4A3GC 2PEBA 4O3OA 3GIJA 4LFAF 3DLBA 2VBXA 5J2PB 4X62J 4DZDA 2FHOB 2WONB 3HOWK 3AFGA 5CHPA 3S1NK 2JOQA 1VISA 2RH6A 1YRTA 3A8KA 2OEMA 5ETKA 4L76A 3V7AA 8AT1B 1GXLA 2IM3A 2DNZA 2KFYA 4QWEA 1URNA 5HQMA 4DUZJ 4CLLA 1KK2A 4A3KK 4WP9A 2K2PA 4DL5A 2PE8A 3BR9A 2M70A 1JK9B 1S6OA 3LGHA 3J7YU 3IR5B 3MD3A 1GMWD 1BS2A 2HS0A 2VQEJ 2EI5A 1T9XA 3RG6A 4LK1A 1N33F 3HKZL 5KFMA 2MKSA 2HVZA 2F40A 1ZQ1C 1QM9A 3QBCA 2FLLA 3CCRB 3AB2B 1NUEA 1UVIA 4A8FA 4HT7A 4NYOA 3SV4A 3FVYA 3BQ2A 3GTKK 3BGLA 3MM8B 5HATA 3IS9A 4A3MK 4M4SA 1P9QC 1PBUA 5LJ5Y 1NJID 1ISEA 4AYBD 1N07A 1PYSB 2XWXA 3FZBA 5CH7B 3N6NA 1ZPWX 4A8MP 3MPYA 4KIAA 2BPOA 1FX2A 1KLNA 2VBTA 1OB5A 2ZH4A 4P25A 2UXBJ 1R27B 3P5TL 4WFXA 5KFFA 5K9FA 4WFBQ 4QWBA 2OUGA 1HYSB 2PDAA 2C28A 2XWYA 3T3FA 4KB4A 1F60A 3ZZUA 4OX9F 2HHWA 5AN9A 1TV6A 2BOAA 3G4SB 1JJ2B 2NPIA 2CFAB 1O2FB 3NL0A 4DUYF 1X4DA 3MM5A 1YIJB 4C0OC 3UD4P 1TL7B 1YBTA 1F93A 3GR0A 3VCDA 2VHGA 2LKZA 3BGOP 3HAGA 1K47A 4CM2A 3B8HA 3TZYA 2B9YA 1UVJA 5J2QB 2HNZA 4J9VA 1HMVB 2XMAA 4ED2A 2YWWA 3DDKA 1TQLA 2BE5A 4YB5A 2BJ7A 2XO7A 3WNDA 2BW7A 3QFHA 5KT7A 3R6LB 2MQLA 3D1HA 1TMJA 3S0XA 1BPLA 3FZ2A 3CCLB 5A8WB 2RU9A 3G05A 2I1LA 3M2RB 1OB0A 3QGPA 2E2IK 4KMAA 4PRFA 1BLUA 4C3JC 4Y2MA 3EWGA 4NYPA 1CQMA 3CD0A 4AFFA 3HHLD 3OJUA 1EHWA 2ZZMA 3FSIA 3G6EB 3HX9A 4L3KA 3GWCA 1GX6A 1RWMB 3M05A 4RUAA 4BXXC 3OFEA 1WUUA 1F7VA 4DSFA 1N8RT 4UOHA 2IBOA 2B3TB 5F4MA 3QX3A 4ZLNA 3D0GE 2YKMA 3GQCA 3V76A 4DFMA 5A8KB 4USVA 2E1RA 2HHVA 1IKYA 2FY8A 2DRAA 3AJ2A 1UV7A 3OZVA 4TMXA 2W6JA 2YQ1A 1LW2B 1HPZB 1M5VC 1RZMA 3EX7B 2CQIA 4RCYA 5KFGA 4X4UA 5DG8A 1S77D 4OZLA 2OTLB 4RU9A 2B7CA 4TKOB 4QBUA 2POKA 2PSZA 3E3XA 4XPEA 2H5JB 3CUNA 1F7UA 2VU5A 5C24A 3K58A 1YHQS 3ZPNA 3LPEA 5E7OB 4C8YA 3M1VA 3Q8VA 4RNNA 3HHEA 4NXNJ 1NB2A 3A8JA 1RTDA 4Z7CA 3JQJA 1U4BA 5KFLA 3J81Y 1KS2A 1GNKA 2B5JB 2EC2A 3MF5A 2D3ZA 5FO1A 2CZ4A 2AX1A 2K1RA 4OFZA 1HWJA 3FDSA 4L74A 1BQXA 5HJXA 1TKDA 1ROFA 3NWGA 2MSSA 3RZDC 4H4MA 2FHMA 4GTBA 5K5MA 5JJBA 2M9KA 4FKXA 4Q5VA 2W4DA 3KJQB 1RT4A 1UJ5A 4LVOP 1DG1G 3WY9A 2YKAA 3BNWA 1Q1KA 2Y3PA 5THXA 2IRXA 1SH2A 4K4WA 1FRMA 1TWCA 1FNMA 3BYRA 2WZPP 3OUYA 4DV4F 3GEEA 5EX3A 3OTEA 2FLOA 1RT2A 4Q7JB 4GTLA 4IG3B 4RW6B 4DNTB 2B4VA 4M8LA 2L9WA 2LEBA 2W7OA 3G6VA 2W4CA 3NS6A 4O2DA 2JA6A 2DO0A 3N79A 3R6KA 4LBIA 1EFUA 3JQQA 3TVKA 1JQWA 4WJ3M 3CJQA 4NLUA 2HWIA 2VG5A 4IRCA 1ZYRA 2H1YA 2V8DA 1Q8BA 1P1LA 4X4SA 1HZEA 1RKJA 1NPRA 4V1Ak 4L73A 1DCOA 1VMBA 3MEEA 1SJ1A 4XONA 2OI2A 3CO0P 4CLKA 4IR1A 3HXMA 3CT9A 2ZM6J 4IG3A 1CG2A 1N52B 4C8NA 2MZSA 4DF4A 4G7ZA 2AGQA 4WZTA 2WW4A 4BCAA 2GJIA 3ASPA 4IOBA 1RWWB 2QGGA 2R9VA 1BGXT 4KGXB 1S57A 3LOUA 3GIKA 4UOFA 4EYIB 2DCUB 1Q7YT 4ZVQB 1ZA2B 3AOAA 4BKWA 1HHSA 2BDPA 5L46A 4USWA 2B7BB 5HXBA 3KUEA 1Q7YD 2DIEA 2HK3A 1N5YA 2MZ1A 2C2MB 4ZLPA 5GV7A 2HBZB 4WXWA 4YG2A 1HD0A 2QFJA 1H98A 2V69A 3H7HB 3BBFA 1VQSA 2E1BA 4P6VF 3HOUK 4KPCA 3ILLA 2ZBQA 3HZEA 4XOPA 2V67A 3M30A 1WU8A 2ZJQQ 4ECTA 5J2NB 2Q6OA 2VOPA 4DX7A 2VFRA 2RF2B 3UWTA 4JV1A 1Y1VK 2A6EA 4PABA 2AT1B 1R5BA 4DR3J 1V3RA 3IAM9 1UETA 3EVWA 2DGTA 1LWEA 3BGFA 4RX6A 3CD6S 1HQUA 5AJ3F 2UXCF 4CP5A 4E2FB 4NXMF 1H38A 4XLHA 2D69A 1ZAWA 2Y3YA 1H8HA 2OO4A 3M3YK 3PEHA 1T6YA 3R1HA 2DH7A 2LEPA 2KFZA 1B4AA 4XDCA 3L95X 3R7SB 1PC5A 3L7PA 1UW4A 3LO3A 3MCSA 1PYOB 3W8PA 2V2VA 2ILYA 1LEOA 1RU1A 3AQPA 3QO9A 4A47A 2KG1A 1KK3A 4DHVA 4YS2A 2WZNA 2ZOMA 4TMWA 2F3JA 4GMKA 2JEIA 2ZFZA 1JA1A 4DQKA 1T95A 1F0XA 4DS5A 3R5DA 3CWJA 4CLZA 4WU2A 3JYTA 3VAKA 4OIOA 2RKIA 1Q78A 3TAQA 4G1VA 1TKXB 4ZGNB 1X4BA 2E9RX 3QWPA 2RDIA 4BBRC 4Y28C 1QFZA 2U1AA 4R71A 3JSMB 1AUSL 1NKEA 2RF2A 2KM8B 3M6UA 4I6AA 4USUA 3GTPK 4PYAA 4UW2A 3MTKA 2R7QA 2GAHC 3OTCA 5IC4B 2HG4A 4Q8FA 4NLSA 1HIYA 2VV5A 4PC1A 2VPYB 2ZZGA 5FDLB 5C44C 4J90A 2N7YA 4WBFA 2OPPB 3IAS9 3U02A 1UP1A 4IG0B 2C1EB 3NBPA 2ACMA 3PZPA 2JEJA 1VK3A 2V2KA 2RKIB 3QO9B 1IJFA 3UVJA 1LK5A 2PE3A 1O0PA 2DJWA 1S9EA 2K3IA 2V9KA 3OW2R 1K83K 4IFYA 1PJ6A 3CESA 3NG8A 4TLRA 2RJZA 3VNVA 5JVHQ 4ILMA 3CCRS 3OUYB 1RWPB 1U1RA 1WHVA 4N7TA 4J9UE 3C16B 4ZN3A 3IGVA 4ANEA 3ENWA 1CC8A 1T05B 4FF3A 5CJ9A 5IYWA 3BR8A 1SPBP 1R31A 1N36J 4R8UB 5KAKA 1KD1T 5FNZA 4IG0A 1D9AA 2KJVA 2E7VA 4NLWA 2XMTA 1SFOK 2BQUA 3MEKA 2W1BA 3I56B 4KGVB 4OI3A 4IRKA 4WIIA 1OPIA 2E2IA 2NVXK 5FD1A 4O3PA 1R6YA 1Q81T 1XMBA 3UD5A 3SQGB 5GMEA 2VONA 3GSIA 3IFEA 4ATNA 3BO3A 1X4GA 2QYCA 4WYWA 2MQMA 3HM9A 2AD9A 4G7HA 2EC0A 3D6MB 3K5LA 4FBTA 1KVJA 3DLGA 3TA1A 1DARA 2CPIA 2V7VA 4MKYA 1V0EA 4LR9A 3S1MC 1PBAA 2ZKUA 4YR2A 1ZS6A 2ZWOA 3HKZD 3CXCB 2CJXB 1SKSA 3WZ0A 2ZD1B 2CVIA 1KC8T 1T6XA 3IO1A 4DV7F 3CPXA 1YVFA 2GZOA 4E0DA 4JK1A 1N32J 1IBMF 5HVGA 4NWBA 1YLOA 3W5HA 3BQ0A 1HPZA 1YZ7A 2NVXA 1U1MA 1ZAVA 2DHGA 3CCLS 1T0TV 2GMLA 2W9BA 2XZWA 3CW2C 1VCTA 1HFEL 2XMJA 5K8NA 2D9PA 1KFSA 2OFGX 1VQ7B 1YIJS 1J5OB 1R0CB 1M90T 4X4NA 5B0EA 4FS2A 4LFBF 2ZFHA 4QPXA 2GSUA 4C8MA 2B8PA 2ZD1A 5DDRC 3Q8QB 1X31C 3SQGA 2VBZA 4RD1A 2FY1A 5K8OA 5IOQA 3D1QA 4QYZJ 5L39A 2G4BA 1U6ZA 2DYAA 1J98A 2EG1A 3HCXA 2HRYA 2L41A 4RWWA 2ZC3A 3DM2A 1XNRF 2GSOA 3MMAB 1E6VB 3V4MA 4RW8B 4RD6A 4M1KA 1S0OA 3CTRA 2W8LA 4J91A 2VUGA 5D3GA 3WQPA 3D26A 2ZOGA 4A8WA 4B3MF 1EFWA 3VZIA 1J5EF 4F8RA 4LOWA 2GJRA 3RW6A 1VQ6B 3QRRA 3BGUA 1Q82D 2KT2A 2ZOFA 4PWWA 3GP9A 2NYIA 2APOA 4FZBA 1ACMB 1IBCB 4AXJA 1FFWB 1V6HA 2YTCA 2W2PP 2YQ0A 2YKNB 3PX6A 1VFJA 3SMZA 1N6QA 4ZPWR 1BJKA 3S15K 3C6UA 2R7VA 3BKTA 1X5OA 3ZZPA 1IKXB 3S2DC 1OB2A 1R9TA 1TL3A 2BE9B 3JSMA 4LQYA 1XZPB 4ECWA 2FJXA 1LWCA 4MEYA 3FBFA 3MMAA 3CCQS 2E5IA 4Y7CA 1ZZNA 3AGPA 2QSFA 2Z2ZA 4I56A 2WVBA 2W7PA 3GFHA 5C42A 4WZEA 4BLBA 1IE0A 3H98A 5LOQA 4NOIA 4KKSA 3RAQA 4DCJB 4NLYA 2ZH5A 4LC0A 4Q2MA 3KUHA 1KBRA 1WF1A 4DS4A 1ICEB 4I64A 2E5LF 3QFCA 3BS9A 1L3TA 2F1FA 2AQ4A 3L3CA 1FJGF 3EM1A 1IVZA 3VGUA 1XTZA 2P8IA 3QZ8A 2IVFB 4RM0A 1HQEA 2X6XA 2DH8A 4OHXA 1J6VA 4UZFA 3LQEA 3DLEA 2XCRB 2XSJA 5SZTA 1NK0A 4O4GB 3GSDA 2AP6A 2MGZA 1C0UA 2EPIA 3HPOA 1X60A 1GVHA 4KC5A 2PGCA 3QATA 2HHTA 1UD3A 2FTRA 3W5VA 2GK6A 2RDJA 2DR8A 2A68A 2IAJA 3T6BA 1JVIA 3MEDA 3VO2A 2D3O1 2DGOA 2ZL6A 1FRNA 3I9ZA 4NX9A 5M2UA 1G51A 4DV2J 2DR9A 2VKRA 2MZTA 4ED6A 4QIEA 4GKKJ 1G7RA 3HDSA 2GJFA 2E5LJ 4F25A 2IMOA 2KU7A 4Y52K 4FYWB 4MMOA 3DLKB 1S6UA 2OK8A 3S14C 4LBVA 1F5AA 2H51B 2LEAA 1L5UA 4XOTA 1LKZA 1EWYA 4FP9A 2OPQB 4G0WA 4PWDA 5JMNA 1U0SA 2G1HA 1C1CA 2VBSA 2FJWA 2QMUB 4AH6A 2HBRB 2XM3A 1VQ4B 1Q79A 3RUBL 1WKKA 3W63A 1TTHB 4ID8A 4ICLB 1FKOA 4KV8A 3H4DA 2XY5A 4K8RA 2NXUA 3GVLA 2IJFA 2V4JB 3OR1B 1S48A 1Y5NB 3MEGB 3GTOA 1DDIA 1MG7A 1SC6A 1S0UA 4X7EA 3H5YA 1C0TB 1O28A 3AT1B 4KASA 4PG6A 3PO2K 1FNDA 5HZAA 1VR6A 4U8YA 2PLFA 3MOJB 2I2YA 4EFAC 2YBVA 4TVAB 4DXLA 1DLOA 1I51B 2L3MA 4U7CA 1S0VA 4LRDA 4ZOSA 3IGNA 4TN2A 2V7WA 5KG6A 4B3XA 3MHYA 4R5PB 3EZOA 2BVNA 3KHGA 1B99A 3LP0B 1VOMA 1WP6A 4NCAA 5EWFA 4WU3A 4TMZA 1NB7A 1IR1A 3KK3A 1FWLA 1CVJA 2ASJA 2Y8WA 3GYXB 2W9BB 3VAFA 1REVA 3PIPQ 4Y2AA 5C25B 3RW7A 2HHSA 3V6KA 5J1NA 5KFVA 3N6LA 3K7RA 1WDDA 1VBXA 4H4MB 4O44B 1EB0A 4XTTA 4NA1A 1FJGJ 3DRSB 3ETMA 1NNDA 1CPZA 3HD2A 1R5NA 5BSXA 2HZVA 3EGVA 3OP1A 3NEKA 2VZ9A 4KN7A 2AJ2A 4UTGA 3K5NA 4C3HK 1LWXA 2DY9A 1F1BB 1TWGC 3H3VD 2O3DA 4MKVA 3DKDA 1NJYA 2ALYB 1VGYA 5DDQC 2WOMB 3OZUA 1KTQA 2H54B 3MUMP 3BKFA 2PHCB 2ZH3A 4MEXA 3OVSA 1NK6A 2DR5A 1X9WA 3ES9A 2QDXA 4URSA 4J9OA 2R8KA 1TK5A 5C4XK 5GADI 1OSCA 3WX4A 1TWHK 4EBDA 1NDKA 5A8AA 4KHPJ 1U2FA 3JXOA 3OL7A 3V2UC 4FNIA 2XI3A 1WHXA 1RUSA 4DSIA 2GMHA 3DYAA 2QV6A 3N0CA 4GZYA 4RW8A 2ZZQA 4GVLA 1QGZA 3PEJA 4ZITA 4DLEA 2VFTA 1F2HA 4LRCA 2MQQA 1LW0B 2FHKA 4C7QA 1SL1A 1X4HA 2OPSA 5KFIA 1N6QB 1G7TA 2ZBVA 1MMDA 4L72B 2RUGA 4CT8A 4P9SA 1FI4A 4F4XA 3OL9A 2CDRB 4DPOA 1UW9A 3ZO7A 4U9RA 4P6YA 3TR5A 4IQXA 5C3EK 4DK0A 1FD2A 2HAIA 1JLAB 2ZTNA 1T3NA 3BGRA 1B3TA 5B0DA 2R2RA 2YNHB 3CCES 3QWUA 3E20A 1L3KA 3JSTA 2DK2A 1QGAA 4U7UD 2OLWA 3HOWC 1FE4A 1TWAC 1M5OC 4QCLA 2V4DA 3G9CA 5KFBA 3GTMC 4ZJQA 1FXLA 3T5JA 3C6TB 3K7AC 4DV2F 1WQHA 2HHHJ 1P4MA 3TAPA 3AA8A 2H48B 1XWLA 2BOPA 1RT6A 2EBGA 2GVDB 1SJQA 4F67A 2XHCA 4RJVA 4GTAA 2B5JA 2C3UA 3FBEA 3DRXA 3CCTA 5B0BA 1CLFA 1LFWA 1S12A 3GTLA 4B3SF 3M1VB 1RTIB 1S1TB 2YXLA 4RW4B 2BE2B 3NGDA 3CQZK 3HVTA 4CDIA 4JUZA 4OZ1A 3S1QC 1XZQA 4LJZA 3BH7B 3Q2SC 3G2XA 3RR7A 3QGGA 4OLPA 3T1YF 2BQRA 4OJ1A 2M8HA 2OK7A 4DN9A 3LQVA 2DNOA 1VH2A 2V4JA 3OR1A 4CIOA 1S1WA 2NSBA 3RTVA 3R5BA 2V7XA 4ELUA 1OGIA 3S1MK 5GAHI 1RAFB 2BGJA 4KGKA 3PVDA 3WNCA 1TR0A 2QL9B 3VGSA 3OD2A 2NR0A 2C77A 3QGHA 1DZ5A 2A2DA 3WDOA 3JQRA 1RQPA 1GE9A 3LWLA 1EIYB 3FSYA 1XR5A 3W7BA 4A3CK 2E9ZA 5KNLA 1RTJB 2GREA 1LXNA 2F4NA 5KFEA 2UVVA 1IM4A 3OTBA 3SCIE 5KFOA 2VJVA 4WPAA 1HBMB 4LF6F 2ZBPA 3JTOA 3TQ1A 2CQHA 3NXZA 4LR7A 3POTB 2G2OA 3GG1A 4JV5J 4NA2A 3TFIA 5IZHA 1ZOTA 4RKUC 1R0AB 3GTOC 1SJRA 2HW3A 4FVCA 2XCPA 3A4TA 4N3NA 5KTQA 3PG9A 3SDEA 2FVCA 1C1CB 4CO3A 4FZVA 2EXUA 1VQ9B 3P26A 1OGJA 1TZ0A 2W7VA 2V8GA 4P7VA 4X6AC 4P6QA 2QEXB 4Q43A 1UKUA 1EH1A 4M53A 1SQGA 3OVAA 1HI9A 2J0QD 4JI8J 3FKIK 1EP4A 1TK8A 1WEXA 3PR5B 3D6FB 2V94A 2D74B 3WBZA 3FKIA 4U95A 1XFOA 1YSJA 3KDNA 2WSSA 4M0LA 1TV6B 1VYAA 1RT7A 2BACA 2DHSA 3PRBA 2VC1A 3WBJA 2DR6A 2VBVA 3KLGB 2B63C 1D9DA 3TAMA 3BP3A 2EFOA 2Q43A 3W62A 3LP1A 1RT1A 2ZBRA 5H1SV 1QGYA 3P96A 4ZP8A 2NVTC 3ZZTA 1XQIA 1CJTA 4RNMA 5GAEI 3KLFA 5JBQA 4WTYA 1FX4A 2GFFA 1WSRA 5DG9A 3D0IE 1Y0YA 4TT3A 2LYVA 3DRYA 2JNJA 3T02A 2IM1A 4IRDA 4DPTA 4NCGA 3H5SA 2E5JA 5CABA 1S4EA 1S5ZA 1TKXA 4ED0A 1HI0P 1HQUB 2OPQA 3BF4A 2VASA 4OIXA 3KNGA 3NKYA 4N77A 4OIQA 4H54A 2UXDJ 1S4FA 4WWSA 1RT1B 1HBNB 5D0HA 3ZNJ1 1UTAA 2F8EX 3I32A 1H2TZ 3J7Z5 1RQRA 3TVZA 4KKOA 4KKUA 1SFOA 1GQEA 4KFBB 4YFXA 3QFWA 3I55B 1N33J 2V4QA 1N5SA 4P3YA 2XO6A 1NB0A 1MABA 1WDTA 4F4KA 4I1TA 5CZVA 3M30B 4DPXA 5D0RA 2EK6A 3SFUA 2IJNA 3DN9A 3TA0A 4I4BA 2JLGA 1A8PA 1REGX 2KXFA 3W5YA 1FRHA 5IV4A 4B08A 4DQIA 2M2BA 2FJDB 1DTQB 2PIIA 4OZ2A 3BPSP 3MECB 1TUIA 2F43A 3GV8B 1FTCA 4NE9C 4RDJA 2C2EA 3A35A 3H2VE 4BLGA 2HHUA 4IH5A 4IR9A 4C2MC 4DU8A 3OTDA 3W5XA 2OBTA 1RWVB 1U8SA 1UEVA 2R8GA 2RT3A 5F8IA 1KONA 2GNKA 1CJVB 3CMQA 3H25A 1SH3A 1NPKA 1PGZA 2XCAA 3GTGK 4AUKA 2XZLA 3CJ2A 4NMXA 3PKMA 2CZVC 4HE5A 4MT1A 4FXDA 3EGZA 1TWCC 1P1TA 3GIMA 3OR2A 2ZC4A 4Z1MA 1Y10A 2C2DA 2CBXA 3ZTPA 4LLGA 1FRQA 1RK8A 1K9MT 2VC0A 5H5JA 3M8QA 2GJKA 4FYXB 1BC6A 5IOTA 3N9UC 1QAIA 4GQNA 1SKRA 2DY1A 1HA3A 2R7TA 5KFSA 3E1YE 2ROPA 2B6AA 4M2LA 4C97A 3MM7A 5KFZA 4F50A 4WF9Q 2NYHA 1Y9OA 1V3ZA 4V19J 5DZ6A 3LA0A 2BF4A 2EFNA 2FVGA 1TUWA 4QIWL 1V0FA 3IRWP 3Q22A 1RT4B 3MPVA 1YJ9B 2W2NP 4DQLA 4HACA 1QTMA 3ZC3A 1TVCA 1IKVA 4P52A 5M2PA 1S9EB 2B9XA 3NRBA 4CLUA 1WC1A 3W5ZA 2DITA 2OBRA 3MAQA 1XZQB 3ENQA 7FDRA 4IO1A 2C2KB 2X1AA 2HNYB 4QHYA 1HI8A 2XNDA 2VJUA 3CJTA 4P26A 2PMZL 2P6TA 2M4MA 2Y0SD 3HOZC 2RQ4A 4ID5B 1NEEA 1B0VA 4PG4A 1S9GA 2MKCA 2PFFB 4XR6A 1NK8A 2RC5A 3PXGa 4IW3B 4NEYA 5E5NA 1OQ6A 2ZUGA 3H42A 2OEJA 3LGNA 4K4SA 4NI2A 4WIQA 1YDLA 4TQRA 3PM9A 2CJBA 3OR2B 1FNCA 4UF4A 2NVYA 3TFHA 5HBMA 1VQ4S 2ILZA 1M1HA 1NDPA 2Q1LA 2J6UA 1ZTWA 2LVWA 5D6GA 4RDKA 1HNIA 4KPYA 5E2QA 4GTEA 1VRUB 1EJ7L 3BCFA 1TVRA 1YBUA 2DT9A 4GC6A 4G1BA 2QLBB 1H73A 4X07A 1PG5B 2CJYB 4BBSK 2ROEA 1SUQB 5KFTA 4PUOA 2HWHA 1TL1A 3TNVA 1NSPA 3HHDA 1W34A 1TVRB 2NVQC 2LMIA 2KJWA 2HHHF 3IWNC 2LQ9A 4CLWA 3SYZA 2E1CA 4KV8B 3ITHA 4Y6IA 1O51A 2OBSA 2B63K 3SLDA 1H85A 4QYRA 2B63A 4R5PA 2R7ZK 1Y1VC 3GTQA 1O5JA 1UD8A 3D68A 1QE1A 2NVTK 4ED7A 4UQTA 1JQGA 5J2PA 4G1IA 1RTHB 4DL4A 3CJSA 1FK9A 1U0HB 4GFQA 2Q3PA 1GXTA 2KXNB 5TMCA 2WBMA 2E9TA 5HANA 2LCWA 2PC6A 5CYMB 2DRBA 2ZH2A 1R8PA 4B9UA 4C45A 1PSDA 2W24A 4ZVRB 4II3A 2OH2A 2CQGA 2XGJA 4C3HC 3DDIA 4PZVA 5DJBA 3Q6QA 4ECQA 3DC2A 1E1RA 3HHLB 5J3OA 4WZQA 4DDQA 1C0UB 2ZE2B 2OTJS 2VG6B 4XCHA 2EFQA 2AEJA 4XSZA 2YKOA 5ETLA 1E3ZA 3R5GA 4B43A 2DNNA 2RS8A 4CO4A 2ZBUA 2E1PA 3LANA 2ZHBA 3BSCA 3V4IA 1VQKB 4HL9A 3THPA 1EK8A 4OX9J 2LU1A 4ZLLA 2V6SA 1DHMA 4B3RJ 4DQPA 5FJ8K 1MWQA 1APSA 1NU4A 2WAQL 1FVSA 3EJMA 5CYQB 3TUIC 3RZOC 3GTPC 3AVVA 3V4IB 4QWAA 4PC3A 3P6YC 4LBYA 3H20A 4UY85 5IS2A 5FJ4A 5EHHA 1RHMB 1D8YA 3CMES 1I3QA 2Y1LB 5LT5A 3TX0A 1WQGA 4GTFA 3KJVA 3T9NA 1YTYA 4CNZA 4ZV4A 1RTHA 1N5VA 5C42B 2BV3A 3BEGB 2NXNA 3CC4B 2XOKA 3BPDA 1FKAF 2DNMA 4XLFA 2MB0B 3FRYA 1U2RA 3DFEA 1M5PC 3GR1A 1LXJA 1S1WB 2QEXS 2PI4A 2HFZA 2YWEA 2KRRA 2HBQB 3KHLA 3OOCA 2W9CA 3MD1A 3GTMK 1NDCA 4A4JA 1WHYA 5D4DA 4Z4SA 4OYPA 4KRWA 1UD6A 5B0AA 3P3DA 4PAAA 3EVOA 4XQFA 5SUHA 3VMFA 1N5TA 3GTOK 1UJ4A 4RLZA 4DV3J 3HLUA 2NVXC 2JJ4D 3MAHA 4CTAA 5KG7A 2HQIA 1GO2A 3MHPA 5I4MA 3A8IA 3CMEB 1GR1A 1XNQF 2V7TA 3VR6A 1URRA 2DIUA 4DV1J 3VV2B 1CC7A 4DQRA 3QIDA 3FBBA 2P3MA 2HZCA 1GEHA 5L38A 1KQGB 4Y0FA 4NI2B 2GCFA 1FEEA 3R6GB 3M6VA 3EXYA 1KK1A 4B47A 2M8DB 8ATCB 1EP4B 5BYQA 4ED4A 2Z58B 2B0GA 2DHHA 3KOAA 3N6MA 2QSWA 3FBCA 3DU5A 1UAWA 2CPYA 3CRZA 3HP6A 4B02A 2CPHA 3TP2A 5T14A 1HARA 2RB7A 2QL5B 3X1LB 3DOMB 1C1BB 2OPSB 3THVA 4LT6A 5EGEA 5E3RA 3Q2TC 3ILJA 3UCUP 1H72C 4RMFA 4WKYA 3TJ9A 1CQNA 1ZM3A 1S1VA 1YRUA 5EN1A 4S0MA 3KLFB 1DD5A 4KT0C 3I5BA 2JX2A 2VJIA 2V5HG 4XN3A 5A0YB 3CJ0A 3DMJB 4HHJA 1FKPA 2WHOA 3SCJE 4CWBA 4ETXA 2P8TA 2V31A 4B9VA 4GKJJ 4RD3A 1TKTB 2YNFA 1N0VC 3GONA 3EGWB 2GIFA 3T00A 1CNFA 3ZFVA 4F4ZA 4DFJA 5F9NA 2DXEA 3PYGA 4N41A 2WVDA 2FHJD 4A8KA 5KW9A 3LQ6A 2G13A 4PPZA 3K2YA 1KEKA 1M90D 1KQKA 3PW2A 2HRUA 5RUBA 4I2PB 2HNZB 5ETTA 5B0FA 1KSPA 3BDEA 3VGVA 5AE1A 2IBKA 1F6TA 2D6FC 3W9HA 4X4PA 5LMNJ 1MU2B 4URGA 2UV8A 3FCVA 5E0OA 4Z4ZA 4MH8A 3M8RA 3M4XA 4U8VA 3CPWR 4Q8EA 3GTQC 3A1YG 2KHCA 3DGPB 4Q0BA 1TWFA 4GKJF 4G0UA 1MROA 3O8WA 1OS5A 3CC2S 6AT1B 2DISA 2E5HA 1XXCA 2F4FA 3PO3K 4F3MA 3WQZA 1SVDA 1RACB 1W35A 2VD3A 4NEZA 4PWDB 4O3SA 1V3SA 2OFHX 4QW8A 1BLIA 1NB9A 5IV3A 2L9NA 2HQ3A 2OHDA 2QA1A 4YHHF 2YQ3A 3CIMA 4KB2A 2FGOA 3M2VA 3C15B 4ERDA 5LSLA 3JAMY 3CMMA 4DR3F 2DOGA 1CULB 2ABYA 4ZKAA 3MDFA 1F20A 4PC2A 2LZJA 4I0WA 2DPJA 4DX8H 2AYBA 3TFJA 3OHAA 1RAOA 3MUVP 4JI6J 1RT3B 4JI1F 5HL8A 5J2QA 3CDAA 1E79A 4YR0A 3MMJA 3CCSB 5KG4A 4AE5A 2U2FA 5K14B 3VVUA 1Y00A 3SCLE 2HQGA 1W2BR 5F4OA 4ZCLA 3SZYA 5J35A 4QJVA 2EG2A 4YELA 2O67A 1ZM4A 2FVPA 3I5AA 1RAJA 4TY9A 2YY3A 1BHNA 3M3YC 3MM6B 4KQZA 1RA6A 4XO0A 4JI3J 3BP8C 3QIPA 2RRAA 1UJ6A 1T8EA 2D9RA 1WJ9A 3S1NC 5F3ZA 2RUSA 2NVYK 4C8ZA 2BKOA 4Z4WA 4A3JK 2D9OA 2XMWA 4DN0A 3KEWA 3TA2A 5KFWA 3AVYA 1S99A 4JI5J 3HI9A 1T94A 2C5BA 2BRKA 3AOCA 5EWGA 1U0HA 4HHHA 2MKIA 2R2TA 3TJAA 5IP7K 4O3NA 2DCLA 3W2IA 3S2HK 1Z1ZA 2YKPA 2R7XA 1O2BA 4MQ9A 1VHIA 1R89A 9RUBA 1TUGB 3KXDA 3GEHA 5AXNA 2XS2A 3QRQA 4UOGA 2LECA 4KY3A 4KDDA 1DRZA 1SC3B 2IC3B 5BR8F 4ZCKA 5J1EB 2A6HA 2QGFB 3O1LA 1MNEA 3Q89A 5AJ3J 2KHDA 4NLDA 1D0EA 4OIPA 1E43A 2HNDA 3KLHB 1JLCB 1CQXA 4J9NA 1VQ9S 3HULA 2ZJRQ 2DGWA 3P27A 3UDCA 4A8XA 3NY0A 2BM1A 3RBZA 1U1QA 1JLCA 4C4WA 5CYMA 4ZVPB 2XNCA 5T41A 1FNBA 5AXMA 4TSFA 2HFVA 1O26A 4HI1A 2VUMC 4OYAA 4F4WA 2XMKA 1FCAA 3VQSA 1JNYA 1YJNS 3C3LA 2MJUA 2VKZG 1YKWA 3DOKB 3KLVA 3V5RA 4YFUA 3NNAA 2XCQA 1U26A 3VAMA 4DR2J 3G8TA 1YG0A 4BY7C 1JKHA 2QLJB 3S16K 1EP1B 4EEYA 3CSKA 1AZSB 3CXCR 1YJVA 2MLZA 3HSDA 4ANCA 3K8VA 2DEIA 1FE0A 1QE1B 3W9JA 4KMDA 3D5MA 3W2VB 1HQ2A 1CJUA 2YWGA 3W5UA 5EDWA 2MY7A 3BJYA 4ZPVR 1IHMA 1I1GA 1LK7A 2R7OA 4WTOB 1NBMA 4F7DA 2ZZFA 1WWHA 5IM0B 3J80U 3CQZC 2W9CB 1TWGK 1Q81D 4P73A 2X51A 4X84A 4I67A 3S1QK 1ZETA 3KMQA 2HMIB 5KFDA 1AB8A 4PXEA 2IHR1 4I6WA 1DURA 5C4XC 4A48A 2GW8A 4CLSA 4W92B 1QY7A 2UUAJ 3DXJA 2YU9K 1BUXA 3CJ3A 2FC9A 5B0CA 1U1PA 1OY6A 2O01C 4TU8A 4ASUA 4ZIVA 3C66A 4M5MA 2V6AA 4NOHA 2QA4B 2BUNA 4ZS6A 1O25A 3BO4A 3I0SB 4XLPA 2R6HA 3ASSA 2CVEA 2R2SA 2UUBF 3HOVK 1N08A 3A3BA 4CLFA 4B3OB 1F2GA 2C3MA 5E6TA 1KTVA 4W90B 3S1RC 4BBSC 1VQOB 1R43A 1PKVA 3K89A 4Z4TA 2ZXIA 3CJ5A 3GIRA 1WG4A 3GTMA 1H74A 4XN0A 5TR9A 2DHAA 2KI2A 2WAQD 2AKWB 3MUTP 5TY0A 4GTDA 1MSWD 1K8AD 5ETNA 1TUVA 1QX4A 2OSQA 2R42A 4LREA 3DCAA 3R8YA 1G6BA 3KLIA 1UVKA 4ICLA 1S4MA 3BDPA 2R93K 5BYRA 1NJZA 1KHVA 2CG8A 5IYBC 2JLFA 2FQQB 1CJUB 1XMOF 2R7SA 4NLRA 2W2MP 3I1FA 4OQJA 2YPYA 1U48A 4L75A 4YN3B 5IORA 2CNNB 2ZEJA 3T51B 2AYGA 2KVIA 2X53S 1YJNB 2IA6A 4Y65A 4HHUA 3RRHA 3UN2A 1TAQA 3MPUB 4ZPAA 1FFSB 1DCHA 4PWUA 1HW9A 4WILA 4KH1B 4YY3F 3QJPA 2X3GA 2QA4S 2FVQA 2Z0GA 2ZHOA 3K5OA 4DR1J 1YHQB 1N34J 2GHWA 1B0TA 4UT4A 2MQ8A 3THTA 1KRPA 3BN7A 3G71B 3Q6RA 5IOLA 1S76D 4YB1P 5KFAA 1VC6A 3OL6A 4RNFA 2WSEC 1TL7A 4EBEA 2ATCB 1F3VA 2NS1B 4IOCQ 2I9SA 3CMAS 4WYLA 1F9NA 1S97A 1EETB 4FN5A 3ULHA 1VS3A 3CVKA 2F1MA 2BABA 4H4OB 3DDYA 4KTQA 4JYAF 1DAXA 3ELHA 4M5DB 4PCQA 1IKWA 3EICA 2VF3A 4EH1A 3MTJA 2E66A 1N36F 4YQWA 4JI3F 2BJ3A 1DQ9A 5GAGU 2DNGA 2JA5A 2XG8A 1RHKB 3PKYA 1KLMA 2JDJA 1UA1A 3GFXA 2C3PA 2PMZD 4G7XA 2HHPA 3OPFA 3R97A 2A2CA 3OEEA 4CCHA 2IM0A 3MM5B 3VWSA 2JA7C 1IM6A 3DLKA 2EBBA 3CCQB 4QFMA 4LFCF 5LSRA 3TRGA 3M7VA 3VVTA 3D7SB 2R9LA 4M1XA 4Z7YA 3BKUA 5IP9K 1O29A 3WIUA 3S17C 4H4KA 4XIUA 3M6WA 1R8HA 4OYXA 3I4HX 5CCMA 4ACAA 2G2YA 5E33A 1U47A 2QLFB 2V7QA 1CJVA 5FDLA 4X05A 4C0HA 2Q6KA 2BA9A 1GAWA 1XC9A 1FRIA 3C16A 3S6EA 4XLAA 1NHVA 1S7IA 2XYGB 3W65A 3V81B 2QN6A 2UUCF 4P2NA 1IBMJ 1YLXA 4J9SA 2GVZA 4I7FB 1RU0A 1SL0A 3I0RA 4C43A 3GTLK 3I82A 4LIWA 4RUBA 1QAJA 2QMWA 1REVB 3T41A 3SEOA 3H0PA 2VUMA 3QFRA 3N5FA 3D4JA 4C2MK 1N4LA 1JKHB 3UCZP 4C3LA 1YJRA 3PW4A 2J76E 1VQ8S 5M5XK 2OAUA 1FK9B 3Q3AA 2QJ3A 3K17A 1YGYA 4RNHA 2XZTB 4Y00A 2OPRA 2HHQA 1GFWB 3RRKA 4D3GA 3IG1A 1W0KA 2CQPA 2R7ZA 4G5GA 2J9DA 1Z2ZA 1U49A 2GQ2A 3EDQB 5CYQA 1XXBA 4QU6A 1R3NA 2HCJB 3I0SA 1RABB 1SMYA 4CO2A 1PAEX 3GTQK 5ETPA 2XY6A 3VNUA 4PXCA 4A3BK 2Z2LA 3WNBA 2ZWPA 5DZ7A 4NLVA 1AROP 5CQGA 1W2IA 5H9EJ 1FA0A 2W25A 1VI7A 4Y2IA 1WACA 1AXQA 5K14A 1QTNB 3BN4A 2R2UA 4C6AA 3SZZA 2BZ2A 4HT5A 1M0SA 3TTGA 2ZDOA 3NGKA 2YNIA 4XLCA 5E3AA 2J6SA 2QG9B 4JMQA 2DXFA 2GIQA 4K4XA 2VICA 1H6KX 2IPOB 2CC2A 2BE2A 2DGUA 4MKBA 4RBTA 1HNXF 5MLCV 4GO7X 2J7KA 1G2EA 1TK0A 1UD5A 2G0IA 3PYDA 3Q39A 1KQSB 4WXOA 2E44A 4OV1A 2AYMA 2A0FB 2PO4A 1E62A 1IWAA 2HFUA 1I3OB 3GB0A 1LQ9A 1UWBB 4KM8A 2NPFA 1GK8A 2VG5B 1U24A 1FXDA 1U45A 3Q24A 1IS1A 5CAAA 1SC4B 3T53B 2XMVA 1FRKA 1Q95G 4RW9A 3GLJA 3QAEA 1I3QK 2FVRA 4GC7A 1WCMK 4DEZA 1U8WA 1E6YB 5GAHU 1WHWA 1KR4A 4JV5F 5HSPA 1AB4A 1HNZJ 2R93A 3Q83A 2WVEA 5E3QA 4DV3F 4C3IK 2ASYA 4QU7A 2ROGA 1RHJB 1C4CA 4XAKA 1JJCB 4PC6A 5HL7Q 3OBIA 4B9LA 3EYZA 4C3JK 3PUMA 2MHNA 4W98A 4URQU 1VRTA 3CW2A 4ZLJA 4MKAA 2ZE2A 3MEEB 3CEDA 3WYAA 3U1MA 3J7A1 1FTRA 3HSZA 1IR2A 1SV5B 2V8VA 3PO5A 4UOCA 2DRDA 3HT3A 3UN5A 5DM6Q 1R0AA 4EZ6A 1RBAA 1MWZA 5M3MK 4LK0A 1WEYA 3TEGA 2XMMA 2HVHA 2HAFA 3RGIA 3TW0A 4B9NA 1Q8IA 2DNQA 5A6WA 4ZJLA 1XN9A 4G65A 1Q4RA 4C3MA 1S0MA 5DDPC 1G4CA 4MFBB 4BWJA 2I1RA 4IUFA 3SLNA 1VHOA 2WVFA 1B4BA 5CCLA 3GU0A 3JS9A 4XPCA 1K1SA 4A3FK 3I4NK 3R7NB 2QC3A 4RLEA 3TAMB 5LL6d 2VQEF 5A0YA 3M8QB 1SBRA 1O27A 4B3TF 4USMA 2F65A 1BWVA 3T1YJ 3DRRA 4BC7A 1HWKA 1ZBSA 2WB1L 4X8IA 3OL8A 4DWIA 4DV6J 3MWBA 4XLNA 3RB0A 5A8WA 2VB6A 1YQHA 4ZP6A 3ET6A 1CULA 3OAAA 3T56B 4WE1A 5A2QY 4G3IA 2PMDA 3PFOA 4F3OA 1PC4A 1NHKL 3ZTRA 1RE1B 4DCPB 3PJ9A 4YAOA 2UUBJ 1PYTA 5DQHA 2JDIA 1SUQA 4PUOB 2DNLA 1JX4A 1S1XA 2ZBIA 4JYAJ 4UQGA 2YVSA 1N88A 3MMCB 5ETSA 4USJC 3J81j 2I5JA 1C2PA 1LV5A 5ETRA 1R9TC 1X0PA 1X7VA 1LW2A 4JI0F 3GDZA 2WSFC 3ASRA 5IT9Y 4WZKA 4MK8A 1Y1WK 3Q8PB 1ZZFA 1S1UA 3ZNUA 3LALA 4DG1B 2WZ1A 1MW7A 3SBMA 4X66J 2BBEA 2HQDA 3B82A 3DNCA 2V4RA 1C1BA 4OZNA 3PVXA 4O3QA 2OIHA 2DXDA 2ZUFA 2NZCA 4Z4UA 5B08A 1UD2A 4IH6A 1VBKA 4QVJA 3CJKA 1AZSA 5TRDA 1XIQA 3OW7A 3RBEA 4PKDB 3K0JA 2YNFB 3I96A 3BSAA 3HOXC 1K28D 3IN5A 2JC0A 1VQMB 2G1DA 2XBPA 3RAXA 5IYCC 2D3UA 1JB0C 2JA8K 1W87A 2UVRA 2HSEB 4PQUA 2A3JA 4XSXA 4K4ZA 3UDLA 2YU9C 3I4PA 4P5BA 1K73D 1S49A 2LQBA 3CCZA 3CCVB 2J0WA 3KLIB 3HD1A 5LJ3Y 1I5OB 3N4WA 1VRQC 3ASQA 2JA6K 5KFQA 4Y7NC 1GJRA 3QNWB 4BY1K 3ZZOA 5TMFA 4ZHRA 3AOBA 1QJHA 2UXCJ 1RHUB 4KSEB 2J0XA 2JA5K 2R7ZC 5F8JA 2RIJA 3HSGA 1K0VA 1VJWA 5KFJA 5I42B 1OYDA 2H5EA 4DCOB 3O3LA 4A93C 4XKWA 1RBLA 2XYPB 4I2QB 3TUZC 2W7AA 1HBMA 5C7PA 4BS2A 1O8BA 2W2OP 3OKXA 1DLOB 1JXEA 1JMTA 1Q86D 3KJVB 2F4VF 4EYHB 5FIIA 4G7WA 3F44A 2K8GA 1HQMA 3IS9B 3ASTA 1VIOA 3V4GA 1G3OA 2M7SA 3TUJC 2F8MA 1BE4A 3AGQA 3FJOA 2P9EA 5FO0A 3K8WA 3HF5A 3PIOQ 1S79A 2YH0A 2R92C 2L9DA 5IM0A 4DI6A 3CCVS 1UVLA 4KJIA 4KYZA 2BKNA 3VAIA 3VQTA 1TFWA 4M5IA 5KG1A 1T03A 2PPBA 1VF7A 5HO4A 1TP7A 3GCXP 2ZNZA 2V63A 3GV7B 1HBOA 2DHXA 2F1LA 3RZOK 2VIHA 1EARA 3PCOB 2R7RA 1VQ5B 3KK1B 2CJ9A 5E68A 4RD2A 1UEKA 4CO5A 3TWZA 1BJTA 1K73T 2JSXA 4P2SA 3IRXA 2XHWA 1HI1A 1RT5A 2VG7A 5KFXA 1RBOB 3R9LA 4K4YA 1JLBA 1X5TA 3TI0A 2OEKA 1K83C 3BY1A 1T9UA 5L8RC 3G96A 2WW8A 2WK4A 1B23P 1J5EJ 3POTA 4EO6A 2QL7B 3KHHA 2PIAA 1MMNA 2Z57B 2E1MC 3T01A 3J7AN 4KBIA 1EKSA 1JIHA 5F8GA 1HBOB 2AEMA 1T6ZA 4JI2J 4QIWD 1VHEA 4QIGA 1VDHA 5CDFA 1AMOA 2DNHA 4ZCMA 2YX1A 5KT5A 2LDIA 4X65F 1USOA 4RNOA 2MYFA 1RWNB 4OOSA 2X3UA 5HAOA 5M5WK 4ACBA 3SSSA 4YDXA 1CJKA 2GK7A 2BEFA 4FDFA 4KO0B 2F8HA 1TWGA 3OJWA 4XMYA 5D4LA 1U1OA 4O4GA 1RCXB 4O44A 1JLEA 4ZDNA 2JWNA 2JA8C 3KNAA 2P9GA 5B09A 4WJ4A 4Q44A 3CCWA 4RW7A 3Q86A 2X8KA 3M2UB 4M5LA 1TAUA 3CC2B 2CPZA 2J9CA 1YJ7A 1QVGB 3PY8A 3FFIA 4OJGA 4DBQA 2F5GA 1LWEB 4OI0A 3TUPA 1EQRA 2KFNA 2NLWA 2CF4A 4TYBA 2CJKA 3W61A 4O3RA 2IRYA 4DR6F 3C8YA 2X6YA 2D3NA 2PFDA 1ZM9A 2C3OA 3JSYA 3OT9A 1HWLA 3C46A 4Y2KA 4DV7J 2E2HK 1N5QA 2I38A 2KDOA 2CQ2A 2Y1IA 1FRJA 1SKWA 2I5JB 5BR8J 4ETZA 4BC9A 3D54A 2JFDA 1UL3A 4D3HA 3UDEA 1FESA 3Q38A 3M8ZA 4LSLB 2WOMA 3AH5A 1S1UB 3IR7B 3OQ2A 2P5MA 2NXJA 2DIVA 4XKVA 3P4UB 4HE6A 2FPHX 3BSNA 5ETMA 1X9SA 2B56A 4RJLA 4WE1B 3V6DB 3QQCD 3BUEA 2B9EA 4F0KA 3G6XA 1ZVUA 2UV8G 1JXVA 5DN6A 1RLDA 4EBCA 3PRDA 2W01A 4OL8A 1I6HK 4TY8A 4P12A 4OI2A 3FJ2A 5J2MA 3ZXWA 3HHLC 2QRRA 4N76A 4PQUB 3I4MK 3L4KA 3TZZA 1YJUA 1I50K 1MN7A 4PC7A 1HNZF 4TN1A 2LA4A 4NBSA 4GT9A 3TEHB 3I9V9 2KH9A 2J7UA 3PHEA 4C8OA 2FUG9 1TWFC 3ZZZA 1RISA 3CO9A 2CQ3A 2KG0A 2EKYA 3R6JA 3T6JA 2YU9A 4OYOA 5T7LA 4JB8B 1T3OA 1GX5A 5DG7A 3MMPA 3S15C 2JA6C 3RBDA 1IBLF 2W2QP 3MGJA 1TMMA 1HR0F 3FMWA 1TWAK 1YBAA 1UFWA 2ZBCA 4ZPTR 5KT2A 4FYYB 1PJ5A 1NK7A 2QZ8A 4MFBA 3DLLQ 2HGMA 3UDVA 1L3VA 4BWMA 1EFCA 1P6TA 2CNKB 5MAOA 4LRFA 1KFDA 2NQPA 4V19X 5HZBA 1WCMC 4F2SA 4FYVB 5KFHA 3FK4A 4OHVA 3DXSX 2HIQA 2QFIA 4X06A 3H4BA 6FDRA 3U6BA 1BQNA 3HXAA 2DGVA 1RP5A 1YITS 3S2HC 4ZVTB 3UVJB 4CO1A 3RZDK 4M63A 3PJWA 8RUCA 3K7AK 1AUDA 4LRBA 4AYBL 3UR3C 4E98A 1F9FA 4N8OA 1SIZA 1Q86T 4YUDA 2M5YA 4P1VA 1V5IB 4NLXA 3SIPB 3MM7B 4LF4J 3T5LA 3W3SA 2Q6CA 1IUJA 1NH8A 4NCNA 3BZQA 3KK1A 2FC8A 1UA0A 2GJ2A 1FDNA 5HQLA 2XY7A 4DR1F 4DQQA 5J1PA 4QIVA 5A8KA 3HHKA 5AXLA 4OHYA 4YY3J 3Q8UA 1SV5A 2AU0A 3I4NC 3G87A 3NE5B 2VNKA 4DR6J 4XLEA 1VBZA 4P71A 2CPXA 3G8SA 3CJ8A 1VQYA 2DTJA 4A3DC 1ELOA 4KKTA 1QSYA 2Q6IA 1VIXA 3N3YA 3PACA 4OPVA 2CPEA 4M5DA 2V6TA 4FNHA 3EGNA 4C98A 2Y8YA 3UW1A 2KN4A 2QA4G 5K8MA 3V6JA 4II2A 1UWBA 2RSQA 1W25A 4BDPA 5HLFA 2DEUA 4DV0F 2J8AA 4M5GA 1K1QA 2CK3A 1C4AA 2FHJA 3SSQA 3MR7A 3NCQA 4OI6A 4YEJA 1VQNB 2KL8A 3AODA 2VQFJ 1SKQA 3O6QA 3RR8A 1R8CA 3GIIA 4TKTA 1NJIT 2NUUG 2I0XA 4RCZA 3M4OC 4NA3A 2IDLA 3I5CA 4I68A 4AQYF 4DPYA 1JOEA 4MYTA 2OP5A 2RAQA 1T9VA 1KNZA 3ZUGA 3SFGA 1ZH5A 4ED5A 1BX1A 3IBWA 2JHEA 3G86A 2FIUA 2C4TA 4F7VA 2UUAF 4TNOA 4KE5A 2JVRA 3E01A 4NASA 4ZH4A 2RQCA 5IYNA 1DFDA 3GYGA 4A3LC 3V6DA 2RH3A 5DETA 4DV1F 4RDLA 5IYPA 1VBYA 3AY0A 1VLOA 4NLPA 4BBYA 3KTQA 1BGWA 3VR1A 3L4JA 2FQOA 3A8EA 2BJ9A 4MJKA 1HHQA 4G6IA 2GVZB 4DL0C 1I6JA 2DB1A 7FD1A 3KHRA 1EP3B 2VJJA 4ITSA 1KOOA 4OYIA 4EZ9A 2PMWA 5KFNA 4XK8C 1KDNA 4FVMA 1YJTA 3QMQA 3CB4A 3QLHB 1JLBB 2AIRB 4DPWA 1GTHA 2GO9A 2BN4A 3W2HA 1VJSA 4TQSA 4LBZA 2FLPA 1WG1A 1RQ0A 4ES3A 2CQBA 5KFPA 3W2EA 3ZTQA 3CC7B 4HDGA 3S1TA 1XXAA 4QUZA 5HP1B 2ZUAA 3V6HA 1LWFA 3PO2C 5DDOC 4A93K 4NZ7A 3W64A 1L0WA 2Q6BA 4JBCA 2XSJB 2OD4A 3QPIA 1TWHC 4F04B 2R8JA 4DL7A 1S1VB 1T03B 2XNRA 1RWOB 2J7WA 5EMNA 1RXOB 3N01A 1W0JA 5DLGA 3I4MC 2LQ8A 2RD5C 2E7XA 1N5YB 4AL7A 4FK8A 1YJ9S 2H4WB 5C5JA 1WOPA 4KHRA 2QMXA 3N0BA 1IR0A 2DGSA 4FF2A 3NCRA 2HDNB 4OMFG 3TO8A 2VNHA 4KAWX 2XZOA 1X4FA 4NL5A 2KTQA 1HHTP 3EZUA 1PIEA 1KWMA 1H7WA 1OY9A 1DQAA 5EX0A 3ZTOA 3AXMA 4ZK7M 1R7IA 4ZVEA 5C3EC 5I3UA 3DGPA 1B0PA 5D78A 3F41A 5KG5A 5DSZA 2IM2A 3FOEA 2V8HA 1SC1B 3RY8A 3GTJA 4XORA 4P2XA 3S17K 1E6VA 3OTOJ 5TV2A 3UCGA 4YB7A 2F7VA 4UAJA 2CQCA 2RNEA 1WPCA 3C2PA 4LMZA 2XEXA 3M8WA 3TANA 1VQ6S 3H5UA 5IYDK 5F0UA 1ZYQA 3AD9C 2ZZTA 4KARA 3VTIA 1INNA 3H8YA 4XL9A 1FDDA 1WCMA 9ATCB 4F02A 4FWTA 3SI8A 5D4PA 2R7UA 2VPZB 3I6PA 1RTZA 5KT3A 4N5SA 2M88A 4AVZA 3CPWB 3SV3A 4Z4VA 1Q5VA 1S7HA 1U7LA 6FD1A 3H2LA 5F8NA 3U6KA 1H0HB 3ILIA 2M3DA 2EK1A 4RBUA 3L09A 1WG5A 3PENA 3OFHA 4C8KA 3ILOA 2WJVA 5HQ8A 1XK8A 2IJRA 2F4VJ 4RPDA 2UZAA 4QR0A 3NGUA 5LXYA 1RT7B 3AVUA 1TTTA 1JWWA 2WB1D 3HHNB 2RE1A 1UVMA 2LQ5A 5C4JC 3L7OA 3J80Y 3AXKA 2D41A 2MEWA 3NUHA 3IPJA 1DQ8A 3CCSS 1E63A 3LP2A 5DGBA 2OKQA 2DGXA 2LXFA 2VQFF 3A1PA 2R4FA 4YHHJ 5D0GA 1W2BB 2UUTA 3VHQA 3RU0A 3ICLA 4X7DA 1UVNA 1JLEB 5DGAA 3R2DJ 4EWTA 4A3CC 5D4OA 4Q0BB 2BGIA 3UQSA 4EUVA 4ZCIA 2O5DA 4LJMA 2O1PA 3FGVA 3M2UA 3HO1A 5IOSA 2MLXA 1XEZA 3U7JA 4PG8A 4AC9A 3GTYX 2CQDA 1WF0A 5KFUA 4UZBA 2BM0A 4LQ3A 4QYZK 2BRLA 2DETA 2COLA 4RW9B 2CPFA 4LBHA 4UUWA 1SI9A 3J81U 1B7FA 4ZPCA 1KQFB 1EFTA 2V2ZA 4OX8A 2GQQA 3RBXA 5CD4H 1X9MA 2FQTA 2YWHA 1BDFA 3I87A 1FO1A 2ASDA 2GQFA 3VO1A 3LTOA 4JI4J 1VGXA 3KLGA 4K2XA 5EGYA 4ALZA 5ADZA 1CSJA 1IBKJ 3W9IA 4RU2A 4P3IA 5KSWB 1HW8A 4AF7A 3JTNA 3SZ2A 2NCKL 3GTGA 2SXLA 4OJHA 4X6AK 4NCBA 1RCOB 4ECRA 1X5PA 2MTLA 4DF8A 1NZAA 1HBNA 2ZITA 4NNJA 5CD4A 4XM3A 1KRHA 3OFNA 2XMUA 2CW0A 4HIZA 1NBEB 1RJJA 3D6HB 3CNQP 5FIUA 1UFLA 2C2NA 1KQ4A 3DRSA 4K1XA 1M5KC 3DU6A 2AJ4A 2EW9A 3BCDA 1IQ0A 4QR1A 4ECZA 4X4TA 3T19A 3MOZA 5B7WA 1M1KD 1RKIA 1A9NB 1TWFK 1R8BA 4IFYB 2NXCA 5J2MB 2CRVA 1NPPA 2MZJA 2OPPA 2GS8A 4FPRA 1YZ6A 2XLIA 5KT6A 3ZC4A 2RVJA 2BANA 1JLGA 3H40A 1U09A 3P45B 3CDUA 4LF9J 4LF7J 5HROB 3LWMA 1N54B 4DPUA 4RD0A 1E6YA 3CCUS 3IWLA 2V2QA 4ES2A 5IFMA 1KD1D 4IFVA 1WF2A 5KOXA 4MIWA 3AAWB 1QG0A 3ENVA 2OMLA 1WTFA 5A88A 3BO2A 1I8DA 2YPZA 4Z2XA 3A12A 3Q8YA 5D15A 3OLAA 2IVYA 1O2AA 1TWHA 3F0NA 1NXIA 3IA0A 4ILLA 1UZHA 2VA3A 1OO0B 4B44A 2A6OA 3MR3A 2HNDB 3M8PA 4WQMA 3ITHB 3ZBUA 4ZN1A 5HMYA 4ZVSB 1QH0A 3UNGC 5LMNF 4B9MA 3DLJA 4NCGB 4BBRK 4BY7K 2AYEA 2MGZB 2W6IA 1HNWJ 5IYRA 3UR0A 4DR7J 2CWKA 2HGLA 3HT0A 1HQEB 4FF1A 3D0HE 3FEXB 1RAHB 4LF4F 4K2JA 1EKRA 1YJWS 4OYZA 5F8MA 2UUWA 3OJXA 3M9NB 1BMFA 1MMLA 4P7TA 4BPRA 4OHWA 4ZP9A 1F5CA 2HEKA 4ZIWA 5F9LA 3GTJC 3S1RK 1X8DA 3JU4A 2JL9A 4GTCA 3G4AA 1FWKA 2G0CA 2BE7D 5CZXA 5K8PA 3G8QA 2LA6A 3S01A 1T9TA 3C14B 3IC1A 3DGVA 2D7SA 1HKAA 4B17A 1QUVA 1NO8A 4UUXA 2DPIA 4A3KC 2UVWA 4A8OA 2N3LA 2BSAA 4QW9A 3BH6B 1X4AA 1TWCK 4ECVA 1VQPS 3GEIA 2MJNA 4OI4A 3KJFB 4LRAA 3H3VL 3J7ZT 1WC4A 2ZZEA 4I69A 1QAYA 3HJVA 2W9AA 2FVSA 2RC6A 1OIAA 1Q53A 3W1YC 3NOGA 3M4OK 1HL6A 1B2RA 2RDDA 2HFOA 2GV1A 3G4CA 2DH9A 2ERRA 3SCKE 3UE2A 3I31A 4ELVA 3GTKC 2XZPA 1MN9A 3HFKA 1H2VZ 4IQMA 2VBUA 1B4SA 4NPOA 5AT1B
chains in the Genus database with same CATH topology
1WOPA 1VLOA 3AD7C 1XZPB 4PABA 1WOSA 3A8JA 3GEIA 3TFJA 3ADAC 5L46A 1X31C 3AD8C 1WSVA 1XZPA 2GAGC 1VRQC 3GEEA 1PJ7A 1WOOA 4P9SA 3A8KA 1VLYA 2GAHC 3AD9C 1NRKA 1XZQA 3TFHA 3GEHA 3TTGA 1PJ6A