1WSRA

Crystal structure of human t-protein of glycine cleavage system
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
371
Chain Sequence
VLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 118
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 2.1.2.10: Aminomethyltransferase.
pdb deposition date 2004-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01571 GCV_T Aminomethyltransferase folate-binding domain
A PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.110 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Aminomethyltransferase beta-barrel domains 1wsrA04
3.30.70.1400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aminomethyltransferase beta-barrel domains 1wsrA02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 1wsrA01
4.10.1250.10 Few Secondary Structures Irregular Aminomethyltransferase fragment Aminomethyltransferase fragment 1wsrA03
1V5VA 1PJ7A 1XZQB 1X31C 3GIRA 4PAAA 4PABA 3AD7C 1WSRA 3A8IA 3TFIA 1VLOA 1VRQC 1VLYA 1WOSA 3GEEA 5L46A 4P9SA 1WOPA 2GAGC 1WORA 2GAHC 3AD9C 3ADAC 1XZPA 3A8KA 3TFJA 1XZQA 1WSVA 3AD8C 3TTGA 3TFHA 3A8JA 1WOOA 1PJ6A 3GSIA 1NRKA 3GEIA 3GEHA 1YX2A 1XZPB 1PJ5A
chains in the Genus database with same CATH superfamily
5ETLA 2EI5A 5IOLA 3DGPB 2I5JB 1RT5A 2VOOA 1C4AA 2R7QA 2XLIA 3OP1A 2RDDA 3Q38A 4NCGA 2F9JA 1F93A 3D9BA 3LWLA 1R8HA 3M32A 1R5OA 5EX3A 4CH1A 1HBUB 4DR4F 2JN9A 3FPPA 2DRBA 5EWGA 2O5DA 3QWPA 4KB2A 4QR1A 3HHNB 2R7ZK 2W01A 1HD1A 5LM7E 3LF0A 5CZVA 4LBWA 3IBWA 1SQGA 4KR0B 2VBZA 4S0MA 2NXUA 1ICEB 2V0NA 3DLLQ 4ACAA 1SB6A 3CD5A 2KT2A 5LSLA 4BPRA 2JWNA 2L9WA 3E01B 2QLJB 3IAM9 1TMJA 4C3MA 4TKOB 2W8KA 1LWCB 2GQQA 1YHQB 1X8DA 3TAMB 3QFTA 1F2GA 3F44A 2C3YA 1UVKA 3ENVA 1VQKS 2B7BB 4DPTA 3AVTA 5IS2A 2BKOA 2A0FB 1Q82D 3OTOJ 3BQ2A 3ISZA 2I0XA 1H98A 3OLBA 1UA1A 2MY7A 1FWPA 2ZXHA 5LJ5Y 4TY9A 2I9SA 1YIJB 2QN6A 4DK1A 1QAIA 3EZUA 5KFBA 1LOUA 1F60A 2FTRA 1KTVA 4LSLA 2NUHA 2WPDA 5HJXA 4XLHA 3UDVA 2XTJP 2UXCJ 4I0WA 2F7VA 3HSDA 1RTIA 3DM2B 1OHHA 4D3GA 1YZ7A 3HAGA 1Y5IB 2IDLA 4HDHA 1S1VB 3E3XA 4ZP7A 2E2HA 1K0TA 1VBKA 3UDEA 1NDKA 1KLNA 1V3RA 2EG2A 1IKVA 2DNYA 5M2RA 1IE0A 3ISND 3I5BA 3FJ2A 3PVDA 4TLRA 3RR8A 1YITB 2WRMA 3VAJA 2F9DA 1F1BB 4DS5A 2HSEB 4KO0A 4X6AC 5DZ6A 1IW7A 3BKUA 1RABB 1NB2A 3KLEB 3DXSX 4KRWA 3RAXA 3QFRA 4LC0A 4A3JK 1RT7A 1JLGB 2JLFA 3M1VB 2ZUGA 4K0KJ 1IWAA 4EI2A 2B7CB 5DG8A 4Q44A 1LK5A 2RH3A 3BH6B 3O2IA 5GMEA 2Q6KA 4EYIB 2C2RA 1KLMB 2IM1A 4WZTA 2P9EA 1FK9B 1HYSB 4A3BC 2OPSB 3AVWA 4RWWA 1Q16B 1TP7A 3KHRA 3BGFA 5C2CA 3HOYK 2GHWA 3SFUA 4M5NA 2W6JA 1KDNA 4WTOB 1RAIB 5C44C 1HBOA 4XPCA 4Z2XA 3P4UB 1X4DA 4RBTA 3GTGC 3VCDA 4OOVA 2QA1A 3H2VE 5CHCB 3CW2A 2MQLA 4NEYA 5IC4B 4NLGA 1CJUA 3POTB 2DGTA 2UXBJ 2CC2A 1UJ6A 2HFUA 4ECSA 4U6PA 5KT3A 2QL9B 3L09A 3PO3K 2D74A 2PO4A 4I2QA 5IYWA 4JI2J 2NCKL 1J6WA 5KT4A 4TLQA 4JV2A 1F20A 3TEGA 3T1YJ 3NOCA 2NZ4A 3I0RA 3VR6A 3OAAA 2AV5A 2X53S 3NL0A 4XLFA 1GR1A 1SJ1A 3TZYA 2NSCA 3IGNA 3DLEB 4DDFA 1YHQS 2WSFC 4LFAJ 3SDEA 1S5ZA 3SJZA 1YLOA 3OFEA 2ZBCA 2QLFB 5F8NA 5K8MA 2V2ZA 1DAXA 1WF2A 2LQ9A 4J91A 5HROA 4X7CA 1S1TA 3RG6A 5T7LB 4ID8A 2V4QA 1XXCA 2JA6C 3JQJA 1M1GA 4CLZA 3OSNA 2R7RA 1QUVA 5KT6A 4HH1A 3GCWP 1YIJS 2MEWA 1QSYA 5I42B 4Z7CA 3PFOA 1KVKA 2OPPA 3A8EA 4ED6A 3OJUA 1AMOA 3T5HA 1OQ3A 1HMVB 4GKJJ 4NLUA 2M0GB 3MUVP 4P1VA 2VASA 2JVOA 4PXDA 1O2AA 2R93C 3F56A 2HK3A 4RDLA 3C14B 2ZZFA 2HBRB 4DL2A 3W2WA 2MQNA 5IYCK 3BBFA 1C0TB 1H6KX 1U24A 2A3JA 2YPZA 3A3PB 2VC0A 4JMQA 4CQJA 2B6AB 1SL2A 4JI0J 2FLNA 2C2WA 1GAQA 4M53A 4OHWA 1RAHB 1KK0A 3MM6A 4BBRC 1YITS 1V3ZA 3QO9B 3I4NC 2DPJA 3P96A 2X3DA 1ACMB 2XG8A 3IFEA 4G1VA 2QA2A 2A2CA 5F9LA 2Y0SD 4KH1B 4FZBA 1BQXA 1GAOA 1FERA 4OZJA 2V6AA 1LWFA 4RLZA 1D1NA 2B43A 4P5AA 1QY7A 1S49A 5A76A 3MMBB 4OLOA 3NG8A 1M5SA 3MHYA 2J9EA 4DL6A 2R6HA 3SV4A 1XMQF 1RBAA 1ZH5A 1RXOB 3FGVA 4G7HA 3G6VA 2OHDA 1YX2A 5CYQB 2YWWA 4PUOA 3T41A 1HNZJ 3B82A 5GADI 4M5MA 4M1XA 3PY8A 3SSRA 1T9YA 2BACA 1JNRB 1RT6B 2ROEA 4LK1A 1RA7A 3M9OB 2X85A 1XXBA 2E44A 4KAWX 5K8NA 3J81k 5TY0A 3SQGB 2HK2A 4P26A 4RUAA 1GJRA 4OYMA 1NJXA 4N56A 4NASA 2CZVC 5IQQA 2JJ4D 3K7RA 1Y1VC 5K20B 1X4CA 3K5LA 4HLBA 4I64A 2JX2A 1MROB 2AJQA 5IZHA 4CLWA 4FNHA 4B3GA 2FVCA 4OYOA 3I4PA 3RZDC 4G0UA 3DOLB 1BMQB 1KOOA 4I6AA 1MWQA 4WIQA 3KUGA 2ADBA 2IM0A 2I2YA 4OPVA 4KC6A 4K59A 4AL7A 4C0OC 3SKBA 1W26A 1N5YA 3MHPA 3GSDA 1HHQA 3KLHB 3VAHA 4OOXA 2HRYA 2R8HA 4IRKA 3FSXA 4XN3A 5E41A 4ECUA 3TA2A 4BXXK 2HQ3A 3B4DA 2UXBF 3DLBA 3CJ4A 1I6HC 4ZLNA 1U26A 2F1FA 3CAGA 4F0MA 3C6TB 1X5SA 2ACMA 2DCUA 1W34A 1Q78A 4YS2A 1VH2A 2GIRA 2XSJB 3T1YF 3OFHA 5HMWA 2XS7A 5HXBA 1VLOA 4UUWA 1VLYA 3GTKK 3HOVC 2LQ5A 3IS9A 1C0AA 3D0GE 1XMOJ 2FZCB 3K57A 4HHUA 2W8LA 4DF8A 1VQ4B 5U47A 5D8HB 3QPIA 2BBEA 2RRNA 2V7QA 2ZE2A 2BXJA 4H4KC 4LSNB 2GV1A 4JV0A 4DL5A 2NXEA 3S1NK 2FVRA 3HFVA 2FJBB 4L3KA 2EBGA 4DUTA 2PEHA 2IAJA 5DZ7A 2D3ZA 1FHTA 1IUJA 4J9OA 3I5AA 5KFEA 5IYQA 4DV5F 2ZTNA 1R0AA 5ETTA 2KDOA 5FIIA 3HX9A 2M8DB 4ILMA 2HLDA 2CQ0A 4GKJF 4MIBA 1FDDA 2IPOB 2E1PA 5CHPA 2FHMA 3KKFA 4CO0A 2E7WA 2XZPA 4KKSA 4KB4A 2HZCA 2DGUA 1VHEA 2V68A 3THVA 3LTOA 1HBMB 2M7SA 4Q2LA 3FRYA 1M5PC 1RWKB 3TTGA 3U27A 3CTRA 2MXYA 4NRUA 3TAQA 2J8SA 4Y2IA 1EI6A 1OY8A 1CJKB 4OJ3A 3JSBA 4IFVB 5KT2A 4OZ3A 1NK6A 1E63A 2HHWA 7FD1A 2XLKA 2FB0A 4JV1A 5EHHA 3TVKA 3QZ8A 4USIA 4CI0B 5BJRA 2ROGA 2ZJPQ 1WQGA 2J0SD 1T5EA 5M2UA 2E9TA 3RJMB 3CJSA 3R1LA 4GZYA 5BYQA 2DK2A 4CLKA 2OBSA 1YI2B 2FGCA 1TUGB 2C2KB 3DNCA 2J76E 1G2EA 2KVQE 2KRBA 1K44A 4FVCA 3I9ZA 1MMNA 4WE1B 1XB2A 4CTAA 3W5YA 5ETKA 3BGRA 3D0IE 3MFIA 5L46A 4IH7A 4MEXA 1F9FA 2OSRA 1O26A 3OUYB 3AD9C 2MZJA 4P5BA 2CAJA 1HW8A 2D3OR 2OELA 4KV8B 1IM4A 3Q8QB 3MPYA 2PPBA 1FXDA 1UKUA 2Z2YB 1QDUB 2U1AA 4RX6A 4O3NA 3ZZUA 4DX8H 3BQ0A 2BDPA 2PIIA 5D3GB 3S14C 3D6HB 1WQFA 2PA8D 1TKZA 4U96A 2ZTGA 1AROP 4XDCA 1O2FB 4JI8J 3OEPA 1QAJA 2YWGA 2F4VJ 2G0IA 2B5JA 4Q0BA 3RTVA 1L3TA 3CO0P 3WQZA 4P2MA 5FJ4A 3LVBA 2KO1A 1CJVA 2GQCA 2FQOA 3GB0A 4NX9A 4X7FA 4U9UA 5HP1A 2W9BA 1VQOB 4F3MA 4ZVGA 2ZZNA 1S1UB 3M2VA 4DX5A 3OEHA 4AYBL 3MMLB 1IKXA 4QR0A 2FDNA 5HBMB 1N4LA 1Y9OA 3FK4A 3S0XA 1K9MD 2D3UA 3FUYA 4XSZA 3J81U 5FJ8K 3NOGA 2IA6A 3HZEA 3QSIA 2GNKA 2SXLA 4F67A 4X7DA 4A47A 2JJ2A 1VQ4S 2R7UA 4OFZA 5GAHI 1WI8A 1FD2A 3MM7A 2HWTA 4YFKA 3N79A 2ALYB 3WIUA 4PXCA 1MN9A 1SFOK 1PGZA 2LP4A 3DRYA 1FEEA 4QIVA 2IJRA 2HNDA 5RUBA 1RCOB 4M1KA 1HWKA 4ED8A 2NVXK 4NCNA 3HULA 3H0GA 4DUYJ 4NMLA 3G9CA 2WTFA 2ZBIA 2IDEA 3CJQA 1ZYQA 4R8UA 4RMFA 2HVZA 4R0EA 3KWMA 4FKXA 1TWGA 1EJ7L 3MF5A 5A8RB 2FLOA 2XCPA 4UT4A 4GTCA 3DMJA 1RQRA 5KOWA 4GTEA 1TWFC 2UUAF 4HT7A 4WKYA 1XMOF 3D3BJ 4B47A 1HFEL 1QUFA 1R27B 2VUMA 1Q5YA 1YJRA 3BGUA 3GTJC 3OR1B 3RY8A 2VF3A 3OL7A 4MFBA 1ZM3A 4N77A 4XR6A 1QGZA 2NPIA 1E3XA 5L1KA 3BO3A 1KN6A 2HQGA 1H7XA 1USMA 1I50A 2C3PA 2I38A 4O3QA 1KD1D 3LQEA 2OEMA 3A3NB 2LMIA 1U1LA 1YJVA 1QE1B 5GAEU 5HK4A 3GTOC 3UN3A 2R9VA 1YI2S 3G6YA 4DU8A 3TWZA 2R8IA 3MWBA 4B9NA 1U0HB 2BRLA 4YFXA 2HIYA 2RVJA 4DQRA 1NSAA 2C4UA 1RTHB 4I7FA 4NCBA 1RWNB 1Y5LB 4ETXA 4LIRA 5KG0A 2GJIA 1M5VC 4Y0FA 1VBZA 3FCWA 3CCUB 5C3EC 5H9FJ 2ASJA 4WFZA 1D2EA 5KG4A 4BC7A 2E1AA 3VVUA 3PJ9A 1N0UA 1REVA 4A48A 1I3QK 4JI5F 5A8KB 5LMNJ 4DFJA 1EFTA 1ZA1B 3N4WA 3H4BA 1E6VA 4DDQA 4UOHA 1HQUB 4DNTB 1Q8BA 4PWWA 5IORA 4B4DA 1TVRA 4BY7C 3IWXA 3GYGA 1NSQA 3ZXWA 3MEDB 2FHOB 3JSRA 5IV3A 4KMUA 5HSPA 2W9CB 1H7WA 4O0NA 5B7WA 5KFCA 3BKTA 3PW7A 2VYQA 3EX7B 2DYAA 2Y1LB 1NDPA 1VQOS 1R9TC 1SC6A 2XMUA 4NLSA 5KFAA 1JLQB 1T9WA 4QIEA 2LA6A 2AIRB 3JQKA 3EQLA 1S6OA 2Z2ZA 1YZ6A 4MT1A 2R8KA 3CCEB 2B9YA 1RT3B 1RYRA 2YNHB 3KLGB 1S7HA 2PMZL 4FK8A 2KM8C 4JI8F 2B0GA 3QAEA 4RNHA 1S12A 5EGHA 3GV8B 4HE6A 1S72B 1TL7B 4YB5A 3V81A 5J35A 2IM2A 2XMMA 5IOTA 1T05B 1U47A 2EXUA 4FBUA 5EMNA 3EVWA 2VG7B 4GTDA 2AHOB 3PM9A 3GTLC 3F41A 5KFJA 3BNWA 2CDRB 3LOUA 2HS0A 1MSWD 3KG1A 2LQBA 3I6PA 3DRRB 1DQAA 5KG2A 4DR7J 2MQ8A 1AZSB 2AU0A 3Q83A 3M3YC 4CZCA 2H5JB 3LP1B 3OREA 4A3GK 3JYTB 4W98A 2BUNA 4USMA 3QFCA 4UW2A 4HACA 1N08A 5F0UA 1DTTB 2MLZA 3PO2K 5AE1A 1J98A 1H3DA 3FZ2A 3R5CA 3MM5A 5F9NA 1SC3B 2CNNB 2CPEA 3H40A 1KHWA 3GFXA 5TJ3A 2CVEA 2GC8A 2HBQB 3G4CA 4IO9Q 1DURA 2G9OA 3DGVA 2KM8B 3UNYA 1PAUB 1S7IA 4LQ9A 5IQ6A 1NKBA 3ENQA 3MD1A 1H38A 3TO8A 4BCAA 2AP6A 3S1RK 5KFMA 3OL6A 1GNKA 1XR5A 4J37A 4I67A 3GZ7A 2HPUA 4RW7B 3PXGa 5A88A 2QL7B 3L9ZA 2BYCA 4ECYA 4QYZK 1IR2A 1NJZA 2W7PA 3C2PA 2DXEA 4M5LA 4B9SA 4RW8B 5KG5A 5IYDK 3CCUS 5BSXA 4WZQA 3TZXA 1YTYA 2KFYA 1IJEA 2E5HA 1RT2A 1HKAA 1F5AA 1DARA 2YKMA 3FKBA 4A3CC 1VIOA 3LAPA 2K7JA 3AVVA 1JLBB 4ALZA 1RTDA 1G6BA 4UQGA 1HWJA 1JMTA 3S7RA 2YU9K 4RPBA 1HQEA 4GFQA 3ZZYA 4OI0A 5F0WA 1HNIA 1VRUA 1IBMJ 1UFWA 3DLKA 4GC7A 1O27A 3SLNA 3H98A 4C2MA 2DYIA 2J0QD 3GEEA 3LAKA 4KATA 2DR9A 3RGIA 5IWAF 2GREA 3OT9A 2KT3A 2XLJA 5IT9Y 1J27A 1TAQA 3N6MA 1JVIA 3Q39A 4DL0C 3CCES 1KVIA 4DCJB 4WWSA 5HMXA 3GJRB 3BSOA 2G1DA 2HNZB 1JNZB 4KN4A 2DCLA 4Q45A 2GVZB 1B3TA 1D09B 1LFWA 4R5PA 2Y3PA 1NM2A 3GQBA 1RB0A 4M5DA 2KYZA 3DLHA 4OL8A 1S72S 1DDIA 5THWA 3X3UA 2C2MB 3A4TA 1UD6A 3GJTB 3QFHA 2BKPA 3OR2A 4Z4UA 4BC9A 1RAJA 2XO6A 1M5OC 1FJGJ 5C2GA 3K89A 3TARA 2B4OA 4NOIA 5DG9A 1XE1A 5I3UB 1RWPB 2FVPA 1S4FA 4JUZA 3QSYB 4NLQA 4LF5F 4Y7CA 3CE8A 4XLPA 1RTJB 3G8SA 2AJ4A 1G51A 3DYAB 3Q24A 4ZP9A 3GP9A 3KNGA 3MPVA 2XHCA 1MMDA 3HHLA 1W87A 2K7KA 2MQOA 1XZPB 4WU2A 3HVRA 5ETMA 5HZBA 1SBRA 1JLFB 1CEZA 2OPRA 4A3DC 3ETMA 3BV8A 2E1CA 2JHEA 2BX6A 3PRVA 4O2DA 1H8HA 1RT4A 4YAWA 3QFWA 4UZBA 3AA8A 2RS2A 2E7XA 3P27A 1WUUA 2PHCB 1TWCA 3KLFB 4BY1K 1WF0A 3VGUA 1U8WA 1KK2A 1QVFR 4E0DA 5AJ3J 4KT0C 1XR7A 4LBVA 3GTQC 3I4MK 4DV3J 2NQPA 2VQEJ 2GMHA 3C6UA 3KHHA 1RYSA 2CFXA 2ZOFA 4AVZA 2E9RX 1FX4A 1BS2A 1GMVA 2X1FA 2OFHX 4LOWA 2HBYB 3WQPA 4DG1A 3G05A 1HPZA 2M5SA 3Q8VA 5BR8J 5KFHA 3ZBTA 4I69A 1WC6A 4II3A 3GWCA 4KHPJ 1HZEA 3M8ZA 3FQKA 4K2XA 3NKYA 2I8EA 3FEXB 2BM0A 1G7RA 1FKOB 2CQIA 1T6YA 2YKQA 1CC8A 2D9OA 2JEGA 3A8JA 1FXRA 5DO2A 2BGJA 4B08A 2PD1A 4P71A 3AHPA 5CCMA 1TELA 1C1BA 1HNVA 3EICA 1RAAB 3DXJA 1QSSA 1BXNA 1N05A 1XBWA 4RDKA 2DR6A 4B3TJ 2YNFA 2CPJA 5DDRC 3KJVA 1K73D 4YB6A 2FJEB 2Q6OA 3U02A 1SMYA 2HVEA 1VK8A 2Q3PA 2ZDPA 4MIAA 2AJ1A 1N5TA 4PWDB 2OBTA 3D67A 3D1QA 4RCZA 3KJFB 2DKOB 2J9DE 1TK5A 2IHR1 1RLCL 2J9DA 1M5KC 2BVZA 2KJWA 1JB9A 4OJGA 5L9NA 2OKQA 4IFYB 2VPZB 3FDSA 4RW4B 4ECRA 2JA7C 2RQKA 1PG5B 1IBMF 4DV1J 1VC6A 2EFQA 2R7ZA 4RUHA 2ZZEA 4B43A 4RWXA 5ETOA 2N7CA 3R1HA 3DRPA 2BE2B 1Y5NB 3ZC4A 2G2YA 2FQTA 3MXHP 3ZTPA 5KFLA 4N3GA 3HSJA 1X0PA 2GIQA 4C3KA 2R2SA 1NDCA 1LW0A 3CDWA 3GTMK 2F8HA 1N34J 2YNGA 4QWAA 2PEBA 2E2HK 3GTPC 1Y1WC 2HFZA 1LWEB 4C3IC 1FJGF 5F8IA 2PT0A 3A12A 1CNFA 1N8RD 1EQMA 3FBFA 2IMWP 1RWMB 3FRZA 2J7UA 4B3MJ 3E51A 3QT5A 4Q5SA 2UUBJ 4DPUA 5E0OA 2W4DA 3IPJA 1MRZA 1N88A 4OJ1A 2PIAA 5AXMA 5IT4A 2H9ZA 4OYIA 3W3SA 2ZD1A 1NSKL 1AXQA 3ETOA 3KTQA 1T9XA 4E98A 3OXGA 2VNKA 3DDKA 4PYAA 2LCWA 3NE5B 1VHFA 1JJHA 2HYIB 4TXSA 3EGWB 4CLTA 5JMNA 4WXWA 5HAOA 1QLNA 1D9DA 3K59A 3VVTA 3V7AA 1H73A 2XWXA 1BHNA 3ZFVA 4OYPA 5I3QA 1IWGA 5KG3A 4P6VF 2XEXA 2XCRB 3BDEA 3CC2B 2VNJA 2BA9A 1YJWB 4JV5F 5A8AA 3R5BA 5FLXU 3FOEA 4IKAA 4DV3F 5EWEA 2VQEF 2X6XA 3R97A 2FHJD 3LO8A 3CJKB 2BJ7A 4RM0A 2RKIA 4IR1A 4UUXA 2FJDB 3EGVA 1FFSB 4Z4ZA 4V1Ak 2KWAA 3QIPB 1TU0B 2C2EA 1NHVA 3G4SB 4DFMA 4P74A 3CJ3A 3PCOB 2BANB 2P9CA 5BR8F 3DN9A 2HCJB 1L3UA 4KMDA 2YNIB 4UOFA 3KLIA 2GVDA 1N36J 4QIGA 5HN0A 3G6EB 4I2PB 3R2CJ 4O3RA 4C3HC 2WOMA 2DIVA 3NGUA 1AYEA 1AUDA 2MLXA 4C45A 8ATCB 3Q2SC 4DV6J 3JSYA 4G1BA 4O23A 4IG0B 3MMJA 4ZCMA 1V0FA 4B3TF 3M8PA 4HR2A 1SPBP 1WOSA 2XM3A 3CC4B 4LJZA 4EH1A 1ZBSA 3HOUK 1EIYB 3R6JA 1EH1A 1VS3A 4LBYA 2HLUA 1UPPA 2LECA 1SUQA 4WFAQ 3MECB 2DVIA 4A3KK 1JIHA 3KK2A 4CWBA 4C3JC 1UVNA 1KEKA 2M3DA 4LRDA 1VQ5B 5J2NA 2CDQA 2Z30B 4DV1F 4GO5X 2JLGA 1NK5A 2FGOA 2ZHBA 2HHXA 1F9NA 2GHVC 1K83C 2VG5B 3AOCA 1FDAA 4X84A 3FKIK 3MCSA 4OIOA 4AF6A 2RU9A 5IYBC 2AYGA 1BWEA 4RW6A 2PE8A 1UWBB 2YXLA 3KG0A 3DOKA 3CCTA 1IKWB 4A3EC 1VRQC 4NI2B 1BX1A 4ZP8A 3BP3A 1YVFA 3FMWA 4X4SA 1C4CA 2RUSA 3O6QA 1R5BA 1N34F 5CH7B 5B6IA 4OIQA 3U7JA 2FZGB 5GVQA 1LK7A 1R7IA 4NYZA 4IG3B 3T9ZA 3CF5Q 2OO4A 3W8PA 2B51A 2DH9A 2LQ8A 1T9UA 1RQPA 4LRFA 1U1PA 1KD1T 4RUBA 3CC2S 2HS3A 1YJWS 4YY3J 2VFSA 4FYXB 4K8RA 2BQ3A 3AJ2A 3RB0A 4XM3A 2XNRA 2WJVA 2BRKA 1RISA 2GFFA 2JA5C 2AX1A 2PC6A 2Y0BB 2XB2D 2QSFA 3PA2A 3BM7A 4L73A 5J1PA 1T9TA 2WK4A 2HFVA 1MABA 2AQ4A 1SL0A 5DETA 2ATCB 2LZJA 4FM9A 2RILA 4DI6A 3G4SS 2XQCA 4A8OA 3TUIC 2UV8G 2ZUFA 4QIWD 3MDFA 4P2SA 4U7UK 5CYMB 1W7WA 2HQIA 4O3PA 2OD4A 3G6ES 3VAKA 2CW5A 2V94A 2Z6BD 2NVQK 1I94F 4MKVA 3CCQB 4XK8C 3TQEA 4CO5A 4CYUA 3S1QC 3LA0A 1ZVUA 3T1HJ 1SV5A 4KFBB 2Q79A 3OFNA 4C0HA 2HBZB 1NZ8A 3OL8A 2IRUA 2KT5A 3U1NA 3CC4S 1S1WA 2JDIA 1NK8A 5CD4H 4DF4A 2KH9A 4PXEA 2X3GA 5K14A 1WELA 4DX6A 2ZVSA 3KHGA 1N36F 3OFGA 1X9WA 2IC3A 5A8WA 2WB1D 5ITHA 1CULA 1RWWB 3BPSP 1HWIA 2BE5A 5C42B 2KB2A 1UW4A 2EKYA 3GEIA 1VQ5S 5IP7C 1V6HA 4KN7A 1VJWA 4QJVB 6FDRA 4TMXA 3HOXK 4U7UD 2FIUA 3SV3A 4C98A 2OP5A 1WG5A 3L4BC 1BUXA 1LNQA 2EPIA 3KG4A 3BYRA 2L41A 4AQYJ 2V7VA 4W92B 3S2HC 2UXDF 1IN0A 4JI7F 2A68A 3OTCA 1BJTA 4OI3A 1WEZA 1BLUA 1N5QA 4A93K 2OBRA 4OLPA 3ILIA 4YAUA 1EETB 3NS6A 2EFNA 3UNGC 4MKBA 3GIKA 2VODA 3A8KA 3HPOA 5KOXA 3GTKA 4C7QA 3K7AC 5HMZA 2QTWA 4A8QA 3CRZA 2ZM6F 3WIVA 2PMDA 1RA6A 1S57A 3K0JA 1MU2B 1B7YB 5GV7A 4PC7A 5EWFA 4Q7JB 2BV3A 3UDCA 4F8RA 1I8DA 2BVNA 2HWHA 5FNZA 3MR2A 4B3OA 4Q2MA 2HGLA 3C15B 1KSPA 1E62A 1Q9SA 1EAYC 2QEXB 3VQSA 2KZZA 2XI2A 1EQ0A 2OPQA 3V4IA 4LR9A 1JLAB 3FBCA 1SKSA 3D3CJ 3DLGA 4PQUB 1U2RA 1DQ9A 1VOMA 2XZDB 4ID5B 2F8EX 4DL4A 4GVLA 3VZHA 3PJXA 4CLSA 3N0BA 2BPOA 1VQ9B 2C77A 1X4HA 3CMAB 2E2JC 1NK4A 4L3NA 1ZZFA 2P9GA 2QX0A 2YY3A 4U95A 4PCQA 3ZZZA 3NP5A 3GTJA 2VKRA 4ED0A 1TWAK 5D15A 3ZBUA 4TVAB 2A1BA 4OYWA 4QVAA 1EKSA 3H3VD 1WCMK 1VI7A 2ZH7A 2BJ9A 4KE5A 4XLCA 4ANDA 2UP1A 1VGYA 2Y1JA 3FFIB 4EZ6A 4KGXB 2AD9A 1TL4A 4YY3F 4KTQA 5A0YA 3VQTA 1EP4B 4G6VB 2GMJA 2WONA 4NLWA 3CCQS 2MZ1A 3WYAA 4DR6J 2VC1A 1X9MA 4MQ9A 1Q8LA 2MKKA 1MN7A 3OW2B 2WR8A 3K8WA 5T41A 5G4DA 4KC5A 3HI9A 3ENAA 3LUYA 1NEEA 1JOEA 5HMYA 1FE0A 3MM8B 1J5OB 2RQMA 2EKNA 2CG8A 5LMZA 4QBUA 3MUMP 1IS1A 2IRYA 3MOZA 1C0UB 1PYSB 4HH0A 1DHMA 3HOZK 2QV6A 3KDNA 2ZBPA 5KFFA 4ECXA 4Z1MA 1J2VA 5ETNA 1UD4A 3PYFA 3VZIA 2N7YA 2RUGA 4B3FX 4IDKA 4CNZA 1XR6A 2PMWA 4OZLA 3CCZA 3T1HF 3M8SA 4U9RA 2D1CA 4Q43A 3CGIA 2ZHAA 3UN2A 2AYBA 4Y7NC 4EFAC 9ATCB 2N4CA 2J6UA 1TUWA 3OJXA 3TZZA 3WBZA 2CK3A 4N76A 4C8MA 4Y2AA 2KFZA 2Q66A 2AEFA 5L9XA 2V8VA 2W4PA 3G82A 1YRUA 3V6JA 1VHOA 1NKCA 1K47A 3CMMA 3DI6A 4BKWA 3BKFA 2FHKA 2VJUA 5EGEA 2VB6A 3UD5A 1U09A 3TUPA 3K5PA 1QD1A 3Q6QA 3OTEA 1SFOA 3H2LA 4MK7A 3G8TA 2DHHA 3GSIA 4LBHA 2NVXA 4Z37A 5HVHA 4CDIA 1NPRA 2QEXS 3CXCR 1NLKL 1TKTA 4C3LA 3FC9A 3WBJA 3HSGA 1WKKA 2MPUA 1GFWB 2V4JB 5KFIA 4PC3A 1TL3B 3V6DB 3CD7A 3PKMA 2H5IB 1S1XA 4C8KA 2B9XA 5SZTA 1S0UA 1VQ9S 1X4BA 2EFGA 1OWXA 3RBZA 3CMAS 2FVGA 1B4AA 2BKNA 4YR0A 3T56B 4KB7A 4PZVA 2WSCC 4OYAA 1ITPA 3DRSB 3CJ8A 4TY8A 4KY3A 3SQOP 1NCLA 1OMSA 4X8IA 1Q8IA 5EX0A 2IMOA 5A2QU 3SLDA 2HFNA 1R8BA 2HVHA 4DV4J 3MAAA 2FUG9 4K7QA 4O44A 3T01A 4M94A 1IB0A 1PILA 2Y1RI 5FO1A 2WB4A 2EIXA 4Z4VA 4A3FC 1U25A 4HYKA 2K1RB 3BGLA 1SL1A 5L1LA 4X64J 1JJ4A 3SSSA 1KRPA 2OH2A 4JYAF 4EBEA 5D0RA 4EGLA 2ZL5A 3QGPA 3RAQA 2HKEA 2R92K 2G2ZA 2BJ8A 3CUNA 1O51A 2K06A 2GSOA 2J7WA 3EXYA 5JXSA 5DM7Q 2ZBRA 2HEKA 4BS2A 1I3QA 3CQZC 4DL7A 4DSKA 2B63C 3A8IA 2OJ3A 2HLTA 2XNDA 4ZVFA 5LSOA 1NJWA 4NXNJ 4OQJA 4DR6F 5HJYA 3IGVA 3EM1A 2W25A 1CJTA 2RQCA 2YKNA 2W2NP 4ZHRA 2LYVA 3SFGA 4D3HA 2W2PP 1Y7PA 2W24A 1VFJA 2YWHA 2E7VA 5THXA 3EGZA 3M9MB 3ZZPA 1WP6A 3S2DK 5GAGI 1WC3A 4TU7A 4TU9A 1SKRA 3WBKA 4M5KA 3PA1A 5C4XC 3KJNB 1N6QA 1WHWA 3CJ2A 3NGSA 2D9PA 2VICA 2HHSA 1K8AD 4WBFA 5KFSA 4RJLA 3CMQA 3ZNUA 1IBLJ 2LXUA 2BEFA 4K4YA 2ZNZA 4UOGA 5D4DA 2G4BA 4FF3A 3KK1B 3RZOK 4CM0A 3DKDA 2W7AA 4WZKA 3KOAA 2RDIA 4P6QA 3NBPB 1KRHA 3PX0A 3BEGB 4ZPVR 4DEZA 2Z58B 4LRCA 3T51B 4OHXA 1FVSA 1DTQA 4RD6A 1VRTA 2KXFA 3L3CA 1UAWA 2H54B 1NJYA 3MM9B 5GAEI 1LW2B 5IM0A 3W2IA 3NY0A 5B0CA 2CJ9A 3S1MK 2J6TA 2OK8A 3TVYA 2O5JA 4U8VA 1G7CB 3TR5A 2YX7A 1PJ7A 1E1RA 5FA6A 1EFRA 4Y3CA 3UI3A 2CQCA 3GMGA 1EX8A 5FIUA 5KW9A 1QUPA 2HMIB 2V8HA 3MMCB 2B3TB 4MMOA 3TNVA 5C4JK 2HHTA 4ACBA 5M3MK 2AX0A 4PABA 5C7PA 1CNEA 2ASLA 1V0EA 2CADA 1CS4B 4LF6J 1FRXA 3O5TB 4CH0S 1F3FA 4HI1A 1T3OA 3HF5A 5LMUJ 2JFDA 3GJSB 1CVJA 4DLEA 1WDTA 5CJ9A 1RT1A 1HR0J 5J2QA 3L7PA 4RNOA 3K8VA 1OPZA 3QLHA 3N28A 1EHWA 2DPIA 1MWZA 5F8MA 4DR4J 3JXOA 1SIWB 3PW0A 1XWLA 5IP9C 4WFXA 1T03B 4IUFA 3W1YC 3DDIA 1TV6A 4JK1A 4FXUA 4WK1A 2Z57B 3TFHA 2X6WA 1JQGA 3U6KA 4DV4F 3OTBA 5KAKA 5FO0A 3AVXA 4CLUA 3CT9A 5FLMK 2O67A 2XCAA 3LP2B 4X4PA 3GE9A 2YU9A 4O4GA 3L95X 4A46A 3I5CA 2Z0GA 3OZWA 3BCFA 1UFLA 3V4MA 4DQSA 3NCPA 4Z4TA 4RD3A 3EJMA 3GTYX 4N47A 3M2UB 3TFJA 2E2IC 1TWHC 3I55B 2RHSB 3PR4A 4G65A 2XY7A 2JNJA 1VQSA 3OKXA 2VG6A 5BSYA 2YH1A 2A6HA 1B7FA 5J1EB 4WKRA 1B70B 3R7SB 2C2ZB 3X1LB 4Q7AA 5DS7A 1O0PA 2YQ1A 2QMUA 2RB7A 1I7PA 2BE7D 2VHGA 2DEUA 5KG7A 4GVBA 2Y9HA 3QBCA 3Q22A 1B0PA 1S6QB 4NLVA 4FZVA 1E3ZA 2JJ1A 1Q8KA 2J9CA 5J2PA 1R3NA 3RRGA 2GQFA 4ILLA 1KBRA 4B48A 5D0EA 4ELTA 3HSZA 4CLPA 3I9V9 4RR5A 2NV4A 2KRRA 3P6YC 3W2EA 3DOMB 1P9QC 1N5SA 1QGAA 4L6V3 1NXIA 2RS8A 1ZETA 4NXMF 1AFIA 4Y34A 1Y0RA 2QT7A 2WVFA 1OSCA 4Z4RA 3D68A 1WOPA 2P8IA 4WPAA 1VBYA 2UUWA 3TRGA 2E1BA 3ZTOA 4X4TA 5M5YK 1VQMB 5B08A 3P5TL 3VGVA 4YEAA 2IVYA 2DNHA 4J9PA 2HZVA 4ICLB 1IBLF 2YX1A 2YH0A 1X7VA 2YQ0A 2OTJB 3MD3A 4ZVPB 1RWOB 1KOHA 3ITHB 3OE7A 2I1LA 4OHYA 2CFAB 3GTPA 3AXKA 3HO1A 3CWJA 3BGOP 2C3MA 8AT1B 5J2MA 2HNYA 3R5AA 1TL5A 4P2NA 4DCPB 5DQHA 2ZEJA 2OMOA 2OI2A 2MKYA 3VNVA 4DSFA 4C4WA 4ZMMA 4G1PA 6AT1B 2MY8A 4X6AK 3P3DA 3W2VA 3MFHA 1A0OB 1NKEA 1DCHA 5JFEA 4DR1J 4C11B 2DGVA 1B99A 3FNNA 2Q6BA 4K4XA 4KAIA 2I6WA 3JSMA 2ZH8A 2HAIA 4LREA 4ATNA 1JKHA 3UVJB 3OJWA 1TTHB 1FWLA 4DLGA 3W2GA 3AXMA 2NVTC 1JA0A 4RPDA 4KKOB 1Q81T 2NUUG 2DXFA 3W2FA 2NYIA 2IIHA 3W9JA 4A3BK 1FNBA 2VPXB 2P3MA 1R89A 3CULA 4G7WA 4F0KA 1RT5B 3BZQA 2GJPA 4LF6F 1S9EA 3CJ5A 4KHMA 2DTJA 2UUTA 3D6MB 5LMUF 2B56A 4NCGB 2EEYA 2VJVA 3M32B 4A8SA 1NBEB 5C44K 1HR0F 4F7DA 1REGX 4N41A 2ZOGA 3QRQA 3GTGK 4FPRA 4DV2F 1KQ4A 1YNJA 1JLCA 1S97A 3QT7A 1BC6A 2QFIA 4YHBA 1SH3A 3I55S 1A6LA 5LT5A 2A69A 3CCWA 1ZTTA 5TMFA 4A8YA 2E5IA 2R7SA 3NWRA 2VPYB 1A8PA 4OV1A 4QWDA 4QUZA 2HVDA 4DQLA 1UJ5A 1A9NB 1S48A 3T5LA 2QYCA 1VK3A 3KLVA 3UQSA 1E6YA 4KBIA 4QU7A 3WXMA 5TR9A 1WJ9A 2COLA 3EZOA 2IBKA 4M4SA 5CA5A 2VBSA 1F9HA 2AT1B 5F8JA 3BBCA 4ZPAA 5TV2A 1UV7A 1HLWA 2CQGA 3ET6A 4KARA 1FDBA 3EDQB 2CZ9A 4YB7A 4ED2A 3OVBA 2QN6B 2XSFA 3AOAA 1F60B 1FJ7A 2JA6K 3LQ6A 4LSLB 1WKLA 1VQMS 1O29A 3C66A 4B17A 1RAEB 5HQMA 1RTIB 1EP2B 2C78A 1RHRB 3IR6B 5ADZA 3GTMA 3MEGA 3HP6A 2OTJS 2R93K 1UD2A 2L9NA 2J0WA 3KK3A 1IKVB 3W60A 1HNWJ 2V6UA 2V7TA 4UY8T 3CW2C 1XMQJ 2CJBA 3H42A 1DD5A 2FHJA 2NS1B 1TR0A 4KO0B 3TP2A 2F4NA 1IR1A 3GVJA 4BBYA 4OPOA 2QTZA 2CA9A 4RLEA 3ADAC 3ZC3A 1LQ9A 1RHJB 4BBRK 4FN5A 2B8QA 2DB1A 4UZFA 3I4NK 3PNIA 3R9LA 4R25A 1KTQA 2V50A 1RT7B 4YB1P 2XYGB 2DR7A 5E7OB 2IYGA 3TFIA 2XY5A 1YRXA 2PDAA 3RRKA 3C3LA 1ZAXA 2B4PA 3VGTA 1XNRF 5ETPA 2NVYC 4P2XA 2NSBA 3F73A 1U6ZA 4PQAA 3GEHA 3L7OA 1YKWA 1HARA 3NGRA 3S17C 5AE2A 3PJWA 1ZPVA 4JP8A 1HA3A 4ZVRB 4YXWA 3DDNA 1OSDA 3ASSA 3RB3A 3D7SB 5FDLA 4OPSA 3P5BP 3NCRA 2NREA 4QWBA 3MOJB 4DCOB 1HBOB 3HHEA 1WHXA 1BQNA 2ZL6A 2RU3A 3ZZRA 3CO9A 1EFCA 1F7UA 2R4FA 1RHKB 2MB0B 1LXNA 2DETA 4YELA 4MIWA 4LFBJ 3HDSA 5ETVA 1CJUB 3M8QA 4DR1F 4AYBD 2CQBA 3E20A 2POKA 4LR7A 2CBXA 5FD1A 3N9UC 2D74B 1FCAA 5DDOC 4I2QB 1C1CA 5C24A 1Y1VK 5KFRA 4LF4F 4WXOA 5F3TA 3THTA 1IXKA 3I0RB 3PDNA 4J9MA 3RBDA 2BMBA 3RZDK 1MNEA 1KQGB 3R3TA 1NHUA 2OGUA 1SXLA 2V63A 4M8LA 3SDEB 4Z4WA 1JQWA 4Y52C 4YN3B 3S16C 4NOHA 2YX4A 5HROB 3M2RA 1S1TB 2UVWA 2J6SA 2XZWA 3ULHA 3BF4A 2FLPA 2CJXB 5KFDA 2GO8A 3R7NB 2OPPB 1I6HK 3CMEB 1R43A 4DV5J 1ZXOA 1YG0A 3AD7C 3GR1A 1FWKA 2P6TA 4LRAA 4ED3A 3W2WB 3MCNA 1M90T 2FC9A 4FDFA 2BQRA 4ROXA 5JUMA 2OSQA 1OY9A 3WY9A 3W9IA 4BLAA 5E3RA 3HOVK 3J81Y 3Q86A 4ZV4A 2MGZA 2YTCA 4TQRA 3MM6B 1D1UA 1QFJA 3PUMA 4TT3A 1FX0A 3KMQA 2BMWA 1VJEA 3CD6B 1YGYA 3M30A 2H3EB 2CQ4A 2HGNA 1D8ZA 4UY85 4F3OA 3FKIA 2PSZA 1UVMA 4QYZJ 2JLEA 4Y2CA 4B9UA 1LWFB 3J7YU 1QM9A 4AT1B 3L4KA 2CYYA 4LMZA 2LU2A 3Q2TC 2V2QA 1FNCA 1XEZA 3UDLA 4KM8A 1UVJA 5B0DA 2Z8QA 5GV8A 1U02A 5F4OA 4P3YA 3K5OA 1HNWF 3W8GA 2V9KA 4QVJA 3BYPA 5G0RA 1AFJA 1OIAA 2UU9F 4PUOB 2DGXA 4XIUA 4RO0A 5F4MA 2JA8C 4MYUA 1XZQA 2HHHF 4J9LA 1YNNA 2IJFA 4NA1A 1IKYA 2IVFB 3MTJA 1NB7A 1VDHA 3US5A 4QW9A 5HI7A 3EGNA 1LFPA 4RBUA 1Q7YT 2N4DA 3LGHA 1YK9A 2R2UA 1WI6A 1N5VA 2AJFE 4DPWA 1P9YA 1R31A 2EFOA 2HQCA 3BO4A 2BW2A 1BPLA 1CC7A 1URNA 1JWWA 1BQMA 2ZOMA 3CTAA 4LBIA 2RJZA 4C97A 2GGPA 1QTNB 4PWUA 1NK0A 1FJCA 1X5OA 3HHKA 2PMZD 2DY1A 3UE2A 1Y3JA 4OIRA 2H4YB 4PC2A 2C22A 1JXVA 4PG7A 4DSJA 1N5YB 3PRDA 3OLAA 2OTLB 2YQ3A 3O1LA 4XLAA 4Z4SA 4ZVUB 4E0FA 4KJIA 3M7VA 1N48A 3SCJE 2WZNA 3W5ZA 2IY5B 1DDGA 1PJ5A 2F1LA 1QJHA 5LXRA 3S14K 4ZLPA 3K5MA 4CM2A 4LFBF 5KT5A 4WP3A 2Z4PA 3MMAA 4F36A 1SM4A 2P5VA 4Q5VA 3QIDA 5JBQA 4WILA 1BGXT 4FF4A 4QYRA 1YJTA 1T6XA 2DR8A 1HBNA 3W5UA 3MEEA 2DCUB 2HHUA 4KMHA 4WF9Q 3CMES 4H4OA 4DPYA 2E1MC 1YJNB 3WX8A 4XORA 3A35A 1IJFA 3CXCB 1HA1A 2XNCA 2GZOA 4RW9A 1M0SA 1S99A 1Z2LA 4RNNA 2F63A 3IS9B 2O1PA 3HFZB 1XJWB 3FEZA 4JI1F 2AGPA 4HVZA 4U8YA 2B8PA 2ZE2B 4DPXA 2UUAJ 2BJ3A 1UD3A 2GJRA 1X9SA 1I51B 2R9LA 2AEJA 2IAJB 4RU9A 3CD6S 4C8NA 1NSPA 1R0AB 3G71B 1XXAA 5D0HA 2CWKA 4CO2A 5B0EA 3I56B 3ASTA 2KG0A 3H8YA 4FBTA 4DWIA 2NXCA 2NR0A 3AJ1A 1TL1A 4JI4J 1SC4B 4A4JA 4KSEB 5IOSA 4EYHB 3NCQA 2G1HA 4WZLA 2XO7A 3G96A 4OZ5A 4HEA9 4XDDA 1TWFK 4ES3A 2ABYA 2LQJA 3MEKA 1P27B 4UF4A 1S0VA 3VAGA 1S9GA 4ED5A 4A3MC 1FNXH 2EVZA 2XNJA 2CQHA 3GTJK 4OZ2A 3EPGA 1GTEA 3L7UA 1ZM4A 1ZTWA 1MLAA 3G4AA 2VBWA 4G6IA 4X05A 3QJJA 3AVUA 1E64A 5D6GA 2XYHB 4OMFG 3K5NA 4H4MA 4I6YA 1JK9B 2DY9A 3BN4A 4NLDA 4OI2A 2E5GA 1FJEB 1U2CA 4NNJA 1FRKA 4JI5J 5E3QA 2EBEA 4HE5A 4X4UA 3GTOK 3E8OA 4CTAB 4PEOA 2XMAA 4B9MA 1FRMA 1WPCA 1PC5A 1UETA 4OZ0A 3BPDA 3BGRB 4USKA 4G1IA 1I6VA 1D0EA 4ZOSA 4CRJA 1TWAA 5D4PA 2XZLA 3W61A 2QDXA 2CPDA 2K3IA 1RBOB 3OXLA 1FRQA 4K4SA 1WCMA 3ZTQA 3GJQB 3LANA 2OTLS 5C3EK 4XNFA 3O3LA 1M1KT 1UEUA 3H0GC 1TKZB 5AXLA 4TU8A 5E3AA 1TWGC 4LVNP 5L38A 1GMWD 2B5JB 4Q0BB 2KZMA 1XN9A 2OUGA 3OHAA 1WSVA 5KFUA 3OSPA 3IR7B 4BY7K 3EUNA 4N8NA 1CJVB 1Y4ZB 2BR0A 3HT3A 2VUMC 2V34A 4USVA 3ASQA 5HP1B 2W9BB 1FD8A 2Y1IA 3LPEA 1FRNA 3M2VB 3H0PA 5K8PA 3DFEA 1HL6A 1YJNS 1IKXB 4F4AA 1I50C 2RF2A 2N3LA 4X62F 4U7CA 1R9TK 4BBSC 3BBBA 2WVCA 3JTPA 1SJ3P 1CPZA 4CT8A 3C16A 2H5EA 3MM7B 3M8RA 5DGAA 1FT8A 3LNNA 1Q53A 2ZH5A 2QLWA 1EP3B 2HNDB 4FVMA 4FYWB 3H7HB 3THPA 1FKPA 4YMEA 4F4WA 3G71S 1R0BG 2XMVA 4ELUA 4AH6A 4R8UB 5KT7A 3IG1A 1GVHA 4IRDA 3I56S 1HD0A 1W35A 1B23P 5DGBA 4P52A 4BLGA 1NO8A 3KL9A 4FXWA 3DMJB 5DRKA 1D9FA 3GTLK 3GFHA 4DBQA 2GK6A 2A10A 3W62A 1F9EB 5BYRA 1JLEA 2OLWA 2MHNA 3W63A 1GXUA 3FKSA 2AJ2A 4L8JA 2MQQA 4WU3A 4MFBB 4YR3A 2L9DA 3M3YK 4DL3A 2WW4A 5C25A 3OZUA 3EYZA 1EWYA 3UFCX 5LOQA 1G3OA 1NB9A 4CT9A 1GX6A 1NJIT 2ADCA 5DDQC 3PO5A 4ELVA 3NAIA 3KEWA 2FY1A 2HFSA 3IRXA 4NLOA 1LWXA 2NPFA 3DCAA 3HXAA 5DJBA 4JI4F 1OO0B 2LU1A 3MCAA 2I1RA 2C2DA 1JA1A 3CDBA 4I7FB 2Q6CA 2X1BA 3LP0A 4II2A 4CLLA 3TX0A 2ERRA 4OX9F 4F7VA 4F0HA 3BH7B 4KGMA 4DZ6A 3IBFB 4KPYA 1REVB 4TMZA 3B78A 3TJ9A 5KNLA 4X4VA 4C8OA 5IWAJ 2OIHA 2AGQA 5L39A 1E6VB 4GQNA 3GU0A 4NMXA 2E9ZA 3RUBL 3HOWC 4A3CK 1TVRB 4DUZJ 1VMBA 4XO0A 4DV7F 4QCLA 1RJJA 3BQJA 4URSA 5KG1A 5E3PA 4F4ZA 3MCOA 2ZJQQ 3TJ8A 1RSCA 3FOFA 1RHMB 1U2FA 3HVTA 3KHLA 4EO8A 3D0HE 1T9VA 4GRSA 2R2TA 2XHWA 1ZS6A 4WFYA 2R92A 4ZP6A 4XTTA 5F8LA 2FYXA 4ED7A 2RC5A 4P25A 4DR5J 4A3LC 3H90A 1VR6A 4M5IA 4LF5J 4G1QA 5H1SV 4DN9A 3D26A 1SJ4P 3CJTA 5GMDA 3A3BA 2KYXA 2XS5A 2RD5C 2ZHOA 1TKXA 3V81B 4YHHJ 3CDEA 4ENOA 2HDNB 1IBCB 4HTIA 3U1LA 5H5JA 3TJAA 3QFSA 3EE3A 2VBTA 1V5IB 8RUCA 3MZIA 2QJ3A 3J7Z5 3R5DA 1QSLA 4MTPA 3MAQA 1WD6A 2GHPA 1OPIA 5HLFA 1Q82T 1NB0A 3IMQJ 1DZ5A 1KQSR 1U1OA 2QE5A 3MPDA 1DLOA 4X66J 1VCTA 4XL9A 5F4JA 3KJQB 2XMWA 1OB0A 4HACB 3Q0AA 4M0LA 4WTYA 3M4OC 2LKZA 4XAKA 3MM5B 1T11A 2P2CB 2WAQL 1X4GA 1DRZA 2O3DA 2QLBB 5HQLA 2UVVA 3DU5A 3I0SA 1H0HB 4QWCA 2RQ4A 2VU5A 4F04B 2ZC4A 2X7IA 4A3DK 4C2MC 4JB8B 3SCIE 5KFGA 4N3NA 1DCPA 2WZPP 4Y2KA 1TK8A 3CEDA 3OD2A 3VO2A 3LPYA 3PACA 4N5SA 3OPFA 2Z56B 4ANEA 2MSSA 1XK8A 2UZAA 2DR5A 2MZQA 4HIZA 4FXVA 5F3ZA 1S6PA 3H5UA 1QUEA 1TLLA 4XLNA 3Q3AA 2VZLA 1HNXF 1O2BA 1BD6A 2ACYA 2DNMA 1BLIA 3LW5C 3GTQK 4ZPTR 1FNOA 2ZUAA 5M3FK 4F4YA 1RDRA 4M2LA 1JB0C 1Y00A 2ZVIA 2R7TA 1IJEB 3PYEA 1RT2B 4LBPA 1LEOA 3DGPA 2HHVA 2I5JA 4UQTA 1EQRA 2OEJA 2YKMB 3ZZOA 3MR6A 1ZAWA 4ZPBA 2LEAA 4CNYA 1RTDB 3FHZA 3DRXA 3PHTA 4OYBA 1HBUA 3EXCX 3OPKA 3ZZTA 1DG1G 1K0VA 1DFDA 3RR7A 1HQEB 2DNZA 2NXJA 1B4SA 4CO4A 2VZ9A 2VBYA 4TSFA 2UV8A 1HNIB 1VRUB 5KFKA 5FLXY 3DLKB 4K5SA 5JVOA 2KXHA 1RU1A 3IO1A 4B02A 3PW4A 1GTHA 3HHLC 2QZ8A 3UCUP 4PC6A 1NNDA 4YG2A 1UMKA 1QFYA 3CPWR 3RB4A 2X3UA 3E01A 1RCXB 1U1NA 3B6BA 3AH5A 3BY1A 1LWCA 3W66A 3TAMA 3AOBA 2MTLA 1SVDA 2B7BA 3N6NA 2FZKB 1TWCC 4R5PB 1NRKA 4DUZF 1I18A 1R6VA 4NWBA 1Q1KA 4M5DB 5EN1A 3N5BA 4C0SA 3PUNA 4TN2A 1ROFA 3M6UA 2IBOA 2W2QP 3PZPA 2ZFHA 2L48A 3OR2B 4A3IC 4ILDA 2BZ2A 1FTRA 2CW0A 1I1GA 2QRRA 2LFVA 3BS9A 1U6FA 3TVZA 4ECQA 1GK8A 3W7BA 3MPWA 2MYFA 2JA7K 1V5VA 1P1LA 1U1KA 4DOZA 2DIUA 2E1RA 4ECWA 1U1MA 4ZPWR 3Q8UA 4OHZA 1VJSA 1VC5A 2G0JA 3DM2A 1KWMA 1S1VA 1S9FA 1E79A 2ZZMA 4DR5F 4U67Q 1D8YA 3P26A 1PKVA 4EK2A 1WKJA 3HHLB 1SCJB 4Z4YA 1KK3A 3LO3A 3PVXA 3BQ1A 3JAMU 2H48B 5JJBA 3AQOA 4F4XA 4YHHF 1T95A 5MLCV 2OPRB 4HTJA 1YJ9B 1OJ4A 1S0NA 4I56A 1ISEA 1FX2A 1YRTA 2LEPA 5DSZA 1RT4B 1SKYB 3VMFA 1JNYA 3KLEA 3HKZD 3QX3A 4L72B 4F25A 4C48A 1S76D 1R0CB 1GMUA 4J7CA 2W6IA 1GT8A 2BQUA 2DOGA 3GTPK 1JLGA 1Y1WK 2XS2A 3MI7X 4C3IK 3M1VA 4ZDNA 1XPPA 2DNOA 4XPEA 4BDPA 1RU2A 2M5YA 4EZ9A 2B7CA 3AD8C 4M5GA 4B9LA 1S79A 5D0GA 4O4RA 2QLXA 5HKKA 4X66F 3C6UB 1FVQA 4DFKA 3E2EA 1UD5A 4P73A 1KLMA 4JV5J 1WORA 1FK9A 1HYSA 2OPSA 4X4NA 1Q86D 4MJKA 4DG1B 3IR5B 3R5GA 4H9GA 1UPMB 3GIMA 5DG7A 1HPZB 3V2UC 4P3IA 1QG0A 2DBBA 5IYRA 4NLXA 2NLWA 3UW1A 4WCEQ 2R7ZC 2YKOA 1Z1ZA 2KG1A 2FC8A 3TQ1A 5HVGA 3POTA 5D77A 2QGFB 1F3VA 4LT6A 3TANA 2Z2MA 1Q5VA 2VA2A 3ISNC 3PO4A 1UZDA 1RU0A 4BLBA 1YJUA 1SJQA 1C1BB 1HNVB 3I96A 3IBCB 2HAFA 3D4JA 5E3CA 3UPFA 2NVYA 4LR2A 4LF2A 3PX4A 3ENWA 2YNFB 4ZIVA 3KJVB 3HM9A 2K8GA 3DLEA 4UTGA 4DZDA 1Y10A 2JEIA 1JXEA 2LDIA 1H72C 2H65B 5T7LA 2F1MA 2YWEA 2KU7A 3FSYA 1VJQA 2D6FC 4C3HK 1PBAA 4I6WA 4G5GA 3PIPQ 5I42A 2LEBA 1FEHA 3GTGA 2DGSA 2F65A 1HMVA 4CCHA 2NZCA 3C19A 3DRPB 3QJLA 2MKCA 4IR9A 1IL2A 3C14A 2HVIA 1WC1A 4YAFA 4NEZA 3VAFA 1C0TA 1ZQ1C 5HL7Q 3OTOF 2J8AA 4OYXA 2OD6A 5D78A 3VF0B 2B6AA 3BUEA 4FF1A 1LW0B 3J80U 1OB5A 3KYLA 2ZH1A 1OB2A 3P49B 1G7TA 1VHIA 4X06A 5B0FA 1GEHA 1GXTA 1NPKA 2X0KA 2IA0A 3AB2B 3QO9A 2YNGB 2DIEA 1YJ9S 4WFBQ 4A3JC 1NDHA 2VH7A 4C3JK 1YJ7A 2GMLA 2PE3A 2CG4A 4R0JA 2XNQA 2UXCF 4RD2A 1AA1B 3OL9A 1NDLA 5KFWA 4XOPA 2A2DA 2HQFA 1ELOA 1S59A 3B4MA 3MMBA 4AUKA 3H5YA 4GT9A 2H1YA 2JA6A 3GIRA 4DK0A 1K83K 2D9RA 3S6EA 4KKUA 2ZD1B 1OS5A 1ZBTA 4DR2J 1SJRA 2JEFA 1HWLA 5IYBK 1KJZA 3BR8A 4LF9J 5CYQA 2RSQA 3HOYC 1H85A 4A3EK 3PV8A 2R93A 3MCMA 2ZH6A 3NWGA 4ES1A 4OP7A 1RT6A 1SH0A 4ZVSB 5E33A 4K0KF 4DQPA 1SH2A 3CD0A 3M9NB 1FI4A 1B0TA 2C4TA 4IOAQ 3SQGA 2XGPA 3IWLA 4QPXA 3MR3A 3SCLE 3SSQA 1HI9A 2C2OB 2GQ2A 3KFWX 4ZVQB 2FY8A 3BREA 1WNEA 3PO3C 4OI6A 3R8YA 5DLFA 1CLFA 2X1GA 1K1QA 2WW8A 1MROA 4K4TA 2R3VA 3JQMA 2RKIB 4X7EA 3PENA 1I94J 3TI0A 2D3NA 3DOLA 1I3OB 4BWMA 5LSRA 3RW6A 1D3WA 4YDXA 4P6YA 3OFFA 4PPDA 2G0CA 3NAHA 2JA5K 2CQ3A 4URQU 4WWVA 4A8MP 2C1EB 4XONA 1L5UA 5B0GA 1S0OA 2YKPA 3KLHA 2ZZGA 2KI2A 3TX8A 2CPFA 3KLIB 1DCOA 1XNQJ 1RE1B 2GVDB 3S8SA 4NZ6A 1IR0A 4QZVB 2ATLA 1RUSA 2WOMB 5ETRA 5H9EK 5LXYA 4FXDA 3ASRA 1XMBA 4JI2F 4AXIA 3NS5A 2X51A 2AEMA 3J7A1 3C6TA 2Q1LA 4OX7A 4EMDA 1GH8A 5IYCC 2QL5B 3M8PB 1RK8A 3S1QK 4WYLA 1WC4A 2XSJA 4LFAF 1YWXA 1F2HA 3D54A 4P22A 4LRBA 1SIZA 1Y1VA 4KASA 2HG4A 2F8MA 4ZJQA 2UXDJ 4JI7J 2WYRA 3PW5A 2ALZA 1UFKA 3JQQA 3RU0A 1SUQB 3JSTA 4LSNA 5I3PA 4CH7A 4DSIA 3KK2B 2RHQB 4PG8A 4LF1A 3ZPNA 4ZK7M 3G2XA 1YSJA 5J2NB 2CPZA 2ZM6J 4V19J 2XZTB 1K9MT 5DQGA 1HWUA 1FFGB 3H5SA 2QTLA 5IP7K 2ZUEA 4IYQA 1RZMA 2DNNA 3BJYA 2D3LA 4JI0F 1WTBA 4DV0J 1HBMA 2YPYA 4RW6B 1UP1A 3IRWP 1H8EA 3DOKB 1RBLA 3S2HK 2ASDA 3Q6RA 4RNMA 2R7XA 3LPXA 2V6TA 1CJKA 1J6VA 3JQRA 1IM6A 4IFVA 3AY0A 1TQLA 3TYTA 1Y0HA 2ZH2A 3GCXP 4CQ1A 4B9TA 3K7AK 1X5PA 3UD3P 1L3KA 2DNGA 3OEEA 4HT5A 2EWHA 1T3NA 2N82B 4H4KA 4Y9RA 4CLFA 2MSTA 4X4RA 3FBBA 2HW3A 4WE1A 2ASYA 1XC9A 2YBVA 3WNBA 4F3QA 4DR2F 2DHXA 1FDNA 1HNZF 3RZAA 5H59A 3M8WA 4RDJA 4LF9F 5B09A 2FLLA 4ITSA 3OUYA 1W25A 1NPPA 1FE4A 1UA0A 3EZ5A 1Q0NA 5D4LA 1PSDA 4M95A 2XZOA 4P10A 4KV8A 3QGHA 3PFEA 1RWVB 1WU8A 2CUYA 5D3GA 2E2JK 5HZAA 4ZH4A 2DHSA 4BXXC 2F3JA 2RAQA 4YQWA 3UR0A 4MKAA 1KR4A 5A2QY 2ILZA 1NH8A 1RAOA 4C43A 3CESA 1G7SA 4KMAA 2QMWA 2ZH9A 2DEJA 3Q89A 1KFDA 3EPIA 4CYUB 4ECZA 4FS1A 4OX6A 4RPFA 4QU6A 1SV5B 1X4FA 4J9SA 3HXMA 3GTKC 1S1UA 3LGNA 1VQNB 4ED4A 5KFTA 4RD0A 1KQFB 2CWXA 3BC9A 5HBMA 1S1WB 1EK8A 2WCXA 2O66A 2GJKA 3JTNA 3NUHA 2MHEA 2BSAA 1BGWA 5K14B 4RZRA 1XNQF 3S1NC 3M4XA 1Q95G 3A3OB 3IM9A 2RE1A 2IC3B 5A8WB 5KFVA 1VQLB 1CULB 4OJHA 2CVIA 5GAGU 2GAHC 2AKWB 1IHMA 3A1YG 4LQYA 4DSLA 4KKTA 1USOA 1M5HA 4ZGNB 3SI8A 4ASUA 2N3OA 3V5RA 1FTCA 5A8RA 4TQSA 3K17A 5IV4A 2APOA 2G2OA 2HURA 3HZGA 4Y7NK 1IQZA 4J0QA 2ZKUA 2VNIA 2M4MA 3W9HA 5C5JA 4RCYA 2H51B 3W2HA 3OR1A 3BH4A 4PAAA 3TOQA 2MDAA 5DS0A 2ZWPA 3J7YI 4USTA 4LBZA 1CBKA 4MH8A 3SYZA 3M8YA 4WJBA 1X4EA 1NMEB 3CDUA 5DDPC 4GTBA 3RYLA 2KVOA 4O3OA 1BWVA 4B3OB 4HHJA 1QE1A 3WNCA 2GA7A 4XKWA 4KGZB 2CRVA 1QAXA 2OMLA 2C3OA 2EFPA 2OPQB 5MAOA 3V4IB 4DV0F 1U0HA 2AYMA 4PR6A 2GIFA 1NHKL 3DLGB 3HCXA 4KM9A 2D69A 1U49A 2HFOA 2Y0SL 5HO4A 3GR0A 5EUHA 1RTHA 3TW0A 2JC1A 1G4CA 3IC1A 1U6BA 2MJNA 2XCQA 4NE9C 4AFFA 2BN4A 1TWFA 4GC6A 4FWTA 2QA4B 4X2BA 5A8KA 1GMWA 4JYAJ 5KFQA 3L4JA 2JRSA 2RDJA 2DH7A 1HQUA 3CCJB 2W2MP 4P12A 4XD7A 2KVIA 4K4ZA 1UMJA 3MEDA 5A0YB 2WONB 5J1NA 2W9CA 4K2JA 2F40A 5IT0A 1JJ2R 3BCDA 3P8BB 2M52A 1X4AA 2XBPA 4AF7A 3EVMA 3GTOA 4OINA 2J7KA 2XCOA 4OI1A 1VQNS 3Q8RB 1YLXA 4A3FK 2HIQA 2KTQA 1JLQA 1RWXB 3OW2R 2XULA 1FNDA 1FA0A 2W9AA 3CJ0A 3RRHA 4JBCA 4EO6A 4PC1A 1EP1B 3C8YA 4TN1A 2F4VF 2RH6A 5IYPA 1RT3A 4A8KA 1SFOC 2YNHA 4B3RJ 1W2IA 3KLGA 2OEKA 1NH7A 2EG1A 1BY9A 2DEIA 1KMHA 4TYBA 4Q8FA 3DHXA 3QYYA 2ZH3A 2X1AA 3VGSA 2FJXA 3IWNC 3AAWB 4DR3J 4DQQA 2NVXC 2B4UA 1VQLS 3AGQA 1B2RA 3VAIA 4IDKB 1TL7A 1WG1A 3R5JB 2ILYA 1KQSB 1T05A 4AL6A 3CQZK 2XMTA 4L76A 2B63K 2VG7A 2FJVA 2AHOA 3RBXA 4FP9A 3PYGA 3T9NA 4XN0A 3R27A 3DRRA 2V4DA 3B8HA 4QIFA 1AZSA 4NRTA 1ZZNA 1T0TV 2HMAA 3NLCA 1B0VA 1X31C 3G82B 3LP1A 3JYTA 2A6OA 3R6LB 4P7TA 1R9TA 4LIWA 3DI6B 1HIYA 4G0WA 4DUYF 1DTTA 3FVYA 4J5OA 3JU4A 5C4XK 1UVIA 1U45A 4B3XA 3SCKE 1F5CA 3ZZ0A 1RHQB 3QAUA 1KNZA 2QGGA 3AGPA 3WC2A 2V7WA 5IOQA 2IYIA 4PG4A 1R8CA 2JOQA 1N54B 2CQ2A 1XQBA 5IC6B 1PO6A 2QG9B 4CP5A 1QVGR 3UO0A 1TKTB 3C46A 1SQFA 2JSXA 2JH3A 4RW7A 1EFWA 2DHAA 3DLJA 5KFOA 2A18A 1ZYRA 3GTLA 3KXDA 1S1XB 2VJJA 1FESA 3QZ7A 4FF2A 4RW8A 1I3QC 4FKYA 2O5IA 3T00A 3TA0A 3GYNA 4A8XA 4OYZA 3CPXA 4TY8B 2QA4S 1JXLA 3U6BA 4DFPA 2RRBA 3OQ2A 1Q86T 1JLBA 3SXLA 4KGVB 1JX4A 1NAQA 1QFZA 3CCJS 3EMTA 3RB6A 1PKUA 3MAAB 4RKUC 4FS2A 4O44B 2F5GA 3EWGA 2VFTA 3CPWB 2EBBA 1TKDA 1KKHA 2J5AA 4KDDA 5KFNA 2WSEC 2M2BA 4NLTA 1K28D 3QJPA 3LAJA 2ZBVA 2MKHA 4WZMA 3PEHA 3CDAA 3QT8A 1RLDA 2ZZQA 1AIPA 3I1FA 5LMNF 1U0SA 4WK3A 1KHVA 3D66A 1VQ6B 3N01A 3M6XA 2IVMA 5JVGQ 1FRHA 1MW7A 1RAGB 2PA3A 2HNZA 2QO3A 2GVZA 2VFVA 1W2BR 4KPCA 1WIHA 5IP9K 1V9OA 2KHCA 3PIOQ 1F6TA 2BOPA 4USWA 3H2UB 1K73T 3M6WA 4DS4A 2PA8L 2MZSA 2KXNB 4X07A 2QFJA 4Y2MA 1CJTB 3VR1A 4FYDA 1H74A 2YKNB 1VQ7B 3K58A 2C2NA 4ZHRB 4NLRA 3CP2A 5I3UA 3H25A 4B3SJ 2ZNYA 3QSYA 1ZA2B 1ZUNB 4J9NA 4A3GC 1RTJA 3M6VA 1EKRA 4B3RF 2HZAA 3DYAA 1H2UX 2W7OA 4IQMA 2PGCA 3PO2C 5CDFA 1FNMA 1RTZA 4DR3F 2E2IK 4QR2A 1TWHK 1RACB 2K2PA 3CB4A 1N6QB 1XZPA 4NXMJ 1IBKJ 1OGJA 1JLFA 3CCLB 3D1OA 3NGTA 1XTZA 3TEHB 1UL3A 2KFNA 1IBAA 3NXZA 4N8OA 1N06A 1ZOTA 1YQHA 3WNDA 3GVKA 2GJFA 4ANCA 1TTTA 1QVFB 4DR7F 2Q6LA 1O24A 3HD2A 3S1RC 1VQ8B 5KFYA 1MG7A 3KLFA 3DHWC 2ZITA 2MQMA 4EU0A 2ZBUA 4HDGA 4LFCJ 2D7SA 3JQPA 1OQ6A 2Y8WA 4FYVB 1DTQB 2CKWA 2GW8A 4YDDB 2DRAA 5IYDC 1T02A 1VRTB 3CCRB 5KTQA 2Q43A 5IM0B 3MR5A 2WSSA 2DH8A 1N8RT 3H20A 2HHQA 2XYPB 5GMKa 4KHRA 1O25A 4RU2A 2V7UA 2HS4A 3KUEA 4A8FA 3OPOA 1WWHA 3Q8YA 4N7TA 2YU9C 2M9KA 1H42A 2VIHA 2AWZA 1NK7A 1FKOA 1XFOA 2PLFA 2W7VA 2L3MA 2LXIA 4ZN3A 2MLYA 1EXMA 3OVAA 2V6SA 2JC0A 1KC8D 3HD1A 2YWFA 4BHQA 3BSAA 4IOCQ 3RW7A 3BN7A 2RNEA 1RHUB 2CQ1A 4KH0B 1RT1B 3D6FB 5J2QB 4AE5A 3LWMA 1A7GE 3I82A 3V76A 3QLHB 1VQ6S 4WQMA 2CNDA 3GTQA 2ZWOA 4WP9A 4F50A 4NL5A 3IXQA 4PWDA 5J3OA 1CSJA 4LK0A 3Q8PB 2KN4A 4RL1A 1TV6B 4EEYA 3VAMA 4DV2J 3KUHA 3OXFA 3SZ2A 5CQGA 1CG2A 1R5NA 4GTFA 3PYDA 2R8GA 4IFYA 2NVTK 2QYGA 2W4CA 4RW4A 1TUVA 2VPWB 4V19X 5SUHA 4WZEA 3GYXB 2CXEA 4O4GB 2DNLA 2PFDA 1VQ7S 2BE2A 3TUJC 4AC9A 4F26A 4AD6A 4WJ3M 2CF4A 3TA1A 1PC4A 4QPTA 4PPZA 1TFYA 5T14A 2RGRA 5KG6A 5HVFA 4J90A 7FDRA 3VTIA 3GV5B 4I1TA 2VG6B 2CNKB 3I4HX 3PR5B 2CNLB 3A1PA 3H5XA 2CJKA 4G7ZA 3QNWB 3NNCA 1WDDA 3PHEA 2QMUB 4Y28C 3D5MA 3CCLS 2MMYA 2V9WA 1T94A 4GVBB 3LAMA 4DQKA 3H59A 1IVZA 5CXTA 1BE4A 4BY1C 4LR8A 3CCVB 3ILOA 1LWEA 1RKJA 2V7XA 5J2PB 1XIQA 1XERA 3AB4B 5E5NA 4A8WA 1VQ8S 3I4MC 4B3SF 1PJ6A 4ZVEA 4NPOA 4X4QA 3H9NA 4OZNA 2MKJA 3ZUGA 1KONA 3CIMA 1T6ZA 2ROPA 2LDYA 4NLYA 5ETQA 4YR2A 4XMYA 2JA7A 2NYHA 1YBAA 3I32A 4P75A 2V2KA 1GO2A 4G7OA 1LKZA 1FDRA 2OK7A 3CCRS 1GXLA 4BWJA 4ECVA 2VA3A 4PG6A 4MEYA 3CIZA 1IBKF 4ZGQB 1Z2ZA 3NNAA 4DXLA 2WBRA 3N5FA 1X5TA 5AE3A 3ZO7A 2XOKA 2FVQA 3VA7A 3VHQA 3LALA 2V69A 4UOCA 4KGKA 2VJIA 2YWKA 2M8HA 5AJ3F 3BSCA 3EVOA 5AXNA 4UAJA 2VV5A 1XNRJ 4EUVA 1S10A 4NZ7A 1RAFB 4QOTA 3MGJA 4DPOA 4HL9A 2EFVA 1W9XA 3V6HA 3MUTP 5J2MB 3NMAA 2HNYB 4OX8A 4LFCF 1AT1B 3G6XA 1AW0A 2LA4A 3DDYA 1R8AA 3N3YA 2MJUA 4YOEA 1Y1WA 1J9ZA 3B54A 3CJKA 1WC0A 6FD1A 1PAEX 5DN6A 2OFGX 2BM1A 5IT9U 3W2VB 2AJ0A 2W2OP 1TVCA 2V31A 2GK7A 3S1TA 3N0VA 2RRAA 1L3SA 3QIPA 4NA2A 4KHPF 5GADU 4J9VA 2CQDA 4HKQA 2XMKA 4DU7A 2BANA 2GX8A 3W5XA 2Y3YA 3JSMB 3GIJA 2YNIA 3MAHA 1IQ0A 4M5JA 2LVWA 1JKHB 4GO7X 1WTFA 2R42A 1LV5A 3FPKA 4QW8A 1PYOB 1AB8A 2CRLA 4I2PA 2NVYK 2XI3A 4ZKAA 5H9FK 4F02A 3D6TB 3S17K 3SMZA 1DQ8A 4NCAA 2AZ3A 1EZZB 1HQ2A 1MWYA 1OY6A 4LF4J 3AA9A 1S9EB 1N33J 2DNKA 1TAUA 1FRIA 1U1RA 4IG0A 2AF6A 5KFPA 1VYAA 1NUEA 1URRA 4JI6J 1JLCB 1APSA 1L3VA 2LLZA 3FCHA 1VBXA 4Y9UA 3GTMC 4C8ZA 1CQMA 2VBVA 2WVEA 2L08A 3CCSB 2GSNA 3SEJA 3T6BA 4ZCKA 3MECA 2E2HC 2XGQA 3CJRA 3JS9A 3GPAA 1B4BA 4Y00A 2ZZTA 1SKUB 1VIXA 2V4RA 4X0CA 3HKWA 3SZYA 3AH6A 3U1MA 1E6YB 3CCVS 1G1XA 2CPIA 4F4KA 2J0XA 1X0FA 4PGOA 2NXNA 2VG5A 3PW2A 1VGXA 4Y52K 2K3KA 3ET6B 2V2VA 3ES9A 1UWBA 3S16K 1T7PA 1V3SA 1IKWA 3KDOA 5M5XK 3R2DJ 3A3GA 2PMHA 2CIMA 2FQQB 4RJVA 4NI2A 3ZIAA 4M63A 3K2YA 4TKTA 4J9QA 3GIIA 3J81j 1AUSL 1R6YA 1I5OB 4HI2A 3QQCD 3QWUA 5E6TA 3VWSA 4B3MF 3MEGB 2UUBF 4IG3A 4J9KA 1CQNA 3KK3B 3FCVA 4E8UA 4DN0A 1SQEA 3V6KA 3HKZL 4EWTA 3UCZP 2ZH4A 1ZPWX 2C5HA 2XGJA 4UZUA 3GFYA 3ILJA 3T02A 1PIEA 2UU9J 1PYTA 1XQIA 4Z7YA 2WBMA 4KQZA 3PKYA 2HHHJ 4ZPDA 1KK1A 4K50A 2BJ1A 1Q81D 1K83A 4DQIA 2ZXIA 1S77D 4YEJA 4TMWA 5EDWA 5AN9A 2EC2A 2VONA 1ZM2A 4YALA 2F43A 3ICLA 4IRCA 1IQTA 2CPYA 3S15K 5CYMA 1HI1A 1W0KA 1F7VA 2DT9A 1SKQA 3V4GA 1KZLA 4NYPA 1GQEA 4MYTA 2BJEA 2B4VA 5FDLB 3JTOA 3RBEA 1INNA 2JA8K 4UZEA 1BQNB 4QHYA 1BQEA 5CCLA 1NBMA 1ULRA 4KFBA 2R8JA 3OW7A 2CZ4A 3UCGA 2QMXA 3E1YE 3SJPA 3HOUC 2OYNA 1QGYA 4G7XA 1UD8A 2C3UA 1WEXA 3M8QB 2IM3A 4A3KC 3OZVA 2AMCB 4MK8A 2DXDA 2JA5A 1C1CB 4Y6IA 3CCSS 1KS2A 3F0NA 4K1XA 5C24B 3QGIA 4DV6F 5C42A 2FVSA 4IH5A 1WG4A 1UEKA 1YDLA 2E29A 4ER8A 4PG5A 2VFUA 4QJVA 2X8KA 1E1QA 1N33F 1VQPB 4E2FB 2PFFB 1S0MA 3FKIC 1BX0A 3SIPB 3M2RB 4KYZA 1TFWA 1GE9A 2BW7A 4JI6F 1YCLA 2ZDOA 4JI1J 3CNQP 5M5WK 2CJYB 1UEVA 2RIJA 3CC7B 2VFRA 4NA3A 4NBSA 2QE7A 3QE2A 2MKIA 1NK9A 1EETA 1SKWA 1WHYA 4B44A 5GAHU 5IXUA 1Z4UA 2P6SA 3G86A 1GX5A 1U7LA 5D4NA 1DBDA 3Q8SB 4YFUA 2ZBQA 4I68A 1COWA 4ZIWA 1UJ4A 2QIFA 3HJVA 3N6LA 2UUCJ 2D41A 4ZLJA 4L75A 2B9EA 2DD8S 2FJAB 4C8LA 1MU2A 3PG9A 5LL6d 4NZ0A 3FJOA 1GAWA 2GS8A 3TAPA 2F4FA 2EW9A 1Y0YA 3C15A 2MGZB 1AB4A 3ONUA 4ZVTB 1WF1A 5L1IA 4MAKA 3AVYA 4OOSA 3M30B 1JLAA 3MURP 4PXBA 3QT6A 3KMSA 3LH2S 1HI0P 4PQUA 1WTHD 4EBCA 1HHTP 4XQFA 1P1TA 3IN5A 4ID5A 3ASPA 2P8TA 4ILRA 1HQMA 3QRRA 2Z2LA 3AJDA 4RBVA 2MZTA 5AXKA 3ERED 4DX7A 4X65J 4P72A 2QC3A 3WODA 4NLPA 1SC1B 3NMRA 2CPHA 3ISXA 2UVUA 4P9SA 2VD3A 2E5LJ 1PCAA 2NVQC 1QX4A 1JJ2B 4H54A 2Y8YA 1B64A 3S15C 5G0RB 2BE9B 3OVSA 4MKYA 4LF8J 4ZCLA 4GKKJ 3HHDA 3FFIA 3O44A 2RMLA 3T5JA 1XZQB 3BP8C 5DM6Q 1IKYB 1EP4A 3JB9k 4A3MK 3DU6A 1DY3A 4DNRB 4L74A 2YVSA 2GPJA 2WJYA 4XCHA 1FFWB 2VKZG 3ZTSA 3MM8A 1H2VZ 1CQXA 1J5OA 3SEOA 1UW9A 4TYAA 4ETZA 1BQMB 5EGYA 3ZTRA 2V8PA 3WX4A 4OHVA 1J5EJ 2CNOB 2BOAA 2GGPB 1C0UA 1RQ0A 2FX3A 2KL8A 4JI3J 3TZWA 2M88A 1W0JA 2ZFZA 5JVHQ 2AZ1A 3UWTA 1UCNA 2EC0A 3HOXC 4WYWA 4OV6A 4RNFA 1TMMA 5D4OA 2H4WB 3D28A 4TMVA 1VQPS 3HVWA 3D2WA 5I4MA 1H2TZ 1QH0A 3R6KA 4X62J 1U48A 2DNQA 3AQPA 5BXIA 3H0GK 1BJKA 4A93C 2QSWA 2JFKA 4ZN1A 4XSXA 3MMAB 1M90D 4JOUA 1TWGK 2GCFA 5CZXA 1WQHA 3FSIA 3CC7S 4PKDB 3PEJA 3GONA 3ZNJ1 2DO4A 2OAUA 1FRLA 1HBNB 3MEEB 4CLYA 2GAGC 3R6GB 1LXJA 1C2PA 3T19A 4FNIA 5DLGA 2AW0A 3W5HA 4J9UE 2HQDA 4H4OB 1P4MA 3CCMB 1F0XA 5F41A 2VBUA 2O01C 5KFXA 2VUMK 2KJVA 2R7VA 1IJFB 2CJQA 2PI5A 1ZM9A 1QVGB 4QQBA 1BMFA 2WAQD 4RW9B 2VNHA 4W90B 4AQYF 2IFXA 1I50K 2AYEA 1O6XA 1E43A 1DJ0A 1R8PA 3GFZA 4BBSK 3CSKA 3N0CA 2GO9A 4IQXA 3Q3QA 3NEKA 1HW9A 2FPHX 3G87A 1I6JA 3NGKA 1EFUA 1K8AT 1WC5A 2V4JA 2BABA 3V6DA 1TL3A 2JEJA 3A13A 4USJC 2PN6A 5E2QA 1S6UA 4LLGA 2U2FA 3T5KA 1X60A 5A6WA 1U4BA 2CJAA 1TWAC 2G13A 2UUCF 2V67A 3FQLA 2DGQA 2FD2A 2ZC3A 2CPXA 1UZHA 5B0AA 2D3O1 2VQFJ 1SJFA 1WCMC 1TL1B 4O3SA 2V8DA 4CO3A 3DRSA 4ZPCA 4ZJLA 1Q7YD 4LSZB 1VQYA 4OIPA 4YAOA 3OBIA 3CP8A 1N56A 9RUBA 3ONYA 2DO0A 1FKAF 2WZ1A 4NYOA 1S9GB 3QATA 4YP3A 4MK9A 1Q79A 2IJNA 3MR7A 2FJWA 3H4DA 4K4UA 4IOBA 3KNAA 2WVBA 3VALA 5AT1B 3OJSA 4XOTA 3SBMA 4OX9J 2K1RA 1HHSA 3QMQA 4CIOA 4H4MB 5CABA 1W2BB 4X65F 3IP0A 4ZJOA 2CQPA 2VL1A 1U1QA 3HOZC 3CVKA 1KC8T 4LF7J 3W64A 3BO2A 2C28A 2E5LF 4LJMA 4ZITA 2B5OA 2DGOA 3NS7B 5E68A 4DV7J 1P8GA 1FRJA 4ZVOB 4LUBA 1RP5A 2R7WA 4TNOA 4LF8F 4GKKF 1UVLA 3NRBA 5K8OA 3T1AA 4C0BA 4FYYB 3T3FA 4ZVHA 3HFKA 4C8YA 4QIWL 1TUIA 3D1HA 3UN5A 1YBTA 3DXBA 1WACA 4DHVA 4QWEA 3WZ0A 1O8BA 3ONQA 3GQCA 3HK2A 2VDIA 4K4VA 1KP6A 3HOWK 3Q23A 4I4BA 4W4MA 1J5EF 3GV7B 4M5HA 4HHHA 5IK2A 1TK0A 2B9WA 4JI3F 3S01A 2EK1A 2RC6A 5DQIA 1FXLA 1RWUA 2PI4A 1NZAA 3UR3C 1RADB 1D9AA 1WOOA 3LQVA 5HQ8A 3CCMS 3BR9A 5KFZA 2RF2B 1Q7LB 1N32J 4WFNQ 5A89A 4RD1A 4B9VA 5IYNA 2VOPA 3HMJG 4Y65A 3KK1A 2DRDA 2WB1L 4QV2A 4USHA 3C16B 4ZCIA 3BB5A 2BF4A 5TMCA 2JDJA 3NBPA 2HRTA 3P45B 4A3LK 1QAYA 5B0BA 1WSRA 3CQZA 1M1HA 2DGWA 3DC2A 2AGOA 2B63A 2MKSA 2Q6IA 1FKPB 2KHDA 5HATA 3J7ZT 4GTLA 3I87A 2HWIA 3I31A 3MM9A 3GG0A 1LW2A 4P7VA 3IG1B 4WP8A 4EBDA 4OZ1A 1N52B 3HLUA 4PRFA 2E5JA 3TUZC 2XMJA 4GMKA 2WHOA 1NU4A 1G7CA 1SI9A 4AXJA 1VISA 4PYDA 2XY6A 3ILLA 3GILA 4FPIA 1JLEB 1OYDA 4AL5A 4YFNA 4ES2A 4F2RA 2ZL7A 5TRDA 3SZZA 2ZKTA 2HMIA 3MMCA 2XC9A 2E66A 1HNXJ 3W5VA 5C25B 3MPUB 3GG1A 5CD4A 3R7BB 3JAMY 2BGIA 3AT1B 2JVRA 1CS4A 3M4OK 2DJWA 1MMLA 1O5JA 1T8EA 1K1SA 3PTWA 4ZA1A 1RGVA 3OOCA 2JZ5A 4J9RA 2DITA 2C5BA 2VBXA 2DNRA 3IRXB 2V5HG 2WVDA 2R92C 2VQFF 3MTKA 4C2MK 1FF2A 4LVOP 1M1KD 4C6AA 1HVXA 5L1JA 4WIIA 3O8WA 4ZLLA 3FBEA 4OIXA 3AODA 3OTDA 2A6EA 1T03A 2VDHA 4P2FA 2X6YA 3WC0A 3LP0B 2GSUA 5H9EJ 3AFGA 2LXFA 1UWAA 2M70A 4DJBA 4X64F 1WHVA 4RUCA 1RKIA 3LP2A 1OYEA 2EK6A 3H3VL 2HHPA 5K9FA 4TMTA 1RI7A 4KIAA 1ZAVA 5K5MA 3WHIA 2P5MA 4XKVA 5L8RC 3J7AN 4ERDA 1UTAA 3S2DC 3FMBA 3W65A 1QTMA 1U8SA 3PX6A 2MQPA 3BY2A 4LF7F 3M2UA 5CAAA 4ZS6A 3EDRB 3HVTB 3WDOA 2YKAA 3BDPA 1Y11A 1VC0A 2BJDA 3IA0A 5J1EA 4NXNF 4LQ3A 3VO1A 1JJCB 4X4OA 1N07A 3T6JA 3OV7A 1O28A 3T53B 1S4MA 3RZOC 4IH6A 4F2SA 4YUDA 4G0VA 2JL9A 3LGMA 4GTAA 4WJ4A 1S6QA 1VQKB 1VF7A 3FZBA 5HANA 4G1QB 1PBUA 2GJ2A 1BDFA 4Q4ZA 5M2PA 3MMPA 4C9DA 1WEYA 4IO1A 1TKXB 5LJ3Y 3BSNA 2XWYA 1KQKA 5IFMA 5BYSA 2R7OA 3DOMA 1TWCK 1N0VC 4USUA 3RAMA 3S1MC 3G8QA 3ELHA 2IRXA 4R71A 1FO1A 4DSEA 4J3NA 1P6TA 2HGMA 4URGA 2DHGA 4A3IK 3GDZA 1EB0A 5HLFB 2JIZA 7AT1B 2A6MA 4O0IA 1TZ0A 3HJFA 2UVRA 1F5BA 1N32F 1NJID 1J6XA 4ICLA 2E2IA 4RD4A 1TWHA 3NNHA 5FL7A 1DLOB 2ZJRQ 1Q4RA 3ITHA 1YBUA 1Y3KA 3QGGA 1L0WA 2HRUA 5C4JC 1S4EA 3GVLA 5F8GA 2CFAA 1KVJA 2RT3A 1EARA 3J80Y 4ECTA 3UD4P 4DMZA 4IW3B 4XLEA 3HHLD 4Q8EA 1D8TA 2R2RA 5KSWB 2MZRA 3VNUA 3GLJA 3I0SB 2QA4G 3M05A 4QFMA 5ETSA 2W1BA 3H94A 2VUGA 3IM8A 4K4WA 2DERA 4G3IA 2KKHA 5HL8A 2DISA 5A6PA 5F8HA 4C11A 2V8GA 2DNPA 1OGIA 1KFSA 1S6PB 4OI4A 3IAS9 2C42A 3HT0A 1HI8A 3UVJA 3HVAA 3U2QA 4K5RA 4CO1A 3NGDA 3QRPA 5FLMC 3PRBA 4UZCA 5CYJA 4KKOA 3VV2B 4ED1A 3OHBA 3FEYB
chains in the Genus database with same CATH topology
1V5VA 1PJ7A 1XZQB 1X31C 3GIRA 4PAAA 4PABA 3AD7C 1WSRA 3A8IA 3TFIA 1VLOA 1VRQC 1VLYA 1WOSA 3GEEA 5L46A 4P9SA 1WOPA 2GAGC 1WORA 2GAHC 3AD9C 3ADAC 1XZPA 3A8KA 3TFJA 1XZQA 1WSVA 3AD8C 3TTGA