2R6HA

Crystal structure of the domain comprising the nad binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
285
Chain Sequence
b'GVKEWECEVLSNKNVSTFIKEFVVKLPEGETMNFKSGSYAQIKIPKYNIRYADYDIQDRFRGDWDKMDAWSLTCKNEEETVRAYSMANYPAEGNIITLNVRIATPPFDRAANKWKAGIKPGISSSYIFSLKPGDKVMMSGPYGDFHIQDTDAEMLYIGGGAGMAPLRAQILHLFRTLKTGRKVSYWYGARSKNEIFYEEDFREIEREFPNFKFHIALSDPQPEDNWTGYVGFIHQVIYDNYLKDHDAPEDIEYYMCGPGPMANAVKGMLENLGVPRNMLFFDDFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH:ubiquinone oxidoreductase, Na translocating, F subunit
publication title Crystal Structure of the Domain Comprising the Regions Binding NAD and FAD from the NADH:Ubiquinone Oxidoreductase, Na Translocating, F Subunit from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Oxidoreductase
total genus 72
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.-:
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2r6hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2r6hA02
2CNDA 2PIAA 3WY9A 3AGPA 1U2RA 1IJFA 5EMNA 3ZBUA 1KK0A 2OTJB 1B23P 2QTLA 1W87A 4EH1A 2HMAA 2AHOA 1SM4A 2BV3A 4PGOA 1VQMB 1UMKA 4P6VF 2BGIA 3CCJB 2R6HA 4IW3B 2QN6A 4RJLA 4YALA 2PMDA 3CCMB 1DDGA 3FJOA 1Q86D 3I55B 4LBYA 3ES9A 2NPFA 1AIPA 2EIXA 3QFTA 2FX3A 1EFUA 2BSAA 2DCUA 4NBSA 4ZV4A 2B5OA 1YITB 2HCJB 5DSZA 3LRXA 1EFTA 3W5UA 1QX4A 1GVHA 4QHYA 3LYUA 3AVVA 3CD6B 4Y9UA 5THXA 1VQ5B 3JQQA 4C43A 3QFRA 2QTZA 1E62A 3G71B 4AC9A 5GV7A 4RD1A 1EFCA 1HA3A 4LBVA 4FWTA 1H85A 3W2FA 4DQKA 1ELOA 2DEUA 1QGAA 5H59A 3CMEB 3FPKA 5TY0A 2YWHA 4B3XA 1VQ8B 1FRQA 4M2LA 4PC3A 3G4SB 1JA1A 2RC5A 1DG1G 3VNUA 1KQSB 1R5OA 2QDXA 2X3UA 2QMUA 4ZGNB 4B47A 3WYAA 1QGZA 2RC6A 4AF7A 1QFYA 2B7CA 3I56B 2OK8A 1DARA 1SKQA 2BPOA 1W35A 1R5BA 3OZWA 4PC6A 4U9UA 1FNDA 2VNIA 1R5NA 2BM1A 3QFSA 3CMAB 1TTTA 1N0UA 2XNJA 3QFCA 3AVTA 4BPRA 4ACAA 1J9ZA 4YAUA 3B8HA 1D1NA 1ZM4A 4RD3A 2DERA 1KJZA 1QUEA 2VNHA 2YWEA 4PC1A 3WNCA 1QGYA 3ZC3A 5FA6A 2BVNA 3CPWB 3E20A 1FNMA 3I1FA 1F20A 4NCNA 3SJZA 1KD1D 3OJXA 4RD0A 1YI2B 3CC7B 4YAOA 1CNFA 4Y7CA 4N3GA 3CCLB 1ZM3A 4M4SA 1QVGB 4G1VA 4YAWA 3LVBA 1KTVA 1YJNB 3W2GA 3OZVA 1M90D 2CRVA 1CQXA 2DETA 1VQ4B 1I7PA 1OB5A 1BQEA 3P26A 1VQLB 3J81k 3CCEB 4G1BA 5TV2A 1KC8D 1A8PA 1JB9A 3W5HA 1VQPB 4YAFA 4G5GA 3AGQA 3ZZ0A 3CXCB 1E64A 3VNVA 1K8AD 1FDRA 3LO8A 1S72B 1WDTA 3ZBTA 1EP1B 1EXMA 3CCVB 4PC2A 1F60A 3JQPA 2EFGA 1NDHA 3B78A 3AVWA 1NJID 1H42A 2B7BA 1TLLA 2BN4A 1KRHA 1YIJB 2HDNB 2GPJA 5GV8A 3U6BA 3PENA 1IJEA 1VQ9B 4MYUA 2J7KA 5JBQA 1AMOA 1XE1A 2C77A 2PLFA 3WXMA 3CRZA 1EP3B 1BX0A 4RD4A 1M1KD 4RD2A 2DY1A 4ZCMA 1ZM9A 4B43A 1K73D 1XB2A 3W5VA 4J0QA 3ZZUA 4TMZA 3CB4A 4B44A 3E1YE 1W34A 3VMFA 3W2HA 4Y9RA 4M53A 1QFJA 1KK1A 1N8RD 1JA0A 3G6EB 1K9MD 1TUIA 3WNDA 1QUFA 1N0VC 3AVUA 1B2RA 4MYTA 3VO2A 4B4DA 3CC4B 2BM0A 2YWGA 1OB2A 3W2EA 2QEXB 3CC2B 1VQ7B 1KK3A 3A1FA 3W2IA 1D8TA 4LC0A 1G7SA 2VZLA 3WBKA 2D74A 4HE5A 1VQOB 1OGJA 3B82A 4F7DA 3OZUA 1VQNB 4ACBA 4TN1A 2XEXA 1Q7YD 1ZUNB 3AVYA 3V76A 4N3NA 1FNBA 1S0UA 4LBWA 1GAQA 1Q82D 2OTLB 2YWFA 2GQFA 3MHPA 1BX1A 3JQRA 1FRNA 1Q81D 3AVXA 4R71A 1DDIA 4RCYA 1EP2B 4DQLA 4AF6A 1QH0A 1E63A 4M0LA 4QFMA 1EWYA 1GO2A 1D2EA 3ZZTA 4TMXA 4ZCLA 2QA4B 4LBZA 1OGIA 5TR9A 2E1RA 4RCZA 1QFZA 1G7RA 5H5JA 4FN5A 2C78A 1G7TA 3P27A 4C0SA 3CCUB 4TMTA 1YJWB 5AN9A 2OK7A 3QE2A 1YHQB 5HXBA 3OW2B 1YJ9B 3CCQB 4P3YA 4B48A 2VNJA 1GAWA 3WNBA 2XNCA 1VQ6B 4ZGQB 4UAJA 3QSYA 3MMPA 1BJKA 1CNEA 4H9GA 4M1KA 3OJWA 2BF4A 4RD6A 3WBJA 1TVCA 1G7CA 4ZCIA 5KSWB 1JNYA 3CCSB 1GR1A 2BGJA 3CW2A 3U6KA 3VO1A 3U2QA 4HE6A 1ZM2A 1QVFB 1JJ2B 3MCAA 1IB0A 2VYQA 4TMVA 2ZITA 1KK2A 4YHBA 4TMWA 2BMWA 2VNKA 4WQMA 1GJRA 1FNCA 1VQKB 4FK8A 1QG0A 4PC7A 1W2BB 4K1XA 3CCRB 4Q7JB
chains in the Genus database with same CATH superfamily
3ZGNA 3UB2A 4HXFB 4DHEA 5KX5B 1V9SA 2A9KA 3WY9A 2BMAA 2QPTA 4MJ7A 4TLLB 1VSUA 4LTMA 4WGGA 4YHHB 3G68A 3VVBA 1IJFA 2QTGA 5KX5A 2AD1A 2PFSA 2QPLA 1XLTC 4H1HA 3GRCA 4ZA2A 2OTJB 4UOQA 4WDQA 5ISMA 3U60B 3CUVA 3SQOA 2XGSA 1AURA 3ACDA 1XEWX 4H4EA 2IGBA 2QR3A 4PYNA 2QLLA 3OJ0A 1GGFA 2O4CA 5HJEA 4EI2A 2QK4A 2A30A 3CKKA 1UM9B 3T7JA 1CFZA 2EF0A 4J0EA 4R2WA 1JXQA 4FYIA 4BVBA 1H9AA 4OP2A 3TLCA 2G0TA 4LI3X 3UG7A 1MP0A 4R2HA 3QXGA 4ETNA 1U63A 1EUCB 1UM9A 4US0R 4JVSB 2R5WA 5AUPB 4CQNA 2DJIA 3EEOA 1JBKA 1XGKA 2WUGA 3NBUA 3RVJA 4B6GA 3CZPA 3AZPA 1XF1A 1EUCA 2BM8A 1V5WA 3KUKA 2BSAA 4QYIB 3ZJUA 2CE2X 4KR0A 4FC7A 3DOFA 2H92A 4AYTA 4ZV4A 1FQOA 4AROA 2B5OA 4QYIA 1XHFA 2LR0A 1X14A 1XJWA 3A1UA 3GGOA 4OF4A 1ISFA 1E2MA 2C3MA 2DG2A 2HHLA 2JIRA 3EIOA 1U5AA 2ZIEA 3HSYA 3LDHA 4L07A 4R2MA 4JQOA 5K0LA 1SU7A 3HN6A 1N8SA 2OM6A 3H4TA 3L3BA 1SXGA 2FN7A 3S29A 1GRRA 4YV0A 3H4VA 3LUGA 4ZARA 3WVNA 1WPRA 3QFRA 3LHFA 1FUKA 4FDTA 2PG3A 3G59A 1I51A 1PIWA 1VG1A 3COYA 1CY7A 1FP4B 3UK2A 1JDZA 3JXEA 4I50B 3G49A 4ERNA 5JAMA 3NUQA 4RZXA 1MO3A 2DTEA 3L1UA 3PCTA 4RGVA 4W8OA 1VPWA 1E66A 1FP4A 2BD0A 2J3LA 4LBVA 4FZRA 2VAWA 4I50A 4BZXA 3EEYA 3PUYA 2ANCA 1YRYE 2QTRA 2W6PA 1TZMA 2C04A 1KJNA 3NIFB 3DBLB 4A8TA 2I3AA 5BSEA 3CVVA 1BFUA 2V4ZA 4DCSA 3G02A 4IMRA 1MGOA 1NOKA 3SLKA 4DIEA 4Q34A 3QMVA 3KKLA 4EPVA 5F3RA 1N75A 2OHHA 4RW0A 3DBLA 4BNDB 1VIAA 2CNBA 5ALDA 2AMLA 3P52A 4HPXB 4UMVA 4D7AA 5A4MS 2YWHA 1PT7A 1T2DA 1CUYA 3KPVA 4FSHA 5CPBA 1CHDA 1CIPA 1WNFA 4KQJA 4BNDA 4J1SA 4LHXA 1Z8DA 3R3WA 1FLNA 2GFHA 1ZRHA 2ODTX 4MQBA 4I1YA 4YUYA 5HF5A 3P9NA 5IMSA 3AHEA 1DIBA 3WS7A 5DNAA 2QMUA 3QE0A 5CGZA 4XOIA 2YZMA 2JHFA 5KJ6A 4TVOA 4IH4A 1Y81A 4PX5A 1XDBA 1PL0A 4EJFA 1PWEA 4I19A 3GJ4A 4YJGB 3IEUA 2E4AA 3RIHA 3RJ9A 4RUKA 4HFMA 3PBKA 4PQYA 3V46A 1JSRA 5HXAA 5JISA 3DL4A 2WP8J 4IH9A 4M9UA 4AO6A 1TMGE 3I9KA 4JYAB 4YJGA 4PLCA 2QU7A 2X8BA 4MGYR 3V2HA 3QPDA 4XOUA 1LQ2A 4LV6A 1PDWA 4M3NA 2O14A 3DLCA 4DR1B 3P4XA 3DVRX 1Z2CA 1KRWA 4ZZ3A 1VIMA 1HDXA 4S04A 4ND5A 3MELA 2GEDA 4AG5A 1G6OA 1W35A 3QQ5A 5EIHA 4CKYA 1VJ1A 5JIBA 2GRJA 3RVMA 5KSZA 4G0VA 3L6CA 3H19A 3L0ZA 2J4DA 1FYVA 2REQB 5FLXA 3QY9A 4DQ0A 2ESRA 3A06A 4PABA 3DEZA 4UU8A 3T4UA 2G80A 4H4DA 3HP7A 1GSOA 2BM1A 4A9AA 3J81A 2CSXA 1CP2A 2REQA 1M73E 1T4DA 2FFBA 3VPBA 1RD4A 1L7QA 2OAEA 2RHLA 3NIBA 4RIGA 3F8TA 1FBTA 1IG3A 2QI9C 3C1AA 4ACAA 4XR9A 1I4OA 1K7XB 3B8HA 1TI7A 4OYRA 2OXTA 1Z2EA 1J49A 3GG2A 3IDOA 4YAGA 1OZFA 2HK8A 3DHEA 2BZSA 2HLPA 2IODA 4RWEA 5CA1B 2PKQP 2GAJA 2G76A 1X1CA 2LUOA 2A0FA 1SJ9A 3C74A 4JD5A 4AIIA 2BGUA 2FQXA 1YX2A 3AG6A 3HI6A 3CZQA 3FI0A 3JQCA 5CA1A 1OFGA 4MPTA 2HAEA 1J2JA 4PG6A 3I1FA 4QPNA 3UHOA 2E5WA 1GG5A 3M6XA 3OC6A 5EI5A 1QQTA 2BZGA 3LLCA 4R51A 1KNXA 4KQ9A 2D2IA 3OQHA 2X4DA 5LB2A 4A0HA 2KBEA 4YMSA 4CIBA 3FHTA 1WDWB 2AVNA 3V97A 3ESRA 3IODA 4CM5A 2EBWA 5EA2A 3L46A 3FF1A 4BASA 3SX2A 3CISA 1PV4A 1P6QA 4YRKA 3P9XA 4JL6A 1C9YA 3GA5A 2J7PA 3QU5A 4GPBA 1JHZA 3A14A 3THOA 4DCTA 1U3GA 2HF7A 2WYIA 3HDJA 4UHCA 2LPMA 5ARBA 3NTUA 4X00A 4M4SA 4Z7QB 4QM6A 2VKQA 2VHTA 4J90A 4KR6A 1MJFA 4HPJB 4ZOAA 2D1TA 1WDKA 3MWDB 1MJGA 2D5AA 4D4MA 4XORA 3M1IA 1RHJA 2AJLI 3PGKA 4LV5B 4O63O 3QLTA 2G1PA 2KVOA 3WRXC 2W48A 4NYJR 1J2UA 2C2YA 3AM3A 4EHAA 1LWOA 5J58A 1UD3A 1CQJB 1RW4A 3MWDA 2YS7A 4MPDA 1B15A 3TSZA 3UH1A 1DAHA 1EHCA 1N9KA 1KQPA 1OUMA 2VDRB 3IT3A 3Q3CA 1BEUB 2DKOA 4LJYA 4RK0A 5EWJB 4C4XA 4QM7A 2UKDA 4BRWA 5LP6F 1J7KA 1GPJA 1CQJA 1VGRA 2B4KA 3ELWA 4WCFC 5CW1A 5E2BA 4KFSA 3K31A 2JFXA 3L8DA 3BZBA 3ORFA 2H1IA 1UWVA 4G1BA 4G0PA 5EWJA 3NALA 4A03A 3DHVA 1AC5A 3D02A 4BNTA 3ITEA 2VP5A 4FYPA 1VHDA 1X1EA 3WMFA 3K1YA 3NONA 1W5SA 5H1YA 1H4QA 1V9CA 3AWIA 2FZEA 5AI8A 1E64A 1X74A 1MTZA 4NCHA 5BW8A 1VG9B 1PW7A 1FIUA 1SCIA 4GT1A 3BY1A 1QK4A 2VBFA 4DDMA 1GPBA 1V25A 4DA9A 4CT0A 1BEEA 3EXHB 2J08A 4P1ZA 3FB4A 3COJA 2VOEA 2GJAA 4OFBA 1ZAYA 2IHTA 1LPAB 3V8RA 4WWHA 3PJGA 4DYVA 3EXHA 1K6IA 4NATA 4PY2A 4OXNA 1PVVA 2QROA 2C9DA 5DTJA 2EAUA 2MR5A 4P5EA 5LD2B 3CUYA 4D3SA 1Y8QB 2PNJA 3N0VA 1JEYA 4IGIA 1QRSA 2Q4DA 5IHXA 3OIDA 4FQ7A 5EZYF 1QV7A 1YE5A 2J3QA 1DZ3A 3CONA 1QHIA 1U04A 2VEOA 1HXHA 2EZTA 4MLZA 3VH2A 2VUHB 1Y8QA 2FUNB 2PZFA 2QD2A 3H3JA 4EHHA 1QANA 3CO0S 4YRZA 2J31A 3EWNA 4DE5A 2C9OA 2D3LA 3DZHA 4PGHA 5ENZA 1H8HD 4M0MA 1W44A 2W2KB 2XLBA 5FJJA 5GV8A 1I2CA 3MYYA 4UFNA 1ZLXA 4NEHB 1U31A 1NJSA 2Z04A 4BJ3A 2O7VA 4IDDA 5EP3A 2VJJA 4ZANA 1J0EA 3RBVA 2D5LA 1YJ8A 1YMVA 3KEWA 4ZIRB 2V7GA 2VBGA 4DLYA 2H2HA 3VKWA 4M1YA 3U7IA 2PUBA 4US2R 3HZRA 3PC7A 4C22A 2IZOA 5IUKC 4ZIRA 4K9SA 3IO5A 4HDCA 1VRWA 3GOHA 4ZVRA 3WLAA 2GDZA 2Y93A 4RD2A 3LL4A 1Q9SA 4BWVA 3CUKA 4J0KA 4EZEA 5JZSA 5JXIA 1ZITA 2MIIA 4X7MA 3L8CA 4BYGA 1V16B 1VPLA 5ADUS 4B79A 3V8NA 3QVUA 4CM8B 1OYYA 1EKXA 1U0SY 1XIVA 2NUBA 3BTOA 1QJ4A 3AL3A 4HRXA 3CE9A 5DN9A 5REQB 3U7QB 3ZE6A 1V16A 4W9NA 3W8RA 4B8YA 2NO4A 4ZJZA 1HDIA 1HV8A 2OP0A 4G0NA 5ALJA 4TTJA 4AMVA 4CM8A 3TPFA 5CG1A 2YVQA 4G81A 3X2FA 3GB9A 2HF9A 5REQA 1RKVA 1GADO 1SCKA 1W0KD 1USKA 4LQ4A 3SG0A 3U7QA 1W34A 4RY0A 2JF0A 1WM1A 4K3UA 5K09A 3H6HA 2BLNA 2IP4A 4A82A 3ZCPA 3V34A 5B1YA 1DG9A 2N47A 1IN8A 2I6GA 2YY7A 3EA0A 3WWYA 3ROXA 1ZGHA 4LDJA 3PA8A 1L5YA 5L4NA 2IZ5A 1JQ3A 4OBBA 3F6BX 3PICA 1G3QA 2HQBA 4WY5A 1PFYA 3E4DA 3BXEA 4ZYUA 5CJ2A 4B4DA 2D8MA 3UW1A 3HB0A 2FI1A 4ZO7A 2YWGA 2EWMA 3EXAA 5LZ9A 1XYVA 2RGYA 2P1DA 3ICPA 2D0PB 3NHPA 1Y8RB 2EXXA 3AL2A 2QEXB 2VK1A 3FYTA 4Q01A 4PX2A 1CUIA 4ZVNA 4L5YA 1P3DA 2GZSA 2QL5A 4X06A 4IDQA 3W2IA 4KVFA 4JJGA 5HS6A 1G4UR 3S1AB 1CR2A 5EIEA 1G7SA 1E0JA 3GRFA 3GWGA 1Y8RA 3MRTA 4C4OA 1KJJA 4GDFA 4LXGA 4B74A 3II6X 5DM70 3S1AA 1HSOA 5JZOA 3LK6A 3OLCX 5IHPA 4PX9A 1NKSA 3RWMB 4GPIB 3GVPA 3W0LB 4QU9A 3S8EA 1Q7RA 1GPUA 2H18A 1AS3A 1PFWA 2ZJAA 3FN4A 5DHAA 5AVKA 1QG4A 3CZRA 4G4IA 4H18A 3OEEA 3NRBA 5F5NA 1JALA 1J0XO 5KDDA 1WPXA 2KYRA 5DTEA 3UGTA 1L6IA 4B80A 1AHHA 4F96A 5A89A 1OIWA 3HNRA 1HL7A 4E4YA 1PYGA 1ENZA 4O2LA 5HW0A 5AKYA 4FONA 1D1PA 4LISA 1LV7A 1ZN8A 2MT9A 2ROQA 3B3QA 2DYIA 3DNPA 4O02B 4R71A 3QX7A 3LD9A 3VSAA 1P4MA 1QBKC 2B82A 3DVLA 4RCYA 1L1EA 5FV7A 1L5GB 1IRIA 5KAPA 1DJMA 5HIIA 3INYA 3FIUA 1QYVA 4F5DA 3UT6A 1OD6A 1NX6A 4FR5A 1WULS 2R1UA 4MW1A 4WESB 4XDGA 2F3SA 5KIAA 3OOCA 3IGFA 3M9WA 3NDPA 3Q3EA 3ZDQA 4MIKA 4J91A 5A5EA 4PCAA 4WESA 5EFZA 1E7RA 2WWGA 5AP9A 3RQIA 4WINA 1MB0A 2O23A 3DCYA 1CE8B 3CG4A 1RI2A 3CCFA 3KE8A 1ZX1A 1Y6GA 2X53S 2RK3A 3QW2A 4MDEA 1GR0A 2ZRDA 4Y98A 1H2AS 1XCJA 3A36A 5K0EA 4ZYWA 4TYNA 1UPXA 3PR1A 1CE8A 2NGRA 1BCRB 3ZKAA 1FU7A 3PYMA 4ZRMA 4D0GA 1NBAA 4WZKA 1IUNA 4KUEA 4X95A 1R9MA 2GRUA 1R66A 2FSGA 5LDHA 1O95A 3PIIA 3TDNA 1BCRA 1N8TA 3KKEA 2OA0A 3ZW9A 3ED5A 4HSEA 2ZETA 4QVJA 1C1YA 2JIZA 3CEPB 4AKEA 4LNHA 3CNEA 1G6Q1 4XZ3A 1J42A 2QVZX 2OGWA 4GC9A 1THGA 1V0JA 1XZMA 3QU4A 5DHSA 2M6KA 3CLSC 3MM4A 4DDVA 3IB3A 3QU2A 2GETA 1C0EA 1HORA 2XUDA 4R3WA 4YP5A 1X7YB 1XFAA 4DMFA 5FBVB 1YS7A 1D04A 2DWUA 2OM2A 5AK4A 3BWYA 4IXTA 1J1IA 1Z56C 2A9JA 2AF4C 2ZUCA 1X7YA 3N07A 5DX0A 1N6RA 4DXHA 4HDMB 1B0PA 2UYCA 2XGGA 4DADA 2V3WA 2VS1A 3KQLA 5JV5A 3UQYS 4F7WA 2YHSA 2GZAA 4HDMA 2EW1A 1IOWA 1KL7A 4TTSA 3DLTA 4KQGA 3OEWA 3UWSA 3T3GA 4E6PA 4F2HA 2NYAA 3FMVA 1KZGB 1GZHB 1JR4A 4AN0A 2V55B 2ZRLA 2XQVA 2QTCA 5DHPA 3AKCA 1RZVA 3WQBA 1HVXA 4MTLA 4URFA 2C31A 3B36A 4F5YA 4D98A 4R83A 5DHUA 4C0AC 1JV2B 1RLTA 4MA0A 2PMFA 1QSGA 1TUEA 1DS6A 2C82A 5JD6A 2F1OA 4OJTA 3NC0C 4QATA 4RKRA 4DLBA 3VYVA 1OZ0A 1SELA 2ZWMA 3DP9A 3ZHBA 5FTJA 3IP1A 2OO5C 2OFOA 2JIDA 5EESA 5IKPA 2FMTA 4ZT7A 4M60A 1ZMOA 3T53B 1KJWA 4OFWA 2V1XA 3BSFA 1JTFA 1DBIA 4H7PA 1IOLA 4L1KA 2BFFB 2EARA 3M33A 2M32A 1ADGA 4OL0A 3CX6A 1JTEA 5B3AA 3R7SA 2Q49A 2Q9UA 3HA2A 3EODA 2BFFA 4I5IA 1JF8A 7REQB 4WQMA 3ONUA 1E94E 1SQ6A 1XQBA 1SVUA 1US8B 3D2BA 3IUNA 3VV3A 4A0GA 1KR5A 2FPXA 2NZVG 1THTA 3QM1A 4CV1A 1GRNA 1ZM7A 2WUEA 2FETA 3AOEA 3PE4A 1O9BA 1QIIA 7REQA 2EYUA 1US8A 3CUTA 3D26A 1GGKA 1H5NA 5I01A 2LCIA 3BRQA 4NG4A 4KLAA 1TAHA 3RI3A 1M5TA 4AT1A 4TLAA 1N3LA 2WHYA 1HMYA 1YC5A 3WLEA 4CMJA 2Q6LA 2WLSA 1AKVA 3STYA 5LZ8A 1XTZA 2H1WA 1NSFA 4R16A 1U8XX 3IEMA 1F8GA 3LUCA 4PBRA 4ZEOA 1JAYA 4A4DA 3ZVKA 1GZ7A 4G9GA 3RAJA 1F0PA 3I9LA 1M2OB 4K86A 4UVEA 2VZ9A 3N0WA 4BIIA 2HMAA 1GQFA 1SM4A 2HPZA 4PHFA 4QPCA 1M2OA 1UJ6A 3EBOA 1Z26A 2KB0A 3JWIA 2CHQA 3LDUA 4G01B 4JJKA 2HU5A 4CI0B 2ZWOA 4GYWA 4KAJA 1FW6A 1MT3A 3QITA 5DNVA 3TUIC 5IM4A 2PMDA 1NRIA 1HL3A 1TGYA 3HU5A 3KEMA 4TKMA 4ARVA 4CU2A 3FJOA 2DFPA 5DS0A 4GMKA 3I55B 4AZTA 5IAKA 1L4HA 2G4LA 2NTJA 5FPHA 3JCZA 1NUUA 5JMWA 2XUFA 2OG2A 4IX9A 2P35A 3GJ7A 1P7ZA 4MKRA 3VDXA 1IN6A 1L4FA 1BD3A 1T1EA 2X2EA 2VWGA 2YQZA 3LVRE 1YDGA 2BKEA 2WE7A 3EGOA 4ZCSA 5GPBA 3VR4D 3SHOA 4G8DA 5F2OA 3VKHA 3T0GA 4HGQA 3I23A 1A82A 3W5UA 1T6NA 1J8FA 1GL6A 2VG8A 3AVQA 4IDCA 5CLHA 3DZKA 4Y2UA 4C1NA 3CD6B 2CZCA 5DEIA 3JYPA 4BMOB 3V8PA 4KO1S 1TFRA 3S2YA 2O2SA 4WA8A 4TWBA 3QFFA 2QTNA 4DUYB 2FK7A 4MAFA 5KSOA 4EGAA 2GZ1A 1D6NA 4HRAA 1U7PA 4JJFA 1J56A 7MHTA 3PA1A 4DIUA 2NU8A 1E62A 4D41A 5LXTB 5JVDF 5EQFA 5CVVA 2X76A 1QYRA 4EKIA 1X9IA 3LUJA 1OA1A 3B6KA 2IE8A 2FZGA 2GCNA 2QL7A 3FOBA 3GI1A 4TMKA 5ALRA 3L7BA 4BMSA 5LXTA 2Y1FA 1MA3A 5IDXA 4LZPA 1T9GS 2GA8A 3TNJA 3I28A 3NR2A 4HKTA 2R1TB 4PFKA 2JGIA 5EQTA 4R2XA 4TGLA 3ND6A 1XZIA 3AETB 4OQPA 1VKJA 1E7YA 3PC6A 2WPNA 2D5BA 1DRWA 3DZIA 3F6SA 2R1TA 4G41A 4TS9A 4WVFA 1NJFA 5EHZA 3LYLA 4FYWA 2IXBA 2C8JA 3AETA 4KXVA 5A3SA 1YQDA 2WF5A 3RTGA 2BFPA 3HKCB 1TJPB 2BAGA 3QTLA 1D2RA 1H2RS 3PK0A 3NBZC 4UAUA 1K6XA 3M9LA 1L5LA 2QTFA 2EZ9A 3LQ1A 3G2PA 2YWBA 3ZWOA 2A0UA 4C7JA 4J2TA 3KWJA 4B73A 3GNLA 3ZHQA 3ISXA 4HYYA 2PMCA 5B36A 1HR0B 1GAEO 3NG1A 4JLPA 621PA 4QDOA 3WTBA 3PQ7A 4Q1BA 5B3LA 1VKNA 2Q5OA 1Z5GA 4QICA 3SIPA 1LK5A 1U8CB 3H2HA 3A4IA 1IHUA 4Y1FA 5IBCA 1LDGA 4QL3A 4G36A 1Y5LA 4UZEA 1U2EA 1WZNA 4N7JA 5FOXA 5DXAA 1MX1A 3WMXA 4PLTA 4B4OA 1JIIA 4DSTA 4YUZA 2VH2A 4DSZA 4BHTA 1V8FA 3DDSA 5H82A 2UZ0A 4YV1A 3NXKA 2IUSA 2WIAA 1NV8A 5BSMA 2P2DA 1GLGA 1PR2A 4Q3LA 1BSVA 1GGMA 3NYRA 2GZMA 4KZKA 3W90A 4PINA 4LZAA 1BMQA 4JI5B 4U9UA 1M2VB 1FNDA 3WQZA 1EBBA 1QAQA 1EDDA 1YONA 2ZT5A 1W59A 3NX4A 1OXVA 4I9GA 3VHLB 2ZBPA 3L7NA 4UCFA 4R8KA 3RC8A 2YMLA 2BC9A 1HC7A 3C7TA 1M2VA 3Q3AA 1TF7A 2O52A 2XB6A 1G8SA 1K0UA 4FZVA 4GPAA 4W7HA 2FZVA 3VKUA 1C9NA 3C8ZA 5D2CA 2YJTD 4ZHQB 1N0UA 3QFCA 3AVTA 2OOSA 2QB5A 5KSYA 1P3JA 3QGMA 5ITZB 1KBQA 1EXDA 4ZHQA 3DEJA 1XQ1A 4ZD6A 3V7FA 5M7EA 2XYPA 1NOIA 1Y5MA 3ZKWA 1KFBB 2Z8YM 5ITZA 4FSDA 3W8DA 2XE6A 1GA4A 1S6YA 2AN4A 2X9QA 4IDFA 3BDAA 4UVIA 3MCUA 4QOIA 3C1OA 3ORYA 3AEKB 3X1DA 2EGHA 2W37A 3DM5A 4HRYA 4YMHA 1G8JA 4C6RA 3AZOA 4FMDB 5DXFA 1VE5A 4WY2A 2PSSA 4HEJA 4LV8B 3AEKA 3AR4A 1UJMA 1JJ7A 2FN3A 2R6FA 2AE2A 4CR8A 4NU5A 4FM9A 1CNFA 3A9WA 3H9UA 1TA9A 4KFCA 1MW9X 4C21A 4XNFA 4JU9A 2A78A 1N1EA 4BU1A 2GO1A 4Z3KA 5A5VA 4XQGA 4HNTA 4NEGA 1SZPA 3KXLA 5EKUA 3R09A 2Q27A 3FNRA 1O5OA 3QWAA 4JQCA 3T1VA 3WAJA 3HCDA 1NJGA 3VNBA 3QLEA 2Y27A 2HY7A 4L5BA 3GQVA 1QYDA 2GYYA 3WDMA 4E13A 4ZGGA 1IWPB 5HWSA 4Q93A 3A70A 3PD1A 3AEYA 3C3PA 3WYDA 1PJ5A 1KXZA 1T5DX 4IY1A 5ABPA 1N7HA 2QZPA 3ED1A 3KB1A 2CFSA 3F97A 4BFZA 1KTVA 1GGHA 4OU4A 5EJEA 4WD3A 1TA0A 3DTYA 1OH6A 4TKVB 3WMWA 2NNWB 3A6ZA 3F49S 4X85A 5GWXA 4Q3CA 4RS3A 1PJBA 4KB5A 2F67A 3KYBA 3KHUA 5E38A 2ZP1A 4O2BF 4ENPA 1A0OA 2LGJA 4Y2VA 1WLSA 4KLNA 2ZATA 4FXUA 1OWMA 1ZGBA 2OUKA 3IRVA 4E1VA 1YAJA 3OQPA 1UEXC 3ADPA 4OHZA 4E07A 3IAHA 1QOZA 3DBRB 3ZZ0A 1X9HA 1NASA 1WOSA 2FRXA 2GBIA 2ISCA 2OAQ1 1SZJG 1XRMA 2JAXA 3LKZA 4JVOA 2YWXA 4QWWA 1B0AA 1NMXA 1XCGB 3WDLA 3DBRA 4K28A 2PZ8A 2QZ4A 4MIEA 1EK5A 3M8KA 1R0ZA 3V6LA 2F9FA 1UJNA 4CN9A 1Z88A 4KPUA 4FFNA 5B57C 2Y0DA 5JNVA 1XU4A 4RV5A 1W46A 3DHNA 3MS4A 5C46F 2C0QA 2PKXA 3CTAA 2B69A 1VIDA 3OMXA 3L7YA 4CLEA 4M86A 1TZBA 1UMBB 1VJSA 1MR3F 3ZVLA 2QMZA 5LWHA 1P2VA 4N18A 3DVSX 3ZEAA 2IWHA 2G04A 3O1LA 4DAEA 1KQOA 1UPBA 5A7FA 5K0TA 4FVTA 5AJUA 1K3TA 4QOSA 1IDN1 1L2TA 1UMBA 3KALA 4EWLA 4JOQA 2ZTLA 1QO0D 2GD2A 1DJNA 4MEAA 4PAQA 3HCOA 1YIJB 3LX4A 4MP8A 2W42A 3ZE0B 2GPJA 1H8HA 2JASA 3GV0A 3PJFA 2IZ6A 4FR0A 1A9RA 2V7QA 1F9AA 3DTVB 4CUZA 4CTOA 4E70A 3VR2A 4MMYB 1AKYA 1YOBA 5IN4A 3GIWA 3O4VA 1IJEA 1SRQA 2B1JA 5EJIA 3TMYA 2V6MA 2ZJFA 2ZB2A 3DTVA 4GZMA 2BBOA 4W1QA 4BMYA 4CV3A 4V24A 2HRZA 4CLOA 4FNGA 5IYNA 2HRBA 4Q9KA 3GFRA 3PT5A 1QB8A 4MUAA 3GBVA 3TGLA 3LX5A 4XVRA 4QVGA 1X1QA 1GCUA 4U9HS 3QVTA 2K2WA 3HYRA 4FUQA 3R9IA 1X7WB 2C5AA 2H9AA 4FCVA 5K8TA 3CEJA 3UMSA 3EBLA 1QTRA 4W5OA 3F3YA 3KZNA 1ZESA 4JI3B 3K6SA 1GNVA 1X7WA 2J6HA 1FYEA 3BPSA 1PGQA 5G1OA 2BELA 1ZM9A 2CNLA 2WSSA 2BUAA 2FDXA 2JFVA 4P0TA 1ENOA 5CT5A 5FOTA 3ABZA 2OPHA 3MF4A 1ISIA 1E89A 1ATZA 3BXHA 3GJSA 2QJRA 4IJVA 2VZ8A 3ABSB 3FZEA 5CURA 3TK1A 1SIOA 3HB5X 3T1TA 1B8VA 1ZZGA 3RQSA 4EFKA 1UAGA 2PT9A 3UNXA 1VG8A 3AR5A 4L5CA 3DDUA 2HQRA 4WXEA 4ARSA 1OLOA 2Z6AA 4MYDA 1KSHA 2VJDA 2XPCA 5BYBA 2JFHA 1E99A 4J7AA 4LSZA 1O08A 1BDMA 1R6XA 3LPAA 1Z7EA 1QFJA 1S96A 3MTQA 3O9VA 4CV2A 4M1ZA 5EEHA 1JA0A 1QE5A 3LF1A 4PO1A 4YP7A 1K9MD 1NIPA 3GDGA 1STOA 3AVUA 2Q46A 4LNAA 3Q3HA 2BRUA 3ZY5A 5SZHB 2JI8A 4NYIQ 2B25A 3HFRA 5AKGA 1MB4A 1Z9BA 3SYTA 3S68A 3GDFA 3QEBZ 3ASZA 3ESXA 1LQUA 3HBNA 5IZ4A 3C3EA 3IUMA 4JGIA 4L28A 5KSPA 3SVTA 5F9HA 4WK2B 2HXYA 1IATA 1VSQA 4I4TF 4MROA 4DNTB 1C0KA 1GGNA 4WJLA 3PRJA 2H1LA 5CVUA 2G07A 5FD8A 4DMRA 2JPDA 2I1WA 3KZVA 1M8PA 4AL4A 3DQZA 3EXHC 4QWMA 1HFEL 2UZ3A 3Q7RA 4JP8A 4LMRA 4GI1A 4DN6A 4UTPA 5J47A 4R3NA 2K5UA 2ADFA 2XKAA 3PNOA 1QHFA 4DNPA 1CIVA 5DT2A 5ECGC 1KDVA 3OD5A 3FDZB 3WDSA 2J30A 5LD2C 1NWCA 1Q7YD 1KEVA 2IIPA 3AVYA 2O5RA 4RIHA 4S05A 2R65A 3OCVA 2YINC 1X42A 16PKA 3A04A 2O3TA 3X1XA 5I9NA 3JSAA 2HC9A 2IFTA 2WYVA 5GAJA 1K2VN 2OCGA 3QJYA 1Y6FA 4NJEB 5KTRA 2DFKB 3D5TA 1YT5A 1E3JA 1T4CB 2J09A 2WNIA 1PS0A 1G3UA 2HRDA 3IAFA 3PR3A 3QYAA 5FQOA 3WL5A 4M0UA 4V2UA 1JJIA 3ZHTA 2CY0A 1EBUA 1YU6A 2G77B 4FQ5A 5BWBA 1DADA 1ID1A 2EKDA 1IRXA 1Y4DE 2QRJA 4R2JA 5LNK6 3ZIDA 3AUKA 3RKRA 1TEXA 2VCEA 1GFWA 3F47A 3BCRA 3RY8A 3PDWA 2C3UA 2OQVA 4GICA 4OX9B 3SZ3A 5CH8A 1D2EA 1Q6YA 3A6EA 4I1OA 5LN1A 3EGCA 3B1XA 4AURA 4ROTA 3FTFA 5D5PA 4AP9A 3EUWA 3TLMA 2ZAIA 4RZSA 4Y30A 4DR3B 2BI7A 4ZVUA 1KS2A 3OU6A 1P6UA 3R0QA 3E3MA 1J24A 1M2GA 5FNVB 4LJRA 4W9NC 1URPA 1Y3DE 3L18A 3K71B 2QRKA 3B9PA 1H9CA 2Z6BD 1HUQA 4X7DA 1T1GA 3AHJA 4PN3A 5FNVA 1S1MA 4Q3KA 1J8QA 1VE6A 1TM7E 1ZH0A 1KWGA 2VK4A 3BJMA 4WNIA 2A3RA 1YS1X 4E6EA 1JR2A 3T51B 1MORA 1UZUA 2G17A 4YCMA 2C4MA 4KXXA 1MQAA 3WA6A 2Q1UA 1DBRA 1V2HE 3QE2A 3INRA 3WP0A 3B38A 5C81A 1HLDA 1S89A 1NQVA 3N2IA 2C5HA 2YOHA 3DXZA 3KZXA 4L9SA 4OGFA 5I9IA 1XK7A 4YR9A 3L4EA 1PEDA 3BD9A 5KTPA 4LOHA 1J7JA 3KSZO 2CMGA 2PGAA 1L7NA 1KPIA 3C8MA 1L7OA 4KH0A 4XM2A 4BZWA 4LF7B 2H4FA 1O54A 2HIMA 3ON5A 4E4RA 3R6DA 2ZI3A 3ABRB 4IEFB 5BT8A 4N7RA 4Z4HA 3L7DA 1GNPA 4MUYA 1EVZA 2WHQA 3EMKA 5HZBA 2AJBA 3OF3A 4G5OA 3K0EA 4PZDA 3VNAA 1JH9A 1QCDA 4JITA 2FZ4A 1MH1A 1NN3A 2VXBA 3LECA 3LOUA 3QI2A 2MCFA 5LVAA 1GL7A 4KR9A 4PYQA 3WKCA 1QZ3A 4AVZA 1XVIA 5C5CA 3IFSA 3MYRA 4B45A 4TWJA 1SR8A 2ZQYA 1NKTA 4OOVA 3ORSA 4HADA 5DYYA 5LOVF 3OF5A 1R2QA 1YZKA 3WYBA 2B94A 4UTXA 5DLDA 3V2GA 2JJ1D 1TVCA 1RYBA 1YVUA 4B4UA 4EI8A 4U1RA 1OYOA 5K4HA 4GOKA 3OURA 1U2PA 3C4QA 2UDPA 4A27A 5BMOA 5KOHB 5C8ZA 1ODLA 3NGMA 3ROFA 1MW8X 1Z74A 5HJ5A 1TU0A 1U7WA 3RYFB 1DX4A 3W9BA 4ZP1A 3ZI7A 5AVXA 2YASA 2X5OA 4LWOA 4U5XA 2Z2IA 4ADSG 3LKDA 1AQJA 3OTWA 2PYDA 4NZZA 4L0MA 3AWDA 1XEXB 3DBHB 4WHMA 3RYFA 1SQSA 3NDIA 4DV5B 3B1KA 3PNMA 1A71A 2V6FA 1CPYA 5DYIA 2WMOB 4TZ0A 2PCJA 5AQEA 1E1QA 1XEXA 3DBHA 1K7YA 4YRPA 1GVNB 1GPMA 2JA2A 1X1SA 3OY2A 1KK2A 2Q3HA 4I5EA 3QV2A 3WQHA 1YXMA 1UADA 1WQ1R 4EG0A 4H7FA 2CMKA 2QM7A 4NQRA 1NJ6A 1NRWA 2WTEA 4XI9A 4DIOA 5L95A 2IX3A 4M7OA 2QLJA 3ZCTA 4B31A 1X1RA 4HEA6 1N2JA 4PLYA 1OI3A 4XLZA 3U3OA 1MBZA 4I4IA 3DDYA 4Q7JB 2ZE5A 4Z86A 2AW5A 2CL6X 2BY4A 5IVKA 2H16A 2XDQB 4BXOA 4W5NA 3BBPA 1KEEB 2CNDA 1NQOA 1YVDA 3LK7A 4UVHA 1DAMA 1O95C 4JBIA 2XDQA 4M0EA 3RS3A 4A2WA 5FBZA 4BP9A 5LR6A 1KEEA 1KEWA 2Y99A 5TT1A 3NGXA 1O3YA 3N7TA 1QK5A 1R0YA 2VWQA 5HQ3B 1N06A 1W87A 2D3NA 4U6SA 4A8JB 5BWCA 3D0RA 4EH1A 1TAGA 3GGPA 1R0RE 3DE3X 4QDKA 2X5XA 4PGOA 3AF6A 1Z0IA 5ALKA 4OMUA 2I66A 3MT9A 1NBHA 4JNKA 4A8JA 5HQ3A 5IT0A 3SCZA 1NNI1 5DM2A 4HVCA 4F4IA 5IKEA 2UXBB 2AFVA 2Z8YA 5CFLA 4UHFA 1CY6A 1ZXLA 4OATA 5MFPA 3HMKA 1S8AA 3FBGA 1UFQA 1LK7A 2W6ZA 3LBFA 4RMNA 1BLIA 1RFGE 3E81A 3U7EB 3SICE 2C20A 2JDID 4EECA 2TMYA 2BUBA 4EMBA 3P9SA 2W2OA 5CXQA 5EL0A 3KBBA 5KBYA 5FUVA 3F5SA 1DFHA 1GQ2A 1P1HA 2PU5A 5AKHA 1D3AA 3A2MA 4Z3OA 3ZG6A 5KO2A 4LOIA 2G83A 4HWSA 3UMMA 2CJYA 4URZR 1ZZEA 1CF4A 1QLWA 1CRWG 4IL5A 3TCXB 3HU1A 3V1KA 3GLIB 1ICEA 2ZJ2A 1XFDA 3DAFA 4JLAA 2IWRA 4KBGA 5A62A 4I08A 4BAZA 2X85A 5IVPA 3EE6A 3DTTA 3GLIA 5CM9C 4AY6A 1MO6A 3I92A 1ESCA 4FBMA 1KOJA 1U9CA 2VSQA 4V0MA 4R2LA 2FPWA 5IJ9A 2C5SA 1HZEA 3MJSA 1FTQA 4ER3A 1JHRA 2F2TA 2QSUA 3AEZA 3MUNA 5F3WB 3PEWA 2IYQA 5BWLA 5HIAA 1XRLA 4HDRB 4P84A 4PM4A 1TW3A 1IBKB 2H52A 4G0OA 2A5YB 3M4XA 3W7BA 2XCUA 4HDRA 3DOIA 4Z0NA 1CRQA 1PJ6A 1NPTO 4RPHA 3AOEC 1LPPA 3ZGOA 3SJ7A 4KGXA 4D8TA 4WCDA 1JI0A 3PR2B 3I37X 3E7FA 2C2BA 2R5NA 1J5XA 2ZWVA 3VU9B 1GZ3A 4OQQA 4OHPA 3G4SB 1ZVQA 2UUCB 1RI4A 4X7RA 2R4UA 4L27A 4DYHA 3VC7A 3VU9A 5JMTA 4UUQA 2XYRA 1SUIA 1YGPA 2H63A 3O8QA 1FMFA 2DOGA 3DT8A 5EZ5A 4ZT3A 3DEAA 3C6YA 4BX0A 4LE1A 3TEMA 4AY2A 4QFCA 3KZOA 1P2DA 3OQJA 2IHJA 1NYRA 4JB2A 3DMHA 4O5OA 5C8DA 1V3VA 1UUFA 3RHFA 2ONKA 3EZ7A 5DP2A 1QVVA 2ASEA 2HDOA 5ER9A 4MZDA 3T7AA 2Q3CA 1VL2A 1KAOA 5CVEA 2CV0A 2QYOA 5K4GA 5CA0F 3MS7A 3L7CA 2H54A 1RM5A 2ODNA 3KOMA 3L1KA 4PGGA 4QODA 3TSAA 5BY2A 1USIA 2Q4BA 4CGZA 1HX7A 1SQ5A 3NVDA 1KI8A 2G5TA 2OHIA 1GUAA 2YN2A 1SUPA 1CLUA 4QRDA 1TIPA 4QDUA 4YQFA 3M82A 1BNCA 4MJLA 5B7NA 1Q92A 3G79A 3FTEA 2D5CA 3SQXA 1FDWA 2XOKD 1N05A 4ZDIA 1ZOOA 1N4AA 4Z4GA 3VYWA 4HMPA 2BM9A 1XMOB 4P9NA 1JJBA 1GFZA 3E27A 2NZUG 2V7VA 3GD5A 1WXWA 2NSDA 1Y4UA 3GVJA 3OA2A 3PHJA 4PAGA 7GPBA 2REXB 2GOYA 1TLTA 1E3TA 2WDPA 3ELYA 4DY4A 2BEWB 4K6CA 4DEXA 2QUBA 2YN0A 2ZKLA 3I1JA 2J9XB 4YLEA 3RIXA 2IYZA 4BNHA 2ZWAA 3RARA 3HKEB 4OXYA 4GUDA 3QFSA 3TZHA 2BEWA 1P7PA 1P3Y1 2OWDA 3I9V1 4K6FA 5K6AA 1TTTA 2VQ3A 4S2EA 1QQ5A 1GYRA 3HKEA 5FLKA 1M10A 4FFPA 1N2CE 3E2IA 5DPMA 4N9QA 4D44A 1ZM4A 2YIVX 1T8PA 3NCTA 4TKOB 4B71A 4HDKB 5ALUA 2YHIB 2VP2A 3UUEA 1QORA 2QT0A 2J48A 4RSGA 1AKNA 1IHMA 2Q6IA 1UXIA 3B9RA 4HDKA 1A4XA 2ECPA 2X6TA 3RWOA 3TUJC 1F20A 1YHNA 2HUNA 3B5JA 1PNRA 1JAZA 1RP1A 4UPVA 1UC5B 3DLPX 3ETHA 1T5LA 1UKZA 3G9ZA 4BB5A 4NL4H 4Q7EA 1I36A 3FCAA 5DHTA 4D79A 2CXTA 4ESVA 4TLBA 5IEJA 3CRQA 2XDAA 4KGDA 4KQMA 4RETA 2OCIA 2OWEA 1IXRC 2WUFA 1J70A 2FN8A 3CSUA 3GVXA 3IUSA 1N7GA 2MOKA 4B46A 4B6QA 1P0IA 1ISPA 3Q6MA 4F9FA 5JYCA 3H8WA 4RPIA 3RBAA 1AY0A 4G1CA 1SULA 2XB8A 1BJRE 2HJVA 2VHUA 3KDSE 2PEZA 2X7XA 5K9ZA 2D4AA 1GPLA 3IXQA 5EIAA 4O8CA 4TSRA 4P33A 2BR4A 3G5LA 1TKCA 2EKZA 3AC0A 2QRZA 4OQZA 3AY7A 1P62B 4TVBA 2YYAA 4ZZIA 3RF7A 1N9ZA 5ETJA 4IEIA 2HLNA 3MJ4A 1RQLA 4YUVA 2DR3A 1ABFA 3TKAA 3IEVA 2OCBA 2Z09A 2AX4A 2L2QA 3W4KA 2FA9A 3W77A 3I5XA 1E9SA 3TD2A 1GDDA 4GEKA 3M6AA 2D3WA 3LXXA 3ONYA 1F12A 2K7ZA 1L9XA 5ARCA 3RJ5A 2HDWA 4NMXB 5JR3A 1Z4MA 2Y9PB 1GQQA 1LI4A 3B6EA 3H9BA 3KT6A 3C43A 4KQFA 5EJAA 1UOOA 3GW8A 3OTOB 1B6RA 5TV2A 2QA5A 5J1SB 2ZR7A 4D97A 1C9EA 4M1QA 5FAKA 1DCFA 3NM6B 4N8SA 2EFCB 3JQ8B 2HHHB 4F3TA 5IJWA 1HT2E 3G23A 3P2IA 2PMEA 1N92A 2A5GA 3GGJA 1Q0TA 1YCDA 1JW9B 3JQ8A 3BFPA 1YJBA 2JKVA 4NENB 5KMGB 2Q50A 3JD3A 5NULA 1BKYA 7MDHA 2F9LA 4KXNA 1E18A 1KI3A 1NF9A 1Q1NA 4NENA 1QS0B 4LI0A 1XYGA 4MXDA 1VB3A 2ONYA 2CC2A 2P9FA 2I0FA 1XQXA 1OI4A 4JUAA 4N9WA 3T3MB 3AF5A 4S35A 4X71A 4D3YA 4GXRA 1QS0A 1N5JA 2XA2A 3GLFB 2JI9A 3ZW8A 1NXXA 2R8EA 5CVCA 3CXRA 4KDEA 4QQ8A 1ULAA 1ZGGA 3RSOA 3WJ7A 1M6YA 4FI3C 5JPCA 3GLFA 1NMYA 1QHSA 4C2UA 3S6JA 2NAFA 1XU9A 2IXGA 3C4JA 3ID6C 4INOA 1PWHA 3OJFA 4P7BA 3WLLA 4UTNA 1UD6A 1CEQA 1EB9A 4IHJF 3SMVA 4UATA 1KRHA 3FE2A 2FF5A 1EWQA 3KJZA 3MT0A 4C3OB 3MNFA 1PJLA 2B8TA 1XTSA 5CR9A 3M5WA 4N82A 3JVUA 4QDJA 4OLHA 3JAWB 3SSNA 1JHPA 4XASA 1NXPA 1M9NA 3VGPA 4B87A 4JYZA 3IAM6 4QDXA 1RC8A 4G4SP 1OWNA 1U4NA 2BI4A 5I7HA 3JAWA 4ARCA 3DM9B 3A3PA 5AVOA 3OU2A 1UT5A 1VSBA 3KIPA 3RVSA 2WMNB 2FR0A 2X4GA 4ZI3A 4CF3A 3W5JA 2PLNA 2O3SA 4K26A 5EJMA 2ZIUB 3H2YA 3MG9A 2V4DA 3VOAA 1SZCA 1YCFA 1A4IA 2ZRAA 1PYOA 3Q5GA 4RGQA 3HO8A 4KQXA 3SJUA 3GFGA 1VA4A 3PF9A 2ZAMA 1JR6A 1U0JA 3UUFA 1AA9A 2CNWD 1DO0A 2ORVA 4RH0A 4KIWA 1K73D 3DDWA 1YRWA 1DP4A 3ETGA 5ERYA 4F3CA 1M66A 1NRXA 3KPWA 2VYND 3GUYA 1LWNA 5GJCA 3RFTA 5DB4A 4J0QA 1XO1A 3W2TA 1A9TA 1PHRA 1KNQA 5EYPA 1TNDA 3A2KA 1T43A 2ISSD 4PLGA 5M3BA 1HURA 4EDFA 3EZXA 2D1FA 1SG9A 1KZYC 3E0XA 3Q38A 1I3KA 1IUOA 1GKYA 3V80A 3K8QA 3LLUA 4EW6A 4ZVLA 3ROGA 1R0BA 1NW8A 5KHOC 1DEKA 1KH2A 4G8CA 4UM9B 1D0SA 1B2RA 1DRUA 2R8YA 3ND8A 4UTOA 4UUPA 3TI7A 1BPLA 3IBYA 3SM9A 3EASA 2J87A 2RBEA 3OZIA 4ZJYA 2A9RA 5F7XA 2GERA 1TPYA 2H65A 2FN9A 5KOIA 3R7WB 4Q4HB 1ZO8A 1W8IA 4DA6A 5JQGF 5AYVA 4YX9A 2XSZA 4MW0A 3A6KA 4FMPA 4PYLA 3WFJA 3JQAD 1UCFA 2R1ZA 5JAOA 3R7WA 4Q4HA 3NM5A 3E82A 4F85A 1J6UA 1FOEB 1N6KA 4OOEA 3ZU2A 2AKEA 1JI3A 1VL5A 4RXMA 1A9SA 1A9XB 2XE4A 3GZ4A 4RTNA 2AD5A 2WY2D 2HCTA 3U0VA 3VJKA 3PYXA 2PIDA 3DE0X 2JAQA 5ALWA 3PSHA 4KIJA 1QO7A 2XEXA 2X8LA 1Q20A 4CKXA 1GCOA 4M1WA 1IMOA 2VT6A 4UVGA 2ZVQX 4EFMA 1XTRA 3ETJA 3C3WA 5MF6A 2ORED 3A9SA 2YVAA 5BN5B 3RGGA 5JEEA 4UC0A 4FB4A 2ASVA 2I29A 1NY6A 4CQMD 4LBWA 2FG6C 1VJ0A 5E7JA 4BKUA 1DAGA 4OQLA 1PFGA 2A1UB 2XCTB 4P6YA 5BN5A 1MVLA 5JYEA 1T6ZA 1X39A 1HTTA 1LC3A 1RAFA 1VLZA 1EUZA 2V45A 3VKVA 4R31A 2A1UA 2Z2YA 1JBEA 4IUDS 2GTPA 3JZMA 3PHHA 1XQ9A 2PO7A 4KV7A 3BWCA 3ZXXA 4RBNA 1E3SA 3E0QA 3X3HA 5J35A 1KFKB 1U7TA 3BHMA 3H83A 1GCIA 1CG6A 1YB4A 4M9XA 2ACVA 4XIFA 4XQ9A 1IH8A 2H57A 2GPSA 2PY6A 4CM9D 1J5EB 2QVBA 1GO2A 3KLBA 3MB5A 3Q3VA 1P2TA 3M1LA 3KZKA 1IE3A 3IT0A 4POAA 4XLLA 3FZNA 5KJCA 1E0DA 4XX0B 1RI5A 2Y3IA 3CKMA 2OCAA 1RLMA 3OSUA 3R3JA 3SK0A 1Y9JA 2I8CA 2QA4B 3JD2A 3FXAA 3L93A 3OU7A 3CF4G 4LXUA 4RCZA 3KQPA 3PQDA 3UFXB 4XX0A 2CF6A 3AP2A 5A8AA 1OGYA 2VP4A 2YV3A 5ER6A 1Q1GA 4ND7A 4S24A 4BEVA 4IOJA 1BHQ1 1CR0A 4FN5A 3P71T 4EY8A 2G70A 3OOWA 3UFXA 2PRIA 4C4SA 3GMIA 3WNVA 2A1IA 1Z2OX 1YL7A 3IH5A 4TMTA 4LRTB 5HQJA 1AD2A 3BUSA 4YRTA 5AHRA 4PO9A 5EGNA 1PEYA 2WR8A 4KPEC 5IN5A 2R47A 1AQUA 1DEXA 1JDPA 4ISCA 4D9MA 4NU0A 2ZOSA 2GK6A 4YRLA 3OW2B 1YJ9B 1GGEA 4CYMA 4JY7A 3U9TA 4Z1OA 2Y1LA 3ZJVA 3QOWA 2BRUC 2RK6A 3QPCA 4P3YA 1PKEA 2HJRA 3OESA 1OW3B 2I2XB 4B5KA 2QN7A 3RO7A 2ZUFA 1MEOA 4HQNA 1LC0A 2X22A 3W5SA 2VUUA 4MRVA 5FUBA 3V6MA 4W6ZA 4BNLA 3MMPA 1VBFA 1Y8CA 5K01A 4PIMA 2C2OA 2OSVA 2COUA 1LI5A 4GX0A 4DPKA 5LWQA 4P9SA 3C5EA 2WJ4A 2XYHA 3QLJA 5BUQA 1ULTA 2C5EA 5LQMA 2D2VA 4PX3A 1PQYA 1IZZA 2LBPA 3OD1A 1S8FA 4QJBA 5DYNA 1JHVA 4RDJA 1USWA 1BYUA 2I6SA 2FG5A 2G7MC 2ZR8A 4G4JA 4PNZA 3X1MA 2PT5A 4CM7A 1BWSA 1C9JA 1CZRA 3LGSA 2ZRGA 4BNJA 3HL4A 4OI1A 1G16A 5A04A 1JNYA 5A71A 1GR1A 1C8LA 2AEMA 1ZI6A 5AXBA 4FHFA 2FPLA 4C0LA 1Z63A 1DKOA 1KOFA 5KVVA 2CE7A 3AJAA 1JAXA 3BL8A 4WOPA 1XQYA 1U81A 2DHQA 2FQ1A 3HL0A 1OB0A 5I7SA 3U2QA 4IICA 4HE6A 1YBVA 3CEAA 1EM8B 1XTJA 2OHXA 2R751 3DGFC 4OY3A 1II0A 1ULZA 2FOIA 1V0EA 2WU4A 1OH5A 1KZLA 3FETA 4QUIA 3SYRA 1S9DA 2GQ0A 1EWVA 2PUTA 5CFNA 1E8DA 1EM8A 2JJQA 2X6YA 1BA3A 2H3HA 3GHHA 3GLHB 3O2SB 1QU3A 1FJ2A 3FZYA 5A5GA 3EZ2A 2PZGA 3SZOA 1W4ZA 3KEQA 1ADBA 2H17A 2QR2A 4EY4A 2CHGA 3GLHA 4TMVA 3GWZA 3JWGA 4I1VA 3USES 1XZHA 1R6TA 4K9QA 7YASA 1PQPA 4YHBA 1HSZA 5AVRA 2LP4Y 4CHTA 4ZDKA 1TQDA 1FMLA 4EGFA 3FM9A 4EI7A 2AJCA 2Y1KA 5J43A 2HA2A 2G88A 5GVRA 2W2LA 5A3JA 2FRVA 1C7EA 3B48A 4UU1A 3L4JA 2R6R1 1SU6A 3F9RA 2CHUA 2HPVA 5HDQA 1YL5A 2QN9A 3ESYA 2QZZA 2DT8A 1D2CA 1JFLA 4LXXA 3KAQA 2QX8A 5EKTA 4JI1B 4CLHA 1UOEA 1U90A 2RH8A 4ENRA 3DC2A 4N03A 1L4GA 3OHPA 4W5HA 5CW2A 2PIAA 1C29B 1FDSA 1FFAA 1P9RA 1WABA 2HT6A 2V8BA 1Z0ZA 3VSEA 3MSCA 5IC4A 2O5EA 2XUZA 4OA5A 3W05A 2C1XA 1DELA 1ODKA 1KYQA 4ZAFA 4ZMBA 3SYMA 2BGLA 3ZCRA 4CIXA 5K8IA 4JXZA 1DT3A 3O4IA 4ZWNA 3NPAA 1J5PA 4L22A 3TW8B 1QKJA 2Q62A 2E0IA 2EZUA 4IOKA 4EF6A 1UJ5A 4LFBB 1W5TA 1HY3A 4EHFA 2XA1A 5C4GB 1XU7A 2IBMA 3TW8A 2A33A 2J0EA 2YXNA 1GUFA 1IDOA 3C0KA 1XUOA 2YFKA 4TT8A 3RFXA 2OTCA 1O6CA 5FI1B 4P98A 1QIJA 3PGJA 4K87A 3Q0TA 3CCMB 4XUDA 3TW4A 4D5EA 4RJIA 4MEBA 3WK8A 4L0DA 2AOWA 2RBGA 2P69A 5TNXA 4C0BA 1KPGA 1U3WA 4M8SA 2WF6A 1WHTB 5BNFA 4LRXA 1FUYB 4S1OA 3AKZA 2EX0A 2GYWA 3F9CA 1P8JA 2Y4OA 3IJ5A 4N5HX 1CUBA 4TVKA 4RZ2A 5BSRA 1A8HA 4JDPA 1MENA 1NJ5A 1QVWA 4WE3A 3TPCA 5A3QA 1Q2UA 1WHTA 2Q6VA 3CNNA 5FOQA 1GKLA 2JRCA 4EUFA 5KMGA 3I4LA 3TW6A 4FMCB 1R8JA 4MMXB 1W9MA 4Q3OA 4GS5A 5EGSA 3T3NA 1GVHA 1OXSC 4GYYA 1G8KA 1XKLA 4UPDA 1T0JB 3WA7A 1E1RD 2QUJA 5BRJA 5ENVA 4FFOA 1IY1A 4DLUA 3KQWA 1HKHA 1FTYA 4HJXA 3N05A 1L3IA 4GXTA 1P9LA 1EAMA 1ND5A 5JOQA 3WSWA 1G9TA 4NMHA 1N9GB 4E7OA 1J8VA 3FPGA 4GWKA 4OXXA 1MAAA 3P4UA 4KHPB 1SBCA 1N9GA 4E2ZA 4ZOCA 2B8WA 2ZXHA 2EKPA 3SYNA 4TROA 1V9LA 1A04A 2WJPA 2D0OB 4MW5A 3T9EA 1SKMA 2C2MA 3MCVA 4N0EA 1WPGA 4GKJB 3UJ3X 4KN5A 4G7XA 3ISJA 5H16A 3TIXB 3BQNB 1E58A 5BXQC 4X66B 2VO1A 5A3RA 1OV6A 2EBUA 4ZO6A 2CYAA 3AERB 3GLUA 5FA8A 2X14A 4B3XA 5DASA 3A4MA 4EPWA 4M2LA 3Q72A 3TINA 3IDFA 3IB6A 3AERA 3MN1A 4QAJA 1L0BA 1YI1A 3I45A 4JIMA 5ALHA 1QAMA 3I6MA 1NVXQ 4BWGA 4CKWA 1R5OA 2CXSA 5DNYB 4JV5B 1Y0BA 2M2IA 1KAGA 3ASPA 3SEZA 4DLNA 4EUSA 4DXDA 3NHFA 3IQXA 2P8SA 1C0PA 3OM9A 1WCYA 3RU9A 5BWMA 4BQPA 3ANLA 1PNOA 3D8HA 1SXIA 1G9XA 3PQ4A 3CLKA 3LFTA 1M7HA 1IEVA 4C4ZA 2D06A 4GPZA 1DAFA 1JVSA 3H0KA 4DJFC 1SXJB 1YKGA 4A8JC 4M46A 4DC0A 2VF7A 4OHCA 1ONOA 1Q21A 1XQ6A 2IY8A 2B8JA 2YZNA 5DTQA 1KDYA 2WWWA 2GHRA 1SXJA 1Y9DA 2XUGA 5FV4A 5EPUA 1NVVQ 4CIVA 3T3OA 2ECOA 1K28D 4CEIB 1YR3A 1YQ9A 4HNRA 3NTXA 3TL3A 1BFDA 3FOWA 4URXR 3MIIA 4ALIA 1IWBB 1AA6A 5HF9A 1JVBA 4CEIA 1T9HA 1HDOA 2UAGA 4FEGA 4X8LA 3VR3A 3O2QB 3TCKA 4F72A 4F8YA 3K94A 1Z4IA 3WWCA 3U4QB 5JJKA 3RG8A 2YZKA 2Z2KA 4WZ6A 2QNRA 2I1QA 3VC2A 1T34A 2JLSA 2V7EA 1FFEA 2QYTA 3H5WA 4JROA 5E9WA 1QVAA 4BLRA 3U4QA 4BPBA 4Z53A 3FWZA 2XNJA 4LJAA 2GMWA 2H5JA 1L4MA 1VC2A 3D6VA 2A5JA 3K9QO 2D2EA 5F1KA 4YV2A 2QT9A 3LUBA 3AUAA 5B58T 2QD1A 4MMZB 2YIMA 3L6OO 1N6OA 3WNCA 4DLRA 5KQPA 1WSDA 1T5OA 1XTTA 1G3MA 1RI3A 2CXXA 5GONF 4CETA 3CPWB 2XQGA 3HEAA 4JQZA 2NM0A 3DL2A 3I2IA 4Q6WA 2VSFA 4NCNA 4BFLA 1GGJA 1TZKA 4WZBB 3C6BA 5F51A 5AW0A 3OZAA 4I66A 3L49A 3VMMA 5L3SB 1ODTC 2MSCB 3HS3A 3P5BA 3BIOA 4MCIA 3NEYA 4N0PA 4WZBA 1XMXA 1VJTA 2PD4A 4YAOA 2GLTA 2INGX 4V0NA 2W4QA 1DC6A 5L3SA 4F5ZA 2FGJA 4Y7CA 1QDUA 2OO3A 1YDEA 3RVNA 4C0JA 2GPTA 5NLLA 3ZDBA 1EJ0A 1CWUA 4PR0A 2PFGA 1JIXA 3KZCA 4JR2A 5JNSA 2G09A 2B8EA 2IHYA 3BJRA 2FW9A 1WTCA 1M2EA 2ZJ8A 3KD2A 2XUHA 3LKBA 5AJVB 2XBMA 2VYFA 3UYLA 5I7RA 4LQLA 2CLHB 2PN1A 3CRVA 1EDEA 5I9SA 5J4VA 5LZ4A 3KQKA 3NI2A 5JWHA 1YF3A 1YDWA 2WK1A 2I7VA 5D7NA 3K73O 5DO9A 2FWRA 5J2UB 5F9FA 1CCWA 1M3SA 4P58A 1XZDA 5H7XA 5B37A 3S5UA 1ECLA 3K6SB 3RU3A 3AXTA 3UXHA 2IW3A 3KUXA 4YRJA 2QRGA 5IT9A 3W2GA 3I9FA 5J2UA 3QE4A 2QVGA 3G6WA 4QO8A 4BNIA 2H4YA 4NULA 2ZRCA 1EK1A 4G0QA 1ZJYA 1VQLB 3INNA 2F8SA 3RHZA 2BCGY 1NTOA 2WT4A 4WEOA 4Y2SA 1H8ED 3FTNA 3FUUA 3HRKA 4PXSA 1RBMA 5JFGA 3RRNA 1A9PA 4WFIA 3E5NA 3REFA 4AJEA 1B74A 3Q7QA 1ES9A 2C92A 5CB4F 3DMPA 3TH5A 1CFJA 1UBTS 4Z9BA 2ZTVA 3PPVA 2W2XA 3CXCB 4MS1B 4CFSA 4URHA 3LO8A 3A1SA 3LQ4A 4R1OA 1N5OX 3H1FA 3O73A 3WAGA 1T3HA 2UZ1B 1NW9B 1JIQA 1WDTA 1SHUX 4MS1A 5K0SA 3ZBTA 2RJ3A 3D3JA 1ZYUA 3T4EA 2OV4A 1DTEA 3MJDA 4O4LF 2WKRA 3FMFA 1SNYA 2G9UA 2UZ1A 1Y5RA 4WNCA 3JYQA 1BXGB 3RRZA 3H9NA 1KO4A 2CLOB 2HBQA 4MV9A 2OQRA 1Q17A 1UBMS 1J2EA 2GN8A 3GCXA 2H9YA 4M7RA 5FPSA 5K6AC 3WHIA 4FYXA 4Y0VA 1BXGA 1D6JA 3P5SA 3LNTA 5C1BA 1NYTA 2FKNA 3U3KA 4RU1A 5I51A 2FW6A 3FPEA 4D92A 4DYDA 2GXAA 5JJLA 4AJ2A 2EP8A 2PWZA 2IS6A 1ZH6A 3ZDRA 1L7BA 1Y63A 4NU6A 4DUPA 2II6A 1PT5A 1O2DA 3KTDA 5TC4A 3MLBA 1F4PA 3HQ4O 3SOPA 1M1XB 4OSOA 5AM5A 3RU7A 3U6BA 5BYAA 3F71A 3JZFA 3JS5A 3FSJX 3IP7A 2JFUA 4E14A 3JARB 5AHXA 1OXMA 5DISB 2IC5A 1V48A 4H31A 4PICA 3P9KA 5B5SA 1HRKA 1MQSA 3EZ6A 3JARA 1KBZA 4LKRA 3M2PA 4QXMA 4C7VA 4QT4A 4DV0B 1ARZA 4UUNA 3RC2A 1I10A 1A72A 3RS9A 1KRXA 4BNXA 2AC2A 3VTFA 3IHKA 1LB1B 4P22A 2ZAOA 4ZO4A 3GLVA 2W9XA 4A36A 3ZWYA 3U1BA 3BH0A 5ICFA 3B7PA 3G5AA 2P3SA 2C29D 3GNQA 1KI7A 4DM3A 1DAPA 3OLXA 2LE0A 1SPBS 1L4UA 1FU8A 2IVZA 3R20A 1YCHA 3OCZA 4OK5A 3W5VA 4MVXA 3NVKI 2VYNA 3DE5X 1PKVA 1JKFA 3D5QA 1T8YA 2H6EA 3FKQA 3X1KA 3ADKA 4JLSA 1O8CA 3PF8A 5KAMA 4OOSA 1MJNA 2QGFA 3E22B 1XCBA 3A4VA 3I01M 4ZVMA 3ORRA 4GLLA 5JWRA 1RWBA 4UXJA 3ZNPA 1T3SA 1X7DA 2H1RA 4LJ5A 1XCOA 5G3ZA 1RJWA 3E22A 3A31A 4NICA 4UNNA 4UREA 3TOSA 2YRXA 1PTKA 3FRIA 5FT9A 1CEXA 1P61B 1DQRA 1U1DA 2VK8A 4GRIA 4NFYA 4MV3A 4NV3A 4RDIA 1PZHA 1QKKA 2DBQA 4R98A 1TQ2A 4BEJA 1IXSB 4EFDA 4JXKA 3DAOA 5JWOA 1K7EB 3N2ZB 5ALVA 4TUYF 4WKNA 4BQFA 3TQCA 2XMRA 2GAFA 4PG7A 4PRKA 2BT4A 2JLCA 3P2EA 4KC0A 4FFMA 2VPIA 3FTPA 3KO8A 3DZ8A 3O7MA 1VSVA 3KFXA 3WBKA 4RJTA 5FFNA 3TJMA 5JXJA 3I1YA 3NKLA 2ZTHA 3HJUA 3IVAA 3QOYA 1E9AA 2PAAA 2QZ9A 1MQ9A 2QHXA 3ZQ6A 2PKEA 4AJNA 2HSJA 2HEIA 3HJBA 2XNDD 4DDKA 2BKUA 1LBQA 1KP9A 4GWLA 1TB4A 4HB2A 5LQRA 2O8DB 3O8BA 4HNGA 2AUMA 4RHTA 3JYLA 3O92A 2O8DA 4JC8A 4P4UA 4DV6B 1OREA 1XKXA 3QUSA 3GT7A 4N6NA 2JFWA 3T7TA 3W6NA 1U0EA 1LU9A 4ZPJA 4P7FA 3OO1A 2F3TA 4GHWA 3WGMA 3ZWBA 4Z4IA 3FAKA 1I24A 1P33A 4F86A 1QPZA 2YXBA 2WM8A 1H9BA 3V8BA 3G88A 3SAJA 2FFQA 2NZYA 2WINI 2XTNA 4H16A 4BFVA 2G8LA 1KDTA 1I6LA 4DR5B 1JPUA 4Z0HO 3E5RA 1O9HA 5AI5A 4DQLA 4KIUA 2X5NA 5FORA 1E4EB 1RVV1 3AHHA 4FR2A 2WBLC 1RRMA 4W5RA 4RH1A 1W5AA 1HE2A 1L7AA 1RWXA 4PQFA 3R9XB 2G28A 1NBEA 2P91A 3HVJA 2PUWA 3L79A 3PZRA 4RLSA 4A23A 1E4EA 5ILOA 4AQYB 1G59A 3R9XA 1RQRA 4R7TA 5ESDA 2GAIA 4B32A 5JNRA 3R5XA 4CTMA 4QJ3A 2CYBA 3B6JA 3SYKA 2YX1A 4EUHA 1E5TA 2QVCA 4FGKA 4O08A 4I9HA 4ZCLA 3OUTA 4QYMA 3KFLA 5FH9A 1X70A 2RGAA 1QIHA 3V2UA 5JFOA 1NXSA 1AJEA 1SBIA 2O2XA 1SFRA 2NXNA 3AQIA 3P9PA 4R41A 4BN0A 1E9CA 4DV4B 3KSDO 1NW3A 1PD0A 2J45A 1G2PA 4WKOA 3SGLA 1NJ1A 2AZDA 2C78A 1R74A 3NEPX 2IHVA 3FR7A 3RK0A 2QXYA 4J0HA 2NO0A 2NP6A 4UBOA 2UZ4A 3L7KA 1IY0A 3ZH9B 3Q4GA 2VJIA 4UMDA 4INPA 1HFJA 4WZEA 5BP7A 2EP7A 3QJ5A 1YUBA 1BJTA 1SURA 1CQZA 3ANSA 1IZYA 3QH4A 4CL8A 1JILA 1K7CA 421PA 3G0DA 5IT5A 1UKCA 4JLOA 4CI9A 3SR0A 2NO5A 3SZRA 3G82C 2QQEA 3G9TA 1Y5NA 4AJ4A 2ZRHA 2N46A 4N5MA 4ENQA 3D8TA 4AK9A 2A14A 1T0PA 4DUZB 4WAUA 3THRA 2P3MA 4BFYA 2PWAA 3CSDA 2C7OA 1XRPA 5F9MA 3KAJA 2Q5JA 3EUEA 1EAYA 4LDPA 3C7CB 4P3OA 3UK6A 5FLEX 3DWEX 5HOEA 5ENDA 2DWQA 1CHNA 4GOXA 1AGXA 1K4KA 4LRQA 3NOXA 3OJLA 5F7ZA 5TLSA 4EGSA 4OAOA 3BXOA 3VPCA 2B4QA 1UM8A 3LT1A 4K9DA 3IQHX 2WM3A 2I6QA 5CH5A 1E4YA 1WG8A 3KSBC 1OBHA 5K99A 1YB6A 3QBJA 3RKUA 1PKXA 1ORRA 1Y6JA 1IAVA 1C3OB 1N5LA 3D7MA 3W9YA 2OXRA 2W6JD 1SOVA 1WTHD 4L2IB 4DIBA 2VBIA 4JFRA 1C3OA 5KEIA 1OC2A 1WW8A 5KZMB 4JK3A 4L4SA 3TTWA 3GPLA 1EFPB 2H4ZA 2GKSA 1AXRA 4QUJA 4D0RA 5KW9A 4I7EA 4L2IA 4F2WA 4EBBA 1BKSB 2DPYA 5A1JA 4LJSA 1Q1BA 1EFPA 1E9DA 3L0BA 4GBJA 4GDMA 5MN5A 1KO7A 3CPHA 3RAEC 1H1LB 4GSKA 1YR7A 1M8KA 1WNTA 2AFHB 4Q1EA 5UKDA 3WWEA 1JEYB 3A6HA 1ZWKA 2BMJA 2OXCA 2ZYHA 3OFSA 3ZQKA 4YACA 5BV0A 5JEDA 1H1LA 1U0OC 2IU6A 2NSYA 2AFHA 2O3JA 3QKSB 5F76A 2P75A 2HK7A 4JYMA 1GUDA 1FXSA 5BV8A 1FDVA 1XAIA 3GEIA 1ULSA 3QKSA 2WEKA 4AU1A 1VJDA 1NI4A 2GJ8A 1LTQA 1FVFA 3UHFA 2O7SA 5FB3A 3O3NB 5F64A 2ZAGA 3P2KA 1U6JA 1MFPA 1I4WA 2FVGA 2FPKA 1NQUA 2FGKA 3FBWA 1Y7IA 5A1TA 4MW4A 1QDLB 3G9QA 4JWKA 3TTVA 3WIUA 2H0RA 3NBFA 3MTBA 5EMNA 1QR6A 3E9YA 4OOFA 3VISA 1X3SA 4DBVO 4RLFA 4ZOLA 1H4SA 1Q1ZA 4DGSA 3DEFA 5AW7A 3NBXX 2DYKA 5FWYA 3VH3A 2QZSA 3QVMA 1W36B 1I7QB 1Q1AA 1OCEA 1Q15A 1U0NA 3N70A 1H0RA 1UMKA 4L6IA 1GT91 4XLCA 3PI6A 4AJ1A 5JDCA 4ZT5A 4JBWA 1MQ8B 4FEAA 1TVMA 5JSHA 1CULC 2YL2A 4YT2A 5DNUA 2FZCA 3O4RA 3T9BA 4BAGA 5BRAA 3DKPA 1ZC4A 3PCRB 5JNLA 4X24A 2DFVA 5JCJA 2G0AA 3DP7A 3BJIC 2GD1O 4O2AB 3AHIA 4EABA 3FFBA 1Q6ZA 4X1KB 2J8ZA 3M9XA 2OBYA 4IJ6A 4M83A 5HZAA 3NT5A 3HCAA 3VR5H 3W1VA 5D01A 4LUCA 3ASQA 4CBVA 1G5RA 1RWOA 2FW8A 4O2AA 2HH9A 2NU8B 5JMOA 5HBRA 2IH4A 2W00A 4X1KA 3W5BA 4LX8A 5EMMA 2CL5A 5AVQA 1DXOA 1EFTA 2Y1OA 2P0YA 3AU9A 2DPMA 2G5GX 3DMGA 4FOPA 5EOVA 3B85A 2JNWA 3B1WA 1J9EA 2R4QA 1PFVA 2AOTA 4RSHA 4PYKA 4EHJA 1PSWA 2ODEA 2OOKA 1YJ5A 3IBSA 5KPJA 1VQ5B 1TQ6A 2GEKA 4Z4YA 4HNQA 4I6GA 3JQQA 3NHZA 1AM4D 3EC2A 5AUOB 5K51A 2YWCA 1MG0A 2UVPB 1XPRA 3R7AA 4YUXA 1Q84A 2ZYGA 5AH0A 5KQRA 1AKTA 2UVPA 3LAWA 2JD1A 3DPIA 4WBXC 1QHXA 1WVMA 2LKDA 4XLTA 3W1WA 3RFVA 1U9JA 1PQUA 1C7IA 1SCJA 3DUFB 3EXEB 2GJKA 1C7RA 1U7HA 521PA 2NUAB 1UANA 5K0FA 4ZDJA 2CLKB 1UKEA 2FMHA 2ZDHA 4IQ0A 4Q21A 2F8TA 3EXEA 2NUAA 1AK1A 4HN9A 1UOQA 1P9WA 1H6BA 4NBRA 2CW5A 3S7ZA 4BNNA 4X93A 4IWYA 2NT4A 1R0SA 1G8PA 3KYIB 2QY9A 3AF4A 2B99A 3LP6A 1EP9A 1G60A 1CY2A 3VSCA 2YC2C 2OL4A 3BRWD 2CXPA 1PSZA 3IVXA 4PPYA 3WDKA 3QF7A 5AMXA 4BMNA 3R77A 4OI2A 1DVRA 2X41A 1JAIA 3HYLA 1OLUB 3DFIA 3OPOA 3P7MA 4KQCA 4LZWA 1KQSB 2PHZA 4YJHB 5IWCA 3VR1A 2FK8A 1DXQA 3TIGA 1DQNA 1OLUA 4L75A 3CBQA 4A8PA 3RVOA 4X6YA 1EUDA 2ZVDA 4JQYA 2CV2A 1WHSB 3H65A 2SECE 3C15C 3L01A 1QGZA 4V0RA 1G19A 5FR1A 3STXA 4BGVA 2Q2VA 3LW7A 3MCWA 2P6NA 4RZIA 2PFKA 1WHSA 1DOZA 1SCDA 1QFYA 2HREA 3EISA 4ED9A 4RPGA 1NB9A 1SBNE 5AW2A 4KXFB 5LSAA 3FKSD 4K9LA 1G9SA 4JU8A 2CWWA 3F90A 2YZGA 5B2ZA 3ZHUA 2PPLA 1PR3A 4JSYA 2R48A 4BO2A 5KB3A 1NVAA 2B2CA 1QZXA 2RIPA 3A1CA 3E5MA 1ODSA 3LC0A 4OKIA 5E7QA 1H1TA 4BNKA 1T91A 1PR1A 1VZ2A 2G6BA 3JX9A 1X13A 3IUQA 4FHGA 5JC1A 1HYEA 4Z4QA 3FCSB 1A2OA 1P8AA 5H4GA 4RPBA 1MDFA 5BQPA 3D3NA 4FJ2A 5K3EA 3RYCB 2VSYA 4Z4RA 2BMFA 5EC8A 2M6RA 4WN9B 3RTAA 1T2VA 1TA4A 4ZT2A 5IYWA 3LBIA 1KQFA 4G23A 4PYJA 3R7NA 4QAQA 3NQ41 1VIVA 4GWGA 1RXEA 2ZSIA 4MVJF 5EPEA 4UUBA 2ZSJA 4XOPA 4WN9A 3W1EA 4L85A 2QLMA 1WUYA 2M5SA 2OFWA 5C1DA 4CMGA 2I6XA 2BH2A 5C5EA 5BSTA 1XP5A 3WFZA 3ZY3A 5KDOA 2QEQA 5CGQB 4MKGA 2OVFA 5HMLA 1YQQA 2DAPA 1LD3A 1QOPB 2P4EA 3EZFA 2HO5A 2ZRIA 2H5LA 2I9KA 3GJYA 3OZBA 4WZZA 1EUQA 2QM0A 2X6WA 3ORHA 4C0HA 1KERA 1WOOA 3FGZA 4S2UA 1O5IA 1RYEA 3MOIA 4O4JF 3X1JA 1NP7A 1UFRA 3LW8A 3DEYX 4JXJA 2O1WA 1EX7A 3D4IA 3I01A 4D9GA 1YI2B 4LPSA 1Z7YA 2NO6A 3GP3A 4PZPA 4C7MA 2CVOA 3BD6A 3NS7A 5YASA 3JQFA 3UOGA 1UT8A 2FHPA 2DHEA 2FPGB 1ECJA 3UXMA 2EFDB 1H66A 5JC8A 3MIZA 4N3GA 1RQPA 1XAHA 2C5GA 2LVBA 4WVLA 3HDTA 2FPGA 3SLGA 4Q9NA 2RHDA 4CWAA 1KI1A 4TLDA 3GPIA 3LC1O 1NZFA 3UAZA 1ACMA 3N7AA 2HJGA 3ICWA 2XCIA 2DKFA 5FTMA 2AG5A 1C0LA 4H08A 4Q1DA 5DTIA 5KNCH 1K5DA 2AZXA 4G07A 3ELUA 1EVLA 1ST2A 4CCSA 3OIUA 1FFSA 2F48A 3AI3A 3K0BA 5LLDA 1NBOA 1X0XA 3VFDA 4Y6RA 1TTHA 5AW9A 5COAA 3DL7A 5J59A 4Y9DA 4A26A 4YAKA 2EEZA 2E4VA 4AJHA 2RH4A 3AF3A 4IJUA 5ADHA 1G55A 3LUAA 3SXUA 2CVQA 3DZFA 4MRAA 1OR8A 4U02A 1JFFB 4QLOA 2WVJA 1QH1B 4RIFA 4AD8A 1E2GA 1OAAA 1SXJC 2X0NA 3A9UA 2CLLB 3GFFA 3A8JA 1VQPB 1RE0A 4KMRA 3WX0A 3GZNB 4JKIA 1JFFA 5IDWA 1QH1A 2Q3EA 4F4FA 4ZQHA 4UFPA 2OV3A 1M8GA 1Z6QA 4KWCA 2R7LA 4H6WA 3C5WP 2DKNA 2RGRA 3UOAB 3GZNA 3CWCA 1Q0UA 1B6TA 1VRCA 2JCXA 1JG3A 1RM3A 2OD9A 3W6PA 1UC4B 5BSVA 2VDLB 3R3ZA 3V4LA 2JC3A 2C3OA 3TX6A 3PEEA 4U7GA 3UT5A 2O3UA 1YACA 1WPQA 2B4RO 2AN3A 1R8YA 1T2UA 2ZUVA 4UBLA 3MLAA 4O4IB 3EZNA 1WB4A 1FMTA 2J85A 3HZHA 3KXPA 4LG1A 4D5GA 1CBUA 4M1OA 1WSWA 2G71A 3OJEA 5JMPA 4D02A 3FCYA 4ETIA 3GXBA 2NSHA 3R0ZA 4O4IA 1LH0A 3IAUA 5EIFA 1U1FA 2GN6A 4UVDA 1VECA 3PFBA 5E9JA 1O0CA 2WHXA 2CVZA 1P4GA 4GX5A 4YA6A 2OQIA 5GGYA 3COSA 4DLXA 1BS9A 1MJ5A 3BGOS 1GPAA 4H6VA 3FOEC 4ZTZB 1KP2A 1TKBA 2F1HA 4DJJA 2ETVA 2PZBA 1SUCA 3RASA 1VJRA 3I9OA 3FYCA 1N6IA 4LWPA 4PYOA 1XKTA 3HYTA 3NRJA 3O03A 1AMOA 2EG9A 2POCA 2XD9A 2YCBA 3OCYA 3ZU6A 1P1JA 2C1ZA 1Y42X 2J6BA 1Z6TA 3MGCA 4AMYA 5I4KA 3MHTA 2JLVA 4YREA 1E7WA 3P9ZA 1BX0A 4RD4A 2DWPA 1M1KD 2ZQ5A 4MKFA 4TL7A 1AO0A 1T29A 3G9XA 4YRAA 1NONA 4BL5A 4A6EA 1HK7A 1FB5A 1RM4A 2NLOA 1SD1A 2Q5HA 1I30A 1UJ2A 4IINA 2ECFA 5ERGB 5KYXB 4KK4A 3K5IA 3F5DA 1B3RA 2BEKA 1G1MA 3T5AA 3EW7A 4UBJA 3N6XA 1J0AA 4Q18A 2V96A 3F7MA 3REOA 5HZHA 1WXHA 4IUCS 3HBMA 1XELA 1QRRA 4B4WA 5KYXA 3NASA 4TV8F 4DKJA 1I7DA 1L8XA 1X3LA 5ALLA 4YXWD 4B44A 3EVDA 3SF8B 1UBRS 2PZLA 4FCTA 2Q6TA 1VPEA 4KX3A 4X1YB 1XNJA 2DP4E 3UUWA 2PRJA 2UVDA 3GFTA 4GZ6A 3I72A 4XPIB 3SF8A 2QR5A 3BEOA 2IXFA 3F3SA 3NIGB 4R1NA 2RGWA 2BI8A 1P6XA 1KMMA 3IVCA 4TM8A 3VM6A 3U44B 1XRJA 4X1YA 1L1QA 1KJQA 1F8FA 1BG6A 1H0SA 1P9OA 5HE8A 1SGWA 4BGUA 3P45A 3RIYA 3U44A 4XYGA 1AUVA 2GBFA 2QVXX 3DJFA 1UP4A 2IV3A 1PJQA 4B40A 1UDCA 2IKSA 5TJHA 3UPDA 3GLIE 1Z0JA 1ZICA 4V0ME 1B2LA 4JHLA 4G6IA 1VQ7B 1XZQA 2JEOA 2NWQA 2YIDA 2YNMD 3A1FA 3I39X 3KOYA 3CFYA 4L0QA 4B83A 5GIOE 2Q7OE 4JSTA 4KPGA 5FULA 1U2TA 5D7BA 1YDMA 2J6CA 4REQB 3G05A 2DCMA 4R7GA 5IJ9B 2NYRA 2V59A 4MQ6A 5CJJA 1HFWA 4R40A 2AUNA 3GFQA 4IIJF 4IDOA 4D0LB 3DKVA 3HVHA 5P21A 1CZOA 1SHZA 1PUXA 3B7WA 1F4LA 4HTFB 4B0PA 5AM3A 3ESAA 1BHO1 3AR2A 2JAWA 3Q41A 4LDAA 4PZLA 3UCXA 4B84A 3OZUA 3WYGA 1YJCA 2BKLA 3O8CA 4IFEA 2W70A 5JQWA 4HTFA 1E3IA 4DWJA 3F7OA 2FOLA 3PFFA 4IGAA 4IGFA 4OKNA 1VPVA 5HA5A 5HCNA 5BOVA 4MRSA 4PFSA 1IZ8A 2BCJQ 3EJ6A 4BLQA 3CF0A 2CHFA 4EATA 3ASTA 4FJ1A 1NF8A 4KRXA 2YWFA 3WHKA 4F92B 3H9CA 5M29A 2G25A 3IVGA 4F8JA 5TGZA 4EPRA 5E1OA 1Q81D 3AJEA 3O9ZA 2REBA 4GQBA 3LG2A 1N2XA 2B0CA 5CVTA 1DTSA 3RAFC 2GPNA 1Q16A 2G72A 3BL6A 1AB5A 4PG5A 3ZU3A 4NP6A 2W6ID 4NABA 3GYGA 1F2VA 3VBCA 3WQRA 4TKZA 1VP3A 2A84A 4IQ4A 2CLMB 1EMDA 3FGOA 4CKZA 2GJPA 3KLPX 5L45A 3FOZA 1IQPA 1E8NA 2Z57A 3TX2A 3OM1A 5F2KA 4AN4A 1I94B 1T2CA 2OBNA 2Y92A 5I4CA 3E23A 3ZWDA 1RHUA 5CCEA 4E15A 1OWLA 3F4BA 3Q1KA 1VHQA 3JPWA 2FHSA 1RMYA 4FHDA 4LOKA 4DK1A 3IEIA 3V9PA 2VI5A 2E1RA 5IASA 1MUUA 1QJCA 1UJBA 2LCFA 3IELA 1G7RA 5TIIA 3RM3A 2V6BA 3H6KA 1CJBA 2PH1A 4DTCA 2RD2A 2PRKA 3ABQB 2C7RA 3ITKA 5IYZB 3CVYA 1L5SA 1OAOA 5L4LA 4RHEA 2V3CC 2Z5FA 1AS2A 2WB4A 2ZB7A 4HYQA 4PR3A 4D9IA