2R6HA

Crystal structure of the domain comprising the nad binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
285
structure length
285
Chain Sequence
GVKEWECEVLSNKNVSTFIKEFVVKLPEGETMNFKSGSYAQIKIPKYNIRYADYDIQDRFRGDWDKMDAWSLTCKNEEETVRAYSMANYPAEGNIITLNVRIATPPFDRAANKWKAGIKPGISSSYIFSLKPGDKVMMSGPYGDFHIQDTDAEMLYIGGGAGMAPLRAQILHLFRTLKTGRKVSYWYGARSKNEIFYEEDFREIEREFPNFKFHIALSDPQPEDNWTGYVGFIHQVIYDNYLKDHDAPEDIEYYMCGPGPMANAVKGMLENLGVPRNMLFFDDFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH:ubiquinone oxidoreductase, Na translocating, F subunit
publication title Crystal Structure of the Domain Comprising the Regions Binding NAD and FAD from the NADH:Ubiquinone Oxidoreductase, Na Translocating, F Subunit from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
total genus 72
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.-:
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2r6hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2r6hA02
5HXBA 1CQXA 4WQMA 1U2RA 4HE5A 1EFTA 4YHBA 5AN9A 4PGOA 1VQNB 2BF4A 5GV8A 1QVFB 3W2EA 4RCYA 1GVHA 3ZZUA 1KTVA 2BV3A 1D1NA 1BX0A 2BMWA 4B3XA 4M4SA 4C0SA 3U6KA 1CNEA 3MHPA 3CCQB 1QG0A 1SM4A 1JA0A 1GR1A 3QFCA 4ACAA 3QSYA 4G5GA 3LVBA 4DQLA 4YAUA 2D74A 1VQOB 4LBYA 1FDRA 1G7CA 2OTJB 1DDIA 1D8TA 3CCLB 5TR9A 4B48A 1VQMB 3CCMB 3W2HA 4YAWA 3MCAA 3CC7B 3ZBUA 1YI2B 1QX4A 1VQ9B 3AGPA 3G6EB 4ZCLA 3V76A 4LBVA 4AC9A 1DARA 2R6HA 3CCRB 1YITB 4YAFA 3CCJB 1ZM3A 3G71B 1KJZA 4ZCMA 3CRZA 4RJLA 1DG1G 2AHOA 1KD1D 1EP1B 3QFRA 4AF6A 3WNBA 2PIAA 1BQEA 4LBZA 3CD6B 2VYQA 2PMDA 4PC3A 1F60A 3W5VA 1BX1A 2GQFA 3PENA 4RD0A 1TUIA 3CCUB 2GPJA 2YWHA 1ZM2A 3J81k 1J9ZA 1QFYA 2BM1A 4J0QA 1NJID 1QGYA 2YWFA 1R5OA 4QFMA 3OJWA 3E20A 1VQ4B 1KK3A 1XB2A 1VQ7B 4Q7JB 2BVNA 4F7DA 1JJ2B 2RC5A 3AVYA 3VMFA 4N3GA 1WDTA 3WXMA 2YWEA 4M53A 4P6VF 1QFZA 1G7TA 4TMXA 2DERA 3I55B 1Q7YD 1ELOA 3CCSB 2EIXA 3I56B 3CCEB 3B78A 1N8RD 2DCUA 3W5HA 1EFUA 5EMNA 4TMWA 1Q81D 1Q82D 1YIJB 1VQ6B 4MYTA 4B47A 4B44A 3MMPA 1IB0A 4M2LA 3OW2B 1QUEA 3OZWA 1K73D 1ZM4A 2B7CA 1K9MD 3ZZ0A 1IJFA 3LRXA 3CMEB 2QEXB 3AVTA 2EFGA 1JB9A 1E64A 1QFJA 3P26A 4B43A 1EXMA 3CXCB 3ZZTA 3A1FA 3CW2A 1FNBA 2BN4A 1FNCA 1OGJA 1SKQA 4EH1A 4YALA 4FK8A 2QN6A 2NPFA 1QVGB 4TMZA 3CCVB 1UMKA 3LYUA 2B7BA 4FWTA 2BGJA 3U6BA 1KQSB 3JQRA 1BJKA 5TY0A 2RC6A 1CNFA 2YWGA 1YJ9B 1KRHA 3QE2A 4MYUA 4TMVA 3AVWA 4RD2A 2ZITA 3OZUA 4PC6A 1DDGA 5TV2A 5THXA 1TLLA 1G7RA 4H9GA 1KC8D 1FNDA 1E63A 1OB5A 1NDHA 1W87A 1FNMA 4ZV4A 4UAJA 3WBKA 3WNCA 5JBQA 1R5BA 1ZM9A 4C43A 2VZLA 1N0VC 4PC7A 1YJNB 2HDNB 1GJRA 2FX3A 1AMOA 2VNHA 1XE1A 2BSAA 1QUFA 1W2BB 4PC2A 2CRVA 1E62A 2C78A 4RD6A 3CPWB 4Y7CA 4FN5A 4RD3A 3JQPA 4G1VA 3CC2B 3FPKA 1A8PA 1R5NA 1FRNA 1TVCA 2OTLB 1Q86D 3ES9A 3WBJA 1M90D 1I7PA 2DETA 2VNKA 4B4DA 2DY1A 1ZUNB 2QTZA 4NBSA 2QA4B 3OZVA 1F20A 4P3YA 3ZBTA 1EP2B 2J7KA 2QMUA 4U9UA 3P27A 4DQKA 3CMAB 1EP3B 1KK0A 3I1FA 3LO8A 4PC1A 1VQ5B 2VNIA 3B82A 1YHQB 3FJOA 1VQLB 4M0LA 1QGAA 3AGQA 3ZC3A 2HMAA 5DSZA 4RD4A 2PLFA 4R71A 2CNDA 1G7SA 2BPOA 1GAQA 3W2IA 3WYAA 2DEUA 2B5OA 1D2EA 3E1YE 2QTLA 3OJXA 1M1KD 1VQPB 2QDXA 4ZGNB 4RD1A 1FRQA 5H59A 3QFSA 1GAWA 1N0UA 1QGZA 1B23P 4HE6A 3WY9A 1KK1A 1S72B 4BPRA 1EFCA 4NCNA 4M1KA 4G1BA 3AVXA 1OB2A 3SJZA 1JNYA 3G4SB 3AVUA 3VNVA 2HCJB 4LC0A 2XNCA 4ACBA 3JQQA 2E1RA 4TN1A 3B8HA 3CC4B 1VQKB 1S0UA 4AF7A 4ZGQB 4LBWA 1VQ8B 1H42A 4N3NA 3W2FA 3VO1A 2BGIA 4RCZA 2XEXA 3QFTA 1KK2A 1OGIA 2X3UA 3U2QA 1W34A 3WNDA 3CB4A 1H85A 5KSWB 4ZCIA 3W2GA 5FA6A 3W5UA 2BM0A 2VNJA 1TTTA 4Y9UA 1AIPA 2XNJA 4Y9RA 1JA1A 1GO2A 4K1XA 3AVVA 2C77A 1IJEA 1B2RA 2OK7A 2OK8A 1K8AD 4YAOA 3VNUA 1EWYA 1YJWB 4TMTA 1QH0A 5GV7A 3VO2A 4QHYA 1W35A 1HA3A 4IW3B 5H5JA
chains in the Genus database with same CATH superfamily
1KMIY 4C2UA 1OV4A 1NW5A 4B3DA 1POXA 2H4JA 1FSFA 1G98A 3JD3A 3BF8A 4J0HA 3VZCA 4J75A 4MITA 5EMJA 1F6BA 4EI8A 1I2MA 4K9NA 4O0MA 1Q0ZA 1VKJA 4IMJB 4LE2A 2W11A 1B26A 3FBGA 4LY0A 4C29A 3ADCA 1IVSA 3ELDA 1DC4A 3JQ8B 8MHTA 1UPBA 1USKA 3HNOA 3OETA 2C5SA 4I81A 3ERCA 2QM3A 1B73A 1S8FA 3FR8A 2OHVA 3MWFA 3QVOA 3S29A 3W04A 3SS9X 1X94A 3LX6A 3QPBA 5GMOA 2PBFA 4UFOA 2V6BA 1L9KA 4QX6A 4LE1A 4TSKA 3TGWA 4RY8A 4C0BA 3NO4A 1ZSYA 3L79A 4R3WA 3DJFA 4AIIA 2NN3C 3KYJB 2J9FB 4ETNA 3SQLA 4YCLA 1X3LA 2MSLA 1I0LA 4AJKA 4DNXA 5JS6A 3E22A 4HQ6A 3X0DA 4OEHA 2XLCA 1N6PA 1DAEA 1I0IA 2OV4A 4P4LA 4DIEA 5B4VA 5AVVA 3RY8A 3C7KA 4Y2JA 1VQOB 1E89A 2LUOA 3GK3A 4ZVLA 1AQNA 3LAWA 2BFPA 5BVGA 2XRZA 5AK0A 1N9KA 2JFOA 2ORIA 3PBKA 4RVNA 4DIUA 5JASA 5EQDA 1NNEA 1Z6XA 1BDJA 1PFUA 3JQ8A 3RH0A 2VHWA 3EYWA 3IAM1 3CCLB 1FX1A 1VJRA 3H5WA 3G0BA 1VQMB 5B7QA 4JKOA 5EJIA 3BMQB 4MKGA 4HYQA 1JL3A 2UYOA 3W8EA 4LK2A 3VR2D 5IZCC 3OHPA 4YX9A 2QOEA 1VLMA 3L05A 1VQ9B 1KNQA 4XLTA 4KIFA 3A6DA 4JY7A 4ZCLA 3VYWA 2BBTA 4QC2A 5JO0A 3BCRA 5A1JA 1K27A 1XVVA 2Y0EA 3FZQA 1W48A 1AQ6A 2KS6A 1E4OA 2QSYA 4RUKA 4B80A 2MYPA 2VKTA 3OESA 2OLJA 2VJYA 3CYFA 4LDJA 4D5EA 2ZM5A 3GEDA 6REQB 1OI7A 3EXIB 3SICE 2JGJA 2NWQA 1JU9A 4R1MA 4JSYA 3VM6A 2J3EA 2VT7A 1I7DA 3WTCA 4ZCMA 1MG0A 2FQYA 1I5OA 1TQ2A 1AS0A 2V7UA 3LXXA 4IXDA 4ARUA 1DIOB 3DP7A 5JATA 1IXZA 1JZQA 3SR0A 1IAQA 2P3LA 2VAXA 2VK8A 1XAIA 1M0WA 5E4TA 4URVR 5IKMA 3HBAA 3VH3A 2H0AA 3NALA 4W8OA 1JQBA 2G17A 4XM3A 1XXHA 1P2DA 4BVKA 1DX4A 3HXKA 3VX4A 1YMVA 1Z5VA 3T15A 4QLOA 2Z6VA 1X9HA 2WSBA 4AT1A 4UTOA 4L8YA 3EQ2A 2YZ2A 3QU5A 2XGSA 3UMSA 2BMDA 2X4IA 3W9UA 3AXSA 1MZPA 2ZUDA 1M2FA 5EUCA 4WIAA 4ENTA 3S3TA 2Q0QA 1SOWA 2HCTA 3ABSB 4ZVKA 5CYOA 5JMOA 1Q83A 2EFHB 4LUCA 1JWAB 2YVAA 2JZOA 1EVYA 1V4BA 1PLLA 1ECFA 1DSSG 2J09A 1DMSA 3EXIA 2EP7A 4Y8VA 3OTWA 2J59A 2QR5A 4FOPA 2Z5VA 4K0RA 1A5ZA 4RK7A 1U0NA 3GGSA 3A36A 1MP0A 2C7GA 4GKVA 4R2JA 1E1LA 2PLWA 3ANXA 4EI7A 3AY7A 4JJ4A 4I9FA 4RM3A 2WF9A 4YELA 1U0BB 3VR4A 1XB2A 5KVVA 1VQ7B 2HIAA 4PYIA 4DBVO 5IT5A 2J31A 3UEOA 5JRZA 3BIFA 4IIVA 4F7DA 3D2BA 3GP5A 2QLTA 3MAJA 4MMZB 1XU4A 1EM6A 4KDCA 1TZCA 3RFTA 5FDFA 721PA 5T41A 1KBZA 1C8KA 2CHQA 3RC8A 4NKRA 3GX1A 4MWSA 3CX6A 1PJQA 3R40A 2QR3A 1ZH8A 4H16A 5AKLA 4REQB 5DTIA 1SUIA 1HE8B 4N0DA 3ZWPA 1KYXA 4H7FA 4OQYA 2YX1A 4M3NA 1G8JA 1Z3IX 1CVLA 4NBUA 1PUIA 3I6ZA 4I6EA 4L0CA 3A4IA 3C3WA 2OBTA 5ADWA 1PT7A 1Y80A 1TYCA 221PA 2XYHA 3U7RA 2C7BA 2AUNA 2GUGA 1CERA 1W88B 2PRKA 2Q4EA 4M55A 3P9XA 4FD2A 4JEMA 2PAFA 5CVUA 5BYBA 5TF0A 1IZZA 4OSPA 2OQIA 4MARA 4P3PA 1UKYA 4MK4A 4ZGWA 3G2IA 1TA0A 1U2GC 3MMXA 1KZLA 1J8MF 2C8LA 1UBUS 3DV2A 2A1IA 3RKUA 3TTSA 5L51A 5JROA 4DV5B 2ZRBA 4J7AA 1X86B 4BZQA 1EFUA 3A37A 3IERA 3UGKA 4GZLA 1OE0A 1HQDA 1T9AA 4CTNA 1XL1A 3C8HA 4XEUA 3OZBA 2ZT8A 4I5FA 4QJ5A 3IOEA 4REQA 4DSZA 1O03A 2R7AA 1RLIA 1S2IA 1T2EA 1U1FA 1CIPA 3GQVA 3NIDB 1DAIA 4J90A 3VC3A 4I1VA 1BS1A 4AWAA 2CL6X 1XZAA 1BA3A 1M10A 1N0WA 5FBWB 2DUJA 1KR5A 3KVNA 4A8PA 4Q21A 2WWHA 4Y2VA 4G25A 3RFXA 5BUQA 4BVHA 3KKNA 3FFWA 4LJLA 4EW6A 2WVJA 1RNLA 2EFYA 3M82A 2A3NA 3FSJX 4JQOA 4O3FA 3ND7A 3TMAA 4KO8A 1Y6QA 1I32A 3AJ9A 4JI1B 2QYOA 1JB9A 1QFJA 3IE2A 4GECA 1X8KA 2EL9A 4IRMA 3C3XA 2ZAOA 2MT9A 1SJ9A 1UXJA 1ZLXA 1C14A 1JJFA 2VTEA 3A1FA 1G41A 1OFHA 4HLCA 4M8NE 2AX3A 3TUIC 3ZBQA 3L1IA 3ZCQA 5JCJD 1VYVA 4NV0A 4TYQA 5EHIA 4NJMB 4AKEA 5DEOA 9LDBA 2PA3A 2CNKA 2QX6A 4O2BF 4YJ3F 3GRKA 4YP0A 2B7BA 3CNBA 3CLHA 3DZDA 1RHUA 1N2SA 1NM5A 3PRYA 4PYNA 3M8KA 3ND9A 3KQNA 3SVLA 4BFYA 5GINE 1RR6A 2H4ZA 2XIQA 2Z9CA 5LP1A 4FMDF 1M8FA 2YWGA 1ZOPA 4Z4IA 1W0JD 3EDOA 4ZCQA 1IN1A 3MJ4A 4PAMA 3R24A 4QXMA 3RSSA 2HMWA 3ICPA 2GARA 2OMEA 3OEHA 2OAEA 4HB4A 4XARA 4M46A 5BV2P 1EHCA 5TS3A 4AURA 4BO8A 3IA7A 3UG7A 4DMCA 3BS4A 1ID1A 4Q9LA 3WFZA 1BS9A 1NPTO 4GNRA 2LCIA 4ER0A 1Z74A 1L5VA 2Q2VA 1Y3DE 3R5SA 4HMQA 5DVZA 4QGGA 5EUMA 3TCKA 3IESA 5BSGA 1AJEA 4KE7A 2L42A 2Y05A 1HG1A 2J9XB 3LBNA 4HVCA 2V6GA 5MHTA 1RHKA 4G0UA 4GP7A 3ILSA 2FPMA 2Z95A 1MOQA 1NASA 4LZJA 3ELBA 1VMEA 4CNBA 4CIBA 3L4KA 5HS6A 5JYEA 3EDCA 1WWKA 4XVCA 4D9NA 4XW2A 2HUNA 2CK3D 2X0JA 4CMHA 2VTBB 3EBOA 4KH1A 2R65A 1OB5A 2Z1NA 3HP4A 4UUPA 2XA2A 4FOLA 5HM6A 1I4LD 1RI1A 3PD1A 4H7IA 5CXXA 1QGUA 1IHYA 1P17A 4CHTA 4F8YA 2A59A 3COYA 1R3UA 4ADSG 4L6AA 2PZBA 3BJMA 3QLTA 1MFZA 1I80A 2P6RA 4KPUB 2VYVA 1FOEB 3DNFA 5K8VA 3S44A 2C9BA 3V8BA 3ORQA 3QOYA 3BF7A 3BN3A 4BEJA 4Q02A 1AMOA 4RW0A 3R8FA 1E6WA 2QD2A 4L0MA 1RQPA 5EEHA 3V7UA 2PJRA 1IHPA 1VECA 2CZQA 2GKGA 2MSDB 4G0ZA 4Q7EA 4DTIA 3CUKA 4X62B 5KSZA 4JLWA 4CR8A 5LZ9A 3ITDA 1OI4A 2PQ0A 1XLVA 3WWDA 4N48A 5KWIA 4EJ6A 4G0NA 1RKVA 5I4CA 1C7ZA 1KP3A 2FGJA 4QEKA 1V48A 5FFFA 5A3SA 5K05A 3OQ6A 2LKDA 1O96A 2H4XA 4P0QB 4MVJA 4DHWA 3CNQS 4RY0A 5H9WA 3WV4A 2VTBA 2DWPA 2PJZA 4XAQA 1MC5A 1R7RA 3GNLA 3NC4A 4KYIB 4PIMA 4BZZA 2XTJA 3WV5A 1YQEA 3CX4A 1ZBQA 3V1TC 1XCMA 2BM8A 2O0MA 2FZ5A 2QX4A 2IGBA 4KPUA 2BR3A 1HKUA 3HSYA 3ES9A 2GUWA 3C1TA 4OFWA 4MV9A 3WBJA 4E46A 1QTNA 3FLEA 4P38A 3I5AA 4GYYA 4GMHA 3E4DA 3IEKA 4K03A 2ZXIA 4RZQA 4DJ5X 4PHHA 1DKLA 1XLTC 4Z4RA 3Q8LA 3G2HA 2V97A 4DBZA 1GNPA 3SYMA 1G5PA 3CX8A 3JWGA 3AVOA 2UVQA 1DCMA 1XNJA 2ZXEA 3HDHA 1T2UA 1P9OA 3QXXA 4P8RA 4WZZA 3MYRA 1UMBB 3GCZA 1MW9X 4KRGA 4PPQA 1NIPA 3PFBA 3KJFA 2I3GA 2Y66A 3GLFA 3T7RA 1RBMA 1ZNXA 4G85A 4J03A 4FGWA 2NU7B 4JXZA 4F0JA 1PVDA 4BP9A 1ITZA 4AP5A 4P7KA 1LRLA 3SZOA 1E9RA 1WW2A 1A9YA 3IFSA 4MW1A 2PS0A 4MYSA 3ZI0A 2N9UA 1EKXA 3TDMA 4GX1A 1KJQA 4C30A 3ZLTA 1U1IA 3PXDA 4WPGA 3L0ZA 5CGZA 1VPDA 1KOGA 4OXKA 1Z5OA 2HNBA 3PFWO 1HZJA 4ODIA 5JH7F 5KWVA 1I7SB 1S96A 4X44A 3WBFA 3AI7A 2PKQP 3RK4A 3LXMA 3K0BA 3UW3A 5A0TA 4H35A 4QOFA 5HUQA 2PO7A 3DT6A 1AVTA 4RJ2A 1NE7A 3GPDG 3KHTA 1D2MA 4RA9A 4DWOA 1SZPA 4AVZA 3KBOA 5FOUA 5CDFE 2JCBA 3KSMA 5JPCA 1UMBA 2RK3A 4B4VA 3F98A 1PZMA 2FPIB 2XNSA 1TT7A 4DLSA 1ATIA 2IQIA 3S55A 4CEJB 2P27A 3KALA 3RWOA 4EPWA 4AJ4A 3T9DA 2C2BA 5C46F 1WCV1 4IXTA 5CVVA 1MRZA 1W93A 2RGNC 3H9JA 3PQ7A 1BROA 4HYEA 3ZCRA 1CJUC 3FUUA 5DSXA 1RTTA 1RI3A 2JGRA 3BMXA 4P12A 1QV6A 4GYWA 4UDNA 1Y48E 1YK1A 2C57A 3O5AA 3ZZMA 4M1QA 4RHCA 2PMKA 1U90A 4RPLA 5KSYA 2OYNA 2P1ZA 1JEAA 4MKRA 4D92A 4WECA 3W3AD 4NCNA 3X2EA 1P2FA 3AB7A 2IOQA 3DT8A 1K2VN 4K8RB 1PLKA 3PUWA 4YEDA 1GNLA 1JU3A 3IKLA 1LF0A 1DT5A 1Y1RA 5J4VA 3ZGVA 1B8NA 2OCAA 3GFOA 5J43A 2AQ8A 2Y99A 3WMRA 4MXDA 621PA 5JSZA 3EMBA 3WOHA 3WQZA 2FPIA 3IKVA 4RPGA 4I8IA 5AOCA 4AWXA 5K8IA 1RRMA 3RRJA 4Q66C 1XC7A 3A3YA 1A8UA 4P31A 3VYTB 1DKPA 2Z2XA 3A1CA 3T5DA 4F5ZA 4AF8A 1I94B 2QUHA 1NZJA 4XD2A 1M8JA 2Y92A 4U9HS 2FKNA 2FSPA 2W2QA 3EQ8A 1ULTA 1YRAA 4MSUA 4RL4A 5DV9A 4DR5B 1VQKB 3UENA 3D0OA 2J3IA 3AJAA 3U7GA 4RQAA 5CJJA 1FQWA 2ZTSA 1MB9A 1BWPA 1IQ0A 1TYDE 3D6JA 4LOLA 2R7NA 3BSSA 2C4TA 3THWB 3KEFA 1K8RA 1NWCA 4QOJA 2CV2A 5FV7A 1P33A 3GAFA 4G86A 3QU2A 4L22A 4QYWA 3HVRA 4MWTA 3WLTA 3R23A 4IV0A 1HFEL 2A67A 5CPBA 1LY1A 2Q3LA 1P9NA 3Q15C 3VC7A 5HZMA 3C7AA 5IJXA 3RRFA 4CTKA 1RQNA 2E82A 3MAGA 3SEJA 1Z5PA 3N6RA 2XB9A 3KD2A 2IRWA 2R2GA 4QUIA 4D3FA 4P5PA 5F2OA 4ECAA 3BFPA 1SC1A 1RT9A 1EM8A 1Y0YA 1L5OA 5IT0A 4ARIA 4OB8A 4MB0A 4YV2A 2IH5A 3G0OA 3HU1A 3RIXA 3PEYA 1VBFA 2B78A 3SSAA 1N2HA 4QM7A 1LW6E 1M72A 4W5TA 1P61B 2I4IA 3V2HA 1TGYA 8ABPA 4DV4B 2F8TA 4N47A 4FYWA 1JH9A 3DMFA 4HH0A 4WNIA 3EXG2 1JA1A 3RI3A 5MFPA 1JDUA 4EGAA 2NNWB 1U8CB 3ZWCA 2PL5A 2O05A 1IJEA 1QE5A 1YZUA 1TKBA 1J24A 2NM0A 3OFJA 5C1IA 3VYUB 3F7TA 4GGOA 5EP4A 2BEWA 4LIPD 3SDSA 1U7WA 3LD9A 3OIVA 2B0CA 4X54A 1EK5A 3G9ZA 3W1WA 1ICEA 1EWYA 1IFXA 2VP0A 4AJ9A 1PZXA 5DZSA 5C1BA 4I1OA 4B3SB 3T3NA 3MTQA 4JC5A 4DM7A 4UQLA 5BNIA 2FAXA 1DIGA 1J6UA 2B82A 2WJGA 2X6RA 4YTEA 3D7RA 2EZ4A 2HNKA 4DEYA 3EZ6A 1CRLA 1YZHA 2R5WA 4IW3B 1O6BA 2AG6A 4H1HA 5AI8A 3OQBA 3UWPA 3VPAA 3FXAA 2P4UA 3NDRA 5J2UA 2UUBB 3KELA 1ZGCA 2HZ7A 2X9VA 3F3KA 5K0BA 4HDAA 5BNWA 4RDCA 4JEIA 2F9FA 4TLAA 4LSMA 4F91B 5JRDS 4GSYA 1IY8A 1XROA 5JCXA 2DFPA 4L8JA 3BRQA 2BF4A 2UUCB 1OIXA 4URHA 3BORA 4X7MA 4IFEA 4R8SA 5F4MA 5CGQB 1RTKA 5IDYA 5JDCC 4CL3A 4OH7A 4YUYA 1C1DA 3PUNA 2V31A 1ZCJA 2DQZA 2UVDA 1XRRA 4Z9AA 3UANA 2QTBA 3BQNB 3D8SA 2Q99A 4L3WA 4OGWA 4JN6B 5TVGA 4GOKA 4TVBA 3IIJA 2O8EB 5LM3A 3FTEA 1QG0A 3FCXA 1XTTA 3R9WA 1Z4NA 5LCXA 3AEKB 2ZRHA 1DTSA 1GKYA 3ZDBA 4JYAB 1C9NA 4MI1A 1FU8A 2GXAA 2FW8A 2GN1A 4ITUA 2BFFB 3EK2A 5TMPA 2MYUA 1PN3A 1XTSA 1LDBA 2HU5A 3OUZA 4P4TA 1DO2A 1Q7GA 1C7QA 3O1JC 2JA2A 4KYTA 5C0OE 2WTUA 1RQRA 4FFOA 1QV9A 1H1TA 2G83A 4OI1A 4DPMA 3DWIA 2CJYA 2ZIAA 5HHTA 4JUBA 2PX3A 3DDWA 2GVDC 3PKIA 3A26A 1FUYB 1AGXA 2FEAA 2N46A 3RRYA 2ZWPA 4PHGA 3F9IA 4EVSA 5AVXA 2OFFA 3PT9A 5E2IA 1C4XA 1C2YA 2P2GA 1JXQA 3MOIA 4J0EA 4X91A 5EVJA 3SC2B 2JJQA 3DEYX 4DXAA 3ZUPA 4NE7A 2WAXA 3CF0A 5LQCA 3FM9A 3ICOA 2G9NA 3X1WA 5T3YA 1YI2B 1E9BA 1MAUA 1ZESA 1ZGGA 2F64A 3E3MA 3EVBA 3QKIA 2A1TS 3HSKA 4O5AA 4OQLA 4TTAA 3WJ7A 3ADDA 2D3TA 2YOHA 3SQXA 1OFIA 1G21A 1Q6YA 3FX2A 3GNSA 3HZRA 4G56A 2BGUA 3FOFC 4EG8A 1C1YA 3RR2A 4KLCA 2WJ3A 4YUAA 5C18A 2PAAA 4NEGA 3ZVMA 1MJGM 1ZINA 4GQAA 2HEGA 1YITB 4IJMA 1NBWB 2Q6TA 3HYTA 5CA1F 1JKMA 1GQQA 2O7VA 4EYGA 1A76A 3P52A 1QKJA 1Z7EA 3ROPA 1KTIA 1YXMA 5D3QA 1MHPA 2H08A 1SD1A 2WU1A 2ODQA 2J67A 1QHHB 2C5GA 3BYZA 3OMXA 4NHEA 2EX1A 2WWVD 1N6KA 3AEUB 3QY0A 3SF8A 3VRHA 2FUG6 4OGLA 3WQSB 3ZWWA 3ZD7A 4CQNA 1DVRA 4DQUA 3B89A 3GVKA 1C3VA 2JAHA 2YCBA 1PFGA 1Y37A 3BEOA 1P0CA 2UYQA 5TQJA 3T7EA 1Z63A 1BQEA 1CU1A 2JI7A 1Z25A 3ASZA 1IYZA 1T6XA 4NPCA 3LJKA 3KQOA 4H7EA 1GRRA 2GZAA 4CM1A 2X0IA 5IKPA 3FKSA 5IYZA 4E4TA 5JZMA 3NS7A 4TPKA 1N5IA 2E21A 3ACDA 2DZDA 3RSZA 1HTBA 3W8RA 2OKGA 3WMGA 2XUKA 2Q41A 3K0SA 1CUZA 4BB9A 5U4XA 2VDUE 2ZTHA 4MJ7A 5IC6A 4RD0A 1U8YA 1ZC4A 2IP2A 3DOCA 2H1LA 3O7MA 3QG5A 4KRYA 1YJXA 4LXYA 4NJOA 1I4EB 5A9TA 1EUQA 2VPYA 3P4YA 2ZJ1A 3AV0B 4IR7A 3EWNA 3RFFA 1EFKA 2A6PA 1JYFA 1YBHA 3ZOKA 1FRZA 1NJID 1U1CA 3LCUA 2B1RA 4JP8A 1M66A 2QB5A 4EENA 2G6BA 4GOJA 5JISA 4Q3OA 4NX2A 1QHHA 1E2MA 3P2JA 4WJZA 2QP3A 5B3JC 4ZTBA 2XH8A 1A8HA 4R1SA 3ZDFA 4F1JA 1YT5A 3CRQA 4D96A 5B7NA 3I09A 4R1PA 421PA 2N3ZA 4X6YA 4JI3B 5BOSB 4L2IA 1JTVA 1TMKA 2ZAMA 4YRGA 1UMCA 1PZEA 1SCDA 3Q87B 1NA5A 1VE7A 4DT1B 4D9GA 4FYIA 5JNWA 3SZGA 1EP9A 1CB0A 1YC5A 2O48X 2OAQ1 3RPEA 4MRPA 2MSNA 1KEZA 5IU6A 3K6SA 1KMMA 4QQRA 4DLKA 4OIFA 3AQ4A 2IEDA 1CEQA 4Y2UA 1IMJA 3CINA 3SHWA 4TYPA 1DO8A 5BV1A 4BVLA 1ZUWA 3NH9A 5WRFA 2CLEB 4KXVA 2UZ1B 3ZGLA 1FPMA 2JLQA 3G85A 1XE3A 2YQ5A 1IUNA 4C5BA 1TKCA 3PDIA 3HGQA 4Y2XA 1RKBA 1MLDA 1JI3A 1Z4MA 2C9ZA 2GT1A 2J30A 2MMCA 2YXLA 4C0XA 4C4RA 3GJ3A 2ZI3A 1QYXA 4AS1A 2V7TA 1NVVR 1QG4A 5CLIA 1Y81A 1RM3A 4M38A 5DSTA 4KAJA 1TIPA 1WKCA 3NUZA 4J6FA 5F4JA 4HXFB 4IV8A 4P58A 1YBMA 3HJHA 4OYRA 1MC4A 4V2UA 1RKQA 2HWKA 4HNQA 5SYAA 2IXTA 3VU8A 4CMEA 4DT1A 1DJMA 2WUDA 4OK6A 1SBZA 4HN9A 1PJCA 3SBDA 4UTVA 1KE1A 4KSYA 5E8RA 1Y5LA 3ZNOA 1XJWA 1CR0A 1I4OA 2XA9A 1UEIA 1GDHA 4RL6A 4OJTA 5FAKA 3E7WA 2O1WA 2QMYA 1VP3A 4LJKA 1GU1A 2AFVA 3DDNA 3FZGA 4L6IA 1YL7A 1DXHA 2ZJBA 3O74A 4R0NA 4TZKA 2XLBA 2P2ZA 3TQTA 1DAKA 1FU7A 2GLTA 4LFBB 3L1JA 1WE2A 3L43A 1IB0A 1U2PA 5BN5B 4L9WA 4PLHA 4Q82A 4QBFA 4E4YA 2FG5A 1P81A 2BGRA 4TKZA 3W7AA 4KDEA 4Z9XA 2FZCA 2ZRCA 2QTCA 2QLMA 3ONYA 4W5RA 2XTZA 4UW9A 1ZM4A 3A6GA 3K71B 3HN2A 1PHPA 2IHYA 2NVBA 2O6LA 4H3SA 2HA5A 2IOYA 1K8YB 3QKSA 4L07A 3WL7A 2ZQZA 4AJPA 4B74A 1X7DA 3VKHA 1H0RA 4JP3A 2VJJA 3AVTA 3C1UA 3R6JA 1OBVA 1QVAA 1OBFO 1X77A 1ZH4A 2FJPA 3H4IA 4I8XA 2PUGA 5CBPA 3T1TA 1R27A 2Z2JA 3EOBI 5LXTB 5DLEA 1QZTA 4IDPA 1CUFA 4R54A 1YJCA 1JG4A 2QYTA 4F4FA 1YVDA 1RZVA 1SKQA 3SJPA 2EBHX 3W3ZB 4DILA 4FK8A 2NYAA 3PB3A 4JBIA 1K5PA 3M89A 2HMSA 4WXYB 1RM5A 1Q0PA 1QVGB 2JI9A 1L1FA 3TE6A 1E2LA 4PSUA 4BBAA 1RADA 1SZDA 2D0PB 4DYVA 5M34A 3ZDDA 2C3PA 4W6ZA 4EMBA 2VQFB 1CQWA 4RMIA 3VBCA 3ZD9A 1S1MA 4EEKA 1KFJB 1TAHA 3G7UA 3N0VA 3NB0A 4PSAA 3IT3A 4K9KA 1A50B 1CS0B 1L1QA 3A4TA 5NULA 1LS6A 5A7GA 1Q20A 1M5TA 2ZR8A 3AX6A 4AJ1A 3ASVA 4NYMQ 4X8HA 3V5NA 4BU0A 4AO6A 4MYUA 1WDWB 2ZTUA 2NO4A 2ZWAA 4E31A 3UHJA 4JUAA 4CTMA 3C4QA 5JSQA 3VZQA 5KTRA 3ZCPA 4H08A 1LK7A 4II3A 2HF8A 3PDUA 4ZDWA 4NCIA 3TO5A 4Z4HA 3K1ZA 4XX1A 1TVMA 2I4TA 3JWPA 4FVTA 3KFLA 3UHFA 4IBOA 3L8GA 3ZE6A 2XCLA 1ZW6A 2BI8A 2WV9A 4ZOQI 1OJLA 2H5JA 4RPCA 1VCHA 1WNFA 1MO6A 4F5WA 2CY0A 1G7RA 3DKKA 3BE8A 1W9MA 3HUUA 3L7MA 4BQIA 4GC9A 1TIBA 4FYHA 2B8NA 2WBLC 3P94A 4WK0B 1FNDA 1UXGA 4C20A 1ZHOA 2GPYA 4GI3A 5H80A 5IJWA 3PKZA 2D5BA 2PMWB 3H19A 4JP2A 1CS0A 1EX7A 4BAUA 3UTCA 1CY8A 3O4GA 1Y3FE 3OPYI 2WIBA 4C43A 2Y3IA 4TZTA 3N3BC 3GEBA 3DDZX 4BJ1A 1WUJS 4ENVA 3DV9A 2NSJA 1IJBA 2HDNB 3AJRA 4XGQA 1OAAA 3FNEA 2ZSKA 3M70A 3N8KA 1G55A 2H5EA 1FVOA 4ZCRA 2R96A 2BSAA 1PNTA 2GPWA 1EA7A 1QIIA 2W6QA 2JLZA 2IHTA 1AZLA 2PGAA 2YNMA 3GW8A 5HZBA 1E6LA 4I55F 3B12A 1ZS9A 2RBKA 3NLLA 5DIFA 3UMGA 2MDTA 2H2AA 4V0RA 3SD7A 3ZW9A 2ATEA 3GVPA 4M7PA 2QYHA 4RZXA 1XCPA 3EH2A 3L77A 4MDHA 3DNMA 2QG4A 5KWEA 1PZHA 2V7GA 3P0JA 1J20A 5AKIA 2M6SA 1KZ9A 2BELA 4KV9A 4UHFA 3JQAB 2NV6A 4BASA 2OBFA 3ZVRA 4ZYYA 4TROA 5IDWA 5LBUA 4BMXA 1E3WB 5FL7D 2Y1FA 1DG9A 2J3HA 3UC9A 1EUYA 1TU0A 1OY1A 5I7EA 1TVCA 3NZEA 2F3QA 2GI4A 3I2HA 3I64A 4KE6A 4KOAA 1NN5A 4QRHA 1TJ4A 2DPLA 3K09C 4KPFC 3RNLA 3QJYA 5GVSA 1N1MA 1U5CA 1Z6PA 1JZSA 3KQKA 3GBVA 1RJWA 1XVLA 1PKXA 1UPTA 2DFNA 1PWZA 2ZB7A 4GEGA 4WZBA 4PAAA 1T5OA 2G67A 4NJEB 3C3JA 4FR2A 3FGZA 2CKMA 3LTEA 1ZUNB 3PPYA 3UV3A 4EITA 1JAZA 1NW4A 3GN1A 1UT8A 3IHWA 3MFQA 3OZIA 4M7OA 4U0KA 5TSDA 3ZG6A 2RJOA 2JHAA 5DNDA 2RBEA 4Z53A 2YOGA 4ZT4A 3PSHA 2C58A 3B53X 4QECA 2HQRA 2PV7A 3VNRA 1WVIA 3I5MA 4MWDA 4OHMA 4R9RA 4OY3A 2QMUA 1ODCA 4G5FA 4R83A 5EJAA 3X2FA 3R6GA 1E3DA 1GTZA 1YTLA 3PE4A 3P27A 3GBPA 3RU2A 1N2ZA 4MUYA 1E1KA 3PGXA 1LBHA 3L8YA 3MRTA 1E3WA 1GPUA 1XZPA 1RMQA 1T3GA 2YASA 4D9BA 3V1NA 4DL9A 3GRCA 1THGA 3PVCA 3EXEB 5CTAA 3MERA 1RC1A 5KIAA 2JIDA 1J2YA 4L5CA 4NU0A 5TRTA 5FYDA 5BRAA 3C3DA 2ON6A 3V80A 2A5YB 3DT9A 3PR2B 3JQ9A 4CQJA 1DCKA 4M0LA 2IW1A 2IZZA 3AK4A 3JQFC 4P5EA 4JBYA 4NJEA 2RDMA 1GPBA 3WGNA 1ENOA 1ND5A 1XCGB 1ZGAA 2W71A 1NUSA 4KWIA 5B3JA 5JJLA 2BGTA 4DGSA 1O0CA 4I5GA 2BOVA 2FP4A 1EFRD 3GLHE 3PG5A 4NOKA 5D1HA 5HJ2A 3WHLA 5AESA 5KTMA 4QFBA 3UH1A 1EESA 3E3LA 3A1NA 3LNTA 2I2BA 3AY6A 1MUUA 1TA4A 4HLUC 2BFMA 3H5AA 3I9FA 3SEAA 1NNLA 2HAEA 4HADA 2XIJA 2AR9A 3FWYA 2ZRAA 2W4QA 4TWBA 4XVUA 1KH2A 2C03A 3CZ9A 4IH9A 3U4AA 3AEXA 3OU6A 1JEQA 2R6R1 2WDPA 1RYFA 2FETA 5K0CA 1D7AA 1P1KA 1VQPB 3RVBA 2SKDA 2DLDA 4DJDC 3EXEA 5B3KA 4BO3A 1N8TA 4ZQEA 3QFSA 4W9MC 2W8BA 4XMYA 1B23P 3K20A 2WFAA 3AI2A 1P5RA 4P7FA 3TI9A 1YI1A 2HJRA 1GZ4A 2PNFA 5J9FA 3AMVA 3FRIA 1TAQA 2R97A 4GS5A 1VSTA 3O6VA 3UQYS 1KIMA 2F3TA 4IDFA 5F5XA 3UNXA 1OB2A 1J5XA 2NXEA 3DPIA 3L8EA 1TM1E 4MDYA 1JGTA 4A27A 4A5OA 2CCGA 5JD5A 2ONJA 2HSZA 1J4AA 5EXEA 3Q5GA 2GB4A 3TCXB 3T5CA 5KNCA 3AESB 1HE1C 3R9XB 3PCXA 1RDFA 2AZ4A 4AFNA 1U28C 1H1DA 2BZ1A 2V5AA 3A6PC 1G5HA 1G8GA 1QWSA 2PGXA 5FPKA 4GWGA 2V9ZA 1UDXA 1U7HA 4E5KA 5C8XA 4AYWA 3H0CA 4IHJB 4UMFA 2ZR9A 5J4HA 4JP5A 1ZKMA 4JI0B 4JJEA 4XYMA 4NEQA 3VQTA 4LF8B 4ZJZA 2BH2A 3WTBA 4N3NA 2RB4A 2Q5LA 1T1SA 2R7LA 4OP2A 3UC5A 3UJ6A 2A58A 4BYMA 1G8PA 3MT8A 2GJRA 2BGIA 1E2KA 2D1QA 3IPCA 4JFRA 4EB6B 2QTNA 3BWBA 1Q17A 2C5FA 4G7XA 2H5IA 4ZOLB 1P18A 4YYEA 4ZVNA 2F1HA 2QM8A 4NZZA 5ALWA 4XIFA 4OXQA 1P75A 1KFBB 2GEDA 4ZAGA 3JAMA 1E3IA 1E6CA 5L40A 2Q4TA 1BW9B 3NGMA 1SXJE 3Q88A 1P4MA 4MS1B 3R9XA 3OE4A 3EJWA 1IN5A 3R5TA 1C7RA 1KQPA 2ZE8A 1JKXA 2FPRA 4M8SA 1I2CA 1XMSA 1U6JA 3LRTA 5LMUB 2CVFA 4JVMA 2CLSA 1ODJA 2R6ZA 4GE0A 1MMFB 7AT1A 1EFDN 1GU0A 2P77A 3FWHA 1OWNA 3L7CA 4IQ8A 4C0WA 5KQPA 2OO5C 3KTAB 4PZCA 4TWRA 5H9VA 1YDEA 2YDXA 3GLGA 2I6XA 1RW4A 4PHCA 5ERYA 5DCUA 1ST3A 3MD9A 5JVDF 1HZZC 2HDOA 1I01A 4ZU3A 1YFZA 3PTLA 3Q8MA 4ZVPA 3HWRA 4O29A 4F38A 5LD2C 5AVQA 5KTNA 3NR2A 5HK9A 4Q3NA 1ADYA 1JIJA 1UC9A 2REBA 3KC2A 3LNCA 4FUQA 3SI7A 1BW9A 3MINB 3DTYA 4FYJA 1A3CA 3B7GA 2RH9B 2OHXA 3Q9UA 1ISJA 2POQX 3ONNA 1Z5NA 5ILGA 3IEIA 5D3MA 3UHOA 2V7PA 5A6VA 5BPFA 1R9JA 1MIOA 4KIJA 2A0WA 3OTIA 3K0CC 5HPYB 3FPLA 5AQEA 4CKCA 5AM5A 1M83A 2ZL6A 1EBBA 4LG1A 1UXHA 4N49A 3IEUA 2VQDA 4WCFC 1F14A 3O2SB 2C92A 4UQOA 4AS2A 1E2BA 4F9EA 3GAMA 4ZMSA 4B40A 3CRVA 4PFSA 2Q7OE 1A7AA 1PE0A 1K66A 4IJ6A 4PSDA 1N4DA 3BKXA 3NAMA 4DLBA 5CA0B 1N9GB 1H2ZA 2NO1A 3I45A 1BC5A 1GAJA 2JAUA 4BLSA 1VJGA 4D97A 5CCXA 1IVNA 4UJ3A 1RQXA 5E9AA 4ASUA 2ZYWX 1Q0RA 2GN8A 2HA0A 3TVYA 4OHXA 3KJHA 1N6LA 5HF9A 1H4QA 4Z2AA 2VKQA 1II8A 5TPWA 4B46A 1EB8A 5JAPA 3KS9A 1OLUB 3VFDA 3R77A 5EUQB 4WZAE 3MINA 4MGKR 1T4GA 3WLKX 1X1BA 1AG9A 3Q3HA 4AMBA 1TEHA 2HWUA 3IRUA 4LJSA 4RVUA 4PNEA 4EDHA 4F4HA 4EBBA 3BRSA 5F4OA 1QGDA 2XMDA 4XB2A 3KXKA 1RCFA 3PEEA 4LYDA 3WB1A 2WHPB 4IDHA 3DG9A 1UAYA 4UEWA 4UXIA 1CE8B 1IEQA 2ENWA 2VQEB 5DBGA 4EK9A 2W98A 3SLDA 1GTJ1 3SC3A 4LV6A 1QYWA 5IM4F 3G5LA 1Q7BA 4GZ6A 4AKGA 1HMPA 3NXKA 3L0YA 3O7WA 3QPVA 1N9GA 4FKBA 5TR9A 1KI7A 1U3DA 4GOND 4XCQA 1RYEA 3CCMB 5DM4A 2W58A 4MX8A 4TKOB 4K26A 2IDZA 2NO0A 3UB4A 3FSGA 4EWLA 4RMHA 1BXZA 4UREA 1I2AA 1LJ8A 3NCHA 1NI4A 4UE2A 3OQMA 4AC9A 3W79A 5IK2D 1OLUA 1AV7A 3ABZA 1RS0A 2BKAA 4TKVB 4IMPA 2J9GA 5HF5A 1NB0A 2AZMA 4AN4A 4IIDA 1TM5E 1WD5A 3CCJB 3BJZA 3K5PA 4FTWA 3S2ZA 3PFCA 5JQGF 1XPJA 3LTNC 5HK8A 1KJZA 3R3WA 2Q1TA 3AEQA 1KE2A 2QR2A 3VPGA 4H3HB 1CE8A 1NVBA 2CDBA 1EVLA 1ZZGA 4BQOA 2VHJA 5FFNA 3Q40A 4RZ2A 3MD0A 5CB4B 5IMBA 2PZKA 3LCRA 4NATA 2HTEA 4G5SA 5LB2A 3EA4A 3ADBA 3ZCVA 1KO4A 3FKQA 3GJYA 2V96A 1HL7A 3HDTA 4URUR 1PD1A 1R0LA 4NDZA 4PYLA 4YJFA 3A2KA 5EA2A 3OEEA 3E5HA 3F78A 2P0EA 3D02A 3DMTC 5IFKA 1H6CA 4S1PA 4J9VA 4P2GA 1JI0A 2BGMA 2G1PA 1ABEA 1P6UA 2FCRA 4ZDIA 3SZRA 4QM6A 5EWJB 1CZNA 4TKVA 1XTJA 1YAJA 2IHZA 3ID6C 2WIGA 4DBLE 1SFRA 4M9XA 4NV1A 1DJLA 1KYQA 3P9SA 4QT4A 4MKFA 4EHBA 2QN9A 4YUZA 1QAMA 5K99A 1V5VA 3JQ7B 4GDMA 4YGXB 2AKYA 1SPBS 1JPNA 3IMCA 3PEVA 4L8VA 1KI6B 2ZEJA 3DZHA 4MAMA 3V2GA 3FOEC 1U5AA 2GAOA 3CNNA 4DADA 3AP3A 5CB4A 4TQUS 2XZOA 1YQDA 2YCLA 5BSEA 5FTKA 2H2GA 5F4BA 4AROA 2FSGA 1AT1A 3IL2A 4PZPA 4B6SA 4Z1OA 1D6JA 4FR5A 1QDLB 1ZCFA 3MOGA 2O8FA 6LDHA 2CDAA 2OD7A 5C7YA 3QEBZ 2QYSA 3PR3A 1WPQA 1T5DX 1Y4UA 3KXLA 4H59A 1YAHA 3C45A 4WNCA 1WUHS 5AHKA 1NAHA 1GCOA 3TDKA 4FE3A 1GUFA 4PPFA 4FDUA 1FYFA 1P5ZB 1VLOA 1U8AA 2GK3A 3U60B 1IH8A 5EWJA 1RXVA 1YQ9A 1WVMA 2IU6A 3R5XA 3AM1A 2XAUA 1XNHA 1MD9A 5INTA 1BHO1 2GYUA 1QVWA 5BORA 4NF2A 3JQGB 4WBNF 1JHYA 4U7DA 3R3YA 3JPYA 2YYZA 3GRAA 4OV6B 1GL3A 1N8KA 4QPJC 1V3UA 3IP7A 4LRSB 2EW8A 2DR3A 3WKAA 4IGIA 1M1UA 2C7OA 3GHYA 5LLTA 2WQ7A 3TSCA 1KI6A 1YB7A 1XDSA 2VDQB 4P82A 1EZ4A 2Y1EA 4EUKA 3PVDA 4H77A 3REFA 4PRKA 3JWHA 3CWCA 5BV8A 1UOOA 3IE1A 3LQEA 5GTDA 1QQ5A 2R6DA 2AQIA 3V3TA 2FG7C 1L4BA 3DFKA 4LYEA 2JLXA 1JYSA 2YJGA 3FB1A 1NYLA 1UJMA 4E7PA 4IQ0A 3T7IA 2W93A 5JXJA 4WWVA 3OWXA 1MO5A 4FDVA 4JUIA 5HTKA 1JIKA 3HJUA 3Q7EA 3UWKA 3MHTA 3EQZA 3V4VB 1GZ6A 3V6LA 1LDYA 5CRIA 1JBKA 2OQRA 4W7SA 9GPBA 3LKBA 2DSNA 3OOEA 1DEXA 4LXIA 1RAGA 1UQUA 1Z12A 3R5HA 2WAOA 3RVKA 2EQAA 3SXUB 3M34A 4RE6A 3TLYA 1R0YA 4DLWA 5A3RA 1J97A 5EOVA 1D2GA 2REQB 4X5OA 2VJIA 1MNQA 4JR1A 4CYMA 2BHLA 2VJDA 4HQFA 3A8JA 4WFJA 2DJ5A 3NTRA 4X6UA 5AK5A 1QP0A 2VCYA 4QNMA 1BVYF 4NU5A 2IS2A 1F2DA 3Q98A 1J0CA 4JGIA 1RQ2A 4AJNA 1BGXT 3THXB 3LECA 3UG6A 3V46A 3VR6H 4D8VA 5JFTA 4UNRA 3JARB 3L1HA 3DFMA 2ZULA 1STOA 3FTPA 4JNKA 1N5DA 2I6TA 2EFGA 2QMHA 4OQ4A 2FPKA 4XVHA 5FBQB 1IUKA 3VTZA 4CDRA 1Q7TA 5GZ3A 1EXMA 2O4CA 3GGPA 3GJ0A 1U98A 3FF1A 4M83A 4WKCA 4UHCA 2SECE 1AZTA 2PX5A 4KMRA 5BQXA 3BHIA 1Z56C 1K88A 1NLYA 4Q00A 3WLLA 4Z4VA 3R75A 3QUAA 3BXEA 1GZ5A 4I4CA 4Q4HA 4CT4B 3ZZ1A 2KVOA 1E8NA 3T5PA 3HBJA 2X4GA 3DTNA 4TMZA 1E2JA 3KQLA 2PGNA 5AHXA 1Z5UA 1E3ZA 1YZQA 1RC0A 4ICIA 4QWWA 1A2KC 3IC5A 1KPGA 4D0SA 1LBIA 3SXUA 4BAZA 4QG3A 3EJ6A 1BJKA 1PJ7A 2UZAA 1CNFA 4FKMA 2REQA 5I7SA 1E79A 4PTZA 4YJKA 1YR7A 3WWCA 3RYHB 2VF2A 2WNHA 3OPQA 4NCHA 5TQ2B 2WU4A 3TR0A 3ZU4A 3NT4A 3I53A 3SP1A 4CMGA 1TTPB 3QVTA 4NXMB 2FMIA 1ADJA 2NXNA 4EY5A 5B30A 3QLEA 4BEBA 4F6CA 4TMVA 3EXHC 3JARA 3HCDA 1EWTA 3MUNA 4JROA 2FEPA 2R66A 3E0XA 1DDGA 2PZAA 3MS2A 4KR0A 3HR8A 4LF7B 2WQZA 5AYVA 1UBLS 2G36A 1T4CB 4ND3A 4OBXA 4WXHA 5DYIA 2ERYA 1Y1LA 3PQ2A 3MWEB 2P67A 4GHWA 4OSOA 3K16A 5EXXA 3QEMB 1OROA 2UZIR 4DMFA 4A82A 2GD1O 4XGRA 2GK6A 1NUTA 1SHLA 3QKTA 1YF3A 3PRHA 3T3GA 4U6SA 3BRWD 1KS9A 4H6PA 5JS2A 5JNUA 1UM9B 4KPYA 3BSWA 1XHEA 4EABA 1PV1A 1V6SA 2IEBA 1UFOA 4IIYA 1W2GA 2RAFA 3GGOA 4UUNA 1L4NA 2G9RA 4PICA 4IDBA 4OX9B 2Q5EA 2Y1CA 4YCSA 3OE7D 3TOCA 3Q10A 4R5MA 3QLVC 5D3ZA 5TQ2A 3MJEA 1UH5A 3NKLA 4I3HA 3WDLA 2FPGB 3NJRA 1U80A 1JIIA 3W5AA 5JFOA 4OMDA 4X00A 4XLEA 3FJYA 3R6KA 5HYVA 1M76A 4AN1A 1QTQA 1AV6A 3GYGA 4HNAB 4CM8B 4J49A 3NHSA 1EIWA 2XUZA 3ZHBA 3RC3A 1JDJA 1Q12A 4JELA 4NCXA 3SZ3A 4HX9A 2ZWOA 1QVZA 1LSSA 4JC4A 4NARA 5EE0A 4PC2A 1NDQA 2Z8ZA 1SVWA 2KE5A 5AM2A 2FUCA 5IRCD 1NOJA 2RHOA 4JMQA 2VJMA 2X5OA 2YC2C 2ZJ5A 3OQPA 3QEMA 4LRXA 4Q1FA 4OFZA 3QVLA 4QGBA 4ND1A 1H6BA 4RXMA 4BVGA 5I48A 2V3WA 5TJHA 3B8EA 5IN5A 3KT0A 1IZ8A 2CJWB 1MX1A 4BE4A 1EK1A 3JASB 4XWTA 2FLWA 2YW9A 4BB0A 3J81A 3BY2A 1KEKA 1TQ4A 3AWDA 3G1WA 3ENWA 3TMYA 1KYIA 3HCRA 4DIBA 1ODFA 4EY3A 1ARZA 1UJCA 5K3AA 5JQWA 2A9FA 3P8ZA 1Z73A 3ANLA 4PRLA 2CDNA 4QATA 3HO1A 1UOPA 1C4WA 1K9SA 4R8RA 4CKXA 1IN8A 1UJ2A 1ZUD1 3SAJA 1Y89A 4BWVA 4RTSA 1HK7A 4MEJA 3AFHA 1QPZA 3G68A 3AINA 3U4DA 1ZEMA 3A10A 1T0UA 3QVVA 1GTMA 2JGDB 1VJSA 3A9VA 4MLDA 1F20A 1ULHA 4WDQA 2CCJA 5JTUA 2XVXA 1CDDA 1ETHA 2V7VA 1VBNA 2PSFA 2QG6A 3ASYA 2PUDA 5JJBA 2UXCB 3DKRA 1LJUA 4HZIA 3R76A 3ROZA 1DFGA 2PVCA 4E08A 4TTIA 4HS4A 1VE1A 5HILA 5LIRA 3S1SA 1GNQA 2CJWA 3AYZB 3O2QB 4EKEA 1UKZA 3TLXA 3T38A 4PNHA 3I1FA 3E7FA 5K0GA 4CU2A 1WZEA 1O94A 1YE5A 3B20A 4R7ZA 4Q4AA 3KXDA 5FL3A 1QPBA 4MMXB 1J5PA 2PSDA 1BDMA 2X7HA 3FE2A 4GM1A 1GQFA 3ZHRA 1I18A 4TKLA 1GKKA 1CRZA 3CTAA 2WHEA 1YHZA 4M86A 1XDZA 3PEUA 4X8LA 1KR2A 2QF7A 1L7NA 2ZREA 4BVFA 1T9ZA 2C7PA 1QRSA 5HZAA 1ORRA 3T41A 1JX6A 1PJAA 3LIIA 3I6YA 1BMDA 1FU4A 2DYKA 2JGDA 1MQAA 5DSZA 1EGMB 3OKXA 1JRLA 1VIAA 2ZDHA 3TOSA 5KYYB 1GAXA 5KREA 4AY6A 1OQAA 3BGVA 2C8JA 3U7FB 2BZSA 2QUZA 1GHTA 3EVNA 1H5QA 1RYHA 3P4XA 1F9AA 1YRLA 2FN7A 3L7OA 4R2XA 1A8IA 2FRXA 3ELUA 3TE7A 2IE0A 3OP4A 2X8WA 2ZYDA 4O4IF 4P83A 1RAFA 1DAMA 4CKWB 4TMKA 1SC6A 1TU3A 3B9PA 4L27A 1U81A 2QD4A 1CY1A 3CUVA 4RD1A 4RHFA 4X85A 5B1HA 4REOA 3GVLA 2DHRA 4LHVA 1NF9A 3WY9A 2M6LA 2QP4A 1KY2A 1MO4A 3DHEA 2FZ4A 3IBFA 4MA0A 4PZYA 1MR3F 1L6IA 1E9SA 2QX8A 4XIJA 2C04A 4TQGA 5FLXA 2A92A 2W6CX 2HLDA 4G1BA 2IXEA 3T0FA 2D6FA 3GVCA 3JX9A 4BBZA 2OAP1 1FSZA 3FNRA 3EIOA 1W4BA 2FPOA 5KYYA 2VUHB 3A06A 4ATNA 4MR8B 1N2GA 3EHEA 4FNGA 4AZ3A 3BB4A 1YONA 1VE3A 3KZCA 4JOCA 1DOHA 5KKCA 5K3FA 1CHDA 5DHPA 1WMEA 1I6MA 1K97A 1Z5WA 2O14A 2QVGA 4EY4A 1W4ZA 2QROA 1UBNA 2I5PO 2Q2NA 4YT2A 1Y8QB 4CKWA 1W44A 3B8HA 3CC4B 3AJEA 2HXGA 4FILA 4HPWA 1ZDMA 1MAAA 2GPTA 2ZUCA 3NGXA 3WMWA 4CW7A 3A0RB 2EDCA 2QGGA 3E1KA 5DXFA 3BWDD 3NRCA 2DM6A 2PL3A 3D7KA 1QIFA 3TSZA 1AQYA 1JQKA 5LC1A 1WZ2A 5IYPA 1WEHA 1KRWA 3AVQA 1E1YA 2D7JA 4D4MA 1C9JA 2VBCA 3BWVA 1IE3A 2OORC 4IYRA 4OU5A 4UPDA 3S4YA 3M9WA 2ZB2A 3EWIA 4EX6A 2JDID 3DBIA 4Z0NA 1T36B 3PNLA 2FUG1 4ED9A 3O8NA 1FW8A 2GS9A 1YB4A 1F8GA 3GCXA 3QV1A 3WNQA 1R0BA 4E30A 2X8LA 2I7TA 1G16A 4RM2A 3RU9A 4ZCIA 3AVPA 1GA4A 4KLNA 3CU5A 4OHZA 4CL0A 1VSQA 5COAA 3GJSA 5GWXA 5TQVA 4LQ4A 4JBXA 3P9QA 3O31A 5FA6A 5CIWA 1PAUA 3SHOA 4KQEA 1OC2A 1Y6FA 4YAGA 2Q8QA 2WC1A 2A35A 4LC9A 1OLXA 2VNJA 3DEHA 3IPRA 3TD9A 3PVZA 1Y8QA 3BDIA 1B16A 1AA9A 3EFEA 3MPUA 4IDEA 2GH1A 4WN3A 4YH1A 3UJPA 3KO8A 1MV5A 3DLAA 1J1IA 1KKUA 1MPTA 5KTPA 5FRDA 2W2XA 1XEFA 1T5LA 1UBOS 2DU8A 2IHUA 3JQDA 5CURA 3ZIUA 1HDXA 4JC0A 2WMOB 1C8BA 2OK7A 3F6EX 2FKAA 1L7RA 3DCNA 1H2HA 1CX9B 1G20B 2XMRA 3OKFA 3IUSA 3R0VA 1CJVC 2Z04A 1VCNA 3D1VA 1VHDA 1KA9H 4RVSA 1U9JA 4Q9IA 2VQ6A 5DULA 1SCBA 2ATVA 1QH0A 2QMZA 3GXOA 2FW7A 3ILYA 3ZEIA 4EHAA 1L5YA 1GFSA 4ZXFA 1OFUX 2EWWA 3O75A 1NAIA 1MENA 1QH1B 1HA3A 2MIIA 4EARA 1UADA 4E1BA 2HWXA 4HBGA 4QUHA 1EI9A 2ZJ0A 5A89A 3R4CA 4XQGA 1QRUA 3PD0A 4C76A 1IHXA 2WSMA 1C7FA 1WTAA 4G6ZA 3IPXA 5EYPB 2ZXHA 3ROTA 4LOAA 1NJ5A 2OV3A 4PO8A 2R8BA 4TXMA 5JSHA 4PGOA 3SYTA 4CG0A 1L4EA 3H5VA 1L2TA 1J1ZA 2NZUG 4YNBA 1YVEI 4NMLA 3KOXA 3H5OA 2I54A 3A1WA 4MGIR 4OMUA 2UVPB 1XBTA 1XTZA 5FUVA 2ZJYA 4ER7A 2BGGA 3RT1A 4X07A 3U6KA 2CE7A 2XKBA 3CISA 1Q57A 3MHPA 4LX0A 4X7PA 2A78A 4Q6WA 4Q3DA 1G60A 2DFDA 4HK4A 3LP8A 3ITEA 4I1RA 5FUWA 4ID3A 3OFSA 5FIUA 3E27A 5LMZA 4MS3A 4IS2A 3LM8A 2G1KA 2P6MA 4ZMBA 3HMKA 4EA8A 4J4TA 4N54A 5IZ4A 3IA2A 1A5SB 3WHKA 1QH1A 2HQOA 3VSAA 5A4KA 5ITZB 2I71A 2BFDA 2ECKA 2GBIA 4FHEA 5IEBA 2GREA 3T3IA 1H5UA 2CBGA 2P1DA 1RZ3A 5IUNC 1JILA 4Y6SA 1B74A 1UXKA 2BJVA 3BMCB 4QOEA 5IH3A 4V0QA 4GR5A 1CQPA 2PX4A 4I2NA 2ZVJA 1RBQA 2ASEA 1M1YE 3F8TA 3L9WA 2H4YA 1ZIOA 4TT3A 2HCFA 4U5XA 2RGRA 1YKFA 1LI5A 2VLIA 4M1OA 4LZNA 3HY3A 1RI2A 2BBWA 1LLUA 2FWNA 3DE6X 3IELA 3T9AA 4OQEA 3AR4A 5K09A 1AKTA 2IXBA 1PYDA 4OI2A 4J2TA 1TXGA 7MDHA 4Y2TA 2XRFA 5CT8A 5JSYA 4HDRB 1QIEA 3FTDA 3RIHA 4H7KA 3UJCA 2V7QD 2OGUA 3I37X 1KYTA 2R5NA 4UNSA 3ED5A 3EPPA 4Y6GB 3TSOA 5KMGB 3B7WA 2HPHA 1FFHA 2ATCA 4E5DA 5ITZA 2YN4A 2G77B 3D3JA 4TRRA 3D7SA 4TXHA 2WSSD 2XDQB 4ZP1A 2FZLA 4YRIA 3ZHSA 1CDZA 3VOTA 3VZPA 2VNSA 4EGFA 4YBRA 2AZDA 5CD9A 3M6UA 1UC5B 3QVJA 5KNDD 3ZY2A 1F7VA 4HO1X 1T5BA 4OAOA 5HFNA 3TNDA 3O03A 1DEKA 1V8BA 2AI1A 2M98A 4QGFA 3SDZA 2OHOA 3NIGB 3EUWA 1A2OA 2QDKA 4ND8B 3MTBA 5LN1A 1XYVA 1MC8A 3MUFA 4Q6BA 1FFGA 4DKJA 2C96A 3L0OA 1CYEA 1F2TB 2LZJA 2GLUA 4NU6A 3DMDA 3W5VA 1GRVA 3C98A 1Z0DA 3SNHA 2VA9A 1QYCA 4UUQA 3ONDA 4YRLA 2F7SA 3OI7A 2QNBA 3G2MA 3N07A 1KAGA 1D9ZA 1ES9A 4HDRA 3V8RA 1J9EA 1J9ZA 4JXXA 1JMVA 1U0GA 3G49A 4CT5A 3L01A 1L4YA 1UP4A 1H6AA 1M1NB 2G9VA 4G7WA 5ESRA 4IVRA 3REQB 2XDQA 4L8FA 2PVPA 4Y6LA 4CV1A 4BQFA 3VHXB 5AD1A 1F8YA 1G5RA 2HK9A 1JPVA 3EAGA 3HABA 2E89A 1OX4B 3F0TA 5DI9A 2XYRA 4WK6A 1JTEA 2VC2B 1N07A 2I1LA 1NVMB 1TD9A 4FBMA 4E5PA 1V7QA 2DWCA 3RSFA 4FCCA 3N2KA 1H94A 1SQ6A 4ND8A 1FP1D 2FWRA 4KREA 2EX4A 4BO5A 2WUFA 2HJSA 4O63O 5AVWA 4RQTA 2X7JA 1VHOA 5I7WA 1ZBDA 1HGXA 1JG3A 2I76A 5LBIA 3JU3A 4HGRA 5E4YA 1L3BA 2GFQA 3VR6A 1ESDA 1NC3A 5DCLA 4RSGA 4D3SA 1JDTA 2W90A 5E8JA 3HYSA 3LUCA 1DCTA 3I6QA 1JKIA 1NVTA 2Y9MB 5CFRA 3P0FA 1ZJJA 3PJFA 3K0HA 2OY0A 3V4PB 4D82A 5EJEA 5F9HA 1SR8A 2AG8A 4Y2GA 5IZCA 2KSQA 3BEDA 2OCPA 4Y1EA 5FHRA 2WSYB 2CMKA 2IVFA 5DYYA 4W5WA 1SXQA 1QAQA 1D6NA 4PFJA 1ZSVA 1O95A 1MB4A 1IXKA 3AHFA 3M6WA 1H9AA 5JI3E 3V55A 3VHXA 2WJ4A 3ML1A 4ZV9A 5CCDA 4LSZA 4L7VA 4OLFA 2WUVA 3K6RA 2FP3A 1SG6A 3PZRA 2VHZA 4W8HA 1VIVA 1QHSA 2RMKA 5DOVA 5ICFA 4AZ0B 2FWJA 2VI5A 4DMUB 5JEDA 5A4MS 1KMHB 4J0DA 1XPOA 2NTEA 1JHRA 2DVMA 4MW9A 2QJOA 4DAEA 5LP6F 1IEVA 2ESRA 3L0DA 3FLAA 4YRCA 3GA5A 3B78A 1YJBA 2J46A 2JKVA 1F3OA 2IUFA 4KI7A 4YRNA 2W6NA 3I2YX 3GJZA 1NT4A 1PL7A 1R15A 3NNNA 3G88A 4KAFA 2ZS8A 4TMWA 3E1SA 1U0RA 1W29A 3P20A 1ZOLA 5FTJA 1SIUA 1YHYA 1WUTA 3TLGB 3MSCA 4PFKA 2WSLA 5ECGC 3ABRB 2G06A 5TMDA 3L0CA 2JFWA 3H5TA 3QA3E 1Z2CA 3T95A 4JLAA 5L3SA 1GDDA 1Q1BA 2Z4TA 3OECA 1L5MA 1JDZA 2I0FA 2PQ2A 3G8BA 5JD6A 1I4WA 1U2TA 2HL6A 2YZNA 1BCRA 2NACA 4CCYB 3UMBA 2NADA 3AZQA 2B8JA 5ANRB 5FPYA 2RH5A 1IG3A 3LDGA 1DELA 3A4YA 4AZ0A 2Y0PA 4H6VA 3RROA 4F45A 5KQMA 3IIMA 3E9MA 3CKMA 4LECA 5AWFC 1JR4A 1YA4A 2WIDA 1KMHA 2QEXB 1JIVA 5EESA 3RHFA 2BFAA 3K5HA 2YIJA 4C7OB 3GMIA 2HSGA 3DE4X 3GA0A 3VU1A 1CHNA 4RANA 3SHVA 3KYCA 3VDRA 2IYQA 3GLKA 5KTOA 1LPPA 1Y9EA 2NTJA 3LHIA 3L7KA 1W0JA 4C22A 2FDXA 1JF8A 1OASA 2JFNA 5K51A 4M8LA 1N34B 2RAUA 1IK6A 3A70A 3H87A 1M2VB 3O3OB 5G3ZA 5BQ5A 1KSJA 2P5UA 3C3BA 3I0MA 3TLGA 6ABPA 4EGCB 1RPZA 1J39A 2XVMA 1ULAA 2YXBA 1HE2A 4XCVA 1MO3A 2CLKB 3MJFA 1D1SA 2HF2A 2ZTVA 4RK5A 4S1TA 4TSFD 1OCEA 4BNVA 5GZ6A 4CUKA 1E3QA 4M7RA 4TLEA 1OHHD 1AKYA 3FFBA 5DNAA 3NE5B 1BMQA 3KQYA 2H00A 4CCYA 3IOCA 3G2LA 3Q6RA 4TX1A 2ORED 2VUSA 3ZJUA 1LVUA 1X8XA 2QV0A 1NWHA 2ZE5A 2F3RA 3WK8A 1KC1A 1C1XB 5IHPA 2ZITA 5EERA 3ISXA 3H5IA 5ALUA 2ZBEA 3UJAA 4CE6A 1I3LA 1PR2A 1G2QA 3GFRA 4HGNA 4RMJA 2E4YA 1GADO 3PX3A 4PZUA 3TL3A 3TLZA 4GWKA 1YLOA 4EFNA 1ILWA 4WK4B 5I8PA 4NENA 2X2FA 4A1OA 4EO4A 2K6GA 3N58A 3TTTA 2CUNA 3F4BA 5E2BA 1NV8A 1Y6JA 1QVVA 1M2VA 3EIQA 4NEHB 1YBFA 2QI9F 4J0FA 3U5TA 5IWAB 1U2GA 2QU8A 2ZTMA 4TTRA 1XZEA 1D5CA 1KMQA 3OCWA 3FTFA 3AFNA 1AKRA 4FEGA 1W9HA 4B45A 2RD2A 4F9TA 1P4RA 1HDIA 4ND4A 1NDHA 1V1MA 4O4JB 4WLNA 3LP5A 2IW3A 4KUGA 1FQJA 1HOTA 5CDFA 2X6TA 3BULA 3H0EA 5JJIA 5AJUA 3GJQA 1N1GA 1GGHA 1E59A 1QGED 4G09A 3ZXXA 1EAYA 2HA6A 5IANA 4A6PA 2C5HA 5JRJA 3GLUA 1QSGA 2E55A 3IT2A 2VK4A 4F06A 4AUEA 3HDYA 2XTNA 1C1XA 3S2UA 1T8YA 2FX3A 3WFJA 2OWDA 1BFDA 1KMNA 1GL6A 2VNHA 2WDZA 1U6KA 2YXDA 3S70A 4LRWA 1QUFA 1PKEA 4WCDA 3CO0S 1C3OA 4M89A 2YJ4A 2CRVA 4IFBA 3RDPA 5JJCA 2JL1A 3PQ4A 4KR6A 5BQOA 1IEWA 3VJKA 2ZETA 1FDSA 2C78A 1W4LA 4JJZA 5AW5A 1CEYA 1OVMA 1NZDA 4KR3A 1QCYA 1B6RA 5E7JA 1RVV1 3SVTA 3EZFA 3OX4A 4HYYA 1VL1A 1TMOA 1R6VA 2OFWA 4O4JA 4D74A 4CQLB 2RGAA 4HEQA 1NRIA 3R6TA 4QYIB 3U0VA 1NT2A 4A8JC 3TNFA 1QIJA 1XXLA 2HHCA 3NVMB 1Q86D 1E6EA 4LVCA 3T9EA 2WIKA 4OHBA 3GOQA 1DG3A 3H11B 2F6RA 3QVGB 5DJ5A 1IXYA 4W5NA 3CMMA 1NATA 3NYRA 3LF2A 1DDOA 3O8BA 4I9NA 5CMLA 3DKPA 4D4KA 4IWXA 4DR7B 3C5WP 3EGXA 4DJTA 5HGXA 3H9GA 3IP8A 4P54A 4C2BA 3WSVA 2OV1A 1S02A 4CLRA 1WF6A 2EKPA 1IDN1 1H5NA 5EIAA 3I04M 4RLHA 3ROMA 5LQKA 3KQHA 5ALOA 3UWDA 1SVIA 2GPAA 3LL4A 4Q9DA 2VBVA 1PJ6A 1U0OC 2PQMA 4UEOA 2NU8A 4EO7A 3AKZA 1EGHA 4B6QA 4A3SA 1SKBA 2Z09A 4H6XA 3MM4A 1FLAA 1ECCA 2QAGB 2C0QA 4EPTA 5C5IA 3CH7A 1HNNA 3ZEAA 4V03A 2NPIA 3W5CA 3S5JA 3K70B 4TSRA 2XUIA 3R44A 4QYIA 2K4MA 2G09A 3UJ8A 3FJOA 1OI2A 4BNLA 2J6CA 3EGWA 1HV8A 3G8CA 3H11A 3QWIA 4IIUA 4PPGA 2FTKE 3RIGA 4GF5A 3AGQA 4G0OA 1VQ1A 4OHPA 1G8HA 1R0KA 4P7GA 3FVVA 3C39A 3QNWA 2QSJA 3NTLA 3M6IA 3NASA 5DS0A 4L1KA 1TDJA 4I50F 1QK5A 2G7MC 4AJOA 3CP2A 1Y5RA 5JZBA 3ZCUA 2FH5B 5I3CA 2DEUA 3WYAA 4NAVA 2VP4A 4YAJA 1U63A 1Q15A 2CNBA 4IQFA 1JB1A 3UOWA 3A35A 4S12A 1R2QA 5A7FA 5HNKA 5ENDA 5LYYA 2XZDA 4QTUB 1ENZA 2QAGA 5EQJB 5BVHA 2HNAA 3C0KA 3EGVA 2JIBA 4QBGB 2CL0X 4QARA 3W8NA 4RH3A 1M6WA 2IYYA 1OT3A 2B8WA 2ZTGA 1ODSA 1VLZA 3F74A 4M6WB 1LJLA 3L4BA 1QGOA 2E6KA 3GUUA 1OXMA 1T0BA 1YCGA 2DF8A 1J8DA 3D8HA 3QKRA 4NZPA 3EC2A 4HE6A 3R4VA 4TV9B 1JHPA 1WW8A 4IS3A 4U7PB 5BSTA 1FL9A 3OJCA 3R3VA 5JDIA 2HA4A 2PKRA 3AI1A 4YPVA 3P1JA 2COEA 4HGYA 1GOTA 2JHFA 1Z7WA 6CHYA 4NS1A 3B9QA 4UMDA 2ZUTA 2ZRMA 4Z8XA 3V8NA 1TM3E 2FEKA 1UBEA 2B1JA 3CUUA 3WL6A 1WMAA 3AJ8A 1T9HA 1V5WA 3H6KA 5DDIP 2BC9A 3WSTA 1NL3A 4IJ5A 3OFVA 4KKUA 4P25A 2AUTA 4UBOA 5EHQA 3KOMA 3CRMA 4D9EA 1P3JA 1RLOA 2JIQA 2OFOA 2VEOA 4FXPA 4TV8F 4Z1MA 3JR3A 3GDGA 2R7KA 3SEQA 2DYIA 1C3EA 4JLBA 4BJ3A 2J9YB 4IVNA 2CLDX 5DISB 1NYQA 3NIWA 2ODWA 5GPBA 1YU9A 3VVLA 1TA9A 3I9OA 4GKJB 1KY4A 2WOJA 2FSSA 2OBMA 2FGKA 2VH1A 1OU4A 1JFSA 3UPTA 1BHSA 1CR6A 4F5EA 4HIZA 1G8FA 3IJRA 4LXHA 5HJEA 4DV3B 1H4SA 2YWDA 5AVUA 4R2MA 1DJOA 1Q44A 3TGLA 1DX9A 3QWFA 1R18A 4F3TA 2WAMA 1Y63A 4P9NA 2ZIGA 2N1MA 3PEWA 1AO3A 3BJRA 4PGHA 3MGAA 4RV4A 2GAAA 3A6EA 2DTEA 3FNHA 2I55A 1LGYA 7GPBA 1JAYA 3AERA 3FHJA 4AJHA 1V9SA 4L72A 4D26A 1I3NA 1EGAA 1EK6A 3FI9A 16PKA 4QU9A 2JGNA 3C87A 5KYWA 2PXCA 4DLYA 1MAVA 4LDQA 3MF4A 1HQYE 3DO6A 4IGAA 3TXXA 1JIUA 3WLRA 1AIPA 3SHQA 4URXR 3QOFA 3IR7A 1LSJA 3I4FA 3PE6A 4L73A 3SJAA 4EHLA 1QQTA 3I8OA 2GZ2A 4IQGA 4G8JA 3UMCA 1GO2A 2HIMA 4JCOA 3L7NA 2MHCA 2Q07A 1QHXA 4DIOA 2RGNA 4ZIRA 1RZUA 3O84A 5BMOA 1LPAB 3WRXA 3LG2A 2BR5A 2C2KA 1E9FA 2B6NA 5CT9A 3VNUA 1YJWB 4DM3A 5J58A 2H0RA 2W00A 2ZCVA 5L9AA 1NKTA 4MUBA 1WZIA 1FX0B 1AQIA 1MORA 2V6IA 4MV0A 4N9QA 3UPDA 3QX3A 2HFJA 3B9BA 2FPLA 3ZQUA 4LMPA 1MQ9A 1IUOA 4JB3A 4KC0A 1NXQA 4G5XA 2V45A 3V8PA 1LBTA 1LX7A 3MWDB 4HGQA 1ZVQA 1OTHA 2LD4A 5HQJA 821PA 3HM9A 4FOSA 4ZT6A 3S2GA 1VQNB 1K98A 3U3MA 2OKCA 3R7NA 1RABA 4H4DA 1CUXA 1NSYA 3KQPA 4UU1A 3HXOA 2FPUA 2ZVPX 5CH3A 1WSRA 3I5YA 2BV3A 1TD1A 1MH9A 5E7QA 5BRJA 4B87A 2BMWA 2TRSB 4C0SA 4H6WA 4RDHA 1RBYA 5EKUA 4UTZA 4J16C 1E2QA 3F7OA 4B3MB 2ZI7A 4K2AA 4MLPA 4HOYA 3DJYA 5H81A 4QXRA 1YCDA 3OQ1A 3DR3A 4ZAWA 3P96A 4I4IA 3CHYA 3DZIA 4L6CA 3UIEA 2PNJA 2EW2A 4N6GA 3DMNA 4B4WA 3PU6A 3W9YA 3QFCA 1IATA 2NXWA 4NZOA 1ZITA 1FDIA 3GWGA 2AOXA 4KDFA 2O6HA 2VYCA 1R37A 4EP1A 4GM4A 3I42A 3MWDA 1ZRMA 3E9YA 4QT0A 2XWPA 2POCA 2YC4C 2G0NA 2XQFA 3PNPA 2D5AA 2XV1A 3ACCA 4D9CA 5FBVB 3TSAA 4LJRA 4DA9A 3O3MB 3H6HA 4GEKA 4I9GA 5LL6P 2C0PA 3JAKA 3LNNA 1DNPA 2Q3FA 4IG9A 4RKQA 4RS4A 1JAHA 3PNMA 4JSTA 4XE5A 5LMNB 1Z4QA 1A4UA 1BEEA 1AKWA 1Z4IA 1Y33E 4G81A 4K9LA 3PC6A 1Q7EA 2QQGA 2PRIA 4R1OA 3VKWA 3WHPA 5AW7A 1G18A 2PZFA 4GDFA 2EZUA 1RXSA 5E6SB 3VVMA 1AS3A 2XOKA 1QX4A 2IBMA 3ROXA 4E5SA 1E7QA 4DHEA 1ISGA 2WABA 2C5EA 1NIJA 1UODA 2IYTA 2O2YA 2W6ID 3GUHA 3FUVA 4ZZ2A 5HZHA 1EE9A 4XWAA 4CCSA 2B83A 3W4KA 4KAAA 1DARA 2AMLA 8AT1A 5DX1A 1GCGA 2JKZA 5FQNA 5JALA 2QJTA 3A4MA 4I4TB 5KKNB 1VSUA 2YFQA 4EKYA 4EY7A 1HFJA 3HWWA 3H9UA 1O87A 2EBFX 4WD3A 2H65A 2XF2A 4E12A 2A5LA 1NXWA 1Q0UA 3A14A 3KVYA 4CKBB 3O3NB 3GLTA 3ICEA 5DFAA 1VJTA 1IOWA 4A0RA 4NH4A 2I4MA 3VKVA 3NTOA 4BO9A 3KV3O 3ZH9B 1SHJA 1KD1D 1D1QA 4B3JA 5IDVA 4LZPA 4BO0A 3PXBA 1X7ZB 3WNBA 3AXTA 1IQUA 3CUSA 4K9QA 4MKXA 1A9RA 2XWBF 3ZWMA 2BP7B 4D6XA 1AKUA 3OO1A 4F3NA 1IM5A 1KZ6A 3KYDB 3RTEA 4BMSA 5C7LO 4NFLA 5IF9A 4K0KB 2VYQA 1JXAA 1BXGA 1X3SA 3ZQKA 3U37A 2BIFA 3GJXC 3I1IA 3MJVA 5E6SA 5JDCA 3OKAA 1U4NA 5HCIA 1VHEA 4P84A 3WIDA 4RETA 3T06B 1A69A 3EZLA 4FSHA 4ZCPA 1K6MA 1QB7A 3NTVA 1XHFA 5CLLA 1CQIB 2UKDA 1ZM2A 1TLTA 3AIKA 2FR1A 4C03A 1Y6ZA 3I9V6 4M0DA 5HM8A 4JI2B 2YV4A 5AXDA 3AYXB 4I4TA 4X8MA 5JOQA 3AUXA 4QKQA 3B2NA 4WKPA 3UAWA 2HV8A 4DR3B 2UZ4A 5CHYA 1DBIA 1NUAA 4LRUA 1FP6A 4OSEA 3LA8A 1TAGA 3AF0A 3T8YA 3ORSA 1X7ZA 2RIRA 3NHZA 1WM1A 3DFIA 4GBJA 2BP7A 2TECE 5EIBC 4KXWA 4WCVA 3KEGA 2A4MA 3LUBA 1IY0A 3I72A 3X44A 4NBLA 3NWEA 2Z1MA 2V4MA 2W2MA 4NOJA 4LX8A 3F6PA 3WMXA 3QV2A 1SKAA 1YCHA 1BLIA 3HV0A 1SRRA 1SUAA 3G79A 3RYIA 1QV7A 1DBVO 4F56A 3VMFA 3HNRA 3COZA 3LC1O 5GJWC 2HJHA 2QN3A 3WQQA 5F2NA 2HT1A 4CM9D 1W2HA 4FZ3A 1Z8NA 2ASVA 1Q0QA 3F3YA 4Q47A 3QEJA 1OFVA 2CLIB 4QHSA 3LBYA 3N87A 3F4KA 1XTKA 1ZOIA 2IT1A 3TB6A 4LRTB 2EC5A 1JHXA 4YCAA 2ZSEA 4LNUB 1KZYC 4LZWA 3NEPX 3QMWA 1TMGE 5AK6A 1SWVA 3L46A 3ZLVA 1L3CA 1TRHA 3L0IB 5CXQA 4OHVA 4DJEC 5IWCA 3A6KA 2R0QC 1SOVA 3BXGA 4LKRA 3HR7A 1JQJC 2ZOSA 1KYWA 3BMNB 3IOBA 2KHZA 4PLGA 4CRWB 2OTCA 2QUKA 2P79A 3OJEA 3O9VA 4PYQA 3N2YA 5IAEA 2W9XA 5FUYA 3GSIA 3F71A 3GFQA 3NP9A 4E6EA 4EZIA 3NJ4A 4AKIA 1Z7YA 2HA3A 3OA0A 1SUCA 3DD1A 1NFRA 3P0EA 1R0ZA 3M6VA 3VSDA 4MQEB 4MIEA 4L4RA 2AR7A 5H68A 2JG3A 1VMKA 1CK4A 2MSWA 2H59A 1GYPA 4WKGA 3QZUA 4PWZA 4LS3A 4EA6A 3VAAA 9MHTA 1R4ZA 1L5GB 4CKYA 1N2EA 2OR3A 3A31A 2QN2A 4ZVVA 4LNUA 1P62B 1H6DA 4MRAA 4OGGA 2BMJA 4U00A 1I30A 1SK8A 3KB8A 4QFDA 3VUFA 3DYIA 1ML3A 1AZWA 1O77A 1XZHA 5BUSA 3ODGA 1JHZA 1F7UA 1UCFA 5JZSA 4N6OA 1KHHA 3WAKA 4DK1A 3PA6A 4RGYA 2GPBA 4EAAA 2FSHA 3SFVA 3ONVA 4NBKA 5HP4A 1ZH2A 2IF2A 3IPAA 1U99A 2D8AA 2ZZGA 2PUJA 1UJ4A 3EB9A 4MH0R 4UC0A 1M2OB 4OQZA 3CXCB 4UDYX 1EEHA 5K4AA 3ZZTA 1Y7HA 2ZJFA 2G9QA 3NWPA 5BW6B 3RHZA 2FZVA 1XNRB 6Q21A 5J2TB 3LGSA 1NQUA 5E4JA 3JALA 3FHLA 4MQEA 1T2FA 2QW8A 2WLSA 1UMKA 3GEHA 2G8LA 3NRBA 3ZY6A 5KQSA 2XB6A 2WMDA 4IIFA 1ZWLA 2B4TO 2H06A 3NV7A 4ZREA 2PUAA 2BGJA 3U6BA 5L3VA 2JJ8A 3T1HB 4OPSA 3TQHA 3KXPA 3RD5A 4GLLA 4ZYVA 2H57A 5HX7A 5EIBD 2SCUA 2ZIEA 4G0YA 4D44A 1W581 4D98A 4O4HB 3MQ2A 4UUAA 1T4BA 2ZS9A 5EFZA 2A9PA 1ZI8A 3UJBA 4TS1A 5LVAA 2GK4A 3AVWA 3ENNA 2J6IA 2JJ2A 1WPRA 5FNVB 3JSXA 3ZQ6A 3JTMA 4ZVSA 3WA6A 3E3NA 2NG1A 4OVKA 1NQTA 2W4IA 1OKKD 1QFMA 1PBNA 3OZAA 4CMCA 2RHLA 1ISMA 2OM2A 4PINA 1XDWA 1HX7A 1B0UA 1CV2A 4DVJA 2EXXA 4JR2A 2OXCA 3ZTTA 1XFAA 1OOEA 2C1ZA 2E48A 1OU0A 2GEUA 2M1ZA 3ZS8A 1RYYA 2WKWA 1XJQA 4F1WA 4K6OA 5I51A 3CCFA 3FPBA 4JLSA 2NZYA 4DDTA 1XFOA 4FQ5A 3U7QB 1A1SA 3PTZA 3TUJC 3A04A 3IPLA 2Q1XA 3C1OA 5FPQA 3HRIA 3GLHA 3RC7A 2CMDA 1SULA 4CIYA 1C9MA 5B7PA 4GLOA 4UAJA 4C87A 2MMGA 4WXRA 4O4HA 3OICA 4E2FA 3KU1A 3UJ3X 5KYGA 3HCCA 3QELB 2X23A 2OHIA 1UPXA 4L8LA 3GGGA 2AYXA 3MB8A 1O97D 3QVUA 2PKWA 4QICA 4BDSA 4BNMA 1T0JB 3BFXA 2HSJA 2Q3HA 1GJRA 5AMXA 1I0ZA 3M6XA 4KYUA 3GEGA 4GPD1 4BC0A 3K8QA 4QSMA 1RQ7A 4LOIA 1EFLA 5FL7A 2IL1A 3LCVB 1C2TA 1EA5A 4D56A 3ONWA 4JYZA 5CXSA 2P69A 3OIFA 3NRJA 5A9RA 5CFMA 2R3SA 4X7BA 2CFTA 3D8RA 5CA0A 4EY8A 3DQZA 2AT1A 3BM5A 3CPJB 4WBNA 1ZN2A 3WYBA 1GSAA 2XUFA 3D31A 4LZOA 4Y1GA 1E62A 5DTJA 4PANA 3T5TA 4DLAA 1CNMA 5K01A 1QQAA 2I29A 3NTQA 4DCUA 5JR3A 3QX9A 1WORA 2EZ8A 4ZYUA 1QIGA 3BGWA 2HQBA 3DOJA 3EC1A 4KQGA 3U7QA 2BFWA 4U02A 4R1TA 4BV3A 4KMSA 3CZMA 3EW9A 5C8YB 1S8NA 1NSFA 3LQYA 5KQRA 1DEHA 2B4RO 2Z3VA 4C21A 2P9ZA 2IP4A 2M6RA 2WHYA 1M7BA 4GPZA 1M90D 2JI8A 3Q5DA 2JFPA 5JBIA 1CRPA 1TQHA 4ROSA 3WO1A 2LNDA 3WB2A 2I7VA 1M34B 4ECEA 1QJ4A 2VNKA 4YFVA 2L17A 4EG4A 2G4CA 2JH8A 3M81A 3OZVA 3AG5A 3ZU3A 1XSEA 3JSAA 4CLOB 5AVYA 1E5TA 4DS3A 2GRUA 1NW3A 2GYWA 4KXYA 1YRWA 2H9AA 3Q0TA 4QUGA 5DT2A 3RGGA 4F96A 4XM2A 3GJ6A 1WMDA 2X5KO 4TQAA 5GJCA 4BMOB 1DL5A 3OTOB 4ARVA 4Y2QA 5LZ2A 3ZDQA 3DH0A 4UOQA 1E6UA 2W6MA 1B41A 1KVQA 3BK7A 3OSZA 4BLQA 3GVHA 1A98A 4Z4CA 3CMAB 2YKGA 4GKKB 1GZDA 4L08A 3FCOA 2PS3A 4UFNA 3UY4A 1VQ5B 3K94A 1TLFA 3BZUA 3ZQ4A 1FJ2A 1HWYA 5K0LA 1SUPA 1UKAA 1J06A 4RESA 3WK9A 1SXJA 4JLNA 2XGJA 3MBKA 1EXWA 4XCXA 4XOTA 1SBCA 1CRQA 4EFKA 1DIHA 4JJGA 2FHPA 2D8MA 2WE8A 3C7TA 5PGMA 3SZMA 3N5KA 1WDKA 3DUWA 3PHGA 3IDOA 4GRDA 1B8VA 2JGIA 4Y2PA 1VE9A 3U1VA 2PLFA 3G9TA 3KOZA 3WB9A 4C7JA 3UJNA 1VYUA 1QLHA 1TE2A 2D1SA 2XVZA 4PR3A 1B8PA 4DV0B 3P0HA 4RA6B 1NBEA 3U44A 4OI4A 2EEPA 2GTIA 5CYFA 4CM5A 2PGJA 2SBTA 3GCWA 1H2RS 2R1VB 2Y1KA 1HDRA 1SK9A 1NMYA 3KK0A 5HBRA 3ASRA 2XVAA 4Q39A 5HQ3B 2J0EA 2Q4DA 3WWPA 2NQTA 5A3QA 4XLLA 2J3JA 4FLMA 4KFUA 5F9MA 4AM8A 5HCNA 1KDZA 3K2EA