5FIUA

Binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXY-ADENOSINE SYNTHASE
publication title Exploration of a Potential Difluoromethyl-Nucleoside Substrate with the Fluorinase Enzyme.
pubmed doi rcsb
source organism Streptomyces cattleya
total genus 80
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5fiuA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5fiuA01
5FIUA 2C5BA 2C2WA 2V7TA 5LMZA 2CW5A 2Q6IA 2C4TA 2Q6KA 2Q6OA 1RQPA 2V7WA 2WR8A 1WU8A 2V7UA 2CBXA 4CQJA 5B6IA 2Q6LA 2V7XA 2V7VA 2CC2A 2ZBUA 2C4UA 2F4NA 2ZBVA 2C5HA 1RQRA
chains in the Genus database with same CATH superfamily
3UB4A 2NUPA 4LSGA 4X95A 3BMCA 1ML4A 4HB4A 2XUOA 3HTXA 4BGUA 1A4IA 4P4NA 2NN3C 1K6JA 2BEJA 4JASB 2RDMA 5AKKA 1E3JA 4M1SA 4MINA 1BXZA 3OU6A 4Z4QA 3GQVA 3LUCA 4QJ4A 1VQMB 1CIJA 2YWXA 1Z75A 4TLAA 3OBBA 2W90A 3K0FA 1XT6A 1ZUHA 3D1JA 4JQYA 1JBQA 2VP0A 4KQMA 4OP3A 3RWMB 2X5OA 3EAQA 1JE0A 4MVJE 5AKZA 5ED4A 2BLLA 2NV2B 2BKXA 4HDNA 2AJCA 4I1UA 4KH0A 4P5PA 1ZVVA 2IPLA 5ALDA 1L5KA 1N08A 2YHAA 3DCNA 4URXR 5AVUA 5F23A 4MVJI 1Z5OA 1V0FA 1Y9JA 1GQQA 2WDZA 5C32A 2VNHA 3KSBC 1WKBA 3EZGA 5MN4A 4CKBA 2J46A 3T4UA 3VHRA 3C5EA 4YCSA 2V9PA 1E3XA 1R5NA 2C4NA 2G0AA 2VYNA 3HXLA 5ENDA 3WLEA 5IT4A 1Q7CA 4KACA 1GP2A 3C3YA 3U2QA 2WR8A 2YMPA 1RJWA 2GN6A 3Q5DA 4K9NA 1QYIA 1T2FA 4Q1DA 1PTJC 3K1AB 5DZSA 3CZRA 3G0CA 1D2RA 1E1YA 2LV8A 3G8AA 2CVOA 3ZN2A 3KQUA 1IN4A 5A4KA 1VXOA 5C31A 4ER0A 1M34E 3LWZA 4HN2A 4BLRA 4RPCA 1DO2A 1EP9A 2PBLA 1WOOA 2O1SA 2GJRA 1ZYUA 5FUVA 4FFDA 2E4XA 1ZK2A 3CPWB 1CJUC 2AKAB 3ER6A 4FI3C 3DYVA 4K9PA 3VR2A 5KWSA 1NXTA 4RF4A 4PYIA 4BKUA 3K8YA 1RQ7A 2JGKA 4KMMA 2P2CA 4J3FA 2B9VA 3N6XA 4PS1A 1JIKA 1RQGA 3VSCA 3ZBTA 1QOPB 2BKAA 3E5RA 4QBGB 2GM5A 4ZRMA 1DOHA 1KYWA 1UDAA 1W4ZA 2XYQA 4IUDS 5JG7A 1KSHA 3TS1A 1DBRA 2PQ2A 4Q9NA 4AXBA 4BZPA 2EEPA 3SSMA 4IZHA 2GZHA 2RK3A 4MV4A 1SEPA 1XXHB 2R6CA 1T5EA 4J2OA 4MARA 2PSHA 2GXAA 4XFJA 1XZCA 2Z3ZA 1HDOA 2JHCA 1AS0A 3OC0A 1EK5A 1O94C 1SVIA 3BGDA 1E3WA 3H4MA 4GM4A 5ITZA 5LOVB 3PTAA 1X1CA 4DHWA 2TMDA 5JRZA 1QIEA 1DEAA 1JIIA 1PR1A 2GPSA 2OD2A 2P9QA 2ZUSA 4XW2A 1KEUA 5G1PA 1TMOA 2Z5LA 3IVAA 4ZI5A 3WL7A 5CDHA 3HXTA 4HTFA 1DKMA 2QW8A 4CT5A 3RPEA 3LF1A 4G84A 1NSFA 1WZIA 3YASA 4JJKA 5HZHA 2Z09A 1W34A 1KOFA 2ACVA 1EP3B 2FW7A 2N46A 2PMCA 1IULA 1YJBA 3DAHA 2GQ0A 3G05A 3P9QA 1PAUA 1RWBA 3PNLA 5DLDA 3RJTA 3FH0A 4DMUB 1AO0A 4GS5A 3ZY2A 3VO2A 1OBOA 2XF2A 1QH1A 2W4MA 3E8MA 1SBZA 4YRPA 1PFYA 2C9MA 1JZTA 2VCEA 1ZUD1 2VHTA 3H9BA 1DPGA 3PQEA 4WOCA 3RT1A 2HM7A 3EUAA 5FDFA 3LT5A 2Q0SA 1ECFA 4M7RA 1V5FA 4XL9A 4AJIA 5EIBD 1VOTA 4IWYA 1FP7A 3C1OA 2DWPA 4AO7A 4XM1A 5A3QA 1Z8HA 5F33A 2ZKLA 5TJ9A 3HVHA 2BKEA 1WXXA 4D97A 5FLKA 4U63A 2C83A 2X8BA 3JS5A 2GZRA 1FLNA 2QRJA 1XDWA 1RLJA 4B2LA 1AKVA 1KEZA 1SKQA 1JDVA 1RSZA 4L7QA 1IOZA 4QJIA 5AJZA 4UOZA 4WXRA 1KRWA 3FCYA 4BIIA 4ZI7F 3ETNA 5BSKA 2W2OA 3ETCA 3RIYA 3ZY4A 3GCGA 1S96A 1MA3A 3AF1A 3F1LA 1J21A 1DRKA 1DG9A 1SVNA 3KTFA 5FTNA 5BQ5A 5JW6A 1ZMRA 2NO0A 5ESWA 4WXPA 4XKJA 5BNWA 1UQRA 2QL6A 4IDOA 4QTZA 5ECYA 4NYMR 4RFLA 5IPFA 5IASA 3JQEA 1G8SA 1V8DA 3AO0B 1V6CA 3IAS1 1XMJA 2VJKA 4B32A 4AUMA 4C0AC 3RAEC 4GGMX 1T4MA 2V6FA 4H0FA 3O82A 4NNPA 2RKBA 3FJYA 1Q7GA 3DEIA 4YXFA 1IJBA 1LBQA 2E6KA 3CSSA 4FFNA 1OC2A 4YJ2A 1YF3A 3H7IA 1O6FA 1CY6A 4TWAA 1G7SA 3WGZA 3IFSA 4EY4A 4OB8A 2F7SA 4DIDA 3N8DA 3GZNB 1E7SA 3EGIA 4P9NA 5FPSA 4V0OA 4BKOA 2GVDC 4CF5A 3K92A 4DJ5X 3V5NA 3DWFA 1J09A 1JXAA 1VLZA 5BWNA 4NCAA 1KH1A 4GRAA 4P1VA 1XZPA 1TECE 1HSOA 1E60A 5TNXA 2HQSA 4F1KA 2FRVA 2BV3A 3VI4B 2EBHX 4HI0E 1U81A 2ZU6A 5JQWA 2Y93A 1E9CA 3ZJUA 1YIJB 2BFFB 5BVGB 3IURA 3WL3A 1Q1NA 1E7RA 2CJXA 2FETA 2M32A 2FFJA 1G8PA 2VHQA 3FUTA 4LY3A 5FAXA 5HFJA 3R9KA 3CVXA 4AS1A 4A27A 5IJAA 5BW8A 5AW2A 5KOHB 4MRVA 3W79A 4ZGQB 1C7JA 4XDHA 1MB4A 4MVCA 3JQGA 4W9MC 2H1IA 4HPWA 4ISBA 4Q1CA 4DWVA 4KR6A 4UDXX 1B8PA 2J67A 2G82A 2Z5FA 4YPVA 4KFRA 4F3NA 1WUHS 3AHJA 3DE0X 3GLHA 4ZVNA 3Q3AA 4OAQA 4IGIA 2ZBVA 4MJ3A 2JLWA 3TDNA 3RLFA 1VZ2A 4POAA 1PJCA 1TJ5A 2FSHA 2EGGA 1ZESA 1M2VA 2IZOA 1KMCA 1YZGA 2O2HA 1DC7A 3DE7X 1PD0A 3WLSA 4XNFA 1M6YA 4UE2A 1LTKA 2NXCA 2KYRA 3G8YA 4I8XA 1Q6YA 2C2XA 4NCIA 1WDTA 4G0VA 4QFBA 2WWIA 1LF0A 1OI2A 3HDHA 4IIDA 4N39A 4PAOA 3ZXIA 5I5EA 1W88B 4WZLA 1PP4A 3R5KA 5GY7A 2NP7A 1YBVA 3HU3A 3DZ8A 1G5PA 3CVUA 4RD2A 1NI4B 1U3TA 3EOBI 4G0MA 1NNI1 4G0WA 3GMIA 4XWYA 8LDHA 4X90A 2NV4A 3P71T 4YCDA 1NXPA 4OG2A 2FP4B 4PAQA 3C6MA 3S40A 2NG1A 4CM4A 3IIKA 4PLFA 3DL0A 5DBIA 4C2BA 3GGDA 4WXYB 5BSGA 4XMYA 1K6EA 1RI4A 1HT3A 1QVFB 3I5MA 2CK3A 3H2ZA 1Q22A 4EYQA 3VNQA 5I4IA 2GA9A 2X42A 4UAUA 4F12A 1RLUA 4CJXA 4IILA 1AZSC 1J07A 1FA9A 3EXHB 4RTMA 4HLCA 2QL5A 3CTPA 2PS1A 5AJYA 2PUEA 2OXEA 1ZR4A 4YJ3B 4EPXA 2ENUA 3A1NA 2F9FA 1CIPA 3HB1A 3AL2A 4DR4B 4I99A 1UKYA 3E2IA 3KSMA 4LX8A 3LX5A 1NBAA 1U99A 1VDMA 4B4WA 5CEJA 4UHJA 3DF9A 4EF6A 1II8B 4QU0A 1N8NA 4YA6A 5JWHA 4X1IB 1W9MA 2AB0A 1FL9A 4GP7A 1GRVA 5JALA 2CB9A 2GCPA 1WW2A 5JAIA 1TK9A 1Z2OX 3BE5A 4A0SA 3JQ6A 2IU6A 5EVCA 2WVAA 3E53A 1THGA 1W0JA 5HQTA 3REOA 3ZBQA 1OX6A 1IHXA 1JSLA 4NOKA 1JHOA 3OTIA 2O20A 3OZTA 4RE5A 5KYGA 3HP1A 1I4EB 3SVTA 3ABRB 3LHDA 3EIQA 4A8PA 4KI7A 1E3MA 4BNTA 3LYAA 2YDXA 2AMLA 4IG4A 2C4WA 1X19A 1YRHA 1PBTA 5JXGA 1FSFA 4O0MA 4MROA 3I76A 4FCCA 4X61A 3RUHA 3KP1A 5JIBA 5KKNB 3PT9A 1ZI9A 2OHOA 3QFRA 1GYQA 1KH2A 1BAPA 2BCJQ 2O3UA 2ON6A 3I2IA 4LJAA 1VI5A 4XRRA 3HSKA 4CM1A 5I7SA 4N76A 4LE2A 1TQHA 1T3ZA 2H65A 4TROA 3Q3EA 4BZXA 1JU9A 1VL8A 2DJIA 3H2HA 4RQTA 2BGIA 5GV8A 1WOYA 3JVEA 4YAKA 4PQYA 4C4YA 4E4TA 1LI5A 1FW6A 3SSNA 2X4LA 3QNWA 3ILXA 2ODEA 4D3ZA 9ABPA 5JRJA 3DDUA 4W5OA 4TTQA 1GQYA 3CCMB 2WJHA 3MGCA 1M6WA 4HKTA 4YQYA 2L18A 4JSTA 4BX2A 2UDPA 1JJVA 4QDZA 1JX6A 1L5QA 4ZO6A 4HLDA 4UARA 1PT5A 4FQ5A 4LECA 1D03A 1GYRA 1PWYE 3V33A 2RBKA 4GMKA 3VVCA 4FM9A 1E32A 1HSZA 2RHRA 4Q0MA 4J0IA 2O9JA 1E3QA 2CXSA 2LRHA 2VT3A 1SD2A 3JD3A 3UY4A 1OD6A 2F2TA 4IM7A 4ZTZB 3NIDB 1CRWG 1U2DC 2PX0A 3HFGA 3ZWCA 4TWRA 1NBEA 5HEKA 4F60A 1ORHA 4KOAA 1JSRA 4MK4A 2P9FA 3WLFA 4DNOA 1JFSA 5M7EA 4TYPA 1V3VA 2EJWA 2Q9AA 4JYAB 2VOJA 1GCOA 3W2GA 2YV3A 5CA0B 5BSUA 1AHIA 3FD8A 1QJCA 1DCMA 3L0CA 4JLUA 3ZK8A 5BR8B 2IP4A 2XE4A 1P4RA 4DC9A 1WPXA 1FMTA 2ZI6A 3RTBA 3F73A 4RPBA 1DRVA 1T6NA 3MJHA 1UBTS 4ZXPA 3PWTA 4N3CA 4QNMA 2IYLD 4LHEA 2WSYB 3ZK7A 4TLEA 4ZV9A 5FWAA 4EFLA 4PANA 1PL7A 4R5HA 2E4WA 3K5IA 5T8KC 3P52A 3O92A 2O2DA 1XTUA 4MWZA 5DK6A 4PRLA 1ZW1A 3ES9A 1QC5A 4RX1A 1TEVA 4PIVA 5EE9A 5I3CA 3FWYA 8ABPA 4BNDA 3V7NA 2AQHA 3I30X 1E2EA 4II7A 3EOZA 4UVIA 3U26A 2CWDA 5FPPA 4OAOA 3P9NA 3VR6H 3ZDCA 4PC6A 4J1TA 2HO5A 4TL7A 4Z2AA 2QAGA 5E6UA 1N5LA 1AH2A 4QEKA 4O4LA 1D2NA 4LDQA 4TTVA 1E9BA 1FW8A 3QELB 3GAMA 3S2ZA 4ARBA 4EYGA 1QFSA 3OTHA 4P7BA 1N2IA 1V25A 1JRLA 2NO4A 4AMVA 1Q0PA 4EY5A 1US8B 3PJDA 4RELA 1URPA 1FQKA 3E1SA 4O1HA 5CNKA 4AQDA 2DFKB 2D2XA 4L15A 4IH1A 5JDCA 3QOFA 4Q34A 2B94A 3O9ZA 1HKUA 2ZJ5A 3HWX1 4HQRA 3OW2B 1XDGA 2HJ9A 2P6MA 2X7HA 4K9MA 4INPA 5A9TA 2PZJA 4H4EA 3PIRA 2XOXA 1HRDA 5FYQA 2ADOA 1IZ7A 3HY4A 1Z0SA 1E3LA 3CKYA 2B30A 4RDKA 1IU9A 2N1MA 3LY9A 4TYMA 1GG8A 3T1OA 1UDXA 2W8BA 1ZUWA 5EUCA 1BN7A 1SVMA 2ZTUA 4ZEWA 2O8VA 3TIGA 4ANFA 1EBUA 2Y0BA 1UK7A 4RTNA 2FUG6 3A3PA 1SBYA 4MHTA 4BFUA 1O5OA 4MAFA 1VJ1A 1CUJA 1O08A 4WKNA 1H4VB 4ENRA 3AU8A 2BFBB 1I36A 3LXMA 4GD3Q 3BNWA 1ZHFA 2IOFA 2XV1A 2ZQYA 5J4VA 1PGNA 4N18A 3Q3GE 2HQ1A 3G9ZA 1TJYA 5AESA 1Z4MA 5F4MA 1L7BA 1T26A 4W5WA 1E7WA 5K3FA 5LBIA 4DMRA 5TIIA 1ZD5A 3JZDA 3T7JA 3ZCVA 3EC1A 3ONFA 4TVKA 3ROZA 4A0FA 2WYRA 5CB4F 1IPFA 4FILA 4U3JA 3BC9A 4GFDA 1JQBA 1N3IA 3VR0A 1D4ZA 1E20A 1IE3A 2ZL6A 2DWQA 4ESVA 3GJ7A 2X41A 3NIGB 1E6WA 4W1QA 2Y1DA 4K1XA 2OZEA 2H18A 1JILA 1VECA 4OVKA 4TSFD 4RTOA 1X42A 2P5TB 2F3TA 4B73A 4QGSA 5ARBA 1TCBA 1UMDB 4X00A 3OICA 2PSDA 4WDRA 1QE0A 3OEED 1E8DA 1NY5A 5JZBA 4TYNA 1S2GA 3WKAA 4ZOCA 1VE1A 2C9CA 2PGIA 3OZDA 4NV1A 3K7EA 3E1KA 4LWQA 2IHVA 1EDOA 3H9EO 4AL4A 3EDOA 2ZXUA 1EUYA 9MHTA 4DV0B 4LSZA 5T67A 1JQAA 2YFKA 4KFCA 1QX3A 3EGWA 4HXEB 3JRXA 4YAIA 5T41A 4TXLA 5BNTA 2AFRA 2BGNA 4IVPA 3WOHA 1BWPA 4E6EA 2E9SA 1OYYA 3E9MA 1KPHA 3AJRA 4JLAA 4MUIA 5EWMA 1UEXC 2I67A 5B3JC 1D2CA 1GXSB 1AKQA 1FOEB 1FMJA 3PE6A 4LWZA 4RF3A 1WF3A 1DSSG 3LBYA 4QOJA 5E9AA 4RY9A 1SHTX 4A8JB 4GR4A 1SB9A 1LPSA 2FPGB 2P9BA 3G59A 4MUMA 5KQPA 1QTRA 1XP8A 2ZJ3A 4L51A 3HB0A 4CXMA 2CUZA 3AF2A 5LU8A 3M6WA 1RTTA 3G2JA 4RS4A 1KARA 1NE7A 1RRPA 4EX6A 1PK7A 1VIAA 1BNCA 1XNHA 3WYGA 1E9AA 4ZJYA 1W73A 4Q12A 4XWOA 1U9CA 1Z5ZA 1S3FA 3O2NA 4X6YA 3NHFA 1JR6A 3FYUB 4O4IB 3NTXA 4C7MA 4INOA 3T7KA 4E15A 5FWYA 1NYQA 1A9RA 5FR2A 4IIJA 4D9CA 3AVQA 1HMYA 1Z2DA 3Q3HA 1AQUA 4QG7A 2PMDA 4HDRB 1ZIPA 1WCWA 2ZSIA 1JVBA 4UPDA 2RGNC 2OORA 4BO1A 3CZAA 5K0NA 2NGRA 1GL9B 2EC5A 4ZARA 3ROGA 5U4QA 4BRZA 3BIWA 2DT5A 3D7KA 2QXUA 5BYBA 1WBJB 2O8BB 1MIOA 2FAXA 3F6YA 1XP5A 1L0BA 1WS6A 1XWFA 3T9CA 3DQZA 3USCS 1WPRA 4FCVA 3CB4A 1WMAA 3I8OA 3UJ7A 4DUPA 1KF0A 3FW1A 2LBPA 3H5LA 4QQRA 1DB3A 4RY0A 4WXMA 5DTIA 3VVBA 4CIWA 1E2GA 1K0UA 1XLTA 3WGGA 4R5MA 4F45A 1N3YA 4YP7A 3A3BA 1CHNA 1LK7A 4MVWA 3ZWOA 3T7IA 4ZT3A 1CNEA 3DDNA 1HQCA 4NBLA 4C0QC 1SU8A 2XF8A 1JQJC 3P2IA 1TT5B 2IYQA 3ADPA 2C8JA 4RHYA 1Z0ZA 4BX9A 2VHUA 4GX5A 2QD2A 3PNPA 1WSDA 4RZSA 5IUNC 2YBEA 5J43A 3JX9A 2IV3A 1XDUA 1UBLS 4JP2A 3L7NA 1CG6A 1G4HA 1O94D 2QP4A 2Y05A 3FVVA 3LRTA 4DVGA 5LJIA 4Q00A 2P4EA 1PG2A 1XOIA 2X9GA 4N5HX 3RT9A 3UMRA 5L3VA 1P39A 4LF5B 2SKCA 3WZ2A 4MVJD 3UWSA 3CR3C 2KW5A 3E84A 4B8WA 3OFND 2FJPA 3OX1A 4F2PA 5K9ZA 2J8ZA 4CFSA 5FO0A 2NPIA 1PKEA 1ZUNA 4WASA 1CUXA 2QRGA 3HADA 1JIJA 3ZDFA 1NBWB 5IAOA 3K9LA 4N8SA 4OTZA 1VJDA 5A6VA 1MEEA 5M34A 2UVPB 4U7DA 5FEMA 3EVAA 3PD0A 3LZ6A 5EP4A 1VMKA 3IRVA 3VDNB 2TS1A 4D9EA 4QDOA 1XMPA 2XXAB 1B00A 1ZHHA 2XGOA 4FGWA 4LRWA 4YMSA 7REQA 2B69A 2WZCA 5HKOA 1ISFA 1P75A 2ZRHA 2D9RA 4E3ZA 5KTPA 4PHTA 2MR5A 3ZOZA 1ZK3A 4WAUA 2OGUA 2VG8A 2NXNA 2ONZA 2WSIA 3U61B 2GSWA 1ZD9A 3BSYA 4UBOA 2IPMA 1Q7EA 3VV3A 3BERA 3I42A 4YLYA 4L27A 5JLAA 3S1SA 1K5DA 4RKWA 3NHBA 3HBNA 5KYUB 1FQJA 3NVAA 1RPJA 3VZCA 5JEDA 3GEMA 1T4GA 4JH0A 1NUHA 3DMRA 5BP7A 5IEJA 1QHXA 3ESBA 3KKZA 3C4JA 4Y2GA 4M0LA 1U7WA 4YP9A 4AYXA 1KMHB 2BP7A 4Z9FA 1C3LA 5ELLA 3KC2A 4ZI7B 2V58A 2GZAA 1HF3A 1DAPA 1QIGA 1HM5A 2QLLA 2X3FA 3CWZA 3GA5A 3H97A 3R23A 4CLRA 1JFTA 3SLKA 4B2IA 4DC1A 3Q85A 3QUQA 1Q7YD 1YIAA 4JLBA 4ZREA 1B2LA 3U4QB 1CVRA 4MKIA 2B20A 4AMGA 3MINA 2OLKA 1IJEA 3K2BA 2QE6A 3DFZA 4R1QA 3N8GA 3GEEA 2DXIA 1F20A 1DLIA 1GLVA 2Q9CA 2XGJA 3H4VA 4K9RA 4YRBA 8OHMA 3WO1A 1FJGB 1Y80A 2GEDA 1B3BA 4P26A 1NW7A 1S2DA 1C50A 1VA5A 3L93A 4HXFB 2DU8A 1Z6GA 3LJKA 1CQIA 3EA5A 4PN3A 4NWIA 1UBFA 3AVWA 5IDYA 2PWPA 3PI7A 1O58A 4P53A 5CLQA 4UTXA 1YTUA 2QTWB 1XTSA 4UXJA 2Y71A 3BJIC 5AW4A 3VNUA 3BRWA 2IA5A 1A9YA 4RENA 5F7JA 3Q39A 1GSOA 2C04A 1Q86D 2FPOA 1AHHA 3G0DA 3NJ4A 4IP0A 1IN5A 2XX3A 4L07A 3RJ9A 1J5EB 4NH4A 1IAVA 3KQQA 4WZ6A 4RABA 3N9IA 4LZWA 3QFHA 4HWOA 4ZKEA 1I8TA 2BR5A 3SIWA 3VNBA 3COSA 4D9FA 1NVAA 4XFKA 3TFWA 3QFCA 1WG8A 1HQYE 3TTXA 3ME5A 2O2XA 3OX4A 3H0CA 1GV0A 5IK2D 1VB5A 2D74A 1YASA 3C6ZA 5EMKA 4JIGA 1JR3E 1ZNWA 3I1IA 3NWEA 5IJ0A 1QG4A 3I5YA 1Y0YA 1EZ1A 2XVYA 3H99A 2EWWA 1XCMA 3WLQA 5JZSA 1RRVA 1TX4B 2QSZA 1JDPA 4C6HA 1VHJA 4C0KA 4E31A 4GZMA 4TXHA 4NL4H 2IBMA 3B12A 4E11A 3EWSA 4EY3A 1N2EA 3FNQA 3L46A 4P4SB 4R8MA 1E7MA 1O97C 1OX4A 2RGBA 4O4LF 2BSXA 2POQX 4EJ2A 2VYFA 2PUWA 2RI0A 3OAAA 1QKIA 1JJFA 2FSPA 3ED5A 4N7JA 1DO0A 4UHBA 3X1XA 1IVYA 3O2SB 3QBTA 2JD1A 2P1RA 1D9XA 1NXQA 2Z9BA 3AOEC 3IGFA 3KOXA 3QQ5A 3C5VA 3QX8A 2R7KA 4KSCA 5G0VA 5AKHA 2PUHA 2ZT7A 3OP1A 4RDIA 1PFWA 1WXFA 2MSDB 2AXQA 5KTKA 4R1UA 2M2IA 4LPSA 3IQXA 2VUHB 4LV6A 4PG5A 4TQAA 3M8KA 1TF5A 4YRJA 1KDOA 1MB9A 2W2VA 5JZVA 1E8NA 1T5OA 1DAEA 1ZJYA 2HLPA 4HAZA 4HN9A 4CU5A 1PEYA 1ZXBA 3OMWA 4TL9A 1UD3A 3X0DA 4ARSA 3L79A 2V5UA 5B57C 2EBUA 1E58A 4GOXA 3OJLA 3K6SA 1FTYA 1RYYA 2JCVA 3KQVA 2ZIFA 3FCUB 3KCNA 3O8OB 1TJNA 5D5PA 3RVOA 3U62A 1EK6A 3CMCO 2FMIA 4K0KB 2BFPA 1UZLA 3LA8A 4C21A 2Y6UA 1CYDA 4RGQA 4HDMB 3HA2A 5CVVA 4JUBA 2JHPA 1CJVC 3A28A 4ZHQB 3WNVA 4Q3EA 121PA 4RTQA 1MDFA 1CLUA 3AOGA 5LBUA 5ESRA 3OJXA 4FONA 1EHCA 2WI8A 3GDGA 3NORA 1QYDA 5DF1A 2R7LA 4YEJA 3CF4G 3B9BA 4O59O 5ALGA 3ZHUA 2Q2WA 2GJPA 2SBTA 2R8XA 2VTVA 2DJ5A 1D1NA 2VK2A 2PFGA 2UVDA 5IBPA 4UZUA 2JRCA 3GZJA 3FWNA 3WSTA 2XQFA 1P4JA 3VVLA 3F5DA 1C7RA 1OWNA 4JC8A 3CINA 3L3BA 1UH5A 2AZMA 3M9LA 1COWD 1XZKA 3PGVA 4NESA 1U0BB 3DYIA 3GF4A 3VZRA 1YWGO 2VP6A 1D7AA 1J90A 3IILA 4UC0A 3HYCA 1MA0A 5FL7A 3E7WA 3BXXA 4K28A 4YWHA 4BU0A 1DQYA 1QGZA 2GAIA 4RD0A 4GO1A 4MRMA 3WZMA 3RV3A 3KAQA 1QQAA 1TD9A 2QY6A 3I9V1 1DAOA 1XAIA 1UC4B 4PFSA 3DO5A 4QUBA 4Q7QA 3SZGA 4MV6A 3F5FA 4G37A 4TKVA 1PLKA 4CTNA 2OYNA 4AKIA 4JP8A 3U17A 4DA8A 2IS4A 4PO9A 4MQEB 1R8XA 4FHZA 4GGPA 4CTKA 3LBNA 1WXEA 2ZM5A 2FQXA 1TGYA 2NUPB 3S2GA 1BCSB 2IS6A 4IO1A 2QX8A 4OJMX 5DHTA 4BIMA 5JE8A 4O0LA 2W2NA 4Q4LA 5DXJA 1OI4A 4LYGA 5JDIC 4DDVA 3DWEX 2CLMB 5DXAA 3I9NA 3IP5A 3WB0A 2ZUEA 3SS8A 3HJGA 1IVSA 3K0FB 1DC6A 2AOVA 3GLFE 5L45A 2HMSA 2HRDA 5C4IA 3PGJA 2GREA 3WTBA 4EJ6A 1XFDA 4AG5A 1MO6A 3C97A 3EWAA 4ZODA 3PNSA 4UCWA 1RYBA 3H1AA 4KFUA 4IIJF 3OPXA 4G4SO 3LXXA 1T9ZA 2ATEA 1KZ9A 4CKBB 2OGTA 3NG1A 5ALWA 1ML3A 4DLZA 4O2LA 3B6JA 4Z4WA 1MJHA 4GHWA 4I36A 2EQBA 4R2JA 3TE7A 4LRQA 5HF6A 1I1NA 2CNNA 3KOUA 4RHTA 3AZOA 2BGLA 3Q0EA 1M76A 5L3RA 4H6PA 4OMDA 2ZRCA 4I1OA 4ZRNA 4O02B 4ZGWA 4IWXA 4WZAA 2C0CA 3FHOA 1FC0A 1OGJA 4OQ4A 4S2EA 4DEVA 1EVLA 3BIXA 3CVWA 3HCFA 3DOIA 1CUGA 1VI2A 1U4SA 1C30A 2M5SA 1GRQA 1FU4A 1N2JA 1YCDA 1QQ7A 2AQIA 3CJTA 3EEFA 3GRPA 3KXDA 3QEOA 3ZCTA 4CKCA 4V1CI 2UUBB 4S04A 3DV0B 4GOND 4JP1A 3JQ9A 2IIPA 3UNXA 1B14A 1I4TD 3N1UA 4CE6A 4Q9LA 4D8YA 4XONA 2Q3LA 4Y1FA 4JBYA 1LV8A 1Q3KA 4RD6A 2EFDB 3KJNA 2BMEA 2P3OA 4BZWA 5AW1A 2QGFA 5AW6A 1RC0A 2R2GA 2PG3A 1CRQA 4DM7A 1KQNA 3BIOA 1TDJA 3CUKA 3X2EA 1EH5A 2SCUA 2HCTA 4ENWA 3U5TA 1PI3A 1ESNA 1GQSA 2FMXA 2B1QA 3GAFA 4FFPA 2AC7A 1DKOA 1QH8A 521PA 5JPIA 2V45A 1NNEA 4QYWA 1X87A 5EJAA 4BTEA 4KQWA 1W36C 1JXOA 2I3BA 1DJQA 1OT3A 5LB2A 3ZH9B 4LRSB 5IJWA 4MEJA 2KQUA 1ZH4A 1ZONA 5EXSA 4NONA 2ZWVA 3GWZA 3WWEA 4LJ6A 2WSBA 221PA 5FRDA 3PRJA 1E3WB 1S1MA 3QLUC 5ITZB 1ND5A 2Q50A 1MP0A 1C3XA 3CG0A 3L8MA 4HDKA 5LSAA 3WNZA 1L7DA 4HAUA 5FOVA 1Y3CE 2J87A 4Q9AA 3CH4B 5TV2A 3WQRA 4NK5A 5AKIA 2C96A 4JOQA 3O47A 4D9KA 4JMLA 1VJTA 4YV2A 1LK0A 4ZEMA 5B30A 2EJBA 2JZNA 4B6QA 4UTNA 2KE5A 2PCLA 1DUSA 2WY2D 1AKWA 3MBOA 1X86B 2CXPA 2I8LA 5CGQB 3O1IC 5IXSA 2FPPA 2RHCA 4Q21A 3BEDA 2C5HA 1YE8A 3A4VA 2JN9A 2XJ9A 1CS0A 2P2SA 3OY2A 1NZFA 2G5CA 3A9WA 4DXAA 2VH1A 2G4VA 1Z4LA 1PWEA 1WETA 3HB9A 1RXSA 1N5KA 1UC9A 1EFCA 3I1FA 1BH6A 3MILA 3A8IA 3OT4A 4PBSA 4XPIA 2WYVA 2CNKA 3W5SA 1DTWA 1DJOA 3JD2A 3V2GA 4PC1A 2GDJA 4UNNA 5ALTA 4ZAVA 1BJKA 3E6AA 4EI9A 2HNKA 4RPKA 3AUTA 2Y9PB 2D3NA 1LU9A 4XCXA 2ERYA 3KZ1E 3O1HB 2DBVO 5IVDA 4KWEA 1YDFA 1J5XA 4E7OA 2DUUA 3P2YA 2VF2A 1GPYA 3GUUA 3OG9A 1N6HA 3MT9A 4KFTA 4PINA 1WDKA 3CXRA 3E1YE 3EARA 4EPTA 5BVHB 3ZGYA 2Q7DA 3L0DA 3PFCA 4HEA6 3FHJA 3GV0A 2PZLA 4CUJA 4GZ6A 3GEBA 2PUJA 5FNVA 5ESXA 4E6PA 4DQXA 3QBJA 2C8LA 2Q45A 4TRJA 1KPGA 2C5LA 2GEFA 1INLA 3H3XA 1T9AA 2B8JA 2D1RA 4HNRA 4ISCA 3TLBA 3K9GA 4BC0A 3CNQS 1V7CA 2ZPUA 4DNQA 5C1DA 1XCGB 1FUKA 2W5UA 2XUDA 3HNPA 5KSZA 5FV7A 2ISCA 4UOEA 3K8ZA 1H22A 1IXZA 1D3AA 3QRWA 1I4OA 3N6RA 1TTTA 1ZMXA 1GZDA 2E5FA 3HP7A 3NGLA 4NFSA 4KNWA 3GGSA 3ZV4A 4CIYA 4N7MA 2DLDA 3PHJA 2OWDA 4YJ2B 3QF7A 2IH2A 3WLHA 2AXNA 1OC4A 2HPHA 1N1GA 2JBWA 3VKVA 2HUNA 3FWZA 4ACAA 1IBCA 1NXVA 1UJ2A 3R77A 4U0JA 1E9RA 4IJUA 3WFZA 1P4AA 2WKQA 4PF1A 1PR3A 3NI2A 2NTYC 1X7YB 2HU5A 5A1JA 2F00A 2B37A 3BXHA 4JBGA 3D8TA 1BEUB 2W6ZA 2HLHA 3P4UA 3OTOB 4F38A 4CLXA 2ZE7A 4Z1OA 1LDMA 1QLHA 4A6EA 2OBTA 2BL4A 3GXOA 4IJ5A 3GDHA 4X5OA 5ERGB 1UBGA 4R9SA 4P4LA 3NDJA 2F59A 4LRUA 4BJ5A 3KFLA 5GP1A 2VYVD 4JGIA 2CL5A 4NTZA 1Z36A 3OOHA 3M4ZA 3C2QA 3IAFA 3L07A 4TTIA 3ZIAA 1Z0AA 4G4IA 4ZI3A 2BKUA 1I32A 3JQGB 3CF0A 3PPIA 1C8VB 3WMFA 3VSBA 4WOJA 1C41A 3PCRB 3HVRA 1SIBE 2I7TA 2QSJA 3GJ5A 3ETHA 3VOAA 2KHZA 2WAAA 2ZT8A 1NVKA 4GBMA 3GLHB 5H16A 3D6FA 3OM8A 3H8JA 4HYQA 3EVBA 3E7DA 3VTAA 2JGLA 3CGWA 3SD7A 4TYQA 5JSQA 3Q8LA 2VP2A 4GC9A 3D0QA 3GGOA 4R41A 4U5XA 3OMXA 1M2VB 3RLIA 1XTJA 3HU1A 3RAPR 4ZPXA 4O2BB 5M04A 4Q24A 3EVCA 3G2MA 3LPMA 3R3UA 1TJ4A 4D57A 1KP9A 2OXIA 3DZBA 3L8ZA 2XWJI 1PR5A 1XZDA 3OF5A 4RLZA 3LC7O 4K0RA 4CQLA 1T8SA 1RJEA 3A6JA 1QOZA 2CLHB 3AP1A 2Z8ZA 3G5UA 1ULTA 2YICA 5HFAA 4PC2A 1U0TA 4PRZA 4DIFA 5C46F 1FSPA 5CLLA 4QBHA 1JDTA 4UUAA 3TAXA 3BBLA 3A2MA 1SXGA 1KK3A 4RXUA 1V1JA 1XZFA 1GUFA 1VTKA 1YULA 5D5HA 1E96A 1R66A 1UJNA 1Z0IA 4MGHA 3SBDA 4BDTA 4NCBA 3W0LB 4D4IA 3R6TA 3MTIA 5KCMA 3LTNC 4Z4YA 5LMUB 1PVVA 4TKOB 3K96A 2BD0A 1C5KA 3DBRA 3G9TA 2IYZA 4H6WA 4FFSA 3ASUA 5IKEA 1LH0A 3DPUA 1WV1A 1XQ6A 4NRDA 4JI5B 5C53B 2WUDA 4JP3A 4ZWNA 2QW0X 3Q2OA 3WWPA 4OHMA 1LBSA 3ILVA 1PNTA 2ZI9A 1GGNA 2ZAMA 3EASA 4NYMQ 4JIMA 1CBUA 3MWGA 4R6WA 5DTJA 1H8EA 3NC4A 3EEQA 5JH7A 2Q1SA 2WVGA 4LJ5A 1P2SA 3HV0A 4CDRA 5KNCH 4GR5A 2Q3JA 3NUGA 2HBZA 1WTHD 2AOTA 2I22A 2J0UA 2GJSA 4I1SA 4A8TA 4LYFA 4CGZA 3B7GA 5E3JA 4CR6A 5FR1A 1FU7A 4EZBA 4YUZA 3ELDA 3DTNA 3OFVA 3PHHA 2PE3A 4XYBA 3SCZA 2OBNA 1HDRA 2CE7A 3O6VA 3RBXA 3AEUA 1ZN8A 2P40A 4BNIA 1VLYA 3RF7A 1E6LA 2J31A 5BOSB 3LT4A 1LC0A 2R6GA 4KQ1A 2WIJA 5CLGA 2F43A 2MYUA 3GRAA 4IRMA 2OYRA 4OQZA 3SQDA 1DJNA 3BTUA 1BQ3A 5GVRA 3QF4A 4Q19A 3NKFA 5HJEA 3ELBA 4Z9AA 7YASA 2XGMA 4LY0A 1FYDA 3MYRA 3SR4A 1M5RA 3ZDAA 1STOA 1X0VA 1NQXA 3FDZA 4N3AA 2JH9A 2OESA 4P7GA 2LGJA 5HBRA 1A1SA 2YVLA 2CZQA 6PFKA 1KIMA 1NC3A 3M6LA 3B9RA 4OKSA 1VLHA 1MFPA 3NCTA 2FVYA 3D6HA 4II3A 4K81B 4MUAA 4G7WA 2PVPA 1E59A 3AR8A 2OPBA 4QLAA 3TSCA 3K9QO 2GRUA 4CMCA 4TZ6A 2CHVA 2Z2ZA 4YT5A 3WFJA 1EX7A 4OP2A 5JZMA 1MRZA 1CEXA 1I51A 3EXFA 5F7ZA 4B17A 4AS3A 4Y2UA 4ZFNA 3ZDDA 3V4PB 3TL6A 5CBPB 2XNDD 1D2HA 2C84A 3A7EA 3C74A 1NM5A 2H5EA 4LNUA 3VPXA 1Z2NX 3DZGA 1YI1A 1L8LA 2A84A 3RG8A 4Q66C 1VQ6B 2Z8YA 3UOWA 2V7BA 3N2GA 3EPLA 2Z95A 1H66A 3UWPA 1YZHA 4K03A 4K9OA 5FFNA 3V2IA 4CMGA 1SQ6A 2QTFA 2A4KA 3AONB 1KJYA 4OHFA 2JI8A 1G7RA 2CE2X 4YP5A 2R4TA 1MOZA 4G26A 4D9HA 1N9ZA 4F5EA 5BV1A 1IXYA 3JV7A 2NZYA 4JAVC 3O9VA 4UQOA 5LB4A 3RHTA 3INRA 1CW2B 4FGJA 2DP4E 4UMFA 5FYDA 1T5LA 1YQTA 2JC3A 3A0RB 1T5IA 2XCUA 1T24A 1DAFA 3FTDA 1QE5A 2JLQA 2PZBA 2YZGA 2WFLA 1GZUA 1BHQ1 1KDTA 1VHDA 4HIZA 1Z29A 5F35A 4LZAA 3UYKA 1DLJA 4JBHA 4EI8A 2VWGA 4L72A 1JH9A 4MI9A 4FYXA 1D4FA 2B7LA 3VR4H 2GX6A 2QTZA 2G1JA 1Y5LA 1PNRA 3CM0A 5A2QA 4ZC1A 1BYIA 5A5EA 2HTEA 5HGJA 1NUSA 2OMKA 2AEJA 4CT4B 4YCJA 4U9IS 3NCHA 1L5MA 2X85A 3FPGA 5TPZD 3QFTA 3N7UA 1M90D 4LE0A 4YRSA 3UB2A 4ZANA 1QC5B 3VOBA 4NI5A 4D8UA 1Z83A 1F12A 3DD5A 4UVHA 3UIEA 3PHBE 3HR4A 1O97D 3MXTA 5CDFE 3GCZA 1J0EA 4I9FA 4Q9IA 4E1VA 4WGFA 4XOUA 4DJTA 6CHYA 2QAGB 1M8KA 2ZSHA 2GMWA 5E6UB 3QK7A 3IIEA 4BNUA 3C5CA 4N3NA 3MPUA 2VBIA 3TZLA 1TKRA 1W1UA 1T9HA 2BGUA 2PHZA 4TSFA 3CONA 1ZGBA 4U8GA 3TN7A 4TYYA 4HWPA 3K2EA 1MX5A 1JBKA 1W48A 4EKYA 3ICQB 3WYCA 4NBTA 1QP8A 3UUFA 1C4KA 4EAQA 2WWRA 2WWWA 1H0HA 4B8ZA 2F9MA 2P8JA 3PDHA 5EIXA 3PUZA 4LBYA 3LY8A 2H3HA 1QHNA 1Z0FA 2PA3A 4BNYA 3FZEA 4XDZA 3COWA 1BJRE 4F3TA 2FCAA 4Z4EA 2FW9A 5GGYA 1VGRA 4MLPA 5KJEA 5P21A 1Y1QA 3RYIB 3T3EA 1W0KD 2IIQA 2C00A 1XKQA 2QTBA 2X1VA 3K15A 4HXYA 4BN4A 4FUTA 1ISJA 5JZ9A 4NZNA 1PEAA 3WI7A 5GZ1A 4BLWA 4C4ZA 2IEYA 3I2GA 3W5AA 1A27A 1YO6A 1X7HA 3LWNA 2XUGA 4EGQA 3LQ1A 3W1VA 5FUBA 5FPYA 1KC1A 4EO4A 1H3NA 1VSUA 1W5EA 2WNSA 2JHFA 1KY3A 3O4VA 4MKGA 3ZE2B 3DL7A 3FF4A 4DSNA 4UHCA 3NIWA 1EJBA 1ULAA 2FSVA 4QTXA 4YREA 3C7TA 3ELUA 4C76A 1HNZB 2QM7A 5F4JA 3DJFA 4HH3C 3T7AA 1X92A 3FTCA 2PKWA 3N59A 2PXCA 5DSTA 5K3FB 5ALZA 3FZNA 4YY3B 1JR3D 1XU7A 1QDUA 3RUEA 2F3PA 4F4CA 1XZBA 3L4SO 3LOQA 2YVUA 3HKEA 5IW8A 1PGQA 1W6RA 2DFTA 2J33A 3D1LA 4Y0NA 2A0UA 3TOVA 4ENPA 4YUYA 4CF3A 2X8AA 3TGWA 3P26A 5IBQA 2FR8C 3VBCA 1QCCA 1F8FA 5ILOA 3I83A 2H8GA 5F2EA 2F1KA 2ZJ7A 4D26A 3OKFA 2EGHA 4GSYA 1BVHA 3CSUA 3DOJA 3QHPA 3KJZA 1XA4A 5EE3A 4YCAA 3AM3A 1YFZA 1SEVA 1YZNA 2ZAOA 3DAYA 3KK0A 3MQ2A 5CLJA 4DV5B 1P7VA 1VLJA 1JXMA 1PTJA 3LV8A 4HS4A 4RW0A 1KQPA 3BVPA 3BB3A 2YS6A 1JZSA 1I01A 2P69A 3EVZA 3H1PA 3KCQA 5JCXA 3ZZUA 5LXTF 1G38A 1B6RA 5KVQA 4QDXA 5AO9A 4Z49A 1QP4A 1VHOA 3OOJA 1RKXA 4P83A 2EFJA 1WVGA 1A8SA 4FFRA 4LJLA 2XLBA 3ESCA 4GWLA 5FNVF 4QPZA 1F3LA 3REFA 1SZJG 1EVKA 1X7ZA 3HGTA 4W9NA 2GYWA 2YVKA 2I2DA 1J99A 2HJWA 2IEZA 2I2FA 5K4AA 4RHFA 3R5HA 1YR7A 3SICE 1RXWA 1NRJB 2RI1A 2FUCA 1E4YA 2ZYIA 1KAEA 5EWMB 5I5GA 1UC8A 1PZHA 1UKCA 3F47A 1SCBA 2HF9A 4I8IA 2VQ3A 4ID9A 2BE9A 1R74A 2W22A 4P5DA 1K9SA 2XBUA 3G8DA 3GNTA 4BNJA 3OZUA 1VB3A 3H94A 3IELA 2A59A 2CZCA 3BHNA 3LRXA 2JIMA 1D1PA 4NH0A 2ZZKA 3EEYA 1W0CA 3RQSA 2I29A 5EMNA 5GQSA 5B4UA 5CXXA 1X9IA 3HJNA 5AVTA 1H1DA 1JEYA 4LDJA 4M1YA 1QZXA 3SX4A 3GEDA 1Z17A 3JPYA 1RYMA 1S3SA 1A50B 5KVVA 3FCAA 1R1DA 2PTHA 3LHIA 1Z07A 3FDXA 3GRCA 2QRLA 2GPBA 5DV9A 1HMPA 1YQUA 4UBMA 2OO5A 1OA0A 1M6NA 1U04A 2YV4A 4KVAA 3EA0A 2IS1A 4Y6LA 3IBFA 3PC6A 1PNOA 4PAWA 4C3VA 1KI8A 1SCDA 5DOZA 4ZCLA 1UIMA 2NMVA 3ETLA 2WE7A 2BDEA 4R8RA 4AMUA 1EFDN 1EB9A 3NX4A 1HOTA 2PJRA 1CY7A 2PKQO 2PVCA 1I4WA 4ZO4A 5LZ8A 4OHPA 3WMWA 3AC0A 1AGXA 1NAIA 1X8JA 3OIYA 3RYHB 3OLXA 4LOHA 3WDKA 1N6NA 2Y77A 1ZZGA 5ETJA 3S2UA 3FIJA 1MT3A 2RAVA 3PC8C 3DVQX 1U8YA 5F7XA 1Y98A 4L9AA 2PFKA 1N9GA 2XXBA 3HEAA 1XC7A 3O3MB 3BD9A 1SG0A 4R0NA 3FVWA 4WKOA 4BLUA 4QOHA 1M34A 2QRMA 4P6VF 3FGZA 3K0EA 4X71A 4DSZA 4EPWA 2I4LA 2IOQA 2Q5FA 3O4IA 1I6MA 4BV3A 1HX7A 1MH9A 3OQ6A 2FX3A 1EFVB 2HJHA 3G2PA 3MOIA 2VXBA 1MOSA 4C08A 1H2AS 1M1NB 4FLFA 1CVIA 3B3QA 2CFIA 2WPNA 3CRW1 5K2OA 4TVOA 1VQOB 1H6BA 1CLEA 1W36D 2QZJA 2OO3A 5CURA 4D25A 6REQA 2XW6A 4JT2A 3GHYA 1OQAA 2VNKA 2VEDA 3GJSA 3U40A 1PW5A 2VBGA 1KP2A 2ZETA 3EXG2 1MR3F 2DQSA 4JLDA 1JWAB 4BN0A 1NASA 2C94A 4TLMB 1YL5A 4BNVA 1KI7A 2O6LA 2RGYA 2O7VA 1L7MA 1Z18A 1U4NA 2V9ZA 1E5TA 4DLYA 4P3YA 1MHPA 2X0NA 3TZEA 4D8VA 3F8WA 5MFZA 1ZUNB 4G67A 2O0LA 2V7VA 3IOCA 2VOEA 3NHJA 3KBBA 2RBEA 4QGBA 4QWWA 4XXHA 3GLRA 4L4XA 4MEAA 4YEDA 4UUOA 3UTCA 4ZV4A 1YJ5A 2IYWA 3OZWA 4JUFA 3ZU4A 4IZIA 3HO6A 3NBYC 4LFCB 4RMHA 2G6BA 3T0IA 2BPOA 4D5GA 1WKVA 2JGEA 2CLFB 3JZAA 3N2ZB 3R09A 3CRQA 2XNSA 4HS9A 1P1IA 3TQTA 1P6QA 1WMBA 2PLFA 5TY0A 3DR5A 4M1WA 2YMQA 3AR5A 3EYWA 3GUHA 4PQEA 5EZQA 2A33A 2OXCA 2X8JB 2JIZD 5EXTA 4QKQA 1K7CA 1NMSA 1JJ2B 1FMCA 2GKGA 3F2VA 3GFBA 2N42A 3LRPA 2QHXA 1LLDA 3CEPB 1OYOA 2P1ZA 2OAP1 4WOBA 3P0HA 1TKBA 3FFTA 2WHYA 4NZ9A 3F46A 4Y0VA 1RQ2A 3IC5A 4WFQA 4DGSA 3GP3A 5AIAA 2ZDHA 3LP8A 3IV7A 1NTOA 3RIHA 4D6YA 5IK2A 3SYNA 4LXTA 1RDFA 3PEEA 5THQA 1EVEA 2FSUA 3WYBA 4QVJA 1ZSNA 5HF9A 2VPZA 4M9QA 3P0IA 1GPUA 4D45A 4BY9E 3KQLA 2ORED 2NX2A 3MLBA 2ZS9A 4ATNA 3DV9A 2ANCA 4PO1A 1NYLA 2W6ID 4P8RA 2BIFA 3DDSA 4CLRB 1DJMA 3IB6A 1U1GA 2CDAA 2HF8A 2VCHA 4NV0A 1XMQB 1XKLA 1QGOA 3GUYA 1KY5A 2VRCD 4LEIA 5FWXA 3THWB 3MINB 3R9WA 1ZM7A 3W1WA 2W83A 3UBTA 2ROQA 2NPOA 3A8TA 5HFNA 2WJ6A 1G8MA 2FHPA 3AV0B 3FGOA 5JNVA 2XAUA 5CDGA 3CUYA 1RRGA 3RRBA 5DW3A 5F78A 2V96A 1K8RA 2FPSA 4DJAA 4AY6A 1MO4A 1YS6A 1KAGA 1IXSB 1VP3A 1TO2E 4RK1A 1DAGA 1ZRSA 4H08A 1GPH1 1SUDA 4PLCA 1CQIB 1U2ZA 3WBBA 3NEJA 1BVRA 1M1ZA 1RWPA 1Z4NA 2FG6C 2HCBA 2D3LA 2K2QB 3DBLA 4RORA 1KU6A 4RTLA 2R1ZA 4FYJA 4A73A 3DLAA 1XIVA 1TM7E 3JYNA 3MAAC 3HFRA 3V6MA 4EJSB 3IXLA 3V1LA 3UJHA 4B85A 5CMLA 5H9VA 4CODB 2C9OA 1BEEA 2ECFA 4LC1A 2G70A 3KLPX 3OJFA 1X1TA 1W5SA 2IHTA 4FS8A 1SUEA 1O7JA 3JAKA 3JW8A 1GTVA 2JLAA 4J0QA 1WZUA 3D7LA 3TZQA 4NEGA 3A8JA 2BZ0A 4UTRA 2B78A 2BDUA 2I3GA 1XTTA 3ZTTA 3G85A 3FSGD 2WF9A 3JZMA 5IC6A 4DRZA 5IJ0B 4NAHA 2CXUA 4OJNA 3WV5A 4MV9A 4G0XA 1EESA 4DR5B 2DSTA 2VSNA 3EFBA 1ULHA 1XQ1A 1YHNA 2BTEA 1TKCA 3T1TA 2ZJ8A 2IEGA 3G4SB 5DHRA 2Z6QA 1Y3HA 2QRZA 3NE5B 4N8DA 1FNDA 2ABWA 2F3UA 4OY3A 5KTNA 1RPZA 4JKOA 3UMJA 2VKQA 3SOZA 4M89A 1KVTA 3UQZA 5DM60 3LPAA 3Q12A 4Q47A 4W6ZA 1J70A 1J0CA 2FLWA 1XHEA 5FPQA 3RARA 4NATA 3I8XA 5HE8A 2GPTA 2DHDA 1DCKA 1EGAA 2BMFA 3PXDA 1T1GA 3LY5A 5T64A 4NJMA 1GZ5A 1COWA 2DUNA 3BZUA 3N74A 2OA0A 4ECEA 5DNCA 4DIBA 3W05A 5A5VA 4GDFA 2C5SA 3D0KA 2OQVA 4KKVA 4RFSA 4AKGA 1NTRA 1W25A 2GYVA 3O03A 3G6EB 2PA0A 3G3EA 1LZKA 4GQAA 4GWKA 4LZJA 1XEWY 3BWVA 4QUZA 2ONCA 3CX7A 4KRFA 1JI3A 1ZD2P 2VJYA 2BVNA 4Q3KA 1DMSA 1FYVA 5THKA 4QXQA 4FYVA 3H86A 1V0JA 4QAQA 3KO8A 1L2TA 5ITWA 2ZIVB 4URUR 5JXJA 3OQJA 4Z9BA 2FW0A 5GIPE 1SXPA 3QHAA 1K7FB 3N7AA 4DPMA 3N0VA 1U0NA 1E3SA 1HGXA 3JZIA 4RJKA 3T3MB 3ZWVA 3T35A 3EX7C 2WD9A 4LHSA 3ZJYA 2O2GA 5GADl 3TPZA 1FX1A 5J23A 1A8PA 1H5QA 2W93A 5JT1A 4V0LA 4O4HB 1ZOIA 2JH3A 4O33A 4QJ5A 2PPLA 4ITUA 4XGIA 3VYVA 3GJ6A 1KAQA 1SBHA 3BXGA 1IZ8A 1MQAA 2XRMA 4LYDA 5J4YA 1UZUA 3Q3IA 4NZMA 4AU1A 4CDGA 1I80A 1S3IA 3DBHA 3KZCA 2D6FA 5FUXA 2FZWA 1MLDA 2OV6A 3A32A 3HJCA 4A16A 1BS2A 1JT9A 1XPJA 2BF4A 3OLCX 2ES4A 3V4LA 3QITA 3I01M 1ZL0A 3SN6A 2XLCA 3RYFA 4CR7A 2OG1A 1GGMA 4A82A 3AG6A 4AF7A 1N92A 3OU2A 5DI3A 3NVDA 3S4YA 3WL8A 4CBVA 2ETVA 4TMXA 4M1OA 2HMAA 4W8GA 2ZBDA 4BO7A 2CXOA 1Z5GA 1RNLA 5AT1A 3ABIA 3EVGA 3NAGA 2A9PA 3JQAD 3ND6A 3ZE9A 1RFLA 3W06A 3AYZB 2VHVA 3H2YA 1N8RD 1HEIA 1EXMA 1PK8A 4I4TA 4LOAA 4LRXA 4QTTB 4Q4HB 1SCAA 1BHO1 2V7EA 3KJHA 3LD9A 4RFVA 3B7WA 1N4AA 5F4ZA 1LSJA 4LDAA 5EP2A 1WVMA 3EEOA 1TUIA 2CV1A 2X8WA 4TSKA 4AI6A 3PS9A 1DIRA 5DGTA 2BFDA 2WZBA 1NONA 3SJBA 3PGKA 2BM1A 3RHZA 1I1QB 2OGWA 3L9XA 2CLLB 1TI7A 4RY8A 4X6XA 5EQJB 1R6UA 4ARZB 3JTEA 2FJ0A 1R37A 3BN3A 1GSIA 5E9WA 3AI1A 4DQLA 1S2MA 4K3VA 4UW9A 4IQ8A 3OE7A 3AFOA 4DW8A 3QPWA 2Z56A 1M83A 3EEIA 3HYLA 3P1JA 4W1SA 5TLSA 2IHKA 4PRYA 4TKUB 5J2TF 3IIMA 3AFMA 4HD8A 1G5QA 1ZKMA 1WOMA 3ETDA 3IVRA 4P38A 5D3MA 5A4MS 5DIZA 1Q95A 2ZSDA 3UMSA 1KK1A 3WIBA 4MAMA 3ZK9A 1E3DA 2AD5A 4REMA 3CPJB 4WJZA 1E2KA 4W7HA 5JTUA 1GZ3A 1N0HA 1QVWA 4BFWA 1LDYA 3NVKI 4C7VA 3M3DA 3KKLA 1FFSA 2E37A 2OV8A 3AJEA 1QQBA 4XB1A 1IY2A 3R2JA 1P62B 4WZAB 1Y0BA 4G63A 5KCZA 5DBOA 4CM9A 2P3QA 1E6KA 4ZI7A 4URZR 2DSNA 1ZAKA 1YLOA 3FMPB 4BMYA 4C2AA 1ZITA 4TRNA 3QE0A 1C30B 4V02A 4O6VA 1IBSA 4B84A 3BMQA 1CKEA 5FLYA 4BUJA 3OQIB 3KB6A 1GLNA 2XOKD 1HY3A 2VBSA 2IW3A 3IP7A 4BAUA 2GN1A 3H87A 1RRFA 4MX8A 3UT6A 4O4JA 3D4IA 3AVXA 3GPBA 4Q7LA 4DA9A 5CIQA 4A1OA 4UPEA 3GJRA 5H3HA 1OB5A 2ETXA 4V0ME 2SCUB 1RZRD 2QQGA 3QEAZ 1JNXX 4M1QA 2AL7A 1YE3A 2C7VA 2P3MA 1RZUA 3ZBPA 1QH8B 3RYCA 5ALOA 3WC4A 2XH8A 3NUZA 3IEXA 4AULA 4ZJUA 4X6LA 2B4YA 3DFMA 3LQFA 2B1IA 3U1BA 4OGWA 1NIJA 1NW5A 4XSHA 2VP4A 3FBGA 1KEVA 2FX5A 4B09A 1Z74A 3ICCA 2DY1A 1Z6XA 4PZ9A 5JCJA 3RUIA 3UENA 3QTTA 4HDKB 3W9YA 5CFLA 4Q7JB 1VL0A 1V9LA 5B3JA 2VF7A 2V5AA 3QWHA 4G81A 1HYQA 4KYUA 5G41A 4BMZA 1QYXA 1PNQA 3TKLA 4A03A 4IHJA 3A6KA 3V1TC 4EI7A 4CKEB 3Q1KA 4NCXA 4EMBA 1NVDA 2YFYA 4RETA 1C80A 1GUAA 2P35A 4WGGA 1TM5E 3MT7A 3TLCA 2ZATA 3VJRA 2RAFA 3K1YA 4QGHA 3HMQA 1ATZA 3ELYA 3PNKA 2HXYA 3ZV6A 1PR2A 2P7IA 5BSFA 1XFOA 4NMXB 3I32A 2FPPB 1WNFA 4O8ZA 4H3SA 2QX6A 2VZ0A 4RDCA 2OYCA 3VAAA 3GJYA 2VPQA 1CS0B 2BGTA 3IVMA 3TQIA 4BGVA 3RC2A 1VA4A 2YVAA 1IATA 3EPKA 3FWHA 1HE3A 1Z13A 3JQBC 4NAUA 4QARA 4ZOLA 4FFMA 3CX8A 3GFTA 2X2EA 5F4OA 1PK9A 3CUWA 3IKVA 1KRHA 3K3PA 4XPIB 1DQSA 5SZJA 2ZWMA 3CEMA 1IEXA 1DTWB 1UM8A 1NLUA 4JVLA 4ZD6A 1CSEE 2H5LA 1PF7E 2IZ6A 3QYFA 3CE9A 3FI9A 3L1IA 2J7PA 5EQFA 4AW9A 2BCEA 3NHLA 4MZDA 1A04A 5HM6A 2OM2A 4DLNA 2X9VA 5EESA 2VYVA 4DLXA 2XNCA 4OQPA 1NKSA 4I50A 4BCCA 4ZRDA 4QDKA 1K6MA 1KVUA 1H0RA 1UMCB 2HADA 1GARA 3N6VA 2FE1A 4YUVA 2ZB4A 2AFHE 4OATA 1VL2A 1H1LA 3MJCA 1JF8A 2DOGA 4ER7A 2EIHA 1FJHA 1U1DA 4ZO7A 1Q16A 2QTRA 1T6ZA 4S0ZA 5FNVB 4WLVA 5CR9A 4WI1A 4HB2A 2BWJA 4B6GA 2VS1A 1NRKA 4KQIA 4ZT7A 3EIWA 4JUIA 1KE2A 5M2QA 4CG2A 4LJRA 3B53X 4UUBA 2UZ3A 2GN8A 2GYYA 2E3JA 5B1HA 4G9BA 4IIYA 5KB3A 1NUPA 1KI2A 1QR6A 2X40A 5FA5A 4BNFA 4DG9A 2VBFA 1NRWA 2RHMA 1OVGA 3NXSA 4B3TB 4MI6A 2COKA 4RAQA 1C9EA 1SURA 1TQDA 1RAIA 2IKQA 2ZJOA 4MP3A 1C8BA 3WL4A 5IFLA 3I01A 5DX1A 5DM70 1J22A 1D7OA 4DV1B 4PABA 1V3TA 4YQEA 4BVKA 4NS1A 2XZTA 5KAMA 3WP1B 3LQKA 4ND4A 3FNHA 1CYEA 2YUTA 4TTJA 5DWQA 1X7GA 3MJSA 2J5QA 4JNKA 1EAMA 2JVJA 1R18A 4BLSA 2VXOA 3T7RA 4AQ7A 2VHWA 1G20A 3MYYA 2DIEA 1RTKA 2YWHA 2AFIE 2GGSA 3BIFA 3CV3A 3F2IA 4OM7A 4HY3A 3VSEA 3P96A 3UUWA 4D96A 1IM2A 4XFDA 4UDYX 2DHEA 2PRYA 2ZTMA 4P3NA 3SF0A 3COVA 4P3OA 2JLXA 5KNDA 1RBQA 2Z4RA 5G4LA 3JQ7B 1E79A 1QANA 5EJGA 4E21A 4B74A 1EJ2A 2EFGA 2O7QA 4R9VA 4WCVA 2GAJA 2X22A 3DDCA 1JDBC 4YRNA 4UKDA 2QTHA 1S3GA 2ILVA 2VIIA 1UXOA 4G01B 1A95A 2HN9A 2DWUA 3DXFA 2EV9A 1U0OC 4G8CA 4EBFA 3Q7RA 5L6MB 3QY9A 2ZYAA 1PGPA 3KQPA 1ZCAA 4BFLA 3K9CA 1R0RE 1F3OA 4BNZA 2IYAA 3RADC 2JASA 2DH6A 3IV6A 2RC6A 4D02A 4Y67A 5CA1F 3T5PA 4LOJA 4OK6A 3HO8A 1YXMA 4ZVRA 3AHFA 1ZN2A 1JALA 2H8KA 1A88A 1L5FA 1JBEA 2G9QA 4UDNA 4JL5A 4KH1A 4HP8A 3ZHCA 3RKUA 1Y4AE 2VHJA 4Q7MB 1P81A 1OLSB 3R5SA 2C29D 2QM3A 4MW0A 5KNBD 1CY2A 2NUAA 1RR6A 1ZOPA 4CQLB 4EUHA 3SJUA 4CNQA 3BTOA 3NKLA 1JHQA 4Z4TA 1FFDA 3FG9A 2Q7OE 5LP1A 1Y3AA 2H92A 2ORVA 2XDYA 4LFBB 3VR5D 2VK8A 4UQLA 1B8UA 1HYBA 1JDJA 2X6TA 3M70A 4NYIR 3COJA 3SVZA 2IDZA 2BUAA 2ZCVA 1WLYA 5M5BA 1WW3A 4OLFA 4NMHA 1GCAA 1QHHA 5K4GA 2OMEA 4ABYA 2BRUA 4EHNA 1N6PA 3SC4A 2VT7A 3PQCA 3DBRB 3HSYA 4PZEA 1A2BA 2XODA 3R6WA 2XITA 5LA6A 3RAJA 5JLJA 4I19A 3HEBA 2I1QA 1IHOA 5JROA 2NO9A 2J9FA 3DMFA 2PANA 4WZEA 3P4YA 4F3RA 4L50A 3L18A 4OPMA 4MGKR 3B48A 4H4DA 2PXXA 1D6JA 8MHTA 1GUZA 4KCGA 2L82A 1Z63A 4J0FA 1JLLA 1ZNXA 5F5XA 5BNIA 5JH7B 1D8TA 3ZGLA 3IPAA 4IINA 1Q3HA 1QNFA 4H7EA 4O1IA 2HSEA 4QULA 2AOTB 2J0UB 3M82A 1ECLA 1VJ0A 2CYBA 1T5SA 4CM7A 3DMTC 3H7AA 2HJRA 2K87A 3CP8A 1KO8A 3NBUA 2CF4A 4JHLA 4GLJA 5LNK6 3MB5A 2HZBA 1RKVA 4XR6A 2PSFA 4QREA 4QVKA 5B1SA 4CQMD 1WHSB 4DEXA 3EQ8A 2BMDA 4OQEA 2IQ5A 1FNNA 3CLHA 3ZZ0A 3UVEA 4E2XA 3FMIA 2F43B 3BWEA 3VU9A 1W85B 3CO5A 1KVRA 3K71B 2H2WA 1SVLA 1BDHA 2Q6VA 2GYUA 4NU8X 2AZXA 1TM1E 3PFNA 3LZCA 1VM6A 2I6SA 1LY1A 2NT3A 3AFNA 1UD6A 1BXGA 1DT3A 3GLUA 1Z4KA 3LL7A 3FDZB 5E0OA 3W04A 1L5SA 2FN3A 3K5HA 4OGGA 5TPZA 1HKHA 3FVTA 3TZHA 4RLSA 1RBMA 3V76A 1MZVA 1NF2A 3KG2A 3B8HA 5IHXA 1SWWA 3TEMA 2YC2C 1HL3A 1T5DX 4L02A 1NQVA 3U0BA 5HXAA 3C5WP 1W6UA 3EXFB 4N6GA 2VDWA 4OJQA 3DULA 1Y89A 4GXQA 4UHKA 3IH5A 4H1VA 16PKA 5B1DA 4EI2A 3AY7A 5DM1A 2CVFA 2GPYA 1OAOC 3ICEA 3PUJA 3IUYA 4EARA 1K4YA 4QQFA 3AOEA 4HAOA 4ZOQI 3USZA 3N2GB 1C3EA 3M5PA 2O07A 4J7CA 3Q8MA 2OFPA 2FWMX 4YBRA 2CMKA 5EE5B 3I12A 3AKZA 2NLOA 2Y76A 3OMLA 1NNLA 2V6JA 3GFGA 4R71A 3WIEA 2D62A 4TTPA 1WUJS 5D7BA 5BR7A 5FX2A 1V16B 2CF6A 3PT5A 2VPPA 3QLJA 4ZVSA 1LVHA 4RV4A 1ACLA 2IDMA 1UKAA 2HSDA 3BE8A 3VMMA 3KZKA 4Z0NA 3ZIUA 1EFHA 4MVJG 1X13A 2QJFA 5ALPA 1L4KA 2QI9F 5IM4A 5C7YA 4WINA 1B0PA 3LW7A 5C4GB 2YMLA 2DC1A 3QU9A 2O23A 4F4DA 1NBMA 3B2QA 3P97A 1YS4A 2J4CA 3E9CA 4JT4A 4KYIB 4Y2HA 3I34X 3W7BA 3DZDA 3K2IA 1DKUA 4Z8YA 3OPYI 4CG0A 2Y1LA 3NBFA 1AUXA 1QP7A 1C3JA 3I6ZA 5H5JA 1G8YA 3BCSA 1MDBA 5TX7A 2WTUA 2CLDX 4KQHA 1FDOA 3LQ6A 3MHPA 1MOPA 1ZVKA 2VO1A 2EATA 1N2OA 4JROA 1WXGA 5DYYA 4BV8A 4J0KA 3AW9A 2O8CB 4H16A 1EXNA 2MMGA 4QZVA 2ZUDA 5E1DA 4YGYA 4QD3A 3SJAA 2R6AA 4V2UA 1TJ3A 1S8AA 2LXNA 1CD5A 1EFRD 1I7PA 1JR3A 1ZWLA 1P7ZA 3D26A 2I6QA 2WW8A 4KK4A 5EJ4A 1KMNA 2WQ7A 2ENWA 2GBLC 2J4FA 4KJZA 1KZHA 2IBSA 5BYJA 2H0QA 4Y9UA 2ID9A 4M3NA 3D4LA 3V4VB 2VP5A 3OLWA 4PHHA 3VAYA 5JJBA 3QWAA 5BN3A 4HH1A 2DERA 2XTMA 1Y0RA 1U0JA 4O4JF 4AJ2A 4TMKA 4KYVA 3SZRA 4CEIA 1NMXA 3L7AA 3OT5A 2JGJA 4NE7A 4ZI2A 1JDZA 3I05A 4MLDA 2W43A 2H29A 1LVGA 4AO6A 4YRFA 1JAYA 3AJ9A 5KREA 2F8MA 3QXCA 5LD2B 1BMDA 2ZPTX 4KKSA 3LK7A 4FU0A 3HM9A 2BJWA 4L0CA 3TRHA 3LUPA 4CTMA 2EW2A 3IDQA 3ZZTA 1EX1A 1T8RA 2H2FA 3C15C 4G41A 5DBHX 3FCXA 1CUIA 4ENSA 4HLNA 1G8GA 4YJFB 2QORA 4E4RA 3GQBA 4C04A 4DR3B 3TE6A 3EFHA 3O8DA 3AFIA 5ARCA 5CX1A 3TG8A 1RAHA 4QUJA 5HX7A 3JWEA 4Q3AA 4LCJA 3ESAA 1JPUA 1DXQA 1PJQA 1Y6ZA 4RL6A 3USES 1XSEA 3VTKA 5L7TA 1M54A 3T4PA 3K16A 1XEXA 2QVCA 4N0PA 4R05A 2D59A 2OC4A 2R6JA 2R8OA 1O5TA 3QLEA 4MVJP 4AG6A 1NXXA 4CLDA 1N6IA 3HUUA 4Y6RA 3EULA 5DYIA 1GY8A 3U7JA 3STUA 3GG9A 3PU6A 4OIMA 5CFQA 1LX6A 1VCMA 2GK6A 3NBMA 1DXYA 3ND7A 4UXIA 1O9BA 2XRFA 5TF0A 1HZEA 1YZKA 4U39A 3TAHA 2XUQA 3DEFA 3DZKA 1QGUA 3HA5A 3KM0A 3BXEA 1P7WA 1Y8CA 3RRFA 6ADHA 1R4ZA 1SBCA 1WWKA 3KXIA 4IDBA 2W2XA 5TB5A 4UFNA 2CC2A 2WNIA 4FNAA 4I8DA 3D8NA 4IFEA 5BURA 4YR7A 4GP9A 3PSAA 5MF6A 1L4LA 2F1OA 2KM1A 4I9UA 4EG3A 5BMOA 4B48A 2ZIGA 5DLYA 5EMHA 4CMAA 3T1QA 3TSAA 1AGRA 3X44A 1MD9A 1L4MA 2GK4A 1UD4A 2IYNA 3FJ1A 4BB5A 3OIWA 4UEOA 4M1ZA 3LLSA 4I50F 2YXDA 1OWPA 4MGZR 3E5NA 4N0EA 1KXZA 3S81A 1FSGA 2B4TO 2LDBA 3X1YA 1C3OB 1EVZA 2AYZA 2ZOSA 4F8EA 3FJOA 1MIHA 1ZQ1A 3HJRA 1CS4C 2DRIA 1CR0A 3MJDA 2CMGA 4CMIA 4QELA 4OQNA 4Z7NB 1OBHA 1RLIA 1UT8A 3QE4A 1XTPA 3IPLA 4KC0A 5ALIA 4DQUA 3UJPA 1MGPA 1X7ZB 1QDLB 5TMEA 4WLFA 4G8JA 2IY8A 2K6GA 3D59A 4DM4A 4XQFA 1RYNA 2BZ1A 5DTMA 2EJUA 4N0DA 5IYNA 1DBQA 3R3VA 4LYHA 4DADA 2D8AA 5C3UA 1LJLA 3FI0A 2WUGA 3CLSC 4FQ7A 3TK1A 3HJHA 4B79A 5CG2A 1EBBA 2YJ3A 4JJEA 4TQUS 1OIXA 1Z5NA 3PR3A 4LRTB 3RUCA 4WLOA 3STWA 4US0R 3T5BA 3CEJA 2UZ4A 1P5RA 1UFQA 4TOIA 1SVUA 3TL2A 1N2ZA 1P8JA 4OYLA 3RUDA 4R8VA 4ZVPA 3ANYB 1UZMA 4BJHB 4EH1A 4WK2B 3GUZA 3RBZA 4YCLA 3BUSA 3R7LA 1V6AA 2H4WA 2B61A 1IFXA 3QLUA 1YK0A 2CKDA 1A9XB 3GLFA 1UQTA 3D02A 1TVMA 3BZBA 1JGTA 1NVMB 1CY8A 4R0MA 3K70C 2XB2A 4HX9A 3KKQA 2ZEJA 1W4AA 5DHQA 1UJ4A 5TMBA 2PKEA 3VZDA 4CM8A 3A6LA 1IEQA 1O3YA 1Y6RA 1UP7A 1ZOSA 3LOPA 4M0UA 4OSEA 5F2NA 1KI9A 1FDSA 3M6XA 4NMWA 3IEIA 3KWLA 2YHSA 2CLKB 2F1JA 3LU1A 4UAJA 2O3TA 4A5OA 2I66A 1X39A 3SM9A 1NULA 3V34A 1JAIA 1KDPA 3RDPA 4ZCTA 1WCV1 2QMQA 5ES3A 2C54A 1SA0A 3GRFA 3FPAA 1HLGA 4QTUB 1TJPB 2ZYTX 5K0EA 2XCSB 2PJDA 1CDOA 2W2PA 1HTBA 2JIZA 3M4XA 1N9GB 3A6ZA 4L9SA 1Z38A 4IW3B 4A10A 1M34B 3EMVA 5EN4A 1SC9A 2A1UB 1G59A 3K9HA 5B4VA 3IKTA 2R1TB 4HRAA 5E1OA 1DQPA 3DVLA 1AF4A 4HUQB 2Y2VA 1SHJA 3THOA 5JYDA 1O96A 1XCPA 1VG0B 3CLUC 3E8SA 3LTEA 4X7CA 1JI0A 1V71A 5DU2A 3V2UA 1TVKA 2BE7A 3IAUA 2GBCA 3U3ZA 1T2DA 1GU0A 4FTWA 6REQB 2FQQA 3ANTA 3GVIA 1YRAA 3JRWA 3ZU2A 2NSHA 1F6WA 4FZRA 4D3FA 3HXOA 4DLLA 3NC1C 4UJ5A 2DQ4A 3OH8A 5DVZA 3KYCA 2ZS7A 4C22A 4KR2A 2F8SA 3STHA 1L7AA 4R3WA 2GNOA 3UHOA 3PQ4A 3VKUA 3LDFA 4D0LB 3GAAA 5A88A 2OCBA 3QJYA 4XVUA 1TW2A 3SHFA 5SZHB 1F5SA 3ODPA 5LA6F 2WE8A 4WBNB 1FZTA 1OVMA 4IIUA 1PJ6A 1EX9A 3I9LA 1JJBA 3K20A 4N01A 1SXIA 4R2MA 5F3RA 1OZ0A 3JXEA 4UNSA 4NCJA 3KJIA 1EB8A 4DCNA 4ZZIA 1G18A 1SOMA 3PUMA 2GRAA 1IBLB 1QLJA 1CUVA 3OKPA 3F4LA 4RTRA 1ZOOA 4LQCA 3VC2A 2ZRPA 4HJRA 4TX1A 1XE3A 3V3KA 3ZI4A 4W82A 5C8VA 4A26A 1EX6A 4OCZA 5ALHA 4MYSA 1NFFA 4JR1A 5GINE 3SEZA 4UM5A 4G5FA 2YWBA 4G0NA 4NBUA 1JA0A 1G291 1L6RA 4NXNB 3INTA 1F2TA 5CU7A 3IV9A 1A8UA 4JB2A 1DZIA 3VJMA 4RDHA 4Q82A 4LJ9A 1RXUA 1XE1A 4H27A 1Y7IA 5FPHA 1LBHA 3EQ7A 2CSUA 4TUYA 1R0SA 1S72B 1E1KA 3ASZA 4NV3A 1QLWA 5A3VA 4AJ1A 2DECA 2NAFA 2H51A 1YUNA 1JIVA 2GILA 3S0JA 3PDWA 2BFEA 5CCBA 3LDGA 1GKKA 1LI7A 4DDHA 2XZLA 2O8EA 2YHUA 1ZXXA 2BHNA 1C1YA 3CISA 1R3UA 4BGIA 1YDGA 4HYEA 1JHMA 1QK3A 3RG2A 3G2LA 2F1HA 3JWJA 4IDQA 1TM2A 3AHEA 2BM8A 3LLVA 4GECA 3RB8A 4EA6A 1E1QD 3JPWA 4NU0A 1UANA 3A35A 5IUJC 4RMJA 5B7QA 4FSHA 2DPXA 1U8CB 3A3YA 4ROXA 3WQSB 5FOUA 2YX1A 3H2GA 5FWXB 5JSKA 4O3FA 3WYEA 4KPFC 5B58C 3ZDYB 2X2PA 4H6XA 3EYAA 1W49A 3RVLA 4C4PA 4BQPA 3GC6A 1Z5PA 2ATCA 3E9NA 3JU4A 5JUWA 3HBFA 2Q6IA 3R3SA 3RS9A 3Q38A 2CF5A 1HG1A 4E2WA 1H94A 2IHUA 5CAEA 2J6CA 2GXUA 5FB3A 5KS2A 1VCHA 1YGYA 4D80A 4B82A 4BWGA 2HFKA 2YFQA 3DBLB 4LBWA 2R4UA 4R9RA 3MWFA 1BCRA 3JYOA 4HGPA 3F49S 4OFWA 1E9VA 4OHOA 5CLIA 1K92A 4YI5A 1I13A 3SKXA 4X85A 3VJLA 2PS9A 2FOLA 3G9UA 1ST3A 4CV1A 3D5TA 3DE5X 4KTVE 8GPBA 5IM4F 4PAAA 1E4EB 1WP9A 2Q5CA 3MLEA 1T3SA 3JAKB 4IV8A 4WNYA 3IT0A 2EXXA 2REQA 2JGNA 2VUIB 1T3HA 3TMYA 1MABA 3WYFA 3ILSA 4BO4A 3D5EA 2JL1A 1KS2A 2V54A 2Z2XA 3I9OA 4AVZA 3I4LA 3KKMA 1ODFA 1U2SA 4MLCA 2ILTA 3SAJA 3WGTA 3PXGA 3DE3X 2JK1A 4YAFA 5JU6A 2O6HA 2XE8A 1KEKA 2XYHA 1O6CA 4FDTA 1VL5A 2AR0A 3QVXA 5CIYA 2JI7A 5FOTA 3EPPA 1ZR2A 1JA1A 3RIGA 1D6SA 2R00C 3U81A 2FN4A 3LQRA 5IU6A 2PXHA 4FFLA 2QQEA 3IUBA 4RQBA 1WU7A 3WRYC 4GX0A 5ICCA 1D07A 3OCZA 3OBIA 2I3DA 2FPRA 2O52A 4PS0A 4PNEA 4P81A 2LE0A 4YPFA 2QVYX 1DUVG 5B6JA 4O3MA 4ARAA 3J7AC 2I6UA 2XUJA 3PFHA 1ULZA 5TS2A 5AI8A 4GSLA 3TXXA 2F67A 3LXUX 3WHIA 4ZT2A 5HBGA 4NJMB 4PFJA 4XCQA 3IYLW 1YI0A 2FMTA 2IF2A 1EXVA 3JQCA 1KBZA 3F6BX 3TOSA 3UK0A 2YRWA 3U7IA 2A9JA 3BORA 2PZ8A 2WJIA 2EQ5A 3HJUA 3OZSA 3ZQUA 4RFSB 1Q17A 2Q2NA 4NZOA 2HMVA 1P0QA 3D7MA 2W2MA 2PGXA 3F1KA 3H2JA 4K9KA 3RK0A 4IRXA 3EHDA 5K6AC 1Q11A 1M2HA 1PW7A 4IJKA 1SCKA 4FMDB 2D54A 3ZGVA 4L78A 1T3TA 1E9DA 4WCFC 4EYOA 4P22A 3PXEA 3OSZA 5K3DA 1Z16A 4EABA 2FI1A 2EL7A 2FP3A 1PFVA 1TC2A 1ISPA 1P1JA 4IHKA 4RF5A 5ELMA 1LLQA 5HCNA 1ZKDA 5K8VA 1DC8A 5JI3E 4UBIA 1TTQB 1MF7A 3MK31 1MC5A 3ABOB 3V4FA 5IVPA 5IZ4A 3H11A 4C5BA 1QDEA 3VH3A 5I8WA 3ZVNA 1JPJA 2E18A 5BNFA 1P4GA 3TDKA 3GUVA 5I3ZA 3LWBA 5T6BA 1YZ3A 2IYPA 2V9CA 4M21A 2YWRA 3ESYA 4X60A 5GVSA 2GTHA 2VH5R 2Z2YA 3FLEA 2N47A 3GCXA 3MWLA 4M7WA 5E4FA 3ST7A 1UBRS 5BV7A 4JJFA 3KB2A 1BMFA 4WZKA 1C8LA 4BVGA 2AK3A 3DBHB 1SU7A 2HIHA 3W3ZB 4FCTA 1E66A 1DJPA 4CUZA 3LDUA 1UUFA 1RQPA 1AQLA 4FFVA 4YP6A 3NASA 3ZCPA 3KSZO 5C1OA 3FPEA 4L9RA 3Q88A 4JVOA 3BKWA 3I53A 3NHUA 3GFOA 2LP4Y 3F71A 4GXNA 5DI3B 4D9BA 3DCYA 1PRYA 3EC2A 3QXJA 2H7YA 3BQMB 1UPCA 2XCQA 4LMBA 4S1VA 3IPYA 3OFJA 4IDCA 3WSWA 5HRUA 1MC1A 3AETA 4C6TB 3GGCA 4I4TB 4NG4A 5ADHA 1MB0A 1QVVA 3P2JA 1S2NA 2ZIUB 4MP8A 4QXPA 1XZEA 2CFTA 2W4QA 3L01A 2XOKA 1ZU4A 2IPNA 3UG6A 4DCVA 3IJEB 1LX7A 1P3DA 1WZCA 1T6YA 4L8GA 4W5JA 1ZBDA 2EGUA 2GVZC 2M1XA 3UT5A 5KOHA 4LOIA 1J56A 5JNUA 4F2DA 1PG5A 1YQGA 2BFDB 1QF7A 2UUOA 4V39A 5CT6A 4WJLA 4BLOA 4UMVA 1IYZA 1Y1LA 3IB3A 1KD1D 5JQGA 1ESMA 2C2YA 2EX1A 1VL1A 4CDMA 2QY9A 2V1UA 1S4QA 2XD9A 2HU2A 1BD4A 3RRJA 3K0KA 3AUYA 4XLHA 1SCJA 4BP8A 3KFVA 2EJTA 4YAJA 1FQOA 1WUTA 3D6TB 1T0HB 5JPDA 4CWAA 3AH8A 2PDAA 2C42A 1P31A 3FPFA 4LF4B 3EJ6A 1VRCA 4OOEA 2ZJ1A 3H1FA 3SC2B 1J9GA 4LHVA 3CUTA 2ZIAA 1BA2A 3E0XA 2OVFA 3I55B 1ZJ6A 1XRLA 2YWCA 4RK5A 1KH3A 3AWIA 4JEUA 4Y9RA 1O87A 1WEKA 1BDJA 4WADA 1OJLA 3E4DA 3CMAB 4KAXA 3MG9A 4D42A 4D4HA 4BVHA 5IN4A 1S8OA 2G63A 3AESA 4ROSA 2I33A 4GYKA 4HDSB 3PUIA 3NHRA 1K98A 4ZYUA 3AR9A 2WJ3A 3UB3A 4E51A 4L75A 1Z4QA 4LRYA 4IUBS 3AGQA 4MQ5A 1F0KA 1Z8DA 4M1KA 5I9TA 4KKTA 1HDIA 4IKOA 3BMQB 2J3MA 2P2YA 1AB5A 4PGAA 5SV2A 4CRWB 8ATCA 1G9XA 4G36A 1XMVA 2I1LA 4MVYA 3WJAA 3CWQA 3IULA 1E2DA 1I1OA 3FFBA 1H2RS 1RE0A 4MO2A 1F2UA 1UPTA 3A2NA 5BR1A 3WA7A 1EZZA 4LXYA 5CDFA 4H60A 5ADWA 4M0PA 2X0KA 2WWFA 4L9WA 1WSWA 4KVGA 5FUQA 3D6UA 1G2OA 1OKKD 3W34A 4Z1MD 3AI2A 4H4CA 5LM3A 1TUEA 3W9BA 1JYEA 4B45A 2IOHA 4TS1A 1XQXA 1L5ZA 3UW3A 1LRLA 4YFVA 4JI6B 3KDSE 2FGJA 2NXWA 3DZFA 4MICA 1C7FA 2HDHA 1U28C 2OV1A 2VJCA 3A11A 4ND8B 4GXTA 3TQCA 3TSWA 1TA4A 4ND3A 1DJLA 1U1EA 3KFXA 4FLMA 5BSWA 1V96A 4ZYLA 5K3EA 1KZ4A 3EIXA 3IT3A 1M66A 1GO2A 2AF3C 3A7DA 3MUEA 4K6CA 4XQGA 1VG1A 1SU6A 2HXGA 5DIFA 1LLUA 1PX0A 1RAEA 1PZXA 3M2PA 3IVXA 1A9TA 2AZDA 4IHJB 4J7XA 4KIUA 4AK9A 1TYDE 1XX6A 2NZWA 1Q7BA 2BY4A 3RC3A 1NXOA 4PW0A 3S5UA 4JC5A 3DMGA 1EVIA 1Y4SA 4YJHA 2I4MA 1FY2A 5TPWB 2W70A 1B0ZA 1G9SA 3UG7A 4ZDKA 4IS3A 2TMGA 2FUNB 2AG5A 4FYIA 4AWAA 1K7SN 1VLVA 2G8LA 4M36A 5JASA 2ZS8A 4ZOLB 4Z4VA 4NLLA 1PJZA 4OX9B 2C3PA 2XQGA 1C4WA 1XL1A 3GGGA 2JKYA 1JJAA 5MGBA 2X3YA 2FUEA 3T8YA 2EW1A 4L73A 3OQOA 3R0ZA 3HXKA 1NC1A 3K5PA 5LYJA 3RBAA 2FW1A 5L8VA 4KQFA 3OI7A 4UCXA 4I46A 4TUYF 5TT1A 2PN1A 4YHHB 1QCDA 2IU4A 3KVNA 4ZAZA 1C0PA 2C2KA 4PNHA 2H57A 4EKGA 3QE9Y 4JL8A 1F0NA 1ISMA 1BQ4A 4KQGA 4CQJA 3OJOA 2PRJA 1NATA 3BEOA 3BT7A 4ID3A 1II9A 3SYLA 1EP2B 5KMGA 2Q1WA 3HKBA 2J3EA 2PUAA 1H1LB 2WDPA 2YXEA 2GPNA 3WB1A 4ZGNB 3F90A 4RD1A 2VDRB 4EVRA 4A36A 3PC8A 3EBLA 5AJXA 2GHQA 1RPAA 1KOJA 1GHTA 2DOKA 3WJ7A 1WORA 3UXEA 1YQ9A 4NZZA 4GI1A 3ZV5A 1R3DA 1Y1KE 2P6NA 4U7HA 2NZUG 1R12A 3VHLB 1B73A 4HNAA 1CR1A 3CLSD 3RK1A 4RTPA 2VPTA 4FMBB 4DNRB 4IGFA 3VAZA 2NYVA 1GADO 4H7DA 5C8YA 3TKAA 3NQ41 2CNWA 3ZLVA 2I34A 4Q6BA 1QHEA 1XTRA 5KTYA 2EYQA 2WSSD 1RI2A 1XQBA 3C6KA 3ETGA 1C7IA 3EZYA 3IUEA 4MQLA 2PT6A 1KE1A 3UA4A 1V7ZA 1EA7A 1SK9A 2E1PA 3GJXC 4GKVA 4Z7QB 1QG0A 1KXJA 1KYXA 3WBKA 4BGDA 4ZTUB 2AOXA 3MWJA 3S2EA 1AD2A 2JFWA 3GNQA 3HLYA 1BE1A 5J5VA 5CYOA 1ICIA 4LA4A 4Q1FA 3K70D 2QXYA 5CM9C 1N78A 2UXDB 3JQQA 1DC3A 5E6SB 3N5KA 4JYPA 4QAJA 3GPCA 2GARA 1QVAA 5I47A 5LZ4A 4G1EB 2W0MA 2EP7A 1Z6TA 4AKSA 3QKIA 3RHFA 3N05A 3WXMA 3VR6D 1TLTA 4ZCIA 1EUCA 5JNTA 2JD0A 3O8QA 1A2KC 3T9BA 1UDRA 2FMHA 4QDJA 3RUAA 4CT0A 1LD3A 1USVA 4LHXA 1ILEA 2PL1A 2ZDGA 1QFYA 3HYSA 1E6UA 2YZNA 4YRCA 2WM8A 4ZVTA 1M8GA 1JN0A 2HA0A 3FNIA 1TFRA 4X7EA 1N6OA 2X13A 2FEOA 3UATA 2R7NA 1G21E 3FAZA 2W6PA 4JYMA 3V8VA 2AJ8A 4YRZA 4ZZ0A 2IYUA 3PXCX 1GPDG 3BSFA 2OKGA 1GG9A 2FDCA 2N75A 3EVNA 3VV2A 3MA0A 5C37A 4KR7A 1YDWA 2XVMA 3OURA 3RWBA 3NO4A 4KNYA 4QNNA 5F73A 3K1AA 1FBTA 4E32A 3BGSA 5B7PA 2J9YB 3BWDD 4E5VA 1VQ8B 1NR5A 2PX2A