5FIUA

Binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXY-ADENOSINE SYNTHASE
publication title Exploration of a Potential Difluoromethyl-Nucleoside Substrate with the Fluorinase Enzyme.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 80
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5fiuA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5fiuA01
2C4UA 2C5BA 2CBXA 2WR8A 2C4TA 2C2WA 5LMZA 1RQPA 2Q6LA 2V7UA 2V7WA 2CW5A 1WU8A 2Q6OA 2V7TA 2ZBUA 2CC2A 2V7VA 1RQRA 2F4NA 2V7XA 4CQJA 5FIUA 2Q6IA 2Q6KA 2ZBVA 2C5HA 5B6IA
chains in the Genus database with same CATH superfamily
1KMNA 4Y2HA 5DYIA 3SS9X 1I2AA 4ME6A 3C6BA 3AKEA 1XA3A 1BU5A 3FM9A 5H1YA 5KMGA 2HCBA 2W42A 3U61B 4GYJA 1A9ZA 4TTRA 5LD2B 4YJHB 1JQKA 4LDJA 4JJGA 4BNXA 4OF4A 4LECA 1DOAA 4KMMA 1SM4A 1UM9B 3AZPA 3AOEC 4KNVA 4LRYA 1P1BA 5DT9A 4C30A 3FVTA 1AQNA 3BHJA 1U0LA 2D5CA 3GUUA 3DMPA 2C1ZA 3UAXA 3ASVA 4IKPA 5CM9C 1F2DA 5D87A 3LECA 1UZAA 1PJBA 4ANFA 2JW5A 4ZYWA 1K5HA 3UBTA 1KYQA 3DO5A 3T35A 1GR0A 2G63A 2ZVDA 4JXJA 3V00A 4DLXA 1WQ1R 1F8YA 2IXGA 1ZIXA 1NPYA 3LWZA 2E6KA 3EXFB 4XM2A 3FBWA 4Q4AB 3NBMA 3KWJA 2OV8A 3EOAI 3NH9A 3ZWKA 1GTSA 1ZVVA 1N1EA 1F2TA 1K9SA 1Q14A 1C3JA 2QVZX 1ZH8A 3G6KA 1SVMA 2AK3A 2DVMA 3HKCB 3LA8A 3MERA 4R2MA 5KSYA 3CTMA 3ZWBA 1I1NA 4JLWA 3MT8A 5JWRA 3IJEB 1OFHA 3GQVA 1QKJA 3HLYA 1P0MA 3S1SA 1FX1A 4BNHA 5DLEA 2GYWA 3QG1A 5KYYB 3DUFA 3G1TA 4A8JA 3OPVA 4IIJA 1HYEA 1TYCA 4QJIA 2NG1A 5KJ6A 3IPCA 4L7VA 3BD7A 3FMFA 4XW2A 4Q1DA 1CZOA 1JSCA 1RZ3A 2ZRDA 3K8OE 4HH0A 4YDSA 1G5IA 2YTZA 4PAWA 4JSRA 5DW3A 1DJMA 1II0A 2NVUA 3OQ6A 4P3IA 1XPJA 1ZD9A 2IZ0A 3E58A 5B30A 3JQFC 5BORA 1WM1A 4GG1A 3GSIA 2FWAA 3LHFA 3L92A 4NQRA 4QFBA 1PL8A 1PNTA 4A6PA 2ROQA 2CXXA 3U49A 4XLCA 3IX7A 1AK1A 2TRSB 3I39X 2JIZD 5AKYA 5C31A 4RA6A 2JHFA 1SQ6A 3L04A 4XYBA 4O2AA 1X1TA 2OXTA 1RD4A 1TIKA 2XB8A 2UAGA 3CF4A 5CLFA 5IULC 3DQQA 1FTWA 2I6SA 4QOSA 1RAHA 3ER6A 2VRCD 4J76A 4S2UA 4YAOA 1UK6A 4XFKA 5EKUA 3ZXUB 4AF8A 2EAUA 1EFHA 1G7SA 5EQJB 5TLSA 3F97A 3GZ4A 4QM6A 2POQX 1W581 2WIAA 3NHJA 1CRLA 2LBPA 1XCJA 2O2EA 5LZ2A 2AF3C 1PIWA 3K2EA 5IZCA 3DBLB 3EG5A 3WKAA 2HF9A 4LV5B 1NU8A 2FMHA 4QA9A 5I9SA 4DZZA 2R5FA 1MW8X 3SHQA 1VE5A 4R8KA 1IWOA 2R5NA 3P9XA 3QFCA 4HXFB 3L7JA 2BBSA 2WLSA 2FGJA 2VDWA 2BHRA 1WR8A 3GIDA 2IF2A 1SVNA 3G49A 3HKDB 4LXIA 4RF5A 2PGIA 1KH2A 5DCUA 5AMXA 4RSRA 2YX1A 3I92A 4MV8A 3VH2A 4D7AA 1POWA 3IDQA 2FE1A 2QN9A 4ZO6A 5CB8A 4ROTA 1RQRA 3LC2O 1FJGB 1CUAA 3RTBA 4EYEA 5A05A 1P75A 4RQAA 1EG7A 4GOMD 4H59A 4KOEC 5KJFA 2X6RA 4DCUA 3CVWA 2IZ5A 4AUEA 2PXXA 3U16A 1QH1A 4IQFA 4LJAA 3F4LA 5B2ZA 2VT6A 4UARA 1BS1A 2O23A 2QL6A 4M2LA 4HXEB 4X00A 5HMMA 2R4UA 3R76A 4EG6A 2V55B 3DBIA 5B1EA 5C8YB 3OURA 4FIZA 5A6SB 2JIDA 5FBKA 4NBUA 1SG6A 4BMVA 2X23A 1E3SA 1AKQA 1JSZA 2IS1A 1PBTA 2OOSA 3JAWB 4PBRA 5BNZA 4GSKA 2WSYB 1QRAA 1VL2A 2ENWA 4Z1MA 4RADA 5DGXA 1A5TA 4LVUA 3ZN2A 1P4AA 1TU4A 3T7AA 2Z4RA 5CB0A 3W5HA 1YVRA 2FLVA 3O3MB 2CFTA 3D3QA 4C6SA 5IDXA 5K6AA 5H8WA 3JQQA 2P4QA 1RYMA 2HHJA 2J7PD 4QLAA 2IXDA 3NORA 4JVOA 4LZAA 3WYGA 1T5LA 5AVUA 4Y7DA 3N59A 4WK6A 3DXXA 1RXVA 3B3JA 3HI4A 1H2YA 5KPJA 1GZSA 2Q5IA 2P6OA 4TYPA 1ULBA 4P2NA 4ZVPA 4N7MA 1TJ4A 1V8FA 1JAHA 1XQBA 2M98A 2ZLBA 3B13B 3EULA 3RROA 3UMVA 5D2CA 4E70A 4YRKA 2A33A 4KQCA 3PWZA 3GLIB 1AK9A 1GQYA 5AOBA 1SUAA 3N28A 2IEIA 1UPUA 2PZLA 3C16C 4DCCA 3LBYA 3NRCA 1W93A 1SHLA 1E1CA 1D8TA 1XZNA 1SXIA 2W2VA 4NU6A 4TT3D 4XCQA 5B37A 3RSFA 2EW2A 1IYZA 2F8MA 3SHFA 4PZYA 4LV8B 3M6VA 1UC4B 2B0CA 4GR9A 2BTEA 3H9QA 4OJTA 4AD8A 1E96A 2BKVA 4OATA 1I2ZA 4RLFA 4AN0A 3QHPA 3CVYA 3FMIA 3TOZA 1IG3A 4PBTA 5L4SA 1WF6A 3TSAA 4HN2A 2IXAA 1EWRA 3RUDA 3S6JA 4CV2A 3QX3A 4TMVA 2B92A 2KMLA 4Z7OB 3OPYI 4DCSA 1W75A 2C3YA 2ZRPA 4C2AA 4O33A 2K6GA 3I1FA 2EKQA 3FCYA 4I50A 1ZBQA 4BBZA 5I6DA 2WJHA 4BQEA 3MTIA 4CFSA 1Z18A 3AOGA 1DKUA 1X3SA 1SC9A 2C00A 3GWGA 5TX7A 1MBZA 1A8IA 4MHTA 4B6JA 5GJWC 3I6YA 4QG7A 2VXCA 2RHRA 1WO8A 4I9UA 4TUYA 1JGTA 3CLTC 3UG7A 1CLEA 3B3GA 4DWJA 1H05A 1PJ5A 3TQCA 1COWA 5LP6C 4BNWA 2RJNA 1A8PA 4BVHA 4RX1A 1IVSA 4Z9FA 1L4YA 2W6NA 3GK3A 1ODLA 1XHEA 5DBHX 4IZ6A 1WOSA 1DRWA 3OUZA 5DNVA 3G85A 5IUJC 1NE2A 1XRSB 3H6HA 4MDEA 5JAIA 1RHJA 5FO0A 1USWA 2ECQA 1UJ6A 1YE5A 2PMKA 1Q7YD 5DIFA 2FW8A 4OYLA 4X95A 4Q5IA 2ASEA 1JDTA 1JDVA 2FRDA 4E4RA 2O8EB 3GH1A 5GADl 3BGDA 3BGIA 2BLLA 3KU4A 4HC4A 4AAYA 2WYVA 3B3QA 2QRHA 5ENZA 4ETMA 3GNLA 3UW1A 1S2IA 3QOWA 1L7QA 3N7TA 2BEVB 4OHPA 4WESA 1I33A 4HIZA 1PJ7A 4M53A 3KALA 2JFQA 2XYGA 4IDOA 1UP7A 2G7MC 4LRXA 5CW1A 3SBXA 3HJFA 2YN0A 4P4UA 3M89A 1LQTA 4HRAA 3KQLA 1LK5A 3I9V6 3EPHA 1EXMA 5J2TF 2ZT6A 2YVUA 1PL7A 1WP4A 4NJEA 4J2TA 3NIDB 3VH3A 4QEKA 3TQHA 1C7IA 3HXMA 4PGGA 3MGBA 1Q86D 1L1EA 1XQ1A 5DO9A 1CNMA 3FD8A 4HEQA 3CCLB 2C59A 4MAFA 3GZTB 3I5UA 4UBMA 2OUIA 1V0JA 5ARDA 4DV0B 3VFDA 3TXYA 2X7HA 1E2NA 1YJWB 1O95A 3E81A 3PUVA 1U2GA 2R48A 3WLSA 3ZIUA 5A3VA 4C2UA 2XQJA 3UJ7A 1RXSA 4G5RA 4HTFA 1K9MD 2O2HA 3L7BA 2AEFA 3HYRA 1KKUA 2YDYA 3CZ9A 3EDYA 3MA0A 9LDTA 2GN8A 2G04A 1NV9A 4NOMA 1MQ9A 4PPFA 4WXRA 2F55A 2VZ8A 1RAAA 1LBHA 3D81A 1GFSA 4TKLA 4GDMA 5KVQA 3QKRA 1WXGA 4I1SA 3DEZA 5CLIA 1AIPA 4L5CA 3LKBA 5HM6A 3MWDB 4JB3A 4W8OA 4ZANA 2DRIA 3QW2A 5A0VA 3OW7A 2F1RA 4GBGA 2VXYA 5LDGA 2A30A 1F0PA 5IYPA 2PJDA 5FADA 1YZVA 1V45E 2FSHA 2QMEA 3HVKA 4FYMA 1KYWA 3RR2A 3JQGA 4J03A 3GGPA 3GRVA 3CESA 2JATA 5IUKC 3OE7A 2H07A 2O57A 2O1WA 3ESCA 4R2JA 5LIRA 2GCOB 1EB9A 4KEAA 1WMAA 3O91A 1A1SA 4WZAE 3IIEA 3WJ7A 3LO5A 2A1UB 3R75A 3TLEA 4RM0A 3RTDA 1VE9A 4MKGA 1OGJA 2B1RA 3HEMA 3H5TA 5CDTA 1ONBA 2RB4A 3CC7B 2ZUVA 2P2LA 4O4LA 1UDRA 1AKWA 3RPEA 4J3FA 2JGDA 1KI3A 1M6WA 5FUBA 2IHNA 3WYEA 2FPGB 3E9RA 3ZHBA 4FXOA 3ZCUA 2F3TA 1KRHA 1VDMA 2VDUE 1SUSA 4NWIA 1VLOA 4C0WA 1KMQA 2HJSA 3H84A 3SX2A 3GLFA 1F38A 2WSIA 3GMSA 2PUGA 1ZRMA 2A58A 3EIHA 3F98A 1P7WA 3LXRA 1XZQA 1KEUA 4DLPA 2RE8A 2REBA 3F3SA 1V6CA 4KX3A 4MPPA 4TTSA 4F6LA 4W99A 2OG1A 1C9NA 3VC2A 4C4SA 1XC7A 1MO2A 1C0LA 2GJSA 3AVPA 3JD2A 1B76A 4RNDB 5DT2A 3S5UA 3GN1A 1Z7GA 2AG5A 1DUVG 1RTKA 4G3XA 5DHUA 4YC7A 3PGMA 1J8QA 2PS3A 2BEUB 2AUNA 4EUKA 1FP4B 4G9GA 2J0VA 3L7NA 3FI9A 5I4CA 4JY7A 4MRNA 1LWOA 5K7SA 2FHPA 4JBLA 2GHQA 5BYKA 2O3TA 3WWPA 4Z4YA 2CZGA 5BNIA 4BUZA 4F8YA 1WY5A 2IYQA 5AM1A 2O2XA 2PJZA 4N40A 2ZYTX 3JTMA 3X1WA 2W48A 4V0MA 3REQA 2IYPA 4D79A 1EK5A 2PRJA 4ASUA 3KQWA 1IOZA 4A2WA 2QJTA 4B6PA 2Q21A 1RHQA 2G77B 4XQ0A 5F3WB 1PV2A 1OLUB 3AJEA 3EGXB 3HQ4O 3KZ1E 4J2HA 4Z4UA 4WNAA 4DVJA 1C2TA 2O54A 1BCSB 3SG0A 3R5TA 1DIOB 3N0VA 2PX0A 2IYAA 3PA6A 3U1BA 2IBTA 1KZYC 1OIVA 3FI0A 5EWJA 4ARVA 2QIOA 2G9UA 2X3YA 2GBLA 4WA7A 2Z0MA 2CDNA 4RZHA 4IDBA 5J23A 3HBMA 4GS5A 2R00C 3EH2A 3IP9A 4WBSA 5LQKA 3ZHZA 2E4UA 4KQFA 4DXHA 1QRTA 4DV2B 4U7WA 3GUYA 3NBXX 1OB0A 1Q44A 1YIJB 3P27A 1EVEA 2GFQA 2SHKA 3A06A 4J4BA 5FOQA 3SLRA 3RUFA 3CCEB 3IQFA 4UM9B 2B2CA 3B1YA 3OJ0A 1Q57A 1NW4A 4MYSA 3BQMB 1P0CA 3QBDA 1Z3IX 4YRFA 3P4XA 4ECEA 1P4RA 1ZM3A 1A5AB 1PNOA 1TVKB 4HJXA 4A6XA 2R6ZA 3UK1A 3DBHB 4E12A 3OPNA 2O1SA 4P7KA 3ZLJA 3G9XA 4QJBA 1VQOB 4ZZ1A 2FZLA 2VZEA 3B52X 3MS7A 1Y1PA 3EDOA 3QM1A 3W8EA 1IULA 4IL5A 4ZXFA 2QTNA 9ABPA 5J5VA 3N2LA 5CGQB 3OIUA 5T3UA 4G5SA 1TDJA 1S3GA 2QPLA 4I9GA 5FD8A 2R60A 3AERB 3UMFA 5A02A 1X15A 5EESA 1RRFA 3AEKB 5BSHA 3U60B 2D5LA 1OA1A 4JNCA 2VEDA 4NLLA 3HDGA 5JLJA 5ILOA 1E60A 1W85B 1XZJA 4BKUA 2QUJA 3M82A 3OJOA 3IAFA 4WADA 4FN5A 2I3AA 4URFA 1C29B 3UUWA 1MRZA 3JWGA 2ZE6A 5J59A 4X0CA 1TFUA 3ZWCA 3MHPA 1ZEJA 3RTCA 2D2FA 4R6XA 5DHFA 3U9LA 3F67A 2C4VA 2PA0A 3Q8XB 5D7BA 1Z0UA 2IHUA 2HHLA 5FOXA 5J2UF 5TF0A 2COUA 4B3SB 3QBTA 3IPLA 4UNQA 4QXRA 1OI3A 4MVJA 3FLMA 2WHXA 5I5GA 3LCCA 3N2KB 2CL6X 3OY7A 3T5BA 3A6JA 4WKGA 1X7XA 2PUAA 3PUIA 4G5XA 4ZT7A 5ICGA 2WVJA 3WOHA 3AX6A 2W0SA 4RJ2A 5L95A 1Q81D 1Z4KA 1E18A 1C14A 2D1QA 2MYPA 2V8BA 3FXAA 4HZIA 3QJ5A 4G2TA 4WNIA 2ZCJA 2DH5A 3OEWA 3RKSA 4E15A 2OCDA 1G3UA 4X61A 5LSAA 4BECA 4AWXA 1M6VA 3PHGA 1KEEB 1OX4A 4Q1FA 4RZXA 1DKLA 1L7XA 1BD3A 1SUDA 2W2MA 2ZR7A 2ZUUA 4NENB 5DMXA 1K8YB 1P9NA 1TX4B 1VLMA 4LQCA 4ZCPA 1ZU4A 4A92A 5EHZA 5K3EA 3TNFA 1OPXA 1P91A 1V8ZA 2PWBA 4JXZA 1GAWA 4MGKR 1ZEMA 2HNBA 1EYZA 1ZZEA 2PV7A 5LIPA 3V55A 1DFHA 1M1UA 4JVSB 5CT4A 5EP3A 1N5RA 3RIMA 1YCHA 2I6TA 4EYQA 2F9FA 2WILA 4QEDA 4B3CA 2X2OA 2OK8A 1ENZA 3HB1A 2ZJZA 1DJPA 1TOAA 2PGAA 5EERA 3I8XA 2A9OA 4LY6A 4IFIA 3JAMA 1WKVA 3D0KA 2CC2A 1PSWA 4NDNE 2QE7D 4JJ7A 3TDNA 2NZXA 1TUBA 3CTPA 4XM1A 1P17A 1BIFA 3SVZA 1LSJA 2O3UA 2GETA 2V98A 5AK3A 3TDKA 1PUIA 4R2HA 4WIAA 2YKGA 4JJ8A 3VR3A 4F86A 5HPYB 2H0QA 1FUIA 3UB3A 3TOVA 2YVAA 2ENUA 3SWWA 4E5MA 2IS6A 2GRUA 2DT5A 1IM5A 2IYNA 3CLRD 3OFND 5C4IA 2DR0A 3FCCA 3E27A 1QORA 1LA2A 1X7ZA 3PRKE 4MKXA 3R40A 5JISA 1MH1A 3IEVA 2V4DA 5BR8B 2B82A 4C6TB 3IE1A 1YITB 4RCYA 2QPTA 3ZQ6A 3AIKA 3ADPA 3QU4A 1KR2A 4WINA 4LF7B 2VJNA 3L5KA 1JFRA 2PBZA 1CEQA 3TAUA 1WEHA 2RGNA 3TWOA 4IDFA 4DEXA 3RGGA 4M1YA 1DS6A 1YRLA 3V4OA 3ETEA 3AHGA 1EK0A 2OGSA 1ZGJA 2RD2A 4BFTA 4ZRMA 2VPZA 5T64A 1V11B 2A57A 5C80A 1ZN9A 3DPSA 1UBTS 4LY9A 3V7AA 1FVXA 4YJHA 1UPCA 2B36A 3NBAA 1N4AA 4BIMA 1M1YB 2FPRA 4LE1A 5ERYA 3ASYA 4CKWA 1UM9A 4WY8A 4XAQA 4BO4A 1C9DB 4AJ1A 3FB4A 4UAUA 3CCVB 4S12A 1SOWA 3DOHA 3MTQA 3GFRA 1S2GA 4DAOA 1Z6TA 4YX9A 3ZS8A 4I3GA 4QX6A 3UTCA 1ZAKA 2OYNA 3K4PA 5BSYA 2LP4Y 2C5FA 3DTVD 3R0JA 4FONA 2EATA 3RSCA 4TSKA 4XSVA 1ORHA 2HL6A 5DNWA 4HGQA 3O73A 4EJFA 5DN6A 4Q66C 2ZVJA 5HILA 4PYQA 3FROA 2ZIUB 3EXFA 4DR5B 5F5NA 1NUUA 1Y7LA 4LXYA 1N8SA 3TEJA 2AT1A 4Q4AA 3I3OA 3QV1A 4KXLA 3ENNA 4R8SA 5KKCA 1NW7A 4NYIR 5CA0B 4ZVUA 1YI1A 4NBRA 5FFMA 1NFFA 3HKCA 3ACBA 3H13A 4QSHA 1UQTA 2G71A 2IYWA 2IYFA 4YDRA 1E6KA 3AIIA 5I01A 2NU9B 4GKKB 3PF9A 4G24A 5AKLA 2DPXA 4PSVA 3D4LA 4YUZA 3S2FA 4XGQA 5GONB 3I4FA 5KYYA 5TMPA 5IT0A 4NBWA 2H5LA 4Z99A 4FW9A 4J0EA 2A0KA 5HR5A 3V76A 2FZCA 1A3CA 1TZBA 5DCLA 2FR0A 4XLEA 1FCJA 1JWAB 1OV4A 1ZH4A 2DHEA 5JXIA 3KYDB 1Y63A 2JKZA 3FZQA 3BGOS 2YICA 1VLHA 2QZ4A 3E4DA 3LW8A 1TECE 2WU0A 3F1LA 4Q3LA 3LBFA 1OGIA 2FH5B 1GGVA 3ESZA 2ORYA 2C2GA 2FFHA 3O8QB 1LXCA 1Z5NA 3Q0TA 4G85A 1L9KA 2ST1A 4E94A 4EMTA 4A8TA 1FP7A 1YRBA 1OH7A 3DKIA 3RFUA 3L5OA 1DKNA 2B1GA 2C3UA 1KVRA 1UC5B 5EKXA 3WKDA 3FFWA 1PLLA 2ZPAA 3NP7A 4J7XA 3BCHA 3P9CA 4G56A 4NMHA 2VJLA 2NV6A 3CF2A 4G0UA 1W29A 3OZAA 1R12A 1ZI8A 1YR2A 2O5VA 2QD4A 2WVGA 1EK1A 1UMCB 3B1JA 4OPMA 3UJCA 4ALNA 5I45A 1J9ZA 4YCSA 4G0OA 5TJ9A 3TZBA 4KR6A 2BJHA 2GZRA 2X9GA 2ZXEA 4XWKA 3H19A 2BRUA 2EKBA 1LKZA 3DBLA 3QLVC 1KAHA 5L4NA 4MQ6A 1FE8A 4BDTA 1IZYA 4PNZA 3P5SA 3C3JA 4CN9A 3MWJA 3HKDA 4XR6A 3E0XA 3RRFA 1D2NA 1R6UA 4PZEA 4DC0A 5H4GA 3I8OA 2VQEB 2H4FA 1CHNA 1X9GA 4I4IA 1YA4A 4BEJA 4F4FA 3R3UA 5I5EA 4LSGA 4GNRA 1W88B 3QE0A 2OHFA 5FULA 1M2EA 2RG1A 3AR5A 1XAJA 3H11B 4OB6A 3RVDA 1IDOA 2EL9A 3A1TA 1HUQA 3BWVA 4AUMA 4ETWA 1EQAA 3L7CA 1ZN7A 3BXHA 3PA1A 2WF7A 3COYA 4JOCA 4M7RA 3RVPA 3TRKA 5JYCA 1MNQA 3TX2A 1VG8A 3EK2A 1ATZA 3L6DA 4GLBA 3LK7A 1PVDA 5C8YA 1YI8A 2P5SA 2G83A 4Z7JA 1J07A 2LCIA 5A6SA 2OO5C 2G9NA 1NLFA 3JQ8B 3Q5GA 2JFZA 2DUNA 3JAWA 1T9GS 5HZBA 2WZDA 4GOND 5C8DA 5JBQA 2EP7A 4JU8A 1VP9A 2CVHA 3IOCA 3E9YA 3M9WA 2X4IA 1H93A 2RBKA 4M6WB 2FYTA 1BDJA 1DMRA 2HN9A 1AG9A 3AY3A 3OG9A 3QMWA 3EQZA 1D5CA 3CR7A 4PX2A 4CGYA 3P0JA 3QHAA 1E5QA 3HJAA 3EVGA 4V3BA 2D5BA 2ZIWB 4JN6B 1U7XA 5HA5A 3KAJA 3RV4A 2VG8A 2RK6A 4HB0A 1VPVA 3GAMA 4QXQA 3O92A 3ZZ1A 1GNVA 3RFVA 1BDHA 5AW4A 1VTKA 3RRMA 4MUNA 4G6IA 4XD7A 3DZ8A 3MQ4A 1LFAA 3MXTA 2J9XB 2H1HA 3GLIA 3UFXB 1NBMD 3DKKA 4AY4A 3GDWA 4D8YA 1M5RA 2H5IA 4BFXA 2FN3A 1KIAA 4WACA 4OI2A 3AVUA 4N12A 5GQSA 5JH7F 2O3QA 4JJ6A 4JJIA 2XT0A 2YMQA 4KAAA 1WZIA 1XEXB 2POCA 4H1UA 2WAAA 4IHAA 4BKMA 2NPFA 1FXUA 3A1SA 2QQEA 3H8SA 5BN3B 4B09A 4YEJA 2WJWA 2PFSA 1JIXA 5ADUS 2ZRIA 3NALA 5KTTA 1VPEA 2Y1KA 4JEIA 3DAPA 3DE6X 4QG3A 2B83A 4C9BA 4Z51A 5TPWB 2CB9A 4IGIA 5LUAA 5J4YA 1ISFA 4S1WA 1PZNA 1N06A 1DBVO 3HCEA 3M1YA 4XLZA 1P2VA 4DIMA 3EDQA 4YR7A 4TX1A 1LS1A 4ZQIA 1X94A 5CFZA 3K16A 1KJIA 2C92A 2G1AA 4DLSA 4EPTA 2UZ4A 1M7HA 8GPBA 2HREA 3G2LA 3WGMA 1FS5A 1QX3A 1ZM7A 4I4TF 4V0KA 3ROTA 4RTNA 1GDHA 1LJLA 4OX9B 5DGHA 3TLMA 1YCGA 4RFVA 4IINA 4RCVA 1Y9ZA 4OXNA 2M5SA 1WZCA 1YX2A 1OAKA 2JJ8A 4CTNA 2XQVA 4BMYA 3PDJA 4HV4A 4XTRA 4HGRA 5GJCA 3T9CA 4N0EA 1E9FA 1MF7A 4HBZA 4B9EA 4BN5A 3FRHA 1T13A 4JYMA 3PEFA 1ZIPA 2O8EA 2DX7A 5E7QA 5THKA 2Z9BA 2GAOA 2HTEA 3D6AA 3C70A 1KGDA 3C74A 3DFFA 1RACA 2YZNA 3N3AC 4I8DA 4WKOA 4B4KA 3FOCA 1AMUA 1FDUA 1MAUA 4YCNA 1XROA 2YC2C 3ZV5A 5ALDA 2ZT7A 3COWA 1DQZA 4TPKA 4IHKA 1G3QA 1J0EA 3VKHA 2LRHA 1BEZA 4LI3X 2BEVA 4OTZA 4LVCA 2Z6BD 3VZSA 4IKOA 4RU1A 4RHFA 5F64A 3CSUA 3HCRA 2P8JA 4E33A 3G0OA 3HC7A 3M4YA 4G67A 5CJ2A 1SRRA 5JS8A 1H4QA 4YRIA 2LTAA 3AUXA 1Z7WA 1AO0A 1A77A 2X0NA 2BFOA 2XMRA 3GP3A 1QQAA 1VQ9B 1IB0A 1HKUA 5SZJA 3GFOA 4RNCA 4KWIA 3TGPA 3H05A 4YMWA 2E85A 4EEZA 4JLMA 2DWQA 1SQSA 2FN9A 1BFUA 3Q6QA 2FR1A 3BSSA 4QLBA 5JO0A 2AE2A 4CF6A 4JEMA 1YL7A 1XZFA 3DP9A 3OEEA 3P9SA 4J0IA 3E6AA 2HDNB 4TRJA 1QTQA 1XQ6A 3MQ2A 4JIMA 1M2NA 3L79A 3RQIA 3AVOA 2AL7A 3T4XA 3JQBC 3CRNA 4QFCA 4P3XA 2PZJA 2GK4A 1XN1A 3OCYA 1OE0A 4O4IF 3A3KA 3E1KA 5DX0A 2F6RA 4H35A 4M4SA 3W7AA 1XNRB 3W9BA 2IU3A 4PZZA 1Y42X 1QBKC 4XM3A 1N8TA 1NTOA 3WHPA 4EO7A 3AJRA 1Z68A 1JQAA 2J3DA 4YNBA 3BCFA 3UCEA 3CLSC 3WR5A 3NOVA 4OOVA 1ZONA 3OLWA 2I8AA 3OX3A 4A3SA 4DJAA 3M49A 3ICPA 2F48A 4PWZA 4MCIA 4EW6A 3C97A 5KVVA 1UPTA 1K7FB 3DDZX 4KE6A 4MQMA 5HF9A 4MAMA 5B3AA 3D54D 3R9KA 1Q21A 1OTXA 1D2RA 3HDHA 3MWDA 4PS1A 1DAEA 1TCVA 4ZP1A 1YC2A 3W78A 2PUBA 2QTWB 3QYFA 3VZPA 2OV6A 1MO4A 5HKBA 1B6TA 3DKPA 4B3JA 2HRRA 5JNSA 2YYYA 2HJHA 4F2PA 1NVEA 1DC8A 1W25A 3A7DA 3EIEA 4G5QA 1CUZA 2GPBA 2ACVA 3IB6A 2JGRA 1UDBA 2XNJA 1KIFA 1ONSA 2CHUA 2GA8A 4XI9A 3EDRA 2FLWA 5F3RA 3L6OO 3FF4A 2QLBA 4JLVA 1USIA 2A1UA 2AN3A 1BMFD 2H2DA 3U40A 5B4UA 2VWPA 2P7IA 5F5LA 1R66A 1XMIA 4FFNA 1YGYA 4M1ZA 1HQYE 4OM7A 2FPGA 1C3EA 3AUUA 4YCAA 1I24A 1U0FA 2ZPUA 4ABYA 2B20A 2GOYA 5K8CA 2JI8A 3RSHA 5CCBA 4N5HX 3GLFE 1YRAA 4XYMA 4B6QA 4JUIA 1PL6A 4KDRA 4YHBA 1SBNE 5J35A 1E9AA 3INYA 3LT5A 2CNNA 3GUCA 3KQTA 5FF9A 2IC5A 3EGOA 3TJZA 1P73A 4LGYA 4UNSA 4XDGA 4DAEA 5JXJA 1MOSA 4CI0B 1M8JA 5EJIA 4GYYA 1DRVA 3KOWA 1CV2A 4H7HA 4MVJP 5EIXA 1E99A 1EX1A 4DL9A 1W47A 2BEUA 1IATA 3OHPA 2DJIA 1FP4A 2A9RA 4Y6QA 1XTBA 2OLJA 1YE8A 3L2OB 2CJFA 2LDXA 2BJVA 2DQYA 2ZYRA 3G02A 3G2PA 2P35A 5M04A 1QP4A 4A1FA 5EHNA 1QAMA 1TMYA 4BKQA 4PN7A 4FIDA 3LQ6A 3CT6A 2VJYA 2E2WA 1NXWA 3BMOB 4KBYA 4LZWA 2Y2UA 2GPTA 1NT2A 4O3FA 1J8YF 1ZIYA 4V0ME 5D3KA 3ZOZA 1C1HA 3EZ9A 1P0IA 1KDZA 1J0CA 3MCVA 4NE9A 4PO3X 2Y4OA 4R8VA 1RABA 1KSHA 4XB6B 3DJYA 3RBZA 2Z2JA 2X9NA 4O4JF 1IPEA 4ZD6A 1UM8A 2UUCB 1AKUA 1OLUA 3EGXA 4L6AA 3DT9A 4XOTA 1NYLA 1ECCA 3IHTA 3TCKA 4X62B 1BCSA 1GARA 3EYWA 3ZYCA 3L01A 4XRRA 3HXQA 2PGNA 3W3ZB 2M6SA 1UFRA 5HM8A 4U39A 4ZO9A 4DPMA 3R8XA 1PFWA 3QNMA 2Z3VA 3H5OA 2YCLA 2X0DA 2OO7A 3O8LA 5EOVA 5J3OA 2IOQA 2JNWA 4UUNA 2ADFA 2HIGA 2CNWA 2FVXA 1Q11A 3OJLA 4ZEXA 3KZVA 2JIBA 3ZZMA 3BJMA 2PWZA 3DAHA 5KX5B 1R9GA 1QLWA 5AVSA 1TT7A 3EUEA 5JAMA 3R7LA 3HV2A 3K4HA 3ZU4A 5FOVA 3L7OA 3NUGA 4HKTA 4YRGA 4PQGA 3HSSA 8LDHA 2ZAYA 1QFMA 5KDLA 2P4HX 3NHSA 1ZOPA 1UWVA 1P5FA 2WM3A 3LPNA 1XTZA 3DL4A 3FPHA 1OLOA 1VLZA 3AW9A 4XYGA 3TGLA 2GCPA 3VJLA 2GZHA 3LUPA 1KJ8A 4TSRA 1TVKA 1RIFA 5EUBA 5FWYB 2PV0A 2Q5EA 2P67A 4TTAA 3DBHA 4N4AA 2X40A 4DLVA 4OI4A 2HMWA 3VPDA 2V6FA 3UWDA 3WHIA 1XFAA 2DH6A 3RSOA 5ADVA 1HWYA 4KKUA 4Y6OA 5LYJB 2ORWA 1JX6A 1O6FA 2FJUA 5ALGA 1P5JA 4NOJA 3FPLA 3SZ3A 3NFYA 3ZNPA 4QUDA 3AERA 2W6PA 1LDNA 1XTKA 3AEKA 3P0EA 1VE6A 4I1IA 4LDNA 1DAOA 3C8HA 3EF3A 1DTEA 1JSXA 1W85A 2HLDA 2ODQA 3QX9A 2XT9A 1WS6A 1IZ9A 2W00A 1UEIA 2I76A 4IRUB 3ZNOA 3UKJA 2O7QA 3OE4A 4AURA 3ZVNA 1EFPB 1UKYA 3D31A 3DEJA 3H7IA 4TV8B 3ANMA 1P74A 1Z35A 4MVJE 4Q03A 1AS3A 3CM0A 2WC1A 4MTLA 3UMBA 1P31A 1JPUA 1KF0A 2XOXA 3GDOA 3N2KA 1Z3CA 4G1MB 4PPQA 3WZ2A 3DBOB 1Q83A 5G53C 3U6BA 1UD8A 4AX4A 2P9FA 2QZPA 3R9WA 2CDAA 1I5OA 5AOVA 1O96B 4G8CA 3SX4A 2WHYA 4HTAA 3TD6A 4EMSA 2IK8A 4EA9A 2ZJAA 3KEMA 1KEEA 4G0NA 4DYHA 1RU3A 3TSZA 5HZHA 1ADGA 2AF4C 3DUWA 1P4SA 4G41A 3JZAA 4NENA 4H0NA 2FN7A 2AYYA 4G5GA 1YE3A 2HRCA 4BZZA 2H3EA 3A3NA 4QNMA 3LT0A 3KAQA 4KMOA 1FVHA 4NXNB 5JCXA 1JHMA 3O1IC 3QEOA 2E49A 3DV0B 1QONA 1BX0A 4RVNA 5HCIA 3OW2B 1I36A 3H5IA 4F2WA 5KKAA 1KQ3A 4LHEA 2A35A 2JKYA 4C1BA 4CMAA 4OQMA 5CD1A 1QQ7A 2WMOB 3ZGXA 4YALA 2RK3A 5IJAA 4GLLA 3U4GA 4C4RA 5IUNC 1L8AA 4JT8A 4LC9A 5E3IA 4YP9A 1G9SA 1AGPA 3PFKA 5L3VA 1U7HA 3VOAA 1XALA 4FZJA 2GO1A 2GESA 4E4YA 1I2DA 2YASA 3L1UA 5HHTA 4LGMA 2E7ZA 3JWHA 4DM4A 1Q17A 2QK4A 3KJHA 3HXOA 1X3LA 3EISA 5IVDA 4J0QA 2P1ZA 5AXCA 3UOWA 3ZTWA 3UJ8A 2GN1A 2Q45A 4X85A 4DE5A 4RM2A 1LBEA 1T29A 4DLKA 5DYWA 2V7QD 2DBQA 1BXKA 1UBJS 4ZOAA 4IJKA 1T9CA 5DHAA 1SHZA 1XQVA 3CINA 1FNNA 1KAMA 3ESBA 1P5RA 4WL0A 5U4XA 1GRRA 4Q00A 5AKKA 2LCFA 4C6TA 2G1UA 4BNFA 1GGNA 4Q02A 1JU9A 1DKPA 4P80A 3PIRA 5CDSA 2BLNA 3CMMA 1TF7A 1CIJA 1XYGA 2FUNB 4P31A 4OHRA 4R98A 4XIIA 3EXIB 5AKEA 4P9SA 3FVRA 3HP7A 1P2GA 1Y1QA 1IHMA 1EIZA 1NHGA 2HMVA 2O0HA 3H16A 3O90A 1PTJC 1ZKDA 3CFYA 3L8YA 1D1NA 3CJTA 4YQFA 1RJ9B 1F51E 1U9IC 4OJMX 3WIVA 2ZYUX 5EFZA 1U8ZA 1V11A 5CXSA 1Z15A 1OBOA 3EGDB 4R69A 1QIMA 3BE4A 5AXAA 5ALSA 3EIQA 4EFMA 4D9KA 1M1YA 4KRGA 4Q0MA 1N3BA 2NXWA 3T41A 3S70A 3GELA 3OIVA 3PXUA 4LISA 1V16B 1JBQA 1ZMRA 2HLHA 4NVRA 2R1VB 3T3MB 1JEQB 1H4SA 3H2KA 3C87A 1Z0KA 3D8UA 2P3MA 4WOKA 2C5GA 1Q0PA 4N1AA 3AXTA 4IFBA 4C07A 1AU9A 4QXPA 1V6AA 3WL4A 1MT0A 3W5CA 1JYEA 1VSQA 2UYOA 1FMTA 4AN1A 1EXWA 4HDMB 3IDSA 3AVVA 1GIAA 4MEBA 3FFBA 1IHPA 3GJ5A 3E7PA 3LWBA 2C2XA 2IZ6A 3P2EA 4XYEA 1XZBA 5C1OA 4Z3KA 1H3EA 2R6JA 2KSQA 4G63A 4OAQA 1K4KA 3OZDA 1YWGO 4EF5A 2YS7A 3RTGA 3SNHA 1KDRA 2ADOA 1KAGA 4QU9A 3TQFA 3UVEA 2P90A 3WBJA 1BA3A 1Q84A 3P94A 4WBNB 1IN1A 1CF4A 1W19A 2NU9A 5HJEA 2E5LB 2TECE 3TLJA 5GONA 3PP8A 4TLAA 4KU4A 2PPLA 1VJTA 3GLHB 3EFEA 1KKLA 4ZGGA 4MJ3A 5KKNB 4E2YA 1YIDA 2R87A 3MOGA 4NV3A 4FZRA 3U0BA 5HTOA 4PLTA 1II8B 1S3IA 4XMYA 3D8SA 5J4LA 4UAJA 5CEJA 2FDRA 1CX9B 4URHA 1VLQA 5BSXA 2IU6A 3KYDA 3KPWA 3QEKA 3WICA 1ZCZA 5BV1A 4V1CI 1R4NB 2BH2A 2V7TA 4S1OA 5T6BA 1Z4IA 4FOPA 3FTNA 5BYAA 4MLZA 3P9KA 1X7WB 1VF7A 2CLFB 3EZ7A 3NATA 3BFPA 1YR3A 3TTYA 3PGA1 5DYGA 2VSNA 2TS1A 3O8QA 4GYKA 1K63A 3M6WA 4RMIA 4AZVA 4I36A 2NUTB 4MV9A 1AURA 4BB9A 1MB4A 1Z12A 1PI3A 2VN8A 3GVXA 4HLCA 4IDPA 4E0BA 2FF5A 1DC7A 2KI5A 3EGCA 3MT0A 2H11A 3GOHA 4RE5A 1GZHB 4X3CA 1RAGA 4JH0A 4MGIR 4UKDA 1MT3A 1YD7A 4FYVA 3FCEA 4JKYA 1UMCA 3ZU6A 4YMUA 2BBWA 5LLSA 5EZQA 4BVAA 1JWBB 1Q22A 2QSYA 4M0PA 5ARBA 1EESA 4HAWA 3E3LA 1RLJA 1KJZA 1BAPA 2RB5A 3A3GA 2VSFA 2W2XA 1GZUA 2C2KA 2CLIB 3CEJA 3F9RA 2VPQA 4Q48A 1DJOA 5CVTA 1ONNA 2FQWA 2IEBA 5JARA 1UT8A 3WKCA 4BV2A 5F4MA 2XNSA 3BRSA 3C6MA 4QUEA 4QUGA 5AIAA 4Z0NA 3ZI4A 3Q9UA 4P92A 3MBKA 2QRPA 1JFFB 2ZRFA 2AW3A 3NVAA 2ZWOA 4L15A 2CB0A 4Z9BA 4CMEC 2XUPA 1QYIA 2PX4A 4Z4WA 1W88A 3FNHA 2LDBA 4R81A 1R0RE 3C3KA 1XA4A 5LBUA 3H11A 3PPXA 4IYJA 3ZE7A 1N32B 4KNYA 2PX8A 4HN4B 2XAUA 3FMGA 2AOUB 4M98A 3ADBA 2NPOA 1YQ9A 4MQ4A 4MKRA 1CK4A 4JNKA 1BQ4A 2V6BA 3C6XA 3JYQA 3R77A 3OBIA 4HPWA 1OYVA 3ROFA 1FFYA 4M60A 4KYTA 4PF1A 5AKHA 3SKXA 4JT2A 1ESMA 4ZDWA 1T0PA 1SULA 3JQ8A 5KW9A 5AUOB 2ZIEA 4G7XA 1G7CA 2YNMA 4JLUA 5AVWA 4M8NE 1D0SA 1Q1QA 1VL6A 2HWYA 4BB0A 4KACA 4B2YA 3W5DA 5IT9A 4KITB 3OCXA 1HE8B 3KJGA 4OFBA 4NAHA 1ZUD1 3DYVA 3EY4A 1OAOC 5BR7A 1DU4A 4M6WA 4A91A 2C83A 3GJZA 3PS9A 1GKLA 1TZ2A 2OGWA 3E9ZA 1A72A 5I4IA 3KD3A 3I6ZA 1P81A 3BTUA 4FMPA 4FFWA 3QHQA 4TQAA 3F3KA 1FNBA 3SM3A 3OEHA 4FOLA 1FLNA 1JLSA 2E87A 3BEDA 3WSWA 2G07A 4YBZA 5IXJA 4J1QA 5BVHB 1SU4A 2NNWB 1PN3A 4UEJA 1OLSB 5GP1A 4X8IA 3PD1A 1T10A 3BMQB 5FWDA 3BBLA 4NY1A 1A8QA 3CLRC 3O4FA 5E8JA 4K9OA 4AROA 3DE3X 3K70D 4XWWA 5FUVA 1RRVA 2R6FA 2Z5VA 3P52A 4PAQA 3GLIE 1QOPB 1YAJA 3UFXA 3VOSA 3LP6A 4JIGA 3K9HA 2WSBA 1BROA 1T2VA 5HKKA 1XTSA 1KZ7B 3KR2A 4F9FA 3K05A 1IQPA 1WZNA 5EIHA 4BKRA 5TS2A 4LKRA 1XEXA 1VIVA 4GI2A 5A04A 2VO1A 3L8FA 1XMXA 2HSEA 3A2LA 2B4KA 3UV3A 5B4TA 3L4EA 4JKIA 3RM3A 3X1XA 5BN3A 1K2VN 1VKHA 1JVSA 1TI7A 2FEKA 1OUMA 5CA1B 5AN9A 1WXHA 4HSEA 5IAGA 3ZNQA 2VNJA 3ABOB 1NQAO 5BQOA 1EVKA 4N03A 1NIPA 3OX2A 3FUXA 1YB6A 1KI9A 5TPWA 1XLUA 3VR0A 4NABA 3LTNC 1L5HB 1JAZA 4AKSA 6ABPA 1VECA 1SD2A 3UO8B 1AV7A 3EPKA 3T5PA 1OC2A 2VT7A 1U2RA 5EJMA 1C7JA 3DB2A 1RKBA 4B2IA 3G5UA 1I6WA 2DFPA 1AF7A 2WVHA 1WCV1 2XMCA 4D6YA 1PVOA 2WZNA 4JUFA 2QM7A 5DGIA 1I5RA 3V8NA 2ZB3A 1TM1E 4MAAA 1FSPA 2GNPA 4LSZA 3DMTC 5HSGA 5D84A 1KDYA 4BLQA 1PZXA 1VJGA 3FOZA 1NDUA 2HH9A 4UCQA 1FDWA 3NGMA 3U3XA 3PPYA 2VZLA 2WOJA 4KNWA 1TM4E 4FQ7A 1K3UB 4G9EA 4OUDB 5DGCA 5EE5B 3ZBTA 1DXYA 1T36B 4F72A 1GPH1 4DHEA 2ZZMA 3K0FB 3CNEA 3X2EA 4DARA 3HV0A 3A4TA 3TTXA 1X1QA 2R1ZA 4RH0A 1TK9A 3ILXA 5CMLA 5AOCA 5FPTA 5IP5A 1GYRA 3I58A 5I48A 2FPOA 3HTXA 2C98A 1YASA 3ZVMA 3OTWA 4GOKA 4ZJZA 4L72A 1JHPA 1SFRA 4Q1EA 2D5AA 1NU6A 1JMVA 1RNLA 2FPSA 2WU4A 4UNPA 4V0SA 5K3OA 5GONF 1E2EA 3MD9A 3THYB 1QU2A 1QH8A 4ZCRA 1O9HA 2JAOA 3RG2A 1VL5A 1UFVA 4RCZA 2FSIA 1FVOA 2YIDA 2Z2IA 3N70A 4L9AA 5FHQA 2H1VA 3N58A 2VDQB 4DJEC 3QKWA 3LS2A 3A2MA 5CDUA 1XRJA 6NULA 1D2MA 1KI7A 2Q2NA 2JAXA 2BM9A 3H4IA 2HT6A 2Y1XA 4RWEA 5AI4A 3SNKA 5AVRA 2YWEA 2RI1A 3FYUC 4NI5A 4U9HS 1UBRS 4MGHA 1EHIA 3DHEA 5C46F 1IBMB 3CW2A 2YQ4A 2G4LA 3LZCA 5FIUA 2I7CA 3ES9A 3QSYA 1U7OA 2VRBA 2JANA 2Z56A 2A1IA 1CYDA 4G1FA 4H3HB 2O3RA 3C7CB 2XADA 4D5EA 3RS0A 4D96A 4E30A 2GFIA 4LZOA 1QANA 1YS1X 3EVTA 1VJ1A 5EI5A 3G82C 5B53A 4CV0A 4Q4CA 2VDVE 4CEIB 2RFLA 2V9CA 1J7KA 2QT9A 4HVLA 2Y76A 3ACDA 3RS4A 3UBMA 1NUSA 3PXGA 1Y7TA 2B30A 1VGQA 1CQZA 2O1XA 2JAPA 1ULHA 1OU4A 3DZKA 5EMLA 3W2TA 3L8DA 4GEGA 3CPHA 1ODSA 5E7IA 4TL7A 1GTVA 1LQUA 1N1MA 2QN3A 1AMNA 5LBTA 2ZYVX 1Y9EA 4D0NA 5A7FA 3GUZA 3KKPA 4O02B 3ILHA 3RB8A 5LWHA 4QV2A 1WA5A 3MG9A 1GTZA 2FFRA 2FKNA 3F6CA 3OTIA 4JI0B 3EE6A 4YT4A 3UC5A 4ALIA 1GPMA 4P08A 2AHOA 3T61A 2EJVA 2ORVA 5TMEA 3C45A 3GJ8A 3CUSA 3I2IA 1R5NA 5WRFA 2PUEA 2ORIA 3GV0A 3UCXA 3TMKA 3NBKA 2NUAB 1GU1A 3GEEA 3OC0A 3NVDA 2ZI7A 4AJ2A 1W0JA 1IPFA 3CX8A 3LPCA 1Q74A 1U7DA 5FJJA 3CEAA 1QDUA 3SDBA 3DE0X 1CEXA 2QQGA 3DGFC 1HO3A 3KZXA 4YCDA 4PHFA 3HCNA 4K26A 5KNCA 4Z6KA 3ABSB 2E3JA 4Y6SA 4MHSA 3EEFA 3IBTA 2PAAA 3T53B 1JIIA 1Z0FA 2C2BA 3VVLA 5CX4A 2ZWVA 3QGMA 3WB9A 5BMVB 1TF5A 1VOTA 1K0FA 3IV6A 2DB3A 3CLVA 3QEMB 4FMCF 5IAKA 5LZ9A 2DLCX 1I2MA 5ALEA 3O31A 4Z4GA 3OJWA 4M0EA 1HRDA 3D4NA 3HLTA 4QBGB 1T6YA 5KHAA 3WLQA 3GLGB 2G0AA 4QOIA 1U7PA 4CCYB 4BLRA 1HRKA 1JT9A 1R6BX 3ABIA 4JGGA 2C03A 4CF5A 3BXEA 4EFDA 4ZN6A 5A4JA 5LQCA 1LDYA 4KAJA 4N8SA 4X0EA 5DCWA 5EUQB 2HEGA 4IO0A 3PQ2A 2H17A 4QPNA 2PBRA 1GNLA 5AHWA 1LPNA 2LNDA 2ID8A 1FLDA 1DARA 1G98A 4GMGA 4MI9A 2KE5A 2NYAA 2GR9A 4TLEA 3VDQA 4F93B 1J2TA 1E2FA 2YVQA 2Y0BA 4KP7A 3BMOA 4MPTA 3GU3A 4MUYA 4W9RA 1CBUA 3TL6A 3RT7A 4DSNA 3VX3A 4ARZB 3FZYA 2BSQA 1BA2A 1UZUA 4C4OA 4RPLA 3Q7RA 2FGKA 3MJVA 5DF1A 4WY5A 3G0HA 5IS2A 1L5WA 1TKRA 3G9ZA 2WWIA 3JVUA 3UH1A 3E2IA 2Q6LA 3D0QA 1DKQA 2G67A 3B9RA 4B3BA 3I5XA 2HPAA 2H1SA 1DAPA 5E3JA 1NBWB 4GYWA 4C7JA 3S5JA 4JWTA 2DFLA 3KCNA 5EEGA 1Q3HA 3ZVRA 1JJVA 3CCUB 1MAVA 2UV8A 4JT4A 2PQ2A 3BFJA 2DYIA 2H1IA 5FL3A 2D1FA 1B8PA 4CV3A 1CU1A 3LRPA 1E63A 2OORC 1ONPA 4QPPA 3AB7A 1V8BA 2AN4A 2HT1A 1OJLA 2VBCA 5KX5A 1GPLA 4GLOA 4IUBS 3UENA 3AUFA 2Q6IA 3PQEA 3Q8WA 1D1SA 5CDGA 1M34B 4GX1A 4E07A 3L7DA 3RHZA 1WETA 2ZJ6A 1UEJA 4RK1A 2H48A 3DHVA 3GN2A 3ZBUA 1NXXA 1E2HA 3AR2A 4HS4A 4OMDA 4UDYX 1H6DA 1I51A 3A1WA 3R7AA 3RC1A 3M4NA 1DQNA 1W36D 4RGVA 2AN1A 3P9IA 4F5WA 4UBKA 2JH3A 4DDVA 3IEKA 1S8FA 2ZSKA 4MYCA 3KUCA 5FWYA 2QUKA 3HUTA 4FHGA 4FI3F 3T56B 4HAXA 5EP4A 3PDHA 5KI6A 2OWEA 4BYMA 3L02A 5FKJA 1FU4A 2VRWA 5I7EA 3RS8A 4P6YA 1PJQA 4S3MA 3ZDRA 2X0FA 4KLZA 2QNIA 5GOTA 5LYJA 3H65A 1U9CA 5L4LA 2IPXA 3EGEA 1KOJA 1UDWA 3H5RA 3V1LA 1R5JA 1Y5IA 2WG2A 1TKAA 1YV9A 4DV1B 2H1FA 1UEXC 2L69A 4QWWA 4ZA2A 1V9SA 3FPAA 3KB8A 4X7RA 4KXWA 2IU0A 2PH7A 3EIFA 3QFTA 3CUTA 2WNHA 2XXBA 4MWBA 4R16A 4A26A 2QMQA 4KI7A 1US8B 1P19A 4AI6A 4DQKA 1OA0A 1RAIA 4HH4A 3OD5A 4MITA 1NXSA 1EFPA 4NMXB 5LP6B 4TV8A 1A7UA 1IUKA 5IN4A 1WCXA 1HQDA 4PRLA 1EA5A 3H0EA 4EQ6B 3BQJA 5BYJA 1ECGA 2SICE 1U4OA 2H7CA 4EA8A 4TYNA 1R6XA 3K9BA 4H0FA 2BFWA 5L6LB 1VLJA 1PWHA 1G8FA 1UJMA 2WAOA 2FWNA 3D4PA 5EWMB 2X6TA 3W3AH 3WGOA 1J21A 2FQ1A 3ADKA 3B3AA 5FTJA 3COSA 3UMGA 3KS9A 3SLGA 2JFNA 3IXMA 3LQKA 1LBSA 1XVAA 2IYRA 4FD2A 2JGFA 3BJIC 1J1ZA 4FZ5A 3RK4A 5I7SA 3K1AB 5JD3A 4F5YA 1MV5A 3PUZA 4Q7EA 1O96A 2XB2A 1J8FA 1CQJB 2R25B 5GY7A 1B23P 4FFLA 4P1ZA 2ZR0A 1BMDA 1J8MF 5KJEA 2Q1YA 3EA5A 1Y6QA 2XTZA 4J9VA 4PY2A 2OPHA 1CRWG 3RT9A 1NFRA 1WP9A 1XN4A 2X19A 3D6NB 3CUUA 3QXGA 2PZKA 5DBIA 5DTMA 5K8JB 1QE3A 3N0TA 4R9SA 3P96A 2GJ8A 4REOA 1TEZA 1E5LA 3W8RA 1MEEA 4LJLA 4GU5A 3HZOA 3UWPA 5CLLA 3DV0A 4GPZA 4QDKA 1AGYA 2FUG6 2VPPA 3NEAA 3E8MA 5I9NA 4I1YA 3CPWB 1KYXA 1NNUA 4YT5A 3I61A 5IN5A 4B80A 3U3DA 2JIOA 2O2ZA 3NM4A 2C04A 3R5HA 1UQUA 2GYYA 3DHNA 2SKCA 4UQOA 1RPAA 1B3RA 1VCOA 2PZBA 1PF7E 2QENA 2UYCA 1U1EA 3ICOA 4MQUA 1GUDA 4BWFB 2JFWA 1FMLA 1Q1BA 1VQ6B 2R86A 3BD6A 2V7PA 4G9BA 4XH9B 3BE6A 1YS2X 4RDIA 4C4PA 1VGRA 2BVNA 2J09A 4DNTB 3WLEA 1HOTA 3INRA 4CL0A 1G8YA 1CQIB 4X7EA 4AVZA 3B8EA 3ASQA 2GKOA 2I3GA 3M6XA 1WY7A 3A1NA 4HYTA 3FDZB 1OB5A 1YZQA 3O2JA 4U7FA 2RONA 1GSIA 3HCWA 3SHVA 6GPBA 1UT6A 1ZNXA 1A96A 4IOJA 3WL3A 4UU0A 4GH5A 3CW8X 4IJUA 4WUTA 3PWSA 4MWOA 5PNTA 3MJ4A 4F92B 3CP8A 2QXYA 3GEGA 5IEBA 4CT0A 5JI3E 5K0ZA 2GPAA 2D3NA 1TCCA 1P9RA 3AW8A 2WMYA 1R0YA 3EXIA 2Q8NA 3UM9A 1CPYA 5A06A 3GC6A 2F1IA 3T38A 4CLOA 4HAZA 4KMSA 4UEOA 2QLTA 5SY4A 5KNBH 1RJ9A 4Y6PA 1XMQB 4OHFA 1MJ5A 4WJZA 3BKWA 4RD6A 3KOXA 3LJKA 1M72A 2WI8A 1ZUWA 3EGDA 2XCUA 1PK9A 3FPEA 4D4LA 4RKFA 5HS4A 4H7PA 1M1YE 3LLCA 1ZSVA 3OFVA 3ADCA 1DBQA 3HU5A 3IUBA 2X9QA 1RLOA 1V16A 3PPWA 4L85A 4RFLA 2R1VA 3RVNA 4AJKA 1JEQA 2JZNA 4KQKA 5IBPA 4QUBA 1NIJA 2DXIA 4FXUA 2YQ5A 2BFNA 4PLFA 2CN1A 1LF5A 3H8JA 3GRCA 4MUKA 4BRUA 3JYHA 4QVKA 2BWJA 3K32A 5FL7A 4M99A 3KB2A 4QHYA 4HDMA 5H70A 3K20A 3LT4A 3QLJA 4BNUA 1X8JA 1KK2A 1HDCA 1M2HA 3G7SA 5AJXA 1BHSA 3VYWA 4YT8A 2CLOB 1P62B 1UIMA 4KQHA 4PX9A 2D0DA 4BHTA 3I04M 5EJ6A 4KPYA 1RYFA 1FYFA 2G76A 4PIVA 5DMHA 4NYMR 1F7VA 4WBNA 4DMLA 2OCLA 3QTLA 4HFRA 2AFRA 4QTXA 4K1LA 4WERA 5JS2A 4B79A 2WJVA 1D4ZA 1OTYA 3MUEA 5DU2A 3GLHA 3PRHA 3KPJA 4HDQB 2CMDA 3CW9A 5KNDD 4ZOEA 1E2GA 1II8A 4W7SA 4PFJA 4DDUA 1DQSA 3VAAA 1G5FA 3Q1LA 1I13A 4NX2A 5ALPA 5GV8A 1OQAA 2HZBA 2OENG 4AL4A 3WGKA 3R7DA 5BSVA 4WZKA 1DSSG 3N8NA 3OZFA 5DBEX 3ANSA 1N6PA 1YUBA 1WSBA 2RH8A 2TSYB 3KOMA 2DWUA 1R4NA 1HDGO 5D6NA 5F5XA 3AP3A 4O0MA 2ZYWX 4IXMA 1XI2A 4NBNA 3CX4A 1PQYA 3OZWA 1QQ6A 1UF9A 1X7WA 3HL0A 3QSGA 3GGGA 1FEZA 1C0PA 1DWUA 1ZM4A 1FTSA 1Q2UA 2NX2A 1XLTC 4K3VA 4R9RA 3RGWS 3MUFA 2NUTA 3TLAA 1YMUA 1OH6A 3QJYA 2E5WA 4WVFA 3TKYA 4XTCS 4CTOA 1FFGA 2Y1LA 4JJEA 1LLUA 2AFVA 4MGZR 4HAOA 3FYCA 5REQB 2MCFA 5CIYA 4ES6A 1G60A 3G2KA 3H94A 3ZGNA 4KXVA 3ZHQA 3HU1A 2YZ2A 2XUAA 1F0NA 1BVYF 3U1VA 4EUFA 5JATA 4DWOA 4R40A 2GYVA 1UKVY 4LUCA 3D2LA 4WTOA 5I7OA 2DJ5A 4KVZA 3PUWA 4YAWA 4JEHA 3USES 3AVTA 1VHQA 1RR6A 4MQBA 1QNLA 4HT3B 1R8JA 3WY9A 4RIEA 3AFHA 3VNSA 5JQGB 3UB4A 1RWBA 4OPSA 5EJGA 2Z5GA 2W70A 1W48A 1E4EB 1DAGA 2FSGA 2X3FA 2PL1A 4XEHA 3V7FA 3PKIA 1Q5PA 1NN3A 3IAHA 2OTJB 4TL8A 4JBHA 2EJBA 4EI7A 4UAVA 4EHIA 2D6FA 1PGPA 1JFFA 2D3LA 2Q8QA 4KI0A 5EUMA 3CRZA 3GPDG 1HDYA 2QTVB 3DEIA 3L4BC 3MJFA 4EKEA 5DFAA 4DUYB 3K6RA 1L5ZA 1WUYA 2ZATA 2AOUA 3RJZA 4EM6A 3N8HA 2GN4A 2BM8A 4M22A 1RZRD 5IW8A 3KB1A 4RL6A 4AMYA 1NOIA 3VH1A 2B69A 5EXDA 5JY1A 2KX7A 2Q46A 4K9KA 2AJBA 1FNCA 1N2CB 2KS6A 1APBA 2J4CA 1J42A 2WB4A 3H5LA 3KQOA 1J5PA 3Q10A 4FXPA 4QUIA 3RKRA 2D8AA 4DNXA 5KS2A 4OLBA 2EZ8A 3L9XA 2GBFA 2B3TA 4OHCA 1NVAA 3E3AA 1ABFA 4CLRB 1XVUA 3BHIA 1NJ1A 2B25A 1E8MA 3ETNA 1UMKA 3JQAB 4NHOA 2I33A 4TWAA 4PSKA 3ZCVA 2PDAA 4FU0A 2R7LA 3MS4A 2FPUA 3L0OA 5AQ1A 4WFKA 4OKNA 5L3RA 1FFBA 4RTPA 1ZWKA 3T0GA 3WRXA 1CIVA 3ROKA 3BZWA 4EG5A 1DBIA 2ZT8A 3H7AA 3KAKA 3MWKA 3ZS9A 2Q99A 2QUAA 3GJRA 5E3HA 4EKDA 3V4RA 1AQYA 2NU6B 3MWYW 4PLZA 3OSUA 5TSDA 3IQEA 4IEFB 1WMEA 1ORRA 5BVHA 5K51A 1RVDA 1OLSA 3GA0A 1H3NA 1WF3A 1C7FA 3CWZA 3EQ7A 3K30A 1U7WA 4MI3A 3BMQA 1UFOA 3EFOB 4ENQA 4EJ6A 2R8EA 1MKYA 1Y89A 3EMDA 4XQCA 1NKTA 3EVBA 1H22A 2EKPA 1EP1B 2J9RA 2ZUCA 1N6OA 1ND5A 3VR6A 4WHMA 4CTJA 1G0OA 1OWPA 1LUAA 1P5HA 2OSBA 2Q0QA 1D2GA 2OBBA 3NHBA 4M89A 2XUZA 3ABZA 5AKZA 1CHDA 3FNGA 4PZ9A 5G0SA 4YCMA 5JS6A 3KVYA 2A78A 1HI9A 4RXTA 4GPD1 2ECOA 4UVIA 2HB6A 3DCNA 2GA9A 1HT2E 2C29D 1N5IA 2ZTMA 3B1XA 1KEPA 4JJFA 1QK5A 2W2PA 1EUQA 2A59A 3R6TA 2VZ9A 7ADHA 1GKUB 1C1YA 1ZUIA 4ND8B 4XB2A 3FDXA 2A3RA 3HP1A 1NMSA 3MJDA 4BO0A 5CA1A 2AOVA 2GUWA 4MPDA 4WLVA 2DP4E 1NI5A 1KI8A 3EQ8A 4Y2PA 5TMBA 3JWIA 3D9QX 3GI1A 2Q5OA 4G2NA 4XWAA 4ZGQB 4K7JA 1ORIA 4OXKA 2C88A 1GXSB 1NQXA 2CL5A 3UJ3X 3ER8A 1L5HA 2WWGA 3PLRA 3AR6A 2V9ZA 3CY6A 4HMQA 4L74A 5EE3A 3T1NA 2D2XA 3W4IA 4C0AC 2O5EA 1RJWA 1NHWA 1YU6A 4I66A 5DI9A 4ZPXA 5ESXA 1ZD1A 4YJ2F 3WIOA 3UPDA 3VR5H 1EI9A 3QIAA 3DLHA 2VDJA 3KKEA 1YFKA 2BKXA 4HDOB 3AFIA 1XFOA 2ID9A 4IDNA 3C7TA 1YDEA 2VYVA 4P38A 2IYYA 1CJUC 1AB5A 3AR4A 4Q6WA 5FFNA 4AY6A 1U0SY 4LCBA 1HURA 1EGAA 4M0UA 4C0BA 1IQUA 4MS3B 1JHDA 4E7PA 2QRGA 4MUBA 1RKUA 4E13A 1PJCA 2ZU0C 4X60A 2PO7A 4PFKA 5AWFC 2FX2A 4PQEA 3RIEA 1QXSA 3HA2A 3TK1A 4OUDA 5CEFA 2JFOA 4S24A 4X45A 1ADFA 1XL0A 3E4CA 4GMHA 1T36A 4D5GA 1M6HA 1XP5A 1ZIOA 2I4LA 2XODA 3FHOA 3MAGA 5LQUA 4K6OA 3K0FA 2BR4A 1LDGA 3ENQA 5FTWA 2Q9AA 2X1MA 2YL2A 3IS3A 3K09A 4J16C 2GHRA 2R44A 4MUMA 3QVGB 3RBAA 3VZCA 4YUWA 1W87A 2VHCA 2DCMA 4H1TA 2I9PA 1JHVA 4OGGA 4Q9DA 3TIGA 4D9FA 1MVNA 4FKBA 2PX3A 2CK3A 4J0KA 4ESHA 1PU2A 1G2PA 1MOZA 1STOA 2YWGA 1VIAA 1Z26A 3AOEA 4I81A 3SYNA 3BERA 2BT4A 3UNXA 4EHJA 3THYA 2FB9A 4C20A 4BGUA 1QAQA 4EVRA 4GMKA 1VZ3A 4IHJF 1A9PA 3W5JA 1PEKE 2LXNA 1J49A 2BGLA 5T8KC 3T1TA 4BRZA 4MO2A 3EFHA 1E79D 2C9OA 4B46A 1QFSA 3CH7A 1ZKMA 1M2JA 4B32A 3FA2A 2ZOSA 3FSEA 4X06A 1WJGA 4UUQA 3ZQKA 1VCMA 5CT5A 4ESOA 4QDUA 2NMVA 3CX7A 4XOIA 1GGKA 4XLFA 3GUVA 1QYRA 4K6MA 4ZOLB 3V3TA 1RMQA 4BS9A 3FHTA 2CEAA 3DDNA 1E2QA 1M1ZA 2YBDA 5CJPA 1QVRA 5K8LA 2INGX 1ZA2A 4PABA 2XMDA 3PNPA 4CEIA 3HR4A 4G5HA 4DPKA 1OWLA 3P2MA 1UOPA 1U1DA 2X5KO 3OQ1A 4O2BB 1GTJ1 1O6ZA 1TO1E 2BAGA 1D7OA 2ISCA 4NFSA 4XRGA 2Y6VA 4L0QA 1FFDA 1SXQA 4G0WA 2VP6A 2I4RA 4X94A 5CTAA 3LBIA 1D5WA 4K05A 3T1YB 5C5EA 4PO8A 5CFMA 3ROMA 3CP2A 1TIPA 4QJ3A 1CY4A 2O2GA 2IHKA 1TU3A 3GJ0A 4EECA 3B2QA 4YRBA 2BMAA 4YYZA 4JEUA 3T3GA 2B34A 2F1JA 1NQVA 1O0SA 2IXEA 1K7CA 4O1HA 4XUDA 3Q8LA 2CFSA 3DZCA 2X8KA 3CMEB 1WPRA 4LDRA 3GJTA 3K5WA 4R9NA 3SE0A 4KVFA 3ESRA 3BL5A 2EJCA 4EZIA 4UE6A 3OU6A 4OSPA 4TGLA 4WZ6A 1JA1A 2NUAA 2NN3C 1GUAA 2O48X 3R3YA 2FX3A 1XWIA 1ZK4A 3T3HA 4H7EA 3B6KA 2ETVA 1N05A 1CVRA 2IF0A 1FL9A 4M9XA 1VQ7B 3KQUA 4EYOA 1NNSA 1RKQA 2EWMA 2C3OA 1TQ8A 3T4EA 3KHUA 1JYFA 4OP3A 4I4LA 4F5EA 2DG2A 3H9BA 4Y1RB 4I9NA 1COZA 1SKQA 5EMHA 2ZYAA 5JRJA 1C7EA 1U9ZA 1G3RA 1VHWA 2PHZA 4K2HA 1C81A 1YCFA 5BMVA 5LQRA 4GUDA 5IK2D 1T6ZA 3QEMA 3QKSB 4GO1A 1PT5A 3S2EA 1VIYA 2WQ6A 3FR7A 3HP4A 1N25A 3M6FA 1GAXA 3LGXA 3GLGA 2EX0A 2OT3B 4CCYA 3G2MA 3AR9A 1O5IA 5E1DA 5CPFA 1KMIY 4D0LB 4OMCA 3TL2A 2JGEA 4NJMA 4QECA 1FMJA 2V5VA 1SIBE 1Q0SA 2P6PA 2Q5FA 5JJ5A 1UADA 3GBPA 4LC0A 2QTHA 1SXJD 4ONEA 4AJLA 2VDLB 3CVJA 5CT8A 4N54A 3VR1A 3WL6A 1FOEB 4Q9IA 3SN6A 2ZSBA 4BZQA 2OHGA 4HRYA 2O14A 3ZIAA 1PEAA 3VNVA 3ROZA 4JVNA 1G9TA 4HNRA 1TTHA 4D02A 1HBJA 1L5OA 4ARZA 1S8OA 3S55A 1ZHOA 3D7LA 3ADDA 4D6XA 4NZPA 4BMZA 3K7EA 3QTBA 4RXMA 1RI3A 4G4SP 4PIMA 2GF0A 4D97A 1PFVA 3A1FA 1P4MA 4KZKA 2IUTA 1E59A 5JAQA 2HIHA 3BH0A 2QWXA 2XECA 4ENSA 3H1TA 1XJ5A 2W22A 2BSXA 4GGMX 2YC4C 4IEEA 3WRWA 3GP8A 2IPMA 4Z4EA 4BO8A 1J2YA 2XYHA 4JITA 1VQMB 4HXYA 3AONB 5DW0A 1OFTA 5LZ8A 1DG1G 2X14A 4KFRA 2H1WA 5IJ9B 3SHTA 4U9UA 1E92A 4TXNA 2IIPA 3OF3A 4BB6A 1B14A 1VG1A 2A5DA 3JQEA 3JQRA 4BDSA 4TSFA 4LIPD 3TECE 1UD3A 4BCCA 4YCLA 1GZ5A 2MMCA 2P6UA 2CVOA 2GILA 3AJ9A 2CJWB 1F6BA 3VNUA 4RD3A 1M34A 2F62A 1Y4ZA 2G9RA 2DWOA 2JIMA 3OX4A 3ZCTA 1GZVA 3QVSA 4Q4DA 2UYHA 5BUCA 1NJSA 4MP6A 1UJBA 4GZ5A 1V3UA 1XEWX 3FDJA 2VTBB 2E4AA 3CCBA 3JQ9C 4OBBA 3WIDA 4URVR 2FFJA 1FUEA 3M6UA 5K0TA 2XIJA 4LXUA 2ZRGA 1ZR2A 4G4GA 5HGJA 3WO0A 3WGJA 1N2GA 2H5JA 4KIGA 3Q9SA 3FTDA 5JR3A 4B43A 1IM8A 3A0UA 3A11A 2JBAB 4LYDA 5K8TA 2WUEA 4JOSA 2ZSDA 3NJRA 4B34A 4CDRA 4BKOA 3LQYA 1UP6A 1JXAA 2W4MA 4QQNA 3DOOA 3UK2A 5JDIC 1Y3AA 1PQ4A 1K6XA 1SZDA 3F7NA 4P4TA 4RBNA 5KNCH 1ID1A 4KIWA 4DK1A 3FKSD 3HB9A 4FLEA 3WLAA 3SC4A 4B7XA 1WB4A 3ORSA 4BUJA 2F17A 4YO8A 1JKFA 5DBFA 3H9JA 1US8A 4XEUA 4IMJB 5LP6A 4PTLA 2EW8A 3U56A 2YJGA 3QITA 4PINA 1G8SA 3O8OB 4IIXA 3F3YA 4EQ6A 4RK5A 4N8EA 4U02A 1ADJA 1K8XB 4EHLA 1GCUA 3HWX1 4B3IA 3VZDA 5EWMA 3BCUA 4DOMA 1XT6A 2ZREA 4LPSA 1WMBA 4ZFNA 4RY9A 3V1NA 5ADWA 3ZDCA 5G0UA 4U1RA 1LK0A 4AG6A 3ZUPA 1X92A 4IXTA 2FR8C 3I2KA 2GN0A 1JR3A 3V42A 3R3XA 1KE2A 3KQPA 4H3SA 4LRWA 1CQJA 1GU7A 4MUFA 4MW2A 3VDXA 2QNRA 4XVHA 1WKBA 1ECPA 1XGKA 3HY3A 3W2IA 1JHYA 4KGDA 2WHPB 1ZWLA 3MSXA 2Z57A 1MH9A 1S8NA 1T9HA 2OXFA 1B6SA 3DTTA 3GYGA 4GMXA 2PQMA 4OKIA 1KQNA 2Q5CA 3UXHA 4B0PA 3OM1A 1VFNA 1XXLA 1E6CA 4C4TA 1U0NA 4IGEA 5C37A 1UOOA 4D9IA 2VDMB 2X5OA 2ACEA 3K5HA 3RFCA 4UVHA 2ZI9A 2AMVA 1G5QA 5M34A 3RJ5A 3ICQB 3U80A 5A3QA 2BTOA 4FINA 3N9IA 3DQPA 1H69A 3FNEA 4UZSA 4BNMA 1QZZA 2HCRA 4B9AA 3N2IA 1Z4QA 5B4VA 1L5RA 1YBAA 1Z2CA 3L43A 3SP1A 3WP1B 2QHXA 1X80B 3WJAA 5L45A 4MWTA 2IP2A 3HCDA 3R6GA 2WTAA 3M6AA 4CKZA 1YJXA 1CQIA 3HYTA 3AGQA 3RS9A 5J5CA 4F45A 1KO5A 1ZGCA 2QYSA 3AV3A 3FDZA 5I8PA 2G9QA 1ZISA 3HU3A 1OFUX 4U6QA 2DQKA 3ZHXA 3ODGA 4HFJA 3PNKA 3VNRA 2VAXA 1EK2A 1JS1X 4OXXA 3PFHA 3WLHA 4ENRA 3T3DA 3T1HB 2H6EA 1IEWA 1VMAA 2ZBGA 5DM0A 5H9VA 3UF0A 4CDNA 3PL1A 4AMUA 5JHHB 1INLA 1TTTA 5HUJA 4CNBA 1SBIA 2NQ2C 2NVOA 3EIWA 5J1TB 4YDQA 4YGXB 1MLDA 4QNRA 2Z6QA 1JQBA 1VPDA 1V2HE 4LE0A 1E3XA 9GPBA 3ANNA 1ZMOA 3WLLA 4AF6A 5FAKA 1PR0A 1QGED 3CZRA 4QXOA 1S3SA 1ZX1A 4O4HB 1IY9A 3DULA 2XBMA 3A4VA 3GRFA 1XOIA 5ITSA 3CYFA 4B4DA 2PSSA 1RM5A 1USKA 1B15A 2C4KA 3DM5A 4IH9A 2J5KA 2V6IA 3ORHA 4EBFA 4W9NC 3S7ZA 3OZCA 5LC1A 4B7AA 3HN2A 1Z28A 3LV8A 1KO7A 3L0ZA 5F23A 5DH9A 3Q88A 2O1EA 4DCGA 1KAEA 4W5NA 1A97A 2OBYA 4KB5A 3VC1A 1NRWA 1BWPA 1W94A 2O2IA 1B74A 2VCEA 2ZUDA 3R7SA 1UZLA 2FWMX 4AYWA 4ZKDA 2QYHA 4CHTA 2UUPA 1L4NA 1TTQB 4D4GA 2QN8A 3TZ6A 4GWKA 1Z74A 1SVWA 4IQ8A 1KYYA 4RVSA 2O50A 3KQSA 1UKZA 2BMEA 3FPCA 4ZODA 1AK2A 2CJXA 5TGTA 2VATA 4A73A 4DIFA 3W0LB 4P0TA 4F4HA 2WIFA 3HM9A 3HUFA 1Z6QA 3ZXYA 3A8IA 3G0IA 4PSDA 4DNQA 3M2PA 4L6IA 2P1RA 4QO7A 2DFNA 2GM3A 2WDZA 3O1LA 4MS1B 3S2SA 4RJKA 4EEKA 2R11A 2JFBA 4M0MA 3GA7A 3AM5A 4RF4A 3S2YA 3WWOA 1W36C 4JFRA 4LWPA 4PXYA 2V0NA 1NSYA 3HAGA 2UZ0A 2ZIGA 2IUFA 1VCHA 2XY4A 3P4UA 5LZ4A 1VRCA 1A95A 1TQ4A 4U2DA 4GC9A 1HTTA 1Z36A 1E77A 4JDUA 3U31A 2GWRA 2R7MA 5JXGA 3VAZA 3R44A 2ZTVA 3W1VA 1L5KA 1AHPA 1JV2B 1T9AA 3MJEA 4ALMA 3OP1A 2C9MA 4FX2A 4UTVA 1PJSA 1PKVA 1XZLA 1X6VA 4MIYA 3ZHRA 3MXOA 3R9IA 4E7OA 4OK5A 4EYKA 2AOWA 2QAGB 4GX2A 1N2XA 5REQA 3KT8A 2VLIA 2YVKA 4EPWA 4QRIA 1YVEI 4OGWA 1IHXA 3AI3A 4FFPA 1FYEA 3MTAA 2R00A 4XKVA 4C3VA 3DF9A 4UD2A 4UD6A 4BLTA 1ECFA 5JECA 1U2QA 5CAEA 1T43A 2C58A 2WSSA 1RM0A 5FB3A 4HQKA 1I4OA 4F12A 3U7FB 2CNKA 4K0KB 5JQGA 1SUPA 3QENA 4FC6A 4Q05A 4BNVA 1E4EA 2AS0A 2ZBEA 1DP4A 3N8KA 4EI2A 1QHEA 2XF2A 3VYVA 1M10A 4L78A 3V7WA 1Z82A 5CAEB 2H4ZA 4C7KA 2RKWA 2XMPA 5JJKA 4MHOA 4OJQA 5JO9A 3UFBA 1E5VA 2PFKA 4L8FA 2QTVA 4K0RA 3A6KA 3EZLA 4BN4A 1RYDA 4CMKA 4A0RA 4DYDA 1RC1A 4E5PA 2I1WA 1SD5A 2VQFB 3E7XA 3G4SB 4GKAA 2CCGA 2HFJA 2P2ZA 2GAAA 4ADSG 4PYIA 1UPAA 2JAWA 5DASA 2B8WA 3I09A 2GHTA 1N2CA 4R4JA 4I1OA 3IR5A 4D0SA 2MOKA 3VRHA 2F2TA 4LWZA 4REQB 4CLRA 4JP3A 4M83A 4UUMA 2JFUA 1NASA 2AMFA 5HTKA 5U9CA 3NJ4A 4X7FA 2DGDA 1T5EA 3JQAA 3KPUA 2I2DA 2XRMA 4B2LA 1NZJA 3FJ1A 5BPFA 1A1VA 3T1OA 2FZ5A 4AO8A 2Z2KA 3H8WA 4R54A 3GDGA 4N9QA 1CUVA 2XCTB 3IKJA 3RK0A 1AKVA 2QMZA 1CVLA 4D3XA 1EE1A 5CFRA 4WASA 4AKIA 1T1GA 2WVAA 3GVIA 4KMRA 1NNEA 3NBZC 4EWLA 1FJ2A 2NU6A 1NJGA 5BWOA 4MJXA 2GDZA 2Q41A 3JV7A 1ST3A 3X43A 3LBHA 5E7JA 1BG6A 2FCRA 5K8UA 2QY6A 1HETA 2JGAA 3EFOA 1SPBS 4ZK2A 3I6MA 3QPWA 3CHYA 1BCRB 1GAQA 1I5EA 2PUHA 5DM4A 1FDRA 1I7NA 5ALHA 1LB1B 1VSBA 3COPA 4B3DA 4ERXA 1KSGA 3LY7A 1UWLA 3K72B 4GGOA 4HPXB 4EJ0A 3FOWA 4M46A 1UD2A 2EERA 4H7JA 1DQRA 4C89A 4LK2A 1JU4A 1VHJA 3LX5A 5HGXA 3HUEA 3U17A 4DRXA 4FGUA 4PRYA 2OV4A 4HAUA 1J56A 5JXWA 1YOBA 4ABTA 2APJA 2AXPA 4DKJA 3CX6A 2ZS7A 1QDEA 4EHAA 4BMPB 4MH0R 4FTWA 2NQ8A 4ND8A 4ZVKA 1XRNA 3VPCA 3RVLA 3I62A 4A36A 3CX3A 3WYFA 4AMVA 1WD7A 1B16A 2EIHA 5HFJA 1XE1A 2RHTA 2P2YA 3L0PA 2QVGA 5DRYA 1PYGA 2RK4A 1GXSA 1LBTA 5GV7A 3HHEA 3LO8A 3SYKA 3LC1O 3T5GA 3EZGA 5HNKA 4LGCA 1F5SA 1WSAA 2H54A 2MSKA 1CRQA 4GE0A 3W6UA 1KHHA 3ZWMA 1JQ3A 1HYQA 2J9ZB 3NKLA 3PDWA 2UYYA 1QHIA 2HYIC 2HBYA 4Z1MD 4RD1A 4RD0A 3QEJA 4ZEOA 3GBSA 1P1CA 1N57A 2NAPA 3P2OA 5FI3A 1WXIA 3ZHSA 5ADHA 1TUIA 5AVYA 2AR0A 5IYNA 3OOJA 2NO4A 1QLHA 4K87A 1MFZA 2O7SA 4MMXB 4MS3A 4A4DA 1NDHA 2FJPA 2GPNA 2JVKA 2O7VA 1BJTA 1FQJA 2W6OA 1SC6A 3CQ9A 3KTDA 4N8DA 3TXXA 3KKLA 5IKPA 3M5WA 5FQNA 1UK8A 1TYBE 4ENPA 4U7DA 2DFVA 1L3IA 2UYGA 4WX2B 1NNLA 2B7BA 3EWAA 3PR2B 4ND3A 5IEJA 4ECAA 3CV3A 1ZOIA 5HZMA 2V0GA 2WZPP 4QFDA 3A35A 2L17A 3GLRA 4RMJA 3ZDDA 4Z0PA 2AOTB 1ULUA 4RLQA 3LYUA 4H4DA 3R3VA 4RPCA 3OQMA 5C1PA 4TLLB 4ND7A 2HV9A 1WOOA 2QRNA 3TW0A 3QBJA 1QYWA 2ZJ2A 2F3QA 4UTZA 2Q4BA 2B4RO 4M88A 3UY4A 2DCUA 2WSMA 1YJCA 2P6NA 3KFLA 4LYYA 5ALZA 2A4KA 4F21A 2AWNA 2FJ0A 2LD4A 4HDRB 1IBSA 4YRDA 2WD9A 3BGSA 5FOWA 1E2IA 1RYNA 3MZ0A 5CBPB 1TTPB 3KEFA 3E22B 2JPDA 2XYQA 1LZKA 2E89A 3KEGA 1UBUS 2IUEA 4Q7MB 5FPPA 3BAZA 4ZK6A 3VPGA 2GPJA 1XDDA 4GVXA 2VT2A 1JA0A 3IV7A 4ZOLA 3TCXB 3AILA 4M8KA 2PGLA 2D59A 1COWD 3HWSA 3L1JA 2Y1FA 3K5PA 4BO6A 3V8EA 2F1LA 2GK6A 4DCJA 5L51A 3FAKA 4PPGA 3LY9A 5LVAA 5FBRB 1J25A 2WTNA 1ECLA 2NXNA 1D2EA 3MCUA 3N8DA 2C7GA 2YYZA 3R0IA 4G07A 2BEKA 4O2BA 2Z04A 2WU1A 4X6XA 1U0TA 1L4UA 1A9QA 1Z0ZA 1KL7A 3DD1A 3LRTA 1T6XA 2IA5A 3L0CA 3NANA 1ZJ5A 4OOEA 1QPZA 1WIWA 1I9GA 3WRYC 4QU0A 2A6PA 1R18A 1RFGE 3NDBB 1AOXA 4LWOA 3I73A 2ERXA 3TNLA 1QH9A 4H6XA 1UDCA 3W06A 1TM2A 5AVTA 4DW8A 2P3SA 2Y93A 5LXTF 1I3MA 1YDMA 1B43A 4ZAXA 4AP6A 1XZIA 4GUAA 4DCTA 1XD8A 2J08A 5JMTA 5ALKA 3KT3A 3LFHA 3EF1A 1E1MA 3F2VA 1NQ5A 5IH7A 2QEQA 3FSGA 3QU2A 4L4YA 3R0QA 1D2CA 2NU7B 3NV7A 4Q7QA 2Z09A 3GPIA 5LB4A 2XHEA 2VUTA 3U6KA 2OFOA 3NWOA 4EH1A 3AFMA 3ILYA 2WF5A 1NQWA 4HBGA 2IFTA 5BW6B 4NBKA 4PYOA 1VHEA 1F9AA 5EHQA 3A2NA 3UICA 3ICWA 5KO2A 1E1QA 1F7UA 2GD0A 2Q1XA 4Y1RA 4W5OA 1NW8A 3L7MA 5FTMA 2ES4A 4NOKA 3QLVA 1O95D 3CBGA 3E3OA 4LN1A 3PTAA 3OKPA 4LBYA 3QKSA 2XA1A 2YVLA 2I4IA 4PZAA 2Z8XA 2BFFB 3GLGE 2XOKA 1P29A 4U7TB 4BWYA 4E32A 5JHGB 4EG1A 2ATEA 1U8EA 2ZYIA 2V31A 3OF2A 3IAS1 4KIFA 4PLVA 3TZEA 5HDBB 1XF1A 1HT0A 4GX5A 5G0VA 4W5QA 2Y1WA 4A5SA 4CUZA 4L6CA 4R8MA 2VK1A 2X0KA 2JK1A 1YJ5A 4K9RA 4JAVC 3I9JA 1UANA 4CCAA 3EW9A 4FMDB 4YGYA 3TSCA 2GS9A 3I01M 4FWTA 5CYPA 3VHXB 3DZHA 4Y1FA 3KKNA 4MKZA 4XJXA 3W5SA 4RHCA 3AYXB 3VSDA 3KEOA 3RVRA 3CUWA 3PJRA 4JQSA 3PC4A 2OO5A 3H5AA 3N3BC 3PLAE 3BIJA 2A86A 1H9BA 2CF5A 2PYIA 3KWMA 4C3ZA 3VJMA 3Q9NA 3EPLA 1HX7A 2PA3A 3NAZA 2XTNA 4MMYB 1SBQA 3OE7D 3C5WP 3D6JA 1LD3A 4L3WA 3HCAA 3ONNA 4WFIA 5AM4A 1SB9A 4CG2A 5GJVC 4D3FA 3T3NA 3W5AA 1HNNA 3MHTA 4O1IA 5CLGA 2X2EA 4QBFA 2Y0DA 5CDFA 1E1RD 1R9JA 2E37A 2J48A 2QD2A 2XX3A 1NVWQ 1VKZA 1GPJA 2ZFUA 3DLIA 4A6DA 1H6BA 2ZZQA 3R3SA 4HXGA 2NZ2A 3GPCA 3VOTA 5IJ9A 1PQPA 2JJ1D 3IVGA 1DNPA 4F7DA 1FQKA 1HTWA 4ZO8A 2RC5A 3V8PA 1KY5A 4H6PA 4P84A 2ZBDA 4E51A 4UNRA 5JZ9A 2DUMA 3OECA 2QNBA 4RD4A 1M34E 2CJWA 3FLAA 1WVGA 4IFEA 4MRPA 2XE7A 2NU8B 1NRXA 1A5ZA 2H9YA 1JIJA 4LYJA 1DCMA 2YRWA 2HXSA 4XCXA 5C8ZA 1FIUA 3U7RA 1C7ZA 3SZUA 4GP6A 1Q82D 2Y3IA 4X8LA 4QUHA 4S1TA 4TLMB 3CXUA 4B8YA 2VTBA 4HH3C 2OGTA 4JR2A 4R1TA 3SXPA 4ML3A 4AU1A 3VZQA 1CF9A 1OBHA 4EYGA 4KC0A 1DCTA 2OV1A 3R6WA 5F1KA 3A26A 5FI1B 5BSTA 2V4ZA 3IO3A 4H0CA 3WFIA 3ZIDA 4FK8A 2GB4A 2YUTA 4DILA 1QV6A 4EIWA 2PUTA 5EZYF 3WE7A 1JQJC 5A6VA 5GVSA 2JBAA 5GGYA 2PMDA 5KYWB 1IEVA 1XZ8A 4RGBA 3AF6A 1QMGA 4QICA 3I04A 4M7PA 2JS7A 1NY6A 2E18A 5EHGA 3STWA 2H0RA 1D8AA 3BJZA 1PHPA 3C7AA 2DOKA 3O0DA 4ASUD 3GUHA 4YS6A 1D0IA 1WMDA 2RH5A 5B1SA 2R0QC 3CA8A 1C0IA 2OAGA 1I3OA 4HOYA 3GVHA 4Y2GA 5HK9A 1CJCA 1ZICA 3S1LA 1QQ5A 4B82A 5AXBA 3TKAA 3O8OA 5LLDA 4LX0A 3GAAA 2NTYC 1GNPA 4YQYA 2FZKA 5ALLA 3PUHA 5ESWA 4UEWA 3C43A 4L75A 5ELLA 3HYSA 4UHJA 5EZSA 3X2FA 4ZAFA 1R4AA 3EBLA 3GJSA 4CHGA 1R0KA 2WTUA 1A50B 2JCSA 3L84A 3GEMA 4W6QA 3PEWA 3OKAA 3ZLVA 4IDQA 1XCPA 2GK7A 1V7QA 1WQ4A 2PT9A 3IT3A 3ORYA 1IJEA 4GQIA 4WZAB 4YREA 3WV4A 3QNUA 1UP4A 3AWDA 2V45A 1JR3E 4WN3A 4N76A 3TLKA 3WO1A 1GGJA 2CJPA 4LI0A 1A4RA 1ZO8A 2VQ6A 3B7PA 5G1OA 2H9AA 3HDQA 3ID6C 4GOOD 4UUOA 5DHTA 3DD5A 3OZ7A 3RRYA 2WHPA 1WXDA 2JEYA