5FIUA

Binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXY-ADENOSINE SYNTHASE
publication title Exploration of a Potential Difluoromethyl-Nucleoside Substrate with the Fluorinase Enzyme.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 80
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5fiuA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5fiuA01
2F4NA 2CBXA 2V7UA 2Q6LA 1WU8A 2C4TA 2V7XA 2Q6OA 2V7WA 2ZBVA 2CW5A 5B6IA 2C4UA 2C5BA 1RQPA 2Q6KA 5LMZA 4CQJA 2WR8A 2CC2A 2V7TA 5FIUA 2V7VA 2Q6IA 2C2WA 2C5HA 2ZBUA 1RQRA
chains in the Genus database with same CATH superfamily
4IIVA 2AN5A 3D8BA 2ZVPX 3ASSA 3OMWA 1HC7A 1SUCA 3X2SA 1HT2E 4BIIA 3LDAA 3V32A 1Z6AA 4ER7A 5EXEA 2BM1A 2EG5A 2GEBA 2PMBA 2B37A 2QY6A 3KPVA 5IT4A 3LJKA 4LY9A 3I9OA 1DSSG 1VKRA 3HM2A 2Q6OA 4O8CA 4ZYVA 4KNWA 4TMKA 3AVTA 4M88A 5JAOA 3LX4A 1N2CE 1UKVY 3SLRA 1JR3D 3OKCA 1SQGA 3NTXA 5ALPA 3MWEB 1QHHA 1AKTA 3QKRA 2HMSA 3C5WP 3L7JA 4JJ8A 5IULC 1CYDA 3FI9A 5KPJA 1ZNYA 2H29A 3GGGA 4FHGA 1PS8A 1A77A 1XV5A 4JP5A 5DCLA 1AN9A 4ENTA 3VR4A 2VF2A 5I9NA 4IR7A 1JT9A 1L7XA 1H85A 2WLSA 3IP5A 4X64B 3EPHA 1FNBA 4D25A 3QFCA 3FBTA 2O7RA 4OU4A 3VYTB 2BSAA 3DW1X 3M9LA 5CK5A 4Q66C 2QTNA 1L7RA 3G9QA 3LWDA 3RIMA 4G5YA 3BC9A 4YJKA 3KFXA 3TL3A 2O7SA 1W47A 4YUWA 2E85A 4QDJA 5H80A 2C77A 3KEFA 5I9IA 1RYBA 4A15A 5B58T 4P3YA 1SGWA 1PG2A 3EBOA 1LPAB 1RJEA 2ETXA 5IH3A 4HAYA 3WBJA 4D96A 2AT1A 1ULAA 4YRCA 1JHVA 2WSBA 2XCUA 3L7MA 3U37A 4LW8A 4JA0A 1RRMA 3FTCA 1ZR2A 1P73A 4J0KA 2WV9A 4QTTB 2C2OA 3BDVA 1ULSA 4OX9B 4TS9A 1ST2A 3LECA 4B6RA 2Z09A 4OI0A 1X14A 3IQGX 4O4JA 5LP6C 4BZPA 1N2SA 4BE9A 2P0YA 3P5SA 4Z1OA 3AEXA 1EJ2A 2ZJ2A 4M9ZA 2B6HA 2D54A 2YHIA 4O29A 4WCDA 3O47A 3IJEB 2PD3A 3D3WA 3G5LA 1MG5A 2GN9A 2R7AA 2WWXA 4E15A 2ID9A 1GVHA 3AONB 3JAKA 1Z4PX 3SYMA 1G8JA 3LVBA 2NUBA 3A35A 2I22A 2YVQA 2E7ZA 2X77A 3BXHA 1ULUA 4KBFA 4II2A 3L3BA 4AY3A 4ASUD 1AB6A 1Y48E 2XCLA 3IJPA 3OQJA 4ZQHA 4MV9A 8ATCA 1IBSA 1ID1A 2MIIA 3I1JA 4Q01A 2WTNA 3LCVB 1WE2A 4QHYA 2P3MA 4B4KA 1NR7A 4C43A 1QYVA 3P2IA 3ZWWA 3OUUA 1K7EB 2I65A 2HCBA 5CPFA 1OFUX 5HWSA 3LPDA 4V0OA 4ZOCA 1GGHA 3KXPA 1FQKA 2AB0A 1YFJA 1SUEA 2WYRA 1OBCA 1NW9B 3JRNA 2O59A 3RREA 4JVMA 2VTKA 2PQ2A 4HLUA 3ZLUA 5HRAA 1JB1A 1IQ0A 1Y7TA 3PXEA 3BT7A 1WCWA 5EC8A 3U17A 4BJ6A 5C80A 3VJMA 5K2OA 1CVIA 1WP4A 3GQBA 1LXCA 5KHOC 4QFMA 1RWXA 5JHGB 5AFSA 3I42A 3C87A 1ID8A 2G9NA 5BURA 4FOTA 3KZMA 5L4SA 3O2NA 5K05A 1SK8A 4RIFA 5HILA 5JADA 1H4QA 2ZITA 3LO8A 2WYHA 5TS2A 2X41A 2O3SA 3SIPA 3RU7A 4YAKA 2JZCA 5AM4A 3MOSA 3BWMA 1ZMBA 3KALA 4CEIB 3F5FA 3EG5A 1IOWA 4TV8A 2ODQA 1X15A 5F12A 4Z4GA 3ONYA 2I4NA 2J9XB 2PR2A 1CC1S 3EC1A 4M4SA 3HVKA 4FZJA 1XQXA 1YRQA 1RZ3A 1L8XA 2YMMA 5BSYA 2CMGA 3SJCA 4C7JA 1S7GA 2NAPA 3GLKA 5EJIA 3W90A 4EY7A 4DV2B 3RVOA 4CPDA 3U5TA 1OBOA 2I6FA 4CG0A 3N1UA 1B23P 4QSHA 1R74A 3ZDQA 4HH0A 4EYOA 3VYWA 3HCFA 5BR7A 4G0VA 4AF7A 1LTHR 2BM0A 1HQCA 1NXXA 2YWCA 1C81A 1VI2A 1GNQA 2A84A 3EIQA 4H6PA 4YO7A 2J1LA 3S99A 3RGWS 4WNIA 2CSXA 1KEPA 1YRWA 2JFZA 1GKUB 5IWCA 1GDDA 4K9OA 3AMVA 3Q1KA 3L06A 2J9FA 5ELXA 1ESDA 2WB4A 1T8TA 4L5AA 1WCIA 1D7AA 3BEDA 2L82A 3A1PA 3NASA 3PNLA 4P4SB 4WE3A 3AKZA 5E0OA 1JEQA 1E9SA 2C2XA 3OCUA 4MW2A 2QLFA 1Q14A 2RAUA 3G7NA 4MNTA 3RYIB 4HXFB 1X1DA 1Y8QA 4B7AA 2ZM5A 4XM0A 3M2PA 2ZP1A 4JSRA 3CH5A 1E2KA 2FMIA 2PUEA 1KQ3A 1XG5A 3GP5A 3IT0A 4G8BA 5FORA 3CCUB 1DCKA 3A9SA 3KOYA 3MJCA 3NT5A 2Z1DA 2QUKA 4QPPA 1G3IA 1I2AA 2VATA 3WYNA 1ZGZA 1C8BA 2I03A 2HU2A 3VAAA 2LUOA 2ZBUA 5DV9A 3DG9A 3W5HA 1KI9A 4XX0B 2CE2X 1E6LA 4RD4A 2DH5A 4B3IA 1PL7A 2DFDA 1WMFA 3H5IA 1JUDA 4MR7A 3AEUA 3LT5A 1UT5A 4U5XA 4XI9A 3W79A 2RGCA 1UBFA 3NWEA 4Q5IA 4BPRA 3CS3A 4OLAA 3R8FA 4FNOA 5FV7A 3A32A 4I1RA 2BGJA 3OJXA 1F3OA 2FRDA 3C15C 3KAJA 4KRYA 5AJUA 4DJFC 3VKHA 4RTMA 2G4VA 2BUCA 3C74A 2NU7A 1F6DA 1E61A 1R1DA 4H27A 4IDNA 4MAMA 5JWHA 4ZI7A 4DQKA 3RSGA 4QUEA 2X8KA 1I0ZA 4O4IA 3X44A 3P4YA 3RYCA 2VDNB 5CXQA 1JPVA 5SZKB 1OGIA 5A71A 1CD5A 1JDUA 1DC4A 2A0KA 3DC2A 4J0FA 4CIAA 5JCOC 1HZEA 5JTUA 3HCDA 2JC3A 4F11A 2XNDA 2Y8EA 2ISQA 3E53A 3QVGB 4EEZA 5LDHA 1EP9A 3K20A 1Y3FE 2BKXA 3EVAA 5FBWB 2DYKA 3RV3A 3JWPA 2KSQA 4A3SA 3HLYA 5TXGA 3HYNA 5ICEA 1E69A 3G9XA 1KIMA 2BMJA 3CLRD 5K2MA 4ZJZA 3OEHA 1OC2A 5CCEA 3S40A 3PEWA 5D7NA 2JGDB 5F51A 4AJNA 1O4WA 1OI7A 2I4TA 4P6YA 2OAGA 3U4GA 1PDOA 5KNBA 1U1EA 2ZWIA 4BGUA 1YXMA 4BVLA 3E61A 2GJ4A 2GILA 2X0DA 3RC8A 1TE2A 5K7SA 1X1CA 4BNKA 1A4IA 4A36A 1W1UA 4S1OA 5CGZA 5AKGA 3NCHA 3HJTA 1E1KA 1NW3A 1Q0PA 2AXEA 2D7JA 4IXNA 1W59A 2H11A 3RU2A 4UBNA 3ZGZA 2FU5C 3L18A 5CMLA 2VSXA 3GRRA 5KAPA 5HZBA 3O5AA 5DULA 3LBFA 3FWNA 3MIIA 3B1JA 1ORWA 2ZTVA 1FOEB 2F1OA 1BCSB 1W76A 1O8BA 2IHYA 3ZGLA 4B6EA 5JH7A 2X3YA 2JFVA 1M2EA 1Z38A 2P2YA 3UEOA 4NL4H 3RSQA 1SRQA 1HOXA 2YH2A 3X1XA 1ZCAA 3AM1A 1RQNA 3O92A 4FMDB 2PWBA 2ZRAA 3C7AA 2CLCX 2H6EA 3IIJA 4GLJA 4X62B 2D5BA 4U00A 2IOFK 2AF4C 4JL6A 5AVQA 3WGZA 5D84A 2PFGA 3AFOA 4Q3KA 4QODA 2H9YA 3AUUA 2Q9AA 4Y0VA 2BGLA 3E3OA 3U3RA 1Z18A 4B31A 4PZEA 1W75A 2A78A 3L7BA 3H2ZA 3KQNA 3M5DA 1JMYA 3OAAA 4HX9A 1ZN9A 2ADFA 1PWEA 3WDLA 2VBVA 4R16A 2GBPA 1GP2A 1PJZA 3EQZA 1NVTA 4EI7A 2I2BA 1LI7A 2LP4Y 4GNRA 1FTWA 3UJ7A 2DP4E 4RV9A 1I18A 2J3DA 4YUAA 4Q6WA 4DDUA 4M2LA 1O6CA 3JU4A 3T4XA 2P79A 1HT1E 1JG2A 4M9SA 4D4GA 3H11A 5TARA 2H48A 4L6IA 2D1RA 2JGFA 4YYEA 3V4FA 1KK0A 3D64A 3MCZA 4LQLA 3WAJA 1N7JA 4U7TB 4OEHA 3STXA 2BH2A 1NYTA 4V1CB 1T36A 1YAHA 4LYDA 3EF0A 3KAKA 4CCAA 4YN3A 3L7CA 1VCMA 4IZHA 1K7CA 2ZI5A 1E2UA 1OI4A 1OLOA 1IQRA 1QIHA 2ZL7A 5EJ6A 2CD9A 1SQ5A 3EMKA 1R0KA 4Q12A 2IXBA 2ZSEA 5LZ5A 3OH8A 4S35A 1IE3A 2JD2A 4MKFA 4DIBA 2QE7A 5AKJA 2JIPA 2PX5A 4I6JA 4C88A 2VSQA 3ASVA 4ZALA 3VPFA 3WGVA 2ONCA 3AR6A 1ZH0A 1D9XA 5JT1A 2A8YA 4RA9B 5LYYA 3UGTA 2XTZA 2Z1NA 4YRRA 3AKDA 3L0PA 1BX1A 3DR5A 4JT2A 2LPMA 1PIWA 1PW7A 2EQ5A 1MQSA 3L77A 1L5VA 4WK6A 1UBCA 4IFBA 1G2IA 4ZCLA 2R4TA 4XIFA 1A7UA 1SQ0A 2R8ZA 3NORA 1MZVA 2B82A 5IYPA 4P26A 2C7BA 1GJRA 3UHJA 4MQ6A 4YPOA 1PGJA 4OSOA 1CQZA 2JKZA 3OHSX 3D3JA 4EJSB 1KP2A 5EY5B 1UBJS 4C7OB 4AX8A 2HMTA 2DWPA 4ZPXA 2GO1A 2DHDA 3BE8A 2I3ZA 4NMXB 5LYJF 4MVJI 2DFNA 5A5GA 2VJAA 3PPVA 2NTNA 1SVWA 1WIWA 2BISA 2WTAA 3EEFA 3Q2OA 1M2VB 3QVOA 3RSLA 3R3JA 3GB9A 4JSYA 1TD1A 5J2UB 3TPFA 2FSPA 4MMYB 1KO1A 4RSHA 1HORA 4R1LA 3UH1A 3QVJA 2EX1A 2NQTA 1MV8A 4EI9A 3HP7A 3CWQA 3A4YA 1BEEA 3AF1A 3BS4A 1QZ3A 2XA9A 2QP9X 3UN1A 5AOCA 3SQOA 1M6HA 2CDCA 4KLZA 4CL3A 1BE1A 4B8YA 1P72A 4Y6GB 1KP3A 3AH8A 4U2GA 3U9SA 3OECA 4J7UA 1RWMA 4UAGA 5AVSA 2YJNA 5LD2B 3F67A 1HDRA 1JT2A 4B8WA 5KMGA 4PAGA 3VH3A 2VBUA 1ETUA 4B7ZA 3B1ZA 4OFXA 1C8VB 5EHQA 4B32A 5CBPB 5ERGB 5CYGA 1M1YB 3TRJA 3DF9A 3W9UA 1ZQ9A 3ASUA 2FEWB 2FSHA 4GOND 4UC0A 1M6NA 4BP3A 3MYYA 3D8TA 4DCCA 1XTSA 4URVR 1J7KA 1SOMA 2GEFA 1GT6A 3LK6A 2F9FA 3TB4A 1PJLA 4QU8A 4IGEA 1XVUA 1UPCA 1J2UA 2HT6A 4P3KA 4RPGA 4XAQA 2X4IA 1CCWA 2AFIB 2YUIA 3M9XA 4IWNA 2OVBA 2EKLA 2GEDA 1C0PA 1MHTA 1SIOA 4PM4A 5SZHB 4X60A 1SNYA 4WOPA 1JA0A 3QI7A 3RW9A 5BRNA 1PJAA 2UVDA 1FW8A 2XDAA 3LY7A 2V9ZA 2IIQA 2ONYA 4NATA 4D4HA 1GGFA 1NMYA 3KDPA 1X8JA 2XGMA 4QXQA 2PGLA 3TSCA 3UXEA 5HR5A 1JQ5A 1A9XA 3KTDA 4YCAA 5A9TA 3R3HA 3W6OA 1QYRA 4L02A 4NBTA 4ZKDA 1OFVA 4HE5A 4C7BA 5K8IA 5KC8A 4IH1A 3AIKA 1B00A 3NFRA 2B8NA 2ZXFA 2IQ5A 3SZUA 2XIJA 2ZR7A 4W9RA 4PRKA 1TU0A 1QGED 4YP0A 4L15A 3EBLA 2WOOA 3CCCA 2IIPA 1K08A 2ZIZA 1UF9A 3G4SB 1CQPA 3H75A 2UZ3A 5EQJB 4G7WA 4E08A 2R66A 3IBYA 3GWGA 1VL5A 1R0WA 3ETEA 3WC4A 4MQUA 5BQXA 1E3SA 2ZJ6A 3RPEA 2W7TA 5D6OA 3CNLA 2QB5A 3E3NA 4MR9B 2CJFA 1D2CA 1ODJA 3TQHA 2P6MA 5JROA 1E0DA 2XUKA 3R1IA 2X19A 1V6SA 4IDFA 4L8LA 3F7TA 2ONKA 4J0JA 5D01A 3TTSA 1EJBA 3UV3A 1M2HA 1F2TA 4HZUA 3ZBQA 3R9XB 4HDCA 3LSTA 1P39A 3D0OA 1UEIA 2Q2QA 5IC4A 1KJ8A 1L0BA 3WJ2A 1KVSA 4OCZA 3UJCA 4EF6A 4DEVA 1GSIA 1L9KA 3VVBA 5IJ0A 1U4NA 2GPAA 2XMRA 3LZDA 5GQSA 5BYKA 1DZIA 1DE0A 2C03A 5FL3A 4YI5A 5LZ7A 2OFXA 2V7XA 1G5RA 3PC2A 1G41A 1JYEA 4K9MA 3FLBA 3OICA 4K6CA 4YMUA 5CLFA 2V7QA 2DPHA 1FRFS 3OCJA 1JWLA 2PYDA 1XXHB 2WPDD 3UK0A 2JA2A 1JZSA 4LRTB 2QTMA 1HDOA 4QJ5A 5KW9A 3W5VA 4ETNA 3EXHB 4EY4A 4Y2RA 2FA9A 1LCIA 2H0QA 3LBIA 4BEJA 1IJKA 1P2DA 3DWFA 2DYIA 2CY0A 4I9UA 4G24A 3TVYA 1F4PA 2QD2A 5LVAA 4Z4VA 5EINA 2IS6A 4CQMD 1BWSA 1ZA1A 1TIKA 4JLJA 2UYQA 3JPYA 4KWTA 4JITA 4KSYA 3TBHA 3C4VA 3DLBA 5DYGA 2OHGA 2CXRA 5FCDA 1DOHA 1Y7IA 5KTPA 3WHPA 2AHRA 4UZUA 5IC6A 1R4AA 3TX6A 1SB8A 1TAGA 3VSBA 3MLAA 3HXQA 2MOKA 1XVTA 3DZDA 1FA9A 3NGXA 4MDEA 1SIUA 5TEWA 2HBYA 3AM3A 3RKSA 3VYUB 2Z08A 5DLEA 4XOTA 1L7QA 2BM9A 4FFDA 4R2JA 4AMBA 2FSUA 1J09A 3EY4A 3SM3A 4D9BA 5JASA 4KWHA 4UU1A 2WQ7A 1GTVA 4P4LA 2B94A 1L3BA 1ZJ5A 3NGLA 4GX0A 3UMCA 1C9JA 1HLDA 5B36A 3ENZA 3X43A 2HI0A 1BU8A 2PWAA 3AU9A 1IOZA 4IDDA 1HI9A 3GEEA 3G2HA 4IXDA 5FWYB 5HGJA 3NPMA 3UW3A 4DG8A 1I94B 4MROA 2RGGA 4ALJA 2Z5VA 1PS9A 4D1YA 5BNWA 1E9RA 1D6NA 1PQUA 2B36A 2GR9A 3DBLB 4M46A 4V0NA 2ERYA 2V6IA 4D97A 4F7WA 5LQUA 4NCXA 3AETB 4WD3A 4IXMA 3QE3A 1I5RA 1ANKA 4U2EA 3OA0A 3QVUA 4CEJA 3W3ZB 4D5GA 1J8YF 3LDHA 3SXJA 3ECSA 5JAIA 4LDJA 5AI4A 3BXFA 4JL5A 5ARDA 1MTOA 4NMWA 2J08A 4BNWA 1N2BA 1NVXQ 1E1DA 4RPKA 2G08A 2EERA 1A9OA 3KELA 4X6XA 3GCXA 3ZE0B 2E5LB 2UYYA 2QXUA 1P1RA 3VVLA 3PBKA 1WEKA 4I99A 5F3WB 2BVNA 1X7ZA 1Y7LA 3X0DA 1XYVA 3M6UA 1ISMA 2ZSDA 4XLFA 2XITA 4E5MA 5AVUA 3PYXA 5JQGA 1FNCA 1SHUX 1QYCA 3HB4X 4TQ9A 1V0JA 2A0UA 4RNDB 3RUAA 3PX2A 3TZKA 1NG1A 3GVHA 1YF3A 5HJ2A 1DBIA 1Z2CA 4EJ6A 4YTEA 2K2WA 2HK9A 3M3PA 5D51S 1MABB 1N2JA 3BFKA 4EKNB 5CG2A 1S8NA 4DT1A 2ZWOA 3ZWAA 4WH0A 2NIPA 1L3CA 1PJQA 3LQFA 3N87A 4LZWA 4LNUB 3UVEA 5EJ5A 1JQKA 5JXHA 2Q4TA 1AJEA 3AZPA 2BY4A 5CT8A 2J4DA 3HDVA 4KDEA 4OO3A 4QG3A 2Z6AA 1QHEA 3I0ZA 1C29B 3QEOA 3KB1A 3PUXA 1C41A 1BIFA 2CHFA 5D3KA 4Q7JB 5HJEA 4LRQA 1GG2A 3NGMA 4QTZA 1QFZA 2ZT8A 1EH5A 1PG5A 2R1TB 5T4HA 1D6MA 1HT3A 4M99A 2PQ0A 1CLEA 4BVEA 2BKLA 4QGSA 2ET6A 5JNUA 3TLYA 3ZKWB 3WLFA 2F48A 2CF6A 2D2IA 2RGNA 3OE5A 2JIBA 2AJCA 2PXAA 5G41A 4TWRA 4GM0A 1U0BB 1XMPA 2WHRA 1TYAE 3IAEA 4A6PA 1LK5A 1T8PA 2V97A 2QM8A 1RP1A 2ZS8A 5HTOA 3ELWA 1XKTA 3F73A 1ITZA 2J9YB 3KOWA 2W9XA 4ZVQA 4Y9DA 4EFMA 1H23A 1OFHA 1Y7HA 1FUIA 4OQMA 3CP8A 2O9JA 1KO5A 3WLSA 1U9JA 4OUDA 1U0TA 4I4TF 1RAHA 3PPYA 1RXCA 4GE3A 2FW6A 5LJIA 1YK1A 2QM0A 1E7SA 2CNBA 5DOZA 2BSXA 2DERA 2NO9A 3K96A 4FMPA 2B69A 4F3RA 1P6XA 3SEJA 1J99A 4X9XA 4BWVA 2Y0DA 3MRSA 1EPUA 3PUWA 1MN6A 3JX9A 4TVBA 3SK0A 3BPSA 4F8EA 3RY8A 2IPAB 3DT9A 4P3PA 4RU1A 1DX6A 3NUGA 1WUYA 3PQ4A 3LW7A 4MSUA 4WA8A 5JDIC 1T8WA 3FI0A 2WJYA 4B44A 3B70A 3M6AA 5FUYA 3HDHA 3Q6RA 3HB0A 1Z0ZA 5EJ7A 3SBDA 2YOHA 2UZAA 4HYEA 1ONOA 3FW1A 2PZFA 4DA9A 2X6RA 4DGQA 3U44A 5FFFA 3ZYCA 4AC9A 4NV3A 5I3CA 1OILA 1UODA 2B4YA 2R2GA 3T3DA 3THYA 1IUNA 1JHXA 5FO0A 2VJDA 4L4UA 3W5AA 3N8GA 4EKYA 1M1NB 4MH0R 4DA4A 2ZRQA 1V1RB 5EJGA 1H8HD 3WL8A 2AJLI 4M0LA 2WNSA 1WVIA 3SKVA 3M5PA 5AWFC 1BKDR 5A4AA 1NNEA 4GOMD 3STWA 2CHEA 4W1QA 4PVDA 4U3JB 4GMHA 4FS8A 1QXSA 1VHTA 4LWQA 1CUFA 3I2FA 4J4HA 1N6LA 2EX4A 3TOVA 1QQ7A 1QK3A 1KFKB 2VT2A 3CLKA 4LF8B 5LQJA 3BGSA 3SC2B 1P1JA 5EQDA 1UMCB 3SX0A 4D9CA 4W9NC 4AKSA 1KORA 1L8OA 2YXPX 2EFHB 2YRXA 3PP8A 4M0MA 4AZTA 5JLJA 2ZLBA 4M49A 1E1CA 2ZG6A 4X97A 2WTBA 1QV7A 2YHAA 3GU3A 4KXVA 3RFVA 5CB8A 1G2PA 4M0DA 2Y6VA 4IHQA 3TTVA 5EQTA 3AOEA 1XQ1A 2ODWA 1KKLA 3TQCA 4C2AA 4QOSA 1TTTA 3DDHA 1Z63A 2E37A 3EVEA 4PZUA 4JQSA 2B1RA 1ZDMA 7ADHA 1E9EA 5HZAA 1LS6A 1PGNA 1C1HA 2OQIA 1JQDA 3D7SA 4X7EA 1QP8A 5KYXB 1M6VB 1PEKE 4GSKA 3PHLA 3JZMA 4NV1A 2MWMA 3PC7A 1YL6A 2ESRA 1JTEA 4B80A 1SU7A 1AX9A 1E1MA 4JLNA 4ZMRA 1ZISA 3P9XA 1ABBA 4QOHA 4WRRA 3D4PA 4PVCA 1NB0A 5EXTA 3V48A 1L7NA 3V1UA 4R5MA 3DMFA 4I4CA 1ILWA 5AK4A 3VKFA 3WV5A 1OWNA 4NFSA 1I7SB 2PJRA 2P6RA 3ZHVA 2X3UA 3ZGOA 4I8DA 3AF4A 1NASA 1W49A 5TC4A 3VZSA 1A2OA 2JK0A 5K0SA 1A9SA 1XFAA 1ZVVA 5CM2Z 2MMCA 3ET5A 1WW3A 3UMVA 1JQBA 4MDYA 4EP1A 1K7YA 1SXJA 3LP6A 2R85A 4XB2A 1XLUA 3T0GA 4CMIB 4D9JA 4F21A 1FLNA 1U4OA 3L8MA 1LLQA 1FDOA 2C9YA 2PX4A 3M49A 4F2HA 1BGWA 1KQGA 3D0KA 3AHDA 4LCBA 3CLUC 1S2OA 1CP3A 4J9UE 1O94C 1J42A 5GONB 1IN7A 3R0QA 4LMAA 5D3MB 1PZXA 2Y9MB 1XMXA 4XE5A 2YHBA 1LLUA 3JYHA 2F59A 5GGYA 3DDOA 1K86A 3HA2A 3BH6A 121PA 3CINA 3IVCA 5FHQA 3VTKA 4ZZ0A 2ZZNA 2AVDA 1NJID 3D1VA 4S12A 4WACA 4G5OA 2JLCA 2FP3A 2R25B 3BRQA 4HAIA 3WK8A 1XMQB 3W7VA 3ACDA 5AQ1A 1H2RS 3W2TA 4CM4A 3NVMB 1Q1NA 1K6MA 2R1VA 3FDJA 3OU6A 2GA9A 3OPVA 3PEVA 2I78A 5EL0A 2HV8A 3WRXC 5ADUS 4INJA 3QXHA 3BERA 2ERCA 3GPBA 2PHZA 4OQFA 3V55A 2IPXA 5LB2A 1SCNE 4UVIA 4JHXA 3ZGVA 2R47A 3AR4A 3GEMA 5DTIA 3IHTA 3S2FA 1OY1A 5I4BA 4Z53A 1K3FA 5F7XA 1FLAA 5H3LA 1DBWA 3QTBA 1QTRA 4K6GA 1GYRA 4JI6B 2P3SA 4ENUA 2K7FA 4F91B 1OVMA 4INZA 1JF8A 1OYOA 3KSZO 4PO9A 3OP4A 5ENVA 3ZNPA 2GXAA 3AIOA 3R09A 2P67A 4Q4AB 4BKUA 4LXQA 5IJXA 2IH2A 4DFDA 1UBNA 4LNAA 3GRYA 1A04A 4PX3A 3IOMA 221PA 2ZEJA 5EXPA 2HPAA 2FHSA 3K0FA 3PLRA 3VYVA 4E3ZA 5JCJA 2I1QA 1ONBA 6YASA 5G4KA 1PFQA 3NOOA 5CDFE 1U2GA 1UXKA 3IE2A 5IAAA 1P6UA 1MC8A 1TTQB 1Q20A 2EP7A 3H1PA 1ZRMA 2WFZA 4NBRA 4DMCA 1WJGA 3X2FA 4H7KA 4Z8YA 2VHZA 2BV3A 1C0EA 2BTQB 2N1MA 2ZYIA 1C3XA 3G2JA 3DZFA 3O4RA 3QJGA 1A98A 4I50F 4IJMA 2L18A 3HFJA 5AOAA 4OQXA 3LUHA 3VR3D 2KBFA 4CTNA 4PG7A 2PRIA 4ZVRA 4F5ZA 2HA5A 3WLIA 3DXYA 3MERA 2A9QA 2WSLA 3ETHA 4EHHA 1A72A 1HG1A 3GLVA 3FNQA 1TVMA 4MR8B 2PZJA 1U28C 4R01A 1QVZA 4CLRB 4MIOA 1ZHOA 3CUSA 3IUEA 2IYZA 1T9HA 2O2EA 2W2TA 4JLDA 4BLTA 1HE8B 3OJCA 4FN4A 3MD0A 5LZ8A 3SMQA 4JB8A 2N3ZA 4WIAA 1JFFB 1QDUA 1N3YA 2TS1A 3R3UA 1B3RA 1D4FA 4XM3A 1M6WA 2EIHA 3ZCXA 1FP4B 1KGDA 1NBWB 3H7IA 3ZCTA 3FSGD 1N2HA 4ND6A 3R7FA 4EG5A 5HKKD 5AP9A 4YJFB 3ED1A 3W78A 3HGMA 1IDN1 1QGUA 2H8GA 2ZRNA 3IEIA 3PGMA 4L0QA 1JRLA 1R8XA 1J2RA 2VP2A 4MUHA 1KI2A 1MR3F 3SZMA 3PSAA 3DHWC 3SZGA 5EIBD 4G25A 3PJRA 3V33A 1TB4A 4HEQA 1QTQA 4RPBA 2EJUA 4BN0A 3CVWA 2RAFA 5D7BA 4RZIA 3I6IA 3KSDO 4O4LF 4MVJH 2FVXA 4YASA 3GOHA 4BB9A 1I7DA 5BSFA 3IPCA 4MEAA 3PE3A 5CM9C 3VR6A 2RGBA 5CB4B 4Z51A 5JPCA 4BEVA 4C4AA 2VSOA 4P6VF 1ZHHA 1N5LA 3DBOB 2YZKA 4Q3AA 3TNJA 1YB1A 3SVTA 4CQJA 3SMVA 2VDVE 1BXRA 2I2AA 4ZYTA 6LDHA 4HNRA 5F64A 3VU3A 2DAPA 4GI3A 4RLFA 4QX6A 3QEKA 1NL3A 3HKBB 1SD5A 4GMGA 3LXXA 1AUXA 1EUDA 2XE4A 2Z30A 3ESCA 3QUQA 5DF1A 5DYNA 1OAOA 5HUQA 1PZFA 1RAFA 2X7JA 3PHBE 4R83A 4GGMX 4DJJA 4BEWA 1U3VA 1BROA 1TT7A 3Q15C 1TM3E 2SICE 3FMIA 5ITVA 3Q98A 1Z4KA 3U7RA 1CF9A 3HJCA 4HRVA 1NM5A 4C2BA 2I2FA 2NX2A 4GP6A 4X41A 3LC0A 2PA3A 1KQSB 5JIBA 4X8MA 2GBLC 2VHVA 2HA0A 4Z1MA 1VIVA 2PGDA 4PHTA 5KNDA 3CVXA 4G0XA 2D1TA 2HPVA 4Q4LA 4UASA 5KWSA 4PAMA 3KXLA 4ZVSA 3BJZA 3QFFA 5CM8B 4JUIA 2RH4A 4F4DA 3CNOA 5JAHA 1E7QA 1N5RA 3NBFA 2IU3A 1F4LA 4GW3A 5EE3A 4BZWA 1V43A 3HBMA 5DSZA 2XUQA 2IPNA 4Q48A 4KNYA 2R8BA 1MP0A 3V4VB 4AKHA 1UAAA 1BE0A 2O3QA 4XDYA 1FX0A 3ZDRA 2JFHA 4XQGA 4MS1A 5I9MA 1GZHB 2PYZA 3LE8A 3I9FA 2HA3A 3FVQA 2WDPA 4G1FA 4H3KB 2DU8A 1HUQA 1UD5A 3KPWA 2A1IA 1JP7A 3IT1A 4Q1AA 4ARBA 4Z4HA 5I7SA 2XCTB 3WS7A 4I3GA 4OYLA 5AIAA 2E4ZA 3WJAA 1YA8A 1ULTA 1U31A 1VLLA 4EYSA 5FA6A 3GJ5A 2QSYA 1L5GB 3D8UA 3I2KA 2YWXA 3TGLA 1ZD5A 4GMXA 2VDPB 5ITWA 3AHHA 3KJXA 5JSHA 4HEHA 5AKZA 1RSZA 3AR9A 2OPHA 2R60A 5CRIA 2Z95A 1NYQA 3BMQB 3JQ9A 4UDYX 1WMEA 1Z0IA 3CGWA 1AUPA 3HZZA 3MXTA 3DDSA 4MWOA 5E4JA 4BNZA 4ZAVA 4OOSA 1BHQ1 2C8VA 3V7WA 3BD8A 4C20A 4Z7JA 4BLPA 3CB4A 3VMFA 2ANCA 4Q4HB 5U9CA 3MWEA 2Q4OA 1FS4A 1FX1A 1ODKA 1OBVA 2V6MA 4MINA 3JQGA 2XJ9A 2IU4A 2HSEA 1RM5A 4UCXA 3GEDA 1E3JA 2CFOA 3HGTA 3HGQA 2C3UA 4MVJM 3AT1A 4OSEA 1LVHA 3BTOA 2W8BB 4O4HB 1TUGA 3TW4A 4J6EA 4W5WA 4IJVA 1V5WA 4AMYA 2QGFA 1MOSA 2G8NA 3AEZA 5E0KB 2D5IA 3EJ6A 1WNFA 3G3EA 3DJYA 4Q3BA 5E6TA 2Z2JA 4YMGA 2VRWA 2ZJ7A 1P1KA 2C82A 4RS4A 4OKIA 5BWBA 2HBZA 4WNAB 1A50B 3FCXA 5LXTA 1G6KA 2F1KA 2F9MA 4IIBA 1SZDA 1B14A 2X4GA 3L8EA 3L9XA 3RJTA 2YCLA 3VGPA 4FDTA 1FFAA 1VCIA 2HK8A 2ZSIA 3LHSA 4RXTA 1CBUA 3OZEA 1P60A 2CXOA 3ETJA 5FOTA 3TKLA 4TS3A 4F3YA 4UHBA 4BGEA 1I3CA 3UF0A 4FWTA 1N6NA 1O7JA 2PUDA 1ZOSA 1HZJA 4EW6A 3NVDA 5B57C 3KZNA 2O19A 1Z68A 1DJOA 4D46A 1M7GA 2NZ8A 2ZE5A 3DQPA 4P3OA 3WFJA 2IYWA 4PLWA 5MN5A 3TXAA 1KEKA 4AAYA 4OAPA 4OYYA 2J6BA 4AUNA 3W04A 1RVDA 3PC6A 3IE1A 3RS8A 2V7BA 4JZYA 3LWZA 3IPYA 1ZOOA 3KJIA 1N9ZA 1VG8A 4Z4YA 3H2YA 2WJGA 2C92A 3KHKA 3WLNA 2A0FA 1D2NA 4OD0A 4TT3D 4OQYA 4UJ5A 4W7HA 4B71A 4Q9JA 1Y80A 2JAWA 1GAWA 5A0VA 4BX9A 3G8YA 5HZMA 3ZWDA 5GIOE 3UMYA 2QSJA 2H8KA 4QNNA 4JJEA 5TF4A 1P4SA 1GNRA 1Z45A 3FPLA 1I6MA 5KHAA 5CDFA 3T61A 4AVZA 4DXDA 1VRWA 1XNJA 3CMEB 2B78A 2C4MA 1BDJA 3L6RA 3JSXA 3Q1LA 5LMNB 4IW3B 2FFRA 5HX7A 2C2MA 2H9IA 4C06A 3PFFA 3S81A 1WXEA 3NHYA 3ZV6A 3GGCA 1NW4A 1O77A 2WHXA 4DK1A 2VDMB 1JYFA 2KWIA 2ANBA 4IM7A 3SP1A 1RQ2A 4LVNA 3PLAE 1XL0A 5KQGA 4ZT5A 3WLPA 4ERXA 1T8UA 3IBTA 4EAAA 3GFSA 2QTCA 5CA0F 2B3DA 2VS1A 3H1TA 2FPOA 3ICWA 5FNVF 4PGMA 5I9SA 4NE9A 4DY6A 5BW6B 4PC3A 3F9RA 3T9AA 1EBFA 5JJCA 2OL4A 3EH1A 4XMYA 1X7YB 1PFGA 1UZNA 1HLFA 2QRPA 2FX5A 1QOZA 2EZ9A 2PSHA 4FEGA 3ZJYA 4PZYA 1CJCA 4GICA 3WIUA 5IMBA 3LDFA 4MW6A 2IBSA 4DMKA 5J4VA 4RAOA 2WWVD 2WZCA 3B2EA 3RYHA 1GFIA 3UYLA 3BREA 1OXKB 3HSYA 2A3NA 4CIVA 2ZSHA 4CEIA 1X7WB 2ORIA 2XA2A 3KEGA 3R3ZA 3F6EX 4TTJA 4LK2A 4CT0A 1TUIA 2BUAA 2IKQA 3NM4A 4NICA 1FMLA 1PI3A 2CXXA 2G88A 3DULA 5FWNA 5AH0A 5A8AA 3GWZA 3MUFA 3ZOKA 2CXSA 2HJ9A 2JFNA 3EWNA 4QNRA 2DLCX 4PPNA 1FFXB 1YFKA 4KTTE 4YLYA 4RTQA 4ISCA 4X91A 4KU4A 1EFCA 1V45E 2C00A 3HCPA 2CVHA 4IZIA 3LLSA 3AP2A 1W88B 1QP0A 2C9CA 3CSDA 3PKJA 3WNZA 2QT0A 5HF5A 4B3RB 4TROA 4LZPA 5IHXA 1BWQA 2IVZA 2YQZA 3ABIA 1KA9H 1TZCA 4P4SA 1U0LA 4LRWA 4RCVA 2ZB3A 2ZXIA 4NU8X 4DZZA 1E1RA 2WZDA 2GN6A 3CN9A 3E7FA 2PFKA 1U2ZA 3RYIA 1E2MA 1M1YE 1THMA 2YN4A 3G5UA 4JJIA 1F1BA 1DIGA 1GGKA 4BCCA 3ZVNA 1BJRE 3ILYA 1V4BA 3IURA 2ZDHA 4HS9A 3RBVA 3TRKA 4A03A 1L8AA 2PGOA 4V0LA 2VNJA 1I0LA 1HDIA 4R0NA 1MB4A 3ZUGA 2GYVA 4B3SB 1JILA 3GRCA 3K4PA 2JJ1D 3FDZB 2H4YA 1ZMRA 4I8XA 4OM7A 2DWOA 2RCYA 1UC9A 1YBAA 2F8TA 4XX0A 2YWDA 1L8QA 4COOA 1I7QB 3QVTA 1U6JA 3MFYA 3CC8A 3GVIA 4YT4A 5I01A 5JTTA 4E4TA 5IWAB 4P3NA 1C2TA 1T1SA 5DASA 4OQDA 1DBPA 2Q5FA 2RAVA 4XFKA 5EN4A 3V7YA 5BMVF 3A7DA 4CODB 1I6LA 1SCUB 1W2HA 3EZFA 1E2PA 5C53B 1FVXA 4HSEA 3K72B 1C9MA 3KKMA 3H5OA 3NALA 2G04A 2RHGB 5FLXA 2QM3A 4WERA 5CNIA 3K9BA 3LZCA 3L8HA 4KZKA 4OV6B 5HS4A 3VV2A 3LSYA 2EHDA 4BP8A 2XCSB 3L6OO 2F17A 1RZUA 1JHYA 2Q1SA 2CFIA 1XZDA 3E23A 4GPZA 4TRRA 5A2QA 1WB9A 521PA 1ZEJA 5CFNA 3F90A 1K66A 1SUFA 1DO0A 2IY7A 4Q3OA 4UHEA 1RHMA 3IDQA 5GP1A 4UMFA 4A2WA 5GZ1A 4XNFA 3PXGA 3T3PB 3QVGA 1O6BA 2QBYB 2EJCA 4PCVA 2O3RA 2DFLA 3CRQA 2IS2A 4V03A 3CC2B 4RM0A 2YVLA 3HI4A 3MT9A 4HAWA 3PQFA 3JQCA 5TB5A 1E20A 1VJ5A 3T9DA 3I28A 4Y1GA 3F0TA 4YT5A 1COWA 5BV7A 3FVRA 4X06A 4CLEA 4D3YA 2UVQA 3S8MA 3MUNA 3NHMA 3ZQ4A 3H8JA 2GXQA 3OLXA 4E31A 4FDLA 2BEJA 1NULA 4LQ4A 4WOKA 2OECA 3EYWA 4KE7A 4A8HA 3VUEA 2CNKA 2GCGA 1EQ2A 3MT8A 4K9LA 2RGWA 1G6Q1 3TD2A 5ALFA 1YR3A 5KDLA 2A7QA 1ZL2A 4F84A 1HE3A 3ZCUA 2I67A 5CNKA 1BPLA 4CM7A 3GLGB 4DMRA 3BORA 1ZW6A 3D7MA 3PVCA 4G37A 2Y1XA 1N0VC 2WD7B 4KGDA 2VL7A 3OIUA 1VYUA 1N05A 1JHZA 1GAJA 5BV8A 1CP2A 3T3EA 1C0LA 4JB2A 4ER3A 1G38A 2C5GA 1VKNA 1U6KA 3SAJA 1JVBA 2ON6A 4CV0A 3OCZA 3QKWA 4LWPA 2YV5A 4N4AA 4E4RA 2CK3A 2YDYA 1BCSA 4HK4A 3MPUA 4PNHA 1YTLA 2PT5A 4TM7A 1E5DA 3K6RA 1E6UA 5GJWC 2VHTA 3W5SA 2J0UB 3JRWA 4J16A 1ZD1A 5HNKA 4JVOA 5HCUA 2E4AA 1SCAA 2JH9A 2XHEA 4R81A 5AQEA 4MWBA 2PO7A 4QYMA 4DIOA 3ZI7A 4JYBA 4UJ3A 2YZ7A 3EDRA 3AIMA 4DYVA 4KAJA 5JVDF 2PIDA 3I58A 3K09C 4B7UA 1GPDG 3PWSA 5JMWA 5DMHA 1DFHA 1TJPB 1DFGA 4JS0A 4NFLA 4PQEA 2ODNA 3DQQA 3VR1A 3ZV3A 1WSBA 4JGIA 3QKSB 1PEYA 1XLTC 4HTAA 4IHKA 3WRVA 2DG2A 5LR6A 1U0EA 2QTVB 1V3TA 1JLMA 1ESCA 3GN2A 3M89A 3ZCSA 4OI2A 4KKVA 1H0RA 3ROQA 4X63A 4YRBA 1NZJA 3KCQA 5F98A 5DKFA 2VJMB 2P2ZA 5EZYB 4BTLA 3JWIA 3C6BA 5E2IA 4ABYA 4EQ6B 5C1DA 1NWCA 3S5JA 3H7AA 1MIOA 3N58A 1ZKDA 3DE3X 3PA2A 3RK4A 4BMNA 4FFOA 3GGJA 4BO0A 3A04A 2LKDA 3E4DA 3L7KA 2XTMA 2ZAIA 4C0JA 3NDBB 1IXRC 2W6QA 4V1CA 2F4NA 5FWDA 2IRWA 4LXGA 1WOSA 4D44A 5HZGA 4HAOA 4XN0A 1OIWA 2ZPAA 3GJ7A 4J91A 2QJWA 2PGNA 4TMVA 4KR7A 2HV9A 1DO2A 4JELA 4S1VA 1B6TA 1P7PA 2H65A 4BCBA 3DBVO 5I48A 4WESB 3PA6A 2OR3A 1YE8A 3NC4A 5CYFA 5F23A 3WBKA 4AP5A 4B7CA 4N49A 2V7GA 1ELOA 1DRJA 3BGOS 4NZZA 4ZVKA 5KU7A 4RA9A 1HEYA 3MD9A 2B2XA 3ROPA 3TBKA 1XN1A 4C4PA 3FPCA 1TPZA 2CLEB 4OP1A 2BMEA 3VSCA 1JJIA 2SBTA 2WHPB 5DVZA 2WDZA 2IY8A 3C6XA 4YX9A 3KYIB 1DMSA 4MI6A 2EYQA 3Q38A 5JNLA 2GNPA 4JYMA 2GZ2A 1SEVA 3NB0A 3SSOA 3ZHCA 1SH7A 2AYYA 2WNIA 4RK4A 1XFDA 4Q05A 3O9ZA 5EI5A 4E13A 3WLEA 5KYKA 4P58A 2RHRA 4MLDA 1P5HA 3IB3A 3TR0A 3Q9LA 4EJSA 4C7OA 4EUHA 4JEIA 3BILA 3ND6A 1E94E 5L4LA 1NSFA 4E2WA 5FBZA 3C3KA 3CCSB 4DADA 2XZLA 5EAIA 3CLSD 3IH5A 1M2VA 2JASA 5A5DA 2G83A 3VVCA 4DC0A 5DN6D 5J2UA 2GM4A 1KS2A 2ST1A 1JQEA 3C85A 4DV0B 2PE5A 3QMVA 2MSWA 4I1SA 1C14A 4PSAA 4COKA 2X1MA 5KPDA 5EUCA 1YJAA 5K8JB 4FSXA 1RRCA 1T1EA 1B26A 1Y42X 2P8JA 2QTBA 4XWAA 3QG5A 5MN6A 3KYCB 3UQZA 4MYUA 2CYBA 1C7QA 1TEZA 2ZJ4A 4H15A 3DE7X 1XDSA 2BT4A 2G28A 3FPHA 2R2AA 2AN9A 1W87A 1NUUA 4W5OA 3ZI0A 3L0BA 3ZIAA 2P6UA 3JYPA 2WJIA 1U02A 1POXA 5BXYA 4QUZA 1GV1A 1PVDA 4BTEA 5HIAA 5CBPA 2DGDA 3DO5A 1M1YA 3UJ3X 5IYWA 1UZMA 3D1LA 3H1GA 3W6ZA 5KS2A 3O95A 3JQPA 1IPEA 2YWHA 4FXUA 4J0GA 4WZLA 2FMUA 3STHA 3THRA 4GC9A 1ZCJA 1V8DA 5FD8A 1NLZA 1T5EA 2QGZA 4KMMA 2XOKD 1R7RA 4E5NA 4H1TA 3ZHTA 4EYKA 2B2CA 3DBRB 4U2FA 4XDZA 4DV4B 1XRQA 4X0CA 4KREA 5KAMA 4JMPA 3BCFA 1IZ8A 1M8GA 5BV1A 2HF8A 4GNKA 2I6QA 4GBGA 3AJEA 1Y9EA 7MHTA 2PSDA 1TQ2A 3OOWA 4OMUA 3BJIC 4CGYA 4YALA 2ZVJA 5LM3A 1Z2DA 1QFXA 3KOOA 1XTZA 3CUWA 3VI4B 2ZUTA 5B4TA 2D1SA 4KGXA 4BFWA 3E1SA 3OOCA 1RC8A 1LA2A 1X9GA 3FZYA 1E6KA 1JGTA 4QRIA 1JG7A 4X54A 1EA5A 1ZWKA 3KJQA 1DJPA 4OK5A 4HNHA 5JBIA 5EE1A 3OFNA 2P78A 2AJ8A 3I9LA 3ORSA 4WXYB 4D9KA 1Z4NA 1X3LA 4P35A 2IUTA 1ND5A 4ZCTA 4CKCA 4A23A 1CJSA 1V3UA 1BNCA 1NUTA 3FWHA 4XUGB 4TN1A 2YICA 3Q6IA 4AJ2A 5CBKA 4KIUA 3IDAA 4FCVA 4L08A 4JAVC 2OXIA 2ZTNA 3I5AA 2ATVA 4YMHA 3W6PA 5JAUA 3NRCA 2J6HA 3QEJA 4CFSA 2ATXA 4DCNA 1XDGA 3OLWA 4ZO4A 3PS9A 1RWOA 2H57A 2QLJA 5DCYA 3UH0A 1HETA 4MR9A 4B2PA 3FKSA 4P4GA 3BSWA 4B8ZA 1TJ5A 2AOWA 1TKRA 3AY3A 3GH1A 5ALTA 1L1RA 1AVTA 3SLGA 5HBGA 4IZOA 2DZDA 4PQFA 1DOAA 5BNIA 3R9XA 2E49A 4M0EA 4BKMA 2GJSA 2O8NA 5CTAA 1PKXA 3TYXA 4HY3A 4P36A 1XZ8A 4NCBA 1LF5A 3E9DA 4NHEA 1QYDA 3TSOA 4UD6A 3BFPA 3A9UA 2ACVA 1PLJA 4WQMA 1NXPA 3QE9Y 2JG3A 2ODAA 4UREA 5A4FS 2A6PA 3A14A 1HRKA 3U3XA 2QLBA 2YUTA 3QWFA 2O8FB 1XEFA 2VUHB 4RTNA 4LJRA 4QM7A 1PFKA 2I91A 4I1UA 1EDZA 2OEPA 4KPGA 4BVJA 3P52A 2ZIUB 4YMLA 5AOVA 2JJQA 4E3WA 2HPHA 4R68A 1F9EA 3EXHA 4IDAA 2GZAA 5K6AA 1GFZA 1QZXA 2PVSA 5DBGA 4IIEA 3T1VA 5JFTA 2LCIA 2AJDA 4TV9A 3E9YA 1QV6A 4QZVA 2EFGA 2K87A 1W5TA 1DDOA 5CEEA 2I7DA 3QU7A 4P5DA 1M2JA 1LY1A 2HLHA 1U0HC 1H1LB 3Q6MA 2CNWA 3E82A 5GMOA 4AFNA 1TF7A 3OZSA 2CNNA 1N4AA 2XQJA 2O48X 3ODPA 4ZOLB 2ABWA 4F9EA 1W1IA 3HLKA 4RM3A 1KY5A 2QTLA 3I3SR 4ZA2A 2R4UA 4QBTA 1QRDA 3R7WB 3PXAA 2OB1A 3ONWA 1XT6A 2FE4A 4L75A 3I62A 4CKWB 1P77A 2JCGA 4FR2A 5A1TA 1WPRA 1RZVA 2C2YA 2V74B 3IEPA 3MF4A 3SY8A 2RHLA 2BHSA 2YY6A 3ZE2B 3WGQA 4AI6A 2G40A 4OG2A 4EX6A 3MQFA 1JFRA 2W6JD 4ZANA 4YJ2F 3UXHA 3K9CA 3PD1A 3M6VA 5FWYA 1OU4A 4OHZA 2H2DA 1HURA 1W4ZA 2OG2A 1DTSA 5B1DA 1B6RA 5LLTA 3L4KA 3IAAA 3TR5A 5PNTA 3AF2A 3FPSA 4ARVA 3UW1A 2FR1A 3DBLA 1U8UA 2JRLA 1K2WA 1SCDA 1SHZA 2ECOA 4BX3A 3AETA 3RC9A 4JOCA 1SAYA 4OLFA 4XOUA 3P0FA 2FG5A 2JCBA 2QZJA 4BBZA 5F2NA 1EESA 4IHAA 4RBNA 2VYFA 1UM9B 2JANA 2O14A 4FONA 1L5MA 3N86A 3B7PA 3GDOA 3N8KA 3V4RA 1F7VA 3GP3A 3EA0A 4Y18A 2YN0A 3EIWA 3OX1A 1JZQA 1H2AS 4DVJA 1UPXA 4UARA 1NE7A 4RVNA 1JAXA 3WK4A 2XGOA 4A5OA 1P7WA 2B30A 3K0AB 4GUAA 4WA7A 4H6VA 2VTDA 3WMWA 3RS2A 1R9NA 3PZBA 4NZOA 3A36A 1Z22A 1HL7A 2G67A 2HIAA 3UJAA 2H7CA 1VI6A 4E07A 2VK8A 4KOEC 2B25A 4URUR 5EE5B 1GDHA 1KYTA 2XYHA 3AESA 3Q6QA 1QQBA 3UOWA 5IKXA 1NVBA 1NC3A 3P26A 1MABA 3BIFA 2D62A 5JS1A 1TFRA 3V8RA 4RSRA 2JLBA 1XBTA 1G291 1XZLA 4LV5B 3H65A 3ULKA 2BPOA 4P33A 2YNMD 3G2IA 4TLEA 5BN3B 5H5JA 1NYLA 3N3BC 3KSBC 4YAOA 4B85A 4E03A 1N0UA 1R0BA 4LG1A 2AK3A 1B0UA 2EF0A 4GDFA 2JLUA 3ISXA 1IN4A 1ND6A 3MMXA 1QNFA 3CPJB 5I7AA 1T9CA 4PNZA 2P9QA 3AUYA 3VR5A 3WTBA 2R1TA 5FWAA 3NONA 2BYTA 1PD0A 2PANA 4ND5A 2IEGA 1C9DB 4X66B 3NT4A 4E32A 3HXLA 1CXZA 3ZKWA 1Z5ZA 3OZDA 4F04A 3HDQA 1IXSB 5K03A 1FMFA 1PWHA 1VZ2A 4YAGA 2BR3A 2I80A 2P7HA 2X8WA 3GRZA 3KSUA 3PQ2A 4RANA 5M3BA 1VL0A 2ZXHA 1V71A 1W34A 1I3LA 3VNUA 2V5UA 3GDFA 2Z5GA 1MNAA 2PO5A 2QQ5A 2J6IA 5CLJA 2X7HA 1K9MD 3RTAA 4O1HA 4FHDA 2VSFA 5FAKA 3WWYA 3U4MA 4D42A 3C7CB 2QQFA 1V5GA 1QSGA 2IUSA 4BNHA 4EB3A 1BH2A 5KVQA 5BUQA 1YFLA 1HYBA 2HJVA 1RHQA 4CVNA 1SUBA 3C3JA 4BNXA 5JWRA 1U90A 4B5KA 1NWHA 2W2MA 3AW8A 3JQBA 4M87A 4QARA 1Z39A 1TEVA 3DKPA 3OTIA 4LHYA 3MWFA 4FEEA 3ZE7A 5HK9A 4B6GA 5AKHA 2R6ZA 1L4EA 3VO2A 2WZQA 1M1ZA 1IUOA 4JR1A 2PBLA 2IYEA 4RESA 3EMBA 1GPJA 1HMPA 1SKYE 5JNRA 2ZUCA 3O8NA 2F1LA 1TQDA 3A1DA 3PITA 3HU2A 1L2TA 4NJEB 3HXPA 2GSWA 3MRTA 5IJ9B 4MQ5A 3IDZA 3QXJA 4LWZA 3CR3C 5D87A 1M1NA 4DNFA 5AVXA 1FDSA 1W9MA 2I8AA 1VJ1A 1GLVA 2JL1A 4FIZA 1N5MA 2QD4A 2XUGA 5DTMA 2XWPA 1H0KA 2CDAA 2IZOA 5DGDA 2VDWB 4KH0A 2D7CA 3ZXUB 2N75A 3CURA 4BIMA 4L50A 4U3JA 1VLJA 1QC5B 2C3YA 5JANA 5FOQA 4CUKA 1W48A 4LC9A 3QFTA 2XUIA 3KBOA 4NZYA 1ESMA 2OO7A 3IPRA 4KQ9A 5JATA 4PHHA 1USIA 2A5DA 4K05A 4LY0A 3EA5A 1LK7A 4DNPA 1JEOA 3GFQA 5CK4A 1NMEA 3AQIA 2G9VA 3GDWA 3U1BA 1YB7A 2KBEA 3WO1A 1JQJC 3R6DA 3IB6A 3GJRA 1QS0B 2QPLA 3B52X 3SJPA 4RPJA 2OTLB 1D5WA 3DZGA 4B4OA 4MEBA 2HMYB 3ZU2A 5IANA 3SLNA 1X87A 2P4UA 4HSGA 4IOMA 4YRDA 4ZICA 2ATIA 2IZ0A 4YRNA 1DMRA 3A6PC 1R6VA 1EWVA 2QYOA 4HLCA 1XF1A 4N9QA 1SG9A 4R2XA 4C4ZA 2F62A 1TK9A 2AXNA 1KMIY 1MDBA 4GAEA 3ETLA 5KYXA 2WB2A 1Q82D 5JCPA 3S2GA 3FGOA 2IBTA 5EFOA 1Q21A 1WBDA 3QPCA 2VQ3A 1Z6XA 4TS4A 5ILQA 1AF7A 1ZKMA 3IIMA 4XZ3A 1BVYF 4ZQGA 1I8DA 5A88A 2A5GA 1YUBA 2FEPA 3HR8A 3R7DA 3WRYA 4XQFA 2V96A 5T67A 5EHIA 4H0NA 1Z15A 2KQUA 4D26A 2ZJ0A 4KIWA 4RTKA 1OCEA 2VN8A 1CY7A 2JGMA 2Q3HA 1NW7A 3DMTA 4LYYA 4RTLA 2C7RA 1YD7A 1JIXA 1AU9A 3MTQA 3P96A 5LU9A 2O2XA 5F76A 1YJCA 4DARA 3E8MA 4CMIA 5KO2A 4OF4A 2DWUA 1N7GA 4RDKA 1W0KA 2HMWA 5GM2A 4ZYZA 13PKA 3PWKA 4N7MA 1R0YA 3EPLA 3JQQA 1N2GA 1RHJA 1H4VB 2H7VA 2JVJA 2YN2A 3HY4A 4JDUA 1P62B 1VJCA 5D3MA 2HXGA 1IVNA 5ESDA 5FPTA 5DM70 4JI2B 3HEMA 1L4LA 3BWVA 3OIDA 3PGXA 3JQAB 3VR4D 1M8PA 3LS2A 2QSZA 4OXKA 5EPEA 2DR2A 5B6PA 5HYVA 4ZVPA 3NHJA 2GRUA 2QN6A 1DIBA 3A9RA 2LW7A 3MS2A 3RYTC 5BT9A 3ZBPA 3ZLVA 3L5OA 4ME6A 4E1VA 4YCDA 4XKWA 4QUIA 3USES 4PLFA 4R6WA 2Y1KA 4JQCA 4P22A 3E9ZA 1OD6A 1J8FA 1YDHA 4U7GA 1FNSA 3ZDDA 4NBKA 3GMDA 4YUYA 1KHTA 4QWWA 4IVRA 4UQLA 2GJ8A 1SCIA 2ID7A 1Y3BE 1G60A 3I92A 3JATB 2QRHA 4JLUA 4OXQA 2VQFB 1G3RA 2C9ZA 2YWJA 3I6BA 3JPWA 1P80A 2XY4A 5L3QB 2ZSAA 2I9KA 3LMKA 3S0JA 3OIFA 4FIDA 4HF7A 1YCFA 4RABA 1WBJB 1EVYA 4HN9A 3VSEA 5JEDA 1HMYA 3BMOB 3D7NA 4RYDA 1NUPA 4URHA 4Q4AA 1EXVA 1VKZA 4IYRA 1U3TA 5TSDA 4R31A 5LJLA 4Y2TA 2PWZA 3G71B 1U1GA 3DOOA 2A59A 2QF7A 3M1LA 5CFQA 2H1WA 2D6FA 3OQBA 1CZNA 1GPNA 1XA3A 2FUG6 2OE2A 2ZRMA 5ALLA 4JLPA 4K9PA 4DM3A 1XI2A 2B3TA 1C9NA 1CY1A 2OGSA 3A1VA 3L4EA 3P2YA 4ZAYA 2QIPA 3X1JA 4DILA 2BTQA 3QX8A 1Q12A 1QPGA 1T3TA 3FMFA 2V58A 4M89A 3LPAA 4YRMA 5AI6A 5CB6A 9LDTA 1C80A 3F46A 5LUBA 3RJ9A 3TTUA 1VPVA 3LK7A 3GJ8A 2O8DB 4MVXA 1HDZA 3SZ3A 2ORWA 3F6SA 4URZR 2PKWA 2QTAA 3LHFA 3REOA 3FTFA 5A62A 3DFKA 3RUHA 4EELA 2NXNA 1QHYA 3I9NA 4MR8A 4Y2JA 3I73A 4CLRA 1H8EA 4ZJPA 1S0UA 1PZEA 1TU4A 2V6JA 1LFDB 2AE1A 4OPSA 4MV8A 3GLFB 4U7JA 4WN3A 4J0HA 4DBLC 3FCEA 2HBQA 1F06A 3P0EA 2BTOA 4B6QA 4CMAA 4YHBA 1N77A 1GITA 3VUFA 1JFFA 1I80A 3NP9A 4ZARA 4M0UA 4DHEA 4M1SA 5P8WA 4LY6A 3SHOA 1FP4A 4UUOA 1K8YB 3AHFA 1OBFO 3OC6A 1MJGA 3DKIA 5KTKA 2ZUEA 1LW6E 4JUBA 4YJFA 3VC7A 1ZCFA 3ON5A 1A71A 3G2MA 2W11A 1UT8A 3D6FA 3EA4A 4KI7A 2P4QA 3AUSA 4ND2A 5CDHA 1S1CA 2BCJQ 2J5QA 3G5AA 1VLMA 3DL2A 3DP9A 1TCCA 1Y1TA 4I81A 4OHMA 5JSZA 1BDMA 2AMLA 3UFBA 4E2ZA 1H2WA 3LUKA 3HPQA 4BLWA 3CEMA 3I04A 4I46A 4EVSA 4AY2A 3OIVA 3AZQA 4BB6A 2VHQA 4PTLA 4AUEA 1ZNXA 1DBSA 3AL2A 3D31A 2O8BB 1Z6PA 1DP4A 2YRFA 3U62A 5BSVA 1RPTA 4OA8A 3WJ7A 4MYTA 4NCIA 4ESOA 3HO6A 3M9WA 4KVZA 1DCFA 3L4BC 5GAJA 3SS8A 3ASPA 2RKOA 2RHCA 3Q87B 2X1HA 3CONA 3T4UA 4WZBB 3NHPA 3KT8A 4Z49A 2O2ZA 1B43A 1WZIA 3BRCA 1Z7BA 1DRVA 3HKBA 2EKDA 1YOVB 4UU7A 2IZ5A 3AM5A 4NBNA 3T4EA 2O2CA 1EDBA 3A2LA 1M2NA 2YYAA 4HMQA 4HG2A 4K9NA 4B84A 4Q00A 3UCFA 1XNQB 3RFXA 3GVXA 2WAXA 1EFPA 1LVGA 4QOGA 1FE8A 1DOZA 2E5WA 3IPAA 2AUTA 1I1OA 3AF6A 3D1JA 2HJRA 2FAXA 3DLTA 2CRVA 1QAQA 4JJZA 4RLQA 3WGKA 1UJNA 4PFQA 5G2OA 3WIDA 4BJ3A 3KAPA 1PJ3A 1R0RE 1R16A 3KKZA 4Z4EA 4TSFA 1K4KA 4MA4A 1H6DA 1N36B 3QEBZ 2C4UA 4DNTB 1IJEA 3UMFA 3R40A 3PJFA 1JKIA 3LYHA 2O0LA 4KO3S 5T5QA 3WQRA 2BELA 2ZBPA 3F7OA 1GUAA 1YACA 4Y9RA 1J56A 1GTMA 3LGAA 4NFHA 4CF7A 2AG1A 2FPSA 3BIOA 1BE6A 4IJUA 1MAUA 1MQ9A 2P5SA 3LPNA 3OTHA 4CHGA 4QFBA 3DAFA 1QRUA 4J9VA 3L0YA 2ZI3A 1C3VA 1TCAA 1G5IA 5IMSA 1V37A 3RIXA 1WF6A 5FAXA 1F0YA 1K68A 4YT2A 5J4YA 5LFAA 5FOVA 1RCTE 4ALLA 4NDZA 4RMIA 3ANLA 3I9KA 4LJKA 2GAOA 1QJCA 4B87A 4JV5B 1RABA 3SYKA 4EFNA 3I5YA 1E1YA 3FF1A 2G1JA 3PFCA 1IHXA 3T38A 4A4DA 1J06A 5TDHA 3SM9A 2JLZA 5EJ4A 1MORA 2I2CA 2XNDD 4KR0A 3R24A 1U8TA 4CV3A 4Z2AA 2QLMA 2FWRA 2V6GA 4EMBA 3WA7A 3FWKA 4BL5A 5DXAA 4M8IA 3QIVA 1N9KA 2IT1A 2ZAYA 3AR5A 2VDOB 3N8DA 3PQCA 2UXCB 2Q07A 3OZRA 2EBHX 4N0EA 4CIXA 1AKEA 2XQVA 4V2IA 3W3AH 3BMQA 3E9MA 4DCVA 2F1HA 3OEHD 4D9EA 5BW4A 3ICCA 2DBVO 1KAHA 2JNWA 2EDAA 1R6AA 3ESQA 3LCUA 3UPTA 1N0HA 3DDCA 3OE7A 3OQMA 1YO6A 2PPVA 1VFNA 1OLUB 4JJ4A 3K70D 1PLLA 2XUJA 5BPFA 4RHCA 5ENDA 1FSPA 1AKMA 1Y6GA 4Q4HA 1N25A 1KVUA 2ROQA 2ZYDA 4MDFA 2FMHA 1VIAA 1MGOA 3ADKA 3OF5A 2FZWA 3PKIA 5EKXA 4ZZ2A 1RWBA 3RFFA 4AJEA 4C7MA 3ZJTA 1S3SA 4QUHA 3I9V6 3PQ7A 1DDIA 1O5OA 3THWB 3AFMA 1JIJA 2OP1A 2GAJA 2M6LA 1DPFA 4O4HA 2W8BA 4TL8A 1MOQA 1PZNA 2HLDD 4MKGA 3VPDA 2FN7A 2OV6A 4P0QB 1HSOA 3ZDCA 4ZCQA 3NC0C 5FQOA 1MAWA 4K2HA 1DQYA 2EWVA 1R18A 1X86B 5AJXA 1N08A 5TT0A 2NO7A 4NOLA 5IUJC 1MF7A 5JS6A 3TG8A 1GWNA 4WNAA 3CQ9A 2WTUA 1EGQA 3WFZA 3QXXA 1MBZA 2B4RO 1YH3A 3D54D 4JD5A 4IS3A 1M66A 3EIHA 5GONA 2QNRA 2QQ0A 3B36A 3BA6A 3ESZA 4NRDA 3COVA 1II9A 3TL6A 2CC2A 1R64A 1A9RA 4CJXA 4G9EA 4XJSA 1VLOA 2NSHA 4BDTA 4BEBA 2IGTA 2IYXA 3OAAD 1CRLA 4HH4A 1O6FA 3RRZA 4XD2A 1NPTO 2OHHA 1Y5LA 3F3MA 4DK0A 2AMYA 5BWCA 4BX2A 3FHLA 2BR5A 2CEAA 4KAAA 4J2TA 1HTTA 3G2LA 5HQJA 3KG2A 4BJHB 4ZHSA 2W93A 1BZYA 1OH7A 2XNHA 1S9HA 3GJYA 4MW4A 4OKSA 4WN9B 2W2XA 1YL7A 2WHQA 5LYJB 4KODA 3KCNA 4A6XA 3MTDA 4L4YA 4DIEA 5KSOA 3PQ3A 4KFCA 2WKWA 3D8SA 2P1RA 2QZPA 3L8FA 1CLUA 3B9RA 1CYEA 3P4UA 2OK8A 3WZMA 1AMOA 1DC3A 4EHKA 1RKVA 4YMIA 3H5LA 3RS7A 4G1UC 4AN1A 2XWQA 1E18A 2OAQ1 4KOAA 4ZU6X 5HZHA 3CX3A 5ALJA 3RTDA 1BD4A 1QDEA 3EOAI 3ZVLA 4DLXA 1NNUA 2YQ5A 1R00A 4P93A 5BSRA 3PCTA 2OBRA 4P7JA 2COEA 4UEOA 1VPDA 1GL7A 4B09A 3CLVA 3MK31 3FIJA 2VDJA 1MQAA 5DRTA 4A0QA 3GN1A 5IJWA 3SICE 1BTOA 1XQ6A 3PYMA 2JHPA 3T06B 2QE7D 1M8FA 2AVNA 3I2HA 4BQFA 4KZPA 3BK2A 4K9RA 2A9VA 4CF5A 2HC9A 5F2OA 1TOAA 1AD2A 1Y5MA 3FKJA 4XUCA 1JG1A 2X42A 1X7YA 3C5VA 3CZQA 3F49S 3L6CA 2D0IA 3QWBA 1PQ4A 4RJ2A 3RVMA 1ONNA 1FMJA 5EEHA 3S8YA 3INRA 1CJKC 1RJ9B 3E7DA 1AGPA 3KFLA 3T9CA 3DPUA 1EHIA 2BMDA 1NR1A 2BBSA 1TTHA 3HKEB 4TZKA 1VQ6B 1A9ZA 2Z8ZA 3M6FA 1I33A 1TMYA 3TPCA 2YC2C 1X7WA 1U9CA 1Y7PA 1ZRHA 2C5AA 3BL8A 1F48A 4UBLA 5IJZA 4IDPA 2I4IA 4DUGA 3SXPA 1CK4A 4OFBA 4LKOA 4WZAB 1XJ5A 2Z04A 2FEOA 1XTRA 4TMWA 4N3BA 4B34A 4JU8A 2MYUA 2W43A 1ZD9A 1Z6ZA 1FFXA 2IVFA 3I1IA 2A4MA 4NHOA 5E2BA 1YR7A 4RK5A 5IN5A 1B1CA 1QHIA 2ECQA 3JVDA 1EVJA 3WWOA 5JMOA 2JHGA 3I53A 2EF1A 1W88A 3LPMA 3PB3A 4EG3A 3IAXA 4HB0A 1D5CA 1GOTA 3WXMA 3U4QB 2YINC 2KMLA 2VNSA 2C7VA 4B3FX 2C2BA 3KXDA 1GFSA 3UPDA 1XVVA 4G5FA 4RK1A 2YS6A 4I5EA 4LEIA 3HH8A 1ZOIA 5K3AA 3SLDA 3IILA 1WLYA 2W6ZA 1C7JA 1NLYA 3EZGA 1FFHA 4PAWA 1D7OA 3IV6A 1PS0A 3V4PB 1T3GA 4QDKA 2PUTA 3S5UA 3LQ6A 1Q15A 1Z0KA 3EFOB 4QRHA 1AQNA 3ZY2A 2OGUA 3IQFA 4F4CA 2HZBA 2FW8A 5E9WA 5EWLB 4L16A 3QPWA 3IQEA 4GPTA 4A0SA 4DTIA 1CEQA 1OBHA 1Y8AA 3OVMA 1G7TA 1PUJA 2VA9A 3FDZA 1XFOA 3HEAA 3R7AA 1VG9B 2Q99A 4QPNA 2BRUC 4BKQA 2VNIA 3FVWA 3NANA 4PPGA 4BAZA 5K0EA 3DTTA 1BJKA 2JZNA 3BULA 4QWMA 4IMPA 3B6ZA 2ZIGA 4MV4A 2NV2B 4W82A 1IPFA 1P9WA 5L40A 1KOGA 1JHOA 4Z6KA 4YLGA 5J1TB 4BTVA 3T5MA 3WFIA 4DC9A 2D4HA 3F8WA 4WKGA 2MSCB 1SCUA 4LCJA 2D3LA 1LQ2A 1HQKA 3B53X 1SY7A 4UNQA 3EXAA 1NN0A 4PANA 2V55B 3J81A 1D2HA 3K9LA 3C7KA 4HNAA 4HWRA 2PV0A 5C52B 3LZ6A 1HRDA 4ZYUA 1LJUA 1WU7A 1OR8A 5CA1B 4G0WA 4PX9A 1PJCA 3LY5A 1RIIA 3L7NA 4A6EA 1GEGA 4UEJA 2BFFB 5L95A 2AX4A 4TYQA 2QN9A 4TQGA 4R8MA 1LBIA 4G41A 2I76A 2VP9A 1DQSA 5BY2A 1CJMA 1DAGA 1JDZA 2LCQA 1R5BA 2QBYA 2XCQA 5H59A 1C4OA 4U63A 4P3IA 4O3MA 3LFTA 5I9TA 1C7ZA 3U4AA 2QUBA 3WWEA 3NUZA 4BFSA 4BYMA 5FDFA 3M33A 2EKZA 2QRMA 7MDHA 4FD3A 5T8KA 2VWHA 3TNYA 3QOXA 4KXQA 2RI6A 4KITB 2Y6UA 3CIFA 3I32A 4EPXA 3U19A 1T10A 3LDGA 2W5UA 3CNBA 2Q41A 3EXEB 3BBLA 3I1YA 1ORVA 4FYWA 4M9CA 5DX0A 3MTGA 3TVTA 4OU5A 1L4NA 1C7EA 3VHRA 1R2QA 3E70C 4EFLA 5JY1A 3R9IA 1Y4UA 2TMKA 2ZGVA 1Z3IX 1HEIA 2Z8YA 4AM8A 1GM5A 1CUUA 5B55A 1I3MA 1F5NA 5CB4F 3T3OA 1NFQA 2H1CA 2NZ2A 2FUNB 4JK3A 2Q3MA 2JIOA 3GLGA 1QVVA 2ZL6A 1A5AB 3PPWA 2WD7A 4L7QA 2V7TA 1RAIA 2D13A 5FIUA 3G02A 3Q0IA 4DANA 2XKAA 1NDHA 5EIXA 2IOYA 1DUSA 5JSUA 3LIIA 3M5CA 5J23A 3T54A 1WCYA 3BX1A 1FXWA 3Q3EA 1VSBA 2NZXA 5E7IA 1OB0A 3BQ9A 4K86A 2ZSUA 3AHIA 4MQBA 2V7QD 5F9FA 3SBXA 1CUZA 1GA6A 4BU1A 1YOBA 1CZUA 1RI2A 4D6XA 5I3ZA 1IK4A 5JR3A 3O0TA 3TSWA 1TW2A 2J0UA 3CT4A 3UK7A 1UBLS 2WG1A 1YX2A 4FQ7A 4IGFA 4NG5A 5KQPA 1QE3A 4IG9A 4YAJA 4Z4QA 1UEJA 2V31A 3O38A 4RY8A 4UU8A 1ODTC 1U7DA 1USVA 2AXQA 2D1YA 2FWAA 2I6TA 3QP9A 2F64A 3RIEA 3USCS 4JN6B 3Q41A 2R00C 2XVXA 3ER8A 3P9IA 4AIIA 1ORHA 4QPCA 5F3DA 3KUCA 3BXZA 3FNHA 5H0IA 4PONA 1BG6A 3UNXA 3F8SA 3QKSA 4PSKA 1QK4A 4D81A 1I10A 1UK7A 1UQRA 3TLKA 5T8KC 4EKEA 4FFWA 2XJ4A 2QTVA 3FGNA 3PL1A 3T34A 3EXIA 3B6MA 3QY0A 1P2FA 3FYHA 4XLEA 1N2ZA 3S1LA 1U2PA 3F6CA 3UC9A 3S7TA 5LMCA 5HPYB 3IUJA 1Z0SA 5CLIA 4XTCS 5EZYA 3DHVA 5UKDA 2J45A 3OT1B 3UKDA 5LOVF 4EQ6A 1R8YA 3FYTA 3VPGA 4MQEB 1XALA 5F52A 2E55A 1PJSA 4YIHA 5HFNA 2IYNA 4KKXB 4HB4A 4MCIA 5C0OE 1EGAA 5EWJB 1THGA 1KNQA 4BMSA 3NWPA 2VPXA 4QUJA 1GPYA 1V8ZA 3DZHA 1XLVA 5HF6A 1ZJ4A 3LW8A 4KLAA 2BOVA 1UM8A 3KEMA 1Z8FA 3OPYB 4KQXA 4P98A 1J1UA 3TUZC 1DRWA 1RAEA 4EYQA 5A7HA 3WL4A 3CY6A 4UQPA 1I32A 2MSKA 1QZTA 3G89A 1QOPB 5GTDA 4A0FA 1E5QA 1XQYA 4UVEA 4WESA 2O2HA 1MB0A 2GUGA 2BI7A 1Q7TA 2QA5A 3C3CA 4DNOA 1RPNA 1WKBA 3LT4A 1QIMA 1AIPA 1LGYA 3GMSA 3OZAA 4H2DA 1V3QE 4F4IA 3H5RA 2QPOA 3BD7A 3HJHA 2QDKA 4W7IA 1D1QA 1IMOA 1WVGA 2GZHA 4LJSA 5IABA 4I4TB 1NUSA 2WHPA 1KJIA 3H16A 4LYHA 4WASA 3ZWPA 4F2PA 1YCGA 2PG3A 5DYYA 3W5JA 1G7CA 4YEJA 1UBKS 4PINA 4QECA 1EK5A 3DE5X 3CLTC 6NULA 4TTAA 3HSSA 5B5SA 1CDEA 5J2TA 5CCBA 1VCHA 5BWOA 4R2HA 2ZIXB 3VMMA 1SXPA 5PGMA 1V5VA 1PE0A 4NYJQ 2XMCA 2AI1A 4HYYA 3D7KA 3WYEA 2H0RA 4X00A 1CZKA 4N0QA 1D0SA 2ZQYA 1P1BA 3E58A 4IDHA 4KXMA 4TZTA 3ZWMA 5T7BA 1V25A 2FXVA 1XLWA 3PDCA 1EG7A 4PW0A 5IAJA 3IMGA 4FM9A 2OHOA 5HP4A 4B3GA 3DHEA 4A2PA 3HADA 2Q62A 5LIRA 3PXXA 3ASQA 1EGMB 3K0HA 3ICQB 4KC0A 1EA7A 2C5HA 3F3YA 5LP6B 5KSWB 4UXJA 4C21A 1ADFA 1ZA2A 3VC1A 721PA 5LDDC 1A82A 1E3IA 4YAUA 2JFYA 3C3MA 4M8KA 1V48A 1VJGA 3T4PA 3W5CA 3PGJA 2VH5R 4JGGA 4M8LA 3QOYA 5K45A 1N8RD 1BYUA 4UMVA 3WG9A 4MIEA 5ELMA 4Z0NA 4OOXA 4XLHA 1Z62A 3HO8A 1GCGA 2C4WA 3R6KA 4V0SA 1FXSA 1YU9A 2OV1A 4ARZA 4E30A 5A3JA 3KX2A 1FW6A 2OHXA 4G97A 4HOYA 2GETA 3UWKA 3L8YA 4CU5A 4NAUA 2ZIEA 3FNFA 3UJ8A 4GSYA 5FWXB 3IO3A 2NO1A 1G3UA 4TV8F 3WRWA 4LUCA 3PNBA 4K0KB 3A58B 1D07A 3GJ3A 3K0CC 2Q4RA 3HWWA 4LBWA 5HCNA 2C8LA 3DBRA 4LMBA 3V2UA 5JAZA 4JLAA 3O3MB 3TRFA 4U2DA 2VDRB 4UTZA 3IMEA 2FG6C 2VJQA 3IR6A 1MAVA 1GKIA 2C1XA 3MQ4A 3ZNNA 4JYZA 3MWKA 4Q4CA 3ZDBA 1WXDA 4CMEA 2VTEA 2PSSA 4MRMB 3SZOA 4QFCA 2CWWA 2AK2A 4IXWA 2UVPB 3I6YA 4CL8A 1U8XX 4G1EB 3T41A 4X7FA 4WLEA 4YGXB 1VL2A 3NH9A 4GGPA 2OYRA 3GNQA 4W8GA 1KZHA 3ROMA 4DQXA 3BKWA 3QGMA 3WKAA 3ZWNA 5FPYA 2PIAA 1WZUA 1W36D 1NG9A 2IS4A 2JAOA 1U9IA 3CX4A 5IK2A 3NHBA 2ZAOA 5DN9A 5K0BA 3GDHA 3M81A 2AQIA 4CT5A 2GPYA 2H2FA 3LV8A 4OXXA 1W1WA 3UKJA 3I12A 4ANFA 4K40A 4L76A 1VLZA 5J35A 3PPIA 5DTJA 2C0PA 4KX3A 3A3NA 3CLTD 4RVOA 4KCGA 3TZQA 2OHIA 5EHZA 4DYHA 2G8LA 3CCEB 2FX2A 1ZO8A 4RIIA 4HGYA 3I9JA 1CJVC 1L5HB 2IV2X 1E2FA 3BCSA 4UHKA 1ATIA 1ZY2A 3K1JA 1EM8A 3PD7A 3MW8A 4XJVA 2OYNA 4A6DA 1ZGAA 1VQOB 3WHKA 2IEBA 5BQ3A 4X1YB 4L3VA 2HJSA 1WWKA 3VHQA 3W3AD 1K3TA 2WRZA 5FNZA 4EK9A 2BTEA 3O8BA 1IHPA 4DB4A 3FSEA 4XWTA 5D6NA 2HT1A 1W9HA 4LVCA 3DB2A 2Q9CA 2VQ6A 2CSUA 5ESWA 3SNKA 4O4IF 1I7LA 3B9QA 2BBTA 4UUQA 2O3JA 2WSYB 3BHNA 1NYRA 4O3FA 4XYLA 4ED9A 2XGSA 4TUYB 1E79A 4HE6A 4FGWA 5C8YF 2O8FA 5D5QA 3GLHB 2WJWA 2Z3WA 3HVJA 3VDQA 1G18A 2DR3A 1CW2B 2FDXA 2DEUA 3Q7IA 5SICE 4BBJA 4EDFA 4EL5A 1NVVR 1GPBA 3IPLA 4E88A 4OI4A 4RSMA 5DBIA 3IJRA 4RW0A 5P21A 5LP1A 4UM8B 2BZSA 2FR8A 2G17A 3EZ2A 2QU8A 3LL7A 4ITRC 4Z4CA 3MMPA 2RAPA 2M9MA 1KH1A 3AERB 1ZJWA 4H1HA 2BM8A 1N75A 3RS4A 1JE0A 2HX1A 4YCMA 2JI9A 1H1LA 3I3OA 4PNEA 2JDIA 1OTXA 3OM1A 3DOIA 4I1OA 4NE2A 3FYDA 1SXJD 1OROA 1QB8A 4F5DA 4FK8A 4ZOLA 1TM7E 1TJNA 3BGIA 3FMVA 3QNUA 2ZTGA 1NBHA 3HU5A 3OOHA 3ASTA 1PK7A 3OURA 3WQQA 4N0DA 2NP7A 1Z25A 1TUBA 5AVYA 1GUDA 2WYWA 2BD0A 1X38A 4GKAA 1KNXA 5CH5A 4F9TA 3ANTA 1GUFA 4CKWA 3BMCB 4WOCA 1S3FA 4I50B 1RLTA 1U8AA 5G3ZA 4ARCA 2WMOB 3O1HB 2X9QA 2FX3A 3KR9A 4LGCA 3QKTA 1RWWA 5GVSA 5HVNA 1EK2A 1QFMA 2WI8A 2BEVB 3QOFA 4UFOA 3Q8LA 2Z2XA 1WNTA 2J3HA 5E3IA 4XN3A 2VC2B 3GFOA 2GK3A 1C8LA 2AWNA 3LBYA 4TKVA 2NUAB 1XVAA 4D98A 5JH7F 3MM4A 2VBGA 1UOOA 1T3ZA 2J5XA 2WWIA 4I9HA 2QY9A 1D0IA 1K4MA 3EUAA 4KYVA 2WUFA 4U2BA 3E8XA 4WBSA 4Y2YA 5CYPA 1IJFA 4QEZA 3C4QA 3GYGA 3OOYA 4DLWA 2JJMA 4J7AA 2J8ZA 4REOA 4KO4S 1WOYA 5DGCA 4MUGA 1FSGA 3C1TA 3L0SA 4MW0A 4L4SA 1ZUNB 2PH1A 1UM9A 4NSNA 1F12A 3HRHA 3RGGA 1DV2A 1Q7CA 1KI6B 1P7VA 2QRUA 5AHKA 3S2UA 5AW3A 3LXUX 4KV7A 1VIDA 2YW9A 4N8EA 1J8VA 4CV1A 2X23A 5A89A 4Q9LA 3AVUA 3RUCA 1ZAKA 1YZUA 1WDLA 3QVMA 5G0TA 5KU1A 3AUKA 3HNRA 4BNTA 3K0AA 4PV7A 1WD5A 3BY1A 4FQ5A 4D4KA 4MWTA 1I1NA 5FBLB 4L27A 5JCJD 4O4LB 2NUPA 3P7MA 2C9MA 3L6UA 4KVGA 1RBYA 5AT1A 1RLJA 3O1LA 1D2GA 1IHUA 3SVZA 3LFUA 4BX0A 4HNUA 1Q9SA 1ZGJA 2SKCA 3GYBA 3OCVA 1JZTA 1OOEA 1RCFA 3T3GA 2QI9F 2JLYA 2I6GA 4HDOB 2YHUA 5IF3A 5KSPA 3IV7A 5K8VA 2JGNA 2JLVA 3QJ5A 1V5IA 1G8MA 1K6IA 1X8XA 2QVXX 2BKEA 1FXUA 3CMMA 1UBGA 5BN3A 3UK6A 1K6JA 3P8ZA 4Q9HA 4BXOB 5TRDA 2AKAB 3IIEA 3SDBA 2W6IA 4TMYA 5EHXA 4GLOA 4OYHA 3VH1A 1LD3A 1TO1E 3D6JA 1NTOA 2OG1A 3GARA 3PT5A 4LJYA 5DYWA 4FI3F 1RXYA 3F6RA 1QKIA 2B1GA 1ZNQO 3N0WA 4UCQA 1OF1A 5K20A 1U2EA 5K09A 1GZ4A 4UOQA 1PQPA 1OTYA 2R96A 3FYUC 3OQIB 4J0CA 3O82A 4RNCA 3UMGA 5AVJA 3LPCA 3V80A 2XKJE 1MT0A 2ZOSA 3BL6A 4IHJF 4MRSA 4UE2A 3RUDA 4ALNA 1OWPA 2BMWA 3DL4A 2GEVA 1M6EX 2RARA 4ROXA 1U8FO 2P1DA 2FN3A 2W83A 2YY7A 3NTLA 5FOXA 3SQNA 2E82A 3ZX4A 4PO8A 1YRAA 1EX1A 3N07A 1GPAA 3QE4A 1X13A 3OQ6A 1E77A 4I19A 1OX6A 2FUG1 1YB6A 4GBMA 3FPBA 4UE6A 3ADCA 1E3MA 3CN7A 5CYOA 1TVEA 1UXJA 3ZN2A 2V7VA 4NBLA 2V5VA 3H0EA 1ZRSA 2HZ7A 3ETDA 2WICA 3NHZA 3HJUA 2BZ0A 4X6YA 3MHTA 2UZ1B 3W1VA 1KY3A 1WQ1R 3FYSA 4C3VA 5TF0A 4NCAA 1J0XO 2CLDX 1YHQB 4KQJA 1RM0A 2W6PA 1EWQA 3KVRA 3CO0S 3VR6D 2R8EA 5E3HA 1T4MA 3CX7A 4FR5A 4NV0A 5ETJA 1OIVA 4EITA 4CETA 3TRDA 3Q5DA 1V1JA 3S2IA 3Q7EA 4LJ6A 4YP5A 1OPXA 2ZBDA 2OO5C 2A3RA 4HKTA 2JATA 4YH1A 1Z13A 1MD9A 5JPIA 2QTFA 2G4LA 5DGHA 1IUPA 2XWJI 4OP3A 1NP6A 3C3YA 1Z7WA 2F1RA 3IVMA 3OT5A 2X5NA 4NJEA 3FNGA 4BLVA 5IJ9A 3GRKA 3QMWA 3K73O 4L4XA 4U5QA 2C2WA 3AGQA 3OEYA 1SBIA 5F7JA 2DXIA 3ZS9A 3ZY5A 5I7VA 1E3XA 4IYJA 3N2GB 5HUHA 3NWBA 2CZCA 4H7JA 1AS0A 1OV6A 1TRHA 3K31A 1GXSB 4F0JA 1T5TA 2PNFA 5GJCA 3CPXA 3UWDA 1RAAA 3CWCA 4HNGA 4URWR 1Z29A 2R8OA 3H0CA 3IXQA 4RIHA 2FN9A 5H83A 1K1EA 5M7EA 2Q1WA 3V1TC 4Z1MD 1QC5A 5KNDD 2IY9A 1EUCB 2R62A 2J3KA 4MS3B 4FFRA 4GHWA 1YITB 2LZ0A 4IQGA 4OOFA 5G02A 2D2XA 1E63A 2RH9B 4WV3A 2IFTA 3TIFA 3TUJC 1QYWA 2QRLA 4NNOA 4D8TA 3QXCA 4ERNA 4RFVA 1ODIA 1ML3A 5I7RA 1VYHA 4PLPA 4DWWA 1KVRA 2FKNA 1EINA 1NF9A 3H3FA 5FPPA 3WWDA 4DCMA 1QQAA 3OZTA 2Z83A 3SI7A 2WZPP 1QS0A 3ESYA 4HJXA 1JFTA 3V8BA 1TAHA 1IZ9A 1GNLA 4EB0A 4BZQA 4KJZA 1DLIA 1A1SA 1L5YA 1BX3A 4AD8A 1WF3A 1TPYA 1ZJJA 1CULC 3E7PA 3VNRA 4O2LA 5TE9A 3KZVA 2QW1A 1B6GA 3HDGA 5K6TA 3AKEA 3M4YA 5IZCC 4BFTA 3I56B 2IZ7A 4G6IA 4DIKA 1CRPA 1A2QA 1PZHA 1J21A 1DELA 2NZYA 4R2MA 1I3NA 3BCRA 3IESA 5THQA 2ZT5A 2J59A 1LEHA 3CRVA 2I55A 4UU0A 5LPNA 5LWHA 2QTRA 2WU1A 4UNRA 4GM4A 5MF6A 5AVRA 3FDFA 1I8TA 3RR2A 4B46A 1XP8A 2E4WA 5GY7A 5DBOA 1KOFA 3L7LA 2DPMA 4M1YA 1J9EA 4QFDA 4AX4A 3WYGA 1IN6A 1I4LD 1ECLA 2X2PA 3NBAA 4HWGA 1J00A 1FLDA 3O3NB 4LZNA 4R9VA 1QGZA 3MS7A 3B13B 1B7GO 2ZETA 2XZOA 1C1YA 4LPSA 4B75A 4UM9B 4AT1A 4PLVA