5FIUA

Binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of a Potential Difluoromethyl-Nucleoside Substrate with the Fluorinase Enzyme.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXY-ADENOSINE SYNTHASE
total genus 80
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5fiuA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5fiuA01
2F4NA 2V7UA 2ZBVA 2Q6OA 5FIUA 1RQPA 2V7VA 5LMZA 2CW5A 2V7XA 1RQRA 2WR8A 5B6IA 2Q6KA 2Q6LA 2V7WA 2CBXA 4CQJA 2C5HA 2C4UA 2ZBUA 2C5BA 2V7TA 2C2WA 2C4TA 2Q6IA 1WU8A 2CC2A
chains in the Genus database with same CATH superfamily
4PZEA 1PL8A 3BMQB 3H9QA 1BN7A 4R83A 4KE8A 3CLHA 3NDPA 3HEAA 2YMLA 1P19A 1XTBA 1ZGBA 3KX2A 4R2HA 4Y2YA 3V1YA 4B7ZA 4R8KA 2OYSA 1O95A 3QFFA 4UDXX 3VR5H 5CHEA 2B0JA 3E9RA 3SNHA 1P2BA 5DX0A 3UAGA 1ZBDA 2PNJA 3EPLA 2D1YA 1RRCA 4DLRA 3SZRA 2XIQA 5KYWB 3KVOA 2WNSA 3NKVA 2HSJA 3ESYA 2ABWA 4MWCA 4OMUA 3TOVA 3U7QA 4FC6A 2ESRA 4PWZA 1CHDA 2NQ2C 3MSXA 1QHGA 1T43A 1WBJB 1O95C 1OYWA 2PAFA 4IXTA 4PLWA 1VKNA 4QO7A 4ZRDA 5IAAA 3IIEA 3FFBA 1YJQA 4MWOA 1IN7A 4ZEWA 3T9DA 2EDCA 2K2QB 2XD9A 4R68A 4KCGA 4YAEA 1CTQA 2ZYSA 3E8XA 2JAUA 1E63A 4FWIB 1S8OA 3RV4A 4IWXA 1Y5MA 3GZTB 4OX9Y 2Q9UA 4GR5A 5NULA 3B78A 2DUUA 1ECFA 4R1QA 3Q5GA 1UJNA 2NYVA 1DIBA 1NP3A 4BPRA 1NOJA 1PEKE 2AEFA 2XIJA 3UJ7A 9ABPA 4LYGA 1P7YA 3UV6A 1MXFA 2NPIA 4QKQA 1GAEO 3C3YA 3GRVA 3KEWA 1OV6A 3A4LA 4EO4A 3SQXA 1AZLA 1JLHA 1J21A 1Y9JA 1Z5OA 1IHYA 1ZNZA 4YHHB 4C0QC 5FL7A 4MTLA 2E87A 2WM9B 1TMYA 2O0HA 4M98A 1PR4A 3EBLA 5K0EA 2UDPA 5HBGA 1OAOC 1RKQA 1TQDA 3LBAA 4OAPA 4P31A 3QPDA 5I8ZA 5KYWA 2JLAA 1IM8A 1W2HA 2HO5A 3IIMA 1M74A 4HFRA 4MDYA 4G56A 2ODNA 2PS9A 1THTA 1WA5A 4HX2A 5IBRA 3FSRA 3BFPA 3EEIA 4L28A 4RDXA 1QDLB 1E3MA 2XNDD 1TXGA 1NB0A 4O1HA 3MWJA 4FFMA 4AI6A 1NQOA 3FGOA 2A4KA 1GV0A 5I5GA 4CW7A 4UE3S 2YIJA 2C61A 1MGPA 3PKJA 4DJJA 3R5JA 1THZA 1A98A 5TQ0A 2FWNA 1IBLB 1WHTB 3QELB 3DWFA 2WHRA 4O2LA 1V5VA 3VC3A 3PL1A 4M1EA 2C95A 1D4OA 3CZCA 4ZI7B 1ZEMA 2VTEA 2J3QA 4NQZA 2HAEA 3PA2A 3EDCA 2ZBUA 4KAXA 3R8XA 1FDTA 3CEAA 1OZGA 3G2IA 3HVKA 4OYRA 1JLLB 4W9NC 3T34A 4KGVA 2GN9A 3G0IA 4HMOA 4XLFA 3M70A 1JYSA 5AM3A 621PA 1W1IA 1ODKA 2EKZA 4Q39A 1IULA 2OMKA 1X7ZB 3FRJA 3QYFA 1FFWA 1I14A 2OAQ1 3PQ6A 2BI4A 4IW3B 3FTEA 4D57A 1LCIA 4JOSA 4B7UA 4DR5B 3E8MA 3IAM6 3EDMA 5ALGA 2CL5A 3QH4A 4R0NA 3LXXA 4B2IA 1CPYA 5CR9A 4HT3B 2ISCA 4IILA 1PHPA 2XE6A 4OLFA 3OLVA 4PGOA 2OWEA 5DYTA 5T57A 4CM6A 1NAHA 1JJVA 2OY0A 2PUCA 4ZQEA 4KDRA 1JT9A 3KZVA 5KSWB 3HZOA 1KI6A 2QS9A 2WJHA 1I1HA 1SC6A 4G5XA 4R69A 1TUBB 3R74A 4CM8B 1TVMA 5ICGA 3ODGA 4DCSA 5CJ2A 2QNRA 2GKGA 4CDRA 1HNWB 3VPBA 3KKKA 4JC0A 1EGVB 2XNSA 2IHBA 5FBQB 3TK1A 1SULA 2OOKA 1K6MA 5IH7A 1X15A 1Z5GA 4JIGA 1OXBB 2D2XA 1E3EA 3WB9A 4BO7A 4F1WA 1PR6A 5M29A 3O8CA 1X86B 2ZRGA 4UM8B 5L4NA 3NQ41 1V0EA 3EE6A 3GLTA 1G60A 4O3MA 4V38A 2X6WA 3KK0A 5AVJA 3RUAA 2LCQA 2ETXA 4WCFB 1XQVA 2QRQA 1H3NA 2Q5QA 3KS9A 5LA6F 2Z4SA 3P7MA 1YVRA 3ETHA 1QDEA 1A4IA 4QGHA 3LQEA 1LPMA 3AR5A 4BZPA 1K7YA 2B7CA 4DQKA 5IT5A 3IDSA 4P0PB 2PEYA 4NTZA 1EAMA 2BR4A 2JD2A 1SHUX 2HF8A 2Y1GA 2OILA 1GZHB 2IGBA 3F5QA 1QF9A 3OETA 2VDQB 4OHPA 5AESA 2WVHA 1C0KA 1RQLA 1WULS 3AUSA 2XYPA 3KJGA 1K0UA 4OREX 5F4BA 1DBRA 4DC9A 1Z2NX 4HZUB 2KE5A 3I6QA 1Q6YA 3L46A 3MTQA 1A8UA 1F6DA 5DGTA 3C7TA 5JJ5A 4FJ1A 3DLAA 1V11B 2IDJA 3LKVA 4X1IB 4ARUA 4RZQA 5FA6A 4L95C 4V0KA 4D0NA 1QCYA 1V1JA 2B7LA 2BFPA 4QVIA 4ZOAA 4V0SA 2W00A 3FVQA 2XHZA 3DULA 4N8EA 2NG1A 2CDNA 5JAQA 3QUQA 4DWOA 1YKGA 1QQBA 4PC6A 4G1MB 4G4IA 3BFKA 2ZTSA 3NTRA 2YW2A 3CMCO 2IUSA 3T94A 1FX0B 3MJCA 2A58A 1X9IA 2RMKA 1C81A 3AT1A 4R2LA 3QU4A 4MWSA 4JXXA 2Z5FA 1DIGA 2VG8A 1H8EA 2Y92A 4Z4RA 3NT5A 3WHKA 1F38A 4RSGA 2NSDA 3G0GA 3K71B 4BTLA 2ZZMA 2VK8A 2BRUA 3WYBA 2ZTNA 3PUMA 3PC2A 3Q8XB 1E1RD 1F2UA 1NVXQ 1P5HA 1BX0A 3ZKWA 5CA0F 4PZPA 1DPFA 4XFJA 4TQUS 2Y93A 3ILXA 2YRFA 4ZAGA 4BY9E 3A1VA 3DDYA 2ZTLA 3M2PA 1G7TA 2DPXA 4OXIA 4BP1A 3AFNA 4UTVA 3GD5A 4DCVA 1KZYC 2O2CA 4GP7A 3A3GA 3UKDA 4Z7OB 3VX3A 2JK1A 2C00A 2OE2A 3PEUA 1Y7LA 3HYLA 2JJ1D 4B4UA 1ZVVA 4KR7A 1YRQA 2A5GA 3MCTA 1KEKA 3D0RA 4FCWA 5JXIA 1KKUA 5AKHA 5GONF 3P9QA 4DV1B 1SR8A 2G1JA 1XEXA 3TFOA 3KWJA 2O5CA 3D7KA 2X5JO 3BIWA 2D00A 4MV5A 5I01A 3OU6A 3LVFO 1J8VA 4BQFA 4HG2A 1JAIA 1I51A 2Y0DA 2ZM5A 1PUXA 2RARA 1IZ7A 5LVAA 1N6KA 2FEOA 3RHFA 3DUWA 5CHYA 3E7XA 1PWEA 4UCWA 4KVAA 4RMIA 5CW1A 4MYTA 3R5HA 4GOND 4RFVA 5JAOA 2Z5LA 3RSLA 4RZ2A 3IKLA 1FMTA 2CJWB 3Q3HA 4R9SA 3KB2A 4YRCA 2ONZA 2X5NA 3VKUA 3AFGA 2QOEA 4IGFA 2DBZA 3FDXA 3NAQA 4GE3A 4X7RA 5TT0A 3V48A 3OE1A 4M9CA 4UBNA 1VL5A 5FNVB 1ECGA 1GKYA 1VECA 1YRAA 1D5WA 2BR3A 3HI4A 1BH2A 2XNKA 2D5IA 3KLMX 4GM0A 1IZ0A 3DC2A 5BRJA 2DJIA 1Z4LA 2CLLB 4V3BA 2QL9A 4XOIA 3DE4X 5HUJA 1JRLA 1T9ZA 1K5HA 1N8TA 4IIJA 4IR7A 1UFOA 1Z4MA 4G67A 3G5LA 2PXXA 4FZ5A 3NP7A 5A4AA 1S2GA 2DERA 1S7GA 2V0CA 2G77B 3G79A 4URYR 2DM6A 1Z5PA 3GA0A 3GEIA 4OHBA 1B2RA 5TE9A 2R1UA 3U4AA 4YRMA 3DZIA 1ADFA 1US8A 1B14A 1W44A 3L7BA 2YW9A 3QOYA 2BR5A 3VZCA 1C4WA 4IEEA 5ED0A 3ZNPA 2JKZA 3GEEA 1KA9H 5K0JA 2I6TA 2CZCA 1NQUA 2WUWE 4IP0A 4HKTA 4KKXB 1N0HA 3UCXA 2YZNA 3A3BA 2PX6A 2Y8EA 1MF7A 2C4VA 4K9RA 4UEQA 3TO5A 3U3RA 4J94A 5K3OA 4R1LA 5ECWA 1ZSYA 2FK7A 4ITRC 3PUIA 5B2ZA 5B4UA 2H06A 1H2HA 1P1BA 4PHGA 2P6MA 4RF4A 4DR3B 2HQSA 5D51S 3UOWA 2CBZA 2JHFA 6REQA 2R8RA 3HTXA 4BGEA 1ZCFA 3FB4A 3GJ3A 3L1UA 3BB1A 3T1QA 5DN6D 2O2HA 4KWCA 5K2MA 3H18A 3LC1O 2B37A 5IVKA 4KHPB 1EFVA 1A96A 2QG4A 3ECAA 4CMGA 4Y2PA 2EJWA 4EA7A 2O48X 3O8NA 3FPBA 3N0TA 2VKTA 5BVGB 2C2BA 4FS3A 3K94A 3A9WA 2J9GA 3SK0A 4D9GA 2NOAA 5TPWA 4GEKA 4JLNA 1JB9A 3NC0C 4UNNA 1V95A 2P1RA 3DT9A 3KU1A 4DGSA 3JQ9A 3FMIA 4BWGA 5CLFA 3V4FA 5JTTA 4RY8A 1Q84A 1DC6A 1ZUHA 4HX5A 2ZETA 3AEKA 1R66A 1UOPA 1VI5A 2I33A 4GS5A 2XBLA 1Z68A 1P81A 3F8SA 1SCJA 2G9QA 3I0ZA 2HYIC 4UE2A 3IMFA 1ORVA 1U7UA 1CRPA 3ROXA 3TIFA 3D26A 3GA5A 4YRZA 4BJ3A 1D6MA 3R6LA 2FKAA 2OFOA 2A0FA 1U3DA 3PSHA 2RDMA 4KIWA 3SGLA 4BB5A 4DYVA 4N9QA 1BJTA 1EJ2A 3F97A 1A3CA 3S8MA 1XWIA 2IXTA 2BM0A 4OKIA 4RQAA 1M2HA 1P8JA 3QPAA 1RRVA 1AKUA 4HI0E 1J9EA 1Z75A 2AUNA 2HA6A 2VRBA 3B3AA 3R9XA 2PKCA 3DS8A 3BCUA 3SDBA 4WFKA 1M6HA 1OFGA 2L69A 3B5JA 3TLYA 3SBXA 2ZBFA 1G8HA 3LBHA 1AQYA 4HJRA 1RXCA 1NL3A 1SD2A 4RGQA 1AKEA 1KS2A 2NUPB 3PD0A 2HMUA 2ZVPX 3K1AA 4KXNA 3K0SA 1E6UA 2LD4A 8GPBA 4QUKA 4V0LA 3HSSA 3PTLA 4Q4HB 4UKDA 5CDGA 1E1NA 2G1AA 3DOCA 1NRXA 2GPNA 4LIPD 2WWVD 2QUZA 3BUSA 3TLXA 1KTVA 4FMCF 2FYTA 1KO4A 2JFBA 3E70C 4Q01A 4HTFB 4AKTA 1YZTA 4DJAA 3FHCB 2VTBB 3O4HA 1YJ9B 4EBBA 3H2ZA 4AKIA 2QMYA 5EZSA 4XYLA 2ZT5A 4MKZA 1QPBA 4CVNA 2O8CB 3OZFA 5C51B 1U5BB 2IPLA 4V0NA 4XWGA 1J8DA 1YWGO 4CV3A 4YAIA 3E1GA 3VKWA 3CC7B 1YB6A 3PWSA 3JYQA 4XYMA 4KAFA 5E2AA 4FYMA 4OOEA 1EXVA 3ONDA 3EQ6A 4LY6A 4P9SA 4JI1B 3VTZA 2BEJA 4YGXB 3CO0S 1SWWA 4JQYA 5KJ6A 1GILA 4BQEA 4YEDA 1YI2B 1T3LA 2O2XA 3GNLA 4FYPA 4H6VA 2BFCA 1JFLA 3E05A 4Y9DA 1XNHA 5FI1B 1XI2A 1FDUA 2H00A 1G8SA 3A1SA 4Y3UA 1YX2A 2IELA 2AZMA 4TN5A 4B4KA 4V1CB 2QRVA 3F4KA 1RYNA 5DN9A 1X3SA 2G7MC 2BGMA 4D0LB 1CQZA 4RTRA 1BXKA 3QWIA 1TYZA 4JJKA 3LRXA 3EWNA 5E9WA 4CKWA 2AB0A 2Q4OA 5GTDA 5L6MB 3UMFA 1I4WA 2C2ZA 5EQFA 1O94D 2OMEA 2VYVA 4J0CA 3S55A 4FMBB 4RD1A 2X40A 3G5MA 4GOMD 4MO9A 2ZTHA 1KYWA 1B15A 2X0IA 1N6IA 3NB0A 5K9ZA 2NTNA 3PCRB 3O2QB 2J59A 4UUAA 1QRAA 4CWAA 3QELA 3NC1C 3TLAA 3O8OA 3TAXA 4EYQA 3EEYA 1UMBB 2A84A 3LQ2A 4XWAA 2NPFA 4PONA 2ZBQA 2Z57A 4KO3S 4O2BB 2FN8A 3TIVA 8ADHA 3RC7A 5HGXA 4QUBA 5I7SA 2WB4A 1CS0B 2RE8A 3LCMA 2V0GA 3FSEA 1AA9A 2O1XA 4HYTA 3KT6A 1CQJA 1USIA 2E4YA 3Q7PA 4W1PA 4XVUA 3WB0A 5H83A 2XSZD 1J07A 1U31A 3FCYA 2PU5A 1C2TA 3KXPA 1FFEA 4CF7A 2EZ4A 4ZO9A 5ER6A 2AQIA 2OYCA 4CKWB 4FHGA 1MGOA 4KO4S 1TUGA 4JB3A 2HCFA 3DWGA 4L22A 3RYCB 3ZBQA 1Y3AA 3IBSA 1PT6A 5E8JA 2YXLA 2R5WA 3CEJA 5KQRA 1T4CB 3HUFA 3B9PA 2V1XA 4Y0VA 4YT4A 4CR6A 3JARB 1QYDA 2R66A 3OQHA 3VPAA 4JUCA 1M54A 1PZEA 2HNBA 3E27A 1V1RB 4FFPA 5HW0A 2QG6A 4GMDA 1K2WA 3EG9B 4J76A 4JBGA 1FDSA 4C08A 3RASA 2IPXA 2C88A 3BWYA 4HRXA 4QARA 2UZ4A 4FFWA 1NW3A 4UZFA 2W2VA 3MSCA 3ASTA 5IVPA 4KN9S 3PZRA 3THYB 3N7UA 1UM9A 1PFVA 2QX4A 4M9RA 3A3NA 1Y1QA 4QDUA 1QG2A 2C2OA 1SKQA 2D2IA 2HHAA 4Q19A 2W6ID 2OHIA 1U2GC 4R2XA 4YJ2B 3WNBA 4CKCA 2D6FA 3KU4A 4CQMA 5KTRA 1R5OA 4FQ8A 3EW9A 2B82A 3VNSA 4LDNA 3WYCA 4IO1A 1OX6A 2IEBA 4N6GA 1E4VA 5LLSA 3FYUC 3ZVNA 1T9KA 2Q6LA 1PDOA 1EI9A 3B2QA 3WAKA 1M83A 1MC5A 4Z6KA 5CFNA 5JOQA 1OIXA 2GCIA 3L5OA 4E09A 1CUEA 2C0PA 1PJ7A 3GEHA 3OC0A 2F3TA 3Q1KA 3H6HA 4LNUB 2QX6A 4PQRA 4XWYA 4AUMA 2FMHA 4E1VA 2V9ZA 5I7FA 4PZDA 4BBZA 5F7JA 1IOVA 4QUAA 3CSSA 4DUGA 2WU0A 5BSHA 1WU8A 3NEAA 2WR8A 4ZRNA 1D6SA 1FLDA 3GRKA 2GBLA 2D3LA 1E0KA 3WSWA 1EFRA 2A1TS 2H1WA 3WO0A 4G0MA 4X1KA 4RANA 1F6BA 1HTTA 1H3FA 2IQIA 3MTGA 3PQ2A 3AYZB 3M49A 4LNHA 2BKAA 4KFRA 4Z9YA 1NG1A 4P98A 5HUHA 3UWDA 3T7CA 3O4RA 1R0XA 4K9OA 2PA3A 5DM1A 3AUKA 1T0UA 1V8PA 3ZN2A 1M2GA 4ZU1X 1E98A 3T7AA 1NBMD 4CMIA 2I6FA 2WP8J 4BEVA 3RARA 4LJRA 1XOIA 2FPUA 1C41A 4RVGA 1W30A 4ODIA 2QMUA 1WW3A 4CIBA 1AZTA 3KOZA 3SQMA 5FR2A 3UMVA 2EX1A 1SCUA 1G9XA 2XAUA 4KPGA 2CXNA 4BNWA 2E6UX 4I50B 3KEGA 3X2FA 4X97A 1L4NA 4FUQA 5EHNA 1ICIA 1ZNQO 1PIWA 3BTUA 3X1DA 3FMFA 4NESA 2P79A 4DXAA 2YL2A 1NBMA 3LQQA 3LSYA 3NTXA 2OCYC 1QZZA 3PNSA 4OGGA 3GDFA 3WJ1A 1WE2A 2JC3A 1RFGE 2ONCA 3DBRA 4Q1EA 4Q1CA 1P75A 4FXUA 1KEUA 2JB9A 1MG5A 4HDSB 4E22A 3TKAA 4ZC1A 1Q1BA 1Y1RA 2JD0A 5GM1A 3TTWA 4EJSA 3UT6A 2F4VB 1OJ7A 1VIDA 1PFYA 2IKSA 4OQLA 4UULA 5DNUA 3ND6A 3NBZC 4AXBA 1QU3A 5I9BA 2Y05A 3WGOA 1O4VA 1FXSA 1NXPA 3ZD9A 1N2CA 3OIUA 4RK7A 3TAHA 1K6EA 3F7NA 1X80B 2QLTA 2FRDC 3OC6A 4MGHA 2VF2A 5EFOA 4BWFB 4YIHA 1N0UA 3CRRA 4WINA 4P4NA 4CKYA 4KQ1A 5IBQA 1Y3HA 5FLKA 3RK4A 3IQZA 4GEGA 2OB1A 2ZJ2A 4RSRA 5J47A 4G0ZA 4JJEA 1YBVA 2XUOA 1L7XA 3C4JA 4KKSA 3GT0A 3PDWA 1C7IA 3KXKA 3GBPA 3LM8A 4MCJA 1ZY2A 3ZDYB 2XNJA 3SCZA 3DLCA 2I91A 2BMFA 3A10A 5T3YA 3DKPA 3PX3A 4W6QA 1A9SA 2QVCA 4H31A 1VB5A 4UHKA 2PH5A 3DEAA 5FPHA 1AKYA 5H8WA 5DXAA 1OWPA 2HIHA 1H2ZA 3FCAA 2OCAA 4UM9B 3R3ZA 4E4RA 3KJNA 1SXIA 1VQ9B 3EVTA 1F0YA 2RHTA 3SPXA 1T2UA 3AKCA 3VDMA 4IZOA 3TLZA 1U3WA 1LPSA 3NLLA 1VHQA 2VAPA 2X4LA 3UW3A 4O6VA 2A5FA 1XCOA 3KUXA 1WB9A 3CKMA 4KIGA 1CLEA 3P0FA 3L8ZA 2XVMA 4J4HA 4YCNA 4OCZA 2ODAA 4RLFA 4BKOA 3UJ3X 1ZQ1A 3VO9A 2I8LA 1ZH0A 2J41A 1N0WA 4A0SA 4MEJA 2RGDA 2VF7A 5EKDA 4EYSA 1ZMBA 4ZCSA 5LU9A 1L2TA 1ZH8A 2PUTA 1WMBA 3M6WA 3P2EA 4RK1A 2P35A 4NQRA 4D8YA 4KRXA 1QQ6A 2FPIA 4F2DA 2CLIB 3VPDA 2CZGA 2ZT8A 1PSWA 3E3AA 1Q9SA 4IJUA 1XZIA 1XZFA 5JW6A 4AVZA 1KQSB 1LNQA 1SRQA 3PICA 4B8WA 5IKPA 1Q0ZA 4X7FA 1M2EA 2Q9BA 3I9V6 4QPDA 2ZTUA 4D1YA 1DG3A 2QLNA 4OKNA 4E2WA 1ICEA 3UQZA 2F8TA 5CVUA 1XEWX 3DMTA 1RPAA 3WHPA 4WKBA 4EABA 4MAAA 3DLPX 4N0MA 5KTOA 5DYWA 3RRMA 5SZIA 3TQSA 5BVHA 2VDRB 2GKSA 1WUKS 2Q46A 1B0AA 3QWHA 1PFKA 3IP3A 5CJJA 4YCLA 3A6FA 2AKYA 2ST1A 4U7DA 2HTEA 2X8LA 3LF1A 5F7OA 1D04A 1UXKA 3IKVA 3PF8A 4RFSB 1ISPA 2PBFA 1Q21A 2W8BB 4ZODA 2G5PA 2M6KA 1XXHE 4DIBA 2R62A 4KG7A 1P1FA 2BKXA 2FEXA 3GT7A 3K72B 3OHPA 5AK5A 5F1PA 1TJ5A 2VN8A 1X80A 3SF0A 3AUFA 4Y2VA 4EG5A 2VT7A 4DA0A 5G3ZA 2EZ8A 2C58A 2H6EA 4I4LA 4RWEA 1WF6A 4MUBA 1GU1A 3RSQA 2ZREA 2WKRA 5KI6A 4QPJC 4EG4A 3A3PA 2DHEA 2WOOA 3FSGA 4OL0A 1Y80A 1ODJA 3LZDA 3ND7A 2J3EA 2VHXA 4A2PA 1C0EA 5A9SB 1TQ2A 1G8JA 4P08A 4DCPA 1NBAA 1GDHA 1AXGA 2PE5A 4DDMA 2XTJA 4TXHA 4R0MA 1JIKA 2IEDA 2DBQA 2QYSA 2WAOA 5B3JC 1G5PA 2D9RA 4QGBA 5DSXA 5FWAA 3UHJA 5IXJA 3HZZA 1SCBA 4BWYA 2BUCA 2FP3A 2R8YA 4KJXA 3HC7A 2C9MA 3RVPA 4ZGQB 1SBCA 2GK4A 2IDMA 5K3DA 2PR7A 1RLIA 2RSLA 1CY0A 1MBZA 1VP9A 4PQYA 3WDSA 1OPRA 4CLRB 3WHIA 3LVQE 1Z2EA 1TU0A 2XTAA 4EUHA 1I2AA 3L04A 4YJ3A 3RPEA 5A3SA 1JBEA 4LXUA 3RFCA 2ARKA 4JLKA 1DKMA 1BQ4A 2CUNA 1XCGB 1N07A 3DMTC 1V3VA 4AJ2A 1QKJA 1J1IA 2HKIA 4JJZA 4ER0A 3ZBTA 4FQ5A 4NMXB 3ZLUA 3KOUA 3A6PC 2IC5A 2Z98A 3KHUA 1UOEA 4LTNA 1O54A 4OQZA 4F1JA 2UXCB 4LFAB 4GLFA 1IM2A 3OFVA 4RW0A 3SIRA 5D84A 4Z4FA 2D0IA 3QKTA 3F6RA 3C3JA 4WDRA 4D9BA 2ZJ1A 4RPLA 3BRCA 4KV7A 2YJ3A 4PHHA 4EA8A 2ZSUA 4RTKA 2VUIB 3VO2A 1OHHD 3E1SA 2V7GA 5IU6A 3ZZNA 1ZRHA 4MW0A 4MV1A 3L1KA 5LQNA 2GA8A 1U9ZA 1RSZA 1VPLA 5EY5B 5F4ZA 2JFOA 3PUYA 1DWOA 4WX2B 4ILEA 4CT5A 1TD1A 1HG0A 4PAQA 4TYMA 2PPVA 4RAOA 4L3OA 5B6IA 1E7MA 1N5DA 4BO6A 1AGPA 2CV1A 3I23A 4RMGA 1SC3A 3BJIC 3DHWC 2IE8A 2J45A 3DVAA 2OHVA 1YJNB 3D8UA 2P2LA 3BFXA 1MO5A 4US1R 3WMGA 4JR2A 1XF1A 4K5QA 3VYRB 2V55B 3HR8A 4C3ZA 3QPWA 3I55B 2QI9C 2PFGA 1A4UA 5F2KA 4KVFA 4TOIA 1IL0A 2Q21A 3FI9A 3HNOA 3TEJA 5IFKA 3G9QA 3DQPA 4LX8A 4U7FA 3RBZA 2VSQA 1J06A 3BQ9A 4KLNA 3VSBA 1TYDE 4RO0A 3AW9A 4DMCA 3MERA 4MVJP 5CB6A 3QWAA 1VXRA 2JIPA 1LSJA 1ECJA 4YDSA 2DYIA 1A5BB 1ESEA 4BZXA 1K3FA 4LXIA 4FLEA 1G20A 1JBKA 2B98A 2P6OA 1I2ZA 2ZWVA 2Q6KA 3EZXA 5G53C 4CQLB 5I7UA 3FNGA 3BAZA 1QG0A 2FI1A 5IH3A 1VG9B 4LC9A 2PZEA 4I19A 4MQLA 2OQVA 1Z74A 5MDHA 3GDWA 5DGDA 4KODA 4ZRMA 3BSYA 5B4VA 4UUOA 4ZOBA 3M1AA 4OVKA 5B1SA 3G2HA 2NSHA 2QJWA 2WM8A 3JD2A 2Z2KA 3LT5A 2CFRA 4YUVA 2P6PA 1YASA 5EWJB 1WUYA 3BH6A 1NI5A 4GBED 3R0QA 5C1BA 2K4MA 3EFBA 2WTBA 4Q37A 3TW8B 3ZE7A 2WB2A 1CRWG 2P40A 1XLWA 1UPUA 4LRUA 3H4TA 4PC1A 2AR7A 2GS9A 1JHOA 2IYFA 3FOCA 4L4SA 5AVOA 4NC9A 5LB4A 3T0IA 2JRLA 3EMKA 1E9BA 3P9NA 3IBYA 2GKOA 2ATIA 3SS8A 4AZTA 4R2MA 3DGFC 4RESA 3JQQA 3ZGNA 1TJ3A 2DWCA 4FCTA 1Z56C 3QI7A 4WJLA 3W5UA 4CN9A 1ZL2A 3C48A 4YDQA 3DZFA 1CUDA 4FYJA 3TFQA 3TX2A 3GEBA 1UP6A 2CHGA 5LMUB 2D13A 2TRSB 3GRPA 3H9EO 4I8XA 2W0MA 3ZY6A 2GCNA 1BE6A 3JAWB 1GY8A 1XJWA 2APJA 2WG2A 1L7NA 1WD5A 3H87A 1TAUA 5IF9A 1EVKA 1F14A 4X6LA 3WVNA 4EHFA 1IQPA 2GFQA 4AG6A 5IYZB 4LOKA 1IY8A 1TEVA 2ES4A 3KVRA 3HDJA 1W87A 4U1RA 3KT0A 1ODTC 1YI8A 2B4AA 5K8UA 5BSGA 2OHFA 3FDJA 5EXTA 1SCAA 4UVIA 1A8IA 1FFDA 1H3EA 3Q6QA 1RJEA 1VKHA 3DYVA 4F60A 4CU5A 3ABQB 5FBKA 5NLLA 4G1FA 1VE9A 4ZCMA 1E6MA 2OZPA 2XE4A 3U3XA 3RYFA 2YY7A 4HYYA 1T29A 1EB9A 5LQCA 1SFRA 3CSUA 1ZWKA 4L2IB 2MU1A 4QYMA 4FOOA 1EXWA 3GEGA 4U9HS 1NDHA 1TMGE 2HLHA 4A36A 1RAGA 3I09A 4EVIA 2MHCA 1JHYA 1YQXA 2GF2A 4IHJA 1XF9A 4WOPA 1SBYA 2BVNA 2Y4NA 4V0RA 4ZVMA 2J67A 4J03A 3DT8A 2WHEA 1RWVA 4PNPA 3NRJA 1JIUA 1K92A 4PYIA 5CCDA 4QTYA 1ZH2A 3FIJA 1W4LA 4BU1A 4EHLA 4BKQA 1MV5A 2QLLA 4QOEA 3CWQA 1KEPA 4J4TA 2C97A 3I01M 3WXMA 1D8TA 1N6HA 3NOXA 3GNSA 2Q2VA 4AN0A 3E61A 3RRJA 3A2MA 1SA0A 3NJ8A 5EJEA 3NIWA 3CUUA 4DL9A 3GPIA 4I7EA 3ZV6A 3FHOA 4URUR 2AJDA 3CUKA 2QXUA 2XMRA 3PPYA 5B55A 1MZVA 1KPGA 1GPUA 3E9DA 3FPHA 4IDEA 5E6RB 2WMDA 1II8A 5P21A 3VTAA 2ZE6A 4PZZA 2PKXA 3NW9A 1DGQA 2I9KA 1Q1AA 1RDFA 2B3TA 2DX7A 1UIMA 1J90A 3BM5A 3LUCA 4XW2A 1BNCA 1JXMA 2Z56A 3IEUA 4K2HA 3A3KA 2NTYC 5PNTA 4OH7A 3U13A 1VRWA 4ICIA 3KKLA 4TXMA 5FF9A 1F8XA 2GJ9A 4EF4A 1L7BA 5HE8A 1F17A 2A5DA 4HQLA 2ZJAA 3GHYA 2PMBA 1PEAA 2HUNA 3WXBA 4AECA 1JDTA 1K28D 1TEZA 4DBZA 1KK0A 3SXUB 1YI0A 3LA8A 3A32A 4R3WA 3S28A 2QJOA 2V6FA 1NXVA 5BWNA 3K1YA 3D7MA 1G8YA 2YHIA 3I56B 4O29A 5TMDA 4TMZA 2WWIA 3ELYA 4J1QA 4A82A 2IDZA 3OAAD 3H5NA 2H1VA 2JIBA 5CFPA 3HXOA 1U0TA 1QG6A 1V16A 1A50B 1Y1LA 4D8TA 1UJCA 3E9MA 3OFSA 5LQMA 2XXAA 1VMAA 4KZPA 4D26A 4X6YA 4DM4A 3CRZA 2IODA 4XLAA 5CYGA 5JAHA 1OQAA 3GT4A 3EYAA 3QBTA 4Q3KA 4FK8A 3MPUA 1VMIA 3LT1A 3IR7A 2QPLA 1KXZA 1DKNA 2GOYA 2I0FA 3A2NA 4PZUA 1O5TA 5HF8A 1VPVA 2P5SA 2R7NA 2ON6A 4YQZA 1NKVA 4AZ0A 1U8CB 4D9KA 2FWMX 3HP1A 5DYGA 2D4HA 4R9NA 2RBKA 3E0XA 2B61A 2FVGA 4NICA 4Q02A 3LZ6A 2VJNA 4BXOA 3K15A 2HJVA 4NBTA 3BXEA 4PHFA 3TRJA 1YGYA 1KSFX 2Z8ZA 1CYEA 4KWEA 5LN1A 1KYIA 4UNRA 1YGPA 5H81A 2GAFA 4RIFA 4TSRA 1EE2A 3F6BX 2X8KA 2WJ4A 5JQWA 5L7TA 2PZKA 4F8YA 4C4YA 2PLRA 1UXHA 5CVVA 3I8SA 2JGNA 3D02A 5A06A 1C7EA 2A9JA 3W34A 4YBRA 2R1ZA 3QIAA 1CY4A 1UPTA 2O54A 4CMBA 1ZFNA 1FNNA 5H70A 3AB7A 5B4TA 3N2ZB 2RGNA 1V7CA 2Z4TA 4MW2A 2LXNA 2X3UA 2QTBA 2I3DA 3S2EA 2CV2A 4XN0A 1OZHA 2EBWA 2EFYA 3H0EA 5I7OA 1UD4A 1VPTA 3X2EA 5HSGA 1ADYA 2YVKA 1UMCA 2DQZA 4R2WA 2P2CA 4FX5A 1S1MA 4MWGA 4MW6A 4UBKA 3SVZA 1QS0B 3AUXA 1XTPA 4IIJB 4CN8A 4L8FA 4L3VA 1XMXA 1THGA 3EH1A 2BBOA 5DHPA 2JAHA 2D74A 3C2QA 4UOEA 3EQ8A 4EARA 4Z2AA 2LDXA 3BWVA 1SXJC 3X1YA 5EKSA 5C7IO 1HFJA 1IHOA 2O3UA 1U3VA 3AONB 4I55F 4O2AA 5KHOC 1T9GS 7ABPA 2QJFA 3FNEA 4KHZA 1FNDA 4G65A 4TLCA 2YJZA 4OB8A 5AVQA 4MWEA 1EBUA 4XMYA 4KYVA 4C2BA 5CB0A 1VLYA 1I10A 1U99A 1Y3CE 1L7EA 1LK0A 1ZD4A 3D4OA 4UTPA 5ALQA 3VZDA 2AFIE 4NBLA 5H82A 4LJAA 3KHTA 1FP4B 1ZI6A 1GAWA 1IM5A 3C1AA 3DMNA 2PBZA 4KE7A 4M54A 4MJ3A 4U9UA 1A7KA 1Y81A 3R6DA 2VP9A 4QVKA 2OVBA 1V0FA 1B93A 3H9CA 3AVVA 1U8FO 2IH2A 3LNNA 3O73A 1SUBA 3AR8A 4C2TA 1U4NA 5KQSA 3OA0A 4EYKA 1YS6A 4JXKA 2PYDA 4TTVA 5TY0A 1ZGGA 4ETMA 4DSOA 4DR6B 2NUPA 3EOBI 4YAWA 2AN5A 5KYUA 4ZI3A 4UJ3A 2F3SA 3PA1A 1YITB 4HWPA 4NAUA 3N8DA 4GKKB 3ONUA 4ACBA 5FXMA 4MRRA 4NG4A 4JEHA 3EIFA 3C7CB 4PO3X 3LQKA 4TRRA 5TARA 3R23A 4C4RA 3OCYA 3GNTA 3ZK8A 3O8QB 5JSQA 1LS1A 3JZDA 5BNFA 5HJ5A 4A6EA 1D3AA 3HU3A 1CUZA 3F67A 3GQBB 4N3CA 4GX0A 1JX6A 4QX6A 5FFNA 1K97A 1TRKA 1XC7A 5B7QA 1TM2A 3HWWA 5T41A 1T6NA 3FTQA 2CDBA 1VHOA 3MBOA 1OLUB 3PX7A 1XP8A 2ZWIA 1F2UB 2Z2YA 3GFBA 3M7IA 2RGNC 3M5PA 2R1VB 5GIPE 4MS1A 4E4YA 3LA6A 2J7KA 1M73E 1DAKA 1T2AA 3MMXA 2BEKA 2AT1A 2FPMA 5FOVA 4ASUA 2O3RA 3RSZA 3S1AB 3OO0A 1FYDA 2JKVA 2Y1DA 3K05A 3SXJA 5FO1A 3FVTA 5E4JA 2I71A 1PSDA 1V16B 3OQMA 1VQPB 3ITEA 3KEQA 2RFLA 5BN3B 1Z0IA 2F62A 5FQOA 3HACA 5J59A 1MH1A 1ADCA 3HM9A 1NASA 3IEPA 3QPBA 5DISB 4CIAA 2YWGA 3O91A 1M1UA 4X64B 1PI3A 4JU8A 3NATA 1CJTC 3IJRA 1UH5A 1N57A 3IAXA 2PV0A 3IRUA 4WESA 1KYQA 4BQOA 2OC9A 3FSJX 5BWCA 4CG3A 5HJ2A 4D8WA 1DJMA 1E5DA 1VE3A 1TYAE 4URHA 2JJMA 3BCSA 4UUPA 3A4IA 2Q9CA 4Q3NA 4R4JA 4IHJB 1TLFA 4ZWNA 1SUFA 4E07A 4OLBA 4QOSA 5KOJA 3KL2A 1YHZA 2H4WA 3PD1A 4KLCA 2X3FA 5FP0A 2HFJA 5IDQA 4PIVA 1T8WA 4QU8A 5J2UA 1XTQA 2SKEA 1SUCA 1YI1A 3STXA 3MLAA 4W5QA 1LQTA 4A9AA 2WK1A 4PR0A 4KRYA 5AR1A 4I9FA 2I2FA 4HUTA 2IRWA 1E1DA 1OI7A 1P9OA 2QAGC 2I7VA 2IYTA 4G6ZA 2QD1A 4KUGA 1L7MA 4U00A 4W8OA 1N32B 4LYAA 4DLUA 4NS4A 4DSTA 2Q7XA 4WZBA 5L6LB 3H99A 5E1OA 3P2JA 3R3XA 4QOIA 2J9YB 2GGSA 2G9VA 3AV0B 3AJDA 3MB5A 3QLVA 4GI2A 3PQ8A 4QXPA 4URXR 3GVIA 4NOJA 4A6PA 2FSSA 5FJIA 4EW2A 1M2KA 1XMIA 2NGRA 3K9NA 4PSCA 2HGSA 2ZZEA 3GH3A 2QN7A 5JEDA 5LNK6 2R6AA 4WCDA 2WFAA 4G8CA 2VYQA 1UQTA 4KXUA 2QSZA 1B0UA 1OTHA 3EUFA 4L9RA 4RKEA 4JGGA 5HXAA 3D6UA 3T6KA 5JC1A 1E69A 5IYWA 4JZKA 4EY5A 1NY6A 1DFHA 2I7CA 3I6IA 4C1BA 1JR3A 5DRTA 5TGZA 1HDZA 4M7PA 1J20A 2AC4A 5EIXA 2Y1WA 4RM3A 3WE7A 1YKFA 1N77A 3T1VA 5J4LA 4BE9A 2WE7A 2NZYA 1A7UA 1DE0A 4BE4A 3L4JA 4WAUA 1ZEJA 2G72A 4COKA 2PUBA 4OGWA 1GSIA 2Q3HA 1QORA 1RQPA 5C34B 1E8NA 2VXYA 1NJ8A 2JG3A 3TW8A 5DP1A 2WQ7A 1X7ZA 1K9SA 1C9MA 2CHUA 3CF0A 4LV8B 4PFQA 4QBTA 3K9HA 5DOVA 4A0QA 4K0KB 4JIMA 4P35A 1QGAA 2Z8YA 3RH0A 3H2HA 1FQWA 3T9CA 1UFQA 3OPMA 1G59A 4H27A 3JWEA 2OV4A 3E03A 3R0XA 2OORC 1QH0A 3BHIA 1GNSA 2XHEA 4N6OA 5B3AA 5BQOA 3RC1A 3MRTA 1NY5A 1SUIA 2VNKA 1VBNA 1XA0A 3H9UA 2Z2XA 2JCGA 5JPCA 1FBNA 1WB5A 1G6OA 4FHCA 3BMOA 4YRGA 1LXCA 3HCOA 4QXMA 3PEWA 4FM9A 2GEJA 4FEGA 1M1YB 4BIMA 1Z16A 3ND5A 2VP0A 4LF9B 2ZUSA 3N6VA 3L18A 2AYXA 3CD6B 2FVXA 4Y1RA 1LS6A 1FTWA 1KPHA 2BF4A 1VL8A 4NIMA 5TNXA 4M8SA 1Y1SA 2UYGA 3MPOA 3I1YA 3ZDEA 4BMXA 4F2PA 3OMLA 5DMXA 1WY5A 1Y6RA 4ILKA 2I6QA 4JOQA 3V4SA 4DLXA 4K6MA 1E5LA 2PD4A 3ZJYA 1YUBA 1Y8QB 2PT5A 1SG0A 3G71B 2GAIA 2OB2A 4D96A 4F2HA 1PX0A 4K6GA 4CLDA 2ZYTX 4LJ5A 2DPYA 2FN7A 2OO5C 1J9GA 1KMQA 1VBMA 2P3SA 2YMPA 5DBEX 3R09A 3NH6A 3RIXA 1J22A 3NT2A 4CQLA 4XOTA 4C7JA 4GKAA 3SEFA 2ETVA 1LJUA 1A5AB 2H1FA 3OLYA 5SY9A 1JV2B 1KU6A 4RHYA 5CGQB 2CNWD 2FZKA 3VR5D 2YJGA 5HMLA 4L75A 3QEJA 4ARSA 3MLEA 2Q9AA 3UBMA 5CURA 4ZJUA 3FGPA 4HEA1 2XRYA 4X65B 3K1JA 4RM0A 4ZKDA 2O6HA 5A04A 1YC5A 5IJ9B 3VR4D 4XM1A 2IHVA 2H2WA 3T1OA 4JLSA 4D4GA 4M37A 4M1TA 4LRXA 4OHMA 3MT8A 3SMVA 4RPIA 2IEIA 2IX9A 3CLTC 1R4AA 4PLYA 2FUEA 1QLJA 1VQ5B 1PR3A 2BMEA 2J48A 2QPOA 2QM7A 2I62A 3OJ0A 4Y2RA 1GIAA 3RG2A 3W90A 1MORA 1U7XA 4HWKA 4G9EA 3RD5A 1JECA 4MUYA 3WBJA 3WR5A 2YWHA 1GL7A 2EFJA 2KHZA 1XELA 3AFMA 3F7MA 3IUNA 4UOQA 3CVYA 3H2JA 4KJZA 3MWEB 4EB6B 1OXTA 3P94A 4EENA 4OUDA 5JAIA 3QV2A 5DNAA 1CUGA 4ALLA 3WISA 3RS5A 3KVYA 2W6JD 4MV6A 3QKWA 1LK7A 2GYUA 2FZLA 3KSDO 3OTIA 4FD3A 4HAWA 4B3SB 2G9ZA 1Y4AE 2HRRA 5IKEA 2EQBA 2ROQA 3HO1A 1ZISA 5KU1A 2ZVDA 5AKZA 1LSOA 1E4YA 1TM7E 3REQA 1U2EA 1HE1C 2D54A 2WHQA 4MRAA 3S2FA 3F96A 5KCZA 4TSKA 2NPOA 3AQ4A 4BLQA 4DPKA 1Z35A 5H68A 1Q0UA 1CZLA 3GVCA 3ELBA 1TOAA 4HD8A 1KFKB 1HNNA 1Y8AA 3PC6A 3PPXA 4NKRA 5IJ9A 1Z0UA 4XGQA 1AUXA 1DIHA 4W9MC 4GX5A 2N3ZA 1MDBA 1OLSA 2EU8A 4V02A 2O20A 2WWTA 1MRSA 5D3ZA 2DWUA 3ESCA 2J46A 1S72B 5KYNA 1D8AA 4RL4A 3KTOA 5T4EA 1JYEA 2YNMD 4GDMA 3TKYA 4CEIB 2EGGA 2VZEA 5LWHA 1XZQA 1ZRSA 4NX2A 4MKFA 2MIIA 3QKIA 4BP8A 3AMVA 2WM3A 1OC4A 2Q8PA 4NK4A 1T24A 9ATCA 4DLKA 1MAAA 3KR9A 1DWPA 4OI4A 3V7YA 3V2HA 4LFBB 1DZ3A 3KQQA 4CKEB 2H5JA 3TBHA 1WTCA 1QDUA 4HF7A 1P4AA 3AGQA 3MZ0A 3SHVA 5JECA 2MYTA 1KVTA 3UUGA 3H86A 3ZIAA 1APBA 1RP1A 2HF2A 3VYVA 1V2HE 1JXOA 1GARA 2QK4A 3L4EA 3MTEA 2VCEA 2X6RA 4G85A 2WHPB 2IHYA 1M6VB 4YP9A 4FKMA 1CJSA 5A5GA 2H54A 5FA5A 3EIOA 5JPIA 4CM1A 3ABOB 1NJSA 4JGIA 4PAOA 1ZK0A 6Q21A 2PZAA 3RUDA 2V7QA 1KAGA 1QJ4A 1NF8A 3NBAA 4XWTA 1KKLA 1XX6A 4PNEA 3GBVA 1KY3A 3K5HA 3DL7A 3THOA 1ONNA 1U0RA 3ZDAA 4Q7JB 4U0JA 1T34A 4JI6B 5C1OA 2VKQA 3O8QA 1M6WA 3HR7A 5T6BA 1YCHA 3HFSA 4KGDA 1C9JA 4TXLA 3O8BA 2IZ1A 5LD2B 1XCJA 5K0LA 5ICSA 3LG2A 2OL4A 3MQFA 3RC9A 4S3MA 4UQPA 2AUMA 3ND9A 4H6PA 4Q6WA 3VZSA 4G5FA 5KYUB 5AJVB 1DADA 1RU3A 3B5IA 2EJTA 1W49A 4YY3B 2Y68A 4BGIA 4MS4A 4MCAA 2Z8YM 3DEKA 1V9LA 4X0CA 2H1LA 3FRIA 4P8RA 3UHOA 3PHIA 3DVLA 2O4CA 2GLUA 5LMNB 4G24A 3V1NA 1GGKA 2W6OA 3KKPA 1IJBA 4H18A 4P80A 3K53A 1KQGA 4V24A 1KDVA 4N48A 4GWLA 3N0VA 1FP4A 1U2DA 2ZJZA 4FXOA 3CM0A 4Q21A 1S3GA 3WIOA 2B1GA 3IHWA 4DRYA 2XY4A 5BV2P 2YYZA 4IKEA 4F4UA 5H9VA 4GIBA 1BVRA 2LWIA 2XGJA 1K08A 4M6WA 5FBRB 3R76A 2ZR9A 5IW8A 5GONB 4MPDA 4N5IX 1E6LA 4CDMA 3CONA 4TT3A 1N5KA 1MPXA 4P7JA 3FAKA 3RIMA 1N8KA 1ORHA 3AJ8A 3CIOA 4HQ6A 4MV7A 5ERXA 3BCDA 4G09A 5D7BA 2BZSA 1SQ0A 2Q5OA 1RAHA 4QREA 2FR8C 3AYXB 4PNZA 1XZJA 5JWHA 3VVMA 2O5RA 3ZCVA 5JATA 4JU9A 1VI2A 4LXYA 4WKPA 1Y33E 4C0JA 1OKKD 1IB6A 2FPSA 4GSKA 3MOSA 4HC4A 4BC1A 3KUUA 2FX3A 2I1QA 4WD3A 4S1PA 5CLHA 1L1FA 4AZ0B 1HI9A 2WHPA 2XGGA 4P4LA 2V58A 4QYSA 3KAQA 4G1VA 2VBIA 1ZOIA 3NNSA 4KIFA 5BWLA 1XKQA 3ZGLA 5JRJA 5JS7A 2B21A 3RO7A 4QBKA 5HZHA 2O5VA 3ZVRA 2ORVA 4UFPA 2BGWA 1IMJA 3Q5DA 1E5QA 3WTCA 3L7JA 3UC5A 4DKXA 1T1JA 3JALB 4LISA 3FNRA 4CF5A 5I9LA 2IY7A 1QX3A 2JK0A 4B4DA 4H16A 4EATA 4YASA 3QYPA 4F5YA 1QSGA 1MPTA 3QHAA 4HAUA 4MI1A 3OKAA 2NMVA 3OOJA 4DJEC 1GPYA 2GD2A 4BX3A 3Q8WA 5CIQA 3TZLA 1U1GA 4QFDA 3PNLA 1P0CA 1Y5NA 2YWRA 3OP4A 3UWPA 2P9HA 4FI3C 4ANFA 1JLRA 4YEJA 1WVMA 4PGFA 2WD7B 4DV4B 2CNWA 1F51E 1XCMA 1PYOA 3H1TA 3WYEA 2A9FA 3V4OA 3FMGA 1RI2A 3QVKA 3DMYA 2BFFA 3WNCA 1Z7WA 3NALA 3RVLA 5IYNA 4E2ZA 1VSBA 1PJZA 2I4LA 4P32A 4XD7A 1CBUA 1WOYA 1A0OA 3J81A 3WOHA 1D1TA 4TKMA 1D4AA 2JGDB 4XOUA 4M83A 1XROA 4H4CA 2PWZA 1WMAA 1BX1A 1ZBQA 4ZMBA 1JFFB 2ZIXB 3SYRA 4E0FA 4PSVA 3U4GA 2FQYA 3L1HA 1RWWA 3FNQA 2WDPA 4DRZA 1N2ZA 4QJBA 3HN6A 4OU4A 4B81A 1YL7A 1Y8RA 4MP3A 3EEFA 1YR8A 3GZJA 3SVLA 2LTAA 3MGGA 3BH0A 2PYZA 2WZDA 4JLBA 4NV0A 3V7FA 5C5IA 1UWKA 5JYDA 1P62B 2PL5A 4BFXA 3CE6A 1IHPA 3GAMA 5AOAA 1TZKA 2SBTA 2ZSKA 2WP0A 1IUKA 3D3EA 3GCZA 1E3DA 3GRAA 4FNMA 1SMKA 2VNHA 1J0XO 1YR2A 2V6MA 1YB5A 2OWDA 2RHJA 3JYPA 3N9IA 3C6XA 3AR6A 5CTJA 1EQAA 2WA1A 5FDFA 1DQYA 3GYGA 2XW6A 1MC8A 4KLAA 5E6RA 1G63A 5BT8A 1ISSA 2GZHA 3BDIA 3IVAA 3LE8A 3PNYA 3QE0A 1QYVA 4G86A 4L27A 3W6NA 3ED1A 3CLSD 3W5DA 4HWGA 1R0KA 1GUFA 1LU9A 3CNQS 3P2KA 4UDOA 3TPCA 5EWLB 2J5RA 4Y0AA 3OQIA 5TXGA 5HZMA 1IN8A 2G9RA 1NNUA 1DU4A 2X2FA 3P0HA 4MQEB 5EKTA 3ZE2B 5J1SB 1V4VA 2CK3D 1Z4OA 1ZYUA 5CB8A 5IEJA 4REOA 3RVQA 2RBGA 3GRYA 4N0QA 2X7XA 1IY1A 4JLOA 3DEFA 2J30A 2DWPA 4G8JA 2CBGA 3IVGA 4K9DA 1SUSA 3DFMA 4ZZ3A 4ER6A 4LZWA 1OI2A 4PR3A 3CVWA 1YH3A 4IKOA 1SEPA 3INRA 4US2R 1LRKA 4EHIA 1MR3F 1OWMA 1L4EA 1NSTA 3PVSA 4JCCA 4JVSB 1Q11A 5EA2A 5FX2A 2VYCA 1TKAA 1HPLA 1OKKA 2XZOA 4OP3A 3RT1A 3SYKA 3TXAA 3C3KA 3GLQA 5IC6A 3WK9A 4P3NA 1ZVJA 4DBLC 2JLVA 3DDHA 3ETGA 1RR6A 4AJKA 1MFZA 1SC1A 3RKSA 3O8DA 2GILA 3I5XA 1I7NA 1U6IA 3JQBC 4IKPA 4RDIA 4PPNA 4AUEA 2PRSA 2WU4A 3QFRA 1RD4A 1ZOPA 2AC7A 1R50A 3SS9X 3IT3A 1GNLA 1U6JA 3MJHA 2AN4A 2LGJA 3OPYB 1BMQA 3G5TA 2QIPA 2O7NA 5DI3B 3OWHA 5FR1A 3T38A 2BELA 3EGIA 3W6PA 1G41A 3CN9A 3ZVKA 4P4SB 3FR7A 3PWKA 5FAXA 2A1UB 5EOVA 4BO9A 3SEJA 4QJ4A 2CLFB 5ABPA 1BHJA 3ZH2A 1NTOA 1U4SA 3BB3A 1N3IA 3NV7A 4LHZA 4LN1A 1P7CA 4EW3A 2P8SA 3HU2A 1LSUA 5DKFA 3E5HA 4EMBA 3IIJA 2CHEA 5DHAA 5ALOA 4XTRA 5KX5A 4MKIA 2ZJ4A 4CMEA 2H65A 3JVIA 1KEVA 2XYQA 2GJAA 2PVPA 1PW5A 2AMFA 4IH9A 3VZBA 4B3JA 1HUQA 2JFHA 1OB0A 1EVLA 4HNTA 1UZAA 3FYTA 4F6RB 3CS3A 1DOHA 3L0YA 3DBLB 4FWBA 1A9TA 3PQ7A 3JD0A 3BILA 2IOHA 3HKBB 4FEEA 3ADCA 1XTJA 2FMTA 1Q1EA 1JB1A 4DQLA 3OKFA 4QVGA 4E5UA 1T5BA 1NMSA 2H4XA 4M0EA 2YBEA 4TWIA 4HLUC 1C30B 1XO1A 3BXGA 2ZXHA 1YFZA 4I1PA 1F8UA 2X8JB 5H59A 4NV3A 2PRYA 1VJSA 3LPMA 3A0RB 3QMPA 1W7AA 1PVVA 2WWRA 2Y4OA 2W4MA 3EEOA 3GLFE 4HDQB 4OPVA 1WVIA 1V37A 3PUXA 3MJEA 5DJ5A 3HO6A 2R7LA 3KE9A 2X8BA 3VSEA 2CC2A 5E6TA 1HT3A 3DOIA 1JF8A 2C54A 2P9ZA 1JUDA 1Y89A 2FPLA 3CWZA 3AP3A 5ALUA 4F5DA 2B0CA 5AIBA 4JDUA 3Q9SA 4PICA 1G5FA 5T5QA 3HLTA 1E4OA 2PSHA 4JB8A 4WMLA 2JS7A 4PV7A 4HX9A 3WGQA 2O2JA 1GXSB 3NU1A 4MJLA 5KBYA 5K8JB 3K8YA 3TIGA 1BKSB 1ZJWA 3ZDBA 5CAEB 1WUTA 2A9VA 1BSVA 2GUGA 3O90A 4RKFA 5EZQA 3LBFA 4BLTA 3JRXA 3USZA 1VCNA 4QHYA 1YACA 2LZ0A 3PFCA 4RXTA 4XYBA 3UXMA 3WLMA 1CHNA 1L7VC 4RPDA 2O57A 4Q9LA 1ZIOA 3CUYA 3MJFA 1J00A 3SMQA 3SLKA 5C8VA 3QOXA 5E6UA 3AVPA 2PRKA 2VP3A 2ZRIA 3I32A 2GA9A 5KCMA 3V32A 2IXBA 4UUQA 3D3KA 3PSAA 3FGZA 1NIPA 1M6VA 2EZTA 3OJXA 4CMEC 1I7SB 2BFWA 2YY6A 4K40A 2BOVA 1M1YE 1CKEA 2J6HA 1RI5A 3M4ZA 1YOVA 3H7IA 4H7KA 4M0UA 3VI4B 4KBFA 4D44A 3U4QA 2X9GA 4CLXA 3DYIA 3OY7A 4I2VA 3L49A 1FU8A 1G21E 1Q0RA 2HWXA 1NA5A 1A7AA 1QCZA 4D0RA 2EC5A 4EGQA 5AXAA 3ISJA 2A5YB 2AG8A 3L01A 4KQCA 2ORYA 4FHZA 1B8UA 2DSNA 5ICEA 2QDXA 2E1RA 1E6CA 1JHVA 2FLWA 2QLMA 2P9TA 3LDFA 3Q39A 2WKWA 1DQSA 1WZIA 4HFNA 3WLPA 2ISQA 4CQMB 4CTJA 4TKUA 2AL7A 4TRNA 4G1UC 4QZVA 1AA6A 3LWBA 5K2OA 4GPZA 4BMSA 3CW8X 2OQ2A 1C8VB 4ZZ2A 1WXFA 3GJ7A 3ZPNA 1EFUA 1FTGA 1W88A 4LXGA 5BSUA 2BLNA 2JLXA 1XT6A 2E89A 2YFHA 3CNNA 1AJEA 1Q7GA 5FWYA 4LG1A 4WEOA 5LIRA 2IBTA 5HKBA 1PJ8A 3CLVA 3CV3A 4HEA6 1IVYA 3DDOA 3MOIA 5ARCA 3CXCB 3C8MA 2XWSA 2ZSJA 2XMPA 3C6QA 3H2IA 3M34A 1XTKA 2EIHA 1TU3A 4U6NA 4HXEB 4N49A 3UHFA 3BE8A 5ITSA 4NYMQ 3D3NA 3O3OB 3PCXA 4ZI2A 1B6RA 4KWHA 1C3LA 2CKDA 1PV4A 4GP6A 4EJFA 4K88A 1Y7TA 2B92A 3UMRA 5HPYB 2WWWA 4GHWA 4PVCA 4MYUA 1II9A 1T2NA 3DSRA 2E49A 4LJ6A 4NCXA 2YQ5A 2PSJA 4OFXA 3WJ2A 2RHWA 4B47A 5IDWA 5JBIA 3EVAA 3U60B 1Z08A 1DEKA 2NUAB 3I0NA 3QVWA 3SZ3A 4EB6A 3E23A 1RJFA 2XGSA 4PZYA 4BVGA 1NLMA 1OU4A 3I45A 3PYMA 1X8LA 4LMPA 4ZANA 2ZIUB 3T4XA 2ID4A 1GTSA 2QRPA 3N8IA 4FNOA 1RBMA 5KW9A 1Z2AA 2H63A 1ZIXA 3EB9A 2OQIA 3MJ4A 3CEPB 2R11A 4JJGA 1I5EA 1U9IC 4JVMA 2P9FA 2IPOA 5EJ7A 2P9YA 3DOFA 2NXJA 5AW8A 3V1KA 4A8TA 3DEZA 4EGJA 5CT6A 1QFYA 4YN3A 2IYVA 1H2AS 4P25A 1SVSA 2E7ZA 3GMSA 3M81A 3NR2A 4G0OA 3WJ7A 4EKDA 5L7WA 2C31A 1EP3B 3ZQUA 2VNSA 3VOTA 2QX9A 3ONYA 2YIVX 4Y9TA 5B2EA 2ZOSA 1UMBA 1T9HA 3EMBA 1YOVB 4XJVA 4LOLA 2HK6A 2A94A 3WGTA 4UPEA 5JCJD 3TTUA 2DU8A 3IUBA 3ZQ6A 2CLEB 4MIYA 1Z06A 1W2WB 1UC5B 2A3RA 3EOZA 3H5LA 1HL7A 4NPAA 4A2CA 1L8OA 2WG0A 3C97A 2XPCA 5FBHA 4BKRA 1OGIA 4ZTUB 1WG8A 3HBFA 1CJKC 1DC3A 3M4JA 1UXJA 4X91A 1UC9A 5AKJA 5AKIA 5TSDA 4TN1A 2C92A 3MBIA 3PX2A 3L7DA 2H3EA 4BMNA 1JJFA 1HDCA 1UKEA 3ZY4A 4G0VA 3G02A 3GG9A 1US8B 1VXOA 4CKBB 1EM8B 2W6ZA 4JEMA 2QR2A 5C3UA 5FOWA 4B73A 5HNKA 1LFAA 2XZPA 4LDZA 1P5RA 1WHSA 3EZNA 4LMBA 4FSHA 2IH4A 3WMEA 4YAGA 3RTGA 3G59A 1SU8A 1GZ5A 3AETA 5EPUA 1SKAA 1C9DB 5ALWA 2A0WA 4WL0A 3EZGA 3D6AA 2G09A 3K1TA 1FU7A 1I36A 4QFBA 5G41A 4CF6A 2PUGA 4OA8A 2JANA 5JS1A 2GD1O 2GBPA 4OHWA 1QH1A 5EERA 3ORSA 5DCLA 1AZSC 3DC7A 4PLZA 3V5NA 2W9XA 3GC6A 3ZWQA 3GRCA 3H8SA 1IXZA 4GUDA 4QBIA 4U6SA 1AY0A 5I7WA 4WFIA 1PL7A 3D7LA 2QRJA 1KZ4A 3OOYA 4DABA 4DMLA 1YZLA 2JASA 5ALFA 2QR3A 2I2BA 3O92A 2FZVA 2YNMC 4A6DA 3M6XA 4N01A 3QUBA 4P53A 2XB2A 5CDYA 1FSGA 1I4DD 3OT1B 3KFLA 3PA8A 3P96A 3VDNB 4DB4A 4YMVA 3G9XA 4LGCA 4YJGB 1RE1A 4FSDA 3P9KA 4GGPA 1AQ6A 5T4BA 3VISA 4NNJA 1NT4A 4GYJA 4YECA 3DTVD 1LBIA 4YHBA 1GL6A 2ZW9A 2RHCA 3BF7A 3HLKA 3RJTA 1NR5A 3VR1A 4EI9A 3ZR4B 5JCZA 1M9NA 3E84A 3L77A 1NMEA 3QXXA 4B2LA 1WEKA 3LQRA 3NUGA 3AHEA 3M9XA 5JNTA 4FE3A 1IWPB 1KZ6A 1Z15A 1W76A 2AN1A 1Y7PA 4NY1A 1YVEI 4XR4A 3TUJC 4A4DA 4IMPA 1M67A 2C8LA 3K92A 5CP8A 4I3FA 5KX5F 1VGVA 3TOZA 3P19A 3IMKA 1JSZA 3YASA 1TRHA 4P38A 5CNMA 1QH1B 2X0KA 2IP1A 4AN4A 2ADOA 1YQ9A 4LS3A 3ZWNA 4Z7JA 5FFFA 3CLSC 1U02A 1TEHA 3CZMA 4ENVA 3L92A 1XPOA 2WTMA 1Z4KA 1V45E 2X1LA 3IPRA 4E2YA 2QTRA 1A9QA 2IYZA 4DREA 4Q18A 2H16A 4QRDA 3FH0A 3HKEB 5E6SB 2C1XA 3S4YA 1NVWQ 4FGUA 4FFBA 1AK9A 1K5PA 4NATA 5JNUA 1DXHA 5EUBA 3M82A 2GYYA 4GC9A 2ZRDA 2F1MA 5FQNA 1XVAA 3INYA 5AWFC 3VRHA 3VJRA 3RWBA 2VHCA 1AUQA 4BB0A 4DWJA 3BMNA 3KQUA 2W71A 3TGPA 3IOEA 1PT7A 3OQ1A 2CDAA 5ERYA 5G02A 4ALMA 1PDWA 3QY0A 1FJXA 5JROA 1OH6A 4NDZA 3BA1A 2QPAA 2PMKA 4MH0R 5KYYB 4U63A 1XZCA 3EVEA 4HAVA 3BA6A 4D4LA 4RIGA 1GT91 1ZL0A 2NU6A 2XB4A 1OXXK 3QBDA 2OORA 5JZMA 1KK3A 1N5JA 4CM3A 3I92A 4X93A 4U8GA 2ZBVA 1CVIA 2CHFA 3MWDB 3A1NA 1VGQA 3G1TA 1CIJA 3QVLA 4PW0A 5DK4A 4R7TA 3GIDA 4WESB 3K16A 4ZQCB 2NU6B 1UR5A 1PZNA 4K26A 2NN3C 3KPYA 4R1SA 2QY9A 1GP2A 3MS2A 4XYGA 1SOMA 4KO2S 4OXXA 3TX6A 3OFKA 2R6CA 3MQ2A 3AF1A 1F0KA 4R71A 2FSGA 4IOKA 4HWSA 2NXCA 1ISMA 1CUBA 1JEAA 3OECA 1H5QA 4HWOA 1BFDA 2WE8A 3PFWO 2AXEA 1X7XB 3F9IA 1FSSA 2Q3BA 3PHBE 4WCFA 3SSAA 9MHTA 3PQEA 5K45A 4FFVA 2ZAYA 2QHXA 3FPLA 1UXGA 2JEZA 3BD6A 3Q3CA 5HA5A 4EGAA 4QBFA 2N75A 4GT1A 2QENA 4TM8A 4EQZA 4LF7B 1JFSA 1ZI9A 1HGXA 2FW6A 2OCKA 3M6MD 4IMJB 1AX9A 2MYNA 5BN4B 2MSDB 6ADHA 2IOFA 2RCYA 1T2DA 4JHXA 1HE5A 4H1VA 3IQWA 2J8ZA 2PNFA 3C4QA 4PPYA 1OLUA 1P72A 3GMDA 3N3AC 3NWBA 4NJOA 4C29A 2GEVA 4DG8A 5EE0A 2QN1A 2ISSD 3AINA 3LKBA 2BFFB 3PB3A 1D9XA 2LRHA 3QVGB 4LRWA 5E6SA 3RSSA 2CXUA 3WQBA 4NCJA 3K9FC 3WGIA 3TJZA 2C5GA 2FR8A 4MYSA 2HSWA 3H1EA 1Z8FA 4W99A 1I1QB 4C0AC 5MGNA 1UP4A 3X43A 3EVCA 1EUCB 4HL6A 2I4OA 4PYOA 1SZPA 1R16A 2Q6VA 3H42B 1NLZA 3PJGA 3S3TA 2Q3JA 3QJGA 4HNVA 4BVJA 4XONA 1AKRA 5E0OA 2VHJA 1D2EA 1G8KA 1W9HA 1YRHA 1F9EA 1AIPA 4F4JA 4E46A 4X44A 4X06A 1W5TA 2GBCA 2DFKB 4IH1A 3FOFC 3ZCRA 2AN9A 2CCKA 4H08A 5B1HA 4BATA 1SHLA 4FFRA 1VTKA 4N65A 1VQ1A 5LXTB 5FYDA 1QK4A 4AWAA 4BKPA 4PN3A 2H1OA 3E1YE 1WB6A 4NBNA 1UK6A 3PUZA 4YFVA 1RYEA 2ZQYA 3N74A 4XPIA 1YFLA 1HQKA 3OEYA 2BY4A 2GRAA 4O63O 1DTWA 2BRUC 5TQ0B 1EWQA 1GUAA 3J81k 1S9HA 3IP7A 2PLNA 2BMWA 2KWIA 2X8JA 2ZIWB 1W9XA 4L9AA 5F5NA 5T4FA 3RIYA 3HJFA 2XYRA 2HMAA 1XZ8A 4LWOA 4K05A 4PX5A 1AS3A 3QNMA 5EMLA 1PWHA 3FUWA 1JI3A 1NYTA 2F3PA 2M1XA 3IT0A 5FPKA 3RVDA 1SD5A 5SZKB 3A37A 2WHXA 4MLCA 1KMHB 4EMTA 3T53B 3OQJA 2WYHA 3UA4A 2XVZA 1Y6FA 1LY1A 2EX4A 4EVRA 2EGHA 1ETUA 5HS6A 2R85A 1ZZGA 2ZSAA 1NN5A 3U7EB 4K7JA 1X94A 3K5IA 1NM5A 2C2WA 2JCYA 3OHMA 3PITA 5EG5A 3RBAA 4OSPA 3D6TB 4WZBE 2WW8A 3DUFB 1H2RS 1HSZA 1V4BA 2YDYA 1O6FA 1Y3BE 1ZJ5A 3HUTA 5ENZA 1W4CA 5DRYA 3IESA 3Q1LA 4GPAA 4UAUA 4M49A 5AW5A 5KTNA 1KHHA 2OSBA 4UDNA 1PTJA 3B1YA 5ESWA 4TVBA 4LVCA 1PRYA 2WUEA 4HZUA 3L8DA 4KKUA 3EF1A 1GZ4A 2WIKA 1D2NA 1SHTX 1RP7A 2HWWA 3FLBA 3FHJA 3GVKA 5IC4A 1V5GA 4H60A 1PKEA 1PJRA 3ML1A 4Q6BA 3ZWPA 1XD2B 4MEAA 1UKYA 4JOCA 3W2TA 4YJ3B 2AW5A 1XDUA 3OM0A 3LLVA 1KAHA 2A59A 5BSKA 3DCJA 2ADMA 1J0EA 3BE6A 1J5XA 4XWWA 4LZZA 5C18A 3FE2A 2WJAA 2B8JA 4NABA 4Z54A 4FQ7A 3ANNA 3HJHA 4MUMA 2CNKA 3F9RA 1YS1X 3VSDA 1KVQA 4ZICA 1M5RA 1S8AA 4QE3A 3ELUA 3IVRA 1JIXA 4N4AA 3VR5A 4BUJA 1MRNA 3G5UA 1PR9A 1GZVA 2ECFA 4D92A 3V2UA 1MC4A 4JLDA 3CLKA 3MTAA 4J7UA 2FFQA 2J07A 3BTOA 3KVVA 4YGYA 2IA5A 2OCDA 3COPA 4EFDA 1VC2A 2C4TA 1G5RA 4HYEA 4KXFB 5B53A 3NBXX 4O4HB 5C4IA 3C3WA 3URMA 5LOVA 1JNYA 5ITZB 3RUIA 3MHPA 1EVYA 3CX3A 4HPJB 4OGLA 1ZNXA 3TECE 3VGPA 4WY5A 4NONA 1KI3A 2W4QA 3OOEA 4RJIA 1ML4A 1DBSA 1C9KA 1MB9A 5DH9A 4AVYA 2JFFA 4ND7A 3SJCA 2HK8A 3STWA 4Q3LA 3WAGA 3SNKA 3TRFA 2NYAA 1WLSA 1Z2DA 3D4NA 3WIEA 1NYLA 2EBUA 4B6OA 5C81A 2JAPA 3LL4A 4MGYR 3PR3A 1MX9A 3BE5A 1QTIA 5ALNA 1QBGA 1M72A 2ZYUX 4MRMB 5C5EA 2GXQA 3IERA 1SIOA 2P6RA 3IVCA 2AX3A 5KSYA 1EX6A 5HKKD 2ZJ3A 1STOA 1KC3A 3ZHUA 1CU1A 1GADO 2YRXA 2ZB4A 1XHEA 3HKDA 5CFOA 3UFBA 1Y4UA 4H3HB 1CZHA 4LJLA 4B6GA 3V00A 5CU7A 4HWRA 4QXRA 5HCNA 1V25A 1JAZA 2AJBA 4WJKB 3TEFA 2ACWA 2I3ZA 4C4XA 3TCXB 4EVSA 1SM4A 1F1BA 1DPGA 3B1VA 4E6EA 1WEHA 5CLLA 3V6LA 3VPXA 1FF9A 4FR2A 1R0YA 4EHBA 4F04A 1Q0HA 1VDMA 4E21A 1NKSA 5KYGA 5J3JA 4D9EA 3CFYA 2ILTA 4DDWA 1OA0A 1JPNA 1Q1GA 2PT9A 3THXB 1VHWA 2PKQP 3FMPB 1QZUA 3HY6A 1TM5E 3LCVB 1T3TA 4Y9SA 3DTTA 3TL2A 1E2GA 4K9LA 4MVJA 2R8OA 4KEAA 1ZONA 4O2BA 4PRKA 1WOOA 1XK6A 2MINB 4R98A 4MDHA 3UPDA 3SICE 2UYOA 4CKCB 4NPHA 3RIHA 2NIPA 1G5QA 4BCCA 3JQBA 4YMLA 1WZ2A 5KNDA 1O9GA 2H52A 4QEDA 2VJKA 3TWOA 5JRZA 1NUPA 1UBMS 3A36A 3ID6C 4GI5A 5EUMA 1A76A 5HEKA 1T3SA 2B4TO 2IYNA 1FW6A 4KGXA 3WYAA 4C0SA 1R8QA 3FNBA 3H1BA 4ZYUA 1UQUA 3WLAA 1USUA 1T4GA 2ZG6A 3A4YA 3RUCA 4X62B 1CF4A 2A1IA 4BLOA 1PKXA 3HYCA 4KR3A 1CFZA 5SZJA 3SZUA 1L4LA 4P7KA 4R01A 4YUXA 1M7HA 1RYMA 4UUMA 1SVWA 3CH5A 1AN0A 4ZYWA 4QG3A 2IDKA 1SBIA 2QX7A 1SXJE 5KVVA 4FYIA 5A5EA 3AM5A 5DULA 4TROA 1Y9AA 3UK0A 1YVPA 4UHBA 2YWCA 1KY2A 2QRLA 4N7JA 2F1JA 3OFJA 1G3QA 1KO1A 1VJDA 2W6CX 4YP0A 4BP9A 4ESVA 2C57A 1P6XA 1VSVA 1G7SA 3V1MA 3ZI7A 3FWHA 3CVOA 3A11A 1Z8DA 2P6UA 3C74A 1KFJB 1VYHA 5DEIA 3DAPA 3LWDA 4IV5A 2VQSA 2D1FA 2YS7A 5CITA 5BNTA 3LQYA 1SOAA 3SJAA 1IZ9A 1RLUA 4IDBA 4BRUA 4F97A 4PYJA 2HA7A 2B1JA 5B57C 2XXBA 2BPOA 1TE2A 3LHFA 4PGMA 4MSUA 5AKYA 4J2HA 2ZJFA 5K01A 4EZIA 2SCUB 4WE3A 1ZJJA 2B36A 3OJOA 4MRPA 5FUXA 3B85A 5ITWA 5CH3A 4Q7QA 4RVHA 4A92A 1UINA 4RTMA 1RWPA 5ICFA 1P7PA 5K0BA 1IK4A 4MOWA 3TRIA 421PA 1G5IA 2CDRA 3CT6A 3DOUA 3FFTA 4NBKA 3H9BA 2XVYA 3IAHA 5LP6A 1TCVA 3MTBA 4FYYA 4M22A 4CYMA 2JEYA 3A9RA 3CF2A 1LW7A 1BZYA 2E82A 1NRIA 3LLMA 4AQDA 3Q9UA 2DAPA 2VA9A 4MR8B 4ZFNA 4X7CA 1H85A 3I1IA 3H6GA 2OFFA 4BWVA 4D4MA 1O58A 3T1HB 1WPRA 3OEED 2YQZA 4NXMB 4FFDA 3Q2KA 1R4MB 2ZRJA 4CTOA 3ESBA 3H1AA 3H83A 1YZYA 3WNQA 4IDHA 5B12A 3GZNA 4Q4AA 3ICPA 4M6WB 4F71A 1SCDA 4EO9A 4F2WA 2AGVA 2C2GA 5KVAA 4TMTA 5DZSA 4N7RA 4HPXB 4I1RA 4UBIA 3PDIA 5F77A 4R54A 5JQGB 5HKLA 3ZV7A 4UVEA 4JYZA 4Y6QA 1DQZA 1OZAA 1VQ7B 1WHSB 2O2IA 2QAJA 2J32A 2VJMB 2FG7C 3P0RA 1HZZA 5E8RA 3CCUB 1OGJA 4NU0A 3EBOA 4KXLA 1RPTA 3AESA 2DQ4A 1Z2CA 2Q1TA 4XVHA 4ZOLB 2BMJA 2QUBA 2O8CA 4KUHA 4YALA 3GCDA 3HSYA 3I39X 3BGVA 3K8OE 1A9XB 5FWDA 2J3JA 3R0VA 4X07A 4U2BA 5CT9A 5TGDA 1JPUA 1GLGA 2F1KA 3PXUA 5JCOC 4D42A 2PX5A 3ZLVA 3E81A 2EX0A 4HGOA 3HL4A 4B3HA 4DR4B 2WOJA 1R4NA 1CUHA 3JQAB 3H2GA 4LY3A 2LW7A 1KO7A 3P4XA 4YRQA 5FA8A 2J33A 4KXYA 3ICQB 4K3UA 1XNGA 2ZAMA 1HLGA 1YQUA 4I4TB 4UMFA 4KQHA 1K75A 3U1TA 4EK9A 2QZSA 2AV6A 1Y0BA 1AKQA 3LT4A 5BN5A 4MXDA 1GQYA 2OG1A 3DVSX 4JL6A 1QIDA 3WGJA 3TVYA 2OV8A 3NT4A 1P3DA 4ZGWA 3DXXA 3THYA 2KLHA 1C1DB 4XH9B 1JYFA 1U0OC 2G40A 4UZSA 2IF2A 3OJCA 1HX7A 2BP7A 3D3JA 2E3JA 2VDKB 3CNBA 2IOYA 1X8XA 3Q88A 4PLVA 4KE6A 4LBZA 2VZ9A 4R40A 5J4VA 1K06A 3TOCA 4WASA 5JDIC 4QPPA 5DB4A 1PDVA 2E37A 4WK2B 3CB2A 2A0YA 3E3LA 1WBDA 5LUBA 4AURA 4S24A 3ZCPA 4RPHA 4JI8B 1WCIB 2J3HA 2IEGA 3ZS9A 2FW9A 2VJPA 3AEKB 4G1CA 4GKJB 3FAZA 3MIIA 5CFMA 2DH6A 2KS6A 1ZN9A 3NOOA 4HQKA 1QIKA 3L84A 3AF5A 3I3SR 5TDHA 5F73A 4DCNA 4GU5A 2XT6A 1RWXA 5IZCA 2V7WA 3L8CA 1NWHA 2OXTA 3TFWA 2QAGA 5BR8B 3W4JA 2A6PA 4ZI5A 5BWMA 3WLKX 5ALMA 2HBQA 2EZ9A 1UKBA 1TL7C 3G6KA 4NFSA 2YJ6A 1EG2A 1NW9B 4FU0A 3LKZA 3K0FA 4ZJYA 5KJEA 3U5ZB 1C1DA 1VSQA 2JLCA 3ZWVA 3GXOA 5ECGC 2PUJA 2IS1A 4UQOA 3PC3A 1DFIA 3VBCA 5HFNA 3RAEC 4RZHA 3T1TA 1CUVA 2GFHA 3IXQA 3B38A 3GJRA 3RTBA 3S99A 1XE1A 5FOQA 5KSOA 4FW8A 4LUCA 4J7AA 3PKZA 4G5OA 3K73O 3RTAA 4JBNA 4C0HA 1E9AA 4ZT6A 3MJRA 1EP2B 2JAOA 2JGRA 3JQAA 4XUEA 1YZHA 2Z30A 1RABA 1VIMA 1BMDA 2EJBA 1L6RA 2YWFA 1E79D 1YDWA 4QYIB 1R6BX 3FF4A 3NORA 4YELA 1E1KA 1P74A 1DT3A 3KBOA 5JZBA 2OESA 4F7WA 3WRWA 1B7GO 2JFYA 4YT8A 2C42A 1CQJB 3PFGA 2PGLA 5JFGA 3U3MA 4PLCA 1R0LA 2ATCA 4L72A 4PRLA 4KPUB 4YRFA 1RYBA 2OBBA 3GSIA 2D7JA 2H2HA 3TLCA 2NV0A 1EBFA 5JLAA 1KAOA 5LZ7A 2HA3A 3Q72A 4KYIB 1DEXA 1R1DA 2QGZA 3AEYA 3GGDA 4AU1A 4FTWA 3HXQA 5DEOA 1ZA1A 3HCEA 3L7OA 4ZVQA 5HTOA 3R3YA 2ZCUA 2CVFA 4WVFA 3CF4G 5ELLA 2NZ2A 1XVTA 2QG9A 1P4MA 2KI5A 2ZFUA 4HLCA 1V96A 1X7DA 1UIRA 1BO6A 5HXBA 1SHKA 2H59A 3NHLA 2PQMA 3LQ1A 4IGIA 4RA6B 4URVR 1XZGA 3G2MA 3FTCA 4XASA 4AO8A 2VOJA 3AY0A 5HJ7A 3BVPA 3KXLA 4YRBA 3DEHA 2FMFA 2HJRA 3QOWA 3BXOA 2J7PD 1E2KA 4YLEA 5CEFA 3DAOA 4LZAA 1FTQA 4QVJA 4O2AF 4RJ2A 4K9SA 4KO8A 1X1TA 3U4IA 2CL0X 4BJHB 5BR7A 2HEIA 4F9GA 4L4RA 4LGYA 3F6CA 1YO6A 2ZUFA 2ZB7A 4JUFA 1N6NA 2O7VA 1G4HA 1LUAA 2A9OA 1KE1A 3DV0A 4BU0A 1PNVA 2OBLA 3QE2A 2O23A 5T8KC 4BAGA 2ALJA 3KE8A 4D9FA 2NX2A 4CTMA 4MUGA 2JCXA 3F8TA 4TVSA 1SO8A 3DBLA 4HQOA 1GR1A 1ZKMA 1JR4A 4Z7QB 5LQUA 3RJ9A 1MT0A 3JAKA 4P12A 1MP0A 4BFWA 3MUFA 1X77A 4NZMA 5C1PA 1UEJA 1B74A 1Q74A 1W5AA 2TMGA 2W43A 3MWLA 4AUKA 2X9QA 2JFGA 2R00C 2ZIGA 3N3BC 4DCOA 4JEIA 2N1MA 2FEKA 3HCFA 3JX9A 3GFQA 1J49A 2JI4A 2G06A 1RC1A 3L4BA 4LJ4A 2IIPA 2IWRA 1FVXA 1M90D 1NMYA 2WIFA 4IIXA 1ZK2A 3R5KA 4OI2A 3LUPA 5FOTA 2Y76A 1NW6A 1XZHA 5I8PA 1RJ9B 5JYBA 3PTAA 2Z6UA 2GHQA 1JL3A 4MKGA 4QU5A 2KBEA 4EPXA 2G08A 4P4SA 5TPZD 2A9KA 2RIRA 3VR6D 4CF4A 5DNVA 1DAHA 1HF3A 1FDIA 4B43A 2OKCA 3D9QX 4WZBB 4Z9XA 5E9QA 2JKYA 3MILA 3PK0A 4FDAA 2I2DA 4Y98A 2BWJA 2ZPTX 3LT2A 3OZDA 4LOAA 5A3RA 1NQAO 1WPCA 2ORED 5EEHA 5JG7A 4FGKA 4X9XA 5FEMA 3A4TA 1N0IA 5IJXA 1G55A 1UWLA 3W6OA 4RDJA 3O3CA 2I4TA 3KSZO 3VC7A 2MJLA 5KEIA 1RE0A 5M04A 3A14A 3GFPA 4BNZA 3KKMA 1TTTA 3TUZC 1J2UA 2XODA 3EHEA 4OGFA 1PGPA 5FBZA 4B84A 1OH8A 2FOLA 4KSYA 3MWDA 5HYVA 1XNQB 4D5GA 4K0RA 4UUNA 3WY9A 1OLOA 1ZMXA 3BXFA 4RLQA 3N58A 2DPMA 3EFOA 4XDHA 1RKBA 3T7RA 1OAOA 3T95A 2WY2D 4ER3A 2P7IA 4PYNA 5KYYA 4NLLA 3I9NA 4IHJF 1OH7A 3O3NB 5B30A 4XKWA 1BU5A 2W8BA 1NQWA 4LGMA 3THXA 2BHSA 2F67A 3N59A 1U0EA 3RTEA 3TTYA 1G3IA 4B9AA 3TBFA 2R6JA 4LW8A 3MN1A 3N2KB 3H5AA 1D2RA 3UT0A 2X2EA 1EB8A 1TIPA 2IOFK 1JSLA 2PS3A 1SA0B 2Z8XA 1MUUA 2JJ1A 1MW9X 4XUDA 3IQHX 1VRVA 1U7OA 3E9CA 3QIVA 2CNOA 3X1MA 1NVTA 2ENWA 1QLWA 3GUCA 4Y2HA 4CI0B 5GJBA 3L40A 3BGDA 5FKJA 3EGDB 4L2IA 3JCZA 1X13A 5TQVA 1V5FA 4QAJA 3GL9A 3I04M 2EKPA 4DA6A 2XBUA 3P9YA 1GKIA 1HV8A 1U0HC 3ENVA 3OCXA 2NZUG 3EGOA 4Q03A 1Q7CA 2Z1DA 4IUCS 4TT8A 3LP5A 1CY8A 2GTHA 5C3MA 4EA9A 1T3ZA 1PZHA 4DBVO 3GVJA 2VRWA 4M9SA 1DSSG 1UADA 4JCOA 1WIWA 4N0EA 1SZCA 4FW9A 1M1XB 3AFOA 4J2OA 1SC9A 5A8AA 1H8ED 2AW3A 2RB5A 1BVYF 3ZWKA 5JAPA 2BFBA 3G0HA 1KDOA 1RWQA 3NBUA 2QZZA 4LJ9A 3LUAA 3WYGA 3M1LA 1YCDA 3SC3A 3RYCA 3DA8A 2VUUA 3NWJA 4BO5A 5HS4A 3OF2A 5C53B 4RPKA 3UCFA 5CYFA 5HE9A 3WKCA 2HDHA 1FCJA 2F90A 2RHHA 3D2BA 4J29A 5D8DA 3G7NA 2OC4A 3V1TC 2ZS9A 1JPVA 5JY6A 1MHTA 1T8RA 3PPIA 1JEDA 5IC5A 5BUSA 2X14A 2V59A 2YICA 4RCYA 1TCCA 4Q1VA 1Z07A 3ZHXA 2GM4A 5EQJB 3ADPA 2FRVA 2NUBA 4K9MA 3CCVB 3TBKA 1KHTA 5BQXA 3DD5A 3WL6A 2CK3A 2XGMA 3HY3A 1YDGA 2DOKA 3OVMA 4IOLA 4L0DA 5U9CA 4LF4B 1ZR2A 1DDGA 2QVZX 1XEAA 1NX9A 2AXPA 3VC1A 3AGPA 2ZATA 3HG7A 5DLPA 4D4KA 5AVVA 3CKLA 4JMLA 1P18A 1T0PA 4TZKA 4INJA 2JFUA 4I9NA 2PN1A 5L3SA 4A26A 1BWQA 1JHUA 1Q17A 2HEGA 1QVRA 4DA7A 3NXKA 2YYAA 2YOFA 3IURA 4CFYA 1JDBB 2VSXA 3C4VA 2BFNA 4C4TA 4PAMA 4MR8A 1VRCA 3RKUA 1F1JA 5KJCA 4NECA 3PGXA 2GM3A 1ABBA 3OPOA 3OICA 4XSVA 4HLDA 1LSSA 2W6PA 4UZUA 3M3HA 3MOGA 1BEUB 1LF5A 5JQGF 1NVKA 3EC7A 5EWJA 3ZVLA 2VDOB 2Q0SA 1QQTA 3PXXA 4CM7A 3KDAA 2WSLA 5AN9A 1N8NA 4J7XA 2X7HA 3ED5A 4CCWA 4EGFA 2H1RA 3PJRA 3OURA 1QZXA 3AXSA 3ROQA 2V7XA 3PQ5A 1AKNA 4HADA 4IS3A 2QN2A 5K8CA 5CT4A 1OXUA 3OQBA 4YCAA 4EPYA 4O4LB 5IN4A 5AI5A 4R9VA 3FWYA 4LPKA 3H1PA 4V2IA 3RV3A 1E2PA 5F98A 1YIJB 1Z73A 1YHYA 2HL6A 2ZE5A 3FDZA 1QAMA 3VU3A 4K46A 1P1KA 2VK1A 3OEHA 4R1NA 1PEYA 2XMDA 3ZXIA 1J25A 1FMFA 3BD7A 4D3ZA 2H9IA 1L7PA 4ZCIA 1F5NA 4HRAA 3IILA 5K3FA 2PR2A 4H1WA 2AI1A 4MV9A 1U0NA 3TZHA 3H4MA 4FIDA 4UAGA 4AF8A 1QG4A 5AOCA 3LK6A 1Q7YD 3LI2A 4JB2A 1VJ5A 1JEYA 1ECPA 2MR5A 4II7A 4PRZA 1UDBA 1QP7A 4JMPA 3FDFA 1TGVA 4QNRA 1QE5A 4BE7B 4LV5B 4IJWA 3DGEC 2XUIA 1U8AA 2BDTA 3ZTTA 4QLAA 3WO1A 3GPLA 3NKFA 1W35A 4TWJA 2R1TB 5K03A 2RGBA 2O7RA 3WYDA 3PIIA 3EXG2 5K0NA 4YJ3F 3QTLA 4IY1A 4HAYA 2VDVE 5THQA 4KPFC 1XN1A 3T1YB 1PK9A 3BKXA 2Z09A 4DQUA 2RAUA 1HDIA 9LDBA 1CQWA 3KSMA 1SQFA 5BSWA 2C9OA 2I29A 3I9FA 4DLNA 4WPGA 5E7IA 4AS2A 2XBMA 2J3KA 1KI1A 4XTCS 4U7JA 3HVIA 1T25A 5FOUA 2HCTA 4E1AA 2I8CA 4HDMB 1NNI1 5IM5A 4AB1A 5KNCA 4QO8A 4R2KA 2XNDA 2XQIA 1M2VA 2YXPX