5FIUA

Binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploration of a Potential Difluoromethyl-Nucleoside Substrate with the Fluorinase Enzyme.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
molecule keywords 5'-FLUORO-5'-DEOXY-ADENOSINE SYNTHASE
total genus 80
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 5fiuA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 5fiuA01
2CW5A 2C5HA 2Q6LA 2ZBVA 5LMZA 1RQPA 2Q6IA 2V7UA 2V7VA 2WR8A 2F4NA 2CBXA 2V7XA 4CQJA 2C4UA 5B6IA 2V7WA 2V7TA 2C4TA 2C2WA 2CC2A 2Q6OA 1WU8A 2C5BA 5FIUA 2Q6KA 1RQRA 2ZBUA
chains in the Genus database with same CATH superfamily
3TGWA 5K0BA 1H23A 1GV0A 3SLRA 1XQ9A 1KYWA 4PAMA 3WIEA 4CFYA 2K6GA 3GHYA 3JX9A 3TD2A 5CTJA 3A7DA 2CDNA 3OZCA 5DT9A 2C57A 2QI9C 3LMKA 5LDGA 4MJ3A 1KMHB 3KL4A 5A3SA 4LKRA 1UK6A 2GEDA 2JNWA 3AUAA 3UAYA 1ORRA 1SXJA 3F6EX 1CP3A 1Q0LA 4YAOA 2GB4A 4FCTA 1UFKA 3LXXA 2JFPA 1I3MA 1W1UA 4IVRA 2DFDA 4ZZ3A 4IIDA 3ZY3A 3II6X 5K4GA 1OSNA 1GKUB 1N0UA 4YAWA 2XA9A 3TNFA 4ATNA 4ZT5A 4BFSA 1W52X 4UM5A 1Q82D 3VO2A 4CEJB 2JD2A 2O8VA 3M5DA 1Z12A 4X63A 4I6GA 1JHYA 1PS0A 1Y5LA 4LBVA 4QV2A 1REQA 3HPQA 5F1PA 5JVDF 4HQKA 3HL0A 3MELA 1T34A 2XT6A 3LYLA 2L0XA 4PZYA 4YP6A 4CM4B 1BXRB 3K2BA 3ADKA 4BQNA 5EZYB 1VI5A 1NG9A 3E35A 1K3FA 3QE9Y 2MSDB 3L1UA 1B6SA 1D0IA 2V7XA 2JCYA 2F9FA 2B1RA 3HSKA 3LW7A 4REMA 4OGLA 3SKVA 3DBRB 2EOAA 2O2JA 4EI2A 13PKA 3WFIA 2ZYDA 3W6UA 1G1AA 4Y9RA 2V74B 3P9CA 1QYDA 4XQEA 1L3BA 1PV1A 3HXOA 4HNUA 4JJFA 1SUSA 2EV9A 1JAYA 3GJ0A 3HXPA 4MVCA 5CXXA 5JECA 1I7SB 1TW3A 4S0XA 5KNDA 2WWRA 5JC1A 1I4DD 3W1WA 5GGXA 2HT6A 3DH0A 4JIGA 3RLIA 1P6UA 2CSXA 2FNAA 3DZ8A 5EGNA 3DFZA 5DW0A 4ACBA 3B6KA 5F3RA 3TZKA 4BJ3A 2VJNA 3U16A 3L8GA 1J42A 1JWBB 2R7NA 4KN9S 3TD9A 4F38A 1ST3A 4G1FA 1Z6QA 2JRCA 3RB8A 1FYXA 1U2QA 1X7WA 2AEEA 2BM1A 1HG1A 1BXZA 1MR3F 3BRWA 4JB8A 2A9PA 3W7BA 1D04A 4JHXA 4K86A 2DHEA 3O75A 3INGA 2WTAA 1G291 2HA3A 3NH9A 4DA0A 1UBEA 1U3VA 3PFGA 1BE1A 1Z5ZA 1AKRA 2NQTA 4IOLA 3T5CA 1ZRSA 5KHOC 3MB5A 2F6RA 2VJQA 4XJVA 4WERA 1NBAA 4WK6A 5FUBA 2GT1A 5L7WA 1K88A 2A1UB 5EHQA 1E3TA 4B0OA 4RC9A 2DUUA 4Z3DA 4UVHA 3IRVA 5E6RB 4W5NA 3OOWA 4E2YA 4DLKA 3DPUA 2AMJA 3UJ3X 2GEUA 3SEQA 3GFBA 5EAIA 4UBNA 3VR5A 3NNNA 2WM2A 1UOEA 2W98A 3OX3A 1GCUA 3BMOB 3NJRA 4LUCA 4EF6A 3U4AA 3LK7A 1S2DA 3ETJA 4EMSA 3B2NA 4BAUA 5KTKA 2O8DA 3NVDA 4CG0A 3AVVA 2JHAA 3JQFC 4NBSA 1PK8A 1KR5A 3SLKA 9GPBA 3QFRA 1I6MA 4BBPA 2KJQA 3H2SA 3JWGA 3NIBA 3PJEA 3SJAA 2Q1UA 2UZ3A 2XNDA 3IB6A 4R2JA 4DQUA 1QV7A 4IQ4A 4RACA 2QS9A 3NKFA 4UTXA 5DHQA 4AXBA 3KPWA 4DDUA 1WSDA 5GONA 2AEMA 4F8EA 5BMOA 3UCFA 5EE3A 4ZI7F 2NU9B 2PPLA 1C1HA 3AETA 1RAIA 3VISA 1W4RA 2GXSA 1E64A 4J75A 4KSYA 1FFAA 1SOAA 4V3BA 4ZYZA 2E82A 3GJ6A 3QKRA 1NTRA 2UXDB 1N5MA 3OZGA 3UW1A 1GGKA 1AZSC 1JFLA 4KXNA 1UOOA 2D62A 5DW3A 5IYZB 3WTBA 2J9YB 5GMOA 2WKWA 1IMJA 1ZXBA 2BFAA 4F12A 3ASQA 2ZDHA 5J2UA 5T3YA 1IWOA 3MTDA 3ZWXA 4FUTA 1W5EA 3GIRA 1TDJA 1KC1A 3B48A 4JBXA 3LUGA 4YP0A 5IULC 5LSAA 1ZOOA 2V0CA 4M1EA 5BO5A 3L0DA 2QA4B 3ZDRA 4N76A 1FYVA 3BYZA 3R4VA 1KPHA 2P9CA 3TB4A 3OCUA 3P2YA 2BM9A 2UVDA 3ETDA 5T8KC 4AF8A 4UMVA 1YK0A 4D3FA 1QRUA 4IO0A 3VH3A 1XZIA 1DC6A 3B1VA 4YVFA 3ZD7A 3ASSA 3FFAA 3VZCA 1RZVA 1NUSA 1KJYA 3K9QO 4JJZA 4RGYA 521PA 4PCUA 3O9MA 3H83A 4I55A 5TB5A 4E1BA 4ZHQA 3L1JA 1DJLA 3DZIA 4WY2A 1D2MA 1FPMA 1L5SA 4MICA 1T2NA 3DT9A 5HX7A 2XKJE 4OXRA 1OV6A 4KAAA 1HDYA 4IIHA 2B1QA 3LL7A 5C7LO 1RVV1 1S6YA 4P34A 3ONYA 4JAVC 4U3JB 2REQA 4RHFA 4E08A 5C35A 1I2AA 1TZMA 3EK2A 1SOWA 2M6SA 3A11A 4H27A 3NG1A 3F6YA 4JI3B 5JR3A 1ZBDA 1P39A 5CDYA 3DEJA 2ZRBA 2SKEA 1EM8B 1LWNA 3BRQA 4FFMA 3X1YA 3WGIA 2C5HA 1SCUA 4LZNA 1GCIA 4IDBA 2N1MA 2QRZA 4XFDA 5CPBA 4DTIA 2GEBA 1EUCB 3X44A 4BQRA 3E53A 1U5BA 1BHO1 3EUEA 1R6TA 1OI7A 1C4KA 3AR2A 4WV3A 5JOQA 3AHJA 1YHYA 3TEFA 1K5HA 5F2EA 2ZRJA 3UV3A 1DUIA 1RQGA 3DM9B 1F8UA 4INZA 4F46A 4MRMA 1QF6A 2DT8A 2GNAA 4UQOA 3ZNPA 2YX1A 3OJFA 4CBVA 5I4IA 3F8SA 3RC8A 2P8SA 1FXUA 2OHJA 4DDKA 4NU5A 4IG4A 3GG2A 1GL6A 3G7SA 3TYXA 4CLOA 1PGJA 3IT0A 1DFGA 2IYNA 2C31A 2VDJA 4WOJA 4XL9A 4FHFA 1EAMA 3MAGA 2V45A 1P80A 3DQPA 3MAAC 2NUPA 3LCVB 4JC4A 3WLNA 4C5AA 3HJUA 2AR9A 3OI7A 5ELLA 3FFWA 3FBGA 3NJ4A 3P0HA 5B3LA 5BURA 4JJ8A 4WZAE 2JIZA 3S44A 2QHXA 4DLUA 4N6NA 1FXWF 3VDRA 1WMBA 3M83A 3IA7A 4PYIA 4IIJF 1ZESA 4Y2JA 1T1SA 4M7OA 1BU5A 3IQDB 5DSZA 4Q9IA 4AMYA 4QQNA 5J43A 1FQWA 1GAXA 1TIKA 8MHTA 3PPWA 5E0OA 2QD2A 5M29A 2IZ6A 4U4AA 3IJ5A 1WM1A 1Y8QB 1XDUA 1T2DA 2C9CA 4CTJA 4LF7B 3E3MA 2QQFA 3I12A 4AJ4A 1FY2A 4DCGA 4ALJA 4XGRA 2B4KA 3ANYB 4X7CA 2PMDA 1G66A 4MGIR 5CCXA 4U6NA 3SDSA 4DF3A 4R0MA 3G68A 2ZIEA 2Y1WA 3A6PC 2ZSBA 1V1RA 3H05A 1AB6A 1GUFA 2GETA 2XRFA 3H2KA 4LOHA 4X6XA 1V3QE 5KMGA 1NM5C 4E32A 4YAFA 2G80A 3OZUA 2IXEA 2WWGA 4FEAA 3FZNA 2GAOA 1W49A 3CESA 2C4KA 2E4ZA 3E8SA 4MAAA 4TV8B 5K4AA 5JNRA 1XP8A 5HMLA 2CHGA 3VH2A 3ROXA 3VR6H 3VMFA 1BEUB 1YNSA 4JLKA 4RKYA 4BXOA 5JEEA 5AICA 4MR7B 1STOA 2X1HA 3R75A 2PIDA 1WB6A 2WK1A 1G55A 1PJAA 5COQA 3G5LA 3VOTA 5TQJA 2EX1A 3FWHA 3DNMA 1RYBA 2NSHA 2VG8A 2J1LA 2VYVA 3MJRA 5LWQA 3KQQA 4EEZA 1FNSA 3VJRA 2RKWA 2WSYB 3EXHB 1Z39A 4MKRA 1K9MD 2XF2A 3FSEA 3MOSA 1HT2E 4I4TA 2PZGA 3Q2OA 4TROA 4WKPA 1UBGA 1YQQA 3AMVA 1OXSC 4Z0HO 3W4IA 3E1YE 2H31A 2VC2B 2VI5A 5KEIA 4WXPA 1AN0A 1J21A 3AHDA 2PXXA 3DBRA 3N2IA 3UJDA 3VU1A 1G3UA 1C7QA 3FDXA 3GRVA 5DJ5A 4DEVA 5I7UA 5ERXA 4RPBA 4AWXA 3TIXB 3ANMA 5I9MA 4BO6A 2EYQA 3GQBB 1U9CA 2B34A 3N6VA 5FOWA 4C4SA 4EJ0A 5CCDA 3V7YA 2C7RA 3GLTA 3REQB 4FFDA 4HGOA 2NNWB 1UD3A 1RS0A 1X7DA 2RARA 5FWYA 4YJ2B 1Q50A 5BUQA 3CNNA 4NMLA 4KB5A 3ED5A 4N41A 2PJRA 2IE0A 1NDHA 3K6SB 5DULA 3F73A 1L5HB 4KCGA 1ISFA 4BBZA 4PVCA 4CKWA 2HTFA 5F2NA 4KKUA 3L7NA 4M0CA 5EQTA 1EEXB 5PNTA 1GADO 3NW9A 4EHHA 3VBCA 3DFMA 2P6NA 2WI8A 3FUCA 1X80A 4D92A 4DXAA 1K7CA 1FTWA 2VHTA 3MINB 4EJSB 1S3IA 2EC5A 4XKVA 5L3ZA 5E2AA 2B0JA 1KZHA 3TAXA 1X7GA 1ZW1A 1V7CA 1J2UA 2HU8A 1M8JA 3DXFA 2P9GA 4RPDA 5FA8A 5CA1B 1N6HA 5FR2A 4MKXA 1N8RD 1UFQA 1NVEA 3WBJA 4OLFA 4Z49A 1L4KA 5J40A 1ZGCA 1EK2A 1GRVA 1RHQA 4DC1A 5CR9A 3PX7A 1DS6A 3E3AA 3HJRA 3S29A 2YYYA 3UMMA 4PSKA 3UA4A 1US8B 2O0JA 4JI5B 4WKGA 2RGXA 2VLBA 2PGIA 1XLWA 3DG9A 3NWBA 2B36A 1EHCA 2EJUA 2XBLA 3JV7A 4MI1A 5ALRA 2VCEA 3NHAA 3E9QA 1W36D 3HBNA 1DCTA 5HJ5A 3UOAB 1A77A 1NF2A 3LVQE 3GY0A 1UJCA 3QELB 1UADA 3DVQX 5TARA 2PFKA 3WMGA 4MAMA 2CXPA 1ZRMA 3BAZA 1B0AA 1MW9X 1T0HB 2WU1A 3BCSA 5CH3A 4LX0A 5EE1A 2IHJA 3FA2A 4IDDA 4YJKA 5JG7A 4K9SA 1YLOA 2CCJA 1X7WB 3MWYW 1YDEA 4L72A 5HGJA 4BQSA 4C7OA 5H0IA 1RYZA 1TT7A 1N0WA 5FFFA 5JCZA 4BYGA 5CVTA 2HPAA 3FDFA 4RPHA 4D6PA 3WGMA 3OZDA 3R3XA 4R2HA 2PRJA 3O83A 3LOQA 4D4MA 1JG2A 4QDKA 1AKVA 2V55B 1HF3A 1BS9A 2WU0A 3DMFA 3IT2A 1XAGA 3B20A 4Q05A 1USGA 2CHEA 5LJLA 3PKZA 4YBRA 4GX0A 4OY3A 1S9DA 1SOVA 2LWIA 4JJAA 5TPZA 1VG9B 4JQZA 4MPRA 4OFXA 3IVAA 4URYR 4D45A 4EJFA 5LVAA 2NX2A 1JR3D 3LFHA 4UZEA 3GFOA 4QTZA 2Q8NA 3B36A 3KJIA 3PGKA 4EB6B 5C46F 1MHPA 3BJIC 1QDUA 4R3NA 1D2GA 1UL1X 3NWOA 1OGJA 1DWUA 3JWEA 5A02A 4R68A 2RG7A 3NGXA 4D56A 4YRDA 1P5JA 1JB9A 3K9BA 2FK7A 3L7AA 1ISJA 2AIRA 3RO7A 3N1UA 5FBVB 3RBVA 3OO1A 2WYUA 2ZIFA 3IE1A 2G4LA 4Q4HA 1Z82A 4XYGA 2WKRA 3I76A 5EUBA 1KI8A 5HKLA 4D96A 3OTGA 3N2YA 4JBYA 3VZDA 4AQ7A 4YRBA 5BUCA 4WPGA 3GEDA 2QD1A 1Y4UA 4IEEA 5U9CA 1I4EB 4PX5A 4H3VA 3C1AA 4LHVA 1DO2A 4GVXA 1FFBA 4UUAA 4L08A 8ABPA 4BDSA 4W7SA 1J8VA 3H9NA 3LPMA 4R7TA 4WE3A 4ZVNA 3RVDA 5JI3E 2CB0A 2F59A 2HJWA 4BEVA 4P7BA 1QJCA 3FF4A 3C87A 2CBGA 3NIWA 4X05A 2I22A 1FFEA 1QV9A 1E58A 1HL7A 1MGPA 3HHEA 1U5BB 3AP3A 1P31A 1WOYA 4H3KB 4TWZA 4B6RA 3OEHA 4P32A 3LPDA 4OQDA 5A88A 2MMGA 5EYPB 4BZQA 4URZR 1WW2A 3UHOA 4DNPA 5A3QA 5JT1A 5JE8A 3AI1A 2V7EA 1QWSA 2ZT8A 1NMXA 1CHDA 3E1KA 4OF4A 3UWSA 5KTRA 2X76A 1K63A 1ZEJA 4YACA 3RIGA 3TW0A 2AQ8A 1CJBA 2EFHB 3UJ7A 3WSWA 1NDUA 1UH5A 2ZJ1A 1M76A 4IOJA 3CCRB 1VQ5B 1B2LA 3SIRA 3UJBA 3WGHA 4BVBA 5CCEA 4JMPA 2Z56A 1AMOA 3HP1A 3NWPA 4P9NA 4DNTB 2Z57A 5KYWB 2HW8A 3DP9A 3K53A 5FLKA 2RI1A 5GJCA 4I55B 1RWXA 4IQFA 2VKQA 3S27A 5LUAA 1WKCA 3HU1A 4L22A 4EIWA 5FUWA 3OKPA 1QFXA 1YXMA 2QYTA 4G85A 1U94A 1A9QA 3KQVA 1LNQA 2ZUUA 3LT0A 1L7NA 1W76A 4RXMA 4TMWA 2P5SA 5IAKA 5IDVA 3G7NA 4WN3A 3VZRA 1NJ6A 2JGNA 5ITVA 4XUDA 3Q11A 1P8JA 3FPLA 2JFHA 4FNAA 2OO5C 1AKMA 2R3SA 2I4NA 2HA7A 2VAXA 4P08A 1WA5A 3BD9A 5AOVA 4E5UA 5JZBA 2CHUA 3ASRA 2EWWA 2GNPA 4C08A 5TIIA 2FETA 2D3NA 3KLOA 5GJBA 3BL8A 4DMHA 4I55F 4RK7A 4MCJA 4MQFB 2EX4A 2W4MA 1OI2A 3R7NA 3OEEA 3SF0A 3OLQA 1GL7A 2O5RA 3KQWA 3QFTA 3VYWA 5BVHB 1PVOA 4UCQA 5IVDA 1XMOB 2QW8A 1H2FA 1X8JA 3OZVA 5AUQA 2PK3A 2XDQA 3O0TA 3DLPX 3I9LA 3PHGA 3G49A 4PQGA 3G9QA 2OFPA 4J0QA 1ZNZA 3C1UA 4MUKA 4XARA 4Q3BA 1OLUB 3IQFA 5I51A 5LP6B 3IL2A 1SPXA 4LZWA 1ZSNA 4U2BA 5AVUA 2CCKA 2PEYA 1QHXA 3GLIE 3AU8A 4ZZIA 4IFTA 4N4AA 1MU0A 1J5PA 1NXXA 1SY7A 1L8QA 2RHHA 5D2CA 1ZMBA 2ZSJA 4IRUB 4F7WA 3PGVA 1E1QA 2HWKA 1LD3A 2G1UA 2GHRA 4F86A 4CPDA 3ILHA 1GQRA 3PFFA 5B6PA 3S1AB 1F60A 4I4TB 4X3CA 3UMCA 2XCTB 2Q3MA 3IUYA 1EK0A 4Z2YA 1VQ1A 2XF8A 1NJ2A 5AVSA 3F78A 4IW3B 2ZB4A 2W83A 5DOZA 2X41A 4BTVA 1Y8QA 3ZPXA 2BM0A 3OQ1A 3BK7A 5E7IA 5AKIA 3WNZA 4LF9B 1NVXQ 2F1KA 1VOTA 4XEHA 1XRQA 3NTOA 1QHSA 4GPZA 4F4JA 1LI5A 4Y1RA 1TO6A 4NTZA 5FL7A 1IUKA 3KD2A 1NKTA 3ZCVA 4RHXA 4ZCMA 1JF8A 1KO5A 2XTMA 4GR5A 2WE8A 4WUTA 2IIQA 2D7JA 4WNCA 4X24A 2NWQA 3HXTA 1SU4A 3A3GA 1GDHA 3NTXA 2GLTA 3PGMA 2IELA 1SC6A 3P7MA 4WBNB 2CJWA 3WLQA 4LC0A 3VO1A 3ITKA 3E2MA 1Z63A 1FLDA 2VNIA 1ZN7A 2ZT7A 3Q3HA 5KJCA 2QVBA 2GFIA 4YUXA 3QWAA 4KQGA 1OI4A 3PRKE 4DLVA 3G2LA 5BV0A 1TCCA 1KMNA 4N3BA 2CNLA 1DJMA 3UXYA 3KEQA 4MV8A 4CT0A 4YMGA 4X66B 1GUYA 4XLCA 3WWDA 5DK4A 4EG6A 4IXWA 4IR7A 1ZUHA 2IL1A 4X41A 5EXXA 5KHLB 2UZ1A 1AHIA 2C9ZA 1USIA 2XT0A 1W2BB 2IW1A 3LP8A 2CDBA 4L5YA 4F4IA 2BISA 2JPDA 2ZQZA 3WQRA 1L6IA 4GYKA 2G06A 4QTUB 3RSZA 5LYJB 3KS9A 4H6XA 5TMBA 5INTA 1V1RB 2R11A 2VTKA 3W05A 3WQSB 3WL3A 5E1MA 2TRSB 5K3EA 2J3HA 3TMKA 3I92A 3IAXA 1Z6GA 3WDMA 1P4JA 2PGOA 4YJ3A 4YRAA 4FW8A 7REQA 2H1HA 2RGYA 1U5AA 2Q5LA 4M9QA 4OEHA 5FTJA 3H6KA 2BPOA 3TCXB 3W5AA 2QKYA 4K81B 3BC1A 3DMHA 3RTBA 1YOVA 1QTRA 1Z68A 2F9MA 2ZTVA 4H0NA 3ZQ4A 2GILA 4ZIRB 4OU5A 4ZEWA 2IHTA 2VRNA 2EP8A 2IU6A 4LFCB 3RIMA 2G9QA 1RLTA 5EP3A 3TLXA 2ZIUB 1Z45A 4XDZA 4MCHA 2XBMA 3MGBA 1D03A 1ADFA 2ZBUA 1AQ6A 1MB9A 1W0JD 2CEAA 1CLEA 3A3YA 3ZU2A 4DR6B 2XCSB 3P0RA 4G1EB 3BRSA 3V80A 2JI6A 2O05A 3R5TA 5F3DA 4EKYA 1NI5A 2BFEA 5D6NA 1IHUA 2O7NA 3T7EA 4B48A 1GXSB 1BMDA 2PS1A 1UDAA 3RS9A 4N3AA 3AI2A 4OHRA 2IK8A 2HMYB 3SE7A 3GJTA 1ZGZA 4CMBA 1SOMA 2ZSDA 3QXCA 1E8NA 1SN7A 3UUEA 3EH2A 1IK6A 3IQZA 4MB0A 1L5YA 4LOJA 2WKPA 3WL7A 2HXSA 1DO8A 3PBKA 2ZCJA 3RJ5A 3A10A 2FLWA 1IB6A 1WF3A 3GLHE 4V0RA 3FYCA 3IMEA 3HI6A 2Z5FA 4DM4A 3RFVA 4IM7A 3T12A 3FB1A 4Q01A 4AIRA 2REBA 1QYRA 1E98A 1I3NA 4PTYA 3SEZA 2FQXA 3X1XA 4NBTA 2CRVA 1S5PA 3PQ2A 5D1HA 1Z83A 4OUKX 5FA5A 1F48A 1Y5RA 3O4VA 5IZCC 4QYXA 5ECYA 3HA5A 5LZ9A 1TJNA 2Q4DA 3FWNA 4PLFA 1JLLA 4QBHA 1B1CA 1C1XB 2NACA 3DOIA 4J0GA 4JXKA 5DTIA 4E5MA 2ORED 3WK8A 1MN6A 4HE5A 1OVMA 3T0FA 2P6MA 4ZAFA 1TAGA 1P17A 2Z1NA 4COOA 1RTTA 1QYCA 4HUQB 5CDSA 2RK4A 3KB8A 2Y1CA 5CT9A 3T41A 1BOOA 1E77A 2HADA 3DUWA 2ZATA 3BXEA 3OY7A 4ZT4A 2Q3FA 1RC0A 2HSJA 3NASA 5IZ4A 3V34A 3PX3A 3AHFA 5JWRA 3U7IA 2X9NA 4NVRA 2IUTA 2J85A 3B7PA 4WZBE 1P19A 4QUAA 4YRSA 5SYMA 5KVAA 2IDJA 2GHQA 5THQA 5I7RA 2NP7A 4XNFA 3I83A 4MVJE 1A9RA 4UXHA 5C1OA 1B14A 2WWWA 4LJ6A 2XE7A 4BB9A 2XGMA 2F7SA 1SHJA 2AQHA 3I09A 2QEQA 2UYQA 2ID7A 3RH0A 5C51B 2HMAA 2H9YA 1A76A 1HXHA 1LDMA 3GK3A 1ZIYA 4B3XA 3T1QA 5B64A 5ALPA 1NVFA 3RRXA 5BR1A 1PUJA 4C1BA 2Z2KA 2OV8A 2CXSA 3EUWA 1JDUA 2VPIA 2WSSD 5EIFA 1GLVA 2YV2A 4FHGA 3UVEA 1DHTA 3VNBA 2C3MA 5FOSA 3TW6A 4HTFA 4BBAA 3JR3A 4JOSA 5ES3A 4JI8B 3KYCB 4IP0A 4BE4A 1IY8A 2AH5A 1TCBA 1ISIA 1ITZA 1YS6A 1C8VB 2G6BA 3MSCA 3U9TA 1MXFA 4YO7A 2JVKA 4UVIA 1ZLYA 2QX8A 2EW1A 4HNQA 1TKAA 3RHZA 1GLGA 3NQ41 4YN3A 1GA4A 1FFDA 2FRXA 3MMXA 4GQBA 1DT3A 1E18A 1UOQA 1N1GA 2YXLA 3AM5A 1RPJA 1WSAA 2OXRA 4DNOA 3QTBA 4OA8A 4LZZA 4BMXA 4BWYA 4DB2A 1AJEA 1N2EA 3ZKWB 1WVIA 1E2MA 2CEKA 2CFOA 2CVOA 2YZGA 4B6FA 1LGYA 1Z4IA 3IEMA 4B3GA 1LQTA 4W5JA 1S4MA 3Q6MA 4PFSA 5DP2A 4GM1A 4ARVA 1GPUA 3CVWA 1QU3A 1V95A 4D9GA 1IRIA 4QO8A 3KKNA 4PONA 1R8SA 1CF9A 1YHZA 4FX5A 4YMTA 1GYRA 1ELOA 1WOSA 1V41E 4U6SA 5FL7D 1EWVA 2WIGA 4OQ4A 3NKVA 1J09A 5K8UA 5THXA 1QVFB 2OEPA 2VF8A 3PUHA 1VHEA 1KK1A 2NTVA 4JK3A 4DJAA 4ZMSA 2W4QA 5J35A 3MOIA 1ECBA 3ND9A 3N8NA 3YASA 3QXJA 3C6KA 5C1DA 1B3BA 1M5TA 2DKFA 2Q21A 2QJRA 5DHSA 3S81A 1H9CA 2AVNA 2PX8A 1CUGA 3IP6A 4AKGA 1JTFA 2EQ5A 3DOJA 2FSSA 4MHSA 1J0BA 1EDEA 1R8JA 2X5XA 3JQFA 3NDBB 3PGXA 4XPZA 2C98A 3N0XA 1KJ9A 5C1BA 2IYYA 3T4XA 2PZ8A 2Z3WA 3GAZA 2V6JA 2QORA 3AF3A 4P0TA 3AGPA 1C1DA 3P5SA 2P62A 1B15A 1QMPA 4HYTA 4UUNA 4DB4A 1EG7A 4WZEA 4BVGA 4N12A 1T91A 4KXFB 2NZ8A 4X7EA 5KINB 5LJIA 3MERA 4RVUA 1N0HA 1MH9A 1JKJA 3TN7A 3GVHA 4M0EA 1BDBA 3CX3A 4BQIA 1EDBA 1KEEB 5G1NA 1QR6A 3VR4H 2DOKA 2JVJA 1T9HA 5CP8A 4ZXPA 1EUDA 5TMEA 3DOHA 3PNMA 1FYFA 4QOGA 3RS8A 2R7LA 4JOBA 2D1YA 3SZGA 2VEOA 2WTMA 1XD9A 3RRFA 2W2NA 2WOOA 2XW6A 4OHPA 4ZOQI 2DTDA 3PICA 2O3JA 3QLUA 1K7YA 2AX3A 2VJCA 3FCSB 4CF4A 2G8LA 3IA2A 4WY5A 1OBVA 2AC4A 2QROA 2R00A 4FNOA 4GOLD 1TF5A 3HACA 5SYAA 3WV4A 4A6PA 1QQ6A 4EUNA 5FF9A 3AHGA 5HOQA 4BBJA 1DPFA 4FT2A 4KWIA 4G0WA 1RACA 1USWA 2I6FA 1ZBQA 4FHZA 3ZXSA 4BWGA 1EAYA 1B7GO 1WRBA 3L02A 1NQ5A 5IABA 1QHGA 1HA3A 4BOYA 5K01A 1YA4A 2A8YA 1Q7YD 2FK8A 2NO6A 3BD6A 5B7QA 3IOEA 3PRJA 1L7RA 4BNWA 5HM6A 1EUZA 5CH8A 1KAGA 1KYXA 1OKKD 3L6EA 3KLNA 4EY8A 2I80A 4GR4A 3VYUB 4MKGA 5KCMA 3TQOA 4H7JA 4DMUB 1VJCA 3OHSX 5IDXA 4UMEA 5DXFA 5E4YA 3H3JA 3A4YA 3W8FA 4FP9A 2H0RA 2OXEA 4CLHA 2JARA 3DC7A 3K1AB 3MWFA 3ZQKA 2H2DA 4W6ZA 4ND2A 1GGVA 3K0CA 1GZVA 1KH3A 4CV1A 1Z37A 3GZTB 3GP8A 3QBVA 1ZMXA 2HDNB 5HCIA 3DW1X 4EHAA 2B6HA 2OAQ1 3QYPA 3EDRA 5FD8A 3W5UA 3BY2A 4CKBB 1BE6A 3TPCA 2WWTA 3HY6A 2FXVA 3Q5GA 1KIFA 4UBJA 1KKLA 4TYQA 3K2EA 1RYNA 1HEUA 1MQ9A 2PKRA 3SU8A 5AK5A 1VSVA 4II7A 4PFJA 4JLWA 2CWDA 3HG7A 1GDTA 4ZEXA 2FSGA 3VUFA 5DBEX 3CMAB 2J6IA 2Q2OA 2I66A 2XGSA 1HLDA 4V2IA 3WL8A 1R6XA 4F21A 5JSZB 3KTAB 3ZU4A 2J3DA 4B7CA 4MTCA 5BXQC 2CLDX 1V47A 2PMWB 3DGEC 3E6AA 3EFOA 3IESA 5ETJA 2GD6A 3A1WA 1IBRA 1K6IA 3D5TA 4Q19A 4DA9A 1U9IA 3OWXA 3W8DA 1B8NA 1JG7A 1HDIA 2ZIAA 5LNK6 4Z4QA 1E9CA 1M0WA 1L8AA 1VKZA 1Y82A 1EP3B 4Z4YA 3IPRA 3KB1A 4PYKA 4BO9A 4KWCA 2PQ0A 2PM8A 4TL6A 4URXR 1JH8A 4YJFA 3R9WA 2VCHA 2R6FA 1UEIA 2UYYA 3LA6A 1OGIA 1PT9A 4TV9F 4LC1A 1EVLA 1UBLS 4ZV7A 4YR9A 5JD6A 3U1BA 4NZMA 3CWCA 1BZYA 1UMDB 2J46A 4OBBA 5DP1A 2GNOA 1QGOA 1T35A 5AR1A 4JBHA 3JQ8B 1PKVA 4TZ0A 2E4UA 4IFBA 1DKQA 3K05A 3RAEC 5ILQA 4BKOA 3U39A 1ZRHA 5C5CA 3NTVA 3DL7A 5DNCA 2WG1A 1V5WA 3C5VA 3CVOA 4Z4ZA 5IH7A 3U40A 2QENA 3GFGA 3OT1A 3PA2A 2V9CA 4U5XA 3Q3AA 4PRYA 1EFKA 3UAVA 5A7FA 2NZWA 2YYZA 4GQIA 5BNIA 3P97A 1IU9A 1Q15A 4MUGA 4Z1MA 4JJ6A 5A3VA 1Y3CE 4B3CA 1U1FA 1O94A 2DQYA 1F3OA 1XLTC 1SKBA 3BH0A 5E9WA 3O3CA 5C8YF 1HE8B 4UW9A 5FQOA 1N3LA 2FFRA 3ANTA 2KSQA 4N0EA 4Y2YA 2VQFB 1CZUA 2F2TA 4KO1S 4CDNA 3I9NA 5EFZA 3HB7A 2P9JA 2ZSKA 2C2HA 3G8YA 4FXUA 2XNSA 4BO3A 3LO5A 1KU0A 1NBEA 4J7XA 3BFKA 1AF7A 3DBHA 3BORA 1YJBA 1HGXA 1L2TA 1PEDA 2Z6BD 4QO7A 3RYFA 3N0WA 1BQEA 3GRCA 3T0GA 5JQGA 5BSMA 3NOVA 2Q6TA 1PR9A 3RBZA 3PE4A 1YE3A 5C7OO 1J00A 3DZHA 4DILA 3UKJA 1NW9B 3ISXA 3LK6A 1U1GA 4YAJA 5DBHX 5HWSA 5TS2A 2XQIA 1IOWA 3DR5A 1P6XA 3T61A 2FUCA 1Y89A 3R3ZA 5H02A 2TMGA 3HN6A 4QTYA 5F33A 5BRJA 1U8YA 1RHUA 3E0QA 3IPCA 1AQNA 1SC4A 4M1KA 2AOUA 2CVQA 3AVQA 1QZZA 2C4UA 3IIIA 1QHYA 3QBTA 4JFAA 4XSGA 5EMMA 2YS6A 1MQSA 3N2EA 2V9PA 4WZBB 4ZJYA 4PLCA 1S1MA 2OCYC 1L4HA 4B1FA 3LWZA 2XMGA 3D4NA 5IH3A 4ZK2A 5LKRA 2JLSA 3ZQJA 4EI8A 1E5TA 4IV0A 1JDVA 1P2FA 2OT3B 3CBQA 2XQFA 3AQIA 3D8HA 1A7KA 1KJNA 1KMHA 1GD1O 1X1SA 3AUJB 4A0HA 8AT1A 1E2KA 1B8VA 2H4YA 1NG1A 3EZ9A 4ZOLB 5E9AA 2HCFA 1DL5A 2XQVA 4F3YA 1U2ZA 3QF7A 1Y1PA 3GA7A 2V6IA 3WYDA 1FQKA 5H81A 1RAFA 1VSBA 4JR1A 3LJKA 4CKEA 2IS2A 4I99A 2ENUA 3EYWA 2EXXA 3EDMA 1G5HA 4YV2A 1YVUA 1LLQA 1PZGA 1ZH4A 3O6VA 1OV4A 4G4IA 2FZEA 4C3OB 3TEJA 4GYJA 4HUQA 4NH4A 4L8FA 2XIJA 1M0SA 2RKBA 5C80A 4OQFA 3P52A 2J6CA 4KR0A 3JZFA 2IYOA 5AW8A 2QE6A 4RY8A 1YU6A 2BWJA 2BEUB 1Q14A 2YJ5A 2WV9A 5L4SA 1D5WA 1BG6A 2FPLA 4OQPA 2FEAA 4EFMA 1O94D 3WRYC 4DVGA 1QYVA 3K35A 4UM9D 2AB0A 4F9FA 2VYVD 4MX8A 3ZBTA 3WVNA 3TLJA 2O48X 2O54A 3U7QA 4ENUA 4NBUA 4RELA 1CDDA 3I58A 1UPXA 5FWAA 3VNQA 1WXIA 4YBZA 2JGMA 5LIPA 1ZL0A 1E0DA 1RFGE 3SX0A 5AXAA 9LDTA 1PVVA 2IOYA 4DQVA 3H5NA 4G67A 5GVRA 2YL2A 3H5WA 4QHSA 5A7HA 3WK6A 3CCMB 4JR0A 3LTNC 2AK3A 3OBIA 1CR6A 1JHRA 3RS0A 1ZH8A 4AQYB 2RIRA 2QN1A 3RGGA 3SDBA 5JJ5A 1U04A 1DTWB 1FP1D 4YLEA 5HS4A 1P7ZA 5DGHA 2DLCX 4GEKA 4CCSA 4DG9A 4G0ZA 5ER9A 3IUEA 1D8TA 1D2HA 3OKCA 1LLCA 5DISB 1N07A 3CNLA 1UM8A 3LYAA 4FX2A 1TUIA 1W48A 1YZUA 2IXBA 4MQ4A 3BXFA 3PNLA 3SMQA 2EZ8A 3JU4A 4YT4A 3PEEA 1AKWA 1NT4A 5HUQA 2VPTA 3JQAB 2D74A 2DPLA 2V5AA 3S8EA 3E15A 3DOEA 4I36A 2R8XA 3IHTA 4D9BA 1I7PA 2G76A 2PZKA 1DV2A 4FYVA 1P77A 3KXDA 4W63A 1C9EA 3QYAA 3D5QA 1IDOA 3B3AA 5K1ZA 3U7JA 1R1DA 1QVWA 2XB8A 5JPCA 2O7VA 1ODTC 3V1NA 3NXKA 5B3JA 4G0VA 1U31A 3JALA 2DR3A 3CPSA 3K4PA 3PNSA 2A58A 1I7LA 3WLRA 4BP3A 2WAMA 5K3FA 1OIVA 3DE2X 2IJGX 2C42A 5TE9A 2XIQA 2OZLA 3NRBA 1K7XB 1FX0A 1E4EB 2GO7A 3AUUA 4L8GA 1W5BA 2BELA 3L05A 4J4TA 5CLGA 1WXXA 1M34A 3W0LB 2GCNA 3NT2A 1OX4B 2IYWA 1PSDA 2C5AA 2OTLB 1B16A 2ZR9A 3HJNA 4IEFB 4B34A 1UQRA 4PSCA 3KQKA 1BX0A 3EAQA 4CLXA 3RAFC 1TVKA 4DV2B 4RESA 3GJZA 2AZDA 1GGMA 3BG5A 5ENVA 4B7UA 1R0SA 2QPAA 4QVKA 1MOQA 2ZQ5A 4YPFA 5JDCC 2R2AA 5A8AA 1NUUA 5KYYB 3WGLA 1BVRA 1AY0A 3L49A 2CLSA 2IXTA 3HMKA 5FBZA 2QTBA 4MJXA 2DPMA 2WICA 3NBZC 3F5MA 3DO6A 3D6AA 4QATA 4LF4B 2IYEA 3T5BA 4BNDB 1U7PA 3IJRA 4AP5A 2DERA 2ZP1A 4C29A 1XDBA 3FBWA 2I76A 4ND7A 4ER3A 1RIIA 2C61A 1G7RA 4OQXA 2QAGA 3DHEA 4I4TF 2FPGA 2XXAA 2E1RA 1R5OA 3DEKA 3LUAA 5B3AA 2C5SA 1RLMA 2QTVA 3ZDAA 4MR8A 1UWCA 1E2QA 4OGFA 1T4BA 3PD1A 5SZJA 2WHEA 1M6HA 2ODWA 5SICE 1POXA 2YMLA 3C8MA 4EZBA 2DCUA 3UKDA 1P1BA 2WF9A 4IIYA 3UHJA 4WJLA 5HBRA 1OUMA 2ECOA 4CE6A 3EXG1 4IG9A 1ZIOA 4QU9A 3PC7A 4AAYA 4RTNA 4M9CA 3RS7A 3L46A 4BIMA 4MQUA 1O58A 3PDCA 2GN6A 5IK2D 5EIHA 1GCOA 2HJVA 2BF7A 1NFFA 1MRSA 4BZZA 1XZPA 1HE1C 2ZJBA 4YELA 5DI3A 3RARA 3SJ7A 3PNOA 4LX8A 2ZBEA 4OA5A 2GN9A 4IO1A 3TF5A 4HNRA 5K0NA 5CFMA 2VDQB 1OH7A 2LNDA 4L6IA 1Q3KA 3HP4A 4YB8A 1EYZA 2GZAA 3HCAA 4KYUA 1Q0QA 4WW0A 1BXGA 4OP7A 3ZNOA 1NYQA 2R6CA 4PX9A 4B3DA 2GCIA 5A9SA 4D0RA 1PJ3A 1C9NA 1CQJB 3V2HA 4Q37A 2FEMA 1Z6YA 4AG6A 4EBFA 5EL0A 5DHAA 2A57A 3O31A 1ACJA 1E2JA 4LJAA 1QVGB 4JU9A 4YRJA 1EJ2A 3L6RA 4P31A 3UWKA 1X3SA 4OJTA 4TZTA 3TL3A 1GNLA 4OX9B 3FYUB 4E7PA 3P96A 3GUUA 4LS3A 1OFTA 5F1OA 3NT5A 2Y0BA 3CJTA 3S5JA 3ZH2A 3K3PA 1QV6A 2XB6A 1KS2A 3MGKA 4KX3A 3WIDA 3JQ8A 1AXGA 3CGWA 2Z9CA 4LJ9A 3MT8A 4Q48A 1RZRA 1DAGA 3RCBA 4C06A 3L77A 1J5EB 1WUTA 1DAPA 3CX4A 2MYTA 4O2BB 4E21A 3U3ZA 2BR3A 5L46A 1F8YA 3R3JA 4A3SA 3ODPA 4MV3A 1R6AA 1GQ2A 4UHHA 4B3BA 2OB1A 3X1MA 4CR6A 3A4VA 5JISA 4MROA 3WYFA 5H4GA 1L6RA 2AI1A 5CVDA 4CUZA 2D5LA 4RJIA 5CGZA 1P18A 2E37A 1M2VA 3O92A 1B76A 3NX4A 4JXJA 4ZOLA 3HDQA 1VGRA 4YIKA 3WFJA 2EKPA 2EZTA 3KD3A 1KNXA 2G67A 2O7RA 2EGGA 4YNBA 1BEEA 1KF0A 1RPAA 2R25B 4Q4CA 2IUEA 4F6CA 2VT3A 1EZZA 4Y2GA 5AO9A 1FNCA 1F0PA 4KQ9A 2W7TA 1UKEA 4IDGA 5F4BA 3HL4A 2IEGA 4BCCA 3O38A 1OI3A 4MVJI 3PZBA 2JGLA 4M1SA 4BY9E 4WD3A 4M9UA 4LMBA 1EFHA 1XF9A 4HADA 4TS3A 3HUUA 3VJLA 3PUNA 4YMHA 3P9NA 3BMCB 1KQNA 4P6VF 2BGIA 2P4UA 1LVGA 1T6NA 4QTTB 1C4OA 1NQOA 2R87A 5I8PA 1OAKA 3HA3A 3WBFA 3FNRA 4FUQA 3L4SO 1VLHA 1HFEL 1FP4A 4RENA 1VE9A 1QFMA 2NXJA 4FOOA 3FHTA 5F52A 3GWGA 2KBEA 3QPCA 3AR5A 1UAYA 2DWQA 1CYDA 1XK7A 3B70A 4L15A 1UR5A 3ZJTA 3TDNA 3FLMA 3R77A 1D1NA 5ICFA 1XRJA 3KWLA 5KHAA 2QX7A 2UYHA 1CS0A 1H3FA 1YA8A 2EF1A 3PI7A 1RM0A 4HLUA 4ZAGA 1EXVA 2BGGA 1WCV1 3CH5A 2NMVA 1UMBA 2R6GA 3RAPR 2J3JA 3LUDA 4GMFA 4G5RA 3S1SA 1FTYA 1KSHA 1UPUA 1D8AA 2BONA 2XUOA 3E5MA 3OPYI 4W1SA 3T1NA 1PYDA 2YYSA 1LJUA 4YHHB 4MWDA 3I28A 4BKRA 3LHSA 3O4GA 4M99A 4LGMA 3D8BA 4LTNA 1X7ZB 3K15A 3DBLB 4PQEA 1QQ5A 3FZQA 1QFSA 2RD2A 4MH0R 2PRZA 4K46A 4ZXFA 3M9LA 1E2HA 1GLNA 1NBIA 1U90A 3IAUA 5CGQB 4C43A 4OQQA 3OQ6A 4K5QA 5T7BA 4KXWA 1JSRA 5K0SA 1T4CA 3MTBA 2MYNA 2F8LA 2HSGA 5ESWA 5LNK1 2H9AA 2V6BA 4Q9JA 3JQGB 1RYHA 2ZROA 2G7MC 4PLGA 4E88A 1X70A 3NWJA 3RUAA 3QMVA 4IJWA 4MIEA 3KJHA 2NZYA 1PDWA 3KFLA 2ANCA 4DT1B 4PQFA 1KI4A 1J70A 4FI3C 1N8TA 3G9TA 1V9SA 2J0EA 1O4VA 1QC5A 3L0CA 4GAEA 3DFIA 3CQ9A 2PGAA 4KFTA 4BV2A 3COJA 2X85A 1FMLA 1HEIA 4YI5A 4YYZA 1F2TA 3DLTA 2JATA 4ONEA 1KEZA 4LVCA 4FW9A 2IYZA 2E6KA 4YRGA 2AKYA 4S1WA 5CEEA 1T8RA 3OQMA 4LCJA 3ZH9B 2ZFUA 1OZHA 3MWJA 1C7JA 1Z0FA 2N75A 4LV8B 1YA6A 3BA1A 3TVYA 2CT8A 4K9OA 4AULA 2GERA 2H65A 2ZXFA 4MARA 1JJBA 1J97A 4PPYA 2ZYGA 1P2DA 5J2TA 1JJAA 3GW8A 5EJGA 3RQIA 4P86A 3U3MA 5LZ4A 4NCNA 4OHBA 3S6JA 4Z4TA 4LCBA 1M7HA 3OX4A 5B55A 1RPTA 1RDFA 2IEAA 3H0KA 3ME5A 2JJ1A 1VJ5A 3VNSA 2LIVA 2QTFA 3FXAA 2FPRA 5CEJA 1F8FA 1X1DA 5B1DA 3F1LA 2LDXA 3H4TA 4BECA 1BX3A 1KI2A 1MB4A 4CGYA 3U4MA 4FMCB 1AZWA 1G9XA 3NAZA 4E31A 4HH3C 2HMUA 4XN0A 2ZR7A 5DXJA 4M7RA 1JHUA 5ALKA 1WB4A 2XDQB 1ZL2A 3GLUA 5HFNA 4QFDA 3CT6A 1K8RA 1KZ6A 2XVYA 3U4CA 2I67A 3NV9A 3SVZA 4I1IA 1K6MA 3ZGOA 1ZJYA 2XTZA 2A4MA 2Q29A 1RJGA 3AF1A 2WYIA 1L1RA 3IILA 4DDHA 1Z4PX 2H4HA 5KYNA 3F7MA 3IE0A 1Y6RA 1RLOA 1ORIA 5C37A 3DWEX 4NCJA 1GQFA 2QPOA 4Q4AA 3AERA 1P8AA 1XAIA 1BH6A 1XDGA 2QMEA 3WX0A 2BJHA 1OB0A 1ATZA 1U8ZA 2XUJA 4UEQA 3SXUB 3CMEB 1U2SA 5A0FA 1SVWA 1KZ9A 2LV8A 2AJDA 4K2AA 1N6PA 3HYCA 2FMFA 2AOVA 3QXXA 1X2EA 4YRRA 3I8SA 3LYHA 3HB4X 4UZUA 5DT2A 5IYNA 3W5CA 4Z6KA 5F9HA 3Q87B 4YQYA 1GZUA 3RRJA 2IV3A 3BGOS 3QOXA 1A7UA 1Q6ZA 3FIUA 4UPEA 4EKEA 5C3MA 5C4GB 1K8ZB 3IMKA 1WDTA 1JJ2B 2I4OA 4KXUA 3NOXA 3C70A 3N70A 4RKRA 3ROTA 1A4RA 4QUHA 2KLHA 1CJUC 1DC3A 1JEDA 1ORHA 1XMPA 3AEQA 4FEEA 4LCEA 4LWPA 1SU7A 3ZD9A 5KOIA 2DRIA 2H2WA 1ZIXA 3O3MB 3T99A 1UKVY 1H0KA 1MF7A 4RDHA 1RKVA 1T4DA 1DJNA 3PPYA 4M8IA 4ODIA 2IZ7A 1PFWA 1L7PA 2WG2A 3AFHA 3LL4A 3L7DA 3RNOA 1PR0A 2BGUA 2JCGA 1ORTA 4J03A 3P9RA 4RLFA 2WZNA 2XMZA 4KGZA 2FJPA 1QK5A 1XEFA 1YZLA 3KV1A 5I9LA 1AMUA 1ULSA 1QPBA 2P2ZA 4N82A 3RRNA 3RK4A 4RS3A 3RVRA 3ESYA 5F1YA 621PA 1JAXA 1VLVA 1YR2A 2D00A 2AOTB 2XX3A 3K94A 3L8CA 1SRRA 4OFZA 4RFSB 2O4CA 4XWKA 1H4SA 2AJLI 1FA9A 3H5LA 3EASA 2XTAA 4V0KA 4G9GA 3T7AA 1MC8A 2O7QA 2PLAA 1OR8A 2ZJZA 4AJLA 2BI7A 5KOJA 2VBVA 3KPJA 3FIJA 3NBUA 1VDZA 3S40A 3F6CA 1Q77A 4RPIA 5H80A 4OHUA 4JT8A 3TTVA 2XYPA 2CCGA 2BFNA 3SNKA 5KSPA 5I5GA 4HD8A 1KHTA 1XDWA 3FTNA 3TO5A 1S89A 5HNKA 2XNDD 4NQZA 3SFVA 3TAHA 4GP6A 3O2QB 1AM4D 2FV8A 3OZFA 3WTCA 4OOSA 2W43A 3IIJA 1ZUWA 5G1PA 4CMJA 5I8WA 4YALA 3SNHA 2Q1XA 3AK4A 3N74A 1GZHB 5EWMA 2OCDA 2WD7A 1GRRA 3H8JA 4KXMA 1ZJZA 1AOXA 3KE8A 1P1CA 2F1RA 2OZPA 3KZVA 4FMBB 3K0BA 4YCBA 5H59A 2I4TA 1XRLA 2CVPA 4QJ5A 3KL9A 5B2FA 4K7JA 3ETCA 1FX1A 1PNVA 3CSUA 4LKOA 3BT7A 1P2GA 2Y99A 3IUMA 4MCIA 3EIXA 4XN3A 3ZHTA 1DRVA 1Z7EA 2FQ1A 3A3NA 2OHOA 4OOVA 3ZVMA 3H42B 5DRTA 3QE2A 5LA6F 3SJUA 4WLNA 1GR1A 1VQKB 1QTIA 1N25A 2DMRA 3HJCA 1SCJA 3IKMB 4BKUA 4BWFB 4JLDA 1KFJB 3DLCA 4I66A 5ICCA 3OFJA 2AI3A 3H8WA 5CJ2A 2OSBA 2OLEA 5B4TA 4RE5A 4Q9HA 5HSGA 1RHMA 4BJHB 1XLUA 2RBKA 4OOXA 2C82A 2XOXA 3HY4A 4UUOA 4ZT2A 3H1EA 2EIHA 2ZZQA 3IXMA 3TOSA 3I5MA 3P32A 2FQYA 4RHEA 1UBOS 2NG1A 4M8KA 4HNAA 2OBLA 4MCAA 4EO9A 4B7XA 3B1FA 4MVJA 4NYIR 3P9SA 1K9VF 1SBIA 2C9OA 1F2UA 4WDRA 1X1TA 3N0RA 3KHUA 4TTQA 2I0FA 4GI7A 3A6DA 4BUJA 1G42A 4PR0A 1L5LA 3VBEA 3OESA 5ALQA 1I8DA 1NN3A 4Y2HA 2IYUA 5EHXA 3ADOA 2OZVA 2YZMA 4N0QA 1BHSA 4PPQA 4D97A 4ZJPA 4MUXA 1Z7BA 3PEVA 1THTA 2WKSA 4U7GA 1LB1B 3P4YA 5L95A 3FN4A 4NU8X 3RDPA 3KALA 2Z6AA 2D1FA 5CM2Z 1TTTA 1JVSA 1DDIA 2DF8A 3G13A 5B53A 4CDGA 5DTEA 3ITDA 1W35A 1CC1S 1S01A 1REQB 3SHFA 4LYFA 2WU3A 1XTVA 4JKYA 4OTZA 3WDLA 2RHMA 4MLPA 3BXZA 3I6YA 5ALTA 2PL5A 4WBXC 2J4CA 2XMQA 1SKQA 3KYDB 5E6RA 3DNFA 1E2DA 1N2CE 5IASA 2JAXA 2AJ8A 4LMRA 1P2UA 3WKCA 2NUAA 4FWIB 4O3MA 3R7AA 1JUDA 1OHHD 1NFQA 1SXGA 2CKMA 3ICEA 1V6CA 1PFYA 4XOPA 1OZ0A 3HXLA 1KDZA 1N9ZA 2NO0A 3LLSA 3GCXA 3TBFA 4QBTA 3W78A 1K08A 1QIIA 1ZSYA 3FI9A 3JASB 2OGZA 4LYGA 4M88A 3HP7A 3TINA 2B1GA 2HF7A 2HIHA 3CLVA 4B75A 5ICGA 2H4FA 1Z28A 4RL6A 2JIDA 4TN1A 1A5BB 3CLSC 3EF3A 3OCWA 1OILA 4QYTA 4ZIRA 2XVAA 1RKQA 1SB8A 4MV5A 2ZRDA 5GM1A 3RABA 3AVTA 2NO4A 2W2LA 1J6UA 3EXAA 4TT3A 5EWLA 1J8YF 4CQNA 2G4VA 1I80A 4EHIA 4CEJA 5ESDA 2FOIA 3AETB 5SYNA 4DUPA 3DWIA 4IBOA 3U4DA 5LBUA 1Q74A 4JC8A 3WJ7A 1RXVA 3LUBA 3BRWD 3C5CA 1JHZA 3RYIB 1W4BA 4QPCA 4TKUB 1XZ8A 1TD9A 1YQTA 1ZG3A 1R5BA 2YV1A 2GWHA 4AW9A 5KPJA 5DYTA 2X77A 3FCXA 4BVKA 2Y3IA 4I6JA 3EULA 2FAXA 5J2UB 5K0JA 1Q81D 4AIIA 2PZEA 3KKEA 3SDZA 3OW2B 3I2HA 4IH4A 4XPIA 2FN7A 1CP2A 3HKCA 1UP6A 5JCJA 4EW1A 4GOMD 4TV8F 1UJMA 4IDCA 4ZO4A 4BAZA 2QTLA 4E2XA 5KWEA 4UCFA 3WWPA 3KSAC 4ARIA 5JS1A 7MDHA 1AQYA 1JEQA 2YR0A 1RFLA 4X7MA 1JFVA 4MYSA 1QXSA 1T26A 4MWBA 1TI7A 4C87A 3STVA 1R4NA 5L3VA 4PSVA 4CUKA 1T6XA 2C9YA 4QFCA 3GFTA 3THOA 4DLWA 3PV0A 1L8XA 4DT1A 2H16A 1RI3A 1DADA 2X2OA 3IALA 3PEUA 3PKJA 4F72A 1GFSA 4I1PA 2MR6A 1LX6A 2YJGA 4IY1A 4L3OA 3TQTA 3VZBA 5G02A 3RIEA 5ARCA 4BB6A 3B38A 4DABA 5IT4A 4URUR 2HO5A 1VZ2A 1PZHA 2QIOA 1LTQA 2RGAA 4GPD1 4ZYTA 4UHKA 4WZZA 1SXJD 4MV1A 2BFBB 1WTAA 4C05A 3G5MA 5AW4A 1WHSB 2QIPA 3LTEA 1RXUA 1TGVA 2PA0A 2ZJ4A 5IAJA 3EYAA 1PZNA 1R0YA 1XFDA 4MS1B 1D1SA 3CUYA 3CKKA 4BO1A 2ZXUA 2CD9A 4GOJA 1G2PA 3UT6A 2I9KA 4ZZ2A 2BP7A 3LXUX 3UUFA 4GVLA 2FQWA 2M1ZA 4L4YA 4UPVA 1BYIA 2NTYC 1RPZA 2IIBA 1ZNQO 2BKVA 3TGLA 2SCUB 5BN5B 4KR7A 3K0SA 1MAUA 1QLHA 3JSXA 4X8OA 2XXBA 5HDQA 1C1DB 3CCJB 1QE5A 1SQ6A 3JQBA 5E1BA 1KJQA 3B3GA 2JJ2D 2GTPA 1H42A 3IERA 5CVCA 3P9QA 5C4IA 2H1VA 2YIMA 1P3Y1 3EIUA 4B6EA 2DCMA 3BCUA 4LXIA 1ZWLA 2NQ8A 3FYUC 4MW6A 3QBDA 2A1TR 3D4OA 3NHKA 4GMHA 4HRVA 2GJRA 4HWKA 4O4LF 3WNQA 5TVGA 3MJEA 1ZAKA 1RP7A 4FJ0A 1VE6A 1T5BA 2E4WA 1LS1A 3ENNA 2PRYA 3DDSA 2C5EA 3HXMA 1XMIA 4DDVA 1MO3A 1PFVA 3U3KA 3CH7A 3LRXA 4NS4A 1M2JA 4AG5A 2IZ1A 3PE6A 1IXYA 1DEXA 2GZ1A 1G2QA 3KVRA 3WDKA 1GNTA 2WTUA 5ALDA 4LWOA 3JQAD 4PZCA 1M2EA 3VGJA 3PIIA 4R2IA 2IYVA 3AESB 3N2LA 3QMMA 1MIHA 1R4MA 3EXFB 3GVJA 4EG8A 1YMUA 3AL2A 5BP7A 3F0TA 4OAOA 2XECA 3ORRA 3BEDA 5F3WB 4X3OA 3GIWA 1RLUA 3E22A 1MOPA 4YYEA 4UFNA 3DKPA 3EEYA 1S96A 2FLVA 3JYLA 4QU5A 1YGPA 4UMDA 5F76A 5REQB 4BKQA 4ETIA 2AUMA 2I29A 2J7KA 1C41A 2RB4A 2WUDA 1Z5OA 1WPCA 4WZTA 2LP4Y 2PGDA 1HT3A 2F1LA 1A97A 4CT5A 2IV7A 3PS9A 2BZGA 4MGKR 4ZDJA 5BSXA 4MLDA 4D9FA 2OK7A 3DKVA 2B35A 3KKLA 4U7TB 5KJEA 3G2KA 1WMAA 4RL4A 4ZRDA 1JHOA 2D1TA 4RKWA 4B82A 3T1HB 3GFPA 4BJ5A 3OLWA 1HNXB 3NCHA 1K9SA 4CIAA 4JL5A 1UPCA 2FZWA 1H6BA 2O5VA 1E5QA 1T8PA 4HK4A 3E1GA 3PD7A 4HATA 3A2NA 3IMFA 4XX0B 4J0KA 1KVRA 4QPDA 2HUNA 4FEYA 4NZ9A 4QXPA 2WUGA 4JUFA 5IFKA 5CU7A 4A0SA 2H48A 4OFBA 3SE0A 4BNMA 1IBCA 4A4DA 1WBBA 1B8OA 3IEXA 3QA3E 2R9VA 2V9ZA 1GPMA 4RMHA 3WLOA 1V3VA 3GT3A 4HGZA 3ZWMA 3I64A 2H4ZA 4UULA 1N4AA 2X3FA 4RH3A 3TSCA 4Z9FA 1GILA 2ROQA 3WJ2A 3V1LA 4DNQA 3K70B 2OHIA 3QFCA 1ZJ4A 4FHCA 2OC9A 2YKGA 4BX2A 2ACWA 3NP7A 1XA3A 3P2KA 3UK6A 1YB6A 5CVVA 5EJ6A 2BFDB 3CZCA 4XA8A 3MRSA 3B1KA 2ZK7A 4DMGA 1BQ3A 2L18A 3FMVA 2BKEA 2BC9A 3A9VA 3A6LA 2BDUA 2OOSA 1TVEA 1H0SA 1TPZA 2VH2A 1WUIS 3ZWNA 3IEVA 4V0ME 5ENZA 2AUNA 4QU8A 3FLBA 2GDJA 2YFQA 4I50B 1YIOA 2X2FA 3BVPA 4LXXA 2ZVDA 4G0XA 3EH1A 4OI4A 2JI9A 1XCGB 4XTRA 2EHJA 1JI0A 3V8BA 3EGDA 1JFSA 1N2SA 3RTCA 1ISSA 2NYUA 1FS5A 2P4EA 4RTLA 4RO0A 4LSZA 1U6KA 3WP0A 4EVRA 4POOA 5LQKA 3PTAA 4Y0AA 4ZANA 4W99A 3IAM1 2Z2IA 3WKDA 5I7FA 3O1JC 4GF5A 4B83A 2JJMA 3SHQA 3OIYA 4GLFA 4B4WA 3OMLA 4CDMA 1Z3CA 2EATA 1GL3A 4R7ZA 3A1VA 2HMVA 2FCAA 3K6KA 1IEWA 4LDRA 3ZE6A 2Q7XA 3N2NA 1XZEA 3M6FA 4LZAA 3EXHA 2Q3BA 4G2TA 2JHCA 1WMSA 3L93A 4W6QA 5TJHA 2Q41A 4A16A 4ENSA 1AQUA 2B3DA 3OCJA 1JXOA 1TQ2A 3GDFA 1YZTA 1US8A 2O50A 1XBTA 4M0FA 2GN1A 5C0OE 5TS3A 5DF1A 2W2KB 1CETA 5B58T 3F8WA 3OTWA 3KC2A 3AO0B 4OIFA 2RJOA 1KORA 1SPBS 3TECE 3HAGA 4K6CA 3AL0C 3O8BA 1EX7A 1OW3B 2Z1DA 1UC5B 2NNLD 3CFYA 4Y1FA 5KTPA 1RRCA 2QG9A 1T1JA 3F49S 2Y1FA 4F3CA 1W25A 2K2WA 4M1TA 3KOMA 3WJAA 3DE5X 5H3LA 3WMEA 3DFUA 3C7KA 3OQPA 4OH7A 1OF1A 4BO4A 3R74A 2ZE8A 2OO7A 1P5RA 4KBYA 1J8DA 3Q7QA 3UHAA 2FCRA 2WSMA 3D3NA 2IVZA 4NQRA 3MMPA 4ZCPA 5JAQA 4KQEA 1T3HA 1E60A 4AO8A 4AMZA 3DBHB 4HVCA 5CFNA 1IQUA 2BLNA 2GRUA 2PD3A 3GD5A 2BMAA 4D82A 3JWPA 1GTZA 4TMKA 2PH7A 4TUYA 1ZQ9A 4R1SA 4DLLA 1ZJWA 3G7UA 1I5OA 4CM9D 2H63A 3BXPA 3FMOB 3H1BA 2C77A 1Z56C 5GZ1A 3V8EA 3DF9A 1E6UA 3AR4A 5E1OA 1S2LA 2QJOA 1N2CA 2QRNA 1G5FA 3ZLUA 3A6EA 5CRIA 1XVAA 4R1MA 3QXHA 2A7QA 4PPNA 3BFPA 3G88A 1DOAA 2QZ9A 3LCMA 1G20B 2I4IA 1R0LA 1WU8A 2PRSA 4GXTA 4OUDB 5DOVA 3VHLB 2WJGA 3USCS 4BASA 4KKXB 3JAMA 4MWGA 3L5KA 1TJ4A 4BV3A 4YH1A 1PUIA 5HXAA 4ZEVA 3ERCA 4DRYA 5HIAA 3QX3A 3NATA 1KDRA 3IKLA 4IHJF 5A1TA 2VBFA 2P6RA 4OL9A 2ZCUA 3MCUA 3OUUA 2IHNA 2ABWA 2NVUB 3JARA 2FZCA 1H1DA 3BC9A 1YRBA 3F71A 3S3TA 2NVOA 1JEOA 4EENA 2BMVA 4QLAA 1A88A 1UZUA 3RG2A 4CMCA 3F6PA 3L7OA 4CKWB 4YMVA 2QZPA 3PXBA 3WA6A 1HE4A 2IPNA 1TVMA 3QVLA 2C92A 2BAGA 4TYWA 4BEJA 1GHTA 4DN6A 1L3IA 1M2HA 1UMDA 4EW2A 3P5BA 4B8WA 4D74A 1BRTA 2UUOA 1O54A 1XTSA 3H4IA 1NZDA 2GBPA 2WVGA 4DMKA 1CDZA 3DR3A 2BBWA 2BFBA 4XD7A 5HTOA 2C9MA 4ND3A 1IY9A 3G8CA 2ZYSA 3E18A 3FZEA 2ILTA 1W88B 4XVQA 3U13A 4EKGA 2IX9A 2R79A 4CG3A 1OX5A 5B36A 2CV2A 4YPVA 3KT0A 1G8HA 1ZVKA 4RVDA 2HQSA 4TL9A 2CMFA 4TQ9A 2ZL5A 3LYUA 4AKSA 5FORA 3A1SA 4MITA 1FUYB 5CIYA 3Q7EA 3R1IA 4ON9A 1UAGA 3VAYA 3M6VA 3AUTA 3RT1A 4KIGA 2FFAA 2JLYA 1TF2A 4MO9A 2GFHA 2SCUA 1JQLB 1G8PA 2CMDA 4NH0A 2QVLA 2IOQA 2DZDA 4GKVA 3GCWA 4GNKA 1AU9A 1DCMA 4D02A 2XZPA 5IVIA 2ZIVB 3GNLA 4NNOA 1M5RA 1V43A 3O1HB 1ESMA 2K4MA 2HQRA 3N2ZB 4JITA 4R69A 1AV6A 3UBMA 3K96A 4R2WA 5GJVC 4DGQA 2B37A 4JDPA 1W5FA 2E4VA 4QUJA 2C9BA 1VYUA 1XE1A 3FOBA 5JD3A 3GZNA 5EQFA 3RRZA 4R83A 3CVXA 4G1MB 2ILVA 4UU1A 3D1JA 1LQUA 3FZYA 4LY6A 4BVFA 2OAGA 2VLIA 5HE9A 3CRVA 3IR6A 3JZIA 4C0WA 1CRZA 4UOEA 1UWLA 1XNQB 4IMPA 4D8XA 3ZZNA 1AZLA 4RDXA 1JJVA 1AUXA 1VP9A 1Z74A 1DO0A 2PFSA 1J07A 2I65A 2JFOA 4RYLA 4H1UA 3MTEA 1KY3A 1IG3A 3ITNA 2C2MA 4I81A 1FFWA 5K0EA 1H2WA 3A1CA 3GJRA 4YRNA 1J2YA 3E2PA 1G5PA 3QG1A 4GR9A 1ZGHA 2FOLA 2ZTMA 1AKYA 2XR1A 3BDVA 3C3KA 3HVKA 3KV3O 2ID9A 2ESRA 2Z83A 4NV1A 1ULAA 5E4TA 2GPNA 2I62A 3EF1A 3HYLA 4US1R 4EQ6B 4C88A 3EVNA 1JQ3A 5AVXA 5L6LB 5IWAB 2NADA 2VXBA 3KVVA 5KC9A 3EWIA 5KKNB 2IHBA 1V5EA 4BV8A 1LX7A 1TB4A 2YQZA 2FB9A 3DOOA 2H0QA 3HZHA 1CERA 1VLZA 3CU5A 3TM5A 5I4CA 4PFQA 3RS4A 1GKIA 1RYFA 1PJ5A 1YC2A 3EZXA 1Y63A 3I9V1 5EERA 2DH6A 4PHGA 4XCVA 4Z4HA 2QLBA 5ARBA 2ZSUA 3MSXA 4C0LA 4RTRA 4I7EA 1GM5A 1DAKA 3EVEA 1JG1A 1YJXA 4P35A 5A5EA 4ZVPA 1DAIA 4WDQA 4HX2A 4RZSA 3ZQ6A 3ZTTA 4JXXA 2EBUA 4FYIA 2ISQA 1ECJA 2PE5A 1Y8RB 4S12A 1RM5A 4RYDA 1F06A 1P7VA 2GA9A 1SVIA 2RSLA 2BJVA 1Y5IA 4RMNA 4G6IA 4YASA 4KQ6A 4NZYA 5EUMA 2F8TA 5D7BA 1N32B 2D2VA 3A4IA 1NN1A 1SU8A 3BJRA 3CNQS 3ADBA 1AH2A 5CD9A 4LJRA 1RYEA 1SA0A 4DIEA 1WULS 3GCGA 2VZ0A 3OZ7A 2QGZA 1FYDA 3E9CA 3VPXA 4BO5A 5FWNA 1ZYUA 5KNDD 2C2GA 3BXGA 3QH4A 1SZDA 5GQSA 5GGYA 2MHCA 1LBTA 4WX2B 3WIVA 4ABTA 2QRHA 4XGNA 3T3HA 1RKUA 2AW3A 1CLUA 3W8RA 3J80A 4ZVOA 1T4GA 3STWA 2WIJA 4BYMA 3EIHA 3RU9A 4R2LA 4MEAA 4YO8A 2HQOA 5L7YA 4M7PA 3THYA 3FYHA 1ATIA 3B78A 1E6WA 3GRAA 4Y1RB 1O7JA 2JAPA 2EG9A 2W00A 1A1VA 2V54A 2HH9A 1T0JB 4U39A 3W7AA 1WV0A 4W5HA 5AVOA 4JKOA 5A7GA 2XXAB 2YZ7A 2PL1A 1BGXT 1YMVA 4KV7A 3ZWWA 5T67A 5ED4A 5HUHA 4HAOA 4DMMA 1P29A 4DYDA 3BE5A 2NZJA 2ZI5A 5KYTA 2Z9BA 3SCZA 4CIBA 2RGWA 3DBVO 2PBFA 5DN6D 2X6QA 4ZPXA 4YV7A 1DBIA 1OT5A 1EA5A 1T9BA 2A67A 4NHOA 4COKA 2O2SA 4QT4A 2V6GA 4E5SA 4GD3Q 1R6UA 2B83A 2IPAB 4J8PA 4OP1A 4DIKA 5KNBH 3CLUD 4BLPA 4FD2A 3HJHA 4UVDA 3REGA 5AUOB 2CUTA 2RGDA 1NR7A 1EWQA 4BNIA 5FUMA 1ABBA 2UUCB 2ZJ2A 2BIFA 5DGIA 1VIAA 3Q10A 5K03A 3LM8A 1SXHA 1GN8A 2CMHA 3EFHA 5JLJA 6GPBA 1W9MA 4C5BA 4KITB 1TUBA 2R00C 3Q9LA 3O2JA 4N3CA 1LF0A 1R0CA 2CYAA 1O95C 4HAXA 2P67A 3MWEA 3GXOA 3OY2A 3GBVA 4G41A 3CLRD 3UAXA 3VR5H 1X7HA 5A5DA 1JFFB 4ND8B 4S3MA 4BCDA 1XZKA 1L7BA 3D8SA 3NWEA 3RSSA 4L3WA 1A2QA 5A6VA 4OGWA 1DTSA 1L4EA 2Q50A 4QPNA 2PQ2A 4OK3A 1WUJS 4H4EA 5HDBB 4C7VA 3U6KA 3BTOA 1BDIA 3WYCA 2QG4A 2VNKA 4UE6A 3FJYA 2C04A 4D44A 5K8CA 4ENVA 2X23A 4H17A 2B5OA 1GG5A 1OAOA 2E89A 2D3WA 2W90A 3KZ1E 4N54A 4RH1A 4EO4A 4NXMB 4MDHA 4YRKA 1YQDA 4EYSA 1J99A 1UM9B 2X22A 2ZTSA 3AHIA 1D2AA 1YS9A 1WZEA 2QTMA 3EXEB 1ZO8A 4RAOA 4M49A 2FEKA 1H2AS 1SGWA 4KSCA 3EA5A 2NP6A 5A03A 4PC1A 1XTBA 2VK1A 1SKYB 1ZR4A 2FN3A 2J3KA 3UPUA 1P4SA 2ASVA 2UUBB 3ND5A 5HKOA 5BWLA 5CEFA 4TV9B 5F2OA 2PYIA 4Y67A 1YBVA 1G17A 1OXVA 2B8NA 2YV5A 1QUEA 2O1SA 3NHRA 4RHCA 2MR5A 1O96B 4EYQA 1XCOA 1INLA 1U7HA 3GPCA 5CLIA 1W7AA 5AVRA 5FFMA 1KKMA 2FR0A 2ONZA 1NXWA 2J4DA 1NZJA 2P91A 2RGGA 2XHZA 1JIVA 1GT91 2ACEA 2BGNA 5FT9A 4QL3A 2P65A 3LFTA 5D6OA 3VAAA 3C45A 1TNDA 1UDXA 5CURA 3VDMA 5JJKA 4Q3CA 1G8MA 4U9IS 1E7MA 2IWHA 3FLAA 4B44A 3JQBC 2A5DA 3PX2A 1W47A 2NV4A 2AQIA 1AZTA 2R6AA 2YVKA 1BJKA 1WMFA 1G8AA 3E3OA 2RGRA 3H17A 3WLAA 1R15A 2Q5IA 1KYTA 5EHZA 5AKLA 5EPUA 1XQXA 2BDTA 1D2RA 1W5SA 1H0RA 1WXDA 4D8TA 4ERXA 1SBHA 3TEMA 1PV2A 4LBYA 1I36A 2ORWA 3LDFA 1ADCA 1P5FA 4DV5B 2HHAA 1YHNA 3CN9A 5DX8A 3HTXA 4WFQA 1QYWA 3KBBA 2VBGA 1E1YA 4ZREA 2J5XA 4C76A 4Z4CA 3K71B 2JGKA 4X1KB 1G5QA 4F04A 3ZVNA 3EIWA 2OORC 4HAIA 3G0DA 5EZQA 5DLPA 4KVFA 1X8XA 2VAVA 3EPKA 1E9AA 2PRKA 2Y05A 1OBFO 3DDCA 2XY4A 4NK5A 3QEBZ 4MRAA 7REQB 3PQDA 4KVAA 1RJWA 3FMGA 3HHPA 3H1FA 3IQHX 2VDWB 3CKYA 3I42A 3CW2A 1YOVB 1TZ2A 4J3NA 2W37A 1ANKA 5KKCA 4G2NA 2JI4A 3SYKA 1XFAA 1XEXB 3IQIX 5TX7A 3HDJA 4HDKA 3ZHCA 4YXWD 5B5SA 3I2FA 3BH6A 3HJAA 5KTOA 1YACA 5A4IS 1F6DA 4JCOA 2OILA 5HQJA 5B58C 4Q3OA 3FGZA 3ENZA 3QKSB 2IEDA 1DAEA 2PSJA 1K8YB 2R66A 1L4LA 3AILA 2VTBA 4B4UA 1K68A 1QYXA 5TRDA 2W6OA 4FYJA 4B3HA 2HGSA 3E3LA 1YJ5A 3JRXA 4R0NA 1RCUA 1R0XA 3EPPA 1CJCA 1L4UA 4RPJA 5SZIA 2QX4A 3A70A 4Z4EA 5B1HA 2V7WA 5HJEA 5L4NA 2BRUA 2CNWA 1E3DA 1L7VC 2EKZA 3MLAA 2XYRA 4YLYA 3TUIC 1L4FA 1GNVA 5BW5A 1KAEA 3S55A 3R0QA 1K66A 2RDMA 4X1IA 2QTNA 1E9BA 1ZM4A 1ND6A 3U3OA 2ASEA 2P5UA 2YMQA 5AI4A 3WLLA 4I5IA 1H22A 2MJLA 4J7AA 5BV8A 1OASA 3LCUA 5AKJA 4NI5A 3N58A 2QX9A 4YRIA 3DXXA 1XL0A 4O29A 1T15A 4B09A 1KQPA 3UOGA 1SCQA 2IA5A 2ZAIA 3DC2A 5CPFA 2AEJA 4RCVA 2Q7OE 2I8LA 4JBLA 5CVUA 5L45A 2NU6A 4RVGA 1IEXA 5AQ1A 4OPOA 2EAUA 4TXHA 2J3QA 3ZU5A 5F7ZA 3V4RA 2QSJA 2Q9AA 3ZGYA 4NABA 5LQJA 1LQ2A 3THXA 3C5HA 5EE5B 5C81A 3MRVA 1D09A 2I6QA 4O2BF 5E7JA 2EFCB 1TA0A 1J2RA 1WSVA 1IY2A 4P4NA 3JR7A 4TLDA 3KPYA 1JG3A 1M6EX 2ZAOA 3BB1A 1J23A 3CLHA 3MZ0A 1TD1A 3OH8A 4J7CA 4IWNA 4U7DA 5ICEA 3KYCA 4WZAB 2R8PA 3H04A 1XN4A 5MN6A 3CZMA 4C0SA 2RGNA 4ZVRA 2A35A 2CL0X 2YCBA 4HDSA 3RK1A 3EX7C 2NXNA 5KWVA 5IBRA 1ZH6A 3MJTA 3GRZA 2H1RA 5T57A 2GARA 2QPLA 3RFUA 4FKMA 3ORQA 4MKIA 4M4SA 1GZDA 3Q1LA 4B2LA 4DS3A 5IYQA 5IJZA 1F1BA 2IFTA 3OIWA 2JEYA 3KZOA 4FDUA 2ADMA 3ZCSA 3DTVD 4MWCA 5CDUA 1UBFA 2Y4NA 1YZHA 4I4NA 2I4LA 2QSYA 4LHXA 4W4TA 1S72B 1VCNA 5FTNA 1L7EA 1U1DA 5KC8A 4F85A 5FO1A 3GJXC 4A26A 1UAAA 1TMGE 1MD9A 2EP5A 1PR4A 2GKGA 5GPBA 4GX5A 3L6BA 4LDJA 4DDMA 1HFKA 1X38A 2OGTA 5GY7A 2VHJA 3LC2O 2B69A 4NAHA 1K2WA 1CT9A 4KKSA 3QVXA 1FDTA 1LXCA 3OFNA 2IUSA 1PJ4A 1MAVA 3DYIA 3M6MD 4RSRA 3CM0A 1CJTC 1FOEB 1SC1A 3IIMA 3NE5B 4HQFA 1NLZA 4NF2A 3O8LA 3CUVA 3A28A 4KQMA 1QSGA 1WNTA 4OO3A 5D3MA 2YOGA 3OD5A 4BNTA 3V46A 2XVMA 4PABA 2R62A 3RADC 1FNBA 2RHGB 1KTIA 3AKYA 2QTAA 4FFLA 4RM2A 1N6LA 2HJRA 1SA0B 1F8GA 1K5PA 2QRVA 5EZYF 2DQZA 3CZ9A 2VK4A 2O4UX 3HS3A 1NVGA 2XWJI 2GF9A 3HBLA 2EDCA 1IIBA 1FP6A 2B2NA 3K6RA 3R3HA 2X0KA 4HMOA 3QE3A 2BHRA 3BHIA 4LTMA 4CV0A 4EG4A 3W1VA 5FB3A 3RD5A 3PUVA 5LL6P 4F1WA 1RI2A 3OQHA 4QAQA 1J1UA 3B7WA 3KDAA 2P75A 3L01A 5DZSA 3BSFA 1Z6PA 3TIIA 4Q7JB 2GD0A 3PVZA 4QOIA 3VZSA 2XOKA 1JFFA 2PG3A 4ND8A 5CG2A 3V00A 3PK0A 1Y0BA 2HJSA 1ZD3A 2CXXA 4HDCA 5HCUA 3BM5A 4DR7B 4L8YA 1JIXA 1M7GA 3HYSA 1NOKA 3LBNA 3Q3VA 2F1JA 1GFZA 4O02B 5TPWB 5JEDA 4HAUA 4AVZA 3GVXA 5JY6A 5C53B 1IWBB 1IJKA 1OPXA 2XCLA 1ZONA 2FA9A 3ONNA 2J3MA 3RU7A 4CM3A 2ZJFA 4II3A 4C2BA 3RC3A 2ANBA 3I9FA 4NY1A 2BH9A 2WINI 1Q9SA 3B3FA 4QUGA 3JZAA 1HVXA 3GRYA 4IQ8A 1NHGA 1YRQA 4K2HA 4AK9A 3D2AA 3EQ8A 3NM4A 4NDAA 1OZGA 3KAPA 1GA6A 3W6ZA 3H3FA 1Q11A 2Z4TA 4CKBA 5KQMA 4P1VA 3O1LA 2J9FA 1M74A 1VA5A 2ZBRA 3R5JA 4G4SO 3MS4A 1B93A 2JFBA 3HJTA 4IUBS 3DAGA 5MFZA 3PFIA 4KWEA 1HURA 3IR5A 1V48A 1VPDA 2V4MA 4MVYA 2CBXA 4OJKA 3WHKA 2FN8A 4N03A 2RGUA 4MO2A 3FNEA 3BH7A 4IOMA 3Q8XB 5EESA 2BKUA 3VSEA 5HZKA 2I3BA 2HPHA 2GPBA 3KTOA 2WQ6A 2C4MA 1V9LA 4MV0A 4NEGA 3PHLA 2PD4A 2PUCA 1A4IA 2IDKA 2W6ZA 3TK1A 1J0EA 1Z08A 1Q0TA 1UMKA 5KJFA 4HN9A 1N8KA 3NTRA 4WJZA 2ZDGA 3MWEB 2UZIR 3UK1A 3ZU6A 1F5SA 3ROKA 3BK1A 3TCKA 4BNGA 1T2CA 2NAPA 2PXAA 1L1QA 2B8WA 1GA1A 2OXCA 4FE3A 4WNAA 1PFGA 1RC8A 1EZ4A 1EK6A 4AFNA 1UXHA 5FPQA 5LP1A 1NRWA 2FWJA 2XRYA 1K0FA 2GVDC 1ZFNA 2VPPA 4YRLA 5G4KB 2H1LA 3O4RA 3KFVA 1ECCA 4QPJC 3MCTA 4M1OA 4U02A 4AD8A 2YMMA 2GBGA 4WCVA 4RORA 4WKOA 3V2IA 1IHMA 1UK7A 1Y1QA 4J0FA 3D6FA 5AK6A 4MVJF 3LU1A 2O2ZA 5EIBC 2QMUA 4ND4A 5EZ6B 1VL2A 4YK7A 2CF4A 3DEIA 1ZD5A 4MA4A 1RRGA 1P0MA 4Q9NA 4MDEA 3OURA 2NSLA 4BRUA 2HLHA 4DHEA 5IKXA 3S5UA 3N2GA 2FWRA 1M1ZA 5LDHA 4TL7A 1KQ3A 2FSHA 2VBIA 1YIJB 2WPNA 4OHKA 4CLRB 1SHLA 5JAOA 4UD2A 1O03A 3GEMA 4LF6B 3FZGA 4TSFD 3NHLA 6ABPA 4LE0A 4X20B 1EZ1A 2EG5A 4DLSA 1C0PA 1GWNA 1VCMA 3AJEA 5E4JA 4ZCTA 1W581 3BGDA 1QOQB 3BWYA 4IJ6A 4O0MA 4LY3A 4D0SA 4HNAB 2FWAA 5AVVA 1Y6FA 5FBQB 2PLNA 2PT9A 4JEHA 4CVNA 1OIWA 2RH5A 1NMEA 2PGNA 3AY7A 2WZQA 1C29B 4R9UC 5F2KA 2JKYA 4LGVA 5A4FS 1NBHA 1PD1A 3BSSA 3GEHA 4OHXA 4QBKA 4Z8XA 4BKMA 4DAEA 4I8DA 2HXYA 3V8RA 2Y1KA 3IKVA 3DDYA 1V5IA 4B85A 4E4RA 3EUAA 5TPZD 2DY1A 1CVLA 3EZ6A 3UMJA 2OV3A 3G5UA 4J0DA 4R41A 2FPXA 3DL2A 2E55A 4OXKA 3SPXA 1QNFA 1JALA 3ODGA 4WT7A 3L04A 3PC3A 3M34A 1UC4B 2GOYA 3GFVA 3QMWA 1VCOA 5HILA 3M2TA 1YVRA 4JJ7A 1NDQA 1E3JA 4OQEA 3L1KA 3BILA 2OHVA 4K9KA 1A2BA 1O96A 3HN2A 1Y9JA 3SFTA 1QZUA 3W2GA 2ERYA 3E9RA 2Q4OA 1NWCA 2VPQA 3BMQA 3P0FA 1MOZA 1UJ5A 2O23A 1FMJA 1E8DA 3I9JA 3D7MA 1K06A 1J0XO 2Z43A 3TJRA 5DWDA 3UGTA 3T3OA 4LK2A 1YRWA 2JC3A 1HDOA 3G85A 1ZLXA 1S0UA 1ODSA 1EJ6A 5HFJA 1X1CA 2PMCA 2O1WA 2XMBA 1ZY2A 2XTNA 4RX1A 5DTQA 5B37A 2ACVA 5T4BA 1V11A 1U7WA 3MPUA 1DC8A 5AFSA 2HPZA 4YPOA 1MVNA 1Y0YA 3CP2A 3E61A 3QWFA 3WMRA 3F96A 3QWHA 1S2IA 4QTXA 4Z0NA 5C8XA 2I4MA 3T3DA 1EFUA 4LHYA 4EB0A 4EMTA 4V1CB 2QM7A 5AKYA 1KO4A 2VUIB 3ILYA 3EN0A 5E6SB 4AUMA 4B2YA 1Q0ZA 3CONA 5IFLA 3H84A 2OGUA 3KAKA 3U26A 4P5PA 1BMFD 2AN5A 1UODA 2X0NA 3D64A 2PT6A 4DK1A 4Q7QA 2OQVA 1Y3HA 1I0LA 1XZLA 2FW8A 3Q3IA 3RGWS 4P5EA 1HO3A 2BEJA 2CE2X 4OGKA 5EINA 2GA8A 4HS9A 2ZLBA 5KAPA 4IDAA 3S28A 3TFQA 4Z4SA 3TLKA 1W4AA 3OJEA 5BQ3A 5CDTA 4NONA 2DSNA 2B25A 3QW2A 1P0IA 4M1ZA 5J4YA 2VP2A 5EIBD 4F11A 1XJ5A 4FFRA 3OP1A 1YZGA 1SCDA 2VF5X 4OBEA 4TLMB 1KO8A 1G4AE 1Z6TA 1ZGBA 1FUUA 1Z8DA 4RGVA 5GTDA 2YVAA 4DIBA 1JBQA 1LVHA 3S2EA 4NAVA 1XEWY 1F2UB 3D3WA 3I0MA 1XRSB 2JA1A 1BE8A 5ALZA 1LH0A 2Q3LA 4B2IA 4RANA 2B0CA 1QHNA 2GD2A 2VXYA 3DV0B 1O6CA 4KL8S 3V3KA 3VV3A 3B12A 1QO0D 1MRNA 3BIJA 3H8SA 3Q4GA 1UIMA 1PCXA 3FNGA 4K6HA 4O4IB 4HPWA 1H1TA 3WB9A 2I6XA 2C7PA 1SVMA 3IEPA 4BNVA 1SURA 4V0MA 5LP6F 2QN8A 4EABA 2W2MA 3NFRA 2BMJA 1TADA 4BQFA 4XLFA 3A26A 1VIMA 1V8FA 4PAAA 2E9SA 4HEA6 4CMEC 4HX9A 1R50A 2DUWA 4HDOB 2JAUA 1RE0A 2WABA 1IVNA 1Y6JA 2AJTA 4Q03A 5FI5A 1YZYA 2ONJA 5ESRA 1TU4A 3I6BA 4WZLA 4LISA 4HDQB 5C5DA 3L3BA 1EX9A 2YDXA 1HETA 3VTZA 2UVQA 4HIZA 1X1QA 3Q7SA 5JFOA 2G0NA 3O03A 5EYPA 5IYZF 5JXIA 3HEMA 2GBFA 5TT0A 1Z4OA 3H7AA 2XEDA 1WTCA 2XNJA 2IHYA 1GITA 2VUUA 3JALB 3MTJA 1TFUA 2QXUA 4N0DA 5JNUA 4K8RB 4CGZA 2ZJ0A 2EFYA 3LQKA 5I9TA 3V7NA 1W2HA 5EUQB 3VDQA 4ZI3A 3MPOA 5J1TB 1GARA 4XGQA 4M3NA 1C4XA 1NSYA 2AYYA 3KYJB 1THZA 2IXFA 4XIFA 2VPXA 5F7XA 3AIIA 4PWZA 1Y7LA 2R86A 2P68A 3OZTA 2AG1A 5C2JB 3AB7A 4MQLA 1E4EA 1FX0B 3E2IA 1LBEA 4FGLA 4PLZA 4LJKA 5K6RA 3MVEA 3PJRA 2V5VA 4OPSA 2EEZA 4WFJA 2R1VA 4Q47A 5LDDC 2GJPA 3RBAA 1U11A 2YHIA 2HA5A 3IP9A 3UT5B 4HT3B 3SG0A 5L40A 2JFZA 1YL5A 2Y9MB 1R3UA 1RJ9B 1YDMA 5D3KA 5EJ5A 5E8JA 1GYPA 4GSKA 1W9XA 1KYZA 2DYKA 3I30X 1SC3A 6ADHA 2L82A 4U2DA 3CVUA 3VPAA 4OXIA 1PN3A 4KUEA 4ITVA 1E1KA 4EG0A 1D4OA 1JI3A 1K8XB 1KY5A 1OD6A 2P9YA 3QJYA 3CLTC 2WWVD 3N0VA 5CXQA 1QGUA 1Y9EA 4QEZA 2WJYA 3H6GA 1CZNA 3JAWB 2VK2A 1EGHA 2HCTA 1FS4A 5FX2A 1COWD 2K7FA 1VP3A 3LQYA 3SKXA 3FTCA 4E94A 4FKZA 3L07A 2X6XA 1J2EA 1WDLA 2AWNA 4EW3A 3ZBQA 3IAM6 3HKBA 4Q7KA 4Q93A 2GKSA 3U4QB 3TQCA 5IM4F 3R6LA 4KDFA 1O97C 2AA3A 3QF4B 4MS3A 5IKMA 1OBHA 2W2VA 3WJ1A 1NW6A 3AV0B 2AMLA 5DBIA 1JAHA 3H6HA 2MDTA 5L3RA 3WLHA 3CCUB 1DTWA 2VYNA 4GOKA 1L9XA 4XFKA 3RIXA 6NULA 3NEAA 1QX4A 3FLEA 5B1EA 1NVWQ 4J0EA 3CSDA 4DK0A