5F4OA

Protruding domain of gii.17 norovirus kawasaki308
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
307
structure length
305
Chain Sequence
SKPFSLPILTLSELTNSRFPVPIDSLFTAQNNQVQCQNGRCTLDGELQGTTQLLPTGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGMVSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVNDDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIIDCLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLVVPANGHFRFDSWVNQFYSLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein VP1
publication title Structural Evolution of the Emerging 2014-2015 GII.17 Noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gii/jp/2015/gii.p17_gii.17/kawasaki308
total genus 71
structure length 305
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5f4oA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5f4oA01
4Z4ZA 3PA2A 4Z4UA 3ASSA 3Q39A 4OOSA 2ZL7A 4QV2A 3LQEA 4X7DA 3R6JA 3ONUA 4OPOA 4RDLA 4WZTA 4P3IA 3D26A 5KW9A 5F4MA 5J3OA 5E6TA 4Z4WA 3R6KA 4WZEA 2OBTA 3PA1A 5J35A 2OBRA 2OBSA 4P26A 4QVAA 5IYQA 3SLNA 5IYNA 4OOXA 3Q6QA 3BY2A 4RM0A 4X7EA 4P25A 3LQ6A 4OP7A 3PUNA 5IYRA 2ZL6A 3RY8A 4ROXA 4RLZA 3BY1A 4OOVA 4X0CA 2ZL5A 3Q38A 3SEJA 5IYPA 3ONYA 4Z4SA 3Q6RA 3SLDA 3SJPA 3PUMA 4Z4YA 1IHMA 4P2NA 4QUZA 5BSYA 4Z4VA 4P12A 3ASPA 4X7CA 4X05A 4RDKA 5F4OA 4X06A 4QVJA 5IYWA 4X7FA 4Z4TA 4P1VA 5F4JA 3BQJA 3SKBA 4X07A 3ASRA 3V7AA 5HZAA 4RPDA 4RDJA 4Z4RA 4WZLA 4OPSA 5BSXA 3ASTA 4RPBA 4OPVA 3Q3AA 5HZBA 4WZKA 3PVDA 3ASQA
chains in the Genus database with same CATH superfamily
4FXUA 4U9UA 3BH4A 1F60A 4B43A 4Z4ZA 2V31A 1WOSA 4YXWA 1JNYA 2D74A 3W5VA 1ZM2A 1SM4A 1N06A 4C0SA 5GV7A 3H9NA 2J7KA 3ASSA 1WOPA 1QFZA 2ZITA 4ZCMA 1S0UA 4DK1A 3CMEB 2QA4B 5DN6A 1V0FA 2EIXA 3AGQA 2BVNA 2QN6A 1E3XA 3R6JA 4H9GA 2DEUA 2ZBVA 4TMVA 1WU8A 1EWYA 4P3IA 2GREA 1WP6A 3D26A 1I8DA 2ZTNA 1XFOA 4JMQA 3A1PA 5B6IA 5FNZA 4QHYA 5E6TA 2ZXHA 1BX1A 4P6YA 4Z4WA 3MCAA 1YLOA 3A8KA 2OBTA 1YX2A 1ZM4A 3PA1A 5J35A 2C4UA 2M5SA 2WZPP 1VHOA 3SJZA 4YHBA 3OW7A 1K28D 2BF4A 3CW2A 4P26A 4XLHA 1Q81D 1UD5A 4PC6A 4WQMA 5IYQA 2Z6BD 1NRKA 2YWFA 1MABA 4OOXA 4Q7JB 2VJJA 1N0UA 1BQEA 1EXMA 2BM0A 2C2WA 2CRVA 1M90D 2OTJB 4G6IA 4UZEA 2X53S 1HVXA 2GK7A 1G7TA 1KK2A 3CD6B 1I7PA 3OE7A 2BSAA 1RQPA 2ZL6A 2HLDA 4KKTA 3AVYA 2X85A 2CBXA 1N8RD 3RY8A 1Q9SA 1W9XA 4RLZA 2F1LA 4MYTA 4YEJA 1EP1B 3I1FA 3BY1A 3J81k 4TMWA 4ZCLA 3AVWA 3Q38A 3WNDA 3G6EB 4XN3A 1E63A 1R5NA 1Q7YD 3HAGA 2W6IA 4AC9A 5A89A 1DG1G 4Z4SA 1KZLA 3A8JA 4M1KA 4WWVA 1V5VA 1VHEA 3PUMA 4B3FX 3KEWA 4N3GA 4DNRB 2WPDA 2NV4A 4Z4VA 4M2LA 1OGJA 3CCLB 2DYIA 1BJKA 3WBJA 4AF6A 1FNBA 3A8IA 4IW3B 1S4MA 4XLCA 1UD6A 2DCUA 1J9ZA 1OB0A 1WSRA 1IJEA 5F4OA 4PAAA 3CTAA 1YJWB 5A88A 3W2EA 1SKQA 4P1VA 2V4DA 4TMXA 2C5HA 4RD6A 4RD0A 1E1RA 2HMAA 4NCNA 1UMKA 2V7TA 3CPXA 1JB9A 3V7AA 2R6HA 4B47A 2HDNB 3KL9A 5TR9A 4BPRA 3LNNA 1CQXA 4ZGNB 2XNDA 2CF4A 1NB9A 4II2A 1EFTA 3W5HA 2WR8A 2WJYA 3BC9A 3AGPA 1QFYA 4RPBA 1TVCA 4DQKA 1D1NA 5KSWB 4RD1A 1SKYB 3QFCA 3OW2B 4XMYA 3PENA 2V7XA 4LC0A 1VQPB 1T6ZA 3CCEB 4XN0A 3AVUA 3MHPA 3ZBUA 1FNCA 1XE1A 3P26A 5TRDA 3W2IA 2Q6LA 3PA2A 4G1VA 4G7WA 2ZL7A 1XB2A 1E3ZA 2HCJB 4FK8A 4M0LA 1VQNB 1OGIA 4XKVA 3A3BA 4QV2A 1NBMA 1H8EA 2AHOA 3LQEA 4X7DA 2EFGA 3OP1A 4Y9RA 1QUFA 1FNMA 4WZTA 3VMFA 5FO1A 4MYUA 3W2GA 1VQMB 1QGAA 1KTVA 2VBTA 5KW9A 5J3OA 1MRZA 4XD7A 1W0KA 2WJVA 2VBSA 1E62A 4J0QA 4NNJA 1QVGB 2X6WA 4ACBA 4QVAA 1KD1D 4UZUA 3VO2A 3SLNA 5IYNA 4XONA 3WNCA 3DDYA 1GR1A 2OK8A 3BY2A 2XZOA 1AMOA 3QSYA 4X7EA 3JU4A 4P25A 3CCJB 5TY0A 1VQOB 2PIAA 1DARA 3LQ6A 2GJKA 4OP7A 4B4DA 1UD3A 3FPPA 5JBQA 4Y9UA 2DOGA 3CCRB 3OEEA 4QFMA 1T6XA 1E79A 2D3NA 4ROXA 2C5BA 4XLEA 1K8AD 1VQ6B 1W35A 3E1YE 5FO0A 3MMPA 1VQ7B 3SEJA 2P3MA 2Q6KA 2V7VA 3ONYA 1KJZA 3Q6RA 2E1RA 1DDIA 1ELOA 1KK3A 1UD8A 4CQJA 1NB0A 1PKVA 4P2NA 2CW5A 3GVJA 4QUZA 4P12A 3ZC3A 3ASPA 1OB2A 4G1BA 5FA6A 1OB5A 2BGJA 2LZJA 2XOKA 2RC5A 2B5OA 2X0KA 1N07A 1Q82D 5EMNA 2QTLA 2GK6A 3T51B 4ZGQB 4QVJA 1GAWA 2ZBUA 1H42A 3B8HA 4X7FA 1QVFB 2XZLA 1KQSB 5F4JA 4PC2A 3CCVB 3BQJA 4P6VF 3SKBA 1QGYA 3B82A 2F43A 2XEXA 4YALA 1VQ8B 5L46A 3ASRA 1QGZA 3GVLA 4E0FA 2X3UA 1YITB 4RDJA 1N05A 4OPSA 4OPVA 3QFTA 4NBSA 3OZUA 4N3NA 4B3GA 3OOCA 2PLFA 4UZFA 4ZV4A 3VNUA 3WXMA 3PVDA 3ASQA 2QEXB 1K73D 1PJ5A 3OJWA 3ZZUA 4YAFA 3WNBA 3ZZTA 1KC8D 4OOSA 2YWEA 4Y7CA 1F20A 4LBVA 3V76A 2VJIA 5H5JA 2BMWA 2WZNA 1HZEA 2D3LA 1D8TA 1GAQA 1OHHA 2CK3A 1FDRA 3ZUGA 1H85A 4DK0A 1T6YA 1U2RA 1W34A 3JQQA 4PC3A 3ZZ0A 1TUIA 2XZPA 3CP8A 3OAAA 4P22A 5DS0A 1VQ9B 1PJ7A 1T5EA 4ASUA 3R6KA 1I18A 3GVKA 1QG0A 5IK2A 3CPWB 3W2FA 3VR6A 1AIPA 1KK0A 4DNTB 1JA0A 1K9MD 3E20A 4TSFA 4XM3A 1V0EA 2X6XA 4L8JA 3G05A 5GV8A 3OJXA 2XNCA 3CCUB 1FRQA 1QH0A 3CXCB 2V7QA 1JA1A 1IJFA 2BGIA 3CP2A 3LO8A 4AVZA 3BNWA 3T56B 1W2BB 3OZWA 1FRNA 1Y0RA 1QX4A 5A8AA 4HE5A 3OPOA 3CESA 2R9VA 1E43A 2YWGA 1BX0A 4RD2A 4M53A 4TN1A 2W6JA 4PABA 2NPFA 1B2RA 1EFRA 3OEHA 4B3XA 3A3GA 3GQBA 1G7CA 2XNJA 4OOVA 4Z1MA 3QFSA 3W2HA 4RD4A 2ZL5A 2GPJA 4FWTA 1EFCA 1RQRA 2JJ1A 1KK1A 3SLDA 4Z4YA 2VBVA 4XNFA 2KVOA 3WYAA 3CCQB 5BSYA 1N08A 1KRHA 2X6YA 5H59A 3CMAB 1COWA 2DY1A 2OK7A 1YIJB 1WTHD 3OZVA 2VNIA 5HKKA 5KNLA 1UD4A 2D9RA 1BLIA 3QE2A 3GSIA 3W5UA 1G7RA 2FX3A 4TKOB 4RDKA 2JN9A 4X06A 2QE7A 3ISXA 4RJLA 4Z4TA 3VNVA 5FL7A 4XORA 4PC7A 1QUEA 4X07A 3BCDA 4RCZA 1JJ2B 3U2QA 4II3A 3U6KA 4KKSA 4GQNA 3CC2B 3H94A 1M1KD 1D2EA 4XKWA 3T53B 5HZAA 4Z4RA 1FNDA 1IB0A 1CNFA 4WZLA 1N0VC 5CDFA 5BSXA 1VLYA 1WOOA 2VYQA 4TMTA 1EFUA 1YJ9B 3FKSA 3CCSB 1EP3B 4UAJA 3WQZA 5THXA 3G71B 4PC1A 1DDGA 4WZKA 2ZTGA 2OBSA 1W87A 3ZPNA 3U6BA 3AVXA 1VLOA 1GVHA 1YI2B 1GO2A 4YELA 2CC2A 5DSZA 1BMFA 5HXBA 2XGJA 1WDTA 4XOPA 4Z4UA 1NJID 3Q39A 1R5OA 2C77A 1GJRA 2PE3A 4XR6A 2DIEA 2VNKA 2QMUA 3B78A 4G7XA 1VQ4B 4XL9A 3ONUA 4LBZA 2QGGA 4OPOA 4ZCIA 2VNHA 4RDLA 1TTTA 4F7DA 5FIUA 2B7CA 3CC4B 1FX0A 1ZM3A 1G7SA 1H8HA 4TT3A 2GJPA 5F4MA 3AVTA 4HE6A 1QFJA 3CC7B 2V7WA 4WZEA 4AF7A 2OBRA 3OFNA 3FJOA 1TLLA 2RC6A 2PMDA 3ZBTA 1UD2A 2WSSA 2BV3A 3I55B 4EH1A 1E64A 4X8IA 1P4MA 3A35A 3Q6QA 2OYNA 4G5GA 4YAWA 4RM0A 3BCFA 2Q6IA 1VQ5B 3PUNA 3FPKA 3CRZA 3ZIAA 2JIZA 4LBWA 5IYRA 2ZZGA 3CCMB 3NE5B 3GIRA 2V7UA 1YJNB 4KKUA 4C43A 2Q6OA 2C4TA 2QTZA 3LVBA 4HIZA 3JQPA 4ACAA 1EP2B 1PJ6A 2BN4A 2X8KA 2VBUA 1R5BA 4X0CA 1VQLB 3I56B 2YWHA 3QFRA 4P3YA 5IYPA 4FN5A 1Y0YA 2ZXIA 3CMMA 2C78A 1VF7A 2B7BA 1A8PA 1ZM9A 1KMHA 1XQBA 2E1BA 3SJPA 3WBKA 3ES9A 4XOTA 2VZLA 2DETA 1IHMA 3VO1A 5LMZA 4LBYA 4TMZA 1ZUNB 1B23P 2CNDA 4XQFA 4X7CA 2GJRA 4X05A 2ZZEA 4M4SA 2ZZQA 4B44A 4RCYA 4XLAA 3WY9A 2GQFA 1W0JA 1VJSA 1WSVA 5IYWA 3CB4A 4YAOA 2I1LA 4R71A 2F1MA 1BPLA 1WORA 2BPOA 3G4SB 2VNJA 1HA3A 4YAUA 2DERA 4PGOA 4RPDA 4B48A 3JQRA 2BM1A 3AVVA 2JJ2A 4K1XA 4XLFA 1S72B 1NDHA 3P27A 1Q86D 4P9SA 1YHQB 3ASTA 1CNEA 2F4NA 1WPCA 2FVGA 1E1QA 2ZZFA 2JDIA 2WYRA 4DQLA 2QDXA 5AN9A 5TV2A 3Q3AA 1VQKB 3OKXA 5HZBA 2OTLB 4RD3A
chains in the Genus database with same CATH topology
4Z4ZA 3PA2A 4Z4UA 3ASSA 3Q39A 4OOSA 2ZL7A 4QV2A 3LQEA 4X7DA 3R6JA 3ONUA 4OPOA 4RDLA 4WZTA 4P3IA 3D26A 5KW9A 5F4MA 5J3OA 5E6TA 4Z4WA 3R6KA 4WZEA 2OBTA 3PA1A 5J35A 2OBRA 2OBSA 4P26A 4QVAA 5IYQA 3SLNA 5IYNA 4OOXA 3Q6QA 3BY2A 4RM0A 4X7EA 4P25A 3LQ6A 4OP7A 3PUNA 5IYRA 2ZL6A 3RY8A 4ROXA 4RLZA 3BY1A 4OOVA 4X0CA 2ZL5A 3Q38A 3SEJA 5IYPA 3ONYA 4Z4SA 3Q6RA 3SLDA 3SJPA 3PUMA 4Z4YA 1IHMA 4P2NA 4QUZA 5BSYA 4Z4VA 4P12A 3ASPA 4X7CA 4X05A 4RDKA 5F4OA 4X06A 4QVJA 5IYWA 4X7FA 4Z4TA 4P1VA 5F4JA 3BQJA 3SKBA 4X07A 3ASRA 3V7AA 5HZAA 4RPDA 4RDJA 4Z4RA 4WZLA 4OPSA 5BSXA 3ASTA 4RPBA 4OPVA 3Q3AA 5HZBA 4WZKA 3PVDA 3ASQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4Z A;  3PA2 A;  4Z4U A;  3ASS A;  3Q39 A;  4OOS A;  2ZL7 A;  4QV2 A;  3LQE A;  4X7D A;  3R6J A;  3ONU A;  4OPO A;  4RDL A;  4WZT A;  4P3I A;  3D26 A;  5KW9 A;  5F4M A;  5J3O A;  5E6T A;  4Z4W A;  3R6K A;  4WZE A;  2OBT A;  3PA1 A;  5J35 A;  2OBR A;  2OBS A;  4P26 A;  4QVA A;  5IYQ A;  3SLN A;  5IYN A;  4OOX A;  3Q6Q A;  3BY2 A;  4RM0 A;  4X7E A;  4P25 A;  3LQ6 A;  4OP7 A;  3PUN A;  5IYR A;  2ZL6 A;  3RY8 A;  4ROX A;  4RLZ A;  3BY1 A;  4OOV A;  4X0C A;  2ZL5 A;  3Q38 A;  3SEJ A;  5IYP A;  3ONY A;  4Z4S A;  3Q6R A;  3SLD A;  3SJP A;  3PUM A;  4Z4Y A;  1IHM A;  4P2N A;  4QUZ A;  5BSY A;  4Z4V A;  4P12 A;  3ASP A;  4X7C A;  4X05 A;  4RDK A;  5F4O A;  4X06 A;  4QVJ A;  5IYW A;  4X7F A;  4Z4T A;  4P1V A;  5F4J A;  3BQJ A;  3SKB A;  4X07 A;  3ASR A;  3V7A A;  5HZA A;  4RPD A;  4RDJ A;  4Z4R A;  4WZL A;  4OPS A;  5BSX A;  3AST A;  4RPB A;  4OPV A;  3Q3A A;  5HZB A;  4WZK A;  3PVD A;  3ASQ A; 
#chains in the Genus database with same CATH topology
 4FXU A;  4U9U A;  3BH4 A;  1F60 A;  4B43 A;  4Z4Z A;  2V31 A;  1WOS A;  4YXW A;  1JNY A;  2D74 A;  3W5V A;  1ZM2 A;  1SM4 A;  1N06 A;  4C0S A;  5GV7 A;  3H9N A;  2J7K A;  3ASS A;  1WOP A;  1QFZ A;  2ZIT A;  4ZCM A;  1S0U A;  4DK1 A;  3CME B;  2QA4 B;  5DN6 A;  1V0F A;  2EIX A;  3AGQ A;  2BVN A;  2QN6 A;  1E3X A;  3R6J A;  4H9G A;  2DEU A;  2ZBV A;  4TMV A;  1WU8 A;  1EWY A;  4P3I A;  2GRE A;  1WP6 A;  3D26 A;  1I8D A;  2ZTN A;  1XFO A;  4JMQ A;  3A1P A;  5B6I A;  5FNZ A;  4QHY A;  5E6T A;  2ZXH A;  1BX1 A;  4P6Y A;  4Z4W A;  3MCA A;  1YLO A;  3A8K A;  2OBT A;  1YX2 A;  1ZM4 A;  3PA1 A;  5J35 A;  2C4U A;  2M5S A;  2WZP P;  1VHO A;  3SJZ A;  4YHB A;  3OW7 A;  1K28 D;  2BF4 A;  3CW2 A;  4P26 A;  4XLH A;  1Q81 D;  1UD5 A;  4PC6 A;  4WQM A;  5IYQ A;  2Z6B D;  1NRK A;  2YWF A;  1MAB A;  4OOX A;  4Q7J B;  2VJJ A;  1N0U A;  1BQE A;  1EXM A;  2BM0 A;  2C2W A;  2CRV A;  1M90 D;  2OTJ B;  4G6I A;  4UZE A;  2X53 S;  1HVX A;  2GK7 A;  1G7T A;  1KK2 A;  3CD6 B;  1I7P A;  3OE7 A;  2BSA A;  1RQP A;  2ZL6 A;  2HLD A;  4KKT A;  3AVY A;  2X85 A;  2CBX A;  1N8R D;  3RY8 A;  1Q9S A;  1W9X A;  4RLZ A;  2F1L A;  4MYT A;  4YEJ A;  1EP1 B;  3I1F A;  3BY1 A;  3J81 k;  4TMW A;  4ZCL A;  3AVW A;  3Q38 A;  3WND A;  3G6E B;  4XN3 A;  1E63 A;  1R5N A;  1Q7Y D;  3HAG A;  2W6I A;  4AC9 A;  5A89 A;  1DG1 G;  4Z4S A;  1KZL A;  3A8J A;  4M1K A;  4WWV A;  1V5V A;  1VHE A;  3PUM A;  4B3F X;  3KEW A;  4N3G A;  4DNR B;  2WPD A;  2NV4 A;  4Z4V A;  4M2L A;  1OGJ A;  3CCL B;  2DYI A;  1BJK A;  3WBJ A;  4AF6 A;  1FNB A;  3A8I A;  4IW3 B;  1S4M A;  4XLC A;  1UD6 A;  2DCU A;  1J9Z A;  1OB0 A;  1WSR A;  1IJE A;  5F4O A;  4PAA A;  3CTA A;  1YJW B;  5A88 A;  3W2E A;  1SKQ A;  4P1V A;  2V4D A;  4TMX A;  2C5H A;  4RD6 A;  4RD0 A;  1E1R A;  2HMA A;  4NCN A;  1UMK A;  2V7T A;  3CPX A;  1JB9 A;  3V7A A;  2R6H A;  4B47 A;  2HDN B;  3KL9 A;  5TR9 A;  4BPR A;  3LNN A;  1CQX A;  4ZGN B;  2XND A;  2CF4 A;  1NB9 A;  4II2 A;  1EFT A;  3W5H A;  2WR8 A;  2WJY A;  3BC9 A;  3AGP A;  1QFY A;  4RPB A;  1TVC A;  4DQK A;  1D1N A;  5KSW B;  4RD1 A;  1SKY B;  3QFC A;  3OW2 B;  4XMY A;  3PEN A;  2V7X A;  4LC0 A;  1VQP B;  1T6Z A;  3CCE B;  4XN0 A;  3AVU A;  3MHP A;  3ZBU A;  1FNC A;  1XE1 A;  3P26 A;  5TRD A;  3W2I A;  2Q6L A;  3PA2 A;  4G1V A;  4G7W A;  2ZL7 A;  1XB2 A;  1E3Z A;  2HCJ B;  4FK8 A;  4M0L A;  1VQN B;  1OGI A;  4XKV A;  3A3B A;  4QV2 A;  1NBM A;  1H8E A;  2AHO A;  3LQE A;  4X7D A;  2EFG A;  3OP1 A;  4Y9R A;  1QUF A;  1FNM A;  4WZT A;  3VMF A;  5FO1 A;  4MYU A;  3W2G A;  1VQM B;  1QGA A;  1KTV A;  2VBT A;  5KW9 A;  5J3O A;  1MRZ A;  4XD7 A;  1W0K A;  2WJV A;  2VBS A;  1E62 A;  4J0Q A;  4NNJ A;  1QVG B;  2X6W A;  4ACB A;  4QVA A;  1KD1 D;  4UZU A;  3VO2 A;  3SLN A;  5IYN A;  4XON A;  3WNC A;  3DDY A;  1GR1 A;  2OK8 A;  3BY2 A;  2XZO A;  1AMO A;  3QSY A;  4X7E A;  3JU4 A;  4P25 A;  3CCJ B;  5TY0 A;  1VQO B;  2PIA A;  1DAR A;  3LQ6 A;  2GJK A;  4OP7 A;  4B4D A;  1UD3 A;  3FPP A;  5JBQ A;  4Y9U A;  2DOG A;  3CCR B;  3OEE A;  4QFM A;  1T6X A;  1E79 A;  2D3N A;  4ROX A;  2C5B A;  4XLE A;  1K8A D;  1VQ6 B;  1W35 A;  3E1Y E;  5FO0 A;  3MMP A;  1VQ7 B;  3SEJ A;  2P3M A;  2Q6K A;  2V7V A;  3ONY A;  1KJZ A;  3Q6R A;  2E1R A;  1DDI A;  1ELO A;  1KK3 A;  1UD8 A;  4CQJ A;  1NB0 A;  1PKV A;  4P2N A;  2CW5 A;  3GVJ A;  4QUZ A;  4P12 A;  3ZC3 A;  3ASP A;  1OB2 A;  4G1B A;  5FA6 A;  1OB5 A;  2BGJ A;  2LZJ A;  2XOK A;  2RC5 A;  2B5O A;  2X0K A;  1N07 A;  1Q82 D;  5EMN A;  2QTL A;  2GK6 A;  3T51 B;  4ZGQ B;  4QVJ A;  1GAW A;  2ZBU A;  1H42 A;  3B8H A;  4X7F A;  1QVF B;  2XZL A;  1KQS B;  5F4J A;  4PC2 A;  3CCV B;  3BQJ A;  4P6V F;  3SKB A;  1QGY A;  3B82 A;  2F43 A;  2XEX A;  4YAL A;  1VQ8 B;  5L46 A;  3ASR A;  1QGZ A;  3GVL A;  4E0F A;  2X3U A;  1YIT B;  4RDJ A;  1N05 A;  4OPS A;  4OPV A;  3QFT A;  4NBS A;  3OZU A;  4N3N A;  4B3G A;  3OOC A;  2PLF A;  4UZF A;  4ZV4 A;  3VNU A;  3WXM A;  3PVD A;  3ASQ A;  2QEX B;  1K73 D;  1PJ5 A;  3OJW A;  3ZZU A;  4YAF A;  3WNB A;  3ZZT A;  1KC8 D;  4OOS A;  2YWE A;  4Y7C A;  1F20 A;  4LBV A;  3V76 A;  2VJI A;  5H5J A;  2BMW A;  2WZN A;  1HZE A;  2D3L A;  1D8T A;  1GAQ A;  1OHH A;  2CK3 A;  1FDR A;  3ZUG A;  1H85 A;  4DK0 A;  1T6Y A;  1U2R A;  1W34 A;  3JQQ A;  4PC3 A;  3ZZ0 A;  1TUI A;  2XZP A;  3CP8 A;  3OAA A;  4P22 A;  5DS0 A;  1VQ9 B;  1PJ7 A;  1T5E A;  4ASU A;  3R6K A;  1I18 A;  3GVK A;  1QG0 A;  5IK2 A;  3CPW B;  3W2F A;  3VR6 A;  1AIP A;  1KK0 A;  4DNT B;  1JA0 A;  1K9M D;  3E20 A;  4TSF A;  4XM3 A;  1V0E A;  2X6X A;  4L8J A;  3G05 A;  5GV8 A;  3OJX A;  2XNC A;  3CCU B;  1FRQ A;  1QH0 A;  3CXC B;  2V7Q A;  1JA1 A;  1IJF A;  2BGI A;  3CP2 A;  3LO8 A;  4AVZ A;  3BNW A;  3T56 B;  1W2B B;  3OZW A;  1FRN A;  1Y0R A;  1QX4 A;  5A8A A;  4HE5 A;  3OPO A;  3CES A;  2R9V A;  1E43 A;  2YWG A;  1BX0 A;  4RD2 A;  4M53 A;  4TN1 A;  2W6J A;  4PAB A;  2NPF A;  1B2R A;  1EFR A;  3OEH A;  4B3X A;  3A3G A;  3GQB A;  1G7C A;  2XNJ A;  4OOV A;  4Z1M A;  3QFS A;  3W2H A;  4RD4 A;  2ZL5 A;  2GPJ A;  4FWT A;  1EFC A;  1RQR A;  2JJ1 A;  1KK1 A;  3SLD A;  4Z4Y A;  2VBV A;  4XNF A;  2KVO A;  3WYA A;  3CCQ B;  5BSY A;  1N08 A;  1KRH A;  2X6Y A;  5H59 A;  3CMA B;  1COW A;  2DY1 A;  2OK7 A;  1YIJ B;  1WTH D;  3OZV A;  2VNI A;  5HKK A;  5KNL A;  1UD4 A;  2D9R A;  1BLI A;  3QE2 A;  3GSI A;  3W5U A;  1G7R A;  2FX3 A;  4TKO B;  4RDK A;  2JN9 A;  4X06 A;  2QE7 A;  3ISX A;  4RJL A;  4Z4T A;  3VNV A;  5FL7 A;  4XOR A;  4PC7 A;  1QUE A;  4X07 A;  3BCD A;  4RCZ A;  1JJ2 B;  3U2Q A;  4II3 A;  3U6K A;  4KKS A;  4GQN A;  3CC2 B;  3H94 A;  1M1K D;  1D2E A;  4XKW A;  3T53 B;  5HZA A;  4Z4R A;  1FND A;  1IB0 A;  1CNF A;  4WZL A;  1N0V C;  5CDF A;  5BSX A;  1VLY A;  1WOO A;  2VYQ A;  4TMT A;  1EFU A;  1YJ9 B;  3FKS A;  3CCS B;  1EP3 B;  4UAJ A;  3WQZ A;  5THX A;  3G71 B;  4PC1 A;  1DDG A;  4WZK A;  2ZTG A;  2OBS A;  1W87 A;  3ZPN A;  3U6B A;  3AVX A;  1VLO A;  1GVH A;  1YI2 B;  1GO2 A;  4YEL A;  2CC2 A;  5DSZ A;  1BMF A;  5HXB A;  2XGJ A;  1WDT A;  4XOP A;  4Z4U A;  1NJI D;  3Q39 A;  1R5O A;  2C77 A;  1GJR A;  2PE3 A;  4XR6 A;  2DIE A;  2VNK A;  2QMU A;  3B78 A;  4G7X A;  1VQ4 B;  4XL9 A;  3ONU A;  4LBZ A;  2QGG A;  4OPO A;  4ZCI A;  2VNH A;  4RDL A;  1TTT A;  4F7D A;  5FIU A;  2B7C A;  3CC4 B;  1FX0 A;  1ZM3 A;  1G7S A;  1H8H A;  4TT3 A;  2GJP A;  5F4M A;  3AVT A;  4HE6 A;  1QFJ A;  3CC7 B;  2V7W A;  4WZE A;  4AF7 A;  2OBR A;  3OFN A;  3FJO A;  1TLL A;  2RC6 A;  2PMD A;  3ZBT A;  1UD2 A;  2WSS A;  2BV3 A;  3I55 B;  4EH1 A;  1E64 A;  4X8I A;  1P4M A;  3A35 A;  3Q6Q A;  2OYN A;  4G5G A;  4YAW A;  4RM0 A;  3BCF A;  2Q6I A;  1VQ5 B;  3PUN A;  3FPK A;  3CRZ A;  3ZIA A;  2JIZ A;  4LBW A;  5IYR A;  2ZZG A;  3CCM B;  3NE5 B;  3GIR A;  2V7U A;  1YJN B;  4KKU A;  4C43 A;  2Q6O A;  2C4T A;  2QTZ A;  3LVB A;  4HIZ A;  3JQP A;  4ACA A;  1EP2 B;  1PJ6 A;  2BN4 A;  2X8K A;  2VBU A;  1R5B A;  4X0C A;  1VQL B;  3I56 B;  2YWH A;  3QFR A;  4P3Y A;  5IYP A;  4FN5 A;  1Y0Y A;  2ZXI A;  3CMM A;  2C78 A;  1VF7 A;  2B7B A;  1A8P A;  1ZM9 A;  1KMH A;  1XQB A;  2E1B A;  3SJP A;  3WBK A;  3ES9 A;  4XOT A;  2VZL A;  2DET A;  1IHM A;  3VO1 A;  5LMZ A;  4LBY A;  4TMZ A;  1ZUN B;  1B23 P;  2CND A;  4XQF A;  4X7C A;  2GJR A;  4X05 A;  2ZZE A;  4M4S A;  2ZZQ A;  4B44 A;  4RCY A;  4XLA A;  3WY9 A;  2GQF A;  1W0J A;  1VJS A;  1WSV A;  5IYW A;  3CB4 A;  4YAO A;  2I1L A;  4R71 A;  2F1M A;  1BPL A;  1WOR A;  2BPO A;  3G4S B;  2VNJ A;  1HA3 A;  4YAU A;  2DER A;  4PGO A;  4RPD A;  4B48 A;  3JQR A;  2BM1 A;  3AVV A;  2JJ2 A;  4K1X A;  4XLF A;  1S72 B;  1NDH A;  3P27 A;  1Q86 D;  4P9S A;  1YHQ B;  3AST A;  1CNE A;  2F4N A;  1WPC A;  2FVG A;  1E1Q A;  2ZZF A;  2JDI A;  2WYR A;  4DQL A;  2QDX A;  5AN9 A;  5TV2 A;  3Q3A A;  1VQK B;  3OKX A;  5HZB A;  2OTL B;  4RD3 A; 
#chains in the Genus database with same CATH homology
 4Z4Z A;  3PA2 A;  4Z4U A;  3ASS A;  3Q39 A;  4OOS A;  2ZL7 A;  4QV2 A;  3LQE A;  4X7D A;  3R6J A;  3ONU A;  4OPO A;  4RDL A;  4WZT A;  4P3I A;  3D26 A;  5KW9 A;  5F4M A;  5J3O A;  5E6T A;  4Z4W A;  3R6K A;  4WZE A;  2OBT A;  3PA1 A;  5J35 A;  2OBR A;  2OBS A;  4P26 A;  4QVA A;  5IYQ A;  3SLN A;  5IYN A;  4OOX A;  3Q6Q A;  3BY2 A;  4RM0 A;  4X7E A;  4P25 A;  3LQ6 A;  4OP7 A;  3PUN A;  5IYR A;  2ZL6 A;  3RY8 A;  4ROX A;  4RLZ A;  3BY1 A;  4OOV A;  4X0C A;  2ZL5 A;  3Q38 A;  3SEJ A;  5IYP A;  3ONY A;  4Z4S A;  3Q6R A;  3SLD A;  3SJP A;  3PUM A;  4Z4Y A;  1IHM A;  4P2N A;  4QUZ A;  5BSY A;  4Z4V A;  4P12 A;  3ASP A;  4X7C A;  4X05 A;  4RDK A;  5F4O A;  4X06 A;  4QVJ A;  5IYW A;  4X7F A;  4Z4T A;  4P1V A;  5F4J A;  3BQJ A;  3SKB A;  4X07 A;  3ASR A;  3V7A A;  5HZA A;  4RPD A;  4RDJ A;  4Z4R A;  4WZL A;  4OPS A;  5BSX A;  3AST A;  4RPB A;  4OPV A;  3Q3A A;  5HZB A;  4WZK A;  3PVD A;  3ASQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...