5F4OA

Protruding domain of gii.17 norovirus kawasaki308
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
307
structure length
305
Chain Sequence
b'SKPFSLPILTLSELTNSRFPVPIDSLFTAQNNQVQCQNGRCTLDGELQGTTQLLPTGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGMVSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVNDDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIIDCLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLVVPANGHFRFDSWVNQFYSLAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
molecule tags Viral protein
source organism Norovirus hu/gii/jp/2015/gii.p17_gii.17/kawasaki308
publication title Structural Evolution of the Emerging 2014-2015 GII.17 Noroviruses.
pubmed doi rcsb
total genus 71
structure length 305
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5f4oA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5f4oA01
2OBRA 5J35A 2ZL7A 5IYQA 4WZEA 4Z4UA 5E6TA 4OOXA 3RY8A 3ASSA 3PUMA 3ASRA 3ONYA 3PA2A 5IYPA 4X7CA 4QUZA 4OP7A 3Q6RA 4Z4RA 3SJPA 4X06A 4OPOA 4Z4ZA 3PA1A 3ONUA 5IYRA 2OBSA 4X0CA 3Q6QA 3PVDA 3SLDA 4QVAA 4RPDA 4X7EA 3ASTA 4RDLA 5F4MA 4Z4VA 3ASPA 3LQ6A 2ZL6A 3D26A 3BY2A 4RDKA 4Z4WA 5F4JA 4OOSA 4X05A 5F4OA 4ROXA 4Z4YA 4RLZA 4X07A 3Q3AA 3R6KA 4QVJA 3ASQA 4Z4SA 5J3OA 3V7AA 3LQEA 4OPVA 4P12A 3BY1A 4OOVA 4RM0A 3R6JA 5KW9A 3BQJA 3Q39A 2ZL5A 4RPBA 4WZLA 3SKBA 5IYNA 4WZKA 4P1VA 5IYWA 4Z4TA 3Q38A 3SEJA 4P2NA 4OPSA 4P26A 5HZAA 5BSXA 4X7DA 4QV2A 5HZBA 4P25A 3PUNA 4P3IA 1IHMA 2OBTA 4X7FA 3SLNA 4WZTA 4RDJA 5BSYA
chains in the Genus database with same CATH superfamily
2OBRA 5J35A 1N8RD 3ZUGA 1KRHA 4K1XA 3B8HA 5IYQA 2ZTGA 3A1PA 1S4MA 1E62A 3HAGA 3A35A 1EP1B 1VQ4B 4QFMA 3GVJA 1PJ7A 2Q6KA 1E79A 2CRVA 5CDFA 3ONYA 1PJ6A 4AC9A 4PC7A 4MYUA 1K9MD 1I18A 5IYPA 5DN6A 3SJZA 4ZGNB 1K8AD 3ZIAA 1KZLA 4QUZA 1J9ZA 1BX0A 3B82A 1FNDA 2XNJA 2B7CA 1ELOA 1VQ7B 4UZUA 4Z4RA 1B2RA 4OPOA 1UD5A 1BQEA 1I7PA 3PA1A 3A3BA 2QTZA 3ONUA 1G7RA 5A88A 5IYRA 3OW2B 2XOKA 3OP1A 2OTJB 1TVCA 4TSFA 4XLCA 4B3FX 3ES9A 3OEEA 3CCMB 1EXMA 3WNDA 4B3GA 5DS0A 4MYTA 4B43A 5AN9A 3VNUA 1QGZA 2NPFA 4P6YA 1W35A 3W2IA 3CMEB 1WU8A 1QUFA 2WZNA 2JJ2A 3BNWA 1N06A 2HLDA 4H9GA 1IJFA 3WXMA 3ASPA 4M0LA 1N05A 1AMOA 4AVZA 2OTLB 5FO0A 3GVKA 2P3MA 2ZL6A 3ZZTA 3OJXA 2ZZGA 1T6ZA 1JA0A 3QE2A 5FNZA 2WYRA 4DQKA 1D2EA 4Z1MA 2VNIA 1PKVA 4OOSA 3CP2A 1ZM2A 4RD2A 4LBVA 2OK7A 4RCZA 1FNMA 4PC3A 1ZM4A 2C77A 1E3ZA 1QGYA 4YALA 4ZCLA 4NCNA 1YIJB 2RC5A 3QFSA 2PE3A 2X8KA 3I1FA 1W0KA 4Q7JB 2XGJA 1Y0YA 3W5HA 2ZTNA 1R5OA 4IW3B 4OPVA 4RJLA 3CP8A 4Y9UA 4P12A 4DK1A 5IK2A 1RQRA 4OOVA 4WWVA 3R6JA 3FPKA 4ZV4A 5KW9A 3CCEB 3GSIA 2YWFA 3BCFA 2BMWA 4DK0A 1QVFB 2DERA 4P1VA 4M1KA 3DDYA 4XD7A 1UD6A 3B78A 1PJ5A 5A89A 4KKSA 3G71B 3Q38A 2QGGA 4EH1A 1DG1G 1H42A 3G4SB 3WY9A 4L8JA 1E3XA 2VYQA 5HZAA 4RD6A 2FVGA 1UMKA 2ZBVA 3LVBA 3OZVA 3QFTA 4P25A 3PUNA 1R5BA 4PABA 3CMAB 4FXUA 2PLFA 1TLLA 1H8EA 3QFCA 3GVLA 2OYNA 3CESA 1M1KD 1I8DA 4DNRB 2EIXA 2VBVA 2VNKA 3ZC3A 4P3YA 5L46A 4HE6A 1QVGB 3BC9A 3CMMA 4KKUA 1YITB 2X53S 2ZXIA 4Z4UA 1T6XA 2D3LA 4RD1A 1OB5A 1E43A 4LC0A 1RQPA 1BX1A 2QN6A 3CRZA 2V7QA 4HIZA 4LBWA 1WORA 4YAOA 3VNVA 4QHYA 1QG0A 3ASSA 5H59A 1NRKA 1WP6A 1GJRA 3PA2A 3WNBA 3U6KA 1BLIA 1ZM9A 4TMWA 4X7CA 4E0FA 1Q7YD 4P6VF 3VO2A 1BMFA 4RD4A 3NE5B 3AGPA 1GO2A 4OP7A 2DYIA 4XNFA 1WOSA 3CB4A 4X06A 2BVNA 2V7VA 4XLHA 2BSAA 1KK2A 2DETA 5TRDA 1WOPA 1WTHD 2B7BA 3ISXA 4XLFA 4F7DA 4PC2A 1MABA 2CBXA 1Q9SA 1NB9A 3G05A 3PVDA 2DOGA 1OHHA 1YX2A 2JN9A 1AIPA 4U9UA 1VQ8B 2NV4A 2ZZFA 4G7WA 2CW5A 3WBJA 2VJJA 3ZBUA 1M90D 2QMUA 1GVHA 5F4MA 4B47A 2V7WA 5H5JA 5FL7A 2HCJB 3H94A 3CPXA 4XN0A 2GJPA 2CF4A 2DIEA 1SKQA 3D26A 1OGIA 3WYAA 1KD1D 3AVYA 1KQSB 2BM1A 4Z4WA 1EFUA 4UZEA 3AVXA 3G6EB 4ZCIA 1FX0A 3T56B 5F4OA 3W2HA 2ZITA 3CC2B 4ROXA 4Z4YA 3GQBA 1Q86D 3KL9A 4TMXA 1WSRA 1WPCA 1QFYA 2ZZQA 1D8TA 4QVJA 3U2QA 1N08A 1W0JA 2D9RA 5KSWB 1VHEA 1UD2A 1KK3A 4XORA 1QGAA 2GJRA 1A8PA 1Q82D 3BY1A 2GK6A 4TKOB 1VQLB 4RPBA 3CCQB 2W6IA 3SKBA 4HE5A 3I56B 1VLOA 3VR6A 4II3A 3V76A 1EFRA 2GREA 2D74A 1KK0A 4R71A 1NJID 3JQRA 2PMDA 3AVUA 4Z4TA 1QFZA 3OKXA 3FPPA 4ACBA 5B6IA 3VMFA 4B4DA 1N0UA 2VBUA 2F4NA 5DSZA 5GV7A 3W2FA 1H8HA 4OPSA 1SKYB 1E1RA 2X6WA 1P4MA 2GQFA 2GK7A 5BSXA 2OK8A 1YJ9B 3CD6B 4XLEA 3A8JA 2C78A 5GV8A 3P27A 2FX3A 4B44A 2Q6OA 2OBTA 2F1MA 2QTLA 3ZPNA 1VQMB 1OB0A 5BSYA 2WZPP 1E1QA 3OFNA 5FO1A 4B3XA 1VQNB 1K28D 4FK8A 2ZL7A 2JJ1A 1G7TA 2X0KA 3OJWA 4GQNA 4M53A 1YJWB 2V31A 4WZEA 1VQ6B 4CQJA 3AVWA 2BN4A 5TV2A 4XMYA 5EMNA 4OOXA 3OW7A 1KJZA 3ASRA 1VF7A 1W2BB 4XQFA 1CNEA 3BH4A 4XLAA 1NDHA 1WOOA 1YLOA 4KKTA 3W2GA 2CC2A 1GAQA 1OB2A 2JIZA 1KK1A 2HDNB 4ZCMA 5JBQA 2E1RA 2CK3A 3SJPA 3T53B 4C43A 2C4TA 4Z4ZA 1VQ9B 1UD3A 4N3NA 1EP2B 3ZZUA 3CCJB 1FNCA 2V7XA 2OBSA 2BF4A 3A8IA 3MMPA 3Q6QA 4ZGQB 5THXA 2X6XA 5TY0A 1DARA 4TMZA 2WSSA 3BCDA 4Y7CA 5HKKA 2DEUA 3JQPA 4QVAA 2VZLA 4M4SA 4RPDA 5FIUA 3CCRB 3ASTA 4RDLA 4Y9RA 1HZEA 3OAAA 1K73D 4P22A 4XR6A 4J0QA 1DDGA 2M5SA 4XKVA 4YXWA 4YELA 2J7KA 2V7UA 2V7TA 1IJEA 3T51B 4RDKA 2HMAA 1VQOB 3CC7B 4FWTA 2XZLA 3ZZ0A 4X05A 3W5UA 2V4DA 3J81k 2DCUA 2BGIA 4YAWA 4RLZA 2XZPA 4WQMA 1T6YA 4G1VA 4II2A 3R6KA 4Z4SA 3ASQA 2DY1A 3OZWA 2C2WA 1DDIA 2VJIA 3LNNA 4G6IA 1KTVA 1G7CA 2JDIA 2R9VA 1W9XA 2C4UA 2XZOA 4AF6A 1QX4A 1QUEA 1F20A 4RM0A 3CPWB 3BQJA 2ZL5A 1EWYA 1MRZA 5A8AA 5IYNA 4TT3A 1XB2A 1UD4A 1N07A 2I1LA 3A8KA 2WR8A 2ZBUA 4NBSA 5IYWA 3OOCA 1TTTA 3SEJA 4XONA 2PIAA 1XQBA 2EFGA 1VQKB 2C5HA 2XNDA 4X7DA 1JJ2B 2R6HA 5HZBA 1S72B 3KEWA 2WJVA 1YJNB 1Q81D 2QDXA 4PAAA 4DQLA 1QH0A 3SLNA 3QSYA 1IB0A 4RD3A 4WZTA 2ZZEA 3I55B 4XKWA 4YAUA 4YAFA 3W5VA 1GAWA 1JNYA 2ZXHA 3OE7A 3ZBTA 5E6TA 3OEHA 1CNFA 4JMQA 3RY8A 1W34A 2VBTA 3CW2A 1BJKA 1W87A 1BPLA 2Q6IA 3PUMA 2XNCA 4ASUA 4LBYA 1ZUNB 1KMHA 1HA3A 2GPJA 2X6YA 3WBKA 1EP3B 2KVOA 1XFOA 3JQQA 1VQPB 1COWA 1VQ5B 3Q6RA 1B23P 1EFCA 1UD8A 5TR9A 1WDTA 3E20A 4TMVA 5LMZA 1FRNA 1FNBA 2BPOA 4RD0A 3OZUA 2RC6A 1JB9A 2QEXB 2WPDA 4TN1A 4AF7A 4ACAA 4C0SA 1VHOA 1D1NA 1YI2B 3OPOA 4X0CA 2YWHA 1F60A 1OGJA 3SLDA 5HXBA 3MCAA 3FKSA 1E64A 3FJOA 3MHPA 3CXCB 1V5VA 4X7EA 2X3UA 1R5NA 2LZJA 4PC6A 2E1BA 4PC1A 4Z4VA 4NNJA 3CCVB 1JA1A 3LQ6A 3JU4A 2Q6LA 2VBSA 3CCUB 3BY2A 1TUIA 1XE1A 1VJSA 2BM0A 3E1YE 4M2LA 5F4JA 3CCLB 1E63A 2XEXA 3CTAA 1T5EA 1V0EA 4LBZA 1HVXA 2D3NA 1N0VC 4FN5A 4UZFA 5FA6A 2BGJA 2AHOA 3LO8A 2WJYA 1WSVA 4X07A 1EFTA 3Q3AA 2YWGA 1H85A 3CC4B 5J3OA 4YEJA 3V7AA 1FRQA 3WNCA 3WQZA 1NBMA 1Y0RA 3CCSB 3LQEA 2QA4B 4X8IA 4N3GA 1G7SA 4XL9A 3W2EA 5KNLA 3Q39A 2CNDA 4WZLA 2BV3A 4G7XA 1GR1A 4WZKA 2W6JA 3AVTA 4UAJA 2F1LA 3GIRA 3QFRA 4DNTB 1S0UA 3PENA 2Z6BD 4TMTA 3U6BA 2YWEA 4P2NA 4PGOA 4YHBA 1V0FA 1NB0A 4P26A 4RCYA 4P9SA 1ZM3A 2X85A 1VLYA 2C5BA 4G1BA 4G5GA 4XN3A 1FDRA 2B5OA 2GJKA 4QV2A 1KC8D 3H9NA 4P3IA 1QFJA 4B48A 1IHMA 3AGQA 3P26A 3A3GA 4X7FA 1YHQB 3AVVA 2VNHA 1CQXA 2F43A 4RDJA 1U2RA 2VNJA 3VO1A 4XOPA 4XM3A 1SM4A 4BPRA 4XOTA 2QE7A
chains in the Genus database with same CATH topology
2OBRA 5J35A 2ZL7A 5IYQA 4WZEA 4Z4UA 5E6TA 4OOXA 3RY8A 3ASSA 3PUMA 3ASRA 3ONYA 3PA2A 5IYPA 4X7CA 4QUZA 4OP7A 3Q6RA 4Z4RA 3SJPA 4X06A 4OPOA 4Z4ZA 3PA1A 3ONUA 5IYRA 2OBSA 4X0CA 3Q6QA 3PVDA 3SLDA 4QVAA 4RPDA 4X7EA 3ASTA 4RDLA 5F4MA 4Z4VA 3ASPA 3LQ6A 2ZL6A 3D26A 3BY2A 4RDKA 4Z4WA 5F4JA 4OOSA 4X05A 5F4OA 4ROXA 4Z4YA 4RLZA 4X07A 3Q3AA 3R6KA 4QVJA 3ASQA 4Z4SA 5J3OA 3V7AA 3LQEA 4OPVA 4P12A 3BY1A 4OOVA 4RM0A 3R6JA 5KW9A 3BQJA 3Q39A 2ZL5A 4RPBA 4WZLA 3SKBA 5IYNA 4WZKA 4P1VA 5IYWA 4Z4TA 3Q38A 3SEJA 4P2NA 4OPSA 4P26A 5HZAA 5BSXA 4X7DA 4QV2A 5HZBA 4P25A 3PUNA 4P3IA 1IHMA 2OBTA 4X7FA 3SLNA 4WZTA 4RDJA 5BSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBR A;  5J35 A;  2ZL7 A;  5IYQ A;  4WZE A;  4Z4U A;  5E6T A;  4OOX A;  3RY8 A;  3ASS A;  3PUM A;  3ASR A;  3ONY A;  3PA2 A;  5IYP A;  4X7C A;  4QUZ A;  4OP7 A;  3Q6R A;  4Z4R A;  3SJP A;  4X06 A;  4OPO A;  4Z4Z A;  3PA1 A;  3ONU A;  5IYR A;  2OBS A;  4X0C A;  3Q6Q A;  3PVD A;  3SLD A;  4QVA A;  4RPD A;  4X7E A;  3AST A;  4RDL A;  5F4M A;  4Z4V A;  3ASP A;  3LQ6 A;  2ZL6 A;  3D26 A;  3BY2 A;  4RDK A;  4Z4W A;  5F4J A;  4OOS A;  4X05 A;  5F4O A;  4ROX A;  4Z4Y A;  4RLZ A;  4X07 A;  3Q3A A;  3R6K A;  4QVJ A;  3ASQ A;  4Z4S A;  5J3O A;  3V7A A;  3LQE A;  4OPV A;  4P12 A;  3BY1 A;  4OOV A;  4RM0 A;  3R6J A;  5KW9 A;  3BQJ A;  3Q39 A;  2ZL5 A;  4RPB A;  4WZL A;  3SKB A;  5IYN A;  4WZK A;  4P1V A;  5IYW A;  4Z4T A;  3Q38 A;  3SEJ A;  4P2N A;  4OPS A;  4P26 A;  5HZA A;  5BSX A;  4X7D A;  4QV2 A;  5HZB A;  4P25 A;  3PUN A;  4P3I A;  1IHM A;  2OBT A;  4X7F A;  3SLN A;  4WZT A;  4RDJ A;  5BSY A; 
#chains in the Genus database with same CATH topology
 2OBR A;  5J35 A;  1N8R D;  3ZUG A;  1KRH A;  4K1X A;  3B8H A;  5IYQ A;  2ZTG A;  3A1P A;  1S4M A;  1E62 A;  3HAG A;  3A35 A;  1EP1 B;  1VQ4 B;  4QFM A;  3GVJ A;  1PJ7 A;  2Q6K A;  1E79 A;  2CRV A;  5CDF A;  3ONY A;  1PJ6 A;  4AC9 A;  4PC7 A;  4MYU A;  1K9M D;  1I18 A;  5IYP A;  5DN6 A;  3SJZ A;  4ZGN B;  1K8A D;  3ZIA A;  1KZL A;  4QUZ A;  1J9Z A;  1BX0 A;  3B82 A;  1FND A;  2XNJ A;  2B7C A;  1ELO A;  1VQ7 B;  4UZU A;  4Z4R A;  1B2R A;  4OPO A;  1UD5 A;  1BQE A;  1I7P A;  3PA1 A;  3A3B A;  2QTZ A;  3ONU A;  1G7R A;  5A88 A;  5IYR A;  3OW2 B;  2XOK A;  3OP1 A;  2OTJ B;  1TVC A;  4TSF A;  4XLC A;  4B3F X;  3ES9 A;  3OEE A;  3CCM B;  1EXM A;  3WND A;  4B3G A;  5DS0 A;  4MYT A;  4B43 A;  5AN9 A;  3VNU A;  1QGZ A;  2NPF A;  4P6Y A;  1W35 A;  3W2I A;  3CME B;  1WU8 A;  1QUF A;  2WZN A;  2JJ2 A;  3BNW A;  1N06 A;  2HLD A;  4H9G A;  1IJF A;  3WXM A;  3ASP A;  4M0L A;  1N05 A;  1AMO A;  4AVZ A;  2OTL B;  5FO0 A;  3GVK A;  2P3M A;  2ZL6 A;  3ZZT A;  3OJX A;  2ZZG A;  1T6Z A;  1JA0 A;  3QE2 A;  5FNZ A;  2WYR A;  4DQK A;  1D2E A;  4Z1M A;  2VNI A;  1PKV A;  4OOS A;  3CP2 A;  1ZM2 A;  4RD2 A;  4LBV A;  2OK7 A;  4RCZ A;  1FNM A;  4PC3 A;  1ZM4 A;  2C77 A;  1E3Z A;  1QGY A;  4YAL A;  4ZCL A;  4NCN A;  1YIJ B;  2RC5 A;  3QFS A;  2PE3 A;  2X8K A;  3I1F A;  1W0K A;  4Q7J B;  2XGJ A;  1Y0Y A;  3W5H A;  2ZTN A;  1R5O A;  4IW3 B;  4OPV A;  4RJL A;  3CP8 A;  4Y9U A;  4P12 A;  4DK1 A;  5IK2 A;  1RQR A;  4OOV A;  4WWV A;  3R6J A;  3FPK A;  4ZV4 A;  5KW9 A;  3CCE B;  3GSI A;  2YWF A;  3BCF A;  2BMW A;  4DK0 A;  1QVF B;  2DER A;  4P1V A;  4M1K A;  3DDY A;  4XD7 A;  1UD6 A;  3B78 A;  1PJ5 A;  5A89 A;  4KKS A;  3G71 B;  3Q38 A;  2QGG A;  4EH1 A;  1DG1 G;  1H42 A;  3G4S B;  3WY9 A;  4L8J A;  1E3X A;  2VYQ A;  5HZA A;  4RD6 A;  2FVG A;  1UMK A;  2ZBV A;  3LVB A;  3OZV A;  3QFT A;  4P25 A;  3PUN A;  1R5B A;  4PAB A;  3CMA B;  4FXU A;  2PLF A;  1TLL A;  1H8E A;  3QFC A;  3GVL A;  2OYN A;  3CES A;  1M1K D;  1I8D A;  4DNR B;  2EIX A;  2VBV A;  2VNK A;  3ZC3 A;  4P3Y A;  5L46 A;  4HE6 A;  1QVG B;  3BC9 A;  3CMM A;  4KKU A;  1YIT B;  2X53 S;  2ZXI A;  4Z4U A;  1T6X A;  2D3L A;  4RD1 A;  1OB5 A;  1E43 A;  4LC0 A;  1RQP A;  1BX1 A;  2QN6 A;  3CRZ A;  2V7Q A;  4HIZ A;  4LBW A;  1WOR A;  4YAO A;  3VNV A;  4QHY A;  1QG0 A;  3ASS A;  5H59 A;  1NRK A;  1WP6 A;  1GJR A;  3PA2 A;  3WNB A;  3U6K A;  1BLI A;  1ZM9 A;  4TMW A;  4X7C A;  4E0F A;  1Q7Y D;  4P6V F;  3VO2 A;  1BMF A;  4RD4 A;  3NE5 B;  3AGP A;  1GO2 A;  4OP7 A;  2DYI A;  4XNF A;  1WOS A;  3CB4 A;  4X06 A;  2BVN A;  2V7V A;  4XLH A;  2BSA A;  1KK2 A;  2DET A;  5TRD A;  1WOP A;  1WTH D;  2B7B A;  3ISX A;  4XLF A;  4F7D A;  4PC2 A;  1MAB A;  2CBX A;  1Q9S A;  1NB9 A;  3G05 A;  3PVD A;  2DOG A;  1OHH A;  1YX2 A;  2JN9 A;  1AIP A;  4U9U A;  1VQ8 B;  2NV4 A;  2ZZF A;  4G7W A;  2CW5 A;  3WBJ A;  2VJJ A;  3ZBU A;  1M90 D;  2QMU A;  1GVH A;  5F4M A;  4B47 A;  2V7W A;  5H5J A;  5FL7 A;  2HCJ B;  3H94 A;  3CPX A;  4XN0 A;  2GJP A;  2CF4 A;  2DIE A;  1SKQ A;  3D26 A;  1OGI A;  3WYA A;  1KD1 D;  3AVY A;  1KQS B;  2BM1 A;  4Z4W A;  1EFU A;  4UZE A;  3AVX A;  3G6E B;  4ZCI A;  1FX0 A;  3T56 B;  5F4O A;  3W2H A;  2ZIT A;  3CC2 B;  4ROX A;  4Z4Y A;  3GQB A;  1Q86 D;  3KL9 A;  4TMX A;  1WSR A;  1WPC A;  1QFY A;  2ZZQ A;  1D8T A;  4QVJ A;  3U2Q A;  1N08 A;  1W0J A;  2D9R A;  5KSW B;  1VHE A;  1UD2 A;  1KK3 A;  4XOR A;  1QGA A;  2GJR A;  1A8P A;  1Q82 D;  3BY1 A;  2GK6 A;  4TKO B;  1VQL B;  4RPB A;  3CCQ B;  2W6I A;  3SKB A;  4HE5 A;  3I56 B;  1VLO A;  3VR6 A;  4II3 A;  3V76 A;  1EFR A;  2GRE A;  2D74 A;  1KK0 A;  4R71 A;  1NJI D;  3JQR A;  2PMD A;  3AVU A;  4Z4T A;  1QFZ A;  3OKX A;  3FPP A;  4ACB A;  5B6I A;  3VMF A;  4B4D A;  1N0U A;  2VBU A;  2F4N A;  5DSZ A;  5GV7 A;  3W2F A;  1H8H A;  4OPS A;  1SKY B;  1E1R A;  2X6W A;  1P4M A;  2GQF A;  2GK7 A;  5BSX A;  2OK8 A;  1YJ9 B;  3CD6 B;  4XLE A;  3A8J A;  2C78 A;  5GV8 A;  3P27 A;  2FX3 A;  4B44 A;  2Q6O A;  2OBT A;  2F1M A;  2QTL A;  3ZPN A;  1VQM B;  1OB0 A;  5BSY A;  2WZP P;  1E1Q A;  3OFN A;  5FO1 A;  4B3X A;  1VQN B;  1K28 D;  4FK8 A;  2ZL7 A;  2JJ1 A;  1G7T A;  2X0K A;  3OJW A;  4GQN A;  4M53 A;  1YJW B;  2V31 A;  4WZE A;  1VQ6 B;  4CQJ A;  3AVW A;  2BN4 A;  5TV2 A;  4XMY A;  5EMN A;  4OOX A;  3OW7 A;  1KJZ A;  3ASR A;  1VF7 A;  1W2B B;  4XQF A;  1CNE A;  3BH4 A;  4XLA A;  1NDH A;  1WOO A;  1YLO A;  4KKT A;  3W2G A;  2CC2 A;  1GAQ A;  1OB2 A;  2JIZ A;  1KK1 A;  2HDN B;  4ZCM A;  5JBQ A;  2E1R A;  2CK3 A;  3SJP A;  3T53 B;  4C43 A;  2C4T A;  4Z4Z A;  1VQ9 B;  1UD3 A;  4N3N A;  1EP2 B;  3ZZU A;  3CCJ B;  1FNC A;  2V7X A;  2OBS A;  2BF4 A;  3A8I A;  3MMP A;  3Q6Q A;  4ZGQ B;  5THX A;  2X6X A;  5TY0 A;  1DAR A;  4TMZ A;  2WSS A;  3BCD A;  4Y7C A;  5HKK A;  2DEU A;  3JQP A;  4QVA A;  2VZL A;  4M4S A;  4RPD A;  5FIU A;  3CCR B;  3AST A;  4RDL A;  4Y9R A;  1HZE A;  3OAA A;  1K73 D;  4P22 A;  4XR6 A;  4J0Q A;  1DDG A;  2M5S A;  4XKV A;  4YXW A;  4YEL A;  2J7K A;  2V7U A;  2V7T A;  1IJE A;  3T51 B;  4RDK A;  2HMA A;  1VQO B;  3CC7 B;  4FWT A;  2XZL A;  3ZZ0 A;  4X05 A;  3W5U A;  2V4D A;  3J81 k;  2DCU A;  2BGI A;  4YAW A;  4RLZ A;  2XZP A;  4WQM A;  1T6Y A;  4G1V A;  4II2 A;  3R6K A;  4Z4S A;  3ASQ A;  2DY1 A;  3OZW A;  2C2W A;  1DDI A;  2VJI A;  3LNN A;  4G6I A;  1KTV A;  1G7C A;  2JDI A;  2R9V A;  1W9X A;  2C4U A;  2XZO A;  4AF6 A;  1QX4 A;  1QUE A;  1F20 A;  4RM0 A;  3CPW B;  3BQJ A;  2ZL5 A;  1EWY A;  1MRZ A;  5A8A A;  5IYN A;  4TT3 A;  1XB2 A;  1UD4 A;  1N07 A;  2I1L A;  3A8K A;  2WR8 A;  2ZBU A;  4NBS A;  5IYW A;  3OOC A;  1TTT A;  3SEJ A;  4XON A;  2PIA A;  1XQB A;  2EFG A;  1VQK B;  2C5H A;  2XND A;  4X7D A;  1JJ2 B;  2R6H A;  5HZB A;  1S72 B;  3KEW A;  2WJV A;  1YJN B;  1Q81 D;  2QDX A;  4PAA A;  4DQL A;  1QH0 A;  3SLN A;  3QSY A;  1IB0 A;  4RD3 A;  4WZT A;  2ZZE A;  3I55 B;  4XKW A;  4YAU A;  4YAF A;  3W5V A;  1GAW A;  1JNY A;  2ZXH A;  3OE7 A;  3ZBT A;  5E6T A;  3OEH A;  1CNF A;  4JMQ A;  3RY8 A;  1W34 A;  2VBT A;  3CW2 A;  1BJK A;  1W87 A;  1BPL A;  2Q6I A;  3PUM A;  2XNC A;  4ASU A;  4LBY A;  1ZUN B;  1KMH A;  1HA3 A;  2GPJ A;  2X6Y A;  3WBK A;  1EP3 B;  2KVO A;  1XFO A;  3JQQ A;  1VQP B;  1COW A;  1VQ5 B;  3Q6R A;  1B23 P;  1EFC A;  1UD8 A;  5TR9 A;  1WDT A;  3E20 A;  4TMV A;  5LMZ A;  1FRN A;  1FNB A;  2BPO A;  4RD0 A;  3OZU A;  2RC6 A;  1JB9 A;  2QEX B;  2WPD A;  4TN1 A;  4AF7 A;  4ACA A;  4C0S A;  1VHO A;  1D1N A;  1YI2 B;  3OPO A;  4X0C A;  2YWH A;  1F60 A;  1OGJ A;  3SLD A;  5HXB A;  3MCA A;  3FKS A;  1E64 A;  3FJO A;  3MHP A;  3CXC B;  1V5V A;  4X7E A;  2X3U A;  1R5N A;  2LZJ A;  4PC6 A;  2E1B A;  4PC1 A;  4Z4V A;  4NNJ A;  3CCV B;  1JA1 A;  3LQ6 A;  3JU4 A;  2Q6L A;  2VBS A;  3CCU B;  3BY2 A;  1TUI A;  1XE1 A;  1VJS A;  2BM0 A;  3E1Y E;  4M2L A;  5F4J A;  3CCL B;  1E63 A;  2XEX A;  3CTA A;  1T5E A;  1V0E A;  4LBZ A;  1HVX A;  2D3N A;  1N0V C;  4FN5 A;  4UZF A;  5FA6 A;  2BGJ A;  2AHO A;  3LO8 A;  2WJY A;  1WSV A;  4X07 A;  1EFT A;  3Q3A A;  2YWG A;  1H85 A;  3CC4 B;  5J3O A;  4YEJ A;  3V7A A;  1FRQ A;  3WNC A;  3WQZ A;  1NBM A;  1Y0R A;  3CCS B;  3LQE A;  2QA4 B;  4X8I A;  4N3G A;  1G7S A;  4XL9 A;  3W2E A;  5KNL A;  3Q39 A;  2CND A;  4WZL A;  2BV3 A;  4G7X A;  1GR1 A;  4WZK A;  2W6J A;  3AVT A;  4UAJ A;  2F1L A;  3GIR A;  3QFR A;  4DNT B;  1S0U A;  3PEN A;  2Z6B D;  4TMT A;  3U6B A;  2YWE A;  4P2N A;  4PGO A;  4YHB A;  1V0F A;  1NB0 A;  4P26 A;  4RCY A;  4P9S A;  1ZM3 A;  2X85 A;  1VLY A;  2C5B A;  4G1B A;  4G5G A;  4XN3 A;  1FDR A;  2B5O A;  2GJK A;  4QV2 A;  1KC8 D;  3H9N A;  4P3I A;  1QFJ A;  4B48 A;  1IHM A;  3AGQ A;  3P26 A;  3A3G A;  4X7F A;  1YHQ B;  3AVV A;  2VNH A;  1CQX A;  2F43 A;  4RDJ A;  1U2R A;  2VNJ A;  3VO1 A;  4XOP A;  4XM3 A;  1SM4 A;  4BPR A;  4XOT A;  2QE7 A; 
#chains in the Genus database with same CATH homology
 2OBR A;  5J35 A;  2ZL7 A;  5IYQ A;  4WZE A;  4Z4U A;  5E6T A;  4OOX A;  3RY8 A;  3ASS A;  3PUM A;  3ASR A;  3ONY A;  3PA2 A;  5IYP A;  4X7C A;  4QUZ A;  4OP7 A;  3Q6R A;  4Z4R A;  3SJP A;  4X06 A;  4OPO A;  4Z4Z A;  3PA1 A;  3ONU A;  5IYR A;  2OBS A;  4X0C A;  3Q6Q A;  3PVD A;  3SLD A;  4QVA A;  4RPD A;  4X7E A;  3AST A;  4RDL A;  5F4M A;  4Z4V A;  3ASP A;  3LQ6 A;  2ZL6 A;  3D26 A;  3BY2 A;  4RDK A;  4Z4W A;  5F4J A;  4OOS A;  4X05 A;  5F4O A;  4ROX A;  4Z4Y A;  4RLZ A;  4X07 A;  3Q3A A;  3R6K A;  4QVJ A;  3ASQ A;  4Z4S A;  5J3O A;  3V7A A;  3LQE A;  4OPV A;  4P12 A;  3BY1 A;  4OOV A;  4RM0 A;  3R6J A;  5KW9 A;  3BQJ A;  3Q39 A;  2ZL5 A;  4RPB A;  4WZL A;  3SKB A;  5IYN A;  4WZK A;  4P1V A;  5IYW A;  4Z4T A;  3Q38 A;  3SEJ A;  4P2N A;  4OPS A;  4P26 A;  5HZA A;  5BSX A;  4X7D A;  4QV2 A;  5HZB A;  4P25 A;  3PUN A;  4P3I A;  1IHM A;  2OBT A;  4X7F A;  3SLN A;  4WZT A;  4RDJ A;  5BSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...