4PGOA

Crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
EILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 19
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4pgoA00
1KK0A 2QEXB 3OW2B 3G71B 3WY9A 1FNBA 1K73D 1D1NA 4LBVA 3CC7B 1H85A 4TN1A 1N0UA 2RC6A 2XNCA 1KK2A 3P27A 1DG1G 4FN5A 4F7DA 3B82A 4ZCLA 3QFRA 1E62A 3FPKA 4LBZA 3WNBA 3AVWA 2B5OA 4G5GA 1H42A 3LVBA 2X3UA 1OGJA 1F60A 4AC9A 1FNDA 3VO2A 5TV2A 1BX0A 2NPFA 4QFMA 1VQLB 2VYQA 4Q7JB 5H59A 5KSWB 4ACBA 3CCLB 1IB0A 5TY0A 2OK8A 3CCRB 3WNCA 3W2IA 1G7CA 1QX4A 1R5OA 4RD0A 3WNDA 1J9ZA 1EWYA 1B23P 4RD2A 3JQPA 1GAWA 3OZUA 4N3NA 1Q7YD 5TR9A 1KJZA 3CXCB 2CRVA 2C77A 2GPJA 1IJEA 4C0SA 1I7PA 4TMVA 3OZVA 3QFCA 1M90D 1F20A 1YJ9B 1KTVA 1JNYA 3I1FA 5GV7A 2BGJA 3QFSA 3ZZTA 4M0LA 1ZM4A 3CCQB 3AVXA 3MHPA 1JA0A 1U2RA 1QFYA 4PC7A 3AVVA 5H5JA 4M2LA 3CCEB 1CNEA 1K8AD 1W87A 1W34A 1OB2A 4DQLA 3ZBTA 1VQ5B 4TMZA 2B7CA 3CCMB 3MMPA 1FNCA 1E64A 2DY1A 1QG0A 3V76A 3WXMA 3U6KA 2OTJB 1GO2A 4PC1A 1FRNA 2E1RA 1EFUA 3B8HA 4RD3A 1FNMA 3P26A 4B43A 2PLFA 1EXMA 1KD1D 2DETA 2D74A 2QTLA 1TUIA 4K1XA 3LO8A 3AGPA 3VNUA 3VNVA 1KQSB 2BMWA 4B47A 4YAUA 4YALA 3ZC3A 3W2HA 4B4DA 3CC4B 3W5UA 1ZM9A 5JBQA 2AHOA 1ZUNB 4Y7CA 3WYAA 4M4SA 1QUEA 1KK1A 2BM0A 2BGIA 2DCUA 1B2RA 1D2EA 4C43A 3QFTA 2PMDA 5EMNA 1OB5A 4TMTA 1VQ7B 2PIAA 1FRQA 4P3YA 4LBYA 1S72B 3I56B 1JJ2B 2YWFA 2ZITA 2J7KA 1ELOA 1VQOB 2HMAA 1YHQB 1HA3A 2OK7A 2QTZA 2C78A 1VQ9B 3AVTA 2XEXA 3G4SB 2EIXA 2YWGA 4N3GA 1KK3A 1ZM3A 4YAOA 1S0UA 4G1BA 2YWEA 4MYTA 4DQKA 4R71A 1TTTA 2QA4B 1VQKB 3SJZA 1YJNB 1UMKA 1EP1B 3CB4A 3CPWB 1DDGA 2EFGA 1XE1A 4FK8A 4ZGQB 3AGQA 3CCSB 4TMWA 4ZV4A 3CCVB 1YIJB 1TVCA 3QSYA 4HE5A 3CCJB 3OJXA 4LC0A 4PGOA 1G7SA 1QGZA 1OGIA 1VQ8B 2VNIA 4HE6A 4Y9RA 3ZBUA 1NJID 1W2BB 2QMUA 1JA1A 3CMAB 2BSAA 2CNDA 3MCAA 4RCZA 1E63A 3VMFA 1G7RA 1QFJA 4MYUA 3B78A 5DSZA 3CD6B 4ZCIA 2GQFA 1CQXA 2VNJA 4AF7A 3G6EB 1XB2A 3CMEB 4RJLA 3J81k 2BVNA 2VNHA 1NDHA 2QDXA 1R5BA 3OJWA 3AVUA 3W2EA 1W35A 1D8TA 4YAWA 1K9MD 3CCUB 3WBKA 3QE2A 1QH0A 4YHBA 2BV3A 1BX1A 2BPOA 3E20A 2BN4A 1YI2B 3ZZ0A 5THXA 5AN9A 4B48A 2HCJB 3FJOA 1CNFA 3U2QA 4PC3A 2OTLB 4RD4A 4FWTA 4Y9UA 4M53A 3AVYA 3E1YE 1WDTA 4P6VF 1QGAA 4PC6A 1YJWB 2BF4A 4G1VA 4J0QA 1YITB 2B7BA 1BJKA 1QGYA 1ZM2A 1VQ6B 4PC2A 1EFCA 4IW3B 1VQMB 3PENA 1Q82D 2VZLA 4RCYA 1QFZA 1Q81D 2BM1A 4B44A 4LBWA 3CW2A 1VQ4B 1EP2B 4M1KA 4NBSA 3ZZUA 4ACAA 1GR1A 3I55B 1BQEA 3CC2B 4BPRA 2FX3A 1GVHA 1M1KD 5FA6A 1EP3B 5GV8A 4TMXA 1VQNB 4WQMA 4B3XA 3W5HA 3W2GA 4H9GA 4UAJA 1N8RD 3WBJA 1SKQA 2VNKA 3VO1A 4U9UA 4YAFA 1SM4A 3CRZA 4RD1A 1IJFA 1G7TA 1R5NA 2YWHA 4EH1A 3JQRA 3OZWA 3JQQA 4ZCMA 5HXBA 1A8PA 1GJRA 1QVFB 1DARA 2RC5A 4QHYA 3U6BA 1VQPB 1DDIA 4RD6A 1QVGB 2DERA 4AF6A 1AIPA 2QN6A 2DEUA 1EFTA 4ZGNB 4NCNA 2XNJA 1FDRA 1KRHA 3W5VA 3ES9A 1KC8D 2HDNB 1AMOA 2R6HA 1JB9A 1Q86D 1QUFA 1GAQA 3W2FA 1N0VC 1TLLA
chains in the Genus database with same CATH superfamily
1KK0A 1W9XA 4KKUA 5HZAA 1HVXA 3GVJA 4AVZA 2QEXB 3OW2B 1UD4A 1T6XA 2F4NA 2W6JA 3G71B 2KVOA 3WY9A 4DK1A 1FNBA 3CESA 4QUZA 1K73D 1VLOA 1D1NA 2WZNA 2JDIA 2JJ1A 3LQEA 4LBVA 4X7DA 2OBTA 4QVAA 3CC7B 3OFNA 2OBSA 1H85A 4TN1A 5F4MA 1N0UA 2RC6A 2XNCA 1KK2A 3P27A 3A8JA 2DYIA 1DG1G 3T56B 3T51B 4X06A 4RPBA 3R6KA 4FN5A 2WYRA 4OOSA 4F7DA 3B82A 5KNLA 2C4TA 4ZCLA 3QFRA 4G7XA 1E62A 3FPKA 2Q6KA 4LBZA 3BY1A 3WNBA 4NNJA 4Z4RA 3AVWA 1BMFA 2B5OA 4G6IA 4G5GA 4WZLA 4WZTA 1H42A 3LVBA 2X3UA 1OGJA 1N05A 4II3A 1F60A 1FNDA 3VO2A 2ZXIA 4AC9A 5TV2A 1BX0A 2NPFA 2VBSA 3OP1A 4QFMA 1VQLB 2GJRA 2VYQA 4P9SA 4Q7JB 5H59A 3A1PA 5KSWB 4ACBA 3CCLB 1IB0A 5TY0A 5L46A 2OK8A 3CCRB 3WNCA 3LQ6A 3W2IA 4DK0A 5F4JA 1G7CA 2V7WA 1QX4A 3BY2A 2XZOA 3ONUA 5FO0A 3A35A 4P26A 3SKBA 4RDKA 2VJJA 1WORA 2DOGA 1R5OA 4RD0A 1WU8A 2CK3A 3BNWA 1J9ZA 3WNDA 3ZUGA 1EWYA 2WZPP 1B23P 4RD2A 3JQPA 1GAWA 3OZUA 4N3NA 1Q7YD 5TR9A 1KJZA 4TT3A 5A8AA 3CXCB 2CRVA 2C77A 4XD7A 4X7EA 2GPJA 1NRKA 1IJEA 4KKSA 5J3OA 3OE7A 1WPCA 3ZIAA 4HIZA 4C0SA 1I7PA 1H8HA 4TMVA 3OZVA 3QFCA 1M90D 1F20A 4DNRB 2WPDA 4QVJA 4PAAA 1YJ9B 1KTVA 4L8JA 1V5VA 1JNYA 3I1FA 1N06A 2V7QA 5GV7A 2BGJA 3QFSA 3ZZTA 4M0LA 2X8KA 1ZM4A 3CCQB 3AVXA 3MHPA 1JA0A 1U2RA 1QFYA 4PC7A 3AVVA 1XQBA 4RM0A 5H5JA 2I1LA 4M2LA 4X7FA 3CCEB 1CNEA 1K8AD 1W87A 1W34A 1OB2A 4XN0A 4DQLA 3ZBTA 1VQ5B 4TMZA 2B7CA 3CCMB 1T5EA 3MMPA 1FNCA 1E64A 1N07A 2DY1A 4GQNA 3RY8A 4OP7A 3SLNA 3ASQA 3CMMA 1QG0A 3V76A 2QE7A 4RDLA 5KW9A 3WQZA 4XKVA 3WXMA 3Q3AA 2R9VA 4YELA 4XOTA 3U6KA 2OTJB 1GO2A 3H94A 4PC1A 3FKSA 1FRNA 1NB9A 1Y0YA 1EFUA 2E1BA 2E1RA 4YEJA 2CF4A 3B8HA 4RD3A 1FNMA 1WOSA 3P26A 4B43A 4Z4SA 4RPDA 2XZLA 2PLFA 4FXUA 3BCFA 2Z6BD 4P1VA 1EXMA 2WJYA 4RLZA 1KD1D 2PE3A 2DETA 2D74A 2GJKA 2ZTGA 2QTLA 1TUIA 4P3IA 4K1XA 3LO8A 3AGPA 3V7AA 3VNUA 3VNVA 1KQSB 1YX2A 2P3MA 2BMWA 1EFRA 4B47A 3CP8A 4YALA 4YAUA 1E1RA 3OKXA 3ZC3A 4XOPA 3W2HA 4B4DA 3CC4B 2CBXA 3Q38A 5IYNA 4OOXA 3W5UA 2OBRA 2WR8A 3T53B 1ZM9A 3PA1A 3Q39A 5JBQA 2AHOA 1ZUNB 3PUMA 2HLDA 4XLCA 4Y7CA 4PABA 3WYAA 4B3GA 2QGGA 4M4SA 4X07A 1QUEA 3A3BA 1KK1A 2BM0A 2BGIA 2DCUA 1UD2A 4WZEA 1B2RA 1D2EA 1KZLA 5DS0A 4C43A 3QFTA 2PMDA 4OPOA 3DDYA 4B3FX 4XMYA 5EMNA 1P4MA 2ZBUA 1OB5A 2Q6OA 1W0KA 4TMTA 2PIAA 1VQ7B 1FRQA 1VHEA 4LBYA 2WJVA 4P3YA 1S72B 3I56B 1JJ2B 1VLYA 2YWFA 3A3GA 5J35A 2ZITA 5IK2A 2J7KA 1ELOA 1VQOB 4XONA 4XLFA 2HMAA 3PUNA 2F1MA 4XR6A 5A89A 1YHQB 1HA3A 1OHHA 2GJPA 2OK7A 2QTZA 3LNNA 2ZZQA 4II2A 2C78A 2OYNA 3SEJA 1VHOA 2GK7A 1VQ9B 3OOCA 3AVTA 2X85A 2XEXA 3G4SB 5A88A 4XL9A 2EIXA 3CP2A 2YWGA 4N3GA 1WTHD 1KK3A 1ZM3A 3ASTA 4YAOA 5F4OA 1S0UA 4G1BA 2YWEA 4MYTA 4DQKA 4R71A 4P22A 2QA4B 3ASSA 1TTTA 1WP6A 4Z4TA 1VQKB 3SJZA 2F1LA 2C5BA 1YJNB 1HZEA 1UMKA 3KL9A 4QV2A 1V0EA 1EP1B 3CB4A 3CPWB 1DDGA 2GREA 3FPPA 2ZZFA 4X7CA 2EFGA 2DIEA 2X0KA 1XE1A 3R6JA 2F43A 4FK8A 4ZGQB 3AGQA 5FL7A 3CCSB 4XQFA 4OPSA 1VF7A 4XORA 4TMWA 4ZV4A 4ROXA 5BSYA 3CCVB 1YIJB 1TVCA 2VBUA 3D26A 3QSYA 4HE5A 3CCJB 4UZFA 3CPXA 3OJXA 4LC0A 4PGOA 3ZPNA 4UZEA 1G7SA 5IYPA 1PJ5A 1QGZA 2XZPA 1OGIA 1VQ8B 2VNIA 4HE6A 4Y9RA 4Z1MA 3ZBUA 1NJID 1W2BB 1YLOA 2QMUA 1JA1A 4YXWA 3SLDA 3CMAB 2BSAA 1MRZA 2CNDA 3MCAA 4RCZA 1E63A 4Z4WA 3VMFA 1G7RA 1Y0RA 1QFJA 4MYUA 3B78A 5DSZA 3CD6B 1OB0A 2LZJA 2GQFA 4ZCIA 1CQXA 1E1QA 1I8DA 1PJ7A 1MABA 2VNJA 4XN3A 3GQBA 3A8KA 5FO1A 4AF7A 4XLAA 3G6EB 1XB2A 2M5SA 3CMEB 4RJLA 2ZL6A 2ZL5A 4X8IA 3J81k 3BQJA 2BVNA 2VNHA 1NDHA 2QDXA 1R5BA 2NV4A 3OJWA 2VBVA 2ZTNA 3AVUA 3W2EA 1W35A 1D8TA 4YAWA 3Q6RA 2C4UA 4KKTA 1RQRA 1UD3A 1K9MD 3CCUB 3WBKA 2XOKA 3QE2A 1K28D 1QH0A 4YHBA 2BV3A 1NB0A 1BX1A 2BPOA 3E20A 2BN4A 4XKWA 1YI2B 3OPOA 2V7VA 3ZZ0A 5THXA 1E79A 5AN9A 4B48A 2HCJB 2V7UA 3FJOA 1CNFA 3A8IA 3U2QA 4E0FA 1T6YA 4PC3A 4TKOB 2OTLB 4RD4A 3KEWA 4FWTA 2Q6IA 3H9NA 4M53A 4Y9UA 3AVYA 3E1YE 1WDTA 4P6VF 1QGAA 4PC6A 4OPVA 1BPLA 3ISXA 4XM3A 1YJWB 2V4DA 2BF4A 1W0JA 2VBTA 2ZL7A 4G1VA 1I18A 4J0QA 1YITB 2B7BA 1BJKA 1QGYA 1UD8A 1ZM2A 1VQ6B 2V31A 4Z4YA 4PC2A 1EFCA 3ASPA 3CTAA 2WSSA 4G7WA 4IW3B 1VQMB 4P6YA 3PENA 1Q82D 3SJPA 2VZLA 4RCYA 1QFZA 1H8EA 1S4MA 1Q81D 4XLHA 2BM1A 1PKVA 5FIUA 1WOPA 2D3NA 1E3ZA 3BH4A 4JMQA 3GIRA 3OEEA 4B44A 2X53S 4LBWA 1V0FA 3CW2A 1PJ6A 5B6IA 2V7XA 1VQ4B 1RQPA 1EP2B 2JN9A 4M1KA 4NBSA 2GK6A 3G05A 3VR6A 5FNZA 2VJIA 3ZZUA 4ACAA 4DNTB 3OEHA 1GR1A 3I55B 2X6XA 1BQEA 3CC2B 4BPRA 5TRDA 3OW7A 1VJSA 2FX3A 1GVHA 1E43A 1M1KD 5FA6A 1EP3B 5GV8A 4TMXA 1VQNB 4WQMA 4WZKA 2XNDA 1UD6A 4B3XA 3W5HA 3W2GA 2ZBVA 3PA2A 4H9GA 4UAJA 1N8RD 3WBJA 2D9RA 3BCDA 1SKQA 3Q6QA 1FX0A 2C2WA 4RDJA 2VNKA 3VO1A 2X6WA 4U9UA 4YAFA 3GSIA 2JIZA 1SM4A 3CRZA 4RD1A 1IJFA 2ZZGA 1G7TA 1R5NA 4TSFA 2YWHA 4EH1A 3JQRA 5IYQA 5IYWA 3ASRA 3OZWA 3HAGA 3JQQA 2XGJA 2CC2A 1WOOA 1N08A 4ZCMA 4Z4ZA 4P2NA 4UZUA 4WWVA 4X05A 5HXBA 2FVGA 1A8PA 2W6IA 3PVDA 5IYRA 4Z4UA 1GJRA 1SKYB 4X0CA 3GVLA 1QVFB 3NE5B 1DARA 2X6YA 1T6ZA 2RC5A 4QHYA 3U6BA 1VQPB 1IHMA 1DDIA 1BLIA 1UD5A 4RD6A 1QVGB 5HKKA 5HZBA 2DERA 4P12A 4AF6A 4XLEA 1KMHA 4XNFA 1AIPA 1COWA 2QN6A 2DEUA 2JJ2A 1EFTA 2ZZEA 2CW5A 4ZGNB 4NCNA 5LMZA 2XNJA 1FDRA 5CDFA 4P25A 2Q6LA 1KRHA 5DN6A 1XFOA 4Z4VA 2D3LA 1E3XA 3W5VA 2ZXHA 3ES9A 4ASUA 4CQJA 5E6TA 1KC8D 1NBMA 2HDNB 4OOVA 1Q9SA 2V7TA 3BC9A 1AMOA 2R6HA 1JB9A 1WSVA 1Q86D 5BSXA 1QUFA 1GAQA 3W2FA 3JU4A 1WSRA 3GVKA 2C5HA 3OAAA 3ONYA 1N0VC 1TLLA
chains in the Genus database with same CATH topology
1KK0A 2QEXB 3OW2B 3G71B 3WY9A 1FNBA 1K73D 1D1NA 4LBVA 3CC7B 1H85A 4TN1A 1N0UA 2RC6A 2XNCA 1KK2A 3P27A 1DG1G 4FN5A 4F7DA 3B82A 4ZCLA 3QFRA 1E62A 3FPKA 4LBZA 3WNBA 3AVWA 2B5OA 4G5GA 1H42A 3LVBA 2X3UA 1OGJA 1F60A 4AC9A 1FNDA 3VO2A 5TV2A 1BX0A 2NPFA 4QFMA 1VQLB 2VYQA 4Q7JB 5H59A 5KSWB 4ACBA 3CCLB 1IB0A 5TY0A 2OK8A 3CCRB 3WNCA 3W2IA 1G7CA 1QX4A 1R5OA 4RD0A 3WNDA 1J9ZA 1EWYA 1B23P 4RD2A 3JQPA 1GAWA 3OZUA 4N3NA 1Q7YD 5TR9A 1KJZA 3CXCB 2CRVA 2C77A 2GPJA 1IJEA 4C0SA 1I7PA 4TMVA 3OZVA 3QFCA 1M90D 1F20A 1YJ9B 1KTVA 1JNYA 3I1FA 5GV7A 2BGJA 3QFSA 3ZZTA 4M0LA 1ZM4A 3CCQB 3AVXA 3MHPA 1JA0A 1U2RA 1QFYA 4PC7A 3AVVA 5H5JA 4M2LA 3CCEB 1CNEA 1K8AD 1W87A 1W34A 1OB2A 4DQLA 3ZBTA 1VQ5B 4TMZA 2B7CA 3CCMB 3MMPA 1FNCA 1E64A 2DY1A 1QG0A 3V76A 3WXMA 3U6KA 2OTJB 1GO2A 4PC1A 1FRNA 2E1RA 1EFUA 3B8HA 4RD3A 1FNMA 3P26A 4B43A 2PLFA 1EXMA 1KD1D 2DETA 2D74A 2QTLA 1TUIA 4K1XA 3LO8A 3AGPA 3VNUA 3VNVA 1KQSB 2BMWA 4B47A 4YAUA 4YALA 3ZC3A 3W2HA 4B4DA 3CC4B 3W5UA 1ZM9A 5JBQA 2AHOA 1ZUNB 4Y7CA 3WYAA 4M4SA 1QUEA 1KK1A 2BM0A 2BGIA 2DCUA 1B2RA 1D2EA 4C43A 3QFTA 2PMDA 5EMNA 1OB5A 4TMTA 1VQ7B 2PIAA 1FRQA 4P3YA 4LBYA 1S72B 3I56B 1JJ2B 2YWFA 2ZITA 2J7KA 1ELOA 1VQOB 2HMAA 1YHQB 1HA3A 2OK7A 2QTZA 2C78A 1VQ9B 3AVTA 2XEXA 3G4SB 2EIXA 2YWGA 4N3GA 1KK3A 1ZM3A 4YAOA 1S0UA 4G1BA 2YWEA 4MYTA 4DQKA 4R71A 1TTTA 2QA4B 1VQKB 3SJZA 1YJNB 1UMKA 1EP1B 3CB4A 3CPWB 1DDGA 2EFGA 1XE1A 4FK8A 4ZGQB 3AGQA 3CCSB 4TMWA 4ZV4A 3CCVB 1YIJB 1TVCA 3QSYA 4HE5A 3CCJB 3OJXA 4LC0A 4PGOA 1G7SA 1QGZA 1OGIA 1VQ8B 2VNIA 4HE6A 4Y9RA 3ZBUA 1NJID 1W2BB 2QMUA 1JA1A 3CMAB 2BSAA 2CNDA 3MCAA 4RCZA 1E63A 3VMFA 1G7RA 1QFJA 4MYUA 3B78A 5DSZA 3CD6B 4ZCIA 2GQFA 1CQXA 2VNJA 4AF7A 3G6EB 1XB2A 3CMEB 4RJLA 3J81k 2BVNA 2VNHA 1NDHA 2QDXA 1R5BA 3OJWA 3AVUA 3W2EA 1W35A 1D8TA 4YAWA 1K9MD 3CCUB 3WBKA 3QE2A 1QH0A 4YHBA 2BV3A 1BX1A 2BPOA 3E20A 2BN4A 1YI2B 3ZZ0A 5THXA 5AN9A 4B48A 2HCJB 3FJOA 1CNFA 3U2QA 4PC3A 2OTLB 4RD4A 4FWTA 4Y9UA 4M53A 3AVYA 3E1YE 1WDTA 4P6VF 1QGAA 4PC6A 1YJWB 2BF4A 4G1VA 4J0QA 1YITB 2B7BA 1BJKA 1QGYA 1ZM2A 1VQ6B 4PC2A 1EFCA 4IW3B 1VQMB 3PENA 1Q82D 2VZLA 4RCYA 1QFZA 1Q81D 2BM1A 4B44A 4LBWA 3CW2A 1VQ4B 1EP2B 4M1KA 4NBSA 3ZZUA 4ACAA 1GR1A 3I55B 1BQEA 3CC2B 4BPRA 2FX3A 1GVHA 1M1KD 5FA6A 1EP3B 5GV8A 4TMXA 1VQNB 4WQMA 4B3XA 3W5HA 3W2GA 4H9GA 4UAJA 1N8RD 3WBJA 1SKQA 2VNKA 3VO1A 4U9UA 4YAFA 1SM4A 3CRZA 4RD1A 1IJFA 1G7TA 1R5NA 2YWHA 4EH1A 3JQRA 3OZWA 3JQQA 4ZCMA 5HXBA 1A8PA 1GJRA 1QVFB 1DARA 2RC5A 4QHYA 3U6BA 1VQPB 1DDIA 4RD6A 1QVGB 2DERA 4AF6A 1AIPA 2QN6A 2DEUA 1EFTA 4ZGNB 4NCNA 2XNJA 1FDRA 1KRHA 3W5VA 3ES9A 1KC8D 2HDNB 1AMOA 2R6HA 1JB9A 1Q86D 1QUFA 1GAQA 3W2FA 1N0VC 1TLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK0 A;  2QEX B;  3OW2 B;  3G71 B;  3WY9 A;  1FNB A;  1K73 D;  1D1N A;  4LBV A;  3CC7 B;  1H85 A;  4TN1 A;  1N0U A;  2RC6 A;  2XNC A;  1KK2 A;  3P27 A;  1DG1 G;  4FN5 A;  4F7D A;  3B82 A;  4ZCL A;  3QFR A;  1E62 A;  3FPK A;  4LBZ A;  3WNB A;  3AVW A;  2B5O A;  4G5G A;  1H42 A;  3LVB A;  2X3U A;  1OGJ A;  1F60 A;  4AC9 A;  1FND A;  3VO2 A;  5TV2 A;  1BX0 A;  2NPF A;  4QFM A;  1VQL B;  2VYQ A;  4Q7J B;  5H59 A;  5KSW B;  4ACB A;  3CCL B;  1IB0 A;  5TY0 A;  2OK8 A;  3CCR B;  3WNC A;  3W2I A;  1G7C A;  1QX4 A;  1R5O A;  4RD0 A;  3WND A;  1J9Z A;  1EWY A;  1B23 P;  4RD2 A;  3JQP A;  1GAW A;  3OZU A;  4N3N A;  1Q7Y D;  5TR9 A;  1KJZ A;  3CXC B;  2CRV A;  2C77 A;  2GPJ A;  1IJE A;  4C0S A;  1I7P A;  4TMV A;  3OZV A;  3QFC A;  1M90 D;  1F20 A;  1YJ9 B;  1KTV A;  1JNY A;  3I1F A;  5GV7 A;  2BGJ A;  3QFS A;  3ZZT A;  4M0L A;  1ZM4 A;  3CCQ B;  3AVX A;  3MHP A;  1JA0 A;  1U2R A;  1QFY A;  4PC7 A;  3AVV A;  5H5J A;  4M2L A;  3CCE B;  1CNE A;  1K8A D;  1W87 A;  1W34 A;  1OB2 A;  4DQL A;  3ZBT A;  1VQ5 B;  4TMZ A;  2B7C A;  3CCM B;  3MMP A;  1FNC A;  1E64 A;  2DY1 A;  1QG0 A;  3V76 A;  3WXM A;  3U6K A;  2OTJ B;  1GO2 A;  4PC1 A;  1FRN A;  2E1R A;  1EFU A;  3B8H A;  4RD3 A;  1FNM A;  3P26 A;  4B43 A;  2PLF A;  1EXM A;  1KD1 D;  2DET A;  2D74 A;  2QTL A;  1TUI A;  4K1X A;  3LO8 A;  3AGP A;  3VNU A;  3VNV A;  1KQS B;  2BMW A;  4B47 A;  4YAU A;  4YAL A;  3ZC3 A;  3W2H A;  4B4D A;  3CC4 B;  3W5U A;  1ZM9 A;  5JBQ A;  2AHO A;  1ZUN B;  4Y7C A;  3WYA A;  4M4S A;  1QUE A;  1KK1 A;  2BM0 A;  2BGI A;  2DCU A;  1B2R A;  1D2E A;  4C43 A;  3QFT A;  2PMD A;  5EMN A;  1OB5 A;  4TMT A;  1VQ7 B;  2PIA A;  1FRQ A;  4P3Y A;  4LBY A;  1S72 B;  3I56 B;  1JJ2 B;  2YWF A;  2ZIT A;  2J7K A;  1ELO A;  1VQO B;  2HMA A;  1YHQ B;  1HA3 A;  2OK7 A;  2QTZ A;  2C78 A;  1VQ9 B;  3AVT A;  2XEX A;  3G4S B;  2EIX A;  2YWG A;  4N3G A;  1KK3 A;  1ZM3 A;  4YAO A;  1S0U A;  4G1B A;  2YWE A;  4MYT A;  4DQK A;  4R71 A;  1TTT A;  2QA4 B;  1VQK B;  3SJZ A;  1YJN B;  1UMK A;  1EP1 B;  3CB4 A;  3CPW B;  1DDG A;  2EFG A;  1XE1 A;  4FK8 A;  4ZGQ B;  3AGQ A;  3CCS B;  4TMW A;  4ZV4 A;  3CCV B;  1YIJ B;  1TVC A;  3QSY A;  4HE5 A;  3CCJ B;  3OJX A;  4LC0 A;  4PGO A;  1G7S A;  1QGZ A;  1OGI A;  1VQ8 B;  2VNI A;  4HE6 A;  4Y9R A;  3ZBU A;  1NJI D;  1W2B B;  2QMU A;  1JA1 A;  3CMA B;  2BSA A;  2CND A;  3MCA A;  4RCZ A;  1E63 A;  3VMF A;  1G7R A;  1QFJ A;  4MYU A;  3B78 A;  5DSZ A;  3CD6 B;  4ZCI A;  2GQF A;  1CQX A;  2VNJ A;  4AF7 A;  3G6E B;  1XB2 A;  3CME B;  4RJL A;  3J81 k;  2BVN A;  2VNH A;  1NDH A;  2QDX A;  1R5B A;  3OJW A;  3AVU A;  3W2E A;  1W35 A;  1D8T A;  4YAW A;  1K9M D;  3CCU B;  3WBK A;  3QE2 A;  1QH0 A;  4YHB A;  2BV3 A;  1BX1 A;  2BPO A;  3E20 A;  2BN4 A;  1YI2 B;  3ZZ0 A;  5THX A;  5AN9 A;  4B48 A;  2HCJ B;  3FJO A;  1CNF A;  3U2Q A;  4PC3 A;  2OTL B;  4RD4 A;  4FWT A;  4Y9U A;  4M53 A;  3AVY A;  3E1Y E;  1WDT A;  4P6V F;  1QGA A;  4PC6 A;  1YJW B;  2BF4 A;  4G1V A;  4J0Q A;  1YIT B;  2B7B A;  1BJK A;  1QGY A;  1ZM2 A;  1VQ6 B;  4PC2 A;  1EFC A;  4IW3 B;  1VQM B;  3PEN A;  1Q82 D;  2VZL A;  4RCY A;  1QFZ A;  1Q81 D;  2BM1 A;  4B44 A;  4LBW A;  3CW2 A;  1VQ4 B;  1EP2 B;  4M1K A;  4NBS A;  3ZZU A;  4ACA A;  1GR1 A;  3I55 B;  1BQE A;  3CC2 B;  4BPR A;  2FX3 A;  1GVH A;  1M1K D;  5FA6 A;  1EP3 B;  5GV8 A;  4TMX A;  1VQN B;  4WQM A;  4B3X A;  3W5H A;  3W2G A;  4H9G A;  4UAJ A;  1N8R D;  3WBJ A;  1SKQ A;  2VNK A;  3VO1 A;  4U9U A;  4YAF A;  1SM4 A;  3CRZ A;  4RD1 A;  1IJF A;  1G7T A;  1R5N A;  2YWH A;  4EH1 A;  3JQR A;  3OZW A;  3JQQ A;  4ZCM A;  5HXB A;  1A8P A;  1GJR A;  1QVF B;  1DAR A;  2RC5 A;  4QHY A;  3U6B A;  1VQP B;  1DDI A;  4RD6 A;  1QVG B;  2DER A;  4AF6 A;  1AIP A;  2QN6 A;  2DEU A;  1EFT A;  4ZGN B;  4NCN A;  2XNJ A;  1FDR A;  1KRH A;  3W5V A;  3ES9 A;  1KC8 D;  2HDN B;  1AMO A;  2R6H A;  1JB9 A;  1Q86 D;  1QUF A;  1GAQ A;  3W2F A;  1N0V C;  1TLL A; 
#chains in the Genus database with same CATH topology
 1KK0 A;  1W9X A;  4KKU A;  5HZA A;  1HVX A;  3GVJ A;  4AVZ A;  2QEX B;  3OW2 B;  1UD4 A;  1T6X A;  2F4N A;  2W6J A;  3G71 B;  2KVO A;  3WY9 A;  4DK1 A;  1FNB A;  3CES A;  4QUZ A;  1K73 D;  1VLO A;  1D1N A;  2WZN A;  2JDI A;  2JJ1 A;  3LQE A;  4LBV A;  4X7D A;  2OBT A;  4QVA A;  3CC7 B;  3OFN A;  2OBS A;  1H85 A;  4TN1 A;  5F4M A;  1N0U A;  2RC6 A;  2XNC A;  1KK2 A;  3P27 A;  3A8J A;  2DYI A;  1DG1 G;  3T56 B;  3T51 B;  4X06 A;  4RPB A;  3R6K A;  4FN5 A;  2WYR A;  4OOS A;  4F7D A;  3B82 A;  5KNL A;  2C4T A;  4ZCL A;  3QFR A;  4G7X A;  1E62 A;  3FPK A;  2Q6K A;  4LBZ A;  3BY1 A;  3WNB A;  4NNJ A;  4Z4R A;  3AVW A;  1BMF A;  2B5O A;  4G6I A;  4G5G A;  4WZL A;  4WZT A;  1H42 A;  3LVB A;  2X3U A;  1OGJ A;  1N05 A;  4II3 A;  1F60 A;  1FND A;  3VO2 A;  2ZXI A;  4AC9 A;  5TV2 A;  1BX0 A;  2NPF A;  2VBS A;  3OP1 A;  4QFM A;  1VQL B;  2GJR A;  2VYQ A;  4P9S A;  4Q7J B;  5H59 A;  3A1P A;  5KSW B;  4ACB A;  3CCL B;  1IB0 A;  5TY0 A;  5L46 A;  2OK8 A;  3CCR B;  3WNC A;  3LQ6 A;  3W2I A;  4DK0 A;  5F4J A;  1G7C A;  2V7W A;  1QX4 A;  3BY2 A;  2XZO A;  3ONU A;  5FO0 A;  3A35 A;  4P26 A;  3SKB A;  4RDK A;  2VJJ A;  1WOR A;  2DOG A;  1R5O A;  4RD0 A;  1WU8 A;  2CK3 A;  3BNW A;  1J9Z A;  3WND A;  3ZUG A;  1EWY A;  2WZP P;  1B23 P;  4RD2 A;  3JQP A;  1GAW A;  3OZU A;  4N3N A;  1Q7Y D;  5TR9 A;  1KJZ A;  4TT3 A;  5A8A A;  3CXC B;  2CRV A;  2C77 A;  4XD7 A;  4X7E A;  2GPJ A;  1NRK A;  1IJE A;  4KKS A;  5J3O A;  3OE7 A;  1WPC A;  3ZIA A;  4HIZ A;  4C0S A;  1I7P A;  1H8H A;  4TMV A;  3OZV A;  3QFC A;  1M90 D;  1F20 A;  4DNR B;  2WPD A;  4QVJ A;  4PAA A;  1YJ9 B;  1KTV A;  4L8J A;  1V5V A;  1JNY A;  3I1F A;  1N06 A;  2V7Q A;  5GV7 A;  2BGJ A;  3QFS A;  3ZZT A;  4M0L A;  2X8K A;  1ZM4 A;  3CCQ B;  3AVX A;  3MHP A;  1JA0 A;  1U2R A;  1QFY A;  4PC7 A;  3AVV A;  1XQB A;  4RM0 A;  5H5J A;  2I1L A;  4M2L A;  4X7F A;  3CCE B;  1CNE A;  1K8A D;  1W87 A;  1W34 A;  1OB2 A;  4XN0 A;  4DQL A;  3ZBT A;  1VQ5 B;  4TMZ A;  2B7C A;  3CCM B;  1T5E A;  3MMP A;  1FNC A;  1E64 A;  1N07 A;  2DY1 A;  4GQN A;  3RY8 A;  4OP7 A;  3SLN A;  3ASQ A;  3CMM A;  1QG0 A;  3V76 A;  2QE7 A;  4RDL A;  5KW9 A;  3WQZ A;  4XKV A;  3WXM A;  3Q3A A;  2R9V A;  4YEL A;  4XOT A;  3U6K A;  2OTJ B;  1GO2 A;  3H94 A;  4PC1 A;  3FKS A;  1FRN A;  1NB9 A;  1Y0Y A;  1EFU A;  2E1B A;  2E1R A;  4YEJ A;  2CF4 A;  3B8H A;  4RD3 A;  1FNM A;  1WOS A;  3P26 A;  4B43 A;  4Z4S A;  4RPD A;  2XZL A;  2PLF A;  4FXU A;  3BCF A;  2Z6B D;  4P1V A;  1EXM A;  2WJY A;  4RLZ A;  1KD1 D;  2PE3 A;  2DET A;  2D74 A;  2GJK A;  2ZTG A;  2QTL A;  1TUI A;  4P3I A;  4K1X A;  3LO8 A;  3AGP A;  3V7A A;  3VNU A;  3VNV A;  1KQS B;  1YX2 A;  2P3M A;  2BMW A;  1EFR A;  4B47 A;  3CP8 A;  4YAL A;  4YAU A;  1E1R A;  3OKX A;  3ZC3 A;  4XOP A;  3W2H A;  4B4D A;  3CC4 B;  2CBX A;  3Q38 A;  5IYN A;  4OOX A;  3W5U A;  2OBR A;  2WR8 A;  3T53 B;  1ZM9 A;  3PA1 A;  3Q39 A;  5JBQ A;  2AHO A;  1ZUN B;  3PUM A;  2HLD A;  4XLC A;  4Y7C A;  4PAB A;  3WYA A;  4B3G A;  2QGG A;  4M4S A;  4X07 A;  1QUE A;  3A3B A;  1KK1 A;  2BM0 A;  2BGI A;  2DCU A;  1UD2 A;  4WZE A;  1B2R A;  1D2E A;  1KZL A;  5DS0 A;  4C43 A;  3QFT A;  2PMD A;  4OPO A;  3DDY A;  4B3F X;  4XMY A;  5EMN A;  1P4M A;  2ZBU A;  1OB5 A;  2Q6O A;  1W0K A;  4TMT A;  2PIA A;  1VQ7 B;  1FRQ A;  1VHE A;  4LBY A;  2WJV A;  4P3Y A;  1S72 B;  3I56 B;  1JJ2 B;  1VLY A;  2YWF A;  3A3G A;  5J35 A;  2ZIT A;  5IK2 A;  2J7K A;  1ELO A;  1VQO B;  4XON A;  4XLF A;  2HMA A;  3PUN A;  2F1M A;  4XR6 A;  5A89 A;  1YHQ B;  1HA3 A;  1OHH A;  2GJP A;  2OK7 A;  2QTZ A;  3LNN A;  2ZZQ A;  4II2 A;  2C78 A;  2OYN A;  3SEJ A;  1VHO A;  2GK7 A;  1VQ9 B;  3OOC A;  3AVT A;  2X85 A;  2XEX A;  3G4S B;  5A88 A;  4XL9 A;  2EIX A;  3CP2 A;  2YWG A;  4N3G A;  1WTH D;  1KK3 A;  1ZM3 A;  3AST A;  4YAO A;  5F4O A;  1S0U A;  4G1B A;  2YWE A;  4MYT A;  4DQK A;  4R71 A;  4P22 A;  2QA4 B;  3ASS A;  1TTT A;  1WP6 A;  4Z4T A;  1VQK B;  3SJZ A;  2F1L A;  2C5B A;  1YJN B;  1HZE A;  1UMK A;  3KL9 A;  4QV2 A;  1V0E A;  1EP1 B;  3CB4 A;  3CPW B;  1DDG A;  2GRE A;  3FPP A;  2ZZF A;  4X7C A;  2EFG A;  2DIE A;  2X0K A;  1XE1 A;  3R6J A;  2F43 A;  4FK8 A;  4ZGQ B;  3AGQ A;  5FL7 A;  3CCS B;  4XQF A;  4OPS A;  1VF7 A;  4XOR A;  4TMW A;  4ZV4 A;  4ROX A;  5BSY A;  3CCV B;  1YIJ B;  1TVC A;  2VBU A;  3D26 A;  3QSY A;  4HE5 A;  3CCJ B;  4UZF A;  3CPX A;  3OJX A;  4LC0 A;  4PGO A;  3ZPN A;  4UZE A;  1G7S A;  5IYP A;  1PJ5 A;  1QGZ A;  2XZP A;  1OGI A;  1VQ8 B;  2VNI A;  4HE6 A;  4Y9R A;  4Z1M A;  3ZBU A;  1NJI D;  1W2B B;  1YLO A;  2QMU A;  1JA1 A;  4YXW A;  3SLD A;  3CMA B;  2BSA A;  1MRZ A;  2CND A;  3MCA A;  4RCZ A;  1E63 A;  4Z4W A;  3VMF A;  1G7R A;  1Y0R A;  1QFJ A;  4MYU A;  3B78 A;  5DSZ A;  3CD6 B;  1OB0 A;  2LZJ A;  2GQF A;  4ZCI A;  1CQX A;  1E1Q A;  1I8D A;  1PJ7 A;  1MAB A;  2VNJ A;  4XN3 A;  3GQB A;  3A8K A;  5FO1 A;  4AF7 A;  4XLA A;  3G6E B;  1XB2 A;  2M5S A;  3CME B;  4RJL A;  2ZL6 A;  2ZL5 A;  4X8I A;  3J81 k;  3BQJ A;  2BVN A;  2VNH A;  1NDH A;  2QDX A;  1R5B A;  2NV4 A;  3OJW A;  2VBV A;  2ZTN A;  3AVU A;  3W2E A;  1W35 A;  1D8T A;  4YAW A;  3Q6R A;  2C4U A;  4KKT A;  1RQR A;  1UD3 A;  1K9M D;  3CCU B;  3WBK A;  2XOK A;  3QE2 A;  1K28 D;  1QH0 A;  4YHB A;  2BV3 A;  1NB0 A;  1BX1 A;  2BPO A;  3E20 A;  2BN4 A;  4XKW A;  1YI2 B;  3OPO A;  2V7V A;  3ZZ0 A;  5THX A;  1E79 A;  5AN9 A;  4B48 A;  2HCJ B;  2V7U A;  3FJO A;  1CNF A;  3A8I A;  3U2Q A;  4E0F A;  1T6Y A;  4PC3 A;  4TKO B;  2OTL B;  4RD4 A;  3KEW A;  4FWT A;  2Q6I A;  3H9N A;  4M53 A;  4Y9U A;  3AVY A;  3E1Y E;  1WDT A;  4P6V F;  1QGA A;  4PC6 A;  4OPV A;  1BPL A;  3ISX A;  4XM3 A;  1YJW B;  2V4D A;  2BF4 A;  1W0J A;  2VBT A;  2ZL7 A;  4G1V A;  1I18 A;  4J0Q A;  1YIT B;  2B7B A;  1BJK A;  1QGY A;  1UD8 A;  1ZM2 A;  1VQ6 B;  2V31 A;  4Z4Y A;  4PC2 A;  1EFC A;  3ASP A;  3CTA A;  2WSS A;  4G7W A;  4IW3 B;  1VQM B;  4P6Y A;  3PEN A;  1Q82 D;  3SJP A;  2VZL A;  4RCY A;  1QFZ A;  1H8E A;  1S4M A;  1Q81 D;  4XLH A;  2BM1 A;  1PKV A;  5FIU A;  1WOP A;  2D3N A;  1E3Z A;  3BH4 A;  4JMQ A;  3GIR A;  3OEE A;  4B44 A;  2X53 S;  4LBW A;  1V0F A;  3CW2 A;  1PJ6 A;  5B6I A;  2V7X A;  1VQ4 B;  1RQP A;  1EP2 B;  2JN9 A;  4M1K A;  4NBS A;  2GK6 A;  3G05 A;  3VR6 A;  5FNZ A;  2VJI A;  3ZZU A;  4ACA A;  4DNT B;  3OEH A;  1GR1 A;  3I55 B;  2X6X A;  1BQE A;  3CC2 B;  4BPR A;  5TRD A;  3OW7 A;  1VJS A;  2FX3 A;  1GVH A;  1E43 A;  1M1K D;  5FA6 A;  1EP3 B;  5GV8 A;  4TMX A;  1VQN B;  4WQM A;  4WZK A;  2XND A;  1UD6 A;  4B3X A;  3W5H A;  3W2G A;  2ZBV A;  3PA2 A;  4H9G A;  4UAJ A;  1N8R D;  3WBJ A;  2D9R A;  3BCD A;  1SKQ A;  3Q6Q A;  1FX0 A;  2C2W A;  4RDJ A;  2VNK A;  3VO1 A;  2X6W A;  4U9U A;  4YAF A;  3GSI A;  2JIZ A;  1SM4 A;  3CRZ A;  4RD1 A;  1IJF A;  2ZZG A;  1G7T A;  1R5N A;  4TSF A;  2YWH A;  4EH1 A;  3JQR A;  5IYQ A;  5IYW A;  3ASR A;  3OZW A;  3HAG A;  3JQQ A;  2XGJ A;  2CC2 A;  1WOO A;  1N08 A;  4ZCM A;  4Z4Z A;  4P2N A;  4UZU A;  4WWV A;  4X05 A;  5HXB A;  2FVG A;  1A8P A;  2W6I A;  3PVD A;  5IYR A;  4Z4U A;  1GJR A;  1SKY B;  4X0C A;  3GVL A;  1QVF B;  3NE5 B;  1DAR A;  2X6Y A;  1T6Z A;  2RC5 A;  4QHY A;  3U6B A;  1VQP B;  1IHM A;  1DDI A;  1BLI A;  1UD5 A;  4RD6 A;  1QVG B;  5HKK A;  5HZB A;  2DER A;  4P12 A;  4AF6 A;  4XLE A;  1KMH A;  4XNF A;  1AIP A;  1COW A;  2QN6 A;  2DEU A;  2JJ2 A;  1EFT A;  2ZZE A;  2CW5 A;  4ZGN B;  4NCN A;  5LMZ A;  2XNJ A;  1FDR A;  5CDF A;  4P25 A;  2Q6L A;  1KRH A;  5DN6 A;  1XFO A;  4Z4V A;  2D3L A;  1E3X A;  3W5V A;  2ZXH A;  3ES9 A;  4ASU A;  4CQJ A;  5E6T A;  1KC8 D;  1NBM A;  2HDN B;  4OOV A;  1Q9S A;  2V7T A;  3BC9 A;  1AMO A;  2R6H A;  1JB9 A;  1WSV A;  1Q86 D;  5BSX A;  1QUF A;  1GAQ A;  3W2F A;  3JU4 A;  1WSR A;  3GVK A;  2C5H A;  3OAA A;  3ONY A;  1N0V C;  1TLL A; 
#chains in the Genus database with same CATH homology
 1KK0 A;  2QEX B;  3OW2 B;  3G71 B;  3WY9 A;  1FNB A;  1K73 D;  1D1N A;  4LBV A;  3CC7 B;  1H85 A;  4TN1 A;  1N0U A;  2RC6 A;  2XNC A;  1KK2 A;  3P27 A;  1DG1 G;  4FN5 A;  4F7D A;  3B82 A;  4ZCL A;  3QFR A;  1E62 A;  3FPK A;  4LBZ A;  3WNB A;  3AVW A;  2B5O A;  4G5G A;  1H42 A;  3LVB A;  2X3U A;  1OGJ A;  1F60 A;  4AC9 A;  1FND A;  3VO2 A;  5TV2 A;  1BX0 A;  2NPF A;  4QFM A;  1VQL B;  2VYQ A;  4Q7J B;  5H59 A;  5KSW B;  4ACB A;  3CCL B;  1IB0 A;  5TY0 A;  2OK8 A;  3CCR B;  3WNC A;  3W2I A;  1G7C A;  1QX4 A;  1R5O A;  4RD0 A;  3WND A;  1J9Z A;  1EWY A;  1B23 P;  4RD2 A;  3JQP A;  1GAW A;  3OZU A;  4N3N A;  1Q7Y D;  5TR9 A;  1KJZ A;  3CXC B;  2CRV A;  2C77 A;  2GPJ A;  1IJE A;  4C0S A;  1I7P A;  4TMV A;  3OZV A;  3QFC A;  1M90 D;  1F20 A;  1YJ9 B;  1KTV A;  1JNY A;  3I1F A;  5GV7 A;  2BGJ A;  3QFS A;  3ZZT A;  4M0L A;  1ZM4 A;  3CCQ B;  3AVX A;  3MHP A;  1JA0 A;  1U2R A;  1QFY A;  4PC7 A;  3AVV A;  5H5J A;  4M2L A;  3CCE B;  1CNE A;  1K8A D;  1W87 A;  1W34 A;  1OB2 A;  4DQL A;  3ZBT A;  1VQ5 B;  4TMZ A;  2B7C A;  3CCM B;  3MMP A;  1FNC A;  1E64 A;  2DY1 A;  1QG0 A;  3V76 A;  3WXM A;  3U6K A;  2OTJ B;  1GO2 A;  4PC1 A;  1FRN A;  2E1R A;  1EFU A;  3B8H A;  4RD3 A;  1FNM A;  3P26 A;  4B43 A;  2PLF A;  1EXM A;  1KD1 D;  2DET A;  2D74 A;  2QTL A;  1TUI A;  4K1X A;  3LO8 A;  3AGP A;  3VNU A;  3VNV A;  1KQS B;  2BMW A;  4B47 A;  4YAU A;  4YAL A;  3ZC3 A;  3W2H A;  4B4D A;  3CC4 B;  3W5U A;  1ZM9 A;  5JBQ A;  2AHO A;  1ZUN B;  4Y7C A;  3WYA A;  4M4S A;  1QUE A;  1KK1 A;  2BM0 A;  2BGI A;  2DCU A;  1B2R A;  1D2E A;  4C43 A;  3QFT A;  2PMD A;  5EMN A;  1OB5 A;  4TMT A;  1VQ7 B;  2PIA A;  1FRQ A;  4P3Y A;  4LBY A;  1S72 B;  3I56 B;  1JJ2 B;  2YWF A;  2ZIT A;  2J7K A;  1ELO A;  1VQO B;  2HMA A;  1YHQ B;  1HA3 A;  2OK7 A;  2QTZ A;  2C78 A;  1VQ9 B;  3AVT A;  2XEX A;  3G4S B;  2EIX A;  2YWG A;  4N3G A;  1KK3 A;  1ZM3 A;  4YAO A;  1S0U A;  4G1B A;  2YWE A;  4MYT A;  4DQK A;  4R71 A;  1TTT A;  2QA4 B;  1VQK B;  3SJZ A;  1YJN B;  1UMK A;  1EP1 B;  3CB4 A;  3CPW B;  1DDG A;  2EFG A;  1XE1 A;  4FK8 A;  4ZGQ B;  3AGQ A;  3CCS B;  4TMW A;  4ZV4 A;  3CCV B;  1YIJ B;  1TVC A;  3QSY A;  4HE5 A;  3CCJ B;  3OJX A;  4LC0 A;  4PGO A;  1G7S A;  1QGZ A;  1OGI A;  1VQ8 B;  2VNI A;  4HE6 A;  4Y9R A;  3ZBU A;  1NJI D;  1W2B B;  2QMU A;  1JA1 A;  3CMA B;  2BSA A;  2CND A;  3MCA A;  4RCZ A;  1E63 A;  3VMF A;  1G7R A;  1QFJ A;  4MYU A;  3B78 A;  5DSZ A;  3CD6 B;  4ZCI A;  2GQF A;  1CQX A;  2VNJ A;  4AF7 A;  3G6E B;  1XB2 A;  3CME B;  4RJL A;  3J81 k;  2BVN A;  2VNH A;  1NDH A;  2QDX A;  1R5B A;  3OJW A;  3AVU A;  3W2E A;  1W35 A;  1D8T A;  4YAW A;  1K9M D;  3CCU B;  3WBK A;  3QE2 A;  1QH0 A;  4YHB A;  2BV3 A;  1BX1 A;  2BPO A;  3E20 A;  2BN4 A;  1YI2 B;  3ZZ0 A;  5THX A;  5AN9 A;  4B48 A;  2HCJ B;  3FJO A;  1CNF A;  3U2Q A;  4PC3 A;  2OTL B;  4RD4 A;  4FWT A;  4Y9U A;  4M53 A;  3AVY A;  3E1Y E;  1WDT A;  4P6V F;  1QGA A;  4PC6 A;  1YJW B;  2BF4 A;  4G1V A;  4J0Q A;  1YIT B;  2B7B A;  1BJK A;  1QGY A;  1ZM2 A;  1VQ6 B;  4PC2 A;  1EFC A;  4IW3 B;  1VQM B;  3PEN A;  1Q82 D;  2VZL A;  4RCY A;  1QFZ A;  1Q81 D;  2BM1 A;  4B44 A;  4LBW A;  3CW2 A;  1VQ4 B;  1EP2 B;  4M1K A;  4NBS A;  3ZZU A;  4ACA A;  1GR1 A;  3I55 B;  1BQE A;  3CC2 B;  4BPR A;  2FX3 A;  1GVH A;  1M1K D;  5FA6 A;  1EP3 B;  5GV8 A;  4TMX A;  1VQN B;  4WQM A;  4B3X A;  3W5H A;  3W2G A;  4H9G A;  4UAJ A;  1N8R D;  3WBJ A;  1SKQ A;  2VNK A;  3VO1 A;  4U9U A;  4YAF A;  1SM4 A;  3CRZ A;  4RD1 A;  1IJF A;  1G7T A;  1R5N A;  2YWH A;  4EH1 A;  3JQR A;  3OZW A;  3JQQ A;  4ZCM A;  5HXB A;  1A8P A;  1GJR A;  1QVF B;  1DAR A;  2RC5 A;  4QHY A;  3U6B A;  1VQP B;  1DDI A;  4RD6 A;  1QVG B;  2DER A;  4AF6 A;  1AIP A;  2QN6 A;  2DEU A;  1EFT A;  4ZGN B;  4NCN A;  2XNJ A;  1FDR A;  1KRH A;  3W5V A;  3ES9 A;  1KC8 D;  2HDN B;  1AMO A;  2R6H A;  1JB9 A;  1Q86 D;  1QUF A;  1GAQ A;  3W2F A;  1N0V C;  1TLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...