4PGOA

Crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
EILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 19
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4pgoA00
1NDHA 4BPRA 3QFSA 3CCJB 3ZBUA 4LBZA 3E1YE 1QGYA 4LBYA 4RCZA 1FNDA 3QFRA 3AGPA 1Q86D 3ES9A 2RC6A 1KD1D 5GV7A 2ZITA 1KK0A 3CCEB 5AN9A 3WNCA 1JA1A 1R5BA 3CC2B 4NBSA 2OTJB 3G4SB 5H5JA 3CCQB 2PMDA 3AGQA 4AC9A 2BGIA 1QVGB 2HDNB 1IB0A 4EH1A 1W34A 1R5NA 3QFTA 2VZLA 3MCAA 4YHBA 1KC8D 3JQPA 1VQ9B 3I1FA 1YJ9B 4RD0A 3CB4A 1GR1A 4RD1A 4RJLA 5KSWB 2VNIA 1QFJA 2BM0A 1N8RD 4ZCIA 1QGAA 1F60A 4RD3A 4PC1A 4ZGNB 4G5GA 3CC4B 1EXMA 3VMFA 3P27A 4TMVA 2X3UA 4RCYA 1GAQA 4M2LA 3WNBA 1CNEA 1ZM4A 1K9MD 2XEXA 2HCJB 3W5UA 2VNHA 1G7TA 2VYQA 1QX4A 4N3NA 5HXBA 2AHOA 1BX1A 1VQNB 4M53A 3G71B 5TV2A 4MYTA 4P6VF 1YITB 3AVUA 2DCUA 4LBVA 3W2EA 3B78A 3AVYA 1QG0A 5JBQA 3MMPA 5TR9A 1AMOA 1KJZA 3WXMA 1VQMB 2BGJA 1CNFA 4TMTA 1FNBA 3WBJA 4F7DA 1D2EA 1ZM9A 1J9ZA 1VQ6B 3VNVA 2C77A 4AF7A 1BX0A 1DARA 1XE1A 3FPKA 3U6BA 2YWEA 1BJKA 1N0UA 3ZZTA 3FJOA 1W2BB 1EP1B 4P3YA 1QVFB 2R6HA 1YHQB 3AVTA 1E63A 1SKQA 5GV8A 4FN5A 3OJXA 5EMNA 4QHYA 2BM1A 1WDTA 4J0QA 2GQFA 4PC3A 3AVXA 1XB2A 1G7CA 4UAJA 1TLLA 2FX3A 2J7KA 5TY0A 2HMAA 1QH0A 3AVVA 2GPJA 1GO2A 1I7PA 3I56B 4QFMA 1H85A 1YI2B 3U6KA 2BPOA 2BN4A 2YWHA 1B2RA 2QEXB 3I55B 1JJ2B 1R5OA 4B47A 1BQEA 4DQKA 1QFYA 1NJID 2QMUA 2OTLB 1H42A 4ZV4A 5DSZA 4TMXA 4ACBA 3CD6B 3E20A 3ZBTA 1YIJB 4HE6A 1U2RA 3W2GA 1GJRA 1EFCA 1KK3A 1AIPA 3CCUB 2YWFA 1M90D 1EP2B 1EWYA 1K73D 1VQ7B 1Q82D 1KRHA 1ZUNB 2BMWA 1JA0A 4C0SA 1VQOB 4RD2A 3OZWA 1VQ5B 3P26A 4Y9RA 4FWTA 2VNJA 3OZUA 4B43A 1JB9A 1E62A 3JQRA 4FK8A 4YAOA 1YJWB 4H9GA 4LBWA 2DERA 3WNDA 1IJEA 3W5VA 4YAUA 1OGJA 2QN6A 4PC6A 1ZM2A 1FNCA 4NCNA 2NPFA 1GVHA 1N0VC 1GAWA 2D74A 4K1XA 3CXCB 1TUIA 4PC2A 4PGOA 4TMZA 1DDIA 1W35A 3VNUA 2EFGA 4N3GA 1VQPB 4B4DA 2DEUA 3WYAA 2B5OA 3B8HA 1KK1A 2CNDA 1G7RA 3W2HA 3WBKA 4DQLA 1TVCA 4R71A 3LO8A 4HE5A 3CMEB 1D8TA 3CCSB 3W5HA 1D1NA 1EFUA 2CRVA 2B7BA 1IJFA 4LC0A 2QA4B 1Q7YD 4M4SA 3QFCA 1FRNA 4B44A 2RC5A 2B7CA 1ELOA 3CCMB 1EP3B 1HA3A 4YALA 4G1BA 3VO1A 4C43A 2DY1A 1YJNB 4G1VA 1DG1G 1QFZA 3CPWB 1F20A 4TMWA 2VNKA 4Q7JB 4B48A 1EFTA 3QE2A 4ZCLA 1VQ8B 3CRZA 4YAWA 1VQLB 2XNJA 3OW2B 1S0UA 2QTLA 3OJWA 3ZC3A 2QTZA 1OB2A 1FDRA 2DETA 1B23P 3CCVB 3B82A 3CCRB 3WY9A 1TTTA 1QGZA 5H59A 3PENA 2PLFA 2YWGA 1E64A 3VO2A 2EIXA 4B3XA 1SM4A 1KTVA 3ZZUA 2C78A 4Y9UA 4PC7A 3CW2A 1CQXA 1VQ4B 1DDGA 4ZGQB 4TN1A 4M1KA 1KQSB 3J81k 2QDXA 4M0LA 4AF6A 2E1RA 4Y7CA 1K8AD 1ZM3A 3G6EB 1KK2A 1A8PA 5THXA 3CCLB 3LVBA 1OGIA 2BSAA 4ZCMA 2OK8A 3OZVA 1QUFA 1FNMA 2BF4A 3W2FA 1FRQA 3U2QA 1JNYA 2PIAA 4ACAA 4YAFA 1G7SA 2XNCA 2OK7A 3MHPA 3CC7B 5FA6A 1W87A 3JQQA 3SJZA 3CMAB 1M1KD 3ZZ0A 3QSYA 4MYUA 4RD4A 4U9UA 4RD6A 4IW3B 1OB5A 3V76A 1Q81D 2BVNA 3W2IA 3AVWA 2BV3A 1QUEA 1S72B 4WQMA 1VQKB 1UMKA
chains in the Genus database with same CATH superfamily
1NDHA 3JU4A 4BPRA 4XKWA 1E1RA 3QFSA 4WZTA 3CCJB 3ZBUA 4LBZA 1PKVA 2VJJA 3E1YE 1QGYA 4LBYA 1P4MA 4RCZA 4Z4RA 1FNDA 3SJPA 3QFRA 3AGPA 3T53B 4G7WA 1Q86D 3ES9A 2CF4A 2RC6A 2WJVA 1KD1D 1E3XA 5GV7A 3T51B 2ZITA 5TRDA 1KK0A 3CCEB 2HLDA 5AN9A 3WNCA 5BSYA 4II2A 1XFOA 1JA1A 1Y0YA 1R5BA 3FKSA 5IYWA 3GVKA 1VHOA 3CC2B 4NBSA 2XZOA 2OTJB 3V7AA 1FX0A 3G4SB 5H5JA 3CCQB 2PMDA 1XQBA 2OYNA 3ONYA 3AGQA 4AC9A 5A89A 2GK6A 2BGIA 2Q6LA 3G05A 3GQBA 1QVGB 2HDNB 3LQ6A 1IB0A 3PA2A 4EH1A 1WPCA 2V4DA 1W34A 1R5NA 3BY1A 3QFTA 2VZLA 3MCAA 1W9XA 4YHBA 1KC8D 3OE7A 3JQPA 4UZEA 2C5BA 1Q9SA 1UD8A 3A3GA 5DN6A 4RPBA 1K28D 1VQ9B 2JIZA 3I1FA 1YJ9B 2F4NA 4RD0A 2V7QA 1UD4A 3OOCA 2V7TA 1E3ZA 3CB4A 5J35A 1GR1A 4KKTA 2X6WA 4RD1A 3CMMA 2VNIA 4RJLA 5KSWB 1QFJA 2BM0A 1T5EA 1N8RD 2Q6OA 4ZCIA 4Z4WA 1QGAA 1F60A 4P6YA 4RD3A 4PC1A 4P2NA 2VBUA 2GJPA 4XD7A 4ZGNB 5A8AA 4HIZA 4G5GA 3OEHA 3CC4B 1EXMA 3OP1A 4AVZA 3VMFA 2GREA 3P27A 4TMVA 4RLZA 2OBTA 4ROXA 2X3UA 3BH4A 2WZNA 4RCYA 2ZZEA 1GAQA 4RPDA 2XGJA 2ZXHA 4M2LA 3WNBA 3OW7A 3BCFA 2D9RA 1CNEA 1ZM4A 1K9MD 2XEXA 3A8JA 3OFNA 2V31A 2HCJB 3ZIAA 3W5UA 3A8IA 1I8DA 4P3IA 3T56B 2ZZFA 2WSSA 3FPPA 4XQFA 2KVOA 2VNHA 3ASPA 1G7TA 2VYQA 5FL7A 1QX4A 4N3NA 5HXBA 3GVLA 3CP8A 2AHOA 1BX1A 1RQPA 3NE5B 1NRKA 4PAAA 4M53A 1VQNB 4X7FA 3G71B 2WJYA 2P3MA 5TV2A 2NV4A 4MYTA 4QV2A 4P6VF 1YITB 3AVUA 2DOGA 2DCUA 4LBVA 4DNRB 3B78A 3W2EA 4XORA 1E1QA 4XLAA 3AVYA 4GQNA 2GJRA 5KW9A 1QG0A 1S4MA 3A3BA 5JBQA 3MMPA 1UD6A 5BSXA 5TR9A 1AMOA 1KJZA 2Z6BD 4WZKA 3WXMA 5HKKA 4TT3A 1VQMB 2BGJA 1CNFA 4TMTA 5F4JA 1FNBA 3ONUA 1VLYA 2F1MA 3WBJA 4F7DA 1D2EA 1ZM9A 1J9ZA 1VQ6B 2V7WA 3BY2A 4DK0A 3ISXA 2C77A 3VNVA 4AF7A 1BX0A 2V7XA 2X0KA 1DARA 1XE1A 3FPKA 3U6BA 2Q6KA 2YWEA 4P1VA 1BJKA 1SKYB 3GVJA 4G6IA 1N0UA 4FXUA 3ZZTA 1VHEA 3KEWA 5IYPA 4Z4VA 4XOTA 2JDIA 1H8HA 1WP6A 2CBXA 3FJOA 4Z4YA 1W2BB 1EP1B 3LQEA 1WORA 4WZLA 4P22A 2ZXIA 5FNZA 3BC9A 2WPDA 4P3YA 2FVGA 5HZBA 2C4UA 1QVFB 2R6HA 1YHQB 3AVTA 1E63A 2CC2A 3ASRA 1SKQA 5GV8A 3OKXA 5F4MA 3SKBA 4FN5A 3OPOA 3OJXA 2WZPP 4UZFA 5EMNA 1PJ7A 4QHYA 2BM1A 1WDTA 4J0QA 1MABA 2GQFA 4OOXA 2X6XA 3PA1A 3R6JA 4PC3A 1MRZA 4X8IA 3AVXA 1XB2A 4OPVA 2WR8A 1G7CA 5IK2A 4UAJA 5FO1A 2E1BA 4TSFA 1TLLA 2FX3A 3PVDA 2WYRA 2J7KA 5TY0A 2HMAA 1QH0A 2R9VA 4P12A 1OHHA 3AVVA 2GPJA 1GO2A 1I7PA 3I56B 1BLIA 4QFMA 1H85A 5DS0A 1YI2B 3U6KA 2JJ2A 2BPOA 2BN4A 2YWHA 1B2RA 1COWA 4Z4UA 5LMZA 1V0EA 2QEXB 4L8JA 1BMFA 3Q6RA 1BPLA 3I55B 3SLDA 2X85A 1WSRA 3H94A 4X7DA 1UD5A 1JJ2B 2OBSA 1H8EA 4E0FA 2W6JA 1R5OA 2ZL5A 4B47A 1VF7A 1BQEA 4DQKA 1QFYA 1NJID 1YLOA 2QMUA 4OPOA 1H42A 2OTLB 3R6KA 4QVJA 4ZV4A 4XN3A 5DSZA 2DIEA 4TMXA 4KKUA 4ACBA 2ZZQA 2XNDA 4QVAA 1UD3A 3E20A 3CD6B 1WOOA 3VR6A 4XN0A 5FIUA 3ZBTA 2VBSA 1YIJB 4HE6A 1U2RA 2V7VA 3W2GA 1GJRA 1EFCA 1KK3A 1AIPA 3CCUB 2YWFA 5CDFA 1M90D 5F4OA 4DK1A 1T6ZA 3RY8A 1EP2B 1EWYA 2D3LA 3ASQA 1K73D 1Q82D 1VQ7B 1KRHA 3DDYA 1ZUNB 1UD2A 1JA0A 2BMWA 4C0SA 1VQOB 4RD2A 3OZWA 1VQ5B 2OBRA 3P26A 3CESA 2D3NA 4TKOB 4XKVA 4Y9RA 4FWTA 2VNJA 3OZUA 4B43A 1JB9A 4OOVA 2W6IA 1E62A 3JQRA 4FK8A 1N08A 4YAOA 1YJWB 4XNFA 2VBVA 4H9GA 4LBWA 2DERA 3WNDA 3SEJA 1IJEA 3HAGA 3GSIA 3W5VA 1Y0RA 4YAUA 1OGJA 4Z4TA 1WU8A 1YX2A 4NNJA 2LZJA 2QN6A 1KMHA 4PC6A 1ZM2A 1HZEA 1FNCA 2QE7A 4NCNA 2NPFA 1GVHA 4P9SA 3H9NA 1T6YA 5J3OA 2VBTA 2F43A 1V5VA 4YEJA 1N0VC 1GAWA 1N07A 2D74A 4XLCA 4K1XA 1WTHD 3CXCB 1TUIA 3A8KA 4PC2A 4JMQA 4PGOA 1DDIA 4TMZA 4YELA 5L46A 1W35A 4P26A 3VNUA 2EFGA 4N3GA 1VQPB 4B4DA 4WWVA 2DEUA 2C2WA 3A1PA 3WYAA 2B5OA 3B8HA 1KK1A 3ASSA 2CNDA 4QUZA 3WQZA 1G7RA 1E43A 3BNWA 2M5SA 3W2HA 3WBKA 4DQLA 1TVCA 2PE3A 2V7UA 3PUMA 2C5HA 4UZUA 4R71A 3LO8A 4HE5A 3CMEB 4G7XA 2VJIA 1D8TA 3CCSB 4II3A 4RDKA 2F1LA 1HVXA 1E79A 3W5HA 1D1NA 1EFUA 2ZL7A 3CPXA 3OEEA 2CRVA 3OAAA 4RDLA 2B7BA 1IJFA 4LC0A 2QA4B 1Q7YD 2ZBUA 1NBMA 2CW5A 1RQRA 4XLEA 3Q39A 4M4SA 4P25A 3QFCA 2Q6IA 2XZPA 1FRNA 1EFRA 4X7CA 2RC5A 4B44A 2B7CA 3PUNA 1ELOA 4XOPA 3CCMB 1EP3B 1HA3A 4YALA 4G1BA 4X06A 4XLFA 2JJ1A 3GIRA 1N06A 3VO1A 4C43A 2DY1A 1YJNB 4G1VA 1DG1G 1WOPA 1VLOA 1QFZA 3CPWB 3A35A 1F20A 4TMWA 2CK3A 2VNKA 3SLNA 4Q7JB 4B48A 4Z4ZA 1EFTA 3QE2A 3KL9A 4ZCLA 2C4TA 4X0CA 1VQ8B 1WSVA 1PJ6A 4CQJA 3CRZA 4YAWA 1VQLB 2ZBVA 3BQJA 1PJ5A 1T6XA 2XNJA 5E6TA 4OOSA 3OW2B 1S0UA 2QTLA 3OJWA 3ZC3A 2QTZA 1OB2A 3CP2A 1FDRA 2DETA 1B23P 3CCVB 3B82A 3CCRB 3WY9A 1TTTA 1VJSA 1QGZA 5H59A 3PENA 2PLFA 2YWGA 1E64A 3VO2A 2EIXA 4B3XA 2DYIA 1SM4A 4PABA 5A88A 1KTVA 3ZZUA 5IYQA 1I18A 2C78A 4Y9UA 4XL9A 4PC7A 4OPSA 3CW2A 1CQXA 4Z4SA 1VQ4B 1DDGA 4ZGQB 4TN1A 4M1KA 2X8KA 1KQSB 1KZLA 3Q3AA 4XM3A 3J81k 4B3FX 2QDXA 3ASTA 3Q6QA 4RM0A 4M0LA 2ZTGA 3ZPNA 4RDJA 4XONA 4AF6A 4DNTB 4WZEA 4B3GA 3ZUGA 4X05A 2E1RA 4Y7CA 2X53S 5IYNA 2ZZGA 1K8AD 2GJKA 2QGGA 3CTAA 1ZM3A 4XMYA 3G6EB 1KK2A 1A8PA 1NB0A 3Q38A 3LNNA 1WOSA 5THXA 4X7EA 5B6IA 3CCLB 3LVBA 1OGIA 2BSAA 4ZCMA 2OK8A 3D26A 4KKSA 3OZVA 1QUFA 1FNMA 2BF4A 3W2FA 1FRQA 3U2QA 1JNYA 2PIAA 4YXWA 1W0KA 4ACAA 4YAFA 1G7SA 1OB0A 2XNCA 2GK7A 2OK7A 3MHPA 3CC7B 5FA6A 1N05A 1NB9A 1W87A 2XOKA 2ZL6A 3JQQA 3SJZA 3CMAB 2XZLA 4XR6A 1M1KD 2ZTNA 5FO0A 3ZZ0A 4MYUA 3QSYA 4RD4A 4U9UA 4OP7A 1V0FA 5HZAA 5IYRA 4RD6A 4IW3B 4X07A 1OB5A 2I1LA 1W0JA 4XLHA 3V76A 1IHMA 1Q81D 2X6YA 4Z1MA 2BVNA 3BCDA 3W2IA 5KNLA 2BV3A 3AVWA 1QUEA 1S72B 4ASUA 2JN9A 4WQMA 1VQKB 1UMKA
chains in the Genus database with same CATH topology
1NDHA 4BPRA 3QFSA 3CCJB 3ZBUA 4LBZA 3E1YE 1QGYA 4LBYA 4RCZA 1FNDA 3QFRA 3AGPA 1Q86D 3ES9A 2RC6A 1KD1D 5GV7A 2ZITA 1KK0A 3CCEB 5AN9A 3WNCA 1JA1A 1R5BA 3CC2B 4NBSA 2OTJB 3G4SB 5H5JA 3CCQB 2PMDA 3AGQA 4AC9A 2BGIA 1QVGB 2HDNB 1IB0A 4EH1A 1W34A 1R5NA 3QFTA 2VZLA 3MCAA 4YHBA 1KC8D 3JQPA 1VQ9B 3I1FA 1YJ9B 4RD0A 3CB4A 1GR1A 4RD1A 4RJLA 5KSWB 2VNIA 1QFJA 2BM0A 1N8RD 4ZCIA 1QGAA 1F60A 4RD3A 4PC1A 4ZGNB 4G5GA 3CC4B 1EXMA 3VMFA 3P27A 4TMVA 2X3UA 4RCYA 1GAQA 4M2LA 3WNBA 1CNEA 1ZM4A 1K9MD 2XEXA 2HCJB 3W5UA 2VNHA 1G7TA 2VYQA 1QX4A 4N3NA 5HXBA 2AHOA 1BX1A 1VQNB 4M53A 3G71B 5TV2A 4MYTA 4P6VF 1YITB 3AVUA 2DCUA 4LBVA 3W2EA 3B78A 3AVYA 1QG0A 5JBQA 3MMPA 5TR9A 1AMOA 1KJZA 3WXMA 1VQMB 2BGJA 1CNFA 4TMTA 1FNBA 3WBJA 4F7DA 1D2EA 1ZM9A 1J9ZA 1VQ6B 3VNVA 2C77A 4AF7A 1BX0A 1DARA 1XE1A 3FPKA 3U6BA 2YWEA 1BJKA 1N0UA 3ZZTA 3FJOA 1W2BB 1EP1B 4P3YA 1QVFB 2R6HA 1YHQB 3AVTA 1E63A 1SKQA 5GV8A 4FN5A 3OJXA 5EMNA 4QHYA 2BM1A 1WDTA 4J0QA 2GQFA 4PC3A 3AVXA 1XB2A 1G7CA 4UAJA 1TLLA 2FX3A 2J7KA 5TY0A 2HMAA 1QH0A 3AVVA 2GPJA 1GO2A 1I7PA 3I56B 4QFMA 1H85A 1YI2B 3U6KA 2BPOA 2BN4A 2YWHA 1B2RA 2QEXB 3I55B 1JJ2B 1R5OA 4B47A 1BQEA 4DQKA 1QFYA 1NJID 2QMUA 2OTLB 1H42A 4ZV4A 5DSZA 4TMXA 4ACBA 3CD6B 3E20A 3ZBTA 1YIJB 4HE6A 1U2RA 3W2GA 1GJRA 1EFCA 1KK3A 1AIPA 3CCUB 2YWFA 1M90D 1EP2B 1EWYA 1K73D 1VQ7B 1Q82D 1KRHA 1ZUNB 2BMWA 1JA0A 4C0SA 1VQOB 4RD2A 3OZWA 1VQ5B 3P26A 4Y9RA 4FWTA 2VNJA 3OZUA 4B43A 1JB9A 1E62A 3JQRA 4FK8A 4YAOA 1YJWB 4H9GA 4LBWA 2DERA 3WNDA 1IJEA 3W5VA 4YAUA 1OGJA 2QN6A 4PC6A 1ZM2A 1FNCA 4NCNA 2NPFA 1GVHA 1N0VC 1GAWA 2D74A 4K1XA 3CXCB 1TUIA 4PC2A 4PGOA 4TMZA 1DDIA 1W35A 3VNUA 2EFGA 4N3GA 1VQPB 4B4DA 2DEUA 3WYAA 2B5OA 3B8HA 1KK1A 2CNDA 1G7RA 3W2HA 3WBKA 4DQLA 1TVCA 4R71A 3LO8A 4HE5A 3CMEB 1D8TA 3CCSB 3W5HA 1D1NA 1EFUA 2CRVA 2B7BA 1IJFA 4LC0A 2QA4B 1Q7YD 4M4SA 3QFCA 1FRNA 4B44A 2RC5A 2B7CA 1ELOA 3CCMB 1EP3B 1HA3A 4YALA 4G1BA 3VO1A 4C43A 2DY1A 1YJNB 4G1VA 1DG1G 1QFZA 3CPWB 1F20A 4TMWA 2VNKA 4Q7JB 4B48A 1EFTA 3QE2A 4ZCLA 1VQ8B 3CRZA 4YAWA 1VQLB 2XNJA 3OW2B 1S0UA 2QTLA 3OJWA 3ZC3A 2QTZA 1OB2A 1FDRA 2DETA 1B23P 3CCVB 3B82A 3CCRB 3WY9A 1TTTA 1QGZA 5H59A 3PENA 2PLFA 2YWGA 1E64A 3VO2A 2EIXA 4B3XA 1SM4A 1KTVA 3ZZUA 2C78A 4Y9UA 4PC7A 3CW2A 1CQXA 1VQ4B 1DDGA 4ZGQB 4TN1A 4M1KA 1KQSB 3J81k 2QDXA 4M0LA 4AF6A 2E1RA 4Y7CA 1K8AD 1ZM3A 3G6EB 1KK2A 1A8PA 5THXA 3CCLB 3LVBA 1OGIA 2BSAA 4ZCMA 2OK8A 3OZVA 1QUFA 1FNMA 2BF4A 3W2FA 1FRQA 3U2QA 1JNYA 2PIAA 4ACAA 4YAFA 1G7SA 2XNCA 2OK7A 3MHPA 3CC7B 5FA6A 1W87A 3JQQA 3SJZA 3CMAB 1M1KD 3ZZ0A 3QSYA 4MYUA 4RD4A 4U9UA 4RD6A 4IW3B 1OB5A 3V76A 1Q81D 2BVNA 3W2IA 3AVWA 2BV3A 1QUEA 1S72B 4WQMA 1VQKB 1UMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDH A;  4BPR A;  3QFS A;  3CCJ B;  3ZBU A;  4LBZ A;  3E1Y E;  1QGY A;  4LBY A;  4RCZ A;  1FND A;  3QFR A;  3AGP A;  1Q86 D;  3ES9 A;  2RC6 A;  1KD1 D;  5GV7 A;  2ZIT A;  1KK0 A;  3CCE B;  5AN9 A;  3WNC A;  1JA1 A;  1R5B A;  3CC2 B;  4NBS A;  2OTJ B;  3G4S B;  5H5J A;  3CCQ B;  2PMD A;  3AGQ A;  4AC9 A;  2BGI A;  1QVG B;  2HDN B;  1IB0 A;  4EH1 A;  1W34 A;  1R5N A;  3QFT A;  2VZL A;  3MCA A;  4YHB A;  1KC8 D;  3JQP A;  1VQ9 B;  3I1F A;  1YJ9 B;  4RD0 A;  3CB4 A;  1GR1 A;  4RD1 A;  4RJL A;  5KSW B;  2VNI A;  1QFJ A;  2BM0 A;  1N8R D;  4ZCI A;  1QGA A;  1F60 A;  4RD3 A;  4PC1 A;  4ZGN B;  4G5G A;  3CC4 B;  1EXM A;  3VMF A;  3P27 A;  4TMV A;  2X3U A;  4RCY A;  1GAQ A;  4M2L A;  3WNB A;  1CNE A;  1ZM4 A;  1K9M D;  2XEX A;  2HCJ B;  3W5U A;  2VNH A;  1G7T A;  2VYQ A;  1QX4 A;  4N3N A;  5HXB A;  2AHO A;  1BX1 A;  1VQN B;  4M53 A;  3G71 B;  5TV2 A;  4MYT A;  4P6V F;  1YIT B;  3AVU A;  2DCU A;  4LBV A;  3W2E A;  3B78 A;  3AVY A;  1QG0 A;  5JBQ A;  3MMP A;  5TR9 A;  1AMO A;  1KJZ A;  3WXM A;  1VQM B;  2BGJ A;  1CNF A;  4TMT A;  1FNB A;  3WBJ A;  4F7D A;  1D2E A;  1ZM9 A;  1J9Z A;  1VQ6 B;  3VNV A;  2C77 A;  4AF7 A;  1BX0 A;  1DAR A;  1XE1 A;  3FPK A;  3U6B A;  2YWE A;  1BJK A;  1N0U A;  3ZZT A;  3FJO A;  1W2B B;  1EP1 B;  4P3Y A;  1QVF B;  2R6H A;  1YHQ B;  3AVT A;  1E63 A;  1SKQ A;  5GV8 A;  4FN5 A;  3OJX A;  5EMN A;  4QHY A;  2BM1 A;  1WDT A;  4J0Q A;  2GQF A;  4PC3 A;  3AVX A;  1XB2 A;  1G7C A;  4UAJ A;  1TLL A;  2FX3 A;  2J7K A;  5TY0 A;  2HMA A;  1QH0 A;  3AVV A;  2GPJ A;  1GO2 A;  1I7P A;  3I56 B;  4QFM A;  1H85 A;  1YI2 B;  3U6K A;  2BPO A;  2BN4 A;  2YWH A;  1B2R A;  2QEX B;  3I55 B;  1JJ2 B;  1R5O A;  4B47 A;  1BQE A;  4DQK A;  1QFY A;  1NJI D;  2QMU A;  2OTL B;  1H42 A;  4ZV4 A;  5DSZ A;  4TMX A;  4ACB A;  3CD6 B;  3E20 A;  3ZBT A;  1YIJ B;  4HE6 A;  1U2R A;  3W2G A;  1GJR A;  1EFC A;  1KK3 A;  1AIP A;  3CCU B;  2YWF A;  1M90 D;  1EP2 B;  1EWY A;  1K73 D;  1VQ7 B;  1Q82 D;  1KRH A;  1ZUN B;  2BMW A;  1JA0 A;  4C0S A;  1VQO B;  4RD2 A;  3OZW A;  1VQ5 B;  3P26 A;  4Y9R A;  4FWT A;  2VNJ A;  3OZU A;  4B43 A;  1JB9 A;  1E62 A;  3JQR A;  4FK8 A;  4YAO A;  1YJW B;  4H9G A;  4LBW A;  2DER A;  3WND A;  1IJE A;  3W5V A;  4YAU A;  1OGJ A;  2QN6 A;  4PC6 A;  1ZM2 A;  1FNC A;  4NCN A;  2NPF A;  1GVH A;  1N0V C;  1GAW A;  2D74 A;  4K1X A;  3CXC B;  1TUI A;  4PC2 A;  4PGO A;  4TMZ A;  1DDI A;  1W35 A;  3VNU A;  2EFG A;  4N3G A;  1VQP B;  4B4D A;  2DEU A;  3WYA A;  2B5O A;  3B8H A;  1KK1 A;  2CND A;  1G7R A;  3W2H A;  3WBK A;  4DQL A;  1TVC A;  4R71 A;  3LO8 A;  4HE5 A;  3CME B;  1D8T A;  3CCS B;  3W5H A;  1D1N A;  1EFU A;  2CRV A;  2B7B A;  1IJF A;  4LC0 A;  2QA4 B;  1Q7Y D;  4M4S A;  3QFC A;  1FRN A;  4B44 A;  2RC5 A;  2B7C A;  1ELO A;  3CCM B;  1EP3 B;  1HA3 A;  4YAL A;  4G1B A;  3VO1 A;  4C43 A;  2DY1 A;  1YJN B;  4G1V A;  1DG1 G;  1QFZ A;  3CPW B;  1F20 A;  4TMW A;  2VNK A;  4Q7J B;  4B48 A;  1EFT A;  3QE2 A;  4ZCL A;  1VQ8 B;  3CRZ A;  4YAW A;  1VQL B;  2XNJ A;  3OW2 B;  1S0U A;  2QTL A;  3OJW A;  3ZC3 A;  2QTZ A;  1OB2 A;  1FDR A;  2DET A;  1B23 P;  3CCV B;  3B82 A;  3CCR B;  3WY9 A;  1TTT A;  1QGZ A;  5H59 A;  3PEN A;  2PLF A;  2YWG A;  1E64 A;  3VO2 A;  2EIX A;  4B3X A;  1SM4 A;  1KTV A;  3ZZU A;  2C78 A;  4Y9U A;  4PC7 A;  3CW2 A;  1CQX A;  1VQ4 B;  1DDG A;  4ZGQ B;  4TN1 A;  4M1K A;  1KQS B;  3J81 k;  2QDX A;  4M0L A;  4AF6 A;  2E1R A;  4Y7C A;  1K8A D;  1ZM3 A;  3G6E B;  1KK2 A;  1A8P A;  5THX A;  3CCL B;  3LVB A;  1OGI A;  2BSA A;  4ZCM A;  2OK8 A;  3OZV A;  1QUF A;  1FNM A;  2BF4 A;  3W2F A;  1FRQ A;  3U2Q A;  1JNY A;  2PIA A;  4ACA A;  4YAF A;  1G7S A;  2XNC A;  2OK7 A;  3MHP A;  3CC7 B;  5FA6 A;  1W87 A;  3JQQ A;  3SJZ A;  3CMA B;  1M1K D;  3ZZ0 A;  3QSY A;  4MYU A;  4RD4 A;  4U9U A;  4RD6 A;  4IW3 B;  1OB5 A;  3V76 A;  1Q81 D;  2BVN A;  3W2I A;  3AVW A;  2BV3 A;  1QUE A;  1S72 B;  4WQM A;  1VQK B;  1UMK A; 
#chains in the Genus database with same CATH topology
 1NDH A;  3JU4 A;  4BPR A;  4XKW A;  1E1R A;  3QFS A;  4WZT A;  3CCJ B;  3ZBU A;  4LBZ A;  1PKV A;  2VJJ A;  3E1Y E;  1QGY A;  4LBY A;  1P4M A;  4RCZ A;  4Z4R A;  1FND A;  3SJP A;  3QFR A;  3AGP A;  3T53 B;  4G7W A;  1Q86 D;  3ES9 A;  2CF4 A;  2RC6 A;  2WJV A;  1KD1 D;  1E3X A;  5GV7 A;  3T51 B;  2ZIT A;  5TRD A;  1KK0 A;  3CCE B;  2HLD A;  5AN9 A;  3WNC A;  5BSY A;  4II2 A;  1XFO A;  1JA1 A;  1Y0Y A;  1R5B A;  3FKS A;  5IYW A;  3GVK A;  1VHO A;  3CC2 B;  4NBS A;  2XZO A;  2OTJ B;  3V7A A;  1FX0 A;  3G4S B;  5H5J A;  3CCQ B;  2PMD A;  1XQB A;  2OYN A;  3ONY A;  3AGQ A;  4AC9 A;  5A89 A;  2GK6 A;  2BGI A;  2Q6L A;  3G05 A;  3GQB A;  1QVG B;  2HDN B;  3LQ6 A;  1IB0 A;  3PA2 A;  4EH1 A;  1WPC A;  2V4D A;  1W34 A;  1R5N A;  3BY1 A;  3QFT A;  2VZL A;  3MCA A;  1W9X A;  4YHB A;  1KC8 D;  3OE7 A;  3JQP A;  4UZE A;  2C5B A;  1Q9S A;  1UD8 A;  3A3G A;  5DN6 A;  4RPB A;  1K28 D;  1VQ9 B;  2JIZ A;  3I1F A;  1YJ9 B;  2F4N A;  4RD0 A;  2V7Q A;  1UD4 A;  3OOC A;  2V7T A;  1E3Z A;  3CB4 A;  5J35 A;  1GR1 A;  4KKT A;  2X6W A;  4RD1 A;  3CMM A;  2VNI A;  4RJL A;  5KSW B;  1QFJ A;  2BM0 A;  1T5E A;  1N8R D;  2Q6O A;  4ZCI A;  4Z4W A;  1QGA A;  1F60 A;  4P6Y A;  4RD3 A;  4PC1 A;  4P2N A;  2VBU A;  2GJP A;  4XD7 A;  4ZGN B;  5A8A A;  4HIZ A;  4G5G A;  3OEH A;  3CC4 B;  1EXM A;  3OP1 A;  4AVZ A;  3VMF A;  2GRE A;  3P27 A;  4TMV A;  4RLZ A;  2OBT A;  4ROX A;  2X3U A;  3BH4 A;  2WZN A;  4RCY A;  2ZZE A;  1GAQ A;  4RPD A;  2XGJ A;  2ZXH A;  4M2L A;  3WNB A;  3OW7 A;  3BCF A;  2D9R A;  1CNE A;  1ZM4 A;  1K9M D;  2XEX A;  3A8J A;  3OFN A;  2V31 A;  2HCJ B;  3ZIA A;  3W5U A;  3A8I A;  1I8D A;  4P3I A;  3T56 B;  2ZZF A;  2WSS A;  3FPP A;  4XQF A;  2KVO A;  2VNH A;  3ASP A;  1G7T A;  2VYQ A;  5FL7 A;  1QX4 A;  4N3N A;  5HXB A;  3GVL A;  3CP8 A;  2AHO A;  1BX1 A;  1RQP A;  3NE5 B;  1NRK A;  4PAA A;  4M53 A;  1VQN B;  4X7F A;  3G71 B;  2WJY A;  2P3M A;  5TV2 A;  2NV4 A;  4MYT A;  4QV2 A;  4P6V F;  1YIT B;  3AVU A;  2DOG A;  2DCU A;  4LBV A;  4DNR B;  3B78 A;  3W2E A;  4XOR A;  1E1Q A;  4XLA A;  3AVY A;  4GQN A;  2GJR A;  5KW9 A;  1QG0 A;  1S4M A;  3A3B A;  5JBQ A;  3MMP A;  1UD6 A;  5BSX A;  5TR9 A;  1AMO A;  1KJZ A;  2Z6B D;  4WZK A;  3WXM A;  5HKK A;  4TT3 A;  1VQM B;  2BGJ A;  1CNF A;  4TMT A;  5F4J A;  1FNB A;  3ONU A;  1VLY A;  2F1M A;  3WBJ A;  4F7D A;  1D2E A;  1ZM9 A;  1J9Z A;  1VQ6 B;  2V7W A;  3BY2 A;  4DK0 A;  3ISX A;  2C77 A;  3VNV A;  4AF7 A;  1BX0 A;  2V7X A;  2X0K A;  1DAR A;  1XE1 A;  3FPK A;  3U6B A;  2Q6K A;  2YWE A;  4P1V A;  1BJK A;  1SKY B;  3GVJ A;  4G6I A;  1N0U A;  4FXU A;  3ZZT A;  1VHE A;  3KEW A;  5IYP A;  4Z4V A;  4XOT A;  2JDI A;  1H8H A;  1WP6 A;  2CBX A;  3FJO A;  4Z4Y A;  1W2B B;  1EP1 B;  3LQE A;  1WOR A;  4WZL A;  4P22 A;  2ZXI A;  5FNZ A;  3BC9 A;  2WPD A;  4P3Y A;  2FVG A;  5HZB A;  2C4U A;  1QVF B;  2R6H A;  1YHQ B;  3AVT A;  1E63 A;  2CC2 A;  3ASR A;  1SKQ A;  5GV8 A;  3OKX A;  5F4M A;  3SKB A;  4FN5 A;  3OPO A;  3OJX A;  2WZP P;  4UZF A;  5EMN A;  1PJ7 A;  4QHY A;  2BM1 A;  1WDT A;  4J0Q A;  1MAB A;  2GQF A;  4OOX A;  2X6X A;  3PA1 A;  3R6J A;  4PC3 A;  1MRZ A;  4X8I A;  3AVX A;  1XB2 A;  4OPV A;  2WR8 A;  1G7C A;  5IK2 A;  4UAJ A;  5FO1 A;  2E1B A;  4TSF A;  1TLL A;  2FX3 A;  3PVD A;  2WYR A;  2J7K A;  5TY0 A;  2HMA A;  1QH0 A;  2R9V A;  4P12 A;  1OHH A;  3AVV A;  2GPJ A;  1GO2 A;  1I7P A;  3I56 B;  1BLI A;  4QFM A;  1H85 A;  5DS0 A;  1YI2 B;  3U6K A;  2JJ2 A;  2BPO A;  2BN4 A;  2YWH A;  1B2R A;  1COW A;  4Z4U A;  5LMZ A;  1V0E A;  2QEX B;  4L8J A;  1BMF A;  3Q6R A;  1BPL A;  3I55 B;  3SLD A;  2X85 A;  1WSR A;  3H94 A;  4X7D A;  1UD5 A;  1JJ2 B;  2OBS A;  1H8E A;  4E0F A;  2W6J A;  1R5O A;  2ZL5 A;  4B47 A;  1VF7 A;  1BQE A;  4DQK A;  1QFY A;  1NJI D;  1YLO A;  2QMU A;  4OPO A;  1H42 A;  2OTL B;  3R6K A;  4QVJ A;  4ZV4 A;  4XN3 A;  5DSZ A;  2DIE A;  4TMX A;  4KKU A;  4ACB A;  2ZZQ A;  2XND A;  4QVA A;  1UD3 A;  3E20 A;  3CD6 B;  1WOO A;  3VR6 A;  4XN0 A;  5FIU A;  3ZBT A;  2VBS A;  1YIJ B;  4HE6 A;  1U2R A;  2V7V A;  3W2G A;  1GJR A;  1EFC A;  1KK3 A;  1AIP A;  3CCU B;  2YWF A;  5CDF A;  1M90 D;  5F4O A;  4DK1 A;  1T6Z A;  3RY8 A;  1EP2 B;  1EWY A;  2D3L A;  3ASQ A;  1K73 D;  1Q82 D;  1VQ7 B;  1KRH A;  3DDY A;  1ZUN B;  1UD2 A;  1JA0 A;  2BMW A;  4C0S A;  1VQO B;  4RD2 A;  3OZW A;  1VQ5 B;  2OBR A;  3P26 A;  3CES A;  2D3N A;  4TKO B;  4XKV A;  4Y9R A;  4FWT A;  2VNJ A;  3OZU A;  4B43 A;  1JB9 A;  4OOV A;  2W6I A;  1E62 A;  3JQR A;  4FK8 A;  1N08 A;  4YAO A;  1YJW B;  4XNF A;  2VBV A;  4H9G A;  4LBW A;  2DER A;  3WND A;  3SEJ A;  1IJE A;  3HAG A;  3GSI A;  3W5V A;  1Y0R A;  4YAU A;  1OGJ A;  4Z4T A;  1WU8 A;  1YX2 A;  4NNJ A;  2LZJ A;  2QN6 A;  1KMH A;  4PC6 A;  1ZM2 A;  1HZE A;  1FNC A;  2QE7 A;  4NCN A;  2NPF A;  1GVH A;  4P9S A;  3H9N A;  1T6Y A;  5J3O A;  2VBT A;  2F43 A;  1V5V A;  4YEJ A;  1N0V C;  1GAW A;  1N07 A;  2D74 A;  4XLC A;  4K1X A;  1WTH D;  3CXC B;  1TUI A;  3A8K A;  4PC2 A;  4JMQ A;  4PGO A;  1DDI A;  4TMZ A;  4YEL A;  5L46 A;  1W35 A;  4P26 A;  3VNU A;  2EFG A;  4N3G A;  1VQP B;  4B4D A;  4WWV A;  2DEU A;  2C2W A;  3A1P A;  3WYA A;  2B5O A;  3B8H A;  1KK1 A;  3ASS A;  2CND A;  4QUZ A;  3WQZ A;  1G7R A;  1E43 A;  3BNW A;  2M5S A;  3W2H A;  3WBK A;  4DQL A;  1TVC A;  2PE3 A;  2V7U A;  3PUM A;  2C5H A;  4UZU A;  4R71 A;  3LO8 A;  4HE5 A;  3CME B;  4G7X A;  2VJI A;  1D8T A;  3CCS B;  4II3 A;  4RDK A;  2F1L A;  1HVX A;  1E79 A;  3W5H A;  1D1N A;  1EFU A;  2ZL7 A;  3CPX A;  3OEE A;  2CRV A;  3OAA A;  4RDL A;  2B7B A;  1IJF A;  4LC0 A;  2QA4 B;  1Q7Y D;  2ZBU A;  1NBM A;  2CW5 A;  1RQR A;  4XLE A;  3Q39 A;  4M4S A;  4P25 A;  3QFC A;  2Q6I A;  2XZP A;  1FRN A;  1EFR A;  4X7C A;  2RC5 A;  4B44 A;  2B7C A;  3PUN A;  1ELO A;  4XOP A;  3CCM B;  1EP3 B;  1HA3 A;  4YAL A;  4G1B A;  4X06 A;  4XLF A;  2JJ1 A;  3GIR A;  1N06 A;  3VO1 A;  4C43 A;  2DY1 A;  1YJN B;  4G1V A;  1DG1 G;  1WOP A;  1VLO A;  1QFZ A;  3CPW B;  3A35 A;  1F20 A;  4TMW A;  2CK3 A;  2VNK A;  3SLN A;  4Q7J B;  4B48 A;  4Z4Z A;  1EFT A;  3QE2 A;  3KL9 A;  4ZCL A;  2C4T A;  4X0C A;  1VQ8 B;  1WSV A;  1PJ6 A;  4CQJ A;  3CRZ A;  4YAW A;  1VQL B;  2ZBV A;  3BQJ A;  1PJ5 A;  1T6X A;  2XNJ A;  5E6T A;  4OOS A;  3OW2 B;  1S0U A;  2QTL A;  3OJW A;  3ZC3 A;  2QTZ A;  1OB2 A;  3CP2 A;  1FDR A;  2DET A;  1B23 P;  3CCV B;  3B82 A;  3CCR B;  3WY9 A;  1TTT A;  1VJS A;  1QGZ A;  5H59 A;  3PEN A;  2PLF A;  2YWG A;  1E64 A;  3VO2 A;  2EIX A;  4B3X A;  2DYI A;  1SM4 A;  4PAB A;  5A88 A;  1KTV A;  3ZZU A;  5IYQ A;  1I18 A;  2C78 A;  4Y9U A;  4XL9 A;  4PC7 A;  4OPS A;  3CW2 A;  1CQX A;  4Z4S A;  1VQ4 B;  1DDG A;  4ZGQ B;  4TN1 A;  4M1K A;  2X8K A;  1KQS B;  1KZL A;  3Q3A A;  4XM3 A;  3J81 k;  4B3F X;  2QDX A;  3AST A;  3Q6Q A;  4RM0 A;  4M0L A;  2ZTG A;  3ZPN A;  4RDJ A;  4XON A;  4AF6 A;  4DNT B;  4WZE A;  4B3G A;  3ZUG A;  4X05 A;  2E1R A;  4Y7C A;  2X53 S;  5IYN A;  2ZZG A;  1K8A D;  2GJK A;  2QGG A;  3CTA A;  1ZM3 A;  4XMY A;  3G6E B;  1KK2 A;  1A8P A;  1NB0 A;  3Q38 A;  3LNN A;  1WOS A;  5THX A;  4X7E A;  5B6I A;  3CCL B;  3LVB A;  1OGI A;  2BSA A;  4ZCM A;  2OK8 A;  3D26 A;  4KKS A;  3OZV A;  1QUF A;  1FNM A;  2BF4 A;  3W2F A;  1FRQ A;  3U2Q A;  1JNY A;  2PIA A;  4YXW A;  1W0K A;  4ACA A;  4YAF A;  1G7S A;  1OB0 A;  2XNC A;  2GK7 A;  2OK7 A;  3MHP A;  3CC7 B;  5FA6 A;  1N05 A;  1NB9 A;  1W87 A;  2XOK A;  2ZL6 A;  3JQQ A;  3SJZ A;  3CMA B;  2XZL A;  4XR6 A;  1M1K D;  2ZTN A;  5FO0 A;  3ZZ0 A;  4MYU A;  3QSY A;  4RD4 A;  4U9U A;  4OP7 A;  1V0F A;  5HZA A;  5IYR A;  4RD6 A;  4IW3 B;  4X07 A;  1OB5 A;  2I1L A;  1W0J A;  4XLH A;  3V76 A;  1IHM A;  1Q81 D;  2X6Y A;  4Z1M A;  2BVN A;  3BCD A;  3W2I A;  5KNL A;  2BV3 A;  3AVW A;  1QUE A;  1S72 B;  4ASU A;  2JN9 A;  4WQM A;  1VQK B;  1UMK A; 
#chains in the Genus database with same CATH homology
 1NDH A;  4BPR A;  3QFS A;  3CCJ B;  3ZBU A;  4LBZ A;  3E1Y E;  1QGY A;  4LBY A;  4RCZ A;  1FND A;  3QFR A;  3AGP A;  1Q86 D;  3ES9 A;  2RC6 A;  1KD1 D;  5GV7 A;  2ZIT A;  1KK0 A;  3CCE B;  5AN9 A;  3WNC A;  1JA1 A;  1R5B A;  3CC2 B;  4NBS A;  2OTJ B;  3G4S B;  5H5J A;  3CCQ B;  2PMD A;  3AGQ A;  4AC9 A;  2BGI A;  1QVG B;  2HDN B;  1IB0 A;  4EH1 A;  1W34 A;  1R5N A;  3QFT A;  2VZL A;  3MCA A;  4YHB A;  1KC8 D;  3JQP A;  1VQ9 B;  3I1F A;  1YJ9 B;  4RD0 A;  3CB4 A;  1GR1 A;  4RD1 A;  4RJL A;  5KSW B;  2VNI A;  1QFJ A;  2BM0 A;  1N8R D;  4ZCI A;  1QGA A;  1F60 A;  4RD3 A;  4PC1 A;  4ZGN B;  4G5G A;  3CC4 B;  1EXM A;  3VMF A;  3P27 A;  4TMV A;  2X3U A;  4RCY A;  1GAQ A;  4M2L A;  3WNB A;  1CNE A;  1ZM4 A;  1K9M D;  2XEX A;  2HCJ B;  3W5U A;  2VNH A;  1G7T A;  2VYQ A;  1QX4 A;  4N3N A;  5HXB A;  2AHO A;  1BX1 A;  1VQN B;  4M53 A;  3G71 B;  5TV2 A;  4MYT A;  4P6V F;  1YIT B;  3AVU A;  2DCU A;  4LBV A;  3W2E A;  3B78 A;  3AVY A;  1QG0 A;  5JBQ A;  3MMP A;  5TR9 A;  1AMO A;  1KJZ A;  3WXM A;  1VQM B;  2BGJ A;  1CNF A;  4TMT A;  1FNB A;  3WBJ A;  4F7D A;  1D2E A;  1ZM9 A;  1J9Z A;  1VQ6 B;  3VNV A;  2C77 A;  4AF7 A;  1BX0 A;  1DAR A;  1XE1 A;  3FPK A;  3U6B A;  2YWE A;  1BJK A;  1N0U A;  3ZZT A;  3FJO A;  1W2B B;  1EP1 B;  4P3Y A;  1QVF B;  2R6H A;  1YHQ B;  3AVT A;  1E63 A;  1SKQ A;  5GV8 A;  4FN5 A;  3OJX A;  5EMN A;  4QHY A;  2BM1 A;  1WDT A;  4J0Q A;  2GQF A;  4PC3 A;  3AVX A;  1XB2 A;  1G7C A;  4UAJ A;  1TLL A;  2FX3 A;  2J7K A;  5TY0 A;  2HMA A;  1QH0 A;  3AVV A;  2GPJ A;  1GO2 A;  1I7P A;  3I56 B;  4QFM A;  1H85 A;  1YI2 B;  3U6K A;  2BPO A;  2BN4 A;  2YWH A;  1B2R A;  2QEX B;  3I55 B;  1JJ2 B;  1R5O A;  4B47 A;  1BQE A;  4DQK A;  1QFY A;  1NJI D;  2QMU A;  2OTL B;  1H42 A;  4ZV4 A;  5DSZ A;  4TMX A;  4ACB A;  3CD6 B;  3E20 A;  3ZBT A;  1YIJ B;  4HE6 A;  1U2R A;  3W2G A;  1GJR A;  1EFC A;  1KK3 A;  1AIP A;  3CCU B;  2YWF A;  1M90 D;  1EP2 B;  1EWY A;  1K73 D;  1VQ7 B;  1Q82 D;  1KRH A;  1ZUN B;  2BMW A;  1JA0 A;  4C0S A;  1VQO B;  4RD2 A;  3OZW A;  1VQ5 B;  3P26 A;  4Y9R A;  4FWT A;  2VNJ A;  3OZU A;  4B43 A;  1JB9 A;  1E62 A;  3JQR A;  4FK8 A;  4YAO A;  1YJW B;  4H9G A;  4LBW A;  2DER A;  3WND A;  1IJE A;  3W5V A;  4YAU A;  1OGJ A;  2QN6 A;  4PC6 A;  1ZM2 A;  1FNC A;  4NCN A;  2NPF A;  1GVH A;  1N0V C;  1GAW A;  2D74 A;  4K1X A;  3CXC B;  1TUI A;  4PC2 A;  4PGO A;  4TMZ A;  1DDI A;  1W35 A;  3VNU A;  2EFG A;  4N3G A;  1VQP B;  4B4D A;  2DEU A;  3WYA A;  2B5O A;  3B8H A;  1KK1 A;  2CND A;  1G7R A;  3W2H A;  3WBK A;  4DQL A;  1TVC A;  4R71 A;  3LO8 A;  4HE5 A;  3CME B;  1D8T A;  3CCS B;  3W5H A;  1D1N A;  1EFU A;  2CRV A;  2B7B A;  1IJF A;  4LC0 A;  2QA4 B;  1Q7Y D;  4M4S A;  3QFC A;  1FRN A;  4B44 A;  2RC5 A;  2B7C A;  1ELO A;  3CCM B;  1EP3 B;  1HA3 A;  4YAL A;  4G1B A;  3VO1 A;  4C43 A;  2DY1 A;  1YJN B;  4G1V A;  1DG1 G;  1QFZ A;  3CPW B;  1F20 A;  4TMW A;  2VNK A;  4Q7J B;  4B48 A;  1EFT A;  3QE2 A;  4ZCL A;  1VQ8 B;  3CRZ A;  4YAW A;  1VQL B;  2XNJ A;  3OW2 B;  1S0U A;  2QTL A;  3OJW A;  3ZC3 A;  2QTZ A;  1OB2 A;  1FDR A;  2DET A;  1B23 P;  3CCV B;  3B82 A;  3CCR B;  3WY9 A;  1TTT A;  1QGZ A;  5H59 A;  3PEN A;  2PLF A;  2YWG A;  1E64 A;  3VO2 A;  2EIX A;  4B3X A;  1SM4 A;  1KTV A;  3ZZU A;  2C78 A;  4Y9U A;  4PC7 A;  3CW2 A;  1CQX A;  1VQ4 B;  1DDG A;  4ZGQ B;  4TN1 A;  4M1K A;  1KQS B;  3J81 k;  2QDX A;  4M0L A;  4AF6 A;  2E1R A;  4Y7C A;  1K8A D;  1ZM3 A;  3G6E B;  1KK2 A;  1A8P A;  5THX A;  3CCL B;  3LVB A;  1OGI A;  2BSA A;  4ZCM A;  2OK8 A;  3OZV A;  1QUF A;  1FNM A;  2BF4 A;  3W2F A;  1FRQ A;  3U2Q A;  1JNY A;  2PIA A;  4ACA A;  4YAF A;  1G7S A;  2XNC A;  2OK7 A;  3MHP A;  3CC7 B;  5FA6 A;  1W87 A;  3JQQ A;  3SJZ A;  3CMA B;  1M1K D;  3ZZ0 A;  3QSY A;  4MYU A;  4RD4 A;  4U9U A;  4RD6 A;  4IW3 B;  1OB5 A;  3V76 A;  1Q81 D;  2BVN A;  3W2I A;  3AVW A;  2BV3 A;  1QUE A;  1S72 B;  4WQM A;  1VQK B;  1UMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...