4PGOA

Crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
EILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 19
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4pgoA00
4TMZA 1QUEA 4P6VF 4ZV4A 3JQQA 3QFRA 4FWTA 4M1KA 1J9ZA 1SM4A 1VQ9B 2OTJB 3OZWA 1VQ8B 1QVGB 1G7RA 1KRHA 1FRNA 2BM0A 3CCQB 1DARA 3OW2B 1KK2A 4ZGNB 4RD0A 3B8HA 1XE1A 3VO2A 3AGQA 1DDGA 1Q82D 4YALA 3CC4B 3CMEB 3AVXA 1H85A 4RD6A 2AHOA 1H42A 2FX3A 1E63A 3B82A 1QFJA 4G1VA 3WXMA 3G71B 3JQRA 1YITB 2BV3A 4YAFA 3CCJB 2BM1A 5AN9A 1VQOB 2YWFA 1EFCA 3FJOA 4PC7A 1YIJB 2YWEA 1Q81D 4B48A 2DETA 4ZCLA 1GO2A 1TUIA 2VNIA 5DSZA 4G5GA 4Y9RA 1QGAA 4N3NA 1NDHA 1W87A 3AVWA 2DEUA 1BX1A 3CRZA 4LBVA 1K8AD 3P27A 2VNHA 3ZZ0A 3OJXA 3QSYA 3W2EA 1F60A 3W5VA 1FNBA 1EWYA 1NJID 3CB4A 3W5HA 4MYUA 1YJ9B 4LC0A 1ZM3A 5FA6A 2QDXA 1YI2B 2XEXA 5JBQA 1K73D 1TTTA 4Y9UA 1GAWA 3QFTA 1XB2A 2QTLA 2ZITA 4RD2A 3PENA 3I56B 4IW3B 1JA0A 1B23P 1VQ5B 4QHYA 3U6BA 1EP2B 1FRQA 4U9UA 5EMNA 2PIAA 1BX0A 3U6KA 3AGPA 1S72B 2DCUA 4N3GA 2OTLB 2GQFA 1D8TA 3W2IA 2QN6A 3W2GA 5TR9A 1OGJA 1M1KD 2BN4A 4YAOA 4TMWA 5GV7A 5H5JA 2R6HA 2XNCA 2BPOA 1VQ6B 1BQEA 4F7DA 1VQ4B 4ACBA 3CCLB 1QGYA 3VNUA 2NPFA 3MHPA 3P26A 3WNBA 5KSWB 1M90D 1E64A 1WDTA 4K1XA 2EFGA 2RC5A 1DDIA 2DERA 3LVBA 1N0UA 1AIPA 4DQKA 2BF4A 2C78A 1QGZA 2QEXB 3B78A 2QMUA 5THXA 4AF6A 1W2BB 4PC1A 1IJEA 4ZCIA 2J7KA 2YWHA 1VQKB 1QH0A 4YAUA 3MMPA 4PC3A 4ACAA 2VYQA 1ZM9A 1YJWB 2VNJA 1G7CA 4NBSA 3WYAA 1IJFA 3QFCA 3G6EB 1YHQB 4M2LA 4B4DA 4WQMA 3WNCA 4RD1A 1KK0A 4TN1A 3J81k 3G4SB 1F20A 3CPWB 2B7CA 1HA3A 1S0UA 3WBKA 1GJRA 3W2HA 4C0SA 1KD1D 1B2RA 2B5OA 3CCEB 2QA4B 4BPRA 4AC9A 2BVNA 4B43A 2YWGA 2X3UA 1E62A 1W35A 4NCNA 1OGIA 1D1NA 2BMWA 1R5BA 1JNYA 4DQLA 3FPKA 1EFUA 1VQPB 5HXBA 1ZM4A 1QFYA 4P3YA 4M4SA 4YHBA 3AVVA 1FNCA 4TMXA 3CCSB 3WNDA 3JQPA 3QE2A 4HE6A 3VO1A 1OB5A 1TVCA 2C77A 3WBJA 2BGJA 4TMVA 3ZC3A 3ES9A 3MCAA 2VNKA 1AMOA 3SJZA 2GPJA 4C43A 1EP1B 1G7TA 2BSAA 3E1YE 4QFMA 4ZGQB 4LBWA 4M0LA 3AVUA 4RCZA 4TMTA 1KC8D 2XNJA 1ELOA 4PC6A 2RC6A 4Q7JB 1VQMB 1JA1A 3CC2B 3VNVA 2OK7A 1DG1G 2HMAA 4J0QA 4PC2A 4B3XA 1KTVA 1QFZA 3OZUA 1KJZA 3CCRB 3CW2A 3ZBUA 4RCYA 1A8PA 4B47A 1FDRA 1CNFA 1FNMA 3I1FA 5TY0A 2B7BA 3CD6B 1KQSB 5GV8A 4RD3A 1GR1A 3U2QA 2PLFA 3LO8A 1GAQA 5H59A 1EFTA 4LBYA 1YJNB 3OJWA 1QVFB 1VQLB 1I7PA 1KK3A 3OZVA 3VMFA 1EXMA 1ZUNB 1QUFA 3CMAB 1VQ7B 1G7SA 2D74A 3W2FA 3QFSA 4UAJA 3CC7B 1JJ2B 3CXCB 1N8RD 3ZZTA 3W5UA 3ZBTA 2CNDA 1QG0A 4G1BA 2QTZA 3I55B 4B44A 2HCJB 1OB2A 1JB9A 1CQXA 1K9MD 2DY1A 1QX4A 4H9GA 1SKQA 1Q86D 2BGIA 1FNDA 1EP3B 5TV2A 1UMKA 4R71A 4LBZA 2E1RA 3WY9A 2PMDA 3CCMB 2CRVA 1IB0A 2VZLA 4Y7CA 1D2EA 1TLLA 4ZCMA 1KK1A 3V76A 4YAWA 4MYTA 1VQNB 1U2RA 3CCUB 4PGOA 1CNEA 1R5NA 3AVYA 2OK8A 1W34A 4FN5A 4AF7A 4RD4A 4HE5A 4RJLA 2HDNB 4M53A 1BJKA 1R5OA 1Q7YD 1GVHA 4EH1A 1N0VC 4FK8A 3E20A 2EIXA 3CCVB 3AVTA 1ZM2A 3ZZUA
chains in the Genus database with same CATH superfamily
3JU4A 4OPVA 4TMZA 5FNZA 3FPPA 1QUEA 5BSYA 4P6VF 4B3FX 4ZV4A 3JQQA 4X7EA 3QFRA 4FWTA 5FL7A 2GK6A 4M1KA 4RPBA 4P12A 4WZKA 1J9ZA 1PJ7A 3CMMA 3GSIA 1SM4A 1VQ9B 2OTJB 1N07A 4OOSA 1SKYB 2ZTGA 3RY8A 4Z4ZA 3OZWA 1VQ8B 3HAGA 1E43A 1QVGB 1G7RA 1KRHA 1FRNA 2BM0A 3Q3AA 3CCQB 1DARA 3OW2B 1KK2A 3H94A 1IHMA 3A3BA 1XE1A 3B8HA 4RD0A 3VO2A 3AGQA 1NB9A 2OBSA 4HIZA 4L8JA 1DDGA 5IYQA 4YALA 1Q82D 1Q9SA 4Z4SA 3CC4B 2ZBVA 3CMEB 4II2A 3WQZA 3AVXA 3A8JA 1H85A 4CQJA 4RD6A 2ZZEA 4P9SA 2AHOA 5L46A 1H42A 2FX3A 2X6WA 2V7XA 2PE3A 4PABA 4XORA 1E63A 3B82A 3Q38A 1QFJA 2ZZGA 2D3LA 2V7UA 1WOSA 4G1VA 4ROXA 3WXMA 3JQRA 3G71B 2BV3A 4YAFA 4G7WA 1YITB 1HVXA 2V7TA 4XONA 4P26A 3CCJB 4QVAA 2BM1A 4X06A 5AN9A 1VQOB 3BY2A 2YWFA 4KKSA 1EFCA 4RDLA 5FIUA 3FJOA 1WORA 4PC7A 1YIJB 2YWEA 2X8KA 2F1MA 4B48A 1Q81D 4OP7A 2DETA 4ZCLA 1GO2A 1TUIA 2CC2A 2VNIA 2D3NA 5DSZA 1I8DA 4G5GA 4DNTB 3ASTA 4Y9RA 1QGAA 4N3NA 1NDHA 1W87A 3AVWA 4Z4WA 2DEUA 1BMFA 1BX1A 4QV2A 4XM3A 3CRZA 3Q6RA 2WZNA 4LBVA 3OP1A 1K8AD 3P27A 2VNHA 3ZZ0A 3OJXA 3ASPA 3W2EA 3QSYA 1F60A 3ZIAA 3W5VA 4DK1A 4OOVA 4WZTA 3BCFA 3ASSA 4XN3A 1FNBA 1EWYA 3D26A 1NJID 3CB4A 3W5HA 4MYUA 3T56B 1YJ9B 4LC0A 1ZM3A 2Q6OA 5FA6A 2QDXA 1YI2B 2XEXA 5JBQA 2GJRA 3G05A 5BSXA 4KKUA 1K73D 5A8AA 1TTTA 1N08A 2ZXIA 4WWVA 4XN0A 4Y9UA 1GAWA 5HKKA 1T5EA 3QFTA 1XB2A 5A88A 1Y0RA 4ZGNB 2QTLA 2ZITA 4RM0A 3PUMA 1N06A 4RD2A 4AVZA 2DIEA 3PENA 3I56B 4IW3B 4RPDA 1JA0A 1B23P 1BPLA 1VQ5B 4QHYA 3U6BA 1EP2B 1FRQA 5HZAA 2GREA 3GVKA 4U9UA 4XOTA 5EMNA 2CF4A 2PIAA 1BX0A 3U6KA 3AGPA 1S72B 2DCUA 4N3GA 2OTLB 2GQFA 3OEEA 4X7DA 1D8TA 4G6IA 4XLCA 2WSSA 4P25A 2QN6A 3W2IA 3W2GA 1VJSA 3T51B 5TR9A 3LNNA 1OGJA 3PA2A 1WSVA 1WTHD 4TSFA 1K28D 4XKVA 1M1KD 3NE5B 3CP8A 2BN4A 2ZBUA 4YAOA 4TMWA 4P22A 5DS0A 5GV7A 2JJ2A 5H5JA 2Q6KA 2R6HA 1E3XA 2XNCA 2BPOA 1VQ6B 1BQEA 3CESA 4F7DA 1VQ4B 4UZEA 2D9RA 4ACBA 2VBTA 4YEJA 2GJPA 3CCLB 4XLEA 1QGYA 3VNUA 3KL9A 2Q6IA 2NPFA 3MHPA 2X6XA 3ASQA 3P26A 3WNBA 4ASUA 1E1QA 5KSWB 1M90D 2C4TA 1E64A 1WDTA 5IYNA 2ZTNA 4XKWA 2OBRA 2KVOA 4K1XA 4QVJA 3BCDA 2EFGA 2RC5A 2JIZA 1EFRA 1WSRA 1DDIA 2DERA 3LVBA 1N0UA 4Z4UA 2CBXA 3CTAA 2CW5A 2E1BA 1E1RA 1AIPA 4DQKA 2BF4A 2M5SA 4TT3A 2C78A 1QGZA 2QEXB 2I1LA 4B3GA 3B78A 2QMUA 5THXA 5IK2A 4AF6A 2Z6BD 1W2BB 4X8IA 4PC1A 1IJEA 4XOPA 4ZCIA 2J7KA 2GK7A 4Z4TA 2YWHA 1RQPA 3T53B 4G7XA 1QH0A 4YAUA 1VQKB 1PJ6A 3MMPA 4PC3A 1NB0A 1V0EA 4ACAA 2F1LA 2VYQA 5B6IA 1ZM9A 1YJWB 3SLNA 2VNJA 2VBVA 1G7CA 4NBSA 2ZL5A 2HLDA 2V4DA 3WYAA 1IJFA 3QFCA 3SKBA 3G6EB 2LZJA 4M2LA 1YHQB 5F4MA 4WZEA 4B4DA 3R6KA 4WQMA 3WNCA 2F43A 1COWA 4RD1A 4TKOB 1S4MA 1KK0A 4TN1A 1UD6A 3J81k 1F20A 4OPSA 4XL9A 3G4SB 3CPWB 4UZUA 4YXWA 2B7CA 2XZPA 3LQ6A 3V7AA 1HA3A 1S0UA 1E79A 1GJRA 3WBKA 1T6YA 3W2HA 3OPOA 4C0SA 1KD1D 1B2RA 2B5OA 5FO0A 3CCEB 2QA4B 2XGJA 2XNDA 4BPRA 2JN9A 4XNFA 3A8KA 2VBSA 3SEJA 4AC9A 2WZPP 2QGGA 2W6IA 2BVNA 2ZZFA 4NNJA 4B43A 2YWGA 3OKXA 2X3UA 3PVDA 3R6JA 4GQNA 5IYPA 1E62A 1W35A 4NCNA 1P4MA 1UD5A 1OGIA 4XLHA 4Z4VA 1D1NA 4OOXA 2BMWA 1R5BA 1JNYA 3LQEA 2FVGA 4DQLA 5KW9A 3FPKA 4DNRB 1EFUA 1VQPB 5HXBA 1ZM4A 4P6YA 1QFYA 3GQBA 4P3YA 1YX2A 4M4SA 4YHBA 3AVVA 1WU8A 1FNCA 3PA1A 4TMXA 3CCSB 3OOCA 3JQPA 3WNDA 4P2NA 2V7VA 3QE2A 4HE6A 4XMYA 4Z4RA 3VO1A 1H8EA 1OB5A 1TVCA 2C77A 3WBJA 2BGJA 3H9NA 3OFNA 4QUZA 3DDYA 4TMVA 3ZC3A 3GVJA 3ES9A 3MCAA 2VNKA 1AMOA 3BC9A 3SJZA 2GPJA 4C43A 3A35A 2ZL7A 4X05A 5A89A 3BQJA 3ONUA 1EP1B 1G7TA 2BSAA 3E1YE 4QFMA 1VLYA 1VHOA 2CK3A 4LBWA 4ZGQB 4M0LA 3AVUA 1WP6A 4RCZA 4OPOA 2ZXHA 5F4OA 4TMTA 1KC8D 2XNJA 1ELOA 4PC6A 2RC6A 4Q7JB 1VQMB 1JA1A 3Q39A 3CC2B 2X0KA 3VNVA 1W0JA 1KZLA 2XZOA 2VBUA 2X85A 2OK7A 1DG1G 2HMAA 2X6YA 4J0QA 4PC2A 4WZLA 2C4UA 3BY1A 1KTVA 1QFZA 3OZUA 2VJJA 1KJZA 4B3XA 1VHEA 2F4NA 3CCRB 3CW2A 3BNWA 3ZBUA 3ISXA 2QE7A 4RCYA 1A8PA 4B47A 1FDRA 1CNFA 1FNMA 3SJPA 5J35A 3I1FA 5TY0A 4X7CA 2B7BA 3CD6B 1BLIA 1KQSB 2XZLA 5GV8A 2WYRA 2NV4A 4RD3A 1GR1A 3U2QA 2X53S 2WPDA 2PLFA 3LO8A 3OEHA 1GAQA 5H59A 1EFTA 4LBYA 1T6ZA 1YJNB 3OJWA 1QVFB 1VQLB 3GIRA 1W0KA 1I7PA 1KK3A 3OZVA 3VMFA 3CP2A 1EXMA 1PKVA 4DK0A 1ZUNB 1QUFA 3CMAB 1VQ7B 3GVLA 4XLAA 1G7SA 2D74A 4RLZA 1UD8A 4X0CA 1I18A 3W2FA 3QFSA 4UAJA 3CC7B 2V31A 4XR6A 1UD2A 1JJ2B 3FKSA 1VLOA 4II3A 3CXCB 4X07A 5CDFA 2V7WA 1N8RD 2GJKA 3ZZTA 1E3ZA 3Q6QA 2W6JA 3PUNA 4Z1MA 3W5UA 1KMHA 3ZBTA 3ZZUA 2DYIA 2CNDA 3OE7A 4KKTA 3A8IA 1QG0A 4XD7A 4G1BA 2R9VA 4E0FA 2WJYA 4JMQA 2QTZA 1MRZA 4X7FA 1OHHA 3SLDA 2V7QA 1V0FA 4B44A 5IYRA 2HCJB 3A1PA 3I55B 1JB9A 5KNLA 1YLOA 1OB2A 1VF7A 1CQXA 1MABA 1K9MD 2DY1A 1T6XA 4PAAA 1QX4A 1HZEA 2ZL6A 1W9XA 4H9GA 1SKQA 5TRDA 1Q86D 2BGIA 5LMZA 1FNDA 2Q6LA 1EP3B 2JJ1A 2XOKA 5TV2A 1WOOA 1UMKA 1NRKA 4R71A 3ONYA 5F4JA 5J3OA 4LBZA 2E1RA 2C2WA 2PMDA 4P1VA 3WY9A 3CCMB 2CRVA 1N05A 1PJ5A 5FO1A 1NBMA 1IB0A 1OB0A 4RDKA 2VZLA 4Y7CA 1D2EA 1FX0A 1UD3A 2JDIA 2WJVA 4P3IA 4XLFA 1TLLA 4RDJA 3BH4A 4ZCMA 1RQRA 1KK1A 1WPCA 2C5HA 3V76A 4YAWA 4MYTA 1VQNB 2OYNA 3OW7A 2C5BA 1U2RA 3CCUB 4PGOA 5IYWA 4Z4YA 1CNEA 1R5NA 3AVYA 2OK8A 4FXUA 1W34A 4FN5A 2ZZQA 1Y0YA 5E6TA 4AF7A 4YELA 4RD4A 2P3MA 4HE5A 2WR8A 1V5VA 4RJLA 2HDNB 1H8HA 4M53A 5DN6A 1BJKA 1R5OA 1Q7YD 3ZUGA 1XQBA 3A3GA 1GVHA 4EH1A 1N0VC 2DOGA 4FK8A 2VJIA 2OBTA 3E20A 4XQFA 1WOPA 2EIXA 3OAAA 4UZFA 1XFOA 3VR6A 3CCVB 1ZM2A 3ASRA 3AVTA 3CPXA 3KEWA 5HZBA 3ZPNA 1UD4A
chains in the Genus database with same CATH topology
4TMZA 1QUEA 4P6VF 4ZV4A 3JQQA 3QFRA 4FWTA 4M1KA 1J9ZA 1SM4A 1VQ9B 2OTJB 3OZWA 1VQ8B 1QVGB 1G7RA 1KRHA 1FRNA 2BM0A 3CCQB 1DARA 3OW2B 1KK2A 4ZGNB 4RD0A 3B8HA 1XE1A 3VO2A 3AGQA 1DDGA 1Q82D 4YALA 3CC4B 3CMEB 3AVXA 1H85A 4RD6A 2AHOA 1H42A 2FX3A 1E63A 3B82A 1QFJA 4G1VA 3WXMA 3G71B 3JQRA 1YITB 2BV3A 4YAFA 3CCJB 2BM1A 5AN9A 1VQOB 2YWFA 1EFCA 3FJOA 4PC7A 1YIJB 2YWEA 1Q81D 4B48A 2DETA 4ZCLA 1GO2A 1TUIA 2VNIA 5DSZA 4G5GA 4Y9RA 1QGAA 4N3NA 1NDHA 1W87A 3AVWA 2DEUA 1BX1A 3CRZA 4LBVA 1K8AD 3P27A 2VNHA 3ZZ0A 3OJXA 3QSYA 3W2EA 1F60A 3W5VA 1FNBA 1EWYA 1NJID 3CB4A 3W5HA 4MYUA 1YJ9B 4LC0A 1ZM3A 5FA6A 2QDXA 1YI2B 2XEXA 5JBQA 1K73D 1TTTA 4Y9UA 1GAWA 3QFTA 1XB2A 2QTLA 2ZITA 4RD2A 3PENA 3I56B 4IW3B 1JA0A 1B23P 1VQ5B 4QHYA 3U6BA 1EP2B 1FRQA 4U9UA 5EMNA 2PIAA 1BX0A 3U6KA 3AGPA 1S72B 2DCUA 4N3GA 2OTLB 2GQFA 1D8TA 3W2IA 2QN6A 3W2GA 5TR9A 1OGJA 1M1KD 2BN4A 4YAOA 4TMWA 5GV7A 5H5JA 2R6HA 2XNCA 2BPOA 1VQ6B 1BQEA 4F7DA 1VQ4B 4ACBA 3CCLB 1QGYA 3VNUA 2NPFA 3MHPA 3P26A 3WNBA 5KSWB 1M90D 1E64A 1WDTA 4K1XA 2EFGA 2RC5A 1DDIA 2DERA 3LVBA 1N0UA 1AIPA 4DQKA 2BF4A 2C78A 1QGZA 2QEXB 3B78A 2QMUA 5THXA 4AF6A 1W2BB 4PC1A 1IJEA 4ZCIA 2J7KA 2YWHA 1VQKB 1QH0A 4YAUA 3MMPA 4PC3A 4ACAA 2VYQA 1ZM9A 1YJWB 2VNJA 1G7CA 4NBSA 3WYAA 1IJFA 3QFCA 3G6EB 1YHQB 4M2LA 4B4DA 4WQMA 3WNCA 4RD1A 1KK0A 4TN1A 3J81k 3G4SB 1F20A 3CPWB 2B7CA 1HA3A 1S0UA 3WBKA 1GJRA 3W2HA 4C0SA 1KD1D 1B2RA 2B5OA 3CCEB 2QA4B 4BPRA 4AC9A 2BVNA 4B43A 2YWGA 2X3UA 1E62A 1W35A 4NCNA 1OGIA 1D1NA 2BMWA 1R5BA 1JNYA 4DQLA 3FPKA 1EFUA 1VQPB 5HXBA 1ZM4A 1QFYA 4P3YA 4M4SA 4YHBA 3AVVA 1FNCA 4TMXA 3CCSB 3WNDA 3JQPA 3QE2A 4HE6A 3VO1A 1OB5A 1TVCA 2C77A 3WBJA 2BGJA 4TMVA 3ZC3A 3ES9A 3MCAA 2VNKA 1AMOA 3SJZA 2GPJA 4C43A 1EP1B 1G7TA 2BSAA 3E1YE 4QFMA 4ZGQB 4LBWA 4M0LA 3AVUA 4RCZA 4TMTA 1KC8D 2XNJA 1ELOA 4PC6A 2RC6A 4Q7JB 1VQMB 1JA1A 3CC2B 3VNVA 2OK7A 1DG1G 2HMAA 4J0QA 4PC2A 4B3XA 1KTVA 1QFZA 3OZUA 1KJZA 3CCRB 3CW2A 3ZBUA 4RCYA 1A8PA 4B47A 1FDRA 1CNFA 1FNMA 3I1FA 5TY0A 2B7BA 3CD6B 1KQSB 5GV8A 4RD3A 1GR1A 3U2QA 2PLFA 3LO8A 1GAQA 5H59A 1EFTA 4LBYA 1YJNB 3OJWA 1QVFB 1VQLB 1I7PA 1KK3A 3OZVA 3VMFA 1EXMA 1ZUNB 1QUFA 3CMAB 1VQ7B 1G7SA 2D74A 3W2FA 3QFSA 4UAJA 3CC7B 1JJ2B 3CXCB 1N8RD 3ZZTA 3W5UA 3ZBTA 2CNDA 1QG0A 4G1BA 2QTZA 3I55B 4B44A 2HCJB 1OB2A 1JB9A 1CQXA 1K9MD 2DY1A 1QX4A 4H9GA 1SKQA 1Q86D 2BGIA 1FNDA 1EP3B 5TV2A 1UMKA 4R71A 4LBZA 2E1RA 3WY9A 2PMDA 3CCMB 2CRVA 1IB0A 2VZLA 4Y7CA 1D2EA 1TLLA 4ZCMA 1KK1A 3V76A 4YAWA 4MYTA 1VQNB 1U2RA 3CCUB 4PGOA 1CNEA 1R5NA 3AVYA 2OK8A 1W34A 4FN5A 4AF7A 4RD4A 4HE5A 4RJLA 2HDNB 4M53A 1BJKA 1R5OA 1Q7YD 1GVHA 4EH1A 1N0VC 4FK8A 3E20A 2EIXA 3CCVB 3AVTA 1ZM2A 3ZZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TMZ A;  1QUE A;  4P6V F;  4ZV4 A;  3JQQ A;  3QFR A;  4FWT A;  4M1K A;  1J9Z A;  1SM4 A;  1VQ9 B;  2OTJ B;  3OZW A;  1VQ8 B;  1QVG B;  1G7R A;  1KRH A;  1FRN A;  2BM0 A;  3CCQ B;  1DAR A;  3OW2 B;  1KK2 A;  4ZGN B;  4RD0 A;  3B8H A;  1XE1 A;  3VO2 A;  3AGQ A;  1DDG A;  1Q82 D;  4YAL A;  3CC4 B;  3CME B;  3AVX A;  1H85 A;  4RD6 A;  2AHO A;  1H42 A;  2FX3 A;  1E63 A;  3B82 A;  1QFJ A;  4G1V A;  3WXM A;  3G71 B;  3JQR A;  1YIT B;  2BV3 A;  4YAF A;  3CCJ B;  2BM1 A;  5AN9 A;  1VQO B;  2YWF A;  1EFC A;  3FJO A;  4PC7 A;  1YIJ B;  2YWE A;  1Q81 D;  4B48 A;  2DET A;  4ZCL A;  1GO2 A;  1TUI A;  2VNI A;  5DSZ A;  4G5G A;  4Y9R A;  1QGA A;  4N3N A;  1NDH A;  1W87 A;  3AVW A;  2DEU A;  1BX1 A;  3CRZ A;  4LBV A;  1K8A D;  3P27 A;  2VNH A;  3ZZ0 A;  3OJX A;  3QSY A;  3W2E A;  1F60 A;  3W5V A;  1FNB A;  1EWY A;  1NJI D;  3CB4 A;  3W5H A;  4MYU A;  1YJ9 B;  4LC0 A;  1ZM3 A;  5FA6 A;  2QDX A;  1YI2 B;  2XEX A;  5JBQ A;  1K73 D;  1TTT A;  4Y9U A;  1GAW A;  3QFT A;  1XB2 A;  2QTL A;  2ZIT A;  4RD2 A;  3PEN A;  3I56 B;  4IW3 B;  1JA0 A;  1B23 P;  1VQ5 B;  4QHY A;  3U6B A;  1EP2 B;  1FRQ A;  4U9U A;  5EMN A;  2PIA A;  1BX0 A;  3U6K A;  3AGP A;  1S72 B;  2DCU A;  4N3G A;  2OTL B;  2GQF A;  1D8T A;  3W2I A;  2QN6 A;  3W2G A;  5TR9 A;  1OGJ A;  1M1K D;  2BN4 A;  4YAO A;  4TMW A;  5GV7 A;  5H5J A;  2R6H A;  2XNC A;  2BPO A;  1VQ6 B;  1BQE A;  4F7D A;  1VQ4 B;  4ACB A;  3CCL B;  1QGY A;  3VNU A;  2NPF A;  3MHP A;  3P26 A;  3WNB A;  5KSW B;  1M90 D;  1E64 A;  1WDT A;  4K1X A;  2EFG A;  2RC5 A;  1DDI A;  2DER A;  3LVB A;  1N0U A;  1AIP A;  4DQK A;  2BF4 A;  2C78 A;  1QGZ A;  2QEX B;  3B78 A;  2QMU A;  5THX A;  4AF6 A;  1W2B B;  4PC1 A;  1IJE A;  4ZCI A;  2J7K A;  2YWH A;  1VQK B;  1QH0 A;  4YAU A;  3MMP A;  4PC3 A;  4ACA A;  2VYQ A;  1ZM9 A;  1YJW B;  2VNJ A;  1G7C A;  4NBS A;  3WYA A;  1IJF A;  3QFC A;  3G6E B;  1YHQ B;  4M2L A;  4B4D A;  4WQM A;  3WNC A;  4RD1 A;  1KK0 A;  4TN1 A;  3J81 k;  3G4S B;  1F20 A;  3CPW B;  2B7C A;  1HA3 A;  1S0U A;  3WBK A;  1GJR A;  3W2H A;  4C0S A;  1KD1 D;  1B2R A;  2B5O A;  3CCE B;  2QA4 B;  4BPR A;  4AC9 A;  2BVN A;  4B43 A;  2YWG A;  2X3U A;  1E62 A;  1W35 A;  4NCN A;  1OGI A;  1D1N A;  2BMW A;  1R5B A;  1JNY A;  4DQL A;  3FPK A;  1EFU A;  1VQP B;  5HXB A;  1ZM4 A;  1QFY A;  4P3Y A;  4M4S A;  4YHB A;  3AVV A;  1FNC A;  4TMX A;  3CCS B;  3WND A;  3JQP A;  3QE2 A;  4HE6 A;  3VO1 A;  1OB5 A;  1TVC A;  2C77 A;  3WBJ A;  2BGJ A;  4TMV A;  3ZC3 A;  3ES9 A;  3MCA A;  2VNK A;  1AMO A;  3SJZ A;  2GPJ A;  4C43 A;  1EP1 B;  1G7T A;  2BSA A;  3E1Y E;  4QFM A;  4ZGQ B;  4LBW A;  4M0L A;  3AVU A;  4RCZ A;  4TMT A;  1KC8 D;  2XNJ A;  1ELO A;  4PC6 A;  2RC6 A;  4Q7J B;  1VQM B;  1JA1 A;  3CC2 B;  3VNV A;  2OK7 A;  1DG1 G;  2HMA A;  4J0Q A;  4PC2 A;  4B3X A;  1KTV A;  1QFZ A;  3OZU A;  1KJZ A;  3CCR B;  3CW2 A;  3ZBU A;  4RCY A;  1A8P A;  4B47 A;  1FDR A;  1CNF A;  1FNM A;  3I1F A;  5TY0 A;  2B7B A;  3CD6 B;  1KQS B;  5GV8 A;  4RD3 A;  1GR1 A;  3U2Q A;  2PLF A;  3LO8 A;  1GAQ A;  5H59 A;  1EFT A;  4LBY A;  1YJN B;  3OJW A;  1QVF B;  1VQL B;  1I7P A;  1KK3 A;  3OZV A;  3VMF A;  1EXM A;  1ZUN B;  1QUF A;  3CMA B;  1VQ7 B;  1G7S A;  2D74 A;  3W2F A;  3QFS A;  4UAJ A;  3CC7 B;  1JJ2 B;  3CXC B;  1N8R D;  3ZZT A;  3W5U A;  3ZBT A;  2CND A;  1QG0 A;  4G1B A;  2QTZ A;  3I55 B;  4B44 A;  2HCJ B;  1OB2 A;  1JB9 A;  1CQX A;  1K9M D;  2DY1 A;  1QX4 A;  4H9G A;  1SKQ A;  1Q86 D;  2BGI A;  1FND A;  1EP3 B;  5TV2 A;  1UMK A;  4R71 A;  4LBZ A;  2E1R A;  3WY9 A;  2PMD A;  3CCM B;  2CRV A;  1IB0 A;  2VZL A;  4Y7C A;  1D2E A;  1TLL A;  4ZCM A;  1KK1 A;  3V76 A;  4YAW A;  4MYT A;  1VQN B;  1U2R A;  3CCU B;  4PGO A;  1CNE A;  1R5N A;  3AVY A;  2OK8 A;  1W34 A;  4FN5 A;  4AF7 A;  4RD4 A;  4HE5 A;  4RJL A;  2HDN B;  4M53 A;  1BJK A;  1R5O A;  1Q7Y D;  1GVH A;  4EH1 A;  1N0V C;  4FK8 A;  3E20 A;  2EIX A;  3CCV B;  3AVT A;  1ZM2 A;  3ZZU A; 
#chains in the Genus database with same CATH topology
 3JU4 A;  4OPV A;  4TMZ A;  5FNZ A;  3FPP A;  1QUE A;  5BSY A;  4P6V F;  4B3F X;  4ZV4 A;  3JQQ A;  4X7E A;  3QFR A;  4FWT A;  5FL7 A;  2GK6 A;  4M1K A;  4RPB A;  4P12 A;  4WZK A;  1J9Z A;  1PJ7 A;  3CMM A;  3GSI A;  1SM4 A;  1VQ9 B;  2OTJ B;  1N07 A;  4OOS A;  1SKY B;  2ZTG A;  3RY8 A;  4Z4Z A;  3OZW A;  1VQ8 B;  3HAG A;  1E43 A;  1QVG B;  1G7R A;  1KRH A;  1FRN A;  2BM0 A;  3Q3A A;  3CCQ B;  1DAR A;  3OW2 B;  1KK2 A;  3H94 A;  1IHM A;  3A3B A;  1XE1 A;  3B8H A;  4RD0 A;  3VO2 A;  3AGQ A;  1NB9 A;  2OBS A;  4HIZ A;  4L8J A;  1DDG A;  5IYQ A;  4YAL A;  1Q82 D;  1Q9S A;  4Z4S A;  3CC4 B;  2ZBV A;  3CME B;  4II2 A;  3WQZ A;  3AVX A;  3A8J A;  1H85 A;  4CQJ A;  4RD6 A;  2ZZE A;  4P9S A;  2AHO A;  5L46 A;  1H42 A;  2FX3 A;  2X6W A;  2V7X A;  2PE3 A;  4PAB A;  4XOR A;  1E63 A;  3B82 A;  3Q38 A;  1QFJ A;  2ZZG A;  2D3L A;  2V7U A;  1WOS A;  4G1V A;  4ROX A;  3WXM A;  3JQR A;  3G71 B;  2BV3 A;  4YAF A;  4G7W A;  1YIT B;  1HVX A;  2V7T A;  4XON A;  4P26 A;  3CCJ B;  4QVA A;  2BM1 A;  4X06 A;  5AN9 A;  1VQO B;  3BY2 A;  2YWF A;  4KKS A;  1EFC A;  4RDL A;  5FIU A;  3FJO A;  1WOR A;  4PC7 A;  1YIJ B;  2YWE A;  2X8K A;  2F1M A;  4B48 A;  1Q81 D;  4OP7 A;  2DET A;  4ZCL A;  1GO2 A;  1TUI A;  2CC2 A;  2VNI A;  2D3N A;  5DSZ A;  1I8D A;  4G5G A;  4DNT B;  3AST A;  4Y9R A;  1QGA A;  4N3N A;  1NDH A;  1W87 A;  3AVW A;  4Z4W A;  2DEU A;  1BMF A;  1BX1 A;  4QV2 A;  4XM3 A;  3CRZ A;  3Q6R A;  2WZN A;  4LBV A;  3OP1 A;  1K8A D;  3P27 A;  2VNH A;  3ZZ0 A;  3OJX A;  3ASP A;  3W2E A;  3QSY A;  1F60 A;  3ZIA A;  3W5V A;  4DK1 A;  4OOV A;  4WZT A;  3BCF A;  3ASS A;  4XN3 A;  1FNB A;  1EWY A;  3D26 A;  1NJI D;  3CB4 A;  3W5H A;  4MYU A;  3T56 B;  1YJ9 B;  4LC0 A;  1ZM3 A;  2Q6O A;  5FA6 A;  2QDX A;  1YI2 B;  2XEX A;  5JBQ A;  2GJR A;  3G05 A;  5BSX A;  4KKU A;  1K73 D;  5A8A A;  1TTT A;  1N08 A;  2ZXI A;  4WWV A;  4XN0 A;  4Y9U A;  1GAW A;  5HKK A;  1T5E A;  3QFT A;  1XB2 A;  5A88 A;  1Y0R A;  4ZGN B;  2QTL A;  2ZIT A;  4RM0 A;  3PUM A;  1N06 A;  4RD2 A;  4AVZ A;  2DIE A;  3PEN A;  3I56 B;  4IW3 B;  4RPD A;  1JA0 A;  1B23 P;  1BPL A;  1VQ5 B;  4QHY A;  3U6B A;  1EP2 B;  1FRQ A;  5HZA A;  2GRE A;  3GVK A;  4U9U A;  4XOT A;  5EMN A;  2CF4 A;  2PIA A;  1BX0 A;  3U6K A;  3AGP A;  1S72 B;  2DCU A;  4N3G A;  2OTL B;  2GQF A;  3OEE A;  4X7D A;  1D8T A;  4G6I A;  4XLC A;  2WSS A;  4P25 A;  2QN6 A;  3W2I A;  3W2G A;  1VJS A;  3T51 B;  5TR9 A;  3LNN A;  1OGJ A;  3PA2 A;  1WSV A;  1WTH D;  4TSF A;  1K28 D;  4XKV A;  1M1K D;  3NE5 B;  3CP8 A;  2BN4 A;  2ZBU A;  4YAO A;  4TMW A;  4P22 A;  5DS0 A;  5GV7 A;  2JJ2 A;  5H5J A;  2Q6K A;  2R6H A;  1E3X A;  2XNC A;  2BPO A;  1VQ6 B;  1BQE A;  3CES A;  4F7D A;  1VQ4 B;  4UZE A;  2D9R A;  4ACB A;  2VBT A;  4YEJ A;  2GJP A;  3CCL B;  4XLE A;  1QGY A;  3VNU A;  3KL9 A;  2Q6I A;  2NPF A;  3MHP A;  2X6X A;  3ASQ A;  3P26 A;  3WNB A;  4ASU A;  1E1Q A;  5KSW B;  1M90 D;  2C4T A;  1E64 A;  1WDT A;  5IYN A;  2ZTN A;  4XKW A;  2OBR A;  2KVO A;  4K1X A;  4QVJ A;  3BCD A;  2EFG A;  2RC5 A;  2JIZ A;  1EFR A;  1WSR A;  1DDI A;  2DER A;  3LVB A;  1N0U A;  4Z4U A;  2CBX A;  3CTA A;  2CW5 A;  2E1B A;  1E1R A;  1AIP A;  4DQK A;  2BF4 A;  2M5S A;  4TT3 A;  2C78 A;  1QGZ A;  2QEX B;  2I1L A;  4B3G A;  3B78 A;  2QMU A;  5THX A;  5IK2 A;  4AF6 A;  2Z6B D;  1W2B B;  4X8I A;  4PC1 A;  1IJE A;  4XOP A;  4ZCI A;  2J7K A;  2GK7 A;  4Z4T A;  2YWH A;  1RQP A;  3T53 B;  4G7X A;  1QH0 A;  4YAU A;  1VQK B;  1PJ6 A;  3MMP A;  4PC3 A;  1NB0 A;  1V0E A;  4ACA A;  2F1L A;  2VYQ A;  5B6I A;  1ZM9 A;  1YJW B;  3SLN A;  2VNJ A;  2VBV A;  1G7C A;  4NBS A;  2ZL5 A;  2HLD A;  2V4D A;  3WYA A;  1IJF A;  3QFC A;  3SKB A;  3G6E B;  2LZJ A;  4M2L A;  1YHQ B;  5F4M A;  4WZE A;  4B4D A;  3R6K A;  4WQM A;  3WNC A;  2F43 A;  1COW A;  4RD1 A;  4TKO B;  1S4M A;  1KK0 A;  4TN1 A;  1UD6 A;  3J81 k;  1F20 A;  4OPS A;  4XL9 A;  3G4S B;  3CPW B;  4UZU A;  4YXW A;  2B7C A;  2XZP A;  3LQ6 A;  3V7A A;  1HA3 A;  1S0U A;  1E79 A;  1GJR A;  3WBK A;  1T6Y A;  3W2H A;  3OPO A;  4C0S A;  1KD1 D;  1B2R A;  2B5O A;  5FO0 A;  3CCE B;  2QA4 B;  2XGJ A;  2XND A;  4BPR A;  2JN9 A;  4XNF A;  3A8K A;  2VBS A;  3SEJ A;  4AC9 A;  2WZP P;  2QGG A;  2W6I A;  2BVN A;  2ZZF A;  4NNJ A;  4B43 A;  2YWG A;  3OKX A;  2X3U A;  3PVD A;  3R6J A;  4GQN A;  5IYP A;  1E62 A;  1W35 A;  4NCN A;  1P4M A;  1UD5 A;  1OGI A;  4XLH A;  4Z4V A;  1D1N A;  4OOX A;  2BMW A;  1R5B A;  1JNY A;  3LQE A;  2FVG A;  4DQL A;  5KW9 A;  3FPK A;  4DNR B;  1EFU A;  1VQP B;  5HXB A;  1ZM4 A;  4P6Y A;  1QFY A;  3GQB A;  4P3Y A;  1YX2 A;  4M4S A;  4YHB A;  3AVV A;  1WU8 A;  1FNC A;  3PA1 A;  4TMX A;  3CCS B;  3OOC A;  3JQP A;  3WND A;  4P2N A;  2V7V A;  3QE2 A;  4HE6 A;  4XMY A;  4Z4R A;  3VO1 A;  1H8E A;  1OB5 A;  1TVC A;  2C77 A;  3WBJ A;  2BGJ A;  3H9N A;  3OFN A;  4QUZ A;  3DDY A;  4TMV A;  3ZC3 A;  3GVJ A;  3ES9 A;  3MCA A;  2VNK A;  1AMO A;  3BC9 A;  3SJZ A;  2GPJ A;  4C43 A;  3A35 A;  2ZL7 A;  4X05 A;  5A89 A;  3BQJ A;  3ONU A;  1EP1 B;  1G7T A;  2BSA A;  3E1Y E;  4QFM A;  1VLY A;  1VHO A;  2CK3 A;  4LBW A;  4ZGQ B;  4M0L A;  3AVU A;  1WP6 A;  4RCZ A;  4OPO A;  2ZXH A;  5F4O A;  4TMT A;  1KC8 D;  2XNJ A;  1ELO A;  4PC6 A;  2RC6 A;  4Q7J B;  1VQM B;  1JA1 A;  3Q39 A;  3CC2 B;  2X0K A;  3VNV A;  1W0J A;  1KZL A;  2XZO A;  2VBU A;  2X85 A;  2OK7 A;  1DG1 G;  2HMA A;  2X6Y A;  4J0Q A;  4PC2 A;  4WZL A;  2C4U A;  3BY1 A;  1KTV A;  1QFZ A;  3OZU A;  2VJJ A;  1KJZ A;  4B3X A;  1VHE A;  2F4N A;  3CCR B;  3CW2 A;  3BNW A;  3ZBU A;  3ISX A;  2QE7 A;  4RCY A;  1A8P A;  4B47 A;  1FDR A;  1CNF A;  1FNM A;  3SJP A;  5J35 A;  3I1F A;  5TY0 A;  4X7C A;  2B7B A;  3CD6 B;  1BLI A;  1KQS B;  2XZL A;  5GV8 A;  2WYR A;  2NV4 A;  4RD3 A;  1GR1 A;  3U2Q A;  2X53 S;  2WPD A;  2PLF A;  3LO8 A;  3OEH A;  1GAQ A;  5H59 A;  1EFT A;  4LBY A;  1T6Z A;  1YJN B;  3OJW A;  1QVF B;  1VQL B;  3GIR A;  1W0K A;  1I7P A;  1KK3 A;  3OZV A;  3VMF A;  3CP2 A;  1EXM A;  1PKV A;  4DK0 A;  1ZUN B;  1QUF A;  3CMA B;  1VQ7 B;  3GVL A;  4XLA A;  1G7S A;  2D74 A;  4RLZ A;  1UD8 A;  4X0C A;  1I18 A;  3W2F A;  3QFS A;  4UAJ A;  3CC7 B;  2V31 A;  4XR6 A;  1UD2 A;  1JJ2 B;  3FKS A;  1VLO A;  4II3 A;  3CXC B;  4X07 A;  5CDF A;  2V7W A;  1N8R D;  2GJK A;  3ZZT A;  1E3Z A;  3Q6Q A;  2W6J A;  3PUN A;  4Z1M A;  3W5U A;  1KMH A;  3ZBT A;  3ZZU A;  2DYI A;  2CND A;  3OE7 A;  4KKT A;  3A8I A;  1QG0 A;  4XD7 A;  4G1B A;  2R9V A;  4E0F A;  2WJY A;  4JMQ A;  2QTZ A;  1MRZ A;  4X7F A;  1OHH A;  3SLD A;  2V7Q A;  1V0F A;  4B44 A;  5IYR A;  2HCJ B;  3A1P A;  3I55 B;  1JB9 A;  5KNL A;  1YLO A;  1OB2 A;  1VF7 A;  1CQX A;  1MAB A;  1K9M D;  2DY1 A;  1T6X A;  4PAA A;  1QX4 A;  1HZE A;  2ZL6 A;  1W9X A;  4H9G A;  1SKQ A;  5TRD A;  1Q86 D;  2BGI A;  5LMZ A;  1FND A;  2Q6L A;  1EP3 B;  2JJ1 A;  2XOK A;  5TV2 A;  1WOO A;  1UMK A;  1NRK A;  4R71 A;  3ONY A;  5F4J A;  5J3O A;  4LBZ A;  2E1R A;  2C2W A;  2PMD A;  4P1V A;  3WY9 A;  3CCM B;  2CRV A;  1N05 A;  1PJ5 A;  5FO1 A;  1NBM A;  1IB0 A;  1OB0 A;  4RDK A;  2VZL A;  4Y7C A;  1D2E A;  1FX0 A;  1UD3 A;  2JDI A;  2WJV A;  4P3I A;  4XLF A;  1TLL A;  4RDJ A;  3BH4 A;  4ZCM A;  1RQR A;  1KK1 A;  1WPC A;  2C5H A;  3V76 A;  4YAW A;  4MYT A;  1VQN B;  2OYN A;  3OW7 A;  2C5B A;  1U2R A;  3CCU B;  4PGO A;  5IYW A;  4Z4Y A;  1CNE A;  1R5N A;  3AVY A;  2OK8 A;  4FXU A;  1W34 A;  4FN5 A;  2ZZQ A;  1Y0Y A;  5E6T A;  4AF7 A;  4YEL A;  4RD4 A;  2P3M A;  4HE5 A;  2WR8 A;  1V5V A;  4RJL A;  2HDN B;  1H8H A;  4M53 A;  5DN6 A;  1BJK A;  1R5O A;  1Q7Y D;  3ZUG A;  1XQB A;  3A3G A;  1GVH A;  4EH1 A;  1N0V C;  2DOG A;  4FK8 A;  2VJI A;  2OBT A;  3E20 A;  4XQF A;  1WOP A;  2EIX A;  3OAA A;  4UZF A;  1XFO A;  3VR6 A;  3CCV B;  1ZM2 A;  3ASR A;  3AVT A;  3CPX A;  3KEW A;  5HZB A;  3ZPN A;  1UD4 A; 
#chains in the Genus database with same CATH homology
 4TMZ A;  1QUE A;  4P6V F;  4ZV4 A;  3JQQ A;  3QFR A;  4FWT A;  4M1K A;  1J9Z A;  1SM4 A;  1VQ9 B;  2OTJ B;  3OZW A;  1VQ8 B;  1QVG B;  1G7R A;  1KRH A;  1FRN A;  2BM0 A;  3CCQ B;  1DAR A;  3OW2 B;  1KK2 A;  4ZGN B;  4RD0 A;  3B8H A;  1XE1 A;  3VO2 A;  3AGQ A;  1DDG A;  1Q82 D;  4YAL A;  3CC4 B;  3CME B;  3AVX A;  1H85 A;  4RD6 A;  2AHO A;  1H42 A;  2FX3 A;  1E63 A;  3B82 A;  1QFJ A;  4G1V A;  3WXM A;  3G71 B;  3JQR A;  1YIT B;  2BV3 A;  4YAF A;  3CCJ B;  2BM1 A;  5AN9 A;  1VQO B;  2YWF A;  1EFC A;  3FJO A;  4PC7 A;  1YIJ B;  2YWE A;  1Q81 D;  4B48 A;  2DET A;  4ZCL A;  1GO2 A;  1TUI A;  2VNI A;  5DSZ A;  4G5G A;  4Y9R A;  1QGA A;  4N3N A;  1NDH A;  1W87 A;  3AVW A;  2DEU A;  1BX1 A;  3CRZ A;  4LBV A;  1K8A D;  3P27 A;  2VNH A;  3ZZ0 A;  3OJX A;  3QSY A;  3W2E A;  1F60 A;  3W5V A;  1FNB A;  1EWY A;  1NJI D;  3CB4 A;  3W5H A;  4MYU A;  1YJ9 B;  4LC0 A;  1ZM3 A;  5FA6 A;  2QDX A;  1YI2 B;  2XEX A;  5JBQ A;  1K73 D;  1TTT A;  4Y9U A;  1GAW A;  3QFT A;  1XB2 A;  2QTL A;  2ZIT A;  4RD2 A;  3PEN A;  3I56 B;  4IW3 B;  1JA0 A;  1B23 P;  1VQ5 B;  4QHY A;  3U6B A;  1EP2 B;  1FRQ A;  4U9U A;  5EMN A;  2PIA A;  1BX0 A;  3U6K A;  3AGP A;  1S72 B;  2DCU A;  4N3G A;  2OTL B;  2GQF A;  1D8T A;  3W2I A;  2QN6 A;  3W2G A;  5TR9 A;  1OGJ A;  1M1K D;  2BN4 A;  4YAO A;  4TMW A;  5GV7 A;  5H5J A;  2R6H A;  2XNC A;  2BPO A;  1VQ6 B;  1BQE A;  4F7D A;  1VQ4 B;  4ACB A;  3CCL B;  1QGY A;  3VNU A;  2NPF A;  3MHP A;  3P26 A;  3WNB A;  5KSW B;  1M90 D;  1E64 A;  1WDT A;  4K1X A;  2EFG A;  2RC5 A;  1DDI A;  2DER A;  3LVB A;  1N0U A;  1AIP A;  4DQK A;  2BF4 A;  2C78 A;  1QGZ A;  2QEX B;  3B78 A;  2QMU A;  5THX A;  4AF6 A;  1W2B B;  4PC1 A;  1IJE A;  4ZCI A;  2J7K A;  2YWH A;  1VQK B;  1QH0 A;  4YAU A;  3MMP A;  4PC3 A;  4ACA A;  2VYQ A;  1ZM9 A;  1YJW B;  2VNJ A;  1G7C A;  4NBS A;  3WYA A;  1IJF A;  3QFC A;  3G6E B;  1YHQ B;  4M2L A;  4B4D A;  4WQM A;  3WNC A;  4RD1 A;  1KK0 A;  4TN1 A;  3J81 k;  3G4S B;  1F20 A;  3CPW B;  2B7C A;  1HA3 A;  1S0U A;  3WBK A;  1GJR A;  3W2H A;  4C0S A;  1KD1 D;  1B2R A;  2B5O A;  3CCE B;  2QA4 B;  4BPR A;  4AC9 A;  2BVN A;  4B43 A;  2YWG A;  2X3U A;  1E62 A;  1W35 A;  4NCN A;  1OGI A;  1D1N A;  2BMW A;  1R5B A;  1JNY A;  4DQL A;  3FPK A;  1EFU A;  1VQP B;  5HXB A;  1ZM4 A;  1QFY A;  4P3Y A;  4M4S A;  4YHB A;  3AVV A;  1FNC A;  4TMX A;  3CCS B;  3WND A;  3JQP A;  3QE2 A;  4HE6 A;  3VO1 A;  1OB5 A;  1TVC A;  2C77 A;  3WBJ A;  2BGJ A;  4TMV A;  3ZC3 A;  3ES9 A;  3MCA A;  2VNK A;  1AMO A;  3SJZ A;  2GPJ A;  4C43 A;  1EP1 B;  1G7T A;  2BSA A;  3E1Y E;  4QFM A;  4ZGQ B;  4LBW A;  4M0L A;  3AVU A;  4RCZ A;  4TMT A;  1KC8 D;  2XNJ A;  1ELO A;  4PC6 A;  2RC6 A;  4Q7J B;  1VQM B;  1JA1 A;  3CC2 B;  3VNV A;  2OK7 A;  1DG1 G;  2HMA A;  4J0Q A;  4PC2 A;  4B3X A;  1KTV A;  1QFZ A;  3OZU A;  1KJZ A;  3CCR B;  3CW2 A;  3ZBU A;  4RCY A;  1A8P A;  4B47 A;  1FDR A;  1CNF A;  1FNM A;  3I1F A;  5TY0 A;  2B7B A;  3CD6 B;  1KQS B;  5GV8 A;  4RD3 A;  1GR1 A;  3U2Q A;  2PLF A;  3LO8 A;  1GAQ A;  5H59 A;  1EFT A;  4LBY A;  1YJN B;  3OJW A;  1QVF B;  1VQL B;  1I7P A;  1KK3 A;  3OZV A;  3VMF A;  1EXM A;  1ZUN B;  1QUF A;  3CMA B;  1VQ7 B;  1G7S A;  2D74 A;  3W2F A;  3QFS A;  4UAJ A;  3CC7 B;  1JJ2 B;  3CXC B;  1N8R D;  3ZZT A;  3W5U A;  3ZBT A;  2CND A;  1QG0 A;  4G1B A;  2QTZ A;  3I55 B;  4B44 A;  2HCJ B;  1OB2 A;  1JB9 A;  1CQX A;  1K9M D;  2DY1 A;  1QX4 A;  4H9G A;  1SKQ A;  1Q86 D;  2BGI A;  1FND A;  1EP3 B;  5TV2 A;  1UMK A;  4R71 A;  4LBZ A;  2E1R A;  3WY9 A;  2PMD A;  3CCM B;  2CRV A;  1IB0 A;  2VZL A;  4Y7C A;  1D2E A;  1TLL A;  4ZCM A;  1KK1 A;  3V76 A;  4YAW A;  4MYT A;  1VQN B;  1U2R A;  3CCU B;  4PGO A;  1CNE A;  1R5N A;  3AVY A;  2OK8 A;  1W34 A;  4FN5 A;  4AF7 A;  4RD4 A;  4HE5 A;  4RJL A;  2HDN B;  4M53 A;  1BJK A;  1R5O A;  1Q7Y D;  1GVH A;  4EH1 A;  1N0V C;  4FK8 A;  3E20 A;  2EIX A;  3CCV B;  3AVT A;  1ZM2 A;  3ZZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...