4PGOA

Crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
b'EILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Unknown function
source organism Pyrococcus furiosus
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
total genus 19
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4pgoA00
1EWYA 1B23P 2DCUA 4YAWA 2PMDA 5EMNA 4PC6A 1W35A 1S72B 2ZITA 2XNCA 1E62A 4RD4A 5THXA 4RCYA 4B48A 1NJID 2AHOA 3B8HA 4WQMA 4Y9RA 1S0UA 1VQOB 3QFTA 3W2EA 1QH0A 1DDGA 1Q82D 5AN9A 1G7TA 1OB5A 1KK2A 1QFZA 3CCRB 3J81k 1H85A 3CXCB 1GJRA 1K8AD 1TTTA 1K9MD 2FX3A 4RCZA 1VQ8B 3U6KA 1R5BA 2DY1A 3W5HA 1TUIA 4AF6A 4RD6A 1FNBA 4K1XA 1ZM9A 4G1VA 2XNJA 4YAOA 1KJZA 1JA1A 2QA4B 1E64A 2BPOA 1SKQA 3ZZTA 1YHQB 3AVYA 2BM1A 3I56B 1YITB 5H5JA 4BPRA 1EFTA 1FRNA 1KQSB 1KD1D 1DDIA 3VO1A 3WBKA 2XEXA 4DQKA 1D2EA 1VQ6B 3FPKA 3VNUA 3ES9A 2B7CA 3V76A 3E20A 1BX1A 3VNVA 1VQKB 2D74A 1YJNB 1BJKA 2EIXA 4YAFA 3MHPA 4ZGNB 3P26A 1QFJA 3JQRA 3CCUB 1W87A 1F20A 1B2RA 1KK1A 4U9UA 3AGPA 2YWHA 2DERA 2BGIA 2QTLA 1QFYA 4C43A 3ZZUA 1ELOA 1BQEA 3CMAB 4AC9A 2RC6A 2CNDA 4RD3A 3AVWA 1I7PA 3W5UA 2NPFA 1ZM3A 2QEXB 3AVVA 2YWEA 3WYAA 3CMEB 4ZV4A 2VZLA 1EXMA 5H59A 4N3GA 4QHYA 1F60A 2OK8A 1OB2A 2BV3A 4R71A 4LBZA 3LO8A 3CRZA 3CCJB 3JQQA 2VNIA 5GV8A 5HXBA 3OZVA 4ZCMA 1JNYA 3AGQA 4M2LA 4NCNA 5KSWB 1E63A 3B82A 1QUFA 3E1YE 3PENA 1A8PA 1XE1A 3QE2A 2EFGA 2YWFA 3CPWB 4FK8A 4TN1A 1M90D 1YI2B 1U2RA 1EFCA 1GAWA 3CCLB 2PLFA 2QMUA 1VQNB 1QGZA 4TMTA 4UAJA 3W2FA 4AF7A 1VQ5B 1AIPA 1Q81D 1YJ9B 3CCSB 3CCVB 2BGJA 2VNKA 3VO2A 4FN5A 4P6VF 5TV2A 2BMWA 4ZCLA 4LBYA 4FWTA 5JBQA 2OTJB 2BN4A 3G6EB 1IB0A 1GR1A 1FNDA 1ZM4A 3ZBUA 3CD6B 3P27A 4Q7JB 1JB9A 3SJZA 1Q7YD 4B43A 1R5OA 1YIJB 4G1BA 4Y7CA 1JA0A 4HE5A 1J9ZA 1QGYA 1QVGB 3AVUA 1QUEA 1ZM2A 1EFUA 1QVFB 5TR9A 1OGJA 2HMAA 3CW2A 3OJWA 1HA3A 1G7RA 3QFRA 3ZBTA 1UMKA 1N8RD 4LBWA 3CCEB 2DETA 2X3UA 1Q86D 4QFMA 1XB2A 3CCQB 1CQXA 4B44A 4M53A 1IJEA 2OK7A 4TMXA 3ZC3A 3OJXA 4MYTA 3OW2B 4IW3B 4TMZA 3U6BA 1M1KD 4TMVA 3OZWA 1K73D 1KK0A 1H42A 3WXMA 3I55B 1SM4A 2DEUA 4DQLA 4YHBA 1FRQA 2QTZA 4RD2A 4LC0A 3QSYA 1GO2A 3G71B 1DG1G 3CC7B 2HDNB 4M0LA 1CNEA 4PGOA 1N0VC 5GV7A 3ZZ0A 1WDTA 4RD0A 4F7DA 1ZUNB 4ACAA 4ZGQB 3CB4A 2VYQA 3AVXA 2PIAA 4B3XA 3WNDA 1QG0A 3CC2B 1DARA 3MCAA 1D8TA 4M4SA 4M1KA 2QDXA 1EP2B 1VQMB 1G7CA 2C78A 3WNCA 1N0UA 3WNBA 2B7BA 1GAQA 1D1NA 1YJWB 1NDHA 1KK3A 2RC5A 1TLLA 4MYUA 1VQLB 1W34A 2HCJB 3MMPA 1FNMA 1KRHA 1QX4A 4B4DA 1GVHA 4NBSA 2E1RA 4RD1A 2YWGA 2GQFA 1QGAA 2C77A 3OZUA 3WY9A 2B5OA 1JJ2B 3AVTA 2VNHA 2BM0A 4LBVA 1VQ7B 3B78A 3G4SB 5DSZA 3W2GA 3FJOA 4G5GA 4PC7A 4PC2A 1W2BB 5FA6A 4ACBA 1R5NA 3VMFA 1EP1B 4B47A 4EH1A 4PC3A 1TVCA 1KTVA 2R6HA 1FDRA 2VNJA 3LVBA 3CC4B 3JQPA 1FNCA 1BX0A 4HE6A 2GPJA 4N3NA 3WBJA 4Y9UA 4YALA 4ZCIA 4J0QA 1KC8D 1EP3B 3W5VA 2QN6A 1CNFA 1OGIA 3W2IA 5TY0A 1G7SA 2BVNA 4H9GA 1IJFA 4RJLA 1VQPB 1VQ9B 4C0SA 3QFSA 3QFCA 3W2HA 3CCMB 3I1FA 4PC1A 2CRVA 2OTLB 4TMWA 2BF4A 3U2QA 4P3YA 2BSAA 2J7KA 4YAUA 1AMOA 1VQ4B
chains in the Genus database with same CATH superfamily
1EWYA 3OEHA 1B23P 2DCUA 1PKVA 4X0CA 4YAWA 2PMDA 3FKSA 4PC6A 1W35A 4KKUA 2ZITA 5EMNA 1S72B 2XNCA 1E62A 4RD4A 5THXA 2ZZFA 3JU4A 4RCYA 1NB0A 4B48A 1NJID 1I18A 2AHOA 3B8HA 1KZLA 4WQMA 4XLAA 2WZPP 4X7FA 4Y9RA 1S0UA 1VQOB 3QFTA 3W2EA 5L46A 1QH0A 4RDJA 1DDGA 1Q82D 2D3NA 1VJSA 3OW7A 2ZL7A 4Z4WA 5AN9A 1G7TA 1IHMA 4G7WA 1OB5A 1KK2A 1QFZA 2JN9A 3CCRB 3GIRA 1NRKA 1H85A 3J81k 1GJRA 3CXCB 4X06A 1Y0YA 1K28D 2QGGA 1K8AD 1TTTA 4QUZA 3OP1A 1K9MD 3A3GA 2FX3A 4RCZA 2X6WA 1VQ8B 3U6KA 1R5BA 2DY1A 2QE7A 3W5HA 5LMZA 1TUIA 2V7TA 2ZTGA 4AF6A 5IYWA 4FXUA 4ROXA 2XNDA 4RD6A 4QV2A 1N06A 3PUMA 1FNBA 4K1XA 1ZM9A 4G1VA 2XNJA 4YAOA 5FIUA 1KJZA 2V7UA 3V7AA 1HZEA 3CP8A 2PE3A 4XKWA 1JA1A 2M5SA 3ONUA 4OP7A 5TRDA 2QA4B 1COWA 1E64A 2BPOA 4XOPA 5B6IA 1SKQA 3ZZTA 2XOKA 4XLHA 1YHQB 2BM1A 3D26A 3OEEA 3AVYA 2XZPA 4TT3A 3I56B 3SKBA 4P25A 1V5VA 1YITB 5H5JA 4X07A 4BPRA 4P3IA 5CDFA 1EFTA 1FRNA 1KQSB 1KD1D 1DDIA 3VO1A 4Z4SA 2CF4A 3WBKA 2XEXA 4DQKA 3PUNA 1D2EA 1VQ6B 3BH4A 3FPKA 3VNUA 5FO1A 4YEJA 2V7QA 2OBSA 3ES9A 2B7CA 3V76A 4XQFA 3E20A 4OPSA 3T56B 1BX1A 4X7CA 1Y0RA 3VNVA 1VF7A 3OPOA 3CP2A 1W9XA 4RDLA 2XZLA 2Z6BD 3CESA 1VQKB 2D74A 3BNWA 1YJNB 1UD6A 1BJKA 5FO0A 2V31A 2EIXA 4YAFA 3MHPA 2D9RA 3KEWA 3OAAA 3P26A 1QFJA 3JQRA 4ZGNB 1OB0A 1T6XA 4RDKA 3CCUB 1W87A 3ISXA 2X6XA 1F20A 1B2RA 1T6ZA 4II2A 1WP6A 4KKTA 1KK1A 4U9UA 3AGPA 1WPCA 4JMQA 2F43A 2YWHA 2DERA 2JJ1A 3ASQA 4P9SA 2BGIA 2QTLA 1BPLA 1E3XA 2W6JA 1QFYA 1WOSA 4OPVA 4XOTA 4C43A 3ZZUA 1ELOA 3G05A 2HLDA 1BQEA 2E1BA 3CMAB 4WWVA 2OYNA 2Q6OA 4AC9A 2RC6A 2X85A 4B3GA 1XQBA 2V7XA 2C5BA 2CNDA 4RD3A 3AVWA 1I7PA 2ZTNA 4Z1MA 3W5UA 2NPFA 1ZM3A 2QEXB 3AVVA 2OBRA 2YWEA 3WYAA 4QVAA 3CMEB 2GK6A 2ZBVA 2VBSA 4ZV4A 2VZLA 1EXMA 5H59A 5J35A 2WSSA 1T5EA 4N3GA 4QHYA 4RM0A 2FVGA 1F60A 5HKKA 4X7DA 2OK8A 3T51B 1OB2A 2BV3A 4R71A 5IYPA 1T6YA 3A8KA 4LBZA 4UZUA 1PJ7A 4CQJA 3LO8A 3CRZA 3CCJB 4GQNA 3JQQA 2JIZA 2VNIA 3GSIA 5GV8A 5HXBA 1NB9A 1SKYB 2F1LA 4XLEA 5IYRA 1N07A 3OZVA 4ZCMA 1BLIA 2GJRA 2C4UA 1FX0A 4RPBA 2W6IA 1JNYA 1W0KA 1W0JA 4XD7A 5HZAA 3AGQA 4M2LA 2XGJA 2Q6KA 3ZPNA 4KKSA 4XM3A 4NCNA 4AVZA 5KSWB 3RY8A 2VJIA 3OKXA 3PA1A 1E63A 1H8EA 1QUFA 3B82A 3E1YE 2GREA 3PENA 1A8PA 1VLYA 1XE1A 3ASSA 1UD5A 2VBVA 3QE2A 2EFGA 2YWFA 3CPWB 4FK8A 4TN1A 2WZNA 1V0EA 3Q39A 4TSFA 1M90D 1E43A 3A35A 1U2RA 5F4OA 1YI2B 2NV4A 3BQJA 1EFCA 4UZEA 1GAWA 3GVLA 3CCLB 2ZL5A 2PLFA 2QMUA 4XLCA 2WYRA 5DS0A 1N05A 1VQNB 1QGZA 2C4TA 1NBMA 4TMTA 4UAJA 5FL7A 3W2FA 4DNTB 3NE5B 2ZBUA 3H9NA 4P6YA 4Z4UA 4AF7A 4OOVA 1VQ5B 3SLDA 1AIPA 1Q81D 2ZZEA 1YJ9B 3CCSB 2LZJA 5HZBA 4Z4ZA 5F4JA 3CCVB 2BGJA 2VNKA 3VO2A 4FN5A 4P6VF 5TV2A 4OPOA 2JJ2A 2BMWA 5E6TA 4ZCLA 4LBYA 3PA2A 4FWTA 4XKVA 4RLZA 5JBQA 4DK0A 2OTJB 2BN4A 5IK2A 2DIEA 3G6EB 1IB0A 4X8IA 1GR1A 1FNDA 2GJKA 3OOCA 1VHEA 1ZM4A 4XORA 2R9VA 3ZBUA 1YX2A 3CD6B 1MABA 3P27A 3GQBA 4Q7JB 1S4MA 1BMFA 1JB9A 4WZKA 1YLOA 1V0FA 3SJZA 1Q7YD 4B43A 2OBTA 1R5OA 1RQRA 3CMMA 1YIJB 4G1BA 3PVDA 4Y7CA 1JA0A 4HE5A 2ZXIA 1J9ZA 2V7WA 1QVGB 4P22A 3AVUA 1QUEA 1ZM2A 1EFUA 4PAAA 1QVFB 5TR9A 4OOXA 3A8JA 1EFRA 1OGJA 2HMAA 3T53B 3OFNA 3CW2A 3OJWA 3R6JA 1HA3A 5A89A 2WPDA 3SEJA 3BCDA 2V7VA 1G7RA 4Z4RA 1I8DA 1WU8A 3QFRA 3ZBTA 1KMHA 3LQEA 3LQ6A 1UMKA 1N8RD 4LBWA 4P26A 2XZOA 3CCEB 1E3ZA 2DETA 5A8AA 2X3UA 3ASPA 4QFMA 4XN0A 1Q86D 1XB2A 3CCQB 1CQXA 4B44A 4M53A 1IJEA 2OK7A 3R6KA 4TMXA 3ZC3A 3OJXA 4MYTA 3OW2B 4IW3B 4P2NA 2WJVA 4TMZA 3U6BA 1M1KD 4XONA 2ZXHA 4L8JA 3OZWA 4TMVA 3ONYA 4YXWA 4XNFA 1K73D 1N08A 1KK0A 2C2WA 1H42A 1H8HA 1VLOA 3WXMA 1SM4A 4DNRB 3I55B 2DEUA 3HAGA 4DQLA 4YHBA 1FRQA 2I1LA 2ZZQA 2QTZA 4TKOB 4RD2A 4LC0A 3QSYA 3VR6A 1GO2A 4RPDA 3G71B 1DG1G 3CC7B 2HDNB 1WOOA 1E1QA 4Z4TA 4Z4VA 3ASTA 2X53S 4M0LA 1CNEA 2GJPA 4PGOA 2D3LA 1N0VC 5GV7A 3ZZ0A 3Q38A 1WDTA 4P12A 4RD0A 4F7DA 1ZUNB 4PABA 5KW9A 3CTAA 3ZIAA 4ACAA 4ZGQB 4XN3A 5J3OA 3CB4A 2VYQA 1P4MA 3AVXA 2VJJA 2PIAA 2DOGA 3WNDA 4B3XA 1QG0A 5IYNA 3CC2B 2VBTA 1DARA 2DYIA 1D8TA 3MCAA 4M4SA 2QDXA 4M1KA 1EP2B 2CC2A 2CW5A 4E0FA 1VQMB 1G7CA 1OHHA 2P3MA 3OE7A 2C78A 5FNZA 3FPPA 3WNCA 4P1VA 3SJPA 4II3A 1N0UA 3WNBA 2B7BA 1UD8A 3GVJA 1GAQA 1PJ5A 2V4DA 2Q6LA 3GVKA 5F4MA 1NDHA 3KL9A 3Q3AA 1KK3A 1YJWB 1D1NA 2CBXA 5BSYA 2RC5A 1TLLA 4MYUA 1VQLB 1W34A 2HCJB 1XFOA 4G7XA 1WORA 3MMPA 4YELA 1FNMA 3DDYA 2VBUA 1KRHA 1QX4A 4B4DA 1GVHA 1PJ6A 2Q6IA 2F1MA 4NBSA 5BSXA 5DN6A 2JDIA 2E1RA 3ASRA 3BY2A 4RD1A 4DK1A 2YWGA 2GQFA 4YAUA 1QGAA 2KVOA 3ZUGA 2C77A 3OZUA 3WY9A 2B5OA 1JJ2B 4X05A 3AVTA 2VNHA 4XMYA 2BM0A 3A3BA 4LBVA 1VQ7B 3B78A 2WJYA 3G4SB 2WR8A 2F4NA 5DSZA 3W2GA 3CPXA 3FJOA 4G5GA 4UZFA 4PC7A 4WZLA 4NNJA 1WSRA 4PC2A 1W2BB 4G6IA 5FA6A 3SLNA 4ACBA 2X0KA 2ZL6A 1R5NA 3Q6RA 3VMFA 1EP1B 1HVXA 4B47A 1E79A 4EH1A 4XR6A 4PC3A 1TVCA 1KTVA 2R6HA 1RQPA 1FDRA 2VNJA 3LVBA 3CC4B 4XL9A 3JQPA 1FNCA 2ZZGA 1BX0A 4HE6A 3Q6QA 4X7EA 2GPJA 4N3NA 3WBJA 1UD4A 3BC9A 4Y9UA 4YALA 2C5HA 4J0QA 4ZCIA 1KC8D 4WZTA 1EP3B 1UD2A 3W5VA 4XLFA 1WOPA 1MRZA 2QN6A 2CK3A 1CNFA 4B3FX 3BCFA 1OGIA 3W2IA 3WQZA 5TY0A 4ASUA 1VHOA 1G7SA 2BVNA 1WSVA 4H9GA 5IYQA 1E1RA 3A1PA 1IJFA 1Q9SA 1UD3A 4QVJA 4RJLA 4C0SA 1VQPB 1VQ9B 3QFSA 3A8IA 3QFCA 3W2HA 3CCMB 3I1FA 3LNNA 5KNLA 4PC1A 4Z4YA 2CRVA 4OOSA 2OTLB 4TMWA 2BF4A 3BY1A 3U2QA 3H94A 1WTHD 2GK7A 4WZEA 4P3YA 2X8KA 2X6YA 5A88A 2BSAA 2J7KA 4HIZA 1QGYA 1AMOA 1VQ4B
chains in the Genus database with same CATH topology
1EWYA 1B23P 2DCUA 4YAWA 2PMDA 5EMNA 4PC6A 1W35A 1S72B 2ZITA 2XNCA 1E62A 4RD4A 5THXA 4RCYA 4B48A 1NJID 2AHOA 3B8HA 4WQMA 4Y9RA 1S0UA 1VQOB 3QFTA 3W2EA 1QH0A 1DDGA 1Q82D 5AN9A 1G7TA 1OB5A 1KK2A 1QFZA 3CCRB 3J81k 1H85A 3CXCB 1GJRA 1K8AD 1TTTA 1K9MD 2FX3A 4RCZA 1VQ8B 3U6KA 1R5BA 2DY1A 3W5HA 1TUIA 4AF6A 4RD6A 1FNBA 4K1XA 1ZM9A 4G1VA 2XNJA 4YAOA 1KJZA 1JA1A 2QA4B 1E64A 2BPOA 1SKQA 3ZZTA 1YHQB 3AVYA 2BM1A 3I56B 1YITB 5H5JA 4BPRA 1EFTA 1FRNA 1KQSB 1KD1D 1DDIA 3VO1A 3WBKA 2XEXA 4DQKA 1D2EA 1VQ6B 3FPKA 3VNUA 3ES9A 2B7CA 3V76A 3E20A 1BX1A 3VNVA 1VQKB 2D74A 1YJNB 1BJKA 2EIXA 4YAFA 3MHPA 4ZGNB 3P26A 1QFJA 3JQRA 3CCUB 1W87A 1F20A 1B2RA 1KK1A 4U9UA 3AGPA 2YWHA 2DERA 2BGIA 2QTLA 1QFYA 4C43A 3ZZUA 1ELOA 1BQEA 3CMAB 4AC9A 2RC6A 2CNDA 4RD3A 3AVWA 1I7PA 3W5UA 2NPFA 1ZM3A 2QEXB 3AVVA 2YWEA 3WYAA 3CMEB 4ZV4A 2VZLA 1EXMA 5H59A 4N3GA 4QHYA 1F60A 2OK8A 1OB2A 2BV3A 4R71A 4LBZA 3LO8A 3CRZA 3CCJB 3JQQA 2VNIA 5GV8A 5HXBA 3OZVA 4ZCMA 1JNYA 3AGQA 4M2LA 4NCNA 5KSWB 1E63A 3B82A 1QUFA 3E1YE 3PENA 1A8PA 1XE1A 3QE2A 2EFGA 2YWFA 3CPWB 4FK8A 4TN1A 1M90D 1YI2B 1U2RA 1EFCA 1GAWA 3CCLB 2PLFA 2QMUA 1VQNB 1QGZA 4TMTA 4UAJA 3W2FA 4AF7A 1VQ5B 1AIPA 1Q81D 1YJ9B 3CCSB 3CCVB 2BGJA 2VNKA 3VO2A 4FN5A 4P6VF 5TV2A 2BMWA 4ZCLA 4LBYA 4FWTA 5JBQA 2OTJB 2BN4A 3G6EB 1IB0A 1GR1A 1FNDA 1ZM4A 3ZBUA 3CD6B 3P27A 4Q7JB 1JB9A 3SJZA 1Q7YD 4B43A 1R5OA 1YIJB 4G1BA 4Y7CA 1JA0A 4HE5A 1J9ZA 1QGYA 1QVGB 3AVUA 1QUEA 1ZM2A 1EFUA 1QVFB 5TR9A 1OGJA 2HMAA 3CW2A 3OJWA 1HA3A 1G7RA 3QFRA 3ZBTA 1UMKA 1N8RD 4LBWA 3CCEB 2DETA 2X3UA 1Q86D 4QFMA 1XB2A 3CCQB 1CQXA 4B44A 4M53A 1IJEA 2OK7A 4TMXA 3ZC3A 3OJXA 4MYTA 3OW2B 4IW3B 4TMZA 3U6BA 1M1KD 4TMVA 3OZWA 1K73D 1KK0A 1H42A 3WXMA 3I55B 1SM4A 2DEUA 4DQLA 4YHBA 1FRQA 2QTZA 4RD2A 4LC0A 3QSYA 1GO2A 3G71B 1DG1G 3CC7B 2HDNB 4M0LA 1CNEA 4PGOA 1N0VC 5GV7A 3ZZ0A 1WDTA 4RD0A 4F7DA 1ZUNB 4ACAA 4ZGQB 3CB4A 2VYQA 3AVXA 2PIAA 4B3XA 3WNDA 1QG0A 3CC2B 1DARA 3MCAA 1D8TA 4M4SA 4M1KA 2QDXA 1EP2B 1VQMB 1G7CA 2C78A 3WNCA 1N0UA 3WNBA 2B7BA 1GAQA 1D1NA 1YJWB 1NDHA 1KK3A 2RC5A 1TLLA 4MYUA 1VQLB 1W34A 2HCJB 3MMPA 1FNMA 1KRHA 1QX4A 4B4DA 1GVHA 4NBSA 2E1RA 4RD1A 2YWGA 2GQFA 1QGAA 2C77A 3OZUA 3WY9A 2B5OA 1JJ2B 3AVTA 2VNHA 2BM0A 4LBVA 1VQ7B 3B78A 3G4SB 5DSZA 3W2GA 3FJOA 4G5GA 4PC7A 4PC2A 1W2BB 5FA6A 4ACBA 1R5NA 3VMFA 1EP1B 4B47A 4EH1A 4PC3A 1TVCA 1KTVA 2R6HA 1FDRA 2VNJA 3LVBA 3CC4B 3JQPA 1FNCA 1BX0A 4HE6A 2GPJA 4N3NA 3WBJA 4Y9UA 4YALA 4ZCIA 4J0QA 1KC8D 1EP3B 3W5VA 2QN6A 1CNFA 1OGIA 3W2IA 5TY0A 1G7SA 2BVNA 4H9GA 1IJFA 4RJLA 1VQPB 1VQ9B 4C0SA 3QFSA 3QFCA 3W2HA 3CCMB 3I1FA 4PC1A 2CRVA 2OTLB 4TMWA 2BF4A 3U2QA 4P3YA 2BSAA 2J7KA 4YAUA 1AMOA 1VQ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWY A;  1B23 P;  2DCU A;  4YAW A;  2PMD A;  5EMN A;  4PC6 A;  1W35 A;  1S72 B;  2ZIT A;  2XNC A;  1E62 A;  4RD4 A;  5THX A;  4RCY A;  4B48 A;  1NJI D;  2AHO A;  3B8H A;  4WQM A;  4Y9R A;  1S0U A;  1VQO B;  3QFT A;  3W2E A;  1QH0 A;  1DDG A;  1Q82 D;  5AN9 A;  1G7T A;  1OB5 A;  1KK2 A;  1QFZ A;  3CCR B;  3J81 k;  1H85 A;  3CXC B;  1GJR A;  1K8A D;  1TTT A;  1K9M D;  2FX3 A;  4RCZ A;  1VQ8 B;  3U6K A;  1R5B A;  2DY1 A;  3W5H A;  1TUI A;  4AF6 A;  4RD6 A;  1FNB A;  4K1X A;  1ZM9 A;  4G1V A;  2XNJ A;  4YAO A;  1KJZ A;  1JA1 A;  2QA4 B;  1E64 A;  2BPO A;  1SKQ A;  3ZZT A;  1YHQ B;  3AVY A;  2BM1 A;  3I56 B;  1YIT B;  5H5J A;  4BPR A;  1EFT A;  1FRN A;  1KQS B;  1KD1 D;  1DDI A;  3VO1 A;  3WBK A;  2XEX A;  4DQK A;  1D2E A;  1VQ6 B;  3FPK A;  3VNU A;  3ES9 A;  2B7C A;  3V76 A;  3E20 A;  1BX1 A;  3VNV A;  1VQK B;  2D74 A;  1YJN B;  1BJK A;  2EIX A;  4YAF A;  3MHP A;  4ZGN B;  3P26 A;  1QFJ A;  3JQR A;  3CCU B;  1W87 A;  1F20 A;  1B2R A;  1KK1 A;  4U9U A;  3AGP A;  2YWH A;  2DER A;  2BGI A;  2QTL A;  1QFY A;  4C43 A;  3ZZU A;  1ELO A;  1BQE A;  3CMA B;  4AC9 A;  2RC6 A;  2CND A;  4RD3 A;  3AVW A;  1I7P A;  3W5U A;  2NPF A;  1ZM3 A;  2QEX B;  3AVV A;  2YWE A;  3WYA A;  3CME B;  4ZV4 A;  2VZL A;  1EXM A;  5H59 A;  4N3G A;  4QHY A;  1F60 A;  2OK8 A;  1OB2 A;  2BV3 A;  4R71 A;  4LBZ A;  3LO8 A;  3CRZ A;  3CCJ B;  3JQQ A;  2VNI A;  5GV8 A;  5HXB A;  3OZV A;  4ZCM A;  1JNY A;  3AGQ A;  4M2L A;  4NCN A;  5KSW B;  1E63 A;  3B82 A;  1QUF A;  3E1Y E;  3PEN A;  1A8P A;  1XE1 A;  3QE2 A;  2EFG A;  2YWF A;  3CPW B;  4FK8 A;  4TN1 A;  1M90 D;  1YI2 B;  1U2R A;  1EFC A;  1GAW A;  3CCL B;  2PLF A;  2QMU A;  1VQN B;  1QGZ A;  4TMT A;  4UAJ A;  3W2F A;  4AF7 A;  1VQ5 B;  1AIP A;  1Q81 D;  1YJ9 B;  3CCS B;  3CCV B;  2BGJ A;  2VNK A;  3VO2 A;  4FN5 A;  4P6V F;  5TV2 A;  2BMW A;  4ZCL A;  4LBY A;  4FWT A;  5JBQ A;  2OTJ B;  2BN4 A;  3G6E B;  1IB0 A;  1GR1 A;  1FND A;  1ZM4 A;  3ZBU A;  3CD6 B;  3P27 A;  4Q7J B;  1JB9 A;  3SJZ A;  1Q7Y D;  4B43 A;  1R5O A;  1YIJ B;  4G1B A;  4Y7C A;  1JA0 A;  4HE5 A;  1J9Z A;  1QGY A;  1QVG B;  3AVU A;  1QUE A;  1ZM2 A;  1EFU A;  1QVF B;  5TR9 A;  1OGJ A;  2HMA A;  3CW2 A;  3OJW A;  1HA3 A;  1G7R A;  3QFR A;  3ZBT A;  1UMK A;  1N8R D;  4LBW A;  3CCE B;  2DET A;  2X3U A;  1Q86 D;  4QFM A;  1XB2 A;  3CCQ B;  1CQX A;  4B44 A;  4M53 A;  1IJE A;  2OK7 A;  4TMX A;  3ZC3 A;  3OJX A;  4MYT A;  3OW2 B;  4IW3 B;  4TMZ A;  3U6B A;  1M1K D;  4TMV A;  3OZW A;  1K73 D;  1KK0 A;  1H42 A;  3WXM A;  3I55 B;  1SM4 A;  2DEU A;  4DQL A;  4YHB A;  1FRQ A;  2QTZ A;  4RD2 A;  4LC0 A;  3QSY A;  1GO2 A;  3G71 B;  1DG1 G;  3CC7 B;  2HDN B;  4M0L A;  1CNE A;  4PGO A;  1N0V C;  5GV7 A;  3ZZ0 A;  1WDT A;  4RD0 A;  4F7D A;  1ZUN B;  4ACA A;  4ZGQ B;  3CB4 A;  2VYQ A;  3AVX A;  2PIA A;  4B3X A;  3WND A;  1QG0 A;  3CC2 B;  1DAR A;  3MCA A;  1D8T A;  4M4S A;  4M1K A;  2QDX A;  1EP2 B;  1VQM B;  1G7C A;  2C78 A;  3WNC A;  1N0U A;  3WNB A;  2B7B A;  1GAQ A;  1D1N A;  1YJW B;  1NDH A;  1KK3 A;  2RC5 A;  1TLL A;  4MYU A;  1VQL B;  1W34 A;  2HCJ B;  3MMP A;  1FNM A;  1KRH A;  1QX4 A;  4B4D A;  1GVH A;  4NBS A;  2E1R A;  4RD1 A;  2YWG A;  2GQF A;  1QGA A;  2C77 A;  3OZU A;  3WY9 A;  2B5O A;  1JJ2 B;  3AVT A;  2VNH A;  2BM0 A;  4LBV A;  1VQ7 B;  3B78 A;  3G4S B;  5DSZ A;  3W2G A;  3FJO A;  4G5G A;  4PC7 A;  4PC2 A;  1W2B B;  5FA6 A;  4ACB A;  1R5N A;  3VMF A;  1EP1 B;  4B47 A;  4EH1 A;  4PC3 A;  1TVC A;  1KTV A;  2R6H A;  1FDR A;  2VNJ A;  3LVB A;  3CC4 B;  3JQP A;  1FNC A;  1BX0 A;  4HE6 A;  2GPJ A;  4N3N A;  3WBJ A;  4Y9U A;  4YAL A;  4ZCI A;  4J0Q A;  1KC8 D;  1EP3 B;  3W5V A;  2QN6 A;  1CNF A;  1OGI A;  3W2I A;  5TY0 A;  1G7S A;  2BVN A;  4H9G A;  1IJF A;  4RJL A;  1VQP B;  1VQ9 B;  4C0S A;  3QFS A;  3QFC A;  3W2H A;  3CCM B;  3I1F A;  4PC1 A;  2CRV A;  2OTL B;  4TMW A;  2BF4 A;  3U2Q A;  4P3Y A;  2BSA A;  2J7K A;  4YAU A;  1AMO A;  1VQ4 B; 
#chains in the Genus database with same CATH topology
 1EWY A;  3OEH A;  1B23 P;  2DCU A;  1PKV A;  4X0C A;  4YAW A;  2PMD A;  3FKS A;  4PC6 A;  1W35 A;  4KKU A;  2ZIT A;  5EMN A;  1S72 B;  2XNC A;  1E62 A;  4RD4 A;  5THX A;  2ZZF A;  3JU4 A;  4RCY A;  1NB0 A;  4B48 A;  1NJI D;  1I18 A;  2AHO A;  3B8H A;  1KZL A;  4WQM A;  4XLA A;  2WZP P;  4X7F A;  4Y9R A;  1S0U A;  1VQO B;  3QFT A;  3W2E A;  5L46 A;  1QH0 A;  4RDJ A;  1DDG A;  1Q82 D;  2D3N A;  1VJS A;  3OW7 A;  2ZL7 A;  4Z4W A;  5AN9 A;  1G7T A;  1IHM A;  4G7W A;  1OB5 A;  1KK2 A;  1QFZ A;  2JN9 A;  3CCR B;  3GIR A;  1NRK A;  1H85 A;  3J81 k;  1GJR A;  3CXC B;  4X06 A;  1Y0Y A;  1K28 D;  2QGG A;  1K8A D;  1TTT A;  4QUZ A;  3OP1 A;  1K9M D;  3A3G A;  2FX3 A;  4RCZ A;  2X6W A;  1VQ8 B;  3U6K A;  1R5B A;  2DY1 A;  2QE7 A;  3W5H A;  5LMZ A;  1TUI A;  2V7T A;  2ZTG A;  4AF6 A;  5IYW A;  4FXU A;  4ROX A;  2XND A;  4RD6 A;  4QV2 A;  1N06 A;  3PUM A;  1FNB A;  4K1X A;  1ZM9 A;  4G1V A;  2XNJ A;  4YAO A;  5FIU A;  1KJZ A;  2V7U A;  3V7A A;  1HZE A;  3CP8 A;  2PE3 A;  4XKW A;  1JA1 A;  2M5S A;  3ONU A;  4OP7 A;  5TRD A;  2QA4 B;  1COW A;  1E64 A;  2BPO A;  4XOP A;  5B6I A;  1SKQ A;  3ZZT A;  2XOK A;  4XLH A;  1YHQ B;  2BM1 A;  3D26 A;  3OEE A;  3AVY A;  2XZP A;  4TT3 A;  3I56 B;  3SKB A;  4P25 A;  1V5V A;  1YIT B;  5H5J A;  4X07 A;  4BPR A;  4P3I A;  5CDF A;  1EFT A;  1FRN A;  1KQS B;  1KD1 D;  1DDI A;  3VO1 A;  4Z4S A;  2CF4 A;  3WBK A;  2XEX A;  4DQK A;  3PUN A;  1D2E A;  1VQ6 B;  3BH4 A;  3FPK A;  3VNU A;  5FO1 A;  4YEJ A;  2V7Q A;  2OBS A;  3ES9 A;  2B7C A;  3V76 A;  4XQF A;  3E20 A;  4OPS A;  3T56 B;  1BX1 A;  4X7C A;  1Y0R A;  3VNV A;  1VF7 A;  3OPO A;  3CP2 A;  1W9X A;  4RDL A;  2XZL A;  2Z6B D;  3CES A;  1VQK B;  2D74 A;  3BNW A;  1YJN B;  1UD6 A;  1BJK A;  5FO0 A;  2V31 A;  2EIX A;  4YAF A;  3MHP A;  2D9R A;  3KEW A;  3OAA A;  3P26 A;  1QFJ A;  3JQR A;  4ZGN B;  1OB0 A;  1T6X A;  4RDK A;  3CCU B;  1W87 A;  3ISX A;  2X6X A;  1F20 A;  1B2R A;  1T6Z A;  4II2 A;  1WP6 A;  4KKT A;  1KK1 A;  4U9U A;  3AGP A;  1WPC A;  4JMQ A;  2F43 A;  2YWH A;  2DER A;  2JJ1 A;  3ASQ A;  4P9S A;  2BGI A;  2QTL A;  1BPL A;  1E3X A;  2W6J A;  1QFY A;  1WOS A;  4OPV A;  4XOT A;  4C43 A;  3ZZU A;  1ELO A;  3G05 A;  2HLD A;  1BQE A;  2E1B A;  3CMA B;  4WWV A;  2OYN A;  2Q6O A;  4AC9 A;  2RC6 A;  2X85 A;  4B3G A;  1XQB A;  2V7X A;  2C5B A;  2CND A;  4RD3 A;  3AVW A;  1I7P A;  2ZTN A;  4Z1M A;  3W5U A;  2NPF A;  1ZM3 A;  2QEX B;  3AVV A;  2OBR A;  2YWE A;  3WYA A;  4QVA A;  3CME B;  2GK6 A;  2ZBV A;  2VBS A;  4ZV4 A;  2VZL A;  1EXM A;  5H59 A;  5J35 A;  2WSS A;  1T5E A;  4N3G A;  4QHY A;  4RM0 A;  2FVG A;  1F60 A;  5HKK A;  4X7D A;  2OK8 A;  3T51 B;  1OB2 A;  2BV3 A;  4R71 A;  5IYP A;  1T6Y A;  3A8K A;  4LBZ A;  4UZU A;  1PJ7 A;  4CQJ A;  3LO8 A;  3CRZ A;  3CCJ B;  4GQN A;  3JQQ A;  2JIZ A;  2VNI A;  3GSI A;  5GV8 A;  5HXB A;  1NB9 A;  1SKY B;  2F1L A;  4XLE A;  5IYR A;  1N07 A;  3OZV A;  4ZCM A;  1BLI A;  2GJR A;  2C4U A;  1FX0 A;  4RPB A;  2W6I A;  1JNY A;  1W0K A;  1W0J A;  4XD7 A;  5HZA A;  3AGQ A;  4M2L A;  2XGJ A;  2Q6K A;  3ZPN A;  4KKS A;  4XM3 A;  4NCN A;  4AVZ A;  5KSW B;  3RY8 A;  2VJI A;  3OKX A;  3PA1 A;  1E63 A;  1H8E A;  1QUF A;  3B82 A;  3E1Y E;  2GRE A;  3PEN A;  1A8P A;  1VLY A;  1XE1 A;  3ASS A;  1UD5 A;  2VBV A;  3QE2 A;  2EFG A;  2YWF A;  3CPW B;  4FK8 A;  4TN1 A;  2WZN A;  1V0E A;  3Q39 A;  4TSF A;  1M90 D;  1E43 A;  3A35 A;  1U2R A;  5F4O A;  1YI2 B;  2NV4 A;  3BQJ A;  1EFC A;  4UZE A;  1GAW A;  3GVL A;  3CCL B;  2ZL5 A;  2PLF A;  2QMU A;  4XLC A;  2WYR A;  5DS0 A;  1N05 A;  1VQN B;  1QGZ A;  2C4T A;  1NBM A;  4TMT A;  4UAJ A;  5FL7 A;  3W2F A;  4DNT B;  3NE5 B;  2ZBU A;  3H9N A;  4P6Y A;  4Z4U A;  4AF7 A;  4OOV A;  1VQ5 B;  3SLD A;  1AIP A;  1Q81 D;  2ZZE A;  1YJ9 B;  3CCS B;  2LZJ A;  5HZB A;  4Z4Z A;  5F4J A;  3CCV B;  2BGJ A;  2VNK A;  3VO2 A;  4FN5 A;  4P6V F;  5TV2 A;  4OPO A;  2JJ2 A;  2BMW A;  5E6T A;  4ZCL A;  4LBY A;  3PA2 A;  4FWT A;  4XKV A;  4RLZ A;  5JBQ A;  4DK0 A;  2OTJ B;  2BN4 A;  5IK2 A;  2DIE A;  3G6E B;  1IB0 A;  4X8I A;  1GR1 A;  1FND A;  2GJK A;  3OOC A;  1VHE A;  1ZM4 A;  4XOR A;  2R9V A;  3ZBU A;  1YX2 A;  3CD6 B;  1MAB A;  3P27 A;  3GQB A;  4Q7J B;  1S4M A;  1BMF A;  1JB9 A;  4WZK A;  1YLO A;  1V0F A;  3SJZ A;  1Q7Y D;  4B43 A;  2OBT A;  1R5O A;  1RQR A;  3CMM A;  1YIJ B;  4G1B A;  3PVD A;  4Y7C A;  1JA0 A;  4HE5 A;  2ZXI A;  1J9Z A;  2V7W A;  1QVG B;  4P22 A;  3AVU A;  1QUE A;  1ZM2 A;  1EFU A;  4PAA A;  1QVF B;  5TR9 A;  4OOX A;  3A8J A;  1EFR A;  1OGJ A;  2HMA A;  3T53 B;  3OFN A;  3CW2 A;  3OJW A;  3R6J A;  1HA3 A;  5A89 A;  2WPD A;  3SEJ A;  3BCD A;  2V7V A;  1G7R A;  4Z4R A;  1I8D A;  1WU8 A;  3QFR A;  3ZBT A;  1KMH A;  3LQE A;  3LQ6 A;  1UMK A;  1N8R D;  4LBW A;  4P26 A;  2XZO A;  3CCE B;  1E3Z A;  2DET A;  5A8A A;  2X3U A;  3ASP A;  4QFM A;  4XN0 A;  1Q86 D;  1XB2 A;  3CCQ B;  1CQX A;  4B44 A;  4M53 A;  1IJE A;  2OK7 A;  3R6K A;  4TMX A;  3ZC3 A;  3OJX A;  4MYT A;  3OW2 B;  4IW3 B;  4P2N A;  2WJV A;  4TMZ A;  3U6B A;  1M1K D;  4XON A;  2ZXH A;  4L8J A;  3OZW A;  4TMV A;  3ONY A;  4YXW A;  4XNF A;  1K73 D;  1N08 A;  1KK0 A;  2C2W A;  1H42 A;  1H8H A;  1VLO A;  3WXM A;  1SM4 A;  4DNR B;  3I55 B;  2DEU A;  3HAG A;  4DQL A;  4YHB A;  1FRQ A;  2I1L A;  2ZZQ A;  2QTZ A;  4TKO B;  4RD2 A;  4LC0 A;  3QSY A;  3VR6 A;  1GO2 A;  4RPD A;  3G71 B;  1DG1 G;  3CC7 B;  2HDN B;  1WOO A;  1E1Q A;  4Z4T A;  4Z4V A;  3AST A;  2X53 S;  4M0L A;  1CNE A;  2GJP A;  4PGO A;  2D3L A;  1N0V C;  5GV7 A;  3ZZ0 A;  3Q38 A;  1WDT A;  4P12 A;  4RD0 A;  4F7D A;  1ZUN B;  4PAB A;  5KW9 A;  3CTA A;  3ZIA A;  4ACA A;  4ZGQ B;  4XN3 A;  5J3O A;  3CB4 A;  2VYQ A;  1P4M A;  3AVX A;  2VJJ A;  2PIA A;  2DOG A;  3WND A;  4B3X A;  1QG0 A;  5IYN A;  3CC2 B;  2VBT A;  1DAR A;  2DYI A;  1D8T A;  3MCA A;  4M4S A;  2QDX A;  4M1K A;  1EP2 B;  2CC2 A;  2CW5 A;  4E0F A;  1VQM B;  1G7C A;  1OHH A;  2P3M A;  3OE7 A;  2C78 A;  5FNZ A;  3FPP A;  3WNC A;  4P1V A;  3SJP A;  4II3 A;  1N0U A;  3WNB A;  2B7B A;  1UD8 A;  3GVJ A;  1GAQ A;  1PJ5 A;  2V4D A;  2Q6L A;  3GVK A;  5F4M A;  1NDH A;  3KL9 A;  3Q3A A;  1KK3 A;  1YJW B;  1D1N A;  2CBX A;  5BSY A;  2RC5 A;  1TLL A;  4MYU A;  1VQL B;  1W34 A;  2HCJ B;  1XFO A;  4G7X A;  1WOR A;  3MMP A;  4YEL A;  1FNM A;  3DDY A;  2VBU A;  1KRH A;  1QX4 A;  4B4D A;  1GVH A;  1PJ6 A;  2Q6I A;  2F1M A;  4NBS A;  5BSX A;  5DN6 A;  2JDI A;  2E1R A;  3ASR A;  3BY2 A;  4RD1 A;  4DK1 A;  2YWG A;  2GQF A;  4YAU A;  1QGA A;  2KVO A;  3ZUG A;  2C77 A;  3OZU A;  3WY9 A;  2B5O A;  1JJ2 B;  4X05 A;  3AVT A;  2VNH A;  4XMY A;  2BM0 A;  3A3B A;  4LBV A;  1VQ7 B;  3B78 A;  2WJY A;  3G4S B;  2WR8 A;  2F4N A;  5DSZ A;  3W2G A;  3CPX A;  3FJO A;  4G5G A;  4UZF A;  4PC7 A;  4WZL A;  4NNJ A;  1WSR A;  4PC2 A;  1W2B B;  4G6I A;  5FA6 A;  3SLN A;  4ACB A;  2X0K A;  2ZL6 A;  1R5N A;  3Q6R A;  3VMF A;  1EP1 B;  1HVX A;  4B47 A;  1E79 A;  4EH1 A;  4XR6 A;  4PC3 A;  1TVC A;  1KTV A;  2R6H A;  1RQP A;  1FDR A;  2VNJ A;  3LVB A;  3CC4 B;  4XL9 A;  3JQP A;  1FNC A;  2ZZG A;  1BX0 A;  4HE6 A;  3Q6Q A;  4X7E A;  2GPJ A;  4N3N A;  3WBJ A;  1UD4 A;  3BC9 A;  4Y9U A;  4YAL A;  2C5H A;  4J0Q A;  4ZCI A;  1KC8 D;  4WZT A;  1EP3 B;  1UD2 A;  3W5V A;  4XLF A;  1WOP A;  1MRZ A;  2QN6 A;  2CK3 A;  1CNF A;  4B3F X;  3BCF A;  1OGI A;  3W2I A;  3WQZ A;  5TY0 A;  4ASU A;  1VHO A;  1G7S A;  2BVN A;  1WSV A;  4H9G A;  5IYQ A;  1E1R A;  3A1P A;  1IJF A;  1Q9S A;  1UD3 A;  4QVJ A;  4RJL A;  4C0S A;  1VQP B;  1VQ9 B;  3QFS A;  3A8I A;  3QFC A;  3W2H A;  3CCM B;  3I1F A;  3LNN A;  5KNL A;  4PC1 A;  4Z4Y A;  2CRV A;  4OOS A;  2OTL B;  4TMW A;  2BF4 A;  3BY1 A;  3U2Q A;  3H94 A;  1WTH D;  2GK7 A;  4WZE A;  4P3Y A;  2X8K A;  2X6Y A;  5A88 A;  2BSA A;  2J7K A;  4HIZ A;  1QGY A;  1AMO A;  1VQ4 B; 
#chains in the Genus database with same CATH homology
 1EWY A;  1B23 P;  2DCU A;  4YAW A;  2PMD A;  5EMN A;  4PC6 A;  1W35 A;  1S72 B;  2ZIT A;  2XNC A;  1E62 A;  4RD4 A;  5THX A;  4RCY A;  4B48 A;  1NJI D;  2AHO A;  3B8H A;  4WQM A;  4Y9R A;  1S0U A;  1VQO B;  3QFT A;  3W2E A;  1QH0 A;  1DDG A;  1Q82 D;  5AN9 A;  1G7T A;  1OB5 A;  1KK2 A;  1QFZ A;  3CCR B;  3J81 k;  1H85 A;  3CXC B;  1GJR A;  1K8A D;  1TTT A;  1K9M D;  2FX3 A;  4RCZ A;  1VQ8 B;  3U6K A;  1R5B A;  2DY1 A;  3W5H A;  1TUI A;  4AF6 A;  4RD6 A;  1FNB A;  4K1X A;  1ZM9 A;  4G1V A;  2XNJ A;  4YAO A;  1KJZ A;  1JA1 A;  2QA4 B;  1E64 A;  2BPO A;  1SKQ A;  3ZZT A;  1YHQ B;  3AVY A;  2BM1 A;  3I56 B;  1YIT B;  5H5J A;  4BPR A;  1EFT A;  1FRN A;  1KQS B;  1KD1 D;  1DDI A;  3VO1 A;  3WBK A;  2XEX A;  4DQK A;  1D2E A;  1VQ6 B;  3FPK A;  3VNU A;  3ES9 A;  2B7C A;  3V76 A;  3E20 A;  1BX1 A;  3VNV A;  1VQK B;  2D74 A;  1YJN B;  1BJK A;  2EIX A;  4YAF A;  3MHP A;  4ZGN B;  3P26 A;  1QFJ A;  3JQR A;  3CCU B;  1W87 A;  1F20 A;  1B2R A;  1KK1 A;  4U9U A;  3AGP A;  2YWH A;  2DER A;  2BGI A;  2QTL A;  1QFY A;  4C43 A;  3ZZU A;  1ELO A;  1BQE A;  3CMA B;  4AC9 A;  2RC6 A;  2CND A;  4RD3 A;  3AVW A;  1I7P A;  3W5U A;  2NPF A;  1ZM3 A;  2QEX B;  3AVV A;  2YWE A;  3WYA A;  3CME B;  4ZV4 A;  2VZL A;  1EXM A;  5H59 A;  4N3G A;  4QHY A;  1F60 A;  2OK8 A;  1OB2 A;  2BV3 A;  4R71 A;  4LBZ A;  3LO8 A;  3CRZ A;  3CCJ B;  3JQQ A;  2VNI A;  5GV8 A;  5HXB A;  3OZV A;  4ZCM A;  1JNY A;  3AGQ A;  4M2L A;  4NCN A;  5KSW B;  1E63 A;  3B82 A;  1QUF A;  3E1Y E;  3PEN A;  1A8P A;  1XE1 A;  3QE2 A;  2EFG A;  2YWF A;  3CPW B;  4FK8 A;  4TN1 A;  1M90 D;  1YI2 B;  1U2R A;  1EFC A;  1GAW A;  3CCL B;  2PLF A;  2QMU A;  1VQN B;  1QGZ A;  4TMT A;  4UAJ A;  3W2F A;  4AF7 A;  1VQ5 B;  1AIP A;  1Q81 D;  1YJ9 B;  3CCS B;  3CCV B;  2BGJ A;  2VNK A;  3VO2 A;  4FN5 A;  4P6V F;  5TV2 A;  2BMW A;  4ZCL A;  4LBY A;  4FWT A;  5JBQ A;  2OTJ B;  2BN4 A;  3G6E B;  1IB0 A;  1GR1 A;  1FND A;  1ZM4 A;  3ZBU A;  3CD6 B;  3P27 A;  4Q7J B;  1JB9 A;  3SJZ A;  1Q7Y D;  4B43 A;  1R5O A;  1YIJ B;  4G1B A;  4Y7C A;  1JA0 A;  4HE5 A;  1J9Z A;  1QGY A;  1QVG B;  3AVU A;  1QUE A;  1ZM2 A;  1EFU A;  1QVF B;  5TR9 A;  1OGJ A;  2HMA A;  3CW2 A;  3OJW A;  1HA3 A;  1G7R A;  3QFR A;  3ZBT A;  1UMK A;  1N8R D;  4LBW A;  3CCE B;  2DET A;  2X3U A;  1Q86 D;  4QFM A;  1XB2 A;  3CCQ B;  1CQX A;  4B44 A;  4M53 A;  1IJE A;  2OK7 A;  4TMX A;  3ZC3 A;  3OJX A;  4MYT A;  3OW2 B;  4IW3 B;  4TMZ A;  3U6B A;  1M1K D;  4TMV A;  3OZW A;  1K73 D;  1KK0 A;  1H42 A;  3WXM A;  3I55 B;  1SM4 A;  2DEU A;  4DQL A;  4YHB A;  1FRQ A;  2QTZ A;  4RD2 A;  4LC0 A;  3QSY A;  1GO2 A;  3G71 B;  1DG1 G;  3CC7 B;  2HDN B;  4M0L A;  1CNE A;  4PGO A;  1N0V C;  5GV7 A;  3ZZ0 A;  1WDT A;  4RD0 A;  4F7D A;  1ZUN B;  4ACA A;  4ZGQ B;  3CB4 A;  2VYQ A;  3AVX A;  2PIA A;  4B3X A;  3WND A;  1QG0 A;  3CC2 B;  1DAR A;  3MCA A;  1D8T A;  4M4S A;  4M1K A;  2QDX A;  1EP2 B;  1VQM B;  1G7C A;  2C78 A;  3WNC A;  1N0U A;  3WNB A;  2B7B A;  1GAQ A;  1D1N A;  1YJW B;  1NDH A;  1KK3 A;  2RC5 A;  1TLL A;  4MYU A;  1VQL B;  1W34 A;  2HCJ B;  3MMP A;  1FNM A;  1KRH A;  1QX4 A;  4B4D A;  1GVH A;  4NBS A;  2E1R A;  4RD1 A;  2YWG A;  2GQF A;  1QGA A;  2C77 A;  3OZU A;  3WY9 A;  2B5O A;  1JJ2 B;  3AVT A;  2VNH A;  2BM0 A;  4LBV A;  1VQ7 B;  3B78 A;  3G4S B;  5DSZ A;  3W2G A;  3FJO A;  4G5G A;  4PC7 A;  4PC2 A;  1W2B B;  5FA6 A;  4ACB A;  1R5N A;  3VMF A;  1EP1 B;  4B47 A;  4EH1 A;  4PC3 A;  1TVC A;  1KTV A;  2R6H A;  1FDR A;  2VNJ A;  3LVB A;  3CC4 B;  3JQP A;  1FNC A;  1BX0 A;  4HE6 A;  2GPJ A;  4N3N A;  3WBJ A;  4Y9U A;  4YAL A;  4ZCI A;  4J0Q A;  1KC8 D;  1EP3 B;  3W5V A;  2QN6 A;  1CNF A;  1OGI A;  3W2I A;  5TY0 A;  1G7S A;  2BVN A;  4H9G A;  1IJF A;  4RJL A;  1VQP B;  1VQ9 B;  4C0S A;  3QFS A;  3QFC A;  3W2H A;  3CCM B;  3I1F A;  4PC1 A;  2CRV A;  2OTL B;  4TMW A;  2BF4 A;  3U2Q A;  4P3Y A;  2BSA A;  2J7K A;  4YAU A;  1AMO A;  1VQ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...