4PGOA

Crystal structure of hypothetical protein pf0907 from pyrococcus furiosus solved by sulfur sad using swiss light source data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
EILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 19
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14578 GTP_EFTU_D4 Elongation factor Tu domain 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4pgoA00
3W5UA 3OZWA 4TMVA 1FNCA 1W35A 4M53A 1YI2B 1GAWA 1I7PA 1YJNB 1DDGA 3CCRB 5AN9A 1OGJA 2C78A 2ZITA 3AGPA 4LBWA 4B3XA 1EP2B 3WY9A 4M0LA 1D2EA 1GVHA 1DDIA 4PC2A 1VQ5B 3U6BA 3CC2B 1EXMA 1F60A 3CMEB 4RD1A 4B47A 1QUEA 4DQKA 1VQ6B 2VNHA 2DEUA 2BMWA 3CRZA 4AF6A 1JJ2B 3AVXA 1QG0A 3OZUA 4QFMA 3CCQB 4C43A 2BM1A 1KK0A 3CCUB 1S0UA 3AVVA 3E1YE 1N0VC 3MCAA 2GQFA 1BJKA 3FPKA 3VO2A 1BX0A 5DSZA 2AHOA 1VQ9B 2VNKA 3OJXA 1D8TA 4RD6A 1KK1A 2YWGA 4NCNA 3CCJB 5KSWB 3QFRA 3QFSA 2BM0A 1UMKA 3P27A 1DG1G 5GV7A 1KQSB 1BQEA 3B8HA 3SJZA 3U6KA 4B43A 2YWEA 1DARA 1GO2A 2BGIA 3WBKA 1D1NA 4R71A 3QFCA 4C0SA 2QDXA 4B48A 3PENA 4AF7A 4ZCMA 3W2GA 3ZBTA 4QHYA 2VNJA 4HE5A 1VQ7B 2BSAA 3CW2A 2VYQA 1FNDA 4G1VA 2OTLB 3I56B 1KC8D 3WNCA 5GV8A 3OW2B 4YAFA 1Q82D 1N8RD 1FNBA 1JA1A 2BPOA 1IJEA 3W2HA 4BPRA 4G5GA 1AMOA 1CQXA 4LBVA 4ZGQB 1YJ9B 4DQLA 3W2FA 2BN4A 2HMAA 2GPJA 1Q81D 2C77A 3J81k 2DETA 1R5BA 1KJZA 2YWFA 3G4SB 1YJWB 1M1KD 4K1XA 4ZCLA 3V76A 1NJID 4M4SA 1EP3B 4YAOA 3CPWB 1EWYA 3W2EA 1VQ8B 1Q86D 1TUIA 5HXBA 1GAQA 2QMUA 1K73D 1QVGB 2PIAA 1JA0A 4RD0A 4UAJA 1QGYA 1YIJB 1CNFA 2BF4A 1K8AD 1TLLA 3ZZ0A 2FX3A 1KK3A 3AVUA 2CRVA 1M90D 2DERA 3U2QA 4TMZA 3I55B 3JQQA 3VMFA 4YAWA 1EFUA 4TMXA 3CC4B 3QFTA 1EP1B 3VNUA 3P26A 4PC6A 3ES9A 1VQPB 1B23P 4FN5A 1Q7YD 2CNDA 3WBJA 3B78A 2B5OA 2R6HA 3LVBA 1FDRA 2RC6A 1ZM4A 1XE1A 3E20A 4ZCIA 5JBQA 1R5OA 2J7KA 3CD6B 1A8PA 1TVCA 2B7CA 1XB2A 1KRHA 2XNJA 1E64A 3CCMB 4TMTA 1CNEA 1ZM9A 5TR9A 3B82A 1TTTA 5THXA 2QA4B 4M2LA 4Y9UA 4NBSA 3QE2A 1NDHA 4Y7CA 3ZZTA 4RJLA 3AVTA 3OZVA 1VQ4B 2OK7A 3G6EB 1VQKB 3ZC3A 1ELOA 2PLFA 4RD3A 2EFGA 1FRNA 4ACBA 1SKQA 3WXMA 1QFZA 3W2IA 4RD4A 1VQLB 1AIPA 3VO1A 2YWHA 2D74A 5H5JA 2BGJA 1F20A 2QN6A 4WQMA 2DY1A 4Q7JB 2OTJB 1KD1D 4ZGNB 2X3UA 4TN1A 4LBYA 1K9MD 1GR1A 1U2RA 1H85A 1S72B 4M1KA 1QX4A 3MMPA 2BV3A 4MYUA 2E1RA 3QSYA 3MHPA 4P6VF 4Y9RA 4ACAA 5H59A 1G7CA 1IJFA 3I1FA 1J9ZA 1YHQB 1GJRA 1FNMA 3JQRA 3CCLB 4G1BA 1OGIA 2BVNA 1EFTA 1QUFA 5EMNA 1KK2A 4TMWA 2B7BA 1ZM2A 4N3NA 1BX1A 4PC3A 3CCSB 3ZZUA 3W5VA 3CCEB 3WNBA 1VQNB 2HDNB 3CB4A 1E62A 2VZLA 4P3YA 1KTVA 2RC5A 2QEXB 4LC0A 4B4DA 1B2RA 3CMAB 4FK8A 4FWTA 4RCZA 3ZBUA 3AVWA 1E63A 1ZUNB 2XNCA 1JB9A 2XEXA 1W87A 1N0UA 4PC1A 3CCVB 5TV2A 3LO8A 4ZV4A 1QFYA 1YITB 1G7RA 1W34A 4N3GA 3CC7B 4AC9A 1QGZA 3FJOA 1VQOB 1G7SA 4J0QA 4H9GA 5FA6A 1VQMB 4YHBA 4IW3B 1WDTA 2VNIA 3AGQA 4RCYA 5TY0A 1OB5A 3WNDA 4EH1A 4MYTA 1FRQA 4LBZA 4YAUA 1R5NA 4PC7A 4HE6A 4YALA 2PMDA 4U9UA 1ZM3A 3W5HA 1QFJA 1H42A 1HA3A 3WYAA 1W2BB 1QVFB 2QTZA 2QTLA 3G71B 1OB2A 3JQPA 3VNVA 3CXCB 1SM4A 1JNYA 4F7DA 1EFCA 1QH0A 4RD2A 2NPFA 1G7TA 3AVYA 4B44A 3OJWA 1QGAA 2DCUA 2HCJB 4PGOA 1IB0A 2EIXA 2OK8A
chains in the Genus database with same CATH superfamily
4RLZA 1WOPA 2WPDA 1UD3A 3W5UA 3OZWA 5FIUA 4TMVA 1FNCA 3LNNA 3Q6RA 1E3ZA 1W35A 4Z4YA 4M53A 1RQRA 1YI2B 4B3FX 4Z4TA 4XLCA 2HLDA 1GAWA 1YX2A 2V31A 2XOKA 1I7PA 1VHOA 1YJNB 5KNLA 1DDGA 1UD2A 1W9XA 2V7TA 5CDFA 5A88A 3CCRB 5AN9A 2WR8A 1OGJA 2C78A 2ZITA 3AGPA 4LBWA 4B3XA 1EP2B 3WY9A 2X6WA 2VBTA 4RM0A 3D26A 3SLDA 4HIZA 4M0LA 4Z4WA 4UZFA 2KVOA 4P9SA 2ZL6A 1D2EA 4TKOB 1GVHA 1DDIA 4PC2A 1VQ5B 3U6BA 2LZJA 3CC2B 1EXMA 1WTHD 5IYNA 1F60A 3SEJA 3CMEB 4RD1A 4B47A 4X05A 2X8KA 4XKVA 4XOTA 4XOPA 1QUEA 1UD4A 2PE3A 4DQKA 1VQ6B 2VNHA 1SKYB 2QGGA 2DEUA 2BMWA 3CRZA 4AF6A 2JIZA 1JJ2B 3CTAA 3AVXA 1QG0A 3OZUA 5F4OA 4X0CA 3BY1A 4X7EA 2OBTA 4QFMA 4P2NA 3CCQB 1Q9SA 4C43A 2XZPA 2BM1A 1KK0A 3CCUB 1S0UA 3AVVA 3E1YE 4Z1MA 1W0KA 4TT3A 2WZPP 1N0VC 3DDYA 3OFNA 3SKBA 5HKKA 3PA2A 1UD6A 2R9VA 3MCAA 4YELA 2GQFA 5BSYA 1E79A 1BJKA 3KEWA 3ZUGA 5FNZA 3SJPA 3FPKA 3VO2A 1BX0A 1WOSA 4G6IA 4XNFA 4XLFA 2ZZFA 4FXUA 4XKWA 5DSZA 3CESA 1UD8A 4PAAA 2X85A 1MABA 1YLOA 2F4NA 2AHOA 1Y0YA 3V7AA 1VQ9B 1MRZA 2VNKA 2VBSA 4WZTA 3OJXA 1D8TA 4RPDA 4YEJA 4RD6A 1KK1A 2I1LA 2YWGA 2ZBVA 3ZPNA 2GJKA 1NBMA 3BCDA 4NCNA 3CCJB 2F1LA 5KSWB 3QFRA 2XNDA 4XN3A 3QFSA 4TSFA 2BM0A 1UMKA 3P27A 1DG1G 5GV7A 2D3LA 1COWA 1KQSB 1OHHA 1BQEA 3B8HA 3GVJA 3SJZA 4CQJA 3U6KA 4B43A 2YWEA 1DARA 1GO2A 2BGIA 3GVKA 3H94A 3WBKA 2XZOA 2W6IA 1D1NA 4R71A 3ONUA 4QUZA 3QFCA 3CMMA 3Q38A 3GSIA 4C0SA 2QDXA 2P3MA 4B48A 5HZBA 3ONYA 3PENA 4AF7A 3A35A 4ZCMA 3W2GA 3ZBTA 4DK0A 4QHYA 4DK1A 2VNJA 4II3A 3ASSA 4X7CA 4HE5A 1S4MA 1VQ7B 1E3XA 2OBSA 5IYQA 1T6ZA 2BSAA 3CW2A 4YXWA 2VYQA 3CP2A 1FNDA 4G1VA 3HAGA 3ZIAA 4OPOA 2OTLB 3I56B 1KC8D 3WNCA 5GV8A 2JJ2A 3OW2B 4YAFA 4X07A 4XONA 1Q82D 4L8JA 2XZLA 2DIEA 2XGJA 1N8RD 1FNBA 1JA1A 2F1MA 2BPOA 4X8IA 1IJEA 3W2HA 4ASUA 4BPRA 4G5GA 1AMOA 1CQXA 4LBVA 4OPSA 4ZGQB 4P22A 3ASTA 3BQJA 1YJ9B 5HZAA 5DN6A 1PJ5A 2JDIA 4DQLA 5BSXA 3W2FA 2BN4A 2HMAA 1WP6A 2GPJA 1Q81D 5IYPA 2C77A 3J81k 2DETA 1R5BA 1VLOA 1KJZA 2YWFA 3G4SB 1YJWB 2WJYA 1PKVA 1M1KD 4K1XA 4ZCLA 3V76A 1NJID 2Z6BD 1WORA 4OOVA 2X6YA 4M4SA 1EP3B 4YAOA 2CC2A 5F4MA 3CPWB 1EWYA 3W2EA 1VHEA 1Q86D 1VQ8B 2GJRA 1TUIA 2ZXHA 4WZKA 4P12A 5HXBA 1GAQA 1Y0RA 2ZZGA 5L46A 2QMUA 1K73D 1VJSA 1QVGB 3ASQA 5LMZA 1T5EA 2PIAA 3A8KA 1JA0A 3R6KA 4RD0A 4UAJA 5IK2A 1H8HA 1QGYA 3ASPA 1YIJB 4PABA 2VBVA 1CNFA 3H9NA 2BF4A 4E0FA 1TLLA 3ZZ0A 2FX3A 1K8AD 1KK3A 3GIRA 3AVUA 2ZBUA 2CRVA 1M90D 1I18A 3A8IA 4XM3A 3FKSA 4Z4ZA 3U2QA 2DERA 4TMZA 3CPXA 3I55B 3JQQA 3Q3AA 3VMFA 4YAWA 4XR6A 1EFUA 2Q6LA 4TMXA 3CC4B 4QVAA 5E6TA 1NB9A 2GREA 1NB0A 3BY2A 1EP1B 3QFTA 3VNUA 3P26A 2M5SA 3SLNA 3OEEA 2V7XA 3ES9A 2Q6OA 4PC6A 4XN0A 3BNWA 2VJJA 5IYRA 1VQPB 3Q39A 4OPVA 4WWVA 1B23P 4FN5A 1Q7YD 3OP1A 2CNDA 3WBJA 3B78A 2B5OA 2R6HA 2D9RA 3LVBA 1FDRA 1H8EA 4WZEA 5B6IA 4X06A 3OOCA 2F43A 2RC6A 1ZM4A 1XE1A 3E20A 4ZCIA 3G05A 5JBQA 1R5OA 3CP8A 4X7FA 2J7KA 3CD6B 1A8PA 1TVCA 2B7CA 4QVJA 3A3GA 1V0EA 2WYRA 1HZEA 2GJPA 1XB2A 4RDKA 2WSSA 2GK7A 1KRHA 1EFRA 2XNJA 1E64A 3PUMA 2X6XA 3CCMB 2ZXIA 4TMTA 2OBRA 1CNEA 1ZM9A 5TR9A 3B82A 1TTTA 5THXA 2CBXA 2QA4B 4M2LA 1PJ7A 3OE7A 4Y9UA 1VLYA 4NBSA 1E1QA 3QE2A 1NDHA 4Y7CA 5TRDA 3ZZTA 4RJLA 1KMHA 3AVTA 3OZVA 2C4UA 1VQ4B 2OK7A 1N07A 3BCFA 3G6EB 1OB0A 2DOGA 2V7WA 2V7QA 3BC9A 1VQKB 3ZC3A 1T6XA 1WSRA 1ELOA 5A89A 1BPLA 2PLFA 4RD3A 4OP7A 2EFGA 1FRNA 3T56B 1SKQA 3WXMA 4ACBA 1QFZA 3W2IA 4KKTA 2V4DA 4RD4A 4QV2A 1AIPA 1VQLB 3VO1A 2YWHA 2D74A 5H5JA 1W0JA 1NRKA 2BGJA 3A3BA 1F20A 5FO0A 2VBUA 3ISXA 4P3IA 2QN6A 4WQMA 2DY1A 4Q7JB 2OTJB 1KD1D 4ZGNB 2X3UA 4TN1A 2D3NA 4LBYA 1K9MD 1GR1A 1U2RA 1IHMA 3OPOA 1HVXA 1H85A 4XQFA 4Z4VA 3A8JA 4XORA 1S72B 4M1KA 4B3GA 1QX4A 3MMPA 2BV3A 4MYUA 2E1RA 3OEHA 3QSYA 3MHPA 1UD5A 2NV4A 4P6VF 4Y9RA 4ACAA 1WU8A 5H59A 4XD7A 4DNTB 1G7CA 1IJFA 4II2A 1BLIA 3I1FA 1J9ZA 3RY8A 4RPBA 1YHQB 1V0FA 1GJRA 1FNMA 1XQBA 2C4TA 3JQRA 1PJ6A 3CCLB 2CF4A 4G1BA 1OGIA 2C5HA 2BVNA 1EFTA 2X0KA 1QUFA 1RQPA 5EMNA 1KK2A 4TMWA 5FO1A 1KZLA 1N05A 2B7BA 1ZM2A 4N3NA 3ASRA 4G7WA 2E1BA 2ZZQA 1N06A 4JMQA 4Z4SA 4P25A 1BX1A 1K28D 2FVGA 4UZEA 4P6YA 4PC3A 3CCSB 1BMFA 1WSVA 4P1VA 4OOXA 3ZZUA 3OW7A 3W5VA 3CCEB 3WNBA 2WJVA 1VQNB 2HDNB 5KW9A 3CB4A 1E62A 2VZLA 3NE5B 1KTVA 2RC5A 4P3YA 4LC0A 5DS0A 4B4DA 1B2RA 4XLAA 1WOOA 2QEXB 3CMAB 3GVLA 4FK8A 4FWTA 4RCZA 3ZBUA 3AVWA 4GQNA 1E63A 1ZUNB 2XNCA 1JB9A 4XL9A 2XEXA 1W87A 2JN9A 1N0UA 3OKXA 2V7VA 3A1PA 4PC1A 3CCVB 1I8DA 3R6JA 5F4JA 4XMYA 3PVDA 2QE7A 2X53S 5TV2A 3LO8A 4ZV4A 1V5VA 1N08A 3JU4A 1QFYA 2VJIA 5IYWA 4AVZA 1YITB 2V7UA 3GQBA 3T51B 1G7RA 1W34A 4KKUA 4N3GA 2CK3A 3CC7B 4AC9A 3WQZA 1QGZA 3FJOA 5J35A 1VQOB 2GK6A 2CW5A 1FX0A 3T53B 1G7SA 4WZLA 4XLHA 4J0QA 4ROXA 4H9GA 5FA6A 1VQMB 4YHBA 2OYNA 4G7XA 4RDLA 4IW3B 1WDTA 3Q6QA 2VNIA 2ZL7A 3AGQA 2Q6KA 4UZUA 4Z4RA 1P4MA 4RCYA 4X7DA 5TY0A 1OB5A 2W6JA 2WZNA 3WNDA 4EH1A 1E1RA 2JJ1A 4MYTA 1FRQA 4LBZA 4YAUA 1R5NA 3VR6A 4PC7A 3FPPA 4HE6A 4YALA 4OOSA 2PMDA 4U9UA 1XFOA 1ZM3A 3W5HA 1QFJA 1WPCA 1H42A 1HA3A 3PUNA 3WYAA 1W2BB 1T6YA 5FL7A 1E43A 1QVFB 2ZTGA 2QTZA 3LQEA 2QTLA 3G71B 2Q6IA 2ZZEA 5A8AA 1OB2A 3JQPA 2C2WA 3VNVA 3CXCB 1SM4A 4P26A 1JNYA 3PA1A 4DNRB 4KKSA 4F7DA 1EFCA 2ZL5A 4XLEA 1QH0A 4RD2A 2C5BA 2NPFA 1G7TA 2DYIA 4RDJA 3AVYA 3BH4A 4B44A 5J3OA 3OJWA 3LQ6A 3KL9A 1VF7A 1QGAA 2DCUA 4Z4UA 4NNJA 2HCJB 3OAAA 4PGOA 1IB0A 2ZTNA 2EIXA 2OK8A
chains in the Genus database with same CATH topology
3W5UA 3OZWA 4TMVA 1FNCA 1W35A 4M53A 1YI2B 1GAWA 1I7PA 1YJNB 1DDGA 3CCRB 5AN9A 1OGJA 2C78A 2ZITA 3AGPA 4LBWA 4B3XA 1EP2B 3WY9A 4M0LA 1D2EA 1GVHA 1DDIA 4PC2A 1VQ5B 3U6BA 3CC2B 1EXMA 1F60A 3CMEB 4RD1A 4B47A 1QUEA 4DQKA 1VQ6B 2VNHA 2DEUA 2BMWA 3CRZA 4AF6A 1JJ2B 3AVXA 1QG0A 3OZUA 4QFMA 3CCQB 4C43A 2BM1A 1KK0A 3CCUB 1S0UA 3AVVA 3E1YE 1N0VC 3MCAA 2GQFA 1BJKA 3FPKA 3VO2A 1BX0A 5DSZA 2AHOA 1VQ9B 2VNKA 3OJXA 1D8TA 4RD6A 1KK1A 2YWGA 4NCNA 3CCJB 5KSWB 3QFRA 3QFSA 2BM0A 1UMKA 3P27A 1DG1G 5GV7A 1KQSB 1BQEA 3B8HA 3SJZA 3U6KA 4B43A 2YWEA 1DARA 1GO2A 2BGIA 3WBKA 1D1NA 4R71A 3QFCA 4C0SA 2QDXA 4B48A 3PENA 4AF7A 4ZCMA 3W2GA 3ZBTA 4QHYA 2VNJA 4HE5A 1VQ7B 2BSAA 3CW2A 2VYQA 1FNDA 4G1VA 2OTLB 3I56B 1KC8D 3WNCA 5GV8A 3OW2B 4YAFA 1Q82D 1N8RD 1FNBA 1JA1A 2BPOA 1IJEA 3W2HA 4BPRA 4G5GA 1AMOA 1CQXA 4LBVA 4ZGQB 1YJ9B 4DQLA 3W2FA 2BN4A 2HMAA 2GPJA 1Q81D 2C77A 3J81k 2DETA 1R5BA 1KJZA 2YWFA 3G4SB 1YJWB 1M1KD 4K1XA 4ZCLA 3V76A 1NJID 4M4SA 1EP3B 4YAOA 3CPWB 1EWYA 3W2EA 1VQ8B 1Q86D 1TUIA 5HXBA 1GAQA 2QMUA 1K73D 1QVGB 2PIAA 1JA0A 4RD0A 4UAJA 1QGYA 1YIJB 1CNFA 2BF4A 1K8AD 1TLLA 3ZZ0A 2FX3A 1KK3A 3AVUA 2CRVA 1M90D 2DERA 3U2QA 4TMZA 3I55B 3JQQA 3VMFA 4YAWA 1EFUA 4TMXA 3CC4B 3QFTA 1EP1B 3VNUA 3P26A 4PC6A 3ES9A 1VQPB 1B23P 4FN5A 1Q7YD 2CNDA 3WBJA 3B78A 2B5OA 2R6HA 3LVBA 1FDRA 2RC6A 1ZM4A 1XE1A 3E20A 4ZCIA 5JBQA 1R5OA 2J7KA 3CD6B 1A8PA 1TVCA 2B7CA 1XB2A 1KRHA 2XNJA 1E64A 3CCMB 4TMTA 1CNEA 1ZM9A 5TR9A 3B82A 1TTTA 5THXA 2QA4B 4M2LA 4Y9UA 4NBSA 3QE2A 1NDHA 4Y7CA 3ZZTA 4RJLA 3AVTA 3OZVA 1VQ4B 2OK7A 3G6EB 1VQKB 3ZC3A 1ELOA 2PLFA 4RD3A 2EFGA 1FRNA 4ACBA 1SKQA 3WXMA 1QFZA 3W2IA 4RD4A 1VQLB 1AIPA 3VO1A 2YWHA 2D74A 5H5JA 2BGJA 1F20A 2QN6A 4WQMA 2DY1A 4Q7JB 2OTJB 1KD1D 4ZGNB 2X3UA 4TN1A 4LBYA 1K9MD 1GR1A 1U2RA 1H85A 1S72B 4M1KA 1QX4A 3MMPA 2BV3A 4MYUA 2E1RA 3QSYA 3MHPA 4P6VF 4Y9RA 4ACAA 5H59A 1G7CA 1IJFA 3I1FA 1J9ZA 1YHQB 1GJRA 1FNMA 3JQRA 3CCLB 4G1BA 1OGIA 2BVNA 1EFTA 1QUFA 5EMNA 1KK2A 4TMWA 2B7BA 1ZM2A 4N3NA 1BX1A 4PC3A 3CCSB 3ZZUA 3W5VA 3CCEB 3WNBA 1VQNB 2HDNB 3CB4A 1E62A 2VZLA 4P3YA 1KTVA 2RC5A 2QEXB 4LC0A 4B4DA 1B2RA 3CMAB 4FK8A 4FWTA 4RCZA 3ZBUA 3AVWA 1E63A 1ZUNB 2XNCA 1JB9A 2XEXA 1W87A 1N0UA 4PC1A 3CCVB 5TV2A 3LO8A 4ZV4A 1QFYA 1YITB 1G7RA 1W34A 4N3GA 3CC7B 4AC9A 1QGZA 3FJOA 1VQOB 1G7SA 4J0QA 4H9GA 5FA6A 1VQMB 4YHBA 4IW3B 1WDTA 2VNIA 3AGQA 4RCYA 5TY0A 1OB5A 3WNDA 4EH1A 4MYTA 1FRQA 4LBZA 4YAUA 1R5NA 4PC7A 4HE6A 4YALA 2PMDA 4U9UA 1ZM3A 3W5HA 1QFJA 1H42A 1HA3A 3WYAA 1W2BB 1QVFB 2QTZA 2QTLA 3G71B 1OB2A 3JQPA 3VNVA 3CXCB 1SM4A 1JNYA 4F7DA 1EFCA 1QH0A 4RD2A 2NPFA 1G7TA 3AVYA 4B44A 3OJWA 1QGAA 2DCUA 2HCJB 4PGOA 1IB0A 2EIXA 2OK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5U A;  3OZW A;  4TMV A;  1FNC A;  1W35 A;  4M53 A;  1YI2 B;  1GAW A;  1I7P A;  1YJN B;  1DDG A;  3CCR B;  5AN9 A;  1OGJ A;  2C78 A;  2ZIT A;  3AGP A;  4LBW A;  4B3X A;  1EP2 B;  3WY9 A;  4M0L A;  1D2E A;  1GVH A;  1DDI A;  4PC2 A;  1VQ5 B;  3U6B A;  3CC2 B;  1EXM A;  1F60 A;  3CME B;  4RD1 A;  4B47 A;  1QUE A;  4DQK A;  1VQ6 B;  2VNH A;  2DEU A;  2BMW A;  3CRZ A;  4AF6 A;  1JJ2 B;  3AVX A;  1QG0 A;  3OZU A;  4QFM A;  3CCQ B;  4C43 A;  2BM1 A;  1KK0 A;  3CCU B;  1S0U A;  3AVV A;  3E1Y E;  1N0V C;  3MCA A;  2GQF A;  1BJK A;  3FPK A;  3VO2 A;  1BX0 A;  5DSZ A;  2AHO A;  1VQ9 B;  2VNK A;  3OJX A;  1D8T A;  4RD6 A;  1KK1 A;  2YWG A;  4NCN A;  3CCJ B;  5KSW B;  3QFR A;  3QFS A;  2BM0 A;  1UMK A;  3P27 A;  1DG1 G;  5GV7 A;  1KQS B;  1BQE A;  3B8H A;  3SJZ A;  3U6K A;  4B43 A;  2YWE A;  1DAR A;  1GO2 A;  2BGI A;  3WBK A;  1D1N A;  4R71 A;  3QFC A;  4C0S A;  2QDX A;  4B48 A;  3PEN A;  4AF7 A;  4ZCM A;  3W2G A;  3ZBT A;  4QHY A;  2VNJ A;  4HE5 A;  1VQ7 B;  2BSA A;  3CW2 A;  2VYQ A;  1FND A;  4G1V A;  2OTL B;  3I56 B;  1KC8 D;  3WNC A;  5GV8 A;  3OW2 B;  4YAF A;  1Q82 D;  1N8R D;  1FNB A;  1JA1 A;  2BPO A;  1IJE A;  3W2H A;  4BPR A;  4G5G A;  1AMO A;  1CQX A;  4LBV A;  4ZGQ B;  1YJ9 B;  4DQL A;  3W2F A;  2BN4 A;  2HMA A;  2GPJ A;  1Q81 D;  2C77 A;  3J81 k;  2DET A;  1R5B A;  1KJZ A;  2YWF A;  3G4S B;  1YJW B;  1M1K D;  4K1X A;  4ZCL A;  3V76 A;  1NJI D;  4M4S A;  1EP3 B;  4YAO A;  3CPW B;  1EWY A;  3W2E A;  1VQ8 B;  1Q86 D;  1TUI A;  5HXB A;  1GAQ A;  2QMU A;  1K73 D;  1QVG B;  2PIA A;  1JA0 A;  4RD0 A;  4UAJ A;  1QGY A;  1YIJ B;  1CNF A;  2BF4 A;  1K8A D;  1TLL A;  3ZZ0 A;  2FX3 A;  1KK3 A;  3AVU A;  2CRV A;  1M90 D;  2DER A;  3U2Q A;  4TMZ A;  3I55 B;  3JQQ A;  3VMF A;  4YAW A;  1EFU A;  4TMX A;  3CC4 B;  3QFT A;  1EP1 B;  3VNU A;  3P26 A;  4PC6 A;  3ES9 A;  1VQP B;  1B23 P;  4FN5 A;  1Q7Y D;  2CND A;  3WBJ A;  3B78 A;  2B5O A;  2R6H A;  3LVB A;  1FDR A;  2RC6 A;  1ZM4 A;  1XE1 A;  3E20 A;  4ZCI A;  5JBQ A;  1R5O A;  2J7K A;  3CD6 B;  1A8P A;  1TVC A;  2B7C A;  1XB2 A;  1KRH A;  2XNJ A;  1E64 A;  3CCM B;  4TMT A;  1CNE A;  1ZM9 A;  5TR9 A;  3B82 A;  1TTT A;  5THX A;  2QA4 B;  4M2L A;  4Y9U A;  4NBS A;  3QE2 A;  1NDH A;  4Y7C A;  3ZZT A;  4RJL A;  3AVT A;  3OZV A;  1VQ4 B;  2OK7 A;  3G6E B;  1VQK B;  3ZC3 A;  1ELO A;  2PLF A;  4RD3 A;  2EFG A;  1FRN A;  4ACB A;  1SKQ A;  3WXM A;  1QFZ A;  3W2I A;  4RD4 A;  1VQL B;  1AIP A;  3VO1 A;  2YWH A;  2D74 A;  5H5J A;  2BGJ A;  1F20 A;  2QN6 A;  4WQM A;  2DY1 A;  4Q7J B;  2OTJ B;  1KD1 D;  4ZGN B;  2X3U A;  4TN1 A;  4LBY A;  1K9M D;  1GR1 A;  1U2R A;  1H85 A;  1S72 B;  4M1K A;  1QX4 A;  3MMP A;  2BV3 A;  4MYU A;  2E1R A;  3QSY A;  3MHP A;  4P6V F;  4Y9R A;  4ACA A;  5H59 A;  1G7C A;  1IJF A;  3I1F A;  1J9Z A;  1YHQ B;  1GJR A;  1FNM A;  3JQR A;  3CCL B;  4G1B A;  1OGI A;  2BVN A;  1EFT A;  1QUF A;  5EMN A;  1KK2 A;  4TMW A;  2B7B A;  1ZM2 A;  4N3N A;  1BX1 A;  4PC3 A;  3CCS B;  3ZZU A;  3W5V A;  3CCE B;  3WNB A;  1VQN B;  2HDN B;  3CB4 A;  1E62 A;  2VZL A;  4P3Y A;  1KTV A;  2RC5 A;  2QEX B;  4LC0 A;  4B4D A;  1B2R A;  3CMA B;  4FK8 A;  4FWT A;  4RCZ A;  3ZBU A;  3AVW A;  1E63 A;  1ZUN B;  2XNC A;  1JB9 A;  2XEX A;  1W87 A;  1N0U A;  4PC1 A;  3CCV B;  5TV2 A;  3LO8 A;  4ZV4 A;  1QFY A;  1YIT B;  1G7R A;  1W34 A;  4N3G A;  3CC7 B;  4AC9 A;  1QGZ A;  3FJO A;  1VQO B;  1G7S A;  4J0Q A;  4H9G A;  5FA6 A;  1VQM B;  4YHB A;  4IW3 B;  1WDT A;  2VNI A;  3AGQ A;  4RCY A;  5TY0 A;  1OB5 A;  3WND A;  4EH1 A;  4MYT A;  1FRQ A;  4LBZ A;  4YAU A;  1R5N A;  4PC7 A;  4HE6 A;  4YAL A;  2PMD A;  4U9U A;  1ZM3 A;  3W5H A;  1QFJ A;  1H42 A;  1HA3 A;  3WYA A;  1W2B B;  1QVF B;  2QTZ A;  2QTL A;  3G71 B;  1OB2 A;  3JQP A;  3VNV A;  3CXC B;  1SM4 A;  1JNY A;  4F7D A;  1EFC A;  1QH0 A;  4RD2 A;  2NPF A;  1G7T A;  3AVY A;  4B44 A;  3OJW A;  1QGA A;  2DCU A;  2HCJ B;  4PGO A;  1IB0 A;  2EIX A;  2OK8 A; 
#chains in the Genus database with same CATH topology
 4RLZ A;  1WOP A;  2WPD A;  1UD3 A;  3W5U A;  3OZW A;  5FIU A;  4TMV A;  1FNC A;  3LNN A;  3Q6R A;  1E3Z A;  1W35 A;  4Z4Y A;  4M53 A;  1RQR A;  1YI2 B;  4B3F X;  4Z4T A;  4XLC A;  2HLD A;  1GAW A;  1YX2 A;  2V31 A;  2XOK A;  1I7P A;  1VHO A;  1YJN B;  5KNL A;  1DDG A;  1UD2 A;  1W9X A;  2V7T A;  5CDF A;  5A88 A;  3CCR B;  5AN9 A;  2WR8 A;  1OGJ A;  2C78 A;  2ZIT A;  3AGP A;  4LBW A;  4B3X A;  1EP2 B;  3WY9 A;  2X6W A;  2VBT A;  4RM0 A;  3D26 A;  3SLD A;  4HIZ A;  4M0L A;  4Z4W A;  4UZF A;  2KVO A;  4P9S A;  2ZL6 A;  1D2E A;  4TKO B;  1GVH A;  1DDI A;  4PC2 A;  1VQ5 B;  3U6B A;  2LZJ A;  3CC2 B;  1EXM A;  1WTH D;  5IYN A;  1F60 A;  3SEJ A;  3CME B;  4RD1 A;  4B47 A;  4X05 A;  2X8K A;  4XKV A;  4XOT A;  4XOP A;  1QUE A;  1UD4 A;  2PE3 A;  4DQK A;  1VQ6 B;  2VNH A;  1SKY B;  2QGG A;  2DEU A;  2BMW A;  3CRZ A;  4AF6 A;  2JIZ A;  1JJ2 B;  3CTA A;  3AVX A;  1QG0 A;  3OZU A;  5F4O A;  4X0C A;  3BY1 A;  4X7E A;  2OBT A;  4QFM A;  4P2N A;  3CCQ B;  1Q9S A;  4C43 A;  2XZP A;  2BM1 A;  1KK0 A;  3CCU B;  1S0U A;  3AVV A;  3E1Y E;  4Z1M A;  1W0K A;  4TT3 A;  2WZP P;  1N0V C;  3DDY A;  3OFN A;  3SKB A;  5HKK A;  3PA2 A;  1UD6 A;  2R9V A;  3MCA A;  4YEL A;  2GQF A;  5BSY A;  1E79 A;  1BJK A;  3KEW A;  3ZUG A;  5FNZ A;  3SJP A;  3FPK A;  3VO2 A;  1BX0 A;  1WOS A;  4G6I A;  4XNF A;  4XLF A;  2ZZF A;  4FXU A;  4XKW A;  5DSZ A;  3CES A;  1UD8 A;  4PAA A;  2X85 A;  1MAB A;  1YLO A;  2F4N A;  2AHO A;  1Y0Y A;  3V7A A;  1VQ9 B;  1MRZ A;  2VNK A;  2VBS A;  4WZT A;  3OJX A;  1D8T A;  4RPD A;  4YEJ A;  4RD6 A;  1KK1 A;  2I1L A;  2YWG A;  2ZBV A;  3ZPN A;  2GJK A;  1NBM A;  3BCD A;  4NCN A;  3CCJ B;  2F1L A;  5KSW B;  3QFR A;  2XND A;  4XN3 A;  3QFS A;  4TSF A;  2BM0 A;  1UMK A;  3P27 A;  1DG1 G;  5GV7 A;  2D3L A;  1COW A;  1KQS B;  1OHH A;  1BQE A;  3B8H A;  3GVJ A;  3SJZ A;  4CQJ A;  3U6K A;  4B43 A;  2YWE A;  1DAR A;  1GO2 A;  2BGI A;  3GVK A;  3H94 A;  3WBK A;  2XZO A;  2W6I A;  1D1N A;  4R71 A;  3ONU A;  4QUZ A;  3QFC A;  3CMM A;  3Q38 A;  3GSI A;  4C0S A;  2QDX A;  2P3M A;  4B48 A;  5HZB A;  3ONY A;  3PEN A;  4AF7 A;  3A35 A;  4ZCM A;  3W2G A;  3ZBT A;  4DK0 A;  4QHY A;  4DK1 A;  2VNJ A;  4II3 A;  3ASS A;  4X7C A;  4HE5 A;  1S4M A;  1VQ7 B;  1E3X A;  2OBS A;  5IYQ A;  1T6Z A;  2BSA A;  3CW2 A;  4YXW A;  2VYQ A;  3CP2 A;  1FND A;  4G1V A;  3HAG A;  3ZIA A;  4OPO A;  2OTL B;  3I56 B;  1KC8 D;  3WNC A;  5GV8 A;  2JJ2 A;  3OW2 B;  4YAF A;  4X07 A;  4XON A;  1Q82 D;  4L8J A;  2XZL A;  2DIE A;  2XGJ A;  1N8R D;  1FNB A;  1JA1 A;  2F1M A;  2BPO A;  4X8I A;  1IJE A;  3W2H A;  4ASU A;  4BPR A;  4G5G A;  1AMO A;  1CQX A;  4LBV A;  4OPS A;  4ZGQ B;  4P22 A;  3AST A;  3BQJ A;  1YJ9 B;  5HZA A;  5DN6 A;  1PJ5 A;  2JDI A;  4DQL A;  5BSX A;  3W2F A;  2BN4 A;  2HMA A;  1WP6 A;  2GPJ A;  1Q81 D;  5IYP A;  2C77 A;  3J81 k;  2DET A;  1R5B A;  1VLO A;  1KJZ A;  2YWF A;  3G4S B;  1YJW B;  2WJY A;  1PKV A;  1M1K D;  4K1X A;  4ZCL A;  3V76 A;  1NJI D;  2Z6B D;  1WOR A;  4OOV A;  2X6Y A;  4M4S A;  1EP3 B;  4YAO A;  2CC2 A;  5F4M A;  3CPW B;  1EWY A;  3W2E A;  1VHE A;  1Q86 D;  1VQ8 B;  2GJR A;  1TUI A;  2ZXH A;  4WZK A;  4P12 A;  5HXB A;  1GAQ A;  1Y0R A;  2ZZG A;  5L46 A;  2QMU A;  1K73 D;  1VJS A;  1QVG B;  3ASQ A;  5LMZ A;  1T5E A;  2PIA A;  3A8K A;  1JA0 A;  3R6K A;  4RD0 A;  4UAJ A;  5IK2 A;  1H8H A;  1QGY A;  3ASP A;  1YIJ B;  4PAB A;  2VBV A;  1CNF A;  3H9N A;  2BF4 A;  4E0F A;  1TLL A;  3ZZ0 A;  2FX3 A;  1K8A D;  1KK3 A;  3GIR A;  3AVU A;  2ZBU A;  2CRV A;  1M90 D;  1I18 A;  3A8I A;  4XM3 A;  3FKS A;  4Z4Z A;  3U2Q A;  2DER A;  4TMZ A;  3CPX A;  3I55 B;  3JQQ A;  3Q3A A;  3VMF A;  4YAW A;  4XR6 A;  1EFU A;  2Q6L A;  4TMX A;  3CC4 B;  4QVA A;  5E6T A;  1NB9 A;  2GRE A;  1NB0 A;  3BY2 A;  1EP1 B;  3QFT A;  3VNU A;  3P26 A;  2M5S A;  3SLN A;  3OEE A;  2V7X A;  3ES9 A;  2Q6O A;  4PC6 A;  4XN0 A;  3BNW A;  2VJJ A;  5IYR A;  1VQP B;  3Q39 A;  4OPV A;  4WWV A;  1B23 P;  4FN5 A;  1Q7Y D;  3OP1 A;  2CND A;  3WBJ A;  3B78 A;  2B5O A;  2R6H A;  2D9R A;  3LVB A;  1FDR A;  1H8E A;  4WZE A;  5B6I A;  4X06 A;  3OOC A;  2F43 A;  2RC6 A;  1ZM4 A;  1XE1 A;  3E20 A;  4ZCI A;  3G05 A;  5JBQ A;  1R5O A;  3CP8 A;  4X7F A;  2J7K A;  3CD6 B;  1A8P A;  1TVC A;  2B7C A;  4QVJ A;  3A3G A;  1V0E A;  2WYR A;  1HZE A;  2GJP A;  1XB2 A;  4RDK A;  2WSS A;  2GK7 A;  1KRH A;  1EFR A;  2XNJ A;  1E64 A;  3PUM A;  2X6X A;  3CCM B;  2ZXI A;  4TMT A;  2OBR A;  1CNE A;  1ZM9 A;  5TR9 A;  3B82 A;  1TTT A;  5THX A;  2CBX A;  2QA4 B;  4M2L A;  1PJ7 A;  3OE7 A;  4Y9U A;  1VLY A;  4NBS A;  1E1Q A;  3QE2 A;  1NDH A;  4Y7C A;  5TRD A;  3ZZT A;  4RJL A;  1KMH A;  3AVT A;  3OZV A;  2C4U A;  1VQ4 B;  2OK7 A;  1N07 A;  3BCF A;  3G6E B;  1OB0 A;  2DOG A;  2V7W A;  2V7Q A;  3BC9 A;  1VQK B;  3ZC3 A;  1T6X A;  1WSR A;  1ELO A;  5A89 A;  1BPL A;  2PLF A;  4RD3 A;  4OP7 A;  2EFG A;  1FRN A;  3T56 B;  1SKQ A;  3WXM A;  4ACB A;  1QFZ A;  3W2I A;  4KKT A;  2V4D A;  4RD4 A;  4QV2 A;  1AIP A;  1VQL B;  3VO1 A;  2YWH A;  2D74 A;  5H5J A;  1W0J A;  1NRK A;  2BGJ A;  3A3B A;  1F20 A;  5FO0 A;  2VBU A;  3ISX A;  4P3I A;  2QN6 A;  4WQM A;  2DY1 A;  4Q7J B;  2OTJ B;  1KD1 D;  4ZGN B;  2X3U A;  4TN1 A;  2D3N A;  4LBY A;  1K9M D;  1GR1 A;  1U2R A;  1IHM A;  3OPO A;  1HVX A;  1H85 A;  4XQF A;  4Z4V A;  3A8J A;  4XOR A;  1S72 B;  4M1K A;  4B3G A;  1QX4 A;  3MMP A;  2BV3 A;  4MYU A;  2E1R A;  3OEH A;  3QSY A;  3MHP A;  1UD5 A;  2NV4 A;  4P6V F;  4Y9R A;  4ACA A;  1WU8 A;  5H59 A;  4XD7 A;  4DNT B;  1G7C A;  1IJF A;  4II2 A;  1BLI A;  3I1F A;  1J9Z A;  3RY8 A;  4RPB A;  1YHQ B;  1V0F A;  1GJR A;  1FNM A;  1XQB A;  2C4T A;  3JQR A;  1PJ6 A;  3CCL B;  2CF4 A;  4G1B A;  1OGI A;  2C5H A;  2BVN A;  1EFT A;  2X0K A;  1QUF A;  1RQP A;  5EMN A;  1KK2 A;  4TMW A;  5FO1 A;  1KZL A;  1N05 A;  2B7B A;  1ZM2 A;  4N3N A;  3ASR A;  4G7W A;  2E1B A;  2ZZQ A;  1N06 A;  4JMQ A;  4Z4S A;  4P25 A;  1BX1 A;  1K28 D;  2FVG A;  4UZE A;  4P6Y A;  4PC3 A;  3CCS B;  1BMF A;  1WSV A;  4P1V A;  4OOX A;  3ZZU A;  3OW7 A;  3W5V A;  3CCE B;  3WNB A;  2WJV A;  1VQN B;  2HDN B;  5KW9 A;  3CB4 A;  1E62 A;  2VZL A;  3NE5 B;  1KTV A;  2RC5 A;  4P3Y A;  4LC0 A;  5DS0 A;  4B4D A;  1B2R A;  4XLA A;  1WOO A;  2QEX B;  3CMA B;  3GVL A;  4FK8 A;  4FWT A;  4RCZ A;  3ZBU A;  3AVW A;  4GQN A;  1E63 A;  1ZUN B;  2XNC A;  1JB9 A;  4XL9 A;  2XEX A;  1W87 A;  2JN9 A;  1N0U A;  3OKX A;  2V7V A;  3A1P A;  4PC1 A;  3CCV B;  1I8D A;  3R6J A;  5F4J A;  4XMY A;  3PVD A;  2QE7 A;  2X53 S;  5TV2 A;  3LO8 A;  4ZV4 A;  1V5V A;  1N08 A;  3JU4 A;  1QFY A;  2VJI A;  5IYW A;  4AVZ A;  1YIT B;  2V7U A;  3GQB A;  3T51 B;  1G7R A;  1W34 A;  4KKU A;  4N3G A;  2CK3 A;  3CC7 B;  4AC9 A;  3WQZ A;  1QGZ A;  3FJO A;  5J35 A;  1VQO B;  2GK6 A;  2CW5 A;  1FX0 A;  3T53 B;  1G7S A;  4WZL A;  4XLH A;  4J0Q A;  4ROX A;  4H9G A;  5FA6 A;  1VQM B;  4YHB A;  2OYN A;  4G7X A;  4RDL A;  4IW3 B;  1WDT A;  3Q6Q A;  2VNI A;  2ZL7 A;  3AGQ A;  2Q6K A;  4UZU A;  4Z4R A;  1P4M A;  4RCY A;  4X7D A;  5TY0 A;  1OB5 A;  2W6J A;  2WZN A;  3WND A;  4EH1 A;  1E1R A;  2JJ1 A;  4MYT A;  1FRQ A;  4LBZ A;  4YAU A;  1R5N A;  3VR6 A;  4PC7 A;  3FPP A;  4HE6 A;  4YAL A;  4OOS A;  2PMD A;  4U9U A;  1XFO A;  1ZM3 A;  3W5H A;  1QFJ A;  1WPC A;  1H42 A;  1HA3 A;  3PUN A;  3WYA A;  1W2B B;  1T6Y A;  5FL7 A;  1E43 A;  1QVF B;  2ZTG A;  2QTZ A;  3LQE A;  2QTL A;  3G71 B;  2Q6I A;  2ZZE A;  5A8A A;  1OB2 A;  3JQP A;  2C2W A;  3VNV A;  3CXC B;  1SM4 A;  4P26 A;  1JNY A;  3PA1 A;  4DNR B;  4KKS A;  4F7D A;  1EFC A;  2ZL5 A;  4XLE A;  1QH0 A;  4RD2 A;  2C5B A;  2NPF A;  1G7T A;  2DYI A;  4RDJ A;  3AVY A;  3BH4 A;  4B44 A;  5J3O A;  3OJW A;  3LQ6 A;  3KL9 A;  1VF7 A;  1QGA A;  2DCU A;  4Z4U A;  4NNJ A;  2HCJ B;  3OAA A;  4PGO A;  1IB0 A;  2ZTN A;  2EIX A;  2OK8 A; 
#chains in the Genus database with same CATH homology
 3W5U A;  3OZW A;  4TMV A;  1FNC A;  1W35 A;  4M53 A;  1YI2 B;  1GAW A;  1I7P A;  1YJN B;  1DDG A;  3CCR B;  5AN9 A;  1OGJ A;  2C78 A;  2ZIT A;  3AGP A;  4LBW A;  4B3X A;  1EP2 B;  3WY9 A;  4M0L A;  1D2E A;  1GVH A;  1DDI A;  4PC2 A;  1VQ5 B;  3U6B A;  3CC2 B;  1EXM A;  1F60 A;  3CME B;  4RD1 A;  4B47 A;  1QUE A;  4DQK A;  1VQ6 B;  2VNH A;  2DEU A;  2BMW A;  3CRZ A;  4AF6 A;  1JJ2 B;  3AVX A;  1QG0 A;  3OZU A;  4QFM A;  3CCQ B;  4C43 A;  2BM1 A;  1KK0 A;  3CCU B;  1S0U A;  3AVV A;  3E1Y E;  1N0V C;  3MCA A;  2GQF A;  1BJK A;  3FPK A;  3VO2 A;  1BX0 A;  5DSZ A;  2AHO A;  1VQ9 B;  2VNK A;  3OJX A;  1D8T A;  4RD6 A;  1KK1 A;  2YWG A;  4NCN A;  3CCJ B;  5KSW B;  3QFR A;  3QFS A;  2BM0 A;  1UMK A;  3P27 A;  1DG1 G;  5GV7 A;  1KQS B;  1BQE A;  3B8H A;  3SJZ A;  3U6K A;  4B43 A;  2YWE A;  1DAR A;  1GO2 A;  2BGI A;  3WBK A;  1D1N A;  4R71 A;  3QFC A;  4C0S A;  2QDX A;  4B48 A;  3PEN A;  4AF7 A;  4ZCM A;  3W2G A;  3ZBT A;  4QHY A;  2VNJ A;  4HE5 A;  1VQ7 B;  2BSA A;  3CW2 A;  2VYQ A;  1FND A;  4G1V A;  2OTL B;  3I56 B;  1KC8 D;  3WNC A;  5GV8 A;  3OW2 B;  4YAF A;  1Q82 D;  1N8R D;  1FNB A;  1JA1 A;  2BPO A;  1IJE A;  3W2H A;  4BPR A;  4G5G A;  1AMO A;  1CQX A;  4LBV A;  4ZGQ B;  1YJ9 B;  4DQL A;  3W2F A;  2BN4 A;  2HMA A;  2GPJ A;  1Q81 D;  2C77 A;  3J81 k;  2DET A;  1R5B A;  1KJZ A;  2YWF A;  3G4S B;  1YJW B;  1M1K D;  4K1X A;  4ZCL A;  3V76 A;  1NJI D;  4M4S A;  1EP3 B;  4YAO A;  3CPW B;  1EWY A;  3W2E A;  1VQ8 B;  1Q86 D;  1TUI A;  5HXB A;  1GAQ A;  2QMU A;  1K73 D;  1QVG B;  2PIA A;  1JA0 A;  4RD0 A;  4UAJ A;  1QGY A;  1YIJ B;  1CNF A;  2BF4 A;  1K8A D;  1TLL A;  3ZZ0 A;  2FX3 A;  1KK3 A;  3AVU A;  2CRV A;  1M90 D;  2DER A;  3U2Q A;  4TMZ A;  3I55 B;  3JQQ A;  3VMF A;  4YAW A;  1EFU A;  4TMX A;  3CC4 B;  3QFT A;  1EP1 B;  3VNU A;  3P26 A;  4PC6 A;  3ES9 A;  1VQP B;  1B23 P;  4FN5 A;  1Q7Y D;  2CND A;  3WBJ A;  3B78 A;  2B5O A;  2R6H A;  3LVB A;  1FDR A;  2RC6 A;  1ZM4 A;  1XE1 A;  3E20 A;  4ZCI A;  5JBQ A;  1R5O A;  2J7K A;  3CD6 B;  1A8P A;  1TVC A;  2B7C A;  1XB2 A;  1KRH A;  2XNJ A;  1E64 A;  3CCM B;  4TMT A;  1CNE A;  1ZM9 A;  5TR9 A;  3B82 A;  1TTT A;  5THX A;  2QA4 B;  4M2L A;  4Y9U A;  4NBS A;  3QE2 A;  1NDH A;  4Y7C A;  3ZZT A;  4RJL A;  3AVT A;  3OZV A;  1VQ4 B;  2OK7 A;  3G6E B;  1VQK B;  3ZC3 A;  1ELO A;  2PLF A;  4RD3 A;  2EFG A;  1FRN A;  4ACB A;  1SKQ A;  3WXM A;  1QFZ A;  3W2I A;  4RD4 A;  1VQL B;  1AIP A;  3VO1 A;  2YWH A;  2D74 A;  5H5J A;  2BGJ A;  1F20 A;  2QN6 A;  4WQM A;  2DY1 A;  4Q7J B;  2OTJ B;  1KD1 D;  4ZGN B;  2X3U A;  4TN1 A;  4LBY A;  1K9M D;  1GR1 A;  1U2R A;  1H85 A;  1S72 B;  4M1K A;  1QX4 A;  3MMP A;  2BV3 A;  4MYU A;  2E1R A;  3QSY A;  3MHP A;  4P6V F;  4Y9R A;  4ACA A;  5H59 A;  1G7C A;  1IJF A;  3I1F A;  1J9Z A;  1YHQ B;  1GJR A;  1FNM A;  3JQR A;  3CCL B;  4G1B A;  1OGI A;  2BVN A;  1EFT A;  1QUF A;  5EMN A;  1KK2 A;  4TMW A;  2B7B A;  1ZM2 A;  4N3N A;  1BX1 A;  4PC3 A;  3CCS B;  3ZZU A;  3W5V A;  3CCE B;  3WNB A;  1VQN B;  2HDN B;  3CB4 A;  1E62 A;  2VZL A;  4P3Y A;  1KTV A;  2RC5 A;  2QEX B;  4LC0 A;  4B4D A;  1B2R A;  3CMA B;  4FK8 A;  4FWT A;  4RCZ A;  3ZBU A;  3AVW A;  1E63 A;  1ZUN B;  2XNC A;  1JB9 A;  2XEX A;  1W87 A;  1N0U A;  4PC1 A;  3CCV B;  5TV2 A;  3LO8 A;  4ZV4 A;  1QFY A;  1YIT B;  1G7R A;  1W34 A;  4N3G A;  3CC7 B;  4AC9 A;  1QGZ A;  3FJO A;  1VQO B;  1G7S A;  4J0Q A;  4H9G A;  5FA6 A;  1VQM B;  4YHB A;  4IW3 B;  1WDT A;  2VNI A;  3AGQ A;  4RCY A;  5TY0 A;  1OB5 A;  3WND A;  4EH1 A;  4MYT A;  1FRQ A;  4LBZ A;  4YAU A;  1R5N A;  4PC7 A;  4HE6 A;  4YAL A;  2PMD A;  4U9U A;  1ZM3 A;  3W5H A;  1QFJ A;  1H42 A;  1HA3 A;  3WYA A;  1W2B B;  1QVF B;  2QTZ A;  2QTL A;  3G71 B;  1OB2 A;  3JQP A;  3VNV A;  3CXC B;  1SM4 A;  1JNY A;  4F7D A;  1EFC A;  1QH0 A;  4RD2 A;  2NPF A;  1G7T A;  3AVY A;  4B44 A;  3OJW A;  1QGA A;  2DCU A;  2HCJ B;  4PGO A;  1IB0 A;  2EIX A;  2OK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...