4RD6A

Structure of aif2-gamma from sulfolobus solfataricus bound to gdp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
414
structure length
405
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 110
structure length 405
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd6A01
2BMDA 4E09A 1XZQA 4JMPA 2D2EA 4DT1B 5BWMA 2C03A 3B7GA 1ZC3A 4MH0R 2WMOB 2O8EA 1I2MA 4TTQA 4KFTA 2O5VA 4B3DA 3CRMA 2OTLB 3PG5A 4JVSB 1UBGA 2BMEA 1MABA 3H84A 4RZXA 3TUIC 1K8RA 1ESMA 2PZGA 3RS5A 3O8CA 3SN6A 3N2IA 4TZ6A 3H2YA 1U8YA 4PANA 1R8SA 3ZJYA 2YNMA 3LBNA 1I7PA 2O0JA 2BKEA 1H85A 1ZCAA 2KSQA 6Q21A 2H16A 2EQBA 5HE9A 4D0LB 3V4RA 1F60A 3A37A 1KKLA 4JLOA 3VKHA 4YDSA 3SHWA 1QGYA 2HMAA 721PA 4MYCA 3T61A 4HZUB 4W7SA 2EFCB 2C2HA 1YR9A 2BBTA 1D2EA 4BFUA 5JSZA 2Z43A 2J7KA 3GLGA 5JHHB 3U60B 1OIXA 4Q4AB 2O0KA 5FR2A 3FJOA 1JBKA 2E1RA 5L8VA 2OFWA 2IYRA 4G5GA 5DLQC 4DSUA 1OH8A 2WKRA 4HI0E 4LJ6A 1NN5A 1G7SA 1T91A 3JZMA 1S8FA 5FL3A 2BMWA 3CRRA 3A1UA 3PUZA 4LHVA 3K9HA 2F3RA 1CNEA 1GDDA 1T6NA 1R10A 1W47A 1E9EA 3TSWA 3TRFA 3CC2B 2OFOA 1IXZA 3QPUA 4P4UA 3DL0A 4PSAA 1XEWY 2PMDA 4C3ZA 1HQYE 2RGAA 4FXPA 5IK2D 5F9HA 2WJHA 3OEEA 2NZ8A 3EPJA 1AA9A 1T3SA 4PAQA 4CEJB 1F2TB 2WIBA 1TADA 5AJXA 1KO4A 2BC9A 2EU8A 4KV9A 4PPGA 1E32A 4V02A 4G3XA 5EXTA 3CF0A 3SBDA 4JLVA 3M0EA 3PENA 1U0HC 4PHTA 4HB0A 1G1MA 4L8GA 1R4AA 3THWB 1RRCA 1KI3A 1U0LA 1E9AA 1H8HA 3U7EB 621PA 3GLHE 1ZM4A 5GJCA 2F9MA 3DM9B 3K1JA 4F91B 4MGZR 5AWFC 1WXQA 2OBLA 4LV5B 4Z54A 1JR3E 4D25A 2P67A 5HKKA 4F4IA 4X8LA 1GAQA 2CHQA 1CR2A 2J87A 1BIFA 4W5JA 4Z1MA 1PVOA 2WWXA 4A36A 3BOSA 1H42A 3GLIA 2XAUA 2QDXA 3TIFA 3MD0A 1A8PA 5AUQA 3U3KA 3ZQJA 4QBIA 4IOMA 3KFVA 2ZI3A 1NN3A 3L0IB 1P72A 1XP8A 4QBHA 3SJZA 5HE8A 1FTNA 1P9NA 4DVGA 3NIBA 4MUBA 4JLKA 3VR6A 4A8JB 5JCPA 1N0UA 1TEVA 1XF9A 2FJUA 2J46A 5EE9A 3CPWB 3CCLB 3U44A 5FOXA 2WPDD 5FTMA 4DLZA 1E0KA 2D2FA 2I1QA 2RC5A 1OFIA 5D3MB 2GEDA 2BGIA 4A82A 2DEUA 5AR1A 4JLAA 3BH0A 1DE0A 2CLCX 3GP8A 1G3RA 3LXRA 5FA6A 4NPHA 5FPHA 1Z0DA 1SXJB 2QPTA 1CRQA 3L8ZA 3WYGA 1W46A 1WRBA 4R2IA 1T3LA 3WXMA 4DB2A 4P32A 4BLRA 2G6BA 3W2FA 4BFVA 4K1XA 4Q4JB 4TT3D 4X8HA 1E9DA 4EPTA 4Q9KA 1FX0A 3EW9A 2ZYWX 2A78A 4IVQA 2IYUA 5E3HA 4TN1A 3SHFA 1LTQA 5JJIA 4HZIA 4K46A 3FKQA 1S72B 4NZYA 2JASA 3K0FA 2GAAA 2R62A 4RFVA 5A0FA 3GEIA 3TE6A 3BB4A 2ZR0A 1UFQA 3Q8XB 4PSKA 1YZNA 1I4LD 1SKYB 2CK3A 2W2TA 2ZETA 4LJ9A 2RGDA 2VNKA 1RYFA 2WOJA 3HP1A 4TYWA 3LRPA 2EFGA 2OK8A 1E0SA 1E98A 4EPWA 2KJQA 4TYNA 1RZ3A 4OI0A 2VHUA 5LB2A 4DDTA 3EPKA 3I5YA 1RPZA 4UNNA 3QG1A 2KE5A 1B0UA 1X86B 4GP6A 2VHQA 3C4JA 1ZUNB 1Z0AA 2H57A 3RS0A 4KLZA 3SFVA 1Z6XA 2G77B 4B34A 4HAUA 4BWYA 3KFXA 2XZLA 1YZUA 2D7DA 1OH6A 4XH9B 2G0NA 1O87A 2D06A 1VDZA 1N6PA 1FRQA 4IOKA 2OBMA 5GADl 3WMGA 2GZDA 2V1XA 3HJNA 3PITA 4JLJA 5H68A 4QM6A 1GTVA 5FTNA 4J0QA 1XMJA 1FUKA 3BAFA 1F2UA 4A15A 2GKSA 3I55B 1QHYA 1TQ4A 2HXYA 4FMBB 3X1DA 1XCPA 2NMVA 3HYTA 4GBMA 2F43B 5BN4A 4Q18A 1P5ZB 3QFCA 4Y9UA 4R7ZA 2FWRA 2CLDX 3F0TA 4NL4H 1Q1EA 3CBQA 3NTUA 2QTLA 4XSHA 3NDPA 3TR5A 2O8DB 4RFSB 2V7QA 4AKEA 1Z2AA 3JZAA 5JI2E 4JBXA 4XTCS 3IBYA 3VU9B 4EJSB 1J99A 1CF4A 4FD2A 1BMFD 1IONA 2HCBA 2R6AA 1TF2A 1SXJD 1DS6A 4Q9IA 4MKGA 1VQOB 1D1NA 4FMCF 3DEFA 4AKHA 2ZM5A 4H9GA 4JKIA 1IN4A 4R71A 3MJHA 4Q48A 4MITA 4TMXA 2FSIA 1R7RA 5SZIA 4JVLA 3SYKA 3ZGXA 5KU1A 4ASUD 5HXBA 1YRBA 2BCJQ 3FMFA 2CL0X 3BBPA 1P2VA 5EXXA 4XIGS 1G3QA 3GFPA 3IDQA 4WIAA 3BFXA 3BH6A 4M9QA 1KMHA 2FH5B 2XXAA 1W4BA 3F8TA 2GZHA 2OTJB 2A5YB 4QC2A 1HUQA 2Z4SA 4M9SA 3BFVA 4RVCA 3E2IA 5FOUA 4EUNA 3QEJA 3IGFA 3RS4A 2GILA 1KI6A 5BYJA 2OCPA 1KZGB 4US1R 1KO1A 4IOLA 4NYIQ 1ZU4A 2NO9A 4LJAA 4D0GA 4TZ0A 4UNQA 3KKMA 1GNRA 4V0NA 4DEXA 2HYIC 5JFGA 3UMRA 3CCUB 1QVGB 3FYHA 2IYVA 3GLHB 1Z3IX 1KSJA 3ES9A 1MO6A 1Z5ZA 4Q1FA 4Q7LA 2QAGA 2R65A 5J4LA 5HR5A 2QTFA 1VQMB 1NG9A 4PX9A 1Z0FA 1P60A 1PV4A 1X6VA 1N0VC 5IK2A 4N0EA 1YZGA 4M1WA 1Q1QA 3TK1A 3QXCA 2OAP1 4Q4HA 2GESA 2BVNA 3Q7QA 3CCEB 1IN8A 3KX2A 4WZ6A 1B2RA 1DAHA 1OKKA 4GRAA 2W6IA 4IVRA 3UWKA 5CJPA 1OW3B 1NKSA 3CKLA 2CVFA 3QUSA 4YLGA 5TARA 4WZBE 2OILA 2HLDD 1XPOA 1KDTA 1IHUA 5EE3A 4JYBA 4TQ9A 1Z8FA 4IDOA 1AIPA 4EIWA 1CJTC 2DFLA 1ANKA 2ZRIA 2BDTA 4Y0VA 3A6PC 4UNSA 5AJWA 4L9SA 4B74A 2GCNA 4LYFA 3TW4A 1EWQA 2XITA 1DELA 3Q85A 1JPNA 3ONWA 3TR0A 3P27A 4ZDIA 4G01B 2HT1A 1L4UA 3CNLA 2MMGA 4B32A 3LVQE 2QEQA 1DAGA 2QGNA 2FOLA 4QRHA 2Q3MA 1FP7A 2EWWA 3EA5A 1XMVA 1NJID 2RKOA 4Q1AA 2FE4A 3V4FA 2V6IA 1ZJ6A 2VP0A 2W6JD 5GJBA 3SE0A 3SJCA 1I2DA 1II9A 4LOAA 3D6TB 1NN1A 5DSZA 1VQNB 1KDOA 2ZE8A 3SU8A 2ZYVX 5CLLA 4BEBA 1HYQA 1FPMA 4MRNA 5FUVA 1A1VA 1XDBA 1N25A 2OESA 4F4JA 4JVNA 3AV0B 4BASA 2GCPA 2NO0A 5B64A 4CEIA 2B5OA 1KRHA 2YWHA 4U02A 3GLFE 3NBFA 2NO1A 3CZQA 1R5NA 5P21A 4CRWB 5JZVA 3IQXA 3LW7A 1EG7A 1UAAA 1Z2CA 1YJWB 2IT1A 4P4SB 4LBVA 4Q4AA 1UF9A 2BBOA 4E03A 1RW4A 3EPHA 4NCKA 5B2ZA 1XMSA 5DI9A 3FWYA 3EC2A 3V76A 1R6BX 3I73A 4I4LA 4QXAA 2C5LA 2HF9A 3ZZTA 2W2VA 1KI1A 3A36A 4AF7A 4TMZA 221PA 1FQKA 2VRWA 3DOFA 4BGDA 1JR3D 1XPUA 3GPLA 1ZNWA 2QGZA 2WSSA 5CLQA 4B44A 2FPLA 2FPKA 4CEHB 3ECCA 1CR1A 3MAAC 3W5UA 5A4JA 2IXFA 1XD2B 3SDZA 1QRAA 2NTYC 1VCIA 2J0VA 2HV8A 2QTHA 1E9RA 4NH0A 3NEYA 3Q7PA 3QPVA 1KI9A 2ZSDA 4ESHA 3LV8A 1E2JA 4HE5A 1D9XA 4JSYA 3EIEA 1GRNA 5F3WB 1U81A 1TTTA 4EH1A 3K0AA 1IJEA 1XEFA 1GNPA 4JVMA 4KLNA 1N6KA 5J4HA 5DN6A 3AVVA 1R5BA 2YWFA 3GQBA 4DSTA 2AWNA 3VR3A 4BE7B 5CITA 2XJ9A 1QZXA 4B4DA 1HY3A 2ZS9A 3VKWA 1NLYA 2OCAA 5JS7A 4DLRA 1RJ9B 3TH5A 2XNSA 4A0FA 1CRPA 1W2HA 2QA4B 4F93B 1FNDA 3GCGA 4LHXA 3UIEA 4YAOA 1AKYA 5FBWB 5FBVB 4UXJA 1MT0A 1HURA 1OH7A 4DLTA 3N70A 4ARZA 2VHJA 5DO9A 1N3BA 1NI3A 1VECA 2ZSFA 1ZP6A 3IEUA 1BYIA 2GA8A 2ZE7A 4Z8XA 1XXHE 2YKGA 4B2PA 1S4QA 5G53C 2EFHB 1KI4A 3UG6A 3NDBB 1UJ2A 2IL1A 2PMKA 2XTNA 1YZLA 2GEUA 3E1SA 2J3EA 2O0HA 2HF8A 2QG6A 1Q86D 1CS4C 2BKUA 1W44A 1JJ7A 2CBZA 5THXA 4Q1DA 4YMWA 2ZTSA 3W6NA 3CPEA 3R7WA 2CCJA 3B1VA 1MO3A 2GBLA 4RD6A 2H18A 1DAIA 1JAHA 4LHWA 2DBYA 4TYPA 121PA 4PC7A 2C9CA 4YDHB 5DNYB 1JEEA 2QY9A 4D0NA 4LJ8A 3U7HB 2AXPA 1WA5A 2RGEA 4Q4JA 1R2QA 1GKUB 4PXAA 4LV8B 4URUR 4A0GA 5KNDA 2GXSA 5E7JA 5BW8A 1JA0A 4LHYA 3L8YA 4ZGQB 1PLLA 1XEWX 4OK6A 3TSOA 3TGPA 1OFTA 4JT2A 1OXXK 4NYMQ 3CCSB 4Q66C 4LBYA 3VO2A 2ZRBA 3OIWA 4P33A 1VYUA 3IIJA 1E2PA 2BIFA 1KDRA 1LS6A 1RRFA 1K73D 5JMTA 1T8UA 3BS4A 4YONB 3C16C 4EFLA 2WKQA 4AK9A 1HTWA 3GEHA 1AK2A 2XEXA 3KKQA 2Z5FA 1Z0JA 3R20A 4C7OA 3CRZA 4MGYR 3QE0A 4V03A 2IS1A 1T3HA 5FPSA 3RC3A 1MV5A 1KGDA 2H5EA 4Q02A 2AFIE 5JS8A 3JQQA 4JLNA 1G18A 5BXQC 5KNBA 2V1UA 3VO1A 2IXGA 1F6BA 2YZ2A 3VNUA 1IB0A 2ORVA 4JJZA 4CZ2A 4YXWA 1E2DA 1TX4B 3WNBA 1QGZA 5J4YA 3VTKA 3TW8B 4TSFD 1VG9B 3M6AA 2O8FB 3IKJA 1OGIA 1XTJA 5KOYA 4OQXA 4A6PA 4XWKA 4JKYA 5AK0A 1ZM2A 2CNWA 3AF2A 4AG6A 2JLYA 4YAUA 2CRVA 3FKSD 3PUWA 4KHZA 3R9IA 5J4KA 3WMEA 5IHPA 2FA9A 2G0TA 2WAXA 5JHGB 3ZD7A 2CDNA 3JQRA 1ZM3A 3SJAA 2G83A 4C0QC 4M2LA 2BN4A 2R6DA 4TYQA 1H8ED 2X19A 1M90D 3V9PA 1VQ6B 4JL6A 3P20A 1ZNZA 2E87A 3G0HA 1P75A 1P73A 5EUQB 1ZD8A 3HWSA 3ZC3A 1P9WA 1JXOA 3CWQA 2CJWA 2XTMA 3T1TA 3OIUA 3IO3A 4FW9A 4XTRA 3NBXX 3VHLB 5FOSA 1UPTA 3R9WA 2BBWA 3IIKA 3UATA 4KAXA 3ZS8A 3ZYCA 5JI3E 1GWNA 3GMTA 4N1AA 1DDGA 1A5TA 2FG5A 5FBRB 3U4QA 4WOPA 1DAEA 3GLFB 1SVWA 4C0BA 3PUXA 4EDHA 4Q1CA 4ILEA 1AQYA 3P4XA 1Q1BA 3RHFA 3RRMA 4QJ4A 4B71A 1RYHA 3QKRA 5FI1B 1GKYA 2XNDD 3OAAA 5CYPA 2BMJA 4B48A 1GUAA 1Z06A 3FTQA 3CCVB 2HUPA 2WWIA 4CDGA 2ZRPA 5H70A 1UADA 4PTLA 1UMKA 3OJWA 2W6JA 4OI4A 4DSNA 3KB1A 5EP4A 3KZ1E 4KODA 1UKEA 1IQPA 3ND9A 2HEIA 2R6FA 4O0MA 2GZAA 2CMKA 1TL7C 3KQUA 2C9OA 4I1VA 2Q3HA 3B60A 1X3SA 2VYFA 4Q19A 3CF2A 3NKVA 1G7CA 5FPTA 1JECA 1KYIA 3ZH9B 1JEDA 2QPOA 4Q9LA 3LLMA 4XVRA 5K8IA 2W83A 4RZ2A 5JLJA 1G4UR 3W5HA 3EPLA 4OHXA 3K70C 3MWLA 2IC5A 2GF0A 2GWHA 1CIPA 1EFRA 2QM7A 1G8HA 1P9RA 2FU5C 2ZAMA 4KBFA 1P2SA 2JJ8A 2ZU6A 3CCMB 1QHHA 3W9YA 1F5NA 3CLVA 3L82B 1A4RA 1ZIPA 2OK7A 1ZIOA 2MSDB 2ZJ2A 1Q7YD 1M6NA 4M22A 4AYTA 4ZKDA 3ADBA 3BIFA 2WJJA 1U2RA 1CLUA 3TSZA 1E2QA 3KL4A 3IIMA 4TL8A 4UXHA 1UBCA 4AKGA 1YQTA 4K81B 1Z6GA 4Y9RA 3PV0A 3LQRA 2VNHA 2GHIA 1XEXA 2OFXA 1CEEA 1KY2A 1G5TA 5KNCA 4P31A 5FH9A 1JJ2B 4PPFA 1WB9A 2JLRA 3FPKA 2FSGA 3CW2A 3P26A 4M4SA 2R6CA 4ZPXA 1OGJA 2DPXA 3FVQA 2B21A 4PPNA 1KMQA 3SOPA 1GM5A 1KNXA 1KAGA 3KXLA 3P1JA 2A7QA 2NZJA 2J7PD 3SBEA 1XD8A 4XWAA 1QFJA 4JLPA 3ICQB 1XXHB 4MKFA 4MYTA 3NHAA 2F1HA 3M1IA 4KITB 4DSOA 4IXMA 3CMEB 1II0A 1TNDA 2REXB 2PEYA 1ZM9A 1P7CA 3MWKA 4B33A 4D4MA 2AXNA 5EJEA 2NPIA 2JLSA 3GJ8A 4IDNA 5GVRA 3W2HA 1NJFA 3K0CC 3RNLA 2O8CA 4M21A 2QP3A 1TAGA 1ZNYA 2P0EA 4DUGA 2KI5A 1TVCA 2PZFA 2QBYA 3AVOA 4O25A 1E2EA 4LV6A 2NQ2C 3TQFA 3WP0A 3PEYA 1U8AA 1XTRA 3PVSA 3TVDA 1U90A 4RCZA 2ZXUA 2WWYA 3DZ8A 2ZIAA 3UMFA 1J7KA 4MDEA 1D8TA 2GCOA 4M8NE 3QVUA 1F48A 4NYJR 3W3AA 5EE5B 5FOVA 4MYUA 1W4AA 3AF0A 1ELOA 3PEVA 1T0HB 3RWMB 1S1CA 5FPKA 4E22A 1XZPA 2F9LA 3IBGA 4MRSA 3CB4A 1VQPB 1IN5A 3C8UA 3DM5A 3QXJA 4XVQA 3W90A 3G6EB 5DHFA 3BWDD 1EFCA 1K9MD 3HU2A 4IHQA 2Z83A 4UJ5A 2GEVA 3IHLA 4PR0A 2P3SA 521PA 3T1OA 4KFSA 4OYHA 2Q21A 3K09A 5C46F 4G1BA 4HLDA 4IDQA 5TDHA 3IQWA 3FFAA 4U00A 1E2KA 4FCVA 4URWR 1Q20A 3B1XA 3I8SA 3IPYA 2KBFA 1J9ZA 4EAQA 4DLVA 2ZR7A 5TMPA 1ZW6A 4GOJA 1KI7A 2DFNA 2LKCA 1U99A 2WMNB 1OHHD 1BKDR 2QRNA 4C0LA 1NL3A 2OXRA 4DHEA 4BLPA 4Q1BA 1OT3A 1G17A 1IXSB 4WAUA 4AIIA 3B82A 3T35A 1HEIA 4U9UA 1UKVY 1W5SA 1E1RD 2JLUA 2O8BB 3AUXA 1ZYUA 2AX4A 4JZKA 4R98A 4D26A 1GG2A 1MRNA 2A30A 1GVHA 4P4TA 4PQRA 3OE7A 1II8B 4GOKA 1OB5A 2F55A 1GIAA 4AYXA 5ELXA 4ZIRA 4YQFA 3WMFA 5FFMA 4PGOA 1SVLA 1LFDB 1NVVR 4H1UA 3ZDQA 2N1BA 3L0SA 3VR2A 3ASZA 1GL9B 5CJ2A 1M2OB 4ABYA 1KJYA 1JA1A 3VR4A 2J0UA 3IEVA 1XCMA 2MSEB 1KO7A 4G5QA 4IVPA 2VP9A 3QKSB 2UZ3A 4JSTA 5IDVA 2P5TB 2JLXA 1XD9A 1AS3A 1YJNB 1U94A 1VQ9B 2GVZC 5CYOA 3DKVA 1L4YA 2JCSA 4FMDB 3S1AB 2PCLA 3W5JA 1WF3A 1T0JB 1YKSA 1IN7A 2GTPA 3DMNA 4P6VF 4Z8YA 2CCGA 5HCNA 2LKDA 3WRXC 3C15C 3JQPA 4NP6A 2VL7A 2QMUA 4BFXA 3GFOA 2IXEA 1V5WA 3T06B 2WAYA 2OCYC 2VHTA 3GLGE 2VH5R 1E69A 4FIDA 1W36C 1YHNA 1G6OA 2ZRHA 2CL7X 4Q21A 3CCQB 4FINA 2FDCA 2GF9A 5DYGA 3GJ3A 2DY1A 4DCVA 1N2CE 1U98A 5KDLA 3EZFA 2PX0A 2UZIR 1VIAA 1PZNA 4DLYA 3THXA 3WHLA 3DHWC 4RD3A 4TL9A 3B1ZA 4CGZA 2XNCA 4PPQA 3LX5A 4LJYA 4GSYA 3KJEA 4HDOB 1GNQA 3KQLA 4JS0A 2LCFA 3LVBA 3B6EA 3KUDA 2YC4C 3AKEA 2NG1A 2DERA 3CCRB 3A4NA 3WYFA 2ERXA 3ZIAA 3PIRA 4NCHA 3O47A 1S9HA 4UQOA 3LBHA 2ORIA 3SZRA 1E64A 4FWIB 4W5HA 1E2MA 1FP6A 4QJ3A 3QNUA 1US8B 1DG1G 2ZJ5A 2BF4A 3VR5A 3AGPA 2FSHA 5B57C 3KXIA 3LNCA 4BZXA 4ERNA 1DBSA 3LX8A 1GSIA 1SVSA 1Z29A 4AWXA 2QI9C 4D6PA 2FEOA 3WYAA 1SHZA 3QF7A 3SJBA 3TAHA 3VHXA 2OBNA 1AZTA 2IYWA 1NVXQ 2WTUA 2BM1A 3MG9A 3PUYA 1RKBA 2HXSA 2EW1A 1E62A 1YZTA 1B23P 2UVQA 5L3SB 4KYUA 2CVHA 3W5VA 2CE2X 5KPDA 5G3YA 2UKDA 3U7GA 4ACBA 1SQ5A 2JIZD 2WKPA 1GR1A 2PEZA 2QSZA 3KTAB 4S2EA 3GLIE 4OQMA 2MSCB 3TKLA 4LX0A 1F20A 5FL7A 3WHKA 5C4MA 3ADCA 2EYQA 1AJEA 2XZOA 4TLEA 1XU4A 3RS2A 1NY6A 2W00A 3FB4A 1J8MF 2DFKB 3M4YA 4BFWA 1VQ4B 4HUQB 3D7MA 4NHOA 1W4RA 1Z08A 4ON9A 4Z51A 4DLXA 3VNVA 1ODFA 3PXGA 3IUYA 2BEKA 1O3YA 1ZNXA 1N6HA 2J45A 3LVRE 4IJMA 4Q1EA 3WBJA 1NP6A 5KO2A 1DAKA 2R6GA 1XCGB 3CPJB 3RRZA 3TUZC 2FFBA 4JL8A 4LHZA 4PC1A 1CJUC 3OIYA 2BOVA 1G64A 4OQFA 5H8WA 1LW7A 1GO2A 1HE1C 1TQ2A 4QBFA 1NRJB 4PHGA 1FDRA 5EZ5A 2W58A 1C1YA 1N5JA 3VX4A 2P2LA 3ZVLA 1UDXA 3TNFA 3X1WA 1YI2B 1S3SA 4HLUA 3DZDA 4MRPA 1R5OA 5L3VA 5E7IA 2ZROA 1KI2A 2ZJAA 3H86A 1ONBA 4ZDJA 4QFMA 4Q00A 3Q72A 4IOJA 1YR8A 3QOFA 1XE1A 4OKSA 3AF1A 3OZXA 4V0MA 3T15A 1WDTA 2YHSA 3CR8A 5DI3B 4L9WA 4Q7KA 1CBUA 1BO6A 2V54A 2V8OA 1EP3B 4RZ3A 4N0DA 3TAUA 2DCUA 1S96A 4KU4A 5G3ZA 3U5ZB 4OJQA 2BPOA 2GJAA 3AVTA 4TYYA 3RANA 3QG5A 4TLDA 3GJ6A 2ZUCA 4AD8A 2ZRNA 3ADDA 1CU1A 3QY0A 4GMXA 1A2BA 2ERYA 1XX6A 1DG3A 3X1XA 1XFAA 1E2HA 4ITRC 2D4HA 2XNJA 2RMKA 4HE6A 3F3YA 5TR9A 2PT5A 4EQ6A 5IRCD 1H65A 2VBCA 4P3YA 3BC1A 1CULC 1G6HA 1Y63A 2XOKD 1XJQA 1TUEA 1ZVQA 3B1YA 1QHSA 4DCUA 4GOXA 1KD1D 5TVKA 5AJZA 2OAQ1 4HB4A 5AJYA 3KJGA 1QHGA 5EXSA 1D9ZA 3LY5A 1G19A 2B92A 4XWOA 2XB4A 2O8EB 5DIFA 3B1WA 2GAOA 1Z83A 2G1KA 2QSYA 1VCNA 4A4DA 2V4ZA 1MABB 1UKYA 2PLFA 1JI0A 1KJWA 1K5GA 1OXVA 1TQDA 3K9LA 3MGCA 3TVTA 4C0AC 5K8LA 2AKAB 2H8KA 2F6RA 4C43A 2JEOA 3GJ5A 3ZVRA 3UXMA 1K6MA 2D7CA 2IYQA 2IUUA 2ECKA 1KDPA 2G9NA 1E9FA 4OQLA 4PFSA 1NIJA 2L0XA 4OHWA 1COWD 4RJLA 2FFAA 1U9IA 5FUYA 5KSZA 3BB1A 1PUIA 4DT1A 3U61B 3AVYA 5DGXA 3B85A 3SR0A 3E1YE 5LDDC 3VAAA 1CJKC 3A1TA 4H1VA 2JDID 1M7GA 2QAGC 3U3OA 2IEYA 4PZZA 2IW3A 1D2MA 2D62A 4TMKA 4ZO4A 5JSZB 3GLGB 4QGAA 3AH8A 1OYYA 2ODNA 1NMZA 2GJSA 5EE1A 1QG2A 2ZRDA 4JL5A 5CB8A 4QNMA 3BGWA 1G8PA 1E9CA 4IFEA 4U5XA 2HDNB 1YVDA 2FN4A 2NO6A 3A58B 3E5HA 5H1YA 3CMAB 5CDFA 4MUAA 3R8CA 4GDFA 2ATVA 4EKDA 1KK3A 4PO1A 1Z6YA 4A2WA 3OZVA 2WPDA 4HZUA 2JJ2D 4RD0A 1OYWA 4TWZA 1W2BB 4AC9A 1M8PA 2GXAA 1VG8A 3LWNA 1DADA 4L16A 1HT1E 2OLJA 1OFHA 4MGKR 2N46A 3EZ7A 3G71B 4MRRA 4KFUA 3ZBUA 4LY6A 1TQ6A 2J9RA 3OFND 4M1MA 2XB2A 1SHKA 2V9PA 3I8XA 1YU9A 4ACAA 2NO7A 2ZJOA 1XTKA 2ZVPX 4PAMA 4B3CA 1EFUA 1U9IC 3NH6A 4TT3A 3W5IA 5JWRA 4KO8A 3AVUA 1CR4A 1EESA 2R44A 3NBYC 4Q4LA 2AD5A 4JIMA 4BPBA 2QRZA 4IXNA 3O8BA 2ZI7A 3RABA 1SULA 4FN5A 2J1LA 5L3QB 3BH7A 4B43A 1YE8A 4OI2A 3DVLA 1ZINA 3B13B 1UEIA 1IAQA 1OXTA 4I1SA 4OHYA 4CEJA 2WM9B 1F2TA 4IEEA 2A9KA 4BFZA 4CT4B 4RSGA 4CF7A 4Y0AA 1T9HA 4B47A 5LBIA 3QFRA 3VKGA 1UBFA 5L3RA 1R0ZA 4G5RA 4P0TA 2NGRA 3ZLJA 2HYDA 1Q3HA 3THWA 4TMTA 2IS6A 3AVWA 5DYIA 5FUXA 2IX3A 3GLIB 1M1KD 3CX7A 2OE2A 1NY5A 3V00A 1CNFA 2A5DA 4KVGA 3CXCB 4OHZA 2IA5A 2ZVQX 2FZ4A 2W2XA 3QIAA 2GVDC 4DCNA 3KKOA 1QGAA 4QJ5A 1TUIA 2QPAA 3EA0A 4UKDA 1QFZA 2F1RA 4K8OA 2B8TA 3C14C 5FR1A 2O8BA 4FK8A 3HDTA 4DZZA 4AY2A 3DMDA 3THOA 4DDWA 1UKZA 1FNCA 5DE3A 2R2AA 2VTKA 1E94E 3OESA 1II8A 3OZUA 1T8TA 1VKJA 2QQEA 4B2IA 1G21E 5ANRB 3B78A 4C30A 3CZPA 4G5OA 2QE7D 3I3SR 1G41A 5C1BA 4W9MC 4QM7A 1GKIA 3W6PA 3E70C 3T34A 2ZJYA 1TF7A 4PQYA 2QMHA 4A8JA 1M74A 1SVIA 4POAA 1XJCA 1EP2B 1ZD9A 3Q9LA 3OIVA 2ZRLA 1ZAKA 2H7VA 4NYIR 4C2TA 2GPJA 4BUJA 3CH5A 1Z63A 5D3MA 3KQNA 1YRAA 3KJIA 5KYKA 3VFDA 1V43A 3FMPB 2YINC 3AP3A 2SHKA 4M1SA 1ZBDA 1MO5A 1E2GA 2XGJA 5H5JA 4DWJA 1BMFA 1Q1ZA 1FZQA 1XTQA 3CM0A 3K0FB 2QU8A 1SXJA 2YJTD 4OI1A 5SZHB 4JBWA 2V55B 3ASYA 3W34A 1I4TD 1NF3A 5GV8A 4OHVA 4OK5A 5JCZA 3ZS9A 5EUMA 2AHOA 3Q5EA 1YJ9B 4HDQB 3I4LA 1KSFX 3B2EA 1A82A 1IJFA 1ZUIA 1IY2A 2GRJA 4DDVA 4A1FA 1U8ZA 2YOHA 4ZKEA 4ASUA 4A2PA 3THYB 1E6CA 1VMAA 2ZRMA 3ZVMA 3GD7A 2X3UA 2J59A 3UG7A 2IF2A 1FTSA 3HPRA 5FTKA 2ZS7A 3UPUA 3U6BA 2IBMA 3IPXA 4PZLA 1NIPA 3W3ZB 4B75A 2P5SA 2VSFA 4HDCA 5HKKD 5KUTA 1S3GA 4B35A 4ZDKA 1NSFA 1G3UA 4B3BA 5IF9A 2GETA 2JLQA 5EP2A 2OZEA 4URVR 4RD1A 1LV7A 4Z1MD 3TQCA 1XWIA 4EPVA 2CEAA 4US2R 5DISB 2ZRGA 4IFBA 1ZD1A 2GK6A 1S2MA 1QUFA 1UDWA 1KHTA 2J5XA 1F3OA 2ZRAA 1DAMA 1Z07A 1PLKA 1BJKA 2ODBA 1TF5A 2FMXA 4XOIA 1KJZA 3QKTA 1F2UB 1LB1B 2YC2C 1YR7A 4ZCIA 2GBLC 2GDJA 4X8MA 5JWHA 1SXJC 1VIYA 4QHTA 3SC3A 4C0JA 4B3GA 3C5CA 5FTLA 2FEMA 4ZCMA 1G9XA 1XMIA 3SYLA 1G3MA 3HU1A 3QQ5A 2BBSA 4FMDF 3CX8A 1A7JA 2BGJA 3T5DA 4AI6A 2G3YA 4BLOA 4Q9HA 1CJVC 3LA6A 3OZWA 1JR6A 2QTVB 4DLWA 5TV2A 2IF0A 3BJIC 3WBKA 2GNOA 1UBEA 1J70A 2I4IA 3CD6B 1KIMA 3GFTA 1G8FA 3LDAA 1XTIA 1YZQA 4JT4A 1NSTA 1WBDA 3D8BA 1GAJA 2I1VB 2Q0HA 2HCJB 2F43A 2RGBA 3N2EA 2B7CA 3OJXA 1KC8D 3SQXA 4D2IA 3BE4A 5DHAA 2JLZA 2ZI5A 1FMJA 2VO1A 3EZ9A 4MGIR 2HLDA 4RFSA 2O8DA 2XJ4A 3BFKA 3VMFA 2ZU0C 2BJWA 1BS1A 1RRGA 2YOFA 3ZVNA 3QE2A 2GJKA 1ZCBA 1FOEB 3VU9A 2PIAA 4EJSA 2KB0A 1N5LA 1NBME 1W49A 2JLVA 3MFYA 3HPQA 1QVFB 2ZITA 2YYZA 4IRUB 1EWRA 2XXAB 3C41J 3AKDA 5FUWA 3GJXC 4HYYA 4V0LA 4V0KA 2JAQA 4I1OA 4PSVA 5F9FA 5HPYB 3H4MA 4HAZA 1S0UA 2A3RA 3KQHA 1FNBA 1KI6B 2YV5A 2CHGA 2WWHA 3FGNA 4HAWA 3QJYA 4M1YA 4YMSA 1G7RA 5EQTA 4UJ3A 1W7AA 1IM2A 2ZJBA 2F1IA 4D4KA 1Z6TA 1X1SA 3FFBA 4QG7A 1CTQA 4GZLA 2DHRA 1N6NA 3K0SA 4JLMA 1XPRA 5AUNB 2NOAA 4XVUA 4YHBA 3T5GA 3CRW1 2JJ2A 2OV2A 1G20E 2VSXA 3QF4B 4Q7MB 1D2NA 4NONA 1QFYA 5FOWA 4D4JA 2DWOA 4M1OA 1E0AA 2WJIA 4TQUS 3NH9A 3CH4B 3AB3A 4TQAA 3A4LA 1MH1A 1N0WA 2Z6VA 1OIVA 3CO5A 4Q01A 3OFNA 2ZANA 4NCNA 4Q4HB 4LSGA 1KQSB 3GLHA 4LI0A 3AVXA 3QXXA 4XJXA 3ZZUA 2MMCA 1G5PA 2J41A 1JR3A 4NCJA 2BV3A 3KDSE 1ZUHA 4CYMA 2VNJA 4TTRA 2C8VA 2V7QD 2CE7A 4LYHA 1DO0A 3W8NA 2KBEA 3BD9A 1JB9A 3QKUA 2D3WA 2YVUA 1AKEA 2JATA 4O2LA 3K8YA 1E2FA 4NU0A 1CR0A 1P2UA 1DPFA 2Z4RA 3TLXA 2V3CC 2ZRFA 1OE0A 1N6OA 1W0JD 5GV7A 2C04A 3DPUA 1G3IA 4OL0A 5EZ6B 3FDIA 4G1VA 2BWJA 5FBLB 4QGHA 3D31A 5E7MA 2ZSEA 3HR8A 2VA8A 5EMNA 3QXHA 4C0KA 4CT5A 5BYKA 3ADKA 3N5CA 3QENA 2EFEB 2JGNA 2ZS8A 3J81k 8OHMA 2QQ0A 1QDEA 1P2TA 4MRVA 1W87A 4FCWA 2IYLD 1AMOA 2QMEA 4NYMR 3QFSA 2GXUA 2ZE5A 2B7BA 5BN3A 4CEIB 1QHNA 5M04A 1DARA 1Z6AA 3U2QA 2VQSA 3QI2A 4C0SA 4QGFA 4YMTA 2X2FA 5KSPA 4G1UC 2HT6A 2VF7A 1NN0A 3LAWA 4A0RA 4BFSA 421PA 2RAPA 2QE7A 1GL7A 3LH5A 4B73A 1RC8A 2VP6A 1JALA 4KVAA 4MKHA 5UKDA 4WXPA 1M7HA 4KYIB 3REGA 2NPFA 3HYRA 4CIDA 3T1VA 2WZQA 4C9BA 4B3FX 3WP1B 4OJKA 2IS4A 1LNZA 3T12A 1MOZA 1G8GA 3A1WA 3RVBA 2EYUA 1JQLB 4EPYA 4QNRA 2BHRA 4URZR 1OJLA 1XRJA 1Z0IA 4ZCLA 4TL6A 1BX1A 2QUZA 2ASEA 1NG1A 2VP5A 3EIHA 3G5UA 1DDIA 1P6XA 1T5IA 4LWZA 4EFNA 4UXIA 1IXRC 2OT3B 5J47A 1Q44A 4Q7JB 2X1VA 4KSCA 3A8TA 4WW0A 4AYWA 3K9GA 1XBTA 2GJ8A 4KCGA 2WJYA 4LBWA 4LZZA 1FNNA 4R2HA 1OKKD 1Q12A 2W6ID 4WXRA 3CNOA 2G88A 1D5CA 3X1YA 4RKEA 4FWTA 1CXZA 3K0AB 1VHTA 1XB2A 4CEHA 1MO4A 4AURA 3RS7A 4RCYA 1DOAA 4DRZA 1XD2A 4TMWA 1W35A 3L0PA 5C2JB 5L3QA 2ODEA 4WBSA 4JLBA 3KJHA 4OBEA 4TMVA 1Z47A 1S9DA 3UKDA 4QHSA 2I3BA 5J5CA 2RB4A 3MWJA 2OLKA 1E63A 4LC0A 4G5SA 1WMSA 1W0KD 1EK0A 1ZMXA 3EZ6A 5BQ5A 4UNRA 1X8LA 3LLUA 1EFHA 2ZI9A 4PC3A 1QHXA 1VQKB 1OIWA 1Z0KA 4BECA 3K09C 3KKPA 2FPMA 4C2UA 4ARZB 3FOZA 1KZ7B 2FX3A 2W0SA 1E4VA 3WNCA 1GRQA 4TSFA 3AP1A 4HAYA 4AG5A 1OPXA 3ND8A 4Q47A 5IT5A 1X8KA 1RJ9A 5KDOA 1XJ0A 1W2GA 3I32A 2ZI6A 3KB2A 1W48A 4YC7A 1G8YA 2XX3A 5H59A 1YJ5A 4D82A 3FKSA 1WE2A 4TLCA 3EXAA 4S35A 4PO9A 3AGQA 2RCNA 2QP9X 4YALA 2V6JA 4E07A 1A2KC 5JEEA 1E99A 1JJVA 2AK2A 1NNEA 3W2IA 1H8EA 1N8RD 3L2OB 4F38A 3R7WB 2H1LA 3LFUA 5TB5A 1E9SA 3CUEF 2VHCA 2QA5A 4NMMA 1AM4D 2ATXA 3FHCB 3NXSA 2CNDA 2Q3FA 4LBZA 3CPHA 5CB6A 1LF0A 1LS1A 4DLUA 4L15A 4QBGB 1G7TA 5KSWB 3RS3A 5HZKA 2AK3A 1G291 2J0QA 1QBKC 3T1QA 1CQXA 2DETA 1G4AE 2AN9A 2PBRA 1IOZA 4OK3A 1CJMA 3X2SA 2WSSD 2A5JA 1VQ8B 1VG0B 3MCAA 2PX3A 1VCMA 1FNMA 3LW8A 1N6IA 2W0MA 4NDZA 5CK5A 2Q6TA 3EWSA 5KSOA 1IN6A 1NLFA 2BJVA 1RFLA 3QBVA 4D4LA 1L2TA 2OCBA 4HLCA 3G82C 1TMKA 2WHXA 2X8AA 1QHIA 4KXFB 3SYNA 2QT1A 5JBQA 1EFTA 1Z28A 2XNDA 3CX6A 3FMIA 4ZGNB 2JJ1D 4Q5IA 1WBBA 4C7OB 4HB2A 4RKFA 4M1TA 1GRRA 3U3JA 3U6KA 3CCJB 1J90A 2ONJA 3CR7A 4LK2A 1HT2E 1K5DA 2FV8A 4XD7D 3THYA 5DN6D 4ZI2A 1FUUA 2YWEA 3RDPA 3SQWA 4A6XA 1XTSA 4PC6A 3MHPA 3F5FA 2JLWA 2GK7A 4DQKA 3FHTA 3PR1A 4DKXA 3EARA 3RSOA 4DEYA 1GAWA 1G5RA 3I62A 2IUSA 4ZV4A 2VF8A 3SFZA 2C78A 2IWRA 4IDHA 2R8RA 2A5FA 3W6OA 3RC8A 3OEHD 4RY2A 1RE0A 1M1YE 1NDHA 1VG1A 3PQCA 1PUJA 2VNIA 3HR7A 4AF6A 1FMLA 4PHFA 2H92A 1GFIA 1GOTA 2F1JA 3NHBA 4BZQA 1Q3TA 4QOSA 3ETLA 4HATA 2EVWX 1AGPA 2ZAOA 4PQFA 2NIPA 3PEUA 2DFTA 4YAWA 2QNRA 1VCOA 2O8FA 4PHHA 3DKPA 1KTVA 4QHYA 4BQSA 4DCSA 4O3MA 4DIDA 4QL3A 4MKIA 2AKYA 3AEZA 1NBMD 2IUTA 1WQ1R 3K70B 2QL6A 5KPJA 2CJWB 5LB4A 2VSOA 3U3MA 4A92A 1TPZA 5AJVB 3U3RA 1BX0A 4BZPA 2TMKA 1G16A 4HSEA 1MRSA 4M1KA 4QGGA 1NVUQ 3MJRA 2OG2A 2AFHE 2R9VA 1KOFA 1Q22A 2QROA 3R9XA 3U4QB 1GILA 1HV8A 2CL6X 3RSLA 3CIOA 1W0JA 3PFIA 3Q3JB 2IEZA 2J7PA 3QKRB 4URYR 1NJGA 4TTPA 4LPSA 1EWYA 3W2GA 4XSGA 2P6UA 1TLLA 3C5HA 3L0OA 1BYUA 4GZMA 1JXMA 4QKQA 4ZI3A 1W1WA 2DWQA 3KUCA 1ETUA 5C4GB 4YAFA 1E2LA 4MA4A 3ZQ6A 3PJRA 3SEAA 3GLFA 1Y3AA 3QBTA 4HB3A 3U7FB 4IW3B 2RGNA 3A4MA 3IILA 3NVAA 2OUKA 3EWAA 2ZI4A 5EP1A 4BRWA 1OB2A 2HJGA 3MSXA 1AS2A 4Q03A 3CC7B 3E20A 2PL3A 5LD2C 3CC4B 3B9QA 3SS8A 2BEJA 2RH5A 2ZSAA 4BPRA 3QEOA 4YMUA 4LJ7A 4LJ4A 3EAQA 1E1QD 3BORA 2A2ZA 2CLSA 3MMPA 3BK7A 4GMDA 4B6FA 4B76A 4WZAE 4YXWD 2KWIA 2ZUDA 1E4YA 1QHHB 2C99A 3I61A 4JLDA 1TU4A 3L43A 4BLTA 4LRWA 2WV9A 2BM0A 4HLUC 1EX6A 4A2QA 1R8QA 1KO8A 3IHWA 1VTKA 1KK0A 1E79D 4NCIA 2CNWD 2OSBA 2C9YA 3AKYA 1LVGA 3QF4A 1QVRA 4NE2A 3I92A 3BB3A 4BLQA 2EWVA 3KQKA 3W2EA 1XEXB 2OEPA 2X77A 4LPKA 2G1JA 2VZLA 5BN5A 1NMYA 1QX4A 4JYCA 4PZYA 2IYYA 4DB4A 1OHHA 1MKYA 4DLSA 3FE2A 4UNPA 2C77A 2DB3A 3WY9A 2HJVA 5E95A 2RHDA 2FFHA 5LPNA 2RGNC 2CHVA 2ZJ8A 2PH1A 4RD4A 1E1RA 3ZZ0A 1AS0A 1FL9A 5HZHA 3K70D 1UEJA 3MUFA 3I5XA 1NLZA 3PEWA 5CIWA 4B3XA 1JAIA 4M9ZA 1Q21A 3OHMA 1DVRA 2D74A 2O8CB 4DQLA 2CXXA 2VEDA 4BRUA 3LQQA 4KI0A 1R0XA 1GL6A 1L8QA 2QBYB 4D80A 4EPRA 3AM1A 1W0KA 2QEXB 3PCRB 3AVQA 3DOEA 3QPWA 1UM8A 3OAAD 4NTZA 5E4FA 1XXHA 1EP1B 4PC2A 5FTJA 2O52A 3W8RA 5KDDA 5K8TA 2DYKA 2ZYUX 2QMOA 4FCTA 1PJRA 2PJRA 2GCOB 2ZYTX 2WIAA 1GJRA 1KAOA 2Y8EA 4IEIA 5AUOB 1YITB 2EFDB 3ZBTA 2AR7A 3K0EA 3GJ4A 2XSZD 3LO5A 2IHBA 1JPJA 3C7KA 2ZSBA 4GT1A 4HUTA 5B30A 5CIQA 2J0SA 4V0ME 4M53A 1EGAA 2IYZA 3RLFA 3TUJC 3Q5DA 3I1FA 3TJZA 1R0YA 3BRWD 3REFA 4DXAA 3HU3A 1E96A 5AUPB 4GP7A 3SI7A 1WP9A 3PUVA 2EIXA 1EFRD 1VYTA 3AF3A 2K5UA 1E0JA 4TLAA 2WWGA 3CRVA 1VPLA 2C96A 2ZRJA 2GJ9A 4N3NA 1OFUX 5KHOC 1E9BA 1P3JA 5TXGA 4I1UA 1FRNA 3ICEA 1W36B 2QAJA 1DAFA 1CP2A 2RGGA 5K8UA 2FZLA 4RD2A 1P62B 1L7VC 3VQTA 3K53A 4BLSA 3BXZA 2JA1A 5DH9A 1C4OA 2AD1A 1RIFA 1GZSA 3LXXA 2BMFA 2RGXA 5SZJA 4DJTA 2A5GA 5FBQB 3UMSA 2Q9BA 3G4SB 4KFRA 2WJVA 4YMVA 2ZE6A 1M34E 3QXSA 3O8RA 2ZR9A 4KSBA 4DDUA 4ZIRB 2P6RA 2RGCA 4P4SA 2PLRA 2IK8A 2LWIA 2ONKA 3CRQA 4TLBA 1IY1A 2FSFA 2ZQ5A 4HEJA 5GJVC 5J40A 2JJ1A 3RYTC 1EX7A 3UANA 5JJKA 3D3QA 4HAXA 1Q82D 1N5KA 5F98A 1VQ7B 2Q9AA 4W5WA 5G40A 3RRYA 2J0UB 1N6LA 2B6HA 2N42A 5CK4A 1TEXA 2B8WA 4JBYA 3U44B 1E2NA 4IDPA 4XD7A 4BFYA 3EIQA 1MR3F 5AN9A 2QT0A 3EX7C 4KBGA 3CNNA 4ESVA 2VLIA 1OH5A 2ZJZA 1R0WA 2IYXA 2PT7A 4GL2A 4DUGD 4X8OA 4F7DA 2JIZA 3OEHA 4GPTA 1TU3A 4NKRA 3B5JA 3SNHA 1E2IA 3AQ4A 1ZM7A 1BQEA 5B58C 1X1RA 5J4VA 1QH0A 5JECA 2C95A 1BOFA 1FX0B 1XNJA 3QKSA 3WRYC 4BEJA 2QN6A 1KY3A 1AGRA 1VQ5B 1GVNB 5D3QA 4UAJA 3S1AA 2R6HA 4GI7A 5CDFE 2QM8A 2XZPA 1SVOA 3AF4A 3UK6A 4DBLC 3OEED 3THXB 3NC1C 3K9NA 1HE8B 1OF1A 2P65A 3RWOA 5EXPA 5C18A 4LC1A 4LUCA 1NBMA 2AL7A 4EPXA 1W4CA 4WA7A 1JNYA 1DTSA 1OLOA 3CF6R 2DR3A 4ZDWA 5JRZA 1K8AD 4FMCB 2QORA 2GQFA 4C0HA 4LYJA 4C4PA 4Y7CA 1H8HD 1S1MA 2IYSA 1SVMA 1EXMA 3H0KA 3TBKA 2VYQA 3ZD6A 2DWPA 3QFTA 3AP2A 3LD9A 4E5UA 5TY0A 2WWWA 3NC0C 4O2RA 1NVWQ 1LF5A 1OV4A 3EASA 1CKEA 2BSAA 1W36D 1YHQB 1W5TA 1IBRA 1ZU5A 4A8JC 4MDFA 4F92B 3UWOA 1QVAA 1VQLB 2FF7A 5EP3A 1JQJC 4RZUA 3OF5A 2F7SA 1FW6A 2E9SA 2IYTA 4F4CA 2ZRKA 4LJ5A 1KSHA 2RHMA 3OE7D 4PAOA 2IS2A 5A5GA 2WWFA 4LGMA 2F3TA 3O8DA 3JVVA 4NYJQ 1US8A 3DO6A 4II7A 5EE0A 2VP4A 4DIEA 1E3MA 2WBLC 5G41A 1OSNA 4L5BA 1U0JA 821PA 1YR6A 1N6RA 2REOA 5HTKA 3A1VA 3BERA 2WOOA 1QG4A 1KI8A 1P4SA 2OO7A 3I56B 2ANCA 1KSGA 4CVNA 4IKEA 2VP2A 4L4UA 3QVVA 3MRSA 1E1QA 4TL7A 1SGWA 2Q9CA 3X1ZA 2XOKA 4I81A 4BFTA 4I99A 4NBSA 4N3GA 3FHOA 5L3SA 3NBZC 3CWZA 2ZREA 3NEJA 4DC9A 2CCKA 2YWGA 5SZKB 2GXQA 1GITA 4HAVA 3VX3A 1T5LA 5LD2B 3GJ7A 3JVUA 2IHYA 3KTAA 4JJKA 1E79A 1KKMA 1WCV1 1Q57A 2QTZA 4KJZA 3B9PA 3AKCA 3R8FA 2WJGA 2REBA 1KK2A 1X8JA 2OXCA 2YOGA 4V0OA 1KK1A 2IWHA 2OM2A 4B6EA 3GJ0A 4D81A 2FNAA 1AN0A 2BCGY 4WVFA 4HUQA 3KKNA 4LCBA 1AQUA 1ESNA 3TMKA 3IO5A 3I72A 1LY1A 1OXSC 2Z0MA 1KO5A 1PLJA 5JJLA 1KMHB 5GVSA 3DDCA 3NWJA 1COWA 4LDJA 1VHLA 3EZ2A 4DCTA 3GEEA 3MLEA 1Z22A 3LBIA 1YZKA 5CM9C 4Q9JA 1OXUA 3FPAA 3KXKA 2ODWA 5FOTA 3LO8A 1P61B 1NVVQ 5FI0B 3P32A 4EFMA 2OHFA 2CK3D 1C9KA 3RAPR 1VYVA 1J2JA 2JDIA 3EG5A 4WQMA 3NG1A 2QENA 5JWOA 1W34A 1NKTA 3QSYA 1SZPA 1SXJE 3ZIAD 5JRJA 2ZUBA 2FGKA 1BH2A 1Q81D 1T4GA 5JEDA 1AZSC 2ORWA 5CM8B 4US0R 5FPYA 2VPPA 1GP2A 1KNQA 1QG0A 4GNKA 4PO8A 1Q0UA 2QZ4A 1SKQA 4R9UC 4U7DA 1FFHA 1M7BA 1DO2A 1RRPA 4GFDA 1FQJA 2P6NA 2QAGB 2PJZA 5GJWC 3EC1A 2C98A 2ANBA 3A1SA 1QF9A 4EQ6B 2ZRCA 4A0HA 3B8HA 1NMXA 1QUEA 5DI3A 1D6JA 2FFQA 4A9AA 3CONA 3WNDA 2AWOA 2ZPTX 2XTZA 3P4YA 4B2LA 4F7WA 1SKYE 2XSZA 4EJSC 4MYHA 3RRNA 3H1TA 4HLQB 4CW7A 2RC6A 1SVKA 1DEKA 4URXR 1ZRHA 2WSMA 3FMOB 3OW2B 1HA3A 2WICA 3VR1A 1N5IA 4M0LA 4AKIA 1IY0A 3AUYA 1ZC4A 1JB1A 5F2EA 4FI3C 4M9XA 2PCJA 5FL7D 4MQBA 3MWYW 2PZEA 1J8YF 2H17A 3K0CA 1HQCA 1SM4A 4G0NA 1HH4A 1RVDA 5KSYA 5HCIA 1I4DD 2X2EA 1YIJB 5KTYA 2WVJA 3AVPA 4OQNA 2FGJA 2VIIA 4LYAA 2QP4A 2ZEJA
chains in the Genus database with same CATH superfamily
2BMDA 4E09A 3D64A 4YAEA 3Q8MA 2D2EA 4DT1B 2Q4RA 2C03A 5ALSA 2EGHA 4F06A 4X3OA 4B87A 6LDHA 3JTMA 4FYIA 1MABA 3ZJ4A 3HXTA 4PWZA 1K7XB 1E58A 3LUFA 1CQZA 1R8SA 1SELA 4ODIA 2AOTA 4JC8A 2JGKA 4ZVKA 4OKIA 4ZOQI 5BQXA 3MMXA 1UZMA 1T4BA 4HD8A 3R7LA 1RXEA 4FFLA 1H4SA 2VDVE 3PD0A 3V4RA 1F60A 4RPIA 3A37A 1P5JA 1UZNA 3KHKA 1XCBA 3TD6A 1ESCA 3N2KB 3W2TA 1M5UA 1UMDB 1ZI6A 2VYCA 3ZW7A 1JYEA 3E8SA 4CM6A 2JFOA 721PA 4RL6A 2AF4C 1U2DA 2FY8A 2IQIA 4HAOA 5ICCA 2CJFA 1I80A 5AFSA 1B6RA 2YWXA 1CR6A 4GM1A 3VC3A 4BFUA 3FSJX 4C4YA 5E1OA 2J7KA 4JBGA 2X5NA 1QO9A 3ZOZA 1K4KA 5L8VA 1TC1A 3FJOA 1CRZA 1GSOA 3PXUA 2OFWA 1Y5RA 4MX8A 1FFEA 1OH8A 2WKRA 4HI0E 2PUTA 5GQSA 4EGQA 2B37A 2WSIA 2RJ3A 1S8FA 2W6CX 4MMXB 2ZFUA 5ALMA 4GXQA 3VM6A 2BMWA 5EWLA 5ILQA 3CRRA 4E46A 3A1UA 5KQLA 3D7LA 3E53A 3ENWA 2AR9A 4X0EA 3ZK7A 1KEVA 2F3RA 1CNEA 5LMCA 3HJTA 4OFXA 1T1IA 1E9EA 4X06A 3M5WA 3QPUA 1IXZA 5BSYA 3BVPA 2PMDA 4RIIA 5IK2D 3QMWA 6ABPA 4M0EA 1C7JA 1UQTA 3GLUA 1OJ7A 1C1XA 3KOZA 1CSEE 2FJPA 4MQLA 3EPJA 2AJDA 4XYMA 4PAQA 4MGHA 2Z56A 3SKVA 1KO4A 2EU8A 3EUWA 5FB3A 4M0PA 2H63A 2Q9UA 3H4TA 3ODGA 3LT1A 3M0EA 1YRQA 2HIAA 3DE5X 3IUNA 1ZWLA 2EBWA 2EXXA 4L8GA 4RPLA 2G4LA 1R4AA 1RRCA 2PJUA 1K6IA 1U0LA 4HQ6A 3SSOA 1H8HA 2ZBGA 5D7BA 1ZJ4A 3B6ZA 4HX5A 1ILWA 5K0CA 1K7CA 1Q0LA 4L51A 1SBTA 2CXRA 3G7SA 4NVRA 1GFZA 5SYNA 4Z54A 4MUYA 4L4SA 4BV3A 4HOYA 3WGIA 3NTXA 2CHQA 4GIBA 3IUPA 2P4UA 3A9VA 4WY2A 4NWIA 4YI5A 1ZK1A 5JDCA 3GPIA 1BIFA 1MVOA 1VPDA 1SBHA 4LSZA 3AI2A 1PVOA 5HF8A 3EZNA 3ELUA 3LQ4A 1P7ZA 4IQ4A 5MN4A 2Y1WA 3EQ6A 3D2CA 2GWRA 3WJ1A 5AUQA 2J5RA 3U3KA 5CRIA 1BJTA 2B7LA 3U39A 1O95D 3AOEA 5JISA 5DSTA 2WJPA 2ZI3A 1WHTA 1K4MA 3EEQA 4QIHA 3TDMA 3HUFA 3L0IB 2H4YA 1ODCA 1JG2A 1FTNA 1KJNA 1S2DA 3A06A 3BXGA 3I76A 4H4CA 3NIBA 3EFOB 4JLKA 3VR6A 4MQ6A 1F8FA 1N0UA 4LWPA 4TRRA 1KFKB 2J46A 1OBVA 4U3JA 3C6QA 3TOZA 1U2PA 4PLTA 3CPWB 2WD9A 2GBIA 3RSHA 3TB4A 3GFBA 1DQYA 3AB7A 3G68A 1E0KA 2D2FA 4C5BA 4DLZA 1JH9A 5EPOA 3L3BA 1JV2B 5CFQA 3KSBC 1AO3A 3EUEA 3RVNA 1RYEA 1NJ1A 3LGSA 4JLAA 2FPIA 5AR1A 3GP8A 1IZ7A 1H1TA 4HRXA 4NNOA 4AJ9A 2DR2A 1FXWF 2H3EA 4LJLA 4LHSA 1DJPA 1U5AA 5IYZF 1CRQA 3HUTA 5COAA 3NOVA 3QTTA 3RREA 4DB2A 4G36A 5EA2A 2ZTMA 5F1PA 4BLRA 2OLEA 3H9EO 4R7TA 2CVPA 3S5UA 4K1XA 4A6EA 4BFVA 1H2HA 2ZTUA 1ZD3A 4GNRA 5AHKA 1J5PA 4Q9KA 5HRAA 1Q11A 2ATCA 4H7IA 1U7DA 4M86A 4Q3AA 6REQB 4IVQA 3MJVA 3SM3A 2R87A 1M5TA 2P75A 3RQIA 4UULA 3AI1A 3SHFA 1LTQA 2LGJA 4X44A 3DCNA 5A2GA 4HZIA 5ER6A 4K46A 1F17A 3FR7A 4X93A 2WWVD 3DMRA 4F5ZA 4RFVA 4YRAA 1GLGA 3GEIA 4MB6A 1QK4A 3RODA 5AVQA 1VI6A 4PSKA 1XZBA 1NVBA 3FNBA 3RSGA 3PLAE 3H2KA 1JKXA 1WPQA 2C7GA 3CEHA 1Z73A 4F3YA 5KJ6A 1I4LD 2DFPA 5JH7A 3M6FA 3K31A 2W2TA 1ZW1A 3CX4A 4DNXA 4YIKA 3MTGA 1RYFA 3MXTA 2XY4A 5HIJA 5ECDA 2GCIA 3DDNA 1OI7A 4L4RA 4UEJA 2OK8A 2FR8C 2HMWA 4HWKA 5DASA 1KJIA 3AU8A 4DVJA 1B14A 1NW5A 3ISTA 5K5EA 3A28A 2QZPA 4OI0A 1QBGA 2VHUA 1U65A 3GEMA 4TLLB 3VR3D 4DDTA 3C3DA 4G9GA 1ZOPA 4OHCA 2J6BA 2C7RA 1B0UA 2HV9A 2VHQA 2VRCD 3C4JA 5C31A 2GTHA 5FHQA 2MYNA 5AHOA 4N5DA 2LDBA 5E1MA 5CDGA 5CFPA 2H57A 1KH2A 4B34A 2O23A 3KFXA 5T4HA 1YZUA 5GZ6A 1DZ3A 4JENA 2CVOA 3V6MA 5IDYA 1H66A 1JTEA 3M5DA 2P2NA 3JALB 2D06A 2XT6A 1JP7A 3JXEA 4EG4A 2OBMA 4HWGA 1LBSA 2Q3LA 1SG0A 3WMWA 4MQEA 4RLSA 1VHOA 2C5SA 2GZDA 2V1XA 3HJNA 2NUPA 3L0CA 4HF7A 4JLJA 5AVRA 2X53S 1OVMA 3ROMA 2XYHA 5IULC 3ET5A 2ZSKA 1HSOA 5COQA 1U2SA 1N33B 4A15A 3X1MA 2DJ5A 2GKSA 2XODA 1QHYA 3X1DA 3KAKA 4R8RA 3ZOKA 4XYLA 3UMMA 1RLUA 5CD9A 2Y68A 4GM0A 2NMVA 4Q18A 5HF6A 3O4VA 4TKUA 3ZIUA 4LNUB 1SOVA 2FWRA 2CLDX 4TZ0A 3COJA 1BS9A 1DTWB 3BA6A 1MG5A 3CBQA 4XSHA 5C35A 3KUKA 1ZBQA 3NDPA 3IB6A 2ARKA 5E9AA 3TR5A 4LHEA 2V7QA 1Y6ZA 2QLJA 3A9SA 2O8DB 3MW8A 1JQEA 4LX8A 3MCTA 4K9QA 4AKEA 4P1VA 3UW3A 2QGFA 2VTBA 1BS2A 1XIVA 4JBXA 1TW3A 4G5FA 5T57A 2DT8A 1ZJWA 1I7QB 2L18A 3A2NA 2EJCA 4FD2A 4QVAA 5DRTA 2WU0A 3B2QA 2HCBA 1EGMB 1GKKA 1DJQA 2AF3C 3SLNA 3LZCA 3AEYA 1MNQA 3OM8A 3RJTA 4Q9IA 4MKGA 3LS2A 4AKHA 2N3ZA 4H9GA 4FYXA 2Z4TA 4G67A 4R71A 2Q8QA 4BRUA 1XKTA 2QWXA 4LI3X 2FSIA 4Z4SA 5SZIA 3WIEA 2GHTA 3SYKA 4DIFA 5IZCC 2FWNA 1YRBA 1VL6A 2BCJQ 4H1WA 2HR1A 4BFCA 5HZMA 1T1RA 2E18A 3INNA 1P2VA 1QKJA 1DBWA 4XIGS 3AONB 1G3QA 4Y2YA 1J0DA 3SC2A 5B1HA 3BH6A 4IDGA 1KMHA 4M9QA 4MS4A 3ZGVA 1A9ZA 3WL3A 3UCXA 1D1PA 4JB8A 1W4BA 1BE6A 4YJ3B 2A5YB 5F7ZA 1Y1TA 5C8DA 1D4AA 1RXWA 1ILEA 2Z4SA 4WNYA 2ZWMA 1EBUA 3IGFA 1D03A 5KVVA 1ZLXA 2GILA 1RNLA 1UODA 4LYEA 2VCHA 5SYMA 1KDYA 2FJ0A 4HNQA 4US1R 1JDPA 1PFVA 1KO1A 4IUDS 1E1CB 4WLNA 3IP6A 2A9QA 5KWJA 2OMKA 4IOLA 4NYIQ 4LJAA 4KO4S 3W4IA 4DEXA 3AX6A 1GNRA 1NQWA 3KKMA 3QLEA 3GDOA 3WKBA 4CKCA 3UMRA 4D6YA 4LYGA 1FSGA 2FW0A 1QDLB 3CCUB 1QVGB 2NYVA 3HXPA 4PGHA 3OIGA 5CM2Z 1I6WA 3K1TA 3N0VA 4BV8A 2G80A 5ICMA 2YS6A 2A35A 4R40A 3U3MA 4ALJA 1BD4A 3IMKA 4N7JA 4X7BA 3OQBA 4S1VA 4OSPA 1R4NA 4Q1FA 3I6QA 5EMLA 1T26A 4HNAA 1FRFS 2JGEA 2XAAA 3NIDB 3ZWCA 5HR5A 4N76A 2QRJA 5E0OA 1WOOA 1NG9A 3S5JA 1LA2A 1TA9A 4OHBA 4PX9A 1UBKS 1LRLA 1U3DA 1YBVA 3TMYA 1VL2A 3UJ9A 4UM9B 4V1CA 4YP6A 1Z6ZA 4JELA 5A4MS 2B83A 2FWIA 1KIAA 1O6BA 4MV3A 3QXCA 1RP1A 3P9IA 5EWJB 2BVNA 2PX4A 3V2UA 3KX2A 4OUDA 4IFIA 4WZ6A 1B2RA 2ZBVA 1OKKA 3GBVA 4N47A 3CF4A 1OW3B 4MCJA 5K3OA 2QG4A 5F3DA 3O95A 2QRVB 3HUDA 5TRTA 4GRIA 3QUSA 4YLGA 5AM5A 4IYRA 4DR7B 3IESA 1DCTA 1IHUA 4D96A 2AOUB 4IV0A 1U3TA 3TTVA 2QF7A 3FDFA 1AIPA 2HGSA 1HGXA 4AULA 1ANKA 3VOAA 2GS9A 2R6ZA 4ARAA 1N34B 3Q3GE 3A6PC 3ZLBA 1JEJA 1W4LA 4R0NA 2WUWE 2FR0A 3R5JA 1I5OA 3PL1A 4C4SA 4LYFA 3GGDA 3D4PA 1BKYA 1G21A 4NAVA 1GEGA 1SVUA 2K7FA 2BR3A 4MW1A 3CJQA 2ZXFA 3ONDA 1ZSNA 2MMGA 3G0IA 2WZPP 1SB9A 3O74A 3LT2A 4HCJA 4OHUA 8LDHA 2OWEA 4RKYA 5CB4B 4B84A 1XMVA 1FDSA 5EHXA 1K5PA 2V6IA 3OTHA 1ZJ6A 2VP0A 2ZBQA 5IUKC 2PQ6A 4F9TA 5BYAA 4WZLA 1S3FA 3HCFA 2MSNA 3ETDA 4O8ZA 4PYIA 2GPAA 4LJSA 4RO0A 2WAAA 1NN1A 1VQNB 1KDOA 4YP0A 1YTUA 2X86A 2XHZA 4JODA 4RIFA 3N2KA 3U31A 5DNUA 1H2YA 5KX5A 1A1VA 1N25A 4E0BA 1C3EA 4JVNA 3AV0B 2FKAA 4ER0A 3UTDA 3UHOA 3JYPA 3L1JA 1BFUA 2V3VA 4C6SA 4P53A 3FR8A 3PX2A 3I1JA 5K3SA 1R5NA 1LVUA 3H1GA 3C85A 3DR5A 3NGXA 4TM8A 3PJFA 2VHZA 5H83A 3BKWA 1UDAA 1YJWB 5K2OA 2IT1A 4LBVA 1AF4A 3LPAA 3JWPA 2PXCA 2BBOA 4M8IA 4E03A 4CNBA 4FXOA 5CFOA 4GMHA 1CY0A 3BZBA 4KKXB 3RI3A 1UBOS 1C3XA 3AILA 1LC3A 3EC2A 3SZUA 4BN4A 4ZVLA 4I4LA 4QXAA 5JTTA 4RHEA 2HF9A 3ZY3A 2MIIA 1HLGA 3A36A 4EGFA 4JP5A 2G1UA 2WYRA 1XAGA 4CCWA 1FQKA 3DOFA 3UT6A 1TRKA 4YLYA 2CV1A 4R6XA 1UBHS 3STUA 5CLQA 5K6RA 2FPLA 4CEHB 5A4JA 3TEFA 1ZMOA 2IXFA 3C48A 4DFDA 2HV8A 3MBOA 5KYXB 1KP3A 4GVLA 4MYDA 3BYZA 3BHJA 3DMGA 2P9HA 5AESA 2ATEA 1UL1X 3QPCA 3UGKA 2JAHA 7REQB 1QRTA 3V8MA 3G2JA 4ESHA 4RQBA 1KI9A 3LV8A 2WT4A 1D9XA 5F3WB 3EIEA 5L4SA 1ZA2A 1U81A 1V41E 4BTLA 1JT9A 1SCDA 1Z25A 1XEFA 3K0AA 1N6KA 1USKA 2VUSA 3AG6A 4KO3S 1V16B 2WMYA 3A1EA 4BE7B 1PI3A 4Z4VA 1LK0A 2DSNA 1NXTA 1YUNA 1EFVB 3C6KA 4RUKA 3VKWA 3OQ6A 4IDDA 1BDJA 2JCGA 3WLRA 4BNGA 1D7OA 1I3LA 4FQ5A 5A2QA 3GPLA 3AY0A 1RJ9B 3TH5A 3WK7A 5LU9A 4DF3A 1W2HA 4U2BA 2QA4B 1OILA 5EC8A 1KC1A 4F93B 3FUVA 1FNDA 2BELA 3GGCA 4LHXA 4M6WA 4BNDB 5FBVB 4R5HA 4NFSA 4UXJA 2XHEA 3GOHA 3O4RA 2BH2A 2FQYA 1OYOA 4JK3A 1OH7A 3N70A 1L7OA 3HGTA 3TKYA 3KLMX 5DO9A 5CGQB 4FN4A 4BOYA 1RMTA 1P1CA 1SK9A 4ZEXA 1FLNA 1NI3A 2Y93A 5AVJA 4KQFA 1DUIA 3IEUA 5CX1A 3DLBA 3T94A 3BEDA 2GA8A 4BBJA 1XXHE 3KKKA 4HBGA 4EG7A 2YKGA 3RK0A 1KXZA 1OC4A 3A7DA 4LY9A 1CZRA 3K32A 4QVKA 5G53C 2KLBA 3HVKA 4QICA 3RIHA 4H15A 4GOOD 3D4NA 4IH1A 5DGDA 3ROXA 4Q93A 3E9NA 2XTNA 2FG6C 2Q4BA 5T3UA 3T56B 5JCXA 5C5IA 2CXNA 1KXJA 1T2VA 2POCA 4B4WA 2FPPB 4MQMA 5ENZA 1XDGA 2O0MA 2C1EA 1T2NA 3GMIA 1LDYA 5C7OO 2NUTB 1DC8A 5THXA 4NICA 3UYKA 4H3KB 4I4TA 4EF4A 3AFHA 2W4IA 1AHPA 2P5YA 3R7WA 3HCRA 3WYBA 3B1VA 1LDGA 3DP9A 1W8DA 2X58A 1XNRB 2H18A 1GGEA 1QO7A 1JAHA 4NS4A 4ER6A 4RMHA 1U8UA 2NXCA 3H11B 5AM0A 4ZO9A 3ZY5A 3K6SB 2QY9A 3L4JA 1EH5A 3UJPA 4DNPA 2AXPA 2RGEA 1R8JA 2KQUA 4URUR 5TF0A 4OCZA 2WTEA 2RFLA 4FOSA 2GXSA 4HXFB 1MAAA 3VHXB 1JA0A 1TD9A 1XEWX 5AVOA 6NULA 3TGPA 3OSUA 4Q66C 1OXXK 3CCSB 2XNHA 4LBYA 4H3VA 2VK1A 2ZRBA 4JQZA 3O5AA 1QQBA 3DEKA 3RADC 2G06A 1V6AA 1ISPA 1VYUA 4KPGA 3TTSA 3IIJA 3FUXA 5AKLA 3U7JA 4JJ8A 4Z4IA 1CX9B 1KDRA 4G85A 3HB0A 4G0YA 4QASA 5JMTA 1T8UA 1SOAA 1WDKA 4XM3A 2DECA 2VN8A 2ZIZA 2WKQA 3M83A 4KWIA 4UFOA 5CDSA 4AK9A 1IHPA 2QZJA 1HTWA 3B3JA 3GEHA 1YJBA 4H4EA 4XUGB 1KQNA 3NZEA 4MGYR 3LFHA 4BS9A 2JFXA 5LKAA 5MN5A 1KL7A 1T3HA 2H5EA 2HRQA 4UHKA 4Z99A 3DMTC 3DEIA 1U8XX 1ZGBA 1G18A 1JNXX 1ZH8A 3E4DA 2DBQA 4CV0A 4LOIA 3BTSA 5EQDA 1G38A 2WLTA 2FW6A 1E2DA 2XE4A 4F86A 3KZMA 4UVGA 1NB9A 3WNBA 3M6WA 4EQZA 3QWFA 3AB8A 3PHGA 5J4YA 4TSFD 3HKEB 3L46A 4J9UE 5LYJF 1ONPA 1XVIA 2P6MA 1QLJA 3IKJA 3KE9A 3QBEA 3SZ3A 3HM2A 4A92A 5KOYA 5I3ZA 3PDIA 4DR3B 4XWKA 3WSTA 3BM5A 5AK0A 1IL0A 2ZIFA 4XASA 3EGVA 2OZPA 1NXOA 4X60A 4EO4A 2JLYA 3TGWA 1NFQA 1PGNA 2CRVA 2R751 2ZBPA 4MRMB 2R00C 3GEGA 2JG3A 4LXQA 3Q8KA 3R3WA 2OFFA 1T8PA 1RYDA 1FBTA 3Q8LA 3ZWYA 1I3OA 4G25A 3BUSA 3WGVA 3WGGA 3PRKE 3ZPNA 4E5YA 2BN4A 2G67A 1AU9A 1H8ED 2X19A 4FP9A 3ZTYA 1M90D 1GQ2A 1JEOA 1NQTA 1QXSA 2GM5A 3P20A 2OCXA 3ILXA 4MWGA 2GKGA 4HFNA 4RK6A 3G0HA 4B46A 1MVLA 3CBGA 1P75A 3CLKA 3GHHA 1P73A 2VBVA 3KJQA 2Y1KA 3HWSA 4JUIA 5T8KC 4LNUA 3ETGA 3CWQA 3FKJA 3GAFA 2NSLA 2V4UA 2OC4A 3PQ3A 2B1QA 1FYEA 2ZZGA 5JSQA 2H31A 4FDTA 5FOSA 3U1TA 1V1RA 4CPDA 3WLEA 2QRQA 3BE5A 1PL7A 3IALA 4W8OA 3TOCA 1EQAA 1SN7A 2IDZA 2JGDA 1ZGZA 3ZS8A 3WL5A 1B4DA 2BP7A 1V47A 3GMTA 4RSHA 4MWDA 1DAEA 4JI7B 1L4NA 4C0BA 3FI9A 1VFPA 2QVZX 4EDHA 1L7BA 2EKQA 5KYVA 3RHFA 1NRKA 4PZPA 1U3VA 1IEXA 4QJ4A 5K6TA 4H18A 2LR0A 1Z17A 4PS1A 3MZ0A 5L46A 5BVGB 5CLFA 2BMJA 3BJZA 4BNNA 4K9PA 1GUAA 1Z06A 4EUNA 2YMQA 3AIKA 4F9GA 5L7WA 1NNI1 3MJEA 2HUPA 3MTBA 2JEYA 1H0RA 1UADA 3WKCA 1ZMBA 4NU6A 3HBMA 2BH9A 3A1FA 5EP4A 3L6CA 4YCNA 3KZ1E 1UKEA 1IQPA 3IHTA 3ILSA 1LJ8A 3S40A 2C20A 2HDOA 3EEFA 5CTAA 5A71A 3KQUA 3B60A 1X3SA 3MGKA 4YJ3A 1OXMA 5A5EA 1KYIA 2XUGA 3PZBA 4R1OA 4IICA 1XDDA 4EL0A 3COWA 4J7CA 1RM4A 3PXDA 1P44A 1ONNA 2P6OA 3VDXA 4RZ2A 3ZJ5A 4XQEA 4KGVA 3VYRB 4EA6A 2ICAA 2PS0A 3MWLA 2GF0A 1N1MA 2QM7A 4JY7A 3VA7A 5CW2A 3L8MA 5EEHA 3JQCA 1KJ9A 3R3YA 1E6WA 4ATNA 4AP6A 5IHXA 1QHHA 3D4LA 4L4XA 4WOKA 2HTFA 4JX8A 3MTJA 4J6FA 5BUQA 2NSDA 1ZIPA 3DDUA 1KEUA 3ZXSA 1Q16A 4UDYX 4DV7B 2OK7A 1WZIA 1IM8A 1P4JA 2VZ8A 1M6NA 4M22A 1J1IA 3DAGA 5D3ZA 4EZBA 1ZR4A 4KXWA 2P4SA 1TK2A 4UXHA 1VZ3A 2BF7A 1NFFA 2OBFA 1TRHA 2ZT6A 3K8QA 3OMWA 4KX3A 1HDRA 3WX0A 3FTDA 3LQRA 4FS3A 1QV7A 5KNCA 4J16C 3ZV6A 4P31A 3NHRA 1JJ2B 3H5VA 4PPFA 1KU6A 2JLRA 3G17A 3S2YA 2JLBA 3EDQA 1ZXXA 2F1MA 3MWDA 4IHJB 5A3RA 3BMQA 3UPDA 2NAPA 1OGJA 2W5UA 2X0EA 2B21A 2FXVA 2OXTA 5HOEA 2EGUA 3ZLVA 1KAGA 2FP4A 1J2UA 2HLHA 4CMIB 2W2NA 3GG2A 2ZTHA 1WQ3A 4ZXPA 1UIRA 3ZHBA 1XXHB 4MKFA 3AIMA 4MYTA 1HDCA 2F1HA 3M1IA 4BO9A 3T7AA 5TQ0A 3PFBA 3H8WA 2REXB 2AOUA 2PEYA 4I1RA 1VE6A 1KRXA 5JSUA 3KEGA 4ZU1X 1JDJA 4FFSA 2VH2A 4UREA 3B3QA 2JKVA 3NGMA 4IF4A 1JIJA 2QQGA 1DTEA 4Z0PA 3T9FA 4HDSA 3W2HA 4X7CA 3I64A 3QOXA 3RNLA 4M21A 3THRA 3PNBA 4HVCA 4KL8S 4TT8A 2PZFA 2WR8A 2FQWA 2ZVJA 2EX1A 1V37A 4O25A 3R7BA 4LV6A 3BWXA 4YB8A 4WGGA 5DNCA 2YYSA 3ZWDA 2GN9A 4BO0A 3A9TA 3WP0A 1U8AA 3PEYA 4HAIA 3NBMA 3WYCA 3E23A 4DLKA 2Y27A 4EUKA 2FVXA 5CB0A 2BR4A 5DHPA 4ZO7A 2VQ3A 1D8TA 1R8YA 1JJFA 4M8NE 3AMVA 1RLJA 2GD6A 4NYJR 3OCXA 5IVIA 5FOVA 1W4AA 2D1TA 4UBJA 2QU7A 4RTNA 1LPPA 1T5BA 3ONNA 2TECE 2ZQZA 3HFGA 4M7PA 4N39A 1T0HB 3C6BA 1NJ5A 5GMOA 5LA6B 2GLXA 2IV2X 4E22A 1CY2A 1XZPA 2F9LA 5DNEA 1VIVA 4L7QA 4MRSA 2ZJ1A 1IN5A 5EKXA 3QXJA 3W90A 3CZAA 3HZHA 3UKJA 1H1LB 1TAUA 4I8XA 3BWDD 3F3KA 1EFCA 3QEMB 3EDCA 4UBOA 4Q3CA 2P9GA 4UJ5A 5GY7A 5K7SA 4UASA 3OPXA 4YUYA 2P3SA 2W43A 5C46F 3HB1A 4KFSA 3UK0A 1PJAA 4G1BA 1U1DA 2K6GA 2OBXA 1UAYA 3O92A 5TDHA 3RGGA 1UQRA 1E8MA 4FCVA 5FA5A 1U2DC 1Q20A 1N75A 2BHSA 3QOYA 2EKZA 2VXOA 2KBFA 3DUFB 3SSMA 3KSUA 1XDSA 4DLVA 2I6QA 4ZC8A 3TWOA 2PWYA 5JATA 1C9MA 5ADWA 5TMPA 1PZMA 4KAJA 2WMNB 1NNSA 2SCUA 4D1YA 1W94A 3DDHA 1JQBA 4DHEA 2ACWA 5JROA 3JQEA 4Q1BA 1G17A 4KIUA 3RJMA 1MHPA 3N3BC 1MJGA 4HRYA 3BK1A 4NOKA 3V1KA 2G5PA 5JD3A 2H1IA 3PNKA 2I4LA 2YVAA 4JZKA 4R98A 3BMXA 1E1MA 4UHFA 2OWDA 7ADHA 4HQFA 4ZARA 2A30A 1GVHA 3K4HA 4MVJD 1FSPA 3H6HA 4EG8A 1Y8RB 3W0LB 4GOKA 2VXCA 3K20A 1E6KA 4M37A 3AJEA 7MHTA 4N6GA 5IAJA 2C94A 3ZX5A 3RYHB 1LFDB 1OI2A 1NVVR 1RXUA 1T5HX 2PMFA 1DCKA 2YY5A 2HQRA 3L0SA 3NYRA 3ZDQA 7REQA 3ASZA 7GPBA 1FVHA 1VB5A 5IEJA 4MIEA 1KVSA 3ER6A 3PQ5A 4KN8A 5TQJA 3VR4A 2H1FA 1JG7A 2IYAA 3N5KA 1CB0A 1XCMA 1GNLA 2MSEB 4LVNA 3I83A 1W85B 4IVPA 2LRHA 4JSTA 2GN4A 1Q0TA 1FP4A 3NLLA 3TEJA 3OZEA 5JAPA 1XD9A 1ZO8A 2EZTA 3T5MA 2PMBA 1YJNB 4IIGA 3UV3A 3HTXA 3OUUA 1K7EB 4FMDB 1XHLA 4CN8A 2PCLA 4KVFA 3K71B 1WF3A 1T0JB 2WTXA 5BW4A 1EUQA 4Z8YA 2UV8A 3HDGA 3NAZA 1F6WA 1UWKA 2P9BA 2WHPB 4X24A 4RZHA 5HCNA 4D6XA 2VL7A 3A2MA 1J7JA 2V6GA 4WACA 5CNJA 5JCJD 4BNDA 3ZDXB 5IJ9A 4J7AA 3MTDA 5A89A 2RSLA 4N7BA 2FXIA 2QUIA 5JDCC 1X0XA 3T0GA 2AJLI 2J8ZA 2IBSA 5CVUA 5DYGA 4UE6A 2FDRA 2DY1A 2Q5CA 4JEMA 1N2CE 1MIHA 5FBRB 9MHTA 1L5WA 2PX0A 2FB9A 3CNHA 3W1WA 1XTUA 4TTSA 4XI9A 3RKUA 3S1SA 4IX9A 1JG3A 3DHWC 4O4LA 4TL9A 2MSKA 3PF9A 3PVCA 1UANA 3ZU6A 1KH3A 4EB6A 4JI8B 1YRLA 3AOEC 2OHIA 3LDUA 4GSYA 1NV9A 2P2GA 2M9MA 2XNKA 2BHLA 3KJEA 1GNQA 3T6KA 4CLRB 4HWTA 3FYDA 4MAAA 4J1NA 5IWCA 3LVBA 3B6EA 3KUDA 5HQTA 2YC4C 3V7YA 3UZUA 4ZV9A 4XGKA 3OPQA 2WE8A 3A4NA 3WYFA 2D1QA 2PR7A 3ZIAA 3GUHA 4I1IA 4WL0A 3ZIDA 4NCHA 5IXYA 3EDRA 2OCLA 5KVQA 4TS3A 3I1IA 3C3YA 2RIRA 4W5HA 1FP6A 4QJ3A 1LQUA 1CJSA 2IZ1A 3VOTA 4CF6A 4C7BA 1US8B 1DG1G 4A7PA 4FGUA 1O5IA 5AW1A 1DL5A 1U6IA 4LNHA 4ERNA 4L4ZA 1SVSA 3DTNA 4JJFA 1UEXC 4RZQA 2QX6A 5CH8A 4KPYA 4UBKA 1KOJA 3A9WA 4I50B 1SHZA 4O08A 4WLVA 3UMJA 4PN7A 4CIWA 3CVVA 3RW9A 2OBNA 3VHXA 1CFZA 1X7YB 1GHTA 3ORHA 4HVLA 1RKXA 2EATA 4AO7A 2CLEB 1IHYA 2EW1A 1YZTA 1YC2A 5IN5A 1B23P 1UPCA 2J67A 3U62A 1L5RA 3OLYA 2B3DA 4C7JA 3HL4A 4FZVA 1BEUB 3QZUA 2VJBA 3GDGA 2LVBA 4OPSA 2JHFA 3GELA 2NTEA 1GQSA 2JIZD 5BSKA 1KU0A 3KTAB 1UD3A 3GLIE 2CUTA 5HJEA 3DW3X 2HU8A 5KBYA 4MVCA 1JMVA 3TKLA 2WC1A 1YB4A 2J9FB 4O2BF 3RPEA 1V3TA 1K68A 5C4MA 3BD6A 2XZOA 1PK9A 2QRMA 1SVNA 4N48A 3FB4A 2ZGVA 5DFAA 1RQLA 2XUIA 3D7MA 5JIBA 4YY3B 2K2WA 4R41A 2V6BA 1K3UB 1U8CB 3PEFA 9ABPA 4ON9A 4Z51A 2ODAA 3LDGA 4DPLA 1Y7PA 3N07A 3RY8A 2RK3A 3HKEA 4LOLA 4LECA 3V7FA 3R3JA 2BEKA 1ZNXA 1PNTA 2J45A 2Z2KA 3LVRE 3AUUA 3O8OB 4FX2A 3ZWWA 1PZEA 4D8WA 1MF7A 2A5LA 4HDKA 1VB3A 4KB5A 4BP1A 1J23A 5L3ZA 2FN8A 4LHZA 3OJOA 4CDNA 2BOVA 2VF4X 4H59A 2R79A 1ZI8A 1JJAA 2ZPUA 3JR3A 1GO2A 3BDAA 1JPVA 3ASRA 16PKA 2VP3A 1Y42X 3GZNA 4GO1A 2QD5A 2WYWA 1M10A 5AK4A 4C14A 2LCQA 2IH5A 2PZJA 3FLMA 1K63A 4JJEA 3ZVLA 4E7PA 6CHYA 5B4VA 5LUAA 4HVAA 1U1GA 3U3DA 3KD3A 1YDGA 1YKFA 2QKYA 4KRFA 1UDCA 2OV3A 4HLUA 1R5OA 2XUAA 4E0FA 1D1TA 1GXSB 3A10A 1IIRA 3BTVA 3GWGA 4YRQA 4CN9A 3ISXA 4CV2A 1KI2A 4CIYA 1TUBA 1VJDA 1PJ4A 4QO7A 1P4HA 4Q00A 3GLIB 3LL7A 4UBNA 4CM5A 1ARZA 3R77A 2OV1A 1WDTA 4LG1A 5JAMA 5KS2A 4U7WA 2JIRA 5D8DA 4L9WA 5B3JC 3IVXA 3D3NA 5BXQC 1BROA 1PFUA 2VNAA 4TS1A 4N0DA 3ASQA 1DNPA 1CUZA 1RQNA 1RWWA 1ADGA 4PN3A 3Q0EA 1XMOB 3MERA 3SIXA 2ZRNA 5BW5A 3Q7SA 1CU1A 1Z12A 4GMXA 2ERYA 1XX6A 2HU7A 4YQZA 4P34A 3REQA 4KMRA 1G63A 2ZOSA 1KIFA 4U5QA 4W6QA 2HBQA 5AJTA 4J0JA 2XNJA 3OJCA 4HE6A 1BGXT 3F3YA 4A8HA 4JJ7A 2O3QA 1M73E 5IRCD 4ZD6A 1H65A 1FVXA 2IVZA 4EABA 2IZ5A 2VBCA 4P3YA 3PPIA 3NRJA 5DT2A 1ITZA 5JFTA 1REQB 1G6HA 2OL4A 1E4EB 3LXUX 1Y63A 1WTCA 2B34A 2XOKD 5K05A 5FIUA 1ZVQA 3B1YA 4KN6A 4GOXA 5TVKA 4BVJA 2QXTA 1XYYA 4ZQBA 1NDQA 2ZIXB 4EX6A 4Q16A 4S04A 3WGQA 3KJGA 1FJXA 1QHGA 4NAHA 5HXAA 1JHAA 3HE3A 3NHYA 1FXSA 2CHEA 4BKOA 4XUDA 4XWOA 1XHEA 3KJNA 4HX2A 2G9ZA 3H9NA 4QFCA 3FYCA 2XWPA 4X84A 3DBIA 2OO5C 3D0OA 2QSYA 2JRLA 3NJ8A 4A4DA 2ERCA 2V4ZA 3VC7A 1UKYA 2PLFA 1JI0A 1KJWA 2CC2A 1OXVA 3B1FA 3C70A 2VAMA 3K9LA 5ESXA 2R4TA 4B82A 1DLJA 4DMCA 3CCCA 3VZQA 1KC3A 2D7CA 2IUUA 2ZQYA 2G9NA 5ITSA 2HN9A 2P3QA 3ESDA 4ZYXA 4MV0A 3NNSA 1M0EA 1NIJA 1FUEA 2O6LA 2V7VA 1QYVA 5FUYA 1VF7A 3AXSA 4QUZA 3BB1A 4N0PA 1PUIA 3IDOA 4HWSA 2QTWB 1PG0A 3B85A 1PN3A 3E1YE 1O57A 4GLOA 4LIPD 3TYXA 4OXKA 4PGFA 4R81A 5TQ2A 3A1TA 2AQKA 4H1VA 5JJBA 5BSXA 2YIDA 1M7GA 1WDMA 5E3IA 4R2JA 3VUEA 1BH6A 1KEKA 3R0IA 4X1YA 1Y4ZA 2IOYA 1OYYA 2GJSA 1Y4DE 5FRDA