4RD6A

Structure of aif2-gamma from sulfolobus solfataricus bound to gdp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
414
structure length
405
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 110
structure length 405
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd6A01
1P6XA 1KMQA 4YMSA 3U7GA 2ZYWX 4K1XA 4JBWA 4US2R 2K5UA 1W35A 5IHPA 1MOZA 3U6BA 1VQLB 1PZNA 3TQFA 2BV3A 1UFQA 3VNUA 4AC9A 3K9NA 1FPMA 3GLFA 2QE7D 2BSAA 1ZM2A 1NBME 4JYBA 4TT3D 2IXFA 2AD5A 5J4KA 2W6JA 2BMJA 1E2HA 4R2HA 4PSVA 3SYLA 2HMAA 1OH7A 1SXJD 4P3YA 1UDXA 2ZS9A 3CRQA 3OZXA 1KGDA 4PAQA 4TYYA 3LBNA 3T5DA 2BWJA 4KSCA 5AN9A 2BCJQ 3W6OA 3W5VA 1DADA 4LV5B 2W00A 1G5PA 4PAOA 4II7A 1BX0A 4Q01A 1XPRA 4N0EA 3BK7A 4LY6A 4WZBE 1E79A 1YR8A 4HDOB 1WF3A 1GRQA 4L9WA 4C7OB 1GTVA 2PIAA 1MH1A 3R20A 1SVLA 2ZSDA 4BQSA 3QEJA 1A8PA 3A4MA 2R44A 4OHVA 1XD2B 3K53A 1N5KA 5E4FA 2FZLA 3MJHA 2GEDA 3UATA 1DAMA 3CX7A 1T3SA 2IYXA 1JECA 4ZDJA 3TUZC 3U7FB 3ICQB 3SE0A 1G21E 5EXTA 2QAGA 4DT1A 1E9FA 2WBLC 3KKMA 3BH6A 3CCLB 4JLNA 1NBMD 1L8QA 4U7DA 4XWOA 2OSBA 5G3ZA 3THYA 3ZD7A 2GEUA 4PHGA 2FPKA 2MMGA 2P65A 3EARA 4DLYA 4M1YA 2H1LA 3TBKA 3N70A 1E98A 2Z4RA 3ZGXA 2BJVA 5D3MA 1NI3A 1W49A 2GCOB 1JXOA 2PBRA 3L43A 4ZGQB 3DOFA 3M0EA 3QEOA 4BPBA 4IFBA 1Q20A 4W7SA 4MDFA 621PA 1N5IA 3VKGA 1E2MA 5H5JA 2BHRA 1DG1G 1KJYA 1YZNA 1OV4A 2QT0A 3N5CA 1R0WA 2GBLA 4TZ6A 3HWSA 4X8LA 1I2DA 3CMAB 2EFCB 3BGWA 421PA 5B64A 1Q86D 3G5UA 3OAAD 3B1YA 2AN9A 2JJ1D 1HE8B 4M1TA 5AJWA 1OPXA 2XXAB 1JQLB 2Q3HA 4YAOA 3NHAA 3OIYA 1XMSA 2XITA 2ZI4A 4OHXA 3VU9A 3H2YA 1IN8A 2ZR0A 4L8GA 4AYWA 4C0SA 1Z07A 1U8ZA 1G8FA 2NO1A 4CEHB 1CR0A 2DFKB 2WWIA 4M2LA 3TRFA 4OK6A 1KQSB 2WAXA 2BDTA 2FFHA 4QGAA 1FNBA 1N0UA 2OTLB 4ACAA 4F7WA 4JBXA 1KKMA 1QHYA 1ZM9A 4RCZA 1TUIA 1BYIA 3WMEA 1XMVA 1K8RA 4FMDF 1MRNA 4PHFA 3UMFA 1XFAA 3Q3JB 5DISB 3NC1C 1SKYE 1XEXA 3JZAA 3X1ZA 1XJCA 4TTQA 2WJGA 2WWFA 5TV2A 3ADDA 2ZROA 1ZRHA 1O3YA 3MFYA 4AG5A 2NPFA 3REGA 5FL7D 1GP2A 1X8JA 2CCJA 4J0QA 3KQLA 3GLFE 2ZSAA 4EFNA 1LTQA 1AS2A 4TSFD 4EPXA 4RFVA 2JLVA 2ZRIA 1W0KD 1IM2A 1KZ7B 2AL7A 3CPJB 3L0OA 2RGEA 1Q3TA 4YLGA 2G6BA 1US8A 4BASA 1UM8A 2CCKA 2MSEB 5HE8A 3TK1A 3MRSA 4Q7MB 2WJHA 2IUUA 3LBHA 3MHPA 1XCMA 2CK3D 4URVR 5JRJA 4OKSA 3IILA 4QHYA 3BE4A 1VCOA 4LCBA 2GTPA 3JQQA 2A5YB 1X1RA 2IW3A 1F2TA 1VQ4B 5GV7A 1H65A 3TGPA 1CBUA 1A5TA 1Q1BA 2CXXA 1OB5A 2XNDD 2I3BA 3THWB 1QX4A 1AS0A 3B2EA 4HAYA 2OV2A 4W9MC 3G6EB 2F6RA 3ZJYA 4HLCA 2FA9A 5BN4A 2ZR7A 3SYNA 5DI9A 1T0JB 1BMFA 4HUTA 3Q72A 2PMKA 4Q5IA 4PAMA 3OFNA 1L7VC 3I55B 2ODEA 2W6JD 4A0RA 1YZUA 3CCJB 1KJWA 1XTKA 2IX3A 1ZM4A 2JIZA 4C2TA 2QQ0A 3SZRA 1N6RA 1XBTA 1N2CE 4V0OA 1U90A 1GZSA 3PQCA 4NPHA 4WZAE 3L0PA 1EX7A 1E79D 2HLDA 2FGKA 2FFBA 4TTPA 1E9SA 1WE2A 3CH5A 1KIMA 4P32A 4EFMA 2WWGA 5CB8A 2X1VA 4B74A 3GFPA 3U44B 1KI6B 4Q21A 2GAOA 4KV9A 3UKDA 1G3QA 4ON9A 4V0KA 1VYUA 1Z47A 2QU8A 3VX4A 2A5JA 1FMJA 1Y3AA 3QNUA 1LY1A 2JLQA 3W5JA 1ZINA 2ODNA 5KNBA 2AR7A 3QFSA 1OSNA 2JJ8A 3CZPA 2ZE8A 3EIHA 3G82C 4GPTA 1TTTA 4L15A 3K0CC 5HE9A 3OW2B 2DBYA 4PQRA 3AVVA 4Q4AB 5FR2A 1OGJA 1G3IA 4X8MA 4OI1A 2ZM5A 1UBEA 2B6HA 4LJ8A 3Q7PA 2WKPA 1ZM7A 4XOIA 3RRYA 2NIPA 5FI1B 4B6EA 4Q00A 2EYUA 3CKLA 2ZRPA 4MRSA 4CW7A 1EESA 3SC3A 4TMVA 2FN4A 2H16A 1OXSC 2LKDA 4UXHA 1Z8FA 4DVGA 4YHBA 3I32A 4NYMR 3W34A 1DE0A 2YC2C 3T35A 2ZUDA 3QPVA 4ZIRA 2IYWA 3HU2A 3THXA 2G3YA 2QM7A 2BGIA 2R6AA 2FMXA 3GQBA 1FX0B 3B1XA 3QKSB 4G5OA 1GKYA 3SU8A 4DCTA 2ERYA 1P2VA 4DHEA 4EJSA 4Z51A 2WIAA 4BZPA 2OCBA 2CHVA 3AP1A 1FFHA 1T9HA 1ELOA 3IIKA 4OI0A 4W5JA 1TU4A 1GNQA 4O0MA 1CS4C 3P4YA 1JAHA 1ESMA 2NTYC 2BGJA 2AD1A 4JT2A 4KFSA 5KHOC 2V4ZA 1YVDA 1AMOA 2IWRA 1T8UA 2Q9AA 2X2FA 2QGZA 4JLOA 4YMWA 1R0YA 1E2JA 3KKQA 1VQOB 2QI9C 4KAXA 4X8OA 3A1VA 3ZDQA 2ZYUX 4O3MA 4N3NA 2ERXA 1VG0B 1VYVA 2Z43A 5JCPA 3FPKA 3GLHA 2JAQA 2R2AA 4CT4B 3PR1A 3LLMA 1MO5A 4QC2A 2H57A 2V8OA 2G9NA 2RGGA 2NO9A 2YNMA 3B6EA 2XTNA 5LD2B 2ZRCA 1E0AA 2ATXA 2IF0A 2CRVA 4EPYA 1OH8A 5L3QB 3K09C 3CD6B 1HYQA 1CLUA 3AVYA 3BH0A 3EXAA 1TQ4A 2Q3FA 4UXIA 4C9BA 4XWKA 1FW6A 3FTQA 1JEEA 1XRJA 5E7IA 3GJ4A 2QP9X 3SBDA 3SFVA 1Z06A 3B9QA 1U0JA 1D2MA 1HV8A 2ZVPX 2O8BA 1XXHA 5FTJA 1KRHA 4POAA 4TL9A 3UPUA 3CO5A 1XPUA 3QBVA 3VR2A 2OFWA 4DSTA 3ZZ0A 1MRSA 3L0IB 2HF8A 4XTRA 5H59A 1EFUA 1NN3A 3DMNA 3CCUB 3QE0A 121PA 1F60A 1AKEA 3T06B 4DSOA 1P3JA 1X6VA 2JLSA 3HDTA 2I1QA 2WWXA 1VPLA 3W3ZB 2GESA 1Z2AA 5JJKA 3KL4A 4H9GA 2O5VA 1ZVQA 3NH9A 3PUWA 1VHLA 2J41A 1XJQA 1KK1A 5JEEA 3W5UA 4ARZB 1JR6A 3A1WA 4HE6A 2WWHA 1RJ9A 4DBLC 4CEJB 3QVUA 2RMKA 2VHTA 1DO2A 4ILEA 3K0AA 4JVNA 1GG2A 3QENA 2AFHE 2BBTA 4LPKA 4WA7A 2J7PA 3CPHA 3RRMA 3X2SA 3P32A 4QJ3A 1AM4D 4DC9A 3EX7C 3ES9A 3EG5A 4HAXA 1E0SA 5EE3A 2VHCA 2UKDA 2P6UA 4HYYA 3RANA 4Y9UA 3NEJA 5EP3A 1L4YA 1T4GA 1U2RA 1KJZA 2XNCA 1ZIPA 2J0VA 5TMPA 5E3HA 4TWZA 1OHHA 4UNQA 1S9HA 3R7WA 5K8TA 2QROA 4A9AA 4LPSA 2XZPA 1W7AA 1E2EA 3BORA 3LO8A 2C03A 1GKIA 1T91A 5FTNA 1UADA 3ZVRA 3CF0A 4C0BA 3A4NA 3SJAA 3UIEA 1JXMA 3LX8A 4LRWA 4EFLA 4P4SB 1G1MA 3W9YA 2YVUA 2QBYA 3ND8A 1BMFD 3D8BA 2V54A 4MRVA 2C9YA 4GT1A 3KXIA 4F4JA 821PA 4IOLA 1V5WA 1YZKA 2KWIA 2VF8A 4GFDA 5DN6A 3RS4A 4AKGA 3OFND 4Q4JB 1QF9A 4AURA 5JRZA 4LC0A 3W5IA 1Q1EA 2JIZD 4NTZA 1L2TA 3M1IA 1E64A 4GSYA 1OFIA 1GVNB 1H8ED 2DHRA 4M21A 5FUXA 3WMGA 1W46A 5DHAA 3C8UA 4QHTA 4XD7A 3QQ5A 4MGZR 4DDUA 2V6IA 4F4IA 5L3VA 2VO1A 2GKSA 1YJ9B 3LD9A 3NKVA 2HLDD 4FXPA 3F5FA 1CR1A 3KJEA 2DWQA 2EU8A 3BB1A 4HB2A 4EIWA 3PEYA 1E96A 2EFHB 1P2TA 4LJ4A 3RS3A 1IQPA 2QTLA 1KSGA 3LY5A 4UJ3A 1CU1A 4B3FX 2AHOA 1JEDA 1Z6XA 2D74A 3TMKA 4N3GA 1R2QA 4C7OA 2PX0A 4I81A 2G0NA 1QBKC 3K9HA 4JJKA 4AF7A 4TMZA 3GLHE 3NBXX 3QXCA 4EDHA 2GCPA 4PC6A 1XD2A 3K0EA 2NZJA 1IB0A 4WOPA 3WYFA 1ZNXA 1Z0JA 2ZI3A 1G8PA 2CDNA 3P27A 1GL7A 1YI2B 5CK5A 1AQYA 2EYQA 3ZQJA 2N46A 4QJ4A 5GJCA 4CYMA 1ZU4A 3B7GA 1J2JA 3GFTA 1PUJA 4I1UA 5TARA 3LXRA 1S1MA 4CEIB 3TAUA 1Q44A 1VKJA 2FDCA 5LDDC 2VYQA 4JIMA 4HLQB 2P5TB 4GOKA 4KFRA 2GWHA 2YC4C 1XTIA 2GJSA 1CRQA 2DFLA 1HT2E 4B3GA 2OO7A 1XXHE 1YRAA 3MGCA 1KO5A 4Q03A 3GCGA 1ZCBA 3U6KA 2J59A 3GJ5A 4JLJA 2BPOA 4Y0AA 4M4SA 2GCOA 3SDZA 1G4UR 4C0JA 3J81k 1S96A 4Q7JB 3LBIA 4KFUA 1OFTA 2VHUA 3I5XA 2ZPTX 4Q19A 2KBFA 3K0SA 4WAUA 3UANA 2ZEJA 4OQMA 1JNYA 2R9VA 1F3OA 1XU4A 2RKOA 2ZJ5A 1KAGA 1ZYUA 1NP6A 5J40A 2O52A 3LLUA 2CHGA 2PEZA 4TQAA 1WMSA 1COWA 2OLKA 2ZJ8A 1W4CA 1RPZA 5FR1A 1JBKA 3BWDD 4BFYA 1EP1B 4XVUA 2ZRKA 3FKQA 4O2RA 3Q7QA 3HP1A 2DPXA 4DIDA 4Z54A 1QFZA 2A3RA 5LB2A 4BRWA 2PLRA 1Z0KA 5DYIA 1E2LA 1NSTA 3QXHA 5FOTA 2ZJYA 3BFXA 4B44A 4LV6A 5TVKA 1W36D 4ZI3A 1Q0UA 3ADKA 4CEHA 1G5RA 1FQJA 2F1IA 2FF7A 1JPNA 2IS4A 4PHHA 2DCUA 2AWOA 4R71A 1BYUA 1KI3A 4DEXA 5GADl 1SULA 1L4UA 3FHTA 2BBOA 2KE5A 2D62A 5FPHA 4RD2A 4NP6A 2D06A 3KB1A 3DVLA 3AF0A 1ONBA 1PLKA 2IT1A 2W2TA 3ASZA 4LHYA 4B76A 2RGBA 2IXEA 1UKYA 1YZQA 4LDJA 4HE5A 1JB1A 1FNDA 4AD8A 4N1AA 3BC1A 1DAIA 4KFTA 4F93B 1A7JA 1W1WA 1P72A 4Q4HB 1OE0A 5HKKA 3CWZA 3F3YA 1YKSA 3AVPA 4FWTA 1CJUC 4RD0A 1F2UB 4KJZA 5IDVA 3VNVA 1II0A 2QAGC 1VG9B 3FHCB 4KYUA 3CX6A 1MV5A 4LK2A 4BLRA 3W2EA 1TQDA 4NCIA 2J7PD 2QDXA 4NCKA 4HLUA 4B3CA 4RZ2A 2FV8A 2GQFA 4LJ9A 2QTHA 3BOSA 2IYUA 3VMFA 3QSYA 2R6GA 2QPOA 2REBA 3C15C 5F98A 2IF2A 1II8B 1I7PA 4GP7A 3TR0A 5AUPB 4G5GA 1B2RA 1OHHD 2B5OA 3NVAA 1M1YE 1UBGA 3E20A 4K8OA 4US1R 1CJKC 2WSMA 2WSSA 1N5JA 1P2UA 4BE7B 1R5BA 2GBLC 1KD1D 3REFA 4XWAA 1SVOA 5HPYB 3CPWB 1QGAA 1NMXA 4KLZA 5DLQC 3C7KA 4Z1MA 5FPSA 4LBWA 4TZ0A 3D3QA 1KDOA 1Y63A 2QZ4A 1G20E 3EASA 3VKHA 1GKUB 3AKCA 5DN6D 1CNEA 4MUBA 3K70D 4KXFB 2P3SA 4HAUA 4I99A 4NYJQ 3DM5A 1S3SA 1IY1A 1Z3IX 2XJ4A 1DG3A 2FG5A 4QM7A 4Q1DA 3VR1A 1UKZA 2UZ3A 1IOZA 4XD7D 3B85A 4RCYA 5KUTA 2CLDX 1OIWA 5FI0B 4NYJR 2C78A 3AP2A 1CJVC 4OQNA 1YZGA 2Z83A 3OZVA 1FOEB 1OKKA 3CIOA 3QI2A 3PJRA 1KNQA 4QG7A 3QFTA 3NHBA 5JS8A 2VIIA 3HR7A 2GK7A 3EZ9A 4BFVA 5JZVA 1R0ZA 3AUYA 4TL7A 2OK7A 4S35A 1KDRA 4BEBA 4WIAA 4KHZA 1DDGA 4P4UA 1OW3B 1IBRA 2PJRA 1FNNA 2FOLA 1WDTA 2HDNB 5JJLA 1KZGB 2RCNA 2LKCA 2QSYA 3EWAA 2NOAA 2ECKA 5CJ2A 5F2EA 2X19A 5A4JA 1RRPA 2IEZA 4TLAA 1R8SA 1DDIA 2J1LA 1QHXA 2O8FB 3BB4A 2WKQA 3OEEA 4RVCA 1I4DD 4K81B 2C5LA 2FSFA 3UWOA 2DR3A 1LNZA 4NCJA 3VR3A 4LBYA 2O8EA 1FRQA 4M1MA 2ZI9A 1R5OA 3K8YA 3QF7A 1U98A 4IEIA 1JJVA 1E9DA 4IDHA 3T12A 4R7ZA 2ANCA 2BVNA 1LVGA 5AJZA 4DQLA 2OTJB 3U3OA 1KY2A 1C9KA 1NLZA 4DCUA 2A7QA 1EWRA 3QY0A 4I4LA 2SHKA 2CE2X 5JHGB 2X77A 2IA5A 3QKSA 1FX0A 4A8JB 4MGIR 5KO2A 4HZIA 3QOFA 3T1QA 3WP0A 5J4YA 2J0UB 2QTZA 4QBIA 4TLEA 3ZLJA 1KYIA 2FH5B 4IJMA 1W0JA 2OFOA 2RHMA 3V4FA 2G88A 4Q7KA 5FBWB 5K8IA 1IN7A 3FFBA 4PHTA 1W44A 4C0LA 2P67A 2ZRNA 4IOKA 2FPLA 5C1BA 1HEIA 2OT3B 4FI3C 3CH4B 2P6RA 1VQPB 3AF4A 2PT7A 4BUJA 1E9RA 5EXSA 3WRYC 1AK2A 4AY2A 4NONA 3NDPA 1CKEA 1Q57A 5EQTA 1T3HA 1BH2A 2A5GA 1HH4A 1X3SA 2UVQA 1DAHA 4B2PA 4NE2A 2FPMA 5L3QA 2QA5A 4URWR 4QGGA 2ZE7A 3NBFA 4MRNA 2B8TA 3BFKA 1NF3A 1OXXK 1U81A 4OJKA 4YQFA 3IBYA 1SVMA 1NDHA 1Z08A 2BC9A 3PUXA 4QNRA 5A0FA 4YALA 1N6NA 3SEAA 2MSDB 3AM1A 2D7CA 3QKRB 4JLPA 4MKHA 5EJEA 1Z0AA 1PLLA 1VQKB 3JQRA 3ZH9B 2QL6A 4NCHA 1ZD8A 1YRBA 2J0SA 3HJNA 3AVWA 2EFEB 4HLDA 3SFZA 1QGZA 2XNJA 2IYZA 2QNRA 2KI5A 5HKKD 3FOZA 5H70A 3CC4B 2AXPA 1Q1QA 2ZETA 3WYAA 3OJXA 4DB2A 2OAQ1 2WICA 4RSGA 3U3JA 5KPJA 4A15A 2BKUA 5BQ5A 3IEVA 3CC2B 1K5DA 2ZI5A 4JT4A 1YQTA 2XGJA 4ARZA 3BJIC 4IDNA 3BD9A 1QVRA 1DBSA 4C0KA 5B2ZA 3KQNA 3IKJA 3O8DA 4CEJA 3K0FB 2GZHA 2PT5A 3LVRE 5AK0A 3L82B 2GZAA 3AKDA 1KSFX 3SI7A 3NWJA 1ZIOA 1N8RD 2VYFA 3CRRA 4G01B 3FVQA 3W8NA 2MSCB 3OEHA 1GJRA 5C46F 1R6BX 1ZNYA 3NXSA 1PUIA 3M4YA 2ONKA 1G4AE 1P9WA 4TLCA 2AK2A 2WSSD 3ND9A 3K9GA 3LWNA 1VTKA 1K9MD 1TNDA 4TLBA 4A0FA 4CDGA 2ORVA 2D7DA 1AGRA 2BMFA 4ZV4A 1M7GA 3L2OB 1PJRA 5DO9A 4Z1MD 3CWQA 3FMOB 4HI0E 1ZC4A 3WBKA 1XEWX 2NZ8A 3W2IA 4OI2A 1F20A 2OM2A 3JQPA 4P4SA 3ZD6A 3LXXA 3ETLA 4YMTA 4KU4A 2IYVA 4QRHA 1SQ5A 2PLFA 4ZDWA 3T5GA 4UJ5A 3EPJA 4MRPA 5THXA 4Q4JA 2QMOA 4A2PA 3PV0A 3MCAA 1LB1B 3AKEA 3TQCA 3VTKA 1LF5A 3AUXA 1NN0A 2B21A 4Q48A 2IYLD 5J4LA 3CF2A 2Q3MA 3VKWA 3FMPB 2RGCA 1B0UA 4MUAA 5BWMA 1P73A 3A1SA 1IN4A 4LJ7A 2VNHA 1XTSA 2ZTSA 3QFRA 1FTSA 1H8HA 2YOHA 2ZS8A 5IRCD 1W4AA 4DCVA 3LX5A 4QKQA 3CF6R 4PZYA 5L3SB 1G18A 5JWRA 2HYIC 5TXGA 4IXNA 4CT5A 2O8DB 1G7CA 3ZZTA 1G5TA 4RD4A 1GL6A 4AF6A 2NG1A 4ASUA 1RW4A 1WRBA 1QZXA 2CCGA 2GXQA 2YJTD 3CNNA 4FMDB 1QGYA 1QHHB 1NVWQ 5F3WB 1E2DA 1XP8A 2R6DA 1NLFA 3OEED 4GMDA 1EGAA 3CRW1 2OCAA 4EUNA 5FUVA 5EP4A 2ZRLA 2EIXA 1IXSB 4B33A 3I1FA 2ZQ5A 4KITB 3FGNA 3X1DA 1AGPA 3LFUA 4XH9B 1CTQA 1GOTA 3CX8A 2WHXA 4O2LA 4DLZA 2OBLA 1CP2A 1WXQA 2OBNA 2W83A 4CEIA 2FEMA 2V1XA 2ONJA 3PITA 4B3DA 2YINC 3AV0B 2A9KA 3RC8A 2KSQA 2VPPA 2NPIA 1SVWA 4OJQA 2GVDC 3GD7A 1W0JD 1U0LA 4UKDA 2ZU6A 3PEVA 1QFJA 1NJID 2O0KA 4DKXA 4N0DA 4KBGA 4TYQA 3FE2A 3T15A 3KKNA 2CMKA 5HCIA 3VO1A 1CIPA 3MSXA 1KY3A 4OL0A 3HR8A 4QNMA 3DZ8A 2WMNB 2C04A 3R9IA 4V0MA 2GK6A 1N3BA 4TQUS 1BO6A 1RRCA 4PPGA 3GP8A 3CRZA 3K70C 1KMHB 4D4MA 1Z6TA 3AVTA 1ZW6A 2Z4SA 3VFDA 4TLDA 4I1SA 3TSZA 1MO6A 2OEPA 3HYTA 5FPYA 5JWHA 4MYUA 2BKEA 1KO1A 4RY2A 3GJXC 3UK6A 3H1TA 3TR5A 3CCQB 3NIBA 4Q47A 1MABA 2RB4A 3EZ7A 521PA 3MJRA 5IK2A 5TDHA 5DI3B 3QF4B 1ESNA 1P9RA 4WXPA 2HJVA 3QKTA 2GVZC 1XPOA 3I4LA 4NYMQ 2HT1A 4C0HA 1KK2A 1E2IA 1GAWA 4B48A 2BMDA 5B58C 4D82A 4GOXA 3O8BA 4UAJA 5F9FA 1E9AA 1SZPA 2Q9CA 2D4HA 2JGNA 5G53C 4HB4A 2HV8A 4CGZA 2AKAB 3M6AA 3X1WA 5KOYA 1KO8A 1E0JA 2VBCA 4JLBA 5JFGA 1UBFA 1DARA 1PV4A 1NKSA 3UMRA 3GLIA 3ZZUA 1KI2A 4LHXA 3ZVNA 1BX1A 2GJKA 1XD8A 1U9IA 3U4QB 4Q18A 4F92B 3O8RA 3NEYA 3E70C 4DSUA 1Q22A 3TVDA 1VQ6B 4ACBA 1F2UA 3WBJA 2IK8A 3H4MA 3I62A 3EA5A 2E9SA 1V43A 2HXYA 3KXLA 3UXMA 2WWYA 2CEAA 4HSEA 5F9HA 4YDHB 2XOKA 4RKFA 4D4KA 1SKYB 4B32A 5KU1A 4DLSA 3W2GA 1KI7A 2P6NA 3C41J 2O8CA 3B60A 2F43A 3OEHD 3KUDA 4RZXA 3GPLA 1I4LD 3CNLA 4RZ3A 3RRZA 4BWYA 2GA8A 3CCSB 4G1BA 4HB3A 3RS0A 4IOJA 3GLFB 3A8TA 1II8A 3A58B 2CJWA 3OIWA 2CVHA 4PANA 3AF1A 5E7JA 2EW1A 1G3RA 4MYHA 3KZ1E 2QM8A 3W2HA 3BB3A 1TUEA 5H1YA 1TF7A 2OFXA 1ETUA 3Q85A 3UG7A 1NVXQ 2JASA 4UNRA 1SXJC 4D2IA 5BYKA 3B5JA 1XX6A 5B30A 1N5LA 1N0VC 1E9CA 3EC2A 4Q02A 4H1UA 2QRNA 1IAQA 3CMEB 3UG6A 2Z0MA 2FWRA 1DAKA 2HJGA 1K6MA 3RC3A 4LBZA 1FQKA 3TIFA 3RWMB 1NN5A 1W48A 3BXZA 4NBSA 3FB4A 4QFMA 1XF9A 4BFSA 2XNSA 3SN6A 1G3MA 2PX3A 4ABYA 2C98A 2VHJA 1YZLA 2YZ2A 1E0KA 1VG1A 4HAWA 3X1YA 1H8HD 3C5CA 4G3XA 3K9LA 2IC5A 2P5SA 1YITB 2QAGB 2Z5FA 4DT1B 1XD9A 2HCJB 3BS4A 4AG6A 1OJLA 1P4SA 1T3LA 3RSLA 4U5XA 5KTYA 1P61B 3RS5A 2A78A 3ZVMA 4Q1AA 3V76A 1TF5A 2F1HA 4ASUD 4D0GA 1JJ2B 4EPVA 1N6OA 1ZC3A 3D6TB 3DOEA 4MYTA 4V0ME 4BZQA 5AWFC 2J0QA 1EFHA 5FBLB 3DKVA 4DLTA 2WM9B 2ZRGA 3OJWA 1NVUQ 1OYWA 2NQ2C 2PEYA 1UKVY 3CCEB 1TQ6A 1YR6A 1IXZA 1LV7A 3W2FA 4HUQB 5EP2A 6Q21A 1CNFA 3FWYA 1Z6YA 1W2GA 1S0UA 3WNBA 2IWHA 2AKYA 4BLPA 4YMUA 3EPHA 4LJ5A 4B35A 1OFHA 1U94A 3NC0C 4HZUA 2ZAOA 4HLUC 4URZR 1TEXA 2GJAA 1GVHA 2CNWA 1TAGA 4HEJA 1XE1A 2RH5A 4MGYR 3CZQA 3LNCA 1VQ9B 2IYTA 3IQWA 2RGAA 3H84A 2A5DA 4Y0VA 4GL2A 1P9NA 2J87A 2AWNA 1R4AA 3W5HA 4BRUA 5DE3A 3QPWA 4Q9KA 2EWVA 4A8JA 5KPDA 2ZJ2A 3MWJA 4ZCIA 1D6JA 1R10A 2J0UA 4G1VA 3OZWA 2OZEA 4R2IA 1D8TA 3GLIE 4LHVA 1Q7YD 1RYHA 5H68A 3TAHA 4I1VA 5AUOB 1G9XA 2WJYA 4QL3A 2EVWX 1FNMA 2VQSA 4DLUA 5SZHB 1RE0A 4RJLA 3DHWC 1N6IA 1D9ZA 3KJHA 4A2QA 2IS2A 4Q1EA 2OCYC 4LYFA 1E2PA 1FZQA 4CRWB 1BS1A 4IEEA 3L8ZA 1Q12A 4KVAA 4YONB 1OH6A 3R9XA 5EE1A 2HYDA 2FX3A 1X8LA 4G5RA 3SJBA 5IK2D 1CQXA 2IBMA 1OT3A 2QA4B 4PC1A 4FMBB 1UBCA 4JSYA 3SNHA 4JVLA 1F48A 1D9XA 4PC3A 3EC1A 3IQXA 4FD2A 3SOPA 3EWSA 4TL8A 1ZUHA 5KYKA 1P2SA 2R6CA 1S2MA 2ZIAA 3GMTA 4HAZA 4FMCF 3OIUA 5FBQB 1UEJA 1KNXA 4MKFA 3Q5EA 4JLAA 4MA4A 4B47A 4G1UC 1W5SA 2W2XA 1KSHA 2ORIA 5AJVB 3U2QA 3QVVA 1R8QA 3RYTC 4Q4LA 1SKQA 3KX2A 1WBDA 1EX6A 1ZCAA 3W8RA 4PQYA 2CL6X 3KFXA 4IW3B 2BM0A 4B4DA 1FRNA 4GMXA 2VP0A 1Z29A 3LVQE 1E2FA 1E2NA 2EFGA 3KQHA 3ZC3A 2DWPA 2VP6A 4D6PA 4GP6A 4IHQA 3E5HA 4HAVA 2YOFA 1ZUIA 1UJ2A 1TADA 4XSGA 1R5NA 1YZTA 4P0TA 2XOKD 4M1SA 1I4TD 3EAQA 1IJFA 1Q81D 1JALA 1S4QA 2J7KA 4ITRC 4R98A 1VMAA 1RKBA 2C9CA 4RFSB 3KFVA 3U3RA 4F38A 1E94E 4GBMA 3VR5A 2AFIE 3EPKA 5JBQA 2ZUBA 1XZQA 4C0AC 1IN5A 2XXAA 2DWOA 3WXMA 1D2NA 3ZVLA 1CF4A 1G7RA 2WWWA 3QXXA 1Z0DA 4U02A 4A0HA 5J4HA 2QE7A 5KNCA 5B57C 1XMJA 2IYQA 2XB4A 3T1OA 4GRAA 5KDOA 2NGRA 4M9XA 4QXAA 1C1YA 1NRJB 4ZDIA 3K09A 1S9DA 3EIQA 4O25A 5FBRB 3WHLA 5EXXA 1VQ5B 1FMLA 1Z28A 3PUVA 1QVFB 2J3EA 2QEQA 3KKPA 4B3BA 3IO3A 3PCRB 2FE4A 4AYXA 2QRZA 2NMVA 1OLOA 5BXQC 1T0HB 1NMZA 5CDFA 2HCBA 1TF2A 4FINA 3SBEA 4C0QC 1J9ZA 2QQEA 2YWGA 2BBSA 4D26A 5LD2C 3A37A 5JS7A 2ZI7A 1JA0A 2WV9A 1GDDA 1AS3A 2LWIA 3U3MA 1SVIA 4FK8A 1GSIA 3PVSA 1QVAA 4LI0A 3CCRB 1CXZA 1M74A 1UDWA 2W58A 4IDQA 1JA1A 4M22A 2DEUA 4Y9RA 1W2HA 2QMUA 1GUAA 4TYPA 4TYWA 3U60B 3OE7A 1KO4A 2ZAMA 3OZUA 4EKDA 2YWFA 3FKSA 3SJCA 2FSGA 5L3SA 1XZPA 2VH5R 3V00A 5LB4A 2I4IA 4ZIRB 2PJZA 2O8DA 1KTVA 3WNDA 2VTKA 4CZ2A 4JVMA 5BN5A 5KDDA 2WTUA 1QHHA 4G5QA 1EWYA 4BECA 4D4JA 3OF5A 1QG0A 1J8MF 1JR3A 5K8LA 2UZIR 3LW8A 1J99A 3JZMA 5SZJA 3F8TA 3AF2A 2GF0A 4L5BA 1KI8A 3GEEA 4JBYA 4URYR 4V0NA 1E69A 4BEJA 2BJWA 2CNWD 3B1VA 2XAUA 3IGFA 2JLYA 1TMKA 3KJGA 5EUMA 5G41A 2JDIA 3THWA 2DB3A 2GCNA 4HDCA 4PXAA 4EQ6B 4NMMA 2ZRBA 1W4BA 4NDZA 2WPDA 2QEXB 3QG1A 2KJQA 4F7DA 1MO3A 2PZFA 3CUEF 1E6CA 1GWNA 1X1SA 1ZAKA 4QBHA 1D1NA 4A1FA 1BQEA 3CW2A 5CM8B 1FDRA 2V3CC 5CITA 2XZLA 4EPRA 3A36A 2F7SA 4OK5A 1HQYE 2Q21A 4OBEA 2G1KA 4KO8A 3AGPA 1EP3B 3VO2A 1YHQB 1KO7A 4BLOA 2VZLA 4P4TA 5HZHA 4BLTA 3CXCB 1E62A 4F4CA 3E2IA 5J5CA 1LF0A 1NLYA 4MRRA 4OQXA 1GITA 3T1VA 3GJ3A 1VIAA 3I8SA 4A6PA 5G3YA 4C4PA 3NBYC 1DPFA 1XXHB 2D2EA 4IRUB 1B23P 1TLLA 1XCPA 1ZBDA 3QE2A 2NO6A 1VHTA 4E5UA 2ORWA 1LS1A 3U44A 5HCNA 1KI6A 3EZ2A 3PIRA 4JLDA 1KK3A 3W90A 4WVFA 4PX9A 4NZYA 3WNCA 2DY1A 5BYJA 3ICEA 2OE2A 2F55A 2CL0X 4IVQA 3IPXA 1OH5A 1W5TA 2F9MA 4DDTA 3V9PA 2R62A 5KDLA 4KCGA 4Q4AA 1M8PA 3QF4A 5DI3A 5C4GB 2QGNA 3TUIC 2BCGY 4DSNA 3N2EA 3D31A 1VQMB 1ZU5A 1SVSA 3QBTA 1S72B 2HUPA 3JVVA 1MKYA 4B75A 3MAAC 4Q66C 2VRWA 1M7BA 3A6PC 2FEOA 2R6FA 3RDPA 1IHUA 4HB0A 3TUJC 4AIIA 5CLLA 2AK3A 1E4VA 1FNCA 2BEJA 1E99A 1XMIA 1GO2A 2GHIA 4G5SA 1G19A 4D0NA 3Q8XB 1E4YA 1SM4A 1WA5A 4KVGA 1AZTA 4YMVA 4B43A 1M6NA 3RS2A 5GVSA 5A5GA 1EWQA 1VIYA 5CDFE 4DWJA 1NJFA 4Q9JA 1HT1E 3QFCA 5P21A 4Q1BA 2C96A 1NSFA 4ESHA 3R7WB 3OIVA 4HATA 1OIXA 2OXRA 3LDAA 1YIJB 1K73D 1ZM3A 4BLQA 2GJ9A 3AVXA 1DAFA 1SHZA 1PLJA 1TEVA 3MG9A 5SZIA 3TNFA 4IOMA 2BF4A 1U8AA 3FYHA 1GIAA 4IDOA 2NO0A 3SHWA 4RKEA 4TQ9A 2MMCA 3GJ6A 1VECA 3GJ8A 1COWD 4LGMA 5L8VA 4OK3A 1OGIA 3PUYA 2XX3A 4WXRA 1Z5ZA 4Z8YA 4DXAA 4M8NE 1VQNB 4NYIQ 3K70B 1Z22A 4MGKR 4ZO4A 4D0LB 4WQMA 5JWOA 3KQKA 1A1VA 4B2LA 1DVRA 3QXJA 2ZJZA 5HTKA 3H86A 3SHFA 5K8UA 1G16A 4BPRA 2WIBA 4MQBA 1P75A 2OILA 1LS6A 4NYIR 1HA3A 3PENA 4NCNA 2IYSA 3BBPA 3I92A 2IYYA 3DO6A 3PFIA 1KK0A 2AX4A 3MMPA 3C5HA 5SZKB 4BFXA 1NMYA 1F6BA 1JR3E 1Q82D 1ZD1A 2FSIA 4JL8A 4LJYA 5H8WA 1CULC 5TY0A 2D3WA 1QHGA 5HXBA 2BEKA 4KYIB 2ZUCA 3WY9A 1GAQA 2QP3A 3LAWA 2ZITA 4JZKA 3A1UA 5AUQA 5JI3E 4R9UC 1R0XA 3RS7A 3T61A 2GXAA 5JHHB 2PCLA 5JLJA 4JKYA 5D3QA 1HE1C 2VL7A 3ECCA 3S1AB 1AZSC 3LQQA 2ATVA 4EH1A 1AN0A 2QSZA 4C2UA 5AJXA 1DS6A 2H8KA 2PZGA 4B73A 2A30A 2RGNA 5M04A 3AGQA 5JMTA 2GEVA 3ADCA 3OE7D 4A2WA 3LH5A 2GPJA 3P20A 5GVRA 3FKSD 1AA9A 1NNEA 1RRGA 5AJYA 3I72A 3IO5A 4AK9A 3PEWA 1Q21A 2FGJA 2B7CA 3I73A 4D25A 4AKHA 1P5ZB 3KTAB 3L8YA 2G0TA 4QGHA 3AF3A 3CB4A 4JJZA 1W87A 1II9A 1S3GA 1Q1ZA 2N1BA 2O0JA 4IVRA 2KBEA 1U9IC 4TMWA 4X8HA 1JR3D 4YAFA 1KAOA 4LWZA 1QDEA 4EJSC 4L16A 4XVQA 3W6NA 2DFTA 5CB6A 2ZANA 2ZVQX 1BJKA 1XTQA 4S2EA 5CIWA 3NDBB 3I8XA 1M1KD 1UPTA 3G71B 3CC7B 3QIAA 1XTRA 4YAUA 1FTNA 1M2OB 1P7CA 4HUQA 4PFSA 4A6XA 1OB2A 2BMWA 3KDSE 5UKDA 2JA1A 2QORA 2JDID 1GILA 4TL6A 4DDWA 1RIFA 4W5HA 4LC1A 1SXJB 4MYCA 4Q9LA 2WPDD 1W34A 4QOSA 5EUQB 3QPUA 3BIFA 1YJWB 2BBWA 4A36A 5FOSA 2VF7A 2XTZA 3W6PA 3BH7A 4B2IA 3AB3A 2OLJA 5AUNB 1RVDA 2ANBA 4JLVA 1KSJA 1XNJA 3T1TA 3ASYA 1IY0A 1G8HA 3CONA 3GLGB 2GDJA 1G6OA 1BOFA 1P60A 1EFTA 3KXKA 2JATA 5KNDA 1J8YF 5CIQA 1VCMA 1W36C 1O87A 1OKKD 1E1QA 1VG8A 1X8KA 2CLSA 2QMEA 2W6IA 1HTWA 2WMOB 3CCVB 2XSZA 5L3RA 5GJBA 2E1RA 2G1JA 1N6HA 2QAJA 3GFOA 4P6VF 4OHYA 4LV8B 2QPAA 1XWIA 2XJ9A 1CRPA 5CM9C 1DEKA 4Y7CA 3R8CA 3AVQA 1OIVA 1R7RA 4LYHA 5C4MA 4US0R 4DB4A 4Q7LA 4WW0A 1U0HC 3N2IA 4E09A 5FH9A 1E3MA 3CLVA 5FTKA 1GRNA 3IUYA 4L4UA 3TSOA 4E22A 5ELXA 4QBFA 3KKOA 4BFTA 5HZKA 4PC2A 2HXSA 4V02A 1VQ8B 4BGDA 4ZPXA 2VEDA 3DMDA 4AI6A 1UKEA 3NTUA 1M90D 2VP5A 3CBQA 5FOUA 3X1XA 4YC7A 4B71A 3FJOA 1CEEA 4XJXA 2JJ2A 1KDPA 2H17A 5EZ5A 2O0HA 4ERNA 4I1OA 1E1RA 4E07A 3HPRA 3G0HA 2YHSA 3AH8A 3JVUA 2GXSA 3MUFA 2CNDA 5DSZA 2WJVA 1J90A 2ZSEA 4Z8XA 2YWEA 2B8WA 5JSZB 2ZRJA 1A2BA 2GETA 3ZBUA 2YV5A 2AXNA 4E03A 3B82A 4ZCMA 4LZZA 2V1UA 1AKYA 4CIDA 5FBVB 1EP2B 1ZNWA 4H1VA 2YKGA 4MKGA 1G64A 4PSAA 2OAP1 3P1JA 4TTRA 4NH0A 3B13B 2DERA 3FMFA 4Q9IA 5DIFA 3E1SA 1AJEA 1IJEA 1JI0A 2IUSA 3FMIA 4M1WA 1TQ2A 1PVOA 1XCGB 4Q1FA 1E32A 2FNAA 2PCJA 4PO1A 1SGWA 2PL3A 721PA 4ESVA 2GRJA 3C14C 1S1CA 4M1OA 5JI2E 2C99A 4ZDKA 5FPTA 1TU3A 4RFSA 3FDIA 4PC7A 1GNRA 4A8JC 4CVNA 3SS8A 2OHFA 4CF7A 3MLEA 1J7KA 3K1JA 1SHKA 1EFRA 1XDBA 2J9RA 5BW8A 1QHSA 2V7QA 1KKLA 1YJNB 4GI7A 4K46A 2XTMA 2GZDA 2ZYTX 2EQBA 4QGFA 4URUR 4G0NA 1G6HA 1H8EA 2EWWA 1KC8D 1NIPA 1FUKA 4AWXA 1U8YA 1NJGA 5FUYA 2ZU0C 1FUUA 4M1KA 2G83A 1KI9A 3WRXC 4DZZA 2FSHA 1Q3HA 4RD3A 2TMKA 3IHWA 2X2EA 4YAWA 3EPLA 4DUGA 1QVGB 1X86B 1GR1A 3B78A 1OXVA 4QHSA 4ZKEA 4DDVA 1QH0A 2DETA 3CCMB 3I56B 2A5FA 1E2KA 3MWYW 4WZ6A 4Q4HA 4YXWA 1XEFA 1G8YA 3AEZA 4JVSB 2O8EB 2HT6A 1MT0A 3LVBA 1T6NA 3CRVA 5KSPA 1AIPA 5DGXA 5CK4A 3QUSA 4LSGA 2J46A 1Z0IA 4KSBA 4PPFA 2YOGA 1FL9A 4P31A 1KI1A 2GILA 3IHLA 3CR8A 1ODFA 3ZIAA 3WP1B 4FIDA 3C4JA 2REXB 1K8AD 1FP7A 2IHYA 5KSZA 1W4RA 3RVBA 1ZP6A 1RFLA 1Z83A 2ZSBA 2R65A 2F1RA 1MO4A 1ANKA 3B1ZA 3EIEA 2QY9A 5C18A 1GAJA 3TVTA 3DM9B 5CYPA 4PGOA 1A2KC 2IEYA 2ZJAA 1QHNA 3ZYCA 2RGDA 3C16C 1CJMA 5FOVA 4FCTA 1KI4A 4JLKA 3TH5A 1N0WA 4EQ6A 3O8CA 1LW7A 2IUTA 2KB0A 3GJ7A 1XEWY 1Z6AA 1NN1A 2C95A 2L0XA 2ODBA 1VCIA 2W0MA 1IY2A 1E9BA 3OESA 4AYTA 4EAQA 1EXMA 1VQ7B 1D5CA 5FFMA 5FPKA 3TW4A 1YR9A 2B7BA 1E1QD 1EG7A 2XSZD 2W6ID 1AQUA 5JJIA 1ZJ6A 4Q1CA 2ZE6A 4BZXA 3LQRA 2PZEA 3NBZC 4WBSA 3NH6A 4D4LA 2VA8A 1YE8A 2R6HA 4ZCLA 2BMEA 1G291 5EP1A 2BN4A 3WHKA 3FPAA 5JECA 4DRZA 3THOA 3UWKA 4MH0R 1VDZA 1GRRA 2HF9A 4KI0A 4P33A 2VP4A 3I5YA 4LJ6A 3WMFA 4D81A 1JPJA 2J45A 3TW8B 3BERA 2JEOA 4BFWA 2QTVB 1NG9A 1NY6A 2D2FA 1W2BB 2Z6VA 3U7HB 2F9LA 3IIJA 4EPWA 2JLWA 4OHZA 2A2ZA 3THYB 1M34E 4DLVA 1Z6GA 3LA6A 3ZBTA 2VLIA 5J4VA 3IEUA 4V03A 2IS6A 5D3MB 4M53A 1Z2CA 3KUCA 3DZDA 2JJ2D 221PA 4JL6A 8OHMA 1G7SA 1QG4A 2RGXA 3VAAA 2CHQA 1E1RD 3AKYA 1NY5A 3I61A 2O8FA 5IT5A 4ZGNB 4MDEA 4BFZA 2BM1A 1DELA 3KQUA 1T8TA 1XB2A 1TX4B 5CLQA 2E87A 3BAFA 2IXGA 1CJTC 3B9PA 1GL9B 1QUFA 5G40A 3HU1A 3LV8A 5KSWB 1LFDB 2CLCX 2R8RA 3RRNA 2V55B 1IN6A 1QFYA 2FJUA 2GJ8A 1RZ3A 3DKPA 3MD0A 3HPQA 4L9SA 1EK0A 4GNKA 4XIGS 3VU9B 3T34A 1GNPA 2B92A 2QTFA 4V0LA 3SJZA 3F0TA 2X8AA 2ZRAA 4UNNA 4TMXA 3VQTA 4DCSA 1SVKA 4TMTA 2H18A 5JEDA 1CR4A 1NKTA 5KSYA 1H42A 5KSOA 5BN3A 2WOJA 2PMDA 5TB5A 3RNLA 2WJJA 2BOVA 4JL5A 5TR9A 4PR0A 4U00A 1EFRD 2JLRA 2JCSA 4FCVA 2V7QD 4A82A 1UEIA 1XEXB 2X3UA 1WP9A 2ZYVX 3BRWD 5HR5A 2P0EA 4GDFA 5AR1A 4LUCA 3VHXA 4F91B 4B3XA 3IDQA 3DPUA 2QG6A 4DCNA 1I2MA 3IPYA 1J70A 3U3KA 3RAPR 3WYGA 3DDCA 2ZXUA 1JJ7A 1ZUNB 2C2HA 1U99A 2WAYA 3GJ0A 3K0CA 4RZUA 4C43A 2ZRFA 4IKEA 1DO0A 2REOA 2JLXA 2RAPA 2W2VA 4NL4H 2NO7A 4LHWA 2ZE5A 3QKRA 3W3AA 1US8B 3PUZA 3TSWA 3V4RA 1ZD9A 4DUGD 3AVOA 2GXUA 2IS1A 1QHIA 2F3RA 3RLFA 5FOXA 4ZKDA 5GJVC 3SQWA 3S1AA 1G17A 2H7VA 2PH1A 5E95A 2F1JA 2VSXA 4DJTA 4OI4A 4DLWA 5IF9A 4KODA 4YXWD 1G7TA 1NG1A 1TL7C 2JLUA 3LO5A 4XTCS 1Z63A 1F2TB 1G8GA 2FU5C 2YWHA 4OHWA 1OXTA 2BIFA 1GM5A 1S8FA 2Q9BA 4OYHA 1P62B 3QKUA 1N6PA 3QG5A 1QRAA 4QM6A 2EFDB 4LJAA 2GNOA 1N6LA 1YHNA 3A1TA 3H0KA 1ZNZA 4FMCB 4JMPA 4RD6A 3KTAA 5CJPA 1A82A 3CPEA 2XEXA 3K0FA 3ZIAD 4JSTA 1NVVQ 2H5EA 1YJ5A 2OG2A 4UNSA 4C30A 3IBGA 4PSKA 2OESA 4FN5A 2IYRA 1XTJA 2DFNA 4DQKA 3TLXA 1HUQA 1KDTA 4PO9A 1DAGA 1T5LA 1N6KA 4LYAA 1NVVR 3MWKA 5FTLA 3EA0A 4BFUA 2IHBA 2ZS7A 1E2QA 1W47A 5FTMA 1VCNA 1F5NA 1KHTA 4GZMA 3B1WA 4JYCA 4TT3A 1OYYA 4DEYA 2OBMA 3ADBA 3DEFA 2QMHA 1SXJA 2VHQA 4W5WA 2N42A 4TMKA 3ONWA 5FL3A 3RHFA 4PQFA 4B6FA 1T5IA 3U5ZB 4XSHA 4LOAA 3RSOA 1K5GA 3CRMA 3ZQ6A 1NL3A 2VP9A 3DL0A 2QT1A 4Q9HA 5CYOA 3ZS9A 4A0GA 3GLGA 2Q6TA 3U7EB 1MABB 3AP3A 3RABA 1HURA 3IIMA 2HEIA 3A4LA 5E7MA 2QP4A 4OQFA 1N25A 1M7HA 1E63A 3I3SR 4UQOA 2OUKA 4B34A 4TN1A 4HDQB 4KBFA 4KLNA 2XB2A 2WZQA 5JCZA 4PPNA 4OQLA 3CR7A 5FOWA 5GV8A 1C4OA 1JAIA 1BKDR 1RC8A 2RC6A 3Q9LA 1TVCA 5DNYB 2ZJOA 4FW9A 1DTSA 1Z0FA 4JS0A 3P4XA 5FA6A 4MITA 5FUWA 4A92A 2VSFA 3QXSA 1NBMA 3GLIB 1YR7A 4GZLA 4QBGB 3THXB 1MR3F 2GAAA 2ZSFA 5ANRB 2RGNC 4EJSB 2G77B 2WJIA 5EE9A 4M9ZA 1WQ1R 4AKEA 4JLMA 4NKRA 1HQCA 1UF9A 2OXCA 2ZRMA 2FZ4A 3PXGA 3BFVA 2WVJA 3ZS8A 2WOOA 1BIFA 4DLRA 5GJWC 2ASEA 2CL7X 3AQ4A 4PPQA 1VYTA 2CVFA 4AKIA 1QUEA 4ZI2A 1FP6A 1D2EA 2O8CB 4URXR 2ZRDA 4LHZA 3GEHA 2ZREA 4IFEA 2F43B 5DHFA 3B8HA 4LBVA 5EZ6B 4BLSA 5JSZA 4U9UA 4C3ZA 2GF9A 1E2GA 2VNIA 3RWOA 2VP2A 3GLHB 1QG2A 3OAAA 3AVUA 3CNOA 2JJ1A 4DIEA 2CJWB 3G4SB 3Q5DA 2FFQA 2C9OA 2ZRHA 5EE0A 1UMKA 3L0SA 1UAAA 2QN6A 3O47A 1W36B 3SQXA 3VX3A 2QPTA 1JQJC 2J5XA 2ODWA 4LX0A 4DLXA 4M0LA 3TJZA 4PZLA 3TE6A 2I1VB 2LCFA 3NG1A 4MKIA 2O8BB 4M9QA 1GFIA 1OF1A 1WCV1 3TKLA 2P2LA 1JB9A 3P26A 1ZMXA 3R9WA 1HY3A 4XVRA 1KMHA 3SR0A 3D7MA 1WBBA 1DAEA 3U61B 4UXJA 3UMSA 4RD1A 2VNKA 1WB9A 1H85A 1EFCA 2ZJBA 3EZFA 1G3UA 2XZOA 3OHMA 2QUZA 2CBZA 2JLZA 5LBIA 2Q0HA 4GOJA 2F3TA 1E9EA 3LRPA 3PG5A 4FCWA 1RRFA 4NU0A 4PO8A 5FL7A 4A4DA 4TYNA 1A4RA 5EXPA 2DYKA 1NIJA 3HYRA 1RJ9B 2H92A 4PTLA 4TSFA 3HU3A 1IXRC 3K0AB 4JKIA 2WKRA 3E1YE 3CM0A 1OFUX 4M9SA 2VNJA 1RYFA 1W0KA 1SXJE 5J47A 5EMNA 3MWLA 2Y8EA 1IONA 2QENA 5EE5B 1TPZA 2W0SA 4PZZA 2C8VA 2YYZA 2OK8A 2RC5A 4LYJA 3PEUA 2ZR9A 3KJIA 2CK3A 4FWIB 2CE7A 1CR2A 2VSOA 3SYKA 2IL1A 4IVPA 1OXUA 3U4QA 4NHOA 3GLGE 5C2JB 2FFAA 3KB2A 1YU9A 2C77A 4HZUB 4UNPA 1XJ0A 3EZ6A 3FFAA 2ZI6A 3GEIA 4IXMA 3VHLB 4D80A 1DOAA 4EPTA 3R8FA 4IDPA 1G41A 4YDSA 3QJYA 5DYGA 5LPNA 1KOFA 5DH9A 3FHOA 2OCPA 2V6JA 2XNDA 3EW9A 2RHDA 2V9PA 2QBYB 4QJ5A 3LW7A 3VR4A 3VR6A
chains in the Genus database with same CATH superfamily
3NM4A 4I4CA 3IHTA 2C0CA 3H3FA 3I9MA 2XXBA 3KPWA 4E5DA 5IHPA 5IZCA 1Z13A 5MGNA 1JMYA 3U6BA 4LGYA 3TQFA 3RSFA 2GYUA 4YP7A 4JBLA 3E0XA 3PF8A 4AJEA 3EMBA 3VNUA 4AC9A 1SQFA 2V7PA 4AQ7A 4TXHA 2EEPA 3OD1A 1ZM2A 4CFSA 1C30A 1XQXA 1Y8RA 2BL4A 4PRZA 5EOVA 2VVTA 2AD5A 4Q3CA 1SU7A 1E2HA 4ZAGA 2HMAA 2A6PA 5ICEA 4BVKA 2O2YA 2QYOA 4HEHA 4P3YA 2ZS9A 4I7EA 3ZDAA 1L5VA 3CRQA 1D1QA 5H9VA 3ZH2A 5DSTA 3ZV6A 4ZMBA 4TYYA 1FP4A 2AG1A 3RUDA 3T5DA 2BGGA 3CT4A 4Z7JA 3FPSA 3C3MA 4JZYA 1V4BA 3KOWA 2O2EA 1V7CA 4GPD1 3ZCQA 1BX0A 1C7QA 4Z99A 4N0EA 2DHQA 1JFLA 1MGPA 2UYGA 1QOZA 3NHMA 2N47A 3ZY6A 1L9XA 2PQ2A 4FFLA 5ICMA 3M5PA 2CB9A 1OR8A 5LQSA 1Y1KE 3L3BA 2DIEA 1IQ0A 3R20A 1G66A 4R8MA 1JHAA 5I48A 3EISA 1ISGA 1YBFA 3HN2A 4P2BA 2FY8A 3WYNA 1P1HA 2ZIXA 3QEJA 2ZQZA 1Z5OA 2BFNA 1J20A 1VL0A 2VZEA 3JWHA 2R44A 4B6OA 2FSVA 4K9KA 5FLYA 1AC5A 3L4KA 2JH3A 1N2EA 2XVYA 1EAMA 2DLNA 4XB6B 1WB5A 1VJGA 1Z4JA 2B0CA 5CNKA 5KKNB 2CY0A 5G4LA 2Y1FA 1G20B 4OUDB 3CX7A 1T3SA 2MSKA 1JECA 2QI9F 1KDYA 2P2YA 3PGJA 5FLKA 3TUZC 3U7FB 3SE0A 3VR0A 1G21E 1QS0A 3DEKA 1GUDA 2QAGA 4ZCSA 1WHTA 3OZFA 2CFSA 4DT1A 5CFNA 1XZNA 3OICA 7AT1A 4P7KA 2ZB2A 5J2UA 4RDIA 4X7DA 2Z3ZA 3OE1A 2O3QA 4JI0B 4XWOA 4LMBA 4ZVKA 1YTLA 5G3ZA 5T6MA 3THYA 3ZD7A 1K0FA 2MMGA 5CLFA 5KTMA 3I2KA 2ZJ4A 3IE2A 4IIJA 3EJ6A 3N70A 1CUFA 1ODTC 3IEKA 4KQEA 4MVJI 1C7ZA 3KT6A 3M34A 4FLFA 2XMDA 1JEQB 1TK3A 2GCOB 2R6ZA 3DHNA 3N2NA 3GW8A 4LNUA 2ODQA 2PBRA 5C35A 4QJBA 4WZAA 1VRWA 4PFKA 2AQKA 4HWKA 3NOXA 4B6RA 5I4IA 5L4NA 1Q20A 4W7SA 4MDFA 1N5IA 2A4KA 3ANMA 4M89A 4BKOA 1E2MA 1ISMA 1URPA 1H2EA 5C3MA 3ZTYA 4G8BA 1DG1G 1KJYA 2TMDA 3M6LA 3GRUA 1HDEA 1R0WA 4O8CA 4E1VA 4TZ6A 3EVFA 1W8DA 3JSAA 1I2DA 3BDAA 4CCYB 3CMAB 1MG5A 3U9LA 1AA6A 1CZUA 3AHFA 3G5UA 4YJ3B 3OF3A 4ZT2A 2AN9A 1PQPA 5KTOA 1B6SA 2ZBFA 4GP9A 1EWVA 2ZXEA 1V47A 3MMXA 1A1SA 1ORVA 2XVXA 4YAOA 3MLAA 4NK5A 1XMSA 2JC3A 2OXFA 4FPXA 3X1JA 3DXXA 3H2YA 1U04A 4JNKA 3VU9A 4AICA 3BWVA 4DJFC 1Z07A 8GPBA 4N54A 3P2KA 4FS3A 4WA8A 2NZ2A 3EODA 5IKEA 1CR0A 3FNIA 3K94A 4CEHB 4U6SA 2ZZMA 3QKIA 2C5EA 3O9MA 1XDSA 4URFA 3PT9A 1PGPA 2ID7A 2BDTA 2BI8A 2WAXA 3DAHA 1N0UA 3AF5A 4ACAA 2F64A 3IUBA 3MSCA 3PI7A 1QIKA 1QHYA 2M9MA 4YH1A 1BYIA 1OTXA 5JG7A 3ZOKA 3WMEA 3BL8A 1YUMA 3NHPA 2Z2KA 2MYUA 4EHKA 1RBYA 3QYFA 4FMDF 1ZXXA 4TLMB 4BLUA 2L18A 1GNVA 3LLSA 2QW0X 1U0BB 2NV6A 2W9XA 3RI3A 2Z4TA 3Q3JB 3UMFA 2BHNA 5DISB 5B1SA 3DD1A 1USUA 2WF7A 1AT1A 2PLNA 2WWFA 4JKOA 3ADDA 1AKTA 1Q2UA 1UJ4A 1ZRHA 2ZROA 3FH0A 4HDSA 1S2IA 1JDNA 1H2WA 4V24A 3AR8A 3K31A 2XOXA 1U0OC 3G13A 2ZB4A 4J7UA 4LECA 1GNLA 4HMOA 4P80A 4J0QA 4DADA 4BCBA 1CIVA 2ZSAA 4EFNA 3AYZB 2EQ5A 1ZCJA 4IIHA 4BC1A 3GARA 1EVQA 1PBNA 4GICA 4HC4A 2E4XA 4I0WB 2D1TA 3RBAA 3WGTA 4D9CA 5LNK6 3QEAZ 2EW2A 3DEJA 2CUKA 4YLGA 2AL7A 2QTNA 5EUQB 1USVA 1Q3TA 3KLPX 4H7EA 1C80A 3CWCA 2NUTA 4L5IA 4EG6A 4E70A 4MI3A 5KTRA 5LA6A 3MRSA 1ONSA 4RZSA 5HX7A 3MHPA 4OKSA 1CD5A 3IILA 4HQFA 3BA6A 3HXMA 2VTDA 1VCOA 3GVCA 2BFEA 3WIBA 5DX1A 1JKJA 4WH0A 3JQQA 2A5YB 2JK0A 2RFLA 2YXEA 5KJFA 1DJOA 1U2GA 3LX6A 4JODA 1SG9A 1D2AA 3HCBA 4FDVA 3QEKA 2CZQA 1CBUA 3DWGA 4QUHA 3VI3B 5HGJA 2CXXA 1BGWA 3AHHA 4NECA 3THWB 5CFRA 3T6KA 5WRFA 4HAYA 1NW6A 1TK2A 2OV2A 3C2QA 3RQSA 3JRWA 3IEIA 2Y0PA 3NJ8A 3VR6D 3ZJYA 1CY2A 4HLCA 5IAKA 3ZHBA 5K3EA 1AV7A 5JH7A 1ZG3A 3HFJA 3G1WA 5DI9A 1LPBB 3LWBA 5AK5A 1N7HA 4LYDA 2JFXA 1JDTA 1FXUA 1RI5A 4YIHA 1I36A 3S8MA 4D8WA 4YP5A 4BFCA 1YNSA 2ODEA 3DFZA 3DCNA 1XTKA 1MX9A 4WZTA 1T5SA 3VTFA 3SQOA 4R16A 4ZVUA 4AU1A 1E5VA 1PP4A 1NQWA 2DF8A 4WUVA 4KKUA 2V31A 1N2CE 2J4DA 4YJ2A 5DM60 5I7EA 3WKDA 4TZTA 5A88A 1E3SA 2NTEA 2AFHA 5HIIA 5LQUA 3DOOA 1U90A 1LWOA 1V48A 2EX4A 3P9SA 4QQ8A 3VNBA 3BXHA 3PXDA 4NS4A 3EVCA 1PRYA 5TJHA 2FFBA 3A6KA 1E9SA 1WE2A 3KSZO 4P32A 2WWGA 3BMXA 4B74A 1DQZA 3OFSA 2CFRA 4XKVA 1JG2A 2PR2A 4I55B 5IAGA 4QDUA 1VYUA 1Z47A 3EK2A 2JAUA 3ECAA 3JWJA 4KV7A 2A5JA 1FMJA 2X2OA 3AEUB 1LY1A 1V1MA 1C8LA 2JLQA 4RHFA 2QJWA 5IW8A 3RO7A 3R3XA 4E1AA 4GPTA 1E7MA 2JJ8A 3ZHYA 4BVLA 3C3XA 4XRGA 4OLAA 2ZZFA 4BMCA 2BR4A 3K0CC 4C7MA 2C88A 4AY6A 4I9HA 4JX8A 5FR2A 4X8MA 3ER8A 5SYNA 1MVNA 1AK9A 1RRKA 2B6HA 5J58A 1QWOA 1L8AA 3DBOB 3O8LA 4Q05A 2WYWA 1ZM7A 4QA9A 4EY8A 5AVTA 2WI8A 1KA9H 2PRKA 4IF4A 1O9HA 1JAYA 1Z88A 2BISA 2EYUA 4XR6A 2ZRPA 3DCYA 4MRSA 4NWIA 1FP2A 2LKDA 4WVLA 4UXHA 3FXAA 3I32A 1FDIA 1SH7A 5EI5A 3IERA 1XKXA 2HX1A 3RIMA 2YC2C 1TVKB 3HO6A 4MWOA 3SAJA 3GDHA 3HVIA 4H4EA 1BE0A 2HA2A 2ZUDA 1I18A 3GGJA 3RRXA 1T2VA 1FW8A 1NW8A 4G5OA 4LMPA 4YFYA 1VFNA 1DUVG 2FN7A 2E6KA 2OKGA 1OUMA 1SO8A 1J00A 2AVDA 4BZPA 5LMUB 2OCBA 3AP1A 1LA2A 1T9HA 4OI0A 5IH7A 1TU4A 5AHOA 1VI5A 4O0MA 3P4YA 3F90A 2ZJFA 4J1SA 2COKA 4KFSA 1MB2A 1T9DA 2X9GA 1JBQA 1YVDA 3HJUA 3WZMA 2REQA 2X2FA 4JLOA 2Q07A 2Q62A 1HDXA 1R0YA 1RYEA 1EFAA 3A1VA 5IBCA 3FSEA 4F6RB 3PJEA 1B41A 3V33A 4O29A 2Q46A 4J2TA 4PICA 1NI4A 2JGLA 4B9AA 3OEWA 4QYWA 4ZZ1A 3QMWA 5JZOA 3D4PA 4C08A 3O7WA 3QVTA 2O20A 3PR1A 5ER6A 3ZE2B 4J43A 1O0CA 2YNMA 1MJGA 4DIBA 3LC7O 1IBLB 1F2DA 1LJUA 2ZYIA 3DMTC 2ATXA 4EJMA 3A1DA 5EIFA 2CRVA 2AMJA 5B1HA 3OLWA 4RTKA 5L3QB 1E4EB 1NAHA 1NP3A 4KIJA 3CD6B 3MOIA 2BW0A 3AVYA 4UXIA 5EGSA 4M54A 2Q3FA 3KQSA 4ND7A 4HVTA 4C9BA 3JVIA 1FW6A 4DJJA 3L92A 3UAWA 3FTQA 1JEEA 1XRJA 3LNNA 1IRXA 3HSYA 4GE3A 2QP9X 2PV7A 4LYGA 4RABA 5E7IA 1OBHA 1XZLA 3B9QA 1U0JA 2IEDA 3EQ6A 1D2MA 1CLEA 5DM4A 5F23A 3PUJA 3ROKA 1YI1A 3ZWMA 3Q3CA 3DHVA 1XXHA 1N92A 2AVNA 5FTJA 4CMJA 5CFMA 5L40A 3UPUA 3CO5A 1PU2A 1XPUA 2WA1A 3QBVA 2PQ0A 2XBUA 4C07A 3ZZ0A 3I9KA 3RIHA 3PPWA 2HF8A 4REOA 4QXMA 2EJBA 2OZLA 3ZDRA 1ZOSA 1QIMA 3RS9A 1IBSA 1KC3A 4DSOA 2QL5A 4HXGA 3TFWA 1RHUA 5LP6F 4XGRA 1PKXA 5HUHA 3DFKA 5JYBA 5K6AA 2JBHA 5JJKA 1G9SA 3R3SA 1RJGA 2O5VA 3PK0A 3IVMA 4GR5A 1H22A 1R0CA 4EKIA 5C7OO 2X76A 3W5UA 1LZLA 4DQVA 5K0FA 1J8QA 4WHMA 1I3NA 5AUPB 4CEJB 3WGYA 3FPBA 3K0AA 1UBJS 2PD4A 2X2PA 3QENA 1OFGA 2IIVA 1BEUB 1A04A 2XYGA 3BQNB 1WW8A 2BBTA 4JWTA 3RRMA 1C9MA 4F86A 2QLLA 8ADHA 1OAOC 2H2WA 1AM4D 4WCDA 1H0RA 3T9CA 1K7XB 2NW6A 1WOSA 5HA5A 2B1IA 3JCZA 4HAXA 4L3WA 4GHWA 4HT3B 2Q1SA 4W7HA 1ZOPA 4EMBA 5F73A 1E3XA 3IP3A 4NRDA 4F2WA 1NJ6A 2Z5GA 2GN4A 4JQCA 5H83A 3DAOA 1KJZA 3IAEA 4Q9DA 1Z4MA 4F1JA 1VB3A 1PR3A 3FKJA 1QKKA 2BTQB 1S9HA 4UNQA 1H6CA 2QROA 3FUUA 2E4AA 1W7AA 2EX1A 3L46A 3LO8A 1GKIA 1T91A 3O4VA 1U3TA 2QR2A 3CF0A 3P2YA 1Y7PA 4G5HA 5B6IA 1J33A 5FTNA 2CKDA 4FQ8A 3VZRA 4FNMA 4WL0A 4P4SB 4EFLA 4IICA 3KTOA 4JJ7A 5JC8A 1LWNA 4MRVA 2HLNA 4GT1A 3W1WA 3KXIA 4F4JA 2Q0QA 4A2CA 1V5WA 1NX9A 3O74A 2QLNA 4GFDA 3RS4A 5BQXA 4HCJA 2QD5A 1LLDA 1ACMA 4LC0A 1WOMA 2Y0BA 4PN7A 5A5DA 3BIOA 3IAS1 4NTZA 4QYMA 3WMGA 1FUEA 1GVNB 1OFIA 1M6VA 2P35A 3ELYA 1W46A 1PEYA 2O0LA 1PFGA 3UWDA 2F2TA 3C8UA 1PK8A 3ZGVA 1DCTA 3AOGA 1GSOA 4DDUA 2H8GA 1ZW1A 1HEUA 2VO1A 4UCFA 3LD9A 5IYZF 2C2ZA 1I1HA 4JGGA 3V3TA 2X58A 1OWOA 4OUKX 2C2GA 1XJ5A 2I91A 4K0KB 4AKSA 2EU8A 2GHTA 3TX6A 3DMRA 5JAOA 3U1VA 5G1PA 2COUA 1PE0A 5D6NA 2C2MA 4RIEA 3GJQA 2QTLA 4WY2A 4BMDA 1KSGA 4UDNA 3OJLA 3EF1A 4Q4DA 4B3FX 3D1VA 2H1WA 4N3GA 2VJMB 3RVJA 2YZ7A 1PJ5A 1KZ9A 4FONA 5K8VA 2NX2A 2VDQB 3EDOA 4Q6BA 4QUJA 3KVOA 4RK7A 2E4UA 2GX6A 4RDCA 3GJSA 4ND6A 5M29A 4TMZA 3E9QA 3QXCA 3AXSA 3V8BA 4PC6A 2AYYA 4Q0MA 3UJ3X 4CFYA 2Q28A 1ZNXA 3K0HA 1JH9A 1U80A 3JASB 3PNOA 4X44A 4TUYA 3IR5A 5EJ2A 2CDNA 2A9FA 5CK5A 4QVJA 3L9WA 5E6RA 1UZUA 1Z36A 1EH5A 2CXNA 1NPDA 2AYXA 1AQYA 2EYQA 3A70A 3DQPA 3GRPA 3GT3A 4KDFA 5GJCA 3MCUA 4CYMA 1MZPA 1ZU4A 1CDOA 4FGLA 1PUJA 2W22A 3PEFA 4I1UA 1V11A 2ONCA 5IJ0B 4CEIB 2NQTA 1Q44A 1OY1A 4H08A 4OU4A 5EIAA 2WNSA 3E8XA 2P2GA 3MT9A 4C7BA 2GJSA 2B4YA 1HT2E 2K2WA 2X7HA 2JGMA 3AR4A 1DHRA 3ORFA 4Z2YA 2VHXA 4Q03A 2BDUA 3IAHA 3IPAA 5FF9A 5HBGA 3KXDA 5AM4A 2QXTA 1QFMA 3U6KA 2FW0A 1IJKA 2OENG 3ITDA 2VF4X 4JQYA 4C0JA 3J81k 1E5QA 1GGKA 2HA0A 3ILHA 5GTDA 5AP9A 4EG5A 3H2GA 4MVXA 4GQNA 1QFSA 2KBFA 1SQGA 3N2YA 1DCMA 3VKUA 1ZS9A 1XAJA 4RVFA 4TM8A 5HM6A 4L5JA 1XU4A 4QTUB 2FB9A 3TRIA 2ZJ5A 4AJKA 3ZWAA 4XLLA 3LLUA 4GI1A 2A1UB 3PYLA 2PZLA 5JNVA 3EGCA 2OLKA 2NO4A 4XM2A 1RPZA 4KQ9A 2ZRKA 4FX2A 3Q8LA 2B30A 2HPVA 4M8IA 3HP1A 3MJSA 4LZWA 5LB2A 4AXBA 5DYIA 3DEYX 4LGCA 3TBHA 1NSTA 2OOKA 4L8LA 3QXHA 4XLTA 4TMFA 3ZX4A 1N78A 2G76A 4PGGA 1GZ7A 4RJ2A 5AKHA 2HQBA 1WHSA 5DCLA 1DEAA 4IHJA 2FOIA 1CRWG 4Z0HO 1Q0UA 5CT6A 1G5RA 2VJDA 3DBLB 2F1IA 4Y7DA 5LQJA 1YGPA 4NZPA 2X1MA 4R1PA 5DTIA 5SYAA 2AWOA 2X7JA 2IOYA 3PE4A 1PSWA 3QBDA 4ZOLA 2BBOA 4LSMA 4MV1A 4DNFA 1R9JA 5JQGA 4XFDA 5E2BA 4UTXA 1IZ8A 5G1OA 4ZYVA 1CVIA 4J6FA 3VR2D 3DVLA 3MS4A 2O48X 2I76A 2IT1A 2HZ7A 2C07A 2QLFA 4KODA 4LHYA 2RKBA 3T4PA 3HJBA 1E5DA 4OMUA 3B3QA 2IYFA 2JFQA 3W6UA 5EJ4A 1SCIA 1R4NB 2P9QA 2WHYA 2ZATA 3VH2A 2P69A 4N1AA 4WLEA 4UD6A 2VOEA 3CLSD 4ZCRA 4TX1A 1FXWA 4J1NA 2AEFA 3TL6A 1NE2A 2W2MA 2WG0A 2X8JA 3R6GA 1WSVA 4Q4HB 5HKKA 1W25A 3CWZA 3F3YA 4KJZA 4D02A 5IDVA 1FFGA 1KEZA 1UBOS 3V7WA 4B0OA 3N7UA 1II0A 4MICA 1ACLA 2E37A 3FHCB 2J9FA 2JJQA 1MV5A 2PVSA 3CX6A 1UC5B 5C80A 4BLRA 2YJNA 4P7BA 1NI5A 3OKFA 1TCUA 1BU8A 2BFCA 4NOLA 2IH4A 3R7LA 1BMDA 4B3CA 2EOAA 1KZ4A 2F9FA 4EB6A 3ONFA 1IOWA 1S2OA 3RU9A 1C41A 3UKOA 2WNHA 3N75A 5CT9A 3QSYA 3SD7A 2QPOA 3C15C 1Y8ZA 3WLPA 1FA9A 1XVTA 4OA8A 4X85A 2HO5A 4GP7A 1QB7A 3DMFA 2O06A 1YB4A 1AURA 4JJ6A 1OHHD 4GMHA 4BO0A 2DTDA 1M6EX 2ACWA 3E9YA 4US1R 4K8OA 5I8PA 3FTDA 4DCMA 2WSSA 3HBMA 5GONF 4Z1OA 1U7WA 4GL4A 5PNTA 3G5TA 3DTVB 3UJ7A 3F74A 4BX3A 4XWAA 1SVOA 5HPYB 1CQJA 3IJRA 1M72A 2JGDB 5DLQC 1QMPA 4D8XA 3Q3VA 2A3NA 3GIDA 4QREA 3AKCA 5DN6D 1CNEA 1A8HA 1EXVA 1PR9A 4GC5A 4HAUA 4O2AA 1MNQA 5KVQA 1GQYA 4CXMA 1Z3IX 2XJ4A 4F5DA 2FG5A 1VJ1A 3OBBA 4MVJA 3VR1A 4NJMB 3CJRA 4KPYA 2YJ6A 3NHJA 3NRJA 1IOZA 4V2UA 4U63A 4XD7D 4ZVTA 1JIUA 1JTFA 3B85A 4PINA 4RCYA 1J8VA 2CLDX 2IYEA 2QRVA 3BIJA 4NYJR 2YMLA 3TLKA 3OO0A 4DXHA 3EGDA 4XPIB 1YZGA 3OZVA 2FF5A 3AIKA 2DUJA 4ZP1A 3QFTA 1V16A 3IMCA 4EW1A 2J09A 1LDBA 5KAMA 2C57A 2W8BA 4KNWA 3TBKA 4BFVA 5JZVA 3E9CA 3QVLA 4MW9A 3C3CA 3ZTWA 2RJ3A 1NE7A 4O4HF 2OYSA 3DEIA 3AUYA 4V3CA 2YIDA 5LLDA 4R51A 3OUUA 1KPIA 4TL7A 4J2HA 4LY0A 2I3GA 2B83A 5BOSB 1QGOA 1XKQA 4KHZA 4M0KA 3O31A 3SLDA 1CCWA 1IBRA 3NHSA 4XM1A 3RVPA 5BSGA 4KXWA 4YPVA 2ISQA 3HCEA 5JJLA 1SQ0A 1WDWB 2AXEA 1HLFA 4MUFA 2J0QA 4AN0A 1RR6A 2O3RA 3LYHA 5F2EA 1JEYA 2VOJA 1AF4A 1T0BA 2G5GX 2VK8A 3E3LA 3FTCA 2HM7A 3PTLA 3ETNA 5CAEB 1DDIA 2J1LA 2V7EA 4OHKA 5EA2A 3SOZA 2O8FB 2ZSHA 3T5MA 1JT9A 2WKQA 2FEKA 1I4DD 3KSDO 4K81B 2YWJA 4BLVA 4CG0A 1KQGA 3VR3A 4NCJA 1JHMA 1O5TA 3BZBA 1RM5A 4GLOA 1FRQA 2BFWA 3DF7A 2ZI9A 5DASA 1BXKA 2R00C 4CCWA 5CIYA 5AKIA 1POWA 2BVNA 1TJ4A 2OBFA 4DQLA 1GFSA 3K5IA 4RPDA 1NLZA 3KB8A 3U3OA 4ETWA 1E7SA 4UTOA 1I2AA 1EWRA 3G7NA 4I4LA 3KLOA 4XUEA 2SHKA 4AO8A 2NUAA 2J3HA 1PCXA 3GL9A 4K7JA 5KCZA 3QX8A 4HZIA 3B6KA 1AY0A 3GFRA 4L7QA 1KYIA 3RT9A 4WKOA 5IDQA 3JYLA 1O7JA 2ZDHA 1QWSA 2ZWMA 3LHSA 1WOPA 1F8GA 3OG9A 1WD7A 1ZKMA 2OP0A 1VGVA 5FBWB 3CESA 3RCBA 2DR2A 1W44A 1NXTA 3ESAA 1LI4A 1C1HA 2AG5A 1RZRD 2ZZEA 1NOKA 1HEIA 3BK2A 2OT3B 4DUYB 3DC2A 1GU0A 5BSKA 1ADFA 1DOHA 4LF6B 3M5WA 2A59A 1MW9X 2PT7A 3WJ1A 1IY8A 4MGEA 5IVDA 4MARA 1EI9A 3IL2A 2JIOA 4NONA 3GWZA 1Q57A 3O3NB 4WZKA 1ULHA 2X9VA 4UPVA 4FT4A 4K03A 5EQTA 3VHXB 1X42A 2IHVA 3K9FC 1HH4A 2RB5A 1QTIA 3OCUA 2UVQA 4YEDA 3PZRA 4WXMA 1JDJA 1NF9A 2EGHA 3P96A 4W9NA 4B2PA 4WOJA 4EJ0A 4URWR 1F0NA 1H3NA 1BC5A 2RHGB 1U81A 4N5IX 3AIMA 1E7RA 4MP3A 2I1WA 5A7GA 1IWOA 1NDHA 3MXOA 3UYLA 4JJ8A 4RPHA 1JDBC 3DTYA 1N6NA 3KL9A 4C0WA 2J48A 2MSDB 5D2CA 4ZJPA 2I54A 5DTQA 1GPNA 3EGVA 5EJEA 2JI9A 3JQRA 3FDJA 3P9NA 4QXQA 2QL6A 2ENUA 3CW8X 1ZD8A 1YWGO 4HN9A 3Q3IA 5CMLA 3VNAA 4EABA 2J0SA 4XZ3A 3LWZA 4HDNA 5JNSA 3UGJA 2CBGA 1W59A 2XNJA 4XMYA 4CMBA 4F60A 3CC4B 2W42A 3SEJA 3JQGA 4L3VA 3WYAA 3NAQA 2SKCA 2WICA 2X5KO 3K6KA 2PTGA 4RSGA 5BQOA 4YRGA 2YW2A 3H8JA 1L5HB 4A15A 3CC2B 4FZ3A 3OFKA 3C24A 1UPFA 2ZI5A 1GZ5A 3ESDA 2IOFK 4QASA 4XUGB 4B6QA 3ZNPA 5FLEX 4YJ3F 4IDNA 3BD9A 1QVRA 5ECDA 4C0KA 4POOA 1T4BA 1ZJ4A 2GTHA 4OH1A 1I14A 4XN3A 3MJTA 3F1KA 1A9ZA 1CUYA 3W9UA 1H1LA 1LCIA 3AKDA 4CMEA 4FFWA 4MPTA 1ZIOA 1N8RD 2CLEB 3IPRA 1Y42X 2VYFA 3C3KA 5ERGB 3GHYA 2MSCB 5KYUA 2AZXA 2NUPA 2XUQA 5K3OA 1XRPA 5C46F 1HE5A 2IOQA 4XYLA 4Y6GB 2ONKA 1I8DA 1KU6A 3TSAA 1RHMA 1KP3A 2R8BA 3L5OA 1R8YA 2IUFA 1PL6A 4PAWA 2AIRA 3EZLA 1VTKA 5EJAA 5F12A 3T8YA 3TXAA 5BOVA 4CM4A 2J3KA 3HB5X 3WK4A 2D7DA 1M6YA 3DOUA 2GCEA 1H1TA 3EC7A 5DO9A 4Z1MD 2ZL7A 4HI0E 3WBKA 4A16A 2Z3VA 2RI6A 3U0BA 4DLKA 1F20A 5DGIA 3WKCA 1SCAA 2HC9A 3LXXA 2B69A 3ETLA 4HGZA 1LDYA 3L7MA 1DX4A 4YMTA 5TPWB 2DRIA 1QCDA 2PLFA 3T5GA 5C1PA 4WKPA 3OOSA 1H1DA 1M2WA 1EHYA 1F8YA 1PW7A 2V5VA 3L1KA 4R3UC 3OQOA 3LHFA 5IKMA 3A9TA 4KE9A 1VL2A 4L5YA 2QMOA 1NHGA 4OMCA 4Q4JA 1T3GA 2QLTA 3ETGA 4LVOA 3VTKA 1Y0YA 1LF5A 3AUXA 5JXGA 1NN0A 1Z7YA 4WESB 3R7NA 1J0DA 3LUGA 5J4LA 3CF2A 3E9MA 3VKWA 4E31A 1B0UA 4MUAA 1P4AA 3AEYA 2QOEA 1NM5C 1ECPA 3H13A 3EXHA 1Q6YA 4LF4B 1XTSA 1PFKA 3AESB 3JQ8B 3JRNA 2QM3A 4JIGA 4DXDA 2YOHA 3DE7X 1PR5A 1M54A 3HCWA 4RSRA 3KSMA 3ANLA 1YASA 7YASA 1FJGB 5FADA 2OD7A 3WFZA 1GA4A 3K4PA 5L3SB 5LYJF 2PL5A 5AVKA 1YB1A 4P08A 4G8DA 4BO6A 1I10A 5IDWA 1VKRA 4TV9B 5JWRA 4I2VA 3UJCA 1AXRA 1G8JA 3ZZTA 1F8FA 4RD4A 1FRFS 4AF6A 1G5TA 2OB1A 3TVYA 2GXQA 2CCGA 2DP4E 1AH2A 2Y05A 3PQ5A 4U9IS 1JYSA 3S4YA 1BQ4A 1UXHA 1NVWQ 3TM4A 4DIUA 3W0LB 3SXPA 5IT4A 5IBPA 3U5TA 3MUOA 1XP8A 4DQDA 1DP4A 1MJNA 3BSFA 3OEED 3ZGZA 2XPCA 4C89A 1W88B 4WY5A 4EUNA 5TX7A 3AETB 5FUVA 1BDBA 5KB3A 1PQ4A 4IJQA 4ZQFA 2EIXA 4HS4A 3E9ZA 3I23A 4XYBA 3I1FA 4B33A 2X0KA 3C8MA 1AGPA 4QE3A 4NEGA 4YJDA 3X1DA 3CX8A 1YBAA 4M7WA 2OCDA 1G5HA 1PJAA 3QBEA 3TMAA 1IN1A 3O1LA 3WHPA 2DBVO 4OAQA 3HDVA 2R1VA 4D4IA 2QTRA 3GDGA 2NV4A 3KLBA 5KWJA 2W5UA 2A9KA 3RC8A 1QH9A 4N9WA 1ITZA 5FWAA 2WFLB 3I9JA 4AY5A 2VFAA 2A9OA 2GVDC 2GUGA 2WYUA 4FLEA 3OA2A 4G4JA 4OJQA 1L7MA 4U2DA 1QFJA 4ROSA 2O0KA 1H5NA 2PKYX 4G4SO 2C4MA 1JLRA 4KBGA 1JXQA 1AKWA 1XN4A 4TYQA 3FE2A 1CHNA 1JJFA 3VO1A 1AD2A 1H2FA 4LFBB 2N75A 2C3UA 1U28A 3JVEA 3OKCA 3OOWA 4OL0A 1Q17A 3Q11A 3H1PA 3HR8A 3IOMA 4QNMA 4RMGA 4UARA 3MHTA 5AXAA 3HYLA 1V0FA 2C04A 4HTAA 1SC3A 4V0MA 3H16A 4KZPA 4WOKA 4YFVA 5IDYA 1LEHA 2BZSA 2NQ8A 3H04A 5EHGA 5SY9A 3CPXA 1KMHB 3GPBA 4KAAA 1W9MA 5GMOA 3GYGA 4D4MA 4M0FA 4ZYWA 1ZW6A 2GWRA 4NE9A 1KWKA 3SHTA 1M76A 3B8EA 5DNEA 1FS5A 1MO6A 1T2AA 1V9LA 2OEPA 3DC7A 3HYTA 5JWHA 4QPZA 1A97A 4BV2A 3I01A 4XCQA 1GQFA 1LSUA 3NIBA 4N9QA 521PA 1YUBA 3MJRA 1EUDA 3PD0A 1Q7CA 1R0KA 1WR8A 3VSEA 2XYPA 1S8OA 1UM9B 4P81A 4ZOBA 4BMVA 3QKTA 3SVTA 2GVZC 5ARDA 4OATA 4E6EA 4C0HA 1KK2A 1PFYA 2BMDA 2QF7A 4QPJC 5HILA 2QK4A 3O8BA 5E1OA 4UAJA 1UXOA 3RF7A 2D4HA 2JGNA 5G53C 4HB4A 1WO8A 1XWFA 1PL8A 3X1WA 1KO8A 4JLBA 4OP7A 5JFGA 4JI6B 1WXIA 1G60A 1IY9A 1HT3A 1NKSA 1W4ZA 3B12A 3HLTA 3UNXA 3O84A 3GLIA 1TTHA 1GTJ1 1JTVA 2GJKA 2VBIA 4TQGA 3QLUA 3WXBA 1IVSA 4S3MA 5JS2A 4F92B 3O8RA 2G1PA 1ND5A 4UUBA 1Q22A 3E5NA 4LF7B 1WQ3A 5C8YA 4ACBA 5FYQA 1BW9B 3UGTA 2AZTA 1ISPA 4Z4RA 3NHLA 3RT1A 2HXYA 2WWYA 3KXLA 1V8BA 3N8GA 4YDHB 5JAQA 3WWYA 3AUJB 4I9GA 5AVZA 4OMDA 2NVUB 2DUUA 1E6MA 3H5AA 5HMMA 4DLSA 2PANA 3QLVC 2Q6KA 4PPYA 4N7JA 2F1MA 4TKVB 1CY4A 1EG2A 3KUDA 2B1JA 9LDBA 2O1SA 1BE8A 3RAFC 2FFRA 2PO7A 4RZ3A 4MVJH 4O4JA 3PQ3A 5ILQA 4XM3A 1L4FA 3RS0A 1RWVA 3TN7A 3A8TA 1X7XB 1ZMRA 1FJ2A 3A9SA 3BHNA 4IQGA 3UUGA 4EEXA 4RULA 1Q1AA 5TJ9A 5JDCC 4NNJA 1WSAA 3W2HA 1QK3A 4O5OA 5H1YA 1TUEA 2VPZA 1TF7A 1EE1A 3QHPA 2Q0XA 4CL2A 3Q85A 4S05A 3N9IA 1NVXQ 2JASA 3HKCA 2BY4A 2FOXA 2INGX 3NYRA 3OCXA 3OA0A 3B5JA 4UVIA 1P29A 5B30A 4I19A 2G82A 1JG4A 5L7YA 3MINB 2OO5A 3VXKA 1MA0A 1K28D 2FWRA 5DX8A 1GPYA 1MC5A 1ZPDA 2HJGA 3BXPA 3EMKA 3N28A 4OLHA 1PG0A 5F3RA 1ZONA 3RAGA 3UAZA 1KJJA 3IAAA 3T3PB 2GI4A 2ID8A 4I14A 4J7CA 4NBSA 4RLZA 3FB4A 5LWQA 4XEHA 2I2BA 5CT4A 2AI1A 4M0CA 3V8MA 3H2JA 1YMQA 2CEKA 3ZUPA 4ZYUA 2C98A 3WB0A 1YZLA 3TZ6A 3GDWA 1FMFA 2EDAA 3CRNA 4F85A 4HAWA 4BTLA 3C5CA 3FNQA 1N36B 3K9LA 4LJSA 1QPBA 4JY7A 2P5SA 1YITB 5TF0A 3W6NA 2Z5FA 2VK1A 3R5XA 5LC1A 2HCJB 2P9EA 5HKBA 1MJFA 2EKQA 3SQDA 2JFOA 1GY8A 1P61B 2E5FA 2AFIA 1OBOA 3M3DA 5JNLA 5KTYA 1CYDA 2FSUA 1ZJWA 2ZZNA 4Q1AA 1TF5A 5LLTA 4R8VA 2F1HA 4L95C 3F71A 4UUNA 1IPHA 1NMEA 1RQXA 4EPVA 4J03A 4QATA 1EFVA 3USZA 3DOEA 3LU1A 3ZLBA 1MENA 4TTSA 5B2FA 5C4IA 3DE1X 5C5CA 1EFHA 1B4DA 1P74A 1HZZA 1N2CB 1XQVA 3OJWA 2FR1A 1QR6A 4GC9A 5JAZA 2NQ2C 5LMZA 1DKNA 1U11A