4RD6A

Structure of aif2-gamma from sulfolobus solfataricus bound to gdp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
414
structure length
405
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 110
structure length 405
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd6A01
3DPUA 3EPJA 2BN4A 1U0HC 1W1WA 1MRSA 2XNCA 3AVUA 4KODA 2ZS9A 4BQSA 4L9WA 2XXAB 1XTSA 1H85A 1E1QD 2BWJA 2BIFA 3IILA 4AWXA 2QSYA 3K70D 1IOZA 1JJ7A 4TMVA 4DDWA 4TSFD 1S3SA 3IBYA 1EFCA 2Q3MA 4HLDA 5JEDA 4N3NA 3EWAA 4DLVA 1OF1A 5FBWB 1XTRA 5FL7A 1O87A 3IIMA 4M8NE 3OE7D 3OFNA 4QM7A 2WPDA 4QJ5A 1W36C 1IY1A 4K81B 3C8UA 5KSWB 3A1UA 5HE9A 4URZR 1XD8A 1BYIA 3ETLA 3DEFA 2PCJA 3F0TA 1XXHA 4L5BA 4P0TA 4Q1EA 3RRNA 4A92A 2AR7A 4DCNA 3SFVA 4ESHA 5JFGA 1OH5A 3H4MA 2VA8A 3B1YA 3ZGXA 1VIAA 3NWJA 5CB8A 3NDBB 2QSZA 4PPGA 3ICEA 1HURA 4DLYA 1XEWX 2IL1A 1E2LA 3GJ7A 1QH0A 1OGIA 2F3TA 5B64A 2FV8A 2ZETA 4U5XA 5BN5A 1KJYA 3VNUA 1GTVA 2BGJA 2ZI6A 2J7PD 3S1AB 4WQMA 3VFDA 5JS7A 1EWQA 5G53C 2DFNA 1KI7A 4DT1B 1CU1A 2MMCA 2WVJA 4RCYA 4RY2A 5L3RA 5FBQB 3A4MA 3LO5A 5LB2A 2YZ2A 1CJKC 5CM9C 3SE0A 1EXMA 1JBKA 1U8YA 1OLOA 1T8TA 2QGNA 3AF0A 2QQEA 4CEHA 2F1RA 4RCZA 5JCPA 1E94E 3U7FB 4F7DA 3WY9A 1GP2A 2E1RA 1UFQA 1KDTA 1G41A 4M9SA 3IQWA 3K1JA 1VG1A 5FUVA 5E95A 4M1OA 4BFXA 1UMKA 4LV8B 3RRZA 4IOLA 3SHFA 2HCBA 4G1VA 4W5WA 2EFDB 3K53A 3LX5A 2VL7A 3EW9A 3CMAB 1OH7A 3I8XA 1GDDA 2FU5C 4D2IA 2DPXA 2ERYA 1UJ2A 4RZUA 1N5JA 3THWA 1DTSA 1IN4A 4QL3A 5EMNA 2XJ4A 4URWR 1HH4A 2NTYC 4K46A 1R5BA 2VYFA 5C4GB 3OIUA 1KAGA 4U02A 2BDTA 1FNBA 1E2FA 4IDHA 2W58A 1F48A 3UKDA 2IXFA 2YOHA 3LFUA 4N0EA 5SZIA 4M4SA 4DDVA 1NY6A 1L2TA 5C4MA 2WMNB 1SXJB 5CLQA 2DBYA 2P3SA 3MWKA 4QXAA 1N5KA 1NIJA 1RVDA 1F6BA 2GCOB 1GNRA 1AK2A 1U94A 5AUPB 5CDFE 4C43A 2D62A 2XTNA 1LFDB 2ZE5A 2ZJZA 4IDPA 4AD8A 4C0BA 5HXBA 4Q4JB 3R9IA 4D26A 1ETUA 4DLUA 4RZXA 3ND9A 2X8AA 1MO4A 2I1VB 5F3WB 3FB4A 1KK2A 5KSYA 3V76A 3AUYA 4G3XA 5FPSA 3W90A 2CNWD 4JJKA 4B6EA 2IS6A 1CJUC 6Q21A 3NH6A 2O5VA 4TLBA 1X1SA 5L3QA 3K09A 3FFAA 1ONBA 4B4DA 3QXXA 2VF8A 1KY2A 1TQ4A 2REOA 1IONA 1E98A 1KO4A 1NIPA 4L16A 2HUPA 2YOFA 4Q4AB 1EWRA 2GBLC 4HATA 4TL7A 4C0KA 2ZRKA 4DXAA 5TMPA 3GLIE 3A58B 2N42A 3LW8A 5TVKA 4IFBA 3SDZA 5KO2A 5C18A 3HYRA 4DDUA 1IBRA 1E99A 1E9AA 2N46A 3VR3A 1PJRA 1G7CA 1YITB 2IHBA 1BYUA 4BPRA 4FN5A 2PZFA 5EUMA 1E2KA 1N0VC 2GXQA 1ZUHA 1EFHA 5L3VA 1G8YA 3PUVA 2A5GA 3T06B 3U7EB 4JMPA 1UM8A 4HSEA 2H18A 1XCGB 5HZHA 4A0RA 2IXEA 2ZJOA 4FCTA 4IHQA 3PIRA 4TLAA 3U60B 1UKVY 3I8SA 4BFWA 1DBSA 2GAAA 2IEYA 3TH5A 1NKSA 1L7VC 4LJ8A 3ZJYA 2J0UB 1QFZA 4IDOA 2FPMA 4LJ4A 1SM4A 5HKKA 1NMYA 2BC9A 1TF2A 2CBZA 3HU1A 2F1JA 1U8AA 4HLUA 3O47A 2W0MA 5L8VA 3OIYA 2O8FB 4P6VF 5FOTA 2VLIA 1OXUA 2F1HA 1UDXA 1B0UA 1JB9A 3PUXA 4A36A 4KJZA 2QN6A 4MGIR 2YVUA 1LS6A 2J7KA 1IY0A 4QBGB 5B30A 5HR5A 2DCUA 3D3QA 3GJ6A 4GSYA 5UKDA 4OQLA 2A9KA 2CXXA 2ZE6A 3CF0A 2J45A 2Q3HA 4NP6A 5CITA 4IVPA 2R8RA 2BBOA 2CL6X 4IOMA 2YHSA 2VH5R 4RKEA 3RS7A 1LVGA 1Z0KA 1ZIOA 1WCV1 4C0LA 5EP4A 3CRRA 4LK2A 3L8YA 4NPHA 1WQ1R 4UNPA 3WYFA 1PV4A 1A2BA 2Q9AA 4B47A 3W2IA 4B3CA 1G1MA 3A8TA 3MJHA 1OIWA 2Z83A 3FPAA 4BFTA 1Q3HA 4Q01A 1RPZA 3REGA 2QGZA 4I81A 4Y9RA 2IUSA 5EE1A 1DO2A 4TT3D 5FI1B 4ZCMA 4A0HA 2GPJA 4DDTA 3IHLA 4F93B 4Q4LA 3OZWA 2Z4SA 4JLMA 2ZIAA 3CB4A 2JLXA 4BWYA 3QF4A 3EC1A 4Q1CA 3CX6A 3X1XA 1ZU4A 4B71A 4BRWA 1TUEA 5KTYA 3ASYA 2VHTA 3W6NA 4KYIB 5CJ2A 1IXSB 3ZVLA 3ZC3A 2GEDA 1FPMA 2A5FA 4N0DA 5AWFC 3V9PA 4HDOB 1VQLB 2OESA 3CWQA 1OB5A 4YMWA 4A2PA 2WWIA 1AN0A 2QAGB 3GEHA 2RKOA 1GG2A 1OT3A 1US8A 3L2OB 3KJIA 2HXSA 2PJRA 2QY9A 4YMTA 2GXAA 4ZDJA 2ZRDA 3B5JA 4QC2A 1ZMXA 4YHBA 1XE1A 2CEAA 3UMRA 4ZPXA 4BFSA 3U6KA 2RGEA 5GV8A 1RRGA 2QPTA 2FJUA 5FTMA 1IN5A 2BV3A 2BBSA 8OHMA 4IKEA 1ZUNB 3W8NA 2MSDB 3CIOA 2CL7X 2H16A 2RHDA 1U81A 3K0AB 1VQPB 4KLNA 4LSGA 1IXZA 4EQ6B 3ZD6A 2GJ8A 4Q47A 1TVCA 5FI0B 3CUEF 3I5YA 4ZDIA 1SXJA 4URVR 1EP2B 1NVVQ 4ZCLA 1A5TA 2OAQ1 2IS2A 2ZTSA 3FHOA 2QTZA 5DHAA 2CJWB 2EW1A 5TDHA 1BKDR 1NMXA 2RGXA 3ZBTA 4E5UA 5EE9A 4Q7JB 1AS2A 5DO9A 3T61A 3CCVB 5EXPA 5CIWA 3BJIC 5FR2A 4TMKA 3K09C 2ZANA 1N6KA 2N1BA 3OEHD 1WBDA 1R8SA 1G6HA 4F91B 4URXR 1KAOA 1ZU5A 1M7HA 2NO7A 3IO5A 2UKDA 1GVHA 1U9IA 1ZINA 2NG1A 3NVAA 4FMCF 4YLGA 5G3ZA 1P61B 2QEQA 3X1YA 1NJGA 1G291 1EWYA 1Z08A 1I7PA 4HB4A 1KI9A 3PEWA 1W35A 3QKRA 3UPUA 5M04A 2IYYA 3QPVA 1SVLA 3QVUA 3R9WA 4LI0A 1RC8A 3KX2A 4WXRA 4MKFA 5LDDC 2AWNA 2QAGA 4AYTA 4LX0A 4JS0A 3PUZA 3L0OA 3FMIA 1LB1B 4QHTA 2GAOA 3LA6A 5J4KA 2JLSA 2JATA 2AFIE 4QGFA 3G4SB 3PQCA 4MDFA 2W6JA 1Q82D 1HQCA 3CZPA 2ECKA 4MRRA 2OEPA 3FJOA 4FWTA 3L0PA 3LLUA 1N6IA 1YZTA 4MYCA 2KE5A 3H0KA 1X86B 4AG6A 1OH8A 2OK8A 1Z6TA 4G0NA 3DO6A 5FPKA 3MGCA 1GITA 2ZRCA 5J40A 4PGOA 4GBMA 4GZLA 3OZUA 1D6JA 2WOOA 2ZI7A 3ES9A 2IA5A 3EA5A 2X2EA 1P9WA 2WKQA 5KU1A 2J0VA 1GKIA 4M22A 4OHZA 4ZKDA 2G6BA 3LVRE 2JLZA 4NU0A 4ILEA 1XRJA 1R5NA 4IVRA 4O0MA 3CWZA 3P4XA 5BN4A 1J8YF 1VECA 4AIIA 3KKQA 1N6HA 2ZJ2A 1X8JA 3U7HB 4IJMA 1EX6A 2QTHA 1VQ7B 3CM0A 2V55B 1SGWA 2YWHA 3K0CC 1GM5A 2W2XA 4ZCIA 3CNLA 4HE5A 2JLRA 3OIWA 1P6XA 5HE8A 2QUZA 3V4RA 4P33A 1GNPA 1F60A 2ZJAA 3RAPR 1WA5A 1K6MA 2GCNA 2XSZA 3MRSA 2H92A 3IDQA 1YI2B 1G3QA 2QG6A 2JGNA 3CONA 3KKNA 1E9BA 2XXAA 5CLLA 4HAZA 4LC0A 1G5RA 3CBQA 821PA 4DLSA 3QY0A 2ZRNA 2VBCA 4CT5A 5EE5B 3CZQA 4BLPA 3OEHA 5DN6D 1M6NA 1RIFA 2Q0HA 2QBYA 2WTUA 1Q7YD 1U2RA 4JT4A 4TLEA 1KK0A 2RGGA 1D9ZA 3T35A 3VR5A 1P4SA 4L8GA 1QHIA 4QNRA 2IF2A 1Q12A 2AK2A 1AGRA 3U3OA 3I61A 4US1R 2BBWA 3FDIA 5A0FA 3AF4A 2KI5A 4PX9A 2AN9A 2ZYTX 3SHWA 1ZM7A 2W2TA 3HR8A 4EFNA 1UKZA 4PSAA 2RMKA 5J4LA 2OTLB 4LZZA 4LYHA 4L15A 2WMOB 3GLFE 2NMVA 1PLLA 1Q0UA 1SULA 2ZPTX 3GFPA 5DSZA 4KSBA 4AY2A 3CCRB 1KSFX 4KVAA 2HYDA 4NCNA 1TX4B 2CVFA 2HEIA 3TK1A 4PQFA 1C1YA 1SQ5A 1E4YA 2CJWA 4Y9UA 2W83A 5BWMA 1CQXA 3MSXA 1F2UB 3QXHA 4D80A 5DH9A 3QFSA 5KPJA 1KK3A 4UJ3A 1FDRA 3THXA 3VU9B 2PX0A 1Z0DA 3TVTA 4IXMA 5FOSA 4Q4JA 4V0LA 4EPYA 2CLCX 4PAQA 1XPUA 4RSGA 2YC2C 1FUKA 1W5TA 2GXUA 1IHUA 4LC1A 3KTAB 2VF7A 2OV2A 5F2EA 2FN4A 2B7CA 3CC4B 1M8PA 1B2RA 2ZUBA 4PO9A 1XTJA 1NVWQ 4IVQA 1SKYB 5TXGA 5JJKA 2BMFA 1XEXA 2Q9BA 2CE2X 4V0MA 2C9CA 4Z1MA 2Q6TA 1MOZA 5JRJA 1HQYE 4KBGA 1YZQA 2H7VA 4HUQB 1US8B 5HPYB 3EPKA 5JEEA 1Z06A 1QVGB 1CR1A 3ZS9A 4LJAA 1ZM4A 1T6NA 2F43A 2ANBA 2PBRA 2FPLA 3OJWA 4NZYA 3S1AA 4FCVA 1J9ZA 4WA7A 3EASA 1OIXA 2O0HA 3DOEA 3L82B 1Q3TA 4BZQA 1UEIA 4YONB 3AVPA 4JL5A 5AJWA 3R8FA 2QTLA 4PANA 1KMHA 1E2DA 2A5JA 2C99A 2B5OA 2QM8A 4NHOA 4CEHB 2RGCA 1N0WA 4HB2A 1AS3A 2ZSBA 3EZ9A 3BB1A 4EFLA 2BOVA 1CS4C 2QROA 4B74A 4Q02A 1QFYA 3W2FA 3LBHA 4GL2A 4QGAA 3H2YA 1NY5A 1OHHD 4GOKA 5LPNA 2PCLA 1H8HA 3R9XA 3TR5A 4ZIRA 1T8UA 1ZW6A 3I62A 1XD2B 1KJWA 1RRFA 1WXQA 1VMAA 1W0JA 4NKRA 2XEXA 1ZNYA 2OZEA 4MITA 2YC4C 2HF9A 2Z4RA 3L0SA 4NYIQ 1BOFA 3VX4A 1JAIA 1F2TB 4D0GA 1YRBA 1HEIA 3IQXA 3JVVA 3T15A 2X3UA 3NHBA 2JLQA 1Q81D 1KNXA 4XOIA 2YWEA 2WSMA 3IIKA 4DLWA 4JBYA 1T3SA 4A4DA 2H5EA 3LH5A 3VTKA 2C04A 5AUOB 1OSNA 1OYWA 3THOA 5EXSA 1FMJA 2D7DA 1E2JA 2E9SA 2GF0A 2FMXA 3JVUA 2GESA 3KB1A 5FR1A 2VP6A 2X2FA 1G8PA 3WRXC 3CPHA 2OK7A 2EFEB 3K0EA 5EP3A 4EPWA 4LPKA 1S8FA 4UJ5A 2SHKA 1KTVA 2WOJA 1CRQA 1GOTA 1CNFA 2BEJA 1COWA 1D9XA 4R2HA 1CKEA 3ZD7A 2ZJYA 1VDZA 4TYQA 4IDNA 1E2GA 5TV2A 2YV5A 4PZLA 4MGKR 3ZZUA 3C41J 3Q85A 3EPHA 5AN9A 2FGJA 1E3MA 1CULC 4LYJA 2GA8A 4EPXA 1BMFD 3FMOB 4DCSA 2ZRPA 1NDHA 1W4AA 4JBWA 1IXRC 3K9HA 5K8UA 1I4DD 5FPHA 3W6OA 2RHMA 1IY2A 2H8KA 3KKOA 2OXCA 3ZS8A 5TR9A 2QTVB 3QG5A 3FOZA 3W3ZB 4QBIA 3TE6A 1JNYA 2QA5A 3BS4A 2WICA 5H1YA 5FUWA 2Z5FA 2OTJB 4CYMA 4TTQA 3KUCA 4O2LA 4ZKEA 1E32A 1RZ3A 4QKQA 2XB2A 2G77B 3LBNA 1MT0A 4CF7A 2JEOA 2CE7A 1ZP6A 2WJIA 5J4VA 1KO5A 4LOAA 4OK6A 1AMOA 4RD3A 1DAKA 1XBTA 4JVMA 5EUQB 2ZRBA 3NC1C 1XZQA 2VSFA 4Q7LA 4B3BA 4C9BA 2HDNB 4HZIA 2YWGA 3A4LA 4QJ4A 1E0AA 4TWZA 2O8CA 1SKQA 2ZQ5A 3D31A 4Q19A 5KDOA 3ZZTA 2IS4A 2FE4A 1E63A 3TSZA 4G1BA 3GJ5A 1VCMA 3PR1A 3ZLJA 4KFTA 1X8KA 5H59A 2QEXB 4HLUC 4IRUB 2VSXA 2PIAA 2V8OA 4LY6A 3ZVRA 2VNJA 4Z51A 3P4YA 5JJIA 5KOYA 4JKYA 1QGAA 421PA 2CLSA 4NCKA 2AHOA 4Q4HB 1FOEB 1GWNA 1RKBA 2IUUA 5BXQC 1P62B 3AVTA 2QL6A 2V6IA 5HTKA 2GDJA 4DRZA 3BH6A 3OAAD 3SU8A 3GPLA 4TZ6A 3EC2A 1T91A 2IW3A 1YZLA 3ZZ0A 3GEEA 3HR7A 1E6CA 4FXPA 1Z63A 2WHXA 1XMVA 1AS0A 1C4OA 3BFVA 2HLDD 2ZRLA 2ZYUX 4TL6A 2DY1A 3Q9LA 4QBFA 4U7DA 1W4RA 4XD7A 2O8BA 1FMLA 2G9NA 3FWYA 3T1TA 1UAAA 3QFCA 4URUR 3B1WA 2J46A 2DETA 1V43A 5F9FA 4WVFA 1FTNA 5BQ5A 3NTUA 5F98A 3FVQA 2OBMA 1CIPA 5FTJA 1TU3A 3VR1A 5KNCA 2DEUA 1CXZA 1NKTA 5J4YA 4LHVA 4CIDA 5E3HA 2OFXA 1N25A 2BCGY 4AYWA 4C0HA 2ZEJA 2ZR7A 4KLZA 1G9XA 5EZ6B 3ZQJA 3MG9A 3MJRA 3K0SA 1DG1G 1E69A 1W0JD 2FFBA 1NJID 1XJ0A 1AQYA 3B1XA 4LJ7A 4CVNA 3PEUA 2FSHA 1G64A 1WF3A 3ADKA 2RGBA 1LS1A 3C16C 1XTQA 3SBDA 4UNRA 3PV0A 4RVCA 2D4HA 4H1VA 2E87A 2QNRA 4B2LA 3RANA 3TNFA 1ESMA 4BEJA 4NCHA 1VCIA 2IT1A 2DFKB 2R6CA 3MHPA 1KGDA 2TMKA 2XJ9A 3FE2A 3MWLA 4PTLA 4BZXA 4DCVA 4DIEA 1X6VA 3HU2A 3PENA 2PT7A 3B2EA 3QEJA 5F9HA 2ZITA 4DWJA 4HYYA 1E1QA 2AL7A 1VQOB 1FTSA 4RJLA 2XTMA 2GQFA 3W2EA 4D81A 5L3SA 2QPOA 1ZBDA 3WNDA 3G71B 2R6FA 3H84A 4Y0VA 2ZM5A 4B44A 4A2QA 1ZCAA 3G5UA 3U4QA 4A0FA 5DLQC 3HP1A 2NPFA 2QRZA 3QEOA 1YR8A 2XOKA 2AFHE 2BMEA 4JL6A 4C3ZA 1N6OA 5EE3A 4ASUD 3RS3A 1EESA 2DYKA 4B32A 4EDHA 3U3MA 1DAMA 5FH9A 4G5RA 2C9OA 3AP3A 1YZUA 1E79A 2OXRA 4NMMA 4QNMA 4HZUB 2JJ2A 2F9LA 2C95A 4OKSA 2V3CC 5FTNA 3SQXA 1PZNA 4HAWA 1QBKC 1AKEA 2CVHA 2Q21A 3AV0B 5J47A 3ADCA 1KY3A 4NH0A 4MH0R 1OGJA 2X77A 1J7KA 4C4PA 1E2MA 3R8CA 3EX7C 4LUCA 1W7AA 1Z3IX 3ECCA 2IEZA 3WBKA 1X1RA 1KQSB 4X8LA 5IRCD 1K73D 3X2SA 4NTZA 3KFXA 3GLGA 3CO5A 1DDIA 1RE0A 4MRSA 4UQOA 1SVOA 2ZR0A 4MYHA 5KDLA 5K8IA 4A6PA 4M2LA 4TZ0A 1YJNB 2HT1A 1G16A 3W5UA 3JQPA 5CK5A 4KAXA 3HDTA 2V4ZA 5SZJA 4DQLA 3DKPA 3CD6B 1NMZA 2H57A 4YAFA 4JZKA 3X1DA 1NVXQ 3NBYC 1A4RA 2X19A 1Z83A 1M7GA 2OM2A 3FMFA 1P72A 4ZDKA 3K8YA 3N70A 2AXNA 4D4JA 4RD2A 4Q7KA 3U3RA 1KI6A 5E4FA 3E1SA 1GRQA 1S1MA 4RFSB 1KKMA 4F4IA 1CEEA 4DC9A 1B23P 3UG6A 4LWZA 4XVRA 1E0JA 3AKCA 1GO2A 1M7BA 4F4CA 2KWIA 1D2NA 1EP3B 1ZJ6A 3TLXA 1KO1A 1G3MA 1OFIA 3ZVNA 2PT5A 2ZSDA 1KZGB 5AK0A 1W87A 1P5ZB 2B8WA 2XZPA 3QUSA 2IYUA 3I72A 4N3GA 2EIXA 2A30A 2OBLA 1XD2A 4D6PA 1VG0B 2XAUA 3ZIAD 4F7WA 4DCUA 2J41A 2CDNA 2EFHB 2UZIR 3NH9A 1O3YA 2JDIA 2Y8EA 2GTPA 2AKYA 2FFQA 3RSOA 3FPKA 1JXOA 2RGAA 4MUAA 2ZXUA 1KI3A 3VQTA 1KDOA 5D3MA 2IXGA 1ZCBA 1G8FA 1QUEA 4QGGA 2QMHA 4BGDA 3W5VA 2B8TA 1GUAA 3AF1A 5SZHB 4WAUA 5KSOA 2AD1A 5GJBA 1UBEA 2BJWA 2IYVA 3BWDD 4Q03A 3I73A 2VHQA 1JR3E 5KPDA 1MKYA 2YKGA 1XDBA 2NIPA 3A1VA 1CR2A 2GJAA 1T5IA 4F4JA 4JLAA 4PC3A 4TTPA 1N8RD 1Q1QA 1Q57A 2WKPA 3B1ZA 1GSIA 4UXJA 1QUFA 3ND8A 2GETA 4M1SA 3ADBA 1FNNA 2ZREA 3FKSA 4M9XA 1JEEA 3WP1B 2YJTD 2O8DB 3LLMA 3QKUA 1YZKA 2GJ9A 2GNOA 1VG8A 2PH1A 3K0FB 4AG5A 1YJ5A 3CRMA 2D74A 1AGPA 4FMBB 4L4UA 4OQFA 4G01B 1I2DA 4OBEA 1E0SA 1G17A 4BLSA 2GF9A 4YAOA 2P65A 4Q48A 2JLYA 1K5DA 4PPFA 3CC2B 2FA9A 1R6BX 3AF2A 3BORA 1KO8A 1MH1A 4FINA 3KQHA 2W6JD 2FSFA 4M1KA 1AM4D 3SYKA 4HAUA 3E1YE 1NF3A 5IT5A 1WB9A 1G7RA 3T1OA 2OCPA 3U2QA 1ZM9A 5EXXA 4D0LB 2IYQA 2B92A 2HT6A 4BECA 1QGZA 3MCAA 3TKLA 1EX7A 2VRWA 3Q72A 1GAWA 2W6ID 3U44A 5GADl 1UKYA 3G82C 2GCPA 2ZYWX 1GZSA 1GFIA 1R10A 4BLRA 4RFVA 4PHGA 2F55A 4I1OA 2QENA 3QG1A 3NC0C 2RGDA 4P4SB 4KSCA 4GNKA 4PR0A 4G5GA 3IEVA 5CDFA 5DNYB 1F3OA 2P0EA 2LWIA 2VQSA 4FMCB 5IK2A 2QORA 4II7A 4YQFA 3ASZA 3EPLA 1XCPA 2OE2A 2ZYVX 3K0FA 4I1VA 3IO3A 3OHMA 4YAWA 1X3SA 3KQNA 4DCTA 2OILA 3ICQB 5FA6A 4Q1FA 3UATA 5LD2C 3UK6A 3H86A 3VNVA 1TAGA 2A7QA 4IEIA 5EXTA 2R6GA 1AIPA 1WMSA 1EG7A 3FHTA 1SXJD 1W34A 4B33A 5A5GA 3HU3A 3R7WB 3W2GA 1GL9B 1W46A 4DB2A 2ZVQX 4V0KA 3GFOA 4X8OA 2IWRA 1FRNA 3RS4A 2BMWA 2IYXA 4LBZA 1U8ZA 2I3BA 2KSQA 3B13B 3I4LA 3PUWA 3D6TB 1JA0A 4LJYA 5J4HA 2D06A 4IEEA 1OE0A 1XP8A 5EQTA 4RD1A 1SXJE 2GVDC 1QG0A 3THYB 1OB2A 1ZD9A 1R8QA 2WM9B 3QFRA 1R0ZA 3CCMB 2IK8A 2ZUDA 3RS2A 3W5HA 1YE8A 4US0R 1W2BB 1JALA 4OQNA 1DO0A 4B3GA 1CRPA 4XIGS 5HCIA 2A5YB 1GAJA 3FGNA 4TYNA 2F43B 1UKEA 1P2TA 3IEUA 1GNQA 2VP9A 1XEWY 2R6AA 5THXA 1FP7A 1G3RA 1K8RA 4HDCA 2REXB 1JR6A 4TT3A 1FNCA 4HEJA 4ZI3A 3NXSA 1JEDA 1S9DA 4BLQA 2VYQA 4GDFA 2ZS8A 2DWPA 4OQMA 4R7ZA 1TQ6A 2WJGA 2V6JA 1BJKA 3QKSB 1DS6A 3SZRA 1N6PA 4O2RA 4YXWD 1Q1ZA 3DOFA 2Q9CA 2R6DA 2JJ1A 4KFSA 1GL6A 3L8ZA 4YAUA 1JPNA 1NN0A 1P75A 2BGIA 3GLHA 3RS5A 4XVUA 3GJ8A 1F20A 4LBYA 5IK2D 4YDSA 3FKSD 4Q9LA 4C0JA 2OFOA 1NLYA 2XNSA 4B2PA 221PA 4MUBA 3WMGA 3SEAA 1Y3AA 1OKKA 1CJVC 2C98A 2QQ0A 4CEIA 1XPRA 2NGRA 4OHYA 2ZS7A 4KU4A 4YMUA 4JYBA 1W44A 2B21A 5H68A 1TF5A 621PA 1TQ2A 3SS8A 3G0HA 4C30A 1NNEA 2GKSA 1GL7A 5G3YA 2VIIA 4KI0A 1XU4A 2MSEB 2R2AA 4JLOA 4EIWA 3LW7A 4EJSA 3BOSA 1HTWA 5HKKD 1QVAA 3KJGA 1R7RA 4BLTA 3A37A 1NN5A 1ZIPA 2FEOA 5SZKB 1KJZA 5L3QB 3PITA 5FOVA 1EFRD 2XB4A 2DR3A 1EP1B 3HJNA 3TIFA 4A1FA 1W5SA 3T34A 3EARA 3AVVA 1CJMA 2ZJ5A 2F3RA 3CNNA 3N2EA 2OFWA 3AQ4A 4EPTA 4ZO4A 2I4IA 1NVUQ 1M90D 1OW3B 4I1SA 3W8RA 1NN1A 4DEYA 5D3QA 1MO5A 2D2EA 1Z0AA 1N6RA 2V54A 1CTQA 1Z6AA 1R2QA 3AVYA 2RH5A 4P31A 1D8TA 1ZD1A 2Q3FA 3U4QB 3PFIA 3N5CA 3DKVA 3QPUA 1VYVA 2NO1A 5JLJA 2PZGA 5CYPA 1FX0B 3QF7A 2WIBA 1TL7C 1NBMD 1LNZA 1G4UR 2FPKA 2IS1A 3RWOA 2R9VA 1S72B 2QT0A 2CCKA 2OLJA 1CBUA 2IWHA 3BB4A 3D8BA 3QXSA 4RKFA 4JLKA 2JJ8A 3M6AA 3QI2A 4FMDF 4Q00A 1VQ6B 2L0XA 1ZC4A 3QFTA 2XTZA 4BFUA 1II8A 3LQRA 4CZ2A 5FTLA 4HB0A 2LKCA 1M1YE 1W49A 1BX0A 3MAAC 3LWNA 3QOFA 1Z07A 3VKWA 2C78A 1Z0FA 4BZPA 1FQJA 2OT3B 2R62A 5FPYA 2ZVPX 5JMTA 5EZ5A 3HWSA 1UPTA 1KNQA 4XWAA 1W4CA 2R65A 2BEKA 3RC3A 3LO8A 1ZUIA 3EZ6A 3SQWA 4B73A 2BVNA 3VMFA 1XWIA 4MA4A 1JXMA 4UXIA 1IJEA 1DADA 4CDGA 2G3YA 3OJXA 2R44A 4DZZA 1G20E 1QZXA 2FF7A 2J9RA 2WZQA 4AKGA 3M0EA 2ODNA 2NO0A 3EZFA 1UADA 2ZRHA 3C14C 3QBTA 3RHFA 3KKPA 5FUXA 1QVRA 1M74A 2IC5A 3GJ3A 4GOXA 3R7WA 1P3JA 3LV8A 3CPJB 3OW2B 3SNHA 2FG5A 3E5HA 2HV8A 1NJFA 3W5JA 2WBLC 4UXHA 5B58C 2O52A 3QVVA 1QHSA 4OI4A 2ZI9A 2QPAA 1KHTA 3C4JA 1Z47A 4ACAA 2RC5A 3B8HA 1EK0A 1QHNA 3FHCB 4JT2A 3EIHA 3UG7A 3CC7B 1SHZA 3PXGA 5JBQA 4LYFA 1N6NA 2RB4A 1TPZA 1W4BA 2ZSFA 4LPSA 5LBIA 1T9HA 3TQFA 3CKLA 1XX6A 4R98A 1W36D 1KK1A 1HYQA 2AD5A 4ARZA 1TEVA 2VP4A 1IAQA 5IDVA 1E2IA 2XZLA 3NDPA 3CR7A 1OPXA 3ZH9B 5EP2A 5JRZA 4HAXA 4P4UA 3WBJA 2OAP1 1VQ4B 1YR7A 2C77A 3O8BA 4QFMA 3A4NA 3U44B 4LBVA 4DB4A 1TU4A 4U9UA 1TMKA 3GJ0A 4RFSA 5H5JA 5CB6A 4WW0A 2Z6VA 4UNQA 1BS1A 1PLJA 1XTKA 3LRPA 1DDGA 1G5TA 1D2EA 4PO8A 4YALA 3B7GA 3OZVA 1TUIA 2GZAA 5AJYA 4ESVA 1FX0A 3I92A 4C2TA 5FBLB 5H8WA 2IUTA 1G7TA 2XOKD 1NSFA 4AURA 1XJQA 5DE3A 1IJFA 2CRVA 1RW4A 3KB2A 2ZAMA 4QBHA 3GLIA 1OJLA 3KDSE 1Q22A 2QP9X 3VR4A 4A8JC 4AYXA 4LHZA 1QG4A 2ZROA 3JQQA 1LY1A 1IM2A 4CT4B 4CRWB 2IBMA 4LV6A 5BYKA 3GLIB 4M21A 3JZMA 121PA 1R0YA 3LY5A 4A6XA 2YINC 3V00A 4JJZA 4XD7D 4FCWA 2KBFA 4EJSB 2QM7A 2ZRFA 1ZM3A 3F8TA 4G1UC 1FNMA 1E2PA 5A4JA 5DYIA 1X8LA 4H9GA 1R5OA 1FRQA 3KUDA 4DSTA 1RYFA 4MGYR 1EFUA 3AEZA 1YJWB 4A8JB 3T1QA 4DLZA 4ZV4A 2EU8A 5AJXA 3QF4B 4WZBE 3CCJB 1E96A 3VO2A 1W2GA 2ZRMA 4Q9KA 1HY3A 4TQ9A 3W6PA 2BSAA 2ORVA 4PQRA 2GEVA 4MGZR 1KDRA 1MO3A 4BFYA 2C2HA 2ODWA 2ZRAA 1HE1C 4NYJR 2G83A 2P6RA 4QOSA 1E1RD 3GLHB 2H1LA 5FFMA 3NBFA 2C5LA 1VYTA 2IYWA 4QGHA 4TQAA 1HV8A 3CRW1 5D3MB 1Q1EA 2NO9A 3IHWA 4C0QC 2EWWA 1ODFA 3Q7QA 1FFHA 3CRVA 1TQDA 3IPXA 3QSYA 1GJRA 4NDZA 3SYLA 3U7GA 4YC7A 4TN1A 2NPIA 1KI6B 2HYIC 4HI0E 4ZIRB 4CEJA 5J5CA 2J0SA 2XGJA 4F92B 1N2CE 4M1WA 1BX1A 4OHWA 2AWOA 3PUYA 2FZLA 2QAJA 1VG9B 2JJ1D 5JI2E 2RGNA 3PEVA 1AA9A 2F6RA 2CK3D 5GVSA 5GVRA 2O8FA 2IYLD 3OAAA 4TYPA 2FNAA 1E9SA 1SZPA 3EZ2A 1CJTC 1RRPA 3DVLA 4C0AC 1XPOA 1U99A 1SVIA 1JPJA 1U98A 3NEJA 4PZZA 3IIJA 2G1JA 2VHJA 2J0UA 4MKIA 2WWGA 1KOFA 1YHQB 1IN6A 1II0A 2GK6A 3EZ7A 4JLDA 1CF4A 1DG3A 3BBPA 3IPYA 3Q5EA 2W00A 4QG7A 3QE2A 1LW7A 2CCGA 3OZXA 1SVKA 2AKAB 3UWKA 4ZDWA 3MFYA 4LHYA 4GP7A 3GCGA 1RRCA 4XWKA 4D4MA 2BCJQ 4DVGA 1DVRA 5FOWA 3VX3A 2MMGA 2D3WA 4DLXA 1XMJA 1JI0A 4JVSB 4B3FX 4EFMA 1U90A 2QT1A 2HMAA 4ACBA 2KB0A 4P32A 1JJ2B 1XNJA 3P26A 3RRYA 1TTTA 5G40A 1U0JA 2BKEA 3GFTA 5TY0A 3M4YA 2ONJA 3AVOA 4D25A 4B75A 1GILA 4KBFA 4HAVA 2P6UA 3WYAA 1CNEA 4F38A 2LKDA 1QG2A 2G0TA 2VO1A 2PLRA 1XXHB 1G8HA 2O0JA 4NONA 4PPQA 1F2UA 3TBKA 2GK7A 5JHHB 2XX3A 1YHNA 2EYQA 3QBVA 2JLVA 4B34A 3TQCA 1GIAA 1S1CA 1JAHA 1BMFA 1KKLA 2ZE8A 3I55B 2CMKA 1GVNB 3B1VA 1NG9A 3GLGE 2ZE7A 2C9YA 3QQ5A 3BAFA 4TMTA 1H8HD 1YRAA 4I1UA 1OHHA 4XWOA 2P2LA 5C1BA 1WP9A 1IN7A 5DIFA 2AK3A 1E2NA 3UANA 2FSGA 2ZU0C 3QXCA 1GKYA 2GCOA 4TYYA 1EFTA 1F2TA 1A1VA 2HJVA 1OKKD 2D7CA 2ORIA 4RZ3A 1M2OB 1JJVA 3B9QA 1S96A 1DAFA 3AP1A 3VAAA 3PEYA 3B78A 1H42A 3ADDA 1WDTA 2PX3A 2ZUCA 2EFCB 4BLOA 1DE0A 1ELOA 1Z22A 2NO6A 2WWHA 3A36A 1NRJB 3CX7A 2FX3A 3EAQA 3P1JA 4GI7A 3AGQA 4NYMR 4WZAE 3VR2A 1Z6XA 4MKGA 2XNDD 5BYJA 3W2HA 2D2FA 2G0NA 1XJCA 1S2MA 1XCMA 4AI6A 2WWXA 3EIEA 3TSWA 3QJYA 4OL0A 2RCNA 4A9AA 4OI0A 1NI3A 1Z5ZA 4CEIB 4C7OB 2O8DA 4Z8XA 1KYIA 2J1LA 1K9MD 2DWQA 3FTQA 1KMHB 4LJ5A 4FMDB 4QRHA 1QF9A 5IF9A 3M1IA 1XF9A 4UAJA 3CCUB 1M1KD 3I5XA 3KXKA 1E9DA 3FKQA 3GLHE 4S35A 4MRNA 3OEEA 4PAMA 2ZJ8A 4Q5IA 2BM1A 4AKHA 3SOPA 3DMDA 1YZNA 3LVQE 1S0UA 1AZTA 2GWHA 2FDCA 1P2VA 2WWYA 2V9PA 2QA4B 2QP4A 5TB5A 2PMKA 4LRWA 4BUJA 4NYMQ 3PG5A 4DT1A 3ZVMA 4MKHA 1OXTA 1WE2A 3C5HA 2W0SA 2OLKA 3VR6A 4RD6A 5AUQA 3BFKA 4FW9A 4NE2A 2VSOA 4PZYA 2HF8A 4KYUA 1MV5A 1W2HA 1KO7A 1N5LA 4OHXA 5DI3B 4X8MA 2OCYC 3MWJA 3BERA 1KMQA 4JVNA 2C8VA 2QI9C 5K8LA 3ZQ6A 5BN3A 1YR9A 3CPEA 3C7KA 4Q9IA 4C2UA 2QDXA 2NQ2C 3CCLB 1HT1E 1T3HA 1XMSA 2GJSA 2QMOA 4Q1AA 4DSUA 1G7SA 5JECA 1IN8A 3KKMA 2WSSA 2ZRJA 5FOUA 4PC6A 1FZQA 2ONKA 4G5SA 4IOJA 1BO6A 3T1VA 1E2EA 4V02A 1H8EA 3DHWC 3K0CA 1DOAA 1II9A 1ZRHA 2NOAA 2WWFA 2CK3A 3C5CA 3I1FA 4JLBA 1QHHB 3R20A 5AR1A 3CRQA 1TLLA 3RSLA 1UEJA 1JR3D 1Z6GA 3BB3A 3OF5A 5E7JA 4D4KA 4WZ6A 1D1NA 4DUGD 1QFJA 4O25A 3IBGA 2C96A 2CHQA 2G1KA 1VPLA 4HB3A 1FW6A 4OJQA 2REBA 1QHXA 1G6OA 1VYUA 2BMJA 5E7IA 4FWIB 4RD0A 2GRJA 2V7QD 3K9GA 2B7BA 2IYRA 2IF0A 1AZSC 2J87A 1W48A 1NN3A 2ODEA 2PEYA 4XH9B 1Q21A 1OFTA 2ZSAA 5KNDA 1WBBA 2R6HA 1E1RA 2JA1A 3EG5A 1OXSC 2ZR9A 3MD0A 1Z28A 2QBYB 3GEIA 3CW2A 4LV5B 2JLWA 1TNDA 1E9RA 1XEXB 4S2EA 5GV7A 2NZJA 5LD2B 4OYHA 3FYHA 4M53A 1XXHE 5FUYA 2AX4A 2WV9A 1QHGA 2ZRGA 3QENA 2V1XA 1NSTA 4Q1DA 4V0OA 1OV4A 1BIFA 2PJZA 3B60A 1ZM2A 1JB1A 2WJHA 3TR0A 4D82A 3GJ4A 4OI1A 1MABA 1KI4A 3IUYA 1II8B 3LD9A 2C03A 3TRFA 4YMVA 3EIQA 4BPBA 2BM0A 4ABYA 1W0KA 4HLCA 1PUIA 2IHYA 4AC9A 5JSZB 2RAPA 3BGWA 3H1TA 4Y7CA 2EVWX 3A6PC 3GQBA 4X8HA 1G3IA 3QPWA 4GT1A 4Q9HA 4JLPA 1KI8A 3CX8A 1NLZA 2A2ZA 3DM9B 1E79D 1QHYA 2WIAA 3WNBA 3NKVA 4JLJA 4TMZA 1KSGA 1UBCA 4MRVA 5KDDA 4PSKA 2FWRA 2XSZD 4AKEA 2OCBA 3AP2A 3IKJA 2EWVA 1QVFB 2VHCA 1AQUA 2GZDA 2QE7A 2ZRIA 4D0NA 2J0QA 3RRMA 2JAQA 1SXJC 1BQEA 2FFAA 3AB3A 2F9MA 2MSCB 4KFRA 4XSGA 1OH6A 1G4AE 4LGMA 1G8GA 4Q1BA 4JYCA 3CCEB 1XMIA 3LVBA 3B82A 3RWMB 4Q18A 5DISB 2O8EA 2WAXA 1NBME 4B35A 5C2JB 3BH7A 1G3UA 5TARA 1QDEA 1W47A 4R9UC 3W9YA 3LX8A 1EGAA 1ZNWA 3QKSA 5DGXA 3GP8A 1XFAA 1LV7A 2IYSA 4B3XA 1CR4A 2VNHA 3B85A 1DEKA 4HE6A 2WJJA 2JCSA 1XEFA 2YNMA 1ZAKA 4GMDA 2PEZA 1C9KA 2VP5A 4A0GA 2A5DA 2Z43A 3LNCA 1YU9A 4I99A 5KNBA 4LHXA 4J0QA 3B9PA 2QTFA 5CIQA 5JI3E 4G5OA 1J8MF 1DARA 3F5FA 5DHFA 1YR6A 3FMPB 2DHRA 3TGPA 1FUUA 2O8BB 3U5ZB 3K9LA 1VQMB 2XZOA 4E07A 5HCNA 3TW4A 1KSHA 3CMEB 2OG2A 1QRAA 4NCIA 3Q7PA 4AKIA 1R4AA 4B76A 1D2MA 1E2QA 3RABA 2P5TB 2VTKA 3BD9A 3MUFA 1J2JA 2KBEA 3THYA 1ANKA 4PHTA 4CEJB 3TJZA 3U6BA 2QP3A 3UIEA 3JQRA 3TUJC 2BJVA 2NZ8A 5BW8A 4JIMA 2ERXA 2W2VA 4N1AA 5JZVA 2ZSEA 3RC8A 2GZHA 3X1WA 2FEMA 2HLDA 4BFVA 5B2ZA 2VPPA 4W5JA 4KO8A 5EE0A 5EJEA 2P6NA 1HUQA 3GMTA 5JWRA 5G41A 4FK8A 1W36B 1N0UA 1TF7A 1VHLA 2JJ2D 2UVQA 3GD7A 1T0HB 4PC2A 1RJ9A 2YWFA 2IYZA 1J70A 3AH8A 1I4TD 3HPQA 1T4GA 3LBIA 4A82A 2RGNC 2LCFA 1OYYA 4PSVA 4JSYA 4BE7B 4TTRA 3BIFA 3HYTA 1VQ5B 4AK9A 1HA3A 1XB2A 4PQYA 3EA0A 3OESA 5GJWC 1CP2A 1DAHA 3SI7A 4ASUA 4LJ6A 1T0JB 3BFXA 1FQKA 1YVDA 3BXZA 1TEXA 3KJHA 3KL4A 4DKXA 1KD1D 5HZKA 2ZAOA 1GKUB 4AF6A 3AGPA 1KIMA 4LYAA 3AKEA 3O8DA 4EPRA 4DLTA 2G88A 1RYHA 4TYWA 3LXRA 3NG1A 1OXXK 4P3YA 1VQNB 2CL0X 2I1QA 3AF3A 4P4SA 2PMDA 3DZ8A 5FBVB 3SBEA 3A1TA 4MQBA 3L0IB 1NBMA 3CF2A 1S4QA 3W5IA 3J81k 1E9CA 2VP0A 5JSZA 3SC3A 2OBNA 4PXAA 1Z0IA 3P32A 1DAEA 2K5UA 4U00A 4OHVA 3U61B 2OUKA 1K5GA 2QRNA 3KFVA 3CPWB 3LQQA 1JA1A 1PVOA 1QGYA 1JQJC 3CNOA 4G5QA 4KXFB 3BK7A 2KJQA 4OI2A 2ZJBA 3BRWD 2FSIA 3AVWA 3CXCB 2ZI4A 2VHUA 5DYGA 2OHFA 1L8QA 1N3BA 1EFRA 3MWYW 3AKYA 1DPFA 2EFGA 2QE7D 1S3GA 2WWWA 4FD2A 5EP1A 2J3EA 3RDPA 2QMEA 5AJZA 3WYGA 5JWHA 2DFTA 1XTIA 3WRYC 1P60A 1E0KA 1ZYUA 2RC6A 2J5XA 4URYR 4DJTA 1COWD 2OO7A 1K8AD 1SKYE 1P2SA 521PA 3G6EB 1A2KC 4W5HA 4M1MA 2XNJA 3SJCA 4H1UA 2PLFA 1PLKA 2WAYA 4WBSA 3RLFA 1M34E 3SJAA 5P21A 2CHGA 3MLEA 4ARZB 3KQKA 1XZPA 2GJKA 1HT2E 4JVLA 1IB0A 3O8RA 1CLUA 4YDHB 2F1IA 1W0KD 4GOJA 2EYUA 3AVXA 3DMNA 1NL3A 1A8PA 1VKJA 5GJCA 3CF6R 4B6FA 5JWOA 3Q5DA 3KZ1E 4L9SA 1SVSA 4XVQA 5IHPA 4UNSA 4K8OA 1P2UA 5KSZA 3PVSA 2WJVA 2FH5B 1S9HA 2ZI3A 3MMPA 1MR3F 3QXJA 4IFEA 1G21E 2HXYA 2WKRA 4KHZA 2BKUA 2GXSA 1KZ7B 4PAOA 4Q66C 3IGFA 1RJ9B 4DLRA 3SJZA 3UMSA 3K9NA 1TADA 1YJ9B 5JHGB 2GEUA 1UF9A 1DAIA 1LTQA 1V5WA 1I2MA 4DBLC 2YYZA 2ZI5A 4M0LA 3F3YA 1YIJB 2ODBA 1N6LA 1UDWA 1IQPA 1KDPA 1P73A 1J90A 2DWOA 4DQKA 3NBZC 4IOKA 4KVGA 721PA 2HJGA 4QM6A 1Z0JA 2V7QA 3REFA 1OXVA 4RD4A 4HUTA 4LJ9A 1Q44A 3A1SA 1YQTA 3SFZA 4Q4AA 3KQUA 4B43A 2ANCA 3ONWA 1R0XA 4HUQA 4FIDA 4TQUS 3RS0A 4XTCS 3QKRB 1P9NA 2BMDA 4Q4HA 2P5SA 4GP6A 3CCSB 4NYIR 4QHSA 3KJEA 1JR3A 1ZNXA 4W7SA 4YXWA 1KI1A 3LAWA 4GMXA 2AXPA 4XSHA 3KTAA 4JKIA 3VHXA 1L4UA 2O8CB 4A2WA 1GAQA 1VCNA 3Q8XB 5FPTA 1YZGA 3A1WA 4EQ6A 1GR1A 1H8ED 2GILA 2GBLA 4R2IA 5CJPA 5AUNB 1MABB 4EJSC 4XJXA 4Z54A 4B48A 2WSSD 2PL3A 3VU9A 1E4VA 3AM1A 4OQXA 1VCOA 3SR0A 4JL8A 3GJXC 2CNWA 3V4FA 3WMFA 4XTRA 1DELA 2P67A 1GRNA 3DL0A 4JSTA 4LBWA 4DHEA 2FOLA 4B3DA 1HE8B 1NLFA 2OCAA 4NL4H 3KQLA 2DFLA 4AF7A 3QE0A 3WHLA 4UKDA 4TMWA 3E70C 3UWOA 3E20A 1VIYA 4PHHA 5JS8A 1KI2A 4KCGA 2BF4A 3NIBA 4HLQB 4B2IA 5FL3A 4POAA 5KHOC 3ZBUA 3SN6A 1Y63A 4BFZA 3BH0A 1G18A 3CRZA 4GRAA 5CK4A 3K70B 3BE4A 4US2R 1FP6A 4ZI2A 3K70C 4R71A 5KSPA 3N2IA 2O0KA 3OEED 4TMXA 2PZEA 5GJVC 4TL8A 2VP2A 1U0LA 1VQ8B 4TL9A 4PC7A 4EPVA 3X1ZA 4EH1A 1KC8D 1YKSA 4M9ZA 3P20A 4W9MC 3T12A 1E2HA 5CM8B 3CH5A 2B6HA 2F7SA 2X1VA 2ZU6A 2QZ4A 2ASEA 1ESNA 4BEBA 4KFUA 1E9EA 1J99A 1E62A 5FTKA 2CNDA 4E09A 3O8CA 2XNDA 5KUTA 1PUJA 4HDQB 3CH4B 3UMFA 4HAYA 4RZ2A 1VTKA 4UNNA 1R0WA 1MO6A 4LHWA 3QNUA 3RYTC 2H17A 1FNDA 2WJYA 3OE7A 3OFND 1E9FA 3VKHA 5FL7D 1Z2CA 5DN6A 3U3JA 5JCZA 3T5DA 1N5IA 3I3SR 1KRHA 5DI3A 4WOPA 5L3SB 2J7PA 1MRNA 1UBGA 1Z6YA 3T5GA 3TMKA 1VQ9B 1FL9A 4ITRC 4DIDA 1NG1A 4EAQA 3JZAA 2J59A 4Q9JA 3VO1A 4YMSA 2QMUA 1D5CA 3Q3JB 4MDEA 4OK5A 3EXAA 4DSNA 2W6IA 3AVQA 3NEYA 3AKDA 3CR8A 1OIVA 3VKGA 3OIVA 4LDJA 1U9IC 3ZDQA 2BBTA 1Q86D 4A15A 4M9QA 3QKTA 3GLFB 4BASA 1CR0A 4CGZA 1L4YA 2HCJB 4Q21A 3CCQB 2EQBA 4NYJQ 4PHFA 2FGKA 1OFHA 1Q1BA 2JDID 1VQKB 4Z8YA 3PJRA 2QU8A 2Z0MA 3BC1A 4PO1A 5ANRB 3TVDA 4Z1MD 3DDCA 1T3LA 4K1XA 4E22A 4CW7A 4V0NA 1ZNZA 2A3RA 1UBFA 4ZGQB 2FFHA 3GLGB 4NBSA 4MYTA 4I4LA 4IDQA 2WPDD 3LDAA 4KITB 1JECA 1E64A 2CLDX 3SJBA 3SYNA 4TLDA 3WP0A 3WMEA 1DAGA 1LF5A 3GLFA 4MYUA 5DI9A 1QHHA 5AJVB 4JLNA 4QHYA 4GFDA 4D4LA 1ZC3A 1BH2A 4TSFA 4PC1A 2UZ3A 2VZLA 1P9RA 1QX4A 4TLCA 2YOGA 4JBXA 3TW8B 4IW3B 4DEXA 3NHAA 4WXPA 2ATXA 2O8EB 5LB4A 2XITA 4NCJA 3TSOA 3I56B 2CHVA 4HZUA 4E03A 1G5PA 1A82A 5JJLA 5C46F 3HPRA 1Z8FA 4GZMA 5CYOA 3ZYCA 2IX3A 4EUNA 4ZGNB 3UXMA 2VNIA 1A7JA 1SHKA 3E2IA 2JIZD 4KV9A 4PFSA 4M1TA 3NBXX 5FOXA 4EKDA 4BRUA 1NVVR 2GVZC 3ZIAA 3RVBA 3THXB 3W3AA 2BHRA 2FZ4A 3CLVA 3VHLB 4JLVA 2JASA 4OK3A 4QJ3A 3WXMA 1Z29A 3RNLA 1RFLA 3FFBA 1ZVQA 4A8JA 3DZDA 4V0ME 3TAHA 3TUZC 3WNCA 3L43A 3AUXA 2ORWA 4MRPA 2VEDA 3W34A 3B6EA 4P4TA 3KXIA 4LCBA 1WRBA 1ZD8A 1NP6A 1JQLB 5KYKA 1Q20A 1KSJA 4DUGA 1F5NA 2DERA 1I4LD 2ATVA 3D7MA 1P7CA 3QIAA 2A78A 2DB3A 1VHTA 4PPNA 4C0SA 2QAGC 3KXLA 5E7MA 3K0AA 5B57C 4IXNA 2OSBA 4M1YA 1LF0A 3WHKA 3C15C 1SVMA 3LXXA 3I32A 2GHIA 2JLUA 4ON9A 5FBRB 4OJKA 3U3KA 5K8TA 1SVWA 1AKYA 4C7OA 5ELXA 2IYTA 4O3MA 4V03A 4FI3C 5H70A 3EWSA 3P27A 1AJEA 3PCRB 4Y0AA 1Z2AA 1T5LA 1OFUX 1H65A 1G19A 1GRRA 4GPTA 4Q7MB 2V1UA 2CCJA 2JIZA 4DSOA 2BPOA 1XD9A 3TAUA 3THWB 4WIAA 3TUIC 4ERNA 2VNKA 3DM5A
chains in the Genus database with same CATH superfamily
3DPUA 3EPJA 1T1RA 1YJAA 2B69A 2VXBA 2JFFA 2NVUA 3BA1A 3WB9A 4MMXB 4D9EA 1YS1X 2ZS9A 5ETJA 3QJGA 4L9WA 3VPCA 3EK2A 4MI6A 2IY8A 5G1PA 2DHEA 4X91A 4AWXA 5B1IA 1NC3A 4AJ1A 4RFLA 4AN0A 4FGZA 5LP1A 1IOZA 1JJ7A 4M55A 1U1GA 4TMVA 4CBVA 2XQJA 4I4TA 1S3SA 3EY4A 2Q3MA 3ANSA 4O4LA 4XMYA 4FBGA 2AE2A 5JROA 4N3NA 4B7AA 4DLVA 4YJ2A 1F4PA 4ZN6A 3OURA 2YDXA 3T7KA 1JIVA 1WG8A 3O2QB 4XGKA 4C1BA 5EHZA 4M7OA 1USGA 2GAIA 3GPIA 3OBBA 4QJ5A 1BE1A 1NB9A 3SF8B 4K81B 5KSWB 5SV2A 3A1UA 4CR7A 1XD8A 4ENVA 3F0TA 2QRVA 4L5BA 1T5HX 3Q39A 3I12A 3CO0S 2VR1A 5DM4A 2IU0A 3KXDA 5BN5B 2KS6A 1MCZA 1LJUA 2RH9B 4TOIA 1D2AA 3QGMA 5ICGA 2OECA 4TUYA 3ZZ1A 2GK4A 2VA8A 4IIEA 3L0ZA 1AKVA 1IXKA 3WLEA 4F5WA 3FX2A 1Y1QA 5A5EA 5M7EA 1CC1S 3IE2A 5DTMA 1E2LA 2F3TA 1EA5A 2ZETA 3ONDA 5BN5A 3L3BA 1OZ0A 4FXUA 5C5EA 3AIKA 2BGJA 2R66A 2HDOA 4ZJUA 3DB2A 3PKIA 1E7WA 2MMCA 2UZAA 3GEDA 4RY2A 1OMOA 4JEUA 1SXGA 3O5AA 3ESYA 5CM9C 2FPUA 2Q29A 3AF0A 1U0RA 2QQEA 4N0QA 3MGAA 4CLRA 4CEHA 2F1RA 3FDJA 3PNLA 3ZEIA 3G68A 2XMPA 2H59A 1DHTA 2X9QA 3DDHA 4RF4A 5E8JA 2ZCUA 4M9SA 5A3SA 3K1JA 4B8WA 2VJJA 4MDEA 1UMKA 2EJBA 2Q7XA 4H7JA 4HN4B 3ZV3A 3LX5A 1ZQ9A 3CMAB 4K28A 3WDSA 5MDHA 1OH7A 1E3ZA 1VSTA 4KG7A 4D2IA 1DKMA 2PMCA 2YIDA 4B3IA 2ERYA 3A1NA 3PGVA 3THWA 4RK6A 4GD3Q 5CGZA 3SNKA 2HK6A 2NP6A 2AX3A 1TEZA 4QL3A 2J6IA 4R1UA 1P0FA 4UUAA 2NNLD 4LTNA 4URWR 3PSHA 4CN9A 2NTYC 3BEDA 1JQEA 2VYFA 3KEGA 1KAGA 4CCWA 5IUJC 5ILOA 2BLNA 4RIHA 2O2HA 1JH8A 4IDHA 4X92A 1QZ3A 2Q3LA 2YOHA 3LFUA 2XOXA 1NY6A 3WRWA 3M6WA 3ZE2B 1B3RA 5CLQA 3UB4A 5JV5A 2VTBA 3MWKA 4UBNA 1ZFNA 1RMYA 1RVDA 3KB6A 1F6BA 3P9XA 1GNRA 1WQ3A 1U94A 3R4VA 1OTXA 2D62A 4O2AB 5LIPA 2XTNA 3FWPA 2ZE5A 2ZJZA 3PXXA 4C0BA 3K1TA 1G6KA 5HXBA 4EHFA 5E9WA 5K6TA 2XCSB 1XJWA 2I2WA 3UAYA 3ND9A 4BTVA 5DNUA 4N5DA 2WTXA 3SCZA 3KTDA 1T2VA 3OP4A 1Y8AA 4W82A 3V76A 4G3XA 2F59A 1NJ6A 3W90A 4D3YA 4U8HA 4B6EA 1CJUC 2ZQYA 3HCNA 3IBSA 2RAUA 1QV6A 3NH6A 5CW1A 1H3FA 4QODA 3QLJA 2QSUA 1E3IA 2W6OA 5FLEX 4ZVNA 4B4DA 1VP9A 5COBA 3V32A 3RYHB 1TQ4A 2REOA 1P0MA 4XX0B 1KO4A 4YRGA 1NIPA 3R40A 4L16A 2YOFA 2VJBA 1TAQA 1WB5A 4NCXA 4DXAA 2D5BA 4GMFA 1DJNA 2VF2A 3LW8A 4KKSA 5TVKA 2GM9A 4N0MA 5DMXA 3HYRA 3MRTA 4CT0A 3V8PA 1IBRA 1E99A 4EI8A 3OY7A 1MAWA 4XYMA 1WCIA 4DDUA 2GNPA 2I80A 2N46A 3JTEA 4ZOLF 3F9IA 1H6AA 1G7CA 1PJRA 5F52A 4DCMA 3WYDA 1Q15A 3DWFA 4BRZA 2WM8A 1P8AA 2UDPA 3D0QA 2P9JA 5DK4A 4UTXA 4HJXA 1ST3A 1YMUA 1EX1A 2FRXA 4L27A 3Q6IA 4TKZA 5KINB 1DC7A 1ZUHA 4E1AA 1UINA 2JJQA 3SE7A 5EJ7A 1HEUA 1G8YA 5EIXA 1FCJA 2Q1TA 4OM8A 1PG5A 3B89A 1A9XB 3UA4A 2ADOA 2IXEA 3OM1A 1DXQA 4FCTA 3U60B 4ZQEA 4Z0PA 1UKVY 3I8SA 2HHHB 3PUMA 1MA0A 2DKOA 1Q2XA 2P9EA 4LYDA 5I4IA 1NKSA 1NPTO 2P90A 4W4TA 5HK9A 3EXIB 1CUVA 1FZTA 4KRGA 3ZJYA 3KWFA 1QFZA 4IDOA 3SZ3A 2ZBPA 4L1KA 2VDUE 2W37A 3PLRA 2QN7A 1ZK3A 4F2DA 1NMYA 3HU1A 1T3TA 1KDVA 1U7HA 5LQMA 2FW8A 4MUHA 1PS8A 4F46A 3ONNA 5KVSA 1LDYA 1ORRA 2BR4A 4RGQA 4MK4A 2FWPA 4N8EA 3PU6A 3ETHA 2XTAA 1OXUA 1UDXA 2MINB 3DTVB 4OB7A 3VU1A 5ULLA 1NHGA 1B14A 3CURA 4MGIR 4MX8A 4EW2A 1QQAA 2J7KA 2PWBA 2W8BB 1AN9A 1T5BA 2OXFA 2QLTA 2OYRA 2DFPA 5B30A 2DCUA 1WPRA 2G67A 3GVLA 1HDRA 3GJ6A 1KAMA 4JBNA 4UMDA 2MCFA 2A9KA 1M67A 2ZR8A 4KAAA 3CF0A 3O95A 4BC0A 1Q92A 4NXNB 4BJHB 4IVPA 3QWHA 3ZWVA 1CDDA 1UC5B 4IOMA 1IBKB 2WYWA 4RKEA 1LVGA 1H2EA 1Z0KA 2JC3A 3BSYA 2IH5A 1J24A 1U2SA 1KZLA 3IAM1 3OZIA 4NPHA 1WQ1R 4UNPA 1PV4A 2FZWA 3W2IA 1QQTA 2COUA 2G8LA 2XDQB 3GIWA 1CF2O 3PD1A 4R01A 1MXFA 2CN1A 4R1QA 3MJHA 3T4PA 1KZ4A 4BFTA 4RPGA 3REGA 1PJ4A 1GCGA 2IUSA 3F2IA 3FNFA 4ZCMA 2PGDA 3NHKA 4DIUA 3IHLA 4F93B 3OZWA 1RPJA 2NYAA 2RG1A 1RYBA 4UPDA 3QF4A 3FY4A 4XKJA 1SCAA 1OI2A 3P2EA 4FNAA 1ZU4A 4JJ6A 3X1XA 1JNXX 1ZMTA 4YJHA 4E31A 5JZSA 1KAQA 3QU7A 1UPUA 3ZVLA 3ZC3A 3ZHRA 2NU6B 1FPMA 3KBBA 4HSGA 4HDOB 1FP4B 3LOUA 3F2VA 1D6MA 3NZEA 4JYMA 4BVAA 5B12A 4DW8A 4RORA 3L92A 4FFNA 2CB0A 4LMPA 4TV8F 3A32A 3GEHA 2AN5A 2RKOA 4D02A 3L2OB 4FGJA 4HDAA 3S29A 3KJIA 2Y0DA 1NZJA 4YMTA 3I5AA 4Z53A 3OCJA 2HKIA 4EW3A 3OZFA 5DRYA 5CFRA 1XE1A 3LC0A 2CEAA 3UMRA 3R9KA 1W9MA 1Z5VA 1IU9A 3FPPA 2XAAA 1EE1A 5FJJA 4I1PA 2IDZA 3TLYA 2GLTA 2FJUA 5ED4A 3NASA 3QFHA 3TCNA 5FTMA 3HV2A 4A26A 1XDZA 5LA6F 5C3UA 2LCQA 1RMQA 1PTJC 3KQYA 4IKEA 2YWBA 4BMNA 3FUXA 2MSDB 5AKKA 1EEHA 4AZWA 2A5LA 1TZCA 3QPBA 1VQPB 2YQ5A 5EJ4A 3ZD6A 2GJ8A 2LGJA 4IQ8A 1QYXA 1I13A 1PP4A 1ZK2A 2DX7A 1ECFA 4CCYA 2NW6A 3FCEA 1SXJA 5C1OA 5JIBA 1EP2B 3AONB 4UVGA 4M36A 3ECAA 1ZJ5A 1A5TA 2PUHA 1AY0A 2Z2KA 4QT0A 2EW8A 1BE8A 5CHEA 2PMWB 2ZJ6A 3FHOA 4F2PA 1YOVB 2K7ZA 2JD0A 2EW1A 2FMIA 2GBPA 4B8YA 5K01A 3PQ2A 1X1QA 3JR7A 2OL4A 2RGXA 4F04A 4D8TA 4YGYA 4F9FA 2P4EA 3H13A 1J39A 3SBXA 2OV1A 1WHTA 2X5OA 3U7RA 4DIFA 2MWMA 1CQPA 3T61A 2XRYA 2WJ3A 1XCJA 3U31A 3DZFA 5CIWA 3BJIC 3NDJA 4TMKA 1KF0A 3OEHD 1N6KA 2N1BA 2CVOA 1WBDA 1KEUA 2X0KA 1OZFA 1R8SA 1SAYA 2YJ5A 2J3JA 3PKJA 3RS9A 3HJHA 3KT8A 4URXR 4DR7B 1KAOA 3HEMA 1M7HA 2NO7A 3D43A 2UKDA 2L42A 3VH1A 1UJ6A 4XR9A 3LSTA 3J7AC 4ZV7A 4YJGB 1P61B 1TCCA 3ZU6A 1ZG3A 5DFAA 1G291 3BGVA 1V7CA 4AJ9A 5LVAA 1Z08A 1I7PA 4LTDA 4QFDA 1EG2A 4XLTA 5JTTA 3FETA 1QF6A 2IYYA 2ZKIA 4RETA 1X94A 4D8VA 5K45A 3HK2A 2OTCA 4JS0A 3O4IA 3WKDA 3L0OA 4MQ5A 4EGAA 1E1CB 1ZICA 2AN1A 3FMIA 2GAOA 1TJ5A 4IUDS 3U56A 3I4CA 4H7IA 1NT2A 3G4SB 3NGMA 4Z4IA 2W6JA 3F3KA 2OEPA 1NV9A 1YZTA 4BB6A 4O1HA 1JFVA 3CZ4A 3N2GA 1K9VF 2PQMA 4EA7A 5JS6A 4P80A 5C80A 3STXA 2XQFA 1GITA 2YNMD 3MGCA 3L9XA 2PUWA 3W8FA 1YL5A 3BKWA 3HDGA 4QE3A 1M2KA 2CVZA 4PNHA 1K63A 2WOOA 1J9EA 4GP9A 3DL4A 2O3RA 4ER5A 2XODA 2IA5A 1SUEA 4K3VA 3RHTA 3HMQA 1NMQA 2J0VA 4RAOA 5ERXA 3LP8A 4EI9A 2NXNA 2IUYA 1R5NA 4O0MA 4C03A 2BELA 4Q16A 3HS3A 1BQ4A 3P4XA 4O1IA 5CT8A 5G0VA 1VECA 2FSSA 1C8LA 3P2MA 5A7GA 3VV2A 2AZTA 2ID4A 4ZO6A 3U7HB 1ISRA 4IJMA 1SBHA 2RH8A 1EX6A 2VG8A 3L8DA 3E81A 1IZYA 5LC1A 2O2GA 2YWHA 2P77A 1FQOA 3GA7A 5F1OA 3DFZA 4OY3A 4HZGA 4HE5A 6LDHA 4OYYA 2C5HA 1BGWA 2G17A 4S1PA 3IT1A 4EUEA 2O2CA 1QMGA 4P33A 3GFSA 5CFNA 3U7JA 10MHA 1N9ZA 2F1OA 1YCHA 1P1HA 1S3FA 5KNDD 4UU1A 5DT9A 3DCIA 2XCIA 4E2YA 4J0JA 1AUQA 3C0KA 2I6TA 1RAIA 3GNSA 3IR6A 4S0ZA 5CLLA 2E4ZA 2X1HA 4LC0A 4HAZA 4X6LA 5JNSA 1RHJA 3AEKB 4UBKA 4Z4WA 1A7AA 3JQ8A 1SNYA 4HG2A 1FLAA 2ZYHA 1BGXT 1KDYA 5IH3A 4DLSA 1ZCFA 1KZYC 2WEKA 5KVAA 2OQ2A 4MR9A 1ZRSA 1HFWA 3CN9A 1I14A 1E3SA 2RJ3A 3PR3A 3TDMA 5IX8A 2WTUA 4TLEA 1CZUA 3VVBA 2NXJA 3VR5A 1QP0A 3GG9A 4C05A 2DPGA 2B30A 4TWIA 1ADYA 3JYNA 3X43A 1OLUA 4XIGS 4Q3OA 1PDWA 4B6OA 1ISHA 1HC7A 4Y6QA 1V1MB 4DNXA 4EVQA 3ZDCA 3F7TA 1L5FA 5EJIA 2Q0XA 1RJDA 4QICA 3T6KA 1LPBB 2C7VA 3AF4A 5A0TA 2O1WA 3L0YA 2A86A 2LVBA 3SHWA 1ZM7A 3TTVA 5A05A 4EFNA 4N8SA 1WD7A 1AQJA 1YVPA 3MTDA 2WMOB 3ZCVA 5FF9A 1M2WA 3TL2A 3Q12A 5HDBB 1Z82A 4U2BA 5DSZA 5I7EA 5HOQA 2YHAA 2C00A 4OFWA 4QOHA 4EG6A 3C6MA 4PINA 5JD4A 2H1OA 5C52B 2HYDA 4JB2A 1T0IA 5BSUA 3TK1A 1E92A 2FETA 5JYEA 4KX5A 1SQ5A 3GZNA 3A9UA 3K96A 1JX6A 3KD2A 2W83A 4L3WA 1BD4A 4COOA 1CQXA 2YJGA 2QZZA 1DC4A 1F2UB 3MSXA 3QXHA 1L0BA 3M4XA 4QAQA 4UJ3A 2Q5IA 4PGHA 1FDRA 1BCRA 1YA8A 4JDPA 3FCCA 1AUOA 1FTWA 3VU9B 3TVTA 4PTYA 3N28A 2VXCA 4IXMA 1GA4A 4PS1A 5A2GA 1JYFA 1TEHA 1QNLA 3DOIA 3CR3C 3TZQA 4CQMB 1YF3A 2ZL7A 2L2QA 2GXUA 4AWAA 3MYRA 4LC1A 2ZBFA 3KTAB 4S0XA 1MO2A 4BVLA 2Q4DA 1Q0HA 1VMEA 2B7CA 1H0KA 3ABRB 1GPBA 1B2RA 3EQ7A 2ZUBA 3KQMA 1XTJA 2X4DA 3NCHA 4MR8B 5IN4A 2PRZA 2J9YB 1T6BY 2V96A 1EHYA 1QFSA 2ZOSA 1YR2A 1HKUA 4GX1A 3T95A 4C5AA 1MOZA 4DC1A 3DD5A 1ISPA 1XVIA 2I62A 1YZQA 5HJ2A 3V33A 4BOYA 4HUQB 4ARBA 1US8B 3G1TA 1G55A 3G13A 5JEEA 3MS2A 3O8QA 2WIGA 2WY2D 3ZZMA 1QVGB 2D2IA 1CR1A 2GSDA 1RWQA 1E9VA 4GM4A 4HWKA 4U2CA 5EIWA 1IRIA 4MW6A 4CMCA 1YC5A 4N4AA 3L1HA 2IKSA 3CUWA 3KTOA 4R3NA 1O9HA 2WG0A 3EASA 1OIXA 1SBZA 2O0HA 4WA7A 3UKJA 5A4MS 3MJEA 4RNDB 1M75A 3AVPA 1V3VA 4NY1A 4ZAYA 4P08A 3FSRA 5AJWA 4H17A 2Y68A 2P6MA 2QTLA 4PANA 5AVOA 2NU9B 2RGRA 3AL3A 2NU8A 4FYIA 1I0ZA 1DCMA 5FV7A 3SMQA 2B5OA 1PO7A 2QM8A 1RAAA 1ZLYA 1G5QA 1Y1SA 4NMLA 4E2FA 1N0WA 1YQXA 4HLNA 4UHEA 4J1TA 5TPZA 1CS4C 1P7ZA 1NPYA 3K1AB 4RACA 4ES6A 3W2FA 4MHTA 4RGYA 4MW5A 1H2XA 1AXRA 1NY5A 2ZYIA 3NWPA 3ORQA 3LCUA 1XU7A 1OHHD 2PPVA 5A5VA 4DM7A 2AS0A 4ZIRA 2Z9DA 1ZW6A 3I62A 4S1OA 4BXOA 5DYWA 1EM8A 1CT9A 1RRFA 2QWXA 3ITDA 4N65A 3LGXA 1CY8A 4TN5A 4N6NA 5BUSA 2R1TB 1GU7A 5F4BA 4ZJPA 3FTNA 3L0SA 1LSJA 4Q3KA 1ZR4A 3VX4A 4XQEA 1ILWA 1EFAA 1YRBA 4IEFB 1NR5A 1HEIA 2IPMA 2NZYA 1UT8A 1DHRA 3EZNA 4QLAA 3T15A 1J1UA 2DT8A 3NHBA 1NT4A 4IGIA 4P4GA 2HCRA 3IIKA 4JBYA 4J7XA 5CBPB 4TKMA 1QPBA 1TRKA 5KYWB 3C74A 2EG9A 2X8LA 1XJ5A 3I01M 5CVDA 5AUOB 3IT2A 1R74A 1ZBQA 2I6SA 3AU9A 4EYGA 1AG9A 2WD9A 1HSOA 4OTZA 1UJ4A 2O7SA 4G8JA 3RGWS 1T2AA 4GKJB 3MWDA 2PUCA 3QKWA 2JFBA 2EFEB 3AT1A 5LU9A 1AV6A 2CY0A 2DMRA 3Q3VA 1IB6A 2SHKA 3T51B 1A71A 1C4WA 4OBBA 4P8RA 4PRZA 4TT8A 1COWA 4ZREA 5HWSA 2LXNA 1CKEA 3ZD7A 1XK7A 1MD9A 2A9FA 5AOAA 2YV5A 4UBIA 3WQZA 1BKYA 1TM2A 3RJMA 3U09A 3AHCA 2JIRA 3ZZUA 4MGKR 4Q12A 4B84A 3EPHA 4IQGA 3K0HA 5BW4A 1E3MA 3JQGB 3BRQA 4OMDA 1BMFD 3H4TA 1E3WB 1E6LA 4JD5A 2Q7DA 2ZRPA 4MR7B 3WISA 1CERA 1JEQA 1IXRC 4OREX 3NUGA 3SKYA 1JRLA 2HK9A 4RBNA 4RIIA 2ZUFA 1AHNA 4XM0A 3ZKWB 1WVIA 5A6SA 1WTAA 1MUUA 1TAUA 3WLOA 2ZCJA 3U17A 3JR3A 2PRIA 3UVEA 4U4AA 2I55A 2WICA 1VZ2A 3KYJB 2OTJB 2JAOA 3QSGA 2GYYA 4G9GA 4TTQA 5KWVA 2C4MA 3SQNA 1E32A 2WUGA 4RIGA 2JEOA 1GV0A 4QWWA 2XD4A 4K6FA 1SZCA 1KO5A 4P5PA 2YH2A 2GREA 1FP2A 1U4NA 4P3OA 3ZWQA 2FOIA 4XONA 2VSFA 1F5SA 4L73A 3N7UA 1Z3CA 4C9BA 2HDNB 2YWGA 4EARA 1NW9B 2O8CA 2J4FA 2H2FA 4OOVA 2OGSA 2JZCA 2JKZA 4Q19A 2FE4A 3TSZA 3WADA 5EIEA 1VCMA 1MTZA 2HJWA 3KUKA 1JEOA 4GXRA 4RW0A 1GARA 3PF9A 2YV2A 4BO7A 1DL5A 2PTGA 2MR5A 3G2NA 3MJ4A 3P4YA 4G9BA 3ZVRA 2WQ6A 1QGAA 4IV8A 5F5NA 5TMBA 1FOEB 3CKKA 2R6ZA 4AQYB 4A6EA 2WJZB 2VBUA 1ATZA 4G0QA 2JHPA 3DVSX 4UUQA 4F1KA 3QLTA 5BXQC 4MVWA 1BDMA 4FC7A 2O2DA 1DFIA 3GJRA 3ROZA 3BH6A 3SU8A 1XN4A 4EHDA 3OJCA 2ZB4A 1ODJA 3EDCA 3GEEA 3AY3A 3HR7A 3UJNA 1Z63A 4B0PA 1XMVA 5C5DA 5HSGA 2HHJA 2OD9A 1M0SA 2A1IA 4WCFA 3REQA 4GF5A 4P7BA 4ARSA 1NLUA 3VAYA 2HLDD 3A9TA 2E6KA 4Q9NA 1ZK4A 4ER7A 1HOTA 2JFHA 2YL2A 4HADA 3TLMA 4U7DA 3DGEC 3N3BC 1WV1A 3JQ6A 3QFCA 2E1PA 3LDFA 3K1ZA 1P1RA 3OPVA 2Z8XA 1V43A 1G60A 3BDIA 4OHMA 1FTNA 4V0RA 5BQ5A 2NZWA 2B1QA 1C8BA 3GEBA 2OBMA 1CIPA 4KGDA 1XLUA 5KNCA 1FK8A 1PZEA 1ODIA 1J5XA 3A3OA 3HRHA 3U4IA 4F1JA 1ABFA 3KJNA 3I4FA 3M2TA 4LXTA 4G4SP 4TXLA 4RTQA 5JAPA 2PZLA 1XMOB 4YRLA 1BHSA 1HE2A 4AYWA 4QTTB 1P4JA 1E58A 2ZR7A 4Z99A 5EZ6B 1QK5A 1LX7A 2QG4A 3MG9A 4G8DA 4AJPA 5JCJA 1E69A 4G25A 5EJ9A 3IKLA 2FFBA 1AQYA 4RC9A 4CVNA 5CD1A 4RSRA 2YFHA 4RPBA 2JHFA 1V71A 2FPGA 4AY5A 1WQ4A 4H7DA 1MA3A 3PA1A 4H1VA 2Z57A 4B2LA 1A72A 3DC7A 1JZTA 4LHSA 3TNFA 3DFMA 3Q40A 3ESBA 4KRFA 1Z0SA 4IDDA 1JWLA 1DINA 1O97D 4LRXA 1BG6A 3H19A 2XMDA 5BW6B 1U2PA 2EGGA 1DQZA 4TUYB 3OQIB 3MWLA 2IPLA 4DCVA 1ZOIA 4DS3A 2G09A 5KYUB 3V3TA 2M6LA 3ODPA 2OYSA 3DDWA 1EJ6A 5FNVB 3LKZA 3ABOB 4FR2A 1VQOB 1FTSA 16PKA 1RJEA 1BFDA 1JZSA 2XTMA 2Y71A 3KQVA 3LIPA 4Q4DA 3W5AA 3M6VA 1Z33A 3LM8A 3LZ6A 2CMGA 1J2TA 1G20A 2Q45A 4Y0VA 3DMHA 5AKGA 1UH5A 2SNIE 3AY6A 1RBZA 5D1HA 2VUUA 3WYEA 4CF6A 1QG6A 1QLHA 3A6KA 1RQLA 1RM5A 4P2GA 4ZAWA 5ELMA 3ISJA 4J3JA 2ZIZA 4KXYA 4JL6A 4Y67A 4ZTUB 1U5BB 1VKZA 1XKQA 3PCTA 2OXIA 1SEVA 3HL0A 1ZK0A 2DYKA 1BVRA 3E4CA 3FB1A 4XIFA 1DAMA 3FPCA 3QUAA 3FYUB 2DBZA 3I23A 2C9OA 2F1KA 2YJZA 1YZUA 3AP3A 2GF2A 1Z15A 1E79A 3PFFA 2OXRA 1X42A 4NMMA 4QNMA 1E5XA 3FSGA 1RKQA 4CLHA 2JJ2A 4RELA 4M9RA 2F9LA 4MROA 2V3CC 3AHHA 2FI1A 3QNMA 3RTBA 4DB2A 2HBRA 3SQXA 1M0TA 4NQZA 4TRMA 3RKUA 1HRKA 2Q21A 3IR7A 5EWLB 2JFWA 2C7RA 5BR7A 5CPBA 2G7ZA 4YFYA 4MPJA 1J7KA 2EWMA 3WGUA 1JG2A 1HFKA 3EX7C 1LKZA 4LUCA 1XZBA 2ZBQA 2IEZA 2PHZA 3WIVA 2HA0A 3QEBZ 1TUGA 3X2SA 2BMAA 2HSZA 4M8LA 1WXEA 2VK8A 5CCDA 5JCOC 4CNQA 3RCBA 3GLGA 5FWXB 2ZPUA 3CO5A 1OXMA 1RE0A 3KEWA 1AUVA 4DK0A 4IG4A 1JDSA 4ER0A 2ZTVA 1ZGBA 1RJWA 1SVOA 2C3OA 2M6RA 3G0DA 1U6KA 2GPTA 5DCUA 3MCUA 4M2LA 4TZ0A 2O9JA 1G16A 3W5UA 1PFUA 3JQPA 5EPOA 1BXRB 4BKPA 2MYNA 3CC8A 1YU6A 1A5AB 3HDTA 2XBLA 1X0XA 1NMZA 3PJGA 1PJ8A 1EWVA 4R8KA 5AI0A 2B0CA 2OXTA 1MOPA 1R27A 1ISGA 2B4YA 3D8HA 3T8YA 1JIKA 2DJIA 1P72A 5KOIA 4RD2A 3DMGA 3KKZA 1M6EX 3U3RA 1FE8A 2HA6A 1S1MA 5AM4A 4K0RA 3O03A 1CEEA 4BO3A 3AJ8A 2JIOA 2Z2ZA 4HCJA 4C08A 1GL3A 1YAHA 1R12A 1VL5A 2B98A 2H0RA 3AKCA 5A0VA 1F17A 1QYVA 4S12A 4JOQA 3HGMA 3QWIA 4X65B 4O4JF 3GRVA 1OFIA 3ZVNA 3QV2A 1FJHA 2HMYB 4UVHA 5AK0A 2B8WA 2NSDA 3I72A 3QHQA 4C7BA 4J7UA 3IFSA 2XYQA 5DGDA 2P9BA 4AJKA 3CT6A 5ALMA 4G4GA 4FKMA 4IINA 4EECA 3HXMA 1VG0B 2XAUA 2GJ4A 1NURA 2CDNA 5JXGA 2XYPA 1BMDA 4BTLA 2JDIA 2Y8EA 1FSFA 1U7ZA 3TLZA 1H4SA 1AD2A 3SGLA 2GNAA 2PGNA 1GZDA 1K2WA 3RSOA 1JFSA 4Z6KA 1YS2X 1Y98A 4MUAA 1KDOA 3WX0A 4V2UA 2HLPA 3IP7A 2A88A 1E3XA 5D51S 3OQMA 1SHTX 4FSXA 1UT6A 2VHXA 4BEVA 6REQB 1PNVA 2AD1A 5KSOA 3U62A 1IDOA 2IYVA 5I7VA 3JYPA 3OIFA 2VHQA 4JH0A 1Z4MA 3BM5A 3AR5A 3R76A 1XDBA 2QTBA 3ROQA 3VDNB 4EA6A 1MX3A 3H97A 1T5IA 3S44A 3VR6D 2AUMA 1XLWA 3RG2A 4OP7A 1Y7PA 1CE8B 3NP7A 3B1ZA 1UWVA 3MCWA 1QANA 4M1SA 3BC9A 1PL0A 1JEEA 4D4GA 5KWEA 3L1UA 3LLMA 3P0IA 3QKUA 2D4AA 1NMEA 2DYIA 2PH1A 3G88A 2D74A 4XOPA 1AGPA 2CYAA 4U7JA 2QLFA 5T64A 1HXHA 2L17A 4L7QA 1G17A 3LQFA 1YIOA 4Q48A 1R6AA 2GK3A 4MS3A 1LK5A 3KQQA 4PPFA 1P6UA 1L7PA 2XOEA 4XFJA 4ZMSA 3U80A 1ISIA 1DBQA 3SDBA 1IBLB 3JQ8B 3G2PA 1AM4D 3ENWA 1V4BA 1PT9A 3DZCA 3KU4A 3E1YE 1Y8RA 2XCOA 3AZQA 1WB9A 3U2QA 1CRLA 1MGOA 4D0LB 5L3QA 1QGZA 4J6FA 1PT6A 1EX7A 1JU3A 1PW5A 2R48A 5HKLA 2V0CA 5TGDA 4BNUA 1OX4A 5F7ZA 2H6EA 1UKYA 3G82C 2GCPA 3ER6A 3LGSA 1R4NB 3QTBA 1GZSA 2XV1A 1XTZA 3KLBA 4Q6WA 2VS1A 1UUFA 3R6TA 4FNMA 3GRPA 4PHGA 3S2ZA 2F55A 2QENA 5FUMA 4P4SB 3Q3GE 4KSCA 3A9WA 1U3UA 2H65A 1Z37A 2Z8YA 2VKQA 1SU4A 3TCKA 1CUIA 4FGKA 4KW7A 4YA6A 4CHGA 2EDAA 4ZPJA 1XCPA 4IYJA 4O4HB 4Q24A 2YJ3A 3PHHA 1UXKA 1L5HA 4YAWA 4D45A 2NV6A 1C8KA 1V95A 4P7FA 1KVRA 2GD2A 3G89A 3RUFA 5FA6A 2WTBA 3CG0A 3L8HA 1OROA 1WUTA 4GS5A 2AOUB 4Q1FA 2RH4A 3A2NA 2CLKB 2PSSA 4LDNA 3UATA 3VH3A 4F56A 5LD2C 3W6UA 1TAGA 1O58A 4OLFA 5HIMA 9ATCA 2J9GA 1E5VA 2ZTNA 1WMSA 2C2BA 2XVAA 1SXJD 1P0CA 1LBSA 3L79A 5C0OE 5PNTA 3G1WA 4ARVA 1N7HA 4LOLA 2ZVQX 4V0KA 3GFOA 4WECA 3TECE 1FRNA 3MLBA 4PX3A 1BZYA 4UD2A 4CG1A 3MJCA 3WSWA 1KL7A 3GF4A 2IYXA 2XGMA 3OZDA 3PUWA 2V31A 1E7RA 1VKRA 3B13B 3UMGA 3D6TB 4FFLA 1HYEA 4INJA 4XM1A 3H65A 3RH0A 5J4HA 1W8DA 4OLJA 1U28A 4JI6B 4Y2GA 4ZYWA 3IVAA 4UOQA 1XP8A 5H3LA 5KKAA 1OBCA 2ORYA 1JYSA 4RJ2A 1Q83A 1THZA 4OGGA 1OB2A 2JHAA 1CIJA 4B4VA 4AF8A 1TTQB 2R85A 2HRZA 3EOBI 2WM9B 1R0ZA 1QE0A 2C3UA 1MEEA 3CCMB 4H15A 4L2IB 2QXUA 3OHSX 1I1QB 4P3NA 2DUUA 2YVKA 2R87A 3P9QA 1JALA 4OQNA 3T1HB 4B3GA 1CRPA 1SMKA 2P1ZA 2E4AA 1NXTA 3E48A 2A5YB 3IP5A 1WXDA 3P2OA 4NZPA 4ZO8A 5J59A 3TN7A 4XCVA 1QDUA 4KQWA 4YP9A 2GD1O 4DJ5X 1L7RA 2V7BA 3VM6A 3IEUA 1FSSA 4GDMA 2ZUEA 1GNQA 4JXJA 4FYWA 1FP7A 2RKWA 1G21A 4HDCA 2YHIA 1JR6A 3PUHA 1W6UA 3Q41A 4P5EA 2HGZA 1KBQA 2ZWPA 2PGOA 1JQDA 2AOWA 3QVGB 5E1OA 2VYQA 4GDFA 2A14A 4EJFA 1SQFA 1H2RS 3IBTA 1ADGA 4GX0A 4OQQA 5CT9A 4YXWD 4J07A 2NUTB 2Q9CA 1CPYA 2DWUA 5C1DA 4QZVA 3BY1A 3HN6A 3IAUA 4K26A 4KFSA 1NN0A 1JSXA 4P26A 4M9CA 2BGIA 1FUIA 3OWXA 2ZXFA 4EUKA 4KN6A 3GJ8A 3WKCA 2BAGA 3QELA 1I10A 3E18A 3V2HA 1K4MA 1OZAA 3CZRA 3FKSD 3L6BA 1UXGA 3LYHA 4B2PA 1N36B 1QH8A 3HVRA 2DPHA 2PANA 5T4FA 4CEIA 2QQ0A 5IANA 3FNBA 1JHVA 1FXWF 1WEHA 2NGRA 4KU4A 4YMUA 1GPAA 1ZPDA 3D8TA 1TF5A 1CQJB 2I76A 2JKYA 3I42A 4C30A 1E1CA 3PFKA 3TJMA 3BD8A 3W5SA 1PR4A 5CR9A 3IJ5A 4UMFA 1PQUA 4M83A 2MSEB 3QUBA 4JLOA 4EIWA 1DG9A 3A1PA 4EJSA 3OJFA 2B25A 3ASRA 1QVAA 4UM9B 5AI6A 3OLZA 3A37A 2CJYA 1NN5A 5L3QB 1KJZA 3OPQA 2VPYA 1XL0A 2ZLBA 5TT1A 2EJCA 1ZOSA 1TZKA 1YJBA 1EFRD 1MX1A 2VJPA 3D6MA 4QTZA 1EP1B 5DW3A 3TIFA 5CXQA 5LP6B 2DC1A 2V7GA 3AVVA 3CNNA 4DDHA 2F3RA 2P1DA 5LYJB 3QVSA 4ZO4A 3DQQA 1N2CA 3DDYA 1NVUQ 1M90D 1OW3B 2I4IA 2YWCA 4LRYA 4WLOA 4DEYA 1WZNA 2ZB2A 5DBFA 2D2EA 1OI7A 2V54A 5AVKA 4H1WA 3AVYA 2QG9A 4RDHA 1D8TA 1ZD1A 1G2QA 2Q3FA 3PFIA 3U4QB 3DKVA 2GERA 2H9YA 3NORA 4C6TA 4ZYUA 4BMYA 2X9VA 2XGGA 3AZOA 1A5SB 1GFWA 3L9WA 4E5VA 4M9UA 1LNZA 2LR0A 3AJAA 2A0KA 4ZYTA 5CB4A 3GRCA 3RWOA 2R9VA 5KMGA 1S72B 5HDQA 2OLJA 3M34A 2VBIA 1MEOA 3H5OA 3BB4A 4TWBA 4AZ0B 3N6XA 1N7IA 4HMPA 2D3LA 3I30X 4EFDA 4YY3B 2EKQA 4LJAA 1J0BA 4JLKA 2JJ8A 4FMDF 4DCJA 1I5OA 4N7MA 4Q00A