4RD6A

Structure of aif2-gamma from sulfolobus solfataricus bound to gdp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
414
structure length
405
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 110
structure length 405
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd6A01
2ZJOA 3QKUA 4Q1EA 1P2TA 1B0UA 4B6EA 3CCMB 2C9CA 4DDTA 4US2R 3KB1A 2D74A 5SZHB 5EJEA 4TQAA 4UKDA 3VR2A 4DLXA 3CCRB 3AH8A 5DHAA 4RFVA 2RHMA 3LW7A 4JBWA 2ZUCA 1KMHA 1FNMA 2HEIA 1W4BA 1Z2AA 3OJXA 3CKLA 2AWOA 1QVFB 2KSQA 2ZI9A 3QVVA 3UMSA 3QXJA 3GLFA 3GLGE 1NG9A 5A4JA 4US0R 2RHDA 1TU4A 1XCPA 2NO1A 3T12A 2QN6A 4W5JA 3G4SB 2VHQA 3W6NA 1GAWA 2GAOA 5KOYA 2J3EA 2RMKA 1F48A 4OHWA 3ZDQA 1CJVC 2Z4SA 3CC2B 4DCNA 3TAUA 4ZV4A 4TL7A 4LHVA 3V76A 2WVJA 3GLIA 3QKRB 4YMSA 1G3MA 1VMAA 3RRNA 4EKDA 3M6AA 1YKSA 2F3RA 1N25A 2YHSA 4MKHA 5KDLA 4MYCA 1ZD9A 1MKYA 3T1OA 3KKQA 1YITB 3CMEB 1YZNA 1U8ZA 3LO8A 4IDPA 3T15A 1GRQA 5CIQA 2QPAA 4L9SA 1UKEA 1S1MA 3MWJA 3B9QA 5EE1A 3QG5A 4RZ2A 2CCKA 3B6EA 4F38A 4HUQB 3ZVRA 3K9NA 4Z51A 2ZE6A 3FJOA 3S1AA 3ZZUA 3HDTA 3NHBA 4Q02A 1N6LA 1P9WA 2WIAA 3OZVA 1KNQA 3NBFA 1J7KA 3U6BA 2OTLB 3FMIA 4LWZA 5GVSA 3F3YA 1ELOA 2GCOA 3FHCB 4E07A 2XTMA 1RZ3A 2VP5A 4B3XA 3HP1A 5EP2A 2CXXA 4C30A 3B7GA 3T5GA 1D9XA 4ZO4A 1IM2A 5IHPA 3GJ7A 2ZSBA 4PFSA 2B7BA 2V54A 2CMKA 3LBNA 4Q4AA 2W00A 4C3ZA 2JLXA 1KZ7B 3FKSA 3KFXA 1F20A 2XAUA 1OXVA 2OFXA 2ZUBA 5LB2A 3HWSA 4DLRA 2OFOA 4EFMA 4BLRA 4EPWA 1QG0A 5EZ5A 2EIXA 1R2QA 2EW1A 2QRNA 5FL7D 1W5TA 3I5YA 2P3SA 3I8SA 2O8DA 1U94A 2EU8A 2FPKA 5EE0A 1TAGA 1R4AA 2BF4A 2J1LA 1L4YA 3HPRA 2HUPA 4HZIA 1P73A 2C9OA 2VH5R 2GVZC 2C99A 1J8YF 1NL3A 2PCLA 1XEFA 3IILA 1Z06A 1UPTA 1BX0A 1KC8D 4NDZA 2HT6A 2XITA 4URYR 3PEUA 3SJZA 1F6BA 4PPGA 3RANA 3MJHA 1H65A 3EXAA 1YJNB 5KHOC 1MABA 5K8LA 4YHBA 2W83A 2BEJA 2QQ0A 3K0SA 3SBEA 5JS7A 2PLRA 4ZDIA 1A5TA 1NLZA 5FTJA 2G3YA 1K6MA 4RY2A 4UXIA 1KKLA 1Z28A 1U0JA 3FFBA 2OO7A 4EFLA 3LO5A 1OFHA 1UJ2A 5ELXA 1K5GA 1FX0A 1KI6A 2ORVA 4XVQA 5EP1A 3TE6A 1US8B 4GT1A 5JRZA 4I81A 3GLGB 1VDZA 2PT5A 3K70C 2FA9A 5CJPA 3GJ4A 3RHFA 1M2OB 3QPVA 4Q9JA 1IB0A 1NY6A 2ZI7A 4YAWA 2ZRMA 4DEYA 2XGJA 1OGJA 4QNMA 3V9PA 3R9XA 2GF9A 2GXSA 3F8TA 4Q4JB 2O8EA 3A58B 1IXZA 2PLFA 1OHHD 2ZR9A 3FYHA 4IXNA 1NVXQ 4X8OA 5AJWA 5UKDA 3EPJA 3UMFA 5JI2E 1WMSA 4B32A 4QG7A 4DCTA 4DLVA 1YRAA 4MQBA 1NDHA 1KI4A 2A7QA 4GRAA 2ZJ8A 4C2TA 4PAOA 4MDEA 2F1HA 3SBDA 4ZI2A 2Q9BA 2ZREA 3R7WB 1W0JA 121PA 4JLDA 4BPRA 1ZINA 5H68A 5IK2A 2IK8A 4PHTA 2A5JA 3IGFA 4S2EA 2FZLA 2JDIA 4PHFA 5AUQA 1RYFA 3CH5A 3RWMB 3VX4A 4R7ZA 3U7FB 2PH1A 1N8RD 1BMFA 1AS3A 2O8CB 1W34A 2ANCA 1LB1B 4H1UA 3QSYA 1YZGA 4QGHA 5CM9C 5J40A 4ZGNB 3Q7PA 1DVRA 1XNJA 4ZDWA 4D0LB 5IRCD 4JLPA 2FSFA 1AQYA 4U02A 1KI2A 2VRWA 1NVUQ 3LX5A 3VKWA 2XZLA 2X77A 2YINC 2W0MA 2AK3A 1TF2A 2QE7A 3KDSE 2DHRA 2YZ2A 2BJVA 5F9FA 1F2TA 2HDNB 4W5HA 3QEJA 1RW4A 3WY9A 2OLJA 5AUNB 4CRWB 3T1TA 3W5JA 3DZDA 1N6NA 1X3SA 5EE9A 5FUVA 1RC8A 1VYTA 3E1SA 2F6RA 1ZIPA 1DO0A 1W0KA 4G5SA 5CYPA 3N2IA 1VYUA 5FOVA 2OK8A 2ERYA 2W6JA 1OXUA 3N2EA 1DAMA 3BGWA 1FNBA 4Q9HA 4YALA 1QFJA 3PUWA 1EFRD 3GLHA 4EPTA 5H1YA 2CDNA 2CK3D 3PUZA 1CKEA 3H84A 3TW8B 4LJYA 2OHFA 5M04A 3SDZA 2A5FA 2G1KA 2J0UA 4OI1A 1NBMD 3FHOA 2V8OA 3FOZA 2OBNA 3QXSA 2XXAB 4AYTA 1Q20A 3GJXC 2YOFA 3CF0A 5BN5A 1E9SA 1A4RA 1KI1A 5CLLA 3JVUA 3G71B 2WBLC 1E1RA 4MKFA 2JLYA 3CCVB 2QA4B 1VQLB 2KJQA 1VQ6B 2VQSA 2WWYA 1C4OA 4BEBA 4YMWA 1DAKA 1JR3E 4NYMQ 4ZIRA 4D4JA 2DFKB 1CJTC 1WA5A 2FGJA 3K70B 1R0ZA 2R6GA 4DT1A 5JZVA 1JJ2B 3Q5EA 3W8RA 3E5HA 2XEXA 4PSAA 4RD4A 5FPYA 3L8YA 4QM6A 3LH5A 1G17A 4EH1A 3WNBA 4XD7D 5D3MB 1ZM9A 3AGQA 3CMAB 1IJFA 1KI8A 2JIZA 4KO8A 2P0EA 2A5GA 2D4HA 2C04A 1JB1A 421PA 4B4DA 2XB4A 3BOSA 3SJAA 2UVQA 4DSOA 2FU5C 1VQOB 1NVVQ 2IC5A 1T3SA 1X1RA 3PUYA 1VCOA 4HZUB 3EW9A 1Z6AA 2QEXB 1K5DA 5G53C 3THYA 1Q7YD 4PZLA 2WICA 2YYZA 1XTIA 1SZPA 2MSDB 4Q9IA 2J7PA 2ODBA 5TB5A 4Q66C 4RD3A 2OILA 2PBRA 1J70A 1UADA 4JYCA 3O8RA 4A2WA 1FTNA 4H1VA 4W9MC 4B75A 5F98A 3PEVA 5CB6A 521PA 2R6AA 1G5RA 3QPWA 1RRCA 1MV5A 1HT2E 1NMYA 2G1JA 2D2EA 4QBGB 2D3WA 2ZRFA 2WJGA 5GVRA 2D2FA 1JAHA 1YQTA 2D62A 3ZBUA 1E2NA 3EA0A 4LGMA 4M9QA 3RWOA 1UAAA 3MAAC 2P65A 4WXPA 1GM5A 4AWXA 4NHOA 3QBVA 3NBXX 1FRNA 3T1QA 1Z3IX 2OXRA 3RSOA 2IEYA 2ZRCA 2KWIA 4ARZA 2MMGA 4HB0A 5DH9A 3NKVA 1MT0A 4HEJA 3CWQA 3CW2A 1DE0A 1UF9A 2GXUA 2WAYA 5TDHA 4D4LA 2CLDX 2V7QA 2IYTA 3RS7A 2HLDA 1P60A 3A1WA 3AVPA 3J81k 2QY9A 5B30A 3FKSD 3EZ7A 1G8FA 1YRBA 1E1QA 4WA7A 1W46A 3C4JA 2DETA 3WRXC 2IYZA 4RCZA 5AJXA 5J4LA 3MSXA 2K5UA 3VR1A 1CU1A 4RCYA 3A4LA 3SJCA 4UJ5A 1E3MA 4LJ8A 1N5JA 2W6IA 3SYKA 4CF7A 1VQ7B 3PQCA 1QF9A 3L43A 4XTCS 4Q4LA 2ZVPX 4JVMA 3TUZC 1GWNA 2Q3HA 1H8ED 3ZC3A 2PMDA 1E2FA 1XTRA 4A92A 3HR7A 1OIVA 4X8LA 3B2EA 1FP7A 3FGNA 5C2JB 4ZI3A 2EVWX 3B9PA 2I1QA 3LXXA 4C0LA 1ZBDA 2FV8A 4Q4HB 2JJ8A 2J0SA 1M90D 1YU9A 2ODNA 1OH5A 3C16C 3P4YA 3DM9B 4PQFA 4OBEA 3WBJA 5F9HA 2ZSAA 4W7SA 4OK3A 1AQUA 1GVNB 2R6CA 4RVCA 1IONA 4P4SA 3UWKA 4YAUA 1G6OA 5HE8A 2F1RA 3NBZC 1M7GA 3MWLA 3THWB 3ZD7A 2FEMA 1ZM4A 2WJJA 3CR7A 4DEXA 2XSZA 2C96A 3IIKA 5KTYA 1CJUC 2ZJ2A 3H1TA 2WJYA 4B48A 4BFUA 2BMJA 4QGGA 1Z63A 3PFIA 2VNHA 1NN5A 3O8CA 1AGRA 4Q47A 4DLZA 1ETUA 2VZLA 4NYJR 1P62B 3SE0A 1VG9B 1GO2A 3QE2A 1Q81D 4LHWA 1E98A 1NN3A 5HZHA 4IOLA 3VHXA 3U3OA 1EFCA 2QRZA 2BBSA 4Q01A 2F1JA 3U61B 3B1WA 3BH6A 2P6NA 1JNYA 1DARA 3OZUA 1G5TA 4TSFD 5EE3A 3RYTC 3VQTA 4GDFA 1V43A 2ZI6A 2ZYVX 1KDOA 2NO9A 4DVGA 4TMZA 3TQFA 4CDGA 1E2EA 1DAHA 3GMTA 4A9AA 4DB2A 2OCPA 5DISB 2VO1A 4DUGA 1CQXA 1T3HA 4M2LA 3OW2B 5DI9A 4DKXA 2IT1A 1W0JD 5IK2D 1EFTA 3A4MA 2DY1A 3MD0A 2ERXA 2OAP1 1G4UR 4PZYA 3VMFA 4V0OA 2ZRLA 3QFSA 5TARA 1RKBA 4PHGA 4N0DA 1TNDA 3I73A 4RD2A 3QXCA 4J0QA 2MSEB 3JZMA 4AG5A 3PJRA 5CIWA 1O3YA 1CXZA 4Q48A 2XB2A 4ASUA 1HYQA 3E70C 3LXRA 1BMFD 2QPTA 2ZITA 2UKDA 1S2MA 3P27A 2EWVA 3OESA 2CL0X 4HAZA 1H42A 1ESMA 1W47A 3PITA 4QBHA 3SI7A 3MG9A 4F4JA 4JSTA 4L4UA 1LF0A 1LTQA 5FL7A 1OB2A 2VIIA 5JEEA 2JATA 1VQ8B 2VP6A 3SYLA 4RKEA 1PLJA 1T8UA 4R71A 1OW3B 3I4LA 2OLKA 2PX3A 3FPAA 3IPXA 4NYIQ 5FBQB 2IEZA 4ON9A 3QUSA 1II0A 4C4PA 1KIMA 4Q7JB 2QE7D 3GFPA 2BBWA 1P5ZB 3W2EA 1OH6A 4ZCMA 4MYTA 1ESNA 4DXAA 2GDJA 1GTVA 3CUEF 4OQXA 2DCUA 1BQEA 4IDOA 3H0KA 1GSIA 1KQSB 1KK2A 4G1BA 3SFZA 1N0VC 5HR5A 1YZUA 3E2IA 4N0EA 1T6NA 4EPVA 1W0KD 4MA4A 5LBIA 1E6CA 3QKRA 4M9XA 1CULC 5CM8B 3HU2A 2W6JD 5FOTA 1NJFA 1OV4A 2OBLA 1P3JA 2GPJA 3D7MA 5J4KA 5FTLA 1QVAA 2VSOA 4PR0A 1ZU4A 3QIAA 4V0MA 1G8PA 3W6OA 2YJTD 1JR3D 1S3GA 3BXZA 4CEHB 1QRAA 4KYIB 4B44A 1L7VC 3BH7A 2YWFA 1QZXA 2C8VA 2QP9X 5GV8A 2QZ4A 3MLEA 4GBMA 1QGZA 4WBSA 4KITB 1P4SA 1PLKA 2QBYB 2DEUA 2GRJA 3TK1A 3VTKA 4PPFA 5HTKA 4HUQA 3T06B 1KO7A 4LYJA 1VQ9B 1OFIA 1VHLA 4URZR 4CIDA 5BN4A 2QORA 2BMFA 4C2UA 2EFGA 1ZJ6A 5FTKA 4DLWA 3CPJB 1CRPA 4NBSA 4KV9A 4Y9RA 2A9KA 1E1RD 2ZRBA 5DLQC 3QVUA 1FP6A 4Y9UA 5H70A 4BEJA 4GZMA 1T3LA 3K0AB 2BPOA 4DQLA 1XRJA 2GJKA 4LHZA 2JJ2A 1JECA 3CONA 4LHYA 1AJEA 1N0UA 2L0XA 2SHKA 4HDQB 1RPZA 3VAAA 3U4QA 4I1SA 4TMKA 2KB0A 1E2QA 1EWQA 3JZAA 4HDOB 4LPKA 5HPYB 2UZ3A 3L0OA 2WJHA 3LDAA 3VR5A 5DI3B 8OHMA 2PZEA 1QHHB 2JIZD 1KJZA 2G77B 1UMKA 3BB1A 5AK0A 2FSHA 4JYBA 5TMPA 2PJZA 1U2RA 1ZP6A 3CM0A 3Q3JB 4IKEA 4BFSA 2ZRNA 4M8NE 1XTKA 3NTUA 2R44A 1TUIA 3BAFA 3GFOA 4B33A 3ZIAD 2JLQA 3LFUA 2F43B 4DSNA 2X2FA 3ADDA 5J5CA 4YXWA 3CRRA 1G21E 3W8NA 1M1YE 3I72A 4PQYA 4LBYA 1M6NA 1K9MD 3OF5A 2AD5A 1TQDA 1EWYA 1E2IA 2BOVA 2O52A 1G3IA 5H5JA 3RABA 1NSFA 1N6PA 2BWJA 2KI5A 3A1SA 5AN9A 2ZM5A 4F92B 1VYVA 4NKRA 1VG8A 4FIDA 1G3QA 1MO6A 2NQ2C 2WWHA 2H57A 2QMOA 4RD6A 2X19A 4B43A 1QHSA 1ZNZA 4LPSA 1FMLA 4WW0A 1YZTA 2QMHA 1QG2A 3LRPA 2VNKA 5AJYA 4V0NA 3EG5A 1N6RA 1XDBA 3T35A 2HT1A 3SQXA 3AUXA 4JVLA 1W7AA 4OJQA 4DB4A 2JA1A 5SZJA 1I7PA 4MGIR 5JFGA 1X6VA 1FL9A 3N70A 4G5RA 3RLFA 2CNWA 4FCVA 2GCPA 1CF4A 4CW7A 5JBQA 2FN4A 1GUAA 2A3RA 2GK7A 1VQNB 4LC1A 3TJZA 4TYWA 3UMRA 1W49A 1J99A 1EFRA 1KSHA 1E9RA 1XF9A 4P33A 4DQKA 4A0GA 4DRZA 3CWZA 4G3XA 4QM7A 4OHXA 5HKKD 3IBYA 4K1XA 3WP1B 5AJZA 1S0UA 1EP1B 2FFHA 2V7QD 1US8A 3BE4A 4IFBA 4Q00A 4D80A 2HLDD 3GLGA 2PX0A 1E9BA 3AVXA 1Q12A 1GRRA 4DHEA 4EPXA 2IUTA 4NPHA 1E1QD 3BWDD 3X1WA 721PA 3AVWA 4M1YA 3REGA 1M7BA 2GZHA 4Q21A 2OUKA 3QENA 3CCUB 4MRVA 3DOEA 1P72A 3QKSA 1NMXA 5EP4A 1D2EA 1Y63A 2DERA 4JVSB 2W6ID 4OQFA 4LV6A 3ZVMA 3CD6B 5CDFE 1CR4A 3PR1A 2OCAA 1JI0A 1GNQA 1TLLA 5K8TA 3WXMA 1IN8A 3ZYCA 5FUWA 5GJVC 4AI6A 4JBYA 2RGEA 1Q1EA 1Q1BA 2GK6A 2W0SA 1JQJC 3M4YA 4IW3B 1RJ9B 1W48A 3R7WA 3CC4B 2J46A 2P5SA 2ZANA 3AKDA 2FG5A 1GNPA 2IYSA 3K0CC 4UNSA 3EZ9A 4QJ4A 3U44B 1AZTA 2QAJA 4XD7A 3DMNA 1D2MA 1G291 1HE1C 4XIGS 3CPWB 2OTJB 3L0IB 1VECA 1XMJA 2O8CA 1Z2CA 4O25A 4TLBA 2C78A 2VEDA 3A4NA 4Q1BA 4O2LA 4Q19A 4I1OA 4DDUA 4PO8A 2WZQA 1CBUA 1XX6A 2XSZD 4FMBB 2AKYA 4YAFA 2WKPA 5L3SB 3GJ5A 1MRSA 2CL6X 1TQ2A 2GJSA 1W1WA 3SC3A 2EQBA 2QTVB 4MRSA 4UNPA 1YR6A 2VP4A 1JJ7A 1JQLB 2IYYA 3CRVA 1Z0JA 2VLIA 1J90A 1UBCA 4JLBA 3OIVA 2QSYA 4OK6A 4Q1CA 4TL8A 4OHVA 5CB8A 5FI0B 5LDDC 5C18A 4LX0A 3C7KA 3K09A 3EC1A 4B3CA 4G1UC 1Z22A 4O2RA 1FQJA 1DO2A 3PUXA 2B8WA 3ADKA 3KJEA 2ZVQX 1KNXA 3IO3A 4D82A 3SJBA 2IWHA 4NU0A 5H59A 2CVHA 4HLUC 1SHKA 2N1BA 3RS3A 5C1BA 3CC7B 1E79A 1LW7A 1YR9A 3L2OB 5DYIA 3TSWA 2I4IA 4M1KA 5KO2A 3AF3A 4C7OB 1P2SA 4DUGD 3GJ8A 5J4HA 3LA6A 2JJ1D 1D9ZA 1WDTA 2IUUA 1KRHA 1QG4A 2P5TB 1HTWA 1BJKA 1K8RA 4M4SA 2YWGA 1ZD8A 1GG2A 1QHNA 1U99A 4V0KA 1QHGA 2BMWA 4IDNA 4RZXA 3IHWA 3OFND 1Z6GA 2ZE7A 1ZU5A 4AY2A 4OKSA 4ASUD 3VHLB 1XMIA 4L5BA 1YR8A 3H86A 2QP4A 4P4UA 3ASZA 1GDDA 1G4AE 3LVRE 4JS0A 1M74A 1TEVA 1FZQA 1EXMA 1HURA 1NF3A 4F7DA 1OJLA 3IIJA 1XEXB 3NG1A 3EPHA 3K9GA 1RRFA 1H8EA 3DOFA 1R8SA 4M1OA 1LF5A 3BERA 5CYOA 4MUAA 5E4FA 2H7VA 2OV2A 1ZIOA 1R7RA 2QP3A 2WWFA 4DSTA 1NN1A 2FDCA 1KGDA 2A5DA 2MSCB 3KTAB 3TAHA 4EQ6B 4CEJB 3EA5A 5D3MA 4YMTA 1N6HA 3OHMA 2HF9A 4B74A 1WBDA 1ZRHA 1P6XA 1UEJA 1X1SA 4R98A 4YONB 3IO5A 5CJ2A 1OPXA 3X1XA 4XWOA 2QENA 4EPRA 1NKSA 2F7SA 1VIAA 3GJ0A 4M9ZA 1Z83A 3B82A 4E03A 2ZJYA 3U60B 3FPKA 3FMPB 4BLTA 1L8QA 2CLCX 2ZPTX 4NONA 2JGNA 3PG5A 1N6OA 1FFHA 3RS0A 4PSKA 4PANA 3ONWA 1E0JA 2A5YB 1GAQA 4B47A 1Z6XA 3CCLB 1F2UB 1R10A 1VCMA 3MFYA 4XWKA 1TF5A 2QMUA 1E2JA 2J0QA 5JJLA 3W2HA 1TEXA 1XU4A 2ZSFA 3DEFA 4Y0AA 1P9RA 3QF4A 2ZJZA 1TQ6A 4ZPXA 2IYQA 2GEUA 2CHGA 5EP3A 2MMCA 1BIFA 3RRZA 2PL3A 3KX2A 3TR0A 3SFVA 1Q21A 2IS4A 4Q7KA 3FTQA 3V4RA 2FF7A 1KJYA 4B3FX 4NCJA 4YMVA 1Z29A 4F91B 4TLAA 2BGJA 2NPFA 3KXKA 4LSGA 3U7EB 2VHUA 4TSFA 1CNFA 2IW3A 1I4TD 2OZEA 1S1CA 1W2HA 4HAXA 3P32A 2N46A 2JJ2D 2Q3MA 4LJ6A 4NCHA 1E9DA 4GP6A 3G82C 3MUFA 3WMGA 2CJWA 1SVIA 4AKHA 5JWOA 2FWRA 3ZVNA 2YKGA 1JBKA 2YWHA 2ZRPA 3CRZA 4OL0A 5JWRA 3VU9B 2V55B 3L0PA 4QGFA 2G88A 1VQ5B 4KCGA 2HJVA 1ZVQA 3QOFA 1YIJB 2W2VA 1CIPA 2AX4A 5EQTA 1GZSA 4B3DA 5GJBA 5EXXA 4LZZA 5SZIA 3VR4A 4AURA 5TXGA 1A8PA 1NMZA 1T0HB 3ND9A 3TSOA 2FH5B 2NO7A 1ZNWA 4TZ0A 2W2TA 2OBMA 1W4AA 3AEZA 4YXWD 4M9SA 1NRJB 4URWR 2PZGA 1HT1E 4HE5A 1I2MA 1FOEB 1GL9B 2ZRJA 4QBIA 4WXRA 5E7JA 1E2GA 5JSZB 3UXMA 2JCSA 4OYHA 3IEUA 4LV8B 4QHSA 2O0HA 4JBXA 4KXFB 4UXHA 3ADBA 3BB4A 2C98A 4KODA 5JWHA 2WWGA 3FMFA 2BC9A 3H4MA 3BJIC 1YHNA 2RKOA 3FWYA 4HYYA 5KDDA 5KSYA 5FBRB 1E0KA 2IYXA 3ZZ0A 4NE2A 3T1VA 4YMUA 3G0HA 4JLJA 4FMDB 4KLZA 1MR3F 2PEZA 4WQMA 5FOWA 1DOAA 3WP0A 5EE5B 1YHQB 1XP8A 2W2XA 5E7MA 1Z07A 4Z8YA 5G3ZA 4II7A 2CNWD 3K0FA 1G18A 1NVWQ 1IY0A 2YOGA 4KVGA 1G20E 4E5UA 3EPKA 2C5LA 3NIBA 1E62A 5K8IA 3THWA 4JKYA 4TQ9A 4UNNA 1X86B 2I1VB 2ZSDA 4YC7A 1EFHA 1JR3A 2BKEA 4BFYA 1IHUA 5ANRB 1KDTA 5BYJA 3MMPA 1GKUB 2XZPA 1U90A 4F93B 4TMTA 1KSFX 4IXMA 3W5HA 2FFBA 4ERNA 1E0AA 1E2MA 3AV0B 1QGYA 5TV2A 4WOPA 4QL3A 1ANKA 4EPYA 3R9WA 4M1WA 1KKMA 5KYKA 2GCOB 1Z0KA 5JJIA 4NZYA 4BUJA 2QI9C 1O87A 2PMKA 4QBFA 4N3GA 1ONBA 4P4TA 4DDWA 3DM5A 5CITA 2QTHA 3ZZTA 1GRNA 4Q1FA 2CL7X 4IJMA 4PGOA 2WV9A 4C0AC 1YJ9B 5FBVB 4IOJA 2VSFA 5AUOB 1WBBA 1WXQA 4OI4A 2ZS8A 5KSWB 1J9ZA 2YC2C 4LV5B 1OYYA 2Z0MA 3B60A 3NC1C 3G5UA 4IVQA 5HE9A 1WP9A 4HB2A 5JEDA 3VO2A 4MUBA 4ESVA 3W3AA 4ZKEA 1NJID 1VPLA 2AWNA 1KI7A 1KMQA 2CHVA 3HJNA 1F5NA 2DR3A 2PEYA 4NCKA 1M8PA 2AFIE 3THOA 2O8DB 4LOAA 2RC5A 1WQ1R 4H9GA 1N5KA 1R0YA 1SVLA 2ZE8A 4TTRA 3UATA 3W2FA 1CEEA 3ZIAA 1EX7A 3FMOB 1JEEA 4RD1A 2X3UA 2GILA 3CPEA 3FDIA 3NWJA 1QUEA 2XX3A 4KYUA 1NI3A 1P9NA 1S8FA 4JLNA 3RC3A 5LD2C 4LBWA 1PUIA 1SXJE 3OAAD 4G01B 3N5CA 5G41A 3JVVA 3V4FA 4QKQA 1Q3HA 4DIEA 2G6BA 1CS4C 2ZU0C 3FVQA 2FMXA 4D6PA 3FHTA 1HQCA 4Q7LA 1T91A 1XCMA 4I99A 4P32A 3ZQJA 3KQKA 1SXJC 5E95A 4G5QA 4I4LA 4US1R 2EWWA 3RRYA 4D0NA 3T34A 3K9HA 2RGAA 4KSBA 3AUYA 3JQRA 4X8MA 4C0JA 2ZYTX 3FB4A 2TMKA 4FI3C 4CT4B 4MYHA 2FEOA 3T5DA 4B34A 3AP2A 2VF7A 1E79D 4LYAA 3A8TA 3WNDA 4DWJA 1FX0B 3IPYA 3I62A 1NNEA 3BK7A 2RGCA 4Z1MD 1PLLA 1UBGA 3GQBA 3K1JA 3ZQ6A 4EJSC 5JCPA 2ZRKA 3QEOA 2HXSA 4CEHA 2PT7A 4A6PA 2NPIA 3EIHA 3AP3A 3OE7D 3RS2A 1GAJA 2VA8A 3THXA 1A1VA 1WRBA 3U7HB 1OXSC 3LY5A 2B8TA 5GV7A 1EK0A 1H8HD 3QF7A 4P3YA 2BVNA 4HB4A 3D6TB 4NL4H 3QQ5A 2WKRA 2CBZA 1C1YA 2GVDC 4QGAA 4TMVA 2HYDA 1SQ5A 3DZ8A 2DWPA 1S72B 4PO1A 5CK5A 2DWQA 1CRQA 1XD8A 2XNCA 1FQKA 1GFIA 2BKUA 3K0AA 1OH8A 4PAQA 3SOPA 4F7WA 4JKIA 3CR8A 3CNOA 4YDHB 1G3UA 1N0WA 1OIWA 5BN3A 3K70D 2EFCB 4JZKA 3M0EA 4LJ7A 4URXR 3WYAA 1PVOA 1Z0AA 2ZE5A 2HMAA 3AQ4A 3CZPA 2LWIA 4OJKA 4PC7A 4F4IA 3R20A 1QHHA 2XTNA 3QY0A 1KO1A 2BBOA 1WB9A 5KSOA 2G83A 3TIFA 4HAVA 1AKYA 1G7TA 1JA0A 5TY0A 2F43A 2VP2A 5C46F 2IS1A 1E9EA 4O3MA 2CVFA 2I3BA 2FPMA 2O8BA 1G8GA 3LLMA 4AF7A 2B6HA 5LB4A 1AKEA 1NG1A 1II8A 2RGNC 4C0SA 3LQRA 1QH0A 5AR1A 3MJRA 3MGCA 3SR0A 4IRUB 4BPBA 3AVTA 4MRPA 1AK2A 1XEWY 3R9IA 4A8JC 1SHZA 1OB5A 3A37A 4LJ5A 2A2ZA 3WNCA 2VL7A 1YVDA 2J7KA 1DTSA 1A2KC 2GQFA 3OIWA 4TTPA 4PXAA 3DKPA 4IHQA 4A0RA 4DDVA 2AN9A 2B7CA 1OGIA 1A2BA 4IEIA 1XD2A 3GLHB 5AUPB 5LD2B 1Q22A 4HE6A 1GJRA 4NH0A 5KNCA 4JVNA 2ZQ5A 4IVRA 3P20A 3KQNA 4PSVA 2LCFA 2OCBA 2J0UB 2JJ1A 3TQCA 4IEEA 1SXJB 2WJVA 1E9CA 2QM7A 3TUIC 2PIAA 3EARA 2DPXA 4HDCA 3FE2A 4TZ6A 2PZFA 4DSUA 4HAWA 2H18A 3OFNA 4PX9A 2ZRGA 2E1RA 5FPTA 3RRMA 2HXYA 2V3CC 1RFLA 2G0TA 1D2NA 2QROA 4QRHA 3VNUA 1GITA 3KKNA 2XZOA 3E20A 1NSTA 5BWMA 5B2ZA 1YZKA 2AK2A 4EJSB 1UKYA 2X2EA 5THXA 4TLEA 3AKCA 4QXAA 2GKSA 1XE1A 5HCNA 3VKHA 4KHZA 1DBSA 5EUQB 1AS0A 3KXLA 4D81A 2F9LA 2V6JA 1Z47A 2EYQA 2QEQA 2Z83A 3SEAA 4U7DA 4LK2A 3UG6A 5SZKB 3WHKA 4BFTA 1RJ9A 2CCJA 3TW4A 4HI0E 5D3QA 2Z5FA 3KKOA 3O47A 4LY6A 5IT5A 3U44A 1AA9A 2V4ZA 2WIBA 4UXJA 2ZXUA 3C14C 3CNNA 5F3WB 4A36A 3IKJA 4P31A 3SNHA 4FK8A 2IF2A 3B1ZA 3U6KA 1Z0FA 3ZS8A 1D8TA 2CEAA 3THYB 4HATA 1DDIA 1CJMA 4XVUA 3HYTA 1JA1A 3NHAA 4I1UA 1JALA 1Z08A 5FBWB 1E96A 2FJUA 2ORIA 3GD7A 4A0HA 3AVVA 4BLOA 2F9MA 4FD2A 5L3SA 4R2HA 5BYKA 1R5OA 4AC9A 3D31A 2R65A 3L0SA 3RAPR 4KI0A 1JEDA 2O0JA 1XXHE 2VSXA 1DAFA 4G5GA 1XPUA 2R62A 2JEOA 3QE0A 1XTQA 4ITRC 2FSIA 3AP1A 5P21A 1XZQA 2QA5A 3EASA 1TX4B 2CCGA 4XSGA 2ZR7A 4UNRA 1ZM2A 1Z0DA 1IXRC 4M1SA 2FFAA 1KO4A 5BQ5A 5FL3A 1II9A 1EWRA 2XTZA 4C0BA 1SVOA 4TTQA 4ARZB 1N5LA 2GBLA 2OXCA 3F5FA 4D0GA 2BM1A 5DHFA 1J2JA 1AIPA 4TN1A 5JS8A 4CEIB 4A82A 2REOA 4A8JB 4C7OA 1LNZA 1YZLA 5L3QB 4OHYA 5J47A 2CE2X 2VYFA 1MRNA 4RZUA 2AL7A 2Q6TA 1EP3B 3OJWA 2YWEA 5GJWC 2DYKA 1GL7A 1Q3TA 1LVGA 3OEHD 4Z54A 1COWA 2FOLA 2IBMA 4G5OA 4W5WA 4MGYR 3VO1A 3I8XA 2NMVA 4GMXA 2KBEA 4D2IA 3QG1A 2PCJA 1D6JA 4B2LA 3CXCB 2D7CA 3AVOA 3CRW1 1KAGA 1TU3A 3C15C 4B3BA 1QHIA 4MGZR 3P4XA 5EMNA 1BKDR 2BEKA 3I92A 2ZJ5A 4RKFA 3NBYC 3NH6A 1OYWA 4TQUS 1DS6A 3AM1A 2WWIA 3AKYA 1U81A 4DBLC 2H16A 4QJ3A 1SKYE 4QFMA 3A1VA 5HKKA 4EAQA 1G64A 3NXSA 1RRGA 4YQFA 4CEJA 1CLUA 1U8AA 3KTAA 1JR6A 1OXTA 4L8GA 1R0XA 2QAGC 2Z43A 4ZDKA 1R0WA 4Y7CA 3C5CA 1GKYA 1LFDB 5E7IA 4HUTA 2OAQ1 3BFKA 3BD9A 4RFSB 1PV4A 2XOKA 5FPKA 3FKQA 3TNFA 1UBFA 1U9IC 1X8LA 4JL5A 5E3HA 1Z5ZA 3NH9A 2VTKA 2BN4A 3C8UA 2C95A 4L9WA 5CDFA 3M1IA 5AJVB 3A6PC 3B1VA 3CBQA 5L3VA 821PA 1IXSB 1G8HA 2F1IA 1VCIA 4BFXA 1KAOA 1KJWA 3BB3A 1OE0A 1TQ4A 1DADA 1ZMXA 2BBTA 3QFTA 1E9AA 1E2KA 3SQWA 3FFAA 3U2QA 1S9DA 3CF2A 1H85A 3U7GA 1XWIA 5IDVA 4ACAA 2C2HA 3LAWA 3QI2A 3T61A 4FWTA 1SVSA 4Q4JA 3GEIA 4BLPA 1YE8A 1BH2A 1HQYE 1GP2A 4AKEA 1E4VA 4KVAA 5FBLB 1P2VA 4P0TA 2IL1A 5HXBA 4TYQA 1L4UA 4IDQA 2RAPA 5AWFC 5HCIA 1G6HA 1HA3A 1ZC4A 4LYFA 1E32A 2XNJA 1E2HA 2QTFA 2WMOB 4GI7A 4FMDF 4IDHA 4XSHA 1GR1A 3LVBA 1W87A 3QJYA 4YAOA 1XXHB 3KZ1E 1R6BX 3LX8A 4KBGA 2RGXA 2DFNA 3A36A 5B57C 2CRVA 3EZFA 4GSYA 5JCZA 1B2RA 3VU9A 2ORWA 3B78A 4A6XA 1N6IA 1U0LA 2ZRAA 4HLUA 4PO9A 3W3ZB 2BJWA 1DAIA 5DN6D 5EUMA 2F3TA 5DSZA 2IF0A 2R2AA 3WMFA 2V9PA 1HV8A 3OZXA 5KSZA 1UM8A 1X8KA 3HU1A 1QDEA 1FNCA 4OHZA 3I5XA 3IIMA 2XJ4A 1IY1A 4OI0A 2O8FB 4DCUA 1G5PA 1UKZA 4NYMR 5JI3E 3CIOA 3BBPA 2AKAB 2ZU6A 2WSMA 2NOAA 1NBME 2ANBA 3AF0A 2HF8A 3OAAA 4NYJQ 1JPNA 5JSZA 1E9FA 1ZCBA 2OEPA 2Z6VA 2NO6A 4CVNA 4L15A 1YI2B 3UIEA 2NO0A 1N2CE 3GPLA 2WPDD 1W35A 3B8HA 1G7RA 1ZM7A 4BLQA 1I4LD 4TL6A 4XTRA 4AIIA 3H2YA 5L8VA 3DDCA 2JAQA 2ZAOA 3KQLA 4FWIB 3X1DA 3I56B 1XPRA 3KJGA 4Q9LA 3BS4A 1OFUX 1NVVR 1QUFA 3IUYA 3TMKA 5BW8A 3GLFE 4C9BA 1QHXA 4TWZA 4EDHA 2CLSA 4Z1MA 4UAJA 1W5SA 1VHTA 2X8AA 3EZ2A 2WKQA 3CCEB 2WM9B 3GCGA 2A78A 5IF9A 4G0NA 3VFDA 2QAGB 2NTYC 1SKQA 4BE7B 1SKYB 1OKKD 5KNDA 1E64A 3OE7A 3GLIE 3B5JA 2J41A 1QX4A 2R9VA 3LBHA 2OG2A 3CRMA 2B21A 2GA8A 5HZKA 1H8HA 2LKCA 2RGBA 4TYPA 2XXAA 2JASA 3KJIA 1KDRA 4EIWA 4D25A 2GJ8A 1BS1A 2ZI4A 3KFVA 2YV5A 3QPUA 1TUEA 2ZRDA 1SM4A 1N5IA 4PC1A 2YVUA 3NEJA 4FW9A 3X2SA 4B35A 3U4QB 2QDXA 2FNAA 2A30A 1QFYA 3B1YA 4U00A 3P26A 1J8MF 1R8QA 2ZYUX 3DKVA 1SVKA 2GXAA 2RH5A 1EFUA 4WIAA 3EAQA 3AVYA 2CHQA 1IJEA 2OM2A 4CYMA 4FN5A 3ZS9A 4LHXA 2QG6A 3K09C 5G40A 1OXXK 2IS2A 4V02A 1IBRA 4FMCB 1AMOA 2FPLA 2GNOA 4PZZA 2GEDA 3VR3A 2ZJAA 3G6EB 1HE8B 3TBKA 2P6RA 1UEIA 2ATVA 4AYXA 3R8CA 1IN7A 4C0QC 3RC8A 1GNRA 1X8JA 3C5HA 4NP6A 2DFLA 4LC0A 3OIYA 2QGZA 2ZUDA 5FUXA 2VBCA 1BX1A 4QJ5A 1UKVY 4RSGA 3U5ZB 4LJ4A 3U3KA 4Y0VA 3CB4A 2HCBA 2HV8A 1FPMA 2Q3FA 3DL0A 4WZAE 2GJAA 3NC0C 5J4VA 4HZUA 1RVDA 2ECKA 2BCGY 1W4RA 3KUCA 1CTQA 2X1VA 5CK4A 1VQ4B 2EFHB 3R8FA 2D7DA 4E22A 2YNMA 4DLSA 4BRUA 1XTJA 1PUJA 3W90A 3EIQA 3HYRA 1XJ0A 1S3SA 4OQNA 1WCV1 3ZJYA 3ZD6A 1XTSA 1NN0A 3E1YE 1OSNA 3IEVA 1E99A 1Q1ZA 1K8AD 1IOZA 4QNRA 2AR7A 3MRSA 5KU1A 1ZUNB 2QT0A 2EFEB 2IWRA 4LBVA 2QL6A 1UDXA 1AZSC 4A4DA 4B2IA 2YOHA 1GILA 3AF4A 4XWAA 4N3NA 5FI1B 2FZ4A 5FUYA 2J5XA 1GOTA 4GZLA 3X1ZA 6Q21A 2FSGA 3AF1A 3GJ3A 1XEWX 4POAA 1E2PA 4LDJA 1G16A 2WSSA 2FX3A 1GKIA 3Q8XB 3AKEA 2QU8A 3UPUA 3OEEA 4UQOA 3CX8A 3QKSB 4HLQB 3ZLJA 5JJKA 4ABYA 2HCJB 1CR1A 1COWD 1TL7C 2IX3A 2ZROA 1T5IA 4TYYA 1F3OA 4C0HA 2ZRIA 4JT4A 4KSCA 2YC4C 1XCGB 4M1MA 2IXEA 1PJRA 4B2PA 1I2DA 2DBYA 3IHLA 3Q72A 5FTNA 5KPJA 4AKIA 4OI2A 1KMHB 1EX6A 2ZAMA 2ZI3A 3GLFB 2VP9A 3BFXA 3GJ6A 1FTSA 4DJTA 2HJGA 3UWOA 1T0JB 5EXSA 1GL6A 3WBKA 4CZ2A 1VQMB 2DWOA 4IFEA 5EZ6B 4JLKA 4ESHA 3SZRA 4U5XA 4DC9A 5JLJA 3SHFA 4EFNA 3B85A 4PQRA 4Q4HA 1GIAA 4FCWA 3GLIB 4BZXA 3CX7A 3P1JA 3CNLA 1TVCA 1AS2A 2Q9AA 4V03A 2OK7A 4PC2A 3RVBA 4HSEA 4D26A 2XOKD 3AF2A 1FW6A 1W4CA 2J45A 3JQQA 1T8TA 4NTZA 3QXXA 4XVRA 1JXMA 1CJKC 2OFWA 2WHXA 4PHHA 4K8OA 3TR5A 3CPHA 4BZPA 1S9HA 3GFTA 2ZTSA 1XMVA 2GESA 1WF3A 2IYUA 4NYIR 1DEKA 4Q9KA 3RNLA 4WZ6A 4MITA 3I3SR 2NIPA 1Q0UA 4DLUA 1C9KA 3A1UA 1KOFA 3S1AB 1LS1A 1Z8FA 2F55A 4BQSA 5KPDA 3GP8A 2H5EA 4TYNA 1Q86D 1HUQA 1ZAKA 5CLQA 3PENA 3CF6R 1E4YA 4XH9B 4HLCA 4DLTA 5FA6A 4MDFA 3SU8A 1RE0A 3U3JA 2R6FA 5TR9A 1ZUIA 1DDGA 3I1FA 3LVQE 4JLMA 3KXIA 4PPNA 1FNNA 3GEHA 2IYWA 4KBFA 1OFTA 3OIUA 2Y8EA 4A2QA 1R5NA 3CCJB 4CT5A 1QVRA 2REBA 3O8BA 4DIDA 4Q4AB 1NLYA 4DCVA 4YDSA 3ES9A 3I32A 1SXJA 3EIEA 2BGIA 4GOJA 2H8KA 3Q5DA 1P2UA 3QKTA 1NIJA 3WYGA 3B1XA 3OEHA 1E69A 1HEIA 2WOOA 1FDRA 5JRJA 2ZJBA 1ZC3A 3SYNA 4JLAA 4URUR 4BWYA 4JJKA 2GETA 3ZVLA 3PV0A 5EXPA 2J59A 5J4YA 2IUSA 3JQPA 4GOXA 4MKIA 3W6PA 2ZR0A 3DVLA 4JL6A 4TT3A 2VHTA 4GFDA 4LRWA 2Q21A 3GLHE 2ONKA 4A2PA 4EJSA 2JLUA 4RZ3A 3O8DA 1I4DD 1YR7A 2AD1A 1P75A 1E94E 3K53A 1FNDA 5JHGB 3WMEA 4FCTA 1VKJA 2D06A 4EUNA 5JECA 5DNYB 3SS8A 1W2BB 1KSGA 4LBZA 5DIFA 2Q9CA 4TL9A 3Q9LA 2BSAA 4QHYA 2RB4A 5K8UA 2QTZA 2VP0A 1G7CA 1MABB 5KDOA 4AKGA 3MHPA 3W5VA 4Q18A 1ZM3A 3KL4A 3WHLA 2XNSA 3AB3A 3RSLA 3ZH9B 2QPOA 1VQKB 2QTLA 3EWAA 4HB3A 4QC2A 3KQHA 1E2LA 3VKGA 4M53A 4YLGA 2NZJA 2GWHA 4LYHA 1IN6A 5C4GB 3NDBB 4JLVA 1UDWA 3BIFA 3BFVA 1FMJA 2N42A 3EX7C 4Q1AA 1G8YA 5H8WA 2QSZA 3W9YA 3QBTA 1VIYA 1KI6B 2AFHE 3AVQA 1D1NA 4ACBA 3QF4B 1KO5A 2XNDA 1IN4A 2PJRA 2LKDA 3IQXA 3CO5A 1ZD1A 1QFZA 3PEWA 2AHOA 3U3MA 1TMKA 1KK1A 4KLNA 2VHJA 2QBYA 2O8EB 1DELA 1NIPA 3TKLA 4KJZA 3X1YA 3BC1A 1FUUA 5KUTA 1B23P 4IOMA 2XJ9A 1SVMA 2ONJA 3ZBTA 1ZW6A 4ZCIA 4IOKA 5EXTA 2HYIC 2OSBA 2NG1A 4MKGA 2C03A 4C0KA 1P7CA 4WAUA 1DAGA 1ZUHA 1G9XA 1NJGA 2GAAA 2ZS7A 4PPQA 2RC6A 1LY1A 2RGNA 5JMTA 1NLFA 2CJWB 2NGRA 4Q03A 1AN0A 3ECCA 1CP2A 4HAUA 1KK3A 4PAMA 4WVFA 3ND8A 4CEIA 1W36D 1LS6A 4A8JA 3I55B 2OE2A 1G41A 5L3QA 4AG6A 3W34A 4RD0A 1QGAA 1QVGB 2BM0A 4HAYA 5LPNA 2BHRA 4MRNA 4B71A 2ZEJA 3LQQA 3DPUA 5TVKA 1HY3A 1BO6A 1IY2A 2BDTA 4K46A 5DI3A 1KD1D 4JT2A 4N1AA 4ZCLA 1CR2A 2W58A 5DN6A 2BMDA 1R5BA 2OCYC 1KK0A 4KFSA 3EPLA 1MO4A 5FOUA 4DZZA 3DMDA 4M22A 3ETLA 2UZIR 3BRWD 4ZKDA 3L82B 1TTTA 3RS5A 1U0HC 3UG7A 1GVHA 1E2DA 2WAXA 1ZCAA 1DG1G 4NMMA 1F2TB 1UBEA 4BFWA 2ZS9A 1K73D 4PTLA 2Z4RA 2WWWA 3TUJC 1HH4A 3LWNA 1TADA 3RS4A 3TRFA 1KSJA 2V6IA 1KO8A 5DE3A 1JAIA 1M7HA 1MO5A 2J87A 3PCRB 2WPDA 2IYRA 2ZI5A 2P2LA 1FRQA 4UJ3A 3WYFA 4URVR 5C4MA 3K0FB 3NVAA 2E87A 4TLDA 2G9NA 4ZGQB 4JJZA 2IXGA 2WMNB 2DB3A 2JLWA 4RFSA 2H17A 3KB2A 3PXGA 1TF7A 1VCNA 1KI3A 2QQEA 2QM8A 4BFZA 4BECA 3LW8A 3EWSA 5FR2A 5A0FA 1T5LA 1BOFA 1ZNYA 4LJ9A 3SHWA 2FFQA 2GHIA 2RGDA 3LLUA 1PZNA 4OQMA 2B92A 1IQPA 3CZQA 3CLVA 4BLSA 2V1XA 3MWKA 2JLZA 1QHYA 1MOZA 1XZPA 1M1KD 2EYUA 2WSSD 4MH0R 1OKKA 1W2GA 2H1LA 2C9YA 3TVTA 2IS6A 2WJIA 4QHTA 3W5UA 1KHTA 3OEED 3ZGXA 1DG3A 4R9UC 2GXQA 4TMWA 2P6UA 3CRQA 1OIXA 2IHBA 4Q1DA 3SN6A 1XJQA 2BCJQ 3A1TA 1N3BA 4G1VA 1QBKC 4O0MA 1M34E 4L16A 4ZIRB 3D8BA 4RJLA 2P67A 2GF0A 4DT1B 3C41J 2VYQA 2IYLD 3CX6A 2WWXA 3HPQA 1KI9A 2QUZA 3Q7QA 3GEEA 4AF6A 5A5GA 2J9RA 3ASYA 4Z8XA 1IN5A 3B13B 2JDID 4MRRA 1S96A 4WZBE 2FE4A 1CR0A 1OF1A 1SVWA 621PA 4XJXA 1KYIA 1G7SA 3DHWC 4GOKA 3TVDA 1W36C 1XXHA 2GZAA 3F0TA 1Q1QA 1N6KA 1RRPA 3NEYA 5DYGA 2CE7A 1TPZA 3L8ZA 1YJWB 4NCIA 4X8HA 1VTKA 3EZ6A 4MYUA 4LUCA 4B76A 2IXFA 4D4KA 1VG1A 1T4GA 1NY5A 1U98A 1XPOA 2WOJA 5FOSA 1A7JA 4BASA 2DFTA 1EESA 3MCAA 1XJCA 4JSYA 3MWYW 1P61B 2JLVA 4S35A 4A1FA 2O8FA 5DGXA 2REXB 1LV7A 2R6DA 2ZETA 4KU4A 1BYUA 1ZYUA 2FGKA 2KBFA 4F4CA 2QT1A 1S4QA 4JLOA 4QOSA 4JMPA 3AVUA 2CNDA 1Z0IA 3LD9A 1KZGB 5L3RA 3TLXA 1KY2A 3QFCA 1E63A 4AYWA 3K8YA 2GJ9A 2O5VA 1G19A 4R2IA 2JLSA 4M1TA 2C77A 1EGAA 1T9HA 1DAEA 3Q85A 4PC6A 2GTPA 3TSZA 2ASEA 1UFQA 2E9SA 2R8RA 1MH1A 3KJHA 2ZIAA 4KFRA 4A0FA 3DO6A 1Q44A 2EFDB 1JXOA 2QGNA 3W2GA 2KE5A 2IHYA 3LV8A 3KQUA 4U9UA 2IYVA 3VX3A 4DCSA 3UKDA 3NDPA 3I61A 5FPHA 4FMCF 3V00A 3KKPA 4HLDA 5FFMA 1OH7A 4V0LA 1L2TA 4AD8A 3LBIA 3THXB 1VQPB 3IBGA 2ZSEA 1SXJD 2QAGA 2VF8A 3BORA 1XB2A 3KKMA 1OLOA 1Z6YA 2ODWA 1U8YA 4E09A 2QNRA 2VPPA 4OQLA 1VG0B 4B73A 1JJVA 3AGPA 3EC2A 1OHHA 4Q5IA 5FR1A 2RCNA 3UK6A 4TLCA 1U9IA 3K9LA 5DO9A 1JPJA 2OESA 1XFAA 4V0ME 5B58C 2J0VA 3ADCA 5B64A 1NKTA 2AXPA 4MGKR 4TT3D 2ZYWX 2G0NA 3ICQB 2VHCA 1XEXA 5GADl 2GCNA 2NZ8A 1RYHA 3W5IA 2VNJA 4BGDA 3OZWA 4B3GA 4BZQA 1ODFA 4NCNA 1KDPA 2RGGA 3ICEA 2WTUA 4ILEA 4BRWA 3U3RA 1SULA 4Q7MB 5FTMA 1Q57A 2ATXA 4D4MA 1FUKA 3D3QA 4EQ6A 1KY3A 4GPTA 1D5CA 4P4SB 3HR8A 1KTVA 1EP2B 5FOXA 4GMDA 5FH9A 4JIMA 2O0KA 3CCQB 4IVPA 1YJ5A 1XBTA 4GNKA 1CNEA 5GJCA 2O8BB 1YZQA 1XMSA 1AM4D 2IA5A 4DLYA 1II8B 4KFUA 1DPFA 4JL8A 1WE2A 2GBLC 3TGPA 3VR6A 1Z6TA 2J7PD 4M0LA 4AK9A 4GL2A 2QMEA 2R6HA 1F60A 1F2UA 2ODEA 3K0CA 4FXPA 2XNDD 5FPSA 1W36B 3LNCA 2V1UA 3IDQA 3QFRA 4K81B 1SGWA 4OK5A 3W2IA 4B6FA 4FINA 2OT3B 4LCBA 2Q0HA 1XD9A 4M21A 5BXQC 2GZDA 3PEYA 4P6VF 1MO3A 3CCSB 1RIFA 4C43A 1A82A 1AGPA 3CH4B 1JB9A 1XD2B 2BIFA 1BYIA 3VNVA 3IQWA 5KNBA 1IAQA 3QXHA 3UANA 2AXNA 3K0EA 1OT3A 4XOIA 4KFTA 5F2EA 4KAXA 4ZDJA 4GP7A 1Y3AA 3PVSA 5G3YA 4TMXA 1Q82D 3PUVA 1W44A 5JHHB 2CK3A 1E0SA 1G3RA 4LI0A 3BH0A 4LJAA 3QNUA 3REFA 1NP6A 3HU3A 1G1MA 3TH5A 3WRYC 2B5OA 1ZNXA 1EG7A 2JLRA 221PA 1NBMA 3PIRA 2H92A 2BMEA 4A15A 5KSPA 4BFVA 1V5WA 4I1VA 4PC3A 2ZRHA 3RDPA 3KUDA 4CGZA 2BV3A 2GEVA 4UNQA 2VNIA
chains in the Genus database with same CATH superfamily
5KYWB 5IX8A 1KH3A 3NBQA 1LZLA 3QKUA 4QICA 3V7UA 2XCQA 1V0FA 2A9VA 1E7QA 4GQIA 4DDTA 1TXGA 4HDAA 3EVZA 1AF7A 2ZWVA 1B93A 4UKDA 5EJEA 3EPRA 1GNTA 1JVBA 4QXOA 1XZGA 3TGLA 4RFVA 2MR5A 4IS2A 5EJ2A 3JYHA 4UHJA 4N47A 3N6XA 3SHQA 1QU2A 1PSZA 3ZTWA 1QVFB 2ZI9A 4BB9A 2XZDA 3QXJA 3EBOA 5A4JA 3RF6A 4LZNA 3W79A 2QN6A 3BXOA 3Q3GE 3W6NA 2D0IA 1GAWA 1O6FA 2B7LA 4Q37A 4DCNA 1DUSA 2ETVA 1CJVC 3ZDBA 1N75A 4MMYB 1L8AA 4P25A 3NV9A 3TAUA 1Q91A 3WYDA 3V76A 2PPLA 2WVJA 2H7YA 2DUMA 4WCFC 4BNXA 1C8BA 1MFPA 2ZJFA 4YMSA 2AJDA 1VMAA 1C3JA 1C3LA 5IYRA 4GMHA 1CCWA 1JIXA 4GH5A 1NHGA 2E4ZA 4MKHA 5KDLA 1SQ6A 3CXRA 4DL9A 5A6VA 4W5RA 1O6GA 2I1WA 4OMFG 3UHOA 1U4OA 3GNLA 2GK3A 3OM8A 4HQ6A 4IDPA 2P2CA 3UAGA 3T15A 2QPAA 4L9SA 2CL5A 1QQBA 4V0RA 2XECA 4WASA 4WK0B 3MWJA 1B8UA 1FF9A 1WF6A 3HRIA 2BZ0A 2PBZA 4RZ2A 1L7MA 4DCOA 2FVYA 1EB8A 3MWDA 3B6EA 1UPUA 1YHZA 1R50A 5ENZA 3TZHA 4CLEA 2W4QA 3K9NA 1IY9A 2ZE6A 2Q5OA 3I9V1 1T2EA 2WU1A 3JARB 3JQAD 2H0RA 2WIAA 2VJMB 1WS6A 1QCDA 2DFDA 5AQEA 3JPWA 3EIFA 1YA8A 3U6BA 1SHUX 3O7MA 3TLZA 4QDJA 2FR1A 3JX9A 1EEXB 1ZG3A 1Q14A 4QUEA 1OQAA 1V3TA 3BZWA 4OOVA 4WPGA 1GKLA 1U5BA 3G5LA 5JQGF 1TYZA 2XTMA 1CIVA 4Q15A 4JC4A 4X5OA 1UFVA 1ZRMA 1TMYA 5EIOA 4IDDA 1N32B 5L51A 1DQSA 2YXBA 4WZAA 1SCKA 2H11A 3KWFA 1J8FA 1NQOA 1X0VA 3PQ4A 4J7AA 5IHPA 4QO7A 1X1EA 2B7BA 1AK9A 2V54A 2CMKA 3I76A 2Z1NA 3N87A 4Q4AA 2W00A 3AQIA 3FOEC 3FKSA 1I24A 3JY6A 1I3KA 4YIKA 3FJ1A 3PRJA 3S70A 5KNDH 2B3DA 5LB2A 1M1NB 2JHGA 1L4EA 2RH9B 4HWGA 3MMSA 3JR7A 1JHVA 2ILVA 4FE3A 3HSKA 3ZHQA 4JXXA 4EPWA 5E9AA 1R2QA 2QRNA 2P3SA 3I8SA 2O8DA 5FF9A 2XVMA 3R09A 2AGVA 4O2AA 4W1PA 1KKUA 4MVCA 1GSHA 2VDLB 5JFTA 1L4YA 5ECDA 5E9JA 1JQ3A 1Y0RA 5HKOA 3K7EA 1RQNA 1J8YF 1A8SA 2PXHA 3I1IA 4FZRA 1V6SA 3UMJA 2FKNA 4E46A 5C8DA 1TYEB 1OY1A 2PO7A 5JSZA 5G02A 4FNAA 2HT6A 5DLDA 5C37A 1L4BA 2XYGA 3ZX4A 3PEUA 3PICA 1F6BA 3NT5A 5YASA 2FK8A 1W85B 2X23A 4MR9A 1H65A 2XUQA 4B7XA 4CF6A 1BE6A 5F21A 3DTVB 5BQOA 3CBGA 3HJGA 5TS3A 2WP8J 3RIXA 1CY7A 3NHJA 5JS7A 3A8IA 3DBHB 2ZCVA 2ID4A 5AI4A 4ZDIA 2I7VA 3G05A 4RY2A 1U5AA 5KOHA 4NV3A 3WNQA 1U31A 3GZNB 3EXG2 2GPTA 5E9QA 1W76A 4DOMA 1E8NA 4XVQA 2PX6A 4GI5A 5JRZA 1US8B 1VOTA 4GT1A 1VDZA 3ZGZA 5J2UF 8AT1A 2FA9A 3PNLA 4O4IB 4WCFB 3BCUA 1LVUA 1DRWA 3N59A 1IB0A 2XGJA 1FEZA 3UB3A 1JHRA 4AMYA 3WXBA 4AUKA 1I3LA 3V9PA 2JAHA 1RE1A 2GXSA 3L7BA 1M1UA 3R77A 4QDUA 1IXZA 3FYHA 5H3LA 5AJWA 2C7OA 2OO5C 2VKQA 1F9AA 4AKTA 1WMSA 2R7NA 4B32A 1YRAA 1Z4QA 4HNAA 4ZMBA 1USKA 2DP4E 1XKXA 2QJRA 4N4AA 5AYVA 3ZNQA 3UJ3X 3H16A 4Q34A 3GAMA 3KUUA 3RK1A 1PHPA 3R7WB 5JY1A 1ZIXA 2NAFA 4BPRA 1ZINA 4JLDA 4UBNA 5H68A 2FW6A 5DNWA 4HOYA 4FB4A 3U56A 3CUUA 1W88A 5T4HA 1GPUA 2C3OA 3BHJA 4KLRA 4MB6A 3RC7A 3D0OA 4OPVA 3ENQA 3RWMB 4ZI7F 3L0CA 1APBA 4XYGA 4JYMA 4D8TA 2FRVA 2PH1A 4LOLA 1AS3A 1NNLA 1QR6A 1W34A 2ANCA 2G4CA 4H3SA 3QSYA 4QGHA 5REQB 5JATA 4ZCSA 4IDGA 9ABPA 4ZYXA 4ZGNB 5ADUS 3WIBA 3Q7PA 1DVRA 1XNJA 5KI6A 2K7FA 1UJ4A 3HYNA 3KQVA 3F46A 4YP5A 5F5LA 3IULA 1H5NA 1AQYA 3ZY6A 1Z74A 2V0NA 3RUCA 3EXFA 2C1ZA 3DF7A 3LA8A 4BNJA 1GTMA 10MHA 3EB9A 2XZLA 4G1EB 4ID9A 3G68A 1WUJS 3EYAA 4R7TA 4LX8A 2O7RA 3JATA 3M6WA 3OC0A 5A4FS 3PUIA 4OHCA 3ZCQA 1Q0PA 2J3KA 4UU1A 3ZE9A 4EG3A 3PTAA 4YJHA 5I5EA 2XCOA 1QK3A 1UJCA 1E4OA 2OLJA 1UDRA 3CRNA 3D1JA 2JG3A 4KPUB 2ZULA 1N6NA 1ST3A 4Y6OA 4YRQA 4V1CI 2IOHA 4GXTA 3CLTC 1X3SA 3GMSA 1QU3A 1W25A 2D2VA 3E1SA 3DBOB 4EYSA 1YNSA 1SC1A 3R6TA 4GI1A 2OAGA 4RSHA 5H9VA 3P2KA 4IJUA 4XLCA 5CYPA 3TE7A 3LTNC 1ZXBA 4D8WA 3VTZA 4HNRA 2W6JA 1LTHR 1WNTA 5L7WA 3PP8A 3H2GA 2RK4A 5AM3A 3HXTA 1KFJB 4Q9HA 4YALA 3MAGA 3EVCA 1D04A 4EPTA 1H2YA 1GG8A 4BDSA 5H1YA 5C7LO 1RXCA 4M0KA 3WDLA 4RXMA 2YJ5A 1K66A 4WY5A 5M04A 3SDZA 3WL4A 2O3UA 1JEYB 2AJBA 2G1KA 4KWEA 5I4IA 2J0UA 2YZMA 1AKVA 3GJZA 4XYBA 2V8OA 4LVOA 4FGSA 3NKFA 2XUAA 3CINA 4OUKX 4AYTA 4X0CA 4EHNA 5I4KA 4N54A 2KPOA 1E9SA 5ER9A 3EGOA 3CLKA 4YP0A 3CESA 5EMJA 3EVBA 3O8OB 3WK7A 2D5BA 4P35A 4IWNA 4BJ5A 3VBEA 1E1RA 1M6YA 2JLYA 4NARA 1VQLB 1RHKA 2VQSA 4OOXA 4Q6WA 1SKUA 3E9MA 4BEBA 3Q1KA 5H3HA 4YMWA 1TYAE 3NIWA 5I7RA 3UTCA 4V2UA 1DAKA 4NYMQ 2TECE 5T8KC 3KL9A 1UMDB 2FGJA 3CZAA 4DT1A 5JZVA 1F7UA 3LDFA 4BU0A 4DUYB 4WUVA 3W8RA 3E23A 1BCSA 3UUWA 3SLNA 4KR7A 1JEAA 2BUCA 2J32A 2OCLA 3LQEA 1ICIA 2OQVA 3RF7A 2IH5A 4QM6A 1I6MA 3ASVA 1J21A 1G17A 3Q5GA 5K4HA 5D3MB 4RELA 2J3IA 1D4ZA 1Z8DA 4MS4B 1Y7IA 2A9RA 3EAFA 1SCUB 2V7GA 1IJFA 1PEAA 5HS6A 1W52X 1C3OB 2P0EA 1P18A 4QXMA 4KP7A 4M6WB 4R16A 5JZOA 2O2ZA 3EH2A 2CXSA 3KZCA 3I6MA 421PA 2XB4A 1S5PA 4YUXA 1NVVQ 2DSTA 1T3SA 1X1RA 2A0XA 2HMWA 3LE8A 2VYCA 2ZIXA 4BBZA 1VJ1A 1LPMA 1H3EA 1TM3E 1XHLA 2HRCA 2LCQA 1Q7YD 5EQDA 1STOA 4Q9IA 4IHJA 3VXKA 3G2OA 4RD3A 2OILA 2JFBA 2RE8A 4E7OA 3IRUA 3NNSA 1J8QA 1M8FA 2P9HA 1E6EA 3EF3A 4YJGA 1O4VA 1RKQA 2QVGA 2W43A 3IAM6 3JYQA 5CB6A 1JTVA 5T57A 4A10A 4ZQEA 4D41A 3T9DA 1MV5A 1XZMA 1NMYA 5EKTA 4MUXA 3LYAA 1ABBA 1UMBB 2CNKA 2WJGA 4R69A 5GVRA 2JEYA 1H1LA 1ZS9A 2WNHA 1WAMA 3JD3A 3O1JC 4L2IA 3ONUA 3WIDA 3ZBUA 2PD3A 3WLLA 4AXBA 3VPXA 5I7HA 4P0PB 5BNFA 4EY7A 1SK9A 2P65A 4WXPA 1V8OA 3QXGA 1FU4A 1UKBA 3PNVA 4BGEA 1MZVA 2OXRA 1Y81A 4GXNA 3RSOA 3UZUA 3A6ZA 4LOKA 1K75A 2MMGA 2RBEA 1U8EA 3IEPA 3IIIA 1UF9A 1WTAA 1A4XA 1Z8HA 2WAYA 2WKWA 4OJMX 4KRFA 1L5HA 2IYTA 2JCGA 4L4XA 2R4TA 3STWA 3OC6A 3AVPA 5EKSA 4MQEA 1PAUA 2GPYA 2P30A 3VH4A 5B30A 1U2DA 1CIJA 2ONCA 4WHMA 3UT0A 1T10A 3IELA 3HA5A 3PGJA 1U0NA 3C4JA 4TQGA 5K0BA 4ADSG 4PS0A 4TKZA 1XAHA 2A58A 1D07A 1WZEA 4CUKA 4IJ5A 3A4LA 3SJCA 4UJ5A 4LJ8A 1N5JA 2W6IA 2CUZA 3SYKA 2XBMA 4B6RA 1N9ZA 3GN1A 3AWDA 4YAEA 4F2WA 3ADOA 4K2HA 2H54A 1IWOA 2M98A 3M9LA 5L3RA 4OH1A 3WWYA 1I0IA 4AJLA 1GWNA 2Q3HA 4CMBA 3TUZC 1CUIA 1Z0ZA 1H8ED 3OP4A 3ZC3A 3LF2A 5IJ0A 3SR3A 3B1JA 3DEIA 4MRMA 2IXDA 3O4FA 5HG0A 4P9SA 3OZFA 3AEKB 4JGIA 3C3PA 1FK8A 3LXXA 3RRJA 3TDKA 2L17A 3KQTA 1RHUA 4PIPA 4BNDB 4C0LA 3HM9A 3SWWA 2J0SA 1UBRS 3G8AA 2ODNA 1OH5A 3FTPA 2N75A 3C16C 3P4YA 2OFFA 4AKSA 4BOYA 4Q16A 3TDMA 4OBEA 2I55A 3UJPA 3HVUA 2C2ZA 4ZT7A 1NLUA 1ZGCA 1EHCA 1G8KA 4YAUA 3PNKA 5HE8A 4E5SA 3JSAA 5BWLA 4BNNA 2IVZA 5FA8A 3MWLA 4WNAA 4G97A 4XM1A 1EIZA 1OLUB 1ZOIA 2X8WA 3KEMA 3L7YA 3IIKA 1B6TA 1H9BA 1XVTA 4UARA 1M34A 5KJCA 3KLMX 4GECA 2XKKA 2R11A 4BFUA 4XNFA 2AMVA 2BFBB 2IZ6A 1JKJB 3BRSA 3GEBA 3QM1A 1KVTA 3RTDA 1F8FA 3TIXB 2BFNA 1VBMA 1Z4MA 4E4RA 3OTWA 2VZLA 1TVEA 4KQFA 2X0RA 1VG9B 3PQ3A 1JVSA 4GEKA 3SE0A 4UDYX 2ZG6A 1HLGA 2FXIA 4D02A 4IOLA 3ZHXA 1X7XB 4J0DA 3PFBA 3BX1A 2XD9A 2AFIB 2BFAA 4HN4B 4DWOA 2P6NA 3OZUA 3KK0A 5ADWA 3KWMA 4GDFA 1MQSA 3GWZA 3NM6B 5IFLA 1AOXA 4DVGA 3TQFA 1DIGA 1X9HA 1DAHA 2RG7A 2B4QA 3FPLA 1I01A 1Z6QA 3HP7A 4DB2A 2OCPA 3UJDA 3VGJA 3SCZA 3BICA 2TMGA 2VO1A 4DUGA 4M2LA 2MWMA 2ES4A 5LKAA 1W0JD 1XR3A 1J1ZA 1SCAA 1AD2A 2HPZA 1G4UR 1V96A 3VMFA 2Z3ZA 2R4QA 1JHUA 3C5WP 1RKBA 5DBHX 5TARA 4COKA 5KU7A 4ZVTA 2BGNA 3R3SA 3QXCA 3ZE7A 4J0QA 3MBIA 1JSRA 3L84A 4BTVA 5CT6A 4Q48A 4ASUA 3KD3A 3LCJA 4LQLA 1LH0A 1A8QA 4XDZA 5BWBA 6NULA 3RC1A 2UKDA 3DMRA 2JA2A 3EXEA 3SI7A 4TSRA 3MG9A 3EFBA 5F4JA 2I78A 2VF2A 4F4JA 3DDYA 4TRMA 2B83A 1LF0A 1U0OC 4EJ0A 5FL7A 2VIIA 5JEEA 3M4ZA 1Y6RA 3K0HA 4RKEA 2I9KA 1PLJA 3I4LA 4BX3A 2B78A 2W2KA 2OLKA 4NYIQ 5FBQB 4D3YA 3O90A 4YRSA 1BOOA 3MAJA 2IEZA 2PD6A 3OZRA 1II0A 5BQPA 3ANYB 1L5NA 1ZJZA 4BO6A 4RWZA 4B17A 2PU5A 2A4KA 1E4EA 3EFOB 4O6VA 4E6EA 5EJFA 5CTJA 4EB0A 5IULC 2XYQA 3I53A 3VZCA 3JQFA 1GTVA 3S2FA 2VNAA 1UIRA 2DCUA 4EGJA 2PUCA 1BQEA 4YRIA 1M5TA 4Z99A 5ALUA 3RYFB 4BWGA 5AQ1A 2FF5A 5K0JA 5LMCA 5HR5A 1YZUA 4B79A 3CUYA 1YQXA 3HO8A 3LIIA 4MA4A 3VSAA 4X94A 3AFOA 2P1DA 2NLOA 4EMUA 3BDAA 1P2FA 3KKEA 3PLAE 2YYSA 2GPJA 3AHJA 4WACA 4M0CA 5LMUB 4J1NA 1AKNA 3L02A 4V0MA 4ZOCA 3GQBB 7GPBA 4B44A 1KR5A 1J5PA 3IP5A 4NJEB 2YWFA 4L07A 5GV8A 1XYGA 5KREA 5M2QA 1JXAA 1GT91 2Q3DA 4N5DA 1PLKA 4LS3A 1TAUA 1FRFS 3MWEB 1V1JA 1XV5A 5DN9A 5EIEA 5EZYB 3EGXB 4J3NA 4REOA 1YGPA 5LQRA 1KO7A 5F12A 4D43A 1TJPB 1OFIA 1VHLA 1P4MA 2H1RA 4KR2A 1GUYA 1RJWA 1C8LA 2QORA 3IQHX 2BMFA 4X85A 1U1DA 1UBSB 4WH0A 4EKGA 1KXZA 1ZPDA 3RVDA 1L9XA 2DUUA 5IYNA 2IY8A 2ODTX 3EY4A 1GEGA 3NHUA 5FTKA 1R4MA 4IF6A 1CRPA 4NBSA 1UANA 3F8WA 4Y9RA 2A9KA 1RLTA 4KV9A 3R5TA 4FX2A 2MYTA 1ZD4A 1FP6A 3NDIA 3QVUA 4KE7A 4GZMA 1ZESA 1T3LA 1AQLA 2E89A 2BPOA 4DQLA 2FPGA 2C7GA 3K0AB 2D59A 3VKFA 3U4DA 3VNBA 4B40A 3HA3A 4EHKA 2JJ2A 1EEHA 4G81A 5BN3B 3CONA 5EIBC 4NULA 1N0UA 2V31A 2EKDA 2SHKA 4HDQB 3PXBA 4H16A 2JFFA 1E1NA 3PJFA 1BA3A 1N3YA 3IA2A 2KB0A 4EF5A 5K0EA 1EWQA 1N57A 4HPJB 3SEQA 3UMYA 2VDWB 2O8VA 1TJ5A 4XLFA 2UZ3A 2X4GA 3D4PA 3JQ6A 4TX1A 4BMYA 3VR5A 4ZEVA 3H1FA 3DVRX 3UHJA 1QHHB 1HSZA 1ZVMA 1KJZA 2PWYA 4N0PA 2IVFA 5TMPA 4X8IA 1DRJA 3CM0A 4UASA 3TW0A 2ZRNA 2ENWA 4ICIA 1M2KA 3ASQA 1GQQA 1USUA 1XTKA 4JH0A 3B7PA 4OHRA 1GNLA 3A2NA 3GFOA 3M5CA 3NHSA 1TD1A 3ZIAD 1KPHA 4DF3A 1MG5A 1IVSA 2C4TA 3ADDA 3PNYA 3V33A 5K3OA 4YXWA 2P0AA 1E6UA 1EFPB 1G21E 1A9XB 1UEXC 1M1YE 2I2BA 3TZ6A 3UQYS 3LPCA 1U3VA 3USZA 8LDHA 3CTAA 4C01A 1RTKA 2KVOA 1TQDA 2AD5A 4G07A 2NYRA 1F06A 1WUTA 3OHSX 1N6PA 1HNNA 5TPZD 3NDRA 4UHFA 4NKRA 4GX1A 1E1MA 1G3QA 1MO6A 3DMGA 4FIDA 2JH8A 3GLVA 3CNQS 3MJDA 4DFDA 1ZNZA 1O9BA 1FMLA 4R2KA 4WW0A 5BW4A 3LRPA 1QG2A 4RZSA 5E4TA 5CW1A 2QM3A 3EZGA 4V0NA 1N6RA 1XDBA 2HT1A 4DLAA 2DQSA 5DSXA 1J8DA 4B7UA 4LJRA 5A4AA 3S0JA 1OZGA 1X6VA 1XRPA 3N70A 3CO0S 1X70A 1P1HA 5JPIA 2CNWA 1ZBQA 3OZDA 4FCVA 2XLBA 2DPMA 5JBQA 3HBJA 2CVOA 5HM6A 1GUAA 1ZD5A 1ISSA 2I99A 2GK7A 1VQNB 4FUTA 1SOMA 4LC1A 1UXIA 4EVSA 4OOEA 3H9JA 1PT7A 4P33A 2R1VA 4DRZA 2C4WA 4DQKA 3CWZA 4EKNB 2ADFA 4DCPA 1TMOA 1V9SA 3ZY4A 3I6ZA 3N8KA 1EP1B 4X93A 3OCCA 5M34A 1V8FA 2HLDD 3GVIA 4HNTA 1BPLA 1QYCA 3BMXA 3TOVA 7REQB 4P4GA 1A27A 3AYZB 1NUAA 4OTZA 3IE1A 4NPHA 3X1WA 721PA 3JQ8B 1PX2A 2XADA 3AVWA 1B26A 4M1YA 3REGA 5JU6A 2AC7A 3CCUB 4MRVA 1TB4A 1DEAA 3DL4A 4YT4A 2QR3A 1Y6JA 3DE7X 4UMVA 3SC2A 2VBFA 2NV6A 4FEEA 1ODJA 5K05A 1ZW1A 2FWNA 3AR5A 3K1AB 1CR4A 3LUFA 5AVKA 1WPGA 1PR5A 1ZL2A 1DZ3A 4IINA 1U3UA 3SLGA 4KZPA 3G5TA 1ZI9A 4ZZ0A 5K8TA 1Z4OA 1IN8A 2A3NA 3ZYCA 2ATCA 5FUWA 3M6LA 4A23A 3OA0A 3C4VA 2GFIA 1PJQA 1R9MA 2RGEA 3C5EA 2W0SA 1JQJC 3M4YA 2Q5LA 4D80A 4S0ZA 2PUGA 1FVXA 3AKDA 4M86A 2AFRA 2OKCA 4X64B 1IBCA 4UAUA 1DUVG 4UNSA 4GDMA 4WZEA 1DLJA 3U4GA 4DADA 3R6LA 1VP3A 1H6DA 1HDEA 1SUEA 5H3CA 3UXYA 3K6SB 4JI0B 2AEMA 2N3ZA 1VSVA 1W4ZA 1U9CA 3ZWXA 2WI8A 2YWJA 2N0SA 3WICA 1H4QA 1BFDA 2YWXA 3DDSA 3JTMA 2ZUWA 3EGWA 3D54D 5D1NA 2VJDA 5LU8A 3JZIA 3UWDA 4Z3KA 3QLVC 4QTTB 3GB9A 4LGCA 1C1DB 4LF8B 3V8MA 5B1DA 1CBUA 4CFYA 1LW6E 4ZU3A 2J4CA 4YAFA 2R7KA 3FXAA 3DE6X 3R5FA 4TXMA 5ES3A 3RIEA 5ED4A 4DQVA 2FSVC 1XGKA 3SHVA 2O1WA 3KSZO 2CXOA 2QTVB 1MAWA 2OVFA 4Q3NA 4X9XA 2VLIA 1J90A 2O2GA 4OK6A 3KT6A 2YDXA 5C18A 1L5SA 3K09A 4MV7A 3GUZA 4G1UC 1Z22A 1IIBA 3P9NA 1OLSA 3QU2A 1L1FA 3RT7A 3NVKI 4OMDA 3PUXA 1SZJG 5A4KA 5JPCA 3KJEA 1EUZA 3L6RA 4IH9A 4XWGA 1I2AA 3EQ7A 3OCJA 3UV7A 4L0QA 2FR0A 3AZQA 1ZAYA 2BY4A 4NU0A 2COKA 3O0TA 4HLUC 1IMOA 3RS3A 3DL7A 4ISCA 2ZQYA 4XI9A 3LWDA 2SKCA 4XIYA 3TSWA 3UGKA 1CZHA 1XSEA 3MUEA 4M1KA 2P9JA 3NT2A 4F84A 3K94A 4HY3A 3ZWBA 5AD1A 3LA6A 4X7BA 2JJ1D 1BVUA 1RPJA 1LI5A 3FLAA 4HK4A 2MT9A 5E4JA 4F9GA 3TW8A 5GINE 2I8AA 4TKOB 3TW6A 3WL5A 2CXHA 4IDNA 5ILGA 4KV7A 2OBTA 3A9TA 4CIXA 5DX0A 2DWCA 2ZE7A 1ZU5A 2VHWA 4C7VA 3V9AA 4R9SA 4AY2A 1IHDA 1EUDB 3DFMA 1XMIA 2O2JA 3DEKA 3E9ZA 2QP4A 4L5BA 5GP1A 4C0XA 4CM8B 4QOJA 3MQ4A 3B2QA 4Z9BA 2LNDA 1PF7E 3LVRE 2PKRA 3FRIA 3IIJA 4QUJA 4ZO8A 1IMJA 4QOFA 1CPYA 2GHTA 1EFDN 1RRFA 1ULZA 4BMXA 4XJVA 5C7IO 1O94C 2QW1A 3M4JA 3CEHA 1YL6A 4PR3A 1RHJA 3R7BA 2R97A 3FSJX 3OBBA 3Q7SA 3B70A 4BNMA 3T3PB 3IALA 2XODA 4D9HA 3WL7A 2J8ZA 2QRMA 5AHXA 4GC5A 4XWYA 2DR2A 1E43A 1N06A 1TZMA 2GKGA 3LVFO 3WLRA 1NN1A 1V5FA 2A67A 2PV0A 2MSCB 3EDQA 2BLLA 4J7UA 3PDWA 1PJ5A 3R3WA 1KC1A 2WJ4A 3N0XA 3QH4A 4ZC8A 4B74A 1RXEA 4QATA 1ZRHA 2ADMA 2EJCA 4KK3A 2PPVA 3T53B 1OPXA 1OTYA 2PQ2A 4UAGA 3BJRA 3T5MA 1DKMA 1YCFA 2F7SA 1W5FA 1XVUA 2AF4C 1Z83A 2YCBA 1LBTA 1AUXA 3B82A 3OZ7A 1VSTA 3DDNA 4GIBA 3ZBQA 2AUNA 2J85A 4EB8A 5AMXA 3U60B 4BLTA 2J9FA 2W7TA 1VJSA 3I64A 2BRUA 2GLUA 2QSJA 5TPWA 1V6CA 2IZ5A 2I6XA 1M2VB 1N6OA 1YCHA 4GPBA 2AEFA 4PANA 4PSKA 5THQA 1F2UB 1Z6XA 2DWUA 2Q9UA 1CY1A 4UHKA 3G23A 4BNVA 1TF5A 4YPVA 2QMUA 3N8GA 2ZL5A 3HRHA 5IYZA 3ZWVA 2IYEA 2Z04A 4RS4A 3R7DA 2ZJZA 4RO0A 5FWNA 4ZPXA 1E2BA 2GEUA 2HBRA 1RAHA 3FNEA 1SELA 4WBXC 1N1GA 1Q21A 2IS4A 2NWQA 5JVDB 2XCSB 3V4RA 3M5WA 4B3FX 5CA1F 2X0FA 3IVAA 2P9EA 1Z29A 5EHXA 4DILA 4F91B 2VYND 3LP5A 3GGJA 4TLAA 4KOEC 2P8JA 2Z2ZA 3RTGA 4RV4A 3KXKA 1CY8A 2FN9A 3H7IA 4LSGA 4ESOA 3GU3A 2B4TO 2IHZA 3I42A 5TRTA 2OZKA 1BFKA 1RI1A 2PSEA 1D03A 5IC6A 1WXEA 1A77A 4HAXA 1ITZA 3P32A 5E2BA 2VVTA 4S24A 5LNK6 5IU6A 5K0FA 1PNQA 2Q3MA 2ZYHA 5K03A 2F48A 1GQOA 1VP9A 3JQ9A 2REQB 2ZZGA 1C1XB 2X8KA 3G82C 3ZPNA 1HYGA 2CJWA 1RJGA 4AKHA 2AQKA 3HV2A 2WTXA 1XDUA 4MVXA 3D1LA 3T7JA 3CRZA 5JWRA 1TA0A 2WLSA 3C1AA 2P6OA 1U3DA 4NE7A 3E2MA 3C3AA 4HO1X 4PG5A 4PU0A 4W5TA 1ADCA 4CM5A 2DIEA 5CURA 5FWAA 1ZVQA 3VDXA 3GGGA 4JK3A 5EQTA 4YP1A 2WV7A 4B3DA 3O83A 3V8EA 1VFNA 4RH1A 3ND9A 1I0ZA 1Z25A 4EJ6A 3LOPA 2FH5B 1E20A 4MEBA 4LWQA 4TZ0A 2OBMA 1LTKA 1W4AA 3AEZA 3DMTA 3FB1A 4UUAA 4YT2A 4GKJB 5JUWA 3T6KA 1NRJB 4XONA 2OC9A 4HE5A 5HXAA 3ROFA 2ZRJA 2XNKA 5KYVA 4EO9A 2FPXA 3FGZA 2JCSA 1Q84A 3FVTA 2P6MA 4LV8B 4B84A 3ADBA 1PYDA 5EJGA 2C98A 5JWHA 3FMFA 5HW0A 2A1UB 2RKOA 2WYVA 3K6JA 5FULA 4CQMD 2L42A 1SXHA 1PQYA 2GPAA 1H2XA 4P36A 1YMQA 4YAIA 4XM2A 1SBCA 4UZSA 4FMDB 5KX5F 4OL9A 1MEOA 3U9SA 1DOAA 1FLAA 1NT2A 3F47A 2W2XA 3ISVA 5TS2A 1Z07A 5CVUA 4WWVA 2NZUG 1E5TA 3BF8A 2VPZA 4KVGA 1L4NA 4HL6A 1PK9A 2C5LA 1F0NA 3EHEA 3NIBA 3D7LA 2Y3IA 3QU5A 4JKYA 5G4KA 5HS4A 3CXUA 2Y1EA 4F71A 2Y0DA 4NXMB 4I55F 1PZHA 3LL7A 2WJPA 4HWKA 1EFHA 4YC7A 1L8LA 1GRVA 3RFFA 3RB8A 5ANRB 1KDTA 4IDEA 1CB7A 1HZJA 3V1MA 1U7UA 1GKUB 1AKUA 1U90A 1OD6A 1XJ5A 2XKBA 4IXMA 4F93B 3W5HA 1FNSA 1OI7A 4F97A 3K5WA 4FDAA 3QPAA 1E0AA 4TRNA 3FUTA 2JGJA 1E2MA 3AV0B 3QUAA 4WOPA 4MW5A 3ESBA 4ME6A 4ND8B 3UYKA 1KZ6A 1F17A 1YAHA 3R9WA 4B31A 3AMVA 5FI3A 1N34B 1W96A 4R2XA 1P3DA 3FPJA 3N0RA 4IJQA 4D7AA 1BVRA 5KOJA 4U5QA 2QI9C 4OMUA 1WW3A 5BO5A 5EWLA 1HOXA 3RYCB 1ONBA 3KUXA 1JHOA 4XGQA 4IUCS 2Z95A 3DZFA 3FPSA 3AI2A 3R4VA 4NBKA 5CITA 3ZZTA 4X54A 3ZNOA 1ZNQO 2Q0QA 3ORSA 5ITZB 1F7VA 2GYUA 4BRSA 4PGOA 1IHYA 3BSSA 4YCAA 4C0AC 2JVKA 3RU7A 3UH0A 3PX7A 4C5BA 3TJMA 3T1NA 1IQ0A 4HKTA 3PPVA 2ZS8A 4E3WA 2OUIA 1J9ZA 3KXPA 3GGOA 3H5OA 2XGOA 1DUIA 1FVHA 4HB2A 3DQPA 3N2KA 1SD2A 1DT5A 1MJHA 3I1JA 1I1QB 3PQ2A 3W3AA 4LA4A 4MUBA 4ZKEA 5U4QA 5JXJA 1KMQA 3T95A 2V7PA 2VPWA 2ZFUA 4EUFA 2GJ4A 4OB7A 4BGIA 2WHPB 4CI9A 4HGPA 4HAOA 2VAMA 3NP7A 2Q2WA 2PKXA 3QELA 4OVKA 2VLBA 2VKTA 4UBJA 2X3UA 3CPEA 2PWBA 4E14A 3NWJA 4YI3A 3RFUA 3G0CA 4E51A 3JQ7B 4MV0A 3ILVA 1D0IA 5TMEA 4J4HA 1U65A 2XEDA 4HUJA 4JLNA 2XT9A 5A1TA 3JW8A 3OAAD 2BD0A 5G41A 3N5CA 3JVVA 3VHQA 1Q3HA 3DV9A 4H1TA 5B4TA 1PVDA 1CS4C 2QN8A 5DX8A 2FMXA 4D6PA 1I3CA 1SUFA 4Q7LA 3WLOA 3MSCA 1Z5NA 3BJEA 3I9LA 4I99A 4G8BA 4ZVOA 2D2XA 3M1YA 1VLYA 1SXJC 3RJZA 3KQKA 3BK2A 4LDPA 4J94A 4I4LA 2ZVDA 2EDCA 4IRXA 1DWPA 1Q7RA 3RRYA 5A04A 3MD9A 1L9KA 2AOTA 2RGAA 3UW3A 5K09A 1VE9A 1OWOA 2RFLA 4P2NA 1Q0ZA 2RGYA 5A71A 4C0JA 3FB4A 4FI3C 1E3WA 4A8TA 2W2LA 4FQ8A 1FYEA 3FIUA 3O8NA 1W19A 5F2NA 2VF7A 3OZGA 1GQYA 5LXTA 4EATA 3W1WA 3IPYA 4XDGA 5HOQA 5AM4A 3LNTA 2K7ZA 4CF3A 2RGCA 3PF8A 4Z1MD 1G1AA 3K1JA 1N5OX 3F6SA 3QEOA 1FDUA 3H9NA 4HBGA 1MX5A 4CEHA 2PT7A 4ZJUA 5E1OA 2X1HA 4YIHA 1AZLA 2FW9A 3U4IA 3LTEA 4KQ2A 4DY6A 2NPIA 5B2FA 1Y8CA 1XQVA 5LQSA 2E5FA 2PUJA 5IVKA 1GAJA 1ZSYA 3LKDA 3MC1A 4HZGA 1A1VA 2BDEA 1NGSA 1EVIA 1OXSC 3LY5A 4QBTA 1T9CA 4XQGA 3KAPA 4YN3A 2IH4A 1A1SA 1VF7A 4P2GA 4MIOA 3KQOA 1L3CA 4XJTA 1NASA 3LGAA 2PUDA 1S72B 3L8EA 2RG1A 2R8XA 3PFFA 3ZV3A 3DVAA 1T5DX 4E15A 3NETA 3AJ8A 1G20B 5CB4A 5HRAA 1OH8A 2GCGA 1YXMA 4ETWA 4PAQA 3SOPA 1OYOA 1KVQA 2WA1A 3OCZA 1G3UA 1OIWA 3W77A 5BV2P 1P4AA 5I7OA 4TYMA 3K6KA 3K70D 5GGYA 4BLWA 4BC0A 1CDEA 3AR3A 4JZKA 2RGRA 4LJ7A 1IUKA 2XQVA 3DE2X 1N5DA 1C0EA 3GLKA 2JFWA 4KGXA 3CZPA 1K7FB 1QQTA 2B4RO 3K8OE 3UUGA 4X8HA 3RODA 3DVQX 5C1OA 3HEAA 4HCJA 1IHPA 3I9KA 5K3SA 1IB6A 3I9JA 4F4IA 4KNVA 2XTNA 5LWHA 3A35A 2A0UA 1WB9A 5EEHA 4MWBA 2ESRA 3TS1A 2ZJ7A 2GOYA 2G83A 1BXKA 2Y71A 3RUDA 1QIJA 3P2MA 3YASA 4BAGA 2VJAA 1G7TA