4RD6A

Structure of aif2-gamma from sulfolobus solfataricus bound to gdp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
414
structure length
405
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 110
structure length 405
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd6A01
5FPYA 2ODBA 4OYHA 1NI3A 2QPOA 4TT3A 4FCVA 2W0MA 3SZRA 4GZMA 2ATVA 4JIMA 3W8RA 1XPRA 2WTUA 2BJVA 4HLCA 3QIAA 4DLSA 1N0VC 4AYWA 3NBYC 1E4YA 2EFDB 1AS0A 4WVFA 3CBQA 4DSTA 5J5CA 2J3EA 4FXPA 3CCRB 4YQFA 3AGQA 3EARA 1F2TB 2WJGA 2CLDX 4HATA 3CX8A 4QM7A 3EZ9A 3REGA 1WB9A 2OFWA 4EDHA 4CF7A 4OQFA 3DOEA 2VP9A 2VZLA 3E2IA 2IXFA 3LDAA 4CEHB 3AH8A 1XTIA 3E1YE 3QFCA 4JMPA 1V5WA 2JAQA 4MGYR 1E9DA 2HV8A 5DI3B 2BMDA 4V02A 4RFSA 4WBSA 5FBRB 1XJQA 4QM6A 4A9AA 1Z6AA 4OQLA 5FI0B 1MABB 2O8FB 1G8FA 2PT5A 5KU1A 4G01B 4B2IA 4UAJA 2ZU0C 2PLFA 4AF6A 2IUUA 3QJYA 3SBEA 3ONWA 1B0UA 3T15A 3KKNA 2FFHA 1TPZA 2QMOA 1TLLA 1SQ5A 1QDEA 4V0LA 3SJBA 5JEEA 1DBSA 5TV2A 4BLTA 2VIIA 4BQSA 2FPKA 4P0TA 3GLIA 1YR6A 2Z4RA 3WRYC 1RPZA 4IVQA 1RRPA 4C0KA 2XSZA 2VNJA 2OK7A 3NEJA 2HLDA 3CCUB 2ZRKA 1KZGB 1ZNZA 4XWOA 5J4HA 5P21A 4OKSA 1TVCA 4LZZA 2CCGA 1G4UR 3KX2A 1W36D 1P4SA 2V6IA 4LV8B 4E09A 3DDCA 2ZE6A 1OXTA 1A82A 4V03A 2V9PA 2R6FA 3U4QA 4P4SA 2GXUA 4EIWA 2V55B 2ERXA 1EFCA 4JJKA 4PO1A 1DG3A 1OH7A 1W4CA 1G17A 2N42A 5D3MB 3RWOA 2J0VA 4EPYA 1QG4A 1XX6A 1ZD9A 1Z2CA 1QGYA 4MH0R 5JRJA 4F93B 1C4OA 3THYA 3CKLA 2WWWA 1G5PA 5H68A 1NJID 3F0TA 5BYKA 2MMGA 1J9ZA 2E87A 3WMEA 3QY0A 3R7WB 4B3DA 1EP2B 3KFVA 2Q3HA 3QE0A 4E22A 1QGZA 2PT7A 3GJ6A 2IW3A 4OI0A 4GMXA 2ORVA 2HYIC 2GXSA 1Z8FA 2CNWD 4OQNA 4DQLA 5AK0A 1XZPA 3ZQ6A 3ZD6A 4RSGA 4X8HA 1KDOA 4DLVA 4Q18A 3A4LA 2O0KA 1NY6A 5BYJA 4HUQB 3TE6A 3EIHA 1E2GA 4I1SA 2QY9A 2QGZA 2J87A 4F7DA 1KDTA 2CHQA 2ZRNA 3CONA 2GPJA 3CCSB 121PA 4K46A 5KSZA 1ZIPA 1C9KA 5M04A 1GAJA 2ZSDA 4Q19A 3EA0A 2B7CA 4M2LA 3FFAA 1OYYA 1ZD8A 2ZR9A 1WMSA 3TK1A 1E64A 3CR7A 4DLZA 1OHHA 3X1DA 2KSQA 1JNYA 4UNPA 5JCZA 1Q21A 4MGKR 4CEIB 4IDNA 2IS6A 2DHRA 3G0HA 2H17A 3CWQA 2YOGA 4LDJA 5KSPA 5KSYA 1AKEA 4RFVA 5DN6A 2BGJA 3Q7PA 1NN3A 3AVPA 2BM0A 1HH4A 2F3RA 1VQ9B 1DO0A 4DCTA 1KI3A 1J8MF 4YAOA 1MO6A 4JT4A 2FPLA 1CS4C 3H2YA 3BIFA 3W2FA 1EGAA 1T4GA 4Q4HB 3KXIA 4IFBA 4LCBA 4BFTA 2NO0A 2NPIA 4P6VF 1SVLA 2VF8A 4MKIA 3GCGA 2IT1A 2OTJB 1W5SA 4URXR 1DAKA 2JJ1D 4IXMA 4UJ3A 1XTRA 3KXLA 1PLKA 3T5DA 2WJVA 2RC6A 1RYHA 2B6HA 1Q1EA 2O8EB 4NCKA 2GCNA 3QPWA 3MLEA 4LJYA 1LVGA 1CLUA 3VR6A 4Q9IA 2XNDA 1E9FA 1KO5A 1VYTA 3BH0A 3GJ0A 5CK5A 1YR9A 1KO7A 4AIIA 2ANBA 4DCVA 2WIAA 4DLXA 1NVUQ 4G1UC 3ZBTA 4YXWD 4CT4B 3IIKA 1H8HA 1G8YA 4LYHA 2VP0A 4YDSA 4BLSA 2J0QA 2C5LA 2AK3A 2DERA 1A4RA 2QROA 3QPUA 4DEXA 2WAXA 1S3GA 1TADA 2UVQA 2F7SA 4N3NA 4O2RA 1Z28A 2VTKA 4NDZA 4P4TA 1NBME 2QTZA 1PLLA 3BS4A 1YRBA 5DN6D 4M9XA 4A0RA 4C7OB 3B1WA 3B1ZA 4PSKA 2ONJA 4TYYA 5JHHB 3KQUA 1IY1A 1WDTA 4QNMA 3MUFA 3IBYA 1GNQA 1ZM2A 1J90A 4PQYA 1ZMXA 2PL3A 3CRZA 2X3UA 3OFNA 4DXAA 3SU8A 5FFMA 3CMAB 3NBXX 1HV8A 5K8TA 4TQ9A 1N0UA 2BKEA 4DB4A 1PUJA 5HR5A 1WXQA 1MO5A 5FA6A 3KB1A 1Q57A 1II0A 2VHJA 2QA4B 4NYMQ 3U3JA 1KY2A 1XMJA 2VEDA 2RGGA 4EFLA 2DCUA 4URZR 3X1ZA 3TQFA 3AF2A 2ZREA 3CX6A 5BN4A 1ZM4A 4G1BA 4IFEA 3GP8A 3X1YA 3L8ZA 3W5UA 3AVTA 5CYPA 1AJEA 2IS1A 1J99A 2F43A 4WOPA 1HEIA 3PFIA 1E0JA 4HSEA 2SHKA 1E4VA 1VHLA 3THXA 2R6DA 4OK6A 4BFZA 3O47A 3ICQB 1M1KD 3CZPA 4LYFA 3SE0A 4LC1A 3G6EB 5KTYA 2VP5A 4XH9B 4F4CA 1K5GA 1H85A 5DLQC 3EPJA 3AV0B 5KDOA 3K0AB 4V0MA 2FMXA 1E9SA 1E69A 4OK5A 4ARZB 4OQMA 4KO8A 2J7PD 3OE7A 2AK2A 2GF9A 1XXHA 2R6AA 5KDLA 5KNBA 4B73A 4P33A 3PR1A 2FSFA 3GFTA 1G19A 2G77B 2OV2A 1OXVA 4JLMA 2BBWA 2V1XA 4LGMA 4RCYA 4Z8XA 5C18A 4CGZA 3QXSA 1OH8A 3LXRA 1ANKA 1TU4A 3UIEA 2RGAA 4X8OA 3BAFA 4BLQA 4AURA 4WZ6A 5L3SA 1G18A 5KUTA 1X1RA 5AUQA 3RRMA 2BHRA 4LJ9A 4RZXA 1FFHA 3GJ5A 1YR7A 1DO2A 4QRHA 1G41A 3N2IA 2GHIA 3ND9A 3NDPA 4BGDA 2OBNA 4O2LA 3IPYA 1E96A 2BEKA 3SFVA 3NVAA 1N6LA 5DH9A 4CDGA 1US8B 3KQKA 2QENA 1ZUIA 2JA1A 3U3MA 4N0EA 2IK8A 1YZLA 5AWFC 2XEXA 1SVWA 4QKQA 5K8IA 1M6NA 1FP6A 2IYZA 5KHOC 3ZYCA 4B76A 4I1VA 1KI4A 4G5OA 1EFUA 4JJZA 2VHCA 3W6NA 2QDXA 3Q7QA 3BC1A 2Z4SA 3RYTC 2CRVA 2ZETA 1KD1D 1UMKA 5LB2A 1YZNA 2JJ2A 3K0CA 1Z2AA 4IDOA 2ZUDA 4GSYA 1JJ7A 1U8YA 2Z43A 1PJRA 3G82C 3LY5A 2C99A 2YWFA 1U81A 4XTCS 4LHYA 4PAMA 1XEFA 1ZIOA 2QPAA 4OHVA 1AZTA 3CMEB 1BS1A 2JGNA 3A1TA 3GLGB 2J0UA 2OUKA 1I4TD 2GEVA 3PEUA 2ATXA 1N25A 3B85A 3HP1A 1IJFA 3AUXA 4OHZA 3GLHB 4TL9A 2X8AA 4EPTA 3RABA 4L4UA 1SVOA 3IIJA 1NN5A 4GL2A 1DEKA 4D25A 2ERYA 1KO8A 1QVFB 1VYUA 2JDIA 3LO5A 2AX4A 3N70A 2FX3A 1NBMA 2J46A 3IDQA 3SS8A 1NNEA 2ZQ5A 4P4UA 4GDFA 2ZJ5A 2B8WA 1E63A 2DWOA 3QXHA 4JZKA 5FUXA 2PBRA 3NIBA 3QXCA 2ZI7A 1VCIA 1P73A 1XE1A 3ZZTA 1HYQA 4BFVA 1EP1B 2ZUCA 1GO2A 3AKEA 2QTLA 2FFBA 3IGFA 4IJMA 2QP3A 4PO9A 2XZLA 3BFXA 1GIAA 4HYYA 3VHLB 1EESA 3VX3A 3B1VA 4KBFA 4P31A 4BFWA 1E9CA 1E2FA 1GG2A 3TUJC 3PENA 5H5JA 1NRJB 1I7PA 1E6CA 2XZOA 2GXAA 1OE0A 2ORIA 2AKAB 4E5UA 4LYJA 4Q7LA 4BFUA 4NCIA 4JLBA 4GMDA 1AKYA 2BMWA 2GDJA 2J9RA 4BZXA 3QKUA 1A2BA 1QF9A 4IDHA 2IYUA 4XD7D 2CCJA 5DYGA 1E2KA 1Q12A 2KE5A 1XWIA 2VHQA 1I2MA 3EAQA 3KJHA 1R5NA 4ABYA 4DCUA 3K09C 1VQ5B 1P60A 2I1QA 3PEVA 3GLFE 3UWOA 3GLIE 3ZIAA 1SM4A 2GJ8A 4NU0A 4TMWA 4GT1A 3W5VA 5G40A 1UKVY 1U9IC 5FTJA 3OFND 3PUXA 1NDHA 1E9RA 2ZAMA 3B8HA 3KXKA 5JBQA 3CXCB 3M4YA 1KDRA 3MWLA 3HDTA 2PZEA 2RGDA 2E9SA 1K8RA 2G1KA 5BN5A 4GBMA 3J81k 1ETUA 1NBMD 621PA 4ZIRB 4Q5IA 4B47A 4DRZA 2ZXUA 2JLXA 2PEZA 4MA4A 1KAOA 1F48A 1G21E 3SYLA 3A36A 4TTRA 2QI9C 1OIXA 4IOKA 4FWTA 2IYYA 2HLDD 1X6VA 2J0UB 1UKEA 4LY6A 3ADCA 5C4GB 2QU8A 2Q21A 3IQWA 4G5SA 2A5YB 3CUEF 4BECA 3AVUA 3EC1A 1L7VC 4IVRA 2AXNA 2CLSA 4TL7A 2HMAA 2DFKB 4LHXA 4KODA 5DNYB 2OT3B 4QBFA 3HU1A 5FBQB 5JEDA 2OG2A 4M1TA 4K8OA 2P67A 1FNNA 3U7EB 2J1LA 1OPXA 4HI0E 3JZAA 4PHHA 1Z5ZA 3U6BA 4DDTA 2D2FA 1Q22A 1TEXA 4JT2A 3H86A 2JLZA 2CXXA 1Z6GA 5DISB 2HDNB 4B33A 1KMQA 3TVDA 1YI2B 4O25A 1CNEA 2GJ9A 4NH0A 3CF2A 3FWYA 3CC4B 1Z0DA 2FZ4A 4J0QA 4C0AC 3UPUA 5HZHA 2DWQA 5C2JB 1SULA 1Q81D 4CYMA 4YMVA 4TZ6A 5IDVA 1DAFA 2CNWA 4PSAA 3K0FA 5L3VA 1BO6A 3K0FB 5L3SB 2WPDA 2OLJA 1GSIA 2EW1A 2C78A 5CYOA 2W00A 3PIRA 1P6XA 4AK9A 2CLCX 1P9RA 2AXPA 2G0NA 4HEJA 4NKRA 4D6PA 2I3BA 3RDPA 3ZVLA 1M34E 4CW7A 4EPVA 2AN9A 3VNVA 3MWKA 3Q3JB 4LV5B 5FOVA 1MO4A 3MRSA 1K5DA 2GAAA 4XJXA 1UBGA 3B2EA 1BKDR 1JJ2B 1T5IA 1XXHB 3ASYA 4ASUA 4Z1MD 5KYKA 5KOYA 1M8PA 4ARZA 1R8QA 4N1AA 3D8BA 3C4JA 3K0AA 2FNAA 2J59A 2H1LA 2AKYA 2G3YA 1FRNA 1KRHA 1M7BA 4KITB 2UKDA 4XVUA 2FN4A 3AEZA 1AGPA 4AKEA 4A6XA 5F98A 5KNDA 4GOXA 4CVNA 1ELOA 1E1RD 4Q47A 1E2NA 3D7MA 3QKRB 4JKYA 4BLPA 2VNIA 1WP9A 3BRWD 3QVUA 1TQ2A 2OO7A 1ZUHA 3CCJB 5TMPA 2QSYA 3RS3A 4BPBA 3PJRA 3MGCA 2C96A 1QZXA 1YIJB 2JDID 3OJWA 1R0ZA 3T12A 1NMZA 2AFHE 1NY5A 5GADl 3AVVA 4UQOA 1M7HA 1Z0KA 1XD8A 1G3MA 4RZUA 3RRNA 1Y63A 3T1OA 1LS1A 2OAQ1 1ZM9A 2DEUA 4B48A 3GLFA 1EX7A 1GTVA 4Q01A 421PA 5TARA 2B92A 1T6NA 4W7SA 2KB0A 3U7GA 3K9GA 1DELA 1Z6XA 2QL6A 1IQPA 3ZVNA 4PZZA 4C7OA 1E32A 4Y9UA 5K8UA 1XB2A 4ZGQB 1HE8B 3MWJA 3Q5EA 5K8LA 2Q3MA 2ORWA 4M22A 2VNHA 3HU2A 3E20A 1A2KC 4IRUB 3VO2A 4DDVA 1QHYA 2HXSA 3OIYA 3MMPA 1U2RA 2EU8A 4HAWA 3ZJYA 2A30A 5FTLA 1OFUX 2D7DA 5BN3A 1NF3A 4MRRA 3EZFA 3IILA 2RMKA 3B13B 4URVR 4HZUB 3TSOA 3I32A 5CITA 4M1YA 2D74A 3GLHE 4D0GA 2J41A 3WYAA 2QM7A 4IOLA 2VLIA 1E1QA 1KYIA 2P2LA 4HAXA 1QHGA 4U5XA 1X8JA 1XTSA 1BX0A 2BV3A 1N5KA 3PUZA 4KLZA 2V7QA 2ZJZA 1IN7A 4A92A 1COWD 3U3RA 3I5XA 1QUEA 3UK6A 3WY9A 2OFOA 3KJIA 4C4PA 2GBLC 4KXFB 1QUFA 2H7VA 4HE5A 4UNNA 4IEIA 2P6RA 4YDHB 2F9LA 2GAOA 3GLHA 1FMLA 4EKDA 4OHXA 1GVHA 3VR2A 3VFDA 5JJLA 1DAGA 2ZJAA 1XZQA 2A2ZA 3SYNA 1ZINA 4DLRA 5G3YA 4A4DA 5GVSA 2OFXA 4PGOA 2DWPA 2H16A 1AMOA 2ZRAA 5D3QA 2ZITA 4PPGA 4DLYA 1YITB 4RZ3A 3SQWA 4DQKA 4D4JA 1GRQA 2PZGA 3I1FA 4H1VA 2FGJA 2ANCA 3GJ4A 2BC9A 3LWNA 3W3AA 5FPTA 3TLXA 2EYQA 2CBZA 3CX7A 1QBKC 3IHWA 4IXNA 4YMUA 1QG2A 2C03A 2ZUBA 1EFTA 4TLAA 1W4AA 4QHYA 1XF9A 3OIVA 1M7GA 4PPNA 4NHOA 3SJCA 1W4RA 4JVLA 1UM8A 3VR5A 5J4VA 3V76A 1OIWA 2WZQA 3AKCA 1JR6A 2XTZA 1UBFA 4AI6A 1Z83A 2GZAA 2ZYUX 2OK8A 4JVSB 2JCSA 4LBZA 2FZLA 1VCMA 2GBLA 2V6JA 4EFMA 2VSFA 2Q3FA 1RKBA 4BFXA 2EFHB 3AF0A 4B34A 2ZRHA 4Q1AA 1VYVA 3FKQA 1EP3B 4YAFA 4QBHA 1CBUA 1N2CE 4HB3A 4NPHA 2B21A 1YKSA 3U44A 521PA 4TLEA 4LC0A 3LA6A 3QEOA 3OAAA 1T9HA 4Q1FA 4FN5A 3WYFA 2A5FA 4V0NA 4QBGB 4C0SA 2XITA 1S1CA 1VIAA 2IYVA 3SN6A 3ADDA 5EP3A 3U60B 1M74A 4K81B 3JVVA 1IN5A 5HCNA 4N0DA 3CWZA 5JI2E 2BMFA 1T8UA 3IEVA 4I1UA 2R6GA 4IOMA 4US2R 3VR3A 4UKDA 4FMBB 4US1R 3PEWA 2JLUA 1I2DA 1EK0A 4P4SB 2XTNA 2HCJB 3MJHA 1EX6A 2FSGA 1I4DD 2PMKA 3CR8A 5DHAA 5EZ5A 4Q1CA 1Z47A 3LW8A 5FL7D 2A5JA 1E2PA 3NH9A 2OM2A 3THXB 2F9MA 1S72B 2RCNA 3I73A 2RC5A 3A37A 4Q9KA 4R71A 2IUTA 4UNQA 2F43B 2YKGA 1FQKA 3B1XA 3NC1C 2VRWA 3KKOA 3E70C 4NYIQ 4JKIA 3K9NA 3GJ3A 1G20E 2QZ4A 1CJUC 1U98A 3CF6R 2QEXB 3KKPA 5B2ZA 1E2DA 1VTKA 3GLIB 4QFMA 1X3SA 4LPSA 2ZSAA 1W2HA 4B3CA 4M1OA 3SHWA 1RRCA 2AWNA 2QTVB 4MYUA 3G4SB 3LD9A 4MRVA 1COWA 2QT0A 3DMDA 4P32A 1OSNA 1SKYB 4KU4A 3H1TA 2QP9X 2IHYA 3W2GA 2W2TA 2NZJA 4W5JA 4F4IA 4FMDF 4MKHA 2IX3A 4Q48A 4CT5A 6Q21A 2QM8A 4QHSA 1XEXA 3RRZA 5HKKA 3WRXC 3P20A 1W7AA 3EWAA 3TMKA 2FG5A 2RH5A 4QJ4A 5LDDC 1SXJA 2QORA 3DL0A 1ZYUA 2E1RA 2OCAA 1NSFA 2W6IA 3OF5A 1R0YA 2QAGC 1ZRHA 2WICA 4LUCA 4EFNA 3F8TA 1J2JA 2ZAOA 4YHBA 2XB2A 3FB4A 4A1FA 1LB1B 1XTQA 4MQBA 3RLFA 3DO6A 3K09A 4NYJR 4HDCA 1N8RD 1RYFA 2AWOA 2W6JD 4RD1A 1G3QA 4Q4JB 3I8XA 3WNCA 1GZSA 3RAPR 3WNDA 4TT3D 3ZH9B 1M90D 3AF4A 3IIMA 4I4LA 1L2TA 1MH1A 5FL7A 4E03A 3Q72A 1DDGA 3CB4A 4Z54A 2ODNA 1P2VA 1SXJE 1SZPA 1G3IA 4OJQA 4W9MC 4HAUA 4HAVA 1N0WA 5KDDA 4KHZA 3CRQA 2IEYA 3TIFA 4XVQA 1G7TA 1T91A 2DFTA 1XTJA 2WMOB 3LQRA 1YHQB 4LJAA 5EE5B 1ZW6A 1DPFA 2V8OA 4ILEA 4TMXA 3FMFA 2O8EA 1GUAA 3TSZA 2A9KA 1I4LD 4MUBA 4ZGNB 5JSZB 1P2UA 3A4MA 2FH5B 2J45A 4WXRA 1OB5A 4UNRA 3WBJA 1KKMA 3TQCA 2O8DA 1F2UA 1PZNA 1FNCA 3B6EA 4LJ7A 1DDIA 3HU3A 5HPYB 1TF2A 3MAAC 1G4AE 1JEDA 3QVVA 4TMKA 3LX5A 4UNSA 5H70A 3VTKA 3VKWA 3LXXA 4QNRA 3A6PC 1U99A 5JFGA 3DPUA 4M1WA 3VNUA 3SBDA 2BBSA 1G16A 3NTUA 4A8JC 1SXJD 4C43A 1ZNWA 4QJ5A 5AJZA 1LF5A 2QPTA 4A0HA 3RS5A 2AHOA 2XXAB 3TAHA 2GZDA 3FFBA 2PIAA 3DVLA 1VQ6B 1KNXA 1F2UB 3L0PA 4JL5A 1II9A 1R8SA 2C2HA 4B3BA 4EQ6A 4CEIA 2X2FA 2YYZA 4M9ZA 4EPRA 4V0KA 1P3JA 5IK2A 5C46F 2IXGA 2GVDC 2G88A 3AGPA 2KBEA 3QKSB 4GZLA 1KO4A 3IO3A 2R9VA 1H8EA 4BWYA 4ZDKA 1GKIA 4FK8A 4KYIB 5H1YA 1VQPB 5JCPA 4TMTA 1Q20A 2WKQA 3EA5A 3RS0A 1LW7A 4DWJA 4MGZR 3NEYA 4XTRA 2YV5A 4QXAA 1UJ2A 4JYBA 1BYUA 3VMFA 4BZQA 4KI0A 3L2OB 1FQJA 5FH9A 4QBIA 3T06B 2BSAA 1GR1A 4RJLA 1FTSA 2XZPA 2CE7A 1OB2A 3K0SA 2IYLD 5FTKA 4PC1A 3W9YA 4Q4JA 2WJJA 3B7GA 2XAUA 3VU9A 4GNKA 2GCPA 2CJWA 4WA7A 2ODWA 4TMVA 2DPXA 2TMKA 2EWVA 2V3CC 3MHPA 2RHDA 4RKFA 4BZPA 3UMFA 4E07A 1JB1A 3BE4A 1E2QA 1UKYA 1SXJB 4RD2A 1FP7A 3A8TA 4JYCA 2WJHA 5D3MA 2BPOA 3UANA 1XEXB 3REFA 3W2HA 3CM0A 3PXGA 4DSOA 2ZRGA 4ZV4A 1CRQA 3CPHA 1GFIA 2XJ9A 2W6JA 5EXTA 1G8HA 2Q0HA 1NIJA 3O8CA 3GJ8A 5FL3A 1AQUA 4PC6A 1XD2B 1DAEA 4D82A 2HYDA 3R9WA 5CJ2A 3CCLB 1QHSA 2VH5R 3U5ZB 3U7HB 2RKOA 3T61A 2B7BA 1P62B 2QP4A 5L3QB 4HE6A 4DSUA 4TLCA 1DARA 2IYRA 3S1AA 3RNLA 1ZC3A 4LYAA 5AR1A 3O8RA 2LWIA 3BOSA 4LI0A 4OHYA 3JQQA 5EXPA 1X8LA 4JL8A 1LFDB 3S1AB 5DE3A 4Y7CA 1D2MA 4NCHA 2OXRA 3ZQJA 2CNDA 2WWXA 4B44A 2EVWX 2KJQA 2ZU6A 1GNRA 3RS4A 4I1OA 1NLFA 1T8TA 3ZGXA 4C0HA 4ESHA 5FOTA 2XNCA 1G7RA 3UG6A 2F1IA 4TL6A 4U02A 5A4JA 2NO6A 2ZRFA 1QFYA 3GPLA 5L3RA 3OIUA 4PFSA 4IDQA 2BM1A 3OJXA 4IHQA 3EPHA 2W6ID 3I72A 4Q66C 1VKJA 2QRZA 1CIPA 3CO5A 4RFSB 2CEAA 1Z63A 3ZS8A 2DBYA 4PC7A 5EP1A 1TNDA 4Q7JB 1JECA 5EXSA 4IEEA 1N6PA 4N3GA 2EWWA 4LWZA 2OLKA 3RSLA 3ZLJA 2ZRBA 2YC4C 1IJEA 3DM9B 3JVUA 4LJ6A 4RVCA 2QQ0A 1GWNA 3FHTA 4TN1A 1MRNA 4CEHA 1U8AA 4QGHA 3UMRA 2GCOB 2NO7A 4L8GA 2NOAA 3ADBA 3LLUA 1CTQA 1W0JD 1IAQA 2FFAA 2WIBA 4HB2A 1G1MA 1H8ED 5JWOA 3FPKA 2GK6A 1N6KA 2Q9CA 2C9OA 3ZZUA 2NPFA 4UXIA 1BOFA 1XD9A 2WSMA 3TUIC 5JS7A 3K9LA 1F20A 4HDOB 1JBKA 3W5IA 3GD7A 1F6BA 2HUPA 4KVAA 2ZE5A 1GP2A 5CM9C 4PHGA 4OI4A 3I56B 3BH6A 4URYR 2IA5A 3DEFA 3B9PA 2R65A 3OEHA 2ZSFA 4OI1A 3GLGE 4NYIR 4US0R 4PQRA 2Z0MA 1FUKA 5FOSA 2ZJYA 3NDBB 1CQXA 1CF4A 2CE2X 3THWB 2RGCA 3MSXA 1VECA 2H8KA 1DAMA 4C2TA 3BH7A 1BYIA 3QUSA 5DGXA 1JA1A 4B2PA 3B9QA 2CHGA 2YOFA 4DVGA 3TVTA 1NN1A 1KJWA 2GZHA 4ON9A 1KO1A 1OV4A 2JATA 4QGGA 3TBKA 4D0LB 4ZKDA 2UZIR 3HR8A 1R7RA 3P1JA 3Q9LA 2O8DB 4JSYA 1U0HC 1NP6A 1R0WA 2YVUA 4W5HA 1OKKD 5TVKA 1NN0A 4OQXA 2Q6TA 4DIEA 3M0EA 1D2EA 4WIAA 5FUYA 4DJTA 5JSZA 1MO3A 2PZFA 1W0JA 4GPTA 3KZ1E 3LFUA 4KVGA 3UXMA 1Q86D 1VG0B 4Y0AA 1ZP6A 3T34A 4AY2A 2O52A 3IQXA 1NJFA 4MDFA 1GOTA 2OXCA 5EXXA 5FOXA 4YONB 1W49A 2OSBA 3FHCB 2ZM5A 1UADA 1T3HA 1T5LA 1H65A 2ZYWX 4NYMR 2PH1A 1P75A 1EWQA 4G0NA 3QFSA 1XMVA 4HB4A 3SHFA 4BRWA 1R5OA 4D4MA 1Z29A 2B5OA 1HUQA 1OXUA 3AP2A 3U2QA 4EH1A 2QSZA 4CIDA 1VPLA 2DFLA 4LSGA 4Q4LA 3EZ2A 5EP4A 3EIQA 5FR2A 1L4UA 4FCTA 4KLNA 1S4QA 2H92A 2G1JA 5DI9A 5THXA 1KI6B 3W8NA 1W36C 1W1WA 2FF7A 1JAIA 3EZ6A 2KI5A 3G5UA 5JMTA 2MMCA 4A2PA 2OHFA 5CK4A 2R2AA 3O8BA 3BB4A 5JHGB 4H1UA 4L5BA 5EE1A 4II7A 4DCNA 1D9XA 5HE8A 5F2EA 3GLFB 2W0SA 3A1SA 5LD2B 1E9EA 4C3ZA 5CB6A 4EPXA 3KB2A 2ZVPX 1HQCA 1E0SA 3D3QA 3SOPA 4G5RA 3NH6A 3EX7C 3AVQA 2N46A 4QGFA 4NMMA 5HE9A 3L43A 3TR5A 1MKYA 3NWJA 3TH5A 3DMNA 3KTAA 1BMFD 3TAUA 4NCJA 1ZU5A 2ZEJA 2ZI6A 5JS8A 3QFRA 3KQHA 4CRWB 4A6PA 3L0SA 4RKEA 1XCGB 4PHFA 2IS2A 1BQEA 2C8VA 4Q00A 2AR7A 1N5LA 1LV7A 2XNDD 4DT1A 1JPNA 5C1BA 5ELXA 1CJTC 2CVFA 1IN8A 3DZ8A 4D26A 3P27A 3P26A 3SNHA 5B30A 3RS7A 2ZS9A 2N1BA 4C0LA 3RSOA 1N6IA 3FMIA 4WZAE 4D80A 4C0BA 1E0AA 3ES9A 1SKQA 4TYNA 4P3YA 1OT3A 3CCQB 2JLQA 4X8MA 1MT0A 4YMTA 2O8BA 3T35A 2MSCB 3H84A 2VSXA 3RC8A 4M4SA 1L8QA 1CKEA 3QNUA 4TLDA 5JWHA 1FL9A 2QGNA 2QAJA 3IKJA 2G6BA 2Z6VA 2IL1A 2QA5A 2VPPA 3NBZC 2GRJA 4AWXA 1EWYA 1ZU4A 4NL4H 3LAWA 5CJPA 3U44B 4C9BA 2XGJA 1W48A 5EMNA 1DADA 4UJ5A 1D6JA 3C7KA 1XNJA 3RHFA 2ZI5A 1IY0A 1G8PA 4YMWA 3HWSA 3FKSD 1GDDA 1N5JA 1SVMA 4L16A 3SEAA 3FOZA 2JLWA 1KOFA 1UF9A 3D31A 4JLDA 5IT5A 3VKGA 2NO9A 2R44A 3M6AA 3HYRA 3SDZA 1FNBA 4IOJA 4Q9JA 3QBTA 1YJ9B 3P4YA 4JLNA 3SQXA 1HTWA 2IS4A 4LRWA 3IUYA 4PC3A 3G71B 4XIGS 4KBGA 1XJ0A 1OIVA 2QAGA 3CPWB 4DUGA 1IXSB 1E79D 2W83A 5JWRA 1CXZA 3Q5DA 4PSVA 1N6HA 4QGAA 1AQYA 1VCOA 2GQFA 5UKDA 1DE0A 1W87A 3KUCA 4ZDIA 4MKGA 4ZI2A 1LTQA 4PTLA 2BCGY 2CMKA 1KNQA 2R8RA 3FGNA 5E95A 3E5HA 3A1WA 4DHEA 4LX0A 1II8A 3W6OA 4XD7A 5HXBA 3Q8XB 3F5FA 4L9WA 5IRCD 4YLGA 1IM2A 4F92B 2XB4A 3A1VA 1VQ8B 2ODEA 4DKXA 3QF7A 3EASA 3KQNA 2IYWA 4PPQA 4NP6A 4BLRA 2VYFA 5HZKA 1CR4A 3BERA 4TSFD 5HCIA 2BEJA 1NG9A 1VCNA 1XEWX 4WQMA 1S3SA 2CVHA 3GEHA 1RVDA 1FX0A 5DHFA 4EJSC 2VF7A 2O8CA 3IBGA 4GRAA 4JLJA 4ZI3A 4AC9A 3QQ5A 1YZGA 1BMFA 1VMAA 2W58A 4JVMA 3JQRA 3AVWA 4TTPA 3BFVA 3LLMA 3GJXC 1E0KA 1KKLA 1QFZA 3T5GA 3JZMA 2A5DA 4PZLA 1JR3D 3L0OA 4LJ8A 2IYQA 4HZUA 1P9WA 1XU4A 1CNFA 2IXEA 2ZRIA 3ICEA 2NMVA 3BBPA 2JJ8A 1OHHD 1H8HD 1G5TA 3CZQA 5FTNA 4G5GA 1VG9B 3TKLA 2LCFA 2ZSBA 1XBTA 4R98A 3LNCA 4LBYA 1AK2A 1RJ9B 2P5SA 4JL6A 4AYTA 1TQ4A 3KJGA 4D4KA 1ZCBA 4C30A 5EP2A 5JRZA 4MRPA 2D4HA 2JJ2D 2C04A 4CZ2A 3EPKA 4AF7A 1IXZA 3RC3A 2D06A 4U9UA 4X8LA 1O87A 3CH5A 2QE7D 4YALA 1DOAA 2BJWA 3FMOB 1XFAA 2ZSEA 1E1RA 2ZR7A 4B71A 2YJTD 3UATA 3R8FA 1JQLB 4XSGA 1J8YF 1KSHA 2JLVA 2Z5FA 4Y9RA 3NHBA 2R62A 2LKDA 1Z0FA 2JJ1A 1G6OA 2EFCB 4KSBA 3A58B 1J7KA 2VP4A 1GAQA 4BRUA 1CEEA 3NHAA 5EUQB 3K70D 2BN4A 3L0IB 3LVRE 1YR8A 5GV8A 3W6PA 8OHMA 1KK1A 1IN6A 3CPEA 4XSHA 1W47A 2ZANA 5AUOB 4PHTA 2BGIA 1UKZA 2PCLA 5DYIA 3W5JA 4TYPA 2FSHA 2WKPA 4TYWA 2JLRA 3OW2B 3HR7A 1XPUA 3VKHA 4YC7A 1SVKA 1E62A 1JALA 2CDNA 1XCPA 5DIFA 1T3SA 3QKRA 4M9SA 5LB4A 2VHTA 4O3MA 1TU3A 1HT1E 5FBVB 1OFTA 4Z8YA 5TDHA 3QI2A 1X86B 1CP2A 2QN6A 1JEEA 3W2EA 1W4BA 5J4YA 1ODFA 3BK7A 3CNOA 3W5HA 1QG0A 1GL7A 5FUWA 3C15C 1P7CA 5AN9A 3KL4A 3UWKA 1TQDA 3ZD7A 2OTLB 4BASA 3FMPB 3SFZA 1U0LA 1K73D 3QG5A 3O8DA 5KSWB 4RD6A 1G3UA 1R4AA 2Z83A 4A15A 3MCAA 4XOIA 2VBCA 4YAUA 1QHHB 3OZXA 4V0OA 5FPHA 1CJMA 2QG6A 1VIYA 1KC8D 2YINC 2ZTSA 2WMNB 3BWDD 3C16C 3AKDA 2F1JA 1QVRA 3WP0A 3I5YA 2QUZA 3KKMA 2WKRA 4DLUA 4C2UA 3CH4B 1D1NA 2YNMA 2HT6A 1JAHA 3QSYA 1W44A 3FHOA 1OH5A 1US8A 5TB5A 5E3HA 1KK0A 2A3RA 2FA9A 4B6FA 3DM5A 2BWJA 3FE2A 4DSNA 5CDFE 2FEOA 3QE2A 3WHLA 1FZQA 4NBSA 1JXMA 1A5TA 1W5TA 5SZJA 2QQEA 3RANA 3V4FA 1YZTA 3DHWC 3K70B 3M1IA 5GVRA 2YWGA 5GV7A 1GJRA 3OEED 3BB3A 4R2IA 2IWHA 4URUR 3UKDA 4AD8A 2ZJOA 2GVZC 4RY2A 5JJIA 4ITRC 4AKHA 2ECKA 2JLSA 1JA0A 2ZIAA 1KK3A 3TJZA 3FPAA 1CJVC 4V0ME 2FGKA 3QKTA 4OL0A 4DUGD 2AD1A 1UEIA 1KMHA 3LVQE 1U94A 4PAOA 2A78A 4C0QC 1GM5A 2O0HA 3GFOA 4DB2A 1OGIA 1G9XA 3NKVA 4WAUA 2DYKA 4LHZA 4EAQA 1D2NA 4R7ZA 2GK7A 1P9NA 2W2VA 821PA 1NJGA 1WCV1 2FPMA 3ADKA 4KSCA 4BE7B 3F3YA 5E7JA 1RFLA 1KZ7B 1Q1ZA 1BH2A 4KCGA 2QBYB 3C8UA 3P32A 4FW9A 2BCJQ 4NE2A 3VR1A 2GILA 5EQTA 1YJWB 3MD0A 2WHXA 2XTMA 1LF0A 2GJKA 1NKTA 4D0NA 1ESNA 5F9FA 1IHUA 3I8SA 4MDEA 4TSFA 3LQQA 1PV4A 2AL7A 4ACBA 3HYTA 5AJXA 5FTMA 1R6BX 4IVPA 4IW3B 1H42A 3OIWA 4POAA 1TX4B 3R20A 5HTKA 4ZIRA 4UXJA 2FU5C 5EUMA 1S9HA 2V4ZA 3L82B 1U9IA 3WNBA 1W2GA 1S1MA 2CL6X 2IF0A 3LVBA 4B6EA 4PC2A 3CPJB 1BJKA 4M21A 1SXJC 3OEEA 1YQTA 5SZKB 4HAYA 2RB4A 4TZ0A 1TQ6A 1E2JA 2GJSA 1X8KA 2LKCA 4WZBE 4S2EA 2ZS8A 4LV6A 2F3TA 2ZI9A 4U00A 5BQ5A 4M9QA 1WBDA 1A8PA 1YE8A 5KNCA 3NBFA 3TGPA 2QBYA 4LHWA 4ZO4A 2BKUA 1P72A 3GQBA 4Z1MA 1DAIA 3LH5A 3FTQA 4M1KA 3U6KA 1UBCA 1ZJ6A 2EFEB 4IKEA 4MYHA 4R2HA 1KJZA 1E2IA 1RRGA 3QPVA 3BGWA 1UAAA 1EG7A 1G7SA 1KSGA 2QE7A 3LW7A 5E7MA 3PVSA 1QHNA 3H4MA 4EPWA 1ZUNB 2FOLA 3BORA 4HLDA 3H0KA 3GFPA 4C0JA 3THOA 3ZIAD 4NZYA 1KTVA 3W34A 4KFRA 1SVIA 1AIPA 4DZZA 4CEJB 4DEYA 5DSZA 4GOKA 3AQ4A 3SYKA 4GOJA 1Q7YD 1KSFX 2GNOA 2J5XA 3EIEA 3P4XA 4TQUS 2F1HA 4L9SA 4B2LA 1HE1C 4F91B 3KDSE 1T3LA 3I55B 3QBVA 5B58C 4BEJA 4B35A 1KIMA 1FW6A 5CM8B 1FNMA 5E4FA 4F4JA 2RGEA 1VG8A 4B32A 1YRAA 1SHKA 1FDRA 4MYTA 1F5NA 4GI7A 4MGIR 5FPSA 2IUSA 5B64A 5C4MA 1FUUA 2BMEA 2REXB 1PLJA 3ZVMA 1XMSA 3BD9A 3SR0A 3KUDA 2RGBA 2P6NA 4JLPA 5HKKD 3EZ7A 1E9AA 1AS3A 4DCSA 3LO8A 3IO5A 4YXWA 3GLGA 1LS6A 2VSOA 5L8VA 1RZ3A 5CDFA 3EWSA 3UG7A 1CJKC 1R2QA 5EJEA 1E94E 1EFHA 1VHTA 1VDZA 3U3KA 4PANA 1NVXQ 5TR9A 1CRPA 3EC2A 1HT2E 4TMZA 1KSJA 2ZI4A 3X1WA 2PX3A 3OZUA 4JLAA 4MRNA 3RVBA 4KYUA 3CC2B 1KI7A 2VA8A 2C95A 1MR3F 2ZRLA 3IEUA 4PAQA 2CK3A 2GJAA 1Z0JA 1W2BB 2F1RA 3ZZ0A 1GL9B 3OESA 3K0EA 4L15A 4ZDWA 2CCKA 3HJNA 1G7CA 2EIXA 3X1XA 1GRRA 4BUJA 4DDWA 2HCBA 3B5JA 5LPNA 2HJGA 5EE9A 3WBKA 1QVAA 4ACAA 2L0XA 2PCJA 2QRNA 2MSEB 4RD4A 2OEPA 2QTFA 3AVOA 3KQLA 1E2HA 1S96A 2H57A 1IXRC 5SZIA 3SC3A 2WOJA 5GJWC 4KFSA 2WPDD 4D4LA 5J4LA 3FKSA 4XWAA 2BF4A 1UDXA 4LJ4A 3AP3A 5JZVA 4WXPA 2P0EA 4TL8A 1KI2A 1N6OA 1NVVR 2OZEA 1XTKA 2JEOA 2C98A 4A0GA 2BOVA 1JXOA 4QHTA 1NLYA 4CEJA 2WSSA 2DB3A 3CLVA 3SI7A 5F3WB 3ASZA 4YMSA 3THYB 1E79A 2VNKA 1N5IA 3ETLA 3R9IA 1OXSC 4AYXA 2K5UA 5BW8A 1VQMB 2H5EA 3N5CA 1EFRD 5CB8A 4KFTA 3AM1A 4IDPA 3V00A 4AKGA 1EWRA 5EE0A 3WHKA 1WBBA 1UFQA 1Z6TA 1QFJA 1YJ5A 3C5HA 1RJ9A 5FUVA 2B8TA 2OAP1 2D62A 2OILA 2QEQA 2WWIA 1A7JA 3CCVB 4TYQA 1OFIA 3K0CC 2EYUA 1OYWA 2Q9AA 2REOA 3E1SA 1SGWA 5JJKA 4LK2A 1Q3HA 2GXQA 2CL0X 4ZKEA 1OW3B 5KSOA 3BJIC 4TLBA 4RZ2A 2JLYA 1OGJA 3LBNA 2BVNA 2ONKA 4JBXA 3Q85A 4JLVA 2DFNA 2IF2A 1S8FA 3RS2A 4Q03A 1RW4A 1FTNA 2WWGA 1B23P 1K9MD 4BFYA 2WAYA 2X2EA 2JASA 4LBVA 1FX0B 2H18A 2DR3A 1AN0A 3CRW1 3U3OA 1QVGB 5JECA 2FEMA 4HZIA 4XWKA 1VQLB 3CIOA 3CCEB 3K70C 4Q7KA 1KK2A 2V54A 3FYHA 3DKPA 3MWYW 3R8CA 3PCRB 4A2QA 2PJRA 4Z51A 2YWEA 5A5GA 3T1TA 1ESMA 2AFIE 1XEWY 2ZROA 3VAAA 3OZWA 2X19A 4BEBA 2VYQA 5EZ6B 5KO2A 2VQSA 5JI3E 2A5GA 5ANRB 2O8FA 4B75A 3WXMA 2O0JA 3NXSA 1IBRA 1TL7C 4A0FA 3C5CA 1EFRA 4DDUA 4MUAA 4QL3A 4U7DA 5AJVB 3C14C 2CHVA 4LPKA 2OBLA 1P61B 3AP1A 2PEYA 2YOHA 1KI1A 2D7CA 3X2SA 1NIPA 1JB9A 1F60A 3PEYA 2JIZA 4JLOA 2IWRA 2XNJA 3ZS9A 2A7QA 3TNFA 1XMIA 1ONBA 1CR0A 1Z07A 2QAGB 3PITA 4QC2A 4ZPXA 5AJYA 1YU9A 5AUNB 1F2TA 2IBMA 1E99A 1KMHB 4BFSA 2WOOA 1XCMA 4KAXA 4I99A 4HLQB 1ZAKA 1CU1A 4F38A 3AF1A 1IONA 1E1QD 1Z3IX 5G3ZA 4G1VA 1Q3TA 3BXZA 3K9HA 3N2EA 3QG1A 2ZRMA 1OXXK 1R10A 2WJYA 2ZJ8A 1SKYE 5GJVC 2D3WA 2NG1A 4NTZA 2REBA 2NO1A 4B3FX 2BBOA 1Q82D 1J70A 1E2MA 1SHZA 2ZE7A 3AF3A 4FWIB 4UXHA 1YZKA 5FR1A 3AUYA 1VG1A 1T0JB 3TUZC 3K53A 2PJZA 3OAAD 2IYTA 2O5VA 4Q4HA 1Z22A 3JQPA 3WMFA 1VQKB 1G3RA 2NTYC 1KHTA 2ZE8A 2RGNC 2C9CA 1CULC 3GJ7A 3IHLA 2XX3A 3B60A 3V9PA 4W5WA 1DTSA 5AUPB 3A1UA 1WRBA 2I4IA 5F9HA 1QHHA 3QF4B 4FI3C 2WWFA 2OE2A 3LRPA 3MFYA 3KJEA 4M1MA 2QTHA 1FRQA 3LBIA 3CC7B 4TQAA 4AG5A 1R5BA 3EG5A 1UEJA 3ZBUA 4JVNA 1OJLA 3CW2A 1RIFA 2CL7X 2CK3D 2JIZD 1S2MA 1W34A 2ZRJA 5FPKA 1D8TA 3EPLA 2HF8A 5FI1B 3QXJA 3PUVA 3EXAA 1QHXA 1TTTA 3T1QA 2OESA 3TSWA 3C41J 3FJOA 2XSZD 4DBLC 4LJ5A 5BWMA 4HUQA 3KTAB 1SVSA 4M8NE 2HT1A 4TTQA 1UDWA 1WA5A 3W3ZB 2WWYA 1WF3A 1E98A 3AB3A 3B1YA 3ECCA 3HPRA 4Q1DA 4Y0VA 3CF0A 3CNLA 2ZYTX 1ZNYA 1W0KD 3I61A 2EFGA 4Q7MB 2HF9A 4DLTA 2WVJA 1P2SA 3A4NA 1YZQA 3ZDQA 1M1YE 3QOFA 2AD5A 5LBIA 1V43A 4ZCLA 3R7WA 2F55A 1EXMA 4BLOA 1AM4D 1K6MA 2HJVA 3QENA 1ZCAA 2KWIA 3IPXA 1PVOA 1NKSA 4QOSA 3CRMA 5CIWA 1MOZA 2PMDA 1XXHE 2VP6A 2NIPA 1KI6A 2BMJA 2QMEA 3TR0A 4ZCMA 3I4LA 1N3BA 4ASUD 3W2IA 4JLKA 4JSTA 3WYGA 4B43A 4FD2A 3RRYA 1AS2A 1QRAA 4A2WA 2G0TA 4QG7A 2Y8EA 4G3XA 5B57C 3PG5A 2FDCA 1D9ZA 5SZHB 2IHBA 4FMCF 3U4QB 4DC9A 4D2IA 1XPOA 3QXXA 3I92A 1OKKA 4F7WA 4PXAA 1AA9A 4QJ3A 4JBWA 2X77A 3LX8A 4WW0A 3EW9A 1FNDA 1KI9A 2PLRA 3VQTA 1NSTA 1AZSC 3B82A 2I1VB 4D81A 2HEIA 3K1JA 1ZNXA 4KFUA 1O3YA 1YVDA 1NVWQ 1S9DA 2G83A 4OBEA 2FSIA 5BXQC 1Y3AA 1D5CA 1TAGA 2QMHA 4GP7A 5GJBA 2Q9BA 1KI8A 4M1SA 2O8CB 3AVYA 1Z06A 2D2EA 5CLLA 1TUEA 3VX4A 2RGXA 5KPJA 1GKUB 2RAPA 4MKFA 4Q4AB 4HUTA 2DETA 3PV0A 1E9BA 3I3SR 3RWMB 3D6TB 1G6HA 1GVNB 4LOAA 2OCYC 1UPTA 5H8WA 2GEUA 4URWR 3K8YA 3LBHA 1DAHA 2YHSA 2EQBA 2C77A 4EUNA 221PA 3VO1A 2ZRCA 1XJCA 1MABA 3FVQA 4R9UC 1MRSA 3U61B 3ZC3A 1S0UA 3QFTA 1N6NA 5CIQA 1ZM3A 5FOWA 4BPRA 1II8B 1KGDA 1N6RA 5DI3A 1GNPA 1P2TA 1Z0AA 3THWA 1JJVA 2FFQA 3LV8A 4A8JB 3WMGA 2OCBA 3OZVA 1GAWA 4I81A 5IK2D 1TMKA 2NGRA 2ZJ2A 2GEDA 3B78A 2ZRDA 3VHXA 1ZBDA 2HXYA 2VP2A 2ZR0A 3ND8A 1NG1A 1YZUA 4AKIA 1OH6A 4H9GA 2FV8A 3MG9A 1IOZA 3L8YA 2ZS7A 3SJAA 3BB1A 4MRSA 4DIDA 1IB0A 1NL3A 4ESVA 4NONA 3CRRA 4O0MA 2IYXA 4XVRA 1A1VA 1JR3E 2GCOA 1VQNB 4K1XA 5G41A 4AG6A 3CCMB 2XNSA 2ZPTX 1GKYA 1HQYE 2YWHA 1LNZA 2VHUA 5FOUA 4A8JA 2ASEA 3BFKA 5GJCA 1K8AD 4B74A 1KDPA 4PZYA 4HDQB 1CR2A 2P6UA 4A36A 5AJWA 1E2LA 1XP8A 1OF1A 4HLUC 1TUIA 1G5RA 1HURA 1L4YA 5J4KA 2PX0A 1F3OA 1G64A 1TF7A 4GP6A 4KJZA 3UMSA 2ZYVX 3MJRA 4A82A 2O8BB 2WV9A 1QX4A 2GWHA 1C1YA 1RRFA 2FE4A 5TY0A 2FJUA 2OBMA 1FPMA 1IN4A 1VQ4B 1G8GA 4OHWA 1OFHA 4M0LA 4RD3A 3FDIA 5TXGA 4Q4AA 4NYJQ 3CRVA 4MITA 4HB0A 1BIFA 1U8ZA 4B3XA 4DT1B 3SJZA 1M2OB 4Q9LA 2FWRA 1HA3A 4FMDB 1Q0UA 1NVVQ 1E2EA 4LHVA 4Q02A 1GILA 4FCWA 4FMCB 5A0FA 1RE0A 1QHIA 2OCPA 2RGNA 4OJKA 1CR1A 3CNNA 3DZDA 2GETA 4EJSA 1Z0IA 1YHNA 2VL7A 1U0JA 1TF5A 5L3QA 5FBWB 2V7QD 2P3SA 2X1VA 1KAGA 1Q44A 1IY2A 1W0KA 1ZM7A 3OEHD 2ZJBA 1XD2A 2MSDB 1JPJA 1DS6A 4PR0A 3NC0C 4S35A 3TW4A 1Z6YA 721PA 2ZVQX 2ZI3A 2NQ2C 1R0XA 2GESA 2WJIA 2WSSD 1ZD1A 2YZ2A 4YAWA 2R6CA 1B2RA 2J7PA 3OE7D 4ERNA 1XRJA 3NG1A 2RHMA 2QNRA 3CD6B 5EE3A 2XOKA 2IYSA 1E3MA 4RD0A 1KY3A 1LY1A 1U90A 3PUWA 1QGAA 3DOFA 3KKQA 5JLJA 1NMXA 2CJWB 2KBFA 1KQSB 4FIDA 1GRNA 5LD2C 3VU9B 1HY3A 2BBTA 1Z08A 4FINA 3ZVRA 2P5TB 1P5ZB 4B4DA 5J47A 2WM9B 1ZC4A 1G291 1W36B 2V1UA 2R6HA 2GA8A 2BDTA 4LBWA 1BX1A 3KFXA 2VO1A 1RC8A 4NCNA 4RCZA 4JBYA 2J0SA 4Q9HA 1W46A 4B3GA 3T1VA 5FBLB 1NLZA 3HPQA 4M53A 1Q1BA 4EJSB 1PUIA 1DG1G 1AGRA 2GTPA 3R9XA 2UZ3A 2J7KA 2QMUA 4Q1BA 1W35A 4PQFA 5DO9A 4DLWA 3I62A 1XDBA 3QEJA 4HLUA 3DKVA 3VR4A 3AVXA 4HAZA 4Q1EA 1WQ1R 1JR3A 4Q21A 4PX9A 5CLQA 1KJYA 3V4RA 1ZVQA 2XJ4A 3QKSA 5IF9A 1GITA 1JI0A 2GF0A 4PPFA 1FMJA 2ZRPA 4MYCA 5G53C 4JS0A 5J40A 1DVRA 2C9YA 1JQJC 3W90A 4EQ6B 1X1SA 3GMTA 4G5QA 1VQOB 2W2XA 4TWZA 1MV5A 4GFDA 2XXAA 1QH0A 2QT1A 1GL6A 3PUYA 2G9NA 3OHMA 4ZDJA 3QF4A 4ZCIA 4OI2A 2BIFA 1VQ7B 5H59A 1FOEB 2WBLC 1UBEA 2GKSA 3GEIA 1T0HB 3PQCA 3AKYA 4OK3A 2IC5A 2DY1A 5E7IA 3TW8B 2YC2C 1TEVA 1YJNB 1WE2A 2XOKD 5IHPA 1OLOA 2P65A 2NZ8A 5KPDA 3U7FB 3TRFA 4PO8A 1Q1QA 4KV9A 1NMYA 2F6RA 2WWHA 2IEZA 3GEEA 3WP1B
chains in the Genus database with same CATH superfamily
1DC6A 5EIAA 5EAIA 2QPOA 5A4MS 3QOXA 3H5IA 2FPIA 4MULA 3HB7A 2Q27A 3SZRA 3MJFA 4M0EA 2NAFA 1KE2A 2QRHA 1I14A 4CG0A 2O1WA 5D01A 4IHKA 4BQIA 1OC4A 3QIAA 3GDFA 5IT0A 3CMMA 3EGVA 4CMGA 4G8JA 4MW4A 3VNQA 1GKLA 1IRIA 2X8JA 1DJPA 1H23A 2EFDB 4GYKA 2EG9A 2PUHA 1Y5RA 1IM8A 3S2ZA 1OC2A 3IELA 2OYNA 4FXPA 3ELDA 4FEGA 4X7CA 5J5CA 3WWPA 2VQ6A 3NGXA 5HSGA 2A0WA 3DZBA 5LUAA 1OYOA 1BD4A 1MA0A 1MUUA 4G81A 4ER6A 3D2AA 4UBIA 3GRYA 3ENNA 2W6NA 2OFWA 5FV7A 3WS7A 1JHYA 2Z9DA 4EMBA 4UW9A 3DOEA 3V4VB 3ZWPA 3FYTA 4Z9YA 2IXFA 3LDAA 1HLGA 4DA8A 3RG2A 2IFTA 3E1YE 3BICA 5CG2A 5DHUA 4PYQA 2A94A 4FFVA 2ZAIA 2PJDA 2JAQA 4G89A 3T3GA 5GZ1A 1UFOA 1E9DA 4H1HA 1Z16A 4XR9A 3EDQA 4RK5A 5E9QA 1CPYA 2BMDA 2CD9A 4KQEA 3WK9A 4B0PA 4WXYB 1SUWA 4A9AA 1BMDA 2YXEA 3HMKA 3TPZA 1MABB 4G5FA 4QDKA 2MWMA 1G8FA 3C6QA 1IWPB 1XZKA 2I8CA 2I3AA 3BMXA 4QPJC 8MHTA 4G01B 4M1QA 2BONA 4KH0A 3M81A 4JI8B 2PGNA 2V7GA 3ESBA 3VYWA 4OX9B 4RS3A 1J0AA 2W8ZA 1JHXA 3OCZA 2HI0A 1NQTA 2G5PA 3QLJA 3QJYA 4GUAA 2QI9F 4RHXA 5LYJA 2IUUA 3SCZA 3T15A 1P1KA 2Q5EA 3UCEA 1JVBA 2YXNA 1TPZA 3G88A 4Q4CA 3FSRA 3WQRA 3CY6A 1SQ5A 3GGJA 4V0LA 3KKEA 3SJBA 1UDRA 1X2EA 3ORHA 4U7GA 4BLTA 2FPKA 4RPDA 3PQEA 3R6TA 4P0TA 1WMBA 1TYAE 1YR6A 2PL1A 4MW0A 1JEAA 1EINA 1RLJA 4XOTA 2QHXA 3PQDA 5KYXA 4L50A 1QIKA 1VLMA 3NPAA 1RRPA 4HNAB 3L6EA 4UOZA 2VNJA 2FFJA 4TPKA 4ZHSA 4G0YA 3CF4A 1XIVA 3D4BA 3U39A 3QVKA 2G5TA 1GPDG 1NNUA 1NNLA 1ZNZA 2ZL5A 1VKOA 5P21A 4UU1A 4QUDA 1E61A 1SBNE 4G2TA 3BWEA 3MLBA 1W36D 1P4SA 4QATA 4E09A 4EA8A 1Y6FA 1DV1A 1XVVA 2ZE6A 1P0CA 2C5BA 1A82A 4BE4A 3DMFA 1QCCA 2R6FA 3L5OA 2RJOA 4JASB 4OM8A 4P4SA 3U4QA 2V3WA 1I32A 3ILVA 4EIWA 1JQEA 4UM9D 4JJAA 4EF6A 1W76A 2A9QA 1PJ5A 2AN5A 2ZJ7A 3F6SA 4L74A 4OYYA 5JALA 1GUBA 2J0VA 4DCGA 2VHWA 4L8VA 1NQVA 4AZWA 3FW1A 4C88A 3B6IA 1QGYA 2PSDA 2YNMC 2WSLA 3A70A 3DQZA 2Y9MB 1VI5A 3BDVA 1ONNA 1JV2B 1V0JA 2VYCA 3M3DA 3AG5A 5H68A 1LEHA 4Z7JA 5BYKA 1J9ZA 3MFQA 5CHEA 4A91A 4X90A 3IXMA 1YA6A 2A9VA 4E22A 2GS9A 4KE7A 2PT7A 4ZZ1A 3JD4A 2IW3A 1WUKS 4KIUA 4OI0A 2ORVA 3G8BA 1W25A 3FRJA 1MBZA 2C9DA 1Z8FA 2GXSA 4Z4YA 4DQLA 3OI7A 4K9OA 4G8BA 4OQNA 5AK0A 4YQEA 4RSGA 3X2EA 1R9NA 1KDOA 1NTOA 4Q18A 1ZRMA 4KTTE 2O0KA 1CY6A 4L0MA 2R79A 3PIIA 3EXEB 4G24A 1BC5A 4BIMA 1DKMA 5K0LA 3WLEA 2HXGA 1FMFA 2FQWA 2GARA 2XW6A 4HGNA 4P4TA 1KDTA 1UBKS 4LXUA 3V1KA 1N9GA 121PA 5L9AA 1IEWA 3ME5A 3HB5X 1M1NB 1P1FA 2X9QA 3ETEA 4GRDA 2ZSDA 4Q19A 5IZ4A 2B7CA 4M2LA 1Y1SA 1OYYA 5DM1A 1WMSA 1ZN8A 2OBYA 2UUOA 5U4QA 1OHHA 3LUCA 5GONF 2A88A 3LCUA 3X1DA 3RI3A 4XPZA 4Z1OA 2I55A 3RH0A 4KMSA 4XWTA 5JCZA 1Q21A 4LWOA 3TTYA 3WGYA 4B87A 1CUUA 1RTTA 1WCXA 3GLTA 5E6UB 2HKIA 1ZK4A 2AFRA 5E6SA 1MP0A 4FI3F 2H17A 5KSYA 4W9RA 2X5KO 2BGJA 3E8MA 3Q7PA 2VAWA 2PG3A 2VJCA 3FCYA 3IT3A 4KEAA 1DO0A 1PT8A 3ZGZA 4DR3B 3H4VA 4YAOA 2HMUA 2VJAA 5GAJA 1AHNA 2Y76A 2YJ3A 3H2YA 3RBAA 3ZNQA 3ZHQA 1LBIA 1EGAA 1V7CA 4Q4HB 5KOHB 2FZCA 3I01A 4IFBA 4NABA 3PR3A 2DUJA 3WC4A 1XAJA 4PVDA 4W1RA 1ZXBA 2NPIA 2X3YA 5CDUA 3GCGA 3QE4A 1T4BA 4P53A 3I1IA 3FVRA 1Y8RB 2IHKA 3G02A 1R0RE 2Q4DA 4NU6A 3T5DA 4TXHA 4DA0A 4ZQIA 4EM6A 2RC6A 1SCIA 1F8XA 1VA5A 3V1LA 5B4UA 5BRJA 2CV2A 1KZ9A 4BFCA 1Q1EA 2JAUA 1MQ9A 4HSGA 3COYA 3OD1A 2CJXA 3RAEC 1V11B 2NU7A 1EDBA 1CSEE 1CLUA 1L4NA 2VK2A 1RD4A 3I6QA 3OCXA 3ZI4A 1N1GA 3ZR4B 2HHJA 2HRBA 4YUZA 5JTTA 1VYTA 3IUEA 1TYZA 5B6JA 2Q29A 5T8KC 3LLSA 1W5EA 2W4IA 3OT4A 5BV8A 4FFBA 4YXWD 3AU9A 8ADHA 4YV1A 1G8YA 3ZWXA 1EU1A 3EA4A 1ENYA 1V95A 1DJNA 2Q3BA 4YECA 1NULA 2AK3A 3OBIA 2Q99A 4GYJA 3MJCA 4KK3A 3BMCA 2YW2A 4RJKA 3H9QA 5K3EA 5KTMA 4QOEA 1C0LA 8GPBA 4RJTA 5IUJC 2PRSA 1U3TA 3FYUB 3N59A 3LOUA 2P77A 2A7XA 1PLLA 3BS4A 3D81A 3MT7A 4NXNB 3SJPA 1FFSA 3IXQA 3IQEA 2CW5A 4H3HB 4M9XA 4A0RA 2J0QA 5CBKA 4XJTA 4IWYA 4QNMA 3AUFA 4AIRA 1OTXA 1WV1A 2PXHA 1D4OA 2CFRA 1G59A 1GNQA 2FDRA 1W5FA 2X3UA 4JXKA 4MCAA 3HDVA 5CVVA 3ZHTA 2OECA 4ZCRA 2JD2A 3HKDB 1VJSA 5JSKA 3TD6A 3E23A 2FJPA 3NBXX 1ZUD1 2WU4A 3RTGA 1N36B 3VH2A 1T4DA 1GCIA 3SC2A 5CB4B 5LWHA 2QLJA 3KB1A 3KT6A 2QA4B 1ZMBA 1OJ7A 2X2OA 3KPWA 1FUIA 1PYDA 3OU6A 1EFVA 1LBEA 5G4KB 1L5LA 1XTVA 1HC7A 4URZR 5HDBB 1O4WA 4JVOA 3ACDA 5IX8A 1EK1A 3AF2A 4ZMBA 3BN3A 3OLQA 3TTWA 3NHFA 1FXWF 5JNLA 3L8ZA 4MROA 2Q5IA 5CYPA 1J99A 1JKJA 4RH3A 2CXUA 4UD6A 1UP6A 2BFBB 4AMGA 1TEZA 3KQYA 1E4VA 1FFAA 4RCVA 3LOQA 1VHLA 4H7PA 2PKQP 4Q3CA 3THXA 3P5BA 3A9VA 4PAGA 5HMLA 3TM5A 5KTYA 2EL9A 4F4CA 3L7LA 3PXDA 4MJ3A 3EPJA 3AV0B 1Y48E 3LUGA 4PRKA 4RMIA 5GONB 4HNHA 2J3QA 1W96A 1TKRA 4OQMA 2P8JA 2OC4A 3K1TA 3FPPA 1XXHA 1L3BA 1UAGA 2GF9A 4H17A 5KDLA 5KNBA 1IC6A 5DF1A 3M3HA 2IOYA 3GFTA 5HRAA 1EH5A 2G77B 4E31A 4LGMA 3ZV3A 2BT4A 3I45A 1NHWA 3CU5A 4WV3A 2BR4A 2KS6A 1NV8A 4I2NA 3OE5A 5EWJB 5JVDA 1JFTA 3BAFA 3LDGA 2ZL6A 3BY2A 3EC7A 1IZZA 4TKOB 2DYIA 1YRLA 3PLRA 5L3SA 3RUHA 1G18A 3V8RA 4Y98A 1X1RA 4FD3A 5KUTA 2ZUUA 4XGQA 4LJ9A 2AJ8A 1E1LA 2OD2A 3R3SA 4YPOA 3GJ5A 1MJGA 2DLCX 1DO2A 3PWTA 2C61A 4QRHA 4FGUA 2QX7A 3N2IA 4PV7A 3KHTA 3ND9A 4J0HA 4BGDA 2OBNA 5JLAA 1B2LA 5JPIA 3P2YA 1J0XO 1UFKA 2UU9B 3KQKA 2QENA 4REQA 3OQJA 1UZUA 3VR4D 3F5DA 2O1XA 3FM9A 4N0EA 5AWFC 3WJ7A 5CNKA 1Y37A 5J2UF 2R7MA 4LMAA 5KAPA 5KHOC 1X9GA 5EMHA 4BBAA 4I1VA 4OLBA 1KI4A 4H18A 4G5OA 1O77A 4D8WA 4FYXA 1N5RA 4QX6A 2P1RA 1DC5A 3ICWA 2VHCA 3TGWA 5ALHA 1NJ2A 4R41A 1NC1A 4HQRA 1QQAA 1E2BA 4HNRA 2D9RA 4Q1VA 4DR5B 2HRDA 1OAOA 4O02B 1ONOA 3AR2A 4IDOA 1MB2A 4GSYA 1BFDA 4RHFA 1U11A 1PG0A 1U8YA 4F8YA 1JG6A 3KHSA 3G82C 2C99A 2R6JA 2EQAA 2NUPA 4PAMA 5FHRA 5J5AA 5K4GA 5BWOA 4RTPA 3M6WA 5EHIA 1BS1A 5J2TB 3GT7A 3PKIA 2J0UA 3N9IA 1I4TD 2GEVA 1WUYA 2W2QA 5DMXA 1ZA1A 1NC3A 1N25A 2R87A 2RHJA 3PHHA 3FWHA 2VBUA 3AUXA 3UQZA 2PO5A 1C9EA 2X8AA 4NV0A 2HK9A 2X4GA 3G2JA 3KFLA 3QVWA 3Q9SA 5FADA 1C30B 2Q5QA 3COPA 3V4LA 4GL2A 4LVUA 1QVFB 3PDUA 3FLEA 5ERXA 3IOMA 2ECPA 2HQ1A 2FX3A 1NBMA 2J46A 5JC8A 2EKBA 4P4UA 1QR2A 4QTYA 2OHIA 4WY8A 1K6IA 1T9ZA 3H2JA 3N0VA 2DWOA 3UB3A 4UQPA 1K7SN 3RD5A 3JYNA 3NIBA 3STUA 3UMJA 1UPCA 4UHCA 3OQ1A 2H2GA 5DHRA 2BGNA 4HRYA 2BY4A 4YAGA 3H6GA 1MHTA 3AFIA 1X1CA 2N0SA 2ZUCA 1LI5A 3AKEA 1Z26A 2HMWA 3IGFA 3LHDA 2QP3A 1I01A 5E4TA 3RFFA 3BFXA 4HYYA 1RWKA 3UENA 1TC1A 4DPMA 5KHLB 4DV0B 1I3NA 2BZ1A 3FFTA 4QD3A 4BFWA 1AGXA 1E2FA 3M1AA 4JK3A 4TXJA 1Z4NA 4X1YB 1MDBA 1YE3A 4RUKA 2OQ2A 4RTJA 3R5XA 3TTXA 2E82A 4C7XA 3QYAA 3FNIA 4X1YA 4C08A 1O9HA 1WMEA 1JYEA 1UBUS 2WKWA 4WBXC 1AUVA 4YRDA 1XN1A 2J9RA 4JX8A 3QKUA 1QF9A 3BEOA 2JGLA 3AHCA 1Q12A 2VHQA 4XI9A 1HORA 1JX6A 4ABYA 2WMDA 1DWUA 4ZI5A 4BVFA 1CF9A 1C4KA 4MR8B 3HBJA 3UWOA 4D5EA 4DGQA 3UKOA 4GT1A 3ZZMA 1UKVY 5ILQA 3EXFB 4EYEA 1WCWA 2EEPA 5J1TB 5TT1A 4J7XA 4FOSA 3FOWA 5CNJA 3TD9A 1DXYA 4O08A 3RVMA 2YDYA 4EABA 4RK1A 4HWRA 1UXKA 4B9EA 4RA9B 3I58A 4JB8A 1JJFA 2RD2A 2G4CA 1C30A 2K2QB 1ETUA 3I9KA 3V8PA 1O95C 5T6BA 2YXDA 3V2IA 4Q5IA 4ZIRB 1JHRA 2J4DA 4B47A 2ECQA 3C6BA 4FDAA 1B7GO 2PEZA 4JEHA 1KAOA 1F48A 2H4JA 4QT0A 4NOLA 2DBRA 2VXBA 1OIXA 3QU4A 3EQ2A 2Y9PB 4CPDA 5IJ9A 1BMQA 2J0UB 3MOIA 4LY6A 1WZCA 3PTLA 3L7JA 3H3JA 1RQXA 3AERB 3G1WA 2A5YB 3IQWA 5AHWA 1GZ5A 3ITKA 1Z6PA 4KQIA 4BECA 4ENUA 4IVRA 4YCBA 2CLSA 2CNKA 2NUPB 2ZIEA 1OU0A 2Z5LA 3MB8A 1K6EA 4LCJA 4R2MA 5EFZA 2VUIB 3T56B 1VGVA 2EX4A 5ADVA 2OT3B 5TQ2B 2RIPA 3HU1A 4INJA 3IIEA 1TJPB 3LQYA 4KXVA 1CVIA 3NHMA 4MLZA 4OOEA 2J1LA 3LHIA 1XZ8A 5MFZA 1OPXA 1K0UA 3QQPA 2NVUB 1CP3A 1UIMA 3CUYA 2YZ7A 1TEXA 1F4LA 1MB0A 3OJFA 3Q5GA 2JLZA 1JHAA 2CXXA 5AD1A 4LZWA 3JCZA 3DPSA 2HDNB 3KOWA 4ARCA 4B33A 1KMQA 4YROA 1Z0SA 1YI2B 4OSPA 3CJTA 3FNGA 1V8PA 1GTL1 2GJ9A 3CF2A 3VNAA 3TXYA 2XVYA 5A05A 2FZ4A 4CQMB 4FZ3A 4J0QA 2BGKA 3N8KA 4MYDA 3V34A 2ISQA 2OCDA 4E4RA 2HK7A 4K9RA 1NLMA 5C2JB 5KWEA 3KK0A 5AK4A 1YR1A 2GEKA 1H0KA 1OA1A 4PSAA 5ENZA 3IV6A 1ORDA 5IH3A 2EAUA 6GPBA 2WB4A 1D2CA 3G89A 3M6IA 3OPYB 4JC5A 4WZZA 4E1BA 4HNVA 5L3SB 1T5EA 2DSTA 2FDXA 3AY3A 1GTZA 1XZNA 2VDNB 5AI6A 5EWJA 5CYOA 3C97A 5JVDB 3H8JA 1P6XA 3SS9X 4AK9A 4CQLA 4NKRA 2G0NA 1YAHA 3MJTA 4HEJA 1G66A 1T9BA 5AESA 1ESDA 3ZVLA 4X97A 4EPVA 3CWCA 1RPNA 3KR1A 3Q3JB 4YELA 1JEOA 2XEDA 3MRSA 4XJXA 2DTXA 2YV1A 4R2JA 2RJNA 3B2EA 1DEAA 5HZBA 1GR0A 1XXHB 2E89A 3ASYA 4ID9A 4Z1MD 4LZAA 3DUWA 1M8PA 5B7GA 5IANA 2OMEA 4XOIA 4LRTB 3RYCA 3D8BA 1SC3A 1P7ZA 4JXJA 2J59A 3ILXA 5DBHX 3TJRA 1KEKA 2EJBA 2VPWA 4TSKA 3X0DA 2BSQA 4YO7A 3PQ8A 4MXDA 4X91A 1LQTA 2P9BA 2NWQA 5COAA 1RJEA 3D8RA 4GOXA 3K1YA 5IMBA 1WW8A 2SNIE 4CR8A 2VWGA 3GROA 4RO0A 4BLPA 1HFWA 1EK2A 2VNIA 1E3DA 1P2DA 4ZWNA 4CU5A 4D9KA 1ZUHA 1Z2OX 2OO5A 3CCJB 4U2CA 2EDCA 2QRGA 3RS3A 5C8YF 4D9NA 1XVTA 2ZPAA 1EFVB 4TTIA 3MGCA 4WDRA 2IYOA 4XWWA 2BRUA 2QQFA 1R0ZA 2ISCA 3T12A 2YV4A 2AFHE 4DWOA 5GADl 4CM6A 5JBNA 1NNSA 3AVVA 3Q88A 2PT9A 4WOKA 1J2EA 2QDKA 1CIVA 1HE4A 4GF5A 5AKZA 2P0AA 4HJXA 4RZUA 1NJ8A 3RBXA 4YQYA 3AB8A 2XGOA 3PPVA 1YQEA 3RPEA 4KR2A 2IX9A 1WQ4A 2RBEA 3DONA 4B48A 3IDSA 2P6MA 1EX7A 1GTVA 1TO2E 3AEXA 3GCDA 3K5HA 4M1EA 4Q01A 421PA 3ZHUA 1Y4DE 1T6NA 3DHEA 3E22B 2AFIA 2GHRA 4RDHA 3JS5A 3KYDB 2AMVA 3DFKA 1ZJYA 4MW9A 4N7RA 4Y9UA 5DTEA 5LDGA 3ZH9B 4YS6A 2Q49A 1B0ZA 2H0RA 1YS4A 2IZ6A 3FF1A 3BXEA 3IQDB 1XB2A 4E2FA 1HE8B 4AJ4A 1GZDA 4LXXA 1NATA 1KS2A 3V7FA 1SHUX 2BUBA 2Q3MA 3BMCB 4TTVA 4FKMA 1LPBB 2H4FA 4Q3EA 3E20A 1P2FA 1A2KC 4ZQHA 1GEGA 1MQSA 1QHYA 2A67A 2FUCA 4HPXB 4I9GA 4R8LA 4UCQA 3OIYA 4D3XA 4EHHA 5CJJA 2VJNA 3ZJYA 3IAAA 5CURA 3STWA 1CERA 4F5EA 9ABPA 2D7DA 4W8GA 3S2IA 4FFWA 2RSLA 4MWGA 1V5VA 4MRRA 1SXGA 4Q3LA 2PX8A 3IILA 1X77A 1Z5WA 1E2UA 4HZUB 3TI7A 3I32A 5CITA 4M1YA 3U81A 2GCEA 2ZJ6A 1XMQB 2D74A 3IMCA 4YNBA 1P3DA 4FJ2A 3TL3A 1L7QA 4MHSA 1QFSA 5FBKA 1VXRA 3RT1A 1CIJA 1KYIA 2VPTA 1C14A 2ETXA 2VZ9A 5I9MA 1PI3A 2G25A 1N5KA 2LCIA 2OCXA 2ON6A 4KLZA 2V7QA 1DHTA 4JEMA 5T4FA 4F56A 1ZKMA 4A92A 2XQVA 4H6XA 2FUNB 5FEMA 4IEFB 2JHGA 1RPJA 1OV6A 1L5OA 3ZWOA 3GY0A 3A31A 1QUFA 4U0JA 4XQ9A 4G4GA 4HE5A 1B0PA 4GH5A 2Q4EA 5JADA 3HUFA 5BV1A 2HWYA 4PS0A 3ZCXA 1KEWA 4RVSA 3VR2A 3ZEAA 3IVGA 1TTHA 1F0KA 3KSBC 3BBLA 4DLRA 4UHEA 2B1RA 2IUEA 5G3YA 3WMXA 2OFXA 2WJ4A 4DSZA 1VHDA 4YLEA 4RDKA 3C3KA 3Q41A 2FQYA 3Q1LA 1ZA2A 4HH0A 2ZITA 4NNJA 2NXWA 2FEPA 4IF4A 4PPGA 1NB0A 4DQKA 4XGNA 3WAJA 4FQ8A 4D4JA 2PZGA 2PFKA 5THKA 1TRKA 4N41A 2FGJA 2ANCA 2H1CA 3TLXA 1HE2A 3LWNA 3HRKA 4Z0HO 4B84A 8LDHA 5CA0A 4YMUA 1F8GA 4U2KA 4MUKA 2C03A 3LVFO 5KNBD 2AV6A 2ZUBA 3K4PA 4LFBB 2GZSA 2LZ0A 3PNVA 4IDGA 4PPNA 2ACVA 1IMJA 4DCJA 3BHMA 1WXEA 4RULA 5J4VA 1Y3CE 1EB8A 3V76A 1PDOA 1XHLA 1ABEA 3AKCA 1GPJA 1I2CA 3OX4A 4HDNB 4MQ6A 2GZAA 2ZYUX 2Q62A 1LU9A 2MR5A 3OIFA 2B2XA 2JCSA 3PDHA 2F8MA 2VSFA 2Q3FA 1ND5A 1ULUA 1SD1A 2EFHB 2I6XA 2X0NA 1MGPA 4U0KA 4YK7A 5LZ5A 2VC2B 3UJ3X 5L4LA 4Q1AA 3F1KA 5HOEA 4YAFA 3D5TA 5AIBA 1CBUA 1RAGA 2D2IA 2E7ZA 2YMPA 2ZTMA 4HB3A 3L8EA 5CPFA 3TQIA 5IJ0A 1UOPA 3QEOA 1S2NA 4DK0A 3EXHB 3WSTA 5AI4A 3WYFA 5DM70 4V0NA 4EJSB 1M67A 2L82A 4NOMA 3RO7A 1FS6A 4KP7A 2PLAA 1S1CA 2IYVA 3JRNA 3ADDA 3U60B 1M74A 4OBBA 3T7TA 2XR1A 1Y1PA 4N0DA 3IDOA 3NX4A 1LPOA 4U1RA 2YHIA 2YCBA 1LV8A 3IEVA 4LGCA 2R6GA 2HRCA 1DT3A 4US2R 1F9AA 2DRIA 4I46A 2RE8A 4MV7A 4QE3A 1C8KA 4DANA 3G5LA 3H04A 2UYOA 4P4SB 2HCJB 2W2LA 3CR8A 5ED0A 1I4DD 5EZ5A 2X86A 3WBBA 1UH5A 2HEGA 1CDZA 2A5JA 2JIDA 3NH9A 1BXRA 4H08A 5LIRA 2CF5A 2RCNA 3S2YA 3IP7A 3T4EA 3U19A 1TD9A 2IUTA 4RF4A 1AZWA 2HHAA 2W8BA 3H83A 4KR0A 4FVTA 3USES 4ESOA 2YKGA 2O7QA 5DNDA 3B1XA 4QOIA 5K0ZA 3ORYA 1VL6A 3KKOA 1EFDN 4NYIQ 4JKIA 4IIJA 4F60A 1U9CA 5C5DA 5KYXB 3VSDA 1QPZA 4BU0A 4QAJA 1CJUC 3S1SA 3ZWCA 1U98A 2FXIA 5BUSA 1QGUB 4QFMA 4ND7A 1W2HA 3KM0A 4HXEB 1RRCA 2AWNA 2J3DA 4MYUA 2ZDHA 3LD9A 4M54A 4ZT4A 1WVIA 3MCTA 3I1JA 4NZZA 1SKYB 4KU4A 2VOJA 2FPPA 4JBNA 3CLTD 1AD2A 3FOFC 3K2IA 5ESDA 2IHYA 3ENZA 2W2TA 1PGQA 1V4BA 2NZJA 4KN5A 4Q12A 2VXOA 1HZEA 5EQDA 4F4IA 2PLNA 2QM8A 1I8TA 4QHSA 3G9XA 2HSEA 4U7PB 4CKYA 5HXAA 4MVJD 1XL1A 4X3OA 4UMEA 2I3DA 1OPRA 1RVV1 1PJZA 2FG5A 3N7UA 3NUQA 3VR0A 4FNOA 2JIQA 2QORA 4HH3C 5BVHA 5IFLA 2C5GA 2E1RA 1WW3A 3ZI7A 1NSFA 4LUCA 1ZRHA 3I0ZA 2ZAOA 2IYFA 3ZN2A 2R7KA 4FIZA 4C4YA 3RYFB 2KM1A 1XTQA 1NOKA 3V42A 1E6MA 3ZWBA 1M5TA 2RH4A 1MAVA 3PXAA 1PG5A 1ZN9A 3HJBA 4HDCA 3NRBA 4AMVA 3WLAA 2B7LA 1A72A 3U7RA 4WBNB 3AF4A 3IIMA 2B94A 4ZHQF 1DDGA 5I5GA 4PABA 2YWCA 3BQ9A 3LIPA 4TLMB 1JZTA 1SXJE 1SZPA 1VL8A 4XOUA 4LJLA 5AKHA 1NWCA 3FB1A 3P9XA 5K3SA 1ZR4A 3ZQ4A 3O92A 5C8YB 1YC2A 3CRQA 4Q3KA 4BX8A 4E2ZA 4YV0A 2G4LA 3QU7A 4XVQA 1SUDA 2YVLA 3N6VA 4JA2A 3G8CA 3GK3A 4LGVA 5EE5B 1E1NA 2NZ2A 3C8MA 3SR4A 4ILEA 5FYQA 4WPGA 3UOWA 3P71T 1P7VA 2XT0A 2O8EA 4J2HA 4JJEA 4M7WA 1GUAA 3DAFA 4ZGNB 2V7EA 4JP1A 4AJOA 5JSZB 2FH5B 3BJZA 3ESDA 5G1NA 2NQTA 4WXRA 4JQSA 5T3UA 1FRZA 1POXA 5G4LA 3WYNA 1T34A 3TQCA 3ZDXB 2O8DA 1Y7IA 2C88A 2HSZA 4O5OA 3HU3A 5HPYB 1SB9A 1JSXA 2A3NA 4WK2B 5F5NA 2YH2A 4IY1A 2CZQA 4R16A 1RZRA 4WZKA 1G2IA 3A6PC 1T2VA 3TW8A 3DPUA 4EELA 3PUNA 3VNUA 2H7XA 1ESEA 1G16A 4GPZA 3HNOA 4LOIA 4GVLA 3IBTA 5ICFA 3OJEA 5B4VA 3TAHA 2GZDA 3EVFA 4RY8A 4AG3A 1K8YB 1CRZA 3DVLA 3M1YA 3L0PA 3GRPA 1OTYA 1R8SA 3RK4A 3WE7A 2E4YA 3GNQA 1QCZA 2TECE 4M9ZA 3GMDA 1O6CA 2P2GA 1RT9A 3NJ8A 1T9AA 2GVDC 5REQB 3B6ZA 4EUSA 3N0TA 4WCVA 5JO0A 4WKNA 4XDYA 4O1IA 1H2ZA 2Q0SA 3QVXA 5FA8A 5ALDA 5JCPA 3EA5A 3RS0A 4DWJA 1JG4A 3UMMA 3FWPA 3M9XA 3NEYA 4XTRA 5DU2A 3RGWS 3VNBA 4D97A 1UJ2A 5K6TA 1Y7TA 3IUNA 2IYEA 2XUFA 4CLXA 1UBSB 2GZ3A 4D41A 5DNUA 4KI0A 3B38A 1FQJA 1K8QA 3IAUA 3L6OO 5FH9A 4U3JA 1Y3FE 1JHDA 1MB4A 1J4AA 4CG2A 3AOEC 2ZIXB 4UM5A 1OB2A 2CE7A 4NQZA 3HJUA 2EP8A 3RKRA 3WK4A 2UVPB 1PJ3A 3LBYA 3JZIA 4Q4JA 4HXYA 5D8DA 5AW3A 2P6PA 2DBZA 2V6MA 1IZ7A 2XAUA 3MQ4A 3VU9A 3I39X 2VRBA 1TPYA 2CJWA 3IJEB 4WA7A 2ODWA 2BP7B 3MGBA 4ZU6X 3RUIA 2FETA 4NJEB 2V3CC 4W5NA 4DTIA 3RARA 1O97D 3DHYA 4B6JA 4JQCA 2ZB8A 2WJHA 5D3MA 5ED4A 1ZD2P 2FWJA 1HGXA 1PQPA 3EUFA 4MX8A 1T2FA 3OIGA 3REFA 2SECE 4V24A 1APBA 2GREA 4ZV4A 1CRQA 2X15A 5LA6B 3RC2A 4HC4A 1TM3E 3AUAA 4XIYA 3H0EA 3O8CA 1L4FA 2DX7A 1PRYA 3GJ8A 4PC6A 3R7FA 1DAEA 1MB3A 2HYDA 3QX9A 1QAMA 2VH5R 1DSSG 4LDQA 2RKOA 3SSNA 5EJMA 4ENPA 1P62B 3U7HB 1WHTA 3O90A 2H85A 2AB0A 3DP7A 5L3QB 1T0PA 4DSUA 4DR7B 4KQGA 4NZNA 1WZIA 4I3FA 1JLSA 1DARA 1HZZC 2VDLB 3FA2A 4RVFA 4TLCA 5D86A 1GUFA 3RNLA 5AR1A 2WPNA 1T6XA 1KOLA 3BMNA 3BOSA 3MCVA 4LI0A 1I6LA 3LT4A 5DEOA 2R1TA 3R7LA 5AW2A 2P9JA 1JS1X 4ZQCB 2RBKA 1OZFA 4UTZA 2CNDA 2VCEA 2X4DA 2ZU6A 3O73A 3H9GA 3I9V6 3O7WA 1CJCA 2ODPA 3PUJA 4H7IA 4CV2A 3IUMA 1DAPA 3RVKA 3HWRA 4FFRA 4QEZA 1G7RA 3TZBA 4DMFA 3EXHC 2GZRA 1W19A 3CZRA 1TMYA 3JAKB 2GN0A 3DTVA 5AVUA 1ACLA 2NO6A 3KOYA 3RU3A 3S4YA 1QFYA 5A4DA 4P35A 2HQBA 2QLTA 2VZ0A 3H2IA 4PFSA 1RYBA 5LQUA 3OQIB 5JAZA 1HETA 1P8AA 4Q66C 4MSUA 1CIPA 3CKMA 3W4IA 1Z6ZA 3E8SA 5HIJA 3CO5A 4LKRA 5H83A 3SYRA 4I50F 1KEUA 5D2CA 5IHXA 4PC7A 1PTKA 4Q7JB 2BTQA 4QECA 2CY0A 5FP0A 3ZLJA 4N3GA 3VPFA 2NPOA 3DDOA 3GC6A 3RCBA 4LJ6A 3T5BA 2DAPA 3IODA 3OY7A 1MRNA 1U8AA 1BU5A 1Y1LA 2AEFA 5IM5A 1IH8A 1KZ4A 4L8GA 2OHOA 3P9RA 4Y6GB 4BKRA 3BWMA 1W0JD 4MP8A 4BO6A 2JI4A 2WIBA 5JWOA 1H8ED 2GK6A 3FPKA 1N6KA 1XHFA 2ZIVB 2Q9CA 3DKIA 4OGWA 3PFNA 4TYMA 5A2GA 1BOFA 3TX2A 2WSMA 4E5NA 4S3MA 4MUEA 4YT8A 3IMFA 3I52A 3WV4A 1EDOA 3LC2O 5ECGC 2HM7A 3SGLA 2PH3A 4HDOB 4E3ZA 4C6TA 4E3WA 4FZRA 1PGOA 3IC5A 1XWFA 1F6BA 3PCTA 1O5IA 5CHYA 2LXNA 3QGMA 4D99A 3NUGA 2OGWA 4L5YA 1EQ2A 2UZAA 3CLUD 4ZVVA 3URMA 3SHVA 3BL6A 3MWEA 2QZJA 4OI1A 5CB4F 1XVUA 3DDUA 2PT6A 5ADWA 4ILKA 3EXG1 3ZCPA 1KDZA 2P75A 2B99A 4DHWA 4YAIA 1A88A 5E1MA 3SVLA 5IZCA 2ZJYA 5IVKA 3G6KA 4I5FA 5I8PA 2JVIA 4F9TA 1V16B 4IGEA 4DBVO 1DIOB 2H8KA 3L6CA 2HTFA 1MEOA 3BH7A 3GDWA 3ZW8A 5CDSA 2HU2A 3Q15C 4TRNA 7YASA 2AT1A 4B2PA 2CHGA 1MIOA 3HVJA 5L40A 3D59A 2ZZGA 1EAYA 4D9IA 2P91A 3L4KA 3NKFA 2X0DA 2GZHA 1KYVA 1ZSNA 4ON9A 4QGGA 1SBYA 1ST2A 4MO9A 4P36A 3RFCA 3TBKA 1RNLA 4G9BA 2Z6QA 4LRXA 3OTGA 3IVAA 4E08A 1Z37A 3HR8A 3W78A 3U0BA 3TL2A 2HSWA 1R0WA 4BYMA 4FFPA 1OKKD 1SK8A 2HV9A 2Q6TA 4BMZA 4IRMA 1DTWA 3MYYA 4NI5A 4DJTA 4AWBA 4JEUA 1MO3A 1X42A 5AHXA 3ZHSA 3SR3A 3T3OA 3CUKA 3Q6IA 4B3JA 3PS9A 4D4HA 2HADA 1Q86D 1BXGA 1EK5A 4Y0AA 2O2SA 2NTNA 3WYBA 1I0IA 3AIMA 1T43A 3M34A 5MGNA 3UB4A 4JSRA 4AY2A 2KVOA 1T3ZA 4OYLA 1NJFA 4B17A 2OXCA 2G80A 1M1YB 4YJ2F 1CE8B 1VKNA 2OSBA 2A0UA 2YXBA 4ZVMA 5K20A 1UADA 2GPTA 4PNZA 2ZYWX 1XAHA 1P75A 2CD7A 5D6NA 1GAXA 2ZKLA 4KDFA 3HNPA 1FYWA 2PTGA 1HFJA 2GFQA 1XMVA 2H1FA 5IUKC 4ZJUA 1R5OA 2GPBA 3Q0IA 4D4MA 4HT3B 5K09A 3AP2A 2IY9A