4RD6A

Structure of aif2-gamma from sulfolobus solfataricus bound to gdp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
414
structure length
405
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 110
structure length 405
sequence length 414
ec nomenclature
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4rd6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4rd6A01
3VU9B 1K5DA 1N6OA 1Z22A 4RZUA 1RPZA 4QHTA 4TMXA 2OTLB 2W6IA 4IVPA 4LV5B 3CNOA 1AQUA 1WF3A 4JLPA 4DCVA 2HXSA 3WYGA 4WZAE 4WQMA 3LD9A 4B43A 3FMPB 2AHOA 4QM7A 1XJCA 4J0QA 4V0NA 5SZIA 2J0UB 1CR1A 2C95A 5KSOA 4Q01A 1XTQA 1EP2B 3K9GA 4Q1FA 3GJ6A 4IDPA 2GF9A 2ZUDA 1N5KA 3MJHA 4JIMA 1BIFA 3CRQA 1GAWA 2BJWA 3LVBA 3NG1A 1RJ9A 2ZRLA 1D9ZA 3C5HA 4A0HA 3QPWA 1ZRHA 3GMTA 5FTMA 1YHNA 2ZI5A 3WP1B 1JA1A 1OXUA 2NMVA 3W2HA 1ZC3A 3CLVA 4I1SA 1J99A 5D3QA 1SVOA 4F4IA 4YAWA 1W2HA 1XU4A 2ZTSA 2G1JA 3C8UA 5H5JA 3NH9A 2VBCA 4QJ4A 1M7GA 5J47A 2D2EA 3KQNA 1U0LA 3WP0A 2F1JA 2RGNA 5BYJA 1GTVA 3CCJB 5H8WA 1IY0A 3RHFA 1QZXA 2CL6X 2F43B 3B1XA 4JLJA 2ZRMA 3AVPA 1TF5A 4GOKA 3CBQA 3I56B 3T1TA 5TV2A 3HR7A 3EZ9A 4IOMA 2H7VA 2DB3A 4QKQA 5FPKA 1NVUQ 2QQEA 2F43A 4LJ6A 2FFBA 5LB2A 3CW2A 3SYNA 3NVAA 3BB1A 3TUIC 1OYWA 2RB4A 2N1BA 3CONA 1XJ0A 2C2HA 1T5IA 3GLHA 1P7CA 3IBYA 5AN9A 3FMFA 5G3YA 1F20A 2VPPA 4R71A 2GWHA 1T5LA 2XB2A 4LJYA 3AUYA 3GLFA 4PHTA 3M6AA 2P5TB 3BWDD 3UWKA 2CE7A 3QQ5A 4DQLA 3EPJA 4AY2A 2JGNA 3BBPA 1M7HA 2HXYA 1S1CA 5DGXA 3W34A 1NMZA 1W87A 2V9PA 2WWWA 1SVWA 4DQKA 2OHFA 1VG8A 3EWAA 2I1VB 3FHCB 3BB4A 3C7KA 1FZQA 1LFDB 5C4GB 5JSZA 3IO5A 2X2FA 2A7QA 3CR7A 1JR3E 5DYIA 4M22A 4WXPA 2ZYVX 1NLYA 3I3SR 1K6MA 4Z1MD 1N2CE 4KBFA 2FX3A 1CTQA 1ZVQA 1E9RA 1AGRA 1NVWQ 2ERXA 4FWIB 2QL6A 3EA5A 1VQLB 1KI9A 1WMSA 2H8KA 1VPLA 4PGOA 1VHTA 2HJGA 1J90A 4H9GA 2QGNA 4Z1MA 1VKJA 2XEXA 1TEVA 3W6OA 1AS3A 1SQ5A 2ZRPA 1NI3A 5F3WB 3DPUA 1FP6A 3IHWA 4URWR 4UXJA 1YITB 1R4AA 1ZYUA 1E32A 5DNYB 3K1JA 3KZ1E 4EFMA 1QFYA 2ZR9A 2VP9A 1XF9A 3QSYA 3KFVA 4Q1BA 1TUEA 721PA 2GZHA 1AKEA 3VNUA 1MO3A 2MSCB 4WW0A 1WCV1 4JSYA 4TZ6A 2ZU0C 3Q8XB 3AP3A 4NZYA 2CCKA 2OO7A 4JLVA 4KBGA 3RANA 2WWYA 1GAJA 1UKVY 3VX4A 1S4QA 3OEHD 3B7GA 4KITB 3BH6A 3W5IA 2ANCA 5HE9A 3VHXA 5KPDA 3L8YA 3OEHA 1JJ7A 2ZAOA 1II9A 1XMJA 4PHFA 2RGNC 4ARZB 5GVSA 3KKMA 4OQLA 4PPGA 5DH9A 4OQFA 2V6IA 4WZBE 1Z2CA 5FR2A 4DIEA 3UPUA 1K9MD 1GVNB 3AF2A 1KJZA 4FK8A 3QIAA 2CVHA 1Q21A 4BLPA 1HE8B 4CGZA 4W5WA 1Q86D 1OH8A 1DDIA 1GR1A 2WJJA 2D4HA 5IDVA 5A4JA 1YZNA 1NG9A 2O8EA 1FL9A 2W83A 4L8GA 1D8TA 4DDUA 2VP2A 4XOIA 4AG5A 1MO4A 4LC1A 3GLHE 3G82C 1CRPA 5GJBA 2IYRA 3SQXA 3L2OB 4Z8YA 3NXSA 5CYPA 4PPQA 3SI7A 1TU4A 1G4AE 3D3QA 3UWOA 2V3CC 3GLFE 1Z28A 3G71B 2QP4A 3EZFA 4V0MA 1JB1A 1CP2A 2C9YA 4KCGA 5HXBA 2WMNB 1RIFA 3IGFA 4GZLA 3AKEA 2CVFA 4P0TA 1P9RA 2ZYTX 5HTKA 1G8PA 2V1XA 2BMJA 4OHXA 1JBKA 1IN8A 4F38A 3FOZA 2QORA 3CPEA 2KJQA 3U3JA 3UG6A 1YJWB 3W6PA 5FPTA 5TVKA 1ZW6A 2QQ0A 1GITA 2PH1A 4G1VA 3ECCA 1NBMD 2NGRA 2EIXA 2YC4C 4CT4B 1E2LA 1T9HA 3ZQJA 3OIYA 4JLBA 1P6XA 4HUTA 1NBMA 1DO2A 1T0HB 2JAQA 2CDNA 4DCUA 1F5NA 4E07A 3MG9A 3M0EA 4HDQB 2H57A 4HLUA 3ZD7A 5D3MB 2DWQA 5KNBA 2OAP1 3OJWA 2NPIA 4FCTA 4Q4HA 4UNSA 1KI3A 2R6FA 1ZUIA 2FDCA 3OZVA 2OM2A 1ZD8A 4IXMA 1FPMA 1KKLA 5JJLA 4JKIA 1DTSA 3UK6A 1QFZA 2BMFA 4KVAA 4IFBA 5THXA 3GJ7A 4A36A 4B3XA 3DMNA 5EP4A 1F60A 1Q20A 3QF4B 4NONA 2FN4A 1KZ7B 3W90A 1LY1A 3THXA 4PAOA 4XWAA 5CK4A 1HUQA 4Q5IA 1S2MA 3BXZA 3DKPA 2O0JA 1GP2A 2NZJA 4M0LA 3IPXA 2R65A 4EUNA 1COWD 4MKIA 1CNFA 2W2VA 4AI6A 2CNDA 3OIVA 1NSTA 2XX3A 4B2PA 2OZEA 4MYHA 4XIGS 3UXMA 1COWA 2XZOA 4BLRA 1RC8A 2YWEA 4AG6A 1IN5A 2ZS8A 3CNLA 1E94E 4Q00A 4MITA 2HLDD 4ABYA 4H1UA 3AVOA 1IONA 5SZHB 2BKEA 3W2FA 2JLZA 3PEYA 2WAXA 5JHHB 1KJWA 2OCYC 3U5ZB 3BRWD 2HLDA 1X8LA 2G0NA 4DSOA 1DAGA 1P9WA 5TMPA 1WDTA 1E69A 2F9MA 3DDCA 1WBBA 1N5LA 1KD1D 5M04A 3ETLA 4XSGA 3CRZA 3REGA 4OHZA 5F98A 4JS0A 4FMCB 4M21A 5AJYA 5BWMA 4DLUA 4US2R 2QPAA 4A0RA 1B2RA 3TBKA 2DFKB 5B57C 4D4JA 2OUKA 4QHSA 2VL7A 1QRAA 2ZI9A 3N2EA 4V0ME 3BFVA 1II0A 3N2IA 1OV4A 2LKDA 3U60B 1T6NA 2BF4A 2GJKA 5C18A 4KJZA 4HLQB 4QJ5A 3EAQA 5C1BA 1HURA 1G3MA 2DPXA 4HUQB 3Q5DA 2SHKA 4MYTA 2Z0MA 4PO9A 1CR2A 3EZ7A 4WZ6A 4DCSA 5LD2B 1LS6A 4EPYA 3AF4A 1Z6GA 5L3SB 2B92A 3NKVA 1KIMA 2NO9A 5EUQB 3BH0A 4AF7A 4LHYA 4P31A 1KO4A 4BQSA 5JEEA 3DKVA 4HUQA 1G3IA 5FL3A 5JHGB 3LBNA 4NYIR 4D0LB 4CEIA 2DR3A 5CDFA 4LJ9A 1NBME 4V03A 4KFTA 1F3OA 3B85A 4BFYA 3K8YA 4KFSA 3LW7A 4TZ0A 2ODBA 4G3XA 2FEOA 2VIIA 2HCBA 4HLUC 5G3ZA 4M9XA 1QGAA 3W5VA 2CJWA 1SXJD 2IL1A 4R2IA 3NIBA 3MAAC 4PZLA 1R5OA 3ES9A 1E2HA 1FMJA 1T0JB 2ATVA 2WWIA 4MYUA 3LBHA 1GKYA 1SXJA 2ZITA 2EWVA 1JQJC 3B1ZA 4Q47A 1YJ5A 3FB4A 3W8RA 2DYKA 4Q9LA 3IIMA 4TLDA 1UPTA 4JT4A 1VDZA 1E9DA 4Q21A 1E2QA 3REFA 2O8DB 3A58B 3RAPR 3AUXA 1U99A 1QBKC 5J4LA 3AF0A 3S1AA 4U02A 2A5GA 3AVQA 1E63A 1E62A 5EP2A 1FRNA 1FX0B 1RRFA 2ZRNA 4Y0VA 3SHWA 5JJIA 4CZ2A 2XXAA 2ZSAA 4DLSA 2PJRA 3RRNA 3Q7PA 4AKGA 1EG7A 3QVUA 4M1SA 2JDID 4KO8A 3SJAA 2QMHA 1HTWA 1FX0A 4GP6A 4C9BA 4MDFA 4XSHA 2CEAA 3LLUA 5GVRA 2O8BB 2JDIA 2DWPA 3K9HA 4BFVA 1GWNA 4JLOA 4L16A 1XPRA 5BN3A 1UJ2A 4DLRA 1SVMA 2HYIC 3AP2A 2C77A 4LHVA 4MUBA 3MRSA 1JJ2B 3RS4A 2XJ4A 1H65A 1BYIA 3CKLA 1E2EA 4PC6A 1Q0UA 2B6HA 4QGFA 2ZE7A 1XZQA 4IW3B 5CJ2A 4M9QA 4P3YA 1KK2A 4TMVA 1ZUHA 2FSFA 1G6HA 4RFVA 4UAJA 2AWOA 4JL8A 4B35A 4D2IA 4F7WA 1PZNA 2RC5A 4RD1A 4ZCMA 3AKYA 3GJ8A 1JAHA 1U0JA 3GEEA 1AQYA 1ZAKA 1F48A 1ZU4A 1XP8A 3ZZ0A 1G18A 1U81A 3CB4A 2GVZC 4NYJR 4QC2A 1S0UA 3NBXX 4LJ7A 2IS1A 2I1QA 4N0DA 2EYQA 4ZKEA 2F6RA 3MWYW 5JS8A 1RKBA 4DCTA 2GBLA 3IHLA 5FH9A 3B13B 4TMKA 4RFSB 1WXQA 4YDHB 4IDOA 3KUCA 5C2JB 5EE1A 4X8LA 4OQXA 2IEZA 4CIDA 5KDLA 3ICEA 3MWKA 3W5HA 4HB3A 5CDFE 4Q9JA 2IYSA 2P2LA 3IKJA 3PENA 1F6BA 3I92A 4GBMA 4P4SA 5F9HA 5EE9A 3GLIA 3B82A 5EXTA 4G1UC 1UKZA 3C4JA 2FWRA 3DVLA 2FE4A 1GUAA 1ZNWA 1W2BB 3KB2A 1SXJC 1Q44A 2D2FA 5B30A 4R2HA 3O8DA 3PEUA 1EFUA 4M1KA 1J8MF 1UAAA 4LYAA 3I61A 1GVHA 2LWIA 3K70B 2ZI4A 2VLIA 3K0AB 1N6HA 4JJZA 3L0PA 2GZAA 4K46A 4AIIA 1SHKA 4BFTA 2XGJA 4G5OA 2FZ4A 4D0NA 4U9UA 4YXWD 4DB2A 4IVQA 4W5HA 3RWOA 1NKTA 3VR2A 2J7PA 3LBIA 5KU1A 3F8TA 3ND9A 2FF7A 3TGPA 1X1SA 5EUMA 2W0SA 4YXWA 3K0AA 3MWJA 2VSXA 4RD0A 4WXRA 2YINC 3B1YA 4DUGD 3THWA 4NBSA 1RZ3A 2NPFA 4XVRA 4A0FA 2NO0A 2OK8A 2R62A 5B64A 2GCPA 4Q7KA 2ZETA 2ZJ2A 1ETUA 1E4YA 2R2AA 2PMDA 5EXXA 4JVLA 4BE7B 4DUGA 2JLWA 2P0EA 3O8RA 2WIBA 3TSZA 4A8JA 4F93B 2PX3A 4DXAA 4IFEA 3GD7A 3QUSA 3SDZA 3EZ6A 4TT3D 2BMDA 4LPKA 1N8RD 2DERA 1X8KA 2ZSEA 3SNHA 4B3BA 3W5UA 4AD8A 4Q19A 1KNXA 5AJZA 4TT3A 3WMFA 4JLDA 4LK2A 2PZEA 2Z5FA 1XXHB 3BOSA 4NPHA 5FOTA 3IQXA 2CHVA 4I81A 2IUSA 2QBYA 3T5DA 3TVTA 4KV9A 4RSGA 3D6TB 4XD7D 3SJZA 1MO6A 2A2ZA 2BM1A 1XXHA 2ZE6A 4LYFA 4AYXA 4B6FA 1K73D 4V0LA 2GBLC 1E4VA 3CF2A 4US0R 1GFIA 1FNCA 3BK7A 4XD7A 2E1RA 4B2LA 4PSVA 1A2BA 2VRWA 5FPHA 2BCJQ 3Q7QA 2YHSA 1YVDA 2A9KA 4D81A 3WYAA 3A1WA 1PLJA 4AKEA 5L3QB 2RGDA 3B1VA 3CMEB 1RRGA 2XTZA 5FI0B 3DL0A 5CM8B 2A5JA 1A82A 1HV8A 2QSZA 2WOOA 2X3UA 2VTKA 1GSIA 1G3UA 1X3SA 4M1YA 1QF9A 1Z0IA 1KO5A 3AF3A 2F1RA 3P4XA 4YONB 2XAUA 1TVCA 3ZVMA 1YRAA 2VSOA 2XNCA 2C9OA 3DHWC 4EQ6B 4ITRC 2IK8A 2VNIA 3U2QA 1X86B 2NO1A 2HJVA 1IQPA 3WY9A 2PJZA 1SVSA 2OTJB 1QG0A 4C0SA 2QTFA 2O8CB 2FPMA 2X77A 4YALA 5GJCA 5E7IA 2QSYA 3OHMA 1X8JA 1BH2A 2ZRHA 3A4LA 5FUXA 1G9XA 1Y63A 2O8CA 5J4YA 3QXHA 1VMAA 4FI3C 2OG2A 4JKYA 2C9CA 5HZHA 1M7BA 4HAZA 4JZKA 1EFCA 4G1BA 3HPQA 5KSWB 1IY2A 1Q3TA 3QEOA 2VP4A 4TYQA 2XITA 3CX8A 4BPRA 3K9NA 3ZH9B 5FPSA 2C5LA 3AH8A 2F1HA 5EJEA 4FINA 2ZRBA 1E99A 2DWOA 4LGMA 4MGIR 4PX9A 4DT1B 2GJ8A 2IW3A 1N25A 4MRNA 3B78A 1AGPA 1Z0AA 2YOGA 4A8JC 5JLJA 4ZDKA 1SVLA 4PO8A 2OAQ1 3EX7C 1UKYA 1P2VA 2AD5A 3UATA 4JBWA 2Z6VA 4II7A 4ZIRB 3EG5A 1CU1A 4DSUA 5KSPA 3QE0A 4LBWA 2IYTA 2YC2C 4QGAA 1EP1B 4KYIB 3CF0A 3NH6A 5JEDA 3T1OA 4CRWB 4MKHA 1DG3A 1KSHA 4ZIRA 2IS4A 2O52A 4BLQA 1R0WA 3R7WB 1NSFA 2F3RA 621PA 4Q66C 4DJTA 4C2TA 1ZU5A 3L0OA 5H1YA 1D1NA 1GDDA 4Q4AB 1XXHE 3PUZA 4BRWA 1E2DA 4ZV4A 1NIPA 1SHZA 1R5BA 5FBWB 3RS7A 1KSGA 4UNNA 4OI1A 2C04A 2RGEA 4GDFA 1CLUA 2O5VA 3MWLA 5AUPB 4FXPA 1Q12A 2XNDD 5KNCA 1VQ6B 3NHBA 1G17A 1P61B 4C0BA 3ZC3A 2FFQA 2WAYA 4Q1AA 2B7CA 2XNDA 1XTRA 2GCNA 1L7VC 4LI0A 4P32A 4DVGA 5JRJA 1MT0A 4B3FX 4Z51A 1E2GA 1AN0A 4O0MA 3VAAA 3CCMB 3TUZC 1UEIA 1VQ5B 2HF9A 3Q72A 1FQKA 4PZZA 1K5GA 4ZI2A 3RS2A 1DG1G 1JXMA 2QTZA 2RHMA 3X1XA 4JLAA 2QP3A 4FMCF 4WAUA 2WJGA 1RJ9B 1VECA 3PUYA 5JS7A 1W47A 1W4AA 1ESNA 2C03A 1VCNA 2QZ4A 1FTSA 1R5NA 2JJ8A 4Q9IA 3KXKA 1VCIA 3OW2B 1LV7A 1S9HA 4F7DA 5A5GA 3ZVNA 4PO1A 4YLGA 3PG5A 4UNPA 2ZJBA 2ZJZA 3IDQA 5A0FA 4Y7CA 3WBKA 1S96A 5ELXA 4RD6A 4A9AA 3GFTA 1OJLA 4LSGA 4Q18A 1YZKA 2VA8A 3CH5A 2EFEB 5HZKA 5C4MA 1R0XA 3E1SA 5EE3A 3ND8A 4ZCIA 1ZJ6A 4XVQA 3KQLA 3V00A 3KQUA 1E2KA 1FNNA 2Q0HA 3EWSA 2HV8A 1XPOA 3T06B 3TH5A 4NTZA 1S72B 2B8WA 4QGGA 2BGIA 1GL7A 3GLHB 5KSZA 1NMXA 4ILEA 2PZFA 4O2LA 1XTSA 2AK3A 2WHXA 1OB5A 2QTVB 2PMKA 1Z6TA 3QY0A 3HJNA 1N6LA 1WRBA 2H16A 1A8PA 4ASUD 4C0HA 1UF9A 3GLFB 1EWQA 3U3OA 1W7AA 2XB4A 1N5IA 4E5UA 2CLSA 2JLUA 4PAMA 1IB0A 4Z8XA 4ASUA 2WM9B 2ZANA 1ZD1A 4XTRA 3R9XA 2JLSA 2KBFA 3FDIA 1PLKA 2WSMA 1S9DA 4RCYA 1XNJA 4ACBA 3TQFA 1ZMXA 3P20A 3W3ZB 5JSZB 1XPUA 1HT1E 4RKEA 4C0KA 2G77B 1SGWA 3QKSB 1OT3A 3ZGXA 4I4LA 1G8GA 1P2TA 3ZQ6A 3KL4A 1QFJA 4BEJA 4DDWA 3T1QA 3ZD6A 5DISB 2YOFA 4B74A 3P4YA 2IX3A 2OV2A 1G7TA 2DEUA 3QKSA 3JZMA 4ON9A 4HAYA 3PXGA 4C3ZA 3IPYA 4QBIA 2VZLA 3LDAA 1GG2A 2UZ3A 1DARA 1EWRA 2EWWA 5IT5A 4IKEA 4NCHA 2OFOA 3U7FB 3I4LA 2UVQA 1KGDA 3LXRA 2W6JD 1DAFA 3A1UA 2J3EA 3CNNA 4B76A 4DRZA 2FPKA 1E0JA 1NLFA 2GZDA 4OHVA 4LYJA 1AMOA 1A1VA 4EAQA 3OESA 1ESMA 2W6JA 5HCIA 2JJ1D 3MMPA 1Q1BA 1M8PA 3GFPA 2NIPA 2ZRGA 1I4TD 4URYR 4B33A 1VQ9B 1GRQA 4TN1A 1I4DD 4Q7JB 2JJ1A 5FTKA 2PX0A 5KUTA 4Q9KA 1ODFA 2IF2A 3W2IA 4B44A 2NQ2C 3FMOB 1W5TA 4DZZA 2QEXB 1L4UA 1IHUA 3ZS8A 2OT3B 4Q03A 4A1FA 4QBHA 4CEJA 3WNDA 1BYUA 5KPJA 4GP7A 2RAPA 3HWSA 4PXAA 1JALA 2W2XA 2XSZD 3G6EB 3I55B 1CNEA 5KO2A 3U6KA 2HEIA 3TKLA 1ZUNB 4BASA 1NN5A 4W7SA 1YE8A 3ZVRA 1YU9A 2RGBA 2XSZA 2ZR7A 4M8NE 1AS2A 4EIWA 2BGJA 1F2UA 3MGCA 1J8YF 1JJVA 3L0SA 3W9YA 1T3LA 4OBEA 2R8RA 2O8EB 2BPOA 2GXQA 2QTLA 2G1KA 3WMGA 4AURA 1ZM4A 4K1XA 3D31A 3AVYA 3UMFA 1HA3A 4CYMA 1GM5A 2J9RA 2C99A 2WKRA 5G40A 1DAIA 1HY3A 4EJSC 4X8MA 5JRZA 1KO8A 2WKQA 5DLQC 1P72A 2G83A 1NP6A 2QM8A 2QPOA 3NC0C 2Z4RA 1PVOA 4KVGA 5AUNB 4ZDJA 2RCNA 3GJ3A 4KHZA 4A2QA 4KSBA 3TUJC 5FOSA 1TQ2A 1H85A 2IYXA 1PUIA 1E9AA 3UANA 3NBFA 1QGZA 2ZI7A 3M1IA 2BMWA 3CO5A 3PJRA 3Q9LA 2VHCA 1TEXA 1E96A 1DOAA 3R9IA 2VHUA 3U44A 1XD2A 4IDQA 1J7KA 1Z47A 3EA0A 3PV0A 1YR6A 1AKYA 1H8ED 4M9ZA 4GL2A 2CL7X 2PLRA 2PCLA 2LCFA 3E2IA 1QHNA 4JYBA 3TR5A 4RKFA 2RGXA 4XWKA 1C9KA 3W3AA 3GP8A 2PL3A 2ONJA 1EFTA 2Z4SA 1H8EA 4RVCA 1EX6A 4Y9UA 3HP1A 3O47A 3ADCA 1QHXA 1DAHA 1UADA 3KJEA 1IN6A 1G21E 3H84A 1XD8A 2REBA 4YMSA 3OIUA 2ZSBA 3OZUA 4DSNA 4HAXA 2VYFA 1OB2A 3GJXC 3MUFA 4PQRA 2JLQA 3E70C 3GCGA 4Q4HB 1GL9B 1BOFA 3V9PA 2V1UA 4HSEA 3SFVA 1QG4A 4DLXA 3LX5A 5DHAA 4E03A 5EQTA 5FTLA 2E9SA 4TTRA 1CEEA 1UBCA 1US8A 4V0KA 5ANRB 4DCNA 1FMLA 1Z0JA 3I72A 1M2OB 5HR5A 3B9QA 1AJEA 3VO1A 2P65A 1GL6A 2J59A 2CLCX 4TLEA 1Z5ZA 2BBOA 4LJ4A 4HAWA 3TIFA 4DSTA 3THXB 1ZM3A 4RD2A 1E79D 3GLGB 2ZU6A 2DFNA 2ORWA 4G01B 4TL6A 4F4JA 1AM4D 2OILA 4B3CA 2ODEA 4WOPA 3SEAA 2BWJA 3AVXA 1E79A 4US1R 1PLLA 3AVVA 2JLXA 1Q82D 2VF8A 2KBEA 3KX2A 4UXHA 1E2IA 2QY9A 3GLGA 3RC8A 1CRQA 5GV7A 1E2JA 4TSFD 3WBJA 1M1KD 1D2NA 2R6CA 3T34A 3BORA 3RSOA 1QG2A 2WJHA 3BJIC 4TSFA 1LW7A 3CRRA 1W1WA 3Q85A 4ESVA 2Q3HA 2WBLC 1W44A 3IILA 2JATA 1YI2B 3I8SA 4PPFA 1MRNA 3KJIA 4GMDA 4H1VA 4N3NA 3HU1A 1IXSB 4NP6A 4RZ2A 4QG7A 4QBFA 4CEHA 3G0HA 1E9FA 1LTQA 2GNOA 4L15A 2AKYA 4L9SA 1WQ1R 4NCNA 4LOAA 3GFOA 3RRYA 2ZE5A 4B48A 4K8OA 5TY0A 3RYTC 2DFTA 1Z83A 3MHPA 1E1QD 5JFGA 3SS8A 2QAJA 4FN5A 2GJSA 3SBEA 1NG1A 2J0VA 4ZO4A 3R20A 1GNQA 4BFUA 1E1QA 3R9WA 1M6NA 1KI4A 3RDPA 5CYOA 3WHKA 5KHOC 3JVVA 1N6KA 4LHZA 1R8QA 4ZDWA 3X1WA 4ZCLA 1OW3B 1OXXK 2A30A 4HYYA 4C2UA 3AB3A 1Z07A 1XB2A 5IHPA 3AKDA 3MLEA 4CEIB 2CL0X 3GQBA 4GRAA 5L8VA 1A5TA 1DADA 1G19A 2CCGA 3EARA 3BE4A 3DOFA 4EKDA 2P6NA 5JWRA 2GJ9A 5BW8A 4DDTA 2ZE8A 1KAGA 4R98A 4A2WA 1N6RA 3V4FA 1BJKA 4TLBA 2QTHA 3A1TA 5AJWA 5DE3A 3TSOA 2CJWB 4KFUA 4C0JA 4ZGNB 4XJXA 3VR5A 2B8TA 1ZCBA 3BAFA 3PITA 2ZR0A 3LWNA 2ZI6A 4QGHA 1SXJB 4GT1A 3ZZUA 2V54A 4Q48A 1OFUX 2BCGY 2CXXA 5BN5A 2OSBA 3KXLA 3WYFA 2BMEA 4TWZA 3B8HA 2PEYA 1LVGA 3GJ5A 2VNKA 3MFYA 1XE1A 3OAAD 3NEJA 5BYKA 3MSXA 3LA6A 3S1AB 1KZGB 2HT6A 4UJ3A 3VKHA 1BKDR 1VQKB 1Z6AA 6Q21A 5P21A 3OAAA 1N0WA 5BN4A 1GKUB 4JVSB 2VQSA 3FFAA 2XXAB 3VR4A 3WXMA 3WRXC 3B2EA 1OGJA 3VNVA 1PV4A 3ADDA 1BS1A 1NL3A 3EIHA 4LYHA 1DAMA 2I3BA 3QXSA 2GK6A 5AJVB 3GEIA 3FFBA 1KY3A 3TK1A 3GLGE 5CIWA 3I73A 4Q1EA 3ASZA 2EFGA 3VR3A 3KKPA 1RYHA 1TL7C 4DC9A 4BZPA 5CK5A 2GEDA 2WTUA 3KQHA 1ZNXA 2A5FA 1ZM7A 3RVBA 5EXPA 1CR0A 4PQFA 1ONBA 1W46A 3CPWB 4WA7A 3ZDQA 4BWYA 1W5SA 2DY1A 5FFMA 2GTPA 3VKWA 1XEXB 2MMCA 1E9CA 2ODWA 1II8B 1W36C 4PSAA 2REXB 3E20A 3IIJA 1K8AD 2Z83A 3CIOA 2R6HA 1Q7YD 4BEBA 2O8FB 2BEKA 1XEXA 4JJKA 2RGGA 2JA1A 4BLSA 2OFXA 1YR8A 1II8A 3BB3A 2Q21A 1OIXA 3ZVLA 2QM7A 4NCIA 1U2RA 1SKYE 1W35A 4HATA 4TMTA 2BOVA 2O8FA 1W34A 2ZROA 5CM9C 4UQOA 5G53C 1CJVC 2CHGA 1D9XA 4HDOB 3IBGA 3KB1A 4RD3A 3SR0A 4ACAA 1E2MA 2IYLD 4IOJA 3KXIA 1KK3A 4XWOA 1VHLA 1QHSA 2P6RA 1XFAA 1Q3HA 1KI6A 1UDXA 2QI9C 2W0MA 4IOKA 3SJBA 3X1DA 1Z0FA 1XDBA 2H18A 1XMVA 1OH6A 1E0AA 1G8FA 4AF6A 1OIVA 3A1SA 4PC7A 2WZQA 1ANKA 4P4SB 1GOTA 2IYUA 1Z3IX 4LPSA 1MABB 4OL0A 3CCLB 2ZREA 3EC1A 3GLIB 2VNJA 2ZQ5A 5J5CA 4C0QC 1OIWA 1HE1C 1VG1A 2VHQA 2QRNA 3VR1A 4DB4A 3LH5A 3LQRA 2YWGA 1T91A 1XCPA 821PA 3EW9A 4W9MC 2GAOA 3VKGA 1MABA 1TU3A 3ADBA 2VO1A 4TYYA 1QHGA 2BV3A 5J40A 3THYA 1N3BA 5EE0A 1WA5A 5IK2D 1G5TA 2WV9A 3B1WA 3PVSA 1SXJE 4JLNA 4KYUA 3HU3A 1R6BX 2IC5A 3TW8B 2VNHA 5IK2A 2FH5B 4N0EA 2BBTA 3C14C 2QN6A 2D3WA 1WE2A 2ODNA 1VQNB 2P6UA 1KK1A 1WBDA 2FNAA 3A4MA 4NMMA 3RS3A 5C46F 5JCPA 3F0TA 1YQTA 3QEJA 4MUAA 1W4CA 2O0HA 3LV8A 3VFDA 1GJRA 3LAWA 4URVR 1NY6A 1YKSA 2IS2A 2IXGA 3THWB 3KFXA 3DM5A 3QKRA 2KSQA 2GQFA 1XEFA 1XTJA 2GA8A 2GILA 5GJVC 4Y9RA 1P60A 2AFIE 2V6JA 5FI1B 4A8JB 4FMBB 3W2GA 2CLDX 3CC4B 1IAQA 3X2SA 3PIRA 2N46A 2YOHA 1HQYE 1L4YA 2F9LA 2R6GA 2ZUCA 2J7KA 2GK7A 3IIKA 2E87A 4YMTA 4JLKA 5BXQC 2WWFA 3FHOA 3W6NA 5FBQB 1H42A 4LZZA 3TSWA 4HZUA 3U61B 2ZJ8A 4XH9B 2DHRA 2ZVQX 3CZPA 4TMZA 1CXZA 1UKEA 3LO5A 3NBYC 2QBYB 4E22A 4QOSA 1VQ4B 2R9VA 5CLQA 1E6CA 3QOFA 1P73A 5H68A 4RJLA 2G3YA 1U8ZA 3U6BA 1JI0A 3D8BA 1KI1A 2ZSFA 3CCUB 4IDHA 4Q1DA 1BX1A 4LJ8A 2PLFA 5SZJA 4RZXA 1F2TA 4G5QA 3B6EA 2F7SA 4NU0A 4MA4A 2VF7A 2V4ZA 2YZ2A 4RD4A 5E7JA 1KI2A 1RW4A 4O25A 2B5OA 4TMWA 2OBNA 2QUZA 3ZJYA 2D7DA 3BH7A 1R7RA 4B73A 5KYKA 2W00A 1KKMA 521PA 4FD2A 4EPRA 2QE7D 4CF7A 2Q3FA 1Q57A 2IYQA 3RC3A 4DEXA 1I4LD 2XNJA 3V76A 2CCJA 5JMTA 1VIAA 4F92B 2QE7A 3DZDA 4DLWA 1GNPA 3GLIE 2D62A 2IF0A 4PC1A 2WJYA 1QHYA 4HB0A 4M1MA 4BFWA 4A2PA 2WOJA 4TL7A 2Q9CA 3TR0A 2JASA 2WJVA 4C0LA 1G7RA 2QGZA 4FCVA 3A1VA 3DOEA 3AVTA 2VSFA 1KK0A 1ZM2A 4PFSA 3U4QA 1FUKA 2BHRA 2KE5A 4HLCA 3QNUA 1RRCA 1QHHB 1EGAA 1G7CA 4JVMA 3VMFA 3RNLA 5JJKA 3H4MA 4URZR 5FOVA 3CH4B 4GZMA 5KSYA 3BD9A 4YAOA 1QHHA 2DFLA 4CVNA 1ZM9A 1U94A 4LV8B 5AJXA 5JECA 4IHQA 4KXFB 3VR6A 3PQCA 1D5CA 4M2LA 1G7SA 2OESA 1NY5A 3U7HB 2G6BA 1OH7A 4KAXA 2G9NA 2UZIR 3CPJB 2QT1A 2OXRA 4DDVA 4GNKA 3CCRB 3FVQA 4C43A 1E9SA 1YIJB 3CX6A 4HE5A 1JA0A 2IEYA 1IXZA 2ZS7A 1XBTA 5TR9A 1EFHA 2RGCA 4IEEA 1H8HD 4OJKA 2FEMA 2XTMA 1YZGA 1SZPA 1I2DA 4JL6A 3RLFA 3BIFA 1Z06A 1QVAA 1RYFA 4BLOA 1YJ9B 2J46A 1H8HA 3C16C 3PEVA 2J1LA 1UFQA 2IHBA 1D2MA 1YRBA 4JVNA 1OFHA 1JEDA 3SFZA 1UMKA 2ZAMA 3OIWA 2ZS9A 1SULA 2QAGA 2QENA 4KSCA 2WWGA 5TDHA 2ZUBA 1GIAA 4A6PA 5JBQA 3K09A 4I1VA 2XTNA 4MGZR 1VG9B 2W2TA 2BC9A 4EFLA 1WB9A 2CK3D 2QMUA 2XJ9A 4FCWA 3J81k 3T12A 2HF8A 2L0XA 2IYZA 2NZ8A 3U3KA 3B60A 4LBYA 1QVFB 4X8OA 3FKSD 1EK0A 5HPYB 2CK3A 4AYWA 221PA 3K53A 3TRFA 1NJGA 1E1RD 4PR0A 4X8HA 2P67A 2ZJOA 1YZQA 3IEVA 3QFTA 1VTKA 3NBZC 2NO6A 3ZLJA 5JCZA 1E9EA 3ASYA 4HI0E 2BBWA 2IYVA 2WKPA 4BGDA 3LQQA 1FW6A 1C1YA 4QHYA 2QMEA 4PQYA 2A5YB 3SU8A 4ZDIA 1YR7A 4QNMA 1YZUA 5EP3A 4EFNA 1VQPB 3PUXA 1MOZA 4HE6A 1RE0A 1CIPA 1OLOA 1SVKA 3HYTA 1JPJA 4OK5A 1Q81D 1DEKA 2YV5A 2ANBA 4AKIA 3SYKA 2X8AA 4UNRA 4MQBA 2IWHA 4G0NA 4Q02A 5HCNA 1NJID 3OZXA 4LHWA 1TQ6A 2IXFA 1TMKA 5EP1A 2AD1A 4O3MA 4V0OA 3QFRA 2JIZD 3LXXA 1OF1A 1LF5A 2OCBA 2JCSA 3CRW1 2X1VA 3VU9A 121PA 4D4LA 1OH5A 1G8HA 1FUUA 1IOZA 5LDDC 5KNDA 1KDRA 1QX4A 2JIZA 2Q9BA 1IN7A 4WIAA 1QGYA 5H59A 4IVRA 2RKOA 1Z29A 2NTYC 4TQAA 1G4UR 4JLMA 3QXCA 5GJWC 4LUCA 3RS0A 4F4CA 3SBDA 3NC1C 1JPNA 4JT2A 2GXAA 1NVVQ 2AFHE 4QBGB 1G41A 2J0UA 5DYGA 2PT7A 4EJSB 1MRSA 3C15C 3B5JA 2AR7A 4TYWA 2NOAA 3TJZA 4B75A 4JBXA 2ORVA 2IYWA 1KYIA 2XZLA 5GV8A 1KO1A 2JEOA 4EJSA 4MRVA 4D80A 2IWRA 1Z0KA 4G5GA 4RCZA 2FPLA 4EH1A 1VQ8B 1UDWA 1A7JA 1O87A 1N6IA 4KODA 1S3SA 5AUQA 2ZVPX 4QRHA 1XMSA 2QAGC 2VP6A 3FWYA 3KTAB 3CPHA 2IA5A 3IQWA 5TARA 1VQOB 1T8UA 2ZXUA 1E2PA 3K09C 1G3RA 4QXAA 1GO2A 4EPVA 2PIAA 3UKDA 1FP7A 4C0AC 1ZNYA 2ZRAA 2H1LA 1D2EA 1AIPA 3KTAA 1QUFA 2CNWD 2H5EA 1ZIOA 1ZIPA 1TADA 5AR1A 3U7GA 1NN0A 4B34A 1NF3A 2CNWA 1FOEB 5K8LA 3GPLA 2WSSD 1VYTA 2OBMA 1XEWY 2DBYA 2GF0A 2ZYUX 1VCMA 1L8QA 4LJAA 3TAHA 5TB5A 1KMQA 1OPXA 1TPZA 1E98A 5E95A 2QG6A 2WSSA 4B6EA 2A3RA 4MH0R 2IT1A 4D0GA 4PHHA 2GAAA 1YZTA 5UKDA 3U3RA 2AX4A 3UMRA 4B2IA 1KTVA 1MR3F 2N42A 1I2MA 3BFXA 5CLLA 2BIFA 3QBTA 4V02A 1EP3B 1MH1A 4FMDF 4U5XA 3VTKA 3PUWA 4CEJB 4A6XA 3CZQA 1EFRD 1E3MA 2MSEB 1XCGB 3ZBUA 2GRJA 1CS4C 2IYYA 5HE8A 1Z63A 2TMKA 2Q9AA 4DLVA 5K8IA 1NN1A 1A2KC 1EFRA 2FJUA 2YYZA 4S35A 2QP9X 3VX3A 3SQWA 5IF9A 3UG7A 2WJIA 4YHBA 3FTQA 2GCOB 3I5XA 1F2UB 4L9WA 5KDDA 1JECA 5FL7D 2B7BA 2WVJA 5FR1A 2D74A 1NLZA 2BVNA 2QPTA 1E9BA 3CWZA 5K8UA 5FL7A 4I99A 3R8FA 2FFAA 3Q3JB 2GCOA 2HT1A 2FV8A 2YJTD 4M53A 2ZRCA 4PC3A 2CMKA 2RH5A 4AK9A 3JQPA 1G3QA 5G41A 4Q4LA 4EPTA 5DHFA 1N6PA 1ZP6A 4PANA 2ZRKA 4BRUA 4DBLC 3KQKA 3H0KA 3OEED 1ZBDA 3A36A 3DM9B 3EXAA 4OI4A 4K81B 1W0KD 4I1UA 4BFSA 2C98A 3BFKA 2IXEA 3R8CA 4D4KA 4BZXA 1KDOA 1BMFD 1QHIA 2OK7A 3OEEA 1XWIA 1NVVR 4YC7A 5FUYA 1W0JD 1IM2A 4IEIA 1DAEA 1OHHD 1SVIA 1W0KA 3RABA 1VIYA 2PZGA 4LBZA 1BMFA 3QG1A 3TNFA 2GVDC 1Y3AA 3CMAB 1W0JA 1XD2B 1OHHA 2YVUA 4LRWA 3U44B 3LVRE 1DS6A 4BPBA 4P6VF 1JB9A 2CBZA 4NKRA 1DELA 1TNDA 4MRSA 4EDHA 3RRZA 4LX0A 4IOLA 4NE2A 1XEWX 2J0QA 1NVXQ 1CJMA 3TAUA 1B23P 2PT5A 4ARZA 4EPWA 1OSNA 5K8TA 4KLZA 3TVDA 4D82A 3QBVA 3ICQB 1YHQB 3V4RA 5EZ5A 3KJHA 5F9FA 3AVUA 2FGKA 3W5JA 1NMYA 4C7OB 4JBYA 2OLJA 4TLCA 5H70A 4PAQA 4ESHA 4CW7A 2FGJA 4Q9HA 1NJFA 1S8FA 1JXOA 3K0CA 1X1RA 1US8B 3SOPA 3U7EB 4OHWA 5AUOB 4JL5A 2Z43A 4C7OA 2PBRA 3JQRA 1FDRA 2WPDD 3RSLA 3AF1A 4JSTA 5FOXA 3THOA 3AEZA 1EX7A 2CHQA 5FBVB 2P3SA 2QRZA 3BGWA 3TW4A 1NNEA 2JLVA 4NYIQ 4WBSA 2ZI3A 1GKIA 2RHDA 2VP0A 2WPDA 1L2TA 4DLYA 1CR4A 3O8BA 2J0SA 2EFCB 1OFIA 1S3GA 2J41A 8OHMA 3GJ4A 4M9SA 4PC2A 2YNMA 3DZ8A 2GEUA 3ZIAD 4GSYA 1OGIA 3DMDA 4UKDA 2GPJA 5CIQA 3WRYC 4R9UC 5FUWA 5EMNA 1G5RA 2J5XA 3EASA 5FOWA 2EW1A 4BLTA 1FQJA 1NIJA 3ZIAA 4BUJA 1Q1EA 4UXIA 4D25A 3FE2A 4NCKA 1KRHA 1KJYA 4HAVA 1IN4A 2AXPA 2Y8EA 2WICA 4QJ3A 1P9NA 2KWIA 3A8TA 3CCSB 1R8SA 4A4DA 4U7DA 3N5CA 1GAQA 1LB1B 5FA6A 1G8YA 3FMIA 1T3SA 2YWFA 3X1YA 5B58C 4LV6A 1CKEA 2FSIA 4GFDA 1KOFA 5D3MA 3OFND 3AQ4A 1KQSB 1KHTA 2FMXA 3QVVA 2HYDA 1OKKD 4CEHB 4Y0AA 4LBVA 2H92A 3CR8A 3RS5A 3A4NA 3K9LA 3CM0A 3OFNA 4QNRA 1T4GA 4OK6A 1W36B 3LFUA 2IS6A 4YMVA 3SYLA 1OKKA 3QE2A 4TYNA 1M1YE 4AYTA 2V8OA 4MGKR 1W36D 4AC9A 2QROA 1MV5A 2OXCA 3QG5A 4BFZA 4A92A 1FNMA 1V5WA 2ZRIA 1LS1A 4PSKA 3W8NA 1ZD9A 5E4FA 1W2GA 1E0SA 4AKHA 1SKYB 2EU8A 3QF4A 3VO2A 4NDZA 4NL4H 1MKYA 1XX6A 3A6PC 1P2SA 2ECKA 3M4YA 4C30A 3X1ZA 1G6OA 4L5BA 1E64A 3ADKA 2OE2A 3CRVA 2VH5R 2VHTA 4DWJA 1OE0A 4HEJA 4IJMA 3GEHA 4OYHA 2Q3MA 2WWHA 1S1MA 4P33A 3T5GA 4URUR 3ZYCA 2C78A 3LW8A 2NO7A 4POAA 3PUVA 3FKQA 2AL7A 3HPRA 3IUYA 4GOJA 4OJQA 1DAKA 1G20E 4OI0A 1IJEA 1RVDA 2PCJA 1C4OA 2ZPTX 4U00A 2AK2A 3H2YA 4NYJQ 3HDTA 3QENA 1DO0A 2VP5A 3K0CC 4YAUA 5DO9A 1K8RA 2A78A 3FGNA 4NYMQ 1I7PA 2K5UA 1IY1A 1R0YA 3QXJA 2QNRA 4NHOA 4B32A 1KI8A 3Q5EA 3VHLB 1RRPA 4BECA 5FOUA 1BX0A 3NEYA 4LY6A 4M1WA 2XOKD 3HR8A 5CITA 5E7MA 3JQQA 1O3YA 1OYYA 5TXGA 4A15A 1Z08A 1XD9A 4OKSA 2HMAA 3KDSE 4UJ5A 2XOKA 1G1MA 2ZYWX 3L0IB 3PCRB 3EIQA 2GKSA 3SC3A 2F1IA 2ZJAA 4AWXA 2EFDB 3PFIA 4TTQA 5L3SA 3FJOA 4WVFA 1J70A 3HYRA 3P1JA 1P2UA 1FNDA 3LY5A 2V7QD 4EPXA 2ZRFA 3LX8A 3SHFA 2G88A 4B71A 2ONKA 3LRPA 1KSFX 4UNQA 4IDNA 3EPLA 4PTLA 3CF6R 3QF7A 2AKAB 3AKCA 3E5HA 3UIEA 2V7QA 3EPKA 1KDPA 2KB0A 4IRUB 2BBSA 4QL3A 3CCEB 4DLTA 2IHYA 1V43A 1AS0A 4N3GA 3CC2B 2ORIA 4MRPA 3CD6B 3P26A 1G291 4MKGA 1TQ4A 1KMHB 5FBLB 2BDTA 1HYQA 1ZNZA 1FNBA 1GNRA 1OXTA 1XMIA 3QPVA 2J45A 1BO6A 3U3MA 1EWYA 1DBSA 1KMHA 3KUDA 4D6PA 3I62A 2O8DA 5J4VA 1NRJB 1VCOA 3AVWA 4MGYR 3LVQE 3W2EA 1SKQA 1U0HC 3CCQB 1G64A 1GRNA 1DVRA 4IXNA 5AK0A 1W48A 5DI3B 1YR9A 3ZBTA 4MDEA 1EXMA 4FMDB 3NWJA 1TTTA 4YMWA 2F3TA 1ELOA 1TUIA 1R10A 1M90D 2MMGA 4HZIA 4LHXA 1KC8D 2DCUA 3AP1A 4OQNA 5DI3A 4B47A 1RFLA 3B9PA 5KDOA 4KFRA 1KI6B 1UBFA 2ZJYA 2EVWX 2CE2X 4DEYA 4YMUA 2BEJA 4TL8A 1NN3A 5FBRB 3OZWA 4FWTA 2ZJ5A 3L82B 2RMKA 2O8BA 3NDPA 4TL9A 3N70A 1N6NA 1CJUC 3HU2A 3K0FB 1CF4A 2WMOB 3NHAA 2HCJB 3E1YE 3MJRA 4OK3A 1QVGB 3EC2A 4PZYA 3K0EA 1TLLA 4BFXA 3AM1A 1KNQA 2FA9A 3T35A 2WWXA 3WNBA 2IBMA 3K0FA 3LO8A 3L8ZA 2W58A 1J2JA 1GZSA 4XTCS 1VG0B 4LDJA 1NDHA 3AGPA 4B4DA 4C4PA 2G0TA 3H1TA 3OJXA 3THYB 4HB2A 2YKGA 5LB4A 3IEUA 3QXXA 4MRRA 4A82A 4KLNA 4B3DA 4S2EA 1PUJA 3AV0B 5IRCD 5DN6D 3I8XA 1KI7A 4YQFA 1FTNA 4NYMR 3FPAA 4A0GA 2AXNA 3KKOA 2BN4A 2JJ2D 5B2ZA 1XJQA 5DN6A 5CB8A 2BJVA 2GXSA 4R7ZA 4DIDA 3TLXA 1KAOA 1W4BA 5LD2C 3O8CA 2D06A 4D26A 2QT0A 3QKTA 2JJ2A 5E3HA 5SZKB 4YAFA 5LPNA 4CT5A 1BQEA 4RFSA 4MYCA 3G4SB 1KY2A 1G16A 4ZKDA 2RGAA 1ZINA 3QKRB 5JI2E 4GPTA 2FZLA 3TQCA 1N0UA 4TQ9A 3T15A 1TF7A 3H86A 3QI2A 1SM4A 2QA5A 2R6DA 4URXR 1R2QA 2FFHA 2REOA 2XNSA 3EPHA 1M34E 2KI5A 4N1AA 4Q4JB 3CCVB 3WHLA 3LNCA 1VYVA 2FU5C 4BZQA 3SN6A 2I4IA 4XVUA 3QKUA 3DO6A 1EESA 2YWHA 2X19A 1J9ZA 2VYQA 1HEIA 2FSGA 4Q4JA 2H17A 1P5ZB 1OFTA 4Q1CA 2ATXA 3FYHA 1JEEA 2J7PD 1ZC4A 4HZUB 5FTNA 3DEFA 4OHYA 2C96A 1NKSA 4PPNA 1UBEA 1LNZA 1T8TA 3K70D 4ZGQB 3C41J 2UKDA 2R44A 1XTKA 3WNCA 5FTJA 3UMSA 3CUEF 2QEQA 1LF0A 1Z6XA 4TTPA 1OXVA 4NCJA 2ZEJA 3PEWA 1HQCA 5JWHA 4YDSA 2VEDA 3EIEA 3AGQA 1U9IA 4GMXA 1Z6YA 2GDJA 4DKXA 1F2TB 3MD0A 3NTUA 4G5SA 4HB4A 1VQMB 2X2EA 2ASEA 3TMKA 1UM8A 3T61A 4KI0A 2NG1A 3KKNA 3ONWA 4G5RA 4HAUA 2BKUA 2MSDB 1X6VA 1XCMA 3GJ0A 4ERNA 1Z2AA 3G5UA 1U90A 3FPKA 1Z8FA 1JQLB 2C8VA 1DE0A 1JAIA 4FW9A 2GHIA 1YZLA 1HT2E 4DHEA 4M4SA 4RY2A 1VYUA 2IUUA 1XZPA 3SE0A 4GOXA 5F2EA 5AWFC 3BC1A 3F3YA 1VQ7B 1CBUA 1E2NA 4B3GA 1ZCAA 1PJRA 4OQMA 3NDBB 2ZIAA 5FPYA 3QFSA 3JVUA 4NH0A 4DLZA 5DSZA 1JNYA 1A4RA 1UBGA 4LCBA 3CWQA 5EE5B 5CJPA 3CX7A 3P32A 2V55B 4PHGA 3U4QB 1TF2A 4HLDA 4OI2A 2QMOA 3IO3A 1G5PA 3OE7D 1GILA 4FIDA 2GEVA 1QDEA 4KU4A 4LJ5A 1Q1ZA 3I5YA 2HDNB 1Z0DA 4GI7A 4L4UA 1P62B 3WMEA 4E09A 2AWNA 1QVRA 1TQDA 3OE7A 1YJNB 5HKKD 4TQUS 3OF5A 2QA4B 2D7CA 3QFCA 3KJGA 1U8YA 3BERA 3SJCA 2JLYA 4LC0A 2DETA 3ZZTA 2ZRJA 2ZM5A 5HKKA 4MKFA 3P27A 4M1OA 2GXUA 5L3QA 1AA9A 3RRMA 3K0SA 5JZVA 4I1OA 5DI9A 2GESA 1W49A 2GJAA 3D7MA 1N5JA 4HDCA 1CULC 1P75A 1Q22A 1GRRA 1E0KA 3VQTA 2PEZA 1E2FA 5FUVA 2P5SA 5J4HA 3TE6A 1OXSC 1CJTC 1IJFA 4CDGA 4Q7MB 2AN9A 1T3HA 4W5JA 5BQ5A 1TX4B 2BM0A 2ERYA 2EFHB 3F5FA 3QJYA 5GADl 1U98A 5L3RA 1CQXA 4D4MA 4EQ6A 2OEPA 5EZ6B 3PR1A 2FSHA 1MO5A 1FRQA 4LWZA 1AZSC 4QM6A 1JR6A 1HH4A 4P4TA 3EZ2A 3K70C 2Q6TA 3CRMA 3MCAA 2QAGB 4QFMA 2A5DA 2GETA 1KO7A 2R6AA 2ZRDA 1D6JA 3RWMB 2FG5A 1QUEA 1M74A 1U9IC 5KTYA 3BS4A 2QDXA 2HUPA 2JLRA 1FFHA 1KSJA 2O0KA 2OLKA 3L43A 4ZPXA 5JI3E 3LLMA 3CC7B 2OBLA 2CRVA 1DDGA 1WP9A 5CB6A 4JMPA 4Z54A 2EQBA 5EXSA 3ZS9A 2FOLA 3QPUA 3I1FA 2XZPA 1IBRA 1XTIA 2VHJA 4DT1A 5DIFA 2RC6A 1UEJA 2IUTA 4P4UA 1Q1QA 2F55A 1CJKC 2BSAA 3FKSA 421PA 1TAGA 1B0UA 2ZSDA 2LKCA 1W4RA 4RZ3A 3FHTA 3JZAA 1E1RA 1KDTA 1P4SA 1IXRC 3CXCB 1AK2A 1XRJA 4ZI3A 3KKQA 1AZTA 4JYCA 5L3VA 4M1TA 5LBIA 4O2RA 1JR3D 2OCAA 5JWOA 5J4KA 1U8AA 2OFWA 5KOYA 3SZRA 3R7WA 4TLAA 3C5CA 3I32A 4TYPA 3T1VA 1JR3A 3A37A 2QU8A 1P3JA 1QH0A 1DPFA 2J87A 2OCPA 2W6ID 2WIAA 4Q7LA 2EYUA 4Q4AA 2B21A 1R0ZA 1N0VC 4F91B
chains in the Genus database with same CATH superfamily
3W04A 3VU9B 2K2WA 1N6OA 4QQFA 4I9FA 2GEBA 1C3XA 3I1JA 4QHTA 3ZK9A 2I6QA 3GA5A 4K6GA 2NUPB 3KT3A 1ZR2A 2Z6QA 2X14A 4S0XA 1KBQA 2QI9F 1WF3A 3OU7A 1Q7CA 4RS3A 1LWNA 1B1CA 1QG6A 2HXSA 5ALPA 4GQNA 3FMPB 3KD2A 3WIVA 1XJCA 1VHEA 4GAEA 2J08A 1VKRA 4PCUA 1IULA 5KSOA 1PFWA 4N0QA 1EM8B 3G2MA 2V4MA 3IODA 3NWBA 1D0IA 1EP2B 2CD7A 2FPRA 5T57A 2FPSA 4HK4A 1PJCA 4EEKA 4ENPA 1IK4A 1X3LA 2PQ0A 2Q4DA 1THTA 5AKIA 4XSVA 3CRQA 3LT1A 4ARAA 1GAWA 1E5QA 1PGJA 2E4UA 2WU3A 4IBOA 3UA3A 1D9ZA 2AJDA 4BBJA 1S01A 3GMTA 5FTMA 1YHNA 3ONVA 5KAPA 4EITA 5MN5A 1F3LA 3SGLA 4CM8A 2FJPA 2WF8A 4OBWA 3W2HA 5KQGA 2AJ8A 1N07A 1SVOA 4YAWA 1XU4A 3MGAA 1PZFA 5A89A 5H5JA 3TVYA 4CLOA 2V4DA 5J47A 5HILA 1B8VA 2G9VA 4JASB 1N1DA 3G17A 1JYEA 3G0OA 4HSGA 1QZXA 2CL6X 2X42A 3NYQA 4WK6A 3GDOA 3I4CA 4EYGA 3VR5H 1BXKA 1LDNA 1UPUA 4QUZA 1R0KA 2FP3A 4REQA 3CBQA 2V97A 3WL3A 1CYEA 2A0WA 3COVA 4ZVPA 3BY2A 1S2IA 1USWA 2FVGA 1CZKA 4FUQA 4DMRA 3TX6A 4JN6B 5FPKA 3JVDA 2IU4A 3RSSA 2F59A 2FFBA 3CW2A 4HQRA 3OY7A 3BB1A 2EF1A 3JPWA 1OYWA 2P4EA 1IZ0A 2RB4A 3CONA 5AI5A 1H3EA 1T5IA 4DC0A 4G7WA 3ENZA 3GLHA 3MOGA 3EGCA 1P7CA 5EKSA 3U0BA 3SKXA 2OHVA 1GQFA 1A9OA 1EEXB 1FDOA 2VPPA 3M2TA 4UBMA 1U3WA 3SR3A 3NXKA 3N8NA 3EVDA 5ECDA 1ADGA 2P5TB 1FP2A 2JFWA 3BWDD 3QQ5A 4OGKA 4DQLA 3NWPA 2CUZA 3UWKA 4GLJA 3N8KA 1Z4OA 4BNUA 1AK1A 2JGNA 1G5IA 3BBPA 3VR4H 1ECLA 3TOCA 1XCOA 1IN1A 2JRCA 2PX5A 2WKWA 4FBGA 4H0FA 4AY5A 2FZCA 2WWWA 3L93A 1SVWA 4QXPA 4DQKA 2OHFA 4X1IB 4YV2A 2I1VB 5ICMA 2AR0A 3C7KA 1WZCA 3D2AA 1FUIA 4D8WA 5JSZA 3W1EA 3IO5A 2X2FA 3OBIA 1DJNA 2WAAA 4MCHA 3QE9Y 4YH1A 4WXPA 1GNTA 3CKYA 1P9LA 2HRBA 3RQIA 4CF3A 2DJIA 3I3SR 1Z15A 1T5SA 1WOPA 2E5LB 5AYVA 1IHOA 4RQUA 4KBFA 4K6OA 1CTQA 4DMHA 5LUBA 1ZVQA 2UZAA 1AGRA 2FPOA 3GGGA 2JGLA 1M66A 1Z37A 4Z3KA 1SUWA 1M2HA 2H8KA 4Z1MA 3BF8A 3T3PB 2JRLA 1VKJA 2IPNA 5EINA 1SQ5A 1RZUA 3OTQA 2H08A 4XB6B 4FEAA 3DPUA 2WKSA 4UXJA 1YF3A 3AF5A 1ZYUA 2DCMA 4Y2PA 4EFMA 3HA2A 1ZI8A 4TTTS 4YJHB 3QSYA 2WM8A 2OZVA 5IYQA 1P1CA 1TUEA 4OHKA 3BJMA 4HVCA 1T2NA 2QNIA 2I4NA 3FCSB 1LNSA 4MWSA 4Z4GA 3VNUA 3WNZA 2HWXA 1TA4A 2AMVA 2MSCB 3O4HA 4YEDA 4JSYA 4TZ6A 1MGOA 3GV0A 4MYSA 1GCGA 4YJHA 2P9GA 2CCKA 4JLVA 4KBGA 4CKXA 4LZNA 5DSTA 2F3SA 4UDXX 3L7JA 4WRRA 4OPSA 1UKVY 2D6FA 2GD6A 3A9CA 1RHUA 1S4QA 1EAYA 1K8XB 1W85B 2FI1A 3B7GA 2FHPA 3UJBA 4HN2A 3SWWA 3DQQA 2H2IA 4W5TA 4FGJA 4WLVA 4LDPA 4ZAZA 4RGYA 4CIWA 2ZT5A 5FQNA 3RAFC 3OEHA 1ML4A 1SCKA 4QDTA 2X41A 1NP3A 3P9YA 3WSWA 1J22A 2RGNC 1RIIA 3KKMA 2X76A 5DH9A 2WUVA 2V3VA 3C97A 1K9MD 2VWPA 1GVNB 1ZUNA 4IMIB 3PNMA 5L4SA 2R8ZA 3OKFA 4RVGA 1E8MA 1KYWA 5DK6A 1FJGB 3ETDA 1KWKA 4CGZA 1NQUA 4OHMA 4Q6WA 4X64B 3SXPA 4W5WA 1Q17A 5TT1A 1MOSA 1DDIA 3FZYA 3IKTA 1OH8A 5A4JA 1TLTA 1YZNA 1VSUA 5E9QA 3Q8WA 3PWZA 4HR7A 2O8EA 4L8GA 3DT9A 1Y34E 2R7LA 5HJ7A 2X1HA 5K0CA 1KVUA 1THGA 4ZAYA 3VBEA 5K0ZA 3GLHE 3W06A 1P6QA 3RYCA 1HDOA 3RYHB 3NXSA 4PPQA 1DQZA 3D3QA 5FOQA 1ZJYA 1T3TA 2VJCA 3VBCA 1N34B 4BNFA 2RBGA 1Z28A 3EUAA 1UPFA 4YN3A 4JT9A 3QA3E 1CP2A 4AO7A 3HMQA 3N6RA 3BIWA 3A2KA 5KWVA 1X77A 2Y1GA 3IGFA 3D3JA 4MVJP 1JIIA 1JNXX 5FI5A 3DC7A 2QJRA 1VI6A 4IX9A 4MVJH 4YA6A 4P0TA 5KBYA 5JH7B 2VPIA 1JRLA 1WQ3A 2ID8A 2VPWA 4IMPA 3FYDA 2JGIA 2CLHB 1PR5A 4F38A 3FOZA 1PJTA 2WIGA 3U3JA 2YMLA 3UG6A 4X20A 4LWQA 4AQ7A 2FUG1 5LUAA 5EHNA 5HDBB 2MSKA 1GITA 2PH1A 5HOQA 4ARSA 5B7NA 1PR0A 1SCQA 2OGUA 2EIXA 1DIRA 1ESCA 2YC4C 3HKEB 4L0CA 2VAXA 1E2LA 1T9HA 2VP3A 2HIMA 3OIYA 4Z9FA 3DDUA 3JQ8B 3RW9A 2OHOA 1P6XA 4PZ9A 1NBMA 5AVUA 1DO2A 1YOVB 1V0EA 5F64A 4UUPA 3SLGA 4GM0A 3ZU5A 5C7LO 1GTMA 5AVQA 1G5FA 3TXYA 2H57A 1XNQB 4HP8A 3V3KA 4HLUA 3ZD7A 3W4IA 1V2HE 2EX0A 5ALDA 5HRCA 1CUXA 2WZCA 3IKMB 4UASA 1GYPA 2JGJA 2QLBA 1NZJA 5C37A 3W0LB 1XMPA 4MTLA 2ES4A 1YRYE 5LQDA 2EZ9A 4M36A 1KKLA 1L3IA 4HT3B 3K9BA 5I7VA 2ACWA 4PX3A 1QFZA 1YDWA 5FFNA 1CJCA 4A10A 2AUNA 2Z9BA 4IFBA 4RSMA 4EHKA 2DR0A 3P52A 3NNSA 2I3GA 3CJTA 3DMNA 1KERA 5EP4A 3H9UA 5TQ2B 5HGJA 1QYWA 1CFZA 2B0JA 3QF4B 4BB0A 4C76A 2A1TS 1QRUA 1XQYA 2FN4A 2JCXA 2RIPA 1KC3A 2JL1A 4K87A 3W90A 5DCLA 4BNXA 2UUAB 1AC5A 4NEHB 3RSZA 4EF5A 2CFRA 3W5DA 1B00A 2O50A 1PNTA 1WTHD 5IUKC 3DKPA 3OX1A 1C2TA 5A2QA 1KAEA 2HBYA 3PFHA 5DM4A 5AOAA 5F9MA 1COWD 2XBUA 4W6QA 5DSXA 4B2YA 5BSHA 1Y8QB 2OC4A 3HCWA 4QWWA 1BS2A 4V0SA 2P6MA 3WFZA 2GFIA 3H17A 2QZ9A 4BLRA 3C8HA 1BHJA 4BVHA 4D3YA 2PD4A 1T9KA 4Q00A 4MITA 1Q74A 3AVOA 1Y8QA 3K5WA 5SZHB 5A6SB 2BKEA 1RMQA 4FGUA 3ONEA 5JHHB 5I4KA 3QY9A 1ND5A 2PLNA 3U5ZB 2HLDA 2R7NA 1X8LA 3I52A 1EZ1A 4BBAA 1DAGA 1Z2DA 1P9WA 2QRJA 1L4MA 4DSOA 5J23A 5EIWA 1E69A 4RKYA 1V16B 3F3MA 1T5TA 2GBPA 1N5LA 1XKXA 2RIRA 3BRWA 3E8SA 3ETLA 5FV7A 5GPBA 4EECA 3MHTA 4OHZA 4KE6A 4LSZA 4E31A 4DR7B 5BWMA 5F98A 3HTXA 3A14A 5C8DA 4QA9A 4D3DA 3WJAA 4BO6A 2OQRA 2C1XA 3W9UA 5IYZF 5HM6A 1V16A 2OUKA 4QHSA 4XYMA 1A88A 2WTMA 4Y7DA 3ZGNA 5CYFA 1JFFA 3I0NA 3NBQA 4G5YA 1K5PA 4H7FA 4PYQA 2CLFB 3GNTA 4UEKA 5LL6P 1T6NA 1VI5A 4L8WB 1K5HA 1SU4A 1NQ5A 1ZGGA 2JI9A 2O8VA 3GEGA 3GJSA 3ILYA 1Z3CA 2EBWA 4KJZA 2DQZA 3PEEA 2XUPA 5C1BA 2Z0MA 3DO5A 1CR2A 1J0BA 1FDVA 2GX6A 4RW0A 2BRUA 2ZB7A 4V3CA 4X97A 5HJ2A 1Z6GA 2PMEA 4EPYA 1UBTS 3AKZA 4IIFA 2FMFA 4BLUA 4AF7A 1P1KA 1SBCA 3KEFA 2WTBA 1SRRA 4P31A 4V0QA 3ZU2A 4BMCA 1G3IA 4NYIR 4NEGA 1ZN7A 1K6JA 2DR3A 1Y5NA 3ONFA 2D5IA 5IM4A 1NBME 1M8GA 1E7MA 4IIJF 1G2IA 1OXMA 2PYDA 4G3XA 5I9TA 2GLTA 4KRFA 2HCBA 2QRVB 3OCJA 1TZMA 4AMUA 1KOLA 1KH3A 4M9XA 5LDHA 1YS2X 4GP9A 5F7XA 3FYUA 2HHLA 2VHWA 2XLBA 4I5DA 3WV5A 1CCWA 1P4GA 3ES9A 3LBHA 2SKEA 1BG6A 2XCUA 4MV5A 5F5LA 3B1ZA 3AIOA 1YJ5A 5JJ5A 3EN0A 3PFGA 4AWAA 4JT4A 2ZTNA 1MB9A 4Q21A 5AI8A 3REFA 4BVKA 3A58B 3BHMA 5DYYA 1DEAA 2F00A 2PT6A 3RAPR 1H6AA 1GNVA 3DKRA 5CR9A 2WIKA 2Y2UA 2J3LA 3U37A 3IRVA 2A5GA 3AVQA 2O54A 2XADA 5EP2A 1FX0B 1DV2A 3HJTA 4QOFA 4YQEA 1TM7E 3H99A 5IFLA 3PGMA 4TPKA 5LC1A 3QUQA 5LQAA 2I91A 1CUHA 3D43A 1AO3A 1MNQA 3Q7PA 2PD6A 4QWMA 4KO8A 4CLRB 1S2NA 2QMHA 1D1TA 1QS0B 1FX0A 3CUTA 2HWYA 4AY4A 4C9BA 4MDFA 3PJDA 3U4DA 3CPSA 2VSNA 3CZCA 3LLUA 4CUKA 4RTSA 1IXKA 3IJ5A 4IG4A 5C7YA 4RADA 4BFVA 2IPXA 2FN8A 1N4AA 1U5BB 1NATA 1UJ2A 2L69A 1SVMA 3CLSC 4DLRA 2RAFA 1N2ZA 3W6ZA 4XI9A 1XZIA 2VAMA 1F17A 1JJ2B 2ENWA 2VF4X 1R66A 1MW9X 5EJFA 4KPYA 5J2UB 1E7SA 4U6NA 3V8BA 1UC5B 1C30A 3G13A 4QGFA 1V9LA 1XZQA 1H9BA 1M6VB 1H2AS 2DTDA 3NO4A 1KK2A 2FSFA 4C1BA 2D1RA 1CS0B 2ZAYA 1ESDA 2Z3VA 4QLBA 4N3CA 3NZEA 4RD1A 4ZCMA 3GJ8A 5CLJA 1U0JA 4WFIA 3F67A 5J2UA 5EMKA 3UFXA 4UTOA 1AQYA 1A4IA 3AJAA 4KQWA 1M6VA 3RHSA 1ZMRA 4CNBA 1ZU4A 3ZZ0A 1G18A 3A7DA 3CB4A 5DBIA 1GZ5A 1O6ZA 5KNDH 4N0DA 4P54A 4BNDB 2PX8A 4LCEA 1U0FA 1BVYF 5DNVA 1C8VB 1YH3A 2VUSA 3MWYW 3WJ1A 3KYDA 2D8MA 2J3JA 2QJTA 3OQOA 3PLAE 2GBLA 2ZVJA 4AQYB 5DASA 4ZT6A 4DZTA 2X0IA 4G0MA 4H35A 1WXQA 1U3CA 5CX1A 1O94D 2X9NA 3ZK7A 1P2GA 1N3IA 4IDOA 1WPQA 3GBPA 4GR9A 3RU7A 3H0EA 3UQZA 4OQXA 3TFQA 2BTQB 2IHUA 4RMGA 5IBQA 1TVKB 5FAXA 2HRDA 4GIBA 4HB3A 1QB7A 1V2GA 3D3NA 1QO0A 3FOWA 2IYSA 4L3WA 4Q9JA 3IKJA 5F33A 3EQ6A 5K8IA 1RM0A 3PENA 1YAHA 3C3DA 3I92A 4IDBA 2FUG6 2R8OA 2XDYA 5EE9A 3SS9X 5K3AA 5JAPA 3B82A 1G6Q1 5EXTA 1X80B 1UKZA 4I9GA 1TVKA 2AUMA 4JI7B 3O1LA 3MJSA 1RKQA 1ZNWA 2FLWA 3PKIA 3UJHA 4CQLB 1MIHA 4QUIA 1CF2O 1JDZA 1SXJC 3GB9A 1VE5A 4YJ3F 1CIVA 3E5RA 4UHCA 3EPPA 3ND5A 1B41A 3PKZA 5ADHA 3ESZA 3MERA 4GECA 4K8RB 3SYTA 1X80A 2P9FA 2R68A 3OIFA 1VPWA 1P0IA 4MVXA 5KVVA 1AE1A 1MBZA 1GVHA 4BV8A 3K70B 1JFVA 2WNSA 1PX0A 4K46A 3ROMA 1SHKA 1PI3A 1WD7A 3ICPA 4G5OA 5BRJA 2YIMA 4MR9A 4W5HA 1U2QA 2E6UX 1NKTA 2JB9A 1RLTA 2J7PA 2XVMA 3CT6A 3ND9A 4K0RA 3JASA 5BO5A 1Z56C 3TD2A 1HNWB 1X1SA 4GOMD 3GLRA 2W0SA 2JFOA 2FRDC 3Q98A 4GC5A 4XUGB 5EUMA 5F51A 4XORA 3SF0A 3WAJA 1WVGA 3BSSA 4M1ZA 4WXRA 2YINC 2IEAA 4UFOA 2HA2A 5IANA 4C08A 5CB4A 5HEKA 4KQXA 4DUGD 4IXDA 4XVRA 2OZPA 1CUYA 2OK8A 1PRYA 1UFRA 2R62A 3QBEA 4Q7KA 2P5YA 2WFAA 3ELWA 4K26A 1E6LA 2Y76A 2WIBA 3PQ6A 3HA7A 4F93B 5HUJA 3L49A 2BFFB 4RZIA 1QGUB 3GD7A 4BFCA 4DANA 3D4BA 4U1RA 2BMDA 1ZOIA 2Q5JA 3OE5A 1N8RD 1J1ZA 2CF4A 2DERA 1X8KA 3BWEA 3SNHA 1RKUA 2P30A 4B3BA 4AD8A 2AN5A 2I65A 5DEIA 3OQVA 5J9FA 4EABA 8ADHA 1A8UA 1G0NA 3CF4A 3WMFA 3BZWA 4IIYA 2QX4A 1QYVA 4P7BA 4IQ8A 4QUDA 3FH0A 5FOTA 3IQXA 3JYNA 2HAEA 2CHVA 2FZVA 4R1MA 2PVCA 3H5OA 5CPFA 3V7WA 2LXNA 3C48A 3OOSA 1Z6QA 1T9CA 2VXOA 3BCUA 4FP9A 4X1YB 3F71A 1U8CB 2A2ZA 2ZE6A 1JEAA 3IEMA 3ESRA 3HFJA 1E4VA 1WW2A 1CUVA 3WTCA 1FNCA 1QTRA 5KVAA 3WLHA 4BNGA 3CN7A 2ID9A 3DONA 1U2TA 3L6BA 2IJGX 1RS0A 1VP3A 3N6XA 3M6XA 3BXOA 4CKYA 4MW5A 4E30A 1WSAA 5FPHA 1E6WA 3D54D 4IJWA 1Y8ZA 4XWWA 3E84A 3LUAA 4D81A 3WYAA 3DHEA 2R5NA 4IWXA 4DA0A 2IHTA 2R86A 3MXTA 2I7XA 3B1VA 2I6FA 1FP4B 4MZXA 1E3XA 1RRGA 4B4OA 3O38A 3E81A 4ZT4A 3TXXA 3EAGA 2A5JA 2WYRA 3FCYA 2QVBA 3V1KA 4ZHSA 1M1ZA 1EWTA 1RRKA 2RG1A 4B80A 3U62A 3S81A 2A57A 1RQXA 1Z0IA 1I5OA 1KO5A 5BWCA 3OCZA 4NMLA 1TGVA 1EK1A 5CX4A 4OB8A 3N6VA 1UXOA 2X4IA 1L5WA 3PZBA 2GKGA 1I10A 1N1MA 1WLSA 2VSOA 2XNCA 1RXUA 2ZULA 3INTA 3DHWC 3HJAA 4RMNA 2IK8A 3S55A 1W5FA 4UU1A 4ZU3A 1EVJA 2PJZA 2QTFA 4RPCA 2O8CB 4OSEA 3H97A 1J5EB 3HMKA 4FEYA 4LZAA 2X77A 1E3ZA 4MCAA 5GJCA 2HA5A 2YJNA 4JQOA 1U6IA 1WDMA 1BH2A 2ZRHA 3A4LA 3ET5A 4JP3A 4K9KA 4UAGA 2QQ5A 2PN1A 5CDUA 1E5XA 4HH0A 4BRSA 1O0CA 2O8CA 5AT1A 1L4FA 3PICA 4CN8A 3UMMA 4JKYA 3ZTTA 2ZCUA 3ZY6A 7GPBA 3HPQA 5KSWB 3F6SA 3QEOA 2WD8A 4L4SA 1WORA 3OCVA 2CMGA 2LDBA 4WKPA 2VRBA 1UD2A 1O9HA 3M6VA 3AH8A 4FINA 4N03A 2CN1A 1PD0A 3R3WA 1YB6A 2CXSA 4JY7A 4LGMA 4PX9A 3UB3A 1XN4A 2PM8A 1N25A 2NQ8A 1J25A 1QK5A 3CGGA 4MRNA 3TLJA 5AJUA 2DR2A 5EJGA 3NRBA 1JJIA 3PHBE 1SVLA 4ECEA 1LGYA 1PHRA 2B99A 2Z3WA 2W98A 3G2PA 1UXIA 2EP7A 1PJ2A 4QRIA 1VHDA 2Q29A 2I29A 1YMQA 1GV0A 3ZGYA 1PGPA 5JNTA 2FMTA 3MTQA 4RK5A 4DSUA 5M34A 1LSOA 2J33A 4RMJA 3SQMA 3WLPA 4EW1A 4ZRNA 1P2DA 2B4KA 2YC2C 1EP1B 1R74A 2NAFA 2WSLA 5KMGB 5L45A 4IP0A 1KSHA 2FEWB 3OZEA 4KYTA 1DC4A 3IAM1 3WS7A 3IQIX 2VAWA 4JUCA 4BLQA 3TGWA 621PA 1CY1A 2Y93A 3L0OA 4RIIA 5LNK1 2ODQA 4Q4AB 3HY3A 3QU4A 1TM3E 1O8CA 4LGCA 3KP1A 1FS5A 3UAXA 3HP7A 4IILA 3MWLA 5JOQA 2FJ0A 2GRAA 2WM2A 3N8HA 4L8LA 3PWTA 4RS4A 1P61B 4C0BA 3ZC3A 3QPBA 1SBNE 1JFSA 4OUDB 2GCNA 4HDKB 4DVGA 2E21A 3EVGA 4B3FX 4Z51A 5C51B 5JU6A 1SU6A 4LI3X 1PR3A 2NU8B 3CCMB 1P4HA 1W9HA 2FRXA 3NCTA 1V1JA 3PGXA 4ZU1X 1M5RA 1JT9A 4HDKA 4O2BF 4XIJA 9GPBA 1E3LA 1H2WA 4AUKA 3CW9A 1C4KA 3M83A 5EQFA 1VJGA 2HDOA 2QP3A 4WAUA 1DCKA 1RJ9B 3PUYA 5JS7A 1ESNA 3HVIA 3N58A 3HGMA 1IU9A 1CQJA 1RCTE 1W96A 2ECQA 2JJ8A 3QVMA 4IH1A 4O3FA 2VPYA 3AFGA 4NZOA 2X85A 3V1TC 1SUFA 3WWEA 4DWOA 1LV7A 4BNWA 4F7DA 3ZVNA 4LK3A 2DLCX 3OX4A 1KEWA 4YLGA 4X00A 3IVXA 4OH1A 2ZJZA 5A0FA 1HVXA 4Y7CA 1Y3IA 4W99A 4KR0A 1NBAA 1R00A 4RD6A 5AKHA 4D02A 2WT9A 1OJLA 1QOPB 2PRSA 1MB2A 4ETNA 4HWGA 4B3MB 3NMUF 2MWMA 4JX9A 1R0XA 2IH5A 1DRKA 4KXUA 4YRLA 2JAWA 2AR9A 3OA2A 3MM4A 4P08A 1E5DA 5AXCA 1Q0SA 3V00A 1YCGA 4PVCA 2Q0HA 1XPOA 2HV8A 4I55F 4NABA 3T06B 4W82A 5L40A 3L3BA 5IKXA 4NTZA 5ESWA 5IJ9A 2AOXA 1CSEE 3C3WA 1QP8A 4IHAA 3P0FA 4QGGA 4WUVA 2YVAA 2FFRA 4HIZA 2FN9A 1NMXA 1N92A 2PZFA 4L9RA 1JLSA 5COAA 1XTSA 2WHXA 5TSDA 2QTVB 4DY6A 5BMVF 3I2JA 1Y8RB 3QY0A 4B4UA 1N6LA 2H16A 1UF9A 3ZNPA 3PVCA 1EWQA 1JN0A 4ZQGA 4KTTE 4MLZA 2FQ1A 1W7AA 4H77A 2XB4A 5F23A 1L4EA 2OV6A 1GPUA 1Y9EA 2CLSA 2PSFA 3P2YA 1IB0A 3HKDB 4Z8XA 3ZY5A 4OOSA 3LG2A 2ZANA 4U3JA 4MTCA 5ES4B 3K6RA 2JLSA 3LM8A 5HRUA 2Y1KA 4R4JA 4G0XA 4O1IA 1AO0A 1QANA 2C7QA 5EWMB 2C2GA 4RCYA 1KIFA 1NKVA 3UXYA 4JXXA 3C6QA 3UH0A 3TQFA 3HKDA 3I4FA 4RKEA 3IQHX 3NVDA 4KO2S 4Y2JA 3H5TA 1OT3A 3ZGXA 4PG8A 5BPHA 2ZTVA 1T0BA 1JMKC 4MV9A 1UJBA 1QIEA 2NUTB 3FDXA 4QGSA 2BMVA 2OV2A 3C6ZA 4R69A 1WXGA 2DEUA 1RACA 2WD9A 1YS9A 3P9IA 1ZH2A 1YJXA 5A4IS 2B4TO 5ILGA 3R75A 2AVDA 1N2HA 4HXEB 1J0DA 3L01A 2QRUA 1T2FA 4WBNF 3BCDA 1EWRA 2BE7A 4MB6A 4X92A 1YI1A 2DLNA 4IKEA 4MLCA 5ALMA 1PAUA 1O08A 3MPOA 1PK9A 3SJ7A 2CV0A 4PRYA 2EDAA 1QYIA 2UVQA 1KGDA 3M9LA 4N5DA 2I3ZA 3LXRA 3E7PA 1Y4DE 3CNNA 5JQWA 1DKLA 3PQDA 4BTEA 4CETA 1E0JA 1UODA 4QTXA 4WNAA 3NUQA 3TTXA 1AG9A 2O07A 5HCIA 3H1FA 1WZ2A 3WIUA 3IPCA 1YJBA 3IT0A 4NDAA 4UM9D 5IAJA 3HI6A 4QVKA 3WADA 4B33A 2NO4A 1AGNA 4N82A 3WJ2A 4Q7JB 5FTKA 1GGNA 3FCCA 2XF8A 5KUTA 4R2WA 4Q9KA 3C8DA 1X7ZB 4EL5A 4B44A 1CVRA 1VGQA 1W5TA 3FMOB 1UBNA 3R7SA 5JG7A 2WYHA 5BW5A 3L7OA 4QBHA 4KLAA 5FNVA 3BYZA 3GBSA 2IOQA 4GP7A 3L5OA 1PJ5A 2C2XA 2I2XB 4RORA 2W2XA 2XSZD 3GRUA 4NK5A 5DV9A 4OLBA 4NBVA 4WNIA 3N59A 5A0TA 1RLUA 3G0CA 3TKLA 4W7SA 1XMQB 4Z2YA 4RF5A 2VAVA 1UD8A 1PT5A 3CKMA 1SBHA 2ZR7A 3K8OE 3LXMA 4M8NE 1RYDA 2PT9A 3IV9A 4PCVA 4YUYA 3PQ4A 4B6QA 2BGJA 1F2UA 2ONZA 3MGCA 1C7QA 4AJHA 2VQEB 3L4BA 4HN9A 4XQFA 3K4PA 4Z99A 4DN6A 3RUDA 3WMGA 1TKBA 3MIIA 1ZM4A 4C7MA 4B6RA 3D31A 4ZRMA 1QH8A 5FJIA 3AUKA 4Z2AA 2CYCA 3D8RA 2J9RA 4KR7A 2WKRA 2Q7OE 4DREA 1D2AA 1TU0A 5B7GA 3E9DA 1HY3A 1ZISA 3HRKA 1XNRB 5DLQC 2WKQA 3LCRA 1P72A 3MOSA 3C6YA 4XKJA 2MU1A 2VNAA 3A4TA 3AC0A 3ISXA 2Z8XA 1UC8A 3I6ZA 4L75A 3U3DA 2Z4RA 4D3XA 3FGZA 4HNRA 3ESAA 1VMEA 4GKJB 1CVIA 2Q5QA 4PYKA 1NWHA 1PUIA 4QUBA 3UANA 5GZ1A 1QGZA 2ZI7A 4OAQA 4AN0A 1BDBA 1ODCA 1ZCZA 2VHCA 3Q9LA 2HJHA 1E96A 4AP9A 5K8CA 2OYNA 4FFWA 4IIGA 4CHGA 1JHAA 1Z47A 3EA0A 3WNVA 3AEKB 1SHUX 1D7AA 1IVSA 3ASUA 2PCLA 3E2IA 1OPRA 4RY9A 2HJRA 3V7YA 1ZNQO 3DAYA 1C9KA 2IEIA 3CLRC 3JQCA 3GP8A 3A6LA 4WKBA 1K7CA 1JSCA 1L5MA 2X6RA 2FWBA 3HP1A 3OQIB 3OKAA 3ADCA 4XFKA 5AHRA 1CIJA 1UBSB 4YMSA 3IAM6 3MMNA 2PGXA 3KQOA 4GW3A 1WAMA 4RF2A 5DWVA 3K30A 5GM1A 1SQ6A 2VBVA 1T9ZA 2VYFA 1VKZA 3GJXC 4HAXA 5LNK6 5COQA 1QQBA 1CERA 3DBOB 1Q0LA 1FY2A 2PBFA 1UDRA 3P2KA 1DL5A 3LUDA 2V1UA 3DZJA 3H16A 2VFAA 1XAJA 5THQA 4OOVA 3SKBA 1UBRS 1OROA 4QUEA 1U8TA 1VC2A 3VNBA 4JWKA 5TEWA 2YZ7A 1CEEA 1US8A 4RLSA 1WU7A 5E1MA 5ANRB 2BDUA 2I66A 4Y2TA 2R48A 4CCWA 3THRA 4AZSA 1AKNA 1Z0JA 1X7WB 2QD2A 3B9QA 3CZRA 3VO1A 2P65A 5DTQA 4B8YA 2GWRA 4J0KA 2J59A 3NPMA 3IV6A 4WOJA 2BBOA 3TI7A 2M1ZA 1Y4AE 3EULA 3TIFA 4DSTA 5KB3A 1BFKA 3FTNA 3RIHA 1XALA 2G08A 3RUEA 4QDXA 3ZLBA 5IX8A 1NOIA 2DFNA 2ORWA 1N1EA 3B6MA 2ADMA 3DCIA 3WB9A 1PQWA 1T8RA 2ODEA 4BYGA 1VLVA 1XLUA 2NV2B 2VWQA 1RBQA 4FEEA 3AVVA 1EVQA 1R27A 4YIHA 2KBEA 2HQRA 2TMGA 2SNIE 4G9GA 4BDSA 1E2IA 4PLHA 1GAEO 3PUMA 1TZ2A 3I9FA 4QUHA 3RC8A 3RJ9A 3OLCX 1JJBA 3FVVA 3O1JC 2HFKA 3UT6A 1I94B 4DLBA 2A59A 2EERA 2ST1A 3OQHA 3PNVA 1W76A 1CUZA 4JJAA 4N39A 3BJIC 3RSOA 4TSFA 4NOLA 1SU8A 5BQXA 1TUGA 4BKRA 1C0KA 5BQFA 3OOHA 1KKUA 1Y6JA 3IQFA 3JYHA 4B85A 2DQKA 2HJSA 2XD4A 2B30A 4KIUA 1Z39A 1EBUA 4PPFA 5HF8A 1JHXA 5LOVF 2CLEB 3J7TA 1JLRA 3ZJ5A 3AB7A 2Z58A 2YV3A 2HBZA 4CEHA 3QFFA 4R3UC 4RKRA 3G0HA 4MB0A 3NHKA 1QTIA 3QZUA 4L9SA 4X3PA 4B6JA 1KRWA 2F1LA 4NCNA 2I8CA 3JAKB 3CU5A 3EXEA 3IVCA 3L7CA 3OPYB 4LOAA 1D1PA 4NAHA 3CZMA 1X1TA 2P2DA 5JISA 1E1YA 3RVRA 1XT6A 1Z83A 2FWAA 3H75A 1JX6A 3MHPA 2LIVA 1EVYA 3KJZA 5P8WA 2EGUA 1ZKDA 2QYHA 1M72A 3C3PA 1THZA 3OPYA 2H1CA 4BFUA 1KDYA 3FAKA 1KVQA 1M6NA 1XDGA 4BQOA 2JAUA 1BA2A 4FJ1A 3D64A 2QRQA 5CYOA 5AVOA 3HM9A 4JB3A 3VOTA 4GNRA 5JUWA 4TOIA 3A32A 2OHHA 1MN6A 3GT0A 4O4JF 3DMFA 3JQDA 1YRQA 1T2CA 4O4IF 2FF5A 4N9WA 4C2UA 2WUWE 1NDQA 1C1DB 4GPIB 1PZHA 4HDSA 4B45A 4C87A 4NE7A 3S7TA 2WE8A 1NYTA 1A5TA 1TYEB 1E4OA 2CCGA 3PHLA 1SHLA 3PR3A 2BTEA 5REQB 3BE4A 4L1KA 4G4SP 1XK6A 2OG1A 3V8NA 4F6RA 4GLLA 4R98A 1ZO8A 1N6RA 2P9HA 1BJKA 3GCDA 3AFHA 4JGGA 1Y48E 2YICA 3T7SA 1RQGA 2RB5A 3HFSA 3WKCA 5BR4A 3MAJA 3R5TA 1MQ9A 1P7PA 3T4EA 3LWNA 4JFAA 5F4ZA 2HSEA 1SXJB 4GT1A 5BUCA 3ZZUA 2V54A 1EH5A 4UQLA 1QV7A 5MGBA 2OSBA 3DE1X 2FETA 4GRIA 3DZHA 4DSZA 5E38A 3MFYA 4TS9A 1XE1A 5B1DA 1Y3DE 3FIJA 3CB2A 3R3YA 2OC9A 2WAMA 4KI7A 5H81A 1V4NA 1SRQA 2HT6A 2L82A 4NLLA 1ARZA 1VQKB 1BKDR 2AE1A 1U7HA 4PLTA 1LZKA 4XZ3A 2NUBA 5DXJA 2PU5A 3T4UA 3OAAA 5KOJA 3SQNA 3FFAA 4IZIA 3WXMA 3TCXB 1O57A 3WRXC 5FV4A 2H29A 3VNVA 3DZCA 3IC5A 3A6ZA 2I9KA 4LYHA 2G7ZA 3V8MA 4XN3A 3PRKE 2GK6A 4DV2B 1KIAA 2C8JA 1XRPA 2BGWA 1K7YA 2IXAA 1KY3A 2W4IA 1WO8A 2QSUA 1J0AA 1JG6A 4Q1EA 5H02A 2A8YA 2VAPA 3VR3A 2H0AA 2OXIA 1FYEA 1RYHA 2CKDA 1Y1QA 3H42B 1TL7C 4DC9A 4EKGA 5BN3B 5JSHA 2VATA 2GEDA 1FFXA 4FHFA 3L1JA 1D5WA 1KMIY 1F5SA 1EB9A 4TKMA 4DR4B 4HEQA 5EXPA 1LA2A 2VXBA 3H13A 3NGLA 2G1AA 5HIJA 1XRSB 3DP9A 1M2FA 1W46A 3ZDQA 4HWRA 1C9JA 2FX5A 3CLHA 5FFMA 2AA3A 3KYCB 2WDPA 3ANNA 3GGOA 4CCYB 5J1SB 3MS7A 1XEXB 2XUDA 2MMCA 1E9CA 3I9NA 1CUUA 4MGEA 1NFFA 1TZCA 2ODWA 2JEZA 5D00A 5IJAA 4U9IS