3H9NA

Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target ir66.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target IR66
rcsb
source organism Haemophilus influenzae
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3h9nA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3h9nA01
3H9NA 2DOGA 3A1PA 2DYIA 2F1LA 3HTRA 2QGGA 1PM3A
chains in the Genus database with same CATH superfamily
3ASSA 3GNGA 1QMCA 1VLYA 3RKXA 2K5IA 1VQPB 1K0XA 3O8VA 4AVZA 1AHJB 4HE6A 5D6XA 4MDWA 3SWNA 3EG3A 2XICA 3JCMd 1OPLA 2DCUA 3ZIAA 1Y0MA 3E9FA 3SDZA 3OW2B 3BH4A 3OFNA 5TY0A 1MNDA 2DETA 5IK2A 4HE5A 4JDSA 2YRDA 3CPWS 2F69A 4UC4A 3HL8A 3CCMQ 2ZPGB 4JMQA 4FU6A 4C0DC 4M75F 3DKMA 3T9NA 3PUMA 2CP3A 2KE9A 3QSUA 1WI7A 3UATA 5L46A 2IPOB 2PUKB 4FSSA 4WZTA 3M53A 1X6BA 5IYQA 1ZSZB 2X51A 3VS2A 4M77C 1K8AR 1CKAA 1FNBA 1E1RA 2DAQA 2BV3A 3GVKA 2M9UA 4KH1B 2QEXA 4J9GA 1W6XA 4FXUA 2VYTA 3CCQT 1U3OA 4H9GA 3SWNB 1MABA 1D0XA 2MPXC 4Y91A 1BB9A 4Z4ZA 3OEEA 3C0CA 2RPNA 4M75G 4RD1A 4AFUC 4HCZA 4G1VA 3TSZA 2NV4A 4M78C 5FIUA 1VOMA 3MEWA 2FVUA 4JLGA 4CI0C 2J6KA 2VASA 3CCSB 2JW4A 2ZBVA 2FHDA 3QWYA 4KH0B 1SKQA 1G8XA 3EFOA 1G3SA 3URGA 3I9QA 1YHQQ 4PGOA 3RR6A 4M7AD 2CGHA 3KEWA 1VQPA 2QTXA 4NOYA 2D0NA 4AC9A 3CC7T 4FIBA 1NPPA 3G71Q 1D1CA 2ZGWA 2V7UA 2L3SA 2O4XA 5GAOl 3GVLA 3OYAA 3CC4A 1TVCA 3CQTA 4RLZA 4PK4A 2I1LA 2L0AA 4C92F 4BUGA 1GBQA 2ATCB 4M7AA 3ES9A 2ZL6A 1R5BA 2GGRA 3ZUGA 1YJWB 2LCCA 5DLQE 3W2GA 1B7TA 2RJCA 3GIRA 3X28B 2JJ9A 1ZUUA 4DEYA 2VXFA 1H8KA 2FEIA 2RO0A 2RQVA 4R0KA 3OYLA 1W1FA 1VQMA 4JRPA 1KRHA 3X24B 1R0BG 4RD4A 1N0UA 4QV2A 3E2UA 3SKBA 3EFOB 1NG2A 2DBKA 2DM1A 3GSIA 5A8AA 1JJ2B 1G7CA 1N8RU 2V7TA 1WXBA 1I0CA 1LNXA 5I2SA 1TXQA 1Q82R 3OOCA 4RCCA 3CP8A 1J9ZA 1GCQA 4TVRA 3OZWA 2JMAA 2WSCE 4XTWA 2M02A 1QQJA 5KCOA 3EG9A 2J6OA 1UGSB 2XDDA 4IUUA 5IHNA 3CBPA 3CCJA 4PAAA 3V7AA 2K3BA 2VBVA 1XOVA 1XNIA 2SEMA 3PVQA 1VQ9T 4X05A 3VS3A 5KYYA 1T0JA 1YNZA 1NPRA 2KBTA 1SSFA 3O5ZA 4LN2A 1K9MU 2DBMA 3EGDB 1OYXA 2K57A 4M7DD 4LDYA 1V0FA 4OB0B 1VYTA 1WHKA 2I2LA 3VU3C 3JB9J 1QW1A 4OPOA 4DQLA 1NM7A 1UJ0A 2P0PA 2OK7A 2V7WA 3PVDA 3PVLA 3RKYA 2MIOA 5GANj 2WSSA 3KBGA 4B47A 4IUPA 4PFPA 5HK3A 1G2BA 1ZX6A 1M8MA 3JB9F 2E1RA 3PA1A 4XLAA 1FRQA 2LX7A 2G6FX 1OZ3A 1YCYA 4E7LA 2XD0A 4XTYA 4DOVA 1YCSB 3OZVA 4F7UA 2PMDA 2XGJA 4XORA 4XOPA 2A0FB 3AVWA 1CSKA 3N5BB 1HA3A 1Y96B 1UD4A 1VLOA 1YFNA 2D9TA 1R77A 1VQ8T 1WHLA 3OY9A 2VNHA 2VNIA 2K6DA 2BVNA 2MF2A 2NYSA 2ZPBB 2NUTA 2C5HA 2DO3A 2E5QA 2KR3A 2P84A 1QCNA 1JRIA 2KK4A 3AGQA 2C0OA 2HEQA 3QYGB 8AT1B 4JJNK 3M0TA 3UT1A 4BE0A 3NTHA 1W70A 1GO2A 2WYRA 4HCCA 4KGXB 2GJRA 1XTDA 4FCYA 3JCMJ 1M3CA 2M5SA 1RQRA 3SEJA 3PE0A 4FYXB 3EGXA 3R6NA 2RM4A 4AG2C 3TEEA 1TUDA 1YJWQ 1BPLA 3QDRB 2HLDA 3RKWA 1O9SA 3VS4A 1UUEA 1HXDA 1QVGA 1W0JA 4RTUA 3B78A 4TMVA 4XMYA 2JUFA 2XOKA 4J9DA 2K4YA 1AEYA 4EMKB 1M2VA 1I1JA 2WSEE 1YITQ 3NPFA 5A88A 3C12A 4Y28E 1N08A 2CT3A 3VMFA 3VS7A 3V76A 2ZPIB 3AHUA 4XTVA 2EIFA 1IHWA 2GTOA 4RUGA 2VXEA 5LJ5e 1D0YA 1WXUA 4OMLA 5IYNA 1U5SA 2CZ7B 2X3UA 4HVWA 3BY7A 4ANJA 4IKFA 1E62A 2V7VA 1IZ6A 4WZLA 1BBZA 1VQKQ 3WQZA 3L2QA 3L2VA 4QW2A 4NL2A 2RI3A 1YHQA 4N4IA 3REBB 4BI3A 1JEGA 3HSBA 1KD1R 4XLFA 2BM0A 3ONYA 1GCQC 1VQ6B 1RAAB 4C8QC 1G7SA 2DE0X 3NFCA 2W6JA 4XU1A 5CO7A 3UWNA 1SG5A 1A8PA 5GAN6 3OYHA 1RADB 1SM4A 2ZPHB 1E3XA 4XR6A 3CCLA 2DL7A 4PFZA 2EGAA 4ACAA 3ZBDA 3JB9G 1K9MC 4KGVB 3E9GA 1N05A 4E7ZA 4BDZA 3QKJA 1ARKA 2XI9A 3QBYA 2XEXA 2PTKA 4IW3B 3BCDA 2BUDA 1E63A 1YITB 3R6OA 4KUIA 3U6KA 4HT8A 4KUDK 2B8AA 1NLOC 2PVOB 2CREA 5A0GA 2V7QA 3L42A 1P92A 3E1SA 3W2IA 2DYBA 1X75C 3CB4A 1Y57A 1WDTA 2PQWA 4GLKA 2KMTA 2R9VA 4JRQA 4AT1B 2RA2A 1YJ9T 4L6V5 2XKOC 4RTTA 2GF7A 4MYTA 1JO8A 3BE3A 3PIPA 3AVYA 1GR1A 3RERA 4C8QE 2YUNA 3QSYA 1XQBA 1OOTA 2DILA 1GRIA 5EC7A 2YWEA 3FPKA 2BZ8A 5KYUB 1IHVA 4OOSA 2OAWA 1QLYA 2L8DA 4K11A 2AZSA 1YJNT 1E3ZA 2VJJA 4XM3A 3WVDB 4X9CA 1COWA 2JJ2A 1S4MA 3OYNA 5F4OA 1KHCA 3QJ6A 2F43A 5LJ3d 3V7RA 1M27C 4AF6A 2CT4A 5CCAA 1D3BA 3A5ZB 4ESRA 2QEXQ 4KKSA 4PC3A 2RJDA 3CCET 4M53A 4YAFA 2KDSA 5L8RE 3M54A 1IJEA 3G71T 1XQHA 4WF2A 3BDLA 1VIFA 2CP5A 4FT2A 2PVDB 3QFRA 1TUIA 3KXTA 1UD6A 4X7DA 3REAB 1X2KA 4M2LA 1TWBA 2D9RA 5GJVB 4Q5WA 3ER0A 3L2WA 3A8HB 3PIOA 5CQYA 2ZTNA 2MMPA 1IB0A 3TU4K 2C06A 5FL7A 4ZN1A 4MMLA 1KQ2A 3G71A 5FWCA 2W6IA 3VRYA 4L8JA 3M55A 3RNJA 2BGJA 2JIZA 2NUTB 1VQOB 5GMKm 4M75C 2JTFA 4A4EA 2DKGA 2V8JA 3V7CA 3RUXA 2NUZA 2QEXB 1IRXA 3CMMA 4Z8AA 2KRNA 4TSFA 3L2ZA 4F7UG 1CNFA 5J3BA 2PLFA 5CIUA 4RG2A 1QUFA 3M0SA 3JB9D 2G3RA 2LJ0A 4TMTA 1KSWA 2EYYA 3CCQA 1WA7A 2GREA 4E7IA 1PJ5A 2C77A 1K8AU 4PJOE 1E6GA 2EQMA 4LE9A 1QFYA 3V8LA 4XKVA 3G05A 1QVFP 2F5KA 3JU4A 4BDYA 1PG5B 1VHOA 2CZ0B 4G6IA 2X6WA 2MWPA 3FLGA 5IAYA 4KBMB 3A98A 1KK2A 1VYVA 1M1FA 1VQNB 2Z6BD 4C8QD 1YITT 3CMEQ 3CPWB 1QG0A 2HBWA 4XTUA 1ACMB 2C0IA 2RNAA 1UHFA 1WOPA 3ZL7C 2F2WA 3ZPNA 2ZXIA 2EW3A 3I55A 3SB2A 3VNUA 3QZ9B 4DBFA 3SLDA 3X26B 1T3LA 4DEXA 4ZTJA 2CSQA 4DK0A 1W0KA 1T3SA 3MP8A 4XU2A 4RTYA 3OYGA 2HBPA 2M51A 1V29B 2E65A 5GAMe 3CP2A 2HAXA 2P3MA 1QWFA 1I4K1 2X9HA 3OYEA 2AT1B 3CCQQ 3JQRA 3MPUB 3NMZC 1JJ2A 1Q86D 3QFCA 3CCEQ 4M7DC 4XN3A 1VQ8A 4P12A 3V7SA 1UJYA 2COYA 1NYFA 1W35A 1Q86C 3KFVA 4PC2A 4FSXA 1G3TA 4II1A 2YT6A 1KK7A 2DL4A 1GJRA 3M4GA 4UZFA 1E79A 2YWFA 1YJWT 4J9EA 2EBPA 2KT1A 4EMKA 2XZLA 1N9RA 1N06A 3X25B 3C94A 4A4HA 2FPEA 2VZLA 4Y9RA 2LZJA 1K0SA 1ZLMA 4PJOF 4CC4B 1RLQC 3LQEA 2M1HA 1WZOA 5I21A 1VQOA 5H59A 3R6KA 2YXYA 5IT9E 4ME7A 1B34A 1YJ9Q 3C95A 2C78A 2CKKA 4WCIA 1IREB 4AFZC 3VS6A 3DB4A 3BC9A 4M75E 2ED0A 1TH7A 2FPDA 5GAMj 2CZ6B 5GMKi 4DBRA 4ZNXA 3CD6T 3F70A 4M78G 5GV7A 4IIMA 1B07A 1PJ6A 4EH1A 5AT1B 3J81k 2E70A 1V0EA 4LUDA 4AFSC 1SHGA 1WSVA 1R8OB 2J06A 2JVVA 2FRYA 3CCUT 2LCSA 5GMKl 3A35A 5B6IA 3OYFA 1H8HA 4M75A 3OYCA 4J9IA 5FRNA 1VA7A 2KGTA 3EFRA 4RCBA 2JTMA 3V8JA 2QEXT 4YAWA 4OGCA 2C4UA 3RMQA 4QQGA 2FL7A 4B44A 2EJ9A 2YUOA 1Z9ZA 4KGZB 2B7CA 4C92E 3WY9A 1BI1A 2QTVA 4B4DA 4IURA 5D7UA 1SPKA 3ZZUA 1VQ8B 3LLRA 2BPOA 3T51B 4B3FX 3ASPA 2EKOA 1Q9SA 2KYMA 2DZCA 2CP6A 2X3WD 4ZCIA 4DQKA 1JXOA 2SRCA 3WXMB 1NJIU 3GIBA 2J7KA 4DK1A 2J05A 2VWFA 1KQSB 1VQ9Q 1QVGS 4FM4B 4XQ3A 8ATCB 2PU9B 2Y4YA 3WYAA 1MV0B 2A37A 2K3YA 3VS0A 1M1GA 3FJ5A 2KVOA 1VQ6Q 1JB9A 1BCOA 2RQUA 2WZPP 2JS0A 4M7DG 2DMOA 4XKWA 1RQPA 1KMHA 3LH5A 7AT1B 3ASKA 2EQKA 4M77E 3OE7A 5KW9A 4EIKA 1UEBA 4B43A 2X35A 3M0UA 3MCAA 1YJ9B 4OB2B 3LO8A 2LNVA 3MO8A 2V8IA 1T6ZA 1S1NA 1KC8D 5IYPA 1K76A 3D7SB 3CCVB 2K5LA 1GFDA 3GF5A 3GOXA 3OW2A 1X01A 3GLXA 3KUFA 4JJDA 3CCMT 2OTJT 5GANg 2HQHA 1G3WA 1ZA2B 2P0QA 1QVFB 2CUBA 2RQWA 2PIAA 1ELOA 2LQ8A 1SSHA 2A3LA 3OW7A 6AT1B 4DA4A 4EMHA 4JS4A 2ZZGA 1EWYA 4C0FA 1VQKA 1EIFA 3UA6A 2XU8A 3HRSA 1M1KD 4IUVA 1VQ7Q 1YI2B 1OULA 4TMXA 3CCEB 3E19A 4XQFA 3SJPA 4BACA 2GJKA 3CC2T 3BW1A 1NBMA 3W2EA 3OA6A 5GAN7 2DTIA 2DVJA 2X0KA 1EFRA 3OS1A 4XU0A 2YLCA 2QDYB 2LQWA 1EX4A 3OJWA 2VGMA 4EDUA 2EJGA 3I56Q 4RPDA 5TV2A 5IH2A 1X69A 2K3XA 1X43A 3JCMf 5KYWB 2ROLA 2A08A 1UDLA 4OMMA 2XHCA 5FU6B 4A63B 2CF4A 5KNLA 1VQ5Q 4OB3B 2DYIA 4OMFB 3W5UA 1VQNQ 5FNZA 3OQ5A 5BSYA 2LDMA 5FO0A 3ONUA 1FNDA 2L5QA 3H0IA 3S3OA 1YI2A 1MMAA 1EP2B 3ASRA 2X3XD 2H3EB 4BE1A 2WPDA 2GFUA 2OTLA 1ZBJA 1KK0A 4UZEA 4G7WA 3FC3A 1UGQB 1QP3A 3OYKA 1KK3A 1Y0YA 1VQ5T 1H92A 1PC0A 2E3HA 4XLCA 2JTEA 1OU9A 1YIJA 1NJIC 2JN0A 2CS7A 1QFJA 2CYZB 3Q1JA 4N4GA 2KVQG 1OHHA 4YHBA 1XJWB 4DNTB 2QA4B 1SKUB 4QHYA 2IVWA 1HYOA 2QG9B 3PGGA 1NJIR 4B3XA 5HKKA 2QK0A 1VQOQ 5GANf 2GNCA 1ZM3A 2LQNA 4M0LA 5DS0A 1IHMA 5IN1A 4WQMA 4LUEA 5J35A 4EMKC 1YWOA 3AVXA 5LJ3h 2P0KA 3CMAB 2DJQA 3Q3AA 3C4SA 2RN8A 1T0HA 1KQSP 3A8IA 3OYJA 5HKCA 3WBJA 1VHEA 1YLOA 3DB3A 4ZV4A 2OTLB 3NHNA 4J9CA 5KYNA 2ZL5A 4FT4A 1DJ7B 1B34B 2HKNA 1BK2A 2EWNA 4X9DA 3OYYA 3MHXA 1BX0A 3P8HA 2JOYA 3E20A 4HCKA 2BE7D 2DD5A 4BD3A 2Q6IA 2QQ9A 2VB6A 4BI4A 2LNHB 1WORA 3UF4A 4LDXA 2CW5A 3CD6B 2X4JA 2K2VA 3LWIA 3OS2A 5FU7C 3DLLA 1QFZA 1QVPA 1UGRB 2HDNB 3CMEB 2E41A 4JPBW 5DY9A 3M0RA 4M77A 2AHOA 2RHIA 1B3QA 1VQLA 1RABB 1M4ZA 1BKBA 3ZZTA 1Q86R 2VVKA 1PSEA 1ZHIA 1KQSS 1KHIA 5LJ3f 1ZBXA 1HD3A 4Q7JB 3S3MA 5F4JA 1RAFB 5CKBA 5GAMd 3EG1A 2B7BA 4X0CA 3OYDA 2WR8A 4ORZA 2DL5A 4J6YA 4RPBA 3JCMQ 4DOWA 3I56T 3AT1B 3HPWA 2HMAA 2DZ9A 5GMKj 2EFIA 1RI9A 5GAN5 2GJPA 2CH4W 3CCSQ 1VQ6T 3CC4Q 1RI0A 4P6VF 5GAOn 3CPWA 4AMCA 2ENMA 1YBYA 1MUZA 2DJZA 4RKUE 5HXBA 3CCRT 3JCMh 2ED1A 2RHYA 4BY6B 3ISXA 4Y9UA 3CC2B 4A53A 5KYWA 3VUZA 5LMZA 2M0OA 3TREA 1ZQ1A 3JCMV 1DARA 1S72T 4F7UB 1WHJA 2NLUA 3ME9A 4RD2A 1AIPA 2HD0A 2IIMA 4A54A 3Q39A 1NDHA 2B86A 2HSPA 2E64A 3ULRB 4C0GA 1HK9A 3CCQB 3QZ5B 1LOJA 1TU0B 2CP2A 1A0NB 3PTAA 4N0AA 5D6WA 5I11A 1VQLT 2VV5A 1M1KR 2E6NA 1QUEA 1WXTA 4PL6A 4M7DA 1YITA 1D1BA 2V8KA 3TQ7P 3VV0A 1RAHB 2JXBA 2VYQA 1SHFA 3QUIA 2X6YA 1I8DA 3VJPA 1TLLA 4XLEA 3CXCA 4HVUA 3VS5A 3FIFA 2GFAA 3SWNC 4JRIA 4M4SA 3BY2A 1PCXA 3G4SA 3A8OB 1GVHA 4KKUA 2L3PA 4QKUA 1VQMT 4N3NA 1D1NA 4NBSA 4J9FA 4P26A 1VQLQ 4M75B 5GMKe 4X7EA 4C8QA 1EFTA 2HL5C 2OTLT 1H42A 2LJ1A 3A8LB 3BFMA 2DRKA 5L23A 2QASA 1WGSA 1VQLB 3DLMA 3H8ZA 2X4YA 2ZAEA 3BDUA 5J26A 3CCUQ 3Q38A 4KKTA 4A4KA 1MNEA 4YXWA 3H9NA 2J7IA 4C43A 3A1PA 1IGQA 2H3JA 3QHSA 2V31A 3QWXX 4RDKA 1WJQA 3QO3A 3CD6Q 2DTHA 2MWOA 1QCOA 2QMUA 5GAOq 2HSEB 1VQMB 4QUZA 3EG9B 4XTZA 1G3YA 1PKTA 4RTWA 3THKA 2DL3A 4OMQA 2F1LA 5FROA 3NGPA 4X34A 4XTXA 1D1AA 2O2OA 2EYQA 4PJMA 3RY8A 4OVAA 3AGPA 5HZAA 4F7UE 3L2RA 4RD3A 1M2OA 3QIIA 2Z0WA 2EFGA 4F04B 3CCRB 1W2BB 4RD0A 3VNVA 1UECA 2YRVA 1H8EA 1WP6A 4BE2A 2EYZA 2DTOA 3CMAQ 4EPCA 1BJKA 2F5TX 4X8IA 2XZOA 5KH6A 1W2BS 1QVFA 4EMGA 2RHZA 1EXMA 2E5KA 2EQIA 2E1HA 4U9UA 3WNDA 1IO6A 2PVGB 2FZGB 2LT4A 4DNRB 2LQKA 4P3YA 4M77G 3CD6A 3PMIA 1MRZA 4FL6A 4X7FA 1I07A 1SEMA 1PSFA 2Q6OA 1TG0A 4QVCA 4B48A 2RHUA 2DXCA 1BIBA 1UTIA 2FG0A 1JU5C 1QP2A 4LDWA 5GAN3 3KL9A 4HKEA 3HRTA 3HAGA 4RTZA 3M0QA 4XL9A 2DFUA 3TVTA 2D74A 3VYHB 1D3BB 2JNGA 1EFCA 1PD1A 4OMPA 4G7XA 1NE8A 2RI2A 1V5VA 1Q7YU 4XNFA 1VQNA 1K9MD 4B3GA 4ZN3A 1QX4A 5EMNA 4QQ6A 4OP0A 1Y07A 4R71A 2DL8A 5BSXA 1U1SA 4FW1A 2OTJA 2QI2A 5KYXB 2ZZEA 4PKCC 1Q82D 1AT1B 3QYHB 3QJYA 4JS5A 1ZSZC 1K73C 4F7UF 2P4TA 1Q82C 1M90U 1BCMA 3JCMc 2JJ1A 4OPSA 4ZGNB 3CCMB 2MCNA 4PJOB 3CPFA 1IB8A 5FU6C 5HK0A 5DSZA 5FLXE 3P8DA 1VQOT 4WZKA 4YAOA 2D6FA 2OYNA 1ZM2A 3CC2A 3H94A 4QT7A 5LJ5j 1Q82U 1K73R 4BPRA 1R0CB 1M5Q1 1WHGA 2K5FA 4M78E 1T5EA 3MHPA 2LVMA 1XFOA 3ASTA 3EH1A 2LX9A 4HXJA 1VQPQ 2LMJA 5IYWA 1OB2A 2O01E 1NJID 3LGLA 1X6GA 4LBZA 4ZGEB 1YI2Q 1VQ7B 5FRMA 1K9AA 4V2SA 3G71B 4L59A 3FJOA 3OW2P 3NE5B 3CC7A 2F1MA 2D1XA 2CC2A 1OB5A 2RK1A 4Z4VA 2X53S 1VQ4A 1UFFA 3MP1A 5GAN8 4FN5A 2QYZA 4M78F 2QQAA 1RAGB 1E1QA 1H641 2KRSA 3OAAA 4X07A 2NUPA 4ZTFA 3CESA 2BMWA 5TR9A 4NS5A 3Q6RA 3JCMg 2QDLA 1WJSA 3CCVQ 1BX1A 3FRNA 1BI0A 2YUPA 1OI1A 1JJ2S 4A4FA 1YN8A 2RC6A 1Y96A 1WLPB 4PC7A 3OPOA 4M77F 2RHXA 4N4HA 3AVTA 3META 5DLOA 3Q6QA 1C1AA 2YHTA 4M7AB 1SF9A 2QDXA 2MOXA 2V1RA 4PJOG 2RJEA 4Z89A 1QGAA 1K28D 1TOVA 3QXEB 3SLNA 3QDFA 5M9OA 3CCVA 1FX7A 2R57A 4TN1A 4B9WA 1MMGA 2DIQA 3X20B 4ELZC 4ATOA 1T6YA 4J0QA 2CK3A 5LJ5g 2A36A 4XLHA 1LPLA 3CCMA 1YX2A 3RIRA 3EGXB 3MEUA 2BF4A 4C92A 3JAME 2O88A 1ABQA 2OAUA 3AVUA 2EQJA 2D3NA 2FRWA 2O31A 1NLPC 2E1BA 3G6EB 4C0SA 2BKDN 1LCKA 4R55A 1QWEA 4O5VA 5GAN2 2GBQA 3JCMX 1AMOA 4PJOC 1M3BA 1OX9A 3EHQA 1EZZB 2YRCA 1NRKA 1KC8C 5LJ5h 4PJOD 3VO1A 1FYNA 1BI2A 4YTLA 2DIGA 2L3RA 1S72Q 2RD1A 3A3GA 2HQXA 1VYUA 4E6RA 4YEJA 4JLIA 2OBTA 4R56A 2QGFB 2ABLA 1PRMC 4X1VA 1AOJA 3NTIA 3FPPA 1V76A 4RTVA 4RCZA 1H85A 5EG2A 5I2MA 4P22A 4Z1MA 3EGDA 3W5HA 4B9XA 1YJ9A 2BSAA 5GJWB 4P5NA 1G7TA 2EJFA 1WOOA 1M30A 1N8RC 1ZM9A 1UD8A 3LWHA 1M1KC 3U23A 4TKOB 1C6VX 5KCHA 1UB4A 1JNYA 1LVKA 4JJCA 2DXUA 3J81E 3UPUA 4LBVA 4E7HA 3FJPA 1YHQB 3OEHA 3BQJA 2BIVA 3JQQA 1ABOA 2DVEA 4JUVA 3SJZA 1KD1C 5FW9A 5A89A 1WQWA 2VC8A 2GK7A 1N5ZA 4LC0A 1K8AD 4M7AE 4PJLA 2K9GA 1JJ2P 1SRMA 3LW5E 3QG1A 2KEAA 2LC4A 2ZZDA 2EQUA 1MMNA 1YJNA 1K8AC 2RC5A 3EG0A 2JN9A 1RAEB 2C2WA 2AZVA 3JRZA 4KRTA 5F4MA 4RD6A 2OTLQ 4Y92A 4LBWA 1XB2A 2V7XA 4J83A 1U1TA 1ZUNB 2X8KA 2ZCFB 4KT0E 2QA4A 1X6OA 4C0DB 1UD3A 2RF0A 3B8HA 5TRDA 4CC3A 2LCLA 1AWOA 5HY6A 1VQ9B 2VNJA 2A7YA 3G4ST 2WZNA 3HHTB 3G6EA 3V8KA 1DG1G 4ROXA 4QVDA 3GPLA 3ZBUA 5GANd 3PENA 5A2QE 4LXCA 1UG1A 4MZMA 1GBRA 4M78A 3MMPA 2MK5A 3EGUA 3PA2A 9ATCB 5CKEA 2MYSA 1NYGA 5IXBA 2YLBA 2VBSA 4NL3A 4X7CA 1KTVA 1N6AA 5AN9A 2CP7A 3E1YE 3G7ZA 4MDXA 2YWGA 1PKSA 3LH0A 3WNBA 4J6XA 4N3GA 4LD6A 1VUBA 4O6JA 4C5EA 4Z4SA 3M57A 1KJWA 1VQKT 2QQRA 4HCBA 1BMFA 4N0AC 2XZPA 2K7AA 2DLPA 3CEYA 2Q6KA 1WTHD 4HVVA 2ROTA 1I5OB 4YAUA 3JCMW 2DEQA 3S6WA 3DDYA 1YIJQ 2VBUA 1VQ7A 5FWBA 1CNEA 2ECZA 2QXFA 2WSFE 3ZEHA 3T53B 3CTAA 1KC8U 3FDRA 4YALA 1TUGB 3OJXA 3FB9A 3EG2A 1I7PA 1JQQA 4CQJA 4OOVA 1WJRA 4M75D 1KG1A 1K4US 4QQDA 4PLLA 4YELA 4D8DA 1KQSA 2GTJA 1AWJA 2HKQB 1NZ9A 2E6ZA 2J6FA 1XE1A 1Y0RA 2HQEA 3UA7A 3CCVT 5DM7R 2KI7A 1GXIE 2EGEA 4OB1B 4PJOA 3GP8A 1D8TA 3CMAA 1W34A 3WBKA 1WPCA 3CC7B 2AHJB 4OMOA 4JZ3A 4GBQA 1EFUA 2EPDA 4J9BA 1W4SA 1AWWA 5FA6A 2EVRA 4C5IA 2K79A 3B82A 2QAZA 4QVZA 1DDIA 3OBWA 2RJFA 2XNDA 5HCKA 2FVGA 4CRIA 3I5SA 1B2RA 3M0PA 5IXFA 2OX7A 4MZTA 4DBQA 3EHRA 3INZA 4QVAA 3ZC3A 2CRVA 3RDVA 1W2BP 1ZM4A 1M90R 2BZYA 4ZGDB 4TMWA 3WNCA 2YWHA 1MMDA 1RL2A 2OK8A 5IHIA 2ZTGA 1QGZA 2KRMA 3CCJB 2OI3A 1PRLC 1FMWA 1M9SA 2FZKB 1V1CA 3I55T 2ZITA 4M1KA 1ZA1B 3TSWA 1Q81R 2XNCA 1WX6A 2GQFA 4XK8E 5CQXA 1KZLA 4OGEA 1KJZA 2JM9A 4C8QF 1VQNT 2JM8A 4J8OA 1R5OA 1UD5A 4P2NA 4XAXB 2K2MA 1YJNQ 4LNPA 1I81A 4J9HA 2IG0A 1Q95G 4F16A 1SRLA 1CKBA 3WXMA 2E10A 4UAJA 4M77D 3P26A 3OKXA 4P25A 2KAFA 4BB7A 4WTOB 3LNNA 3VS1A 4C92G 4J7FA 2RMOA 1RAIB 1H3HA 2QA4T 4OPVA 1KD1D 3CCUB 5C6SA 1G83A 4Z02A 1PKVA 1T6XA 5A0LA 4C92C 1N0VC 2O9VA 1GAQA 1MGQA 1NBEB 3ZFJA 1QVGB 3OYMA 2I0NA 1WPYA 2V26A 5GV8A 2XDBA 4IUTA 2GPJA 4II2A 3HTRA 4M78D 5J39A 2PUOB 2JMCA 2X4WA 3UDCA 3JCMP 2BGIA 4OP7A 1WOSA 1VQ4T 4CC7A 1VQ6A 3U6BA 4RDJA 1OPKA 1K73D 2XNJA 3VKIA 1D2EA 3G1JA 1VJSA 1W9XA 1VQ9A 2DY1A 1AD5A 1JB0E 3PFSA 4RMOA 1UHCA 2FPFA 3I56B 4K1XA 4II3A 2XIDA 1KFZA 2YSQA 4M78B 1OGJA 1B23P 2PE3A 2DEUA 3M9QA 1EFNA 4XONA 1E6HA 2R5MA 2CP0A 3I1FA 1BLIA 3S3NA 3G4SB 3MEVA 4PFOA 1VQ4Q 1I5LA 2KXCA 3VR6A 2AKKA 4NNJA 4J5YA 3A3BA 5CK9A 3CXCS 3SD4A 4C0ZA 4Z88A 2LZ6B 4M77B 4MZPA 1GAWA 3HKSA 5LJ3e 5AYFA 1C0MA 2R58A 2BTTA 4KULA 1TTHB 3CPWP 2FO0A 3CPXA 3HP9A 4Z4TA 1MV3A 2QQSA 5KE3A 1VQPT 4M7DE 2NWMA 3LVBA 1PD0A 4GY5A 3AVVA 3CC2Q 4G5GA 2BE9B 5CVIA 5CR2A 4PNOA 1WSRA 2C4TA 5ECAA 2KNBB 4FWTA 2DXBA 1VQ7T 5GAMh 2EIXA 2X4XA 2H8HA 4ZGQB 2B5OA 3PNWC 3CW2A 3D26A 2NUPB 1FDRA 4ZGJB 3RBBB 2OTJB 4AFQC 2NPFA 1F20A 4C8QG 2OBSA 5D6YA 2HCKA 3OZUA 2VGNA 4G1BA 1AVZC 1QKXA 3CCRQ 2DIEA 2EYWA 1EP3B 3MKDA 3CCJT 4HIZA 3I35A 3BNWA 2DPPB 2LT1A 4UZUA 4M4ZA 3I55B 3MP6A 5DN6A 3CCLT 2F4NA 3A8JA 1S72B 2KQWA 3G6ET 2GQIA 1VQ8Q 2WJYA 3OBYA 2FYKA 1CQXA 1VQ5B 5LJ3g 3CCLB 5GANe 4QVJA 3H0FA 2CH4A 2EAYA 4QFMA 3ZZ0A 1PWTA 2D0QB 2QGGA 3I5RA 4OF1A 3SHWA 1F60A 4J7IA 2VJIA 3L2UA 2KROA 3M5AA 1W2BA 3H6ZA 4JZ4A 2PZ1A 2DRMA 4A4GA 3OS0A 1JA1A 1N8RD 5IHKA 2EYXA 2WACA 5LJ3j 2HDAA 1K1ZA 4NCNA 3A8GB 3I55Q 2COWA 3J7AF 1F1BB 1UMKA 4PABA 1TUCA 2ESWA 4XN0A 1HSQA 1E43A 3GVJA 1QVGP 1H3ZA 1FRNA 4JRKA 3OYBA 1YJWA 5GAMf 3HFNA 3P8BB 2C5BA 2OJ2A 4D6WA 5A0DA 4E7JA 4ZCMA 2CBXA 1MHNA 4RM0A 1Y71A 1BQEA 4XD7A 1YWPA 3M4YA 3QPHA 1QCFA 1DDGA 1IGUA 1VQKB 2RB6A 1YJNB 4MMKA 2QA4Q 1FXXA 3CCEA 1N27A 5C0MA 3CBMA 2JT4A 1OQKA 3MJXA 2BN4A 4P3IA 1HZEA 3EH2A 1AZGB 1J3TA 1Q81U 4RJLA 1N8RR 3CCUA 3JQPA 2DNUA 5GAOm 3FEOA 2EKHA 3CC4T 1FWZA 2QQBA 1OZ2A 2V1QA 3LGFA 2CZ1B 3OB9A 4M7AC 3A8KA 2GK6A 2LTOA 2DF6A 5GAMg 4WWVA 2LP5A 4E0FA 4FYYB 1VQ5A 2GQVA 1PJ7A 2Y4XA 1S0UA 1Q81C 3OP1A 5KYUA 4GLMA 3GQBA 2M16A 3HFOA 1WDXA 3CBOA 3G4SQ 2Y90A 4D8KA 3MCAB 5LL6S 1WYXA 1FMKA 2RI5A 1U2RA 3NTKA 3TCJA 1VQMQ 3LQ6A 4TMZA 2FZCB 1OB0A 2LJ3A 3VUBA 3OMCA 3GBQA 2RQTA 4L5GA 4RDLA 2R5AA 2ZPFB 4M7DB 2COZA 2HNIA 5KYXA 1VF7A 4RTXA 4C8QB 4FK8A 2F2XA 2QE7A 2QTZA 3VO2A 3G6EQ 2CSIA 2R6HA 2L89A 3GNFB 3CCLQ 4Y7CA 5I22A 1Q7YD 3M56A 1WHHA 1OV3A 1SKYB 1YHQT 2VUBA 4Z4YA 2QTLA 1BI3A 2YDLA 4F17A 4DBHA 1OGIA 5KSWB 1WNLA 1X27A 4P6YA 1Y7XA 1GL5A 3RMSA 5CKDA 4CC2A 1R5NA 1M90D 2LRQA 2PNIA 4OMNA 4PC1A 1O75A 2QN6A 4TT3A 2BZXA 1WU8A 1FX0A 2L2PA 5J3OA 4HA8A 1ZSZA 2AIRB 4E2FB 4F14A 2A28A 4GQNA 2YWWA 3SEMA 3CXCB 1NEGA 5FU7B 1E64A 5GAN4 2D3LA 4MYUA 3CCSA 3PT9A 2E4HA 2DA9A 1JBMA 1WFWA 4OOXA 4ZCLA 4JJBA 2WJVA 1W87A 3SFMA 3CMAT 2DX1A 3H0HA 1PNJA 1X2QA 4DQ2A 3JCMb 2YUQA 2W10A 5H5JA 5IYRA 2BM1A 5JBQA 1JA0A 5THXA 2O9SA 5KE2A 2KY9A 3FKSA 2JDIA 1D0ZA 1ZUKA 3BY1A 3A8MB 4BI8B 5GAOr 2DOGA 1QVFS 3PMTA 1KC8R 1NB9A 4J6WA 3VRZA 2D8HA 1AWXA 2DD4A 4F7DA 4FYVB 1I18A 1M2VB 2AK5A 3HRUA 2RQRA 1D09B 4ACBA 4IIOA 1NEBA 2ZZQA 2FB7A 3H41A 2RH2A 3IQLA 1OEBA 1HJDA 3CC7Q 4LDVA 1UGVA 3CC4B 4FYWB 3JSCA 2DERA 2O4XB 2KT8A 1BIAA 4RCYA 1N07A 4AG1C 4C92D 3U2QA 1PM3A 2XDPA 1BYMA 1K9MR 1QH0A 1E7OA 1WHMA 2XK0A 2CUDA 1QKWA 4M7AF 1I8FA 4X06A 1FNMA 3JV3A 2KSSA 2HZYA 2MI6A 1Q86U 5HZBA 3CCST 4IUQA 2EGCA 4M7DF 2ZBUA 3QFSA 3M59A 4PJJA 4HT9A 1YIJB 1LJOA 1OX8A 2C0TA 1TS9A 1M8VA 1ZUYA 3VYGA 2ZZFA 3T56B 5GANh 2DK3A 1UD2A 4FW2A 2VNKA 1YP5A 1U06A 1PHTA 1WIEA 2HL3A 5CKFA 1YIJT 3CMEA 4PC6A 4RG8A 2HCJB 2ZL7A 2ZPEB 3R6JA 1Q81D 2OTJQ 1Z9QA 4AF7A 3OW2S 1KIKA 4M7AG 2DXTA 3OS5A 1N9SA 4XOTA 3OMGA 2M0YA 5CAIA 1OU8A 3P27A 1RUWA 5LJ5f 2RK2A 2XG8D 1RACB 4ELYC 3JB9H 4Z4RA 3L1AA 1YI2T 1Q7YR 3CMET 2E3IA 3WVEB 2D8JA 4LBYA 2E12A 1M3AA 5KYYB 3QFTA 2F2VA 5CDFA 3ZBTA 3EFSA 1JXMA 3ASQA 2GCXA 1G5VA 1U8RA 3OYIA 2VKNA 1BU1A 1P4MA 2OBRA 1RLPC 3OSVA 4E7KA 1G7RA 2CNDA 1GFCA 4Z4WA 4LDUA 4E47A 5GAOp 3CCJQ 1IJFA 1Q7YC 2MAMA 3CRZA 2FX3A 1HVXA 3W2FA 3M58A 4ASUA 1TSFA 2Q6LA 3JB9I 1EP1B 4XU3A 4Z4UA 1FMVA 2ZXHA 1KQ1A 4E7SA 2XMFA 1UGPB 1UE9A 2KXDA 5CKHA 2X6XA 3W5VA 5GMKh 3CCRA 2KYBA 5E6TA 2L3QA 3J80E 1VQ4B 1GCPA 4C5GA 1KK1A 4C92B 2VBTA 1K73U 4PJNA 4BY6C 2V4DA 1AZEA 1M90C 1M1KU 4P1VA 3JCMe 4C5HA 3MEAA 3PUNA 3RESA 2P4RA 5FO1A 5LJ5d 4VUBA 3I56A 3W2HA 3QE2A 1QGYA 3EAEA 3BCFA 2X85A 4WZEA 1TTTA 3LYIA 1FNCA 3LX7A 3CXCP 1ZSGA 4P9SA 1IXDA 1KD1U 1WQ7A 4B6MA 3OSSC 2JS2A 2CDTA 2JZ2A 4LD9K 2W0ZA 4PLIA 1S72A 1NB0A 1VIEA 2AKLA
chains in the Genus database with same CATH topology
3H9NA 2DOGA 3A1PA 2DYIA 2F1LA 3HTRA 2QGGA 1PM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9N A;  2DOG A;  3A1P A;  2DYI A;  2F1L A;  3HTR A;  2QGG A;  1PM3 A; 
#chains in the Genus database with same CATH topology
 3ASS A;  3GNG A;  1QMC A;  1VLY A;  3RKX A;  2K5I A;  1VQP B;  1K0X A;  3O8V A;  4AVZ A;  1AHJ B;  4HE6 A;  5D6X A;  4MDW A;  3SWN A;  3EG3 A;  2XIC A;  3JCM d;  1OPL A;  2DCU A;  3ZIA A;  1Y0M A;  3E9F A;  3SDZ A;  3OW2 B;  3BH4 A;  3OFN A;  5TY0 A;  1MND A;  2DET A;  5IK2 A;  4HE5 A;  4JDS A;  2YRD A;  3CPW S;  2F69 A;  4UC4 A;  3HL8 A;  3CCM Q;  2ZPG B;  4JMQ A;  4FU6 A;  4C0D C;  4M75 F;  3DKM A;  3T9N A;  3PUM A;  2CP3 A;  2KE9 A;  3QSU A;  1WI7 A;  3UAT A;  5L46 A;  2IPO B;  2PUK B;  4FSS A;  4WZT A;  3M53 A;  1X6B A;  5IYQ A;  1ZSZ B;  2X51 A;  3VS2 A;  4M77 C;  1K8A R;  1CKA A;  1FNB A;  1E1R A;  2DAQ A;  2BV3 A;  3GVK A;  2M9U A;  4KH1 B;  2QEX A;  4J9G A;  1W6X A;  4FXU A;  2VYT A;  3CCQ T;  1U3O A;  4H9G A;  3SWN B;  1MAB A;  1D0X A;  2MPX C;  4Y91 A;  1BB9 A;  4Z4Z A;  3OEE A;  3C0C A;  2RPN A;  4M75 G;  4RD1 A;  4AFU C;  4HCZ A;  4G1V A;  3TSZ A;  2NV4 A;  4M78 C;  5FIU A;  1VOM A;  3MEW A;  2FVU A;  4JLG A;  4CI0 C;  2J6K A;  2VAS A;  3CCS B;  2JW4 A;  2ZBV A;  2FHD A;  3QWY A;  4KH0 B;  1SKQ A;  1G8X A;  3EFO A;  1G3S A;  3URG A;  3I9Q A;  1YHQ Q;  4PGO A;  3RR6 A;  4M7A D;  2CGH A;  3KEW A;  1VQP A;  2QTX A;  4NOY A;  2D0N A;  4AC9 A;  3CC7 T;  4FIB A;  1NPP A;  3G71 Q;  1D1C A;  2ZGW A;  2V7U A;  2L3S A;  2O4X A;  5GAO l;  3GVL A;  3OYA A;  3CC4 A;  1TVC A;  3CQT A;  4RLZ A;  4PK4 A;  2I1L A;  2L0A A;  4C92 F;  4BUG A;  1GBQ A;  2ATC B;  4M7A A;  3ES9 A;  2ZL6 A;  1R5B A;  2GGR A;  3ZUG A;  1YJW B;  2LCC A;  5DLQ E;  3W2G A;  1B7T A;  2RJC A;  3GIR A;  3X28 B;  2JJ9 A;  1ZUU A;  4DEY A;  2VXF A;  1H8K A;  2FEI A;  2RO0 A;  2RQV A;  4R0K A;  3OYL A;  1W1F A;  1VQM A;  4JRP A;  1KRH A;  3X24 B;  1R0B G;  4RD4 A;  1N0U A;  4QV2 A;  3E2U A;  3SKB A;  3EFO B;  1NG2 A;  2DBK A;  2DM1 A;  3GSI A;  5A8A A;  1JJ2 B;  1G7C A;  1N8R U;  2V7T A;  1WXB A;  1I0C A;  1LNX A;  5I2S A;  1TXQ A;  1Q82 R;  3OOC A;  4RCC A;  3CP8 A;  1J9Z A;  1GCQ A;  4TVR A;  3OZW A;  2JMA A;  2WSC E;  4XTW A;  2M02 A;  1QQJ A;  5KCO A;  3EG9 A;  2J6O A;  1UGS B;  2XDD A;  4IUU A;  5IHN A;  3CBP A;  3CCJ A;  4PAA A;  3V7A A;  2K3B A;  2VBV A;  1XOV A;  1XNI A;  2SEM A;  3PVQ A;  1VQ9 T;  4X05 A;  3VS3 A;  5KYY A;  1T0J A;  1YNZ A;  1NPR A;  2KBT A;  1SSF A;  3O5Z A;  4LN2 A;  1K9M U;  2DBM A;  3EGD B;  1OYX A;  2K57 A;  4M7D D;  4LDY A;  1V0F A;  4OB0 B;  1VYT A;  1WHK A;  2I2L A;  3VU3 C;  3JB9 J;  1QW1 A;  4OPO A;  4DQL A;  1NM7 A;  1UJ0 A;  2P0P A;  2OK7 A;  2V7W A;  3PVD A;  3PVL A;  3RKY A;  2MIO A;  5GAN j;  2WSS A;  3KBG A;  4B47 A;  4IUP A;  4PFP A;  5HK3 A;  1G2B A;  1ZX6 A;  1M8M A;  3JB9 F;  2E1R A;  3PA1 A;  4XLA A;  1FRQ A;  2LX7 A;  2G6F X;  1OZ3 A;  1YCY A;  4E7L A;  2XD0 A;  4XTY A;  4DOV A;  1YCS B;  3OZV A;  4F7U A;  2PMD A;  2XGJ A;  4XOR A;  4XOP A;  2A0F B;  3AVW A;  1CSK A;  3N5B B;  1HA3 A;  1Y96 B;  1UD4 A;  1VLO A;  1YFN A;  2D9T A;  1R77 A;  1VQ8 T;  1WHL A;  3OY9 A;  2VNH A;  2VNI A;  2K6D A;  2BVN A;  2MF2 A;  2NYS A;  2ZPB B;  2NUT A;  2C5H A;  2DO3 A;  2E5Q A;  2KR3 A;  2P84 A;  1QCN A;  1JRI A;  2KK4 A;  3AGQ A;  2C0O A;  2HEQ A;  3QYG B;  8AT1 B;  4JJN K;  3M0T A;  3UT1 A;  4BE0 A;  3NTH A;  1W70 A;  1GO2 A;  2WYR A;  4HCC A;  4KGX B;  2GJR A;  1XTD A;  4FCY A;  3JCM J;  1M3C A;  2M5S A;  1RQR A;  3SEJ A;  3PE0 A;  4FYX B;  3EGX A;  3R6N A;  2RM4 A;  4AG2 C;  3TEE A;  1TUD A;  1YJW Q;  1BPL A;  3QDR B;  2HLD A;  3RKW A;  1O9S A;  3VS4 A;  1UUE A;  1HXD A;  1QVG A;  1W0J A;  4RTU A;  3B78 A;  4TMV A;  4XMY A;  2JUF A;  2XOK A;  4J9D A;  2K4Y A;  1AEY A;  4EMK B;  1M2V A;  1I1J A;  2WSE E;  1YIT Q;  3NPF A;  5A88 A;  3C12 A;  4Y28 E;  1N08 A;  2CT3 A;  3VMF A;  3VS7 A;  3V76 A;  2ZPI B;  3AHU A;  4XTV A;  2EIF A;  1IHW A;  2GTO A;  4RUG A;  2VXE A;  5LJ5 e;  1D0Y A;  1WXU A;  4OML A;  5IYN A;  1U5S A;  2CZ7 B;  2X3U A;  4HVW A;  3BY7 A;  4ANJ A;  4IKF A;  1E62 A;  2V7V A;  1IZ6 A;  4WZL A;  1BBZ A;  1VQK Q;  3WQZ A;  3L2Q A;  3L2V A;  4QW2 A;  4NL2 A;  2RI3 A;  1YHQ A;  4N4I A;  3REB B;  4BI3 A;  1JEG A;  3HSB A;  1KD1 R;  4XLF A;  2BM0 A;  3ONY A;  1GCQ C;  1VQ6 B;  1RAA B;  4C8Q C;  1G7S A;  2DE0 X;  3NFC A;  2W6J A;  4XU1 A;  5CO7 A;  3UWN A;  1SG5 A;  1A8P A;  5GAN 6;  3OYH A;  1RAD B;  1SM4 A;  2ZPH B;  1E3X A;  4XR6 A;  3CCL A;  2DL7 A;  4PFZ A;  2EGA A;  4ACA A;  3ZBD A;  3JB9 G;  1K9M C;  4KGV B;  3E9G A;  1N05 A;  4E7Z A;  4BDZ A;  3QKJ A;  1ARK A;  2XI9 A;  3QBY A;  2XEX A;  2PTK A;  4IW3 B;  3BCD A;  2BUD A;  1E63 A;  1YIT B;  3R6O A;  4KUI A;  3U6K A;  4HT8 A;  4KUD K;  2B8A A;  1NLO C;  2PVO B;  2CRE A;  5A0G A;  2V7Q A;  3L42 A;  1P92 A;  3E1S A;  3W2I A;  2DYB A;  1X75 C;  3CB4 A;  1Y57 A;  1WDT A;  2PQW A;  4GLK A;  2KMT A;  2R9V A;  4JRQ A;  4AT1 B;  2RA2 A;  1YJ9 T;  4L6V 5;  2XKO C;  4RTT A;  2GF7 A;  4MYT A;  1JO8 A;  3BE3 A;  3PIP A;  3AVY A;  1GR1 A;  3RER A;  4C8Q E;  2YUN A;  3QSY A;  1XQB A;  1OOT A;  2DIL A;  1GRI A;  5EC7 A;  2YWE A;  3FPK A;  2BZ8 A;  5KYU B;  1IHV A;  4OOS A;  2OAW A;  1QLY A;  2L8D A;  4K11 A;  2AZS A;  1YJN T;  1E3Z A;  2VJJ A;  4XM3 A;  3WVD B;  4X9C A;  1COW A;  2JJ2 A;  1S4M A;  3OYN A;  5F4O A;  1KHC A;  3QJ6 A;  2F43 A;  5LJ3 d;  3V7R A;  1M27 C;  4AF6 A;  2CT4 A;  5CCA A;  1D3B A;  3A5Z B;  4ESR A;  2QEX Q;  4KKS A;  4PC3 A;  2RJD A;  3CCE T;  4M53 A;  4YAF A;  2KDS A;  5L8R E;  3M54 A;  1IJE A;  3G71 T;  1XQH A;  4WF2 A;  3BDL A;  1VIF A;  2CP5 A;  4FT2 A;  2PVD B;  3QFR A;  1TUI A;  3KXT A;  1UD6 A;  4X7D A;  3REA B;  1X2K A;  4M2L A;  1TWB A;  2D9R A;  5GJV B;  4Q5W A;  3ER0 A;  3L2W A;  3A8H B;  3PIO A;  5CQY A;  2ZTN A;  2MMP A;  1IB0 A;  3TU4 K;  2C06 A;  5FL7 A;  4ZN1 A;  4MML A;  1KQ2 A;  3G71 A;  5FWC A;  2W6I A;  3VRY A;  4L8J A;  3M55 A;  3RNJ A;  2BGJ A;  2JIZ A;  2NUT B;  1VQO B;  5GMK m;  4M75 C;  2JTF A;  4A4E A;  2DKG A;  2V8J A;  3V7C A;  3RUX A;  2NUZ A;  2QEX B;  1IRX A;  3CMM A;  4Z8A A;  2KRN A;  4TSF A;  3L2Z A;  4F7U G;  1CNF A;  5J3B A;  2PLF A;  5CIU A;  4RG2 A;  1QUF A;  3M0S A;  3JB9 D;  2G3R A;  2LJ0 A;  4TMT A;  1KSW A;  2EYY A;  3CCQ A;  1WA7 A;  2GRE A;  4E7I A;  1PJ5 A;  2C77 A;  1K8A U;  4PJO E;  1E6G A;  2EQM A;  4LE9 A;  1QFY A;  3V8L A;  4XKV A;  3G05 A;  1QVF P;  2F5K A;  3JU4 A;  4BDY A;  1PG5 B;  1VHO A;  2CZ0 B;  4G6I A;  2X6W A;  2MWP A;  3FLG A;  5IAY A;  4KBM B;  3A98 A;  1KK2 A;  1VYV A;  1M1F A;  1VQN B;  2Z6B D;  4C8Q D;  1YIT T;  3CME Q;  3CPW B;  1QG0 A;  2HBW A;  4XTU A;  1ACM B;  2C0I A;  2RNA A;  1UHF A;  1WOP A;  3ZL7 C;  2F2W A;  3ZPN A;  2ZXI A;  2EW3 A;  3I55 A;  3SB2 A;  3VNU A;  3QZ9 B;  4DBF A;  3SLD A;  3X26 B;  1T3L A;  4DEX A;  4ZTJ A;  2CSQ A;  4DK0 A;  1W0K A;  1T3S A;  3MP8 A;  4XU2 A;  4RTY A;  3OYG A;  2HBP A;  2M51 A;  1V29 B;  2E65 A;  5GAM e;  3CP2 A;  2HAX A;  2P3M A;  1QWF A;  1I4K 1;  2X9H A;  3OYE A;  2AT1 B;  3CCQ Q;  3JQR A;  3MPU B;  3NMZ C;  1JJ2 A;  1Q86 D;  3QFC A;  3CCE Q;  4M7D C;  4XN3 A;  1VQ8 A;  4P12 A;  3V7S A;  1UJY A;  2COY A;  1NYF A;  1W35 A;  1Q86 C;  3KFV A;  4PC2 A;  4FSX A;  1G3T A;  4II1 A;  2YT6 A;  1KK7 A;  2DL4 A;  1GJR A;  3M4G A;  4UZF A;  1E79 A;  2YWF A;  1YJW T;  4J9E A;  2EBP A;  2KT1 A;  4EMK A;  2XZL A;  1N9R A;  1N06 A;  3X25 B;  3C94 A;  4A4H A;  2FPE A;  2VZL A;  4Y9R A;  2LZJ A;  1K0S A;  1ZLM A;  4PJO F;  4CC4 B;  1RLQ C;  3LQE A;  2M1H A;  1WZO A;  5I21 A;  1VQO A;  5H59 A;  3R6K A;  2YXY A;  5IT9 E;  4ME7 A;  1B34 A;  1YJ9 Q;  3C95 A;  2C78 A;  2CKK A;  4WCI A;  1IRE B;  4AFZ C;  3VS6 A;  3DB4 A;  3BC9 A;  4M75 E;  2ED0 A;  1TH7 A;  2FPD A;  5GAM j;  2CZ6 B;  5GMK i;  4DBR A;  4ZNX A;  3CD6 T;  3F70 A;  4M78 G;  5GV7 A;  4IIM A;  1B07 A;  1PJ6 A;  4EH1 A;  5AT1 B;  3J81 k;  2E70 A;  1V0E A;  4LUD A;  4AFS C;  1SHG A;  1WSV A;  1R8O B;  2J06 A;  2JVV A;  2FRY A;  3CCU T;  2LCS A;  5GMK l;  3A35 A;  5B6I A;  3OYF A;  1H8H A;  4M75 A;  3OYC A;  4J9I A;  5FRN A;  1VA7 A;  2KGT A;  3EFR A;  4RCB A;  2JTM A;  3V8J A;  2QEX T;  4YAW A;  4OGC A;  2C4U A;  3RMQ A;  4QQG A;  2FL7 A;  4B44 A;  2EJ9 A;  2YUO A;  1Z9Z A;  4KGZ B;  2B7C A;  4C92 E;  3WY9 A;  1BI1 A;  2QTV A;  4B4D A;  4IUR A;  5D7U A;  1SPK A;  3ZZU A;  1VQ8 B;  3LLR A;  2BPO A;  3T51 B;  4B3F X;  3ASP A;  2EKO A;  1Q9S A;  2KYM A;  2DZC A;  2CP6 A;  2X3W D;  4ZCI A;  4DQK A;  1JXO A;  2SRC A;  3WXM B;  1NJI U;  3GIB A;  2J7K A;  4DK1 A;  2J05 A;  2VWF A;  1KQS B;  1VQ9 Q;  1QVG S;  4FM4 B;  4XQ3 A;  8ATC B;  2PU9 B;  2Y4Y A;  3WYA A;  1MV0 B;  2A37 A;  2K3Y A;  3VS0 A;  1M1G A;  3FJ5 A;  2KVO A;  1VQ6 Q;  1JB9 A;  1BCO A;  2RQU A;  2WZP P;  2JS0 A;  4M7D G;  2DMO A;  4XKW A;  1RQP A;  1KMH A;  3LH5 A;  7AT1 B;  3ASK A;  2EQK A;  4M77 E;  3OE7 A;  5KW9 A;  4EIK A;  1UEB A;  4B43 A;  2X35 A;  3M0U A;  3MCA A;  1YJ9 B;  4OB2 B;  3LO8 A;  2LNV A;  3MO8 A;  2V8I A;  1T6Z A;  1S1N A;  1KC8 D;  5IYP A;  1K76 A;  3D7S B;  3CCV B;  2K5L A;  1GFD A;  3GF5 A;  3GOX A;  3OW2 A;  1X01 A;  3GLX A;  3KUF A;  4JJD A;  3CCM T;  2OTJ T;  5GAN g;  2HQH A;  1G3W A;  1ZA2 B;  2P0Q A;  1QVF B;  2CUB A;  2RQW A;  2PIA A;  1ELO A;  2LQ8 A;  1SSH A;  2A3L A;  3OW7 A;  6AT1 B;  4DA4 A;  4EMH A;  4JS4 A;  2ZZG A;  1EWY A;  4C0F A;  1VQK A;  1EIF A;  3UA6 A;  2XU8 A;  3HRS A;  1M1K D;  4IUV A;  1VQ7 Q;  1YI2 B;  1OUL A;  4TMX A;  3CCE B;  3E19 A;  4XQF A;  3SJP A;  4BAC A;  2GJK A;  3CC2 T;  3BW1 A;  1NBM A;  3W2E A;  3OA6 A;  5GAN 7;  2DTI A;  2DVJ A;  2X0K A;  1EFR A;  3OS1 A;  4XU0 A;  2YLC A;  2QDY B;  2LQW A;  1EX4 A;  3OJW A;  2VGM A;  4EDU A;  2EJG A;  3I56 Q;  4RPD A;  5TV2 A;  5IH2 A;  1X69 A;  2K3X A;  1X43 A;  3JCM f;  5KYW B;  2ROL A;  2A08 A;  1UDL A;  4OMM A;  2XHC A;  5FU6 B;  4A63 B;  2CF4 A;  5KNL A;  1VQ5 Q;  4OB3 B;  2DYI A;  4OMF B;  3W5U A;  1VQN Q;  5FNZ A;  3OQ5 A;  5BSY A;  2LDM A;  5FO0 A;  3ONU A;  1FND A;  2L5Q A;  3H0I A;  3S3O A;  1YI2 A;  1MMA A;  1EP2 B;  3ASR A;  2X3X D;  2H3E B;  4BE1 A;  2WPD A;  2GFU A;  2OTL A;  1ZBJ A;  1KK0 A;  4UZE A;  4G7W A;  3FC3 A;  1UGQ B;  1QP3 A;  3OYK A;  1KK3 A;  1Y0Y A;  1VQ5 T;  1H92 A;  1PC0 A;  2E3H A;  4XLC A;  2JTE A;  1OU9 A;  1YIJ A;  1NJI C;  2JN0 A;  2CS7 A;  1QFJ A;  2CYZ B;  3Q1J A;  4N4G A;  2KVQ G;  1OHH A;  4YHB A;  1XJW B;  4DNT B;  2QA4 B;  1SKU B;  4QHY A;  2IVW A;  1HYO A;  2QG9 B;  3PGG A;  1NJI R;  4B3X A;  5HKK A;  2QK0 A;  1VQO Q;  5GAN f;  2GNC A;  1ZM3 A;  2LQN A;  4M0L A;  5DS0 A;  1IHM A;  5IN1 A;  4WQM A;  4LUE A;  5J35 A;  4EMK C;  1YWO A;  3AVX A;  5LJ3 h;  2P0K A;  3CMA B;  2DJQ A;  3Q3A A;  3C4S A;  2RN8 A;  1T0H A;  1KQS P;  3A8I A;  3OYJ A;  5HKC A;  3WBJ A;  1VHE A;  1YLO A;  3DB3 A;  4ZV4 A;  2OTL B;  3NHN A;  4J9C A;  5KYN A;  2ZL5 A;  4FT4 A;  1DJ7 B;  1B34 B;  2HKN A;  1BK2 A;  2EWN A;  4X9D A;  3OYY A;  3MHX A;  1BX0 A;  3P8H A;  2JOY A;  3E20 A;  4HCK A;  2BE7 D;  2DD5 A;  4BD3 A;  2Q6I A;  2QQ9 A;  2VB6 A;  4BI4 A;  2LNH B;  1WOR A;  3UF4 A;  4LDX A;  2CW5 A;  3CD6 B;  2X4J A;  2K2V A;  3LWI A;  3OS2 A;  5FU7 C;  3DLL A;  1QFZ A;  1QVP A;  1UGR B;  2HDN B;  3CME B;  2E41 A;  4JPB W;  5DY9 A;  3M0R A;  4M77 A;  2AHO A;  2RHI A;  1B3Q A;  1VQL A;  1RAB B;  1M4Z A;  1BKB A;  3ZZT A;  1Q86 R;  2VVK A;  1PSE A;  1ZHI A;  1KQS S;  1KHI A;  5LJ3 f;  1ZBX A;  1HD3 A;  4Q7J B;  3S3M A;  5F4J A;  1RAF B;  5CKB A;  5GAM d;  3EG1 A;  2B7B A;  4X0C A;  3OYD A;  2WR8 A;  4ORZ A;  2DL5 A;  4J6Y A;  4RPB A;  3JCM Q;  4DOW A;  3I56 T;  3AT1 B;  3HPW A;  2HMA A;  2DZ9 A;  5GMK j;  2EFI A;  1RI9 A;  5GAN 5;  2GJP A;  2CH4 W;  3CCS Q;  1VQ6 T;  3CC4 Q;  1RI0 A;  4P6V F;  5GAO n;  3CPW A;  4AMC A;  2ENM A;  1YBY A;  1MUZ A;  2DJZ A;  4RKU E;  5HXB A;  3CCR T;  3JCM h;  2ED1 A;  2RHY A;  4BY6 B;  3ISX A;  4Y9U A;  3CC2 B;  4A53 A;  5KYW A;  3VUZ A;  5LMZ A;  2M0O A;  3TRE A;  1ZQ1 A;  3JCM V;  1DAR A;  1S72 T;  4F7U B;  1WHJ A;  2NLU A;  3ME9 A;  4RD2 A;  1AIP A;  2HD0 A;  2IIM A;  4A54 A;  3Q39 A;  1NDH A;  2B86 A;  2HSP A;  2E64 A;  3ULR B;  4C0G A;  1HK9 A;  3CCQ B;  3QZ5 B;  1LOJ A;  1TU0 B;  2CP2 A;  1A0N B;  3PTA A;  4N0A A;  5D6W A;  5I11 A;  1VQL T;  2VV5 A;  1M1K R;  2E6N A;  1QUE A;  1WXT A;  4PL6 A;  4M7D A;  1YIT A;  1D1B A;  2V8K A;  3TQ7 P;  3VV0 A;  1RAH B;  2JXB A;  2VYQ A;  1SHF A;  3QUI A;  2X6Y A;  1I8D A;  3VJP A;  1TLL A;  4XLE A;  3CXC A;  4HVU A;  3VS5 A;  3FIF A;  2GFA A;  3SWN C;  4JRI A;  4M4S A;  3BY2 A;  1PCX A;  3G4S A;  3A8O B;  1GVH A;  4KKU A;  2L3P A;  4QKU A;  1VQM T;  4N3N A;  1D1N A;  4NBS A;  4J9F A;  4P26 A;  1VQL Q;  4M75 B;  5GMK e;  4X7E A;  4C8Q A;  1EFT A;  2HL5 C;  2OTL T;  1H42 A;  2LJ1 A;  3A8L B;  3BFM A;  2DRK A;  5L23 A;  2QAS A;  1WGS A;  1VQL B;  3DLM A;  3H8Z A;  2X4Y A;  2ZAE A;  3BDU A;  5J26 A;  3CCU Q;  3Q38 A;  4KKT A;  4A4K A;  1MNE A;  4YXW A;  3H9N A;  2J7I A;  4C43 A;  3A1P A;  1IGQ A;  2H3J A;  3QHS A;  2V31 A;  3QWX X;  4RDK A;  1WJQ A;  3QO3 A;  3CD6 Q;  2DTH A;  2MWO A;  1QCO A;  2QMU A;  5GAO q;  2HSE B;  1VQM B;  4QUZ A;  3EG9 B;  4XTZ A;  1G3Y A;  1PKT A;  4RTW A;  3THK A;  2DL3 A;  4OMQ A;  2F1L A;  5FRO A;  3NGP A;  4X34 A;  4XTX A;  1D1A A;  2O2O A;  2EYQ A;  4PJM A;  3RY8 A;  4OVA A;  3AGP A;  5HZA A;  4F7U E;  3L2R A;  4RD3 A;  1M2O A;  3QII A;  2Z0W A;  2EFG A;  4F04 B;  3CCR B;  1W2B B;  4RD0 A;  3VNV A;  1UEC A;  2YRV A;  1H8E A;  1WP6 A;  4BE2 A;  2EYZ A;  2DTO A;  3CMA Q;  4EPC A;  1BJK A;  2F5T X;  4X8I A;  2XZO A;  5KH6 A;  1W2B S;  1QVF A;  4EMG A;  2RHZ A;  1EXM A;  2E5K A;  2EQI A;  2E1H A;  4U9U A;  3WND A;  1IO6 A;  2PVG B;  2FZG B;  2LT4 A;  4DNR B;  2LQK A;  4P3Y A;  4M77 G;  3CD6 A;  3PMI A;  1MRZ A;  4FL6 A;  4X7F A;  1I07 A;  1SEM A;  1PSF A;  2Q6O A;  1TG0 A;  4QVC A;  4B48 A;  2RHU A;  2DXC A;  1BIB A;  1UTI A;  2FG0 A;  1JU5 C;  1QP2 A;  4LDW A;  5GAN 3;  3KL9 A;  4HKE A;  3HRT A;  3HAG A;  4RTZ A;  3M0Q A;  4XL9 A;  2DFU A;  3TVT A;  2D74 A;  3VYH B;  1D3B B;  2JNG A;  1EFC A;  1PD1 A;  4OMP A;  4G7X A;  1NE8 A;  2RI2 A;  1V5V A;  1Q7Y U;  4XNF A;  1VQN A;  1K9M D;  4B3G A;  4ZN3 A;  1QX4 A;  5EMN A;  4QQ6 A;  4OP0 A;  1Y07 A;  4R71 A;  2DL8 A;  5BSX A;  1U1S A;  4FW1 A;  2OTJ A;  2QI2 A;  5KYX B;  2ZZE A;  4PKC C;  1Q82 D;  1AT1 B;  3QYH B;  3QJY A;  4JS5 A;  1ZSZ C;  1K73 C;  4F7U F;  2P4T A;  1Q82 C;  1M90 U;  1BCM A;  3JCM c;  2JJ1 A;  4OPS A;  4ZGN B;  3CCM B;  2MCN A;  4PJO B;  3CPF A;  1IB8 A;  5FU6 C;  5HK0 A;  5DSZ A;  5FLX E;  3P8D A;  1VQO T;  4WZK A;  4YAO A;  2D6F A;  2OYN A;  1ZM2 A;  3CC2 A;  3H94 A;  4QT7 A;  5LJ5 j;  1Q82 U;  1K73 R;  4BPR A;  1R0C B;  1M5Q 1;  1WHG A;  2K5F A;  4M78 E;  1T5E A;  3MHP A;  2LVM A;  1XFO A;  3AST A;  3EH1 A;  2LX9 A;  4HXJ A;  1VQP Q;  2LMJ A;  5IYW A;  1OB2 A;  2O01 E;  1NJI D;  3LGL A;  1X6G A;  4LBZ A;  4ZGE B;  1YI2 Q;  1VQ7 B;  5FRM A;  1K9A A;  4V2S A;  3G71 B;  4L59 A;  3FJO A;  3OW2 P;  3NE5 B;  3CC7 A;  2F1M A;  2D1X A;  2CC2 A;  1OB5 A;  2RK1 A;  4Z4V A;  2X53 S;  1VQ4 A;  1UFF A;  3MP1 A;  5GAN 8;  4FN5 A;  2QYZ A;  4M78 F;  2QQA A;  1RAG B;  1E1Q A;  1H64 1;  2KRS A;  3OAA A;  4X07 A;  2NUP A;  4ZTF A;  3CES A;  2BMW A;  5TR9 A;  4NS5 A;  3Q6R A;  3JCM g;  2QDL A;  1WJS A;  3CCV Q;  1BX1 A;  3FRN A;  1BI0 A;  2YUP A;  1OI1 A;  1JJ2 S;  4A4F A;  1YN8 A;  2RC6 A;  1Y96 A;  1WLP B;  4PC7 A;  3OPO A;  4M77 F;  2RHX A;  4N4H A;  3AVT A;  3MET A;  5DLO A;  3Q6Q A;  1C1A A;  2YHT A;  4M7A B;  1SF9 A;  2QDX A;  2MOX A;  2V1R A;  4PJO G;  2RJE A;  4Z89 A;  1QGA A;  1K28 D;  1TOV A;  3QXE B;  3SLN A;  3QDF A;  5M9O A;  3CCV A;  1FX7 A;  2R57 A;  4TN1 A;  4B9W A;  1MMG A;  2DIQ A;  3X20 B;  4ELZ C;  4ATO A;  1T6Y A;  4J0Q A;  2CK3 A;  5LJ5 g;  2A36 A;  4XLH A;  1LPL A;  3CCM A;  1YX2 A;  3RIR A;  3EGX B;  3MEU A;  2BF4 A;  4C92 A;  3JAM E;  2O88 A;  1ABQ A;  2OAU A;  3AVU A;  2EQJ A;  2D3N A;  2FRW A;  2O31 A;  1NLP C;  2E1B A;  3G6E B;  4C0S A;  2BKD N;  1LCK A;  4R55 A;  1QWE A;  4O5V A;  5GAN 2;  2GBQ A;  3JCM X;  1AMO A;  4PJO C;  1M3B A;  1OX9 A;  3EHQ A;  1EZZ B;  2YRC A;  1NRK A;  1KC8 C;  5LJ5 h;  4PJO D;  3VO1 A;  1FYN A;  1BI2 A;  4YTL A;  2DIG A;  2L3R A;  1S72 Q;  2RD1 A;  3A3G A;  2HQX A;  1VYU A;  4E6R A;  4YEJ A;  4JLI A;  2OBT A;  4R56 A;  2QGF B;  2ABL A;  1PRM C;  4X1V A;  1AOJ A;  3NTI A;  3FPP A;  1V76 A;  4RTV A;  4RCZ A;  1H85 A;  5EG2 A;  5I2M A;  4P22 A;  4Z1M A;  3EGD A;  3W5H A;  4B9X A;  1YJ9 A;  2BSA A;  5GJW B;  4P5N A;  1G7T A;  2EJF A;  1WOO A;  1M30 A;  1N8R C;  1ZM9 A;  1UD8 A;  3LWH A;  1M1K C;  3U23 A;  4TKO B;  1C6V X;  5KCH A;  1UB4 A;  1JNY A;  1LVK A;  4JJC A;  2DXU A;  3J81 E;  3UPU A;  4LBV A;  4E7H A;  3FJP A;  1YHQ B;  3OEH A;  3BQJ A;  2BIV A;  3JQQ A;  1ABO A;  2DVE A;  4JUV A;  3SJZ A;  1KD1 C;  5FW9 A;  5A89 A;  1WQW A;  2VC8 A;  2GK7 A;  1N5Z A;  4LC0 A;  1K8A D;  4M7A E;  4PJL A;  2K9G A;  1JJ2 P;  1SRM A;  3LW5 E;  3QG1 A;  2KEA A;  2LC4 A;  2ZZD A;  2EQU A;  1MMN A;  1YJN A;  1K8A C;  2RC5 A;  3EG0 A;  2JN9 A;  1RAE B;  2C2W A;  2AZV A;  3JRZ A;  4KRT A;  5F4M A;  4RD6 A;  2OTL Q;  4Y92 A;  4LBW A;  1XB2 A;  2V7X A;  4J83 A;  1U1T A;  1ZUN B;  2X8K A;  2ZCF B;  4KT0 E;  2QA4 A;  1X6O A;  4C0D B;  1UD3 A;  2RF0 A;  3B8H A;  5TRD A;  4CC3 A;  2LCL A;  1AWO A;  5HY6 A;  1VQ9 B;  2VNJ A;  2A7Y A;  3G4S T;  2WZN A;  3HHT B;  3G6E A;  3V8K A;  1DG1 G;  4ROX A;  4QVD A;  3GPL A;  3ZBU A;  5GAN d;  3PEN A;  5A2Q E;  4LXC A;  1UG1 A;  4MZM A;  1GBR A;  4M78 A;  3MMP A;  2MK5 A;  3EGU A;  3PA2 A;  9ATC B;  5CKE A;  2MYS A;  1NYG A;  5IXB A;  2YLB A;  2VBS A;  4NL3 A;  4X7C A;  1KTV A;  1N6A A;  5AN9 A;  2CP7 A;  3E1Y E;  3G7Z A;  4MDX A;  2YWG A;  1PKS A;  3LH0 A;  3WNB A;  4J6X A;  4N3G A;  4LD6 A;  1VUB A;  4O6J A;  4C5E A;  4Z4S A;  3M57 A;  1KJW A;  1VQK T;  2QQR A;  4HCB A;  1BMF A;  4N0A C;  2XZP A;  2K7A A;  2DLP A;  3CEY A;  2Q6K A;  1WTH D;  4HVV A;  2ROT A;  1I5O B;  4YAU A;  3JCM W;  2DEQ A;  3S6W A;  3DDY A;  1YIJ Q;  2VBU A;  1VQ7 A;  5FWB A;  1CNE A;  2ECZ A;  2QXF A;  2WSF E;  3ZEH A;  3T53 B;  3CTA A;  1KC8 U;  3FDR A;  4YAL A;  1TUG B;  3OJX A;  3FB9 A;  3EG2 A;  1I7P A;  1JQQ A;  4CQJ A;  4OOV A;  1WJR A;  4M75 D;  1KG1 A;  1K4U S;  4QQD A;  4PLL A;  4YEL A;  4D8D A;  1KQS A;  2GTJ A;  1AWJ A;  2HKQ B;  1NZ9 A;  2E6Z A;  2J6F A;  1XE1 A;  1Y0R A;  2HQE A;  3UA7 A;  3CCV T;  5DM7 R;  2KI7 A;  1GXI E;  2EGE A;  4OB1 B;  4PJO A;  3GP8 A;  1D8T A;  3CMA A;  1W34 A;  3WBK A;  1WPC A;  3CC7 B;  2AHJ B;  4OMO A;  4JZ3 A;  4GBQ A;  1EFU A;  2EPD A;  4J9B A;  1W4S A;  1AWW A;  5FA6 A;  2EVR A;  4C5I A;  2K79 A;  3B82 A;  2QAZ A;  4QVZ A;  1DDI A;  3OBW A;  2RJF A;  2XND A;  5HCK A;  2FVG A;  4CRI A;  3I5S A;  1B2R A;  3M0P A;  5IXF A;  2OX7 A;  4MZT A;  4DBQ A;  3EHR A;  3INZ A;  4QVA A;  3ZC3 A;  2CRV A;  3RDV A;  1W2B P;  1ZM4 A;  1M90 R;  2BZY A;  4ZGD B;  4TMW A;  3WNC A;  2YWH A;  1MMD A;  1RL2 A;  2OK8 A;  5IHI A;  2ZTG A;  1QGZ A;  2KRM A;  3CCJ B;  2OI3 A;  1PRL C;  1FMW A;  1M9S A;  2FZK B;  1V1C A;  3I55 T;  2ZIT A;  4M1K A;  1ZA1 B;  3TSW A;  1Q81 R;  2XNC A;  1WX6 A;  2GQF A;  4XK8 E;  5CQX A;  1KZL A;  4OGE A;  1KJZ A;  2JM9 A;  4C8Q F;  1VQN T;  2JM8 A;  4J8O A;  1R5O A;  1UD5 A;  4P2N A;  4XAX B;  2K2M A;  1YJN Q;  4LNP A;  1I81 A;  4J9H A;  2IG0 A;  1Q95 G;  4F16 A;  1SRL A;  1CKB A;  3WXM A;  2E10 A;  4UAJ A;  4M77 D;  3P26 A;  3OKX A;  4P25 A;  2KAF A;  4BB7 A;  4WTO B;  3LNN A;  3VS1 A;  4C92 G;  4J7F A;  2RMO A;  1RAI B;  1H3H A;  2QA4 T;  4OPV A;  1KD1 D;  3CCU B;  5C6S A;  1G83 A;  4Z02 A;  1PKV A;  1T6X A;  5A0L A;  4C92 C;  1N0V C;  2O9V A;  1GAQ A;  1MGQ A;  1NBE B;  3ZFJ A;  1QVG B;  3OYM A;  2I0N A;  1WPY A;  2V26 A;  5GV8 A;  2XDB A;  4IUT A;  2GPJ A;  4II2 A;  3HTR A;  4M78 D;  5J39 A;  2PUO B;  2JMC A;  2X4W A;  3UDC A;  3JCM P;  2BGI A;  4OP7 A;  1WOS A;  1VQ4 T;  4CC7 A;  1VQ6 A;  3U6B A;  4RDJ A;  1OPK A;  1K73 D;  2XNJ A;  3VKI A;  1D2E A;  3G1J A;  1VJS A;  1W9X A;  1VQ9 A;  2DY1 A;  1AD5 A;  1JB0 E;  3PFS A;  4RMO A;  1UHC A;  2FPF A;  3I56 B;  4K1X A;  4II3 A;  2XID A;  1KFZ A;  2YSQ A;  4M78 B;  1OGJ A;  1B23 P;  2PE3 A;  2DEU A;  3M9Q A;  1EFN A;  4XON A;  1E6H A;  2R5M A;  2CP0 A;  3I1F A;  1BLI A;  3S3N A;  3G4S B;  3MEV A;  4PFO A;  1VQ4 Q;  1I5L A;  2KXC A;  3VR6 A;  2AKK A;  4NNJ A;  4J5Y A;  3A3B A;  5CK9 A;  3CXC S;  3SD4 A;  4C0Z A;  4Z88 A;  2LZ6 B;  4M77 B;  4MZP A;  1GAW A;  3HKS A;  5LJ3 e;  5AYF A;  1C0M A;  2R58 A;  2BTT A;  4KUL A;  1TTH B;  3CPW P;  2FO0 A;  3CPX A;  3HP9 A;  4Z4T A;  1MV3 A;  2QQS A;  5KE3 A;  1VQP T;  4M7D E;  2NWM A;  3LVB A;  1PD0 A;  4GY5 A;  3AVV A;  3CC2 Q;  4G5G A;  2BE9 B;  5CVI A;  5CR2 A;  4PNO A;  1WSR A;  2C4T A;  5ECA A;  2KNB B;  4FWT A;  2DXB A;  1VQ7 T;  5GAM h;  2EIX A;  2X4X A;  2H8H A;  4ZGQ B;  2B5O A;  3PNW C;  3CW2 A;  3D26 A;  2NUP B;  1FDR A;  4ZGJ B;  3RBB B;  2OTJ B;  4AFQ C;  2NPF A;  1F20 A;  4C8Q G;  2OBS A;  5D6Y A;  2HCK A;  3OZU A;  2VGN A;  4G1B A;  1AVZ C;  1QKX A;  3CCR Q;  2DIE A;  2EYW A;  1EP3 B;  3MKD A;  3CCJ T;  4HIZ A;  3I35 A;  3BNW A;  2DPP B;  2LT1 A;  4UZU A;  4M4Z A;  3I55 B;  3MP6 A;  5DN6 A;  3CCL T;  2F4N A;  3A8J A;  1S72 B;  2KQW A;  3G6E T;  2GQI A;  1VQ8 Q;  2WJY A;  3OBY A;  2FYK A;  1CQX A;  1VQ5 B;  5LJ3 g;  3CCL B;  5GAN e;  4QVJ A;  3H0F A;  2CH4 A;  2EAY A;  4QFM A;  3ZZ0 A;  1PWT A;  2D0Q B;  2QGG A;  3I5R A;  4OF1 A;  3SHW A;  1F60 A;  4J7I A;  2VJI A;  3L2U A;  2KRO A;  3M5A A;  1W2B A;  3H6Z A;  4JZ4 A;  2PZ1 A;  2DRM A;  4A4G A;  3OS0 A;  1JA1 A;  1N8R D;  5IHK A;  2EYX A;  2WAC A;  5LJ3 j;  2HDA A;  1K1Z A;  4NCN A;  3A8G B;  3I55 Q;  2COW A;  3J7A F;  1F1B B;  1UMK A;  4PAB A;  1TUC A;  2ESW A;  4XN0 A;  1HSQ A;  1E43 A;  3GVJ A;  1QVG P;  1H3Z A;  1FRN A;  4JRK A;  3OYB A;  1YJW A;  5GAM f;  3HFN A;  3P8B B;  2C5B A;  2OJ2 A;  4D6W A;  5A0D A;  4E7J A;  4ZCM A;  2CBX A;  1MHN A;  4RM0 A;  1Y71 A;  1BQE A;  4XD7 A;  1YWP A;  3M4Y A;  3QPH A;  1QCF A;  1DDG A;  1IGU A;  1VQK B;  2RB6 A;  1YJN B;  4MMK A;  2QA4 Q;  1FXX A;  3CCE A;  1N27 A;  5C0M A;  3CBM A;  2JT4 A;  1OQK A;  3MJX A;  2BN4 A;  4P3I A;  1HZE A;  3EH2 A;  1AZG B;  1J3T A;  1Q81 U;  4RJL A;  1N8R R;  3CCU A;  3JQP A;  2DNU A;  5GAO m;  3FEO A;  2EKH A;  3CC4 T;  1FWZ A;  2QQB A;  1OZ2 A;  2V1Q A;  3LGF A;  2CZ1 B;  3OB9 A;  4M7A C;  3A8K A;  2GK6 A;  2LTO A;  2DF6 A;  5GAM g;  4WWV A;  2LP5 A;  4E0F A;  4FYY B;  1VQ5 A;  2GQV A;  1PJ7 A;  2Y4X A;  1S0U A;  1Q81 C;  3OP1 A;  5KYU A;  4GLM A;  3GQB A;  2M16 A;  3HFO A;  1WDX A;  3CBO A;  3G4S Q;  2Y90 A;  4D8K A;  3MCA B;  5LL6 S;  1WYX A;  1FMK A;  2RI5 A;  1U2R A;  3NTK A;  3TCJ A;  1VQM Q;  3LQ6 A;  4TMZ A;  2FZC B;  1OB0 A;  2LJ3 A;  3VUB A;  3OMC A;  3GBQ A;  2RQT A;  4L5G A;  4RDL A;  2R5A A;  2ZPF B;  4M7D B;  2COZ A;  2HNI A;  5KYX A;  1VF7 A;  4RTX A;  4C8Q B;  4FK8 A;  2F2X A;  2QE7 A;  2QTZ A;  3VO2 A;  3G6E Q;  2CSI A;  2R6H A;  2L89 A;  3GNF B;  3CCL Q;  4Y7C A;  5I22 A;  1Q7Y D;  3M56 A;  1WHH A;  1OV3 A;  1SKY B;  1YHQ T;  2VUB A;  4Z4Y A;  2QTL A;  1BI3 A;  2YDL A;  4F17 A;  4DBH A;  1OGI A;  5KSW B;  1WNL A;  1X27 A;  4P6Y A;  1Y7X A;  1GL5 A;  3RMS A;  5CKD A;  4CC2 A;  1R5N A;  1M90 D;  2LRQ A;  2PNI A;  4OMN A;  4PC1 A;  1O75 A;  2QN6 A;  4TT3 A;  2BZX A;  1WU8 A;  1FX0 A;  2L2P A;  5J3O A;  4HA8 A;  1ZSZ A;  2AIR B;  4E2F B;  4F14 A;  2A28 A;  4GQN A;  2YWW A;  3SEM A;  3CXC B;  1NEG A;  5FU7 B;  1E64 A;  5GAN 4;  2D3L A;  4MYU A;  3CCS A;  3PT9 A;  2E4H A;  2DA9 A;  1JBM A;  1WFW A;  4OOX A;  4ZCL A;  4JJB A;  2WJV A;  1W87 A;  3SFM A;  3CMA T;  2DX1 A;  3H0H A;  1PNJ A;  1X2Q A;  4DQ2 A;  3JCM b;  2YUQ A;  2W10 A;  5H5J A;  5IYR A;  2BM1 A;  5JBQ A;  1JA0 A;  5THX A;  2O9S A;  5KE2 A;  2KY9 A;  3FKS A;  2JDI A;  1D0Z A;  1ZUK A;  3BY1 A;  3A8M B;  4BI8 B;  5GAO r;  2DOG A;  1QVF S;  3PMT A;  1KC8 R;  1NB9 A;  4J6W A;  3VRZ A;  2D8H A;  1AWX A;  2DD4 A;  4F7D A;  4FYV B;  1I18 A;  1M2V B;  2AK5 A;  3HRU A;  2RQR A;  1D09 B;  4ACB A;  4IIO A;  1NEB A;  2ZZQ A;  2FB7 A;  3H41 A;  2RH2 A;  3IQL A;  1OEB A;  1HJD A;  3CC7 Q;  4LDV A;  1UGV A;  3CC4 B;  4FYW B;  3JSC A;  2DER A;  2O4X B;  2KT8 A;  1BIA A;  4RCY A;  1N07 A;  4AG1 C;  4C92 D;  3U2Q A;  1PM3 A;  2XDP A;  1BYM A;  1K9M R;  1QH0 A;  1E7O A;  1WHM A;  2XK0 A;  2CUD A;  1QKW A;  4M7A F;  1I8F A;  4X06 A;  1FNM A;  3JV3 A;  2KSS A;  2HZY A;  2MI6 A;  1Q86 U;  5HZB A;  3CCS T;  4IUQ A;  2EGC A;  4M7D F;  2ZBU A;  3QFS A;  3M59 A;  4PJJ A;  4HT9 A;  1YIJ B;  1LJO A;  1OX8 A;  2C0T A;  1TS9 A;  1M8V A;  1ZUY A;  3VYG A;  2ZZF A;  3T56 B;  5GAN h;  2DK3 A;  1UD2 A;  4FW2 A;  2VNK A;  1YP5 A;  1U06 A;  1PHT A;  1WIE A;  2HL3 A;  5CKF A;  1YIJ T;  3CME A;  4PC6 A;  4RG8 A;  2HCJ B;  2ZL7 A;  2ZPE B;  3R6J A;  1Q81 D;  2OTJ Q;  1Z9Q A;  4AF7 A;  3OW2 S;  1KIK A;  4M7A G;  2DXT A;  3OS5 A;  1N9S A;  4XOT A;  3OMG A;  2M0Y A;  5CAI A;  1OU8 A;  3P27 A;  1RUW A;  5LJ5 f;  2RK2 A;  2XG8 D;  1RAC B;  4ELY C;  3JB9 H;  4Z4R A;  3L1A A;  1YI2 T;  1Q7Y R;  3CME T;  2E3I A;  3WVE B;  2D8J A;  4LBY A;  2E12 A;  1M3A A;  5KYY B;  3QFT A;  2F2V A;  5CDF A;  3ZBT A;  3EFS A;  1JXM A;  3ASQ A;  2GCX A;  1G5V A;  1U8R A;  3OYI A;  2VKN A;  1BU1 A;  1P4M A;  2OBR A;  1RLP C;  3OSV A;  4E7K A;  1G7R A;  2CND A;  1GFC A;  4Z4W A;  4LDU A;  4E47 A;  5GAO p;  3CCJ Q;  1IJF A;  1Q7Y C;  2MAM A;  3CRZ A;  2FX3 A;  1HVX A;  3W2F A;  3M58 A;  4ASU A;  1TSF A;  2Q6L A;  3JB9 I;  1EP1 B;  4XU3 A;  4Z4U A;  1FMV A;  2ZXH A;  1KQ1 A;  4E7S A;  2XMF A;  1UGP B;  1UE9 A;  2KXD A;  5CKH A;  2X6X A;  3W5V A;  5GMK h;  3CCR A;  2KYB A;  5E6T A;  2L3Q A;  3J80 E;  1VQ4 B;  1GCP A;  4C5G A;  1KK1 A;  4C92 B;  2VBT A;  1K73 U;  4PJN A;  4BY6 C;  2V4D A;  1AZE A;  1M90 C;  1M1K U;  4P1V A;  3JCM e;  4C5H A;  3MEA A;  3PUN A;  3RES A;  2P4R A;  5FO1 A;  5LJ5 d;  4VUB A;  3I56 A;  3W2H A;  3QE2 A;  1QGY A;  3EAE A;  3BCF A;  2X85 A;  4WZE A;  1TTT A;  3LYI A;  1FNC A;  3LX7 A;  3CXC P;  1ZSG A;  4P9S A;  1IXD A;  1KD1 U;  1WQ7 A;  4B6M A;  3OSS C;  2JS2 A;  2CDT A;  2JZ2 A;  4LD9 K;  2W0Z A;  4PLI A;  1S72 A;  1NB0 A;  1VIE A;  2AKL A; 
#chains in the Genus database with same CATH homology
 3H9N A;  2DOG A;  3A1P A;  2DYI A;  2F1L A;  3HTR A;  2QGG A;  1PM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...