3H9NA

Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target ir66.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target IR66
rcsb
source organism Haemophilus influenzae
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3h9nA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3h9nA01
3A1PA 3HTRA 2F1LA 2QGGA 1PM3A 3H9NA 2DOGA 2DYIA
chains in the Genus database with same CATH superfamily
3MHXA 4CC2A 1IZ6A 3OOCA 4OPOA 5IT9E 3GOXA 3MO8A 2YLBA 1NDHA 2F4NA 4UZUA 1KK7A 3JRZA 3V7CA 4P3YA 2RO0A 4LDVA 1AZGB 5FU6C 4HCZA 4MZMA 4ASUA 4FYYB 4XU1A 1QVGP 4ELZC 3OYGA 5CR2A 2Z6BD 1BU1A 2XMFA 3A8JA 4Z1MA 1WP6A 3UA7A 4M78E 2QI2A 3QJ6A 4BB7A 2JJ9A 3M55A 5CKBA 3OY9A 1SHFA 1KJWA 2PE3A 1V76A 2SEMA 4NL2A 4LNPA 4PC2A 3MEWA 3M4GA 2YUNA 3ME9A 1F1BB 5HK0A 5GAOn 5LJ5f 1F60A 2E70A 2LZ6B 2Y90A 2EAYA 3PT9A 1K76A 2OTJB 5IK2A 1U1SA 4BI3A 1N8RR 2X85A 3CC7T 3JB9H 3ISXA 3G4SA 1ZUNB 1VQPA 5B6IA 4PLLA 3VO2A 4OB0B 3CCMB 3VS5A 3FKSA 5KW9A 3INZA 3LYIA 3OSSC 4XN3A 1S72B 1SRLA 4M1KA 2DLPA 3GPLA 1NYGA 3SFMA 2ZZFA 3CCJB 1N9RA 2X4XA 3CEYA 1N9SA 2J6OA 2OX7A 2RJCA 2HAXA 3J80E 5GV7A 5E6TA 4TMTA 3GP8A 2FPEA 3I9QA 2YRVA 4GBQA 1E3XA 2RHYA 3JCMg 1PWTA 3M0RA 3HRTA 5GMKe 1MHNA 2EJGA 2O4XA 1E64A 3Q39A 5CVIA 2B7BA 4J8OA 1DG1G 1J9ZA 2YDLA 1PRLC 1ZBXA 1V1CA 1IJEA 2COZA 1X69A 2D9RA 3GF5A 2D3NA 2HCJB 3BCFA 4RD4A 1YI2Q 3WNDA 2J6KA 1NG2A 4QVZA 1G3YA 3G71B 4L5GA 1YITB 4JLGA 4A4GA 3CCLT 1VOMA 2M51A 2AZVA 4RTXA 2OTLQ 4J9IA 4PGOA 5J3BA 1VYTA 2RK1A 4JRIA 2BUDA 2QQAA 4OOSA 3MJXA 4LC0A 5LJ5j 2L3PA 3FLGA 3QYHB 1YX2A 1UHCA 4PC3A 5KYUA 5H59A 2EKHA 3CC2B 3CBOA 3MCAB 1TU0B 3RUXA 1PSFA 4ANJA 1RAFB 1EFCA 1VQLB 1GAWA 3CCVB 3P8DA 4OMNA 2B5OA 2MF2A 2EKOA 3A5ZB 1UJYA 3OBWA 2LJ1A 2RI2A 4RD1A 2O31A 3OYAA 3CXCA 2HD0A 1YIJQ 2ZPIB 1S1NA 1E1QA 3ZUGA 4P3IA 4DK0A 3HFOA 3QWXX 2ZBVA 1Q7YR 4X7DA 2PVDB 1QVFP 2E65A 2RPNA 3I5SA 1VYVA 4M77A 4ZTFA 1VQ4Q 1AOJA 2JXBA 5IHIA 2YHTA 1K8AD 4P2NA 5GAOp 4EPCA 1EP3B 1W4SA 3ASRA 2DKGA 2CKKA 2OBRA 3E9GA 1OZ2A 3BE3A 2WPDA 1RAEB 3EHRA 1RAHB 4M75B 4Z4SA 3OW2B 1SKUB 4QFMA 2HL3A 2D74A 4Q5WA 4DBRA 3VRZA 1VQ6T 3R6JA 1QKXA 1TOVA 3M59A 5BSXA 1G7SA 2AKLA 2YRCA 3AGQA 1WHHA 4ZGJB 2J7IA 2CH4W 1VYUA 2M16A 4EIKA 1EXMA 3HSBA 1QMCA 2F2VA 4E6RA 2QYZA 3U2QA 1KRHA 4II2A 1VQOB 3OBYA 4J6WA 2VBTA 2JN9A 5GAMd 4PJOA 3W2IA 4M7AB 3RNJA 4XORA 5L46A 3CC4B 1K28D 1RLQC 2VBUA 1HYOA 1MV0B 2OTLT 2KI7A 1E6HA 1K8AC 4XLFA 4C92F 5GAOl 3JU4A 1YJWQ 1LOJA 2AZSA 2LTOA 4JDSA 2RQUA 4P26A 4B4DA 4A63B 5CQYA 3CXCS 4DNTB 1SSFA 2EYZA 4M77D 1VLOA 2HSEB 3EG3A 3BDUA 2O4XB 5IYNA 3SWNB 4M75F 2K7AA 4QUZA 4YAFA 2D3LA 3SLNA 3KBGA 4M7AC 2K2VA 3SWNC 4F16A 2D0NA 3EG9A 5GAMe 2OTJT 1GR1A 1GXIE 1UD6A 5LJ3j 1YITQ 1WNLA 3ASTA 5CQXA 2F5KA 1Y07A 1BLIA 3H0HA 3CP2A 2W6IA 4C0SA 2WZPP 2OK8A 3KEWA 4F7UF 2HQXA 4AFUC 3CCLQ 4XTVA 3QSYA 1N05A 1X6BA 2ZPHB 3QDFA 2FPFA 4C5GA 3P26A 4AF7A 1WIEA 1CKAA 3VYHB 1H8EA 4HVVA 1JNYA 1IHVA 3CCJT 1Y7XA 1VUBA 4ZGDB 4YALA 2MOXA 1AVZC 1YJ9A 1J3TA 3JQPA 4YELA 3GNGA 4IUTA 1W2BP 3JAME 2E41A 2ROLA 5FWBA 2MWOA 3ASKA 1N8RU 1QKWA 3WNCA 3CCST 4NBSA 1T6ZA 3OJXA 1D1CA 4Q7JB 3I5RA 1M9SA 1WDXA 2MK5A 4ESRA 3A3GA 4X7FA 1UUEA 3A8KA 1W34A 1YJNA 1ZQ1A 2D1XA 1Q82C 3EG2A 3RDVA 1V0EA 2RJDA 3CMEQ 1UD5A 2V1RA 2XG8D 1KSWA 5LJ5d 3VYGA 4IKFA 3SHWA 1W70A 5IYPA 2R9VA 2FHDA 1G3TA 5GAOq 1YI2T 1KC8R 3MCAA 4R71A 1UGSB 2RJFA 1ZUUA 2LP5A 3DB3A 2HSPA 4AVZA 2ABLA 3OYFA 3A3BA 4NCNA 1FDRA 2ZGWA 5GV8A 2DXUA 1N0VC 4FN5A 1WXTA 4MDWA 3EH2A 3M5AA 4JPBW 2OI3A 3CCUT 2JIZA 1YNZA 2NUPA 4PLIA 5LJ5e 1VQ5Q 1PJ5A 3LQEA 1VQPB 2W10A 3BQJA 1RI9A 5D6WA 4HVWA 1OI1A 2DIEA 4WF2A 4PJOD 3VO1A 4MYTA 1ABOA 4BE1A 1M3BA 3T53B 1AIPA 4XN0A 3CD6A 1PKVA 1O9SA 2D0QB 1AWWA 1ZHIA 3NTHA 2Q6OA 2PUOB 4LDUA 2DMOA 3EGDB 1I0CA 5EG2A 5C0MA 3HPWA 2Q6IA 1ZUYA 3T56B 2X4YA 3NMZC 1OX9A 4BY6C 3PFSA 2CT3A 5FWCA 3V7RA 2O2OA 1I5LA 1ZA2B 9ATCB 1B23P 5IAYA 4O6JA 1Y0RA 4FXUA 4RJLA 1QUEA 5GJVB 3WQZA 2VBSA 1X27A 4OP7A 3SDZA 4C92G 2FEIA 2DNUA 4P6YA 5CDFA 2RQWA 4N0AA 1K73R 1RQPA 4LBVA 5CIUA 1BCMA 2J05A 1SHGA 1PM3A 5KYUB 1QWEA 1NLPC 2DTIA 3RKXA 5L23A 3UDCA 1E1RA 3EGXB 4DQLA 2CDTA 5A88A 1TTHB 2C4UA 2FVUA 2EBPA 2NPFA 3EH1A 1BX0A 1VJSA 3VS7A 1WDTA 2Q6LA 2DPPB 4PJOG 2QQRA 5A0LA 3SB2A 1UGQB 2K4YA 3BNWA 1YCSB 4FWTA 2K5FA 3LWIA 3D7SB 4Z4ZA 3FJOA 3OMCA 2NUTB 2R5AA 4VUBA 1R0BG 5IN1A 1U8RA 1R8OB 1K9AA 2P4TA 3FPPA 2ENMA 4C0DC 2LCLA 4OP0A 4JMQA 4G6IA 2DO3A 3FC3A 1P4MA 1WORA 5FO1A 1ZUKA 1XQBA 6AT1B 1T6YA 2EFIA 4Y92A 2QEXQ 2K9GA 2OAWA 5TV2A 1YN8A 1S72A 4QVJA 4MZTA 2X3UA 4WZTA 4AG1C 3H94A 1KQSS 1B34A 2BIVA 2CSQA 3WVDB 1VIFA 1IJFA 2X4JA 4JRPA 5CKEA 2MPXC 2VGMA 3CMMA 4C92D 1EWYA 1R77A 1UTIA 1YJNT 4DNRB 4CC7A 3PIPA 1GCPA 4M7DC 4BACA 4LDXA 2WJVA 3CB4A 4AFQC 4II3A 1QQJA 4M0LA 1BI0A 2LNVA 4F7DA 1H92A 5DLQE 4F7UB 2F1MA 3VR6A 4A4KA 2RH2A 2X6YA 2CSIA 1YI2A 4BDZA 1DDIA 1VQ9A 4OGCA 3LQ6A 4CC3A 1OV3A 1KD1U 1BK2A 1W87A 2J7KA 1X75C 1AWJA 5D6XA 1NE8A 1DARA 2A08A 3AVVA 1UB4A 2BZYA 3CC4Q 2GJRA 1VQMT 2B7CA 4M75D 1COWA 4RTVA 4KRTA 3CD6B 4L8JA 2P0QA 3RIRA 4XLCA 5HCKA 3CCQA 2KSSA 2CREA 2MMPA 1G2BA 1N0UA 1H8KA 3QYGB 3M54A 4XOPA 4M78F 3G6EQ 2L8DA 2K3XA 3ES9A 1M90C 4LDWA 4ZGNB 3MP1A 4E47A 2XI9A 2L3RA 4OMFB 3BDLA 1VQ8B 4X7CA 2GQIA 3X24B 2EIFA 1M1FA 2V1QA 3BFMA 2DIQA 3C0CA 4N4HA 1Q7YC 1WSVA 3BH4A 1MMAA 1UD2A 4E7SA 1ACMB 4Z02A 3Q3AA 2CZ1B 1H8HA 1TUIA 2LRQA 4P5NA 3C94A 4XTXA 4BI4A 5TY0A 2QA4T 4L6V5 3CW2A 3VNVA 2RI5A 3JCMW 5CCAA 1VQPQ 1KMHA 2VVKA 2G6FX 1KC8C 4RG8A 3OSVA 1EIFA 1OB2A 1M90D 2VUBA 1VQKT 4ATOA 3B78A 4XOTA 3WNBA 4BY6B 4RD2A 1JB9A 4JS4A 3OPOA 1JA1A 2C0TA 5D6YA 3PNWC 1R5BA 4OVAA 2WZNA 2X6WA 1G5VA 1UD3A 2LT4A 4IUPA 2XZLA 1D0ZA 1GCQC 2JMAA 4C0DB 2A36A 2X3WD 2XDPA 4M7DA 1KTVA 3W2HA 1Q95G 2ZZEA 4TMZA 1WJQA 3HAGA 3JCMf 3QXEB 4M4ZA 3G7ZA 4X1VA 2I2LA 4BD3A 3OYBA 3AVTA 5A0GA 3RESA 1KC8D 1N07A 1NPRA 5FIUA 4M7AG 5KYWA 3OW2P 1FNDA 1Y0MA 4M77E 3ZBUA 1OPLA 4OMOA 3FB9A 2COYA 2R6HA 2RHUA 4LBZA 1WI7A 2YLCA 2E5QA 1H85A 2K5LA 1VQNB 2DY1A 2KXCA 2H3JA 3VS2A 4P6VF 3Q6RA 3QFTA 2P4RA 1M8MA 2DZ9A 4DEXA 2JM9A 2LT1A 3OYNA 1SF9A 4A4FA 3FDRA 2EFGA 3NGPA 3RKWA 3RERA 3H9NA 4F7UE 4XU0A 1E6GA 4BI8B 1S72T 2DETA 1YJNB 5LJ5g 3G05A 2JZ2A 3F70A 1YLOA 4FT4A 2BZXA 1VQ8A 2BMWA 5LL6S 4RCBA 1E3ZA 2FZGB 1QVPA 1C6VX 2WACA 3JCMd 4LD9K 2YWGA 3W5HA 4XTUA 1Y0YA 1U06A 1HVXA 2OAUA 1BI1A 3CCJQ 4QV2A 1NBMA 4XNFA 1RAGB 2ZL5A 4LBWA 4JJDA 4DQKA 3JB9F 3FPKA 2ZTNA 1KD1R 4XTYA 2D9TA 4OMQA 4QQGA 4B9XA 2QGFB 1NJIC 2CNDA 3JCMb 1PJ6A 4XKWA 1R5OA 3CCQQ 2OTLB 1MNDA 4E2FB 3DLLA 2JDIA 2KRMA 2ROTA 2EW3A 3SJPA 2V7VA 2XK0A 4FM4B 1E62A 1BKBA 3VUBA 3GIRA 1XJWB 2EJFA 2PU9B 2XDBA 3PA1A 4XU3A 1CQXA 1W35A 3H0IA 2VBVA 4B48A 2IIMA 1VQ9Q 2JUFA 1I8FA 3KFVA 4WZEA 2RQVA 2ZZDA 5GAN5 5GMKm 1X43A 1TTTA 1Q86R 2VNJA 1AZEA 1KZLA 4P22A 2YRDA 2KVQG 4M75C 3CPWS 1YP5A 3TEEA 1OX8A 2DBMA 2H3EB 2GQVA 2E1BA 1HSQA 2HDNB 1M3CA 3ASPA 3T9NA 1BIAA 1YBYA 4J7FA 4DBHA 4KGZB 1UFFA 3W2EA 1GBRA 1QP3A 4QQ6A 4JZ3A 2HDAA 2R58A 3C12A 2DBKA 3BY2A 4TSFA 4RDJA 1LCKA 2BF4A 5KH6A 1S72Q 2DXCA 1E63A 4DBFA 2FPDA 4LUEA 4RTUA 2AT1B 2C0IA 5GAN2 3WXMA 2CK3A 3CBPA 2D6FA 3MEAA 2DJQA 2JJ1A 3QKJA 1RI0A 2BE7D 1R0CB 2V8KA 1XQHA 2CBXA 4B6MA 3I55B 4A4EA 5IHNA 2DL7A 3MEVA 4OOXA 2CYZB 3A8IA 4LDYA 4XMYA 3EGUA 1A8PA 3EGXA 3H41A 5LJ3g 1KK3A 3QZ9B 1H3ZA 3R6OA 1VQ7Q 4BE0A 2YSQA 2HEQA 1VQNQ 1GO2A 4AC9A 2LQKA 3OYCA 4KT0E 1W2BA 1BBZA 1I7PA 1WU8A 4F7UA 1Q86C 2HKQB 1QCNA 3RMSA 1VQ9T 1QVFS 3CPWA 3OZWA 1NPPA 3CPWB 2E3HA 4AFZC 2BVNA 1F20A 3O5ZA 4C5EA 1VA7A 2IG0A 1NB9A 2FZKB 1T3SA 1D1NA 2QTVA 4RCCA 2X51A 1MV3A 4B3GA 1QW1A 2E1RA 4B47A 5KYNA 2JJ2A 2RN8A 4PJJA 3OP1A 3R6NA 5AT1B 5FRMA 3VU3C 4ELYC 3DB4A 2WSFE 2RJEA 1WJSA 1KQ2A 4ZNXA 2X8KA 4P1VA 4E7LA 3AT1B 3OYJA 1KFZA 1G3SA 3GVKA 2DL5A 4NOYA 1YFNA 3CCEQ 1D0YA 3X26B 3CCEB 3V8JA 2XKOC 3E2UA 3G6EA 4C92A 3H8ZA 3CD6Q 2PVOB 2ZTGA 4DOWA 1D1AA 3CC4A 3ASQA 2KBTA 1H42A 5F4MA 3CCMA 2LX7A 3WYAA 4JJBA 1UDLA 1ZSZB 2VNKA 1T5EA 2HBPA 2YUOA 4ROXA 1QUFA 3OEHA 2K3YA 4F14A 1EFRA 4JRQA 2X9HA 1OOTA 4YTLA 2KMTA 1KK2A 2XZPA 4C0ZA 1K9MC 4FSSA 2V8JA 1M1KR 2L5QA 1GFDA 1BX1A 3V76A 2NUPB 2E5KA 2ZAEA 5CK9A 4FYXB 2QQBA 2BGJA 4YAUA 2H8HA 1D0XA 3A8HB 2DD5A 4CI0C 4DOVA 1FMKA 5A2QE 4J9EA 3ULRB 3CRZA 3PMIA 5FLXE 4N4GA 3UPUA 2QA4Q 3OS2A 4OGEA 1GCQA 2M0YA 3ONYA 4RD0A 2P0KA 4QW2A 3CMEA 2GTOA 3HKSA 3OA6A 3UATA 4GY5A 1ZM2A 1VQ6B 2M02A 4XU2A 2KYBA 4FW2A 2DTHA 3HRSA 3JB9I 3L2RA 3QFSA 1R5NA 1PJ7A 2ECZA 1RQRA 2QN6A 2JMCA 5LJ3e 2CF4A 3OYYA 2KR3A 4C43A 1IB0A 2EWNA 2LC4A 4J0QA 3PUMA 3OMGA 4CC4B 5I22A 3LW5E 4PABA 2YXYA 4FU6A 1YJ9Q 4BE2A 3AGPA 4RDKA 2B8AA 3E1YE 2NLUA 3VS3A 2J06A 3P8HA 2C5BA 4AFSC 1WTHD 3OB9A 3QDRB 3X28B 4Z88A 1W0KA 2B86A 3OS0A 3CMAB 1I07A 1JA0A 4KGVB 2QEXB 2MI6A 3SLDA 1WHGA 5HXBA 2JS0A 3MP6A 1PD0A 2X35A 3CCLA 2VXEA 5GANe 1G7TA 3CCUA 7AT1B 2COWA 1M27C 4XAXB 1KQSB 2WJYA 2DA9A 4M75G 3I55Q 5FU7B 3W5VA 5KSWB 2OK7A 5KYXA 1WOOA 4YEJA 4JJCA 2L3SA 5I21A 2KDSA 4YXWA 3V7AA 1NM7A 2VASA 4TMVA 1HD3A 2HL5C 1OYXA 4WZKA 2WSCE 3CQTA 4F7UG 4Z4YA 4IW3B 2CW5A 4RPBA 2XHCA 4XKVA 4FT2A 1NRKA 3J7AF 4ZCLA 3QHSA 4RDLA 4KH0B 2EIXA 4Y28E 2ATCB 2HZYA 1FMWA 2M5SA 5GANd 2KY9A 4L59A 1FX7A 2LCSA 4E7HA 4M7DF 4ZCIA 3PGGA 1VQ5B 1FRNA 2VJJA 2DJZA 5A0DA 1VQ5A 1JJ2S 1QVGA 3JCMh 3V8LA 4EMGA 2DEUA 2A7YA 4ACAA 2BTTA 2O9VA 1EFNA 5KYYA 4KKSA 1DDGA 1VQ9B 1XOVA 4XTWA 2ZCFB 2K3BA 1RABB 2RMOA 2Y4XA 3GVLA 3I56B 5GAN4 2X3XD 1VQOA 1C1AA 4PL6A 4GLKA 4E0FA 1I8DA 4IUUA 1Q81D 5J3OA 2HBWA 3CXCP 4RM0A 4RTWA 5GAMh 2XGJA 1BQEA 2A3LA 4C92C 2XD0A 2WSSA 1H641 5HZAA 1QVFA 2MWPA 1VQ4A 3CMAT 3W2FA 2A0FB 4D8KA 4TMWA 4BUGA 3ZZTA 4RTYA 4FCYA 5LJ3d 2XDDA 2YUPA 1YIJA 3CPFA 3NTKA 1YIJB 2EYWA 4ZCMA 3AHUA 5GAN3 4XLEA 5J39A 3JQQA 2QXFA 4DEYA 4C8QG 1D3BB 1IRXA 5D7UA 1XFOA 1KC8U 5FW9A 2CGHA 4C0FA 3A35A 2DF6A 1SM4A 1HXDA 3PMTA 1YITT 1VQ7B 4N0AC 1YJWB 3REAB 5CKFA 1WLPB 3X25B 1TG0A 4PJLA 2Y4YA 2MAMA 2DK3A 2C78A 5A8AA 3A8LB 3META 3ZBDA 2R57A 1EP1B 2WR8A 2Q6KA 3Q6QA 1K73C 2K79A 4C0GA 2OTLA 3PENA 1WXUA 3EGDA 4CQJA 2LZJA 3CCQB 3Q1JA 2VWFA 2AKKA 3KXTA 1MMDA 1PCXA 1PD1A 4OOVA 2YWWA 1GJRA 4IUVA 1G3WA 1VQKB 1B2RA 2R5MA 3PTAA 1KG1A 2JTFA 3PVDA 1D3BA 1VQ7T 1I1JA 1FWZA 3CCRA 3W5UA 1G7RA 5GMKi 4UZEA 5CKHA 2DX1A 4ACBA 3TVTA 3CCMQ 3GQBA 1YITA 3L2QA 3ER0A 2EQJA 4RKUE 1UMKA 1IHWA 1WHKA 5ECAA 1GVHA 1H3HA 1NYFA 1VQ4B 2C2WA 1X2KA 3EG1A 1SSHA 1WQ7A 3VUZA 2KRNA 3U6BA 4C8QE 2M0OA 3EFRA 4ZN3A 2OYNA 2E3IA 4ZV4A 3LGFA 1GL5A 4MMLA 1WA7A 3L1AA 3B82A 3SWNA 1AHJB 5IYRA 4PJOB 4M7AA 1EX4A 2LNHB 3M53A 1M2OA 1RAAB 4BDYA 1YJWA 1N27A 3JB9J 1JJ2P 2CP2A 2RF0A 5H5JA 5GAN8 1RUWA 4V2SA 3H0FA 4RD3A 4ZN1A 5J26A 2JS2A 3OYDA 4HIZA 3CCSQ 3CC4T 4M7AD 3I35A 3LX7A 4WZLA 2LJ0A 1WX6A 2DRMA 4R0KA 4Z8AA 3CD6T 2GJKA 1VQNT 4LBYA 1AD5A 1BI3A 4C8QD 2QEXT 1SRMA 1K9MR 5GANj 3CMET 1VQ7A 2XNCA 4MDXA 1QGZA 3S3NA 4QT7A 3G6EB 2BE9B 2BV3A 1FMVA 2EQUA 2GCXA 1K9MD 1AT1B 5FRNA 3M56A 2JVVA 4OMPA 1I18A 1OEBA 3ZPNA 2CZ7B 1D1BA 1ZSGA 3NFCA 1RL2A 2E64A 1ZX6A 3T51B 4TVRA 2JNGA 3G1JA 1CSKA 2QG9B 4RLZA 2XNDA 5GAMj 2V7XA 5F4OA 5HKCA 4X7EA 4H9GA 2MIOA 5GAOm 4C8QC 4EMKA 1VQLQ 4EMKB 3GNFB 3WY9A 1MUZA 1OQKA 2XIDA 3PA2A 2E10A 4PJNA 1KHCA 1QWFA 1NEBA 1WSRA 1IREB 2RNAA 1Q81C 3FRNA 3D26A 3EFOB 1QGYA 1SEMA 4ZTJA 4Z4TA 2FZCB 3MP8A 2GK6A 1PG5B 4X9CA 1Q86U 2V8IA 1X6GA 3G4SB 4QQDA 3VS1A 4J9FA 1Q9SA 1JO8A 2AK5A 2RB6A 4JS5A 1WZOA 2OTJQ 3G71Q 2E6ZA 3WBKA 1JBMA 4ZGEB 3ZBTA 3RKYA 2FVGA 4RD6A 1BYMA 3MEUA 2JM8A 3L2ZA 3BC9A 4HT8A 2K5IA 1OULA 3SJZA 2EQMA 5TR9A 1U5SA 1VQMA 2QDLA 1KIKA 1UGPB 3CCUB 1QH0A 1W2BB 2F2XA 2MCNA 5I2SA 3VS0A 2KXDA 2AHOA 1TWBA 4X34A 3URGA 2DVEA 4M7DB 3CC2Q 3P27A 2KT1A 3ONUA 3CMAQ 4Z89A 4DBQA 1TLLA 5IXFA 1W1FA 3OKXA 2CUDA 3H6ZA 3JCMX 1ZSZC 3ZFJA 1MGQA 3CMAA 1VQ4T 1VQ5T 4PJOC 2FYKA 3I1FA 1FRQA 2E1HA 3OZUA 3PVLA 4BPRA 5DSZA 1VQMQ 4DA4A 1SKQA 5HY6A 3CPWP 3MHPA 4JLIA 4Y9UA 1DJ7B 2VC8A 4KUIA 1WPCA 1OU9A 3CCRB 2BM1A 1QGAA 3QJYA 4G7WA 4XLAA 2RM4A 1LNXA 2RI3A 4QVDA 3ZC3A 2E12A 4RUGA 2WYRA 2OJ2A 1VQ8Q 1VQ6Q 2OTJA 4PNOA 3VS4A 2KYMA 4E7ZA 1FNMA 2EGAA 2NUZA 1UG1A 2CP5A 2EJ9A 2C0OA 2EGCA 4FL6A 4C5HA 2DFUA 1WOPA 4QKUA 2IPOB 2NV4A 2KVOA 5LMZA 3LWHA 1E79A 2ED0A 1D09B 1C0MA 4P25A 2PNIA 3A8MB 3LNNA 2P84A 4M78G 5FROA 3JQRA 1HZEA 2X4WA 4HA8A 3BY1A 3L42A 4PJOF 5KYYB 4FK8A 2BKDN 3A1PA 4Y9RA 4YHBA 2A28A 3S3MA 2FX3A 2CUBA 1IO6A 4G5GA 5LJ3h 1W2BS 2VJIA 3EG9B 2F1LA 4IIOA 3JCMe 1XE1A 1Q7YD 4E7IA 4B3FX 1JB0E 3RR6A 4TKOB 4JRKA 1YHQA 5GAN6 3I55T 4XONA 1VHEA 4AF6A 1K73D 5GANh 4FYVB 1A0NB 2EGEA 2K6DA 5EMNA 4PAAA 4R56A 2DRKA 2ZITA 1I5OB 4DQ2A 1TXQA 5CO7A 5FU6B 1X01A 4UAJA 1XB2A 2CS7A 4U9UA 5BSYA 2VGNA 1WHLA 3OE7A 1NJIR 4X07A 5GAN7 3FIFA 3CTAA 1D8TA 3TSWA 4K11A 1XNIA 3EG0A 1V5VA 3OYMA 1QVGS 2CH4A 3GSIA 1W9XA 1X6OA 2KEAA 2DCUA 3L2WA 2GNCA 3NTIA 1LJOA 3M0QA 2ZPGB 4X8IA 4J9DA 4Z4UA 1Q82U 4RMOA 3L2UA 2JN0A 2L2PA 1IHMA 2KRSA 2XEXA 2EQIA 4X05A 1OGIA 3P8BB 2DVJA 2PIAA 4M2LA 1M2VA 3CCSA 1IB8A 1PKTA 2L3QA 2JTEA 2LQNA 3KL9A 3UA6A 1RACB 1JXMA 3M0TA 2V7QA 5FNZA 2QDYB 4PC7A 2ZPBB 5CAIA 3ZZ0A 3JV3A 2E4HA 1OU8A 1Y57A 1ZSZA 2V4DA 2FRYA 4XL9A 4Z4WA 1MMNA 1WGSA 2RHXA 2QA4B 1OPKA 1FX0A 1ARKA 3CMEB 5TRDA 2BGIA 5A89A 4KULA 3E1SA 1U1TA 2ZZGA 4XR6A 4M77G 1JRIA 4OPVA 2D8JA 1TH7A 4C8QA 4EMKC 1ABQA 2CRVA 2BPOA 4EDUA 2VYTA 4XQFA 1LVKA 3AVUA 1V29B 4UZFA 3JCMQ 3DKMA 4M77F 3M9QA 3CC7A 4YAWA 2A37A 4M7AE 2DEQA 1M1GA 4PJMA 3OYLA 4X06A 4K1XA 1B3QA 1VQPT 4A54A 2VV5A 1QX4A 5FA6A 3CCRQ 2VZLA 4M53A 3QSUA 1VLYA 3CCMT 3L2VA 1I4K1 1VQ8T 2VXFA 1QVGB 1Q82D 1JQQA 2RA2A 1NEGA 3QG1A 2CT4A 3M0PA 1N8RC 3TSZA 1NJIU 1VQKA 1MNEA 2CZ6B 4IURA 2GREA 4QVAA 3VJPA 3TCJA 2BSAA 2LCCA 2K57A 5DLOA 3OQ5A 1U2RA 2C77A 3I56A 4C8QB 1K8AR 4B43A 1X2QA 3JSCA 4FIBA 4OB1B 4A4HA 3RY8A 1M4ZA 2F5TX 1AWOA 1E43A 1KQSA 1PKSA 3OJWA 2XICA 1TS9A 1ZBJA 2NUTA 2I0NA 3HP9A 4PKCC 1VF7A 2FRWA 4F04B 3EHQA 4C8QF 1N08A 1XTDA 1CNEA 1ZM3A 3E19A 4PFPA 4M7DE 3W2GA 5THXA 4LN2A 5HKKA 3BW1A 1YCYA 2QEXA 2P0PA 1HJDA 1MMGA 1K0SA 1W0JA 4HXJA 3QFCA 3HHTB 1UHFA 1WHJA 2HNIA 4HKEA 2GF7A 3M0SA 2KNBB 4M78C 2CC2A 1M90R 4D8DA 1QCFA 5GAMg 3WVEB 4B9WA 3CCLB 2KQWA 2LX9A 2O88A 3EFOA 5HZBA 4KH1B 3LH5A 2HCKA 5GAOr 3JCMV 1Q81U 1M8VA 4TT3A 4WCIA 1VQOQ 1KQSP 1QCOA 1WXBA 2CP0A 2F69A 2DERA 5KE3A 4JZ4A 5KYXB 2Z0WA 1OB0A 3QIIA 3PE0A 1WOSA 3OYKA 2F43A 4G1VA 1K73U 2PZ1A 4RCYA 3ASSA 4G7XA 4RCZA 2KK4A 3A98A 4NL3A 2W6JA 3CCVT 1QLYA 3E9FA 1Z9QA 3AVYA 3S6WA 1RLPC 2RC5A 4AG2C 3THKA 5J35A 4WWVA 5L8RE 1UD8A 2IVWA 3NHNA 4P12A 1TUGB 2RQRA 4LE9A 1Y71A 2G3RA 3CC2T 1Z9ZA 1N6AA 1BJKA 1QFZA 5IYQA 2XZOA 1E7OA 2GPJA 2QQ9A 5DM7R 2C4TA 1UJ0A 2C06A 3AVXA 2ZL7A 1KHIA 2QK0A 4OB3B 4PK4A 2XOKA 4FYWB 4AT1B 2DL3A 4HT9A 1OGJA 4F17A 4C92B 2EYXA 3LVBA 3CCVQ 5AN9A 3G71T 2E6NA 1M1KD 4GLMA 1MABA 2OBSA 3HTRA 3I55A 3AVWA 1TSFA 2NYSA 3QE2A 4Y91A 4J9BA 3OEEA 3JCMc 3UF4A 1PC0A 1S0UA 3CESA 2BZ8A 1EP2B 3CCUQ 4N4IA 4J5YA 2FL7A 1KD1D 1BI2A 1ZA1B 4O5VA 3VKIA 2SRCA 1Q81R 1QVFB 4J9CA 4HE6A 4NS5A 1Y96A 1W6XA 3OS1A 4M7DG 4Y7CA 1Y96B 4J83A 2I1LA 4J7IA 1YWOA 1IGQA 3ZEHA 5M9OA 3Q38A 2LQ8A 2KROA 3VMFA 1NBEB 5DN6A 1M2VB 3CCSB 1K1ZA 2LVMA 1G8XA 2PLFA 2XNJA 2J6FA 5GANg 2V7WA 4FW1A 2HQEA 2WSEE 2X6XA 2BN4A 1UE9A 2KT8A 3U23A 2JW4A 4GQNA 1AMOA 1T0JA 3VRYA 1JEGA 3M4YA 4J9HA 4KKUA 1QFYA 1OHHA 1K9MU 2LJ3A 1Q86D 4XTZA 3FJ5A 2EYQA 1YJNQ 2V26A 4B44A 1K8AU 1TUCA 2PMDA 2DL4A 1YIJT 1JU5C 1U3OA 3TREA 2X53S 1YI2B 2GJPA 2QTLA 1GBQA 5DY9A 3FEOA 2QA4A 1VQOT 3NPFA 4TN1A 1QP2A 2QTXA 5GMKh 2QDXA 1UGVA 5IH2A 3OW2S 2CP6A 3QZ5B 2KAFA 2QGGA 4P9SA 4KGXB 2DOGA 2KGTA 3CPXA 5JBQA 1FNBA 3PUNA 1WHMA 4KKTA 2V31A 2V7TA 3M58A 3HRUA 5FU7C 4XD7A 3U6KA 4CRIA 4X0CA 4PFOA 2LMJA 4ORZA 3CCQT 1VQKQ 3ZIAA 4Z4RA 3V7SA 4IIMA 1UECA 3QFRA 1FNCA 1M30A 2HKNA 4EMHA 3UWNA 2DYBA 1M1KU 3ZL7C 3X20B 1V0FA 4J9GA 4WTOB 4RTZA 5GMKl 3OYIA 4M78D 1LPLA 2K2MA 1YJ9T 1QFJA 2JTMA 2ZBUA 1SG5A 1OB5A 3VV0A 3G6ET 2DYIA 2QMUA 1NLOC 2LDMA 5KE2A 3G4ST 3QPHA 3CC7Q 1BB9A 2DXBA 2VNHA 1K4US 4ZGQB 1ZM9A 1KK1A 2ZPFB 2DXTA 4C92E 3OFNA 3CCVA 1PRMC 1WFWA 4JUVA 3OS5A 4DK1A 3OYEA 4B3XA 2EYYA 3CCEA 4MYUA 2EQKA 4D6WA 4II1A 2ESWA 2QAZA 3CP8A 3QUIA 3EAEA 2DM1A 3HL8A 5KCHA 2GK7A 4G1BA 1YJ9B 1N5ZA 1Q82R 3JCMJ 2PUKB 3LH0A 4M78B 1RADB 1JXOA 4PC6A 3I56T 4TMXA 3WBJA 1B34B 3A8GB 1VHOA 4YAOA 5FL7A 3N5BB 5IHKA 2FO0A 2HQHA 3WXMB 3V8KA 2GQFA 2PQWA 2RHIA 1WQWA 3SEJA 1BPLA 3PVQA 1GAQA 4HVUA 5GJWB 2FB7A 2MYSA 3TU4K 1AWXA 4WQMA 2RK2A 2HMAA 4PC1A 2GGRA 2YWEA 1IXDA 3BCDA 2DZCA 2AHJB 1FXXA 1PNJA 4KUDK 2O01E 1ELOA 4PFZA 2ZXIA 3RBBB 1PSEA 4R55A 2LQWA 3GVJA 2DD4A 2DTOA 1GFCA 3REBB 8AT1B 1VQNA 2M9UA 4M4SA 1SKYB 2XU8A 1P92A 1M1KC 4M75E 1N8RD 1FYNA 2EVRA 3TQ7P 2CZ0B 1Q7YU 3E20A 1YHQB 2PTKA 4RTTA 1D2EA 2HLDA 1CKBA 1HA3A 5GMKj 1UGRB 4OPSA 4N3GA 3O8VA 3JCMP 3C4SA 1KD1C 3PIOA 5C6SA 2ED1A 3LGLA 2KE9A 4XK8E 4A53A 3M57A 2JOYA 1YHQQ 1RAIB 3A8OB 4QHYA 4Z4VA 4QVCA 1ZM4A 5I2MA 4XM3A 3JB9G 4J6XA 2FG0A 1G83A 3CCET 1PHTA 3NE5B 5I11A 3JB9D 2YUQA 2YWFA 3DLMA 3VS6A 3OYHA 1O75A 1VQMB 2W0ZA 1EFUA 4M78A 1MRZA 2BM0A 1M5Q1 1M90U 1AEYA 1S4MA 4EH1A 1NJID 5KNLA 4FSXA 1B07A 3C95A 3BY7A 2PVGB 5CKDA 2CP7A 5IXBA 2RHZA 3SKBA 2O9SA 3GBQA 2QE7A 3EFSA 1VIEA 3R6KA 4OMMA 4RPDA 2EPDA 4JJNK 1GRIA 1OZ3A 1T0HA 3I56Q 5GANf 3GIBA 3QO3A 4LUDA 5HK3A 3S3OA 1WJRA 2DAQA 1QG0A 2ZL6A 4M7AF 3ZZUA 1I81A 1VQ6A 2V7UA 2DIGA 4PJOE 1ZLMA 1G7CA 1WPYA 4M77C 4OB2B 4LXCA 1VQLT 2GFAA 3OAAA 3M0UA 5IYWA 1EZZB 2OBTA 4M77B 5LJ3f 8ATCB 5F4JA 1HK9A 1CNFA 4XQ3A 2C5HA 1SPKA 2VNIA 2ZPEB 4UC4A 4XLHA 4LD6A 2VYQA 2JT4A 2GBQA 5GAMf 1EFTA 4C5IA 3OW7A 4KBMB 1BIBA 2VB6A 1TUDA 3KUFA 3RMQA 3SD4A 2X0KA 2YT6A 4AMCA 2P3MA 4HE5A 2F2WA 4M7DD 3OZVA 3VNUA 4N3NA 2QQSA 5KCOA 3CC2A 3MKDA 1M3AA 2DE0X 1KJZA 3CC7B 5KYWB 2RQTA 2ZZQA 4HCBA 2L89A 3CCRT 4X9DA 3CBMA 1BCOA 3IQLA 2L0AA 2YWHA 1T3LA 2GTJA 1NZ9A 1YWPA 2GFUA 5AYFA 4HCCA 3CCJA 1YHQT 2ZXHA 3FJPA 1K0XA 3CXCB 5LJ5h 3SEMA 1IGUA 1TVCA 3LLRA 3G71A 1JJ2A 2RD1A 3J81k 3GLXA 4MZPA 1JJ2B 3DDYA 4IUQA 2QTZA 3HFNA 2M1HA 1T6XA 2AIRB 3G4SQ 1KK0A 3LO8A 4E7KA 2D8HA 3QWYA 2DL8A 4E7JA 3MMPA 4ME7A 2QASA 5FO0A 2RC6A 1BMFA 2CP3A 3QBYA 3J81E 4M75A 3OW2A 4HCKA 4OMLA 1NB0A 1YJWT 4RG2A 2DILA 4NNJA 2VKNA 4MMKA 1UEBA 1B7TA 1WYXA 1VQLA 3B8HA 4J6YA 3UT1A 3MPUB 1KQ1A 1UD4A 2NWMA 5DS0A 4OF1A 1N06A 5EC7A
chains in the Genus database with same CATH topology
3A1PA 3HTRA 2F1LA 2QGGA 1PM3A 3H9NA 2DOGA 2DYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1P A;  3HTR A;  2F1L A;  2QGG A;  1PM3 A;  3H9N A;  2DOG A;  2DYI A; 
#chains in the Genus database with same CATH topology
 3MHX A;  4CC2 A;  1IZ6 A;  3OOC A;  4OPO A;  5IT9 E;  3GOX A;  3MO8 A;  2YLB A;  1NDH A;  2F4N A;  4UZU A;  1KK7 A;  3JRZ A;  3V7C A;  4P3Y A;  2RO0 A;  4LDV A;  1AZG B;  5FU6 C;  4HCZ A;  4MZM A;  4ASU A;  4FYY B;  4XU1 A;  1QVG P;  4ELZ C;  3OYG A;  5CR2 A;  2Z6B D;  1BU1 A;  2XMF A;  3A8J A;  4Z1M A;  1WP6 A;  3UA7 A;  4M78 E;  2QI2 A;  3QJ6 A;  4BB7 A;  2JJ9 A;  3M55 A;  5CKB A;  3OY9 A;  1SHF A;  1KJW A;  2PE3 A;  1V76 A;  2SEM A;  4NL2 A;  4LNP A;  4PC2 A;  3MEW A;  3M4G A;  2YUN A;  3ME9 A;  1F1B B;  5HK0 A;  5GAO n;  5LJ5 f;  1F60 A;  2E70 A;  2LZ6 B;  2Y90 A;  2EAY A;  3PT9 A;  1K76 A;  2OTJ B;  5IK2 A;  1U1S A;  4BI3 A;  1N8R R;  2X85 A;  3CC7 T;  3JB9 H;  3ISX A;  3G4S A;  1ZUN B;  1VQP A;  5B6I A;  4PLL A;  3VO2 A;  4OB0 B;  3CCM B;  3VS5 A;  3FKS A;  5KW9 A;  3INZ A;  3LYI A;  3OSS C;  4XN3 A;  1S72 B;  1SRL A;  4M1K A;  2DLP A;  3GPL A;  1NYG A;  3SFM A;  2ZZF A;  3CCJ B;  1N9R A;  2X4X A;  3CEY A;  1N9S A;  2J6O A;  2OX7 A;  2RJC A;  2HAX A;  3J80 E;  5GV7 A;  5E6T A;  4TMT A;  3GP8 A;  2FPE A;  3I9Q A;  2YRV A;  4GBQ A;  1E3X A;  2RHY A;  3JCM g;  1PWT A;  3M0R A;  3HRT A;  5GMK e;  1MHN A;  2EJG A;  2O4X A;  1E64 A;  3Q39 A;  5CVI A;  2B7B A;  4J8O A;  1DG1 G;  1J9Z A;  2YDL A;  1PRL C;  1ZBX A;  1V1C A;  1IJE A;  2COZ A;  1X69 A;  2D9R A;  3GF5 A;  2D3N A;  2HCJ B;  3BCF A;  4RD4 A;  1YI2 Q;  3WND A;  2J6K A;  1NG2 A;  4QVZ A;  1G3Y A;  3G71 B;  4L5G A;  1YIT B;  4JLG A;  4A4G A;  3CCL T;  1VOM A;  2M51 A;  2AZV A;  4RTX A;  2OTL Q;  4J9I A;  4PGO A;  5J3B A;  1VYT A;  2RK1 A;  4JRI A;  2BUD A;  2QQA A;  4OOS A;  3MJX A;  4LC0 A;  5LJ5 j;  2L3P A;  3FLG A;  3QYH B;  1YX2 A;  1UHC A;  4PC3 A;  5KYU A;  5H59 A;  2EKH A;  3CC2 B;  3CBO A;  3MCA B;  1TU0 B;  3RUX A;  1PSF A;  4ANJ A;  1RAF B;  1EFC A;  1VQL B;  1GAW A;  3CCV B;  3P8D A;  4OMN A;  2B5O A;  2MF2 A;  2EKO A;  3A5Z B;  1UJY A;  3OBW A;  2LJ1 A;  2RI2 A;  4RD1 A;  2O31 A;  3OYA A;  3CXC A;  2HD0 A;  1YIJ Q;  2ZPI B;  1S1N A;  1E1Q A;  3ZUG A;  4P3I A;  4DK0 A;  3HFO A;  3QWX X;  2ZBV A;  1Q7Y R;  4X7D A;  2PVD B;  1QVF P;  2E65 A;  2RPN A;  3I5S A;  1VYV A;  4M77 A;  4ZTF A;  1VQ4 Q;  1AOJ A;  2JXB A;  5IHI A;  2YHT A;  1K8A D;  4P2N A;  5GAO p;  4EPC A;  1EP3 B;  1W4S A;  3ASR A;  2DKG A;  2CKK A;  2OBR A;  3E9G A;  1OZ2 A;  3BE3 A;  2WPD A;  1RAE B;  3EHR A;  1RAH B;  4M75 B;  4Z4S A;  3OW2 B;  1SKU B;  4QFM A;  2HL3 A;  2D74 A;  4Q5W A;  4DBR A;  3VRZ A;  1VQ6 T;  3R6J A;  1QKX A;  1TOV A;  3M59 A;  5BSX A;  1G7S A;  2AKL A;  2YRC A;  3AGQ A;  1WHH A;  4ZGJ B;  2J7I A;  2CH4 W;  1VYU A;  2M16 A;  4EIK A;  1EXM A;  3HSB A;  1QMC A;  2F2V A;  4E6R A;  2QYZ A;  3U2Q A;  1KRH A;  4II2 A;  1VQO B;  3OBY A;  4J6W A;  2VBT A;  2JN9 A;  5GAM d;  4PJO A;  3W2I A;  4M7A B;  3RNJ A;  4XOR A;  5L46 A;  3CC4 B;  1K28 D;  1RLQ C;  2VBU A;  1HYO A;  1MV0 B;  2OTL T;  2KI7 A;  1E6H A;  1K8A C;  4XLF A;  4C92 F;  5GAO l;  3JU4 A;  1YJW Q;  1LOJ A;  2AZS A;  2LTO A;  4JDS A;  2RQU A;  4P26 A;  4B4D A;  4A63 B;  5CQY A;  3CXC S;  4DNT B;  1SSF A;  2EYZ A;  4M77 D;  1VLO A;  2HSE B;  3EG3 A;  3BDU A;  2O4X B;  5IYN A;  3SWN B;  4M75 F;  2K7A A;  4QUZ A;  4YAF A;  2D3L A;  3SLN A;  3KBG A;  4M7A C;  2K2V A;  3SWN C;  4F16 A;  2D0N A;  3EG9 A;  5GAM e;  2OTJ T;  1GR1 A;  1GXI E;  1UD6 A;  5LJ3 j;  1YIT Q;  1WNL A;  3AST A;  5CQX A;  2F5K A;  1Y07 A;  1BLI A;  3H0H A;  3CP2 A;  2W6I A;  4C0S A;  2WZP P;  2OK8 A;  3KEW A;  4F7U F;  2HQX A;  4AFU C;  3CCL Q;  4XTV A;  3QSY A;  1N05 A;  1X6B A;  2ZPH B;  3QDF A;  2FPF A;  4C5G A;  3P26 A;  4AF7 A;  1WIE A;  1CKA A;  3VYH B;  1H8E A;  4HVV A;  1JNY A;  1IHV A;  3CCJ T;  1Y7X A;  1VUB A;  4ZGD B;  4YAL A;  2MOX A;  1AVZ C;  1YJ9 A;  1J3T A;  3JQP A;  4YEL A;  3GNG A;  4IUT A;  1W2B P;  3JAM E;  2E41 A;  2ROL A;  5FWB A;  2MWO A;  3ASK A;  1N8R U;  1QKW A;  3WNC A;  3CCS T;  4NBS A;  1T6Z A;  3OJX A;  1D1C A;  4Q7J B;  3I5R A;  1M9S A;  1WDX A;  2MK5 A;  4ESR A;  3A3G A;  4X7F A;  1UUE A;  3A8K A;  1W34 A;  1YJN A;  1ZQ1 A;  2D1X A;  1Q82 C;  3EG2 A;  3RDV A;  1V0E A;  2RJD A;  3CME Q;  1UD5 A;  2V1R A;  2XG8 D;  1KSW A;  5LJ5 d;  3VYG A;  4IKF A;  3SHW A;  1W70 A;  5IYP A;  2R9V A;  2FHD A;  1G3T A;  5GAO q;  1YI2 T;  1KC8 R;  3MCA A;  4R71 A;  1UGS B;  2RJF A;  1ZUU A;  2LP5 A;  3DB3 A;  2HSP A;  4AVZ A;  2ABL A;  3OYF A;  3A3B A;  4NCN A;  1FDR A;  2ZGW A;  5GV8 A;  2DXU A;  1N0V C;  4FN5 A;  1WXT A;  4MDW A;  3EH2 A;  3M5A A;  4JPB W;  2OI3 A;  3CCU T;  2JIZ A;  1YNZ A;  2NUP A;  4PLI A;  5LJ5 e;  1VQ5 Q;  1PJ5 A;  3LQE A;  1VQP B;  2W10 A;  3BQJ A;  1RI9 A;  5D6W A;  4HVW A;  1OI1 A;  2DIE A;  4WF2 A;  4PJO D;  3VO1 A;  4MYT A;  1ABO A;  4BE1 A;  1M3B A;  3T53 B;  1AIP A;  4XN0 A;  3CD6 A;  1PKV A;  1O9S A;  2D0Q B;  1AWW A;  1ZHI A;  3NTH A;  2Q6O A;  2PUO B;  4LDU A;  2DMO A;  3EGD B;  1I0C A;  5EG2 A;  5C0M A;  3HPW A;  2Q6I A;  1ZUY A;  3T56 B;  2X4Y A;  3NMZ C;  1OX9 A;  4BY6 C;  3PFS A;  2CT3 A;  5FWC A;  3V7R A;  2O2O A;  1I5L A;  1ZA2 B;  9ATC B;  1B23 P;  5IAY A;  4O6J A;  1Y0R A;  4FXU A;  4RJL A;  1QUE A;  5GJV B;  3WQZ A;  2VBS A;  1X27 A;  4OP7 A;  3SDZ A;  4C92 G;  2FEI A;  2DNU A;  4P6Y A;  5CDF A;  2RQW A;  4N0A A;  1K73 R;  1RQP A;  4LBV A;  5CIU A;  1BCM A;  2J05 A;  1SHG A;  1PM3 A;  5KYU B;  1QWE A;  1NLP C;  2DTI A;  3RKX A;  5L23 A;  3UDC A;  1E1R A;  3EGX B;  4DQL A;  2CDT A;  5A88 A;  1TTH B;  2C4U A;  2FVU A;  2EBP A;  2NPF A;  3EH1 A;  1BX0 A;  1VJS A;  3VS7 A;  1WDT A;  2Q6L A;  2DPP B;  4PJO G;  2QQR A;  5A0L A;  3SB2 A;  1UGQ B;  2K4Y A;  3BNW A;  1YCS B;  4FWT A;  2K5F A;  3LWI A;  3D7S B;  4Z4Z A;  3FJO A;  3OMC A;  2NUT B;  2R5A A;  4VUB A;  1R0B G;  5IN1 A;  1U8R A;  1R8O B;  1K9A A;  2P4T A;  3FPP A;  2ENM A;  4C0D C;  2LCL A;  4OP0 A;  4JMQ A;  4G6I A;  2DO3 A;  3FC3 A;  1P4M A;  1WOR A;  5FO1 A;  1ZUK A;  1XQB A;  6AT1 B;  1T6Y A;  2EFI A;  4Y92 A;  2QEX Q;  2K9G A;  2OAW A;  5TV2 A;  1YN8 A;  1S72 A;  4QVJ A;  4MZT A;  2X3U A;  4WZT A;  4AG1 C;  3H94 A;  1KQS S;  1B34 A;  2BIV A;  2CSQ A;  3WVD B;  1VIF A;  1IJF A;  2X4J A;  4JRP A;  5CKE A;  2MPX C;  2VGM A;  3CMM A;  4C92 D;  1EWY A;  1R77 A;  1UTI A;  1YJN T;  4DNR B;  4CC7 A;  3PIP A;  1GCP A;  4M7D C;  4BAC A;  4LDX A;  2WJV A;  3CB4 A;  4AFQ C;  4II3 A;  1QQJ A;  4M0L A;  1BI0 A;  2LNV A;  4F7D A;  1H92 A;  5DLQ E;  4F7U B;  2F1M A;  3VR6 A;  4A4K A;  2RH2 A;  2X6Y A;  2CSI A;  1YI2 A;  4BDZ A;  1DDI A;  1VQ9 A;  4OGC A;  3LQ6 A;  4CC3 A;  1OV3 A;  1KD1 U;  1BK2 A;  1W87 A;  2J7K A;  1X75 C;  1AWJ A;  5D6X A;  1NE8 A;  1DAR A;  2A08 A;  3AVV A;  1UB4 A;  2BZY A;  3CC4 Q;  2GJR A;  1VQM T;  2B7C A;  4M75 D;  1COW A;  4RTV A;  4KRT A;  3CD6 B;  4L8J A;  2P0Q A;  3RIR A;  4XLC A;  5HCK A;  3CCQ A;  2KSS A;  2CRE A;  2MMP A;  1G2B A;  1N0U A;  1H8K A;  3QYG B;  3M54 A;  4XOP A;  4M78 F;  3G6E Q;  2L8D A;  2K3X A;  3ES9 A;  1M90 C;  4LDW A;  4ZGN B;  3MP1 A;  4E47 A;  2XI9 A;  2L3R A;  4OMF B;  3BDL A;  1VQ8 B;  4X7C A;  2GQI A;  3X24 B;  2EIF A;  1M1F A;  2V1Q A;  3BFM A;  2DIQ A;  3C0C A;  4N4H A;  1Q7Y C;  1WSV A;  3BH4 A;  1MMA A;  1UD2 A;  4E7S A;  1ACM B;  4Z02 A;  3Q3A A;  2CZ1 B;  1H8H A;  1TUI A;  2LRQ A;  4P5N A;  3C94 A;  4XTX A;  4BI4 A;  5TY0 A;  2QA4 T;  4L6V 5;  3CW2 A;  3VNV A;  2RI5 A;  3JCM W;  5CCA A;  1VQP Q;  1KMH A;  2VVK A;  2G6F X;  1KC8 C;  4RG8 A;  3OSV A;  1EIF A;  1OB2 A;  1M90 D;  2VUB A;  1VQK T;  4ATO A;  3B78 A;  4XOT A;  3WNB A;  4BY6 B;  4RD2 A;  1JB9 A;  4JS4 A;  3OPO A;  1JA1 A;  2C0T A;  5D6Y A;  3PNW C;  1R5B A;  4OVA A;  2WZN A;  2X6W A;  1G5V A;  1UD3 A;  2LT4 A;  4IUP A;  2XZL A;  1D0Z A;  1GCQ C;  2JMA A;  4C0D B;  2A36 A;  2X3W D;  2XDP A;  4M7D A;  1KTV A;  3W2H A;  1Q95 G;  2ZZE A;  4TMZ A;  1WJQ A;  3HAG A;  3JCM f;  3QXE B;  4M4Z A;  3G7Z A;  4X1V A;  2I2L A;  4BD3 A;  3OYB A;  3AVT A;  5A0G A;  3RES A;  1KC8 D;  1N07 A;  1NPR A;  5FIU A;  4M7A G;  5KYW A;  3OW2 P;  1FND A;  1Y0M A;  4M77 E;  3ZBU A;  1OPL A;  4OMO A;  3FB9 A;  2COY A;  2R6H A;  2RHU A;  4LBZ A;  1WI7 A;  2YLC A;  2E5Q A;  1H85 A;  2K5L A;  1VQN B;  2DY1 A;  2KXC A;  2H3J A;  3VS2 A;  4P6V F;  3Q6R A;  3QFT A;  2P4R A;  1M8M A;  2DZ9 A;  4DEX A;  2JM9 A;  2LT1 A;  3OYN A;  1SF9 A;  4A4F A;  3FDR A;  2EFG A;  3NGP A;  3RKW A;  3RER A;  3H9N A;  4F7U E;  4XU0 A;  1E6G A;  4BI8 B;  1S72 T;  2DET A;  1YJN B;  5LJ5 g;  3G05 A;  2JZ2 A;  3F70 A;  1YLO A;  4FT4 A;  2BZX A;  1VQ8 A;  2BMW A;  5LL6 S;  4RCB A;  1E3Z A;  2FZG B;  1QVP A;  1C6V X;  2WAC A;  3JCM d;  4LD9 K;  2YWG A;  3W5H A;  4XTU A;  1Y0Y A;  1U06 A;  1HVX A;  2OAU A;  1BI1 A;  3CCJ Q;  4QV2 A;  1NBM A;  4XNF A;  1RAG B;  2ZL5 A;  4LBW A;  4JJD A;  4DQK A;  3JB9 F;  3FPK A;  2ZTN A;  1KD1 R;  4XTY A;  2D9T A;  4OMQ A;  4QQG A;  4B9X A;  2QGF B;  1NJI C;  2CND A;  3JCM b;  1PJ6 A;  4XKW A;  1R5O A;  3CCQ Q;  2OTL B;  1MND A;  4E2F B;  3DLL A;  2JDI A;  2KRM A;  2ROT A;  2EW3 A;  3SJP A;  2V7V A;  2XK0 A;  4FM4 B;  1E62 A;  1BKB A;  3VUB A;  3GIR A;  1XJW B;  2EJF A;  2PU9 B;  2XDB A;  3PA1 A;  4XU3 A;  1CQX A;  1W35 A;  3H0I A;  2VBV A;  4B48 A;  2IIM A;  1VQ9 Q;  2JUF A;  1I8F A;  3KFV A;  4WZE A;  2RQV A;  2ZZD A;  5GAN 5;  5GMK m;  1X43 A;  1TTT A;  1Q86 R;  2VNJ A;  1AZE A;  1KZL A;  4P22 A;  2YRD A;  2KVQ G;  4M75 C;  3CPW S;  1YP5 A;  3TEE A;  1OX8 A;  2DBM A;  2H3E B;  2GQV A;  2E1B A;  1HSQ A;  2HDN B;  1M3C A;  3ASP A;  3T9N A;  1BIA A;  1YBY A;  4J7F A;  4DBH A;  4KGZ B;  1UFF A;  3W2E A;  1GBR A;  1QP3 A;  4QQ6 A;  4JZ3 A;  2HDA A;  2R58 A;  3C12 A;  2DBK A;  3BY2 A;  4TSF A;  4RDJ A;  1LCK A;  2BF4 A;  5KH6 A;  1S72 Q;  2DXC A;  1E63 A;  4DBF A;  2FPD A;  4LUE A;  4RTU A;  2AT1 B;  2C0I A;  5GAN 2;  3WXM A;  2CK3 A;  3CBP A;  2D6F A;  3MEA A;  2DJQ A;  2JJ1 A;  3QKJ A;  1RI0 A;  2BE7 D;  1R0C B;  2V8K A;  1XQH A;  2CBX A;  4B6M A;  3I55 B;  4A4E A;  5IHN A;  2DL7 A;  3MEV A;  4OOX A;  2CYZ B;  3A8I A;  4LDY A;  4XMY A;  3EGU A;  1A8P A;  3EGX A;  3H41 A;  5LJ3 g;  1KK3 A;  3QZ9 B;  1H3Z A;  3R6O A;  1VQ7 Q;  4BE0 A;  2YSQ A;  2HEQ A;  1VQN Q;  1GO2 A;  4AC9 A;  2LQK A;  3OYC A;  4KT0 E;  1W2B A;  1BBZ A;  1I7P A;  1WU8 A;  4F7U A;  1Q86 C;  2HKQ B;  1QCN A;  3RMS A;  1VQ9 T;  1QVF S;  3CPW A;  3OZW A;  1NPP A;  3CPW B;  2E3H A;  4AFZ C;  2BVN A;  1F20 A;  3O5Z A;  4C5E A;  1VA7 A;  2IG0 A;  1NB9 A;  2FZK B;  1T3S A;  1D1N A;  2QTV A;  4RCC A;  2X51 A;  1MV3 A;  4B3G A;  1QW1 A;  2E1R A;  4B47 A;  5KYN A;  2JJ2 A;  2RN8 A;  4PJJ A;  3OP1 A;  3R6N A;  5AT1 B;  5FRM A;  3VU3 C;  4ELY C;  3DB4 A;  2WSF E;  2RJE A;  1WJS A;  1KQ2 A;  4ZNX A;  2X8K A;  4P1V A;  4E7L A;  3AT1 B;  3OYJ A;  1KFZ A;  1G3S A;  3GVK A;  2DL5 A;  4NOY A;  1YFN A;  3CCE Q;  1D0Y A;  3X26 B;  3CCE B;  3V8J A;  2XKO C;  3E2U A;  3G6E A;  4C92 A;  3H8Z A;  3CD6 Q;  2PVO B;  2ZTG A;  4DOW A;  1D1A A;  3CC4 A;  3ASQ A;  2KBT A;  1H42 A;  5F4M A;  3CCM A;  2LX7 A;  3WYA A;  4JJB A;  1UDL A;  1ZSZ B;  2VNK A;  1T5E A;  2HBP A;  2YUO A;  4ROX A;  1QUF A;  3OEH A;  2K3Y A;  4F14 A;  1EFR A;  4JRQ A;  2X9H A;  1OOT A;  4YTL A;  2KMT A;  1KK2 A;  2XZP A;  4C0Z A;  1K9M C;  4FSS A;  2V8J A;  1M1K R;  2L5Q A;  1GFD A;  1BX1 A;  3V76 A;  2NUP B;  2E5K A;  2ZAE A;  5CK9 A;  4FYX B;  2QQB A;  2BGJ A;  4YAU A;  2H8H A;  1D0X A;  3A8H B;  2DD5 A;  4CI0 C;  4DOV A;  1FMK A;  5A2Q E;  4J9E A;  3ULR B;  3CRZ A;  3PMI A;  5FLX E;  4N4G A;  3UPU A;  2QA4 Q;  3OS2 A;  4OGE A;  1GCQ A;  2M0Y A;  3ONY A;  4RD0 A;  2P0K A;  4QW2 A;  3CME A;  2GTO A;  3HKS A;  3OA6 A;  3UAT A;  4GY5 A;  1ZM2 A;  1VQ6 B;  2M02 A;  4XU2 A;  2KYB A;  4FW2 A;  2DTH A;  3HRS A;  3JB9 I;  3L2R A;  3QFS A;  1R5N A;  1PJ7 A;  2ECZ A;  1RQR A;  2QN6 A;  2JMC A;  5LJ3 e;  2CF4 A;  3OYY A;  2KR3 A;  4C43 A;  1IB0 A;  2EWN A;  2LC4 A;  4J0Q A;  3PUM A;  3OMG A;  4CC4 B;  5I22 A;  3LW5 E;  4PAB A;  2YXY A;  4FU6 A;  1YJ9 Q;  4BE2 A;  3AGP A;  4RDK A;  2B8A A;  3E1Y E;  2NLU A;  3VS3 A;  2J06 A;  3P8H A;  2C5B A;  4AFS C;  1WTH D;  3OB9 A;  3QDR B;  3X28 B;  4Z88 A;  1W0K A;  2B86 A;  3OS0 A;  3CMA B;  1I07 A;  1JA0 A;  4KGV B;  2QEX B;  2MI6 A;  3SLD A;  1WHG A;  5HXB A;  2JS0 A;  3MP6 A;  1PD0 A;  2X35 A;  3CCL A;  2VXE A;  5GAN e;  1G7T A;  3CCU A;  7AT1 B;  2COW A;  1M27 C;  4XAX B;  1KQS B;  2WJY A;  2DA9 A;  4M75 G;  3I55 Q;  5FU7 B;  3W5V A;  5KSW B;  2OK7 A;  5KYX A;  1WOO A;  4YEJ A;  4JJC A;  2L3S A;  5I21 A;  2KDS A;  4YXW A;  3V7A A;  1NM7 A;  2VAS A;  4TMV A;  1HD3 A;  2HL5 C;  1OYX A;  4WZK A;  2WSC E;  3CQT A;  4F7U G;  4Z4Y A;  4IW3 B;  2CW5 A;  4RPB A;  2XHC A;  4XKV A;  4FT2 A;  1NRK A;  3J7A F;  4ZCL A;  3QHS A;  4RDL A;  4KH0 B;  2EIX A;  4Y28 E;  2ATC B;  2HZY A;  1FMW A;  2M5S A;  5GAN d;  2KY9 A;  4L59 A;  1FX7 A;  2LCS A;  4E7H A;  4M7D F;  4ZCI A;  3PGG A;  1VQ5 B;  1FRN A;  2VJJ A;  2DJZ A;  5A0D A;  1VQ5 A;  1JJ2 S;  1QVG A;  3JCM h;  3V8L A;  4EMG A;  2DEU A;  2A7Y A;  4ACA A;  2BTT A;  2O9V A;  1EFN A;  5KYY A;  4KKS A;  1DDG A;  1VQ9 B;  1XOV A;  4XTW A;  2ZCF B;  2K3B A;  1RAB B;  2RMO A;  2Y4X A;  3GVL A;  3I56 B;  5GAN 4;  2X3X D;  1VQO A;  1C1A A;  4PL6 A;  4GLK A;  4E0F A;  1I8D A;  4IUU A;  1Q81 D;  5J3O A;  2HBW A;  3CXC P;  4RM0 A;  4RTW A;  5GAM h;  2XGJ A;  1BQE A;  2A3L A;  4C92 C;  2XD0 A;  2WSS A;  1H64 1;  5HZA A;  1QVF A;  2MWP A;  1VQ4 A;  3CMA T;  3W2F A;  2A0F B;  4D8K A;  4TMW A;  4BUG A;  3ZZT A;  4RTY A;  4FCY A;  5LJ3 d;  2XDD A;  2YUP A;  1YIJ A;  3CPF A;  3NTK A;  1YIJ B;  2EYW A;  4ZCM A;  3AHU A;  5GAN 3;  4XLE A;  5J39 A;  3JQQ A;  2QXF A;  4DEY A;  4C8Q G;  1D3B B;  1IRX A;  5D7U A;  1XFO A;  1KC8 U;  5FW9 A;  2CGH A;  4C0F A;  3A35 A;  2DF6 A;  1SM4 A;  1HXD A;  3PMT A;  1YIT T;  1VQ7 B;  4N0A C;  1YJW B;  3REA B;  5CKF A;  1WLP B;  3X25 B;  1TG0 A;  4PJL A;  2Y4Y A;  2MAM A;  2DK3 A;  2C78 A;  5A8A A;  3A8L B;  3MET A;  3ZBD A;  2R57 A;  1EP1 B;  2WR8 A;  2Q6K A;  3Q6Q A;  1K73 C;  2K79 A;  4C0G A;  2OTL A;  3PEN A;  1WXU A;  3EGD A;  4CQJ A;  2LZJ A;  3CCQ B;  3Q1J A;  2VWF A;  2AKK A;  3KXT A;  1MMD A;  1PCX A;  1PD1 A;  4OOV A;  2YWW A;  1GJR A;  4IUV A;  1G3W A;  1VQK B;  1B2R A;  2R5M A;  3PTA A;  1KG1 A;  2JTF A;  3PVD A;  1D3B A;  1VQ7 T;  1I1J A;  1FWZ A;  3CCR A;  3W5U A;  1G7R A;  5GMK i;  4UZE A;  5CKH A;  2DX1 A;  4ACB A;  3TVT A;  3CCM Q;  3GQB A;  1YIT A;  3L2Q A;  3ER0 A;  2EQJ A;  4RKU E;  1UMK A;  1IHW A;  1WHK A;  5ECA A;  1GVH A;  1H3H A;  1NYF A;  1VQ4 B;  2C2W A;  1X2K A;  3EG1 A;  1SSH A;  1WQ7 A;  3VUZ A;  2KRN A;  3U6B A;  4C8Q E;  2M0O A;  3EFR A;  4ZN3 A;  2OYN A;  2E3I A;  4ZV4 A;  3LGF A;  1GL5 A;  4MML A;  1WA7 A;  3L1A A;  3B82 A;  3SWN A;  1AHJ B;  5IYR A;  4PJO B;  4M7A A;  1EX4 A;  2LNH B;  3M53 A;  1M2O A;  1RAA B;  4BDY A;  1YJW A;  1N27 A;  3JB9 J;  1JJ2 P;  2CP2 A;  2RF0 A;  5H5J A;  5GAN 8;  1RUW A;  4V2S A;  3H0F A;  4RD3 A;  4ZN1 A;  5J26 A;  2JS2 A;  3OYD A;  4HIZ A;  3CCS Q;  3CC4 T;  4M7A D;  3I35 A;  3LX7 A;  4WZL A;  2LJ0 A;  1WX6 A;  2DRM A;  4R0K A;  4Z8A A;  3CD6 T;  2GJK A;  1VQN T;  4LBY A;  1AD5 A;  1BI3 A;  4C8Q D;  2QEX T;  1SRM A;  1K9M R;  5GAN j;  3CME T;  1VQ7 A;  2XNC A;  4MDX A;  1QGZ A;  3S3N A;  4QT7 A;  3G6E B;  2BE9 B;  2BV3 A;  1FMV A;  2EQU A;  2GCX A;  1K9M D;  1AT1 B;  5FRN A;  3M56 A;  2JVV A;  4OMP A;  1I18 A;  1OEB A;  3ZPN A;  2CZ7 B;  1D1B A;  1ZSG A;  3NFC A;  1RL2 A;  2E64 A;  1ZX6 A;  3T51 B;  4TVR A;  2JNG A;  3G1J A;  1CSK A;  2QG9 B;  4RLZ A;  2XND A;  5GAM j;  2V7X A;  5F4O A;  5HKC A;  4X7E A;  4H9G A;  2MIO A;  5GAO m;  4C8Q C;  4EMK A;  1VQL Q;  4EMK B;  3GNF B;  3WY9 A;  1MUZ A;  1OQK A;  2XID A;  3PA2 A;  2E10 A;  4PJN A;  1KHC A;  1QWF A;  1NEB A;  1WSR A;  1IRE B;  2RNA A;  1Q81 C;  3FRN A;  3D26 A;  3EFO B;  1QGY A;  1SEM A;  4ZTJ A;  4Z4T A;  2FZC B;  3MP8 A;  2GK6 A;  1PG5 B;  4X9C A;  1Q86 U;  2V8I A;  1X6G A;  3G4S B;  4QQD A;  3VS1 A;  4J9F A;  1Q9S A;  1JO8 A;  2AK5 A;  2RB6 A;  4JS5 A;  1WZO A;  2OTJ Q;  3G71 Q;  2E6Z A;  3WBK A;  1JBM A;  4ZGE B;  3ZBT A;  3RKY A;  2FVG A;  4RD6 A;  1BYM A;  3MEU A;  2JM8 A;  3L2Z A;  3BC9 A;  4HT8 A;  2K5I A;  1OUL A;  3SJZ A;  2EQM A;  5TR9 A;  1U5S A;  1VQM A;  2QDL A;  1KIK A;  1UGP B;  3CCU B;  1QH0 A;  1W2B B;  2F2X A;  2MCN A;  5I2S A;  3VS0 A;  2KXD A;  2AHO A;  1TWB A;  4X34 A;  3URG A;  2DVE A;  4M7D B;  3CC2 Q;  3P27 A;  2KT1 A;  3ONU A;  3CMA Q;  4Z89 A;  4DBQ A;  1TLL A;  5IXF A;  1W1F A;  3OKX A;  2CUD A;  3H6Z A;  3JCM X;  1ZSZ C;  3ZFJ A;  1MGQ A;  3CMA A;  1VQ4 T;  1VQ5 T;  4PJO C;  2FYK A;  3I1F A;  1FRQ A;  2E1H A;  3OZU A;  3PVL A;  4BPR A;  5DSZ A;  1VQM Q;  4DA4 A;  1SKQ A;  5HY6 A;  3CPW P;  3MHP A;  4JLI A;  4Y9U A;  1DJ7 B;  2VC8 A;  4KUI A;  1WPC A;  1OU9 A;  3CCR B;  2BM1 A;  1QGA A;  3QJY A;  4G7W A;  4XLA A;  2RM4 A;  1LNX A;  2RI3 A;  4QVD A;  3ZC3 A;  2E12 A;  4RUG A;  2WYR A;  2OJ2 A;  1VQ8 Q;  1VQ6 Q;  2OTJ A;  4PNO A;  3VS4 A;  2KYM A;  4E7Z A;  1FNM A;  2EGA A;  2NUZ A;  1UG1 A;  2CP5 A;  2EJ9 A;  2C0O A;  2EGC A;  4FL6 A;  4C5H A;  2DFU A;  1WOP A;  4QKU A;  2IPO B;  2NV4 A;  2KVO A;  5LMZ A;  3LWH A;  1E79 A;  2ED0 A;  1D09 B;  1C0M A;  4P25 A;  2PNI A;  3A8M B;  3LNN A;  2P84 A;  4M78 G;  5FRO A;  3JQR A;  1HZE A;  2X4W A;  4HA8 A;  3BY1 A;  3L42 A;  4PJO F;  5KYY B;  4FK8 A;  2BKD N;  3A1P A;  4Y9R A;  4YHB A;  2A28 A;  3S3M A;  2FX3 A;  2CUB A;  1IO6 A;  4G5G A;  5LJ3 h;  1W2B S;  2VJI A;  3EG9 B;  2F1L A;  4IIO A;  3JCM e;  1XE1 A;  1Q7Y D;  4E7I A;  4B3F X;  1JB0 E;  3RR6 A;  4TKO B;  4JRK A;  1YHQ A;  5GAN 6;  3I55 T;  4XON A;  1VHE A;  4AF6 A;  1K73 D;  5GAN h;  4FYV B;  1A0N B;  2EGE A;  2K6D A;  5EMN A;  4PAA A;  4R56 A;  2DRK A;  2ZIT A;  1I5O B;  4DQ2 A;  1TXQ A;  5CO7 A;  5FU6 B;  1X01 A;  4UAJ A;  1XB2 A;  2CS7 A;  4U9U A;  5BSY A;  2VGN A;  1WHL A;  3OE7 A;  1NJI R;  4X07 A;  5GAN 7;  3FIF A;  3CTA A;  1D8T A;  3TSW A;  4K11 A;  1XNI A;  3EG0 A;  1V5V A;  3OYM A;  1QVG S;  2CH4 A;  3GSI A;  1W9X A;  1X6O A;  2KEA A;  2DCU A;  3L2W A;  2GNC A;  3NTI A;  1LJO A;  3M0Q A;  2ZPG B;  4X8I A;  4J9D A;  4Z4U A;  1Q82 U;  4RMO A;  3L2U A;  2JN0 A;  2L2P A;  1IHM A;  2KRS A;  2XEX A;  2EQI A;  4X05 A;  1OGI A;  3P8B B;  2DVJ A;  2PIA A;  4M2L A;  1M2V A;  3CCS A;  1IB8 A;  1PKT A;  2L3Q A;  2JTE A;  2LQN A;  3KL9 A;  3UA6 A;  1RAC B;  1JXM A;  3M0T A;  2V7Q A;  5FNZ A;  2QDY B;  4PC7 A;  2ZPB B;  5CAI A;  3ZZ0 A;  3JV3 A;  2E4H A;  1OU8 A;  1Y57 A;  1ZSZ A;  2V4D A;  2FRY A;  4XL9 A;  4Z4W A;  1MMN A;  1WGS A;  2RHX A;  2QA4 B;  1OPK A;  1FX0 A;  1ARK A;  3CME B;  5TRD A;  2BGI A;  5A89 A;  4KUL A;  3E1S A;  1U1T A;  2ZZG A;  4XR6 A;  4M77 G;  1JRI A;  4OPV A;  2D8J A;  1TH7 A;  4C8Q A;  4EMK C;  1ABQ A;  2CRV A;  2BPO A;  4EDU A;  2VYT A;  4XQF A;  1LVK A;  3AVU A;  1V29 B;  4UZF A;  3JCM Q;  3DKM A;  4M77 F;  3M9Q A;  3CC7 A;  4YAW A;  2A37 A;  4M7A E;  2DEQ A;  1M1G A;  4PJM A;  3OYL A;  4X06 A;  4K1X A;  1B3Q A;  1VQP T;  4A54 A;  2VV5 A;  1QX4 A;  5FA6 A;  3CCR Q;  2VZL A;  4M53 A;  3QSU A;  1VLY A;  3CCM T;  3L2V A;  1I4K 1;  1VQ8 T;  2VXF A;  1QVG B;  1Q82 D;  1JQQ A;  2RA2 A;  1NEG A;  3QG1 A;  2CT4 A;  3M0P A;  1N8R C;  3TSZ A;  1NJI U;  1VQK A;  1MNE A;  2CZ6 B;  4IUR A;  2GRE A;  4QVA A;  3VJP A;  3TCJ A;  2BSA A;  2LCC A;  2K57 A;  5DLO A;  3OQ5 A;  1U2R A;  2C77 A;  3I56 A;  4C8Q B;  1K8A R;  4B43 A;  1X2Q A;  3JSC A;  4FIB A;  4OB1 B;  4A4H A;  3RY8 A;  1M4Z A;  2F5T X;  1AWO A;  1E43 A;  1KQS A;  1PKS A;  3OJW A;  2XIC A;  1TS9 A;  1ZBJ A;  2NUT A;  2I0N A;  3HP9 A;  4PKC C;  1VF7 A;  2FRW A;  4F04 B;  3EHQ A;  4C8Q F;  1N08 A;  1XTD A;  1CNE A;  1ZM3 A;  3E19 A;  4PFP A;  4M7D E;  3W2G A;  5THX A;  4LN2 A;  5HKK A;  3BW1 A;  1YCY A;  2QEX A;  2P0P A;  1HJD A;  1MMG A;  1K0S A;  1W0J A;  4HXJ A;  3QFC A;  3HHT B;  1UHF A;  1WHJ A;  2HNI A;  4HKE A;  2GF7 A;  3M0S A;  2KNB B;  4M78 C;  2CC2 A;  1M90 R;  4D8D A;  1QCF A;  5GAM g;  3WVE B;  4B9W A;  3CCL B;  2KQW A;  2LX9 A;  2O88 A;  3EFO A;  5HZB A;  4KH1 B;  3LH5 A;  2HCK A;  5GAO r;  3JCM V;  1Q81 U;  1M8V A;  4TT3 A;  4WCI A;  1VQO Q;  1KQS P;  1QCO A;  1WXB A;  2CP0 A;  2F69 A;  2DER A;  5KE3 A;  4JZ4 A;  5KYX B;  2Z0W A;  1OB0 A;  3QII A;  3PE0 A;  1WOS A;  3OYK A;  2F43 A;  4G1V A;  1K73 U;  2PZ1 A;  4RCY A;  3ASS A;  4G7X A;  4RCZ A;  2KK4 A;  3A98 A;  4NL3 A;  2W6J A;  3CCV T;  1QLY A;  3E9F A;  1Z9Q A;  3AVY A;  3S6W A;  1RLP C;  2RC5 A;  4AG2 C;  3THK A;  5J35 A;  4WWV A;  5L8R E;  1UD8 A;  2IVW A;  3NHN A;  4P12 A;  1TUG B;  2RQR A;  4LE9 A;  1Y71 A;  2G3R A;  3CC2 T;  1Z9Z A;  1N6A A;  1BJK A;  1QFZ A;  5IYQ A;  2XZO A;  1E7O A;  2GPJ A;  2QQ9 A;  5DM7 R;  2C4T A;  1UJ0 A;  2C06 A;  3AVX A;  2ZL7 A;  1KHI A;  2QK0 A;  4OB3 B;  4PK4 A;  2XOK A;  4FYW B;  4AT1 B;  2DL3 A;  4HT9 A;  1OGJ A;  4F17 A;  4C92 B;  2EYX A;  3LVB A;  3CCV Q;  5AN9 A;  3G71 T;  2E6N A;  1M1K D;  4GLM A;  1MAB A;  2OBS A;  3HTR A;  3I55 A;  3AVW A;  1TSF A;  2NYS A;  3QE2 A;  4Y91 A;  4J9B A;  3OEE A;  3JCM c;  3UF4 A;  1PC0 A;  1S0U A;  3CES A;  2BZ8 A;  1EP2 B;  3CCU Q;  4N4I A;  4J5Y A;  2FL7 A;  1KD1 D;  1BI2 A;  1ZA1 B;  4O5V A;  3VKI A;  2SRC A;  1Q81 R;  1QVF B;  4J9C A;  4HE6 A;  4NS5 A;  1Y96 A;  1W6X A;  3OS1 A;  4M7D G;  4Y7C A;  1Y96 B;  4J83 A;  2I1L A;  4J7I A;  1YWO A;  1IGQ A;  3ZEH A;  5M9O A;  3Q38 A;  2LQ8 A;  2KRO A;  3VMF A;  1NBE B;  5DN6 A;  1M2V B;  3CCS B;  1K1Z A;  2LVM A;  1G8X A;  2PLF A;  2XNJ A;  2J6F A;  5GAN g;  2V7W A;  4FW1 A;  2HQE A;  2WSE E;  2X6X A;  2BN4 A;  1UE9 A;  2KT8 A;  3U23 A;  2JW4 A;  4GQN A;  1AMO A;  1T0J A;  3VRY A;  1JEG A;  3M4Y A;  4J9H A;  4KKU A;  1QFY A;  1OHH A;  1K9M U;  2LJ3 A;  1Q86 D;  4XTZ A;  3FJ5 A;  2EYQ A;  1YJN Q;  2V26 A;  4B44 A;  1K8A U;  1TUC A;  2PMD A;  2DL4 A;  1YIJ T;  1JU5 C;  1U3O A;  3TRE A;  2X53 S;  1YI2 B;  2GJP A;  2QTL A;  1GBQ A;  5DY9 A;  3FEO A;  2QA4 A;  1VQO T;  3NPF A;  4TN1 A;  1QP2 A;  2QTX A;  5GMK h;  2QDX A;  1UGV A;  5IH2 A;  3OW2 S;  2CP6 A;  3QZ5 B;  2KAF A;  2QGG A;  4P9S A;  4KGX B;  2DOG A;  2KGT A;  3CPX A;  5JBQ A;  1FNB A;  3PUN A;  1WHM A;  4KKT A;  2V31 A;  2V7T A;  3M58 A;  3HRU A;  5FU7 C;  4XD7 A;  3U6K A;  4CRI A;  4X0C A;  4PFO A;  2LMJ A;  4ORZ A;  3CCQ T;  1VQK Q;  3ZIA A;  4Z4R A;  3V7S A;  4IIM A;  1UEC A;  3QFR A;  1FNC A;  1M30 A;  2HKN A;  4EMH A;  3UWN A;  2DYB A;  1M1K U;  3ZL7 C;  3X20 B;  1V0F A;  4J9G A;  4WTO B;  4RTZ A;  5GMK l;  3OYI A;  4M78 D;  1LPL A;  2K2M A;  1YJ9 T;  1QFJ A;  2JTM A;  2ZBU A;  1SG5 A;  1OB5 A;  3VV0 A;  3G6E T;  2DYI A;  2QMU A;  1NLO C;  2LDM A;  5KE2 A;  3G4S T;  3QPH A;  3CC7 Q;  1BB9 A;  2DXB A;  2VNH A;  1K4U S;  4ZGQ B;  1ZM9 A;  1KK1 A;  2ZPF B;  2DXT A;  4C92 E;  3OFN A;  3CCV A;  1PRM C;  1WFW A;  4JUV A;  3OS5 A;  4DK1 A;  3OYE A;  4B3X A;  2EYY A;  3CCE A;  4MYU A;  2EQK A;  4D6W A;  4II1 A;  2ESW A;  2QAZ A;  3CP8 A;  3QUI A;  3EAE A;  2DM1 A;  3HL8 A;  5KCH A;  2GK7 A;  4G1B A;  1YJ9 B;  1N5Z A;  1Q82 R;  3JCM J;  2PUK B;  3LH0 A;  4M78 B;  1RAD B;  1JXO A;  4PC6 A;  3I56 T;  4TMX A;  3WBJ A;  1B34 B;  3A8G B;  1VHO A;  4YAO A;  5FL7 A;  3N5B B;  5IHK A;  2FO0 A;  2HQH A;  3WXM B;  3V8K A;  2GQF A;  2PQW A;  2RHI A;  1WQW A;  3SEJ A;  1BPL A;  3PVQ A;  1GAQ A;  4HVU A;  5GJW B;  2FB7 A;  2MYS A;  3TU4 K;  1AWX A;  4WQM A;  2RK2 A;  2HMA A;  4PC1 A;  2GGR A;  2YWE A;  1IXD A;  3BCD A;  2DZC A;  2AHJ B;  1FXX A;  1PNJ A;  4KUD K;  2O01 E;  1ELO A;  4PFZ A;  2ZXI A;  3RBB B;  1PSE A;  4R55 A;  2LQW A;  3GVJ A;  2DD4 A;  2DTO A;  1GFC A;  3REB B;  8AT1 B;  1VQN A;  2M9U A;  4M4S A;  1SKY B;  2XU8 A;  1P92 A;  1M1K C;  4M75 E;  1N8R D;  1FYN A;  2EVR A;  3TQ7 P;  2CZ0 B;  1Q7Y U;  3E20 A;  1YHQ B;  2PTK A;  4RTT A;  1D2E A;  2HLD A;  1CKB A;  1HA3 A;  5GMK j;  1UGR B;  4OPS A;  4N3G A;  3O8V A;  3JCM P;  3C4S A;  1KD1 C;  3PIO A;  5C6S A;  2ED1 A;  3LGL A;  2KE9 A;  4XK8 E;  4A53 A;  3M57 A;  2JOY A;  1YHQ Q;  1RAI B;  3A8O B;  4QHY A;  4Z4V A;  4QVC A;  1ZM4 A;  5I2M A;  4XM3 A;  3JB9 G;  4J6X A;  2FG0 A;  1G83 A;  3CCE T;  1PHT A;  3NE5 B;  5I11 A;  3JB9 D;  2YUQ A;  2YWF A;  3DLM A;  3VS6 A;  3OYH A;  1O75 A;  1VQM B;  2W0Z A;  1EFU A;  4M78 A;  1MRZ A;  2BM0 A;  1M5Q 1;  1M90 U;  1AEY A;  1S4M A;  4EH1 A;  1NJI D;  5KNL A;  4FSX A;  1B07 A;  3C95 A;  3BY7 A;  2PVG B;  5CKD A;  2CP7 A;  5IXB A;  2RHZ A;  3SKB A;  2O9S A;  3GBQ A;  2QE7 A;  3EFS A;  1VIE A;  3R6K A;  4OMM A;  4RPD A;  2EPD A;  4JJN K;  1GRI A;  1OZ3 A;  1T0H A;  3I56 Q;  5GAN f;  3GIB A;  3QO3 A;  4LUD A;  5HK3 A;  3S3O A;  1WJR A;  2DAQ A;  1QG0 A;  2ZL6 A;  4M7A F;  3ZZU A;  1I81 A;  1VQ6 A;  2V7U A;  2DIG A;  4PJO E;  1ZLM A;  1G7C A;  1WPY A;  4M77 C;  4OB2 B;  4LXC A;  1VQL T;  2GFA A;  3OAA A;  3M0U A;  5IYW A;  1EZZ B;  2OBT A;  4M77 B;  5LJ3 f;  8ATC B;  5F4J A;  1HK9 A;  1CNF A;  4XQ3 A;  2C5H A;  1SPK A;  2VNI A;  2ZPE B;  4UC4 A;  4XLH A;  4LD6 A;  2VYQ A;  2JT4 A;  2GBQ A;  5GAM f;  1EFT A;  4C5I A;  3OW7 A;  4KBM B;  1BIB A;  2VB6 A;  1TUD A;  3KUF A;  3RMQ A;  3SD4 A;  2X0K A;  2YT6 A;  4AMC A;  2P3M A;  4HE5 A;  2F2W A;  4M7D D;  3OZV A;  3VNU A;  4N3N A;  2QQS A;  5KCO A;  3CC2 A;  3MKD A;  1M3A A;  2DE0 X;  1KJZ A;  3CC7 B;  5KYW B;  2RQT A;  2ZZQ A;  4HCB A;  2L89 A;  3CCR T;  4X9D A;  3CBM A;  1BCO A;  3IQL A;  2L0A A;  2YWH A;  1T3L A;  2GTJ A;  1NZ9 A;  1YWP A;  2GFU A;  5AYF A;  4HCC A;  3CCJ A;  1YHQ T;  2ZXH A;  3FJP A;  1K0X A;  3CXC B;  5LJ5 h;  3SEM A;  1IGU A;  1TVC A;  3LLR A;  3G71 A;  1JJ2 A;  2RD1 A;  3J81 k;  3GLX A;  4MZP A;  1JJ2 B;  3DDY A;  4IUQ A;  2QTZ A;  3HFN A;  2M1H A;  1T6X A;  2AIR B;  3G4S Q;  1KK0 A;  3LO8 A;  4E7K A;  2D8H A;  3QWY A;  2DL8 A;  4E7J A;  3MMP A;  4ME7 A;  2QAS A;  5FO0 A;  2RC6 A;  1BMF A;  2CP3 A;  3QBY A;  3J81 E;  4M75 A;  3OW2 A;  4HCK A;  4OML A;  1NB0 A;  1YJW T;  4RG2 A;  2DIL A;  4NNJ A;  2VKN A;  4MMK A;  1UEB A;  1B7T A;  1WYX A;  1VQL A;  3B8H A;  4J6Y A;  3UT1 A;  3MPU B;  1KQ1 A;  1UD4 A;  2NWM A;  5DS0 A;  4OF1 A;  1N06 A;  5EC7 A; 
#chains in the Genus database with same CATH homology
 3A1P A;  3HTR A;  2F1L A;  2QGG A;  1PM3 A;  3H9N A;  2DOG A;  2DYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...