3H9NA

Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target ir66.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
b'HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation factor rimM
publication title Northeast Structural Genomics Consortium Target IR66
rcsb
source organism Haemophilus influenzae
molecule tags Ribosomal protein
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3h9nA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3h9nA01
1PM3A 3A1PA 2F1LA 3HTRA 3H9NA 2QGGA 2DYIA 2DOGA
chains in the Genus database with same CATH superfamily
3JCMP 1AD5A 4M7DC 1Y57A 2ED0A 4UC4A 4B48A 4JRIA 2JS0A 3CMAQ 4NNJA 1NJID 3FDRA 1QLYA 2QDYB 4DK1A 3NMZC 8ATCB 2B7BA 4OB3B 4PFOA 4B3XA 1N06A 1OYXA 4RDJA 2AKLA 5IN1A 3RMQA 2V7TA 1VQKB 1WZOA 5GJVB 3QXEB 2CW5A 1M90U 4LDVA 3G71T 2A37A 2FVUA 4M75F 3GOXA 3CMAT 3CCRQ 2EPDA 4QKUA 2OTJT 2BKDN 2DXTA 1JRIA 4A4GA 5J3OA 2IVWA 1OX8A 2FL7A 3DB3A 2E41A 2EIFA 2XDPA 3A8LB 4A4FA 1ZSZA 3PE0A 3CMMA 1TG0A 2K7AA 4KKSA 5F4OA 4QVAA 1SHGA 2OAUA 2WPDA 2FRYA 1G7TA 3GPLA 2D6FA 4PJOA 2D9RA 2R5AA 1ZHIA 3OS1A 4AFSC 1QVGA 2ROLA 2GJKA 4N4GA 2E1RA 3CCQA 2RHZA 1VQOA 3I55B 2F5TX 2VBTA 4J9EA 1CSKA 4R56A 1X75C 2KMTA 2A3LA 3FJPA 5DM7R 4OGCA 1VQNB 4JPBW 1YIJB 5HY6A 2DO3A 2PUOB 2G6FX 3A8JA 2WZPP 5KW9A 1ZA2B 4IURA 1DARA 3CBPA 4M4SA 4M7AG 1KC8U 2PE3A 4ZN3A 3OYEA 1VQPA 2QQRA 3SWNB 1Z9QA 3WVDB 2OBSA 1SM4A 3QE2A 1UGSB 1VQ7A 2ZPIB 4Y28E 4E7HA 3CCLQ 2EQKA 4HT8A 4G7XA 4FSSA 2RJCA 1I1JA 3CCQB 3UA6A 1VQOB 2QK0A 1Q7YD 2W6JA 3B82A 2D0QB 2MOXA 2XOKA 1QCFA 1NM7A 2ECZA 3PA1A 3OMCA 1MHNA 4RTTA 1KC8C 4A63B 5LJ5d 5BSYA 3HFOA 5KE3A 2VNJA 2EBPA 2XD0A 1D3BA 2J05A 3SHWA 4C8QE 3CCLT 2M1HA 3ZZUA 1VQ9A 1X2QA 2DJZA 4LD6A 5KH6A 2DMOA 5KYXA 3SJZA 1VQPB 4AC9A 4J9BA 2LZ6B 4XTWA 1S1NA 1YJWT 4KRTA 2DD4A 1E62A 1SKQA 3A3GA 3MPUB 3A1PA 3OB9A 1YITA 4KBMB 4P6YA 1I81A 4RTXA 4B43A 3ZZTA 1ZQ1A 4M2LA 2E5QA 2VJIA 4MZTA 1IHVA 1YI2A 1TTTA 3VS2A 4M75D 2X53S 1XTDA 1OX9A 2VC8A 1QFYA 3O5ZA 2QDXA 2ZTNA 1ZA1B 1VYVA 3QYHB 4XQ3A 5KYYB 4UZUA 3CPFA 4X9CA 3CC7A 1RL2A 2EQIA 3CCEQ 1N0UA 2NUTA 4PLLA 2XZPA 1ZLMA 4QVJA 5HZAA 1ABOA 3RDVA 2O4XB 5CAIA 4ELYC 5KYXB 4M7DB 1BBZA 3ZFJA 2ZZGA 5I21A 1N9RA 2M16A 1E6GA 2KRMA 2CS7A 1J9ZA 1KSWA 1UDLA 5GANj 1S4MA 1I0CA 1M8MA 2P84A 2E4HA 1YITB 2Q6KA 4E7ZA 2PVDB 2W10A 5BSXA 3D7SB 4BACA 3Q3AA 3CCET 4Y9UA 3CPWB 2E3IA 1D1NA 2V7VA 1NJIR 1T6XA 1BI2A 4KULA 5LJ3d 1YI2B 1QX4A 4GY5A 1UHCA 3VS1A 2HKNA 1DDGA 4DOWA 4PC2A 5IK2A 3U6KA 3CC7B 3M4GA 1WJSA 1AT1B 3G1JA 4XLEA 3CCUB 1G5VA 3MMPA 4C8QA 2HDNB 2ZZFA 1RQPA 3TCJA 2O9VA 2PU9B 4IIOA 1U1TA 2CT4A 2K5LA 3VYGA 2GNCA 2D3NA 5A89A 3RKXA 5I2MA 2RQUA 2MPXC 2OK7A 1I18A 3JCMf 4UZFA 5D6YA 1X6BA 3FKSA 3OZWA 4FYXB 3OPOA 4XU2A 2XNJA 5GAMj 3CB4A 1EFCA 1B23P 2R57A 1VIEA 5J3BA 3AVTA 3L2UA 1GFCA 5E6TA 3E9GA 5KYUB 4GLKA 2YUNA 2RI2A 3TVTA 2XDBA 2HDAA 2K3BA 1KJWA 4TKOB 1W4SA 2DK3A 5GMKm 2DZCA 1NYFA 1YN8A 3PVLA 4DQKA 1UGVA 3PVQA 2BZ8A 5FU7B 2EGCA 2CC2A 4C8QB 3E1YE 3FPPA 3KL9A 3HSBA 3JV3A 4E6RA 2LDMA 4M7AF 4J6WA 1FMVA 2E70A 5DLOA 4B3FX 4PJJA 2MAMA 4DK0A 1XQHA 2DTIA 3META 4P22A 2QG9B 5LMZA 3CMET 3I5SA 1BIBA 2BE7D 3LYIA 2V1QA 4X9DA 3PUNA 4DA4A 5FRMA 2KEAA 2DTOA 3ZBDA 1I7PA 1NB0A 4CRIA 4RD3A 1M8VA 2JZ2A 4RM0A 4DQLA 4BE1A 1QG0A 3GVJA 2LT4A 1VQ4Q 4FT2A 1OI1A 2RQRA 1W34A 3GLXA 3ASQA 1M90R 1KK3A 1K28D 3REBB 4RD6A 1M1KD 1WX6A 5C0MA 2EJFA 2EIXA 2WR8A 2YRDA 1D0YA 1R5OA 2P0KA 1B2RA 2EAYA 3OJXA 1S72Q 3OS0A 4JLGA 3C94A 5KCHA 4XTZA 3C95A 1H3ZA 4DEXA 1EFUA 3V8JA 4PK4A 2Q6OA 4F7UE 3ZEHA 1RI9A 2H8HA 1S0UA 2GTJA 5AYFA 1AWXA 3CMAB 1JJ2S 4EPCA 3OYHA 2OTJB 1ABQA 1WHMA 4M78B 1ZBJA 2QAZA 1S72T 1SRMA 2KRNA 4RPDA 1WIEA 2RC5A 3C0CA 4DOVA 1H8HA 4B4DA 3PGGA 2GF7A 4E0FA 2CSIA 2HKQB 5GAN7 2NYSA 2EQUA 4CC7A 1KD1C 2I2LA 2E1HA 2C77A 4P5NA 4XKWA 3EHQA 1V1CA 3GF5A 2FYKA 4PJOG 4C92E 1PD1A 4XM3A 2D1XA 3Q1JA 1VQMT 1OGIA 3CP8A 5EG2A 3VMFA 4XN3A 3OOCA 1KC8R 5CO7A 3EFOA 3BFMA 1NZ9A 1BCMA 1XQBA 3ONUA 2OAWA 3MCAA 1WORA 2BM0A 3DLMA 2A0FB 2OX7A 4JJNK 2DBKA 1QWEA 2E6ZA 5GAMe 2BGIA 3SLDA 2RNAA 1UD2A 3ZPNA 2EYQA 3H8ZA 1XB2A 2X8KA 1FYNA 2XMFA 3QUIA 4BY6B 1E3XA 5J26A 2DYIA 3PIOA 2PNIA 5LJ5f 3GVKA 2DL4A 2XHCA 3GIRA 3ASRA 4PC6A 4IUVA 3M57A 1Q95G 2CNDA 4M7AD 3EH2A 4EDUA 1I8FA 5A0DA 1YJWA 5HK0A 1T6YA 3FJ5A 2QN6A 2V7XA 2ZXIA 1I5LA 4ESRA 3Q38A 2MWPA 1W87A 3QFCA 3EFOB 1ZBXA 3H9NA 3QO3A 4JLIA 3BW1A 1GR1A 4Y7CA 1KD1D 4G1BA 9ATCB 1BCOA 5GMKl 5GAMg 1VHEA 1B34B 1DDIA 3SLNA 3QSYA 1YWPA 2E6NA 1H641 3E1SA 3OYYA 4HT9A 4F7UA 3N5BB 1IHWA 1KRHA 1WQWA 2X4JA 2F5KA 5GAOn 2DYBA 4AFZC 3R6NA 3NPFA 4LDYA 1RABB 2EYYA 1EP3B 3AVVA 3CC2Q 2YDLA 4D6WA 3OYCA 4XN0A 2RJFA 1YHQA 1Q82D 2RK2A 2B8AA 1C1AA 2X35A 2CBXA 3BY7A 4JS4A 2QTZA 1WHJA 1E1QA 5FO1A 1M2VA 1YJWB 4OGEA 3GBQA 2YWFA 4PC1A 2QEXQ 4UZEA 3EG0A 3BNWA 4RTUA 3RERA 4GBQA 4Z88A 1OB5A 5A88A 1VQ6T 4C92A 5F4MA 2QA4A 1NBMA 3CC2T 1AEYA 4HCCA 4P26A 1QFZA 4XTUA 4P9SA 1PM3A 4F7UB 2X85A 4LN2A 1JA1A 2AZVA 3EG9A 3A8OB 2QEXT 1K8AU 3HAGA 4IUQA 3CESA 2FRWA 5KYWA 4X05A 1BIAA 5LJ3f 4Q7JB 1RI0A 4PC3A 3AVXA 5GAN5 3AVWA 1KQ2A 5GAOr 1YHQB 1RAEB 5GANd 3PFSA 2Q6LA 3JCMe 4P3YA 3ZIAA 4BI8B 2CZ6B 1M2VB 1MNEA 2YRCA 3L2VA 1RUWA 1ZM2A 4O6JA 2KVOA 3V7RA 5CKEA 2ZBVA 2GPJA 4C0ZA 3I1FA 1K8AC 3CCEB 3CCJQ 4QT7A 3L2ZA 3A8KA 4OMQA 3TQ7P 4DBFA 2YWGA 2DILA 2CKKA 2DERA 5H59A 2CP5A 4YAFA 3TSZA 4CC3A 3CD6A 4RTYA 4KGXB 5KYWB 3CXCB 4J8OA 3JCMg 1BJKA 3CCVA 3JCMW 3CCJT 3MEVA 2DIEA 5I2SA 1F60A 3AGQA 2X4YA 1EIFA 2GFUA 1IXDA 2PVOB 4Y91A 1MV3A 1HK9A 2LCSA 3CC4A 3OKXA 3WNCA 2GQFA 3CMEA 4ACBA 4PJOF 2D3LA 3HP9A 2EVRA 2FZKB 4C0DC 3LH0A 4ZGJB 5H5JA 5HXBA 4ZGEB 1QVPA 3FIFA 2ZZQA 1OB0A 4E7KA 3CW2A 5DLQE 6AT1B 4XTVA 3ZBUA 2NLUA 4WZEA 1W2BP 1CNFA 1K8AD 4M77A 1IJFA 4B6MA 2ZL5A 3V7AA 3UPUA 4MMLA 2QASA 4OF1A 2YT6A 5D7UA 3LW5E 2F43A 3OZVA 2CP2A 1WHHA 5J35A 4OP7A 4PJNA 4BE2A 4PC7A 7AT1B 2EYWA 2L3SA 5HCKA 3CMEB 1I5OB 2DOGA 1YJNQ 1FWZA 4P1VA 2RI5A 3M0PA 4CC2A 2L0AA 1M3AA 1HD3A 3OJWA 1IREB 4NS5A 2GBQA 1QVGS 1UD3A 1BPLA 2YSQA 1BYMA 5AN9A 3ULRB 3JCMX 4M77B 3LGLA 3P26A 4J5YA 5A0LA 1BU1A 2K6DA 2EFGA 3JCMJ 2DF6A 3J81E 2NUZA 2C0OA 2P0QA 2A7YA 4FM4B 3PIPA 1T5EA 3SKBA 3LO8A 2VYQA 4C5GA 3KFVA 3WBJA 4XLFA 4FT4A 2VBUA 2LP5A 1H3HA 4M1KA 2RQTA 4ROXA 1LCKA 1WU8A 2RB6A 3G4ST 3HRTA 2V8KA 1VQKA 1K9AA 2I0NA 5FL7A 1S72B 1E43A 3NFCA 4ZGDB 2K4YA 3W2GA 3PMTA 1BB9A 4HE5A 3VYHB 1N07A 3PA2A 4X8IA 3EFRA 2Y4YA 1FX0A 4AFQC 3MP6A 3BCFA 2F2XA 1PKVA 4XU3A 4MYTA 2MCNA 2XICA 1VQMB 4RD2A 3CPXA 1Y7XA 5DY9A 1T0JA 4FL6A 1EFTA 4PJOD 5CKFA 4J83A 1UJ0A 5IAYA 1Q7YU 3B78A 1NPRA 1Y71A 3I55A 3JQQA 1KQSB 5FU6C 2LQWA 2AIRB 1VQ5Q 5GAMh 2NV4A 1AWWA 1GVHA 4J9GA 4J0QA 1KHCA 1MNDA 1SRLA 4Z4VA 1VQNA 4DEYA 3P27A 4EMGA 1YIJA 4II3A 1K73U 2DEUA 2LNVA 4M7DE 3ME9A 1MABA 4M0LA 4NOYA 4C8QF 4XTYA 2JTEA 3JQRA 3W5HA 1Q7YC 1VQ5T 2V1RA 2YHTA 1K76A 3SWNA 1YJ9Q 1QCOA 2Q6IA 3CCRT 1HXDA 2OTLQ 2J6OA 1OHHA 2D9TA 4K11A 1VQ6A 2L8DA 2QTVA 3OS5A 1K73C 1PSFA 3V7SA 2HMAA 2LMJA 1YX2A 3S3NA 4FK8A 2XIDA 1AOJA 2G3RA 4CC4B 4QQ6A 3CXCP 4TT3A 4F7UG 3BQJA 3LGFA 4WQMA 4WZTA 2RN8A 4QVZA 4N3NA 1OPLA 1JJ2P 1M5Q1 1YCYA 2OTLT 4C5EA 3GP8A 1FRQA 2YUQA 3CBMA 5HK3A 3A35A 1NE8A 3NTHA 3PUMA 1D1CA 5C6SA 1SHFA 1RLQC 1K8AR 3HPWA 2IIMA 3M0UA 4XLHA 3BDLA 4EMKA 4TMVA 1TUCA 2V26A 4ZCMA 4M75C 1VQ6B 4RD1A 4CQJA 4C92G 3RKYA 1DJ7B 3M54A 3QWYA 2KRSA 5GANf 4ZTFA 3L2QA 5B6IA 1RACB 3LWIA 5TR9A 4KKTA 5LJ3g 3WYAA 1X2KA 3CC2B 2BUDA 4ME7A 3VS3A 3MP8A 2RJDA 4TMTA 1GRIA 5D6WA 4P25A 1QGZA 2VUBA 2Y4XA 1MMAA 1PJ6A 4ZCLA 2QE7A 2QEXB 2FG0A 4M78F 1H8KA 5KYYA 1K73D 4JRPA 3T56B 2RHUA 5CKBA 3JCMh 1KK2A 3J7AF 3UA7A 3WVEB 2CP3A 2O4XA 1I8DA 5GAOl 4M7DA 3S6WA 5TV2A 2LNHB 3LH5A 3OE7A 4EMKB 5FO0A 4J9IA 3OYMA 3VUBA 4RMOA 2BZXA 3RY8A 3EGDA 3HHTB 4R0KA 2DL7A 2KDSA 4N4HA 1VQLA 3AVYA 2ESWA 2J7IA 3JB9J 3HFNA 3CPWA 1IZ6A 1E63A 2H3EB 4LE9A 1UD6A 2COZA 2XGJA 3AVUA 1JO8A 4RUGA 5GMKe 1PC0A 1A0NB 1UTIA 4FW2A 2D74A 2HEQA 2EKHA 4A54A 2V31A 1MMGA 2WSFE 4X0CA 5IYNA 4DQ2A 3V7CA 1H42A 4E7LA 3G05A 3KEWA 4HVVA 2MMPA 3CCUA 2P3MA 2QMUA 3CCJB 1TU0B 4ZTJA 4BD3A 4KGVB 4C8QD 1UFFA 4PJMA 2CRVA 3WQZA 1WXTA 4ELZC 3G6EQ 4Z8AA 3EGDB 3CQTA 1N0VC 4Z1MA 1YLOA 1VQLB 4RCBA 2LTOA 2DNUA 2OBRA 1UMKA 3JU4A 4DBHA 4XORA 4OOSA 2E5KA 5KYUA 2CUBA 4M78E 2DXCA 3PENA 1G2BA 2JS2A 4V2SA 4AT1B 3ER0A 2HL3A 2JM8A 5LL6S 3OEEA 3G6ET 1MV0B 2JTMA 1X27A 2KSSA 2BF4A 2HLDA 4XOTA 4LNPA 4YELA 3M5AA 1M1KU 2VV5A 4A4HA 3X20B 1TLLA 5IH2A 3BE3A 2DPPB 4YAOA 4OOXA 4NCNA 1FX7A 1EZZB 3FJOA 2DXUA 3M59A 3QKJA 4OPSA 3OW2P 1B07A 1D0ZA 1TXQA 2EGAA 1KQSP 3INZA 3H0HA 1VQ8Q 4LBYA 1AWJA 2HAXA 2A08A 3CBOA 3CCSQ 3M0QA 4PGOA 4PABA 1EFNA 4RPBA 1IGUA 1XOVA 1M1KC 4C5HA 1WP6A 3E19A 4KUDK 1B7TA 4F7UF 2O31A 2PQWA 1VQ8T 1W9XA 1QCNA 2BN4A 3CRZA 1NLPC 1KQ1A 4JJDA 3I56Q 1V29B 4OB1B 1ZUKA 2M0YA 2HZYA 1TS9A 4IW3B 5GAN3 4RTZA 2I1LA 3L1AA 2FO0A 4L6V5 4N0AC 4UAJA 1MUZA 2DY1A 1OPKA 2QTXA 3REAB 3CC4Q 2X0KA 2RO0A 3RMSA 2SEMA 1YFNA 2C4TA 2E65A 2KXCA 5CKHA 4C92F 1MMDA 3G4SB 2YUPA 3I56T 3U23A 3G71A 1T3LA 3TSWA 3THKA 2LCCA 4Z4WA 2KBTA 1WI7A 5KCOA 3CMAA 2ZPGB 2DVJA 3QBYA 2OTJA 3RESA 4M78A 1Q7YR 4FYYB 1IGQA 2R9VA 1ZUUA 4JZ4A 3NHNA 2EYXA 1R0CB 1W2BA 1WSRA 1JEGA 1FXXA 3QZ5B 2CP6A 3P8HA 4F04B 1H8EA 3ZUGA 2K5FA 2DTHA 1K73R 1C6VX 1UGRB 4KH1B 1VQ4T 4WWVA 2QQ9A 3CCMQ 1WHLA 3M53A 1KD1U 3C12A 4LBZA 2BIVA 3G71B 4J6XA 1D8TA 4RDKA 4EMHA 1QVFP 3SJPA 1RAGB 1QVGP 1Y07A 4BE0A 4M7AC 3R6OA 1RAAB 4LDXA 2F2VA 5FW9A 5IXFA 4B3GA 2DL5A 2HL5C 3OQ5A 3CCMT 1HVXA 1GCQC 1OOTA 1FDRA 1ZM4A 2DL3A 2JDIA 2YWWA 5L46A 4C43A 1AVZC 5FLXE 1Q82U 1W2BB 4XL9A 2LX9A 5FNZA 4Q5WA 4GQNA 1E64A 1VQ5B 4X07A 3BY2A 2QYZA 3AT1B 1NG2A 3CCRB 3S3MA 3MHXA 4YAWA 3X28B 2MI6A 3QHSA 3OZUA 1VA7A 2OK8A 1WYXA 4C0FA 1BMFA 2NWMA 3GNFB 5EC7A 3RR6A 1B34A 1Q82C 5L23A 4OB0B 3OS2A 3OMGA 2E1BA 2OTLB 3LQEA 4HXJA 3CCLA 3S3OA 5IYWA 2DL8A 2KAFA 4M77F 4Z4UA 3LVBA 2MYSA 1PD0A 3OBWA 4VUBA 4HVUA 3M0TA 2ZL7A 2BTTA 1AIPA 1UE9A 2ZITA 4HCZA 3OY9A 5KNLA 1H92A 1G83A 4L5GA 4AG2C 3GVLA 2JNGA 2RK1A 1WJQA 1X43A 3EGUA 4J9CA 5THXA 1PRMC 2RM4A 4FYVB 1EWYA 1U2RA 3LNNA 4C92D 1WGSA 4E7SA 3FC3A 1SKYB 1W0JA 3ZC3A 4P2NA 1R5NA 3QDRB 4XU0A 1W0KA 1EP2B 2CREA 2GGRA 4R55A 1PCXA 1ZM9A 1WOPA 2ZBUA 3CCLB 5F4JA 4LUDA 1VQNQ 1IJEA 3A3BA 2LJ1A 1GJRA 1SSFA 1E1RA 4MDWA 4M7DG 3ONYA 4RCCA 1N08A 2X3XD 2DEQA 1U3OA 4G7WA 1X6GA 1R8OB 2J06A 4OPVA 4JRKA 3M9QA 1JXOA 3E2UA 1FNCA 3H0IA 4D8KA 2RD1A 5L8RE 5CCAA 1VF7A 3CCEA 1A8PA 4L59A 3OYGA 4RCZA 3W2HA 1QW1A 1OEBA 4QFMA 2Z0WA 3CCQQ 1PJ5A 1VQOQ 2P0PA 2QGGA 4E7IA 2BMWA 4IUPA 3VNVA 2HNIA 3P8BB 4M77E 1Q9SA 2DX1A 4XOPA 2XI9A 5CQXA 4K1XA 1VUBA 3EG1A 2ROTA 3QZ9B 3AGPA 4HIZA 3CXCA 1N8RD 2EWNA 2F2WA 3U6BA 3I35A 4C0GA 4RTWA 3J80E 2GJRA 4WZKA 4X06A 1K9MU 3OW7A 1VQPQ 1WJRA 2WJVA 5GAN6 1M1KR 1VQ7Q 4QUZA 5DN6A 2CH4W 1WOSA 1QUEA 3HRSA 1MMNA 2FEIA 2VASA 5FRNA 3UWNA 3AHUA 2HBWA 3G6EB 3H0FA 1GCPA 1VQPT 2L3QA 1K9MC 1YCSB 2CP7A 2DAQA 1VQ7T 4ATOA 3VRYA 4C8QG 2ZPFB 2DD5A 1G7SA 5GV8A 1JJ2B 1PSEA 1VQ9Q 4OMPA 3W2FA 2KXDA 4EIKA 3ISXA 3OP1A 2CGHA 2ENMA 4Z4ZA 1PG5B 1UGQB 4JUVA 1WHKA 5GAMd 2AKKA 2JJ1A 4GLMA 5GMKi 1KZLA 2LQ8A 3HL8A 1VYTA 1LJOA 2CP0A 3VJPA 2X6YA 1YITQ 2O2OA 4TVRA 3BDUA 1OB2A 4FSXA 2RF0A 3GNGA 1N9SA 1VQ9T 1SEMA 3UATA 4ZCIA 5HKCA 3VO2A 5GAN8 2JMCA 4OMMA 2MIOA 4N3GA 1BKBA 2M9UA 1YI2Q 4Y92A 3X24B 2PIAA 5I22A 1NYGA 1M27C 3SD4A 2RHIA 1KTVA 2XKOC 3CC7Q 2JJ9A 2V8IA 1ACMB 3JSCA 1YITT 1VJSA 4IKFA 1VIFA 4DBQA 4FWTA 1WOOA 4XNFA 2DETA 1OZ2A 4JDSA 2WSSA 3I9QA 1K9MD 3SFMA 1VQ4A 4P6VF 4Y9RA 1QH0A 2Y90A 1JB9A 2C5BA 1N05A 2AK5A 2K3XA 5LJ3j 3OYKA 3U2QA 1UECA 3I56B 4BI3A 1Q86U 2GREA 3CC7T 3VU3C 3G7ZA 3NTIA 2JN9A 1D1BA 4XMYA 4FU6A 2ZCFB 2VYTA 4ASUA 4AMCA 2GK6A 2DZ9A 1OV3A 3VNUA 1ZSZC 4QW2A 4M78G 1S72A 1KD1R 4ACAA 3SWNC 2P4TA 1FNBA 1TUDA 4PJOC 1YJNT 2C06A 2JMAA 1Q86C 4J7IA 2X4XA 2V7QA 5IT9E 4RD0A 3EAEA 4M7DF 2F4NA 1M1FA 3KUFA 4U9UA 4YTLA 1VQ4B 2DM1A 1UUEA 1WXBA 1U06A 1GXIE 2VNHA 1VQMA 5GAOm 2KE9A 1Q82R 2ATCB 3L2RA 2VNKA 3OW2A 4XAXB 2GQIA 1RQRA 2QQSA 1KQSA 2RHXA 1U1SA 1QUFA 4OMFB 3JCMd 2CF4A 5LJ5e 4Z4YA 1N6AA 1BK2A 3JCMc 1AWOA 2FVGA 1QQJA 3CCMB 5M9OA 1ZSGA 2BSAA 2ZXHA 4MZMA 2F1MA 1OU8A 2HQEA 2JIZA 3VV0A 3OYIA 4YALA 2PTKA 2VVKA 3JAME 8AT1B 2MK5A 3CEYA 4XLAA 3BC9A 3OA6A 2X6XA 4XR6A 1LNXA 2ZZDA 1RAIB 3E9FA 4RTVA 2X9HA 1JNYA 1P4MA 3GQBA 2ZAEA 4X7DA 2HCJB 5GMKj 2NUPA 1JU5C 1Q86D 1N27A 4PLIA 3VO1A 2FPDA 3OSVA 2XG8D 3RUXA 3OW2B 5LJ5g 1BI0A 2J6KA 2CZ0B 1W70A 2CT3A 1GBRA 3M56A 3CPWS 1V76A 3OSSC 3L42A 4FYWB 4PAAA 2OTJQ 4AG1C 2EGEA 4YAUA 1NEGA 2Z6BD 2KY9A 1U8RA 2JM9A 1U5SA 1TH7A 1M2OA 2DJQA 3RIRA 2LVMA 2A28A 2GCXA 1TWBA 4X1VA 4BI4A 1E7OA 2X6WA 1W1FA 1VYUA 4ZNXA 3VS0A 2O88A 2QTLA 1WDXA 4N4IA 2CUDA 2ZTGA 4R71A 3W5VA 4C0DB 1G8XA 5KE2A 2NUPB 1IHMA 1JA0A 4WF2A 3CC2A 3LX7A 3P8DA 3FLGA 1NLOC 2PVGB 1N5ZA 3QIIA 3ASSA 1TOVA 1RAFB 2HQHA 5LJ3e 3NTKA 3QDFA 3MEAA 2RPNA 4M4ZA 1YJ9T 1M90C 2QEXA 2HD0A 1Y0MA 3SEJA 2DA9A 1AZEA 1QVFA 3GSIA 2EKOA 4EH1A 1UEBA 1SKUB 2VB6A 4PFPA 2EYZA 2BGJA 4G1VA 4M7DD 4LDWA 4O5VA 2HBPA 2JTFA 2LT1A 2L3PA 1Y0YA 1E3ZA 2LC4A 1DG1G 4RG2A 2VZLA 3VRZA 2E64A 2LRQA 3PTAA 5GAN2 3DLLA 1D0XA 4XTXA 4XONA 3QG1A 1PNJA 1K9MR 1UD8A 3VUZA 4F17A 3LLRA 3EFSA 1RLPC 5FU7C 4C8QC 2K3YA 1ZSZB 4WTOB 3UDCA 4ZGNB 2R58A 4BB7A 4OVAA 2RC6A 5J39A 3DDYA 2DE0X 4OB2B 4PJOB 1QVFB 2C0IA 5IYPA 1QVGB 2W6IA 3CCJA 4D8DA 1TVCA 2BE9B 1GBQA 4Z4SA 5ECAA 1BI3A 4XLCA 4J9DA 5A8AA 4OOVA 4M75E 3KBGA 1COWA 4RLZA 1M90D 4HCKA 3MHPA 2FZGB 2LZJA 2DCUA 1D1AA 2F1LA 1G7CA 3QJYA 1WFWA 1YJWQ 1JXMA 1XJWB 5GAOq 3LQ6A 3OEHA 3WNDA 3HKSA 2DRKA 2K79A 2JW4A 1B3QA 3JCMQ 3FEOA 4OMOA 4AF7A 5CQYA 5GAMf 4RG8A 3J81k 1UB4A 1BX0A 2PZ1A 3MP1A 4KUIA 2C5HA 5DS0A 4E47A 5AT1B 1K0SA 1HZEA 1VQ7B 2M0OA 1V0EA 3SB2A 5IHIA 3VS6A 5A0GA 4BDZA 1WHGA 1CQXA 3QFSA 2JXBA 3FB9A 2YWHA 1YHQQ 2BPOA 2KYBA 1YP5A 2OJ2A 2YXYA 3KXTA 1UHFA 4TN1A 4X7EA 2PUKB 1BLIA 1W2BS 1ZUNB 3UT1A 5GV7A 2LJ0A 2MWOA 2ZPHB 1GL5A 2X3UA 2FZCB 5D6XA 1D3BB 3MEUA 2WACA 4J6YA 4F7DA 4M78C 4HVWA 1FMKA 5FU6B 2QA4Q 4BPRA 2EQMA 1VQ9B 2GJPA 4IUTA 2CK3A 1YHQT 4PFZA 1KC8D 1I4K1 2B5OA 4M77G 1Q86R 5FA6A 3SEMA 3BY1A 2H3JA 3L2WA 1KK1A 4AVZA 1YJNA 4CI0C 1KK0A 4JMQA 4ZN1A 2QA4T 4JJCA 3JCMV 1WLPB 4FXUA 4M75A 2ZPEB 1HA3A 1QKXA 2COYA 3PNWC 3H94A 1CKBA 2QQAA 3A8MB 4X34A 3ZL7C 3QJ6A 1R77A 2LX7A 3G4SA 1X01A 1G3YA 2NUTB 4BY6C 4RCYA 1VLOA 4KH0B 1UG1A 2EFIA 1Q81U 3H6ZA 1KHIA 3QPHA 3A98A 3Q39A 2YLBA 2QDLA 1UGPB 4A53A 3JB9G 4RDLA 4M78D 4ORZA 3T51B 2CZ1B 3CD6Q 2YUOA 1YJNB 3CCST 1LOJA 1CKAA 3MJXA 1WQ7A 2KR3A 4H9GA 3CCVQ 1O9SA 3MEWA 5TY0A 1LPLA 3BH4A 4B44A 4OPOA 4J9HA 2KK4A 3TEEA 4M75B 1I07A 1Q81C 3VKIA 4MZPA 1G3TA 3EG3A 3HTRA 5IXBA 2YRVA 4G6IA 2JJ2A 3CMEQ 2VBVA 3T9NA 2FPFA 3CD6T 2VGNA 4B47A 2D8JA 1UJYA 3VS4A 2RMOA 1YNZA 5LJ5h 3CCVT 1Y96A 4ZV4A 4RJLA 4Z4RA 4FCYA 1ZM3A 3QFRA 3JQPA 4YEJA 4A4EA 5CDFA 4F14A 3CC4T 3SDZA 4BDYA 4HA8A 3NE5B 2E3HA 3RKWA 4A4KA 1J3TA 2K5IA 2XNCA 4MMKA 3ASTA 2OYNA 4KGZB 1VQ5A 2XK0A 4JJBA 3WY9A 2XZOA 1G3WA 1RADB 2O9SA 2ZGWA 3CCRA 3CP2A 3OYLA 2C2WA 2EQJA 2JOYA 4RKUE 5GJWB 3M55A 1K4US 1R5BA 4FIBA 2DIQA 4MDXA 2B7CA 1M1GA 1PKSA 2ED1A 2W0ZA 3OYDA 2KYMA 2AZSA 4YXWA 2RQWA 1CNEA 1Y96B 2VXEA 4PJLA 4LD9K 1FNDA 2RJEA 1ELOA 3OAAA 1QKWA 4XU1A 3OFNA 5HKKA 3A8HB 1Q81D 1K1ZA 1YJ9A 3QSUA 3ZBTA 1IRXA 2AHOA 4J9FA 3JCMb 2OTLA 4NBSA 1SF9A 1R0BG 4QVCA 5EMNA 1F1BB 1NRKA 2BVNA 1RAHB 2GFAA 1AHJB 2KI7A 2KVQG 4C92C 1V5VA 4DNTB 1EX4A 3MO8A 1D09B 1WSVA 5GANe 4F16A 3CXCS 1F20A 1T3SA 1EXMA 3C4SA 3M0SA 4DBRA 1QP3A 1E79A 3T53B 3X25B 1W6XA 5CK9A 2BV3A 4P12A 1VQMQ 2E12A 5FWCA 2YLCA 4HE6A 1KG1A 2DKGA 4J7FA 1X69A 4XK8E 5LJ3h 4M7AE 1KFZA 1KJZA 1XFOA 2PLFA 4TMWA 1NEBA 2KROA 4LBVA 4OP0A 3TREA 1VQKQ 5CIUA 3R6JA 1YJ9B 4B9WA 2V4DA 3HRUA 4QV2A 1UD5A 4YHBA 2QQBA 1K0XA 2VGMA 2CH4A 2DRMA 2QXFA 3V8LA 5GANg 1N8RU 2E10A 2KNBB 2LJ3A 4C0SA 5GAOp 1SG5A 3GIBA 2WJYA 5DSZA 4WZLA 3ASPA 1WDTA 1M4ZA 3EH1A 1VQKT 2WSEE 4N0AA 4B9XA 4XQFA 5KYNA 2M02A 2FX3A 2X4WA 2LCLA 3ZZ0A 2SRCA 2K2VA 4XD7A 2XZLA 2D8HA 1OQKA 1OULA 2L3RA 4TMXA 1N8RC 2C4UA 1TUIA 1TSFA 2B86A 1WNLA 3B8HA 1HJDA 3I55Q 2X51A 5FROA 1OGJA 2QI2A 3A8IA 4TSFA 2K2MA 3CPWP 1QGAA 1XNIA 1SPKA 1HSQA 4PKCC 1UD4A 4FW1A 2L2PA 2VJJA 2COWA 2HQXA 1YIJQ 3JB9F 2AHJB 2O01E 2BZYA 4LUEA 2CZ7B 2ZL6A 1VOMA 2EJGA 1XE1A 4LDUA 4L8JA 2GK7A 2K9GA 1ARKA 1QMCA 3EG2A 3I55T 3MCAB 5I11A 1H85A 1GAQA 3EHRA 1O75A 5HZBA 2ZPBB 1VQNT 4G5GA 2VBSA 1YIJT 1VQ6Q 2RQVA 4M77C 1D2EA 1NB9A 3W2EA 3X26B 4LBWA 4E7JA 4M53A 5GMKh 4QHYA 5FIUA 5IYQA 3OYFA 2PMDA 3JB9I 5JBQA 2LQNA 2FB7A 4M7AA 1VHOA 3DKMA 1FRNA 3G6EA 1GCQA 1EP1B 2DVEA 2EW3A 1WPYA 3QWXX 1EFRA 1PWTA 1SSHA 2RHYA 1M30A 5CVIA 1JJ2A 1BI1A 3F70A 2KGTA 3CCQT 1X6OA 1VQOT 5A2QE 2MF2A 2M5SA 1JBMA 4JS5A 2K57A 1W35A 3W2IA 3H41A 4PL6A 4QQDA 4BUGA 2XDDA 4PNOA 3WBKA 4Z4TA 2JVVA 2HSPA 3M58A 2JT4A 5IHKA 5LJ5j 2XEXA 3OBYA 4Z02A 1PHTA 2A36A 1MGQA 1HYOA 4RD4A 3ASKA 2ZZEA 3VS5A 4ANJA 4M7AB 1FMWA 2XNDA 1QFJA 1WTHD 3OW2S 1VQ8A 1KQSS 3D26A 2J6FA 1NDHA 1WPCA 2P4RA 2DXBA 4M77D 3CCSA 3M4YA 2R5MA 2HSEB 2C78A 4C92B 3Q6RA 4C5IA 4LXCA 1OU9A 3A5ZB 2QA4B 1Q81R 2M51A 2CSQA 3CTAA 2HCKA 1QGYA 1QP2A 1VLYA 2DBMA 4M75G 4IUUA 2KT1A 2RH2A 1FNMA 2GQVA 1GFDA 5FWBA 2CYZB 2VXFA 3EG9B 4ZGQB 1M3BA 4JZ3A 4NL2A 1KK7A 3O8VA 3I56A 1VQLQ 1T6ZA 2BM1A 3R6KA 2RI3A 2NPFA 1M9SA 1OZ3A 4II2A 2LQKA 3OYJA 1G7RA 3VS7A 3E20A 1VQ8B 3WXMA 4AF6A 4X7FA 2JUFA 3CCSB 2V7WA 1TUGB 2R6HA 4HKEA 3JB9D 1VQLT 1E6HA 3FPKA 2OBTA 3CCUQ 4OMNA 4AFUC 1KMHA 5GAN4 4DNRB 1GO2A 1BQEA 4OMLA 2IG0A 2CDTA 4II1A 1YI2T 4JRQA 2VWFA 3CD6B 1AMOA 1PKTA 1YWOA 2DIGA 3QFTA 3JRZA 3PT9A 4P3IA 2L89A 3QYGB 5KSWB 5IHNA 3CCVB 3CCUT 2F69A 5TRDA 4NL3A 1QWFA 4HCBA 3LWHA 2X3WD 3FRNA 1GAWA 1G3SA 2JN0A 3NGPA 3WXMB 4QVDA 3OYAA 2IPOB 1NJIU 3CC4B 2AT1B 1Y0RA 1JQQA 3CCMA 3URGA 3JB9H 1MRZA 1PJ7A 2V7UA 2WSCE 4E2FB 2V8JA 4KKUA 3WNBA 2J7KA 2C0TA 3BCDA 1QVFS 2ABLA 1JB0E 4IIMA 1YBYA 1Z9ZA 3IQLA 2EJ9A 2KQWA 3A8GB 1C0MA 3EGXA 2QGFB 3W5UA 3Q6QA 2FHDA 4QQGA 4WCIA 1NJIC 2OI3A 2D0NA 3RBBB 4KT0E 2VNIA 2WYRA 1IB8A 3V76A 2KT8A 1V0FA 3G4SQ 3I5RA 4Z89A 4MYUA 5CR2A 1T0HA 2XU8A 1NBEB 4PJOE 4X7CA 4LC0A 1AZGB 1ZUYA 2YWEA 3MKDA 5CKDA 4EMKC 1IB0A 1WA7A 3VR6A 5GANh 2DLPA 2DFUA 2GTOA 4FN5A 2L5QA 1LVKA 3PVDA 1WXUA 1ZX6A 2RA2A 1IO6A 4XKVA 1PRLC 3EGXB 2WZNA 3PMIA 3M0RA 1N8RR 1NPPA 1BX1A 3RNJA 1P92A 1M3CA 3TU4K 3V8KA 2FPEA 4TMZA 3UF4A 3DB4A 5IYRA 3OYBA 1TTHB 3ES9A 3OYNA 2VKNA 3G71Q 1KIKA
chains in the Genus database with same CATH topology
1PM3A 3A1PA 2F1LA 3HTRA 3H9NA 2QGGA 2DYIA 2DOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM3 A;  3A1P A;  2F1L A;  3HTR A;  3H9N A;  2QGG A;  2DYI A;  2DOG A; 
#chains in the Genus database with same CATH topology
 3JCM P;  1AD5 A;  4M7D C;  1Y57 A;  2ED0 A;  4UC4 A;  4B48 A;  4JRI A;  2JS0 A;  3CMA Q;  4NNJ A;  1NJI D;  3FDR A;  1QLY A;  2QDY B;  4DK1 A;  3NMZ C;  8ATC B;  2B7B A;  4OB3 B;  4PFO A;  4B3X A;  1N06 A;  1OYX A;  4RDJ A;  2AKL A;  5IN1 A;  3RMQ A;  2V7T A;  1VQK B;  1WZO A;  5GJV B;  3QXE B;  2CW5 A;  1M90 U;  4LDV A;  3G71 T;  2A37 A;  2FVU A;  4M75 F;  3GOX A;  3CMA T;  3CCR Q;  2EPD A;  4QKU A;  2OTJ T;  2BKD N;  2DXT A;  1JRI A;  4A4G A;  5J3O A;  2IVW A;  1OX8 A;  2FL7 A;  3DB3 A;  2E41 A;  2EIF A;  2XDP A;  3A8L B;  4A4F A;  1ZSZ A;  3PE0 A;  3CMM A;  1TG0 A;  2K7A A;  4KKS A;  5F4O A;  4QVA A;  1SHG A;  2OAU A;  2WPD A;  2FRY A;  1G7T A;  3GPL A;  2D6F A;  4PJO A;  2D9R A;  2R5A A;  1ZHI A;  3OS1 A;  4AFS C;  1QVG A;  2ROL A;  2GJK A;  4N4G A;  2E1R A;  3CCQ A;  2RHZ A;  1VQO A;  3I55 B;  2F5T X;  2VBT A;  4J9E A;  1CSK A;  4R56 A;  1X75 C;  2KMT A;  2A3L A;  3FJP A;  5DM7 R;  4OGC A;  1VQN B;  4JPB W;  1YIJ B;  5HY6 A;  2DO3 A;  2PUO B;  2G6F X;  3A8J A;  2WZP P;  5KW9 A;  1ZA2 B;  4IUR A;  1DAR A;  3CBP A;  4M4S A;  4M7A G;  1KC8 U;  2PE3 A;  4ZN3 A;  3OYE A;  1VQP A;  2QQR A;  3SWN B;  1Z9Q A;  3WVD B;  2OBS A;  1SM4 A;  3QE2 A;  1UGS B;  1VQ7 A;  2ZPI B;  4Y28 E;  4E7H A;  3CCL Q;  2EQK A;  4HT8 A;  4G7X A;  4FSS A;  2RJC A;  1I1J A;  3CCQ B;  3UA6 A;  1VQO B;  2QK0 A;  1Q7Y D;  2W6J A;  3B82 A;  2D0Q B;  2MOX A;  2XOK A;  1QCF A;  1NM7 A;  2ECZ A;  3PA1 A;  3OMC A;  1MHN A;  4RTT A;  1KC8 C;  4A63 B;  5LJ5 d;  5BSY A;  3HFO A;  5KE3 A;  2VNJ A;  2EBP A;  2XD0 A;  1D3B A;  2J05 A;  3SHW A;  4C8Q E;  3CCL T;  2M1H A;  3ZZU A;  1VQ9 A;  1X2Q A;  2DJZ A;  4LD6 A;  5KH6 A;  2DMO A;  5KYX A;  3SJZ A;  1VQP B;  4AC9 A;  4J9B A;  2LZ6 B;  4XTW A;  1S1N A;  1YJW T;  4KRT A;  2DD4 A;  1E62 A;  1SKQ A;  3A3G A;  3MPU B;  3A1P A;  3OB9 A;  1YIT A;  4KBM B;  4P6Y A;  1I81 A;  4RTX A;  4B43 A;  3ZZT A;  1ZQ1 A;  4M2L A;  2E5Q A;  2VJI A;  4MZT A;  1IHV A;  1YI2 A;  1TTT A;  3VS2 A;  4M75 D;  2X53 S;  1XTD A;  1OX9 A;  2VC8 A;  1QFY A;  3O5Z A;  2QDX A;  2ZTN A;  1ZA1 B;  1VYV A;  3QYH B;  4XQ3 A;  5KYY B;  4UZU A;  3CPF A;  4X9C A;  3CC7 A;  1RL2 A;  2EQI A;  3CCE Q;  1N0U A;  2NUT A;  4PLL A;  2XZP A;  1ZLM A;  4QVJ A;  5HZA A;  1ABO A;  3RDV A;  2O4X B;  5CAI A;  4ELY C;  5KYX B;  4M7D B;  1BBZ A;  3ZFJ A;  2ZZG A;  5I21 A;  1N9R A;  2M16 A;  1E6G A;  2KRM A;  2CS7 A;  1J9Z A;  1KSW A;  1UDL A;  5GAN j;  1S4M A;  1I0C A;  1M8M A;  2P84 A;  2E4H A;  1YIT B;  2Q6K A;  4E7Z A;  2PVD B;  2W10 A;  5BSX A;  3D7S B;  4BAC A;  3Q3A A;  3CCE T;  4Y9U A;  3CPW B;  2E3I A;  1D1N A;  2V7V A;  1NJI R;  1T6X A;  1BI2 A;  4KUL A;  5LJ3 d;  1YI2 B;  1QX4 A;  4GY5 A;  1UHC A;  3VS1 A;  2HKN A;  1DDG A;  4DOW A;  4PC2 A;  5IK2 A;  3U6K A;  3CC7 B;  3M4G A;  1WJS A;  1AT1 B;  3G1J A;  4XLE A;  3CCU B;  1G5V A;  3MMP A;  4C8Q A;  2HDN B;  2ZZF A;  1RQP A;  3TCJ A;  2O9V A;  2PU9 B;  4IIO A;  1U1T A;  2CT4 A;  2K5L A;  3VYG A;  2GNC A;  2D3N A;  5A89 A;  3RKX A;  5I2M A;  2RQU A;  2MPX C;  2OK7 A;  1I18 A;  3JCM f;  4UZF A;  5D6Y A;  1X6B A;  3FKS A;  3OZW A;  4FYX B;  3OPO A;  4XU2 A;  2XNJ A;  5GAM j;  3CB4 A;  1EFC A;  1B23 P;  2R57 A;  1VIE A;  5J3B A;  3AVT A;  3L2U A;  1GFC A;  5E6T A;  3E9G A;  5KYU B;  4GLK A;  2YUN A;  2RI2 A;  3TVT A;  2XDB A;  2HDA A;  2K3B A;  1KJW A;  4TKO B;  1W4S A;  2DK3 A;  5GMK m;  2DZC A;  1NYF A;  1YN8 A;  3PVL A;  4DQK A;  1UGV A;  3PVQ A;  2BZ8 A;  5FU7 B;  2EGC A;  2CC2 A;  4C8Q B;  3E1Y E;  3FPP A;  3KL9 A;  3HSB A;  3JV3 A;  4E6R A;  2LDM A;  4M7A F;  4J6W A;  1FMV A;  2E70 A;  5DLO A;  4B3F X;  4PJJ A;  2MAM A;  4DK0 A;  1XQH A;  2DTI A;  3MET A;  4P22 A;  2QG9 B;  5LMZ A;  3CME T;  3I5S A;  1BIB A;  2BE7 D;  3LYI A;  2V1Q A;  4X9D A;  3PUN A;  4DA4 A;  5FRM A;  2KEA A;  2DTO A;  3ZBD A;  1I7P A;  1NB0 A;  4CRI A;  4RD3 A;  1M8V A;  2JZ2 A;  4RM0 A;  4DQL A;  4BE1 A;  1QG0 A;  3GVJ A;  2LT4 A;  1VQ4 Q;  4FT2 A;  1OI1 A;  2RQR A;  1W34 A;  3GLX A;  3ASQ A;  1M90 R;  1KK3 A;  1K28 D;  3REB B;  4RD6 A;  1M1K D;  1WX6 A;  5C0M A;  2EJF A;  2EIX A;  2WR8 A;  2YRD A;  1D0Y A;  1R5O A;  2P0K A;  1B2R A;  2EAY A;  3OJX A;  1S72 Q;  3OS0 A;  4JLG A;  3C94 A;  5KCH A;  4XTZ A;  3C95 A;  1H3Z A;  4DEX A;  1EFU A;  3V8J A;  4PK4 A;  2Q6O A;  4F7U E;  3ZEH A;  1RI9 A;  2H8H A;  1S0U A;  2GTJ A;  5AYF A;  1AWX A;  3CMA B;  1JJ2 S;  4EPC A;  3OYH A;  2OTJ B;  1ABQ A;  1WHM A;  4M78 B;  1ZBJ A;  2QAZ A;  1S72 T;  1SRM A;  2KRN A;  4RPD A;  1WIE A;  2RC5 A;  3C0C A;  4DOV A;  1H8H A;  4B4D A;  3PGG A;  2GF7 A;  4E0F A;  2CSI A;  2HKQ B;  5GAN 7;  2NYS A;  2EQU A;  4CC7 A;  1KD1 C;  2I2L A;  2E1H A;  2C77 A;  4P5N A;  4XKW A;  3EHQ A;  1V1C A;  3GF5 A;  2FYK A;  4PJO G;  4C92 E;  1PD1 A;  4XM3 A;  2D1X A;  3Q1J A;  1VQM T;  1OGI A;  3CP8 A;  5EG2 A;  3VMF A;  4XN3 A;  3OOC A;  1KC8 R;  5CO7 A;  3EFO A;  3BFM A;  1NZ9 A;  1BCM A;  1XQB A;  3ONU A;  2OAW A;  3MCA A;  1WOR A;  2BM0 A;  3DLM A;  2A0F B;  2OX7 A;  4JJN K;  2DBK A;  1QWE A;  2E6Z A;  5GAM e;  2BGI A;  3SLD A;  2RNA A;  1UD2 A;  3ZPN A;  2EYQ A;  3H8Z A;  1XB2 A;  2X8K A;  1FYN A;  2XMF A;  3QUI A;  4BY6 B;  1E3X A;  5J26 A;  2DYI A;  3PIO A;  2PNI A;  5LJ5 f;  3GVK A;  2DL4 A;  2XHC A;  3GIR A;  3ASR A;  4PC6 A;  4IUV A;  3M57 A;  1Q95 G;  2CND A;  4M7A D;  3EH2 A;  4EDU A;  1I8F A;  5A0D A;  1YJW A;  5HK0 A;  1T6Y A;  3FJ5 A;  2QN6 A;  2V7X A;  2ZXI A;  1I5L A;  4ESR A;  3Q38 A;  2MWP A;  1W87 A;  3QFC A;  3EFO B;  1ZBX A;  3H9N A;  3QO3 A;  4JLI A;  3BW1 A;  1GR1 A;  4Y7C A;  1KD1 D;  4G1B A;  9ATC B;  1BCO A;  5GMK l;  5GAM g;  1VHE A;  1B34 B;  1DDI A;  3SLN A;  3QSY A;  1YWP A;  2E6N A;  1H64 1;  3E1S A;  3OYY A;  4HT9 A;  4F7U A;  3N5B B;  1IHW A;  1KRH A;  1WQW A;  2X4J A;  2F5K A;  5GAO n;  2DYB A;  4AFZ C;  3R6N A;  3NPF A;  4LDY A;  1RAB B;  2EYY A;  1EP3 B;  3AVV A;  3CC2 Q;  2YDL A;  4D6W A;  3OYC A;  4XN0 A;  2RJF A;  1YHQ A;  1Q82 D;  2RK2 A;  2B8A A;  1C1A A;  2X35 A;  2CBX A;  3BY7 A;  4JS4 A;  2QTZ A;  1WHJ A;  1E1Q A;  5FO1 A;  1M2V A;  1YJW B;  4OGE A;  3GBQ A;  2YWF A;  4PC1 A;  2QEX Q;  4UZE A;  3EG0 A;  3BNW A;  4RTU A;  3RER A;  4GBQ A;  4Z88 A;  1OB5 A;  5A88 A;  1VQ6 T;  4C92 A;  5F4M A;  2QA4 A;  1NBM A;  3CC2 T;  1AEY A;  4HCC A;  4P26 A;  1QFZ A;  4XTU A;  4P9S A;  1PM3 A;  4F7U B;  2X85 A;  4LN2 A;  1JA1 A;  2AZV A;  3EG9 A;  3A8O B;  2QEX T;  1K8A U;  3HAG A;  4IUQ A;  3CES A;  2FRW A;  5KYW A;  4X05 A;  1BIA A;  5LJ3 f;  4Q7J B;  1RI0 A;  4PC3 A;  3AVX A;  5GAN 5;  3AVW A;  1KQ2 A;  5GAO r;  1YHQ B;  1RAE B;  5GAN d;  3PFS A;  2Q6L A;  3JCM e;  4P3Y A;  3ZIA A;  4BI8 B;  2CZ6 B;  1M2V B;  1MNE A;  2YRC A;  3L2V A;  1RUW A;  1ZM2 A;  4O6J A;  2KVO A;  3V7R A;  5CKE A;  2ZBV A;  2GPJ A;  4C0Z A;  3I1F A;  1K8A C;  3CCE B;  3CCJ Q;  4QT7 A;  3L2Z A;  3A8K A;  4OMQ A;  3TQ7 P;  4DBF A;  2YWG A;  2DIL A;  2CKK A;  2DER A;  5H59 A;  2CP5 A;  4YAF A;  3TSZ A;  4CC3 A;  3CD6 A;  4RTY A;  4KGX B;  5KYW B;  3CXC B;  4J8O A;  3JCM g;  1BJK A;  3CCV A;  3JCM W;  3CCJ T;  3MEV A;  2DIE A;  5I2S A;  1F60 A;  3AGQ A;  2X4Y A;  1EIF A;  2GFU A;  1IXD A;  2PVO B;  4Y91 A;  1MV3 A;  1HK9 A;  2LCS A;  3CC4 A;  3OKX A;  3WNC A;  2GQF A;  3CME A;  4ACB A;  4PJO F;  2D3L A;  3HP9 A;  2EVR A;  2FZK B;  4C0D C;  3LH0 A;  4ZGJ B;  5H5J A;  5HXB A;  4ZGE B;  1QVP A;  3FIF A;  2ZZQ A;  1OB0 A;  4E7K A;  3CW2 A;  5DLQ E;  6AT1 B;  4XTV A;  3ZBU A;  2NLU A;  4WZE A;  1W2B P;  1CNF A;  1K8A D;  4M77 A;  1IJF A;  4B6M A;  2ZL5 A;  3V7A A;  3UPU A;  4MML A;  2QAS A;  4OF1 A;  2YT6 A;  5D7U A;  3LW5 E;  2F43 A;  3OZV A;  2CP2 A;  1WHH A;  5J35 A;  4OP7 A;  4PJN A;  4BE2 A;  4PC7 A;  7AT1 B;  2EYW A;  2L3S A;  5HCK A;  3CME B;  1I5O B;  2DOG A;  1YJN Q;  1FWZ A;  4P1V A;  2RI5 A;  3M0P A;  4CC2 A;  2L0A A;  1M3A A;  1HD3 A;  3OJW A;  1IRE B;  4NS5 A;  2GBQ A;  1QVG S;  1UD3 A;  1BPL A;  2YSQ A;  1BYM A;  5AN9 A;  3ULR B;  3JCM X;  4M77 B;  3LGL A;  3P26 A;  4J5Y A;  5A0L A;  1BU1 A;  2K6D A;  2EFG A;  3JCM J;  2DF6 A;  3J81 E;  2NUZ A;  2C0O A;  2P0Q A;  2A7Y A;  4FM4 B;  3PIP A;  1T5E A;  3SKB A;  3LO8 A;  2VYQ A;  4C5G A;  3KFV A;  3WBJ A;  4XLF A;  4FT4 A;  2VBU A;  2LP5 A;  1H3H A;  4M1K A;  2RQT A;  4ROX A;  1LCK A;  1WU8 A;  2RB6 A;  3G4S T;  3HRT A;  2V8K A;  1VQK A;  1K9A A;  2I0N A;  5FL7 A;  1S72 B;  1E43 A;  3NFC A;  4ZGD B;  2K4Y A;  3W2G A;  3PMT A;  1BB9 A;  4HE5 A;  3VYH B;  1N07 A;  3PA2 A;  4X8I A;  3EFR A;  2Y4Y A;  1FX0 A;  4AFQ C;  3MP6 A;  3BCF A;  2F2X A;  1PKV A;  4XU3 A;  4MYT A;  2MCN A;  2XIC A;  1VQM B;  4RD2 A;  3CPX A;  1Y7X A;  5DY9 A;  1T0J A;  4FL6 A;  1EFT A;  4PJO D;  5CKF A;  4J83 A;  1UJ0 A;  5IAY A;  1Q7Y U;  3B78 A;  1NPR A;  1Y71 A;  3I55 A;  3JQQ A;  1KQS B;  5FU6 C;  2LQW A;  2AIR B;  1VQ5 Q;  5GAM h;  2NV4 A;  1AWW A;  1GVH A;  4J9G A;  4J0Q A;  1KHC A;  1MND A;  1SRL A;  4Z4V A;  1VQN A;  4DEY A;  3P27 A;  4EMG A;  1YIJ A;  4II3 A;  1K73 U;  2DEU A;  2LNV A;  4M7D E;  3ME9 A;  1MAB A;  4M0L A;  4NOY A;  4C8Q F;  4XTY A;  2JTE A;  3JQR A;  3W5H A;  1Q7Y C;  1VQ5 T;  2V1R A;  2YHT A;  1K76 A;  3SWN A;  1YJ9 Q;  1QCO A;  2Q6I A;  3CCR T;  1HXD A;  2OTL Q;  2J6O A;  1OHH A;  2D9T A;  4K11 A;  1VQ6 A;  2L8D A;  2QTV A;  3OS5 A;  1K73 C;  1PSF A;  3V7S A;  2HMA A;  2LMJ A;  1YX2 A;  3S3N A;  4FK8 A;  2XID A;  1AOJ A;  2G3R A;  4CC4 B;  4QQ6 A;  3CXC P;  4TT3 A;  4F7U G;  3BQJ A;  3LGF A;  4WQM A;  4WZT A;  2RN8 A;  4QVZ A;  4N3N A;  1OPL A;  1JJ2 P;  1M5Q 1;  1YCY A;  2OTL T;  4C5E A;  3GP8 A;  1FRQ A;  2YUQ A;  3CBM A;  5HK3 A;  3A35 A;  1NE8 A;  3NTH A;  3PUM A;  1D1C A;  5C6S A;  1SHF A;  1RLQ C;  1K8A R;  3HPW A;  2IIM A;  3M0U A;  4XLH A;  3BDL A;  4EMK A;  4TMV A;  1TUC A;  2V26 A;  4ZCM A;  4M75 C;  1VQ6 B;  4RD1 A;  4CQJ A;  4C92 G;  3RKY A;  1DJ7 B;  3M54 A;  3QWY A;  2KRS A;  5GAN f;  4ZTF A;  3L2Q A;  5B6I A;  1RAC B;  3LWI A;  5TR9 A;  4KKT A;  5LJ3 g;  3WYA A;  1X2K A;  3CC2 B;  2BUD A;  4ME7 A;  3VS3 A;  3MP8 A;  2RJD A;  4TMT A;  1GRI A;  5D6W A;  4P25 A;  1QGZ A;  2VUB A;  2Y4X A;  1MMA A;  1PJ6 A;  4ZCL A;  2QE7 A;  2QEX B;  2FG0 A;  4M78 F;  1H8K A;  5KYY A;  1K73 D;  4JRP A;  3T56 B;  2RHU A;  5CKB A;  3JCM h;  1KK2 A;  3J7A F;  3UA7 A;  3WVE B;  2CP3 A;  2O4X A;  1I8D A;  5GAO l;  4M7D A;  3S6W A;  5TV2 A;  2LNH B;  3LH5 A;  3OE7 A;  4EMK B;  5FO0 A;  4J9I A;  3OYM A;  3VUB A;  4RMO A;  2BZX A;  3RY8 A;  3EGD A;  3HHT B;  4R0K A;  2DL7 A;  2KDS A;  4N4H A;  1VQL A;  3AVY A;  2ESW A;  2J7I A;  3JB9 J;  3HFN A;  3CPW A;  1IZ6 A;  1E63 A;  2H3E B;  4LE9 A;  1UD6 A;  2COZ A;  2XGJ A;  3AVU A;  1JO8 A;  4RUG A;  5GMK e;  1PC0 A;  1A0N B;  1UTI A;  4FW2 A;  2D74 A;  2HEQ A;  2EKH A;  4A54 A;  2V31 A;  1MMG A;  2WSF E;  4X0C A;  5IYN A;  4DQ2 A;  3V7C A;  1H42 A;  4E7L A;  3G05 A;  3KEW A;  4HVV A;  2MMP A;  3CCU A;  2P3M A;  2QMU A;  3CCJ B;  1TU0 B;  4ZTJ A;  4BD3 A;  4KGV B;  4C8Q D;  1UFF A;  4PJM A;  2CRV A;  3WQZ A;  1WXT A;  4ELZ C;  3G6E Q;  4Z8A A;  3EGD B;  3CQT A;  1N0V C;  4Z1M A;  1YLO A;  1VQL B;  4RCB A;  2LTO A;  2DNU A;  2OBR A;  1UMK A;  3JU4 A;  4DBH A;  4XOR A;  4OOS A;  2E5K A;  5KYU A;  2CUB A;  4M78 E;  2DXC A;  3PEN A;  1G2B A;  2JS2 A;  4V2S A;  4AT1 B;  3ER0 A;  2HL3 A;  2JM8 A;  5LL6 S;  3OEE A;  3G6E T;  1MV0 B;  2JTM A;  1X27 A;  2KSS A;  2BF4 A;  2HLD A;  4XOT A;  4LNP A;  4YEL A;  3M5A A;  1M1K U;  2VV5 A;  4A4H A;  3X20 B;  1TLL A;  5IH2 A;  3BE3 A;  2DPP B;  4YAO A;  4OOX A;  4NCN A;  1FX7 A;  1EZZ B;  3FJO A;  2DXU A;  3M59 A;  3QKJ A;  4OPS A;  3OW2 P;  1B07 A;  1D0Z A;  1TXQ A;  2EGA A;  1KQS P;  3INZ A;  3H0H A;  1VQ8 Q;  4LBY A;  1AWJ A;  2HAX A;  2A08 A;  3CBO A;  3CCS Q;  3M0Q A;  4PGO A;  4PAB A;  1EFN A;  4RPB A;  1IGU A;  1XOV A;  1M1K C;  4C5H A;  1WP6 A;  3E19 A;  4KUD K;  1B7T A;  4F7U F;  2O31 A;  2PQW A;  1VQ8 T;  1W9X A;  1QCN A;  2BN4 A;  3CRZ A;  1NLP C;  1KQ1 A;  4JJD A;  3I56 Q;  1V29 B;  4OB1 B;  1ZUK A;  2M0Y A;  2HZY A;  1TS9 A;  4IW3 B;  5GAN 3;  4RTZ A;  2I1L A;  3L1A A;  2FO0 A;  4L6V 5;  4N0A C;  4UAJ A;  1MUZ A;  2DY1 A;  1OPK A;  2QTX A;  3REA B;  3CC4 Q;  2X0K A;  2RO0 A;  3RMS A;  2SEM A;  1YFN A;  2C4T A;  2E65 A;  2KXC A;  5CKH A;  4C92 F;  1MMD A;  3G4S B;  2YUP A;  3I56 T;  3U23 A;  3G71 A;  1T3L A;  3TSW A;  3THK A;  2LCC A;  4Z4W A;  2KBT A;  1WI7 A;  5KCO A;  3CMA A;  2ZPG B;  2DVJ A;  3QBY A;  2OTJ A;  3RES A;  4M78 A;  1Q7Y R;  4FYY B;  1IGQ A;  2R9V A;  1ZUU A;  4JZ4 A;  3NHN A;  2EYX A;  1R0C B;  1W2B A;  1WSR A;  1JEG A;  1FXX A;  3QZ5 B;  2CP6 A;  3P8H A;  4F04 B;  1H8E A;  3ZUG A;  2K5F A;  2DTH A;  1K73 R;  1C6V X;  1UGR B;  4KH1 B;  1VQ4 T;  4WWV A;  2QQ9 A;  3CCM Q;  1WHL A;  3M53 A;  1KD1 U;  3C12 A;  4LBZ A;  2BIV A;  3G71 B;  4J6X A;  1D8T A;  4RDK A;  4EMH A;  1QVF P;  3SJP A;  1RAG B;  1QVG P;  1Y07 A;  4BE0 A;  4M7A C;  3R6O A;  1RAA B;  4LDX A;  2F2V A;  5FW9 A;  5IXF A;  4B3G A;  2DL5 A;  2HL5 C;  3OQ5 A;  3CCM T;  1HVX A;  1GCQ C;  1OOT A;  1FDR A;  1ZM4 A;  2DL3 A;  2JDI A;  2YWW A;  5L46 A;  4C43 A;  1AVZ C;  5FLX E;  1Q82 U;  1W2B B;  4XL9 A;  2LX9 A;  5FNZ A;  4Q5W A;  4GQN A;  1E64 A;  1VQ5 B;  4X07 A;  3BY2 A;  2QYZ A;  3AT1 B;  1NG2 A;  3CCR B;  3S3M A;  3MHX A;  4YAW A;  3X28 B;  2MI6 A;  3QHS A;  3OZU A;  1VA7 A;  2OK8 A;  1WYX A;  4C0F A;  1BMF A;  2NWM A;  3GNF B;  5EC7 A;  3RR6 A;  1B34 A;  1Q82 C;  5L23 A;  4OB0 B;  3OS2 A;  3OMG A;  2E1B A;  2OTL B;  3LQE A;  4HXJ A;  3CCL A;  3S3O A;  5IYW A;  2DL8 A;  2KAF A;  4M77 F;  4Z4U A;  3LVB A;  2MYS A;  1PD0 A;  3OBW A;  4VUB A;  4HVU A;  3M0T A;  2ZL7 A;  2BTT A;  1AIP A;  1UE9 A;  2ZIT A;  4HCZ A;  3OY9 A;  5KNL A;  1H92 A;  1G83 A;  4L5G A;  4AG2 C;  3GVL A;  2JNG A;  2RK1 A;  1WJQ A;  1X43 A;  3EGU A;  4J9C A;  5THX A;  1PRM C;  2RM4 A;  4FYV B;  1EWY A;  1U2R A;  3LNN A;  4C92 D;  1WGS A;  4E7S A;  3FC3 A;  1SKY B;  1W0J A;  3ZC3 A;  4P2N A;  1R5N A;  3QDR B;  4XU0 A;  1W0K A;  1EP2 B;  2CRE A;  2GGR A;  4R55 A;  1PCX A;  1ZM9 A;  1WOP A;  2ZBU A;  3CCL B;  5F4J A;  4LUD A;  1VQN Q;  1IJE A;  3A3B A;  2LJ1 A;  1GJR A;  1SSF A;  1E1R A;  4MDW A;  4M7D G;  3ONY A;  4RCC A;  1N08 A;  2X3X D;  2DEQ A;  1U3O A;  4G7W A;  1X6G A;  1R8O B;  2J06 A;  4OPV A;  4JRK A;  3M9Q A;  1JXO A;  3E2U A;  1FNC A;  3H0I A;  4D8K A;  2RD1 A;  5L8R E;  5CCA A;  1VF7 A;  3CCE A;  1A8P A;  4L59 A;  3OYG A;  4RCZ A;  3W2H A;  1QW1 A;  1OEB A;  4QFM A;  2Z0W A;  3CCQ Q;  1PJ5 A;  1VQO Q;  2P0P A;  2QGG A;  4E7I A;  2BMW A;  4IUP A;  3VNV A;  2HNI A;  3P8B B;  4M77 E;  1Q9S A;  2DX1 A;  4XOP A;  2XI9 A;  5CQX A;  4K1X A;  1VUB A;  3EG1 A;  2ROT A;  3QZ9 B;  3AGP A;  4HIZ A;  3CXC A;  1N8R D;  2EWN A;  2F2W A;  3U6B A;  3I35 A;  4C0G A;  4RTW A;  3J80 E;  2GJR A;  4WZK A;  4X06 A;  1K9M U;  3OW7 A;  1VQP Q;  1WJR A;  2WJV A;  5GAN 6;  1M1K R;  1VQ7 Q;  4QUZ A;  5DN6 A;  2CH4 W;  1WOS A;  1QUE A;  3HRS A;  1MMN A;  2FEI A;  2VAS A;  5FRN A;  3UWN A;  3AHU A;  2HBW A;  3G6E B;  3H0F A;  1GCP A;  1VQP T;  2L3Q A;  1K9M C;  1YCS B;  2CP7 A;  2DAQ A;  1VQ7 T;  4ATO A;  3VRY A;  4C8Q G;  2ZPF B;  2DD5 A;  1G7S A;  5GV8 A;  1JJ2 B;  1PSE A;  1VQ9 Q;  4OMP A;  3W2F A;  2KXD A;  4EIK A;  3ISX A;  3OP1 A;  2CGH A;  2ENM A;  4Z4Z A;  1PG5 B;  1UGQ B;  4JUV A;  1WHK A;  5GAM d;  2AKK A;  2JJ1 A;  4GLM A;  5GMK i;  1KZL A;  2LQ8 A;  3HL8 A;  1VYT A;  1LJO A;  2CP0 A;  3VJP A;  2X6Y A;  1YIT Q;  2O2O A;  4TVR A;  3BDU A;  1OB2 A;  4FSX A;  2RF0 A;  3GNG A;  1N9S A;  1VQ9 T;  1SEM A;  3UAT A;  4ZCI A;  5HKC A;  3VO2 A;  5GAN 8;  2JMC A;  4OMM A;  2MIO A;  4N3G A;  1BKB A;  2M9U A;  1YI2 Q;  4Y92 A;  3X24 B;  2PIA A;  5I22 A;  1NYG A;  1M27 C;  3SD4 A;  2RHI A;  1KTV A;  2XKO C;  3CC7 Q;  2JJ9 A;  2V8I A;  1ACM B;  3JSC A;  1YIT T;  1VJS A;  4IKF A;  1VIF A;  4DBQ A;  4FWT A;  1WOO A;  4XNF A;  2DET A;  1OZ2 A;  4JDS A;  2WSS A;  3I9Q A;  1K9M D;  3SFM A;  1VQ4 A;  4P6V F;  4Y9R A;  1QH0 A;  2Y90 A;  1JB9 A;  2C5B A;  1N05 A;  2AK5 A;  2K3X A;  5LJ3 j;  3OYK A;  3U2Q A;  1UEC A;  3I56 B;  4BI3 A;  1Q86 U;  2GRE A;  3CC7 T;  3VU3 C;  3G7Z A;  3NTI A;  2JN9 A;  1D1B A;  4XMY A;  4FU6 A;  2ZCF B;  2VYT A;  4ASU A;  4AMC A;  2GK6 A;  2DZ9 A;  1OV3 A;  3VNU A;  1ZSZ C;  4QW2 A;  4M78 G;  1S72 A;  1KD1 R;  4ACA A;  3SWN C;  2P4T A;  1FNB A;  1TUD A;  4PJO C;  1YJN T;  2C06 A;  2JMA A;  1Q86 C;  4J7I A;  2X4X A;  2V7Q A;  5IT9 E;  4RD0 A;  3EAE A;  4M7D F;  2F4N A;  1M1F A;  3KUF A;  4U9U A;  4YTL A;  1VQ4 B;  2DM1 A;  1UUE A;  1WXB A;  1U06 A;  1GXI E;  2VNH A;  1VQM A;  5GAO m;  2KE9 A;  1Q82 R;  2ATC B;  3L2R A;  2VNK A;  3OW2 A;  4XAX B;  2GQI A;  1RQR A;  2QQS A;  1KQS A;  2RHX A;  1U1S A;  1QUF A;  4OMF B;  3JCM d;  2CF4 A;  5LJ5 e;  4Z4Y A;  1N6A A;  1BK2 A;  3JCM c;  1AWO A;  2FVG A;  1QQJ A;  3CCM B;  5M9O A;  1ZSG A;  2BSA A;  2ZXH A;  4MZM A;  2F1M A;  1OU8 A;  2HQE A;  2JIZ A;  3VV0 A;  3OYI A;  4YAL A;  2PTK A;  2VVK A;  3JAM E;  8AT1 B;  2MK5 A;  3CEY A;  4XLA A;  3BC9 A;  3OA6 A;  2X6X A;  4XR6 A;  1LNX A;  2ZZD A;  1RAI B;  3E9F A;  4RTV A;  2X9H A;  1JNY A;  1P4M A;  3GQB A;  2ZAE A;  4X7D A;  2HCJ B;  5GMK j;  2NUP A;  1JU5 C;  1Q86 D;  1N27 A;  4PLI A;  3VO1 A;  2FPD A;  3OSV A;  2XG8 D;  3RUX A;  3OW2 B;  5LJ5 g;  1BI0 A;  2J6K A;  2CZ0 B;  1W70 A;  2CT3 A;  1GBR A;  3M56 A;  3CPW S;  1V76 A;  3OSS C;  3L42 A;  4FYW B;  4PAA A;  2OTJ Q;  4AG1 C;  2EGE A;  4YAU A;  1NEG A;  2Z6B D;  2KY9 A;  1U8R A;  2JM9 A;  1U5S A;  1TH7 A;  1M2O A;  2DJQ A;  3RIR A;  2LVM A;  2A28 A;  2GCX A;  1TWB A;  4X1V A;  4BI4 A;  1E7O A;  2X6W A;  1W1F A;  1VYU A;  4ZNX A;  3VS0 A;  2O88 A;  2QTL A;  1WDX A;  4N4I A;  2CUD A;  2ZTG A;  4R71 A;  3W5V A;  4C0D B;  1G8X A;  5KE2 A;  2NUP B;  1IHM A;  1JA0 A;  4WF2 A;  3CC2 A;  3LX7 A;  3P8D A;  3FLG A;  1NLO C;  2PVG B;  1N5Z A;  3QII A;  3ASS A;  1TOV A;  1RAF B;  2HQH A;  5LJ3 e;  3NTK A;  3QDF A;  3MEA A;  2RPN A;  4M4Z A;  1YJ9 T;  1M90 C;  2QEX A;  2HD0 A;  1Y0M A;  3SEJ A;  2DA9 A;  1AZE A;  1QVF A;  3GSI A;  2EKO A;  4EH1 A;  1UEB A;  1SKU B;  2VB6 A;  4PFP A;  2EYZ A;  2BGJ A;  4G1V A;  4M7D D;  4LDW A;  4O5V A;  2HBP A;  2JTF A;  2LT1 A;  2L3P A;  1Y0Y A;  1E3Z A;  2LC4 A;  1DG1 G;  4RG2 A;  2VZL A;  3VRZ A;  2E64 A;  2LRQ A;  3PTA A;  5GAN 2;  3DLL A;  1D0X A;  4XTX A;  4XON A;  3QG1 A;  1PNJ A;  1K9M R;  1UD8 A;  3VUZ A;  4F17 A;  3LLR A;  3EFS A;  1RLP C;  5FU7 C;  4C8Q C;  2K3Y A;  1ZSZ B;  4WTO B;  3UDC A;  4ZGN B;  2R58 A;  4BB7 A;  4OVA A;  2RC6 A;  5J39 A;  3DDY A;  2DE0 X;  4OB2 B;  4PJO B;  1QVF B;  2C0I A;  5IYP A;  1QVG B;  2W6I A;  3CCJ A;  4D8D A;  1TVC A;  2BE9 B;  1GBQ A;  4Z4S A;  5ECA A;  1BI3 A;  4XLC A;  4J9D A;  5A8A A;  4OOV A;  4M75 E;  3KBG A;  1COW A;  4RLZ A;  1M90 D;  4HCK A;  3MHP A;  2FZG B;  2LZJ A;  2DCU A;  1D1A A;  2F1L A;  1G7C A;  3QJY A;  1WFW A;  1YJW Q;  1JXM A;  1XJW B;  5GAO q;  3LQ6 A;  3OEH A;  3WND A;  3HKS A;  2DRK A;  2K79 A;  2JW4 A;  1B3Q A;  3JCM Q;  3FEO A;  4OMO A;  4AF7 A;  5CQY A;  5GAM f;  4RG8 A;  3J81 k;  1UB4 A;  1BX0 A;  2PZ1 A;  3MP1 A;  4KUI A;  2C5H A;  5DS0 A;  4E47 A;  5AT1 B;  1K0S A;  1HZE A;  1VQ7 B;  2M0O A;  1V0E A;  3SB2 A;  5IHI A;  3VS6 A;  5A0G A;  4BDZ A;  1WHG A;  1CQX A;  3QFS A;  2JXB A;  3FB9 A;  2YWH A;  1YHQ Q;  2BPO A;  2KYB A;  1YP5 A;  2OJ2 A;  2YXY A;  3KXT A;  1UHF A;  4TN1 A;  4X7E A;  2PUK B;  1BLI A;  1W2B S;  1ZUN B;  3UT1 A;  5GV7 A;  2LJ0 A;  2MWO A;  2ZPH B;  1GL5 A;  2X3U A;  2FZC B;  5D6X A;  1D3B B;  3MEU A;  2WAC A;  4J6Y A;  4F7D A;  4M78 C;  4HVW A;  1FMK A;  5FU6 B;  2QA4 Q;  4BPR A;  2EQM A;  1VQ9 B;  2GJP A;  4IUT A;  2CK3 A;  1YHQ T;  4PFZ A;  1KC8 D;  1I4K 1;  2B5O A;  4M77 G;  1Q86 R;  5FA6 A;  3SEM A;  3BY1 A;  2H3J A;  3L2W A;  1KK1 A;  4AVZ A;  1YJN A;  4CI0 C;  1KK0 A;  4JMQ A;  4ZN1 A;  2QA4 T;  4JJC A;  3JCM V;  1WLP B;  4FXU A;  4M75 A;  2ZPE B;  1HA3 A;  1QKX A;  2COY A;  3PNW C;  3H94 A;  1CKB A;  2QQA A;  3A8M B;  4X34 A;  3ZL7 C;  3QJ6 A;  1R77 A;  2LX7 A;  3G4S A;  1X01 A;  1G3Y A;  2NUT B;  4BY6 C;  4RCY A;  1VLO A;  4KH0 B;  1UG1 A;  2EFI A;  1Q81 U;  3H6Z A;  1KHI A;  3QPH A;  3A98 A;  3Q39 A;  2YLB A;  2QDL A;  1UGP B;  4A53 A;  3JB9 G;  4RDL A;  4M78 D;  4ORZ A;  3T51 B;  2CZ1 B;  3CD6 Q;  2YUO A;  1YJN B;  3CCS T;  1LOJ A;  1CKA A;  3MJX A;  1WQ7 A;  2KR3 A;  4H9G A;  3CCV Q;  1O9S A;  3MEW A;  5TY0 A;  1LPL A;  3BH4 A;  4B44 A;  4OPO A;  4J9H A;  2KK4 A;  3TEE A;  4M75 B;  1I07 A;  1Q81 C;  3VKI A;  4MZP A;  1G3T A;  3EG3 A;  3HTR A;  5IXB A;  2YRV A;  4G6I A;  2JJ2 A;  3CME Q;  2VBV A;  3T9N A;  2FPF A;  3CD6 T;  2VGN A;  4B47 A;  2D8J A;  1UJY A;  3VS4 A;  2RMO A;  1YNZ A;  5LJ5 h;  3CCV T;  1Y96 A;  4ZV4 A;  4RJL A;  4Z4R A;  4FCY A;  1ZM3 A;  3QFR A;  3JQP A;  4YEJ A;  4A4E A;  5CDF A;  4F14 A;  3CC4 T;  3SDZ A;  4BDY A;  4HA8 A;  3NE5 B;  2E3H A;  3RKW A;  4A4K A;  1J3T A;  2K5I A;  2XNC A;  4MMK A;  3AST A;  2OYN A;  4KGZ B;  1VQ5 A;  2XK0 A;  4JJB A;  3WY9 A;  2XZO A;  1G3W A;  1RAD B;  2O9S A;  2ZGW A;  3CCR A;  3CP2 A;  3OYL A;  2C2W A;  2EQJ A;  2JOY A;  4RKU E;  5GJW B;  3M55 A;  1K4U S;  1R5B A;  4FIB A;  2DIQ A;  4MDX A;  2B7C A;  1M1G A;  1PKS A;  2ED1 A;  2W0Z A;  3OYD A;  2KYM A;  2AZS A;  4YXW A;  2RQW A;  1CNE A;  1Y96 B;  2VXE A;  4PJL A;  4LD9 K;  1FND A;  2RJE A;  1ELO A;  3OAA A;  1QKW A;  4XU1 A;  3OFN A;  5HKK A;  3A8H B;  1Q81 D;  1K1Z A;  1YJ9 A;  3QSU A;  3ZBT A;  1IRX A;  2AHO A;  4J9F A;  3JCM b;  2OTL A;  4NBS A;  1SF9 A;  1R0B G;  4QVC A;  5EMN A;  1F1B B;  1NRK A;  2BVN A;  1RAH B;  2GFA A;  1AHJ B;  2KI7 A;  2KVQ G;  4C92 C;  1V5V A;  4DNT B;  1EX4 A;  3MO8 A;  1D09 B;  1WSV A;  5GAN e;  4F16 A;  3CXC S;  1F20 A;  1T3S A;  1EXM A;  3C4S A;  3M0S A;  4DBR A;  1QP3 A;  1E79 A;  3T53 B;  3X25 B;  1W6X A;  5CK9 A;  2BV3 A;  4P12 A;  1VQM Q;  2E12 A;  5FWC A;  2YLC A;  4HE6 A;  1KG1 A;  2DKG A;  4J7F A;  1X69 A;  4XK8 E;  5LJ3 h;  4M7A E;  1KFZ A;  1KJZ A;  1XFO A;  2PLF A;  4TMW A;  1NEB A;  2KRO A;  4LBV A;  4OP0 A;  3TRE A;  1VQK Q;  5CIU A;  3R6J A;  1YJ9 B;  4B9W A;  2V4D A;  3HRU A;  4QV2 A;  1UD5 A;  4YHB A;  2QQB A;  1K0X A;  2VGM A;  2CH4 A;  2DRM A;  2QXF A;  3V8L A;  5GAN g;  1N8R U;  2E10 A;  2KNB B;  2LJ3 A;  4C0S A;  5GAO p;  1SG5 A;  3GIB A;  2WJY A;  5DSZ A;  4WZL A;  3ASP A;  1WDT A;  1M4Z A;  3EH1 A;  1VQK T;  2WSE E;  4N0A A;  4B9X A;  4XQF A;  5KYN A;  2M02 A;  2FX3 A;  2X4W A;  2LCL A;  3ZZ0 A;  2SRC A;  2K2V A;  4XD7 A;  2XZL A;  2D8H A;  1OQK A;  1OUL A;  2L3R A;  4TMX A;  1N8R C;  2C4U A;  1TUI A;  1TSF A;  2B86 A;  1WNL A;  3B8H A;  1HJD A;  3I55 Q;  2X51 A;  5FRO A;  1OGJ A;  2QI2 A;  3A8I A;  4TSF A;  2K2M A;  3CPW P;  1QGA A;  1XNI A;  1SPK A;  1HSQ A;  4PKC C;  1UD4 A;  4FW1 A;  2L2P A;  2VJJ A;  2COW A;  2HQX A;  1YIJ Q;  3JB9 F;  2AHJ B;  2O01 E;  2BZY A;  4LUE A;  2CZ7 B;  2ZL6 A;  1VOM A;  2EJG A;  1XE1 A;  4LDU A;  4L8J A;  2GK7 A;  2K9G A;  1ARK A;  1QMC A;  3EG2 A;  3I55 T;  3MCA B;  5I11 A;  1H85 A;  1GAQ A;  3EHR A;  1O75 A;  5HZB A;  2ZPB B;  1VQN T;  4G5G A;  2VBS A;  1YIJ T;  1VQ6 Q;  2RQV A;  4M77 C;  1D2E A;  1NB9 A;  3W2E A;  3X26 B;  4LBW A;  4E7J A;  4M53 A;  5GMK h;  4QHY A;  5FIU A;  5IYQ A;  3OYF A;  2PMD A;  3JB9 I;  5JBQ A;  2LQN A;  2FB7 A;  4M7A A;  1VHO A;  3DKM A;  1FRN A;  3G6E A;  1GCQ A;  1EP1 B;  2DVE A;  2EW3 A;  1WPY A;  3QWX X;  1EFR A;  1PWT A;  1SSH A;  2RHY A;  1M30 A;  5CVI A;  1JJ2 A;  1BI1 A;  3F70 A;  2KGT A;  3CCQ T;  1X6O A;  1VQO T;  5A2Q E;  2MF2 A;  2M5S A;  1JBM A;  4JS5 A;  2K57 A;  1W35 A;  3W2I A;  3H41 A;  4PL6 A;  4QQD A;  4BUG A;  2XDD A;  4PNO A;  3WBK A;  4Z4T A;  2JVV A;  2HSP A;  3M58 A;  2JT4 A;  5IHK A;  5LJ5 j;  2XEX A;  3OBY A;  4Z02 A;  1PHT A;  2A36 A;  1MGQ A;  1HYO A;  4RD4 A;  3ASK A;  2ZZE A;  3VS5 A;  4ANJ A;  4M7A B;  1FMW A;  2XND A;  1QFJ A;  1WTH D;  3OW2 S;  1VQ8 A;  1KQS S;  3D26 A;  2J6F A;  1NDH A;  1WPC A;  2P4R A;  2DXB A;  4M77 D;  3CCS A;  3M4Y A;  2R5M A;  2HSE B;  2C78 A;  4C92 B;  3Q6R A;  4C5I A;  4LXC A;  1OU9 A;  3A5Z B;  2QA4 B;  1Q81 R;  2M51 A;  2CSQ A;  3CTA A;  2HCK A;  1QGY A;  1QP2 A;  1VLY A;  2DBM A;  4M75 G;  4IUU A;  2KT1 A;  2RH2 A;  1FNM A;  2GQV A;  1GFD A;  5FWB A;  2CYZ B;  2VXF A;  3EG9 B;  4ZGQ B;  1M3B A;  4JZ3 A;  4NL2 A;  1KK7 A;  3O8V A;  3I56 A;  1VQL Q;  1T6Z A;  2BM1 A;  3R6K A;  2RI3 A;  2NPF A;  1M9S A;  1OZ3 A;  4II2 A;  2LQK A;  3OYJ A;  1G7R A;  3VS7 A;  3E20 A;  1VQ8 B;  3WXM A;  4AF6 A;  4X7F A;  2JUF A;  3CCS B;  2V7W A;  1TUG B;  2R6H A;  4HKE A;  3JB9 D;  1VQL T;  1E6H A;  3FPK A;  2OBT A;  3CCU Q;  4OMN A;  4AFU C;  1KMH A;  5GAN 4;  4DNR B;  1GO2 A;  1BQE A;  4OML A;  2IG0 A;  2CDT A;  4II1 A;  1YI2 T;  4JRQ A;  2VWF A;  3CD6 B;  1AMO A;  1PKT A;  1YWO A;  2DIG A;  3QFT A;  3JRZ A;  3PT9 A;  4P3I A;  2L89 A;  3QYG B;  5KSW B;  5IHN A;  3CCV B;  3CCU T;  2F69 A;  5TRD A;  4NL3 A;  1QWF A;  4HCB A;  3LWH A;  2X3W D;  3FRN A;  1GAW A;  1G3S A;  2JN0 A;  3NGP A;  3WXM B;  4QVD A;  3OYA A;  2IPO B;  1NJI U;  3CC4 B;  2AT1 B;  1Y0R A;  1JQQ A;  3CCM A;  3URG A;  3JB9 H;  1MRZ A;  1PJ7 A;  2V7U A;  2WSC E;  4E2F B;  2V8J A;  4KKU A;  3WNB A;  2J7K A;  2C0T A;  3BCD A;  1QVF S;  2ABL A;  1JB0 E;  4IIM A;  1YBY A;  1Z9Z A;  3IQL A;  2EJ9 A;  2KQW A;  3A8G B;  1C0M A;  3EGX A;  2QGF B;  3W5U A;  3Q6Q A;  2FHD A;  4QQG A;  4WCI A;  1NJI C;  2OI3 A;  2D0N A;  3RBB B;  4KT0 E;  2VNI A;  2WYR A;  1IB8 A;  3V76 A;  2KT8 A;  1V0F A;  3G4S Q;  3I5R A;  4Z89 A;  4MYU A;  5CR2 A;  1T0H A;  2XU8 A;  1NBE B;  4PJO E;  4X7C A;  4LC0 A;  1AZG B;  1ZUY A;  2YWE A;  3MKD A;  5CKD A;  4EMK C;  1IB0 A;  1WA7 A;  3VR6 A;  5GAN h;  2DLP A;  2DFU A;  2GTO A;  4FN5 A;  2L5Q A;  1LVK A;  3PVD A;  1WXU A;  1ZX6 A;  2RA2 A;  1IO6 A;  4XKV A;  1PRL C;  3EGX B;  2WZN A;  3PMI A;  3M0R A;  1N8R R;  1NPP A;  1BX1 A;  3RNJ A;  1P92 A;  1M3C A;  3TU4 K;  3V8K A;  2FPE A;  4TMZ A;  3UF4 A;  3DB4 A;  5IYR A;  3OYB A;  1TTH B;  3ES9 A;  3OYN A;  2VKN A;  3G71 Q;  1KIK A; 
#chains in the Genus database with same CATH homology
 1PM3 A;  3A1P A;  2F1L A;  3HTR A;  3H9N A;  2QGG A;  2DYI A;  2DOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...