3H9NA

Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target ir66.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation factor rimM
publication title Northeast Structural Genomics Consortium Target IR66
rcsb
source organism Haemophilus influenzae
molecule tags Ribosomal protein
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3h9nA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3h9nA01
2DOGA 2F1LA 2DYIA 1PM3A 3H9NA 3A1PA 2QGGA 3HTRA
chains in the Genus database with same CATH superfamily
4H9GA 5TRDA 1W87A 4M78G 3CCMB 2OTLT 2V7VA 3PNWC 1W4SA 2DIQA 1H3ZA 4C8QB 1RL2A 4PC6A 1WOSA 3QIIA 1H85A 4M7DC 2RPNA 4R56A 4OB0B 2MWPA 3OPOA 3NTHA 3QFCA 3PIOA 4HT8A 4RTYA 2WZPP 2LZ6B 3OYYA 4PJJA 3D26A 5IT9E 2RJCA 3FJ5A 1ZSZC 3OYKA 1W1FA 5FRMA 4KT0E 2RC5A 1JRIA 1S72B 4WQMA 3X28B 4YEJA 2IVWA 4L59A 2HMAA 1E43A 4ZCIA 2YXYA 4RD3A 4C92B 2CP3A 3O5ZA 2BE7D 4ZV4A 1YN8A 1M90U 3JCMQ 4HCCA 3PFSA 3AGPA 1PJ5A 3VS5A 2RI3A 1YITQ 2X4XA 2F2WA 4OOVA 4F14A 1E79A 4TMTA 2C4TA 3CCJA 2X3XD 1SKYB 4E7LA 4P12A 3GVLA 2A0FB 4M78A 4F16A 2D9TA 3CCET 4JLGA 2BVNA 1ABOA 2YUNA 1WHKA 2JTEA 3CCUT 4KULA 5GAMe 3ZUGA 2FO0A 2VKNA 3AVVA 3EFRA 5FU6C 2K7AA 4JJNK 3C12A 2DLPA 4HCZA 5LJ5e 2KROA 3WBKA 1D1BA 4II2A 3SD4A 1VQ4Q 4ATOA 2WJVA 1AWJA 2BZ8A 1BIAA 3CC4A 2FZCB 2LJ0A 3ZC3A 2D8HA 2DETA 2K5IA 2OAWA 1RLPC 3CMAQ 1WA7A 2CREA 4M78E 4B44A 5A0GA 1JU5C 4UC4A 2DYIA 2JN0A 2P3MA 4OMFB 5J26A 1E1RA 2K3YA 4QQDA 4FK8A 1MNEA 3HKSA 2RO0A 1OV3A 2OTJQ 1VYUA 1S72A 4B43A 3BNWA 2ED0A 3NTIA 4DA4A 3AVXA 2ZZQA 4QQGA 1H8KA 1IB8A 2I2LA 3RUXA 3J80E 5KYNA 2V1QA 4XOTA 2A08A 2V8KA 4JS5A 1YJWQ 1AWXA 5CVIA 4C8QE 4II1A 3AGQA 4NS5A 3GBQA 1BCMA 4LDVA 2XOKA 3T51B 4LDXA 3H8ZA 5FA6A 1QX4A 4M7AC 1G8XA 2A37A 5FLXE 1LJOA 5C0MA 2AKLA 2KRMA 3AVTA 2NUPB 4J6YA 4LNPA 2IIMA 4JZ3A 3QYHB 1M90R 3R6KA 4P9SA 4JRIA 4C5HA 3CXCS 1QVGA 3H94A 1NPRA 2HDNB 2C77A 2VXFA 2K57A 5CKBA 3CMEQ 1MABA 3ASKA 2X53S 3EGXA 2KBTA 1YJNT 2L3QA 2A28A 1NPPA 3A3BA 4C0FA 5D6YA 3FJOA 2KR3A 1CKAA 5CK9A 3P8HA 1YITA 1AMOA 3QBYA 3CXCA 3S6WA 4RDJA 2D0NA 1YWOA 3NHNA 2E5QA 2GTOA 3VUZA 3HFNA 2DRMA 5GV7A 2JT4A 3RESA 4WF2A 4ZN1A 2XK0A 1VQ9T 3X20B 5GANh 2DXTA 3JRZA 2RQWA 2PUKB 5J39A 1PC0A 4BI3A 4Y91A 2QYZA 1JJ2P 4HCBA 1WJSA 4KH1B 3OW2A 1M8MA 5I22A 2YWFA 3BY2A 2WSEE 3EFSA 1TSFA 1M1KU 4YXWA 4FWTA 4X9DA 2KT8A 1BYMA 5GJVB 3SWNB 1KHCA 2DX1A 4L5GA 4J9DA 1MV3A 4G5GA 2K2VA 3W2HA 1AT1B 2X6XA 2ZTGA 3CMAA 5KH6A 3EH2A 3Q3AA 2RN8A 1TTTA 3TVTA 3CC7T 2OTJA 4NCNA 1YJNB 2NUTB 1VQKT 1N07A 4XLCA 3P27A 4J9HA 2EKHA 2F2XA 3WXMA 4JJBA 5FW9A 1YJWA 3R6JA 2E1BA 3I56T 3LO8A 1YJ9Q 3GIBA 4G7XA 1R5NA 3BFMA 3AVYA 2V7UA 4XLFA 2LQNA 3TSZA 4G1VA 4Z1MA 3PTAA 4P5NA 2ED1A 5F4MA 2L3SA 2QA4B 1UGRB 2DIEA 3A8MB 3REBB 1PCXA 1YFNA 1ZHIA 1W0JA 1VQ5B 1BMFA 1H42A 4C8QC 3CMEA 1WHHA 3H0FA 4BPRA 3Q6QA 1JA1A 3M0QA 2RJEA 4KUDK 4HE6A 1R0CB 2QEXQ 2JOYA 1XFOA 1V76A 1RAHB 1O9SA 3RIRA 1GL5A 1GJRA 5BSXA 3BQJA 3VS4A 3E19A 2JXBA 2MYSA 1VQPT 3JB9F 5DN6A 3HP9A 4XLEA 3SWNA 3PVDA 1V5VA 1OGIA 3EFOA 4Z4TA 5M9OA 3SLNA 1Q81D 1TG0A 3CC7B 2XNCA 4C92C 1M1KR 4MZPA 4WZLA 2X3WD 1PRLC 4RCBA 4PC2A 5F4JA 3FC3A 1G7SA 5A88A 1AVZC 4XTVA 4C0DB 1RACB 5GJWB 1D1AA 4JS4A 2D6FA 3EG3A 4OF1A 4RD1A 2RA2A 3THKA 1Q82D 2ZXIA 3U6BA 5D7UA 4DBHA 4RTWA 1RAAB 1X2KA 2YWHA 5GAMh 2KQWA 2JVVA 3W5VA 2DJQA 3M0TA 3PVQA 4XU1A 4B9XA 3G6EQ 2ZXHA 1S4MA 2MCNA 5LJ5h 2W10A 1AWWA 1BX0A 4Y9RA 3BDLA 5I11A 4PAAA 2ZL7A 1U06A 1KC8U 1RQRA 4HCKA 1B34B 2BSAA 4XR6A 1CSKA 1VUBA 3ZBTA 5FWCA 1N9SA 4FW2A 4RKUE 2X0KA 2J6KA 3H9NA 2BPOA 1HXDA 2X51A 2O9VA 1G3YA 5HZAA 3M53A 4DBFA 4EMKA 2EPDA 3EG2A 2EGCA 5AN9A 1OU8A 1VQOT 4M7DF 2EWNA 2C4UA 1IRXA 1VQPB 3V7RA 1WXTA 2EGEA 5HK0A 2OI3A 1R77A 5GAN4 2ZPHB 2R58A 1VQ6T 1SM4A 5DSZA 3L1AA 2M0YA 3FPPA 2E1HA 1VQLB 3LQEA 2XDPA 1FXXA 3I55T 2QGGA 2ZPIB 4ZGQB 3BH4A 4N4IA 2C5HA 5C6SA 1XNIA 2CGHA 4E6RA 2ZITA 4P6YA 2QEXA 4FXUA 3MP1A 3VO2A 3L2WA 2E3IA 2CBXA 2YWEA 1W6XA 1QCOA 1PKSA 1YCSB 2ROTA 4RMOA 1N0VC 5GAN3 1IREB 2SEMA 5A0LA 4M77B 4G6IA 3JB9D 1VQNB 1PD1A 4XD7A 3WYAA 4ZN3A 1T3LA 4OGCA 4A4HA 1N08A 3KXTA 3L2QA 2C0TA 3L2RA 3CB4A 4J7IA 1VQOB 2DFUA 4ZCLA 1KC8R 3GNGA 1YIJT 4FW1A 1OI1A 4B3FX 3FPKA 5KCHA 5GAMj 2RI5A 2EQIA 3G6EA 2BN4A 4AG1C 2DL4A 3W5HA 4Y28E 2GK6A 5LJ5j 2LP5A 3U23A 1M5Q1 4QVJA 3NGPA 3EG1A 3I55B 4UZEA 2XNJA 3OYFA 3WY9A 4F04B 4F7DA 3CCSB 4A53A 2JS0A 5GAMf 3OYJA 2D8JA 1ZUUA 2PVOB 3FJPA 1X6GA 1K73U 1W34A 1VQLA 4OPOA 4OB3B 5LJ5f 3BC9A 3OEEA 2RQTA 1DG1G 2MK5A 2Y4YA 3SWNC 2O4XA 4R55A 3CCQQ 3OZUA 4TMZA 2P0PA 1BBZA 1PSEA 1UUEA 2ESWA 5IXFA 1NE8A 3JCMe 3OAAA 2WACA 1QGAA 2C78A 2DBMA 2O88A 2DBKA 3A8GB 1QCNA 4JJCA 2CZ0B 1YI2T 4M7AF 2BF4A 1VYTA 5KE3A 3MCAA 4Z4YA 3J81k 2WYRA 1KJZA 5KW9A 1ZLMA 2B8AA 4M7DG 3H0IA 3OYIA 3L42A 3RR6A 3ZBUA 3G4SQ 4M2LA 1E3ZA 1LCKA 2R5MA 3QWYA 1WQ7A 1WDXA 2CDTA 1VQNA 5A89A 2YLBA 2DM1A 2CP6A 3CCRB 1VQ8B 2P4TA 4FYXB 2AKKA 1NLPC 3I35A 3X26B 3OY9A 1N06A 2LNHB 1RI0A 3M9QA 4YTLA 1RADB 2KE9A 1W2BP 2WJYA 1W2BB 3EG9B 4P2NA 3CC2B 1Q9SA 3QZ9B 1COWA 4HIZA 3G1JA 3A8IA 1NB0A 2JS2A 5KYUB 3OYEA 2BZYA 4PJNA 2MAMA 3RBBB 3HL8A 4MDWA 5IHIA 4TMVA 3A8OB 4XQ3A 1QP3A 2DL7A 1T0JA 1M90D 1V0EA 3A35A 1U2RA 4OP7A 2QG9B 2LCLA 4C5GA 4YAUA 4FSSA 2VUBA 1MMNA 1WIEA 1YI2B 4M7DA 1N8RC 1K73R 4F17A 3VMFA 2YRDA 1OPKA 2E1RA 5LL6S 4DK1A 2GTJA 3DB3A 1NYGA 1WU8A 2PLFA 2OAUA 3G71B 4EIKA 1U1SA 4IUQA 1ZSZA 3GVKA 1UD6A 4M53A 4BI8B 1W2BS 1PJ7A 2DEQA 4MMKA 3CCQA 5HKKA 1Q86C 3EAEA 1K9MC 5D6WA 2VASA 1H3HA 1M2VB 4M7DE 2QMUA 4XORA 3VS2A 2F5KA 3J7AF 5H59A 2EIFA 1ZBXA 1QFZA 1MRZA 4X0CA 3JQPA 2OYNA 3L2ZA 1QVPA 1PKVA 1ZUNB 1K1ZA 3CCVQ 4M7AD 3EG9A 3ASPA 4XONA 4KH0B 3DLLA 3CC2A 3G4SA 3BDUA 4M7AG 2RHZA 2VBSA 4C8QF 4O6JA 3VR6A 1C1AA 2VVKA 4LBVA 3NTKA 2F1MA 2XU8A 1U3OA 2FZGB 2BE9B 1GCPA 3NMZC 2CSQA 1Q82R 1D09B 4KKTA 3M4YA 5GAOq 2O9SA 3M5AA 1VQ7T 1FNCA 5BSYA 3OZWA 1MHNA 1VYVA 7AT1B 2I1LA 1ZM2A 4QUZA 1EFNA 4C92F 1WNLA 2EW3A 4YAWA 1ZUYA 4PABA 4AMCA 1IO6A 1X6OA 3M54A 3S3OA 3EG0A 5GANe 4OVAA 3A8KA 2ZZFA 2HL3A 3EGDB 3ME9A 1TLLA 6AT1B 3T53B 2V7QA 5L23A 2J6OA 3JB9I 4M77C 2ZPFB 3OSSC 4M7AA 5AYFA 1KTVA 1RAIB 3OW7A 1KK2A 5A8AA 1R8OB 2M0OA 3CD6T 4P26A 4IUTA 3MO8A 1Q7YU 2CH4A 2ECZA 1OZ2A 2AIRB 2CT3A 4RG2A 4CI0C 2CP2A 5DLOA 3CCMQ 2JIZA 1EFRA 2Q6OA 4M75B 3CESA 2ZCFB 2ZL6A 4OP0A 3GP8A 3JCMV 1M1KD 2R9VA 1KG1A 3CC4Q 1SRLA 2AZSA 1PRMC 1VQ7B 3U6KA 1FYNA 2H8HA 1Q7YC 4HA8A 5CCAA 4JPBW 2C0OA 3JCMh 4M78D 4HVWA 4DOWA 4ZGJB 1KK1A 1ZM3A 1S72Q 2K4YA 3CCVA 1YHQB 1RAFB 1QFJA 2RK1A 2E5KA 5CKEA 3V8JA 3OYNA 1KFZA 4Z4ZA 5KCOA 1JB0E 1JXMA 2ZPBB 4PJLA 2PVDB 1LPLA 2W0ZA 2BM1A 2RQVA 4N4HA 3ZFJA 4C8QD 3ZBDA 2XIDA 1BCOA 3E9FA 3MJXA 4J83A 2ZZEA 2H3EB 4C8QG 4FT4A 2FRYA 2OBSA 2RI2A 1RLQC 2J7IA 4E7JA 2ZAEA 2E70A 1K0SA 3CD6B 1FMWA 4R0KA 4P25A 1YITT 1H92A 5GAN8 1RQPA 2DL5A 1WHMA 4NL2A 4A4GA 9ATCB 3OYDA 2ENMA 3OYGA 1UGPB 1KQSS 2DNUA 2OK8A 2XDBA 3QWXX 4DBRA 1FDRA 2K79A 2W6JA 1N9RA 1WFWA 2RHIA 5LMZA 3CRZA 2HSPA 4ANJA 4TMXA 4C92G 1T0HA 3QJ6A 8AT1B 4C5EA 2C2WA 2X8KA 3ULRB 3MMPA 2VC8A 2Z0WA 2Y90A 4EMGA 3UATA 1KK7A 4A4KA 2XZLA 2WSFE 2CF4A 2X35A 4RDKA 3VUBA 1KQSA 2OTLB 4XQFA 3RKYA 3TSWA 4WZEA 1X01A 1VQ4T 1QUFA 4XAXB 2FPFA 3GF5A 5FNZA 1QVGP 1OB5A 2L89A 3OJWA 1ZM4A 3CCMA 3FRNA 1YHQA 3LH0A 4C8QA 1KQ1A 1K0XA 1M3CA 1WXUA 4FT2A 4LDUA 1I5OB 1UECA 3SEJA 3A8JA 3V8KA 2M02A 4J9BA 1H8EA 1DARA 4E7ZA 1WOPA 2X4YA 2AT1B 3SFMA 2K3BA 1FMVA 2PVGB 3JCMW 4M1KA 1WJQA 1KC8D 4KKSA 2DPPB 2SRCA 2CUDA 3CEYA 1D3BB 1RAGB 4XTYA 4C92A 3A3GA 3EHRA 3M0UA 4LN2A 1GXIE 4R71A 4QVDA 3T9NA 5GAN6 3JCMf 1IB0A 1PNJA 4TMWA 1PKTA 3LVBA 1GFDA 4A4FA 3CCEB 3HAGA 5FRNA 1OX8A 3LQ6A 4KKUA 2DD5A 4PC7A 1NBMA 1I07A 1MMAA 3O8VA 3CCUB 3JCMb 4NNJA 1Y57A 3CQTA 3PGGA 2VJIA 4LUEA 3OS5A 1VQMT 4C92E 2OTLA 5LJ3e 4XK8E 4HT9A 1NEBA 4MYUA 4J9IA 4FYWB 1Y07A 4ZGEB 1G7RA 3PVLA 2FVGA 3SHWA 4KGXB 2HQXA 3VNVA 3SDZA 3E2UA 3CPWP 4NBSA 2EJGA 2DE0X 1N27A 5CQYA 3RKWA 3JCMX 1JEGA 2VYTA 1VIEA 2XICA 2K3XA 5KYXB 2AZVA 1BX1A 1JJ2B 2DXUA 1G3TA 2B5OA 3GOXA 1WGSA 4JUVA 1YWPA 1M4ZA 4QVAA 1QH0A 1D3BA 3HRTA 2DEUA 4XTXA 2GBQA 2XZPA 1ZUKA 2CRVA 5FO0A 4WZTA 3ZZ0A 2NUPA 5FU7B 2XZOA 1WHJA 2JJ1A 3LX7A 4E7KA 2QA4Q 1VQMB 3QXEB 5GAN2 1YJ9T 3CBMA 3FDRA 2E3HA 4M75C 3CCUA 1VQ5Q 1OU9A 2LX7A 1K73D 2GQVA 1ZQ1A 2RD1A 4LBZA 1CNFA 5A2QE 5I2MA 3RY8A 2D3LA 3KL9A 3QDFA 1SEMA 2RB6A 3QZ5B 1HZEA 2CP5A 2HBPA 2K6DA 3Q38A 3I9QA 2HKNA 5TY0A 2LCCA 1VQ9B 1WJRA 1IHWA 1JJ2S 2LT4A 2CZ7B 3M0SA 4D6WA 2RF0A 4DNRB 3CC7Q 2GQIA 1UD4A 4JMQA 3QHSA 1M3BA 5CAIA 2DXCA 1EIFA 3W2IA 1FX0A 2JN9A 1JJ2A 2D74A 1QCFA 2E6NA 4JJDA 2CYZB 2E6ZA 3VJPA 4BE0A 1KMHA 1BI2A 3ASTA 1UD2A 1WHLA 2X6YA 3QE2A 3OE7A 5KNLA 1B07A 2KSSA 1YX2A 4X05A 5GANj 1VQKB 2F43A 1KZLA 4M77F 2JMAA 1QMCA 2CW5A 1FWZA 2QN6A 3OBYA 2FPDA 3G05A 4GBQA 1NG2A 3EH1A 3LH5A 1YJNA 2MWOA 4OMQA 2NUTA 3OJXA 4XTZA 2FYKA 3I56B 3VNUA 3FB9A 1M27C 2DCUA 5GANd 1ZA1B 5GANf 5CO7A 2QDYB 4QKUA 3VO1A 5AT1B 2YDLA 4JRPA 3CP8A 2DYBA 2HLDA 5TV2A 3OS0A 3OQ5A 3ZZTA 5J3BA 1UJ0A 2M5SA 3TEEA 2RJDA 2L0AA 1VQPQ 2P0QA 1IHMA 3OYBA 1PD0A 3SB2A 5GAOl 3OA6A 1C6VX 3P26A 1EFCA 2AK5A 2QA4A 3B8HA 2JZ2A 4PFOA 1T3SA 5GMKl 8ATCB 1MMGA 4QVCA 1OZ3A 2E65A 1OPLA 1VQLQ 4Z89A 2LX9A 1VQ5A 3PUNA 3GLXA 3OSVA 1E63A 4X7FA 1MNDA 1SHFA 5EMNA 4WTOB 3E20A 2FG0A 4C0GA 4ASUA 2BKDN 1UD5A 2XNDA 2KXDA 5EC7A 5EG2A 1YLOA 2R6HA 1U5SA 3QSYA 3OYAA 2NPFA 2EYXA 1M30A 2KYBA 5HZBA 1XTDA 4ELZC 4CC3A 2QASA 2FL7A 1TTHB 3A1PA 3TCJA 3MEAA 3CC7A 2ABLA 2ZPEB 1K8AU 2PNIA 1TU0B 4MDXA 3CPFA 1VQNQ 4B47A 1I4K1 4C5IA 4HKEA 2YUPA 1D1CA 3META 2MPXC 2YRCA 4RPDA 2L2PA 2YRVA 3QKJA 3I56A 3GQBA 1VQOQ 2NYSA 5LJ3h 5IXBA 3OYCA 4Z88A 5F4OA 1K8AC 2PZ1A 2EYZA 1WX6A 2E64A 1WSRA 1P92A 4RM0A 1T5EA 3PMIA 1LNXA 1QLYA 2RJFA 4RCZA 4M4ZA 3I55Q 2X85A 1IJFA 1B34A 1I8DA 3JB9H 3CCSQ 1OGJA 3MP6A 2EQJA 1QVFP 3M4GA 4M77G 1QVFB 3UF4A 3ASRA 4II3A 1KQ2A 3VYHB 4PNOA 1VQ6B 2DY1A 3X24B 2RC6A 2CP7A 1VQPA 4MMLA 2EFIA 2KT1A 4ZNXA 5GAMd 2K2MA 4QW2A 2DK3A 4YELA 2JMCA 1TH7A 2X6WA 4P22A 5LJ5d 4DQKA 3CBOA 4J9EA 2X3UA 4TN1A 1Q7YD 4Z8AA 2GQFA 3GPLA 1D0XA 2W6IA 4XM3A 2A36A 1F60A 1JNYA 4RJLA 3CCRQ 2DKGA 1VQ8Q 3V8LA 2MI6A 1M2OA 1K8AR 2LNVA 4XNFA 4LDYA 1WYXA 5KYWB 4PJOB 5FU7C 3HSBA 2RHXA 4M7DD 2X4WA 1SKUB 2OX7A 2VV5A 1U1TA 2DL3A 4BE2A 4HE5A 2QAZA 3CC2Q 1MGQA 2EKOA 1TOVA 1I8FA 1JA0A 4M77A 2R57A 1X27A 2VBVA 3KFVA 4IUUA 1KD1U 2VJJA 1YIJB 2JW4A 1GRIA 2VZLA 2XI9A 2WPDA 4ACAA 1PJ6A 4RD2A 1XQHA 2BUDA 1VQOA 1LVKA 4F7UB 2WR8A 4AVZA 4N0AC 5LJ3j 4LUDA 4E2FB 4P3IA 4BY6B 5GAN5 4XTWA 1BKBA 1YI2Q 4RPBA 5CDFA 1BQEA 1KD1C 4OMMA 3H0HA 3CTAA 4XKVA 4AFZC 3SLDA 3Q39A 4CC7A 4M77E 1ZA2B 4F7UG 1N8RU 3I55A 4PLLA 3PENA 5LJ3f 1TWBA 4J9CA 2PUOB 1UFFA 2KK4A 4CQJA 3CCSA 2CP0A 2KMTA 3G71Q 2Q6IA 4YALA 2Y4XA 4HXJA 4ZGDB 3JU4A 4RCYA 4RD0A 3M0PA 4FYVB 3UPUA 4OOXA 2LTOA 4YAOA 2JJ9A 3W2GA 3KUFA 4XLHA 4DQLA 1E62A 1VHEA 4YHBA 4DEXA 4J8OA 3LWIA 3P8BB 1Q86U 2EJFA 5IAYA 5CKDA 1K9MU 4C0DC 2PE3A 2K9GA 1NJIU 2RQUA 5FO1A 1Q81C 1A0NB 3CCLT 2FHDA 4LD6A 1S1NA 5IYQA 1PHTA 2E4HA 1GVHA 4X07A 4ROXA 1ZSGA 4YAFA 4M75F 1H8HA 2GFUA 1NB9A 1U8RA 3QPHA 1Y0RA 3CCRA 3E1YE 1VQ8A 1T6YA 2YLCA 2K5FA 1NJIC 4LXCA 3PA2A 3ASQA 3NPFA 1SKQA 4Q5WA 2HKQB 2LZJA 1KD1R 3NE5B 4PJOE 1WQWA 4F7UA 1B2RA 4P1VA 5H5JA 4DNTB 1KJWA 5B6IA 1MMDA 1W2BA 1QGZA 1I0CA 2JNGA 2JTMA 3IQLA 2VBTA 4Z4SA 2GCXA 1ACMB 2HQEA 4L8JA 2PTKA 4XU2A 5KYUA 1AZEA 2X4JA 4J6WA 2V8IA 1V29B 4G7WA 4WZKA 3VS0A 2LQWA 2LMJA 1NEGA 2PU9B 4AG2C 2EFGA 1N8RR 1SHGA 1M8VA 4JRQA 2HCJB 4BI4A 4UAJA 4F7UE 2WSCE 3C0CA 1UMKA 2KI7A 4ME7A 1YI2A 4XMYA 4FN5A 2AHJB 3U2QA 2CH4W 2DL8A 4EH1A 3CCLB 3SJZA 4Z02A 3UDCA 4TVRA 4C43A 1WI7A 4Z4VA 1FNMA 3UWNA 2M9UA 3CCJT 3G71A 2CS7A 3WNBA 2D3NA 1Q86R 1GAQA 1UGSB 5GMKe 4OPVA 1SPKA 1K9MR 4XL9A 5FL7A 4DK0A 1KK0A 2DOGA 4Y9UA 2GJPA 2XDDA 2KAFA 4J9GA 3TQ7P 3J81E 1BIBA 3VS6A 1P4MA 5DLQE 1M2VA 1ZM9A 2M1HA 4ZGNB 2RHYA 3ISXA 5L46A 1WPYA 1DJ7B 1VQ7Q 1WORA 5KSWB 1QG0A 2VXEA 1GFCA 2FPEA 3CC4T 2K5LA 4P3YA 3BE3A 1YHQQ 4RUGA 4DEYA 1K9AA 4JZ4A 1AOJA 5GAOr 2BGJA 3W2FA 2VYQA 2DAQA 1J3TA 2A3LA 5I21A 4LBYA 3V76A 3AVWA 1D8TA 1TVCA 2QE7A 1K28D 3A98A 3VU3C 1S72T 5IYNA 1XB2A 2ZL5A 4M75D 2QQBA 4RTZA 2VNHA 4M75G 4PC3A 2COZA 4X7CA 3RMQA 3REAB 1M1GA 1D0YA 2RH2A 2KGTA 5CQXA 4MYTA 1GAWA 2HCKA 1UB4A 2V7WA 4C0ZA 3CCJB 3CD6Q 1FMKA 4IUVA 2QTLA 2R5AA 1D2EA 3WQZA 3PIPA 3LWHA 1Y71A 1QKXA 4M78B 1EP2B 2PQWA 2HDAA 2CUBA 4N3GA 3PT9A 4PJOC 1Y0MA 1RABB 1SSFA 1ZX6A 3INZA 4DOVA 1BI3A 4XN3A 5TR9A 1DDGA 1SG5A 1IHVA 1M3AA 3EGDA 4IUPA 4N4GA 1QUEA 1TS9A 1T6XA 3I1FA 1C0MA 3CC4B 4Z4RA 2LDMA 4X06A 2OTLQ 4O5VA 4OMLA 1WP6A 5HKCA 3C95A 2F5TX 1DDIA 2NV4A 1N6AA 3I5SA 5DM7R 4C92D 4EPCA 2F1LA 3F70A 1KHIA 5KE2A 4M75A 4AT1B 3RERA 1B23P 4PL6A 1TUCA 4BY6C 4QV2A 1Z9ZA 1F20A 4KGZB 1Q7YR 2QTXA 3OYHA 1X2QA 4K11A 2Q6KA 2DJZA 3ZIAA 4QQ6A 3NFCA 1I5LA 4IURA 3GIRA 3MPUB 3MEVA 1VQ7A 2DVJA 1QW1A 2V7XA 3UA6A 5IYWA 5ECAA 2PMDA 4PK4A 2RQRA 4J7FA 3ZL7C 2CKKA 2DZ9A 1J9ZA 4ACBA 3H41A 3JQQA 3OZVA 2OBTA 1QVGB 1UTIA 3CMAT 1ABQA 1BI0A 2QK0A 4FSXA 4FU6A 4M75E 4CC2A 3QO3A 1M90C 1LOJA 4KUIA 1YBYA 4A4EA 3JCMP 1OX9A 3EGXB 1GBRA 1EP1B 4IKFA 2OTJT 2CC2A 4HVVA 3HHTB 2DRKA 4OPSA 2COWA 3CXCP 4V2SA 1YITB 1YJWT 1I18A 3CCEQ 3CXCB 1I1JA 2QQRA 3B82A 2RNAA 3LYIA 4XU0A 3CD6A 3CCUQ 4CC4B 2E12A 4ESRA 5IYRA 3AHUA 4OGEA 2B7BA 1XJWB 3JCMd 2F4NA 1EXMA 3VRYA 1QWFA 3TU4K 2DMOA 4ZTFA 2NUZA 3OW2P 3A5ZB 2QI2A 2L3RA 2HSEB 3JAME 4IW3B 3CMET 4PKCC 2RMOA 3OW2B 2DZCA 1MUZA 2XGJA 1QVGS 3G7ZA 3PUMA 2LJ1A 4CRIA 2GREA 5FWBA 1NRKA 1VQ4B 4UZFA 2LJ3A 3X25B 2LQKA 1VLOA 2JDIA 2IPOB 3OS1A 1EWYA 4NOYA 2JM9A 1K8AD 3CMAB 4OB2B 4D8DA 5GAOp 2G3RA 2EBPA 1F1BB 2KDSA 1OB0A 4E7SA 2CK3A 1GBQA 4BACA 1JB9A 2KRNA 3MHPA 4N3NA 2OTJB 1PG5B 2GJRA 4AF7A 4OMPA 3A8HB 3M58A 2DO3A 4PFZA 5GMKh 1V0FA 3WXMB 1JBMA 1YJWB 4J5YA 2YWWA 2BGIA 1BJKA 2E10A 3CPWB 1H641 2FZKB 1R5OA 3JQRA 4P6VF 3ONUA 1VQMQ 1YJNQ 3LNNA 3OW2S 3ONYA 4U9UA 3FEOA 5A0DA 5E6TA 3M56A 2RHUA 3QYGB 5HXBA 1VJSA 3CMEB 3C94A 1G7CA 1EZZB 1WLPB 2QA4T 3LGLA 4OMOA 1FRQA 1YNZA 4RDLA 1Y96B 1AEYA 3OP1A 1UE9A 3OYMA 1VQ5T 1VQ9Q 1YP5A 2EQMA 3AVUA 1Q95G 3CCEA 4X1VA 3S3MA 1KK3A 3SEMA 4FCYA 3JCMg 4AFSC 2J06A 1VQ4A 2D1XA 5IYPA 2ZGWA 4FIBA 1T6ZA 3VV0A 3EFOB 2YUOA 1HA3A 1M1FA 2DTIA 3CPWS 2BTTA 2L5QA 2P0KA 1OEBA 2V1RA 1OULA 1M1KC 3BCDA 1VLYA 4XKWA 1SF9A 3FLGA 3HPWA 3MEUA 3VS3A 2BM0A 2QEXT 2KVQG 4GLKA 2JM8A 3VS1A 2PIAA 2X9HA 3LLRA 1I7PA 4FM4B 2C5BA 1VQKQ 4M78C 3LGFA 3CPWA 3PA1A 2H3JA 1UG1A 3JB9J 2EQKA 1KD1D 5KYXA 1X75C 3RNJA 4AF6A 1QKWA 4B6MA 2HAXA 3I56Q 1WHGA 4X7EA 2Z6BD 1PM3A 1QWEA 1KRHA 4LE9A 1KIKA 2EIXA 4EMKB 3OBWA 3CP2A 2FVUA 5GMKj 5I2SA 1W70A 3V7SA 3CW2A 2LQ8A 1YJ9B 5DY9A 1Y96A 4A54A 1TUGB 2LRQA 4PC1A 1HK9A 4RD4A 1HYOA 3M59A 1G7TA 5CKHA 1A8PA 1N8RD 4ORZA 4E7HA 2LT1A 3G6ET 4ELYC 1VQMA 1QP2A 3TREA 2QDLA 1R5BA 3GVJA 1MV0B 1OOTA 4JLIA 1RI9A 2EYQA 3BY7A 3JCMc 4RLZA 2GPJA 3B78A 1W35A 2B86A 1RUWA 1WXBA 1IGUA 2L8DA 1OQKA 2M16A 2QGFB 1IZ6A 2YSQA 2I0NA 2P4RA 1VQLT 1VOMA 2QEXB 3Q6RA 1VQ9A 4M4SA 1Q86D 1K9MD 2OJ2A 4A63B 4GLMA 4N0AA 5L8RE 1NJID 2VNIA 1EFTA 1N5ZA 2DXBA 1GO2A 3SJPA 4Z4UA 4DBQA 3A8LB 3BCFA 1UJYA 2NWMA 1NM7A 1UGVA 2EAYA 2FEIA 2MOXA 3QFTA 5GV8A 3LW5E 2C06A 1YCYA 2VWFA 4PLIA 1RAEB 1K76A 2D9RA 2ZBVA 2KYMA 4X7DA 3HFOA 1E1QA 3QUIA 4RTXA 3M55A 1E3XA 2F2VA 3BW1A 2O2OA 4PJOF 4PGOA 2OBRA 2VBUA 1VQNT 4JRKA 1BPLA 5J3OA 3E1SA 4Y92A 2FX3A 3VYGA 2CT4A 3CPXA 3G6EB 3P8DA 4LDWA 4QT7A 2COYA 1Y0YA 1VQKA 1YJ9A 4DQ2A 1EP3B 1XOVA 1KC8C 4EDUA 3MHXA 4Y7CA 1OYXA 1WDTA 3QJYA 4ZCMA 2DA9A 2VGNA 2DIGA 4RTVA 3V7CA 3OEHA 1E64A 4F7UF 3EGUA 2XD0A 2ZBUA 3FIFA 5FIUA 1UDLA 1X43A 3GNFB 2WSSA 1SSHA 3FKSA 1VQ6Q 2QQAA 2CNDA 2XHCA 2KRSA 2BV3A 4LBWA 1PSFA 1E6HA 2O4XB 3CCST 1XQBA 5GANg 3AT1B 2EYYA 4RTUA 1W9XA 3RMSA 2GK7A 4Q7JB 2HQHA 3MCAB 4GQNA 4M77D 1E6GA 1Z9QA 5GAN7 1JO8A 5KYYB 1E7OA 3DKMA 4E47A 4RG8A 2MF2A 2QTVA 4Z4WA 1TXQA 1V1CA 3VS7A 4J9FA 4J6XA 1N05A 2A7YA 1VF7A 5GMKi 3N5BB 1K4US 4OB1B 2YHTA 2YT6A 2HD0A 1NDHA 2F69A 3WVEB 2O31A 3M57A 3JB9G 1G3WA 1D0ZA 5IN1A 1M9SA 1X6BA 1ELOA 2YWGA 1Y7XA 3HRSA 3CCQT 1G5VA 2GGRA 3PE0A 2BMWA 3CCRT 1VQ8T 2ZZGA 1PWTA 2DTOA 1AHJB 2WZNA 4XU3A 1XE1A 2OK7A 2V31A 5IHNA 1JQQA 2E41A 4X9CA 4BD3A 3QFSA 1AWOA 2DD4A 2KY9A 1I81A 4MZTA 1YIJQ 1G2BA 4AC9A 4X8IA 3CC2T 3SKBA 2JTFA 4FYYB 3G4ST 2VNJA 3OOCA 1NLOC 4AFQC 4LD9K 4J0QA 3WBJA 4PFPA 2QTZA 1OHHA 2DERA 5FROA 1QVFS 4BE1A 1UHFA 5THXA 4PJOD 1WZOA 1AD5A 1FNDA 5J35A 1BU1A 4PJOG 2V4DA 4M7DB 1NZ9A 3QDRB 5IHKA 3DB4A 4ZTJA 4QVZA 3QG1A 5CKFA 1BI1A 1VHOA 1UGQB 2VB6A 1K73C 2MIOA 5KYYA 2NLUA 1WTHD 1QQJA 1ZSZB 1HD3A 1QVFA 2P84A 4BDZA 2KVOA 3WNCA 4B4DA 2B7CA 3MEWA 3OYLA 1VQ6A 3CCQB 3G71T 2ZZDA 1WSVA 2EYWA 2EJ9A 4D8KA 1B3QA 2KNBB 1AZGB 2J7KA 2V7TA 5LJ3d 3KBGA 1GCQA 4KBMB 2GF7A 3RKXA 3KEWA 3VRZA 4G1BA 4B9WA 1Q81U 4B48A 3OMGA 3G4SB 5GAMg 1GR1A 4X34A 4EMKC 2HZYA 2BIVA 2XKOC 5LJ5g 3OKXA 2JJ2A 3L2UA 1JXOA 5KYWA 1Q82U 4PJOA 3C4SA 4BUGA 2KXCA 2GFAA 2RM4A 3ER0A 1CQXA 2RK2A 2MMPA 5FU6B 4EMHA 1TUIA 1R0BG 2G6FX 3MKDA 3UT1A 1CNEA 4BDYA 4WWVA 1O75A 1WPCA 1BK2A 2DTHA 4WCIA 4B3GA 1D1NA 2HL5C 2FB7A 2XG8D 4MZMA 4TSFA 3V7AA 2QDXA 2L3PA 1UEBA 5IH2A 1YIJA 1Q82C 1G83A 3CCVT 1UD3A 2VNKA 4OOSA 3W2EA 3ZPNA 2DF6A 3URGA 3CMMA 4BB7A 5DS0A 2O01E 4TT3A 2KEAA 4TKOB 3WNDA 4IIOA 5CR2A 3WVDB 3ZZUA 2GNCA 2HBWA 1NBEB 2LVMA 2EVRA 5GAOn 3CCLQ 3QFRA 3PMTA 2V26A 2AHOA 4M0LA 4M78F 4M7AB 2EGAA 2ZTNA 3OFNA 2J6FA 3E9GA 4XTUA 4RTTA 5LJ3g 4KGVB 2CZ6B 4KRTA 3JSCA 1KSWA 3ASSA 2HNIA 2JUFA 5GAOm 3L2VA 1Q81R 4L6V5 2IG0A 5GMKm 1W0KA 4IIMA 3DLMA 2ZPGB 2VGMA 2YUQA 4NL3A 3Q1JA 2Q6LA 1G3SA 3CBPA 1ZBJA 3CCVB 1ARKA 2XMFA 1UHCA 4GY5A 1BB9A 1QGYA 3R6NA 3JCMJ 1NJIR 5D6XA 3GSIA 3OMCA 3D7SB 1IJEA 4OMNA 2LCSA 3S3NA 3T56B 4E0FA 2M51A 2QQ9A 3ES9A 1S0UA 1OB2A 4HVUA 5HK3A 2LC4A 4JDSA 1EFUA 4LC0A 3CCMT 1YHQT 4QHYA 5JBQA 3ZEHA 2FRWA 1VIFA 4FL6A 1X69A 3H6ZA 1EX4A 1QFYA 1HVXA 3MP8A 2QXFA 1WOOA 2J05A 1UD8A 4VUBA 4AFUC 2HEQA 2DVEA 1NYFA 2EQUA 3OS2A 1IXDA 4XN0A 3CCJQ 4QFMA 2DILA 4RCCA 5HCKA 5HY6A 3UA7A 1BLIA 1FNBA 4UZUA 2C0IA 5IK2A 2XEXA 4C0SA 1FX7A 2BZXA 2ROLA 3M0RA 2GJKA 1VA7A 1HSQA 1GCQC 1TUDA 2V8JA 2CSIA 3JV3A 4B3XA 3RDVA 3DDYA 3R6OA 1SRMA 3HTRA 4PJMA 4K1XA 2CZ1B 2ATCB 3I5RA 2D0QB 3W5UA 1IGQA 4RD6A 1CKBA 1N0UA 1AIPA 1FRNA 3CCLA 4E7IA 1HJDA 1KQSP 1B7TA 4XLAA 3VKIA 3QSUA 3HRUA 1KQSB 2QQSA 3EHQA 3OB9A 5CIUA 4M7AE 3BY1A 4XOPA
chains in the Genus database with same CATH topology
2DOGA 2F1LA 2DYIA 1PM3A 3H9NA 3A1PA 2QGGA 3HTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOG A;  2F1L A;  2DYI A;  1PM3 A;  3H9N A;  3A1P A;  2QGG A;  3HTR A; 
#chains in the Genus database with same CATH topology
 4H9G A;  5TRD A;  1W87 A;  4M78 G;  3CCM B;  2OTL T;  2V7V A;  3PNW C;  1W4S A;  2DIQ A;  1H3Z A;  4C8Q B;  1RL2 A;  4PC6 A;  1WOS A;  3QII A;  1H85 A;  4M7D C;  2RPN A;  4R56 A;  4OB0 B;  2MWP A;  3OPO A;  3NTH A;  3QFC A;  3PIO A;  4HT8 A;  4RTY A;  2WZP P;  2LZ6 B;  3OYY A;  4PJJ A;  3D26 A;  5IT9 E;  2RJC A;  3FJ5 A;  1ZSZ C;  3OYK A;  1W1F A;  5FRM A;  4KT0 E;  2RC5 A;  1JRI A;  1S72 B;  4WQM A;  3X28 B;  4YEJ A;  2IVW A;  4L59 A;  2HMA A;  1E43 A;  4ZCI A;  2YXY A;  4RD3 A;  4C92 B;  2CP3 A;  3O5Z A;  2BE7 D;  4ZV4 A;  1YN8 A;  1M90 U;  3JCM Q;  4HCC A;  3PFS A;  3AGP A;  1PJ5 A;  3VS5 A;  2RI3 A;  1YIT Q;  2X4X A;  2F2W A;  4OOV A;  4F14 A;  1E79 A;  4TMT A;  2C4T A;  3CCJ A;  2X3X D;  1SKY B;  4E7L A;  4P12 A;  3GVL A;  2A0F B;  4M78 A;  4F16 A;  2D9T A;  3CCE T;  4JLG A;  2BVN A;  1ABO A;  2YUN A;  1WHK A;  2JTE A;  3CCU T;  4KUL A;  5GAM e;  3ZUG A;  2FO0 A;  2VKN A;  3AVV A;  3EFR A;  5FU6 C;  2K7A A;  4JJN K;  3C12 A;  2DLP A;  4HCZ A;  5LJ5 e;  2KRO A;  3WBK A;  1D1B A;  4II2 A;  3SD4 A;  1VQ4 Q;  4ATO A;  2WJV A;  1AWJ A;  2BZ8 A;  1BIA A;  3CC4 A;  2FZC B;  2LJ0 A;  3ZC3 A;  2D8H A;  2DET A;  2K5I A;  2OAW A;  1RLP C;  3CMA Q;  1WA7 A;  2CRE A;  4M78 E;  4B44 A;  5A0G A;  1JU5 C;  4UC4 A;  2DYI A;  2JN0 A;  2P3M A;  4OMF B;  5J26 A;  1E1R A;  2K3Y A;  4QQD A;  4FK8 A;  1MNE A;  3HKS A;  2RO0 A;  1OV3 A;  2OTJ Q;  1VYU A;  1S72 A;  4B43 A;  3BNW A;  2ED0 A;  3NTI A;  4DA4 A;  3AVX A;  2ZZQ A;  4QQG A;  1H8K A;  1IB8 A;  2I2L A;  3RUX A;  3J80 E;  5KYN A;  2V1Q A;  4XOT A;  2A08 A;  2V8K A;  4JS5 A;  1YJW Q;  1AWX A;  5CVI A;  4C8Q E;  4II1 A;  3AGQ A;  4NS5 A;  3GBQ A;  1BCM A;  4LDV A;  2XOK A;  3T51 B;  4LDX A;  3H8Z A;  5FA6 A;  1QX4 A;  4M7A C;  1G8X A;  2A37 A;  5FLX E;  1LJO A;  5C0M A;  2AKL A;  2KRM A;  3AVT A;  2NUP B;  4J6Y A;  4LNP A;  2IIM A;  4JZ3 A;  3QYH B;  1M90 R;  3R6K A;  4P9S A;  4JRI A;  4C5H A;  3CXC S;  1QVG A;  3H94 A;  1NPR A;  2HDN B;  2C77 A;  2VXF A;  2K57 A;  5CKB A;  3CME Q;  1MAB A;  3ASK A;  2X53 S;  3EGX A;  2KBT A;  1YJN T;  2L3Q A;  2A28 A;  1NPP A;  3A3B A;  4C0F A;  5D6Y A;  3FJO A;  2KR3 A;  1CKA A;  5CK9 A;  3P8H A;  1YIT A;  1AMO A;  3QBY A;  3CXC A;  3S6W A;  4RDJ A;  2D0N A;  1YWO A;  3NHN A;  2E5Q A;  2GTO A;  3VUZ A;  3HFN A;  2DRM A;  5GV7 A;  2JT4 A;  3RES A;  4WF2 A;  4ZN1 A;  2XK0 A;  1VQ9 T;  3X20 B;  5GAN h;  2DXT A;  3JRZ A;  2RQW A;  2PUK B;  5J39 A;  1PC0 A;  4BI3 A;  4Y91 A;  2QYZ A;  1JJ2 P;  4HCB A;  1WJS A;  4KH1 B;  3OW2 A;  1M8M A;  5I22 A;  2YWF A;  3BY2 A;  2WSE E;  3EFS A;  1TSF A;  1M1K U;  4YXW A;  4FWT A;  4X9D A;  2KT8 A;  1BYM A;  5GJV B;  3SWN B;  1KHC A;  2DX1 A;  4L5G A;  4J9D A;  1MV3 A;  4G5G A;  2K2V A;  3W2H A;  1AT1 B;  2X6X A;  2ZTG A;  3CMA A;  5KH6 A;  3EH2 A;  3Q3A A;  2RN8 A;  1TTT A;  3TVT A;  3CC7 T;  2OTJ A;  4NCN A;  1YJN B;  2NUT B;  1VQK T;  1N07 A;  4XLC A;  3P27 A;  4J9H A;  2EKH A;  2F2X A;  3WXM A;  4JJB A;  5FW9 A;  1YJW A;  3R6J A;  2E1B A;  3I56 T;  3LO8 A;  1YJ9 Q;  3GIB A;  4G7X A;  1R5N A;  3BFM A;  3AVY A;  2V7U A;  4XLF A;  2LQN A;  3TSZ A;  4G1V A;  4Z1M A;  3PTA A;  4P5N A;  2ED1 A;  5F4M A;  2L3S A;  2QA4 B;  1UGR B;  2DIE A;  3A8M B;  3REB B;  1PCX A;  1YFN A;  1ZHI A;  1W0J A;  1VQ5 B;  1BMF A;  1H42 A;  4C8Q C;  3CME A;  1WHH A;  3H0F A;  4BPR A;  3Q6Q A;  1JA1 A;  3M0Q A;  2RJE A;  4KUD K;  4HE6 A;  1R0C B;  2QEX Q;  2JOY A;  1XFO A;  1V76 A;  1RAH B;  1O9S A;  3RIR A;  1GL5 A;  1GJR A;  5BSX A;  3BQJ A;  3VS4 A;  3E19 A;  2JXB A;  2MYS A;  1VQP T;  3JB9 F;  5DN6 A;  3HP9 A;  4XLE A;  3SWN A;  3PVD A;  1V5V A;  1OGI A;  3EFO A;  4Z4T A;  5M9O A;  3SLN A;  1Q81 D;  1TG0 A;  3CC7 B;  2XNC A;  4C92 C;  1M1K R;  4MZP A;  4WZL A;  2X3W D;  1PRL C;  4RCB A;  4PC2 A;  5F4J A;  3FC3 A;  1G7S A;  5A88 A;  1AVZ C;  4XTV A;  4C0D B;  1RAC B;  5GJW B;  1D1A A;  4JS4 A;  2D6F A;  3EG3 A;  4OF1 A;  4RD1 A;  2RA2 A;  3THK A;  1Q82 D;  2ZXI A;  3U6B A;  5D7U A;  4DBH A;  4RTW A;  1RAA B;  1X2K A;  2YWH A;  5GAM h;  2KQW A;  2JVV A;  3W5V A;  2DJQ A;  3M0T A;  3PVQ A;  4XU1 A;  4B9X A;  3G6E Q;  2ZXH A;  1S4M A;  2MCN A;  5LJ5 h;  2W10 A;  1AWW A;  1BX0 A;  4Y9R A;  3BDL A;  5I11 A;  4PAA A;  2ZL7 A;  1U06 A;  1KC8 U;  1RQR A;  4HCK A;  1B34 B;  2BSA A;  4XR6 A;  1CSK A;  1VUB A;  3ZBT A;  5FWC A;  1N9S A;  4FW2 A;  4RKU E;  2X0K A;  2J6K A;  3H9N A;  2BPO A;  1HXD A;  2X51 A;  2O9V A;  1G3Y A;  5HZA A;  3M53 A;  4DBF A;  4EMK A;  2EPD A;  3EG2 A;  2EGC A;  5AN9 A;  1OU8 A;  1VQO T;  4M7D F;  2EWN A;  2C4U A;  1IRX A;  1VQP B;  3V7R A;  1WXT A;  2EGE A;  5HK0 A;  2OI3 A;  1R77 A;  5GAN 4;  2ZPH B;  2R58 A;  1VQ6 T;  1SM4 A;  5DSZ A;  3L1A A;  2M0Y A;  3FPP A;  2E1H A;  1VQL B;  3LQE A;  2XDP A;  1FXX A;  3I55 T;  2QGG A;  2ZPI B;  4ZGQ B;  3BH4 A;  4N4I A;  2C5H A;  5C6S A;  1XNI A;  2CGH A;  4E6R A;  2ZIT A;  4P6Y A;  2QEX A;  4FXU A;  3MP1 A;  3VO2 A;  3L2W A;  2E3I A;  2CBX A;  2YWE A;  1W6X A;  1QCO A;  1PKS A;  1YCS B;  2ROT A;  4RMO A;  1N0V C;  5GAN 3;  1IRE B;  2SEM A;  5A0L A;  4M77 B;  4G6I A;  3JB9 D;  1VQN B;  1PD1 A;  4XD7 A;  3WYA A;  4ZN3 A;  1T3L A;  4OGC A;  4A4H A;  1N08 A;  3KXT A;  3L2Q A;  2C0T A;  3L2R A;  3CB4 A;  4J7I A;  1VQO B;  2DFU A;  4ZCL A;  1KC8 R;  3GNG A;  1YIJ T;  4FW1 A;  1OI1 A;  4B3F X;  3FPK A;  5KCH A;  5GAM j;  2RI5 A;  2EQI A;  3G6E A;  2BN4 A;  4AG1 C;  2DL4 A;  3W5H A;  4Y28 E;  2GK6 A;  5LJ5 j;  2LP5 A;  3U23 A;  1M5Q 1;  4QVJ A;  3NGP A;  3EG1 A;  3I55 B;  4UZE A;  2XNJ A;  3OYF A;  3WY9 A;  4F04 B;  4F7D A;  3CCS B;  4A53 A;  2JS0 A;  5GAM f;  3OYJ A;  2D8J A;  1ZUU A;  2PVO B;  3FJP A;  1X6G A;  1K73 U;  1W34 A;  1VQL A;  4OPO A;  4OB3 B;  5LJ5 f;  3BC9 A;  3OEE A;  2RQT A;  1DG1 G;  2MK5 A;  2Y4Y A;  3SWN C;  2O4X A;  4R55 A;  3CCQ Q;  3OZU A;  4TMZ A;  2P0P A;  1BBZ A;  1PSE A;  1UUE A;  2ESW A;  5IXF A;  1NE8 A;  3JCM e;  3OAA A;  2WAC A;  1QGA A;  2C78 A;  2DBM A;  2O88 A;  2DBK A;  3A8G B;  1QCN A;  4JJC A;  2CZ0 B;  1YI2 T;  4M7A F;  2BF4 A;  1VYT A;  5KE3 A;  3MCA A;  4Z4Y A;  3J81 k;  2WYR A;  1KJZ A;  5KW9 A;  1ZLM A;  2B8A A;  4M7D G;  3H0I A;  3OYI A;  3L42 A;  3RR6 A;  3ZBU A;  3G4S Q;  4M2L A;  1E3Z A;  1LCK A;  2R5M A;  3QWY A;  1WQ7 A;  1WDX A;  2CDT A;  1VQN A;  5A89 A;  2YLB A;  2DM1 A;  2CP6 A;  3CCR B;  1VQ8 B;  2P4T A;  4FYX B;  2AKK A;  1NLP C;  3I35 A;  3X26 B;  3OY9 A;  1N06 A;  2LNH B;  1RI0 A;  3M9Q A;  4YTL A;  1RAD B;  2KE9 A;  1W2B P;  2WJY A;  1W2B B;  3EG9 B;  4P2N A;  3CC2 B;  1Q9S A;  3QZ9 B;  1COW A;  4HIZ A;  3G1J A;  3A8I A;  1NB0 A;  2JS2 A;  5KYU B;  3OYE A;  2BZY A;  4PJN A;  2MAM A;  3RBB B;  3HL8 A;  4MDW A;  5IHI A;  4TMV A;  3A8O B;  4XQ3 A;  1QP3 A;  2DL7 A;  1T0J A;  1M90 D;  1V0E A;  3A35 A;  1U2R A;  4OP7 A;  2QG9 B;  2LCL A;  4C5G A;  4YAU A;  4FSS A;  2VUB A;  1MMN A;  1WIE A;  1YI2 B;  4M7D A;  1N8R C;  1K73 R;  4F17 A;  3VMF A;  2YRD A;  1OPK A;  2E1R A;  5LL6 S;  4DK1 A;  2GTJ A;  3DB3 A;  1NYG A;  1WU8 A;  2PLF A;  2OAU A;  3G71 B;  4EIK A;  1U1S A;  4IUQ A;  1ZSZ A;  3GVK A;  1UD6 A;  4M53 A;  4BI8 B;  1W2B S;  1PJ7 A;  2DEQ A;  4MMK A;  3CCQ A;  5HKK A;  1Q86 C;  3EAE A;  1K9M C;  5D6W A;  2VAS A;  1H3H A;  1M2V B;  4M7D E;  2QMU A;  4XOR A;  3VS2 A;  2F5K A;  3J7A F;  5H59 A;  2EIF A;  1ZBX A;  1QFZ A;  1MRZ A;  4X0C A;  3JQP A;  2OYN A;  3L2Z A;  1QVP A;  1PKV A;  1ZUN B;  1K1Z A;  3CCV Q;  4M7A D;  3EG9 A;  3ASP A;  4XON A;  4KH0 B;  3DLL A;  3CC2 A;  3G4S A;  3BDU A;  4M7A G;  2RHZ A;  2VBS A;  4C8Q F;  4O6J A;  3VR6 A;  1C1A A;  2VVK A;  4LBV A;  3NTK A;  2F1M A;  2XU8 A;  1U3O A;  2FZG B;  2BE9 B;  1GCP A;  3NMZ C;  2CSQ A;  1Q82 R;  1D09 B;  4KKT A;  3M4Y A;  5GAO q;  2O9S A;  3M5A A;  1VQ7 T;  1FNC A;  5BSY A;  3OZW A;  1MHN A;  1VYV A;  7AT1 B;  2I1L A;  1ZM2 A;  4QUZ A;  1EFN A;  4C92 F;  1WNL A;  2EW3 A;  4YAW A;  1ZUY A;  4PAB A;  4AMC A;  1IO6 A;  1X6O A;  3M54 A;  3S3O A;  3EG0 A;  5GAN e;  4OVA A;  3A8K A;  2ZZF A;  2HL3 A;  3EGD B;  3ME9 A;  1TLL A;  6AT1 B;  3T53 B;  2V7Q A;  5L23 A;  2J6O A;  3JB9 I;  4M77 C;  2ZPF B;  3OSS C;  4M7A A;  5AYF A;  1KTV A;  1RAI B;  3OW7 A;  1KK2 A;  5A8A A;  1R8O B;  2M0O A;  3CD6 T;  4P26 A;  4IUT A;  3MO8 A;  1Q7Y U;  2CH4 A;  2ECZ A;  1OZ2 A;  2AIR B;  2CT3 A;  4RG2 A;  4CI0 C;  2CP2 A;  5DLO A;  3CCM Q;  2JIZ A;  1EFR A;  2Q6O A;  4M75 B;  3CES A;  2ZCF B;  2ZL6 A;  4OP0 A;  3GP8 A;  3JCM V;  1M1K D;  2R9V A;  1KG1 A;  3CC4 Q;  1SRL A;  2AZS A;  1PRM C;  1VQ7 B;  3U6K A;  1FYN A;  2H8H A;  1Q7Y C;  4HA8 A;  5CCA A;  4JPB W;  2C0O A;  3JCM h;  4M78 D;  4HVW A;  4DOW A;  4ZGJ B;  1KK1 A;  1ZM3 A;  1S72 Q;  2K4Y A;  3CCV A;  1YHQ B;  1RAF B;  1QFJ A;  2RK1 A;  2E5K A;  5CKE A;  3V8J A;  3OYN A;  1KFZ A;  4Z4Z A;  5KCO A;  1JB0 E;  1JXM A;  2ZPB B;  4PJL A;  2PVD B;  1LPL A;  2W0Z A;  2BM1 A;  2RQV A;  4N4H A;  3ZFJ A;  4C8Q D;  3ZBD A;  2XID A;  1BCO A;  3E9F A;  3MJX A;  4J83 A;  2ZZE A;  2H3E B;  4C8Q G;  4FT4 A;  2FRY A;  2OBS A;  2RI2 A;  1RLQ C;  2J7I A;  4E7J A;  2ZAE A;  2E70 A;  1K0S A;  3CD6 B;  1FMW A;  4R0K A;  4P25 A;  1YIT T;  1H92 A;  5GAN 8;  1RQP A;  2DL5 A;  1WHM A;  4NL2 A;  4A4G A;  9ATC B;  3OYD A;  2ENM A;  3OYG A;  1UGP B;  1KQS S;  2DNU A;  2OK8 A;  2XDB A;  3QWX X;  4DBR A;  1FDR A;  2K79 A;  2W6J A;  1N9R A;  1WFW A;  2RHI A;  5LMZ A;  3CRZ A;  2HSP A;  4ANJ A;  4TMX A;  4C92 G;  1T0H A;  3QJ6 A;  8AT1 B;  4C5E A;  2C2W A;  2X8K A;  3ULR B;  3MMP A;  2VC8 A;  2Z0W A;  2Y90 A;  4EMG A;  3UAT A;  1KK7 A;  4A4K A;  2XZL A;  2WSF E;  2CF4 A;  2X35 A;  4RDK A;  3VUB A;  1KQS A;  2OTL B;  4XQF A;  3RKY A;  3TSW A;  4WZE A;  1X01 A;  1VQ4 T;  1QUF A;  4XAX B;  2FPF A;  3GF5 A;  5FNZ A;  1QVG P;  1OB5 A;  2L89 A;  3OJW A;  1ZM4 A;  3CCM A;  3FRN A;  1YHQ A;  3LH0 A;  4C8Q A;  1KQ1 A;  1K0X A;  1M3C A;  1WXU A;  4FT2 A;  4LDU A;  1I5O B;  1UEC A;  3SEJ A;  3A8J A;  3V8K A;  2M02 A;  4J9B A;  1H8E A;  1DAR A;  4E7Z A;  1WOP A;  2X4Y A;  2AT1 B;  3SFM A;  2K3B A;  1FMV A;  2PVG B;  3JCM W;  4M1K A;  1WJQ A;  1KC8 D;  4KKS A;  2DPP B;  2SRC A;  2CUD A;  3CEY A;  1D3B B;  1RAG B;  4XTY A;  4C92 A;  3A3G A;  3EHR A;  3M0U A;  4LN2 A;  1GXI E;  4R71 A;  4QVD A;  3T9N A;  5GAN 6;  3JCM f;  1IB0 A;  1PNJ A;  4TMW A;  1PKT A;  3LVB A;  1GFD A;  4A4F A;  3CCE B;  3HAG A;  5FRN A;  1OX8 A;  3LQ6 A;  4KKU A;  2DD5 A;  4PC7 A;  1NBM A;  1I07 A;  1MMA A;  3O8V A;  3CCU B;  3JCM b;  4NNJ A;  1Y57 A;  3CQT A;  3PGG A;  2VJI A;  4LUE A;  3OS5 A;  1VQM T;  4C92 E;  2OTL A;  5LJ3 e;  4XK8 E;  4HT9 A;  1NEB A;  4MYU A;  4J9I A;  4FYW B;  1Y07 A;  4ZGE B;  1G7R A;  3PVL A;  2FVG A;  3SHW A;  4KGX B;  2HQX A;  3VNV A;  3SDZ A;  3E2U A;  3CPW P;  4NBS A;  2EJG A;  2DE0 X;  1N27 A;  5CQY A;  3RKW A;  3JCM X;  1JEG A;  2VYT A;  1VIE A;  2XIC A;  2K3X A;  5KYX B;  2AZV A;  1BX1 A;  1JJ2 B;  2DXU A;  1G3T A;  2B5O A;  3GOX A;  1WGS A;  4JUV A;  1YWP A;  1M4Z A;  4QVA A;  1QH0 A;  1D3B A;  3HRT A;  2DEU A;  4XTX A;  2GBQ A;  2XZP A;  1ZUK A;  2CRV A;  5FO0 A;  4WZT A;  3ZZ0 A;  2NUP A;  5FU7 B;  2XZO A;  1WHJ A;  2JJ1 A;  3LX7 A;  4E7K A;  2QA4 Q;  1VQM B;  3QXE B;  5GAN 2;  1YJ9 T;  3CBM A;  3FDR A;  2E3H A;  4M75 C;  3CCU A;  1VQ5 Q;  1OU9 A;  2LX7 A;  1K73 D;  2GQV A;  1ZQ1 A;  2RD1 A;  4LBZ A;  1CNF A;  5A2Q E;  5I2M A;  3RY8 A;  2D3L A;  3KL9 A;  3QDF A;  1SEM A;  2RB6 A;  3QZ5 B;  1HZE A;  2CP5 A;  2HBP A;  2K6D A;  3Q38 A;  3I9Q A;  2HKN A;  5TY0 A;  2LCC A;  1VQ9 B;  1WJR A;  1IHW A;  1JJ2 S;  2LT4 A;  2CZ7 B;  3M0S A;  4D6W A;  2RF0 A;  4DNR B;  3CC7 Q;  2GQI A;  1UD4 A;  4JMQ A;  3QHS A;  1M3B A;  5CAI A;  2DXC A;  1EIF A;  3W2I A;  1FX0 A;  2JN9 A;  1JJ2 A;  2D74 A;  1QCF A;  2E6N A;  4JJD A;  2CYZ B;  2E6Z A;  3VJP A;  4BE0 A;  1KMH A;  1BI2 A;  3AST A;  1UD2 A;  1WHL A;  2X6Y A;  3QE2 A;  3OE7 A;  5KNL A;  1B07 A;  2KSS A;  1YX2 A;  4X05 A;  5GAN j;  1VQK B;  2F43 A;  1KZL A;  4M77 F;  2JMA A;  1QMC A;  2CW5 A;  1FWZ A;  2QN6 A;  3OBY A;  2FPD A;  3G05 A;  4GBQ A;  1NG2 A;  3EH1 A;  3LH5 A;  1YJN A;  2MWO A;  4OMQ A;  2NUT A;  3OJX A;  4XTZ A;  2FYK A;  3I56 B;  3VNU A;  3FB9 A;  1M27 C;  2DCU A;  5GAN d;  1ZA1 B;  5GAN f;  5CO7 A;  2QDY B;  4QKU A;  3VO1 A;  5AT1 B;  2YDL A;  4JRP A;  3CP8 A;  2DYB A;  2HLD A;  5TV2 A;  3OS0 A;  3OQ5 A;  3ZZT A;  5J3B A;  1UJ0 A;  2M5S A;  3TEE A;  2RJD A;  2L0A A;  1VQP Q;  2P0Q A;  1IHM A;  3OYB A;  1PD0 A;  3SB2 A;  5GAO l;  3OA6 A;  1C6V X;  3P26 A;  1EFC A;  2AK5 A;  2QA4 A;  3B8H A;  2JZ2 A;  4PFO A;  1T3S A;  5GMK l;  8ATC B;  1MMG A;  4QVC A;  1OZ3 A;  2E65 A;  1OPL A;  1VQL Q;  4Z89 A;  2LX9 A;  1VQ5 A;  3PUN A;  3GLX A;  3OSV A;  1E63 A;  4X7F A;  1MND A;  1SHF A;  5EMN A;  4WTO B;  3E20 A;  2FG0 A;  4C0G A;  4ASU A;  2BKD N;  1UD5 A;  2XND A;  2KXD A;  5EC7 A;  5EG2 A;  1YLO A;  2R6H A;  1U5S A;  3QSY A;  3OYA A;  2NPF A;  2EYX A;  1M30 A;  2KYB A;  5HZB A;  1XTD A;  4ELZ C;  4CC3 A;  2QAS A;  2FL7 A;  1TTH B;  3A1P A;  3TCJ A;  3MEA A;  3CC7 A;  2ABL A;  2ZPE B;  1K8A U;  2PNI A;  1TU0 B;  4MDX A;  3CPF A;  1VQN Q;  4B47 A;  1I4K 1;  4C5I A;  4HKE A;  2YUP A;  1D1C A;  3MET A;  2MPX C;  2YRC A;  4RPD A;  2L2P A;  2YRV A;  3QKJ A;  3I56 A;  3GQB A;  1VQO Q;  2NYS A;  5LJ3 h;  5IXB A;  3OYC A;  4Z88 A;  5F4O A;  1K8A C;  2PZ1 A;  2EYZ A;  1WX6 A;  2E64 A;  1WSR A;  1P92 A;  4RM0 A;  1T5E A;  3PMI A;  1LNX A;  1QLY A;  2RJF A;  4RCZ A;  4M4Z A;  3I55 Q;  2X85 A;  1IJF A;  1B34 A;  1I8D A;  3JB9 H;  3CCS Q;  1OGJ A;  3MP6 A;  2EQJ A;  1QVF P;  3M4G A;  4M77 G;  1QVF B;  3UF4 A;  3ASR A;  4II3 A;  1KQ2 A;  3VYH B;  4PNO A;  1VQ6 B;  2DY1 A;  3X24 B;  2RC6 A;  2CP7 A;  1VQP A;  4MML A;  2EFI A;  2KT1 A;  4ZNX A;  5GAM d;  2K2M A;  4QW2 A;  2DK3 A;  4YEL A;  2JMC A;  1TH7 A;  2X6W A;  4P22 A;  5LJ5 d;  4DQK A;  3CBO A;  4J9E A;  2X3U A;  4TN1 A;  1Q7Y D;  4Z8A A;  2GQF A;  3GPL A;  1D0X A;  2W6I A;  4XM3 A;  2A36 A;  1F60 A;  1JNY A;  4RJL A;  3CCR Q;  2DKG A;  1VQ8 Q;  3V8L A;  2MI6 A;  1M2O A;  1K8A R;  2LNV A;  4XNF A;  4LDY A;  1WYX A;  5KYW B;  4PJO B;  5FU7 C;  3HSB A;  2RHX A;  4M7D D;  2X4W A;  1SKU B;  2OX7 A;  2VV5 A;  1U1T A;  2DL3 A;  4BE2 A;  4HE5 A;  2QAZ A;  3CC2 Q;  1MGQ A;  2EKO A;  1TOV A;  1I8F A;  1JA0 A;  4M77 A;  2R57 A;  1X27 A;  2VBV A;  3KFV A;  4IUU A;  1KD1 U;  2VJJ A;  1YIJ B;  2JW4 A;  1GRI A;  2VZL A;  2XI9 A;  2WPD A;  4ACA A;  1PJ6 A;  4RD2 A;  1XQH A;  2BUD A;  1VQO A;  1LVK A;  4F7U B;  2WR8 A;  4AVZ A;  4N0A C;  5LJ3 j;  4LUD A;  4E2F B;  4P3I A;  4BY6 B;  5GAN 5;  4XTW A;  1BKB A;  1YI2 Q;  4RPB A;  5CDF A;  1BQE A;  1KD1 C;  4OMM A;  3H0H A;  3CTA A;  4XKV A;  4AFZ C;  3SLD A;  3Q39 A;  4CC7 A;  4M77 E;  1ZA2 B;  4F7U G;  1N8R U;  3I55 A;  4PLL A;  3PEN A;  5LJ3 f;  1TWB A;  4J9C A;  2PUO B;  1UFF A;  2KK4 A;  4CQJ A;  3CCS A;  2CP0 A;  2KMT A;  3G71 Q;  2Q6I A;  4YAL A;  2Y4X A;  4HXJ A;  4ZGD B;  3JU4 A;  4RCY A;  4RD0 A;  3M0P A;  4FYV B;  3UPU A;  4OOX A;  2LTO A;  4YAO A;  2JJ9 A;  3W2G A;  3KUF A;  4XLH A;  4DQL A;  1E62 A;  1VHE A;  4YHB A;  4DEX A;  4J8O A;  3LWI A;  3P8B B;  1Q86 U;  2EJF A;  5IAY A;  5CKD A;  1K9M U;  4C0D C;  2PE3 A;  2K9G A;  1NJI U;  2RQU A;  5FO1 A;  1Q81 C;  1A0N B;  3CCL T;  2FHD A;  4LD6 A;  1S1N A;  5IYQ A;  1PHT A;  2E4H A;  1GVH A;  4X07 A;  4ROX A;  1ZSG A;  4YAF A;  4M75 F;  1H8H A;  2GFU A;  1NB9 A;  1U8R A;  3QPH A;  1Y0R A;  3CCR A;  3E1Y E;  1VQ8 A;  1T6Y A;  2YLC A;  2K5F A;  1NJI C;  4LXC A;  3PA2 A;  3ASQ A;  3NPF A;  1SKQ A;  4Q5W A;  2HKQ B;  2LZJ A;  1KD1 R;  3NE5 B;  4PJO E;  1WQW A;  4F7U A;  1B2R A;  4P1V A;  5H5J A;  4DNT B;  1KJW A;  5B6I A;  1MMD A;  1W2B A;  1QGZ A;  1I0C A;  2JNG A;  2JTM A;  3IQL A;  2VBT A;  4Z4S A;  2GCX A;  1ACM B;  2HQE A;  4L8J A;  2PTK A;  4XU2 A;  5KYU A;  1AZE A;  2X4J A;  4J6W A;  2V8I A;  1V29 B;  4G7W A;  4WZK A;  3VS0 A;  2LQW A;  2LMJ A;  1NEG A;  2PU9 B;  4AG2 C;  2EFG A;  1N8R R;  1SHG A;  1M8V A;  4JRQ A;  2HCJ B;  4BI4 A;  4UAJ A;  4F7U E;  2WSC E;  3C0C A;  1UMK A;  2KI7 A;  4ME7 A;  1YI2 A;  4XMY A;  4FN5 A;  2AHJ B;  3U2Q A;  2CH4 W;  2DL8 A;  4EH1 A;  3CCL B;  3SJZ A;  4Z02 A;  3UDC A;  4TVR A;  4C43 A;  1WI7 A;  4Z4V A;  1FNM A;  3UWN A;  2M9U A;  3CCJ T;  3G71 A;  2CS7 A;  3WNB A;  2D3N A;  1Q86 R;  1GAQ A;  1UGS B;  5GMK e;  4OPV A;  1SPK A;  1K9M R;  4XL9 A;  5FL7 A;  4DK0 A;  1KK0 A;  2DOG A;  4Y9U A;  2GJP A;  2XDD A;  2KAF A;  4J9G A;  3TQ7 P;  3J81 E;  1BIB A;  3VS6 A;  1P4M A;  5DLQ E;  1M2V A;  1ZM9 A;  2M1H A;  4ZGN B;  2RHY A;  3ISX A;  5L46 A;  1WPY A;  1DJ7 B;  1VQ7 Q;  1WOR A;  5KSW B;  1QG0 A;  2VXE A;  1GFC A;  2FPE A;  3CC4 T;  2K5L A;  4P3Y A;  3BE3 A;  1YHQ Q;  4RUG A;  4DEY A;  1K9A A;  4JZ4 A;  1AOJ A;  5GAO r;  2BGJ A;  3W2F A;  2VYQ A;  2DAQ A;  1J3T A;  2A3L A;  5I21 A;  4LBY A;  3V76 A;  3AVW A;  1D8T A;  1TVC A;  2QE7 A;  1K28 D;  3A98 A;  3VU3 C;  1S72 T;  5IYN A;  1XB2 A;  2ZL5 A;  4M75 D;  2QQB A;  4RTZ A;  2VNH A;  4M75 G;  4PC3 A;  2COZ A;  4X7C A;  3RMQ A;  3REA B;  1M1G A;  1D0Y A;  2RH2 A;  2KGT A;  5CQX A;  4MYT A;  1GAW A;  2HCK A;  1UB4 A;  2V7W A;  4C0Z A;  3CCJ B;  3CD6 Q;  1FMK A;  4IUV A;  2QTL A;  2R5A A;  1D2E A;  3WQZ A;  3PIP A;  3LWH A;  1Y71 A;  1QKX A;  4M78 B;  1EP2 B;  2PQW A;  2HDA A;  2CUB A;  4N3G A;  3PT9 A;  4PJO C;  1Y0M A;  1RAB B;  1SSF A;  1ZX6 A;  3INZ A;  4DOV A;  1BI3 A;  4XN3 A;  5TR9 A;  1DDG A;  1SG5 A;  1IHV A;  1M3A A;  3EGD A;  4IUP A;  4N4G A;  1QUE A;  1TS9 A;  1T6X A;  3I1F A;  1C0M A;  3CC4 B;  4Z4R A;  2LDM A;  4X06 A;  2OTL Q;  4O5V A;  4OML A;  1WP6 A;  5HKC A;  3C95 A;  2F5T X;  1DDI A;  2NV4 A;  1N6A A;  3I5S A;  5DM7 R;  4C92 D;  4EPC A;  2F1L A;  3F70 A;  1KHI A;  5KE2 A;  4M75 A;  4AT1 B;  3RER A;  1B23 P;  4PL6 A;  1TUC A;  4BY6 C;  4QV2 A;  1Z9Z A;  1F20 A;  4KGZ B;  1Q7Y R;  2QTX A;  3OYH A;  1X2Q A;  4K11 A;  2Q6K A;  2DJZ A;  3ZIA A;  4QQ6 A;  3NFC A;  1I5L A;  4IUR A;  3GIR A;  3MPU B;  3MEV A;  1VQ7 A;  2DVJ A;  1QW1 A;  2V7X A;  3UA6 A;  5IYW A;  5ECA A;  2PMD A;  4PK4 A;  2RQR A;  4J7F A;  3ZL7 C;  2CKK A;  2DZ9 A;  1J9Z A;  4ACB A;  3H41 A;  3JQQ A;  3OZV A;  2OBT A;  1QVG B;  1UTI A;  3CMA T;  1ABQ A;  1BI0 A;  2QK0 A;  4FSX A;  4FU6 A;  4M75 E;  4CC2 A;  3QO3 A;  1M90 C;  1LOJ A;  4KUI A;  1YBY A;  4A4E A;  3JCM P;  1OX9 A;  3EGX B;  1GBR A;  1EP1 B;  4IKF A;  2OTJ T;  2CC2 A;  4HVV A;  3HHT B;  2DRK A;  4OPS A;  2COW A;  3CXC P;  4V2S A;  1YIT B;  1YJW T;  1I18 A;  3CCE Q;  3CXC B;  1I1J A;  2QQR A;  3B82 A;  2RNA A;  3LYI A;  4XU0 A;  3CD6 A;  3CCU Q;  4CC4 B;  2E12 A;  4ESR A;  5IYR A;  3AHU A;  4OGE A;  2B7B A;  1XJW B;  3JCM d;  2F4N A;  1EXM A;  3VRY A;  1QWF A;  3TU4 K;  2DMO A;  4ZTF A;  2NUZ A;  3OW2 P;  3A5Z B;  2QI2 A;  2L3R A;  2HSE B;  3JAM E;  4IW3 B;  3CME T;  4PKC C;  2RMO A;  3OW2 B;  2DZC A;  1MUZ A;  2XGJ A;  1QVG S;  3G7Z A;  3PUM A;  2LJ1 A;  4CRI A;  2GRE A;  5FWB A;  1NRK A;  1VQ4 B;  4UZF A;  2LJ3 A;  3X25 B;  2LQK A;  1VLO A;  2JDI A;  2IPO B;  3OS1 A;  1EWY A;  4NOY A;  2JM9 A;  1K8A D;  3CMA B;  4OB2 B;  4D8D A;  5GAO p;  2G3R A;  2EBP A;  1F1B B;  2KDS A;  1OB0 A;  4E7S A;  2CK3 A;  1GBQ A;  4BAC A;  1JB9 A;  2KRN A;  3MHP A;  4N3N A;  2OTJ B;  1PG5 B;  2GJR A;  4AF7 A;  4OMP A;  3A8H B;  3M58 A;  2DO3 A;  4PFZ A;  5GMK h;  1V0F A;  3WXM B;  1JBM A;  1YJW B;  4J5Y A;  2YWW A;  2BGI A;  1BJK A;  2E10 A;  3CPW B;  1H64 1;  2FZK B;  1R5O A;  3JQR A;  4P6V F;  3ONU A;  1VQM Q;  1YJN Q;  3LNN A;  3OW2 S;  3ONY A;  4U9U A;  3FEO A;  5A0D A;  5E6T A;  3M56 A;  2RHU A;  3QYG B;  5HXB A;  1VJS A;  3CME B;  3C94 A;  1G7C A;  1EZZ B;  1WLP B;  2QA4 T;  3LGL A;  4OMO A;  1FRQ A;  1YNZ A;  4RDL A;  1Y96 B;  1AEY A;  3OP1 A;  1UE9 A;  3OYM A;  1VQ5 T;  1VQ9 Q;  1YP5 A;  2EQM A;  3AVU A;  1Q95 G;  3CCE A;  4X1V A;  3S3M A;  1KK3 A;  3SEM A;  4FCY A;  3JCM g;  4AFS C;  2J06 A;  1VQ4 A;  2D1X A;  5IYP A;  2ZGW A;  4FIB A;  1T6Z A;  3VV0 A;  3EFO B;  2YUO A;  1HA3 A;  1M1F A;  2DTI A;  3CPW S;  2BTT A;  2L5Q A;  2P0K A;  1OEB A;  2V1R A;  1OUL A;  1M1K C;  3BCD A;  1VLY A;  4XKW A;  1SF9 A;  3FLG A;  3HPW A;  3MEU A;  3VS3 A;  2BM0 A;  2QEX T;  2KVQ G;  4GLK A;  2JM8 A;  3VS1 A;  2PIA A;  2X9H A;  3LLR A;  1I7P A;  4FM4 B;  2C5B A;  1VQK Q;  4M78 C;  3LGF A;  3CPW A;  3PA1 A;  2H3J A;  1UG1 A;  3JB9 J;  2EQK A;  1KD1 D;  5KYX A;  1X75 C;  3RNJ A;  4AF6 A;  1QKW A;  4B6M A;  2HAX A;  3I56 Q;  1WHG A;  4X7E A;  2Z6B D;  1PM3 A;  1QWE A;  1KRH A;  4LE9 A;  1KIK A;  2EIX A;  4EMK B;  3OBW A;  3CP2 A;  2FVU A;  5GMK j;  5I2S A;  1W70 A;  3V7S A;  3CW2 A;  2LQ8 A;  1YJ9 B;  5DY9 A;  1Y96 A;  4A54 A;  1TUG B;  2LRQ A;  4PC1 A;  1HK9 A;  4RD4 A;  1HYO A;  3M59 A;  1G7T A;  5CKH A;  1A8P A;  1N8R D;  4ORZ A;  4E7H A;  2LT1 A;  3G6E T;  4ELY C;  1VQM A;  1QP2 A;  3TRE A;  2QDL A;  1R5B A;  3GVJ A;  1MV0 B;  1OOT A;  4JLI A;  1RI9 A;  2EYQ A;  3BY7 A;  3JCM c;  4RLZ A;  2GPJ A;  3B78 A;  1W35 A;  2B86 A;  1RUW A;  1WXB A;  1IGU A;  2L8D A;  1OQK A;  2M16 A;  2QGF B;  1IZ6 A;  2YSQ A;  2I0N A;  2P4R A;  1VQL T;  1VOM A;  2QEX B;  3Q6R A;  1VQ9 A;  4M4S A;  1Q86 D;  1K9M D;  2OJ2 A;  4A63 B;  4GLM A;  4N0A A;  5L8R E;  1NJI D;  2VNI A;  1EFT A;  1N5Z A;  2DXB A;  1GO2 A;  3SJP A;  4Z4U A;  4DBQ A;  3A8L B;  3BCF A;  1UJY A;  2NWM A;  1NM7 A;  1UGV A;  2EAY A;  2FEI A;  2MOX A;  3QFT A;  5GV8 A;  3LW5 E;  2C06 A;  1YCY A;  2VWF A;  4PLI A;  1RAE B;  1K76 A;  2D9R A;  2ZBV A;  2KYM A;  4X7D A;  3HFO A;  1E1Q A;  3QUI A;  4RTX A;  3M55 A;  1E3X A;  2F2V A;  3BW1 A;  2O2O A;  4PJO F;  4PGO A;  2OBR A;  2VBU A;  1VQN T;  4JRK A;  1BPL A;  5J3O A;  3E1S A;  4Y92 A;  2FX3 A;  3VYG A;  2CT4 A;  3CPX A;  3G6E B;  3P8D A;  4LDW A;  4QT7 A;  2COY A;  1Y0Y A;  1VQK A;  1YJ9 A;  4DQ2 A;  1EP3 B;  1XOV A;  1KC8 C;  4EDU A;  3MHX A;  4Y7C A;  1OYX A;  1WDT A;  3QJY A;  4ZCM A;  2DA9 A;  2VGN A;  2DIG A;  4RTV A;  3V7C A;  3OEH A;  1E64 A;  4F7U F;  3EGU A;  2XD0 A;  2ZBU A;  3FIF A;  5FIU A;  1UDL A;  1X43 A;  3GNF B;  2WSS A;  1SSH A;  3FKS A;  1VQ6 Q;  2QQA A;  2CND A;  2XHC A;  2KRS A;  2BV3 A;  4LBW A;  1PSF A;  1E6H A;  2O4X B;  3CCS T;  1XQB A;  5GAN g;  3AT1 B;  2EYY A;  4RTU A;  1W9X A;  3RMS A;  2GK7 A;  4Q7J B;  2HQH A;  3MCA B;  4GQN A;  4M77 D;  1E6G A;  1Z9Q A;  5GAN 7;  1JO8 A;  5KYY B;  1E7O A;  3DKM A;  4E47 A;  4RG8 A;  2MF2 A;  2QTV A;  4Z4W A;  1TXQ A;  1V1C A;  3VS7 A;  4J9F A;  4J6X A;  1N05 A;  2A7Y A;  1VF7 A;  5GMK i;  3N5B B;  1K4U S;  4OB1 B;  2YHT A;  2YT6 A;  2HD0 A;  1NDH A;  2F69 A;  3WVE B;  2O31 A;  3M57 A;  3JB9 G;  1G3W A;  1D0Z A;  5IN1 A;  1M9S A;  1X6B A;  1ELO A;  2YWG A;  1Y7X A;  3HRS A;  3CCQ T;  1G5V A;  2GGR A;  3PE0 A;  2BMW A;  3CCR T;  1VQ8 T;  2ZZG A;  1PWT A;  2DTO A;  1AHJ B;  2WZN A;  4XU3 A;  1XE1 A;  2OK7 A;  2V31 A;  5IHN A;  1JQQ A;  2E41 A;  4X9C A;  4BD3 A;  3QFS A;  1AWO A;  2DD4 A;  2KY9 A;  1I81 A;  4MZT A;  1YIJ Q;  1G2B A;  4AC9 A;  4X8I A;  3CC2 T;  3SKB A;  2JTF A;  4FYY B;  3G4S T;  2VNJ A;  3OOC A;  1NLO C;  4AFQ C;  4LD9 K;  4J0Q A;  3WBJ A;  4PFP A;  2QTZ A;  1OHH A;  2DER A;  5FRO A;  1QVF S;  4BE1 A;  1UHF A;  5THX A;  4PJO D;  1WZO A;  1AD5 A;  1FND A;  5J35 A;  1BU1 A;  4PJO G;  2V4D A;  4M7D B;  1NZ9 A;  3QDR B;  5IHK A;  3DB4 A;  4ZTJ A;  4QVZ A;  3QG1 A;  5CKF A;  1BI1 A;  1VHO A;  1UGQ B;  2VB6 A;  1K73 C;  2MIO A;  5KYY A;  2NLU A;  1WTH D;  1QQJ A;  1ZSZ B;  1HD3 A;  1QVF A;  2P84 A;  4BDZ A;  2KVO A;  3WNC A;  4B4D A;  2B7C A;  3MEW A;  3OYL A;  1VQ6 A;  3CCQ B;  3G71 T;  2ZZD A;  1WSV A;  2EYW A;  2EJ9 A;  4D8K A;  1B3Q A;  2KNB B;  1AZG B;  2J7K A;  2V7T A;  5LJ3 d;  3KBG A;  1GCQ A;  4KBM B;  2GF7 A;  3RKX A;  3KEW A;  3VRZ A;  4G1B A;  4B9W A;  1Q81 U;  4B48 A;  3OMG A;  3G4S B;  5GAM g;  1GR1 A;  4X34 A;  4EMK C;  2HZY A;  2BIV A;  2XKO C;  5LJ5 g;  3OKX A;  2JJ2 A;  3L2U A;  1JXO A;  5KYW A;  1Q82 U;  4PJO A;  3C4S A;  4BUG A;  2KXC A;  2GFA A;  2RM4 A;  3ER0 A;  1CQX A;  2RK2 A;  2MMP A;  5FU6 B;  4EMH A;  1TUI A;  1R0B G;  2G6F X;  3MKD A;  3UT1 A;  1CNE A;  4BDY A;  4WWV A;  1O75 A;  1WPC A;  1BK2 A;  2DTH A;  4WCI A;  4B3G A;  1D1N A;  2HL5 C;  2FB7 A;  2XG8 D;  4MZM A;  4TSF A;  3V7A A;  2QDX A;  2L3P A;  1UEB A;  5IH2 A;  1YIJ A;  1Q82 C;  1G83 A;  3CCV T;  1UD3 A;  2VNK A;  4OOS A;  3W2E A;  3ZPN A;  2DF6 A;  3URG A;  3CMM A;  4BB7 A;  5DS0 A;  2O01 E;  4TT3 A;  2KEA A;  4TKO B;  3WND A;  4IIO A;  5CR2 A;  3WVD B;  3ZZU A;  2GNC A;  2HBW A;  1NBE B;  2LVM A;  2EVR A;  5GAO n;  3CCL Q;  3QFR A;  3PMT A;  2V26 A;  2AHO A;  4M0L A;  4M78 F;  4M7A B;  2EGA A;  2ZTN A;  3OFN A;  2J6F A;  3E9G A;  4XTU A;  4RTT A;  5LJ3 g;  4KGV B;  2CZ6 B;  4KRT A;  3JSC A;  1KSW A;  3ASS A;  2HNI A;  2JUF A;  5GAO m;  3L2V A;  1Q81 R;  4L6V 5;  2IG0 A;  5GMK m;  1W0K A;  4IIM A;  3DLM A;  2ZPG B;  2VGM A;  2YUQ A;  4NL3 A;  3Q1J A;  2Q6L A;  1G3S A;  3CBP A;  1ZBJ A;  3CCV B;  1ARK A;  2XMF A;  1UHC A;  4GY5 A;  1BB9 A;  1QGY A;  3R6N A;  3JCM J;  1NJI R;  5D6X A;  3GSI A;  3OMC A;  3D7S B;  1IJE A;  4OMN A;  2LCS A;  3S3N A;  3T56 B;  4E0F A;  2M51 A;  2QQ9 A;  3ES9 A;  1S0U A;  1OB2 A;  4HVU A;  5HK3 A;  2LC4 A;  4JDS A;  1EFU A;  4LC0 A;  3CCM T;  1YHQ T;  4QHY A;  5JBQ A;  3ZEH A;  2FRW A;  1VIF A;  4FL6 A;  1X69 A;  3H6Z A;  1EX4 A;  1QFY A;  1HVX A;  3MP8 A;  2QXF A;  1WOO A;  2J05 A;  1UD8 A;  4VUB A;  4AFU C;  2HEQ A;  2DVE A;  1NYF A;  2EQU A;  3OS2 A;  1IXD A;  4XN0 A;  3CCJ Q;  4QFM A;  2DIL A;  4RCC A;  5HCK A;  5HY6 A;  3UA7 A;  1BLI A;  1FNB A;  4UZU A;  2C0I A;  5IK2 A;  2XEX A;  4C0S A;  1FX7 A;  2BZX A;  2ROL A;  3M0R A;  2GJK A;  1VA7 A;  1HSQ A;  1GCQ C;  1TUD A;  2V8J A;  2CSI A;  3JV3 A;  4B3X A;  3RDV A;  3DDY A;  3R6O A;  1SRM A;  3HTR A;  4PJM A;  4K1X A;  2CZ1 B;  2ATC B;  3I5R A;  2D0Q B;  3W5U A;  1IGQ A;  4RD6 A;  1CKB A;  1N0U A;  1AIP A;  1FRN A;  3CCL A;  4E7I A;  1HJD A;  1KQS P;  1B7T A;  4XLA A;  3VKI A;  3QSU A;  3HRU A;  1KQS B;  2QQS A;  3EHQ A;  3OB9 A;  5CIU A;  4M7A E;  3BY1 A;  4XOP A; 
#chains in the Genus database with same CATH homology
 2DOG A;  2F1L A;  2DYI A;  1PM3 A;  3H9N A;  3A1P A;  2QGG A;  3HTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...