3H9NA

Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target ir66.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
b'HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome maturation factor rimM
molecule tags Ribosomal protein
source organism Haemophilus influenzae
publication title Northeast Structural Genomics Consortium Target IR66
rcsb
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3h9nA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3h9nA01
2QGGA 3HTRA 1PM3A 2DYIA 2DOGA 3A1PA 2F1LA 3H9NA
chains in the Genus database with same CATH superfamily
2PVGB 3OS0A 4JS5A 1WHJA 1JQQA 5GAN5 2FX3A 3G6EA 2YWGA 3OOCA 1T3SA 4PJOD 3UWNA 2DX1A 1B34B 2KY9A 2FPEA 1RLQC 1COWA 1SRMA 2BUDA 2ZPEB 4C8QE 5J26A 2FHDA 2C4UA 1OOTA 2BKDN 2GREA 4QT7A 3GP8A 1VLYA 5CKFA 1KC8C 1WOSA 2HAXA 3EFSA 2DZCA 4X8IA 2FRYA 1O75A 5H5JA 1M27C 2VZLA 3FPPA 3GIBA 3BCFA 3RMQA 2DVEA 3OY9A 4XLFA 2RQWA 3TREA 5GAN3 4LDVA 1QVGP 3CCUQ 3CB4A 1Y7XA 5TRDA 1VQ8T 2WSFE 1YITB 3J80E 5LL6S 1ZSZB 2BV3A 2EJGA 2QXFA 2JZ2A 3CC2B 3GIRA 2ZBVA 1U5SA 1OULA 2HKNA 3QG1A 1V0FA 1UHFA 2V8JA 3GVKA 2V8IA 3SHWA 4D8DA 5CDFA 4Z02A 1T0HA 3AHUA 2ZCFB 2NUZA 4OB3B 1BJKA 1VQ9T 3RY8A 1KJZA 5FU6B 2F2VA 1WIEA 3VO1A 3FRNA 2A37A 2D3LA 2NV4A 3EFRA 3Q38A 1YJWB 3QO3A 3PIPA 3BCDA 5GJVB 1K9MR 2VYTA 3I1FA 1M1KU 3PTAA 3CXCS 3HSBA 4KH0B 3HHTB 5GAMd 3CCEA 2JOYA 2QA4Q 2EQIA 1UTIA 1NLOC 2D0NA 1KMHA 3GSIA 2XDPA 4M78F 4ZTJA 1M1KC 3CPWB 4N4HA 2BSAA 4OGCA 4PJOE 1M4ZA 3CCUT 1FMWA 4BDYA 1TTTA 3WXMA 2KK4A 2V4DA 3OW2A 1Q7YR 3OZVA 2XZPA 1NE8A 4B4DA 2D74A 1XTDA 2DEQA 3KXTA 1G2BA 2WACA 3O8VA 2J6FA 1N27A 2FZCB 2LC4A 4F7UE 3CCET 2ZZQA 3OS5A 2BZXA 4Z4WA 2ENMA 3OMCA 2NUPB 3KFVA 1Z9QA 2PIAA 1NB0A 3X25B 2YDLA 4XTYA 3QZ5B 4Z4UA 1X27A 1VQ6Q 2COYA 2DLPA 3JB9H 2JN9A 4F17A 1ZQ1A 4BY6B 4LN2A 1SSFA 3E19A 1YITQ 1ZUUA 5LJ3h 1GAWA 2VGMA 3P27A 2YT6A 1KHCA 1I7PA 1M8MA 1ZUYA 3R6NA 1KTVA 4DK1A 4KBMB 3NTIA 2BZ8A 4XTUA 2LX9A 1QP2A 5FL7A 1N8RD 2P0QA 3W2EA 2G3RA 5A89A 1SM4A 1YJNB 2YUQA 5CR2A 4J7FA 1H8EA 3CBOA 2RN8A 5KNLA 2K5FA 5EMNA 4G6IA 2JS0A 1KQSS 1BMFA 2QDYB 2EPDA 1RI9A 4C5EA 3QWYA 4P5NA 2JM8A 2L0AA 1HA3A 3EH2A 3W2GA 4F7UG 2CP7A 4IUTA 4RKUE 3OPOA 4ROXA 3W2IA 3QIIA 4FU6A 2OBRA 2QA4B 4CRIA 3CCQA 4WWVA 3RKXA 5HXBA 1OU9A 1KD1U 4C92G 2X85A 4XONA 2JTEA 3OW7A 2DL5A 2PZ1A 1GL5A 2YWWA 2DOGA 1G3SA 1RADB 3PENA 1Q82U 4WZTA 2C4TA 1WJRA 1KK7A 4X7EA 4E7HA 2VKNA 4DBRA 2RJFA 2VNIA 1M1FA 2L3QA 1EXMA 3CCSA 2XZOA 4R56A 1X6BA 4J5YA 2RH2A 1KRHA 4FXUA 2XDDA 1MMGA 3LVBA 1RAIB 2KBTA 3CC4Q 3A8JA 2MK5A 3CMMA 2RQRA 1W70A 4M53A 4PAAA 1DARA 1PJ5A 5IHKA 1NB9A 3VS6A 4XKWA 3ES9A 3CCMA 1MABA 1YIJQ 3A1PA 4BE2A 1TTHB 2DBKA 3G7ZA 1Y0MA 1BKBA 5GAMj 2HL5C 1QW1A 3NMZC 5KE3A 1E64A 3CC7Q 2HSPA 1AWXA 2OTLA 4RLZA 4PC7A 4RMOA 2KR3A 4E6RA 1Q86U 2PU9B 1JB9A 1SKUB 1PHTA 4PKCC 4J6WA 4BI3A 2O9SA 2V26A 4OMNA 4X9CA 1WHKA 4PFOA 1AT1B 3GNFB 5CQYA 1PNJA 3A35A 4LDXA 5GANh 1NG2A 1VQ4T 2E1BA 3OYEA 1UGSB 1K4US 3QUIA 3LH5A 1R5OA 3PT9A 4XM3A 4XN3A 1FX7A 1QQJA 5C0MA 1VQLB 3CPFA 4F7UA 1S72Q 7AT1B 2XNJA 2YWFA 1IB0A 1TLLA 2EYZA 2LNHB 1JA1A 1UD4A 4N0AA 4XLAA 3M4YA 4E7LA 1JB0E 1FNDA 2YWEA 2HKQB 2K2VA 3M5AA 3C94A 4JRKA 2CDTA 4RD3A 2CP0A 4RDJA 1UEBA 1M2VB 1QFZA 2LDMA 5KCHA 1T3LA 3LW5E 4GQNA 1AZEA 2X8KA 5I2MA 2HD0A 3LGFA 1FYNA 3EGXA 1I8FA 4OP0A 3LX7A 5C6SA 1EFCA 2EQKA 4MYUA 3JU4A 1D1AA 1ZUKA 2RI2A 1Y07A 3OBYA 2FB7A 5I11A 3KL9A 1VQ9B 3NTKA 3E1SA 1GAQA 3CCQQ 4OOSA 1WU8A 1VQOA 5TR9A 3HL8A 5HKKA 2JM9A 3OW2P 3WYAA 4LDUA 1Q81C 1M5Q1 3CC2T 1QKWA 3CPWP 2V7UA 2VJJA 1QCNA 3PVLA 1BPLA 4AMCA 4BI4A 5FRMA 4OVAA 4HE5A 4YAWA 2FYKA 4OMFB 3VRZA 3I55B 4OPOA 1BI3A 2A28A 3S6WA 1QVFA 5KYWA 3RERA 4QVDA 1VQPT 4X07A 1FXXA 1VQ7T 4JJBA 5IYRA 2LRQA 3VNUA 1H641 2DCUA 4ATOA 1ZSZA 2OI3A 3R6OA 1IZ6A 1FNBA 3PA2A 4N4IA 2CSIA 3M9QA 4E7KA 4M7AC 3JCMg 4M78E 3HP9A 2AKLA 1D0ZA 4C8QB 5GAMh 5GAOq 4JRPA 3ZL7C 1LJOA 3CCRQ 1MMDA 1HD3A 1WJSA 3JQRA 5A0DA 3FDRA 3HFNA 2BE9B 1M90R 1T5EA 2E6ZA 2DNUA 4QQ6A 1VLOA 4FYWB 3LH0A 1G7RA 1ZM4A 3CD6Q 3CTAA 3AVXA 3QFCA 2M02A 2EQMA 3WY9A 2DM1A 2LCCA 4FSXA 4C92A 2V7VA 4TT3A 1WSVA 3ZZTA 1JBMA 2I2LA 1VQ8A 1WZOA 4XTXA 1U2RA 5FLXE 1VQ5A 3A8IA 2P3MA 3L42A 1W34A 3T51B 1JJ2A 1N8RR 3OYBA 1KC8U 1H3ZA 5FW9A 1FNMA 2DIQA 4GY5A 1MV0B 5DM7R 1H8KA 1KC8R 5F4OA 1UGRB 2C0IA 4RTYA 1QG0A 3RESA 5JBQA 4E0FA 5IAYA 3UA7A 2EJ9A 3SDZA 1F60A 2E1HA 4J7IA 3B78A 2SEMA 3REAB 3I55Q 4PL6A 2RHYA 4EMKA 3GQBA 1N07A 2GTJA 4A4GA 4LDYA 3I35A 1E63A 1JA0A 2H8HA 5IXFA 3HTRA 4IUPA 4JMQA 3CESA 2DA9A 2M0OA 3WVDB 3Q6QA 2DD5A 2XKOC 1YITT 1VQPQ 2A0FB 1RAGB 4G7XA 4TKOB 3TSWA 1D3BB 3CCUA 4OMLA 4J9FA 3U2QA 3CCRB 1VQ7B 2NUTB 1BIBA 3CPWS 1SSHA 2PQWA 2VNHA 4M75D 2RK1A 3WNCA 2B7BA 5GANf 4F7UB 2EYYA 3I55T 2XD0A 3TQ7P 4B47A 2KEAA 1YI2Q 2CC2A 4F16A 5IK2A 1VYUA 1OB5A 3QXEB 3CXCB 1VQNA 1PJ6A 1Q9SA 3JQQA 3PNWC 5GANd 2YUPA 2DF6A 4QQDA 4KH1B 1H3HA 4Z4YA 4RTTA 4C0DC 3CMEQ 4M75A 4QVJA 1GBQA 3V7RA 3MHXA 2J7IA 4J9HA 2RK2A 4NL3A 2AZVA 3ME9A 3OBWA 3LO8A 4KULA 5KYUA 1D1NA 3SLNA 4R71A 1UD3A 2OTJB 2MWOA 2KSSA 4EMHA 1KQSA 3P26A 4YEJA 3VS4A 4MDXA 2RQUA 1RAHB 1AD5A 4Z1MA 3ZZUA 1S1NA 2LP5A 3CCRA 3MMPA 3L2QA 5KYYB 9ATCB 1U06A 2X3UA 3EG0A 4XMYA 3VUBA 1Q7YD 1SPKA 1P92A 1ZA2B 2FZGB 2VNKA 3CCQT 2X3XD 1BI2A 1YI2T 2F5TX 2RD1A 3QJYA 4M7DG 1W2BS 2CNDA 2NUPA 1EP1B 2RA2A 1P4MA 3X28B 3OYFA 2BTTA 4IUQA 3UT1A 1K73D 4ZN1A 2ROLA 1YJWQ 3X24B 1N5ZA 2X4YA 1EFTA 3CEYA 5J39A 3NE5B 4PC2A 1D1BA 1Q81R 4DNTB 2V31A 1DG1G 3T56B 3EHRA 5GMKi 1PKSA 2W0ZA 4AFSC 5DN6A 4EDUA 1YI2B 5GMKm 1IXDA 2X3WD 2MI6A 5D7UA 1AMOA 1G7TA 4RCCA 4HIZA 3ZPNA 2W6IA 2LT4A 4NOYA 2C0TA 2OTLQ 5AT1B 4DQKA 4PLLA 2GFAA 2D0QB 4TMTA 4K11A 4Z89A 2HQHA 5H59A 1OHHA 2LX7A 3CMEB 3UATA 3MPUB 1W87A 1ARKA 2BE7D 1M9SA 4P25A 5KYWB 3OYCA 1S72T 1X43A 2EAYA 2OTJA 2MYSA 4M78D 4EMKC 4G1VA 3JCMJ 4DEXA 3D26A 4M75G 2KI7A 3EG9B 1K9MU 1VOMA 5I21A 1WFWA 1PC0A 3ZIAA 1ABQA 1FWZA 4EH1A 2DXUA 2KROA 3JAME 4PJMA 4OB0B 2WPDA 1D8TA 4J9EA 2QTLA 4G1BA 2RHUA 1YN8A 4E2FB 3CCSQ 1H85A 3H0IA 3V76A 1VQMQ 3A8MB 2QA4A 2ZXHA 1VQ4A 2AHOA 4R0KA 1QVPA 2C06A 3A8LB 2KXDA 3JCMd 1VIEA 2KXCA 3M57A 2HNIA 3T53B 1BCMA 2CREA 1DDIA 2HDNB 4GLMA 1R0CB 4C92C 5HK0A 2PUOB 1G7CA 1W4SA 3D7SB 3WBJA 1KK3A 3I5RA 3I9QA 3B82A 2JNGA 4ZNXA 1TXQA 4M7AG 2K6DA 1VQKA 4LBZA 4KUIA 5IH2A 4IIMA 4DBHA 2XNDA 5TY0A 2GJPA 2DK3A 3H0FA 2QA4T 2CK3A 4XQFA 3CXCP 3FB9A 2R58A 1HJDA 3RR6A 3CCST 2DPPB 2Q6IA 1CSKA 3MEWA 2JN0A 4U9UA 5J3BA 2BIVA 3A98A 2OTLB 2VBSA 2D1XA 4Z4SA 1OX9A 2RJCA 4XLHA 1WQWA 5CIUA 4NS5A 1KK2A 1Q81D 4JZ3A 2AK5A 3OMGA 2FL7A 1XB2A 3E20A 3VV0A 1AWOA 1UE9A 1NEGA 3RDVA 1YJ9B 2GQVA 3J7AF 1VUBA 1RQRA 2XGJA 1WXTA 4M75E 4DBQA 1HK9A 3SLDA 4OMPA 2DD4A 2CT3A 2DEUA 4OOVA 5KSWB 1WLPB 2ZZDA 4BACA 2V7TA 2ZPIB 1SEMA 4OOXA 1R0BG 4GBQA 2RC5A 1Y71A 2Z6BD 3N5BB 2EJFA 2RPNA 4J9BA 4M77C 4RDLA 2F1MA 3JB9J 4HCCA 4ZCLA 1AOJA 2MIOA 4R55A 1YJNQ 2HCKA 3CC7B 4HT9A 3R6KA 1UB4A 4N3GA 1BBZA 2B86A 4E47A 4FYXB 3OZUA 1RAEB 4UZFA 5GAOm 1OZ2A 4AG2C 1WPYA 4XLCA 3VJPA 2E65A 1WOPA 3FIFA 2DIGA 1JXMA 3CC7T 2QQAA 4XN0A 1RL2A 1VQKB 1EP3B 3H6ZA 2L3SA 4RM0A 3VRYA 1C6VX 2KT8A 2CZ1B 1MUZA 2EFIA 2O01E 3JV3A 5IHNA 2E10A 2EIFA 3VYGA 2BF4A 4XTZA 1YCSB 1QH0A 3EFOA 3LLRA 2QK0A 3QPHA 1R5NA 2MOXA 2CZ0B 4CC2A 4WZEA 3VKIA 1MV3A 3FLGA 2RQTA 1UD8A 2PE3A 5J3OA 4RTZA 1E6HA 1NPRA 1I5LA 4HVWA 4M1KA 2RHIA 2K2MA 4X34A 1TOVA 1I81A 3Q1JA 2VV5A 3VS0A 2VC8A 1M90C 2WJYA 1YJNT 1BB9A 2RHZA 1FMKA 2BM1A 3VUZA 1OZ3A 1QFJA 2JUFA 2PNIA 3OAAA 1UD6A 4JJCA 4M2LA 4B9WA 4BE1A 4YELA 3M55A 1WNLA 1BLIA 3JSCA 4C43A 2EFGA 2C78A 2JJ2A 4P1VA 4EMGA 4FYVB 1Q82R 1VHEA 5FWCA 3OW2B 3QJ6A 1AWWA 2HLDA 1ZBJA 3Q3AA 4F7DA 1PKVA 4QVZA 2EQUA 1B2RA 3OFNA 1WGSA 2GNCA 3CXCA 2DRKA 4LC0A 4TMWA 3WNBA 4Y7CA 1TSFA 3GVLA 1EX4A 3OYKA 1ZM2A 1SG5A 3P8BB 3TVTA 4BUGA 1OX8A 4OMQA 1QKXA 4PJOG 4ESRA 2CBXA 4M75B 1IGQA 2FPFA 4WF2A 2XDBA 4OPSA 2D9RA 4RD2A 3ONYA 4RTXA 4C8QC 2LQWA 4AC9A 4FW1A 4ELZC 3EGUA 5GAN4 3DLLA 4WZKA 1JXOA 3CMEA 1OGIA 1N06A 4KKSA 1VQ5T 3TSZA 5A2QE 3G71A 1TH7A 3CCLT 4MYTA 5GAOl 2YHTA 1JJ2B 2GJRA 4D8KA 4L5GA 2C5BA 3U6BA 2WZNA 3OSVA 2DVJA 2LNVA 3C0CA 2K79A 4CQJA 2NUTA 5FRNA 5L46A 5GAN6 4M78B 1KHIA 3PIOA 1YJWT 3F70A 1NBMA 3A5ZB 4LBYA 1Q82C 4C8QF 3AVYA 3OA6A 4Y91A 3V8KA 3CMET 2VBTA 1FDRA 1VQ9Q 2WZPP 3SEJA 3VS7A 1A8PA 2C0OA 1WORA 5A0LA 4HVUA 1BK2A 1KQ1A 1F20A 2HBPA 3Q39A 1ABOA 4C8QA 4LUEA 5GANe 1YHQQ 2JTMA 3FKSA 4YAFA 3HPWA 1M30A 4ELYC 2WJVA 3QFRA 4B43A 4ZCIA 1IJEA 2VASA 1VQ8B 3CBPA 3OB9A 2R5MA 2LQKA 1OB0A 4IW3B 2IIMA 1FX0A 1UECA 2E3IA 1WQ7A 1ZHIA 2Y90A 2V1RA 4Z4TA 2X4WA 5FO0A 1PSEA 2GQIA 5IYPA 2O31A 4LE9A 3JB9F 4M7AF 1X2KA 3G4ST 2BVNA 2M9UA 4P3IA 4Z4VA 4PJOC 5A88A 1IO6A 4II3A 2ZPBB 2LQNA 1UFFA 2A3LA 3CCEQ 4RTVA 1VQNQ 3LQEA 5EG2A 4QV2A 1OI1A 4YAUA 4KGZB 1QUFA 1KC8D 2DTOA 1A0NB 3H9NA 1NJIC 3MP1A 2EYXA 4HKEA 2ZXIA 1WDTA 1KQSP 1S72A 3MEVA 4PK4A 1BQEA 1D2EA 2XEXA 1NDHA 1Q86R 1QVGS 4C8QD 4PJJA 3A3BA 2IVWA 2CZ7B 4ACAA 1ZA1B 1PCXA 1R77A 2EW3A 2M1HA 1D0YA 1Q86C 3G05A 1NEBA 4B9XA 1KD1R 4M75F 3PUNA 4AF7A 4F7UF 1AIPA 3SKBA 1YWPA 1VJSA 5DLOA 2PLFA 5IYNA 1VQOB 4OB2B 2QGGA 2VGNA 3DB4A 3PA1A 3G4SQ 5BSYA 1I07A 2DE0X 4FN5A 2VB6A 1CKAA 1UD2A 2LVMA 4TSFA 2PVDB 3ZBDA 2QG9B 4NCNA 4YHBA 1KZLA 3JCMf 4OPVA 3OKXA 2DAQA 1YFNA 1K0SA 5GANj 1IHWA 2RJDA 1VQKT 2HCJB 4MZTA 2K7AA 1YNZA 2X51A 5LJ5h 4P22A 2RI3A 5CK9A 1M8VA 1K8AC 4II2A 1QCFA 1CQXA 3ZFJA 5IYWA 4M77A 2KMTA 2AIRB 3AVWA 4OGEA 2CYZB 1IB8A 3CCEB 4BE0A 2IPOB 1Q95G 4NL2A 1D1CA 1E7OA 2F1LA 3CD6A 5LJ5f 5KCOA 3L2UA 2XICA 3JCMh 1I5OB 4LXCA 4KRTA 4E7ZA 2GTOA 4TN1A 1U1SA 2QMUA 1Q7YU 1X6GA 1PKTA 2BN4A 4BB7A 2JVVA 4BDZA 3MP8A 1GJRA 2RO0A 2OK8A 2BPOA 2FG0A 1QLYA 1EFUA 1LPLA 4FM4B 4M0LA 2XU8A 1WSRA 3UA6A 1E1QA 1NBEB 4XORA 4JRIA 1EFRA 2VUBA 3CMAT 3G71B 4ZGEB 4XAXB 3CD6T 3RMSA 2D6FA 4OB1B 1NJIU 1T6XA 1Q7YC 2KAFA 2XIDA 2KYMA 3DLMA 3MKDA 4FT4A 5LJ5j 1IGUA 2EKOA 2RC6A 5GAOr 3EGXB 1O9SA 2PVOB 4RD0A 2GK7A 2F5KA 5LJ3j 1IHMA 2ZTGA 4OMMA 2OTLT 1KJWA 1K73C 4FIBA 5GMKj 2L5QA 3SEMA 4BPRA 1I18A 4WQMA 1UJYA 5GAOp 4E7JA 4ASUA 4XLEA 3P8HA 1K9MC 2MCNA 1Y0RA 2X6WA 4JZ4A 4ANJA 2QQRA 3CCSB 4X9DA 2K3XA 5DSZA 5THXA 3ZUGA 3M56A 5CO7A 2CP5A 1DDGA 2K57A 2JIZA 3KUFA 2I1LA 4QQGA 4UZUA 2RI5A 2D3NA 1GCQC 3CC7A 3PVDA 4M78G 2DL3A 4MZMA 3CCMB 1AWJA 2CH4A 4DNRB 1Y96A 1V29B 2KGTA 2L3RA 3M54A 1VQLA 3BQJA 4TMXA 4X7CA 2WYRA 4QHYA 4C8QG 1S0UA 4RD4A 4UZEA 5TV2A 4WTOB 4P2NA 3BE3A 3E9FA 3M0TA 1WXBA 2YLCA 3OE7A 3JB9D 2HQEA 5FWBA 3QZ9B 2C2WA 3QWXX 3MO8A 3VYHB 3WNDA 1I1JA 1VQ5Q 1K8AD 2EIXA 3GBQA 3QFSA 3S3MA 1SKYB 2E1RA 1G3WA 4II1A 2KRMA 3RIRA 1HXDA 1HZEA 2QEXB 4RD1A 2DJQA 1YJNA 4FYYB 1W0JA 4X1VA 1N9SA 2YRDA 1B23P 1GCPA 2WSEE 1JJ2S 5LMZA 4Z8AA 2MF2A 4Y9RA 4PJOF 2XK0A 4M75C 2B7CA 2ZL6A 1EP2B 1QWEA 2OX7A 1QUEA 3FJ5A 1TG0A 2GJKA 4X0CA 1ZBXA 4ZCMA 2LTOA 3OYNA 3CC4B 2YUOA 2KVQG 2P4RA 3AVTA 3L2ZA 3BW1A 5CKDA 2J06A 4K1XA 1ELOA 1NRKA 1HYOA 2LCLA 4C92B 4PC6A 4A4HA 3NGPA 2QDLA 2HEQA 1N08A 4RPDA 2Y4YA 2NPFA 1Y96B 2Y4XA 2XHCA 3W2FA 1VQ7A 2QQ9A 4P26A 3CCMQ 4M7AE 4J8OA 1BCOA 1BI0A 1GFDA 4TMVA 1HSQA 2QDXA 4XD7A 1N8RU 5CVIA 1V76A 2P4TA 4JRQA 1H42A 1GCQA 3PFSA 3U6KA 4RPBA 3BH4A 1RQPA 2DKGA 2LZJA 3G71T 4M7DC 4Z4RA 1G83A 1MNDA 1WHHA 2EKHA 3TU4K 4EMKB 1EZZB 5E6TA 1VQKQ 2QI2A 4BD3A 3HFOA 4HVVA 4M77D 3X26B 1W2BP 1KD1D 4O5VA 1QVFB 2QEXQ 2DO3A 5GAMg 2BZYA 4MMKA 3A8OB 2VJIA 2EBPA 4M77G 1LOJA 1N9RA 2F2XA 2OK7A 2RNAA 1M3CA 2Q6OA 4JS4A 2KQWA 1RAAB 2QTXA 3E1YE 4QFMA 1KIKA 4RCZA 1WJQA 1M3BA 4KUDK 4RJLA 4DQ2A 3OP1A 4P6YA 3QSUA 2VWFA 2A7YA 4J6XA 4PJNA 1XQBA 2LQ8A 2YSQA 1E62A 3MHPA 4NBSA 3QYHB 2EGCA 3LWHA 2VYQA 4OMOA 1MRZA 2VBVA 2AKKA 3DB3A 3P8DA 3PGGA 5FU7B 2ABLA 1T0JA 4RG2A 1EIFA 3ER0A 5AN9A 1NZ9A 2FPDA 5CKBA 4M77B 2E70A 3FEOA 3G4SA 1W2BA 4RDKA 5GANg 2FO0A 1PRMC 1YITA 1PG5B 1X01A 2WR8A 1FNCA 4GLKA 4M7AD 2V7WA 1ZSGA 4HCKA 1X2QA 2K5IA 1ZX6A 1K1ZA 2COZA 5KYXA 3CCLA 2J7KA 2EYWA 4OF1A 1B07A 2M16A 3M0RA 1XQHA 3OYHA 3W2HA 3HRTA 3I55A 2XMFA 2EYQA 5HKCA 1YJWA 4CI0C 2X6XA 1VQNT 2LJ3A 4V2SA 2FVGA 4DBFA 1IRXA 2B8AA 2CS7A 1GO2A 4UAJA 1AZGB 2L2PA 4J0QA 1M1GA 2DTIA 1M2VA 4M7DD 2FEIA 2E5QA 4Y92A 5GAMf 3CPWA 3E2UA 3LGLA 2P0PA 4QUZA 2X53S 2LZ6B 1MGQA 1NYGA 2K3YA 1RLPC 2YUNA 2MPXC 3U23A 2QTZA 4QW2A 2D8JA 1I0CA 3SJPA 2DL4A 3CCRT 3OYYA 1OYXA 3WXMB 3E9GA 5CAIA 8AT1B 4TMZA 4RG8A 3DKMA 1WXUA 1VQ6T 2QQSA 2I0NA 4KT0E 1WP6A 3CCVB 1YHQB 3OS2A 2XOKA 3G6EB 1KG1A 4M7DB 5LJ3f 3PVQA 4KKUA 1PM3A 3MJXA 4MMLA 4C5IA 4E7IA 2RF0A 1M1KR 1GR1A 4G5GA 2J05A 1K8AR 3FC3A 4P9SA 3VMFA 1ZM9A 1FRNA 1VA7A 5KYUB 2ZPGB 4J9CA 3HKSA 4X7DA 4N3NA 5HZAA 5GV8A 1VQ4B 3J81k 1BX0A 1Y0YA 3EG3A 4J83A 4XR6A 1OV3A 3W5UA 2E4HA 3VS2A 1K28D 1QMCA 1YWOA 1YP5A 1F1BB 1TUIA 4PABA 1UUEA 1MHNA 5LJ5e 1GXIE 2O2OA 3OSSC 4EIKA 2DERA 1YBYA 2HQXA 4C5GA 3SWNB 1JRIA 1S4MA 3W5VA 3EG9A 2JTFA 4LBWA 2X35A 2ZAEA 3L2WA 2OTJT 1PWTA 4DK0A 1YLOA 2X6YA 3PMIA 3CW2A 3QBYA 2V1QA 1TS9A 3J81E 1TUDA 3ZC3A 1KQ2A 1SHGA 4M7AB 3NHNA 4M4SA 5GAN7 4C5HA 4D6WA 3W5HA 2EVRA 4KGXB 3ASRA 5KYXB 5GJWB 3GPLA 2CUBA 2OAWA 4B44A 3INZA 3BFMA 1MMAA 2QASA 1TUGB 3A8HB 3RUXA 1VQ8Q 4ZGDB 3G4SB 1W2BB 4XNFA 2YLBA 2EGEA 2OTJQ 2GPJA 1GRIA 1G3YA 4C0ZA 1YIJT 3CCJA 1N05A 4PFPA 4A4FA 5KE2A 1T6ZA 4AFUC 1OPKA 3CCMT 4KGVB 4C0GA 4MZPA 3REBB 4A53A 1Q86D 1QGYA 1RAFB 1N6AA 1RUWA 4L6V5 3JCMV 5LJ3e 1QGAA 1WX6A 3VO2A 3ZBTA 2FRWA 4PJLA 1JU5C 3CRZA 4LD9K 4J9GA 5IXBA 3M0UA 3CCLQ 1ZM3A 1AEYA 2P0KA 4PGOA 2VXEA 1LCKA 2WSCE 4XU1A 2D9TA 3DDYA 2BGJA 3OYLA 1VYVA 2ZITA 4P6VF 2XNCA 2YRCA 3OYDA 3MCAA 2V7QA 3CCJQ 3MCAB 3JCMW 4FWTA 4FT2A 4AT1B 3OQ5A 1BI1A 1B3QA 5LJ3d 2B5OA 1J9ZA 1WPCA 3CD6B 5GAN2 2G6FX 2DYBA 3HRSA 1QFYA 2JDIA 4AFQC 3CMAB 2JJ1A 4HXJA 1YHQT 3CCVT 3G71Q 2DFUA 4JLGA 2ECZA 5F4JA 3M0SA 2C77A 1BX1A 1NYFA 2CKKA 1FMVA 2CT4A 3X20B 2J6KA 1VQOQ 3KBGA 3O5ZA 3I56Q 1M90U 2L3PA 3M53A 1BU1A 5IT9E 3L1AA 4J9DA 2VNJA 3BNWA 4FSSA 2HL3A 1VQLT 2XG8D 4ZV4A 3I56A 4YTLA 2Z0WA 2EGAA 4ZGNB 3LNNA 1D3BA 4J6YA 3CCUB 4B3XA 2ROTA 1E1RA 1AHJB 1Q82D 1UMKA 3LQ6A 5DLQE 4TVRA 1OU8A 1K73R 2CP3A 1VQMB 4AFZC 3VU3C 3CC2Q 4C0FA 4LBVA 4JLIA 1D0XA 1MMNA 4QVCA 4DA4A 2V7XA 1UJ0A 1K8AU 2BGIA 3I56T 1RACB 2VVKA 8ATCB 2OBSA 1VQPB 2LT1A 4LD6A 1SF9A 2O88A 3URGA 4CC3A 4F14A 3WQZA 1R5BA 4B48A 1VQ7Q 4EPCA 4N4GA 1VQPA 5DY9A 1CNEA 3S3NA 2VBUA 3A8KA 5GMKl 4A54A 4BI8B 1RI0A 2HZYA 1GBRA 1I8DA 2Q6KA 3MEAA 4DQLA 1QVFS 4Y9UA 1VQ5B 5L23A 2FVUA 3GNGA 4PJOA 4DEYA 3Q6RA 4YXWA 5FNZA 3CMAQ 2DETA 3BY2A 4ZGJB 1J3TA 4ACBA 4O6JA 4XL9A 3EGDA 3THKA 2DMOA 1VIFA 4L8JA 3BY7A 4PNOA 4M7DE 2CRVA 4J9IA 2K4YA 3JB9G 4C92D 3I56B 1YJ9Q 1NJID 1PSFA 2CGHA 1TU0B 4H9GA 2Q6LA 4M7DA 2CP6A 2R9VA 4A4KA 1KK0A 2YWHA 1M1KD 2RB6A 3MEUA 2DXBA 2EWNA 2KYBA 4AVZA 3OYAA 4HE6A 4RUGA 3LWIA 3BY1A 5D6YA 3ASQA 2BM0A 2SRCA 2KRSA 4UC4A 3QHSA 2M0YA 1EWYA 2DXCA 1E3ZA 4JJDA 1K73U 1JNYA 2DRMA 3T9NA 2ESWA 1SKQA 2DYIA 2DTHA 1YJ9A 3SJZA 3SB2A 3AGQA 1D09B 2WSSA 3FJOA 5L8RE 2DL8A 2QAZA 4FCYA 4BY6C 1KK1A 2X0KA 1LNXA 2A36A 1V5VA 1OPLA 2LMJA 3RKWA 3UF4A 4RCBA 1BIAA 2ZZEA 1N0VC 3CP2A 1DJ7B 5DS0A 4N0AC 1YJ9T 2RHXA 2ZGWA 1VQ9A 1E43A 1N8RC 5IYQA 1BYMA 4B3FX 1N0UA 1XFOA 1VYTA 4X7FA 3A8GB 4XU3A 4QVAA 3H41A 2R5AA 4Q5WA 2K3BA 1W1FA 1LVKA 4P3YA 2DL7A 3M0PA 4IUVA 3OJWA 4LDWA 5GAMe 3V7SA 2DBMA 3G6ET 5A8AA 3NFCA 4ORZA 3EGDB 2W6JA 2ATCB 4AF6A 5I2SA 1G7SA 4XKVA 1M3AA 1NM7A 4JDSA 3GLXA 3M58A 1VQ6B 3M0QA 3C95A 4PLIA 1OB2A 4PC3A 2RM4A 4IKFA 2V8KA 4IIOA 3ULRB 5M9OA 2RJEA 2LJ1A 1W9XA 2E6NA 2KE9A 5FU6C 4PFZA 1W6XA 2L89A 1YIJB 3JRZA 2CH4W 1V0EA 3PUMA 2VXFA 2QYZA 3IQLA 1KD1C 4C0DB 4XOTA 2MMPA 4Y28E 1G5VA 5IHIA 4RCYA 5CKEA 3AVUA 1OQKA 2F2WA 4LNPA 3JCMQ 3QE2A 5HK3A 2E64A 3JB9I 2H3JA 5D6WA 2R57A 3JQPA 4XU0A 1JEGA 1SHFA 4IUUA 4DOWA 3OJXA 1CNFA 1K9MD 2R6HA 2F69A 2F43A 4ZN3A 1QVGA 4X06A 1UD5A 3WVEB 2JXBA 1QVFP 4ZTFA 5A0GA 2ZZGA 1YI2A 5HZBA 3OYJA 2GGRA 1Q81U 1WHMA 1G8XA 1S72B 4X05A 3EFOB 5D6XA 3JCMb 2DJZA 2EQJA 3CQTA 4A4EA 3SFMA 1RABB 1IREB 3SWNA 1K76A 1AVZC 2K5LA 2W10A 5KH6A 5B6IA 3OYGA 1YCYA 2P84A 4B3GA 4IURA 3VNVA 4FL6A 1E79A 3MP6A 1VQ6A 3OEEA 1EFNA 2ED1A 2DXTA 3QYGB 1TWBA 2OJ2A 1VQMT 2HDAA 2O4XA 2ZPHB 1B7TA 2JW4A 3NPFA 5I22A 1YX2A 3FPKA 2E12A 4XQ3A 1MNEA 5KYYA 1YIJA 3V8LA 3BC9A 4YAOA 2HSEB 3CCJT 1W0KA 1PD0A 3B8HA 2MWPA 2E5KA 1NPPA 3ASSA 3QDRB 3OW2S 1W35A 3QFTA 1G3TA 1KQSB 1JO8A 2PUKB 2RMOA 3I5SA 2LJ0A 1VQMA 1XE1A 4NNJA 1QP3A 1I4K1 4C92F 3R6JA 4P12A 3OYIA 3WBKA 4KKTA 1X69A 3CCVQ 1U8RA 2AZSA 2GCXA 4L59A 1KFZA 1E6GA 5HY6A 2L8DA 3OEHA 3OZWA 2GK6A 3HRUA 2OYNA 2YRVA 3H0HA 2RQVA 1QGZA 2QGFB 4Q7JB 3EG1A 4JJNK 5IN1A 5KW9A 3GOXA 2ZPFB 5EC7A 2KVOA 4OP7A 3UPUA 1VQLQ 2CF4A 3S3OA 2JMAA 2QQBA 1KSWA 3SWNC 2GBQA 4QKUA 2CUDA 1UGVA 3RBBB 3G1JA 1T6YA 2DILA 3PMTA 1QVGB 1E3XA 3EG2A 4JPBW 5BSXA 2XZLA 2GF7A 3OYMA 5FIUA 1UGQB 1ZLMA 1GFCA 2JJ9A 3META 3QKJA 3RNJA 3CMAA 4C0SA 3C12A 3V8JA 1YHQA 1OGJA 2D8HA 5FO1A 1V1CA 1XOVA 2X9HA 1ACMB 2X4JA 1IJFA 4M7DF 2QN6A 1PD1A 2J6OA 1UGPB 3JCMc 2DY1A 2E3HA 1VHOA 2F4NA 3RKYA 1WOOA 2YXYA 2CP2A 5KYNA 4MDWA 2PMDA 4WZLA 2CW5A 2ZZFA 2JT4A 3CPXA 1XJWB 2O4XB 1Z9ZA 5AYFA 3VS5A 3ZZ0A 3CCQB 3JCMX 2MAMA 2PTKA 1WHLA 1H92A 4CC7A 4PJOB 3CP8A 2NYSA 4C92E 1Y57A 1U3OA 2AHJB 4ZGQB 2JS2A 4F04B 3SD4A 2JMCA 2FZKB 3G6EQ 4M7AA 3L2RA 2QTVA 3M59A 1M90D 3EHQA 5CCAA 2E41A 3H94A 5FA6A 3GF5A 3FJPA 3UDCA 1K0XA 1ZSZC 1TUCA 4HCBA 4A63B 3AT1B 3OS1A 1X6OA 3PE0A 3A3GA 1QX4A 1WYXA 1X75C 3AVVA 1NLPC 4RTUA 1VQ4Q 1PJ7A 1U1TA 3NTHA 3ASPA 1UHCA 4XTWA 3HAGA 3QSYA 3VS1A 3LYIA 1SRLA 2M51A 1R8OB 4PC1A 4E7SA 4M77E 4RD6A 3VR6A 1FRQA 3CCVA 1H8HA 3EAEA 2GQFA 4Z4ZA 1CKBA 4G7WA 5GAOn 4RTWA 2X4XA 3BDLA 4M78C 1IHVA 3TCJA 2KNBB 2C5HA 5ECAA 2CSQA 2ZTNA 2NWMA 3AGPA 2DIEA 3ISXA 2COWA 3ONUA 4CC4B 3GVJA 1UDLA 2AT1B 4M4ZA 1WDXA 2ZL5A 1VF7A 2NLUA 4HT8A 5CKHA 3JCMP 4M78A 3ASKA 3L2VA 1B34A 1WHGA 1PRLC 6AT1B 4B6MA 2A08A 5GAN8 1GVHA 3M4GA 1NJIR 1TVCA 1WA7A 4XOPA 3CC4T 3VS3A 5GMKh 2IG0A 1QCOA 4WCIA 2DZ9A 4XK8E 1C1AA 1OEBA 5FU7C 1QWFA 2CZ6B 4XTVA 2XI9A 1WTHD 2LCSA 3V7CA 2KDSA 2KRNA 4YALA 4AG1C 1C0MA 3V7AA 2BMWA 5GMKe 1WI7A 1HVXA 4VUBA 1UG1A 2KT1A 4DOVA 4LUDA 1VQOT 4Z88A 2HBWA 2M5SA 5F4MA 2GFUA 1ZUNB 3EH1A 3H8ZA 3TEEA 3CC4A 4FW2A 2QEXT 1JJ2P 3ASTA 3CC2A 5LJ5d 2K9GA 4M77F 3CCLB 2OAUA 3KEWA 3ZBUA 3C4SA 5FROA 2HMAA 4HA8A 3JCMe 1K9AA 2ZBUA 3QDFA 5LJ5g 5GV7A 1M2OA 4FK8A 2OBTA 2H3EB 2ZL7A 5J35A 1VQNB 2QE7A 3ZEHA 3CBMA 5CQXA 4XU2A 5LJ3g 5HCKA 2O9VA 1XNIA 3CCJB 3BDUA 4JUVA 4HCZA 2ED0A 2QEXA 4ME7A
chains in the Genus database with same CATH topology
2QGGA 3HTRA 1PM3A 2DYIA 2DOGA 3A1PA 2F1LA 3H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGG A;  3HTR A;  1PM3 A;  2DYI A;  2DOG A;  3A1P A;  2F1L A;  3H9N A; 
#chains in the Genus database with same CATH topology
 2PVG B;  3OS0 A;  4JS5 A;  1WHJ A;  1JQQ A;  5GAN 5;  2FX3 A;  3G6E A;  2YWG A;  3OOC A;  1T3S A;  4PJO D;  3UWN A;  2DX1 A;  1B34 B;  2KY9 A;  2FPE A;  1RLQ C;  1COW A;  1SRM A;  2BUD A;  2ZPE B;  4C8Q E;  5J26 A;  2FHD A;  2C4U A;  1OOT A;  2BKD N;  2GRE A;  4QT7 A;  3GP8 A;  1VLY A;  5CKF A;  1KC8 C;  1WOS A;  2HAX A;  3EFS A;  2DZC A;  4X8I A;  2FRY A;  1O75 A;  5H5J A;  1M27 C;  2VZL A;  3FPP A;  3GIB A;  3BCF A;  3RMQ A;  2DVE A;  3OY9 A;  4XLF A;  2RQW A;  3TRE A;  5GAN 3;  4LDV A;  1QVG P;  3CCU Q;  3CB4 A;  1Y7X A;  5TRD A;  1VQ8 T;  2WSF E;  1YIT B;  3J80 E;  5LL6 S;  1ZSZ B;  2BV3 A;  2EJG A;  2QXF A;  2JZ2 A;  3CC2 B;  3GIR A;  2ZBV A;  1U5S A;  1OUL A;  2HKN A;  3QG1 A;  1V0F A;  1UHF A;  2V8J A;  3GVK A;  2V8I A;  3SHW A;  4D8D A;  5CDF A;  4Z02 A;  1T0H A;  3AHU A;  2ZCF B;  2NUZ A;  4OB3 B;  1BJK A;  1VQ9 T;  3RY8 A;  1KJZ A;  5FU6 B;  2F2V A;  1WIE A;  3VO1 A;  3FRN A;  2A37 A;  2D3L A;  2NV4 A;  3EFR A;  3Q38 A;  1YJW B;  3QO3 A;  3PIP A;  3BCD A;  5GJV B;  1K9M R;  2VYT A;  3I1F A;  1M1K U;  3PTA A;  3CXC S;  3HSB A;  4KH0 B;  3HHT B;  5GAM d;  3CCE A;  2JOY A;  2QA4 Q;  2EQI A;  1UTI A;  1NLO C;  2D0N A;  1KMH A;  3GSI A;  2XDP A;  4M78 F;  4ZTJ A;  1M1K C;  3CPW B;  4N4H A;  2BSA A;  4OGC A;  4PJO E;  1M4Z A;  3CCU T;  1FMW A;  4BDY A;  1TTT A;  3WXM A;  2KK4 A;  2V4D A;  3OW2 A;  1Q7Y R;  3OZV A;  2XZP A;  1NE8 A;  4B4D A;  2D74 A;  1XTD A;  2DEQ A;  3KXT A;  1G2B A;  2WAC A;  3O8V A;  2J6F A;  1N27 A;  2FZC B;  2LC4 A;  4F7U E;  3CCE T;  2ZZQ A;  3OS5 A;  2BZX A;  4Z4W A;  2ENM A;  3OMC A;  2NUP B;  3KFV A;  1Z9Q A;  2PIA A;  1NB0 A;  3X25 B;  2YDL A;  4XTY A;  3QZ5 B;  4Z4U A;  1X27 A;  1VQ6 Q;  2COY A;  2DLP A;  3JB9 H;  2JN9 A;  4F17 A;  1ZQ1 A;  4BY6 B;  4LN2 A;  1SSF A;  3E19 A;  1YIT Q;  1ZUU A;  5LJ3 h;  1GAW A;  2VGM A;  3P27 A;  2YT6 A;  1KHC A;  1I7P A;  1M8M A;  1ZUY A;  3R6N A;  1KTV A;  4DK1 A;  4KBM B;  3NTI A;  2BZ8 A;  4XTU A;  2LX9 A;  1QP2 A;  5FL7 A;  1N8R D;  2P0Q A;  3W2E A;  2G3R A;  5A89 A;  1SM4 A;  1YJN B;  2YUQ A;  5CR2 A;  4J7F A;  1H8E A;  3CBO A;  2RN8 A;  5KNL A;  2K5F A;  5EMN A;  4G6I A;  2JS0 A;  1KQS S;  1BMF A;  2QDY B;  2EPD A;  1RI9 A;  4C5E A;  3QWY A;  4P5N A;  2JM8 A;  2L0A A;  1HA3 A;  3EH2 A;  3W2G A;  4F7U G;  2CP7 A;  4IUT A;  4RKU E;  3OPO A;  4ROX A;  3W2I A;  3QII A;  4FU6 A;  2OBR A;  2QA4 B;  4CRI A;  3CCQ A;  4WWV A;  3RKX A;  5HXB A;  1OU9 A;  1KD1 U;  4C92 G;  2X85 A;  4XON A;  2JTE A;  3OW7 A;  2DL5 A;  2PZ1 A;  1GL5 A;  2YWW A;  2DOG A;  1G3S A;  1RAD B;  3PEN A;  1Q82 U;  4WZT A;  2C4T A;  1WJR A;  1KK7 A;  4X7E A;  4E7H A;  2VKN A;  4DBR A;  2RJF A;  2VNI A;  1M1F A;  2L3Q A;  1EXM A;  3CCS A;  2XZO A;  4R56 A;  1X6B A;  4J5Y A;  2RH2 A;  1KRH A;  4FXU A;  2XDD A;  1MMG A;  3LVB A;  1RAI B;  2KBT A;  3CC4 Q;  3A8J A;  2MK5 A;  3CMM A;  2RQR A;  1W70 A;  4M53 A;  4PAA A;  1DAR A;  1PJ5 A;  5IHK A;  1NB9 A;  3VS6 A;  4XKW A;  3ES9 A;  3CCM A;  1MAB A;  1YIJ Q;  3A1P A;  4BE2 A;  1TTH B;  2DBK A;  3G7Z A;  1Y0M A;  1BKB A;  5GAM j;  2HL5 C;  1QW1 A;  3NMZ C;  5KE3 A;  1E64 A;  3CC7 Q;  2HSP A;  1AWX A;  2OTL A;  4RLZ A;  4PC7 A;  4RMO A;  2KR3 A;  4E6R A;  1Q86 U;  2PU9 B;  1JB9 A;  1SKU B;  1PHT A;  4PKC C;  4J6W A;  4BI3 A;  2O9S A;  2V26 A;  4OMN A;  4X9C A;  1WHK A;  4PFO A;  1AT1 B;  3GNF B;  5CQY A;  1PNJ A;  3A35 A;  4LDX A;  5GAN h;  1NG2 A;  1VQ4 T;  2E1B A;  3OYE A;  1UGS B;  1K4U S;  3QUI A;  3LH5 A;  1R5O A;  3PT9 A;  4XM3 A;  4XN3 A;  1FX7 A;  1QQJ A;  5C0M A;  1VQL B;  3CPF A;  4F7U A;  1S72 Q;  7AT1 B;  2XNJ A;  2YWF A;  1IB0 A;  1TLL A;  2EYZ A;  2LNH B;  1JA1 A;  1UD4 A;  4N0A A;  4XLA A;  3M4Y A;  4E7L A;  1JB0 E;  1FND A;  2YWE A;  2HKQ B;  2K2V A;  3M5A A;  3C94 A;  4JRK A;  2CDT A;  4RD3 A;  2CP0 A;  4RDJ A;  1UEB A;  1M2V B;  1QFZ A;  2LDM A;  5KCH A;  1T3L A;  3LW5 E;  4GQN A;  1AZE A;  2X8K A;  5I2M A;  2HD0 A;  3LGF A;  1FYN A;  3EGX A;  1I8F A;  4OP0 A;  3LX7 A;  5C6S A;  1EFC A;  2EQK A;  4MYU A;  3JU4 A;  1D1A A;  1ZUK A;  2RI2 A;  1Y07 A;  3OBY A;  2FB7 A;  5I11 A;  3KL9 A;  1VQ9 B;  3NTK A;  3E1S A;  1GAQ A;  3CCQ Q;  4OOS A;  1WU8 A;  1VQO A;  5TR9 A;  3HL8 A;  5HKK A;  2JM9 A;  3OW2 P;  3WYA A;  4LDU A;  1Q81 C;  1M5Q 1;  3CC2 T;  1QKW A;  3CPW P;  2V7U A;  2VJJ A;  1QCN A;  3PVL A;  1BPL A;  4AMC A;  4BI4 A;  5FRM A;  4OVA A;  4HE5 A;  4YAW A;  2FYK A;  4OMF B;  3VRZ A;  3I55 B;  4OPO A;  1BI3 A;  2A28 A;  3S6W A;  1QVF A;  5KYW A;  3RER A;  4QVD A;  1VQP T;  4X07 A;  1FXX A;  1VQ7 T;  4JJB A;  5IYR A;  2LRQ A;  3VNU A;  1H64 1;  2DCU A;  4ATO A;  1ZSZ A;  2OI3 A;  3R6O A;  1IZ6 A;  1FNB A;  3PA2 A;  4N4I A;  2CSI A;  3M9Q A;  4E7K A;  4M7A C;  3JCM g;  4M78 E;  3HP9 A;  2AKL A;  1D0Z A;  4C8Q B;  5GAM h;  5GAO q;  4JRP A;  3ZL7 C;  1LJO A;  3CCR Q;  1MMD A;  1HD3 A;  1WJS A;  3JQR A;  5A0D A;  3FDR A;  3HFN A;  2BE9 B;  1M90 R;  1T5E A;  2E6Z A;  2DNU A;  4QQ6 A;  1VLO A;  4FYW B;  3LH0 A;  1G7R A;  1ZM4 A;  3CD6 Q;  3CTA A;  3AVX A;  3QFC A;  2M02 A;  2EQM A;  3WY9 A;  2DM1 A;  2LCC A;  4FSX A;  4C92 A;  2V7V A;  4TT3 A;  1WSV A;  3ZZT A;  1JBM A;  2I2L A;  1VQ8 A;  1WZO A;  4XTX A;  1U2R A;  5FLX E;  1VQ5 A;  3A8I A;  2P3M A;  3L42 A;  1W34 A;  3T51 B;  1JJ2 A;  1N8R R;  3OYB A;  1KC8 U;  1H3Z A;  5FW9 A;  1FNM A;  2DIQ A;  4GY5 A;  1MV0 B;  5DM7 R;  1H8K A;  1KC8 R;  5F4O A;  1UGR B;  2C0I A;  4RTY A;  1QG0 A;  3RES A;  5JBQ A;  4E0F A;  5IAY A;  3UA7 A;  2EJ9 A;  3SDZ A;  1F60 A;  2E1H A;  4J7I A;  3B78 A;  2SEM A;  3REA B;  3I55 Q;  4PL6 A;  2RHY A;  4EMK A;  3GQB A;  1N07 A;  2GTJ A;  4A4G A;  4LDY A;  3I35 A;  1E63 A;  1JA0 A;  2H8H A;  5IXF A;  3HTR A;  4IUP A;  4JMQ A;  3CES A;  2DA9 A;  2M0O A;  3WVD B;  3Q6Q A;  2DD5 A;  2XKO C;  1YIT T;  1VQP Q;  2A0F B;  1RAG B;  4G7X A;  4TKO B;  3TSW A;  1D3B B;  3CCU A;  4OML A;  4J9F A;  3U2Q A;  3CCR B;  1VQ7 B;  2NUT B;  1BIB A;  3CPW S;  1SSH A;  2PQW A;  2VNH A;  4M75 D;  2RK1 A;  3WNC A;  2B7B A;  5GAN f;  4F7U B;  2EYY A;  3I55 T;  2XD0 A;  3TQ7 P;  4B47 A;  2KEA A;  1YI2 Q;  2CC2 A;  4F16 A;  5IK2 A;  1VYU A;  1OB5 A;  3QXE B;  3CXC B;  1VQN A;  1PJ6 A;  1Q9S A;  3JQQ A;  3PNW C;  5GAN d;  2YUP A;  2DF6 A;  4QQD A;  4KH1 B;  1H3H A;  4Z4Y A;  4RTT A;  4C0D C;  3CME Q;  4M75 A;  4QVJ A;  1GBQ A;  3V7R A;  3MHX A;  2J7I A;  4J9H A;  2RK2 A;  4NL3 A;  2AZV A;  3ME9 A;  3OBW A;  3LO8 A;  4KUL A;  5KYU A;  1D1N A;  3SLN A;  4R71 A;  1UD3 A;  2OTJ B;  2MWO A;  2KSS A;  4EMH A;  1KQS A;  3P26 A;  4YEJ A;  3VS4 A;  4MDX A;  2RQU A;  1RAH B;  1AD5 A;  4Z1M A;  3ZZU A;  1S1N A;  2LP5 A;  3CCR A;  3MMP A;  3L2Q A;  5KYY B;  9ATC B;  1U06 A;  2X3U A;  3EG0 A;  4XMY A;  3VUB A;  1Q7Y D;  1SPK A;  1P92 A;  1ZA2 B;  2FZG B;  2VNK A;  3CCQ T;  2X3X D;  1BI2 A;  1YI2 T;  2F5T X;  2RD1 A;  3QJY A;  4M7D G;  1W2B S;  2CND A;  2NUP A;  1EP1 B;  2RA2 A;  1P4M A;  3X28 B;  3OYF A;  2BTT A;  4IUQ A;  3UT1 A;  1K73 D;  4ZN1 A;  2ROL A;  1YJW Q;  3X24 B;  1N5Z A;  2X4Y A;  1EFT A;  3CEY A;  5J39 A;  3NE5 B;  4PC2 A;  1D1B A;  1Q81 R;  4DNT B;  2V31 A;  1DG1 G;  3T56 B;  3EHR A;  5GMK i;  1PKS A;  2W0Z A;  4AFS C;  5DN6 A;  4EDU A;  1YI2 B;  5GMK m;  1IXD A;  2X3W D;  2MI6 A;  5D7U A;  1AMO A;  1G7T A;  4RCC A;  4HIZ A;  3ZPN A;  2W6I A;  2LT4 A;  4NOY A;  2C0T A;  2OTL Q;  5AT1 B;  4DQK A;  4PLL A;  2GFA A;  2D0Q B;  4TMT A;  4K11 A;  4Z89 A;  2HQH A;  5H59 A;  1OHH A;  2LX7 A;  3CME B;  3UAT A;  3MPU B;  1W87 A;  1ARK A;  2BE7 D;  1M9S A;  4P25 A;  5KYW B;  3OYC A;  1S72 T;  1X43 A;  2EAY A;  2OTJ A;  2MYS A;  4M78 D;  4EMK C;  4G1V A;  3JCM J;  4DEX A;  3D26 A;  4M75 G;  2KI7 A;  3EG9 B;  1K9M U;  1VOM A;  5I21 A;  1WFW A;  1PC0 A;  3ZIA A;  1ABQ A;  1FWZ A;  4EH1 A;  2DXU A;  2KRO A;  3JAM E;  4PJM A;  4OB0 B;  2WPD A;  1D8T A;  4J9E A;  2QTL A;  4G1B A;  2RHU A;  1YN8 A;  4E2F B;  3CCS Q;  1H85 A;  3H0I A;  3V76 A;  1VQM Q;  3A8M B;  2QA4 A;  2ZXH A;  1VQ4 A;  2AHO A;  4R0K A;  1QVP A;  2C06 A;  3A8L B;  2KXD A;  3JCM d;  1VIE A;  2KXC A;  3M57 A;  2HNI A;  3T53 B;  1BCM A;  2CRE A;  1DDI A;  2HDN B;  4GLM A;  1R0C B;  4C92 C;  5HK0 A;  2PUO B;  1G7C A;  1W4S A;  3D7S B;  3WBJ A;  1KK3 A;  3I5R A;  3I9Q A;  3B82 A;  2JNG A;  4ZNX A;  1TXQ A;  4M7A G;  2K6D A;  1VQK A;  4LBZ A;  4KUI A;  5IH2 A;  4IIM A;  4DBH A;  2XND A;  5TY0 A;  2GJP A;  2DK3 A;  3H0F A;  2QA4 T;  2CK3 A;  4XQF A;  3CXC P;  3FB9 A;  2R58 A;  1HJD A;  3RR6 A;  3CCS T;  2DPP B;  2Q6I A;  1CSK A;  3MEW A;  2JN0 A;  4U9U A;  5J3B A;  2BIV A;  3A98 A;  2OTL B;  2VBS A;  2D1X A;  4Z4S A;  1OX9 A;  2RJC A;  4XLH A;  1WQW A;  5CIU A;  4NS5 A;  1KK2 A;  1Q81 D;  4JZ3 A;  2AK5 A;  3OMG A;  2FL7 A;  1XB2 A;  3E20 A;  3VV0 A;  1AWO A;  1UE9 A;  1NEG A;  3RDV A;  1YJ9 B;  2GQV A;  3J7A F;  1VUB A;  1RQR A;  2XGJ A;  1WXT A;  4M75 E;  4DBQ A;  1HK9 A;  3SLD A;  4OMP A;  2DD4 A;  2CT3 A;  2DEU A;  4OOV A;  5KSW B;  1WLP B;  2ZZD A;  4BAC A;  2V7T A;  2ZPI B;  1SEM A;  4OOX A;  1R0B G;  4GBQ A;  2RC5 A;  1Y71 A;  2Z6B D;  3N5B B;  2EJF A;  2RPN A;  4J9B A;  4M77 C;  4RDL A;  2F1M A;  3JB9 J;  4HCC A;  4ZCL A;  1AOJ A;  2MIO A;  4R55 A;  1YJN Q;  2HCK A;  3CC7 B;  4HT9 A;  3R6K A;  1UB4 A;  4N3G A;  1BBZ A;  2B86 A;  4E47 A;  4FYX B;  3OZU A;  1RAE B;  4UZF A;  5GAO m;  1OZ2 A;  4AG2 C;  1WPY A;  4XLC A;  3VJP A;  2E65 A;  1WOP A;  3FIF A;  2DIG A;  1JXM A;  3CC7 T;  2QQA A;  4XN0 A;  1RL2 A;  1VQK B;  1EP3 B;  3H6Z A;  2L3S A;  4RM0 A;  3VRY A;  1C6V X;  2KT8 A;  2CZ1 B;  1MUZ A;  2EFI A;  2O01 E;  3JV3 A;  5IHN A;  2E10 A;  2EIF A;  3VYG A;  2BF4 A;  4XTZ A;  1YCS B;  1QH0 A;  3EFO A;  3LLR A;  2QK0 A;  3QPH A;  1R5N A;  2MOX A;  2CZ0 B;  4CC2 A;  4WZE A;  3VKI A;  1MV3 A;  3FLG A;  2RQT A;  1UD8 A;  2PE3 A;  5J3O A;  4RTZ A;  1E6H A;  1NPR A;  1I5L A;  4HVW A;  4M1K A;  2RHI A;  2K2M A;  4X34 A;  1TOV A;  1I81 A;  3Q1J A;  2VV5 A;  3VS0 A;  2VC8 A;  1M90 C;  2WJY A;  1YJN T;  1BB9 A;  2RHZ A;  1FMK A;  2BM1 A;  3VUZ A;  1OZ3 A;  1QFJ A;  2JUF A;  2PNI A;  3OAA A;  1UD6 A;  4JJC A;  4M2L A;  4B9W A;  4BE1 A;  4YEL A;  3M55 A;  1WNL A;  1BLI A;  3JSC A;  4C43 A;  2EFG A;  2C78 A;  2JJ2 A;  4P1V A;  4EMG A;  4FYV B;  1Q82 R;  1VHE A;  5FWC A;  3OW2 B;  3QJ6 A;  1AWW A;  2HLD A;  1ZBJ A;  3Q3A A;  4F7D A;  1PKV A;  4QVZ A;  2EQU A;  1B2R A;  3OFN A;  1WGS A;  2GNC A;  3CXC A;  2DRK A;  4LC0 A;  4TMW A;  3WNB A;  4Y7C A;  1TSF A;  3GVL A;  1EX4 A;  3OYK A;  1ZM2 A;  1SG5 A;  3P8B B;  3TVT A;  4BUG A;  1OX8 A;  4OMQ A;  1QKX A;  4PJO G;  4ESR A;  2CBX A;  4M75 B;  1IGQ A;  2FPF A;  4WF2 A;  2XDB A;  4OPS A;  2D9R A;  4RD2 A;  3ONY A;  4RTX A;  4C8Q C;  2LQW A;  4AC9 A;  4FW1 A;  4ELZ C;  3EGU A;  5GAN 4;  3DLL A;  4WZK A;  1JXO A;  3CME A;  1OGI A;  1N06 A;  4KKS A;  1VQ5 T;  3TSZ A;  5A2Q E;  3G71 A;  1TH7 A;  3CCL T;  4MYT A;  5GAO l;  2YHT A;  1JJ2 B;  2GJR A;  4D8K A;  4L5G A;  2C5B A;  3U6B A;  2WZN A;  3OSV A;  2DVJ A;  2LNV A;  3C0C A;  2K79 A;  4CQJ A;  2NUT A;  5FRN A;  5L46 A;  5GAN 6;  4M78 B;  1KHI A;  3PIO A;  1YJW T;  3F70 A;  1NBM A;  3A5Z B;  4LBY A;  1Q82 C;  4C8Q F;  3AVY A;  3OA6 A;  4Y91 A;  3V8K A;  3CME T;  2VBT A;  1FDR A;  1VQ9 Q;  2WZP P;  3SEJ A;  3VS7 A;  1A8P A;  2C0O A;  1WOR A;  5A0L A;  4HVU A;  1BK2 A;  1KQ1 A;  1F20 A;  2HBP A;  3Q39 A;  1ABO A;  4C8Q A;  4LUE A;  5GAN e;  1YHQ Q;  2JTM A;  3FKS A;  4YAF A;  3HPW A;  1M30 A;  4ELY C;  2WJV A;  3QFR A;  4B43 A;  4ZCI A;  1IJE A;  2VAS A;  1VQ8 B;  3CBP A;  3OB9 A;  2R5M A;  2LQK A;  1OB0 A;  4IW3 B;  2IIM A;  1FX0 A;  1UEC A;  2E3I A;  1WQ7 A;  1ZHI A;  2Y90 A;  2V1R A;  4Z4T A;  2X4W A;  5FO0 A;  1PSE A;  2GQI A;  5IYP A;  2O31 A;  4LE9 A;  3JB9 F;  4M7A F;  1X2K A;  3G4S T;  2BVN A;  2M9U A;  4P3I A;  4Z4V A;  4PJO C;  5A88 A;  1IO6 A;  4II3 A;  2ZPB B;  2LQN A;  1UFF A;  2A3L A;  3CCE Q;  4RTV A;  1VQN Q;  3LQE A;  5EG2 A;  4QV2 A;  1OI1 A;  4YAU A;  4KGZ B;  1QUF A;  1KC8 D;  2DTO A;  1A0N B;  3H9N A;  1NJI C;  3MP1 A;  2EYX A;  4HKE A;  2ZXI A;  1WDT A;  1KQS P;  1S72 A;  3MEV A;  4PK4 A;  1BQE A;  1D2E A;  2XEX A;  1NDH A;  1Q86 R;  1QVG S;  4C8Q D;  4PJJ A;  3A3B A;  2IVW A;  2CZ7 B;  4ACA A;  1ZA1 B;  1PCX A;  1R77 A;  2EW3 A;  2M1H A;  1D0Y A;  1Q86 C;  3G05 A;  1NEB A;  4B9X A;  1KD1 R;  4M75 F;  3PUN A;  4AF7 A;  4F7U F;  1AIP A;  3SKB A;  1YWP A;  1VJS A;  5DLO A;  2PLF A;  5IYN A;  1VQO B;  4OB2 B;  2QGG A;  2VGN A;  3DB4 A;  3PA1 A;  3G4S Q;  5BSY A;  1I07 A;  2DE0 X;  4FN5 A;  2VB6 A;  1CKA A;  1UD2 A;  2LVM A;  4TSF A;  2PVD B;  3ZBD A;  2QG9 B;  4NCN A;  4YHB A;  1KZL A;  3JCM f;  4OPV A;  3OKX A;  2DAQ A;  1YFN A;  1K0S A;  5GAN j;  1IHW A;  2RJD A;  1VQK T;  2HCJ B;  4MZT A;  2K7A A;  1YNZ A;  2X51 A;  5LJ5 h;  4P22 A;  2RI3 A;  5CK9 A;  1M8V A;  1K8A C;  4II2 A;  1QCF A;  1CQX A;  3ZFJ A;  5IYW A;  4M77 A;  2KMT A;  2AIR B;  3AVW A;  4OGE A;  2CYZ B;  1IB8 A;  3CCE B;  4BE0 A;  2IPO B;  1Q95 G;  4NL2 A;  1D1C A;  1E7O A;  2F1L A;  3CD6 A;  5LJ5 f;  5KCO A;  3L2U A;  2XIC A;  3JCM h;  1I5O B;  4LXC A;  4KRT A;  4E7Z A;  2GTO A;  4TN1 A;  1U1S A;  2QMU A;  1Q7Y U;  1X6G A;  1PKT A;  2BN4 A;  4BB7 A;  2JVV A;  4BDZ A;  3MP8 A;  1GJR A;  2RO0 A;  2OK8 A;  2BPO A;  2FG0 A;  1QLY A;  1EFU A;  1LPL A;  4FM4 B;  4M0L A;  2XU8 A;  1WSR A;  3UA6 A;  1E1Q A;  1NBE B;  4XOR A;  4JRI A;  1EFR A;  2VUB A;  3CMA T;  3G71 B;  4ZGE B;  4XAX B;  3CD6 T;  3RMS A;  2D6F A;  4OB1 B;  1NJI U;  1T6X A;  1Q7Y C;  2KAF A;  2XID A;  2KYM A;  3DLM A;  3MKD A;  4FT4 A;  5LJ5 j;  1IGU A;  2EKO A;  2RC6 A;  5GAO r;  3EGX B;  1O9S A;  2PVO B;  4RD0 A;  2GK7 A;  2F5K A;  5LJ3 j;  1IHM A;  2ZTG A;  4OMM A;  2OTL T;  1KJW A;  1K73 C;  4FIB A;  5GMK j;  2L5Q A;  3SEM A;  4BPR A;  1I18 A;  4WQM A;  1UJY A;  5GAO p;  4E7J A;  4ASU A;  4XLE A;  3P8H A;  1K9M C;  2MCN A;  1Y0R A;  2X6W A;  4JZ4 A;  4ANJ A;  2QQR A;  3CCS B;  4X9D A;  2K3X A;  5DSZ A;  5THX A;  3ZUG A;  3M56 A;  5CO7 A;  2CP5 A;  1DDG A;  2K57 A;  2JIZ A;  3KUF A;  2I1L A;  4QQG A;  4UZU A;  2RI5 A;  2D3N A;  1GCQ C;  3CC7 A;  3PVD A;  4M78 G;  2DL3 A;  4MZM A;  3CCM B;  1AWJ A;  2CH4 A;  4DNR B;  1Y96 A;  1V29 B;  2KGT A;  2L3R A;  3M54 A;  1VQL A;  3BQJ A;  4TMX A;  4X7C A;  2WYR A;  4QHY A;  4C8Q G;  1S0U A;  4RD4 A;  4UZE A;  5TV2 A;  4WTO B;  4P2N A;  3BE3 A;  3E9F A;  3M0T A;  1WXB A;  2YLC A;  3OE7 A;  3JB9 D;  2HQE A;  5FWB A;  3QZ9 B;  2C2W A;  3QWX X;  3MO8 A;  3VYH B;  3WND A;  1I1J A;  1VQ5 Q;  1K8A D;  2EIX A;  3GBQ A;  3QFS A;  3S3M A;  1SKY B;  2E1R A;  1G3W A;  4II1 A;  2KRM A;  3RIR A;  1HXD A;  1HZE A;  2QEX B;  4RD1 A;  2DJQ A;  1YJN A;  4FYY B;  1W0J A;  4X1V A;  1N9S A;  2YRD A;  1B23 P;  1GCP A;  2WSE E;  1JJ2 S;  5LMZ A;  4Z8A A;  2MF2 A;  4Y9R A;  4PJO F;  2XK0 A;  4M75 C;  2B7C A;  2ZL6 A;  1EP2 B;  1QWE A;  2OX7 A;  1QUE A;  3FJ5 A;  1TG0 A;  2GJK A;  4X0C A;  1ZBX A;  4ZCM A;  2LTO A;  3OYN A;  3CC4 B;  2YUO A;  2KVQ G;  2P4R A;  3AVT A;  3L2Z A;  3BW1 A;  5CKD A;  2J06 A;  4K1X A;  1ELO A;  1NRK A;  1HYO A;  2LCL A;  4C92 B;  4PC6 A;  4A4H A;  3NGP A;  2QDL A;  2HEQ A;  1N08 A;  4RPD A;  2Y4Y A;  2NPF A;  1Y96 B;  2Y4X A;  2XHC A;  3W2F A;  1VQ7 A;  2QQ9 A;  4P26 A;  3CCM Q;  4M7A E;  4J8O A;  1BCO A;  1BI0 A;  1GFD A;  4TMV A;  1HSQ A;  2QDX A;  4XD7 A;  1N8R U;  5CVI A;  1V76 A;  2P4T A;  4JRQ A;  1H42 A;  1GCQ A;  3PFS A;  3U6K A;  4RPB A;  3BH4 A;  1RQP A;  2DKG A;  2LZJ A;  3G71 T;  4M7D C;  4Z4R A;  1G83 A;  1MND A;  1WHH A;  2EKH A;  3TU4 K;  4EMK B;  1EZZ B;  5E6T A;  1VQK Q;  2QI2 A;  4BD3 A;  3HFO A;  4HVV A;  4M77 D;  3X26 B;  1W2B P;  1KD1 D;  4O5V A;  1QVF B;  2QEX Q;  2DO3 A;  5GAM g;  2BZY A;  4MMK A;  3A8O B;  2VJI A;  2EBP A;  4M77 G;  1LOJ A;  1N9R A;  2F2X A;  2OK7 A;  2RNA A;  1M3C A;  2Q6O A;  4JS4 A;  2KQW A;  1RAA B;  2QTX A;  3E1Y E;  4QFM A;  1KIK A;  4RCZ A;  1WJQ A;  1M3B A;  4KUD K;  4RJL A;  4DQ2 A;  3OP1 A;  4P6Y A;  3QSU A;  2VWF A;  2A7Y A;  4J6X A;  4PJN A;  1XQB A;  2LQ8 A;  2YSQ A;  1E62 A;  3MHP A;  4NBS A;  3QYH B;  2EGC A;  3LWH A;  2VYQ A;  4OMO A;  1MRZ A;  2VBV A;  2AKK A;  3DB3 A;  3P8D A;  3PGG A;  5FU7 B;  2ABL A;  1T0J A;  4RG2 A;  1EIF A;  3ER0 A;  5AN9 A;  1NZ9 A;  2FPD A;  5CKB A;  4M77 B;  2E70 A;  3FEO A;  3G4S A;  1W2B A;  4RDK A;  5GAN g;  2FO0 A;  1PRM C;  1YIT A;  1PG5 B;  1X01 A;  2WR8 A;  1FNC A;  4GLK A;  4M7A D;  2V7W A;  1ZSG A;  4HCK A;  1X2Q A;  2K5I A;  1ZX6 A;  1K1Z A;  2COZ A;  5KYX A;  3CCL A;  2J7K A;  2EYW A;  4OF1 A;  1B07 A;  2M16 A;  3M0R A;  1XQH A;  3OYH A;  3W2H A;  3HRT A;  3I55 A;  2XMF A;  2EYQ A;  5HKC A;  1YJW A;  4CI0 C;  2X6X A;  1VQN T;  2LJ3 A;  4V2S A;  2FVG A;  4DBF A;  1IRX A;  2B8A A;  2CS7 A;  1GO2 A;  4UAJ A;  1AZG B;  2L2P A;  4J0Q A;  1M1G A;  2DTI A;  1M2V A;  4M7D D;  2FEI A;  2E5Q A;  4Y92 A;  5GAM f;  3CPW A;  3E2U A;  3LGL A;  2P0P A;  4QUZ A;  2X53 S;  2LZ6 B;  1MGQ A;  1NYG A;  2K3Y A;  1RLP C;  2YUN A;  2MPX C;  3U23 A;  2QTZ A;  4QW2 A;  2D8J A;  1I0C A;  3SJP A;  2DL4 A;  3CCR T;  3OYY A;  1OYX A;  3WXM B;  3E9G A;  5CAI A;  8AT1 B;  4TMZ A;  4RG8 A;  3DKM A;  1WXU A;  1VQ6 T;  2QQS A;  2I0N A;  4KT0 E;  1WP6 A;  3CCV B;  1YHQ B;  3OS2 A;  2XOK A;  3G6E B;  1KG1 A;  4M7D B;  5LJ3 f;  3PVQ A;  4KKU A;  1PM3 A;  3MJX A;  4MML A;  4C5I A;  4E7I A;  2RF0 A;  1M1K R;  1GR1 A;  4G5G A;  2J05 A;  1K8A R;  3FC3 A;  4P9S A;  3VMF A;  1ZM9 A;  1FRN A;  1VA7 A;  5KYU B;  2ZPG B;  4J9C A;  3HKS A;  4X7D A;  4N3N A;  5HZA A;  5GV8 A;  1VQ4 B;  3J81 k;  1BX0 A;  1Y0Y A;  3EG3 A;  4J83 A;  4XR6 A;  1OV3 A;  3W5U A;  2E4H A;  3VS2 A;  1K28 D;  1QMC A;  1YWO A;  1YP5 A;  1F1B B;  1TUI A;  4PAB A;  1UUE A;  1MHN A;  5LJ5 e;  1GXI E;  2O2O A;  3OSS C;  4EIK A;  2DER A;  1YBY A;  2HQX A;  4C5G A;  3SWN B;  1JRI A;  1S4M A;  3W5V A;  3EG9 A;  2JTF A;  4LBW A;  2X35 A;  2ZAE A;  3L2W A;  2OTJ T;  1PWT A;  4DK0 A;  1YLO A;  2X6Y A;  3PMI A;  3CW2 A;  3QBY A;  2V1Q A;  1TS9 A;  3J81 E;  1TUD A;  3ZC3 A;  1KQ2 A;  1SHG A;  4M7A B;  3NHN A;  4M4S A;  5GAN 7;  4C5H A;  4D6W A;  3W5H A;  2EVR A;  4KGX B;  3ASR A;  5KYX B;  5GJW B;  3GPL A;  2CUB A;  2OAW A;  4B44 A;  3INZ A;  3BFM A;  1MMA A;  2QAS A;  1TUG B;  3A8H B;  3RUX A;  1VQ8 Q;  4ZGD B;  3G4S B;  1W2B B;  4XNF A;  2YLB A;  2EGE A;  2OTJ Q;  2GPJ A;  1GRI A;  1G3Y A;  4C0Z A;  1YIJ T;  3CCJ A;  1N05 A;  4PFP A;  4A4F A;  5KE2 A;  1T6Z A;  4AFU C;  1OPK A;  3CCM T;  4KGV B;  4C0G A;  4MZP A;  3REB B;  4A53 A;  1Q86 D;  1QGY A;  1RAF B;  1N6A A;  1RUW A;  4L6V 5;  3JCM V;  5LJ3 e;  1QGA A;  1WX6 A;  3VO2 A;  3ZBT A;  2FRW A;  4PJL A;  1JU5 C;  3CRZ A;  4LD9 K;  4J9G A;  5IXB A;  3M0U A;  3CCL Q;  1ZM3 A;  1AEY A;  2P0K A;  4PGO A;  2VXE A;  1LCK A;  2WSC E;  4XU1 A;  2D9T A;  3DDY A;  2BGJ A;  3OYL A;  1VYV A;  2ZIT A;  4P6V F;  2XNC A;  2YRC A;  3OYD A;  3MCA A;  2V7Q A;  3CCJ Q;  3MCA B;  3JCM W;  4FWT A;  4FT2 A;  4AT1 B;  3OQ5 A;  1BI1 A;  1B3Q A;  5LJ3 d;  2B5O A;  1J9Z A;  1WPC A;  3CD6 B;  5GAN 2;  2G6F X;  2DYB A;  3HRS A;  1QFY A;  2JDI A;  4AFQ C;  3CMA B;  2JJ1 A;  4HXJ A;  1YHQ T;  3CCV T;  3G71 Q;  2DFU A;  4JLG A;  2ECZ A;  5F4J A;  3M0S A;  2C77 A;  1BX1 A;  1NYF A;  2CKK A;  1FMV A;  2CT4 A;  3X20 B;  2J6K A;  1VQO Q;  3KBG A;  3O5Z A;  3I56 Q;  1M90 U;  2L3P A;  3M53 A;  1BU1 A;  5IT9 E;  3L1A A;  4J9D A;  2VNJ A;  3BNW A;  4FSS A;  2HL3 A;  1VQL T;  2XG8 D;  4ZV4 A;  3I56 A;  4YTL A;  2Z0W A;  2EGA A;  4ZGN B;  3LNN A;  1D3B A;  4J6Y A;  3CCU B;  4B3X A;  2ROT A;  1E1R A;  1AHJ B;  1Q82 D;  1UMK A;  3LQ6 A;  5DLQ E;  4TVR A;  1OU8 A;  1K73 R;  2CP3 A;  1VQM B;  4AFZ C;  3VU3 C;  3CC2 Q;  4C0F A;  4LBV A;  4JLI A;  1D0X A;  1MMN A;  4QVC A;  4DA4 A;  2V7X A;  1UJ0 A;  1K8A U;  2BGI A;  3I56 T;  1RAC B;  2VVK A;  8ATC B;  2OBS A;  1VQP B;  2LT1 A;  4LD6 A;  1SF9 A;  2O88 A;  3URG A;  4CC3 A;  4F14 A;  3WQZ A;  1R5B A;  4B48 A;  1VQ7 Q;  4EPC A;  4N4G A;  1VQP A;  5DY9 A;  1CNE A;  3S3N A;  2VBU A;  3A8K A;  5GMK l;  4A54 A;  4BI8 B;  1RI0 A;  2HZY A;  1GBR A;  1I8D A;  2Q6K A;  3MEA A;  4DQL A;  1QVF S;  4Y9U A;  1VQ5 B;  5L23 A;  2FVU A;  3GNG A;  4PJO A;  4DEY A;  3Q6R A;  4YXW A;  5FNZ A;  3CMA Q;  2DET A;  3BY2 A;  4ZGJ B;  1J3T A;  4ACB A;  4O6J A;  4XL9 A;  3EGD A;  3THK A;  2DMO A;  1VIF A;  4L8J A;  3BY7 A;  4PNO A;  4M7D E;  2CRV A;  4J9I A;  2K4Y A;  3JB9 G;  4C92 D;  3I56 B;  1YJ9 Q;  1NJI D;  1PSF A;  2CGH A;  1TU0 B;  4H9G A;  2Q6L A;  4M7D A;  2CP6 A;  2R9V A;  4A4K A;  1KK0 A;  2YWH A;  1M1K D;  2RB6 A;  3MEU A;  2DXB A;  2EWN A;  2KYB A;  4AVZ A;  3OYA A;  4HE6 A;  4RUG A;  3LWI A;  3BY1 A;  5D6Y A;  3ASQ A;  2BM0 A;  2SRC A;  2KRS A;  4UC4 A;  3QHS A;  2M0Y A;  1EWY A;  2DXC A;  1E3Z A;  4JJD A;  1K73 U;  1JNY A;  2DRM A;  3T9N A;  2ESW A;  1SKQ A;  2DYI A;  2DTH A;  1YJ9 A;  3SJZ A;  3SB2 A;  3AGQ A;  1D09 B;  2WSS A;  3FJO A;  5L8R E;  2DL8 A;  2QAZ A;  4FCY A;  4BY6 C;  1KK1 A;  2X0K A;  1LNX A;  2A36 A;  1V5V A;  1OPL A;  2LMJ A;  3RKW A;  3UF4 A;  4RCB A;  1BIA A;  2ZZE A;  1N0V C;  3CP2 A;  1DJ7 B;  5DS0 A;  4N0A C;  1YJ9 T;  2RHX A;  2ZGW A;  1VQ9 A;  1E43 A;  1N8R C;  5IYQ A;  1BYM A;  4B3F X;  1N0U A;  1XFO A;  1VYT A;  4X7F A;  3A8G B;  4XU3 A;  4QVA A;  3H41 A;  2R5A A;  4Q5W A;  2K3B A;  1W1F A;  1LVK A;  4P3Y A;  2DL7 A;  3M0P A;  4IUV A;  3OJW A;  4LDW A;  5GAM e;  3V7S A;  2DBM A;  3G6E T;  5A8A A;  3NFC A;  4ORZ A;  3EGD B;  2W6J A;  2ATC B;  4AF6 A;  5I2S A;  1G7S A;  4XKV A;  1M3A A;  1NM7 A;  4JDS A;  3GLX A;  3M58 A;  1VQ6 B;  3M0Q A;  3C95 A;  4PLI A;  1OB2 A;  4PC3 A;  2RM4 A;  4IKF A;  2V8K A;  4IIO A;  3ULR B;  5M9O A;  2RJE A;  2LJ1 A;  1W9X A;  2E6N A;  2KE9 A;  5FU6 C;  4PFZ A;  1W6X A;  2L89 A;  1YIJ B;  3JRZ A;  2CH4 W;  1V0E A;  3PUM A;  2VXF A;  2QYZ A;  3IQL A;  1KD1 C;  4C0D B;  4XOT A;  2MMP A;  4Y28 E;  1G5V A;  5IHI A;  4RCY A;  5CKE A;  3AVU A;  1OQK A;  2F2W A;  4LNP A;  3JCM Q;  3QE2 A;  5HK3 A;  2E64 A;  3JB9 I;  2H3J A;  5D6W A;  2R57 A;  3JQP A;  4XU0 A;  1JEG A;  1SHF A;  4IUU A;  4DOW A;  3OJX A;  1CNF A;  1K9M D;  2R6H A;  2F69 A;  2F43 A;  4ZN3 A;  1QVG A;  4X06 A;  1UD5 A;  3WVE B;  2JXB A;  1QVF P;  4ZTF A;  5A0G A;  2ZZG A;  1YI2 A;  5HZB A;  3OYJ A;  2GGR A;  1Q81 U;  1WHM A;  1G8X A;  1S72 B;  4X05 A;  3EFO B;  5D6X A;  3JCM b;  2DJZ A;  2EQJ A;  3CQT A;  4A4E A;  3SFM A;  1RAB B;  1IRE B;  3SWN A;  1K76 A;  1AVZ C;  2K5L A;  2W10 A;  5KH6 A;  5B6I A;  3OYG A;  1YCY A;  2P84 A;  4B3G A;  4IUR A;  3VNV A;  4FL6 A;  1E79 A;  3MP6 A;  1VQ6 A;  3OEE A;  1EFN A;  2ED1 A;  2DXT A;  3QYG B;  1TWB A;  2OJ2 A;  1VQM T;  2HDA A;  2O4X A;  2ZPH B;  1B7T A;  2JW4 A;  3NPF A;  5I22 A;  1YX2 A;  3FPK A;  2E12 A;  4XQ3 A;  1MNE A;  5KYY A;  1YIJ A;  3V8L A;  3BC9 A;  4YAO A;  2HSE B;  3CCJ T;  1W0K A;  1PD0 A;  3B8H A;  2MWP A;  2E5K A;  1NPP A;  3ASS A;  3QDR B;  3OW2 S;  1W35 A;  3QFT A;  1G3T A;  1KQS B;  1JO8 A;  2PUK B;  2RMO A;  3I5S A;  2LJ0 A;  1VQM A;  1XE1 A;  4NNJ A;  1QP3 A;  1I4K 1;  4C92 F;  3R6J A;  4P12 A;  3OYI A;  3WBK A;  4KKT A;  1X69 A;  3CCV Q;  1U8R A;  2AZS A;  2GCX A;  4L59 A;  1KFZ A;  1E6G A;  5HY6 A;  2L8D A;  3OEH A;  3OZW A;  2GK6 A;  3HRU A;  2OYN A;  2YRV A;  3H0H A;  2RQV A;  1QGZ A;  2QGF B;  4Q7J B;  3EG1 A;  4JJN K;  5IN1 A;  5KW9 A;  3GOX A;  2ZPF B;  5EC7 A;  2KVO A;  4OP7 A;  3UPU A;  1VQL Q;  2CF4 A;  3S3O A;  2JMA A;  2QQB A;  1KSW A;  3SWN C;  2GBQ A;  4QKU A;  2CUD A;  1UGV A;  3RBB B;  3G1J A;  1T6Y A;  2DIL A;  3PMT A;  1QVG B;  1E3X A;  3EG2 A;  4JPB W;  5BSX A;  2XZL A;  2GF7 A;  3OYM A;  5FIU A;  1UGQ B;  1ZLM A;  1GFC A;  2JJ9 A;  3MET A;  3QKJ A;  3RNJ A;  3CMA A;  4C0S A;  3C12 A;  3V8J A;  1YHQ A;  1OGJ A;  2D8H A;  5FO1 A;  1V1C A;  1XOV A;  2X9H A;  1ACM B;  2X4J A;  1IJF A;  4M7D F;  2QN6 A;  1PD1 A;  2J6O A;  1UGP B;  3JCM c;  2DY1 A;  2E3H A;  1VHO A;  2F4N A;  3RKY A;  1WOO A;  2YXY A;  2CP2 A;  5KYN A;  4MDW A;  2PMD A;  4WZL A;  2CW5 A;  2ZZF A;  2JT4 A;  3CPX A;  1XJW B;  2O4X B;  1Z9Z A;  5AYF A;  3VS5 A;  3ZZ0 A;  3CCQ B;  3JCM X;  2MAM A;  2PTK A;  1WHL A;  1H92 A;  4CC7 A;  4PJO B;  3CP8 A;  2NYS A;  4C92 E;  1Y57 A;  1U3O A;  2AHJ B;  4ZGQ B;  2JS2 A;  4F04 B;  3SD4 A;  2JMC A;  2FZK B;  3G6E Q;  4M7A A;  3L2R A;  2QTV A;  3M59 A;  1M90 D;  3EHQ A;  5CCA A;  2E41 A;  3H94 A;  5FA6 A;  3GF5 A;  3FJP A;  3UDC A;  1K0X A;  1ZSZ C;  1TUC A;  4HCB A;  4A63 B;  3AT1 B;  3OS1 A;  1X6O A;  3PE0 A;  3A3G A;  1QX4 A;  1WYX A;  1X75 C;  3AVV A;  1NLP C;  4RTU A;  1VQ4 Q;  1PJ7 A;  1U1T A;  3NTH A;  3ASP A;  1UHC A;  4XTW A;  3HAG A;  3QSY A;  3VS1 A;  3LYI A;  1SRL A;  2M51 A;  1R8O B;  4PC1 A;  4E7S A;  4M77 E;  4RD6 A;  3VR6 A;  1FRQ A;  3CCV A;  1H8H A;  3EAE A;  2GQF A;  4Z4Z A;  1CKB A;  4G7W A;  5GAO n;  4RTW A;  2X4X A;  3BDL A;  4M78 C;  1IHV A;  3TCJ A;  2KNB B;  2C5H A;  5ECA A;  2CSQ A;  2ZTN A;  2NWM A;  3AGP A;  2DIE A;  3ISX A;  2COW A;  3ONU A;  4CC4 B;  3GVJ A;  1UDL A;  2AT1 B;  4M4Z A;  1WDX A;  2ZL5 A;  1VF7 A;  2NLU A;  4HT8 A;  5CKH A;  3JCM P;  4M78 A;  3ASK A;  3L2V A;  1B34 A;  1WHG A;  1PRL C;  6AT1 B;  4B6M A;  2A08 A;  5GAN 8;  1GVH A;  3M4G A;  1NJI R;  1TVC A;  1WA7 A;  4XOP A;  3CC4 T;  3VS3 A;  5GMK h;  2IG0 A;  1QCO A;  4WCI A;  2DZ9 A;  4XK8 E;  1C1A A;  1OEB A;  5FU7 C;  1QWF A;  2CZ6 B;  4XTV A;  2XI9 A;  1WTH D;  2LCS A;  3V7C A;  2KDS A;  2KRN A;  4YAL A;  4AG1 C;  1C0M A;  3V7A A;  2BMW A;  5GMK e;  1WI7 A;  1HVX A;  4VUB A;  1UG1 A;  2KT1 A;  4DOV A;  4LUD A;  1VQO T;  4Z88 A;  2HBW A;  2M5S A;  5F4M A;  2GFU A;  1ZUN B;  3EH1 A;  3H8Z A;  3TEE A;  3CC4 A;  4FW2 A;  2QEX T;  1JJ2 P;  3AST A;  3CC2 A;  5LJ5 d;  2K9G A;  4M77 F;  3CCL B;  2OAU A;  3KEW A;  3ZBU A;  3C4S A;  5FRO A;  2HMA A;  4HA8 A;  3JCM e;  1K9A A;  2ZBU A;  3QDF A;  5LJ5 g;  5GV7 A;  1M2O A;  4FK8 A;  2OBT A;  2H3E B;  2ZL7 A;  5J35 A;  1VQN B;  2QE7 A;  3ZEH A;  3CBM A;  5CQX A;  4XU2 A;  5LJ3 g;  5HCK A;  2O9V A;  1XNI A;  3CCJ B;  3BDU A;  4JUV A;  4HCZ A;  2ED0 A;  2QEX A;  4ME7 A; 
#chains in the Genus database with same CATH homology
 2QGG A;  3HTR A;  1PM3 A;  2DYI A;  2DOG A;  3A1P A;  2F1L A;  3H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...