3H9NA

Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target ir66.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords Ribosome maturation factor rimM
publication title Northeast Structural Genomics Consortium Target IR66
rcsb
source organism Haemophilus influenzae
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01782 RimM RimM N-terminal domain
A PF05239 PRC PRC-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.240 Mainly Beta Roll SH3 type barrels. PRC-barrel domain 3h9nA02
2.40.30.60 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 RimM 3h9nA01
2DYIA 3HTRA 2QGGA 2DOGA 2F1LA 1PM3A 3A1PA 3H9NA
chains in the Genus database with same CATH superfamily
1T3SA 2KRSA 3HP9A 1ZUNB 1OYXA 2PZ1A 3QZ9B 1T6ZA 3J80E 1VQPB 3CPWA 1PSFA 5KE3A 3DLMA 4M7AE 3RR6A 2J6FA 4PLIA 1PD1A 2MCNA 3NMZC 4B9WA 1KSWA 3T9NA 3META 4HCKA 4J6XA 3CCLT 2B7CA 1OU8A 2ZPBB 1ZBJA 2QI2A 1VQ4A 1F1BB 1GCQC 2YRVA 2X3UA 3MMPA 3ASKA 2V8KA 2HQXA 2KK4A 2Y4YA 1VQ4Q 1X2QA 2DOGA 2LQKA 2F5KA 4OMFB 4M77E 4WZKA 2QG9B 1PCXA 4FYXB 3L2RA 3JCMe 4OP7A 2ZCFB 2K3BA 2HD0A 1NB9A 4GLMA 2FEIA 2OTLT 4OMLA 4FYYB 4OB1B 4XORA 3KEWA 1JNYA 3PVQA 1QGYA 1NJID 1GR1A 3ZZ0A 4HE6A 3TVTA 3U23A 5FRNA 4C92G 5CKDA 2JIZA 2X3XD 2BGJA 1VQ5B 1G7RA 3OYAA 3OKXA 4CRIA 3JB9D 2JMCA 2YUQA 1VQ7T 2ZBVA 3ONUA 1UECA 2OTLB 3SB2A 3SLDA 3QDRB 7AT1B 4BDYA 2CP3A 2COZA 2FL7A 4E7ZA 4XM3A 4DBFA 4RTXA 2CSIA 2E70A 2VXFA 4B43A 3VS6A 3B8HA 1M1GA 3PIOA 3LQEA 3ZZTA 4Q7JB 4TMVA 2DO3A 4DA4A 2HL3A 1N0VC 4QQ6A 1W2BA 1X27A 1Q9SA 2HBWA 5LJ3j 5KCHA 1VQ7B 2EGEA 3V76A 2EVRA 3W5HA 5GANh 3G4SB 3Q6QA 3W5UA 1VQ6T 4RPDA 3OW2S 4KRTA 1KQSA 1YJWB 4EMHA 1JA1A 1Q81D 2RC5A 1X75C 4FT4A 3CCMA 4YEJA 1QVGB 3G71B 3OBWA 3MP6A 4JS5A 4M78A 2RM4A 3RIRA 3CCMQ 2OTJT 3A3GA 4P3IA 3M0QA 1I8FA 1XTDA 4QV2A 4WQMA 5E6TA 3RY8A 1CSKA 4LD9K 4P25A 3FRNA 1NBMA 3J81k 2KR3A 1G3YA 2ZPIB 4ZN3A 2BPOA 3CMAA 3M59A 1VQ4T 2NUZA 2K5FA 4B44A 1M90D 5CO7A 2DTIA 3OEEA 1K1ZA 2JTEA 3CMAQ 1JRIA 3LGFA 1G2BA 3OMCA 4XLCA 2OTJB 1G3WA 4DK1A 1KD1D 3OBYA 3CMMA 4UZFA 1UGRB 3N5BB 1OB5A 1OZ2A 1ZLMA 1TUGB 1VQLB 4P2NA 1QCOA 2FPEA 2J6KA 4M7DE 3EG9B 3QZ5B 3FDRA 4Z4ZA 4FSXA 2XGJA 3P8BB 2MMPA 3E9GA 4LBVA 2QDLA 1JA0A 4YTLA 4PJOF 3GQBA 3M4GA 4RTZA 1K4US 1TLLA 2VXEA 3FIFA 2EQUA 3SWNB 2EGCA 3REBB 2PVGB 1BIAA 2F2VA 5I2SA 5I21A 4WF2A 2E1RA 3SJPA 2GNCA 3CCET 1VIEA 2MAMA 3GNGA 1KIKA 4HVUA 1HJDA 5LJ5j 2I0NA 3SWNC 1Q86R 1PKTA 4Z8AA 3PE0A 4N0AA 1WQ7A 3AVYA 2RI3A 4PFPA 3O8VA 1C1AA 3CCEB 4ELYC 2DXTA 1QVGS 2KQWA 2ED1A 2XIDA 1DDGA 1Y0YA 4ZCLA 1B7TA 4X06A 3CPWS 4JPBW 3GP8A 4KBMB 1GAQA 1Q86C 1UTIA 1YITA 3JCMV 5IK2A 4M7AD 4J83A 2LX9A 1TUDA 3D7SB 2LJ0A 3G6ET 2BMWA 1VQKA 1ZSZA 5GAOr 4MDXA 1YITQ 2XG8D 2QGFB 3RNJA 5KH6A 2DYBA 4M7AB 3E19A 1PNJA 2Z0WA 1OOTA 2X51A 2CGHA 2EJGA 2DL7A 5EG2A 3GVKA 2QTLA 3OYMA 4M77D 4F14A 1PRLC 2HQHA 3FLGA 3G6EB 2DD5A 4IUQA 2DFUA 3CMEB 1D0ZA 4RDKA 4DQ2A 2VJIA 3BCFA 3CCVB 2RQUA 2M5SA 3UA7A 1WSRA 2Q6KA 1XOVA 2B5OA 3OAAA 4NL3A 1QVGP 3OOCA 1M2VB 4M78C 1QKWA 5GAOm 4IW3B 3OYBA 1EFNA 3JB9G 1VQMA 1XQHA 1I7PA 1N8RD 2XICA 1K28D 4PJOA 4DQLA 2KXCA 3KUFA 3VS2A 1KK0A 1VQMQ 2X35A 4J0QA 4C0ZA 2IIMA 5FRMA 1T0JA 3GNFB 4F7UG 3W2IA 1IJFA 3LWIA 3PMIA 3PUMA 5IYNA 3C0CA 2V1QA 2DF6A 4HA8A 4ZGDB 2C0OA 4Z88A 3OYGA 4PC7A 5GAMe 5GMKm 1PSEA 1H641 1VOMA 2RHXA 2WSFE 1ZM4A 2KVQG 5IXBA 5IXFA 3NTHA 1E3XA 1VF7A 1KQSS 2QMUA 4ZV4A 1OGIA 2M9UA 3R6NA 4C8QA 5FU6B 2LCCA 1FRNA 2CSQA 2ROLA 5GAN7 1WYXA 4Z4YA 1XNIA 2JT4A 2K2VA 2X6YA 4YAWA 4Y28E 4C92F 1S72T 2XD0A 1AVZC 1KHCA 4LUEA 3CCRT 2YWFA 1YITT 1EFCA 5D6XA 3OJXA 1QGZA 2QQSA 4R55A 1FNMA 3BY1A 2A0FB 4J5YA 1U1TA 4Z1MA 2EKHA 2FX3A 2A08A 3CTAA 1YI2T 1SHFA 3UPUA 2AZVA 4Z89A 1EIFA 1S72B 1PKVA 2GFUA 2RJEA 1BMFA 3A1PA 4N0AC 3CCUB 2XDDA 1YIJA 1FMWA 4XTYA 2DIQA 1YIJQ 5M9OA 1K8AU 2VZLA 3I9QA 2NUPB 4M7DD 1YI2B 2YWGA 3M0PA 4X7CA 2D3NA 1DDIA 3AGPA 1QGAA 2ATCB 2LJ1A 3ASQA 4QVCA 3OYKA 1AEYA 4PK4A 4IURA 2MI6A 2QEXA 1K9MD 2KROA 4M75A 3MKDA 3PIPA 1OHHA 2WACA 3A8IA 1I18A 3MPUB 2EW3A 3JCMg 3HSBA 4DK0A 4HKEA 4E7JA 2RHYA 5LJ3h 5HKKA 2JNGA 4HXJA 2YXYA 4BDZA 1HSQA 3CD6B 1N05A 2LZ6B 3GVLA 2E6ZA 4EMKA 4E7LA 3H9NA 3V8JA 2P0KA 1N0UA 5LMZA 1PJ5A 3VYHB 1I1JA 4IIMA 2JS2A 3CEYA 5GANd 4YELA 4XKWA 2XZLA 2YUNA 4RDJA 5IT9E 4P5NA 4BI8B 3QSYA 2KRNA 1J9ZA 4ATOA 1R5NA 1YWPA 2P0QA 5IN1A 4Y9UA 1N9RA 2P4TA 1QVFA 4Q5WA 1VHEA 2PQWA 3LYIA 2JJ9A 4PJOC 1D09B 3CCSA 3CBOA 1VQNA 4C92A 1SEMA 1XE1A 2LNHB 1KC8R 1UJ0A 1RI9A 3RDVA 2XDPA 3E2UA 3CCSQ 3ER0A 1VQNQ 2MYSA 1H3HA 1Y07A 4JDSA 5AT1B 3OYEA 1N08A 1YBYA 3PVDA 2X6XA 3PT9A 2L3PA 3L2ZA 2FRYA 4M77G 2QASA 4II1A 4MYTA 4E0FA 4G1VA 4OMNA 2EFIA 5IYRA 3WVEB 1WOSA 1KC8C 5FU7B 1VYTA 1Q7YU 3W2GA 3HL8A 4TKOB 4YAFA 4BE0A 5ECAA 4RTVA 3A8HB 1SKQA 4C0DC 2LQWA 4LUDA 4ZCIA 3QG1A 2RK2A 3JAME 4BI4A 5J35A 1D3BB 2GJKA 1SSFA 2RQRA 2FVGA 3HRSA 3BCDA 2DL5A 1BI3A 3VS4A 1ZM3A 1TOVA 1NYFA 1I81A 1VIFA 3VYGA 1Q95G 1UD2A 1TWBA 3CCQB 2V7VA 2YLCA 1FMKA 5GAN8 4ZGQB 2DNUA 3ZEHA 2D0QB 3HHTB 5LJ5h 4R56A 2K57A 3A98A 3OYLA 3A35A 4A4HA 4X0CA 1MRZA 1JJ2B 1KTVA 2CKKA 3BH4A 1S0UA 1XFOA 4C5IA 3AVTA 5I11A 4D6WA 1QWFA 4A4GA 2V1RA 1KG1A 1I0CA 1AWOA 4HCBA 4LDYA 1K0XA 5AN9A 2DTHA 2F2WA 1W9XA 3G1JA 1QLYA 4WCIA 2RC6A 4X7DA 5AYFA 3OPOA 2DERA 3UF4A 2Q6IA 2GQVA 4X7FA 1ZA2B 3A8KA 4AFSC 3CC4A 1GAWA 4BPRA 1EX4A 1PJ6A 4DEYA 1OPLA 3WVDB 4OMPA 4RPBA 2LQ8A 3JB9F 3CC4Q 4PC3A 1H42A 2LZJA 1SKYB 3EGUA 4PABA 3PVLA 4EMKC 1K73R 1D0XA 1YJ9T 2MWOA 3OS5A 4RD6A 1QKXA 4F7UF 1WHHA 2F2XA 4E7HA 3ZZUA 2C0TA 2L89A 3JCMc 4OPVA 1N8RU 4QVZA 2QA4A 1B34A 2CYZB 5TR9A 4OB3B 4RCZA 4FCYA 2VNHA 3VUBA 4PJLA 1RAEB 1FNCA 3AVVA 1RAGB 2DZCA 4EIKA 4M7DG 1VLOA 2GQFA 1YJ9B 4FXUA 3WXMA 3S3OA 2VWFA 4FW1A 3I5SA 2XNJA 4N4GA 5HKCA 2ZGWA 2RH2A 2LMJA 2L0AA 1NM7A 3CXCB 1ACMB 2KY9A 1YHQQ 4WZTA 1WJQA 1BI0A 4LDVA 4LC0A 3SD4A 3I55T 3C12A 4FU6A 3CC2A 3CP8A 4OB2B 3NPFA 2E3HA 4B3GA 3OMGA 1X6GA 4J6YA 1GO2A 4XLFA 2DETA 3CC2Q 3ES9A 4JZ3A 2FVUA 4XU1A 5D7UA 5DY9A 2LVMA 4J6WA 2BE7D 3V8KA 2VJJA 1VA7A 2QDYB 4C8QG 3EGDB 2D1XA 3CBMA 3IQLA 3I55B 1D0YA 1R5BA 3ASPA 1W0JA 1Y57A 4J9IA 5HZBA 4HT9A 1MHNA 2RHUA 2VV5A 2OBTA 4RMOA 1RUWA 3VJPA 1A8PA 4OP0A 5KCOA 3REAB 2LCSA 4A4EA 1E62A 1JXOA 4E7SA 2ZXHA 5IYQA 4AT1B 3CC4T 5GAOl 1M5Q1 2VYQA 4DOVA 2M0YA 2I1LA 3ZPNA 2RJFA 2VBUA 5GAN4 2YLBA 3A8OB 1B07A 1NEGA 2CBXA 3ISXA 1K0SA 1BIBA 2C5HA 2VUBA 1RABB 4XTUA 1QG0A 2KGTA 1M8MA 1OQKA 1Y71A 2K9GA 1F20A 1FRQA 2R9VA 4AVZA 4F7UA 4H9GA 2DBKA 2KYBA 3MEUA 3QFRA 3FB9A 2V8IA 5GAOq 2ZTNA 1AZGB 1DG1G 4CQJA 4P9SA 2QQAA 3LH0A 3EG2A 3DB3A 1YJWA 3OP1A 4G7WA 4M75G 1FXXA 1MNEA 6AT1B 2BGIA 1GXIE 4P22A 3VO1A 1F60A 3RUXA 5IHNA 1YHQT 1QVGA 2VBSA 2PTKA 3G71A 4ZTJA 3OSSC 1MUZA 3Q38A 1N27A 4PJNA 4ACBA 3EFOA 1IO6A 2KEAA 4OPSA 5LJ3d 2ABLA 2WZPP 3NGPA 3FPKA 5GANf 4XOTA 3S3MA 1WGSA 2JS0A 5GMKe 4LDUA 3BY2A 1EFUA 3OYFA 3VRZA 4C0FA 2GREA 2RN8A 4M77F 5GAMj 3UATA 1SG5A 1GL5A 1AIPA 1YN8A 3PUNA 1KQ2A 4Y9RA 2IPOB 1MABA 2OAUA 5GJWB 2K5IA 4JS4A 1LNXA 5FL7A 3A5ZB 4QT7A 2X4WA 1R77A 2KYMA 3DDYA 3CCLB 3P27A 4NOYA 4M4SA 4RD4A 2R5MA 2J06A 2HDNB 2Y90A 5EMNA 3VUZA 3VKIA 4EPCA 2X4JA 1W4SA 3T56B 3EFRA 3Q1JA 4BUGA 2RQVA 3QUIA 1FX0A 3EG1A 5HK3A 1AHJB 2KT1A 3LGLA 2EBPA 5DN6A 8ATCB 2DPPB 1IGQA 2RNAA 3JCMP 1M3AA 4JJBA 1CNEA 1QUFA 4A63B 4Z4TA 1DJ7B 1VQ9A 1BK2A 1D1BA 1E6GA 3QFTA 2D8JA 1TVCA 2RQWA 4FN5A 4J9BA 1PG5B 1VQ9Q 3CCJA 1EXMA 1VQOT 5KSWB 2GFAA 2RHIA 3C4SA 3CCJQ 3LW5E 2DD4A 4NCNA 2OYNA 2QN6A 4JRKA 1NJIC 1K8AR 3PA2A 1E43A 4HVWA 1RAAB 3E1YE 4X05A 2YUPA 4RKUE 1HZEA 1WSVA 1VQOB 5CKHA 5LJ5d 4ORZA 1H92A 1CQXA 4KKSA 1M9SA 2JJ2A 5FROA 1EP3B 4OF1A 2CREA 1YP5A 1M1KU 2D0NA 1GBRA 5KW9A 1VQ6B 4M7AA 1ZHIA 1UDLA 1X01A 2QTXA 2JZ2A 4E2FB 1N6AA 3EG0A 1K8AC 3M4YA 3E9FA 2E1HA 3B82A 4M0LA 2VNJA 2DX1A 1IRXA 2GCXA 2JM8A 4FK8A 5J26A 1B2RA 3CMEA 3OEHA 4M53A 1W87A 4M77A 2CF4A 2WPDA 3OYNA 3CMEQ 4Y91A 4M7DF 2DKGA 3J7AF 2XK0A 2E41A 3AT1B 3E1SA 1YJNA 3CC7A 3QE2A 3L2VA 1VQ4B 2K3YA 2GGRA 2E4HA 1IGUA 1X69A 1K9AA 2VB6A 4ZN1A 1YJNQ 1Q82U 3CC7Q 3C95A 1TUIA 5GAN2 2JXBA 5KE2A 4JZ4A 1JB9A 1ZX6A 2HL5C 5F4OA 3BDUA 4WZLA 5THXA 3D26A 1VQ8A 1KK2A 2P3MA 2CUDA 1VQ8Q 2JMAA 4RUGA 2DTOA 1Q86D 1GFCA 3J81E 1RLPC 4C8QF 4ME7A 4Z02A 4OMQA 4ZGEB 4RD2A 3CCJT 3B78A 2HMAA 1BJKA 1LPLA 3M0RA 2I2LA 2F1MA 1Q7YR 3M0TA 3ZC3A 1I8DA 4R71A 4A4KA 2EAYA 4DOWA 4ANJA 1PWTA 3M5AA 1U5SA 3FC3A 1N06A 4RCBA 1BI1A 3I35A 1XB2A 1W2BB 3CCMT 4TVRA 3OS2A 5TV2A 3QWYA 1WPCA 4CC7A 1UD3A 2AZSA 2YHTA 2QK0A 1VQKQ 3EH1A 1Q7YC 1UGQB 3H0HA 1QFJA 1RQRA 1OPKA 2CUBA 3MCAB 2DY1A 4XL9A 1NG2A 3EAEA 3CCUA 1NYGA 1W35A 3CMAT 2F43A 5A88A 1EFTA 1I5OB 2CP6A 5GMKi 3CCMB 2D9TA 3CCUQ 3CBPA 4BY6C 4M78B 2W0ZA 4J9EA 4FYVB 2DL4A 1UGVA 3QXEB 1DARA 1MMDA 1QFYA 1SSHA 1WXUA 4DEXA 2X6WA 1VYVA 1HYOA 4V2SA 4RJLA 4QQGA 5JBQA 2M51A 1N5ZA 1ARKA 2ECZA 3EGXB 2FZGB 4M75F 1X6BA 3JQRA 4DBQA 1VJSA 4M7DA 1YJNT 4FIBA 5HK0A 3CC7T 1E1RA 1K76A 4Z4SA 1QCFA 1SRMA 3TQ7P 1QP3A 3LWHA 4HCZA 1RAHB 3W2EA 4AG2C 3WQZA 1GVHA 4Y92A 4IUVA 3L2UA 2LCLA 4KUIA 4LD6A 3QJYA 3CD6A 5CAIA 3NE5B 5I2MA 2MPXC 2XHCA 1PJ7A 2PNIA 3CD6Q 2VKNA 1KQ1A 1G7TA 2QYZA 4M77C 3ZL7C 3JU4A 1TTHB 4KUDK 4PFOA 3HRTA 4OOVA 3GIBA 1G83A 4AFZC 1KRHA 2G3RA 1BPLA 1P4MA 3QBYA 1SF9A 2LQNA 4OMOA 2WR8A 5KYNA 1NZ9A 1WDXA 1NB0A 3VS5A 2VBTA 4ZNXA 3SLNA 2D74A 5LJ3f 2ZZQA 2EQIA 2YWWA 2CZ6B 2DYIA 3GBQA 2EQKA 2BIVA 2ZTGA 1MMGA 5KYXB 1NJIU 1VQKT 5GAMh 1J3TA 1N8RC 2DILA 2KVOA 4XK8E 1BU1A 2YDLA 1WHGA 4TN1A 1TTTA 4IUPA 5J3BA 4XLEA 3MP8A 2DL8A 1FYNA 1WHMA 1XQBA 1IB8A 3CQTA 5A0GA 2BM0A 5DLOA 1PHTA 4F16A 1IJEA 3WNCA 3CCRB 2HEQA 1EP2B 1YITB 2E1BA 1N9SA 1WIEA 3SFMA 2PLFA 1MMAA 3OYIA 3VS7A 4XNFA 2O31A 3AVWA 1ZUYA 2EQJA 1D3BA 4ZGJB 5J3OA 2OI3A 3FJPA 2XZOA 3WYAA 1WI7A 2ZZEA 4RDLA 1BI2A 1ZSZC 2DVJA 2P84A 1SKUB 3CCQA 1OULA 1TH7A 5CKFA 2A36A 1BX0A 1GFDA 1C6VX 1QWEA 4FT2A 2QEXQ 5LJ3e 2DK3A 2ZZFA 1VQMT 3A8GB 1WJRA 3KBGA 5GAN6 1LCKA 3F70A 4L5GA 1Q81U 3HRUA 1AOJA 5DSZA 5HZAA 3H41A 1NRKA 1KK7A 1FNBA 1RI0A 3L2QA 5C6SA 4FW2A 3MHXA 4OVAA 4PAAA 2CP0A 1UD5A 2HQEA 3QYHB 2NUTA 2LP5A 3P8HA 1EP1B 3KL9A 4FWTA 2V31A 1KFZA 1E1QA 4P26A 1VQMB 1UHFA 3QYGB 4P6YA 2DRKA 5LJ5f 4PJOB 4KULA 4M7DC 1FMVA 3DLLA 2R58A 4XTVA 2XZPA 4XU0A 3M53A 3PMTA 1OV3A 1M90U 2XI9A 1HK9A 4RCCA 5KYUB 4CC3A 1BKBA 3I56A 4M7AG 4LNPA 4QVAA 1MV3A 1KD1U 3VS1A 5GANg 1KC8D 1M1FA 2CS7A 3G05A 2AHOA 3I56Q 5FO0A 1T0HA 5FIUA 2R57A 1ZUKA 2C4TA 2KT8A 5FW9A 2GPJA 1NDHA 1UJYA 4RTYA 1IHVA 3PA1A 5GMKj 1WFWA 1S4MA 2HKQB 3OZWA 3KXTA 4C0DB 1HVXA 4AG1C 2KXDA 1LOJA 2DJZA 3X25B 4ASUA 1XJWB 4A53A 4C8QC 5KYWB 1YIJT 2KRMA 1FDRA 4A54A 2CP2A 2RO0A 2E6NA 1FNDA 4UZUA 2LC4A 1Y96A 2AHJB 3EG3A 3VRYA 2X8KA 5CIUA 5BSYA 1G3SA 3OW7A 3OZVA 3TCJA 4XLHA 1R5OA 3ZBDA 2XMFA 4XN0A 1ZQ1A 3S3NA 1T6YA 2O4XB 2QGGA 3OQ5A 1TXQA 1YIJB 2JTFA 1OEBA 5GV8A 4N4HA 2C4UA 3FJOA 2QEXT 1MGQA 4JRIA 5A8AA 2F1LA 4XU2A 1H3ZA 3LLRA 4MMKA 5CVIA 5F4MA 2WSCE 3P8DA 4F17A 4J9GA 2E12A 4P1VA 3GSIA 2V26A 5KYYA 9ATCB 4X1VA 2RB6A 1O75A 2QAZA 1NEBA 4IUUA 4OB0B 1JXMA 3ASSA 1IHWA 5HXBA 4C5EA 2P4RA 2EPDA 2RQTA 2EJ9A 4XTWA 3JCMQ 5DM7R 3H94A 1V0FA 3ONYA 1YCSB 2M02A 2NYSA 2LJ3A 1I5LA 4J9DA 3L42A 1E79A 2HLDA 4QFMA 3V7AA 2DAQA 4NS5A 1BQEA 2NPFA 4HCCA 2D8HA 3GOXA 2E5QA 3DKMA 4AFUC 4M75C 2X53S 4EMKB 5GAN5 4OOSA 4UAJA 2PVOB 4LN2A 1Y0MA 2V7XA 4B3FX 2CH4W 2ZAEA 4KGZB 3CCST 5LL6S 4RLZA 2QQBA 1VQNT 2M1HA 1BB9A 1R8OB 3RKWA 4YALA 1K73D 3ASTA 1RQPA 1E3ZA 1ABOA 2BTTA 3OYJA 1M1KR 1UEBA 1WP6A 3L2WA 2WJVA 4N3GA 1H85A 2ZL5A 5IYWA 4II3A 2XEXA 3C94A 2JVVA 1GCPA 3CCSB 1VQNB 4MZMA 4DNRB 4C92B 1YCYA 2OJ2A 2QA4Q 1C0MA 1WX6A 2B8AA 4ELZC 1M1KC 2EKOA 1OGJA 4G7XA 1RL2A 2BZ8A 1WZOA 2V7WA 3W2FA 4C92C 1D1AA 1JJ2S 2QXFA 1VQPA 1MNDA 1AZEA 5GAOn 2AK5A 1YLOA 5CK9A 4JJCA 1IZ6A 1Q82R 2ZITA 5GAOp 4J9FA 1VQPQ 2PU9B 1M3BA 1YWOA 2LTOA 1AMOA 2R5AA 2PE3A 2VGNA 2ZPGB 1QX4A 4G6IA 1JQQA 1EZZB 3ZIAA 2EYYA 3AHUA 1NPPA 3HFOA 2XNCA 3W5VA 5H59A 3RMQA 1WJSA 3SKBA 2K79A 1Q82C 4ACAA 3ZBTA 1P92A 3CCLA 2EWNA 1WQWA 4RTTA 3M58A 1O9SA 4MDWA 2DBMA 3CCLQ 5IYPA 2ESWA 1WTHD 4EMGA 1VQ5A 4WTOB 1CNFA 2KAFA 4ESRA 1JJ2P 1NPRA 1VQ5Q 5GAMd 1RADB 2OTLA 2JN0A 5CCAA 3UT1A 4ZGNB 1X43A 2QQ9A 2XKOC 4MMLA 4PJJA 5C0MA 1B23P 1MV0B 2OTLQ 4AC9A 3MJXA 2XOKA 2ZXIA 3L1AA 1H8HA 1K9MU 2J7IA 3BY7A 4KT0E 4RTUA 1ZM9A 3CC4B 3NTKA 3CRZA 1R0CB 3A8LB 3X24B 1VQ7A 2JTMA 3A8JA 1U8RA 5GMKl 2QA4T 3G4SA 2L3SA 4OOXA 3H0IA 3JB9J 5L46A 4MZTA 1VQ7Q 2RMOA 1AWJA 3Q39A 4QUZA 5I22A 3G4SQ 1WOPA 3CXCS 1V29B 2D9RA 5CDFA 3JCMf 3WNDA 2V8JA 4MYUA 1QUEA 3SJZA 1YJWQ 3AGQA 4Z4VA 1KZLA 4PGOA 3OY9A 4M7AF 2BZXA 2LT1A 1B34B 4YHBA 2DLPA 3G71Q 1X6OA 2CT3A 1JEGA 4ZCMA 1VQ6A 3U2QA 3QHSA 2OX7A 1B3QA 1UGSB 3CC2T 2WSEE 1VQ6Q 1SM4A 2XNDA 1LJOA 3ZBUA 1QCNA 3OYHA 1YHQB 4E6RA 2X4XA 4M78E 1UD4A 2C2WA 3OW2B 2DMOA 2OTJA 4AF7A 1VLYA 4LDWA 5H5JA 1UFFA 5LJ3g 3SEMA 1RAIB 2OTJQ 3CC2B 2BE9B 2MIOA 2Y4XA 1VQLA 4J9CA 1TS9A 3QKJA 3T51B 3CXCP 3EG9A 2ROTA 3DB4A 5J39A 1VQLQ 3LQ6A 2FZKB 4II2A 1M2OA 5GMKh 2AKKA 2PVDB 3UA6A 2FRWA 1VQ5T 4J7IA 2O2OA 3AVXA 1WDTA 4JJNK 3BC9A 5F4JA 2KNBB 1WNLA 3FKSA 2QQRA 2A28A 3SWNA 2MF2A 5TRDA 1WHJA 1IHMA 4B9XA 3JCMh 1NJIR 2EGAA 3V7CA 3G7ZA 2DXUA 4B6MA 3FEOA 4OPOA 3R6KA 1TUCA 4GQNA 2YRDA 3MHPA 5GANe 1SHGA 2FG0A 3VMFA 1WHLA 4PLLA 4XTXA 2F4NA 2OBRA 1VUBA 1COWA 1Z9QA 3CCEA 1OU9A 3G4ST 5BSXA 2RI2A 1D8TA 1QP2A 1BLIA 1K8AD 3CCEQ 2GJRA 3GLXA 4OGEA 1GBQA 2L5QA 1YJWT 2IG0A 3AVUA 4FM4B 3JCMX 4RD1A 2ZPFB 1G3TA 4F7UB 2RPNA 1G7SA 3G71T 3RERA 1ZBXA 2KDSA 3V7SA 1UGPB 2DRMA 3CB4A 3MP1A 2E10A 3H6ZA 1T6XA 4F7DA 1W70A 1UUEA 3MCAA 3LO8A 1UMKA 1Q81R 2P0PA 2CNDA 3G6EA 4LBYA 1OX9A 4LBWA 4WZEA 4C0SA 3U6BA 5LJ5g 1K73U 3RKYA 2V7QA 3LX7A 4JUVA 3OYCA 3G6EQ 3CPWB 2VASA 3CCVA 3QFCA 3EFOB 2H3EB 3ZUGA 4XQFA 1W34A 3EHRA 2F69A 1Z9ZA 1OB0A 1ZM2A 3CCVQ 3BQJA 5CQYA 5A2QE 3LNNA 3EGXA 1T3LA 1M2VA 8AT1B 1VQLT 1UD8A 1BBZA 3PNWC 4B4DA 1Q81C 2AIRB 2WJYA 2DCUA 2CP7A 4XD7A 1M90R 4P6VF 1NE8A 3HTRA 2LT4A 3BW1A 3WY9A 1U3OA 1OI1A 1PD0A 3OS0A 2A3LA 3VR6A 2SRCA 2QE7A 4U9UA 1NLPC 1W0KA 1KD1R 5KNLA 1E64A 1M4ZA 3JV3A 4L8JA 3OW2P 2DIGA 1JO8A 1VQ9T 1M90C 5FWCA 4LXCA 4X9CA 2OAWA 4PJOE 2RA2A 5L23A 1KD1C 2GK6A 4NL2A 4N3NA 1VHOA 2PMDA 1Q7YD 2O01E 2HZYA 1E7OA 3S6WA 4M1KA 4XOPA 2COWA 3VNUA 1A0NB 4Z4UA 4TSFA 4JLGA 3THKA 4UZEA 1I07A 1VQ9B 4X07A 1UD6A 5D6WA 3GVJA 3NFCA 3M9QA 2Q6OA 3QPHA 3CCJB 5KYXA 4C8QE 4GBQA 2CP5A 4RM0A 4XKVA 4D8KA 2DEQA 4BI3A 3ME9A 2ENMA 3I1FA 4VUBA 2JDIA 3OB9A 4FYWB 2ZPHB 5GV7A 4BY6B 4B47A 3OFNA 2KBTA 3ULRB 4R0KA 1V0EA 2C78A 4M78D 1S72A 1KQSB 3CCRA 1S72Q 1HD3A 5FWBA 2CDTA 2R6HA 3MEVA 4YAOA 4E7IA 4WWVA 3OZUA 1S1NA 3CCRQ 3CMET 4QW2A 2FHDA 2NUPA 5DLQE 3V8LA 3WBJA 2HKNA 4BB7A 3CCVT 2LDMA 1YI2A 1EFRA 5GAMf 4RD3A 2ZL7A 2YUOA 4EDUA 1YI2Q 1ZSGA 2Q6LA 1AWXA 3CMAB 1QW1A 2W6JA 1W6XA 3X26B 4GY5A 4PNOA 2FZCB 2GTJA 1ABQA 4M7AC 1RAFB 1D1NA 1YFNA 1WXBA 3UWNA 4IIOA 2L3RA 3CW2A 2DJQA 2HCKA 4DQKA 2VGMA 4M77B 1AD5A 3R6OA 5IAYA 4KKTA 3WNBA 3A3BA 4L59A 4TMWA 2IVWA 3ASRA 1VQ8T 3JQPA 3JQQA 1AT1B 1JBMA 3TU4K 2YRCA 3NTIA 4YXWA 1YJNB 3CC7B 3CPWP 4KH0B 3BFMA 4AFQC 4QKUA 4PC2A 2HSEB 4BE1A 2CC2A 4M75E 1G8XA 4PC6A 3QJ6A 2XDBA 2VC8A 2O9SA 3BDLA 5EC7A 3OE7A 1N8RR 1KK1A 3M55A 4XU3A 4KH1B 4QQDA 4E47A 2BUDA 1VQ8B 2RJCA 2W6IA 4K11A 1W2BS 3KFVA 4PKCC 4J8OA 1JU5C 4C5HA 1QFZA 3SHWA 5TY0A 3MO8A 2J05A 5KYUA 5GAN3 4C43A 4HE5A 4TT3A 2SEMA 3BE3A 4XTZA 4GLKA 4PJMA 4EH1A 1PRMC 3U6KA 3OA6A 2BM1A 2X85A 2B7BA 4Y7CA 4RCYA 2J7KA 1V1CA 2DEUA 2FYKA 1X2KA 1HA3A 1QQJA 2DM1A 3VS3A 2HSPA 2GJPA 2KMTA 1YNZA 3CCUT 2NV4A 5KYWA 5FU6C 2V7TA 4C92E 2JOYA 2DA9A 1VQKB 2CZ0B 1ZSZB 3NHNA 3JB9I 5FA6A 5A89A 1UG1A 3SEJA 4XLAA 1HXDA 2EYZA 4F04B 1PKSA 5L8RE 2PUKB 2BZYA 1QVPA 2K3XA 1WPYA 4L6V5 2XU8A 4IUTA 4OGCA 1W2BP 3W2HA 2EFGA 4M2LA 2O4XA 2QTZA 2ZL6A 3OSVA 4QVJA 2J6OA 1BX1A 2CT4A 5CKBA 2DZ9A 1EWYA 2VYTA 1NBEB 3CCQQ 4PC1A 5HY6A 1KQSP 3JCMd 1NLOC 1JJ2A 3INZA 4QVDA 4Z4WA 2X3WD 3QO3A 1TSFA 3CD6T 2EYXA 4KKUA 1FX7A 1PM3A 2DE0X 1UE9A 4M7DB 4BE2A 2E3IA 4OMMA 2X9HA 4BACA 4PJOD 1YX2A 2EJFA 3GF5A 4KGXB 4AMCA 1K9MR 3CPFA 2FPDA 1SRLA 2G6FX 2DIEA 3Q3AA 2QDXA 2OK8A 1D1CA 3O5ZA 2O88A 2ZZGA 1TG0A 3T53B 2C06A 2LNVA 4FL6A 5A0LA 3HKSA 2CH4A 1GJRA 1KHIA 2RD1A 2RK1A 4C8QD 1K9MC 4K1XA 4C8QB 1CKBA 1QH0A 3URGA 3TEEA 2NWMA 1ZUUA 1PC0A 4M78G 2JJ1A 2L8DA 1V5VA 1Y7XA 1H8EA 4X7EA 4J9HA 2JW4A 2KSSA 2MOXA 2QTVA 4TMTA 3M0SA 1V76A 2M16A 3RESA 3EH2A 2RHZA 1T5EA 3LVBA 1R0BG 2D6FA 4JLIA 4KGVB 2HNIA 1YJ9A 1WORA 1IREB 2PIAA 4P3YA 4HT8A 1KMHA 1Q86U 1YJ9Q 4CC4B 2VVKA 2KI7A 2K5LA 1E6HA 1ELOA 2CRVA 5LJ5e 3CXCA 1CKAA 2AT1B 3CCQT 4XQ3A 2FB7A 2C5BA 4B3XA 2E5KA 4NNJA 3WBKA 4MZPA 2F5TX 4JRPA 1BCMA 3FJ5A 3VU3C 1M8VA 3V7RA 3VNVA 1U2RA 3QWXX 4M75D 5FU7C 3TSWA 2JM9A 1UHCA 3CPXA 2K6DA 2EQMA 1BCOA 5GANj 1WU8A 3PGGA 2ED0A 2QEXB 1SPKA 3EGDA 2YT6A 2Z6BD 1ZA1B 1G7CA 2CZ7B 3QIIA 1LVKA 3LH5A 4M75B 3I55A 1WOOA 4XR6A 2EYQA 3Q6RA 3OYYA 1KJZA 2HCJB 3R6JA 3TSZA 3I55Q 4YAUA 4D8DA 1JB0E 2H3JA 5IHKA 4O5VA 2HAXA 2D3LA 2JN9A 2X0KA 4NBSA 1M3CA 3JCMJ 2BF4A 2EYWA 4RTWA 3RKXA 2RI5A 5FO1A 2WZNA 2VNIA 2NUTB 2K2MA 4B48A 3I56T 3QSUA 2BV3A 2VBVA 2B86A 2GF7A 2YWEA 1QMCA 4RG2A 4JJDA 3OYDA 2OK7A 3FPPA 2PUOB 2FO0A 3SDZA 3E20A 1MMNA 2L3QA 1M1KD 2OBSA 2GBQA 2X4YA 3M54A 3VV0A 4TMZA 1GRIA 4C92D 2O9VA 3BNWA 4C5GA 2CW5A 1Y0RA 2BKDN 3I56B 1QVFB 5FNZA 1TU0B 3OS1A 1OX8A 3H0FA 4G1BA 4XMYA 4X8IA 1FWZA 2YWHA 3QFSA 2NLUA 3EHQA 4HVVA 2CK3A 2GK7A 1M30A 4QHYA 5GJVB 5CQXA 2YSQA 5CKEA 3JCMb 1IB0A 4F7UE 4O6JA 4TMXA 3QDFA 3HAGA 1GCQA 4LDXA 1WLPB 4P12A 2BVNA 1M27C 2A37A 4XAXB 1Q82D 3P26A 2GQIA 2K4YA 1Y96B 1K73C 1G5VA 1VYUA 3CESA 3M0UA 2LX7A 1D2EA 2DXBA 3JSCA 5IH2A 2AKLA 4CI0C 1KK3A 4CC2A 1YHQA 4ZTFA 2ZBUA 2EIFA 4PJOG 2H8HA 3OW2A 5HCKA 2ZPEB 5D6YA 2MWPA 3VS0A 1AWWA 2L2PA 3HFNA 1OB2A 2LRQA 2A7YA 4PFZA 4DBHA 2E64A 5B6IA 3JRZA 2BSAA 2DVEA 4RG8A 3JB9H 2DXCA 5KYYB 2COYA 1BYMA 4XN3A 1N07A 3X28B 3X20B 5FLXE 5CR2A 3GIRA 2VNKA 2M0OA 2W10A 4PL6A 2CZ1B 1IXDA 3I5RA 4G5GA 3RBBB 2V7UA 4JRQA 4Z4RA 3JCMW 2FPFA 1QVFS 4LBZA 2C77A 4XONA 1WXTA 1UB4A 4M4ZA 2BN4A 3UDCA 2ZZDA 1W1FA 5A0DA 2WYRA 4RD0A 4N4IA 4JMQA 2HDAA 4AF6A 3M56A 4HIZA 5GAMg 4LE9A 2MK5A 1WA7A 1KJWA 3OJWA 2JUFA 2WSSA 2RJDA 3ZFJA 2V4DA 2K7AA 3M57A 4C0GA 4DBRA 2GTOA 3H8ZA 5DS0A 3EFSA 1U1SA 2DL3A 3A8MB 2C0IA 1RACB 4UC4A 1E63A 4A4FA 2RF0A 1VQOA 3HPWA 4ROXA 4X34A 2QA4B 4J7FA 3PTAA 2E65A 3VO2A 1WHKA 1VQPT 4FSSA 4E7KA 1U06A 1VQOQ 4DNTB 1H8KA 3GPLA 3PENA 3TREA 1I4K1 1OZ3A 4X9DA 5IHIA 4BD3A 4IKFA 1RLQC 2EIXA 1QVFP 2KE9A 3PFSA 4M78F 3WXMB 2HBPA 3RMSA 3CP2A 3MEWA 1KC8U 3MEAA
chains in the Genus database with same CATH topology
2DYIA 3HTRA 2QGGA 2DOGA 2F1LA 1PM3A 3A1PA 3H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYI A;  3HTR A;  2QGG A;  2DOG A;  2F1L A;  1PM3 A;  3A1P A;  3H9N A; 
#chains in the Genus database with same CATH topology
 1T3S A;  2KRS A;  3HP9 A;  1ZUN B;  1OYX A;  2PZ1 A;  3QZ9 B;  1T6Z A;  3J80 E;  1VQP B;  3CPW A;  1PSF A;  5KE3 A;  3DLM A;  4M7A E;  3RR6 A;  2J6F A;  4PLI A;  1PD1 A;  2MCN A;  3NMZ C;  4B9W A;  1KSW A;  3T9N A;  3MET A;  4HCK A;  4J6X A;  3CCL T;  2B7C A;  1OU8 A;  2ZPB B;  1ZBJ A;  2QI2 A;  1VQ4 A;  1F1B B;  1GCQ C;  2YRV A;  2X3U A;  3MMP A;  3ASK A;  2V8K A;  2HQX A;  2KK4 A;  2Y4Y A;  1VQ4 Q;  1X2Q A;  2DOG A;  2LQK A;  2F5K A;  4OMF B;  4M77 E;  4WZK A;  2QG9 B;  1PCX A;  4FYX B;  3L2R A;  3JCM e;  4OP7 A;  2ZCF B;  2K3B A;  2HD0 A;  1NB9 A;  4GLM A;  2FEI A;  2OTL T;  4OML A;  4FYY B;  4OB1 B;  4XOR A;  3KEW A;  1JNY A;  3PVQ A;  1QGY A;  1NJI D;  1GR1 A;  3ZZ0 A;  4HE6 A;  3TVT A;  3U23 A;  5FRN A;  4C92 G;  5CKD A;  2JIZ A;  2X3X D;  2BGJ A;  1VQ5 B;  1G7R A;  3OYA A;  3OKX A;  4CRI A;  3JB9 D;  2JMC A;  2YUQ A;  1VQ7 T;  2ZBV A;  3ONU A;  1UEC A;  2OTL B;  3SB2 A;  3SLD A;  3QDR B;  7AT1 B;  4BDY A;  2CP3 A;  2COZ A;  2FL7 A;  4E7Z A;  4XM3 A;  4DBF A;  4RTX A;  2CSI A;  2E70 A;  2VXF A;  4B43 A;  3VS6 A;  3B8H A;  1M1G A;  3PIO A;  3LQE A;  3ZZT A;  4Q7J B;  4TMV A;  2DO3 A;  4DA4 A;  2HL3 A;  1N0V C;  4QQ6 A;  1W2B A;  1X27 A;  1Q9S A;  2HBW A;  5LJ3 j;  5KCH A;  1VQ7 B;  2EGE A;  3V76 A;  2EVR A;  3W5H A;  5GAN h;  3G4S B;  3Q6Q A;  3W5U A;  1VQ6 T;  4RPD A;  3OW2 S;  4KRT A;  1KQS A;  1YJW B;  4EMH A;  1JA1 A;  1Q81 D;  2RC5 A;  1X75 C;  4FT4 A;  3CCM A;  4YEJ A;  1QVG B;  3G71 B;  3OBW A;  3MP6 A;  4JS5 A;  4M78 A;  2RM4 A;  3RIR A;  3CCM Q;  2OTJ T;  3A3G A;  4P3I A;  3M0Q A;  1I8F A;  1XTD A;  4QV2 A;  4WQM A;  5E6T A;  3RY8 A;  1CSK A;  4LD9 K;  4P25 A;  3FRN A;  1NBM A;  3J81 k;  2KR3 A;  1G3Y A;  2ZPI B;  4ZN3 A;  2BPO A;  3CMA A;  3M59 A;  1VQ4 T;  2NUZ A;  2K5F A;  4B44 A;  1M90 D;  5CO7 A;  2DTI A;  3OEE A;  1K1Z A;  2JTE A;  3CMA Q;  1JRI A;  3LGF A;  1G2B A;  3OMC A;  4XLC A;  2OTJ B;  1G3W A;  4DK1 A;  1KD1 D;  3OBY A;  3CMM A;  4UZF A;  1UGR B;  3N5B B;  1OB5 A;  1OZ2 A;  1ZLM A;  1TUG B;  1VQL B;  4P2N A;  1QCO A;  2FPE A;  2J6K A;  4M7D E;  3EG9 B;  3QZ5 B;  3FDR A;  4Z4Z A;  4FSX A;  2XGJ A;  3P8B B;  2MMP A;  3E9G A;  4LBV A;  2QDL A;  1JA0 A;  4YTL A;  4PJO F;  3GQB A;  3M4G A;  4RTZ A;  1K4U S;  1TLL A;  2VXE A;  3FIF A;  2EQU A;  3SWN B;  2EGC A;  3REB B;  2PVG B;  1BIA A;  2F2V A;  5I2S A;  5I21 A;  4WF2 A;  2E1R A;  3SJP A;  2GNC A;  3CCE T;  1VIE A;  2MAM A;  3GNG A;  1KIK A;  4HVU A;  1HJD A;  5LJ5 j;  2I0N A;  3SWN C;  1Q86 R;  1PKT A;  4Z8A A;  3PE0 A;  4N0A A;  1WQ7 A;  3AVY A;  2RI3 A;  4PFP A;  3O8V A;  1C1A A;  3CCE B;  4ELY C;  2DXT A;  1QVG S;  2KQW A;  2ED1 A;  2XID A;  1DDG A;  1Y0Y A;  4ZCL A;  1B7T A;  4X06 A;  3CPW S;  4JPB W;  3GP8 A;  4KBM B;  1GAQ A;  1Q86 C;  1UTI A;  1YIT A;  3JCM V;  5IK2 A;  4M7A D;  4J83 A;  2LX9 A;  1TUD A;  3D7S B;  2LJ0 A;  3G6E T;  2BMW A;  1VQK A;  1ZSZ A;  5GAO r;  4MDX A;  1YIT Q;  2XG8 D;  2QGF B;  3RNJ A;  5KH6 A;  2DYB A;  4M7A B;  3E19 A;  1PNJ A;  2Z0W A;  1OOT A;  2X51 A;  2CGH A;  2EJG A;  2DL7 A;  5EG2 A;  3GVK A;  2QTL A;  3OYM A;  4M77 D;  4F14 A;  1PRL C;  2HQH A;  3FLG A;  3G6E B;  2DD5 A;  4IUQ A;  2DFU A;  3CME B;  1D0Z A;  4RDK A;  4DQ2 A;  2VJI A;  3BCF A;  3CCV B;  2RQU A;  2M5S A;  3UA7 A;  1WSR A;  2Q6K A;  1XOV A;  2B5O A;  3OAA A;  4NL3 A;  1QVG P;  3OOC A;  1M2V B;  4M78 C;  1QKW A;  5GAO m;  4IW3 B;  3OYB A;  1EFN A;  3JB9 G;  1VQM A;  1XQH A;  1I7P A;  1N8R D;  2XIC A;  1K28 D;  4PJO A;  4DQL A;  2KXC A;  3KUF A;  3VS2 A;  1KK0 A;  1VQM Q;  2X35 A;  4J0Q A;  4C0Z A;  2IIM A;  5FRM A;  1T0J A;  3GNF B;  4F7U G;  3W2I A;  1IJF A;  3LWI A;  3PMI A;  3PUM A;  5IYN A;  3C0C A;  2V1Q A;  2DF6 A;  4HA8 A;  4ZGD B;  2C0O A;  4Z88 A;  3OYG A;  4PC7 A;  5GAM e;  5GMK m;  1PSE A;  1H64 1;  1VOM A;  2RHX A;  2WSF E;  1ZM4 A;  2KVQ G;  5IXB A;  5IXF A;  3NTH A;  1E3X A;  1VF7 A;  1KQS S;  2QMU A;  4ZV4 A;  1OGI A;  2M9U A;  3R6N A;  4C8Q A;  5FU6 B;  2LCC A;  1FRN A;  2CSQ A;  2ROL A;  5GAN 7;  1WYX A;  4Z4Y A;  1XNI A;  2JT4 A;  2K2V A;  2X6Y A;  4YAW A;  4Y28 E;  4C92 F;  1S72 T;  2XD0 A;  1AVZ C;  1KHC A;  4LUE A;  3CCR T;  2YWF A;  1YIT T;  1EFC A;  5D6X A;  3OJX A;  1QGZ A;  2QQS A;  4R55 A;  1FNM A;  3BY1 A;  2A0F B;  4J5Y A;  1U1T A;  4Z1M A;  2EKH A;  2FX3 A;  2A08 A;  3CTA A;  1YI2 T;  1SHF A;  3UPU A;  2AZV A;  4Z89 A;  1EIF A;  1S72 B;  1PKV A;  2GFU A;  2RJE A;  1BMF A;  3A1P A;  4N0A C;  3CCU B;  2XDD A;  1YIJ A;  1FMW A;  4XTY A;  2DIQ A;  1YIJ Q;  5M9O A;  1K8A U;  2VZL A;  3I9Q A;  2NUP B;  4M7D D;  1YI2 B;  2YWG A;  3M0P A;  4X7C A;  2D3N A;  1DDI A;  3AGP A;  1QGA A;  2ATC B;  2LJ1 A;  3ASQ A;  4QVC A;  3OYK A;  1AEY A;  4PK4 A;  4IUR A;  2MI6 A;  2QEX A;  1K9M D;  2KRO A;  4M75 A;  3MKD A;  3PIP A;  1OHH A;  2WAC A;  3A8I A;  1I18 A;  3MPU B;  2EW3 A;  3JCM g;  3HSB A;  4DK0 A;  4HKE A;  4E7J A;  2RHY A;  5LJ3 h;  5HKK A;  2JNG A;  4HXJ A;  2YXY A;  4BDZ A;  1HSQ A;  3CD6 B;  1N05 A;  2LZ6 B;  3GVL A;  2E6Z A;  4EMK A;  4E7L A;  3H9N A;  3V8J A;  2P0K A;  1N0U A;  5LMZ A;  1PJ5 A;  3VYH B;  1I1J A;  4IIM A;  2JS2 A;  3CEY A;  5GAN d;  4YEL A;  4XKW A;  2XZL A;  2YUN A;  4RDJ A;  5IT9 E;  4P5N A;  4BI8 B;  3QSY A;  2KRN A;  1J9Z A;  4ATO A;  1R5N A;  1YWP A;  2P0Q A;  5IN1 A;  4Y9U A;  1N9R A;  2P4T A;  1QVF A;  4Q5W A;  1VHE A;  2PQW A;  3LYI A;  2JJ9 A;  4PJO C;  1D09 B;  3CCS A;  3CBO A;  1VQN A;  4C92 A;  1SEM A;  1XE1 A;  2LNH B;  1KC8 R;  1UJ0 A;  1RI9 A;  3RDV A;  2XDP A;  3E2U A;  3CCS Q;  3ER0 A;  1VQN Q;  2MYS A;  1H3H A;  1Y07 A;  4JDS A;  5AT1 B;  3OYE A;  1N08 A;  1YBY A;  3PVD A;  2X6X A;  3PT9 A;  2L3P A;  3L2Z A;  2FRY A;  4M77 G;  2QAS A;  4II1 A;  4MYT A;  4E0F A;  4G1V A;  4OMN A;  2EFI A;  5IYR A;  3WVE B;  1WOS A;  1KC8 C;  5FU7 B;  1VYT A;  1Q7Y U;  3W2G A;  3HL8 A;  4TKO B;  4YAF A;  4BE0 A;  5ECA A;  4RTV A;  3A8H B;  1SKQ A;  4C0D C;  2LQW A;  4LUD A;  4ZCI A;  3QG1 A;  2RK2 A;  3JAM E;  4BI4 A;  5J35 A;  1D3B B;  2GJK A;  1SSF A;  2RQR A;  2FVG A;  3HRS A;  3BCD A;  2DL5 A;  1BI3 A;  3VS4 A;  1ZM3 A;  1TOV A;  1NYF A;  1I81 A;  1VIF A;  3VYG A;  1Q95 G;  1UD2 A;  1TWB A;  3CCQ B;  2V7V A;  2YLC A;  1FMK A;  5GAN 8;  4ZGQ B;  2DNU A;  3ZEH A;  2D0Q B;  3HHT B;  5LJ5 h;  4R56 A;  2K57 A;  3A98 A;  3OYL A;  3A35 A;  4A4H A;  4X0C A;  1MRZ A;  1JJ2 B;  1KTV A;  2CKK A;  3BH4 A;  1S0U A;  1XFO A;  4C5I A;  3AVT A;  5I11 A;  4D6W A;  1QWF A;  4A4G A;  2V1R A;  1KG1 A;  1I0C A;  1AWO A;  4HCB A;  4LDY A;  1K0X A;  5AN9 A;  2DTH A;  2F2W A;  1W9X A;  3G1J A;  1QLY A;  4WCI A;  2RC6 A;  4X7D A;  5AYF A;  3OPO A;  2DER A;  3UF4 A;  2Q6I A;  2GQV A;  4X7F A;  1ZA2 B;  3A8K A;  4AFS C;  3CC4 A;  1GAW A;  4BPR A;  1EX4 A;  1PJ6 A;  4DEY A;  1OPL A;  3WVD B;  4OMP A;  4RPB A;  2LQ8 A;  3JB9 F;  3CC4 Q;  4PC3 A;  1H42 A;  2LZJ A;  1SKY B;  3EGU A;  4PAB A;  3PVL A;  4EMK C;  1K73 R;  1D0X A;  1YJ9 T;  2MWO A;  3OS5 A;  4RD6 A;  1QKX A;  4F7U F;  1WHH A;  2F2X A;  4E7H A;  3ZZU A;  2C0T A;  2L89 A;  3JCM c;  4OPV A;  1N8R U;  4QVZ A;  2QA4 A;  1B34 A;  2CYZ B;  5TR9 A;  4OB3 B;  4RCZ A;  4FCY A;  2VNH A;  3VUB A;  4PJL A;  1RAE B;  1FNC A;  3AVV A;  1RAG B;  2DZC A;  4EIK A;  4M7D G;  1VLO A;  2GQF A;  1YJ9 B;  4FXU A;  3WXM A;  3S3O A;  2VWF A;  4FW1 A;  3I5S A;  2XNJ A;  4N4G A;  5HKC A;  2ZGW A;  2RH2 A;  2LMJ A;  2L0A A;  1NM7 A;  3CXC B;  1ACM B;  2KY9 A;  1YHQ Q;  4WZT A;  1WJQ A;  1BI0 A;  4LDV A;  4LC0 A;  3SD4 A;  3I55 T;  3C12 A;  4FU6 A;  3CC2 A;  3CP8 A;  4OB2 B;  3NPF A;  2E3H A;  4B3G A;  3OMG A;  1X6G A;  4J6Y A;  1GO2 A;  4XLF A;  2DET A;  3CC2 Q;  3ES9 A;  4JZ3 A;  2FVU A;  4XU1 A;  5D7U A;  5DY9 A;  2LVM A;  4J6W A;  2BE7 D;  3V8K A;  2VJJ A;  1VA7 A;  2QDY B;  4C8Q G;  3EGD B;  2D1X A;  3CBM A;  3IQL A;  3I55 B;  1D0Y A;  1R5B A;  3ASP A;  1W0J A;  1Y57 A;  4J9I A;  5HZB A;  4HT9 A;  1MHN A;  2RHU A;  2VV5 A;  2OBT A;  4RMO A;  1RUW A;  3VJP A;  1A8P A;  4OP0 A;  5KCO A;  3REA B;  2LCS A;  4A4E A;  1E62 A;  1JXO A;  4E7S A;  2ZXH A;  5IYQ A;  4AT1 B;  3CC4 T;  5GAO l;  1M5Q 1;  2VYQ A;  4DOV A;  2M0Y A;  2I1L A;  3ZPN A;  2RJF A;  2VBU A;  5GAN 4;  2YLB A;  3A8O B;  1B07 A;  1NEG A;  2CBX A;  3ISX A;  1K0S A;  1BIB A;  2C5H A;  2VUB A;  1RAB B;  4XTU A;  1QG0 A;  2KGT A;  1M8M A;  1OQK A;  1Y71 A;  2K9G A;  1F20 A;  1FRQ A;  2R9V A;  4AVZ A;  4F7U A;  4H9G A;  2DBK A;  2KYB A;  3MEU A;  3QFR A;  3FB9 A;  2V8I A;  5GAO q;  2ZTN A;  1AZG B;  1DG1 G;  4CQJ A;  4P9S A;  2QQA A;  3LH0 A;  3EG2 A;  3DB3 A;  1YJW A;  3OP1 A;  4G7W A;  4M75 G;  1FXX A;  1MNE A;  6AT1 B;  2BGI A;  1GXI E;  4P22 A;  3VO1 A;  1F60 A;  3RUX A;  5IHN A;  1YHQ T;  1QVG A;  2VBS A;  2PTK A;  3G71 A;  4ZTJ A;  3OSS C;  1MUZ A;  3Q38 A;  1N27 A;  4PJN A;  4ACB A;  3EFO A;  1IO6 A;  2KEA A;  4OPS A;  5LJ3 d;  2ABL A;  2WZP P;  3NGP A;  3FPK A;  5GAN f;  4XOT A;  3S3M A;  1WGS A;  2JS0 A;  5GMK e;  4LDU A;  3BY2 A;  1EFU A;  3OYF A;  3VRZ A;  4C0F A;  2GRE A;  2RN8 A;  4M77 F;  5GAM j;  3UAT A;  1SG5 A;  1GL5 A;  1AIP A;  1YN8 A;  3PUN A;  1KQ2 A;  4Y9R A;  2IPO B;  1MAB A;  2OAU A;  5GJW B;  2K5I A;  4JS4 A;  1LNX A;  5FL7 A;  3A5Z B;  4QT7 A;  2X4W A;  1R77 A;  2KYM A;  3DDY A;  3CCL B;  3P27 A;  4NOY A;  4M4S A;  4RD4 A;  2R5M A;  2J06 A;  2HDN B;  2Y90 A;  5EMN A;  3VUZ A;  3VKI A;  4EPC A;  2X4J A;  1W4S A;  3T56 B;  3EFR A;  3Q1J A;  4BUG A;  2RQV A;  3QUI A;  1FX0 A;  3EG1 A;  5HK3 A;  1AHJ B;  2KT1 A;  3LGL A;  2EBP A;  5DN6 A;  8ATC B;  2DPP B;  1IGQ A;  2RNA A;  3JCM P;  1M3A A;  4JJB A;  1CNE A;  1QUF A;  4A63 B;  4Z4T A;  1DJ7 B;  1VQ9 A;  1BK2 A;  1D1B A;  1E6G A;  3QFT A;  2D8J A;  1TVC A;  2RQW A;  4FN5 A;  4J9B A;  1PG5 B;  1VQ9 Q;  3CCJ A;  1EXM A;  1VQO T;  5KSW B;  2GFA A;  2RHI A;  3C4S A;  3CCJ Q;  3LW5 E;  2DD4 A;  4NCN A;  2OYN A;  2QN6 A;  4JRK A;  1NJI C;  1K8A R;  3PA2 A;  1E43 A;  4HVW A;  1RAA B;  3E1Y E;  4X05 A;  2YUP A;  4RKU E;  1HZE A;  1WSV A;  1VQO B;  5CKH A;  5LJ5 d;  4ORZ A;  1H92 A;  1CQX A;  4KKS A;  1M9S A;  2JJ2 A;  5FRO A;  1EP3 B;  4OF1 A;  2CRE A;  1YP5 A;  1M1K U;  2D0N A;  1GBR A;  5KW9 A;  1VQ6 B;  4M7A A;  1ZHI A;  1UDL A;  1X01 A;  2QTX A;  2JZ2 A;  4E2F B;  1N6A A;  3EG0 A;  1K8A C;  3M4Y A;  3E9F A;  2E1H A;  3B82 A;  4M0L A;  2VNJ A;  2DX1 A;  1IRX A;  2GCX A;  2JM8 A;  4FK8 A;  5J26 A;  1B2R A;  3CME A;  3OEH A;  4M53 A;  1W87 A;  4M77 A;  2CF4 A;  2WPD A;  3OYN A;  3CME Q;  4Y91 A;  4M7D F;  2DKG A;  3J7A F;  2XK0 A;  2E41 A;  3AT1 B;  3E1S A;  1YJN A;  3CC7 A;  3QE2 A;  3L2V A;  1VQ4 B;  2K3Y A;  2GGR A;  2E4H A;  1IGU A;  1X69 A;  1K9A A;  2VB6 A;  4ZN1 A;  1YJN Q;  1Q82 U;  3CC7 Q;  3C95 A;  1TUI A;  5GAN 2;  2JXB A;  5KE2 A;  4JZ4 A;  1JB9 A;  1ZX6 A;  2HL5 C;  5F4O A;  3BDU A;  4WZL A;  5THX A;  3D26 A;  1VQ8 A;  1KK2 A;  2P3M A;  2CUD A;  1VQ8 Q;  2JMA A;  4RUG A;  2DTO A;  1Q86 D;  1GFC A;  3J81 E;  1RLP C;  4C8Q F;  4ME7 A;  4Z02 A;  4OMQ A;  4ZGE B;  4RD2 A;  3CCJ T;  3B78 A;  2HMA A;  1BJK A;  1LPL A;  3M0R A;  2I2L A;  2F1M A;  1Q7Y R;  3M0T A;  3ZC3 A;  1I8D A;  4R71 A;  4A4K A;  2EAY A;  4DOW A;  4ANJ A;  1PWT A;  3M5A A;  1U5S A;  3FC3 A;  1N06 A;  4RCB A;  1BI1 A;  3I35 A;  1XB2 A;  1W2B B;  3CCM T;  4TVR A;  3OS2 A;  5TV2 A;  3QWY A;  1WPC A;  4CC7 A;  1UD3 A;  2AZS A;  2YHT A;  2QK0 A;  1VQK Q;  3EH1 A;  1Q7Y C;  1UGQ B;  3H0H A;  1QFJ A;  1RQR A;  1OPK A;  2CUB A;  3MCA B;  2DY1 A;  4XL9 A;  1NG2 A;  3EAE A;  3CCU A;  1NYG A;  1W35 A;  3CMA T;  2F43 A;  5A88 A;  1EFT A;  1I5O B;  2CP6 A;  5GMK i;  3CCM B;  2D9T A;  3CCU Q;  3CBP A;  4BY6 C;  4M78 B;  2W0Z A;  4J9E A;  4FYV B;  2DL4 A;  1UGV A;  3QXE B;  1DAR A;  1MMD A;  1QFY A;  1SSH A;  1WXU A;  4DEX A;  2X6W A;  1VYV A;  1HYO A;  4V2S A;  4RJL A;  4QQG A;  5JBQ A;  2M51 A;  1N5Z A;  1ARK A;  2ECZ A;  3EGX B;  2FZG B;  4M75 F;  1X6B A;  3JQR A;  4DBQ A;  1VJS A;  4M7D A;  1YJN T;  4FIB A;  5HK0 A;  3CC7 T;  1E1R A;  1K76 A;  4Z4S A;  1QCF A;  1SRM A;  3TQ7 P;  1QP3 A;  3LWH A;  4HCZ A;  1RAH B;  3W2E A;  4AG2 C;  3WQZ A;  1GVH A;  4Y92 A;  4IUV A;  3L2U A;  2LCL A;  4KUI A;  4LD6 A;  3QJY A;  3CD6 A;  5CAI A;  3NE5 B;  5I2M A;  2MPX C;  2XHC A;  1PJ7 A;  2PNI A;  3CD6 Q;  2VKN A;  1KQ1 A;  1G7T A;  2QYZ A;  4M77 C;  3ZL7 C;  3JU4 A;  1TTH B;  4KUD K;  4PFO A;  3HRT A;  4OOV A;  3GIB A;  1G83 A;  4AFZ C;  1KRH A;  2G3R A;  1BPL A;  1P4M A;  3QBY A;  1SF9 A;  2LQN A;  4OMO A;  2WR8 A;  5KYN A;  1NZ9 A;  1WDX A;  1NB0 A;  3VS5 A;  2VBT A;  4ZNX A;  3SLN A;  2D74 A;  5LJ3 f;  2ZZQ A;  2EQI A;  2YWW A;  2CZ6 B;  2DYI A;  3GBQ A;  2EQK A;  2BIV A;  2ZTG A;  1MMG A;  5KYX B;  1NJI U;  1VQK T;  5GAM h;  1J3T A;  1N8R C;  2DIL A;  2KVO A;  4XK8 E;  1BU1 A;  2YDL A;  1WHG A;  4TN1 A;  1TTT A;  4IUP A;  5J3B A;  4XLE A;  3MP8 A;  2DL8 A;  1FYN A;  1WHM A;  1XQB A;  1IB8 A;  3CQT A;  5A0G A;  2BM0 A;  5DLO A;  1PHT A;  4F16 A;  1IJE A;  3WNC A;  3CCR B;  2HEQ A;  1EP2 B;  1YIT B;  2E1B A;  1N9S A;  1WIE A;  3SFM A;  2PLF A;  1MMA A;  3OYI A;  3VS7 A;  4XNF A;  2O31 A;  3AVW A;  1ZUY A;  2EQJ A;  1D3B A;  4ZGJ B;  5J3O A;  2OI3 A;  3FJP A;  2XZO A;  3WYA A;  1WI7 A;  2ZZE A;  4RDL A;  1BI2 A;  1ZSZ C;  2DVJ A;  2P84 A;  1SKU B;  3CCQ A;  1OUL A;  1TH7 A;  5CKF A;  2A36 A;  1BX0 A;  1GFD A;  1C6V X;  1QWE A;  4FT2 A;  2QEX Q;  5LJ3 e;  2DK3 A;  2ZZF A;  1VQM T;  3A8G B;  1WJR A;  3KBG A;  5GAN 6;  1LCK A;  3F70 A;  4L5G A;  1Q81 U;  3HRU A;  1AOJ A;  5DSZ A;  5HZA A;  3H41 A;  1NRK A;  1KK7 A;  1FNB A;  1RI0 A;  3L2Q A;  5C6S A;  4FW2 A;  3MHX A;  4OVA A;  4PAA A;  2CP0 A;  1UD5 A;  2HQE A;  3QYH B;  2NUT A;  2LP5 A;  3P8H A;  1EP1 B;  3KL9 A;  4FWT A;  2V31 A;  1KFZ A;  1E1Q A;  4P26 A;  1VQM B;  1UHF A;  3QYG B;  4P6Y A;  2DRK A;  5LJ5 f;  4PJO B;  4KUL A;  4M7D C;  1FMV A;  3DLL A;  2R58 A;  4XTV A;  2XZP A;  4XU0 A;  3M53 A;  3PMT A;  1OV3 A;  1M90 U;  2XI9 A;  1HK9 A;  4RCC A;  5KYU B;  4CC3 A;  1BKB A;  3I56 A;  4M7A G;  4LNP A;  4QVA A;  1MV3 A;  1KD1 U;  3VS1 A;  5GAN g;  1KC8 D;  1M1F A;  2CS7 A;  3G05 A;  2AHO A;  3I56 Q;  5FO0 A;  1T0H A;  5FIU A;  2R57 A;  1ZUK A;  2C4T A;  2KT8 A;  5FW9 A;  2GPJ A;  1NDH A;  1UJY A;  4RTY A;  1IHV A;  3PA1 A;  5GMK j;  1WFW A;  1S4M A;  2HKQ B;  3OZW A;  3KXT A;  4C0D B;  1HVX A;  4AG1 C;  2KXD A;  1LOJ A;  2DJZ A;  3X25 B;  4ASU A;  1XJW B;  4A53 A;  4C8Q C;  5KYW B;  1YIJ T;  2KRM A;  1FDR A;  4A54 A;  2CP2 A;  2RO0 A;  2E6N A;  1FND A;  4UZU A;  2LC4 A;  1Y96 A;  2AHJ B;  3EG3 A;  3VRY A;  2X8K A;  5CIU A;  5BSY A;  1G3S A;  3OW7 A;  3OZV A;  3TCJ A;  4XLH A;  1R5O A;  3ZBD A;  2XMF A;  4XN0 A;  1ZQ1 A;  3S3N A;  1T6Y A;  2O4X B;  2QGG A;  3OQ5 A;  1TXQ A;  1YIJ B;  2JTF A;  1OEB A;  5GV8 A;  4N4H A;  2C4U A;  3FJO A;  2QEX T;  1MGQ A;  4JRI A;  5A8A A;  2F1L A;  4XU2 A;  1H3Z A;  3LLR A;  4MMK A;  5CVI A;  5F4M A;  2WSC E;  3P8D A;  4F17 A;  4J9G A;  2E12 A;  4P1V A;  3GSI A;  2V26 A;  5KYY A;  9ATC B;  4X1V A;  2RB6 A;  1O75 A;  2QAZ A;  1NEB A;  4IUU A;  4OB0 B;  1JXM A;  3ASS A;  1IHW A;  5HXB A;  4C5E A;  2P4R A;  2EPD A;  2RQT A;  2EJ9 A;  4XTW A;  3JCM Q;  5DM7 R;  3H94 A;  1V0F A;  3ONY A;  1YCS B;  2M02 A;  2NYS A;  2LJ3 A;  1I5L A;  4J9D A;  3L42 A;  1E79 A;  2HLD A;  4QFM A;  3V7A A;  2DAQ A;  4NS5 A;  1BQE A;  2NPF A;  4HCC A;  2D8H A;  3GOX A;  2E5Q A;  3DKM A;  4AFU C;  4M75 C;  2X53 S;  4EMK B;  5GAN 5;  4OOS A;  4UAJ A;  2PVO B;  4LN2 A;  1Y0M A;  2V7X A;  4B3F X;  2CH4 W;  2ZAE A;  4KGZ B;  3CCS T;  5LL6 S;  4RLZ A;  2QQB A;  1VQN T;  2M1H A;  1BB9 A;  1R8O B;  3RKW A;  4YAL A;  1K73 D;  3AST A;  1RQP A;  1E3Z A;  1ABO A;  2BTT A;  3OYJ A;  1M1K R;  1UEB A;  1WP6 A;  3L2W A;  2WJV A;  4N3G A;  1H85 A;  2ZL5 A;  5IYW A;  4II3 A;  2XEX A;  3C94 A;  2JVV A;  1GCP A;  3CCS B;  1VQN B;  4MZM A;  4DNR B;  4C92 B;  1YCY A;  2OJ2 A;  2QA4 Q;  1C0M A;  1WX6 A;  2B8A A;  4ELZ C;  1M1K C;  2EKO A;  1OGJ A;  4G7X A;  1RL2 A;  2BZ8 A;  1WZO A;  2V7W A;  3W2F A;  4C92 C;  1D1A A;  1JJ2 S;  2QXF A;  1VQP A;  1MND A;  1AZE A;  5GAO n;  2AK5 A;  1YLO A;  5CK9 A;  4JJC A;  1IZ6 A;  1Q82 R;  2ZIT A;  5GAO p;  4J9F A;  1VQP Q;  2PU9 B;  1M3B A;  1YWO A;  2LTO A;  1AMO A;  2R5A A;  2PE3 A;  2VGN A;  2ZPG B;  1QX4 A;  4G6I A;  1JQQ A;  1EZZ B;  3ZIA A;  2EYY A;  3AHU A;  1NPP A;  3HFO A;  2XNC A;  3W5V A;  5H59 A;  3RMQ A;  1WJS A;  3SKB A;  2K79 A;  1Q82 C;  4ACA A;  3ZBT A;  1P92 A;  3CCL A;  2EWN A;  1WQW A;  4RTT A;  3M58 A;  1O9S A;  4MDW A;  2DBM A;  3CCL Q;  5IYP A;  2ESW A;  1WTH D;  4EMG A;  1VQ5 A;  4WTO B;  1CNF A;  2KAF A;  4ESR A;  1JJ2 P;  1NPR A;  1VQ5 Q;  5GAM d;  1RAD B;  2OTL A;  2JN0 A;  5CCA A;  3UT1 A;  4ZGN B;  1X43 A;  2QQ9 A;  2XKO C;  4MML A;  4PJJ A;  5C0M A;  1B23 P;  1MV0 B;  2OTL Q;  4AC9 A;  3MJX A;  2XOK A;  2ZXI A;  3L1A A;  1H8H A;  1K9M U;  2J7I A;  3BY7 A;  4KT0 E;  4RTU A;  1ZM9 A;  3CC4 B;  3NTK A;  3CRZ A;  1R0C B;  3A8L B;  3X24 B;  1VQ7 A;  2JTM A;  3A8J A;  1U8R A;  5GMK l;  2QA4 T;  3G4S A;  2L3S A;  4OOX A;  3H0I A;  3JB9 J;  5L46 A;  4MZT A;  1VQ7 Q;  2RMO A;  1AWJ A;  3Q39 A;  4QUZ A;  5I22 A;  3G4S Q;  1WOP A;  3CXC S;  1V29 B;  2D9R A;  5CDF A;  3JCM f;  3WND A;  2V8J A;  4MYU A;  1QUE A;  3SJZ A;  1YJW Q;  3AGQ A;  4Z4V A;  1KZL A;  4PGO A;  3OY9 A;  4M7A F;  2BZX A;  2LT1 A;  1B34 B;  4YHB A;  2DLP A;  3G71 Q;  1X6O A;  2CT3 A;  1JEG A;  4ZCM A;  1VQ6 A;  3U2Q A;  3QHS A;  2OX7 A;  1B3Q A;  1UGS B;  3CC2 T;  2WSE E;  1VQ6 Q;  1SM4 A;  2XND A;  1LJO A;  3ZBU A;  1QCN A;  3OYH A;  1YHQ B;  4E6R A;  2X4X A;  4M78 E;  1UD4 A;  2C2W A;  3OW2 B;  2DMO A;  2OTJ A;  4AF7 A;  1VLY A;  4LDW A;  5H5J A;  1UFF A;  5LJ3 g;  3SEM A;  1RAI B;  2OTJ Q;  3CC2 B;  2BE9 B;  2MIO A;  2Y4X A;  1VQL A;  4J9C A;  1TS9 A;  3QKJ A;  3T51 B;  3CXC P;  3EG9 A;  2ROT A;  3DB4 A;  5J39 A;  1VQL Q;  3LQ6 A;  2FZK B;  4II2 A;  1M2O A;  5GMK h;  2AKK A;  2PVD B;  3UA6 A;  2FRW A;  1VQ5 T;  4J7I A;  2O2O A;  3AVX A;  1WDT A;  4JJN K;  3BC9 A;  5F4J A;  2KNB B;  1WNL A;  3FKS A;  2QQR A;  2A28 A;  3SWN A;  2MF2 A;  5TRD A;  1WHJ A;  1IHM A;  4B9X A;  3JCM h;  1NJI R;  2EGA A;  3V7C A;  3G7Z A;  2DXU A;  4B6M A;  3FEO A;  4OPO A;  3R6K A;  1TUC A;  4GQN A;  2YRD A;  3MHP A;  5GAN e;  1SHG A;  2FG0 A;  3VMF A;  1WHL A;  4PLL A;  4XTX A;  2F4N A;  2OBR A;  1VUB A;  1COW A;  1Z9Q A;  3CCE A;  1OU9 A;  3G4S T;  5BSX A;  2RI2 A;  1D8T A;  1QP2 A;  1BLI A;  1K8A D;  3CCE Q;  2GJR A;  3GLX A;  4OGE A;  1GBQ A;  2L5Q A;  1YJW T;  2IG0 A;  3AVU A;  4FM4 B;  3JCM X;  4RD1 A;  2ZPF B;  1G3T A;  4F7U B;  2RPN A;  1G7S A;  3G71 T;  3RER A;  1ZBX A;  2KDS A;  3V7S A;  1UGP B;  2DRM A;  3CB4 A;  3MP1 A;  2E10 A;  3H6Z A;  1T6X A;  4F7D A;  1W70 A;  1UUE A;  3MCA A;  3LO8 A;  1UMK A;  1Q81 R;  2P0P A;  2CND A;  3G6E A;  4LBY A;  1OX9 A;  4LBW A;  4WZE A;  4C0S A;  3U6B A;  5LJ5 g;  1K73 U;  3RKY A;  2V7Q A;  3LX7 A;  4JUV A;  3OYC A;  3G6E Q;  3CPW B;  2VAS A;  3CCV A;  3QFC A;  3EFO B;  2H3E B;  3ZUG A;  4XQF A;  1W34 A;  3EHR A;  2F69 A;  1Z9Z A;  1OB0 A;  1ZM2 A;  3CCV Q;  3BQJ A;  5CQY A;  5A2Q E;  3LNN A;  3EGX A;  1T3L A;  1M2V A;  8AT1 B;  1VQL T;  1UD8 A;  1BBZ A;  3PNW C;  4B4D A;  1Q81 C;  2AIR B;  2WJY A;  2DCU A;  2CP7 A;  4XD7 A;  1M90 R;  4P6V F;  1NE8 A;  3HTR A;  2LT4 A;  3BW1 A;  3WY9 A;  1U3O A;  1OI1 A;  1PD0 A;  3OS0 A;  2A3L A;  3VR6 A;  2SRC A;  2QE7 A;  4U9U A;  1NLP C;  1W0K A;  1KD1 R;  5KNL A;  1E64 A;  1M4Z A;  3JV3 A;  4L8J A;  3OW2 P;  2DIG A;  1JO8 A;  1VQ9 T;  1M90 C;  5FWC A;  4LXC A;  4X9C A;  2OAW A;  4PJO E;  2RA2 A;  5L23 A;  1KD1 C;  2GK6 A;  4NL2 A;  4N3N A;  1VHO A;  2PMD A;  1Q7Y D;  2O01 E;  2HZY A;  1E7O A;  3S6W A;  4M1K A;  4XOP A;  2COW A;  3VNU A;  1A0N B;  4Z4U A;  4TSF A;  4JLG A;  3THK A;  4UZE A;  1I07 A;  1VQ9 B;  4X07 A;  1UD6 A;  5D6W A;  3GVJ A;  3NFC A;  3M9Q A;  2Q6O A;  3QPH A;  3CCJ B;  5KYX A;  4C8Q E;  4GBQ A;  2CP5 A;  4RM0 A;  4XKV A;  4D8K A;  2DEQ A;  4BI3 A;  3ME9 A;  2ENM A;  3I1F A;  4VUB A;  2JDI A;  3OB9 A;  4FYW B;  2ZPH B;  5GV7 A;  4BY6 B;  4B47 A;  3OFN A;  2KBT A;  3ULR B;  4R0K A;  1V0E A;  2C78 A;  4M78 D;  1S72 A;  1KQS B;  3CCR A;  1S72 Q;  1HD3 A;  5FWB A;  2CDT A;  2R6H A;  3MEV A;  4YAO A;  4E7I A;  4WWV A;  3OZU A;  1S1N A;  3CCR Q;  3CME T;  4QW2 A;  2FHD A;  2NUP A;  5DLQ E;  3V8L A;  3WBJ A;  2HKN A;  4BB7 A;  3CCV T;  2LDM A;  1YI2 A;  1EFR A;  5GAM f;  4RD3 A;  2ZL7 A;  2YUO A;  4EDU A;  1YI2 Q;  1ZSG A;  2Q6L A;  1AWX A;  3CMA B;  1QW1 A;  2W6J A;  1W6X A;  3X26 B;  4GY5 A;  4PNO A;  2FZC B;  2GTJ A;  1ABQ A;  4M7A C;  1RAF B;  1D1N A;  1YFN A;  1WXB A;  3UWN A;  4IIO A;  2L3R A;  3CW2 A;  2DJQ A;  2HCK A;  4DQK A;  2VGM A;  4M77 B;  1AD5 A;  3R6O A;  5IAY A;  4KKT A;  3WNB A;  3A3B A;  4L59 A;  4TMW A;  2IVW A;  3ASR A;  1VQ8 T;  3JQP A;  3JQQ A;  1AT1 B;  1JBM A;  3TU4 K;  2YRC A;  3NTI A;  4YXW A;  1YJN B;  3CC7 B;  3CPW P;  4KH0 B;  3BFM A;  4AFQ C;  4QKU A;  4PC2 A;  2HSE B;  4BE1 A;  2CC2 A;  4M75 E;  1G8X A;  4PC6 A;  3QJ6 A;  2XDB A;  2VC8 A;  2O9S A;  3BDL A;  5EC7 A;  3OE7 A;  1N8R R;  1KK1 A;  3M55 A;  4XU3 A;  4KH1 B;  4QQD A;  4E47 A;  2BUD A;  1VQ8 B;  2RJC A;  2W6I A;  4K11 A;  1W2B S;  3KFV A;  4PKC C;  4J8O A;  1JU5 C;  4C5H A;  1QFZ A;  3SHW A;  5TY0 A;  3MO8 A;  2J05 A;  5KYU A;  5GAN 3;  4C43 A;  4HE5 A;  4TT3 A;  2SEM A;  3BE3 A;  4XTZ A;  4GLK A;  4PJM A;  4EH1 A;  1PRM C;  3U6K A;  3OA6 A;  2BM1 A;  2X85 A;  2B7B A;  4Y7C A;  4RCY A;  2J7K A;  1V1C A;  2DEU A;  2FYK A;  1X2K A;  1HA3 A;  1QQJ A;  2DM1 A;  3VS3 A;  2HSP A;  2GJP A;  2KMT A;  1YNZ A;  3CCU T;  2NV4 A;  5KYW A;  5FU6 C;  2V7T A;  4C92 E;  2JOY A;  2DA9 A;  1VQK B;  2CZ0 B;  1ZSZ B;  3NHN A;  3JB9 I;  5FA6 A;  5A89 A;  1UG1 A;  3SEJ A;  4XLA A;  1HXD A;  2EYZ A;  4F04 B;  1PKS A;  5L8R E;  2PUK B;  2BZY A;  1QVP A;  2K3X A;  1WPY A;  4L6V 5;  2XU8 A;  4IUT A;  4OGC A;  1W2B P;  3W2H A;  2EFG A;  4M2L A;  2O4X A;  2QTZ A;  2ZL6 A;  3OSV A;  4QVJ A;  2J6O A;  1BX1 A;  2CT4 A;  5CKB A;  2DZ9 A;  1EWY A;  2VYT A;  1NBE B;  3CCQ Q;  4PC1 A;  5HY6 A;  1KQS P;  3JCM d;  1NLO C;  1JJ2 A;  3INZ A;  4QVD A;  4Z4W A;  2X3W D;  3QO3 A;  1TSF A;  3CD6 T;  2EYX A;  4KKU A;  1FX7 A;  1PM3 A;  2DE0 X;  1UE9 A;  4M7D B;  4BE2 A;  2E3I A;  4OMM A;  2X9H A;  4BAC A;  4PJO D;  1YX2 A;  2EJF A;  3GF5 A;  4KGX B;  4AMC A;  1K9M R;  3CPF A;  2FPD A;  1SRL A;  2G6F X;  2DIE A;  3Q3A A;  2QDX A;  2OK8 A;  1D1C A;  3O5Z A;  2O88 A;  2ZZG A;  1TG0 A;  3T53 B;  2C06 A;  2LNV A;  4FL6 A;  5A0L A;  3HKS A;  2CH4 A;  1GJR A;  1KHI A;  2RD1 A;  2RK1 A;  4C8Q D;  1K9M C;  4K1X A;  4C8Q B;  1CKB A;  1QH0 A;  3URG A;  3TEE A;  2NWM A;  1ZUU A;  1PC0 A;  4M78 G;  2JJ1 A;  2L8D A;  1V5V A;  1Y7X A;  1H8E A;  4X7E A;  4J9H A;  2JW4 A;  2KSS A;  2MOX A;  2QTV A;  4TMT A;  3M0S A;  1V76 A;  2M16 A;  3RES A;  3EH2 A;  2RHZ A;  1T5E A;  3LVB A;  1R0B G;  2D6F A;  4JLI A;  4KGV B;  2HNI A;  1YJ9 A;  1WOR A;  1IRE B;  2PIA A;  4P3Y A;  4HT8 A;  1KMH A;  1Q86 U;  1YJ9 Q;  4CC4 B;  2VVK A;  2KI7 A;  2K5L A;  1E6H A;  1ELO A;  2CRV A;  5LJ5 e;  3CXC A;  1CKA A;  2AT1 B;  3CCQ T;  4XQ3 A;  2FB7 A;  2C5B A;  4B3X A;  2E5K A;  4NNJ A;  3WBK A;  4MZP A;  2F5T X;  4JRP A;  1BCM A;  3FJ5 A;  3VU3 C;  1M8V A;  3V7R A;  3VNV A;  1U2R A;  3QWX X;  4M75 D;  5FU7 C;  3TSW A;  2JM9 A;  1UHC A;  3CPX A;  2K6D A;  2EQM A;  1BCO A;  5GAN j;  1WU8 A;  3PGG A;  2ED0 A;  2QEX B;  1SPK A;  3EGD A;  2YT6 A;  2Z6B D;  1ZA1 B;  1G7C A;  2CZ7 B;  3QII A;  1LVK A;  3LH5 A;  4M75 B;  3I55 A;  1WOO A;  4XR6 A;  2EYQ A;  3Q6R A;  3OYY A;  1KJZ A;  2HCJ B;  3R6J A;  3TSZ A;  3I55 Q;  4YAU A;  4D8D A;  1JB0 E;  2H3J A;  5IHK A;  4O5V A;  2HAX A;  2D3L A;  2JN9 A;  2X0K A;  4NBS A;  1M3C A;  3JCM J;  2BF4 A;  2EYW A;  4RTW A;  3RKX A;  2RI5 A;  5FO1 A;  2WZN A;  2VNI A;  2NUT B;  2K2M A;  4B48 A;  3I56 T;  3QSU A;  2BV3 A;  2VBV A;  2B86 A;  2GF7 A;  2YWE A;  1QMC A;  4RG2 A;  4JJD A;  3OYD A;  2OK7 A;  3FPP A;  2PUO B;  2FO0 A;  3SDZ A;  3E20 A;  1MMN A;  2L3Q A;  1M1K D;  2OBS A;  2GBQ A;  2X4Y A;  3M54 A;  3VV0 A;  4TMZ A;  1GRI A;  4C92 D;  2O9V A;  3BNW A;  4C5G A;  2CW5 A;  1Y0R A;  2BKD N;  3I56 B;  1QVF B;  5FNZ A;  1TU0 B;  3OS1 A;  1OX8 A;  3H0F A;  4G1B A;  4XMY A;  4X8I A;  1FWZ A;  2YWH A;  3QFS A;  2NLU A;  3EHQ A;  4HVV A;  2CK3 A;  2GK7 A;  1M30 A;  4QHY A;  5GJV B;  5CQX A;  2YSQ A;  5CKE A;  3JCM b;  1IB0 A;  4F7U E;  4O6J A;  4TMX A;  3QDF A;  3HAG A;  1GCQ A;  4LDX A;  1WLP B;  4P12 A;  2BVN A;  1M27 C;  2A37 A;  4XAX B;  1Q82 D;  3P26 A;  2GQI A;  2K4Y A;  1Y96 B;  1K73 C;  1G5V A;  1VYU A;  3CES A;  3M0U A;  2LX7 A;  1D2E A;  2DXB A;  3JSC A;  5IH2 A;  2AKL A;  4CI0 C;  1KK3 A;  4CC2 A;  1YHQ A;  4ZTF A;  2ZBU A;  2EIF A;  4PJO G;  2H8H A;  3OW2 A;  5HCK A;  2ZPE B;  5D6Y A;  2MWP A;  3VS0 A;  1AWW A;  2L2P A;  3HFN A;  1OB2 A;  2LRQ A;  2A7Y A;  4PFZ A;  4DBH A;  2E64 A;  5B6I A;  3JRZ A;  2BSA A;  2DVE A;  4RG8 A;  3JB9 H;  2DXC A;  5KYY B;  2COY A;  1BYM A;  4XN3 A;  1N07 A;  3X28 B;  3X20 B;  5FLX E;  5CR2 A;  3GIR A;  2VNK A;  2M0O A;  2W10 A;  4PL6 A;  2CZ1 B;  1IXD A;  3I5R A;  4G5G A;  3RBB B;  2V7U A;  4JRQ A;  4Z4R A;  3JCM W;  2FPF A;  1QVF S;  4LBZ A;  2C77 A;  4XON A;  1WXT A;  1UB4 A;  4M4Z A;  2BN4 A;  3UDC A;  2ZZD A;  1W1F A;  5A0D A;  2WYR A;  4RD0 A;  4N4I A;  4JMQ A;  2HDA A;  4AF6 A;  3M56 A;  4HIZ A;  5GAM g;  4LE9 A;  2MK5 A;  1WA7 A;  1KJW A;  3OJW A;  2JUF A;  2WSS A;  2RJD A;  3ZFJ A;  2V4D A;  2K7A A;  3M57 A;  4C0G A;  4DBR A;  2GTO A;  3H8Z A;  5DS0 A;  3EFS A;  1U1S A;  2DL3 A;  3A8M B;  2C0I A;  1RAC B;  4UC4 A;  1E63 A;  4A4F A;  2RF0 A;  1VQO A;  3HPW A;  4ROX A;  4X34 A;  2QA4 B;  4J7F A;  3PTA A;  2E65 A;  3VO2 A;  1WHK A;  1VQP T;  4FSS A;  4E7K A;  1U06 A;  1VQO Q;  4DNT B;  1H8K A;  3GPL A;  3PEN A;  3TRE A;  1I4K 1;  1OZ3 A;  4X9D A;  5IHI A;  4BD3 A;  4IKF A;  1RLQ C;  2EIX A;  1QVF P;  2KE9 A;  3PFS A;  4M78 F;  3WXM B;  2HBP A;  3RMS A;  3CP2 A;  3MEW A;  1KC8 U;  3MEA A; 
#chains in the Genus database with same CATH homology
 2DYI A;  3HTR A;  2QGG A;  2DOG A;  2F1L A;  1PM3 A;  3A1P A;  3H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...