1QUFA

X-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
ADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title X-ray structure of the ferredoxin:NADP+ reductase from the cyanobacterium Anabaena PCC 7119 at 1.8 A resolution, and crystallographic studies of NADP+ binding at 2.25 A resolution.
pubmed doi rcsb
total genus 85
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1996-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qufA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qufA02
4M0LA 1VQ8B 3W2EA 3QFCA 3E20A 1QUFA 2BM0A 1WDTA 1YJ9B 2OK7A 1VQMB 4R71A 1QGZA 3WXMA 1EFCA 3B78A 4YAUA 1Q81D 3ES9A 1AMOA 4M4SA 1CQXA 1QX4A 4LBVA 5JBQA 1G7CA 4YALA 3W5HA 1KD1D 3CCSB 3WYAA 2QTLA 4K1XA 2YWGA 1K8AD 2YWHA 1QGYA 1QFYA 4FK8A 3QFRA 2CRVA 2QDXA 2QN6A 1GAWA 2BF4A 2C77A 4QHYA 1D2EA 2PIAA 2X3UA 1W34A 2HDNB 1FNDA 4MYTA 4C43A 4PC2A 3B8HA 3ZZTA 4PC3A 1EWYA 2XNJA 4RD3A 3VO2A 1F20A 4ACBA 1FNBA 4PC6A 1VQOB 1VQ4B 3LYUA 1JB9A 5THXA 3OZUA 4HE6A 1ZM9A 4YAFA 4ZCIA 1KJZA 5EMNA 3CC4B 3W2IA 3CCJB 1OB2A 1H85A 1KK3A 3W5VA 1TTTA 2J7KA 2BM1A 4Y9RA 1GVHA 1F60A 2BPOA 3WBJA 2RC5A 3VMFA 3CD6B 1BQEA 2PMDA 4RD4A 4B4DA 1W35A 1VQKB 3G6EB 4LBYA 4HE5A 1QUEA 3ZZUA 1FRNA 3P26A 1G7SA 1EXMA 1VQ5B 2VNJA 4H9GA 1KRHA 1D1NA 1KK2A 1S0UA 4BPRA 1R5OA 1VQ9B 3FJOA 1FRQA 1EFUA 3JQPA 1Q82D 4M1KA 3AGPA 3B82A 3CCQB 1EFTA 1R5BA 1VQPB 2CNDA 2EIXA 2BGIA 3PENA 1W2BB 1TUIA 2OTLB 4J0QA 3U6BA 1OB5A 1M90D 1YITB 1M1KD 3CB4A 1Q7YD 3W2FA 5AN9A 2HMAA 1KC8D 2R6HA 1FNMA 2VYQA 4LBWA 5TV2A 1E64A 1ZM4A 3AVUA 4TMTA 2VNIA 3AVWA 1KK0A 5GV8A 2B7CA 4P3YA 4F7DA 3G4SB 3W2GA 1ELOA 1SM4A 1KK1A 1W87A 2C78A 2OTJB 1B23P 3CXCB 1ZM2A 3VNVA 3LVBA 1GO2A 1QG0A 1OGJA 5GV7A 1TVCA 3I1FA 3OJWA 1QVFB 4UAJA 1N0UA 4RD6A 3CPWB 4AF7A 3VO1A 4Q7JB 3QE2A 2BGJA 2BN4A 3CCEB 1HA3A 4RCYA 1FNCA 4G1BA 1BJKA 1CNFA 4LBZA 4B3XA 3CW2A 2PLFA 1DARA 4ACAA 1G7RA 1CNEA 4RD1A 3CRZA 1QFZA 4TMWA 4Y9UA 3WBKA 3LO8A 3OW2B 4RCZA 2GQFA 2QA4B 1N0VC 2QMUA 3CC7B 3LRXA 1IJFA 2VNHA 4IW3B 4AF6A 4EH1A 1ZM3A 4FN5A 1E63A 2DERA 3CCRB 1FDRA 2NPFA 5H59A 3MCAA 1YIJB 3CCLB 4QFMA 3ZBUA 2E1RA 1VQLB 2FX3A 4N3NA 1A8PA 1JNYA 3I56B 1J9ZA 1IJEA 1OGIA 2D74A 2EFGA 4TMVA 1E62A 2DCUA 3CMEB 1JA0A 3ZC3A 1DG1G 3QFSA 4NCNA 2XNCA 4G5GA 5H5JA 1D8TA 1U2RA 5KSWB 2BVNA 2ZITA 1GAQA 3AVTA 3U6KA 2YWEA 3OZWA 3WNCA 2B7BA 4RJLA 3P27A 3W5UA 4MYUA 4M2LA 1TLLA 3AVVA 3ZZ0A 4DQKA 5TY0A 3VNUA 4RD2A 4DQLA 2BV3A 3WY9A 1EP3B 1ZUNB 2DETA 4B47A 4B44A 4ZGNB 3OJXA 1YJNB 3FPKA 3WNBA 4B48A 1XE1A 1GR1A 1YI2B 1H42A 4G1VA 3JQQA 3AVXA 4M53A 2BMWA 1QVGB 1K73D 2XEXA 2DY1A 4ZCLA 2AHOA 5DSZA 4YHBA 5FA6A 1I7PA 4AC9A 2BSAA 1YJWB 1Q86D 1B2RA 3V76A 1QH0A 3OZVA 1VQNB 1DDIA 1SKQA 3WNDA 3J81k 1AIPA 1JA1A 4PC7A 1KTVA 1N8RD 1VQ6B 2YWFA 1UMKA 1XB2A 3E1YE 3ZBTA 2GPJA 1NDHA 3W2HA 1BX0A 1EP1B 2VZLA 1YHQB 3AGQA 4TMZA 2OK8A 3CCVB 3I55B 2QEXB 3QFTA 1VQ7B 1QFJA 3MHPA 4N3GA 1G7TA 4TN1A 1BX1A 1KQSB 1IB0A 3QSYA 3CC2B 1R5NA 4TMXA 4C0SA 3U2QA 2QTZA 3G71B 5HXBA 4PGOA 2VNKA 1GJRA 2RC6A 4WQMA 3JQRA 3CCMB 1K9MD 4PC1A 4NBSA 4P6VF 4B43A 5TR9A 1JJ2B 3CCUB 1QGAA 1DDGA 4RD0A 2B5OA 4U9UA 1EP2B 4LC0A 2DEUA 4YAOA 1NJID 1S72B 3MMPA 3SJZA 2HCJB 3AVYA 3CMAB 4ZV4A 4ZCMA 4Y7CA 4YAWA 4FWTA 4ZGQB 3A1FA
chains in the Genus database with same CATH superfamily
3WGNA 1H93A 2FVXA 4EGCB 5KHOC 2XH8A 4XYLA 2FLVA 5G02A 4ESEA 3TGPA 1T5EA 5E8JA 3WQZA 5HQJA 3O4IA 5LXTA 2VDPB 3EWIA 4JNCA 1NVVR 2R00A 3THRA 1CKEA 2P3SA 4OAOA 2Q6OA 3I53A 1C7ZA 1QGED 1EUCA 4V1CI 1C0EA 1WZCA 5J3JA 1ZH0A 1U0FA 1YJ9B 4IGEA 3T3NA 2GJAA 3GDGA 1L5YA 4NP6A 2EL7A 2OVBA 3K0BA 3H5NA 1QFMA 4Y1GA 4BV3A 4J0FA 2DBQA 1QGZA 2HDOA 3NDPA 3TPZA 2BHNA 3PF8A 1TYDE 1VF7A 3GUVA 4M8KA 4N03A 3RVQA 2WWXA 1BD4A 1JTEA 4ZI7A 4J8PA 3SFZA 5JWHA 3BXEA 3FPJA 4X7CA 1KZYC 5GP1A 2V6MA 1DX4A 1QR2A 4WCFC 4W8OA 1RJDA 2B0CA 3UTCA 3HXKA 4JLAA 3X1XA 3IEPA 1Z6XA 4UVIA 3RV4A 5EXEA 1GLVA 1CQXA 2RGGA 4KVZA 5HW0A 2YQZA 1OX4B 1YCHA 1RWXA 5TRTA 5KHLB 5L46A 1VKZA 4V0SA 4OB6A 2VP6A 3HB1A 2EBFX 3H0EA 5KJ1A 2CEAA 3OPYA 3ZWNA 3U7QB 1ECBA 3SKBA 2QTLA 3A4YA 1OYOA 2K2WA 4K1XA 2Z8ZA 1D2MA 3HUTA 2QVGA 1O7JA 2NTNA 1RQ7A 2YWGA 2EEZA 2XWJI 3HS3A 3QIAA 4HDMA 4M7RA 2TYSB 4NZPA 3UJHA 4BMXA 1DKOA 4NECA 1GGJA 3IULA 3KQYA 1P2BA 4TLEA 3PPXA 3LFTA 3L6OO 5FPSA 4B33A 2XUGA 4YGYA 3R7FA 3D7MA 3PNSA 4KDEA 5FNVA 5LCXA 1GSIA 2HIGA 4LYFA 4DF3A 4E14A 5L9AA 4RTLA 2XNDD 1ZHOA 1Z63A 4YMTA 1R9NA 2EGHA 3NEAA 5DGHA 1UMDB 4M38A 5L7TA 4H7DA 1AA6A 1QXSA 3CH6A 2XRZA 4NZNA 5K1ZA 1TAQA 4Y1RA 4H27A 3LBNA 4IQ8A 2WIGA 4NBRA 4AJLA 1R9GA 3MWYW 3CLRC 3SHWA 1G66A 4ISBA 1BGWA 5EEGA 5LLSA 1L7XA 1SHJA 2I0FA 3LQQA 1IJKA 1P5RA 3DBLB 5JOQA 1X0XA 1DAFA 3KSZO 1YVUA 3IQWA 4UUMA 2ZWOA 4HGRA 1KMNA 1ONSA 2EFYA 2O8EB 2IYTA 3KU1A 3TNFA 3NIFB 5LIPA 1KVSA 4MUYA 3AF6A 1G63A 1M2OB 1QOPB 1PHPA 1E1MA 4LZNA 4FS8A 3P9IA 3U4QB 5LLTA 5KPDA 2WWVD 5DBFA 1M67A 4IYRA 1QC5A 3KQWA 1RVV1 1J33A 1SQ6A 2IHBA 3EF0A 4ZEWA 2Z30A 1MJGA 3IPYA 1YRBA 3GU3A 5LOVB 2HA5A 2J0SA 4PC6A 3IO5A 4EA9A 1OI2A 4Y6SA 5AJTA 4CL3A 1ZNYA 4MS4B 2AC2A 2BKUA 3X1DA 4BFVA 3UGJA 4MPJA 4BX0A 2VDNB 4NDAA 2J85A 4C0WA 5B6JA 5KTMA 3ZH2A 1ZVJA 1ZI8A 4D9HA 1NTOA 1XFDA 5EMNA 2UZ1B 3K9NA 4FX2A 3WHLA 1LPNA 4BCDA 5I7UA 1F8XA 4L5JA 1BMQA 2AI3A 2YW9A 4EFLA 1GQ2A 4ZT7A 4F4JA 1WY7A 2QTCA 4RULA 2KSQA 2B69A 3GRFA 1B6SA 2YIDA 1NVBA 4E2XA 1ZGJA 1GPKA 2AFVA 2H2IA 2X4LA 3ZVNA 4ARZA 3KL9A 3Q7PA 3DLPX 1MX1A 4Q00A 2J3IA 4FGLA 4BPBA 4BMCA 1AQIA 4OLAA 5GZ3A 4RKWA 1U31A 3JQEA 2OENG 1TA9A 3CLTD 1N05A 1YQQA 4KACA 4ZVQA 3UMRA 2OHVA 2V9CA 2O8VA 4PPGA 3WKBA 2GVZC 4QVKA 4R8VA 5C3UA 5CCDA 1LBSA 1I1HA 3BB1A 1VE9A 5BVGB 1HDYA 2JF0A 1KQ3A 3PQ4A 4WCVA 4ZT2A 5COQA 3IAS1 3HDTA 4WZTA 3OIGA 3A6FA 4YRAA 4WXRA 4O3FA 1TM1E 3N86A 1VQ5B 1VA5A 3LGSA 4G4IA 5AM2A 2VUIB 5E1MA 5GADl 1S0UA 5K09A 4EFDA 3RTCA 1R8XA 3VU3A 2MSEB 2PZEA 2P2NA 4FJ2A 3TI9A 1XJQA 1GCGA 2ZS8A 2VDWB 3FZGA 3IQHX 4JFRA 4P7GA 4EYGA 1YQUA 3GXBA 4TT8A 1KOGA 5JLJA 2JW5A 2HLDA 4F5EA 3Q38A 4HR7A 4A8HA 3RHTA 3X2SA 5EJMA 5ENZA 1V26A 2FW9A 4B73A 1Z5GA 4PYIA 3OLVA 3ELYA 1ETHA 1XEXB 3K2IA 2WTNA 4DR5B 2ZJ0A 5BUQA 1DC8A 3PENA 1V47A 4ZODA 1X9HA 2N1MA 1C3OA 1E59A 2YHIA 1E4OA 2QP9X 5JPDA 1SCDA 5FBLB 4C0QC 4J1TC 2NO1A 2VSQA 1A98A 1ZZEA 4CYMA 1SG6A 3BXXA 3I1IA 1Q0ZA 1MN6A 3O8LA 1K9VF 3EAFA 1KEWA 4XM3A 5E1DA 2QZZA 5LBTA 2DM6A 3UUWA 1Q7YD 1IXKA 4ND4A 5TRDA 4LN1A 4S2EA 5EZ5A 2GWRA 1F0YA 3REFA 4BMOB 2F8MA 2B8EA 1T0IA 3H18A 2PKQO 5ITZA 1TMYA 3DBRB 3ZR4B 5LQKA 5LMUB 4GEGA 4LBWA 3OZFA 2GK4A 1PJRA 4RZ3A 3STXA 3VKUA 1RLOA 3C48A 3JQFC 3D3WA 1BN7A 4O25A 2ZIWB 2OYSA 2ZSHA 4WBSA 3I0NA 1KETA 4DY6A 1DPFA 2IU6A 3U5TA 2G3YA 5HG0A 1TC1A 5BURA 3MCUA 4E3ZA 3PNQA 4TMYA 4O2RA 4CL8A 2I99A 2YW2A 4II3A 1M1ZA 1Z2DA 4KYUA 2Z4SA 4MQEB 4PAQA 3SFTA 6YASA 2DSTA 3WIDA 4PBRA 3IJPA 4FI3C 1KU6A 4MWGA 2NXJA 2V3CC 1H8EA 4Z8YA 3V8NA 2EXXA 1ELOA 1KMHA 4JXJA 1ADGA 1ZK1A 4PIMA 3WC4A 3WIUA 3ZCVA 3RM3A 1FQWA 3AIKA 3HL4A 1GDTA 3MJFA 4H7FA 4X64B 3IXQA 2J7PA 1EK0A 5KNDA 5B3JC 4D4GA 4X66B 3RAJA 4QEZA 3LLVA 4EO9A 2ZIXB 3KSMA 3OKXA 1H1LB 3Q3VA 4RTSA 1F8YA 3BTUA 2KVOA 4YBZA 2VKTA 2BDTA 4IIJB 4MGZR 1WPGA 3H97A 5KYUA 3SZRA 3T38A 5J2TB 1MOZA 1POWA 16PKA 2EBHX 1E7YA 2FMFA 3G2PA 4B3MB 5IYPA 1AKWA 5E9JA 1NBMD 2FEKA 4X8MA 4NOJA 1JFTA 1H9AA 1GKLA 1UWKA 2JVIA 3VPHA 1RPAA 3ER8A 2WABA 4AF7A 4BLOA 2QM3A 4MMZB 3IV7A 2E87A 1EINA 3P9YA 2QP3A 5FRDA 4MVJI 4U7JA 3WYEA 1DEAA 3T9EA 1E89A 2MSDB 1SURA 2I6SA 2E6UX 2WU0A 3IAM1 4C4SA 2XCOA 2P0AA 1I10A 5ICMA 1PFWA 5IBQA 3ZD7A 2FCAA 3T34A 3G3EA 1L5HA 3JAKA 3HYRA 3HFRA 1W19A 2OHIA 2YIVX 3BGIA 3EZ2A 4M7OA 4TROA 3JTEA 1HFKA 3DV0A 1DV2A 1DKLA 2PU7A 2V74B 4B3XA 1CTQA 2WE7A 1GZDA 3WLOA 2R0QC 4HWTA 1DARA 4GBED 2Z6BD 2PX0A 2B8NA 4L5CA 5DK6A 4M0MA 1Z38A 5BR1A 2YZNA 1IZ0A 5FBWB 4K0RA 1M8JA 4X7FA 1VDMA 3DG9A 2LXNA 2P5SA 3DTVA 3EARA 3ESDA 1IQRA 2FF7A 2GA9A 4UNPA 2Y66A 1D2GA 3TLKA 1JEQA 3WDLA 5DI3A 2HXSA 1HLGA 2XY4A 5TX7A 3HVIA 4OGWA 4PPNA 4BATA 3X1JA 2VWHA 1T1EA 2WAXA 4L4YA 2JANA 4RCZA 3I73A 3HYNA 4MR9A 1K88A 5JNTA 3PFHA 4F9TA 1UQUA 3GLKA 5FWYA 1K1EA 3A9SA 1U6IA 3KXKA 1JKFA 4MA0A 1PJLA 4G5QA 4MICA 5HCIA 3VJLA 1JLMA 1V8ZA 5AM4A 3TB4A 3SQXA 3LBIA 1QF9A 2H1FA 2NV2B 4AF6A 2ZU0C 1NHWA 3NBKA 3VUFA 2ORIA 1P4HA 4MO2A 3HVJA 4XSHA 3BBLA 1DXOA 3W9YA 1JXOA 1JFFA 4R83A 2CVQA 4P0TA 3ZXXA 4O2AF 1ZINA 1Y6GA 5A5DA 1MR3F 2MSCB 3H4TA 3QU7A 1G18A 1XNQB 4FE3A 4YV1A 2E3JA 1VQLB 1OLOA 4UNSA 1E7WA 4PG5A 4M8LA 4BWGA 1KJIA 2WUEA 4AG3A 1OGIA 2C42A 4EHDA 1A9XB 4V39A 5GONA 2VHQA 2X14A 4KXVA 3Q8MA 2I29A 2ODNA 5ESDA 1C2YA 3CZ9A 4Q93A 2OCKA 2PD3A 5EIAA 3SC6A 4NCNA 2XE4A 1TLTA 2V31A 1JAXA 1IN1A 1JSXA 3WJ2A 4JB3A 4PHGA 5BSKA 3KQNA 1KGDA 3B3AA 2CCJA 1KDPA 4XX1A 1HDRA 3RRXA 5DO9A 3NHMA 4NV1A 1F8FA 8ATCA 3V1TC 4Y9DA 3H5AA 1B6GA 4UXIA 3IKJA 4X9XA 1HTWA 4BNWA 3A70A 5FR1A 1CDOA 4BDTA 3L1JA 4RFSA 3DO5A 4BP9A 5EOVA 2QJFA 2QV0A 3OA2A 2XQFA 4YJHB 4F96A 3RUCA 2FQWA 3M5WA 4ARBA 2PKXA 1FUIA 4QWMA 2V58A 5KNBD 3EUWA 3VI3B 3I52A 1VGRA 3C8MA 1ULBA 4FC6A 4HDSB 3NM4A 4CIDA 1WXIA 2VJLA 3HLTA 5BN4B 1E7RA 4AMGA 2DP4E 1BVRA 1VL1A 2D1QA 1EIWA 3DULA 1I3NA 3P2JA 2VCEA 3WY9A 2KJQA 2G88A 4E2FA 5L53A 4XUDA 1AZWA 4TLAA 1ZUNB 3RF7A 4BXOA 3DMYA 4B47A 1HV8A 2XOKA 5JTUA 1JR3D 4HDNA 3PE4A 2YNMA 1KSGA 1Y8CA 4GE3A 5IDWA 2ORED 2OP0A 3WL7A 1FTGA 3T41A 2AMFA 2AQIA 5LQJA 3IILA 4G1VA 4S2UA 1A4RA 2ZFUA 2EVWX 3T1OA 3SR4A 1ZGAA 3LZ6A 4QDXA 4LVOA 4PHCA 1WDWB 4WV3A 4ETIA 4WH0A 4J0HA 2MSWA 1BEZA 3QOFA 4PLVA 1JMYA 1TFUA 3CT6A 5D5QA 4YCAA 2AKEA 3V4SA 1SIUA 2ZJZA 1H4VB 1YQ9A 4PO9A 2DR2A 5IH3A 2GVDC 3THWB 3MT8A 3DCIA 2PMBA 3O0DA 2JIPA 1UXKA 3ESRA 1GTZA 2ZRPA 3F78A 3VR4A 5DSZA 1I33A 1F6WA 5DNVA 1E79D 3GLSA 4JJKA 2K6GA 4N5LA 3I9KA 3V1KA 3DBHB 4X7BA 4BKPA 1QQTA 4JXZA 4Q7KA 1MUUA 2FCRA 3EZ9A 1IUKA 3NEJA 2CVOA 4MW7A 2IIVA 4KXYA 3A8IA 4YAEA 3GFFA 3OU7A 5KDDA 4HUJA 3UT6A 1AKEA 1PVVA 2QAGC 1JA1A 2UVDA 2HQRA 5B36A 1N8RD 3TTVA 3GRKA 1L5GB 3ZIAD 1WHSB 2H65A 2VBCA 1USUA 3KKEA 2OV8A 1IDN1 3HBJA 1UPFA 1T8TA 2WSSD 5F4BA 3BXZA 3UMGA 4YUYA 1I0IA 1VZ3A 5FFMA 1DAGA 2JI8A 4C4YA 2I6XA 3AG5A 4FHEA 1E3EA 3O9ZA 3H9CA 4ZEVA 1DWOA 1YB5A 1NVAA 2Y76A 2IVFA 3JZDA 3KTDA 1OLUB 1W96A 1XMOB 3LI2A 5IZCC 3H6KA 2R85A 3MINA 1DQZA 3O83A 2NIPA 1GNVA 1R15A 2W6CX 4KMSA 2R84A 2WY2D 4YDQA 3L8HA 1QFJA 4EA6A 2UXCB 3GC6A 2TECE 1U3UA 2IBMA 1KMIY 3OX2A 2VDVE 2ZR9A 4NZOA 1H0KA 4Q15A 4P1VA 4RDCA 4G6IA 4C4ZA 5K8IA 2RBEA 3IB6A 2NU9A 4IRXA 3RFFA 3KSAC 2FF5A 3AY7A 1AF4A 2V4MA 4QX6A 3IIEA 3JZIA 1KKLA 3TDMA 2ZZKA 3RC9A 2M6RA 1UC8A 3RUPA 5HP4A 2XB2A 2HSWA 2GRAA 1WXWA 2PRYA 3R5JA 7ABPA 2YQ4A 9LDTA 4GXRA 1LTKA 1XZCA 1Q17A 4NAUA 3ZHXA 4BC1A 1JDSA 1T5DX 2W2LD 3NAGA 5LKRA 4HXEB 3JARA 1Z9BA 4G25A 1L5LA 1M5TA 3EF1A 4YRGA 1EK2A 1ZD8A 3DCNA 2PUFA 1ZICA 2GERA 2IY7A 4JC4A 3P2YA 1GL7A 1KP2A 3HKEA 2HZBA 2JH9A 1JKMA 2YOHA 4O4JB 4WOBA 3ZV6A 1P1FA 1QGAA 2JGJA 1Z15A 2VXOA 3F3MA 4JP1A 5DXFA 4D4LA 2QBYB 2PUWA 3CGGA 3T9AA 2B5OA 1RYBA 3LC2O 4EG3A 4ML3A 3UV7A 4H3VA 2VPYA 5EZ6B 4L15A 2ZZQA 2W98A 2W9XA 1LQUA 1TJYA 2XJ4A 4HDOB 4HQOA 3PJRA 4Y2PA 4YJ2B 4IGIA 3SQLA 5BSEA 4IHKA 4BO0A 5C7IO 4DQDA 3EE6A 2BGGA 3D3EA 3L6UA 3HCDA 2PUEA 1RW4A 2PXHA 2BH2A 4ZV4A 3DZ8A 4ZTBA 5MDHA 3ZGVA 1JAZA 5JY6A 2VH1A 4OCZA 5CA0A 3FJYA 3H86A 5IJ0A 3SEQA 3K31A 1NF3A 2YBDA 1OIVA 1BHO1 3QEKA 3FR8A 3ZWQA 5KQGA 4AY3A 2R1VB 4G5XA 2J6BA 3DO6A 2QG6A 1FLDA 2C4KA 3KB8A 3BRWD 3MTIA 2HFJA 3BKXA 5E6UB 1CIPA 3U09A 1NQAO 4AMVA 3NKFA 3BKWA 3JU3A 1BYUA 3Q7QA 1V96A 1CQIB 3CPEA 3AEUA 2I76A 1T91A 3LDHA 3TW4A 5DN6D 1T3HA 1AS0A 4X7DA 1IK6A 2BMFA 3OQPA 1R4MB 5JPIA 1H2HA 1KMMA 1KY3A 1LI5A 1J7KA 1T2UA 2B36A 2MHCA 1TEZA 1T1JA 2H29A 1EVEA 1R3UA 3UT5A 13PKA 3OKCA 1WORA 1NFFA 2A94A 3TAUA 4ZHQB 1E3ZA 4E5NA 4RVNA 3EEFA 1CJUC 4MJ7A 4BFXA 4C87A 4F06A 1NVFA 2J9FA 2GQ0A 2NOAA 1NN1A 1VTKA 4CCYA 4BNDA 3T5PA 3AH8A 3EGXB 3K1ZA 4RDIA 3L5KA 3HFSA 5KYWA 4KRGA 1ULAA 1Q20A 2GX6A 1PO7A 4EHKA 4ENUA 3EXAA 4MYCA 2FJ0A 1ZFNA 2K2QB 3EXHB 3ZDFA 1DZIA 3HO8A 1RBMA 1PTJA 2VRCA 7REQB 1KYTA 4FEEA 5EZYB 4M37A 3ZOZA 4EL0A 2X3FA 3LHFA 1WSBA 2AFHB 3OICA 3NBUA 1QDUA 1VIMA 4CI0B 2XHEA 4HEA6 1ZWLA 3G2LA 2IIQA 4LX8A 5ADUS 4PLPA 4FT4A 4YI3A 2EFJA 2EFHB 2VBFA 2R8YA 4LG1A 3TTXA 5AW7A 4E5PA 1YJCA 3FUTA 5JZVA 4L0DA 1YUMA 2OBTA 2B25A 1TM7E 3NOOA 4EBFA 1TL7C 1I2DA 4UMDA 3F8WA 5LUBA 4ND6A 2O8FB 3AB3A 4B82A 1RWBA 4BQSA 3C5CA 4C01A 3KHSA 2QDXA 4XYGA 1GAWA 4JKYA 3RFCA 3LK7A 4URVR 3OZEA 5CDGA 4MDFA 2GD6A 1ZO8A 4MKHA 2AZTA 1P7ZA 4OYYA 3GLHA 5A1JA 4QHYA 1ADCA 3AJEA 1GZ3A 1CDDA 3NDRA 1NMEA 2ONZA 3OIVA 1P1JA 4JUDX 3U7HB 3ZHSA 3F7NA 5K3FA 3K7EA 1D2EA 2YCLA 5HZMA 1SOWA 2H59A 1I4DD 2C3OA 3A6ZA 1AKMA 1YS7A 3QGMA 4IINA 1BS9A 5FUWA 2IEIA 2CWDA 3U44A 1WO8A 2FVGA 1T9HA 3AXSA 3EFEA 3C0KA 3IP9A 3BICA 3OETA 4LDQA 5AM3A 5JRJA 5KVAA 4REQA 1ZRMA 1OYVA 1XTUA 1C80A 3HYLA 3PSAA 2HPHA 1RP1A 1X1DA 2I5PO 2XNJA 4IMIB 4MWSA 3DDWA 1GTRA 4LOLA 3VO2A 3DHVA 2FZKA 5CM8B 1VPVA 2DT5A 3R5KA 3ESBA 2WHRA 1K4MA 3MOGA 4CM6A 3A3OA 1DEHA 4DLPA 1NF9A 2QMYA 1G5PA 3C5WP 3DXYA 4S1PA 3JYOA 1NIPA 2Q50A 3JZMA 1H1TA 3MB8A 4L74A 3A6EA 3L49A 3FPAA 4QU9A 2A9JA 4UHJA 1XZIA 3OJCA 2B78A 1TO6A 2NZJA 3LYUA 4R84A 3BXHA 4XI9A 3PPVA 2CLHB 4B2LA 1E2KA 2WIJA 5THXA 3NM5A 1Y1TA 2A9QA 1WUJS 2QQEA 4X5OA 5H0IA 3NAMA 3RAEC 3HXOA 1G8AA 3HU2A 2Q4RA 3CLTC 5IYZF 2WG0A 5K4AA 1XI2A 4KJXA 3AFIA 1IXYA 1AQJA 1RYNA 4MB6A 3TAHA 1QYVA 3DD5A 1NOIA 4DLZA 3VAZA 5BSWA 2XB8A 3S27A 4DREA 1X9GA 2Q5FA 1C9EA 1XLUA 3WWOA 1ZW1A 4LGMA 3PLAE 5ALLA 2H2FA 2V5VA 4XYEA 3M4NA 4G0YA 3V9AA 4KO4S 1ZEMA 2XTAA 4JNKA 4E5VA 1R10A 1PLLA 1BQEA 3E9CA 3H9JA 4UHEA 1ZSVA 3VISA 5D87A 1MG5A 5IXSA 3G6EB 3HJNA 4FDUA 4O2BB 2Q6KA 4UDOA 4G56A 3Q3GE 3K9BA 1L7VC 3F3YA 5AHXA 3GPIA 3B5JA 3S1LA 4O4IF 3ZPXA 4RQBA 2OLJA 4X91A 2IWHA 2BZ1A 4B3SB 2OPHA 4DARA 5E8RA 3LDGA 1OW3B 3GHYA 4WAUA 2GD2A 1QDLB 3GK3A 4HPXB 3TJZA 4YV7A 4JLSA 5HIAA 3DSRA 4NLLA 2GLUA 4FD2A 1BVYF 2O0KA 1PJ7A 1O4WA 3KKOA 3PNVA 2I6GA 1ZC3A 4YHHB 2KHZA 2I7TA 4HGPA 4WD3A 4GQIA 3G7SA 5IEJA 4MVJH 1ZWKA 4OHMA 5A3QA 1CY0A 4XOTA 1WB9A 1Y3CE 1C7QA 1ECPA 3G59A 4PGMA 2SKCA 4YRCA 2GLTA 1FXSA 2G0AA 2HF7A 1OOEA 1P75A 3ZCSA 4CQMD 1YJBA 3QUBA 1I6WA 1UZMA 3RWBA 4E09A 2HSJA 1KO7A 2B35A 3FH0A 3GEPA 4ZALA 1FP4B 2Y1CA 2PL3A 3OIDA 2M6LA 3UWMA 3Q12A 4TLBA 4YT8A 2P6MA 4JK3A 3ZYZA 3PXUA 3ZJTA 3V2HA 4MAFA 3WSVA 2R66A 2ZRHA 3TTTA 1HYGA 3AFMA 4RQAA 1AHHA 4IJKA 2LKDA 3K71B 1U2SA 1Z7YA 4F3KA 3QEMA 2WJHA 3GLTA 4A1FA 4QBHA 4BNYA 5K05A 4FIZA 4Z4TA 4IXNA 4OYRA 1YK1A 2J0QA 4S35A 2HMAA 4UVDA 4F3RA 1YQTA 3LF1A 1AQ6A 2H1IA 4CM8B 1ONBA 2QAIA 3I6MA 4WFJA 2VSFA 3W3AA 4IJ6A 1GUFA 2C7PA 4MUEA 1YKSA 3FNIA 1T1IA 4AYXA 3IT1A 3W77A 3I6QA 2VL7A 4KK4A 1W2WB 4M1YA 4N49A 5A4DA 4I4TB 2X5NA 1W48A 1XXLA 2WLSA 4KK3A 4WNCA 3KTAA 5A0TA 5B57C 1HE5A 1HC7A 2XZPA 1Q1NA 1E60A 3CN9A 3EHEA 2AGVA 2Y99A 3RS9A 3SEJA 1K89A 4M7PA 4F7DA 3QSGA 1E2GA 2JBAB 3BHMA 4FXPA 3GWZA 1PFYA 4RTKA 1RWNA 3PITA 1FQOA 3PC2A 2BGRA 4BNHA 1F0KA 3GBSA 3K4PA 4X05A 3ZVKA 4O08A 2XBMA 5THKA 4GL2A 2OR3A 1E1LA 3NATA 2AEJA 4KGXA 5JZBA 3ZV4A 1YDMA 5DYNA 2A1TS 4L16A 1ZU4A 1HK7A 2JKYA 1KGSA 2OAQ1 2XW6A 4B3CA 1RVDA 1A8HA 1YGPA 4W6ZA 3AG6A 3S2YA 1BX3A 3LV8A 3RK0A 3A4VA 3ZU3A 3UICA 5IHPA 1XXHB 3JZAA 4EFMA 4B6PA 1RHRA 2O4CA 1YRYE 1B6RA 2HPVA 1G8JA 1P0MA 2YN2A 3GZ4A 4H17A 4OHRA 3F6YA 1YDWA 3QBEA 3FKSA 1YCGA 1N0IA 3AM3A 4LSWA 4QXAA 1L7AA 3DYVA 3HCOA 5LFAA 3Q11A 1K4YA 4W5WA 3M34A 5EPEA 1GL3A 4XUEA 2WA1A 1DRWA 1PN3A 3OUZA 2IJGX 2GK7A 1HA3A 2SKEA 3OQIB 1ZA1A 4W5HA 4AT1A 3NJ8A 2L82A 1MC4A 1YC2A 2OD7A 3ODGA 4GHWA 4PZYA 1QK4A 2AOVA 3NT4A 3R6GA 5CPFA 3VOTA 2VP0A 3FXAA 4L73A 3QUSA 5BNZA 2PLFA 1SEVA 1UJ5A 4LF6B 1Z0JA 2J9ZB 3K72B 5LR6A 1CG6A 4PV7A 4P4LA 2I78A 4YFVA 3M82A 3GY0A 4QUBA 1WETA 2O2HA 3A26A 3GPCA 4DLNA 3CSDA 1DUIA 4X8LA 1YA8A 2X1VA 4Z9XA 1Z0SA 3K9WA 4MVJF 3WBKA 5CHYA 1U2ZA 2LCQA 4BO9A 2OB2A 2FW8A 2WINI 1L0BA 2GJ4A 4I8XA 1QLJA 1SQ0A 1FL9A 1TCVA 2VQ6A 2WJYA 2VDKB 1M6YA 1MABA 3KD2A 5ECWA 3GVLA 1EUYA 1T15A 1SKBA 5FPYA 3SBXA 1IJFA 4GMXA 3EEBA 3GCXA 4B31A 2BBWA 3P52A 3WK4A 1C7IA 2HRZA 4N7BA 2P2GA 2Q21A 1NRKA 2D62A 3WHIA 3ZCQA 3G17A 4HLUA 1JKIA 2H00A 3F97A 5ARCA 1R27A 4XLEA 1UXGA 3AXTA 1D07A 1VJSA 1FDRA 1OWPA 3M70A 3S81A 4Q82A 2X0JA 3U13A 3ZDQA 1CT9A 1JDBB 2BEWA 5T3UA 3DLCA 3MCAA 5HKKA 1SELA 1RTKA 1H0HA 3CCLB 1H3FA 4HWRA 5CG1A 5IKXA 1F7UA 3ZBUA 3P9XA 3BNWA 4N9WA 1C3EA 2DE0X 1QPBA 4RWEA 3VC2A 2FY8A 1P2UA 2AWNA 3RS5A 4OF4A 1V1RB 1SHLA 2O57A 2ZYVX 1V45E 1E62A 1LPSA 3TNJA 4CKXA 3CMEB 1QHGA 3AJRA 4XYMA 1IPHA 1ABFA 2E18A 4IDOA 5GINE 3CUYA 2X5OA 3U5ZB 4FKMA 2XUPA 4LHYA 4RE6A 5BT9A 1Q2XA 3CF6R 5IWCA 4N76A 5I9IA 4QU0A 3JQAB 4JSRA 5DMHA 1P4AA 3T5BA 3WIOA 1MOSA 5C8VA 3IODA 4RXTA 2H8GA 1CUAA 1KQGA 1WBDA 5FUXA 3RUFA 3VZDA 4JP3A 3LA6A 1AHPA 1ORTA 2YRFA 3TQFA 3TKYA 3U4DA 4ALMA 4ETNA 5A4MS 2W11A 1FC0A 4TWRA 2OM2A 3BA6A 3KG2A 5EKXA 4Z0PA 3U26A 4RDJA 5B58C 2C2ZA 1VJ1A 1DLJA 2XMSA 4ZPXA 5K0CA 3C4QA 4COOA 1YMQA 5CYOA 4Z53A 1G8PA 2PZJA 4UCFA 1CR0A 5DHSA 3CVVA 1L4KA 3G5MA 3Q7TA 2PYZA 4MYRA 4HEHA 4JSYA 1UD4A 3PUKA 2H18A 1Y0BA 2DG2A 2J87A 2Q6LA 4XJXA 1E2IA 2GHRA 4CZ2A 3SF0A 5B12A 3T7KA 1BZYA 2FWMX 2QUBA 2QT1A 3Q2OA 1DBPA 1VMEA 1UINA 3PJGA 3G79A 1ZIDA 2R48A 4HO1X 2Y0PA 3JR7A 3Q3JB 2C5HA 3COZA 5HK9A 5LUAA 4U2BA 1FFWA 3U1TA 4C2BA 2QTWB 1ILEA 1Z5WA 1O94A 1QTRA 2PQ6A 4M53A 2YXDA 3DW1X 4CV1A 4XORA 3LLUA 1A72A 2IY8A 1JE0A 2PR2A 2ZSFA 4EMTA 5C8DA 1K0FA 4FE4A 3EN0A 3WISA 3P19A 4PLFA 3NHJA 1C9NA 2F8TA 4FOOA 4JEUA 2IYEA 1JXMA 4NQRA 2VSOA 2AD1A 2IHVA 4OOEA 1NI4B 2ZI9A 5C9ZA 3BH7A 5IXYA 4ITRC 4ZTUB 1SPBS 5FA6A 3BZWA 4Y98A 4TS9A 2Y1LA 2Q46A 4Q3BA 3TINA 2TSYB 4N0PA 4PPQA 1ZN9A 2DCMA 2XCIA 4GSLA 4Z5XA 4PG7A 2PJRA 3RIXA 4UEJA 2WHEA 3WNDA 3N39C 3A9CA 2R65A 4EMUA 3WJ1A 5IRCD 3AUAA 3WGQA 1A5BB 4DGSA 1UBJS 5GM2A 3NHBA 1IM5A 1YR6A 4FLEA 5GONF 4XKJA 1Q0UA 2ZQ5A 3G0OA 2FE1A 3E5HA 3RG8A 4ABTA 3P32A 4HDSA 3CPSA 4CFZA 4K46A 1RYDA 3QKUA 3FUCA 4O29A 2XSZA 4RHCA 4RNCA 3E7PA 5IBPA 5U4XA 1XJWA 5BN4A 4KQ6A 4WUTA 1OKKD 2VXYA 5FWXA 5ECGC 1RMTA 3KZOA 4D5EA 3Q8XB 5L6MB 3MJ4A 2QZ9A 5CX1B 5C8ZA 4GPZA 1NN3A 2CHEA 1YCDA 1ZUNA 2ZJ5A 5H82A 2E4UA 1PJ3A 1QU2A 3T1VA 2A86A 3K96A 2P1DA 3NEYA 1V41E 2VUTA 3BCSA 2RAUA 2VT3A 1RZVA 3Q15C 3N0TA 2GXQA 3IOEA 5TARA 3D81A 2CVHA 1F9AA 1Q0LA 1P0FA 4U39A 3PBKA 4LOAA 3SKYA 5DNCA 1UP7A 9LDBA 1FTNA 1GQRA 1MEOA 3GZNA 4D3YA 4DJ5X 5JC1A 1AV7A 3W5JA 3KLOA 3TVDA 4YMGA 3THWA 4ARSA 3MM4A 2C7OA 1SC9A 3EGVA 2DTDA 4OBXA 4DZRA 3CCMB 3RV3A 2DECA 3DLBA 1JSLA 4NBSA 1F12A 1YDGA 3UMCA 4MQUA 3DOIA 3DVLA 1DTWB 4R3NA 3FOEC 1YZUA 4G63A 1JECA 3WP1B 2F7SA 1XYVA 3BIXA 2PVSA 4M54A 1A3CA 1Z5UA 2FW1A 5AW9A 4CTNA 5JMOA 2I2XB 2XGJA 2PRSA 3CONA 3L1HA 4KO2S 3OMLA 3PUWA 3S4YA 2EGUA 2GKSA 2FTKE 2EQBA 3AP3A 1S8FA 1FZQA 1OLSA 3LY9A 4XIFA 3C8DA 1QMGA 1LVUA 4XZ3A 3RJ9A 1R0RE 1HDZA 1VE1A 1XGKA 4IZOA 1UXOA 4MUNA 4XGQA 2JFWA 4GLLA 1BDMA 2W6IA 3D9QX 1TCCA 4R41A 1KDVA 3FF4A 5JAPA 3BK1A 4LOIA 1OH8A 4HFMA 4Y1FA 2WJ6A 1LNQA 2W2QA 4TSRA 4PG4A 2NQ2C 4MINA 5K3DA 1RWVA 3QYPA 4MGKR 1P9WA 1UKYA 4E33A 2CBXA 1FNSA 5IM5A 1SHZA 3QFHA 4NARA 4YQYA 5GIPE 1XRRA 4DYVA 1W9MA 1POXA 1LK0A 1MQSA 1EH5A 1ZD3A 2HMYB 3C1AA 3OF3A 4PAWA 3A31A 4X90A 4YTEA 4HN9A 4WLVA 4JGBA 1PWXA 5C4GB 2IP2A 3G8YA 4V24A 3QXXA 5TJ9A 3RAGA 2OBSA 5E6SB 1A4XA 3V1UA 3OLZA 4F4FA 1E9FA 1NXQA 1VKRA 3QELB 3A05A 3P4UA 5KW9A 1AS3A 3OJOA 4MA5A 2ZBRA 4AUKA 5AKKA 3ZDZB 1WPCA 3A9RA 4ONEA 2XXBA 3JQ9C 2JFUA 3L8FA 1BE1A 3T0IA 3D2LA 3FUUA 5DBEX 2ERYA 3DOHA 2P3OA 3IUJA 3V1YA 4B3FX 3FR7A 2WJIA 3E27A 3ODPA 3H13A 3RVOA 2IY9A 1G20E 1QBKC 2HH9A 3NHRA 2IIPA 2PE5A 2WUGA 1BDHA 2PSFA 2H9YA 1T3ZA 4FYWA 2DRIA 4FZ3A 1D04A 3UXMA 3A06A 4MUBA 2FOIA 2C9MA 3AESB 1YRAA 3HCNA 3DFIA 3TLXA 3QU4A 1R18A 6LDHA 3DF7A 3IMEA 4G1MB 1DO2A 4R68A 1U1IA 4F5YA 2ZULA 3GR6A 3RH0A 4YP9A 3SXJA 2HA4A 2NO7A 4LQCA 3MK31 4BRUA 1PR1A 2IYAA 1J8QA 2Q8PA 2R8PA 1RJ9A 4HBZA 1WKBA 1D0IA 3KR0A 4JMLA 2C4NA 4LHWA 4D9NA 1FSZA 1W47A 1HDXA 1E3LA 1L6IA 1TQ4A 2GILA 3OCJA 4MUGA 2GOYA 4ZVLA 2QVLA 4U7FA 2MCFA 3NC1C 2FP4A 4DLSA 3K09A 2F3TA 3V00A 4X1YA 5I7HA 4KXNA 2J3LA 1W5AA 2Q2QA 2RIPA 3ABRB 3KVNA 3Q85A 4HAYA 4C3OB 3D6MA 4BJ3A 2JIBA 1QP7A 1EFPA 1DRVA 1VL5A 3PQCA 2XYRA 4QM6A 4LCJA 3FOFC 1W0JD 3PL5A 4EPWA 3HU3A 3KJEA 4IR7A 3A3NA 5EIEA 3IKTA 2WKPA 3G7UA 3B7WA 5ALMA 3WNVA 4U2CA 4YB8A 4S05A 1GSOA 3RSSA 3WGJA 3RTBA 4XN3A 4I50B 1SKAA 3ADOA 1MTOA 2RHGB 4JLBA 4MI9A 2B7LA 3SLRA 5CTAA 1ZNZA 3TLYA 1PD0A 1Z17A 4DAEA 4KKXB 5DOVA 2CLKB 1T3LA 3BD6A 4S0ZA 2TMDA 4XX0B 3L0ZA 2VQ3A 2HMSA 4XJVA 4EHAA 3EGXA 5H9WA 5KYGA 1IEWA 5CDHA 1RPNA 5AKYA 2IHTA 2FMHA 2JFHA 2Y77A 3GT7A 4JS0A 3EXHA 4KR9A 9MHTA 1BMFA 1QO0A 2GEBA 2QN3A 3WNQA 1P8JA 3R9XB 3CZ5A 4NABA 3IMGA 3PRKE 2GF2A 7REQA 2C3YA 4JYPA 1A9QA 1LLFA 2XD4A 3CLSC 4PAOA 3VHXB 3V9PA 3ROPA 2AFHA 2NTEA 3U3XA 3EPLA 3GIWA 4OGGA 4C6SA 1VGQA 1SZCA 1WJGA 1ZJ5A 2CYBA 2PS0A 2VUUA 3H5WA 4IOJA 4EP1A 3PTZA 1P18A 3LUCA 4EUFA 1DAPA 1JQEA 2OO5C 2Q3LA 4FLFA 4JOCA 3WO1A 2IBSA 2HHAA 3WQHA 1O5IA 3VM6A 3W5BA 1PKEA 3HY6A 1IHDA 1ICEA 2AG1A 4OG2A 4AMYA 1GLGA 4D45A 4IICA 1O9BA 2BI7A 3HCWA 3U4GA 3PNOA 4ANFA 3B3FA 1TZ2A 3BRQA 2HADA 2C9ZA 1Z35A 1N9GB 2YOFA 4H16A 1IEVA 1T36A 1Y7IA 1XCPA 3P0HA 2EATA 4MKZA 4DN6A 1FCJA 2CJYA 5A2QA 4NF2A 1QE5A 3AZQA 3JWHA 1SN7A 5EINA 1JGTA 4NJEB 1AJEA 2X6WA 1QIDA 2A67A 2DHRA 2A9OA 3BQNB 3PUVA 4D0GA 4URUR 2W22A 3ZK7A 3FGPA 2CJWB 3I0ZA 3JPWA 3RRFA 2VPPA 2PX3A 2OBMA 3H5IA 4IVRA 4UBLA 4ZIRA 3FGNA 4A8JB 4ZCPA 3L1VA 1OZ0A 1TPYA 5CVVA 4O63O 1T2FA 1I4TD 1SBQA 4Z4RA 1X7ZB 3JYQA 4GS5A 2VJKA 3FYUC 1VQ9B 1V6CA 4MX8A 1X39A 1Z33A 3ICPA 1M3SA 2FSVC 4EA7A 3W3AH 3JQPA 3BMNA 3GJ5A 1Q82D 3BREA 4M1KA 2Z3VA 4QBKA 3ROEA 5K8TA 3CCQB 2PH5A 1XFOA 3KU4A 2CNDA 4HH4A 3ZKWA 1D0SA 1PR5A 3WLJA 4JYAB 1G2IA 4IV0A 5AKZA 4RYLA 2AC4A 3KJZA 3QVKA 5ESXA 4WL0A 1VP9A 4C3UA 2JJMA 1YBVA 5BT8A 1J1IA 1WAMA 3HB4X 3WRYC 2FA9A 3DUFA 1I01A 3B52X 4I2NA 3G82C 3ICOA 4PZ9A 4IIGA 1ZUD1 2R751 3QKRB 4IWXA 1M90D 4PPFA 1C30B 1EP9A 4B3DA 2I66A 1KMCA 4MXDA 3MUOA 4W7SA 5TT1A 4Z0TA 2OY0A 4L8JA 1R6AA 2COUA 4NEGA 1TMGE 5EIOA 4XD7A 3B1YA 3TCNA 4C4RA 4DJJA 2P3LA 2C96A 4KR7A 1K5HA 4MZDA 4UUPA 3CKKA 4DMFA 1OJ7A 2V1XA 2XMDA 3R6WA 2VAWA 2VWPA 3IKVA 4MJXA 2Q3HA 4UAGA 2ZBDA 1F3LA 5UKDA 3OF5A 1BWSA 4A9AA 1Y5LA 5JZ9A 4Y2UA 1HE1C 1JUDA 4J1QA 3ZQ4A 3B9QA 3PPIA 3WGZA 3CRRA 5M3BA 3RT9A 4FB4A 1OFVA 1RI3A 3BM5A 3D02A 1TCBA 3Q10A 3VPDA 4RZIA 2FQQA 2VC2B 4UASA 3DBVO 1PNTA 4HT3B 2JATA 3K0HA 4ISCA 4BO4A 2Y9PB 4DA4A 1ZVQA 1JJVA 3WS7A 5EMMA 1N6PA 4GMDA 5LMCA 1KI6B 2XCQA 4TUYA 4X45A 4ZKEA 4KQIA 3WX0A 5JCJD 2RAPA 4R9SA 2V8BA 3DFKA 1T13A 3TXXA 2JFGA 4UAVA 4Q7LA 1QKKA 4WZZA 2IELA 2G4LA 2FWRA 3A4IA 2I80A 4D97A 4E31A 2CSUA 2BZSA 1ZM2A 1VSQA 2QVCA 2RKOA 3OM1A 1JKJB 1U3WA 2JVJA 2OEPA 1GNTA 3PUZA 3WSWA 4AJ1A 4B5LA 4W5RA 1L4HA 2PZBA 1GO2A 3CLUC 5F5NA 1C9MA 1JLSA 4QUJA 5CX4A 3RBAA 4D4IA 1O0BA 2A33A 4BVAA 1W93A 2G72A 1O58A 1Q7RA 3I9MA 4DIFA 2AOUA 1IULA 3O2NA 1BJTA 5FADA 1VG8A 4PZZA 2PGIA 4D81A 5I8PA 2I4LA 4FS3A 4HNAA 4M46A 3D6UA 2NU6B 5KWJA 1P81A 2E4YA 2D59A 4HLQB 5FHQA 4XVCA 1YUBA 1W44A 5ENVA 3EOBI 1U9CA 1LC3A 4LKRA 1AQLA 1EG2A 1ZOSA 2OOKA 1OLXA 2ZDHA 4PLHA 5FT9A 4FR5A 5LOVF 2IXGA 4QASA 4WY2A 3C3WA 4HXGA 4PYNA 3B48A 4DW8A 1Y82A 3I1JA 2CXQA 2ID7A 4PTLA 2ST1A 3P0RA 5KTPA 5CLHA 1HUQA 1REQB 1T6XA 2G70A 1D9XA 3ONVA 3O0TA 3SYKA 2XAAA 1MX5A 4ZA2A 4CRWB 2YZGA 1NJ8A 4TM8A 2HCFA 4CEIA 1XUOA 2ES4A 2H3HA 1RAAA 2YASA 4JBYA 5AI5A 4U0JA 1JI3A 2UVPA 1CUBA 4G2TA 5DLYA 3ER6A 3OTWA 4KLRA 4URHA 4EG6A 4RLHA 1T3GA 1B2LA 1T0HB 4NZZA 3LO8A 5DTMA 1BH6A 2NTYC 2JGDA 3OW2B 2BFEB 3EPKA 4XFKA 4GYKA 1ZPDA 1TVMA 2QA4B 2GBGA 5JD6A 1GOTA 4X6LA 3A3BA 1LBHA 2FYTA 1Q1BA 3GFVA 3H8JA 5TGDA 4W1PA 3WHKA 2Q5CA 1XJCA 4PAMA 2WYOA 3AHGA 5A0VA 3IEVA 3KYCB 4XWAA 4JI8B 1CFZA 2INGX 1E63A 2X9GA 3HKDB 1WULS 4HZGA 3A2MA 2GZMA 3WE7A 4A0GA 2AZ4A 4P4SA 4NULA 1DUVG 4JOBA 4LZZA 4UHFA 2Z57A 3DOUA 2PL9A 4OQXA 2NPFA 1ESCA 4QC2A 5BXQC 4UEKA 2J67A 1SB9A 1AKQA 4XSVA 4B8ZA 4Q1VA 4D9JA 3KOUA 4RBNA 2Q7XA 2ZTSA 1C3LA 1MHPA 4GOOD 3VDMA 5AVXA 3H2YA 5JO9A 1A8PA 1UOEA 2LDBA 1HEYA 3BFVA 3FNGA 3UN1A 3VYRB 4CKEB 3OTOB 3D7SA 1OASA 3H9GA 3N9IA 4FGZA 4L2IB 2PX4A 4XIGS 2P9BA 2O0MA 1WX1A 2YHSA 1E2NA 3UZUA 4YAKA 2EF0A 3IEUA 4QDKA 4IDEA 4YRKA 1BVHA 3O6VA 3BWMA 1S9DA 4TRJA 5C8YB 3OTIA 3R7NA 5F78A 3AVTA 1K3FA 2G9NA 3VJKA 1XDBA 3DMPA 3ZWWA 5ITWA 1JDZA 4ER3A 4EY3A 3EGWA 3AOEA 4FJ0A 3ZWVA 3H5VA 3KZNA 5JXJA 1PBNA 1RI4A 3OTQA 2ZUSA 4JEIA 4Q47A 3UM9A 3E05A 4EJ2A 3IAS6 3FPBA 3EUEA 4X94A 1EBUA 5JSKA 5HZHA 2EFCB 3T7JA 2A5YB 4IDQA 2VPTA 3HHPA 2XBUA 2F55A 1Z2EA 1NLMA 3DD1A 5CVJA 3U1BA 4NMWA 3WWYA 3K05A 4KIWA 2H1OA 1L5KA 2YXEA 3IEIA 3E8XA 1VLYA 3KZXA 1D1TA 2XUJA 1FRZA 2F9FA 2YBEA 5ALZA 1UMBA 3BG5A 4KO8A 3C3AA 2HBQA 1JX6A 4L9RA 4M9XA 4E1VA 5JPCA 3MSCA 4QLAA 1PWYE 1P4JA 2C83A 2Q9BA 4MUKA 4AULA 2R4UA 4C7OA 4Z4QA 4MVXA 3VJRA 1G8YA 1X1BA 4RJJA 2IC5A 1L3CA 3UWPA 1QP4A 3B3QA 4KKVA 3ZWAA 3K35A 2ZJOA 4GLOA 4I81A 1OA0A 3WLNA 2QAJA 1V1RA 2RD2A 3O4FA 3EZNA 3PHHA 3BL6A 2QVYX 1KI4A 4ENSA 3GEIA 2W37A 4URXR 4IIJF 4DNOA 5DNWA 2CHGA 3H65A 3UAOA 3VR6A 5J2TF 2ZJ8A 1MCZA 4ZCLA 3V34A 1X7YB 5FBRB 4YP7A 1NXVA 1PIWA 3QVOA 3K70B 1QVVA 4WLFA 4DLLA 4ALNA 2ZT5A 1OFTA 5JIBA 4HNVA 1O97C 2XGGA 1AN0A 2Q3MA 3BIJA 4MI3A 5KSZA 3SQWA 4Z7NB 1GNLA 4E03A 2VF7A 4PFQA 5JDIA 1KI9A 4DR3B 3SEFA 5L3QA 1GG8A 3BDIA 4PCVA 3TLGB 4DPMA 3O4JA 3AUTA 4TKUB 4XRGA 1G8SA 1Y3IA 3QZUA 3E7WA 2JLBA 2OKGA 4D8XA 2XLBA 4Y9TA 1U2DC 3DQQA 3SIWA 1VHEA 2FPGB 3ZBTA 3C7TA 1E0JA 2ZW9A 2P4HX 3I8XA 1SHKA 2CLIB 4TOIA 4AZ0B 2UYOA 2EWVA 3U0BA 1FDSA 2TMKA 2ZTUA 4JLNA 3AGQA 4ES6A 1MC8A 5LMZA 1WTCA 3ZJ4A 1LC0A 3ETEA 4HTFA 1BEEA 3QF4A 1JIIA 1X42A 5EUCA 5H16A 3NHLA 5HIMA 2WG2A 5KINB 3B9BA 1QIKA 3ESYA 1YOVA 1JZTA 2WAAA 3IQEA 2J31A 3EGCA 4V03A 5TS3A 2FXVA 4DIDA 2IW1A 1YIOA 2VDUE 3VVBA 4CLRA 3ACBA 1NM5A 2E5FA 1DPGA 4F60A 5CP8A 3R41A 4IUDS 4IIEA 1Y9AA 1YONA 3KHTA 4BGEA 1PG0A 1TZMA 1KEVA 3NI2A 3BJIC 3SX2A 1DC7A 3HY3A 4MVJD 4C0KA 4E4YA 3U3MA 3DE5X 5LYJB 1ESZA 3DR5A 3IAM6 3TFQA 3EH2A 3NH9A 5HRUA 2VNKA 2WE8A 1ZISA 3AVPA 3GA7A 2QUIA 4AYTA 1S8AA 3YASA 4KR2A 5DIFA 4JBLA 5KOYA 2HV9A 2JLXA 3BY2A 2WYVA 4RZSA 5DYWA 5FPPA 5HFNA 1IG3A 3AHEA 4YUWA 2O9JA 1QIFA 1Z0AA 3DE7X 1MZPA 4LJLA 1JIJA 3KAPA 3ABOB 1ZK0A 2MSLA 2PD6A 5DNDA 1IDOA 3JATA 2RAVA 5JMTA 2EDCA 2FR1A 3ACCA 1QPGA 4KFCA 4LC0A 1U98A 3HSSA 5TQVA 2J7PD 2OZPA 4ZXFA 1RI1A 4A10A 1Z2NX 3B9PA 3SEAA 5HKOA 2WV9A 3HV2A 1TEHA 4JUBA 5TIIA 3MJSA 1QHFA 2YUTA 2ZSBA 3I58A 1XTPA 1LY1A 3TIFA 1BOFA 2EJCA 4X1IA 3UATA 4OJTA 4DRYA 2PR7A 4YAWA 2HMUA 5IH7A 5JVDA 4GX2A 4XLTA 1JHUA 1JRLA 3FNHA 5CVEA 4IDBA 4JJZA 2P2ZA 5HUHA 5B2EA 1U9JA 1WBJB 3ROTA 2YYAA 1P0CA 3J80A 1TTHA 3BFJA 3WLPA 3FUXA 4RY9A 4GXNA 5BWMA 1H6AA 1QJ4A 4MAMA 4QSMA 5ADVA 5ARDA 1E3IA 4Q0MA 2YJ5A 2OWEA 1EJ0A 1W0CA 3TSOA 1MDBA 5LZ8A 2I6UA 2A0YA 3HV0A 4DMHA 5I7EA 1IYZA 5BSMA 3O73A 2WWFA 1YJ5A 4ME6A 4MZXA 3REQA 3DM5A 4FYKA 5IEBA 3VOSA 3VR1A 3LUJA 1ZOPA 3C6MA 4G5FA 3UCEA 4R3WA 4B5KA 2WKRA 4MB2A 8LDHA 5G0SA 3F9IA 3VKWA 2B3TA 4LVUA 1G291 2C20A 3G5UA 3TRIA 2NUTB 1JDTA 1BE0A 4QKQA 3EY4A 3WXBA 3T4EA 3U17A 4BJ6A 1VZ2A 2P9TA 2IS2A 1MIOB 3TKAA 4J2OA 4XTCS 4BLQA 3ZGLA 4LAFA 5ITSA 1G5FA 3UB3A 5F9FA 1PEAA 4EVSA 4AMBA 1ZRHA 2GPBA 1QV7A 4NS4A 5DWQA 2IZZA 3RREA 4GZ6A 1VRVA 1BCRB 4N4AA 4L95C 4BP1A 3CCSB 3GROA 2FX5A 8AT1A 2OL4A 3GELA 4I55B 5F1PA 1OROA 4LF7B 1WQ4A 2ZUEA 1YZVA 3JQBA 5ULLA 3U4AA 3CS3A 1F3OA 2F1KA 5C1DA 4IUBS 2B98A 4JC0A 3TECE 2JJ2D 3MMXA 4NFLA 2J5QA 1SD2A 1TU3A 2R6JA 5FA8A 5I9BA 3DE3X 5HTKA 2QLMA 1N2CB 1OAOA 4B7ZA 3PJDA 2OZVA 1A9ZA 4MMXB 3ADBA 4RHYA 4TS1A 4YCNA 3KEQA 2IPMA 5JCZA 4YLYA 4HTAA 2HO4A 1RRCA 3EJWA 1LNZA 4BTEA 4QO8A 3MGGA 4DCCA 4PYJA 5MF6A 1FX0B 3JQ6A 2OG2A 2X7JA 3L77A 1WB4A 3UJ6A 7AT1A 4ZEXA 3T6KA 1F4VA 5AUOB 3KX2A 1BU5A 2BKXA 5E6SA 2CZGA 4H1UA 1YMUA 2B21A 2C3PA 1E5LA 2PCLA 3ITDA 1SK9A 3TOXA 4OU5A 5BPHA 2P1ZA 2PKRA 3FUWA 4RHXA 4DGQA 3OEHA 1GUZA 4E2WA 1EX7A 2Z3WA 3RU3A 1YVEI 4G37A 5EAIA 1M8KA 3CPJB 3N3AC 3MIZA 4HAOA 2NT3A 3EXIB 4EYOA 3HO1A 3WLAA 2K7FA 2W6QA 2XHZA 1GG2A 1I2BA 3CN7A 3PNMA 5G41A 1NJFA 1U4SA 1YR3A 3PQ2A 3I5XA 4BMDA 4MPPA 4XLFA 4ACBA 1FTYA 4KFRA 1AGNA 1ZA2A 2HIHA 1W88A 2J9YB 1T9DA 3AR2A 1FFCA 3DWIA 1NOKA 3LC0A 1U65A 3E3MA 3IC5A 4FFBA 4QFCA 4ALIA 3CTMA 1G0NA 1G98A 1P1RA 3OZUA 2Q2VA 1D5WA 3FWZA 3KUCA 3GGCA 1VE6A 1HFJA 4EJFA 2ZAMA 4DXHA 5A71A 1FIUA 1HZZA 2EKZA 4OYLA 2CJXA 3UJ8A 1IHMA 1DQPA 1G59A 4N0DA 2GJRA 5AVJA 3ICQB 1KK3A 5HRCA 3ONYA 3A9WA 3LUPA 2YRWA 4O4JF 2FMKA 4ETWA 1YQXA 3VSDA 1V8DA 1X80B 4B6SA 5AFSA 3WGGA 3S44A 4X7MA 5FTMA 4CUZA 3KAKA 4RUKA 4FGSA 4CKZA 1B93A 3EC2A 4OGLA 3GLQA 3HLYA 1EVKA 2V4UA 2DKNA 5J58A 1EPUA 4D4KA 3BMOA 2AF3C 3F96A 3RLFA 1CUDA 5EMHA 4AJJA 3D0KA 2D0DA 2JA2A 2FUEA 4F1WA 1GGVA 1IWOA 2QN9A 2P8JA 4YJ2F 3I1YA 2CXNA 3BCFA 2HN9A 2ATVA 4FFRA 5J40A 1GPJA 3RJTA 5IVHA 1QUEA 1JNXX 1B76A 2OXTA 2CLMB 1N8SA 2FR0A 2ZRIA 3SCZA 5BYBA 1DIGA 2RH8A 2XUDA 2XYVA 3QLEA 1TZKA 5B2FA 3LP5A 3W3ZB 1LBTA 2IOQA 4JQZA 4QGHA 1ZSNA 1H05A 4QNNA 4P82A 4DJTA 2FUCA 4ED9A 3GH1A 1P9OA 4WFIA 2BRUC 4NMLA 3PI7A 1FS6A 1GA6A 5ALKA 4U3JB 3GAFA 4QDUA 1UZLA 1M6HA 1RAFA 1U28A 1W25A 2HAEA 3C98A 3QV2A 4G8CA 4YP0A 4URZR 3ZOKA 3LDAA 3N76A 3R9XA 4MP3A 2C9YA 1VYTA 1GRNA 1RNLA 4QGAA 4F8EA 6CHYA 2IYUA 4KFSA 2CDRA 4JYBA 1TUIA 4KMOA 1XRLA 4LHEA 4M1MA 4TTAA 4JX8A 1QAMA 4DMUB 4RAQA 4ZHQF 3AERB 5AW6A 5FF9A 4MQ5A 2J4FA 1U02A 4IDAA 4Q1DA 1XTQA 5HFJA 1W59A 3IJ5A 1A9OA 2R1ZA 2XXAA 1YITB 3AFHA 4ATNA 2M2IA 2YVKA 1PKXA 5TGZA 4DG8A 1X7GA 4HADA 4QWWA 1E2DA 4WXPA 1DQSA 5J35A 2KI5A 2VHTA 2YXLA 2RI6A 2ZB7A 3CR8A 3RSOA 1QCZA 3QU2A 3V8VA 3HZRA 5B1YA 2BM9A 4UU0A 3BWXA 5TV2A 3T7AA 3T9CA 2FI1A 4B74A 5EZYF 3ADKA 3V4PB 4D98A 2H57A 4QECA 4C4XA 1ZM4A 1FP1D 4TX1A 3OKFA 4UBOA 4XQ9A 2NVUA 5IYWA 1EBFA 1NJ6A 1QAQA 2Q0HA 2Q5JA 3AVWA 3D2AA 3Q0EA 1V37A 3KOXA 1GU0A 4WZBB 4NJEA 2OA0A 5G4KB 2LZ0A 1G21E 2NTVA 2VA8A 4ZC8A 2VHEA 4YONB 4PRZA 1JG3A 4XGKA 4FZ5A 3RU9A 2FEWB 5ANRB 4LRUA 3F5MA 3PXEA 3QENA 4HB2A 3VTFA 2IH4A 5F5XA 5LBUA 4PR3A 3WYFA 1PJ2A 3QHAA 1U5BB 5FAKA 5FUBA 5I47A 3L8CA 2F00A 1X7ZA 2AQ8A 4BFSA 1ZC4A 3O91A 1U8YA 5AJVB 1U8CB 1LPAB 3ELWA 4R8RA 4LISA 3IGFA 2YFYA 3C43A 4CEJA 2O8CB 2GPSA 3HJTA 2PT6A 1U0TA 4QVJA 1EQAA 3KJHA 2XWQA 2XX3A 1VM6A 2VTDA 4RWZA 4J4BA 1QRTA 2Q41A 3VNVA 4Z49A 1A2OA 4XVHA 2ZEJA 3T94A 3B1KA 3UAZA 1QG0A 1OGJA 1UK8A 4G9EA 5ICFA 2Q5HA 4EYSA 4XGIA 1TF5A 1AQUA 2O05A 3WK5A 2I6QA 2BHRA 3E15A 4OFZA 1HNWB 1ZGHA 3GVJA 1DO8A 1PVOA 2FPIA 1AKYA 3K9LA 3OF2A 4E15A 2QI9C 2X23A 3ZQUA 2C97A 3S2FA 4E13A 3FB1A 4C7XA 5TNXA 1K6XA 3ICCA 2BGMA 4Q1FA 3F47A 4WZLA 2Q99A 3VYVA 1P33A 3FZYA 2HUNA 3QVGB 3C70A 2PD4A 2X15A 5CVUA 4E2YA 2BMDA 1RM4A 2ZUCA 1EE9A 5K51A 4ZAGA 3C6QA 3KQPA 1MJNA 5DP1A 2GH1A 1N06A 4LF4B 2PHZA 1J20A 3GJTA 3GRCA 3S7ZA 2A0XA 4RD1A 2X9NA 4GPEA 3NHYA 1VKJA 3E9NA 5CCXA 1H65A 1N1MA 1IMOA 2YQ5A 2P9ZA 4AWXA 4Y9UA 4CLDA 5A2GA 1XVUA 1BA2A 4D44A 4IO1A 4DV6B 2PA0A 3A6LA 5D51S 1N6NA 5ELXA 3BVPA 1F1BA 5KWVA 3TEMA 4NHOA 4YBRA 2ID8A 4CM9D 4CJXA 1I7QB 3L7AA 4J1TA 4BC0A 1TFRA 2G0TA 2E89A 3CYFA 4V0ME 1J99A 4CDNA 2ZTMA 2ZVPX 4O2BF 3QU9A 2KLHA 4PSDA 4QD3A 1GEGA 3HXPA 5EXDA 3AWDA 1C5KA 1KEEB 1L4YA 1PLJA 2X8BA 2Z58A 1BGXT 1P62B 4J9UE 4QQFA 4X8OA 3ZNOA 4B8WA 1RU3A 4YCMA 1BXRB 3VZBA 1NC3A 3UF0A 3R2JA 4FN5A 3FZEA 3SMVA 3OM9A 2H51A 4UVGA 4C29A 4M8NE 5SYNA 2P5UA 1ATZA 1ZCFA 3WZ2A 2NGRA 4TUYF 3ZLBA 2XMPA 4H7KA 4N3BA 4BLTA 5KOJA 2DXIA 2EZTA 3F6RA 1J1UA 2QS9A 4JLJA 1CIVA 1IIBA 2UUPA 5J1SB 4W9MC 1T0BA 4J2HA 4DDUA 1GKYA 3NFYA 3RYIB 1TM2A 1WDLA 5IDQA 4QBTA 1L5OA 3IUBA 1SD1A 4LHZA 4BZPA 3D2BA 1J0AA 1UBMS 2XKJE 4CL2A 1KI7A 1UKZA 1SXJB 5AOCA 1FY2A 2PO5A 5E6TA 4OQMA 4RACA 4KXQA 1HXHA 3FCOA 1Q1GA 3T99A 4Y6RA 3E48A 1U2RA 1KO4A 3D3QA 3JASB 1P3DA 2ZSKA 2BVNA 3TEFA 2X1LA 2WICA 3IPLA 3LHDA 2G4CA 3O74A 1VBFA 2G17A 3BJEA 3RFVA 5IPFA 3U6KA 1NQWA 3S70A 1KVUA 4GOLD 1ESDA 2HJSA 3L46A 3WNCA 3ZY4A 5KPJA 2CLDX 1P61B 3JSXA 2A92A 2E48A 4NJMB 5KJ6A 5B1DA 1PL7A 1XQBA 1TLFA 4PHTA 1CERA 4EI9A 5LQAA 4WPGA 4EUHA 4DLAA 3IERA 2CV2A 2V7QD 1EFKA 1TLLA 1CUCA 1DDOA 2H1WA 5DASA 2YIMA 4LYYA 2Z1DA 1L5FA 2F3PA 2XUOA 1UWVA 1E1QD 1D2AA 4RHEA 4X6UA 1B42A 3AONB 5TY0A 2BMEA 4I4TF 2CCKA 2SICE 2PGAA 2V0CA 1JPUA 3EVTA 4ZVTA 2I2FA 4K7JA 3SC3A 2PLNA 2NO6A 3G2HA 4BBZA 1OV4A 3T4PA 2ODPA 4ITUA 2CE2X 2FXIA 2IHUA 3L0CA 2ZYHA 3HKDA 1UT8A 2A6PA 2YJNA 1UC9A 3A58B 3R6DA 1ISIA 1BH2A 3EMBA 3NG1A 3ONEA 4JUCA 4R8SA 3F1LA 4R2KA 2ZTHA 2X6YA 2J59A 1V9LA 3I4FA 4TVOA 1GR1A 1N07A 3I30X 4TLMB 3DEFA 1J25A 1EFRD 3VHLB 4D3FA 1E1CA 1PSWA 1PWZA 4F46A 2PUVA 2XUZA 1BDJA 4WTOA 3TZQA 2W83A 4P80A 2PT9A 1E0DA 2ZK7A 3IDSA 3VTAA 2V7XA 1C14A 1QVGB 1I13A 4TZKA 5E3HA 5BV7A 3U3KA 4ER6A 5EKUA 1VE3A 2ZBPA 5B7GA 1G20B 4BNIA 2IHJA 1F2UB 1FJ2A 1H94A 4KUHA 4JBXA 2ZRGA 2NT4A 2CUZA 2GHTA 4WKOA 2FEOA 1W9XA 1WVMA 5AKXA 5C8YA 2DC1A 4TQAA 4DKXA 4QXQA 4HAXA 2M1XA 5KREA 3Q39A 1BSVA 1QYRA 3ERCA 3OX1A 2XKAA 3QXCA 4Q21A 1C3JA 3TEJA 3V76A 2ZATA 1UM9B 2AEMA 2GN6A 1A77A 3W04A 3LZCA 2RGUA 3W5AA 3I62A 1VKHA 1K2VN 4C5AA 4L0MA 2AF4C 1J0CA 4REMA 3SHQA 3KBBA 5K99A 4MHTA 2OYRA 3M6AA 3DMHA 1JWAB 4JI5B 2WDPA 1T9BA 2V7GA 2O5VA 4LZAA 3WWPA 2ZJ2A 4RKYA 3VKVA 3E1YE 4FJ1A 1ABEA 1F0PA 4Q4AB 3ADDA 1II8B 3BJRA 3OKPA 1HX7A 1PJZA 1XL1A 2ZSEA 1DKRA 1EP1B 1T8RA 3N07A 4W5TA 2ASEA 4LV5B 3SDBA 2X4IA 4D43A 1YHZA 2P0EA 1LK7A 1O08A 1ZK2A 2H08A 1LK5A 1BROA 1TC2A 4PIPA 4Q4LA 3TOVA 5B55A 3EC7A 2BTEA 2R7LA 4ZVSA 3VR5A 1I6MA 2AXQA 1D2CA 4FEGA 3MHPA 4YVFA 4N3GA 2CD9A 3AR6A 3LX8A 1TCUA 3IIMA 1ZGGA 4IEIA 1S89A 3NRBA 2WU3A 4F3TA 5JNUA 4B76A 2GYUA 1GPH1 1SC6A 5P21A 4Y30A 4JI1B 2YVAA 4R7GA 3WQQA 1M2VB 1SVNA 4XQGA 2P65A 3PRYA 3EBPA 3G5LA 3W3AD 4EB0A 2PUGA 4JMQA 2GS9A 1GPWB 1YDFA 1LJ8A 4WESB 3SSAA 1M2EA 3EZ7A 5EJ9A 3DL2A 3H1PA 1B15A 3NAZA 4OAPA 4XLZA 1U8TA 5H9VA 3BMXA 3D8NA 3SC4A 1GHTA 3WLSA 4EF4A 3MWJA 2ZZNA 2DPLA 4AWBA 1FSFA 2X77A 3KZMA 1WQ1R 2PTGA 3P9KA 3W4IA 5D3KA 1KFCB 1NI3A 5I7OA 1XPJA 3C8UA 4O59O 5H83A 5LZ9A 1CUVA 2P9HA 1OQAA 2IXTA 2QL9A 3AVQA 3HJGA 4MW0A 5HQTA 4B3TB 3OEWA 3ZV7A 5JNLA 1N7JA 5DWVA 4BV9A 5J4LA 2VIIA 1JQ5A 4KVGA 5I9SA 4C1BA 4DDMA 2FKAA 1GL6A 2YVQA 3T8YA 2ZT8A 2O0HA 1GQFA 2PJUA 4Z4UA 5LP6B 2HO5A 2H9IA 3INRA 2SCUB 3L05A 4UHHA 4RHFA 2JJ1D 3NWOA 5BNWA 1A9PA 5IARA 4DWVA 1RZRA 5F4MA 3TDNA 1KE2A 3OEED 4ZEMA 4YO7A 3AOGA 3DT6A 3SZGA 3C6KA 1BQ4A 3QG5A 2OBBA 4LUCA 3EEOA 4EYKA 1ZCZA 3E4CA 3WI7A 3EZXA 4R16A 4XDHA 1DAKA 1XQ6A 4BQEA 2DHEA 3ISXA 2NG1A 4OUKX 2FNAA 4QNMA 1XFAA 1OFUA 3U4HA 3BORA 3HXTA 4A6PA 3OFKA 4DT1A 5LU9A 5EQDA 2QJWA 4OMUA 3OBBA 4UTVA 1PX2A 3ZE7A 1F38A 1PR6A 3BCRA 2GCEA 2PY6A 2L69A 5LYJA 3IBSA 5H3LA 4NDZA 2MINA 3B20A 4M1QA 2HSGA 2Z5FA 1HDEA 3RRMA 1UF9A 3VGPA 4R71A 2WB2A 1DX9A 2UZAA 4MV1A 1E0SA 1EKXA 1Z83A 2PX8A 3GFTA 2XE7A 1NQXA 1AU9A 3LIIA 4MR8B 1N32B 5CA1A 3R7WA 3JD4A 3V4RA 3PEWA 1F6BA 2P2CA 1FS4A 2DOKA 3E22B 5KBYA 2WW8A 1UD8A 4OQQA 1VCOA 2VJMA 3LO5A 3HB5X 3IO3A 3PDCA 3SC2B 1GUDA 2I9PA 2ZBFA 4U5QA 3ZS9A 3NE5B 3ZJUA 3NYRA 5FBKA 2QR5A 5JBQA 5ALYA 5A9RA 4Y2QA 1XP8A 3H84A 1LDNA 3R0JA 3RABA 4D0RA 4PZPA 1X2EA 2AW5A 3Q2IA 1KD1D 3UOAB 5A6SA 2XBLA 3DFFA 3WYAA 2DWUA 4UXJA 1S3FA 7MHTA 2GEDA 4L78A 4EKYA 1QAOA 2J08A 1GZ5A 1N5KA 3UA3A 4LDZA 3F7TA 1JEJA 5F3DA 1EE1A 2VAMA 2PBFA 1UBEA 3PNBA 5FQOA 5G1PA 3OI7A 2X6XA 1AO0A 4MKGA 1CR4A 1Z4QA 2HGSA 5TF4A 2OQVA 5DJ5A 2ZYUX 4UBJA 1NF2A 1FLNA 1JQ3A 5IUNC 3F6SA 3PD0A 1D8AA 3N5CA 5IXJA 2REOA 3DDSA 1PS9A 1DOZA 1EWVA 3NC0C 3N05A 2XT6A 4JY7A 2R5FA 3KB2A 4Y2SA 1VL8A 1WMFA 5DLEA 1V1MA 1YKFA 4N8SA 4B79A 2BE7A 3MWGA 4OQNA 5C3MA 2BUBA 3OQJA 3S8YA 3VPAA 3WP0A 4IZ6A 4Z4ZA 1H1DA 5A1TA 3CZRA 5AIAA 5ALOA 1IVNA 3OJ0A 1LBEA 4CM9A 1TYEB 5G0TA 1QQ5A 1IATA 2QWXA 4OB7A 3MYYA 3UUEA 2V7PA 2Y6UA 3UXHA 5JVDF 2GBCA 4JP2A 4IRMA 4KAAA 2BY4A 2WF8A 2IDJA 3NETA 3GMIA 4G8DA 3E0QA 4LJ6A 3N2KB 4RHTA 4YPFA 2Q0SA 1A2KC 1OZAA 1YL7A 3H05A 4L0CA 4NE2A 5LZ4A 4POOA 3TWOA 4AZ3A 2YNMC 4IOLA 3B2QA 5AYVA 3RVNA 1FNBA 1TMOA 1AN9A 1ORDA 1R7RA 2C5AA 2WNIA 2ZUDA 3QNUA 1UD5A 4RPHA 4W9NC 1L5SA 3S0JA 5JATA 1QG6A 1YA6A 4MVJE 1N2OA 5FI0B 5KMGB 2GRUA 3HZHA 3DNFA 3ZLJA 2FFBA 4OFBA 4NOMA 1I1QB 3R6TA 1G55A 1L3BA 1W7AA 2IODA 1W1UA 1H2BA 4IHAA 4L4SA 1T5OA 1SUWA 4CN8A 3AF0A 2O2JA 3O8OB 2HK8A 1U0GA 1CK4A 3NOVA 4GG1A 1E2HA 4XN0A 4QO7A 1H4SA 2P6PA 5H80A 2AOXA 3QJGA 3HB7A 5KU1A 1HWYA 3KIPA 2HTEA 3T53B 1G3MA 3TE7A 3A6DA 2QNIA 1U7UA 3VMFA 1JIVA 4GDMA 4C20A 1HT2E 1XA0A 4LQ4A 1FF9A 4EGAA 1VECA 4Z0NA 2DIEA 4DIUA 1W52X 3A3KA 4FM9A 3KJXA 2B0JA 3G2NA 4BO6A 1RKBA 3ITKA 1SUPA 1XHFA 3GQBB 3WDSA 3GOQA 4WX2B 4C21A 4YCBA 3R0XA 1KHTA 3CUSA 3ZZUA 2FPLA 3QKTA 3E84A 4LYHA 4PRYA 3PGKA 5DX1A 1X7DA 2XNDA 4Z54A 3LXMA 2J0UA 4O8CA 5DV9A 3ZBPA 4OLHA 4H9GA 4UZUA 1LKZA 3B1JA 1M6EX 3ON5A 4GU5A 3CG0A 4HDKB 4V0RA 1T8SA 1K2WA 5JD3A 3WV5A 1Y8RB 2LWIA 3LT5A 2HQOA 3KQQA 4TM7A 4KXMA 3KKLA 3EXIA 1L7DA 3HI4A 5AJWA 1BS1A 3AEKB 3IS3A 2I91A 3ZEAA 2H16A 4K88A 1VSVA 1C0LA 1NVUQ 4N6NA 3TG2A 5IS2A 1EK1A 1TD9A 3CH7A 1EFTA 1OFIA 5DHTA 3WOHA 4TYYA 1U9YA 5EIBD 3UG6A 1WZEA 5C1OA 3RFUA 4ZRMA 3TSCA 2DUMA 1FVOA 2WIBA 3DGEC 4N7MA 1MX9A 1LDMA 2QD4A 4KQ9A 5CLQA 4ZD6A 3SJBA 3U49A 1RCTE 2MTBA 2PWZA 1OH6A 2IX3A 3W6UA 1OB5A 1QH9A 1T9GS 4UDYX 1YTLA 2ZGVA 1IM8A 1KC1A 2B9EA 2EKDA 4E07A 1Z07A 3E23A 3INGA 2FZLA 1A04A 3A04A 2H2AA 1IU9A 2ZJ6A 4K3VA 3WICA 2NAPA 3FLEA 2O5CA 1NMQA 2OMEA 4LYEA 3ELBA 4FPXA 5AKJA 2VYQA 4QUZA 1DCFA 4KGDA 4V38A 1NQOA 1CX9B 1BHQ1 1WXFA 4QOFA 5KTSA 1T5IA 1YVRA 4ER5A 4TMTA 2Z8YM 3QE0A 1IUOA 1DC3A 1AXEA 3IV6A 3QQ5A 4V0QA 1NVMB 3E9EA 5DULA 4V0LA 4RSRA 4DS3A 1PFUA 2XCLA 3KLPX 1KK0A 1X7WB 1PJ4A 5FKJA 2HBZA 3X44A 1JXQA 3MIIA 4RV5A 4DR2B 3T3EA 4NENA 3CMCO 2D0OB 5JJCA 1BTOA 4X65B 4YMWA 3QTLA 1E3XA 4YROA 5B4VA 4PYQA 5AK4A 4M1EA 2R86A 2D5LA 3U56A 1VG0B 4BNXA 3HGQA 3OOSA 4PE5B 4RU1A 3EZGA 3VPSA 4EUNA 1G5TA 2YDXA 2YMMA 3N2ZB 4Q02A 2OBXA 3WYBA 1LRLA 3PE3A 3I2JA 3L0OA 3DVSX 5M04A 1ZVVA 2D4HA 1BN6A 2H6EA 2NZ2A 2R62A 1PEYA 2NQTA 3NCTA 4TWAA 4GOJA 1Q0TA 2Z83A 4F5DA 1I1OA 5IAKA 1Y9EA 2AS0A 2HA0A 4I50F 3ZWBA 4R6XA 3SPXA 4GC5A 1QVFB 3F2IA 2BFDB 2VRWA 1PNQA 3GN1A 3VO9A 1GAXA 4JOQA 4JVSB 3E58A 4IHQA 3UEOA 1Z7GA 4L76A 4MJ3A 1II9A 2QXTA 5JSHA 5ALUA 5LVAA 2RKWA 2ZP1A 4Q7JB 1O6BA 3MRXA 2QPAA 3LUAA 4PLGA 5AI9A 5HA5A 3CX4A 1VQ1A 1Q57A 1I6KA 3NCHA 3SSOA 4YP5A 2JAWA 5DT2A 3HCRA 1XRPA 4QDJA 5KHAA 4CG3A 3P5BA 3OE1A 1FNCA 1KMQA 2CLSA 2CXSA 2ECOA 2YHAA 4BQFA 5FNZA 2D13A 1HNNA 1J8VA 1F14A 2PX6A 4LPSA 1UJCA 2Q3DA 3AUSA 5FQNA 4UMEA 3WL8A 1QP8A 1NVKA 1Q22A 3EHDA 1QYCA 1ODIA 3D7KA 3JVUA 3MTBA 5AJZA 5E3IA 1DIBA 5G4KA 5IC5A 1JLHA 1Q50A 5G53C 1T0UA 4CEHB 1VLVA 1B7GO 4D9GA 5BR4A 4CMHA 4R31A 1L4UA 2BW0A 1Z36A 4YP1A 3RKUA 5BVHA 1E4EB 2IYVA 5C1BA 3FTCA 1YRQA 4Y0NA 1U5BA 1VHLA 1OAAA 1YRWA 2B1GA 4L6IA 1SVSA 2XECA 1MPTA 3GOHA 2PFKA 3V3TA 2RGNC 1EQUA 1C8KA 5U1PA 3FDIA 2O8CA 4G3XA 3GJ7A 1ARZA 3FI9A 3T7SA 2BHTA 5AVSA 2YFKA 1FBNA 3DHEA 3UNXA 1YACA 3DBOB 3GAMA 4EPYA 4XJTA 3BMQB 3BJZA 2VNHA 1JN0A 1KJNA 2ZYAA 1MFZA 2BLNA 2P9JA 3BS4A 3OZIA 4PYKA 3TD9A 2I2CA 3FVRA 4MYHA 1L7BA 3UENA 3BTOA 5TQ2B 3ZLTA 1XMPA 2FUG6 1YI0A 1YI8A 4DBVO 4LXQA 5FPHA 3RNOA 4P0QB 1XDWA 4J1NA 1ZK3A 4DILA 1NB9A 2YMLA 1Z0DA 4QNRA 4D8VA 3KSDO 1OBCA 4F3YA 1ZUWA 1LJUA 3AKDA 1LSOA 3IPCA 3RC8A 3PDIB 2E1RA 1X7XB 2AR7A 3HJRA 5SY4A 3UCFA 5K4GA 2IDKA 2FB9A 1T2VA 3KEGA 3QWHA 1Z4OA 4LKOA 2YYYA 3IBCA 3U61B 1AS2A 4WNIA 1RIFA 2WJPA 3CW9A 1WZIA 2ZE6A 3TR5A 1K97A 3O4RA 2OILA 3CG4A 4RL4A 5CVCA 2TMYA 3U4CA 1NBMA 3QFSA 4PQEA 3SXUB 3K1AA 2XNCA 2GETA 4HAZA 4BMZA 1E2PA 4CV3A 4KR6A 2PZGA 4E51A 1PRYA 1U0OC 4YRZA 4UNIA 5EE3A 3LCVB 5L3RA 4DNRB 4BU0A 2B4RO 2JD0A 4F8YA 2NPOA 2YV4A 4ZAFA 1J8DA 1RWQA 5FUMA 3PU6A 3KRTA 1NBAA 4C7VA 1A5SB 1N1GA 1LRJA 2JFPA 1SCJA 1VJCA 2QQGA 4NZ9A 4R6WA 1B3RA 1WOYA 2OV6A 2UZ3A 2WWGA 3DYBA 1Q2UA 5B37A 4UM8B 5K0ZA 1ADJA 3GRUA 3TLEA 1XZMA 3A8KA 3L0SA 1CEQA 3IR7A 2BIFA 3IMCA 6Q21A 3CVXA 2J4DA 4OHFA 2Z5VA 4QEDA 1GCAA 3O2SB 1EFDN 4B6GA 3HPRA 3DE0X 2R6R1 1PVDA 3GP5A 4X95A 5EVCA 1QTQA 3LJKA 3KALA 1E1DA 3FD8A 4NY1A 4TRMA 2ZPUA 4K6KA 3KPYA 1KEEA 1EVJA 4Q5IA 4ENTA 2JHCA 1H2WA 2ZRQA 4HX9A 4LXHA 2JIZD 3IX7A 5B53A 1AX9A 4MHOA 1MAVA 2C4TA 1DWPA 1DQRA 1NW5A 1SCQA 3NTLA 4QA9A 4WFQA 3R6LA 5HHTA 1ORWA 3OZBA 4EARA 3OJXA 5CFRA 4G0UA 1DADA 1JVNA 3FNBA 2ZWVA 4UM7A 1NW8A 4L8GA 2L42A 3UAYA 2BUAA 4HLCA 2Y9MB 3L6DA 3A1DA 1ND6A 4WADA 2WOJA 4R1PA 2MYUA 5I01A 1JEYA 5AK6A 1MAHA 4DR7B 4QOGA 4W5QA 4FEAA 5BW6B 4I9GA 3HA7A 4AN4A 1HQCA 4J0JA 3QV1A 5FI5A 1IIRA 2QRVA 4HB3A 3ZK8A 2AJTA 2JD2A 5FOXA 2DKOA 3I2KA 4ZU1X 5BWBA 4YHBA 1RXCA 5EE9A 1EAMA 3DC7A 2JZOA 3FMPB 2B9VA 3AJAA 3FNFA 3HCEA 4LTMA 4DIBA 3FWHA 4TTJA 4KRFA 2NU7A 1YX2A 3L7CA 3DW3X 3AYZB 2CHVA 2XWSA 4GM1A 4Y1EA 4W7HA 4F93B 4BLSA 1BOOA 1KBZA 3UMYA 4A0HA 3ZDRA 2OCBA 4CLEA 3NUZA 5FL3A 2PUJA 3WL4A 3N1UA 2JLWA 5JT1A 2OV4A 4BFWA 4B7UA 1SUFA 1G3RA 2Q1TA 3VC1A 1P9NA 2FOXA 4FIDA 4U8GA 1XB2A 3VOBA 3B1WA 3QPBA 1IM2A 4L07A 2WWRA 4G7XA 3GT3A 1TAGA 1LLDA 2BJWA 2FPUA 1EXVA 4KEAA 5ILGA 3VH3A 2Z95A 1E9AA 2MWMA 3PYMA 4MW4A 5JNVA 1EK5A 4HNSA 2YWBA 3DFUA 4TMZA 4DSAA 3MS4A 3CCVB 1MA3A 2GEVA 2WAMA 1TJ4A 3A11A 2E85A 3S6JA 2WF6A 3W79A 3LYAA 2R1TA 5ALHA