1QUFA

X-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
ADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title X-ray structure of the ferredoxin:NADP+ reductase from the cyanobacterium Anabaena PCC 7119 at 1.8 A resolution, and crystallographic studies of NADP+ binding at 2.25 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1996-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qufA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qufA02
3FPKA 1K8AD 2X3UA 2DETA 2FX3A 4F7DA 4B47A 3WXMA 5GV7A 3AVWA 3U6KA 1VQPB 1EXMA 1FNDA 4UAJA 4G5GA 2RC5A 2HMAA 1CQXA 4MYUA 2PMDA 4ZGQB 1GO2A 1QFYA 4QHYA 1TLLA 1VQ7B 2DEUA 3MMPA 1JNYA 4PC1A 1SM4A 3QE2A 2BSAA 4ZV4A 4PGOA 3W5VA 3CW2A 1ZM2A 2CRVA 2C78A 1QGZA 3I56B 1KQSB 1QFJA 2BN4A 3OZWA 4B48A 4C43A 2QTLA 5EMNA 3JQPA 3PENA 4RD0A 4FWTA 1B23P 1EP1B 1JA1A 1DDIA 1QG0A 1VQ8B 2C77A 3WNDA 3AVXA 3AGQA 1B2RA 1YHQB 3P26A 3VO1A 4TN1A 3ZZ0A 3QSYA 2VNIA 1AMOA 4HE6A 4BPRA 2AHOA 2B5OA 1VQ4B 4LBYA 1K9MD 3CCEB 3CB4A 3OZUA 1IJFA 4RD2A 3LYUA 1QX4A 1R5OA 3CCMB 1GAWA 4M1KA 1GR1A 1H85A 5FA6A 1Q7YD 2YWFA 2XEXA 3WBJA 3CD6B 3WBKA 4M4SA 3W2GA 3G4SB 3WY9A 2J7KA 1HA3A 1QFZA 4LBVA 1VQKB 3LO8A 2BV3A 3J81k 5TV2A 4AF7A 2B7CA 4ZCLA 3CPWB 1BX0A 1R5NA 1NDHA 1YJNB 2BMWA 3AVTA 3W5UA 3A1FA 1BJKA 1ZM9A 4R71A 2EFGA 2HCJB 3W2IA 3ZZUA 4MYTA 4G1BA 4TMZA 1OB2A 3U6BA 1YITB 2DCUA 3OZVA 2QTZA 3LRXA 4FK8A 4YALA 4TMWA 4RCYA 2GPJA 3VNVA 1VQLB 1GVHA 3ZBTA 3CMAB 4TMVA 4NCNA 1E63A 4DQKA 4H9GA 1ELOA 1FRQA 1N8RD 3CMEB 1FRNA 4N3GA 3JQQA 1KD1D 1Q82D 1VQ5B 4YHBA 2B7BA 4EH1A 3CCUB 1EFTA 4YAUA 3CCQB 2D74A 2VNKA 1CNFA 2BF4A 1EP3B 4J0QA 5JBQA 1KRHA 3U2QA 1TUIA 5AN9A 2BPOA 1GAQA 5KSWB 2QEXB 4RCZA 3W2EA 1YIJB 1S72B 3JQRA 3CCVB 1AIPA 3W5HA 1VQOB 4Y7CA 1XB2A 2OK7A 2VNJA 3ZZTA 4HE5A 2E1RA 2HDNB 3CC4B 3VMFA 4NBSA 2GQFA 3AGPA 1JB9A 1FNMA 4K1XA 3V76A 4G1VA 5HXBA 4QFMA 4RJLA 1OGIA 5DSZA 1KC8D 1N0VC 3OW2B 2QDXA 2BM1A 1Q81D 1E64A 1W87A 4RD6A 1F60A 4C0SA 3QFTA 4Y9RA 1M90D 4RD3A 4PC7A 1F20A 2QN6A 1W35A 1KK0A 3WYAA 5THXA 2YWEA 4P6VF 1XE1A 4N3NA 4M0LA 3QFRA 5TR9A 1D1NA 3FJOA 1K73D 1IB0A 1QGYA 4ACBA 4ZCMA 1NJID 1DDGA 2PLFA 1ZUNB 3CCLB 3CCJB 4Q7JB 1JJ2B 3B8HA 4P3YA 3B78A 1VQ6B 3G71B 2OTLB 1KTVA 2NPFA 1QGAA 4LBWA 3B82A 3CC7B 3P27A 1QUEA 1KJZA 1M1KD 1ZM4A 4AF6A 1TTTA 3SJZA 4M2LA 1D8TA 1U2RA 2XNJA 3ES9A 5TY0A 4YAWA 3CCRB 4ACAA 1OB5A 2VYQA 1G7SA 1QUFA 4B3XA 1EWYA 3AVVA 1H42A 4AC9A 1TVCA 3CC2B 5H59A 4U9UA 3VNUA 1EFCA 1EFUA 4ZGNB 1KK3A 1DARA 4RD1A 4LBZA 4PC2A 1CNEA 1WDTA 1QVFB 1D2EA 1QH0A 2OTJB 1FDRA 1I7PA 1W34A 4TMTA 3ZBUA 1VQ9B 2ZITA 3VO2A 3WNBA 1BQEA 2BVNA 1R5BA 1G7TA 2CNDA 3CCSB 4YAFA 1YJWB 1N0UA 3ZC3A 2OK8A 2EIXA 5H5JA 1KK2A 5GV8A 3MHPA 1UMKA 3I55B 1SKQA 4Y9UA 2RC6A 3G6EB 1IJEA 4RD4A 1J9ZA 1FNBA 3I1FA 4B44A 2QA4B 1YI2B 1BX1A 1QVGB 4LC0A 3W2HA 1JA0A 4M53A 2QMUA 2BGIA 4B4DA 2YWHA 4YAOA 1VQMB 3QFSA 3AVUA 3E1YE 1DG1G 2BGJA 2DERA 4IW3B 4PC6A 1G7CA 2VNHA 3QFCA 1EP2B 3MCAA 1S0UA 2PIAA 2VZLA 3WNCA 4B43A 1YJ9B 2XNCA 3CXCB 1VQNB 1OGJA 2YWGA 3W2FA 1Q86D 4ZCIA 1E62A 1G7RA 3OJXA 4FN5A 3CRZA 3AVYA 1FNCA 4TMXA 1ZM3A 4DQLA 2R6HA 1W2BB 2BM0A 3LVBA 4WQMA 1A8PA 2DY1A 1GJRA 3E20A 1KK1A 3OJWA 4PC3A
chains in the Genus database with same CATH superfamily
2R8YA 1Z4KA 3B60A 1G98A 4KIGA 5ELMA 3OF2A 4YJ2B 1K8AD 3BG5A 4XCXA 2QMHA 2GWRA 5CEJA 1UBTS 2G5PA 4UTVA 2NSLA 2ECPA 1B43A 1S8AA 3K1ZA 1D2HA 4C4ZA 5JAZA 4RDHA 5EE3A 4Q1AA 5JI3E 3WWZA 2SHKA 3FWPA 1OC2A 1ZCJA 5GV7A 3GAAA 4L8VA 3UMVA 1IN5A 1YZKA 1G1AA 3K70C 5HS6A 5LMZA 1PT6A 3GNSA 4JY7A 4PZUA 4PYMA 4W1QA 1WMFA 2IITA 2OM2A 1CQXA 3GT4A 3QE3A 3AJ8A 1VGVA 3GUZA 3W5JA 1CHNA 5A5DA 2FJPA 4EOGA 3QVGA 3R6DA 1GO2A 2V0CA 3E8SA 2B1RA 4UFOA 1WORA 3F5SA 3D4OA 3H16A 2PUJA 4NFYA 4OHYA 1P2TA 4MLCA 3OZ7A 1MDFA 4PINA 4WD3A 2IYRA 4Z99A 2X0JA 2IH4A 3RU3A 3C5HA 4JELA 1H1LA 1SZDA 5AKKA 1RBMA 4DNXA 1ZOSA 5KNCD 1QV6A 1SM4A 2DPGA 2N0SA 2RAFA 4HWTA 1WPRA 1S9HA 3MA0A 4H35A 1PJRA 3ESRA 3KP1A 2ZBUA 3DHNA 2QE7A 1HDEA 3C48A 2H7YA 2O59A 3RUDA 2IGBA 4O63O 2PIDA 2OA0A 1F4PA 4BUZA 4HVCA 1DIBA 2QJRA 2C2MA 4OMCA 4OQQA 4MR7A 4R01A 3A37A 1PUXA 1J09A 1EGQA 1KHHA 4MYSA 1XPJA 4OHXA 5E4JA 1QFJA 3L6UA 5EPEA 2R6R1 2BFNA 1ND5A 4B48A 3INNA 4CKEA 4LMBA 4Z7OB 2FGJA 4MIYA 3W5SA 2IFTA 2R86A 2CMKA 2AOTA 4Y8VA 5BO5A 5HRUA 3CX6A 1L4EA 1SIOA 5TDHA 2VWGA 3DJYA 4CMAA 1J00A 5BOSA 1XEWY 1WLYA 2FPPA 3DM5A 5E9WA 1G2IA 4FWTA 5BORA 1OPXA 4M0KA 3TJZA 1UP7A 4FGKA 1Y8ZA 1JA1A 4O1HA 4R2KA 2X42A 1V1RB 1NXPA 5CNIA 1XYGA 1R18A 2JBHA 3C39A 2M6KA 1JPJA 1XFAA 1BOFA 2PPLA 5HK8A 4P38A 5B7QA 1Q84A 2WQ7A 2AJLI 1SG9A 4LQCA 4UW9A 4ZO6A 5ALVA 1V43A 1LPOA 2RI6A 2F43A 5J2UA 3TLMA 2IK8A 4DR6B 3VRHA 1OH6A 2CWDA 4TQGA 3ZZ0A 4CM4A 2HK7A 1BN6A 2ZJZA 2B4RO 3PKIA 4GEKA 4LC1A 3I28A 4K9PA 3SS9X 4JN6B 5IDXA 4LG1A 3HBJA 1KEEB 3Q38A 2GDZA 2QUJA 4O33A 5TSDA 3SHTA 5CLJA 5CCXA 1AMOA 4PO3X 2JAPA 5KTNA 3CX8A 4WZAA 3S55A 3UMRA 3PTAA 3MMXA 1FIUA 5C31A 1KP2A 3SU8A 3UK2A 4AJIA 1YL6A 2A9RA 3AF3A 3RS7A 1T24A 3HYRA 1DJLA 3SKVA 1K8ZB 4U2BA 5JUWA 1BXGB 1C0EA 4FFVA 3HU3A 4JQYA 3VR4D 2AI2A 3Q6RA 2VKQA 1T2FA 4KXUA 2FN9A 3DCIA 4YRKA 3KWLA 4UNRA 3HJFA 1DC5A 1U0EA 2G9ZA 2ZTGA 4CF6A 2AF4C 4FR5A 4ZQHA 2ZDQA 5CCDA 4DMGA 1ZI9A 5AJVB 1QX4A 3C0KA 4RL6A 1RRVA 1Z0IA 3D5TA 1KI2A 3OJFA 4FZJA 5E4YA 4D99A 4OHVA 5B6IA 4NU0A 5IAGA 2W8ZA 5FA6A 2VQ3A 3KQTA 4ZGGA 1B6SA 1MA3A 2WK1A 4JMPA 7REQA 4TOIA 4LF9B 5EP1A 1U1GA 5GGYA 4MA5A 5DOZA 1O77A 3DVRX 4I4NA 4HJRA 2B2CA 1HH4A 3T38A 2XUGA 2DUNA 3PUJA 3NP9A 4WINA 5HKBA 3KALA 1NR1A 4RY2A 3V1TC 3LUKA 4TLAA 3VA7A 2QYTA 1ORHA 3QUBA 5TMBA 3TL2A 5JH7A 1PGPA 4WKPA 4Z4EA 3A9SA 1JE0A 4RH0A 3G2LA 1H9BA 1Z37A 3LLCA 3PGKA 3BDAA 3I5YA 2FSSA 4QIHA 5AHWA 4CE6A 1XIVA 4HRYA 1BE1A 2Q5IA 1R88A 3NG1A 2CCGA 3QBDA 1AQLA 1BMFD 2WJGA 4A1OA 2FW1A 4X7PA 3TE6A 4EUNA 4BRUA 2HMSA 3BCUA 2PX0A 4UUQA 5C4GB 3TTWA 4LHVA 3ZLBA 4BP8A 1DZ3A 3U0VA 3NTLA 3KKLA 1IFXA 3U4MA 4MYTA 3H2SA 3M4JA 4R2HA 3CS3A 1CJVC 2AHRA 3E7XA 1F51E 4FI3F 2LDBA 5BYBA 3BF8A 3J80A 4HH4A 3LRXA 5BRNA 5DYYA 3CKKA 4G6ZA 5CK4A 5IMBA 2Y1XA 3O8NA 4XVCA 1P2SA 4YALA 4MQMA 4YBZA 2J59A 3CLSC 3ZCRA 4JXJA 1LSSA 1YCGA 3WDMA 2JRCA 1KQGA 4KJXA 4C0XA 4AZ3B 4YEDA 1VLQA 4Z4YA 1EK2A 5K8CA 2BHRA 1DKPA 3LT4A 4PRZA 1E60A 2WKRA 4HZUA 1T5EA 4K9KA 3GGPA 3O2JA 3V32A 4EENA 3IQXA 1V45E 4GP9A 4XL9A 1DKNA 1BXRA 1NAHA 4IBOA 4MQLA 4EZEA 1Q3TA 3O93A 2VJAA 5IK2A 1DRKA 1FRQA 2HJRA 4R81A 3I6IA 2K5UA 1LVHA 3DUFA 5ED0A 3QVUA 2QTHA 2B83A 1UXKA 4F2HA 1FRFS 4HNHA 1VMIA 4UE6A 3KHUA 2VSXA 2VC2B 4A7PA 1HM5A 1Q82D 4ABTA 1NRKA 2ADMA 3UHOA 1XYYA 1JN0A 4HUQA 4BJ6A 3K32A 3NWOA 1BH2A 2IJGX 2BRUC 4DBVO 4EH1A 2N42A 3TDMA 3NGMA 1UBFA 2HQOA 4X7MA 1LK7A 3H4VA 1TMKA 3KFVA 3VKFA 4KXXA 4LE0A 3MTGA 1KY5A 3UK6A 1X7WB 3HVIA 1PTJA 2WC1A 1DG3A 1LDEA 3HCDA 3QPAA 3NHAA 4KQIA 4LZZA 1L4YA 4IX1A 4PEVA 4E6PA 1LFDB 3O8QA 3E3OA 2P9YA 1UAGA 2C5HA 4GOMD 4JL6A 4YPFA 4RTRA 1EHCA 4MWTA 1TC1A 5GQSA 4OU4A 5D5QA 3SYNA 5AJHA 1E7RA 1YS7A 1EI9A 3H3JA 3DE1X 3P0IA 2BRUA 1OA1A 5BVGB 2AZTA 3K2QA 4IGAA 2CLFB 1WVGA 2KI5A 2QNRA 2ZULA 4LXUA 3FCOA 2QEXB 2IHNA 1J56A 2ICAA 4RCZA 1E4OA 1TMYA 2OKGA 3B6KA 4G6IA 3QWAA 1Z75A 4NU6A 3RV4A 5HIIA 2AF3C 3ZV4A 4OX9Y 4L0MA 3HRKA 2XEDA 4KFCA 4QC2A 1OLXB 4LC9A 3OQMA 4OFZA 2EFHB 5JSQA 5BSHA 2E6UX 4OA8A 4XQ0A 1FDTA 4BMOB 1FFHA 3U40A 4KR6A 2NQ2C 5IXJA 3D6JA 3UG7A 3RVKA 3IUPA 5T6BA 4UQPA 1CJUC 1KMMA 4NYJQ 4R31A 2BHTA 8AT1A 1VJCA 1XA4A 1YVRA 2RHOA 3UWDA 4LF8B 2DOGA 3OKXA 2NZJA 3SM3A 3GEHA 3ONUA 4KWCA 4KV7A 4B34A 3NETA 3M49A 1A9YA 2CL7X 4WJZA 3TI7A 3SKYA 3SG0A 3RVDA 2PUDA 1HSZA 1T36B 3CTPA 4ZWNA 2AG6A 2XH8A 1U4OA 4AMGA 2ZW9A 1J07A 1TJYA 4LJ5A 3Q2KA 3U5ZB 4QOHA 4ODIA 5KWJA 2GCPA 1ECJA 3K9HA 2R1VA 3I30X 2X9QA 2VUIB 4PC7A 2I6SA 3AR6A 3H2GA 3HYNA 4LA4A 4LTMA 3KQNA 1P5HA 4PNEA 3JSAA 1VKJA 3LUJA 2R62A 5ILGA 4EAAA 5AVWA 3OIWA 3TG2A 1EK1A 5TQ0B 1H0SA 3H2YA 1NBAA 2DG2A 4GC5A 4PVCA 1J25A 1KO8A 2O2DA 3AEUB 4RV9A 1AK9A 2X1VA 2X15A 4ITVA 4CR7A 4RULA 4EW6A 1CQWA 4I7EA 4E0BA 2C8VA 2X1HA 4UM8B 2BEJA 5B30A 3JZIA 3E15A 1D1NA 1L5SA 3AINA 4HEA1 1GADO 1R3DA 1E9AA 3ITDA 4N6OA 3K0AA 3CUUA 3V4LA 1W0KA 4RMJA 4C7BA 2MOKA 4BZZA 5JMPA 3I9JA 3WHIA 4KMRA 2C8JA 5IARA 1CRLA 3ZU3A 5B55A 2PLFA 2PWAA 1UKBA 1N7IA 1ZGZA 4L9WA 2NSYA 2V03A 4QUAA 1TCVA 2A6PA 1PV4A 1IQUA 4X92A 1QRTA 1S96A 1W0JD 3IVCA 3B8HA 3A2LA 1F5NA 4MQEA 2GGSA 4X1YB 3T6KA 4UUPA 1YRQA 3NANA 4YC7A 4RBNA 2EHDA 1VQ6B 4WBNB 3TOSA 1MB0A 1MQAA 2JLBA 1NYRA 2R85A 4H31A 4WZ6A 5BY2A 3IEVA 3JQAD 1E20A 3NB0A 4CODB 3ZD8A 3D81A 4Q3NA 1RXCA 3EQZA 3O4JA 1U5BA 3DAGA 4UDYX 2AZXA 3CC7B 1C8LA 2Y3IA 1GGHA 1HKHA 1NMEA 4MK4A 5EUQB 3GGDA 1EGHA 3CF4G 2W9XA 3L6CA 1XZGA 3JW8A 1RZRA 4XLZA 1PYOA 4AF6A 2FW9A 1MDBA 1Y0BA 4NYIR 3HYSA 4NWIA 2BEUA 4PYJA 3EGXA 3JVUA 2HKIA 1MLDA 2GNPA 5IF9A 2OD9A 1U2RA 2QTWB 1L5HA 3HXOA 1EFHA 1E9SA 4LWPA 4BXOA 3Q7IA 5FQOA 3WAGA 1EKXA 3IJ5A 4IOKA 3QXHA 3C3DA 2QRLA 4BO9A 1XZEA 1I18A 1XNRB 3MYRA 4I9GA 3MINB 5AFSA 2QP9X 3F8SA 2DSNA 4TKOB 3EDMA 1ZJ5A 1PU2A 3V1NA 1GLVA 3CYFA 2G25A 4R1UA 4I81A 5DK4A 4GF5A 2ZWPA 4HMOA 5JWHA 3PDUA 5EZ6B 4PAAA 4AP6A 3QFFA 4FDAA 2WA1A 4IDNA 2Q3EA 2F3SA 1E2FA 2ODBA 3QQ5A 4WOBA 5K3FB 1GXSB 2XKJE 1Z5ZA 2VI5A 1E3ZA 5HUJA 1FSPA 3OEWA 4H6PA 1UD8A 1RT9A 4MRMB 3FTCA 3GUHA 1NPYA 1V35A 4AG6A 3DF9A 1H5QA 2ONYA 3EQ2A 3TOVA 3OO0A 4FFLA 5EHGA 2O0HA 4F93B 2BUCA 2VVTA 3ROPA 1L5LA 3M82A 1KK3A 2TS1A 1ARZA 1SCNE 1TEVA 4WNAA 3ICQB 2R68A 1XG5A 4LHXA 3AEZA 2C2XA 4QUGA 1MAAA 2VJBA 4UDNA 2I4MA 5B1EA 4QTYA 1OB0A 1FMJA 3R9XA 3RI3A 2D3NA 1W30A 1HNWB 1P2VA 2B34A 2QG6A 1U80A 3CZQA 3LK6A 4P12A 4Z7QB 1JKIA 1TE2A 4XM1A 3DS8A 1EIZA 3E53A 4DA0A 4QBGB 2VBIA 3GDHA 2IYOA 3OTWA 1XXHA 3KL9A 2P62A 1M2HA 1GZDA 2A14A 3G3EA 4BV2A 5E6TA 3PHJA 2X14A 3VQTA 2CNDA 1U0GA 4FFMA 2XJ4A 4X45A 2WIJA 3LWZA 3GCXA 4D97A 1C9JA 3O4IA 4P83A 2Q99A 1H3NA 3A1TA 2PAAA 3QKWA 4L02A 1E8MA 4Z0HO 1WUKS 3LL7A 5E1DA 3MHPA 3UUFA 3T3OA 3FOBA 3TD2A 2OV6A 4EFKA 2VZ8A 1JQ5A 3EXFA 3OURA 2E37A 1J2UA 2BGWA 1NR7A 2J09A 2BL4A 1PL0A 3ZD9A 4RHFA 1X6VA 4CMIB 3E84A 4ETWA 2PJRA 1VBFA 3C7AA 3C3WA 3ZOZA 3GFRA 2Q2VA 4OXXA 3MAAC 2FOIA 3OMLA 2JJYA 1MHPA 2WPDD 2E4ZA 1N36B 1PO7A 1ODCA 2FQQA 2RHCA 1A7UA 3O90A 4RNCA 1V9SA 3V00A 3HG7A 3VHXA 3WGQA 1C30A 1ZGJA 2WW8A 3O4GA 4QG7A 5ALNA 2EX0A 1NUHA 4Q9DA 5INTA 2N47A 3ST7A 3INRA 5C8DA 4ZO8A 2HJWA 5HSGA 1JEYB 5HCNA 3RFTA 1FYEA 2EHJA 4GP6A 4YJDA 4IIJA 3IV7A 1U8XX 1JNXX 1H22A 3UWPA 4JJEA 2BONA 1KE1A 3AUUA 3UF0A 1YOVA 3UJAA 1DRJA 3C2QA 4NK4A 1P17A 4LQDA 1PLLA 1XCJA 1L3BA 3A35A 5AI4A 3PL5A 3ZQ6A 5A3RA 1Y1TA 3RVPA 3SOZA 1N2SA 3DOFA 4ZVNA 1SC1A 3SJ7A 4I6GA 5I7RA 2ZM5A 1PZEA 1S0UA 2PIAA 1Z29A 2VUTA 2BDEA 2XQIA 4AURA 4ZN6A 4ZVKA 3CGGA 3WLHA 2OZLA 3DOEA 4AP5A 4UM5A 2XNDA 5DM60 2JCVA 5F3WB 5FWDA 2I03A 3ZWNA 1U7TA 2QJTA 3KZKA 2P3LA 1UD4A 1TT5A 1WOMA 1YDGA 4DEVA 1KDYA 1O54A 1XJQA 3OLYA 4RZ2A 4RY8A 5SICE 1PUIA 3GL9A 3RAGA 4NXMB 3FZQA 1V4BA 4L0DA 1QQTA 4OK6A 5FUVA 3HWSA 1V4VA 2J9ZB 1JBQA 4UNNA 5J4HA 1UADA 3AH8A 3H5RA 2C4HA 3RB8A 5IAKA 4XLTA 2ZAIA 3BF7A 4AIRA 3KQUA 2FVGA 3EISA 4EA9A 1G9TA 2QTNA 4WQMA 1N5RA 5DYNA 3W3AA 4MQFA 1EFVA 2J5XA 5JS7A 3H11A 5I8WA 1NW7A 3KKMA 4KMMA 4YJHA 3SJBA 2CDNA 2C54A 1RLOA 2VHVA 2QM0A 1UQRA 3AEQA 3L5KA 3LLMA 3LP8A 1P62B 3GIWA 3WLQA 4LUCA 4PAWA 4TKVB 5D3KA 3H2JA 2EFJA 2WEKA 4G41A 4A2PA 4LOHA 2DECA 4IEEA 3H9JA 3H7IA 3NM4A 5BWNA 1S3IA 5G1PA 4WAUA 2HTEA 2J48A 4IDBA 4M8KA 3WXMA 1KZYC 2WYHA 1JKJB 2B37A 2BCEA 1JFSA 3ZR4B 4J4TA 3AVWA 3DO5A 2E5WA 1E6EA 3MTDA 4FNOA 4EF4A 5LDGA 1Z5UA 3JVEA 3HKEA 1M10A 3BK1A 3G5AA 4UAJA 521PA 2HMAA 3HADA 4GE3A 4CL2A 4D8TA 4DN6A 4IJVA 4U2KA 5BT8A 5FBVB 1AF7A 2QL6A 1CEEA 3GRKA 4ZI3A 3T4EA 1PZHA 4OHWA 1XTUA 1EP9A 5D51S 5H0IA 1ZGAA 2VDRB 5FHQA 3GRFA 3IPCA 4UTXA 4N76A 2P40A 1PJQA 2VJQA 1KDTA 1N1DA 3BILA 2OECA 1YB1A 3SHFA 2C7PA 4BE9A 5GJBA 1FW6A 1XPOA 4F3TA 2M1ZA 2B1IA 2GF2A 2D2EA 3KR0A 3OFJA 5FO1A 3R24A 2CHEA 1UCFA 3FWHA 4FSXA 2VWQA 1ORDA 1PJBA 1RDFA 1MRNA 5JDCC 1K88A 4MWBA 5ERXA 3PNKA 1TEXA 3A26A 4MUYA 1FE8A 1HTWA 3OH8A 4TV9F 4DV0B 1RQLA 3GGGA 1RBQA 2XB4A 3TEMA 4C0JA 1YWGO 2VRCA 3QPVA 4MJLA 4PQGA 3RNLA 2C7OA 2CXXA 2XCTB 1GCOA 1Y5MA 3VKUA 4CI9A 4DCGA 1JHXA 4HDCA 2GN8A 4PONA 1USIA 4II3A 2ZRFA 3MFQA 4D5EA 1DAMA 2P9GA 4WWVA 2XWBF 4IVNA 3O1HB 4DLLA 3QVOA 5JDCA 1A71A 4MDYA 2GA9A 3IOYA 4OG2A 3VPFA 2ZRQA 3C5WP 1DC8A 2GZ1A 3MEQA 4MP3A 1LNZA 3ZGYA 2EWWA 1I13A 3G2MA 3GLTA 1M33A 1Q83A 1Z0DA 4PZYA 2GHIA 3BWXA 4HFJA 1IUOA 1DDIA 4MMXB 4L78A 3HXPA 3RGWS 4PQRA 1CZLA 2YCBA 1YU9A 1TADA 4BBAA 1TC2A 3W4JA 2IDZA 3D6HA 4C88A 1VJ5A 5GVSA 2Z04A 1FDSA 1SXIA 4PXYA 2JGAA 3UAZA 3ZCUA 1GA1A 3OX3A 3QUSA 3HRIA 5SZJA 3WNQA 2IXBA 4ILEA 4I5DA 5DYWA 3NBYC 4UHCA 1BCRA 2X4LA 3WNVA 4XX1A 3N2ZB 2ZUTA 3ASYA 3STXA 2MR6A 1UZNA 2VNIA 1X8KA 2OHJA 2WTMA 3WKBA 1G4UR 4MJ7A 3ZWYA 1CY8A 3WJAA 2Z56A 4FZ5A 3DR5A 4GOKA 4HDMA 4NOKA 4PF1A 2NP7A 2O2EA 1BD3A 3NBUA 821PA 4X8MA 1BS9A 4JR0A 3HJCA 3UCFA 5CA1B 1IULA 3BD7A 2P5SA 3UA3A 1I14A 4XKWA 4CQMA 1NW5A 1FX1A 2E21A 5F76A 5GONB 1GPBA 3N6RA 1Z6ZA 1ZP6A 1E8DA 2CVHA 3OAAD 4JLMA 2EP5A 1YDMA 1JU9A 5CTAA 5T4HA 1NUPA 4W5RA 3E2PA 3JALA 1U7WA 3KZCA 3PUYA 4TVOA 4CI0B 5IUNC 2O8FA 4G2NA 2NOAA 2V58A 4HEA6 5IKOA 4CRWB 4EW3A 4UJ5A 2Q62A 2G17A 2B6HA 4WCFC 3RSLA 3U0BA 4C0KA 5EZ5A 4DM4A 3U09A 1H3EA 2PVCA 1HE8B 3HWWA 3PR1A 3SK0A 2YWFA 2XEXA 1OOEA 4HNAA 4MLDA 4OLHA 3TRHA 5THQA 4OQLA 1D09A 1K5GA 2J3IA 4K9SA 1HORA 4UDOA 1ZCFA 4RESA 1HLDA 1SIUA 4N5NA 5F1OA 1TW2A 4CG1A 4F3KA 5GY7A 5DASA 2ZUBA 5CBPB 1L4FA 2HJHA 2MYNA 2Q41A 4YS6A 3TVDA 4C7XA 2E82A 4LBVA 2O8EA 2ZWIA 4CV3A 5IG2A 3GJ6A 2BJHA 2R84A 4TLBA 2Q3LA 2ZRDA 3PEWA 3MAGA 4FD3A 1REQA 1Y1LA 5ABPA 1NJFA 2I76A 4JOSA 4WCFA 2GXAA 4UFPA 2H2AA 2WM3A 1OH8A 3NH6A 1MAVA 2IYZA 3RASA 4KNWA 2HCRA 3EDCA 1LD3A 3JATA 4QNMA 2QPLA 1XDBA 1LUAA 2BF7A 4ZRNA 3SYTA 1ZD4A 5LYJA 2E49A 2WV7A 4EG6A 3MJTA 3AETA 1VFNA 1YJNB 3QMMA 5DX1A 2OPHA 4DGSA 5EN4A 4URZR 1NP3A 3UAOA 2GARA 3ANXA 2PWBA 1XQYA 1ZM9A 2HCBA 2JEOA 3TOZA 3ICPA 1QHYA 3CH6A 4G56A 2A58A 4KQGA 2ZRPA 3AHGA 1N9ZA 3GQVA 4HNUA 2IEDA 3ZDDA 4CUKA 1E4VA 1JJIA 2BI8A 3NDBB 3OPVA 3HJHA 1A96A 2ZRCA 4PGMA 5KQPA 3DBRA 2RDMA 1M8JA 3DVQX 3HB5X 4KGVA 3V6LA 3VJKA 2IYQA 4AMBA 4D6PA 4MCAA 3TW8A 2WE8A 2JIOA 2IPMA 4NS1A 2G67A 4DBZA 2XVAA 1GKIA 2OXEA 2J8ZA 5DWQA 1MJGM 3KSUA 1GNRA 3PPYA 5E6RB 3V7UA 3GH1A 1A50B 4M76B 2V3WA 2JD1A 3VC3A 1E0KA 1FQWA 2DBYA 2XLCA 1CEYA 3WHPA 4WBXC 1RWKA 2B4YA 3EYWA 5GP1A 1QH1A 1WMAA 2PGDA 3MGAA 1Y37A 2BBWA 2H2GA 1QYXA 5PNTA 1NQOA 3TD9A 1EE1A 1T5LA 2VBFA 4A6XA 2QD2A 1DOHA 3QBJA 1H6DA 2FZVA 4D3SA 2X0IA 1XZAA 2G06A 1WY7A 4I5EA 3QBEA 2WLSA 3H9GA 1FRNA 3PDWA 5EP3A 5JFOA 1R3UA 1EUYA 2FSVC 1ZIYA 1M2JA 1P3Y1 3CH5A 3BHNA 5LUBA 3G0HA 1Z6GA 4FCCA 4YMGA 4W9MC 2POCA 4BS9A 2DLNA 1Y5NA 3S29A 3Q11A 3ETNA 5I9BA 2QX7A 3A36A 3DEJA 3F5QA 5GPBA 3EIUA 1P6UA 4H6VA 2G71A 5D3MA 3F6SA 3K5IA 3TR5A 5CB0A 2VNKA 1TCBA 2O2HA 4K03A 3KG2A 4GICA 2FSVA 1HTTA 4B4OA 3OE1A 5REQA 4BNUA 1M76A 3E8MA 1A8SA 1N7HA 4QPJC 1DWOA 3H9CA 4UAVA 2VZEA 3KJNA 4OL0A 2BBTA 3OJLA 3KVOA 3PFWO 3WIUA 4BLRA 1G38A 4DUGA 4PLCA 3KUXA 5IF3A 5J2TF 2V6JA 1EHYA 3BULA 4MUHA 1KKMA 4PAGA 5CT6A 2ZM6B 1JH8A 6ADHA 3EVBA 3W2EA 1R64A 1J5XA 3EJWA 3H05A 4KQMA 4YQZA 3LHKA 5KOHA 5KVCA 5C53B 3OZXA 2OO5C 3ML1A 3UPDA 5IHPA 1GZ7A 1RWNA 3A4NA 1QRDA 4AZ0A 2K6GA 2ACVA 1GPH1 2QLLA 1IY1A 1HZJA 5LZ9A 1YMUA 4DZRA 4EG1A 4DVJA 3STTA 3TPFA 2G3YA 1PSZA 4KQWA 4MRVA 4RMIA 1F6BA 1SBZA 2O1SA 4BNKA 2WWIA 2H3HA 4RPLA 2DKNA 4CCSA 4X41A 3QKUA 2XUQA 3PGA1 1P1KA 5AJWA 3TTXA 5ES4B 1JEAA 4G0MA 2C83A 4KKXB 3BBPA 1CX9B 5JPDA 3CF2A 1ESCA 2OO5A 4EHBA 3UYKA 5DSZA 1YRHA 4YUXA 2AD1A 1JEJA 4RFVA 1B2LA 2F1OA 2PYDA 4HWSA 3VX4A 4D4JA 3JPWA 2NTEA 4G5YA 3UAGA 1H9CA 4EJSC 5ERYA 3V55A 1O5IA 2PK3A 3WB2A 4ZYXA 1WULS 1UM8A 2VG8A 2F3PA 3G88A 1WPQA 4QEKA 1JQJC 1DINA 2L42A 3R7WB 3RAPR 4G26A 2WJIA 2FPKA 2OOKA 2MSKA 2YC2C 3LYAA 4FGUA 1K8XB 1TRHA 3FSGA 4C1NA 5AESA 2WSMA 3T7EA 4JS0A 6PFKA 2HEIA 1YQGA 3EIOA 2RGNC 3DWFA 4M98A 1W0CA 2W8BA 4KK3A 4C5AA 1AV6A 3CM0A 5EZYB 2VQDA 4P33A 1AE1A 4Z2YA 1SWVA 3LXXA 5BSMA 2AFIB 1W5FA 3DFZA 3TSYA 3BKXA 3MRSA 4EJSA 2QYHA 1MAWA 3UHFA 4DXHA 3JX9A 3E3LA 4WV3A 1JEEA 3H75A 3R7LA 1RAGA 1XE1A 1THZA 2VDWB 3HY6A 2ILTA 3F3SA 1N6NA 3BH4A 1X14A 2FN3A 1VM6A 1CEQA 1IB0A 2PX2A 3HUUA 3HLKA 3L79A 3S8YA 4O0LA 3P97A 2RGNA 4RQBA 4AK9A 1KR5A 1XE3A 2P79A 4PTLA 4GOJA 1HFWA 5E1MA 1L6IA 1YS4A 4M1YA 1WS6A 4LYJA 2RGCA 3NE5B 3R3JA 3ZNPA 5KYTA 3O4FA 2W37A 1ONPA 4P7BA 2QRUA 3AUFA 3D8BA 4XQ9A 5FUYA 5CG2A 1QQAA 2RK6A 4EQZA 4DPKA 2X76A 1EAYA 3O94A 4DIFA 3G71B 1V47A 1KTVA 2NPFA 1ECFA 1KC1A 3GVIA 4YFYA 1V9CA 5I7SA 1IMJA 5KOJA 3RSZA 1G18A 2ATXA 1MFPA 4R05A 3WLKX 3FNEA 4XR9A 1X7DA 4YUWA 4IHJB 1K7EB 1U2ZA 2EJCA 1IOZA 5FT9A 5LQNA 1T4CB 1JHPA 2HSZA 2QMQA 3HJRA 3QVTA 1BS2A 3AR3A 1NBWB 3NX4A 4FUQA 1CE8B 4JT2A 2VP6A 1XRPA 2VJPA 1BW9A 1OFUA 1ZAKA 2QRMA 3DXFA 3L0BA 4MJ3A 3U7QB 3LHIA 1C3LA 3U7RA 4GYKA 4CN8A 2QN7A 4LJ6A 5DNAA 1JEOA 3RRNA 1EJ6A 2XD9A 2ZJ3A 4N6GA 2AZMA 4PIMA 1YE8A 2VRNA 1RC0A 1EGVB 3EVAA 3CX7A 3QW2A 3H5NA 2VYQA 2BKVA 2CUTA 4IIHA 3SXPA 3TQFA 1FTGA 1RZVA 4P36A 3R7FA 4ENTA 2AMFA 2PRIA 3WLAA 4RPCA 3G1TA 2VBTA 4NCBA 4F2GA 3AVVA 1XVLA 2WFLA 3KZVA 3AQ4A 3Q39A 3LQRA 4U6QA 2P9QA 4UM9D 4L8FA 2XRMA 1TVCA 1XD2B 3V8EA 4E14A 5ICEA 4J3FA 2P35A 1E2NA 1EWKA 2PS0A 3WS7A 4YHHB 1R6UA 1I2AA 1ZESA 1RHKA 3AVPA 3I9NA 1ACMA 1WZCA 1L4UA 3FAKA 3E2IA 4KI0A 3R7AA 3I09A 4RTOA 1RRCA 4MGIR 1H2BA 3HV0A 1TKBA 1LI5A 2FWJA 2IZOA 4OVKA 1L6RA 5DCYA 3GUUA 3T7IA 1KQFA 4Q4DA 5J5CA 1SVSA 2UVDA 2YXBA 2IXAA 4MDFA 3L7YA 3Q0EA 1P2DA 2CUNA 3AK4A 4O5OA 4KACA 1YULA 5IM5A 3FNIA 2G4VA 5JNSA 2H5JA 2ZSHA 1TM5E 1G8MA 1KH2A 4B6RA 1T2EA 1JXOA 1XQVA 3ZY6A 1G20E 2G76A 4GUAA 3KOWA 4BKMA 5HFJA 4ED9A 1FDRA 2ZRHA 3CO5A 1BVUA 3HEMA 4H1UA 4OV6B 4CLOB 3BZWA 4OFXA 1HMPA 2Q6VA 4FNGA 2J9FB 1ZIPA 3F1LA 4X66B 4TUYA 4MUBA 1G7TA 2GCGA 3E70C 3G23A 1M2NA 5JC8A 4YV7A 3DVLA 1GZ6A 4H6WA 5AHKA 1Z0FA 2XYGA 1YJWB 1BXKA 2CXSA 2OK8A 3KQQA 2NW6A 4QGHA 4EKYA 3BMQB 2EL9A 2QD4A 4TXNA 1OMOA 5DI3B 1GRCA 4OHRA 2IUYA 1WHSB 3VSCA 1KFKB 3NFYA 3PPIA 4ZEMA 1A27A 3ORHA 4X6UA 4AN1A 5LU8A 3MYYA 1MTZA 1Y3AA 4XUCA 3VU0A 1U98A 4ENUA 4Z7NB 1J9ZA 3KUUA 1JR3A 1Z36A 3O3NB 3ZLTA 1RXWA 3FUTA 4PLPA 5I4KA 2EKPA 3GZNA 5IAOA 2P0EA 5TX7A 1EFKA 2HSJA 4HADA 2NO9A 3D2CA 3OCVA 1R0ZA 3FVTA 1IHYA 3NVAA 4CPDA 4RC9A 4DA6A 2QXUA 5JD4A 2CFOA 1W6RA 2EQBA 4ND3A 1UUFA 3NNSA 3P0EA 1MRZA 4Q3AA 1UPFA 1ODLA 3MK31 1LTHR 2O8FB 3SZUA 4CM3A 1J20A 2XUDA 4JJ4A 5ADWA 3H2BA 4FOLA 1E32A 3TPZA 1WVMA 5AW3A 4B85A 1P9RA 2XSZD 3IR5A 4QWMA 3L7AA 4QVIA 4ML3A 2PMCA 2DWUA 2B99A 1G16A 4BO6A 4DYHA 2AN5A 3L7KA 3V5NA 4ZDJA 5B53A 1KFBB 2GEBA 2E5FA 5KVSA 4IS3A 4M9UA 4F8EA 1H4TA 3II6X 5IWCA 1Y5RA 4G0YA 4M0CA 1RQPA 2W6ID 5GWXA 4UTRA 4LE1A 2X5KO 4LRSB 5HVNA 2GAFA 2HMTA 5AJYA 2C0CA 1TK2A 4RTMA 3ACDA 3H5TA 2RKWA 3MMZA 3KDPA 3DL7A 2QLTA 3VC1A 4FB5A 3A1CA 1C4KA 5K4AA 4RQAA 1QKIA 1U8FO 1GEGA 1N2BA 2YVUA 3HU5A 3RC2A 5ITZA 3ETCA 5KHLB 5M7EA 5DHFA 3PT9A 5B7GA 2VPPA 4PHGA 2CMGA 4F86A 1CUDA 3ONYA 3RK1A 4E5YA 2ZIAA 3HB9A 4J9VA 2GZMA 3EIXA 3QG5A 4QFCA 1RABA 5CYPA 4B76A 3VVCA 2RAUA 2B35A 2XB2A 1ISMA 3WICA 5LKAA 3UA4A 5A03A 3ADCA 5A4DA 1GJRA 2BE9A 1RM0A 1C0KA 1DOZA 2GI4A 2CJFA 1OKKA 2HF9A 2IXDA 2QVZX 2V7EA 4WXMA 3RS2A 3RUFA 2XQJA 4M0UA 5LC1A 3FPLA 1BGWA 2CL0X 1KL7A 1GV0A 1HE2A 2JHFA 2QL7A 2CJWA 2ZSUA 5IJ9A 1K0UA 3SFVA 3W6UA 4RIEA 2JDID 3OEHA 1ZW6A 2FEMA 3M8KA 3B8EA 3OP4A 2FP4B 4FEYA 1YUBA 3PIIA 4FMCF 4LNUA 4EMBA 1HQKA 2NZWA 1GYRA 2PX4A 1DAOA 3L1VA 3QNMA 2EC5A 3C6QA 4TXHA 1SC4A 4KK4A 1W5TA 3T35A 4DMHA 4G5GA 4YRAA 8GPBA 1IVSA 1D5CA 4AN4A 2Y1OA 3TCKA 2VYCA 2DFTA 5AUNB 4XKJA 5AKEA 1MT3A 1PJCA 4Q4HB 4I6EA 2GLUA 3UB3A 4AO8A 2AXNA 4LYFA 5E7QA 2YV5A 4GOOD 4DLYA 1IN1A 2A1TS 1G21B 4P54A 1TLLA 4RZUA 3TAHA 5JAIA 5ARBA 3U44A 3FTNA 1QK4A 1WETA 1T8RA 4L6AA 3JZMA 4LSMA 2OBRA 3FLAA 1B74A 2P4QA 4EPVA 2IQIA 2YZ2A 3DDCA 3HS3A 3M2TA 3OOEA 3PD7A 3S5JA 1JNYA 4WK0B 3EBPA 2JRLA 2OBMA 3N0RA 1E2IA 4DIMA 3HCFA 1OFTA 3L7NA 1C8KA 4YJGB 3T3GA 4KR0A 5A4KA 4DLRA 3W5VA 4UBMA 3JQ8A 4XCQA 1GTVA 3H19A 5F9MA 2D8AA 4BVLA 4ER5A 1UWKA 4ZJUA 2FPGB 4ZQFA 1MV8A 3IE2A 4O4JA 2XTNA 4AZTA 4Y6PA 4CLRB 1R0RE 1YK1A 2BKEA 3T5CA 2PT7A 1E6MA 3ZYCA 4DY4A 1O5TA 4E2FA 2A4KA 3O84A 3NTRA 2ZXIA 2WWWA 3A11A 5HA5A 2B1GA 1MEEA 3UJ3X 3OZWA 4DREA 3UGJA 4C43A 4DR7B 2EJUA 3RR2A 3MCZA 1KI4A 5A5GA 4S1VA 3AXSA 1YL7A 4WXEA 1DS6A 1XQ6A 3V7AA 2XUPA 1OIXA 3ZUGA 5DXFA 1VPLA 3UC9A 4CDNA 2IOFK 1ZD9A 4I5GA 3R5JA 2X58A 3RBAA 2FG6C 2CZQA 3AC0A 4FYJA 5KWIA 2RI0A 3PDHA 2PUTA 1XOIA 2C20A 4NHOA 1YQUA 4OQ4A 2C77A 3RU9A 1H8EA 1TYEB 3AG5A 3KD2A 4ETMA 4MVJG 5BXYA 3QTLA 4NFLA 3E5RA 4EHNA 3F2IA 4LKOA 2FEOA 2PSHA 4NBNA 4D3XA 5FEUA 2OV8A 1U3CA 2GJ8A 2YHBA 1OFIA 3RKUA 2I2CA 3PJDA 4W6ZA 4TN1A 4DDTA 4E2ZA 1E1CA 3UJHA 3FKSA 3D64A 4EY6A 2IXTA 4Q7KA 3L6EA 1JT2A 4D9JA 1VPWA 4PZZA 1Z38A 5CDFA 3PUZA 5BN3A 1PT7A 2IH5A 1E7MA 1RWWA 4FT2A 4KAXA 2XJ9A 3GDGA 2O8VA 3WIOA 1TUBA 3DT9A 3UHJA 4Q1FA 5C3UA 2O9JA 4Y0AA 4KO2S 5ANRB 1NDQA 1NQVA 1ZRSA 4BPRA 4KV9A 4L57A 1H2WA 3IULA 4HAYA 1VJGA 3SJAA 4E51A 2GFHA 1F2TA 3MOGA 3R9IA 4O2LA 2ZT7A 3IEXA 4Z4SA 1H6BA 1BG6A 2VA8A 3AL0C 1L7MA 1NKSA 3HUFA 3ZY4A 4PV7A 3N2KA 1U2QA 3QY0A 4FMDB 4PXAA 2W2QA 4MV4A 2NTVA 4WLFA 5BRAA 2XVMA 4A82A 4LFAB 3HJUA 2B61A 4XORA 4HAIA 2O8CB 3CCBA 1JIJA 1ZBDA 2FMFA 4TLEA 4O4IB 1LI7A 1SPXA 2V7WA 4M1KA 3CCMB 1FY2A 1I10A 2BR5A 1CG6A 2CMDA 2FCRA 2I7VA 3NGLA 3ORQA 1XFOA 4IEFB 4TQAA 3WBJA 1GIAA 3OSUA 4QYIA 1DLIA 2OYSA 1V11A 4MUXA 3HB4X 2FWRA 4RZQA 4TYMA 1V7PC 1OZFA 4IIYA 3IMKA 1PWEA 3D7LA 4JLOA 1EXNA 2ECOA 4GNRA 2YIDA 1GGKA 2OE2A 3L8CA 2VNSA 4Y2PA 3B1WA 1HEYA 3I83A 5HDQA 2FAXA 3NHJA 3RWOA 3H5WA 1M72A 1OXBB 1OGYA 4IDEA 2LZJA 5EE1A 4JI8B 2QKYA 1Z4PX 1NX9A 4I9NA 1WBBA 1B76A 4M1ZA 2B7CA 4KAJA 4KSYA 1R5NA 1XK7A 3CLUC 1IOLA 4EKIA 3R6GA 1OY1A 4PBRA 5LMNB 1XAIA 2R66A 3P9IA 4M6WA 5C1IA 1UZAA 5DZSA 1NM5C 4CMJA 4JITA 3GARA 3R7DA 1N3BA 5GINE 5FBKA 4CTKA 2QQ0A 4I0WB 5EJGA 2V55B 4X1OA 4B3FX 4MPRA 2J3DA 4F04A 5JQGF 2RBEA 3T9AA 2VP3A 1NBME 3OFND 4YDRA 5HFNA 4RHYA 3TOCA 2LE0A 5AOCA 3BZUA 3OZVA 3D3WA 4ISBA 4M9ZA 1NB0A 1SUIA 1R4MA 1XFDA 3IBTA 4MDHA 4PR3A 5EJ8A 4RO0A 3KDAA 4Y67A 3R7BA 4CU2A 4EFDA 3GN2A 1E18A 1NM5A 1TLTA 2RKBA 3RBVA 1PEDA 1ODSA 1ZNQO 3TFWA 3CE9A 1AKNA 4QULA 2RGEA 3SD7A 1R00A 1U8YA 2E85A 3GFOA 4DSTA 1LVGA 2ERCA 2ZRLA 1M6YA 4NC9A 1QE3A 3EA5A 3FJ1A 1PGOA 3ZLUA 4ALJA 1P6XA 4PCUA 4V39A 4N0QA 4FUTA 2HZ7A 1HL7A 3BCDA 3GJQA 1FYXA 3FH0A 4O2RA 1Z0JA 2RAPA 4P4SA 4IHKA 9ABPA 3O95A 2P5UA 3Q7PA 2A0FA 2Y1WA 3OTQA 4MUIA 5BUCA 1YF3A 4PYRA 2UUPA 3CSDA 3T3PB 3L4SO 3M5DA 4RJTA 3X3HA 3T1HB 3A1DA 4D4GA 1UP4A 1VQ5B 1RAIA 3K9LA 1P75A 1S2NA 2RG1A 4Y9DA 3SX4A 3WMFA 1XSEA 2NV2B 2OD7A 2OAGA 1P0PA 3Q8WA 1RPJA 2DPXA 3L7CA 1CY7A 1YUNA 3Q12A 4X1IA 4Y18A 1P77A 1RLIA 2E18A 3VR2D 3G9TA 2O1EA 3V48A 4EECA 1PT9A 2VHEA 3BIJA 4PN7A 3U4QB 1YB2A 2BJWA 3BL8A 3RUEA 3QVGB 3N2EA 1BHJA 2G0NA 2D74A 1LPNA 2IX9A 3KK0A 2UZIR 5CMLA 4PE5B 1EX9A 1G19A 3CN7A 2B3TA 1OASA 1RRGA 4RANA 2UU9B 4C07A 3C1AA 1C1HA 2QX8A 2ZIGA 5BQXA 2XKAA 2GEFA 1YT5A 2F48A 4B3IA 3K70B 4AJJA 3JASA 2XZLA 1K6IA 1W4LA 2R11A 3ELBA 4O8ZA 5CM8B 3W8DA 3ZWDA 1EUCB 3T15A 3CTAA 1V4NA 2NSDA 2WYIA 5KKNB 2A5GA 1YAJA 4JL5A 3N7UA 2ZOSA 4QVKA 2V6GA 4IQGA 1LBSA 4F5YA 1LRJA 2WINI 2CW5A 4HAOA 1AQ6A 2VIIA 3CNHA 4JEIA 4OYYA 4RTSA 1QG6A 2OUIA 3T1NA 4CIYA 5DM70 3C6KA 3THYB 4YCMA 2YOFA 1OX5A 1LKZA 1G4HA 1OYWA 3AY0A 4HE5A 5FI0B 1P7ZA 1CDEA 2P6UA 2DJIA 2A9VA 3R6TA 5JCZA 1VRCA 4BB9A 1CY2A 3SZ3A 2PWPA 3N0WA 3GNTA 3U7JA 5JR3A 4NBSA 3BFPA 1Z5VA 2D1RA 2Q3DA 3QU5A 4HRXA 4XGIA 5JATA 1TRKA 2F3QA 1I7NA 2P2LA 3EXG2 1QVAA 1NRWA 3OMXA 4OQZA 9GPBA 1AZWA 3MWDA 3W3AH 5C32A 2OZVA 2EBWA 3QA3E 4M1WA 1TZKA 5TE9A 5E9JA 1OGIA 1Z25A 4NY1A 4QBTA 4MNTA 2PBRA 3SR3A 4S1TA 1H2YA 1U0FA 1TJNA 3GJ3A 4FI3C 2F43B 2FEXA 1K7XB 3I58A 3QXJA 4G1EB 1Q81D 4W99A 4DCCA 1QGUB 4C3ZA 2BGUA 2PJDA 5TQ2A 3SX0A 3WIVA 4ZAZA 5ETJA 3T5AA 1BMTA 2J30A 3GJRA 3VR6D 4Y9RA 2NZXA 1NHGA 1V8OA 4OIFA 3TMYA 1GDTA 1GRVA 4E30A 1W19A 2XQGA 3MMSA 3A4TA 4L76A 2ZJ5A 1HT1E 2WU4A 2P2YA 4Z2AA 3C7DB 1UJCA 2I4OA 4BQEA 1KK0A 1WXXA 3C8HA 3DUWA 4WZAB 1WCIB 3KT3A 3R5SA 5DEOA 3ZEIA 1X1SA 2E0IA 1Q7BA 1ZGCA 1QO0D 4Q7LA 4U4AA 1WZIA 1FP4A 1G8JA 2WP0A 3VNQA 2VTBA 5IPFA 2BFWA 2GBFA 4BGUA 2BHLA 3M2PA 5JRDS 3UWKA 1XRRA 1HOXA 2P30A 2WM2A 3WLPA 3IUEA 4R98A 3Q9LA 5EMHA 3DT6A 3QKTA 5FBRB 4AKSA 4QXQA 2IOQA 4Q1BA 4OHZA 4DJEC 4UM7A 5JMWA 1N92A 3L46A 5BW6B 1R0SA 3UFXA 4C7KA 1EM8A 3KQPA 5K3CA 3NP7A 1JU4A 3KYDA 2QQFA 3EW7A 1WVIA 5T64A 3U3RA 1QP8A 4K6OA 7REQB 3KJIA 2PFSA 3CG0A 3OZSA 3OP1A 3RROA 2CBGA 1Z62A 1GQSA 2QUZA 2I78A 1TJ5A 1UMCA 5ALFA 4BMNA 4GSLA 2QX4A 2H4XA 4OOXA 1R9NA 1Y9DA 3SBEA 5DLDA 4M1SA 2BAGA 5DX8A 3HEBA 3ONVA 3IT1A 3D6MA 4AJOA 2D8MA 1S3SA 1B00A 4GZ5A 2PSFA 1RAEA 4EY3A 3P45A 4UPEA 1UJ6A 3HNRA 1VHLA 4G0NA 3MWGA 3I9LA 4M2LA 1I1OA 3B89A 4JIMA 4WA7A 3LXUX 5L4NA 1QAMA 2VDPB 3WK7A 4QVAA 3FGZA 4U6SA 3VH3A 3CT4A 3A9TA 2LGJA 2ZBPA 3G0GA 4U3JA 4L4SA 3OPYI 2OXTA 2Z1MA 3AKCA 4BNHA 4EFNA 5BP7A 5FAXA 2GCEA 2QW0X 3I01M 4ND7A 4DWVA 3FOEC 1Z35A 2UYGA 1E1LA 4XR4A 2XAUA 1RRMA 2Q1UA 1F6DA 3CEJA 4W5JA 4P3IA 1YS1X 2O1XA 1YQWA 2CFIA 4MVJP 4JI1B 3ASSA 3FMVA 3GUCA 3ZWMA 1E5DA 2DFKB 4UE3S 3R6JA 2V3CC 4IXWA 2CV0A 2IH2A 5FLYA 5LJLA 3LX4A 2UVPB 4FDLA 3LDGA 4W5HA 3RU7A 1DBRA 1DBSA 2RHGB 2CHUA 4G85A 4LYAA 2FN4A 3MN1A 4O3FA 5EJ7A 4QU0A 4F46A 3L0DA 3TZKA 5HIMA 4TLCA 1P44A 1SBHA 4BUJA 1UEXC 3VJRA 4MS3B 3FHTA 4CM1A 4B7AA 3B5EA 3LQ1A 3MUFA 4E08A 2E1BA 2OWEA 2WD7A 3FSRA 2MT9A 3CPJB 1IG0A 2YXPX 4NL4H 1KAGA 2PL1A 3W6NA 4EKEA 3KVNA 1SVNA 4KPUA 5DO9A 1UM9A 1W5EA 3I6QA 4KE6A 5A3VA 1Y5IA 4CTNA 4EBBA 5JZ9A 3A2KA 2B1QA 1VL2A 4BWGA 1PEYA 1QB8A 4O8CA 1XTQA 4PM4A 3DUFB 2H65A 3JWPA 2ZJ0A 2HA4A 4DZTA 5KJFA 1BN7A 1SHKA 4OTZA 2FN7A 1O96A 3DV9A 1I7PA 3K30A 3RUCA 4E0FA 5A7FA 4XPIB 4JU8A 4XGQA 5LYYA 2MCFA 1ZNZA 1GNSA 2XWSA 4M49A 3RYIB 4Q3DA 1F1JA 2DUWA 4M9QA 3JVDA 3IKVA 5LA6B 4YJ3B 3AESA 4XIYA 3KUKA 2PV0A 4M83A 3WMXA 1Q1QA 1H6AA 1ORVA 2VJNA 3C3BA 3SLGA 2AYZA 2PD3A 1XMJA 3SCZA 5EWLA 2JEZA 5H5JA 1WQ1R 3ADDA 5GV8A 1R8QA 1U7ZA 3GDFA 4GZ6A 4R68A 1GSHA 4UULA 2KS6A 3I55B 1KU0A 1X9HA 1XCGB 4UBOA 1K7SN 1EUQA 4B8YA 3QK7A 4B71A 5FWXA 1CR4A 2O0LA 2V5VA 3CW8X 4P4UA 3SBDA 3EWSA 1VE6A 4OOFA 1NB9A 4GX1A 1JJ7A 5BNTA 1QOPB 3C5CA 2V6MA 1QIMA 2OV4A 1ZJ4A 2X0KA 1X13A 3HBMA 3VV2A 1PNTA 4ZFNA 2Y4OA 3IVAA 1IUPA 2ID4A 5IABA 2W22A 1YIOA 1A5TA 4BVHA 5JYBA 3AF0A 2FWPA 3DE3X 1Y4UA 1ETHA 3E8XA 4TZ0A 3ZHSA 1Q95A 1M5UA 4AMUA 5JNUA 1WSVA 1J2JA 2O7NA 4GKAA 4WASA 3V8NA 3DQZA 3EGEA 1DO8A 1PJ7A 1IATA 4HN2A 1I1NA 4JEHA 5DE3A 2VPQA 1K8RA 4BFYA 3NUQA 3FZGA 4YWJA 2WDPA 3DZHA 2DAPA 2EKQA 2VNHA 1IZZA 721PA 5FPHA 4QZVA 3HVJA 5A9SA 4Q1CA 1G5RA 1A4IA 1U0HC 1M2EA 2XDQB 3GJ8A 1PT5A 4K46A 1ZN2A 3Q6MA 4JHXA 2B25A 2G08A 1AKTA 3O3MB 1T5TA 1YZLA 5EVCA 4A73A 3URKA 1IUKA 2WKSA 3PQ3A 2JHPA 5J63A 3UQYS 5ENDA 2R1VB 2OAEA 2RGAA 2ZJ6A 4OXNA 4DT1B 3AVYA 4JJ6A 1KJYA 2AJBA 4MH0R 3ENNA 4ESEA 2ODWA 2JFOA 2K2WA 3PC3A 1N7JA 1DHRA 1IWOA 2QR5A 5FOVA 3ET5A 2FQWA 3NBMA 4RJ2A 1GQ2A 4GMDA 4JQCA 4Q24A 5AW0A 4I1PA 1GKKA 2C9YA 3V1LA 2F9FA 4MROA 2BLNA 1MRSA 4DDVA 3TQRA 1DKRA 1MVOA 3GEBA 2J5RA 4JLVA 2CE2X 3AT1A 2R0QC 2OKCA 3WOHA 1JPUA 1NYLA 1V5WA 3O8BA 4W6QA 1CIVA 1NA5A 3USES 1RYZA 4D9GA 1DKOA 1OWLA 2WJZB 4LSGA 4BNDA 4CIDA 3AUTA 1UBHS 4F6CA 5BQ5A 3PFHA 1VQPB 4A8JC 2PUGA 2DFDA 5BURA 2RJNA 1TAHA 4G07A 4ASUD 4RVOA 2O07A 2WTEA 1ZSYA 5LZ8A 4MHSA 5KCZA 4DR5B 3I2HA 2YRFA 3NWBA 3O74A 3OUTA 1VHWA 2DFLA 3EGWA 5A7GA 1GKLA 3UT0A 5GJWC 2PQ0A 3U3XA 4F6LA 4PO8A 4QHYA 2ZBRA 4FMBB 4Y2TA 5AKHA 3RG8A 4MW1A 3FOFC 3B1ZA 4P1VA 1Z12A 2IZ7A 2EKZA 5BSKA 4Q03A 3EPRA 3IXMA 4O4LB 4A8JA 1KI9A 1XKLA 1VL8A 1UDWA 2ZB4A 2ZYDA 3HHEA 3LW8A 3QE2A 1IHMA 1XZIA 3LZCA 3OLXA 5K3DA 3HPRA 4CGYA 3GSIA 3NTOA 4IH9A 3U3DA 4CMHA 4Q82A 4BMZA 1ECCA 3D4PA 1JAXA 3KDSE 1EGAA 1VA5A 3RSFA 2XOEA 4C4PA 3OKCA 3A1VA 1AO3A 2WJAA 1QQ6A 2YWRA 3QMVA 3T3EA 5CXQA 4OGLA 1QZ3A 4E88A 5D5HA 1SCUB 3LY9A 1MORA 2XE7A 5TT1A 2F4NA 3DM9B 1QSGA 4US2R 1PJ8A 5BRJA 2VF4X 1Q1NA 4B09A 5GIOE 1ULBA 2HCTA 1A9OA 1WNFA 4TZKA 3EBLA 3L7MA 1EFPA 4L5CA 4P4NA 1WZEA 3PENA 2PO5A 4JOQA 3UXEA 1JKXA 2ORWA 2O3RA 2DTEA 4NP6A 1HY3A 4X91A 4YT2A 5LQKA 3ZE0B 4BKOA 2Y6VA 2XCRB 2Q5LA 1ZDMA 5LL6P 1GSOA 1NSTA 3EXHB 1RFGE 4B5LA 5KC8A 4JLKA 1KARA 2FY8A 2WWRA 4Y9SA 3EVFA 4UTPA 4HMQA 3F46A 2Y0PA 2QJFA 1K5DA 2VHXA 3BDVA 4PIVA 3GFQA 1I4LD 2FEPA 5CURA 5KVVA 2CWWA 2R5FA 2HWYA 1RJ9A 2YY6A 3I73A 5EHIA 1KYZA 2BI7A 3FUUA 2FPMA 5MF6A 1DPGA 1DJQA 5CK5A 3IO3A 4LY6A 1D1SA 1YJ5A 2I7DA 3BJZA 2AK2A 5SZHB 2QQ5A 3HUTA 4BVAA 3O8CA 3E18A 1HE1C 2X5NA 6REQB 1AU9A 2G36A 4S24A 2GZRA 4FIZA 1ISPA 1U9JA 1DQSA 5E95A 4BO1A 3GI1A 1ILWA 1JJAA 1HQCA 1RXVA 1UAYA 2C9ZA 1G8YA 5AICA 3TBKA 2ZQZA 4NAHA 3IXLA 2V9PA 2Q2WA 3F6YA 3V33A 1TU0A 1XVUA 2HBRA 2PQ2A 4DC0A 3EOBI 1C1XB 1YDHA 2D5LA 4UMDA 3C85A 2FF7A 4RKFA 5BW4A 3CNQS 5FOXA 3OQIB 4BGEA 2C4TA 2CV2A 4BVFA 2JB9A 4RSRA 5B1YA 1Z26A 3BXXA 3IQWA 1R8SA 1GAWA 1P4SA 1ICEA 4L8LA 2VCYA 5CDTA 1JR2A 4YAJA 2HT1A 1Q7YD 4WZBB 3DDYA 5DRTA 3LNCA 3U7EB 1WLSA 1JV2B 2FFJA 2PUAA 2C0PA 3BA1A 3LC1O 1BRTA 3PYXA 3G7SA 2D0IA 1K4KA 1DUVG 4QQNA 4HTFA 5H9VA 2OLKA 2X2EA 4BN4A 3HA5A 2GPTA 4ES6A 1R7RA 3HK2A 4JQSA 1SBYA 1II9A 1RHMA 2DCMA 4NE7A 3FVVA 2NSJA 1VQKB 1CPYA 2B8WA 2JFGA 2VDLB 3T7CA 2H2FA 3ZD7A 3I6MA 5BOVA 1L1EA 4PYOA 3M4YA 2FV8A 2PLAA 4MWOA 1ML3A 3L0OA 2AG8A 2YNMD 2HREA 3KBOA 3HNOA 2ODPA 4KBYA 3SQDA 2JGMA 2BGLA 3JQFC 4XB1A 1DKUA 1AMUA 1KZ9A 1FDVA 3DL0A 4MO2A 3V46A 3ROXA 2ZI5A 2J85A 4OBEA 3ZU5A 4D57A 4JIGA 2KSQA 4QUJA 4RYDA 5KQRA 4NOJA 4F6RA 4Q4JA 2JZCA 5HJEA 1M0SA 3VV3A 3DWEX 1K08A 2F9LA 3K9WA 4DANA 4Z49A 4MQUA 2QM8A 3B51X 2EG5A 1L7OA 3ESXA 1LW7A 2DFNA 2JGJA 3CX4A 4ZT2A 1AS3A 1RRFA 1WSWA 4HX2A 4KJZA 2GK3A 2O3QA 2ID7A 2UZ1A 3DZGA 4EYSA 4TV9A 1O94C 5ICGA 4GKKB 4Z51A 3MLAA 2JFHA 3K8QA 2V4DA 1O0SA 2YOGA 4N39A 2AN3A 3TZHA 1PEAA 1PDWA 1OV4A 1ZHHA 1AKYA 3DMTC 5AD1A 2VL7A 3CZMA 5A5VA 4B6PA 3FPGA 3FWNA 1JFFB 3MRTA 3WYGA 4FJ2A 1P5ZB 2Q5QA 3GLHB 3VNVA 5HPYB 3K9QO 4UQLA 4YJHB 2D3TA 1SEVA 4MINA 4C4OA 3OECA 4GZMA 3A32A 2KQUA 3TNLA 3W05A 3P0JA 4P3PA 1MJ5A 3T7SA 1GRQA 1MABA 4MAAA 4YQEA 4RAOA 2DZDA 5KYGA 3LUCA 3QUCA 4EKNB 2OBLA 1QHGA 4WIAA 1SXQA 4RHCA 3V4SA 1C0LA 3Q7TA 1SC6A 1PLJA 2O8NA 3DMFA 5JIBA 2C5EA 4KGXA 1VB3A 3V8RA 4CLHA 5CP8A 3RWMB 2GDJA 4JQOA 5I7EA 3CVXA 4JJ8A 4MA4A 3KEQA 1WE2A 1SCIA 2IY9A 1U2SA 1OBFO 2IIPA 4HH1A 4NPAA 4H6XA 4MRAA 3DVSX 1ISSA 4AKIA 5KNDA 2B78A 4ID3A 2RIRA 2JBWA 4DUZB 4RUKA 4D82A 1LBHA 2XGMA 3OTOB 2JLCA 1OIWA 1NKTA 5NULA 3WK4A 3QFHA 1COWA 1UIRA 3FOCA 3IURA 2GVNA 4PG5A 4Y2VA 1IN7A 1PR9A 4QUDA 5F2KA 4E3ZA 3AJAA 5JJKA 1SJ9A 2J9XB 2XBLA 4DXDA 1NBEA 2PWZA 1TNDA 2ZP1A 2ID9A 4P31A 4ZAXA 5HX7A 1Y4SA 2GLTA 3GCZA 4JENA 3GJ0A 5BMVB 1VSUA 3LS2A 3D1LA 1T4DA 2ERXA 1W85B 1KQPA 2NAPA 1T9KA 3A9RA 5KMGA 2Q6LA 2VRWA 4GXRA 4Y7CA 5E7MA 4CTOA 2Y1CA 1SHLA 1GNPA 1W4BA 5ELXA 5F9FA 1IB6A 3I3SR 1C0IA 1W47A 3PXUA 3F96A 3MGGA 3H94A 4WZEA 2HY7A 3U31A 3VMFA 2EJVA 1CVLA 3D0KA 3LE8A 4H7FA 1SG6A 1C7FA 2AR0A 2PGNA 3LHSA 3O3OB 4OHMA 4CF3A 1PFQA 1DBIA 3KSAC 3WGVA 3CRVA 4G1VA 1B14A 3QE9Y 4BDSA 3R3YA 1DMSA 1I2BA 3KV3O 4EG5A 3KLNA 5DNCA 5AKGA 4CEHA 1MC5A 4NBLA 1NQXA 1PWXA 3A9UA 1N0VC 1SOAA 3MRVA 1G0OA 1M73E 2IZZA 2P1RA 3UM9A 3ILXA 1OWMA 3I12A 5FB3A 1O4WA 3HDTA 3D8RA 2EQ5A 5ER9A 1PZNA 4GLJA 4BQPA 2GKSA 4EJ6A 4KQXA 1M90D 2O7QA 1BO6A 1F20A 4KFUA 1YVUA 3FCCA 1ISGA 3IOBA 5EP4A 2HZBA 2G9UA 4FFWA 4MCJA 1J0DA 3FCEA 3IEUA 3AYXB 3RANA 5FH9A 1TW3A 2OQ2A 3OHMA 3WYAA 2IY8A 3EGDA 4UC0A 4NNPA 5L9AA 2QI9C 1EAMA 2CVOA 3OCWA 2QEQA 2II6A 4JP1A 3LFHA 2MSWA 3OOWA 4DCJA 4EL5A 4P6VF 1PKVA 4A6EA 1GKUB 1I5EA 1MX9A 4TL7A 4AY3A 2JLZA 1QDLB 1U81A 5TVGA 5EGSA 3BY1A 4RABA 2VPWA 1ZM7A 4XM0A 4HNVA 1NX6A 1OILA 2PM8A 3I5MA 2ISCA 3OWHA 5KX5F 5K9ZA 3FF1A 3CRRA 5CIQA 3DONA 4D8XA 2IOFA 3NUZA 1OF1A 1ZUNB 1GAJA 3ESQA 2WWVD 4IUBS 3CUTA 4JT8A 5AXCA 3WOVA 1LS1A 3LVQE 2ZUCA 1RJEA 4FGLA 4K9LA 5K51A 4BWFB 1LS6A 1BE8A 5AHXA 1ILEA 3B78A 3QBVA 4OGKA 1YACA 2WNHA 2NNLD 1NSFA 4H3KB 4NE9A 4RTJA 2GS9A 4AQYB 2XVXA 3Q3HA 2GH1A 2VBCA 2ZUWA 1JHDA 3Q6QA 2IHJA 4RDLA 4FFBB 3SC2B 2CJXA 3D8NA 4QBKA 1N3YA 3C8DA 1QUEA 1YNSA 1ZMRA 3LUAA 5H81A 4E94A 1QONA 5HXAA 4XWWA 3NMUF 2H2DA 3Q9SA 2P1ZA 3WFZA 5SY9A 4LDPA 3S1SA 1P9WA 5H3CA 4MW9A 5B3JC 5LQJA 5IEJA 1A97A 3FYUC 4ID9A 5B5SA 1L4MA 4P86A 4G4IA 4IYJA 2VSOA 5EJEA 1OZAA 3EFHA 3RIEA 2YZNA 3D6TB 1UK9A 3QVWA 4JI7B 2V31A 1GPNA 4YRGA 3V7NA 1PIWA 2HWXA 3A3GA 3AETB 4B81A 4ARIA 2XTZA 3A4IA 4GOLD 4IJQA 5CFNA 2M9MA 3DHVA 4EGCB 4IDCA 3E9RA 1T25A 4CBVA 1NQTA 4S12A 3SAJA 1NUUA 2O8CA 1W1WA 1YCHA 1DIHA 2A88A 3TH5A 3FYUA 2XDYA 3NC1C 3C7KA 5J2TA 5D6OA 4V0NA 3FYTA 1K86A 1W5BA 2GEJA 4J3JA 5AK0A 2DQZA 3AJ9A 4Q48A 2WZCA 2VQSA 1GUDA 1NW6A 2BKLA 3H0CA 3TW8B 3KEOA 4D80A 2W6OA 3NORA 3PLAE 1Q11A 3M89A 1VTKA 4Y6OA 2BFFA 2C2ZA 2NYAA 4B5KA 3GLGB 3RRBA 3PZBA 4D9EA 2ZR8A 3DBHA 5CITA 5E7IA 4XQEA 3LBFA 4Q4AB 1HWYA 1WTCA 2IU6A 4D02A 3M6WA 1UMDA 2G9NA 4HSGA 4D9CA 1QMGA 1L4LA 3H2HA 5FOUA 5KTSA 3QEMA 1GG5A 4RXMA 1IK6A 1IC6A 2Q3FA 4N8SA 1Z56C 2GM5A 5ALPA 4ZIRA 2ZVJA 5AWFC 2GXSA 2ZB7A 4JGIA 1NFFA 1ENYA 3PX3A 4NU5A 1XZQA 5FWAA 16PKA 1O6CA 3VR4A 2V1XA 3K72B 3ZHRA 4ZI7B 1H4SA 5BN4B 2A35A 2I4TA 4K05A 1T1JA 2IYPA 4Q9IA 3WWOA 2IVZA 2C2GA 1E3QA 2J3KA 1XU9A 2BDTA 3MIZA 5DOVA 4EY5A 4HV4A 4QJ4A 4FC6A 6CHYA 1PWZA 3F0TA 3GUVA 3OIFA 3BL6A 1HO3A 4JGBA 4ZHQF 1Q0LA 2CE7A 4F8JA 2H2HA 3DMPA 1QK5A 1K6MA 3D6UA 3RV3A 2MMGA 3C4VA 1JQLB 1HDRA 5REQB 5JEEA 3FFWA 5E4TA 1DUIA 1J06A 3K2IA 1SKQA 1VCOA 2FN8A 1EVZA 3LLSA 4B17A 3LDHA 5A6SB 4RVCA 1XLUA 1FNBA 4JP8A 3DZKA 1K7CA 1NKVA 1JECA 1KOJA 1OI2A 3I1FA 1T1GA 2IUEA 4JFAA 4Q4LA 1XTIA 2ERYA 5AVJA 1FBTA 4ENRA 1LWNA 2NU9A 1N9KA 4PGHA 2J87A 1W88B 2W98A 2O0MA 3ZE6A 3ICVA 2JK1A 4X7DA 3IVXA 4AQ7A 3E5HA 4OJKA 2H5EA 1IOVA 4ECEA 4Y9TA 3PK0A 2H1LA 3WYNA 1EINA 2R3SA 4V0LA 2ORED 1ZSVA 3K0CC 1J0BA 2QVXX 1BMFA 3INTA 1OREA 4LYDA 3D8SA 3K6SA 4O4HF 3TLJA 3WGJA 3WGYA 1Z7GA 3THXA 5JBIA 4LWOA 3WJ7A 3K09C 2ZBQA 5KAPA 3QFCA 1LH0A 1KRXA 1JHOA 1HE3A 3I4FA 1Y6ZA 4GQBA 1Q0UA 3K0CA 2IA5A 1M66A 1TI7A 3DP9A 2RGWA 2J33A 3N39C 1GL9B 4YXWD 1RLUA 1C14A 3QOFA 2HLPA 4O5AA 4N6NA 1G7RA 5KOIA 2P75A 2VBVA 1HYEA 5D8DA 3K09A 1UF9A 2B8JA 2WYWA 3DP7A 2W6PA 2Z2YA 1JQBA 2ZT5A 3RSGA 1IY8A 1S2OA 3LYHA 3CTMA 4DQLA 4CM9D 5IMSA 1W73A 2BWJA 3SC4A 2DRIA 1T26A 3G8DA 4A0HA 1NIJA 3S2FA 2W43A 4BQIA 3IX7A 4GGMX 2WIGA 2EKBA 3ENQA 4K9DA 4OGWA 4ZREA 4DADA 1T0UA 5JYEA 2ZYTX 5IYPA 3OF5A 2EX4A 3C7CB 4KNYA 2E3JA 4ZT6A 1F0PA 2WPNA 1DGQA 1ODTC 4RHTA 1YS9A 1DCKA 2DHDA 3VHRA 1SAYA 4H4CA 2JFBA 4FKZA 4WGFA 1DIGA 4FDUA 4M0EA 1DRUA 1VKNA 4E33A 2HU7A 4ISCA 3TEJA 1M75A 3N87A 4KFRA 4HLQB 4K6MA 4BO2A 1YGYA 3DBOB 3TSOA 4DLXA 2JFPA 1UKVY 3O9VA 1N0WA 3FETA 1GZ4A 4LY9A 5CGQB 4OMUA 3T0FA 2FUCA 3UJCA 5BR7A 1Q22A 4Y2SA 1HLFA 3CR3C 4UHDA 1CQPA 3O7MA 4IIGA 4S1WA 5TS3A 4BO3A 1SKYE 1X39A 4BOYA 1QU3A 1HF3A 3EA0A 4YJFA 4RVNA 1MV5A 4XGKA 3WK6A 5BSWA 1TEHA 4QUEA 3JYNA 5TGDA 1HUQA 4P34A 2ZI9A 3MT0A 3NKFA 1JDTA 3OCJA 5LJIA 4A36A 1VQ7B 4UXIA 1QORA 1WD7A 1OXUA 1YKFA 2JFQA 3AERA 1M1YB 5GM1A 3MMPA 4EX7A 1KZ4A 3QHQA 2D59A 3RC1A 2X2PA 2AN9A 2KBFA 1XDUA 5JJBA 3GEMA 1Y42X 4MB0A 4K0RA 5HKKD 5HZKA 4CEJB 5LD2B 1AKUA 1ZM2A 2WT8A 4J2HA 1LPAB 2FPIB 2H57A 2FSPA 1ZNXA 3CJTA 2SKDA 4JEUA 2RGGA 4L0QA 1BMDA 4EYQA 1KJQA 3R5FA 3FOAA 3PWKA 3KKKA 3MSXA 1LDYA 4AO7A 4DKJA 2M2IA 4JODA 1KQSB 2ACKA 3KJHA 2E5LB 2FEAA 1L5NA 4LE2A 1IK4A 2ZJYA 3DLPX 4FQ5A 5K1ZA 5A62A 4R8KA 4WUVA 4F12A 4FYHA 1B6GA 2SBTA 2CLEB 1Z17A 3MG9A 3P2OA 5DXJA 2H7VA 1BDBA 3I2JA 1Z0ZA 3PEFA 4JA2A 3SQNA 4BZPA 2I4IA 2JI9A 5FTNA 2WT4A 3M5WA 3NTXA 1YE5A 3IBYA 3HZRA 2WA2A 1XBTA 1XJWA 1EUDB 3VBCA 4CMEC 1L8QA 3H3XA 3IYLW 3AOGA 2YJNA 3L01A 3A9CA 1T9BA 4A3SA 1M0TA 4CIBA 1E1KA 5U9CA 4HYTA 1RKUA 2BUAA 2PUCA 1U7HA 2DBZA 3H1TA 3L7OA 4MXDA 4XQFA 1XZPA 1SCJA 2RIPA 3ZEAA 3IIIA 1UJ2A 1YHYA 1GVNB 1ZVQA 1Z4OA 4L16A 2JLAA 3FNFA 3HQ4O 4MV7A 1MJFA 1VBNA 5T7BA 3TGPA 1IYZA 1T1EA 3OLZA 5J43A 2YVLA 4MS4B 4FSHA 3PJGA 4FX2A 3B36A 2DOKA 4IOMA 4CMEA 5TRTA 4AKTA 2X1MA 1NLUA 1NZJA 1Y1PA 2Z9DA 3DZBA 3OJCA 4K6FA 4QOSA 3WZ2A 3A10A 1DAIA 3ETDA 1U7PA 4FCTA 4TUYB 5D7NA 3EY9A 4E2YA 3OFVA 5HF5A 4CKCA 4DB4A 5CLFA 5T57A 3VHQA 2EW1A 1D1QA 2PEZA 2ZVQX 2NLOA 3H3FA 4G9EA 3ZJYA 3CB4A 2YUIA 3UHAA 3SQMA 3NKLA 4EY7A 4HDRA 3O4HA 3AF4A 3ORYA 4RD2A 4YCJA 1IEXA 4M9SA 3G85A 2OXFA 3THOA 1M1NA 3JQAA 3UPUA 4DDHA 1GNVA 4LZNA 5DYGA 1EESA 1H85A 1KZ6A 3AUAA 2R2AA 2RBGA 5G0TA 3W6PA 3GZNB 1ZCAA 4LQ4A 4C06A 2C94A 3NDRA 2RJOA 4K9OA 4ND8B 1ZSNA 1CLEA 4NG4A 4ZOQI 4F3RA 3OX4A 2ZEJA 4ZK2A 3I34X 3PRJA 1I0LA 3DQPA 1QIDA 1XVIA 3K7EA 4QYTA 1J5EB 1KO4A 3HTXA 4FFSA 3FMFA 3VOSA 3LO8A 2G5GX 3F1KA 3TLGB 2OEPA 2RHBA 5IUJC 4PSUA 4KQCA 2RHJA 1EDOA 5HEKA 5DN6D 3A25A 3K0SA 3LA8A 3PZRA 1ESEA 3GPIA 2O2YA 4XH9B 5AK5A 3WLRA 5B64A 3HU1A 1TM3E 2NACA 3DKVA 5I5EA 1SVMA 3RARA 2ADOA 4E22A 2C31A 1PG5A 4JUAA 4NQZA 1RHRA 5BSEA 3IEIA 8LDHA 1BMQA 2LV8A 3HKBB 1BJKA 2EZ4A 3KJZA 4LX8A 4ZU1X 3SKXA 3F4LA 3V7WA 4WEOA 3L6DA 5M3BA 1IOWA 1V3TA 4N54A 2EFGA 5C80A 4J1NA 2J3JA 3ZQJA 1J2EA 3CA8A 2DQSA 5AJUA 5E6SB 1YJCA 2CXNA 4GEGA 4BFXA 3U6BA 4BU1A 3ITKA 3TG8A 3TSZA 4PCLA 1ESDA 3KZOA 2HFJA 1KERA 3WX0A 4EW1A 1R15A 4F4UA 5AVSA 2P9JA 2ZI3A 3CINA 3HVKA 1MW8X 3A8IA 3A4MA 3S6JA 4HFNA 4PWZA 1QBGA 1JRLA 1WUHS 2HFKA 5HKAA 4N3AA 3U7GA 2WM8A 2IBMA 3EVTA 4D1YA 2PMBA 1VQLB 3HO8A 2LCQA 1N2EA 3QMPA 4YRFA 4BVBA 4U7FA 3MGBA 4P9NA 2I1QA 2NUPA 1RAFA 1UT8A 3A2NA 4L3VA 5DULA 1AHNA 1QC5A 3L0ZA 3EZLA 3ZWVA 3LH5A 2W4MA 1IN6A 3NJRA 4OYHA 2AYXA 3HH8A 1TQ6A 4ZO4A 1Y6RA 1T2CA 1L1RA 4MW0A 1O3YA 4P3OA 3IBFA 4XSGA 3UOGA 1CY1A 3T1QA 2B9VA 3O8OB 3HDVA 3FRJA 2UXBB 3NHZA 3AWIA 1XMSA 3A0RB 5JTUA 1DIAA 1P7WA 1YASA 3TNDA 4TMYA 1JGTA 3B1JA 4JLSA 3HB0A 4BEVA 3WQZA 1MOZA 4DMKA 4ALLA 3RSQA 1L9XA 2EAUA 2NU8B 3IDAA 3SVZA 4A2CA 4O3MA 3MTJA 2CCKA 2NVUB 2FZ4A 3FD8A 3T5GA 3N2LA 4M0MA 2CXQA 2PUWA 4BX2A 2YJZA 2WLTA 4RM3A 2D5CA 3L1HA 3RJMA 1JXAA 2WPDA 1DFHA 1WZUA 2OBYA 3EGIA 3CCCA 3MS4A 4TTIA 3ZZNA 4TRRA 3HGMA 4BLVA 3GJ5A 1NTOA 2OSVA 4LXIA 4MRPA 4EZBA 3ERCA 4HGYA 5J4VA 1QQ7A 1J2RA 5BN1A 1OA0A 2NAFA 1G8HA 1VG9B 1Q15A 1YIJB 3NCHA 4J76A 1GU0A 4TTAA 1UIMA 3AL3A 3M7IA 1TA9A 1EUZA 1M5TA 5F4JA 1IWBB 2VAMA 1JHAA 3CRMA 1F0NA 2NNWB 2NYVA 3I42A 4HWGA 1G3MA 2XI4A 3KCQA 3NCTA 4X1KB 3WBBA 4BFWA 5AJTA 4BO4A 2J0EA 1Q21A 5FULA 3A3OA 5DFAA 2C2WA 2HRQA 3NEJA 4RJJA 1NZDA 2YW2A 4AT1A 1K2WA 3ZE2B 1J22A 3RS4A 3IJEB 5FPSA 1DIOB 3O0DA 4REQA 4XJXA 1Z6XA 1E5QA 3I9FA 1EXWA 3N2GA 3GA0A 3B12A 3OX1A 5CH8A 2YFHA 3B9PA 1GNLA 1J0XO 4XLFA 4R6XA 4CR6A 4CT5A 1PV1A 1SY7A 5BN5A 4MCIA 3ELDA 5BPFA 1N6HA 1QLJA 5JCOC 3DC7A 4RJLA 1YR6A 3TQHA 4MAFA 3O73A 5BSXA 3UGKA 4OLFA 2CLLB 3BHMA 2FUNB 2C98A 3RVMA 1MGPA 3VAAA 1NF3A 4DZZA 1KF0A 1J49A 1X1AA 1VDMA 2GK6A 2H2IA 3DVAB 4KPEC 3IJRA 4FM9A 1TQ8A 1UBRS 3N8DA 2R6AA 1V8ZA 3DDOA 1TECE 3L6RA 5KTMA 2YJTD 4B84A 1RMYA 1ZPDA 2EP7A 2JC3A 1O8CA 1OXXK 4R16A 4EP1A 4RD3A 4F8YA 5MFZA 1G66A 4B82A 2JH3A 4N3BA 5B4VA 4PZ0A 4HLUC 5CVTA 4TKZA 1JDBC 2ZQYA 3MOIA 3Q9UA 4IILA 1FU8A 2YHSA 5I4BA 2SCUB 5JQGA 5KU7A 2LZ0A 3P19A 5AIAA 3WQSB 4NBVA 1SKAA 4B74A 1IZ9A 1FYDA 4Y2UA 3GVKA 4FOTA 4YRZA 5JANA 4AWBA 1F2TB 2P2CA 1T9AA 2AQHA 4BVJA 3HEAA 1FLAA 1P1CA 3BD8A 4H7KA 4NZMA 1QGYA 1DEAA 3JAKA 2OCGA 3NYWA 2DIEA 3PEVA 1R12A 4PQEA 1HNXB 4P32A 2G83A 3CKMA 1DDGA 4CEIA 5FR1A 4HLUA 5AVKA 2XZPA 1SELA 3F74A 3CQ9A 4XYEA 4YCBA 3GAFA 3FYDA 1J7JA 4ZAWA 5YASA 1A8HA 1G6OA 2ZBEA 3O26A 3VGPA 3GO4A 4ROXA 1VLJA 5CR9A 1Q3KA 3F67A 2IPXA 3QEJA 4IG4A 1T2VA 2FPLA 2IZ1A 4TYNA 2PA3A 5FWYB 4EG8A 2D54A 2WKWA 2PTGA 4S3MA 2VWHA 3EG9B 4MW6A 3ZDXB 4ARSA 2BP7B 3E9MA 3C45A 4KRFA 4LXXA 3VTZA 5CFLA 3HCEA 4IJ5A 4KYIB 3LKVA 4RTQA 3VZRA 2PCJA 2GERA 1DXQA 3QMWA 4G1UC 4JDUA 4RPJA 4YJ2F 2FPUA 3WE7A 2QU8A 2YY5A 1JR6A 3COYA 1TU4A 1Z5PA 1KPGA 1TYBE 3FWZA 3RREA 3ANNA 4CWAA 1HL3A 5GZ3A 1GKYA 2RH4A 4WBSA 3Q98A 1PZGA 4MB6A 4DABA 3Q3CA 3QYJA 1NW9B 4WFQA 1UEJA 5FFNA 4RHEA 3ZS9A 1I01A 2GYVA 3LIPA 3C1OA 4PGAA 1D03A 4K88A 1X3SA 1SHTX 1K06A 1DIRA 1Q0HA 3P9NA 2Z2IA 4PZLA 1DDOA 1RXEA 3L9WA 4H1HA 5I7AA 3KB6A 4D0GA 1EH5A 1FNNA 2QSUA 1UDRA 1WXEA 3IT0A 4WECA 4X20A 3R44A 1K1EA 4NF2A 4WOJA 5LXTB 1FPMA 4XEUA 4FTWA 3MBIA 5D86A 3HZOA 4QRHA 1R1DA 3GEDA 3AB3A 4WNCA 3D6FA 5HQ3A 3LT5A 5JRZA 2YMMA 3RF6A 1P18A 3BWCA 1NLFA 1BEEA 5CDUA 1QS0B 3I04M 4JXKA 4XVRA 3ZH9B 4H18A 4JI6B 5G1OA 5KSPA 1IBKB 1FSGA 4Q6BA 4GWKA 4BE7B 4GFDA 2WBLC 4FEAA 4Y30A 5AK3A 1W36C 1A2OA 1NFRA 4P22A 2OSBA 1E1QD 2GX6A 3H97A 1USUA 3BVPA 3HZZA 3ND5A 4G4SO 1R6TA 4AYWA 2C82A 1I3LA 1WQ4A 4MKZA 2X9NA 1J0EA 2NPIA 1JL3A 2HA5A 3GEEA 3DJFA 3UK7A 2QF7A 5DH9A 1HDGO 3EJ6A 1MG0A 2A1UB 1DBVO 1RLMA 1AXRA 3OKAA 4OSPA 3IIEA 1D2MA 1NPTO 3HHPA 2R1ZA 3ZDEA 2DGDA 3BFKA 2A5JA 4PXSA 5JSFA 4P58A 2Q50A 3RIYA 1NRIA 1SA0A 4UASA 4DWJA 5M2QA 3AEKB 1Y8QB 3TGLA 3LPNA 3S2SA 1JI0A 3DV2A 1SU8A 2RG7A 3F9CA 1H2RS 1UXGA 1IN4A 1JW9B 3EEIA 3HFSA 4G9BA 3EF0A 3UW1A 4ARZB 4R69A 4LGMA 4LXHA 4XOUA