1QUFA

X-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
ADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the ferredoxin:NADP+ reductase from the cyanobacterium Anabaena PCC 7119 at 1.8 A resolution, and crystallographic studies of NADP+ binding at 2.25 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 85
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1996-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qufA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qufA02
3OZUA 4P3YA 4HE5A 1W34A 3I55B 4ZCMA 3G4SB 4LBVA 4YAUA 2XEXA 4B4DA 1JJ2B 1FRQA 4ACAA 1N8RD 1D8TA 1W2BB 3CC2B 3U6BA 1ZM4A 3VNVA 4G5GA 1VQKB 1ZM2A 4MYUA 2QMUA 1BX1A 4YAFA 2DY1A 1TTTA 4ZGNB 4M2LA 2BSAA 1QFZA 4N3GA 1YHQB 1S0UA 1VQNB 1SM4A 3WNCA 1ZM3A 3V76A 2FX3A 5EMNA 5HXBA 1KK2A 2VZLA 4TMTA 1QVGB 3MMPA 2BMWA 3AGQA 2BN4A 3ZBUA 3CCRB 4J0QA 2C78A 3ES9A 3I56B 2ZITA 4M1KA 4P6VF 1G7SA 1I7PA 2GPJA 1EFTA 1E62A 4YALA 4RD1A 1EP3B 3VO2A 4G1VA 1OGJA 1SKQA 1N0UA 1KJZA 4RD6A 1R5NA 5TV2A 5DSZA 1J9ZA 2QA4B 4M0LA 3ZZTA 3VMFA 2PIAA 1DG1G 4PC6A 3E20A 4QFMA 3FJOA 1N0VC 4B43A 2B7BA 1D1NA 4Y7CA 5THXA 1EFCA 4G1BA 3AVYA 1YI2B 1FNMA 1Q86D 4PC1A 1YITB 1KC8D 2BPOA 3OJWA 5GV8A 1BX0A 3QFTA 1DDGA 1W35A 3CRZA 1JB9A 2XNJA 1G7TA 4RD3A 3QE2A 2J7KA 2OK7A 1KD1D 5H59A 1QG0A 4TMVA 5GV7A 1VQ4B 4M53A 2DETA 1KK0A 4RD0A 1EP1B 2AHOA 2YWGA 2OTLB 2BGIA 3OJXA 3ZZUA 1EXMA 4HE6A 2YWEA 1GAWA 1AIPA 3JQQA 3CCEB 1YJNB 3W5VA 5AN9A 1OB5A 1JNYA 3I1FA 4ACBA 1H85A 3MHPA 2OTJB 3CPWB 4MYTA 3WXMA 4C43A 1FNBA 1TLLA 1VQ7B 4PC7A 3G6EB 1A8PA 1R5OA 4RCZA 2YWFA 3CCJB 4Q7JB 1EP2B 3FPKA 1AMOA 1Q7YD 2BM0A 4LBYA 2VNJA 1VQ8B 1JA0A 3VNUA 3W2HA 2BVNA 4TMWA 3LVBA 3AVTA 1GJRA 3W5HA 3CC4B 2E1RA 1GVHA 4PC2A 1KRHA 2CRVA 1E64A 3WNBA 1M90D 3VO1A 3LO8A 2EFGA 3W2FA 3CC7B 3QFSA 4AF7A 1YIJB 3AVWA 1HA3A 5H5JA 2B7CA 4RD4A 3W2GA 4PC3A 3CCSB 3QFCA 4UAJA 1CNFA 3CXCB 3QFRA 3OZVA 1QGYA 3G71B 3CMEB 1M1KD 4FK8A 1K73D 4LC0A 4B47A 1GO2A 2HDNB 2QDXA 1CNEA 2XNCA 1F60A 3U6KA 2HMAA 1YJ9B 1IJEA 1QGZA 2HCJB 1ELOA 3OW2B 3ZBTA 1D2EA 3U2QA 1XB2A 3PENA 1CQXA 2PLFA 3ZZ0A 4NBSA 2DCUA 1VQ6B 1NDHA 5KSWB 1VQMB 4QHYA 1ZM9A 1QVFB 2VYQA 3B78A 4PGOA 5TY0A 3W5UA 4EH1A 4AF6A 2R6HA 3JQRA 4TN1A 4ZGQB 4DQKA 4ZCIA 1QUEA 1K8AD 2VNIA 4U9UA 3P27A 2NPFA 1OB2A 1E63A 1VQOB 3W2EA 4Y9RA 2QTZA 3CB4A 3QSYA 1FDRA 1OGIA 4M4SA 3OZWA 1K9MD 2OK8A 4B48A 1VQ9B 3CCLB 1QGAA 4RCYA 3LYUA 3B82A 2PMDA 1EWYA 4B3XA 1IB0A 4TMXA 1G7CA 1KQSB 1VQLB 4BPRA 2DERA 3A1FA 1IJFA 1XE1A 1H42A 1QFYA 3CD6B 1R5BA 1GR1A 2VNHA 4YAOA 1VQ5B 1EFUA 1WDTA 2YWHA 1ZUNB 4IW3B 1QX4A 2BF4A 4WQMA 1GAQA 1QH0A 2D74A 1NJID 2RC6A 2X3UA 1DDIA 1UMKA 3SJZA 4YAWA 3ZC3A 1BQEA 3WBJA 3W2IA 4LBZA 3AVVA 1VQPB 3MCAA 4B44A 2B5OA 2BM1A 1YJWB 3LRXA 4FWTA 4AC9A 4F7DA 4K1XA 2QN6A 3CCVB 1DARA 3WY9A 3CMAB 1Q82D 1KTVA 3WYAA 2RC5A 4RD2A 4C0SA 5TR9A 2BGJA 3AGPA 1TUIA 1KK1A 4NCNA 2EIXA 4ZCLA 2GQFA 2QTLA 1KK3A 1JA1A 4Y9UA 3CCMB 1FNDA 5FA6A 4ZV4A 1QFJA 1Q81D 4RJLA 2BV3A 3E1YE 4DQLA 2CNDA 4LBWA 4FN5A 3AVUA 1W87A 2C77A 1G7RA 3J81k 2QEXB 2DEUA 1S72B 3WNDA 1B23P 2VNKA 3AVXA 4N3NA 4YHBA 1TVCA 3CCUB 3WBKA 1BJKA 3JQPA 4H9GA 1B2RA 1F20A 1U2RA 1QUFA 3CCQB 1FRNA 1FNCA 3CW2A 3B8HA 3P26A 4TMZA 5JBQA 4R71A
chains in the Genus database with same CATH superfamily
3QBJA 2LZJA 3I9V1 3R0JA 2IIVA 2O05A 1QTRA 2PGNA 4HE5A 4P81A 3LQ4A 2JFUA 4BO8A 3CF2A 5D6NA 5HCNA 4CVNA 1Y9JA 2BP7B 1EXWA 3CURA 3WP1B 1HDCA 1F4VA 4TLMB 1TT5B 2R8PA 4Q47A 4I55B 2WE7A 3RWOA 1M34E 3OX1A 1P2GA 3U4AA 3NJRA 3P9NA 4ZZIA 5IVHA 1KH3A 5L4NA 3TX6A 4FBGA 4G4SO 4TSKA 5KYVA 1HBJA 3SYTA 4MUAA 5BUQA 4OHMA 3LX6A 3BK7A 3L41A 4IJUA 2YW2A 4AKEA 1GTMA 5GJCA 4M7OA 4MGZR 1I1NA 1VE3A 3IMGA 1X3SA 1VMIA 2BFBB 1K3UB 2X7JA 4G0XA 4UMVA 1I1HA 3SSAA 2BMEA 1G4AE 4X1IB 3LX8A 3SR0A 4V02A 1PD1A 4TMYA 1OILA 3MM4A 4FNAA 4N18A 4GP6A 4X94A 4OHVA 1N6RA 3TW0A 1HQDA 4R41A 5CB4B 3MSCA 5CVEA 4ZTUB 1V4NA 2A9PA 1TYZA 3KFLA 4JBGA 5ALSA 3WK5A 3FF1A 4EI7A 1W48A 1EVJA 2Z2YA 3QU2A 4OAPA 5ARCA 5H70A 4DCSA 1XRQA 3RBVA 1I0LA 5TQ0B 4QM6A 1P1RA 1Z68A 3G9UA 1IL0A 2OC4A 2PX3A 4MQ5A 1V3QE 3VYWA 3E5HA 1G3UA 5B1IA 3OCUA 1DKOA 4GWGA 1P6UA 2H52A 3GDFA 1W47A 3E5RA 5LNK6 1FLVA 2PIDA 3HBNA 4MP6A 3C7CB 2ZBGA 3HTXA 1OTHA 4Y6RA 3MLBA 4O59O 3CF0A 4C5BA 1TDJA 5D3ZA 3FYSA 4RACA 3CJTA 4AKGA 3E4CA 5TSDA 3LNNA 1GPAA 4DLNA 4BAUA 2BN4A 4DYDA 5T7BA 2UYHA 2OPHA 3ODGA 4IZ6A 4F86A 2Z8YA 1OF1A 3DV0B 1UKAA 3OH8A 2F8SA 3KD2A 2HLPA 1KERA 2VJQA 1A71A 1SHZA 1ZIXA 2WG0A 3KYJB 4M1KA 2OV4A 4P08A 1BXRA 1P0FA 3DCIA 3K8ZA 3ZDZB 2LE0A 4AQ7A 3BXXA 5C1BA 4KQ6A 4C7JA 1ST2A 3GT7A 3L3BA 3ZPXA 1IN4A 3RKSA 2A94A 2QV0A 2PTGA 3LDGA 3CLTC 4RVSA 5SY6A 3ZXIA 3CVOA 1MNAA 2X5KO 4ETWA 4JEHA 3GJXC 2D3WA 2IK8A 2O5VA 1JJVA 1KJZA 2WNSA 4H15A 5J4LA 1R5NA 2Q1TA 3QMWA 1FYDA 3WGKA 2JHPA 1GFSA 2PMKA 3P52A 1TW2A 4GOND 1KJ8A 2QD5A 1XZMA 2WJHA 2P6PA 5KC9A 1A5SB 3STVA 1V6AA 4BGUA 4DMRA 2JGAA 3QFFA 2AOUB 2ID9A 4HB3A 4R2KA 1TTQB 3LS2A 3OA0A 2CF6A 4H3KB 3CRW1 1GPWB 3NC1C 4LNAA 2R4UA 4MXDA 3RVSA 1DJLA 3ONVA 1NPYA 4M0CA 4XLTA 5EUMA 2V7BA 4PSCA 2GKOA 5F9FA 4DLTA 5B2EA 3THWA 1P9NA 3DTVA 3JQ8B 5B57C 1F06A 3B13B 2AE1A 1PO7A 3GLGE 5C5DA 3GCZA 3PNVA 4RY9A 3QOXA 1V2HE 4C2TA 4Q4HA 4R31A 3JASB 5FI1B 1VLYA 1ZGAA 4O4LB 3Q8WA 2FTKE 3WNZA 5IABA 5CMLA 4Y7CA 5I7UA 4RPDA 2CVOA 5FADA 1LSUA 1WVMA 1MO5A 1F5SA 2C2YA 2CMKA 1YK1A 1WXHA 1R16A 3DLBA 4G0UA 4KLRA 4Y2HA 2P3LA 3FYTA 2JPDA 4G1BA 2OUKA 2VSQA 2I7TA 3FNQA 3K1AB 3M6UA 3C3MA 3G0BA 3NYWA 3PI6A 1SMKA 3PUIA 4JYCA 5C3UA 4AG3A 2ZDHA 4HEA6 4B6QA 3D2LA 4J0KA 2X9QA 1R9NA 1NV8A 2B20A 2Q5EA 1AQUA 3EULA 5AVZA 4Z4FA 2DIEA 1JI3A 1LCIA 4INOA 4O4IB 5I9MA 1KDRA 2ALJA 2BPOA 2GM5A 2RHOA 2ZUSA 3KWMA 5H0IA 2FPKA 1TXGA 1V35A 3B20A 3BMQB 3PC2A 4PPQA 4CEIA 2V7XA 1SBHA 2PS9A 1PJBA 3U7IA 4ZDWA 3VOSA 2PS1A 3PT9A 4YMUA 3BA1A 2V7QA 3HDYA 5F4ZA 1ENZA 4HXYA 3RYIA 3ZU5A 1NWHA 1NE2A 1N25A 2G88A 2IOHA 3SBXA 3VAAA 4BUCA 2J7KA 3GT4A 2ZL7A 5E8JA 2XSZA 1HKUA 4CI0B 1WOSA 1PZGA 1Y1SA 2HFKA 1N8SA 5E4YA 2HT6A 1K6MA 4N0QA 1B41A 4MTCA 4L8WB 3IB3A 2CZCA 2P2DA 3KCQA 5DW0A 1IN6A 3RIGA 5GJBA 3FZYA 2VJJA 5FEUA 2BGIA 2DHCA 3CNNA 2AN5A 2EKLA 3KHTA 3MUFA 3ZZUA 4PLWA 2M2IA 3M4YA 3RS3A 4IICA 3UK7A 3OVMA 1G4HA 4TM8A 2ISSD 2ZUBA 4UQOA 3Q6MA 2KM1A 3CEPB 1H2BA 2FFAA 4UVGA 3OY2A 1PT7A 1QYDA 3ND7A 1B15A 2F3UA 4DM3A 3VPCA 2YS7A 3H19A 4MR9A 5BR7A 2XSZD 2IQ5A 3MGGA 2JBWA 2H00A 4PLYA 4YRFA 5I4KA 1RRCA 1U0SY 2HLDA 3GR6A 4FFSA 2YUIA 3A31A 4EY5A 3BKXA 1SKUA 5AW9A 3KKZA 2JCVA 1NUPA 4E1BA 3PK0A 3Q0EA 4XMYA 1ZWLA 3D2BA 2TECE 4XOIA 5G0UA 1DQZA 2DFNA 3HBFA 5ALIA 5FBWB 2F1OA 1IM2A 4CCYB 3TFOA 2H4YA 2H1OA 4IJWA 2DWQA 3HC7A 4XUCA 3MJSA 2EX1A 4JR0A 1E79D 1NLZA 3F9IA 3MJEA 4HNTA 1A8QA 2ANBA 1JEOA 4ZO7A 3U13A 5HHTA 2G9UA 1ECBA 4NICA 4TGLA 5ITZB 2L69A 3LUCA 1SCAA 1J0BA 2YDXA 2C0CA 1F51E 2PFKA 2ZT7A 4XWYA 3THXB 5BPFA 1XKLA 3GGPA 4GPBA 3OJFA 1RP7A 1N1GA 1JDUA 3TSYA 3FHTA 2I2CA 2OVBA 1XAIA 4RPCA 1G19A 3L5KA 4ES6A 4E11A 5L53A 2QVZX 4Y18A 2P0YA 5C51B 1EIWA 3EXIA 2XQIA 1R8JA 2CXUA 3CKKA 3FIJA 4X8OA 3UWSA 3VOTA 2J9FA 1A4RA 3IUBA 5AXCA 2WWRA 5C34B 3RIYA 5I45A 4P0QB 2VP4A 1Z3CA 4LOIA 4RYLA 1WTAA 2VQ3A 4TMWA 4XRRA 4ZZ2A 2BGNA 4YX9A 5ALXA 4LX0A 1LDYA 5T8KA 5GINE 4AKTA 4HSEA 5JYCA 1EVZA 1FP4B 1VL1A 1VYTA 1GU1A 2H7XA 2VJCA 3K53A 3R1IA 1NBME 4WY8A 1A9YA 2K7FA 4Z3KA 4A4DA 1DCMA 4BVGA 1ONNA 1W1WA 1ZSYA 1ZMTA 2JJYA 1X7YA 4J0FA 4QE3A 3G6KA 3SJBA 3WK7A 1S2MA 4MPDA 3P97A 2Y1XA 5AUPB 3AEZA 3DDYA 3W6ZA 4BFUA 2J41A 3IR6A 1I6LA 1THTA 1X80A 3I6MA 4PXYA 2EU8A 3DTTA 2GTIA 5JI2E 1QDEA 3G5AA 4NV3A 1U94A 1YWGO 2BEUA 1WSAA 2KLBA 5FWDA 2Q5OA 4BLPA 3O3NB 1JR4A 2R1VA 3K6KA 1HYBA 2CMDA 2RKOA 1JR3E 2OG2A 1DIHA 2GYWA 4N6GA 2QLMA 2R8XA 1H1DA 3R3VA 2JA2A 3C2QA 3Q2IA 3EPRA 3S28A 5CDTA 1BDBA 4YJ3A 2ZM6B 1UXHA 4UZFA 4II2A 3PFHA 4YUZA 4RLZA 3JCZA 2VP0A 4MV0A 4UAJA 4NMWA 4QUEA 2IXBA 1Q2UA 2GN2A 2P78A 4D9EA 5JYBA 3EPKA 3HFRA 4LJ9A 3QFRA 2WHRA 2B34A 4C0BA 2V7EA 4RU1A 4EZBA 5HQTA 3DL7A 1F8GA 1VKHA 4DG5A 4RK7A 4QQFA 2PQMA 1YRYE 4X07A 2GHRA 1N3YA 1XC7A 4H17A 4HDNA 5AKLA 3O95A 4NMXB 1XA0A 1P7VA 2WYWA 2ZTHA 4CM8A 5GADl 2FR8A 4HDKB 2QZ9A 1M74A 3HWSA 2HBYA 2ZR8A 1TVKB 4R1MA 2Q9AA 1MXFA 1SBNE 3AKZA 4E32A 2P6MA 2YHUA 1Z9BA 1WNTA 2X0JA 3EXHB 3KQVA 4O0LA 3U44B 2FUNB 2C9CA 1CY0A 1KZGB 3M3HA 2XWSA 2XNCA 3UNXA 1U5BA 4UOEA 2ODBA 3BTVA 1H22A 2VDJA 3VDMA 1EGHA 1SK9A 2J4CA 2XUDA 1DXQA 2E85A 3FOAA 4I9HA 5AOCA 3HP1A 3VR1A 1QGZA 1NJ2A 3HR4A 1P6QA 1U2SA 4E3WA 2QRQA 3KT3A 3CRNA 4K2AA 1W36D 2NMVA 1VI2A 2ACWA 3Q41A 5K3BA 3WL7A 1EH5A 3EDYA 2Z1DA 1C4OA 1TFUA 4YCAA 1DZ3A 1PT8A 2FV8A 3WIVA 4ZHSA 4ZRDA 4ML3A 1HE8B 1NI3A 4DNRB 1WV0A 3HYLA 3QXJA 4QRDA 4W1SA 1DAPA 5TDHA 3TOCA 1FFAA 5JSHA 3BAFA 4BMOB 1FU4A 1P75A 3SG0A 1GNSA 3ZX5A 2GPNA 3CNHA 2W42A 2JGEA 3OESA 1T1GA 2FSSA 4KO8A 2XMGA 2YHIB 3W3AA 4Z4TA 5YASA 4GE0A 3BG5A 5GPBA 3B78A 1JFRA 2IP4A 2W2KB 1P4MA 3HS3A 3L7KA 2V7TA 1XHEA 4UUQA 3Q87B 4BRWA 1L3CA 3F4KA 4ZGQB 5B4TA 3OFSA 4FEEA 3DE3X 1I2DA 3NBQA 3RSGA 3T5CA 1CEYA 1GZ7A 3IKJA 1DOZA 2DPMA 2C5HA 2P0EA 3CUUA 3NXKA 2QF7A 1R37A 1RI3A 3KEQA 1T5EA 2BKAA 2KBFA 3K8YA 4HX9A 1U90A 4J1QA 4POAA 5FOQA 3T99A 1ZIDA 5I7HA 2V4DA 1OI3A 1R9MA 5EMMA 4I55A 1OPRA 3IMCA 3LPCA 2CFRA 3ZJ5A 2JCSA 2BBTA 3L93A 3QVWA 2IF0A 1XRLA 4G1EB 1SXHA 3QPBA 4J07A 4Z4GA 1O4WA 1VKNA 1FTWA 3DOJA 2EGUA 1JEAA 1AHNA 1YZQA 4HBZA 4IUDS 2EWMA 3GEIA 4ALIA 3CZAA 3LGSA 2QIOA 4XGRA 2V0GA 1AT1A 3DLPX 1U99A 4MS1A 3UMGA 1H6CA 2VIIA 4QDTA 1VQ9B 1NM5C 5TJHA 4I9GA 1ORRA 4IFEA 3FHLA 2EATA 3WKDA 4BFXA 3ZV3A 2OYSA 3QV1A 1OT3A 2GEVA 3PUVA 4WY2A 3V1MA 1OAOC 1WVIA 2NOAA 1XZHA 2VJDA 2X42A 3CTAA 3OZCA 4OJTA 3WAKA 5CB8A 1UODA 3BYZA 3BJZA 3ICCA 4G1FA 1U3VA 1MB2A 4OJYA 3AERA 1YSCA 3RU7A 4NMMA 5A9TA 3T7EA 4EAQA 4Y7DA 4C03A 1NXTA 5GGXA 3B5IA 4BMVA 5C32A 3GI1A 1N8KA 4RTRA 2FFJA 2AX3A 3UKOA 5IG2A 2W2OA 5IM4F 9ABPA 4AMYA 1MP0A 2R7KA 5LU9A 4H7IA 1F6DA 4UOZA 1SUCA 2YX1A 2RD2A 3NTRA 3O9ZA 3ANYB 1KSFX 2ZJ7A 1T24A 2IE0A 1A4IA 3PU6A 3PWKA 3D8UA 1VB3A 4Q19A 1AZLA 5JROA 4KJXA 4KWCA 1L7XA 2ONCA 2D74A 2PRJA 3A4TA 1TA0A 4GM0A 4KDRA 4EG7A 1NVAA 4X7MA 4XONA 5K51A 2AUNA 4EUFA 1WP9A 4U39A 4X97A 3S4YA 4UTRA 3NTOA 4G5YA 2IX9A 3OIGA 2O3RA 4KG7A 1NXWA 2YIJA 4L0CA 3CX6A 2MJLA 3T3DA 3GFVA 5JJ5A 3JYOA 5DCLA 1P1KA 3FR8A 1HSZA 1MN6A 2Z4RA 1L1QA 1FNNA 1RYBA 3HA2A 4ZAWA 2OM6A 3ADOA 4P4SB 5JQGB 4QU8A 5LLTA 4MVJG 3SBDA 3DLHA 2SKEA 2ZRLA 4NQZA 4MRNA 1J8VA 4PVDA 3HB4X 4RPLA 4HPJB 3EE6A 1IN8A 2QPLA 3V1NA 1YB4A 3DC2A 4FCTA 2Z9CA 3QXGA 1LDNA 1SIUA 4M21A 4N0EA 3HEBA 3HKDA 5AT1A 3RKRA 3DR5A 1KVQA 1UKEA 1YMUA 5EPOA 4IO1A 3WYAA 4JLWA 4BKPA 2C4KA 4EHLA 2QE6A 4KWIA 3A4LA 3ZIDA 1BS1A 4XYEA 4BV9A 5HS6A 4ZKDA 4DLBA 3AGPA 1GLGA 1Y8QA 2VNAA 3MAJA 2NTVA 4XJVA 3TMAA 1J5EB 3R3JA 3JQ8A 4PY2A 4E5SA 2Q4RA 2D2EA 2H5EA 4A0GA 4I6EA 4BTVA 4GE3A 3NXSA 3ISVA 3VQTA 2VAPA 1GU0A 2GD2A 4LDRA 1LZLA 2JIOA 1S1CA 4D8VA 4PQYA 3T9DA 2Q1XA 1VIVA 5FTMA 1E5DA 1I4WA 5TNXA 3D54D 3GO4A 3UT0A 5DNWA 4GQIA 4JI8B 4K6FA 1QFJA 1Q0PA 2Q07A 4QNNA 3M34A 3LVQE 5BP7A 4OKNA 1I6WA 5KTPA 4M89A 1NN3A 2PH7A 1W2WB 4QYSA 2O06A 4IFIA 3E2IA 3P1JA 1M8FA 3PQ2A 3RO7A 1C3JA 4UPEA 1K66A 4WXRA 7YASA 2ZU0C 3H5OA 2CNDA 2DPLA 2EF1A 4MUYA 2R5WA 3N9IA 1EK6A 2P79A 2QEQA 2NZXA 2Q9CA 3HJRA 4PIMA 4RZ3A 5CVVA 3ZCTA 3ADKA 5I7OA 2FVXA 4G5OA 2CZQA 4GQBA 2B1JA 3IX7A 3T34A 1XN4A 5JYEA 5JS7A 1DWQA 3DV0A 2AKAB 2XBLA 2WF5A 2GN0A 3EOZA 3S2SA 4QUGA 4O2RA 3X2FA 3MRXA 4EYQA 4HCJA 5CGZA 5ADUS 1XZJA 4QIHA 4DMMA 4COKA 2X76A 3ZW7A 1LK5A 2G70A 3NC0C 5BVHA 1B2RA 1T2AA 2R65A 1PG2A 4NPHA 4OI1A 4RZUA 5CXXA 1KPIA 2SHKA 2I4LA 3ZWPA 4GX1A 1X77A 5A5EA 2ZANA 5TE9A 4EIWA 3DL4A 1FFEA 3DZIA 2ILVA 4PPFA 3N70A 4WBNB 2O5CA 1H3FA 1NVBA 3E3NA 3BSFA 3H2BA 5T4BA 3UUFA 4QYMA 3AY7A 3RRJA 5DRTA 2ZB8A 1P1CA 1H4VB 5ER6A 3VISA 2IHUA 2O5RA 1X2BA 2HHHB 2VHXA 1CW2B 3F49S 1N7IA 5J2UF 2E4UA 2PKXA 2PXHA 3TEJA 4O6VA 4JWKA 2AZDA 3QF4A 2XEXA 4B76A 1S9DA 3SXUB 4UNQA 4YRJA 1GQYA 4B3RB 1IHPA 1N8RD 1L9KA 4P38A 2DF8A 5JS2A 3G05A 1O03A 1X1AA 3QX7A 3QJYA 3TRIA 3GA5A 5SYAA 1OX4A 1QP8A 1QOPB 4KOAA 4L8GA 1FEZA 1BD3A 3FFAA 4B9EA 3CUEF 3BWBA 2ZPUA 2FHPA 4WW0A 4I5EA 3NPMA 5CFPA 1E9AA 1JHXA 3EUAA 1AHPA 3K9LA 3DAGA 5LZ2A 1CC1S 4A0RA 2L19A 1E89A 1QG2A 3KQYA 4KQIA 5ER9A 3SYMA 3PKJA 3WGIA 3RADC 4O4JB 2ZUCA 3G1UA 3L4JA 4LF7B 2FEWB 3S40A 3KDSE 2PG3A 3A25A 3NBYC 4JL5A 4A5SA 1G8HA 2IYNA 3IRUA 1VQNB 2CDRA 1VFPA 3J7AC 4JZYA 5DLYA 3E4DA 4G0PA 2VTBA 3OM9A 1T8YA 4QT4A 1T0HB 4DWOA 2VJLA 4RABA 1VMKA 1D4FA 4Y2PA 1K6IA 1OOEA 1SOAA 1USKA 2OD2A 4TV8B 4L0MA 16PKA 2GCEA 2JN9A 3I6BA 1GV0A 2ZEJA 1V8ZA 3NBZC 3RUFA 2OFPA 4R9SA 3AHHA 3D4NA 3NMUF 1WR8A 4B5KA 4ARCA 1BXKA 4MGHA 3N5CA 4G24A 2VPWA 2M1ZA 1BRMA 4J0QA 1II9A 1E69A 1JFFB 1E61A 1ZUWA 3LF2A 5CNKA 5ANRB 1Z4LA 3WICA 8ABPA 1FSPA 3I56B 1B6SA 3WSWA 3I8OA 3BIOA 2QJFA 5I7WA 1GTSA 3OWXA 2XOKD 4RMNA 1RWPA 5BORA 3B9BA 3MG9A 4P54A 4U7HA 4OIFA 3CUTA 1I6KA 4PRYA 3PDUA 4Q3DA 4OLHA 3TQHA 2C54A 1OGJA 3EVTA 5KW9A 3CLSD 3LAWA 5FV7A 5CT9A 3FYDA 1Y8AA 3L5OA 4G7WA 1MABA 1NUSA 1QF7A 1XNGA 3OCCA 4JKYA 4MX8A 3SEFA 1BE0A 1P2FA 1DQRA 4DXDA 2VHZA 3J7TA 3ANTA 3QRWA 3IXQA 3U4HA 3JYLA 4RUKA 1Z2NX 4ARZB 3LLMA 1NVUQ 1GUYA 4X54A 3SOZA 4CKEA 5BRJA 3QX8A 4KLZA 5C9ZA 1KAHA 2PD3A 5BQ3A 5IF9A 4Z4YA 5AXAA 3RC3A 1F9AA 2BUBA 5C3MA 3I52A 4B0PA 3GZJA 4R1LA 2X0NA 3PBKA 3FGZA 2ZE5A 4PC6A 1Y8RA 1YRQA 3A1SA 3FFTA 4I6JA 4P3PA 4QREA 5DHQA 1OC4A 4MV3A 4UHJA 2OXIA 4D81A 2VQDA 4RJ2A 1D1NA 1ZA1A 4ZALA 1I3OA 3E1SA 3K4PA 4Z4RA 3ME5A 3NDPA 4QJBA 5FWXB 3SMVA 5LXTA 3OQIB 4F3NA 3N2GA 1K2WA 1ZOLA 2Q21A 3PTLA 5NULA 2QRNA 3OQHA 4KHZA 3D7LA 3VHRA 3SI7A 2ZS9A 1OZGA 4F2PA 3AEXA 1YI2B 2QJTA 5DTQA 3UAXA 4V1CB 1CF4A 4A16A 1C3OA 4IIYA 1FRFS 5JALA 5I5GA 1S1MA 3B9QA 3TZHA 1U7XA 3PUJA 1GM5A 4BTLA 2YJZA 1FNMA 1DWUA 1OLUA 1N5MA 4A0HA 4JYPA 3NUQA 2P4HX 1H2YA 1MX1A 4AMBA 1RJDA 4S12A 1GA4A 2ZAGA 3KE9A 4U4AA 4CT4B 2QMEA 3OJWA 1QANA 1CF2O 1Z29A 3LOUA 3OUTA 4N47A 1I3CA 5EKTA 5M29A 3ZHVA 4ZAVA 2QN8A 1KFKB 1M6VA 3NO4A 4Y2TA 2H1LA 5JJKA 2XNJA 4UAUA 3CMCO 3TD2A 4N4AA 3NIFB 5DLDA 1HT1E 2OK7A 3OZBA 3ETCA 4NJMA 3NHPA 4MKFA 2VPQA 2PK3A 2C3PA 3L6UA 4Q48A 5JSFA 2XWQA 3H1BA 4AJNA 2YS6A 4EB6B 3F4BA 2WYIA 5AHRA 5ICSA 5DYTA 5CXUA 2AI1A 4YECA 4Z9AA 3UK1A 5IU6A 3G59A 3LBYA 4GAEA 5I7FA 1HY3A 2VQFB 1S8FA 1Z25A 4I81A 4E15A 2JHGA 2XD9A 5IFLA 5IX8A 5C2JB 3JQQA 5JV5A 4TQAA 2WHEA 1XYYA 2P9CA 1E32A 3GLTA 3FCOA 5KNDD 3W5VA 4G26A 1GNPA 4YONB 4BVFA 4IDAA 1FS4A 1BW9B 5CRIA 2QBYB 4KXUA 1XRRA 4KRXA 1U9ZA 1FQKA 4KUGA 3H0EA 4R2XA 4AZSA 2EJTA 4PPYA 1LI7A 2OQRA 1ISHA 3K2QA 1IRIA 2AC4A 3JS5A 2WNHA 3JZAA 2DWPA 4R2IA 4XFKA 3PKZA 1JJIA 1YJXA 3OX4A 5HNKA 3V8VA 1ORDA 4C43A 1SC3A 2B8EA 2QRUA 2VPXA 3T7KA 4CIXA 4HDNB 3GJ3A 3B6ZA 5DN9A 4OQZA 4WOBA 1WEHA 4PC7A 2HK6A 3UAYA 1T9ZA 3S7ZA 3NV7A 2CJWA 1XWWA 2DWUA 5DBIA 3MFQA 2R47A 1GNQA 4KW7A 1UK9A 1NOKA 2XHEA 1DRWA 3FDJA 1I4OA 3TL6A 3PNLA 4ZJZA 4WKBA 1L6RA 4B82A 2XV1A 5IDYA 5IK2A 1NJFA 3ZU3A 1F2TA 4D9IA 2G6BA 4I14A 1J99A 5EVCA 3K32A 5EWMB 1WSDA 3KJZA 2GZSA 3S5UA 4AJHA 3UJDA 4FNMA 5JSUA 4EVSA 1PP4A 1BDHA 1KARA 2KQUA 2H6EA 3EWSA 1NVVQ 3A6HA 4ZZ0A 1I4DD 3EQ8A 4P9NA 1U9YA 1XVVA 2AG8A 5C4GB 4EGSA 4R16A 3DEHA 3KEFA 3G2OA 1LWNA 1P2UA 3OKAA 6CHYA 1MVNA 1K28D 2HSWA 2H5JA 5LZ4A 1HQCA 4YA6A 5E7MA 3IL2A 2I6GA 4NEGA 1Y4AE 3O3CA 5K8TA 2JD2A 1CRZA 2W2LA 3WV5A 3NATA 2IUYA 4P4LA 1RADA 2Y1CA 1RIFA 1FK8A 4P7FA 1QGUB 4LXHA 4BKUA 1WMDA 1KZ4A 3BD9A 3IBYA 3FNBA 4NHOA 5IAJA 3WGLA 3OKXA 5CLGA 4G0QA 4BMZA 4BO5A 1BEZA 3UA3A 1Q0UA 5AK5A 3R3WA 5LXTF 1KKLA 2DQZA 4DCVA 3KXLA 1YJ8A 4E4RA 3ADDA 4OY3A 3W2FA 1E1QA 4Y6GB 1EDZA 1LWOA 5F77A 5C8YB 2FZWA 3C74A 3R24A 2OFXA 1TQ8A 4TL6A 2Q3HA 5JQGA 2ZS7A 3GGGA 3GJTA 4S1VA 2QRVA 4BX8A 1M1YE 2CNNA 3DGEC 5KB3A 1KETA 3ECSA 4JEUA 2FZLA 1HA3A 5KDDA 4Y2VA 1XRNA 3RYFA 1QHFA 4WXEA 4I6GA 1WOMA 3HGQA 5L3SA 1T43A 1KDZA 3FOBA 4MDYA 1KAMA 1ZN2A 4PC3A 3IT0A 3T9BA 2FPUA 2IYOA 4LV8B 3QFCA 3T5PA 5FAKA 2PZAA 3I3SR 2V7WA 3NM6B 2ODWA 1MJGM 3TTTA 3ZWMA 2UVQA 1ZSVA 3ZIAD 3H42B 1ISIA 2NYVA 4RGQA 1WNFA 2JKZA 3C4QA 2PL3A 3HU1A 4NG5A 2HJHA 4P7KA 4UE2A 3P9CA 1QC5B 4JI0B 3DPSA 2WIGA 3DVQX 4ZIRA 4FK8A 3D2CA 1R8SA 3DM9B 4X84A 3QW2A 5C46F 421PA 2B3TA 3FWZA 3IBTA 1IQRA 4MCJA 1NPDA 3MWDA 5TGZA 4KE6A 4QBGB 1QHGA 4YWHA 3W79A 1SXJC 3GN2A 4B33A 3AUJB 1P33A 4NSNA 2CDNA 1KJWA 1M2OB 2CHFA 3AYXB 3DM5A 4EGQA 1P18A 1ZJ6A 2I2WA 4GLFA 1JEQA 5HM6A 3HP7A 3C97A 4IXWA 4KV7A 3RTCA 3G68A 1QZ3A 2OGZA 2H0QA 3A3NA 3MAGA 1I32A 2MSDB 2QTAA 5F5NA 3TRDA 2X1LA 2L82A 5EZYF 1JVNA 3VTAA 4WFJA 3O9MA 1Z0JA 2XUIA 3HVJA 1DVRA 1MKYA 1JU4A 5KSOA 2AMJA 4WX2B 2GNAA 2IBMA 3HCPA 1WRBA 2YZMA 4MO2A 4OHYA 3NNDA 1JV2B 3LQFA 3DSRA 2PLFA 2BGRA 5B58T 1QP4A 1RWKA 4U7TB 1XEWX 1V0JA 4HWTA 4G8DA 1QSGA 3W6UA 5AW7A 3J81A 3K2EA 1XPUA 3CLVA 4AMZA 1PGOA 3VVCA 4E09A 4GIBA 2RGBA 3QKTA 4MCAA 2CWDA 2P9HA 4UW9A 5TT1A 4PEVA 4UVHA 3ZWNA 1E58A 4ZGBA 4BMXA 5CDUA 1Z2OX 4OXKA 4NKRA 3SIWA 1T2DA 5EP4A 3WYFA 2CJXA 4MV8A 4DUYB 1CZNA 3LY5A 3DP7A 2H08A 2ZUTA 4P8RA 5HG0A 3AJ9A 3FVQA 4CR6A 1T2NA 1QFXA 1OB2A 4AG6A 5AYVA 1NI4B 1E7MA 1FUIA 4EHFA 4MVJM 5LFAA 4R1SA 3I0ZA 3Q8KA 5F7OA 1G8SA 2I7XA 3E9NA 1AHHA 2XT9A 2IY8A 3LDFA 1OXUA 4ZZ3A 3RYCB 3SM9A 2FPGB 3G2NA 2VDUE 2W83A 4IIHA 4G89A 4ATNA 4LRQA 3D5TA 3GNTA 5GOZA 3VKUA 3EEBA 2GZMA 2V6FA 3EVAA 2CF4A 2ZJOA 2Z8YM 3L1VA 2V9PA 5HIMA 1C3EA 2X2OA 3RJ5A 4YPVA 5FNVF 5KNBD 4K9SA 4DSZA 2BGUA 4RWZA 1CP2A 3RS8A 4N1AA 3HRHA 3WLJA 2VDMB 1KZ6A 2ZCUA 2QKYA 4Z4SA 2Y1FA 2B1QA 3SKYA 3ZE8A 3IOBA 3MWJA 4CM6A 1JZTA 3LHSA 3CLKA 5H9WA 2OILA 3F9CA 3W5IA 4KP7A 2PNJA 2HX1A 5D7NA 5I48A 4BO3A 1CUFA 1S2GA 3UZUA 4B4UA 2RH5A 4HLQB 4W5OA 2YNMC 4PQEA 3WYDA 4OXNA 4XEHA 3M6MD 1PNOA 3NUZA 1Q14A 4IQFA 3AO0B 3NI2A 2JFQA 2POCA 2XCSB 4EHHA 3E82A 3FPHA 1TLTA 4AJEA 2P8SA 4B7AA 1DAFA 2A78A 2Z6BD 2ATXA 4LV6A 2DVMA 4BBZA 1H23A 3HHPA 3QU5A 2SCUA 4U02A 3V7NA 2EAUA 3CGGA 3ZNPA 3N8HA 3KIPA 4YCBA 3KQNA 3WO1A 3RTAA 5LWQA 2C99A 2RGWA 1CVIA 2XA9A 1DPFA 1MCZA 1W5FA 2IYVA 2A86A 1FDWA 3KX2A 3QM1A 4FXPA 5CNJA 2FPWA 2ZPTX 3G2IA 3EAFA 5BMVA 2CYCA 3TZCA 1O94D 1TCCA 1EFKA 1X0VA 4D4IA 2XMDA 1NMEA 5TPZD 3IIKA 2FR0A 2RHJA 1DTSA 1HM5A 2BI7A 4PG8A 2O0HA 3L49A 5E0KB 3SDZA 1J2JA 3V48A 4MP3A 1KZYC 2IV2X 4NCHA 4QV2A 1RAFA 2H18A 1PEAA 2VHEA 4NX2A 5KYWA 1KYWA 4Q1BA 1AK9A 5ES3A 2W6CX 3SPXA 5MF6A 3KZOA 1QR2A 221PA 4GMXA 1JYFA 4FQ5A 4M0UA 5H80A 1RTTA 5F23A 1JFLA 4K86A 3MTQA 1JAYA 2C42A 4RTMA 2VK4A 3QU7A 4MYDA 1U9JA 4Z9YA 3A37A 4Z99A 5A02A 2VKTA 2JS7A 3DDNA 5TPZA 4JKOA 3UWPA 3MA0A 3SEZA 4KN6A 1CUAA 3TDMA 3TW6A 2QTLA 2OAGA 1KBQA 3NH9A 3UMSA 3UMCA 1GTRA 1GUZA 4GI7A 4Y8VA 1P3Y1 4KXNA 5AKGA 5K03A 2VYVD 3ICQB 4F56A 1Y6RA 2HPHA 3VZPA 3EC2A 3Q85A 1GYPA 2BEVA 4REOA 5EINA 4EB3A 1TCBA 2WT4A 1U0RA 3BRWA 4XWGA 2VJMB 1DXYA 3IUQA 4ZPJA 4PLHA 3BWXA 4RJKA 1OBVA 4LBWA 4RZSA 4TV8A 3HZOA 3AIKA 1PK9A 3L2OB 1KIFA 3FPCA 2H59A 3X3HA 3O9VA 4MDEA 1JF8A 2BLNA 2EEPA 2GX6A 3E70C 4JB8A 5HOEA 4XJTA 2OV2A 3U7JA 4AYXA 2CXHA 4AUKA 1WZ2A 2VHCA 2QJOA 1I8TA 2HZ7A 3HCFA 3KUKA 3NASA 5E7JA 5FXMA 1GEEA 1SWVA 3N0VA 3PFWO 2ZWAA 3EQ9A 4WTOA 2ILTA 1QMGA 1VRCA 4LS3A 3IVCA 4RHEA 4UC0A 1C8KA 1RWQA 5F78A 1IY8A 1YS9A 1US8A 5IWAB 3AVPA 2QJWA 3ZGVA 2QD1A 5EWJB 4XDZA 5P8WA 4UHFA 4LIPD 3L7NA 4H6XA 1N57A 1EX7A 3FMIA 2IELA 4PIVA 1N77A 1UC9A 3BSYA 1OV4A 1JKMA 1P4GA 3QVXA 3RPEA 1CHNA 1I24A 4FFRA 2FMTA 3K70B 1MJNA 4MRPA 4B2LA 2WWVD 1W4BA 3SHTA 4YYEA 3CPHA 1YVEI 4EZIA 3BGVA 2HI0A 2ZUUA 4HDMB 5TMBA 3ZZMA 2H8GA 1U7WA 4FI3C 1S2LA 3GW8A 2XIQA 3INTA 1VG8A 5BNFA 2BGLA 2GEUA 1G59A 3GLRA 1H1LA 4GBJA 1P8AA 3G9QA 4YJ2A 1W2BB 2FLWA 5IW8A 1XXHA 2Y0PA 4N82A 4RO0A 1Y8RB 2JEYA 3A4YA 3FHOA 2EGHA 2WKWA 3JY6A 2HBQA 4TLBA 1UC5B 1T0BA 2ZRMA 3HL4A 2C2KA 3KJIA 4B4WA 1E7QA 4G09A 4Q7QA 3Q8XB 1MHPA 2WKQA 2WSYB 1FE8A 4NYMR 5F5LA 4DQUA 1R6BX 3LECA 1ML4A 2C0QA 2DR0A 3GRAA 2RJ3A 5F1OA 5IH3A 2OHHA 4BAGA 2QTTA 2GUWA 1YHQB 1I4TD 4YK7A 4HVCA 1QQBA 5EQTA 4KQHA 2IX3A 1SG0A 1UBKS 1CE8A 2XQJA 1KO5A 3DBVO 4IM7A 2QYSA 2BUCA 4GGMX 3IP5A 5J5AA 2RG1A 4FJ0A 2LKCA 5IEBA 2FXIA 5A0FA 3ZEAA 1DFIA 3V4PB 4BU0A 4CODB 2C7BA 4PTZA 3H1TA 3SC4A 1YFLA 1U8AA 3FDZB 3JQFC 4NJEB 2XF8A 3CSDA 3F71A 3HO6A 1FYFA 1TZ2A 2F62A 5EWLA 5H83A 3S2YA 5IZ4A 3IQIX 3ZLVA 5A2GA 1SCIA 1E4EB 3DC7A 3GSIA 5DDIP 4EY8A 1I9CA 2B8TA 2QGGA 3NHRA 4IOMA 1DBWA 5GIOE 3AR7A 1X74A 2LD4A 1LV8A 3CP8A 3H5WA 2C5SA 2ZITA 3M4ZA 4HH0A 3NDBB 1ZH6A 5BV8A 4V0NA 1I7PA 2ZRQA 1SVWA 2FR1A 4JV5B 3K1JA 3KLBA 1QGUA 3PEVA 4E5PA 3B38A 3L01A 3SSNA 3VO2A 2D1FA 4K46A 5I7AA 4P58A 4QHSA 1YS4A 3PLNA 4XD2A 3UV6A 2O3TA 5DM1A 1E3MA 3Q3HA 5F4OA 3L4BA 4IIVA 5KQPA 3OPQA 1TF5A 2XBUA 3P9QA 1E9RA 1WMAA 1LV7A 2YXNA 3UJBA 2G1AA 4EM6A 5JRZA 3P5SA 2BGKA 3FSEA 5AHWA 2XQVA 3C6XA 2HCRA 2QGFA 5FA5A 5EP1A 1NVFA 2KLHA 2DUJA 4AW9A 4N76A 5KQMA 4M0LA 2GO1A 1IVSA 1AO0A 2WT8A 2FMIA 4DV3B 3S44A 2DY0A 1GPUA 3AH8A 1ZD4A 1K7FB 1QO7A 2CCJA 4PZEA 4FOOA 5AM0A 1FX1A 1Z0DA 3UK0A 1CY6A 1W0KD 3KKQA 4PHTA 2PFSA 1A7UA 3QYPA 1MZPA 4F8YA 2PYDA 3OHSX 3ZY3A 2V9ZA 3HYCA 1NQ5A 2PV7A 4Z4EA 5A4AA 4UBNA 1UKZA 1E3EA 3BEDA 4C78A 1XVUA 3IPXA 3OLYA 1MD9A 5JD6A 5M5BA 3IUPA 2H2HA 1GL9B 3G1WA 4R7ZA 5CTAA 5F2OA 3UIEA 3MERA 3ICWA 4YGYA 5FLYA 1NMQA 1E59A 2IP1A 2GESA 3BTOA 5FTNA 4F3KA 1WB6A 1FVOA 1IXKA 2QTWB 4DC0A 5KX5B 3FGNA 4DM4A 3T5AA 1J2TA 5CR9A 4KRYA 3LUGA 3MVEA 4PX3A 2HUPA 2E82A 1G98A 2JAQA 2R1TA 3R76A 2WNIA 1NW5A 3ZWAA 1NONA 3NYIA 2UYCA 1DL5A 4K7JA 5GV8A 2JDID 4FILA 5JEEA 4XOPA 4L75A 3IQXA 4GX5A 4E2FA 4IEIA 5BYAA 2OECA 3SZGA 1RLIA 2P67A 4ALJA 4DSTA 1V71A 5TS2A 3DF7A 3ST7A 2ET6A 2ZIXA 1BH2A 3QUAA 1Q3TA 1JQ5A 1AZWA 4H7DA 3P9YA 4ZWNA 2YY5A 2CNKA 1MX5A 1YAJA 3OOHA 4IXNA 5F2KA 2XY4A 3V6MA 3QQPA 4B2PA 4MVJF 3QPUA 4WBNA 1HMYA 5CLLA 4EGCB 4JN6B 3H13A 4V0LA 3FRHA 4C2UA 1Q17A 1SA0B 1XBTA 1L7BA 5FOSA 2NO1A 3IT3A 2VG8A 1P9WA 4PCVA 4OPMA 3G3EA 2WSBA 4REQA 3OJ0A 5CCEA 3HKBA 2CV1A 3RHZA 2GT1A 4RTKA 2A5DA 2QE7D 3KKMA 2XD4A 4C4YA 3UT6A 3TCNA 2XAAA 4G01B 1H85A 4NOMA 4A2WA 1CR6A 3L6EA 1BCRB 5LVAA 2OENG 1WQ4A 1X1TA 4BP3A 1J5PA 2LGJA 3GXBA 2ENUA 4QPJC 3ZJTA 2PY6A 4MYTA 1RWVA 3BMCB 3LPLA 3MFYA 3BXFA 3A28A 5BR1A 4MVJP 4CEHB 3OU7A 2W93A 1GNRA 2O4UX 4JYBA 3TE7A 1A8PA 3EN0A 3KZNA 4EB0A 3UV3A 1N8TA 4ZIRB 2Z2XA 2JIQA 2XB2A 1KBOA 2PGDA 3UC5A 2J07A 1U2TA 5ECGC 5IT9A 4QRHA 2J3IA 4UTNA 1MR3F 1SC9A 3WIEA 4P3OA 4WEOA 1VI6A 4TOIA 1T9DA 3JVUA 2QTNA 1UPTA 4P25A 1YTLA 3SFTA 4BU1A 4FOLA 4NV0A 4EEKA 2Z95A 2VP3A 2VK1A 4EGFA 4CFZA 3OMLA 1YJCA 4RK1A 1E3WA 4MJXA 2R00A 4I8XA 4B3DA 3IAS1 3F6PA 4D79A 5FL3A 1CRWG 4DJ5X 4ZYUA 2MYPA 1QHXA 1A7AA 1CB7A 1U0FA 2P7HA 1DIRA 4U2FA 5I3ZA 4LF5B 1VHOA 1OYVA 3LQQA 1V95A 3BK2A 1H1TA 1JVSA 3F1KA 4KFTA 2YCLA 1JXAA 2ZYGA 1Y1KE 2Q49A 4XI9A 2ZJ4A 4MHTA 3T7IA 2Y1GA 5FIUA 1NI5A 2REQA 1Y42X 2VYFA 1QKIA 1GJRA 4TQGA 5KJFA 2D8AA 4KBGA 4UMDA 4EOGA 4OOSA 2Q3CA 4IG9A 2X85A 2JJ1A 3BT7A 4GLJA 2Z9DA 3AL3A 4Q3EA 4D9JA 4D9GA 1Y3DE 1Y6JA 5ITSA 3D7NA 3O8DA 2ASVA 3INNA 2QG6A 2LTAA 1OMOA 4RYDA 4RULA 4W9MC 1SXJD 1LLUA 3DHNA 3ZXSA 1XT6A 4XTRA 3OE7D 3STUA 3FF4A 1IQUA 1MO2A 4CZ2A 3EJWA 3A1PA 2CVFA 3U49A 4R2LA 2W98A 2XMCA 4KLNA 4AF7A 2ZFUA 4EA9A 2A2ZA 1SNYA 3U39A 3ZLUA 4Q9DA 5DRYA 1CUYA 1NI4A 4GBGA 4OGFA 4DA8A 3G85A 2P6RA 1RI5A 2AK3A 5HCIA 4ECAA 3U3ZA 1OR8A 3S8YA 4L07A 1PLKA 3A2MA 1GGVA 4KJZA 1II0A 4ZI5A 2WQZA 3WIUA 4PIPA 3BILA 4IHJA 2VS1A 5J2UB 4WXMA 4NIMA 3SKXA 1WXXA 4JIGA 3ANLA 3F6BX 1FW8A 3T61A 2LVBA 1O95D 3V1TC 2GUGA 5G0WA 3RTGA 3ILVA 4K6OA 3DAYA 1V39A 1ZNXA 2HNAA 3R5JA 4WNCA 1M6YA 1MENA 3BIWA 5KYGA 3B48A 2IKSA 5KOHA 2VJAA 4RDHA 1EUDA 1L7DA 1S8AA 1ZOPA 3E8XA 3LBNA 3QBVA 4IDPA 4UE3S 4ZVVA 2FWPA 2QMOA 4IIGA 5EJFA 4B8WA 4BWGA 5CDYA 3W9YA 1AKWA 2EX4A 2OWDA 1PR6A 4YNBA 4BYMA 1VPDA 1D3AA 4XVUA 2NVOA 1PS9A 5B1YA 4CETA 1BNCA 4GMFA 1L4GA 4U1RA 5ALRA 4CLRB 4TTRA 2WAXA 3AL0C 2XW6A 2AN3A 3AEQB 2C4TA 4JS0A 4JL8A 3WFIA 5DM70 1ELOA 3OW2B 3EIWA 4RS3A 5CVDA 2IODA 4TUYF 1HLPA 1WXWA 4U9HS 1VSBA 5DXFA 3VHXA 5KTYA 4ISCA 3UWDA 2NNLD 4EENA 3CR3C 3TAXA 1IH8A 2JNWA 5BN4B 1CQXA 1XWFA 2ZR9A 3HV0A 5LOVF 4OHCA 1W4CA 2IYQA 2JJ2A 4D0NA 3W4IA 3BBPA 1TM1E 1JPJA 3T38A 3PD0A 3JQBC 1YR9A 4BFZA 3WMRA 3AM5A 3PRJA 1AQLA 4M0PA 5BMVB 4QOHA 3IVMA 2XWPA 5BN5B 4D6PA 4Q05A 1M76A 1USVA 4JUAA 2F6RA 5JVDA 4J9VA 4O2BF 2FQYA 3CX3A 4TXLA 5HZMA 2IYSA 4AF6A 1WS6A 3N1UA 2Z3ZA 5ALGA 4D25A 1WB9A 2ZI7A 2Q1UA 4NENA 3WMGA 5A7GA 2H1FA 1HC7A 3KZVA 4KAFA 1KVRA 5K8VA 3FPPA 4PLVA 1Y7IA 2JJ2D 2YV5A 3HV2A 3NP9A 3IUMA 4MVJH 4PO3X 5EYPA 5GJVC 1T2VA 5SZJA 1M2NA 4K5QA 4WLNA 1MB9A 3GLGB 5HILA 1P3DA 5LQJA 4MWTA 4HFJA 4YDSA 4AVYA 5ARDA 3D6UA 2DULA 1IOLA 2ZJAA 1NY5A 3HJCA 1G16A 2QAGA 2X13A 3BHIA 3VZSA 1XMPA 4PFQA 4RLHA 5K20A 3L7JA 1AHIA 4W8OA 1G2PA 2M9MA 4Y2JA 4E08A 3MMSA 2Q5LA 4EBBA 2VP9A 4JWTA 3KB8A 4K03A 2FQQA 1QJCA 2A7XA 4U7WA 1JHDA 4OHZA 1R0ZA 4JYMA 2PMFA 5JCOA 2YKGA 1GQ2A 4DJAA 1AO3A 3HBJA 3ZE6A 1M5UA 1Z4KA 4UNNA 1KQSB 1D2GA 1PFKA 1YRWA 1NKVA 1VQLB 3WL4A 4ZAGA 4MWDA 4MP8A 4J2TA 3IKLA 1XQBA 5BN3A 4JB3A 2A92A 1LDBA 2W43A 3OUUA 4TKLA 2DFVA 4HDSA 5EFOA 4KQFA 4TKZA 2XRYA 1G66A 1P2VA 3KB1A 4WNAA 2EZ9A 2FKNA 3NHWA 2J4DA 4ZQIA 3SX4A 2AMFA 3S1AA 1E4EA 3VHQA 3SLRA 5JADA 1XO1A 2P6OA 3WDSA 3V7UA 3TB6A 1JIVA 4R1TA 1MUUA 2BW0A 5B7QA 2GVDC 4BV2A 4EUNA 1MORA 4TV9F 2FUEA 3OE5A 3O8OB 2AN1A 5AW3A 1FUEA 2DWCA 2G9ZA 1KC3A 2R7MA 3GDWA 2LIPA 4RF3A 4TTTS 3PGJA 1XD2A 3STXA 2PX5A 1EEHA 2WPDD 4UCXA 4CQJA 1QQTA 1YR3A 2C58A 9ATCA 1R4MA 3SZOA 3EWAA 1T2CA 2G8NA 4G1UC 3T1OA 3AR6A 4HG2A 2QUBA 1W75A 1M7HA 4OAOA 4LCJA 5LA6A 1WUTA 4QGGA 4Z0NA 1PL7A 5SV2A 721PA 2IH5A 1UWCA 2R4TA 1CBUA 5HOQA 1LRLA 2QX6A 2BGGA 4C14A 1CJUC 3WDKA 1N6HA 1YT5A 1WOPA 1WPGA 2Q28A 2Y4NA 2ZDGA 2XTAA 3VPXA 4JMQA 4OPOA 1OBOA 1WL8A 2BGJA 2FFHA 1VKJA 3EQ6A 4G1CA 5LB2A 4LRTB 3O8QA 3DW1X 4XDGA 3JTMA 3KALA 4GNKA 1TUIA 5E3HA 4IH9A 4IDNA 1NQOA 5DIFA 4FQ8A 4PN7A 2QMYA 3KQSA 2R2AA 2J4FA 1V5VA 4M9UA 4HUQB 5HA5A 1ONSA 3MJ4A 3I9KA 4CTNA 1M34B 3ZVRA 1XDSA 1VLQA 2E4AA 2F67A 3B3AA 4W9NC 4HATA 4LRSB 3VUEA 3EWIA 2I55A 1E1CA 4K81B 2IEIA 3VU3A 1OA0A 2NYAA 4DCTA 5AUOB 1LDGA 3BMNB 3MQ2A 1L5LA 4F4FA 1L8AA 1OV6A 2B4TO 1PD0A 2ZWMA 4X7DA 5IJ0B 4OO3A 2IU6A 4HR7A 4K0KB 2DOGA 1I36A 5BW6B 2CUNA 3C0KA 4FN5A 1KBZA 3GAAA 2P68A 4I46A 4DUGA 3KQUA 4M6WA 4F9GA 3RU9A 3IULA 4CMAA 2HYIC 3QNMA 4IRMA 1JI0A 2GI4A 4J4TA 4BO4A 4P1ZA 5BWNA 1KDYA 3BE5A 1D2HA 1ICEA 5IC6A 1HPLA 1PYDA 2IEDA 2OBYA 4ZO4A 4OUDA 4CDGA 1M67A 1E7WA 3ACBA 3AUXA 1UDAA 4NARA 5HF9A 5LR6A 4X64B 3KQLA 2C5AA 3M6WA 1IONA 3AFHA 3BWVA 5JH7F 3AUFA 4XH9B 1D04A 5DT9A 2H9AA 4X62B 3O31A 5ICEA 1RBYA 1TQHA 2AVNA 2FJPA 1EQ2A 4FZ5A 3ELBA 1IY1A 1D1QA 4H9GA 1GILA 2ZIXB 2PXXA 3ANXA 3D8NA 3GYBA 3LL7A 1M2KA 4TS3A 4GDMA 1CQPA 1JDJA 4RE5A 5M34A 2PTHA 2YY6A 5EIAA 4TPKA 3W0LB 4ZKEA 4RQTA 5IANA 2H3HA 5JBQA 4LHYA 3UT5A 2PZ8A 2VK2A 3KVNA 3GVKA 1YQWA 5KEIA 1F60A 5LBUA 5K4HA 5BYKA 3KXPA 1XYGA 1WMFA 1A9PA 5FV4A 1FP7A 2I6SA 2JFBA 1BH6A 2VATA 4MEJA 1LI5A 4NS1A 3U7QB 2HT1A 3Q0TA 1Y9EA 3VX3A 2PJRA 3GEEA 3GQBA 3ZVNA 2MTBA 3CWZA 4FTWA 2IYYA 3NBMA 3VAYA 2G09A 3GC6A 5KKCA 2HMVA 4PONA 4TRMA 3QXXA 2Y9PB 1U5AA 1K68A 3A8TA 3I92A 3UK2A 2CUTA 2WR8A 4ZT3A 2J48A 4C6HA 2F3SA 3DVRX 5DULA 3PEFA 3DO5A 1P73A 1VQKB 4GEGA 3SYLA 1JLLB 5NLLA 4FOPA 2JW5A 4DM7A 1KGSA 2FXVA 3DKIA 3UJHA 3DDWA 1CY8A 2AJTA 2WJYA 2P62A 4YAFA 1Q16A 1EVYA 3WXBA 4DR6B 1HDZA 2X0IA 1SVSA 2WHPB 2XRFA 2W2NA 4GD3Q 4ENVA 4YUXA 3H6KA 4X3PA 3TBFA 4PAAA 1BVUA 1ESDA 3IQZA 521PA 4IH1A 2VUIB 3E15A 3X1JA 2DYIA 1GEGA 5CVTA 2OQIA 5K2MA 1N6KA 3G8CA 2BF7A 3CH4B 4IIXA 1VI5A 1PJ7A 2I3GA 2WTXA 4P12A 4QJ5A 5EMNA 1RQLA 4F3TA 5AK0A 3RRBA 3UJCA 1PJ5A 3DLTA 4WK4B 1V9SA 4PZ0A 1ORTA 5E9QA 4DTIA 4OKSA 3GUYA 3BMOB 3E84A 5BWOA 2X23A 2ZCJA 3P0FA 3HN2A 2H51A 1SH7A 4UKDA 2DX7A 2EKZA 4WVFA 4X61A 2GEDA 1X7WB 3H9GA 1JW9B 4ZU6X 5ICFA 3UJ3X 4D42A 3UHFA 1H3EA 2COEA 1L4HA 3NBKA 3QZUA 5DM0A 3RF7A 4YP1A 3VO9A 3C6ZA 4KQ2A 4AP9A 5LOVA 1HYGA 3Q7TA 2CUZA 3O91A 2JKYA 4UTVA 3ESDA 4DREA 5B53A 1QIMA 2W37A 4XM3A 4LJLA 3PUZA 5EHZA 4RHXA 1W44A 3ABQB 2O6LA 3K9GA 2QM7A 2BEKA 4W7HA 3S3TA 3URKA 1VQ1A 4ZVLA 3H5AA 2NIPA 1N0UA 4MKRA 5BQ5A 1PS8A 4EPYA 2VUUA 1S9HA 5EXTA 2VSOA 3NZEA 4GUAA 3U4QB 4AMUA 1SWWA 4WESA 2B25A 3EGXB 4UMFA 1GTL1 5JC1A 2X4DA 3B3FA 4RFSA 3EZGA 3HKBB 2W48A 3I01M 5B3LA 5ABPA 4LHWA 1L4NA 3ZCSA 4YAGA 1JA9A 4RH1A 4JKIA 1KO7A 1JALA 1LTKA 1NBAA 4JVLA 1WO8A 1USIA 3ESCA 5FT9A 2GA8A 3EFOA 3T4XA 3WHPA 4BQSA 2J0SA 4OQFA 3UJ7A 1BN6A 5EXSA 4D92A 2O8VA 2XNSA 6Q21A 4F93B 4NBLA 1M6HA 2XZOA 4RZ2A 2ZJ8A 4NU5A 4ZO6A 3WGYA 4EGAA 2IS1A 3FJOA 1BFDA 1P4SA 1ZH2A 2JLAA 3CW9A 1I7DA 5K8LA 1P6XA 2FW7A 3EZ7A 1SELA 4FZ3A 1ZG3A 4J4HA 1U2GA 5F4JA 3WB9A 5EZYA 1R50A 4PLGA 2B0JA 1HG0A 4H27A 2MSCB 1KMNA 5C7IO 3CGWA 3BY1A 2ZUFA 1T4DA 3DT9A 4Z5XA 4NPAA 2OHJA 4YMLA 4RAOA 4ZAZA 1XP5A 1VGVA 1EFCA 4G56A 1AD2A 2GPBA 1C9YA 4B6RA 2I4IA 3GD7A 1MRZA 3EPPA 3CC8A 3UJ9A 1UDCA 1DCTA 2EP7A 1B43A 4PXAA 2PUJA 4KFSA 3I8SA 3H9UA 1E1MA 3HJTA 3H94A 1IN5A 2MSKA 5A9SB 4FFBB 4PC1A 4X90A 1AG9A 2G8LA 3MUOA 2NUPA 3U26A 1R4ZA 2G06A 1IY2A 2BAGA 2YVAA 4GBED 5AVRA 1GZUA 4B3IA 3QFTA 1RCFA 1K97A 2CEKA 2REQB 4OOXA 3C6KA 3ER6A 3AR4A 4EO4A 5CDSA 1NG9A 4C0WA 1Q12A 1YB5A 3LQKA 4M0DA 1T1EA 1Z5VA 5LDDC 2CJFA 1DXHA 1DXOA 2Z9BA 2AR7A 1WDMA 1Y4DE 1NR1A 3KUCA 4AKIA 4WPGA 3ORRA 1GHTA 1OXBB 5GV7A 3GG2A 1EQAA 5FQNA 3A2NA 2HRDA 4CU2A 4BX3A 4RKRA 1M2GA 4G0VA 1M73E 4J4BA 3NAMA 4G4IA 1WHSA 3V2GA 2VF5X 1DRJA 4FGSA 4NONA 2HXSA 3E9MA 2I8LA 4IO0A 5EJ6A 1OAKA 1ZQ1A 3QBEA 4KHPB 4I8DA 2QTCA 5LD2C 1HETA 3THRA 4QXQA 3OY7A 1AURA 1NR5A 4BIMA 3SQXA 1Z15A 2H1WA 1XLVA 2XUAA 2EARA 4M1QA 4UTZA 2P35A 3DFZA 3JZMA 1K7YA 2NXJA 2CXSA 2ZE8A 5I9NA 3H5TA 5EUCA 2JCXA 2KWIA 2EQBA 3EIEA 3MCTA 4R8LA 3JWPA 4S2EA 4WI1A 2DFPA 1VE9A 5CYPA 3GOHA 2OKCA 1ABEA 1R66A 1IVNA 3K0EA 4YV2A 1RDFA 2C9OA 3R74A 1H8ED 4OF4A 1UWVA 1BFKA 1OJLA 1NYTA 2PSHA 3PZBA 4R2HA 1VHDA 2Q5QA 3BRSA 1W0CA 4FR5A 3RAGA 3F6SA 4Y9DA 2CYAA 1IUNA 4LYAA 3TIXB 4Q7JB 3DDUA 3FOFC 3KCNA 2O0LA 1QAOA 2HQRA 5G1NA 5MHTA 1W5SA 2IZOA 1JSCA 4XSGA 4HBGA 1C3LA 3PXCX 4BNDB 1C0KA 4S1PA 1DRKA 5ALMA 3G9TA 5EC8A 1MJ5A 3K0FB 4HUTA 1CQJB 4Q7MB 5K0BA 3KZ1E 4QOIA 2YIVX 4C08A 5JW6A 3BZUA 5CIQA 4L8VA 3U1VA 3LL4A 4WNAB 3OMXA 1M8KA 3EVDA 1SZCA 3L1IA 4LQDA 5DGXA 5K0FA 1NY6A 1T4GA 1QH1B 1PI3A 3ADCA 1EUZA 1KMMA 1HE3A 2R5FA 3FCXA 4R68A 3OOWA 4NFYA 5TQ2B 2XGJA 1JG1A 2HIAA 3D7KA 3COPA 3KKEA 4OMFG 1N2CB 3WLQA 1DP4A 1G8PA 2E1RA 1UJ2A 3ACDA 2EIHA 1Y1TA 2PYIA 2WUDA 4FFLA 1XD9A 4KUHA 4QDXA 1YL5A 2RGRA 3GMTA 3SJAA 3JAWA 2HV8A 1H2AS 4R3WA 3LXUX 5HE8A 4AWBA 3ZY4A 4HN4B 3L7LA 2ZJYA 3RS4A 1HH4A 4H60A 5DPMA 1NF2A 2D59A 2DPHA 3T95A 4NE7A 5L45A 3LTNC 3IR5A 3R9KA 1WW2A 5BSRA 5AW2A 4HWKA 4J43A 4X6UA 2F4VB 3QXHA 3JPYA 2RE8A 2R8ZA 2J0UA 3DTYA 4LNHA 4NYIR 3FDXA 4BJ5A 4D57A 2Q2WA 3L9WA 5TGDA 3LG2A 4FBLA 5IMSA 2I6FA 2P3SA 3ABIA 3BXOA 3NRBA 1NB9A 3QXSA 4DCCA 6AT1A 4AZ0A 2PGAA 2CFTA 1OVMA 3A6LA 4KR9A 5MDHA 4DA4A 4JGGA 2IBTA 5EUBA 4NU8X 1RXEA 1JEDA 1YX2A 2AS0A 3FFXA 5AKYA 2XZLA 1PVDA 3V7WA 4ZVUA 3QMMA 1OY1A 1JTEA 3MC1A 3WJ7A 4W6QA 4R98A 1V7QA 1OYWA 2AXPA 2J9YB 2WJIA 3JQAA 1MRNA 3NTUA 4D0GA 4FXOA 2ZXFA 1RCTE 4KRFA 2DHRA 4LY6A 3CPXA 1WV1A 3SC2B 4YP6A 2EERA 4A7PA 4IJMA 2WZDA 4CI9A 1GFWA 1F0PA 2H4WA 2ZPAA 1XTSA 1N06A 1IZ7A 1RWBA 3AERB 2QT0A 1CNEA 3W8EA 2YYYA 3LT5A 4L8LA 3CKMA 1WMSA 4K9PA 4Y2RA 3T0GA 4YRIA 6REQA 3QU9A 5IASA 3KJFA 4LGYA 3JZDA 2E5LB 1B0ZA 2WPNA 3RSHA 2OB1A 4BNXA 1C4WA 1QF9A 1U3TA 3O0TA 2B4RO 3BGWA 1FMJA 2JAWA 3N0WA 4DLWA 2VA8A 3O4JA 1IULA 3PXBA 4UXJA 3UB4A 4JLVA 2ZRPA 2Y8EA 3TIGA 1QQ7A 2IY9A 3PR1A 2BUAA 3VYRB 2WU1A 4CXMA 3A1NA 2WWIA 5DTRA 3K16A 3UQZA 3F5SA 4KXVA 3Q6IA 4YJGB 2J46A 1VQMB 4C05A 3JQBA 4AAYA 4DPLA 1G8MA 3RASA 1Z2EA 1JBKA 1H0HA 1PT6A 2CLIB 4QXOA 3WL6A 1IU9A 1ATIA 3DZFA 2V4ZA 4MS4A 1W7AA 2BM8A 4ZRNA 4B71A 3LWBA 1SA0A 4M8SA 1RZRD 5AW5A 3KKOA 1KYVA 1N5JA 2R6HA 2QLLA 4YXWA 5FWAA 4XQEA 2JGNA 1XCJA 4MNTA 1PTKA 4PRKA 4ZCIA 3LX5A 4DOMA 1LLFA 2AKYA 3IAXA 2I1QA 5D87A 3Q2OA 1PV4A 3R0QA 1EHYA 3WLMA 1OLXA 5AVOA 2QMQA 1EINA 1RLUA 2YW9A 2CNOA 3QENA 4DB4A 1FTQA 3GH1A 4XAQA 3GNSA 4DIEA 4ENWA 4RDKA 1JSXA 3ORYA 4DMUB 3A6ZA 2VJMA 1Z0SA 1W0JA 4I1SA 4JP8A 2LDBA 2V96A 2ZYRA 3JTEA 4MEAA 2WF9A 4XQ9A 1WCV1 3W7AA 1FDRA 5EZ5A 3SGLA 2EC5A 3MJCA 2I6TA 1N1DA 3OAAD 1QR6A 5F51A 3UXEA 1IHYA 1U8ZA 2GFQA 1G8FA 1XZDA 3ACCA 3KT6A 1DX6A 2BGMA 4WD3A 5ITVA 1WCIA 2VJOA 4MCHA 3K73O 3SC3A 5A3JA 2EWVA 3TTXA 2ZJ5A 5L3ZA 1NBMA 3I8XA 4KPFC 1YL6A 2PSDA 2IVZA 1YC5A 4GI2A 8ATCA 2XOKA 3H4TA 3P71T 4YUVA 2WINI 3H8SA 2QOEA 4RDIA 2NACA 4RANA 3K5WA 2ZUDA 4ZYZA 5DX8A 4U2GA 2D3NA 1W0JD 5KWIA 1G3MA 1BROA 2UZAA 2Y6UA 5DH9A 3EAGA 1UMBA 1A2BA 4D97A 5I01A 3KJEA 5P21A 3W77A 1KDTA 1FJHA 1RI4A 2YWHA 1ZUNB 4IW3B 4QUZA 3K0CA 3WMFA 3DWFA 2GBFA 3AR9A 4A1OA 1SAYA 4JB2A 3FUTA 1ZK1A 2UVPA 1M1UA 1GAQA 2B1RA 3LYLA 3NGXA 4PO9A 4KKSA 3P9ZA 4HDMA 3GWGA 3ANMA 1Y1QA 2R00C 4FR2A 4MDHA 4RH3A 4Y9SA 3SC6A 3RVMA 4OQDA 1K1EA 3SJZA 1IWPB 1T5TA 2YJ4A 3SIXA 1J49A 1GGHA 1SUDA 3LT1A 5BVHB 1EUYA 3ZNQA 4XLHA 3KOWA 4R2MA 2HV9A 4R9NA 2RGYA 2GDJA 3LK7A 3UY4A 4C4AA 3E3OA 1QIHA 3ZV6A 4EQ6B 1N1MA 1DUIA 3AVVA 5DO9A 2ZI4A 2DQ4A 2R11A 4H1UA 3RSZA 2C2MA 1K6EA 4HTFB 4L73A 5EJ2A 3ER8A 1N32B 2YXEA 2HMUA 1BU5A 4XXHA 4F6LA 2GJRA 13PKA 1O87A 3KR0A 1LFDB 3GV0A 3JALA 4RFSB 4NOKA 5AQEA 4TKMA 2D1TA 4F6RB 2JBAA 2RHBA 4RF4A 5ALPA 1CUSA 2O0MA 3LO5A 4CYMA 5ALDA 4FCCA 5TR9A 3PFNA 1Y4ZA 2VXOA 4CDRA 1EPUA 1OX4B 3KKLA 4J1TC 3A1DA 1ZVQA 1UJ4A 4KR0A 1RR6A 1U5BB 4TVKA 1SXJB 2IHYA 3RF6A 3T6KA 1EFVA 3AINA 2WY2D 5BPHA 3MJHA 3WG9A 2X4GA 2VCHA 3IC5A 2G40A 4A73A 1JIUA 4GM4A 3AKYA 4AN1A 4DIUA 4GYJA 4DJJA 1U2ZA 3D8BA 3E5MA 2AMLA 3G2PA 5E1BA 5BVGB 2KI5A 2WHPA 3Q5GA 4L51A 1ENPA 5FRDA 1DO8A 1XXLA 2NZUG 2PZLA 4BO7A 3EVCA 4ZTBA 4ZV4A 4G5RA 4PFKA 4UEKA 1JQAA 2I3AA 1UJ6A 2JIPA 1RU3A 2A67A 4GPD1 4PG7A 3L4EA 3V97A 4F9TA 4GZ6A 1CZKA 4US2R 4YAEA 2VZ0A 2OZVA 2JLVA 2YJ3A 3PF9A 5CP8A 3GLIB 4B6JA 4DR7B 1U4NA 4A8JC 1BMQA 2FW0A 2OM2A 5FUVA 3AVUA 3U44A 3BB1A 5DSXA 4GH5A 4KXLA 5AW4A 1G7RA 4X7FA 2PMBA 4OMCA 5EMLA 3KVOA 3Q39A 2DEUA 1Y7PA 3WNDA 4DCNA 1NN5A 1FU8A 2BFWA 1PR0A 3IP6A 2CUKA 4N0MA 3RH0A 3Q6RA 5HJ2A 3QKRA 2UUPA 5I3CA 3SBEA 4Y6LA 2FPLA 4D3XA 2ACKA 3KLMX 1OC2A 5I8PA 4MI9A 4L6AA 2APJA 2DFDA 1L5OA 1PQYA 1E2KA 2PQ0A 4IHAA 3L8GA 2LCIA 3WIBA 1WPCA 4LHZA 1I7SB 1RWNA 4J0HA 4KPYA 1L4UA 2ZETA 1Z2PX 3I3OA 1K4MA 3KM0A 2Q0HA 3HB9A 1VZ2A 3JRNA 4XJXA 4IGKA 1RBQA 3AILA 1WMBA 2VXCA 3GZTB 3IDSA 2WYOA 1JYSA 3M6IA 5CDFE 2AL7A 3CZ9A 3DAPA 1LF5A 3I4CA 3PNKA 1W34A 2R25B 3FSRA 3G4SB 3QYAA 4HGRA 3NHBA 4IMPA 2BTOA 1ZSNA 121PA 3PA6A 1N9GA 2BFFA 4WGFA 3ML1A 3AU9A 1G1AA 2FWMX 2RK3A 3HJAA 3HY6A 1W581 3WV4A 1T9BA 2H31A 3WRYC 2W2MA 3AJ8A 3C3XA 4GOMD 2GN4A 4H6VA 4DMLA 4YLEA 4G5GA 2WJ3A 2C1ZA 2A84A 8MHTA 3EVFA 5AJWA 2ZJ1A 1AMUA 3HY4A 1XKQA 1YU6A 2I3BA 4HUJA 2OO5A 3DD1A 2PUFA 3SX2A 1C7IA 3L0IB 4KMSA 3UN1A 2EBWA 1TYEB 3MJDA 4Q3KA 1F4LA 5C1IA 3ZWDA 5CYGA 5D5PA 3ZLTA 3IPYA 4E7PA 5LMZA 1JDNA 3CM0A 4O4IA 1L7MA 1RMTA 2HDHA 4ZI7F 1MQ9A 1YRBA 3OIDA 3PGKA 4WKOA 3RVNA 3ZE1B 4DV4B 3FMGA 1V37A 4XKWA 2VDKB 2BFEB 5GQSA 1KJIA 4LZJA 4MQFB 1S0UA 1U0OC 3K4HA 1ZI6A 3ORHA 5BSMA 1FW6A 3DVAA 3GPDG 4O29A 4BQQA 3TTUA 3ETDA 3IH5A 4CJXA 3UW1A 5DISB 1M2WA 2Q5IA 2G04A 1PZHA 5T8KC 2K4MA 4TVOA 2BMFA 1OLUB 1JLMA 1WUJS 2A5GA 2F43A 1YR8A 2ST1A 3AC0A 3LQYA 4J76A 4KE8A 4MW9A 1NLUA 3JQ7A 5ALTA 3GFTA 4BNIA 3AP1A 3QWFA 1YE3A 4B73A 1CP3A 2NXEA 3FKSD 4DNFA 1GCGA 2XYGA 4ZZ1A 2BE9A 2LR0A 4PG4A 3TYXA 5KTOA 1XZ8A 3FTPA 3RFFA 2G5PA 4JP5A 4OB7A 3CCRB 2AYYA 4UDYX 4X66B 3FTDA 4D43A 4XW2A 1GXSA 1GTZA 1ODLA 1RJWA 4HY3A 5FYDA 4EF6A 3WKBA 3OT5A 1Y8ZA 1A3CA 2W11A 1NMSA 2GLTA 3DOIA 1UBMS 4MAMA 4TRRA 3UJNA 4P0PB 3ZZNA 3I2HA 4GNRA 1LBTA 3EXEA 1JHRA 3R6JA 1T25A 3PIRA 4MVCA 4MVJE 2DPXA 4HX5A 3RRZA 3PQEA 4B2YA 2NT3A 4FSDA 1GIAA 4YCSA 2QORA 3K1YA 4OQ4A 1SXGA 4Q93A 2QK4A 3RVRA 1O9GA 4ZVMA 1Z82A 5FUXA 1YKFA 1W30A 3L7BA 2ODEA 3IMFA 4R0VA 4O2AA 5C81A 2VBVA 2WTBA 3I72A 4CKWB 1V7PC 1J9ZA 4GI5A 4HEA1 1EEXB 4ZU3A 4CM1A 3MGAA 3DNMA 2DBYA 4YMWA 3KETA 3CZCA 4AG5A 1NRXA 4K9RA 1GKIA 3D64A 1WQ3A 2HWXA 3FZEA 4HRXA 2FZGA 5FUQA 3GIWA 1QOZA 1M5RA 4QFMA 4H77A 2XBMA 2G0TA 3T3IA 4GXRA 2B83A 3OOEA 3Q3JB 2B1GA 1L5YA 1U2GC 4OGWA 4RK5A 1M34A 1C2TA 3HYNA 4N48A 4UM9B 2GCPA 2HMYB 3EBLA 2G17A 2AXEA 4FGZA 4TRNA 2PX2A 2YWCA 4R2WA 4QXPA 2XNHA 2VWGA 3DMNA 2C61A 5DP1A 1F8YA 1BPLA 1U8YA 3VU8A 1S2DA 1N6LA 1E9SA 4DZRA 2CSXA 5IXSA 1U3GA 4Q3CA 3LDHA 4LMRA 2GBLA 1ADYA 3L0SA 2I71A 2YUTA 1U0NA 1WLYA 2WV7A 2XMSA 4GI3A 1YHYA 5E4TA 4AD8A 2XCTB 1BVYF 1XP8A 4Q34A 4CIDA 4RTQA 2HLDD 1KU0A 1KI3A 3SHWA 3REFA 1ZL0A 3PD7A 1XNRB 1TYBE 4FFWA 3LP5A 2VF4X 2W6JD 5DX0A 3QYFA 4XFDA 4B2IA 1CR4A 3I6ZA 4UBIA 4X85A 1SUEA 1LA2A 1XUOA 3GJRA 4HAIA 4MPJA 2D06A 1J23A 1U04A 3H18A 3PJGA 3TVYA 5JMOA 4TS9A 4QELA 3GBSA 1P17A 2EZ8A 4H1TA 4EHIA 4DG9A 2J3QA 1IXZA 3F47A 1YDFA 2IU3A 2ZRDA 2HQ1A 3GLFB 1ODKA 3O4GA 3PVZA 3L7CA 4HN2A 4NNJA 4OHPA 1RXVA 1AGRA 2FUG1 3AOEC 1RJ9A 5AICA 2RI1A 4WSOA 4BO9A 4DTCA 4F72A 1S2IA 2V4MA 4B7UA 4BC0A 4FE4A 2AHOA 1ANKA 1JSRA 3PD1A 5AW0A 3TQCA 1RI1A 2VUHB 2MINB 4BNGA 4BQFA 1VG1A 3AFGA 4GMDA 2ZS8A 5TVGA 3PQFA 1V11A 5KJEA 3NOXA 1EJBA 1JAIA 1DWOA 1RNLA 3B1XA 3JVIA 3AUTA 3OO1A 4XOUA 4A92A 3SDBA 1NVTA 3BUSA 3COWA 3RYFB 1JAZA 4IXMA 1MA3A 3IP7A 1DO2A 4L3OA 2WUGA 2WM8A 2JFNA 2I6XA 2Z0MA 3EQ2A 3OIWA 4P93A 3ZJUA 4JX9A 2OMEA 1OLSA 4AJ2A 3PPIA 1H6AA 2Q9UA 1PEDA 5EQJB 5COBA 2C59A 1MAAA 2YYSA 4PGMA 1YR6A 3MSXA 2VBIA 5T4FA 1IHMA 2H48A 3UUGA 2Q62A 2NO0A 2WIBA 3D8RA 2G63A 2D0PB 1WXEA 4R8VA 3ULKA 2GTHA 4DW8A 2P30A 3UFXB 1RLMA 2WYUA 4M9SA 2W6ZA 4QOEA 4BJHB 2RDMA 4E1AA 2RJNA 2PRSA 3WNQA 4C1BA 3V8NA 2AFHE 3RJMA 5JTTA 1HI9A 1VIAA 2D7JA 2G71A 2O14A 3HRKA 3OJEA 4LJ8A 4HVLA 1E2UA 4W9RA 4NCBA 3K9FC 1VHJA 4PS1A 4PYMA 3IAAA 5ELLA 2SNIE 4K6GA 3C85A 1IG0A 5EVJA 1KI6B 1D9XA 4QBFA 4WEQA 4YXFA 1P61B 4B3MB 3DUFA 5G1PA 3OC6A 3EZFA 3N74A 2X2PA 4PHHA 4UHCA 4W4TA 3C15C 2HA0A 1J0AA 3O75A 5EMHA 3TZLA 2F1LA 1PK8A 4C3OB 1PSZA 1KY4A 3R5HA 5B6JA 4ZV7A 3RRMA 3AVTA 1J9GA 5EGNA 3I04M 4GRIA 4EJFA 3RNLA 3RM3A 1IJBA 5U1PA 3MBKA 2TMGA 1QCCA 4CBVA 1Z5UA 4N01A 4OI4A 1OH6A 3W5HA 3L7OA 4L4SA 2WB2A 3B12A 1TGVA 4FKZA 5DNEA 4Q1FA 4LECA 2PZJA 1IIRA 4P3IA 1BYIA 1KEPA 1PJZA 1PR3A 2VF7A 1TEVA 2W6PA 3CSSA 1R4NB 4F3YA 5HVNA 2LZ0A 3R5SA 5B4VA 1BKDR 2BR4A 3TG8A 1ECPA 2HSDA 3RIMA 5GMOA 2QENA 1FFXB 1VLLA 3HXPA 1FX0B 1FXWA 4ETMA 4RDCA 2HRBA 1ZA2A 1ZP6A 3ZS9A 4OPVA 1CB0A 2C2HA 2QAGB 3HXKA 5KYUB 4TYWA 1L5NA 1JVBA 2H0RA 2IF2A 2JFOA 3I0NA 4PR0A 5A1JA 1RRMA 4C5CA 1DJQA 3ITDA 1YIOA 5E7QA 4MIKA 2C8JA 3BJIC 4DN6A 4AUEA 1G9TA 2RHCA 1QBGA 2JKVA 2ODQA 3U61B 3A26A 1G63A 3VNRA 4BAZA 5TMDA 3RNOA 1SCUB 2OCKA 2QJRA 2XHZA 4FMBB 3STWA 3TPZA 1JAXA 3V8QA 2AEJA 5JNRA 2EHJA 2ODAA 4ESVA 2PUWA 1VCNA 3E6AA 3LBIA 1T9KA 1XALA 1K08A 3OZVA 5K3SA 1PFWA 4DVJA 1CRLA 4AXBA 2DSNA 4I1VA 4MQ6A 4Q0MA 3CINA 3DOFA 4LXTA 2IHKA 1X8KA 1OKKD 3IHKA 1B00A 1KY2A 2PCJA 3R7AA 2J5RA 2PVPA 2J7PA 3MIIA 2BE7A 1CY4A 1X3LA 1XE3A 1Z7YA 2CJPA 3K9QO 3X1DA 5K6AC 1E0JA 1FDSA 4BXOA 4ZRMA 3H2GA 2B94A 2MSLA 1JSLA 3D5EA 3TR6A 3ECAA 3FAZA 3NDIA 1L7NA 3B51X 2E0IA 3PHGA 2QQ0A 1YH3A 1YQTA 2C94A 5LLDA 1UZAA 5FPTA 2BJVA 2B37A 1T3ZA 1YNSA 2A4KA 4HXFB 4L4XA 3MXOA 3JD0A 3NWOA 3EVEA 1X1RA 1YS6A 1QJ4A 4OH1A 4TWAA 4DA7A 2QRPA 1AUOA 1EAYA 1P77A 1VA4A 5TF0A 3GA7A 1M1NA 2P5UA 4Q1AA 2WUWE 3NOVA 2DGDA 3Q3CA 3ZZ0A 5IJ9B 1YMVA 1S96A 2ERCA 2QGNA 3GARA 1IJKA 3FUVA 3TPFA 5JHGB 1X1SA 2HF2A 3IB6A 4NEHB 2CHVA 2J1LA 3IELA 4KSBA 2NVBA 2RONA 3OPYB 5FYQA 4DDMA 3V80A 1X2EA 1DJMA 3WB1A 1XZIA 1X8JA 4D6XA 4HZGA 3M89A 3ZXXA 5K3EA 4PGOA 3DMYA 4EH1A 3HG7A 4N5MA 1YVPA 1PFGA 2JEOA 3F3SA 4EL0A 3A7EA 2W70A 4F5WA 1J25A 3PNSA 2WZCA 4KU4A 2F1JA 4KXYA 4WZAE 2D6FA 4HAWA 2IA5A 3A7DA 2GYYA 1F2UA 1NFQA 4X1YB 3UB3A 3N7UA 3JQDA 2IT1A 3UMVA 5CEEA 1ODCA 5EJEA 2Q3LA 1A72A 3GLHE 5AI9A 4BZPA 4ON9A 1S2OA 3D3KA 3GAFA 3VR4H 2CMGA 4KSYA 4Q1EA 1FQJA 3K35A 4M1WA 2PT7A 3CJQA 3ZHYA 2Q3BA 4G25A 3ASRA 1D7OA 2NV0A 3DBOB 5AVSA 5ICCA 3A4IA 3B9PA 3ON5A 5EE3A 3TCXB 3KL9A 3V1KA 5HKBA 1EWVA 2X8KA 2BRUC 5HEKA 4Z4WA 5JAUA 4LF8B 4I9FA 5GP1A 5CA0F 5EXXA 4OGLA 2WWFA 4R1UA 3ETLA 5GONF 1GZ5A 3TFQA 2GH1A 3I4FA 2GZ1A 3K6SA 4WACA 3IE2A 3IQFA 3CCBA 1YR2A 3ORQA 4I3HA 4BB6A 2W4MA 3U7HB 3I28A 3I2KA 1XELA 4I1UA 1N7HA 3W3AD 1ZR2A 2PKWA 3OOCA 3HL0A 4P7BA 5ERYA 4B17A 4BPRA 1C7EA 2VEDA 3A1FA 4G86A 4YXWD 1R5BA 1GR1A 5DK4A 2AQ8A 4UQLA 2GM4A 2QRZA 1T35A 3HPQA 2P2YA 3BHMA 4KK4A 1T1SA 1VBFA 2AD1A 4HLNA 4JP1A 5HJ7A 2XE8A 1YV9A 3VH2A 4QC2A 2FPIB 4ZJPA 3JYNA 4IXTA 2DAPA 3TO5A 5HUJA 1WOYA 2O54A 2QY9A 2E4VA 3EC1A 4D9FA 3A6DA 3VDRA 2PZFA 1RPTA 4YRPA 2R3SA 1CUUA 2RC6A 1UINA 1GKYA 1T3HA 1E92A 3C5CA 4KO3S 4TWRA 5JDCC 2QRHA 5I7RA 1LKZA 3DOCA 4IY1A 3W2IA 5LMCA 3CVJA 1WM1A 2Q5FA 1VMEA 3U7GA 3SZMA 1YI0A 3MJVA 4R1NA 3V8BA 2VL7A 2WU0A 3OT1A 4HDAA 4MQEB 3HMKA 2WSSA 3KEOA 4FN4A 4NHEA 4ZJYA 3TECE 2BM1A 2I91A 4OHRA 2R1UA 1SVMA 1E8MA 4AJPA 2CBXA 2PUAA 2QN6A 2NU8B 1SB8A 3RGWS 3CH5A 1PL8A 2ZQ5A 3WY9A 1G5TA 3IFSA 4LKOA 2ZWPA 3SS8A 3WGOA 1LTQA 1V3VA 1U2QA 3PT5A 1Q7GA 1XZGA 5L3RA 2AEEA 4CE6A 3BSWA 4C0SA 1IZYA 1KYIA 1RYEA 1U0GA 3FUCA 4X8MA 3A14A 1TTHA 1Y3CE 2GJAA 4D44