1QUFA

X-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
296
Chain Sequence
b'ADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
molecule tags Oxidoreductase
publication title X-ray structure of the ferredoxin:NADP+ reductase from the cyanobacterium Anabaena PCC 7119 at 1.8 A resolution, and crystallographic studies of NADP+ binding at 2.25 A resolution.
pubmed doi rcsb
total genus 85
structure length 296
sequence length 296
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1996-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1qufA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1qufA02
1DDGA 3CC7B 1DDIA 2QTZA 2HMAA 4H9GA 1E63A 1SM4A 3FPKA 1S72B 4FK8A 1W87A 1EXMA 4YHBA 1FNMA 3P27A 2VZLA 1KK2A 4LBVA 5TR9A 2VNHA 3FJOA 2X3UA 5GV8A 3QFSA 1AMOA 2HCJB 1UMKA 3VNUA 4NCNA 3I1FA 3QSYA 1NDHA 2YWFA 3AVTA 3WNBA 4PC2A 2BN4A 3QE2A 1F20A 4ACAA 3OZVA 3W2FA 1FNBA 3QFRA 2BV3A 3AVVA 3PENA 2QN6A 1BX0A 4Y7CA 2RC6A 1QUFA 2GPJA 3CB4A 4QHYA 1TTTA 1R5NA 4B47A 1XE1A 1VQOB 1IB0A 3W2EA 1OGIA 1QFZA 3J81k 2PMDA 4B43A 2NPFA 3B8HA 5FA6A 3CCSB 2BGIA 2B7CA 4RD6A 1EP1B 3CMAB 5EMNA 1KK3A 1DG1G 5THXA 5DSZA 1VQ6B 4LBYA 4C0SA 2FX3A 1FRNA 1EP2B 1KRHA 3CD6B 2C78A 3CC4B 4M1KA 2XNCA 1D2EA 4J0QA 2GQFA 2QDXA 4TMTA 3MHPA 3LYUA 1B23P 3CPWB 3P26A 3E1YE 3LO8A 1YI2B 4QFMA 3WBJA 1G7TA 1JA0A 1HA3A 1GAWA 3U2QA 3OZWA 4EH1A 1K73D 1QGAA 4ZGNB 1GO2A 4AF7A 1G7SA 2AHOA 1VQ4B 1R5BA 4M53A 3WBKA 4PC3A 1E64A 1QH0A 3ZZTA 4LBZA 2OK8A 1FRQA 2E1RA 5TV2A 3CC2B 3ZZUA 4M0LA 1H42A 1VQ9B 5HXBA 4ZV4A 1QFYA 2R6HA 3W2GA 1TVCA 1Q82D 3WY9A 5KSWB 1YJWB 1JJ2B 4ACBA 2BM1A 1FNDA 1N8RD 2C77A 2EFGA 3VO1A 3G6EB 1VQ8B 4RCYA 1BX1A 3ZC3A 1BJKA 2BGJA 1IJEA 1ZM9A 2OK7A 1AIPA 3CCVB 4G1BA 1W34A 1ZM3A 1ZM4A 3WYAA 3OJWA 1VQKB 2OTJB 4LBWA 1G7CA 3G4SB 3WNCA 2XNJA 1VQMB 4YALA 3SJZA 2DCUA 3JQQA 1Q86D 3QFTA 3CCLB 1OB2A 1QVFB 4F7DA 3B78A 4B3XA 4RD0A 3I55B 1GAQA 1KK0A 4FWTA 1OB5A 1I7PA 3E20A 1TUIA 4HE6A 4K1XA 1YJNB 3AVUA 1GR1A 1N0UA 3CXCB 3CCEB 1DARA 1U2RA 4YAFA 4MYTA 3JQRA 1QG0A 3QFCA 4TMVA 2CRVA 2VNJA 4TN1A 1GJRA 4AC9A 4RD2A 4Y9UA 5H59A 1W35A 3OJXA 1KJZA 1H85A 2YWEA 1G7RA 1JNYA 4UAJA 1VQ5B 3ZZ0A 1S0UA 2BMWA 4YAWA 1ZM2A 3LVBA 3B82A 3CW2A 3CMEB 4B48A 1VQPB 1VQLB 3CCUB 5H5JA 1FDRA 3CRZA 2BPOA 3I56B 1ZUNB 4G5GA 1EWYA 3CCMB 4RD3A 2QEXB 4M2LA 3CCQB 4N3GA 1IJFA 3ZBUA 1JB9A 4P6VF 1CNFA 4PC1A 4YAUA 2D74A 3VO2A 1KK1A 3W2HA 2DEUA 3LRXA 2DERA 4PC7A 1OGJA 5JBQA 3OW2B 1K8AD 4RD4A 2DETA 3A1FA 5TY0A 1Q81D 2CNDA 4YAOA 1ELOA 2BM0A 1QFJA 3VNVA 2VNKA 1D1NA 1CNEA 2EIXA 2PLFA 4Q7JB 1FNCA 3AGPA 3AVYA 1QX4A 1SKQA 3V76A 1YIJB 1QVGB 4PGOA 4R71A 4AF6A 1D8TA 1VQ7B 2B7BA 4P3YA 4DQKA 2RC5A 3MMPA 1TLLA 1EFUA 2YWGA 2BF4A 3VMFA 5AN9A 4HE5A 1EFTA 2YWHA 1BQEA 1GVHA 4B44A 3WNDA 4RJLA 4IW3B 3G71B 2VNIA 4RCZA 1F60A 4N3NA 1EFCA 4LC0A 4ZCIA 1KC8D 4MYUA 4U9UA 3AGQA 3JQPA 4M4SA 3W5HA 4PC6A 1CQXA 2DY1A 1YHQB 2HDNB 4NBSA 1QUEA 3OZUA 1M1KD 1A8PA 3AVWA 4TMXA 4ZGQB 2VYQA 3CCJB 2BVNA 2XEXA 1QGZA 4G1VA 1EP3B 3U6KA 2PIAA 4ZCLA 3W5VA 3U6BA 3AVXA 1XB2A 4B4DA 1M90D 2QTLA 4RD1A 4BPRA 4ZCMA 2ZITA 1K9MD 4DQLA 3CCRB 1VQNB 1KTVA 3ES9A 1NJID 1WDTA 1W2BB 3W5UA 4C43A 3W2IA 4TMZA 1JA1A 1YJ9B 4WQMA 1E62A 1R5OA 3MCAA 5GV7A 4Y9RA 1Q7YD 4TMWA 3WXMA 4FN5A 2OTLB 1YITB 1KQSB 1N0VC 1KD1D 2BSAA 1B2RA 2J7KA 2QA4B 1J9ZA 1QGYA 3ZBTA 2B5OA 2QMUA
chains in the Genus database with same CATH superfamily
3D0QA 3MTIA 1B42A 1JR6A 1TAGA 4MQEA 3CPXA 3L92A 3VSCA 2WUGA 2J41A 3CZPA 3G5LA 5AOCA 3NIFB 2WIFA 4PCVA 1E6WA 4HWPA 2WJWA 4PYLA 1NYRA 5FPHA 4DV1B 4G2NA 4GYWA 5BSXA 2R751 2WIKA 5EMMA 4AYTA 4YT8A 2QE6A 3UWPA 3O5AA 5I5EA 3P2IA 4EMSA 1YDMA 4GLBA 2BM9A 1VTKA 2NADA 4M3NA 1RWQA 1ZIYA 2OZKA 5KC8A 2FEXA 1EHYA 4Y6RA 4B3RB 1VA4A 5COAA 4R54A 3F6CA 4E0FA 1WCIA 4FT4A 4L4ZA 1FPQA 5IKOA 4UD2A 1UINA 1MGOA 2KBEA 3DKRA 1TM7E 3KXDA 1KOFA 2C9ZA 4W5WA 2NYUA 1WBBA 1U5CA 1UZLA 1FFDA 2NNLD 4K6OA 1X1TA 1SC6A 2AN3A 1ZNXA 3NFRA 3KWMA 1GTG1 1P5HA 2LP4Y 2ZLBA 3IP6A 5JAHA 2XOXA 1YU9A 1AQJA 1SK8A 1YZ3A 2VFAA 3CE9A 4IQ8A 5J23A 2R65A 1YXMA 1S6YA 2FGJA 3ZIUA 4C5BA 2BFEB 1RJEA 1SUAA 1EDEA 2OFOA 3O1IC 1FTSA 1X1QA 4XQCA 1H2HA 1W76A 1CJUC 5H02A 2VDUE 3HXLA 2V6IA 3VZPA 4Z49A 3B13B 3T54A 4HSGA 3VU9B 1A5BB 3IBYA 3NIGB 4WE3A 2E4XA 2XA9A 3K2IA 1PZEA 3BHJA 4WN9B 3PLNA 3F7NA 1EP9A 4Y0VA 1G2IA 1VPWA 3H8VA 5KDDA 2OY0A 3KOWA 2ZI4A 2ZRQA 3GEDA 3RM3A 2LRHA 2NWQA 1OROA 1YKFA 4BO9A 5I4CA 5T4BA 4XFKA 3PE4A 2W83A 3LY9A 4LJ9A 3CTMA 2HEGA 5EUCA 1GNPA 1P0QA 2EP5A 3PFKA 1SXPA 3HY6A 3GPIA 4TRNA 5EUMA 2H1IA 1V5VA 4B43A 2BI7A 2DF8A 3Q6IA 4R83A 5KSZA 3AL0C 4TTRA 2DT8A 2CHEA 5TRTA 4KV7A 4J6EA 3RRYA 5HZAA 4EJFA 4G0XA 1XIVA 3GJZA 5DT2A 2GFIA 2QZJA 4RD6A 1YJ5A 1Z4JA 2HQOA 2PZBA 3LLUA 1GU7A 3NV9A 3QENA 2D54A 4I5DA 1ZBDA 3OO1A 3V1TC 1Q6ZA 3WS7A 4ZDJA 3UOWA 2WUDA 1VMIA 4DYDA 4RULA 2R87A 4C4XA 4BY9E 3QMVA 1N07A 3KKPA 1C30B 4HMPA 2A9QA 4HWKA 3QI7A 4PHFA 3AM1A 2G40A 3MA0A 3ROEA 4TMKA 3B36A 3OKPA 2FMHA 1Z0ZA 3U4DA 4LBYA 3RGWS 3Q87B 1TKAA 1O94A 3CS3A 3R77A 5JADA 5ANRB 3W04A 4AW9A 4K6FA 2ACEA 4RMNA 2VK1A 3C48A 3JARA 1V5GA 3ZGNA 5EXSA 5JANA 2Q28A 1CUZA 1N9GB 1Y98A 2BFNA 3SC4A 5JH7B 3TUJC 5EIEA 1IHXA 1N7IA 4EGQA 5TMPA 3A9WA 2YJ3A 4Q3NA 1VG1A 2PXHA 1F7VA 1V3UA 5DTRA 1Z7EA 3GFOA 3LUKA 4FCTA 5LB4A 4C4ZA 1AS3A 2TMYA 2UUAB 4FONA 2YMPA 1JXOA 3C16C 4QASA 1N7JA 3HV0A 2I4RA 4FGUA 1U7TA 4MO2A 3I1IA 4GGPA 1P81A 3MS7A 1U2ZA 2C5BA 1RR6A 1SZCA 3UJDA 3TUIC 1HC7A 1UIRA 2ODAA 1OXXK 1YBVA 1HEUA 4FYIA 4Y9SA 1DAIA 1N2EA 3A27A 4N9QA 3WLSA 3DZJA 1EFHA 3IKTA 4E7OA 1RPZA 2HR1A 1VQ4B 1COWA 1R5BA 2HFKA 4D9NA 4EB0A 1Y33E 3B2EA 1WB6A 3LX6A 3ESAA 4HRXA 4X71A 3WDLA 1L7AA 2O3QA 4MVJP 1Z2AA 5BT8A 2OBXA 3VPGA 3ZU6A 3ZLTA 3QE3A 5HYVA 5A1JA 2HYIC 1AF7A 3UMRA 2P9GA 4BGIA 3EPKA 2Q9BA 1UKEA 1LNSA 1YZNA 1GFWA 4MWBA 3ZHCA 4BFZA 2PZKA 4OHYA 4YHHB 2ZL6A 3K96A 2UUOA 4UHCA 1E79D 1S3IA 4J90A 4UZSA 2RJOA 1NKTA 1K5GA 2OCLA 2P5YA 3GAMA 4MGKR 4UPEA 3SCZA 1R1DA 1PR4A 2O2ZA 3I42A 3JR7A 4M7OA 4XIFA 1HY3A 4B2IA 3BSYA 4KQEA 1JHDA 8LDHA 2ZYUX 4HDNB 4HNAA 5ARCA 3H9NA 2PPVA 4CT4B 4GPTA 4DM4A 3WGNA 1FYVA 4AMZA 3W2GA 2ZRKA 3D7RA 3BWYA 4DTCA 2JLRA 1Q82D 2KLHA 3UC9A 4KV9A 4BB9A 4DN6A 1K3TA 3MWJA 3R9XA 3PSHA 2C2HA 2C7VA 1QYDA 3SQLA 1XA4A 2PLNA 4PXAA 1V1MA 3CVWA 5DYIA 4PYRA 2BM1A 1FNDA 1EK2A 1VCNA 3SF0A 2FQQA 4H59A 1PL6A 2O7SA 3UY4A 3DAPA 3GGGA 2OXTA 5K99A 5E6UA 5LU8A 1M54A 3K8YA 1DVRA 3ZUGA 4IDBA 2XYVA 2VQSA 1EX9A 4LYEA 1FP7A 4I6GA 4X94A 4HJRA 5AIBA 4OCZA 5D5PA 2OBRA 4CDNA 1PJ5A 1XZQA 3NAMA 2DSNA 3U4MA 1JKIA 3JQAA 4O4HA 2AMVA 3HYRA 2GDJA 3PFFA 4XD2A 1VM6A 3ACCA 3KHSA 4YO7A 5K3BA 1MO5A 1O9GA 5JRJA 4JI7B 5LQRA 1E5LA 3ETNA 4LKRA 1CR1A 1HDXA 2G9UA 1CUUA 4XARA 1O6CA 1D4FA 2JCVA 4QU5A 4IM7A 3V8BA 3ETDA 5A5GA 2YWDA 4DHEA 4G0OA 4GXQA 2VTDA 2IGTA 3G5UA 1TCCA 1XQ9A 2YJNA 2R4QA 2MU1A 1G291 3LWZA 3ZCSA 2AKEA 2XXAB 1PIWA 4DKJA 1ZOLA 5TJ9A 2HRQA 1GARA 1WLSA 3LQYA 4QFCA 1Z0SA 1NVTA 4YCCA 1GPUA 3Q6RA 1VQMB 3A4LA 4MOWA 3KAPA 4BKOA 4GL2A 1TA4A 1BD3A 2NZUG 2R6FA 3PR1A 4LDQA 4R2XA 4RGQA 5JSZB 3KR0A 2NZWA 3CH6A 2ZAOA 1N0IA 2QRHA 3FPSA 3KEFA 3Q1LA 3FNEA 2C1EA 4PLTA 2ODNA 2WJHA 3EJ6A 4RY8A 5AJHA 4A8JA 5JSQA 1ICEA 4KREA 3GJ7A 3VKWA 1FNNA 1IYZA 2Y6VA 4GUDA 5CJ2A 1INLA 5LBTA 3U7GA 1M7HA 2G1AA 4WOJA 4C4TA 4CKXA 1F38A 4OGFA 1KFKB 4MS1A 1DU4A 4LHYA 3WK7A 2WYIA 2PMCA 1ZD8A 4H31A 4NBLA 4RQUA 2DP4E 2W2MA 5FXMA 5A03A 1YL5A 3GIWA 2GH1A 3C43A 1YJNB 2BELA 4AJIA 4ER6A 3CIOA 3TJRA 1IM8A 1Z36A 3KT3A 2W6PA 3IELA 4JR1A 3F5FA 2HRBA 4MV8A 3NHUA 3LE8A 4D6XA 3I8SA 4BWYA 1ZUHA 5FO0A 4V38A 4ARZB 4M98A 4QG3A 4IIBA 4HAYA 3K35A 1H2WA 1NE2A 5DHFA 1T3HA 2YXLA 2WT9A 3L04A 3OCJA 4YAFA 5KI6A 4CJXA 7GPBA 3JTMA 2WIDA 3G17A 3DBLB 5KNDA 2PGOA 5IFLA 5BSMA 2WJYA 3GFFA 3GIRA 1IEXA 4ALKA 4KXWA 1WEKA 4NAVA 4N3AA 4Q9HA 4V2IA 2D62A 2R68A 3L46A 1SIUA 4JKIA 2BDUA 3OVMA 4YDHB 3TOVA 5JXHA 4FFSA 3NBAA 3TH5A 2KX7A 2G63A 4C4YA 1KO4A 5F35A 1N25A 1WMSA 3GUVA 1TMYA 3P2OA 3STUA 4BNXA 4I99A 4DC0A 1SHJA 2PBFA 1K75A 4P58A 1N6RA 5CFLA 1DAPA 4QU0A 3LPAA 4NDZA 2OC4A 3WNVA 1SUFA 3NDIA 3TIVA 3AU8A 4GRDA 2VF7A 2FAXA 5DGIA 1TYEB 4B4OA 4TWAA 1NVAA 3DQPA 5G4LA 4MVJF 1S2NA 1MFZA 3K4HA 1N6PA 2P2DA 3WLPA 3ZWVA 4BO7A 3PTAA 1IDOA 1QH1B 5DF1A 5E2IA 5FWYB 4BTVA 3ECCA 1GGHA 2H4JA 1OMOA 3KTAB 2JCSA 5LA6A 1DIOB 1GADO 1TT5A 3ILHA 4EWLA 1IOVA 1ZAYA 4Q4AA 3GNLA 5F52A 4LOKA 4N47A 4OPSA 1BTOA 2NU9A 3HA2A 5EQDA 1CZRA 1VYHA 3CE6A 3DS8A 1D1PA 3L0IB 3GLFA 2PK3A 4PZ9A 4P6VF 4ZRNA 2QMZA 4LYDA 4I81A 4COOA 4ZDWA 1WJGA 4KQ1A 1MD9A 1WSRA 3LY7A 4ZQIA 4YCSA 1XFDA 5KTSA 3SDSA 1OI3A 3UJ9A 1UOPA 1NFFA 4HDKB 1UMBB 2VP0A 1USKA 4MZDA 1KVRA 3RUHA 1NASA 3ZXSA 4BVHA 2IKSA 3CF2A 3M5WA 4TS3A 2NUAB 4A0QA 2GCPA 2JI7A 2D8MA 3CBQA 4IIJA 3FTFA 5LP1A 5JBQA 1G8SA 3JQBC 2EQBA 2QN3A 3CUSA 4I19A 2JHGA 1FVHA 1DXYA 2W6NA 4LRSB 3C3JA 3NZEA 2CLOB 4R3UC 4DPLA 2F9MA 2C9CA 1DQZA 2VUUA 3BYZA 4X61A 2IDJA 2Q3LA 3HS3A 2R2AA 3UMFA 2UXDB 3OCUA 3JQ8B 2FZKA 2ZANA 1VPLA 1P72A 2EIXA 1KFJB 1MAWA 3NVDA 4QSHA 2ZUTA 4LQ4A 1ESNA 4W7SA 3NX4A 4BFCA 1E1QD 2FMTA 2V03A 4MDFA 4JJZA 4H7FA 5JALA 1XYYA 2FEKA 2XDQB 1GRRA 1LS1A 2FW0A 1HRDA 2ZEJA 4H7DA 1UJNA 4R71A 3HWRA 4AF6A 4IFIA 3SSMA 1A1VA 2B7BA 3VR4A 3DGEC 1YOVA 1JDTA 2YJZA 1NQXA 4IHKA 4RTPA 3QHAA 1PLLA 3EASA 4UHDA 2R6GA 2IBMA 3U3MA 1WZIA 2L42A 3TRKA 1KSGA 3IBCA 3D6AA 3UH1A 3ZV7A 4UTPA 4CIBA 1RXSA 1L0BA 2CE2X 3GVXA 2NQ8A 4OLJA 2NUTA 1JFRA 4EHBA 4HUTA 4OPOA 1MEJA 4HYEA 2X9QA 4X65B 1GVHA 1GCOA 3ZHSA 1Z0JA 1FSZA 3D8NA 3S28A 2XUFA 3HJGA 3SF8B 3UB4A 2AL7A 1LBIA 4V0SA 4D8XA 5F4BA 3KDSE 3MFQA 1ZH4A 4I4LA 3TG2A 4TV9F 1UBTS 1RI2A 1EK5A 3NIWA 5H82A 5JATA 2AC7A 1ZITA 2AEMA 1GZUA 1MH9A 3UMCA 1GT6A 3EPLA 4B81A 4R8KA 4ZI3A 1SB9A 1NY6A 3ZBPA 1XL1A 3U9LA 1WULS 1P9RA 2HK9A 4M1OA 2WU4A 5CLQA 3JQPA 2RBKA 3OOJA 4G9EA 1E6EA 2GLTA 2A6PA 2VDLB 1WMDA 3T7DA 4DV4B 4PC6A 1EB8A 3RTDA 2J48A 2FG7C 3VR4H 2ZQ5A 3U4GA 3BD8A 1AUXA 3HDHA 4HVAA 3Q8MA 3IGFA 3ENVA 1AZWA 3CNLA 2C5EA 1FDVA 3OG9A 4TZ6A 1UEIA 3OEHA 1DCMA 5C80A 1XQBA 4FSHA 1GPLA 1Z2NX 2D7CA 2MMCA 1LW7A 2PZ8A 2IHBA 3OOEA 4MIYA 3W4KA 3CX3A 3I39X 1OXMA 1R15A 4KR3A 3VU0A 4MVXA 2NNWB 2DFPA 3QXJA 3IYLW 4BNNA 2CZQA 2SKCA 4RXTA 4GBMA 5CVVA 1SQ5A 3CB2A 1LLUA 1MG5A 2J6BA 2FOXA 4MI1A 4MUXA 3ZEIA 4AG6A 3QE9Y 4RK5A 1BZYA 3ST7A 4DBZA 5KYVA 1UKZA 3EEQA 3ELWA 2ZWOA 3PNPA 2AX4A 3M33A 3UB2A 4RVHA 3EXIA 1CEYA 3I9OA 2PH1A 4EG5A 2CJYA 4M37A 5DNYB 1RWPA 4IS3A 4PLWA 4XPZA 1L7DA 1R0RE 5FADA 3CKKA 3LKDA 2M1ZA 5B37A 4MX8A 5C34B 3R9XB 3QBDA 1GM5A 4V03A 3UTDA 1IBLB 3L7NA 5KC9A 5T6BA 1F1JA 4LWPA 4MV3A 1VHQA 5CTAA 5JXWA 5DN6A 3RRNA 4S0ZA 2J45A 5ILGA 4MEAA 3HADA 2YV3A 3QA9A 1NU8A 4AIIA 2GJ4A 1L5KA 4X8MA 2X8KA 1GPKA 1PGPA 2HWXA 3NHKA 2QD1A 2M6LA 5C7IO 3I73A 5G1OA 5KPDA 2PUDA 2GJ9A 1Q7YD 2AOTA 3FUCA 3OT1B 4YJ3B 4K40A 1CJCA 1YS1X 4K9KA 4KXLA 5H3HA 3TLXA 2LW7A 3IQZA 3WGQA 2PSJA 2R1UA 3KJFA 4DA0A 1WSDA 2FOLA 3UMMA 2CLLB 4LSMA 2OD7A 4RZXA 1MVNA 4N7RA 3VJKA 1Q77A 3VSDA 1ULSA 2BRUA 2JJQA 1Z5OA 4MB2A 1OYOA 3M8KA 5C4MA 1Y8ZA 1KD1D 1CUBA 4I1UA 3KZOA 2CXSA 4UZEA 3ISXA 2AD1A 2GYVA 4IXDA 5J5CA 1RFGE 2D0DA 4XM0A 4BECA 3U19A 2J7KA 2BUAA 5DULA 4RHTA 2WAXA 2X2FA 4E70A 2RGYA 1VHTA 3ONWA 1PDOA 4WLOA 3T8YA 4A0SA 3OF2A 3LBFA 4IOLA 4MUFA 5JEDA 4DM7A 3HP1A 3DAGA 1XWWA 3F6EX 2L0XA 5FBWB 2I6SA 3K0HA 3TOSA 3V42A 1RWNA 3OZXA 4BV3A 3QX3A 5IMSA 1E63A 4OQLA 2UV8A 2CVHA 3NONA 3OPYI 2VJYA 1DKNA 4JYMA 1J39A 5HMLA 3BWVA 1BE8A 1T4MA 1MR3F 5C46F 3NFYA 2F3SA 2RGNC 5TPWB 2AZ4A 1F0NA 3JQ6A 2OLKA 1WDLA 1W73A 2IPAB 2X9VA 1BCSA 5HP4A 1M8JA 3IHWA 4FSDA 3NBUA 3W5DA 1IBMB 1XAGA 5JFOA 2NM0A 3HP4A 2VDJA 5GV8A 1YR1A 1DQSA 2AWOA 1A9ZA 2ETVA 5K3AA 1PTKA 4A1OA 3VHXA 4Y2VA 5AUPB 5JVDA 4ETWA 1Y6RA 4X1YA 3AHEA 2PGLA 3ENWA 5HIKA 1T2FA 4D9BA 2QE7D 1YJQA 1EBUA 2Q9CA 2IUUA 1UZNA 3N87A 3ZHBA 5JJIA 3U0VA 2IWHA 4YUYA 3O82A 1Y6FA 2Q2NA 5BWCA 1W581 4RESA 4YK7A 1F20A 4AXXA 2AI1A 4MWCA 4JEMA 4M83A 4J4TA 5JIBA 3QFRA 1T5IA 1W0JA 1T9CA 4EAAA 5T3UA 2X7XA 1VE9A 4P83A 4HNRA 1ECGA 1ZC3A 3W5AA 4OREX 2XXBA 4GM4A 1JF8A 5EEHA 2C4TA 3P4XA 3K5IA 2YRXA 4YRRA 4B7UA 5IVDA 5KVQA 4MICA 4XLZA 2W6MA 1C4XA 2E4WA 5F4ZA 4QHYA 5KYWA 3UWOA 1VCIA 1W2GA 4L4UA 2J3KA 4XKJA 2GJAA 1A50B 3LA6A 3DE3X 2R00C 3EZ7A 1U0GA 3GDOA 3IQGX 3R3SA 4MJLA 3V00A 3AILA 1ZU5A 1T9ZA 4DLLA 1OGIA 2XODA 1XOIA 3PICA 3W7AA 2DQSA 4JWKA 4EYSA 5IYZF 1NF3A 1O3YA 3U7IA 3IR5A 2I2XB 4H6VA 5HWSA 1JDUA 3SEZA 3CCFA 3EOAI 3KUXA 4P53A 4I1VA 2XDWA 1JJBA 3M1LA 4HV4A 5B1HA 1ZWKA 2O1EA 3F9RA 3STWA 3LDGA 1BJRE 3MGKA 1TVMA 2G76A 4KFSA 4LKOA 3VR4D 4BMYA 2YN2A 5E8RA 1H5NA 1ZEMA 3L82B 3R0XA 4F38A 2PUFA 1MVLA 3GNQA 3N05A 1TZCA 3AFGA 5IXJA 4I8IA 3GC6A 1V26A 1EP1B 2Z9CA 4OHWA 1NBAA 2FSPA 4ESHA 4YBRA 1IBRA 4LZWA 4BP8A 1RAAA 3C8DA 3H2BA 4PBTA 5C4IA 3DHWC 3I4CA 4B71A 5DSZA 1O6FA 3SPXA 4IKPA 4JB8A 3AERB 2I3ZA 2QR3A 5KJCA 5DGDA 2JIDA 4XYMA 3SN6A 4O8ZA 5K2MA 4D5GA 1J5PA 5GADl 1K5DA 5K3CA 3R1IA 1ZD9A 3BMCA 4P4TA 3PGLA 3MJHA 1NVEA 1A9OA 1BOFA 2HPVA 1CJMA 1IM5A 2WQZA 1OQAA 4M89A 2PVCA 2GQFA 4HLUA 2A1IA 2OCPA 3AOGA 1E59A 4O02B 3GK3A 4TMTA 2RAPA 2Q50A 2CF5A 4BRUA 2GNOA 3ITKA 1CFZA 4LWQA 2QYOA 2OAEA 4MPTA 4NPAA 1N2SA 5E95A 4V3CA 4REQA 3I61A 4D57A 3EXFA 4NZ9A 3FTQA 5M04A 3OLQA 5LYYA 1U8FO 5EZQA 3LUDA 2QD3A 5B30A 5CDYA 3EYAA 1JA0A 3FWZA 2X22A 3SDBA 3SOPA 1GAWA 1D2CA 1OBFO 3U2QA 1CETA 3DVLA 3GARA 4ENPA 5U4QA 4OQZA 1WR8A 1F8GA 2QRQA 3N07A 4PCLA 4XA8A 3LT1A 3DO8A 3LI2A 4PZYA 4OK5A 1POWA 5D5HA 4A6EA 5EVCA 2CF6A 3PUVA 4BFLA 4D96A 5AVRA 4KN6A 1PQ4A 5DWDA 5BOVA 4JQSA 2ISQA 4Z4UA 1WCIB 3ZZTA 2FMKA 3KTFA 1TVKA 5ECWA 5T57A 2XSZD 1XXHB 3R5JA 3V80A 3K70C 1E3IA 1MC1A 1W5AA 3HUEA 4G09A 1G5FA 2PZLA 4KRGA 3FMOB 4WIAA 1GL3A 3C97A 1XX6A 1Z4QA 1DIRA 2DULA 2Q5EA 1GPJA 1FMJA 2I4IA 3NBZC 3WGKA 3OQOA 4G5HA 4D4HA 4ROXA 4P86A 2DE0X 3DDOA 1VPTA 3P32A 3PYMA 4RYDA 2BHNA 2VOEA 1B7GO 2IIPA 2W8BA 3WQHA 2YVKA 2X14A 4PYKA 1MEOA 5IZCA 1U6JA 3REFA 2NU7A 1L1FA 3EC1A 1UQRA 1JJ2B 3PNSA 2YIDA 3RUDA 4BOYA 1VPVA 1A04A 5E2BA 3BKWA 1GKIA 2LPMA 5JSYA 1W5BA 2NX2A 5IAGA 1FQWA 5L3QA 1Z56C 3RU7A 2P69A 4REOA 1C4OA 4V39A 4MYRA 4L8VA 3CVJA 5AHWA 1SEVA 5AIAA 3D2LA 4RPKA 10MHA 3VPAA 3AYZB 3LMKA 5ALFA 4O59O 5K0NA 1RMQA 3Q7IA 4A8TA 2QTWB 1BJKA 1Z8DA 3O9ZA 3O1LA 4MW7A 2WYVA 5HK9A 1FJXA 2FQYA 1ML3A 2QBYB 4S2EA 1JTFA 2GRUA 3NGMA 1PQUA 2Z3WA 1IAQA 3W3AH 1M5RA 2ZRAA 2R8PA 3HJRA 5BY2A 2HK7A 2DHQA 1ZM4A 1T5EA 2QSYA 2WG0A 3BHIA 1H9AA 7YASA 1CQWA 4O1IA 1NBMD 2WTBA 2J8ZA 2EDAA 4GAEA 1VECA 1GSIA 4YJ3F 2ZM5A 3OWXA 3GCXA 4ZARA 5EESA 3FCOA 1KS2A 3JXEA 1VJ5A 4G2TA 1T0BA 5CDFE 1VE5A 2NZVG 2BJHA 4TV8B 3UUGA 2BHTA 2D3TA 4WJKB 1XFAA 2QX8A 3OAAD 4ZKEA 3TEFA 2DPXA 1C3EA 4ZVRA 3LL7A 3PI7A 2MCFA 2ZRBA 2EF1A 4A8JC 3PJEA 3Q0TA 2QRUA 4LZZA 5CITA 2UUPA 4PICA 2WTNA 3BQMB 3N8HA 4OUDA 4I1SA 1OB2A 4AF8A 2SCUA 4XR4A 2VYVD 3B78A 4JEUA 3TLJA 4IDQA 3TR0A 2XQVA 3ZWXA 1Y89A 3LUPA 1R8XA 3GLHE 1KMIY 1YRHA 4OJKA 3NHJA 4E12A 5MDHA 2RG1A 4FWTA 3AW8A 3IBSA 1L3BA 5H9WA 1P91A 1PFUA 3ND8A 4LCJA 1L7VC 2YW9A 4G89A 4WEQA 1G3QA 1FFHA 5EZ5A 4TS9A 3NEPX 1UANA 3HKDB 3NXSA 4WCVA 3INNA 2HGZA 2J87A 5E7MA 5H3LA 4ER3A 4MA4A 1MEEA 2ZZFA 5LR6A 1AM4D 4INAA 2JLSA 1BG6A 4XFJA 3JVIA 2OQVA 5F3WB 3N9IA 4IDPA 4MARA 2VJQA 3K7EA 1AKNA 3F6SA 4PZ0A 1DAKA 3BTUA 3WSTA 4CW7A 4ZK6A 4DB4A 2QTFA 3KD3A 2AK2A 2AYZA 2XVZA 1Z38A 3HDVA 1DJMA 3IODA 3SVLA 3ONVA 1DS6A 3GLIE 4R3NA 3OKFA 3WG9A 3WJ7A 2OBBA 4L28A 5FUBA 2H29A 2HX1A 5T6MA 1H8ED 3UPDA 1BH2A 3ZHTA 1PJ2A 4MUNA 4B6FA 3I6YA 1ZL2A 3CR3C 4FFVA 4C0HA 1YS7A 3ZLJA 3T0IA 3FHLA 1OLUB 1OY1A 2WPDD 2VAXA 4IFBA 3KT0A 3PVDA 2DQYA 3D3NA 2X0EA 1YD7A 3LRTA 1EQAA 1J06A 4UD6A 4Q6BA 4UM5A 3FDZB 5BSUA 1DHRA 4C6TA 4BU0A 2C98A 5CT9A 2Q6OA 4YQZA 5JOQA 3KQUA 3KLPX 4W6ZA 5F1KA 2AFHA 1GZVA 1RXEA 3O9VA 1M8KA 3DBLA 4GKJB 4YRAA 4O4IF 1SU6A 2ODEA 2WYRA 1V11B 3GRYA 3NIDB 2PUHA 1FS5A 3CY6A 1NNSA 4F5DA 5EG5A 3ZH9B 4Y7DA 3GLHA 1Y9EA 3X3HA 4X20A 821PA 5F12A 1NQWA 2GN9A 3TLAA 3R6LA 3RAPR 2J07A 3U7FB 2GHIA 1YSCA 3SIRA 1P3Y1 2FW7A 2NQ2C 2I2DA 2IYVA 2XYQA 3C70A 3GEHA 5JNTA 5B2EA 2O06A 3A1PA 5B58T 2OGSA 4L1KA 3AH8A 1D4ZA 2ZWMA 2F67A 1IM2A 3W2HA 2QSZA 4MRMA 3Q40A 2HRDA 4BFSA 3QPCA 3PX2A 4OQDA 3EY9A 4AMGA 5JECA 3X1YA 1SA0B 2HPHA 3FZYA 2Z8XA 3PHHA 4TM8A 4JBLA 2DERA 4F2DA 3KQSA 2G8LA 3HCEA 2FQWA 1GZHB 3PLRA 3UYKA 2EKZA 3IT0A 5D8DA 1K8AD 2C94A 2PTHA 3BH6A 4X20B 2O6HA 4A8JB 3T1TA 3SWWA 2V1UA 1YASA 5F9HA 1FU7A 1X7WA 4Q3EA 1J5XA 1QVVA 3OMXA 3G2HA 3ZDXB 4YAOA 3KPWA 3OKCA 2PX5A 1ZH2A 2WSLA 1VL8A 2YDXA 4IG9A 1EE1A 1JECA 3TMAA 2FSFA 4MKIA 1TPYA 1ELOA 4BLUA 4ARBA 5I3ZA 3N0VA 2LNDA 3VO9A 3NLLA 1HYBA 2FP4A 2RGCA 5AI9A 3LYHA 3M6WA 3SLGA 2VNKA 2Q5LA 2PMWB 4G0QA 1YQXA 1XR3A 3GZNB 3F7OA 2CLCX 1JWLA 1XTJA 3ED1A 1GQOA 3B1ZA 4MP8A 2DX7A 3OY7A 1JIVA 4Q6WA 2ZJ3A 3MD9A 1EZ1A 2R1TA 3WKBA 3U5TA 3KXIA 5K3EA 2AMLA 1YT5A 5BQFA 5A4KA 3I1YA 1Y4AE 2IU6A 4CETA 3CKLA 4G6IA 1QVZA 4AM8A 1Z2PX 4M1QA 4XD7A 3L5OA 5KWVA 3AP3A 4URYR 2X6WA 1EFUA 4ZO6A 4PLCA 5KWSA 1L4HA 3H65A 1P39A 5DOVA 1UPTA 2UYYA 2VSXA 1FYEA 1NF9A 3CPSA 4WZBA 5JY1A 5KUTA 2XJ9A 3DDUA 4EJSC 4NOLA 1P1JA 4LTNA 3QKUA 1WB4A 5KX5A 2QN9A 4A4DA 2PMBA 1MAVA 2REOA 2DKNA 4K9DA 1OLSA 4HNTA 1XAIA 1ZJYA 2GPBA 5H81A 5IYRA 4RJLA 3LO5A 4NATA 2VPPA 3D54D 3DM5A 1O0BA 3N5CA 1Y4SA 3V4ZA 1MX9A 1BEUB 2QXTA 3G9QA 4N3NA 4M6WA 5KNBD 1EFCA 1E9AA 2YFQA 4B32A 3M6UA 4O2BB 1KEEB 2QTAA 1BVUA 4YFVA 5EKXA 1YVPA 1IZ7A 1PFYA 1Q5PA 4RFSB 3KHKA 1RLMA 3LQ4A 4B4WA 5HR5A 5KOJA 4OV6B 3DDHA 3KTAA 5LA6B 5DK6A 5CB4B 1RBMA 4MYUA 1XVLA 5A5DA 4DT1A 3O47A 1B3RA 2Z43A 5F9MA 4M4SA 2C2YA 4F85A 3VZBA 3A8KA 4W9NC 1CQXA 1DC4A 1NW8A 3H0EA 1RLUA 3K9HA 4EMBA 2ESRA 1LBQA 1QHIA 1SEPA 2QVCA 1W88B 2WW8A 3DPSA 3COVA 4QGHA 3BB1A 3ESRA 2FNAA 5SYAA 1DT5A 1R6BX 3E9RA 4E08A 3TDNA 2ONYA 4MQ5A 1UBHS 4LRUA 2LR0A 4HUJA 1DCKA 4LOHA 4RF5A 1NVBA 1PJCA 1CCWA 1W46A 3ESZA 4LGMA 3WLEA 1WXEA 2N75A 4X1IA 4OKSA 2IYAA 1YUMA 3FYCA 3ROMA 3RVMA 4ARUA 5U9CA 2XGMA 1AHNA 2ZUWA 4YASA 4B3GA 3MRXA 1P7YA 4G1VA 3LQQA 3QWIA 1HDIA 3G23A 3DMTC 4E30A 4RJTA 5HGXA 5IZCC 2WMOB 3GPLA 1GTSA 4IEFB 5DISB 3PZRA 2PLRA 5I9IA 4UTNA 4R7TA 2ZSDA 4JELA 3IS3A 3TTVA 5EP1A 2HA2A 3WK4A 4Z1MD 2QTLA 3DL2A 1VFPA 2NYAA 4LXXA 3D3WB 4OG2A 2ZITA 5LZ2A 3PDCA 4UJ5A 2R8BA 2I6UA 2H85A 3DHYA 4IMPA 4YMGA 4LHWA 3IQWA 1NPDA 3IMCA 5CYPA 4WZTA 2CW5A 2ZRJA 4CVNA 2YWJA 4NZYA 4AT1A 3GZ4A 1TE2A 1UBNA 2F2TA 3OZCA 4PABA 5B1YA 2O19A 1EEXB 4IJWA 4MWOA 2V9ZA 5K3DA 2JLQA 1G6KA 2VN8A 4LGVA 1Z26A 1I1NA 4HN2A 1SCDA 1G21A 1JI3A 2GF9A 2IV2X 4MS1B 3GJ0A 5A5FA 4QDOA 4IUCS 1NZDA 1ZS9A 4ZVKA 2W90A 3TBKA 1WU8A 3ZY4A 1QB7A 3WYFA 2NT4A 3N59A 4BL5A 3LT0A 5GMOA 2C96A 3EK2A 4JXJA 1JQKA 1LB1B 4K03A 2NU6B 4ZODA 1HZJA 2WF6A 3ULKA 4FZVA 5SZJA 3AR5A 5BV7A 2V7GA 1XROA 2RHWA 5B1DA 2X58A 1EFPA 3BZUA 1FJHA 4KIFA 3KOXA 2G83A 1GD1O 3HCCA 4Q66C 3WWOA 1P2FA 1FUUA 3BEDA 5BWMA 1W59A 2I2FA 4K86A 1JHPA 3U80A 4KO2S 3NVMB 4TLDA 3FH0A 1D04A 1D1TA 2W93A 1YR6A 2J32A 1XVTA 2Z2JA 3C24A 3LSYA 3QE4A 4OTZA 1J8MF 3RASA 3SEFA 4HLUC 1FC0A 3ZV3A 4EPXA 5K3FB 1WXDA 3OUTA 3GFQA 4IILA 4TWRA 1U2EA 4DSTA 3GV0A 4FIDA 4LOIA 1VDZA 3F73A 5LP6A 3SVZA 2ZAIA 3NJRA 1XRSB 2ZUCA 5IK2A 3C5VA 1QYVA 3PNVA 4URZR 5GZ3A 3ZIAD 2QRPA 4FMCF 4OJYA 3PHLA 3TLGB 2WVHA 4BLOA 5I7UA 2BLNA 2X0NA 5CJPA 3HCNA 4XWKA 1FZQA 2VPZA 4FHEA 1I14A 3W78A 4C0JA 1O8CA 2PVSA 3AW9A 1VJRA 1I1OA 3CNBA 3ILSA 4Z54A 4EHDA 4B80A 2CFIA 3ESYA 2IPOA 4EG7A 1IWPB 2GK7A 4O63O 5D7BA 1ZN9A 2ICAA 3P0JA 3H1GA 4WK6A 3V7WA 2IW1A 2BFEA 1I0LA 2Y92A 1A4IA 3KB8A 1AO0A 3TTXA 2I87A 3NO4A 1UPBA 3D8TA 4EL5A 4MS4A 3QVSA 2A0FA 2PBZA 2CFCA 4ZO9A 4CXMA 2AWNA 3C8HA 1JDBB 3SS8A 1FY2A 1PZXA 1CQJA 3T7JA 1N3IA 4DMKA 1WKBA 2OV3A 3H5LA 4H60A 5J1TB 2FXVA 1XA0A 2LKDA 2R5WA 1J1ZA 5CEJA 3OLZA 3W2FA 3VKFA 3N2GA 2VHYA 4CPDA 5E1BA 1X14A 2BMDA 4MV6A 5DYNA 3UQYS 2RGWA 3FX2A 3ZDEA 1O7JA 2VSQA 2J31A 4H15A 3CXUA 2FOIA 2OT3B 1GZ7A 2WT8A 1PK9A 3ESXA 3SE7A 3HJFA 4OU4A 3FTDA 4KQMA 1VBNA 3HYNA 2WTMA 3VI3B 4ONEA 5DW0A 2VHEA 3FLEA 4RQTA 2VZ0A 4JLDA 2IQIA 2WTXA 1TFUA 4L3WA 1FMCA 1QV7A 2G09A 3K5HA 1Z4PX 2XKJE 4H7PA 4ME6A 4B6JA 5JZBA 4L6AA 3KXKA 2HAEA 1KQ3A 1GPMA 1E5VA 5EP4A 4BTLA 4UXIA 3X1DA 4EHHA 1T1SA 4B47A 5F64A 4WSOA 4K9PA 2CV1A 1T9BA 3AT1A 2TMKA 1JIIA 3KKMA 4IH4A 3W2EA 4N9WA 3PZBA 2QL7A 4ZQCB 4YV1A 2VTBB 4KFRA 1JEYA 1I7DA 1QFZA 5IDXA 3N7AA 1Q15A 3W1WA 1S1MA 2Q2OA 2WDZA 2DUUA 2ZRHA 3GMIA 5F33A 4QKQA 1XLTA 3MEQA 1OWPA 5JS7A 1GPNA 1QR6A 1WL8A 3K72B 4DSZA 3JQ9A 2ZBVA 4Z8XA 3L84A 3ON5A 2WQ7A 1Z33A 3IVGA 1GZ5A 2AXQA 1M8FA 2IODA 2XOEA 2CDNA 1VE3A 2GCIA 4E46A 2YASA 3NT4A 4J0DA 3RC8A 3CMAB 1W9MA 5ENVA 1JVSA 3SXJA 5JYEA 1IY9A 2VKTA 2GAFA 1ZXXA 3FOBA 4CQJA 4PSKA 3D02A 2G8NA 3JSAA 1XC7A 5FWXA 4RUKA 2Q9UA 1U3VA 4ZT2A 1GL6A 4MKGA 5B64A 1FRNA 4DV6B 3WA6A 1PGQA 2HWYA 1AURA 2QVLA 2ZRLA 3GN1A 4RSMA 3T6KA 1U2PA 4ATNA 1VE1A 4XGNA 4IBOA 2M98A 1RXCA 3D3EA 3FG9A 1Y8RA 2X5JO 3L18A 4RF4A 5A71A 1KYQA 4MGEA 4CUKA 3T12A 3Q9LA 1JS1X 3RIHA 3O8DA 4Z4YA 1LTQA 3OFJA 1UT8A 5CU7A 1K28D 2BT4A 2CEKA 2IEDA 1X9GA 3VBEA 4DNFA 2QVGA 2FKNA 1T2CA 1KP9A 4ZDKA 2WOJA 1G9XA 3R6WA 1OLXB 4RZIA 3M6XA 1MRZA 4EKDA 5K3OA 1Z0AA 1ZQ9A 3LLMA 3WRYA 1K0UA 1FFEA 1G7TA 3EDCA 1NBMA 5T4EA 2R8XA 1VMAA 2H2FA 4W1PA 5COBA 4WN3A 5C5CA 2JFUA 3B52X 3T4UA 3ROFA 4EIWA 3WSVA 5TT1A 3BZBA 3J80A 3PSAA 2FYTA 1X7YA 2JVKA 5LCXA 1KOJA 4OHVA 5KTOA 2P7IA 1BC5A 4FKZA 3ZJUA 1WS6A 3AEKB 4MUMA 4RTQA 1DAFA 1QB8A 1EVYA 2XY4A 5FR1A 5BUCA 2BR5A 3EZGA 3ODGA 3LAWA 4AZ0B 4B6QA 1MABA 2HJGA 4KP7A 4YUZA 2XTMA 2QNIA 4WLUA 5H16A 1E3LA 2ZVJA 5J4KA 2YR0A 2QZ4A 3WGUA 2BI4A 1JG7A 1X7XA 1HGXA 4YCMA 2AJDA 3GJ8A 1TX4B 4NARA 3O8OB 1LTKA 2XD9A 4B1FA 3MG9A 3OEEA 3HR8A 4I5IA 3DD1A 4EGCB 5JI2E 1UBEA 5DN6D 2DKFA 2HSGA 5JLJA 3ASTA 1UF9A 5LWHA 3O21A 1C3XA 5GINE 3EZFA 3G5AA 3TQOA 2ZSJA 2JLCA 2JFFA 4I1OA 3WP1B 4LISA 4DW8A 3H9QA 3NJ4A 2OYCA 3W0LB 1THZA 1YJWB 3QEOA 1JT9A 5F78A 1MMFB 2GM3A 5L46A 1JE0A 1N8NA 2VBVA 1L8OA 1A71A 1ZGCA 3C87A 3N7UA 5AKHA 4ZRDA 3DWEX 5L7YA 4D8YA 4X8IA 1WSWA 3AF1A 3UV6A 5C1PA 3WFJA 2I80A 3NC4A 1UPFA 2NVWA 3T0GA 5C3MA 5FI3A 2WIGA 3K53A 3RS9A 3AJRA 3O6VA 1MABB 2PRZA 3SHVA 2Y0BA 4CI0B 1A5AB 1XBTA 3L7CA 4TSFA 2VHQA 2O8CA 5DOZA 3TCNA 5A3JA 1FP4A 3OZSA 5I9MA 4IDHA 4BZPA 1MNQA 2ADFA 1Q0UA 5FLEX 4PZLA 3IQHX 1V7PC 3SBEA 4WZLA 3SBXA 4F5WA 3AIIA 3GCZA 5A4MS 1CERA 5DMHA 1I8TA 1K6MA 1W5EA 3GVCA 1OWLA 4HBZA 1NF2A 1TECE 2H2GA 1U5BB 3ZQ4A 1BYUA 2MSDB 3IE0A 1OX4B 3G2OA 4DA6A 4LQCA 1KARA 4YLYA 1AQYA 3AI2A 4L4YA 4OHOA 3ER9A 1YE3A 3VDQA 2C92A 2GK6A 2A9VA 5HM8A 5AW7A 5CNMA 3WI7A 3GP3A 3NUQA 3VV3A 1W4RA 4BX8A 1TB4A 2Q6LA 4ZYZA 1PS8A 2ZKLA 3N2KB 1UM9B 1OTHA 1B6GA 1BHSA 4Q03A 4QFDA 4RBNA 4NE9A 4BV8A 4EKIA 2IDMA 3JQQA 2Y67A 1IL0A 5A04A 1Y8RB 2C9YA 2VSFA 4I1IA 1J24A 2AX3A 3H0CA 1QSGA 1M2FA 4LZLA 1EFPB 1OW3B 3TI9A 4PX9A 1ZOIA 2CNWA 3WLLA 1ZSNA 4HLDA 5FWXB 5JXGA 4C2AA 3R0IA 3B3JA 1CW2B 2BGTA 4EVQA 1AZLA 2GPTA 3D64A 3QKSA 1M1ZA 3RWOA 1BFUA 4G8CA 3PEFA 3WRXA 1C0PA 1IHMA 2QR5A 3R2JA 2F1HA 3SR4A 4F60A 4YMVA 1ZMXA 2IFTA 3EGCA 4ZYTA 5AD1A 4MH0R 3LOQA 2QT1A 4WZZA 2WP8J 3GPBA 4KWCA 3JQRA 4F92B 1PJ8A 3ZDYB 2HMVA 3CONA 1WHSB 3S1AB 3CPJB 1K8QA 1CQIA 2EL9A 3FSGD 4LN1A 4TKVB 4YJGA 4QVJA 1RKBA 4EPVA 4B85A 4TN1A 3VAAA 2NMVA 1UPCA 4D45A 4RGYA 1TEXA 3BJMA 1W4AA 3Q12A 4Z9AA 4BB6A 4WESB 3DMNA 4JI8B 1VG8A 2WY2D 4MDHA 2ID7A 2YOFA 4DCPA 2R47A 3WLQA 3B9PA 1CB0A 3AUTA 5F7ZA 4RYLA 5EVJA 2FLVA 2ZI3A 3F8SA 3BC9A 2DUWA 4HGQA 1ZCFA 5GM1A 4HX2A 3TD2A 4CDGA 4L8JA 4RO0A 2Z4RA 1O8BA 1I4LD 1S0UA 1W9XA 1FCJA 1H05A 1DQYA 4CDRA 3I8OA 1T1IA 4XDGA 1P77A 1T5DX 2QGGA 1OI4A 1VQLB 1K97A 3ICWA 5DJ5A 1JHOA 2EKQA 3KPUA 2AW3A 4GXNA 2W6JA 4IICA 2H1RA 1FDRA 1L4NA 3CSUA 2P68A 1F9EA 3UOGA 1SZPA 4R7GA 3CWQA 3P0RA 1JG1A 4UBKA 3WVNA 3AI7A 2FMFA 2PR2A 4URWR 1HOXA 1RFLA 3SYTA 3WJAA 4YT2A 4JXZA 1I7LA 2OTCA 1PR3A 2XIQA 1GTJ1 4NYMR 1O5OA 2H7VA 1M2EA 2IOHA 4P84A 4LSGA 3BT7A 1SHKA 1SD5A 3P0IA 4U2CA 3CSDA 4CV2A 3L8CA 4NXNB 1ZI8A 1PS9A 2ZWVA 2RHLA 4Q21A 4OOXA 5B12A 2EJTA 1H9CA 1XZKA 2F1IA 1BU8A 3N0WA 5E6SB 3HB1A 4ZU1X 3RC1A 1B8NA 3ILXA 1E9CA 4NJEB 1M66A 1E2DA 1GQRA 2I33A 2O1WA 3F2VA 5ALHA 5EXDA 1A7AA 1N92A 1NW6A 3O84A 4E7PA 2QM0A 2VDNB 4KITB 1CE8A 3LRXA 5K20A 4LFAB 3CMMA 1Y6QA 1E5TA 2F9FA 3CO5A 2NPIA 2Q21A 3AKYA 3EIWA 5BN3A 1QKIA 2GWHA 1BHO1 1YBHA 1D7AA 2VP4A 4MW6A 5FEMA 4TXLA 2NU9B 5TLSA 3H86A 4R0MA 5ARDA 3EPJA 1NMZA 4JWTA 4M8LA 3X1WA 3ZW8A 3L7DA 4LXIA 4RKRA 3BA1A 1G8PA 4WLVA 1UEJA 3UK0A 1XN1A 4CF3A 1SBHA 4CI9A 2B69A 3H1FA 1QFJA 1MB3A 2I66A 4LVNA 4HDRB 1PQPA 3Q39A 2CFTA 1VLYA 1MTZA 4S1VA 1W8IA 2B36A 2H7YA 4YGYA 1QORA 2AXPA 1I0IA 1ODSA 4LE1A 5F76A 4CU5A 2R60A 5JSUA 2VQEB 3DZIA 1U80A 1ADCA 5F77A 1EUZA 4G7XA 2B34A 1GOTA 3ZE7A 1TM4E 4J76A 4XYBA 4J4BA 4A8HA 4LDJA 4PNZA 1SHTX 4IIJF 3VNRA 4MTLA 4GBED 4O3FA 4X66B 1T5SA 2GK3A 1K2WA 2CMKA 2JJ1D 4HZUB 3EJWA 1FXUA 2G71A 2F1JA 3Q11A 5IDYA 4QIHA 3WK5A 5ICEA 1QIDA 2HBQA 5F7XA 1X13A 3KQYA 1XMJA 1M2OB 2YHIA 1ZVVA 5AN9A 4R3WA 4ZVQA 1AKWA 4GEGA 1A77A 5KVCA 1PWEA 4QBFA 5KQSA 1N6HA 3FBTA 1XDWA 4F5EA 4TV8F 2VZ8A 3U62A 2D2FA 2VIIA 5FX2A 3RY8A 1A88A 2VRNA 3EAFA 4HYQA 4N8DA 4X41A 3QLJA 1ZDMA 1QONA 3NHWA 5DE3A 2QS9A 5CD9A 1DEKA 3P9RA 3MC1A 4OHKA 3VUFA 4MHOA 1HT1E 4DLNA 1ONNA 2ZZMA 2V9CA 3QX8A 1J97A 2QRLA 2Z58A 5A3VA 1BA3A 2DBYA 3C6BA 4JOCA 2B99A 2PE3A 1B1AA 2REXB 1XEXB 3E7PA 3QU2A 5KYUA 2C61A 3HBMA 4FCCA 4CF6A 4OF4A 3RSGA 4RKEA 3QJ5A 4JV5B 3P97A 5FQNA 3F78A 1I3NA 1CS0A 3B6EA 1J8DA 1MO4A 2WAYA 3ZQJA 1M2KA 3O8OA 4YC7A 3TR5A 3BWMA 4X93A 2Z0MA 2C4MA 2B61A 3OPOA 1NNI1 1C4KA 3D3WA 2EZ8A 2UZ4A 3B6JA 4KKTA 3K9WA 3NH9A 3DMDA 3TIXB 4YJHB 1NBME 1K6JA 3C41J 3HRKA 3C6XA 4P4SB 1GKYA 1UP7A 5HVNA 2OSBA 1HUQA 1ID1A 2VNAA 3C98A 3ZDZB 3ZHXA 1LCIA 5DHAA 3UJ8A 4Z4GA 4LRWA 2BE7A 2WSIA 3MXOA 3OIVA 2PGNA 2ORIA 1QIKA 4O6VA 5EMKA 4AUNA 5L4SA 4EJ2A 2NSYA 1M34A 1FSPA 4AN1A 2DFLA 3KCNA 2IIBA 3R9WA 4YP7A 4FEGA 1Y9DA 1XA3A 2EFCB 2BEWB 1OF1A 4L6IA 3DNPA 4MKRA 4OH1A 1FTNA 1BCRA 2WTUA 3RVQA 3I5XA 1EB9A 4HH4A 1PJZA 2JGNA 2QLJA 1JH9A 1NLZA 4UM7A 2XB6A 2AQKA 1XGKA 3FB4A 1AG9A 4JBWA 3HMQA 1SUCA 3CRNA 2VJBA 1PV4A 1LDYA 3LGSA 1JJVA 3FPGA 4M7WA 2ZJ2A 5FOXA 2Q5HA 1T4GA 1RAFA 3OOWA 4JYCA 1NULA 4ZVLA 3FWPA 1M7BA 3GUHA 5KNDH 2PY6A 2XQFA 1OIXA 4CV1A 4R2IA 4B17A 1QVWA 1F06A 2QRGA 3UUFA 3PKIA 1OPXA 3RS7A 5B1IA 3ZHOA 2JB9A 2VL7A 3ELBA 4JITA 1NKSA 2AW5A 3STHA 4MQFA 4YVFA 5JZMA 1GZ6A 2HCTA 1PVDA 3PGA1 3UCEA 2VDMB 4HVCA 3NYIA 3TTTA 4L73A 5HZGA 3DCYA 1ENZA 3G0GA 1N2OA 2XB9A 4MMXB 4Y98A 5BNFA 3LUGA 1YZHA 4R2LA 2C97A 1M67A 4GT1A 2A58A 2HNAA 1A8HA 2V0NA 4J29A 4TMYA 1QP8A 5LJLA 1TJ4A 1E6LA 2WZDA 5HILA 3NEAA 1XXLA 2BTQB 1II0A 2ZIVB 1BQ3A 4Q34A 1SG6A 4CFZA 1DX9A 3D6JA 4OJTA 5JQWA 4G23A 2IYFA 1FUIA 3F1KA 4QUHA 2B83A 4KQKA 4PHHA 2CXUA 2GT1A 4MO9A 4XN3A 1IK6A 4AL4A 3RT7A 1QGYA 3ZBTA 2ARKA 3IUNA 3L77A 3OHPA 4FLFA 4UQPA 1UK7A 4KMSA 3FKJA 2CNLA 3RJMA 3RQSA 2QMUA 5JCJA 2R7MA 1B0ZA 4YRZA 5AKZA 3FR8A 4BNKA 1X92A 4CM5A 2XVMA 1H6BA 3MOSA 5TDHA 1MORA 2XUZA 2H0QA 3FPKA 1OWOA 4OP2A 4M7RA 5IYZA 4IIFA 1V1JA 3VPBA 1EXMA 5FLXA 4GUAA 1TJ5A 1HOTA 4N5LA 2Z6QA 2FHPA 1G6OA 4K9OA 3SMQA 3L05A 5K0FA 3N8GA 2PANA 2O2HA 1QCZA 4ZOCA 2F9LA 4D3ZA 2QUHA 2J3EA 3L2OB 5T4HA 1ISHA 1ST2A 2ONZA 2I7DA 4M1YA 1Q1ZA 5CNIA 1ZR4A 1EGMB 1TLFA 4FHDA 4G24A 4A16A 1MKYA 2B8EA 2P27A 2Z8ZA 3UNXA 5ER9A 3B5EA 1UFVA 4MGYR 3EHDA 3N0RA 1Y3DE 4RZ3A 2AE1A 2XA1A 2XB8A 3W90A 4GOOD 2JA2A 2I6GA 4NE2A 3AFOA 4BEBA 5EJGA 2I34A 3EVNA 1T3GA 2GTHA 4V0LA 3RYHA 1B14A 1XJ0A 3PGMA 1YVEI 3OEWA 5A4DA 4LXHA 4S1TA 2V7WA 3AZOA 2OGUA 5EE9A 5FV7A 3SIXA 2WLSA 5TB5A 3SKVA 1PYGA 5IF3A 1SC4A 3OZVA 4F5YA 1V39A 1VQ1A 5LZ7A 3ROZA 4AZVA 5CFZA 3BWXA 1BEEA 2CUNA 4G5OA 4U7TB 5EE5B 4ZAYA 3WIBA 2XBMA 3T7CA 4EJ0A 4KQWA 4KPEC 3T51B 5EIBC 3UFBA 5IAAA 2V5UA 4B3CA 4HNQA 4O4JB 3HR7A 2A3RA 5EGSA 2WZPP 3VV2A 2G4CA 3LNTA 4RX1A 1ZUIA 1L4GA 3MTBA 1BDBA 4RJJA 4BV2A 4C89A 4EJMA 1YTLA 1PYDA 4N5NA 3EODA 1B0UA 4M87A 4AQDA 4MKHA 3UC5A 1I5OA 3P0FA 4L9SA 2PZFA 2DFKB 3OBBA 2C88A 1PKEA 3ZJ5A 4AMBA 3E6AA 2AI3A 1WTCA 3RC3A 3TE6A 3EXAA 1R5NA 4OU5A 2P6PA 5DM4A 4GOND 2GF2A 1US8A 2ST1A 1XE1A 4JOSA 2SHKA 1Z28A 1OOEA 2RGAA 2XKAA 3ORHA 4N5HX 3T41A 4GX1A 3PB3A 1SVNA 3BWEA 3COSA 3Q3HA 4FQ8A 4QBHA 4PBRA 1V9SA 3R8CA 1CR2A 3P2YA 4K9QA 1QYCA 2GYYA 2Q0SA 5IYNA 4XDZA 2YFKA 5JAIA 1UDXA 3ESQA 1PT5A 4OUKX 3FZNA 1YQ9A 4NK4A 2DRIA 2LGJA 3FWNA 1ML4A 4CMIB 2I3GA 2NSHA 2D1RA 4MCJA 1KSHA 1K92A 2Q4RA 2H8KA 4NICA 3IBFA 4DA4A 4GECA 1V48A 4V0RA 4BVKA 1R4MB 4M49A 3HLTA 1KL7A 1HSOA 1UFOA 5FP0A 5BN3B 1Y42X 2UYQA 5LQNA 3L8ZA 3RYIA 1D6JA 2PQ6A 2C9OA 5K4AA 4DMLA 4IWNA 5THXA 3BF8A 3FRJA 4HLCA 4RANA 3U3XA 4TZKA 4NJMA 1YZGA 2RIRA 4D8TA 2FX3A 1KI6B 3IHLA 5DX0A 1WP6A 1KEPA 3DOFA 3WLFA 5B1EA 3IFSA 4EZBA 1AKQA 1SUDA 1VL2A 4K6KA 3KIPA 3SKYA 4C20A 3HO1A 4M1KA 4O5AA 3G05A 2FTKE 4HUQA 1BS9A 1SVMA 2JFBA 2PRJA 3V7AA 1BDMA 2YVLA 3HKCB 4KQJA 2VJPA 4Q9JA 5NULA 3PXGA 3RDPA 1WUTA 2X7HA 2E1BA 1AQUA 1XRJA 1B6RA 1TA9A 4WNIA 4ZZIA 4BAGA 3X0DA 2A5LA 2CL5A 1EGAA 1L3IA 4MGZR 4ZT4A 3E1YE 2I78A 3FLMA 3RWMB 2GPAA 4PQFA 4WZAB 1LPAB 1H1LA 4HB4A 4KO1S 1P1RA 4LJ6A 3QKIA 1TF2A 2CWDA 5DTQA 2OFWA 4UOZA 2C8LA 5IKPA 2OYSA 1AQ6A 1P9OA 1BN7A 1KYXA 4ZAGA 3WL5A 3SAJA 1D2MA 3OZWA 3DE7X 4JQZA 3FGPA 1CULC 1WAMA 2AN5A 2D2XA 3EQ9A 3T7IA 3FPAA 3I5UA 4HDSA 1DV1A 1G7SA 4C08A 4F4FA 4NMLA 1U9JA 4X1IB 2WPDA 2I9KA 3AK4A 3KAKA 3V32A 2GBIA 4D8UA 2GZRA 5B53A 2ENWA 5A2QA 5J2UF 5BMVA 2Q07A 1JEDA 3R3WA 1XD8A 4QDTA 3ZQUA 1GN8A 3BHNA 3K0EA 3C3EA 4H18A 4EGJA 1OTYA 3AR9A 3QJGA 4OM8A 2HRRA 4TX1A 1GRNA 1N5MA 4YDQA 5GAJA 4FR2A 2P78A 4WA8A 5CPFA 3D7NA 1RLTA 4D4KA 2E5LB 3B1YA 1TW2A 5JJLA 2VT7A 5FPYA 1T8WA 4JL5A 1IATA 3VHRA 1A3CA 3GRPA 3JASB 3OU7A 3C0KA 2FEWB 1BVYF 3MNFA 3UH0A 4AO6A 4B87A 4BNLA 3KJIA 4C1BA 4YRIA 3FOFC 1KO8A 1NN3A 1HE8B 3PQEA 4BJ6A 4BNUA 1YCGA 2FR0A 3KK0A 4XOTA 5CNJA 3R7WB 1XVIA 1WDMA 3LXRA 1U6IA 4WY5A 3P4UA 1PZFA 2PS9A 5TNXA 4HWRA 2P6UA 1RQPA 2E89A 4BN0A 4KR7A 1K8ZB 4UUBA 1P33A 2IIQA 4B2LA 5IHPA 4ER5A 1K3UB 4EPYA 5AOVA 4KH0A 1NRWA 4Q00A 5I47A 2EFGA 1K5HA 5EZSA 3QVKA 1VZ2A 2JLBA 5E1OA 1L4LA 3CLHA 4I9NA 4FNAA 5IJWA 1E6UA 1HM5A 5K4HA 4GF5A 2X9GA 4DJFC 3N2KA 2NAPA 3MTGA 2PD4A 4EUKA 5JS8A 1L1EA 2VDWA 4G0NA 1CRZA 4G25A 4RY0A 3UKOA 2E85A 3OICA 3L1UA 5JO0A 3JWPA 1JKMA 1VGQA 1WHTB 2X2EA 1C8LA 2J9GA 2WRZA 5FPPA 1T26A 1TMKA 5BP7A 1HI9A 1HZZA 1MQ9A 1Q17A 4RV5A 3INRA 4RGBA 3HB5X 3RPEA 1N6LA 5KOYA 4UBJA 3AY0A 1LBTA 4IRMA 4A27A 1T1RA 4KR6A 1WDWB 4X8LA 4P2GA 2OG2A 2IXFA 2CHFA 3FMGA 1V9LA 4MLCA 4A6DA 2R79A 3G59A 3EC2A 4KGVA 4L15A 1MX3A 4YCLA 3ADOA 5CVDA 2YYYA 3A6GA 1YA8A 2E49A 4MCIA 5IH3A 3KB6A 1TA0A 4YV7A 5TXGA 4LK2A 2G9VA 1M5TA 1JSZA 4F21A 1XDDA 3SJZA 2AIRA 3UANA 2X1VA 5FV4A 4I1PA 2W4QA 2DCUA 3A10A 4WINA 1X1CA 4KO3S 1G66A 1Q1EA 3H9UA 3MWYW 2QZSA 2GSWA 2J5XA 3QFTA 4JLVA 1SXJC 3ILVA 5TMBA 5K1ZA 3REQB 3T5AA 1TKRA 3W5BA 5TS3A 4O4IB 3THWA 1B00A 2ZB3A 4MRMB 2J33A 4TYNA 4NLLA 1G21E 2Z9BA 1CRWG 4K5QA 4YRFA 3LLSA 2ZYIA 5KS2A 2QYHA 1KAQA 4G5RA 4FFRA 5ENZA 1ZRMA 3AYXB 3WFIA 4UVGA 3K8ZA 3CXCB 1N2BA 4C7KA 4H6PA 2V4ZA 2FPPA 3T0FA 4B5KA 3L9XA 2PX8A 4F7WA 1DJNA 4N5IX 1GQSA 3CSSA 4C3VA 1K63A 2J3IA 3T5DA 5AVXA 1UR5A 2XV1A 1BKDR 3I76A 3Q7QA 3UBMA 9LDBA 3QVGA 1T5BA 1Z15A 3EARA 2V6JA 3NRBA 4P3OA 1E20A 4XSHA 1G5HA 5JAOA 2F43A 1LNZA 4LNAA 2JH9A 4OFXA 3T52A 3T4EA 3TQHA 4RPBA 2GTPA 2DPLA 4F3KA 3TLCA 4WLNA 2MINB 2XAAA 2L82A 3DTYA 3O95A 3A3GA 1XDZA 1PJTA 2O5VA 1P2SA 2OPBA 3H13A 3L01A 2B4RO 3ORFA 1N08A 5H59A 4EUEA 1P2VA 4D26A 4C9BA 1CZHA 3QEBZ 2BFMA 3ZU5A 1JJIA 4NR0A 4E1VA 2IYRA 4EX7A 2X9LA 4CLDA 4DMGA 2GBGA 1LWNA 1NMSA 2X5OA 3ZZ0A 1ZA2A 3OSUA 3JATB 3IXQA 2A84A 1FIUA 1F7UA 3LVBA 2ECPA 4XI9A 4EPWA 2EWWA 3CMEB 2QTHA 4KPYA 2GZ2A 1AY0A 2OAGA 2X6RA 1JU4A 3FVVA 3HBJA 1W96A 5GONB 4BVGA 5C8VA 1OA0A 4JKYA 3HBAA 4OIFA 3SLDA 1DT3A 2JHCA 4I50F 1HMYA 1JVBA 4ZRMA 4YS6A 3CZCA 2NXWA 2R5NA 3Q3CA 1HEIA 2V4MA 4I4IA 4CLEA 3BD9A 3IP7A 2WAAA 2Q3DA 3R3UA 4HPWA 4NFSA 4UHFA 4RA9B 3THOA 2VYCA 3HUTA 4HADA 3V1UA 3ZVRA 3G1WA 4DWOA 2VBIA 3EA4A 4DLSA 4RIIA 2GA8A 3CCQB 2C5AA 1CIPA 2ZE8A 3TRIA 2NIPA 2W2PA 3EVDA 4N54A 1OPRA 2W2TA 2ZR9A 4DE5A 4F4HA 2F00A 1KR2A 4ND3A 4ODIA 4C2BA 2E4ZA 4KDFA 4MPRA 1KK1A 2PJZA 4RQAA 2Q2WA 5BNWA 3I0ZA 1OH7A 2Q2VA 4LWZA 4JS0A 5SV2A 3FAZA 3MCWA 3T3HA 4DMRA 2C5FA 4INJA 1YV9A 3QLUC 5C51B 3ZGLA 2G17A 2JBAA 2XMRA 3ML1A 4ND8B 3C4VA 3DXYA 4D3SA 1Z3IX 1KC3A 2YIMA 1EXNA 1RXVA 1G21B 1M6VB 1K9VF 3BDAA 2VWPA 1VFNA 3ZU3A 1TJPB 1MJ5A 4JROA 5AM1A 3RSFA 3N7TA 2WI8A 1IXKA 1ULUA 4LJ8A 4PZAA 4R4JA 1UKVY 1XK6A 3EEBA 1B8VA 1R10A 2I2WA 1Q0HA 1HLGA 1OXVA 4C7OB 2YXBA 2E6KA 3PNYA 3MWEA 2XT9A 2XNHA 2WM2A 4K3UA 3ZWYA 1N36B 2W5UA 4EA9A 2N1MA 4JI5B 1CFJA 4KH1A 3IQIX 4B0PA 3MGAA 4ZYWA 4HPJB 3R6GA 2Q6KA 3AEXA 4DMCA 1Z74A 4ENQA 1UC9A 1DEHA 4WY8A 3A6HA 2QQFA 4DZZA 4QV2A 4RZHA 1TEHA 5KU1A 2GZSA 1TU3A 5FD8A 4RDIA 3HHPA 4GZMA 4ZAWA 3B8EA 3DE1X 3T3GA 1ZGZA 1TLLA 1DC3A 3CG4A 4FR5A 1TEVA 4BMZA 1AKYA 1E1YA 2A33A 2CZGA 3JQ8A 3O8RA 3KWFA 5CFQA 3BD7A 3MWEB 1PT9A 4QPZA 5J1SB 2BF4A 1LI4A 1CK4A 3D0OA 2EQ5A 1NRXA 2ZROA 3O0DA 4P08A 4HE5A 1XTIA 4PX5A 3EXG1 1VKOA 2K87A 3RQIA 1XKXA 2OXCA 2C4NA 3DQQA 3ZCXA 5G3ZA 3OW7A 2CWWA 1Y6GA 2NUPA 2QJWA 3KOYA 4QVAA 1W88A 1DC6A 4BO8A 3UFXB 1QLHA 2Q0HA 3A8TA 2R8ZA 5BV2P 5ETJA 1OWMA 6ABPA 1OFUX 3DE0X 4IKOA 3GJ4A 4MINA 5HKAA 2IL1A 5I9NA 1HRKA 1Y1RA 1SKBA 5FTWA 4AG5A 1R64A 4R1TA 1LDMA 1KTIA 4YIHA 4ZCIA 1KC8D 3GXBA 2H4WA 4MVJE 1QLWA 4MV1A 2IDZA 4W8GA 3R4VA 1J56A 2YHSA 3GRCA 2ZZGA 4G7WA 5HUHA 2AMFA 1HDZA 4UULA 3WYBA 3V4OA 5M29A 1U0SY 3JRNA 2QRZA 1XDUA 3BH7A 4BNHA 5FNVA 1AQLA 4W5JA 1PYOA 1TCAA 5DXFA 2Z3ZA 3WAKA 5LQMA 1XZNA 2A2ZA 3LDHA 4X7FA 1HORA 3RVOA 2ZUEA 3CUYA 1XF9A 4TL6A 3AQ4A 4XVQA 1WXWA 5HHTA 4QE3A 4ENRA 1Z17A 2OORA 5DBOA 4L9RA 3DOEA 2QTNA 3U31A 3ZOZA 3CWZA 4R2HA 3L49A 1XEAA 5EZYA 4X7BA 4TT3D 2DYKA 1E2GA 1T2NA 2HY7A 3BTOA 3MTEA 1UD5A 5HDQA 4B34A 4MLDA 3RSZA 2VF8A 1XJWA 2VPQA 5AHKA 2ZXFA 4B4DA 2ZTHA 4BGEA 3OX4A 1KVUA 5L8VA 2IW3A 3E23A 4FQ7A 5E7QA 3JSXA 4UUQA 1WB9A 2CL0X 1OV6A 1Z34A 1SVWA 2JFHA 3NBKA 3D8BA 2VUIB 3LP8A 1FP6A 2F6RA 2NQTA 1LFAA 4HK4A 4L8FA 3ZGVA 3AR8A 1DUVG 2HADA 3HLYA 4QSMA 5E9AA 3N39C 2P5TB 2ZG6A 3UICA 5K6RA 1O4WA 3GY0A 4C6SA 3FPPA 3B6KA 4OXNA 5ESRA 2QA5A 4CMAA 3GH1A 3GD5A 2OLEA 4I3HA 5CA0B 5LD2B 3T5TA 1OJLA 1X7WB 2IT1A 2Q5FA 1JMKC 3OIUA 4LZOA 1K6EA 1SGWA 4LYYA 4CEIB 1J2YA 2UU9B 2O48X 3VAZA 5ADVA 4DOMA 2OFPA 4QVIA 5F5LA 3WXMA 3I9KA 4KK4A 4DIBA 4HVTA 2V45A 3OKAA 2XCSB 1YS9A 1RIFA 2IHVA 3GPDG 5B3JA 4KQIA 3HXKA 4DCGA 4ADSG 3AM4A 3TSOA 3HCOA 1Y1QA 4MK4A 3ZKWA 1DXOA 1W49A 1H3NA 2DM6A 2X8JB 4J7XA 4JGGA 5L7WA 5CCXA 2YYZA 3BVPA 4LNUA 1EIZA 3I1JA 3KZXA 3V7NA 3VZRA 4EHAA 3VNSA 3P9ZA 2O8BB 1JHMA 3NHSA 1X86B 2IYWA 2JCXA 3HSSA 3PFCA 4XX1A 3W9BA 1ECPA 3BFKA 2B7LA 2R7AA 4YMSA 1KI2A 1GFZA 1OX5A 3EPRA 4I4TB 4L9AA 1LLFA 1TK2A 2DBQA 3D6VA 4DSAA 4YRMA 4TYYA 2QOEA 1JIJA 2XCLA 3RC7A 4HP8A 1KXZA 3KLOA 3ZDCA 1T2EA 3ZYZA 2ES4A 1YJ8A 4HG2A 1RJ9B 2IZOA 1SO8A 1ZKDA 2OUKA 3QMWA 3R6TA 1U9CA 4R69A 3TGWA 5LFAA 1PJ4A 1Z2EA 4MWZA 2B20A 1IU9A 4TLCA 3TR6A 1X2EA 3SQDA 1ZGJA 4OSEA 2Q5OA 5C8YB 1KEVA 2JARA 1GSOA 2I2AA 2IITA 1J5EB 3A06A 5HIMA 2WUEA 4F91B 2WZNA 3DG9A 5L9AA 4CGZA 4GI7A 3P27A 5A7HA 2Q41A 4IVNA 5LMUB 3M89A 2WM9B 4GSKA 1JBKA 2VCHA 3RHZA 1M9NA 3IMFA 4KLZA 1TUBB 1CY6A 2PGJA 1SK9A 2JGFA 2WU1A 2YZKA 4MKFA 1B0PA 4IV8A 4XGKA 4LQLA 4ETNA 5AUOB 5CB4A 4DR4B 3PVZA 3IO3A 1R8QA 1FTYA 1NDHA 1RAIA 2Q3FA 2WVAA 5FTLA 1VL6A 3KOMA 3DLAA 3MTQA 4PLFA 3A6DA 1DO0A 3JD2A 5LBUA 4QYIA 4CDMA 4NCHA 4ZTUB 3OLWA 1XPRA 1MB0A 5BNZA 2X1MA 3K2EA 3Q7PA 4LS3A 2J0SA 4LDZA 4ACAA 1WW8A 1V35A 5KJ1A 2DJ5A 1E98A 3FOAA 4Q4AB 1C2YA 1FSGA 2I29A 2XT6A 2AF4C 3U1BA 2WMDA 3OECA 2VPXA 4OH7A 2HTEA 2WJPA 2EP7A 3JWHA 1ACJA 4BKPA 1BLIA 3E3AA 3C7DB 4MSUA 2GN2A 2L69A 1KSJA 3OE5A 5AOBA 1OIVA 5T8KA 3WMFA 4M0EA 5JD3A 5JNRA 4P4UA 5JAPA 1RC1A 3AVOA 2O7NA 1E1RD 2LDBA 2VDQB 4G5SA 4OP3A 4UHKA 3URMA 2ZPTX 3FZQA 3DNMA 1TUBA 2P4SA 5D3KA 3TJMA 1L5GB 3RS0A 4CE6A 4ENVA 2ZGVA 8ABPA 4BGDA 2Y1WA 4YJ2A 5I7HA 5LZ9A 4IJKA 4FZJA 1NP3A 5B5SA 4LXUA 4GZ6A 1M83A 4MQUA 1YRLA 3W06A 1Q1AA 3RFUA 3OZGA 1SXHA 2C7QA 5BWNA 4YY3B 3LWDA 2Q4BA 3PQ3A 3E9YA 3WGIA 4DDKA 2H1HA 3BDIA 3RVBA 4G37A 1MOZA 2P3LA 5B2ZA 1ZHHA 3GT7A 3WL3A 5EFZA 2H3EA 3BUSA 4YRQA 4N3BA 4CKEB 2WEKA 3PGKA 4MR9B 3JD1A 3VU3A 1VLLA 1Z82A 2YXNA 2QIPA 1U0RA 1XWFA 1H0KA 2J3LA 1BROA 2BGIA 4TTTS 2RDMA 2WUWE 4KMRA 3G2KA 1NMYA 4XDYA 1GDDA 3M9XA 3C3DA 4KFTA 4CIVA 2QSUA 2Q1TA 4YRCA 1ZINA 4U6SA 3ZIAA 3PU6A 3WIUA 4BRWA 3JZDA 4DNTB 1V2HE 1GRCA 3LGXA 4LA4A 3O91A 4BBJA 3NH6A 3SOZA 5IHXA 1Q44A 3ZE0B 1GU1A 4E6PA 2C8VA 2QQ5A 4QBGB 3VR3D 1G20E 4RDCA 4XNFA 4EGSA 3O74A 1NQAO 1P1KA 4L7VA 3S2YA 1H4TA 2J9RA 3NT2A 1OT3A 3P71T 1NLUA 2DKOA 2NV0A 2GN6A 5GIPE 5MN4A 1F0KA 1Q91A 2OZLB 4PCUA 5ISMA 3RRXA 2ATXA 1SURA 1RT9A 2C20A 3N2IA 2NU8A 1J70A 1YACA 2W8BB 3VR5D 3WDMA 4BLQA 1YB4A 4BIIA 4HWOA 4PZEA 4CRWB 2YZGA 1V4NA 2XNDA 4JCCA 2WKQA 3ZE9A 4OO3A 4K9MA 1JHVA 4B31A 2ZR0A 2YYSA 3OU6A 1J23A 5DRYA 4NV0A 1G42A 2YC2C 1YKGA 2LXNA 3DDZX 4X6YA 5JDCC 4Q37A 3KQMA 2IX9A 3OU2A 3A1CA 1LF5A 4RTKA 1YRQA 3R40A 5A9TA 3H4TA 3LS2A 4KKSA 4BFXA 3L9WA 4IMIB 4F4IA 1OXSC 2VRBA 3L7LA 3F4BA 3O1HB 1XMQB 4B4UA 4ENUA 2WJ6A 4FHCA 4ZYYA 1H1TA 1P4GA 5EKTA 2HHLA 1IXSB 3NBMA 1M6NA 4HB3A 3T1NA 3UB3A 3W7BA 4BVJA 3D2BA 3A11A 1A8SA 3L7MA 4KGDA 3BXXA 3OHMA 1WY7A 3P2JA 3UN1A 1GZDA 1TAUA 1HLFA 1U3GA 2H7CA 1UT5A 1GGMA 3D4IA 1Z5PA 3B6MA 2Z2KA 1UXOA 3MLBA 4ZV4A 2Y66A 3BGSA 3QW4B 2HXYA 5JNUA 4BCBA 3NCTA 5H80A 4FFWA 1WVMA 4OIMA 1TVCA 2PX3A 3FLAA 2J3HA 2GNPA 3B6IA 2XKBA 5LMCA 1U8YA 5KSWB 2D4HA 4ZMBA 4OQYA 1E2JA 4AS3A 2D0PB 3W3ZB 1X94A 2JF0A 5CIYA 3EGWA 3UQZA 1UOOA 1ATIA 1GZ3A 2EBFX 2BMJA 2NO6A 3C45A 3SD7A 3HABA 4ETIA 2P2CA 3CRMA 2Z3VA 3WNZA 3AERA 1YB2A 3G0IA 5DHSA 5DXAA 5A6SB 3QGMA 1K27A 1JSRA 2P77A 5BW4A 4UUMA 4F11A 1EX6A 2A5DA 3ZY3A 1DDOA 1BKSB 5JCOA 3IKLA 1IJEA 1ZM9A 1GSAA 4ZVPA 4ARAA 2Q4EA 1NVWQ 7REQA 1ND6A 1DP4A 3IC5A 4HN9A 3PHGA 1FDOA 2PX6A 4JP1A 3CR8A 1XEWY 4LMAA 5E4JA 3WOVA 4AJOA 1Q84A 1E3JA 2FFBA 2FQ1A 3C6MA 3UPUA 1FEZA 4PG4A 1ZONA 1KDRA 1RKXA 1SMKA 4MWSA 4KLRA 1OKKD 1VRVA 1Y9ZA 2Q4DA 2ZOSA 1UM8A 4RMJA 3W5IA 2OG1A 2HN9A 2QZZA 1HDCA 1SOUA 3TF5A 1PTJA 2PS1A 3AKDA 4D99A 4O08A 4XEHA 4CM3A 2HXGA 1KMHA 2Z6VA 3OPMA 2H11A 2RH5A 2R1VB 3C74A 1A8QA 2C3UA 1E3EA 3WJ2A 4QUDA 2FLKA 1JRLA 4B3DA 1ACLA 4RHEA 1E2PA 3OIFA 1NUPA 5DLYA 4BWGA 4YJGB 4AU1A 4E4YA 3BSWA 4UM8B 4NRDA 3ABOB 5BSWA 4ZC1A 3COJA 3HWWA 4O29A 4JKOA 2FX2A 3CIFA 3O9MA 3TAHA 1E1QA 1P3DA 1Z6ZA 3ZWQA 2OCDA 4FMBB 4J1TC 4ND8A 2J3DA 4G0ZA 1KK0A 1JFLA 3VZQA 4HB0A 5KOJB 1V37A 3AKCA 4E33A 4AQYB 1I7PA 1CVIA 2NO9A 1EK0A 2K6GA 1R37A 4KXQA 5IT4A 2H1SA 2C0CA 4GYYA 4H6XA 1XTKA 4Z4RA 4NNJA 3IAM6 4I3FA 5PGMA 1EXDA 3GOQA 2PJRA 2IEYA 1L5YA 3AHFA 2O23A 1A27A 1B73A 1GY8A 3AEYA 2YN4A 3AR6A 2P75A 2VCEA 4RK7A 2HA3A 4NI5A 4U0JA 4JUAA 4R5HA 4JUBA 1DRVA 2B2NA 4BMVA 1I3KA 3NYWA 1Z4MA 2JG3A 4MYTA 2P6MA 3QY9A 4YPFA 2H0AA 2NACA 3HXQA 2H51A 4CUZA 3G0DA 4N7JA 3NEYA 4IUDS 3MVEA 4IQ4A 4P4LA 1YF3A 2XGJA 4JC8A 1DIAA 1CZNA 2QM8A 1VL0A 1QQ7A 2PLWA 1WWKA 4WKOA 3T5GA 3L0CA 4ZN6A 2RARA 1JW9B 2H5EA 3FFBA 1GJRA 4UKDA 3WIVA 5FI0B 4TLEA 3WFZA 4QPDA 1UQTA 1BRMA 3DT9A 1CT9A 3Q1KA 4JBGA 1H1DA 1BCSB 2I6QA 2X40A 3B7WA 3NPAA 5EWMB 3RSOA 3ZHZA 5DHPA 2BZGA 3ZWBA 2C2MA 3BFVA 3RJ5A 2PGAA 2A88A 1NJ5A 1WQ3A 3CUVA 4Y2HA 4ZJZA 4G4IA 3IKMB 1NN1A 3JCZA 1XZBA 2DR3A 2ZBDA 3TAXA 5HKLA 3AL3A 3WYGA 4D9IA 1JR3A 2O9JA 1DIHA 4Y30A 2JIPA 1A2KC 2RGBA 2FMXA 4QL3A 4EF5A 3CRZA 2FU5C 3KSZO 1MV8A 4RJKA 2BKEA 2RGRA 2OZLA 2QGNA 5IFKA 1R16A 3CCMB 2O8BA 2QQGA 1CQPA 2OBLA 2I0FA 2QEXB 1P4HA 1HE1C 3PQCA 4I55B 4ZHQF 2JIQA 5JJ5A 1IBKB 2P3QA 4U2FA 3U4HA 4TUYA 4GOLD 4RHYA 3GT4A 2PZGA 1T4DA 4O0LA 3PQ8A 5HJEA 3ZYCA 2QD4A 5DM1A 1PP4A 3G2NA 2GN8A 1L7QA 2PD6A 2GEJA 5HCIA 1QO9A 1YRBA 6CHYA 1TTQB 5KCZA 2HRZA 1VCMA 3ND6A 4DEVA 1W4LA 4OXRA 4XM2A 5B3AA 4LFCB 5J4LA 1TCUA 1PWXA 3JVUA 3TQIA 3IJPA 4CCWA 1NVFA 3HY3A 1AB5A 3K0CC 1PL8A 1E1KA 1WD5A 3SYNA 4CEIA 1G18A 1M2VA 1R8YA 4OK6A 5LDGA 4C6RA 4RTMA 3R6JA 1I24A 1Q81D 1SWVA 1WOOA 1RM3A 2YCBA 3GSIA 2YMQA 4PGGA 1O94D 1LW6E 1PK8A 4J3JA 1WUIS 2RI0A 5HKKA 4J0CA 2Z6UA 3QYAA 5DKFA 4DGQA 4NYJQ 2IYEA 5T5QA 4B74A 2C5GA 5IYZB 1CTQA 3M1AA 4WCDA 5TE9A 4WFIA 2XGOA 4HAWA 4D8VA 1QQ6A 4TRJA 4AY6A 2FN9A 4BP1A 2ZUUA 2J6IA 1D1NA 2FZLA 2O2IA 4GLOA 1CNEA 1V96A 3QX7A 3N3BC 5ILOA 4KC0A 2BRUC 1FNCA 2JBHA 2VT6A 4FFLA 2UYHA 4M36A 1QX4A 2EFYA 3VH2A 4X7CA 4JJ4A 3VR6D 4LEIA 2IELA 4M9RA 4PGOA 1S89A 1IULA 4LOAA 5IC6A 1VQ7B 1JDZA 3QVLA 1PQWA 3H6HA 5PNTA 1C80A 3K05A 4G8BA 5A62A 4QM7A 1JR3E 2BGRA 3E15A 1D0SA 3JYOA 3W9SA 3PNKA 3MMPA 1QGUB 4UM9B 5I8PA 3JZAA 4K7JA 2DSTA 4B2PA 3ADCA 2EJWA 3R0JA 3MLAA 1KFEB 4NU5A 2NXEA 2QY9A 2R96A 3BL8A 3VMFA 3PCRB 5FHRA 4D4MA 2MOKA 1BHJA 2B78A 1ZW1A 1WZUA 5A5EA 1ZUWA 1CR0A 3L6OO 2H0RA 1GKKA 3ZHVA 1T9KA 5HTOA 4D80A 5DH9A 4IX9A 3EXEA 5JSKA 4DA8A 1RDFA 3JRXA 5EJAA 5HF9A 3JVEA 3N2NA 5E3IA 2GFQA 3AESA 1PVVA 3IDZA 4OM7A 4DGSA 3U3OA 3LCMA 4DLKA 1B3BA 2QD5A 5CDUA 2PR7A 4W9NA 4NAUA 1ZH6A 2HBYA 3PNMA 2FE1A 1ZO8A 4ZGWA 2ORED 3KP1A 2WJJA 4YP5A 1R7RA 1UJ6A 5AH0A 1EI9A 2W6JD 4Q1FA 1DMSA 3G0BA 3OPVA 3MOIA 5HSGA 1GAJA 3DVAA 3MELA 2VWHA 3HWSA 2QD2A 1FFCA 1V25A 5IU6A 1XL0A 3ZOKA 4ALLA 4TQUS 2VSNA 1MDBA 1MZPA