4B4DA

Crystal structure of fad-containing ferredoxin-nadp reductase from xanthomonas axonopodis pv. citri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
256
structure length
256
Chain Sequence
b'AFGAETVLEVRHWTDAYFSFTTTRDAGFRFENGQFVMIGLETETRPLLRAYSIASANWEEHLEFFSIKVPDGPLTSRLQHIQPGDKVLVGKKPTGTLLISDLHPGRNLYLLGTGTGLAPWLSIIKDPETYERFDKVILTQGVRFVQDLAYRDYFERELPQHEFLGDLLREKLLYYPAVTRETFANQGRLTELMADGRMQQTLGLPTLDPANDRFMICGSPQMLADLRSLLDSRGFQTSPRIGTPGHYVFERAFVEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystal Structure of Fad-Containing Ferredoxin- Nadp Reductase from Xanthomonas Axonopodis Pv. Citri
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri str. 306
molecule tags Oxidoreductase
total genus 81
structure length 256
sequence length 256
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4b4dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4b4dA02
4LC0A 1H85A 2B5OA 4ZCLA 3VO1A 3VNVA 3ZBUA 3V76A 1VQ9B 1EWYA 3QFSA 3W2HA 3AVXA 1YJWB 2VNJA 3G71B 2YWFA 1ELOA 4Q7JB 4BPRA 5HXBA 1S72B 2BSAA 2QMUA 4ZV4A 2B7BA 3LYUA 3CCUB 5TY0A 2DETA 2VZLA 1F20A 2YWGA 2QTLA 2QTZA 2XEXA 1W34A 2GQFA 3CB4A 4YAOA 1ZM4A 3CXCB 3W2EA 3P27A 1R5BA 1S0UA 4RD2A 1QX4A 5H5JA 3AVYA 2FX3A 1H42A 1QUFA 4N3NA 4R71A 1AMOA 2VNIA 3JQRA 2ZITA 1JJ2B 3E20A 3AGPA 1TLLA 3AVUA 2B7CA 5THXA 4PC7A 1EFTA 3WYAA 1GAQA 2E1RA 1J9ZA 3CC7B 1WDTA 3MMPA 2QDXA 3JQPA 1YHQB 2BM1A 2HMAA 4RCZA 4B48A 1QVFB 3CCLB 1VQLB 4B47A 1VQ8B 4DQKA 1EP1B 2DERA 4RD0A 3P26A 2BMWA 3CCQB 1FDRA 4ZCIA 3CMAB 2XNCA 1DG1G 1OGJA 1FRNA 1G7RA 3I55B 4B4DA 4LBZA 1VQMB 1M90D 1FNDA 3CC2B 2HCJB 4LBYA 3AVTA 3W2FA 4MYTA 2YWEA 4ZGQB 1VQ4B 3FPKA 5GV8A 1QFYA 2C78A 2VNHA 3U6KA 2R6HA 1YIJB 3A1FA 4FWTA 1E62A 1OB2A 4MYUA 1FNCA 1YJ9B 3LVBA 1EFUA 2YWHA 1Q82D 1E63A 3ZZUA 3CC4B 3VO2A 1D8TA 3PENA 2GPJA 4NCNA 1EP3B 3WY9A 1G7CA 3CCVB 1SKQA 4K1XA 3CCJB 4P3YA 1EXMA 1YITB 1ZM2A 3WNBA 3ZBTA 1KK3A 2J7KA 1QGZA 1NDHA 3MHPA 4LBVA 3SJZA 2BN4A 1Q81D 2X3UA 4PC3A 3CCRB 2BGIA 3I1FA 4RD6A 1VQPB 1CQXA 1NJID 3CD6B 1QGAA 4N3GA 3W5VA 1VQ5B 4RJLA 1BJKA 1GO2A 1K8AD 3OZUA 4TMZA 3WXMA 4UAJA 1AIPA 4M0LA 2VYQA 3ZZ0A 4TMVA 2DY1A 1Q7YD 2BGJA 4YHBA 5JBQA 3MCAA 4YAWA 5TR9A 3W5UA 2OTJB 3WNCA 4YALA 2OTLB 4TMTA 3WNDA 3AVWA 3U2QA 4B3XA 1IJEA 4ACBA 3B82A 4ZGNB 4G1VA 2D74A 4QHYA 1QFJA 1GAWA 1ZM3A 3I56B 3B78A 1B2RA 1M1KD 4M2LA 2QEXB 1U2RA 1TVCA 4M1KA 4AF6A 2C77A 1GR1A 3G6EB 1FRQA 1XB2A 4TN1A 3VNUA 3OZVA 1QGYA 1ZM9A 1JB9A 2RC5A 5H59A 4EH1A 1TTTA 4WQMA 3WBJA 4TMXA 5EMNA 3VMFA 3OJXA 1BQEA 2VNKA 4PC1A 3CCEB 1BX0A 1QFZA 5KSWB 1N0UA 3LO8A 1OGIA 1W87A 4F7DA 2CRVA 1VQOB 3LRXA 1G7TA 4QFMA 1VQ6B 4Y9UA 3JQQA 1W35A 1E64A 1KJZA 1N0VC 2XNJA 3J81k 2QA4B 3E1YE 4G5GA 3CW2A 2DCUA 1D1NA 4RD3A 1JA1A 5DSZA 1DDGA 1KC8D 3QFCA 3OW2B 1UMKA 4FN5A 2HDNB 1G7SA 2RC6A 3FJOA 3CMEB 1GVHA 2PMDA 2PLFA 4B44A 2BVNA 4P6VF 2QN6A 4B43A 3G4SB 5GV7A 1I7PA 1KK2A 3W2GA 1B23P 1EFCA 4HE6A 1D2EA 2BF4A 3U6BA 4Y9RA 1R5NA 2OK7A 3CCSB 1KQSB 1VQKB 1IB0A 1HA3A 3QFTA 3CPWB 1R5OA 1BX1A 2BPOA 1QH0A 1CNEA 4PGOA 1F60A 5AN9A 4HE5A 2EIXA 1QVGB 1KD1D 3W5HA 1Q86D 4ACAA 1VQNB 1OB5A 1QUEA 3OJWA 2EFGA 1SM4A 3OZWA 4LBWA 4M4SA 5FA6A 1ZUNB 4AF7A 3QFRA 1KRHA 1XE1A 1FNBA 3CCMB 1KK1A 4FK8A 4C0SA 4Y7CA 2OK8A 4NBSA 1N8RD 3ZZTA 1DARA 1K9MD 2BM0A 1YI2B 2BV3A 1FNMA 1CNFA 4YAUA 4RCYA 1K73D 1W2BB 1EP2B 5TV2A 1VQ7B 3ES9A 4RD4A 4IW3B 4AC9A 3CRZA 2CNDA 1JA0A 1KK0A 3W2IA 1DDIA 4C43A 1QG0A 4J0QA 1KTVA 1JNYA 2AHOA 3B8HA 3AGQA 4YAFA 4U9UA 2NPFA 1IJFA 4G1BA 4PC2A 2DEUA 3QSYA 1YJNB 4TMWA 2PIAA 3ZC3A 3QE2A 3WBKA 4PC6A 4ZCMA 3AVVA 4RD1A 4H9GA 1GJRA 4M53A 1A8PA 4DQLA 1TUIA
chains in the Genus database with same CATH superfamily
4M98A 4YRRA 1YRLA 2A5JA 2ZRIA 4G01B 2FSVA 4C2AA 5I9LA 4F92B 5DP1A 4BB0A 4BMSA 2GREA 1GLNA 5CR9A 4PO3X 3SR4A 3M70A 1QIKA 1W9XA 4X20A 3O1IC 5CJPA 1K68A 1OTXA 4XLFA 1QK5A 2PNFA 2Q7XA 2ZPTX 3UMJA 3ZS8A 2NU7B 3ERCA 3Q1LA 5IC5A 2AD5A 1EWYA 1EKXA 1JDTA 3GJRA 3H3JA 4YAGA 4RK5A 1O6GA 2DGDA 2GEUA 1FP7A 3HA7A 5JVDA 4WLNA 1CERA 4FFLA 4P82A 4PR3A 3RBVA 4GI1A 4E5KA 1JL3A 1AZSC 1E7MA 1B8NA 1N6KA 3R7SA 3RHSA 2M6LA 2FWPA 4LJSA 2PKYX 1XZCA 1J2EA 1PD0A 2E6UX 2PRYA 4DNRB 1H6DA 3B70A 4RVCA 1J2UA 2CUZA 3HTXA 3MILA 1SAYA 1JEJA 4RUKA 4B8YA 2VXCA 2ODAA 5AXDA 1ST2A 2CBXA 2VTDA 2H1VA 4HB2A 1Q0ZA 1TZMA 4DLAA 4A4DA 3LDHA 1HQCA 2ZROA 4OL0A 2QKYA 3SMQA 1K0UA 3KQWA 1K6MA 5LMUB 2QPOA 3PWSA 3S8EA 1ZEMA 1XOIA 2I2XB 4RWEA 2Y66A 2JFFA 4JI7B 1ZGCA 4Y2PA 1JKFA 1RU3A 3KSRA 1UT5A 3NAQA 4AIRA 5IYZA 3AG6A 4CM4A 2D3NA 2P2LA 3EAFA 4B4UA 3G2PA 4J1TA 2VYNA 2C7PA 3EEQA 2BZ0A 3FNGA 4KQWA 3ZVMA 2ZBPA 4INOA 4WZBB 5LMZA 1V1MB 1DAMA 5BR1A 1COWA 3O9ZA 4LRXA 3DFUA 3FZYA 3CIFA 5TT0A 4EMTA 1R88A 2DC1A 3H1BA 3UIEA 3KWJA 1KZ7B 4FB4A 1G5RA 1WPCA 2CXXA 3BJMA 3ZU2A 1BDIA 4AN4A 2V9ZA 1DLIA 1U5CA 2J5BA 5AIAA 4BB5A 2A4KA 4DADA 3LXMA 1JQ3A 4YMIA 1NM5C 2WLTA 3KLNA 3R7DA 4AZ3A 2D4AA 1GLVA 1K66A 1MDFA 4BFYA 2UU9B 1EGMB 1JPVA 2JAQA 2D1SA 3EISA 2BZSA 2HXGA 5JJBA 5LD2C 1KA9H 4K81B 3VH3A 5DTQA 1P5HA 3QYFA 1J9ZA 1AUPA 1MXHA 1TM5E 2BEWA 3LHIA 3ICCA 1W88B 4OQFA 3VR3A 3BGIA 5B58C 3Q5GA 5JATA 1NVAA 3RQSA 4XASA 1QVZA 5F2NA 2Y2VA 2HX1A 3K1ZA 3GGGA 4RDLA 1ECGA 4JT9A 4QASA 2YWBA 2NUPA 4YDQA 3JD2A 4ZGWA 1H93A 4W6QA 4YCBA 1QVFB 4KMMA 4M0DA 4Z4VA 1VLLA 2CDAA 3E0XA 5CK4A 1XZLA 1HVXA 1CZLA 1PHPA 2CXPA 2HJRA 3IDZA 1QWSA 4GP7A 2YJ6A 4R2LA 3UAXA 3NASA 1E2DA 4U4AA 4IV0A 4OXQA 4RENA 5HXAA 1I1QB 3AG5A 3WMFA 1GL6A 1LI5A 2WT9A 3FSJX 4E2WA 3L9WA 1L5VA 1O95C 1ZOSA 2VPTA 3GDGA 3PFGA 3HI4A 1ACLA 3GEPA 4LOHA 4TVKA 1PVOA 3H5VA 3IUPA 3SZUA 5J5VA 5IKXA 2UUCB 2B3TA 2Z56A 3JYQA 3C8UA 5G0SA 3KT3A 2C9DA 2I8CA 3N87A 3OQ1A 3L8YA 4QT0A 1T9GS 1XU4A 1Z9BA 4LHVA 5EXSA 4DMFA 5H3CA 4A3SA 2R9VA 1A2KC 4QUKA 3P96A 2CJWA 1WR8A 4NBVA 1V8DA 4QODA 3D2LA 3G6KA 1EDOA 2Z9BA 1FP2A 4TLAA 5GM2A 1VFPA 4PPYA 1VQ4B 4XKJA 4BTVA 3N8DA 3K3PA 2H59A 4D3YA 3F49S 3L9XA 3I9V1 1F0NA 2KE5A 4MA5A 5HFJA 1S3IA 4F3TA 1TK9A 4RHYA 3LP8A 3U26A 1N06A 2C8JA 1GEEA 1E94E 5EPEA 3A6HA 3V8BA 2OXIA 1E1MA 4D46A 5J3JA 2YHIB 3FA2A 1RHQA 5LIPA 1JGTA 2V31A 1ZGAA 1N9GB 2IZOA 2QN1A 3IIJA 3I1IA 3LX4A 5EHQA 1UC9A 2JK0A 4XZ3A 3VVLA 3SP1A 4QPCA 3CC4B 2OZKA 2FPPB 3BREA 4RULA 1EFKA 3CH4B 1LNSA 2D0OB 2D6FA 2MIIA 3WL4A 1C3OB 2NUBA 4MI9A 4Y2RA 1FCJA 3WY9A 5EJ8A 4E2FA 1DQSA 3KZXA 4IJVA 1JMYA 4FFBB 1Q1AA 3PNBA 4NU8X 4IHJA 2HA5A 4ZKEA 1MVLA 1EXMA 3BICA 1W7AA 4HDKA 3ETDA 3LDGA 3WNBA 1F5SA 2ACVA 2BFDA 2UYQA 2YJ5A 2RG1A 5HMLA 5CCXA 2CL7X 2WE7A 4M9XA 3TW8A 5FLXA 3ADOA 4LJRA 3RBAA 1NMQA 4NQRA 4PYKA 1GCOA 2W2NA 3GRRA 3ZDRA 4B3BA 2F3QA 1BU8A 3WZMA 4RLZA 3SIXA 2MSKA 5AW2A 1SBTA 2I4RA 2JJ8A 4DB2A 3L4SO 2CLSA 3SS8A 5JBIA 4LBVA 1CY2A 1SVIA 1LTKA 3A9SA 4Y30A 1E9DA 2J07A 4B84A 1EVIA 3EG5A 4M8NE 1FNSA 4D3FA 1O96B 1WHSA 3W5JA 4QU9A 5FWXB 2LCFA 3VKVA 4DC1A 3N70A 3WGVA 1NR5A 1NVGA 2GJ4A 5DHQA 4NCBA 1A5AB 5C35A 3BF8A 4B74A 1IVYA 4R0NA 1NF3A 3KSMA 4BVGA 1FE8A 3AUYA 2QD5A 3TQIA 5DXAA 4UUPA 3H2JA 3VPXA 4IR7A 3VU9A 4URHA 5ITVA 4DCUA 4S35A 1C4OA 1I9CA 3AMVA 1AB5A 2WIJA 4J0FA 3NOVA 4KUEA 4DCPA 4M37A 3ACBA 4J94A 2Z8YA 5CNKA 2OOSA 4TL9A 4DJ5X 4CF4A 4ZI7B 1VHLA 1H0KA 3QVOA 3GJ0A 3O4GA 1JVBA 4P93A 2PZEA 3FPSA 2VH1A 4ITUA 1VPVA 2JJ1A 4RKQA 1BN6A 2ZXHA 4HLNA 2VCHA 3PYLA 3ZBPA 3GRCA 2WKWA 2JJMA 4R1NA 4NCIA 3ZQ6A 2ZSBA 5KNDA 2C8KA 4DLWA 4ZOCA 1S02A 1JAZA 1FX0B 2V6FA 3DDOA 3E5RA 3EXEA 1CUEA 1Q7EA 4GRAA 4R9UC 1MJ5A 1VKOA 1VXRA 3FCXA 3KBOA 4KNWA 3SICE 2AEJA 2PSHA 1TF7A 3EXG1 3U3MA 3UB3A 5CA1A 1P4HA 4YRNA 3BQMB 4MGHA 1LTHR 2JGJA 4LG1A 1HQDA 5KOHA 1FQKA 4GC9A 1MEEA 1RAHA 2OCDA 4NAUA 2HNBA 5ICGA 5IYRA 4BC1A 3C74A 4MINA 2ZE6A 1BOFA 1M66A 2O2SA 5JG7A 5BY2A 2PWPA 1WXXA 2WE8A 1L1QA 3OJFA 1T1EA 1RKBA 4GYJA 3AVWA 1GZDA 3QKSB 5FOUA 3WQRA 3AP2A 5ERGB 1K7SN 2PMEA 4ZTZB 2PA3A 3JRNA 1DOHA 1R6XA 4LGVA 3OPNA 4OHXA 3VZBA 4EJ2A 1NVVR 1Y42X 2PZFA 2R00C 3C3CA 1LB1B 4NX2A 3RKSA 5KPJA 2GJAA 5AHXA 2PUTA 4MGYR 4ZOLA 2QEXB 1QZTA 4Q1VA 5DB4A 4N12A 3VC1A 2DRIA 1D0VA 2Q5FA 1H5NA 3RROA 3TLJA 1JXQA 4BQRA 3ADBA 1T2VA 1YVDA 1I2ZA 3THYA 3UJ7A 1VMIA 1I1OA 5TEVA 1XZHA 3G0CA 3HN2A 2CD9A 1G8SA 2Y05A 3RFUA 2ALJA 1ECBA 2BKAA 1Q20A 1Y0BA 3BK7A 3DCJA 3EZLA 4YJ2F 3RRBA 5IF9A 1SB8A 2QLJA 1AY0A 3RYCA 5C1OA 4JGGA 4L0MA 4N9QA 3HHPA 3TLMA 1FMFA 1O9GA 5JE8A 3R40A 2Z2IA 4AJIA 3CIOA 2ODNA 3I28A 1GU7A 3Q15C 4DBZA 3AUXA 4LQ4A 4M76B 5DCYA 3UJNA 1BROA 3HEAA 1NVKA 1YS2X 3GVJA 4RTRA 3FF1A 4Z2YA 2PPVA 4WNAB 4JB0A 1EK0A 1EM8A 2XWJI 4M22A 2W8ZA 5D7BA 1JEDA 1KERA 2YFQA 3EG9A 3QW2A 3VGJA 3JALA 4E08A 1VBKA 1ZNXA 3ILXA 1CHNA 4YRDA 4NKRA 3ITNA 4KQMA 3MT7A 2BTOA 2NYVA 3N5CA 4NYMQ 3HB9A 1VG0B 4TKVB 4KWCA 3CZ5A 4XFJA 4DDVA 3I9KA 2F4VB 1E18A 4BLRA 2QP4A 3DDUA 4XLAA 2J09A 4MVYA 1NBEA 5IZCA 4D25A 2Q4DA 2PDAA 3KQMA 3MVEA 3PK0A 4FMCB 2W48A 3NW9A 2F1LA 1Z2OX 2Q8NA 4UCFA 2HA7A 4E4YA 5LDHA 2FQQA 4B4KA 4I1UA 2BSQA 1OPXA 3K1AA 3GMSA 4Q16A 3QPVA 2QW0X 3C4VA 4MEJA 3T52A 2BHTA 3FPPA 2F48A 1V45E 1SQFA 1U8EA 2D3WA 1F0PA 3NYQA 1U2DA 3BEOA 3OSZA 4IIBA 3CNLA 4GKBA 4KQKA 4EDHA 3LWNA 3J81k 5LQDA 2YIJA 3BG5A 4I8DA 5T8KA 3I04A 5A6SB 3P9YA 4ZQCB 1UFRA 4J16C 4JQZA 4G7WA 1QZXA 4MQEA 3X1ZA 4DNTB 4I2NA 1KJQA 1QE5A 1TU4A 5C8DA 3ZJYA 2WTNA 2EZ8A 3CBGA 1GT6A 1X7YA 5EFOA 2X77A 5FWAA 3CTMA 1E6LA 4CVNA 3I9V6 5JW6A 5MFPA 5K8VA 4U0KA 5JD6A 2VTBA 1BE0A 5LPNA 5H9WA 4NE2A 1EX9A 5EP3A 5I4IA 1GVHA 1YXMA 2PMDA 4IJUA 3WRVA 2V3VA 2Y67A 4AYTA 1FQWA 5EJ4A 2HLDA 5GV7A 5EGNA 4PW0A 1ID8A 1YTUA 1YZLA 3ONYA 3WQSB 4PTZA 1NQUA 2WVHA 1WKVA 1T5TA 3NV7A 3WGLA 1GWNA 3AY3A 1C3EA 3PQ4A 1U2ZA 3RS0A 3SEFA 4C7BA 4F71A 1XQBA 4WDQA 1Q92A 2ECFA 1GA1A 1K28D 1MEJA 2NVBA 3ESAA 4NZ9A 4LDAA 1FYFA 4IIDA 5AJYA 2HNKA 1K7EB 2V7EA 2J33A 5CIQA 3SQNA 1CEEA 4DCVA 1XQXA 1K2VN 2D1RA 3FGZA 4TKMA 1Y48E 1GR0A 1K8RA 1JG7A 4R81A 4MICA 1X8XA 3ZE8A 3VTFA 3DJYA 1J97A 1MOZA 1U9IC 2O0HA 3O7MA 4R2KA 1IWOA 3SPXA 1EH5A 4EKEA 3RKUA 4YCJA 3ZZNA 1RKQA 4Y9SA 4TXLA 5SZJA 2IBSA 3RG8A 1Q86D 3LOUA 4RGYA 1CUSA 1FJHA 5DOVA 3QP9A 3K6SA 5K51A 3V3TA 5JSZA 4TT3A 2JLRA 1BG6A 4M83A 2GYUA 2IWRA 1TFUA 1O95D 2J48A 3E7WA 5FA6A 4KFCA 3IMGA 1U2QA 1VSBA 1YDMA 2J9YB 3QLEA 4R0MA 3EXG2 4ZKDA 3C7DB 1UJNA 1Y8QB 3MCVA 1TMOA 4C7OA 3KUCA 2JIZA 3ZNNA 3ORRA 1ZK2A 1UKBA 2VFAA 2OPHA 3AERA 3PUNA 2QNRA 2YNMA 1UBMS 4WASA 2ID4A 2W5UA 4ESHA 1O77A 1RI5A 3K9WA 4O2RA 5IYWA 2RH5A 2V0CA 2X41A 4W1QA 1PI3A 3I3OA 2C9MA 3BC9A 5DU2A 5ADWA 1ZR4A 2QTVA 4GF5A 1RZRD 4Q5IA 4YHHB 1A5ZA 1JJ7A 2M1ZA 2BJHA 3OJOA 1YI2B 4TTIA 4B83A 1IZ7A 1OYYA 2XB4A 2ATEA 3L5KA 4JOQA 4AKEA 4YAUA 1TD1A 3D4BA 2JI9A 2PCJA 3QUCA 3QELB 2HREA 1WUHS 3W3ZB 3ZYCA 3LF2A 3WC4A 3LNCA 5TV2A 2YJ4A 1WSRA 1W5AA 4KN8A 4R8LA 4X3PA 3T38A 5J4HA 3O4FA 4FOPA 4IG4A 4DQ0A 3QMMA 1NUTA 2JCSA 3ZHUA 1G18A 3F96A 1GT91 4QV2A 3VOSA 2Q62A 2V7VA 1Q1BA 1PIWA 2ABWA 3A26A 1SUWA 3HLYA 3IKJA 3L7LA 4AG3A 4ZZ2A 3N6RA 5M04A 3E1GA 2C5FA 4BNFA 2RAFA 5BWOA 1JLLB 2NV6A 4CKEB 1ZR2A 5AP9A 3VPGA 1JJFA 1QH8A 2BIFA 4RTPA 4C6TA 3AV0B 4LJKA 1I01A 1M6EX 4MLZA 3OTWA 2IX9A 3ABZA 3L8CA 2NLOA 1NKSA 4BKUA 3GJ7A 1DB3A 4TSFA 2RGYA 3QNUA 3J81A 1IWBB 1Y6QA 3KO8A 4U9UA 1ZI8A 3BMNA 3IOCA 2ZJYA 5H8WA 3C6YA 2NOAA 1MB4A 2ZJ5A 4OJNA 1FU8A 2OFPA 5JCOA 3S68A 4DVGA 3NG1A 3SXPA 3EF0A 4U6NA 1GRVA 4XR9A 1YL5A 2VTEA 1E6CA 4K88A 1HLPA 1U99A 1IM2A 4TYPA 1AZWA 2HLPA 3C7KA 3LRPA 4OL9A 5CVCA 3R76A 3IIMA 4PAMA 3ZC3A 1JDBC 3DB1A 2FMIA 3I9LA 3P4YA 4X1IA 2VSNA 4XIIA 4US0R 5BWNA 3Q7EA 4P6YA 3T7EA 2UV8A 2BJWA 2H6EA 5CTJA 3L0YA 3ZG6A 3BB4A 2VJNA 4LPKA 4COOA 2BGGA 1A4IA 1QP8A 1JIIA 1M2OB 1WG8A 2CFTA 1K7XB 4JQOA 4ER0A 1N78A 3L8HA 2WD7A 3KL2A 5GJCA 3B6IA 3WB9A 1DNPA 3T7KA 2LBPA 2BSXA 1NBHA 3D5QA 1DC8A 1YTLA 3OM0A 3GXBA 4CMJA 3A6GA 4ZHQA 4OHCA 4KQ6A 1YZUA 2VBIA 3A8TA 4GLFA 4S12A 2FUKA 5DM2A 2QZSA 1R9GA 4C2BA 4JXZA 3B38A 3VSEA 3IQHX 2ONZA 4B40A 2C00A 2GN2A 4Y6QA 2R7AA 1IDN1 3K30A 1C1XA 3BQ9A 3S70A 1XU9A 3PSHA 2B8JA 4H15A 3T35A 1APBA 4KMSA 3KE8A 2VHTA 2WHQA 3I23A 4R1PA 2Z98A 3UK0A 4IL5A 3PR1A 4OXRA 3R9WA 1J2JA 3LTNC 2O2ZA 3OM8A 4BPRA 4URZR 5JUWA 1EEHA 1M74A 4K86A 3FPAA 2BGLA 3VBCA 2JGAA 1EQAA 3GEEA 4MKRA 3CU5A 4S2UA 1OI4A 3LTEA 2RAUA 3O8DA 3ETGA 3KPYA 4RPBA 1NJ8A 2IPAB 4KR0A 4BO5A 3OUTA 1EWQA 4NZZA 3CCUB 1HLDA 3HCRA 3WFJA 5AW3A 1F8GA 1FRFS 2D13A 2J4DA 2I62A 4PG4A 3AIKA 3IEVA 5DBEX 3SOZA 3D4PA 3ICQB 4B2PA 1T2EA 1SXIA 3FW1A 4GLBA 3DBVO 1VKRA 5J59A 1RXIA 3RSFA 3HNRA 3PXUA 5ALOA 3K09A 1SVNA 3JQDA 1OKKD 5AOBA 4EB0A 2XEXA 2FRDA 3SCZA 1YHYA 2R8BA 3GBSA 3R6TA 1T36B 5ERYA 3I30X 3ED1A 4MJ7A 5H81A 3GJQA 4G09A 5IDYA 4B45A 2XVXA 2VT6A 4FGZA 3R6KA 4RDJA 1XLTA 1OILA 3COPA 5HW0A 3EA4A 4J2OA 4M0MA 1QOPB 5LXTF 1N2JA 1WMFA 4IDHA 1QMGA 3DE5X 3GMDA 3ICOA 3O1LA 4F06A 2BTEA 1RI3A 5IAJA 1I6WA 3LUGA 4WKPA 4C7KA 2IE8A 2FWIA 2XPCA 4IVNA 3M1LA 4RYLA 2FPLA 4RVDA 2ZAOA 2BGUA 2QSUA 4KAXA 2MINA 3DAOA 4GDFA 2OE2A 4ILEA 5G02A 3JQRA 4Y8VA 2JFXA 1JJ2B 1E92A 2FVGA 3KEGA 3KTFA 1NDQA 3OFJA 4LQCA 5AK0A 4MUJA 1XHFA 5FFNA 5H70A 3SHFA 3EEOA 2PUEA 2HMVA 2QM8A 1V8OA 2XTNA 3PA2A 2P3QA 4MKGA 5GWXA 4KXUA 3S1AA 1RWVA 1FQOA 3ESQA 2MSWA 3VYTB 1WXQA 4QA9A 5FB3A 2JH3A 5BMVB 3A9UA 1XZAA 3CRRA 3A3YA 3R4VA 1AF4A 1YIOA 4IH1A 2RKWA 5DBGA 5I4BA 1TUBA 2RCYA 1RQ7A 4UBLA 5FWYB 4JHLA 4H4DA 3GHHA 2SKEA 3NBXX 4YIHA 2C03A 1MH9A 4R3WA 1LNZA 2G0TA 1GTMA 2ZYWX 3A8KA 4F93B 3DXFA 3D54D 1VCNA 2XKKA 3AHCA 3J80A 1J2TA 4UUAA 2IU4A 1ZQ1A 5LP6A 3UWPA 1P31A 3QX7A 4B6GA 4MW1A 4AM8A 5IHPA 5HUQA 3IMFA 3SSOA 4EEZA 4JLVA 1Z6AA 1V5IA 2HSWA 3RVQA 1AUXA 3ZWDA 2GVDC 4X20B 3ZDZB 2ZRJA 2FZKA 3UJ6A 4TVBA 5CLFA 3IQIX 3Q5EA 4TN5A 4DQKA 4TLEA 4AJHA 4BIIA 5A5VA 1KSHA 1LBSA 2H9YA 3GZJA 4X8IA 4EF6A 4PEVA 3RVPA 1L4LA 1T2AA 5KHLB 3OZRA 1AQLA 1GZ4A 3RJTA 1S2MA 2ZB3A 2ZYGA 3B20A 5JVDB 1RYYA 2DXIA 1XAGA 4D8YA 1OC2A 3NH9A 4HQ0A 2J3DA 2ZXEA 4BLOA 3CINA 2C5EA 2XOEA 2WWGA 4KHPB 3FCCA 1RQPA 4DQUA 2R1ZA 1GGEA 3G2NA 2P9QA 2IEYA 3DOEA 3CC2B 3JR3A 5JS7A 3IILA 4C89A 4W9RA 1JEYA 5E4JA 3OZGA 5TVGA 1CXZA 2WUVA 1IXYA 3KDPA 4CIAA 3I01M 5GV8A 5F4JA 1EA7A 2XV1A 3QPUA 3I5XA 3IULA 2O3SA 2H4JA 3AR8A 1RYNA 2YDXA 1Q44A 3V7UA 3U6KA 1RI4A 2W2LD 4U2DA 1N1GA 4BVHA 1H3EA 4FWTA 6Q21A 5E4FA 5CFMA 4IIJA 4GMXA 5IYZB 3TLZA 2V9PA 4ZYYA 1TQ8A 2WZDA 5GOZA 4LRWA 2BELA 4L78A 4CM4B 5J43A 4TL8A 1MIOB 4F85A 4RVHA 3FOBA 4XOIA 5H3LA 3D7KA 3G5LA 5K45A 3VYVA 3P2KA 5CPBA 2OPBA 1YULA 5G0TA 3EZYA 1H5QA 1KZGB 2WILA 3KR1A 3X3HA 1S4QA 4KIFA 4DUYB 4OHFA 2C5GA 1PKXA 1ZUWA 3PT9A 2AS0A 4BU0A 1X0VA 1CBUA 1PT5A 1ZGJA 4OMDA 1D2MA 4E4RA 2H08A 2Y1OA 4PGAA 2G5CA 4AZ3B 3HSYA 4CKCA 2VQEB 4JSTA 3ADDA 1W5FA 2L42A 2WUGA 2O7RA 3DE7X 3FIJA 1IH8A 5IT0A 3S3TA 2NU8A 5IAAA 1GXSA 5LQSA 4EKYA 5AVOA 4RFVA 3S29A 5D86A 4CGZA 3L05A 3NDIA 3AZQA 2BEWB 4E14A 1M8KA 3QJGA 4IXWA 5B3LA 3THWA 3AR4A 1TZ2A 2WNSA 4UUNA 4FI3F 1RP1A 3I58A 1Z0IA 1B1AA 1U0EA 2QVLA 3STHA 4TGLA 3AI3A 2VIIA 2GCGA 2VZ0A 4YPFA 1I8DA 5J2TA 1E2NA 2NUPB 5E9QA 2Q7DA 1CUGA 1S7GA 4HNRA 3T3IA 4DWJA 2K87A 3ER6A 2GBLC 1JB1A 5COBA 3LGAA 5DNAA 4DV2B 4L8VA 4JY7A 1HLGA 3SE7A 2XGMA 3U4GA 2CNBA 2QQ5A 2R6GA 4AKIA 1QGAA 2H29A 4GSYA 1FSSA 2IYRA 5KKNB 3AHIA 4BBZA 2Z3WA 2O06A 5F77A 2X7HA 3DE4X 4HAVA 1DT3A 3FKSD 3MFYA 4OATA 4DYDA 1UPBA 3FB1A 4V24A 1UWCA 3FVTA 4O6VA 1N8SA 3ZY6A 3DE1X 2IP1A 4ARSA 4RA9A 1EAYA 1JS1X 3PD7A 1ZC4A 4LOJA 9MHTA 2ET6A 3P52A 2GD0A 2I65A 1KOFA 2ZWMA 4D3SA 2WAOA 1YRBA 4ZYLA 1X86B 4CCYA 4BQFA 1NVXQ 2XLCA 4I4TB 1X77A 3PA1A 1GRCA 3LU1A 4FGSA 2CJWB 4EEKA 2IDJA 1Y98A 4KITB 3HS3A 2OC4A 2H5EA 5I7UA 3MS4A 1U28A 3PYXA 4UE3S 1SCKA 1GKIA 4F56A 3DAFA 5BRAA 1M2HA 4P12A 2OB2A 3INYA 1XQWA 2B0JA 3QZUA 3IELA 3PHHA 4YIKA 3VR0A 4TMTA 3MGKA 3ZKWA 2D1FA 3WNDA 3JVVA 4LYAA 1XEWX 4HX5A 5HM8A 3MD9A 1IJEA 4CF5A 3IFSA 1MW8X 1VCIA 2QXYA 3IVAA 3TQRA 1RLMA 2K5UA 1WXWA 1HNWB 5J35A 1W44A 2TYSB 4G1VA 2QUIA 4R8SA 3UV6A 1FS4A 2W00A 2YIDA 1PV4A 4D6YA 1MNQA 1OFGA 1SHKA 1WQ4A 3IUNA 3QU2A 4CM6A 3U80A 4QYIB 1MO2A 3SY8A 5DNYB 4XVHA 5EMKA 1EA5A 1U81A 1XCMA 2YYZA 3AJEA 1R4AA 3FWKA 1HTWA 3HXPA 3W7AA 2XRFA 3K0EA 1BMFD 2PMFA 4FLEA 4LCEA 4XVRA 4BCCA 4CQMB 3L7IA 1QMPA 2B5VA 3ETEA 4KPYA 4UCWA 4TLMB 4GGOA 1P7CA 2OMKA 3DLIA 1UBJS 2WFLA 1NW9B 4ZAWA 1GPNA 1VA4A 1BVYF 4RKEA 4UMDA 1DQPA 4IHJB 4XN3A 4D42A 1EJ2A 1A96A 3M3PA 4HDKB 1HYQA 2FUCA 3IQXA 3Q88A 4MUMA 2APJA 2BFDB 2NGRA 4P35A 4C6RA 4G8DA 2Q2QA 1FFEA 3TW8B 4KQJA 4RH0A 5T6BA 4AX8A 3BL8A 2PH3A 1HLFA 2QLLA 4ADSG 2HZ7A 2XA2A 5ED4A 1LC3A 4G0MA 4BP3A 4H6PA 5FHRA 1CY6A 3FXAA 4GZ6A 3UENA 4EJSC 2G3YA 3JQAD 3G2LA 3BL6A 4G36A 5CLGA 5B30A 4AP5A 3AR5A 4GGMX 1JAXA 1WHSB 2DG2A 2OT3B 1I4LD 2Q21A 4WX2B 3STYA 4YV0A 4L9RA 2CMKA 3OQIB 2CYBA 3TJZA 3L8DA 2FEMA 3AM4A 4CM5A 3ZQKA 3FSEA 1KQNA 5E3IA 1EJBA 1Q7BA 1KJ9A 2MSLA 3FOCA 4CR7A 4ZEVA 2Q2VA 2G70A 4Z0TA 1UCFA 2BE9A 1KIMA 3BUSA 4HC4A 3VU9B 3DAHA 2NM0A 1NJ1A 1KHHA 1DC4A 1P4AA 4MGIR 4TYWA 4FJ2A 2X42A 3PC8C 5J3OA 5TPWB 4QKQA 4LHZA 1Q0LA 2O6LA 1FXSA 5C3UA 3L1JA 4Y9UA 3OY2A 5AKGA 2V7PA 4BE9A 2V59A 4QEDA 3DDWA 4UEJA 3TZEA 2CF5A 2G82A 3ZW8A 3QE4A 2PE3A 2QA4B 1E98A 3G23A 3MJEA 3NZEA 1JTFA 3SNHA 4BZXA 4ZTUB 1G64A 3A1UA 3HI6A 4PYRA 1VL6A 3OQBA 3EXEB 1GKYA 2YZ7A 4RIIA 4RK1A 3RUPA 4HDAA 3CH7A 5CA1B 4X71A 1NI4A 5JDIA 2WKSA 4B1FA 1C0LA 3U4QA 3UK7A 3DUWA 3NIBA 4R83A 3DMTC 4F45A 5KOHB 4EZIA 5B7QA 2P6PA 1NR1A 2GHIA 3E18A 1ZONA 1TKAA 1WSVA 4HT3B 2IXDA 4QYMA 4TV8F 3TECE 1D4FA 1H8ED 3RC1A 2LE0A 4U3JA 1KVTA 2H2FA 2XWPA 3BTOA 4D79A 3A32A 1LSSA 1X9IA 1MABB 2BJVA 2WIKA 4MQUA 5MDHA 5NULA 1PL7A 4BP8A 1IJBA 3TZQA 4KO4S 2ZRKA 4DUZB 4Z4ZA 1SIWA 3BMQA 1JHZA 2BCJQ 1SBYA 4ZOLB 2QRQA 3EGIA 3NJRA 2WQ6A 1GQ2A 4YRMA 4CFZA 2X86A 3NXSA 2WF8A 3G82C 4GT1A 1R5OA 4V0NA 5E1OA 1NQXA 3NC1C 2EX1A 3MWDA 4MLDA 3H9JA 3TDNA 4W9MC 3GYGA 2JA2A 2MJLA 4KNVA 2FCRA 4X1YA 3ZWVA 5MN4A 3RYCB 1I30A 1XRSB 2H18A 3MIIA 2IF0A 3GNSA 1W47A 3W5HA 4JJAA 4TTPA 4YP1A 3RQIA 1EQ2A 1MQ9A 2FW8A 2LCIA 1CJKC 2YS6A 4FW9A 3TTSA 1VQNB 2QOEA 3G9QA 1VHJA 4OFBA 1QZZA 3F6RA 5HBRA 1JE0A 1CE8A 3I9MA 4DJTA 5FUQA 5LVAA 2CN1A 3BFJA 3E8MA 3PLRA 4HQFA 3CZMA 4WY5A 1EM8B 1FUEA 2B78A 3PGXA 2RGCA 4JJ6A 4KLCA 4M4SA 5IKPA 1TW3A 4M1SA 3EG9B 3JALB 2VBUA 2CXTA 1BS1A 4M8KA 3FLAA 3USZA 1ZITA 2FSUA 3CGWA 4A0RA 7MHTA 1U63A 1IBCA 2D06A 1XE1A 3U4HA 4CWAA 3H2YA 8ABPA 4QOJA 3KRTA 5JI3E 4YCNA 4J3JA 4QFDA 1KK1A 1FYWA 4PABA 6REQA 1GP2A 3P2YA 2QTNA 2WWXA 1CVLA 2XMZA 5KQPA 2KQUA 1DARA 2HBQA 3E03A 2ZDQA 1C0PA 2R11A 3NR2A 5EIOA 1T10A 1LPOA 3R5JA 4YAKA 3K1AB 5HWSA 4QL3A 3QEMB 4JI1B 3PPVA 4O5OA 1OFIA 2Y6UA 3VA7A 3IXQA 2NZWA 1MHPA 2CKMA 4JX8A 2ZSFA 4LVNA 1MDBA 3NI2A 1L1FA 4DILA 1NM5A 1N8TA 1IHOA 4C20A 1LDEA 1DRUA 3GGJA 5JSFA 1VB3A 3C70A 5SY9A 4C29A 2P6RA 1JP7A 2KJQA 1CDOA 1H05A 2H65A 3BYZA 1P72A 3ES9A 2PV7A 3UH0A 3UJ8A 4MQEB 4DYVA 3KOXA 4Q3CA 4F72A 3LC2O 3U40A 3IJ5A 4C05A 4IGAA 5A02A 3KDSE 1XPOA 1X7YB 4CCSA 4ZMSA 5DCLA 3B2EA 5ALLA 4XRRA 1TYBE 2VBTA 4BKPA 4UBOA 4B7ZA 4BJHB 2BFEA 4EARA 5KU7A 1INLA 3N8KA 5J40A 2ODWA 2RHDA 4B0PA 3KKQA 3PXDA 1NTOA 4EYGA 1GCIA 1V4NA 3HN7A 4BNYA 4M9SA 4TVSA 4HQLA 3B8HA 4H6VA 1GSHA 1QF9A 2ZQYA 4N5LA 2R97A 4P7BA 3RC7A 3WB2A 3EPPA 3U5TA 1CZRA 1MHTA 2Z6VA 1EZ4A 3PRYA 3UGKA 3DPIA 1LPPA 3B60A 1IJFA 1QC5B 1U9ZA 1UDBA 2FG6C 3OKFA 4E5DA 5AUPB 3GLGE 1VKZA 4V2IA 3EK2A 4M9ZA 2D5IA 2A0XA 3PHBE 4S24A 2UKDA 1GPYA 2OVBA 3HUDA 1CDDA 1Y37A 1O95A 2XIJA 3R5KA 4BHTA 3EDRA 4HEJA 3CISA 5CT9A 3U48A 1XE3A 4JWTA 1VYHA 3EFEA 4HFJA 3WYFA 4ESEA 1DG3A 1Z8FA 2PSDA 2CYAA 5J4KA 2WJWA 3RVMA 3TW0A 4YK7A 1SA0A 1NRJB 1Z2CA 1I5OA 3SG0A 3HP1A 4B3CA 2ZRNA 5K1ZA 4LKOA 1RPZA 2W42A 3ASZA 1GPUA 4E31A 1RZRA 2ECPA 2J9FA 3NHJA 5AKYA 1NURA 2A5FA 1A8QA 2DLDA 4ZCLA 2HRRA 1XXHE 3GF4A 3HP4A 3M89A 2D5AA 3NHAA 4HLCA 5HOEA 3K0SA 4KGDA 2W4QA 1A98A 2IBTA 1OZ0A 1NQTA 3K6SB 2IU6A 3IKTA 3EPKA 3H6KA 5JSZB 1N8KA 2BI8A 2Z43A 3A6DA 4G5RA 3UAVA 1OTHA 1V7ZA 4HQRA 3BXEA 1K88A 4EQ6A 1P1FA 1ECJA 3TDMA 4NIMA 2CVOA 4JI3B 4C7OB 4RTOA 2QXUA 3CVYA 2O23A 1UZUA 4C4ZA 1DT5A 4FEYA 1MUUA 4NBLA 2XE7A 1B0PA 4HNHA 4U2CA 4TWRA 5C5CA 1IZZA 5FPHA 1WD7A 2R6DA 5DBFA 5B37A 4XL9A 3I9OA 1U2SA 4IZIA 4AN1A 4D44A 5KDOA 1HY3A 4IGEA 3NGLA 4KXWA 4H17A 4UXHA 1MAVA 3PUWA 5P8WA 5CFNA 2XUJA 3OTQA 4WESA 3E2PA 4ZD6A 3IT2A 4MPPA 2DETA 1GZVA 5LWQA 5K3AA 3C7TA 3WS7A 5KBYA 2VTKA 4Y2GA 4QRIA 3EIQA 3OPQA 1N2SA 2YWGA 1D5CA 1Q0HA 1QX3A 5DGTA 2R3SA 1ZWKA 2OCAA 2FWMX 3LT1A 1HV8A 2Z4TA 3HVKA 4NSNA 1HX7A 3VTAA 1OI2A 3O8BA 4MIOA 2H8GA 3JD0A 1LWNA 1ULHA 1Z5ZA 5CDHA 4D9MA 4KB5A 3E8XA 1WDMA 1Z37A 2QJWA 3REGA 1EWTA 1TPZA 3K92A 4NBKA 1HYGA 2ZB7A 2C4HA 1V5GA 3HVUA 3RRMA 1O2DA 3EMKA 5LZ7A 3ZGXA 4XPIB 1D03A 3ESRA 2ORED 1QH8B 4B6PA 1MBZA 2QBYA 2JBAA 3L7CA 5PNTA 1KU6A 1DEOA 1MC8A 1PCXA 3DEJA 3EPRA 3FYTA 4LVUA 4YTEA 3SJCA 1GZHB 3C0KA 1AMOA 4LNHA 5LBUA 4MUEA 3WRWA 5BP7A 3DTYA 5AOAA 3KS9A 3ENNA 3NOOA 1LS6A 2YWRA 1CZHA 1P4GA 4MUFA 3T9BA 4IQFA 4P4LA 4EK9A 2B2CA 4DNQA 5A04A 2JLXA 2ORYA 4X0EA 4UNRA 2QRUA 1C7RA 4XA8A 1T8UA 1R4NA 4TXJA 5CLLA 3ZEAA 2AOTA 1JA9A 3DOCA 2DPYA 2CDBA 2QN9A 4BO2A 3WL7A 2D8AA 1X1DA 3HA3A 2REQA 4Q3EA 1KTIA 3FPLA 5JO9A 4KJXA 2OV2A 1JXMA 2FQ1A 1GZ7A 2WD7B 2V3WA 3PFBA 5KI6A 4IY1A 4GMKA 3TXXA 3D4IA 2MYNA 3NALA 3U3XA 4J91A 5JHHB 3AFOA 5GZ3A 3BTVA 4KAFA 4X7RA 4ZHQB 2O20A 2CC2A 4G1MB 1X19A 4MEAA 2Y68A 3HDGA 3ZR4B 1VQ8B 1X9GA 5CB8A 4E7PA 4R1OA 4TX1A 5L8VA 4PSKA 4PHTA 3D4OA 4TSKA 2FJUA 4US1R 1XD9A 3GCGA 3IE2A 1MTZA 1IEXA 2V6IA 1XZGA 4AVZA 4FIZA 4JA0A 4NYIR 2J0SA 3AETA 2BMWA 4K46A 3V4OA 4CRWB 1OKKA 1PSWA 3H2SA 4IJ6A 4P80A 2JFGA 4WEOA 4WZ6A 5B55A 4MCIA 3B3JA 3H3FA 2O2EA 2OV6A 5FYDA 3VZPA 3GLHE 2DUWA 1YB7A 2M6KA 1HMYA 5D5HA 3RVDA 3BH4A 4CODB 3WGQA 2R00A 4CTJA 5LOVF 2DM6A 2NSLA 4JBIA 3GEIA 3AEQA 1OWPA 1G7RA 4B4DA 3AKDA 1E5XA 4DB4A 1TW2A 3PPXA 1FFCA 2FWNA 3LPCA 1CF4A 1RWBA 1C3LA 2YOHA 2QV0A 2Q8QA 2C8VA 2O3UA 5DHSA 2FPRA 3KOUA 5KKCA 1JI0A 1FDOA 3FPKA 5DHRA 3KJFA 1D2NA 2VHXA 3W8RA 1WY7A 5JJLA 1G0OA 1SEVA 2DFPA 1KEKA 1WB5A 1YK0A 1XL0A 3O7WA 3U09A 3OWXA 2A9OA 3GFFA 1ETHA 3K05A 3EMDA 2HU2A 3OKCA 4MHSA 1XHLA 4XGIA 3RANA 4YCSA 1YIJB 2J31A 1K92A 4QHSA 1UR5A 1F2UA 4PZYA 1EFUA 3UY4A 1Q7RA 3PZRA 3P71T 1Y8AA 1C30B 2YJNA 4TL7A 1KJNA 2HJWA 5CFLA 3LW8A 3MBOA 3V8VA 2VF2A 1K8XB 3E3NA 3V2IA 1T0BA 1JBKA 1WB4A 1CUJA 4UPEA 3EH1A 3TIVA 1Q7CA 4RMIA 2CT8A 4IFIA 2MINB 3PCTA 1ISGA 2JFZA 3UW3A 2XT9A 3WDSA 2JI7A 3MMNA 4TVOA 1PR3A 4K2HA 2FE1A 4C0XA 5L53A 3MXTA 3SR3A 4DMUB 1IK6A 3S2FA 3ZJTA 3S1AB 1VIYA 3HKBA 4R51A 3RAJA 3VNRA 4RQUA 2VT2A 2PMCA 3AHFA 4O2BF 4DXHA 3FIUA 4CR6A 1DCKA 1NFFA 1W0KD 1SUFA 2ZPAA 4UAGA 2TSYB 5JMOA 3CX6A 4Q6WA 4NYJR 5KNDD 4D8UA 1XLVA 5DFAA 4ZV7A 5IM4A 4NXMB 3KZMA 2J8ZA 3K4HA 1UXIA 1BS9A 1NR7A 5BNTA 4R69A 3SN6A 4DMRA 4Z0PA 4J16A 4IO1A 2A0KA 1SXGA 2M6RA 2VT3A 4Y6LA 2XCUA 5ALEA 1GPWB 4GMFA 4UBJA 1DKPA 5C8YA 3NP7A 3K9LA 5F3RA 5TS3A 5LP6B 1RPAA 3ONFA 4OIMA 1UBRS 5TIIA 5GY7A 1YVEI 3NBQA 3X1WA 1FXWA 4DCCA 1TU3A 5JH7F 3W5VA 4YCMA 2CVQA 1NN3A 1RYZA 3ITEA 4WW0A 2BM9A 2FGKA 2QUAA 3UKOA 5TF0A 2MYTA 2W2LA 1U0TA 1G4UR 1JHQA 4ND3A 2G4VA 2AQ8A 3GEDA 2XMSA 3U7FB 3R0QA 1YB4A 2NP6A 2PBLA 3FSGD 3L04A 2EL7A 1WXIA 4KDCA 3B7PA 1Y7LA 2R8XA 4FOOA 4BNLA 2C92A 1OMOA 1NZJA 2Y93A 4J7XA 2F8SA 2Q0HA 5G0WA 3HMQA 3LLCA 2O1EA 1ONPA 4OO3A 1M6NA 4JJ8A 1KKUA 4Y6RA 3A3BA 4GPD1 3TNLA 2IYAA 3C7CB 1RTTA 3NE5B 1JLMA 2BFBA 2HQSA 1UPXA 4NJMB 1FMCA 1E4YA 1HR0B 4JI4B 3E9ZA 4OHMA 1B42A 1Z62A 5EY5B 1JEYB 2HA2A 4GUDA 1JT2A 2EJVA 1YJBA 3FMVA 3KHKA 3ODGA 4IDQA 4R9RA 2I33A 3LUHA 4CV1A 4AMUA 1U9IA 5BXYA 3EVGA 1NUQA 4YALA 4X92A 5LB2A 4P98A 4AF8A 5BVHA 1KSJA 3OOEA 4AULA 3VGPA 3U2QA 3DULA 4BNGA 4EG8A 1FSPA 1LKZA 2A14A 3AR7A 3JRWA 4ACBA 3AEUA 4IIJB 1W5BA 3C5CA 1DCMA 3IVXA 3NCHA 4JASB 2WIBA 3IA2A 4KFTA 3PYMA 4QHYA 3A2MA 3STTA 1ES9A 2E48A 4OI4A 1Y7HA 4JN6B 5C4IA 1BWPA 3LWDA 4M0FA 4XSHA 1L4NA 5T5QA 2X4GA 4CZ2A 3A3PA 2JKVA 4FHZA 4M1KA 5JWRA 1CSEE 1N9ZA 2QRVA 3H86A 1W4BA 2DMRA 5CH8A 3QWFA 2XDYA 2PX6A 3L40A 4YMUA 3R0VA 4B80A 3NNSA 5ENVA 3OO1A 5J2UA 1QYXA 3VZRA 1X74A 3UKDA 1GQQA 5LQNA 1HTTA 4CKCB 8LDHA 5HUJA 3NWEA 1TA0A 1LLCA 1X1AA 2PV0A 3T5PA 2OQRA 1KI3A 2V45A 2FSSA 3AQ4A 4KXVA 4R3UC 1GXSB 2VF5X 3DR3A 4XWAA 1I7NA 4H3KB 5F2EA 4OA5A 3IQEA 4RQAA 1Z2NX 1ZM9A 2I4TA 1EVJA 3TTTA 1KZLA 3FUTA 2C4VA 2RC5A 1CZNA 1KYZA 3A58B 4N6NA 4UNQA 4DMKA 1O8BA 1YE3A 2QRHA 4I14A 4UUMA 4JLSA 1E9BA 3CLHA 2DHEA 3VKFA 1ODCA 3IRUA 5J2TB 1NZFA 1QVVA 4XIGS 3M82A 3N2YA 4TSRA 3IMKA 1GARA 3AEKA 3FPEA 3BCHA 4I6JA 5FCDA 1Z3CA 4ZT4A 1HEYA 2JJQA 3YASA 3MYYA 5LQKA 3LO8A 1W87A 2F43A 2BKEA 2R6ZA 3PEEA 2WTMA 4PSCA 1X1EA 1NP7A 1J0EA 3PQ2A 4F21A 3EQ8A 1Z34A 5G53C 5LZ8A 2J6BA 2EKPA 5PGMA 3RVKA 4WLOA 3IKMB 4H7DA 4CV2A 2BKVA 2GN9A 2I80A 5EYPA 5BW8A 2HV8A 2OFWA 2V96A 1YS6A 1E64A 2X85A 4PQRA 1LF5A 2O2XA 5ESRA 1I4EB 5KC8A 3I37X 4RA9B 5JC1A 3E1YE 5DYWA 3CB2A 2JL1A 1PDOA 2ONCA 2XOXA 3R9IA 4XYEA 1Z45A 2WVAA 1YDWA 2YHBA 4Q3OA 1U0JA 2QL9A 2WG2A 3OZ7A 4CCYB 4B3HA 1C7FA 3U61B 4ROXA 3CT6A 3DBHA 3KYJB 1C4WA 1JFFA 1N33B 2CV0A 4K6CA 1N5KA 3HCAA 4L5JA 2RD2A 4I1IA 2G5GX 3DMHA 5LA6A 4DCMA 1MV8A 2CHFA 3P0RA 3V2GA 4ZVQA 1Q57A 1QVAA 1BGWA 1A76A 4OJQA 3F7TA 2ZTGA 3ESXA 3LY7A 2FZWA 3EDQA 5F9HA 1Z13A 2CFIA 3C4JA 1BYIA 3OJEA 4UXJA 3VSAA 4RNCA 5CDGA 4J90A 5FADA 4B43A 1QHFA 5EP4A 4EY6A 5IFLA 5IVPA 2I71A 2JZNA 2GZ3A 2IUSA 4M9QA 2ICAA 3WV4A 1PR5A 2WF9A 3ETJA 2X9NA 1JLRA 3FX2A 2O48X 4FCWA 4CL2A 3JQAA 5FFFA 1CF2O 1KO8A 4AUEA 2CJYA 3BZWA 2PU5A 5K4AA 1SXJC 1ZH4A 3HBFA 3VPSA 3TRDA 4YT8A 5EWLA 4J3FA 3DV0A 3D6AA 2OHHA 3AUUA 3LMKA 4KYIB 3WNVA 5CGZA 3TXAA 3U0VA 4BNJA 3ZWKA 5A4AA 3IEPA 2BM8A 4XMYA 2GBFA 3TL2A 5DI9A 2EIXA 1ZSVA 2FHSA 4UDXX 1SU8A 4ZU6X 1FPMA 1JYFA 2HNAA 3PQEA 1GHTA 4BQNA 4F97A 1X9HA 5LN1A 1ORHA 3N0XA 3CLSC 1J6UA 4HWOA 4I50A 4RTLA 3HSKA 5CRIA 4GPEA 3IQZA 3BMOA 3OJWA 2CCGA 3OTGA 4GXNA 4RL6A 3I0MA 3HRIA 2H4XA 1PK7A 1R16A 1CC1S 1NONA 4QPDA 2DTDA 2VVTA 4MB0A 5I8WA 3ESDA 1U98A 2N1BA 4ZT2A 1U2TA 5DW3A 1PAUA 3FD8A 1PVDA 3NORA 3SOPA 2E0IA 4I7EA 3ZXSA 4Q3NA 5BWCA 5AJTA 4QVJA 1PR2A 3RS7A 1YMVA 2B8NA 3R8XA 4Y7CA 1VE3A 3ZWAA 3UAOA 1F48A 1P5FA 1VJRA 2JGNA 2KMLA 4Q02A 4UZUA 2GPWA 4LJLA 4U7JA 2RK3A 4CNQA 4DSAA 3OQMA 1IRXA 1QZ3A 1B8VA 4DIDA 1RACA 4O25A 3GLIE 4A92A 4IF6A 1DTEA 1J20A 1H8EA 4O0LA 3MFQA 3JVEA 5JNSA 2QW8A 4PE5B 1QO0D 3P2IA 2RJ3A 3CE6A 1SCJA 5EEGA 1ACJA 1IVNA 3QU9A 4O4JF 4QUGA 2VHVA 4WLEA 2WHRA 5IYNA 1TTPB 5JQGA 1E1QA 4QSHA 2O1XA 2G71A 3QUTA 1UK8A 2XHEA 1NQVA 5KVAA 2HU7A 1G9XA 3UJPA 1UANA 5BMOA 1CY0A 4AG5A 3VQTA 1I2BA 2ZEJA 3V8NA 1CY8A 4UVEA 1Q3HA 1XLUA 3OM9A 4P58A 2A7XA 3MJRA 5AM1A 4ZCSA 5K0GA 4DKJA 4XVQA 3A1CA 4ZCQA 1QHXA 1TEXA 1SCAA 1U3UA 1A2BA 3S6JA 5IWAB 3M5DA 1SKYB 3KSBC 1LS1A 1A9RA 1QAOA 2CNNA 2V7XA 5CBPB 3K6KA 4YAFA 3RUEA 1GNVA 1ZGHA 1VGQA 1Y9EA 1MZPA 3VNBA 1RFGE 4IYJA 1FTGA 5IKMA 5HVNA 3O8CA 4P0QB 1HKHA 5CJ2A 4XRGA 2VP2A 2FLKA 2IZ0A 3GPBA 1X2EA 4GQNA 5KNLA 3TJMA 5JASA 4EHFA 1KXJA 2FOLA 4G07A 5AVXA 3LK6A 1ENZA 3N7UA 3HQ4O 1ND5A 2HYDA 1HE2A 2DKOA 5DX1A 2ONJA 1N5DA 2H2IA 4IDNA 4JJ7A 4URUR 5E8JA 4ZCMA 1PJ8A 2B21A 1YT5A 3AJ9A 2DBRA 1JIQA 3OCXA 4PG6A 4Q01A 4A6PA 5A5FA 2H5IA 1J4AA 3JATA 2G08A 3IT0A 2GTHA 2IP2A 4JQYA 4MO2A 4U7HA 4DQLA 2ZJ1A 4X1YB 1SRRA 3ACDA 3L1HA 3NGXA 3DMFA 3OLYA 1JRLA 3EH2A 2GXAA 1IPHA 2YRWA 1H85A 4KXQA 5IFKA 1RVV1 3QE0A 5EIBC 2HW8A 3NWJA 2G9NA 4XCQA 4UTOA 4DR4B 4G8JA 5CCBA 2FW7A 1NVFA 4FKBA 2C9OA 4M99A 4K87A 4KI0A 4B7UA 2E5LB 5TSDA 4OOVA 4MLPA 1H9BA 1JQ5A 5KW9A 3QFSA 1MB0A 4FCVA 3CH6A 1EU1A 4A1OA 4DA6A 1DIGA 4PXYA 3W5BA 3NTLA 2WC1A 5EKTA 2P8JA 3HDYA 4ARUA 3AVXA 2VK8A 2VNJA 3ZJVA 4RLQA 1GCUA 4NC9A 2C61A 5B3JC 1IK4A 2KSQA 2F00A 1U7WA 2C1ZA 2IQ5A 1SBQA 1KFJB 3AK4A 3B13B 4TTAA 3RLIA 3V46A 3ZV7A 6REQB 2UDPA 4EJ6A 5IUJC 1A5SB 1NQ5A 4RX1A 2YWJA 2ZR7A 4ZV4A 1PEKE 2QZJA 2BEVA 4Q1BA 1ZH8A 2DFKB 3TPZA 5BXQC 2C0PA 1MGOA 3DB2A 5JSYA 2WU1A 2GPBA 2FRXA 4O59O 5LBTA 5FQNA 1SHZA 4B09A 3GFSA 1KXZA 4EGAA 1H6BA 3DDNA 4OU4A 1NMEA 3GBVA 4X60A 1BA2A 3WSVA 3KELA 3MJVA 2IUUA 2X3YA 1MC5A 1Z26A 1NTRA 1TYCA 2JCYA 3GUZA 5KVSA 5JJ5A 4ZVVA 2ZI9A 4OQXA 4QWWA 2YIMA 2FGJA 3FB4A 3R7AA 1YL7A 1YZTA 2OBFA 2A9QA 2IUEA 3GIRA 1S8NA 2R6AA 3CCBA 3LX8A 5EAIA 3DDZX 1NGSA 2XB6A 5F2OA 1BHSA 1TT5B 1EM6A 4RDCA 2ZE5A 3DOIA 1G3MA 2BFEB 2OV8A 5B6JA 5DMXA 2IIVA 5GTDA 1L8OA 1G3RA 1VRCA 3AVYA 3AM5A 2HPAA 2AI2A 1J49A 1QYCA 4I9GA 2PVPA 4NHOA 4R1MA 3U3OA 3ZDDA 2BW0A 1EFAA 3VAZA 2BMDA 2YJ3A 1IBKB 3IAAA 2GBLA 5DISB 3RUDA 1YDGA 3D43A 2HOQA 3FF4A 2NTVA 3JU3A 2EP7A 1RJ9A 2ZITA 3BGOS 3LM8A 3SSMA 1SPBS 3AYZB 4GP6A 2QG6A 2VF7A 3M6WA 5DO9A 4ZEMA 4BQPA 4CLXA 5CH3A 4G2NA 5F73A 4RTMA 4JB3A 4L5CA 3ZIUA 1N2CE 4A6XA 4RDHA 4CM9D 2VPIA 2W6NA 1RRVA 3EYWA 1V9LA 1WTAA 3UMYA 1YI1A 4P84A 1YMUA 1HFEL 5FUYA 1XCBA 5T4EA 1X70A 3DBIA 1PKEA 3Q7IA 1QRAA 2H16A 1SA0B 1I7LA 3E22B 1RIFA 2P5YA 3P9QA 3Q6NA 4NFYA 5EUCA 4RCZA 2W0SA 3KNZA 3S81A 1GG8A 5HRCA 2IXAA 4YMLA 1U6JA 3IQWA 3BHNA 4E51A 4AS1A 2J9FB 2WU0A 4QDXA 3UHFA 4IRMA 3RBZA 1JX6A 1ZCFA 3OP4A 4CQNA 1ZYUA 3I62A 4ER5A 3EASA 2EEPA 3G0IA 2GN6A 4CIBA 3OWOA 4PYMA 4AURA 4DM7A 5AHWA 2G25A 4C7MA 1AQYA 1ZVQA 3O8LA 4WADA 5KWVA 5CFOA 1Z18A 3UJ9A 1T8YA 2WD8A 3PT5A 1A5TA 4WLUA 4HQNA 3ZQ4A 1YE5A 1KE2A 1UOOA 4LOLA 1OXUA 1ZM7A 4HWGA 3SKYA 3T9AA 2CHEA 4DCNA 2PL3A 1US8B 3LNTA 2VJMB 3G9ZA 3OMXA 3PKIA 3I55B 2ASEA 2WDZA 3KD3A 3V33A 4MGKR 3ICPA 1M90D 1D3AA 4NFSA 4M9UA 3M6IA 5TRDA 2JGDA 3TD9A 3WK6A 1GZSA 1WOOA 5AVSA 2NX2A 5EHNA 3R8CA 1K7FB 1MO5A 1LD3A 1WUTA 3QXCA 3FNRA 4UNPA 3TX2A 5ADVA 4E32A 4XQ9A 1SO8A 1XCOA 2WTAA 3LECA 4AI6A 3DKKA 3HLTA 5EVJA 1NY5A 2O50A 3L18A 4JYMA 4UARA 1FNCA 3DQPA 2FLVA 3FLMA 4RZUA 2VP4A 3UHJA 2D00A 1ZOPA 4EJSA 2OWDA 4BDSA 4QE3A 1QB7A 5ER6A 4W5TA 3ZZUA 2VCYA 1SKAA 1GZUA 2PX5A 3H87A 2CFSA 3FDJA 2OV3A 5DLQC 2X0KA 4KGZA 1USKA 4U2KA 4KYVA 5CDTA 1XEXA 2QBYB 1DBSA 2JBAB 3CJRA 4D4MA 3LLVA 1E6WA 5IVKA 2PD3A 4KQFA 5I51A 1G0NA 3NIGB 4YRLA 3CCVB 1SKQA 3IJEB 1PD1A 2TMGA 3W34A 3UUWA 3AJDA 3Q5DA 4W7SA 4R2MA 5IC6A 2GKSA 3BE6A 4AUNA 1A2OA 3CV3A 1PJ4A 1KI4A 3INNA 1YD7A 3PC8A 4JLJA 1X39A 1RWNA 1L2TA 2GPTA 2XYHA 4A2CA 3N05A 5JRJA 4DDKA 4YELA 3CLSD 1EZ1A 1B3BA 3L79A 4U2FA 3FZNA 4MVJP 5A4MS 1NAIA 4L76A 1UZNA 2GX6A 2MSDB 3HJGA 4OTZA 1M1NB 3ASYA 3PWZA 3AC0A 4XJSA 1AXGA 2YW9A 2AOTB 2HO5A 3PFCA 4NJOA 4G5OA 3GJTA 4CUJA 4X84A 4F7WA 5JADA 2Q5HA 3DE6X 2REQB 4JL8A 3I1FA 2BGTA 5IVHA 4HRXA 3FDIA 4J0KA 4KL8S 1ADBA 5GJWC 1JWAB 1GL7A 4GI2A 3V4LA 1XL1A 3VHXB 4CU2A 2UYOA 3TAXA 2C4KA 2O7NA 3SWWA 1IRIA 4C4PA 3DMTA 3EVNA 4RE5A 5ULLA 4OHYA 5JZMA 2C5BA 4M86A 5DYYA 5K5EA 1WMSA 2OR3A 4MWEA 4OPVA 1NIJA 3LKVA 2XVYA 4HSGA 2FPOA 1D9XA 3HN6A 2VPWA 5B12A 3AETB 3AP1A 3PUHA 1ZJJA 2EGGA 3Q3IA 1W48A 2O8NA 3IBCA 3ZLJA 2ILVA 2XECA 3NM4A 4OSPA 3AOGA 4UAJA 3VDQA 2GEDA 3GO4A 3Q3VA 1OWLA 3DH0A 2N47A 2BKXA 3C1TA 3PVSA 3TNDA 2PGAA 4K6MA 4Z4IA 2B0CA 5MGNA 4JCCA 3H8SA 1M9NA 4E09A 2A1IA 4Z4SA 4TMVA 1GA4A 4F0JA 2JCGA 4XEHA 1O0SA 3L2OB 1TO2E 2I2CA 2J7PD 2Q50A 1N36B 5DLDA 5BSKA 5FNVB 1E2BA 2HRDA 2ZSDA 4EVQA 5L51A 5TR9A 1TAHA 4F12A 2H52A 1JZTA 3EN0A 4RHUA 5JD4A 3DO5A 2VXBA 4R31A 1JBEA 1Z5UA 3LPNA 4D45A 2PA0A 4EG0A 3GRUA 2RI1A 1UFQA 4OGKA 3B9PA 5EP2A 2AXNA 1E4VA 1F2UB 2J3EA 4JB2A 4Y9TA 5TMBA 3TMKA 5EJ9A 1GAWA 1W0KA 4GI3A 5C7LO 4FQ5A 1LTQA 121PA 3H9QA 1G4HA 1B3RA 2BFWA 3I6MA 3L7DA 4OKIA 4DCOA 1ZLYA 3DPUA 3ZWNA 2E1PA 1U7UA 2ZZQA 1G20E 1WZNA 2Z5LA 2WNIA 4YACA 3SQWA 2F55A 3RTBA 3RVBA 5LLSA 2A1UA 4NV1A 1GR1A 2VDJA 3U7GA 3RC2A 1LK5A 3GOHA 2AHRA 4KHZA 3A1NA 3FNIA 1AS3A 2OGZA 3VVBA 3ECCA 1UZMA 4N0MA 5BYKA 4JXJA 4S1OA 4REMA 4OGGA 1AO3A 1DJPA 4YRQA 4GICA 1Z47A 3ED5A 4PICA 5EIBD 3UBTA 3T1VA 1FUUA 2VP3A 3ZCUA 4JI0B 5KC9A 4FTWA 1KAQA 5HK8A 1P45A 3M2TA 2JGIA 1E4EB 1PK9A 2L69A 1B8UA 3OHSX 3UJCA 4I55A 5B4TA 4FEGA 3KVRA 2YL2A 3DEHA 1M0WA 1Q0TA 4NENA 1RCUA 4AP9A 4C01A 1WCYA 5EMNA 3DD5A 4ITVA 3GI1A 4O08A 4M0CA 2ZJ3A 4E30A 1KOLA 1C0IA 1BQEA 1OZHA 1PJCA 4HPWA 1U5BA 1HEIA 1OBOA 4Y2XA 3SYTA 3W1EA 1KAMA 2FOXA 1N0IA 1XZJA 3PI7A 1CQZA 1L3IA 1MA0A 3F8TA 1AV6A 3C3JA 4QNNA 2M1XA 3AEXA 2QUKA 2SKCA 3ENWA 3T5GA 4C87A 1GKUB 3ISJA 2PO5A 3LRXA 3OE1A 3PUXA 4D7AA 4M89A 1FOEB 2ZXUA 4PV7A 4RSGA 2PT9A 3KKMA 4BX2A 3KQNA 2E49A 3CEAA 1SVKA 1N07A 1M2JA 3QNWA 1OIXA 5JTTA 4KK3A 1QBKC 1W94A 5AVUA 2VHZA 1E9CA 4I1SA 3VDXA 1OA1A 3FDZA 3OZEA 1TJ5A 3L4JA 3LDAA 3PJRA 3GJ5A 5HF8A 4HMPA 5K0TA 5EHXA 3H6GA 5CLJA 2HJSA 4ZU3A 1OFUX 1S1CA 2Y1XA 3WNQA 4AY5A 4DTIA 3GP8A 1U0BB 1QOZA 1RE0A 3PD1A 5L3ZA 2JHPA 1TEVA 2HUNA 2PL5A 3OW2B 5EQDA 1AQUA 3V55A 1ABFA 2WZBA 3ZDEA 5DM1A 5JFGA 3C7AA 2Z3ZA 1BDMA 4Y7DA 5LWHA 1L7PA 4I4CA 3FJOA 1Y5NA 1TO6A 2F3PA 1XMIA 4O3MA 1UKZA 3B9RA 3M7IA 4OGWA 1SHJA 2B9EA 5EE3A 3ZHCA 5BVHB 4OQDA 3ZU3A 1DDOA 4IKEA 2X0DA 3ETHA 3REQA 1VLJA 3AEUB 3QFFA 3H99A 1EIWA 3HO8A 3HXQA 1U3VA 4KOAA 1CLUA 4KQCA 1SWVA 2PHZA 2Z5FA 1ZK4A 3O91A 4TWAA 3FTFA 4MQ5A 1D1TA 5L40A 4QUHA 1YRWA 3NUQA 3TLKA 3UJBA 5H7XA 1NSYA 1WQ3A 2R4QA 4PX2A 3WLHA 4BQIA 3EQ6A 3RW9A 1X80A 1KH2A 2HIGA 2QRVB 2GNOA 1SOWA 1H23A 2EG9A 3QUBA 1H2ZA 1S8FA 4XDYA 1PQWA 4MV3A 2W2XA 1KMIY 3KT0A 1KIAA 3NETA 3NIDB 4NULA 1RXVA 1IBMB 4UFNA 3DZKA 5J2UB 4AO7A 2PS9A 1Z06A 1SKMA 1AKUA 4DNFA 4G8CA 2V7TA 3JY6A 1DLJA 5KSPA 1YDHA 3OX4A 4NOMA 1JIVA 1Z4JA 2XTZA 5FHQA 1DQZA 4OLAA 4KFUA 4YUAA 2C2HA 4ZQBA 2J41A 3H0KA 3PNKA 3QOXA 4GE3A 2D1TA 2O3TA 4HZIA 4CIDA 1BRTA 1MAWA 1F8YA 2J9XB 5ITZA 3KKNA 3KXDA 1T1JA 5BT8A 1XTBA 5E95A 2JI8A 3EZXA 2ZBQA 3A4NA 4I5IA 4NECA 3PGLA 1V6CA 2D9RA 4HB0A 1KC3A 3SHVA 1WZUA 7GPBA 3T99A 5F5LA 2HCBA 2CZCA 3L0PA 3IIEA 5ELMA 1ESZA 1RSZA 4JGIA 1M2VB 2J4FA 2YQ4A 3TQSA 1QSGA 2JHGA 3COYA 3MUNA 3NHBA 4ENPA 2J45A 1YS7A 1H3FA 1U1EA 2EKQA 4GOXA 1H4QA 2DBVO 3AEKB 3DDHA 3M6UA 1AT1A 4LGCA 5EXDA 4BFVA 2AOWA 4NBSA 1CUBA 3C43A 5HQTA 4IUYA 1HO3A 4CMCA 3E9RA 2Z8ZA 3QVGB 4NH0A 5BSVA 2FR1A 2EFEB 1DAGA 4OFXA 5I9NA 5KYXB 1UDAA 2BM0A 4UTVA 3OX1A 5EYPB 4YP0A 5EIEA 2ZBFA 1NLZA 4B6OA 3UBMA 4Q9KA 4MYCA 5IKOA 5B1DA 1EPUA 1A9QA 1CD5A 3Q4GA 2GWHA 5DM0A 5E1BA 4A15A 2WSIA 1EP2B 2N3ZA 4KIJA 3F6YA 3HFRA 2PEZA 1HNZB 4Q0MA 1NKVA 3IS3A 5IEBA 4INJA 1SC1A 3ZD8A 3H83A 4Z99A 2JIDA 1Z12A 3PJGA 4F2WA 2PH5A 2X8KA 3VFDA 4AC9A 1JDBB 3H94A 2C2BA 1JFFB 1XPJA 1H6CA 2LVBA 3K73O 3CRZA 1VFNA 2PUHA 3B1ZA 4TRMA 2GEBA 8MHTA 2I6FA 5LA6B 2V98A 1YCGA 1POWA 1NQAO 2WVGA 3UH1A 2J5KA 1KDPA 3QVKA 2BF7A 1JTEA 3FMGA 1YR3A 3QBJA 3ZE0B 1E0KA 2ZUEA 3U4AA 4EUKA 4QBTA 1TC2A 1VE5A 1XFOA 1Y82A 2IHJA 4JIMA 3W0LB 3WWEA 1KTVA 4M1WA 5JY1A 3NEYA 4GYYA 2O3QA 1WORA 2GLTA 1MENA 2RAVA 3ANTA 2A9KA 4EHBA 4LY0A 4DBLC 1OLSA 2PE5A 1TGYA 3JQAB 3EZ9A 4KYTA 4KKUA 1URPA 4BO4A 3F98A 4CTOA 4EUNA 1XRJA 2C97A 2GZDA 4PX5A 5EMJA 5G2OA 2BZ1A 2OLKA 3E2MA 3NPAA 4RMNA 3HO1A 1XXHA 2OYNA 2CSXA 5AKXA 1VA5A 3OM1A 521PA 1LRKA 3UXYA 3ABOB 3DV0B 1P7VA 1J39A 1I0ZA 3O4VA 3WLSA 4E5PA 1WHTA 1T2FA 5T4FA 4QULA 4EHDA 3U7EB 4GVPA 4LZNA 2GFIA 1ZN8A 1G19A 3PR3A 2B1QA 3MA0A 2A9RA 2MYPA 3QVMA 1QTQA 2K2WA 1KO4A 3LQFA 3EVBA 2IY9A 3E9DA 3ZHVA 2H51A 3CKLA 1GRQA 2BD0A 3JPWA 2VUTA 3OETA 1ORWA 4G56A 2VR1A 4XSVA 4XVCA 5A4KA 2EU8A 1XO1A 2FR8C 2VPYA 1NLMA 3EIHA 3OF3A 4HTAA 1T6XA 2ZLBA 4I50B 2ZTUA 3R6GA 2QW1A 3KL4A 1T2DA 4BMVA 1Z83A 3AI2A 1G1AA 3N8IA 4MCJA 4RPCA 4A82A 4LFCB 4HV4A 4Z4EA 2YFYA 4HRVA 1Y63A 1JZQA 1RYFA 2XX3A 3F9IA 5I9TA 1QO0A 3K31A 4N01A 3ICEA 2GZHA 2R65A 4FDLA 3AHGA 2P9YA 2P5TB 2PRIA 4Y2QA 3ZLTA 1RVDA 4QRDA 1JDVA 3LT5A 1H2EA 3G71B 1HYHA 4M8IA 1A69A 4DA7A 2O0LA 2D2FA 3FHJA 4GKAA 3EIUA 2WKPA 2NTEA 3UFXA 4C0BA 4HLUC 1O4VA 5TQ2B 1E2PA 1Z0JA 1L5OA 2FP3A 4GPZA 4KWIA 4UEKA 5E6SA 4Z4GA 1EFPB 2AJLI 2OM6A 3EEFA 3MJHA 5HRAA 2W0MA 2XUPA 4G6ZA 1RKXA 1X1QA 1PZXA 2ZR9A 4AP6A 2XQGA 4C0JA 5FTLA 4OPSA 3WDMA 2OHVA 1QNLA 3IUBA 5BUCA 5DM70 1GTVA 4UMVA 2ZQZA 4JMQA 3D2AA 4J1QA 4XFDA 1ISIA 2IHBA 2R6CA 2VJDA 2XA9A 5E0OA 2EAUA 3PTZA 4WJZA 5EMMA 5TDHA 3OZSA 4K03A 1F20A 1K5PA 1X14A 3I9JA 5F76A 3W06A 1D5WA 2BFNA 1W2GA 4WOKA 5AVKA 4R4JA 4V2UA 1NATA 2Z2JA 4MP6A 3O93A 4RYDA 5JQGB 4LE2A 2BYTA 3T0GA 3DF9A 1U7TA 4NRDA 1CR1A 2XAUA 5F52A 2ZT6A 4JC0A 2RBEA 4XGKA 4HVTA 3UPUA 1ZXLA 2RG7A 1UM9A 3L3BA 5FL3A 3IDSA 4Z5XA 1K3FA 4GXQA 2W2VA 1SHUX 3EQ2A 4B46A 1PW5A 2JD1A 2QYTA 1N6LA 2VN8A 3W8EA 5JFOA 1MQSA 1E3LA 4R2JA 5CU7A 1F6DA 3ZVRA 2QSJA 1IHPA 1UXHA 1XKTA 1K8YB 3EJWA 3KCNA 5F33A 2AKAB 1RPTA 3UUFA 3WOHA 2E87A 4PQEA 1MG0A 4F5DA 4CG0A 3NPMA 2GR9A 2Y1CA 4HXFB 3OSUA 4RVOA 4TS3A 5EXXA 3RUFA 2PFSA 3PGMA 4HN4B 1TQ4A 4M0EA 4F3KA 3GU3A 3DR5A 3ZCQA 2I2AA 2JGRA 1EFTA 2C4TA 3HKCA 3WO0A 4AJ9A 1QTRA 4AS3A 5KQGA 1UEIA 2FUEA 3OBIA 4PF1A 3VUEA 2V0GA 2AKEA 3T1YB 3H2IA 4AJEA 3ELWA 1CUDA 1NG1A 4FJ0A 4IQ0A 4RDXA 3AHJA 4H4EA 5GM1A 2V5UA 4TYQA 1O03A 3A1SA 1VI6A 2ERYA 3GLHA 1LX7A 3W4JA 3CF4G 3IVCA 2AFIB 3E35A 1TF2A 1TOAA 4X7FA 1VM6A 2JLSA 2LW7A 2VAPA 2GEJA 2ZDHA 3DE3X 4INPA 1BCSB 5K3SA 2XODA 1F0KA 1UPAA 2TRSB 3LSYA 3LLUA 4L2IB 3RODA 2GI4A 2BR5A 2C5LA 5BSYA 3U4IA 4F4JA 3ENKA 1L3CA 1P3JA 1PFGA 3MW8A 4ZQHA 2ZRFA 3C6QA 3P26A 1TVKA 2X13A 3HUEA 2OCBA 3IB3A 3LUBA 4KBYA 3QOWA 4MS3B 4EZEA 1Y6FA 1DWPA 1VJ5A 5TC4A 1L5SA 4LZAA 1QQ6A 2O7QA 3JD4A 1NMYA 3A14A 3GUHA 2J9GA 4MTCA 4RAQA 4XQCA 4YRPA 4QDUA 2Y0EA 3W9UA 3WDLA 4ENSA 3DZ8A 5JU6A 1P1BA 3AF1A 3FHCB 1XTRA 2BEVB 3ZCVA 3AKYA 2BP7B 3HKDA 4Q4JB 1JXAA 1J8QA 4QDJA 5FI0B 2HBRA 5T3YA 1J8DA 3T7TA 4EG7A 2X4LA 3DC2A 3SX0A 5K7SA 2JAWA 5FXMA 5EKUA 5BW6B 2I6TA 5F51A 5FA5A 5HDBB 5JXIA 2CJPA 1P6XA 3U31A 3QQ5A 4KTVE 4IDGA 4Q9IA 1XX6A 1YHZA 5E1MA 5IDQA 5JALA 1UM8A 4QNRA 2CWWA 3AIMA 2R6HA 4JBLA 3AKEA 4MSUA 4UBMA 5D6NA 1PJ5A 3MG9A 3KTOA 4HR7A 3CPJB 1KJ8A 3MMZA 1UP6A 4CM9A 1C29B 2B82A 3LQEA 1N25A 2QZZA 2QLFA 4K3UA 3BD9A 2VSFA 3MS7A 3T3HA 4I9FA 4FLFA 2R4UA 3TVYA 1E61A 1WVGA 2P7HA 3N2GB 3WHPA 1SELA 3P9XA 4L3VA 1VKNA 1J5XA 4QU0A 1XCJA 5C80A 2OA0A 1W59A 2IXTA 1E6KA 4LYDA 2NZXA 2M5SA 4C1NA 1DJMA 1CDEA 1QG6A 1Q1GA 3E5HA 3E7PA 1JHAA 2I78A 4M0UA 5K2MA 1N6OA 1RJ9B 3ESCA 1AHHA 3ZHYA 3OZAA 3FWNA 1WKBA 3N8NA 1AK2A 2WJJA 4LYYA 3VYSB 3PHIA 3ER9A 2NW6A 1C9MA 3E70C 4OP1A 4D3ZA 3MHPA 1AKWA 5EJFA 3I1YA 2BEUA 1SCUA 2XF8A 1TZJA 1ZIDA 1NJGA 1SUBA 2CLHB 1E9SA 2ZUBA 1LI7A 1UD6A 4AT1A 5EJ7A 2PGJA 4L85A 4BZPA 4IKOA 1XNRB 1OI3A 4QQRA 4YLGA 3CCRB 1OU0A 4CKWB 2BGIA 1M0TA 3RPEA 2O52A 4OY3A 3T4PA 3RADC 4DG8A 1TI7A 1IY2A 1BYUA 3LUDA 2QRMA 3HYCA 2P5UA 3R3SA 4FCTA 3E4DA 1A71A 4I5DA 3LQ2A 5BV0A 4RM2A 3GWGA 1LX6A 4WXEA 3SBXA 4MOWA 3OP1A 1WSAA 1AURA 4H0NA 2NT4A 1AD2A 1U1GA 4QPJC 2I6GA 2F8LA 2IXGA 1ZVKA 2D0DA 1XV5A 3LCJA 1QKIA 4FIDA 4U63A 4RJLA 1UXOA 3IURA 3PNQA 4BATA 3IE0A 4IJ5A 1Z0AA 2JJ2D 4JLPA 4BO0A 2WYWA 5K3DA 4GX2A 1KQOA 4WUVA 3K5HA 5EGSA 4BZWA 4G1CA 5U4XA 4ERXA 1GNPA 2ZJOA 4INAA 1RRPA 2XMBA 4CMEC 4TXNA 4ZT3A 1OWNA 4P5EA 3UJDA 4D9FA 2VC2B 3LGXA 3QYAA 4FYHA 3B8EA 4A6DA 3GCWA 2BHSA 2JI4A 2VWPA 5AVJA 1XD8A 3ROPA 1JHVA 1SXJA 3JZAA 1NXVA 5IKEA 2CUKA 1UWKA 3DZHA 1T4BA 3FPGA 2P9TA 4MAFA 5AQ1A 4P9SA 3G6WA 2XZPA 1H2WA 2QTHA 2JGDB 4YONB 4F9EA 5JNTA 1W93A 5AVRA 1SQ5A 3DMNA 4NG4A 4LF4B 2VDUE 1ZKDA 4RF3A 1L4BA 3WLEA 3WSTA 4BLQA 3W5UA 4LE1A 4Q9AA 3PL5A 3D59A 1HDEA 2XSZD 3QPAA 1FFGA 1Z2AA 1M8FA 1QXSA 3D8HA 5E2AA 4URFA 4TTVA 3L0IB 1Y8CA 5BYAA 3L7OA 4FD3A 4BV8A 5HX7A 2X15A 4QECA 4EJSB 2C7QA 1JUDA 2AEMA 1VYUA 2GS9A 4PLZA 4JVLA 4FD2A 2FH5B 1VL8A 5M34A 3RC9A 2IYVA 3QF4A 1TJPB 1GOTA 3H11A 3Q7RA 1FU7A 4F86A 5B3KA 3TQTA 2JVKA 5LL6P 4XQEA 1XEXB 3QVUA 4PTYA 4PS1A 5JSUA 1YVUA 1L6IA 4Z4TA 3ZKAA 4E0BA 2JIOA 2NV0A 2QX6A 4V0OA 1LNQA 5DX8A 1FVFA 2CGEA 2W9XA 3MT8A 4TWIA 3BE4A 4B79A 3PL1A 3ZGLA 5A0FA 3QLJA 3NHUA 3MZ0A 4RDIA 2NTJA 1FXUA 1FEZA 4GBJA 1GPAA 4KSYA 1LDYA 4CLOA 2VJBA 5EPOA 4W5NA 2UZ1A 4UNIA 1KBZA 2IDKA 2IPMA 3JAWA 4OA8A 4OAQA 5B53A 3SAJA 1BWRA 1R5JA 3A6EA 16PKA 2NUAB 2XE8A 4CT0A 1ZX1A 5H59A 3VAAA 3I6YA 1BC5A 1XKLA 2OV1A 2EKLA 3FE2A 2J32A 3M9WA 3R6WA 2EYQA 4B32A 1L5FA 4XB2A 3H84A 4LVOA 4QVAA 2H31A 4HH3C 5MGBA 5AVTA 4GEGA 2XCSB 1CR4A 2C31A 2H11A 5TNXA 2UZ4A 3EW9A 1MMFB 3JD3A 1XAIA 4ASUD 1RJGA 1RJDA 2J7PA 2VK1A 1QFZA 1YV9A 2V4ZA 3T12A 3TSCA 3Q98A 4R9NA 4YECA 2PGOA 3K9BA 3PE3A 8ATCA 3FH0A 1OH8A 1XTIA 1XDDA 3E6AA 1HT3A 2PLWA 4Z8XA 4PX3A 4UREA 4DDWA 4P3IA 3T4UA 1XAHA 1UEXC 1E9FA 2CXQA 2EFDB 2QVXX 2W6ID 1A8IA 2C7RA 5FPPA 4B85A 1IHYA 1CPYA 1LPAB 1DXOA 2WV7A 3H9GA 5TQ0A 4ZCPA 4A5OA 3I34X 2FSHA 4JQSA 2FEAA 2P5SA 5KDLA 2DCUA 3QOFA 2YDYA 3K0FB 1YFLA 4FSHA 4DJEC 4EO9A 4C0KA 4MIKA 1XMQB 4E70A 2IK8A 2QU8A 2IGTA 4QPNA 5IJ9A 2WINI 1ZMRA 1W46A 2C95A 2DTXA 2VHYA 3AX6A 4G84A 4M55A 3CE9A 4NBRA 4WDRA 1Z2PX 4ALIA 4DQVA 2OAEA 5JYEA 1AM4D 1J33A 5HDQA 1RLTA 5HUHA 1BD3A 1Q14A 4TYMA 3G88A 1GZ6A 2I7VA 4OYRA 3ZBQA 1P62B 1ORRA 2P6NA 4F2DA 2A33A 1GGKA 4BXOA 3OEED 5K6TA 1DO2A 4Q4HA 1TD9A 1E7SA 3N53A 3EGXB 2XWSA 3F6PA 5KTRA 5COAA 1UPCA 2B1JA 4DK1A 4IZ6A 1Q1EA 2XXBA 5IAOA 4X9XA 5JNRA 3U3KA 4G8BA 4RPKA 3U6BA 5L7TA 1PW7A 2N75A 1JHPA 4XIYA 5H9VA 4EW1A 1KO1A 3GFVA 5GIOE 1DWQA 1OVGA 3FJYA 3UJAA 2JGFA 2O2DA 1R15A 2B25A 2B92A 3I76A 3BHJA 1EUZA 1TKRA 4NOLA 4CG2A 4IDOA 1E3SA 4Z3KA 5B3JA 1YR7A 1ZD5A 2HRCA 3EB9A 3WLLA 4B6JA 4JOBA 1YS9A 2XUKA 1L5NA 4ZGGA 3AUSA 5AN9A 1ZW6A 3OJCA 4A9AA 5AW6A 1P9WA 2YRFA 3GN1A 3A3KA 2VH5R 4UVIA 3GR6A 2D62A 3D81A 4P4GA 1H2FA 3AF0A 4X64B 1Z6ZA 1GGJA 1Z0ZA 4NV0A 1UOEA 3K32A 1PV1A 4DLRA 2XLBA 1A4RA 4UPVA 4ACAA 2O2JA 3BXPA 4XQFA 7MDHA 2WHYA 4HXEB 5LYYA 5K01A 3B89A 4V0RA 2DH5A 1I94B 1Z15A 2PT5A 1OZAA 3JARA 1L7VC 5E9WA 5KEIA 1CULC 3GLIA 5CNIA 1ZRHA 4BJ1A 3MF4A 1C1DA 4NENB 3EEYA 4B4OA 4LYHA 1RYDA 1UDXA 4B3DA 3RV4A 4XEUA 1I1HA 3KFXA 2Y0PA 3L0DA 1U5BB 3Q2IA 2ZR8A 1ULAA 2JIRA 1KZYC 4IDPA 3K53A 4FK8A 4GH5A 3N0VA 3SSNA 3HC7A 4GBED 1TK2A 1IN5A 1IEVA 1N8RD 5EJGA 1T9ZA 1P1RA 2RIRA 3NYRA 4JC8A 2FE4A 3W7VA 3W90A 4BFWA 4EFMA 5CVTA 3TRIA 4LZPA 3ROFA 5AM3A 4PNEA 1V16A 2AG6A 5CM9C