4B4DA

Crystal structure of fad-containing ferredoxin-nadp reductase from xanthomonas axonopodis pv. citri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
256
structure length
256
Chain Sequence
AFGAETVLEVRHWTDAYFSFTTTRDAGFRFENGQFVMIGLETETRPLLRAYSIASANWEEHLEFFSIKVPDGPLTSRLQHIQPGDKVLVGKKPTGTLLISDLHPGRNLYLLGTGTGLAPWLSIIKDPETYERFDKVILTQGVRFVQDLAYRDYFERELPQHEFLGDLLREKLLYYPAVTRETFANQGRLTELMADGRMQQTLGLPTLDPANDRFMICGSPQMLADLRSLLDSRGFQTSPRIGTPGHYVFERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Crystal Structure of Fad-Containing Ferredoxin- Nadp Reductase from Xanthomonas Axonopodis Pv. Citri
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri str. 306
molecule tags Oxidoreductase
total genus 81
structure length 256
sequence length 256
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4b4dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4b4dA02
1TTTA 4C0SA 2EIXA 1IJFA 2BGJA 4R71A 1EFTA 4DQLA 4ZV4A 1S0UA 2YWEA 1FNCA 3G71B 1KK0A 4U9UA 3QFSA 3AVUA 3WBKA 2QTLA 2B7BA 2BPOA 3QFTA 1DARA 2QMUA 3QFCA 4RD2A 3WNBA 5THXA 1YITB 3JQPA 1HA3A 3CCQB 3W2IA 4UAJA 2VNKA 4FN5A 3P26A 1EFCA 1FNBA 2D74A 1JJ2B 1E63A 3FJOA 1SM4A 2OK8A 4B48A 1QUEA 1BQEA 3CW2A 1VQMB 4ZGQB 1NJID 3MHPA 3U2QA 4Y9UA 3OZVA 3VMFA 3ZZUA 1IJEA 4AF7A 3LYUA 4TMXA 5KSWB 1VQ5B 1ZM9A 3PENA 1OB5A 3OZUA 3V76A 1TLLA 1D2EA 1OGJA 4M1KA 2XEXA 2C78A 4PC6A 1Q7YD 4B3XA 1CQXA 2BM1A 2ZITA 3J81k 5TR9A 2QEXB 3B82A 1E62A 1FRNA 3CC4B 5EMNA 4NCNA 2HDNB 1JNYA 1GR1A 1YJ9B 1QFJA 1JA0A 3AVTA 3CRZA 1R5OA 1XB2A 1DDIA 1D8TA 3AGPA 1YHQB 3U6KA 4LBWA 1F60A 1G7RA 3CCMB 2PIAA 4YAUA 2R6HA 1Q81D 1W35A 3A1FA 3MCAA 1K9MD 2QN6A 1QGZA 4YALA 3AVYA 1KC8D 1W87A 3CPWB 1W2BB 4N3GA 3ZBTA 1ZM3A 4P6VF 3U6BA 1VQ8B 1EXMA 2GQFA 1FRQA 1QGYA 2J7KA 3LVBA 4RJLA 3JQQA 2BF4A 3W5UA 1EWYA 1K73D 3W5HA 1KK3A 5H5JA 4B4DA 4DQKA 1A8PA 4PC2A 4QHYA 1VQOB 2HMAA 1Q82D 1VQ4B 1NDHA 5GV8A 5HXBA 2E1RA 2RC5A 3CC2B 2OK7A 1M1KD 3CCUB 1VQ6B 3AVWA 4G1VA 2VNHA 4P3YA 1BX1A 5JBQA 1UMKA 4ACBA 4C43A 3CCVB 2YWFA 5GV7A 2VNIA 4YAFA 3ZBUA 1OGIA 4TMWA 2OTJB 3E1YE 1DDGA 3OJWA 1GO2A 1ZUNB 4AF6A 4Y7CA 1D1NA 1KD1D 3E20A 3OJXA 3VNUA 1VQNB 3I1FA 4FK8A 1KK1A 1YJWB 1M90D 1AIPA 1H42A 1OB2A 1CNFA 4G5GA 3AGQA 4EH1A 1QVGB 4J0QA 3JQRA 3FPKA 2DERA 4N3NA 4ZCIA 1CNEA 4RCYA 1QVFB 2PLFA 1AMOA 4MYTA 2OTLB 4K1XA 3QFRA 1QFZA 1ELOA 1BX0A 1G7CA 2RC6A 4Q7JB 3VO1A 2GPJA 2DEUA 4TN1A 2YWHA 3OW2B 1XE1A 1G7TA 3VNVA 2XNJA 3CC7B 1N8RD 1FDRA 1W34A 3B8HA 4B47A 1GJRA 3G6EB 4HE5A 1VQKB 1G7SA 5AN9A 1VQ7B 1H85A 1SKQA 4YHBA 2VYQA 3G4SB 2QA4B 3MMPA 2AHOA 3CCSB 1QH0A 4M53A 5DSZA 4LBYA 3AVVA 4TMVA 4M0LA 2YWGA 4YAWA 4RD3A 1TUIA 1GAQA 3W2FA 3I56B 4PC1A 1KJZA 1ZM4A 1EP3B 2C77A 4G1BA 3CD6B 5TV2A 4PC7A 1R5BA 2PMDA 3LRXA 3W5VA 3CCEB 1IB0A 3ES9A 1JA1A 4AC9A 1KQSB 3LO8A 3WBJA 2B7CA 1YJNB 2QTZA 4YAOA 2BN4A 2HCJB 3W2GA 1EFUA 3WYAA 4HE6A 4LC0A 2EFGA 2NPFA 4B43A 3WY9A 1QGAA 2BM0A 2DY1A 1S72B 1EP2B 1E64A 1QG0A 4RD6A 4F7DA 1BJKA 1JB9A 4RCZA 4WQMA 1DG1G 1N0UA 4PC3A 3QSYA 1WDTA 3CCJB 1QX4A 4LBVA 1GVHA 4PGOA 3OZWA 1I7PA 1VQPB 4IW3B 1K8AD 3VO2A 3WNDA 4RD4A 2DETA 3QE2A 2XNCA 1KTVA 4QFMA 1QFYA 5H59A 2BSAA 3CMAB 4RD1A 3ZZTA 1TVCA 3SJZA 1EP1B 1B23P 3B78A 2B5OA 5FA6A 2BVNA 2BGIA 4ZGNB 3CXCB 4TMTA 3W2EA 3I55B 4B44A 1VQ9B 4ACAA 2QDXA 1N0VC 1YI2B 4LBZA 4Y9RA 1U2RA 2VZLA 3W2HA 4ZCLA 5TY0A 2FX3A 3WNCA 4FWTA 4RD0A 1FNMA 4H9GA 3WXMA 2DCUA 1VQLB 2VNJA 1F20A 4BPRA 2BV3A 1YIJB 4M4SA 2X3UA 4MYUA 1FNDA 3ZC3A 1Q86D 1B2RA 1GAWA 2CRVA 4M2LA 1KK2A 1QUFA 3P27A 1J9ZA 1ZM2A 3AVXA 2CNDA 3CCLB 1R5NA 1KRHA 4ZCMA 2BMWA 3CCRB 4NBSA 3CB4A 3ZZ0A 4TMZA 3CMEB
chains in the Genus database with same CATH superfamily
2CVOA 2Z4RA 5L8VA 4JEMA 4OHFA 1FE8A 1H5NA 1OX4A 2BEVB 1U0SY 1XHEA 1QAMA 16PKA 4ZCQA 4JQZA 1P2SA 4G5HA 3G9QA 4KFTA 4X61A 5LYJF 2FVYA 1UFOA 2JKVA 3LGSA 3U3JA 5ES4B 3BZUA 3ZDFA 5I7HA 4NOJA 3K6SA 5F1PA 2CDBA 2Q5CA 2XVXA 2ORWA 3GCXA 4BZPA 5A4AA 4I8XA 4NBKA 3ENVA 3UMGA 3WK4A 1T2AA 4V03A 5C7IO 1Z2OX 5E3IA 1AXRA 3RTEA 1ONNA 1QXSA 4YP5A 5BW5A 1JG7A 1A8SA 1RAIA 1TAGA 1EE2A 2CBGA 1SK8A 4E51A 1MIOB 3O0TA 4XL9A 4RIEA 3RKUA 2J9ZB 4B0OA 1E92A 4ZT3A 2P8SA 1GU1A 4AZ3B 3DP7A 1JHDA 2A5DA 4NCBA 5BRJA 1U2SA 1WQ4A 1I1HA 5F5NA 4BNVA 1XAHA 3O7MA 1AOXA 5BMVF 1G66A 1L8XA 1MZVA 1KPIA 1XSEA 2HCTA 5JRZA 2CJYA 4BXOB 2X5NA 1BGVA 1U0JA 3FVTA 1U5BA 2ZJ8A 3GL9A 4B3BA 1A4RA 4Q12A 4Z4HA 2SNIE 5J1SB 2Z2IA 1JMYA 4U4AA 1JJ2B 3IAS6 4EHHA 5K99A 1E6EA 4QQRA 2QRVA 5LA6F 1MC8A 4QSHA 4PPGA 4HN4B 3G2LA 2FW1A 3JR3A 3NORA 5F73A 5FUWA 3X44A 1YC2A 2QSUA 2WWXA 4QBKA 2PD3A 1PWHA 3FPCA 3CVWA 3HB4X 1TO6A 2BJVA 2P5TB 3AJ9A 3BEOA 3CPJB 2RB4A 2H29A 3N8KA 3LAWA 621PA 5JZ9A 4ZGQB 4NATA 4V0SA 3GRFA 4LE0A 4RK5A 5LPNA 1VECA 1N08A 1W73A 1G4AE 3MRSA 2C4TA 2PWZA 2GF0A 3R5TA 5ES3A 2BEVA 3D4LA 4FNMA 2I1LA 5FRDA 5DNUA 1FZTA 3MELA 1E0KA 1GD1O 3QM1A 4ZJPA 2ZRIA 4EDHA 1Z75A 2BDTA 2GJSA 2YIJA 4OJYA 3UXHA 2FEWB 3WBFA 1I30A 1JSCA 4AN4A 4QYSA 3PQ6A 1Y8CA 3MWFA 1B41A 3KDSE 5AM0A 2QW0X 4NARA 4PE5B 1RKVA 1RE0A 3QBJA 1I18A 3TUZC 4HDQB 1ENZA 2DPHA 3EGXB 5A9RA 4MPPA 4RSHA 1E4EB 3OLWA 2OG1A 4Q3BA 5DMHA 1ESNA 2O8DA 4H7KA 3OF3A 3PENA 4LMAA 2XF8A 1XRLA 3FI9A 2WIJA 3K0EA 3OZUA 1OFGA 2D7CA 3LZDA 3NHFA 4LOAA 3R23A 3D6VA 3OCCA 5E7IA 1QMGA 2DR3A 2H63A 3K35A 3TNFA 5LJIA 1QOPB 4UUMA 2ZIFA 3MUFA 4IPTA 4ZOLA 4BGEA 4FDTA 3RBZA 1YK0A 1IG3A 5F7OA 1UP6A 3H18A 4M8SA 4MWBA 5BV7A 4EY8A 1IG0A 3M5CA 1YB6A 3LFUA 4KRGA 5JS6A 4M9CA 5F3WB 2BFDA 4XCQA 1BVYF 2DKOA 3E53A 3HFGA 3MWKA 3ASQA 5D3KA 2J7PD 3NTXA 2RGUA 1J2JA 1QYXA 1B0PA 3Q1LA 4LVNA 4YYZA 3FCXA 1E6LA 1HO3A 1J0XO 1WMBA 2BC9A 2ZSAA 3GH1A 2ATCA 2NW6A 3EIFA 1T8SA 1EVIA 1G2OA 1H9AA 2QQGA 3A7EA 3P52A 4JJ6A 4N0EA 4U2EA 1FFSA 2HH9A 4Q39A 4YLYA 1OXXK 4KXWA 1LWOA 4PQGA 2WTXA 3KOUA 1X1EA 1RWOA 2NXNA 5DBFA 5BSKA 2P77A 3M6LA 2XR1A 4BFVA 1T0IA 1VL1A 4RH1A 4MB0A 4LF4B 3KTDA 3VSAA 5LOVB 1DDIA 3UWKA 1HDOA 4TKZA 3TG2A 4PLYA 1PZGA 3U6KA 3PNMA 1ULZA 1G7RA 3K5WA 4ZGWA 2W58A 1Q12A 1N2JA 2ECPA 3AR2A 3QF7A 4WBXC 1CZNA 2WT4A 1QF7A 5CG2A 2OCLA 1CRPA 3MLBA 5IVDA 2XYQA 1CUAA 2B34A 2PX2A 4M36A 4Y3UA 4QJIA 3AVYA 3IPXA 4HO1X 1GKUB 4MQ6A 4FCWA 2XOKD 4YJ2F 1DBSA 3DMTC 1DDOA 1JLRA 2X7JA 3VPDA 3LCRA 1ZYUA 2DJIA 2I62A 3ANMA 3JY6A 4C6SA 4F5ZA 4G23A 4PRLA 1EZ4A 3THWA 3K3PA 4QUAA 3OQ1A 2WSYB 3DDWA 3P96A 1KE1A 2PZBA 3AUFA 5FTKA 2CVPA 5EN4A 1XZBA 1SURA 4LX8A 1SD1A 3CSSA 2BF4A 1N2CB 1ZGJA 2PEZA 1KMNA 4B7ZA 2XUGA 2HFJA 2B9VA 5BSYA 1DAMA 5DF1A 5IDVA 5LB2A 4B6JA 1PO7A 4WLFA 4JI3B 1DO8A 2Q3MA 2QD5A 5DLPA 3S70A 3GI1A 1SCUB 1R0WA 3B1WA 4QTYA 2AOXA 3HGMA 2Z56A 3LXUX 2Z2YA 4EY5A 2V9CA 4DJEC 3AIMA 3ICCA 2BFBA 3GLHE 3INNA 1BDIA 3K16A 2EJUA 1XD2B 1VJTA 2PTHA 2QZ4A 2C7VA 4KQIA 4XB1A 1ZSYA 3RVDA 4BKUA 4GSYA 4DJAA 3LVFO 4I4CA 4YJGB 1ULUA 2HUPA 4KVGA 3HEMA 1W36B 4PFJA 2PTGA 4O25A 4GI7A 3PL5A 3LUFA 3C3EA 1ZMRA 3FAZA 1KVTA 2COUA 1W48A 2TMGA 2FKNA 3AUTA 4BL5A 1QYCA 2ERXA 3UWMA 1SKYE 4DL9A 5LM3A 1VSBA 2R1TB 2DFKB 4CL8A 5IYPA 3W3AA 2FQ1A 4R40A 5LOVA 1XPRA 3RQSA 4J4HA 4D80A 3BXFA 3H3XA 5JNRA 4WDRA 1IHYA 1NN1A 4MX8A 2CT8A 4IXDA 2HIGA 5AK5A 5CAEB 3T7JA 4EQZA 3AKEA 3MTEA 3QITA 4B80A 1BX1A 4KMOA 1AC5A 3G8DA 2BMFA 1UMKA 4IV0A 4ZU1X 5TGTA 1CK4A 2XMQA 5LDHA 2YWFA 4PIVA 3I3OA 4O1MA 1L5ZA 4R8VA 3NT5A 4ND2A 5AOVA 3P45A 5HQTA 2QT1A 2IVZA 4JFRA 4C0XA 3LFTA 3VISA 2VTBB 4CMAA 2XNHA 1JXAA 4E5VA 1YFKA 4XLFA 3NOVA 4JH0A 1HE2A 4B31A 4EB0A 1SUPA 4LE1A 2OTJB 2EKLA 2XGMA 5K3DA 3P4XA 5A2GA 4I9HA 3TDMA 2R1VA 1KH1A 1PUJA 3QG1A 2PG3A 4RVCA 1IY8A 4DIKA 1N2CA 2C4UA 3DEIA 4X94A 4YCAA 3SZMA 2GD1O 4JBIA 2DJ5A 1QYVA 4P26A 3I76A 3LDAA 2GREA 3M49A 1R0ZA 1N7GA 2O7SA 2OL4A 4QOFA 1NQWA 1SVLA 4LDAA 2WJ6A 4O2BA 4XASA 5JJCA 5KQGA 4U7TB 4FUTA 3RFUA 2WB2A 1CNFA 2WF5A 2MU1A 2CV2A 5GZ6A 4IFIA 3JV7A 1HMPA 3F5FA 3JASA 4YT8A 2CMDA 4IXMA 3D0QA 4L9AA 1CRWG 3AF1A 2E49A 4YMHA 1FK8A 1PQUA 1U2QA 3NWJA 1GGEA 3HBJA 4C4TA 3W5DA 1XDZA 3GPDG 1DBPA 2IYYA 3QVLA 4KLAA 1XEXB 2W2KB 3UA3A 3GUUA 1EVKA 2JGJA 3HBMA 2IWRA 1QTNA 5KQMA 2WTNA 2IP4A 2NU9B 1SVKA 3TBFA 4BX0A 1X19A 2J3KA 2FYTA 1AGRA 4PSCA 2QNRA 3G17A 1AMOA 3JQDA 3QKTA 4MKIA 4RWEA 4XFDA 1LVUA 3DM9B 4TGLA 4GR5A 4YROA 3H5VA 4HB0A 1P0QA 1Q0LA 2OEPA 3AZPA 3R3WA 2QVZX 1KYXA 1U7WA 3WWDA 4HNUA 4TN1A 1GITA 1NFFA 4XM3A 2WM3A 4UQOA 1EB8A 3F4LA 1XVLA 4OQDA 3EISA 3LLSA 1V95A 4HNSA 1X7XB 3KKZA 1DBIA 5AWFC 1XXHA 5EJ2A 1VB3A 4N4AA 1XZNA 2BM9A 2QR2A 3CLTD 1M3SA 4DNQA 3E35A 2PSHA 2QX4A 4MWZA 3ZZNA 1PAUA 2YYZA 2HEIA 4ABTA 2JPDA 3FFBA 3D4NA 2VHYA 4C04A 4QDZA 4FE4A 2O1XA 1L6RA 3HJUA 4MUHA 1KQ3A 3TZLA 4U2CA 4NNJA 1KDOA 2ZULA 1I5RA 3EYWA 3OOYA 1CJCA 4KV9A 4N5NA 1T3LA 4NBLA 5AK6A 3TTXA 3STUA 1UBMS 2IS4A 1VHQA 1KYQA 1GLVA 1X7GA 1Y82A 3L18A 3LWBA 3HGQA 4WUTA 2UUBB 4PS0A 1DOAA 2HRDA 1YDWA 3JYPA 1NLZA 4QBFA 4WEQA 5K0GA 3EPHA 1WTAA 4OI2A 3DW1X 4E2WA 2C5LA 5JFOA 4NXMB 3LMKA 2IYEA 4NJEB 1KIMA 3CRMA 1L4FA 3FWPA 3HVUA 4IL5A 3BE6A 3H2JA 2VZ8A 1W0CA 1XZFA 1Y33E 4JXKA 3KNZA 3GBVA 3ZQ4A 1XEXA 1U3CA 2VJOA 1KGDA 2GCEA 1CZRA 2OM6A 1S2OA 3M1YA 3ITDA 3CU5A 4LJ5A 2O3UA 3EVEA 5I7EA 4DTIA 1WZUA 3K2EA 2MYNA 3UTCA 1PD1A 4EG4A 4K9DA 3M5PA 2VQFB 1FPQA 1UAGA 3J7AC 3OOEA 2WV9A 1J06A 1WETA 1J56A 2H16A 3P0HA 1ODLA 3Q0TA 3TE6A 2Y6UA 1SXPA 2AKYA 2HR1A 1K0FA 5FUVA 3A4VA 4MCHA 2BMVA 2IOHA 3IP3A 3NJ4A 3HCEA 4TXJA 3QVWA 4GGPA 5ELLA 3TSOA 3WR5A 4B4VA 3SXUB 2WYVA 5CA1B 3AOGA 1JPVA 1X13A 4B84A 1NVVQ 4L8GA 3B3AA 4LF8B 3NIBA 1S2LA 1GCAA 5B7PA 4XJVA 3TRDA 1T9HA 1BTOA 3AESA 4R6XA 1DFGA 4WE3A 3BD8A 5L7YA 3ZY3A 3A28A 2F00A 2X9NA 1W6UA 3CCEB 3FM9A 4OBBA 4DR3B 2JFYA 5EIBC 3RJZA 5JZBA 4OPVA 3MYRA 1A69A 4TOIA 2OWDA 4OUKX 3WFJA 3FNRA 3DAHA 3O6VA 4LEIA 5F9MA 3SQLA 4Y2JA 3KTAB 1SXJA 1WDWB 2XD9A 4YMSA 3Q38A 3CW9A 1LI7A 1MU0A 4MPTA 3RYIB 4CM4B 1T5DX 1TM5E 1KJQA 2Y0CA 3AVOA 1CT9A 3JQFA 3O8OB 1L1FA 3RVMA 1TMOA 3T3PB 1E7MA 3TLMA 3BTUA 4HE6A 2JFUA 2WLTA 5A7FA 1J99A 1EFPB 5EJ9A 1K9VF 1TYAE 1NC1A 1OBVA 1W4AA 1DBRA 1U1EA 2G07A 4KW7A 5JJLA 1X9IA 4TMYA 5LLDA 1VJ5A 1I6KA 3AUUA 5E8RA 4XH9B 2JIQA 1V2GA 5K1ZA 3RK0A 1EXDA 4O5OA 1E9DA 2XCQA 1D8AA 1TMGE 3BPSA 3M9LA 3V9AA 5IK2D 2XNSA 3I9OA 1KA9H 1P1HA 1A5BB 3NJRA 4B79A 4EB3A 1YONA 3ABOB 3OZRA 5LMCA 3BKXA 5F9HA 2XQFA 2MDTA 5TSDA 1S96A 2JIRA 1U7OA 2JCYA 5GONB 4KYTA 2TSYB 4OPSA 4Q6BA 5DXJA 4IXWA 3DV9A 2DBVO 2EKZA 4G81A 4RD4A 2YW2A 4WECA 5JZVA 2Q5FA 2OAGA 4YLGA 3UGKA 3W4KA 4JJGA 5JMOA 1DT5A 3IAAA 1J5XA 3GCGA 4Y9SA 3I58A 4FOSA 1Z0DA 1ZCBA 2RG7A 2QRGA 1TI7A 4XZ3A 1U28C 3H5IA 1XG5A 5JAQA 1CP3A 5IS2A 3QVKA 1ZJYA 4TYYA 2Q5HA 2GTIA 4LVOA 1DGQA 2E4VA 1FFCA 3L4EA 2R8BA 3N8NA 4BO8A 1Q11A 1Y98A 2UDPA 2Y68A 1XX6A 3TZBA 3H2HA 1C9NA 2GWRA 1V3TA 4BNHA 3ADKA 1T9ZA 5KTSA 1SBCA 2GZHA 4K81B 1IVYA 4YUVA 1KQOA 4MHSA 2NNWB 2GARA 3P9PA 2HMTA 4TMTA 1VL8A 4IWXA 1V5VA 4CCYB 1K92A 3AR3A 3L02A 3KTAA 2ZAMA 3PNVA 3NS7A 3WJAA 2JLVA 4GG1A 3PT9A 4Z7OB 1DQZA 3JAWB 4ZCLA 4C2TA 4FYYA 5G4LA 5KNDD 3U4AA 3TKAA 1VZ2A 4M22A 5BN4A 1EFPA 3LKVA 3B70A 4IDCA 4OLAA 5HKKA 5JEEA 4Z2YA 5JIBA 1H0SA 1WHTB 4P3OA 3T7CA 4D4LA 2BGMA 2JGEA 3BWCA 3W77A 4F71A 2F1OA 1JG2A 1NI4A 1JR3D 4CPDA 2BF7A 3E9RA 3GPLA 4K0KB 1HI9A 4UU0A 1QGUB 4E1VA 3H1EA 1U4OA 1R66A 2C3OA 1SB9A 1P1KA 5F21A 2EG5A 3IOBA 2APJA 4X06A 3PEEA 1Y5LA 3ROPA 3PPYA 5ALHA 1II8A 1B16A 3W9SA 1PWXA 3KAPA 5GONA 5IHXA 4KBFA 5BW6B 3VZQA 1X1QA 4PPQA 1ZEJA 2QTFA 4G26A 4MR8A 2C9BA 1HR0B 3RSCA 5J4YA 5FV7A 3HXQA 3Q8KA 4KXXA 4BDTA 1A1SA 1TAHA 1XIVA 2A59A 2CNDA 4NZ9A 3M1LA 2WU0A 2PUWA 3A4TA 3BHJA 4MYCA 3WIEA 4LAFA 3GLFE 1PSWA 4ZVLA 4DTCA 4UMEA 2ZM6B 1KHHA 2FQQA 4F96A 3TLJA 1M33A 2L42A 3VX3A 1Z83A 1Z8FA 2FWBA 2P3LA 3ED5A 4BO5A 5IEBA 3SEZA 3DE2X 3FPAA 2K2QB 3GLTA 4UXJA 5EP3A 3VNBA 3GC6A 4EY6A 5LWQA 2BFMA 3BSSA 1W93A 2FQYA 2O06A 1K98A 3E5RA 1VPWA 2R7NA 1V7ZA 4LPSA 1WOSA 2P2YA 1FNCA 4LDJA 2HI0A 1XROA 3T3HA 3G71B 3A3NA 3KYIB 2DX7A 2QIPA 4JUCA 3KU4A 3IR7A 3DTYA 2KBFA 3QNUA 1GFWA 4L22A 4P81A 4ZIRB 3CVUA 3AVUA 3LTEA 1N3BA 5CCDA 2LRHA 3HSKA 4QPNA 3OMWA 1I94B 2BPOA 1IUKA 3N2KA 3R09A 4XUEA 4BECA 1BSVA 5DM0A 2DHCA 2JFZA 4G8DA 4BVKA 1PCXA 1BC5A 3WL8A 1A9RA 2QTWB 2XJ9A 1PT7A 1PNQA 2CSXA 1I7SB 4A8JC 3E05A 2V7QD 3MJFA 1BE6A 3RSFA 2RFLA 4JUFA 1QX3A 1N2BA 2R7AA 2R5NA 1HQCA 3REOA 5AOCA 2D2EA 1Y0RA 1NVXQ 1W4ZA 2JJ2A 1USVA 3D5QA 3PS9A 2J9YB 5SY9A 3P26A 1WBDA 1J6UA 1XPJA 4BQRA 1VLYA 2D1YA 4PX9A 1BMFD 1BOFA 5IT5A 3BYZA 3EWAA 5JUWA 5J9FA 2J0EA 4B6RA 2MYUA 3PEVA 4HX9A 4UULA 5IABA 1QU2A 4DVGA 3AM3A 2P69A 3C5EA 3EIQA 3EIXA 4NBUA 3KWLA 1IBSA 1L5WA 2PGXA 1Q6YA 1U2EA 1UDCA 2XGSA 1VHJA 3TRFA 2XB9A 1JSLA 1XRRA 1Z18A 3GNLA 1Z74A 2OWEA 1H6BA 1C30A 1RXYA 3R5FA 4HH1A 4HTAA 2BRUC 2A5FA 1XFAA 4EGQA 1XXLA 4WBNF 1P0IA 1I1NA 2JI6A 4ZICA 1MD9A 1OLSA 4G0YA 4XCXA 2HQOA 4EMTA 4WGFA 2V1XA 3TZEA 4IQ4A 4BX8A 1J00A 1LBSA 1KSJA 2W42A 3NBXX 1OF1A 4PF1A 3CFYA 2X5JO 1P7ZA 4OA8A 4Z5XA 3VMFA 4L5CA 3LYUA 1BW9A 4TMXA 2EEZA 5B37A 3TLAA 4B33A 4KR2A 4WLUA 4D9FA 3RTCA 4NFYA 1Y4DE 3H11B 2G8LA 3OIDA 2W00A 5K5EA 2D9RA 4MS4A 4E46A 1D2CA 2G8NA 2WHEA 1YX2A 2GK7A 4P7JA 4ZIRA 1O95D 4R1QA 4RM0A 3T1OA 4F1JA 1VHDA 1Y7TA 3C6ZA 1PEDA 2QPAA 2WE8A 4X6YA 1K3FA 3KM0A 4D8WA 2I3AA 2JVIA 4E07A 4F8YA 2ZCJA 4JI4B 1ZO8A 3LRTA 2HK7A 4QV2A 1ZM7A 3ZWBA 4F9GA 2VJIA 1AU9A 1Y1SA 1XAIA 5KJ1A 2C78A 4IDOA 4MR7B 1YFLA 2GI4A 3GGCA 4B3XA 2IOQA 1CB0A 5HKOA 1QCYA 1EGMB 1ZLXA 3R3UA 5AKEA 3LQQA 1TD1A 1NP3A 1PZHA 4Z7JA 2H4ZA 2YHBA 1VE7A 3E9CA 5KNCD 1Z4JA 1VIAA 5DCUA 4IM7A 3VH4A 1E3WA 4J0KA 4G63A 2FK7A 4JA2A 4RA6B 1VE9A 5F4BA 1Z16A 2J3MA 1NONA 1D2HA 4WADA 3SHTA 3PPVA 4ZYWA 2WZNA 3T0IA 1T6ZA 1FVHA 2L17A 2EGHA 2YUTA 4R41A 2HMYB 3ZTTA 2RJOA 5AVUA 4R1MA 3KQNA 2C7PA 3OCUA 4J49A 1VYUA 4OOFA 6ABPA 1EWVA 2CFIA 2QA5A 2IE0A 3HVRA 5IAGA 3RC2A 4CI9A 3WB2A 2LW7A 3TI9A 4MSUA 4YAUA 2JH8A 2FRDA 2PD6A 1VSVA 4JC0A 4MYRA 3K72B 1W35A 4NBNA 4FR0A 3TUJC 3RS9A 3GWGA 4YALA 4J16A 1ZKDA 3LOPA 4QEDA 4AK9A 1OYOA 4D6PA 1XNGA 3E7WA 3BKWA 5JS1A 4NQZA 4ZEVA 5HF6A 3VR1A 2ZJ3A 8LDHA 2VA9A 4PYLA 3PLNA 5I7RA 2FWAA 2Z58A 5L3ZA 1X8JA 4QTUB 4CIXA 5EGNA 3BZWA 1N34B 3WYGA 4N3GA 2WJYA 1NOKA 2G0NA 1ENOA 3ONNA 1GPLA 5MFPA 1I4EB 2BTQA 2GXSA 5D5HA 4N18A 3QYAA 1IY0A 3O31A 1FRQA 4BNTA 3L1IA 5CXSA 3BWVA 4RH3A 5IYRA 4ZK2A 3L4BA 3RJ9A 3HZZA 1GG9A 3FF4A 4EL5A 3NC4A 1FXWA 4DC1A 1M6YA 3W5HA 1KK3A 3L6EA 1E9CA 4EB6B 1MN6A 2RGXA 3U17A 1S8OA 5CFZA 2W93A 2WJGA 5H5JA 1V9SA 3C14C 1V4VA 3DVRX 1KO4A 1P44A 3R5SA 5EKTA 1VDZA 4RKFA 3SSAA 4B4DA 3TIGA 1ADCA 3BMOB 1A8PA 1ND6A 3K1YA 1GNTA 1T4BA 3U0VA 4B6GA 4JT8A 1WZNA 4FX2A 1R0CA 3OIYA 2YHAA 1BEZA 1FEZA 2VRNA 4HH0A 4QFCA 3QKUA 4KSBA 3ZGXA 1W0JA 1OJLA 2P27A 4BE7B 2OQVA 1KKMA 5HXBA 2IX9A 2OXRA 3AJDA 2W5UA 1HZZA 3BRWD 4PCUA 2A0XA 3CC2B 1QTRA 4YUZA 1ZJWA 2FLWA 5TB5A 3ZD6A 2EG9A 5JANA 2WYUA 3EQ9A 3IVMA 1OA1A 4CT5A 4PCLA 4JAVC 5JS8A 4LV5B 4FFBA 2HU7A 3BQNB 1MA0A 4F2PA 5K0CA 4UPDA 2QWXA 1H2WA 1XK7A 2DLDA 3L0OA 1M6VA 3MXOA 4Q16A 4UEWA 1X8LA 4G1EB 1JSXA 5BUSA 3CCVB 4O5AA 3ROGA 4B7CA 1N6HA 4YO7A 3VDMA 1HYQA 3JD4A 4P38A 2Y1XA 1P3JA 2O5CA 3QTTA 5GV7A 3IAXA 1AX9A 2OM2A 4IDPA 4QQ8A 4Y6SA 1KOGA 3Q98A 1NLUA 2AHRA 5BURA 3ZH2A 2XA1A 2VCYA 3DL4A 3EPJA 1XPOA 4BE4A 2QM8A 1DIOB 3WLEA 2WOJA 4LJSA 3PWZA 3U39A 2ZSIA 2AOUB 4Q48A 3M2TA 1AKUA 5IP5A 3O95A 1E6MA 2PPVA 3CTAA 1JDVA 4LFAB 4X3OA 4BFZA 3TDNA 2IXDA 1QV6A 2PR2A 3K8QA 3H2YA 3ABZA 3P0EA 3QKSA 5T6MA 2WWYA 2VBTA 3R5HA 2ZCUA 1MX1A 4I5GA 4KE9A 4F3YA 5AJHA 1VQNB 3UATA 2HLDD 1KOFA 3TQHA 3G5UA 3DZHA 4DIEA 2X14A 1WVMA 2QG4A 3VTFA 2RGDA 1FYXA 2ZB2A 1XEAA 1AZSC 3O3NB 4EGFA 5T3UA 1XKXA 3RYFA 2D6FA 3C45A 1BGWA 4RTRA 4KKUA 4JJKA 4D25A 1S1CA 2C3MA 4KX5A 5NULA 3O26A 4WCVA 5KYUB 1UD2A 2UZ4A 1ZWKA 2FEMA 5U9CA 4R16A 2Y3IA 2J67A 3LVRE 3PEUA 1YE3A 1SU8A 3TBHA 2X4DA 2GJAA 4BC0A 2J45A 7MDHA 1ID1A 1NMEA 3W4JA 3EOAI 1ISFA 4M9XA 5HDBB 2WILA 5K7SA 2AEJA 4C2BA 4RCYA 1AS0A 1U8CB 2FI1A 2D0DA 4L76A 4MP3A 4YWJA 5K6AC 2ATVA 3IAUA 4GICA 2B1QA 2GFHA 5CX4A 2OTLB 3OEWA 3UPDA 4HYYA 3UH0A 4S1WA 3K70D 4DNFA 3W8RA 2R62A 2J9FA 3EXG1 1WCIB 1SHJA 3WNQA 2J6IA 4Z4UA 1F1JA 4IUBS 4WAUA 3R9KA 1RHQA 3IESA 1M8JA 2AF3C 2AVNA 4KNYA 1ZHFA 2GXUA 2QR3A 3P0JA 4HB3A 4HWGA 2FZ4A 1B3RA 4I1IA 3DC7A 4IQGA 3THXB 4QOHA 4E12A 4OMCA 3R7DA 4E22A 1PGJA 1EWRA 4GVPA 3NBKA 2GGSA 3V4PB 4V0KA 2NM0A 3JWPA 3OZAA 3ZIAD 2AOUA 1NPYA 5BORA 1QK3A 1I3NA 2QE6A 5CMLA 2PKQO 3T38A 3WKDA 3WRYC 1QP0A 2R8PA 4K88A 3CUWA 3FYUC 1NAHA 3K70C 2VJYA 2BZGA 2V96A 2ZYHA 3PE3A 3PRHA 5KNDH 1BE1A 1W76A 1XTBA 3TNYA 1H85A 2CJPA 3RAFC 2HWUA 1QM5A 2IP2A 1ETHA 1FMLA 3RVPA 4TS4A 3HKEB 4KODA 2CW5A 1CVLA 1ICEA 2DOGA 2BYTA 3TTWA 1J42A 4W99A 4P0PB 2O54A 1UD3A 4Y6GB 5C18A 1PL6A 1SKUA 2WUWE 4ZFNA 2I2DA 3OZBA 2J9XB 1X7ZB 4C5BA 3DBIA 1MH9A 4EA9A 1Y8RA 3NM5A 2IX3A 4O63O 1GCUA 1P2BA 1DIBA 2WJPA 1HVXA 3HB0A 4NK4A 4TQ9A 3UH1A 1D2GA 2C0CA 1WU8A 1NW4A 2HLNA 2AH5A 2J4CA 3II6X 3PTLA 1K4KA 4G0PA 3GFGA 4IDQA 5C8DA 2BOVA 4CM1A 4Z4WA 3IHWA 5C0OE 4AX4A 2JA2A 1GPDG 4GF5A 3MN1A 3D1VA 3VUFA 3RFXA 5IFLA 4ZI7B 2CV0A 1XOIA 3C3PA 3ANSA 1UD6A 3PDUA 4LIPD 4NS1A 4UKDA 2ONJA 2EX1A 1B8PA 2Q5LA 1FJ2A 1ZXXA 3EXIB 4LI0A 3LGAA 4REOA 1ZM4A 1MC5A 3C6YA 1T4GA 1V11A 3LCVB 2IHJA 3AU9A 4CMCA 3THXA 1Q2XA 3GJ5A 4WOJA 4XJXA 4TT8A 3KYCA 5FOVA 2HJRA 3FVWA 5HBGA 3EGCA 2BEWB 2NU8A 3STHA 4Q1AA 3MD0A 2J3JA 4C7OB 2UXDB 1R5BA 3EAQA 4XLTA 2DLCX 5J2UF 3ZW7A 4J1TC 3SXJA 4GI2A 4KQ2A 1HT0A 3AUKA 3IMCA 3KCNA 4YX9A 4LJ4A 4CDGA 5JS7A 2GEUA 2R00C 1CUSA 1XD8A 4H6XA 2YVKA 4E5UA 2DSTA 4I19A 1RIFA 3WBJA 1XTVA 1E3MA 3EFHA 2I2CA 2PGIA 1JKMA 3LHFA 5A9SB 4HADA 4ZAZA 2IYLD 5JPIA 3S28A 2JVKA 2XIJA 4J2HA 3V34A 4DMHA 5BV8A 5JRJA 3DZDA 5E1DA 2VDQB 1JHRA 3NBFA 4DDUA 3RANA 3BCHA 2AEFA 3PGJA 5BN3A 1O0CA 3C1AA 2ORED 5JD5A 1E5DA 4RCZA 2ZYSA 2PO7A 4F06A 2VSNA 3R9XB 3MOGA 1NMYA 2JFOA 4HNAB 5IT0A 1ZR4A 4QXPA 4RFSB 4B75A 1LC0A 2V9PA 5IYZA 5EJMA 1OROA 1U8ZA 3CZ9A 3AO0B 5FUXA 1ICIA 1BXGA 2EW8A 3KCQA 4D4JA 3BXPA 2HMWA 4DNOA 3NTRA 4MI3A 2I0FA 1OMOA 5AW1A 1J7KA 3D6FA 4PX2A 3CB2A 1DAIA 1RS0A 4N39A 4CM7A 1EXWA 4UUQA 1HBJA 3H04A 1VIYA 2Z9CA 4L3VA 5ALFA 1PR3A 3IP7A 5KYYB 1TA0A 3R3HA 3ON5A 2AZ4A 3QELB 1RYNA 3LCJA 2B5WA 4M7OA 1UK7A 4YRNA 5CLFA 4KUGA 1JH9A 3ZGNA 1ULBA 2CKMA 4II3A 3E7DA 3DCYA 1N5MA 4YRRA 2OXIA 3ZZTA 5GWXA 2X7HA 3L06A 5B4TA 2O48X 4CR8A 5TS3A 4I55F 2CE7A 4HIZA 4JYZA 1JTEA 2C5BA 3C8MA 4U7JA 4JZKA 4Q3NA 4WT7A 4AMGA 5KCZA 2EHDA 2NXJA 3IP5A 1OC4A 2XDQA 5JAHA 5ICMA 3OMLA 3A36A 3A6EA 4WNCA 1CVIA 4E94A 5AUOB 3D6NB 4U7GA 1Z68A 3K2BA 2XCRB 1FNSA 1KNQA 2FHSA 3N2GA 4TLLB 5EXPA 4ND6A 3N0TA 3WWOA 3W2HA 1GEGA 4U1RA 3B9PA 1LDYA 2Q7OE 5CLLA 1PF7E 821PA 2Z4SA 3B52X 3FR8A 5HKAA 2MYPA 4FJ0A 3FCAA 4HUQB 3CNHA 1BU8A 3DQZA 2WFAA 3V4VB 1IOZA 1GUDA 1NDUA 3P2YA 3RTGA 2OHVA 5CB8A 2IYRA 4LYFA 1G5PA 5KNCH 1NX9A 4NONA 4RFSA 2CLOB 5LP6C 3U4QB 4GFDA 1JHOA 2GSDA 4HUJA 5DXAA 3UUGA 4AWAA 4DB4A 3R6WA 5TQ2B 3QA9A 3GT4A 4RESA 2IV2X 4EG8A 3UUFA 3EH2A 1FVOA 4WFIA 2PQ6A 3DGFC 2GPBA 4YIHA 1XTZA 1X8KA 3FGNA 3IUPA 5ISMA 2FPUA 2FN8A 3D8RA 5KTRA 1G291 2WYOA 2NSJA 3HJNA 3I1JA 1OC2A 2RK6A 3ETGA 3QELA 1ZVKA 3DAOA 2VHUA 3Q85A 4OYLA 1DTWB 4UHEA 2PX5A 1UMBA 4ITVA 2PANA 3WLFA 2VJPA 1ZH2A 3I9MA 4Z9XA 1EG2A 3HCPA 3MSXA 3JTMA 4C0KA 3PXAA 5HF5A 3W9YA 3TAHA 1Q83A 5IRCD 1J2RA 1G9TA 4GZ3A 4MWGA 4W8GA 1FYWA 3JQBC 1C9JA 1P9LA 2B7LA 2GVDC 2HRRA 1GUZA 1RFLA 2I33A 2I1WA 2XCLA 2ZT5A 3C74A 3JD0A 3NI2A 3NT4A 3OMXA 4HX5A 4DCUA 2YC4C 2WMNB 5LVAA 1MQ8B 3IKVA 3A1WA 4KZPA 4I8IA 4ESVA 1QGOA 2HSWA 3RU9A 3ZK9A 4O4IF 1Y5MA 4HDKA 4IOMA 2NUPB 3UPUA 3C3MA 4B7AA 2QTLA 4JBYA 1CUIA 3WYNA 2Y27A 4H0FA 5FTJA 4M1ZA 5CT6A 2O5EA 3IAM1 1YS9A 2PQMA 3H1TA 4YRPA 3C97A 5L53A 5CNKA 1CEXA 1RI5A 3BDVA 3PNKA 4HXEB 4PWYA 3KXIA 4AMZA 4GLFA 4NENA 5E4JA 4BMVA 3NYIA 3LF1A 3LUDA 3OTQA 4BFWA 4F4FA 6Q21A 1P1IA 1I9CA 1VCNA 3FOFC 4DF3A 4RABA 4JLKA 3HEAA 5KX5B 3BD7A 4LWQA 5CU7A 4P53A 4FMPA 5ITZA 1RCFA 1KDZA 1F48A 3RRNA 3GYGA 3L7LA 7MHTA 4L5IA 3I52A 5TF0A 1WOOA 4ZVSA 5AW2A 3TIIA 5E4FA 1Q16A 3DXFA 2JD0A 2JLQA 1B6RA 2IV3A 4HWRA 3DHYA 1QHHA 3G2JA 3QG5A 2JHGA 1EA5A 4N12A 4C29A 1OB0A 1SM4A 1F0NA 5T4BA 1J0DA 2EJTA 2X5XA 5DGIA 4KGDA 1BQEA 1UPAA 4CKBB 1DTWA 3IKJA 1XRNA 9MHTA 1X1DA 4LOHA 2ZRNA 1PKXA 5FPSA 3DD5A 2MSCB 3E6AA 5FTMA 4CXMA 3VR2D 1MQSA 1PQPA 1BKSB 1HT3A 4I9UA 1NJID 1AXGA 1RFGE 4GZLA 4OGGA 4JMPA 4V0QA 2WHRA 2XODA 1UPTA 5EE5B 2G9NA 4NF2A 3VHXA 4BVFA 1Q50A 2IYXA 5JPCA 2AC2A 3BTVA 4AMBA 4F2WA 4FYKA 5EXXA 4G0MA 2J3HA 1U0OC 2IDKA 3RJMA 3JAKB 1A7KA 1PDVA 1Z0IA 3CLKA 1ZM9A 2G6BA 2HSZA 4DDMA 2OGTA 2RBEA 3HUDA 2AXEA 2FJ0A 2VSYA 1MGOA 3R8XA 1EHCA 2PEYA 3QVUA 1P72A 4Y1FA 4C87A 4Z2AA 4ZOQI 2Y9MB 3PXCX 3V76A 4F0JA 5IH7A 3L07A 3UMYA 2ZRJA 2RGBA 4Y0VA 1PTKA 4L85A 2J6HA 4KLCA 1FUYB 4M1KA 4UEJA 2GO7A 2RHHA 4HC4A 1D04A 1Q7YD 1JECA 1RW4A 1C8LA 1SUIA 2H31A 3CH7A 3IMFA 3QLUA 4I1YA 4UDXX 4JP2A 7YASA 1ESDA 4FEEA 1UDWA 4JXXA 5TR9A 3PU6A 1SCNE 3ZV5A 1OFTA 2GUGA 3ILSA 1ZGCA 4QEZA 5A1TA 4RKQA 1HH4A 2NXEA 3O7WA 2Y9PB 4A7PA 1U4SA 1G5IA 3IXQA 3O94A 1FX0B 1H5UA 1U2ZA 2DWPA 1DXYA 4NCNA 3B1YA 1J22A 2OCYC 1EDDA 3DMPA 3PNSA 1GNVA 4KLZA 4GL2A 4IRUB 3WWZA 5J4LA 1C7RA 1WSBA 5DP1A 3IBCA 2E37A 1RHRA 1K08A 1MT3A 2I66A 3A6LA 3UHJA 3SDZA 3CWQA 4A8HA 3I8XA 3HR8A 1LA2A 4CN9A 4FQ8A 4YPVA 4L9RA 3FOEC 3UMSA 4MH0R 5BSRA 2W2QA 5HOQA 1N78A 3IV6A 3MTIA 1XV5A 5CLGA 1T6YA 1OCEA 3TW0A 5GIPE 1H6AA 2MCFA 2FHPA 3T06B 1RWBA 4GMKA 4JIMA 3ZE1B 1OYVA 4EHJA 1NBOA 2FW6A 5LZ2A 2QAGC 3QKRB 4RF2A 4E15A 2G4LA 4MR9A 2IPAB 2PZLA 5IJWA 1KETA 1ZUNA 2VQEB 1FDVA 2R96A 1U0FA 2W4IA 5IMBA 3UJHA 2ZJZA 1JHVA 1XZPA 1UPUA 1WOMA 2FSPA 4YP1A 3R7FA 3T52A 1LF5A 1KEUA 5HSGA 5TE9A 5HFAA 2C9YA 3ZVLA 1TQ8A 4RK6A 1ENYA 5CURA 1QH1B 2RARA 3BXOA 1QO0A 3GJ7A 2CXTA 2FA9A 2C42A 4LQCA 3WJ7A 5JO9A 3WZLA 2GO1A 1CQJB 1H22A 3PBKA 2R751 3VJKA 1IN1A 1T24A 2GPSA 3G89A 1BXKA 3LPCA 3FCYA 3DCNA 4RVGA 4UAGA 4CM8B 1TCAA 2Y1KA 2GN2A 5EOVA 4KIWA 1QGYA 4KQHA 3I64A 1SOUA 5DN6A 1XMVA 3N8GA 4XVRA 2Z0MA 3ZWOA 1X2BA 3AYZB 4OUDB 2ENWA 4DRXB 3VDNB 2WIAA 3PVCA 2PVSA 4ZC1A 1E5TA 3FTPA 3SD7A 1VMEA 4HOYA 4NWIA 3W3ZB 1V35A 1G19A 1XAGA 5IPFA 2ZI3A 3TOXA 3S81A 5E38A 1XDDA 4G01B 1CJUC 4I1UA 4XQ9A 1FL9A 4CRWB 1OHHA 2BKEA 3ZLJA 5MN5A 4XLLA 5KYWB 1DX9A 1QIIA 4NEHB 4BEJA 3N3BC 3AL3A 4X6LA 1JB1A 3H97A 1ULHA 1Q5PA 1U2GA 3MCZA 4NBVA 3B6EA 3M4JA 1JHAA 4DREA 3N2NA 1XEFA 1TJNA 1BA2A 4QLAA 4ZO8A 1NE7A 3IP8A 2VF4X 3IEKA 3U26A 2PU7A 4CCWA 3WYEA 3LPNA 4WLEA 3S2IA 3U31A 2QVXX 3VPAA 2QR5A 3CCUB 4DMGA 5LP6F 2GN9A 2I9PA 4F3TA 2OCPA 4EKYA 1FLVA 3KHTA 4A4DA 4IIJA 3QKRA 3LNTA 4QBGB 5DNEA 1YRYE 2C7QA 1FYFA 5FBZA 3QLEA 4P3YA 4B3JA 2QN2A 3QY0A 5TNXA 2D2FA 1T4MA 3DZGA 4DAEA 1H1TA 2GN1A 2LIVA 3EZGA 3CMMA 1NSYA 1RWPA 1ENPA 5A4DA 3KKQA 2IIPA 5E0OA 4DS3A 1H6DA 2GMWA 3KEOA 3VSDA 3I9LA 2KQUA 4BATA 4W6QA 3GEMA 4FUQA 3IKLA 1GDHA 1ECJA 4TMWA 2VN8A 1JMVA 4CETA 1I8TA 5K3AA 1VFNA 3ICOA 3LA6A 3QMPA 4PNZA 1CQJA 1VHWA 3VZBA 4D5GA 1I33A 1HE8B 1N8TA 3AQ4A 3OOJA 3WC4A 1ZWLA 1EWTA 4PLWA 3R0VA 4I3GA 3V8NA 2WWGA 3SEQA 4KR0A 4RHYA 3R0ZA 2NO7A 3K1ZA 3L93A 5AD1A 5FH9A 1JYEA 2E6UX 4PYQA 3VNSA 1X8XA 1OPRA 4C07A 4RDLA 3UANA 1K6MA 2W6MA 3F0TA 3PXUA 1CQIB 3V2GA 1ZI9A 5JWHA 1AM4D 3RHSA 3UMCA 1S02A 2N3ZA 4CMBA 4BJ5A 3U3DA 3KJIA 2JLYA 1T8WA 3TZHA 3UENA 1O9HA 3JZIA 4B32A 2ODWA 3HFSA 1KZYC 3FCOA 3TSYA 5J47A 3BJIC 3RVBA 3ZKAA 1IBCA 1ZIPA 5JVDB 2XMBA 1ZLYA 4HXYA 4BVGA 2NU7B 1Q7GA 2VQDA 3GRRA 3QX9A 4QNMA 2JFGA 3HMQA 2AJ8A 4GT1A 2G1PA 2W48A 4X7FA 4PAMA 3DUFB 4ISBA 5JSFA 4IS2A 3QU9A 4MV8A 4PZYA 2O7RA 2XZTA 2ODTX 5J63A 3HR4A 4WLVA 3U81A 5BSTA 4R0MA 5LXTA 3MWDB 2WMOB 2XOXA 2AN4A 4DM3A 3ESAA 4K1XA 5GJBA 1X0XA 1Y3AA 4UU7A 3RPEA 4BAZA 2RCNA 5JATA 2YOFA 1F8YA 2RC6A 3C3DA 3P9XA 4XCVA 4A8TA 1DEXA 4FX5A 2JH9A 1S5PA 3K1JA 1UMCB 1WO8A 2YWHA 5IU6A 1AKWA 1WB4A 3PHCA 4QFDA 3T35A 1WRBA 4Q9DA 1JL3A 5DHPA 4X65B 4RE5A 3U60B 1AGYA 1BFDA 1GL3A 1WSAA 1Y5NA 3LK6A 1KQGA 5C1DA 5DGHA 4JOCA 1NBHA 1WKVA 1K27A 2UVPA 2P4SA 1JHZA 2HSGA 1TJ5A 4FSXA 1JZSA 1XA0A 4GWKA 4Q1CA 3IIMA 3REGA 2Y2VA 1RWVA 4B47A 1NYTA 1Z0SA 4RPJA 4JGBA 4UHJA 2G63A 1S8FA 3AY0A 1G3UA 2OQRA 1YUNA 2JANA 5HPYB 13PKA 1ARZA 1TU4A 3S1SA 5K8UA 4Q9IA 4YXWA 1KDRA 5LZ9A 1OX6A 2DVMA 1X7YA 4HPWA 4C5AA 2GZDA 4XR4A 5FADA 5FPHA 1M1UA 1QBKC 4BZQA 5AK4A 1LUAA 5CVCA 3S2GA 1CR2A 1IPFA 5AVVA 2H0RA 2JZOA 1GU0A 1Z6YA 4RDIA 5KQRA 5LDDC 3V1NA 5IUJC 1T0HB 1V6AA 4DN6A 5JVDA 1VOTA 3OEHD 4WY5A 4LGMA 3EZFA 1P0CA 3WI7A 3OPQA 5L4SA 4EG0A 1DRKA 3A6GA 3HUFA 4MQLA 3ROEA 4OXYA 4YV2A 5LQCA 1BH2A 4LZNA 3AR4A 2ZIEA 2X6YA 2JN9A 3IBSA 1L4NA 4XYGA 2W2LD 4MLCA 5E8JA 1AUOA 4K9NA 5LLSA 2Z04A 1H4VB 1VF7A 2ZI6A 3MWDA 3E8MA 3O93A 1DKRA 4IHJB 4Q21A 3K1TA 2VRCA 4Y2XA 1G6KA 2B35A 2HCRA 4BVHA 3ZWWA 2WU4A 4HMPA 4YQYA 1KP3A 2FFRA 2EQAA 5IBQA 3IE1A 1IBLB 2Z3WA 3EZ2A 3N0VA 3ZV4A 3DLPX 2BGLA 3IDAA 3CNLA 1IAQA 3MINA 1XFOA 1OU4A 5EIFA 4O4JB 4MW4A 3DHVA 4R2KA 4ER6A 2R11A 1UXGA 3B1VA 5KDDA 4AZVA 5K2MA 1L7MA 3NPMA 1YI1A 1GVNB 4IDFA 1GPYA 4M54A 3TLBA 4EHAA 1XK6A 1Y9ZA 2O2YA 1L0BA 1NMZA 1BCRA 2BZ1A 3FH0A 3I2GA 3U7FB 3P9CA 6LDHA 5B36A 1ZNXA 3NTOA 3S8EA 2G5PA 3KVVA 3GT0A 4HGPA 5JJKA 3T5TA 3WHPA 1VG9B 1ZOOA 2VSXA 3IUSA 3OZEA 4TWZA 1W19A 1BXRA 4LDZA 5B1HA 3RUPA 2AI2A 4EG1A 1C8VB 2J3QA 4B85A 3ORSA 4A8PA 3JARB 1F4VA 5K2OA 2UYOA 3OFVA 1B0AA 1CXZA 2X7XA 3CN9A 3F9IA 4Q0MA 3ZCSA 5KTTA 2QE7D 3QLVC 4ON9A 3CE9A 4PZZA 3W8EA 1H2RS 4Y2HA 5TPZD 3NWEA 3MLAA 4QVAA 1Z39A 4HDSB 4PC3A 1ZKMA 2AKAB 2XUKA 2GTPA 4CV3A 1JR2A 4DLUA 4K2AA 3HP7A 2IYQA 3IELA 1YQWA 3PIRA 5DEOA 3DZKA 2D1TA 3FHJA 1U3DA 2JFNA 1DUSA 5JAIA 4PR0A 2P40A 1YRLA 2WAYA 3R3YA 4IJKA 4A5SA 1PT9A 4QFMA 4UARA 1ZMBA 4UBLA 1JBKA 1KO1A 3EIWA 5CJ2A 4HQRA 3TSZA 3X1YA 1NF2A 3VZPA 3ZKWB 4QJBA 1RXEA 3F7NA 3VTAA 3KJHA 1P19A 1VLLA 2QMOA 3BDAA 4JP3A 2B92A 3BERA 4O59O 4PR3A 5A02A 3H9JA 4X1YA 3BWYA 4R4JA 4RD1A 4O4JA 2H7VA 3GDGA 4PSDA 3HNPA 5CK4A 2JG3A 1OXBB 3AWIA 1A2BA 3C6MA 4HGNA 4WA7A 3ANNA 2Y0DA 4I50F 2EZ9A 5CB4A 3V2IA 4ZEMA 5KTKA 1I2BA 4EX7A 1K7EB 1QAQA 3DFUA 5KKAA 3IL2A 4HTFB 2FFQA 2ZM5A 2PS9A 1ADYA 3LW7A 3PYMA 5BN5B 2IYTA 4UNIA 4NTZA 1E0SA 2YJ4A 3QVGB 5EMKA 1UM8A 3SWWA 1B42A 2QD4A 3AHIA 1GGKA 4MKHA 1IYZA 2ZB4A 2ZTSA 3RJ5A 2I55A 2PZEA 3D4BA 4GOXA 3SFTA 4EF6A 2NZUG 3CNBA 4LJRA 4LNHA 1DEAA 1L7XA 1HDCA 3B6KA 2ZREA 3NHUA 4RIGA 5J2TA 4FWTA 1UJ2A 4RD0A 4Y0NA 5GVSA 3WJ2A 1UDBA 1T5IA 3QUTA 4DV4B 1COZA 4KH1A 2O2IA 2H2WA 2K87A 2X8BA 3QW4B 2OG2A 3EZ7A 4MAFA 3D31A 3EVAA 4WXHA 2VNJA 2FPPA 3TCXB 4TV9F 4JSRA 1F14A 1F20A 2G4CA 3O2SB 4O4HB 4Z53A 1DLIA 1EFRD 1L4LA 2R7MA 4FD2A 4OIFA 4QBIA 1JG3A 4CEHB 4TWBA 4D9CA 2PMBA 5DYNA 4LC9A 3ZXXA 1LDNA 2UU9B 4FGJA 4CTKA 2B8WA 1STOA 1S3GA 1AK1A 3K0FA 2B25A 3OO1A 4PZ9A 5HXAA 2OE2A 1XF9A 3KOOA 2PAFA 5IAKA 3EWSA 2F1JA 2FK8A 2NV2B 5EGSA 4A6XA 1TW2A 4BQEA 2Q1SA 3OX1A 3QOFA 3TTYA 5IN4A 5LU8A 5SYAA 1TUEA 2Q21A 5ER6A 2WYIA 1XLTC 1QIMA 1OE0A 2ZRBA 3FUVA 3HVJA 1EBUA 3EXHA 4NBSA 2HRZA 4P32A 4Q02A 3T1HB 3CG4A 4TVBA 4II2A 1GRCA 1E8DA 4W1SA 2J87A 4NYIR 1FVFA 2IF2A 2P90A 2C4KA 2EGGA 4MUFA 1CF9A 5J3OA 3HP1A 1Z73A 4GD3Q 4TSFD 3A3GA 1KAEA 1UXIA 4G9EA 4Y98A 1NQUA 4UNQA 1Z8NA 4YUXA 1G8AA 1ZC4A 3VOAA 5BN5A 3F97A 2PLWA 1XQWA 1NY5A 1VGVA 4FW9A 3TSAA 3E8XA 4JLMA 3E3MA 1FS4A 2FR8A 5GP1A 4DHEA 1JIIA 2NNLD 4K05A 3KFXA 1SXHA 2X4LA 3KR2A 1G8KA 3BRSA 2VXOA 2J6BA 1F1BA 1R37A 2JAWA 5AICA 5CBKA 3LQ4A 3DNFA 1NUAA 1ZJ4A 2OGSA 4D7AA 1DARA 4FEGA 4K86A 4WASA 3X1MA 5DBEX 4KE8A 1ZG3A 2VPWA 3KUUA 2FMHA 4FZRA 4PG4A 4MIOA 4AULA 4Z0TA 3QOWA 4RD2A 1XJWA 4JJ8A 3HS3A 4AQDA 3RV4A 1H4QA 1YITB 2BR4A 1WHSB 4KOEC 3PZRA 1HA3A 4ZCSA 4D92A 1MB4A 3T1TA 4W4TA 3Q12A 4ZREA 3J81A 4ITRC 2P6MA 2P6UA 3UXEA 2YFYA 3OFSA 5BMVA 3ZHOA 4QEKA 5EKUA 4E2YA 2Z1NA 3JRXA 2OP0A 4CM5A 1K7CA 2IYFA 4REMA 4V0MA 4YQEA 2I3ZA 4FD3A 4NZNA 2D0IA 1JAHA 2Q4EA 2TMYA 1QUEA 1F3OA 2W4MA 2R66A 2XTJA 5DOVA 1MTOA 3DZBA 4DSNA 1MQAA 4COKA 1P3DA 3W6PA 3NB0A 4RHEA 4WL0A 4D4GA 1GKLA 5ALUA 3A6KA 5HW0A 4P4NA 4RMJA 2PKXA 1J90A 1KC1A 1WAMA 3HJGA 4HMOA 4WNYA 3ZGZA 3DEZA 2AYZA 3NLLA 4XIJA 4ALKA 2H6EA 5FYQA 1O5IA 1JDZA 5AI4A 3TOVA 3WFIA 3IS3A 3DONA 3WLAA 3WGQA 2AQHA 3QXSA 2ZROA 2DLNA 1P0PA 3L8ZA 4P0QB 1WCV1 1FU8A 2AI3A 4LV6A 3RRBA 1ISJA 1C50A 4WZZA 1YU9A 1IHDA 1PYDA 1U7UA 1KVRA 1IPHA 2Q99A 3HN2A 3RC7A 3EFOB 2WINI 4BRZA 5ELXA 2W6JA 4JGIA 2ASVA 2Q7XA 4TUYF 4CF4A 2Y8EA 4C4OA 2BAGA 3ZJUA 4TLMB 3ESRA 4GIBA 4ALJA 4RMGA 5CTAA 4YCSA 4ASUA 2XWPA 4PZCA 5TGZA 4FQ5A 1IN7A 1OD6A 3KPJA 4G85A 3IJRA 4GP7A 4LYJA 1A27A 4YH1A 1KF0A 4IG4A 4UE2A 3FYHA 1Q7CA 3A9WA 3E4CA 3GCWA 3O9ZA 1P0MA 4ZD6A 1AKYA 3NWOA 3T54A 5CDYA 3N74A 1J23A 2VS1A 1IDOA 2W9XA 3LI2A 4AMYA 3TFQA 3TM5A 4BU0A 2R2AA 1T5TA 2QRJA 5TRDA 2BMDA 4OHWA 1RBZA 4B2YA 2BI4A 5JC8A 1QQBA 3BH4A 2B1RA 5EMNA 4IIFA 4LKOA 2D5CA 4BTLA 3LZCA 4MVJI 1ZQ9A 3NUGA 2R8OA 3HKDB 4TLDA 2VF5X 4LCBA 2PWYA 3E3LA 3OZGA 4IUDS 4M55A 4Q00A 2A57A 4U2KA 1N1GA 4RSGA 2XTMA 2JW5A 3VPBA 2V4ZA 1IZ9A 3AEZA 3PNQA 3WXBA 4Z4EA 3VNQA 1XQ1A 4YPFA 2QAJA 1PNVA 5I4IA 4G8CA 3X2EA 2VCEA 2I5PO 4R5HA 2IYAA 4KQKA 4LGYA 4UVEA 4WCFC 4XA8A 5AMXA 3WHKA 2WA1A 2CYCA 1ODSA 3NVKI 1GV0A 2XUFA 1SVMA 4S1VA 1XN1A 3CF2A 4BEBA 4F3NA 4W6ZA 4F92B 1IDN1 2H18A 1MVLA 4IH1A 4LHWA 4MRRA 4KPYA 3GLUA 3CCMB 1U7ZA 4YRBA 2DUNA 5CT9A 3G2KA 1Z8HA 2F8SA 1NY6A 4OAOA 2IW1A 5FNVF 4W5RA 2Z6AA 4KOAA 3A1FA 1I7LA 3ACDA 3NMUF 2EWVA 1QGZA 3C87A 2A30A 8GPBA 4YT5A 3SZGA 1LSUA 3DFKA 1BAPA 3OLCX 3FDIA 4HN2A 1W2BB 4JKOA 1TVMA 2IUTA 4EABA 4O33A 3AHHA 3F6EX 2IS1A 1WW8A 2EVWX 1OU0A 2R97A 2VHQA 3CLSC 4EEZA 3DFMA 4F60A 5J4VA 2RGAA 4L6AA 5EPUA 2OPHA 5AK3A 2VHTA 3H13A 4YCJA 3WADA 4P6VF 1TZ2A 1U8AA 3MVEA 3PK0A 1CBUA 1XMPA 4UFPA 5TF4A 4ZZ3A 3UUEA 2BE9A 5CEJA 2QK4A 2ZWVA 3BZBA 5FXMA 3R7LA 3V6LA 1J7JA 1FFXA 4QIHA 3VFDA 3MGAA 2EV9A 3HNRA 5IW8A 5LC1A 2PNFA 1N6NA 3UN1A 3UW1A 1VJRA 4UTOA 5REQA 3V8VA 1E0AA 9LDBA 3DDZX 3R3XA 5DCYA 1V25A 2Q0XA 2YN2A 3WGJA 2V6IA 3ZDXB 4QODA 2R6JA 4KC0A 2ZQ5A 3JZDA 2KW5A 3V9PA 4ZOBA 3ZBPA 2W2MA 5KJEA 1F9AA 3OU6A 1QZ3A 1Y9DA 5EWJB 3G8AA 2A0FA 5T64A 2DIEA 2NSLA 3U1VA 3TVYA 1G8SA 1BYUA 2YJ3A 3T5GA 1ZX1A 2IYPA 3W5SA 2ZW9A 4DLYA 5EUCA 3E2PA 4CDNA 4BN0A 4WY8A 4KXFB 4LTMA 1OLUA 1WY5A 4G2NA 3JZFA 3ZE6A 4R2JA 4DGQA 3P2EA 2RONA 4KAXA 3W6NA 1YKSA 3Q15C 4IQ0A 3SC6A 3CTMA 1ZIOA 4W7IA 5IBCA 2PBRA 4O8CA 3WGHA 3BXEA 3OICA 4MW5A 3QYFA 4N5LA 1DI0A 4BNFA 4HQOA 2G1KA 3O3OB 1ONPA 4RV4A 3CRRA 5DE3A 4FLEA 4ARIA 5G0UA 5CA0B 4BFLA 3U16A 4WZBA 4KMMA 2OCXA 5DLEA 5K51A 1MNAA 2VNHA 3T5CA 3I42A 1IM8A 5E6TA 5J4HA 1IOWA 1YRQA 4MCIA 4EW2A 5JBQA 3GT3A 4ETIA 1T9DA 2KS6A 3AM1A 4TZKA 1L8LA 4RF3A 1OWLA 2PYDA 3OKCA 3P9RA 4FFDA 3RGGA 3NYWA 1W30A 2NYAA 1EFKA 4NYMR 4ZHQB 4XD7A 1QRAA 3EXEB 3M3PA 1MHPA 2JFHA 3AHFA 3VAYA 3Q39A 1QB8A 4R1SA 1TEVA 5HCUA 3HDTA 2HHHB 4IDHA 2O0HA 1RD4A 5C9ZA 1AMNA 2IYNA 2IEZA 5KS2A 1SVOA 2O1WA 3CGWA 3N75A 4ARSA 3NFRA 4C0LA 2OFOA 3RYHA 1KD1D 4DYDA 4KUHA 2VJJA 1SY7A 3H9UA 4WKNA 4MQ4A 5GM2A 4GOLD 5IKMA 3AF0A 1ZP6A 3VNUA 5AIBA 1NVTA 1OY1A 3UTDA 3R0IA 2PXAA 2VL7A 1VLJA 2YRWA 4XDGA 2OBBA 2C5AA 4AY6A 2J07A 3I9JA 5EG5A 1KI6B 2GYUA 3RLFA 4AUMA 4DABA 2AOTB 2AQ8A 2WU8A 4YV1A 1G8GA 5DVZA 3OIUA 3FSRA 5LUAA 1UK6A 3AKDA 3IR5A 4U7PB 4KWCA 2H5JA 3EA4A 4KAJA 4FKMA 3WLMA 2PUGA 3K92A 1HFWA 2HJVA 4Q5IA 1ZUD1 5C8VA 5MDHA 2RGEA 3PB3A 4X62B 5AJZA 1D7AA 3U7HB 3P5BA 1A9TA 1MENA 1S2NA 3ZWCA 1TK2A 2JGNA 1KMIY 4EY3A 2BT4A 4HAVA 3FYTA 5ALZA 1P74A 4Q7JB 1CY7A 3W3AD 2CVZA 1IHMA 3NYQA 2XTAA 2I1VB 2R6CA 4IIHA 1C5KA 1HFKA 1ZN2A 3NUZA 4CLEA 5HNKA 5IJAA 1OBOA 1MAVA 1F38A 1ZD8A 2H4JA 3QWIA 2HA0A 3BFVA 2ZZNA 4PO9A 4ZHQA 1WUKS 4LQDA 1S9HA 3IEVA 1I5OA 3L7IA 5JQGF 6NULA 1IMOA 4F5EA 4BPBA 4DWJA 1WR8A 4I4NA 4GOJA 4MA4A 3IEMA 2O6HA 4DFDA 2VTKA 4G25A 2G0TA 3G0IA 4JB0A 4Q05A 3FX2A 5CM8B 5K0SA 1LLCA 3M7IA 1F0KA 3GEPA 3BWDD 1WP6A 2VF2A 3MAAC 2W6NA 4AJ9A 2NO1A 2PUDA 3VR6A 1E9RA 1WUJS 4I4TF 4JEIA 1ZH6A 1IHUA 1M7GA 3MD9A 4HF7A 4L51A 1SKQA 4IWYA 4JZYA 4F12A 2PH5A 1YACA 4BUJA 3ASZA 1J0AA 2H4YA 3I45A 4R8SA 1Y8QA 3G5AA 1V71A 2AOTA 1H2XA 1K66A 3GEHA 4IMIB 4J03A 4MRPA 1UFVA 1JHXA 2GA8A 2PH3A 1Q21A 2O5VA 3X1WA 2CHFA 1OV4A 2D0OB 4HS9A 5L6LB 1GQQA 4QHSA 3NDJA 4YMTA 5JH7F 4BAUA 1U9CA 4H6VA 2AN1A 2UZ1B 2VEDA 3BWMA 2W6CX 3U7QB 3G79A 4OSPA 1Z5ZA 4R8KA 1XQBA 1TU0A 5C8YA 2CV1A 1Z7YA 5EE0A 3BGVA 4GE3A 1SBTA 3LY8A 1JVBA 2O19A 5A3VA 5DT2A 2PU5A 2VDVE 5DT9A 2QMHA 2QIOA 1P31A 3N6XA 1TUIA 1NL3A 1EMDA 4GI5A 1T5EA 2CDAA 4P92A 4UAUA 2PUFA 5FOSA 1GIAA 1T9BA 2PXXA 4BFSA 2GJPA 2Y71A 1TK3A 2ZUCA 3I6YA 3S27A 2I7DA 4N41A 5B7NA 2FH5B 2EW2A 3PXBA 4I14A 4U8HA 1DC7A 4UVGA 2OESA 3SR3A 2I78A 4NBWA 4AYTA 2H4FA 3GHHA 3L2OB 2IEBA 3L7MA 5DYTA 4L4XA 1LX7A 4KQ1A 4YHHB 2NZJA 4J43A 2GTHA 3BORA 3BL6A 3D3EA 1KIAA 3QEOA 2ZIZA 3HEBA 1ODCA 4QC2A 2PJUA 5ERGB 2CDRA 5A5EA 5KB3A 1SPBS 4KO1S 1Y9JA 2DPLA 1Q84A 4MNTA 4Q34A 2FWMX 2B7CA 1AKEA 1ISHA 1M76A 3G2PA 3RFVA 4YAOA 3JRWA 3KG2A 1W47A 4I0WB 5E95A 2EHJA 1WCXA 5HJ2A 3IVXA 5U1PA 1X14A 5FEUA 3NR2A 1ADGA 2FMKA 2NSHA 2YVQA 2AFHA 3DOEA 1M8PA 1M1YA 2G4VA 1IXSB 2FG6C 2XTZA 3UHOA 1BS9A 4NMXB 2HF9A 1PYGA 2PHZA 4DLTA 2A9KA 3QPVA 4B8ZA 4F93B 3HRKA 3ND8A 1TM1E 4RZQA 4Y67A 1BA3A 4ISCA 4KDRA 3NOQA 4XNFA 2CD7A 4WXPA 4I3HA 1N0UA 4URHA 1V1RB 1WMDA 1Y9EA 2NZ8A 2UZ1A 3SEAA 3VJLA 1NVBA 5HM6A 3G1UA 1E98A 2C4MA 1I6MA 1QX4A 2DFLA 4I5FA 4JJ4A 4AIRA 4DGSA 1P0FA 2ZDQA 4J3NA 1I7PA 3B7PA 3NHBA 4GX2A 3MOIA 4P5PA 3WGYA 3DBVO 3KR9A 3VO2A 3WNDA 3IEXA 1YIDA 1I3LA 1NVMB 1SQSA 4JUBA 2DC1A 4DLRA 5JYDA 1CRQA 4US0R 2VBCA 1TQHA 4DMLA 1CE8A 1BH6A 2ZEJA 3QUQA 1DCFA 2AG8A 2X58A 3Q9UA 4MTLA 4C03A 4TKOB 2DWCA 3A8IA 3KZKA 1YNOA 5ARDA 4EZEA 3PHIA 2G06A 4ARBA 1YR7A 3O4RA 3WK6A 4F97A 5JBIA 4M9RA 3AEQA 1B23P 1HC7A 1UAYA 3CPSA 4ZMSA 1N2CE 2FWIA 4L73A 3KVRA 4NFLA 2C61A 3B9QA 1NXWA 1Q57A 2NZXA 2XPCA 4UBKA 1GCGA 2C9MA 3PHJA 4LSZA 1R4AA 4RWZA 2WSMA 4ZOLF 1G59A 3B36A 4NRDA 4XSHA 1JQDA 1AH2A 2F67A 1GPAA 2PPLA 2ZXUA 3PFWO 4PYKA 5ALOA 3HO1A 1SIBE 3KVNA 5K3EA 2F1RA 2IIBA 2H11A 5FKJA 4WOCA 5FLEX 4ZJUA 4PONA 4Z1OA 1O58A 3HAGA 1J2YA 2FETA 2LVBA 3H5NA 3UK7A 3S7TA 4DLXA 3OKFA 1SXJD 1VKHA 1Z9BA 1FNMA 1AKVA 2XUPA 1XP8A 3CZAA 4XM0A 5TT1A 3F71A 5D6OA 2Y0BA 4FFSA 4AJ4A 3HP4A 3M9WA 5DXFA 1PW5A 1THMA 3OWHA 1VQLB 3PQ5A 3S2YA 3VI3B 3WLSA 4Z1MD 4ZYLA 1H0KA 4MUIA 3P2MA 2FQWA 3OKPA 1T0PA 3LQRA 4TS9A 5AFSA 1AV6A 4MKZA 4PNHA 1YJ8A 1P4SA 1IWBB 2PY6A 3DGEC 3R2JA 2X3UA 3I2IA 2WTMA 4GRIA 2ZUBA 4OKIA 4R84A 4Z86A 2ZI9A 1XZHA 4L28A 4EELA 4LYYA 4UPEA 3C41J 3PDIA 2ISQA 3WDKA 4B45A 1YGYA 2PXHA 1ZCAA 3KX2A 4RZXA 1GXSA 1QUFA 3FXAA 3JWJA 2VYVA 1AJEA 2H51A 1FXSA 1U3TA 1XXHE 1Z4KA 2D1FA 4C0WA 3ZWYA 2FPXA 3PD7A 4OFXA 1Y0YA 4M1WA 1GARA 3FCSB 2AUTA 3I9FA 1Y5IA 3KOYA 4S0ZA 4WFJA 3T1VA 3C8ZA 1YBFA 1ECBA 2FFBA 5HKBA 4TMZA 3LE8A 4P3XA 2ZTUA 2OHGA 1ZA2A 4KE7A 3FUWA 2XVAA 5DBHX 2JJMA 5CPFA 1NQAO 2LZ0A 5KDLA 3RRYA 4B3SB 3UEOA 3N0WA 1S0UA 3R75A 1DQRA 3KL4A 1F5SA 3I6QA 4FSHA 5IYNA 3MWYW 2HXYA 2L0XA 1E7YA 3KEQA 1DAHA 5HJ5A 1OXSC 3INRA 4L57A 5F78A 4CV1A 4QRDA 1Z12A 5F7ZA 4OM7A 1XCOA 5K8TA 4UTXA 2ZB7A 4L7QA 3JXEA 1CV2A 2PSSA 4FR2A 3M4ZA 1FJHA 1M2FA 3EGVA 4LC1A 5JV5A 3LXXA 4GMGA 5CXQA 1C3OB 3TF5A 1FDTA 1IVNA 1RQ7A 3AIIA 1G6HA 3Q8MA 1NW9B 2VFAA 3P97A 2JCBA 3H0EA 3R3SA 3ZVRA 4DV6B 2XW6A 2HMSA 2J5RA 3AR7A 3LCMA 1Z29A 1JSRA 3SSOA 5EWMA 2C4VA 4LX0A 3EIHA 2CBXA 2YS6A 1YR3A 2RHLA 4CQLB 5HKKD 2GLUA 3EVGA 3KJZA 4XIIA 1JIVA 1EIZA 3W0LB 1QKIA 5HE9A 4LF5B 2VBUA 2YMPA 2QM3A 5LOVF 3BCFA 3KUDA 4D2IA 3OTWA 1Y5RA 5K3OA 1TE2A 3ILXA 4QU5A 4WOKA 1K89A 1RLOA 1XAJA 3LHKA 4Q4DA 5B1SA 1M74A 2IGTA 4D0RA 2LKDA 4DLKA 5L3QB 4NYJQ 1VL5A 2OOKA 4DNPA 1H8HA 5LQKA 1SK9A 1U9ZA 2P3OA 3CC8A 3QXHA 3L4JA 4AKHA 2HT6A 3HYSA 1VYVA 1Z2CA 2HDOA 4GECA 4MYSA 3LQ1A 4R9VA 5FLKA 3GMDA 4TKVB 1MF7A 1PZXA 1IXKA 3X43A 2XCUA 4ND7A 4V1CA 1FFHA 1CUXA 4JBXA 3SYKA 5IJZA 3C5CA 2XZDA 3C24A 5DISB 4BVLA 4US2R 1FSGA 1C7ZA 3GNTA 4G24A 5EKSA 2OC4A 2ACEA 2ONKA 3ZHVA 4E5NA 2EZTA 4XYBA 4G5QA 4L8FA 3ROXA 3ZTYA 3AKZA 4ZP1A 3SQNA 1R50A 2PXCA 4WBNA 4E2XA 221PA 3JQ8B 1SXJE 3D8UA 2JIDA 3NHJA 4IICA 1BWQA 2A5JA 1FFWA 2F9LA 3H2GA 4KR9A 5C8XA 4A6PA 3FTQA 4ZAVA 4C01A 3WJ1A 2JGAA 3F49S 4HPXB 2D5IA 2ZIWB 2WZCA 4GM0A 4MA0A 1SRQA 4B8YA 4MUNA 1Z6ZA 3RIMA 1XYYA 3NVAA 2AN9A 3MZ0A 3GJZA 1QIFA 4ECAA 4ZZ0A 2KBEA 5GQSA 3OWXA 5F9FA 4YELA 3FOBA 4C0QC 1UWVA 2P2GA 3HYTA 3GFSA 5IJ0B 4Z4IA 4BNZA 1FTNA 3P9QA 4ZT6A 1GUYA 3RSSA 2A78A 1M54A 1DX4A 2XCOA 1N3YA 4M9SA 3HSSA 3L82B 5FO0A 1Y0BA 3PD0A 2G04A 2ZJFA 4ARAA 4DSTA 3H0CA 3HZHA 2TMDA 3Q10A 3GX1A 3IQWA 5COQA 3VPXA 1GP2A 4EHIA 2QEXB 4IH9A 4QPPA 2PT6A 4WIAA 2YMQA 1ZQ1A 1E3DA 4XVUA 3HA5A 1QO7A 2DPMA 4DUGA 3DMNA 3OQ6A 2GZ3A 3X1ZA 4MLPA 4RADA 5CGQB 3FZNA 4WZAA 2JJ2D 1JEQA 2CYBA 3WS7A 2ZYVX 3O75A 3C6QA 1T2NA 4IRXA 4KH0A 3ZHBA 2PQ2A 4BUZA 1YDHA 3F8SA 2JS7A 2OMKA 4O6VA 1N06A 1OFUA 3LDGA 3LHSA 4LI3X 1POXA 1Z88A 3DO6A 3CIFA 3IA2A 4FTWA 4WGGA 5AM1A 2QORA 3AVTA 2A94A 4A5OA 1C80A 4Q7LA 4KHPB 4PYJA 4IMJB 1N8SA 3DLIA 3NC0C 1R5OA 2VP9A 2BEJA 1I0ZA 3AHCA 1ML3A 3EBPA 3IC5A 3NDRA 4GPAA 4RZHA 3W3AH 4BQFA 2VHVA 5EUQB 2V1UA 3H9QA 3GLFA 4JELA 4RGVA 3TL6A 1B6GA 2VXCA 3L41A 3DLCA 3UBTA 3KR0A 1USUA 1N1EA 2G77B 1CUDA 4L08A 1SKMA 4WA8A 4YNBA 5JOQA 2EDCA 1P39A 2FRXA 2W6OA 3PUZA 5I9BA 4N5DA 3V33A 3UJNA 1RBYA 1T1GA 1JYSA 5H3LA 3CURA 3TD6A 5JASA 1WVIA 2XXBA 3NOXA 3H86A 3IXLA 4YDHB 5JCJA 4BEVA 3GQBB 4OXRA 2IHVA 2AMYA 3E2IA 3EY4A 3DG9A 1ATIA 4MVYA 4RS4A 4XXHA 3SKYA 1QU3A 4OOXA 1NJGA 4J7UA 2I34A 3RVNA 1P2DA 4DLNA 3KLBA 4KO8A 2JCVA 5IJ0A 4QJ3A 2OR3A 4ZK6A 3ZX5A 2OBXA 1MO6A 2BY4A 4HEHA 3DM5A 2GPWA 2IKSA 2HTFA 2O2JA 4C06A 5KREA 5HE8A 1UMDB 5TLSA 1HK7A 2ZSDA 4YWHA 3M1IA 1E3EA 2F1KA 5H02A 1S2IA 1G5FA 3QKIA 2EP7A 5C51B 5D1HA 4KB5A 3T7SA 2TECE 1QB7A 2BFCA 1XUOA 3CISA 4IF6A 4OSOA 4PGMA 4RV9A 4BKPA 2G9UA 2VJQA 4CHTA 5HGXA 1QRUA 2YV1A 2YWCA 4CI0B 4XB6B 3OC0A 1G21A 5DGDA 2AVDA 2F1LA 4DQKA 4H59A 5ALWA 3PFCA 4EWLA 4DLLA 2ORVA 4YRCA 3CPEA 3F3KA 5FFFA 3DDUA 1NWHA 1WXFA 2NVBA 2QMZA 2ZSHA 4PM4A 4KJXA 1NJ1A 2FUG6 5DZSA 4M38A 3E1GA 1Q82D 3V5NA 1P62B 4HJRA 5TS2A 4OH1A 3WOHA 3GJTA 5L46A 4MKRA 5J23A 5HIKA 3CUVA 2JCXA 2WIDA 2G25A 1KY4A 3CXUA 5AVWA 4F3CA 3RREA 1ADBA 1DC5A 2B1GA 3C7DB 4G0QA 3EY9A 3VAZA 1E4OA 1WCYA 2J0UB 1JT9A 4QUIA 3UFBA 5CCBA 2Z6VA 1T36A 3C39A 2B4YA 4BYMA 2X5OA 2H0AA 4U2DA 3CZMA 4ZI3A 4D5EA 3FCUB 1Y3FE 4UE3S 4OREX 3PYLA 2ID9A 5C1PA 2C9CA 2OCAA 2BLNA 4R1OA 3CVYA 4YCNA 1PK7A 2A14A 3LVQE 1NVAA 4R2WA 4QWMA 3W05A 2V7GA 2MINA 3U37A 3M8KA 4CIVA 4DXDA 1RDFA 2YJNA 1KFEB 2QVYX 4QUEA 1C0EA 1HE1C 4NE9A 1OTHA 5LKAA 3OQJA 2C5EA 5IT4A 4MLZA 3IQDB 4OYHA 3KSZO 2OFPA 1SB8A 2EKDA 3KDAA 5EQDA 3Q8LA 5A6VA 4TVSA 4P3NA 4MGYR 4A27A 1HDZA 3ZDCA 1DAPA 4HD8A 3MPUA 3CRNA 4RM3A 1P1FA 2NX2A 4MQ5A 4J1QA 5AW5A 1X1SA 3T9AA 4G0ZA 4WN9B 1NJ2A 4O2AB 3TXAA 4MUYA 1ZNYA 3LDUA 1UZNA 2FAXA 4GGOA 2DWUA 3KV3O 2OC9A 4NBTA 1QF6A 4AAYA 1L4HA 3OFNA 1U9IA 3S2EA 3OKXA 2ADMA 4ZGGA 4MUKA 3DKRA 4YREA 3WK9A 1JDPA 3HJCA 2O0KA 3HDHA 3TR0A 1N0WA 3P2JA 4D3XA 3GUVA 4CFZA 4CT0A 4ZCIA 1LRKA 3JR7A 3QVTA 4G0XA 1CC1S 2OXCA 4DBLC 3C4QA 3KQMA 2Q3JA 3JWEA 1P6UA 3ZW8A 2P9FA 3FCCA 3IQZA 5F1YA 2FOXA 1W0JD 3BCUA 4WFKA 3ONVA 2H7CA 2FWRA 1G63A 4KTVE 4OVKA 4DQDA 5C1BA 1KH3A 1CQPA 2HXGA 3L4BC 4KKVA 4ALMA 3QFRA 2X41A 4BVAA 1U0BB 2D4AA 1YQQA 2ZZMA 5A0FA 3KYDA 4BB5A 3UAVA 3N7TA 1YCHA 1WXGA 3DYBA 4AG6A 2FPIA 3V3KA 2KWIA 4RTQA 5FPPA 4B3MB 1T6BY 2AFRA 3DBHB 3UV7A 3D9QX 1ZNZA 3GT7A 2OFWA 3J7TA 3PT5A 4OU5A 3MWJA 5DI3B 3DNPA 1Q17A 3TZQA 3ONYA 3MQFA 5AHOA 4Y2PA 5DX8A 4TV8B 1EE9A 4HGRA 3ZWNA 2QPTA 3NDIA 2XDWA 2CVQA 4AS2A 2ZE5A 3G6EB 1TCVA 8ATCA 1JKJB 1DC6A 5JMPA 5G1OA 4BVEA 3HCDA 4DNXA 1B74A 4GM1A 2OBFA 1JG6A 1DWOA 3AP2A 3HGTA 4A6DA 1DKLA 3WGNA 2XHZA 2C2WA 3PTAA 1RYMA 2X2PA 3HUUA 1BEUB 2V3CC 1BWPA 4PLZA 2W6ZA 3LDFA 4GMFA 4PXYA 1YZHA 4OFWA 2Q4RA 3EEIA 5LNK6 1YR8A 5GONF 3DTVB 1XCBA 2H1OA 1IL0A 2FMTA 1JDTA 2AHOA 3GIRA 1IUNA 1KZLA 3GFPA 3N76A 4M1YA 4GX0A 3RNLA 2B2XA 2FXVA 2QTBA 5DSZA 1JP7A 1GGNA 4G4JA 4PG6A 5DNCA 4K5QA 2X0JA 5A5FA 2O2XA 4KPGA 6ADHA 4H27A 3OT1A 3SS8A 3SC2A 4ESOA 3O21A 2D62A 3AI3A 4E13A 1GKKA 3AUSA 5DP2A 3NBMA 3SLGA 3Q9SA 3S8MA 3ZR4B 5T4HA 4HFNA 4D8VA 2P2ZA 4K03A 1N0IA 4DILA 4B2LA 4Z51A 1LD3A 4N3CA 5LZ5A 4E0FA 1TQ2A 1QC5B 1DTSA 2HB6A 2V7EA 4WJKB 3A6ZA 3OQMA 5GJWC 4E7OA 1PZFA 4G7XA 1G20A 4OM8A 4BNIA 4LFBB 5BPHA 2PUVA 4UBMA 4U00A 3C7KA 5T3YA 1PL7A 2Q2VA 3UBMA 1KJZA 2WIGA 2JAHA 3PUHA 4NJMA 1JHQA 4YTEA 1UEXC 5GGXA 2GOYA 2QTCA 1S2GA 4LXUA 4YAIA 3KKOA 1MCZA 2GNPA 3B5EA 3ZVNA 2HA2A 1TCBA 3FW1A 4DMRA 4TV8A 2IW3A 1E3QA 1PZMA 1D1TA 1U7HA 2HQ1A 1NTOA 4H1TA 3C1OA 1M1NB 1U31A 4WDQA 1S89A 1YR1A 4J76A 4HG2A 3KT6A 4NMMA 4JXJA 3WB9A 1X15A 2C2GA 2Z2ZA 2H1RA 2CK3A 1YJ5A 1YOBA 2AJLI 4DUZB 1NIJA 5JMTA 2RGRA 4ILKA 3KXLA 1XLUA 4RL4A 5FL3A 1DHTA 3ANLA 1CZOA 2VZEA 4EHLA 2P4UA 4XOPA 2FXIA 2PV7A 5FFNA 3DTVA 5FR2A 2H9AA 2W7TA 1USGA 4B43A 4NOLA 4TT3D 5BQOA 3WA7A 4MVJG 2GEDA 4G84A 2HHAA 1EP2B 4PCVA 4UU8A 8ADHA 3EAGA 5E4TA 1O54A 2D8AA 2I22A 3QV1A 4L9WA 1QAOA 2NZYA 3ZBQA 4Y1GA 3DFFA 3REFA 2REQB 1M72A 5JSKA 4P2BA 4ZARA 1UEIA 1XQ9A 1NBWB 1LK5A 4M0EA 1WDTA 1QCZA 3OP1A 2ZATA 4FOPA 5DHTA 4QARA 4XX0B 3W4IA 4F46A 1VBNA 2A5YB 1NB0A 4E4TA 4F4JA 1VB5A 5DH9A 1YGPA 3C3XA 3O1JC 3QRWA 4BO2A 2CCGA 1JEDA 4IW3B 4DJ5X 1DOZA 1XVIA 2M6RA 4XR9A 2NO9A 4EG6A 1PX2A 2JF0A 1L8OA 4ENTA 4OXKA 4IV8A 2EBUA 3HBFA 3Q88A 4JN6B 3ANTA 3BJRA 1Z7WA 3GVXA 2BSAA 1I1QB 1WB6A 1KEPA 5M3BA 3CMAB 2WTAA 4WINA 4JDPA 2R4TA 2EKQA 2IV7A 4FB5A 5A5VA 3L92A 1YDEA 2HEGA 4CEJA 1ZVVA 1VLMA 2QL9A 4V02A 5GM1A 2D8MA 3MJCA 1PNOA 1EP1B 4YFVA 2OPBA 3RK4A 1TFRA 4BRUA 2BELA 3BOSA 2CLMB 3RU3A 5CCEA 2B5OA 3H2IA 1TZCA 2RBKA 3HHPA 3IBTA 3L5KA 3Q1KA 5ALIA 5K3FB 3C4JA 3HPRA 3TTSA