4B4DA

Crystal structure of fad-containing ferredoxin-nadp reductase from xanthomonas axonopodis pv. citri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
256
structure length
256
Chain Sequence
AFGAETVLEVRHWTDAYFSFTTTRDAGFRFENGQFVMIGLETETRPLLRAYSIASANWEEHLEFFSIKVPDGPLTSRLQHIQPGDKVLVGKKPTGTLLISDLHPGRNLYLLGTGTGLAPWLSIIKDPETYERFDKVILTQGVRFVQDLAYRDYFERELPQHEFLGDLLREKLLYYPAVTRETFANQGRLTELMADGRMQQTLGLPTLDPANDRFMICGSPQMLADLRSLLDSRGFQTSPRIGTPGHYVFERAFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Fad-Containing Ferredoxin- Nadp Reductase from Xanthomonas Axonopodis Pv. Citri
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri str. 306
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 81
structure length 256
sequence length 256
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4b4dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4b4dA02
1BQEA 1GO2A 3ZZTA 3WNCA 1VQKB 2YWHA 2D74A 4Q7JB 1JB9A 2BGIA 3ZBUA 1IJEA 3QFCA 2BMWA 1QGYA 2VNIA 3VMFA 1K73D 2RC5A 1FDRA 3WBKA 2ZITA 2CNDA 3LRXA 3CCVB 4J0QA 1Q7YD 1QUFA 4R71A 3B78A 4PC3A 2FX3A 3AVTA 3B8HA 4M53A 1F60A 4B47A 1Q81D 2BPOA 3CCRB 1M1KD 1FRNA 4P3YA 1KTVA 3CD6B 4TMXA 1OB5A 3W5HA 3FPKA 5H59A 3QSYA 3E1YE 2B5OA 3CXCB 1ZM3A 3OZVA 2BM0A 3CCQB 3AVWA 1YIJB 2R6HA 4HE6A 1Q86D 1CQXA 4RD2A 1VQ7B 1EP3B 1K8AD 2DY1A 4ZCIA 1W35A 2HCJB 1BJKA 1TUIA 3CCSB 4MYTA 3ZBTA 1W34A 2YWFA 1EP2B 3CCLB 1GAWA 4YHBA 1QFZA 1ZM9A 3G4SB 3I55B 3E20A 2XNJA 4H9GA 5TV2A 1UMKA 3QFRA 3CRZA 1GJRA 4AC9A 1FNMA 2PMDA 2GPJA 1BX0A 3JQPA 1R5OA 2HDNB 1JJ2B 2PLFA 3PENA 1VQ6B 4M0LA 1VQ8B 1G7SA 1R5BA 1KK3A 1SM4A 1KK0A 3LO8A 4PC2A 2B7CA 1EFUA 2DEUA 4U9UA 1B23P 1KJZA 2VYQA 3W5UA 2DCUA 3ES9A 3SJZA 2C77A 1DDIA 3CC7B 3W2HA 1KC8D 3U6KA 3AGPA 1VQPB 4K1XA 4TN1A 3CMEB 3W2IA 3OJXA 5AN9A 3W5VA 1GAQA 1KK1A 2X3UA 3CW2A 4M1KA 3WBJA 5THXA 4FN5A 4PC1A 1G7RA 5DSZA 4ZGNB 3I56B 2QTZA 1A8PA 4NBSA 2QEXB 4ZCLA 2BVNA 2QA4B 4TMVA 1YHQB 1YI2B 4YAWA 2HMAA 1BX1A 3V76A 4B44A 3OZWA 2OK8A 4LBZA 1U2RA 2DETA 4C43A 1TTTA 4BPRA 3WNBA 2OTLB 4LBVA 1AIPA 5FA6A 3LYUA 1IB0A 2QN6A 3A1FA 1D2EA 5HXBA 3U6BA 1CNFA 4RCYA 4PC6A 1N0UA 1FRQA 1S0UA 1D8TA 2BN4A 4B3XA 3P26A 1GR1A 3FJOA 1OGJA 1E62A 2YWEA 4RCZA 2DERA 4LBYA 1KK2A 4MYUA 4RD6A 5EMNA 1KD1D 1CNEA 1VQ9B 4RD1A 4RD4A 5TY0A 1WDTA 3W2EA 1QGZA 4AF6A 5GV7A 1VQNB 3MCAA 1H42A 4ACAA 1VQ4B 4B48A 3U2QA 3W2FA 1W2BB 4YAUA 1JNYA 3ZZUA 1I7PA 2BF4A 5H5JA 4LBWA 4ZGQB 5JBQA 3ZC3A 3CB4A 1FNBA 3CCUB 1ZM2A 3CMAB 4G5GA 1QVFB 3OW2B 1R5NA 1N8RD 2BSAA 3WNDA 2GQFA 2EIXA 4B43A 3G71B 1IJFA 1ZM4A 1YJWB 5TR9A 1N0VC 3CPWB 1EP1B 1VQ5B 1DG1G 1YJNB 3WXMA 4M2LA 1DDGA 1G7CA 1QUEA 1QH0A 5KSWB 3MHPA 4AF7A 1EXMA 2XEXA 1B2RA 4TMTA 3CCEB 1QFJA 2OK7A 4WQMA 1DARA 2QMUA 1QGAA 1NDHA 1M90D 4DQLA 4Y9RA 3VO1A 1D1NA 1SKQA 4HE5A 2AHOA 1S72B 1FNDA 1XB2A 1KRHA 3OZUA 2VNHA 2BM1A 2QDXA 1G7TA 4G1VA 2QTLA 3AVUA 4B4DA 1J9ZA 4N3NA 4YAOA 1GVHA 1AMOA 1YITB 2J7KA 3QFTA 4NCNA 4Y9UA 1E63A 4PC7A 2VNJA 1VQLB 2NPFA 3OJWA 3QE2A 1TLLA 3VNVA 1ELOA 3G6EB 4YAFA 4DQKA 2PIAA 4ZV4A 3J81k 4C0SA 1HA3A 2BV3A 3MMPA 4Y7CA 3I1FA 1QX4A 4F7DA 3VO2A 4G1BA 1Q82D 4M4SA 4UAJA 3AVYA 1K9MD 2VZLA 1EFCA 3WY9A 2C78A 1EFTA 1TVCA 4TMWA 1E64A 4N3GA 5GV8A 3AVVA 2E1RA 2OTJB 1EWYA 4RD0A 1VQOB 1KQSB 2RC6A 1QVGB 2CRVA 2EFGA 4YALA 1F20A 4LC0A 1XE1A 4FK8A 1JA0A 1QFYA 3W2GA 3CCJB 4RD3A 3JQQA 1FNCA 1OGIA 2B7BA 1VQMB 3AGQA 4EH1A 4IW3B 1ZUNB 2XNCA 4P6VF 2YWGA 4ZCMA 1QG0A 1JA1A 1YJ9B 3AVXA 1W87A 3B82A 3WYAA 1OB2A 3QFSA 4PGOA 4ACBA 2VNKA 3JQRA 4QHYA 2BGJA 3CC2B 1H85A 4QFMA 3CCMB 3VNUA 4TMZA 3LVBA 4FWTA 3CC4B 1NJID 3ZZ0A 4RJLA 3P27A
chains in the Genus database with same CATH superfamily
4U6QA 2GN4A 5IYNA 4JLMA 4J8PA 3OCZA 3RF6A 4BJ1A 2AXNA 5JQGB 2YV2A 5K4HA 4RKWA 4OATA 2H2FA 4UE6A 2B21A 1IHUA 2FMFA 2OBFA 2ZJ3A 4ZDKA 4I1PA 3NBYC 5GMOA 4ZQEA 4YMVA 1IJEA 5KNDA 5U4QA 1QLJA 4C04A 5IUNC 1L7PA 4RSGA 1YB4A 2AR0A 4P0PB 3NJ4A 2JLYA 2JIBA 2ZZQA 1B73A 2C29D 2G1JA 4U00A 2ADOA 1TL7C 5ALUA 3EXFB 1XTUA 1S8OA 3VHQA 3FIJA 4UCQA 3X1ZA 5I4KA 3DTVA 1Y1LA 4TUYF 3SSMA 1LD3A 3DFUA 4XDGA 3LL7A 4EENA 1RYHA 2O20A 1M6VA 4M86A 4FM9A 1KY5A 3GMIA 4YMSA 4ETMA 3C7AA 3ACBA 3QEOA 3UG6A 4HDSB 5DBGA 5IBPA 1V16A 3O47A 4DRYA 5AT1A 4PC3A 1X1CA 1S3IA 2H85A 4QPDA 2YJGA 2ZSBA 1I32A 1R0SA 2ACKA 4CM4B 1OOEA 1PT5A 1J4AA 3CJTA 1N57A 2AJBA 1YO6A 4H17A 5AVWA 2RJNA 1F2VA 5EE1A 1M2OA 1JWBB 1HKHA 3FBWA 1C9EA 4R0NA 3EVCA 2BM8A 1XVLA 4P3YA 2QE7D 1BEUB 4IHKA 4RW0A 2ZR7A 3PS9A 5EXDA 2GYWA 2WG2A 4RTQA 4S1VA 1E3EA 1I9GA 1NFRA 4H18A 3UQZA 5IXJA 1PT8A 3FPEA 2LBPA 3U13A 2NZVG 4R1UA 3RUPA 2EL7A 2LIVA 3PTLA 3WRVA 4P5PA 1RHQA 1QIHA 1XX6A 2HBQA 2Q4RA 2F8MA 3M4XA 4FYIA 2A1UA 5KWSA 1XMVA 3ZNOA 2J09A 2PLWA 3MK31 1NI5A 1MX1A 1ZUIA 3DB2A 1DQYA 4CYMA 4FFPA 1T2AA 4URXR 2BSXA 1DAGA 2BM0A 2FAXA 3CEJA 1MJGM 5CURA 1UM9A 2GRJA 1MVNA 4K9PA 4CWAA 2A9RA 5AXDA 5LQJA 4U7HA 4FW8A 5FQNA 1K7XB 3DEHA 2Y6UA 4QJ5A 3ZY3A 1J0CA 4MRRA 3SVLA 4BVHA 2CFRA 1CYDA 3PA6A 4K2AA 5JTTA 1G55A 2GGSA 2VDRB 4BJ3A 2YOHA 2ZIAA 4TTIA 5K0EA 5AOBA 1TUIA 4HH0A 3CC8A 1BU8A 3NKVA 3HA7A 4MZXA 4Z9BA 3DB1A 3OKXA 3P71T 2JJ8A 3OOYA 3UXMA 3PLAE 1WUIS 4FMDB 4K3UA 1DBRA 4AJPA 4O3MA 4DYHA 2J6BA 2A1UB 2OORC 2XCIA 1DELA 1T29A 5A7HA 1YMQA 4CVNA 5F7XA 4GL4A 1BEZA 2FUG1 3BL8A 3O7WA 4M7PA 4JN6B 4DV0B 4MDYA 5AJTA 3ZGZA 2FFQA 2I66A 2WWVD 4PGMA 5LP6F 1SVSA 5CT8A 1Z08A 3L7OA 3T7DA 4P4LA 3L8DA 2NM0A 3DZGA 2GNAA 1OREA 1VKRA 1UKAA 1WBJB 1U1IA 4MQMA 4OQ4A 4KQXA 3I01M 1J6UA 5GAJA 4EUFA 2K5UA 4JQCA 5U9CA 3DP7A 3ZDXB 3GFTA 5C4GB 1ATZA 3MXOA 3N6VA 1JFLA 4KMRA 2AF3C 4OMCA 5LOVA 2PMDA 1T3TA 4KLNA 3AP1A 1L5SA 4R54A 2E6UX 3DEYX 5HZBA 4EMUA 5KYXB 1DC5A 1V11B 2QQEA 1M8FA 4ZI5A 3RS0A 3Q6IA 4XGQA 5IYPA 3R9WA 2CFIA 1CDZA 4NL4H 2XAAA 1M76A 1SUPA 2FPMA 3M6XA 4L0CA 2XCQA 5B2EA 4YP7A 1MPXA 3USZA 1Y1QA 1XLWA 2WJYA 4ZEVA 3K9GA 1XWIA 4KN5A 2BD0A 1H23A 4QU8A 2O8NA 5ES4B 3VDXA 1MQ9A 1AF7A 1RQLA 2PZGA 5BSUA 4YIKA 4M0LA 1RC1A 4CODB 3IT0A 2H2GA 3E3MA 4OJTA 2WF9A 2W2KA 4IX1A 4MA4A 4NVRA 4CQLB 5NLLA 1U02A 3X44A 4G09A 5BV2P 1EFUA 3GFRA 4I5EA 4K26A 4HT3B 1YS4A 1BDIA 2D4AA 1OXXK 5FTMA 2IYWA 4ODIA 5BQOA 4QPCA 4K9SA 2GM9A 3CLRD 4DXAA 3CH5A 4M36A 3LVFO 3OMWA 4PZEA 5EG5A 1DO0A 1RIIA 2O1WA 4RXUA 3YASA 5EE5B 2L42A 4DSOA 1KXZA 3SF8A 2YIMA 3QOFA 3TIIA 2AYYA 1O95D 5EMKA 1T2NA 3KQKA 2WHEA 4C2AA 4MJXA 5IH7A 1UBGA 4KL8S 2RGCA 2ISSD 3D8TA 1QC5B 2GWRA 4RV9A 5C8YF 4IWNA 1RACA 3E6AA 4P84A 5CH5A 4ZV9A 3RWMB 1M6EX 3HNPA 3PV0A 2ZEJA 1LLDA 3KUDA 2AIRA 2J87A 4ZEOA 3S8MA 3OZAA 2IZOA 1U1CA 3ICCA 4X7EA 1Q3TA 4FI3C 3HDQA 3AW9A 3IBTA 4CM9D 4PVCA 4RJKA 1QOQB 3IILA 1HNNA 2W42A 4JJZA 4FR2A 4KVFA 4OJKA 3G2IA 4H08A 3Q2KA 4LYAA 3OU7A 2OYSA 4Z4ZA 2DHEA 4RK7A 1HLFA 4ENVA 1NMYA 2B1GA 3VR6D 4YC7A 2H1OA 3FWPA 5BR1A 4RFSA 2QD1A 3ZBPA 3HAGA 3IUBA 4C0BA 1EM8B 1X1EA 3B3GA 8LDHA 5KC8A 1E7WA 3V76A 2IWHA 3UCEA 4JY7A 3RHZA 3ZQKA 4RSMA 4BO3A 521PA 3CX7A 1ZQ9A 3N8NA 1Z4KA 3P94A 5FYDA 2DR0A 1QYCA 3R41A 3A31A 1IQPA 2GN6A 2EX0A 2YXBA 2O5CA 1NN0A 2RHTA 4DA6A 4NXNB 3CO5A 4DJEC 3U09A 4FDLA 5I6DA 1REQA 4GGPA 5EXSA 3TDMA 1DMRA 1I14A 2YZNA 4LBVA 4LGMA 3H9EO 3QMWA 2ERCA 1TEXA 3LYHA 1EM6A 1UWLA 1DHTA 3ZD6A 3ICVA 1FJHA 1X8XA 3GY0A 4WGFA 1D2EA 1QO0D 1T91A 3JQAD 1QP4A 1CS0B 4TQAA 2R751 2ZVPX 3B7PA 2AOUA 4MSUA 2VRWA 1JAYA 2HZ7A 2ZS8A 3H2GA 3P2KA 5DHPA 5G2OA 4D9HA 3X1YA 4LYDA 1L4FA 3T06B 3HRIA 4MWBA 2P7IA 1K6JA 10MHA 4F4HA 2HMYB 4H6WA 3LECA 1PR3A 4HBGA 2GLUA 2JF0A 1ADCA 4QRDA 1KP3A 2J07A 5BY2A 1I1HA 4NESA 1PV2A 3GF4A 2ONKA 4YPOA 5G3YA 5LVAA 4HI0E 3W3AH 4LJ7A 4C4PA 1NA5A 2ID7A 3QX3A 2ZTMA 4ZEWA 1PYGA 4NP6A 2UU9B 1AS3A 1BHO1 3GR6A 5HF8A 2QROA 3W3AA 4D9GA 4D45A 1NG9A 5IULC 3MCZA 4LDNA 3OOJA 2PT9A 4M0DA 5T4EA 3I5MA 4MYDA 5KYXA 1AM4D 3CF0A 2VSXA 3GCXA 3GJYA 3W2EA 5DM0A 1XNGA 2DOGA 2IOFA 4KN6A 4HKTA 2DM6A 2VHEA 4XKWA 1C8VB 1EWKA 3ABZA 3QPVA 1IPFA 4RVHA 2POQX 2HWUA 2PX5A 1GZVA 3RT1A 3FTDA 4E1BA 2I22A 5JW6A 3QVKA 4ZTZB 2Q62A 1T4MA 2ZZGA 1R7RA 2Q29A 1W25A 2YVKA 3ABIA 3AR4A 4MV3A 4QYSA 4IZ6A 1TQ4A 3TBHA 2PXCA 5CA1B 3A9RA 3QVXA 1SXGA 2ZB8A 1R8SA 1Z56C 1Z8FA 2QTRA 4PLFA 4U2FA 5KHAA 3NFRA 3GLIE 1HE8B 4HEQA 2ZSKA 2Y1CA 3HZHA 5E1DA 3SE0A 1TMKA 2GM5A 2VWHA 1T9AA 2GJKA 3VOBA 3HJNA 4D9EA 1SAYA 2KHZA 5LZ2A 4QUKA 2REOA 4WOKA 3I05A 3EOZA 1QGUB 1CF4A 3WNDA 2CYAA 3E4DA 2CD7A 4ZALA 1CY8A 1JKMA 4BE7B 2WKRA 4EKDA 3CX4A 3OZIA 3TCXB 4JBWA 3R44A 4PHTA 1O5IA 1QPZA 1T43A 4RHTA 4O5AA 1E1KA 2WUWE 2HCRA 3A2NA 5CLHA 4QQNA 3SSOA 1PTJA 2XOKA 3SP1A 3LX6A 4REOA 2YJ5A 2NOAA 2Q3FA 2O52A 4TXJA 1JLLB 5CLGA 5LB4A 2CUTA 3R0QA 4ZVOA 2REXB 4PR3A 3I42A 2MIIA 2WZDA 3GVCA 2NU8A 5BN4A 1DAHA 1E43A 2YH2A 2QLJA 2VZ8A 3THOA 3OFNA 2BT4A 3H42B 4BMPB 4BO8A 1F8FA 1MAWA 2XA9A 3R74A 1UK7A 3QPUA 3ZE9A 3HXQA 1A71A 3ASYA 3WWZA 2ZRDA 2GM4A 3DJYA 3KG2A 4OFZA 2WJVA 1NDHA 1U98A 2IXAA 4TV8B 3BK1A 3RYHB 3VUFA 4DVGA 3DYIA 1AURA 6LDHA 1OT5A 2NW6A 3A4MA 4OTZA 4F38A 3VU0A 2JGNA 4YI5A 4HS9A 1R64A 1YDFA 2X2OA 3BDAA 3NAGA 4QUGA 4BMCA 2BJWA 1S72B 5T6MA 3WI7A 2R5WA 1HMYA 1HYBA 5ALPA 4QAQA 1U0LA 1NXXA 1YDMA 3DC7A 2BM1A 3HCOA 4LQCA 3TW8B 3WYFA 1OBCA 1H9AA 1RWOA 1N2EA 3ADOA 5FUQA 2AFIB 1KOFA 1C50A 2VK1A 4UBLA 3ZN2A 4CMGA 3VYSB 1H2BA 3DEJA 1IBKB 4IV5A 1P18A 3UAZA 3DBHB 3KZCA 4A91A 5CLIA 3WA6A 4DG9A 4JELA 3KVNA 4TKUB 1GVHA 2XW6A 1IHPA 3LI2A 3UMCA 4Z4UA 1R27A 4FYYA 3O8OB 1SKYE 4ZEMA 4BGDA 2A57A 1KO1A 2JA1A 4FDMA 3U7RA 2FPIA 2IEIA 5I7VA 5L7WA 3JQFA 4W1SA 4E2FA 5FO1A 4WBXC 4NZYA 3U60B 1ESNA 1R00A 3N0WA 3PYMA 1QVAA 3H4MA 3IDAA 1BAPA 2Z57A 3OJWA 1RI3A 2LE0A 2W58A 2XRFA 1RHRA 2WAYA 3GPDG 3M1AA 4WKPA 1URPA 3VU9A 2HBYA 1DCKA 1U0HC 3IODA 5IDYA 3KB6A 3TRFA 1N33B 1P74A 3GYGA 1VRWA 1R4MA 3IUNA 4N7MA 3VPFA 3KXDA 2QV7A 3WGOA 3ZEIA 1L4KA 2IEDA 2W93A 3HBJA 3GGPA 5ERYA 3IUYA 4DR3B 3NOVA 1QHGA 2R4UA 1P2BA 2QW1A 4C08A 1E1QD 1W0KD 2I7XA 1Q84A 5JADA 5B3JA 4C0SA 3UB2A 1BS1A 2QR3A 4QUBA 5TSDA 1BFDA 3TIFA 4LOAA 4OHRA 3LBHA 4LS3A 1YHYA 3EVZA 3R0XA 3BKXA 4XCXA 1XZBA 5FV7A 4EDHA 1HDIA 2EHJA 1J8DA 3PXDA 4K5QA 1H66A 1MOZA 3L0CA 5G1OA 5KQRA 3R4VA 2PS3A 2FETA 1ZJYA 5HBRA 2H57A 2JHCA 1KBQA 4C0JA 1FZTA 2PE3A 3V4LA 4MLCA 5H3CA 4K9KA 4RDCA 1VJRA 1KNXA 3HO6A 2E6KA 2O2DA 1SCDA 1YFKA 2GO7A 3RK1A 5IBCA 2O54A 3MW8A 1V4VA 2P9EA 1FUYB 3KR1A 5F77A 1KY3A 1S8AA 4IIGA 2G72A 4KJZA 1NBME 4B2IA 4DCOA 1IXYA 3I2KA 1LFAA 1YCFA 1GN8A 3ED1A 4FTWA 1LWOA 1GLVA 3AHJA 5KCZA 1KEVA 1NQXA 1F51E 1GRVA 1BU5A 3JAKA 1XLUA 4EOGA 1JHUA 3BQNB 5DBIA 3TJMA 2OVFA 3K5IA 3CVYA 2EJWA 2Q07A 3HQ4O 4AM8A 1MENA 2FE1A 3NBKA 3QX7A 3KKOA 1ZI8A 5BYKA 1P2TA 1XNJA 4IQGA 3GDFA 1FLVA 3WHLA 4ALMA 2XWPA 2ZIVB 4FIZA 3R5XA 1JAIA 4GS5A 6REQA 5LU9A 3ORSA 4TL7A 2Z3ZA 4R1TA 5LP6C 4DAEA 5CA0B 5J2TF 4Z49A 5E7IA 3F73A 1RC8A 5CXUA 4HZUB 4KQGA 1MNQA 2ZB4A 3SIRA 3CN7A 1U8XX 2QY6A 4OH7A 2WILA 3D8RA 4US0R 2HRQA 2QRVA 2IZ1A 2QQFA 1O6FA 1GIAA 3DEFA 2IE0A 1FNCA 1DKLA 1PEKE 1B42A 2BUAA 3MA0A 5DBHX 4EATA 1Z38A 1EGAA 4OG2A 2H48A 1OGIA 2YJ3A 2ZG6A 1L1RA 1QVWA 1A4IA 2PGOA 2EZTA 1R0YA 3EF0A 1D04A 1FEZA 1ORHA 3N8GA 4J2HA 4JXJA 3DL7A 5B2FA 3HXOA 1YE8A 1KU0A 2H3EA 3GFSA 4IIJF 1GDHA 2FW8A 1L4YA 2XNCA 2EAUA 3RREA 1F5NA 3NRJA 1H9BA 4IDNA 3UTDA 3VR5A 1CUDA 2C8JA 3VPAA 1SEPA 4ID3A 1FP7A 1R6XA 5HMMA 4UHBA 4CLXA 3WGQA 1SBIA 2QD2A 1X9HA 3A1EA 2GF2A 3P0JA 4IR7A 1EWRA 4NFHA 1P2VA 4RC9A 4GPTA 4MV1A 3T8YA 2PYZA 1CJUC 1DT3A 5BMVB 5CDGA 3EUEA 3B48A 4ZAXA 5LMNB 3DKIA 3JQBA 4Z53A 1YK1A 1OB0A 5IVIA 3GI1A 4O4LB 4RDHA 4AJHA 2CLDX 5EE0A 1U94A 4LPKA 3EGCA 4UVDA 5E8JA 1E1DA 3NETA 1N9GB 3EQ7A 4LW8A 4F96A 3HJAA 2RGXA 1E5DA 4LRSB 2D74A 3RU3A 1OD6A 4AZ3B 2CJFA 3AEKB 3CLSC 1C9MA 5F4ZA 4XIJA 3VR3A 2XKKA 3S2SA 3C16C 3R20A 1OT3A 3DE1X 3VZSA 1MXHA 1XD2A 3GA0A 2I6XA 3JX9A 3M5PA 2I54A 3QVOA 3QYPA 4FFNA 4G9EA 1EUDB 1MDBA 4IV8A 4P9NA 2I78A 1HVXA 4JODA 3EIWA 2D5AA 2J4DA 2PWYA 3WP1B 4A5SA 5J2UA 1UMBB 4XGRA 2VF2A 3QKSA 2J9GA 5BMVA 1BGWA 4O2AF 2C3YA 4YO7A 5I9SA 5EHZA 3L7JA 4JI8B 1KI6B 3KB1A 2JD1A 2YMMA 1DC3A 1C0IA 3DT6A 3H3FA 5A1TA 2BSQA 4ND1A 4KFRA 2NZYA 4ILEA 1EFDN 3DO6A 1V7PC 5DIZA 5IANA 5IM4F 4R71A 2OC4A 2XQKA 4RKRA 3KB2A 2QZ4A 4UEJA 5K3BA 5KOIA 2F2TA 4R84A 3FKQA 4JJKA 4FGSA 3RFUA 3BRWA 3GT7A 1KS9A 4WCVA 4DSZA 2QIOA 5E0OA 3ICQB 2HWYA 2WF6A 3PUMA 2Z3WA 2EBUA 3BXFA 4GSYA 1FLDA 3BWDD 1KZ4A 5T4FA 4E0BA 2R2AA 2DQ4A 1FRNA 4UFPA 3OQJA 4H4CA 4YJFA 2XQVA 3IP6A 4PG8A 5B64A 3WTBA 1XLTC 5B53A 5EIOA 1XNHA 3RYCB 4PAMA 1SUSA 3AI1A 4ALLA 4WASA 1ZC3A 2E4UA 2VJOA 3IBSA 4EP1A 2Q5JA 4JJAA 2F1KA 1O8CA 2HR1A 1M1NA 2EZ8A 2C97A 2HF9A 3FGZA 3K8OE 3S40A 2IP4A 4ALNA 1L7NA 3W34A 1WG8A 4RHXA 4DY4A 3D3JA 4KCGA 4LYFA 1N5LA 3D3KA 2Q2NA 4RANA 1G6KA 4YJKA 3K6SA 3KEOA 2BGRA 1EWVA 2HXSA 1HDOA 1JTEA 5CAEB 3F5MA 2F9FA 4TYNA 4IRMA 2XLBA 4MQEB 5AI4A 3ZY4A 3MMNA 4IHAA 5FCDA 5H80A 3SJCA 3OETA 1L8QA 4G0UA 5EIHA 3DDNA 4K9MA 3NHBA 1IY8A 2D00A 2IUSA 5C8XA 5HZAA 1UODA 4XWGA 4ZU6X 5I9TA 3U3JA 2O8DA 3F4BA 1SVIA 5IZ4A 4IIJB 4V0OA 1P1JA 3U3MA 5AD1A 3THRA 2FE4A 3DOOA 3CCSB 2C7OA 4GEKA 1X15A 2GEJA 3GL9A 2IRWA 4MR8A 3HNOA 1S2MA 1X70A 2WYVA 3TW8A 5ED0A 1V7ZA 2XGMA 3ISXA 1VLOA 3S2ZA 5J3OA 2XZLA 1BVRA 1YB5A 3OY2A 2ENWA 4UKDA 2EV9A 4WNIA 3H1BA 4N39A 3O8OA 4FLMA 1P29A 1XE3A 5HFNA 4NBUA 3KKEA 4EYEA 2IYSA 4WIAA 1H8HD 2UUOA 1E4EB 3ZWPA 2YIDA 4DDTA 2O8FB 1NT4A 3BJEA 2HWXA 2IHYA 4ZT2A 1T8PA 3F4LA 2ORIA 1FVXA 3N0XA 4JSRA 3CRZA 1H0KA 4KXVA 4UARA 3FGOA 2CBXA 2GHQA 3CZ5A 5JARA 1EA5A 1P80A 2YWCA 4LYYA 3A4YA 5DP1A 5IKOA 5C52B 4U7GA 3BMCB 3QJYA 4Z0NA 4F4JA 3NFYA 2VQ3A 5HFJA 4GI5A 4N48A 1MB3A 2RHGB 5AJXA 4PX5A 1WE2A 1VIAA 2IE8A 3CNOA 3EFHA 4C0KA 1QONA 1IVSA 5D5HA 2PMKA 2FTKE 1THGA 2O7RA 3KHSA 3L1IA 3B6MA 3DDHA 3WRXA 2DECA 4U2BA 4YRQA 2JKYA 1U28A 2I03A 3KLPX 3UKDA 2JI8A 4E09A 4EGCB 1JR3D 2QNBA 2XUAA 3FJ1A 2VEDA 2Y76A 3W5JA 2XNDA 2H1FA 2BDTA 3AB3A 5HFAA 2AK3A 1IUNA 3PRHA 1VQ8B 1PU2A 3DTYA 3DO8A 4MINA 4Q9LA 3WMEA 1R66A 1Q0UA 1AQLA 3JSXA 2X6WA 2HBZA 1TDJA 4X97A 2VUSA 4GKBA 1LH0A 2IUEA 4A0QA 4TKMA 4FZVA 3DZKA 5EWLA 2FN7A 4J16C 3WAKA 1TLTA 2IPXA 3BMCA 3ZQ6A 3PSHA 2HW8A 1U2GC 3H05A 2GA9A 2WKPA 3CE6A 3CLVA 3N8DA 4IDOA 1I10A 3EMKA 4ZJPA 1J1UA 4CLEA 3DNPA 2QM7A 1HDGO 1D6MA 2M6LA 3QG5A 1UK8A 2W90A 3RSQA 1WABA 4HNRA 2CXXA 3EQ8A 2Z1NA 3W2IA 3GUCA 3DKVA 1JEOA 5CB6A 5AN9A 2RDMA 3VI3B 1ZD2P 1M2EA 1K5HA 2X2EA 1JIIA 1IY2A 5DTQA 3TW0A 2XVYA 2PD4A 5ETJA 2ZU0C 3L8HA 4IJ6A 3HEAA 2QMYA 2ZULA 2F1HA 2E9SA 3RUFA 1M8JA 4K86A 1Z2EA 3WZ2A 3R5SA 1QWSA 3LCVB 2DLNA 3JU3A 1ZOSA 2I9KA 3WKBA 2V55B 3KCQA 1O95A 4E07A 2A1TS 2GASA 3NJ8A 1CLUA 1S9HA 2PZBA 4KLAA 4C6SA 5IUJC 1QK5A 2ISCA 2QA4B 2F4VB 1JRLA 2I1LA 3KZOA 4L0MA 4MUEA 5HJ5A 1JR6A 2Y68A 1DWPA 1NY5A 3EVNA 2YBEA 4F2WA 2BELA 1JQJC 4MIEA 2ZR0A 4N8SA 3OPMA 5G0UA 5CAEA 2ZTLA 5KOYA 1N8TA 2G9VA 2IZZA 4ZCSA 1QBKC 4NWIA 1BHQ1 2NV4A 2LD4A 4X1KA 3QEBZ 4L3VA 5CDFE 3LMKA 1AS2A 3TX6A 2P8SA 4BX8A 4A03A 4WNYA 4CT5A 1Z6GA 4X94A 3WYBA 1L8LA 2EARA 1QANA 4MRPA 1IHYA 2ZWVA 1M8PA 1OW3B 1ZG3A 4KQJA 4PCUA 4RZ2A 5FR2A 4KOEC 4DDHA 4LK2A 4TKZA 2BFBB 2QD3A 3R9KA 3UV3A 3L07A 4OHWA 3VNSA 4C21A 1ZVJA 1HLGA 2X0EA 4IVQA 4YA6A 1NXQA 1F4VA 3HGTA 2P5TB 2IBTA 3COSA 4ZA2A 2JLUA 1V5FA 2P69A 1R4MB 2VPWA 1DJOA 2G4VA 1T13A 5CH8A 3UN1A 5HXBA 5K6RA 1AE1A 2OBLA 2O4CA 4HGQA 4A23A 2PS1A 4RCYA 1KSGA 3PUHA 1R9NA 2CHFA 4GYJA 1NN3A 4AY3A 4ZYXA 1R9GA 3G2NA 4J0FA 2C5BA 1UAGA 4G5SA 1RAIA 1DZIA 5TRTA 3E3AA 2WDZA 1X39A 2XYPA 2JCXA 3HG7A 5EUQB 1U0GA 4AKHA 4JWTA 1QMPA 3UC5A 1V9SA 1UJ6A 1NV8A 1I18A 1U7DA 2ZUBA 3AJAA 4JP5A 4U0KA 3VDRA 1X1BA 4CDMA 2YINC 1I2AA 2G9QA 2GTHA 3BXOA 4KJXA 5HHTA 5JSHA 1TK3A 1W36B 3OE1A 4IJVA 4Y9SA 1LBSA 4DV6B 2PGNA 2IEZA 1OGJA 1E62A 1PL8A 1ZN8A 3DXYA 2CHUA 3R5HA 1YCDA 4R9SA 5D3QA 3WRWA 4XTRA 2AC7A 1O96B 2ODWA 3IP5A 1YI0A 3DDZX 3KHUA 1TZCA 1X1AA 2VF5X 4OEHA 4UU1A 2C5FA 3BZUA 5DHUA 5IC4A 3FOEC 3ZWBA 2OCKA 3WIEA 3WYCA 3FW1A 3JQ8A 4YB8A 1ZGBA 4FFOA 4EHNA 3D02A 4P83A 4TLCA 4RJ2A 2O4UX 4LJYA 2CLKB 3U2QA 1HOXA 4N3AA 3K1ZA 3OIYA 3GZNA 1NSYA 3KQPA 4YRAA 3KQYA 1RFGE 3IQDB 4PYLA 4FZJA 4KEAA 5D87A 3AM1A 3CB4A 2IHTA 1JQKA 1KY4A 3GVJA 4TQUS 3ZGXA 1RMYA 4Z6KA 3M49A 2QZSA 4OLJA 4BFSA 4TT3A 4K46A 5DFAA 4JITA 3ZD7A 1V7CA 4GM4A 4GXNA 4F3TA 4YCDA 3K1AB 4D4HA 3ZDBA 3WISA 1WEKA 2ECQA 3U3XA 1G2QA 5M34A 1EG7A 2RGUA 5FNVF 1YUBA 4RHYA 1WXHA 2VI5A 3MTBA 4GNRA 3STTA 1N7IA 4H7DA 4D4LA 2FFRA 2HSDA 3EEQA 1X8KA 3OT1B 4JOSA 4ESHA 5LLTA 3PL5A 4NCKA 2YWDA 1DB3A 3P0EA 2QRLA 4DM4A 4WJKB 2ZLBA 2OZLB 4Q3EA 5JH7F 4I4TF 2I3AA 3PNVA 4K0KB 2I7TA 3H5WA 4XZ3A 2JIOA 1GILA 1W6UA 2PUVA 3QEKA 4MB6A 3HKEA 4X20A 3KQWA 3SFZA 1ADJA 5WRFA 5GY7A 1N36B 4IILA 5K0JA 2FPPA 4R8LA 2RHLA 4V24A 2Y8EA 2GZRA 4I4TB 3K5PA 1WVGA 2IZ6A 3ZHSA 2Y0BA 3EDQA 2AVNA 2B30A 3K94A 1IOVA 5SY6A 2FSUA 4RTOA 1HSZA 2CUKA 1KJWA 4FEGA 2BMAA 1NIJA 2Q21A 2HO4A 1Y3FE 1FFXB 4UNQA 4YRRA 2SCUB 4N0DA 2PZ8A 2OSVA 3RYFB 4PBTA 1H0RA 4OI2A 3E03A 1VL1A 4MRVA 5EP4A 1N34B 1P9WA 2VNHA 3MUNA 4QUIA 1FMFA 4O1MA 3E05A 1JIXA 4KHZA 1OC2A 4NCXA 5CX1A 5IM5A 5A6SA 1BQ4A 4K8OA 2ZUVA 1ZVVA 3K0SA 4X84A 3SXJA 5K8LA 4QM7A 2YW9A 4LRUA 3K73O 4OYYA 5IJXA 5KPDA 3KVOA 2A9JA 3BSFA 4FBLA 3QMVA 1DXQA 1N6IA 3PNBA 3F5SA 2FWMX 4NS1A 2H00A 3SXPA 1EMDA 1F7UA 1X0VA 3DFKA 3GRUA 1VE1A 2WAOA 2WIDA 3V1YA 4AMGA 4CV3A 4NU6A 2Z09A 4DMHA 3TM4A 2C20A 5ED4A 4RTNA 3PRYA 3ANSA 9MHTA 1U0SY 3FNFA 3DE3X 2HJVA 1PJ2A 5IBRA 4MWCA 5M3BA 4ANFA 3SYTA 2O19A 1SPXA 2VO1A 4WSOA 3GJ6A 3MERA 2XNDD 1NWCA 4YAFA 2ADMA 5GTDA 5HSGA 4JXXA 3OT1A 4QOGA 5EINA 5A5DA 3ANTA 2KLBA 1V5WA 4G84A 3TNDA 4BTEA 2XB2A 4HPXB 1QVRA 4PQRA 2NMVA 1QDEA 4FR5A 3J81k 1RXYA 3HDGA 5I9LA 5KPJA 2XADA 4Q0MA 1WRBA 5F3WB 4RZSA 3AJEA 1EX6A 3P97A 4WWVA 4JR1A 2CNWA 3CS3A 4FHZA 4BNMA 3IV9A 3UBMA 3O7MA 1L7RA 5FPHA 3BOSA 3M6IA 5IT9A 3IULA 2FOLA 1E60A 2NWQA 5GP1A 4F4FA 2CV2A 1HQKA 1V3UA 3S1AB 4HDOB 1P19A 4QDJA 4U1RA 4CU2A 4O6VA 4NQRA 2HA0A 5L3QA 2OZEA 2P2DA 1W5BA 5JXIA 4B45A 1ONBA 4BNKA 2N1BA 1RBZA 4NARA 2W71A 5COQA 4H1WA 1GGVA 2YY6A 3GCGA 4JBLA 1NMQA 4UHKA 1PJTA 4C76A 1EFTA 1N25A 2AR9A 1C3LA 2FZKA 5IN5A 2WIFA 2XUGA 4KRYA 3X1XA 3KTOA 4DB2A 2OCBA 5DTRA 1ADYA 1OASA 1M2OB 4E32A 3EDRA 3JWJA 2ZJBA 3PVZA 1AKMA 1JYFA 2WOJA 4X90A 2FMTA 2A3NA 1ZJ6A 1KEEA 1FUUA 3GEMA 2GPTA 2QVBA 4QXPA 5JSQA 1FFEA 5JYEA 1KJYA 3ECCA 1B6TA 3GAAA 3INGA 3JW8A 3M3PA 3OC0A 4LTNA 3WGTA 2H51A 3EE6A 1Z6AA 1VQOB 2WA1A 4OK5A 3I0ZA 1T9BA 4O4JB 2XGJA 3PBKA 4LMRA 4OHXA 4Y7DA 2PL9A 3KO8A 4IGEA 3RRZA 4A0HA 1C7ZA 3FN4A 2Z5GA 3ZZ1A 3K16A 5BVHA 4FLFA 2F1OA 1TZJA 1LCIA 1JLSA 1DIRA 2ZI9A 2P5YA 2N42A 2VJAA 3PNSA 2UZ0A 2R7AA 2YZMA 4OU5A 3A3BA 1ZGJA 1II0A 3U0VA 3KJQA 3ER6A 4C6TB 4JLKA 1UDRA 3FKSD 2C03A 1DQNA 5A0FA 5J5AA 3RTDA 5I9MA 4DYVA 3JZIA 1C1HA 4YRMA 2VT6A 2BFWA 4U9IS 5DXAA 1H6AA 2QPLA 2I4OA 5EY5B 4HPWA 4MK4A 2XGOA 3BL5A 4Z3KA 6GPBA 3UGJA 4Z0TA 4R8KA 9GPBA 4PG7A 3DZFA 5FEMA 1SFRA 1MRNA 1GKKA 2JFQA 3UBTA 1FUKA 2K2WA 2A35A 1GTVA 1L7QA 2A9QA 2HSEA 4UVIA 5F1PA 1Q7GA 4MMXB 4ETNA 3ESYA 3O8NA 4A6DA 4GSKA 1KRWA 1YAHA 3K5HA 1JIUA 4AUKA 3D4BA 2JEZA 4MWEA 4BQOA 2PRKA 5IDVA 1KIFA 3B5JA 2W9XA 5HA5A 5BSMA 9LDBA 1KZHA 2XHEA 4IRXA 1KPGA 1LF0A 4KI0A 1KJQA 1QP0A 4DNQA 1X7HA 2F1JA 3P9IA 1ACMA 3BY1A 4FYPA 2E55A 5BWNA 2W2VA 1N5KA 3ONNA 3ZZTA 5EWLB 3FYSA 4DBLE 4D9MA 4ZZIA 1NNEA 2IK8A 2N0SA 2CSUA 2P4SA 2Z2JA 3OM8A 2H7XA 2XMSA 3GN2A 2CWDA 3MG9A 2IYFA 3L3BA 2C2BA 2ZYRA 3C3XA 1V1RB 3KYIB 4EB3A 1UQTA 4ND5A 5C34B 3TM5A 3OKFA 5CB4A 2Y67A 1SU4A 1RHUA 2O1XA 2CE7A 1QK4A 1FZQA 1FTNA 4TWRA 4XA8A 5TS3A 4E4RA 1N3BA 2RC5A 2OFFA 3R7NA 2CVZA 4F5ZA 3NVDA 1YS1X 1XD8A 3F6PA 2SECE 3L4EA 3Q87B 2W83A 4XQCA 4BAGA 5KYGA 4QU9A 5A4JA 5LZ4A 1MVLA 1Z83A 1FU4A 1SVUA 1XALA 2E82A 3E82A 1FLAA 1YDHA 2XUHA 3DE2X 3TW4A 3JQGA 2C2KA 1JR3E 3QV1A 2I4TA 1KMMA 4GECA 4JIGA 4UHFA 5A7GA 3T35A 4N5HX 1K9VF 5IWCA 1OX4B 2H63A 2WJAA 4YT4A 3Q3EA 4ZHSA 5JR3A 4MUXA 1A5AB 2GARA 4MUNA 2FX3A 2R6R1 1KQPA 1NBWB 3EHDA 4GR5A 4I55A 4RVNA 7ADHA 2FJ0A 1DV1A 1Z2OX 3DLIA 3T41A 3TLBA 1P1RA 2ZE7A 4ARVA 3SIPA 4JZKA 1SKMA 3ILXA 3WXBA 1BD3A 3MHTA 4G4SP 2R6AA 1D6SA 1GTG1 1VQ1A 4WXPA 1Q81D 4KXWA 2BPOA 4LPSA 1UMDB 3LXUX 3LKZA 2XNKA 4IZOA 4DLYA 1AKNA 2WUVA 5LZ8A 4A0FA 4CKEB 4MWSA 5B1YA 1Y4ZA 4MA5A 1VHTA 3LUCA 2F3UA 3FKSA 1NW9B 1ZIDA 1QZ3A 2CDCA 1EA7A 1YR1A 2EF1A 2QJRA 4MV6A 1QP7A 4XLCA 3PX2A 2C2YA 5AK0A 4M6WB 1E6MA 1VSBA 4KLZA 3W5HA 1FQWA 1JEEA 4I4TA 1DE0A 2GCPA 1NC1A 4KXYA 3TFWA 2ZI6A 2VDWA 4Q7KA 3ZW9A 4R98A 3EGDB 3HLKA 1ZM3A 4GOND 621PA 1DG9A 2IH5A 1IEVA 2V4ZA 2B37A 4BZPA 1LPMA 3R3UA 5F2NA 2L0XA 1S3FA 4N6OA 3I0MA 4BFTA 1VQ7B 3SC3A 4DRZA 2PYDA 1E2BA 4IOJA 3FRIA 2ZCJA 1PR6A 1IZ8A 1VPLA 4UHEA 5LQDA 2GEDA 4ZCIA 1HURA 3OTWA 3R6TA 3VX4A 1JSZA 2XWBF 3K20A 4BFVA 2EQBA 3O4RA 5CYGA 3OAAA 3LXXA 5DBEX 3W6OA 4AJEA 4Y2RA 4BVLA 3N7AA 4MYTA 2B4YA 4BYGA 3HKBB 5LCXA 3UJNA 2WJPA 4G0WA 3ZWQA 1ZXBA 4BASA 1E0AA 4EVIA 5JO0A 2DT5A 2F3SA 1WHSA 5ECWA 1ULBA 3GAFA 4KBYA 1J25A 4BLTA 2XH8A 3IE0A 4KUHA 3CPJB 3MZ0A 3GK3A 2F43A 4LC1A 3OWHA 3IV7A 1NKTA 2B1JA 4BXOA 1VYUA 2I33A 1RJEA 4G5YA 4M37A 2GJSA 2F8SA 3O2JA 4Z9FA 1QAOA 3HE3A 1QKKA 3HYNA 1P7ZA 3IQXA 4GFDA 4UTXA 1RR6A 5F4BA 5FOTA 1Z39A 2XF8A 4XVUA 1NE7A 2YFQA 1FNMA 4LY0A 1T5IA 3U4DA 1JI3A 4CLOB 2RAUA 3QEAZ 2K2QB 4E51A 1RYYA 3BH6A 4AS3A 4L85A 4EAAA 3PJRA 3M7IA 5JYDA 4MA0A 2VCEA 2CL7X 3T5MA 4CQLA 2YHSA 1J1IA 3VR5D 2ZM5A 4JS0A 3GLHE 1UDCA 4H0FA 3B1YA 2NVOA 1U2EA 2AN5A 3E0QA 1SCAA 4HDMA 1K3UB 1BFUA 3D6AA 4LYGA 1LZKA 4PFQA 2JLWA 5KWJA 3H5TA 2X15A 4O4LF 1XXHB 1I8TA 1ICIA 2QAGC 2PRIA 3I37X 4OXQA 2IY8A 1R6BX 1YQDA 2P3OA 2H6EA 1I1QB 3AR7A 5CYFA 3EWIA 4IHJA 5AK5A 5JFGA 5KTYA 4DDWA 1CULC 1WSVA 4MP6A 5FIUA 4QGBA 1B15A 1PJ8A 4XONA 1WUHS 1K92A 1T1GA 2DHCA 1EZZA 2H4WA 2VJKA 1TM1E 3HUFA 5BR8B 2SKDA 2OCGA 1G291 3G0BA 1MH9A 4M8SA 5E3JA 5F3DA 1UKZA 4IH4A 3ABOB 3AYXB 1VG0B 1ST3A 2ZAMA 2FY8A 2QRJA 2XB4A 2X5JO 4ALKA 1XF9A 3G85A 4NICA 3G7SA 1Z06A 1N4AA 1HV8A 2NP6A 3G0GA 4HH4A 2R48A 3BDIA 4US2R 3H1PA 1C1DA 2ZVJA 4XB1A 3UMMA 3CW2A 2I9PA 4YR9A 1UMDA 4FDAA 4G5HA 5LDHA 2P9FA 2Q5HA 2ZR8A 4F86A 1TZMA 4PX2A 5JD6A 1V5IA 1VCOA 2Q3JA 3SMVA 2PL5A 2ZJ6A 3UMSA 4ZVNA 2BW0A 2NX2A 4MR9B 3RYTC 4OP1A 1CB7A 4PBSA 3SSAA 3DGEC 4HZIA 4HB0A 3STWA 3WLNA 2V3CC 4IG9A 2PQ6A 4RHEA 3L4SO 3VGJA 4YJ3F 3PCXA 2ATXA 4DR1B 4HAIA 5IBQA 3R7SA 4E13A 4ZWNA 2PLNA 4UPDA 4Z4SA 5K0FA 2Q4BA 1EK2A 3GG9A 4M6WA 4M49A 3G2JA 1RHJA 4D4IA 3LHSA 1TM2A 3HM9A 4JI1B 5B1EA 1WMAA 2ZJ7A 3NG1A 4L7VA 3ZBQA 4X62B 5D86A 1RM3A 4AROA 2BEUA 1SXPA 1R0BA 5DYTA 2EJTA 1RKUA 3GPBA 5BSHA 1SZJG 3RAFC 1QYDA 2XRZA 3AEQA 2EZUA 3AF1A 3C70A 3DMNA 4DABA 1X9IA 4B4OA 4EY3A 5JANA 4M0FA 1SHTX 5C8VA 1EFLA 3CSUA 4LMPA 1S8NA 1WOPA 3UHAA 1UAYA 1G98A 2A86A 2WVHA 1SUIA 5BQPA 3UWMA 2ZRQA 2VH1A 1XJWA 2KPOA 2QYHA 4RFLA 4N1AA 2VCYA 1FUEA 4N65A 3TO5A 4GUAA 3PHJA 2WEKA 2XHZA 3NHFA 1PZXA 4RPJA 4X1YB 3IHLA 2XYGA 4L07A 4D0SA 1WTAA 3N2GB 2WQ6A 4WKGA 1SH7A 3IQHX 1Z2NX 2NU7B 4MEAA 2YV5A 5K3OA 4UEOA 1VE7A 4JJEA 3GB9A 4B81A 1UKEA 3KPWA 3A2MA 2JFWA 3FCUB 5AW8A 5A7FA 1NTRA 3N39C 3UV6A 5LUAA 2E4WA 3DOCA 3GEPA 1D8TA 3JVEA 4JX9A 2VF4X 4G89A 3VVBA 2E21A 4IDBA 4EECA 4EBBA 1J99A 5BMOA 4C7OA 1UEXC 1L4NA 1SELA 4R9VA 3EG5A 4L4UA 5B1HA 1P2UA 2VKTA 4RMIA 2GVDC 2BGNA 1F3LA 1N5JA 2GAOA 1D6NA 1VOTA 2LW7A 1ZO8A 3A4NA 2BBTA 3CZMA 3QNWA 4LBYA 1NRJB 3RC1A 2IXFA 2P7HA 2Z08A 5KMGB 2V5AA 3WLQA 3DBLB 1HSOA 1BPLA 1ST2A 2C0PA 5A3SA 3F3SA 3BRQA 2RGRA 4DLLA 3PP8A 2B4RO 2QJWA 4AF6A 1R10A 2WJ3A 3JWGA 3MJRA 4MDFA 1VQNB 3CUYA 4MUKA 3WGIA 4HWRA 2J7PA 4JD5A 3X2EA 3OE5A 1JJAA 2V1XA 2QLLA 5D3MB 1SQGA 2PGLA 3OFKA 2VEOA 1JECA 3B7GA 2O23A 2WYOA 4FQ7A 1CF2O 2ZIXA 1GZ6A 1ZIOA 2FG6C 5DSTA 2IX3A 3DXFA 4I7EA 4P4NA 4I55F 3SLGA 4QVJA 1FNBA 1EVYA 4QV2A 2R44A 2E4VA 4RMHA 5B37A 3BXEA 4J9VA 3VGPA 3PQ8A 1JHXA 2O05A 2CE2X 3S44A 1JXOA 4OQMA 4BKRA 3A1TA 2NO1A 4B5KA 2QORA 3BB1A 1T2VA 3GEGA 5LZ7A 2LVBA 4CNBA 1EUDA 4I4IA 1YHNA 1XOIA 5JBIA 3EA5A 2H17A 2V0NA 3QXGA 4IDAA 3DEKA 5E2BA 5DN6D 1CV2A 4A26A 4DQXA 3RU9A 1EINA 6NULA 1RQGA 3I4CA 1JUDA 1COWD 2OTCA 5B7QA 1T5BA 2OFXA 5AVSA 4RMNA 1NQVA 2QXYA 4XAQA 3TLEA 1DG1G 2VUIB 2AL7A 1WQ3A 4JR2A 1W76A 3C3PA 2VL7A 2BKEA 3KJEA 1EFKA 1DEOA 1KH3A 5DBOA 5C8DA 3OLWA 1CNMA 1WOMA 5A6VA 2GKSA 1CY6A 3RTGA 2O14A 1RZVA 4K6FA 3H11A 3IELA 4EG4A 3FRHA 3IFSA 5EEHA 5K01A 2FMHA 2KMLA 1J06A 2FB9A 8ATCA 1RWKA 3RT7A 3Q2IA 5JNLA 4LXUA 1T4CB 3ZGNA 5D7NA 2YHUA 3ONWA 1YJBA 3CPHA 3P0HA 3SGLA 2QLNA 1C81A 1DXHA 1YJ5A 4RENA 2Y1LA 3QUTA 3TNJA 3DW3X 5LYYA 3QENA 3T54A 3VJKA 1AO3A 4L4ZA 4LDPA 2V8OA 5TEWA 3OOSA 3QXHA 1PJRA 2TECE 5DLYA 4BO0A 2HZBA 4QO7A 4RH3A 2CSXA 3GRCA 5EYPA 4G1CA 3DDOA 4LY3A 3TBKA 1NVEA 2DUMA 1E1CB 1GSHA 1E9DA 4FHGA 2J5BA 3VM6A 4DA7A 2R4TA 3FI9A 1KEUA 1VHDA 5D3KA 3KU4A 4OM7A 4AXXA 1HEYA 2QJOA 3TUIC 3HADA 2XT0A 1GQYA 1ORDA 1WF6A 1RHKA 3K8QA 1C4OA 1P60A 5G41A 3ZXSA 4JBHA 2I2BA 4RIGA 4Q3KA 4BO7A 2R6ZA 1ZK2A 2HPHA 3N2LA 5IUKC 4OI0A 1DTEA 1EFPB 4Q7EA 4X7MA 4YRKA 2ET6A 1W7AA 3DZBA 4PINA 1CZKA 2ZTVA 4PRYA 1OXVA 3GGDA 1KZYC 3IJ5A 3IP8A 1XFAA 3W6NA 2E49A 2X8LA 3LWZA 1GM5A 2ZJ4A 2YZ2A 4AY5A 4RA9A 4EDFA 3W5CA 2QN2A 3BF7A 2QXUA 3VSDA 4Q66C 2E5LB 4UTOA 3FF4A 4W8HA 1O9BA 4GG1A 2Y1XA 5AKYA 3NVAA 3EX7C 2ANBA 1DOHA 4BQFA 3QE2A 2XMZA 3R0IA 4RJIA 1TZKA 3BMXA 1W47A 4D9KA 2WDPA 5LQNA 1FCJA 2Z4SA 2I67A 1E9CA 4GP7A 5LBUA 1P17A 4KQMA 2Y99A 1LPNA 3AW8A 1VL6A 3PR1A 5D84A 2F3TA 2P6RA 3ZWDA 3DD5A 1KI3A 4PFJA 2G9UA 4C7JA 4DQKA 1D2HA 4J0GA 1VHOA 1XZ8A 3L8GA 4RPKA 3TLZA 1P44A 4ONEA 4D96A 3AF2A 2HYIC 4QBIA 2PR7A 3ASTA 4F60A 5H4HA 4MVJE 3C6QA 2TMYA 1OAOC 4Y0AA 5F7JA 4EARA 4P1VA 1MTZA 1WPRA 4Y2TA 4YELA 1DXOA 2AF4C 5EPUA 4IDGA 5D6OA 2BGGA 3H0CA 2ZJZA 4CR7A 1SVWA 3K72B 1RCFA 2VPPA 4ZOLF 2M2IA 1WZNA 2A5JA 1PQWA 2QQ0A 1I5OA 1C7IA 2H2DA 1YULA 3P0IA 4DCGA 3A8JA 4X1IB 3NHMA 1EFCA 1ZITA 3ILHA 2F55A 1G2OA 1P6UA 5CT4A 3KR9A 3T1OA 4NZNA 5KQGA 1MO4A 3QW2A 1U9IA 4ENPA 3QHQA 4QJIA 5EJFA 3T4EA 4MKIA 4ZVLA 1G5IA 2CJPA 2QL5A 2X7XA 4FYXA 4L5IA 3Q3IA 4KQ9A 3BMOA 1VPTA 2JKZA 2ZRGA 5C8YA 4DVJA 2E1RA 2W5UA 1A7JA 3W3ZB 1UDWA 1T5SA 4RWZA 3J80A 4KXQA 1XKTA 4NOLA 5JD3A 5DWDA 2BFEB 3H19A 2E87A 3VNRA 5AVUA 1MTOA 2GTIA 3A3KA 3AIIA 4Y3UA 3AR5A 4YVFA 4F3KA 3W4KA 3M6FA 3JTMA 4BLVA 2WZPP 1GZ3A 4O3FA 5DI9A 4B3IA 4DIFA 1E2LA 2IZ0A 1PVOA 1CRPA 4YALA 1LC3A 4IDPA 3TIXB 1V2GA 1ZN2A 2RCNA 1OV4A 3C5VA 2AEEA 2FW0A 4QWMA 5ABPA 3BEOA 4UUMA 4ABYA 4YJ3A 1S2DA 3DOIA 3QM1A 4KN9S 2RGNC 1Y33E 1T2CA 4X8OA 2XT6A 3RS7A 5EZYF 3ZWYA 1I0LA 4C4ZA 2X7JA 5DNWA 2WAAA 1U8AA 4Q3CA 4D8WA 4G0XA 5I4BA 1U28C 4F8JA 4DEXA 4E11A 3EPLA 1WZ2A 3NVKI 1YL5A 4QDUA 3TK1A 4BCCA 2RAVA 1UJ2A 5IHPA 5MHTA 1QCZA 2YR0A 3HY3A 1CUCA 4KE9A 5AJWA 5L53A 1MC4A 1SQ5A 4D92A 5TE9A 1W1IA 3N2YA 1R5JA 3EMBA 3NHYA 3QVLA 4J0EA 4C89A 3D31A 4HNTA 3BRWD 4JLDA 3EN0A 2ZJ5A 3PFWO 2WIKA 4JYCA 1UFOA 1RRVA 3A0RB 4MAAA 4C7KA 2OCAA 3FSEA 2YJ6A 4HNAA 1CIVA 3VR6A 2C4HA 1FFYA 2GBLA 4JJFA 3X2SA 1PAUA 2AOWA 3NYQA 4QHYA 2W0MA 3RT9A 3PUYA 3FHTA 5TPWB 1EFPA 2ICAA 1G19A 4NU8X 2J7PD 3ZGLA 1Z26A 3T94A 2EEPA 1NVBA 2C7VA 3PWKA 3TZBA 3AINA 2JGAA 1EHIA 1XN1A 4QTXA 4ZOCA 2JJ2D 4LXTA 4OMFG 2BH9A 3AUXA 3IOCA 4FMPA 5LXTF 3O1JC 4PPNA 2GXQA 4BNFA 2BY4A 4URZR 1VF7A 1E6UA 4A8PA 3URMA 3P0RA 3U4QA 3C3DA 3D8NA 4NCHA 5CUQA 1B14A 4R2WA 1HDCA 5ICCA 1HZZA 3G9QA 3L9WA 1Y34E 2WE7A 3KOMA 2BE7A 2HF8A 1GKYA 1YZFA 3NANA 1X92A 4J3FA 4OBEA 4L6AA 5AKKA 4FS3A 5DHQA 1QGYA 4AZVA 2P0YA 3IHKA 1ESZA 4RPDA 3L7MA 4GU5A 4OGLA 5LYJF 1P91A 4AWBA 4X3PA 4MHTA 4GQIA 3A1UA 1DIOB 3RKRA 1B6GA 2B5VA 3TAHA 5CT5A 5GIPE 3NUQA 4LJLA 2FDCA 1DX4A 5IKMA 4QD3A 2VP9A 2BDUA 4UZFA 1EZ1A 1EKXA 3LYLA 1YR7A 4OQZA 4RELA 3SY8A 4D5EA 2OMEA 5L3QB 4IWYA 5ELMA 1PF7E 1EEXB 2QRKA 1QHXA 2VJQA 4X71A 1MA0A 1ABFA 3SX2A 5L8VA 3WBFA 3CIFA 4B3TB 2R8PA 1B0PA 1VGQA 3DAPA 4KPUA 3STHA 1O6ZA 2A6PA 1YNSA 3UJ6A 3X43A 5JSUA 4LDQA 5LMUB 2IU6A 5GGYA 4QBHA 4XCQA 5ALVA 5IYZB 1VLMA 3AVTA 2FPRA 2WKQA 1BMTA 1I4DD 2Y0DA 3BHMA 1X8JA 3M6MD 4OM8A 5EKXA 3HCWA 3IBCA 3NRCA 3PQCA 3AV3A 3ISJA 2ZYDA 4RPIA 5SZHB 1M73E 3WIUA 3EFEA 1N5DA 1GPAA 5F4OA 1E66A 2MR6A 4OHZA 4EPYA 5EHXA 3GVHA 2JHAA 2PZKA 1U6KA 2HLDD 3D7RA 4MDHA 3O38A 4DW8A 5FORA 1BE6A 2A9VA 3H8JA 5FADA 1KO5A 5G53C 1AXRA 4CIXA 1SOAA 5E6TA 2AQ8A 1AT1A 1GRNA 1R4NA 1SG0A 3H13A 3NEJA 3OMXA 4H59A 1YVPA 1IAVA 1SCNE 1B41A 3FPKA 5H59A 1KMHB 1PZMA 2HHCA 2PVCA 2Q5IA 3HVJA 5EHIA 1OMOA 2ZI5A 3EEOA 1JGTA 2XDQB 4GPZA 4CTNA 1C1XB 5DPMA 1XPUA 3AVWA 4WFKA 4CTKA 3MLBA 1C7JA 1U04A 4LYEA 3QELA 3TL2A 4JQZA 2LDXA 5I47A 1CQXA 3I0NA 4KQ2A 4DA8A 2VSQA 4G86A 3RVNA 4NONA 1XLVA 2D8MA 4MICA 1L5HB 2GB4A 3AZPA 2JJMA 2D7JA 3DBIA 4EUNA 1ZZGA 2HSGA 3PDIB 4J43A 5T57A 1A76A 2TRSB 4BB0A 1GFSA 3ZDZB 5JZOA 2G5CA 4WZLA 2ZBEA 2GN2A 1GTRA 4AX4A 3P9SA 5LQAA 1R8YA 4LF5B 1K6XA 1LUAA 1K06A 1WP9A 3AFNA 2I3BA 5C31A 2NZWA 1H8ED 3IIIA 1NYQA 4LCEA 4PAQA 4RADA 1C9KA 2BHLA 2C3UA 3R7AA 3WHPA 5KOJB 4HQOA 3Q98A 2I7VA 4RF4A 4WUVA 5AVVA 4JB8A 1KAGA 3TOSA 4N5LA 4N8EA 2MCFA 1S5PA 3CZ4A 1KEEB 2IEAA 4FHCA 3U7FB 2PK3A 4UEWA 1GNVA 2QJTA 1WL8A 1KVRA 5FQOA 4AJIA 4LF6B 2EATA 4INJA 4O08A 2W48A 4QHTA 3P9RA 1IPHA 1KF0A 1ZRNA 3DMTC 3L84A 1J0EA 4RKFA 5C7OO 2RGWA 4MRMB 3LT1A 4OL9A 4LJ8A 1ORIA 4RVDA 2Q45A 2YYSA 1DFGA 4F9TA 5L3ZA 2MMCA 1AMUA 1E3DA 3C3EA 3EZYA 4YDSA 4G8JA 3FHJA 3T4PA 4BXOB 2WUEA 3A6KA 2QUZA 4N54A 5F5XA 5KTPA 3DNFA 3QKUA 3JQPA 2CW5A 1CRZA 1TLFA 2ZT6A 2HT1A 5KWVA 4PWYA 1ZIXA 3KTAB 4GHWA 5ALKA 1T9GR 1VI6A 4IDFA 4K40A 1FY2A 3RDPA 1DFIA 5GVRA 4DZZA 2COEA 4DS3A 1DUSA 3RYCA 3IBGA 3TS1A 3R24A 3WL5A 5LQUA 4U5QA 3PENA 4W63A 5KUTA 3IQFA 1OTXA 1UZLA 3PWZA 4GWGA 2A4KA 4HN9A 1ZCBA 4TROA 1KK0A 1T5EA 1E8NA 2AJ8A 3IL2A 4HQRA 4P4UA 1U3TA 1SUBA 5BN1A 3VMMA 2XD4A 2D1TA 1CUFA 1E5XA 1JHOA 1YXMA 4FMDF 2VJDA 1U6IA 3IEUA 5JXHA 3P9NA 1RE1A 2ZDGA 3AHFA 1KJ9A 3KKKA 3A11A 1M66A 3B3QA 1QH8A 4O25A 2P3QA 4GKAA 2W8ZA 5J5VA 3STXA 1P0MA 4PW0A 4BMDA 1XZNA 2WU8A 4HAUA 1FTYA 1KC8D 3Q8LA 5JNUA 1VQPB 1WXXA 4KSCA 2JI7A 3GGJA 3QY9A 5IDWA 1V1MA 2I65A 1FU7A 1EUCA 2AN4A 2LKDA 4RMJA 1X7WA 3ROZA 4F6RA 2DWOA 1JLMA 1W5SA 1Y5MA 1NJSA 5L9AA 1J8FA 2RBGA 3ZKWA 1OC4A 1JHRA 3OIUA 3H17A 3HL0A 2SHKA 2YHBA 2F7SA 1VLJA 4M1KA 1M2GA 3N86A 5GOTA 3NX4A 5H9VA 2ORED 2RIPA 1MNAA 2XVAA 2PWZA 4V39A 3M5WA 3VC7A 1KYZA 2DWCA 3TRJA 6ADHA 4RPHA 2JAWA 2XJ4A 5J43A 2FQQA 1YNOA 5DSZA 1ADBA 3KX2A 3TYXA 5CB4B 1C2TA 2AZMA 4B3HA 2PUDA 1G20A 2QTZA 4CIDA 2ZL5A 4GH5A 2J59A 2V7QD 2PSFA 1W4CA 3HRHA 3DDUA 5BORA 3K9QO 1JVNA 1KDYA 1W0KA 2P6NA 5G02A 3EXHC 3U4HA 1XMOB 2BAGA 3B51X 1U1GA 2V59A 2W2QA 5B36A 1B93A 5T4BA 2POCA 3V7NA 5EZYA 3QE3A 2NQ2C 5IDXA 2PA0A 1BVUA 3LH5A 3ZKWB 4H4DA 5A4KA 5EIEA 3ME5A 1YASA 2PO5A 4RVSA 5B3AA 3RKUA 4CM1A 3CRMA 3ETHA 5ITWA 5J4LA 5LM3A 4ZVMA 2PLRA 5DTEA 1UKCA 3FCYA 1VSTA 3GBVA 2H08A 3GRRA 2FXVA 4A2WA 2Z0MA 4JNKA 1UBOS 1OFHA 5EIBC 2V6GA 1N32B 4MPTA 2OTLB 1Y7HA 5ALMA 4I36A 3ZHXA 1C8LA 1BMQA 1Y4UA 4L22A 5ULLA 3LY7A 1SZDA 4M9XA 3OEED 4J1TC 3ZWAA 1JL3A 3K92A 4MKZA 4OHOA 5DGHA 4EW2A 3V4PB 3A1FA 3S7ZA 1HTWA 2XTZA 3IR6A 4OYHA 4RVOA 2I4RA 1CEQA 2D0DA 4GXTA 2C5SA 2NSDA 3AG6A 2ID9A 3D7SA 3ZW8A 1YRAA 3PT9A 4DTCA 5KTKA 5HTOA 2XYVA 4OXIA 4LNUA 4FD3A 4RE5A 3M83A 3PEYA 4LV5B 2C7RA 3DLHA 1U0TA 4CI0B 4P4TA 5ECYA 5GJWC 2WWTA 2ZIEA 3HWWA 4P36A 1M2JA 1PIWA 5LIRA 3EXEB 2PUGA 1IUKA 1IIRA 3EUFA 3Q39A 5TNXA 1SQFA 1SU6A 4GNKA 4XUCA 4F1JA 5G4KB 1U8FO 1L5KA 3AETB 1XRLA 3O3NB 4RLHA 5IVHA 2BWJA 3D4NA 5TB5A 4BNVA 4M46A 2IV7A 1LPPA 1UJCA 1O9GA 4CTOA 2WLSA 1MX3A 1NE2A 3NHUA 3STUA 4FFBA 1XTJA 3TB4A 4G25A 2IY7A 4BX2A 1JPUA 1G59A 5C46F 1B8UA 1XGKA 4UBJA 3THWA 1ZJJA 3UY4A 3B8EA 2P9JA 1TUGA 3FZEA 3IX7A 4F21A 2EVWX 1M5TA 1F2UA 2GAJA 3IHWA 3OO0A 4FCCA 3U48A 2QMZA 4WZAE 1KEWA 1RAFA 3UJ9A 3W4JA 2EJUA 4JP2A 1UJ5A 3VZQA 2FWPA 2JZOA 3I2GA 1OKKD 3BORA 1F12A 1MO6A 1FFAA 5H5JA 3L6BA 2B8WA 3MTGA 3WK6A 1QTRA 2BC9A 1OJLA 4YFYA 5L4LA 3G8BA 3HB0A 1OX6A 4J0HA 4ZT4A 4X1KB 2GZMA 3N1UA 4UCFA 5A3VA 2GCNA 1ZGAA 2REBA 3G8YA 1JYEA 1S8FA 3JCZA 1D1QA 1Q0RA 1DAPA 2J0VA 4RVGA 1E6KA 4LRYA 5JU6A 4F92B 1OXKB 5A62A 4OOFA 1L9XA 2VDKB 3PVSA 4C2BA 1UC4B 2FZ5A 4DLZA 3HYTA 2E5WA 5HZKA 5IAEA 2AK2A 2MSLA 1PR0A 5LXTB 1EE9A 5HBGA 4Q21A 4KRFA 1OGYA 1OIXA 1IJFA 3K05A 2XIQA 4MUHA 4RA6B 3K71B 2C31A 3V5NA 1W9MA 1JS1X 1EP1B 4RK0A 1KETA 1WKBA 1XT6A 5MN4A 4JASB 3LT5A 3QTLA 4EG7A 2P62A 1YJNB 4LMAA 3GLKA 4ZCQA 4M2LA 4IJUA 1QUEA 4KFUA 3BC1A 4UATA 4IUYA 5H3LA 3FSJX 5A4MS 4B3RB 1HLDA 5J1SB 4DJ5X 3LUGA 4YY3B 3T1NA 2CD9A 2OWEA 4EG1A 4IKOA 3OTIA 4GIBA 4B3DA 4B2YA 4XJSA 2ZI7A 3GIWA 5E3IA 2OZPA 4BMNA 5I7AA 4WVFA 3WDMA 3HUEA 4KTVE 2FQ1A 4EO4A 3JQEA 3M33A 1XDDA 1ZXXA 5DASA 5E8RA 4QTYA 1K3TA 2CYCA 1K63A 1MP0A 3TX2A 1YVDA 3H2IA 3HGMA 1E3QA 1IEXA 3I01A 1TI7A 2PWAA 1SKQA 1N06A 2OV6A 5L4SA 3ZCSA 4QLBA 1NVWQ 4GMXA 4LFBB 2CMDA 2Y0EA 1JEDA 4Z4HA 3K70B 4DMFA 1ZLYA 2NVWA 4PQFA 5LYJB 1UBHS 3GRYA 2VHUA 3OHMA 3JALB 5J9FA 2I2AA 4AVYA 4ENRA 2J5RA 1WTHD 1OV6A 5E0KB 4EW6A 4NABA 3ENKA 2Q8QA 2R5NA 3ZQ4A 3OQMA 3IAUA 1E2NA 3DSRA 5BRJA 2QENA 5H02A 3T1VA 5T64A 3FOZA 3ERCA 1Q74A 2CBZA 2BIFA 2Q8NA 5KQPA 3AILA 5TXGA 2HCBA 1EB8A 4RIHA 3V46A 1E59A 1E77A 2BKLA 3QKTA 4HB2A 4XARA 2XUIA 4D4KA 4F4UA 2ARKA 4KV7A 2I4IA 1XVAA 2HA6A 4P92A 1VQLB 4ID9A 3EG9A 2QSJA 4J29A 3RRYA 4TKVB 4N18A 1ELOA 3G6EB 2A1IA 1AGNA 1Q1AA 4LC9A 4P3NA 3R7WA 3WLRA 3CVWA 3N07A 4LZPA 4Q4AA 4UE3S 3WGKA 4B33A 4BNJA 3NWBA 3IIEA 5EKTA 4I66A 3DMPA 4XPIB 3S0JA 1PBTA 3CUTA 2I7DA 1OWPA 1WXQA 1WLSA 2O7SA 3DR5A 2PBLA 4GQNA 5ALYA 4EL5A 2CBGA 2O2CA 4YECA 2E89A 2HSWA 3D1VA 5ENDA 3PX7A 1RNLA 2EBFX 4JUDX 2FPXA 1IB6A 3PEEA 9LDTA 1LWNA 2P75A 3UXHA 4B82A 4R16A 2ZIFA 4G1BA 5ADUS 2Y4NA 4PRZA 4W5RA 4MHSA 4U7JA 1O4WA 4Z4GA 5DRTA 1GCAA 2GAAA 2KYRA 3WLSA 2CJWA 2ILVA 2NSHA 2ORYA 1LJ8A 4C01A 3C3KA 1OIVA 1JW9B 2PD6A 4MS3A 1SVMA 1ISIA 1AS0A 2AUTA 2DFLA 1M2VA 3OBIA 5DYWA 4ZT7A 2VZLA 2QNIA 2UZ1A 2RKOA 1PR2A 3MS2A 1NXOA 2DU8A 4BDTA 1CY1A 2R7MA 2A33A 1J23A 3SLNA 4WZEA 1Q19A 3FY4A 2O8VA 5FTNA 3E2PA 1UUFA 2XXJA 4XTCS 4PN3A 5KQSA 3QVGB 2YYYA 3RUAA 3RS4A 3EPJA 3G1TA 3F97A 3E9EA 2Z5FA 2Z04A 1SURA 3U9TA 4J7XA 5FEUA 4E33A 2PNJA 1W29A 1Y1KE 3HSSA 3P9YA 2FPGA 5K20A 1ZOIA 3PA2A 1YB6A 2EFEB 2PBZA 3OKAA 5FBQB 3ZJVA 4EHDA 2XSZA 1UF9A 1K0FA 2IQ5A 1PHRA 4L9AA 5E4JA 4BFLA 4BLRA 3HEBA 1GPBA 1WQ4A 3MM4A 4HYEA 4YBZA 3VNAA 4ND4A 3QKSB 4JLUA 2XUOA 2RBEA 4KZPA 4ZYWA 4C2UA 4O0LA 1RAAA 2I4LA 4CF3A 2RARA 2B69A 4LJ6A 1S3SA 4H15A 4AFNA 1J9EA 2VAVA 1RKVA 4ZHQF 1MC8A 5JDCA 2OZKA 5K0SA 1QP8A 1EBFA 4ZYUA 2P91A 4NBTA 5DMXA 4I08A 1SJ9A 5IJ0B 3UM9A 1P3DA 3P52A 2GOYA 5CB0A 1GPWB 4H6VA 2PGIA 4PSVA 3V1MA 1E2KA 3MBKA 1ILEA 4J7UA 1BMDA 3PDCA 4E2YA 3SEJA 1XR3A 2JVIA 3L7KA 1LXCA 1XCJA 2VXCA 5E4TA 3WS7A 4DCMA 1QGDA 4O4HF 3MCUA 4P9SA 1Z5VA 1EYZA 3BPSA 4TVSA 1XRQA 3QFSA 1X77A 3D3WB 4JUBA 4RK5A 3W04A 4GGOA 4QLOA 4PCVA 2WVAA 5J2UB 4GO1A 1DKUA 5C1DA 1IH8A 2GPWA 3EYWA 1EXWA 4NYMR 4EPVA 1GXSA 4FONA 3GIRA 1OLSB 2J3QA 2QAIA 2WIGA 3FNIA 3TLGB 2VDNB 1TT7A 2AI3A 4QAJA 1U8UA 3CRRA 2Z6AA 4TZKA 3TQTA 3ZZ0A 1VPEA 4BBJA 2G83A 4F2PA 5GQSA 1U4SA 1YJAA 4RJLA 1WSRA 1QCCA 1V1RA 2ZE8A 4HMQA 4UNPA 5BNWA 4A5OA 3H8VA 1GAEO 4R31A 4CKWA 1PD1A 3F1KA 2YWHA 1NVXQ 5EIXA 3RSLA 3D64A 4A2QA 1KPHA 3REQB 3ZTWA 2GCOA 2WSYB 2WUGA 4ZVTA 3SZUA 3AG5A 4S1WA 3O3OB 1HG1A 4Q4AB 3BG5A 2IELA 2VNIA 1QGOA 2C9YA 4FZRA 1MX5A 2Q50A 5TT1A 3SMQA 4ZTUB 4ND3A 2PT7A 2V7EA 4PO9A 3CQ9A 4IFIA 4DLKA 1BOOA 4LISA 4TLEA 1V4NA 4IZIA 2B2XA 1CF9A 3LQ6A 1SHUX 2FQWA 3G5UA 3LQFA 2C3OA 4YDHB 4BVKA 5BNZA 2CLHB 5EWJA 1UZAA 4IPTA 5EJ2A 4ZJUA 4F93B 5HZMA 2B2CA 3NORA 3TAXA 3ZV4A 3ZEAA 2C83A 4HO1X 3IVMA 4R6XA 1E4OA 1KKUA 4B7AA 2JFNA 5FUWA 3VKVA 4O1IA 5AW2A 4B6RA 3AY7A 3UH1A 4IS2A 4DUYB 4S05A 3GLFA 1P2SA 2CLLB 3HN7A 2RHCA 3I8OA 3JQ8B 3PHGA 1JH8A 3WBBA 4ZZ0A 5DULA 2ZWAA 3BH7A 2XQFA 2PAFA 4UD6A 1FXWF 5I3ZA 4F5WA 3L46A 3PXUA 1WV0A 4H1HA 5THKA 3UA3A 5E2IA 3LK6A 2ZRNA 4Q16A 4YFVA 1D4OA 3NH9A 5TQ0A 4YAJA 1ZD3A 5FPYA 4BFZA 3UHPA 2X42A 2PLAA 3NPAA 1P5RA 3DCIA 1V37A 4G0QA 3QWAA 2BR3A 2IXDA 2OYCA 4JL5A 3LXRA 3H0KA 1E9RA 1IG0A 5FNVA 4D26A 4RIFA 1IOZA 4XKVA 2RFLA 3LDUA 4UNRA 4HDNA 4BB6A 4ND8A 3WO0A 1UPBA 1WXIA 2PZFA 2WNIA 4H0CA 1OB5A 4HUQA 4X91A 4YHHB 1ODSA 4QXAA 2ZI3A 2Z8YA 3LSYA 4JHXA 5EJ7A 5JE8A 2FU5C 2B5OA 2A8YA 2PH5A 2VSOA 4ND2A 2EKLA 5BV8A 1Y89A 1PGNA 2G1UA 4M0UA 2C0CA 3LZ6A 4DG8A 1NURA 1Q15A 3AJDA 1YC2A 5EXTA 2PUFA 1EQUA 5EQJB 1GA4A 2BTEA 1YS7A 1M67A 4PHGA 3ECAA 5AQ1A 4BQPA 3O4HA 4PQGA 4BWFB 5JD5A 2WR8A 2WICA 4CE6A 5J4HA 3CU5A 4L50A 1O08A 2ANCA 1XDSA 2W2KB 3RS3A 4OX9Y 2XWQA 1YQWA 3QPDA 4XR6A 2JBHA 3AJRA 3E35A 1P7PA 1ESEA 1OJ7A 4S2EA 4UFNA 1NPYA 4IOLA 1UH5A 4XLZA 4G4IA 4I46A 1J39A 3E81A 1E3MA 1G63A 4LVCA 4W4TA 5AJZA 3WICA 3LKVA 2ZW9A 4DCTA 3DP9A 3G6WA 5BSFA 1B43A 2WMOB 2CWWA 2LGJA 4G3XA 4GE3A 3TLJA 5C7IO 3HVRA 1JZTA 1NRIA 2O0MA 1EDDA 3EASA 4EJ2A 5JSZA 2RH5A 4ND6A 1O77A 5CHEA 4PNPA 3GNQA 4PLWA 5IAAA 4K9RA 3IUSA 4C6HA 2GLTA 4TL8A 4LQDA 4PHCA 1ZVQA 2F8LA 1P73A 4M55A 4QNRA 3WP0A 2VT7A 1A1SA 2P79A 4GM0A 1FQKA 4OB7A 2G1AA 5A9RA 2B9EA 5C51B 3Q6QA 4LX8A 3ETLA 3H5LA 3HKCB 3NHWA 1XHFA 1JXMA 1FB5A 5LIPA 1GFWA 4YP6A 1XZMA 3PIDA 4X7DA 1RFLA 2QMOA 4E5VA 1JEJA 5KJCA 5LQCA 3INNA 4XD7A 2XNHA 2UZ4A 1V39A 3FMIA 3RVMA 3EVTA 3OX1A 1AA6A 3DGFC 2VLBA 5HILA 2FF7A 2OG2A 1ZK1A 4TTAA 1H0SA 2CXHA 4L8VA 4LZLA 3KSMA 3OZSA 3R6DA 2VK4A 4LE0A 2MT9A 3DAYA 3F74A 5L3RA 3UC9A 4B6JA 1S4MA 4GOLD 1YZ3A 3H83A 2DWUA 1QLHA 1RQ2A 1R5BA 1SVOA 1SM4A 2A30A 2AOTA 2R5FA 2YNMC 3BXZA 3GJQA 1BH6A 3K2QA 3LUBA 3UK6A 3GLGE 4C2TA 4NV3A 4RQTA 3OJFA 1WKVA 2P65A 2DEUA 1NOJA 1X7YB 1VCMA 1AK1A 1IRXA 3Q1LA 4XORA 1Z45A 3EZ7A 5KSYA 1A8QA 1RXUA 2WD9A 4DUZB 3HUDA 5CYPA 4Q6BA 1VE6A 1G5QA 1WPXA 1Y5RA 4KH0A 5F9MA 4AN0A 1S2NA 4YRGA 1SD1A 2V0CA 3N2ZB 4EFNA 3OD5A 1HT0A 3CCFA 1KBZA 2XYHA 4K1XA 3GUHA 4PY2A 5EWJB 3HU3A 3FMVA 2OAQ1 3WHKA 3WL8A 1RWQA 4B6FA 4E31A 4EYQA 2OBYA 3L93A 1SXQA 3LUDA 1KK1A 1Y8QB 1VHWA 3IQZA 3KSZO 5JV5A 1YUNA 5JS7A 2PFGA 3T3NA 3HABA 2EFDB 3GLIA 1KNQA 4Y18A 1EJ2A 1P6XA 5K3EA 4GLBA 1X9GA 1AC5A 4JLNA 2PO7A 1I3MA 3CZAA 3NUGA 4RXMA 1DQSA 2FPKA 5IEBA 4EEKA 3JAMA 4BFYA 4RUKA 4E5PA 5CFLA 1BYUA 2JI4A 1WXEA 3DQQA 3I56B 3DWFA 4AJLA 1U9ZA 1Z17A 3RIEA 4D42A 4JDUA 3BXHA 1V5VA 1Z9BA 4XWWA 4ZT3A 5HQ3B 3P8ZA 2BM9A 3HLYA 3BWYA 3P1JA 2WJ4A 2HPAA 2GKOA 4O8ZA 3AHCA 4OFWA 3U81A 3K6SB 4KR7A 1ZJ5A 1H05A 3L8CA 3HDHA 4NBNA 1W85A 3BWCA 4PICA 1U0NA 1N8KA 4RXTA 2J6HA 3A7DA 1X1SA 2GZDA 1FRFS 1W9XA 5BW4A 4PTLA 3HZRA 3IAEA 2C5AA 1GFZA 3CZ9A 3PD1A 4GPD1 1E96A 4PYMA 1OFGA 3L01A 2RB4A 1KZ6A 2YCBA 4EEZA 3WA7A 3UOWA 2G80A 3I8XA 2GPAA 4C43A 4IIJA 1H2ZA 5CHYA 3KJZA 1EQ2A 4JI6B 3RUCA 4DLXA 2R47A 3AEZA 2ZXIA 2O8CB 3QLUA 4BVGA 4X6XA 4CLOA 4YRSA 1AIPA 1HPLA 1U8TA 3Q41A 3L8MA 3D7KA 2FMIA 3MWKA 1UJMA 2ZWIA 4PFSA 3LY5A 4AJKA 4DNTB 2B1IA 2GILA 4LOLA 5LWQA 3MOIA 3PXBA 4TXNA 4YQFA 2QRGA 2OCIA 1CNFA 1LJLA 3NGLA 1MO5A 2FPUA 2H2IA 3A0UA 4HDMB 2JIDA 4HLNA 2P3MA 3HV0A 2MSWA 3BXXA 2P4HX 3NTRA 4R40A 3LUHA 3N9IA 3LX5A 2HF2A 1UBEA 1IATA 4I4CA 4O29A 3LP5A 4IVPA 4UVGA 3PUNA 2PMWB 4YLGA 3TVDA 4GI3A 1EAMA 4MNTA 5CDFA 2YY7A 1HH4A 1RMTA 1ZD1A 3D0QA 1ZH0A 3PGMA 3S81A 1DEAA 1KOLA 4FFWA 2RE8A 1HI9A 3O1IC 5LLSA 4C5AA 1DZ3A 3HMKA 4QU5A 4XJTA 3J7TA 2BFEA 1M1UA 4EM6A 4WNAA 2IW1A 2VHXA 3BIWA 4RCZA 2O57A 2B83A 1DUIA 2CHEA 4MW9A 5TPZA 5IABA 3SWWA 3CVUA 4Y2VA 2ISQA 3DVRX 4RD6A 1CG6A 2VQEB 2DBQA 2QLMA 4I3GA 3W6UA 1T1RA 2GWHA 3CO0S 4HLCA 2GHTA 2IXEA 4O2RA 5D3MA 4DG5A 1HETA 4NULA 3G0HA 1ORTA 2B78A 3LOPA 1MF7A 4ND7A 2ADFA 4AP5A 4YCCA 3KELA 4G7XA 1CS4C 2FZ4A 1RWNA 2W6NA 3CISA 3A6JA 2V6JA 1XQXA 1L1QA 4YTEA 2WJIA 2OV1A 1NI4B 1BRMA 1PG0A 1JA9A 2V3VA 3OFVA 4AQ7A 3DE6X 3DTNA 1N3IA 1KWKA 1JG1A 1P4SA 4C05A 2A58A 4R3WA 5AI5A 1D2GA 1I13A 4B46A 1NUSA 3BNWA 1SKUA 1Y63A 3GRZA 1EXDA 4LBWA 3CY6A 1J9GA 3BBLA 3VR0A 3A25A 3BD9A 2CL6X 3LXMA 3TEFA 2JD2A 3TZLA 5BWCA 1YX2A 2V7UA 3CMAB 2RIRA 1GUFA 2B98A 5HE8A 1IWPB 4ZAFA 2RHWA 4Y6QA 3X1MA 3C41J 4A36A 2BEVA 3G13A 2ES4A 3PEVA 1EUZA 4OO3A 5KJEA 4YAGA 1ZINA 1E2PA 1NSTA 4UW9A 4AN4A 3JYHA 1CIJA 3TNFA 2BDEA 4N40A 2ZL7A 3FOBA 1LSSA 3VNBA 2D7DA 4FX5A 3SS9X 5DXFA 2X0JA 3G71B 4LQLA 2HRRA 3MT9A 1RYNA 4BLSA 4AB1A 2HIAA 4GR4A 4O4HB 4DNXA 3A6PC 1HF3A 2AOVA 3C6YA 3OJ0A 1PSDA 3RRNA 1NX6A 2ACWA 4X1YA 2UDPA 1M2VB 1WU8A 3Q72A 3EULA 5IT5A 4EF6A 1AB5A 2WV7A 5HMLA 4DLNA 3NT5A 1Z4PX 3JWIA 5CB8A 3CCEB 2VWPA 3ITNA 3NIWA 5EPEA 2DLCX 3A4LA 4TZTA 4BV2A 1L5WA 4KPFC 2G4CA 1U99A 1BE1A 1YOVB 3DV0A 5BRAA 5AVXA 1ML4A 1WSWA 1Y9DA 4JL8A 3DMFA 4KC0A 1A69A 2P0AA 3I2JA 4Y1EA 4BZWA 3ISTA 4ZI7F 4XYLA 3E58A 3TPZA 1H6BA 3VKGA 2NZUG 1RJWA 4JUIA 3L6RA 1TCAA 1TOAA 1T8TA 2FUG6 3CTPA 3GJTA 3WQSB 3ZHYA 5HQ3A 1J5PA 3KEWA 5GGXA 1RRGA 2Z9DA 4YRPA 6ABPA 3SVTA 3D43A 2OFPA 4HFJA 1KRHA 2VXYA 3VZDA 3OQOA 1NW3A 1BEEA 4GLJA 4NATA 1YAJA 4UTVA 3SZOA 3EY9A 4M9CA 4FPXA 4HXFB 1VBFA 1C1XA 1IUOA 1YIOA 1YQGA 2G71A 3JYLA 1N08A 4I81A 4ZMRA 1LDEA 2CUNA 3CLUC 3TLMA 3ZU2A 3TPFA 1HRDA 4PS1A 4N9QA 1JJ7A 3O0DA 1Z6TA 4NMWA 1DC7A 2Q5EA 3E9NA 2NUBA 3GFFA 1FMTA 3MJVA 4FU0A 1GUZA 4NH0A 4XDZA 2ZIXB 3WDLA 3KSAC 4J3NA 1Q16A 4G0MA 3K35A 1KGSA 2ZOSA 5KREA 4E08A 3U4IA 2O7NA 4BP3A 1GYRA 1I3OA 2A0XA 2Z43A 3HR8A 4RPBA 2GTPA 3BQMB 3I9V1 1V8FA 1D3AA 1NYRA 4UREA 1IAQA 3IA2A 3LPDA 3QE4A 4BRSA 3K9WA 1NJ6A 1LS6A 5HDQA 3D0OA 3AXTA 3LFHA 1US8A 4XQEA 5LBIA 1G5PA 2PSEA 1AKEA 2BI7A 3T3PB 3GNLA 4DM3A 2PKQO 3LDGA 5AQEA 2C4NA 5ALHA 4YRCA 3DZHA 3CWQA 3PR2B 2Y0CA 1D7OA 4QBTA 1HA3A 5SV2A 4MJ3A 4BEBA 4AVZA 4OIFA 4CG0A 3GLVA 1EFRA 2WQZA 3FDFA 2NZJA 4JFAA 3DPSA 1ID1A 1QQ6A 1UJ4A 1ULAA 3AF0A 3TINA 5F9HA 1GRRA 2V6IA 3PQ4A 4L4XA 3EZ9A 5EJ9A 1MVOA 1Z7GA 3F6BX 4X1IA 4I6EA 1USGA 4M8LA 2YQZA 3B20A 1CHDA 1PX2A 3GA7A 4URHA