4F7DA

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
246
Chain Sequence
SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
total genus 76
structure length 246
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4f7dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4f7dA02
4Y7CA 4MYUA 2OK8A 4H9GA 3WBJA 4YHBA 1GAWA 3OJWA 3WNCA 1QUEA 1TUIA 2VYQA 1QGAA 4RD1A 2CNDA 1ELOA 1QGZA 5GV8A 4EH1A 1YJ9B 3W2GA 4LC0A 1CQXA 3OJXA 4B44A 4NBSA 4PC2A 1N8RD 4ZCLA 2EFGA 3VMFA 1CNEA 1H42A 1K73D 1R5NA 4LBZA 1G7CA 3CB4A 2HDNB 2BM0A 3SJZA 2QN6A 1S72B 1EP1B 2DEUA 1KK3A 1ZM9A 1W35A 1ZM4A 1QFYA 4C43A 1GO2A 3LRXA 1OGJA 4Y9RA 4AF6A 3QFSA 1JJ2B 3AVXA 2QMUA 2BV3A 3U6BA 5THXA 3CCMB 2QTZA 3ES9A 2BGJA 4U9UA 4B3XA 1GR1A 3OZWA 2GQFA 4LBYA 1FNBA 1TTTA 1YIJB 3QE2A 2HMAA 3QFRA 3FPKA 3PENA 1E64A 4YAWA 3J81k 3CCEB 1OGIA 4MYTA 1IJFA 1XE1A 1BJKA 3OZUA 3G71B 2BSAA 3WNDA 4DQKA 2BMWA 5TY0A 1BX1A 3W2IA 3AVUA 2QA4B 1B2RA 1FRQA 2PIAA 3V76A 3AVYA 5H59A 4RJLA 2FX3A 2XEXA 4P3YA 1H85A 1VQ4B 5GV7A 2YWHA 1DG1G 3CMAB 2PLFA 2E1RA 2RC5A 4PC6A 4RD3A 3AGQA 3W5HA 1E63A 1EFTA 2RC6A 1HA3A 4Y9UA 1VQ9B 3E20A 1FNMA 4B48A 3ZZ0A 1VQPB 1DDGA 1QUFA 2QTLA 1VQLB 3CCJB 1G7TA 3W2EA 3B8HA 4B43A 5DSZA 1R5BA 1QFZA 1U2RA 1KK2A 1CNFA 3QFTA 1S0UA 1R5OA 1K8AD 4LBVA 4LBWA 1AMOA 4PC1A 1YJWB 3OW2B 3P27A 1VQKB 2BGIA 2B7BA 2BF4A 1B23P 1AIPA 4ACAA 3ZZUA 4AC9A 4HE6A 1D1NA 3CW2A 1QFJA 4N3NA 2YWEA 4HE5A 4M0LA 4PC7A 3VNVA 1WDTA 4Q7JB 5TV2A 1XB2A 5JBQA 1Q86D 1EWYA 1FDRA 3WNBA 1SKQA 3VO2A 2HCJB 2GPJA 3AGPA 3W5VA 3U6KA 4M4SA 3VO1A 2QDXA 4TMVA 3CC2B 4M2LA 2R6HA 1M90D 3I1FA 3WBKA 3OZVA 1A8PA 4F7DA 2YWGA 1BX0A 1FRNA 3JQQA 1D2EA 3JQPA 3MCAA 4B47A 1K9MD 3I55B 3CC7B 4RCYA 1JNYA 2AHOA 4YALA 1EXMA 3CCVB 4AF7A 4G1VA 1JA1A 3WXMA 3MHPA 4FWTA 3WYAA 3B82A 3WY9A 4ZCMA 2X3UA 1N0VC 3CMEB 2DETA 2XNCA 1D8TA 4WQMA 3ZC3A 4YAUA 3CCRB 4ZGNB 3LO8A 4BPRA 4FK8A 4UAJA 1YHQB 3CRZA 3QFCA 4B4DA 3CXCB 4G5GA 4RCZA 1Q7YD 1EP3B 1EFCA 3I56B 1VQOB 3ZZTA 4ACBA 4G1BA 3QSYA 1YJNB 1KRHA 3LYUA 3G6EB 2DY1A 3VNUA 1VQ8B 1QG0A 4PC3A 4J0QA 1M1KD 1UMKA 4PGOA 1DARA 1YITB 3W5UA 2CRVA 1W34A 1GVHA 4RD2A 1KK0A 3FJOA 2VNHA 3W2FA 3ZBUA 4ZCIA 1EFUA 1ZM2A 3AVVA 4TN1A 4NCNA 1ZUNB 2QEXB 1E62A 1W87A 3ZBTA 4N3GA 2C78A 5HXBA 4YAOA 3CCSB 1SM4A 1KTVA 5TR9A 2J7KA 1KD1D 1NDHA 1KJZA 4IW3B 4DQLA 2VNKA 1JA0A 5H5JA 3E1YE 1KQSB 1DDIA 4R71A 5KSWB 1N0UA 3CPWB 1VQ6B 2C77A 2EIXA 1F60A 1VQNB 3MMPA 1G7SA 4TMWA 1ZM3A 2XNJA 2PMDA 1GAQA 4ZGQB 1QH0A 1VQMB 2B7CA 2OTJB 1NJID 5EMNA 2BVNA 2DCUA 4RD6A 3LVBA 1BQEA 2BN4A 2VNIA 4TMTA 2B5OA 2D74A 1VQ7B 1F20A 2BPOA 4M53A 4RD0A 1W2BB 1QX4A 1QGYA 4P6VF 4QFMA 3JQRA 1Q82D 1TVCA 3B78A 3CCLB 1KK1A 4QHYA 1I7PA 3W2HA 3U2QA 4TMZA 3CD6B 1FNDA 3AVWA 3A1FA 3CCUB 1OB2A 1VQ5B 4TMXA 2VZLA 1OB5A 3P26A 1YI2B 3AVTA 2OTLB 1QVFB 2YWFA 1Q81D 4ZV4A 4YAFA 1TLLA 1J9ZA 2NPFA 5AN9A 3CCQB 2DERA 1JB9A 4M1KA 4FN5A 4RD4A 1KC8D 2BM1A 3G4SB 4K1XA 1IB0A 2VNJA 1G7RA 5FA6A 1QVGB 4C0SA 2ZITA 1IJEA 2OK7A 1FNCA 1GJRA 3CC4B 1EP2B
chains in the Genus database with same CATH superfamily
4Y7CA 1KEUA 1UWLA 1ESMA 2CLOB 1FFWA 2GAOA 2YW9A 5C5IA 3QOXA 2Z9DA 4Y1RA 4P31A 3L4JA 2HK6A 1VKHA 1PK9A 3AONB 4LDJA 5JO0A 2H1OA 3WNCA 3E22B 5EIBD 5K8IA 2ZYWX 4GPZA 1V0FA 5LXTB 2EZ4A 3AINA 5IEBA 1PU2A 2BIFA 4AJJA 1GDTA 1P60A 2YASA 3WZ2A 3IUJA 1D07A 2FGKA 5A9SB 3OCJA 1JDPA 3Q85A 4TKVA 2QJTA 5HZHA 1OLSB 5COBA 4EW2A 1DRJA 3GW8A 4L15A 1SH7A 3TG8A 3OJXA 1DP4A 2PGNA 2ARKA 4HRVA 4KUHA 3B52X 1VP9A 1CRWG 3HEAA 4FR5A 4GM0A 1RHRA 2BE9A 4KQ2A 3DDYA 3W5AA 1LVUA 1NQTA 4O2BA 1H42A 4MS4B 2OAEA 2B4TO 1R5NA 2HV9A 1CE8B 1JAIA 4MVJD 3RLFA 5L95A 4Q16A 4HQOA 2D3NA 2ZBFA 5B6PA 3EX7C 3G9XA 4GL2A 4MMYB 3FSGD 8AT1A 3CZAA 4NCBA 4IIEA 3HCOA 4D96A 4WL0A 3CF4A 5DLDA 3W78A 1ZOSA 2V4MA 3W1VA 3JS5A 4AN4A 4EK9A 4YAGA 3FSEA 4L76A 3ELBA 1ZD5A 4EVIA 3QF4A 2CEKA 1YQDA 4NATA 5AKYA 4EO4A 5BW5A 1HFEL 3I04M 4OQDA 1N05A 4R2JA 2B8EA 2GCEA 5EIBC 3TVTA 1PR3A 3V32A 3GRYA 4GDFA 2YIJA 1Z39A 4UM9D 1WXHA 2FN3A 1A7AA 3A4IA 3L3BA 4WNAA 3BWYA 3GNQA 5JC8A 3LRXA 1QYIA 1XCMA 1GQQA 2WUWE 5AIAA 2HWYA 4NPAA 3GAAA 5DHUA 1XDUA 2Z2JA 4TS4A 3QVUA 4BBJA 2QT1A 5EA2A 5FWXA 1FMLA 3ITEA 2WWVD 1MNQA 3T1QA 1WOMA 3WRVA 5FI3A 3W8NA 3O8DA 4F3YA 5HHTA 3GY0A 3CNOA 2OBMA 1IXZA 2JZNA 4KUEA 1U3UA 2XCRB 4L74A 1UFOA 3ZZ1A 2RHMA 4QGAA 2ID9A 2B1JA 1PVDA 3QPWA 3ZZNA 5KDDA 3F0TA 3KAJA 1KVQA 1SR8A 3LECA 1L8XA 5CXSA 3RAJA 3UHAA 3DE7X 3T06B 3ZOKA 5K6TA 1L7DA 4YAEA 1PWEA 4XUGB 1GYPA 4UZUA 1A2QA 3WTBA 3H11A 5A2GA 3U4QB 5LLTA 3T9DA 2IVFA 4OCZA 4EYEA 2PH1A 5AK6A 4Z0HO 1O6BA 5JS6A 1S1CA 3AERA 3JD0A 2R11A 3H3FA 4G2NA 3HU5A 5A0FA 4N6GA 1NXVA 2WKQA 3CCEB 4Q4LA 4R7TA 3KXKA 1RAGA 2FPRA 2DHCA 2OT3B 3BILA 3HJRA 3N5KA 3QE4A 4I55A 4DSNA 4P22A 5BURA 2B8JA 4BLSA 1DX9A 1PNOA 2IXGA 4PEVA 2LCQA 4C5AA 2ZT6A 4HVLA 2M2IA 1USVA 1XRMA 2C9DA 1Q1ZA 3GPIA 1HTBA 4PV7A 2GZSA 4YLEA 4Q4CA 4DVJA 4W5OA 3ISXA 1B2RA 1DC3A 2VG8A 1V9CA 2YBDA 3RG2A 4GR4A 5A4AA 5KNDD 3VYRB 1FJGB 2P9YA 3QQPA 5EFZA 4BIIA 1SVIA 4IV0A 5CR9A 2FX3A 2XEXA 2WKRA 3RAFC 3TRJA 3UAZA 4EDFA 5FBVB 1M6VB 1PL7A 1QDUA 5AJYA 4I50A 2V74B 2OQ2A 3PRJA 4Q7LA 3TSCA 1DOAA 1VMEA 3NPMA 4EUKA 3VHXA 4IHJA 4J3FA 5EUQB 3KFXA 5BR4A 3ULKA 1AS0A 5AI4A 3C3YA 4WOKA 2YV4A 5JJKA 2GOYA 2L82A 3QYPA 1TZKA 3DCNA 1EK0A 1GA6A 1CP3A 2VJPA 5K3FB 1XFOA 3W8FA 4HXGA 4B48A 3A6FA 1KQGA 2WBLC 1VQPB 2AD5A 4I9GA 4J16A 4WMLA 1XKQA 5H8WA 1J8MF 1CJKC 1FS4A 4GH5A 4ND3A 1W9HA 2VTBB 1IH8A 3ICQB 4QNRA 3KJFA 2CFTA 3SQNA 3WAKA 2ETVA 3GNTA 3VNQA 4EW1A 3N0RA 4P7FA 1XTKA 4BO6A 2IZOA 2Z83A 4WJZA 4W6QA 1A8UA 2B1GA 1XN1A 1KE1A 2O8CB 2E55A 3GRKA 1NBMA 2WF8A 4DCMA 2ECKA 1PFQA 4JJ4A 2O2ZA 2NZ8A 2E21A 3C6KA 5IDXA 1B6SA 4X20B 1NVWQ 1U0OC 2VPWA 3S2IA 5KJCA 2BGIA 3EDMA 3SE7A 1YD7A 4B2PA 1JB1A 5B53A 2TMGA 4OFZA 1VCOA 4AWAA 1MB2A 4AC9A 2UUBB 4QYIA 2WYWA 1VG9B 4P86A 3UMJA 1A2OA 5ECWA 1I6WA 4HNTA 2YWEA 4PBRA 4D9EA 3WYDA 1QE0A 4D43A 4PO8A 1CY2A 4X07A 1XEXB 1CTQA 1E0KA 2VJYA 3I05A 2ADFA 2V65A 4HHEA 3NX4A 5F4OA 4D4MA 4DJFC 3AETA 2BKLA 3G8AA 5T67A 4LZWA 1J2RA 1G41A 1NN0A 4RY9A 5EGSA 3CKYA 2ZUEA 5I5GA 1E7MA 2ZBPA 1UBFA 1YUBA 2G6BA 3HB9A 1E79A 1EFVB 3I0ZA 1N5KA 4O0MA 5J1TB 4AG5A 1J21A 1T1JA 3EZGA 4I9FA 1R9GA 1A5TA 1GUYA 3EZ6A 4KMRA 2DFKB 1BGWA 3ZHUA 4MVJF 4GI1A 4U7TB 3NTQA 2NZYA 3R6LA 2Z9BA 4ZJZA 4RIGA 3V7UA 3ZKAA 1G2QA 4I1VA 2C9ZA 4Z7QB 3WWEA 4PY2A 3ZNNA 4AUNA 3CVYA 1M90D 1VKOA 1A69A 2G80A 4XGQA 3SHTA 3OOJA 3UGQA 4IIGA 1M5RA 1M0EA 1BHQ1 1EMDA 4Q19A 3DD5A 1KC1A 4RGBA 4ZARA 3E4CA 3WG9A 1T4CA 5IPFA 4Q6WA 5KYWB 1W0JA 2A1UB 2V45A 3W8DA 5B3JC 5EE5B 1TUEA 4LJYA 1BVRA 4DCTA 1YLOA 2V7WA 5DB4A 3JALA 1TGVA 1WDKA 1VE1A 1VLJA 1N2ZA 2QXUA 2WD9A 4O4HA 3USZA 4ZXFA 2LDBA 2VHVA 3DOCA 3I55B 2G09A 3EBPA 1ZJ5A 3TLJA 3CKKA 1FUIA 5C31A 1BJRE 1UM9A 2X2OA 2E4YA 4Q1BA 1GTL1 1GZDA 4S1PA 2X5XA 2HA4A 2XH8A 2YR0A 2ZJBA 4CLEA 4EHIA 1VIVA 8ATCA 5DF1A 4BN5A 1ZCJA 2R8ZA 4C30A 2R5FA 3BHIA 1AK2A 1PL6A 5TARA 4XGRA 3SOZA 5D87A 1V8DA 2BOVA 3A9TA 5ERYA 3AQ4A 3AF6A 2G77B 3G7SA 3DQQA 5BSUA 2BRUA 1ISPA 1H5QA 4JB0A 1P8JA 2VBSA 1HEYA 2WJ3A 2ERYA 3D8NA 2PGOA 2VSYA 1W7AA 2LIVA 3N74A 1N7HA 1U3DA 4FK8A 1JIXA 2ZZEA 2HCRA 2ZI6A 3ASZA 1HLFA 1HNZB 2EX1A 1R16A 1Y8RB 2NU7A 4CKEA 2JARA 1GT91 4ND7A 1VHEA 1QONA 5H4HA 2AHRA 2OGTA 5JAPA 1W4ZA 1UOOA 2IYYA 3IB3A 1A88A 2FW9A 3CVWA 1AV6A 1HVXA 4DNTB 4RCZA 4OJMX 5HGXA 4ZHQF 2R66A 2J87A 1Y9ZA 3OO0A 2IBSA 2ZCVA 4C88A 1Y7LA 2W2KA 3U09A 1N6KA 2HRCA 3ZWQA 4DFDA 4OPMA 4UVIA 3OKPA 3RE1A 4WKCA 2HRRA 1W49A 2ZIFA 3GMSA 4X00A 4QSHA 5AW9A 2F67A 1MLDA 2P1RA 2HSDA 3CXRA 3GJ6A 4BZPA 5KC9A 2FW0A 4QRIA 1AKVA 2FPLA 4HMOA 3H8VA 4TWAA 4LUCA 5GOZA 3IFSA 3MILA 3QVMA 2I4NA 2NVWA 1QG0A 4DIMA 2NVUA 5HJ2A 1Q84A 1E1LA 3FZYA 2QXTA 5FFMA 3ZUGA 4ZGGA 4PZLA 2ZB4A 4X95A 3RRMA 4G4IA 4EZBA 1U28C 2Z57A 1TF7A 3KUXA 3H5OA 2G9VA 4UOEA 4JBWA 3I8OA 5JSZB 3W9UA 1YTUA 4RA9A 3FVVA 4HLQB 4IJVA 4QRHA 1D03A 1QWSA 5CYGA 3R4VA 4ED9A 4RABA 3GPCA 2PKRA 4FGUA 2AXQA 4AJLA 4BQIA 1V4VA 1U99A 4M0DA 3W2FA 2F9LA 3K0CA 1CQPA 2BC9A 2WM3A 5A7HA 1UXKA 4PFQA 1NJ1A 1UP6A 1XVVA 1Z4LA 3JWIA 2NU9A 3UZUA 3KTDA 3AVVA 4TN1A 1X7HA 2QG6A 3L6BA 5FV4A 2D2XA 3CR7A 5KTTA 1QHEA 1EJBA 4NVRA 1T8RA 5A3JA 1CB0A 3I1IA 1J5PA 2JAOA 1FUKA 4FUTA 4G67A 5CURA 4DG9A 1PEAA 5LSAA 3G2IA 4LYJA 3ZBTA 5B6JA 3PVZA 4Z9AA 2WVGA 3ASYA 2I2FA 1DXHA 1LDMA 2H16A 2PS1A 2E82A 5FLEX 1SD2A 1H3NA 4ZDKA 1BA3A 2Y0PA 1FRZA 3Q7QA 1UEXC 2F9MA 4JMPA 4UNQA 4CU2A 2G04A 2AKEA 1JEJA 2OAGA 2ZTSA 4HEJA 4OSOA 5JEDA 1MA3A 2Z1DA 5IBRA 5AVXA 1ZLYA 2X7JA 2D0OB 4ALIA 5JLJA 2V98A 2W6IA 1JA0A 2PD3A 3BL6A 2PMFA 3GEDA 3KXIA 5EQTA 2FR8C 3KKMA 3FNGA 1G3IA 1IQPA 3LKDA 3SZ3A 3PLAE 4F4UA 1WO8A 4GOND 4B3SB 2A1UA 3LRPA 5LBIA 2W2OA 4JY7A 2F64A 2XW6A 4N40A 4AULA 1IBLB 3LK7A 3WSTA 2J9YB 4L5YA 3E81A 2H8GA 5GJWC 2JBAA 3ZWYA 4Q5IA 4FYXA 2R8PA 4TRNA 1JLKA 1Y42X 2WILA 3E0XA 2VJBA 2AMJA 4R1QA 2QM0A 1LDYA 1PP4A 5G4KA 1RYYA 1H2AS 1G7SA 2FH5B 3URKA 3T3PB 4WK6A 2EU8A 2CF4A 4Z1MD 2FV8A 3NALA 2OV1A 4P7JA 4P2BA 1VOTA 2CLKB 2ZULA 3MJSA 3X1YA 2BEVA 4IFTA 1MOQA 2BKUA 1H0RA 1E2FA 3ABRB 1EVKA 4ZT2A 5ED4A 1NJID 2BFDB 3FNFA 1ENPA 1T9DA 2TECE 3Q87B 5LP6B 2I3DA 4JX8A 1JG1A 1B43A 2AJDA 4WX2B 3CPXA 2XXJA 4KDEA 1MGPA 1MORA 4XPIA 4Q01A 2OHVA 3ANXA 2JCBA 4AZ0A 5CDUA 3FDZA 2RD2A 3TNLA 3MJRA 5KSOA 2V3CC 1T34A 2PKCA 2A2ZA 1KDYA 1JZQA 3D4BA 1EUDB 4XLZA 4RYDA 4YJGB 4TQAA 1T9HA 2NZJA 3DBOB 4FYWA 1FP4A 4B74A 3G59A 2ZZFA 4DVGA 5CGQB 8GPBA 2A9OA 2C58A 5DM60 3E18A 5COQA 3E27A 3ZWPA 4BWFB 5JD4A 4RD0A 2WA2A 3F71A 4CUZA 4UBNA 5SV2A 5HRCA 4PLTA 1XHEA 3CC8A 3LHIA 1VLOA 3ROMA 1UXGA 2HXYA 4Y2QA 3DKPA 5F73A 4O59O 5KYKA 1NFRA 1TIBA 4H7HA 2F1OA 4IS2A 3P0EA 3SHOA 2DR2A 1P1RA 3C2QA 3KCQA 4KPUA 3T41A 3OI7A 4X3CA 3B3JA 4QOHA 3H2IA 4M0PA 2PUWA 4YAJA 5ILOA 3ONWA 1PKVA 1GADO 1UAGA 5I7UA 5E6UA 4JI6B 2WC1A 5L7TA 3AZOA 5LKAA 1ATZA 3K8QA 1PE0A 4WHMA 1RAIA 4EVRA 4RZUA 5TQ2A 5C8YF 4JI5B 4K26A 1R2QA 3NJRA 4LFCB 4C7OA 5K3BA 4PTLA 2UVDA 4HAOA 3HVIA 1X80A 4QBGB 2Q4TA 4OU5A 5C7LO 1P6UA 1IEVA 2VKQA 2YQZA 2ZB3A 3ZVLA 3GELA 5I7AA 3ZCUA 4Z7OB 1JSLA 1N9KA 1YQUA 2GZMA 3DFZA 2ZI3A 2EWWA 2WTBA 2J9ZB 4P54A 3D26A 2Z2KA 4G84A 2DBYA 2BFBA 2P90A 4MPDA 5AK4A 3SS9X 4PHCA 1EUQA 1T8UA 3OZBA 3T3OA 1WXXA 2DM6A 2WJGA 4YJ3A 1ISSA 1U7UA 4KOEC 1SQ0A 2BLLA 2R96A 2SCUB 2XXAA 4M9UA 2B6NA 1V7QA 5CFNA 1RU3A 4ZV4A 2Q7DA 5DULA 1TK2A 3S99A 3RG8A 1P5JA 2YHBA 2YZKA 1MRZA 3MJTA 3QM1A 4P9SA 4F3CA 1PJ5A 4A2CA 1LNSA 4CF3A 4DKJA 1J9ZA 2QGNA 1QE5A 4LQDA 3I61A 2EBHX 4V0OA 5LFAA 5E0KB 3M6AA 2DERA 2XTZA 1QCZA 3L6CA 3CR8A 2DB3A 1XRPA 1Q3HA 3MS2A 2PL3A 1AA6A 1W0KD 4WDRA 4LN1A 4TQGA 3N2KA 4MVWA 2BM1A 3G79A 3G4SB 2OP1A 3HBFA 3T7KA 3UVEA 1NT2A 2FW8A 2Y1EA 2CJPA 3PX2A 1Y7TA 1MO3A 2Y77A 5BR1A 6CHYA 4RULA 1UBHS 1HMPA 2JHFA 2PUCA 1R4NB 3HTXA 1OZFA 1QVRA 2IZ0A 3NZEA 3MWEB 2OK7A 1QQ6A 1V3VA 3AR4A 3ZW9A 2FMKA 3MWDB 2AC7A 2EYQA 2QMOA 2F9FA 2K5UA 2ISSD 2PDAA 2Z5GA 3W5SA 2NMVA 4OP7A 1II9A 1LLCA 4FZ3A 3E6AA 2XMQA 4NOJA 4XM1A 4PZZA 2BMAA 1RBYA 3OIVA 3GLHB 5AKXA 1JQLB 3L6OO 3TAXA 4RD1A 1ZH6A 2Y1WA 1FLAA 3MIIA 4HNGA 1PGQA 1S7GA 4OUDB 5HRAA 1KZLA 5GV8A 4JDPA 1M6EX 3C8DA 4MV8A 4UUNA 2Y27A 4QBFA 1CUHA 2H31A 3JQBA 2YYYA 1GLGA 3ROPA 2IPLA 1OROA 1UWVA 5DYIA 4ZVTA 3JVUA 4WZKA 4CMEC 1G64A 3KVVA 5FR1A 4QSMA 3AFNA 4G0PA 5M3BA 3TOZA 2O3UA 2IDMA 1U7ZA 4DMCA 1C1HA 2DECA 4EB3A 8LDHA 3DPSA 2O5VA 4CMIA 2Z2XA 4TUYA 1VGRA 4JODA 5UKDA 6NULA 4WLNA 1VJDA 2LP4Y 3K5IA 3RFUA 1JIIA 2H2DA 2WK1A 1XKLA 2PEZA 4JVMA 4Z9YA 4ZDWA 3WB2A 2CXOA 5JEEA 1YBHA 4Q05A 2QX8A 4WBXC 4C4PA 1IEQA 1ONNA 2WT9A 1Q11A 3UK7A 3ZJTA 1NLZA 3SBOA 1ETHA 4NJOA 4I3GA 3SEZA 2PQMA 5B7PA 2VK1A 5FIUA 1XDBA 3OLCX 2CFOA 2JDID 1E3TA 2PFKA 1UOPA 3ABQB 4FZJA 3PNPA 2BSQA 1UD4A 1Z0AA 3S8YA 2Q8NA 3FKJA 3MLAA 3PJEA 4RF5A 4S1NA 4YP0A 1T3HA 3WWYA 4JJIA 1RBQA 1JEDA 2VWGA 3SK0A 4C43A 3K92A 3OEWA 2YJ6A 5DP2A 3WHLA 4YRGA 4R81A 3A58B 3MT0A 3AUYA 3LHFA 4WERA 4BLUA 3E82A 2OCPA 3O4JA 2JJ1D 3W3AH 2ZSBA 4E14A 5IWCA 4J43A 2EGGA 4A9AA 1ZINA 4PRKA 1N2GA 2P41A 4PRZA 1KMQA 1U0SY 3O8OB 2ZR8A 3A25A 3B1VA 3DNFA 4MQ4A 3L4BA 3U40A 2W4IA 2XIQA 1NX9A 4M99A 2B1QA 4PHGA 1Q0HA 4Q3EA 1A4RA 1NBEA 1SOAA 1WMAA 1ADCA 1Y3FE 2DUUA 4R3NA 2BGJA 1OLOA 2FN9A 2PBLA 5H3HA 3IVGA 3T0FA 1ZRNA 2Y0EA 4E22A 2DFLA 1U9CA 2AOUB 1W19A 2FXIA 3ANMA 4LQ4A 3RJMA 4TMFA 2X7XA 1CQZA 4I8IA 4YA6A 4CL2A 2O54A 3G23A 4IINA 1E6KA 1NBIA 1PQUA 4QQNA 1J5XA 3HLYA 1XWWA 2W8ZA 2CZQA 4RA6A 1ANKA 1XEWY 2ZIUB 4J91A 4YT2A 2P68A 2HIGA 1CUXA 3PENA 1JEOA 1M6HA 4WASA 5EWMB 5REQA 3TBHA 2L0XA 3RVNA 1P72A 5LJLA 1X70A 3JU4A 3EZ9A 5JDCC 1D9XA 3MMSA 5JXIA 2WM9B 3GARA 3FH0A 2OKCA 2Q4RA 2WTXA 2B1IA 2DUJA 4L22A 1B6GA 4LYGA 2O1XA 1EE1A 5K51A 5AHOA 2IL1A 3B6MA 3ITKA 4YRSA 4AICA 3H1AA 3NC4A 2I9KA 3U4CA 1TM3E 1DQZA 1U0JA 4YJ3B 1RHKA 3WGIA 3A7DA 4Z49A 4G07A 1SIBE 2YJNA 2ECPA 4IXMA 4XWGA 4CR6A 1JG7A 1KH2A 3BFVA 4H7JA 5IVDA 4AWBA 4D9GA 3ONNA 5CD1A 2MSNA 5CDYA 1NNSA 1CUUA 3FTQA 1VQ4B 3MJHA 4X8HA 4YCMA 1DG1G 5BSTA 4MB2A 1V5GA 1Z3CA 3AHHA 1W1IA 5EIWA 1QGOA 1E3WB 4AKHA 2IYPA 3GLQA 4LXTA 4C6TB 4C04A 1VJGA 3IAXA 1RRGA 4XOTA 1JBEA 1N5MA 3OPQA 3TOCA 4W1QA 2BMJA 4ZANA 1BGVA 3D9QX 1AHNA 3VYUB 4M98A 2VLBA 2P6UA 3K15A 1VDMA 1ZX1A 1J2UA 2YINC 3LBHA 2XMSA 3B5EA 4PPNA 5EHGA 2BJWA 4S05A 4M0CA 2JGFA 2VJKA 1OILA 1P39A 4G1FA 2POQX 3BHNA 3H8JA 2N47A 5A62A 3R41A 1CUWA 2C0QA 3NANA 1FTGA 1T2AA 4D1YA 3WNQA 1M1YB 3OCVA 1S3IA 3TJMA 2H1HA 2W6PA 3DYBA 4HXYA 2A1TS 3TD6A 2XYGA 5EIEA 1O0CA 1UZLA 2GK3A 3AXSA 3HBMA 2DOGA 1QK5A 3JWPA 1K8AD 4GSYA 4ZCSA 5BN5B 3H99A 1SCBA 4Q18A 4QTZA 1WPRA 1TFRA 5KNLA 2ZBGA 3DWIA 3JQAB 3KM0A 1IBMB 2I7CA 3FKQA 4TXHA 1LPAB 3PXAA 5CFQA 3HZZA 3SVLA 2COEA 5IJ9A 2IRWA 2X1MA 1W8IA 1EVQA 1PZEA 2GD1O 2HOQA 5AVOA 2IDKA 5FT9A 4UCFA 2H4HA 4FIDA 3QV2A 4HNAB 4U7JA 5IXYA 1HXHA 2OFPA 3HSYA 3RDPA 1DI0A 3EAFA 4L6AA 4KLCA 3N75A 1D1NA 2X7HA 4XCQA 4ZO4A 3JARA 1QYRA 1Q20A 2OBNA 2WVHA 2VVTA 3GJRA 4N3AA 2RONA 3MWLA 3R5FA 4H7FA 2V7EA 3L0PA 5JRDS 4PABA 3TLAA 4FGKA 4HNVA 3MWFA 2Q6TA 3IVRA 1M6YA 2ZETA 4NDNE 4NMLA 1O57A 3RVQA 4BL5A 2PUHA 3E23A 3H1PA 3Q3AA 2LCFA 3H1TA 1T8SA 3S1LA 4D9NA 3A2KA 1ZU4A 4LYYA 2IYFA 3AUKA 3CCFA 2Z5VA 3QNUA 4TWJA 4DM7A 4Z51A 2XCSB 3QOFA 1E3LA 2D1TA 3PB3A 1KRXA 3WO1A 1D0SA 3D8BA 1R00A 5IVIA 3SVZA 5B55A 4HQFA 1UBUS 1T3SA 1N8TA 121PA 4DA6A 1FP4B 3OTIA 1XX6A 2ODPA 4TWBA 4DUGA 2XQFA 1FX0A 1F3OA 2NO1A 3H2ZA 1WHTB 2GEUA 4AO6A 3MYYA 1URPA 3E3MA 1SBIA 1F8GA 3LP5A 5EQJB 3W4KA 4B4UA 3MBOA 2V6IA 2Q3BA 4DQXA 5JHGB 4BFWA 2C8JA 3U7HB 1X7ZB 3B5JA 3ZCTA 4EM6A 3IL2A 2ANCA 4OHOA 4N5IX 1YACA 3TO5A 4D9MA 2ZRBA 2ONJA 5ALKA 5HIKA 3UNXA 1NNEA 4AJOA 1DSSG 2HTEA 2WOOA 4MRMB 4OI0A 4NFHA 4I9HA 5F76A 1WB4A 1M1UA 4PX2A 2QRHA 4BDTA 2WWTA 1O54A 2FUKA 1WD7A 1W88B 2ASEA 2F59A 3B1XA 4IZIA 4BU0A 1Y9AA 2Q07A 1WB9A 2WU0A 1G2IA 4I55B 3UB3A 1AKQA 4KDFA 2AQKA 4IZHA 1O5OA 3FCSB 3KLNA 4MCAA 3WWCA 4CV2A 1E4EA 3FRJA 1X87A 3UH0A 1FXWA 3MHPA 3VX4A 1MG5A 1NPDA 1PG2A 2YWCA 3O90A 4MAAA 2J6IA 1SUAA 3DHWC 3KP1A 3PD0A 3DKRA 3U44A 5DH9A 4YH1A 3Q6QA 1IZZA 1HMYA 3LHDA 4TLCA 5DI3A 5FBZA 4YUZA 5FYDA 1PWZA 2GHIA 1U1DA 1ULZA 3GYGA 4OFBA 5L4SA 2A67A 1S4QA 5H80A 4HYEA 3ZPNA 1OLUA 3KR1A 2VS1A 2SKEA 5EIAA 3MB8A 3DW3X 4LXXA 1E58A 3SN6A 1S2GA 3CCRB 2IUEA 1HPLA 1AY0A 5L46A 3F6RA 4HTFA 1A96A 2EJTA 4OSPA 3TI9A 3C8ZA 5FFNA 3USES 1CR1A 3ZLUA 1PJSA 2CNWA 4R9RA 3TQTA 4EAAA 1VLZA 4TGLA 5AJZA 4E94A 2FTKE 3NVKI 1VPDA 3G0BA 1GKIA 4OX9B 4FFSA 2X58A 4POOA 3FGZA 3PJDA 3SYNA 5EXTA 4LXIA 2ZCJA 4IDOA 1Q91A 1I3MA 2BRUC 1YL5A 2OY0A 3E8XA 3IBSA 2D5LA 1SC1A 3CN7A 4TKUB 1ZOLA 5CFLA 1G6KA 2BD0A 3PE6A 1T6ZA 2FOIA 1D4FA 2N1MA 3GLGA 4K9LA 4IO0A 2ZS9A 2CL5A 3DTTA 3OE5A 1Z4QA 4K9KA 1J2TA 1QVVA 2RB4A 2X5KO 3V2UA 4BGDA 3P9SA 3KEMA 4M38A 2JLUA 1DV2A 2P4UA 3D3WA 2NSLA 1VQ8B 4XR9A 3KZOA 4PX3A 3KTAA 4X7MA 1HYBA 1V6CA 4BOYA 4LF6B 1G1AA 1RP1A 5CM8B 1IATA 2R68A 5E7IA 4D3DA 2QDKA 3L8DA 1EG7A 4WY8A 1O97D 2GUGA 3AR3A 1ZJZA 4YRZA 1G21B 2O2HA 3H4IA 1RI1A 3OWHA 3RF6A 4BGVA 5G1PA 2NV6A 1H8EA 5I6DA 3GF4A 3FYUA 5FWDA 4B76A 1GPLA 3NORA 4C4TA 3QX8A 1BDHA 3OKAA 5BO5A 1TADA 3EGXA 4MEAA 2Q2OA 3D81A 4W8OA 2AN9A 2FX2A 2G1AA 2O14A 3ZDZB 5JT1A 1WR8A 1WCXA 2XTNA 1P7PA 2HA5A 3CF0A 4O2AA 4RVCA 4LIPD 1N2JA 3ZHQA 3DZKA 4MDEA 3QEKA 4YRMA 1M74A 4AWXA 4FCVA 3E70C 3GVLA 1CIVA 4HRYA 4UHDA 3I9MA 3KB8A 4WW0A 4EPRA 4COOA 2X8BA 5F7JA 1SBZA 4WUVA 2LKDA 1ZD1A 2W43A 1XQWA 2OCYC 2PZAA 4QUKA 1AKTA 2GZ1A 2J59A 2WV7A 4AKSA 2P6RA 1DO0A 2FEKA 2IOFK 5IDQA 2DWQA 2IUTA 2IX9A 3Q0EA 1VPWA 3ISJA 4RYLA 1NP3A 1ZGCA 2DH6A 3H9EO 3OHPA 5CCXA 3HG7A 1KTVA 2O59A 2IYRA 4L57A 4XCXA 2WSMA 3I6YA 4FHGA 4KWIA 4OXKA 1TM5E 2VNKA 5KAPA 3SE0A 4BMZA 3OQOA 2IUUA 4COKA 2XGGA 2V8BA 5K3EA 1YKGA 1Z74A 4LXHA 2R0QC 4B7CA 4IIHA 2P2NA 3VPDA 1HDYA 3S1SA 3N9IA 4J4HA 4YMSA 2QK4A 3IAS6 1DMSA 4HEHA 4G56A 1G9TA 3ZWXA 1JTFA 2YJZA 5E3JA 4WESB 3D0OA 2RHCA 1EX1A 4C89A 1XZFA 3HRHA 3O8RA 3H13A 2ZYRA 1PJLA 4LJ8A 1O94C 1OZAA 1KH3A 1XA0A 3ZIUA 5LIRA 3LHKA 1HSZA 4YELA 2XYHA 4FYMA 1UDXA 5PGMA 4TYNA 1R4MA 4HDOB 1E1RA 1UM9B 3M5CA 3PG5A 4KK4A 4K3UA 5K2OA 2NU7B 4WKOA 4EPWA 4PAAA 2P9EA 4R0VA 2QUAA 1UWKA 4YCCA 1P1JA 3SD7A 4EJFA 1SGWA 1E1QD 1U2GC 4RY8A 2QORA 2UKDA 4JJGA 1FFHA 4L73A 4P58A 1TYEB 1YASA 2FLVA 4O02B 4UTOA 4UASA 3TSAA 4F6RB 1O95A 4D0SA 5KNCD 3L8ZA 2BVNA 2VBVA 2JI7A 4I2VA 1CS0B 4CPDA 4MZXA 4CQMD 5HVNA 2HF9A 4M21A 3EARA 4YUXA 6REQA 1Y7HA 1FLVA 5K0BA 5EJFA 2GPWA 2QT0A 2SNIE 4FOLA 2AN1A 1SD1A 1Y4UA 5K05A 1Q44A 2YXPX 3EBLA 3BOSA 1NVBA 3F2VA 4MJXA 1UBJS 3U80A 1XFAA 1EZ4A 3ZWAA 2YWXA 1PT7A 4DNPA 4DLAA 2IXTA 2D74A 4GWLA 1U5BA 4NTZA 4JR1A 5JTUA 1TNDA 2VSNA 3CTPA 5F7XA 5IRCD 3Q7PA 1F20A 1NB9A 2H4XA 4UU0A 1Z7BA 5D1NA 4TKUA 2OPHA 4AMVA 4DADA 2VUTA 4NG5A 1YIOA 1ISGA 4JB3A 4BNJA 1ZMRA 5ALZA 2WM8A 4KACA 4KQHA 3LWNA 5KCMA 2QTGA 4G4GA 2R87A 3GK3A 3SQWA 5JJIA 3DBRA 1P18A 2P6MA 4Q37A 4ZYTA 1FUYB 1OFUX 1IAQA 1ORIA 2AH5A 3JQRA 3DBVO 4C08A 1Q82D 1NIJA 1CKEA 1QZ3A 3CHYA 3G9QA 3LP6A 4PSKA 2EX0A 5A1JA 3TEFA 4ZWNA 2Q3EA 3ESQA 2GASA 2GESA 2WF5A 3CH7A 4AF8A 5HFNA 4RE5A 3GD7A 1DKNA 4JH0A 1LSOA 2F4NA 1DEXA 1Q22A 3CUEF 3DZBA 2UZ3A 1YZYA 2I7XA 1YQXA 3I3SR 3Q41A 1D2AA 3U7RA 3DZJA 4NABA 1DVRA 2GZAA 4I1IA 4FILA 3L1JA 3R0QA 4JBNA 5FJIA 3UB4A 5DCUA 3D3NA 4LGVA 3JQCA 3KELA 2EFJA 4Q3LA 1NM5A 4W63A 1TJPB 5ALWA 2QZSA 2GM4A 1RZRA 4LDZA 1H6CA 2AEMA 2DBQA 2ZVJA 4JC4A 1CSEE 1E6MA 1SIWA 5IN5A 4ATNA 5BN5A 4G3XA 2F1JA 3RVSA 2O06A 1MB3A 3OX2A 4BXOA 4F11A 3GLHA 2PNFA 1VJ5A 4DLUA 4Q15A 2HQ1A 3DNPA 5IM5A 2HBZA 3OM9A 5EIOA 4YAFA 2B5WA 2GBCA 2IEDA 3CYFA 5TQJA 2BFFA 3IUNA 4JVNA 4EKEA 4CL0A 3NWOA 3FIJA 3EW9A 2MYPA 3A9CA 5I8WA 1BMFA 1JGTA 1Q50A 3GGSA 4NCHA 1L9XA 1A82A 4DRYA 3ZU6A 3MC1A 4IUYA 4ABYA 2EG9A 4QM7A 3SLKA 1J9EA 4B9EA 3B9PA 3L7KA 4I1UA 3ZDRA 3ZX5A 2DPMA 1F1JA 4ARZA 3PA2A 3W79A 2GN6A 2H1IA 3I5UA 3L0CA 4J4TA 4QTYA 2ZBEA 3JU3A 2KI5A 4YROA 4CN8A 3A6LA 2TRSB 3I52A 1HQCA 3TPFA 1QFXA 3BZBA 4S1VA 4PIVA 4RHTA 4ROSA 5C3MA 5IAOA 2BGTA 1CVRA 2I4MA 4FCTA 1WB6A 3V5NA 2BFFB 3DLCA 1U8CB 2Y05A 5CA1F 3DZGA 1TL7C 4J3JA 4UVGA 1QIDA 4L4UA 3M49A 1EGAA 3D7RA 1WXIA 4H9GA 3PQ7A 5F98A 4RCVA 1RC1A 5FWYA 3KV1A 2RHWA 3CUKA 3T51B 3DZCA 3LVFO 2VTKA 4MUIA 1XVTA 2X4GA 1EDEA 3KWJA 1QGAA 1HDCA 1UOQA 1E2BA 3O3NB 2R6ZA 4MH0R 2P69A 4F2HA 4ZVPA 1NNLA 2DQSA 2P0AA 4LECA 3OOHA 2EW2A 1XN4A 1L8OA 2FSFA 2YJ4A 3HDQA 4P26A 1W46A 3LBNA 3FYTA 4QPDA 4A2QA 1WUIS 4GI5A 3ZE7A 2G08A 2J9FA 1GUBA 2QW0X 1EQ2A 3GZ4A 2VK2A 4KH0A 4BLWA 3Q10A 1FYVA 2IJGX 3EEBA 5KX5F 5EJ5A 1A5ZA 3DV0A 4R51A 5H3CA 1FP2A 4AVYA 4OOEA 4EVSA 2PX2A 1P44A 1CJTC 2BBOA 4GR9A 1HYEA 3WLFA 1QRRA 3R3SA 4PX9A 2BL4A 3WL7A 3ZHCA 4BFSA 2ZWOA 2FGJA 1OR8A 4WBNB 2QAGA 1OIXA 3MUEA 1ZZEA 4NBRA 4Z4GA 2FEXA 2FOLA 3HJTA 4ETMA 2QE6A 3B3GA 1H2WA 1GEEA 2A0FA 4LJ7A 5CM2Z 3SEFA 4TTSA 4GOKA 2AWNA 2H0QA 3OHSX 1DAEA 1Q74A 4ERXA 1SO8A 2NTVA 2QD2A 3L77A 5AOCA 5IAKA 1A50B 1Z88A 1J8DA 2QN7A 2Z95A 3WVNA 1DO8A 2OM2A 2ZU6A 4BMSA 2D1YA 4I6GA 5EWLB 4DMHA 13PKA 1MW9X 2Q3MA 2CE2X 2IA5A 4OYLA 3AHGA 5EG5A 2IZ7A 1TJNA 2QPTA 4PHFA 5AOAA 6YASA 2FWNA 2XA1A 3GGCA 3ORQA 4MP6A 3G0DA 5AKJA 4JWTA 4DNXA 3RRNA 1EKXA 1G8FA 1GTVA 1EE9A 2J4FA 2YC2C 3JQ7A 4UBMA 5FWAA 3RSGA 3H5NA 2OM6A 2DG2A 2P5SA 1ZUHA 3C6ZA 1SZDA 4EFDA 3WWPA 3DBHA 1SQSA 5TMBA 3ZE8A 1PGOA 2Y2UA 2IHJA 4EWLA 1OSNA 4YRQA 3M9WA 3I9KA 4OHMA 4GX0A 4PAGA 1OH6A 1PI3A 2J4DA 3CCMB 3FGNA 4L3OA 2DE0X 4FW9A 4D45A 2BUCA 2XLCA 4WK4B 3WC4A 3WK6A 2AZMA 3ZD7A 3ANTA 4LBYA 2W6JD 3BKWA 4LI0A 4ALKA 1LX7A 1EXVA 4LCBA 1FNBA 1DUSA 1FQWA 4E5KA 1UD8A 1BW9A 2QL9A 5BUZA 3U7FB 4FXUA 2VZEA 1OBOA 1DKMA 2I6UA 4FT4A 3SJBA 5JSHA 2H1WA 3WQBA 3IXLA 2W2QA 1TTPB 4FNAA 1U9IC 2ZE8A 3KQHA 4O29A 2RGCA 2OE2A 5KTRA 4KQ6A 1IBKB 1KMHA 5GP1A 4MYTA 3Q8WA 3O75A 3O3MB 4IX1A 4YJHB 1FL9A 5IEJA 3IX7A 3AEQB 4UZSA 1PR0A 1IMJA 2GBIA 4HN9A 4MYDA 4TKVB 5IAEA 4OP1A 5ELLA 3IDOA 4DUYB 4OXXA 3T5BA 4N65A 2F1IA 3PNQA 2PRYA 3CVUA 2AUMA 2QD3A 4G5OA 3QPDA 1GVNB 4D81A 3CM0A 4MINA 2FZEA 4KRYA 3M1YA 3JQFC 3ASRA 2WYUA 2P9GA 3HABA 5AVJA 4NXNB 1OOEA 2P1ZA 3KBBA 1Y9DA 1Y37A 5EYPB 3DOJA 4RMGA 3UOGA 1RYEA 1Z13A 1ZIOA 3D8RA 4QUGA 2QZ4A 5LM3A 1K28D 5F64A 1ZMTA 1LQTA 1ZR2A 3E5NA 2C2YA 4OOVA 1J49A 3CLUC 3EZLA 3GHHA 1RPAA 4HGPA 3UT6A 2FXVA 3CURA 4GQIA 3W6UA 1NW8A 2JIBA 3RSZA 4P98A 3JZAA 4DR3B 1TUBA 5ALPA 2XGMA 4QT4A 1E9RA 1TTHA 4CT4B 3I2JA 4K9RA 2D5AA 2B8NA 2JFZA 3GZJA 2OR3A 3P9YA 4MJLA 3U0VA 1XXLA 5JFGA 3G5LA 1CU1A 4O2AB 4Z8YA 4OQMA 5C5DA 2FYTA 1R9JA 1V9SA 4GICA 2JHGA 3MBKA 1DDGA 4J90A 2FPXA 4OP2A 1C7RA 2NUPA 4FEEA 1BMDA 3AHCA 2QAJA 1J25A 2OMKA 3CR3C 4HQNA 4KQCA 1JU4A 5IDYA 3KQYA 1T2FA 4EITA 3LF2A 1Y9EA 4L5JA 2VAPA 5ELXA 2IS2A 5I7WA 3OPMA 2C7VA 3SYLA 2R00C 3SM9A 5K8CA 2QTTA 1D04A 2O20A 2PV0A 2E4UA 1XZPA 2IPXA 3PR1A 3HB1A 1UMCA 1Z47A 1NZFA 4G5HA 3N7UA 3S7TA 4MRVA 5H0IA 1R88A 1U0EA 3HC7A 5JCOC 3PDJA 2W2NA 1H9AA 2VXYA 4XYBA 1KDZA 2B7BA 1KETA 1VKNA 4EP1A 4X5OA 3QPCA 4DV6B 1N34B 1OWNA 2ZAMA 5C8XA 1U1GA 1X1RA 2YMQA 4QARA 2J4CA 4QDTA 2VPXA 4WZEA 4M7OA 5EWJB 2I2DA 4OI1A 4FFLA 1VRWA 1C4OA 2V6MA 4EGSA 2EKPA 4B4VA 5IYPA 3GDFA 3DAHA 5CA1B 1JHRA 5DWVA 2WKWA 1N2HA 4KHPB 3KYDB 5JZVA 1ZH2A 2JJ8A 3IAM1 3DEFA 1E69A 4FPXA 5BSVA 3TUZC 1YL6A 1XIVA 4WTOA 3UV6A 1ORWA 2OBLA 3A1NA 3F90A 3LCMA 1PR4A 4D4JA 2EZTA 3IYLW 2ORYA 1E6CA 2PRIA 4E70A 3EVFA 5JUWA 1P9NA 4K9SA 1QM5A 5KJEA 2ZI5A 3F5MA 2OXTA 5LWQA 2WU8A 2BTQA 3LX4A 5ALYA 1QV6A 2AI3A 2JZCA 3EGEA 3U6KA 2AQHA 3AY3A 2VL7A 3NKVA 4I19A 1P2FA 2QNIA 4R8SA 1GHTA 5C34B 2O3SA 3LRTA 3EA5A 4CFYA 2VSOA 1PL0A 3BTOA 3MGKA 1NYLA 3QIVA 1OX4A 1UK9A 2PFGA 4P84A 3AVQA 3PHLA 4B0PA 3TNDA 4NAVA 3GA7A 3BBPA 4AT1A 4YMTA 4OBBA 4MTLA 3REGA 4M2LA 2V97A 4UU7A 4XGIA 3JQ7B 4Z4WA 3A35A 4CKZA 4BX8A 4AZVA 1KAQA 1T5EA 2O2XA 3K3PA 1XHLA 4FKZA 4YDSA 5JDIC 5KPDA 2R4UA 4FSXA 4V2UA 3SHWA 4F7DA 1YS9A 3DSRA 1ZBDA 3OT1B 3OC6A 2NACA 2QROA 2FDRA 2CXSA 3SS8A 3HGMA 5ICGA 1RAHA 1M8PA 2FUG1 3NAGA 1JEYA 4BMNA 1N75A 1VLHA 3RROA 4X05A 1NX6A 3C6BA 3ZGVA 1SC3A 2NADA 5H3LA 3R9KA 4GKBA 1O08A 4LVUA 2VTBA 4IUBS 1G8KA 3ACBA 3OP4A 4V0RA 1E3IA 3BH4A 4Q1EA 4LOKA 5EXSA 4QU0A 3BWCA 3IUEA 4DZTA 1IXYA 2DFDA 1PRYA 3K9BA 4C6TA 1DKPA 3R5SA 4FT2A 4IMPA 4ZK2A 4ZYWA 4FWTA 3WYAA 1A95A 3D3WB 1SKAA 3AB7A 1LBHA 3CONA 3D2LA 3LS2A 5C81A 3PJRA 4JEHA 3FMGA 4I1PA 4YCBA 2A3NA 1E3SA 2GDJA 4GUAA 4K6CA 5CT6A 3WB0A 1LPNA 3DV9A 2H1RA 2IIQA 2NSYA 3T38A 5HX7A 1JT9A 5IM4A 3ZCXA 2DETA 1ZXLA 1Y8QB 3GROA 3MYRA 2YDXA 3H87A 4W99A 5EZQA 4CF5A 4CEHB 2PGDA 5IF3A 4Q82A 5LPNA 1E8NA 5JARA 3QX7A 1BE6A 1FU8A 1S2NA 1EFVA 1SCAA 4GYWA 4KMOA 4P5EA 3OPOA 3SX2A 2PX3A 3TB6A 1MB4A 4B83A 2QIPA 2QF7A 4ZO9A 1DWOA 3HDJA 1W0JD 2I2BA 1K8QA 2WLTA 2YYSA 3HNPA 4HX9A 2BI4A 1A9ZA 1Q7EA 2BJVA 3TTVA 4A0FA 1FJ2A 3SS7X 5C1OA 1NUHA 2WU3A 5DU2A 3MAAC 4PPFA 4HMPA 5BSMA 1RXVA 5AVSA 1OA0A 1YJBA 2X8JB 3PQ6A 4HFNA 4YJDA 1T5LA 3VTZA 5AW7A 4XAQA 5LDDC 1OT3A 1XCJA 1RQ2A 2PJZA 4HO1X 1VGQA 1TW2A 3ZTTA 3COYA 5B1IA 4NARA 3ET4A 4QG3A 1OYYA 1VHDA 1TEXA 1DHTA 3LYUA 2WTUA 2GK7A 2AVNA 2JB9A 4GMHA 4JOSA 3KBOA 1O4WA 4YNBA 2M6SA 1AF4A 1H1DA 1YX2A 2SHKA 1JHOA 1N36B 3H7IA 5IWAB 4F5DA 3HA7A 4A8PA 2IY8A 1IUOA 1JIVA 4M0MA 1EB8A 4WLOA 4AJNA 4R41A 3O31A 1VKJA 4BJ1A 1VJ1A 4XB2A 5EZYB 1F6BA 3KSZO 3RAGA 4KFSA 3TE7A 2C4VA 1FFYA 2EYUA 3FJOA 3SF0A 4ZT3A 4BO9A 1BAPA 2FG6C 4L78A 4QKQA 4X9XA 1YMUA 2WTEA 2YRWA 1TJYA 1QBKC 3OA2A 4JP2A 4KQKA 3QMMA 4K6HA 5FFFA 3WHIA 16PKA 4BNGA 1BROA 4RE6A 1PJ8A 5CNJA 1ARZA 4MPJA 1EUYA 1C9MA 1NF2A 4N18A 4BFTA 2HK7A 3WBBA 1XK7A 2ATEA 3VPXA 3AY0A 3AJDA 3F6SA 4ER5A 2VPPA 3UB2A 1RYMA 4HH4A 3KHTA 2AZXA 4KQJA 3UGTA 2WZDA 4QATA 1CLEA 1QGUB 3HI4A 1HDIA 1NONA 4E5UA 2RK6A 2PT6A 2GD0A 4ISCA 3CCSB 1L7OA 3VJMA 2DSTA 3K9QO 4B6EA 4IQ4A 5JE8A 2J7KA 1ONPA 3A8KA 3C7CB 4XLCA 5HK8A 3JRXA 4DQLA 3PCXA 1JHPA 5SYNA 3QKSB 5U4QA 3RBAA 5KQPA 1XBTA 1PJZA 3COJA 3DOEA 2P62A 4DMGA 5JAMA 4X62B 1Z8DA 2YV5A 1U1EA 3GSIA 2BGNA 2QVCA 2ILVA 1I7QB 1J8VA 3LTNC 1REQB 1TD9A 3KXPA 2X5OA 4JT2A 1WPCA 1VYHA 3AYXB 5JMWA 4J7XA 2VUHB 3BSFA 3KRTA 1EFPA 3R6WA 3L6RA 3PGLA 5LA6B 1ZC3A 5P8WA 2BMEA 1CDEA 3PNKA 3FJ1A 3TQQA 4O3MA 4DA9A 4N3CA 3CNBA 2Q6VA 5AJTA 5LJIA 4D9IA 3SZOA 1XALA 5L3RA 1LRKA 3TXXA 1F60A 1BDJA 1DXYA 2RJNA 4X6XA 3N2NA 2O05A 4BNNA 1KE2A 1U0BB 2AWOA 4P7GA 1C3OA 3NCHA 1JS1X 1F2TB 4P4SB 4DSOA 3MNFA 5J2UF 1B26A 2DMRA 3KXDA 2XMPA 4EUSA 1P62B 4PR0A 4YQYA 1U2PA 1GKKA 5FCDA 3WA6A 4MW2A 2CC2A 3X1ZA 4RTNA 5ITZA 5EJ7A 1NRJB 1OCEA 2OUKA 2LD4A 2VFAA 3RNOA 2VHJA 4R2XA 2XUZA 3NG1A 2DSNA 2Q0HA 4AK9A 1B42A 4B3TB 5AM2A 1L7NA 3KU1A 1RVDA 2PSDA 2QTHA 3A2NA 5TX7A 3VDMA 2ZVQX 2HLHA 2VIIA 2A5JA 3WNZA 3RT1A 2W6ID 3NW9A 2B3DA 3RS7A 2BWJA 2CXNA 4RW0A 3UHJA 5MGNA 4KN8A 3HAGA 1W5AA 4FOSA 4UNNA 1CUSA 2DPHA 3E9NA 3ETJA 4Y2SA 5EI5A 5LMNB 3K9LA 3NAQA 4OMFG 4GX2A 3ZV4A 4H7IA 4DMMA 2FRVA 3CW9A 1FSPA 5K9ZA 4LFBB 2TS1A 1N07A 4FZRA 5JXJA 1V5FA 3FWNA 4M1TA 5FQNA 1G21A 4EY3A 1MAHA 3AZPA 1QGYA 4M87A 4E5SA 3S2ZA 1U2EA 5KVVA 4XLFA 1NP6A 3WLHA 4N8SA 1IYZA 3EDOA 2ZTNA 2CFIA 4RBNA 4O2RA 1T8TA 2P2ZA 1GL7A 2XVYA 5EY5B 1T0PA 1I32A 3IEIA 3G2HA 1IG0A 3A0RB 4NJEB 4O63O 4DQDA 2QYHA 1M6NA 2DUWA 3O9ZA 5H16A 3KQOA 3BQMB 1KZ7B 1H1LB 1SUCA 3M2TA 2G0AA 3E84A 3O8BA 1ODIA 3LQRA 3CD6B 2DOKA 4G86A 2QV0A 1APBA 2VF4X 1FNDA 1H2BA 2RBKA 4TLMB 3GIRA 2PG3A 2QJOA 3K32A 4OQNA 5AI9A 1Z7YA 2X0JA 3GEMA 3GVIA 3V1UA 1UAYA 1V1JA 4HUJA 2LGJA 4AECA 1GPH1 5F23A 4OGFA 5FPHA 3P9PA 5GWXA 4EYGA 3OESA 1V8PA 2XUGA 4E31A 2OTLB 1G5PA 3WZMA 3RM3A 3ZGLA 1SQ6A 4E46A 2PANA 3MAJA 1J97A 1DQPA 1V5IA 3RGGA 1GD1O 3VKWA 1A5SB 1GG9A 1NFQA 3G2LA 5GQSA 4PG8A 2XJ4A 2HT1A 3GC6A 3X2SA 1P1IA 1RWVA 3IV7A 2AKYA 1X7ZA 2MTBA 1M67A 4FZ5A 3PFIA 4JQOA 1VMKA 3B48A 5DM4A 3SOPA 3FDZB 4JP8A 4EJSC 2IU0A 4UQOA 5CLIA 4EA9A 5AFSA 1FFEA 1ECJA 1P1BA 2A0UA 3D1VA 3KCNA 1A72A 2D2VA 4XUDA 5PNTA 2I7TA 1NASA 1I7SB 3OLXA 1G98A 5TE9A 5B3KA 4O4IB 5ISMA 1GU0A 1SXJC 4JL5A 3A9UA 3F3YA 1M6VA 4EFLA 3UT0A 5FUYA 4W8GA 3NHZA 3TM4A 1W9MA 4NPHA 2AKAB 5HCUA 4F12A 4LNAA 5CLGA 3K9GA 3M9XA 3RIEA 5JH7B 1XMPA 1K92A 4FGWA 3KT0A 1EB9A 5EVCA 5LBUA 4YIHA 2C4TA 3ZHVA 4KLRA 3JTEA 3N7TA 1C8KA 2OV6A 1A8IA 5IKOA 1VM6A 2H5IA 4RDHA 4R1MA 2XECA 1B3BA 2VYQA 1K8YB 2GXUA 4GE0A 1YV9A 2PAAA 3SC2A 2EFYA 1ELOA 3HP7A 2D5CA 4HTFB 2XODA 3UFXA 1CUAA 1ZVJA 2OHJA 4H7PA 1SA0B 4HH1A 4B4OA 3ESYA 3KSDO 1R64A 3WLJA 1T9CA 3EVAA 4UDYX 3TPZA 3STXA 1PTJC 3B1YA 1MPTA 3DF7A 2J0EA 3GOQA 3TWOA 3C3DA 3H2BA 4G8JA 4KIWA 5DWQA 1SCUA 4IMJB 1MC5A 2XZTA 2JGNA 2N9UA 4LY9A 4BQPA 1EVZA 5B1DA 1N8RD 1BS9A 3TIXB 3A1WA 1KYIA 1RMYA 4AG6A 1D1SA 4F1KA 4YRBA 4LE1A 5CP8A 2B4YA 4OGWA 2FVGA 2QRNA 3PNMA 4MMZB 2DULA 2CBXA 1XCGB 4XDGA 4TPKA 1Y81A 3BRWD 1DNPA 4BBPA 2YVUA 3MCTA 1NP7A 4L4ZA 5K6AC 5E9AA 2D4AA 5K6RA 2WJWA 3T8YA 2QL5A 3KPVA 4UPVA 5J2UA 2AV6A 2EQBA 2VK8A 4A5OA 1IY2A 1XNJA 1W8DA 1X94A 2QMQA 3CVOA 3KJIA 2ZBVA 2AEEA 4RAOA 4D9BA 1Z6QA 3A6HA 3G2JA 5IYNA 2EZUA 3TTXA 4HLUA 4B7ZA 1T1GA 3BIXA 5DOZA 4DLKA 1P2DA 4CI0B 2FRXA 1WXQA 4WWVA 1UBNA 3R0JA 3R7LA 3VR5D 1L5FA 4RPGA 2VDPB 4YMUA 3AV0B 1ZGHA 5DBEX 1PZMA 2Q2QA 3O3OB 3U3ZA 3I6MA 1KQFA 3AVXA 1DC5A 5FEMA 5F78A 5J2UB 1U63A 1PW5A 3GRVA 3KE8A 1O95C 1X42A 2QMUA 2O7QA 4NY1A 3RRXA 3TD2A 4X06A 2JRCA 4OHBA 5MDHA 1KAGA 2B8TA 2OEPA 4MRRA 1D6SA 1UF9A 1V47A 2HXGA 1PV1A 2PO7A 5DIZA 1G3MA 4YPFA 4YPOA 3OZWA 3KEOA 4YQEA 3VA7A 5FEUA 4M37A 1Y9JA 2O2EA 4W5TA 1R7RA 3PCRB 4D2IA 5LQCA 1AE1A 1E3QA 4V39A 4IUCS 4M88A 2AXEA 3LVRE 4Y2RA 4EZIA 4CKEB 3IODA 2VJAA 1N25A 1C5KA 4UVDA 3ISTA 2BY4A 4OGKA 3RUHA 1HDRA 4BVJA 4DT1B 2WYRA 4M1EA 5JY6A 2D7JA 1NXWA 1RTTA 4J07A 1F6WA 1VZ3A 1YCDA 1MP0A 1GYQA 1Z6ZA 4BFYA 4XVUA 4R98A 5TXGA 3TL2A 2CN1A 3N8IA 4LOIA 2A14A 3OQBA 1E7RA 1I1HA 3GLKA 4KGVA 4LG1A 1KSHA 4QYXA 3T9AA 2V9ZA 1M7HA 3TFWA 3VI3B 2VZ9A 3VO8A 4UTPA 1I36A 2GVDC 4JLPA 4NH0A 4UREA 5HM8A 4FYIA 2MMCA 5GIPE 1GTRA 3MMZA 4HDKB 2GREA 2EW8A 4MR8B 1SWVA 1DLIA 1YQGA 1JR3E 1S9DA 5LMZA 1N1MA 2CUTA 2O2CA 4H08A 2BCGY 3D7NA 3FHCB 2A35A 4XWAA 3ZY5A 1GYRA 1YB4A 5DHSA 1CRQA 4Y18A 4YDRA 1JE0A 4FSDA 4ETNA 3BEOA 3EDQA 2GN1A 3EG5A 3ND5A 1TB4A 3RS4A 4V0QA 2ZYVX 1A98A 2VH1A 2F00A 5IARA 1XTTA 4ZRMA 4RPHA 5GZ1A 4LF5B 1VCNA 4Y6RA 4EKYA 3G17A 2PPVA 2VDQB 3ZWNA 5C5CA 1R9NA 2RC6A 3SNHA 3F5SA 4G4SP 4F21A 4IDEA 1QYXA 1T0IA 2H08A 2V59A 4MWOA 3RTGA 5J2TB 1GQOA 1XZJA 2G5GX 3AHFA 2QJWA 5IW8A 3T7CA 3BDIA 4C6SA 1EXNA 3C8MA 3JR3A 2QTCA 3HKDA 4MMXB 5DNEA 1G7TA 1D1TA 2IGBA 2WHPA 3DXZA 1K08A 5JH7A 2JLWA 1OBFO 3BA6A 1YC2A 4PGMA 3RLIA 3EIUA 5FLYA 5KOHB 3PBKA 1U8YA 4JK3A 3BIFA 5E4FA 1P1HA 3HGQA 5D85A 3QQ5A 1U5BB 2C61A 3BCUA 2ZL7A 1T36A 3WFJA 4A8JB 1AMOA 1X8XA 3O1HB 3MTEA 4KIGA 3L4BC 4KTVE 4RQBA 3KYCB 3ROKA 421PA 1Q92A 1GCAA 3JTMA 4RSHA 3WL3A 5CGZA 4I9NA 4J0DA 5TVGA 4BE9A 3NIFB 2R1ZA 1XLWA 1F7VA 4UFPA 3KLOA 3GUZA 1KDVA 3ZPXA 5GOTA 5HKKA 4EEZA 1LUAA 5JWHA 1BLIA 4QRDA 1NSFA 1QFJA 4JR0A 1I18A 4MV3A 3BERA 2GJRA 5DTMA 1O8BA 1V16A 4PG4A 4BTVA 1UMBA 1PJ7A 4C2AA 5LNK1 1EM6A 2WIGA 4M9SA 1Q2XA 2WB4A 3EOBI 3RYTC 5TF0A 1PYDA 1E2LA 1CZOA 1FZTA 4LYEA 4ZOEA 1OV6A 2AFRA 4M7WA 3WSWA 5IUKC 1SCJA 4IWNA 1Z4PX 4ZCRA 5CA0B 2QSUA 5IYWA 1K63A 3D6JA 1SKQA 3ZWCA 1AN0A 2GA8A 3AH8A 3B5IA 3EYWA 1L7EA 3IP1A 1XRNA 3V3TA 1O9BA 4NE7A 3KK0A 1IL0A 2YVKA 2ZJFA 3BXXA 1FJHA 3FLAA 4FSHA 3FOEC 2AN4A 5EJ9A 5LMCA 3L9XA 4ZMRA 4CF6A 2BHTA 2QDXA 2G17A 4ZEWA 4JSTA 3REFA 1HFJA 4TLBA 1MNAA 2CWWA 2WJ6A 5EKUA 3NH6A 2FUG6 1QHHB 3NMUF 5DV9A 4K1LA 1QHHA 2DPGA 1U8TA 5AI5A 3V1NA 5HRUA 2R6HA 4FQ5A 5EJAA 5A9SA 4JLVA 3DGFC 3UUFA 2YXDA 2G5CA 1EI9A 3A26A 3RS8A 4ML3A 5BWBA 4OSEA 3DBLB 4MCIA 4YP5A 3T99A 1P74A 3ZCRA 3NHBA 5JS7A 3BCFA 1FLNA 1PZNA 1J8FA 2GM3A 3IJ5A 3NDJA 2OXEA 1H3FA 2J41A 4U6QA 4ZJYA 5LMUB 2XMRA 5EJEA 1ZUIA 4ZOCA 4FGLA 2GPAA 3UG6A 3KDAA 5HWSA 1V48A 5CTJA 2HNAA 2O0LA 3GBPA 3H2KA 3K0HA 3SU8A 3Q4GA 1VBFA 4UM5A 3WJ7A 3IDZA 4M55A 2AHOA 3V55A 5JDIA 3E53A 1W96A 4MW6A 3VKFA 3CCVB 4WXRA 5CHYA 5DW0A 2J45A 2XGJA 3KB6A 4G1VA 4BKPA 2C3PA 2QVLA 3H4VA 5L8VA 4BYMA 5JAIA 5MN4A 1I3CA 1FS6A 1QPBA 3BE6A 1I30A 3SSMA 2QQ0A 4I5EA 3IEMA 1UT5A 3ZY4A 3KZKA 3I34X 4KXXA 2B25A 2G1KA 5DGXA 2HPVA 2C0CA 2L19A 1KMCA 3WZLA 4WZZA 2LUOA 3CA8A 1W36C 2CMHA 3CINA 4JXZA 4GW3A 1PFYA 2IYWA 1GUFA 1HUQA 1DBIA 1SHTX 4ZQBA 4X7RA 4C3VA 1JFTA 3FKSA 3B9QA 3KZMA 1K3TA 2NO4A 2Q9BA 3UF0A 3CKMA 3LO5A 3MPOA 3OMWA 2FFAA 4KR2A 5J35A 4X7PA 4G5GA 1HURA 2V6FA 1Q7YD 1U1FA 1EP3B 3ASQA 3GZTB 1NC1A 4ENWA 5BUQA 3HCFA 3EMBA 2R7KA 3ESXA 3L8EA 3LC2O 3O7MA 3OUZA 4QBIA 1WSDA 5DYNA 3WGMA 3FFXA 2QUZA 2PGXA 4N03A 3QSYA 1B00A 2HU5A 3DQZA 3FCOA 4PLGA 3RYFA 1N3LA 2YBEA 3GFGA 3Q9LA 2AG6A 2UUPA 4LI3X 3CIFA 5ALTA 5ALIA 4CLDA 4KUGA 2HMVA 3VNUA 2AYXA 1HE3A 1L5OA 1G5HA 1ZN2A 4LZJA 5CB0A 2JAHA 1SUFA 3WP1B 4A8JA 3PNYA 2ZEJA 4ESHA 1UMKA 1K9SA 4KN5A 3WQSB 3ODPA 4DBVO 3UXEA 3EGDB 2I1VB 5ICCA 4D92A 2CF5A 3CT6A 2YV2A 1MGOA 2AI2A 3DEHA 3WMXA 3T3MB 2AMFA 3GPDG 4PYLA 2OHGA 3V6MA 3T1NA 3I4FA 1DWQA 4FXPA 3CRMA 2WZQA 2AT1A 1ADFA 3IQWA 3KPYA 1FFXB 2ZKLA 2CNWD 3KKOA 4P9NA 5AK3A 1NG1A 1VZ2A 2A5FA 3CO5A 4E4YA 5K09A 2V55B 3DTYA 2KSQA 2W11A 3NFYA 4HDMA 3SR3A 3U44B 1POXA 2A7QA 1UMBB 2G9QA 2O1EA 1YI1A 1Y48E 3ZGOA 2PKWA 2QENA 1LJLA 4BO5A 2HR1A 1SBQA 3C6QA 1ZUNB 3K9WA 1U7OA 2BAGA 221PA 4GWKA 4RJKA 3MJEA 2RGAA 4X92A 3I83A 5D3MA 1RZVA 2Z8YM 5HFJA 1WAMA 3OQNA 2O2YA 4BB9A 4K0RA 4ZMSA 1Y4DE 1VHTA 4W8HA 3J80A 2EBWA 5T8KC 1MBZA 2P9JA 4ON9A 2QRKA 1V1MB 3PUNA 2CYCA 3AYZB 3D1LA 2XOEA 1L1RA 4BQEA 1Z5VA 4GC5A 4WKPA 1ST2A 4X66B 2EP5A 5C8VA 1IZYA 4KLNA 1G5IA 1J0BA 3PI7A 4ZI3A 5A4JA 2WSYB 3A4TA 4EMBA 3IPXA 5F2KA 3ZHZA 1GAXA 1TM4E 3ONVA 4JS0A 3DB2A 4TVBA 5JVDA 2X1VA 1XZCA 4RGYA 1MOZA 3NETA 2RKBA 4U6NA 5I9NA 4X8LA 2FZ4A 3OJOA 4Q1AA 1XZLA 2J3LA 1GRNA 1C0LA 3A05A 1FVOA 1V6SA 4R71A 1P2GA 2NNLD 2QTFA 1L4LA 1LSJA 1RXWA 4QOEA 4RZIA 4I1RA 3VJLA 4DDTA 1VQ6B 4CTNA 2GN8A 3BJEA 2UZ4A 5DLEA 3C0KA 3OJ0A 1ACJA 3NKFA 1Z2NX 2B7LA 4JJFA 2FN8A 2IHKA 2JAWA 1Z0KA 3SLDA 3LGXA 1NUSA 1V8FA 3PEVA 4U2KA 5GJCA 5KYVA 3EJWA 1O0BA 2VQ6A 2Z6QA 1BEEA 1CDOA 1JEEA 3EHEA 3H17A 1VQMB 3QMVA 3UM9A 4FU0A 1RFGE 2HMWA 3KV3O 2ZE7A 2CSUA 3H0EA 3PFGA 3SIPA 1FYXA 1YQ9A 5J5CA 4S04A 1WP9A 4ADSG 3A10A 2N0SA 4FN4A 3HYLA 4GXRA 1W93A 2JCSA 3SFZA 4XRGA 1KIAA 4HNAA 5AW8A 2QMYA 3QW4B 4WECA 5E9WA 4EB8A 2IZ5A 1WZUA 2GYWA 4AS1A 2F43B 4HDKA 5LYJA 3LOPA 1EFHA 5JWRA 5LYJB 3CEAA 4GLFA 5D5QA 3WO0A 5EZSA 5L3SB 1JLRA 2PLAA 5LQUA 1UQRA 3AHDA 3H9GA 3I4LA 4WT7A 4XL9A 4IYRA 4NC9A 4R8MA 1ECBA 4CGZA 1W2BB 3MUNA 4E4TA 3QVLA 2GA9A 1QANA 1QBGA 2DFVA 3DR3A 5AI0A 3M6XA 3HPRA 4YP9A 4QFMA 5FOWA 5IFKA 3ZYZA 1YRHA 3BJZA 3LWDA 5TS2A 3K6JA 1G21E 3WMEA 3QXHA 5A04A 3VR3A 2WR8A 1WPGA 2QGFA 4AY5A 2FWRA 3AHIA 1Y1SA 1E1QA 1KI7A 3T3HA 1EZZA 4G6ZA 3IAFA 1V4BA 3DWEX 1D5WA 8MHTA 1Q14A 1UP7A 5TPWA 4OFWA 3RYHB 2WAOA 3HLKA 1JAZA 1YDFA 3NFRA 2HB6A 2NTYC 3PI6A 1U5CA 1U5AA 4BVEA 2GAAA 3CBGA 4P92A 4D0GA 4KE7A 4KI0A 4L4RA 4NJMB 2O5RA 3CCUB 1KO7A 3DW1X 2VZLA 1E18A 2NU8B 5B6IA 4RETA 2CLIB 1M2NA 1L7AA 3P9NA 2VDRB 2H11A 3PHCA 4J2TA 2WUGA 4IR7A 4HDMB 4YCDA 4R9VA 4IJ5A 1IHYA 1T5BA 1J23A 2PCJA 2YZMA 1JSXA 3BMNA 4HD8A 3ROFA 4LVCA 3L4EA 4RVHA 4RPDA 5ALHA 1TOAA 1QVFB 3ZW8A 2FB9A 1N5IA 1OMOA 4ZCQA 4DGSA 4MA0A 4KHZA 4Z86A 1HQKA 1WSRA 3GRUA 5AVWA 1ILWA 3EIEA 4CN9A 3H2JA 4CIAA 3TSYA 3ABZA 4EJSB 1UMDA 2V7PA 3IUMA 4PGGA 5AN9A 1SBNE 1TX4B 5IF9A 1T0JB 5I7EA 2WTMA 2Y1LA 4UBLA 3S1AA 4OK6A 5FBQB 3HXMA 2J07A 4ALLA 4RD4A 2XUAA 4RL4A 4WCFC 2EZ8A 3FMOB 1AHIA 2JAUA 2ZT5A 4FYYA 4HDAA 5BMVA 3WKEA 1WXWA 1HKUA 2HMYB 2R8YA 4B7AA 1PS9A 5COAA 4D56A 1AT1A 1T0UA 3AILA 2ZITA 5KREA 5G0VA 5IJ0B 3WOVA 4R2LA 4Y3UA 1U04A 4MDFA 2HSWA 3L0YA 3CC4B 1NMSA 2HJWA 1ZVQA 2Y3IA 2HJ9A 4I14A 3GO4A 4J29A 1W75A 2OK8A 1V41E 5HDBB 3UYKA 4DAEA 1ZA1A 821PA 4LFAB 2F6RA 1GAWA 3S5UA 4NDAA 1SHUX 1V16B 1QYVA 3GJZA 1QIMA 5WRFA 1UJ4A 4QXRA 5CX4A 1SZJG 2ZE6A 3RB8A 1TUIA 5CDGA 1CUJA 2FMTA 4B9AA 3QITA 1MAWA 1HYGA 1IPHA 3BBLA 1M33A 3S44A 1IPFA 4PE5B 3MRSA 4OG2A 3TE6A 2OXRA 2TMDA 3IO5A 5BSXA 2A0KA 3NV9A 4P4GA 2C92A 2PQ0A 1JQBA 4GZ6A 4LC0A 1TA0A 4R7ZA 4AJPA 2ODQA 2VSFA 3HYTA 3SIWA 1ST3A 4BRSA 2AF3C 2RH5A 2OFXA 3Q2OA 4DBLC 1L4UA 3NEJA 1O9GA 4N5NA 5KYYA 4C4SA 1QIGA 3LNNA 1XU9A 2ST1A 4BNHA 4CTMA 5JALA 3SQLA 2C94A 3PA1A 3CE9A 4X65B 5JNRA 4MGEA 4ZDJA 1XEAA 5B57C 2XT9A 3FOCA 2UZ0A 4OF4A 1FW6A 1PQ4A 1XRSB 3IUPA 3QPAA 5EJ4A 2D5IA 2FMUA 4L7QA 3GFSA 1G4UR 1JMYA 3DE1X 3JQGB 3NTVA 3R0ZA 5EMKA 1QYWA 4HWRA 3B6KA 3A4NA 3WB1A 5JJ5A 3SXUB 5FOSA 1F2DA 2CDRA 4PHTA 4E1VA 1C41A 4N01A 3M2PA 3BUSA 3AOGA 4CCAA 4O8ZA 3J81A 1MB0A 4H2DA 1ZM9A 2FVXA 1N06A 1U1CA 3IQEA 5F5XA 3WK7A 5KJFA 1OLXA 1SUEA 4RSMA 3TRHA 1X77A 5B3LA 3JQ6A 3RKUA 2JLVA 1CRPA 1YDMA 4MHTA 3EZXA 4EBFA 3FSRA 4CIDA 1ZUWA 1Y3HA 4KLAA 1YNSA 2A0WA 2FAXA 3ANLA 3ZDYB 5CVTA 4NAHA 2R7MA 1UBKS 1ZIDA 1BVUA 2I1QA 2FZLA 5C46F 3EFBA 5BUCA 2JVIA 1IWOA 2QTZA 5DGHA 4DLTA 3CUUA 1TTQB 4UE3S 4LE2A 3K70B 4OEHA 1CCWA 1NF9A 1TKRA 4C01A 2AFHB 3AY7A 4X6LA 4QUAA 2FPKA 4V1CI 1VHWA 5K3SA 1KRWA 4BQOA 5DLQC 5BWLA 4HAXA 1T9ZA 3EBOA 1CX9B 1G5RA 4X71A 1T24A 2I4OA 4JI2B 4XGKA 1SQFA 1BEZA 2JGDA 3CLVA 3R3HA 3EMKA 4ZOLB 1CEYA 3AUAA 1SHLA 2JLAA 4CMKA 1WHSA 5AKGA 5JNVA 5AQEA 3GFTA 2EDCA 4AZSA 4I4TB 4Y30A 4HUQA 1ZMOA 3C97A 4YAWA 1DOZA 1VKZA 2WHEA 5KTOA 2O2IA 2OZVA 1JECA 5JZMA 2EKLA 2RK3A 2DWCA 2GS9A 2JK1A 4TLDA 3MTAA 1PHPA 3EXEB 4AN1A 5ARDA 3H5LA 3Q0IA 5BUSA 4HIZA 4WIAA 2BHRA 3HB0A 1YGYA 2WWIA 2AG8A 2HBQA 4FKBA 4PG5A 3V1YA 1JHZA 4PW0A 4IJKA 5J43A 1E5TA 2KMLA 2Q62A 3NRJA 4IBOA 3BY2A 3RFVA 3IMFA 4A27A 4JLAA 2IYSA 5AKHA 2PUBA 1C3VA 4FDMA 1VHJA 3AF1A 4HLNA 5M04A 5JJBA 4KSBA 3ZJYA 4BAZA 4IOJA 1ODTC 4RY2A 3JYQA 3P9KA 4FHDA 3UMVA 5CFOA 2RC5A 1Y1RA 1F1BA 2WWHA 1F0NA 3O2NA 1G6OA 4DR2B 2E4WA 5DNVA 2QQFA 1E63A 2C57A 4FDTA 4KKXB 2YH2A 1S96A 1XD8A 5CLLA 5KYUB 3UK0A 5HQJA 3WK5A 2EC5A 2P3QA 1VE6A 4AIIA 4RPCA 1ZNZA 2IUSA 3OT4A 3IKTA 1J0XO 3H1FA 3OX3A 4NHEA 1Z9BA 2PGAA 3IIJA 4AD8A 1XXHA 1V35A 4RK7A 4P6YA 2P27A 2NW6A 5E3IA 3I1YA 3WLPA 3PTZA 3TW6A 1YFZA 2C29D 4LXYA 4YS6A 3X0DA 2BP7B 2J7PD 3SJAA 5KOIA 3SM3A 1A71A 3BB3A 5BR8B 1FSFA 2NUAA 1U2RA 2E4AA 3TEJA 4F96A 2GEBA 4X97A 2O8CA 3TQHA 1S0UA 2Z3WA 3H18A 3B7PA 4YRTA 1BCRB 5JYEA 1ZVKA 1G8MA 3BTSA 4N7MA 4XCVA 5AUPB 5K8VA 4OJKA 1XTPA 3K71B 2CXRA 3DEJA 3K5PA 1L7BA 1PVVA 2O7RA 3FFBA 4Z99A 3GCZA 3HRKA 3HACA 4FB4A 5HW0A 1JKJB 1Q1AA 2HIAA 4KWHA 5C1DA 1ESEA 5I7SA 1WSWA 1JKJA 4JMQA 3LV8A 4LCEA 4RVGA 4S12A 1FCJA 2CB9A 3D5EA 4DWOA 2J3IA 1LLDA 4FYJA 2GH1A 2WFLB 3JVVA 4Q03A 3VNAA 5F5LA 5LZ4A 2HRDA 1YSCA 4JLBA 1N77A 3CLHA 3R7SA 4ZAXA 2DWUA 1GXSA 1PFUA 5DCWA 3ZHSA 1CHDA 4N7RA 2XYVA 4X93A 4DCUA 3I9FA 1GTSA 1GKYA 1T6YA 1S3FA 5FOXA 5DN6A 1IONA 2HA2A 3ZE1B 2DT8A 3EFHA 4QODA 1T8WA 1X9HA 4B3BA 4EHLA 2Q5JA 5I01A 3LCCA 4C4XA 3C16C 1P0IA 3KPUA 2HCJB 3LDUA 3MOSA 1V71A 1OXUA 1BKYA 1E6UA 4QHSA 3TDMA 5FPKA 3W5VA 3GVXA 4RACA 5DK4A 2ZPTX 2VCEA 3AJRA 1J7JA 5HQ3B 2WJYA 4L5AA 2D7DA 5KQMA 5C1IA 3V7AA 3DEYX 1MX9A 2VPYA 1UBGA 2E37A 2K4MA 4JWKA 4IGIA 3RW9A 2R97A 2XZOA 4QDJA 3TVDA 2F4VB 2F8TA 1SNYA 1IEWA 1GPUA 1GZVA 1RE1A 2FSGA 1X1CA 2UXBB 2F8SA 1SKYB 4H15A 4IV5A 5AHRA 4YASA 4L3WA 3T3NA 5IJXA 5DE3A 1YKSA 4XKWA 3L8MA 4LRSB 4XUEA 4AJEA 2FFHA 1BCSA 4EF4A 3KOYA 2R8RA 3F1LA 1FRNA 3LD9A 4L4YA 3JQQA 2X77A 4K0KB 3V7WA 3PE3A 3B2EA 5KVAA 4B75A 3IP9A 3N6XA 2VTDA 4DBZA 1ZN7A 2JAPA 1W4RA 4UFOA 5LZ5A 3MGGA 4QJ3A 3KT6A 3PUJA 5AVQA 3U56A 1M0SA 5G4KB 1L4MA 3ELUA 2X86A 4MKRA 2ZI7A 4UUPA 1B1CA 2J32A 2HA3A 4PAQA 4LPKA 3LZ6A 3F73A 5CVUA 4KNWA 2QGZA 2FSUA 3VR6A 1P7ZA 3P2JA 3VV2A 2IBMA 1CDDA 3FDJA 1G3UA 4DCOA 1VF7A 2OVFA 3V33A 5B1YA 1R1DA 3JD4A 4CL3A 1U9ZA 3H1BA 5B36A 2QGGA 1W44A 2FR8A 2VC2B 3CMEB 4OMUA 4OQZA 1T15A 3RUAA 3TJRA 2O5CA 2E2WA 1MIOB 2J85A 2JGLA 1RACA 3UFXB 2B61A 3X2EA 1QRUA 3ZC3A 3B36A 3NHRA 4Q1DA 4BPRA 2CCKA 3ME5A 1BG6A 1GN9A 1Y8RA 4EGAA 3KZ1E 3RBZA 4CEIA 3OZEA 1PS8A 1V37A 3HJCA 3QEJA 2R7LA 4K81B 3PEFA 4CEJA 4CKBA 1GPWB 3FPEA 4CL8A 2L42A 2DQYA 4JMLA 1W0KA 4P4UA 4RK5A 5JAOA 4YR9A 4PICA 1E1KA 4TQUS 5CM9C 3SEQA 3SC6A 1XYGA 3EGDA 4ISBA 1JXOA 3FRHA 4UEWA 3M6IA 4JOCA 3O82A 4RJIA 4ABTA 3IR7A 5FPPA 4N5DA 3WFZA 2R1TA 3DOHA 1M73E 3KJHA 4MUNA 3WGGA 4QPZA 2JIDA 3G6EB 3UAXA 3KJNA 2R8OA 1ACLA 1INLA 1JSCA 2EIHA 1EK1A 3RRZA 3SIRA 1D2GA 2K87A 4PGOA 1LI4A 1GSOA 1YDGA 5C8ZA 3OY2A 3PQEA 4JUIA 4EW6A 5AVUA 1SBTA 2QJRA 2M9MA 2P79A 3A8JA 1YFJA 2VJCA 5ESWA 2G4VA 1UPAA 3OPNA 3UAVA 3G6WA 5IJ0A 1CUGA 2B6HA 4AQYB 1C3OB 4P4SA 2DWPA 3M9LA 3KOUA 1V5VA 4BECA 4KAFA 1TUGA 5G3ZA 1E9EA 3TW4A 3L9WA 3TFQA 1WORA 3ILSA 2I5PO 5DGIA 4D7AA 1E2DA 3O74A 3VKUA 4AP9A 3N2KB 3M1AA 1KSGA 4E30A 1L5RA 4C2UA 4Z4QA 1W29A 4Y2TA 1ZICA 2GLUA 3C87A 1J70A 1NVTA 2OYCA 1HDEA 1KU0A 4JSYA 4K9NA 3PKJA 5TJ9A 3V7NA 3TLZA 1KI1A 3HZRA 4XKVA 5D84A 3GVCA 4MCHA 3NU1A 2X6TA 2ZYTX 1EJ2A 4R9UC 1E3WA 3TH5A 3N8HA 3BHMA 5CJPA 3ZNOA 3W1WA 4CM6A 3W8EA 3W9YA 4QLAA 3D31A 3ICOA 3KQPA 5GM2A 5A89A 2WUDA 5IDVA 1I4WA 1MJHA 4RZ2A 1N2CE 4LOLA 2PEYA 1OD6A 3RRBA 2IWHA 4MEJA 3EISA 1VG8A 1HE1C 5T8KA 1QX3A 2DUMA 4DJDC 3H9BA 4JLUA 2P8SA 4IVNA 1QP8A 3UOAB 5TMEA 1Z6AA 1MTZA 5IUJC 3V4ZA 3EGIA 3B38A 5TVKA 4OV6B 2JL1A 4QL3A 3KUCA 4YTEA 1GL9B 3C39A 1E5LA 1BC5A 3EEYA 5ALOA 3SQDA 1CDZA 2IOFA 1ISIA 1N0UA 3AJ9A 4UXIA 4E21A 4ERNA 2J3EA 3K8OE 1UAAA 3IJRA 3U4GA 1G17A 1ZMBA 2XGOA 3IP6A 3SZUA 3SICE 2WIFA 3NT4A 4HVCA 5DM1A 5KHOC 1L5SA 3C1UA 3DMRA 5FTJA 4DC1A 5K8UA 3E7XA 3L1VA 3SCZA 5G1OA 1IG3A 1QH0A 2NQTA 2EFHB 4X64B 1B3RA 1M54A 3W90A 1WOSA 1Z06A 4AI6A 3TCKA 3QEAZ 2IYXA 3CZ4A 1ZKDA 2CFSA 4BKUA 2HSZA 5FULA 4OH1A 4FEGA 4WZTA 4GVXA 2UYCA 4CE6A 1UPTA 2VHUA 4WGGA 2H1VA 2I6XA 5EE3A 4ZJUA 2HSEA 5AXBA 3RC2A 3LIPA 4U1RA 3DUFB 4W7SA 3TS1A 4BZWA 2PD6A 2KYRA 5E7MA 3OWOA 1WJGA 4NJMA 1XQ6A 2GX6A 4RMHA 1C1XB 4D25A 5AJHA 3K2BA 3F3SA 2V8OA 2WNHA 3DOOA 3MINA 4J76A 2ONZA 4KQFA 1Z6PA 1TAHA 2C4NA 3N1UA 1BGXT 4HNRA 1NUTA 2R86A 3T9BA 1X1BA 2UZ1B 1CUDA 4NBKA 2XE4A 4F4CA 2ZIXA 4HK4A 1QDEA 1DC8A 4G2TA 5K03A 4D5GA 3QSGA 1ESNA 5ARBA 2AOVA 3Q3CA 1DBRA 3JQ8A 4D6XA 2WQ6A 3KUKA 3LQ1A 2JH9A 2WF7A