4F7DA

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
246
Chain Sequence
SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 76
structure length 246
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4f7dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4f7dA02
3U6BA 3MMPA 1ZUNB 1EXMA 1KJZA 4UAJA 3ES9A 4MYTA 4F7DA 1VQ5B 5FA6A 1B23P 5GV7A 1G7RA 1GR1A 1QFZA 1EP1B 1EFTA 3U6KA 3W2FA 1KK3A 2B5OA 3SJZA 3JQQA 2BGIA 2DEUA 3W5VA 4RD6A 2E1RA 5TY0A 1BJKA 1NDHA 1H42A 3OJWA 3QFSA 2PMDA 4TN1A 2VYQA 4RCZA 1JA0A 4PC2A 4Y9RA 1VQ6B 3I1FA 1I7PA 3WY9A 3CCRB 2GQFA 3MHPA 4HE5A 1VQ7B 2FX3A 4RD2A 3G6EB 3AGPA 3OZWA 2OTLB 4LBYA 2C78A 3J81k 3MCAA 3E1YE 1R5NA 4NCNA 4B44A 1OGJA 3CC7B 3ZBTA 2RC5A 4ZCIA 3W2IA 3CCVB 3I56B 3CCSB 2X3UA 3AVYA 2XNJA 4IW3B 1ZM4A 3AVUA 2BM1A 3LO8A 4M1KA 2PIAA 3VO1A 3QFTA 1DARA 1Q86D 1A8PA 4TMXA 3JQRA 2HMAA 4P3YA 1EP3B 1W87A 2HDNB 1EP2B 2VNHA 4G5GA 3CRZA 4Y7CA 1R5OA 1OB5A 1U2RA 3W2HA 1DDIA 4PC6A 3VMFA 1YI2B 1W35A 4RD1A 5THXA 3CC4B 4YHBA 2OTJB 2QN6A 1E62A 1KQSB 1QUEA 2PLFA 4B4DA 1KK2A 1OB2A 3JQPA 1YHQB 4M2LA 3AGQA 1K73D 4RD4A 1XB2A 5TV2A 3B78A 1N8RD 4Q7JB 1Q81D 1J9ZA 1QGYA 1QFJA 3WXMA 4U9UA 1GAQA 1SKQA 2YWGA 3QFRA 4PC3A 3G4SB 2GPJA 3LYUA 2QTLA 3W5UA 2ZITA 2D74A 4J0QA 2B7CA 4LBVA 4B3XA 1EFUA 1BX1A 1SM4A 4C43A 1W34A 1GAWA 2RC6A 3ZZUA 4YALA 3U2QA 1ZM9A 1QFYA 1VQMB 1QGZA 1GVHA 1N0VC 1QUFA 4QFMA 1H85A 1FDRA 1QX4A 1M90D 1ELOA 3W2EA 1D2EA 1FRQA 2QEXB 1EWYA 4LC0A 4TMWA 4BPRA 4G1VA 1QH0A 1D8TA 3AVTA 4TMTA 3V76A 1JA1A 2EIXA 1TLLA 1M1KD 4ZV4A 1AMOA 3W5HA 1CNEA 1VQ4B 1N0UA 4AF7A 1ZM3A 4AF6A 2DY1A 1JJ2B 3AVVA 3P26A 4PGOA 1BX0A 1S72B 4RD3A 3W2GA 3LVBA 4TMZA 5EMNA 1FRNA 3CW2A 1E64A 5GV8A 1VQPB 2EFGA 2QDXA 2J7KA 4DQKA 2BVNA 4LBZA 4YAFA 2VZLA 3WNBA 4YAUA 1VQKB 4H9GA 1XE1A 1D1NA 4PC1A 4PC7A 3CB4A 2BM0A 4ZGNB 4AC9A 1W2BB 3FJOA 3CMAB 1YIJB 1IB0A 5TR9A 3CC2B 1E63A 3CMEB 3CCLB 4NBSA 5H59A 4G1BA 1IJFA 1KK0A 1AIPA 3AVWA 2XEXA 1K9MD 1BQEA 1QVFB 2BGJA 3WBKA 3I55B 1CNFA 1TUIA 1Q82D 3FPKA 4P6VF 1FNCA 3P27A 4WQMA 4B47A 1IJEA 4Y9UA 2R6HA 3VO2A 1UMKA 2QA4B 4HE6A 2NPFA 1YJ9B 2BPOA 5HXBA 4FWTA 3WNCA 4ZGQB 4M4SA 5DSZA 4ACAA 1FNMA 4RCYA 1YITB 4FN5A 3E20A 1FNBA 3CCQB 2XNCA 1CQXA 3B82A 1YJWB 4B48A 3AVXA 2BV3A 4B43A 4FK8A 2YWEA 3ZC3A 2BSAA 3CD6B 3OJXA 5H5JA 4YAWA 1YJNB 2DCUA 4RD0A 3B8HA 4ZCLA 3WNDA 1GJRA 1DDGA 4N3NA 2QTZA 3CCEB 1KRHA 4R71A 1VQ9B 3A1FA 1B2RA 2VNIA 1G7TA 1DG1G 3OW2B 4EH1A 2YWHA 3G71B 1QG0A 1G7CA 2DETA 1JB9A 2AHOA 4N3GA 2B7BA 2BN4A 3VNUA 3ZBUA 1VQ8B 1GO2A 3QE2A 3WBJA 4ACBA 4ZCMA 5KSWB 1KK1A 3OZUA 5JBQA 3LRXA 1F60A 2BMWA 2CNDA 4M0LA 4M53A 4QHYA 1F20A 4DQLA 3CCMB 1JNYA 3VNVA 2HCJB 1KD1D 2C77A 1G7SA 3ZZ0A 5AN9A 1K8AD 1NJID 2CRVA 1WDTA 3QSYA 1S0UA 4TMVA 2OK8A 2VNJA 1ZM2A 1TTTA 1R5BA 1KTVA 3QFCA 4RJLA 2OK7A 3WYAA 1QGAA 1Q7YD 1VQLB 2DERA 4MYUA 1FNDA 3CCJB 1QVGB 3CCUB 1TVCA 3CPWB 1KC8D 1OGIA 3ZZTA 2VNKA 3PENA 1HA3A 4YAOA 2QMUA 4K1XA 2BF4A 3OZVA 2YWFA 1VQOB 3CXCB 1VQNB 1EFCA 4C0SA 4LBWA
chains in the Genus database with same CATH superfamily
4WD3A 3MMPA 3MJDA 5GJBA 1KJZA 2Z5LA 3WMGA 4I19A 1GDDA 5JCOC 1A82A 1X1SA 3SHQA 5FA6A 4OFWA 2BC9A 3SF0A 2ISQA 4J7CA 2H51A 1FVFA 2E2WA 3OQBA 3TF5A 1DV2A 3WRXC 4MI9A 5IUNC 5JYCA 3UC9A 1POXA 1XZEA 4F6RB 2PCJA 3Q2KA 3LOPA 5BVHA 2WSSA 1EUZA 4WKBA 5FBLB 4C7JA 3V3KA 4OJNA 4OK6A 3ICEA 3AJEA 4AS3A 2Y67A 2ZANA 1QQBA 2E1RA 3PLNA 2IZ7A 4U2KA 5EGNA 3UOGA 1Z0UA 1ZUWA 4LTMA 2QZPA 5EIXA 4PYIA 4F84A 3DLIA 1A8UA 4IDGA 4L50A 2PR7A 4TXJA 1I80A 2EARA 3TVYA 1BROA 1NX6A 1PR2A 1YRLA 5HMLA 2G72A 2AUNA 2FUG6 5AOCA 3IE1A 1CUSA 4UW9A 3ZD7A 1R8XA 5L3RA 5BO5A 4OUDB 4E46A 4IICA 3FW1A 3GRZA 5FPPA 3VHQA 2GT1A 2AZXA 1Z83A 4AYXA 2NYAA 4DQ0A 5M5BA 3LKBA 1RWPA 4OBEA 1OAKA 2FWIA 5LLTA 1QGOA 2NU7A 5H3LA 2BFDA 2FV8A 1G41A 2ZL5A 5KYVA 1PJ8A 3S7ZA 3RVOA 4JR1A 2MSWA 1XDUA 4UEOA 3T7IA 1QVWA 1T0UA 1OY1A 3QKRB 4E33A 2OCIA 1NN0A 3AX6A 3I9LA 2YMQA 1LKZA 1ISSA 1X1TA 2VWHA 4H3HB 2BIFA 2F9FA 2C7PA 3SQXA 2A88A 5B3AA 2A33A 2FHPA 2Y66A 1QHSA 1KI4A 5LM3A 2VHXA 1M0EA 1FLAA 4CKWB 4LWQA 3K4HA 1XO1A 1F9EA 1MRSA 2V59A 3MAJA 4HH0A 4JI0B 3C1OA 2EGGA 1M2VB 3EWAA 3G0CA 4WZKA 2XY4A 3OCUA 3GUZA 3ORYA 4HXGA 3ELUA 4L78A 5BT8A 3N2ZB 4NXMB 3KHTA 4IIJF 1ZLXA 3P9SA 4XUEA 2IYSA 3HJTA 3F7NA 5EIEA 1TTHA 4Z4EA 2XR1A 4REOA 1YVDA 4FJ1A 1LLDA 4FMCB 3GAZA 3T1OA 2V3WA 1DC4A 3K9BA 4P3OA 3FTDA 1B76A 1GPYA 1ZJ4A 3NBKA 4CM8A 4L95C 4Z4FA 3VKHA 3DPUA 3A4YA 2VJCA 4RZXA 3VPBA 2FMUA 4K7JA 3MC1A 3EIQA 1Y1RA 3OZ7A 5GOTA 3I56B 1QCCA 4A8JB 3T0FA 5JARA 3GF4A 1A9YA 1DHTA 1FRVA 1Y3CE 3EARA 5B1SA 2AEEA 4W7IA 3WB2A 4F5EA 1X80B 1JU4A 2OHIA 3LF2A 3RIEA 5JXWA 2D7JA 4W9MC 1V2HE 4WNAB 5DYTA 4MX8A 1NUHA 5JANA 4ZKEA 2HK6A 4G2NA 3AVUA 3RS8A 2P5SA 5FUBA 4OHRA 1R4ZA 4URXR 2FDRA 3H5LA 1VMKA 3KQNA 3L7KA 2J48A 3UYKA 3UT6A 3LVQE 3T5AA 5LLSA 2H4JA 3AY0A 3GEMA 3GGSA 1XMOB 3V6MA 4XUDA 1RWKA 3ZD8A 5C1BA 1I3NA 3LVRE 3PE6A 4LX8A 4BJ5A 4DV2B 2I1VB 2JD1A 5G3ZA 3EF3A 3RS4A 1IG3A 4GMXA 3COZA 4K26A 3I05A 2VOEA 1B7GO 3WDKA 4Y0VA 1O5TA 3HA7A 4WGGA 2Q0HA 2VG8A 2ONKA 2X22A 4HQLA 5KWVA 3HVRA 2BH2A 4X1OA 1T0HB 1Z33A 4OA8A 4O4JB 1PUJA 3K94A 3ESXA 4TLDA 2IBTA 1OT5A 1MC4A 4BNJA 4KKUA 1UD4A 1EIZA 1MB3A 2UZIR 1TNDA 1UMDA 5F7OA 3RWMB 5KUTA 1V0EA 1GU7A 5J1SB 4PCLA 2AWNA 3D43A 1V1JA 1V48A 3I23A 4DC9A 2DIEA 1H2BA 1T6ZA 1NUSA 4MRRA 2DH6A 4DAEA 2GWHA 5JH7B 1TMYA 3FOBA 3KOUA 1CUWA 1ZSVA 5SYMA 1SUWA 1V4BA 2ZI3A 4BBAA 1CFJA 3BHMA 3LPLA 3CZ4A 3P52A 1CJSA 2AR9A 1PGOA 2O2HA 1XMVA 4AZWA 1EUYA 1K73D 3OX3A 4BV8A 5J58A 5K8CA 1KQGA 1Y6QA 1Z56C 2ENWA 2QU7A 2H31A 2UZ0A 3HJHA 1B6GA 4H18A 4KN6A 4Y9SA 1BGVA 4ZQHA 5F7ZA 4IQFA 4UTOA 4JCCA 4EF4A 3B60A 2O5EA 1T9AA 2JN9A 4QVAA 1TA0A 4C78A 5EKUA 5HIJA 1D5WA 5LP6A 3CPHA 1AKUA 3IUNA 1GNRA 3ON5A 3GLSA 1W5FA 3PG5A 3U09A 1IYZA 2RGUA 4ENVA 4HWSA 3QLUC 1DPGA 1KR2A 1P19A 3PDCA 3Q9NA 1H0RA 1XU7A 1GGEA 2B30A 4C88A 2OZVA 3HWWA 5IT5A 4RY9A 5HKOA 2FDCA 1COWD 1EVQA 3PCXA 5K0SA 3H2HA 2AF3C 2O50A 3EK2A 1ABFA 4B6GA 4JV5B 1SUDA 4F4HA 4B7UA 2NO6A 2PMCA 1CX9B 1GV1A 3K9NA 3V7NA 4DGQA 3KV3O 2BDUA 4B1FA 2W42A 9MHTA 4ER3A 3FVVA 5EUBA 3T5DA 3A36A 1RAHA 3NM5A 1CF4A 2WIDA 1F2TB 1Q57A 2OP0A 1DTWA 1SM4A 2CZGA 3HCRA 4MR8B 3DC7A 1GAWA 3R2JA 2P8SA 5JS2A 4QT4A 5KTRA 2OMKA 1R0WA 5HQTA 3FPFA 2Y76A 3W8NA 4BVGA 2X0EA 1FQJA 3JARB 4JP1A 5BN4A 3GZ4A 3A1NA 1YRHA 2XXAA 4QFMA 1KKMA 4DXAA 1EFRA 1M90D 2XMQA 1XKQA 1ELOA 1SKYE 2H92A 1PR6A 3H8VA 1G55A 2QAGA 3JVIA 1JEEA 1XEWY 1FA9A 5M29A 2BGUA 3MTDA 1LCIA 3RSFA 2B2NA 4B31A 2OHHA 3TTWA 4ER0A 4KTVE 4O4IF 3GDWA 1MJGM 4MPPA 3QWBA 1H9BA 2XCLA 1PWXA 2GJ9A 1W6RA 3UATA 2VYCA 2EVWX 5K3SA 3D7SA 3OIFA 1M2OA 4MULA 5LZ8A 1QH8B 3PC8A 3VX4A 5BNTA 4C2TA 2G71A 3GFPA 2JGNA 4MJXA 4TYPA 2QVYX 4E0FA 5C8YF 1U0NA 1TJNA 1Q17A 5A06A 3TX2A 1NZDA 4UUBA 3GWGA 4O2AF 3DBOB 3KYBA 5ISMA 4KRGA 4OL9A 4AKIA 1VECA 5IANA 2YXBA 2FUKA 4MCAA 4BX9A 1M1KD 4LIPD 3GO4A 3EVTA 1NF3A 4E94A 1Y6GA 2V6FA 3VPHA 1PK8A 1AQJA 4M0DA 3T3IA 3K6SA 4Y6LA 2XPCA 3IDSA 1AMOA 3USZA 1YR7A 3E9CA 5KDLA 3AWDA 3IP6A 4KQMA 3VC3A 4YVFA 4BAZA 2XE6A 3E0QA 1N0UA 3F67A 4J7AA 1YZQA 4HEQA 5J4YA 1T9KA 1TYEB 3CW8X 3P2EA 3GVHA 2PRIA 4HLNA 2VOJA 1JJ2B 1J0DA 1XTIA 2WWHA 3HN7A 2AJBA 5DHFA 3FWPA 4CQLB 4Q4JB 3W79A 1SXJA 3F4KA 3FA2A 4BRUA 3ROFA 5C4GB 1G9TA 3EXIB 3H1TA 5K0GA 3ANLA 2JFPA 2X8AA 2JK1A 3A6FA 1ZK1A 2F00A 3PSHA 2J7KA 1ADYA 2QVGA 3CX3A 1J8DA 3FPGA 4NOKA 5IBRA 4ALJA 5A9RA 2J6BA 4W5QA 2I55A 1R7RA 3DMTA 1V8FA 3D9QX 4IG4A 1JR3A 4INZA 1T6NA 3ABZA 4NU5A 1GNTA 2XODA 1VL1A 2BM8A 1S8FA 5IAKA 1RNLA 1V8BA 2CV2A 4Z4IA 2Q7XA 5LZ5A 2IJGX 1FNNA 4FLEA 4Z9FA 4BZPA 2DB3A 1ULHA 4M9QA 3JZDA 1Q3HA 3CMAB 3ED5A 4XIFA 3RKRA 5KEIA 4ZT2A 3SKYA 1ICEA 3MT9A 3C97A 3L7LA 2UUOA 2J0SA 3U56A 1DWUA 1FX0A 4J75A 4FX5A 1E63A 3QFHA 4EPXA 1TADA 4LF5B 3A0UA 5AW8A 1IJFA 4ML3A 3B52X 4ZT6A 4AUEA 4IMJB 4RDXA 1JHUA 4UTXA 5F9HA 1G5HA 3K30A 4DMCA 4PYQA 1P7YA 3PB3A 3I55B 8AT1A 4BQPA 2JVKA 4KLCA 2IEDA 3MJRA 3CVXA 2E4AA 3U7FB 4LY3A 1WKBA 1PG2A 4ND5A 5EL0A 2XWSA 3WGHA 4DREA 2JAHA 4CIYA 3HFGA 4DS3A 1ZN7A 1IXZA 3L43A 4CTKA 1EVJA 5ED4A 1JDBC 1M2FA 1SCDA 1HNZB 1EGMB 2IZZA 3BXZA 3HKCA 3AKZA 3BFXA 3VTFA 4IDBA 3ET5A 3FCYA 3PFCA 3E1KA 4HAUA 2R5FA 2QM7A 1QYDA 5B58C 3GPBA 4CBVA 4JSRA 1RDFA 4BN0A 4O5AA 5JROA 3PXUA 3A4MA 4AQDA 4QPNA 4C7VA 1QCYA 5B4UA 4PAOA 4WK2B 4RCYA 5E4TA 3W6PA 3WYEA 4ZIRB 1YQGA 2ZR7A 2ORWA 2WKQA 4G23A 3V8VA 4Z5XA 2RD2A 4X1YB 2AN9A 3ZPNA 4OH7A 1ZDMA 2EKQA 4LRUA 2W2PA 1O7JA 1GRNA 2MSEB 1XV5A 1WBJB 3AR7A 3JQ7A 4CL0A 1L5ZA 3DEYX 3AVXA 4FZRA 4IFBA 4MV1A 3CA8A 3QVOA 3PEUA 1L5OA 4P92A 4FK8A 1J8QA 3AFNA 5A04A 2IYVA 4KV7A 3II6X 1I1QB 4Z9BA 4AUMA 1I5OA 2QRUA 3PRHA 3WLPA 4PPQA 4ALLA 3A8IA 2O3JA 2WT4A 3RUHA 4L9WA 3VR5A 3AH8A 1JHQA 1RBZA 1S3IA 1UBSB 3DOCA 4WN9B 2GK7A 1DRWA 5CYOA 1H3EA 2DSTA 1J00A 1V5FA 1DOAA 5IEBA 2H4WA 4NH0A 1GAJA 4BU0A 4PVDA 2WK1A 3GEHA 1U7DA 2P3OA 4XLCA 1W4CA 1Q0ZA 2Q5HA 1HLDA 1BGWA 3PYMA 3N87A 3KKKA 1HYQA 2IOYA 1AUVA 1PT5A 2GXQA 3RNLA 3ZZMA 2HZBA 5HM6A 2HKIA 5GZ3A 2VLBA 4XR9A 4Z4WA 4ZHQA 4DCPA 9ATCA 2X5NA 4GYWA 5B1EA 1ESCA 1JW9B 4B3HA 1M8FA 4F9FA 2V7GA 1SHKA 2Q2NA 3GP5A 4RLQA 3PTLA 3BMNB 3WP0A 3SR4A 3E23A 2CVHA 1PIWA 3FTPA 4KP7A 5KYXB 2FG5A 2J9FA 2V96A 1IOLA 3B9BA 4NZYA 4OQ4A 5K3FA 5JHGB 1JR3E 2HCFA 4L0QA 4OHFA 1R3DA 3AF5A 4NICA 4AECA 1JFTA 5IVKA 2OZPA 2PO7A 3VPAA 5B2EA 3LIPA 4ZYTA 4V1CB 3SX0A 2O19A 3O2SB 3OE1A 2IDZA 3OA0A 4HWPA 4QJBA 3WSTA 2K2QB 3A0RB 3OEYA 5F5LA 2JIPA 3BCRA 1U8AA 3C85A 2HY7A 2N0SA 1OA0A 1JIUA 3QE2A 1TM4E 1TQDA 2WPDD 4P81A 5TQ2A 2GDJA 1BXRA 3V3TA 1Q12A 4HH3C 4U1RA 1WPRA 1XDZA 3BREA 3CRW1 5FOSA 4PYOA 1YA4A 4EA8A 1MA0A 3K31A 4GO1A 1EVZA 3E9DA 2POCA 4LISA 4K87A 1U0OC 2BM9A 5IHXA 1VJDA 4QXMA 4PRKA 4A2PA 1EXDA 1WBBA 1V71A 3MWGA 2G4LA 1UF9A 2HX1A 4IOMA 1HRDA 1LVGA 3RS9A 3UNXA 1LDNA 2QD5A 4R0VA 1P2FA 1XQBA 1K8AD 3G7SA 1W30A 1HOTA 2TMGA 1DC3A 3PJDA 4JR2A 4E7OA 3GSIA 1B16A 1GGNA 2XBMA 1NVKA 2IY8A 1XTUA 3JPWA 2B3TA 4EEKA 3MQFA 3O26A 1RFGE 4CN8A 2OCAA 3K0HA 5KMGA 2Z08A 2G40A 1G6OA 2Y1FA 3G5AA 2ZYGA 1WOPA 1AKNA 5F4MA 1GQQA 1WCIA 1KBOA 3G1TA 3NKVA 10MHA 4AX4A 4HDNB 4I4NA 1W1WA 4MDHA 4QU8A 1HFKA 4JLKA 1P9NA 1FQKA 4I55A 1SBHA 3W5CA 3NBZC 2DCMA 3V9PA 3U3JA 1G8YA 3LXRA 1A9RA 4IKPA 5H0IA 4TQ9A 4IH1A 3V55A 1P1CA 4Q15A 2W8BB 3ZE8A 1WUYA 3HUTA 4YJ3F 2X1VA 4IIUA 2P90A 2JEYA 4L22A 4LXXA 4AICA 3O8BA 4CM9D 1JR2A 2VJDA 2Z98A 5J59A 1MV8A 2GEUA 4A36A 4NOJA 1KC8D 4MLPA 1OPRA 1F06A 1UEIA 3CONA 2ECPA 1WM1A 2NADA 3D1VA 4NV3A 5HKLA 4AJ4A 1XC7A 2GR9A 2QI9C 4L74A 1UXKA 2QRHA 2VYND 4K9QA 3UPDA 4F06A 1I2DA 4BECA 5JS6A 5IS2A 3KB8A 3H4MA 2CXHA 1TEXA 3DTYA 3OQPA 3SP1A 2AMLA 3LCCA 4FZJA 3ONUA 1IBCA 4B84A 1WORA 2QNIA 1V11B 1KETA 2D2IA 3FMIA 1V1MA 1ZUNB 1GFZA 2VJMB 4ZAGA 3MTIA 2P6MA 3PVZA 2ES4A 3CRMA 1M2JA 3SG0A 1KRWA 4B5LA 1U6KA 2GREA 1X9HA 4HADA 4MP8A 3Q5DA 3B53X 4MDYA 4RESA 1LX7A 3EGXA 3JZAA 1HPLA 4ESHA 4ENSA 1TDJA 2GBCA 3LRTA 3MD0A 4UULA 2I22A 4X1IB 3UKOA 1SKAA 2EBFX 3Q3IA 2P6PA 1KGSA 3NDBB 2CF6A 2ZEJA 3O38A 3O84A 4HWGA 1N7IA 3LGXA 3FHCB 3TIVA 2NSYA 5T4HA 3RAPR 4CF6A 2Z9BA 5JCOA 5E7JA 2O8CA 1VLZA 2ATEA 3ZDYB 2WTAA 1WLYA 1T5BA 4BNXA 2H2IA 2HIHA 1BDIA 4R68A 3NH6A 2V5UA 3FI9A 2CJYA 3ZXSA 3U7QB 3W3AH 2ETVA 3ULKA 2G82A 2M1ZA 4I2VA 4OKSA 3KCNA 4HTFB 3WIUA 3GL9A 2AOTA 4CU2A 2QZJA 1P7PA 3DUFA 3EPLA 1RCTE 1II8A 2YN0A 3Q3AA 1RM0A 3QYFA 1GOTA 1GPBA 1QFMA 1VE6A 4P82A 3W6ZA 3RWBA 1HT1E 4FB4A 5LQUA 2O0KA 2ZSBA 4R9VA 1JQEA 4CV3A 4LJ9A 3H3XA 1EUDA 4ZU3A 3JX9A 4COKA 4A92A 2R8OA 5J5CA 5BNFA 3UMMA 5J9FA 1XZQA 5CW2A 5CT4A 1CQIA 1IUNA 2F90A 4TZTA 2G77B 3IUBA 1Z4KA 2W5UA 2D5CA 1RAFA 3MCWA 4IUYA 2ZAOA 3OKCA 1JPUA 2OAQ1 4QGAA 2W2QA 5DNVA 5JT1A 4HE5A 2RHWA 4ED9A 4AJLA 4PLCA 4W9RA 2E4UA 2Q5JA 2WJZB 4S05A 3KAKA 3P9NA 4IHKA 4YBZA 3SYLA 4EG1A 3SVZA 2QLLA 1P33A 4X92A 4EO9A 3VYWA 4NYJR 1KSFX 3IOMA 1E3TA 3ZJVA 4JJ4A 2O8DB 1KIAA 1JG2A 4KUEA 1NJ8A 1QCZA 3K9WA 3NPAA 1AV7A 3CC7B 2QTMA 4UTNA 5CDFA 3ZBTA 1JJIA 4AJ2A 4X8OA 4OX9Y 3FSEA 3WJ7A 1NXOA 1S7CA 1C0PA 1M34A 2EFYA 2JI6A 3SGLA 4KO2S 3CCSB 4B8WA 4ENTA 5AQEA 1QB7A 3HYTA 4RAQA 3DL7A 3EZYA 3MCUA 4TLAA 3KVNA 1GGMA 5DTMA 2P5TB 4CG3A 1BDBA 5HSGA 2VTVA 4BDTA 3IA2A 1M7HA 1OBVA 2G0NA 4EKEA 3OUUA 4UJ5A 5CU7A 2F8SA 1W9HA 3K9GA 3MIZA 3RC2A 4INOA 4Z2AA 1XTBA 2JIZA 1EG2A 3F8SA 4I50F 4BEVA 4DMMA 4AZ0A 1C81A 3UAVA 1PR1A 4M1KA 2QJFA 2XEDA 1UBCA 1MUUA 3DD1A 3EWNA 3I0MA 3WL3A 1DARA 1GCGA 1SG0A 4WECA 3RH0A 3S2IA 4BTLA 2UXDB 1OWLA 2YXEA 1E1RA 3AZPA 4YRMA 3NC4A 2O8EB 2NQ8A 1CR6A 1YZVA 3S7TA 2DTXA 2WBLC 1YS1X 2XMBA 3Q12A 3JQRA 2HMAA 2X9GA 2Y1EA 4Y2TA 5DBOA 1XF9A 3WZLA 3FRIA 5HTKA 3NCHA 5I3ZA 3ZWKA 1YFJA 1LRLA 4GOXA 2XCUA 3V9AA 4XVUA 3BF7A 3G68A 3LT2A 5AM1A 5K20A 3DO8A 1RZ3A 1OBFO 1W35A 4HS9A 4RD1A 2SKDA 3EBLA 1D2GA 1RPTA 5T8KC 5C32A 4UUOA 1Y1PA 4BQNA 2P6OA 3KWLA 1E6EA 4H1TA 4XIGS 1K8QA 3PF9A 3BDVA 1MXFA 4H7DA 1SVMA 3A3OA 1U5AA 3D7LA 1YKFA 2PY6A 2VBGA 1U7ZA 4IIGA 2QYTA 1TMOA 2HJRA 3DE3X 3WYNA 3IUQA 4GD3Q 4W99A 6GPBA 2CK3A 1HYHA 1TM5E 3WGGA 5SICE 3WFIA 4YV1A 1U8ZA 4KIGA 3JQPA 2GHTA 1N5DA 3BMQA 3C3JA 3M6VA 1BA3A 2OXFA 1QP0A 2AUMA 2VBFA 3NVDA 1T9CA 4P98A 3WAJA 1H5NA 4CMIA 3N39C 3E9EA 4JBHA 4X8LA 5LDHA 1GPDG 3C8MA 1YQ9A 1EFPA 4CF7A 1MFPA 3TRKA 1GD1O 2Y1XA 1TQ4A 3OM0A 5D01A 4BJHB 4YO8A 4E13A 1J7KA 3D6UA 2Q3MA 1TGYA 1Q81D 2XDAA 3BVPA 3DMFA 2F9LA 4N12A 3CUVA 5EQFA 1SKYB 2XQJA 5IJ9A 2C57A 3TYXA 4AZVA 4BMDA 2Q8QA 4FS3A 3A6JA 4V3BA 1U99A 2D7CA 1FP4B 4PLZA 3SHFA 4MB6A 5SY6A 4L3WA 4DDKA 5DYYA 3L18A 4BRZA 2NUAA 4Q3LA 16PKA 5AJWA 3MLEA 2FY8A 2NYUA 3K6KA 2XECA 2P9GA 1SQ5A 4OHBA 2WJGA 3LTEA 3W5UA 1UZNA 3LQ4A 2IT1A 5KYUA 3VR6D 1Z4MA 5IH3A 3DJFA 3RRXA 1P0PA 1VP3A 4MS3B 1OE0A 1OAOC 4MVJE 3GARA 2NXCA 3VFDA 4AKHA 1QTIA 3LQEA 2J85A 4CKEB 1TF2A 2VHUA 4EGSA 4EG6A 1EIWA 4QEDA 2PGAA 5D3MA 3LUKA 4QXOA 1CUIA 4HGRA 3NT2A 1WXXA 2QDKA 4QEZA 4EW2A 2BMEA 4B6PA 4KXLA 1PFWA 1UPCA 3EXAA 4DUGD 3FB4A 2CXRA 1ONOA 1ARZA 5AJYA 3VHLB 5LMCA 3TFQA 3OPYB 4EITA 3NX4A 4LNUA 3ZGYA 5EJIA 3G2JA 2AK3A 2IC5A 2ADMA 2Z4SA 4KH1A 5FXMA 2IIPA 1H1DA 4D4LA 4XDYA 1CVRA 4KSBA 1P39A 2ZJFA 3IQDB 1PL0A 3NC0C 3NETA 4L5JA 4UHCA 5KYTA 2FYTA 2CLEB 5FI5A 2ZR0A 1NJFA 3NZEA 3Q8XB 5CT8A 3PCRB 3RU7A 1PJTA 1T5OA 2I9PA 3MWDA 3NGXA 3DLTA 3EGDB 1Z08A 4FKBA 2IXAA 3DBIA 3TOCA 2WYRA 5HJ2A 1RWXA 3RRJA 3PNLA 4KH0A 4BMXA 2OVBA 3A58B 1T8WA 4RMJA 3ZCRA 3CYFA 4GLJA 4UREA 1AKMA 1HFEL 4NFYA 4BV2A 4DLKA 1NF2A 3NIWA 2GM3A 5B4VA 3FYHA 1S2GA 1GXSA 4NCJA 2WUVA 2F4NA 5GJWC 2VK4A 2XVXA 4DG8A 3TB6A 3HO6A 4QTUB 5ARCA 1MEJA 3EOAI 3OMWA 1AH2A 2PS1A 2QTHA 2Y0PA 3BEDA 2I34A 2HU5A 4LZOA 4AO7A 5LP6B 2ZSJA 5L3QA 1GA6A 2YQZA 3PJFA 3QU9A 4MYSA 4NMWA 1FMCA 3E22B 3M5CA 5E7IA 3V8RA 9ABPA 2RI6A 4ONEA 1C3JA 4AAYA 3OZAA 4FYIA 4YAEA 4ETIA 3CF6R 4ENUA 2OB1A 4XD7A 1XVVA 3PPYA 2WF6A 1D6JA 2OV3A 1P2UA 3ANSA 3QJ5A 3SYNA 3OU7A 4M1TA 3U9TA 3EYWA 1DMSA 1NSYA 1RMQA 4EVQA 2AIRA 1RHQA 1SQ6A 1XZDA 2PSFA 3CLTC 2PUAA 4EELA 2CHEA 5C52B 1SZJG 1MOZA 4MCIA 2XUQA 4C3ZA 3Q6MA 1DTWB 3C74A 3VZRA 2A4KA 1D1TA 4WE3A 1KF0A 1R50A 4RZ3A 4EP1A 1I30A 1VLQA 2Y0BA 4RHUA 2ECKA 3IMKA 4KQEA 4RJJA 1NM5C 4QOHA 2DQZA 4U2FA 1TUEA 5BXQC 2GPYA 4AULA 4AXBA 3N6XA 4UDYX 5LQRA 1V39A 1GNPA 1V2GA 1J5PA 2QM3A 4NVRA 4WOBA 1Z7EA 1IQ0A 3FCSB 3D2BA 3WYGA 1Z6YA 2JRLA 3KWFA 1KZGB 3TW6A 2WICA 3M1IA 4P80A 1MEOA 1TMGE 2J1LA 4HYQA 3VTAA 4DIEA 1M83A 3I2JA 3PWSA 4OKNA 1A2KC 3KK0A 4IWNA 5KTYA 4N3CA 2NVOA 1RSZA 4URVR 5FCDA 2FA9A 2VRBA 1PFUA 1N9ZA 3DPIA 4W1QA 5BV8A 5K0TA 3B1KA 5AKEA 1M2OB 1BQEA 3UHFA 5IUKC 3SZGA 5CHEA 3ZQ4A 2AZMA 3TAUA 4X97A 4KVFA 1L9XA 4CV1A 4NCBA 1DAKA 1VG1A 1NUQA 3P27A 1T1SA 4L8GA 5AKJA 4KWTA 1L4MA 3HA2A 3JD4A 3QBJA 3N59A 1JL3A 1X1DA 4K6CA 3WK9A 4W5WA 5FNVA 1IJEA 5JWOA 2C4HA 4XQ9A 4QJ3A 1N33B 2ZBVA 4GICA 1N08A 3ONYA 4IKEA 4LHSA 4NEQA 1FQWA 4OXKA 3TQQA 5A6SA 4TKUA 3MF4A 4PGAA 4CLDA 5JVDF 4YGYA 4ODIA 5B4TA 5IYNA 2IGBA 7REQA 1KXZA 2CUKA 3FCEA 2RHTA 4QD3A 3VZBA 3ETGA 4R2HA 4C14A 5B3LA 4G36A 2MYUA 1FTWA 1PN3A 4FC7A 3HZRA 4R8RA 1CS0A 5E6TA 1WLSA 5DFAA 2FSFA 3E03A 5DSZA 4AIRA 2J41A 1XPRA 1FNMA 2YUIA 2GZAA 2O0MA 3H2GA 3KKPA 4IZ6A 4KR3A 2B8JA 3FGPA 1QK5A 5HS4A 4I1UA 2I67A 3NDJA 4EJ6A 3OUTA 1ZIDA 1E7RA 4DHWA 4MW7A 4WCFC 4OD0A 4QYTA 4E6PA 1E7MA 2OC4A 4JC0A 2VDUE 4P38A 5EE0A 1PK9A 4CT5A 1YJWB 4JDUA 3KR0A 3ZJUA 1M6VA 1NY6A 1FFEA 2NO1A 1LGYA 1SH7A 1ZK4A 3A9VA 4YRIA 1FFYA 3SCZA 4HT3B 4OOXA 2JIQA 2BSAA 2EFHB 3I2GA 3R1IA 4W63A 3GLIE 5KNCD 1J8FA 1DDOA 2IV3A 1YH3A 1L8XA 2AX3A 5KOJB 1Z16A 5E2AA 3V5NA 3L6EA 3FNIA 2JASA 3D0KA 3FYUC 2B78A 2VF5X 3I5AA 4IXDA 3A8JA 1KZ1A 4K6HA 2X0FA 4PANA 2NTNA 2V7QD 2QLMA 3UIEA 4B32A 1J0EA 1OX5A 4CQJA 1CDEA 2WU3A 3CCEB 2HQOA 3N7TA 3O74A 2OM6A 4ZOAA 3ZWNA 4ZEMA 4R1PA 1DXYA 1FX0B 2ZTUA 4DLXA 3CRVA 3RS7A 5M34A 4G0XA 4X93A 3T5MA 1WOOA 5A4JA 4E08A 4C4PA 5C51B 1BMFA 2G06A 3N2IA 5JO0A 2YC4C 2OV2A 2YNMD 1G8AA 2X8LA 2AUTA 3E9MA 5AI8A 3SLRA 3ZQKA 5IKPA 2V1UA 1IJBA 2CDAA 5E6UA 4FCTA 3HXLA 1GRVA 1TAQA 3IR6A 4RK0A 1G7TA 2ZUUA 3GFGA 3KQMA 4N82A 1NZFA 3PXEA 3QGMA 1YUBA 5IYZF 3HTXA 1L0BA 2YWHA 1C3LA 2GARA 4QOJA 2BFEA 3DP9A 3MWFA 5ITVA 2DFTA 2IH4A 3GJ7A 4QDUA 2PUVA 3MILA 1MQ8B 1FRFS 1TCAA 1C7RA 5LQSA 2X6YA 3DNFA 3H2YA 2V6JA 4H0NA 2IW1A 3D26A 1J33A 1N1EA 3NFYA 2GASA 2HJ9A 3B1XA 3LUAA 4KVAA 4R5MA 4R1QA 3RRZA 4D5EA 2BN4A 1R0XA 1PFVA 3I4FA 4N5NA 1QXSA 1XRQA 4TV8A 5BV0A 2I7DA 2IVFA 4FE3A 4DARA 3A04A 3T5PA 2IYAA 1I01A 3KP1A 2X4DA 3OFNA 1L3CA 2AN5A 4MW5A 4DLZA 3O75A 3QE4A 3ESQA 1V25A 1G3QA 3A3YA 5SYAA 1SOVA 4QHYA 3CH7A 1J1UA 2VQSA 5BSVA 1TJPB 1L4FA 1EE1A 3MWEA 1I5EA 1OLOA 4REMA 4CEIB 3V34A 5BV7A 3R77A 3EC7A 2XB9A 4H15A 3WNZA 4P4SA 1DJLA 1ZAYA 1IG0A 2ZJAA 2IXBA 4OM7A 5ALTA 4DQVA 2OP1A 4WL0A 4TV9B 4CR8A 1A2QA 5AW7A 2EP8A 1XMJA 2XD9A 3OPMA 2JFUA 2FXIA 1SVLA 2LDBA 2OK8A 4KGZA 1FDWA 4LSZA 5DLEA 1HTWA 3UKJA 5K8VA 2Z5FA 2CFOA 1ZGBA 4L72A 3GVIA 5BP7A 4QSMA 3BJMA 2OE2A 4R3NA 1UPXA 4H3SA 4IIVA 5FTLA 4B5KA 1Q7EA 3NNNA 3CRQA 2GN8A 3UMJA 4EPWA 2OEPA 4FMPA 1MO6A 3IQXA 1JFRA 3OZBA 1YRWA 2DF8A 4GM4A 4ZO6A 3CH6A 4PWZA 3UMVA 1N4DA 3DSRA 4GLFA 4BNKA 5JDCA 5DXJA 3ZH2A 3V00A 3F5MA 3CR8A 3I9KA 3GT4A 4NECA 4EPRA 2Q4DA 3BG5A 1MMFB 3TWOA 1BJTA 2PT5A 3A1DA 4FVTA 1CB7A 4S0ZA 1WWKA 3CZ9A 3K2EA 5J47A 2V3VA 3JQCA 1JDUA 4A1OA 1I6WA 4QVJA 2J3LA 4RK5A 1OGIA 3OTIA 3ONEA 2J9FB 3G9UA 5K3FB 3TD2A 4OKIA 4TL6A 1JV2B 2QSUA 3KEOA 1GEGA 5K9ZA 1ENZA 3VR5H 1KC3A 2NO5A 3H5AA 3K0BA 3TXAA 3QE9Y 2H5EA 3SD7A 1YZYA 1Y7IA 3A27A 3IVAA 4R2WA 3CJRA 4XCXA 4Z9YA 2IX3A 3U1TA 1NGSA 3WR5A 4JC4A 1HF3A 4F2PA 1GAXA 2G83A 2ZE7A 5E2BA 4YQFA 1KQNA 4C1NA 2REBA 1DB3A 2JLAA 4FWIB 4M1YA 4WFJA 4FMCF 3TR6A 2XHEA 3AP3A 5J5AA 4ZMSA 5BSWA 5DDIP 3ZVKA 1A2OA 5ALXA 1EEHA 3QBDA 5ITZA 1VLLA 2ESRA 1ACLA 2Q3HA 3VM6A 3CLVA 1P3JA 3ZU6A 5B30A 4LF8B 3J7AC 2J0VA 2X2FA 4URZR 2JK0A 1PT8A 5IW8A 1FP6A 3PXGA 1V8OA 3ZEIA 5CFRA 2BDTA 1IB6A 3SJZA 1LBIA 3EW7A 3X1MA 1CF9A 1JDSA 1MBZA 4ER6A 2JJQA 1WOSA 2C2HA 5HE8A 3TPFA 5K8LA 3EGVA 3K73O 5FLEX 1DUIA 1R66A 4LDNA 4KMOA 5EZYB 2C4TA 521PA 1H4SA 2J5QA 3I4CA 2A9RA 1JGTA 5DMXA 3DJYA 3EGOA 1AQYA 4LWOA 4P4GA 1DG3A 4GPIB 2IWRA 5LP1A 4FXUA 1EE2A 2QXTA 3DTVD 4BLRA 2DWOA 5KMGB 4RZQA 1YUNA 2ZWPA 4B4KA 4C7MA 4HYYA 4KBGA 4MGHA 4PZZA 3QJYA 1A4XA 3RG8A 3IP7A 3L40A 2X7JA 1X87A 4ZVRA 4B6FA 1YLOA 1ZH4A 2XZPA 3DD5A 3IQEA 4M99A 4IJMA 2C42A 2PGJA 2ZT7A 1EM8B 4FGLA 3C8ZA 5GONA 4O1MA 5JXJA 3COSA 2QXUA 2Y2UA 3PK0A 4ZQGA 4HKTA 5IHPA 4KQ6A 4OQYA 1U2ZA 2RIPA 4YDRA 4B6JA 1LX6A 2PNJA 1FP7A 1MR3F 3BERA 1I7PA 2ZK7A 1CZNA 1USIA 2BI4A 2OO5A 5TIIA 3S8EA 4MRNA 3FKSA 3P4XA 5CLIA 2GJKA 2JFOA 2YZKA 5EMKA 3SJCA 1E77A 1DL5A 2FX3A 4LW8A 3LBYA 1MVOA 3COJA 1G4UR 2JARA 5F3RA 2ZWOA 1TYBE 1XNGA 2A92A 4G4IA 4NV1A 2FMKA 4IDAA 2RHGB 2HBZA 3KEQA 5JH7F 1L7XA 3HZHA 4L4ZA 1HRKA 2VJYA 4QU5A 3BXXA 5T3YA 5CB6A 3HFRA 3E81A 4LNHA 1U1FA 2WMYA 3EQ6A 3IOBA 1F1JA 2V7VA 1OGJA 1V1MB 2ODQA 2PZJA 4Y2HA 2RHDA 1B73A 4QODA 1F4VA 2RG1A 1RTKA 3Q40A 4UBKA 4D9KA 3OZIA 1K6JA 2GEFA 1P31A 4H59A 3M8KA 3PEEA 4KMSA 4R3WA 4XX0A 2OA0A 5JAOA 2NP7A 2QVXX 1UM9A 4JMLA 4CCYA 3W7VA 1KO8A 4CM6A 2XWBF 4QBKA 2GCOA 4WV3A 1J56A 3FPSA 1XQXA 2H65A 5FUYA 3H1PA 2IYZA 3KU4A 4BBJA 2QBYA 3GFTA 4F21A 1L4NA 2P0AA 3KHUA 2HF8A 2Y6UA 1BCRA 3LO8A 2GK4A 1JUDA 3F47A 5DSTA 4ZALA 1BYUA 4Z51A 1HL7A 3M33A 5TPZA 1AMNA 4CQMD 3C3YA 4RMHA 3VYRB 4C2UA 4P3XA 1S1MA 2OCKA 2FUEA 5LB4A 1Y8ZA 1QSGA 1WEKA 4BVEA 4RTNA 1JAIA 3DUFB 4PONA 3GLUA 1N5OX 2B4AA 3A4IA 2AZTA 3HU3A 3MGAA 2WHXA 3TOZA 2C7RA 3AESA 3JQ6A 4S35A 2Y99A 1J49A 4EKGA 4XM1A 4CMEC 2FH5B 4HWTA 5EWMA 4HATA 5B5SA 3W1EA 1U2RA 4J29A 3UFBA 4Z3KA 1EUDB 2MSKA 3BCFA 2A2ZA 2O3QA 2Y1KA 4X95A 1GZ7A 2Q3BA 4P5PA 1E0JA 3TLXA 5HNKA 1Z26A 3MTJA 3DDNA 4QX6A 4C6RA 3B2QA 1H2EA 3PT5A 4KQGA 4ZU1X 3ZNQA 1W48A 2OTJB 1Z0KA 4DYDA 2GPWA 5DH9A 5EWLA 4E4YA 2ZRDA 4WJZA 2GERA 2G80A 1EFHA 2OBLA 5T41A 3GFVA 4QUIA 3P9PA 1FBTA 9GPBA 2AEFA 3AEQB 4QQNA 3G2QA 3JR7A 3V8EA 3RVRA 1YHQB 1O5OA 3P8ZA 1YL5A 1U28C 3CRNA 3ND9A 4WY2A 1QH9A 3AGQA 1VJRA 1QQ6A 2JATA 3X1KA 3R3ZA 5EE1A 5JYDA 4EENA 4G5XA 1YZNA 3BA1A 2ACKA 3NTUA 3U44A 5EP2A 1TT5A 3LNTA 4XVCA 3BGIA 2I62A 1IY8A 2AS0A 2BTOA 3ELYA 2A5FA 3R3HA 4C22A 5EHXA 5JDIC 5L45A 1H2FA 1O9HA 3SOZA 4ZCTA 3LUHA 2BHTA 5ENZA 2YV4A 4EG0A 3AI2A 1E1NA 1FDSA 2XLBA 2IL1A 1SBQA 1NRJB 1SJ9A 2GN9A 2PRSA 1QFJA 1RRPA 1GYRA 1FU8A 1GL3A 1I7NA 1PE0A 4HQKA 4R9UC 4HVLA 3T5CA 1R27A 4DMLA 1XE3A 3C3EA 3KPUA 2FX5A 2NTEA 3NHYA 4J16C 2PMKA 3PPWA 1R6DA 1X13A 4LQ4A 4XFJA 5HK9A 2YWGA 4Q5IA 4ZAVA 2JFVA 2O2CA 3GD5A 1E1QD 1UBNA 2CNBA 3U9LA 3V4ZA 4J49A 1OASA 1J70A 3IHTA 3QPAA 4PO1A 1G6HA 2FPWA 3T7AA 3BWMA 1BX1A 4OQXA 1NN1A 4G6ZA 1B6RA 4DK0A 1WB6A 2JIOA 4QDKA 5DB4A 4FYVA 1GKIA 5A1TA 1ATZA 1YR8A 2O2JA 2JNWA 3P32A 4BL5A 4W4TA 3QG5A 3PHBE 4OXRA 2WE8A 3JXEA 4PCAA 4F2HA 3DDWA 3WOVA 1DBRA 3QV2A 5C81A 2ZAYA 1T9HA 3FYTA 3VZSA 4B74A 5AD1A 2XT0A 4GECA 5AI0A 121PA 4QUZA 4X6YA 1ZHHA 3MWJA 1CYEA 3TBKA 2C2XA 3BRCA 4DDTA 1O8BA 4IGEA 2XAUA 4URUR 2FR8C 2ODBA 5K3OA 3MJFA 1OAOA 2SCUA 4ALIA 3DE5X 2WM8A 3BM5A 2WHPB 2C2KA 1BTOA 3BIOA 4V03A 4LC0A 3WKDA 1ZGZA 5IAJA 5BY2A 1RWNA 2AEMA 5FF9A 3R7SA 4DR5B 5IM4A 2I7TA 3HJAA 3IVMA 2X0NA 2EXXA 3LL7A 3BXEA 4RUKA 3W6UA 3QPBA 1QF9A 2QE7A 2BGLA 1R37A 2EJCA 1QP4A 4LOJA 3ZXIA 5DNYB 1TVKA 4LF6B 4LJKA 2C0QA 3MGGA 4G0MA 4KPEC 4DDHA 5HFNA 5DLDA 3ETNA 4WWVA 3EA4A 4LDZA 4YO7A 4E5UA 1UJNA 1YNOA 1N9KA 2HHLA 4GXRA 2HYIC 2XSZA 2WF7A 3L0YA 1Y1QA 1C0EA 3GFBA 4LZWA 4YMWA 1ZWLA 2IUSA 3KAPA 2JKYA 4BFYA 2NZUG 4BVBA 4RX1A 5AP9A 4ESOA 4YV7A 3CF4G 3VKFA 4OUKX 2YV2A 1T4CB 3OAAA 4WSOA 2GLXA 4MUFA 3LL4A 4JD5A 1ZK2A 2OAEA 4KFCA 4PAAA 3T99A 3IBYA 4IOKA 4JI3B 4AMZA 5CNMA 1G20A 1DIRA 1SHUX 1I0LA 2W4QA 1K0FA 1WHTA 2IITA 1JVBA 3DVAA 1ECJA 2FQQA 3B3JA 3LFTA 5IJ9B 4AXXA 2RSLA 2YHUA 1QE0A 1U0SY 1PJ7A 4E12A 3G2LA 1ZNZA 5KTOA 3UPTA 2A3NA 5U9CA 3UXEA 1SC9A 4V0SA 4MRPA 2NUAB 2Q6KA 1E8NA 3WGNA 4JB8A 2VKQA 1VQPB 2HF7A 1UKZA 2QDXA 1YOVB 2BKXA 4D96A 2QUKA 2ZI9A 3OURA 4DWVA 4F71A 5CA0B 2QVZX 1FFHA 1G291 1GZVA 1UODA 3DXZA 4LKOA 1ZMOA 2H2AA 1G5TA 2FLWA 4U7GA 1S9HA 5DBGA 5KYUB 1S8NA 1GFWA 4L9AA 2R6CA 1FXSA 1ZD5A 3H2BA 5FA5A 3LY7A 4UPEA 1BFUA 1YZHA 3HP1A 3L7BA 2CHUA 1XUOA 3HCFA 1ZW6A 2YCBA 1YHYA 2BM0A 2ZTLA 4LVUA 3QU4A 4F91B 3NBYC 1CETA 3T6KA 4BFXA 2CYBA 1EQUA 1SG6A 1O6BA 2PZ8A 1U2DA 3KT8A 3WZMA 3GJTA 4I2NA 3BWYA 1WUHS 2A6PA 3SC3A 4E88A 5I51A 4MUAA 3I52A 4FYWA 4BGEA 1BLIA 3VO9A 1S8AA 5G0VA 1J39A 4ZVMA 3VAZA 2NOAA 1SB8A 3AUYA 3AHIA 1BXKA 3CMEB 3FI0A 4HG2A 2UZ1A 4TLCA 4BQIA 5IAAA 2A9KA 2H2FA 1TUGA 3HCPA 3LU1A 3ZBQA 3QKWA 2XNSA 2GF2A 3DYBA 3IVRA 2VRCD 1NM5A 1UAYA 4IUDS 4YRCA 4I08A 1E3XA 1RS0A 4ZOBA 4DCVA 4BXOA 4B3TB 2PAFA 4Y1GA 4Q3AA 3VGPA 5HS6A 3BSWA 1JH8A 4DLPA 3AM4A 1ADJA 2A35A 3FVTA 1A9TA 2X42A 4WDQA 4B47A 4E2WA 4GYJA 1PNQA 4D82A 1TF7A 4I66A 1HDYA 1L6IA 4J7XA 4Y18A 4ZAXA 1MENA 3TLYA 1U4SA 1GXSB 1MB0A 3PEFA 1XWWA 5FBQB 3OCYA 5AFSA 3GLIB 3IPLA 4R84A 1VLHA 3SEFA 1T1EA 4JUBA 3RHFA 3M5DA 5EIBC 1U3VA 3DT8A 3L6OO 3PXDA 4YA6A 1ADBA 1Y8QA 1YB2A 4N5IX 1G0NA 3UQZA 5DTQA 3WJ2A 2H6EA 5GPBA 4OL0A 1FUIA 1VG8A 4G7XA 2ZJ6A 4HPWA 4ZQEA 4BP8A 2Y1GA 5L3QB 4F3NA 9LDTA 2C2GA 3GI1A 5L3SB 3OEHD 4FR5A 3UJ9A 4BEWA 4JT8A 2FN4A 5A89A 2QQ0A 5EJEA 4LHVA 1B2LA 1W9MA 4I9GA 5FLXA 1I4DD 2A9FA 2XMPA 4N41A 2GCGA 2VKTA 4NBWA 4YI5A 3Q5EA 1XIVA 2DFPA 2K4MA 1EK5A 1JFFA 3HRHA 4D80A 4FEYA 2OV8A 1IXKA 1L9KA 4NOLA 2XMRA 4OOFA 1JI3A 2W0SA 1U0FA 3EVEA 1D2CA 1JLKA 2YW9A 4WBNB 5JPCA 1JQAA 1L7NA 3LLMA 2FPKA 4M9CA 2XOXA 3P0RA 4MWGA 3GCZA 6Q21A 2QMOA 4D3XA 2Y9MB 4U0KA 3B1WA 2ORED 4D44A 3A26A 1NDQA 5M2QA 1YRBA 3FMGA 1M6YA 1QKJA 5C0OE 4OATA 4WXMA 2B0JA 3WL6A 4D3DA 4D6PA 3UJPA 1YJBA 4DY6A 4LV8B 2PSDA 3I61A 3OFSA 2IEAA 1IATA 4HZGA 4IDEA 4M22A 4Q66C 2XCTB 3S29A 2HT1A 5ALNA 1KRHA 1VA4A 1YI1A 2QTBA 3FPJA 2RK4A 1MOSA 1XWIA 2UYYA 1ZI8A 4XKWA 4Y1FA 1CJVC 1E89A 3OJCA 4ER7A 5IJXA 3TKYA 1DC7A 4D8WA 3OOSA 3U0BA 4EKYA 4TVKA 5JSUA 3FYUA 4JP8A 4BLVA 3HGQA 2C3OA 4BYGA 4WLOA 5GM1A 3ZHTA 5JECA 1PKXA 3NHMA 3DMHA 2WM9B 4X7MA 1KEEA 2PHZA 3BD8A 3MPUA 3UEOA 5JQGB 4DHEA 1SVOA 4B9EA 3N2EA 1MU0A 4LN1A 3BZWA 4YWJA 4I99A 2J7PD 1RPAA 1I3MA 3C7TA 5JBNA 4G0VA 2RK6A 3AY6A 2IUYA 2G70A 3BMXA 1PVVA 3TZLA 2ZYAA 4HDAA 3QZUA 2EEPA 2FPIB 1UT5A 2BDEA 3ZBUA 1AB5A 2M98A 3ZIDA 4NAVA 4PXAA 5A4FS 1RFLA 1IK6A 1Y5NA 3LWZA 2HEGA 3M6IA 1HLFA 4DDUA 3VDQA 4D8YA 5MF6A 3VYSB 2P4QA 1N5KA 2D0OB 3K8QA 3BXHA 2C2BA 4QQFA 5EKTA 1XZ8A 3VNVA 4AJNA 5A03A 3DOUA 3N2GA 1P5RA 2Q1SA 1JDBB 1BS2A 4ZCPA 3X2FA 1NFQA 4G6IA 2Y93A 3B6MA 4A6PA 2OFWA 1SWVA 1KEZA 3GY0A 5FOWA 4UD2A 5AVJA 3C3PA 1QG6A 2BFBB 3SZ3A 4RS3A 1CE8B 1DC6A 4ID3A 1M6VB 3EIEA 1W75A 2WFMA 3AEZA 1EGAA 5DN6A 4NIMA 2NZVG 4PSCA 5DHQA 5IAEA 3RRMA 2J30A 1YK1A 2QZSA 3N7AA 3ZJ5A 1E1MA 4FZVA 3FFXA 5IDYA 4G25A 4BO0A 5GVRA 1CUHA 2FZCA 3FPCA 3UMYA 2WTBA 4X7DA 5FNZA 1GQSA 1P1RA 1PG5A 1ZGCA 2ZG6A 1JQJC 3H75A 2VJQA 1RWWA 5AIAA 5DBHX 1U0RA 4J2HA 1JFSA 2HBYA 1U8YA 2M2IA 4MVYA 2CLMB 3CEPB 4AIIA 3L7JA 2H3EA 4DA6A 2C92A 1QNLA 1JAYA 4L85A 1YGYA 3FJ1A 1IEVA 1RHMA 4HNAA 3WNVA 3L1KA 3WLJA 1BE1A 3M5PA 3GLFA 3LQQA 2EBUA 2VXCA 3FWNA 3H9QA 1EWRA 3ET4A 5ALSA 5K0CA 1RQLA 1IHDA 4KE8A 2VP0A 1VMIA 3UV3A 2ZIWB 4YCBA 2XCSB 1DADA 2NPOA 3F8WA 3MAAC 4NZMA 1UR5A 1T2DA 1LK7A 1I18A 1XTZA 2WC1A 4OQFA 4OP2A 2IY7A 2CHQA 3F5SA 1DPFA 2WV9A 2X1HA 4PZLA 3G8DA 3RC9A 3E1GA 1V5WA 1YT5A 3F5FA 4HK4A 2WZPP 2ZUCA 5TMEA 3BILA 3H2ZA 3ILVA 3KG2A 3K2QA 3HCCA 1ETUA 2FRDA 4EJSA 3QKSA 4Q00A 2QMUA 1NMSA 5BWOA 2BF4A 5HF5A 2V97A 3K7EA 2EQAA 2WF9A 5KTNA 1QZ3A 4P1VA 2VJIA 1MW9X 2CLDX 3E0XA 1N6IA 3QTBA 1F6DA 1HE4A 2I4MA 2RCNA 1FK8A 3IYLW 4V0QA 4AY2A 1M6HA 2PWPA 4L08A 3PUIA 2XMCA 4TSFD 1C7FA 2WD7A 4TV8B 5HE9A 1Y9DA 4OLHA 4TS1A 5H4GA 1YFLA 2O0JA 2IPOA 2ZTSA 1PX2A 1I2MA 1G3IA 2GMWA 1O5IA 2Y92A 1GR1A 2BTQA 2G1KA 1I4WA 1EFTA 1E60A 1QO0A 3MWEB 3KHKA 4XWTA 3REQB 1O94A 4Z4GA 4A2QA 5ALIA 3U39A 2P4SA 3LG2A 4GKKB 3RTGA 1JJ7A 3MWLA 3L8HA 4P4SB 2CLOB 1Q1AA 2BGIA 3E18A 3A2MA 3F4BA 2ATIA 5EIWA 1QIKA 5IG2A 1H42A 4FS8A 3RF6A 1XPUA 3LFHA 4RTPA 4RPBA 3M3HA 1TZKA 2DFNA 3JALB 4JUIA 4I14A 3DTNA 1MQ9A 3FUTA 2IH5A 1FVOA 3UA3A 4BKQA 1RC8A 2QVLA 2FFBA 4XLLA 1Z38A 3OCVA 2XITA 2GYWA 4F97A 4ZRNA 2EJWA 5KQRA 1F2VA 3WYFA 3KSAC 2YQ5A 3KQTA 5J63A 4C3VA 1VB3A 2LW7A 2NQTA 3RRYA 4NI5A 3H04A 2VHJA 3IR5A 1GCOA 3PDWA 4Z1MA 2W9XA 2WJWA 1L1FA 1X1CA 4URYR 4PTYA 4XRGA 4UEQA 2PUDA 4BMZA 3OP4A 5T5QA 2IHUA 1I7DA 2VT3A 4MA5A 3JZMA 4O6VA 4LHWA 1B3BA 3UCXA 3IKTA 3MSCA 3PL1A 4X3OA 3N28A 2PQMA 3GGOA 4RTOA 1QR2A 2NZWA 1UBRS 3I1FA 4AS2A 3MN1A 2II6A 4LZLA 3ZIAD 4AD8A 3PX7A 3D3EA 3PZBA 3DCNA 1BE6A 2NZ8A 1IONA 1NQXA 1X92A 5AVSA 2FZVA 2VYFA 1BVUA 1EESA 1WD7A 2QR3A 1GEEA 4NMMA 3T7JA 1V4NA 3NUGA 3FWHA 3OPQA 2PLNA 4BWVA 4PYJA 2WDPA 3A28A 1YZFA 4GOND 3T06B 1YQTA 3M49A 4EY4A 4RVOA 4F6CA 1QWSA 3OESA 2C5AA 4DM3A 1U6JA 1OV6A 4FONA 5I7WA 2YXPX 3W3AD 3D5TA 3OMLA 5A4IS 1JIQA 1KDVA 3ADBA 1RMYA 4LX0A 1XPOA 4IHAA 1GZ5A 2A0WA 1O6CA 2R6JA 2KJQA 1CZOA 2YJ3A 3U48A 4RK4A 5ITZB 2W6OA 4ZCIA 1JE1A 2WJPA 2X86A 3DL2A 3G0DA 2ZZMA 2PUWA 3KQPA 1OLSB 2TSYB 4QATA 3HU5A 4ZO4A 4HJXA 1YE8A 2Z6UA 1GAEO 5FL3A 5LXTB 3LBFA 1PYDA 2Q5FA 4UHFA 1QORA 5E6SA 1FSSA 1T15A 2NXWA 4C76A 2XH8A 2DJ5A 2NXNA 3CWQA 2NUPA 3DCIA 4MWCA 1ZM4A 4Z6KA 1G8FA 1OILA 2GSWA 4NK4A 3CUWA 3ZDAA 1GFIA 5AVQA 1W9XA 2BM1A 3G2NA 3IGFA 5BWCA 2MSNA 2PWBA 4Z4VA 1S2NA 2Z4RA 3H8WA 2WKRA 3GUVA 3KJFA 4N6NA 3RIHA 4IXNA 4PFQA 4BFUA 2HA3A 1H05A 2Y4OA 4NR0A 3NXKA 1JJFA 3HYSA 4I9HA 13PKA 1E4VA 4BZWA 4ILEA 8LDHA 3N2KB 4B4UA 2OB2A 4HAZA 3BMCB 3O31A 1JWAB 3V4RA 1W87A 1T3HA 3FDJA 4URFA 1J2UA 4G9BA 4JB2A 1K68A 3ND8A 4CI9A 1DI0A 3BB1A 4HAYA 3D8NA 1YB4A 3IOEA 1VDZA 4GU5A 1BW9A 4WNIA 1G3RA 4BFLA 5J23A 4MS4B 4FT4A 1DJNA 4J0FA 3CGWA 3ROEA 5JADA 4NZOA 3TDNA 1KZ9A 4OQZA 4YAJA 3S1AA 4HGPA 4B79A 2JGFA 4Q82A 4X5OA 3AI3A 4N7JA 3NWEA 3QPVA 3UGKA 5K05A 1VYTA 3MBIA 2ZRJA 5JG7A 3TQTA 4WEOA 1YRQA 2OCXA 1YQUA 3TBHA 3UXHA 1XNJA 3D6JA 4B0OA 4BQSA 4DILA 4V3CA 4EKNB 2VAXA 3CWCA 4AVZA 3GYGA 3HM2A 1JSXA 4MEAA 4CMEA 4DTCA 3U3MA 1Y9EA 5ES4B 5CPBA 3P4YA 1RAEA 5J3OA 4ANFA 1NBMA 3RSOA 3DOOA 4BO8A 2G8LA 3CLRC 3DE2X 5EHZA 1SD5A 3D0OA 1RRFA 5ALQA 3R5FA 3C3AA 3UH0A 1A9ZA 3GA5A 3PXXA 5DM1A 1USUA 2IA5A 3N86A 1MPTA 3RT9A 2Z83A 2ZRMA 4FEAA 1XAIA 3LQYA 1JDNA 4LWPA 4C3UA 1VYUA 4EDHA 5IJ0B 1IEXA 4HBGA 1B42A 1F2DA 3ASSA 4J43A 4UQPA 1R1DA 1SUAA 2HLHA 4OHWA 3TIFA 1TJ3A 4NESA 2VUSA 1QGYA 1JALA 3TRHA 2BP7A 1U28A 1C0IA 3EVAA 1M2KA 1X94A 4P9NA 4Q4AA 4R2KA 4B46A 3QUQA 4CCYB 5MN6A 2WSSD 3S27A 1R2QA 4UNQA 5KNDH 4FDAA 2O2GA 1YS9A 1ONNA 2GCOB 2IIQA 1AO3A 2JKZA 2ZBFA 1D6NA 3G5MA 3HMKA 3I2HA 3KTAA 1G2OA 1HEUA 2GSDA 2IPAB 1AUPA 2ZXEA 3C7AA 3LYUA 4ZXPA 3RGGA 3WGQA 2QTLA 4HAXA 3BUSA 2ZITA 1BVYF 1NMEA 2QTCA 3LYLA 5JDIA 2V9PA 1LK0A 1UANA 1CJTC 2IYFA 2YWDA 4PR0A 5DM2A 4D0RA 2QN7A 1FX1A 3C5HA 4ZO7A 3ESDA 1JG6A 3RBVA 5CW1A 4CFZA 4EL0A 2G28A 4J16A 1KYVA 1JFLA 4FCVA 1Y4SA 4K0KB 1V47A 2COUA 5CXQA 4D4HA 1BJRE 3O9ZA 1RKVA 1VL8A 2Y1OA 3TD6A 5MN4A 1A0OA 1HZEA 1OFUX 2ZXUA 1QUFA 3GBSA 1DAMA 1A9SA 2OXTA 3A1TA 5L6LB 3BICA 3MG9A 2R1VA 1W8IA 3KYDA 2H48A 2C94A 1CXZA 2ZCVA 3LZ6A 1FRQA 4XCQA 3KLPX 2JA1A 4OFZA 1H2HA 3UHOA 2ZDGA 2LNDA 4U2DA 3RJ9A 5K8UA 2JLWA 4UUAA 4WZLA 3CNHA 3SZMA 4KEAA 2ZZEA 2QRLA 3L8MA 2WJAA 5AI5A 1X8LA 5CX4A 1YMUA 3STTA 4P9SA 1SKMA 5ANRB 4UE6A 4NG5A 5FUXA 4GL4A 5AJXA 2JGKA 3DEFA 1UBJS 1KKUA 1QZXA 2RI0A 1M2EA 1VLMA 3AY7A 3U19A 3HN6A 4A73A 2P3LA 2X4IA 1Z0ZA 4G84A 2PX2A 1B6TA 3TBFA 3UAYA 3W6NA 1TLLA 3Q2OA 4XVHA 4F4FA 2HRRA 1Z35A 3MT7A 2NO0A 2NZ2A 3WK7A 4G4GA 2REQA 5KKAA 2X4LA 5JNRA 2BJHA 3B7WA 3UICA 1PLJA 2PO5A 4EABA 3VX3A 2HMUA 1T2AA 4D0SA 2OY0A 3BGOS 4D97A 3ETCA 5BNWA 4X65B 1TT5B 2XW6A 3CN7A 4KSCA 3EG9A 2JLVA 2PS3A 4AKGA 2O2IA 1OLXA 2IF2A 2FKAA 3NEJA 4I3HA 3UOAB 1KL7A 3AB7A 4D41A 3O8OA 3ABOB 4N18A 1Y5MA 3R5SA 1IY1A 2NZYA 3CG4A 2IV7A 1ECLA 4X90A 4EHAA 2AQHA 1HTBA 2PLRA 1O96B 3Q4GA 3QX8A 1BOFA 1T6XA 3LVBA 5DN9A 1EH5A 5KYGA 2LUOA 3L7DA 3WDSA 3D6TB 2H5JA 4OPOA 3HKEA 4ZYZA 5L95A 2PUHA 2BVNA 1T36B 5JNTA 4IQ0A 1DAOA 4YJHA 1JSCA 2VZLA 3M4YA 1NBME 3AG5A 5HYVA 4E07A 1VCMA 5DYGA 1R4NA 3LUPA 1C0LA 3RU2A 2ENUA 5IT9A 2RDMA 4WRRA 1BQ3A 4DCMA 4GX0A 2RGRA 1GNLA 2EGHA 2QL7A 4U7TB 1IWBB 3W90A 4B7ZA 3LNNA 2ZJ4A 4RJIA 1X7ZB 4KX3A 2DU8A 1MIHA 1ZCJA 1QQ7A 1ZFNA 3QXSA 1UJ2A 4LVOA 1DEAA 2HSGA 3C5EA 5BXYA 1CQPA 1GTL1 2GI4A 1SC1A 4QU9A 4CG2A 2HLPA 1V6SA 1Z5OA 3UMRA 2SCUB 1PJQA 1ZNYA 7ADHA 4A6DA 3B1ZA 3H9GA 3NTOA 5C8VA 4OXQA 3TQFA 2RHHA 2FMTA 5DBIA 1TQ8A 2AFVA 1ZPDA 4RGYA 4UFOA 1Z6ZA 4BGUA 2BZ1A 3R3UA 4PSVA 2XEXA 5ADVA 3TTXA 2V0CA 3QRWA 1LDEA 3D3JA 5J2TB 2H2DA 1X0XA 3NTQA 2H4XA 3GT7A 4CM7A 4NL4H 4M3NA 2QX6A 5HGXA 3JVVA 3T3DA 1YZ3A 2JLQA 3D6VA 4D9MA 3IPXA 2R25B 4YQYA 4KXXA 5F4BA 2ZYVX 2JA2A 5AW4A 4LOKA 2HR1A 2A5JA 4BVKA 1XNRB 4A26A 1P2TA 1Z2DA 2H0RA 5LOVA 2IHNA 1ZIOA 1Z07A 2ODTX 4D4KA 4F5DA 2O6LA 3EEYA 5LMZA 3O03A 4L4SA 1YX2A 4HDRA 3GPCA 4K86A 1G18A 1WHTB 4JOQA 4OQLA 1T9DA 3JW8A 4HDMB 3MPOA 1BKDR 1LV8A 1ZA1A 3QLJA 4KGDA 5BV2P 4ESVA 1RW4A 3GMTA 3SZOA 1YS6A 2B82A 1CLEA 3CSUA 1X7GA 2P3MA 1FFDA 1KMMA 3AJRA 3JQAB 5H83A 1E18A 1T2VA 1Y7HA 1OI2A 2E87A 3QXXA 2AF4C 2QPOA 3BIJA 4Y30A 2OGWA 1K7SN 4PGMA 1KEUA 2C7QA 2ZZGA 3JQ9C 2BMDA 2P35A 3B1FA 1PJ5A 4I9NA 3WWDA 1KMNA 3CNOA 3F98A 1L2TA 4TKMA 4TV9F 4ZV9A 5ERXA 5BMOA 5JMTA 1SB9A 4GWLA 1FFBA 1XJQA 2FPMA 3O47A 4OHZA 2NU9A 3JVEA 3ZGXA 8GPBA 1WU8A 4KN9S 3PLAE 2PFKA 4EZBA 4YRPA 3ZX4A 5FWNA 3K0EA 3E8SA 4PX5A 1WBDA 2COEA 4I3FA 2DHQA 1EFRD 3TRJA 1GJRA 2AXQA 3AR3A 2HNAA 2HUPA 3NONA 3OWXA 1CZUA 2HA0A 3CE6A 3R5KA 4PGGA 4IMIB 4CMCA 1XP8A 4P2NA 1DEKA 5JRJA 2XT6A 1D3AA 4MUMA 1UQTA 4KREA 2WJ4A 3GELA 1R8QA 2PYZA 2XUZA 2ZBDA 2CLHB 4GM0A 4PYLA 4GSKA 1E3IA 1RXCA 3JU3A 4IDDA 3ENZA 4V0NA 3GRKA 1E3LA 1B2RA 3N05A 4TYMA 5F2KA 4QAJA 3Q8LA 3JQDA 2AJ8A 1L7AA 1GL6A 4XIIA 3Q38A 3D4LA 2VXOA 3LQRA 4IXTA 5B12A 4R7ZA 3U4QB 3FSGA 4L02A 4TTPA 4B87A 2MJLA 1EJ0A 3JD0A 3TQOA 1MW8X 3R6JA 4JLNA 4NNJA 4D9FA 1FYVA 4XDHA 3E3AA 4MI6A 3FLMA 3OM9A 4FDTA 2CLIB 1SAYA 3C8HA 3UMCA 1T1JA 5AK6A 4CCAA 3ZKWA 4ARZA 4IIJA 1XCBA 3A1CA 4W82A 2X2PA 2CEKA 4ZN6A 1ADFA 821PA 2A57A 5FI3A 4OJYA 2IW3A 2ZE5A 3UB2A 4L8YA 3K53A 1LI7A 3RB8A 5MGBA 3A6PC 4KGXA 2DHEA 1W49A 2HV8A 3GFFA 3REFA 3VUEA 1SHJA 2HSDA 4M7WA 1SXJD 2FQ1A 5EJ6A 1Z17A 3MEQA 4AKSA 5CTAA 4HPJB 2GVDC 1VFPA 4FZ5A 4F86A 1DJQA 3HRKA 4WUVA 1Z0SA 4UFNA 4PQYA 3ILYA 4BIMA 3ROKA 3KOXA 4CKYA 1I13A 2JFXA 2WIKA 2Z8ZA 4A9AA 4KR7A 4O0LA 1C7ZA 2GJPA 3BH7A 1GRQA 2FPGB 2IUTA 4RY8A 4DCTA 4MGZR 4J3FA 2Y68A 1IN1A 1DFHA 2G1UA 1JR3D 5CT6A 4UNNA 4BKOA 2EW8A 2JW5A 2XUOA 3IP1A 5LNK6 2HLNA 3FETA 5EZYF 3DP7A 3AUTA 5DIFA 2VQEB 1DT5A 3O9MA 2FHSA 5ECYA 4RVCA 2ZPAA 4DPLA 4LCBA 4IZIA 3ZS9A 5TJ9A 4M89A 4WCFB 3RVJA 3RSZA 2B1IA 5G0SA 4OXYA 1XWFA 1UK8A 1YS7A 1E2JA 1F8YA 2WAOA 2WU1A 3OQJA 3NT5A 3PXAA 4AG6A 4I6EA 4PWYA 3ADDA 1E7YA 3NM6B 4Q9JA 1MRZA 1T8RA 1NX9A 4GRAA 5JCJA 4DV1B 1PZEA 1C9EA 3I5MA 3EXFA 5AK5A 2QRVA 1FYXA 5JFGA 2GBFA 4J2OA 3Q41A 1UD2A 5K0BA 3IAFA 1LC0A 5HJ5A 1NJ1A 4US2R 1JZTA 3CPWB 1NXQA 2W6ID 1PNTA 1VHQA 2O48X 3IAUA 3FGOA 4MQ5A 4RE6A 2GGSA 3AFMA 4ALMA 1EX7A 4UMFA 4PQRA 2AC2A 2NUTA 2IUUA 3ZNNA 1IWOA 1ZD4A 2B92A 2NXEA 2ZATA 3KOYA 3QVJA 4GPAA 2DQYA 4KJXA 1PVOA 1OJLA 4JI2B 4XQ0A 2WNIA 4JJIA 1Y3DE 5CD9A 2DFDA 3CXCB 1G2IA 1WSAA 2NSDA 5AK4A 4EQ6A 1D07A 1X1QA 4RQUA 3ZWXA 1LLQA 4G5YA 1NU8A 3HL0A 1NNSA 3I9NA 2PX5A 2WJIA 3JYOA 3CT6A 2YW2A 3VPSA 4BV3A 5CBPA 1EXMA 3QELA 4R9NA 1W581 4OI1A 1MCZA 3UK7A 4V1CI 2I9KA 5THQA 3ES9A 5B6IA 4K46A 3ZK7A 2XYVA 3A8TA 1E2MA 1N2CA 5E4YA 1Q20A 2FWAA 1M1ZA 3F71A 4FYKA 3R9IA 3U7RA 4FOSA 4HLDA 3K1AB 4CIWA 3THWB 3U6KA 4FFRA 4O29A 3X1DA 4PN3A 2ZJ0A 2A7QA 4Q0MA 5JS1A 5E95A 1T1RA 3H2KA 3H4IA 4RL4A 1WSDA 2AKEA 3BWBA 3NV7A 4S1TA 2CT8A 5HF8A 1QO9A 2Q4OA 5AXCA 3W5VA 4O4JF 4E0BA 2NP6A 1X7HA 1JJAA 5I7HA 5AVTA 2GEJA 2Q41A 2WUWE 1YK0A 4FT2A 4DJFC 1NI4B 2WUDA 1E3ZA 4HNHA 3BX1A 2Q5LA 3LP5A 3ETDA 4U7PB 5BQOA 2VBVA 2P69A 2VPXA 3QYJA 4O25A 1VMAA 2JI4A 2VJBA 2IHJA 3C8DA 2IHYA 3FKQA 3HE3A 3DMGA 4PIVA 3VR5D 2PZKA 4CKBB 3BAFA 5F35A 5DU2A 1AZTA 2PUFA 5EA2A 5BUQA 1T5DX 5EE3A 1XYYA 3IMCA 4M9ZA 1Q22A 5AHWA 1I5RA 4E14A 1NVMB 4JOSA 2Z3VA 1DBQA 4RKQA 4NENA 4HNAB 2GJ4A 1NLYA 2RARA 2FF5A 3G8BA 3VU0A 2GBGA 3BL6A 5JIBA 1ZXXA 3IULA 3LXXA 2EKPA 3QWHA 1FFGA 3BKWA 3QYAA 2CB9A 4O4IA 2J3QA 3GCWA 2JHCA 4YDQA 1UMCA 4RKYA 4RPLA 3W9SA 3CHYA 2CMKA 4Q37A 1WB4A 1YJXA 2CXSA 2VSOA 3R6GA 4GDMA 4H08A 1VTKA 3O8NA 5AXBA 2QX7A 2AVDA 3PITA 1HEIA 4ENPA 1JLHA 1W0CA 4A5OA 4QSHA 3RRFA 5C8YA 3QKSB 3LLSA 1UIMA 2M6SA 4O2AA 1TW3A 2ID7A 3R0XA 1DC5A 4IIHA 3UWDA 2GPNA 1K6XA 1U2GC 4G5HA 3KJQA 2HRZA 4HNQA 4MVJF 5GINE 3KFXA 4P53A 1G4AE 4OQEA 4DJTA 3AVQA 4FFSA 1YKGA 2YFHA 2ZBQA 5A7FA 5KSOA 3NGMA 1O3YA 4RTQA 1T3SA 2XWQA 3RSCA 4UHDA 4Y3UA 4DSTA 1ZVQA 2JGMA 2JS7A 2Y6VA 4TTJA 1L3IA 3KXDA 3HWX1 2I6TA 1GVNB 1W5TA 2NU6B 3VBCA 1GZDA 4JI8B 5DP1A 1CQWA 1P0CA 1QGED 3FE2A 5D86A 3WADA 5HW0A 1L8LA 4YACA 2C8LA 4S12A 2QY9A 4ZJYA 3L4JA 2ZYUX 4I6GA 4UU1A 4BGIA 2FJUA 3BEOA 4CIAA 2YJNA 1WCXA 3IPAA 5IK2A 1Y7TA 3R75A 1N5IA 4JENA 4U8HA 3UXMA 1H6BA 3RYIA 3ZDCA 2IYTA 2JGDB 1DWQA 3OT5A 4CL3A 3RBXA 4AWAA 2CNNA 1LLCA 2F1OA 5C4IA 5DCWA 4FBLA 4WACA 3O3OB 1GTG1 4J8PA 3TKLA 3H9NA 4II2A 1Q86D 2FB9A 4HLQB 4MKGA 5KSYA 1NB9A 3IJPA 4KE7A 1GSOA 1JT9A 3T1NA 5L3VA 4AS1A 1F8UA 1CS4C 3CXUA 2GZ3A 1ISFA 5L46A 5AKXA 5C1PA 4IINA 5LVAA 4FM9A 4YCMA 3ORSA 3TRIA 1EP9A 4KRYA 1I32A 4H2DA 5KTKA 4G5GA 1QRRA 2GD2A 3SE7A 3MRVA 2ASVA 1Y1LA 1ZMTA 1UKCA 5KOHA 4WEQA 1T3TA 2QRNA 3MELA 2PH7A 1JG3A 2RGWA 4G0ZA 4QTZA 1XPJA 1A8IA 2XZTA 3ZNOA 3IXLA 3O8QB 4R8KA 3FBTA 5CVVA 2IDMA 2IPLA 2YY7A 5BN3B 5FD8A 4DR4B 4RYDA 2AQKA 4RNDB 4B7XA 2DT5A 1DS6A 3EDCA 5JEEA 5L40A 2KLBA 4JT4A 4B4DA 1DWOA 1K08A 4YP6A 4P4LA 3KQUA 2QRJA 3D31A 1ZUHA 4DPMA 5GY7A 3FGNA 3C48A 1E3WB 1D0SA 2X9VA 3SSMA 4ZYVA 1VJTA 2LZ0A 2FFAA 1XJ0A 2VI5A 3GEEA 4R6XA 4QOGA 5AVKA 4RD4A 2RH8A 4JCOA 3W5AA 2PJZA 3OZGA 4M0EA 3BNWA 1B0AA 3UH1A 3YASA 4EX6A 3UGJA 2WWWA 3SLDA 1SG9A 1CP2A 3EPKA 3QXJA 1ONBA 1N2JA 4LSMA 4Q7EA 3X2EA 1JDTA 3AZOA 1CEEA 4ZVKA 1XTRA 3ER9A 2HV9A 3L0SA 1OFUA 2OWDA 2YYSA 1YI8A 5TPWA 1MQSA 1YHNA 5DXFA 1ZLYA 3LHKA 2HM7A 5AJUA 4QYIA 4EFKA 5AKGA 2YOFA 4EO7A 3VC1A 5E6SB 4FWBA 5JYBA 3KJZA 3KQSA 3ZHSA 5AK3A 4ZZ2A 2NUPB 1BH6A 1UMBB 3DBRA 2FETA 4QGFA 5IJZA 2X9LA 4ZZ1A 3ZDBA 1XQVA 4ZPJA 1KDRA 2AOUB 3BK2A 2B7CA 3JS5A 3OTHA 3LP8A 5CA0F 4B3XA 4LXHA 3QF4A 4IS3A 3EEFA 3EUEA 4TYWA 1N07A 1AOXA 3KWMA 3WYCA 5REQB 4BFTA 1Y6FA 4AZSA 4JH0A 2G0AA 3CNNA 3LLCA 3V46A 2LTAA 1OFGA 1H9CA 5ERYA 3CKYA 1OTYA 1FBNA 3PE3A 3AETA 2AFHE 2O3UA 4JVMA 3ZQ6A 1H85A 4BLPA 1HFJA 1ZRSA 1W5SA 3ITDA 3EDQA 1E7QA 3JV7A 2VT2A 3CZCA 4GNKA 2R86A 2J33A 4AJPA 1BW9B 1RXEA 1PRYA 4KAFA 3WAGA 4MQUA 2PTHA 4NAUA 1YZTA 4LI3X 3GDGA 5FOTA 2FMFA 3ZY4A 4P4TA 5CFOA 1Z5NA 2Q5IA 5FTNA 5CBKA 2P9CA 3PR3A 4LYHA 2JDIA 2GAAA 1EXWA 3HR7A 1E1KA 4IXMA 1QE3A 5IDWA 5KB3A 5H3HA 3HB0A 1UWKA 1D8TA 4DK1A 2H0QA 3DQPA 4GXTA 3EPRA 5JJ5A 4GI5A 2O1XA 4OLJA 1M2NA 4J1SA 3M9LA 4DWJA 4E21A 2HU8A 1VHTA 4A8HA 1AQNA 3A6KA 4PS0A 4G5QA 5G53C 3TTTA 2A9PA 4WKCA 2IIVA 3JASB 2RH4A 1S3SA 2XT9A 3M1YA 4ERXA 1IL0A 4CLRB 4ABTA 3N5CA 2VRNA 5BSHA 4IDFA 3EX7C 4HGNA 1UOQA 5NLLA 4NYIR 2CXXA 4EJ2A 2RONA 1FFAA 4BFCA 5KHOC 5IYPA 1WOMA 2Z30A 3I8SA 4HF7A 2JC3A 4YJDA 3KDSE 4OQPA 1B26A 1V26A 2EZ4A 3WS7A 1VKZA 1RQXA 1ZIXA 2VAMA 3NHJA 3OIVA 2HDOA 3ESBA 3P26A 1P1BA 4FFLA 3F7TA 4Q4AB 2GNAA 4GBMA 3VI4B 2IZ1A 3QHAA 1QYXA 4HGYA 3ZK8A 2FPUA 5I9LA 4UMVA 4L7VA 1U8CB 3KTAB 2XB2A 3HPRA 1EAYA 4L8LA 5F1KA 1M67A 3QBEA 4FDUA 3R6WA 5DCYA 1JHPA 3AIMA 5F3WB 5F4ZA 4LBZA 2JIZD 3CVOA 5F52A 5F5NA 3DV2A 4JS0A 2IZ6A 4O08A 4H9GA 4QVIA 4OB7A 2PWAA 1XHEA 1H3FA 2Q2OA 3OHSX 3PFBA 4WBNF 1WXEA 4OXNA 5KBYA 1E1RD 4S2EA 2VDQB 1KJQA 2CMFA 3R6KA 1AT1A 1RZRA 1P91A 4FNOA 2HDWA 4JQSA 3L0IB 2RHRA 4UM9D 4J6EA 3R5HA 4AMUA 4HNSA 2WILA 4YMTA 1L4EA 2P0YA 1TKAA 3R0IA 1LJ8A 3UY4A 2R6AA 3ZHZA 3H5OA 5TMBA 2VT7A 3WIEA 2NO4A 3X2SA 3LPNA 5IAGA 1WVMA 2R1VB 3IAS6 1QRSA 2XGSA 3EZFA 3L84A 4XM3A 3AQ4A 4R16A 3PLRA 3RC1A 3SXUB 4R98A 3H86A 1N36B 2DBYA 3JAKB 4MCHA 4QC2A 2VJAA 2MWMA 4RADA 4ZQFA 1XXLA 1G63A 3G05A 1I6LA 2MTBA 3IMEA 4JGIA 3ZU4A 5I9SA 1EFDN 5DP2A 3HUEA 4IJUA 1N78A 4EB8A 4BCCA 1P4AA 1SR8A 4YJ3A 5TJHA 2G4CA 4H6WA 4TXNA 2ZUWA 3F6SA 1A9XB 2RGXA 2NTYC 4BX3A 4OBXA 1MRNA 3QMMA 1FDIA 2IP4A 2DUUA 4KAJA 3VNBA 5JQGF 3HYRA 1XAJA 1UBEA 4HQRA 2GN6A 2REQB 3SHTA 7AT1A 2GLTA 2WSYB 1OUMA 2FSVC 3AJDA 1W59A 2PS0A 1ANKA 3BL5A 3GRRA 5ALYA 4KWEA 3EF0A 5BWBA 2DLNA 1Y4AE 1YJ9B 1KEVA 1SIOA 4A8JC 4E70A 1YCFA 1F2UB 3EG9B 5KIAA 3NAGA 1QHXA 5K3DA 4OK3A 2DHDA 2GBLC 5HXBA 3GJ0A 1CU1A 2DWPA 3E2PA 4BDSA 2VRWA 3O8OB 1YCGA 4DIDA 2JIBA 3R7FA 4AO8A 2I2DA 1AO0A 3U7IA 2AN4A 4XGQA 1GKLA 1L5HA 3NAQA 1QJCA 1CG6A 2G04A 2R5NA 4KAAA 5CYPA 3N7UA 4PBTA 5LZ9A 5FTMA 4RM2A 1HNNA 5B3JC 1N9GA 2AA3A 3KQQA 2GVZC 3HKEB 3FTFA 4L0CA 3I6MA 1UUFA 4ETNA 1J4AA 1Z63A 3TPZA 3ZBPA 2OXIA 3FOWA 1C1DA 2YFKA 4MR9A 3IH5A 4DBVO 3CF0A 5EWJA 4Y2GA 1IY9A 2WR8A 1R4NB 1DX9A 1OF1A 2ZSKA 3MOGA 5EIAA 4MKFA 2BLLA 3GXBA 1VMEA 3QIAA 3GW8A 4HV4A 3PA8A 4A0QA 1KO1A 3GVLA 4QRIA 2GB4A 4MWEA 3DAYA 3EGEA 1PL7A 4P32A 4RV4A 2F3PA 221PA 2G9ZA 1R0CA 4N3NA 4L1KA 3JQ9A 3GDOA 4BLOA 1IIBA 1J9GA 3DWEX 3BJIC 2C98A 3UOWA 4N40A 2MT9A 1KEWA 4IWXA 4H4DA 1Q95A 4WFKA 5EQTA 3SBOA 1XU9A 2CMHA 2GN2A 2O06A 4JOBA 5DGTA 1EE9A 1V5IA 3RVSA 4ZYUA 4NBUA 2C3YA 1Q50A 3F78A 5D51S 2JFWA 2XQVA 5BOSA 1VPDA 4OBBA 3NJ4A 1PKEA 1D0IA 5C35A 1RR6A 4X07A 4YUVA 3GUYA 4FBMA 3V8MA 1PT6A 3GJYA 1VHWA 3D4IA 4ZOLB 2BFPA 3V7UA 5FWYB 1OC4A 4YUWA 3TM5A 5CCBA 2FWRA 2YJ4A 3P97A 1SZCA 2I6QA 2GEKA 5I4KA 1YVPA 4UHHA 2DZDA 2PX0A 3FAZA 3PI6A 1QRUA 4N0PA 4MW6A 4RV5A 4O8CA 3ROTA 5DS0A 3JYNA 4RE5A 4B6RA 3PQ6A 4H1HA 4AZ3A 1V45E 1R8JA 4PZEA 1OXXK 2JJ1A 1V37A 4XGNA 1LSOA 3WBJA 3N8KA 2G8NA 1DJPA 4HSGA 1FYWA 5BMVB 4OYLA 3HCWA 5FT9A 2AYYA 3NHSA 3PJGA 4REQA 1KK1A 1Q74