4F7DA

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
246
Chain Sequence
SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
total genus 76
structure length 246
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4f7dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4f7dA02
4R71A 1HA3A 2CNDA 3U6BA 1TUIA 1IJFA 1VQKB 3W2GA 2PMDA 4B44A 1GVHA 1QH0A 1FDRA 1FNDA 1DG1G 3CCMB 1EWYA 2VNIA 3MMPA 4RCYA 3AGQA 1CQXA 2J7KA 4LC0A 3QE2A 4TMZA 3CPWB 4K1XA 1ZM2A 3W2IA 2VNKA 4YAUA 3CC2B 4G5GA 1A8PA 1E64A 5AN9A 4H9GA 3CMAB 2RC5A 1YITB 2HMAA 2X3UA 3OZVA 4RCZA 4B43A 2QMUA 1D2EA 4UAJA 2YWHA 4PC6A 4Y9UA 4B4DA 1JNYA 2QN6A 3CW2A 4RD0A 1Q82D 1S72B 4P3YA 2BN4A 3CMEB 2B7BA 4ACAA 1QGAA 4YALA 1JB9A 1TTTA 4RD2A 1KQSB 4BPRA 2BM0A 5HXBA 1DDGA 4RD4A 2HCJB 2BGIA 3WXMA 3ZZ0A 4EH1A 3QFTA 3OW2B 3OZUA 1CNEA 1D8TA 4ACBA 1B23P 3E1YE 3W2HA 3WY9A 1BJKA 3CCLB 1B2RA 4YAOA 4N3NA 2VZLA 1N0VC 1ZM4A 3VNUA 1YJWB 3JQRA 3V76A 4DQLA 4RJLA 1FRNA 3WNBA 3WNDA 3W2FA 3I1FA 3FPKA 1BQEA 1W35A 3AVTA 1E62A 3CB4A 3LYUA 1DDIA 1H42A 4Y9RA 1JJ2B 4TMWA 1KRHA 1KK0A 3ZBTA 1QGYA 4QHYA 3LVBA 1F60A 1FNMA 3ZC3A 4HE6A 4TN1A 1KK1A 4FN5A 3I56B 3AVUA 1EFTA 1BX0A 3QFCA 1KTVA 2R6HA 1TVCA 2PIAA 3CCUB 3G71B 3ZZTA 2YWFA 1CNFA 4N3GA 3B8HA 5EMNA 2BM1A 1FNCA 4PC1A 4ZGQB 1I7PA 2RC6A 2XNJA 4YAFA 3CCRB 4IW3B 2GQFA 2EIXA 4LBVA 1S0UA 1FRQA 4YHBA 3W5HA 2OTJB 2XNCA 1EFCA 2BPOA 1VQPB 3AGPA 3VO2A 3B82A 5TR9A 1JA0A 2QTZA 1EFUA 3WYAA 4U9UA 2AHOA 3CRZA 4NBSA 2VNHA 2YWEA 3OJXA 1NDHA 4RD1A 3W2EA 4M2LA 3AVVA 1GO2A 1BX1A 4M1KA 4AF6A 3OZWA 4M0LA 4FWTA 1J9ZA 3SJZA 1ZUNB 1IB0A 1YI2B 4MYTA 2EFGA 2OTLB 1JA1A 3B78A 2XEXA 4LBWA 2BGJA 1DARA 1OB5A 4PC2A 1ZM9A 1QFYA 2QTLA 3ZZUA 1VQ8B 1QGZA 2BVNA 1XE1A 1GAWA 4ZV4A 1SKQA 1W2BB 3U6KA 1KK2A 3P27A 3VMFA 1M90D 1N8RD 4ZGNB 1GJRA 3G6EB 4PGOA 3CCVB 3JQPA 2OK7A 5H59A 3MCAA 3WBKA 3CCQB 3WBJA 2DETA 4M53A 3LRXA 1VQ6B 1Q81D 1KK3A 4M4SA 1KC8D 1GAQA 3QFRA 4J0QA 1QVFB 3OJWA 4YAWA 3W5UA 4NCNA 4P6VF 1QUEA 3P26A 3PENA 2E1RA 2QDXA 1D1NA 2BSAA 1VQMB 1VQNB 3U2QA 3QFSA 1Q86D 4WQMA 3CCJB 4MYUA 1YJNB 2FX3A 3I55B 1VQ9B 4C43A 2CRVA 1EP3B 1G7TA 1VQOB 3MHPA 4B47A 1OGJA 1VQ4B 1YIJB 3CCEB 1EXMA 1Q7YD 1VQ7B 2BF4A 1F20A 4TMTA 4QFMA 2DCUA 2GPJA 4PC3A 4DQKA 2DERA 5FA6A 1AMOA 3AVXA 4Y7CA 2VYQA 1OGIA 1WDTA 5DSZA 1G7CA 5GV7A 1K9MD 2QEXB 3CC7B 3QSYA 2ZITA 3G4SB 4ZCMA 1VQ5B 1QFJA 3VNVA 3W5VA 1R5OA 1AIPA 5GV8A 1H85A 2OK8A 3ES9A 1QVGB 1IJEA 2QA4B 3VO1A 1YJ9B 2HDNB 1N0UA 5H5JA 2C78A 4FK8A 1K8AD 4TMVA 3CCSB 1FNBA 1R5NA 4PC7A 5TV2A 1EP2B 1G7SA 1QX4A 3JQQA 3LO8A 2BV3A 4G1VA 1VQLB 3CC4B 4B48A 5JBQA 3FJOA 2B7CA 4LBZA 1NJID 5KSWB 3E20A 2B5OA 4Q7JB 2YWGA 5TY0A 4AF7A 1QUFA 2NPFA 1G7RA 4G1BA 3CD6B 1GR1A 1M1KD 4TMXA 1KD1D 3AVWA 1ZM3A 1EP1B 1TLLA 4C0SA 4LBYA 3ZBUA 4HE5A 1ELOA 4RD6A 4B3XA 3J81k 2D74A 2DEUA 1E63A 5THXA 3AVYA 1XB2A 1U2RA 1W34A 1OB2A 4AC9A 1QFZA 1K73D 1UMKA 3WNCA 4ZCIA 4F7DA 4RD3A 1R5BA 2PLFA 3CXCB 2DY1A 1SM4A 1W87A 2C77A 1YHQB 2VNJA 1QG0A 1KJZA 3A1FA 2BMWA 4ZCLA
chains in the Genus database with same CATH superfamily
1WF3A 1OB0A 3L7LA 2QN9A 4J7AA 3U6BA 2DIEA 3UGJA 5DCWA 5I7HA 3EGXB 1XVAA 4M7OA 2OPHA 3EX7C 3U5ZB 1TMYA 4AY2A 1BPLA 3NBKA 1TEXA 3QV1A 4ENRA 5BMVB 3STTA 4QRIA 3WAKA 5LFAA 5LP1A 4Y1EA 3NWBA 2H3EA 1YA8A 3DMFA 5TVGA 2HTEA 1TW3A 1IXZA 4DIBA 3QBDA 3VRHA 4QA9A 3L8DA 1Z0UA 5FTKA 3OCYA 3KAKA 3G0GA 1CDOA 4HK4A 4YQEA 3GVPA 1VI5A 4QPPA 5BN4A 4OQEA 3LX8A 4UE2A 1QIKA 1WU7A 1W1UA 1O89A 5KNCH 4EBFA 5IEBA 1OYVA 4M49A 2G6BA 1C2YA 2VBIA 1E94E 1U2EA 5ALDA 2ZAGA 4RU1A 5BQPA 2YW9A 1GRRA 2LZ0A 4YI3A 4QT4A 5JS8A 1HDGO 3G9TA 2XV1A 4NJMB 4XTRA 2R1TB 3Q87B 4QXAA 5EZYB 2PX0A 4AL4A 5ARBA 1Z2EA 2GN8A 3AR4A 3PQEA 3M0EA 3RC7A 4ZQFA 4CIXA 1U7OA 1NHGA 1OZ0A 4LY6A 4XWTA 5CMLA 3UKOA 1Z26A 2QMUA 2B98A 4CQNA 1UQUA 1M8FA 1WXWA 1E7MA 2P9YA 4TRJA 2NN3C 1DIAA 2XBUA 2XDQB 3QF4A 1DQYA 2DUNA 2HSGA 1YHYA 2B69A 2DWCA 2GYWA 4HFRA 4NJEB 4TVKA 3W2TA 4IIGA 3DMHA 2J5KA 2W2LA 4EAAA 2VDPB 1VKJA 2Z3WA 3JCZA 4Y2XA 3TAXA 1RNLA 5P21A 4YDQA 5FPHA 4PRZA 1IK6A 4WESA 4CCYB 2X1VA 3RR2A 4ZVOA 1SXJB 2V0GA 2ORWA 1PL7A 3WGMA 1NVTA 2Z2ZA 5EWLA 4HF7A 4EY5A 2YCLA 2PT5A 4ACAA 1C2TA 1ZD8A 1G3RA 4L3VA 4U5QA 3VX4A 5BUCA 5ILOA 2JG3A 2FR0A 2EW2A 4HGOA 4I4TA 4GHWA 2W2TA 4XWWA 1ES9A 2K7FA 1HE3A 1LWNA 1EWTA 4QARA 5HMMA 2XYVA 4LVUA 1F48A 1K2VN 1T35A 2H06A 3SQDA 4G0UA 5IABA 1KYXA 3QPWA 4RQAA 2WYOA 2X9GA 2Q6IA 1W59A 1RBMA 4X84A 4ZREA 3CRMA 1RYHA 3EC2A 1LDNA 2O8BA 3NKLA 3IKJA 4BZPA 1W4BA 2DR3A 5DRTA 3VGPA 4JJ8A 2FQXA 2HMTA 1DX4A 5SY4A 2QHXA 2X6RA 3QW4B 2PZJA 2Z6BD 3R6DA 3CLUD 2WTBA 1SBYA 3ZHUA 4EVSA 2VI5A 4LF9B 4BN0A 1E7QA 3JVEA 4M6WA 2IX9A 2Q6LA 1DIHA 4MUXA 4I5EA 1UJ2A 4JKOA 4ZAZA 1ZPDA 3RC3A 1YTLA 2YV3A 1WP4A 2A5JA 5TLSA 5FNZA 1NUUA 5CDSA 3GLFB 3NORA 1NBWB 4ENSA 4YAOA 2CMGA 2HWUA 1F3LA 7AT1A 4L15A 4LVCA 1RMTA 2VDNB 3K9FC 1KZ9A 3UW3A 3W3ZB 4YLYA 1NY5A 1X7XB 2EHJA 1YMQA 2SHKA 3A1NA 3WYBA 3EVGA 3U39A 3VOAA 4UXIA 4UFOA 4AUKA 4O5OA 1XJ0A 1RM5A 3OT1A 3GAZA 3UFBA 2XNSA 4CM6A 2JHAA 1TTQB 3KOMA 5F52A 3HFGA 3RSCA 3WLIA 1JFFB 2PXAA 1MX3A 3LLUA 4PLHA 1DDIA 3ETGA 1ZJWA 5I9NA 3L1UA 3N0XA 1TM1E 3RIGA 3WZ2A 3EZXA 1E7YA 4C05A 4MW2A 3DP7A 4I4NA 4IF4A 1R16A 4AWAA 1SBQA 5IF3A 1YJQA 4PR0A 3A04A 4LCBA 3I1IA 4RDCA 1UXKA 3N8KA 3FDIA 2NTNA 1MTOA 2YXDA 4R8LA 3QQPA 5IT4A 3M3PA 1NBEA 2Z4TA 1FUEA 3DE1X 2P3QA 1K5HA 3TOVA 5DYTA 1WCWA 2WSMA 4X1IA 4FYVA 4YRGA 2RHLA 1ZK1A 1Q6ZA 2OM2A 1NKVA 4OF4A 4RZSA 1SK9A 4X7DA 1NR1A 2ZDGA 1YB2A 2E89A 5AM3A 3R3HA 2QAGB 1BNCA 1SH7A 1I4OA 4EHDA 1QVZA 1WBJB 1C4OA 3SZRA 4PX5A 4AP9A 3R9KA 4NXNB 3IKLA 1TCUA 4ND6A 4YUVA 1U5BA 2HXYA 4DJJA 2D00A 2GH1A 1VA4A 2QR5A 4GPAA 3LYHA 4UU0A 1GQOA 5DYYA 2ZAMA 3PCRB 1QP4A 3OF2A 1PVOA 3HDJA 1NVMB 1QG2A 2H8GA 3DR5A 3MGAA 4Z9AA 5B55A 2Q5HA 2M32A 1L4EA 3AY6A 3PE4A 1J07A 3DDUA 3MVEA 4RVDA 2H9IA 2GEDA 2EIXA 3RUHA 1HL7A 2OG1A 1E1KA 3HJCA 4KUEA 4OXQA 5AM5A 1W4CA 5GIOE 1C80A 2NXNA 2AJBA 2M6RA 4HNAA 1Q7TA 4MUFA 1B8OA 3TLZA 1HY3A 4HDMA 1N5KA 1XCPA 4H4DA 3FMIA 1NSYA 5DCUA 3KQOA 1UM9A 4L4SA 4EW1A 3I5XA 4DB4A 4A82A 3SX4A 1JDNA 1S4MA 1XJWA 1VQPB 1U65A 2I87A 1NE7A 2AMVA 1JFRA 2VR1A 1Z7WA 2REBA 2XUPA 3E7WA 4OHWA 3WYAA 1MAWA 3IBFA 2P79A 2QUAA 4X20A 5EJ5A 3H2ZA 3AXSA 3WFJA 4GU5A 1ZGAA 1A9TA 3H6KA 1SUCA 2Q99A 4IIHA 3WL3A 1VL6A 2R4QA 4P7GA 3KZVA 3S55A 1GYRA 4S0ZA 1NXXA 3AB8A 3D7MA 3R7NA 5J4VA 1N6NA 4B74A 5C7IO 1GTSA 4GICA 3G2HA 1E1RA 5BSHA 1PEDA 1XZJA 2CSXA 1PYOA 1IHMA 2FW7A 4IVRA 1WTHD 2ERXA 2ECKA 4W99A 3ND9A 4HGYA 4JJGA 1P72A 4N6GA 1M6NA 2HDOA 3SJUA 1ISFA 3DEHA 3KD3A 5HUHA 4NFHA 3T54A 1K89A 1Q21A 3BX1A 4ZQBA 4FT2A 4HTFB 4OAOA 1WV1A 1C9MA 3HKDB 1PSWA 1R1DA 3OICA 5B1HA 3M8KA 3FAKA 3HB5X 4O3MA 4RF5A 4M0LA 2L0XA 3KWJA 3SJZA 1M75A 1MT3A 4NWIA 4EQZA 1CT9A 5JH7A 1YJ5A 2ATXA 4P84A 2R7MA 2OTLB 1R0RE 3OO1A 3PGLA 3DLBA 1TE2A 2EJWA 1P8JA 3RBVA 3D8NA 2RAUA 3H11A 2H57A 2GCEA 4G86A 4NBNA 3T9DA 3PFIA 1DZ3A 2NO5A 4YUWA 3M6VA 5KNDH 1HLGA 2BE7A 4MYCA 2NQ2C 3L7KA 2VXBA 2EBFX 4UEKA 4K9SA 2X1LA 2YFYA 1T3ZA 4BQEA 4DKJA 3GA5A 1A2QA 3KK0A 3I04A 4M86A 4OM8A 4RELA 1QIHA 4F2GA 1GPH1 4IX9A 5LB2A 3T12A 3OTWA 4AZTA 4DZRA 2C5EA 4ZHQB 2NXWA 5JZBA 3FCEA 1NJFA 1G5IA 3AFHA 4OQNA 5GZ1A 3GG9A 4YRMA 4G6ZA 3AWDA 4CTKA 3NU1A 3THYB 4F5ZA 1AQIA 4WNYA 2VT2A 5ARCA 5IUJC 4PGOA 3BOSA 2JZOA 4JUDX 2QTGA 2YMLA 4P7KA 2VRWA 4EA6A 1S2NA 3QU7A 4MR8A 5A6SA 5GOZA 4JDUA 1GUAA 3V7WA 4GMXA 5CH5A 3BWMA 4K9RA 1WMFA 5GOTA 3TW4A 4A23A 4MX8A 2ZB3A 4JNCA 4AKEA 2DETA 3TK1A 2ATEA 2EIHA 5JIBA 1T0BA 5DTMA 4Q34A 5DGXA 3N2YA 1FX1A 3GVKA 4FI3C 4BUJA 4FMDB 3PQ2A 1DOHA 3OKCA 2BUAA 4G23A 3BXZA 1QVFB 1SNYA 4ILKA 3GN2A 4YAWA 2GB4A 4P6VF 2WJVA 2AX3A 1E9CA 1WB4A 1UBTS 2RE8A 1ONBA 5ALJA 2ZAOA 3KZXA 5JQGA 1TYEB 2EWWA 2X8AA 4FVTA 1SD2A 3IP3A 2P2YA 2WKWA 1PNRA 3FWHA 2MSDB 4WLVA 5I8PA 4UXHA 2VQSA 3K73O 3AHIA 2CL7X 4P98A 1EVEA 4WNCA 3L6CA 3TZKA 4DSUA 4O59O 1E2KA 1N6PA 1PJ2A 3LOQA 3JVUA 2WAAA 1H4TA 1DTEA 2HFKA 5LBIA 4UASA 3FF1A 4ZCPA 1OT5A 2WSSA 2AFIA 2QRGA 4OFWA 3HYTA 4HCJA 4JQSA 1PT5A 2C9MA 3G9UA 5LU8A 1EESA 3R74A 1OHHD 4I5FA 1A98A 1JQLB 4D4MA 3JVVA 1W7AA 1XNQB 1Q1BA 4D9FA 3N6XA 1USIA 3HHPA 4E31A 3GV0A 4YRLA 5ICMA 3I5YA 2YX1A 4CFYA 5ITWA 1OMOA 4KXQA 5EP1A 4MKXA 5BW6B 1JFSA 1JJFA 2GYYA 3I6QA 2VKQA 3FGZA 1R18A 4I99A 4NPHA 1R3UA 3C6KA 5D1HA 3SLKA 3L1HA 1OXUA 3TI7A 2DERA 5TSDA 3AQ4A 2ZUBA 1M76A 3SS9X 5FA6A 3TDKA 3HXMA 1VM6A 3S8EA 1ECLA 1RTTA 1K9VF 3ZNQA 3KL4A 2PWAA 3MTAA 2RD2A 4U00A 1RXVA 2YY7A 1D1PA 4HDQB 2YN0A 3BXHA 4G9EA 5B7GA 4LK2A 2ACVA 2HSZA 3ZLTA 4Z4HA 1S2LA 4YLEA 4RHEA 4DG5A 2FJUA 4KKXB 5CYFA 5GJCA 2A14A 3TR5A 4XRRA 2G7ZA 1UKCA 1A4UA 1V0JA 2Q3JA 2WJ4A 4GXQA 2DBQA 4E94A 5B2EA 2IZOA 5HXAA 3E8SA 4EF4A 5ICFA 4YX9A 3LD9A 4IJQA 1PD1A 2XCUA 1GGFA 2YJ4A 3ZHXA 2RGWA 4FQ5A 2LZJA 3GCDA 3CRVA 4GL2A 5C2JB 4QOHA 4DMLA 4KW7A 2VAVA 2YUIA 4NOKA 4D8UA 3C3BA 4S24A 3BFXA 2MJLA 4N5HX 1J25A 4MIKA 2HEGA 3I4LA 5B1EA 4NF2A 4BNYA 2BISA 1FNBA 3E7XA 3VVMA 5KO2A 1NOKA 1NVUQ 2JPDA 4WJZA 2X19A 4BS9A 4ZTZB 4BRUA 4L75A 1IK4A 2GSDA 3ZTYA 1OYWA 4JROA 1MQ9A 1TYZA 3T1HB 3EEYA 3OE7D 4IWYA 1G7SA 3NRBA 2IZ6A 3PNKA 1XTVA 5IDVA 5JMTA 3S81A 1LPAB 2HXGA 2V0CA 3R3SA 5F2NA 3RSHA 4DK1A 1USUA 4UBOA 1Z18A 1U0JA 1FLAA 2FPMA 4FCCA 3BZBA 4QXMA 1NXOA 4MW7A 2ZW9A 2P5UA 5HK9A 3CNNA 4LBZA 1NJID 2ERYA 3OP4A 3S27A 4OFBA 4CKWB 4FYYA 1LDEA 4KVFA 3BHNA 1KI8A 2GBCA 3FSEA 4AJPA 5CBKA 5TT1A 4KPUA 4MWZA 1KO4A 3V4LA 4BRWA 4ZAGA 4XLCA 3PT5A 4ABYA 1NF3A 1U0LA 3BCRA 3EWAA 4HG2A 4BVEA 2IYUA 4ZO4A 4CV1A 1U8CB 3ZV5A 5BOVA 1HQKA 3A10A 4MPDA 1P6QA 1YV9A 2CLIB 2A0FA 1VJDA 3N6VA 4B6SA 5JD6A 4ZWNA 2WB2A 2GETA 4WZTA 3DEIA 2CK3D 1YJ8A 2D5BA 3HUDA 4IDFA 4HD8A 4RACA 2C8LA 4FEEA 4MWSA 3IAS6 4OXRA 4WZAB 1I0ZA 4YRFA 4EI2A 5IFLA 1ZHFA 2ODNA 2HF9A 1JEJA 3UW1A 4HNUA 1KNQA 1Y3HA 4IIBA 3ZV7A 4E46A 3SLRA 5KMGB 3Q6QA 2GK6A 1C8BA 3A1VA 3FMGA 1L7AA 4DXAA 1T9AA 2EKPA 3TGPA 3GLHE 3KU4A 5E3IA 3UWKA 1L4FA 1Q5PA 1DV1A 2XD4A 2GZHA 4GUAA 3KB1A 4OU4A 4P2BA 3W05A 4KKUA 2WHQA 1CJKC 1FMLA 5T4HA 1Z38A 4AC9A 3AHEA 3BBLA 3MCTA 1IXYA 4ALKA 4U5XA 1RCFA 4NH4A 2WF6A 4NCHA 1K8QA 3MLBA 5TQ0B 4DEVA 4HNTA 1UMBA 4CU5A 3QLJA 2MR6A 3MTDA 3QYPA 3L1KA 4W5HA 3UB3A 1Q22A 1PZMA 3K1AA 5DW3A 3ZWVA 5B2FA 2R1VB 5JQGB 4YECA 2J4FA 4B7ZA 5A5DA 3ABSB 3T9BA 1C0EA 2QRLA 2CJFA 1ORIA 3L8CA 3ZWBA 2ZT6A 1TK2A 2CCKA 3I2GA 3DO8A 5G4KB 4DLNA 4UOEA 1U8EA 2RHJA 3ER6A 3R0ZA 4YXFA 2YZ7A 2VF7A 2J3DA 4U7WA 1R27A 1E1CA 2WHXA 1YHQB 3DVAA 5L3ZA 2R79A 4HGRA 3SDBA 3W9BA 5C1BA 4YMTA 5JCOC 3GGDA 3HRHA 3H9UA 3LW7A 3OFVA 4KN8A 3EPJA 1R7RA 4RWEA 1SUFA 3T3MB 3TRIA 3ZH9B 5FH9A 1DIRA 3GZTB 4JUIA 2CVZA 4EJ2A 4M9ZA 4ON9A 3UGKA 4DK0A 3W9SA 3AILA 3QWHA 1V7PC 1L7PA 1L3IA 2R9VA 4TPKA 1PJ7A 4UE6A 3F3KA 4C2AA 3ZPNA 4CDNA 1SVOA 2VDWB 4V39A 3I9V6 2CF6A 3PA1A 2KLHA 1V5FA 2IITA 1UBRS 3X1DA 4ZIRA 3D8RA 4ZCSA 1JEYA 1QCDA 5CA0F 5AVVA 2YZGA 1A97A 3WAGA 4JI2B 3OZEA 4OI0A 2YZKA 1S2MA 2E5WA 1WBBA 4EJSB 2Q0HA 2D5IA 3E18A 1VMEA 2ZUUA 3IR5A 4FKBA 4GBJA 5IPFA 4BV2A 5IT0A 2ZULA 2UYCA 3ZUGA 3E0XA 3ZTWA 3C41J 4C7JA 4BZQA 1PD0A 5EE5B 3RTGA 3R6LA 5J5AA 5BQOA 2OOSA 3BILA 1DT3A 1OD6A 3DONA 1EEXB 4AXBA 2YV5A 4C03A 5K8LA 3GGPA 3W6UA 1W29A 1X2BA 2AC2A 1HDYA 1ZK0A 2G1JA 4NBKA 3OU7A 1SG6A 1H5QA 3OZGA 3LY5A 4B43A 1YC2A 2Y05A 3I9LA 3WGZA 3RKSA 3LS2A 1VYTA 4NZZA 3EVBA 3IPRA 4UUOA 1YZTA 2CWWA 4UAJA 4XX0A 2F1IA 3IUYA 4IFIA 1PSZA 5KKNB 3SAJA 4Z7NB 3CLSD 1YCFA 2OHVA 1LFAA 1DAGA 1J9GA 4MQMA 1EQ2A 1H2YA 1Z0JA 2OC9A 4RFLA 3H5WA 3H9EO 4KFSA 4XA8A 1S72B 4CHTA 1M2KA 2JIZA 1BMQA 3JQ8B 2CHUA 3AP3A 1FFXA 1RQ7A 3HXPA 4TMFA 4UZFA 1MAUA 3EVEA 1EKXA 1OC4A 4I46A 1L8LA 4KXYA 1T6XA 4OGKA 4WZAA 4D0SA 3KD2A 2Z6QA 2ZQ5A 1PF7E 2R65A 1D6NA 1KS2A 5EXDA 4RQTA 1I8DA 1OR8A 1UJBA 1AX9A 1P4AA 4HDCA 3VU0A 2CXRA 4LDJA 3ZGLA 5BV0A 3ZQJA 3WLAA 1GOTA 5C9ZA 1V9CA 1X1SA 3HYRA 1Z33A 4N7MA 4U7JA 2BM0A 5CD1A 4BO9A 1G9XA 2DU8A 3GNSA 1B93A 1G8HA 3FSJX 4A26A 1DRUA 1OC2A 4M1WA 5ECYA 2F8MA 3R8CA 1X19A 2WVJA 2CFRA 3HNOA 5JO0A 2BGIA 2J9XB 4NPCA 5T3UA 2E85A 4U7DA 3TJZA 5PGMA 5IEJA 4NLLA 1JECA 3EXG1 1ZIPA 2O5RA 3VYRB 4PBRA 1CNEA 1Z7EA 3DT6A 5DISB 3DT8A 3WVNA 2QE6A 4HUTA 4YMHA 3G5LA 3ZWCA 3DTNA 3IEIA 4WOCA 4S35A 3GWGA 4G65A 1NU8A 2XGOA 2JVKA 3T38A 3WZMA 1FVFA 2GGSA 2VHEA 3Q8XB 2H1SA 3CCLB 1B2RA 3KYJB 4RL4A 5LZ9A 4HKTA 2B5WA 1P73A 5I9TA 3RYFB 5LL6P 3OFJA 1QR6A 1N0VC 3FRJA 3V7NA 4F6RB 4KR6A 4P5EA 2WYHA 1UK9A 3S7ZA 1FU7A 1KARA 1X8KA 1NW6A 2RGNA 1RI3A 3KTAA 4GS5A 2G9QA 1EUCB 2ZBFA 1JR6A 1FRNA 1OWPA 1U98A 2JZCA 2R8BA 3HGTA 1GSHA 3CJTA 2VSOA 2BFBA 3A6GA 5EPOA 5F1PA 4RHYA 4C21A 1T4DA 1K7FB 5COBA 1IM8A 1BQEA 1LJ8A 1WPGA 3EZYA 3NC0C 4NIMA 1AKMA 4RFSB 1X3SA 4UVEA 2O59A 3QM1A 4B82A 4HP8A 4HYTA 1STOA 4OV6B 3G3EA 3NAQA 4ND2A 5E3JA 2O8EA 4AS3A 2A35A 2AI2A 2XCIA 3GEDA 5EWJB 4BYGA 5IXJA 1YWGO 2IY8A 2JFUA 2Q4EA 4AJ1A 1N36B 3VU3A 4NV3A 4P32A 1IAVA 4JSYA 2BKVA 5D5PA 2ATIA 4XQ9A 1WY5A 3K2QA 5ARDA 2B1RA 3C1TA 5HDQA 2D9RA 1Q1QA 4P3OA 5TNXA 3X1WA 4CM3A 3R75A 5TPZA 3KPUA 1EM8A 3FFBA 1N77A 2QR2A 2F1OA 2R7AA 4MEJA 3UG6A 3OEYA 1WY7A 3VYWA 1P2FA 3WKAA 4CFZA 3THXA 3OH8A 2B4TO 5G3YA 2OE2A 5FL7A 1OFHA 1KPIA 3HBNA 4JLAA 4Y8VA 2I33A 4WAUA 2QM7A 2RHOA 5DBHX 2H2DA 3CGWA 3SZUA 2BGRA 1J1IA 5JVDB 1V6AA 1OV6A 1Z07A 3HP4A 1P61B 4MKZA 2J3QA 3LCRA 3B8HA 4L3WA 1EDEA 4CV2A 4DLRA 3ZPXA 2BM1A 1L1EA 3CNQS 2YMMA 3N2ZB 2OCKA 3CT6A 3JPYA 5EIBD 4EVRA 2IA5A 4JKYA 4K87A 4O2BA 2PJRA 2Q7XA 3FFXA 3ENVA 1O4WA 2RC6A 1A2OA 2CYBA 2ORED 1R64A 4RDJA 2IBMA 2VH2A 3B1VA 3EFHA 4OGLA 4Z4WA 1L5MA 4IIFA 4LHYA 1Z68A 1YUMA 4OB8A 5T6MA 1FC0A 2C5LA 4DY4A 4BVGA 2VP3A 4TL6A 4YR9A 4P3IA 1YQXA 4CTNA 1HDRA 2JIBA 3EGIA 3L7DA 4TWBA 3TE7A 3DXZA 3L8ZA 5AJUA 2VRNA 2I54A 3N86A 3N2IA 2QMYA 2JFQA 4RX1A 3DOCA 3I2FA 2YY5A 4Q16A 3RV4A 3FH0A 3NIWA 2YWDA 4R2XA 2JIPA 1ZRHA 1VECA 1LF0A 3BBPA 4DMCA 3A9SA 4RVUA 1GT6A 4PNEA 2VZ8A 2YJ5A 2PRIA 1FP1D 4L5JA 2QY6A 1XAJA 2Y4NA 1JA0A 2XE7A 3EIXA 3OOHA 4IEEA 1EFUA 4C3ZA 4BNFA 3WE7A 5KREA 1BS2A 4RL6A 3JAWA 2YXEA 3MSCA 2ZTGA 1UJNA 4RA6A 2VJIA 4J4BA 4M9UA 3U7JA 1BU5A 4ME6A 2FSUA 4IV8A 2ALJA 3GL9A 5AJHA 1RYMA 3H2BA 4UHCA 2X14A 1PX0A 4FNAA 4D99A 2QP3A 3M6XA 1B76A 2RH4A 4E4TA 4EA7A 4A92A 3PEVA 3OZAA 4NYMR 1QP7A 2PAAA 3GJ0A 3R3JA 1Q0PA 4YY3B 2UYOA 3BIFA 2JEZA 1HT2E 3OJLA 4TL9A 1ZUNA 2CNKA 3JD4A 1EDOA 2VG8A 1JQ5A 2K87A 2H5IA 3P0EA 3EA0A 1EB9A 4YO8A 1RBYA 4WZAE 5EA2A 3V1YA 2VSQA 1YI1A 2WSLA 4KAFA 3PEUA 4TM8A 3PWSA 3NHMA 4NCXA 3UCEA 4KX3A 1KRWA 5BWCA 2I4MA 2JDIA 1ISIA 2Z95A 3KVYA 4DCNA 3K5PA 1RQRA 3JPWA 4Z0HO 1KQPA 2P4QA 4KCGA 1QFYA 4Z4ZA 2PMFA 4B0PA 4FJ2A 2H18A 4B5LA 2I34A 1DKLA 5DBGA 2J7PD 5C5IA 3M6UA 2O1WA 3MGCA 4BMVA 1TLFA 2VK8A 4XM2A 5KW9A 3SIWA 1UMDA 5EESA 5CM2Z 3SDZA 1ZMXA 3QJGA 3OEEA 4WCFA 4ERXA 1GPJA 4UMFA 5H3LA 4U4AA 1K2WA 4XVHA 3R4CA 4ZOLF 4MR8B 3NCTA 4E03A 4MUMA 1X38A 5BMVA 2PBRA 2FY8A 4MZDA 3TLAA 3U09A 5AJTA 4QUAA 2Y27A 1VG9B 5THQA 1YB1A 4KLAA 4Z4SA 1XKQA 2OKGA 3IODA 1Y3AA 3V1NA 1P1KA 4Z0TA 1DPFA 3CSDA 2FR8A 2ZYWX 1P6XA 3HKEA 3CNLA 4NAUA 1EUDB 2EBWA 4MKHA 5FLEX 1HTTA 2WF7A 3S70A 3OP1A 4MH0R 4CKYA 4Q7QA 1T9BA 1OTYA 2NACA 3C16C 1NNUA 2WP0A 3LUHA 4BZXA 4EUFA 3O31A 4TYWA 1TQ2A 2GRAA 3JTEA 4IHAA 2FFHA 2RHWA 4GNKA 4H7FA 4I6GA 1T5TA 5F21A 2IYRA 2BLNA 1Z0ZA 2DWPA 2IU4A 2VP9A 2VPWA 4XI9A 5G4KA 1JALA 4B35A 4WFQA 1JJIA 5SY9A 4BLTA 3IR6A 1SU7A 3PENA 4FSHA 4GUDA 4UMDA 2WD9A 3LHDA 3UENA 1YCDA 3O03A 1E2FA 4FGJA 3OU2A 1C1XB 1U2ZA 1C8LA 3K0HA 3OG9A 4KITB 1NSFA 4WCVA 1L5OA 2PZGA 5JZOA 2CE2X 1CUYA 3AT1A 4J16A 1M2EA 1AG9A 4KRXA 1HGXA 3RAPR 1P9RA 3BXOA 5C5EA 5CB8A 3CWZA 3DSRA 3I9V1 1HKUA 4NU8X 2IYYA 3AK4A 3BD6A 3JAKA 3KQWA 3NJ8A 3EMDA 4RF3A 4TUYA 5EMLA 4ZCTA 2CMFA 3TAUA 3C8DA 5AXDA 2R6JA 3P2JA 1VSUA 4ENQA 2BR4A 2XMSA 3A37A 3RU7A 1VQ4B 1Z5VA 1Z8NA 2YXNA 2VDOB 1Y5NA 2QTMA 2ZIWB 4LJ7A 3FDXA 2P5SA 4JC4A 1E4OA 4WLFA 1E1LA 1NC1A 3HXOA 1PW5A 1FMJA 4XQFA 2OWDA 3Q2IA 4G0VA 5G1NA 1TYAE 4ZJYA 1GHTA 3VM6A 1PG2A 3JYOA 1DJPA 4PBSA 1K3TA 1QDLB 5H4GA 2C9ZA 4XSVA 1FYFA 1DKPA 4BV9A 4YCMA 4X06A 1R0ZA 1ANKA 4OI4A 2NU9A 3HXLA 2FAXA 2Q4RA 4FBLA 1F1BA 5LUBA 5HJ5A 4N41A 1U8YA 1SCBA 3PUHA 3AEUB 1YCHA 5FHQA 4CLRB 4XGIA 4K88A 2QEXB 3RI3A 3TQOA 8MHTA 2N42A 3GH1A 4ETMA 1JW9B 3LY8A 4G4JA 2OHJA 4G0ZA 4OYYA 1MF7A 3HJRA 3ZZ1A 1Y1PA 1ZY2A 2HBYA 1VTKA 1MV8A 2ZJBA 3A9CA 3LP8A 2AXNA 3ADPA 1K6XA 1ID1A 1X0VA 4HRAA 4L50A 3WB2A 3VTFA 1CRLA 4MUHA 4G5FA 4LHWA 4RO0A 4ZVUA 1CJSA 4DR5B 3N2KB 1QVGB 3OQ1A 2JH9A 3ZUPA 1ISPA 2GVDC 4HUQB 5LZ5A 2HZBA 1XJQA 2TRSB 5CX1B 4LOKA 2V4DA 3KLBA 3OOWA 4F4UA 1E3QA 2IKQA 1G5FA 1KBZA 3HCFA 4RADA 3S5JA 4KQHA 2AFHA 1XTKA 4D2IA 2BHLA 4U7PB 1X7ZB 2RGCA 1NURA 4JH0A 5JSFA 5KOHB 3WBFA 1CY6A 3EXHA 2R7NA 3PSHA 4ZXFA 4Q47A 3OE5A 4IV5A 4QYIB 4D9BA 4YT4A 4O1IA 1ESEA 1EVLA 4F11A 1CY0A 4GRIA 4KK3A 4G8DA 3D1VA 1QX4A 1QFSA 2A86A 1C7ZA 2QQ5A 2VEOA 3EZ7A 4ITVA 3N5CA 4FKZA 5EFZA 4YYEA 3FPFA 4ID9A 5HZKA 2QQFA 1I3LA 4GMGA 2NP6A 2PGXA 2RKBA 3MBKA 4ZO9A 1C7JA 4FYWA 5EVCA 1WZUA 2YYYA 2CC2A 3U3KA 4Z5XA 3FJOA 2ONYA 5IMSA 2IS2A 2ZAIA 2GRJA 1Z0DA 3AP2A 3NTXA 2KPOA 4MA4A 1LBEA 3R5TA 4OKNA 5LNK1 2VAWA 2B94A 1ZSNA 1THZA 1G2OA 3BFPA 3MSXA 1DFIA 2QXUA 2QVLA 5A5EA 4Q7JB 4JLUA 1G41A 1GA4A 2YYSA 4I9UA 1AXGA 1JQKA 3NBFA 3PVZA 5TY0A 4PQFA 4QU5A 4AD8A 1S7CA 3PD0A 1G66A 2X7JA 4RGYA 3DLCA 4IMRA 3OQNA 5GVRA 5KIAA 4E5SA 1GR1A 2GF2A 4JOBA 2JFWA 1ORTA 1X7XA 3TDNA 3QVGA 5CURA 4OXNA 5K0BA 1W4RA 1MJGM 2Y99A 1NI5A 2ZSHA 3UV7A 2G4CA 1XRNA 1L9XA 1P4JA 3PPVA 2F9FA 2ATVA 1F2DA 3HCNA 1W47A 1PO7A 4QL3A 1GZUA 4B8WA 1M34B 1MO2A 2NXEA 3K0EA 4JLSA 2X8BA 3UICA 3COPA 4Y6RA 2V7QD 3HXTA 3PV0A 3L0PA 5DGIA 3V9PA 4L8LA 1T26A 2FHPA 2ZJ0A 2FK8A 4HNGA 4QXRA 1KTIA 2QD4A 4B6FA 2AXEA 1U6IA 2TMDA 1I1OA 2B6HA 4YCBA 3K0CC 5C81A 4MVJD 2C3UA 1ZI9A 1X1DA 2K7ZA 2OLEA 2XNHA 3M6WA 3FPHA 3O1HB 4E0FA 4Y2PA 1R9MA 3BWEA 3IQEA 3BNWA 4QYMA 3G2OA 3U7IA 1RQPA 1JA9A 2ZJ8A 3DE3X 4DLYA 5JRJA 3UPTA 1JTVA 4G56A 2VBGA 3Q3IA 1O87A 1D6SA 2G0AA 4TV9F 2PSHA 4XLFA 3F9IA 1RXUA 1YULA 4TLMB 1UBGA 3K31A 4UHJA 1FFSA 5DNYB 5KYYB 1PJQA 3DEAA 1WMBA 1QBKC 4TKUA 4AUEA 5HUQA 5BV8A 3HDQA 4HYQA 1BFUA 1A50B 1V9SA 4Z3OA 2B7LA 3EG9B 3B6MA 1P39A 4CUJA 3ZIDA 2JIRA 2OCPA 3HPRA 4EKYA 1PJTA 2QVYX 4PRYA 5I8WA 4DR1B 4E5KA 3CSUA 4P81A 2FWNA 4PCLA 1UBSB 2FU5C 3UMCA 2V7VA 2GOYA 1Z8DA 4RTNA 2X5XA 2O2ZA 1JZQA 2DT5A 4UHBA 5KYWA 4FHFA 4C3OB 1V11A 4QU8A 1YDWA 4JBYA 5CH8A 2G1UA 4GF5A 1M10A 3ONDA 4WN9A 4KXMA 4Q01A 5JRDS 1YKFA 1WULS 3O92A 5JSUA 1GPAA 2PK3A 2CXNA 3A06A 1SD1A 3OQVA 3P20A 4JU9A 1F8FA 4LVOA 1I18A 4PYIA 4QD3A 5KAPA 2I6XA 4MPRA 2MCFA 2R97A 4N5LA 4N48A 1QU3A 1I01A 1C1DB 1LPNA 1VL5A 4IM7A 4ZGWA 4BNUA 3QBTA 1J99A 2ZG6A 2ZRCA 2ZXFA 3C6YA 4BNMA 4KQJA 2D1YA 3BE5A 5ESDA 4E11A 1XQBA 2DPXA 4YAJA 2PH3A 3CZQA 3S44A 2X2EA 2ZT7A 2FW0A 4XVUA 3AOGA 3K5IA 4EL5A 4TWZA 3WFIA 3WIVA 3UBTA 4IDOA 1XNRB 2ZTHA 3RG2A 5FBQB 5JFOA 3Q7SA 4QYTA 1RC8A 3IB3A 2WPDD 4FDUA 2GZMA 4G84A 4W8OA 4GYYA 4F2HA 5ICGA 4Y3UA 5KTPA 2VXOA 3O8NA 3KYDB 4M8IA 1WB6A 3ZJYA 4B3FX 2V55B 2QD1A 3C97A 3AW9A 3Q0IA 3TLGA 3THXB 3B5EA 2GWRA 3GLHB 3IIKA 4HRXA 3RJZA 1V16A 3UZUA 4D9KA 1K97A 3NATA 5CBPB 2Y1DA 2D4HA 2C42A 5HCIA 2Q5EA 2RGYA 2JK1A 1O6BA 1NV8A 3IUJA 4B4DA 2PZFA 3C8UA 4PVDA 4MQ5A 1VI6A 2X9VA 4OL0A 2O19A 1N8KA 3PKJA 2ENUA 5LJLA 1YMUA 1TIBA 1KO5A 3ZWPA 1VL2A 3ETHA 3JTMA 3SIPA 2AR9A 4GL4A 4ALIA 3D3JA 4H35A 3SZOA 2B7BA 1SGWA 2M6SA 3NTRA 3OAAA 9ABPA 1XNGA 3ZDXB 2TSYB 3I3SR 1GZSA 3L01A 3CRNA 3HUTA 1H1LA 3PF9A 3PNPA 5AHKA 5FI1B 2M9MA 2Z9BA 3O2NA 2ERCA 2VLIA 2CJYA 5LLSA 1D6JA 1C7EA 3GN1A 1BDJA 2A3RA 4LUCA 2QT9A 2P1DA 4NYMQ 2VEDA 3HN6A 3Q3VA 5E1DA 4P0PB 1DI0A 3I9MA 2RHDA 2E49A 1XDGA 2NQ8A 4KQMA 4WI1A 3V2GA 1CZOA 4KQ9A 5A1TA 4CCWA 1M74A 2EJBA 1NLUA 3JQBA 3UHAA 4Y6SA 5PNTA 2O8BB 1AUVA 7REQA 1QYDA 3ELBA 2HCJB 4ZIRB 1HSZA 3K8QA 3OE4A 4LDZA 4LS3A 4AY6A 1P7WA 1R74A 1NM5A 3BA6A 2P2ZA 1NWHA 4RUKA 3KVNA 4UUMA 2B6NA 3MHTA 5L53A 1C8VB 1NW4A 1WMEA 5D6NA 1Y81A 2B2XA 5IJ0A 3NHSA 4PFQA 4CL8A 4BFTA 4YREA 3ROXA 4DV7B 1SOMA 2ON6A 4CEIA 3HKCB 1PLKA 4G85A 1YOBA 2P91A 4HYEA 3AETB 4M46A 4RMJA 3QG5A 4F2PA 3FVVA 1BJKA 2I03A 3CX7A 3IILA 2OYCA 3UMVA 4RQBA 1OUMA 1R8JA 4PTZA 4UHDA 2CMKA 2O2XA 5HW0A 4BV8A 1GDTA 2MSCB 1PZGA 1IUKA 2WLSA 3EZNA 3K9NA 5J5VA 1T6YA 1M34A 1QOPB 3CLTC 5L4NA 1MAVA 4DQLA 5J4HA 4O4JA 1U9CA 1ZK2A 5DULA 2FP3A 3O1IC 1X39A 4K86A 4L28A 4C06A 4EG1A 1P75A 4QSHA 3H87A 1F5NA 1FTWA 1BS1A 4KUHA 4BO2A 1VPTA 1X1QA 4QBGB 1X8XA 3VC7A 2BY4A 2BEJA 1XTUA 3S1AB 3C70A 5D85A 3LYUA 4OVKA 1WORA 2ZZKA 1SCUB 4LYJA 1H42A 2H1FA 2Q41A 1JJ2B 1FFXB 5ECWA 1UMCA 3JQ8A 3WLFA 1U99A 3P4XA 3TWOA 1KK0A 1IQUA 1T29A 2B3TA 1P5FA 3HCRA 4X6XA 4QLAA 2AK3A 4DYHA 5FOQA 3QPBA 3CGGA 1F60A 1PFKA 4A10A 3VPDA 5BYAA 4JP1A 1EDBA 3AEZA 5FX2A 4JEIA 1DKNA 4Z86A 2QD2A 4XYGA 4JEUA 3ZDAA 5FO1A 4O3FA 4OH7A 3KLMX 1R9JA 3BB4A 3OT1B 4PHHA 4R2MA 4U3JA 1PKXA 4Q9IA 3FI0A 1W88B 2WTXA 4ZYVA 4HZGA 3AUYA 2KM1A 3DYIA 5AW5A 3PFKA 1CJTC 5E7MA 1ZKMA 1Z0AA 4CI9A 4RGQA 1AQLA 1NXWA 4IIYA 4NPAA 1A8HA 2HMSA 4QGSA 3G71B 1CJCA 2HADA 3UJ7A 4YJFA 3R1IA 2CFIA 4IH9A 2EEZA 2YC4C 3FPEA 1YJBA 4CF4A 1O95A 4NL4H 4IMPA 3T3GA 5CNIA 1OJ7A 1DPGA 2EFJA 3NHUA 3ICEA 4IY1A 3R8XA 2CDNA 3L0IB 4TL7A 3OCJA 2EL7A 1YQTA 4I4TF 4HQOA 4Q3BA 4RKEA 2JFHA 2G67A 1FRVA 5AM2A 1YIAA 4KIUA 4GFDA 1G8GA 1EK1A 3GT0A 5CYOA 3RG8A 4LOLA 2R48A 3ZOKA 5B12A 4H6WA 3QHPA 4G25A 1E1QD 1KQ3A 1OPXA 3NT5A 1HDIA 2MYPA 1QS0B 3NJ4A 3QI7A 1Y3IA 2J9YB 4ZANA 3SNKA 4V1CB 1WDLA 3H17A 1E0DA 4I19A 3RYHB 5CA0B 3TIGA 2CB0A 5DNCA 4PYNA 2WZCA 4OHOA 2EL9A 3B6ZA 3RK4A 1I1NA 3H2JA 2VQEB 1A1VA 1FTNA 1YQQA 1E2UA 3GZ4A 3OA2A 4ZCRA 1ZISA 5A3QA 1IH8A 1ILWA 4COKA 5DBFA 4Z0NA 2FWMX 1SC9A 2HJHA 4DCJA 1RPZA 1Q0UA 3DM9B 3MIZA 1MJ5A 1OAAA 2XMRA 2BTQB 4MHOA 4OFZA 3WHPA 5BO5A 4E2XA 2J31A 4ROXA 4HVCA 3T5CA 5EHIA 2DCMA 4GQAA 3P0IA 3RS4A 1QYCA 3E5RA 1CJMA 3HUEA 2W6JD 3AF5A 4KBGA 3T7DA 1K28D 5E4JA 4HQFA 3VC1A 3K0AA 2P9BA 3WKBA 3OZIA 1J0DA 4X0CA 3Q9UA 3EIOA 3G2QA 3N2NA 3T4XA 1R6TA 4DLAA 4EYEA 1E2BA 1MABB 1Z12A 2YBDA 4G9BA 5DIZA 4JEHA 1C7RA 4BE4A 4N54A 4OQ4A 4K6MA 2BJWA 1NUHA 2ZS9A 5D3QA 5GY7A 1JG6A 1W30A 1TU4A 5KTTA 4C78A 2IL1A 1EK6A 1ZXXA 2GHTA 3U48A 3LUBA 2P62A 1KEEB 5K0SA 3UYLA 5C52B 3AFNA 5BXQC 4OX9B 4ZARA 4C7OB 2LR0A 4OIMA 1T5EA 4BVAA 4F6RA 3WLQA 1M7HA 3OF5A 4DS3A 2C5AA 3R6WA 1OZGA 1KHTA 4MYTA 3ILYA 1TPZA 1VLQA 4KMMA 1LW6E 2GEUA 3M9WA 2W71A 1TAQA 2XEXA 3R3WA 1G6HA 1PJSA 4RSRA 4CKCA 2OZLB 3EHDA 3ZJ4A 3EDYA 4U2FA 1YOVA 2GI4A 3BGOS 1JAYA 3K1YA 4GZ5A 4NFLA 1Z8FA 3GGCA 4I1IA 4C4TA 3SLDA 1P0QA 1NN1A 1ZLXA 1E5LA 1GFIA 1TQHA 1ZUD1 2PS1A 2VP2A 3NAGA 3CF4A 3B2QA 4L0MA 5CLJA 4J94A 4HQ0A 2XZLA 3ELDA 3A70A 3PXGA 4X45A 2YVLA 2R6FA 3I32A 1N8RD 2V5UA 3NVDA 2IZ7A 2QGNA 1KZLA 4NC9A 1XTBA 1WDMA 4QYWA 3SXUB 3CZRA 3KT3A 4BX0A 2AOUB 5CB6A 3KPWA 4KSYA 3BRSA 5DIFA 5FA8A 4PCVA 1XTIA 3A7DA 1ACMA 3FMFA 3SVZA 1UANA 2V6IA 2C4WA 1L7XA 3GGJA 1FFBA 1Y1QA 5JCJA 2WT9A 3I9OA 1HMPA 3LRXA 3OLZA 4YAGA 4ZGGA 4ND7A 2XRMA 1TM3E 3DCNA 3PUNA 2WHYA 2ZROA 2PPLA 4J16C 3RRBA 3U3RA 4TKUB 1T4CB 5JC8A 3BD9A 2XVXA 1CDDA 5DE3A 1I3NA 2SKCA 2W48A 4RABA 4UKDA 2V1UA 1XWFA 2G70A 3K15A 1PT6A 3K70B 3TZLA 4YEDA 4RK0A 3TXYA 3FTDA 4X7RA 1IBMB 2WABA 1RXSA 3RVQA 3IO5A 4CR8A 3AI2A 3K0KA 1I1QB 3QXSA 3B1XA 5L45A 1OXBB 4QV2A 4RS3A 3LQEA 1XKXA 3GDOA 4E7OA 4V1CA 5HJ7A 3T94A 1NULA 1NYTA 1QTIA 2GUGA 3M5WA 4KIWA 4WT7A 2TMYA 4YP9A 4OLHA 4UARA 1LPSA 1L1FA 2ECFA 1AZLA 5KCMA 5T4EA 4OX9Y 4IXTA 2ZRJA 4EUHA 3MHPA 3I5MA 3OPXA 5TQ0A 5B4VA 5FV4A 1OGJA 2V7XA 3MUFA 5JZSA 1MCZA 2Y71A 2ZUTA 2G63A 1RYYA 3IUMA 4PZEA 4C29A 1C3OA 4Y1RB 3AUSA 1DIGA 2QRNA 3FGOA 3JRNA 3SXJA 1KJ9A 2DB3A 4DQKA 3RKUA 1Z16A 1WCYA 2CKDA 2WSSD 4X7PA 3GB9A 2W2LD 4H3VA 4YAKA 2BP7B 4JAVC 1JFVA 1JHXA 1G8MA 1NUSA 4I66A 3UH1A 1FTGA 1T8SA 3TXAA 4UUNA 3FTEA 1X9HA 3DZIA 3DAYA 5EMJA 3EVNA 1GILA 3D3NA 3WV4A 4Z4YA 4LF8B 1ZJZA 4C2TA 3IUPA 3SYMA 1JH9A 4B80A 1E2JA 4DY6A 4BASA 3T3IA 1ZOIA 4GYKA 4JZKA 3UWMA 3DVQX 5EHXA 3AH8A 3IEVA 1TCVA 2HJSA 3X0DA 1WO8A 2OUIA 2BE9A 3X1MA 2FZ5A 5K4AA 2OBRA 3OIWA 1Q11A 5IKXA 1YVRA 2I2BA 2W2VA 1XEXA 3H5OA 4ETIA 1RAEA 1X1AA 2YHBA 1AIPA 2CVHA 3S8YA 3OLWA 3LCCA 3KEGA 4OHZA 2J3HA 4XDGA 2Q4DA 3O3OB 4KPEC 2YV4A 3FCXA 4Z0PA 1WB5A 2QUIA 1PSDA 3U4HA 3LRTA 5EVJA 1CRWG 3KSBC 1S2OA 3NRJA 4CXMA 1GPLA 2WFLA 2YQ4A 3UJBA 4MPTA 5A9RA 5KTMA 1L6IA 5LZ4A 1BHJA 4RZIA 2E4XA 4DADA 4CM8B 5F7ZA 3T06B 1P1HA 1SXHA 3QUQA 4E1AA 1J23A 1RVV1 2R11A 4MRPA 3A4YA 4CKWA 5EEGA 1P7PA 4TMVA 1UM9B 2ZQZA 2B1GA 4R5HA 4YPOA 2VBSA 1OI3A 3K72B 3M5PA 1XU7A 3S1LA 4M83A 4ZYYA 3VA7A 3ZD7A 2HCTA 4G5XA 1L5FA 3JR3A 3AF1A 3BS4A 4IG9A 1E8DA 1N2SA 1ITZA 1D0VA 3HY4A 2DTXA 4G0XA 3KZMA 4OD0A 3ZQ6A 3OZCA 2HD4A 4CDRA 4UQLA 2Z1MA 3Q2OA 5CUQA 4BQFA 1LB1B 1QLHA 3EISA 4DDHA 1CDEA 1A2KC 4N47A 1TC2A 3A28A 3C5WP 3L8YA 3EZ6A 3IVRA 3WLJA 1Z6XA 4RY9A 3STYA 4GH5A 1I7NA 1B6TA 4MWTA 5HS6A 2DQSA 3RHTA 5BOSB 4CL2A 4B2PA 3VR2D 2ONCA 1NB0A 2OO5A 2C1ZA 2Q5JA 2R1ZA 3PBKA 4B81A 1MB2A 5MN4A 4MUIA 1IB6A 3LPAA 4MYRA 1JZTA 3UXYA 2H4ZA 3EFBA 4UTVA 1CF9A 1XRPA 2JW5A 4Q7EA 2B5OA 1ACJA 1E0KA 1H65A 3CVUA 4YJKA 5J3JA 2Q1TA 1L7RA 1AQ6A 1ESNA 2J6HA 3O8RA 4YJDA 4BO5A 1GPNA 4TV8B 3RRNA 4UCXA 5FI3A 4G1BA 4OCZA 1BJTA 5JAZA 2HPVA 2IZ1A 4XARA 2JGKA 4TRRA 1AU9A 2QPOA 3G8AA 5CD9A 1N3IA 2VZEA 1J33A 3I6MA 3USCS 2NMVA 1YZUA 4CIAA 4GLLA 1UR5A 5DHAA 3UOAB 5E6SA 2C2KA 2GZDA 4JENA 3T7JA 3GYGA 4EY7A 1Z5GA 4QLOA 3EHEA 1W2WB 3EPKA 4QOGA 3OMXA 1N2CE 2VYVD 4X1KB 4YV7A 4RY8A 3H9CA 1DUSA 5HKKD 2NPOA 5IBRA 2B1JA 1U2GC 4YS6A 4CPDA 3LHIA 3B20A 4P86A 3ENNA 3UWPA 5KSYA 1T1SA 3DH0A 5I51A 4HDNA 2H85A 2H48A 1IWPB 3LI2A 1LNSA 1FJ2A 4NOJA 4BFYA 1J0AA 1UAGA 3Q9LA 1P33A 3CR3C 3WLKX 3WWZA 1URPA 1MXFA 2O3QA 3S68A 4TXNA 2XWJI 3EH2A 4CMAA 3EVZA 1LC0A 4DSZA 3B6EA 1PK9A 3IBCA 2AT1A 1VIMA 1NJGA 4YHHB 4JJZA 1Q83A 3R0QA 3VHRA 1KRXA 4IHJF 1IZ7A 2XRYA 3M6LA 1G0OA 1XRRA 1Z4OA 2GFIA 3HGQA 3L77A 5K45A 1OBOA 4FFWA 4Y0NA 3ZYZA 5LXTA 4QVJA 3L0CA 5BQXA 3QNWA 5HUJA 1T5SA 1YE5A 2PCJA 3H94A 3HB7A 4C6HA 2Q2WA 2XB8A 1F6DA 5ICCA 5KOHA 5JXJA 2RGNC 2PFGA 4EY6A 4RTLA 1A5AB 2F1LA 2FH5B 3LX5A 4OBEA 4CN9A 1L7OA 1ZD9A 5DMHA 3BMOB 4K03A 4EMBA 2ZRHA 4ZCLA 2BT4A 3DHNA 1WD5A 3L46A 3WGJA 3NC1C 2IUUA 3O2JA 3KZNA 2OXCA 2W4QA 4NYJQ 1M73E 4NZPA 5GIPE 3EGWA 2C61A 2H08A 4FCWA 4GMKA 4KYTA 4EMUA 5B7PA 3GEHA 5KHOC 5J3OA 1RR6A 3X2EA 5HA5A 2Y68A 2REXB 4HRYA 3CZMA 2O54A 3Q8MA 4JLJA 2VSFA 1EFPB 3QTTA 3L06A 3IQWA 5I45A 2O1SA 5F33A 3DEZA 4TKLA 5AESA 1XQVA 2W6IA 4WCFC 5INTA 5F77A 4U63A 3OIFA 1P3JA 2HRCA 3H5VA 4XX0B 1IWOA 4XKWA 2XNDA 4KTVE 4YASA 1UPAA 3IR7A 3SKXA 3H5AA 2ZJ4A 3VO9A 1MEEA 4J1TA 4BWYA 4KBFA 2AG6A 1N0IA 1A5BB 3TQHA 1I6MA 2FG5A 3A1CA 1R66A 4J3JA 4UM7A 5B3KA 2P65A 4C20A 3DOJA 3S99A 4LFBB 3KHKA 3RS9A 3U7RA 2X8WA 3RD5A 1WQ1R 1M6VA 5K9ZA 2PUDA 1Z4LA 1AD2A 2PT7A 1WXXA 4HNHA 1PK7A 1QHXA 4DT1B 5IX8A 2GLXA 2OV8A 3PHGA 3NUQA 4K40A 1MIOA 2C84A 2J59A 4REMA 5EZYA 3P9ZA 1GKUB 1L1RA 1MQ8B 4Y30A 3RBXA 1JDBC 5C8ZA 3D2CA 4CMIB 4QJ3A 2FDXA 3WL6A 5IAJA 2QUKA 1W5TA 3RABA 3KL9A 1VJTA 1WSBA 4L95C 3VPXA 3TQSA 5BURA 4F12A 1F8YA 3I92A 3UTCA 5FBWB 2ECPA 1LI7A 1KETA 2E4ZA 1FJXA 3L7MA 3T35A 1BVHA 3HM2A 1FUYB 3RJ5A 4M60A 3AMVA 5COQA 1Z73A 1U1GA 1XF1A 3B70A 3L4JA 1W0KD 3CUTA 3NM5A 1GFWA 3H9BA 4R9NA 5AK4A 3SXPA 3A9VA 4F2WA 1NM5C 1V4BA 5JSHA 1F2UB 4EY4A 3AEYA 1XQYA 1KWKA 2VUUA 3ESYA 5EJ9A 5EIFA 2FETA 2F17A 1UWVA 3LLCA 3BK2A 3QIVA 3WLRA 4N12A 1PS9A 1S8FA 4A6EA 1RWVA 1W8IA 1RYZA 1BXRA 2PRYA 5F35A 1J42A 1Y7IA 4W63A 1JXOA 1WG8A 3C6BA 3KBOA 5LQUA 5A88A 3X3HA 3RUFA 3LNTA 4K2HA 2FHSA 2E87A 2WMNB 2RHMA 1BMTA 1PLLA 1OU4A 2C4HA 3LKBA 4BFXA 2DTDA 3RIXA 2UUAB 4L0QA 2WIFA 2EOAA 4ZZ0A 1NLMA 2B99A 4HDMB 4O0LA 3E5HA 3UF0A 4BNGA 2OC4A 3OZSA 1NI3A 4UUQA 5GVSA 2PGOA 2QN3A 4HH0A 1UFKA 1KKLA 2WF8A 1YONA 3HI6A 4YO7A 1DG3A 3E1YE 2X76A 4QHSA 5AKLA 3VSAA 3WZLA 2YNMC 5AI8A 3T5MA 3N58A 1G3MA 2WFAA 1MFPA 1OLXA 3TRJA 1LDMA 1IE3A 2POQX 3O9VA 3UA3A 3QBEA 4JX8A 4OJNA 4HLDA 3SGLA 4CEHB 2NAFA 5B2ZA 4QM6A 2RBGA 3U4DA 4D4HA 4M1QA 2PMBA 4EW2A 4Z4RA 4XB1A 3SEZA 1PL0A 2ET6A 2GCIA 2NG1A 3PWZA 1UPCA 1YBAA 3M6AA 5U4XA 4C30A 4HDNB 1HR0B 1TO1E 3VMMA 2FDCA 2B4QA 4KACA 4OEHA 4P54A 4ZN6A 2H17A 1DIOB 2V5VA 5TF0A 1E43A 4WWHA 1XYYA 5HMLA 1IPFA 3AHDA 2HMYB 2WU4A 4WXMA 5FUMA 1PGQA 2XTNA 3LBAA 4PFSA 1BXZA 4YCDA 1OH8A 1ZNYA 1CUUA 2JKVA 2GN1A 3H42B 3ACBA 2BGLA 1Q7GA 4JLBA 4I3HA 1KRHA 1V96A 3ENQA 3KU1A 3JSXA 1IN7A 4LDAA 4OL9A 4RVCA 5HDBB 4QHYA 2O2IA 2FCRA 3AUXA 2BTOA 2WNHA 4RJTA 5KQGA 2PY6A 2QN2A 4DM3A 4RA9B 4F3NA 4KRGA 1AN0A 1PW7A 5FP0A 2HA4A 3F49S 4N5MA 2RJNA 3ND8A 1EFAA 1Y8ZA 1YS7A 2WJZB 4LVNA 1CG6A 1YIOA 4Z3DA 5JS2A 2AJ8A 4DIMA 1N6LA 1JI3A 1N75A 2X2FA 2I1LA 3I56B 3AVUA 1OJLA 3CR8A 3EEFA 3M6FA 3SKYA 3DKVA 1G8AA 2F1HA 4M9SA 3FTNA 3IVCA 3JAWB 1TQ8A 2A88A 3SYRA 1E3XA 4HH4A 4HMPA 4U7FA 4UEJA 2QVBA 1E58A 2R66A 4TSRA 3LWDA 2J48A 2CT8A 5EMNA 1SBZA 4MI3A 2I6GA 2IIBA 3U4IA 2W6PA 3MAAC 1I4TD 1FFAA 3P2YA 3JWIA 4AM8A 1M0TA 4ZGQB 2VA9A 1OAOC 1JBKA 5GAJA 4H6XA 1SIBE 1SBHA 2NTJA 1XZBA 2E4UA 3MRSA 3WDMA 2YYZA 1D8AA 1ZZEA 3MPOA 2ZZQA 4D5EA 2R6GA 2RB5A 4AUNA 5I7RA 2FWAA 1DJMA 4PAAA 4MQLA 3FPPA 1XL0A 1QNLA 4WRRA 2COEA 2I7CA 4R9UC 4JI6B 4RIGA 1A7AA 2OAGA 3ADOA 1WXEA 2GQFA 1YZFA 4LBVA 2EQAA 1PV2A 2C3YA 1XQ6A 2WD7B 3QYFA 3SJ7A 3QY9A 1ZGZA 1LBHA 1U4OA 1C14A 3GJ4A 4EHKA 5J2UF 4Q1EA 4PABA 1PZNA 2O5VA 4G01B 4L27A 3PD1A 5BPHA 2EDAA 3RQIA 3HCCA 2C2XA 3AEUA 3GOHA 4IZIA 4UPDA 3ZCTA 4OLAA 1H2FA 2JVIA 1BDMA 2V74B 2WJAA 1PR6A 2FSVC 3PQ4A 3V33A 3MS2A 3VPSA 2BC9A 3G1WA 3TF5A 1I6WA 2UVPB 2JJ1D 1SC1A 5AW1A 2H07A 2VPXA 3D8BA 5E4FA 3A4IA 1QFMA 1PQYA 4P0QB 1U8FO 3K0CA 1PGPA 4GI1A 4WKOA 2OCDA 2D1QA 4LJYA 1IRXA 3NDJA 1EVYA 4J0EA 4RKWA 3KVOA 4IDQA 1XTTA 5BRAA 3U4GA 1QP0A 4GKVA 4U8HA 4KN6A 2HWXA 3GJ8A 4X8MA 3TVTA 2G8NA 1KMHA 1IFXA 4UUAA 2VNHA 2YWEA 2Q1SA 1UDXA 1G20A 1AO3A 3G88A 3NHRA 4OOEA 3A2KA 1J6UA 1Y7HA 1KFBB 3D8TA 3FROA 4QULA 5AJVB 3AYZB 4EA9A 4U39A 1AF4A 4XLEA 1POWA 4BNDB 3O94A 4TOIA 5LOVF 2XYPA 5JWRA 3LUGA 4O2BF 1XSEA 2D6FA 4Q39A 1IATA 3P52A 4RM0A 1SXJC 1MA0A 3P9SA 4AG6A 4CMBA 3GIDA 4J1TC 2D1TA 5ES4B 3HYCA 3OEHA 4NJEA 1NVVQ 4L8FA 4P4GA 1P81A 2EJVA 1NU6A 3OLXA 5SZHB 1YI2B 3NV7A 3DZCA 2EFGA 5D7NA 4E21A 4ER6A 4EW3A 5KHLB 3DHVA 3GLFA 2NXCA 1GPKA 4XIGS 5ICSA 4GRDA 2I91A 4H1WA 3ROEA 2CCGA 1NXVA 4YRCA 4EFNA 2Y1OA 5AK0A 5KDLA 3JYPA 1LSUA 1Q1AA 2R6DA 1OY1A 3F90A 3EZFA 5BQ3A 1JSZA 1JHAA 1SKQA 3QPUA 1H2AS 3MINA 4JXJA 5FBVB 5CB0A 1R6BX 2O8VA 4OOVA 1DINA 4MS3A 1MHPA 3A58B 4P4UA 5KUTA 4B31A 1AGYA 3TLKA 2XBLA 1IUNA 4HV4A 4HWSA 4M76B 2BEUB 1FP6A 1Q44A 4OQFA 4FB4A 1E9AA 2JS7A 1R0BA 3W5IA 3G6EB 1FUKA 5A89A 1WEKA 2DX7A 3AYXB 4AG5A 1EXWA 4HPWA 5HF6A 1Y4AE 1G3QA 4FFDA 2WAYA 4E33A 4G1MB 4M99A 3JQPA 3R7AA 3F67A 1YZVA 2DWUA 1RYNA 3ABRB 4YFYA 4UJ3A 3ZK8A 1Y3CE 5KU1A 3LGSA 4L5YA 4UMEA 1Q15A 1W73A 3WBJA 1Y1LA 4IQFA 1RP7A 2CVQA 2D2VA 3E9MA 3EF0A 4IIEA 4FW9A 3RAFC 1Q81D 4HWTA 2AOVA 3B6KA 2BAGA 5DN6A 3PFWO 1P1RA 2WJPA 1H22A 5G02A 4EG0A 2F43B 4GKBA 3QFRA 2CXPA 2A94A 2AS0A 4FBMA 3R5HA 1KSGA 2W8BB 1NB9A 1AUOA 3NX4A 3P26A 4CF6A 3N3BC 2ZTMA 2I4OA 4NRDA 4PQEA 2HF2A 5L95A 3RFUA 1RI4A 2GF9A 2GPAA 3Q10A 1GG5A 3R09A 1VQMB 3TW8B 5C4GB 1SUIA 2F1MA 2BSXA 3LP5A 4I14A 3LQYA 4I2VA 4IIUA 4CFSA 2OLKA 4CKBB 3MGKA 3LCVB 1HDCA 3BAFA 3FY4A 3HSSA 3GCXA 1ECGA 3SD7A 4OP7A 3A0RB 1U7ZA 3D4PA 4R6XA 5BSFA 8ADHA 3G49A 4E4RA 1Q3KA 2ZRIA 3CH6A 2Q2QA 3AJEA 4OGWA 4I1VA 1ECCA 3S8MA 2WWRA 1QV6A 1YOVB 2O7SA 2ZR0A 4RF2A 4C5BA 3UB4A 4XCXA 4G5OA 1YT5A 1KZYC 4D9EA 3F0TA 4O2BB 1TJ4A 3MBOA 1U9JA 3UOWA 1L2TA 1KAEA 2ZZFA 3NETA 4TMTA 4JEMA 1ENZA 2C4UA 1C4XA 1D5CA 1JNXX 2QVZX 4C4OA 1ILEA 2QT1A 5F9HA 1H9AA 5JEEA 2NO0A 2W0MA 3WIOA 1NZDA 4FUTA 2Y66A 2C9OA 1G20B 1I2ZA 1HNZB 4B6QA 4FIDA 3IBSA 1CB7A 1OGIA 4BCCA 2ADMA 2CNLA 3ZCPA 2QTTA 1ETHA 4Y9TA 2A9JA 4BVFA 5A7GA 2QQ0A 1KWGA 1TVKB 1DCKA 2HDWA 3ROPA 1FW6A 3AIMA 1CUDA 2FN4A 3CUUA 1DE0A 3BH6A 1WABA 3NWPA 3UCXA 3N07A 1VQ5B 1EFKA 2G4LA 2HMVA 3RVMA 4JDPA 1KI7A 3IAFA 1I4DD 2GPNA 1ADBA 3GRKA 3WBBA 3I8OA 3WP1B 4X7CA 2E21A 1UKYA 3K8YA 1GUZA 5H80A 2IP2A 4WERA 2X0FA 5FOWA 5IDYA 3TW6A 2QA4B 2CLDX 5E8RA 1LVHA 4R2WA 1QP8A 1CUJA 2EATA 1J8FA 2QIOA 2RCYA 4OXYA 4Y6PA 3STWA 2BI8A 1T36A 3ZGYA 3FZGA 3U44A 1O94D 4NEHB 5EINA 1OFTA 2AX4A 1XU4A 1DCFA 2PUFA 3TH5A 1KMCA 4XLHA 4EHHA 3ENWA 1TYBE 1EXVA 1MGOA 5KVVA 2HM7A 3FTQA 4X3CA 3G9QA 4OO3A 5EE3A 4BP3A 1R5NA 5AW2A 2J08A 4GOOD 2W70A 5CM8B 1DMSA 3PUJA 1TT5A 4BRSA 1WBDA 1XELA 5LIRA 2GRUA 3EIHA 5LDDC 3KQUA 1GGJA 5DLPA 1SEVA 4BLUA 5IHXA 1LQUA 1V37A 4F5DA 1TJYA 1D2GA 1HZJA 4AJEA 1Q92A 4I8XA 5KNLA 2IKSA 2PGIA 3KB8A 1VG1A 4BE9A 3SOPA 1N3BA 3FZQA 5CX1A 1LRLA 2ROQA 3PITA 1DRWA 2ZXIA 1SK8A 2X8LA 5F5LA 4DABA 3WQRA 4ARAA 1GTL1 4B3IA 1EU1A 3ASVA 2XUHA 1UDCA 4Z3KA 3IH5A 4GX2A 3VVBA 5KSWB 3H4TA 4EHLA 1LBQA 4FGWA 3TZHA 1SG9A 3FNBA 3HZOA 4EG4A 3KPVA 1UP4A 1QG4A 1ZIXA 1KYWA 1MB0A 1NTOA 2WLTA 3A31A 1GV0A 2GO1A 3KKEA 4FXOA 4JB3A 4JR0A 1DKUA 4YV2A 5I7VA 3FBGA 1IQRA 1CJBA 3FD8A 4DNPA 3FPLA 5AKYA 2XXAB 2QZSA 2C5HA 3PQ3A 4ERNA 5JU6A 1E8NA 1A76A 3F4LA 3GRCA 4IGFA 5LQDA 4Q9KA 4A3SA 3LHSA 3KVVA 4WKPA 3V5NA 3UC5A 5CCBA 2I9KA 2X4LA 2VJMB 4TSKA 5ALXA 2GERA 5FPYA 5A7HA 4BEJA 4C6TB 2QKYA 5F23A 4QKQA 1T3TA 5GM1A 1ZM3A 1GPUA 3AOEC 3OE7A 3G2IA 5LA6B 2FOXA 4YP6A 3RU3A 3WK8A 4ES6A 2RI6A 5KX5B 4JR2A 3TRDA 4LBYA 2XRFA 3LL7A 1N5DA 4MQEB 3H1FA 3UNXA 1WRBA 1H94A 2WVHA 1L7MA 4HZUA 3TIFA 5DNVA 4Z4CA 4KIJA 4PHGA 1UD4A 4Q7MB 4GLOA 2JKYA 4CG1A 3V1TC 4E0BA 3D0RA 2D74A 5A3RA 4BX8A 5CPFA 1WB9A 4BGDA 4JMLA 4QQKA 4X3PA 4YRBA 5M5BA 2HSWA 4KR0A 3JZFA 3ZCRA 3AHHA 5EP2A 1N8TA 1WKBA 3FCCA 4ZC8A 2DPYA 5KINB 1NW5A 4NKRA 2YIDA 1F9EA 3I0NA 3BK7A 4XGRA 1D04A 4J0FA 4MKIA 4EQ6A 1VYUA 1SKYB 3CEJA 5BXYA 1S2GA 3PC8C 4CLOA 1GFZA 3U7EB 3WQBA 2BGUA 4QPJC 2O7NA 4F7DA 3ETLA 1IZ8A 3H83A 1TKAA 2FYTA 5IK2A 1BWPA 2J1LA 1VSVA 2J3MA 3P4YA 3ZX4A 3R6JA 2ZSAA 3DTVD 2CL6X 2J09A 4XDYA 1RHMA 3H99A 5TRTA 2OXIA 1VCHA 4DV2B 5HCNA 1VCOA 2E6KA 2PR7A 1ZVJA 1A3CA 4Y6QA 3K6JA 2W2MA 1U7WA 3A6HA 3N0WA 4ZVVA 2VRCA 3AUKA 4MS1A 2PGNA 1WNFA 2FFQA 2ZU6A 4RE6A 3O5AA 4D6PA 2BH9A 1XVUA 4R1OA 3SPXA 2O5CA 2JAWA 3QWIA 4K2AA 4E51A 4EAQA 2JZNA 2VPZA 3TVYA 3GUVA 2CFTA 1VQKB 3DQQA 4IGKA 5P8WA 1KDZA 4BWGA 2PWZA 4FX2A 2FEMA 3JYLA 4CDGA 3KSRA 3IRUA 5KVSA 1G5RA 3FUTA 1R0LA 5EWLB 2AEMA 4L72A 4DAOA 1SZDA 4YXWA 1YK1A 2MTBA 1GNRA 5D7BA 5H82A 3VZQA 4EHFA 2JGDB 4XYMA 4F04A 1QKIA 1JG3A 1EFLA 1H0HA 1RXEA 3K92A 1NVXQ 4X1YA 2OQVA 2XA1A 1Z06A 3IUEA 3O82A 4PZ0A 2D2EA 1XKTA 3OA0A 4X24A 2YWRA 3KIPA 4KZKA 5F3RA 2BFEB 4MICA 3LKDA 3UATA 1RHUA 3STVA 1NQUA 2CE7A 1QH8B 2UZAA 1FFWA 4X6YA 4XWGA 4R83A 1CUCA 3GJ3A 2Y9MB 2IBTA 1IC6A 2E6UX 1YNSA 3D54D 3O1LA 2AQKA 1BVRA 2FFAA 4ASUA 2ZEJA 4P58A 3ELUA 1Z36A 3BKXA 3ZV6A 3X1ZA 5A4MS 4H7KA 4G1EB 1VKHA 2WUEA 1DRKA 1W44A 2XZOA 4LGYA 5G0VA 4YRSA 1FFEA 4HUJA 1LY1A 2X42A 1O8BA 2ZIXA 3EB9A 4NDZA 3RJMA 4QIHA 1Q12A 4OJKA 3HBFA 1LBSA 2WMYA 1I7QB 1RABA 1XDBA 1Z83A 2BBOA 2HU2A 4UVIA 2BTEA 2CLOB 1ZDMA 3C5VA 4PZDA 4C3VA 4QE3A 1YDEA 3TCKA 2CMHA 5U1PA 4NBLA 4K6OA 1FXUA 1OLSA 4P35A 1N06A 1EEHA 3RFTA 4ZOQI 1RIFA 1QH1A 1A04A 1RQLA 3HMKA 2BD0A 1RWQA 3JU3A 3LZ6A 1T34A 4MA0A 2BW0A 2BMVA 2OCXA 2WNSA 4MNTA 3U0BA 3L9WA 3BIWA 5B30A 2QZZA 2DFKB 1FDWA 4WIAA 1DRVA 2ZSDA 4MCAA 4R84A 3UTDA 3WGKA 5AIAA 4JCOA 1N9GA 3OY7A 4JQCA 2GPYA 4OPOA 4MARA 5ITVA 3OZ7A 1DWOA 4GZLA 3D6HA 5ADHA 3S7TA 5CFOA 1E9DA 1M72A 4RD2A 1KOLA 4GDFA 5JSYA 3EYWA 1U3UA 3OHSX 3WSWA 3INGA 5EWMB 3R3ZA 4Z2YA 1QZZA 2GKOA 3FPGA 1CWUA 2BFEA 3GLQA 5D86A 1M7GA 3E2IA 1S5PA 2GHIA 2ONZA 3GHHA 1JLHA 4JJEA 4MP3A 4NEQA 5FFNA 5FWXA 3L84A 1J5PA 2PGLA 3BE8A 4PAMA 3T1TA 4EY3A 1S8OA 2X0NA 4J76A 2ID8A 3T1VA 3A6KA 4NK4A 2IXTA 3RJTA 4Z1MD 2VK1A 5JALA 2RK4A 5A3SA 2GD6A 5F12A 4FOTA 5E4YA 2FPKA 5M34A 2O8CA 3GHYA 5DXFA 1KU0A 1UWCA 3TE6A 5FTWA 4BQSA 3PTLA 2FWBA 4TTJA 4ZJUA 5IJ0B 4FINA 4F9GA 3ASTA 1M0WA 4GI5A 2P4SA 1ZMBA 4GPTA 2JAOA 2O4UX 2G06A 4BTEA 1P3Y1 3EF3A 3UMGA 4OATA 1O5OA 4LJ8A 4I5IA 4QBKA 4DCSA 4KXVA 1U3GA 4G41A 5HK8A 3PP8A 2C98A 4QVIA 5DRYA 3R20A 4LV5B 2NLOA 1BMDA 3I2JA 4DR2B 4BX2A 1E89A 4KWCA 3V9AA 3SSOA 3UGTA 4RENA 3WNBA 2HJVA 1QWOA 3E4DA 1Y4DE 3HVJA 3IGFA 3PNMA 2G71A 4IOMA 3I52A 1D07A 1IQPA 3FPKA 1K66A 1NUQA 1Z37A 3CV3A 3QF7A 4KLZA 5BMVF 5JS7A 3P2KA 4DNRB 3U7QA 3PXXA 3INRA 5KYGA 2CV2A 2CNWD 1P29A 3JZMA 3KAPA 5KTRA 2F67A 2QTAA 3ASYA 1R0WA 1TT7A 2ZIEA 2R96A 3PUZA 3LNNA 2C7VA 1ZLYA 4DMMA 5BR4A 5HYVA 4PG6A 1K08A 4B76A 3JWHA 3ZW8A 2CKMA 2WJGA 2WKSA 5KTYA 3WLMA 1XVTA 3F78A 2CZCA 4JKIA 5C1DA 2KSQA 5BPFA 2FUKA 2H7VA 1FNMA 1UOQA 1WZNA 2GNOA 4D8VA 1QQ6A 3FB1A 5K1ZA 2J6IA 3QLTA 5JSZA 3NBMA 4TN1A 1G3IA 2P6UA 1FVXA 3I37X 4LZNA 5JTTA 3C3AA 1U8UA 1EVJA 1LTHR 1JEEA 3NIDB 4UZUA 5U4QA 3RHSA 1VCMA 3WYGA 3FUWA 1W0CA 4BQOA 3LTEA 5NLLA 1T3GA 4DCCA 5I4BA 2QZJA 3LXRA 1N5OX 3V7FA 1C29B 4I50F 1PUJA 3S3TA 4BZZA 4EI9A 4EPTA 2ZM5A 1OWOA 3GARA 3MYRA 4M0KA 2QF7A 3SOZA 3DLHA 4YMLA 3OC6A 1JDTA 5C4IA 3DJYA 4O4JB 1FUIA 3LE8A 1CRPA 3UMYA 3BULA 4YFVA 2FEKA 3DO5A 5HRUA 4FR0A 1BCSA 2M1XA 3FNGA 4FYKA 1NOIA 3BXPA 4LWZA 2REQB 2OXRA 3E9QA 2E55A 2BEVA 3ROFA 3RRYA 2I2AA 4Z9XA 1CPYA 3PI7A 2CLSA 1MH9A 2OBSA 1ZI8A 4WA8A 4XM1A 3L04A 5ESRA 4DLBA 3EAFA 1EAMA 1O08A 1SA0A 1XE3A 2J9FB 4X7EA 1W46A 2WD8A 2ZI9A 4Q1DA 5FHRA 5BN1A 1AKUA 3V1MA 5CXXA 5IJAA 5J9FA 2DULA 4XJTA 1JSLA 2DG2A 4YRPA 3ZU6A 2XOKD 1QTQA 4ARVA 1G4AE 1DAMA 2QE7D 2G7MC 3W5HA 4JUAA 3TEMA 4BP8A 3I12A 4BN4A 3T7EA 4ZVTA 1VPEA 4IF6A 2I1QA 1A7JA 1V43A 5DZSA 3CVWA 1EE9A 4YDRA 4IH4A 4F5WA 3I28A 4Q4JB 5K0LA 1EFCA 1WUJS 5IKMA 1JFTA 1F7VA 4IDEA 5K20A 5TS3A 2KJQA 5TR9A 3NC4A 1RVDA 3F3MA 5EXXA 1KE2A 1SCNE 1U5AA 4HI0E 4PZPA 4WFIA 3G0BA 2V7EA 3TS1A 2W8ZA 1E9VA 3CLVA 3V2IA 4KH1A 5BN3A 3I30X 3H2KA 5KJ6A 1SXJA 1ZH8A 4MQUA 4I4CA 1LPBB 3FKJA 4DUZB 5IYNA 3FRIA 3FYHA 4F3KA 4LI0A 3UMBA 3A8IA 1TK3A 2QK4A 4NONA 1S1CA 3B1KA 3JALA 3ZE2B 4Z7QB 4CMIA 2V7QA 3RW9A 2C4VA 3SM3A 1GU0A 4IHQA 3KT8A 1IIRA 5I7UA 2PH1A 2IV2X 1DCTA 5K3EA 1VJRA 5EJ2A 2AXPA 1CJUC 1GCUA 2CMDA 2DSNA 2ODEA 3B5JA 2JANA 3BORA 4QTXA 4O2AA 1Y9AA 5A9SB 1I5OA 5LMZA 2A1UA 3AX6A 3THWA 3I1JA 3QPAA 5BUSA 2XTAA 3VNSA 1ZA2A 3L6UA 1KY5A 1FL9A 1PJCA 4MROA 3RVJA 1TEHA 2AQHA 4DUPA 3Q40A 1ARZA 1Y7LA 4LRSB 4P3KA 3C3DA 4N0PA 3WJ2A 3ZHZA 4CM9A 2YFQA 5B3LA 4PC2A 1L4HA 4REQA 3SEAA 1V3QE 5DK6A 3ZZUA 1PJLA 3ROGA 4D41A 2GEKA 3T5TA 4JYCA 1TZCA 5FWYA 4Q82A 4EI7A 3EXIB 5FADA 4ZV4A 2VTBA 3AUFA 3SC6A 4H4CA 4ZQGA 4GXNA 1U7HA 1L7EA 1LLDA 4W9MC 5KJEA 1Z13A 4LJAA 4BNHA 5C8XA 4B3SB 3OQJA 1B0PA 2FK7A 3C3CA 4FN4A 3CU5A 2PD6A 1YRLA 3U4QA 5HGXA 2G80A 3K9BA 3W6OA 3IC5A 4XIIA 3IPAA 1B0UA 2IYLD 1I7SB 2GCOA 2C9CA 3PHCA 3ZVMA 1V71A 3EARA 4O4HB 2FQWA 4TTQA 3GYBA 4BC1A 1GLNA 2J3JA 4HDSB 4DMHA 4DMRA 2IH2A 2GZSA 3BXGA 3G7SA 4TLLB 1B42A 4N9QA 2FP4A 4UOQA 4AKHA 3WBKA 1XZMA 1H2EA 1RI1A 2ZJ7A 2COKA 5SZIA 2VTDA 3ETCA 3RTDA 1Y9JA 4PFKA 2O06A 4WK6A 4AU1A 3UK1A 3NASA 3H8SA 3OPYB 3W8EA 4DILA 5FPSA 3IKTA 3D9QX 3TLCA 3ZI4A 3LECA 3WIEA 2FMXA 4XGNA 2LE0A 3MIIA 1SCKA 5DK4A 1RM3A 2DUUA 1MFZA 1KIAA 1PNVA 2I7XA 1U04A 2FP4B 4LOJA 4RLSA 2XODA 4XL9A 1JN0A 1RJ9A 3AVPA 4ROSA 4EZIA 4H7JA 2AZMA 2IGTA 3AI7A 4NS4A 2I66A 3BY1A 2IPLA 1UZNA 1HURA 1NW7A 2W43A 4A1FA 4L5BA 2RGXA 2V6MA 4LTMA 4MYUA 4MRVA 3KFLA 5FUYA 2ONJA 2C8KA 2AW5A 2Z2KA 2G17A 3MJEA 2VT6A 4BQRA 1Q14A 2X9LA 3KXDA 4FU0A 4KH0A 4CEJB 3HBJA 4L8WB 4DWWA 2GCNA 2ZB7A 2PPVA 3TD2A 4J9VA 2C57A 1BW9B 4EW6A 3LDFA 2F3PA 3BY2A 4B47A 3F1LA 1M8GA 3O3MB 5ALNA 3THOA 3QU5A 4I1UA 1KJ8A 1P9NA 1SWWA 3AF4A 2HL6A 1VQ7B 3MELA 1W0JA 3V8NA 3WLNA 2QBYA 1JE1A 2PE5A 1Z4IA 4EDFA 1T5HX 4ALLA 4UXJA 1QMGA 2B8WA 3VNRA 5DM2A 1D4AA 3C74A 3KLOA 2R5FA 2VYQA 2CWDA 2ZI4A 3ORHA 3VR5A 4WMLA 1UK6A 3AERB 3N5KA 3NT4A 3OKFA 3DZJA 3PDUA 1IBRA 3LBYA 3EE6A 3EUEA 2BFMA 1K9MD 4RGBA 4R01A 5FPQA 2A0UA 3TMKA 4F4CA 2A2ZA 1ZEMA 3ZEAA 2GA9A 2IHVA 3GXBA 3OMWA 1UPFA 3DMNA 2I7TA 3DL7A 4FGKA 4GGPA 3RUAA 1JEYB 5HF9A 4G81A 3LP6A 5KSPA 1KFCB 4QEZA 2ZETA 3HKBA 2Q7OE 3WKCA 1R5OA 3AU8A 3P19A 2BKEA 4OQPA 2AQ8A 3ND7A 4FDLA 4KNWA 1M1ZA 3ES9A 4G26A 1F8GA 4YCJA 5K8CA 4LEIA 4W9RA 2WHPA 1L5ZA 4ZEOA 5KHAA 3K4HA 4UAGA 3UJ8A 3OZDA 3R5XA 2WFZA 1X0XA 2VYND 3FCYA 4WGFA 3ZZNA 3V7YA 1HNNA 1KFEB 2CV0A 5IN4A 1K8AD 3F71A 4D02A 2GK4A 2PUAA 2F8TA 1PJ8A 2J30A 4AZWA 4EG7A 4QNMA 3KHTA 1YS6A 4PC7A 2ZRKA 3K05A 3T3NA 4MVJE 3PHLA 3IDFA 3FR8A 1JP7A 3GC6A 4N65A 3UMSA 4FOSA 4Z4TA 1F17A 2DUWA 3IUQA 1XCMA 2PYIA 2ANCA 1II8A 2UAGA 3R77A 3ZD8A 2WQ6A 4DXDA 4ENUA 2OFWA 2RARA 4NQZA 4ZOEA 3LO8A 4V0NA 4E4YA 2VHXA 3WYCA 3KO8A 3FBTA 2QM0A 3H6HA 4QYIA 7ADHA 3CC4B 2PKRA 4JJ4A 4HEA1 1RZRA 1FEZA 4W7IA 2FB9A 3A0UA 3K0FA 5K6AC 5HBRA 5J2UA 2Q28A 1E32A 4FFPA 3WIDA 5K4GA 3AM5A 4R3NA 2QTBA 1UADA 3DULA 3TYXA 1XEXB 4OGGA 3ILHA 4UNNA 4OMFG 4FD2A 3UUFA 4JYZA 3D6NB 1MD9A 2ZT5A 2OO3A 3HO1A 2J7PA 3ZY3A 1SULA 3PICA 1H8HD 2BKXA 1EXNA 1BMFA 4NG4A 3D3WA 2NTVA 3NPMA 1SBCA 4RCVA 1DEXA 3BWYA 4KQIA 2QUBA 1EM8B 4IQGA 3WDLA 2X8KA 1WPQA 3SFTA 5AVZA