4F7DA

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
246
Chain Sequence
b'SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 76
structure length 246
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4f7dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4f7dA02
1VQMB 3ES9A 4J0QA 1QFZA 1EWYA 2BSAA 3I56B 1QUFA 3OZVA 4TMXA 3J81k 1QGAA 4B4DA 1EFTA 3LRXA 2QMUA 2C78A 3CRZA 5THXA 2DY1A 4PC1A 4PC3A 4G1VA 4YAOA 1IJEA 1JJ2B 1ZM3A 4ZCMA 4FWTA 3VO2A 1AIPA 3WBJA 3QFCA 3CCJB 4AC9A 1VQLB 1OB5A 2VYQA 1KTVA 1N8RD 1OGIA 4YAUA 2YWGA 3CCQB 4DQKA 2EIXA 1R5BA 2YWEA 3QSYA 4B47A 3CMAB 4MYTA 4FK8A 1QFJA 4G5GA 3OZWA 4RD6A 4RD4A 1UMKA 1JA0A 4P6VF 1VQPB 1M1KD 3U2QA 4N3GA 4RD2A 1VQNB 3A1FA 2J7KA 2E1RA 2OTLB 1TTTA 1J9ZA 1JNYA 2XNCA 1K73D 1FRNA 3VMFA 3ZBUA 4QFMA 3WNBA 1KQSB 1KK2A 3WYAA 1EXMA 2FX3A 2PMDA 2B7CA 1BX1A 1GJRA 2R6HA 1ELOA 3ZBTA 4R71A 1TLLA 2XEXA 4RJLA 2BMWA 1VQ7B 1KK3A 1Q82D 2B5OA 1IJFA 4YALA 2QTZA 2QA4B 1ZUNB 4RD3A 2YWFA 3QFTA 2DERA 3G71B 3FPKA 1K8AD 1NDHA 3P27A 1VQOB 3B8HA 3OW2B 2VNIA 1TVCA 2BN4A 2OK7A 2PLFA 2XNJA 4YAWA 1GAQA 2DETA 1CNEA 4LBWA 4B3XA 2VZLA 1G7RA 3ZZUA 2DEUA 1KD1D 5DSZA 3G6EB 1D2EA 3QE2A 1I7PA 1F60A 3CB4A 2BVNA 4K1XA 3JQQA 1Q86D 4HE6A 3AVUA 5H59A 1KRHA 3JQPA 4ZGQB 3OJWA 2QN6A 4C43A 4TMWA 3PENA 3CMEB 4ACAA 4RCYA 4Y7CA 4MYUA 3AGPA 4M0LA 3WBKA 2VNJA 2OK8A 1GAWA 4IW3B 3AGQA 2PIAA 1VQ4B 1VQ6B 4N3NA 1EP2B 1FNMA 2EFGA 2OTJB 1W87A 3CCLB 3WY9A 3AVYA 2X3UA 4DQLA 4BPRA 3LYUA 4ZV4A 4ACBA 5TV2A 1DDIA 1N0VC 4RD0A 4ZCLA 3V76A 1CQXA 3OZUA 2BM0A 1QGZA 3CC4B 1WDTA 3E1YE 3AVTA 1QG0A 1FRQA 2CRVA 4UAJA 1GR1A 1W35A 4H9GA 2B7BA 3VO1A 1IB0A 1DDGA 1FNDA 3P26A 4B43A 3CCSB 4WQMA 3W2EA 3CPWB 3AVWA 1B23P 2D74A 4U9UA 5EMNA 3W2FA 3CCMB 4Y9RA 3B82A 4RCZA 3CC2B 1EP1B 3CCEB 3U6BA 4TMZA 1DARA 1EP3B 2BGIA 2BGJA 3WNDA 1H85A 1OB2A 1G7SA 3VNUA 3MMPA 1OGJA 1XB2A 1ZM9A 1D1NA 3CCRB 3MHPA 2BV3A 3OJXA 1QGYA 1KJZA 2RC6A 3W2HA 1QFYA 5GV7A 3CCVB 4B44A 5AN9A 1M90D 1G7CA 1W2BB 3LO8A 4G1BA 2ZITA 4PC2A 1ZM2A 2BM1A 5H5JA 1B2RA 1QVFB 4AF6A 4PC6A 5TY0A 3I55B 1BQEA 3CXCB 1AMOA 1Q81D 4TN1A 1Q7YD 4QHYA 4TMVA 1YIJB 2CNDA 4M1KA 1EFUA 3LVBA 2BF4A 4M2LA 3W2GA 4F7DA 4AF7A 1QH0A 1FNBA 3W5UA 4RD1A 1H42A 3CC7B 1VQ9B 1E62A 3FJOA 4P3YA 1QUEA 2DCUA 1GO2A 4Y9UA 4LBZA 1DG1G 1FNCA 1R5NA 4PGOA 3G4SB 1SKQA 3I1FA 4ZGNB 1JB9A 2QEXB 1QX4A 3WXMA 2YWHA 3MCAA 4LBVA 3JQRA 1FDRA 4FN5A 4YHBA 3AVVA 1SM4A 1NJID 3U6KA 1VQKB 2GQFA 2RC5A 2HMAA 2QTLA 1YHQB 4LC0A 4B48A 3AVXA 4ZCIA 3WNCA 1BJKA 1YJNB 1EFCA 3B78A 1E64A 1YJ9B 5KSWB 5GV8A 1TUIA 4HE5A 3SJZA 1R5OA 2NPFA 2VNHA 1YJWB 1BX0A 3QFRA 3QFSA 1N0UA 3CD6B 3VNVA 1E63A 4M4SA 3CCUB 3ZZ0A 2QDXA 1U2RA 1GVHA 3E20A 4Q7JB 1S72B 2C77A 4NBSA 3W5HA 1F20A 1K9MD 4YAFA 1CNFA 3CW2A 1S0UA 2HDNB 2HCJB 2AHOA 1HA3A 1VQ8B 5HXBA 4M53A 1KC8D 1YI2B 5TR9A 3W5VA 4EH1A 3ZC3A 4PC7A 1JA1A 3W2IA 4C0SA 1YITB 1ZM4A 1W34A 3ZZTA 5JBQA 1QVGB 1KK1A 1A8PA 4NCNA 1G7TA 1D8TA 2GPJA 4LBYA 5FA6A 4TMTA 1VQ5B 2BPOA 1XE1A 1KK0A 2VNKA
chains in the Genus database with same CATH superfamily
4FXPA 2C3UA 1A9ZA 2JAPA 3INGA 2LCFA 3V9AA 3EWSA 1QVRA 4GVLA 3NUQA 5EJAA 3ETCA 2PX8A 2IYZA 4HDOB 4JT8A 2HU2A 1VL8A 4X24A 3IB6A 2GPAA 4JYBA 5AHRA 5FFNA 2BEVB 5D2CA 4ZVUA 1W30A 5ULLA 3GX1A 2CC2A 3PUIA 4US1R 3U48A 3BMCA 1MAAA 3NBFA 4WBSA 4LVUA 4EHAA 1N9GA 4MJ7A 4NH4A 2JGDB 3U09A 1R2QA 1LB1B 2WYOA 1L4NA 3M5CA 2FN4A 1DAHA 2J3KA 4NFYA 4NDAA 1BU5A 2YV2A 4F7WA 1N8SA 1W85B 2XB2A 2C98A 2MR6A 3C97A 3TX2A 5JI2E 1IY1A 1MRNA 4OJYA 1E98A 4UZFA 2IPOA 4C7XA 2WWFA 4Y0VA 4BEJA 4ZGBA 1G8GA 2JANA 2ZUSA 3CPEA 3M2TA 4M8SA 4V02A 3ROEA 4BEWA 3IEMA 2C3OA 2UZ1A 5EJ7A 1YBFA 3AWDA 2BYTA 1UC8A 4JMLA 4IRXA 2OXEA 1VQLB 4WWHA 2Q3BA 4KLRA 4OOEA 5K8JB 1UCFA 2Q50A 5BW5A 4HZUB 3DHNA 2BMFA 2NZXA 4D3YA 1CCWA 4MIEA 4RKEA 1AKNA 3VR5D 5JS6A 1T9CA 1YGPA 3EUFA 3GUUA 3EBPA 2EWWA 3FNQA 1B26A 4BV8A 1EZ4A 3OLYA 1R5BA 2PGOA 3Q15C 1WB4A 2YJ6A 3CC8A 4MLZA 1RR6A 3U9SA 2K4MA 4DJFC 5JATA 1T5OA 1SAYA 4K9QA 3SPXA 4BFUA 1B00A 1RXEA 1TT7A 1KO7A 4FW9A 4J03A 3CMAB 1DJQA 3KFXA 2D3TA 3C85A 4CI0B 4OSEA 4F86A 1IFXA 3KWFA 1RZRD 4M9UA 2GUWA 1XZCA 1Q84A 4Y1RA 5KDOA 3OPYA 1QCYA 3PGA1 4TRJA 1NAHA 3PQ4A 3SI7A 5JWRA 4OQPA 1J2UA 2G4VA 4KVFA 4ND5A 1X42A 2CXSA 3PHBE 4LPSA 3RVOA 3WJ2A 1MEEA 4DDVA 4X92A 1AOXA 5AKYA 4QYWA 3VR5H 2OQRA 2A4MA 2B61A 4AX8A 1IQPA 5ADWA 4X7CA 2ZIUB 3V55A 3ICWA 4Q16A 5EERA 3R7BA 2IHYA 2SICE 1P7ZA 2X9VA 4M6WA 1J9ZA 2VP3A 4I2NA 2Z98A 3GRKA 1NVWQ 2G5CA 5F4ZA 1XNGA 4D8VA 5D6OA 3USES 4FEEA 1KJNA 2HRQA 1HSOA 4RLQA 1QIIA 2I4TA 2GB4A 4CLOA 3WNBA 4PG4A 4IILA 4OKIA 2WIKA 1KK2A 1QKIA 2RK3A 1J7KA 1EXMA 3D3JA 4H1UA 3A2LA 5FI5A 3SEQA 4BYMA 1KO4A 3BWCA 4RMGA 5ELLA 2WU3A 2ZSFA 5T4FA 4KQ1A 3KJGA 3LGAA 4AL4A 4CT4B 1KI1A 3MOIA 4MQEB 3QG1A 4HPJB 2V96A 3QTTA 3VPDA 1EIZA 3CXUA 1ESDA 3FMVA 3KQWA 3QVVA 1Z6ZA 1JEQA 2YY5A 3F78A 4QVJA 3ROXA 2HFJA 1UQRA 1BWQA 4R68A 3VO8A 4OVKA 2ATXA 1KAMA 1SVIA 3CEHA 4KPUB 3GFBA 4CM4B 4JY7A 1QAOA 1SGWA 1I01A 1TM3E 1JZTA 1WMFA 2EW2A 5EMJA 4CXMA 2JIQA 3CJQA 3WX0A 4GRIA 5I3ZA 1OWOA 5MN5A 1UEJA 4ERXA 1W75A 1Z07A 5BV7A 3TIGA 3RY8A 4URZR 2QA4B 4Z3KA 1A82A 2FHSA 4DLAA 3I83A 1VSUA 1SHKA 5CEEA 1Z2CA 4B46A 1CJUC 2JH9A 3D3WA 2B99A 3K4PA 1N6IA 3PKZA 1L5ZA 3FPPA 1QE3A 1GPKA 4XTCS 5KDDA 3RS5A 2O59A 3QVJA 4I55B 4F96A 2Y1LA 4R0MA 3THSA 1TIBA 2RGUA 3GQBB 1KEZA 1R4NA 4K6MA 5JMTA 2CVZA 2JDID 4MKRA 5JNUA 5TVGA 3H7AA 1ESNA 3MTBA 1R4MB 3SK0A 3WSVA 1T0JB 2C2GA 2NQTA 3QELB 4P3KA 3EWAA 5THQA 4YAWA 3ZI0A 3FG9A 4YV2A 1ZHHA 5DKFA 2WZDA 1FZTA 1JDBC 1MHPA 3TEFA 1ZH0A 2REXB 5FF9A 3M4ZA 1SK9A 4F92B 1QORA 3OZEA 2LZ0A 1G7RA 1PGPA 3ZZUA 3RIXA 1BMFA 3HDYA 2HSDA 5A6SA 4Z49A 3G6EB 4Y6LA 1D2EA 3PF8A 3EVDA 2WSYB 4KZKA 4AICA 1WY5A 3ZBPA 5AD1A 1Y0YA 2VPTA 4CM8B 4PG6A 1VP9A 2C9BA 3C6QA 4DGSA 1WPQA 4GLBA 3G0DA 1G8FA 1EXVA 5HK8A 1RHRA 3W3AA 4GXNA 2Q3CA 5B2ZA 2IU6A 2XKAA 3UQZA 1NUTA 4D92A 3TLZA 2YIMA 3OJWA 3ZQUA 4RYLA 2QN6A 5HZHA 1X74A 1C30A 4P4LA 4WXMA 4L9RA 3ADDA 5CLHA 1DLJA 2ZE6A 1C3VA 4KXYA 1C3JA 1OZFA 3IEUA 5ERGB 4XVCA 3KSZO 4Z4EA 2FSPA 1IN8A 1K6MA 1IY0A 3ZY5A 3ZCSA 4ND2A 1GRNA 4HAXA 1P1IA 2G72A 4DEVA 1BG6A 3PPIA 1NOJA 3BL8A 4HDRA 4WGFA 5KX5F 1O58A 1EDEA 1HZZC 3BFPA 1Z7WA 5TIIA 3OAAA 4ARIA 5C80A 1KEUA 2H2HA 2V6JA 4FXUA 3OD5A 2OCIA 1PS0A 2JI6A 2RARA 5FOWA 2HY7A 4KQMA 4O4LA 3A06A 1GZHB 3RADC 1ACJA 3D64A 2OK8A 1HDRA 3SDBA 4P82A 1UC9A 4J7XA 3ZCRA 3K2BA 1CD5A 3ER8A 1KORA 1YAHA 3VRHA 5CITA 5B3AA 1F8YA 1VYUA 3K4QA 3KHUA 4PTZA 5IKPA 3WQQA 1HKUA 1OX6A 1W87A 2AZ4A 1R66A 2EGHA 2R7AA 3BQNB 3O74A 4KQ2A 3OOEA 4LRQA 3SDZA 2QI9C 3TZLA 1P5HA 3TZHA 3CVOA 3WY9A 5B55A 1SD2A 3UB2A 4HNVA 1CP3A 4KJXA 4RPHA 3WLSA 3SGLA 3JQEA 5K4AA 4HS4A 3RTEA 2GNAA 4XQEA 3T1OA 1XTSA 1Z75A 3S2ZA 4GSLA 3CVWA 1ACMA 2Q27A 3KTOA 1D1PA 2QP4A 1I18A 5BR7A 3E1YE 1X7DA 3BMXA 3PCRB 4KXMA 1GQFA 1U3GA 3QPAA 2ZCJA 2I6TA 3MWKA 2PR2A 1D4FA 4HH1A 3VDRA 3BRWA 4O4IA 2C4NA 1F8FA 3AR5A 5ALFA 1ZITA 4BLVA 4BP8A 1QIEA 2DFKB 1E4VA 1NRJB 2VP9A 3OP1A 1T26A 3T9AA 5KOHA 3VSCA 1CC1S 1XEFA 2PNFA 2CFSA 3DOJA 4H9GA 4NCAA 2XMPA 1JJVA 4IDQA 4LXHA 5J2UF 1U0GA 1G4HA 2WRZA 4H3SA 5TB5A 2EGUA 2I7VA 4GM4A 3TOCA 2FZKA 3P26A 1LQTA 4H08A 3CCSB 1P19A 4PZCA 1E32A 3ICEA 3LECA 3CPWB 2XVXA 3MBKA 1Z26A 1Y8QA 2Z83A 1GZ6A 2X22A 2J4FA 3STVA 4CIDA 1X9IA 4FX5A 2V7GA 4FS8A 3LI2A 1QG4A 3G9UA 3QLUA 4BO5A 4AJ4A 3D8SA 5FBLB 1G6HA 4FBLA 4PYRA 3UWPA 2NU8A 1YIAA 1KVSA 3BIWA 1UJ4A 3I9V1 1FTQA 1RRCA 4X95A 3A1TA 1TYDE 4Q9AA 4DTCA 3H8WA 1W5SA 1AZLA 2GGSA 1NFFA 3A6LA 3FMPB 4NU5A 3T61A 4FB5A 1P29A 3W6NA 4FWIB 1B93A 1XB2A 4DJEC 5A06A 3U37A 1RJ9A 1ZEMA 3L7CA 2VHUA 3KVYA 5AVYA 5EMHA 2WWHA 4WEOA 5K0JA 1EX9A 2QUAA 4BKQA 4FS3A 3GIWA 4DQDA 5K3FA 1UDBA 3LUDA 3TAHA 1JFLA 2WYRA 4WBNB 4QXMA 1YQEA 1II8B 1QFYA 3OPQA 1TI7A 5GONF 3GN2A 2NVOA 1QPZA 1Z0AA 2BE7A 4AN0A 3MCTA 4NJOA 4O4HB 3R09A 5F7OA 5FUYA 5M2QA 4DW8A 2OQVA 2CWDA 2XCLA 2YRWA 4IHQA 3IPXA 3C1OA 2RKOA 3ZI7A 4EJ2A 4EGSA 2F1JA 1L7PA 4GYKA 3GFQA 2JLBA 2SCUB 1P7PA 3O4HA 2QHXA 4MRAA 2QE7A 4OH1A 1EFAA 3N2YA 2LP4Y 4TWJA 5AKEA 1WOPA 3Q3IA 4FOSA 1CJBA 2QWXA 5TY0A 1M1UA 4P0QB 4P8RA 3CIFA 3OIYA 3Q7IA 4X84A 2WNHA 4QBKA 1RI2A 2GD1O 4X07A 2XYGA 2FETA 4AQDA 3GMTA 3V8PA 4BB0A 4RWZA 3L6EA 2YQ5A 2PU7A 2PV7A 1ZIPA 2XPCA 4TVOA 4BKRA 2OVBA 3RV3A 4QFCA 1ZMRA 4RTLA 5AVRA 2IF2A 1GZ5A 4RVNA 5C4GB 1EGMB 3ENKA 1XHLA 2CV1A 3PFKA 2NU6A 3IH5A 4AF7A 3IQWA 1IUNA 4PBTA 3BSSA 4ZQEA 5DTJA 4P80A 1EB9A 2FQQA 3O1HB 3V97A 3WTCA 2WJ4A 4AU1A 1SBCA 1F51E 1MJNA 1UJNA 1V1MA 2V3CC 2WKSA 2R2AA 4KU4A 4ADSG 3KZNA 2BRUC 5SV2A 2AYYA 3PGVA 4AMVA 1XKLA 1E62A 1OLXB 4XASA 3H0KA 4XNFA 2RKWA 2FW9A 4IOJA 4MKGA 4RIHA 4YJKA 4PFQA 1K6IA 4HFJA 1NUAA 4PIPA 2G7ZA 3P2KA 3PI6A 4M9ZA 3Q8LA 5JNLA 2I9KA 4D0RA 5H9VA 3TBFA 1FPQA 4ALLA 4IYRA 3BDVA 1PJ3A 2GEFA 3MGGA 4KV7A 3S1AB 1MAVA 1RMTA 2AFIA 3OJ0A 4RL6A 4E09A 4B3IA 4L2IA 1GNRA 3O0DA 4V0LA 3UGKA 4F5WA 2O2IA 2XTNA 3OU7A 5CRIA 3N5KA 4DJJA 3LXXA 3AR4A 3BERA 4MJ3A 3H1AA 4YMTA 3WRYC 3LY7A 2C0PA 4W8OA 3OE4A 1DPFA 2PUWA 2ZB7A 4HB3A 2WVJA 2XKBA 4KAJA 1VB5A 4NHOA 3WGMA 3H97A 5ALYA 2NZ8A 4NYIR 4NRDA 2W6JA 3C5CA 1NRIA 3CNNA 4IFEA 3V8NA 5K4HA 3LLMA 4Z4YA 2AZDA 1OJLA 1N8TA 4E15A 5F2EA 5SY4A 3H99A 3T7EA 2Q4EA 4EF6A 3H9JA 2QTLA 2F2TA 1PL6A 4ZVTA 4DCCA 2Q07A 1K88A 3LP5A 4INAA 5FPTA 1FLAA 3OTIA 2JBHA 3F9IA 4D56A 1C7ZA 1X1RA 1GA6A 2KMLA 3TMYA 3L01A 4UZSA 3PE4A 3FIUA 2IXDA 3VZBA 2FFRA 2QLNA 1KE1A 4Z2YA 4BLQA 1Q15A 4OQDA 4CG2A 3NHLA 4AY6A 5GV8A 3P2IA 3EXEB 2EQAA 3CH5A 4MMZB 4Y2QA 3ZWCA 2CHGA 4TKUA 4Q02A 2J0UB 4GX1A 1OA1A 2PQ2A 3IAXA 5J1TB 2VNHA 1BVYF 4G1MB 4G1CA 1WZNA 4ZI7B 1NVTA 3R4CA 1ZD2P 3UB4A 2Q6OA 3ASPA 3RS4A 1S8OA 1DRKA 4GDFA 2B1IA 3MWGA 4R2MA 3K5WA 1E1CA 4HDQB 4W5RA 5F2KA 4R2KA 4A36A 2DBZA 1WXHA 3OQVA 1H4TA 4X1YA 2MCFA 4CFZA 3ZOKA 5HUHA 3IDFA 5JJBA 3Q6QA 3WYDA 5KZMB 1SKAA 1UUFA 3FVQA 1YRAA 2BFEB 1SIOA 2E37A 1IC6A 2XUAA 2ZIWB 4U2DA 2CLMB 1JVSA 4IUCS 5HDQA 3E9RA 5BYKA 1NTOA 3RUEA 3DEHA 3AF3A 1LU9A 1P4AA 4R2JA 2J5BA 2E48A 2NVUB 5CB4A 2BMDA 2GA8A 1F20A 5JFTA 3E5RA 4C4XA 3TRJA 1E9RA 2QTRA 4MUFA 1G64A 3MFYA 4BVLA 1I94B 1N7JA 3W6ZA 4CUKA 5IUNC 5HXBA 3AIKA 5C5IA 2X8LA 1E6MA 2C94A 5CH3A 1QE0A 3LUBA 5TR9A 2A9PA 5U1PA 4AKSA 2XGSA 3IKTA 3ZC3A 3I6MA 4RH1A 2PD6A 2IEDA 3R3YA 4J4TA 3L0IB 5FA5A 2GVNA 5TQJA 2Y0CA 3LXUX 1E2PA 2FSHA 2WWRA 3KJQA 4JUCA 1DCKA 3PDHA 4EA8A 4ZV9A 4Z5XA 4N6GA 4NONA 2FK8A 3D7KA 3KT8A 4UKDA 4EFMA 2JJ2D 3UMVA 4D74A 3SOZA 4YV1A 3RK1A 4TWRA 4UJ3A 1SFRA 2YNMC 3AVQA 1UK8A 4TTJA 1Z06A 4FFMA 3DBOB 3TDMA 3EOZA 4DA9A 1GCIA 1UDXA 2WIBA 5F73A 1L4KA 3OIFA 5DTEA 3T7SA 1ZK1A 2WF5A 5CYOA 2EVWX 4MB2A 1QU2A 3D02A 5IJZA 3E23A 2MMCA 3U9LA 3VYWA 1T8SA 2GD2A 2OFWA 4LXTA 4D8WA 5JY1A 3QJGA 4DNFA 3OTGA 3GWGA 2G63A 2NTYC 3VR6A 4MV9A 2ZJOA 1GN8A 5HDBB 1VL0A 3MVEA 5ENVA 5C8DA 1PNRA 4TTIA 2HRCA 3J81k 1E3SA 1C1HA 2IUUA 1XZNA 5DT2A 3O3OB 2PQ0A 2F48A 5CT6A 3BRSA 5AXCA 3U4GA 4OP1A 2I7DA 4DILA 1VG0B 5A89A 1Q74A 1JHQA 2RHBA 4F2DA 3G9TA 2UKDA 2D7DA 3H9CA 2P65A 4RESA 3IMFA 4RV5A 2FW7A 5JNVA 1X15A 1WUKS 5EL0A 1JDZA 1C3XA 5KAPA 5LFAA 5BV2P 5JZVA 4Y2GA 2HIGA 3G89A 3AEUA 4KB5A 3I04M 2Q3EA 2ZT5A 1WSAA 1KPHA 1TZ2A 5ALLA 1WY7A 4Z0PA 1K6EA 1U9CA 1VLMA 2NUTA 3CUWA 1P4SA 1TAHA 1X1AA 4G4SO 4QGHA 2X4GA 3TSYA 3U7EB 1DOAA 4M0KA 4OFWA 1HI9A 1U8AA 3QUTA 2GCGA 4BB6A 2H1IA 4ETIA 4PYOA 4R6WA 3HEBA 2BJVA 1IXYA 1P2TA 5DM60 2YVAA 3STXA 3UV3A 4ZO4A 4Q1VA 3PJGA 3DDOA 1Z4QA 3KLPX 1WEKA 4JQZA 2BONA 4RAQA 2H1OA 1FW8A 1AJEA 4XPIB 1C3OB 1JR3A 4LWPA 3QSYA 1R6UA 2YJ4A 1OAKA 3IJRA 3OM9A 3F5SA 4D9FA 2OAGA 4Y18A 4MYTA 5J5VA 1KZ6A 1RSZA 4LDZA 3RVJA 1XZFA 3EA0A 2P9TA 1W6UA 5LD2B 3ILYA 4H0NA 3V6LA 1PJAA 1SVNA 1E6UA 3MTAA 3THXB 3DMNA 1CULC 2XDQB 4UTNA 1CYEA 3ONVA 3S2YA 1RKUA 5LQKA 1QYIA 4G3XA 1HYBA 1MC4A 5AVXA 4ATNA 4EEKA 5JAMA 1CYDA 1NUHA 1JFFB 1PEKE 3S99A 4C1BA 4HVAA 4PXYA 3E7DA 5KTKA 1M8FA 6ABPA 4GQAA 3OQJA 1VMAA 4QJ5A 2VEDA 2JLZA 2QVCA 1WDWB 5IBQA 3ADBA 4GZ6A 1RWMA 1HE1C 4HDCA 4Y1FA 4RAOA 2HDHA 3SHOA 3TQFA 2OTLB 3QEMB 3VVMA 5IDWA 1FU8A 4BFXA 1QQ5A 2RGRA 4P53A 4WN9B 4RVSA 2BSXA 4XTRA 3WIUA 3QPDA 4DC0A 2EATA 3KYJB 4GOMD 1DX6A 4LCBA 4LSWA 3TK1A 1FLDA 3AETB 4BB5A 5CB8A 4QD3A 4KN5A 2D2IA 5DX1A 1L3IA 2ZANA 2NSJA 1L7OA 4QQ8A 3EEYA 3LT5A 3K1ZA 4W9NC 5TS2A 2M6KA 5CBPB 1FRNA 3DDCA 3IODA 4O33A 1BHQ1 1VBNA 4IF6A 4EO9A 1NZFA 3E9MA 1P6UA 4PIMA 3M2PA 2CW5A 1BW9B 3RVKA 5ICCA 2X7XA 2X86A 2JPDA 5D00A 4RMJA 2YCLA 2QX9A 3REFA 1RAIA 4X8HA 2CXHA 5EQTA 6NULA 4AI6A 2G17A 1H0SA 1KEVA 4GXTA 4J75A 4TWAA 1JV2B 1VLQA 2EDCA 5A4KA 4KUEA 4HEA6 1O97D 4PHCA 3TIVA 3TW8B 1RZ3A 4MPRA 4DRYA 1OCEA 1Q3KA 4BBJA 5KVAA 1FJXA 3K94A 2RG7A 4QOIA 1YT5A 1JFTA 4A2QA 4KHPB 4OQLA 1XA3A 3QVWA 2D5LA 4YJHA 1KMMA 2WW8A 5DW3A 1L5SA 5HCNA 4BNTA 3DHWC 2I55A 3GAAA 4NKRA 5C1IA 2C7RA 4V0RA 1JQ5A 4Q3OA 2BW0A 3OUZA 3HKDA 1X6VA 1LQUA 5EP3A 4B40A 3L4EA 1F0YA 1QU3A 1RPNA 4OK3A 3VBCA 1LWOA 1V71A 2KX7A 2P1ZA 2V5VA 4E5KA 1WU7A 1NJSA 2Q6VA 1K8AD 1L1EA 4MUMA 2ZSJA 2ZSBA 1JHVA 1V3VA 3QU7A 2ZE8A 3DOCA 3E9DA 1MOQA 3DZGA 3QOYA 1JXAA 4C4SA 5A2GA 1PFYA 2AKYA 3G2HA 1P5FA 1CXZA 1SQFA 2ZI6A 4WW0A 3P4YA 4XGQA 4A0QA 3U39A 3PLNA 1V39A 1WIWA 2UAGA 5DS0A 1E2DA 3DBVO 4M1MA 3VPSA 1I3KA 5FWAA 3BS4A 2VP0A 5FEMA 2VRCD 5KJFA 3CW8X 4JDUA 1FL9A 4IJMA 1XRRA 2NUPB 5CNJA 5EE0A 4ZVSA 5H81A 1XMQB 2ACWA 3HNOA 3ZWQA 4B3XA 1ZGAA 2JFQA 2I3GA 3KJHA 2OHOA 2ZAGA 1HZZA 5IVHA 2DEUA 1BE6A 1PK7A 2R751 4IP0A 1EFDN 4QECA 1PNVA 4JITA 2GXQA 1W48A 1YIOA 3GLTA 3PR1A 4L5JA 2WABA 4FQ7A 3ZE9A 1EWQA 4J0DA 2PEZA 4MGYR 1NNLA 5CB0A 2GBPA 1D8AA 3O03A 1WSDA 4WLUA 5F52A 2G7MC 2OBSA 5TJHA 5JVDF 1C1YA 2V8BA 5KNDA 3H9NA 2XWPA 1MQSA 3E7WA 3QLJA 2NUAB 1B6TA 3ZU4A 4AVYA 1WVIA 1U8UA 2BBWA 1OBFO 2HJRA 3Q7EA 3ASTA 4YJ3B 4C6SA 2IIQA 5KYWA 4JSTA 3PENA 5EWJB 1ONPA 1TUBB 1OFHA 4CUJA 3UJ3X 4D46A 2OHVA 3REQA 2V5AA 3LK6A 3T4PA 3ED1A 1CY4A 3AERB 2B1QA 2W8BA 4IAOA 2B1GA 2I8CA 3SVZA 2P2LA 3ZUPA 5IYNA 2ZBVA 4RV9A 1IXZA 4GGMX 5DNAA 5CLJA 4F9GA 3SJUA 3AGPA 3WBKA 2H1LA 2PZLA 4RMIA 2P68A 4OXNA 4NCBA 2PAFA 2PKCA 3IQIX 3UQYS 3HEMA 2GARA 3NC0C 1JFVA 3BD9A 4KG7A 5F1PA 3RVNA 4D8UA 2AFHE 4S24A 1E3DA 3OT5A 6Q21A 1E5LA 5HQTA 1U2TA 2I62A 2C3MA 4II7A 5CK4A 1AB5A 1H6DA 5F2OA 3P4UA 2Q4TA 4WH0A 1DAGA 2ILVA 4OYLA 2JLQA 2OBBA 4V24A 2WEKA 1C0LA 1J2RA 1SPBS 1ZW1A 5FQOA 5AM3A 2X9QA 2QLJA 3PJDA 1X1EA 1HFKA 5C5EA 2FY8A 1JS1X 4ISCA 2IS1A 5ADVA 1AKMA 2XUGA 3NWBA 3AR7A 1N08A 3KNZA 2FWNA 2PMCA 1EGVB 5LLSA 1B41A 1ID8A 1LPBB 3CM0A 5KHAA 2Z5LA 5CVDA 2X8WA 3WB2A 2CCKA 2EHDA 2YS6A 3FZQA 4ALIA 1R8XA 1T2AA 5F9FA 1EE2A 1IBSA 4ZMSA 1XPRA 1HBJA 4C4AA 4PGHA 2Y99A 5EWMA 1JW9B 1KVUA 3CC4B 2PWBA 3D2LA 3CUUA 1X70A 3G2OA 3CRQA 2ZAMA 4JB2A 5TGTA 3TPFA 5J3OA 2QD1A 1WOSA 4G81A 3RYFA 3TG8A 2J4DA 1CQIB 4N5IX 4WCFC 3QUQA 3VTAA 3VSEA 2CRVA 4BWYA 3JZFA 2FFAA 5EE5B 1YUBA 4H7PA 2CXXA 2HHCA 3K8OE 2E4YA 1N05A 3JWPA 3S5UA 1R4ZA 2RGWA 3GGJA 3IBYA 2ZI7A 3LYLA 2VQEB 2VHXA 4WLNA 4TPKA 4IX9A 5IVKA 1D03A 4OHCA 4ZT5A 4Z9FA 3VPHA 1NYLA 2ORED 3DTNA 2HADA 3HMKA 4P38A 1J5XA 4D9BA 1H2AS 5K3DA 4C4RA 4MDEA 1K7XB 2FPXA 4UDNA 3ICVA 3UAXA 1DDGA 1RHJA 3ZK7A 4GYYA 3BRCA 4WOBA 3ZE2B 4R2XA 4FHZA 4OAOA 4X61A 2FZCA 4G36A 2H31A 3MBIA 3PL1A 3NIWA 4Y98A 3R77A 2W2KA 2QRHA 3IXLA 1Z4MA 4IFIA 3V80A 1NE2A 3C2QA 1YE5A 3CEMA 1Y8ZA 3UOWA 5JH7B 1KOGA 2P9GA 3QENA 4WFQA 2PWAA 2BDEA 1E1KA 4FMCF 2AOUA 1TYAE 3O2NA 1O5IA 3GFTA 5AP9A 2JC3A 4XMYA 1R12A 4M36A 2HXGA 4ZCPA 4GRAA 5ALOA 4B5KA 2OYNA 3GNTA 1GGFA 2DVMA 4D6PA 4IKEA 3KOMA 3DW3X 3QOWA 4MWSA 1ZRNA 2V0NA 3FTCA 2XQIA 3NHWA 2I4OA 4IMJB 4KWHA 2VK2A 4GT1A 4K3VA 3MMPA 2IHUA 2PFKA 2QXUA 3BMNB 4XR9A 3JSAA 2YFYA 3NHFA 1DV2A 3DDUA 4IFBA 3E35A 2PL9A 2WIGA 1XAHA 5IJ9A 1RJGA 4KK4A 1RRGA 4PYNA 1IZYA 1DKPA 1WLSA 2FWPA 3FSGA 1FP4B 1V9CA 3TCXB 3KR9A 2IU0A 3TE7A 4A6DA 4CTMA 4QYMA 3ZY3A 2I6XA 1R6VA 2MHCA 4LMPA 1EFRA 2UVPA 3WSWA 4EKIA 2IZZA 3DR3A 3PSAA 1W19A 4NL4H 3TZQA 3EZ6A 3R23A 3SEFA 4HAIA 5C32A 4LJRA 3DEZA 3FA2A 2ZVPX 3ZQ4A 5B7QA 1ZM2A 4O4JA 4OUDA 5I3CA 5CVVA 3MIZA 3TSAA 4JJ4A 5L3SA 3DSRA 1SVLA 4FOTA 5B1HA 8ATCA 5FPPA 2FMUA 4AJKA 1QB8A 3E7XA 2I4MA 4P9NA 1OLUA 4QWMA 3TRDA 2GHRA 4DMFA 3R9WA 5FRDA 2O2EA 5HF9A 3X1YA 5B3JC 3PPWA 3AINA 2WOOA 5TSDA 1TKRA 3OPMA 3D9QX 2FZLA 4FDMA 2YMQA 3VV2A 4HWTA 1BZYA 1OBCA 1R10A 3D6NB 3F98A 2VZ9A 4O2LA 5E3JA 4YEDA 1RFLA 4RSRA 4J7UA 3R74A 4BWVA 1EFUA 2B4YA 4CM7A 3WRYA 4MOWA 4Q4JB 3CTMA 4ASUA 5EHQA 1M2EA 1DBWA 4RF5A 3HLYA 4I4TA 3UHPA 2BUAA 3NANA 4ARZA 8GPBA 4NR0A 3ESZA 2H6EA 5HK9A 1MN6A 4MJXA 4Q3EA 3VVBA 1J42A 3E4DA 2P2ZA 3FVWA 1MVLA 1Y81A 1F6BA 1YQDA 3A6ZA 2I66A 4LA4A 4QU0A 3DLAA 1HK7A 3ZPXA 3T53B 1EZZA 4NE2A 3NP7A 4CKCB 1WPGA 2W2LA 1PTJC 4AUNA 1DG1G 1MFZA 1O0SA 1BH6A 4WAUA 3GMIA 1FNCA 1Z2AA 5LWHA 1ZHOA 3P45A 2A9FA 2OGZA 4DEYA 4Q3DA 3JATB 4MIYA 2P9CA 2HYIC 1Z17A 3MRVA 1ZI9A 1QIJA 2HC9A 3CVUA 4G9EA 3ZX4A 2R5WA 3QNWA 3FAKA 4P7BA 1Y34E 4O0MA 3VDQA 5LP6B 1PT7A 5G4KB 1SRRA 1FDRA 5EUMA 4F1JA 2HLDA 1E2UA 1VJDA 3DPUA 1CV2A 1LKZA 3CNQS 1FU7A 3RRMA 3VAZA 3ZN2A 1NXOA 3R3UA 3K70D 4MR9A 5A02A 1EAMA 1XDBA 4P0PB 2BLNA 3DV0A 3L04A 1JN0A 1JYSA 4JODA 3LC7O 3VPBA 1KERA 1T1IA 3CA8A 1C9JA 4PG7A 1XK7A 1IY8A 1SJ9A 1SKYE 2I6QA 2P7IA 3C0KA 3NPMA 4NVRA 1KI6A 1LW7A 4JBIA 2IXFA 1YJNB 3VYUB 3K2IA 2ZRJA 3OUTA 2H85A 1PW7A 4A6XA 4HV4A 3GF4A 1SVUA 4XJTA 2IOHA 4ZN6A 4XLAA 5ICGA 4X3CA 3NEYA 1Q57A 3EXIB 1Y3HA 1E3QA 1M67A 2NO7A 2QG9A 4RY8A 3VVLA 4MRMA 2DWQA 2GUGA 4N40A 4ZHQA 2HRRA 3HXOA 2OXCA 3PHCA 3NBZC 4WGGA 1N0UA 3F4BA 2IDJA 1XNJA 4B7ZA 3MELA 5FXMA 3VU9B 3G0IA 4OP2A 2LR0A 1Z7YA 3EG9B 2O1WA 2V7VA 4KWIA 3QOXA 4KSCA 4DMUB 3LQ1A 3SXUB 2R25B 2XRMA 3W04A 2GMWA 3K20A 4G1UC 1XXHA 2R4QA 2VXOA 2YNMA 3HBAA 5DIFA 2XMSA 3NEJA 2ZWAA 3CO5A 3LCVB 3E20A 3OT1B 1XQXA 4FYIA 4CMEA 3ZDEA 2JAOA 3KYIB 4KVZA 4U7GA 5EVCA 4NBSA 2JCXA 1IH8A 4DREA 4X90A 1EFVB 4FNAA 2O7QA 5K20A 2MU1A 5CH5A 4O02B 3GSIA 5AW7A 4V3BA 2R7MA 4C30A 3BDIA 1TOAA 4YCLA 1TQHA 4COKA 2AHOA 5DN9A 4DDMA 1C8LA 4CQMB 3NJ8A 3BQJA 2BFDB 2KLBA 3E8MA 2HHAA 4Z9BA 1SKYB 3TR5A 5CLQA 3BDAA 4MW4A 2GX6A 4X66B 4JJFA 1FUUA 1JQKA 5L3VA 5MFPA 1G6Q1 1K2VN 2HF9A 5LQMA 5AQ1A 3FOWA 2WF7A 1TUGA 2OLEA 3VU0A 5DI3A 4LYHA 4EBFA 3SNHA 3RRFA 1J1ZA 1TPYA 4YTEA 1ML3A 2ST1A 5J40A 3SLKA 1MW8X 1N1GA 3PKIA 1OW3B 5DK6A 1FS4A 3DE5X 1D8TA 3KZKA 1B3BA 1XDGA 3HO8A 3BCRA 1P31A 1GAEO 2MSCB 1NJ2A 3EFBA 3U16A 3F0TA 3QKIA 2ZP1A 3R7WB 4PSKA 2ZLBA 1U0EA 4N47A 5AM1A 2O6LA 1VQ5B 4LC1A 1RQ7A 4TKZA 3PFFA 2V97A 1H2BA 2V8OA 1QH8A 3IUSA 4LE0A 4RVDA 4Y1EA 2VRBA 1RLUA 1QQ7A 2VWGA 3MTEA 1M0TA 2LIPA 4KP7A 5AKIA 5KU7A 4JCCA 4PPQA 2O20A 3JVDA 4B3CA 1CW2B 4DE5A 3I56B 3HY3A 4AZVA 2R65A 1I4LD 2RHDA 3Q7PA 4ND3A 5I01A 1FJGB 3CPXA 4TMXA 3D31A 3GB9A 4ZQBA 1RMYA 1CIPA 2NV6A 3JQCA 2GEJA 5EWLB 4D8TA 4EG5A 5KYGA 3DEYX 1UPTA 4UNNA 5DGHA 3KJNA 3N0XA 5CTJA 4JP2A 2OC4A 1LS6A 4XYBA 5EJ8A 5U9CA 4AKTA 3H5RA 2QZSA 1BIFA 1G8JA 1W85A 3RU2A 3O38A 3EZGA 3R3SA 1V43A 3FOAA 1VG8A 3LY5A 1HRKA 1FK8A 1TMGE 1A4RA 3IYLW 2C7BA 1G55A 5IYWA 4P25A 2XAAA 3SBOA 1WX1A 2ORIA 5AK0A 1JDTA 1E9BA 3OX1A 3QLEA 1RLMA 1S2DA 1ZEJA 3FXAA 3D2CA 4LYFA 2ET6A 2AR7A 3O94A 2WJVA 5COBA 4ID3A 2XNSA 1HL3A 4HWGA 3I2KA 3U80A 1TPZA 4B6OA 2FWMX 1KI7A 1KH1A 1O87A 1CZLA 2OCLA 2PSSA 1MF7A 2NSLA 4N82A 4PM4A 1RWPA 3QPWA 3EMBA 3LLCA 5FAKA 3PGMA 4Q3KA 2CFTA 1Z7GA 4W9NA 3HP1A 4XW2A 5HVNA 1FDOA 1MGOA 3EPPA 4RABA 4X1OA 3HL0A 2V4DA 3F74A 1Z6AA 4QYIB 4TXMA 1VJRA 4A91A 2PHZA 2HO5A 2K87A 2YRFA 5LXTF 4B2YA 4F2PA 2O5VA 5U4XA 5L7TA 1J6UA 3OQMA 2UYHA 1ISMA 1E7WA 2BY4A 3G13A 3N76A 3OBIA 3KD2A 2ZUTA 4BE9A 4DIUA 1Q3TA 4G5FA 2XHZA 2ZUVA 4O08A 1VJ0A 2WF8A 3CZ5A 4P6VF 4MW5A 1KKMA 1E6CA 4PWZA 4QSMA 4URUR 4EABA 4CETA 2GYYA 2PD4A 3DKPA 3ILXA 2BTEA 1C0IA 3BH6A 4GOKA 3COWA 2CUNA 3LC1O 4O2AA 2LTAA 1WWKA 1YZQA 3FR8A 1JR2A 3IEPA 1XQBA 3A8IA 2ZL5A 1LH0A 1SOUA 1K7YA 3F5QA 3IPLA 4QDZA 4ZT7A 4JXJA 2J9XB 1C4KA 2VSQA 2ZI3A 2BR3A 3DQQA 2UUCB 1GEGA 4K6KA 2D13A 2NZJA 3K0EA 3KDPA 2HQ1A 3O47A 1AKUA 1BKDR 4WWVA 2A0WA 5F5LA 4MAMA 2GAAA 4Y6RA 3G0CA 1V47A 2JLVA 2B8NA 1XLUA 4QX6A 1ILEA 2PNJA 5LDDC 2OP1A 1UXGA 3OW7A 3R5XA 4GOLD 5IRCD 4B84A 1HT0A 5D3KA 2OTCA 3I34X 3MNFA 1ZJ6A 3DE0X 3ROKA 1J25A 1ELOA 1YDHA 4ZKDA 4G7XA 3NKFA 1CUCA 1I8TA 1MCZA 1ATIA 4TYMA 2GT1A 4RKWA 2A5LA 2YX1A 1M34B 4WNIA 2QNRA 1KWKA 2DPGA 2CNLA 3WZ2A 1GGKA 4M7OA 3UGTA 2RAFA 3RFXA 4PHGA 3COJA 3H6GA 5DGCA 1LZLA 3IV6A 3LWZA 3SR3A 1A4UA 1XJCA 2L17A 2ACVA 1X9GA 4GMHA 4EGCB 4RVCA 5CURA 2PGIA 5REQA 3SVLA 4BKUA 4LZOA 2V7XA 4NARA 1KAEA 2REBA 5ALEA 1HDYA 1LS1A 3EDCA 5B53A 3WB0A 4ER7A 4KR3A 1Z29A 1KMHB 3OQ6A 2ZU0C 1X7XB 1YZFA 2DERA 4JB8A 3L92A 3SR4A 3SU8A 1K08A 4JN6B 4RTPA 3RRBA 4YCSA 1PR3A 2J9YB 3HM2A 4FYMA 2O06A 2C2ZA 4IM7A 3STHA 3VR3A 4HD8A 4I55A 4XPZA 2PV0A 4TTPA 3TTXA 3UGJA 3N0TA 2F3RA 2H17A 1ZBQA 4AJJA 4B75A 2REQA 3GQBA 2CZGA 4HQRA 3BXOA 5I47A 4WJLA 3T5DA 2X85A 1TVCA 3ZWWA 1B16A 1R4MA 2MR5A 3TFOA 3CUSA 1XEAA 5H3HA 3L7NA 4NMHA 3VJLA 2W9XA 2ZKLA 2JCBA 3G5UA 1LRKA 4CEIA 1GGJA 2H4ZA 3AIOA 1RE1A 4ON9A 4EI8A 3O3CA 4NICA 4MGKR 3H5VA 3DOOA 1G5RA 3OT4A 4HAWA 4BBZA 1HDIA 3NV7A 2DHCA 3DAPA 1T2VA 4JLSA 4RGQA 1WW8A 4X71A 4I3HA 3WMEA 5HRCA 2O3TA 5C1BA 2V7WA 1P9NA 2V0GA 3VYSB 4X8LA 4M0UA 1CR2A 1ZIXA 3H2IA 1S3SA 2WJ3A 4R8MA 3HYLA 4S2UA 2H3HA 1IB6A 4JLKA 4XQGA 1V96A 4LQLA 2AMLA 1J9GA 4AXXA 4WLEA 4IGFA 3SC2B 3WLTA 2BVNA 5EESA 1XELA 5CDTA 4YS6A 2XMBA 1DBRA 2ZTSA 3U3JA 1PI3A 1G8HA 4KEAA 4G2TA 4IV5A 4E5SA 4JL5A 4EMTA 1AGPA 3LKBA 1K97A 1JMVA 1LY1A 1Z34A 3BAZA 4FFBB 4ZVMA 5TMPA 1KQGA 1QYVA 2RH8A 2VN8A 5I9SA 2J0EA 2FPIB 3KD3A 2DTXA 3MSXA 2CLEB 2X7JA 4RHXA 3ZGLA 4FQ5A 4KQXA 4JP8A 1HE4A 1IK6A 4BNFA 1TF2A 2CVPA 3HACA 3I5AA 4B3SB 4YUVA 2DRIA 4KZPA 4DCOA 1MC8A 3LT4A 3G82C 4MUJA 3B2NA 1ZCZA 2L19A 1HDGO 4QREA 4DLRA 2P4HX 1Z9BA 2Z2XA 4IDGA 1JEAA 4J1TC 5FAXA 5FX2A 3K92A 2FG5A 4JU8A 3ZJYA 1FNSA 3U5ZB 4EI2A 2AC2A 4WCFA 4HYTA 5IKOA 2ZUFA 4Y6QA 1S4QA 2VAVA 3R7NA 1RKXA 3UJ8A 3UWKA 2QUZA 1F38A 3RHFA 5DBIA 3V6MA 3WMRA 3GJ8A 3M9WA 1XZPA 5IYRA 1FFHA 1T6ZA 4F5ZA 4DDUA 1CNMA 1DFIA 4J0GA 5CNKA 3DBIA 1ULUA 1BROA 3R6LA 4EVSA 1B7GO 2CNWA 4MMXB 1Z18A 2IHVA 1JHDA 4NOKA 4LF5B 3DBLA 2P5SA 5IZ4A 3OUUA 1D2MA 5FJIA 3KSAC 2VYFA 1GKYA 1PLLA 1RZUA 2ZSAA 5IBRA 5HKBA 2PZKA 1BFKA 1OMOA 1SXHA 2HQRA 2ZTVA 2G9QA 4BVAA 5AIBA 4KE7A 5AW6A 2XZOA 2Q5HA 3ZIDA 2VPIA 3JQ8B 4EUFA 2AT1A 1NMQA 2FP3A 1Q19A 4NU6A 1R37A 1OT3A 4A5SA 3UOAB 3AIIA 4R7ZA 1WUYA 3O8LA 3AVTA 1VP3A 2E55A 1J2JA 5CGZA 4C4PA 2FVXA 1Z82A 3TXAA 4YIHA 1O0BA 2HJHA 4ZK2A 3DR5A 3Q9SA 3QBEA 1LWNA 3NORA 2WAOA 3BMQA 3ZD9A 4X7MA 1JIVA 3OIGA 4RM3A 5FPSA 2BI4A 1VF7A 3GBPA 1FPMA 1T0UA 3IVCA 3U7RA 4A16A 1D7OA 3SZUA 4MTCA 5A4JA 2MYTA 5JDCA 3SIXA 5AWFC 2H2GA 3LBYA 1IB0A 3D2AA 2ZIEA 4RADA 1X38A 4U9HS 4LOLA 3GA7A 4MRRA 1MOSA 1G5IA 5KWJA 4BRSA 1UC4B 2J46A 3EXG1 4G26A 2OAP1 3U19A 2ZRGA 1L8LA 1T4MA 2VYND 3AUTA 3OZ7A 3TZCA 2CMFA 1PX0A 3HGQA 4LV8B 2LZJA 1JLHA 1SCJA 2XDWA 1DQYA 1K92A 2Q3LA 3MJRA 4FD2A 5LB4A 1PFUA 4P2GA 2VP2A 4XIGS 5BUQA 1Z7EA 5L4NA 1IXKA 3D6AA 1KQPA 4I50B 4DNTB 1VHJA 3GV0A 4A0FA 5SZKB 3QX7A 4Z7JA 3N7AA 2FPGA 1ZMXA 3OFJA 1MRZA 4IWNA 2G9RA 3UJAA 2W0SA 1MR3F 4YRCA 3QK7A 5DBFA 1UOQA 4JLUA 3B9RA 4URVR 1Y6ZA 3OMWA 5GJCA 2X0DA 3ZBQA 3L1UA 3QNUA 3TW6A 5B3JA 3WLRA 5IAJA 1YL7A 1W4BA 4LGCA 1ENYA 1M2JA 2UVDA 1TB4A 3DWFA 5T4HA 4ZALA 2A33A 4O4LF 4W5OA 1E4EB 1W94A 4WBNA 4NBVA 2NSYA 3FBGA 2COKA 4D5EA 2EIHA 2HB6A 2BR4A 1LSUA 2QPOA 3RABA 2CLLB 3ICPA 3CCVB 2FFBA 2VATA 2YHBA 3L41A 4O4HA 4LOKA 3TZBA 2DAPA 2PK3A 1ZJJA 3HBFA 1GU7A 4GWKA 3TCNA 2ORYA 3NOXA 1DTEA 5JCJD 3OPNA 2DTDA 2C7VA 3GRAA 4X60A 4PFKA 4ZANA 1NG1A 2FVGA 4HFRA 3V4SA 1JDSA 4F2GA 3GAMA 2GVDC 3TL3A 1R9MA 3FROA 1REQB 3PA8A 1WV1A 1SIWA 1BXRB 1NI4B 3GVJA 4LISA 4EKDA 1QVFB 1PTJA 4PC6A 3I4LA 2GJAA 3QVKA 4YNBA 5FHQA 1T0HB 2ZJ8A 4RDIA 1UP6A 1W88A 1IATA 3CWZA 3B85A 4J94A 1AGYA 1CUSA 1QHHB 4JI5B 1KZ4A 2NADA 4JWTA 3ZD7A 1YIJB 2R68A 2ZTMA 5AJXA 3T5GA 2EZ8A 3T34A 4HYYA 1W36D 1PF7E 4JT9A 3QOFA 3ISVA 4IV0A 2QUKA 5HF6A 4FSXA 1AUQA 3UJPA 1XJ0A 4M1KA 1UFOA 4KE6A 2BF4A 4JROA 4NCIA 3UAVA 2RHOA 4FXOA 3EXHC 2WP0A 1XSEA 2O48X 2ZSHA 3A1SA 4G85A 1M6EX 4JC0A 4TQUS 5EHZA 2H4YA 3QMPA 3OF5A 3O8RA 3AUAA 1E59A 1G5PA 5K3AA 2HGZA 1P9RA 3PWZA 1UAAA 3C8UA 4YYZA 4GI5A 3SS7X 2JJMA 5EE1A 4QM6A 4P3YA 4MUXA 4R1UA 4CIWA 2LVBA 1H0KA 2R62A 1QQTA 1P2SA 3WL8A 1GQ2A 1UMCB 1QO7A 5DSTA 3SOPA 2VFAA 3AT1A 3ISJA 4IIYA 3KU4A 4AS2A 3NVMB 5EJGA 2QE6A 3L8CA 3ZV7A 4B4VA 2HCTA 3K0SA 2IW3A 3OE1A 3IBTA 3E18A 1O9HA 3NQ41 3LQEA 3HYCA 4TKVB 3ZLUA 4B3DA 4BNNA 3PITA 1N33B 3WLLA 1P3DA 2N3ZA 3LHKA 4UFPA 3U62A 5IBCA 4P31A 4ZEXA 1T5BA 3VSBA 2VZEA 1Z6YA 2C2KA 4DRXB 4UJ5A 3R7LA 4JR0A 3KLMX 1AURA 2UZ3A 3UJNA 1KYYA 4JLNA 1A76A 2CJYA 2JAUA 4FFNA 2Z1DA 1T36A 1AUOA 5CX4A 4B71A 5JWHA 1VQKB 2JFZA 4IQ4A 3BEOA 3K15A 4OHRA 4YT4A 5JARA 2VHYA 1ZWKA 5KYVA 3F8SA 1SXIA 3AUYA 3D26A 1FY2A 1YRYE 3EF0A 2DT8A 4LZNA 1PU2A 1TTHA 3HH8A 4JGGA 1N34B 1KSHA 4MR8B 1L5LA 1K0FA 4QPDA 3E9ZA 5JFOA 2CXQA 1AGRA 2G0TA 1Z6XA 3R3VA 1P0PA 2OC9A 3CKLA 4UPVA 3MS4A 2DECA 4X1IA 2GJ9A 2CLCX 4Q5IA 1A9XA 3B48A 3EXEA 1TO1E 1QHXA 4WZEA 1QO9A 1Y3DE 5B37A 5LP6C 3H2BA 4A1OA 1MD9A 4P92A 4RGBA 1Q95A 2NPFA 1PJBA 1WHSA 4Y30A 2C4VA 1ZDMA 4D4GA 3KTFA 2P30A 4LRTB 2QW0X 1MIOA 4F9TA 4RVHA 1WMSA 4XLLA 3PFGA 1JIKA 1Q1BA 1A71A 3JV7A 4ZEOA 1RJFA 1YJQA 3AB3A 3NVAA 4KQWA 4M46A 2XRFA 4S1OA 5CVCA 5KKAA 1PKEA 3DTVA 1OXBB 3MLBA 2BFEA 5TVKA 1XQYA 1MXHA 3O8QA 4GMGA 5TF4A 1GVHA 5J4HA 1PLKA 1RXWA 4JOCA 4X5OA 1Z56C 2C5BA 4D3ZA 1IHDA 3I2JA 3U0BA 2DFVA 1FEZA 2TMKA 1I4EB 3GNSA 1DOZA 3HDVA 3GMDA 3BXFA 3NWOA 1N75A 4UW9A 1ZD9A 1NMSA 1R9JA 4B09A 3MWLA 4PN7A 3B38A 2CCGA 4D4IA 1QHEA 2QQGA 3Q2OA 5BQFA 1P2GA 1XZIA 3NIFB 1ZM7A 2Z8YM 1I13A 2G70A 3LW7A 1T3ZA 3OO1A 3WDSA 1XE3A 3AESB 3KAPA 2VI5A 3W5VA 3PHHA 5IJXA 1V7PC 2O3RA 4HK4A 3THYA 1V8PA 3HJBA 1C4WA 1EZ1A 2WSMA 5AI8A 4I5GA 1XPJA 3RUFA 3SIWA 2RHMA 1HLFA 3WK7A 3KVOA 4KR2A 2VG8A 3SYKA 4QGSA 4K81B 4B32A 3DE2X 3LQFA 4B34A 3I9V6 3H9UA 1YV9A 2WNSA 3UA3A 3HGMA 2Q1TA 1CZKA 4XWYA 2ZPUA 2ZREA 1TXGA 1TA4A 2R96A 4LWQA 3LUHA 1E7SA 2WPDA 2D7CA 2I6SA 4OKNA 4N5LA 2QYTA 1PJ2A 1GT91 2R8ZA 4WFJA 3AUSA 4R0NA 1DINA 4F12A 2VT7A 5I7VA 3TGPA 2I8AA 4KFCA 3V32A 2Y05A 2IYAA 2NP6A 1FDWA 4KRXA 2BE9A 1CE8A 2B36A 3ROFA 3FNBA 2VNSA 3UFXA 1VHOA 1YZVA 1E9VA 4UMFA 1SU7A 3KWMA 3KM0A 2AKEA 1JR6A 5IUKC 3DMPA 3BC9A 1S01A 3DDHA 4B4DA 1XBTA 2Q41A 3ETLA 4HDNA 1UWCA 1RTKA 2CF4A 1J0BA 2J5QA 3CNLA 2X9LA 2HLHA 1N5OX 3NNNA 3NRJA 5J2UB 4YRMA 3PLAE 5HFNA 3R9XB 1GFZA 5A4IS 3BMOB 4K7JA 4OHMA 4CKEB 1RHMA 1RYFA 4OK5A 1I7SB 1J33A 4HTAA 1YCGA 2A9RA 2WJZB 2JLCA 2OR3A 1FFSA 4UHCA 1NP3A 3L4SO 4XLCA 2PSFA 3P0HA 2ENUA 3ODPA 1ZG3A 2RHTA 3TVTA 3BK2A 3WQHA 1G21B 2VHZA 1J22A 1DXQA 3OJFA 2LXNA 3G85A 1NLFA 3UKOA 3CY6A 1B4DA 1F2TB 4EZIA 1MQAA 1WB9A 3Q87B 1JH8A 4JVOA 3FETA 4IZHA 5BY2A 2WDPA 4PAOA 4RJTA 4CTOA 1E3WB 1FS5A 1N5MA 4J7CA 2AEEA 2GJPA 3FDFA 3QV2A 3JD4A 4BVJA 2VJAA 3I6YA 3JARA 3OIWA 1N8RD 2XE4A 1PR0A 1KSFX 3I1JA 4IQ0A 1PZGA 4HCJA 5C52B 2W71A 2EIXA 1NBMA 1C7JA 1NOIA 3CINA 4BV3A 4KR6A 3U4MA 5KOJA 5EHNA 2NSHA 2CV0A 2XW6A 4EYSA 2PX4A 4ENUA 1WKVA 3AV3A 1QFJA 2BFAA 1UBTS 2DY0A 3KEMA 4G5GA 3THXA 3R6JA 2GHQA 4WZKA 2W37A 2XDQA 3OZWA 3ZWOA 3MXOA 1GGHA 1NBEA 3EIOA 4ZVVA 5DYIA 4EKYA 5CVTA 1R8YA 1SK8A 1AA6A 1F4LA 1XCMA 2Z08A 4DWJA 1VA4A 4HQ6A 3UT5B 2W6ZA 4MV4A 3SS8A 5EQFA 4BQFA 5EKTA 1U7WA 1Z16A 3KZMA 1XKTA 3QFFA 4LUCA 3OSZA 1WCWA 3ECCA 4NH0A 4G2NA 2BEKA 5AVVA 1WULS 5L7WA 4GI3A 3ZI4A 1BHSA 2J85A 1H93A 1OZGA 3OD1A 4J1QA 4BNIA 1MJHA 1RRMA 1UZLA 3KQYA 1U5AA 4PRZA 6CHYA 4A15A 4Y2TA 1YVPA 2B6HA 4BO8A 1GUZA 2IYTA 2V59A 3H2SA 1RAEA 5CX1B 2WHRA 1P6QA 3WC4A 2ENWA 3SKBA 1P2BA 1TFRA 4FEAA 4P3IA 4K9SA 4K9NA 3UJCA 4A8HA 3W78A 4WNAA 3SY8A 4J1SA 1PSZA 2IW1A 3PYLA 2E2WA 2X8JA 5CUQA 4QEZA 4XUCA 4BMYA 4P54A 3ANYB 1VE6A 3ZCVA 3WJAA 1ZJ5A 3MAGA 1QFSA 3EGXB 4G23A 1EK6A 2JLYA 2JD0A 3A1EA 3LK7A 1TJ5A 3PA2A 3JASB 5HZBA 2ZIAA 4REMA 1UBSB 2H0AA 5H80A 5BOSB 1QDEA 1YI1A 1PR9A 1JG6A 1Z39A 1YVEI 1G38A 2EAUA 3ET4A 3NIDB 4J0HA 3RU3A 5GJWC 2JL1A 4UUBA 3KL2A 5DP1A 4N0QA 2DH6A 4OHWA 4WMLA 5G1PA 5BNWA 5DASA 2OHGA 4EJFA 5BURA 2FUG1 4YXWA 1ECPA 2D0OB 5FL3A 4CDGA 4YALA 1J8VA 1ZP6A 3BFXA 1Q0QA 4L8LA 5E2BA 1U8EA 5C4MA 2ZZNA 1XTKA 2X0NA 3JU3A 3KBBA 5LA6A 4RENA 1KH3A 2P4SA 3V5NA 4MV7A 4TUYF 4GHWA 3JALA 4F1WA 5F3WB 1BMFD 2F3PA 3WL4A 3H16A 3M3DA 3IUEA 2VDRB 2WICA 1PD1A 5D8DA 3DL7A 2JGKA 1NDHA 3OI7A 2AG8A 3A2NA 2AC7A 4HQLA 4WK6A 4JA2A 2XB6A 3RQSA 3P71T 1Z0IA 4PZUA 3ZQJA 4UHHA 2PZGA 3IRUA 3VJRA 4PXSA 1QMPA 1M8PA 3W3AD 2PCLA 2G08A 1KZ1A 4BFTA 1HDCA 3GJXC 3RBAA 2D1YA 4HNRA 3A3YA 3G8AA 5ITZB 2PLFA 1KZ9A 3GJ7A 3HDTA 4L6CA 4CKWB 2RBGA 3SLRA 5L4SA 3EX7C 1WEHA 2QORA 1J06A 1VPDA 2H1WA 4R1OA 5F35A 2ZQYA 2XIJA 3BT7A 1OOEA 1CNEA 4LKRA 2DHDA 3AG5A 4EGFA 1NOKA 1TMOA 3DMFA 3TNDA 5JW6A 1QIMA 3JPWA 3L4BC 5BVHB 1OH5A 4V39A 1JBEA 1UH5A 2X3FA 3LPLA 1J8DA 3N75A 4DSOA 4J1TA 4JOQA 4MHTA 3OAAD 2DLDA 3PUVA 5AJVB 5LBIA 1BDIA 4QUBA 5B6PA 3TVYA 3PWTA 3KLNA 2AJ8A 4FCCA 3HYTA 4JD5A 4R1TA 5HIJA 1LC3A 1LLDA 3HJTA 1I4TD 2JK1A 3OIUA 4UARA 5L46A 2YJNA 2JRCA 1SVOA 1C80A 2NUAA 2PIDA 3C7KA 1KRHA 1E2KA 3GEBA 1ZFNA 2XBLA 1Q7CA 3H13A 3LYHA 5DW0A 3D6HA 5BQ3A 3JYLA 5LDHA 1X39A 1W9MA 2XZLA 3A70A 2HNKA 4QPNA 4BC0A 4ZYXA 4TMWA 1IN5A 1Q44A 4LZZA 3F1LA 4G97A 2OOKA 2XUJA 3B1VA 3BQ9A 2Q9AA 2Z2JA 4FIDA 4NV1A 1EVEA 2ZR0A 2ZTUA 1U5CA 3DOIA 5E4FA 3TZKA 4BJ3A 2PXHA 5KHLB 2TSYB 3HYNA 1JG7A 2IUSA 2HA7A 3A9WA 3MJVA 2GFQA 3QSGA 1VIDA 4WCDA 1UKAA 1XG5A 4BQEA 4DLLA 1XJ5A 5BV0A 1KZYC 3PIRA 4OFXA 4W7SA 4F3NA 1U5BB 4UTRA 3AEZA 1ORTA 3BXEA 4NQZA 1XALA 3AONB 1CEQA 4PRKA 3ZY4A 1PTKA 1DTWA 4RDKA 3CX7A 1G2OA 5CJJA 4JMPA 1JDVA 5CEJA 2A1TS 3UK1A 2A0YA 3DKVA 1Z5GA 4DLPA 4HXGA 2Y2UA 1LI5A 3BRWD 3BZWA 4IWXA 4Y9SA 1JWAB 1CSEE 4YGXB 1FSZA 1WMAA 3BD7A 1OXMA 1T13A 3PX2A 3V7YA 1TGYA 3CLSC 1WDKA 3JXEA 1ZJ4A 4R98A 4RHCA 4DCTA 1H1TA 2LW7A 2VZ0A 2X3UA 4DQLA 1HE3A 3LX5A 2GK4A 4RD0A 4ZCLA 3AP2A 1EA7A 1B73A 2OGSA 4EG8A 2GNOA 1ESMA 3R0IA 2C8VA 2AX4A 2CUKA 3EASA 4ND7A 3ZOZA 3Q3JB 2B78A 4J4BA 4Q4LA 2BTQB 3CXRA 2MSWA 1E8NA 3A27A 1UJMA 5KB3A 4JKOA 4XLFA 5CT8A 4AMGA 1FTGA 2ZIXA 3HE3A 4INPA 4U6NA 3AEKA 1NIJA 4I14A 1U2DC 4UPEA 4NC9A 1CQIA 4JDPA 4X9XA 3NYWA 3A6KA 3BQMB 3EIWA 1NYQA 1I5OA 2XB4A 3KTDA 4NMWA 3SIPA 4EKNB 3QE9Y 4IEFB 4EYKA 1DT5A 1NXQA 3A36A 3ZD8A 1KIAA 1GR1A 1LBIA 1O03A 1UD3A 2AOTA 2PSJA 4L4SA 3UJ7A 3N2NA 2O8EA 2YV1A 1UPXA 4GI1A 2AFHA 4MUIA 1KS9A 1WKBA 2R1VB 4U2FA 2G9UA 3EUEA 1PE0A 1YJ8A 3O9VA 3GLFB 2QTTA 3ZWBA 4W5TA 1W581 2J59A 2Y93A 1GXSA 3AHDA 1LBEA 2A0FA 2SKCA 2I3AA 1CDZA 2Q4DA 3NV9A 4IICA 4J2TA 3KQHA 1CPYA 3QBTA 1A5TA 1WA5A 1VLVA 3QBVA 3IURA 3Q11A 2UUBB 3GCGA 5CTAA 4P1VA 2FPWA 3MCWA 2QAGB 3QUAA 5JJCA 3K70B 1OC2A 3SHFA 5KYNA 1YASA 3JWJA 3GDWA 4U2KA 5KJCA 2P2GA 3K0AA 3B1KA 3DUFA 3K2EA 2ZBDA 2FN9A 3DWEX 3O8CA 3C7AA 1VPLA 4E0BA 1PYDA 3STWA 4E5YA 3BK1A 1F2DA 1UMBA 1AT1A 4MAAA 5A3RA 2PKXA 1K7CA 1U2PA 2DCMA 3HWRA 3LS2A 4PG5A 4NBUA 2BGIA 3DNFA 5JDCC 4RTKA 3BCDA 1Y4ZA 3WLEA 3WNDA 2QE7D 2WKPA 1ONBA 2QTHA 4YWJA 2HJGA 2GPBA 2IIPA 3HVJA 4LZWA 3RFTA 1NX6A 3CE6A 2AW3A 2DM6A 4RK5A 5EJ2A 3BIJA 5ELMA 3T38A 1NBWB 2HUPA 3H1GA 1Y9JA 1UKVY 1O08A 2HXYA 1Y8AA 5ALVA 1QGYA 1UKBA 1IVYA 4ZAYA 1CF2O 1FP4A 4LVCA 2WJAA 2BMJA 4BRWA 4D0LB 1FSFA 1KOJA 5A9SB 1NXTA 2ZAOA 3FLBA 3EXHA 5K2OA 4BVFA 4D44A 5BN5B 1M90D 1FXSA 4HGZA 1U7ZA 5IVPA 3GR6A 5G3YA 1JE0A 1KR5A 1PFWA 2OORA 3Q5EA 2PD3A 5TRTA 4E21A 4JL6A 4RGVA 1DEOA 2C2OA 2ESRA 1CQPA 1KWGA 2C2BA 1Q2UA 2I6FA 5I7WA 1Z45A 4LV5B 1E7QA 3KQTA 4ESOA 2BM1A 2RJNA 3DQZA 4TSRA 3T5AA 5JS8A 1YZTA 2G1PA 5M34A 3IILA 4ZD6A 4LNHA 1TTQB 1TVMA 2G8NA 1K28D 4DLBA 3I55B 2N1MA 3D3EA 1QP4A 1NSYA 3CXCB 1UMDA 1BXZA 2VA8A 3LT1A 2J30A 2Z43A 2ZE7A 5EP4A 1R0YA 5ESWA 3U49A 3UWSA 1CY8A 5FOQA 1NW6A 3GRPA 3MMZA 1CUGA 1DHRA 2HIHA 2ORWA 4HNGA 4IO1A 2P2NA 4OXQA 1EUCB 2H92A 3RSSA 3ZNNA 2WF9A 5JSZB 3TW4A 3VR4A 4EG1A 3C98A 3SN6A 3GYGA 1P5ZB 1U7OA 3ANTA 3O2JA 1T9GS 2DBQA 1DXYA 3D6MA 3TVDA 2X0RA 3JAMA 1E58A 1ADBA 1Z0SA 1SB9A 1TD1A 2VP5A 1Q3HA 1PX2A 3BB4A 3GI1A 5FIUA 2D1TA 4CMIA 5AKZA 5K2MA 4RZ2A 2B1RA 3SICE 4DR3B 3COSA 4N5NA 1AMUA 4XOTA 2JH3A 3CLRC 5AXAA 1X1DA 5CT9A 2P1RA 3UT0A 2W6JD 1WNFA 1X8KA 1F12A 4IOLA 4L0QA 2MSNA 3AXTA 1T5SA 2WKWA 5E8JA 3H5IA 2WD7B 1OTHA 4QTTB 1GPUA 3DLTA 3MLEA 2C61A 1CUHA 2A67A 3I2IA 3NZEA 4ZVRA 3WLOA 4IMRA 2Q99A 5J2TF 2ONCA 3PUMA 2WKQA 3NBAA 4JWKA 1N5JA 1NLMA 2W6IA 4QBIA 3ZWYA 1PJ4A 4GOJA 4TRNA 2Y0DA 4BPBA 5H3LA 3RAPR 2XOXA 4R9VA 2QK4A 2CDNA 3JVVA 3DFFA 1UT8A 3G6KA 5HUJA 5LP6A 4HH3C 3TG2A 1KDTA 2FEWB 3MCAA 2E85A 1U1GA 2B4TO 2C54A 3FPGA 2ZB2A 2RK6A 1WVMA 3K5PA 3KC2A 3LUPA 4L6IA 2XECA 4MKZA 4S3MA 4YHBA 5FADA 3F46A 2W8ZA 3H1FA 4EYQA 5LKRA 1BS2A 3TQRA 1DJLA 1EFPA 2XB9A 1PYOA 2GQFA 1FXUA 1YL5A 4CMKA 3KX2A 4Z8XA 3I52A 4YT2A 4EA9A 4BNYA 2C95A 2R8RA 2GQ0A 3PQCA 3N6XA 4OLFA 2FR8C 3PQ5A 4P93A 4P32A 4C6TA 1W5TA 1YHQB 4YCDA 4CQLA 1PR6A 3QE3A 2OPHA 2Z4RA 3DZ8A 2IOFK 3W6OA 1INLA 3MJCA 4WZAA 4WFKA 5F7ZA 1XTUA 3HN6A 4G0UA 1M2GA 1M7HA 1PT6A 3E82A 4J29A 2J3HA 2VVTA 4OQYA 4QQKA 1NDUA 2ZBPA 5EYPA 1CEEA 3DDZX 3KOZA 1TZJA 2ZRCA 4WZBE 5AIAA 4OUKX 5JVDB 2DQSA 3CLTD 2FB9A 4PX2A 5JIBA 1A7JA 3A31A 1JZSA 3DOEA 2JKYA 3H7IA 1HV8A 4AX4A 4JYAB 5LWQA 1YJWB 1Z2NX 1PLJA 3E3AA 4TLLB 5T64A 2DFLA 3GCDA 3CD6B 2VBCA 2CL0X 4Q6WA 4C3UA 1WKCA 1TUEA 1UKEA 2BFCA 3K72B 1EVLA 4YRDA 3SXUA 2EJVA 4DBLE 1E92A 1UM9A 3B12A 4BAZA 3IPYA 4C0AC 3D4NA 5DNCA 4KE8A 2KW5A 4TSKA 5H7XA 2F8TA 5F98A 4D6XA 4MLPA 4HVLA 1SZPA 3H5OA 1PBNA 4C0QC 3USCS 1W0KA 5ES4B 2IY7A 4ZARA 2A88A 2DLNA 3F71A 5JE8A 5LQDA 1QF6A 2XA1A 1EFVA 1NIPA 1W4ZA 5DCUA 5LYJA 1YA4A 3GP3A 3UK2A 2J87A 1Q9SA 1K9MD 1BO6A 1HETA 3PVCA 3MW8A 4I4TF 3FY4A 4S1NA 1SBTA 1TQ6A 4EQ6A 4CQMA 5JZ9A 4L4RA 2I2CA 1IQUA 2BFDA 5HGJA 1UOEA 1K7SN 4E22A 1MAUA 2I3BA 3FUTA 1HR0B 4B35A 3NHSA 3O4FA 4OHUA 1MDFA 1PL0A 2B5WA 3RS8A 3VR6D 4ZVPA 2Q3MA 3KLBA 1O7JA 5CM2Z 4LZPA 4WZBB 2O2YA 3L7LA 4LVOA 3SXJA 3GLGB 1ZR2A 4LF8B 3HK2A 4CR7A 2G1AA 3IULA 3D4PA 4CF4A 2WHEA 2P11A 4M86A 1JGTA 2QD4A 4MUYA 2WAMA 4N0EA 3WLFA 4LBYA 1POXA 3WMGA 2YW9A 4LNUB 3HDQA 2L69A 3R7WA 1JTFA 5C5CA 4WACA 4Z9YA 4ES6A 3RSOA 4DV0B 1XXLA 2PTHA 2H2AA 1KZGB 2VDLB 4XQCA 4W9MC 2H7YA 2FWBA 1PWEA 1N6HA 1JEJA 1GDTA 1E3LA 3R76A 2AQKA 1VYVA 3R0JA 3ZEIA 5AW8A 5LZ2A 4KBYA 2F1LA 1EWYA 1H5UA 3CMCO 5LB2A 1A88A 3PGJA 1PJ6A 4D0NA 1YCFA 3AW9A 4JNCA 2WAAA 3HCFA 1GCAA 1USWA 2ZW9A 4YCAA 4CZ2A 4YPOA 5IYZA 5KKNB 4JENA 3BCHA 4BGDA 2F55A 3IP3A 2ZVQX 1UPUA 4MHOA 1NP6A 1V37A 1ONSA 2FFQA 3RNOA 3GEPA 2VJPA 1AS2A 2DY1A 4MWDA 4GMKA 7ADHA 1YS9A 4IINA 4NENA 2FU5C 1JR3D 3FCOA 5I4CA 3ZWXA 3MS2A 2YZGA 3SWWA 1V8FA 4ZU6X 2MYPA 1GSIA 1IBRA 4FGLA 4KQJA 2CSXA 2CFCA 1ESCA 5KC9A 5KCZA 3KB8A 3VAYA 1DP4A 4RPCA 3SYMA 4F4DA 5LUAA 1QTRA 2RHWA 1P80A 4L9AA 5EHGA 1OZAA 1G66A 2NZUG 4FMCB 1SBZA 4ZHQF 5AVQA 3QFHA 4O63O 5JU6A 5SYNA 3TLAA 1U04A 3WK8A 3AI3A 2GF2A 1NUQA 1WZ2A 1YQTA 1T9HA 3H2GA 3K9WA 2PS9A 2VYQA 1S2OA 1GIAA 1OFGA 2I71A 1RWXA 4FU0A 2DZDA 4KPYA 3MYYA 5K3OA 1Z8FA 1PZHA 2B2XA 1IOWA 3ETNA 9ABPA 2DFNA 3UG7A 2Z6QA 3HP7A 1E1QA 2C0QA 4NEHB 3GZNA 2K6GA 4R1SA 5ECDA 4AJHA 2VCYA 521PA 2Z9BA 3F97A 3PD7A 1FQJA 1FRFS 3O95A 1IRIA 3HA7A 1GD1O 4I08A 4P2BA 3SQXA 2QT9A 2RAPA 1Y9AA 5BWBA 3L79A 4AKGA 2V54A 2Z9CA 1L7NA 3O3MB 5KS2A 1YAJA 3EXFA 2Q6KA 4HL6A 4HNAB 1RXSA 1Y82A 3IGFA 1XWIA 5B1YA 2HGSA 3LTEA 1R6AA 3KTAB 2ZWVA 1R6TA 3A1VA 3AKYA 3P0FA 5T8KA 3VM6A 3ANLA 4H3VA 2IZ0A 4EB0A 1RBZA 1AB6A 2WTEA 3FSEA 1CFJA 1Q6YA 2PBLA 4CU2A 5KUTA 1P2UA 1TDJA 3VI3B 3AP1A 2P5YA 4IJ6A 1XDZA 3PNKA 1WQ3A 1XZAA 2PWPA 4HH0A 1BNCA 2GSDA 5C37A 3A4LA 3U3XA 3HKBA 2B4AA 2Y4NA 1HT1E 1JVBA 1XAGA 3M4JA 4MLCA 4DUGA 5LQRA 4YCMA 5T6MA 1T8TA 2JLUA 3WP0A 4RANA 5TQ0B 5KMGA 2YWCA 1I5EA 4D9HA 4M0CA 1XKXA 1VSBA 3DNMA 4M21A 3F7NA 1AKYA 5A2QA 1H2HA 2PTGA 2CBZA 4RIFA 4AD8A 4E4YA 4L27A 2C1ZA 5EG5A 3GOHA 2UYQA 3ZWNA 8AT1A 1F7UA 4TXLA 3UENA 2H7VA 2J32A 4R83A 2W2MA 3X1ZA 3ZQ6A 3R5FA 4WIAA 4XVRA 3KKZA 2P9QA 3BK7A 4FKMA 4NDNE 5H9WA 4QPCA 1N06A 3UPUA 4CEJA 2Y1CA 4MQLA 1O6CA 4CKBB 3M6AA 4DADA 3ZG6A 4B74A 3WOHA 2QTZA 4HWPA 3CE9A 1GUDA 2V45A 2OCXA 2QM7A 3WZMA 2C83A 4A9AA 4RD3A 1KO1A 1YIDA 2VQFB 1B3RA 3L4BA 4NAUA 1EG7A 3T1QA 3UXYA 4KQFA 4UCWA 3O3NB 5FBWB 3GXBA 1QRUA 1DAEA 2LE0A 5LOVF 1RC8A 1E8MA 4D8XA 3QQ5A 2OG2A 1TAUA 1Z4LA 5LU9A 3HC7A 1QNLA 2E4VA 2PKEA 4CF6A 5ILOA 3DEAA 4AVZA 3X1MA 1VLJA 3CJRA 4A92A 2D00A 1C29B 2JHAA 1F5SA 3U13A 1ZGCA 3P19A 4NFLA 2WPNA 4YAJA 2QRNA 4S1PA 5BNIA 5KNDD 3KQLA 1BEEA 1I14A 1Z5ZA 4PLGA 3T9FA 4E13A 1UBKS 2FZVA 3G68A 1WUIS 3I42A 5EHXA 4A6PA 1OSNA 4WDQA 4CL2A 3U60B 1HURA 2VHEA 3ZCTA 1LPAB 1MH9A 3CONA 1I33A 3N86A 3FCXA 4N9WA 1L7DA 4CIBA 1IBKB 4ND8B 1FNNA 1X8XA 3BZUA 5B1SA 1ODKA 4U7WA 1OBHA 4RCVA 2I78A 1TF5A 2W22A 2O8BA 3IMCA 3LCMA 3AFNA 2JEOA 3GRCA 1LK0A 3NEPX 4WINA 5CA0A 4F4CA 3QITA 1DCTA 4UC0A 1YRQA 221PA 4DRZA 3AF2A 2CJFA 1F17A 4OU5A 1O89A 3V7FA 2FCRA 1VSTA 3JQQA 4WKBA 4DJ5X 5C53B 3FYUB 4OV6B 3THWB 5KNDH 1HG1A 3NWJA 1DUVG 3C5EA 2VP6A 4G4GA 1KA9H 4KGZA 4BKPA 4XARA 1RLOA 3ITKA 3BXPA 1EINA 1A9PA 1RI1A 2IPAB 3HUEA 3PEUA 4TWIA 4BGVA 1ORVA 2CXTA 1TA9A 1X77A 5E6SA 4AUMA 5AYVA 5I7HA 5KJ1A 3F7MA 2OHHA 4FDAA 4E5VA 1PN3A 3GG9A 3GARA 4TKLA 1FMTA 3GEHA 4MARA 1BJTA 3KZCA 1ZX1A 3N3AC 4WRRA 1UD8A 5ED0A 3ZJ4A 4EFKA 1W6RA 4BHTA 4EPVA 4OQEA 3MTQA 2A9JA 3E3MA 3MZ0A 3ID6C 4LAFA 2BKLA 2LCIA 3IKVA 3HY6A 1K86A 4M0MA 4C22A 2YUIA 1UBFA 5A1JA 1ODSA 1XPOA 4MRVA 2OLJA 3KRTA 2VJDA 2JCSA 2QB5A 1BCSA 4NESA 1J5PA 1SVWA 1U2DA 2JHFA 4RIGA 2FMTA 1XVVA 2ZTLA 3IIMA 5IT4A 3O1IC 2FEPA 3EC1A 2EGGA 1FDIA 2C3YA 5GVRA 5DHPA 2ZSUA 2P62A 3VH3A 3WYCA 3G5MA 3ESDA 3RIHA 2P69A 1VQ4B 3IO5A 4KBGA 3TQIA 1A77A 5EUCA 1N5IA 3TLCA 3FWZA 1C41A 3PA6A 5EUQB 3UCXA 3X1JA 2CHQA 1W36B 1OILA 2Q45A 3FWYA 2I65A 3I2HA 4BNXA 3Q8MA 3LMKA 3W9UA 4R81A 2INGX 5B58T 3SBXA 4YP5A 4X97A 1YQXA 2A57A 1X7ZB 3D7LA 3DF7A 3LCJA 4H7JA 3B2QA 3LPMA 4H1HA 3HB0A 1YTLA 4MS1B 3O1LA 4ZGGA 3U3OA 3CNBA 4KODA 2JJ1A 1V0EA 2D6FA 5IMBA 1NZDA 1M1YB 2JLRA 3E7PA 1IPFA 1DKRA 2AJDA 2WLSA 4FC7A 3DBHB 4QEDA 2QLLA 3LQYA 3SHVA 4YUAA 2GS9A 4YI3A 4F8JA 2Q5OA 3C4VA 2ZDHA 4WADA 4C0BA 4BV2A 1K3FA 1YDGA 2ZJ4A 1LA2A 1Q21A 4MK4A 4IIBA 1TQ2A 5K0FA 5TS3A 1DC7A 5G4LA 4OLBA 4PAAA 3NHMA 3VISA 1QOZA 4EA6A 4BMOB 4L5AA 2C9MA 3UUFA 1ECCA 3OKPA 3OIDA 5TNXA 4I9GA 3C74A 2PKYX 3HB4X 2HWWA 1XD2A 5J5AA 2FZWA 3GDOA 4LRSB 2Q9UA 2W11A 4TS3A 4ESVA 4C7VA 2EL9A 4HWRA 3ZDFA 2ATCA 4Q1AA 3R8CA 2BEWB 2HREA 1W1IA 2R85A 2YHAA 3AFIA 4ZREA 5HKKA 3ND5A 2PS0A 2HSWA 4M76B 2J3MA 2YZKA 3RFVA 4NEQA 4U9UA 2DU8A 2CE2X 4OI0A 3IKJA 1N6RA 3FSGD 4RUKA 3SEJA 1KFKB 3CG4A 4BMDA 5KTSA 2PLWA 4I9HA 2QR3A 2IX9A 3ENNA 1RC0A 1NNUA 1EFRD 1A98A 2LWIA 1MOPA 3PE6A 3QHPA 4TV8B 2O8CB 1ZKMA 2ZRQA 1RTTA 1F9EA 3E3OA 3U6BA 2P6NA 4HAYA 4K8OA 1VE9A 2VQ3A 4YT5A 2D62A 2A7QA 1G9TA 1RCTE 4HSEA 2C04A 3NFYA 2EZUA 5DWDA 1SA0A 4EG6A 1Q7TA 4X20A 3WHPA 4H1TA 3H9EO 2Y1XA 4XJVA 2DKFA 4C08A 1EVIA 1EU1A 1YMQA 1K98A 2J48A 4ER3A 1JLKA 4F71A 5E6UB 3CX6A 4TQAA 1K4MA 5K9ZA 2ZJ0A 1S7GA 1E4EA 3DOFA 5JC1A 2OESA 1GRQA 2BV3A 1MTOA 4BZXA 3RYCB 1ZRHA 3DT6A 1JHPA 1JLRA 3LZ6A 3RS7A 5F4MA 3EHEA 5FUVA 3K70C 1Z0KA 3KJFA 3N2ZB 4KAAA 5GV7A 1DRUA 2IYOA 4MXDA 3BOSA 1QS0B 3OMLA 5FR1A 1VCHA 1ZSNA 2ZPTX 5GGYA 4AJNA 4ENPA 2XKJE 5ICMA 3G3EA 1OU4A 5TARA 1YH3A 2G76A 2PZ8A 2XLCA 4Q93A 4OQZA 2ZZGA 1I6MA 1I2CA 4LTDA 3ICOA 1XFDA 3ITEA 2JFHA 4PGGA 1EFHA 3CUKA 3OFSA 5D01A 1FB5A 1GNSA 2WE7A 3X1WA 4DA7A 2X5NA 4E1BA 5JQGF 4YH1A 2YV4A 4REQA 5HIAA 4NS4A 4ZVKA 4QGBA 3R8XA 1VLHA 4ALMA 5H5JA 3AB7A 4LOHA 5JECA 1IK4A 3JQBC 1ZK3A 4OJMX 3T54A 4BNWA 1CVLA 4HYEA 2C4TA 3BCUA 1OPRA 1AMOA 1T9ZA 3ASQA 3HWWA 3RK0A 4CMCA 4B7XA 2W2LD 5CG2A 3G6WA 4J2HA 4YDRA 3RTAA 4XYMA 1F8UA 3OLWA 3ENZA 1Q14A 5D51S 3CHYA 2ZS7A 3OU2A 3TRHA 4D9NA 1IHXA 2YJTD 1BQ3A 5JASA 1NXPA 3EPRA 3SX2A 2WP8J 3IIEA 2JJ2A 3BMCB 3QW2A 3S7ZA 1TM2A 2XZTA 4Q4AA 1MPXA 1UL1X 2A1UA 3ZXUB 4YEJA 5E1BA 2IX3A 3K0KA 621PA 4HLCA 3RWBA 3LX8A 1N9GB 4V1CI 3NCTA 2X6XA 1IIBA 1EGQA 2HLDD 5FA8A 1OFTA 2A59A 5KU1A 4HRAA 2W6MA 4ZODA 4WL0A 1I0LA 1VQ9B 5A3QA 1J2EA 3MSCA 2H2FA 4L8FA 3N7TA 2KLHA 4OQQA 1GO2A 4QUJA 2G1JA 2Z1MA 2Z2YA 4WLOA 5BQ5A 3K71B 4HX5A 4RIEA 1SQ5A 1ZZEA 2WZQA 1N25A 2OQIA 1RYBA 1H1LA 1TK9A 3DVRX 1M1XB 3EJ6A 3JYQA 2UZ1B 4PPFA 3U7FB 3SSAA 3ZYZA 4EX7A 1E9EA 1VL6A 2DULA 3JY6A 3MPUA 2VUSA 4TKVA 4ZCRA 1SKQA 3HN2A 5JYDA 1QLWA 4GYWA 1XLVA 3L7KA 3R6KA 1WD5A 2R60A 2V6GA 5ALXA 3X2SA 3Q88A 2O1SA 1G20E 3H1TA 3OP4A 1W93A 1AZWA 4Y2SA 1BA2A 2D5BA 3LCCA 4QBTA 1YU6A 3K09A 4BFLA 1GG2A 2VBVA 4JVSB 4BJHB 1P81A 4Y2UA 1FCJA 3IXQA 3U6KA 3UXHA 4FT2A 3SCZA 4DJAA 1SXJE 4DK1A 2FTKE 1DC3A 4QELA 2O3QA 4QVIA 1MJ5A 3MT0A 3AUUA 4MCJA 1YZGA 2M1ZA 5F5XA 1HC7A 4F4JA 3W5CA 1RJWA 3FRHA 5E7JA 3SZLA 4A7PA 4U2GA 3MN1A 4DLYA 2R6AA 4DBVO 1S2GA 1V6SA 1QZTA 3P2YA 3OPYB 4G4SP 4YGYA 1RU3A 5DYNA 2ZSKA 3TM5A 1GRVA 1TO2E 3E1GA 9LDTA 4X0CA 2NWQA