4F7DA

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
246
Chain Sequence
SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 76
structure length 246
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4f7dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4f7dA02
1XB2A 4RD6A 4K1XA 4RCZA 2AHOA 3AVXA 4AC9A 3CCLB 2VNHA 3WNDA 1EWYA 3W2FA 3AVTA 2DCUA 3OJXA 1KRHA 1QFYA 1TVCA 2EIXA 2NPFA 4Y9UA 1G7TA 4P3YA 1B2RA 4NCNA 2CNDA 1ZM2A 2B5OA 3V76A 2VYQA 3AVUA 3AGPA 3OZUA 1VQ7B 1E64A 2FX3A 5JBQA 1ZM3A 4F7DA 3VNVA 1QVGB 3WYAA 3ZZUA 5TR9A 1KQSB 1ZUNB 2QTLA 4U9UA 1Q81D 3CCRB 1QUEA 3CW2A 2OK7A 1K9MD 2BGJA 3CCMB 1JB9A 3B78A 1W34A 3QFRA 3ZZTA 2BF4A 1VQPB 1VQ6B 1AIPA 1FNMA 4M2LA 2XEXA 1VQLB 3CPWB 1QFJA 2ZITA 1VQ9B 4HE5A 1E63A 2PIAA 4P6VF 4PC7A 2VZLA 3MHPA 3P27A 5H59A 2DETA 1YJNB 4RD3A 1EP1B 2YWGA 1QGYA 1IJFA 4N3NA 1GO2A 3ES9A 3W5UA 4PGOA 1OGIA 2E1RA 1VQMB 4PC1A 2RC5A 3SJZA 1FNBA 2PMDA 5FA6A 3CD6B 3VMFA 1R5NA 1K8AD 5TV2A 2VNIA 3CRZA 4TMXA 2GQFA 1K73D 3U6BA 3G6EB 4M1KA 3B82A 1KC8D 3E1YE 2BGIA 1QH0A 4RD4A 1CNEA 1M1KD 4DQKA 1Q82D 1OGJA 4RD1A 1G7RA 1KJZA 3WBJA 2OK8A 3ZZ0A 3CMEB 3VO2A 1KK0A 2J7KA 1DG1G 4RJLA 1R5OA 1TLLA 4TMZA 1ZM4A 3ZBUA 2PLFA 1W87A 4ZGNB 1YIJB 1W35A 3I1FA 4LC0A 5AN9A 5DSZA 2QA4B 1Q7YD 3I56B 1DDIA 3JQQA 3AVWA 2HCJB 4TN1A 2YWFA 4M4SA 4QHYA 1U2RA 1JA1A 2QN6A 1D1NA 1EP3B 3FJOA 1QVFB 2BN4A 1A8PA 2BVNA 3QSYA 4B47A 4IW3B 1YJWB 4Q7JB 1GAQA 3G4SB 3CC7B 4B43A 3CXCB 4G1VA 3WY9A 3LO8A 4TMVA 3W2GA 5KSWB 2GPJA 1YI2B 4YHBA 1EFUA 1TTTA 3QFSA 4ZV4A 1D8TA 3FPKA 1JJ2B 5GV8A 1F60A 4B48A 3AGQA 1KK2A 1QG0A 4YAOA 4ZCLA 1VQ4B 1R5BA 4TMTA 1QUFA 4H9GA 3WNCA 3LVBA 4YALA 1EP2B 3WXMA 4RCYA 2YWEA 3JQRA 2C78A 4ACBA 1ELOA 1N0VC 2HDNB 3W2EA 3VNUA 1SKQA 1JA0A 3I55B 2HMAA 1WDTA 2VNJA 1IJEA 1M90D 4ZCIA 1FNCA 4Y7CA 1S0UA 4QFMA 4LBZA 1FDRA 1SM4A 2BV3A 4UAJA 5TY0A 3OW2B 4PC6A 3CCEB 2DERA 3ZC3A 1GJRA 1YHQB 4BPRA 4DQLA 3CCUB 3AVYA 1KK3A 4RD2A 4AF6A 5H5JA 1NJID 3LRXA 4NBSA 1KD1D 2QEXB 5THXA 3W5VA 2OTLB 1OB2A 4FWTA 2BSAA 3U6KA 2QTZA 1QX4A 1B23P 1DDGA 4B4DA 1CNFA 3WNBA 1HA3A 4RD0A 1G7SA 3J81k 1I7PA 2B7BA 3QE2A 3WBKA 4ZGQB 2QMUA 2YWHA 1XE1A 1S72B 4PC3A 1VQKB 3CC4B 3QFTA 4MYUA 1EFCA 2CRVA 1EFTA 1BX1A 1FNDA 1GAWA 1J9ZA 2VNKA 4ACAA 2OTJB 2XNCA 3LYUA 1YJ9B 1FRNA 4M0LA 4YAFA 4YAWA 3JQPA 4PC2A 2EFGA 3OJWA 2DY1A 1VQ5B 3CCSB 1VQOB 3AVVA 4FN5A 4MYTA 1QFZA 5HXBA 4EH1A 1CQXA 2BPOA 3CC2B 1BJKA 2QDXA 5EMNA 3A1FA 1KK1A 4TMWA 3W2HA 1IB0A 1KTVA 4C43A 1YITB 1N8RD 1GVHA 1N0UA 3W5HA 4B44A 3ZBTA 1VQNB 1VQ8B 3CB4A 1NDHA 4G5GA 4YAUA 1EXMA 2BM1A 3P26A 4AF7A 4C0SA 1QGZA 1TUIA 4HE6A 1JNYA 4G1BA 3CCJB 2DEUA 3B8HA 3QFCA 1F20A 3OZVA 2BM0A 1BX0A 1H42A 4FK8A 3U2QA 3CCVB 4LBWA 4LBVA 1DARA 4ZCMA 3OZWA 3CCQB 4Y9RA 2RC6A 1E62A 1BQEA 4R71A 1AMOA 1G7CA 3MMPA 3G71B 3MCAA 4N3GA 2BMWA 4J0QA 3W2IA 1Q86D 4B3XA 4M53A 1UMKA 2R6HA 2XNJA 1ZM9A 1GR1A 1OB5A 3VO1A 4WQMA 2C77A 2X3UA 3PENA 1FRQA 1D2EA 3CMAB 1H85A 4LBYA 1QGAA 2D74A 2B7CA 1W2BB 3E20A 5GV7A
chains in the Genus database with same CATH superfamily
3BQJA 1XB2A 5C7OO 2HWXA 3D7LA 5EHQA 2WUFA 4MXDA 3WQHA 1U31A 3O73A 4NU0A 1XX6A 2F3RA 1HI9A 2OHFA 3NVMB 4JOSA 3ZJVA 4B1FA 3ASZA 2VPZA 4OM8A 4HCJA 1RXSA 3INRA 2HSZA 5SY4A 2RJNA 3I04M 2J08A 1SXGA 3WJ2A 4J6EA 4B8YA 4GMDA 3DOHA 1BJRE 5BN5B 1A4IA 3IESA 2Y2VA 4AROA 1V0JA 4KP7A 2CUTA 3VQTA 3K9LA 2EIXA 5EJ8A 4UUBA 1Q84A 5JI2E 1SOWA 5LLDA 2Z6QA 4DEXA 3INYA 3OEYA 2Q2QA 1RDFA 4EFKA 2NYRA 4HDMB 2QYHA 3GG2A 1PZEA 2OBSA 4NCNA 4ND8A 4QU9A 5GM1A 4KE6A 4C14A 1HNXB 3TFWA 1PTJA 3N74A 3TZQA 4TROA 5CDTA 1CB7A 2HYDA 2B8NA 2Y99A 3H2JA 3VUEA 1F6DA 5DX1A 2OCXA 4ZCPA 3ZOZA 4G0UA 1XZMA 4Z7JA 3W3AA 4ZMBA 1E77A 1V5EA 1OFTA 2D62A 5KHOC 2W42A 1UBEA 2VYQA 2GILA 2X19A 2G1KA 5J1TB 3WJ7A 1AE1A 4K8OA 1Q1AA 1AKEA 2PCLA 3ZCXA 4AVYA 2ASVA 4CFZA 4EG0A 3C7AA 3I9NA 2FQXA 4XLTA 1ZWKA 2XF8A 3FI9A 2ZUDA 4MQLA 5P8WA 1TYZA 3H6KA 1ZUNB 1Y7PA 4OUDB 4U9UA 2E9SA 2P1RA 1PYOA 1XP8A 2HFKA 2ZUCA 3DQQA 3K6JA 4J8PA 3CCRB 3ZLTA 4A2WA 2VTEA 1JDZA 2VJIA 4Y2YA 3W5IA 1K88A 4D81A 4I5DA 2ZE7A 5ABPA 1E7SA 5HILA 4FMCB 3BMXA 4RY9A 4R8KA 2RHMA 4B40A 4EL5A 3QRWA 3SXPA 4HAYA 3T3PB 2JHPA 1DBVO 4GEGA 5HZKA 3HCPA 3U5ZB 4BNFA 4ZVQA 3PVSA 4TN5A 2BGRA 4KU4A 5A6VA 2KLBA 2NZ8A 3AFOA 2CJWB 4C03A 1MABA 1EK0A 3F9RA 4FUQA 2HLDA 3H04A 4FYYA 2XUGA 5CX1A 5H8WA 1I3LA 4L5CA 1EFAA 2WKPA 1S2LA 1Z68A 4FLFA 5IH3A 2M9MA 4EHLA 5C35A 3B3AA 3KWLA 1E2HA 3CO0S 5LP1A 1BDIA 1UD8A 1R8SA 1R00A 2HDOA 6CHYA 4H1UA 2C1ZA 2IOFA 3L8FA 1RXUA 2PUJA 1UC4B 2IUYA 3A6EA 4OOSA 1NI5A 2P41A 1RXIA 5JMOA 4EB3A 3EB9A 4ES6A 4BS9A 1AN0A 3URMA 4IH9A 1I4OA 1WVMA 3FLEA 2P0EA 3K9CA 2GKSA 2PKRA 1ISJA 3QQPA 4OH1A 1J97A 3P97A 1LI4A 2PVPA 3E3MA 2VPWA 4UTZA 4CM6A 2ORWA 1JAXA 1Q1GA 4RW0A 121PA 4HDSA 3OMWA 5A05A 5EIBC 2W70A 4ZVPA 1DAIA 2PKYX 1LLDA 3PF8A 1DXOA 2NU6A 1G8PA 2VYVA 3U4AA 1IBSA 3G0IA 5F4JA 4TLAA 5GAJA 3U44A 3TNLA 5IX8A 5L8VA 4R05A 4BVHA 4GPEA 1G8FA 2QNIA 1UZUA 3H2YA 2Y0BA 4MIEA 3PA1A 1SXJD 2G36A 4WDQA 3RIHA 2MSWA 1QHSA 5B1EA 3BD8A 4FYWA 2QSJA 3ZGZA 3QM1A 3HU5A 5IK2D 1ZVVA 3QJ5A 3G13A 2DHEA 2FPIB 1JIXA 1Y3AA 2B4TO 4PYQA 5HIKA 1F4VA 1L8LA 2QTRA 2XWJI 3RRXA 2PJZA 4UUAA 1VDZA 2VSYA 4G1CA 2DB3A 2EWVA 2XYRA 1D1SA 2GAOA 1G8JA 3WB9A 1R0WA 3IKMB 3G6EB 1WP4A 2AH5A 1YHNA 3B82A 3QMVA 1KC8D 2QTHA 3PP8A 2XV1A 3LKBA 3JR7A 4H4EA 2D13A 2RI1A 4N7RA 3AR8A 4S12A 4UQLA 3U9SA 5DBFA 4G5RA 2HH9A 1U2QA 2IIBA 3HQ4O 1CRPA 2P2NA 4G7WA 2Q4BA 4MICA 4BLVA 5DHQA 4Q3EA 4RHFA 5DYTA 3KCNA 4FGJA 4I5GA 4F93B 4EY6A 1E4YA 7AT1A 2HSJA 3A3BA 2P2ZA 3ODGA 3I30X 2WYIA 2VJYA 3RSQA 1G7RA 2F4NA 3L06A 3U49A 3ETGA 4DIDA 4LF9B 3JVIA 2NXNA 4X95A 3UYLA 3OOSA 2XGGA 1KU6A 1J23A 1P9OA 2FEPA 3H5WA 3IUQA 4OY3A 2DYIA 4D8WA 2WI8A 4NK5A 2WM8A 2X6TA 3NTUA 1DG1G 2FEKA 5BSKA 4MVJD 3PI6A 2HYIC 4Q9NA 4CMCA 3MERA 2H1RA 1H3EA 4RVCA 3ZKWA 1M34B 1XLWA 4GKVA 2PRJA 3Q9UA 2XCOA 3ZV3A 1PR6A 2TECE 5CIYA 5DSZA 2RJ3A 3B6IA 1QO9A 3ETDA 3LTEA 5LQCA 1AK9A 2QA4B 1ZISA 2OMEA 1E9VA 3I56B 3PHHA 2ZUTA 1KYXA 5D7BA 5JVDB 2PSFA 4G25A 2CMKA 1Y1TA 3NCHA 1IWPB 4K6CA 4MWBA 2HCJB 2IBMA 2OAQ1 1K6IA 1W7AA 4FOOA 2YWFA 3GJ3A 2IYFA 4IDHA 4ETMA 4NCIA 3P9NA 3MTBA 5BRNA 3O4RA 4REOA 5EIOA 2XZLA 4ZEOA 3FIUA 3T5GA 1D6MA 3KK0A 2QN6A 3F6SA 5LQRA 3DZFA 3N76A 3NV9A 5C8ZA 4MUKA 2FJUA 3UAYA 2C7RA 2HDHA 3BXXA 3SU8A 1E0JA 1F8FA 4AO6A 2ANCA 1JQLB 5A2QA 3M70A 2JKVA 2VAWA 1QRTA 4R6XA 2I4OA 4HYEA 1C7FA 5JD6A 4K46A 1NP7A 4ID3A 2GRUA 4JUAA 3ICCA 3ZU2A 1AGXA 4MKFA 3M6LA 2WJPA 5LNK1 1T1GA 3B36A 4XOIA 1SC9A 1Z74A 3NBKA 4OQLA 3HCOA 1IN4A 1T9ZA 2RK3A 2V5AA 4CR8A 5GVSA 2P6UA 3CT6A 4TKOB 3ASPA 2J3JA 4A91A 1WQ4A 2EJVA 4YWHA 4UTRA 3U1BA 3IBTA 2Q7OE 5GIOE 4MGIR 2PHZA 3V7WA 4OA8A 1YJ5A 5ULLA 1K6EA 4HNSA 2XQFA 4DQUA 1GPJA 1X1AA 3NHZA 4B48A 1CQJB 5ELLA 2JI6A 3FKSD 4BC1A 4HQRA 2VT3A 1NZJA 1WTHD 2I3GA 3S5UA 2FSUA 1JFRA 2NXJA 2NVUB 2HA3A 1O57A 3MJ4A 3MJDA 2XBMA 3VJMA 2PSHA 2O7NA 1QUFA 4Z2YA 1TADA 1VP3A 3WNCA 3SS9X 2ZT7A 1SMKA 5G0SA 3UAXA 1W29A 1SUPA 3GROA 3HI6A 4G0ZA 4RFSB 5HKOA 1F0YA 1Z12A 2D1QA 3RRFA 1L7MA 4B6RA 2ZT6A 3QEBZ 1E1LA 3PWTA 2YV2A 3WRWA 1VJ1A 4YRNA 2ZSHA 3KQQA 1N0VC 1C1XA 5FBLB 1ATIA 1TL7C 1QR6A 3QPAA 3QH4A 3MTGA 4LDNA 4OQNA 1KZGB 4FSHA 4W1RA 4ZZ1A 2QE6A 1RPAA 3WZLA 1YDMA 1ISIA 3N3AC 4YUAA 1LBHA 5JWHA 4MV1A 1WXGA 3ZJ5A 2VNJA 4BKRA 2HPHA 3EUWA 4CQJA 1RPJA 4V1CI 2QY6A 4WN9A 4AQ7A 1M0SA 4NBTA 3DEHA 5FUYA 2G9RA 3PGA1 1DV1A 4DMHA 4DW8A 1ENPA 1F12A 2DT8A 4Y0NA 4HG2A 4QFMA 1P6XA 4LBZA 2JD1A 4BCDA 4EJSB 1W2GA 5AKJA 3ULKA 1OBHA 1PVVA 2GJAA 1AV7A 1NBEA 4H7IA 5AM0A 1JJ7A 1THGA 3ROFA 4V0SA 1XAGA 2ACKA 4LYAA 1W19A 3W7AA 3D3JA 4C7BA 2GKGA 5KYWB 1DGQA 1P4HA 1R4AA 2IGBA 2RHJA 3H19A 1W0JD 4H7KA 4GECA 3FDZB 2JJMA 3RVMA 3VR2A 4ZGGA 5C37A 3I61A 2QPOA 1QIKA 1TDJA 4D5EA 3BZUA 3FBGA 1NJ6A 1NXPA 3MS2A 3KQVA 5ESRA 1EWTA 2YYAA 1I4WA 3ZHOA 5BSHA 1Y8RB 1MEOA 3K9NA 3UK1A 4MUJA 1XRJA 1EUDA 1UQTA 5C8YA 1G16A 1FFDA 2W6QA 4WFKA 2JI9A 3A28A 4AF6A 5JZ9A 2IPMA 2XHZA 1MB4A 3BHJA 4H1TA 2ZJ4A 4R8LA 5DHSA 4ETIA 3THSA 3A3YA 1CR6A 3D31A 3Q0EA 3TBFA 3AB3A 2DFPA 1L4HA 4UBIA 1XWIA 3ELUA 1DUIA 1E5DA 3K4PA 4HXEB 1EE1A 1WDLA 2L17A 1N0HA 3N28A 5G2OA 3MPOA 2XA9A 2XVMA 2RGAA 2QTGA 3IHLA 3OX4A 5G41A 1VCHA 2GNOA 1OAOA 1QJ4A 1T2NA 2O8DB 4LZPA 3QK7A 4ZRMA 2R7AA 1TA9A 3V2GA 5KSOA 4G6ZA 3MCWA 1DJLA 4XN3A 1YA8A 1QU2A 2MMCA 3PA6A 3GW8A 3BXHA 5D6OA 4B87A 2RDMA 5HZGA 3K30A 4US1R 3ELDA 2YJZA 4FCTA 1UKZA 5K0GA 2FW7A 4EHFA 4NHOA 4ZYYA 2CB9A 1SUBA 2GBLC 1KAMA 3UT0A 2C4TA 2HY7A 2GZ1A 3HUDA 3ABOB 3K1JA 4P3XA 4OQ4A 4UFNA 1P5HA 4ZGQB 2CYBA 1CXZA 3JYLA 4CGYA 1GA1A 1CUUA 4FQ5A 3VU1A 5B7NA 2D5CA 1QH8A 2QPAA 4Q0MA 1QHIA 1V5WA 3VPGA 4DLTA 1JKJB 4AZ3A 4B2YA 3N53A 2EZ8A 1DTSA 3U7IA 3HZOA 1T9KA 1VE3A 2HGSA 2A78A 1G20B 3HU2A 4KV9A 2F55A 1ZM7A 1RWBA 2OCYC 2WHRA 4II7A 5TQ2B 4DM7A 1OKKA 1VJDA 3RVLA 1BX1A 4RMGA 1EVJA 2DLDA 2ZZQA 1XC7A 2PXHA 4EY3A 2GK3A 3TX2A 3VVCA 5CB4F 5LCXA 7REQA 5ICCA 4IWXA 2XB2A 3BUSA 3BWBA 3DHWC 4QJ3A 3THOA 1XZHA 5H4GA 2H29A 5KYVA 5I7OA 2JLZA 3DZIA 1X2BA 2LRHA 4KN9S 1XEXB 3QVUA 3O26A 2POCA 1N5JA 4NJEB 1MNAA 3H1EA 4EENA 4X54A 3MGKA 4Q7LA 1NOJA 5JOQA 1GEEA 1LI5A 3K71B 4OSOA 4C5AA 3ADCA 4QOGA 1YRAA 3S8MA 2O8NA 3EE6A 3NHYA 3GQBB 4DLLA 5CFZA 4FFBB 1YR3A 4EH1A 2P6MA 2RI6A 4F6LA 2YZNA 2P3LA 5E4YA 3E1KA 5DTMA 3NTOA 1KL7A 2ZRCA 3NTQA 4KQCA 5FFNA 1MMFB 4OKNA 4Q7MB 2QUBA 5CVCA 1TM5E 4PABA 4H08A 3DHNA 4H15A 2P91A 4QATA 4TMWA 2C88A 3AZPA 4NDNE 4TTPA 4B85A 1K89A 1JR3D 2GJKA 3IEUA 3K0EA 5AJUA 4C06A 1VSVA 4UVDA 1QQAA 1HFWA 3L49A 4HZIA 2ONJA 3M81A 3ZBTA 4FOPA 3R8FA 1PK9A 3F47A 3H11B 5NULA 4PCVA 4MS4B 3U1VA 5JECA 3S40A 4JC0A 1N05A 1BWPA 5JXHA 1SVUA 1XTQA 1ECJA 3IAEA 3DCNA 1K7XB 3CIFA 3VI4B 2H2HA 1KY5A 2D2IA 3STVA 2CNNA 1PGJA 1H66A 2FV8A 4LS3A 1IBKB 2Y1WA 1HDZA 4LA4A 1O95A 2YXEA 5ALUA 2WD8A 2GPTA 2YWDA 5CNMA 4CF5A 2GGSA 3QYAA 3ZDDA 3DPUA 3PZRA 3PGXA 5BWLA 3MELA 3P2MA 4Y8VA 3EA4A 3PGKA 4KAXA 1AQYA 1PJCA 3C74A 1IWBB 4B6SA 4EO4A 1QVAA 5FPQA 1T1JA 1ZGHA 3LUDA 3WLJA 1GNSA 3CCVB 4RABA 4RH3A 3G68A 4BU0A 1PV4A 3VC1A 1UKVY 5FLEX 4PAWA 3LHFA 4JJKA 3WLPA 4P83A 3SNKA 4N5IX 1SVLA 2SKDA 2NP6A 4Q6WA 4RA9A 5HP4A 1F5SA 3ZXYA 4M37A 5IMSA 3D5QA 3DFKA 1A8SA 4O1IA 3BH6A 1UBTS 5K0LA 821PA 3EXIA 2G7ZA 2ZJAA 1UJMA 3KJGA 3NHRA 2I6GA 1EDOA 2VHJA 3USCS 3W2IA 5JXWA 2YTZA 2ZYIA 4IS2A 4P98A 3KXLA 1X8LA 3TIXB 4MW0A 5IBQA 4W6QA 3P9QA 2WSLA 4V2UA 3VO1A 3BFJA 5EJFA 2ONKA 4DY6A 5CB8A 5LNK6 3WNZA 2IF2A 3THRA 2NU7A 3I9KA 1NTOA 4K6GA 4R51A 4BFYA 8AT1A 5KWVA 4L2IB 4YUYA 3R6KA 2C99A 3E9YA 3OLYA 1C7IA 2QRUA 3E27A 2BOVA 2D2XA 1EE9A 4WJZA 1Z4OA 1ZI6A 2YJNA 1G60A 4HNQA 4PX3A 2H4XA 5CGQB 2V7QA 1RLJA 2DX7A 5HFAA 2EKBA 4BKQA 4F84A 5GV7A 2ZLBA 3G2QA 1BMFD 1R6DA 3WK9A 1G21E 2GREA 3A1VA 4FMCF 1NL3A 3TIVA 2OZEA 3VVLA 2C57A 4DZTA 5H9WA 1E43A 3OWHA 3G8BA 4NSNA 5B58T 3STYA 5DBEX 5KS2A 4K9MA 3CCLB 2A5YB 3I01A 1KOGA 1UM8A 3CZMA 2VF5X 3AUUA 3F1KA 2V74B 3BJIC 1YK0A 5FL3A 2CV0A 1N7GA 1QZ3A 2PZEA 5KYXA 3LBNA 2M5SA 3MSCA 2OV2A 3DMDA 3RASA 3HYCA 3FF4A 2OYSA 1KFCB 1HMYA 1QO7A 3D6MA 3EXHB 3QUQA 1MV8A 4HFMA 3WYBA 5IZCC 1XMQB 1UZNA 4GOKA 4BNZA 4YFYA 1PWZA 3RYFA 4B3HA 3IP6A 3LDAA 4LJLA 3GJ8A 4AG5A 4L4YA 3GLFB 3QVMA 4Q39A 1AU9A 2GA8A 4D79A 4IDDA 1M1YB 2VBGA 3C24A 4PE5B 3KDSE 5EJMA 4HVAA 3EY4A 1J2EA 4EOGA 3T6KA 2QN9A 4YJHB 4DBZA 2SCUA 2BZ0A 2VDVE 2CLCX 3ZE7A 3ICEA 3QVJA 2QD5A 3C7DB 5GIPE 1OFIA 3FTEA 1CU1A 4QOFA 3NLLA 1JUDA 2CNOA 4PZ9A 2HSDA 3LOPA 4F4JA 1E9SA 1OLXB 2WPDA 4KQKA 4X24A 1JWLA 1Z8DA 2G5GX 3KCQA 1VPWA 2CXUA 2LGJA 3QLUC 4G4IA 4S1WA 4HNAA 2VATA 3D3KA 3QJGA 1S9DA 3RV4A 4XOPA 1ONBA 2OP1A 1ZD9A 5DASA 4KVAA 1Z0AA 2H2GA 2B34A 3HU1A 4BRUA 3GN2A 4JX8A 5DNWA 5G1NA 3EF0A 2MJLA 1OXSC 4H3SA 1Y7HA 2YINC 3WAKA 3RRNA 3DEJA 1MXFA 2ZI3A 3GVKA 3BJZA 4PZPA 3PC7A 3K20A 2W6JD 4TVBA 3RYCA 1QCYA 1IAQA 4UCFA 3RRJA 4C4YA 3EMVA 4YT5A 4KR2A 1SC4A 2MYTA 1HOTA 1GQSA 2O05A 3ACCA 7MHTA 4Z86A 2QKYA 2EYQA 3KB1A 2J8ZA 5I51A 2R8EA 2I1WA 3GGPA 5K0EA 1P1CA 1EK1A 1RRVA 1OASA 3L0CA 4WXRA 5AD1A 1ADFA 2CUNA 4P6VF 2GX6A 2VG8A 4I46A 3HGTA 1ZD3A 1S3FA 1BMDA 2CNLA 3GRUA 4QRHA 5B3JA 2R3SA 3HKBA 3SM3A 2C9DA 5J1SB 2AN3A 2ZRNA 4CM8B 2CT8A 1PFQA 4TL6A 4JIGA 5I8WA 1R4MA 4G56A 2GVDC 2PJDA 3IAHA 4AS2A 2BRUC 1G63A 4RYDA 3VSCA 3RYIA 1VF7A 4B3GA 1ULTA 2ATEA 3R0QA 1E18A 3SQMA 3ZU3A 2ATVA 4A0HA 5EWJB 3A10A 3KTDA 3UMBA 3NWOA 1E8NA 4NBLA 4EFDA 2ZJ6A 5LOVF 3TM4A 1CUIA 5F2EA 3IAM1 3RJTA 3EULA 1RM0A 1P5FA 4FEYA 3D54D 4KXUA 1Q7RA 5DHRA 4A15A 5T3YA 9MHTA 4KOEC 4YV2A 5DT9A 2HMYB 5FFFA 4YN3A 1CHNA 1H2WA 3R5FA 2YOGA 2A86A 3EC1A 1AX9A 2ZPTX 4UMDA 3H99A 4US2R 2JDID 3QKSB 5CAEB 3AQIA 3LLUA 2KBEA 2ZM6B 1SB9A 2P68A 3ORFA 3U7QB 1A27A 1X19A 3M4YA 1NRXA 4KQFA 4GX5A 4YB8A 4PAAA 1NNEA 3HL0A 3LFHA 3ZNQA 2LVBA 3Q7EA 3HJAA 3LC2O 4L3WA 3E82A 3IPYA 4F92B 2LCQA 1VSTA 4UXHA 4OBXA 3VU3A 4NDZA 5T4HA 1L6RA 3VZSA 4QQ8A 3BHIA 2IEAA 1XZNA 3L8YA 3X2EA 3AJAA 5GINE 3CW8X 1M8KA 1DEOA 1W85A 3RIGA 1RQNA 2V31A 1J0CA 4D3XA 1VXOA 2QM3A 4HQFA 3FR8A 2PQ0A 1VB5A 2PLWA 3AHGA 4OBBA 3IIMA 4CT5A 5K6AC 1EYZA 1U94A 5TJ9A 1KDVA 3D6AA 4K0KB 4W1QA 1EFRD 1THTA 2WIBA 3GUZA 4CLXA 1HRKA 1LSJA 2BIFA 2VHVA 3DDWA 4G0MA 4IKOA 5EZYF 3RBXA 1J21A 3ZZ0A 5FB3A 4K9KA 5B4TA 1SHKA 4Q34A 3KT8A 4CKXA 2VRBA 3A6GA 1E2MA 1L5MA 4E21A 2R7MA 1E94E 1KI3A 1TJYA 1XAHA 4B5KA 4RDJA 4LXXA 4BASA 4BJ1A 3LG2A 4GI5A 1L5RA 1KGSA 4LVCA 1I33A 3H9QA 4LX0A 2QZPA 2HU8A 3GYGA 4ZARA 4ZGNB 4LNHA 2BEWB 4J0CA 4NMLA 5IHPA 4L73A 1VLQA 2R00C 3O9MA 5EKUA 2XXJA 4HI0E 1DTWA 4RL6A 1QKKA 4PG7A 2GNAA 1Q7YD 1XCMA 1BDBA 5FTLA 1WB9A 1AQJA 2H92A 1DDIA 2HCBA 3K0AB 3QPCA 2BEJA 1E3EA 3GLHB 1OIWA 4QC2A 4QGBA 4W5TA 2VKQA 3KVYA 3WGKA 4K40A 2V9PA 1TLFA 2VJPA 2H5EA 2EJUA 3PV0A 2ILTA 3ANXA 3QFHA 4NI5A 3Q87B 4WCDA 3UCFA 1Y6GA 3D8BA 3H9UA 3NYRA 1V7PC 3G8DA 4QUDA 5DGHA 4HP8A 5DTJA 5IASA 2UYCA 1B1AA 2J7PA 3W9UA 2CCKA 4PONA 2YY6A 1G55A 3L84A 3UMYA 2I2AA 4PLPA 4S1NA 2HDWA 2BN4A 1JHDA 4NYJQ 4PY2A 1GAEO 1VPDA 2C9YA 4HDKA 4RGQA 2AKEA 1GSOA 1P0QA 2DQZA 2YXBA 4JGGA 4B47A 2JIOA 5P21A 3A1DA 1RT9A 3CVWA 2J9XB 2JLSA 3RUDA 1G5QA 1T4MA 1ZW6A 2C82A 3G4SB 2AV6A 5JZVA 2DWQA 1FMJA 5K99A 1O9BA 1W8IA 2BFOA 2KJQA 2RK4A 4EIWA 4WIAA 2PZLA 4YXWD 3L6UA 2PU7A 1CQIA 1NKVA 3N6VA 5LDGA 3OIVA 5LUAA 3I2FA 2ZUFA 4ANFA 2AOVA 1XTZA 2GPJA 4D9MA 5EYPB 5FWAA 4X05A 4R8RA 1RJEA 4UEQA 4C6HA 3KEGA 2BAGA 4MR9B 5AVZA 2Y6VA 2BFBA 4IXNA 4UHBA 3O3NB 3E18A 4RENA 1KEWA 4ESVA 3M33A 2UZ1B 4H0CA 1JJ2B 3TRIA 1YKGA 4JODA 3NAZA 2J3HA 3R3WA 5GV8A 1KZ1A 2ZXFA 4HGOA 4Q1BA 1YB7A 4K9PA 5J63A 5BV2P 4KNVA 2A1UB 2A33A 2VEDA 1SVNA 2AC7A 3TR0A 1FNSA 2IYLD 3DP7A 1B6RA 2MIIA 2Q45A 1NVFA 4TT3A 4LY9A 2PX6A 5HF8A 2BFEB 4KPGA 4DRYA 1VKZA 4IVNA 2X1MA 2WQZA 3UK7A 1MJ5A 4MUYA 1L4BA 3EPPA 3ZHZA 4QRIA 4MCIA 2HRCA 4QOIA 4NS1A 3BWMA 1W5SA 2OD7A 2YIMA 3OEEA 1DKNA 5IAOA 1E9FA 3D7MA 2ZJ1A 3P0RA 1UMDB 1FVHA 1KEKA 1E9CA 5BNZA 2FMXA 3AR3A 2C78A 1PDWA 2XITA 3FVRA 1ZCJA 4Z1MD 3I9LA 2MSEB 1SUIA 2Y1LA 1ABBA 1OH7A 2FP4B 5IDQA 5D5QA 1UADA 4U5XA 3FMVA 1G5TA 1HYQA 2LIPA 2EJCA 1N2CB 2RH4A 4G2TA 2HNBA 5FJIA 2Y1DA 3W2EA 3VNUA 5E3IA 2V7XA 1USIA 3O4HA 1X1SA 5FOUA 5EZ5A 3I55B 1O8CA 5DBIA 1WDTA 1JQEA 1W4AA 1Y48E 2P5TB 3OFVA 4Z4QA 1WL8A 4PQGA 5FYDA 5CFNA 4GYWA 1P18A 2WAAA 2I7CA 2JFBA 3ESAA 3VYTB 1JPUA 1ODIA 2B2XA 1PJAA 1U1IA 2GBLA 2WD7B 3AOEC 4X1KB 3EC7A 3SQNA 4U6QA 4JCOA 4QSMA 2F3SA 1CVRA 3CXRA 4ATNA 1YK1A 3MS7A 5TF0A 3WMRA 1Z06A 1CY8A 1BEZA 2IZ7A 1A82A 2I6QA 2VP0A 4GWLA 1Y0BA 4YNBA 5E1OA 3QY9A 1V3VA 3UZUA 1UK9A 1AS0A 3G17A 4LZZA 3T3OA 3EFEA 1WR8A 4V38A 5EAIA 5FWXA 3MHTA 2KHZA 1T0JB 4TWBA 3IQHX 1RQXA 3OO0A 3QE0A 1RLIA 4HGYA 1XEFA 3WQRA 1L4YA 1YBHA 4R1TA 1XRNA 1NUPA 3ZD9A 2BT4A 2PZBA 5FLYA 4G36A 4RKYA 2A14A 4OSPA 4JT9A 1B6SA 4QAQA 5CGZA 2NADA 3GMTA 4BB6A 1QYXA 1OT3A 2BP7B 1FTNA 3BGIA 3N5CA 5C5DA 1BS1A 1T8RA 3LRXA 5A5EA 3QQ5A 4YMHA 2ZWPA 5IDVA 4QJBA 4EJSC 2EERA 3FZYA 3M1IA 5KVAA 4NMMA 3SPXA 3EVCA 3CC8A 2AJCA 1JFLA 4IGIA 3BXGA 3UMMA 1NY6A 1ISMA 4MPJA 1GOTA 1L4EA 2OGZA 4RKWA 2OVBA 1E7MA 1V9SA 3RU2A 2BFFB 3OE7D 4NPCA 1OV6A 3OM8A 4NR0A 3RANA 4MPPA 3AX6A 3DVLA 4EHAA 3CPSA 5KQPA 4XOUA 3INTA 4N82A 1B23P 2O2ZA 3A9UA 4B4DA 3LGXA 3FMIA 1KPHA 4FP9A 4CM5A 3MILA 2WB2A 3KE9A 1OLUA 3LVFO 5EMHA 4V2IA 2X5JO 3D6FA 3Q2OA 1NBMA 1JW9B 2REQB 3D1VA 3U3DA 4ENRA 2D5AA 3I64A 4CG1A 3SCZA 2JN9A 1UWCA 2R6R1 2VBCA 1ECPA 1IN1A 3QEMB 1FLDA 3UKJA 5F4OA 1S8FA 3I37X 5E6SA 3TG2A 4OH7A 2WKQA 4INJA 4LJAA 3EDOA 4NOLA 4D8UA 5LL6P 3MTJA 3RUEA 3Q8KA 3KVRA 1URPA 4BFVA 3PCXA 1T5HX 2ZRMA 1BOOA 3IAM6 4XSGA 3K8YA 5G1OA 1NHGA 4E46A 2FGJA 2Y4OA 4X8IA 3VR5H 3IKTA 1SA0B 1JV2B 4OHVA 2EZ9A 3P5SA 4KGDA 1L5ZA 2FQ1A 2WZBA 3ISJA 4LQDA 1OLSB 1PQUA 4CUZA 2DBRA 3DDYA 2OECA 2OTJB 4K3UA 4RA6A 2EGUA 1KVSA 4IWYA 5D84A 4FFNA 1NPTO 5C4GB 4QPCA 5KDLA 2VEOA 4CTMA 4H7EA 4JB0A 1ZVKA 1YLOA 2ZB3A 1GRRA 3ZWBA 1AQUA 5GADl 2GFHA 2O8CB 5I9LA 5CM8B 3O0TA 1SUDA 2PAFA 3DO6A 3HVIA 4OAPA 2PMWB 3NWEA 3VJRA 4WZAE 4R8VA 3H0KA 2X13A 3MSXA 3DNFA 4RS4A 1N2EA 2OT3B 4J75A 2HLNA 5JDIC 1H2BA 4YUZA 5CB4A 2BPOA 2Y1GA 3NB0A 3SZGA 5JCJD 1BGVA 2V6GA 2NUPB 4BWFB 5CFLA 3SZUA 1V8DA 2LKCA 1FUIA 3AM4A 2RCYA 2X0RA 1AKMA 2FEXA 2W2PA 3TSOA 4F8JA 2WYUA 2IC5A 3WDMA 4UBOA 5KPDA 5FBHA 1T35A 3TMYA 2H5LA 3QMWA 4AP5A 4S24A 4EVRA 2G0TA 4LXGA 2ZYWX 2COKA 4IMJB 5ADUS 4LFAB 3GRAA 4K3VA 4QDZA 4JLUA 1VQ8B 1ISRA 4WOBA 3OA2A 4U1RA 1RBYA 3NKFA 4E09A 2FPOA 1EXMA 1NFRA 2EL7A 2OSVA 1GRQA 3F4KA 4IDNA 4ZQFA 5JPDA 1HEUA 3I5YA 4JUFA 2QD4A 1OX4A 1FX0A 1FNNA 2AK3A 3F7NA 3LJKA 2J9RA 1UP4A 2FWBA 2FG7C 1DNPA 1UDXA 5FXMA 4Z9FA 2JGFA 1LVHA 3N2NA 4MW9A 4ISBA 3KT0A 2QQGA 5LU9A 4MA0A 4RU1A 3A4MA 3UG7A 4BXOB 2V7EA 1ECCA 1XJWA 4LHYA 1T10A 3QVLA 4LSGA 5TXGA 3D4LA 4BMCA 4PGFA 4X45A 1F20A 1MZVA 2WTAA 3NYIA 3T4EA 2NYVA 3O92A 4YPVA 4BFWA 1T36A 1N6PA 3ZV4A 1I3MA 4X8OA 2PUAA 2QTBA 3G5AA 3OZWA 1FFWA 1KXZA 1PT7A 1H5NA 1LSSA 1E62A 5DIZA 3ZHQA 5IZCA 3G9UA 4A2CA 1UPAA 3HVRA 2AR7A 3U40A 4BJ6A 4M9QA 4X94A 5B64A 1Z35A 2H5IA 1PWXA 3UATA 4WKOA 2EG9A 3G1UA 4J0QA 4FHGA 3QXSA 2Y0EA 1YULA 2W2KB 4UXIA 1OILA 2RAFA 5DISB 1RXCA 4W99A 3DD1A 4MAFA 2XVZA 3RPEA 4F72A 1FFYA 4OOEA 2EF0A 3CNEA 1G6OA 3HA2A 1DC8A 5C7YA 2AK2A 3PLNA 3PX2A 2PSJA 3QLUA 3O1LA 3U81A 3CMAB 4OA5A 4Y6OA 2C8LA 3JTEA 3B20A 4RQBA 1XMVA 5K6TA 1RU3A 2XB4A 5ESWA 3GEIA 4MULA 4TZTA 2RSLA 2ZIXB 3ITNA 1UXGA 4KL8S 5MF6A 3TUZC 1U0FA 4DHEA 1K63A 5EXTA 2JAUA 4M6WB 2IPXA 2BCGY 5REQB 1K68A 3KKEA 4W5JA 1WW3A 5EUBA 4AUEA 5D3ZA 5J4HA 2CFSA 2HV8A 3LDFA 3F8TA 3PQ8A 2F1LA 4XR9A 1V1RA 2AFVA 1JFFB 3PQDA 4PYLA 3VR4H 5I01A 2WJGA 3UFXA 1DJMA 3LIPA 2C4VA 2VNHA 1EGAA 3ZWMA 4LJKA 2FZKA 3EVZA 1GG2A 2WWGA 4KKTA 1I4LD 5DPMA 5L4LA 2BGWA 1L5VA 4FGSA 1UMCB 1YVUA 2J67A 1D2HA 4LDAA 4KN6A 1MXHA 4WERA 3MLEA 3V2UA 5A3QA 2BH2A 2YVKA 3TI7A 1JE0A 1P39A 3GZNB 3OAAD 5ETJA 2IBSA 2OA0A 1IQRA 1ISHA 2FN9A 2QX7A 1QF9A 1CEEA 3F8WA 3RTCA 3DFMA 4V0LA 3ZVNA 1MV5A 5AK4A 3F2IA 5EHIA 5BYBA 3IL2A 5CLFA 1PZFA 1MJGM 2GCNA 4P9SA 2O4UX 2BRUA 4MQUA 1NVEA 2RHBA 2YZ2A 1I30A 4IZ6A 4MQFA 1W36B 3DNPA 1Z8FA 1NWHA 3O3CA 2CJWA 2J3MA 4O4JA 3T8YA 2ZRHA 4GD3Q 1T3SA 1CUGA 1TU3A 2IS1A 1YJQA 4QEZA 5C1BA 1AF4A 2IDJA 3JYQA 3VR3A 1QDEA 5I7WA 4X07A 1CZLA 3L4SO 3FOEC 3ZD6A 3ZZUA 2O19A 3T1YB 3RK0A 2C58A 5B4VA 2OZLA 1KDOA 1N6IA 1Q81D 1P3DA 1HDYA 1LW6E 3EXHC 1X1QA 4P2NA 2R1TA 4CMBA 4HB4A 3EN0A 1O6FA 4TVKA 3NW9A 3LVQE 1KMMA 3AY3A 8MHTA 2GM5A 3ZUPA 4JP2A 5DNEA 4OD0A 1XXLA 2ZBUA 2N47A 5ARBA 3ROKA 4KVZA 3BH0A 2PGLA 2VHTA 3FWYA 4BNIA 4BWVA 5B30A 3U4CA 5CDFA 1C29B 1NYQA 1OU0A 2H9IA 2ZJ3A 2MR5A 4WPGA 5G0TA 5TMPA 5DNYB 2J3QA 4HMQA 1VJSA 4HXFB 4NYMQ 5TQ0B 4K6FA 5DSXA 3QLTA 3T41A 3VC3A 1NDQA 1K8YB 3KJFA 5GZ6A 2G88A 2H17A 3NWPA 5FV4A 5KJCA 3HK2A 2GQ0A 2NUBA 1QMPA 2E48A 3FX2A 4L7VA 5HM8A 2F8LA 3OZBA 1Z7WA 3Q3AA 3CR7A 3DS8A 2CFIA 5FPSA 1Z3IX 2D7JA 2NO0A 2OP0A 3CRMA 4KACA 4JN6B 3P27A 1II8B 1W46A 3AIMA 2W6IA 2Q5CA 3L07A 1VECA 1S9HA 2P3MA 3OCZA 4JLPA 4MTCA 4EMUA 5C7LO 3KFLA 2B0CA 5LB2A 2WJAA 3C3YA 3IPLA 3B1JA 2AXNA 1C1HA 1GO2A 1Z33A 3EDYA 3FNGA 3I1IA 3MPUA 3P0JA 4ZXPA 3RB8A 3H6GA 1KMNA 1V37A 4KDEA 5IPFA 1Y34E 4WLUA 1X6VA 3L9XA 2JI8A 4OL0A 3R7SA 3TNFA 3GAAA 4Y2TA 2UVDA 1EQ2A 1MAVA 4RZIA 4Q1FA 5CBPA 1LKZA 2I1VB 1SH7A 1DAGA 3E0QA 2PMDA 4TL7A 1YVRA 3ZH2A 3V33A 3AJ8A 1XDGA 3RHZA 3WP1B 5FA6A 1DRWA 3WSWA 3VOBA 2R00A 1X1EA 5CDGA 4ZPXA 2OXTA 1W5FA 4O4HB 2HJRA 4OHUA 4WXPA 1Y98A 3NDJA 1QNFA 3CNNA 2RFLA 4L6CA 1EB8A 1J70A 5DEOA 1AD2A 2C98A 1PFYA 3EFBA 2P4HX 3MWDB 4ZODA 5LOVA 3F73A 3U6BA 3EGWA 2H1VA 1M73E 2X8JA 3B3QA 4URHA 5EY5B 1KI2A 3WQSB 1GQ2A 2BONA 3AUSA 5ILGA 2C5HA 5AW1A 1V5IA 2XGMA 3K2IA 4A26A 2RAPA 5KDOA 3F3MA 3PFFA 4KWTA 4O0MA 3RF6A 1CKEA 2Y27A 4H4DA 3BAZA 3ZE9A 1YA4A 1RI4A 2BBWA 5EFZA 4MS1B 1ZXBA 1AKVA 4FNMA 5I3ZA 1O7JA 4KK4A 2FW0A 1H2EA 4BLOA 1YZ3A 5J58A 4CDNA 2N1BA 2Z4SA 1Q82D 4KH0A 1UBUS 2DC1A 2Z4RA 5U4QA 4CV0A 3TRDA 2O2GA 3DT8A 1DBRA 1ZGBA 1TKBA 3NKVA 2CMGA 3S2UA 1GUAA 1Z0ZA 4WVFA 3SSMA 3SZOA 3V2IA 3ZLUA 3SFTA 3G9XA 2W2NA 3NEPX 5JO0A 3ZBQA 2NTJA 4ZVRA 1RLMA 2X3YA 3T61A 2PS9A 1N36B 2FE1A 5DI3A 1KEEB 1ZZEA 1AHNA 1DLIA 1NXTA 2XMGA 4JBLA 2VZ9A 3IUSA 2CYCA 3MC1A 4K5QA 3HBNA 4RZXA 3S0JA 1Y4ZA 2WFLA 2AT1A 3DW1X 3CPXA 3PYLA 3ZLVA 2IHBA 3IE0A 2VYCA 1WXEA 3QJYA 3AKZA 5FI5A 3SC3A 4JMQA 2CLFB 1OY1A 3ANYB 1J2TA 5D00A 1IN7A 1XD8A 4EG1A 1WZCA 4TTJA 3SYMA 1RWVA 3F46A 4IOLA 2G25A 3RG8A 3IKJA 3C1TA 3OTHA 1C7QA 1YVPA 4G6IA 2CDCA 4M8KA 1U0OC 3KKZA 1B0UA 3LXMA 4U9IS 1DT5A 5AH0A 5EZYA 4CJXA 3GLIE 1J7JA 1IH8A 4LHXA 1E4OA 3VZCA 1E3WA 1T2AA 3CZCA 4JKIA 3VKWA 1UWKA 2HHCA 4TN1A 2YJTD 3AESB 1NASA 3N8HA 2R65A 3KKNA 1E6LA 1O08A 1W2WB 1NQ5A 1O4WA 2HT6A 3AWDA 3A25A 4Y0AA 3VU0A 3MT7A 3PR2B 2MR6A 4MTLA 4JLKA 3PUNA 4JLAA 4G0XA 1VYUA 2QRJA 4FCCA 5DTIA 3HCRA 3I5XA 3UB4A 1A8PA 1GRCA 1HK7A 1U0LA 4PPGA 2JFNA 4ZJZA 1ZYUA 3X0DA 1SEPA 4BJ3A 1Z5OA 1GM5A 3QSYA 3ER8A 1E1YA 3KQOA 2Q41A 3GPDG 1APBA 2JIDA 1YJWB 4CCSA 1XGKA 2PKQP 1YTUA 4CR6A 2FVYA 1OLOA 2VDNB 3HFRA 3CC7B 4M9ZA 4NNOA 4PXAA 4PYMA 2YC4C 4D7AA 2KM1A 3TSWA 1NW3A 4HQLA 5LP6F 2AI2A 2BKUA 2IS6A 4XI9A 3T7TA 1M0EA 1G3RA 3ZPNA 1VMEA 3G2JA 3JATB 4IV0A 4RQAA 1LLCA 2PAAA 5DTQA 2B5VA 3ANLA 2FGKA 4MR7A 2UUAB 2CE2X 4ZT7A 3O8LA 3LNNA 3RC8A 1E1NA 4R1PA 2VXOA 3AR5A 2O54A 1SIBE 4NYJR 1R15A 1NI4B 3PGJA 2ZB2A 2HXSA 2Q4EA 1KE2A 3IYLW 3FUXA 5EJ9A 4WK0B 4UNNA 3TTUA 5IWCA 5KTPA 3BILA 2C0QA 2QMQA 3BL6A 4IXMA 7GPBA 1GCOA 2VZEA 3NH6A 3Q98A 1N5RA 1DEKA 1JG2A 3DW3X 1OHHA 3FPJA 4ZICA 1VQ4B 3JRNA 4IICA 3T7DA 1JLLB 1PGNA 4IS3A 4PLVA 1PW7A 5A7FA 1Z7EA 3B8EA 3H3JA 1B8UA 3D1JA 3Q6RA 2X7HA 4X62B 2VJNA 3OC0A 3RAPR 1BO6A 2HAEA 3I04A 1YZQA 1FQOA 2OO3A 2FPMA 4KUHA 3GVCA 2QN7A 4FIZA 2O23A 4KQEA 4CT0A 4TS4A 1U2GC 4IOKA 1E0SA 1VL6A 2O57A 2XUOA 2WPNA 1UKYA 4XQFA 2NG1A 3A6JA 5BMVB 1C9MA 1M2JA 3THXA 3L8HA 4XM0A 3NBXX 3LRPA 2HW8A 4RSRA 2A5LA 1W49A 1WMDA 2BMEA 4EHDA 1ORTA 2J59A 3G5MA 5C0OE 5A6SA 2WWYA 4DR2B 1CD5A 5KJ1A 2JFWA 3ILSA 4MUHA 4UNIA 4MWCA 2FMKA 5KJ6A 1AZTA 2QROA 2QTWB 4ZPJA 4OXYA 3FW1A 2IF0A 2FI1A 2J0UB 3IQEA 2DIEA 4L4XA 4X20A 4I55B 3NNDA 5KSZA 2NTYC 4HYTA 1GL3A 3HR7A 3QKUA 4Z54A 3ZU6A 3Q9LA 4TMKA 2NVWA 4WWHA 3W9SA 4OGLA 1S0UA 4GGPA 4RXTA 4BB9A 4UOZA 2A2ZA 2BEVA 1WU8A 2XB6A 2WOOA 3UWMA 3DBIA 4B3FX 3KPVA 3L6EA 5A4KA 3U7HB 2PL9A 4MRMA 3SZ3A 1SM4A 3W9BA 2ZU0C 3LX5A 1D2GA 3R0XA 4FFVA 4Q7KA 4TTAA 1WZ2A 2BV3A 1Z0JA 1Y9JA 1ZUWA 1GN9A 4IIDA 1T9DA 4ENUA 1Y6ZA 1QZZA 2ZP1A 3KU4A 1YU9A 4BCCA 4D9KA 1DC3A 2JLRA 3SSAA 2XCUA 5DLEA 3ZC3A 4MVJI 3D7NA 3TLZA 5MGBA 4QYMA 1FY2A 1IHUA 4DF3A 5TGZA 2HZ7A 4FMBB 1E61A 2P9FA 2XD9A 1VCIA 3IQDB 4E3WA 1ZDMA 1EG2A 5GOTA 4GQIA 5H4HA 5F51A 4MITA 1YIOA 3OZTA 1CC1S 1JE1A 1VHJA 3REGA 1HEYA 3QBJA 4E2WA 5THXA 2Z56A 2NUAB 4IJKA 3WMGA 1XPUA 2QN3A 2Y0CA 3FHLA 4FU0A 3P45A 1JKJA 3H3FA 3NBFA 1UFQA 1CW2B 1DBPA 1J8VA 1GXSB 3PFCA 1A95A 5DM60 4IJVA 2YNMC 1NR5A 4I9GA 4UUNA 1BWSA 3LF2A 4Q4HB 1NAHA 1GCGA 3HR8A 2C31A 2FRXA 2JAQA 2NZ2A 3LY8A 5F9MA 5JDIA 3AF6A 2DPLA 5C31A 3EXAA 5A3SA 3AI1A 2ZQ5A 1SD1A 4FZVA 5JZBA 3HVUA 5F98A 1CNMA 1OQAA 1YQXA 2AYXA 2MSDB 3ND8A 4MRAA 1G2QA 1NUAA 1MRZA 5K3CA 1FJGB 3V8QA 2GN9A 1L7VC 1Z0UA 2X41A 5ESXA 3J81k 3CX7A 1P4GA 2ZR7A 2VPXA 4XGNA 2GASA 5LDHA 3IAFA 4WZTA 1P19A 1LJUA 1K92A 4GICA 2W2OA 4DM3A 4XCXA 4F1WA 5H02A 4YR7A 2WTXA 4HZUB 4KQ2A 4NRDA 4U8HA 1SKMA 3OJCA 2XHEA 4D45A 3ICWA 1I6WA 4Z4TA 2FUNB 1I14A 5A9SA 3GQBA 1QE3A 4QPNA 1I1QB 5HE8A 5BSMA 3VYSB 5BW5A 1J99A 2W5UA 3C70A 5FT9A 3IMGA 3M4NA 4OQEA 4KIFA 1PV1A 2ZSBA 3BDAA 3HP4A 1JHXA 3ND7A 1FQJA 1U0RA 2UUBB 3DHEA 1NUHA 3DPIA 1D6NA 4TS9A 2BGGA 3QF7A 3H8JA 4ACAA 4GG1A 4Q1CA 2IE0A 3EIUA 2R8XA 4MUEA 3JQ7B 1E9EA 1H8HD 2IZ0A 3GLTA 1JA9A 2FMIA 3FPCA 3QW4B 3OD1A 1LBIA 2XI4A 1BVRA 3VR6H 5B3AA 4QRDA 1F2TB 4MS4A 4LZLA 1KIFA 3KALA 2H7YA 4LCBA 1VQ5B 2PL3A 3FUVA 4JLSA 4C3ZA 1V9LA 1NVVQ 3RVNA 1LBTA 2NZYA 1A04A 1JLSA 3B70A 1O9GA 2Z8ZA 3PE4A 3IC5A 1QFZA 1MUUA 2F62A 4WKBA 3ZWWA 3E9MA 4HN2A 1WCXA 2JJ1A 4TV8F 2QIOA 3BIXA 1PLKA 1K8QA 2IYSA 3A1FA 1WP9A 4YH1A 1KK1A 1QDUA 2XDWA 5WRFA 1XKLA 2YJGA 1KTVA 1XMJA 3AW9A 4A7PA 4MINA 1WUHS 3GRKA 4D1YA 2Z30A 1RRCA 2WYVA 3RREA 3WQBA 4D0RA 3KQTA 1FYXA 1VQNB 4RTSA 3KQPA 1ECBA 4NTZA 5HFJA 3WZ2A 4ISCA 1Z15A 4INZA 4L1KA 4N65A 3CYFA 2MHCA 4LE0A 3TBHA 4BVAA 3OZDA 3ANMA 2YV5A 2FSSA 2ONCA 3B89A 1ZN8A 1M34E 3VU9B 1FXUA 2G4VA 1O87A 3TIIA 2BTQA 4UDOA 2Q49A 4OJMX 4EMBA 4Z5XA 1E6EA 2HU7A 2OGSA 3KYCB 4KO4S 4EAQA 3U56A 3DLHA 4BN4A 2NSLA 4V0ME 4OUKX 1YQTA 2A1IA 3P9CA 4WKCA 3B8HA 1S2IA 3SJAA 3M3HA 3GUCA 2FDRA 4WFJA 1DHRA 5AT1A 4OIMA 4XQCA 4L2IA 2FFBA 3VC7A 3LPAA 4WZBB 2WQ6A 1DPFA 4K9SA 3ONYA 2FXIA 3U2QA 4YCLA 1T5DX 3GLGB 1F7VA 4NARA 1D4OA 2RMKA 3ZK7A 3ICPA 4A8HA 3FYHA 3LCJA 1VKRA 1GYPA 1Q0PA 3DHYA 3H1FA 1XQVA 2FG5A 1L7DA 3F3YA 4PAMA 1J00A 2O7VA 4N0EA 3N2ZB 1X80B 4N40A 4BIIA 5BR4A 1IN5A 2IEGA 5LQJA 4TV9F 2QL6A 5DLDA 5IHXA 4RMIA 2FEWB 4N3GA 2FX5A 5EVCA 2IUFA 3M8KA 2V98A 3RODA 4TYYA 5KEIA 4MKZA 2W4MA 2I76A 2H4FA 4M87A 2GN8A 4HPXB 1GR1A 4MAMA 3CLUD 3CA8A 3V3TA 3M0EA 2C77A 2BC9A 4N5NA 2OGWA 4OJKA 1YRLA 3DO5A 2IVZA 3B5JA 2W37A 4YBRA 1H2XA 5LMUB 4B31A 5EXXA 3ENZA 2X0NA 4C76A 1FYDA 3UVEA 3DOEA 3Q4GA 1Z62A 1E5LA 1LBSA 4AJ1A 2E18A 2WVGA 1VFNA 1L5LA 4EG3A 3F6BX 1V6AA 4Y6PA 1RM4A 3RVQA 1UBFA 2EP5A 4UBJA 4BEWA 1L4LA 1PT9A 5FNZA 4GLOA 3RBAA 4RTQA 4KVGA 4YGXB 4B7XA 1AKUA 1P2FA 1RWPA 2F59A 3OZGA 1Y42X 1U8YA 1XK6A 2QZ9A 4HRAA 4AC9A 1K08A 1RCFA 2DTEA 2VRWA 2DFLA 2ZL6A 3HDVA 5BV8A 3FFTA 3OY2A 5HDQA 4YTEA 4HNUA 2ZANA 1II9A 5HYVA 5FULA 4OYYA 3GAFA 5E2IA 3ZXSA 5EHGA 1V8PA 2G5PA 2BH9A 2ISQA 3Q12A 3EVFA 5C1PA 4JCCA 4KYTA 4DYHA 1S1CA 1DIBA 3OQOA 2VHEA 1DB3A 1I2BA 3T7RA 2FPGB 4D3DA 5B2FA 2AR9A 4LK2A 4F5EA 2EFDB 2AZ4A 4JC4A 1VG1A 2IYQA 1HFJA 3IBSA 4NF2A 4MR8B 1N3IA 2M1ZA 2GZSA 1IRIA 4OQPA 1KAGA 1E3TA 2XAAA 2C20A 2ENWA 2X1VA 4KV7A 2M6LA 1BS9A 2NPOA 3WG9A 5HQTA 5JBQA 3RBZA 3N0WA 1PLJA 5ADHA 3CJQA 3VHRA 5LBUA 1J2UA 3I2YX 4GKAA 4NLLA 3AUFA 3UUWA 4EJ6A 4I66A 4LF4B 2C0PA 2OCAA 5JAIA 4QVJA 3EZLA 3PC8C 1FQKA 4WTOA 2QM8A 3UPDA 1XL1A 8GPBA 1G291 4BBJA 2YQZA 1SBTA 1YS7A 3FETA 5JAMA 1J8MF 2YL2A 3MUEA 4UZUA 4DNOA 4O4HF 1SBZA 5D1NA 2IY8A 5KNDH 3CTAA 4Z9BA 1B42A 3CG4A 4UTPA 2QZJA 3EPJA 1ZZGA 5CXQA 1W36C 1EJ6A 1JMVA 1VE5A 3OOJA 5AHKA 5EWJA 1G66A 5GWXA 4YWJA 1DIRA 2AOTA 1JDNA 4NBUA 5DSTA 3MEQA 5D6NA 3CPHA 1R6AA 5KAMA 1OFUA 3SEJA 2QN1A 3RF7A 4B3DA 2XRZA 4JDUA 3ZI7A 1RQPA 3HRKA 3JVDA 4DE5A 3OT1B 5IAGA 5K8TA 2QGZA 2NZJA 3IV9A 3MOIA 5L51A 3WA7A 3M3DA 3EJ6A 4NCKA 3H5NA 4M0DA 4E2ZA 5HHTA 5L40A 1VGRA 1XZCA 2JH3A 2E4VA 2PVCA 3DB1A 4KBYA 4DJDC 4F1JA 1E59A 1U2SA 4J1NA 4GWGA 4C6SA 4IZIA 4WACA 2ZBPA 2QDKA 4QVIA 2XDYA 2OBLA 1YJNB 2IYUA 2ZZMA 2YWGA 1QGYA 1G19A 1L5QA 1Y5IA 4NENA 1VIYA 1IJFA 3O3OB 1NV8A 4RWEA 5A0FA 4EJ2A 2E5FA 1F06A 1TXGA 2VK8A 2OV1A 5CITA 4ZK2A 3CP2A 2DJ5A 4QAJA 4LFCB 2PT9A 3LXRA 1TX4B 4P4LA 2IUEA 1EFPB 1MC4A 1R8JA 1WZEA 2PS1A 5DK4A 5TPWB 5TS2A 1PYDA 4GNKA 2F1KA 1L5HA 5CB0A 1GFZA 4S0ZA 4PZYA 4PC1A 3DVAA 2RC5A 1IU9A 2QENA 1KH1A 4EJFA 1C9DB 1PJBA 3QMMA 3F3SA 4M89A 3RABA 3CLSC 3BN3A 4CFSA 1RYEA 3CD6B 3FCOA 2ZIGA 5CEFA 2WJJA 1UOPA 1UEIA 4MVYA 4TLMB 3FGNA 4QIHA 1JHUA 1I7LA 1U0TA 4YBZA 1L7EA 2JHCA 4I5IA 1GUYA 3DEAA 1A2QA 1FW6A 1M2OB 2A9JA 5K3FB 2ZRGA 3U60B 2OAGA 2Y3IA 2QTMA 1G6Q1 1KI7A 1NPYA 2BR5A 2YFYA 5CT8A 5EHNA 1RXVA 1E5XA 2XX3A 3L7DA 4KLZA 5CRIA 5F52A 8ABPA 4DR6B 2HEGA 2OZKA 3RM3A 4DRXB 5K1ZA 2WTUA 3MUOA 4O59O 3CUSA 3NG1A 1MRSA 1NW9B 3H2ZA 3EZXA 4YRKA 1CR1A 4EZBA 4HNTA 2VQFB 3TTSA 1PR9A 4COOA 1C7ZA 2A0UA 4QTYA 2RE8A 1Q0ZA 2AR0A 1QOQB 3DMNA 3QF4B 3RC3A 4KNWA 2DWPA 2H48A 2IE8A 4QUHA 4WVLA 4M36A 3WLHA 1RMQA 1YDEA 2IUUA 1EZ4A 4DLSA 4L5YA 1J5PA 4RK4A 1FK8A 1G5RA 3EDQA 3EY9A 1GKKA 4LHVA 3P0IA 4U2FA 5BSRA 4GT1A 3ONDA 4KDFA 2YZMA 3QVXA 4S04A 2ZTUA 1V25A 2VA8A 5TDHA 1T0IA 5JISA 2Q0HA 4NCBA 3BB4A 4L8JA 3PTAA 3HSSA 3HA3A 5ALYA 1CHDA 3SR3A 1LH0A 4XRRA 3BSWA 1D2MA 5FAKA 3OKFA 1XRPA 3AEUA 1V11A 2QD2A 5JAZA 2ZJBA 3PRKE 4UMFA 2H08A 1XYGA 3JWPA 4MLPA 4V0NA 3U4QA 4F4FA 1Q0RA 3UW3A 4J76A 4Z7NB 5KU7A 1J9GA 1SZJG 4P3KA 5CEJA 2ATIA 1PQPA 3JWGA 5JANA 3UWSA 3PWKA 1UJBA 4ER7A 1GNTA 2JK1A 2YASA 2OV8A 2YFHA 3QVGB 4NE9A 1D8AA 3D81A 3UPTA 2C95A 2ZVPX 2IDKA 1E0DA 4CEJA 1C3OB 1OW3B 3FRHA 3R3ZA 2UZ1A 4DR1B 4JELA 1KS2A 2ZE8A 3PUYA 4MI3A 4CXMA 4CHTA 3O8QA 4ZT5A 1KY3A 3RU9A 3UIEA 4DG5A 2PPLA 4N76A 2BFCA 1SBHA 5BMVF 4GDFA 1JHYA 3AYXB 1XCLA 3KWJA 2GEUA 2X9GA 1SXJB 1E2EA 4GEKA 1T5TA 2FAXA 3DQZA 3WB2A 4NAHA 5CLJA 1PJRA 5EJ4A 4BUJA 2ZG6A 4I50F 2ZUEA 3FPPA 4NAVA 3G9TA 1E6UA 3IP7A 2OPBA 5BRJA 1UMDA 4QJ4A 3PPWA 5GZ1A 1P5RA 3GBVA 4MMYB 4XUEA 2NO4A 4TZKA 2ZZKA 3O8DA 2JBHA 1TKCA 4EI8A 1CUYA 2RB5A 3HVJA 4JSYA 3HN6A 5AKXA 5BWCA 2R9VA 4RGBA 3U0BA 1NVXQ 3HKCA 5EZSA 2F8SA 4HTAA 1TECE 1UC9A 4QOHA 2Z4TA 5KO2A 5JNTA 2TMKA 4LQ4A 4OFZA 5LQAA 4NBKA 4HTFA 2EX1A 2W90A 2XLCA 3HRIA 3T53B 4LJ5A 1VHOA 2GSWA 5ER9A 1P9WA 2YS7A 1R4NA 2OUIA 5FI1B 4AN4A 4AUKA 1OF1A 3T3NA 1ARZA 2EFEB 3D3WB 1BXKA 4UARA 1LDEA 2IZ5A 2W4QA 4D74A 3FDXA 4F4HA 4B33A 4EF6A 2RD2A 2GM4A 2QXUA 5L9AA 2JW5A 2P9BA 3LWNA 2VXCA 2CFOA 1XTUA 2G7MC 4LUCA 2I2FA 2WD7A 4OQYA 4X1KA 3C85A 5E3JA 5A5FA 3BXPA 4MUNA 4IY1A 3V8MA 3WXMA 3P1JA 3VMMA 4XLAA 1HQYE 5EWLA 5FOSA 4DIUA 2PRSA 4L08A 5IXSA 1FP2A 4B3RB 3P0FA 3PE3A 4P82A 2AX3A 1NZFA 2JLVA 4IIJF 3VPFA 3WO0A 2MYUA 4EX6A 2WRZA 4OXXA 3DOJA 1U02A 4RLZA 2R87A 3KKQA 2P3OA 4X3CA 1DJQA 3TVDA 1XKQA 2DE0X 2ZL5A 1N07A 4ILEA 3W1EA 4Z51A 2B8TA 5C5IA 2A9PA 5LP6B 5CX4A 1T8SA 2FMTA 5JJKA 3OPXA 1NVMB 1XA4A 3OFNA 1E58A 2QRQA 4K2AA 4CMHA 1JMKC 1GARA 4G37A 5A4FS 1ST2A 2ZB7A 3KP1A 5BW6B 4ZKEA 3RCBA 3BWVA 3WYEA 3KEFA 2X8BA 4GPAA 4H3HB 3WV5A 1DQNA 1M90D 2WMDA 4MWTA 4OLJA 1RZUA 4ZCIA 4EHIA 1MBZA 1FFBA 4O4IA 1PR4A 1T2CA 1MTOA 4RXUA 3B2QA 1UDCA 5AVYA 1UBKS 1NN5A 3GVJA 2YFKA 3IHWA 3PGVA 3PUWA 4REMA 2E6KA 3EF3A 5AVJA 1JAYA 2GAAA 1R3UA 2X1HA 4HDNB 1TTPB 2GHQA 2VDQB 1JKIA 1P77A 2JJYA 2E7ZA 3PF9A 1CCWA 1TK9A 2VH1A 4RS3A 2AG0A 3PUIA 2V5VA 1BYIA 4GR4A 3UHAA 3UM9A 1X7XB 3SICE 4BO1A 1BEUB 4EI7A 1Z5VA 4H7DA 4NXMB 1RYDA 2XOXA 2YZKA 3MXOA 4Q9LA 3TLCA 4RELA 3DM5A 4NU6A 2LD4A 2P9JA 3KIPA 5AWFC 5LBTA 2HJGA 1X86B 2Z57A 2G17A 3IBGA 3IVGA 3WI7A 4BPRA 3O4GA 1T3ZA 1U8FO 3SC6A 4EYGA 3JALA 3GD7A 3KQYA 2OHVA 3RJZA 1U7OA 1TM4E 1O58A 4RD2A 1QVRA 2WSBA 3PBKA 1YAHA 1VI2A 3C98A 1NJID 4P3OA 4HXGA 5LZ2A 4TZ0A 1NQOA 2IGTA 1N4AA 5U4XA 4HXYA 3D8HA 4XN0A 1ZD4A 1Z6TA 5EN4A 1P7YA 2J3KA 3HJTA 3VVBA 5IN4A 3EGIA 2C96A 1JT9A 4MUMA 1N4DA 1U99A 4FWTA 4FEEA 3ESBA 3HADA 2G0AA 2VT2A 3BE5A 3BKWA 1U3WA 3U3RA 1XMOB 3NNNA 4CM3A 3VHQA 5CLHA 1I3NA 2XZTA 3A32A 3BZWA 1OLSA 3G6KA 4HH3C 5K9ZA 5FWYA 3FYDA 1GTJ1 1OA1A 2IU0A 5J4KA 3AZOA 2UU9B 3PNMA 2F00A 3UJHA 4BGEA 4ARUA 2R2AA 4DCOA 1REQA 5IEJA 3UXYA 1SXPA 4HT3B 3R3JA 1EFVB 5BPHA 1IZ9A 4II3A 3BGOS 4UVIA 4TYPA 3QE2A 4Y1RA 3F74A 3HB7A 3VRHA 4JYAB 1SFRA 3EG9A 5EXSA 4W7SA 4XGRA 4RACA 5JZSA 3TLAA 3W2TA 2XRFA 3W5DA 3GJ4A 1BTOA 1IWOA 3KEQA 4HDAA 4IZOA 1XN4A 4FUTA 3EUFA 4JP1A 4PX2A 3V34A 1F9AA 2NV6A 4EA9A 3L04A 4KQHA 3W7BA 3ZHXA 5KYKA 3CKKA 3V32A 5J5VA 3OMLA 3UJBA 5ERGB 1N1MA 1MQ9A 3R7AA 2PPVA 5JO9A 4BTLA 1UJ5A 3LMKA 5JE8A 5JNVA 1L7BA 5EIXA 4XL9A 3ORHA 4Q66C 3VBEA 4IDFA 2O4CA 1FNDA 4BGIA 4F56A 1QP7A 1TNDA 2C3PA 2QJTA 2ZRAA 3SLNA 2GTPA 3LQ2A 1S2DA 3H5VA 8ADHA 1WETA 1F6BA 4L9SA 4J0JA 5EIWA 4G1UC 4JVSB 3ZCQA 1T3GA 1VE1A 2P9EA 1B15A 3DZ8A 1CDDA 3LLVA 1ZNQO 3FWZA 3OESA 1T1IA 1YS9A 2KI5A 2XR1A 3EZYA 3MN1A 4A9AA 4J1SA 1R9NA 1VLMA 3FD8A 4L85A 5EWMA 3R9XB 3MLBA 5KU1A 1SKYB 5H3CA 1EU1A 3O91A 1RAEA 3O75A 3ROEA 3KQSA 5HUQA 3H1AA 3V8BA 2I1LA 2OMKA 3ZDEA 5H82A 2ATXA 1OVMA 4MI1A 2CLIB 2QJWA 4J3JA 2OWDA 1P1HA 1XIVA 3GLUA 4JP3A 1ZCFA 1Z0SA 4DPKA 1JDSA 1H3NA 3DE6X 3BA1A 3QV1A 4M1OA 1XDZA 4FDMA 1I5EA 5EMNA 2FWMX 3BIFA 4IUDS 2DH5A 2E4XA 5HFNA 1XZGA 1RABA 1X7ZB 4H31A 1E7WA 1N8TA 1KO1A 1ZNZA 2R66A 3SX4A 4EVSA 3COPA 5DYIA 4BMVA 1KHHA 2C9MA 1XAIA 3LOUA 1K97A 2DQKA 3EODA 2ODEA 4NVRA 2B4RO 2C8JA 3C6BA 4CKEB 3PIDA 4N8EA 4FNAA 4OGFA 4RHYA 3FPSA 1W88B 4P2GA 4RPKA 3WLIA 2QLBA 2ZZGA 5A5GA 4LNAA 2CF6A 1M6VA 2A30A 3L7AA 1NTRA 1TQHA 2FFQA 1OUMA 4TV8A 1ZP6A 1SG6A 2HNKA 2K6GA 4JZKA 4MPRA 4WESB 2OCDA 4LMAA 1T91A 3T9DA 2G77B 5DBHX 1HNNA 2QTVA 4F5ZA 1KEZA 2ZRIA 1KHTA 5A4DA 2C54A 1H2AS 1RRGA 2ZWIA 4OQFA 4WI1A 2O2IA 4URWR 2QBYB 2O9JA 1QTQA 4IQ0A 3GP5A 4D3SA 3ISXA 2FUEA 2FF5A 2WIJA 4QQKA 4A27A 1ONOA 4BMXA 4LJRA 4MKXA 4KIWA 2HU2A 4WBNB 2AJTA 2FPWA 4RM0A 1FUEA 4CCYA 3N6RA 1VLOA 1E2NA 1I1OA 3HY4A 1DAOA 4W7HA 1SUCA 3OZIA 1MAWA 2HWWA 4HDQB 5CDHA 2I34A 3P2EA 3JWJA 3GRRA 1G7CA 3L7YA 3S3TA 3LF1A 2PBLA 4L78A 4W63A 3MCAA 3JQCA 1JFFA 5CLQA 5BYKA 4HJRA 1T43A 3AFHA 1EGQA 4ALJA 4M53A 2R6HA 5JRZA 4PR0A 4PTLA 1F14A 1TYAE 1V7QA 1VL1A 3O1JC 3S2YA 4JXJA 4YDHB 4LRTB 3TZEA 1M7BA 1TUEA 1PNTA 4QUBA 4E1AA 3QUBA 3UQZA 2BY4A 3PEVA 2OFWA 3PC8A 1P0CA 1NW5A 4LBYA 5ICSA 1QGAA 1M5TA 5H83A 4N6NA 3UJPA 5BQXA 4F6RB 2FZ5A 1EM8B 2Q5IA 4ITRC 4TV9A 4FW9A 1WZUA 2X2FA 1FS6A 1W4RA 5AICA 1GQOA 5FTJA 5JQWA 5LWQA 5B12A 1XF1A 1LGYA 2RGCA 3FN4A 5ALRA 2VQSA 5LQNA 3CCFA 1RHMA 4A73A 1WPCA 1RSZA 621PA 1Z5PA 5KWIA 2IYNA 1Q5PA 5AM2A 4H3VA 4GRAA 2B9EA 2I4NA 5DTRA 3T1VA 5H3LA 1L7XA 3N0TA 2GF0A 1FIUA 5COQA 4B35A 4M83A 4DSTA 4WXEA 4RESA 3LQ6A 3W2FA 4J0HA 3O2QB 3EWSA 3DFZA 3K6SB 1BCSA 1BHO1 2XYPA 3A9CA 4LEIA 4UFOA 3BULA 4WOPA 3R9WA 2JPDA 5K0SA 1F0KA 3W6ZA 3BORA 1YI0A 3R0JA 3NBAA 4ML3A 2H2AA 5AVTA 1W75A 3ZTTA 3IIJA 1U6JA 2W58A 3A26A 3F78A 5SZIA 5AKLA 4IJQA 1N2CE 4HDRA 5DCLA 4JUIA 3V76A 1SOVA 3VPDA 4MDFA 1U4SA 4BVKA 5JYCA 1QWSA 1QHEA 2QRVB 3EZGA 2IU6A 3B6JA 2DPGA 3DWIA 5HS6A 3QWBA 4EB0A 4EB8A 2QLTA 1COWD 3AR2A 1TMOA 4HYYA 1XQ1A 1JYSA 2FX3A 2H85A 5EGSA 3QU4A 3DO8A 3LWDA 4R1UA 4C7XA 1M7HA 4RTRA 4CM7A 2G70A 4F06A 3GP8A 4NIMA 1EVLA 1T25A 5UKDA 3IUNA 1DBQA 4WLVA 3U9LA 5LU8A 4DXDA 1IOLA 4M46A 1DC7A 1NB9A 4EGJA 2D1FA 2NM0A 3L0DA 4YQEA 4QM6A 2D0OB 3V6MA 4NH4A 3FRIA 3ZGLA 3CCMB 2ZL7A 1GCIA 1VL8A 3ONEA 3CSUA 3AXTA 3R41A 4CKBB 4IHKA 4QDJA 4KQ9A 3S8YA 2MINB 3IH5A 1VRVA 5C5CA 2JFZA 2FP3A 2Z0MA 4E31A 1HC7A 3O8CA 1ZUD1 3MMSA 2EFYA 1DQRA 4FIDA 3Q6QA 2QRGA 3SG0A 3DLBA 3AIIA 2FPPA 2ZI6A 3PSHA 3RE1A 5DM2A 1TZJA 1X3LA 2UZIR 2PH3A 2XEXA 4GOJA 2IYPA 2VRCA 3EVAA 1TW2A 3D4BA 4QYWA 4QUZA 4Q3LA 4BZZA 1SXQA 4CN9A 3WL6A 4MA4A 1XLUA 2GYWA 3SJPA 2X9LA 1EK5A 2XW6A 5CR9A 2FUCA 5JAUA 2QRHA 4GLJA 5HQJA 2VQEB 3NHAA 2AW3A 4O1MA 1I6MA 1Q1ZA 3L82B 1T1SA 3N2KA 4QODA 4AIRA 2CNWD 4EFLA 1D7AA 4Z4GA 3HWSA 5I5EA 1A7KA 4FD3A 2VLIA 2AJDA 1EP1B 2BUBA 2XDAA 2XF2A 1A8HA 1PN3A 2QPTA 3A1TA 2ZWAA 4IHAA 4MZDA 3IAAA 5JFGA 1NDUA 4X7MA 3CKLA 1X14A 1Q44A 3KSRA 3IOCA 4PIPA 2CJYA 4BB5A 4CKEA 4ON9A 2CXHA 3X1WA 4E5KA 4IF6A 5EQJB 4AS3A 3BK2A 4X84A 2G76A 3GA7A 1VI5A 3HY3A 2EX4A 1ZN9A 1QOPB 4LOKA 3GCGA 2FK8A 3RO7A 1WOPA 1QHHA 2NV0A 1TEVA 3LSTA 4FN4A 2XT9A 4L4RA 4AYWA 3MQ2A 3X1JA 4IEEA 3UJ9A 2KW5A 3K4QA 4OVKA 1I6LA 2Q5FA 2W00A 2Z1MA 1SVWA 1LQTA 2OENG 3ZR4B 1F2UA 2QD3A 1RKXA 3UHJA 1UZLA 2HUNA 3CUUA 1KI4A 4E13A 4CL8A 3VR5A 1SY7A 5LQMA 2INGX 2ZJYA 5I8ZA 2OSBA 1QF6A 3W3AD 2NU8B 3V4ZA 3CMCO 3IKLA 1RC1A 4YEDA 5AXCA 3NUZA 3IDFA 3OSZA 4OM7A 1ILWA 5A02A 2I6FA 2E55A 4XKJA 3EFHA 3G0GA 3SLRA 5L3QA 3H2SA 4JK3A 3DDZX 4CLRB 1H3FA 1B7GO 5ALFA 4F9TA 4O3MA 2P3QA 5L4SA 1XKXA 5IM5A 5KZMB 1W581 3DAGA 3LK6A 3DBHA 3N8GA 1TRKA 4Z3DA 1GPBA 2IH4A 2G82A 1QH1A 4EI9A 2C4UA 1VKHA 2EBWA 2J3DA 4RLQA 2RG1A 2QVCA 2GF9A 4HEHA 2K7FA 4JLMA 3M4ZA 2ECFA 2VWQA 2OCIA 2V54A 3K1TA 2B35A 5AXAA 1G4HA 5GQSA 3SGLA 4BKPA 3W8FA 5D3KA 1XYVA 4BMYA 4NZYA 5EP2A 521PA 1QQ5A 1FTWA 4BFSA 1CUXA 3A36A 4TWRA 4YV0A 4C4AA 5HOQA 3TVYA 3P9SA 1MJHA 2VOEA 4U3JA 3VI3B 2XXAA 2BHTA 3S1LA 4JR0A 1WB6A 3EQ9A 3GJQA 2E0IA 3WRVA 4DB4A 1ZSNA 1RHKA 3RSZA 1KSFX 1HLGA 1UOOA 2VF7A 4R8SA 3RHSA 2QXYA 2BR4A 3M6VA 2P1ZA 4GVXA 2QAGB 4Y2VA 2RBEA 2JL1A 1GLVA 2VOJA 2R97A 5B7QA 5CG1A 2JLUA 4JFRA 3GPLA 4NFHA 4Q4CA 2I6UA 3KETA 2CJFA 3I6BA 1RHUA 2OQVA 6Q21A 2M6SA 2GEVA 4X6XA 5FUXA 1B16A 3W9YA 1SNYA 4D2IA 4Y1FA 2Y9PB 3QVTA 4ZAGA 1ESEA 1T8UA 3ZHTA 2BZ1A 4ZAVA 5AVKA 4K28A 1O96B 1H2ZA 1BE0A 5EGNA 2YWCA 3GCZA 4NZOA 2W93A 1AS3A 1X8JA 2IDZA 3GT0A 5B5SA 5FUMA 5LMZA 5K51A 2VYVD 1WQ1R 1P6QA 4IP0A 4PLFA 2QMZA 3HXKA 2ONYA 2OLJA 1SHTX 2DU8A 4OLHA 3OT5A 4LECA 5I5GA 5JARA 1CJKC 1CQZA 2I80A 3MAGA 5KNBH 2WT4A 2LWIA 3OPNA 4W7IA 3O2SB 4CDGA 2RKBA 4EPXA 2EVWX 3HB1A 1RQ7A 2CGEA 4RPHA 1NKTA 2QORA 1OJLA 1S4MA 1FS5A 4NFSA 4RCVA 1OAAA 1YMUA 1TEHA 1T2FA 3PJRA 1CDOA 3AFGA 4M0KA 2Z98A 3CF4G 3O94A 3HYSA 3DMFA 3JY6A 1EHYA 1EGHA 4WA8A 4OX9Y 1UODA 5IANA 1VRWA 4MIKA 2GO1A 1FB5A 3HZRA 4NICA 2OCKA 5EMKA 2C0CA 1SXJC 4I50A 1U1EA 2ST1A 1F8UA 4MLDA 1XA0A 5F76A 5IDXA 4PZEA 3RG2A 3JAWB 1HE2A 1CS4C 5LA6B 5FEMA 3VPHA 4TKVA 2D06A 4YP1A 2II6A 3JCZA 3RY8A 3UMCA 5KNLA 2X0IA 3C3KA 1WG8A 3JASB 1NY5A 1JWBB 3I2HA 3R24A 1O8BA 4GKBA 3AO0B 2ACVA 2ILVA 5JADA 2G72A 4ZZIA 2HU5A 4LJ6A 2AFIA 3FJ1A 1K66A 4AKHA 3VR4A 1LW7A 1BE6A 3BSSA 4C0WA 3I8OA 1D07A 4LK3A 5FR2A 3ZH9B 1R27A 2XE8A 3GRYA 4H6PA 3REQB 4RJTA 3ENNA 4W6ZA 4G0VA 5H7XA 1ZIYA 3LQYA 3R3YA 1Y37A 3T12A 1AHHA 1UQUA 4JR1A 4WK4B 4WNAA 1DOZA 1N9KA 4JJIA 4RZSA 3RBVA 2J6HA 4KPUA 4XW2A 1Z63A 3PYXA 2WILA 1MJGA 4ZT2A 4AQYB 1ODSA 4B4UA 1U28C 1QVZA 5KYUA 4KQ6A 2OCLA 1BOFA 2I55A 4FONA 2IQ5A 3EUAA 1I7QB 2ZIUB 3M9XA 5D1HA 4ZEWA 1JB1A 1BPLA 4OP7A 1WA5A 3FPGA 4IIJA 4A1FA 1DKMA 2GPYA 2VYNA 3LP8A 2AFHA 4LXHA 1V7CA 3GVXA 5AM4A 1CF9A 2IP1A 3DGFC 2O2XA 4BCBA 2WICA 1IOZA 2V65A 3JQ8B 3EAFA 1HZEA 1GXSA 3PDUA 3EOAI 3A4NA 3DD5A 2I4LA 4LQCA 5LZ5A 6AT1A 3C43A 1RYHA 2JGRA 4RKEA 1LBEA 1M6YA 3V8NA 4DCSA 1S3SA 2FFJA 4YJ3F 1IE3A 3VH2A 2VJMB 3I3SR 2O8EA 4Z4WA 3C14C 1YHQB 4EKDA 5K0NA 3HH8A 5JLAA 4W1PA 3QX9A 3A6DA 4ZKDA 1AZSC 3LWZA 3DMRA 1LFAA 3T7CA 2QRZA 2V9CA 3O74A 4TVOA 5CM2Z 3T9BA 3RAJA 3ZHCA 3I9FA 4ZJPA 4QOEA 5IJWA 3PPVA 2POQX 3WLAA 4DNXA 4M9SA 4I3GA 4B32A 3PHIA 4ND1A 4YREA 2JIRA 2VHYA 2QEXB 2OORC 4Z1OA 5C1DA 1UDRA 2GCOB 1BGWA 1G3UA 3AP2A 3RD5A 4I4TB 2OTLB 3BM5A 4Y2UA 4LDPA 3ZDAA 4CWAA 4DMKA 2ZT8A 4ERNA 2BSAA 2NN3C 3H6HA 1FDWA 3U6KA 1PYGA 4O3FA 1VIVA 1E9RA 3X1KA 1SWWA 3U4DA 1J0BA 1QX4A 4JLWA 3EPRA 4QG7A 3TPZA 5AHOA 3ZXXA 1G1MA 5LYJB 1PNQA 1Y3DE 3PKZA 4DKJA 4DRXA 1DQZA 4YY3B 4HR7A 4FXUA 3SK0A 1HA3A 3OICA 4PLYA 1USVA 3WLRA 1WRBA 4CF7A 2FRDC 2RK6A 1I2MA 4LV5B 5KPJA 3KQKA 1K6XA 4EX7A 5FP0A 3N7UA 1YE3A 1T6BY 1AY0A 4YVFA 5ENZA 3TLMA 4HRVA 5FAXA 3QNMA 4WADA 1TT5A 5GP1A 5ILQA 4AMUA 1E1CA 3CONA 1R9JA 1Z16A 4PAQA 3OPYA 1P44A 4Q01A 3L1HA 3W6OA 1U3DA 5F73A 1DEXA 4JLDA 2AZTA 3CLTD 5KTOA 1WE2A 4D5GA 3D6VA 3NEJA 2JFGA 2P9YA 2R8RA 1C7EA 2NO6A 5ADVA 3G5LA 4KLAA 1X7YB 5DI9A 4AY2A 1AV6A 3C6YA 1U63A 2D0PB 1QZUA 1EA5A 1TRHA 2PFKA 1SULA 1NC3A 3KAPA 4RV4A 1IXYA 4IG9A 3MWEB 1E1KA 1RI5A 1L3CA 2ZBDA 3M6WA 4M86A 4WOCA 4FB4A 3NGXA 1KZLA 4XWKA 4R31A 1GAWA 2DBYA 3OQJA 3PTZA 1L5GB 1GNLA 3WYDA 4ZZ3A 1AHIA 3LNTA 2P2LA 1ZCZA 5IBCA 5EJGA 1FP4B 2CHQA 3FDFA 4XWTA 3E8SA 2FUKA 3DAPA 3MQFA 4LGYA 1WCIB 4XM3A 3GZ4A 2X7XA 1ZCAA 1FU7A 3QFFA 1HDEA 3WYCA 2F8TA 4WRRA 2VAPA 3AUYA 3HEMA 3OOHA 2ID7A 4DT1B 4XONA 1RQRA 1U0NA 3E9QA 4Q1VA 3SOZA 3T7AA 3WGOA 4JLNA 2QVGA 3G0BA 1QHNA 2PXCA 3AJ9A 3FVVA 3T5TA 3K6KA 1P2BA 3F4LA 3EGCA 3SC2A 1T9AA 1ISPA 1O97D 2HCFA 3H0EA 1P4SA 2ZGVA 1JQBA 2JGJA 2R7KA 4A8PA 2WE7A 3CNBA 4RADA 3E03A 3WIUA 1U7WA 4TX1A 4JI5B 3UTDA 1NJFA 3ZWAA 4C43A 4GPD1 1YCDA 2BKVA 16PKA 1R8YA 1G1AA 1U8XX 1XCJA 2NTVA 3B7GA 4WL0A 3FUTA 4G0WA 2D54A 4HRXA 1NF8A 2DM6A 4G4GA 4P33A 3L4JA 1WB5A 1UQRA 3O83A 5GMOA 1V4NA 4IYJA 4XUDA 4YAUA 4ODIA 2OB1A 2H16A 1HT0A 5A4MS 3AP1A 4R98A 2A35A 4ZIRA 4Z2AA 1AKWA 3GBSA 1P1RA 3EIQA 4MO9A 2LDXA 3MCUA 4JUCA 4GPTA 4UUOA 1A72A 1YE5A 1FLVA 3PQEA 1PNRA 2CMDA 3LH5A 2I2XB 5JSZB 1UD5A 2J33A 3CCJB 5JNLA 4AAYA 2EEPA 3PL1A 5BOSA 3QFCA 1ZOIA 1CP3A 4RH0A 4RPLA 4U7DA 3EOZA 3PHBE 1R12A 4ESOA 1NMSA 3ZCRA 1ZKMA 5JATA 4X06A 2FMHA 4JMLA 4L02A 5F3WB 1WEKA 3R9XA 1SHZA 2CDBA 3LDHA 4ZI7B 2X6WA 1E2IA 4DB2A 3UO8B 4P80A 4U2KA 4EY5A 1Z2PX 3UAG