4F7DA

Crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
246
Chain Sequence
SKFDTATVLSVHHWTDTLFSFTCTRDQALRFNNGEFTMVGLEVDGKPLTRAYSIVSPNYEEHLEFFSIKVQNGPLTSRLQHLKVGDPVLIGKKPTGTLVADNLLPGKTLWMLSTGTGLAPFMSIIRDPDIYERFDKVVLTHTCRLKGELAYMDYIKHDLPGHEYLGDVIREKLVYYPTVTRITDLIASGKLFTDLDMPPFSPEQDRVMLCGSTAMLKDTTELLKKAGLVEGKNSAPGHYVIERAFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
total genus 76
structure length 246
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4f7dA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4f7dA02
4TMWA 2D74A 1F60A 4G5GA 5THXA 3B8HA 3WNDA 2HCJB 3U2QA 5TV2A 2DY1A 1CNFA 1EP3B 2PLFA 2HDNB 2X3UA 4DQKA 1IJFA 4FK8A 2EFGA 4TN1A 5GV8A 2OTJB 3OJWA 4PC1A 1TUIA 4LBZA 3AVTA 4RCYA 1QH0A 4RD0A 1B2RA 1EXMA 1DDIA 3CCVB 3CC2B 1VQ7B 1BX1A 3W2HA 1VQ9B 4YALA 4RD4A 3W2IA 1OGJA 1QFJA 3ZBUA 1S0UA 4RCZA 3QSYA 1UMKA 1JJ2B 2ZITA 2DEUA 1SKQA 2OTLB 1QX4A 2BSAA 3LO8A 3W5HA 1I7PA 3AVVA 3ZZTA 3U6KA 3I56B 1VQ4B 1H42A 3CB4A 4EH1A 1VQ6B 4QHYA 3CW2A 1FNMA 2BGJA 1YITB 2EIXA 1VQPB 1DG1G 2NPFA 1FNCA 3A1FA 1U2RA 4WQMA 1G7CA 2QA4B 5EMNA 1EFCA 4FWTA 2BF4A 1AIPA 3CD6B 1JA0A 3I1FA 1EP1B 5TR9A 3CCMB 3V76A 4B48A 3ZZ0A 3PENA 4TMXA 3W5VA 4HE6A 1JB9A 1QG0A 2XNCA 4F7DA 1OB2A 3LVBA 3CXCB 2C77A 2C78A 1R5OA 1EFTA 2VZLA 3OW2B 3AVYA 4ZCLA 2YWGA 3WBKA 4LBYA 3WY9A 3LYUA 1R5NA 1KK0A 1KRHA 1YIJB 1N0VC 1ZUNB 3WBJA 3W2EA 2AHOA 1Q81D 3B82A 1S72B 1QFZA 3ZBTA 3JQRA 3U6BA 4P6VF 1E62A 3OZWA 4MYUA 1GVHA 3VMFA 3QFRA 1CNEA 1EFUA 2VNIA 3AGQA 4AF7A 1DARA 4DQLA 4ZV4A 1TLLA 3OZUA 3ES9A 4HE5A 5HXBA 3WNCA 1QGAA 4NBSA 4LBVA 4PC7A 1CQXA 2BVNA 2OK8A 1QFYA 2BN4A 4ZGNB 1QUFA 1EWYA 5H59A 2DCUA 4AF6A 1ELOA 4PGOA 2BV3A 3CMAB 2QTLA 1YHQB 1YJ9B 1KTVA 3ZC3A 1VQOB 1YJWB 1QVFB 3QFTA 1KC8D 1GAWA 3AVXA 2BM1A 1Q82D 1G7RA 4PC3A 1K73D 2VNJA 4PC6A 5JBQA 4LBWA 4ZCIA 4PC2A 4B3XA 2GPJA 1W2BB 1XB2A 3VO2A 4M53A 3CRZA 1FDRA 2BPOA 1ZM4A 4U9UA 1WDTA 1TVCA 4TMVA 3JQQA 4QFMA 2QN6A 3WNBA 3CCRB 2XNJA 1KQSB 2XEXA 1KK2A 4YAUA 1G7SA 2FX3A 1J9ZA 4NCNA 2YWHA 1ZM3A 4Y9RA 4Y7CA 4C43A 1ZM2A 2VNKA 2QDXA 2QTZA 1DDGA 4M4SA 3CCUB 1BX0A 3OZVA 1KJZA 3W2GA 4Y9UA 1IJEA 3FJOA 4RD6A 1H85A 1IB0A 1K8AD 3CCLB 4M1KA 2BGIA 1JNYA 4ACBA 2VNHA 3VO1A 4G1BA 3VNVA 3QE2A 1D8TA 1NDHA 3AGPA 1OB5A 1QVGB 4TMTA 4P3YA 1W35A 4UAJA 1M1KD 3QFSA 2BMWA 3MMPA 4YAFA 4YAOA 2CRVA 1GR1A 3JQPA 5DSZA 3CC7B 4G1VA 2YWEA 4B44A 1ZM9A 1FRQA 4MYTA 3E20A 4N3GA 5AN9A 4B47A 1N8RD 3CPWB 1VQ8B 1GJRA 1OGIA 3J81k 3VNUA 1F20A 4K1XA 4IW3B 1B23P 1JA1A 2CNDA 1QGYA 5FA6A 1M90D 1W87A 1K9MD 1KK3A 3P27A 4ACAA 1GAQA 3WXMA 2R6HA 5H5JA 2PIAA 3G71B 1G7TA 3I55B 1BQEA 5KSWB 3CC4B 2B7BA 2DERA 2B7CA 2YWFA 1FRNA 3AVWA 3ZZUA 4B4DA 4YAWA 5TY0A 3AVUA 4ZGQB 1AMOA 1FNBA 5GV7A 1D1NA 4J0QA 1NJID 3CCSB 4FN5A 1VQLB 2E1RA 3CCJB 1Q86D 4R71A 2GQFA 1VQ5B 4BPRA 3MHPA 2RC5A 4RD2A 1E63A 4C0SA 4M0LA 1VQMB 3QFCA 1KK1A 1BJKA 2BM0A 1XE1A 3B78A 1R5BA 1TTTA 4Q7JB 4H9GA 2DETA 3P26A 1VQKB 2OK7A 4ZCMA 3FPKA 1QUEA 2HMAA 4B43A 1E64A 1N0UA 1HA3A 2J7KA 4RJLA 1GO2A 1YI2B 4RD3A 3CCEB 1QGZA 1YJNB 4M2LA 3WYAA 3LRXA 1D2EA 1SM4A 2QEXB 2B5OA 1VQNB 2QMUA 1KD1D 4N3NA 4YHBA 3E1YE 3CMEB 3G6EB 1EP2B 4TMZA 1W34A 1A8PA 4RD1A 4AC9A 3G4SB 1Q7YD 3W5UA 3MCAA 2RC6A 3SJZA 4LC0A 2VYQA 3W2FA 1FNDA 3CCQB 3OJXA 2PMDA
chains in the Genus database with same CATH superfamily
4P22A 2PPLA 1O96B 3FSGD 3H2KA 1H66A 2QN1A 4IH1A 3Q98A 5I48A 4LMBA 5TNXA 5JEEA 2F43A 5ARCA 2GZ3A 2XQIA 1Z37A 5K1ZA 1MQ8B 5B1EA 3QTLA 1XZFA 2O4UX 5JYDA 2NN3C 4ZTZB 2CFIA 3MWKA 1DKPA 4DF3A 4FK8A 2Y1DA 3GAZA 2BW0A 3HCFA 4M9RA 1OFIA 1AC5A 5TGTA 1NVFA 2ZJBA 5H83A 5HUHA 3CFYA 2AOWA 2WYHA 2REXB 4Q47A 4Q00A 2CVOA 1P3DA 4QL3A 1FFXA 5AW1A 1RQ2A 5DRTA 2FPXA 5IJAA 3FDXA 1D09A 2RIPA 2RB4A 5HQ3B 3HR8A 3I6QA 1E43A 3GP8A 1GU1A 4M9QA 4P7BA 5EIWA 5G1OA 1DJNA 1E2BA 2OUIA 4KRGA 3NDPA 4A1FA 1BXKA 2ZVDA 1VQ7B 4KKUA 1VSQA 5EUMA 3THSA 2I91A 4TL9A 4NJEA 3TM4A 3ASQA 1YVRA 1P7WA 4AX4A 2QMEA 2YVKA 3K92A 4RVOA 1KTIA 1IPFA 4JJ4A 3VHQA 1ZXBA 3A1TA 4OGWA 1TD1A 4F2PA 2AYYA 3UAGA 3V9AA 2YJ5A 3E3MA 4D97A 2O8FA 4WN9B 2AUMA 5J2UA 1I0LA 1GAEO 3WK4A 4AQ7A 5B6JA 3E82A 1Y48E 4G81A 3RS3A 3BWYA 2DTDA 4RTPA 4COOA 2CXUA 2B8EA 1UAGA 5G1NA 1TF7A 2GEFA 2FRVA 1UWKA 4HLUA 4LHSA 2LBPA 3LKVA 4ALKA 1V1RB 2Z4RA 4M6WA 4RK4A 1WM1A 4CETA 1OXUA 2QVXX 3EBLA 4PTZA 2FWIA 2J7PD 2ODBA 4QGFA 2LKCA 1JR2A 2FLVA 1F12A 4RXMA 5ESDA 3RU9A 4QT4A 2OXIA 4EB6A 1I7PA 5BO5A 5JAIA 3RIYA 4LF6B 3QWFA 3ONVA 5A5FA 5DSXA 2A88A 5K45A 4R51A 3NDIA 1BDHA 3GT7A 3JSAA 2V55B 2RAVA 1N7GA 4QGGA 3CNHA 4JLOA 2RGCA 1P1CA 3DULA 4GPTA 4LK2A 4ZO4A 5KC8A 1WVMA 2FDCA 4PPNA 4ABYA 3H0EA 4LZLA 2GS9A 2HX1A 3L1KA 3BK7A 4BL5A 5DNYB 2O6HA 4DMLA 5EWJB 2O2YA 2OHOA 3GZ4A 4N3BA 4PZLA 2AEMA 4EHLA 5F7XA 2VXBA 3F6SA 5JO0A 1JDBB 1KGDA 1KY2A 1YHYA 3EXEB 4IHKA 4KJXA 3JZAA 2QP3A 1A27A 3ZXUB 1NQUA 3OECA 1NUQA 2NUPB 1QP8A 3B12A 3W3AD 1C1HA 1VCIA 5FL3A 4EBFA 2YWDA 4JBIA 3AP1A 2B35A 2F62A 3SC6A 3VDXA 2PZJA 4RDJA 2R7MA 3AUKA 3D7MA 3U3KA 4CM9A 4M0EA 4EHKA 4DDVA 4B6JA 5KJCA 1YHZA 1HYBA 3FVQA 3G2PA 1C1YA 1FDSA 5KVSA 3RANA 4F46A 3IBTA 4FI3C 2O2JA 3MG9A 2E49A 3H1TA 3OUTA 6REQA 1QGDA 1A9OA 3ACDA 1E2FA 1W75A 1VL8A 2K4MA 2WWHA 3GBVA 1L9KA 2D0PB 2WF8A 1KVSA 4TSRA 4ND3A 1KYWA 4KZKA 2O2EA 2DKOA 1JBKA 3FW1A 3PCXA 5L6MB 2H1HA 1I2AA 1U04A 1I1NA 3HUTA 2HTFA 2E4YA 3IBFA 1FUKA 4QEZA 1JLKA 3H9GA 1OPRA 4PG5A 1PJ8A 4EY3A 1XKTA 1SCIA 4PHFA 4ZOEA 5FUVA 3WADA 3P2JA 3DMFA 4MUIA 1CUBA 2V59A 1XZLA 1Z39A 4GGOA 3RUAA 4MHSA 3PGLA 1L7DA 3BRWA 2VPWA 3WBJA 4CG1A 4QG3A 1DG9A 1QZ3A 2O8VA 3ECSA 4KPUA 2QUAA 1E3TA 1USGA 3I3SR 4XJSA 3FX2A 3T7DA 2FQXA 2IXTA 3IS3A 1NRXA 3U9LA 1LRJA 1PD0A 1Q81D 3G79A 3MJVA 2XECA 1CJTC 5JALA 3TQCA 1ZH4A 5JNUA 1JAZA 3VBEA 4JA2A 1L3CA 5DCYA 2R8EA 4H1VA 1AKNA 1E62A 3BK1A 1P1RA 1O95C 3DJFA 3R7NA 5L7YA 4ZU6X 1SZPA 3N28A 1CU1A 3OWXA 4LZJA 3AUXA 4TL6A 3RIMA 5T6MA 2DFLA 3HMQA 4EF6A 2PV0A 5FV7A 1T24A 3G0GA 1ZONA 1CNEA 1Z56C 2HMVA 1L5QA 1X7XA 2IW3A 2ZSUA 1USVA 3D6JA 2WM8A 4WE3A 5TMBA 2SECE 4QXMA 2A2ZA 3T3MB 3E2MA 5C8YB 2PKQP 3EFBA 2OZLB 3L6CA 3P9IA 3PD0A 4HNRA 5JU6A 3MMZA 1TNDA 5FORA 3B6JA 4YUVA 4JCCA 3UWOA 4RLFA 3SQOA 5HSGA 1I18A 1B0PA 4O08A 4JI1B 1VLJA 2W11A 1SBHA 2AZ4A 3INRA 1NU8A 3OCYA 3VYVA 1JVBA 5ULLA 4DN6A 3KB8A 3DKRA 1FU7A 2VT3A 3NTLA 3O4JA 4K0KB 3BULA 1OW3B 3LCCA 1PG5A 1K98A 2CB0A 3QE0A 3R3UA 1T0BA 3ZJ4A 2C54A 3P9KA 1REQB 3JVVA 3AUUA 1GADO 3ZIUA 4MS3B 5B12A 4QV2A 4OFBA 4S2EA 3RYHA 4P0QB 4E09A 1JDJA 1M2HA 4RY0A 1SRQA 3ZC3A 1JNXX 2GUWA 3KBBA 1GZDA 1VMIA 1XNGA 3NLLA 4WY2A 5F4ZA 4E6PA 1C41A 4AMGA 1AXGA 1YR8A 2XD4A 1NV8A 3KVOA 2H1SA 4OU4A 3TSZA 5BW5A 4KPYA 3QPVA 3RAJA 3FRJA 3G0HA 4PG4A 1GFIA 1FP6A 5AXAA 3UC9A 1CRZA 2O07A 5JS7A 3T0GA 4DVGA 2WWXA 2PS0A 5B5SA 1P4JA 5DSTA 3A4TA 2C98A 5KU7A 4WIAA 2AK2A 2Q46A 2BFPA 3B7PA 3BE5A 4ALIA 3L6RA 3COYA 5G2OA 3MJFA 1KY4A 5K6RA 4IHJB 4MPDA 4PZPA 3VO9A 2MSKA 1OI4A 2FR8A 5IAEA 1OI7A 3TVYA 5GADl 4PZYA 1VRCA 1Y5MA 2C88A 4ML3A 4M1YA 3AH8A 3WRYA 5LP1A 1NURA 3PNMA 4RENA 1TVCA 1WPGA 1SKBA 3BSWA 4R3WA 2GJRA 4QVAA 1JAHA 1GCIA 1TJNA 2BI4A 4ARSA 2Z2IA 1NOJA 1P2UA 3C8MA 2QRLA 5AUOB 1ISSA 1K6XA 2XEXA 4POOA 4NYIQ 3A35A 2EU8A 1AF4A 2QGGA 1JFLA 2TMKA 3NGMA 5KNBD 3QKSA 4H1WA 4FYKA 1LLQA 2O06A 2P65A 3MUEA 1JHPA 4RA9B 1AGRA 1QHYA 4GOXA 4Y9SA 5F2KA 3V2UA 3L8ZA 1L5LA 2WFLA 2FMHA 3EVBA 3BC1A 5HE9A 1JSZA 4Y6OA 1DOZA 1E9VA 2O1WA 4TQGA 1J2RA 1KSHA 4MROA 3SC2B 1N5LA 1EQ2A 4NCNA 3LY9A 4KQIA 3P52A 5JD3A 2YWHA 3W3AH 1DKOA 1PU2A 4UPDA 1BD3A 3MWYW 3ISJA 4J3NA 3AW9A 2VBCA 1F48A 2NV0A 3D6AA 2CXPA 3DEJA 3OT1A 4QBGB 1GPKA 2O0JA 3GY0A 5GONF 5K0NA 5J4YA 3FR7A 4ZQHA 1SXJE 2QMOA 1U3TA 4HGOA 2I1VB 3DHYA 3VR4D 3T9FA 4JASB 5TVGA 4ZYZA 2BKUA 2Q1WA 3B6MA 3CF6R 4HQFA 2F8LA 4IRXA 1W73A 4UM5A 4YWJA 3W7AA 2J4CA 5EJ6A 1KFKB 3K9CA 2R9VA 5L45A 3MFYA 5KW9A 3AQ4A 2W6ZA 3W2GA 2OLEA 1LZKA 4HDSB 1EUCA 1Z4PX 2BMEA 4L0DA 4ARUA 4FMPA 1YU9A 5FB3A 1ZUWA 1ODLA 5CBPB 1W9HA 5IP5A 4DV6B 1RHQA 1UPUA 3T6KA 5ADHA 1YK0A 2IYVA 3D6UA 1H2AS 5K5EA 3MUFA 5LWHA 4KAAA 2AFIB 1FPMA 2BFCB 1G60A 4AT1A 5EJEA 3D5EA 5TXGA 3PD1A 2XODA 3DZDA 1CY4A 1YJCA 2HH9A 2QLBA 2VNHA 1FDUA 3L3BA 3L4SO 3TL2A 1RM3A 4JIGA 3UA3A 4ZZ3A 4KITB 1K7YA 4YP5A 3VNVA 1FX0B 5EZYF 1HSOA 1KJNA 2D9RA 1XI2A 4ISBA 5MDHA 3MTAA 5JXHA 2NQ8A 4ZT7A 2HNBA 5CM2Z 1EU1A 5L4SA 2WJJA 2AOTB 3WL4A 4J0GA 5AVRA 4U2BA 2XAUA 3QUBA 4TVSA 1IE3A 4HWPA 1H9AA 1W1WA 1WXFA 2H5LA 3B1VA 4IYJA 1YIDA 3VDRA 3ZNQA 1ENOA 2B1RA 3GRRA 5ER6A 5DLEA 1T5BA 1JIKA 2O6LA 3O83A 1PZEA 3CLUD 1XZQA 3B6IA 4YLGA 3JQPA 2A86A 3ODGA 5ESXA 3SJCA 1XRRA 1W36B 3LVQE 1NDUA 2BGRA 1SD1A 3SS8A 5EIEA 3O75A 4EYGA 1XHFA 5IABA 1GUYA 1SULA 2YOFA 1KNQA 4B9AA 1CR6A 2GUGA 2GASA 1PEAA 2GCPA 1QO9A 1WPQA 3KAQA 1D2MA 4ALJA 3W79A 1H8EA 3O0TA 4H7FA 5JADA 4MWBA 4YMVA 1J06A 1CY2A 4V0ME 4BO3A 3GOHA 4MYTA 2HIHA 3MWLA 5CAEA 3GJ7A 1I9CA 4HV4A 1CF4A 4EP1A 3FFBA 3AO0B 5AN9A 4N12A 4OA5A 1C80A 2DCMA 5FT9A 2PKXA 4P93A 4EBBA 5H9VA 3CPWB 2JH8A 1Q0ZA 2OHFA 3EOZA 1LPPA 4LWQA 4ZMSA 5IJ0A 1KBZA 1NL3A 4P7JA 4PSCA 1VPLA 2NT3A 3NW9A 3TGWA 3OQJA 4BNKA 2HBYA 1FFSA 3L8YA 1QHHB 1YE8A 1Z2EA 4R6XA 4ZDJA 4TYYA 3R7WB 1D2AA 1BG6A 3WYGA 1QGYA 4X92A 3S8MA 1YMQA 3SDBA 3W7VA 3H3FA 4W9RA 1P7ZA 1Q1BA 1WWKA 2CXQA 1J0AA 3RF7A 3QHQA 4O4JF 2R11A 4OGGA 1V8ZA 2O5VA 2X0RA 4RGBA 1U1FA 2H31A 1PR5A 1Y0BA 4MV4A 3B3QA 3ELWA 1NLUA 3SS7X 2WIKA 3BUSA 4BFLA 1EUDA 4B35A 3UAZA 5IDVA 2OZEA 1WHTA 2I7VA 4UUMA 1WVIA 3LZDA 1LI4A 3R23A 5LB4A 3SFZA 5BWNA 3O8BA 1H4VB 3H1PA 3K9WA 2QP9X 4J1SA 4KAXA 5BSVA 1KEUA 3OW7A 1Y1PA 1RJGA 4QUBA 4A8JB 3G71B 1HNNA 3S99A 2WJ4A 4YCJA 2C9OA 1EMDA 4BNDA 3I5YA 1DKQA 1A5ZA 2Q4DA 4MQEB 3SHFA 1LWOA 3SCZA 1O87A 4ERNA 4MGKR 3SZGA 1ENYA 1UXKA 5IH3A 2C00A 2RI0A 2XV1A 4MNTA 3UKDA 3O2QB 1KWGA 5HHTA 4RX1A 1UT6A 2QPAA 4DUPA 5KNBH 4RF4A 1RZUA 2WD9A 5ES4B 1CULC 4OF4A 1C7JA 2GD1O 5P21A 3CJQA 1CR0A 1N1DA 4G01B 4KLZA 5K0GA 4FN5A 4JL8A 3REOA 1R4MA 3B51X 4XW2A 4Y98A 2XTAA 1WCWA 3LRPA 4MJ7A 2ZLBA 3PHGA 4JLSA 1VQ5B 2A9QA 5T8KC 3BAZA 1OE0A 4GYWA 4U4AA 2GJ8A 1LH0A 4OKIA 4OQEA 4TS4A 8AT1A 1P4AA 2QTGA 1UJMA 4HB0A 1BCRA 1GT91 4QRDA 5E0OA 2ZIVB 3HV2A 3NOVA 4D1YA 1JIQA 4YT8A 4YRMA 3C70A 4NBNA 1G5TA 3GFVA 1KO1A 1FYEA 3GLQA 1QV7A 4WLNA 5B58T 4D9CA 1NVEA 4NECA 4EVSA 1BE0A 3SYNA 3WLQA 2H2GA 1FK8A 3NS7A 4BJ5A 1ZN2A 2AK3A 4EJMA 4MW7A 1HXHA 1P1KA 2Z4SA 2R0QC 2C5BA 1ILWA 2Z3WA 1DAEA 2ZYGA 3Q5GA 2EG9A 3PX7A 3WP0A 4YA6A 1DSSG 2YFYA 3SZRA 3ZV4A 2ZTGA 2XTMA 1FSZA 2YRXA 5FAXA 2IYYA 1OLSA 3JQCA 4QVGA 1UDRA 1WMFA 2ON6A 5E38A 4MPJA 4ROSA 2ZE5A 4BFYA 3OQNA 4E2ZA 3T1YB 1Y0YA 1J8FA 2IDJA 2NW6A 5AFSA 1GG2A 2E5WA 2L69A 2X1MA 4MUBA 3T5AA 3KT6A 3OA2A 2GPSA 2ORVA 4D25A 3T38A 3R3YA 1GO2A 2L17A 4IWXA 4RD3A 3EIFA 3VZBA 1CWUA 2QD5A 4AZ3A 4YUYA 3Q88A 1SOUA 1PQ4A 4R8SA 4YRBA 1Y33E 2GJ9A 4YXWA 2ZAIA 3NHYA 2CT8A 1VZ3A 3GEHA 5H4HA 4XIJA 4LQDA 1Q2XA 4FNAA 3WA7A 1XP8A 3K6RA 1G8YA 5EXPA 5C8VA 1DRUA 3CR3C 3DTNA 5DIFA 4DV1B 1GCOA 3L0SA 2NACA 4IOMA 4AL4A 1K5DA 4DZZA 4NBWA 3KAPA 4R01A 5G0UA 4B3TB 3FPPA 2XTJA 3A9WA 3E9DA 5KZMB 3AESB 1BA3A 5JC1A 2BWJA 3S2EA 4BX2A 1YS9A 1RYEA 3PT5A 4YDRA 4O2AB 1X15A 3FSGA 1VM6A 2QRVB 2I4IA 1R4AA 3DUFA 4GO1A 2DZDA 5BVHA 4ASUD 1L5VA 2GK3A 3DKPA 2YZ7A 4GF5A 4FHGA 3GI1A 3CF2A 5A9RA 3EEYA 1YULA 4D81A 3MPUA 3NAMA 2Q7OE 4IFIA 3WI7A 3VQTA 1QBKC 4GOLD 4HWKA 2OBYA 2RHRA 2PUTA 2VYQA 1ZOLA 2CFOA 5F1KA 5PGMA 4B33A 1WSAA 3LHSA 4LYGA 1C9YA 3TQOA 3ICOA 4MAFA 1PBNA 2XXAB 4HJRA 3W0LB 4GVPA 1FLDA 1SCUA 4P3IA 1C7EA 1EXNA 4ZOLF 1KMHB 3CPSA 3KK0A 4M0UA 4ZPJA 3TX6A 1CVRA 4CT5A 4DCCA 5THXA 4WZ6A 1YTUA 4XLCA 1I4DD 4Y2GA 3I3OA 1U3WA 3DNFA 4FFRA 2QM7A 2GZHA 1EK1A 4H6XA 2P3SA 3TFQA 5L6LB 4NE2A 3CX4A 4EYEA 2VDNB 2JDIA 1GTZA 4ILEA 2NU8A 1L3BA 3E0QA 3H4VA 4CM5A 1LLCA 3TN7A 3P32A 4YPOA 3D8SA 4LRXA 1RWKA 2DWQA 4G65A 4N41A 2AFRA 2ZWOA 3AJDA 3QV2A 4MW9A 1YLOA 4CHGA 1ISPA 5TT0A 3VZQA 4DJDC 1ZW6A 4WBNA 5A3QA 1M74A 2C1XA 3D6MA 1IONA 1KZYC 4MVJP 4R9RA 1U0JA 1B6RA 4GUAA 4WX2B 1Q7GA 1NVXQ 1X0XA 5DM0A 5U4QA 1YQXA 3E03A 4QREA 2JI6A 4EUHA 4FJ1A 5ALEA 1W5FA 4CXMA 3H94A 2P4EA 3TQRA 3WKBA 1OF1A 4DW8A 3L6OO 5BSRA 1UJCA 3VVCA 1NQOA 3IP3A 3GMIA 4ADSG 3HFSA 4JQSA 3UYKA 5KYWA 1EDDA 1XAIA 4BN5A 1T5TA 2WSYB 2G88A 4Q4AB 5KTTA 1CZRA 2J3HA 3HCNA 3COVA 3ENVA 3OM9A 4UVHA 3NHZA 3RC2A 1ATIA 1QK5A 3L8HA 4NAVA 5JTUA 3U1BA 1QRAA 1G6HA 5EXTA 1PR2A 1FRFS 2NO1A 5DLPA 4RZXA 2C5GA 3EG9A 3JQAB 3P9QA 4IXNA 5JY6A 5KYKA 3MMNA 4C5BA 3N2NA 5ITWA 5CLQA 4HRYA 5EYPB 3RG8A 4X8LA 4CN9A 1G8AA 3PA8A 5DM1A 3Q8KA 2I87A 5AJHA 1TYEB 4UTRA 1YB1A 3ONUA 3GF4A 3FYUA 3FHOA 4XCQA 3PRJA 4QSHA 2A9PA 1XZNA 1Z15A 4RTLA 3AKZA 2IBSA 5ALTA 1TM3E 3HBJA 4B3SB 3R0ZA 2Q28A 4DREA 2JGDB 2V7WA 4Q9IA 1H42A 4GZ5A 3BIOA 2XDQB 1KQFA 5JTTA 4PG6A 1T5EA 3KJNA 4PR0A 2UZIR 3DL4A 3H97A 3B3FA 3OZCA 3QX9A 3T3NA 4H3VA 4KYUA 3H5NA 1YB2A 2H2DA 5IM4A 4PQGA 1Z8FA 3FG9A 4DFDA 4MSUA 1Q9SA 5HM8A 2JBAB 1NIJA 4PCVA 1OFUA 1IQPA 1OBHA 3IJPA 4MRNA 3Q3EA 2XCLA 1WUTA 1QF9A 3A25A 1IG0A 4G9BA 4LV6A 1HLPA 3E2IA 1S2MA 2R8ZA 3AEYA 3BBPA 1ZIDA 2WWRA 5HF9A 5HOEA 4JI0B 2VIIA 1AIPA 1MDBA 1XG5A 1A2KC 1ZGGA 3H9CA 3M6VA 3QHPA 1LJUA 2HU8A 1MO5A 4ZVSA 4Q34A 3AI3A 3U4HA 4ZICA 2B37A 4RADA 4HB2A 4Q7QA 3OCWA 2JIOA 1IBLB 1HBJA 2XW6A 1GN8A 4DNPA 3JD0A 1L6RA 3PQ5A 1PE0A 2PAAA 4CFSA 1ZVVA 4FSDA 3RVSA 4UU0A 2O0LA 1M6VB 2JVJA 2K2QB 3E8MA 4GT1A 1NBME 4GRAA 2P79A 5ELMA 1XD2B 1ZPDA 2D1FA 3K8YA 5ISMA 3NHLA 3TRJA 4UREA 1TEXA 2WA2A 3AVOA 1KH2A 5LDHA 5DVZA 2C77A 4DLVA 5LQKA 2AKEA 2HJWA 1T4GA 3QELB 2YJ3A 1RXYA 4EDHA 3K96A 5BWLA 1SZDA 3WBKA 1X13A 1G66A 1Z75A 2W6PA 4H59A 2XYRA 3WY9A 1ADJA 4JROA 4C4XA 3E27A 4REQA 1W9XA 3JYNA 2TYSB 3MCTA 3RT9A 2BFFA 2GTPA 1DKRA 2VKTA 4FHEA 4ERXA 1C9KA 3EVNA 3ESDA 3FHJA 3NHJA 2PBLA 5NULA 5IXSA 4OLAA 4PZCA 1B0AA 4LV5B 5U4XA 2LTAA 3EVAA 2Z2JA 1A5TA 1WMAA 3H0KA 4PQEA 1J8YF 5B57C 2Q3JA 4XOUA 2IPXA 1Z7WA 5ENDA 3LPLA 4MVCA 4FGJA 3QIVA 3PDWA 5KWEA 1WY5A 1Y9AA 1BOOA 4BNWA 2PK3A 1M7GA 3RH0A 4FEGA 1RHMA 4Q1VA 4V3BA 3MWJA 3RYIA 4HGRA 5K8IA 1VRVA 1WTCA 2G9UA 3QI7A 5GOTA 4F2GA 1WS6A 5A9SA 4ZI7A 2EV9A 5CFRA 3PPWA 3TBHA 1ZD9A 5DZSA 1Z22A 2F67A 2H2WA 3G59A 4K1LA 1XEWY 4OG2A 1VE6A 4PAAA 2P4SA 3H5TA 1CR4A 1CY6A 3DTVD 1U9YA 4ND1A 1NW5A 2ORIA 1C3OA 4BRUA 2VJOA 4C6HA 1PFWA 1SUBA 3C3JA 3M8KA 4OJQA 3FOFC 4LBVA 3AB7A 1ICIA 3WNVA 3RE1A 4Z3KA 1LCIA 2BVNA 3CLRC 4AJ1A 1E4EA 1A97A 3HCAA 3P9ZA 4BWYA 1Z6AA 1Y3DE 2VAWA 3G0CA 3R3WA 3VNRA 1DIHA 2NUBA 5EZSA 4BNFA 1B00A 1NBIA 2PG3A 2GLTA 3PUYA 3CMAB 4X3OA 4D2IA 4RLZA 3EZ7A 1FU4A 4M1MA 3GB9A 2ATEA 5ER9A 1UZMA 4RKYA 1EB9A 2YRWA 3REGA 1T29A 4ENSA 3NUQA 3OHPA 5C7OO 1T15A 2Z5LA 4Q93A 4AJJA 1Y7TA 3U3JA 2VDWA 1NJGA 3R8FA 3N0TA 4Q3CA 1EUQA 4X63A 3AVXA 5CA1B 1AGNA 3ZIAD 1LSSA 1CZHA 3DV0A 3REQA 3AEQA 4MPRA 2B30A 3AINA 1NHGA 1R6TA 4WOJA 5FPQA 1YJBA 4X97A 4BASA 3WYFA 1M6NA 2Y05A 1F5SA 3DFFA 2QD1A 4NXNB 1ZK3A 1U9ZA 4BE7B 4DWVA 1X19A 3QUSA 1A3CA 2FPMA 4FGUA 4K6FA 1QQ7A 4K8RB 4MICA 5CW1A 5FCDA 3VC3A 4PN3A 3PC8A 3EIXA 2D6FA 4J1TA 4XX0B 4MV8A 2I78A 2VHTA 1ZD5A 3QM1A 3JQQA 4QFMA 1X8XA 1E7WA 3EEQA 5HEKA 4D8WA 3CP2A 2IXBA 3GW8A 3H2ZA 5DX8A 1MIOB 1K9VF 4HYEA 2BP7B 5JWOA 4A73A 2EJVA 4OQNA 5BQ5A 5IUKC 4RYLA 1P5HA 3AIMA 3U4GA 2Z9BA 5CM8B 1R9NA 3E81A 1B8NA 3VZSA 4L9SA 4CUJA 5B2FA 1GOTA 2UUCB 2FX3A 3L43A 3DQQA 4G8JA 4V2UA 3W6PA 2FMTA 3I6MA 5HJEA 3KQWA 5AHRA 2ZJ7A 1AN9A 1QBGA 3C3MA 3GH3A 3IC5A 1D6JA 3MYRA 1L7EA 1XMSA 2HREA 1E89A 1R6XA 5AUQA 3WDMA 4GLJA 5HUJA 5J2TB 4R1TA 5D7BA 5I5GA 2FZCA 4HEA6 4DC0A 5JJLA 1XEFA 2NSLA 1Q20A 4LAFA 3I12A 5KNCD 2WDPA 1THGA 3H17A 4U6QA 1R4NA 1Y37A 2AXNA 2XCUA 4ZO9A 3BJMA 5EL0A 3AZOA 3WZ2A 3GLGB 2J8ZA 1KEVA 2AN3A 3IE2A 1J0CA 1NY5A 2XYPA 1ODIA 4G5OA 1F7UA 4LJYA 1U0BB 1ZCZA 2A0KA 3GDOA 3H2JA 1GUFA 4C6RA 2KPOA 1HZJA 2Q3EA 1D2GA 1KO4A 5HS6A 4UCWA 3WB1A 1PQPA 3PQFA 4YJFA 5DWQA 5DBGA 1AX9A 2YMLA 3ASYA 2OBTA 4MP6A 1UBLS 4DVJA 2BKLA 4AD8A 1WNFA 4AROA 1C4XA 3MTJA 1FS5A 2WSMA 3FJOA 3CKYA 1CP3A 3NKVA 4WH0A 2JCBA 1E5XA 2IXFA 3T3DA 5DW3A 4F21A 2E5LB 1K0UA 2FFRA 1E3IA 1IB0A 2QI9C 3HAGA 2W8ZA 1K4KA 3H16A 3K5HA 2YQ4A 2PQMA 1CJSA 3AETA 3A3OA 4P80A 4L6IA 4M1KA 2BGIA 1S2DA 3I1JA 5TLSA 1HNXB 2QAGB 3DD1A 3QJGA 5HZMA 2VXCA 4KX3A 5J9FA 3F9IA 2WJYA 3QE2A 1I5RA 1HRDA 2I76A 2CMKA 5EPOA 2LDXA 3S6JA 1L4KA 1QO7A 3DBHB 4L27A 1ZUD1 1L5OA 4XVCA 4UAJA 4UM9D 3EY9A 2IOFA 1WSBA 2NZVG 5FWAA 1GQFA 2HHHB 2VG8A 4V0NA 4E2FA 1TK2A 2EATA 5F21A 3ZVNA 1M1NB 3OU7A 5GAJA 4QPNA 2CV1A 2X8KA 3IDOA 1NI4B 2BEUA 3ORYA 1J0DA 3QLJA 2XKBA 1BVYF 1SKYE 5AVOA 3R6GA 4LMPA 5FQNA 3SXUB 2Q3DA 5AW3A 2ZBVA 3QK7A 4HAVA 2BJWA 1ANKA 5JZMA 1II8B 3TJRA 4D0RA 3C97A 1E32A 1UM9A 3OX2A 2MHCA 2DUUA 4JLBA 2REBA 4UUQA 2C7RA 3HVJA 4AJPA 1WR8A 2DFTA 3V4VB 2ZSAA 2G0NA 3EVGA 3GUVA 4JQOA 4M9UA 4DSNA 1UBRS 3PGMA 1CUEA 1KP2A 4GPZA 2O0HA 4RQAA 1B4DA 4A5SA 4MV1A 3DHNA 3I6IA 2I7XA 3TAUA 3L82B 3NP9A 3EISA 4LC9A 3KDAA 3ER6A 1OXKB 3OC6A 3PR2B 3QYPA 3HBAA 2YXPX 1QQAA 3P1JA 1T91A 1GSIA 4Z4IA 4JELA 5TQ0A 4YYZA 4HCJA 4D3YA 3NBKA 4U7TB 4R0MA 4Y6SA 1GGNA 5F1YA 2JBWA 3KQKA 2CDCA 4QVKA 3X1ZA 5FBWB 1M90D 1IDN1 1MRSA 3E5RA 1TLTA 3MPOA 3QVOA 4KN5A 4NHEA 1YJ5A 3I6BA 4GXTA 1RWNA 2FEWB 4E94A 1DJMA 5DI3A 1XLTA 2QJFA 3M81A 1PDOA 2NYVA 4C4SA 1H4TA 1U0FA 2F3TA 3HY6A 5GVRA 1NNEA 4LRTB 2H9YA 1Z4JA 1MOSA 4KDEA 5FO0A 2B5VA 2O7QA 5CLJA 4XYGA 2IP1A 2B8NA 3LBHA 4GE0A 3ZDRA 4NNPA 2UZ0A 2VNAA 2N75A 2V0NA 4BB6A 2H1IA 2EW2A 1L7AA 4EY4A 4IIVA 2E21A 4A91A 2O2SA 3WMEA 1N77A 2NSYA 1EK2A 2G1PA 4NE7A 2W2NA 4EFNA 2BH9A 2QUBA 1YI0A 1XEWX 3DD5A 1X1SA 3ID6C 3RRZA 5BN1A 3UH0A 3SVLA 3Q3JB 5IKOA 2P8JA 2J48A 4CEJA 5DNCA 3PXBA 2A5LA 5ALGA 4HEHA 4BFCA 4E5SA 3SS9X 4KRXA 1J20A 3VGPA 5E7QA 4M0PA 1IM5A 1IEXA 4LQCA 2XRMA 3IAS6 4M46A 1UPXA 3BCUA 2ABWA 5TY0A 4PX2A 5KQRA 1G20B 3COWA 2O3QA 3OEHD 1YXMA 3RBZA 4QUAA 4F4JA 3NZEA 1SBCA 4ENQA 4X06A 2IH2A 2IS2A 4TV8F 2D2VA 3RUHA 3CCJB 3NPMA 3E7DA 3IQIX 4EJ0A 3OZ7A 1K28D 2PPVA 3AKEA 5AOVA 2O0MA 3KQPA 4X44A 1F4VA 1N92A 2FSSA 4P53A 5KNCH 3AFHA 3CWZA 4JU8A 2YX1A 5K51A 1U99A 4CBVA 4E07A 4KKVA 4D0SA 1GP2A 4QD3A 2F9FA 2P9QA 2PRSA 3QU9A 4JI5B 3PJDA 1O6CA 1EVQA 2OV8A 2QW8A 4PM4A 2ZIGA 3MSXA 1WBBA 4OMFG 1Z82A 3RPEA 5CFQA 3N07A 3EA5A 3S44A 4E11A 2NP7A 1PT9A 4G4IA 1A8QA 2DY0A 3K70C 7GPBA 2Y92A 3T4UA 2CZCA 4DM3A 5JC8A 2VAMA 1ZH8A 1EKXA 3NM4A 1TM1E 3O4FA 1S9DA 3ZGYA 1PR4A 4NP6A 4DNOA 5CCEA 3D6FA 1NG1A 5FEUA 5IVPA 4WFJA 5DLDA 1RXVA 2GZMA 4X07A 4KWTA 2DVMA 1MPXA 1QTQA 4Q3DA 3OPMA 1NKVA 2WFMA 3HU5A 3RO7A 4DWJA 3WJ2A 1GLNA 3LL7A 5KYYA 1PLLA 1P4HA 5CX1B 1IUPA 1QGZA 2A5DA 4FMDB 2PWBA 1Q21A 3IYLW 4GOJA 2I3ZA 4R84A 3COZA 3S3TA 3K9NA 3VPXA 3WIDA 3FLMA 2X7XA 1VIMA 1THTA 4HFRA 1D2EA 3M7IA 5AHXA 2RDMA 2RH5A 3G2LA 3JQGA 1XQBA 3FNFA 4OK6A 4R7ZA 5AM0A 1MOQA 1R0RE 3M82A 1W59A 3PE3A 4U7GA 4UHCA 4JC5A 2XF8A 4A82A 1G2OA 4XIIA 5C0OE 4F5WA 4BVAA 5AD1A 1DV1A 2FRXA 3ETCA 3IP1A 3LIIA 1T1IA 1ULUA 3ET4A 4XM3A 1E77A 3DO5A 4RBNA 2FCAA 4FXOA 2QXYA 3CCFA 3FZQA 1V95A 2FN9A 4NJEB 4EW6A 3CT4A 2W2KA 5E9QA 3RWBA 3OQ1A 1NBWB 3O3OB 4K7JA 4ND7A 1OREA 2VSNA 2WKSA 3KSRA 1BX3A 4P2NA 1M7BA 2HWYA 3KQSA 3L77A 3T4EA 4CKYA 5AVQA 3IPRA 3P71T 1ISRA 2EW1A 2QAIA 1YSCA 3L4BA 3Q12A 1E2EA 4IZIA 1RWPA 2B2CA 2EVWX 2RC6A 2O8FB 3Q6NA 5J2UB 1L3IA 3SJZA 4CMJA 3FAKA 4ZMRA 1K9SA 1RCFA 5DNVA 1YA6A 3ZE1B 4CUKA 1B1AA 1O9GA 2Q1UA 1TAUA 3SDZA 3PVCA 4ISCA 3DCIA 3OT5A 5CYOA 3L4JA 2H18A 1K08A 3LPAA 1G17A 3OQHA 4M6WB 2C5EA 3B6KA 4OYHA 5BR4A 2QM8A 2VTBB 1L5KA 5NLLA 5AM3A 4B3FX 4HH3C 2X8JA 4LYAA 1W4CA 5REQA 1ZNYA 3VKVA 2VRCD 4EB6B 1DC8A 4YV1A 3WMWA 2J30A 4DRZA 5FH9A 1BU8A 1S2GA 4D74A 1LDBA 5CBKA 1PG2A 3ENWA 2I4RA 1ZCBA 4WNIA 2GMWA 3UMFA 4NPCA 2FPLA 1NWCA 4ZK6A 2WILA 3M0EA 5BSUA 1O4VA 3JZIA 5JD5A 5KEIA 1QB7A 2JEYA 4NBRA 1V5FA 4U00A 3N86A 5B3JC 4IIDA 1AKQA 3I9JA 1T2DA 2NXJA 3HO8A 5EUBA 4X9XA 5JT1A 5I45A 1OVMA 4LBZA 3BD6A 3VUFA 1A69A 3CT6A 1MX3A 4ND4A 4QGSA 5U9CA 5DHAA 3TUJC 4L4YA 4EA9A 4EB3A 5K6TA 5BYAA 2X9NA 1RRCA 4W1QA 2ZRGA 4EA7A 5A2QA 1CRWG 3WLNA 4NYMR 3OE7A 1XN4A 1ULBA 4QPZA 2D0OB 2QL5A 3N87A 5MFPA 4X6YA 2I7CA 4RV9A 4TX1A 1XZCA 5DULA 2WF7A 3TGLA 2MIIA 1AO3A 3W2IA 3UMVA 3MQ2A 3DLCA 3EIHA 3QKIA 1J56A 1JDBC 1FEZA 2ACEA 3CTMA 4MVJA 2XH8A 3UJDA 3IGFA 4AG3A 4YYEA 1BVUA 2HWWA 3BSFA 1MV8A 5GJCA 1UJNA 2OT3B 3TINA 2CDNA 4F4FA 1EZ1A 1YIAA 3PGXA 4JBNA 3FNIA 2ZITA 2VSQA 2DEUA 2ILTA 2QJTA 3IUMA 1T13A 3VTFA 3EC2A 2AKAB 4ZVVA 5IXJA 2FUEA 1SKQA 5D6OA 3PQDA 3Q3GE 2OTLB 1PEYA 3HB1A 4HWTA 5DBOA 3ZN2A 3KEGA 1FVHA 1RC1A 4TS3A 2VAVA 2VP2A 3NWPA 5JS1A 4H7PA 5DTIA 2NQTA 4CGYA 3EGDA 1Z7YA 1P2BA 5EIOA 2JANA 4PHGA 3MCUA 3BEOA 4MB2A 1NC3A 2XTNA 5BNFA 3WIOA 3CW2A 4WUVA 2O8DA 1N06A 2KW5A 2QX7A 2OGZA 2VYND 5ILGA 3CF0A 3HYSA 5JAZA 3KQLA 5BQXA 4BMYA 1EHIA 1DBPA 1ZOSA 4RMIA 2BFBB 1X7WA 1QZZA 1BRTA 2AJCA 1I30A 1Z6QA 2V96A 3G5LA 4ZCSA 2I33A 3FCOA 1TOAA 3KUUA 3PXDA 1QYWA 3ZK7A 5I51A 2BEJA 4JJFA 4XGIA 4JNCA 1GQQA 4WZBE 5H82A 3V8MA 2QZZA 2WA1A 3WS7A 5C46F 3ORSA 4HZUB 2C2XA 4FLMA 1H6DA 4XGQA 2B94A 2XD9A 1BH2A 1TQ4A 4UHHA 3KZKA 1PK9A 1X7XB 4IO0A 2ZSKA 1RPZA 2IL1A 2ISQA 3F4BA 2JEOA 5KKNB 1ZK4A 4MWTA 4KUGA 1G41A 3DYBA 3ZU6A 1P0IA 1PK7A 4LF8B 1GCGA 3L0BA 5E8JA 1H1DA 1Z8NA 3C1OA 3U7GA 1KARA 1SG9A 4HK4A 1X7YA 1E9DA 1TGVA 2A78A 2H1RA 4XLAA 2IZ0A 2MJLA 3I05A 4X93A 1KDZA 4LQLA 3ZY5A 1JTEA 3A4MA 2PD4A 5IBQA 4IWYA 2VYVA 1CERA 1DTWA 1FVXA 1BVRA 1NOKA 2YXEA 3BF7A 3KEFA 4AJKA 1HDGO 4MW1A 2M1XA 4ZCLA 5CDTA 4FIDA 3QHAA 1PR3A 4G2NA 4TTQA 3UT5A 1VKHA 4XCVA 4C07A 1KK0A 4YREA 2DHEA 2Y0BA 3QKRA 4PS0A 1YIJB 4G0WA 3FCCA 4QDTA 4X7DA 1BD4A 4E3ZA 3ZJVA 4M83A 4IIJF 4MI6A 5I7AA 1Q5PA 2C94A 4C7JA 5KO2A 4YMTA 1O9HA 2W4IA 2HCBA 4U1RA 2ZRIA 4ZEOA 1GU7A 4CG3A 3HCBA 2IYZA 3VX4A 3LIPA 1ZJWA 4CKEB 1XHEA 3DNPA 3L01A 5FPKA 3E3LA 1T8PA 4I9NA 1KI3A 3B7GA 1YQ9A 1JQLB 3U4DA 3T41A 3ENZA 3N6XA 9LDTA 2PS3A 3ZVKA 4L5BA 1OZGA 1WNTA 2O57A 3LKZA 2EHDA 2IGBA 4XFDA 4WDRA 3AB3A 1W25A 3PEUA 4HGQA 4IEIA 1X70A 2XLBA 5TF4A 3NAZA 2FVYA 3HEMA 3T99A 2RHCA 2AB0A 2PKYX 3A1NA 3N2KA 3TL3A 3AZQA 1EHYA 1KI7A 3AHFA 1BS2A 1XTUA 3ES9A 1ID1A 3JQ9A 1RYHA 5HA5A 3QKSB 3VKWA 1A8IA 4AKIA 2W42A 2A58A 1L7QA 5HTOA 2ARKA 2YWCA 4PC7A 1OZHA 3F1LA 3MT9A 1R64A 2H1FA 2OK8A 4FGWA 1ODSA 4HQOA 3WGGA 5H8WA 1RFGE 4MGYR 1IOVA 4EG8A 3MHTA 2N9UA 5DTQA 2UYGA 1ZVKA 2ZFUA 4ZQGA 3ABQB 2G9QA 3BZBA 1OI3A 3CRMA 3HDGA 1XD9A 2EEZA 3UAWA 3OT1B 1X80A 4XQ0A 3AHJA 1IBKB 1GTL1 4QVIA 2JAXA 2GPNA 2RSLA 4AX8A 4P2GA 2DHDA 4C14A 5LPNA 3HP4A 1OX5A 4G09A 4GBMA 3GLHE 4OOXA 2PT5A 3DW1X 4QULA 3V8BA 3EAGA 2CXRA 3BWMA 1ECCA 4JVNA 3ESAA 4UNPA 5F64A 4DA9A 3K09C 3DKIA 2XXBA 4RKWA 4BMPB 2X6WA 1EUCB 2X19A 4PXAA 3UAVA 2GO7A 1DIOB 1RWQA 2P6NA 4LJLA 3JWPA 1MO3A 4N40A 3UMSA 4CKBA 2GHQA 2X5KO 2XGMA 4H6PA 4LRSB 2YJGA 2RBKA 2II6A 3CV3A 4UNQA 3TNYA 3CF4G 2NVUA 4NZZA 5DYNA 4GU5A 3LY5A 4G8DA 1U1DA 4H1UA 2EZ4A 2F1KA 3EQZA 2ZI7A 3UXMA 1EWRA 4ENPA 1HYGA 3UMJA 2AMYA 2DHCA 1E3QA 3I1IA 5FR1A 4LNUA 5D86A 1FNNA 1OLXA 1Q3TA 4IQGA 1PWEA 2CDBA 3VOSA 3UBTA 1RR6A 3K1TA 1BS1A 1L2TA 5K20A 4AY3A 3KDPA 1H6BA 3GLIA 5H7XA 2YV3A 5TS3A 4A10A 1GL6A 4CIXA 5MGNA 1JQJC 3CHYA 3DHEA 5CDFA 2Q5QA 2R8PA 1QIIA 3EVFA 5HCIA 3A2KA 3G1TA 3G5MA 2GTHA 2W2TA 2XVYA 1WMSA 4KL8S 4RIEA 4WACA 4YT4A 5BWOA 1CJMA 2AG5A 3OJCA 3PR1A 3VZCA 1NF8A 4LJ7A 5SZHB 2WWIA 1XQ6A 5CJ2A 1GL3A 1AURA 1WAMA 2PVSA 2OV3A 4NX2A 1U4OA 4L50A 4EB0A 3ZCXA 1VPDA 3BMCB 2EP7A 2AG8A 5BT8A 3T51B 1NXOA 2OGUA 4XLFA 5AVXA 4UFOA 4Z3OA 2V4UA 1A8HA 4US1R 2X4LA 5ALFA 3UWDA 5AW6A 3OTIA 3OZVA 4F3KA 2X0NA 3TG2A 3TOSA 1TMGE 3RUPA 2XJ9A 2PGAA 4BLUA 3IR6A 2QXUA 1E60A 1MCZA 2HSWA 2I7TA 2FLWA 3B2QA 3O03A 5BN5B 1VBNA 1TMYA 2GPAA 4KMOA 1WPXA 3R44A 1F1BA 3I9LA 3QOYA 5CAEB 1E6UA 1KH3A 2GXUA 2Y0DA 1UZLA 3BMOA 1GRQA 5KQSA 3MQFA 1QYRA 1XVUA 1RZRD 4H1TA 3ZDZB 3NBUA 3DV2A 1W36C 4J2HA 4WV3A 5IJ0B 3PI7A 5FULA 1C4WA 3WVNA 2XHZA 3LPMA 2DECA 3T8YA 1P3Y1 4PRKA 3N7AA 3G2KA 3HXOA 1XXHA 3DJYA 4H4CA 3O21A 4DABA 4DDKA 4NDNE 2RD2A 1IYZA 3IUSA 2Q2QA 1WB6A 4JKYA 2HDOA 2CN1A 4NYIR 5HZKA 2J6BA 1W4RA 3NJRA 3L7NA 2QZJA 4KQMA 3E15A 2C82A 3OWOA 4WZAA 4TRNA 4CWAA 2CJXA 2FGKA 2PVCA 1OASA 1FJXA 1Z13A 3F9CA 3C16C 1XFOA 3KHTA 3QITA 4F71A 1EUDB 3PDIA 4DSUA 1WHTB 3V1LA 2QTVB 3PEVA 4KGVA 4E6EA 3TPFA 3KKLA 4QYSA 3QEJA 2QQ5A 2DKNA 5G3YA 4CF7A 1Z7GA 1IHOA 3V1NA 4D8VA 4DV0B 1WETA 3PL1A 1JQ5A 3OIDA 4AJ9A 3IFSA 2VP5A 3RTCA 7REQA 4WZTA 1JT2A 4BP9A 3FD8A 5BV1A 1DBIA 5JXJA 4I5EA 3R9KA 3HB4X 3C7AA 3JATA 2P35A 1N33B 5CNMA 3JVDA 3VU8A 2CB9A 2QRQA 5LP6A 3JWJA 4BYGA 1MAVA 3ITKA 4EI8A 3UT0A 5F9FA 2QN2A 3HSKA 4XYEA 4ENTA 3RVRA 4RVDA 1N2EA 1R0XA 2QD4A 5AT1A 1TQHA 3R9XB 5GPBA 2DJIA 5K2OA 1W5EA 3M4XA 4BLOA 1G16A 3YASA 3PA2A 2WDZA 5DYTA 2VBIA 3T94A 1R4MB 5ITZA 3KDSE 3QU4A 2IUSA 2PANA 4IKOA 3DDSA 1G8MA 4A8JC 2HRCA 1HM5A 1U6KA 2PX8A 3N8NA 3A4IA 4YP6A 1QIMA 3TNJA 1OX6A 3RRNA 4F2WA 1OV4A 4BHTA 4OB8A 1BCRB 4W9MC 2W48A 1KDYA 4EFMA 1WL8A 3QLVC 4IH4A 3ISTA 3DH0A 3PUZA 4MGZR 1JA1A 5AUNB 4MWDA 1FTSA 1GEGA 1QXSA 5FEMA 4BLTA 1OFVA 5CNIA 4NEQA 2AQIA 2V65A 2ZAOA 5AKYA 2OA0A 4NNJA 1YHNA 3HWX1 4HAIA 5DX0A 3T52A 3WLPA 4YJ2B 4NAHA 4UUNA 2RKWA 2X15A 1IH8A 4OP2A 1IXYA 3DE1X 1AKRA 3RARA 2J0VA 2CLHB 1OLSB 1F6BA 2PLRA 2BR4A 1POWA 2O5RA 3H9JA 5ALMA 5EY5B 4X61A 3PUIA 2R6HA 1Y3FE 1RPTA 2BJHA 1Z0DA 3R7FA 6LDHA 5HIAA 3GLUA 1SXJD 4QJIA 5EMMA 2CDAA 2ZB4A 1OKKA 1Q0QA 2F90A 4BBJA 1EYZA 3QVKA 3C1TA 2VJDA 4O4IA 3W7BA 5CA0F 2MSLA 3EZFA 5EE1A 4AZ3B 4X00A 1PFUA 4FEEA 4RF2A 4ZT6A 4INAA 2H8GA 3ASSA 3B5JA 2B69A 4MUAA 1XWIA 2PUGA 2UYHA 1Y3BE 2JFGA 4I55B 3TRHA 2FW0A 1RAAA 5IK2A 1P2SA 5E4JA 2GQ0A 2FDRA 2G5GX 1I3MA 4YDSA 4EO4A 5EERA 1XVTA 2IEIA 3D3WB 4UULA 1RT9A 2O8BA 1L6IA 3O31A 1L5NA 4CMAA 3P20A 5I8PA 3S55A 2AI1A 2ANBA 4QOHA 1MJ5A 5BN4B 4XXHA 3TVTA 3U7IA 3LHFA 3NP7A 3L7DA 1Y8AA 5D00A 2WTXA 5BNZA 1VJTA 2G71A 5EWLA 4EKDA 5HRUA 3HA3A 2FFAA 3UUFA 4LTNA 1XROA 4QELA 4KLAA 3SEZA 1ND6A 1U6IA 1XK7A 2ECOA 4LJAA 3A9UA 4UVEA 2C9ZA 4H16A 5F7ZA 5HF5A 5I9BA 5IDXA 3B9RA 1K3UB 3IMEA 4G1FA 2ZXFA 3H5RA 4QBIA 4J0EA 1ZNQO 5EHIA 1LPAB 4G24A 2JGNA 1BJKA 1DVRA 5TE9A 4D41A 5AOCA 9GPBA 1PKXA 3SM3A 5E1DA 4UATA 1C2YA 1OWNA 2I7DA 4LJ8A 3MBIA 1DQSA 5ALDA 4C2AA 2VAPA 2FN7A 2OVBA 3Q3HA 4DB4A 8ATCA 3GJQA 3TF5A 1SCUB 4XRRA 5EGNA 5FTNA 1UC8A 4AZTA 3QG1A 3INGA 4QO8A 4DA8A 2V6BA 3IURA 2P6MA 3PHLA 3Q15C 4N0DA 4ZDIA 3JAKA 4KXWA 3VNSA 4E5MA 4IIUA 3SX4A 2BEKA 4J76A 1N0UA 4CN8A 3PHJA 2Q0QA 1Y8ZA 4FDMA 4Z0TA 5F3DA 3RY8A 2AVNA 1NFQA 2F3QA 4N7RA 3VU0A 2J9GA 5C1DA 1JLLA 3IBYA 5JVDF 3N0VA 1PWXA 1Z07A 4QU0A 4WLEA 5IRCD 4XM1A 4KKXB 3PFIA 1INLA 3NRJA 1YJNB 3B3GA 4XIYA 3T3HA 1XKQA 4HP8A 4DCOA 1M2VA 1WJGA 4AIRA 5BSWA 5CFPA 3DT8A 2YXBA 4WBNB 2FCRA 1QOZA 3GYBA 4E51A 4KXFB 4Y18A 3RVMA 4DYHA 2I5PO 2FEMA 4JYPA 2FFJA 1M34E 3KPYA 4TV8B 3EDCA 1GARA 4L3VA 4LVCA 1CNMA 1PWHA 3KEQA 4KWIA 4XVUA 3WL8A 4YMGA 1E4YA 2AZXA 3ORHA 4CM4B 4CMIA 5FO1A 4HTFA 2OCXA 4GZ3A 4HMPA 3DBOB 2WYIA 2ZI4A 3GLRA 3L02A 1VLQA 4R05A 1ZKMA 1OGYA 1XIVA 4MVYA 1A8PA 1IM8A 1JHMA 3A0UA 5KYWB 1I1OA 3E58A 3KVYA 4I1RA 2H9IA 3IJRA 4GUDA 3UJ9A 3WYDA 4G0PA 4RK0A 2FPSA 3N6RA 3UO8B 4ZJPA 3R6DA 1ECGA 1GNPA 3TECE 1M2JA 2VT2A 3LTEA 3NIDB 4R8KA 3R4CA 1N3YA 1PS0A 3H8VA 3O2NA 2PRKA 3LQQA 2YHIB 1S3GA 3U9SA 3P4YA 5EHNA 1XLUA 2C4KA 4E2XA 4PXYA 3PNLA 1J9GA 3IEIA 3RKSA 4ER7A 1A2QA 2PMDA 1C7QA 3MAGA 2HLDD 2YW9A 5AJZA 3KV1A 1JJBA 2CBZA 4P5EA 2H7YA 3BBLA 4WKPA 2W58A 4CTOA 2MU1A 3KSZO 2FFBA 4BVLA 5KSZA 1XTTA 2R68A 1EUYA 3L9XA 4M99A 2FKAA 1IXZA 4DQKA 1CIVA 2CYCA 2PSJA 1ORRA 1NDQA 1Q22A 2R62A 2XUPA 3NOQA 4FFNA 5CGZA 4BN4A 1OHHA 4KQ1A 3R7DA 2O8EB 2EFGA 4WKGA 2QDKA 5EFOA 5C34B 1YR6A 2D2EA 1BJTA 2OTJB 2PMEA 2ODWA 3KM0A 1ZC3A 2NO5A 3TX2A 1EHCA 5DEIA 5EJ5A 3KG2A 4PBTA 3NONA 4LWPA 1H23A 5ALWA 4WA7A 5JVDA 2C0QA 4C0KA 4DUGA 4RCYA 1WQ4A 4WDQA 2NXWA 4S3MA 1H0KA 4PWZA 3W1EA 4ZYVA 2J5XA 3ASUA 3PI6A 4JB2A 1ADBA 2BCJQ 4TS9A 1L5ZA 3ESCA 4FVTA 4Q19A 3W2HA 3AXSA 3OEWA 3AM3A 2DUJA 5DN6A 3Q8LA 1BXRA 4RFVA 4YIHA 3EPJA 5DTMA 1PVVA 4MRRA 1NNI1 1Y63A 3U37A 1UDWA 2WG0A 4RHEA 3HXLA 4OOVA 5JPIA 1XVIA 3W8NA 4R8LA 1UD2A 2ETVA 4RSRA 3HGMA 2FUCA 1AQNA 1Y7HA 4TLCA 4GKBA 4LDQA 1D0SA 3R75A 3X1WA 1S3IA 4FDLA 4KBYA 1Z6YA 2AFHB 1QGUB 2XSZD 4XKJA 4DJ5X 5IBPA 2NZXA 2VKQA 1PZGA 5H3CA 2A9OA 1QFSA 4IPTA 4YIKA 5E4TA 5FBKA 1QJCA 4HAZA 5B7GA 4CJXA 2PUBA 2MR5A 5KTOA 3NGXA 4HVTA 1P5FA 3S8YA 1CJBA 2W2LA 2VF2A 3I4CA 3TPZA 3HPRA 2BFFB 1ZRHA 1ZL2A 3CS3A 3EPPA 4OUDA 4QHYA 2Y1XA 3TD6A 1UBGA 2AJDA 1UJ6A 2EBHX 4KO3S 2EZUA 2P1RA 3TXYA 3T7SA 2V7UA 3TAHA 1J24A 2VTEA 4UHFA 4BKMA 4EHNA 1FNCA 1Y1QA 2W6ID 3LP8A 4F3CA 3KETA 4Q9JA 4P4LA 2E5FA 1KOLA 2AX3A 3TIXB 2QJRA 2RGXA 3AONB 2FEOA 4I9UA 4V0LA 2PS9A 3RODA 1VHJA 2QTMA 2H16A 5C51B 1FNSA 2FOIA 4QFBA 1J90A 3TR0A 5DNDA 1R1DA 1O95A 4D3SA 3TH5A 4XLTA 3RFCA 1UXGA 3CD6B 4BQIA 4ZI7B 4HEA1 5A9SB 5DWVA 3P5BA 4DEXA 1SBQA 3QYFA 3H5LA 4PCLA 5IN4A 4CW7A 4BNLA 1VMEA 1I4EB 1FFGA 4H0CA 3M6IA 5EKXA 4DMRA 1LBIA 3L2OB 4OKNA 2W93A 4RETA 4CIDA 3ZZ0A 4Z53A 2ZE7A 1V26A 4X7PA 3QU7A 1T2CA 5DYGA 2ZYAA 2AI2A 3STTA 2AA3A 3TBFA 1WB4A 2F4VB 2PZFA 4PO8A 1YDMA 1E4EB 3ACCA 3RVLA 3FYDA 4FMCF 4UAVA 1T5HX 3CPXA 1KYTA 3PPXA 5AKGA 3GHYA 5LA6F 1CRPA 3CNQS 5AK3A 3WX0A 2CY0A 1PFGA 1RJFA 1FL9A 2IC5A 3IOCA 1NN3A 4LFCB 3WIUA 3EZLA 1Z17A 2WV9A 4LXYA 3PLRA 1E3DA 3D7RA 1R8SA 3C4QA 1YZTA 2HY7A 4C3ZA 2QORA 2X1LA 1XZGA 5LOVF 2GVZC 3HJRA 2ZYWX 2IYTA 2VDWB 1SU6A 3G2MA 4JVMA 3CCBA 2E1BA 2C8VA 2LW7A 2H4JA 1WUHS 4Q12A 1JQ3A 2HQBA 4B5LA 2A9FA 2JAUA 3KT0A 3PQ6A 1HYHA 1EFVA 3DWGA 1V1MB 3MCVA 1Z4NA 3AEQB 3DM9B 4S35A 5AI8A 3NHRA 3REQB 4J9UE 2OXFA 1NXVA 2G08A 4ZWNA 1ES9A 2JLSA 1G8FA 3MWDB 5I47A 4MYUA 4BFXA 2B9VA 1NVBA 2Q3MA 3SLNA 1NF2A 3W8FA 5KTYA 4W63A 3S7TA 1IHYA 1DC5A 3I9MA 1CY7A 4D8YA 5I8ZA 5E9JA 4YLEA 3EOAI 2JJ2D 4L73A 2KX7A 4PNEA 2CCJA 1DTSA 1SBTA 4ZPXA 4NCIA 1CFJA 4LDNA 1RLUA 4YUZA 1VE9A 2QN8A 5SYMA 3BGOS 2ONZA 1J2YA 4GQNA 1O9BA 2IYFA 2QRJA 4YMHA 1UBCA 2Q4OA 2O50A 4C08A 3ISVA 4DM7A 1PEKE 1V9SA 2P2LA 4DC9A 3H04A 4CM7A 2GXSA 2BN4A 3AR5A 3A26A 1H1LA 2C92A 4RFSA 1PQYA 1OXTA 1TYDE 2DHQA 2OCGA 2XE4A 1F8XA 1Y1RA 3GLTA 4B7XA 1M6EX 4QUEA 3SBDA 4FJ0A 3GNQA 4NMXB 1LFDB 2DCUA 2WZNA 4V0SA 3IMCA 4PYKA 4HH4A 5P8WA 3PITA 4C7BA 5JAHA 2X6RA 1R4NB 1Z3CA 3ABIA 2FB9A 1AS3A 2FZVA 1LPBB 2GCOA 1XN1A 1ESNA 3DVLA 2OOSA 4MV5A 4YQYA 3RGGA 5KVAA 4URZR 1E59A 2TMYA 5GGYA 1MTZA 3EGXB 4B3MB 1NN5A 5I9IA 4BNHA 4LTDA 2X5NA 4EB8A 2QS9A 5TARA 4C0JA 2PUVA 5FJJA 1W4LA 1K73D 1JF8A 1EQUA 2ZRDA 4G4GA 5AHKA 5AR1A 2A5JA 4DCVA 4BV8A 4D9EA 1NX6A 3TQTA 2IU3A 3B9QA 3RRMA 4LGYA 3ZS9A 3PIIA 3ABRB 3VO2A 5D2CA 2REOA 4XORA 5HBRA 2DUMA 2NUTB 5FV4A 2L82A 3IRVA 1ZNZA 1MAUA 4D6YA 3GJ5A 3AETB 3T0FA 2X42A 3T35A 4AKGA 4DV4B 1HO3A 1WDTA 3QLUC 5IN5A 1IVNA 1L4BA 1NJ8A 1R8YA 4BV9A 4G0UA 2ZJ5A 2FSPA 4RQBA 1SQ6A 4YO8A 1Z5OA 3L7MA 4RC9A 4ZK2A 2OWDA 1NBMD 1TQ2A 1Z35A 2WU0A 5EP2A 2YNMC 5GJWC 2HF8A 4HDMB 1DAHA 2KI5A 3RFFA 3I72A 4LIPD 4L4RA 5EVCA 1E1CA 5F73A 4F3YA 4F11A 3KQQA 3GEMA 5JOQA 2WVHA 1K6IA 1XRMA 4X62B 1FUEA 2OQ2A 3Q7PA 2ZBPA 4Y3UA 3ZYCA 3UHAA 2QE6A 2BEUB 4EPXA 4ZJYA 1TCCA 2QAGC 4F2HA 2Y66A 1I80A 1QP0A 3BFPA 1NW7A 4TL8A 4N82A 4J94A 1PFVA 1FRVA 1DQZA 3PKIA 2WJZB 3R6JA 1KEEB 3M5PA 4D4GA 4JCOA 2QT9A 1QVWA 3MQ4A 4BUCA 3DVSX 2C4NA 2H3HA 4II7A 4JI3B 3RVBA 4C4YA 2UUBB 4GBED 4WZKA 4ENRA 1IXSB 1GIAA 1OFTA 2NZJA 1YTLA 2OBFA 2YVAA 4HGPA 4TRJA 1P6QA 4FGSA 1V25A 3FCUB 2AE2A 1GPH1 1B43A 3LS2A 3VA7A 3AYZB 3WB2A 2IY8A 3SEFA 4XDHA 1V71A 3L7KA 1RYBA 2JD2A 4JLPA 1X92A 1N2JA 2PAFA 4OAPA 4PEVA 3H7AA 5L3RA 1SBYA 3IODA 4DQXA 5KTKA 3NXSA 3EH2A 1K8AD 2IEGA 3HJCA 5ALZA 2J3KA 2ATIA 4PVDA 1NX9A 4FPXA 5FHRA 5JCOC 3EZGA 4Q01A 2WIFA 5CTAA 4I8XA 3RS0A 2DQYA 3CGWA 3IP5A 5TQ0B 2QPLA 1RPJA 2ZZQA 4JR2A 4N8DA 2Z2KA 3WQBA 1UBMS 5EIBC 1NB9A 3QJYA 4UBMA 5JS6A 4EY6A 5LMCA 1D7OA 5JH7A 1H5NA 3GDWA 3JD2A 5BNIA 4RTKA 1NRKA 4RFLA 4PR3A 2I71A 3EE6A 3DLTA 3HWSA 4B6RA 3PYMA 4G1UC 5DI3B 1JSCA 2H06A 5JSKA 2GD0A 2NVOA 5ARDA 4KWCA 5AVZA 2JB9A 2WB4A 3B48A 3X1XA 1EDZA 1LTKA 1PT5A 2VP4A 1NPTO 3D0QA 2YYSA 1XVVA 3KU1A 1C4KA 4DXHA 3HZRA 1WXDA 2CSXA 2H9AA 5EJAA 3L40A 1DHRA 4KQFA 1TMOA 3B2NA 1LLFA 4YAOA 1NBHA 3I53A 2VPQA 1J9EA 5H9WA 2BCEA 4CV0A 3QPBA 3QVWA 2R00C 3DMPA 2DIEA 3NEYA 4I4TA 1GHTA 1V9LA 3W5JA 1E3SA 1T5OA 2Z5VA 2ZDGA 4RSGA 3MN1A 4UKDA 4YUWA 5A1TA 2VDKB 5F3WB 4UDXX 3N8IA 4G36A 1QTRA 4BGIA 2FG5A 4HAOA 4P5DA 4DA7A 3NC0C 3U4QA 1AKUA 1I6MA 1YCHA 2IYUA 1A5SB 2PZ8A 2QTNA 3WLFA 5L7WA 1NSTA 3QXJA 4X8IA 1QIJA 1F2TB 5CDHA 3FSEA 1IPHA 1G1AA 2XVAA 4INPA 2B99A 3SNKA 2WU1A 1U1CA 4L3OA 1GZVA 2QLLA 2QT1A 4AJEA 2F59A 1LXCA 1YS1X 2JI4A 2IIPA 1O7JA 2GBPA 3AFOA 3CUYA 1TM2A 3J80A 2EKLA 3OKFA 2MCFA 1Z83A 1N57A 4Q1DA 1RCTE 1F20A 3H1EA 1T25A 4MI3A 1B7GO 4B6GA 3PWTA 4Z4VA 3I9NA 4F86A 4L57A 5FLYA 3ANSA 1J2JA 1O3YA 2PKEA 1D6NA 1E7QA 1G9SA 4BN0A 2GF9A 4PSKA 3DCYA 1F5NA 1W88B 4TTPA 3S29A 3FNGA 4O8ZA 2BFNA 1JFTA 2YICA 3Q2KA 1Y3CE 4LZOA 1E3JA 2IXDA 3U7HB 1F9AA 1N3IA 2J4DA 1M5UA 1PZFA 1SQSA 1ZQ9A 2WKPA 1DWPA 1SUEA 2ZRJA 3KVRA 4HLCA 1YBMA 1XZAA 5DXFA 1NLZA 2HT1A 1M2EA 2JAOA 4JBWA 4NDZA 3N2ZB 5FNVF 4B8WA 4C89A 2ACVA 1CYDA 2GK4A 3H9QA 4NV0A 2PLNA 1MW8X 4QWMA 5D51S 2A94A 2VHCA 4FIZA 3CX8A 3PWSA 1UD8A 4XTCS 2A9VA 3Q7IA 5KYYB 2HXSA 3IULA 1LX6A 2PXXA 3QX3A 5H3LA 3NATA 1FDVA 4WFKA 1K4MA 5DU2A 3WGQA 2E6KA 1FRNA 1D2CA 3C3AA 4N54A 3O8OA 3TS1A 3GFPA 4UVDA 1T4CA 3KD2A 4E7PA 1XQVA 1NP7A 3BJZA 5GY7A 4DILA 4ZGQB 2HBRA 2IV7A 1JR3A 5BMVA 5I3CA 3JQGB 3ZR4B 1Y8RA 2FZEA 2BTQB 2IYEA 4J1QA 1VIVA 4M55A 4U6SA 3ZTWA 3ZDQA 2GREA 5CW2A 1HOXA 2V74B 5LYYA 3UCXA 5LKRA 1U1GA 3T3IA 2VYCA 3V4ZA 2PU5A 4IIYA 3PKJA 3RVDA 4CKZA 1NB0A 2JIRA 3E9ZA 1GZ3A 4C06A 2HSEA 1IUOA 1U9CA 2WKRA 3GVIA 5LIPA 3HR7A 2F1LA 2COUA 2BD0A 3SHVA 2H59A 2LR0A 4NESA 2GXAA 1RRFA 3WJ1A 3ZCUA 2TRSB 1XKXA 2XAAA 1NW3A 2PFSA 2JIZA 3ED1A 2B34A 2ADFA 4YK7A 1VQMB 1U65A 2P9GA 2V7BA 3ASZA 3UK1A 3ZWMA 4TTRA 3FWHA 2MYUA 2BM0A 2ZZKA 4NABA 1EGAA 4DANA 1WABA 3B78A 3OPYI 4ESVA 3HXTA 1Z4LA 3HO6A 5E3JA 1F8GA 1UC5B 4C30A 1JQAA 3GN2A 2DETA 4V0MA 2ZUFA 3Q9UA 2VATA 5ENZA 2ZS8A 3LUKA 4IDGA 4LNAA 1X7DA 2HSGA 2Z43A 4MAMA 2WJAA 4BQSA 2HMAA 1QDEA 5I9NA 2PTHA 1OD6A 4G3XA 2NUTA 2VK8A 2I8CA 1I4LD 1Q3HA 2PUHA 1BEZA 3H5OA 4TV9F 3X1MA 4DZTA 10MHA 4X8MA 1R4ZA 4YR7A 4QJ5A 2OILA 1A4XA 1TUBA 4TUYB 1YQEA 4ZALA 1I2ZA 3VH1A 4KQCA 5BP7A 1U28C 4I4IA 4ZRMA 2FWJA 2X1HA 4Y9TA 2F1OA 4R2HA 5EKSA 1CD5A 3GUYA 2ZUTA 1EFAA 1OC4A 5TQ2A 3RAFC 1F0PA 3CR7A 5L3ZA 4UHDA 1L4UA 4D9MA 1M2WA 1N5OX 1X7ZA 1OXSC 1CBUA 2BGUA 2PX3A 2ZRPA 3KKNA 3NTUA 4PW0A 3MZ0A 4RAQA 2PSSA 3C7CB 1C30A 2CC2A 3L7LA 2J9FB 2XBUA 4JBGA 4PNPA 4YRLA 5F2NA 3IESA 1Z47A 2DPXA 3TLBA 1XJ0A 1A82A 1QGED 2CHQA 4C0AC 1OAOC 2BY4A 2OFXA 1ULZA 4UD6A 3VPGA 1QQTA 3CXUA 3W5UA 1YUMA 3UTDA 5CFMA 4GBJA 1EEHA 2FEPA 5DM70 3N5KA 4YH1A 2ZIEA 4DR5B 4GX0A 4OEHA 5CVEA 2Q3BA 1DCMA 4I9HA 3IEPA 1RC0A 2HHJA 3G1UA 5DNWA 3HDQA 2YASA 1NZFA 3NNSA 1HOTA 1X8JA 5T4FA 2AT1A 3GEDA 2H3EA 3N9IA 4BC1A 1MU0A 2C31A 4X41A 1C0PA 2CNLA 1ZINA 3IEUA 1GGJA 4H7HA 3DDOA 4GPEA 2B61A 1V16A 3GHHA 4LHEA 5T4HA 3J81A 4YGYA 4NOLA 4EHDA 5JJBA 7MDHA 2FWPA 2VVTA 4L51A 4NE9A 2O8DB 1GUAA 4TN1A 1YB5A 3WQSB 1UZNA 1BW9B 5CR9A 2NYRA 4O4HB 1XWFA 3S40A 4L2IB 4BRWA 1KERA 5CCBA 1NG9A 1X7GA 3PICA 3SXPA 1OXVA 4AFNA 3R3ZA 4QUDA 1TAQA 1LSUA 2HA3A 2OXRA 4QZVA 4AYTA 5IDWA 2P5SA 5M5BA 1GSOA 1ML4A 2AMVA 3FKQA 3SC3A 4AN1A 5LQJA 1H93A 3JQ6A 5JJKA 1PZNA 2PXHA 3OCZA 3OZDA 3KUKA 4X3PA 2W2MA 3ZVLA 1JVNA 1UQTA 3LDAA 1GPWB 1J23A 2EW8A 5CX4A 1V5IA 1LSJA 3K6JA 1JL3A 2YN0A 3AG5A 4IGEA 5IZ4A 1DOAA 1R9MA 1J7JA 1R5JA 2Q5HA 3DFIA 5IX8A 1J2TA 1U4SA 4K6GA 1K63A 1IFXA 5IAKA 4DOMA 1JIIA 4HRVA 4FOTA 3I37X 1I7SB 1MC1A 2ZSFA 4RD4A 2P1DA 4C7MA 4E5VA 4EGFA 3HYRA 3G8DA 3NKLA 4GM0A 5B64A 1QONA 3GCDA 3O1LA 4NKRA 4XRGA 4D99A 1TW3A 1X7YB 4TLAA 3KOXA 3TZCA 2YOGA 2QRNA 5HIKA 3LUAA 4K6KA 2DSNA 1J70A 1TZ2A 1UADA 1JJ2B 5F35A 3T5CA 1TTPB 2PZBA 5LBUA 1XMVA 1DTWB 3G82C 5CT9A 1XYVA 4RL6A 3G2OA 1RAFA 2Q5IA 1H05A 2EGHA 3DP7A 3GRVA 4RTOA 4KOEC 2PYDA 2NU9A 3QKRB 1QRTA 1C9JA 5JNTA 1VQ4B 4IZ6A 2ZRLA 5B1SA 3HN6A 4O8CA 4KXYA 4UOZA 2YFKA 2FI1A 3BL5A 2H2AA 3BG5A 3R8CA 1T9ZA 2VCHA 4J16C 4OQLA 1YACA 2REQB 1SHJA 3DTVB 4G97A 1E9RA 2XXAA 4ID9A 1MG5A 4BP3A 4EX6A 3B1KA 1V5GA 4F1WA 1USWA 1VE3A 3INNA 3WR5A 4MTCA 3PPVA 1Q6YA 4JB8A 4NU0A 3SEAA 1RXCA 2AJTA 3DV9A 4J1NA 1D1SA 4MINA 1IRXA 1G21A 1X6VA 3KYIB 3PNOA 2BGNA 3UHFA 1JA0A 2Z8YM 1O0BA 1JKIA 4XM0A 2FU5C 3AERA 3E1KA 2FPPA 1O8CA 5E9AA 3T5GA 1YVPA 4MUGA 4W82A 5DW0A 3O94A 4Q1BA 5F76A 3N2KB 5FPTA 4BKRA 1OZAA 5C8DA 4RTMA 2G6BA 2JBHA 4WZEA 3AR8A 4FEAA 4XWWA 1KI1A 3W5VA 4TMXA 2Q41A 2ZEJA 2B92A 4FC6A 3TD2A 3HJFA 3AQIA 3CURA 1JB9A 3A9VA 2QYOA 3P2EA 4MIKA 1ZAKA 3HVIA 4MI9A 4POAA 4ZQIA 2YV4A 1GDDA 2B3DA 3FBTA 3SC4A 4KWHA 2QQEA 3TJMA 4K6HA 1J5XA 2Z1DA 3CR8A 3Q6IA 2JGFA 3WRYC 4PINA 2QT0A 4HT3B 3II6X 1P61B 3LLSA 1JILA 4K2HA 1Z38A 2YWGA 1GPNA 1V48A 1X80B 2WM9B 5JLJA 2ZP1A 1U0HC 3DEZA 3EZXA 3JASB 3LYUA 2DE0X 1G42A 3RU3A 2NU7B 4X71A 1QTIA 1Z4OA 1IXKA 2W8BA 4J8PA 1N78A 4YAEA 1HPLA 1OROA 3AUFA 3ANLA 1RPNA 2B2XA 2BFEA 1D07A 2XMRA 1ZOIA 4OI0A 3CE9A 1MX9A 1QS0A 4EZBA 1ZSNA 3BAFA 3CTPA 4EO9A 2GK6A 1XV5A 1DEHA 5KTNA 2JKVA 1DRKA 1HFKA 3VAAA 4HC4A 4PYQA 5LR6A 3IPCA 2G9VA 4CKBB 1CF2O 3UAXA 1RVDA 1DJQA 4QYWA 1Q57A 2NV4A 3PA1A 1ZK2A 2BOVA 5IJWA 3QFRA 2HPVA 2JGKA 1BROA 3CRNA 1FLAA 4DG5A 4EA8A 4C2UA 3JVIA 4XWAA 1RWVA 1R27A 2C96A 2VJAA 4UEKA 4YI3A 4JP1A 1QJ4A 2VNIA 1I7NA 1HL7A 4DPLA 1E79A 1J8VA 3OWHA 3WGHA 5FYDA 1CT9A 1DBSA 2CMFA 4X6UA 5IYZB 2C7QA 1FP1D 1PNOA 4LNUB 1E94E 1OLXB 2HRDA 3E9MA 3JQDA 3LSYA 4WK4B 2OFWA 3RAGA 4WY8A 1BKYA 1EWTA 2DAPA 3DOFA 4MJXA 4V02A 4BB0A 3U5TA 1XJWA 3R41A 2P0AA 1JU3A 5C18A 5EWMA 2YINC 1U5CA 3BFKA 1TA4A 4BKOA 3O8CA 3F8WA 3G5TA 3ZWOA 4CF6A 4RLSA 1K06A 1AMNA 1QCCA 2PGIA 4BMCA 1F17A 4IUDS 1CZOA 1PAUA 1O94C 2YZGA 4ZVMA 3FYTA 2J0UA 1QOPB 2J5KA 2BV3A 2C8LA 3NRCA 3CQ9A 3CLSC 3PE6A 1ESCA 4XN3A 1N2XA 5KMGB 4EAQA 4G5FA 4GLBA 3KZCA 1G5HA 3A14A 2G5CA 3C6XA 3KLMX 5AH0A 4GL2A 3BHNA 5B37A 4X5OA 5I6DA 3I04M 1QVFB 1RKXA 2YVQA 1SWWA 2OCKA 3BB3A 1J25A 1J39A 2WIBA 5LYJA 4NZYA 1CC1S 1CEYA 1BCSB 4W1PA 1IZ9A 3VVBA 2ZXUA 2BM1A 2SBTA 1BMFA 1L8OA 2H17A 1AF7A 2JCYA 4BU0A 4ZT4A 5DGCA 2EZ9A 2ZVJA 1QVAA 1Z34A 4ND8A 3L04A 4X84A 3WHPA 4AG5A 2NTEA 4NLLA 4UM9B 3HA2A 1W2BB 5IZCA 5FOQA 3BMOB 1H8HD 1ZS9A 5KX5A 4Y6GB 1Y7PA 4O2BB 3H18A 4DCPA 3HEBA 2PNFA 3V80A 2EL7A 4QGAA 3A9CA 3EJWA 1JXQA 5EJMA 1K86A 1N2CE 4GKVA 3H2IA 1XXHB 1TU3A 3ILSA 5IWAB 2QJOA 3GUHA 4Y2RA 3V55A 3WHKA 3BYZA 1EFHA 5GWXA 5D7NA 3EY4A 2G70A 5TPWA 2Q3CA 2YCLA 1MRNA 1GUZA 4C7OA 4WZAB 3U61B 3FWKA 3A9TA 3QPAA 3AEKA 3C15C 2EBUA 1GD1O 2W22A 1C0EA 1EE1A 2GFIA 5JYEA 2WP8J 2I1WA 1D0IA 3PDIB 3QI2A 4FYHA 4AURA 1XQYA 2FEKA 3SZMA 3VPDA 1QHNA 4YJHA 2IPNA 1B6GA 2IGTA 3I42A 4X1YB 4BO7A 1VFNA 2QY6A 1OZFA 1NT2A 2EYQA 4DPMA 3VJRA 2PH1A 2HV9A 3OTHA 4J0CA 5D87A 3LCUA 5B1DA 2OQVA 2WI8A 3G17A 4M8SA 7REQB 4F93B 1MB2A 2O2DA 5BSMA 4HXYA 4EGSA 2X7HA 4WLUA 1I7LA 1U8YA 4H4DA 3D4IA 5LP6B 1RIFA 1FPQA 2AN4A 2SNIE 4D8XA 5ALIA 1DDGA 1YZ3A 3W78A 4LF5B 2FAXA 3IKVA 4U3JA 5G0VA 1P9NA 2BDEA 5JATA 1DQNA 2NNWB 3U3OA 4HQRA 1H6CA 4KHZA 2JFBA 1LZLA 4CDRA 2YHSA 2GCIA 3FZEA 3IHTA 2X6QA 5ITZB 2ZIAA 1J09A 2JLWA 3BE6A 3R0JA 3CPEA 3A2LA 2BM8A 5AHWA 4B6PA 2P9FA 5J3OA 2WTUA 3KL9A 4BZWA 1TKBA 2SKCA 5TT1A 1MUUA 1OA1A 3VISA 4P9SA 1T8TA 2DKFA 1AB6A 4TYPA 5A62A 2ST1A 1WZ2A 2QTCA 2YWRA 5AKLA 1T0IA 3USES 4D80A 1WB9A 5KI6A 5CG2A 1JUDA 4ZARA 4BCBA 2ZW9A 3B7WA 3HV0A 1KJYA 3CZCA 2ECPA 3U4IA 4EIWA 3OSUA 1UQRA 4KLNA 3PVDA 4H7IA 5DJ5A 4NAUA 4ETIA 1R3UA 2VF7A 4TMTA 4P3YA 1W35A 2EX0A 1ZFNA 2H08A 3RBXA 1VHDA 4PZDA 2CVFA 4H7EA 3COSA 4ZOBA 3V3KA 4BAGA 3LHIA 4RDLA 1M1XB 1N5KA 2COKA 4QASA 4TZTA 4B9EA 2JA1A 5FWXA 2PKRA 2XA2A 4UMVA 1LRKA 1SHLA 3FTCA 1H65A 5K2MA 1ABEA 1KXJA 4K86A 2GM3A 5AOAA 3T3OA 3FB4A 3H5IA 3DUWA 3HA7A 3K6KA 5DLYA 1SZCA 3SAJA 4I1IA 1ONSA 3WYCA 4C7XA 4HVCA 1XZIA 4MUYA 4E4TA 1L7RA 4CQLA 4EY8A 1VHEA 1YNOA 1RMTA 3GLVA 3A2MA 4Z8YA 3WLTA 4M0KA 1SU8A 2NZYA 3DDUA 3INTA 3G85A 3NHSA 5IKMA 1ZM9A 1J1ZA 1FRQA 2OAEA 4Y1RA 4KN6A 3V7UA 1Q0TA 2O8BB 4JBXA 5MHTA 4MGIR 1XFAA 5ALHA 2ILVA 2P62A 1RW4A 2AX4A 2XUDA 5EP1A 3EBPA 4YAGA 2QTHA 4I50F 4YDQA 1BAPA 4XTRA 4L8FA 2Q6IA 3IV9A 3NMUF 5KOIA 1NMEA 3CBGA 1WCV1 4M9XA 3P94A 5I4KA 2W2OA 3SYKA 4Q82A 3LC7O 4PRYA 4B40A 4OH1A 2HEIA 4XWOA 4BLQA 1RI2A 2A84A 3TZLA 4TRMA 2PFKA 2D2XA 5M3BA 2VQSA 1K9MD 4NPHA 2B21A 4Q9AA 5FFFA 4F45A 1ZL0A 3NORA 5I8WA 1U94A 1F7VA 1YZLA 2ZRHA 1N2BA 4Z4QA 1NNSA 1H2ZA 5HJ5A 4INOA 4CU5A 1B2LA 2QPOA 1OBFO 4MHOA 2C4MA 1JTVA 4BQQA 4M0CA 2XDWA 4ZHQA 3JAKB 5JJIA 2FZLA 2BI7A 5CU7A 4BLPA 2YJ6A 3CUSA 2XMCA 4DXAA 2Y67A 4NWIA 2C03A 3KPUA 4FDAA 4AY4A 1ODCA 3NDBB 2BKXA 4Z9BA 2IT1A 1B3RA 4E22A 4PS1A 2X8BA 2H6EA 3M6FA 1ESDA 2R65A 3M9WA 4H3SA 2HZ7A 2V7PA 3I73A 4MQBA 1FDOA 5EIFA 1TM5E 3RLFA 1M2VB 3DXYA 3D8HA 4MV3A 1X1BA 1IULA 2IY9A 2QHXA 4R2LA 1YV9A 4WK6A 4JMPA 1RHKA 4NCXA 3AHHA 4G5HA 5L40A 3CWCA 4KO2S 3CLKA 4WHMA 1PCXA 1XU9A 4HDRA 3RUIA 4M37A 4GMKA 4HFMA 2ADMA 1MB3A 3U60B 2DT5A 1O96A 2X40A 1MEEA 1KEPA 4CMIB 2X4IA 3JQ8A 4KR0A 5I7EA 4K9KA 1C0IA 3GJ4A 4ARBA 3HXPA 4H6VA 2GRUA 1UP7A 4RY9A 1E63A 3C39A 1HGXA 1DJPA 4HBZA 1NJFA 5DISB 2BFOA 4AN0A 3OOWA