1T6XA

Crystal structure of adp bound tm379
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
287
structure length
266
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
total genus 69
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6xA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6xA01
5LLTA 2IP1A 2CYCA 1EXDA 4Q93A 4UZEA 1PFYA 2GOYA 3NBKA 4J75A 3CR8A 1O0CA 1EUQA 1YI8A 2A1TR 4RUKA 4MW5A 2VBTA 5FNZA 1K92A 1OWOA 3M5WA 2GM3A 2TS1A 4ZT4A 2J08A 1JEDA 1M1ZA 1YULA 2YXNA 4YP6A 3ISJA 1PG0A 1KP3A 3E27A 4MUHA 4ND6A 2D54A 1IQUA 3X1JA 1O0BA 5A88A 1U7DA 4MLPA 1R6TA 1NB0A 1KQNA 1N2IA 3FETA 4GU5A 2WB2A 2J07A 4QBTA 4JFAA 1OBHA 3IDFA 1ILEA 1R6XA 3VU8A 1TQ8A 1WXIA 1M8FA 1NYLA 2DXIA 3Q12A 1WKBA 4MVYA 1I6MA 1V8FA 2V0CA 3G5AA 1K4MA 4QREA 4NATA 1XNGA 4U8HA 2IELA 4CDNA 2DLCX 4I6JA 3AL0C 1OWMA 3RFFA 2OV4A 3GUZA 1QRSA 1VLHA 1WJGA 4MW0A 2WSIA 1NUQA 1P4MA 4G5FA 1O94C 3N8HA 4NAHA 3MLAA 4JXZA 4MULA 4PBSA 4HJXA 4ARIA 2BTEA 3IMGA 1I6KA 1N07A 1MAWA 3X1MA 4DDHA 1NUPA 2Z3VA 2CUZA 2VXOA 5JBNA 3ZIUA 1VL2A 1MOPA 1J1UA 3RJZA 4MUFA 1JIJA 1T9GS 1NUTA 1COZA 3HL4A 3A04A 4MW2A 3HGMA 3CA8A 4Q16A 1GAXA 3AIIA 2PFSA 4MWDA 4MUKA 2BYTA 2YWCA 1JGTA 5FO1A 3CLUC 2AZXA 3P0JA 1WQ3A 1N2GA 2ZP1A 5LM3A 3FOCA 1NURA 2QJTA 1X6VA 1EFVA 1TYBE 5EKDA 1I2DA 1G59A 1N2OA 1Q11A 4I6GA 2I1LA 5K0SA 3LCJA 1LI7A 1PFWA 1NZJA 1O94D 4DDKA 4G5YA 2P3MA 3CTAA 4ND7A 2J5BA 2YY5A 4FZJA 1S4MA 1Q15A 1A8HA 1YUMA 2O8VA 3P0IA 1LI5A 3CVXA 1U3DA 5HG0A 1KP2A 1N2BA 3IUEA 5TS2A 2CV1A 1T6XA 1TEZA 4MWCA 1MAUA 2CV0A 3PNYA 4YBRA 2H2AA 3IVXA 4BWVA 2A84A 3FNRA 1WXHA 3PXUA 3RK1A 4G6ZA 3CVWA 2QTMA 4DJAA 5LFAA 1F9AA 1KQPA 1O5TA 3SDBA 4ZCSA 3HFJA 4MW9A 5KHAA 1MB2A 3K32A 4KR9A 1KH2A 4GRIA 1TFUA 4ZCRA 3HZRA 3SEZA 3FI0A 4R2MA 1N2EA 1NUSA 3UK2A 5AHWA 3IH5A 3CLTC 3ELBA 4MW6A 3TQIA 3Q4GA 2PXHA 2ZUFA 1O97D 2CT8A 1XNJA 4XFDA 2ZUEA 3QTBA 4U63A 4EG5A 2JAXA 5DEOA 3HMQA 3CLSD 4F4HA 2NSYA 4NX2A 1SURA 1PFVA 2EJCA 1EFPA 3UY4A 3FIUA 4E1AA 4ARCA 1H3EA 1MB9A 2A1UA 2B7LA 1GZUA 1NI5A 1OWPA 4X0EA 3MXTA 1X8XA 1IFXA 2QUIA 4YP5A 5J5AA 2CV2A 4DNXA 4KKVA 1N78A 3F3MA 2AKEA 4ZT5A 4MUIA 2A1UB 1OWNA 2J09A 1U3CA 2X3FA 3MUEA 4OUDA 4ZT2A 3X1KA 3CLTD 3ZJVA 5J59A 4WSOA 2X1LA 4PBRA 4XFJA 3TQOA 4MVCA 5TRDA 2D5BA 4H3SA 1IQRA 3ZXSA 2VBVA 2PZAA 2QJOA 2QJFA 4R2LA 4A91A 2XRZA 2A1TS 1T6YA 3SYTA 2XRYA 3ND5A 3H9BA 3SZ3A 1M8PA 1O96A 1B6TA 1MC1A 2AG6A 1H1TA 1IRXA 1WOYA 5F23A 2VBUA 4MVXA 4K0RA 5HUJA 1KQOA 5TEVA 1ZUNA 4RPIA 1NUUA 1JZSA 2Z09A 2RD2A 1N08A 2EL7A 4JZYA 1JILA 3PNBA 1TYCA 3TZLA 3NV7A 1QTQA 3OTWA 4MAFA 2A86A 4J76A 1LW7A 2DETA 1Y42X 1N77A 5BNZA 3UC5A 3IVCA 1H3FA 3IOEA 2QUHA 1O97C 3LE8A 4KR7A 1VBKA 4S1OA 1R6UA 5IHXA 4R0NA 2E0IA 1ZH0A 3C8ZA 3H9CA 4CT0A 4KR6A 1KAQA 1ZH6A 4CQNA 3ZGZA 3GMIA 4MW4A 3CLSC 4EF6A 4KPUA 1NB9A 1KAMA 2QUKA 2HGZA 1F4LA 2X0KA 2WQ6A 2HZ7A 3AG5A 4YMIA 5TEWA 4ZCPA 1GPMA 3QE4A 4JXXA 1EFVB 2J4DA 4YP7A 1QNFA 1EE1A 1RQGA 3SP1A 2WQ7A 1F7UA 3MMXA 1GLNA 1M8KA 4HJRA 1FYDA 3KT6A 3QTTA 3DPIA 1PFUA 3VRHA 1EJ2A 2CSXA 1VBNA 4EG4A 3CVVA 1V47A 2CFOA 3L93A 2E21A 5H16A 4MUNA 2V0GA 4NDAA 2E18A 2DERA 3KT8A 5FO0A 2JANA 3VGJA 5KCMA 4UZFA 1JIIA 2NZ2A 1N3LA 5DB4A 2VTBA 3UMVA 4EG6A 3KT3A 3JXEA 4EGAA 3S3TA 1XNHA 5HUHA 1GTRA 2JA2A 2O5RA 3I05A 1ZJWA 1QRTA 2YWBA 3IODA 4EFKA 3AKZA 3AFHA 1M8GA 1GTSA 1Q19A 1YIAA 2QTNA 2VTBB 3FWKA 2PIDA 3IUBA 1TYDE 2QUJA 1JMVA 1O6BA 2DUMA 4EG1A 1J09A 2G36A 1MRZA 1WQ4A 4ZT3A 3DV2A 5J58A 2CYAA 1QQTA 4ZT6A 1NSYA 4ZCTA 5K0TA 1H3NA 4MUGA 1J70A 4L2IA 2DEUA 4P2BA 1EFPB 4ZT7A 3H97A 1U0BB 2RE8A 1JECA 3BL5A 1TYAE 1M8JA 2GKSA 4ZCQA 4F3RA 1T6ZA 1CT9A 4EG7A 3FG9A 3MLBA 1DNPA 4NZPA 4QRDA 1JZQA 1O95D 2H29A 3A05A 3RHSA 2X1MA 4HK4A 3OP1A 4L2IB 3COVA 4OJMX 3U1VA 1MBZA 1K97A 3CLRC 4EG8A 1QU3A 2DPLA 2DR2A 2VBSA 3GLVA 1T9GR 1U7XA 1D2RA 1JHDA 1IVSA 1J1ZA 4OUDB 1N1DA 3A2KA 3ND6A 3UOWA 1N2JA 2PZ8A 2QTRA 3AG6A 3INNA 4K03A 4MWEA 4DE5A 3HV0A 1MJHA 1K4KA 5A8AA 1IQ0A 1OBCA 3N05A 2IJGX 3IMEA 4TS1A 3RBAA 1WXGA 1J20A 1J21A 3IOBA 1M83A 4MUJA 3G6KA 3Q10A 4PBTA 1ULHA 4EG3A 5KWVA 4I6EA 3A4IA 1O96B 3IVGA 3DLAA 1N2HA 3N9IA 2A4MA 5A89A 3SEQA 1N05A 3ND7A 4HPWA 1IH8A 3D6UA 2D13A 4MUEA 3DO8A 1KORA 3TNJA 1YIDA 2PZBA 1VBMA 3RK0A 1XJQA 3FDXA 3COZA 5TGTA 5DK4A 1HYBA 1G8HA 2E89A 1G8GA 3FHJA 4WNYA 3ILVA 2OYNA 3FY4A 3KFLA 2R5WA 3CLRD 4CDMA 4MQ6A 5IJXA 1EUYA 2HMAA 4JYZA 3FH0A 3KT0A 1F7VA 1GN8A 1WY5A 3N2YA 1JIKA 1JEEA 3L92A 3P0HA 1FFYA 1IHOA 3D6VA 1KKUA 3SZGA 1Q77A 3NBAA 4NAUA 3ZJUA 2PG3A 4KPUB 3CVYA 2A7XA 1P7PA 1KH1A 1OD6A 1PG2A 1UFVA 1WXEA 3COYA 5H7XA 3K9WA 3G59A 1I6LA 1QU2A 3P52A 3TS1A 2Z08A 3CVUA 4AS1A 1N06A 2C5SA 4MW7A 3ZUGA 1OWLA 3H05A 1O95C 2A88A 3COWA 3ZJTA 4MVWA 5DASA 4DDMA 4XSVA 3ZXIA 4AQ7A 4U7JA 4MW1A 1Q9SA 1WZ2A 3BNWA 3PRHA 3IOCA 4MWBA 1QRUA 1NP7A 3PNVA 1YUNA 1KR2A 1KH3A 1G8FA 1QJCA 4DLPA 2CYBA 3LOQA 3TZEA 1N75A 1WXFA 3CLUD 3IMCA 4PY2A 2OQ2A 1BS2A 3H99A
chains in the Genus database with same CATH superfamily
5CAEA 1RI4A 3BPSA 1N6HA 4UZEA 1W5EA 1GHTA 1T10A 2RARA 4BRZA 1I4LD 3OJEA 1O9BA 5HPYB 3FRJA 5JZBA 4OK3A 1SY7A 1Z83A 3DMGA 4JT9A 2P5TB 2XDQB 1OLUB 1B2LA 2ORED 1IUOA 2QSJA 3N3AC 2OLKA 1K7FB 4L8YA 5JZOA 1NDHA 1BW9A 1YDEA 3DP7A 1CY2A 4CIXA 3K9QO 4AZSA 2ZVDA 1N34B 1IG3A 1NBWB 2JJ1A 1NW8A 5I4BA 5BVGB 3E9DA 2B1JA 3ZS9A 1L7BA 3QP9A 4FDUA 1BH6A 1ZXXA 3FFXA 2GEVA 2PLNA 3GDOA 2F90A 4KX3A 4OQLA 4CQMD 3AGQA 1AU9A 2IHTA 3AM3A 5AVYA 5C31A 1KI6A 1Z74A 2YXPX 1Q1GA 3HYLA 3L8GA 3OOHA 1QIIA 4JLPA 2MDTA 1IE3A 2YJ6A 4E3ZA 4TXHA 2B5OA 3WIDA 2YVQA 4OA5A 3ZKAA 1QP8A 1E62A 4YFYA 4NBRA 4II2A 4GI7A 2QM0A 1ZISA 1QZXA 2PRKA 1W5FA 1KZHA 3OWXA 1XZGA 2ZUTA 2R6HA 2C2GA 3ZV5A 4RDIA 3T1NA 1RHRA 2VF5X 1R0WA 3PL1A 4ZU1X 3CO5A 1EDBA 2BE7A 2VCYA 1IPEA 2WW8A 3T52A 4QEDA 2OB2A 4AWAA 1OWMA 4C89A 5K09A 3JQGA 2XKAA 1BH2A 1QRSA 3ZDAA 1DAOA 2PKQO 2F1IA 2GAAA 3GD7A 4C3ZA 2WSIA 1M0WA 4UASA 1Z47A 2MSEB 2PSDA 3FKQA 221PA 2LPMA 5JS8A 5LKAA 1UMCA 5DHSA 1IBKB 4KXVA 2CXUA 3VR5H 1L7PA 4F84A 1FFHA 1P1IA 4J1TC 1P7VA 3AHCA 5F76A 2QN3A 3WKAA 3TLGA 1TUGA 4DC9A 4EK9A 1J2JA 5D3ZA 1XD8A 3KQPA 5JJ5A 1FF9A 3HBLA 5AH0A 4X0CA 4NI5A 3GWGA 4H4EA 4PS0A 2Y0DA 2Z4SA 1DWUA 3WGGA 1JVBA 5JBNA 5HZGA 4M1QA 1J2UA 4X1IA 5AW3A 4KE8A 2QRKA 5TQ0A 3V33A 9ABPA 5EE9A 1D2AA 1FSSA 4FZVA 2WHPB 5KNLA 4NOKA 3HPQA 4ZGGA 3W3AA 4QARA 3N2NA 5ILOA 3L8YA 5AJWA 2UUBB 3EQ6A 3GVLA 2F3QA 4Q47A 3HKDA 2RAVA 2QJWA 3B6KA 4KPFC 1Y8ZA 3PIIA 1PF7E 4MUKA 3CXUA 3H2HA 3H2KA 2ODPA 2YWCA 3DDSA 1D03A 3WYFA 1KERA 4OQZA 4WCFA 4O1HA 1AE1A 3KYJB 1HE8B 4YWJA 3N39C 4XQEA 3BCFA 2FFAA 3RUEA 5BURA 1DXHA 2GDJA 4HC4A 4IGKA 2VLBA 5LA6F 5CLHA 5EIHA 4EBBA 4XVQA 4D8TA 1IXRC 1EFTA 3AKDA 1TW3A 1UAYA 4ZTUB 3R4VA 3LQEA 2PH3A 3KKEA 3OOYA 1O94D 3ZDQA 2VHVA 3A4NA 2A30A 4HDRA 1E3EA 4Z9XA 1NDQA 5EUBA 1U0HC 2PANA 3GT0A 2G1PA 1QF7A 1WB5A 1Q50A 5JBQA 1JHXA 2AFIE 4G8DA 4YRPA 1YBMA 4KGZA 3PWSA 1FE8A 3F7TA 1LI5A 1YJ8A 3IQEA 5C7OO 4IG9A 4DLNA 3IUEA 1SZPA 4IHJB 1NAHA 3HCDA 4KLRA 2PD6A 3OPNA 4GL4A 4HEA6 3D7SA 4DCUA 4QICA 4G9EA 2VDOB 4L3VA 4YBRA 3RJ9A 4OMDA 5CCDA 3GCZA 1RWKA 1FA9A 1M2HA 4FKBA 2Z2XA 4I55A 4OD0A 1DAHA 1PV4A 3PG5A 4QWWA 1SKYB 1R0YA 2J1LA 4G09A 4DLZA 4BX9A 5KTYA 4KR9A 1T15A 2P2SA 4ZCRA 3ECCA 2ZKLA 1H4QA 1C9KA 2IYNA 4EI7A 3Q2OA 3S70A 1WF6A 4J1QA 2XOXA 3D59A 3QU7A 2PX0A 1RXIA 3H2JA 4HD8A 4TL9A 3TKLA 3SSMA 4QA9A 5DPMA 4FYHA 1KBQA 3LC0A 4C0SA 2UUCB 1E2EA 4XFDA 1QVGB 2VJYA 3G79A 4WVLA 4AKTA 3AUTA 4ENQA 1CRQA 2G28A 5CURA 3LA8A 1FYVA 1GT91 4FN4A 1ORIA 3QX7A 5B58T 2IWRA 3T35A 5KKNB 1XU9A 2FZ4A 5ALIA 1QG0A 3LUAA 3R6TA 3LF1A 3H0EA 4BFVA 3CE9A 1RBQA 4JJFA 5BW5A 1PK8A 2OZVA 2ZRFA 3OEHA 3IT2A 3PC8C 2FCAA 3KTFA 1QBGA 1D7AA 3WRXC 1RYNA 2C20A 2YV3A 3FIUA 5BOSA 4YMUA 1E7WA 5CD9A 1EGQA 2XR1A 4MCHA 1WABA 3HXTA 4YI5A 2B36A 4G56A 4AY3A 4YRIA 2EWWA 1S3SA 4ND8B 3TYXA 4R69A 1H6AA 4BMNA 3FA2A 2I4OA 2DY0A 4HUJA 3TX6A 1V4VA 5EXTA 4JI0B 1E32A 2JF0A 3W3AH 4HQLA 3OKFA 4JI1B 1WHTA 3MTJA 4LGVA 4F96A 3P0EA 3GJ4A 2F3SA 1DX9A 3IESA 3PRYA 3PUMA 4YRRA 3VZRA 4EUEA 1G7CA 3AF4A 4Z0HO 4X64B 4UC0A 1BE8A 5ES4B 3PQ5A 5BYJA 4HQ6A 3ZW8A 3U9SA 4XA8A 4IPTA 5F9HA 2ZI3A 3QXGA 1C0EA 2R7NA 3LBNA 2EBHX 3ZH2A 4DR2B 7REQA 5J59A 4A6XA 2PU7A 3M1IA 4LY0A 5BYKA 2HA6A 2FVGA 3IIEA 1LBIA 3UG6A 4PBRA 3U4HA 1XIVA 2ZEJA 5FR2A 3DCNA 2IY9A 2ZR7A 3D3WB 4XUGB 4ZGBA 2FN9A 4RTLA 4UM5A 2WKSA 1LD3A 1CUHA 3CSUA 4GWGA 4IZOA 2P2LA 3W34A 5TQ2A 2J67A 3DDHA 4XLLA 5K9ZA 1J8FA 4BVGA 3AY6A 4LDAA 3DT8A 4HB3A 1JALA 2AOXA 4IH9A 5FTKA 2V1UA 3QV1A 3E3LA 2PS3A 3E7XA 2Q62A 4JR2A 3SZ3A 3C7TA 3NTLA 2RAUA 2M98A 1XZCA 1E1MA 1I2ZA 1VSTA 3WBBA 4OQEA 3U37A 2DQ4A 1XDDA 3B82A 2PNFA 5EP4A 1DEAA 2G3YA 5KYUB 4MI9A 3HVIA 1JIVA 4JNKA 4HAZA 3C1UA 4BNJA 1IY8A 4YAGA 2FSPA 1JZSA 4NPAA 1N08A 3G71B 2W90A 4OP1A 3RSGA 1KVRA 3CUKA 4Y2TA 4ZQHA 3C2QA 1VLLA 2G71A 1K6XA 2FXIA 2WHRA 3FPFA 1MN6A 4FHEA 1N77A 4KU4A 3UC5A 1YS9A 3THWA 4MUBA 4KN9S 3BC1A 1PV1A 2BISA 3KJGA 1DWPA 3F8SA 3SQLA 5I45A 1O97C 3D2BA 4OXNA 4KXMA 3UA4A 1WDKA 1J22A 1IIRA 5JEDA 4XR6A 1YZFA 2R3SA 3LI2A 2VSOA 2NXJA 4GX1A 1GZ4A 3X1DA 1NVXQ 1IXSB 2C9CA 1XKTA 4IH1A 2VQ6A 3HVKA 3CG4A 3JS5A 4EF6A 4BLOA 1FRQA 4BVKA 4N7RA 1L7RA 3QYPA 2NXNA 1TDJA 4HWPA 1I5RA 4P3XA 3QFSA 1T24A 2P4HX 3ZW9A 3O1IC 3RRZA 4AJKA 3R1IA 3VR2A 1RRVA 4QXPA 4CN9A 3O73A 4D9FA 1RXVA 1O57A 1MJGA 2AXNA 4NNOA 3TOXA 5ICEA 4ZI5A 3PPVA 2FPKA 5ER6A 5JZSA 2ZR9A 3W78A 4Y2PA 3ASSA 4PC2A 4J0DA 1YVEI 4BVEA 5AW8A 4S05A 1K8YB 2RHRA 4TN5A 1VI6A 3TOSA 1H2ZA 5LA6B 5GOTA 3L7CA 2PR2A 4MUNA 4PFSA 4LV5B 4MDEA 4AICA 1BMTA 2JZOA 2Z0MA 1CRLA 2MR5A 2PKQP 4A0QA 4D42A 1NOJA 4ODIA 4Q4AA 3RF7A 1KYYA 4DQDA 4PGGA 4X8OA 3RAPR 1U28A 1YB2A 4JUCA 3V3TA 3VZDA 3VKGA 4NYMR 4K9MA 4Q9KA 4DV1B 4FFOA 2I7CA 2QVBA 4PYLA 4GEGA 4ZODA 1SQ5A 2SCUB 4DRZA 5A62A 1XZQA 5GV8A 3BT7A 1X1RA 4ZOLB 1YE3A 1L5FA 4RQTA 1VJSA 5JASA 4YA6A 1U7ZA 3BIJA 3EZXA 1Z3IX 3CXRA 4HF7A 1QCCA 1ULUA 4M1ZA 3R7AA 4CV1A 1ZJWA 5HIIA 1PWEA 3QSYA 3G05A 2DSTA 2IHYA 1JUDA 2JLCA 1M8GA 5JSUA 3KWLA 2W58A 4F86A 4YMHA 4H08A 3SICE 2EIHA 4H7HA 3QEOA 2QVXX 1TYDE 1O6BA 2DUMA 4JK3A 2P11A 3EFOB 4PONA 1Q0SA 1X1QA 2FPIA 4ZT3A 3D64A 2DFLA 3AVPA 3B7PA 1EGVB 2R1UA 1ZH2A 4O1MA 4OSPA 1WF3A 2AMVA 4MUGA 2R8BA 4NMWA 1I13A 3QE9Y 3T7RA 4RKRA 5C8DA 3NOXA 4L2IA 2X6XA 4M87A 2XXJA 5EZ5A 2HR1A 1L7NA 5H81A 2BBSA 1TCUA 3MW8A 4I1IA 3PUJA 3K0HA 1BJKA 5JPIA 4E2XA 1DC3A 3FRIA 4B2YA 2POCA 2RE8A 1HZZA 4RY2A 3OFKA 5B1SA 4PR3A 2R6AA 4NHOA 2GKSA 3LS2A 2F8SA 2XE6A 1A1SA 3FE2A 3IPLA 3MLBA 4YDQA 1HE3A 4G8CA 2D4AA 1J0DA 3Q6QA 1Z5OA 5J5CA 4EELA 3BMQA 3HN6A 1NLMA 1O95D 4HH0A 4C05A 5LQNA 3C85A 3G6WA 3I9V6 1XZ8A 2EHJA 2PX3A 4ILEA 4KQ9A 1NJ2A 2ZRHA 4CKBB 3KS9A 1K97A 4KX5A 4FCCA 3DKIA 4L9SA 1SXGA 3IP6A 2DBVO 1P74A 3ITKA 1SU7A 1ZBQA 2WLSA 4PRZA 1PGQA 1Q0TA 1JHDA 4YCLA 2ZYIA 1Q7GA 1NU6A 2P9JA 2QAJA 1Y8CA 3EDRA 3MUFA 3SKXA 2DH5A 2QS9A 5JLAA 3WNZA 1SKYE 3TW4A 3ND6A 4EPRA 3F5MA 3UAZA 3BRWD 3C43A 1IHDA 3JRXA 4RH1A 1L3BA 3C8DA 1C7IA 3NO4A 1E6EA 3ZLUA 1BG6A 2XCSB 1UDCA 3K8QA 2AI1A 3DV0B 4PZDA 2R8EA 2V45A 3RBAA 4BLPA 3EH2A 1W85B 3QFFA 1KI8A 3TCNA 1EXNA 2EGGA 2KLBA 2OPBA 5IT5A 4DL9A 2J7PD 4FNAA 1AMNA 1XU7A 1UFKA 2F2TA 3IE0A 3DHNA 3IXMA 3PICA 4R1MA 3TD6A 2H57A 2POQX 3D02A 4C7KA 3HB4X 4CODB 1K8AD 1PUJA 2QAGA 2YFQA 3QBEA 2C1XA 4LK2A 2VZEA 3AC0A 1NF8A 5ENDA 5EN4A 3ZDYB 3AEQA 3HWX1 2YW2A 2PUDA 4IL5A 2HLHA 1FDSA 5B30A 2JK0A 3ZE1B 1YZVA 4DDTA 4TRRA 3HHEA 1WTAA 3VX4A 4D56A 2Y6UA 3R3XA 3D2CA 1M6WA 5I9MA 5DDIP 2HIMA 2SICE 4D9JA 2HA5A 1KSJA 4MVJM 5BR7A 4IVQA 5MN4A 3ETDA 2OYNA 3PWKA 3ROTA 1YTLA 1YV9A 1DJMA 1JP7A 2BDEA 2VDLB 3FH0A 4YT8A 3TCXB 1X9HA 3TGPA 5DM70 3OCZA 2HKIA 2AF4C 3FTNA 4KN5A 5C3UA 1FX0B 5KNCA 5IK2A 5IWAB 4UDOA 3U40A 6PFKA 2OCBA 4L0MA 2AR0A 2QTFA 2A0WA 5CA1F 1DQNA 3RADC 3HQ4O 3OQBA 2VP0A 3UWMA 1LEHA 3TMKA 4DLWA 5C4IA 1Z7WA 1Y7IA 4AG5A 2Q4TA 1MG5A 2FA9A 2APJA 1NG9A 2ZTSA 1P2BA 3WB2A 5HZHA 5FBWB 2B61A 2HK6A 1FS5A 3PGJA 4MARA 4UHEA 3AP1A 1N5MA 3UAWA 5DGHA 1EVEA 1AY0A 4GKVA 3EIFA 3DMDA 5JFTA 1F6WA 4DUZB 4NRDA 4Z49A 4PQRA 4Z0TA 1GKKA 5HE9A 2QX7A 3LCMA 1NXWA 1N06A 1G1AA 2B4KA 4MW7A 1BDMA 1UOOA 2OAGA 2EARA 1NBHA 3A3BA 2YV5A 1DINA 1FYFA 1L4NA 1TZ2A 3WLLA 4ISBA 1YB5A 1MQ8B 2GLTA 3WB0A 4F4JA 5LP6F 3GBSA 1GN9A 3ZJTA 1IIBA 3CF4A 2D3TA 3OKXA 1TQDA 3P5BA 1NXTA 1XZEA 4AYTA 1GUDA 2R6GA 1NIPA 3EULA 1HF3A 1BFDA 3BMNA 3P9XA 4HNTA 2XECA 3CWCA 4F4FA 3T7AA 2GFHA 2C58A 5C2JB 1ZNYA 1YQWA 2Q5CA 3M8KA 4Z4EA 3I1JA 2QQFA 2HSZA 4NH0A 2JI8A 4NENA 4FWIB 5A4DA 4WK6A 1DEKA 3ZV7A 2H7VA 3KUKA 1QJ4A 1FRNA 3E8SA 1J56A 5JROA 1EXDA 1N6OA 2VA9A 2PK3A 5DCLA 1WCYA 4JWKA 4GLJA 1O0CA 4OXQA 1EUQA 3L9WA 2BMDA 4RUKA 1A97A 1CR1A 1YHQB 5HEKA 3TM4A 4AY5A 4KHPB 1JR6A 4MZDA 4P4LA 4EY3A 2NNLD 1EWYA 4JQZA 3NDRA 1U0EA 1I7PA 3C1TA 3MS2A 2VK8A 2GCIA 1FTSA 3PT5A 3WO1A 3RAFC 4DWJA 3RIEA 3EPLA 1AO3A 3CH5A 3W8DA 3X1JA 4XRGA 1AKTA 1H1LA 4TT8A 2MSDB 4BE9A 4YUZA 1WCIA 3E9RA 4TTTS 3O83A 4FEAA 1L7DA 1XN1A 4AJHA 4QGBA 3NPMA 2D5IA 2P4QA 1VJGA 2Q1UA 4IX1A 2EFGA 3CSDA 2VZ9A 4GU5A 4AZWA 4WKPA 1V95A 2J07A 4WY8A 4DJFC 1YDGA 2JGAA 3F2VA 3PEVA 3R6WA 3WGYA 4BUZA 4C4SA 3EC2A 2AMFA 4E2YA 1PJ4A 3LT2A 1RDFA 4FJ2A 4IIXA 4M8SA 2QTAA 3O4IA 5JD4A 4PZPA 1PZXA 3F5QA 1D1QA 3PEFA 1IXZA 3GJYA 3WRYA 1J24A 3HRKA 1E5DA 4MVJE 5REQA 3HI6A 1G3RA 1WKBA 3K8OE 4GM4A 1NMXA 4MS4A 4CKYA 1N6PA 1ZH4A 2ASEA 3AR7A 3WVNA 5KDLA 1D04A 3KEOA 2FWNA 2I34A 5AKKA 3A9RA 2ZPTX 5IDXA 5CVVA 3WL4A 1DC7A 2GERA 4JC8A 2JD1A 4Y9SA 5FI0B 1MABA 3OX1A 1R27A 4MW0A 2GK7A 1L5SA 4WKBA 3TL6A 1ZGZA 1Y9EA 2QIOA 4XPIA 4YRSA 5HJEA 2BP7B 4JYAB 3NWPA 1I18A 3H2ZA 1Z17A 2R84A 3AM5A 4L7VA 3T34A 3RAGA 3S6JA 2BTEA 1E79D 1U8FO 1Z37A 1PFKA 3RRNA 4IS3A 4OIMA 5J2UA 3QXJA 1U9JA 3V2HA 2BGUA 2XMDA 3FWYA 1VQNB 2ZJ8A 4YMLA 4E12A 3W6PA 1DJLA 2FPLA 2UAGA 2VF4X 3CKMA 3MMSA 2QRPA 3N58A 2JIQA 2YOFA 5KNDD 1T35A 4OAQA 1W19A 5I7AA 4QNMA 3R9IA 3MCAA 3VAYA 3WAGA 1BDIA 1J1UA 2VJBA 4JA2A 3P96A 4CEHA 4BJ6A 1L4FA 3DDZX 1Z6AA 1BVRA 1W4RA 1YOVB 2GTHA 2JW5A 5ITWA 1FJGB 4MW2A 3E22B 1Y6JA 4PAMA 3T12A 5E0OA 3MTIA 4O4HA 1I7SB 3ND9A 1LLDA 1QIEA 4WXYB 1GM5A 3MLEA 3Q7TA 1C5KA 3HCNA 2XZTA 5JH7B 3GZNA 4MUYA 2ZT5A 5CT4A 3TJRA 1F2TB 3A8JA 4YRTA 1ZJ5A 2Y0BA 1WQ3A 2NZ8A 1HQKA 3AKCA 4Q02A 1EP9A 1Z4MA 3RHTA 3F8TA 5F1KA 3T5BA 2L17A 1NF2A 1TGYA 2R00A 4BASA 1T0JB 4B3GA 2BJHA 2M2IA 3CNBA 4GYWA 4IR7A 3QWFA 2PWBA 3ADOA 2IV2X 1HT3A 4KI0A 3QNMA 1QE0A 1SAYA 2XZDA 3F9IA 4JUIA 1VJ1A 1HKHA 3ZJ4A 2EKQA 1KZ1A 1U0GA 4Y30A 2JLVA 1UP4A 5DMXA 4YCCA 2PU5A 4OLHA 3RTGA 1QG4A 3ZPXA 4G41A 1JAIA 1E1CA 2B5VA 1ZLYA 2FW6A 3L0OA 4G0YA 3BD9A 1CUEA 4HPXB 5IF3A 2VDUE 3DXYA 4LSMA 1G20A 3BA6A 4KO1S 4US0R 4KYUA 4CQLA 5IVPA 3DGFC 4MKZA 1YIJB 5AJTA 1FCJA 4N5LA 5LOVA 2ODTX 3SMVA 4Q4DA 3PNYA 4MAMA 2FOIA 4YT5A 4B4VA 1T5TA 2PKYX 3KIPA 1WXHA 3DMFA 3O4HA 3OLCX 1RYDA 1ZK0A 2JFYA 4UDYX 5CA1B 2FVXA 3OP4A 2NU9A 1G2IA 3BWXA 1LBSA 2FZKA 4W8GA 4F71A 3MSXA 2R7MA 2C5LA 4PGAA 3KEFA 5HF8A 3SC3A 2TSYB 3NIGB 1YJ5A 1PUXA 4RH0A 4YMTA 4BMCA 4UDXX 5JDIA 3AI2A 5ECWA 4Y7CA 5E9QA 4F9TA 4CMEA 1C4OA 3ZWYA 1N2SA 1RWNA 5JANA 3D4NA 5I7RA 1RJFA 1OZ0A 2VBFA 3W79A 6ABPA 1QOQB 4H7EA 3CNQS 5E1DA 3ABIA 3ZNNA 4AW9A 3DE2X 1QMGA 1S7GA 1Y82A 3PYLA 1GUYA 4A0HA 2YH2A 2PY6A 2FN3A 3CTPA 5K3BA 4W63A 1P5ZB 2YWRA 1AXGA 1VE6A 2MOKA 1KXJA 1NOIA 2X3YA 3QY9A 4NJOA 4BLTA 5F2NA 4LSGA 4FLMA 1E3XA 1Y4ZA 4M36A 2BCJQ 3BGVA 5JYDA 4BATA 1YJBA 2FK8A 4U7WA 1U4NA 3AUUA 4Z4GA 2VH2A 1UFOA 2BFBA 1IUNA 2VDRB 5C51B 1XB2A 1RYMA 1E3JA 1QVZA 4CHGA 1G8AA 4BJHB 2FZEA 3O21A 4HH4A 3E84A 1ZBDA 4ZANA 3AVWA 2ADFA 4RPJA 3IBFA 3ITEA 2PH1A 1U8CB 3A1CA 3CP8A 4BO3A 4AK9A 3VX3A 2ZZKA 4FUQA 5FBRB 3Q6IA 4L0QA 1Y1KE 2C61A 1JDBB 5ADHA 4DC1A 1RZRD 2OV3A 1HEIA 1KYVA 2DHCA 4IIFA 5EWJB 4DNXA 1VC2A 1BJRE 3ESDA 5AICA 4JBLA 1XK6A 2J3IA 3HO1A 1XD2A 3T4EA 1TZMA 2JB9A 4CRWB 1ZIPA 4ZT5A 2J85A 5G2OA 4Z54A 3KC2A 2DWPA 4WZ6A 3ZHQA 1P3DA 1P9NA 4LZNA 2BM1A 4PRYA 4BTEA 1PZMA 3RVSA 3G5LA 4QZVA 4P38A 3AY0A 2AS0A 4QGFA 3C7CB 4GOOD 4TUYA 2OM6A 5H70A 2PZEA 1ISGA 2HTEA 2QR3A 1N6IA 4GMDA 4II7A 1AJEA 4PCLA 1G3QA 3QQ5A 4FS3A 5HDBB 1M5RA 1W49A 3FBGA 1E2HA 1JLMA 1NI3A 3IV7A 1IN1A 3EDQA 3ASTA 1SBQA 5HZBA 2IL1A 4TLEA 5FPQA 5JSHA 4WBSA 5EXPA 3WP0A 4A91A 4FXUA 3BCSA 1PSDA 3NBZC 3ZWPA 4GC9A 4HWOA 3NP9A 3D8TA 3LP6A 2WTNA 3PFNA 2OSVA 3GG2A 4L6IA 3BH7A 2RGNA 4U3JB 1KMIY 5SY9A 1CUFA 2D1RA 3TIXB 2FWJA 1T2EA 2GLUA 2RGGA 1IN5A 3MTEA 3PBKA 5AKEA 5E1MA 2BD0A 2OV6A 5F23A 1V0JA 4PC3A 2J9XB 2Y68A 3OOEA 1WSVA 2QMQA 3QNWA 1I2MA 4GXRA 2BGIA 1YMVA 1QGUA 4KQ2A 3WIVA 4CM8B 3O4GA 4ZHSA 1TUBB 5BO5A 3ONUA 4K26A 5DULA 4JZYA 3OG9A 3E18A 5ALHA 4BB9A 4NY1A 4A3SA 3AVVA 1R5JA 3A4LA 4EUHA 5CG1A 1MVNA 2HDOA 4MHSA 4OAOA 3ETNA 4F2PA 2YVAA 1B74A 4JHLA 2HRRA 3T94A 4LV6A 2CK3A 1OFGA 1FEZA 2Z1MA 3E3NA 5CX1B 4ZVQA 2CVZA 2QRZA 2V4DA 1ACJA 2XRMA 2JLZA 1TU4A 1EFHA 3LBFA 1IOZA 4PPGA 3SKYA 2RHDA 1K5DA 1RJDA 5J9FA 1E9VA 2HW8A 2GEDA 3T5MA 4BE7B 3B13B 4DDUA 5IHXA 3OH8A 1ZD8A 3VR0A 2QOEA 4UBMA 5HQTA 3GXBA 4RH3A 4FB4A 1AKWA 1QGAA 5JMWA 1Z35A 1XFDA 2AC2A 2AN3A 1KAQA 1VZ3A 1YHNA 5ERGB 4PLGA 1YRHA 2YXDA 4WAUA 1D9XA 1ISIA 4XD7D 3STUA 4P83A 4QTYA 5FWNA 2WIGA 5E3HA 1NB9A 1K4YA 4YJFB 4DV5B 1AKVA 3DV9A 4G5QA 2DPYA 1U6KA 3FCCA 3OU7A 3HDGA 3PT9A 3LQ1A 2QVZX 4JMQA 1JEQB 1X7XB 2ZWAA 3Q3EA 4H77A 3T15A 1ORTA 1XCPA 5FUXA 2EOAA 5GTDA 1EEHA 1VQ7B 2LKDA 4D3DA 1PR6A 1PT9A 4RD6A 1OC2A 2AEMA 1WPCA 4FIDA 1T8RA 2VYVD 4W8HA 3OZVA 4GPEA 4OATA 3C6YA 3WMFA 5CYPA 3V8RA 1W2HA 1CQJA 2CFIA 1PZFA 3LFTA 1WHSB 2O2CA 4RORA 2ERCA 1Y98A 3DLIA 4X3OA 1XDSA 2XKBA 1OXBB 1DBPA 3L93A 4B84A 3NASA 1H69A 1C1XA 1VLZA 2JDIA 2AOVA 2WAMA 3HCEA 2VBCA 3FCYA 3KHUA 5DTJA 3LA6A 2GN1A 3T53B 1IMOA 1VDMA 1XCGB 2NN3C 1PJ2A 1PWZA 2ZRPA 5KCMA 1VLVA 4DLLA 2FFRA 1QHSA 3UJPA 1M66A 4FIZA 2O3QA 1OXMA 2ZIUB 4M37A 2H2FA 4OKNA 4UMFA 5FB3A 2I7DA 3EXEB 2VZ0A 4JYBA 4X5OA 4HGYA 2PYIA 3QPWA 4M9SA 1IZ8A 3S8MA 3BICA 3OECA 4WW0A 3P2MA 3VQTA 4OH7A 3LL4A 2A1IA 4KQJA 3HCBA 4NS4A 1JDUA 2JA2A 4U5XA 4JGBA 5C3MA 1BCRA 1MC8A 3GLIA 4H59A 3RH0A 3TRFA 1K98A 1MU0A 1HSOA 1NNI1 1OROA 1L5NA 4JEMA 4F5ZA 1J5PA 3Q9UA 3D7MA 4UM7A 1J8QA 1ZVJA 1KDYA 3AVYA 3G85A 2QUJA 1E5VA 1QYXA 3ZH9B 4I5EA 3EBOA 4BP8A 5FWDA 4Y3UA 2R62A 4JBXA 4KACA 2JLWA 1GDTA 2ZXHA 4UHDA 3QEAZ 2Y9MB 2PS1A 4V0LA 4IBOA 3K9GA 2Q28A 3W5BA 2ZCVA 4CMCA 2C54A 2RKWA 1CR2A 1PCXA 2BFFB 5DNEA 1NVMB 4BO5A 1ZHOA 5H3LA 4OL0A 1Y33E 3RFUA 1YJQA 4P54A 3BE5A 4WASA 1MO3A 1U2GC 4X8IA 2QT0A 1CUAA 3E0QA 3GRUA 5KVSA 4I4LA 3A3OA 3Q7IA 4QSMA 4QAQA 4IXMA 2GHRA 5HILA 4F3RA 3PXBA 1E98A 1E4OA 2I29A 4K9QA 2FSSA 4A8HA 2IWHA 3U7IA 4QRDA 2P4EA 1WBBA 3QNUA 2E5LB 2A0XA 4FBMA 5AJUA 1S8OA 1TO2E 1UPUA 2J9RA 3GRRA 1BGXT 4G0NA 4YP0A 3V1TC 2IV7A 2A33A 3ZWDA 1TJ5A 3HXMA 4R1TA 3CLRC 3EIOA 2H6EA 4OQ4A 5GM1A 3KZCA 5BVHB 4N0PA 4G4SP 3PPWA 1LNZA 4PIVA 2HDHA 2W2LA 2Y76A 5A3RA 3FTCA 4UE2A 3LVQE 2O2XA 3NVMB 2WUDA 3AK4A 3MT9A 2IS4A 2ARKA 5CVEA 4B2LA 3ORSA 5KX5A 3LLUA 4HP8A 4OJQA 2QRNA 2XF8A 3L77A 3QVWA 1A9XB 3LX5A 4XDZA 4CM9D 1F4PA 1YDMA 1TC1A 4L8JA 2QLLA 1CVIA 1ST3A 2D5CA 1XTKA 2ECFA 2HJSA 2I0FA 2NVOA 2WABA 4MDHA 3PE4A 5H8WA 3AM1A 2IKSA 1Q1QA 1WXGA 3IHTA 1KO4A 3RS8A 1UT5A 2PL5A 2GZMA 2WKQA 3HABA 4MR9A 4MWSA 3WB1A 4ZQGA 1JLLB 1MO6A 3G9ZA 1MV8A 1UXGA 2GETA 1NFQA 2CZGA 3JQ9A 2A5FA 2VXBA 1QAMA 4I7EA 4F38A 3DLAA 5ITZA 3FVRA 4IGAA 4JZKA 2NZXA 4XIGS 4Z3DA 1N05A 3NJ8A 4M0KA 4UUMA 4EEKA 4HNGA 1RJ9A 4N9WA 3KBBA 2YDXA 4EHAA 1PR2A 1QV6A 3GUCA 5EJ2A 1RYFA 4ZO9A 2X4GA 3MD0A 2EFYA 2ZUVA 2OKCA 5BV7A 3WK9A 5IU6A 4EUKA 3TX2A 5DU2A 3MZ0A 4K6CA 3JD1A 4LHVA 4QBIA 3COPA 4M38A 1M7HA 4F11A 4YMVA 2HMTA 3JAKA 3P2OA 5IJXA 4N76A 4UMDA 3RUDA 2CB0A 4NMMA 2A9OA 4ZHQF 5G41A 5KTKA 3O4FA 3VKWA 1RM0A 1EYZA 1PUIA 2AOUA 2VH1A 4ABTA 4CQMA 3ZZ1A 3TIIA 2O20A 3CURA 3ORQA 4FP9A 4NMLA 4C22A 5JQGB 5IT4A 5D5QA 2JD0A 3BB3A 4J3FA 4GX2A 1QTRA 5AXBA 4N5NA 4XCQA 1AOXA 3A4TA 4D80A 2AE1A 2N47A 5BQ5A 1T9DA 4RGBA 5B1IA 3H16A 1ZOLA 1SC1A 5DNUA 4R31A 4YCJA 1K28D 3I34X 4B7AA 2ZWOA 3FTDA 2VAPA 4KR0A 2I67A 1OXKB 4B3CA 3PXXA 3CUVA 3ZQKA 5ALMA 1PT6A 5IZCC 2AOTA 2RB5A 2X77A 3PHIA 1CJCA 1C4KA 3H18A 1YB1A 2VJOA 5CW1A 4HSGA 5SV2A 2JLSA 3BF8A 2IYFA 4PZLA 4F9FA 3P5SA 1NU8A 4DJEC 1GSOA 1SUDA 5AVSA 5J35A 2WILA 3UMSA 4CU5A 3WLMA 1J5XA 1EUCA 1EIWA 2P4SA 1DQYA 1BA3A 1NWCA 1LQ2A 2JFFA 1WUTA 4LRQA 4UAGA 5AW9A 5T8KC 1SXJB 1XP8A 2PFGA 5DM0A 3IIKA 4HTFA 2MTBA 1C7ZA 1MGPA 1SD2A 5CGZA 1E5LA 2J9FA 2YCLA 3PYXA 4UQPA 3F71A 3L8DA 3FJYA 1N3YA 2OP1A 1NJ6A 2YZ2A 3U4DA 5JNVA 5KC8A 5CB4B 1KK0A 3QVLA 3ROMA 4B17A 3QWHA 3U7EB 3AESA 3EBPA 2PUEA 3VH2A 1BU8A 4EZEA 1FW8A 1P29A 2PA3A 1FP2A 1RZUA 1Z2DA 1VDZA 4JB8A 4H1WA 1BWQA 3LUPA 1E96A 4MO9A 3RVKA 4C6RA 5CBPA 1YQTA 1M74A 2OECA 1E1DA 3QE3A 4CIDA 5TVKA 3WR5A 2IXTA 4DA8A 4BX0A 1AV6A 4CMGA 3G2NA 1RWVA 1WDLA 2B8TA 4KQEA 2GF9A 3FCAA 3UXYA 4BLWA 4XJXA 3TW8B 3ZHYA 3NBFA 4HDMA 4K9DA 4O2BA 5DMHA 3KXPA 5FX2A 1N1GA 3L1IA 3QRWA 1TTTA 1H8HA 1ZFNA 4NULA 1JXAA 5ALZA 5C32A 1EJ6A 2WAAA 1B16A 1PG0A 2WTAA 1L6IA 3FGOA 3UAVA 3EVNA 3GGDA 2EP5A 4IXTA 3VBCA 1PQWA 4GAEA 2GAOA 1RJWA 3ZC3A 2HDNB 1U3UA 2VNJA 3H17A 1S2OA 1SC6A 1TT7A 4XKJA 3UW3A 3BD7A 3LY8A 1PK7A 4P3OA 1N0IA 2Q9AA 3E6AA 3CU5A 3IA2A 3NM5A 1T36B 4WRRA 4JLJA 3RQIA 2ZVJA 5LDDC 1QHNA 1RMYA 5L46A 4X93A 2BFWA 3WNCA 3N2IA 2Y3IA 5HJ2A 4EG0A 5AYVA 2ZYRA 1J6UA 1JA0A 2FGKA 4KXWA 4XQCA 5EYPA 4I9UA 2JFXA 1V35A 1SG9A 4L5YA 4N49A 1BE0A 2IZ6A 4AROA 1I6MA 3WNDA 3SJUA 1QO0D 3QXXA 2KSQA 1VL6A 4FMBB 3TLXA 4LF7B 1TECE 5B7NA 2NU6B 2PZKA 1Q3HA 2BF7A 1ZCAA 2FQ1A 4CTMA 2FN4A 3B9PA 2HRDA 4E11A 4KMOA 3UATA 4DV6B 1FJXA 2VJIA 3PU6A 4H6WA 4M8KA 4M99A 4FX2A 4OOXA 5HKKA 2WD7B 1BSVA 2GPSA 2J59A 5F5NA 3NRCA 3QBVA 3WJAA 3RODA 4DUPA 1JF8A 5DE3A 4D25A 4P08A 1CS0B 1EWKA 4HJXA 3GQBA 3L9XA 2VF7A 3W2FA 3F78A 1PX2A 3R0VA 1NJSA 3IMGA 4XYMA 3U6BA 1NLYA 3DMRA 4ROTA 4Q24A 1BEUB 4RTJA 4PSDA 4P4TA 4ER5A 2OAP1 2ZJ6A 3A1FA 3HP7A 5JXWA 4ZO6A 2R1TB 4WFKA 4PG8A 4M9RA 2XB4A 3NDPA 4H60A 2F9MA 3DF9A 4QUHA 2YZGA 1Q57A 5B3KA 1IZYA 1FLNA 4XDYA 5HWSA 3MYYA 1JJFA 4J7XA 2CC2A 2NIPA 1XAIA 4CLDA 4D45A 4Q16A 1LB1B 1XP5A 1Z6TA 3MCWA 5FLKA 5EVJA 4ZJPA 2ZL6A 2FX3A 1POXA 1KQ3A 3TINA 5DHAA 3KYDB 3WWEA 1BXRB 3L06A 3TDKA 4OHCA 1U4OA 421PA 5C1DA 3JQRA 3I6MA 1QIMA 2O0MA 3BXPA 3O1HB 1TD1A 3ELDA 4XRRA 2XT9A 1G16A 1L7MA 5TVGA 3C6MA 5ES3A 2GJAA 3E5MA 1EWVA 2ZJYA 2O52A 3OZTA 4DCNA 1ZOPA 4JYMA 4AJ4A 2IHUA 2YIMA 3IBCA 3DOUA 4UCWA 4NWIA 2W2XA 4R9VA 1J8VA 3QUQA 1ZMOA 3RDPA 2PA0A 3L8EA 3OZIA 3HXKA 1ACLA 2QUZA 3RFXA 2R2AA 1L1RA 4RKFA 4C7VA 4BRSA 2QN1A 1JFFA 5ICMA 3LC1O 3WLQA 1FDOA 1I2BA 3ZWKA 1PTJC 5LXTF 1ZXLA 3UWPA 5JC8A 4OA8A 4TS4A 1R50A 3DF7A 5TS2A 5KHLB 1HKUA 2G5CA 2D06A 4ZYYA 1QB8A 2DJ5A 4FLEA 3KYCA 4Q39A 1IHPA 4EB6A 1HE2A 2H2AA 4ZAWA 1EBBA 4F1KA 2B2NA 5K8VA 4NNJA 4M0EA 3HG7A 1E9CA 1R0XA 3N0XA 2H4JA 5TMDA 3RC1A 1FFBA 1OW3B 4MPTA 4C78A 1P2SA 4B6FA 2WYOA 1G4AE 3QE2A 2ZLBA 4GRIA 4NICA 1V3QE 4LWQA 3A1EA 2C96A 3T61A 3PQ3A 4JB0A 3MJEA 5EZQA 4YGYA 4RHTA 4QTTB 1NRKA 4EMBA 4S0ZA 3KFXA 2RJNA 3Q5GA 4H27A 4Q4CA 3AJAA 1VFPA 3QUCA 4YJHB 4E2ZA 4ZV9A 2D7JA 2CXTA 2G1KA 1QHYA 3KPVA 4HX9A 3E9ZA 4YAJA 1OR8A 2GJ8A 4D46A 2YV1A 4LOHA 1XZBA 3I2JA 3CP2A 2AA3A 3RSHA 4EPVA 4WEQA 3CT6A 3NM4A 1NPTO 2FSFA 5CP8A 4YRJA 5LIRA 4LMAA 2WICA 3B6JA 3R7WA 4BIIA 3ETLA 4CJXA 3LY9A 4QYWA 2I4TA 2X2PA 4REQA 3HLTA 1W1IA 1UBMS 2WT4A 4MQ4A 3ONEA 2CVHA 4WZKA 3U81A 3RV3A 4AS2A 1KI3A 3SCZA 2ZZGA 4NECA 4E1AA 1U8UA 1NBOA 1JPJA 2O54A 1RKQA 1P1HA 5IJ9A 4D98A 4BGVA 5EKTA 1S2DA 1UPCA 3PUXA 4X0EA 1BXGB 3FYUC 2IYYA 4WNIA 4EAAA 4AKGA 3H1GA 2QMYA 2TMDA 3T7TA 3F6SA 5H4HA 4C2BA 2QV7A 4RMJA 5BSMA 4F9GA 1U0OC 2YXLA 1YA4A 4U6SA 4FS8A 1AB6A 3VPFA 3WGZA 1JQ5A 3RKRA 1L5MA 1KEEA 1C3LA 4X9XA 3EVZA 1Z8HA 1BS9A 2FUCA 4MMZB 1Y0RA 1GUFA 2ZVQX 3EXIA 3VC1A 1Z34A 2KHZA 1A7KA 1XLVA 2IGBA 3OO0A 1KS2A 4YBZA 1URPA 4F7WA 5AVUA 3KTDA 1S3IA 5CIYA 5IYZA 4BB5A 1IOLA 5JHGB 3B1JA 1NW7A 4ZU6X 4ZOBA 1JG7A 3V3KA 1XXHA 1QR6A 4P1VA 3R0QA 1XDZA 2FMXA 2QENA 1KR5A 4FXPA 4KG7A 2Z58A 1EPUA 2YWXA 2X0EA 2PGIA 3QYAA 3M4JA 2BM8A 4H2DA 3DHWC 4EABA 3G8BA 4MVJG 2RHJA 1U7WA 4WECA 3ZVMA 4Q3LA 4CR7A 3ESYA 1GPJA 1H5QA 1SK9A 5AUNB 5JUWA 3FOBA 3K2IA 3VKFA 1P8JA 2PMEA 3E48A 1TAUA 1U0NA 4PG5A 3ZX4A 1J2YA 3ILYA 1Y0BA 3H5IA 5FBHA 2ID4A 4BEWA 4E14A 1YZHA 2RHLA 1NVVQ 4EJSA 3V1KA 3FXAA 3AERA 4DY6A 5TARA 1EZZA 1G19A 2A9QA 2GPWA 3TQRA 1HE1C 1PAUA 1DBQA 2AJBA 1N57A 1OFIA 3RYCB 1I7DA 1JILA 3QXSA 2GNPA 4LSZA 2V3WA 4W9RA 4YRFA 3NHRA 5D86A 2HYDA 2CVQA 4YFVA 4LJ5A 2FDRA 1IJBA 2QG4A 2O23A 3BAZA 5JRZA 3U4QA 1GVHA 2ZSAA 3G68A 4P82A 3WGVA 3OTQA 1SUCA 4MITA 3SG0A 5ITVA 4D4GA 3NB0A 4RSMA 1VG8A 2W6JA 1XRRA 3A6HA 1F3OA 2YN0A 3QLEA 5EWMA 3TKAA 4JI2B 1UBEA 4NCHA 1F06A 2F43B 4PLHA 2F62A 1G5HA 4RCVA 1JEYB 4L8LA 1IMJA 1R6UA 2G08A 1TKCA 4P7JA 4R0NA 1PGOA 2IH5A 1PS0A 3OZAA 3C8ZA 5LZ9A 3L6DA 3PDIB 3DBLB 2O2JA 2V7UA 1DMRA 3URKA 1OX4B 3CLSC 5FTLA 3HLYA 4UEJA 1O95A 1HORA 1V2HE 3EAQA 4OQMA 5EPEA 4YRAA 4CGZA 2Q8PA 3IJEB 3BSYA 2BEWA 1IWBB 1GXSA 2WSMA 4YJ2F 1ZM7A 2BFEA 2Z2KA 3AG5A 2CEKA 2CJXA 1EIZA 1GPMA 4B79A 4BFYA 2J4DA 6LDHA 4P0TA 4OPOA 4YP7A 2PUFA 5HZKA 1MO4A 3QYJA 1BOOA 1M2JA 1KZLA 4X7CA 3R6KA 3I37X 2RAPA 5KOHB 4F3KA 1F17A 2V74B 4Q3CA 5DBFA 3NATA 2XB8A 5K8JB 3VDMA 2EGUA 2ZI9A 2Z8YM 1HR0B 5F4ZA 5K7SA 1GNPA 3WI7A 3JPWA 1TX4B 3WS7A 4BVLA 1VGVA 5LSAA 4WCDA 2R8RA 2CSXA 1E1NA 5THKA 1JZTA 2QE7A 2ZUUA 1O87A 4YNBA 4TMXA 5A9TA 4NDAA 3B2NA 3K6SA 5GQSA 4B7CA 4AWXA 4IIJF 5IN5A 2GVNA 2EW2A 3OZBA 4PSAA 3KO8A 4AXXA 2PSSA 1Q17A 5J63A 2PKWA 3ZGLA 2QSZA 1USWA 2LXNA 1YT5A 2WJJA 3GRVA 4XOTA 3ICOA 3K2QA 3OEED 1QKJA 4K1LA 3ODGA 3U7QB 2ZSBA 3KT3A 4OOFA 1R7RA 2OHFA 1S3FA 5FT9A 3CRRA 3QVOA 3REGA 2HWWA 2Q27A 1B14A 1KZ6A 2PUHA 4AF6A 3GPIA 4RSGA 3IHKA 5LXTB 3PQ6A 1WPGA 2FLVA 3IODA 3MG9A 4MWZA 3TKYA 4DCPA 3MOSA 5KVAA 2YWDA 3PFHA 4BNVA 4H15A 3KPUA 3U4GA 2IH2A 3FLBA 1YX2A 1YDFA 1OLUA 2VTDA 2XDQA 3RU7A 4JR1A 1OI4A 3WLKX 2C04A 3UQYS 1ZW1A 5KKCA 1CHDA 1JFRA 1Z82A 2O2GA 2DHRA 1NBMD 4L4RA 4QO8A 5HTKA 4XGIA 3S2EA 4DM4A 3HJAA 3I01A 4IJQA 4I50F 3UV6A 1AS3A 1K1EA 1PV2A 3LK7A 3GYGA 5K99A 2OAEA 4IKPA 4ZCTA 1G6HA 2GI4A 3UTCA 4GPTA 1J0BA 2PKCA 5BRJA 5GZ1A 3L7AA 4EDHA 1JIQA 5EUQB 2EEZA 3UH1A 4DNQA 1S1CA 1H2YA 1M2EA 3C7KA 4IKOA 1OZAA 2BMAA 2H1CA 1SBCA 4YCAA 2HXGA 4NZPA 2XGMA 4PPFA 4EG7A 4HVCA 1DAFA 4J1NA 3ZW7A 2JGKA 3L5OA 5H4GA 1EB9A 4MUAA 4XB2A 1YKFA 2PGNA 4I36A 3EGVA 2Q5FA 4CF3A 2ZQZA 3SSNA 5DH9A 1RCFA 2Z6UA 2YBEA 3BZWA 4PXYA 3A6PC 4JFRA 4Q7MB 2LNDA 3S4YA 4RLSA 5EKUA 5TQVA 5L4SA 1ADJA 2GZSA 5CDUA 2CXOA 2W5UA 2Z4RA 3GLRA 3MJFA 1DBIA 1D4FA 1RLJA 1YE5A 3NYWA 2Z95A 4GP9A 2BBTA 4BBZA 1V8DA 3F73A 2XT0A 4HGPA 1DL5A 1KNXA 2J9GA 4XIFA 1HPLA 5EJFA 1XD9A 3V48A 3ESZA 5JNUA 1RC8A 3R5XA 1BX1A 4OSEA 2WIBA 4D6PA 3L84A 3V2GA 4FDMA 4A92A 1XEXB 1V1MB 1FPMA 4DMUB 3RWBA 3MGAA 3L82B 1YR9A 4UNQA 5E4FA 2GWRA 1J21A 1RWPA 2FZVA 4R0VA 4HLQB 2ZZMA 1X8LA 4KYTA 3ZWVA 5C5DA 2P68A 4GO1A 2XWBF 4CR8A 1DRUA 1KZGB 2I9PA 3O47A 5IUKC 5JNWA 1A9QA 4WA7A 1I7QB 3R77A 3Q85A 2AVNA 2G70A 2Q45A 2WHPA 1H2BA 4J4BA 2P0EA 4DXHA 2FQXA 4Z8YA 2F1OA 4G1CA 1KJZA 3CRMA 5ULLA 3O8DA 4HFNA 3V1MA 2DQYA 2BH9A 2JGMA 2EKZA 1EX9A 3GROA 5EVCA 2OHGA 2F48A 1LUAA 4FFNA 5D6OA 4RF4A 3JARB 2B9VA 3AEUB 4R2WA 4JSRA 2FG5A 2QN8A 1QX3A 3K0EA 3CE6A 3OT4A 4PSKA 3ROKA 2B3DA 2H06A 5HIJA 3T38A 4W4TA 4DT1A 3DULA 3G0GA 3OJCA 3MUNA 3WSVA 3D8UA 3O8BA 4OV6B 2KM1A 4KREA 2NADA 1A9YA 2XZLA 4L4YA 2MINB 4Y0NA 3SXUA 4MJLA 1YZLA 4HATA 4URUR 4J0FA 2VAMA 2PVSA 4BQEA 2VPXA 4E51A 1FMLA 1P33A 2H4YA 4KGXA 3RU9A 4BMSA 5TMBA 1XZLA 2OG2A 2CLOB 4A82A 2DP4E 3K0FA 1CZNA 3M9LA 3PJEA 3GV0A 1RXCA 2DUJA 3DFFA 1FMJA 4IHJA 2YKGA 3ESBA 3EQ9A 4KPUB 1EVIA 4GLFA 3TLZA 1WMBA 1G8YA 1VHLA 1H2HA 2BIFA 3K15A 2A7XA 3ZHOA 2V54A 3SF8A 1D07A 4RWZA 1KFEB 1WXEA 2GA8A 3GJ6A 3NIBA 4YS6A 5ILQA 1GT6A 3DG9A 2QNBA 4LMPA 2XF2A 3W7VA 1MG0A 3GFPA 4K8RB 5DKFA 3ZHVA 3Q6RA 2CLDX 4DIUA 4ER6A 1JWLA 4ZAYA 1NNLA 3W5UA 3IBGA 2Z57A 1JFSA 2OFWA 1ESCA 5ALOA 1HH4A 3R5TA 3KALA 4IWXA 2Q4BA 4Q12A 4TMTA 4ZVVA 5A04A 4G5RA 1W5BA 1ZSNA 2PRJA 4FEEA 5K3EA 1YZQA 2ZVPX 1AK9A 4YJ2B 4K7JA 2VJQA 2ZBVA 4GMKA 2XAAA 1JHQA 3SFVA 1R8JA 1XBTA 3ONNA 1CC1S 4WXMA 4C0QC 3NDIA 4WLEA 3LNNA 3BILA 3QVJA 2IQIA 2FP4B 1YUNA 2OCIA 3IEUA 2EGHA 4WZBE 1KR2A 2JIBA 5KNDA 3CCUB 1O8CA 3EK2A 4DLTA 3L0BA 1PHRA 3OTHA 5ETJA 2QN6A 2N46A 3PDJA 3IQHX 2CV1A 2YHIB 3IAUA 3FBWA 3QVUA 2VR1A 3ZXYA 1Y1RA 3N2ZB 4AMZA 3PUNA 4JLMA 1PI3A 2IP1A 2MYNA 1A2QA 2WT8A 2Q6OA 4KE9A 4LI0A 4DQXA 4B40A 4GZLA 4G23A 1HX7A 3KL4A 4HY3A 4ND8A 4DA6A 2F8LA 2J30A 4D3YA 1ULAA 5DLPA 5JXGA 3NEAA 4PINA 1DRKA 3SIWA 2QBYB 4ZT4A 3QVVA 1RRMA 2BLLA 1M1ZA 2GEFA 2YOGA 3U3ZA 1OH8A 1GQYA 3PHJA 4Y67A 1KO8A 5ALNA 2B30A 3QLJA 4YAWA 4G24A 3ZU3A 1F1BA 4XXHA 4IIEA 3TGLA 1YZYA 3K1AA 2M1XA 2D2EA 2HV9A 3MILA 4UAUA 3WGJA 1JFVA 5KYWB 1BXKA 2GJ4A 2W43A 4G37A 3VR4D 4XD2A 4C87A 2PH5A 5K3AA 5TXGA 1DZ3A 3DTVD 4Q0MA 1DBWA 1JXMA 2B8WA 3ICEA 4K05A 1XZMA 4U8GA 1CCWA 1KA9H 1U1FA 2XUQA 2O3UA 1A2KC 2H0AA 3D3WA 1OBHA 4I5GA 1RLIA 1V39A 1JJIA 3JQBA 3WADA 5AW1A 1Y1SA 2HI0A 1ILEA 4B3BA 4DARA 2FW7A 4I50B 2XV1A 2YNMC 5DIFA 1PVOA 4JL5A 3ACBA 4UJ3A 4W5RA 1XWFA 4MA5A 4HZGA 3B1VA 3I9V1 1U3VA 2UDPA 3ZHUA 4YROA 5TLSA 3OA0A 3D6HA 3GYBA 5IABA 3FPLA 2BKVA 2YTZA 3I6BA 5BWCA 2IYUA 3SEAA 2C77A 2COUA 4IINA 1VLHA 2WOOA 3FDFA 3HB1A 4LECA 1T26A 3RS0A 4ETNA 1MR3F 4WNAB 2GEJA 2IW3A 2IZ5A 5KYUA 4AN1A 4PN7A 5GIPE 3PGKA 1K6IA 4OU4A 3VMFA 3IPCA 2G9UA 3WLPA 1CJMA 2QY6A 4PG6A 4BKUA 4Z7NB 5A5EA 3S5JA 2WYUA 4BC1A 5LU8A 3U16A 3ZIAD 4PBSA 3BUSA 2GS9A 3AW9A 3JYQA 1NJ5A 2WWGA 4KSBA 4B32A 4US2R 1YONA 1VTKA 2J8ZA 2ONYA 4FILA 1GDDA 4I4CA 4MROA 3K4QA 1Y1PA 2XNCA 3CPXA 4M76B 1ATIA 4X6XA 4TYYA 3TO5A 1FNNA 2GR9A 1V6CA 1KSHA 1JQKA 4WI1A 3ZE9A 1QWOA 2ZBQA 3RC2A 1NX9A 1EX1A 1QK3A 3AYZB 3BFXA 4FHCA 2ZBPA 3Q1LA 3LVFO 1H6DA 2V5AA 4QQNA 4WADA 1RI3A 2Q3JA 10MHA 1Z7GA 3MJTA 1BN7A 1JIJA 2IPLA 1RRCA 3VOAA 1H9CA 4AO6A 4D3FA 2C99A 3H11A 3S1AA 5KTPA 2VDPB 2O8EB 2CNWD 2GWHA 2WG1A 2CJPA 2IYZA 2QTZA 4TSKA 3O1JC 4M54A 3CIFA 5F3RA 4P2GA 5EQFA 5JYEA 1HFJA 5EEHA 5DNCA 4RLHA 1UJCA 4YB8A 2A9KA 2QLBA 1UOEA 3P0JA 3OKPA 3P0FA 3QUBA 1X92A 3GJ3A 3KLOA 1L8LA 1SJ9A 4AZ3B 1N3IA 2QJTA 3DM5A 1XDGA 4ML3A 5DHQA 1NY6A 3SLGA 1CG6A 1A9OA 2Q3FA 4CTKA 3EIXA 1M2WA 2DTDA 3JYOA 4JJEA 1ZL2A 4N18A 3WHLA 5L6LB 5IAAA 4BU0A 2LZJA 2G9ZA 2Q6TA 1T4DA 4DR6B 1BKDR 4OX9Y 3L41A 2DECA 2BV3A 1JIUA 3LZCA 1I5EA 1R74A 1Y8QB 1ZRMA 1B6SA 3C24A 3OX3A 4FC7A 1BHO1 4XLFA 2ZQ5A 5BNWA 4G0WA 1UBGA 1ZD9A 2L0XA 3T41A 3V7YA 3U4AA 2EWMA 4IFEA 3M6XA 2YWGA 1XEAA 2A9RA 5HG0A 1YI1A 3B9BA 2VPQA 4ID9A 1GO2A 4KI7A 5LA6A 4AMYA 4HXFB 1BTOA 4D8VA 3MWYW 2ID7A 1NJGA 4EYKA 1KJNA 2QA5A 2GK4A 4FNMA 4NCKA 1A8IA 3P1JA 2A9VA 3FOWA 3P9RA 4WWVA 1Y63A 2V6JA 1Q1AA 3L7IA 4MWTA 1C7QA 4W7SA 4BV2A 4QKQA 2XMQA 2SCUA 3E05A 2VPWA 3SDBA 4MW9A 2JFPA 4YMSA 1HE4A 3A9VA 1KH2A 5EESA 4RJTA 3V7NA 4CKCB 2JGIA 1DKPA 4XSHA 2FUG6 1KDPA 4LOJA 4WXHA 1I0IA 1Y37A 5A5DA 1YZUA 5KDDA 3S5UA 3NQ41 4NE2A 2PRZA 1W2WB 1SC9A 3NLLA 2CT8A 1HQCA 3CC4B 1WCXA 2YMPA 3T4PA 1QQ7A 4RA6B 4BLUA 3MPUA 1ZI6A 2WA1A 3KQQA 3PJDA 4ARUA 2NVUA 4ITRC 5AK5A 4NFHA 3GNQA 1MF7A 3TEJA 1VE3A 2UXCB 3DZBA 2CNLA 1Y81A 5I5GA 4DLSA 1HG1A 2D1FA 3R3VA 3H5VA 4PLCA 3FLAA 1Q7BA 1V5VA 1R6AA 2GF0A 3HB9A 4FYJA 4IO1A 1GCUA 2CXSA 3HGQA 4DVJA 1RKBA 3EZLA 4FWBA 1ZN8A 4BWFB 1AUQA 2YZMA 4EY5A 3T1QA 3W4KA 1ISHA 2DYKA 3KZXA 4DIBA 2A1UA 3JD4A 1CDOA 1UJ2A 4TM7A 4NDZA 1NMSA 4GBMA 2ATEA 2PZFA 3CUSA 1T2VA 4LYDA 1B00A 4I3GA 3R7LA 4QLBA 3RS5A 3PENA 1WD7A 3U19A 4ZMSA 4ABYA 4MYCA 3HBJA 2AOWA 3BZUA 5IUJC 3HEMA 2QU7A 3FUTA 4WUTA 4CKBA 3LJKA 4ZIRB 2PUAA 5G4LA 1T9CA 3L4SO 3HR4A 4WOKA 3BXEA 4NARA 1UKZA 3DDCA 1S2NA 2C7GA 4G6IA 4M1EA 4RABA 5F73A 5EHZA 5HIMA 3E1KA 1YQEA 2PT5A 1W4ZA 2RKOA 1SRQA 2BGNA 3ILXA 3Q0EA 3NGMA 5H82A 1SA0B 4OJNA 4Z5XA 1EAYA 3CLTD 3M6LA 7MHTA 1CZLA 4WSOA 1N6KA 3PNLA 2G9NA 4ZALA 2P7IA 3R5JA 2ASVA 2VPZA 4RPCA 4A9AA 5FRDA 1FNBA 3KQSA 2VBVA 5LMZA 1W85A 2XB6A 1I7LA 1PW5A 2QJOA 2QJFA 1XF1A 2MIIA 2YYZA 4UD2A 1ZHHA 2A1TS 2XVYA 1T6YA 4N7BA 1K8XB 3PGA1 2WFZA 2Y1WA 3PLRA 1EVJA 2I2DA 2DU8A 2JGFA 3CF6R 2VJPA 1OH5A 4G0UA 3ZE7A 4HFRA 4JGIA 5F35A 1D2MA 2LW7A 4LDQA 1NV9A 2H4FA 2D3LA 2X0DA 2ZT6A 4XZ3A 3PDUA 1OGYA 5EC8A 4CNQA 4X63A 4F4DA 4CLOA 1LXCA 5HUJA 2H2WA 3CWZA 3A9CA 5KQPA 3HY4A 2L82A 3PFBA 4Q1DA 1ZD4A 3HO8A 1Y6FA 1OLXB 3KZMA 1ESEA 3AINA 2V7WA 1A50B 2EL7A 2PV0A 3L6BA 3O2QB 1I6WA 2X40A 1CRZA 1KIAA 2WTXA 1G291 3K0AB 1GGNA 5I47A 5K4HA 2AFHE 1LW7A 2DM6A 3LF2A 3FZYA 1N1EA 1D6JA 3ZCXA 3TNFA 1YSCA 4K40A 2NAPA 1FX0A 2RB4A 2HF9A 4EJ0A 1AUPA 2GYUA 1AUVA 1WDWB 4Y2VA 1UMBB 5JC1A 4B43A 2JLXA 3CW9A 1GZHB 5F33A 1ELOA 2WHXA 4PHFA 1DKLA 3OFND 4WBNF 1GU1A 4UM9B 2BFMA 1NQVA 1Z6PA 3E1SA 3T7JA 3DL0A 1B4DA 1EFCA 2JVKA 1T9AA 1H2AS 2FPWA 3BMOB 4ZVOA 4GOND 4LOAA 3WIEA 5JR3A 3GWZA 3S27A 2H9YA 2JRLA 5I7FA 4EY8A 5HZAA 2JAUA 4XARA 3UJAA 4M2LA 3J81k 1OTHA 4JJ6A 2Z1DA 3A0UA 1JQAA 5HIKA 4FDVA 1SIOA 2X0KA 4LBWA 4IDOA 4P0QB 2CBGA 3C45A 4BV8A 4O4JF 3EQ2A 4ZOCA 1P2GA 5E7MA 4DEYA 2HK8A 4NV3A 8ATCA 4DLBA 2XODA 5FNVF 3S81A 1EE1A 5CITA 4GKAA 2FEWB 4GUAA 4NZMA 4L5AA 1AA9A 2WQ7A 2XUOA 4UZUA 4I9FA 5DW0A 1AZSC 4KXUA 2HJGA 1YCGA 3EDCA 3H1FA 4X6YA 4CM9A 4OYRA 2LDBA 3TMYA 4UVGA 1M2OA 4CMIA 3A4YA 4WCFC 3R75A 2F3PA 2E6UX 3SC2B 5AQ1A 2I55A 3KL2A 5FTMA 5H16A 1O6FA 5KSOA 4C43A 1U8YA 4JV5B 2G67A 2YY7A 5ELXA 1Z4LA 3JATB 3MTGA 2GCGA 3AHDA 3B52X 2JVJA 3EEYA 4ALNA 1N3LA 3ZEIA 1H1DA 2VEOA 2Q1SA 4QFDA 5LR6A 1QLJA 1FNMA 2WSLA 2X9GA 3MBKA 4NNPA 4BV9A 5GJBA 3QA9A 2C94A 3QLTA 3WRXA 3VSEA 4EI9A 5DHUA 5C1BA 5I9LA 3E9YA 1T0UA 5L3VA 1Q20A 1Z5VA 3UJ6A 4Z9BA 2FFBA 2H5LA 1JXQA 3GH1A 1YJNB 3VZSA 2WV7A 4DA7A 4QE3A 4JL8A 1KKLA 1KU6A 3ZD8A 5IYWA 3HKCA 3KUXA 4LGYA 1APBA 4R5MA 2CJFA 3R5KA 4PNPA 1L4HA 2LV8A 1P72A 4DQVA 1YIAA 5HW0A 2VTBB 1GGEA 2ILTA 5FWAA 2G5GX 1G3IA 2V4MA 1P7CA 3IQDB 2C7PA 1LTQA 3CISA 3W6OA 1YFKA 3V7AA 2CF6A 3I6QA 4QDJA 2H3EA 4JJ7A 1MRZA 4RPKA 4NIMA 3ESXA 3SBEA 1PWXA 2EZ4A 4AURA 3V8PA 1RM4A 4B4UA 4QBKA 1EBFA 1RHMA 4WNYA 3WDLA 5G0SA 1T4MA 2IBMA 1TK3A 1WE2A 3L4EA 4NL4H 4B71A 2FF7A 4Z9YA 4QT0A 2OFFA 4FVTA 1ZGHA 4N5IX 3H97A 5C1IA 2I6SA 1OYVA 4GOJA 4AI6A 2FFHA 5JFOA 4X24A 4EX6A 4R0MA 1U7HA 4MDYA 1P2DA 4MS3B 1QYCA 4G9BA 2HO5A 3UUWA 4C0JA 1QHEA 2FWPA 3ABRB 3DLTA 3J80A 1G6OA 3CMAB 3TVTA 3P9ZA 1G6KA 3V4FA 2IOQA 1XPRA 3H4IA 4PIMA 4ONEA 1N6RA 1Y8AA 1OI7A 3OJXA 1GTVA 1NI4B 4GVPA 4N6NA 3BJEA 5I9BA 3VVLA 5C81A 1U7XA 1A8QA 1RYHA 3MB5A 3AR6A 1QHFA 1TO1E 5EPUA 3UQZA 3B6ZA 2XZPA 1IVSA 4BOYA 4TZ0A 4QG3A 4YHBA 2G17A 3KWJA 4DBZA 2BP7A 4XKWA 8MHTA 1LDNA 3F98A 4DC0A 4MKIA 3K0SA 1IN4A 2GF2A 1K4KA 2ATCA 3V8NA 4KR3A 1Z5ZA 4EB0A 2BDUA 2EQAA 3N05A 3O3OB 4CLRB 4DIDA 1IWPB 2J3EA 4L51A 4D97A 1XPOA 1KHTA 4F60A 4Q1CA 5GAJA 3S99A 2ZU0C 3VH3A 3GLHE 3MK31 3Q40A 3G6KA 4MI1A 2BGKA 4UW9A 3VYSB 2B3TA 3DM9B 4DQUA 5DF1A 4KAXA 1G4HA 1Z0JA 3I8OA 2XTJA 4XLCA 4TS9A 1DADA 1N2HA 3D5EA 3WO0A 2GK3A 2PHZA 3MJHA 3SJCA 2Q0SA 2WV9A 3ICCA 3SEQA 3L1HA 3GGCA 4CMAA 4TM8A 3ZWOA 5IJ0B 2E6KA 1P8AA 2VF2A 3GJ5A 4P4NA 2GQ0A 1OUMA 2GA9A 2D4HA 2QRGA 4YN3A 2NO0A 4WJKB 3TRIA 4E0BA 3E22A 3F5FA 1BRMA 5JS7A 3LT5A 1ANKA 2WY2D 1VBMA 3GP3A 3LIIA 2WFMA 5AKJA 1LFAA 3LNTA 3IE2A 4I46A 1ULZA 3WK5A 3U7HB 4QSHA 1WVMA 1U99A 4MB6A 4UMEA 5H02A 1GZ6A 4PSCA 4QBFA 3RRFA 2TRSB 4OQQA 5IXJA 1WPXA 2C9ZA 3GZJA 3EIWA 3SPXA 5BSFA 2IXFA 2X8JB 4JNCA 1OHHD 2F9FA 2D0IA 4YUXA 2GBPA 2ZR0A 1KK1A 1A9SA 5IC4A 3K1ZA 2PMDA 3D6VA 1OLSB 1H0SA 3OJ0A 1I01A 3UIEA 3BBPA 5BMVF 3MT8A 2SKDA 1JFLA 2RC5A 1UOQA 2AMLA 3ZK9A 4DFDA 1DO8A 2CL7X 2YR0A 4BGDA 3SZGA 4EYQA 2KE5A 3ETJA 3L43A 3N8DA 4B47A 1ETHA 4OFZA 1V45E 2EV9A 4DR7B 3ZZTA 4CF4A 1K7CA 4LSWA 4R1OA 4AIIA 5HXAA 4LGCA 2VQSA 4DJDC 4IYRA 1DQSA 1EZ1A 1OD6A 4L3OA 1DV1A 4EFNA 5CA1A 4UOQA 5LQSA 1ECLA 1LW6E 4WBNB 2C8JA 6YASA 2NSHA 3DVLA 1MPXA 4PRKA 1H0HA 2XDWA 2AQ8A 3LWNA 4R1PA 4BXOB 3LM8A 4HQNA 5DBIA 3F0TA 1DT5A 2NGRA 4F45A 3LKVA 4FD2A 4A5SA 5KJ6A 3BXZA 5JV5A 3OW7A 2V6FA 4L07A 4J6FA 4U7JA 3QFRA 2PBFA 4O4JB 1RM3A 1N7HA 1SQSA 1CDDA 1P6QA 4LUCA 4G5GA 2HQ1A 4DLXA 4DILA 3IGFA 4QG7A 3IOCA 1XEWY 3VM6A 3JQQA 5FNVB 2IDZA 4Z99A 4BE4A 3W5CA 2AX3A 2ZTLA 4WFQA 2Q5QA 1V5WA 4YLGA 5AM4A 2RC6A 4B74A 2ZDQA 3OCWA 5IZ4A 4H0CA 5LP6A 3EEFA 1C8BA 1UBKS 3CESA 4N0QA 1BS2A 2CE2X 5G0WA 4W5WA 2R7AA 4K9SA 1W4BA 1ADYA 3FMGA 3H13A 2PMKA 3BCHA 1M1NB 1DAIA 3KSAC 1CU1A 1YKSA 4XQFA 2UXDB 1T91A 3BM5A 3NUZA 2RJOA 1F48A 2O4CA 4A0RA 4LMBA 4YJDA 3NFYA 1FPQA 4UNSA 4I5DA 1U28C 2WK1A 3DOIA 1TRKA 5FV4A 2QPLA 3D3EA 3N86A 5TF0A 1BD3A 4KODA 5BORA 4CIAA 3T3NA 4JI8B 4CTOA 4H35A 1DV2A 2KB0A 4I4IA 1YULA 1EX6A 2NTVA 2ZM5A 1BMDA 2PT7A 3E27A 4HZUB 5IPFA 3X2FA 1CDZA 1DJNA 1ECGA 1UC5B 3E1YE 2CDRA 1DXYA 5JJCA 3RREA 1Z4OA 3O4JA 4XWWA 1GTJ1 4DR3B 4LTDA 1KQNA 3QI2A 5I6DA 2QTVB 1E2QA 1CNEA 1GPAA 2I62A 2OC9A 3MRSA 5DW3A 1JN0A 4MVJD 1GPNA 2XQFA 3TVDA 3PUHA 3AV0B 3OPYA 5LB4A 4LXYA 4BTVA 2O7NA 2OVFA 3SBOA 1AQJA 4AY2A 1JJAA 3WGQA 1XRNA 3AXTA 4M0FA 5C35A 3DBOB 1NYLA 2BZSA 1IVYA 2UUOA 2EW8A 4INPA 1CVLA 4PLVA 4J0HA 4ZVNA 5KJEA 2ZXIA 3BIXA 3TSOA 5C7YA 5CCEA 1PR5A 2R6DA 2BH2A 3C5WP 1WB4A 2J46A 4U3JA 3A70A 3KB1A 1Y3FE 2ZJ7A 3D4PA 3LPCA 3RFFA 2GT1A 1HZZC 2HNAA 2R44A 4LZPA 4BLVA 2E1BA 2PUVA 4YV0A 4HAVA 5ESXA 5A4AA 1AT1A 1YU6A 4Y6OA 3UCXA 1ZONA 3EWNA 3I9NA 5LIPA 4QPCA 4JIGA 3L4KA 1WLSA 1WETA 4CM8A 2UYQA 4MPPA 1TUBA 4ARIA 5HQ3A 4NABA 4OXIA 3OESA 2BTQA 3MJRA 3ZD9A 5L3QA 1X42A 1R9JA 1SVSA 1I6KA 2X86A 3Q2KA 2NYRA 2YQ5A 3HZOA 3JQGB 4V3BA 1YTUA 1TA4A 3X1MA 1P1RA 4QDOA 4OGKA 3GARA 4YWHA 1TK2A 1V11B 3EX7C 2G9QA 4WVFA 3R3WA 1JBEA 1XALA 3PCXA 4KUHA 3WL8A 3DFKA 4CN8A 4ECEA 1CX9B 3GIWA 4AY4A 1UK8A 1UMCB 3ENKA 4IQ0A 3RJZA 3RUCA 1CR6A 2R11A 3AU9A 4JXKA 4MUFA 3W5SA 1JHRA 4KK3A 3CINA 3ANXA 2IEGA 5A1TA 3HUDA 5ICFA 3BH0A 3SHQA 2IOFK 4B80A 5LQCA 1Z6XA 3LUGA 3REQB 1L3CA 4PGMA 4Q82A 1YCDA 3CCCA 2H8KA 2W00A 3DHEA 3GHYA 4GLOA 1F2VA 3JYNA 2CBXA 4KH0A 1U2DA 2CUKA 4YJFA 5IJWA 3JX9A 1N2GA 2ZP1A 2OG1A 5TQ0B 2Q0HA 3F7MA 2XMZA 4Y18A 1OV4A 1KFJB 3GU3A 1WX1A 3EG9A 1E3SA 1I2DA 2DSNA 1Q3KA 3K6KA 1PS9A 1W35A 3F5SA 1S2LA 3DKKA 3HKDB 1VE9A 4B6PA 5KOJB 4XH9B 3ZU2A 3CIOA 3JAWA 3JVIA 2J4CA 1Q86D 4LISA 3RJ5A 1MKYA 1Q91A 2B21A 2WF7A 2XSZD 4GYJA 1N7GA 4WCFB 2JFWA 4DG5A 1UFQA 2XNDD 1DEHA 2ZJAA 3DWGA 1WHSA 2XJ4A 3IMFA 2A5YB 3DW3X 3TE6A 4BMPB 1N32B 2Y1KA 2COKA 3K70C 3K72B 1Z07A 5JBIA 3P20A 4J0IA 2CVFA 2HPHA 4MCAA 4UVDA 5IH3A 2C2KA 2FHSA 4JLDA 1FTQA 4OU5A 5LLSA 1JR3E 1W0CA 3ZY6A 5LUAA 5KTTA 4Q4LA 4RPLA 4Y6LA 4BLRA 5E3JA 3EXEA 1IUKA 3G6EB 4GZ5A 4GXTA 3QVXA 4BNUA 2VWHA 1FVFA 1P6XA 1V5IA 3AH8A 2NUPB 4YEDA 3PQCA 1PGPA 3SEZA 1W94A 1UC9A 4G85A 2P3SA 2IZ7A 4NK4A 5DM60 4C2AA 4B7XA 3MTQA 1NBIA 3GRCA 4DSZA 1JYEA 1SOAA 2A94A 1IK6A 3ACCA 1QRRA 4IDNA 4XCVA 4GBJA 1QCYA 1OBFO 5JAQA 5U4QA 5AVRA 3WZ2A 1TGVA 4G7XA 3QVMA 5HM8A 4KLNA 2MSKA 5BSTA 3I56B 4Z0PA 4F5DA 5DEOA 4KN8A 2M9MA 4W6QA 3NH9A 4RESA 2RK4A 1C81A 1MORA 3M9XA 4MGKR 1C8KA 4XQ0A 5FFNA 821PA 4LK3A 4HUQB 2BFFA 1DG9A 3SAJA 4X07A 1N2CB 5F1YA 5TPWB 4XLAA 2P8SA 4G4IA 3VXKA 2CL0X 3F3SA 2BBOA 2RG1A 2YC2C 1U11A 4F92B 1H22A 3C1AA 2ZB7A 4BFSA 1JLHA 2AT1A 1V6SA 1JR2A 3KOXA 3EYAA 5FD8A 1U98A 1HDZA 4E4TA 3MMNA 4YUAA 4NBWA 1THGA 3IOMA 3UVEA 4BNMA 4GG1A 1ZO8A 4E2WA 4NYIR 5BQFA 1HNXB 3L7NA 5BOSB 3H6HA 1QLHA 2CDAA 1DJPA 3GX1A 4NEHB 5BVHA 1D8TA 1GA6A 3ED1A 4OTZA 4PTZA 4OI1A 2IIBA 1O6GA 1H0RA 2J09A 3OLVA 3TNYA 1DUIA 5KNBD 2IYWA 1RI5A 3JWJA 1YS6A 2O2IA 3HNRA 3SE0A 3H75A 1CK4A 4O2AF 3SLNA 1KZYC 4WGGA 1UP6A 1LY1A 1WHTB 2ZSHA 9LDBA 4H3SA 2HWKA 1VKRA 3HJUA 3ORRA 3NTUA 4JJ8A 4HNUA 7GPBA 2AUNA 3AVOA 3ZXSA 4BBAA 3Q8XB 1VQKB 3H1PA 3O92A 4NCXA 4RL6A 5HR5A 2JIZA 3OEEA 4EPYA 2E85A 3KCNA 3RK4A 1N33B 2GZ2A 5JMPA 3AR4A 1TQ4A 1MA3A 4Y6QA 1KC8D 3LUDA 3ND5A 4DLRA 1JMKC 1FUIA 5M04A 4FYIA 2X4IA 3SGLA 4EJFA 4RIGA 5KKAA 3B1KA 4EM6A 1A04A 3DKVA 3LDHA 1ICIA 4BFXA 2C2MA 2DFNA 5TQ2B 2VHCA 2ZRKA 3AILA 1Y5MA 1QXSA 3INRA 2IU6A 5JFGA 3IPXA 4EJSC 1E20A 3ZHRA 5MDHA 4H1HA 4RPIA 4TQ9A 2Z09A 1V1RB 1IG0A 4CCSA 2VA8A 2ISQA 3FOZA 1TYCA 1DS6A 3OCJA 3WK6A 4R51A 4Y6PA 3V76A 4BL5A 4JT8A 3ADBA 3PVZA 5CVTA 5FIUA 3WDSA 2W0SA 3NR2A 1ULBA 2H5JA 4V0RA 1T4CB 4A2PA 4ZVMA 2FKNA 3EUFA 3IVCA 4WINA 2VQDA 1QVRA 4V2IA 1RWQA 5IJAA 5CDGA 3DEJA 4BLQA 3OOSA 3DZCA 1W52X 2HXYA 5JQGA 1IVNA 2Q1WA 2REXB 5NLLA 1UBCA 5JI3E 1BFKA 1BIFA 1EWRA 3SD7A 5JSZA 3GELA 2QM3A 2Q6VA 1T5IA 5H9VA 4NPHA 1G7RA 2NPIA 3O1LA 3OMLA 2UZ1B 3DL7A 4C08A 5HJ5A 4Z4YA 3PVDA 2YFHA 4I19A 4HYYA 4UEKA 2O7VA 2W4IA 3JYHA 3UUFA 2A14A 2GN6A 2QZJA 4XLEA 1B8VA 2PEZA 3SU8A 2QXUA 3D8RA 5F4JA 3HY3A 4ADSG 3OPXA 3NBYC 3QE4A 1W7AA 3EZ7A 3FCUB 3DZIA 4ER7A 1BZYA 2WSYB 1K0FA 4PHHA 2Z6BD 3S40A 3ZBPA 1QE3A 1N7IA 5G3YA 1P81A 2A0UA 2JFHA 1SHLA 1N9ZA 4EYGA 1YR7A 4L85A 2CVPA 3GN2A 3WHIA 2DPGA 4I8DA 2W70A 4TKVB 4AIRA 3H86A 3CD6B 4JVNA 1NP3A 1PD1A 2LWIA 1SXJA 3EBLA 5AM1A 1R0CA 5HYVA 4NOJA 3ADDA 5D7NA 2JFNA 4TRMA 3D7LA 4WACA 3VDXA 3PC2A 1DO0A 1X87A 2CNBA 2R00C 2CFOA 1YCHA 3SNKA 1YGYA 1P73A 1NXQA