1T6XA

Crystal structure of adp bound tm379
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
287
structure length
266
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords riboflavin kinase/FMN adenylyltransferase
total genus 69
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6xA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6xA01
1N06A 4EFKA 3CA8A 3CTAA 5FNZA 1NUPA 1MC1A 2RE8A 4QREA 4F3RA 1H3EA 2QTMA 4I6GA 1NP7A 2J5BA 3IUBA 2WQ7A 4PBSA 1KQPA 1ULHA 3IH5A 2X1MA 2A88A 3UK2A 1YUMA 4YP6A 1KR2A 3G59A 1DNPA 3H9BA 5TS2A 1N1DA 2HGZA 3ND7A 4PY2A 4DDKA 2E89A 1U3DA 4HPWA 1TEZA 2AZXA 1M8GA 3IVXA 2Z08A 3FETA 3PXUA 4YP7A 5DEOA 1Q19A 1GTSA 1S4MA 3ISJA 3CVUA 2WQ6A 2CFOA 4EG8A 3ZJUA 3A04A 1GZUA 1NSYA 1SURA 1N3LA 2IELA 1RQGA 3FHJA 4MUKA 3IMGA 4I6JA 3AFHA 2VBUA 4HJXA 1XNGA 3D6UA 3X1KA 1JHDA 1EE1A 3RBAA 1YIDA 1IQ0A 3JXEA 1P4MA 3Q4GA 1N77A 4ND7A 1Y42X 2JAXA 4OJMX 4CT0A 1I6MA 4MW5A 3TQIA 2ZP1A 1EUQA 2YY5A 3IODA 1Q11A 4EGAA 3RJZA 1M8PA 1MAUA 5DK4A 1COZA 2PIDA 4ZT4A 3AG6A 1U7XA 2DPLA 5A88A 4G5YA 3SYTA 4UZEA 3UC5A 4UZFA 1LI7A 2YWCA 2CV2A 4JYZA 3AKZA 2AG6A 3X1MA 2V0CA 1WY5A 2PXHA 4ZCTA 1KP2A 3CLTC 2QJTA 1N78A 3IMEA 3IVGA 2QJOA 4KR7A 4L2IB 1N75A 1D2RA 4DLPA 3G5AA 1KH2A 1MB2A 1MBZA 1O6BA 3KFLA 1QJCA 2ZUEA 2D13A 2QJFA 3Q10A 1EUYA 2WSIA 2R5WA 1JIJA 1FFYA 1K4MA 4DE5A 3SEQA 4NATA 1WXFA 3SZ3A 2TS1A 3ZJVA 3PNYA 4F4HA 3K9WA 1PFVA 2CYCA 1EFPB 5TRDA 1IQRA 3A4IA 2QUIA 4EG6A 1K4KA 3H9CA 1IHOA 5LLTA 3HFJA 1KH3A 3H99A 3Q12A 1OD6A 4EG4A 4J76A 2E21A 1UFVA 1NUUA 1EFVA 4MW1A 4MW0A 3P0HA 4OUDB 2P3MA 1OWOA 5KCMA 2VBTA 4CQNA 4QRDA 1Q77A 3FOCA 3K32A 4ZCSA 3UMVA 4GRIA 2X0KA 3KT8A 1JEEA 1M8JA 5EKDA 1I6KA 3PNVA 1J20A 3LOQA 3CLUD 1R6XA 4MVCA 3KT0A 4MULA 3INNA 4BWVA 4MW9A 4Q93A 3P52A 4ZCPA 4ZT3A 2J08A 4ARIA 3LCJA 3IOBA 4MW4A 1PFYA 4JXXA 4YBRA 1QU2A 2V0GA 2VXOA 4MUEA 2WB2A 4MWDA 3VRHA 2OYNA 1JZSA 3FY4A 2D5BA 1NUSA 2H29A 2CV0A 1TYBE 4PBRA 1X8XA 3ZXSA 2E0IA 4U8HA 2A1TR 1PFWA 1WKBA 3H05A 1LW7A 2PFSA 5K0SA 5F23A 4HJRA 1U7DA 5FO0A 1H3FA 1QRSA 4ZT2A 1P7PA 1ILEA 4HK4A 3L92A 1HYBA 5BNZA 4G5FA 1U3CA 1QU3A 3N05A 1T9GR 1BS2A 2OQ2A 3P0JA 1NZJA 1J1ZA 1EXDA 2DEUA 1PG0A 4CDNA 1KP3A 4MWCA 3CLSD 3CLTD 2G36A 3U1VA 1F4LA 1WXHA 3RHSA 1GPMA 4ZCQA 1NUQA 5KHAA 1JMVA 1NI5A 1ZH6A 4TS1A 2O8VA 2DUMA 3DPIA 5DB4A 5IHXA 1IH8A 2PZBA 4WSOA 1YULA 4EG7A 4AQ7A 3G6KA 5K0TA 1Q9SA 5TGTA 4A91A 1IVSA 3MLAA 1O95D 2EJCA 2YWBA 4FZJA 3TZEA 3L93A 1JIIA 3N8HA 1T9GS 5JBNA 1M83A 3HGMA 2VBVA 2A4MA 4R2LA 1G8FA 5TEWA 1F7UA 1OWLA 4XFDA 2JA2A 4MVWA 4DNXA 1K97A 3CVVA 1N2IA 5AHWA 3UOWA 4KPUB 4MW2A 4WNYA 1O0CA 5DASA 3TQOA 4NDAA 4YP5A 3ELBA 3COWA 3KT3A 2A86A 1I6LA 1GLNA 1B6TA 1T6ZA 3MMXA 3MUEA 4JFAA 1JECA 1EJ2A 4MW7A 1F9AA 1GN8A 4K03A 3CLRC 2QUJA 4ND6A 1LI5A 3GLVA 2O5RA 1KH1A 5LM3A 1OWMA 3IMCA 3UY4A 2GKSA 1MAWA 3IOCA 2HZ7A 4MUIA 2DETA 1TYCA 3IUEA 2CSXA 5HUHA 5J58A 1PG2A 1O97D 2GOYA 4JZYA 4R2MA 2X1LA 2AKEA 3FNRA 1O96A 3X1JA 3IDFA 4XFJA 1VLHA 3PRHA 2A84A 2DERA 1JZQA 1TQ8A 3ZXIA 2JANA 3PNBA 5H16A 2J07A 2DLCX 1N2OA 2A1TS 2B7LA 3MXTA 1M8KA 1VL2A 4MUNA 4L2IA 3QTTA 4E1AA 1QNFA 5HG0A 1CT9A 3ZJTA 1ZH0A 3FDXA 2PZ8A 3TS1A 2IP1A 1TYDE 4K0RA 3OTWA 1MOPA 3NV7A 3GUZA 4DJAA 3FI0A 4KPUA 1O95C 2CYBA 2BYTA 1NB9A 3ND5A 4ZCRA 1KORA 2Z3VA 1G59A 1O97C 4MVXA 3TZLA 1M8FA 1XNHA 1WZ2A 2PG3A 1YUNA 3BNWA 4KKVA 3QE4A 4NAHA 2VTBA 1T6YA 4MUFA 4KR6A 1N05A 5HUJA 1O94D 3RK0A 2IJGX 4MLPA 5KWVA 1WXIA 1A8HA 4P2BA 4RPIA 3HV0A 1GAXA 5FO1A 3FG9A 3BL5A 1OWPA 1T6XA 4MUJA 4ZT7A 1FYDA 4MQ6A 2VBSA 4MWEA 3S3TA 3AG5A 3N9IA 1GTRA 4ZT6A 1H1TA 2NZ2A 2QTNA 2RD2A 1OBCA 2OV4A 4EG3A 1K92A 1O96B 2J09A 4NX2A 1O94C 4I6EA 1NB0A 3VGJA 2QUHA 3FIUA 1QRTA 4MAFA 3RFFA 3SP1A 2ZUFA 1R6UA 4S1OA 1G8GA 3COVA 1N2GA 4X0EA 1MJHA 3CLSC 4DDMA 1O5TA 4KR9A 1XNJA 3CLRD 4PBTA 1TFUA 4MWBA 1QQTA 4ZT5A 1WOYA 1F7VA 3IVCA 3HL4A 3RK1A 1NUTA 1KAQA 3C8ZA 1KQNA 1QTQA 4U63A 1TYAE 1YIAA 1IQUA 3FWKA 5J59A 3F3MA 4G6ZA 2BTEA 4MUGA 2DXIA 3N2YA 2A1UA 3CVYA 1ZJWA 1WJGA 1OWNA 1N2HA 5TEVA 3OP1A 2PZAA 3MLBA 1JIKA 1VBKA 1MRZA 3QTBA 4U7JA 1WXGA 2NSYA 3ZUGA 3A2KA 4EF6A 1NURA 3E27A 4NAUA 4MW6A 3D6VA 1OBHA 1IRXA 3CVXA 1JILA 5A8AA 1G8HA 1Q15A 4GU5A 1I2DA 2C5SA 5IJXA 3ZIUA 3CR8A 4YMIA 3ILVA 3NBAA 2QUKA 2A1UB 4MUHA 4JXZA 1J1UA 3AL0C 1J21A 4EG5A 1KKUA 1EFPA 4XSVA 1O0BA 3COYA 1WXEA 3IOEA 2CUZA 4QBTA 1V8FA 2CYAA 3DV2A 3HMQA 1N2BA 4MVYA 3SEZA 5H7XA 1IFXA 3ND6A 1N2EA 1N08A 2XRZA 2A7XA 1J09A 1JEDA 1EFVB 3GMIA 1QRUA 3NBKA 4OUDA 2X3FA 4ARCA 2I1LA 2EL7A 1ZUNA 3DO8A 3H97A 3I05A 1WQ4A 1NYLA 3AIIA 1PFUA 1JGTA 1WQ3A 3COZA 4J75A 3TNJA 4NZPA 5LFAA 3A05A 4H3SA 3CVWA 1MB9A 2VTBB 1N2JA 1U0BB 1VBNA 2HMAA 2QTRA 3DLAA 1X6VA 1XJQA 4R0NA 1YI8A 1R6TA 3VU8A 4CDMA 3KT6A 1M1ZA 4DDHA 2E18A 4RUKA 5A89A 1J70A 1H3NA 5J5AA 1KQOA 2YXNA 3HZRA 3SZGA 1KAMA 4Q16A 2CV1A 2Z09A 1VBMA 2DR2A 1N07A 2GM3A 3LE8A 2H2AA 1V47A 3FH0A 3M5WA 4EG1A 4AS1A 3ZGZA 2XRYA 2CT8A 3SDBA 3P0IA 2D54A 2J4DA 3CLUC
chains in the Genus database with same CATH superfamily
5KJFA 4YAUA 2ONKA 5B2EA 2IEGA 2FEKA 3D8NA 2X15A 4PGAA 2R6HA 4MEBA 4N0PA 1BROA 1USIA 4RW0A 2OOSA 2PT9A 4BX8A 4ENWA 1NP7A 2HM7A 4D3SA 3QITA 3JAMA 3GRCA 1S89A 3ZUPA 4YO7A 5CW1A 4EMUA 4Y2HA 2JB9A 4MS1B 1NMXA 1FTYA 4MPJA 5CDHA 2VHTA 3CT4A 3ESYA 4FOPA 2FR1A 1EP3B 1RBZA 2W11A 3R20A 5A04A 2YIDA 2RHDA 5EGNA 1VYUA 1ZGJA 2VTEA 5D8DA 3ZHZA 3ZCVA 1HORA 1SBNE 1W5TA 2E6UX 1XPUA 1FMTA 3PPIA 4PY2A 4PIPA 2E89A 4HN9A 1U3DA 2WVAA 3KAJA 3NH6A 1QFSA 3AETB 1H2WA 5JO0A 2PJUA 2Z08A 4OGWA 3ANNA 3E9QA 3NGLA 2VAWA 2W4QA 5DN6A 3IUSA 4PAOA 5DBOA 1JG7A 2WQ6A 2BBOA 3F4KA 1DIHA 3ZJUA 3JQEA 2QWXA 2O7NA 1THTA 1U2TA 1EFRD 1NVVQ 1I14A 2H8KA 3OEED 4YQEA 5BNFA 4BLPA 4BLSA 1FX0A 5IYPA 3J81k 3GAMA 3SSAA 3RWOA 4CMKA 3FF1A 1APBA 4QGSA 5BWOA 1PE0A 4GLOA 4WN9A 4GPBA 4LFCB 4IQFA 4JD5A 5SV2A 1EPUA 5AUQA 2O8FA 2FWRA 5KWEA 3MFQA 2N75A 3W8EA 1N77A 1ZWLA 1PL7A 4CT0A 3H9JA 5ESXA 2HR1A 4EYOA 3UUFA 3E82A 4MW5A 4X1IB 2ZP1A 1QJ4A 3TQIA 1N34B 1P31A 3IAM1 3WJ1A 3CBQA 2O50A 3AR8A 3PE6A 5A4FS 1VYVA 1D2AA 3BJIC 4HNAA 2HA4A 2PIDA 4XB1A 2IYEA 1AMUA 2QJRA 3UJ8A 2ZRDA 3QMWA 5FKJA 2MHCA 1LXCA 2BEUB 2WT9A 3IBTA 3QX9A 1GPNA 3CG4A 3F46A 4IM7A 2OORC 4QPZA 1T6BY 5EXXA 1ISFA 5F73A 2Q3MA 4Q00A 2BFDB 1ORRA 1YDEA 1CQIB 4KR3A 1QKIA 3TLEA 2QLJA 2WIKA 4OXIA 3K96A 4DDUA 1XN4A 3BMQA 3EA4A 2ZR7A 4QQ8A 4B4UA 3M6WA 2CBXA 5BN3B 4ZODA 1E6EA 1V7ZA 1XRRA 2ZT7A 3EXFA 3HHPA 1WA5A 4Q9NA 3E03A 4AWBA 2EQAA 3EDQA 4JU8A 2IS1A 1RFGE 3C5EA 2QS9A 3JTEA 1A1VA 1F8GA 3FOFC 2ROQA 2JCYA 2VTDA 5B12A 4RULA 4KPEC 3SWWA 2I8CA 3VKGA 5A3RA 4DN6A 4IGKA 4LJ7A 3HVRA 3LY9A 4JOCA 1Y1KE 5AJHA 1X1SA 4EFDA 1XDWA 4AW9A 2FV8A 5JR3A 1C5KA 4BVAA 1CQXA 1DKPA 2XXAA 1P6XA 4A6DA 1SUCA 4TSFD 3GJ8A 1YU9A 3MOGA 1CQIA 1RQ7A 4UAVA 2Z5VA 3NHFA 4NNPA 4PSKA 3BMCB 3I9V6 4L78A 3BGWA 1PFVA 5K8UA 2N1MA 3X1YA 2JJ1D 3AEQA 3ZQJA 3JRXA 1G21B 1IQRA 4J43A 5A9TA 4JLKA 4HMPA 4OPSA 2CJXA 2FZLA 3KZVA 3LA6A 3HFJA 1UPAA 2ISQA 3K8OE 3R9XA 1V43A 2BCEA 3RRYA 1MOSA 1OD6A 2WTMA 3EGOA 1DC6A 5F78A 2H52A 4O29A 2JFQA 5IBRA 1QG0A 3N6VA 1V0EA 3L4EA 1E1MA 5EA2A 2FHSA 4D02A 2ZBVA 2QP9X 4Q3LA 1OWOA 5DI3A 2Y71A 3FBGA 2VBTA 2IEZA 3E7XA 1IU9A 1LCIA 2R8RA 2QRNA 3FVTA 3Q3GE 4AMYA 5JNWA 1IZYA 1BOFA 3R77A 4OSPA 3CEPB 3Q8WA 4NCNA 2H5IA 2XE7A 3JVUA 2GEFA 4JELA 1ECPA 2E5FA 3WLMA 1PD1A 3I2FA 4ZMRA 2YFYA 4JQYA 3RLIA 4XDHA 1XZMA 4TKZA 2OKGA 3K09C 3H3XA 4J7XA 4XTRA 2V6FA 2ZJAA 2ZYSA 2G0NA 1VMEA 1QUEA 2O5VA 1Y89A 1R8YA 2Y27A 1P75A 5JSKA 1YA4A 1Z17A 3OZEA 1E9EA 2IQ5A 4CKBA 3ANTA 4MUEA 3O2JA 1LQ2A 5JNRA 3D0OA 3B78A 4PC6A 1NV9A 1XTIA 1IM2A 4GOMD 4BKOA 1VKOA 2OYNA 3E61A 4KIWA 3IP6A 1DUSA 4HX5A 1W36C 1W4CA 4FLEA 3W4KA 2NTVA 5JAHA 5FTMA 1V95A 2RGNC 4HGOA 4RC9A 4RSGA 4HSEA 5KNCD 2ZPTX 1MC8A 5AUNB 2F90A 1U2PA 4HMQA 4JKYA 3RS7A 4HWKA 4P82A 3RJMA 2PRIA 4HTFA 5EKTA 2F7SA 4RPBA 4XKVA 1ZHHA 2GN8A 5HCUA 3JWIA 2Y4NA 3ZDAA 3QEMA 1IN1A 2C07A 4Q24A 3IT1A 4MSUA 1BIFA 3RYHA 1C30B 1LTKA 2OCAA 3QPVA 1F0YA 3OJCA 4EF4A 1YR7A 2YASA 2FPKA 4J0GA 4JA2A 4XLLA 1KVUA 1WHSB 1QU3A 4KDEA 3RVRA 3D3EA 2CVHA 2JJMA 4ZCLA 4GWKA 1K7YA 3SJ7A 3L7BA 2OFXA 4FIZA 4LSWA 4V1CI 3KKQA 4P53A 1XZJA 3LDGA 4RVGA 1X3LA 4CXMA 4OP3A 4KBFA 5DCLA 3RC2A 5CB8A 4URVR 1HDIA 2HK8A 4JVLA 1YK0A 2O8DB 4M0FA 5FJIA 1U4OA 3DO5A 1EGHA 1RTTA 1OCEA 1S01A 3PD7A 1PT8A 4MR9B 5BQOA 1NI5A 1ZH6A 2C2ZA 2JNWA 4PU0A 1TKCA 3V7AA 1BMFA 1J24A 2Q99A 1HH4A 3LPNA 3MINB 4EG7A 2QORA 4EGQA 3OD1A 2EDAA 2JGNA 2AMLA 3OX2A 1GZVA 5KKNB 4EB8A 1YT5A 5CBKA 1N1GA 1A5SB 4HWSA 2F9LA 1DMSA 3L93A 4ZHQA 5IK2D 3EEQA 4TYYA 5B7QA 2HTEA 1SK9A 4IQ0A 4ESOA 2BGLA 2RIPA 2VBVA 4UHCA 3TIXB 4D9JA 3KQHA 2W8BB 3OLZA 4A8TA 1QPZA 4W6ZA 3Q85A 4AYTA 2I1WA 3L4BC 4MVWA 4NBSA 3NT2A 4INAA 3KSMA 2R86A 4KNVA 5L8VA 1ZNQO 5HF9A 3G05A 4AXXA 1GPWB 1DEXA 3O84A 4LXYA 1T9KA 4BNKA 1HRKA 2ORVA 3DOHA 3QUSA 4Z7OB 3A26A 1N36B 5L45A 3RT9A 1R8SA 3NHZA 1Z5PA 1N7JA 4ZYZA 3H1BA 5KYWB 1F38A 3O93A 3O8CA 5A05A 2A9JA 3GDFA 3OIDA 4DUPA 4N5DA 2O2ZA 2FW6A 1G5QA 1W0JA 1R5OA 1UQTA 2AN5A 3QW4B 4XVHA 5C1PA 1W59A 3DTYA 5LM3A 4KFUA 4W9NC 3WK4A 1OWMA 1V9SA 2WZCA 4HYTA 1DG1G 2GFHA 5COQA 1SC1A 2W8BA 3F6EX 4TV9B 4DIEA 1JT2A 3SEAA 1JG6A 1W34A 1X15A 4UOZA 3L7NA 1TYCA 2ZBQA 1GGNA 2NZYA 5AKHA 3FPLA 3KOZA 4J0DA 1VLOA 3OZ7A 5EZSA 3RQIA 3DVSX 1RQNA 1DUVG 2OCGA 2W2XA 5G3YA 1XELA 4EAQA 1XTSA 3KQYA 3FAZA 5CVEA 3KOXA 1QR2A 1R0KA 1MHPA 2B98A 1QAQA 5CYPA 1RLTA 3K31A 4L4UA 1RM0A 2RAPA 1C8BA 1VE9A 2J07A 2JFBA 3A36A 3CIFA 1B6RA 1XMXA 2DFVA 2JHAA 3NHRA 4KAFA 1ACMA 1QQ5A 2X7JA 3K1AB 3M83A 3N6XA 4BP1A 4RPKA 4RWEA 1BQEA 2WFZA 3RC1A 1SKYB 2I33A 4IG9A 4IP0A 4KQFA 4PVCA 3WLQA 4LBVA 2PUJA 1YV9A 3LQ4A 3OTWA 5KNBD 2ASEA 5GONF 4MKXA 2FW0A 4RMGA 4AKEA 1XFDA 5BVHB 5ALWA 1N9ZA 3ND5A 4GZ6A 3VU9A 4E2XA 1A82A 2D2XA 3LKDA 5CX1A 1EH5A 1FXSA 4QO8A 4CKZA 1Q1QA 4H15A 2X9VA 3W2FA 3JAKB 2X42A 2H0QA 1TE2A 1PEYA 1OFGA 3JVIA 4X7FA 3D02A 1GKIA 4XWAA 2GMWA 3MS4A 4AQYB 2RG1A 3QVSA 4RTJA 3BKXA 1E6UA 1K3FA 2HCFA 3KUDA 3AVWA 1NNSA 3IT2A 2Z83A 4FMDB 5IMBA 4C4AA 4CM1A 1TCVA 2B20A 2O3JA 2HHAA 3OX3A 4JNCA 2WF7A 3QUBA 2IWRA 1DEKA 2WJ3A 3DEJA 3L9WA 5JTTA 2PLRA 3IIMA 1X7HA 3IVRA 4ND4A 4WVLA 4DLZA 4BQNA 4YMGA 1GTRA 1NVVR 5DXAA 2W2NA 2AJBA 3AJ8A 3AM3A 5EQJB 3I9NA 4FOLA 2Q28A 4M87A 2YCLA 1HSOA 3GQVA 4DOMA 2RD2A 1DELA 4RD0A 4A10A 2XB4A 2JLXA 1HE4A 1ZK3A 3EASA 3V2IA 5JQWA 3NDIA 4A0FA 1M0WA 5IYWA 2WU3A 3LBFA 5G1NA 2FN3A 3R7DA 3FMFA 2NV6A 3CX7A 2XWQA 1LQTA 4NYMR 3FIUA 3I4CA 3E4DA 5AI8A 5AJZA 4QXQA 3IAUA 1LJLA 2BSAA 1R6UA 5L3SB 2ZUFA 5CDUA 1QQ7A 1R6AA 3GEMA 1NQAO 3JYLA 2K5UA 4PZAA 5F4OA 4X0EA 2GEBA 3E1YE 4NK4A 4CIDA 2J5KA 4N8DA 2QROA 4HYEA 3VOAA 4Y67A 4HQRA 2ZSAA 2CBZA 3OX1A 2HF9A 4FYXA 1Z4PX 2VSFA 1PJ5A 4MWBA 4QTZA 2OFFA 4DLKA 3QJGA 1W46A 2XDWA 5IAOA 3DGFC 4E5NA 1P1CA 4FE7A 2ECFA 1Z2NX 2W98A 3AJDA 3CX6A 3OFVA 4CKEB 2W2KA 4YT4A 4IGFA 4P31A 1Z2OX 5JH7B 5FWDA 3BN3A 3CMEB 1OZFA 4J9VA 5H0IA 5BSWA 1EK6A 1YAHA 1L4MA 3GGDA 5A9SB 3ZCQA 1JE1A 1YR8A 4QDTA 3SJPA 2O54A 3BMXA 5J63A 4F5DA 1CQZA 3NGXA 1KJJA 2TSYB 2UUOA 2YVQA 2YN4A 1KS9A 2O6HA 3G8CA 3PFGA 1JIKA 2ZRIA 3HYCA 1GNRA 4K86A 4A0GA 3D1LA 1ESCA 5BW5A 1RMYA 2HBZA 4AM8A 2GTIA 3OCVA 1PGJA 2YRFA 1FB5A 3FZGA 4HEJA 3TPCA 5B4TA 4P6VF 5DIZA 1POXA 3G6WA 1Z6YA 4NZOA 1PR5A 4JT9A 4N6OA 1G2QA 2XEDA 1MX5A 3G8YA 1YRBA 3NTOA 5FPHA 2V74B 3KSRA 4UTXA 1GGJA 2WA2A 2ZW9A 1UMDA 2PMWB 1I2DA 2EARA 3A4TA 4Q1CA 1GG8A 2JLQA 3UBMA 3SY8A 2VPZA 2CVPA 3NW9A 2GSWA 4MUHA 3BZUA 4YUXA 2HJWA 3EIFA 3VU3A 3IQFA 4G56A 3LNTA 1WY7A 4FBGA 4TKMA 3TW4A 2O19A 2DBVO 3JWEA 1L4GA 2CFIA 1BFKA 2QAJA 1OT3A 1F48A 1M1XB 1VMKA 3GT7A 4LDRA 2JH9A 1HQDA 4Q4AB 5L3RA 5ITZB 1BNCA 3F96A 3O8LA 1KKLA 3PG5A 3D2LA 3ROKA 2DU8A 2WJZB 3BMOA 1Z3CA 3OM8A 1EEXB 3QVWA 2NQ2C 1XTRA 5IKEA 1F0NA 1XXHE 2X53S 2PBRA 5AW8A 1T9CA 1XRQA 3OESA 4I1IA 4WOKA 1QRUA 3KCQA 3M49A 2JGLA 2YXEA 2H1OA 4RORA 2PH5A 3GPBA 4XPZA 1E20A 3PB3A 4C2TA 4ZCMA 2BR5A 4AKIA 4Q1VA 1BE1A 3EPKA 5A1JA 4QLAA 5GZ3A 1A8UA 4E22A 1RXIA 3GLFB 1G18A 1US8A 1WQ3A 2JLBA 3ODPA 1XZGA 1ZVQA 4KVGA 5ILOA 3R23A 4J75A 4CCYB 4D80A 4YAIA 1IDN1 4TMKA 3IJEB 3ADBA 1GY8A 1LLQA 4JJ4A 4YC7A 3FHTA 1VKRA 4UTRA 4Z99A 4ZRDA 1Z28A 2Y77A 3N2ZB 1JN0A 4WY2A 1JQAA 5AXDA 1JNXX 3C16C 4RH3A 2WWGA 2VK8A 2Y9PB 1GSHA 1A27A 1XPJA 4X7BA 1DADA 4BLUA 2NV2B 4I9UA 1GG5A 4US2R 5SY6A 3UF0A 1E3WA 4DDHA 3UPDA 2V59A 1S1CA 1H3NA 5AVUA 1L5RA 4LOLA 4M8IA 2VNKA 4LRWA 5ALIA 5GQSA 1X7YB 1XL1A 3M6IA 3NPAA 4C88A 4HAWA 1IEVA 1KL7A 2ZSHA 3G13A 3CO5A 3VO1A 4NJMB 3ZHYA 1C1YA 3WP1B 4ECEA 4EYEA 5CFMA 5AN9A 3WSVA 2QVXX 4DSOA 4I55A 5ULLA 1T3LA 3N3BC 3I61A 1PYDA 2VUUA 3VU1A 3U7GA 2XRYA 3QM1A 1ML3A 1FP4A 4PICA 2VQDA 3QVKA 2HIMA 1Z4LA 4QGAA 3GJSA 1NR5A 3ZC3A 2JN9A 1XXHB 2ZSFA 3P2EA 1VKNA 5TQVA 3RHTA 4BS9A 4D41A 4YRBA 2NPFA 2LDXA 5IG2A 3PYMA 2QD3A 4QREA 3VZDA 1E32A 3PHLA 1Z47A 3PWTA 3GJ0A 2ZJ8A 2AD5A 4A2PA 2GT1A 4JP1A 4I1SA 2J5BA 4KI7A 4Y9RA 1BMFD 3GELA 5GGXA 3T4UA 4AURA 4JV5B 2WJHA 3VJMA 2J9GA 4YY3B 3N0RA 1XQBA 2CLLB 2X14A 5JI3E 4NC9A 1G0OA 3MB5A 3OEHD 4HS9A 1FSZA 4YPFA 3RIYA 1K2VN 3CX8A 5BPHA 2WWVD 2Z2KA 4XEUA 2XZTA 4WINA 3UK1A 1DAOA 4QX6A 5BNIA 1RZ3A 4DDKA 5JD5A 1S2GA 2AFHB 4ZAFA 1C9KA 3QU2A 4KAAA 4LZZA 2PUBA 3NWOA 2RHOA 3VC2A 3KKKA 3C41J 1OGIA 1I4LD 1GTSA 4RGVA 4LOHA 3V8BA 5INTA 1A2KC 2XZOA 3R7NA 4ATNA 2OZLA 7REQA 4A8HA 4PGHA 3KXKA 2AYZA 2Q41A 3A04A 3FCXA 1SCNE 1VBFA 2J85A 4BB0A 2RKWA 3G23A 1ORDA 1RQGA 6NULA 5IJ9B 6ABPA 3KQKA 1QE3A 3FHJA 1GU1A 3F2IA 1PI3A 1NBME 1TZKA 2FMFA 3IMGA 4PQYA 5E6SB 2Q5FA 4DPKA 5IVHA 4WQMA 2C3MA 4MB6A 3ROTA 1LTQA 4MS4B 2VRCA 4TKUA 5E6RB 3RBAA 4CLRB 2EERA 5IJWA 1RWNA 1UXIA 4IYRA 4I9GA 4AECA 1E5LA 3MVEA 4KKUA 1S0UA 3KB6A 4E15A 1IJBA 3EVTA 4X95A 5JBIA 1MRSA 2X4DA 3D9QX 4NAVA 1IEXA 4TTPA 1FK8A 4Y1FA 4KPYA 1TC2A 1ISMA 5FI0B 1VE6A 3CWCA 5E6UA 4C08A 1Q11A 4DCPA 1LZLA 1TQHA 2PO7A 3KAQA 3RG8A 4HV4A 1JIUA 3HLKA 5AK5A 3UFXA 2BF4A 1QOZA 2JGDA 2RBEA 4US1R 2HL6A 4KGDA 4UPDA 4L9AA 4CJXA 5ELXA 4BE7B 3MRXA 4WDQA 4LGMA 3Q8KA 2DFDA 4NARA 4RPCA 1CULC 1JYSA 1TF7A 1RPAA 3U48A 4CLHA 5AKZA 4UZFA 2C98A 1X2EA 1W36B 3AKZA 3OU6A 4RM3A 4J1TC 4PHTA 3O82A 3IQGX 2Q3CA 2F62A 4ZEOA 1XYVA 1G66A 2CE7A 5C32A 3ZXYA 4BRUA 4PC1A 2A9OA 1KP2A 2QA5A 4XM3A 5LWQA 2PWBA 4D9BA 5IXSA 1JJ2B 5CM9C 5JZOA 3PFWO 4TRNA 1SPBS 3WIDA 1NVGA 4NBTA 1C41A 4CM4A 1E1RA 3ZY6A 2A0YA 1MBZA 2YUIA 3KZOA 1M6NA 4JGIA 1UBEA 4H9GA 1RD4A 1KFBB 4FS8A 3JW8A 3K0CA 5KTSA 3TH5A 3HU1A 5HFJA 3PLAE 2SECE 3DDCA 2C59A 3OUZA 3V4LA 2JPDA 5FL7D 5TT0A 4F2DA 3SYKA 5EIXA 4X3CA 1I0ZA 1LNSA 4A9AA 3ZG6A 3B89A 4LDQA 4OQPA 1OXUA 4CBVA 1IQPA 2TS1A 2HV8A 1KZYC 3O8OA 3TM4A 3GFOA 1N3YA 2ZVQX 3Q72A 4WY5A 3QF4A 4PYLA 3IE1A 1ZVMA 4MP3A 4O8CA 2A57A 2JVKA 3DOIA 4KBYA 3H0CA 1N6HA 2PANA 3L4BA 4NMHA 4PPQA 2GHIA 1K4KA 2Z1NA 1GVHA 4OFWA 4TVBA 5LLTA 3C2QA 2ZB3A 3NATA 1Y8QA 2OXRA 2O48X 1Q0UA 3PQ4A 3Q9NA 4Z0TA 1YVRA 2E7ZA 3H2IA 5DNWA 2C2MA 1HFEL 2ZIXA 4Y6LA 5KJ1A 1NVBA 4I3FA 4MW1A 2CLHB 1HE8B 5JVDA 1QVAA 3UMJA 2YBDA 2XWBF 4OUDB 5ALFA 3B3AA 2CHGA 2EF1A 4QDOA 4X6LA 3BXXA 3W05A 4FFVA 2Q62A 1D2EA 3G2PA 3WICA 3BT7A 3DG9A 3QNMA 2FTKE 1UM9A 1XYYA 4IGIA 4OYLA 4P4SA 5EJIA 1BYIA 3A2MA 4ESEA 4YI5A 5DNCA 3CXCB 3LFTA 4FR0A 4CR8A 2JIRA 1XT6A 3NHAA 4BNJA 3I9LA 5EMNA 1LDEA 2COEA 1V2GA 3M1LA 4U2DA 5SY4A 4A8PA 4CL3A 5K7SA 3S8EA 5KO2A 1NPDA 1F3OA 2IKSA 4C4YA 2W42A 2QNIA 2R7MA 3TL3A 4ZCPA 1HR0B 1LSSA 4HB3A 3OZUA 3M9WA 1TO2E 4HUQA 3ONFA 4IJKA 4R8KA 5CFZA 1PFYA 2EKZA 3ZBPA 3GFQA 1QU2A 3L8ZA 1GAWA 4CR7A 4IZIA 3WB2A 4CTJA 5DXJA 3OZSA 4ARVA 2VDQB 2XMGA 2OGUA 4XR6A 5JWRA 4ASUA 2D5BA 2UXBB 1UANA 1OYYA 1DZ3A 5CG2A 2E5WA 4R01A 1RYFA 3Q2IA 4CT4B 2IGBA 3VZPA 4P7KA 2P4EA 2PXCA 5L7WA 2CV0A 4QU9A 4B6PA 1FY2A 1JDSA 2ZUDA 2D3WA 2ZJ7A 4D1YA 5CW2A 2IXGA 3ZDFA 1U0OC 1B16A 1FXWA 3OKXA 2ACKA 4XX0A 1BQ3A 2IHJA 4GI2A 3PD0A 1LPNA 3UH1A 4B4OA 1P7PA 5DFAA 3L4KA 1GARA 1VSTA 3ITDA 4RM2A 3SXUB 3ZYZA 5BNZA 3ZLVA 4UHKA 3WLJA 1C0EA 3RIEA 4K9NA 2HF7A 2IXEA 5HIIA 1YCFA 4PSVA 4RQBA 1VLMA 4U2FA 3TGWA 6CHYA 1QH0A 4WY8A 3QFFA 3HO8A 2GPAA 1XPOA 2C9DA 4RHFA 1A9YA 1GNTA 5EWMA 1ODFA 3DEFA 1C3LA 1E3JA 1QR6A 4G0MA 5AT1A 3MGGA 1G6OA 5G41A 2FSGA 3LDHA 4UC0A 5BNTA 1AQNA 3OOSA 4Z4CA 3D2CA 3WWPA 4IKPA 3UA4A 4MS3B 2O8FB 4K9SA 1VJTA 1N5MA 2OB1A 4QYTA 4M89A 1V1RB 2XCTB 3PVDA 5BT9A 4MQFA 2EX4A 1KBZA 4KH0A 4L5AA 3UJ9A 3FOZA 1XRLA 4C4RA 2YUTA 3OCJA 4B3GA 3E7FA 5CYGA 3CEJA 3IDQA 5LMUB 5SICE 4G0WA 1O6GA 1K5HA 3SKBA 4GD3Q 5AK3A 1EFKA 1KI2A 1HK7A 3TE7A 2C58A 1XVLA 4BC0A 2B92A 5DCYA 3ZOZA 3GWGA 1ZK2A 3AGQA 2PUHA 2QPTA 4R2LA 2IPXA 4IIUA 4BO6A 4C6SA 4HR7A 2PV0A 3HCDA 1ZZGA 4WERA 1DT3A 4N7JA 2I2AA 4REQB 5DULA 3UOWA 5K20A 4AP9A 1T2DA 1VCHA 1F0KA 3RROA 1X19A 4PLWA 4Q12A 1XLWA 2CMFA 3M33A 3OETA 1U1GA 1X8LA 2BSQA 4BNDB 4CGYA 3MQ2A 2DCUA 1SVLA 5AOCA 3AIKA 3EWSA 1CIVA 1OROA 2WWRA 1WBDA 2MSKA 1IM5A 4M98A 4IOMA 2GAJA 5I5GA 4A1FA 4D3DA 1KH1A 2Q4RA 4G07A 4UE2A 3MNFA 2I8AA 5FBVB 4XQFA 1P74A 4JLJA 1TM5E 1VL0A 2I0FA 3I5AA 4O4JB 1JB1A 4UU8A 5ECDA 4CHTA 2OBXA 4R83A 2DPGA 5H70A 4QUZA 3IUEA 1AQIA 4IHAA 3A1EA 3GRVA 3TSZA 5I5EA 4IDDA 4YTEA 4AS3A 4M3NA 3LK7A 4UREA 4V2IA 3S4YA 1UBLS 1Q7BA 4JZYA 2O7VA 1KXZA 3IYLW 1DOAA 2IHUA 2PRJA 1YOVA 4FFPA 1PZHA 2CLOB 4L4RA 1QQAA 2XV1A 5KWIA 3Q7PA 4UBNA 5K03A 4WA7A 3KEMA 5CT5A 2C31A 3B12A 3OQ1A 1VJCA 2NW6A 2V5VA 2V9CA 4RVFA 3UQZA 5KSWB 4TQ9A 5ADUS 1P1RA 1VL2A 4S12A 3BDVA 4OQ4A 5F52A 3LYHA 3ORQA 5MN6A 1H94A 4PLGA 5I4IA 2YZ7A 4D8XA 3NC1C 3PC3A 5BSVA 1ONSA 2OBMA 2OCXA 3CN9A 1AGPA 3R24A 3I9V1 3ST7A 3USZA 3NV7A 3K6SB 4IVQA 2JFNA 4LZPA 3RNLA 4PO8A 3RSGA 4F9TA 3KZ1E 1QDLB 2YXDA 4QUGA 1NI4B 5JARA 4E5UA 1J56A 2FUG1 3RSOA 4EDHA 3AYZB 4B76A 3ASSA 4BBZA 3EZ7A 1Y8QB 2ABWA 5ICFA 2MYUA 1E1QD 1T5IA 2CDAA 1O2DA 3CUTA 5A3SA 4B3CA 5J3OA 4BX2A 1Z5GA 2ZYAA 3ETCA 4H17A 3VBEA 2BGIA 4A23A 1L5OA 2K4MA 1Z6PA 2DCMA 1PQYA 2GAAA 4KWCA 1CJKC 1YVEI 4ZAGA 4XL9A 5C0OE 4OLBA 3DBLA 3R0JA 3TZKA 1P81A 2FSHA 3TWOA 2W6ZA 1VHEA 1H2BA 3CRRA 3G0IA 2AG5A 1Y7PA 1GAXA 1OWPA 2GUGA 4E4YA 3NUZA 1GA4A 1Q2XA 1WVIA 3A6KA 2EFGA 3DFKA 3JQCA 1V7QA 4KV7A 4XLAA 1QK3A 4R3WA 3CF0A 4L51A 1Z4NA 3W8RA 1IUNA 1RMTA 2E87A 4XSGA 4AZ0B 3WHIA 3EGEA 2XSZA 3FDZB 1ILWA 1RU3A 3ZK7A 1KAEA 3KUKA 5K3CA 1GFWA 5CB0A 3JATA 3BQNB 4HP8A 4X63A 3THWA 4IJUA 4WNAB 5ILQA 4I3HA 3KOUA 3PICA 3S1AA 4C6TA 4HUJA 1IYZA 3RFFA 4HDOB 3B7WA 4B1FA 3F6BX 3KX2A 3KQPA 3M70A 5IYZB 3QU4A 4NQRA 5AHXA 2VR1A 4ZVTA 5B53A 4IL5A 3BRCA 3A4VA 3PDIA 4M6WA 3UG7A 4URYR 2JAWA 1CR6A 2Q0HA 3PT5A 1Y7TA 1EUDB 1G0NA 2YV2A 3Q5EA 4YH1A 2PUGA 4DDMA 4ZZIA 4IDGA 4JLUA 4L02A 1XPRA 1JB9A 3AVVA 4KITB 4C4OA 4P84A 1QFXA 4UHHA 5H80A 1O4WA 4HDRB 3I0ZA 3ZN2A 4UJ5A 2Q1XA 2WTEA 1GGKA 3E8SA 5M3BA 1XZQA 4KXFB 1T0PA 3FKSD 4NU6A 1SC4A 4MYTA 3A8IA 3JVDA 5A3QA 1HNZB 4WX2B 4BKPA 2JLYA 2IUSA 3K0KA 4KN9S 5EMMA 5TPWA 4EI8A 4D4KA 1DKQA 3NYIA 3WP0A 1GTG1 3ZCXA 4CN9A 2HCJB 1EA5A 2A1UA 2RHMA 4J7CA 3VO2A 2J45A 2H1VA 5JNVA 3I53A 1UH5A 2D5LA 2Q1WA 2X7XA 3I55B 3C24A 2CXRA 5E38A 4P9NA 1N1EA 2YVAA 1J2UA 4X20A 2EG5A 3CKKA 4Z4UA 2PCJA 1IIRA 2VBFA 4LZJA 2HUNA 3PGVA 2GAFA 2HJHA 4V1CA 1VJSA 3ADPA 3RR2A 1ECCA 1VE7A 4G9EA 3GR6A 1CHDA 4XKJA 3KDAA 5F1OA 2YN0A 3CESA 1ENPA 2NV0A 3M4NA 3I92A 3C98A 4Y9TA 4GLLA 1V0FA 3JAWA 3QLEA 1E0KA 3EXEB 2W7TA 1DTWB 4N82A 5EPUA 1TM4E 3CSUA 2YV4A 3F97A 1IRIA 1NXOA 1PCXA 1UKYA 2FU5C 2PZLA 3DMTC 1QVGB 3W5JA 4AZWA 4REMA 2JRCA 1GUYA 2BONA 4CTMA 4A2WA 2IODA 2WJ6A 4D97A 1DO0A 3QVTA 4NG5A 2G9RA 2W0MA 2WAYA 2OGZA 5ENZA 2IDMA 4B6EA 2VAPA 4TMXA 5EIOA 4E2ZA 4CETA 1RYZA 4TWAA 3TXAA 3T56B 4RTKA 3HVKA 1PGNA 1S9DA 1CDDA 3FSRA 3ITKA 3HGTA 1KMIY 3ELDA 4I5DA 4XR4A 4D25A 3SHTA 3A6EA 4FDVA 1MEOA 3WOHA 3A3KA 2E55A 3B9QA 3VAAA 3IGFA 1QP8A 4AO7A 5BQFA 1XTKA 2HT1A 4L8GA 4QUHA 4FB5A 3KQVA 3PNPA 4G26A 5IPFA 3BM5A 4FFBA 3A1FA 3BWXA 2UZ3A 3QWFA 3WQBA 1V0JA 3ACCA 2XRZA 3W6UA 1YS4A 4JR1A 1GCAA 4JT2A 3BSYA 2EW1A 4GNRA 4ARSA 1AS3A 2GCNA 4LX0A 5AK6A 3ER8A 3DV0B 4S1VA 3UUGA 2XVXA 1UJ5A 1LSUA 4CMEA 3ZY3A 1TAUA 1EFRA 3PRKE 3U7FB 2GK3A 2JBHA 4UBOA 4BN0A 4HQOA 1TZJA 1EBUA 1JGTA 1KPHA 2DKFA 3KALA 3OM9A 4U6NA 3R9KA 4EARA 2F1IA 4PZZA 3AESB 1R6VA 1KFJB 4CKYA 3AFNA 1XQYA 4LISA 4UBIA 2N46A 5BWLA 4KQ2A 4R98A 3RVBA 2P5YA 4BNZA 2M6LA 4MVJI 3BK7A 5KEIA 2O8EB 2ZDGA 1M90D 3NV9A 4F4JA 2OESA 3QY9A 1YK1A 1E7QA 1L4NA 3D5QA 1R6TA 1D6MA 4FSXA 7ABPA 5HQ3A 4BV3A 1N6LA 5FUQA 1WPXA 2VJQA 1IJKA 4DUGA 1KQOA 1U9ZA 4DJFC 4DDTA 4QNNA 2WTXA 4HAXA 3BB3A 4L08A 1YJWB 1UOEA 3FJOA 4G0PA 2IZ7A 4PNPA 2B4TO 3TNLA 3VR0A 1BTOA 5AJXA 4Q4DA 3H2KA 4AO8A 3IMKA 3AWDA 4K26A 1RC8A 1E1CB 3EIXA 4CEIB 2G9ZA 3MERA 4WGGA 1VHQA 4K6GA 2A5JA 1QOPB 2BFOA 2EKQA 4ER5A 4L4ZA 1ANKA 4D3ZA 4Z3OA 1J9EA 1GQFA 1Y33E 2H2HA 4I6GA 2QZJA 4L4XA 2BY4A 3H9QA 3U6KA 3L46A 4MQLA 5BORA 3RRBA 4ARAA 2FPRA 4G5RA 3JARB 4OG2A 3TAUA 3VSAA 5JSQA 4H1VA 1CYDA 3IJRA 3GL9A 4IFTA 2DUWA 2DWPA 2IZ1A 5LMCA 5L3VA 4J3FA 3HKEB 4IIBA 2QRMA 3OT1B 4PAQA 5FJJA 3ZKWB 2NXWA 2A88A 5EI5A 4TS3A 3DFZA 1YUMA 3ZBTA 3ZX5A 3HBFA 2AD1A 3DF7A 2XLCA 2FMXA 4Y9UA 1TW2A 2BFEA 4RIIA 3IURA 4EB3A 4KRYA 4GPD1 3DE3X 5I4BA 2E5LB 2YTZA 3OA2A 4CKWA 1FW6A 3CX4A 3K0HA 3G8DA 2IXTA 2P9YA 2I22A 4BVBA 4ZJYA 1E9FA 3IILA 4PS1A 2VJMA 3ISJA 1ELOA 2G0TA 5F1KA 1G2PA 1R9MA 2NX2A 4LXXA 1JQJC 4YRGA 2BKXA 1CLEA 3RBXA 2IHYA 5ALLA 4ZHQB 5H4HA 1X9HA 5A4JA 3LPDA 2IELA 1W0KA 2CDBA 4WZAB 5BSGA 2PAAA 3EWAA 2D3LA 1HF3A 2V31A 4DM3A 1VGVA 1UKCA 2FG7C 2EX1A 4G5GA 1D3AA 1XNGA 4EF5A 1EK2A 1ODTC 1EVKA 2VHXA 4PG7A 2BP7A 4R69A 1NSTA 1VSQA 3EODA 1CHNA 1FF9A 1DE0A 3EMVA 1R4NA 2FN9A 3N07A 3IBYA 4I9NA 4K9LA 4NOMA 4UATA 1VYTA 4BFSA 4CFZA 2G1PA 1RI3A 1ZWKA 2QD1A 5KINB 1X94A 2C78A 2WD8A 3KYIB 1AKQA 3A1VA 4RF4A 4YCSA 5TY0A 1YOBA 2QPLA 3LL7A 4GUAA 4OA5A 3DVAB 4XJTA 2XYPA 4OO3A 2XCLA 2CBGA 1CVRA 3SYTA 4CZ2A 5I7AA 3KWLA 4QBFA 3EF3A 5KHOC 4LDZA 1TPZA 2XVMA 4AZSA 3P4XA 5DM2A 2QTAA 2QD2A 2V0CA 1JHVA 4KSYA 5D3KA 2GEJA 3AERB 4FZRA 1PP4A 2ORIA 3QMMA 2P8JA 4RPLA 2Q2WA 2QQGA 4WZBA 4MRNA 3MG9A 3O74A 1H05A 2DBQA 3Q2OA 3T7RA 1F9EA 2WVJA 4Q02A 3DMPA 2O2HA 2C8VA 2QL9A 3PDJA 3FI9A 4JK3A 5M04A 3JAWB 4ENVA 1CNMA 3KWMA 2GD0A 3QNUA 2XQVA 2YHSA 1UDAA 5EXPA 5G02A 1P2DA 2B3TA 3HVUA 4W7IA 5EZYB 4Z4WA 4A6PA 2ZIFA 1KYIA 2EEPA 2HA3A 5FR1A 2VYQA 1QIDA 1AS0A 1EJBA 5AHKA 4BX3A 5FLYA 1SY7A 2BV3A 2PGDA 2CY0A 2JD1A 4X0CA 2PSDA 1U7HA 1FFGA 1XZEA 3GPIA 4ZICA 1WB9A 4HO1X 5LBUA 4XX1A 1Y1PA 1EFPB 4URFA 3OJOA 4OYHA 5CX1B 2L19A 2BMWA 2G7MC 5EZQA 5ICGA 4BKMA 2MMCA 1JJAA 2BVNA 1R8QA 2AW3A 1EHIA 1BVYF 2QD4A 3BHNA 1GTL1 3JZFA 4ZOCA 2DFPA 4FQ5A 4GAEA 4M0PA 5TJHA 1KDZA 1DKNA 1RWVA 3EVEA 4TT3A 5BSTA 3DZCA 4EHDA 5CA0B 1C4WA 4CF5A 3WL5A 4B2YA 4X54A 5FBKA 3H1AA 1WORA 2RHBA 3QH4A 1J42A 1M2OA 3KE8A 1PS8A 3N8IA 1A2QA 1P33A 3FFWA 3MRVA 3SK0A 4JLSA 1DJNA 1M1KD 2JW5A 4ND5A 4Y6PA 1WUTA 1IHUA 4PVDA 3SKYA 5CDGA 4NJEA 3RE1A 3UG6A 1C1DB 2AXQA 1UDWA 3LPMA 3RFTA 5YASA 1GG9A 1E7RA 3BTSA 4XGNA 4ZYVA 1RWKA 3KT0A 4N39A 2UVPB 3V9AA 4Y6QA 5BWMA 4UQPA 1CZKA 4ZT3A 3GNSA 3VV3A 3TECE 4ZTUB 1J22A 2IPOA 1O95A 4LC1A 3LCJA 3EF0A 3KVOA 4V39A 3FZEA 2I7CA 3TRHA 1YU6A 3DZKA 4CL0A 1RWPA 5C18A 4OQXA 4X6YA 5JPDA 1C3JA 4XMYA 4PSAA 4P34A 1UKZA 3E6AA 2BN4A 3W4JA 3ABRB 1SVMA 3KWJA 1NQUA 2J5XA 2Y1WA 2C3YA 3LWZA 1U04A 1RHKA 2MSEB 2XWJI 1TO1E 3BILA 2ATXA 2O0LA 4O0MA 3W78A 1E2FA 1VL1A 3LIIA 5DLDA 4QTXA 3GIRA 1N0UA 3GVXA 1E92A 2BUCA 3OLXA 5FV7A 1CTQA 1N0VC 1LW7A 3KCNA 3RNOA 3ANLA 3SC3A 1QO9A 5FO0A 1A4UA 1YGYA 1QG4A 5IUKC 2AF4C 5LJIA 1UAYA 4WJZA 4ZAWA 2GXSA 5FUMA 3S81A 4FD2A 4O4LF 1CKEA 1W2BB 1X7WA 1LBQA 4N9WA 4UPVA 1GPAA 4DKXA 1GSOA 3UN1A 2HCTA 4DQKA 4C4PA 5CT8A 2XZPA 2TYSB 3VC1A 2Y68A 4RZ3A 2Y1CA 4CIAA 4MR7A 5CJJA 3I0MA 3GW8A 3CJRA 4AROA 2BMAA 4BFZA 5JH7A 1SXQA 4OOEA 1M2VA 3QELB 4IGAA 4HRVA 3E5MA 3T95A 3CCRB 2C77A 1CY8A 1KJZA 1J90A 2P0EA 4TRRA 4EKYA 4LK3A 4J49A 4NFSA 3AF5A 3TM5A 3ZD6A 1WDTA 4Q19A 1EYZA 3EDYA 4MQMA 1OA1A 1IPFA 3LFHA 1ZNWA 4Z9AA 4AMGA 1P9RA 1ECLA 1U0GA 3I04M 4X97A 5E4JA 3VMMA 2OAP1 9ATCA 3LQEA 4D0SA 1M6EX 2R3SA 4MI1A 2PZBA 3CPXA 1TJYA 2R2AA 3D6JA 4JB2A 1UK7A 4OJNA 1UQUA 4ZVQA 3A3NA 3L7IA 1UFRA 5DJ5A 5IXJA 5JYDA 1NXSA 5TMDA 1A9XB 1NW5A 2AR0A 1P72A 1SZPA 4FDMA 1WCXA 1U28A 1NT4A 3MLAA 5DNEA 1UPTA 4B4WA 1E2KA 1T9GS 5BR4A 3PIIA 3TW0A 4LRQA 1M2VB 1J23A 1YQ9A 3QELA 3FB4A 4Y2YA 3SF0A 2FFAA 3KTDA 4R81A 3OMWA 1TKAA 1LPBB 5KYYB 1C81A 3U09A 5K4AA 2Z1DA 4NH0A 1ITZA 1ZL0A 3EQZA 4KPUB 3PUKA 3KAPA 3U3KA 3E23A 4X62B 3AVQA 5IAEA 3UMCA 3RYHB 6AT1A 4AG3A 1TADA 3BIFA 5JMWA 3OF5A 4FE4A 1QIGA 3A3OA 2PBZA 4YPVA 1B6TA 5ED0A 1KOLA 4D3YA 2NP6A 1JECA 1F2UA 3H84A 3GLHE 2P1ZA 2Z58A 4BLVA 3C14C 6REQB 2WWYA 3E5HA 3F9IA 1VFNA 4LSGA 1YZFA 3FUUA 2FX3A 1SHZA 2JFPA 3BEDA 1PZFA 4C7XA 1EB9A 3PUVA 2C99A 2HMTA 2Z04A 1JG3A 4RJIA 1QH1B 4KYVA 4EX7A 3CCCA 1PVOA 2QXTA 2OKCA 1QSGA 4AS2A 1DAPA 2P4HX 2MWMA 2KS6A 4GI3A 3JU3A 3ASUA 5DTQA 1A0OA 1CWUA 1EINA 1NP3A 4Z4EA 5THXA 5LIPA 2R4UA 4R2MA 2AEJA 3BWEA 3P9NA 1XRMA 2GK6A 1YS7A 3DMHA 2QU8A 4KQCA 3CYFA 4OBWA 4OHWA 4OP2A 4X6XA 3SSOA 4XFJA 4AY3A 1PEKE 2GPWA 4ZDIA 3FKJA 1NKTA 3CH6A 3FPJA 1WCWA 1UC4B 1ZOPA 2I2BA 3FSEA 2JGDB 4NZMA 3NH9A 1OV6A 1USGA 2H5LA 1G20A 3BFVA 3BTUA 2L42A 4HZGA 4I66A 2FMIA 3B5EA 3C8DA 4MUNA 4DILA 3HB9A 4AJKA 4V38A 3JQPA 3GGCA 3IHKA 4LKRA 1PUJA 4D45A 3UBTA 3A37A 1MNQA 1X80A 4KN8A 4F72A 2A9FA 5AIAA 2PGLA 4P54A 3QE2A 4TS9A 4B75A 3KSBC 1KHHA 1ESEA 1FP2A 1QWOA 2EW2A 2F9MA 2JH3A 3GGOA 3O90A 2JDIA 4Q05A 4KYTA 4RLSA 2ZRHA 2FR8A 3H5OA 3HKBA 2CLMB 3VHLB 1KORA 3DWIA 1W85B 4JKIA 2IHTA 4B7AA 2H7XA 1EXMA 2VYVA 2J6HA 3OC6A 4D9EA 2GM9A 1DP4A 3EULA 1U80A 4RYDA 5KOHA 4LOAA 3RVOA 1S6YA 3Q7TA 2JLAA 3TBFA 2OLKA 2G8NA 1Z6QA 3GH3A 3LVQE 4GH5A 5E2BA 5T3YA 4N4AA 4NICA 4PAMA 5DGIA 2XDYA 4H18A 1E63A 1U1CA 3CRW1 4PINA 1HM5A 2IYAA 3WQSB 1LNZA 3V42A 3ZDEA 2FP3A 1UT6A 2MT9A 3KG2A 5DNUA 1ZHFA 5AXCA 1UJMA 4EMTA 3O1JC 5HZAA 3EEBA 3F5QA 3MJSA 3OLQA 4XCVA 1BAPA 3SQMA 3PUIA 2X2EA 3MJFA 1YB7A 5GZ1A 4OVKA 4OXQA 2W6MA 4OOVA 1T0HB 1Q0TA 2BGKA 4MV1A 1P8AA 2EJUA 3RAPR 2BEVB 2FEOA 3L0DA 2RGGA 3SC4A 4BATA 4TTSA 4NLLA 4BECA 1G8KA 2GEVA 1C2TA 5DX8A 3RT1A 1BW9A 1II8B 3KQOA 4DV1B 1GQOA 3DTVD 1Y1TA 2HUPA 3CNLA 3L0IB 4M37A 5C4MA 1P4AA 1YZVA 2Q27A 4UBLA 2ZJ4A 3ETHA 1KYTA 3PHJA 1M10A 4HDCA 4UM7A 1GM5A 1KNXA 2I99A 4ES6A 4I55F 3GJ5A 4Y30A 2WIAA 1QFZA 1M75A 1YJQA 5JMTA 5ALPA 3K8YA 5C3UA 1GFZA 4F46A 3UB3A 3ZS8A 4KQ1A 3COVA 3U7QB 4TLLB 3OZIA 5HOQA 5ES3A 5EVCA 3U9LA 3HM2A 1Z06A 3F2VA 4Z4IA 4S3MA 3RVJA 3CLSC 5I4CA 4KSCA 4QYMA 4PAGA 5DT9A 1KI8A 3BK2A 4Q21A 3VPCA 3L1HA 3UAZA 4CG2A 1DBQA 4PZPA 1PT9A 1WOYA 1E1KA 1MB0A 1SU7A 3BULA 2XF8A 4PO1A 3UGTA 1ESNA 1PT6A 3RK1A 4TYWA 5JAIA 2E4AA 1BA2A 3W9UA 3OPOA 1TYAE 2GHRA 3EIOA 3PUMA 4TV8A 4ZANA 4YCCA 2Q6TA 4YALA 3PJGA 1B1AA 2YHAA 3ML1A 1JEQB 3P9XA 4G6ZA 1EP2B 4LIPD 1PYOA 4MUGA 4AICA 2G82A 5ES4B 4DNTB 5J4HA 3CLKA 2VZ9A 4G5QA 3WL8A 3UMBA 3V8QA 5LNK1 1P4HA 1GL3A 5TEVA 2XT6A 2QUBA 5AVJA 1IXZA 1KAHA 1SCDA 3TZQA 4YT2A 4BE4A 4BMZA 4EO4A 1QUFA 1VJDA 3QTBA 4A82A 3D4PA 3AOEA 2OC4A 2AXPA 4RBNA 4NPCA 4QG7A 1X9GA 4MJ7A 4YRZA 3LX6A 4TSRA 5J5CA 3WVNA 3ZY4A 3Q8LA 4Q1FA 1VXRA 4R2WA 1O08A 1N5RA 2VJJA 3WMWA 1CZHA 1TLTA 3CUKA 4WOBA 2VOEA 3LWBA 3ZU3A 5FF9A 5A8AA 2G70A 1KY4A 2ZFUA 1N2CE 2C9OA 1VSUA 2XKAA 3LF2A 4KLNA 4OLJA 1UMCB 2LGJA 4E13A 3I1FA 1FFWA 1PS9A 1NVKA 5HGJA 4DLSA 5T4EA 2W6ID 5GJBA 2BGNA 1OBOA 1VB5A 2C5EA 4DXAA 1R8JA 2OOKA 1NF3A 4OA8A 1M73E 3N5KA 1A7AA 1UD8A 2R68A 3NBFA 1A3CA 2Y8EA 3IULA 4K5QA 2JHGA 3CONA 4TN1A 1UD2A 5KU7A 4LW8A 2AOXA 2ZJ1A 3B6KA 1ZIYA 3ORRA 4EP1A 4I14A 3FWZA 5KWJA 2QVGA 1O6ZA 2ZYHA 2OENG 4TL8A 3CW2A 4KVZA 2XY4A 2ZREA 4BEBA 2EKBA 1XEWX 4XE5A 1ZM7A 2IEYA 4CF3A 1ZBQA 5JDIA 3ETDA 1F5NA 4RA9A 4N54A 1VQ5B 1T0JB 3BCFA 1JSCA 2ONYA 4Q18A 3X1XA 2F8SA 4QASA 3E58A 4NR0A 5KTKA 5L9AA 3VDRA 3QWBA 5AIBA 3VR3D 3Q8XB 4M4SA 4DHWA 4L5IA 4REQA 3T7AA 2PKRA 3JYNA 5E1OA 1ZONA 4LYJA 1FDVA 1G21A 3KR1A 3NXKA 4JLNA 5CIWA 4FP9A 4YVFA 3H2JA 1K86A 5THKA 3R9WA 3LLUA 4RTQA 1CUSA 1V11B 4ZVVA 3QBEA 4NIMA 3A1PA 3OLYA 4HF7A 5LL6P 1VQ6B 4K6KA 3CUEF 2E4XA 3H5TA 3TTYA 1SAYA 2VJMB 1JBEA 4J1SA 4BNWA 1QGDA 4PYJA 3EXIB 3AR4A 2A5YB 3SZRA 4N3CA 5LP1A 3MYYA 4JB8A 1YJ8A 5IM5A 2ANBA 4GR4A 2E18A 4DR4B 4B31A 1P4JA 1CY4A 1F2TB 3RGGA 1N7HA 3PPYA 4PG4A 4EHHA 4YV2A 5KU1A 2KWIA 2PWAA 5EERA 4B83A 2Y1LA 4B4KA 1JHZA 4DIBA 3K9GA 4DMFA 4C14A 4M60A 3C7AA 3UXMA 2G4VA 4RVHA 1I51A 5GIOE 5J4YA 2O5CA 4YRPA 1LJUA 1HWYA 4WCDA 3N28A 4DA6A 2QI9F 2WWIA 3DBRB 3M6XA 4ISCA 1WTAA 3ZHSA 5ITZA 4RTSA 3NJ8A 3R4CA 2YZNA 2VP9A 4P1VA 4L2IA 1C4KA 3C3DA 4HQ0A 2GJSA 1T5DX 2PUFA 2YJ3A 2BFBB 2QV0A 3EOZA 2ARKA 1RQRA 1KMCA 1RLOA 1ZL2A 3PQ8A 3KVRA 4Z3KA 1SUAA 4UTVA 1K08A 4ZDKA 3NBQA 4LHZA 3QKSB 1RWXA 5FT9A 5IT5A 1TKRA 2IEAA 5I3ZA 4HI0E 2KE5A 5FLKA 1VSBA 3NOXA 5TF0A 1VE1A 1Y3AA 1EZ4A 1K9SA 3LDFA 2I91A 4XDYA 3M4YA 3LQ1A 4AT1A 4JLAA 4G0ZA 4DBVO 1EHYA 2QRVA 1OX4B 1RLMA 1JFFA 1JR3E 4HPWA 4PHHA 4RZQA 3ED1A 3JWPA 1Q0RA 1YHZA 3R3XA 4M21A 1WB4A 2FQYA 1SXJC 1XFOA 4KLCA 5BO5A 2X5OA 1KO4A 2ZZNA 2A9VA 4R84A 1GUBA 1UZLA 3WWEA 1I01A 4ZZ3A 3L6CA 4J7UA 2R47A 2Q5QA 4LZLA 4U0JA 4ZU6X 4DMHA 3D6AA 3CE6A 4RH0A 1NBHA 3CLVA 1PLJA 3O3OB 1HV8A 4DVGA 5JD4A 1R9NA 3ZNNA 1V5WA 1Z62A 1YS2X 1TA0A 4WXYB 3RIXA 1YJXA 1XKQA 2EZ9A 2WYRA 4HJXA 3D6UA 5E4TA 1RM4A 4OFXA 2JCVA 5IW8A 3EXHC 3WGJA 2JLUA 2I4NA 3EZGA 3IAAA 4MR8A 4X3PA 4DXHA 2NXNA 3EVAA 5EXSA 3ETGA 4ND7A 2EJVA 2BLLA 2G76A 4RF5A 1FFHA 4ETMA 3E3LA 4BVJA 2YZMA 5ANRB 1KU6A 4ZMBA 1R0BA 1W2GA 3OO0A 3L43A 4N3AA 2IYNA 1VDZA 2FG5A 5LQMA 4ONEA 3NHWA 4H08A 2CHVA 1LF5A 4FDUA 3BH6A 4RDIA 5JVDB 4EPWA 4G7WA 3D1VA 1L0BA 4BJHB 1QK4A 4KX3A 4Y2PA 1JDZA 3FLBA 3MUNA 4EUNA 3RHZA 4UZEA 3UC5A 5BR1A 3PIRA 1I3OA 2YWCA 3M34A 2A7QA 1CZUA 2EJTA 2JK1A 2NG1A 3Q11A 5E9AA 3RJ5A 4JYZA 2AG6A 3GUVA 3N6RA 1Z2AA 4EI2A 1MX1A 3RSSA 1P5HA 1TT5B 4YCDA 4ZAXA 3FPKA 1O94A 3FNQA 3KQLA 3DMYA 2FG6C 3DBRA 4EUKA 2NU8B 4RY9A 5DLEA 1W2WB 3AIMA 4M9RA 1Z56C 5A03A 3REFA 3ICQB 5EGSA 3PQEA 5BT8A 4LGCA 2LDBA 2P9BA 5LZ5A 4I3GA 1XTJA 4HEHA 1TCCA 4O5OA 4PCVA 3W2IA 4G0QA 4MYSA 4EI9A 1FYVA 1Y7HA 2H2DA 3I01A 4HADA 4QDZA 5DNYB 1QVZA 4JDPA 5KOYA 2ZL7A 2C54A 1KDRA 4X7DA 3FLAA 3M1AA 3G9UA 3PEEA 3TR0A 1N9GA 1WHTA 4HCJA 4CEJA 2O8BA 4P3XA 2MINB 4QFMA 3OBIA 4FI3C 3O3CA 5EHGA 4MAAA 4BNLA 1JV2B 1ETHA 3KEQA 3KELA 2CNWD 2WHQA 5GMOA 5J40A 1KEVA 3BA6A 2CNNA 3JZIA 5TQ2B 3IR7A 1CC1S 4RMIA 3IUYA 4R1SA 3RB8A 1SH7A 1EHCA 1U7WA 1UBSB 2JK0A 3EGDA 1X70A 2PZGA 5HF6A 1I80A 1SXPA 2H31A 3QOXA 5ALDA 4EG6A 3ND9A 1OAKA 5DDIP 1YF3A 1XU4A 1D6JA 3EXG2 5BQ3A 1LX6A 3WZLA 3QSGA 4LOJA 1UC8A 4RHYA 4X07A 2JFOA 2R7KA 3B1VA 1H9BA 2ZBEA 3EUAA 5DGDA 2Z2JA 5HKBA 2BGGA 1K88A 5EHXA 2GN1A 5LZ7A 2P0AA 1SVUA 3OFSA 2BEUA 4K8OA 5F3DA 3ASRA 3DULA 3OZVA 3EW7A 3H2SA 3KT8A 3Q7RA 3R44A 3SE0A 2XMSA 3WK8A 3WMEA 3AVYA 3THXB 2JBAA 2VJPA 2YW2A 4HXFB 3WKCA 1R0ZA 4WE3A 3QPAA 2JLWA 2TMKA 4R2KA 5IJ0B 3CLUD 2WUWE 2I6FA 5CTJA 4UAUA 3WSTA 2J33A 3P1JA 3PXDA 3S29A 1YDWA 5B1EA 1PUXA 2CN1A 3GJYA 2WKPA 4Q93A 4JVOA 4EHJA 4AD8A 1OLUB 1LPMA 4O1MA 5BOVA 3ITNA 1LNQA 3D2BA 5IZCA 1QP7A 2IKQA 3JATB 4LXTA 1KE2A 2OHJA 3B1YA 3F7TA 3GAZA 4D0LB 1CY6A 2CHUA 2IPAB 3DZBA 1Z25A 4G0NA 1VJ0A 1Z34A 2P77A 3TIVA 1BXZA 4OHCA 3ESZA 1JZSA 5BP7A 3T3OA 4MIKA 1JA1A 2AFHE 2I2XB 3QGMA 4XDGA 3LKBA 2ASVA 5DV9A 5CVDA 3Q9SA 5DX1A 3ZU6A 1GUZA 3TQRA 3LX8A 4HQFA 3QX7A 4BTEA 3QOFA 3WNBA 4QO7A 2E0IA 4E31A 2LE0A 3H05A 3WTCA 1W1WA 3VJLA 2FOIA 3UGKA 1KYVA 3W1WA 1ODKA 3AI2A 2A67A 3WMXA 4BWYA 2H8GA 3H6GA 1UDRA 1MB3A 1GQ2A 3HB0A 2C4NA 3F6SA 4ZT2A 3V4SA 1JSZA 3G9XA 4AUMA 1T2VA 4UKDA 1DJPA 1BMDA 1Y5NA 2PSSA 3N87A 4MYDA 4YQZA 4EKIA 2WFLA 4OMFG 4C2AA 1KEEB 4EIWA 1K63A 1YWGO 1M1NA 3CW9A 3WO1A 4P08A 3N05A 2OVBA 3IPLA 2WINI 3I2HA 5HQJA 1KK1A 2PL3A 2HA5A 2WOOA 4NH4A 3V6MA 2Y2VA 4MK4A 4OXRA 3AFOA 3GVJA 3G1TA 1PG0A 2CL7X 4ND8A 2QAGA 3E1SA 4LJYA 3T9FA 2IOQA 1W44A 4CKWB 3CLSD 3G8AA 3NYWA 4D43A 1F8YA 1VGRA 1XCMA 3O4RA 1Z63A 1X86B 3WJ7A 2ID9A 2JC3A 4AVZA 5J9FA 3Q3JB 4DNOA 4DV7B 3CVOA 1W52X 1ZKMA 5GINE 3H5AA 1A97A 3EVDA 5BY2A 2V9ZA 1YZGA 5JTUA 1GPJA 1KEZA 1KOJA 2X6RA 4JIMA 1ECGA 4WH0A 4ENUA 3S1LA 3CMAB 1K89A 3G6KA 3ID6C 3LI2A 1V6SA 3HWRA 4LDJA 4P83A 4ZOLB 1DIRA 1IWPB 1L5HB 2GFQA 4TQUS 4EYGA 4ILEA 3TGPA 5JNLA 4HH4A 4EJSA 3GUYA 1SWWA 5CTAA 3FGNA 3NIFB 1YRWA 4UZUA 2DQYA 3DNPA 2JD0A 2SKCA 1MO5A 2FPPB 3JYHA 4HWTA 5IT9A 2PEYA 3TOSA 3PC2A 4Y0NA 5FV4A 3GJQA 3RS5A 1T8TA 2OCLA 1YA8A 3EGVA 2AYYA 2H2IA 4PPGA 4C29A 5KNDH 1YR3A 1IOLA 2O4UX 3JRWA 1K97A 3CRMA 3GCXA 4MQEA 3H6HA 5H9VA 2ERYA 2IU0A 2C5HA 1ZJYA 5AHWA 1VLQA 1O0CA 2XNDD 5DASA 3P9RA 3C6YA 3QVMA 4KQXA 3D3QA 1HDZA 1TPYA 4R0VA 3ZCPA 3QWIA 4AVYA 2HU5A 4FFLA 3I5YA 3GFFA 3TOXA 1KE1A 3FWHA 4ZJZA 3EMKA 3OM1A 2PE3A 4QATA 4JFAA 3CUYA 4P3PA 4RNCA 4BZXA 1ZFNA 1OI3A 3NT5A 5HM8A 1Z8DA 3V1KA 4W5JA 1A8IA 1VLLA 3TJMA 1F0PA 4E4TA 4WKNA 5FYQA 3LUBA 2BDTA 3CC7B 4CIXA 1KI6B 1EFHA 2WRZA 4TWZA 4P5PA 4JT4A 5EIAA 1EX6A 3R40A 1XA0A 2DJ5A 4H3KB 2CLDX 4MQEB 3WKBA 4XGQA 5F2OA 3V5NA 5CB4B 3NBYC 1NE7A 5AKJA 5C35A 2FPUA 2NV4A 2J0VA 5BYBA 2X1LA 2P27A 2RAFA 3SICE 3X1JA 4Z7JA 5ICCA 4F6CA 4FZ5A 1OKKD 2VJNA 4UCQA 1OTXA 1UBOS 2YXPX 1HDRA 1JLRA 1BGXT 1Z4OA 1YZLA 4WGFA 5HF5A 4C5BA 5LD2C 2DLCX 1E2IA 3HB4X 1KJWA 3EZ6A 3CH7A 3KZKA 3OIFA 1YR6A 4IJQA 4NOKA 3C5VA 4DLNA 4E1AA 5JASA 5HG0A 4TMYA 3Q98A 1K28D 1B3BA 3BHJA 4MQUA 1M7BA 2CL5A 4WEQA 5CIQA 1JHMA 1NSFA 1U7TA 2YNMD 2YWRA 2QTVB 4RY0A 2MSDB 3O31A 4D79A 4MS3A 3GZ4A 5LDDC 3L7JA 3U44B 5LQJA 2FPGB 1E6WA 3RS0A 1DCKA 1E2DA 1M1YE 3ONUA 1HT0A 3BNWA 4ZVRA 3LZDA 2GQ0A 2YVLA 4ZVPA 4QOEA 1Z6GA 4LJRA 2VSXA 3E1GA 4EFMA 2QGNA 1V7CA 3FCAA 4QTTB 1U2GA 2V4MA 1WXIA 3RRXA 1JS1X 5EJGA 3H1TA 2XXAB 2P9EA 3QFHA 1YDHA 3HLTA 3TAHA 4TLEA 1WMDA 3O8NA 4C30A 1JIQA 1RBYA 2VP2A 2BGWA 1T3SA 2J9RA 4WBNB 3EVCA 3OCXA 3S3TA 1A96A 3P2MA 4OM8A 5BSXA 4LYDA 4N47A 3UZUA 5B30A 1YL7A 4BV2A 3AY6A 2QV7A 2PX5A 2ZTHA 4J3NA 5EL0A 2ZZGA 3RBVA 3EAQA 2QIPA 1XNQB 9MHTA 3RF7A 4FXUA 2IITA 3U40A 5AW6A 4EG3A 4I1PA 2Y67A 4H0CA 1AZSC 3ZGLA 2AMYA 1C3XA 1BPLA 2X5JO 1HLFA 2IYFA 3W2GA 1U6KA 3QLUA 3AINA 2C0QA 1WU7A 5A7FA 3LSYA 1Z3IX 3QFCA 1RC1A 4IEFB 4Y2GA 2QVBA 5LZ9A 3ASPA 5LQSA 1PYGA 4R2XA 2FWJA 1ZIOA 3SHWA 1MJHA 1ZLXA 4WLOA 5F5XA 4YAGA 2IH5A 3QXSA 5DTIA 1XKTA 4KUEA 3IXMA 3AF0A 5FPYA 4CF6A 2OMKA 1I8TA 2BFMA 1O5TA 4B35A 1QOQB 1U7UA 4EK9A 2VN8A 3TLBA 4UDOA 2QEQA 3MPOA 5HSGA 1MFPA 3LD9A 2H1HA 5GADl 1ZCJA 3JQRA 2HPZA 3FRHA 1DJQA 2Y6VA 3DMFA 3WXBA 5IS2A 2W00A 2WYUA 1N8TA 2PMBA 3LCRA 1JHAA 1IBSA 4XQGA 4EHIA 1J6UA 1VPEA 1CY7A 1UEXC 2BZSA 4H1UA 1NMQA 4KNYA 5KNCA 3E8MA 4IAOA 5ESDA 5DXFA 1OLOA 5FLEX 3UCXA 3B9PA 2GRAA 1IHPA 4FILA 3JYQA 3BD8A 3SFTA 4GOXA 3B7GA 4ANFA 1ZJWA 3O4JA 1JDPA 5ESWA 4D9NA 2XIJA 4JL5A 2YJZA 4M86A 1YNOA 2HRCA 3IUNA 3PNMA 1MRZA 4L74A 4JUBA 3HA2A 3GJZA 4L27A 5IF3A 1DQZA 3B70A 3G3EA 3I5UA 4WV3A 1E1LA 4G8BA 2IYUA 1PZNA 1S8AA 4KR2A 1EVEA 2J4FA 3G2JA 3I9KA 1HT3A 3NCTA 1Y4ZA 2D7CA 3TTWA 3WLLA 5REQA 4ID9A 4PIMA 3CVXA 3T99A 3OPXA 3F5FA 1A8QA 1RYYA 3KLBA 4NL4H 4Z0HO 5HFNA 4YV0A 1Q15A 2DOGA 4WOCA 3GGSA 3UJPA 2F43B 2IUTA 3KPYA 4GPIB 4QJ5A 4QPDA 4MRAA 4TXMA 5PNTA 4CF4A 5BOSA 2DIEA 4D8VA 1IUKA 4M6WB 3CH5A 1V5EA 3N86A 3HDQA 2WNSA 4I5GA 4X5OA 2H1RA 4YEDA 2POQX 4XUCA 3DKIA 3FTQA 3IP5A 2YY7A 3BAFA 3AL0C 1RYNA 4A73A 2G04A 3G68A 2PYIA 4Q5IA 3AV3A 3RRFA 1Q0HA 2EWWA 1VF7A 1LS6A 3X43A 1N33B 1WD5A 3L0CA 4OYYA 1T35A 4F91B 1AH2A 4V2UA 2R6DA 1Y3DE 1IY9A 2HU2A 1E1CA 3RUEA 3U7JA 4CEIA 3IOEA 2Q3FA 1CR0A 5J1TB 3RDPA 3UQYS 4D26A 3ZHTA 5IKPA 1KI1A 2OZVA 3CO0S 3LGXA 4AUNA 1NLMA 3KKOA 3X0DA 4OJKA 3ZDQA 4EBFA 4B3DA 1ZIDA 2RK6A 4OHFA 1DMRA 1C3OB 3HU3A 2AZTA 5CLHA 1FS6A 2VQFB 3AV0B 3LAWA 1AKYA 3HVJA 3PNQA 3KBBA 2JI7A 4XJSA 4C20A 1LA2A 3NEPX 3RC8A 3S5JA 5IN4A 3OQ6A 1YA6A 3FTFA 2REOA 4JYMA 4TMVA 4O25A 1PFUA 2WTUA 1LBTA 2VYND 1BKDR 3V3KA 2BJVA 3HNRA 4DS3A 2JLCA 2WUVA 1B1CA 2XMBA 4W1SA 4EG0A 3VV2A 3NTVA 4LQCA 2OBYA 2YWGA 4GYYA 4MB0A 4RWZA 4CUZA 3ZCUA 4YROA 5JEEA 4OXXA 3R6DA 2PNJA 3L18A 4NPAA 4FN5A 1ZSNA 2OYSA 3I76A 2BGTA 3JAKA 3NVAA 1AE1A 5K3FB 2GR9A 1RC0A 2BEJA 5FR2A 3GUUA 1U1DA 3GG2A 4KQKA 4CIWA 1OASA 5A89A 4FYMA 3RTAA 2OTJB 4AAYA 1QG6A 2XAUA 4IIVA 3JPYA 4CMIB 5FWXB 1JFRA 1KC1A 4QOHA 1N8NA 2NSJA 3ILSA 4WFIA 3Q7IA 4TLBA 4C4ZA 1TVKA 1UJBA 2NZ8A 1DAFA 3DNMA 1E6KA 4YRQA 2DR2A 1TI7A 5BN4B 2YVKA 1FE8A 5DS0A 2C2HA 3ZGZA 1KY5A 2CT8A 2JRLA 2KLBA 1AF7A 2DGDA 3FHCB 4FFBB 3RYTC 3E3NA 1NBOA 1BJRE 2GRUA 1Y8CA 5CBPB 1VL6A 1VCIA 3QBVA 5B36A 1RYBA 4ZVNA 2VS1A 1J9GA 2D3TA 2X3YA 3PXBA 4LPKA 4TXNA 4N3GA 3SS8A 3VKVA 4DARA 4HB4A 5L4NA 4OX9Y 3RRNA 4NXMB 1Z5OA 3LUGA 4O4LA 4DJJA 1BXKA 2GPBA 1BZYA 2BGMA 2BR3A 2TMGA 3VR6A 3MCUA 4KXYA 2G71A 3FW1A 1ZN7A 4RANA 2QR2A 3W1VA 1E79D 2FK8A 5FBWB 4AX4A 3GV0A 2BGJA 1SJ9A 1JT9A 1MXHA 1QHEA 1ULHA 2BTQA 3WHKA 2FSVC 1L4EA 4BIMA 3DZGA 1FPQA 2M1ZA 3BAZA 3E35A 4EY8A 1G5FA 1SUIA 1NF8A 1G4AE 3IS3A 2C4MA 1KR2A 2VI5A 3HYRA 4PLCA 4KXNA 3ZWDA 3TRDA 3Q3AA 4CM8A 2AJ8A 2FE4A 2RHHA 3VDMA 4WT7A 2HIGA 1CPYA 2QY9A 2AZXA 4D98A 4BVFA 5J47A 2HIAA 4R1QA 5DBGA 4P7GA 4OD0A 2E4WA 3UEOA 4R5MA 5FUWA 5B3LA 2J0SA 1UBCA 4NFHA 1Z36A 1V1JA 3OM0A 4QICA 4WW0A 2VRWA 4IIJA 4WKGA 2XT9A 3THYA 5ERGB 1SZJG 1HQKA 4U6SA 1F8UA 1UKEA 2FI1A 4RS4A 3WS7A 3ES9A 4HXGA 2FLVA 2UAGA 4EL0A 5ALOA 3O8OB 3NWEA 3X1KA 1JHDA 3TKAA 3ZVMA 3AFIA 3HN7A 3BD6A 1YDFA 1YIDA 2XADA 3FM9A 1WW3A 3N2EA 3PUYA 3Q5GA 3ZV5A 1XBTA 5B3KA 1VOTA 5ALSA 3A0UA 5CH5A 4R1NA 3U4MA 2ZIUB 3B6JA 4OJMX 4D96A 1JSRA 4ENRA 5IC4A 5LXTB 4ZTZB 3NMUF 5IYQA 3K0CC 1T8RA 2GRJA 1FJHA 1JKJB 2Z3WA 4RKQA 3ROPA 2RHGB 3NTQA 1Q6ZA 5CLIA 2XCRB 4DL9A 4FW8A 2EFCB 1K8ZB 5JZSA 5TB5A 1JG1A 1M6WA 1D0SA 3JX9A 1KS2A 1O9GA 5I7EA 3ZWPA 4G5YA 4CUKA 2X6WA 2P35A 4QM6A 4RCYA 3W3ZB 3F3KA 3KQQA 1TTPB 4JB0A 4N0EA 1N6PA 1P39A 4FYIA 4HYYA 4AY5A 5AM4A 2CV2A 3CU5A 3E9NA 3WL3A 3AJAA 4JJ6A 2KJQA 5FUYA 4ZCTA 2UDPA 1GTJ1 3MZ0A 4NU8X 4LJ6A 3CFYA 3KKEA 4YJDA 3T1NA 4RDHA 4QGGA 3ZE2B 4WESA 2AC2A 3TL6A 1XIVA 1MB2A 1VKJA 4V0NA 3S2FA 1UEJA 3C6ZA 1XQVA 5CNKA 4MVJE 4WZLA 3OQNA 3RC3A 3H5WA 3NJ4A 4QC2A 2Z3ZA 3WK5A 5LD2B 4HWRA 1JU4A 1XK7A 3B1ZA 3M2PA 4I9HA 1ZI6A 5AESA 4UEQA 4DE5A 2XODA 1PJ2A 1U0EA 4D4HA 4U7TB 4KAJA 2JVJA 1G3UA 2FUCA 2GUWA 2OORA 3LLSA 4AN1A 1ZH8A 3C3WA 2IYZA 1OUMA 3K9WA 1JBKA 3FMGA 3KKNA 1JAHA 2H7YA 2CXOA 3WNCA 3A4IA 2DUNA 4ZVKA 3Q7SA 3DVLA 5C8DA 4CIYA 2ECPA 1T2EA 2R1TB 2OSVA 3C1TA 4W63A 2VZ8A 4B6RA 4JGGA 4CKXA 1QVRA 2VHZA 2NOAA 4J76A 1G5IA 1KSHA 3GFSA 1CRPA 1L8AA 2XGSA 3EGIA 1PTJA 2B8WA 4GC9A 4UUPA 4YP0A 5JE8A 4Z4FA 4DLXA 5A7HA 1EE2A 4HDNA 5EZYA 3QNWA 3FOCA 1DSSG 3KK0A 1EM8B 1SQSA 3LU1A 2OG2A 1GQSA 1NIJA 2ECOA 2X0KA 4QU8A 1TK3A 2WDZA 3K30A 4YBZA 3RC9A 4OQDA 3TLAA 1FDRA 3OKPA 4W1PA 4J16C 4OH1A 5T57A 2ZE6A 3I6MA 2GCEA 3R09A 4G9GA 2XUKA 3ZWNA 1TT5A 4LNHA 3PNSA 3ZDDA 2WG1A 1OX6A 2A4KA 3WGIA 1IB0A 2YWFA 4UM8B 2WV7A 2QXYA 5G40A 2PX3A 3S2UA 4JMQA 3R3UA 2Y2UA 5K3AA 4YRLA 4AULA 4EECA 2HSJA 2QW1A 3L1KA 4UU7A 4YBRA 1T25A 1U99A 2VCHA 3P20A 4IXTA 3PCRB 2W9XA 4MMXB 1U2ZA 5AJTA 1LK0A 1T26A 1CR4A 4H7KA 5EJFA 1ORIA 1L5FA 4HRYA 1DQPA 2HREA 3KC2A 4JYAB 2H29A 4FYWA 5FWXA 1X8XA 2AZMA 2IXAA 1B8VA 2V3CC 1LFAA 2GO7A 4BVHA 1G8SA 1H42A 1SKYE 2V9PA 3F6CA 3KTAB 1TD9A 4GP9A 4LDAA 3H4MA 4V24A 1OAOA 1ZJ5A 3FCEA 4PSDA 1G4HA 1HVXA 3SR0A 1IBLB 4F06A 2EOAA 3CPEA 3CZCA 3GU3A 3K9QO 4GX5A 1CG6A 1ILEA 1CF4A 3PA6A 1HZJA 4UCWA 4JBGA 5I9SA 3GEBA 3BDIA 1X7ZB 3DB1A 5CK5A 3SZLA 1LD3A 1KZ9A 1H2HA 4CT5A 3BWDD 4BKQA 2D7DA 4TX1A 1JVNA 4TV8B 1W9XA 2OQ2A 4H6XA 1XTBA 2CD7A 5C51B 3TTTA 4TMTA 4NFYA 1XLUA 2QN6A 4FWBA 3IUPA 4BJ5A 3AF3A 4LE2A 4R3UC 4CDNA 1F20A 3EFHA 4G0OA 4PLZA 3OZWA 4CV3A 1LX7A 4E5DA 4GX1A 4S35A 3KOMA 3LYLA 4ZMSA 3D4IA 2GLXA 2GTHA 5DZSA 1UOOA 3S6JA 3ZIAA 3R6GA 4QU5A 5JHHB 1L7MA 4QWMA 4Q4CA 3AF4A 4RV4A 3FVWA 3DDOA 4O2BB 1V5FA 1Y7IA 1VQPB 4MQ5A 5E2IA 3EEYA 1FS4A 4MQ4A 1Z83A 2RI6A 3DPIA 5JI2E 4ICIA 5LQAA 3LBNA 5I7RA 3QY0A 4WSOA 3K0FB 3VDXA 4KN6A 3CMCO 4LJ5A 2F1LA 1UWLA 1W6RA 2PV7A 2Q4BA 3NRCA 4RHCA 4KIGA 4BO3A 1N2ZA 4D9CA 4G0YA 1TVEA 2AZ4A 3PENA 2BM0A 1KJQA 2DHDA 2W5UA 1O95D 5KAMA 4FZJA 3QKSA 4IWNA 2X6YA 1M1UA 3K15A 1PL6A 3KVVA 1P2VA 4OMDA 1W5FA 1VQ8B 5BRAA 5HW0A 4F04A 3JQGB 1TM2A 3E9CA 4CCWA 2DWUA 4DV5B 4I8XA 4Z5XA 5TEWA 3WGMA 4QODA 2JGEA 2ID4A 4UAJA 1G4UR 2NWQA 4EGSA 3AL2A 5TV2A 3GVHA 3NDJA 2Q50A 2ZROA 4K6OA 4YRJA 1UBMS 1J99A 2HU7A 1JAYA 1XTTA 3IBCA 3MMNA 4XX0B 3SZOA 2FZCA 3ZV3A 4MDHA 1KDTA 3IOMA 2L69A 4EPRA 1MA0A 1Y80A 3QFSA 1GLNA 1T1RA 2D0OB 3LCCA 3G0HA 3HSSA 2HC9A 2ZI4A 4I08A 1SKBA 1F9AA 1GU7A 2JFFA 2QMHA 3L7KA 2XOXA 4YEJA 3A06A 3CLRC 4XARA 2EHDA 5E7QA 3GLVA 2ZXFA 3S44A 4AK9A 1P0IA 4BLTA 2PZMA 3OVMA 2FAXA 3R0XA 4MUMA 3F6PA 4P36A 1ZCZA 1NY6A 1K5DA 3TTXA 1T1IA 4JJ8A 1E62A 4YAFA 4V3BA 3KB8A 1T1GA 3AY0A 4MB2A 2M6KA 4Y9DA 1RRFA 1PZMA 1KAGA 4KKTA 1E8NA 4K6HA 5HUHA 1JR4A 2DFKB 3EA5A 2W2VA 2W2MA 3PR3A 2BC9A 1ORTA 1OZHA 2PGAA 1BCSB 1O96A 2XNJA 2DHEA 3IDFA 3LHKA 4L8WB 2OXEA 3TFOA 3TUZC 3K9HA 4MKGA 1W5AA 3CUVA 4PTYA 2ZYRA 3MC1A 1K0FA 5FOQA 1Q6YA 4UEJA 2IOFK 3K9CA 1K9MD 3DMRA 1LI4A 4U2EA 1C3OA 4EJ0A 3RTEA 3QTTA 3EIQA 1D1PA 3JCZ