1T6XA

Crystal structure of adp bound tm379
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
287
structure length
266
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 69
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6xA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6xA01
4MW1A 5J5AA 2CV1A 1WZ2A 1WXIA 1JZQA 3HV0A 1U7XA 1WXGA 3FETA 4Q93A 4MUIA 4YP7A 3X1MA 1IQUA 4KR9A 1M1ZA 3S3TA 3KT6A 2QJFA 2WB2A 1J1UA 4MW0A 5EKDA 4K0RA 4ZT7A 1KAMA 1O94C 3KT8A 3UOWA 2C5SA 2QUJA 5KHAA 5BNZA 1U7DA 4GRIA 1WKBA 3SZ3A 3CLRD 5K0SA 1U0BB 5J59A 1NURA 1JEEA 4OJMX 1M8FA 1WOYA 4PBTA 3LCJA 1QTQA 4MWEA 2R5WA 3FIUA 4U7JA 1WXFA 3GLVA 2CV0A 1YULA 3I05A 1GAXA 3PNYA 3U1VA 2X3FA 1KH1A 1WY5A 2D54A 2CSXA 1I6LA 1OWOA 1VBMA 3ZXSA 4EF6A 4EG8A 1DNPA 3D6VA 2QUKA 3N8HA 4AS1A 5DEOA 3Q12A 4ZT6A 1N77A 1U3CA 4DLPA 4UZFA 4K03A 3IOCA 1O96B 2J08A 2X1LA 3TZEA 3N2YA 2CT8A 1D2RA 3P52A 2A1TR 3CLSD 2NSYA 2CYAA 3TNJA 3H9BA 2QUIA 3VRHA 1MB9A 4HPWA 1EXDA 3A04A 3NV7A 1NZJA 3VU8A 1I6KA 2VTBA 1QNFA 2A86A 3CVWA 1PFVA 4MUNA 1ZH0A 2PZAA 2E21A 5F23A 1WXEA 4E1AA 2A1UB 3IODA 4J75A 4J76A 3FHJA 1EFVA 3MXTA 1ZUNA 3ILVA 2E18A 3A05A 4MUEA 1EFVB 3DLAA 1EUQA 3AL0C 2JANA 1UFVA 2H2AA 3ELBA 3G59A 1IFXA 3RHSA 1NP7A 2DPLA 4MW4A 1J20A 3FY4A 5TEVA 3G6KA 1ZH6A 4I6JA 1V8FA 1K4MA 5KCMA 3HFJA 2V0GA 1S4MA 2AG6A 2OQ2A 1G59A 4RPIA 4HK4A 3RFFA 3CLUC 4YP5A 3DO8A 3CVXA 1MAUA 4FZJA 3ZIUA 3UY4A 3IOEA 1MOPA 3COZA 1T6XA 4ZCPA 2X1MA 1O97C 5JBNA 1N05A 5TGTA 3BNWA 4R0NA 4BWVA 4TS1A 1PFUA 1VBNA 3LOQA 3Q4GA 1H3FA 3CVUA 1M83A 1N2HA 4R2LA 2EJCA 5H16A 3P0HA 1NUUA 4ZT5A 3X1JA 1KQPA 1R6XA 2YY5A 2WQ7A 3TQIA 1K97A 1Q77A 1JZSA 1J1ZA 1QRUA 1JGTA 3A4IA 4JXZA 1T6YA 2CYCA 2VBTA 1N08A 4KPUA 5TEWA 5IHXA 2RD2A 4NAUA 1N75A 1V47A 2H29A 2GKSA 2ZUEA 4PBRA 1OWNA 4A91A 1JECA 2A84A 3IMEA 1N2JA 2Z08A 1QRTA 1J09A 4MUKA 3ND7A 1I6MA 4MVCA 3DPIA 3SDBA 1IQ0A 3CLRC 3PNVA 4ARCA 1OWPA 4MVYA 1QRSA 3K32A 2QJOA 4ZT4A 4XFJA 4RUKA 1HYBA 4HJXA 4U8HA 1CT9A 3LE8A 4MUGA 1KKUA 1N78A 3ZJUA 1F7UA 5H7XA 3GUZA 4ARIA 2RE8A 2PG3A 2D13A 4OUDA 4EGAA 1NSYA 5TRDA 1QQTA 1N2OA 3MMXA 3FNRA 1N3LA 2DLCX 2X0KA 1COZA 2A4MA 2HMAA 3CLTD 3IDFA 2ZUFA 2VBVA 5FNZA 4EG1A 4AQ7A 5HG0A 1A8HA 4X0EA 4ZCTA 5LFAA 2DEUA 1T9GS 2HZ7A 1M8KA 3HGMA 3CLSC 4ND6A 1JIJA 3QTTA 4R2MA 4DDHA 2QUHA 1O6BA 4KR6A 4EG3A 1QU3A 2OV4A 2D5BA 3IVXA 1MAWA 2E0IA 1KR2A 3IH5A 4HJRA 3IUBA 1IRXA 2PIDA 3M5WA 3UK2A 3H9CA 3ZUGA 2IJGX 1PFWA 4YP6A 1IHOA 3ZJVA 2QTRA 4CQNA 4DJAA 1XNGA 1LI5A 3UC5A 4JXXA 1IVSA 2CV2A 1O95D 2BTEA 3H99A 2VTBB 1KP2A 1YIDA 1YUNA 1N2BA 1T9GR 4I6GA 1X8XA 2QTNA 2YWBA 3ND6A 1M8GA 4MW6A 1QJCA 1NB0A 2JAXA 3MUEA 4MW5A 3H97A 1KQOA 5A89A 2J07A 1TYCA 3OP1A 3H05A 2V0CA 1U3DA 4NDAA 1GPMA 1OD6A 2OYNA 2BYTA 2NZ2A 4KKVA 4MW7A 1OBHA 3NBKA 3IUEA 3IVCA 4MUHA 4G5YA 1JMVA 1G8FA 1Y42X 1VLHA 5FO0A 1KQNA 2AKEA 3IVGA 4JFAA 2EL7A 1G8HA 3G5AA 3D6UA 4MQ6A 1SURA 2P3MA 4MW2A 3CR8A 2CUZA 1K92A 3SEQA 3X1KA 4MVWA 4DE5A 5KWVA 3UMVA 4QBTA 3CVVA 3JXEA 1LW7A 2O5RA 1P4MA 2PFSA 4P2BA 1WJGA 1JHDA 2IELA 1F7VA 3SEZA 1WXHA 1ZJWA 4MLPA 3ISJA 1TEZA 4EFKA 4EG6A 4ZCRA 3A2KA 1R6TA 3FG9A 1VBKA 3AKZA 3HMQA 3ZJTA 1KH3A 3PNBA 1H3NA 1EFPA 4KPUB 4Q16A 4F3RA 2J09A 4JZYA 1K4KA 1PFYA 1OBCA 1B6TA 1O0BA 1KP3A 3FDXA 4NAHA 5LM3A 1TYAE 1H3EA 5J58A 2QJTA 3FWKA 1XNJA 3IOBA 2DXIA 3COYA 1JILA 1EJ2A 4UZEA 1GZUA 1N2GA 3CLTC 1N1DA 1J21A 3ZGZA 1PG2A 2B7LA 1MRZA 4KR7A 3FOCA 1G8GA 2GOYA 1NUTA 3DV2A 3MLBA 1OWLA 4L2IA 1FYDA 3L93A 3KT3A 4MVXA 3IMCA 1N06A 3AIIA 3PXUA 3K9WA 5DB4A 3RJZA 1MJHA 1F4LA 4L2IB 4OUDB 1NYLA 1Q11A 3BL5A 3Q10A 2XRZA 1N2EA 1WQ4A 3SYTA 4YBRA 2O8VA 1TYDE 2A1TS 2Z3VA 5HUJA 2WQ6A 4PY2A 2DR2A 3VGJA 1MBZA 3AFHA 1Q19A 3FH0A 1TFUA 4NZPA 1KH2A 3COVA 3AG5A 3QE4A 4G6ZA 3QTBA 2A7XA 3COWA 1NB9A 1H1TA 1RQGA 4QREA 1R6UA 3RK0A 3CVYA 1EUYA 1YIAA 3PRHA 3TZLA 4DNXA 1J70A 5A8AA 4PBSA 1TYBE 1TQ8A 1FFYA 1YUMA 3KT0A 4MWCA 1O94D 2WSIA 2DERA 1JEDA 1KAQA 2VBSA 1O95C 2DUMA 3N9IA 1JIIA 1N2IA 3KFLA 4WSOA 5IJXA 4F4HA 5K0TA 3TQOA 3ND5A 1JIKA 1O96A 1M8JA 4MWBA 5DASA 1N07A 4NX2A 4EG4A 2XRYA 2TS1A 1GN8A 2CFOA 1NUQA 4CDMA 3SP1A 2PXHA 3ZXIA 2DETA 1GTRA 1XNHA 1PG0A 2PZ8A 2J5BA 1NI5A 1BS2A 3L92A 1LI7A 2IP1A 1IQRA 1WQ3A 2VXOA 4MUJA 3RBAA 1YI8A 3GMIA 5A88A 4ZT3A 3RK1A 2A1UA 4H3SA 4NATA 5AHWA 2PZBA 5TS2A 4XFDA 4ZT2A 4JYZA 2GM3A 5LLTA 3CTAA 3E27A 2VBUA 2Z09A 3P0JA 1T6ZA 2G36A 3P0IA 1MB2A 2AZXA 1GLNA 5DK4A 4CT0A 4EG7A 3CA8A 2ZP1A 4G5FA 4MUFA 3OTWA 1ULHA 1IH8A 4EG5A 1MC1A 1O5TA 3MLAA 4WNYA 1F9AA 3TS1A 1QU2A 1VL2A 3NBAA 2YXNA 3FI0A 2I1LA 4CDNA 4MAFA 4MWDA 1XJQA 2HGZA 3SZGA 4ZCQA 3N05A 1OWMA 4MULA 3INNA 1KORA 5FO1A 1P7PA 4DDKA 1NUPA 2A88A 2QTMA 3CLUD 4DDMA 2J4DA 5HUHA 1I2DA 1O0CA 3AG6A 4ND7A 1X6VA 3HZRA 1EFPB 2E89A 1O97D 4MW9A 2CYBA 4I6EA 3F3MA 4QRDA 3IMGA 4YMIA 4U63A 1Q9SA 1Q15A 2YWCA 3C8ZA 4ZCSA 4XSVA 3HL4A 4S1OA 1ILEA 1M8PA 1EE1A 2JA2A 1GTSA 1NUSA 4GU5A
chains in the Genus database with same CATH superfamily
2FSIA 2CV1A 3E2PA 2OXFA 1WXIA 2O4CA 3FLEA 3S55A 4B6GA 1SKYB 2WNIA 4FCWA 4MUXA 2JLXA 3L8EA 4CI0B 4HQKA 3ZW8A 1XEXB 4L8JA 1SNYA 1ZESA 5LNK6 3GGSA 1UK8A 1EU1A 3JD3A 1KXZA 3NT5A 4RJLA 1RWMA 1A7AA 2B9EA 3L7NA 4TXMA 1GHTA 1FDSA 3IAXA 1GPUA 3KSUA 1Y8CA 4OGKA 4G24A 5B55A 5FBHA 1IBCA 5F12A 5K3BA 4ZT7A 4IGIA 1KK2A 4FBGA 5BQ5A 4WKNA 4G3XA 4MEJA 1TUBB 2IX3A 1U7DA 5HK9A 1B0ZA 2CWWA 2NX2A 1FTSA 3BWDD 4WJZA 5CHEA 4D9BA 3L8MA 4QOHA 4WKPA 2ZQYA 1UBNA 2YV4A 2X3UA 5AR1A 4WK0B 1LX6A 3CLKA 4RA9A 2GBGA 3RVSA 4CEIA 4RTSA 5HS6A 4AT1A 2QX7A 1V39A 3I56B 4NBTA 2YJ4A 1ST3A 4R6XA 3AI1A 2FWJA 5FPPA 1UM8A 2ASVA 2CKMA 5GJCA 3V2HA 3VO2A 5IWAB 2G1PA 4ZOBA 4J7UA 3OE4A 1M6VB 5HQJA 5IFLA 3GDFA 5TQVA 1I7PA 2EYUA 4BNTA 4Z2AA 3QF7A 4FFBB 1VLJA 1VHOA 2NO6A 1VMKA 1OTXA 3QX7A 4ALLA 4CM9A 5I7RA 3DEHA 3BM5A 3KC2A 4NRDA 1EK6A 2X6QA 1GLGA 3ONWA 4UQLA 2HBQA 1U5AA 4URXR 1XU9A 1CQJB 3HKEA 4ACAA 3UGQA 5JRDS 1M6YA 1HPLA 2DF8A 4L8FA 4X65B 2JGFA 3E81A 2P2YA 4IFIA 5I7HA 4YVFA 2WZPP 1MB9A 3EZ7A 1A2KC 1G18A 2G3YA 2GAOA 3A32A 2C9ZA 3GOHA 3TJMA 3V00A 5KJ6A 2P9HA 1HMYA 1F2UB 2FRDA 3WWPA 1TA4A 3S1LA 3VU8A 1YL7A 2ZXHA 2NSHA 4FPXA 5HF6A 4X7DA 1IJKA 3OPQA 3WTCA 3QKUA 4AJLA 2PJDA 5K4GA 1DUIA 3GMDA 3SBEA 5A4DA 3JWGA 1PNOA 4H2DA 3CH5A 3SJUA 3TOZA 1B16A 1MIOA 5DNVA 3S2UA 4HE5A 2DVMA 1NULA 2YIVX 4GYWA 4A2CA 2ACKA 2OBNA 2W6QA 2YXDA 5EZYF 2OBLA 4ML3A 1AB5A 2QDKA 1KRWA 4I1OA 2B5OA 1CUVA 2H85A 3ILVA 3KBBA 4XIFA 4TXNA 4ZI2A 2J8ZA 3A05A 2H8KA 3QEAZ 4L95C 2PT7A 4Y2QA 4C7OA 3VYUB 2H57A 4CDRA 4PQYA 4Z4UA 2DG2A 3C87A 3KSRA 5J63A 3S4YA 1W94A 2XA9A 3V2UA 3CX7A 4LA4A 5EJFA 1WOMA 2UZIR 2YRXA 3DUFB 3KNZA 3LT4A 4Q0MA 2VJOA 2VZEA 3WE7A 5KCMA 2QN6A 1C9YA 4ENVA 4NE9A 3VR0A 4PQGA 1DXOA 2Y3IA 3PVZA 2ZBFA 2YMQA 1UPCA 3AXTA 1GTVA 1ZU5A 2Q50A 4PX3A 4FYHA 4TWJA 2QVCA 3TLKA 2XXAA 3GFFA 1BRMA 2BIFA 3DKKA 3ZKAA 3IOEA 5HUQA 5IYZB 4ZCPA 4EYGA 4PG7A 2XZTA 1U80A 3BA6A 3F6RA 2ZIVB 2KW5A 3V1KA 4HXEB 4PLWA 3HN7A 1DDGA 2HB6A 4MGEA 5JMOA 3DWGA 4IDDA 5A9RA 5DN6A 3HJHA 1G0OA 5E3JA 1RQXA 1G291 4YRAA 3AVWA 5SZJA 3FOAA 4P7BA 4F9GA 3X1JA 1CVRA 4B80A 1T5SA 4QDOA 2DQYA 3MERA 4BE9A 5FADA 2WYHA 4GLLA 3OIFA 3A9UA 3GLGA 2IUEA 2IYLD 3R6TA 4D8VA 2JDID 1DKLA 1UH5A 2MYNA 1JR4A 3A35A 2J4FA 1JZSA 3F1KA 3ZHZA 4BVBA 3QKRA 2IHUA 4NCXA 4FONA 1T6YA 4YAIA 3F9RA 3G49A 1E6WA 3NHJA 3NW9A 1VKHA 5CB4A 5IUNC 2G07A 4OLAA 1W0JA 4Q1AA 1UP4A 2D7CA 5G4KB 1I0ZA 1JECA 3DDCA 3FOZA 1FTYA 1PEYA 2CLOB 3O21A 4BDTA 1T8TA 1J09A 5B36A 5FBVB 1NRXA 5KREA 2JLCA 2C97A 3EBOA 3P8ZA 2J31A 3VZQA 4LZJA 2HBRA 2I66A 3ZY6A 5JXHA 3IP8A 5DM0A 1D2GA 4TMWA 4XFJA 4MDHA 4OOXA 2JFFA 1T1JA 2B0JA 3RYFA 1E7QA 2QUAA 5AQEA 3T1NA 4FR2A 2BBWA 2R68A 1R0LA 1FDVA 4BP3A 4YLYA 1VF7A 3TECE 3JALA 4RTQA 2FMXA 2QWXA 1M33A 3CX6A 2GN4A 3ENVA 1P6QA 5DYNA 3VR3D 3BMQB 1KZ9A 5FAKA 1JHOA 1OVGA 1P3Y1 1SUCA 4LDAA 4G67A 4S2EA 3V8RA 2NSJA 5BMOA 5JD4A 1ZD3A 5EE0A 2PUAA 5CT5A 4EDHA 3N70A 4LWOA 5IKPA 2YKGA 1MW8X 4J16A 5B58T 2Z6BD 5LB4A 3EPJA 5KB3A 2MT9A 2VPYA 1EJ0A 3X0DA 3GEBA 3BICA 4IIXA 1EDZA 1KJQA 1UC8A 2QLFA 3UMCA 3ZEIA 3I04M 4Z4HA 4HPJB 5GTDA 2VJKA 2VZLA 1REQA 3OT4A 2P9GA 1QBKC 1JI0A 4OI2A 3RC2A 1SIOA 5CM2Z 1P39A 5LLDA 3BKWA 4B3BA 3W06A 3JYQA 5J3OA 4URHA 1O9HA 4BJ6A 2MSDB 2FQWA 1FXWA 1V43A 4IXNA 4ZKDA 2VKQA 4NP6A 3OPYA 1JYFA 2ZB8A 4D6YA 2A9QA 1XNRB 2TMGA 1J23A 1I2BA 3N7UA 4ZYZA 2RJOA 3VZDA 2A0UA 2J0UA 1RKBA 3S28A 1JAXA 1QKKA 3UK2A 2N9UA 4DRZA 3H9CA 3ZUGA 4ZI7B 1AY0A 3K6SB 4CV0A 5BSKA 1FX0B 4D79A 5A62A 2YVLA 2HREA 1Y8RB 1ZXBA 2DE0X 3LWBA 5IKMA 4W6QA 1U1IA 2W6ID 4QXRA 3LHKA 3BWVA 3ZDFA 5BMVF 2GPJA 1X0VA 5JEDA 4YJ2F 2W2KA 3DXXA 4MR7A 1VIAA 5CNJA 3TSAA 4FJ0A 1A8PA 4G36A 1E2MA 1KAHA 3TWOA 5SY9A 3CFYA 4MO9A 4CTKA 1KP2A 2ODNA 1E3DA 3BIWA 4UHJA 2OO7A 2FR8C 1KKMA 4R1NA 3LPDA 1I7LA 1EUDB 2C1ZA 3QBDA 2PX6A 5GINE 2GBLA 1CUUA 1T9GR 3FA2A 4AIIA 5AMXA 3WWOA 2NG1A 1HQYE 4QPPA 1WB4A 2ST1A 4M0FA 4DV3B 1M5TA 4XLCA 3RVQA 1RHQA 3H11A 3AM1A 1J90A 2O7QA 5EQTA 5ER9A 4BRUA 4D3DA 2O57A 2VP6A 3O8CA 1MX5A 1C7FA 1MB0A 3D3NA 2XMRA 4ITRC 1YRHA 3WHPA 1KWGA 4HQRA 1VPTA 1IY1A 4ZVQA 1NHWA 3ZHSA 3A26A 2XE4A 4Q7MB 2FSPA 5AVWA 4KQCA 1K8XB 1FW6A 2G5PA 2XZOA 3KEWA 2IF0A 3GK3A 4G37A 4D7AA 2QD3A 1GV0A 3SG0A 4JLNA 3WR5A 3A6PC 1BKYA 4WT7A 4MIOA 3BD6A 4TROA 4AP5A 1CLUA 1EVQA 1U2DC 1AZSC 4E5DA 3IUEA 4R2HA 2QU8A 1SB8A 5BRNA 3DE1X 3AERB 5DGDA 5I9MA 3A11A 3R7WA 3T1OA 1O9BA 2ZIZA 2HFJA 1T8PA 2C84A 1I4WA 2P62A 3COSA 3DQPA 3JWJA 3OD1A 4DB2A 2HWXA 2P27A 5CG2A 2FNAA 4TLCA 5WRFA 4QDXA 1W4LA 1C1HA 1T3LA 4QBGB 4BNNA 2VP3A 1P1BA 1X9IA 1P1IA 1R66A 2IIVA 3MINB 3PU6A 1LW7A 4PVDA 4B8WA 4B35A 1B2LA 1LBTA 2XF8A 3CWQA 4FBMA 1E9FA 4LRWA 5K3EA 1XHFA 2ZUTA 4DC0A 1MV5A 3U7JA 1U0OC 1XU4A 2EXXA 3TZKA 1HFEL 1NV8A 3EC2A 2RHOA 4DNQA 4DIOA 3VYRB 2YINC 3QU4A 2EFGA 2ZBVA 3OU7A 4GYYA 5AIBA 3ZJTA 4X64B 4QUKA 4BVLA 2WZQA 1OI7A 1V5WA 5CA1B 1BA3A 3QBEA 3VTKA 1MO2A 4PC7A 1GDHA 4XLFA 1B15A 3DFUA 1NQ5A 3F5FA 3GD7A 3I6BA 5IBPA 1L8XA 3A0RB 1A5BB 2I6SA 4NAHA 4G5XA 4MYSA 3ORFA 3HHEA 1QONA 2J9XB 3AEUB 4LF7B 1ETUA 2C03A 4RACA 2BFEA 1JIQA 5LVAA 4BNUA 2D06A 3DCIA 2VHXA 3KVOA 4IIJA 4O29A 2GK6A 2QBYB 4ZD6A 5NLLA 4KR7A 3WGVA 1QHYA 2IEIA 1K88A 4P3IA 3CCVB 1LPPA 1K5GA 1MAHA 2IX9A 2O2JA 3PFKA 4FEGA 1A8IA 3O74A 4AL4A 3X1YA 1FYDA 4LZNA 3AIIA 4EFDA 2J4CA 4OBXA 4ZK2A 2XTMA 1B14A 1O5OA 2DC1A 1AGYA 4AJ1A 5FI1B 4PINA 5B7QA 4DZRA 1XKLA 1YS1X 5B30A 4YBRA 2O0MA 1XCGB 3O82A 2CVFA 2IWRA 1C50A 1QCZA 1QZUA 4KBYA 5IYQA 1WPRA 2EG5A 1FP2A 1WDLA 2WYWA 4HAOA 2OK7A 1AKYA 5F3RA 2AN9A 2V3VA 4Q3NA 3ZE7A 1JU9A 4B7ZA 2DOKA 2O3QA 2GK4A 1Z56C 2BGNA 3C3JA 3PE4A 1JDZA 2OORA 3P0FA 1AZWA 1CYDA 2HK8A 5EKTA 4WZZA 1ZXXA 1GQQA 1QR2A 2W58A 4F2GA 2RGBA 2V4ZA 5L4SA 2P2GA 4OB8A 3PRYA 2QAJA 3FYUA 4TN1A 4ETIA 5EZQA 3HRHA 1E5TA 1GZ4A 4I4IA 2Q2VA 3F5SA 5I48A 3CKLA 3LUGA 3UGJA 2O07A 2OK8A 5ALKA 1Z4NA 3W4IA 1CYEA 2UZAA 5AESA 4HGPA 3L6BA 2JH3A 3EF3A 2VJYA 2VI5A 2QR2A 2RK6A 3F5QA 5TSDA 4DLYA 2XTZA 2HWKA 5HZAA 1NW9B 4F8JA 4V0MA 1UJ6A 5CFQA 1QYWA 4DMRA 5BN3A 1ONPA 1Q6ZA 4RM2A 4LGVA 3ER9A 1JEAA 1XKQA 5EP3A 1GCGA 2O0HA 1KY4A 3G79A 1G19A 4G0ZA 4L6CA 4PPGA 1EFCA 2QA5A 2WTAA 1SKUA 3QX8A 1PGJA 4IWNA 1TLFA 1LK0A 2DR3A 2QSZA 4EI2A 1G4UR 3RGWS 4MQUA 3RK4A 5DX8A 3TOSA 3VSDA 3L7IA 4BBZA 4EVRA 4PG8A 2RGUA 3L92A 1Q20A 4IY1A 3LXXA 3PYXA 2NVUB 3TEJA 1HEYA 1GNLA 1SFRA 3TTWA 4BEBA 3FMVA 2FZWA 3QM1A 4P4SA 5A3VA 1WXQA 3GMSA 4YR7A 1YRAA 2QB5A 5JG7A 3RC7A 3MF4A 5A88A 1XZMA 3G0DA 3GJYA 2EFCB 3GCGA 4EO4A 1BE1A 4C9BA 3D2CA 2YOFA 5H3CA 2ZJ7A 4PYLA 3UJBA 4XFDA 5L40A 5LIPA 2Y4NA 4HVAA 5LLTA 3VU9A 3CUEF 2VJAA 3F9CA 2GO1A 2HXYA 5DNWA 4HG2A 1LSUA 3FMOB 4BC1A 3BG5A 2JD2A 4XKWA 3QLVA 3I61A 5AT1A 1P44A 2D3WA 2O54A 1RCUA 1EGAA 1KAGA 3GJZA 4BNMA 1MHPA 1VYHA 5EE5B 4IFEA 1T1EA 1JAHA 1TT5B 1L4HA 3OMXA 4EG5A 4XGNA 3I6ZA 5T4HA 4E0BA 1H2YA 1OUMA 3CBGA 1KI4A 3S6JA 4BX3A 3TS1A 1CJMA 2WW8A 1MUUA 4AXXA 3E18A 1TYEB 2GN6A 3HKBB 3OWOA 4TRRA 1EX1A 2JFPA 1HDCA 3MGAA 3HO1A 3QFSA 1YI1A 2UUPA 4FOPA 4WKGA 1QIFA 2PSJA 3CUUA 5CXSA 1NWHA 2HAEA 1VM6A 4D4HA 5ALYA 4HX9A 2Y0EA 2AOXA 4HAUA 1ECFA 4MAFA 1BFDA 2OPHA 1XJQA 5BN5A 1V6SA 5CVCA 3SZGA 2QNRA 4OL0A 5DNCA 2EL9A 3O1IC 4JLPA 4XKJA 1HE2A 5G53C 3VH3A 3WICA 5A2QA 4OVKA 4DVGA 1Z18A 3HA5A 2RJNA 3JAWB 3BMCB 3KLBA 3Q2KA 4IBOA 3X43A 2F1KA 2VFAA 4CKBA 2YV5A 4TYPA 1TMYA 2HRRA 3TNDA 4BE7B 4IJVA 1Q17A 2BFPA 1UIMA 1ZM4A 4R51A 4D74A 5JDCA 1MAAA 1U2SA 4M0UA 2VP5A 3I3OA 1N6NA 3VR6A 1EFPB 1GPH1 3FPBA 2XNCA 3SLGA 5IK2A 1NXQA 2AFVA 3IT2A 3ML1A 2G1UA 1XZKA 2Z8YA 3P9NA 4GZ6A 4JMPA 1EFAA 5F98A 1AD2A 3ED5A 4OQQA 3UV6A 1NLFA 4YP0A 1ILEA 2R1TB 1EXNA 4PE5B 4Q9DA 4Z4VA 2G9NA 3NDIA 2JLYA 4ND8A 2XDAA 2B4RO 5K09A 2IHBA 4XEUA 4BE4A 3QYFA 4WZBB 3N0XA 2EC5A 2H1FA 2Q28A 3HFGA 3LZDA 4JUIA 4IL5A 4LHWA 4OB6A 4O1MA 4YBZA 4CM1A 4DARA 3LNNA 1ZJ5A 3QFFA 2XY4A 3SCZA 1LTQA 4MXDA 3IURA 1OTHA 2FQ1A 4KR9A 1PTJC 2F3RA 3GNSA 1JKMA 1ZGBA 3P5SA 1F1JA 1II8A 4MLCA 4UM7A 2NXCA 2UUOA 4MW0A 4R2KA 1H05A 1JIUA 4KO3S 1XRSB 1YR3A 3BL8A 3ZCSA 2P40A 3AR8A 1RFLA 3PGA1 2GJ9A 3QX9A 1NURA 1YQUA 2BEVB 4TV9F 1U8YA 4D81A 3STYA 3OZTA 1EK0A 1K28D 4MWEA 1ZGGA 3TBFA 1AZTA 1YBAA 4FKMA 3V7NA 5ICMA 1SBZA 1SVUA 5LKRA 3ODPA 5TGZA 3THOA 1JA1A 3QPWA 1KK0A 5FR2A 3WHKA 3WB9A 2JBAA 5IM5A 3DLBA 5JS1A 1WHSB 4LF9B 4L15A 3K2BA 4CIWA 3AM3A 2OCLA 4GQBA 4D82A 1W9XA 1CIPA 1GTMA 5E0KB 4EF6A 1VE3A 1WIWA 2ADOA 2XWSA 3N8IA 3RT7A 4LBWA 4FFPA 4IO1A 4M55A 1BGXT 4EOGA 1RYBA 3II6X 3VGPA 1Q0LA 5KYXB 2VP4A 4Y18A 4JN6B 5F7XA 4O2AB 3HCBA 5JH7B 3S5JA 4IXWA 1NR5A 4DTCA 1VJ5A 4XQGA 3SVTA 3ROMA 1ORIA 2FPGB 1S2DA 4KEAA 4MRAA 2F00A 5BVHA 2IBTA 1H22A 3EDMA 4HNSA 1CB0A 3ZWKA 3URKA 1XRNA 2HI0A 2QRLA 4ABTA 2GS9A 4I3GA 1QAMA 3B13B 3L9XA 1YTUA 4DLLA 4CDMA 5KVAA 1D9XA 1DG3A 4Q3OA 3GJXC 2SCUA 1V1RA 1EXDA 4GKBA 1HX7A 3IHTA 4YR9A 1ZIDA 2FY8A 2EDCA 3BQJA 1SUAA 2FV8A 2G09A 1NZJA 3DDOA 2C4KA 3HLTA 2VRCD 3K53A 4I81A 1GIAA 1CY7A 1SXIA 2HMWA 2H7YA 1QE5A 3NCHA 3WO0A 1VTKA 4Z3KA 4UE2A 2CDNA 2FX5A 3KXIA 3E5HA 3QEMA 3E9YA 3ZH9B 4DSOA 5FF9A 3WQSB 4M0CA 4A2PA 3HNPA 2EP8A 2J9ZB 2ZCVA 4KZKA 3IODA 4Y2HA 1G5FA 3V3KA 5K20A 5MF6A 1U2GC 3RYIA 5CUQA 1MDBA 3VOBA 2F43B 2H4JA 3TW0A 4DUYB 2WYOA 4EGJA 1P2TA 3KB6A 3L1HA 4XJXA 4BP9A 1CZHA 3BB3A 3IBFA 4TYWA 3AVOA 1WUJS 1SXJE 1E18A 3VC1A 2MHCA 4CQMB 3T1HB 2IHJA 3NT4A 5LZ2A 1F6WA 3ELBA 3KK0A 3OJFA 3BHNA 1AKVA 4YWHA 4EB6B 3I8OA 1KDZA 2GBIA 4WBNF 1ABFA 1K0FA 3G6KA 4YECA 1FA9A 1ARZA 1YA4A 4JOSA 3CJTA 3RBVA 4HK4A 3D4IA 2ACVA 4ZTBA 2ZSAA 1EE9A 2AI3A 1KZ4A 2IYUA 3H8JA 3NDPA 4OI4A 2HCRA 2B6HA 3HVUA 4Q82A 1J2EA 5LBUA 2I0FA 3JWEA 3LLSA 3ZHQA 3OLWA 1X94A 1P19A 4RW0A 3PGKA 5JAMA 5MFZA 1RYMA 4QATA 1T2NA 3BNWA 5KOJA 4BWVA 1KOFA 1CNEA 5KTNA 3GCXA 2JIRA 4G1CA 5JR3A 3H5RA 1R4MA 1YX2A 4ZO9A 1Z5PA 1SRQA 4ADSG 2C2HA 3OPYI 2KM1A 5JNTA 4DUGD 3DCJA 1P3DA 1B8VA 4GWGA 5C8YB 4OHXA 4DPMA 4PYRA 3ZE9A 3FWZA 4RX1A 3GBPA 3GARA 3W8RA 1SHLA 3WLPA 2ABWA 2CNNA 4A73A 3FZNA 4C6TA 2FFBA 3DVRX 1Q77A 2FN4A 4KMMA 3DTVB 1UXHA 2J9RA 1RQLA 2YVQA 4B09A 4D0LB 2FN7A 4D5GA 4R1PA 1NNI1 3Q8MA 1NVAA 3KWFA 5CVDA 1PLJA 2R2GA 2WTXA 4PIVA 3SJBA 4B4WA 4OFXA 1GNSA 3E7PA 3H6GA 4I9HA 5FI0B 3I53A 3K05A 4JYMA 4UUQA 1T24A 5FYQA 1C4OA 4UDOA 2BM0A 2EEZA 1PQYA 1EFRA 5AVVA 3EPHA 2MR5A 1KZLA 2FPIB 1Z5UA 3QFRA 1U4OA 2OP1A 4Q9JA 1JPVA 2FTKE 2FZLA 3ZU6A 3ZDEA 3NC0C 1ORWA 4D42A 4CMBA 1T5TA 5JXJA 3GLFE 2AMFA 3RRXA 1IOZA 4DCCA 2UXBB 2CXHA 1KSFX 2QE6A 3AILA 1CT9A 4KMRA 4EGFA 1CKEA 4LV5B 2EKQA 3PEVA 3PDJA 3LY9A 1DXYA 4HRXA 5KOYA 1XTZA 5EKUA 3TRIA 2JAQA 2ZI4A 2ZRMA 4UU7A 5LYJB 4OLBA 1XHLA 2JAOA 3DCYA 3SFVA 4UOEA 4GGOA 4U7WA 3ZTYA 1N2OA 3DZBA 3NNSA 4B6RA 4R98A 3C5EA 3PWKA 4IKPA 4I5EA 3GH1A 4XEHA 1GPLA 2Q5QA 4KV9A 2RAVA 3DPSA 3H2GA 3S70A 3TAXA 3DGFC 3JSXA 3EXEA 1G41A 5CX4A 2ZIEA 1A8HA 4X0EA 4AQ7A 1FMFA 2MSNA 2KJQA 4BS9A 1OKKA 4MZDA 4OYRA 4PZDA 1T9GS 2ENUA 1B3BA 2ZFUA 5F3WB 2ZAIA 5IVPA 4BNLA 2EWWA 1PT9A 5C3MA 2MYTA 3O75A 4G63A 1FSFA 1KYWA 4L8GA 5C7OO 1RRMA 2BF7A 4YEDA 3D43A 1KO7A 1G21B 3FCYA 2DRIA 3PUZA 1ZSVA 4LDQA 2FRVA 1TA0A 2I3ZA 5CX1B 2ZT7A 3R9XA 4KXUA 4YAEA 1RCTE 3AM5A 1E1RA 2OGSA 1KI7A 4N3CA 3UUFA 4KC0A 3VDXA 4H7JA 1B93A 3B6JA 4GVLA 2YOGA 5H81A 1G2QA 2ZTLA 1TCCA 4YONB 4MINA 4QEDA 3ZJVA 4K9KA 5EWMB 1Z5OA 1LV7A 4QDZA 2XUKA 4AZ0A 1R4NA 3N0WA 1D4FA 1A9ZA 3AZPA 4OHWA 4ZJUA 7AT1A 2C7BA 4ER5A 5IW8A 2R86A 2XT6A 3I1FA 2WJ6A 2XQFA 4MS3A 3OFNA 3LPNA 3SEAA 4JASB 1FSSA 3ZY4A 3NCTA 3T7JA 4TZ0A 2A5DA 4EUNA 5BV1A 5TXGA 4HB2A 2R6FA 1Z0JA 2OCBA 2DWUA 4LF8B 3A3PA 1H6CA 3PGMA 1MG5A 4I46A 2A14A 2BGGA 3E7FA 2XJ4A 2OV2A 3GLHB 2YWBA 1CQIB 3GNLA 2Y1XA 3DMHA 2YS7A 3OF2A 3TFQA 3PK0A 3F4LA 3O9MA 2B83A 4OPSA 4JYBA 3IP6A 1QHHA 2X2FA 3V76A 3T0IA 3JZIA 2XGJA 2HSEA 4RF3A 1XF9A 3EEIA 3QXGA 2P2SA 1ZWKA 3GEDA 5JD3A 4EF5A 1J2UA 4HTFA 4LKRA 1Z5WA 3GT0A 2PYIA 2RHCA 2O8BB 2BYTA 4XASA 2DWCA 2VBFA 5BR4A 4LW8A 5FEUA 2QQ5A 5FBZA 2QL5A 4QNRA 3U40A 2IK8A 1JJAA 4R8MA 4ER6A 1UOQA 2Q1WA 3FAZA 5KX5A 3QU2A 1NW5A 4RU1A 5G4LA 1VSBA 1WDKA 3LJKA 3PQEA 3OPNA 2Q27A 2ZIAA 4YRFA 2ZTUA 3O31A 1MHTA 2DFKB 4TYNA 1P61B 2GSWA 5DE3A 4TT3D 4BVGA 1S0UA 3NTRA 4LDNA 4Y9SA 3U62A 4B44A 1H42A 2O0JA 5JECA 4CKZA 4WXRA 3UMVA 1VPVA 4XIYA 4X91A 5CIYA 1XA4A 2Q5JA 5TMDA 1KQ3A 4IIYA 1XTQA 1DEAA 1NC1A 1R0WA 3QJYA 1KDTA 1BH2A 3G8YA 2MWMA 2QTWB 4IXMA 2DGDA 4Y9DA 4RL6A 3SC4A 3EGXB 1DMSA 2A0YA 3EIFA 3OQHA 3A2KA 2JGKA 1NVGA 5K8CA 1EFKA 4F1WA 3U9LA 3PUKA 4CLOB 1X7YB 1JFRA 1ZL0A 4RDKA 1Y3AA 2GFIA 3GJ6A 3BD9A 1W2HA 5DI3B 2DLNA 1M2OA 2RGYA 4QPNA 5AK4A 5EL0A 2WWVD 5JW6A 4YCJA 3W3ZB 2XRMA 3KEMA 5C18A 2K7ZA 4PWZA 1FOEB 5KQGA 2R84A 1GJRA 5JADA 1YOVA 3PYLA 3IPYA 4CE6A 4NBUA 1HV8A 1W93A 3GJTA 4FHDA 3UK1A 3NUZA 5EOVA 3V8BA 4C22A 1FP7A 3EQ2A 2PX4A 1SCBA 1MVLA 1W49A 2AYXA 3AF3A 4QYIB 1G8GA 3G2PA 1ZRHA 5A2GA 2HW8A 3QITA 2CWDA 2BFCA 1YACA 2WICA 4P93A 4UUPA 3ESYA 3KT3A 3KZVA 3TPZA 3C6MA 5HIKA 3K8ZA 1Y0YA 2LRHA 3CNNA 2OZLA 4HR7A 1ZHOA 1YDHA 1OXVA 3W3AH 1BFKA 1FRVA 4EY5A 2XRZA 4RLZA 3JAKA 1ICIA 1WQ4A 4KN5A 2VHCA 5BVGA 5THKA 2P11A 4UUMA 1K73D 4ZO4A 4Q1DA 1JI3A 3KAPA 4KI7A 4LNUA 1UKEA 5K8LA 4PHHA 5HF5A 1W73A 4EW1A 3DFIA 3G89A 2VJQA 1SU7A 2RGWA 4G9BA 3WMEA 4DHEA 4ASUA 1GYPA 3NDJA 4DLTA 1T26A 3FPAA 1R9NA 2WINI 3HN6A 3TPFA 3U0VA 4IEIA 4JJ8A 5LZ5A 2WIDA 3GVLA 3FVWA 2BGMA 2WIFA 1LI4A 2IVFA 4XQFA 4LHZA 1H1TA 4LYFA 5SY6A 4DCGA 5JWRA 3W5DA 3FJOA 4RPJA 3RK0A 5DZSA 2D00A 3ZCVA 1HE5A 5CT8A 4PBSA 1H9BA 3RSSA 4YXWA 1TQ8A 4P2GA 3VPHA 1MH1A 1L7MA 3BB4A 1HI9A 2F1IA 4B6QA 3OE1A 1W9HA 1WRBA 4C0HA 3WIOA 2FW0A 3AFOA 2GN2A 2HGSA 2A0KA 3IIEA 4YLGA 5F1YA 3WKAA 2FPLA 3ZNPA 3CEPB 3KJFA 1BA2A 2EFJA 4JWKA 2C5EA 5FLKA 2I6FA 1BDJA 1GPBA 2XZDA 3GIWA 4UM9D 5IJXA 4GYJA 3KJEA 1NVBA 4F4HA 1CS0B 1SVNA 3ED1A 4MAAA 4RELA 3SQDA 1SVOA 1QMPA 1BDMA 1FMCA 1FP6A 1ZHFA 2D8MA 3ZU5A 1C3JA 3KCQA 4L9AA 4Q3CA 4RY8A 2IZZA 2CFOA 4ISCA 3V48A 3QHPA 2GVDC 1K8YB 3DQZA 5M5BA 2CNWD 2WVHA 2HF2A 1WX1A 1VL1A 2NO4A 3O4IA 3OLYA 1YIJB 4HDRA 1BVRA 4GMKA 4XX0A 3LW8A 2VSXA 3CN9A 2AFHA 3NYQA 5FTNA 4QTZA 2F8SA 4WX2B 1WDMA 4MRPA 4EWLA 5IPFA 5KQSA 5KYGA 3PX7A 1C8KA 3OCCA 3Q2IA 2NVBA 3QWHA 1QH1A 1ZC4A 4YMGA 3QVOA 2RHJA 3NP9A 3HJCA 1Z6GA 2HJWA 1KDPA 3HV2A 1T9ZA 3IT0A 3O90A 5F7JA 5HCIA 3T34A 2A1UA 1X74A 2YZGA 3D6TB 2HKIA 2GPWA 2C98A 4X7RA 2NT3A 4G5QA 3GVIA 3I1YA 3W3AD 3VKUA 4X7CA 3AGQA 4ZYLA 3ABRB 1ENPA 2X58A 3K1YA 4B4OA 1EZ1A 1YFZA 2C5LA 2FWRA 2X8AA 1VZ3A 5I4CA 1T3GA 3OPOA 3QPAA 1EZZA 1Q44A 2OECA 2C2BA 2YASA 4HHEA 3GLGE 1JT9A 5BP7A 4IDNA 4RHCA 1IULA 2B25A 3G3EA 3LD9A 4G5FA 1EP2B 3SLKA 1NA5A 1S2NA 5COQA 1IH8A 2XWPA 2HHHB 2V7XA 4BO2A 4BTEA 2GZHA 4H0NA 3OJOA 3QVLA 4OXRA 4RIIA 3RBXA 4C4PA 3KYDB 1B8NA 4TLAA 5EXDA 2ESRA 3REQB 1ABEA 4N0DA 2X6XA 2ZXIA 1ORHA 2HJRA 1B4DA 1A9RA 1NOIA 1Y89A 2FMHA 2OZPA 5LJLA 4RZQA 2NAFA 3CRW1 1GRNA 2O52A 1NP6A 2I1LA 3B9PA 1JXOA 2HEIA 1E2PA 2PR7A 5TPWA 2C2OA 3MJHA 4XB1A 4XVHA 1JIVA 2BKXA 4WLVA 1MJGM 4MULA 3OZCA 4B8YA 2JGIA 2YJ5A 5KTTA 4GR4A 4R1LA 4PSKA 2WD8A 1GFIA 2AD5A 1B0AA 1C7IA 4JJGA 4PN3A 1QLJA 4IZHA 2C88A 4Y2JA 3WMWA 4NTZA 1L4UA 4HS4A 1IEWA 3RAPR 3U3ZA 4M1KA 4E94A 5J4YA 4WRRA 1JLLA 5B12A 4N76A 2Q07A 4I6EA 5J47A 1KZYC 2JLSA 4YMIA 2H1VA 3ENWA 3MTQA 2P3LA 3M6WA 4HWSA 5M2QA 1UCFA 1YQEA 1XWIA 3Q5EA 1KFKB 1WKCA 4ZOAA 5EQJB 1I32A 1C1XB 4PTZA 2GUWA 4G89A 2JA2A 4MVJP 2VSFA 3P0RA 2O7VA 3BTUA 4HAVA 3RTGA 1BCSA 4ZVOA 2HL6A 4F3YA 3M4XA 3JYNA 1L0BA 1OZAA 4M8SA 3SKVA 4U9HS 4RNDB 1DS6A 4YAGA 5K4AA 2CLSA 4MUBA 3ZJ4A 1HZJA 1QIKA 1OSNA 2NV2B 3EIQA 1PCXA 2BKAA 4IQFA 4MR9A 4CHTA 4D57A 4X24A 2P1DA 4WECA 3AEKA 3ZHTA 2YVUA 4C4SA 3PPVA 4ZDJA 4Q24A 4JYAB 3HKDB 1POXA 2WJVA 1HE3A 2XMDA 2BUBA 2E55A 3FUUA 2AJLI 3MA0A 4O1HA 4XYEA 5DBHX 2E5LB 4BMXA 3PC3A 3U7RA 3Q11A 1GILA 4X61A 4ATNA 3PSAA 1NAHA 1XMJA 4XWAA 2WM8A 4YT5A 3KT8A 2HV9A 2C5SA 5CHYA 5TS3A 3UOWA 1ZR2A 4GRIA 4H7PA 1DAGA 4RZUA 1AQJA 3KU4A 4CMIA 2XLBA 1HR0B 1U0BB 1SOVA 1EP9A 1DLIA 1YRYE 4LXTA 2J67A 1M8FA 1QH9A 1Y6FA 2HA2A 1PR2A 1HT3A 5HMMA 1P8AA 1U8AA 4YQFA 2GKGA 1A71A 4EELA 2ZTNA 1ODCA 2YZ2A 1FXWF 2X8JB 1V9CA 3I05A 4BO6A 4MRSA 5EFOA 1OYOA 2EGHA 3VHXB 3I0NA 3NOQA 4MYCA 2WP8J 3G2OA 3U5TA 1T8SA 1GPWB 2VBCA 1P1KA 1TZ2A 1T1SA 4PV7A 5BWNA 3WWYA 3TCXB 1RZ3A 2OZEA 1L1RA 1VBMA 4O4IA 2DQKA 4ZOLB 5B1IA 1K6XA 3PJFA 4TLEA 2HPZA 4BYMA 1RWPA 2IEDA 3TKYA 5C8VA 4LJLA 4JS0A 1ZZGA 2I87A 3E53A 4KUGA 2XV1A 2GTIA 5DM2A 1O96B 2J08A 2X1LA 3UJCA 2NQ8A 4I9GA 5JXIA 3ZS9A 4HQ0A 3FFXA 1I7SB 3PQCA 4X05A 3E0XA 4C1BA 4E1BA 1P0CA 1GXSA 1HKUA 1NFRA 2RCNA 7YASA 4K9DA 3HEAA 1B2RA 1TM7E 3AQIA 4JBIA 1T2UA 2VDWA 2VPIA 3LDFA 4FP9A 1A96A 4BKMA 2AMYA 2P2ZA 3DWEX 1NLMA 3AESB 3LGSA 3O8OA 4Q4AA 7ADHA 1E2HA 4WQMA 1YRBA 3BERA 1OW3B 1ZNQO 2OCYC 4C3VA 1BE8A 3FNQA 5IYWA 5E4TA 4A92A 1F3LA 3AO0B 3QOFA 3MW8A 4V0ME 4K40A 4BX0A 2WSMA 2WHEA 4JY7A 2I4MA 1G5PA 4UD6A 2V7WA 1C1DB 3RS8A 5KVVA 1C3OA 2E18A 4MVJG 1X70A 2NUTB 1FDOA 5IH3A 4J4BA 2A5JA 3SHQA 4ICIA 2QX6A 3LU1A 4JT8A 1IVYA 2G9RA 5BR8B 2QMYA 4LHVA 4WK6A 1AKMA 1RM4A 2ERXA 1BXGA 1UZLA 3AKEA 3W6NA 5JISA 3EUWA 5TEVA 3O8BA 1Q84A 1B0PA 5EPUA 1ZUHA 1QE0A 1AK9A 5AWFC 4E15A 3JQPA 2G5CA 1E0AA 2LXNA 1HH4A 2UVDA 2GPSA 2JI6A 3FGZA 1F5SA 1KWKA 2O1EA 4MPPA 1YZQA 2RK4A 5ADVA 4GLBA 5AVSA 5AVUA 4XH9B 3FTDA 4FQ8A 5FPTA 1WKVA 4H15A 4GZ5A 2H7XA 3LHIA 3WLKX 4I66A 1E3QA 1T4GA 1VKNA 2B3TA 1JUDA 1GO2A 2HZBA 4R0NA 4TL8A 5TGTA 4E5KA 5CXUA 1GA6A 3W5AA 1Y1SA 4ZREA 3G88A 3DMPA 4QRIA 2IU3A 3DDHA 3FNBA 3WKDA 4UU8A 5AVOA 2D1RA 4G5HA 4YQEA 2C0CA 4K87A 1O87A 2GZAA 3UC9A 5KTRA 3WLAA 1Z0UA 1VPEA 3JWHA 5DOZA 3VPAA 1PFKA 3UFXB 4XWGA 4KH0A 4YDHB 4DRXB 4XUDA 1L5VA 2HQ1A 1JJIA 4V1CA 3WB2A 1RPZA 3D7MA 1F8XA 4XTRA 3WSTA 2GCGA 1W0KD 4DDTA 3E61A 1TPYA 2CFCA 2HQOA 3J81A 1B41A 1UZNA 3CM0A 4GVXA 1NDHA 1UZUA 3EWAA 3KYCA 4JUAA 1LTHR 4HDMB 4M9RA 2JNWA 4L3VA 3GJQA 1NV9A 4JR1A 1Y3BE 1T4BA 4AZSA 2C20A 2TRSB 2ZUEA 5JAIA 4EPVA 3KDSE 4JLMA 2OXRA 3CUYA 3IMEA 3KP1A 3SKXA 3EVFA 3JQAB 4R2XA 1TCVA 2H1IA 3HEMA 2ECKA 3LY5A 2XOKD 5BSHA 3H6KA 4CL2A 2NYUA 2ZE5A 2OCDA 3BB1A 4KLCA 1XJ5A 3G9UA 4GMXA 1NLZA 2ERYA 3AUAA 3OPXA 5E7QA 2X5JO 3X3HA 1WO8A 3D3WB 5LQKA 4OGLA 3WGMA 2BTOA 2GRUA 2QJOA 3JD0A 1VDZA 2GXQA 3FW1A 4RH1A 4AJ2A 3VC7A 3LGXA 1OTYA 8GPBA 3DF7A 1UDCA 3AHHA 4FGZA 4UUNA 2O7RA 2CXTA 2OWEA 3CF0A 3P9KA 1M0WA 4TV8B 5GZ6A 2J33A 3JQ7A 3U9SA 3D81A 3LYLA 3U60B 1LPAB 1EXMA 5CFRA 1PS8A 3SS8A 4WUTA 3RU9A 4R3WA 2VUHB 1RZVA 2FCRA 1QVVA 3ROGA 3EPPA 2HNAA 2E4AA 3ME5A 1VLVA 3KVVA 1E4OA 2QUZA 3ADPA 1M5UA 3I9FA 3Q88A 4O2BB 5ULLA 4HUQB 2AX3A 1HZZC 5CU7A 1GGEA 4QBFA 3EDCA 2B61A 3FUCA 1R8QA 1UD6A 1EDEA 3K16A 2DEUA 3M1IA 3CKYA 3B36A 4XW2A 2RHGB 3HGMA 4LYHA 2WG2A 4EUEA 4RLSA 3OAAA 2Z98A 4DQKA 4RCYA 2G0TA 5JRJA 4A10A 1DE0A 2YZKA 2ZB2A 2VJMA 1R18A 1UK6A 1XJ0A 3ABZA 4Q3AA 6PFKA 1L7QA 3TJZA 4ZQGA 3OE5A 2NP7A 1VSVA 5DLQC 3WGOA 2VRWA 3D2AA 3AQ4A 2C5HA 3QBVA 2PGXA 5ITWA 4LECA 4N40A 1O5IA 3RV3A 5JFGA 4RTNA 4KFCA 4BV3A 5EA2A 2B7CA 1AS0A 1G3IA 2PYZA 1T8UA 2QVXX 3JATB 4MSUA 3HXMA 4QO7A 1TK2A 2VDRB 1Q91A 1CERA 2CCGA 2VJLA 1R64A 2YICA 1AA9A 1GITA 1UK9A 4J9UE 3SS9X 4YT4A 2WD9A 4HNGA 1PFWA 4MKGA 2EP7A 3X1XA 3P2YA 4BZPA 4JLJA 1CB7A 4CKYA 1RABA 2OUIA 1ANKA 1ZD9A 4UREA 2QG4A 3KD2A 4OP1A 1Z38A 5IAKA 1QXSA 1EVKA 3A10A 4WASA 3SSNA 1ZUWA 4BXOA 1OXKB 4JQSA 4YCAA 1JPUA 1P2VA 1VFPA 1WV0A 4B87A 1FW8A 1F2VA 2JBWA 3SD7A 5BWBA 3SQOA 4RVGA 2HQRA 1QGZA 3WA6A 4XGRA 2IPNA 3DTYA 2YHIB 5CLHA 1ZCZA 5HZMA 4M7RA 4NICA 2F9MA 3UJ6A 1GAEO 2HWWA 4RYDA 3WGQA 1O9GA 3HDVA 3LQ1A 2JAXA 3AONB 2EERA 2FKNA 2OCAA 2M1ZA 3MUEA 3PUYA 1GNVA 5ALQA 3WOHA 2XZPA 2J9FB 5I9TA 1YB7A 3R0QA 5IT4A 1YQXA 1Z88A 4AJKA 2J3HA 5JC1A 2ZRBA 4P0PB 1AMUA 3BGVA 4TZKA 4UTOA 3PHLA 3EVNA 1W1IA 3EY4A 5EWLA 5K45A 4LWZA 3L7MA 4BLVA 2OZKA 1OGJA 2FU5C 3KPUA 4D9GA 2H5EA 1KE2A 4EPTA 3NALA 4N4AA 3IFSA 1F38A 1BU8A 1F8YA 3NBKA 3SR0A 1L5SA 4UBKA 2H92A 1G8FA 4DSUA 2DBYA 2QP4A 1KYYA 1MC4A 1OQAA 2PKRA 2GPAA 1FUEA 1JDVA 5HCNA 3IVGA 2CC2A 3CCRB 1J0BA 1J2JA 1G8HA 2B99A 2EL7A 2OD7A 2OL4A 3NH6A 4KSYA 4NYMQ 1WCXA 2AG1A 3V8MA 5A5EA 1C8VB 3I76A 3M5CA 4E46A 2PDAA 5JCXA 2O2SA 4L0CA 4NZOA 4RTPA 1T91A 3JPWA 2HMSA 4G0NA 4JQOA 2P4UA 4ZALA 3Q5DA 3SFTA 1JAYA 2FOXA 4COKA 3GGPA 3W34A 2JVKA 3R3VA 3VM6A 1YS7A 2YWGA 2C31A 3A1TA 2RGRA 3GR6A 4PIMA 2XUFA 3AKZA 1NN0A 5KVCA 4J7CA 1DI0A 5HDQA 1Z63A 1CJUC 1JJ2B 3EJWA 4MYTA 1Q1GA 3WK6A 2Y05A 4F3RA 2H1WA 1QUFA 1D1PA 3WNVA 4B85A 2H2HA 3K9BA 5HFNA 3LFUA 1T1GA 3HCPA 3CCFA 1H94A 2R96A 3MS7A 1SC6A 4MUMA 1WDWB 4WAUA 3DVLA 3IT1A 3OPMA 2WJPA 2GHTA 4RORA 5LOVB 1UXOA 1UMCB 2M9MA 4C87A 1KEEA 4QVIA 3MHPA 2JI7A 1ZK3A 3G0BA 4TYYA 5BNWA 3DDWA 4A36A 5BV7A 4O02B 2VDOB 4OJNA 5JI3E 2GREA 1BW9B 1YL6A 3ZNOA 3EXFA 2AEFA 2VZ0A 1SMKA 4PN7A 2QTCA 1C3VA 4GKKB 1QKIA 4FD3A 2B2NA 2BI7A 3GZNB 4FNMA 3D5TA 3T5GA 3R8FA 2PUFA 2RHWA 3ASSA 2IXBA 3QVGB 4FIZA 4K86A 3QG1A 4AWXA 4BLSA 5JHGB 3I55B 2XAAA 3NHAA 4IHJB 3DZFA 1KR5A 4NABA 1TYDE 5ALHA 1X87A 2Z3VA 4JROA 4MPJA 3K96A 1G20A 2QPTA 2C3MA 4Q00A 2DR2A 3GX1A 3HL0A 4RZHA 1QIGA 4XYMA 1IDN1 3CX8A 5C2JB 1P9WA 3CT6A 1PZMA 1TVKA 4QQRA 4ABYA 1QH8B 1MNQA 4RANA 4D41A 4BMOB 1PKEA 1V8BA 4GOJA 1QG4A 4F4UA 2O2CA 4JLVA 2YJ3A 2A8YA 4GX1A 1FFYA 4X7MA 4DBLC 2WTBA 1O6ZA 1R8SA 5JV5A 3LQKA 2R1VA 4BASA 3OCUA 3G0HA 1BD3A 4UTVA 3VKHA 4OQZA 3GO4A 3ZX5A 3OUUA 2AR0A 1VPWA 3PD1A 2BR4A 1ZMRA 3K0CA 3UG7A 3QUQA 1PD0A 1N0HA 2R1ZA 4K2AA 1NF3A 2EEPA 2FN8A 2ZRQA 3PUJA 2PE3A 2YZNA 3D59A 2PXHA 2WHQA 3DOFA 2DULA 2PRJA 5KJFA 3PDUA 5AM1A 1LXCA 2LGJA 4J0EA 3EZ6A 1F60A 3E8SA 1ZY2A 4WACA 2FXIA 4GO1A 1EM6A 3HZOA 5TPZA 3S8MA 1IQRA 4GEGA 2X0FA 2ZUUA 2Z30A 5EEHA 2QG9A 5E7JA 2V1UA 2GYWA 3CUSA 1SVIA 4F60A 4B4KA 3X1WA 4DLUA 4FFVA 4W82A 5LA6B 3RG8A 1X7DA 4AKSA 3RYHB 3ESDA 5ITZB 4DV7B 2IS2A 1FNSA 1KYZA 2GEDA 2OFXA 4RAQA 1FXUA 2Q3HA 1G8JA 3PPYA 3QX3A 2PZBA 3ZDBA 2GEBA 4O4IF 4JYZA 5HWSA 1QHSA 1MQ9A 1HL7A 5FNVB 2HUNA 4ZGGA 1QP0A 3HR7A 3HC7A 2DCMA 2BKVA 1ND5A 4RDXA 2BMDA 2WG0A 1PRYA 2COKA 3N2GB 2ZYDA 2ZM5A 4GXRA 4ZHQA 2HA3A 3FUVA 5GONB 1WABA 3S2SA 3S2GA 2CXPA 4YGXB 4E3ZA 5B3KA 1AF7A 3NRJA 2QHXA 1O94A 2IYFA 3WNBA 3GY0A 4WOBA 5AKGA 4JEHA 3L18A 1UOPA 4G23A 3A0UA 3JVIA 4GZ3A 3E3AA 1L5MA 4IDBA 1N7GA 2GM9A 4O4LB 1ISJA 2X77A 3ROPA 2GCPA 1O5TA 2CZQA 3BGSA 3FDZA 3ICWA 4M2LA 4P54A 3E7DA 3NHWA 4JUCA 4OQPA 4TKOB 3UM9A 1ZKMA 1OFUA 5HIJA 5JCPA 2R8BA 4RZ2A 3KFXA 3BXEA 5LCXA 3I2HA 1FFXA 1QZZA 4BPBA 4LKOA 3O8QB 4YAJA 4ZV9A 2Q6VA 2Q6IA 3TKLA 2CUTA 2WU0A 5AUNB 5EZSA 3HBLA 4RH3A 1EFLA 2PKEA 1CJBA 1C7JA 3AEZA 2A3RA 1PIWA 2JVJA 2N3ZA 2QE7D 2I9PA 1O08A 2CEAA 1GPDG 3AP3A 5FWYB 4AULA 4CM6A 4EFLA 4ZYUA 2Z3WA 3EARA 5ALJA 4DR4B 1KI6A 2WLTA 5L7TA 6ABPA 4XI9A 1XL1A 2XYQA 3U80A 3HXQA 4WOPA 3HZHA 1H8EA 1VQNB 4J0IA 4P6YA 1PL7A 2B8NA 3E1YE 3OEHA 2J1LA 3BK2A 3BMNA 3PPWA 4S0XA 4CUJA 1AKNA 3PA2A 1N8NA 1QHNA 2E89A 2X9NA 3BH7A 4DMGA 3F3MA 3F46A 4NBLA 5AVTA 1W1WA 5ILOA 5DGHA 3KAQA 5IN4A 3GROA 4PYNA 3Q1LA 1VMDA 2GJKA 1USVA 4XSVA 4S1OA 1A8SA 1N5JA 4JJAA 5CA0B 4HS9A 4X95A 5IJ9B 1BS1A 4UM8B 3OPVA 3HR4A 4QYWA 3BGDA 1OAKA 3R3HA 2BE9A 1U3VA 2HF9A 4JUBA 3X2SA 3ZDZB 3HXKA 2M2IA 5CNMA 1W48A 3DWFA 1DKUA 2FZ5A 2VF8A 2G7ZA 4FZVA 5AKYA 5HKKD 3KQOA 4LYGA 1SXQA 1WXGA 4DMLA 1L4MA 1MKYA 2Q2QA 4FMDF 1E98A 4PSVA 4A1OA 1EWRA 3EG9B 4Z9AA 1AKEA 2P1ZA 1HSOA 3AFGA 3C3XA 5AVYA 1C80A 1WV1A 4JC8A 2IXTA 1BN7A 4GKAA 4WGFA 1YMVA 4LXUA 2O8CB 1TU4A 3ELUA 5IP5A 3KHUA 5C81A 1A9YA 2GMWA 3BC9A 1KYXA 2Q5OA 3T5CA 3WRYA 4EHBA 3QVXA 3DE3X 1OT3A 5DT9A 1OIVA 3TIFA 4Q9HA 1WLYA 5LQDA 3CLRD 3G8DA 3U3KA 4I55F 3OM9A 2GAJA 5JAQA 4CIYA 2ZLBA 1JKJA 1UBHS 1XTKA 2FR1A 4AS3A 2QYTA 2CK3A 1ZONA 4HYTA 1GQ2A 3GLVA 4JEIA 1JV2B 1UPUA 2OV8A 4YRQA 4EUHA 2J30A 3AR4A 2OBTA 2M6RA 3GLIA 4OQYA 5E9JA 2AJ8A 1U0EA 2VYVD 2JZCA 4FYPA 3PXAA 4HI0E 1C3LA 2OOKA 3SZRA 3THWA 4F5EA 3I09A 3D6VA 1KD1D 4K88A 4AS1A 4ODIA 4AVZA 4DLBA 4GE3A 4OA8A 1OLSB 2P4SA 1I01A 2FHSA 1SRRA 1Z4IA 3ETCA 2YWHA 4LV6A 2I1WA 1U98A 4ILKA 3UAXA 4BLUA 1TM4E 2FUKA 1LS1A 4XE5A 4BFZA 2VZ9A 2GZSA 3LBFA 4V1CI 3HH8A 3HU5A 5LQMA 3OQVA 1Z22A 1QQBA 1DQZA 5GM2A 1SXHA 4AKEA 3KZCA 3O4VA 4LYEA 1GZSA 2AHRA 2QUIA 5EP1A 4R3UC 3NP7A 1OH5A 3G6WA 2Z6QA 2V74B 3IHLA 4K05A 4RDCA 3GA0A 4GC5A 3Q3IA 2RBKA 2PX2A 2FN9A 2G67A 2EYQA 3PKZA 4BIIA 5C32A 5BMVB 4K1XA 2I55A 1KO1A 5CYGA 2GVZC 4HNRA 3S7TA 1GCUA 4AN1A 1O8CA 2Q4OA 5A9SB 2OGZA 1QCDA 3KPYA 4KSBA 2WNSA 1E64A 1RT9A 1A9OA 4J76A 4M1OA 4NV3A 4GE0A 4RKQA 5AJTA 4D9FA 2C1EA 3BT7A 3HDHA 3BXZA 3OJCA 3RS5A 2ZRLA 1M2KA 2C2YA 5CP8A 4UHHA 2AFHE 3DLAA 3GLQA 1NTRA 4IOMA 5LQJA 1N9GA 1TAGA 2FCAA 1BXRA 1EFRD 1QX3A 3RHSA 1JVNA 4C0AC 2QTHA 2Q46A 3HWSA 4JU8A 2GAAA 1YZ3A 5KX5F 1TF2A 3E9ZA 1E94E 4R05A 4NAVA 1CR6A 4KR3A 3G1TA 3WGZA 2FW1A 5E2IA 3MRVA 3KRTA 5JSZB 1A5AB 3H5OA 1KEUA 1AXRA 1CK4A 3AVPA 1OZFA 2VP0A 3BHJA 3E35A 1WEKA 3ZNNA 3QI7A 3OCXA 1MOPA 4DPLA 1D8AA 3NHKA 1BVHA 3G0OA 1KJNA 5JYDA 3H9QA 2WTNA 4BCBA 2ENWA 1G8AA 4RK1A 3VOSA 4J0CA 3MXOA 4IXDA 3KZKA 1ZM2A 3FM9A 2JVIA 3Q9SA 5KOHB 5HEKA 5CYPA 3EA0A 4RXMA 2NZVG 4UXIA 2ZSKA 2D0OB 3HTXA 4KYIB 3FKQA 4P2NA 4I50A 4GIBA 5D1NA 2WTEA 1VQ4B 2AF3C 2BFNA 2FZVA 3NVDA 1LBHA 3Q6IA 3JQFA 4WV3A 2EKZA 3TLYA 4MKRA 3WYNA 2EFEB 3PNSA 4A27A 2C9YA 1Q21A 5CVTA 3D7RA 1NQUA 2WJGA 3T7SA 2GHRA 5ABPA 1GEEA 3MFQA 1VG8A 2EHDA 4JVLA 2WWGA 3W05A 3K73O 4KPUA 2WD7B 3I1IA 3DKIA 3RAEC 4NAUA 3A6DA 1NNSA 3DFMA 5LP1A 5DRYA 2OAEA 3SHWA 4CJXA 3R0JA 3IXLA 2RBEA 5J1SB 4BFCA 5REQB 4BQRA 1XNQB 5C0OE 4JBHA 5CLJA 1E1RD 1SHZA 1SWWA 1RYDA 2W2PA 3E8MA 3FCSB 1JYEA 1U2PA 2ODTX 3D5EA 1H0KA 3PUXA 2VZ8A 1V48A 1IY8A 3HVJA 3TR5A 1Y9JA 4GICA 1ADBA 4OHZA 4M76B 3TTXA 2PZEA 3L06A 3MWFA 4IIDA 3ANXA 1BGVA 4Z9BA 4I2VA 5KNDA 5A5FA 1SQ6A 5FWXB 1YDGA 3IB3A 3LT2A 2GD6A 1ULZA 3OFND 4IX9A 2IY9A 1DFHA 3LOUA 5D1HA 1LDEA 1GAWA 2ILTA 2PKWA 3RSHA 1WXWA 3W78A 5M3BA 4H4CA 1B76A 4QUJA 4RTKA 1KO8A 3ZVMA 1PNTA 2IUTA 1N3LA 4EBFA 1L5NA 3IDFA 3BL6A 3D1JA 3OP4A 4QDKA 1TJYA 5CM9C 4KQ1A 3QPUA 2FUG6 2BCGY 2Z2KA 5C5IA 4KQIA 2J48A 4C3OB 2AJTA 5KTPA 4B84A 2C2ZA 3S44A 1FMTA 2YV2A 4TSFD 1YDWA 1OFUX 2C0QA 2YY7A 3WY9A 1BMDA 4DDHA 5CBKA 3ZWQA 4LGMA 3CQ9A 2ZITA 4KR6A 4HGYA 4RYLA 4IF4A 4B6PA 2JC3A 3IVXA 3JW8A 3KU1A 1EVZA 2YWDA 1C9NA 1C4KA 1RD4A 3GLRA 3KQTA 2WPNA 1YCHA 3PR1A 1T9CA 4WDQA 3NT2A 2C4MA 3DA8A 3R5JA 1N4AA 4D02A 4CEJB 3TCKA 1E1DA 3BJIC 2H59A 1KMMA 3Q7IA 3WJ1A 3T56B 2OCGA 4JI4B 1XX6A 2EW1A 2DUUA 3T3EA 1N0VC 3MT7A 1RI3A 2IJGX 3P4UA 5JCZA 4JYPA 3ETJA 1QS0A 1NJ6A 2C4HA 5K05A 4XFKA 2PTGA 4CQNA 1NW7A 3JX9A 4WDRA 5TLSA 3A9VA 5KHLB 1SO8A 2CMKA 2D62A 4DFDA 1RPTA 3KLPX 4I4TA 2IW1A 3F6PA 5AK5A 3EDOA 4YY3B 2P68A 4JQCA 3DW3X 1UP6A 1KARA 3BAFA 1O8BA 3MTAA 2JS7A 2WAAA 2LCIA 3KPWA 4KREA 3QF4B 4RPKA 1SZCA 3HO6A 1W5BA 3CC8A 1GZ7A 3PUHA 3TLGB 1NVWQ 1YB6A 2YFQA 3K9HA 4K1LA 3WBJA 3VKVA 4C03A 2KQUA 1F8GA 3JU3A 4FS8A 4AC9A 3OQ6A 3E58A 4JK3A 4MW6A 5T4BA 1QJCA 4YMSA 4G1UC 2ZBRA 3L8HA 2AWOA 1EJBA 3OECA 1Q57A 3T3PB 3OT5A 2C2WA 2R8XA 5E0OA 2GA8A 3T9BA 1XZIA 2ODQA 1NR7A 3B3JA 3L01A 4E5NA 3DP9A 2DR0A 4MR8B 3ZX4A 1HA3A 4FOTA 1AV7A 5BT9A 1TADA 3BOSA 3KQMA 5AHRA 5DRTA 1SHUX 4N0EA 3HA3A 1L5HB 4MH0R 5BSWA 1E5LA 4CCSA 4HUTA 3ZN2A 2ZWAA 4UHDA 2HM7A 4Y1FA 4TLMB 4BFXA 1VLHA 2P2CA 3EIEA 5IC4A 3PF9A 2PT6A 4LY3A 2ZZQA 1FBNA 2E1BA 4QNNA 4R9VA 2ONJA 4V0NA 4Z4IA 1SQ5A 2O2EA 4KGVA 1RTKA 2FMFA 3ABSB 3JQ9A 2V6MA 4MW2A 3ISXA 1CIVA 4Q9IA 4J2HA 3JU4A 4ZVTA 1T2VA 1VI6A 1TLTA 2PH3A 1IMJA 2O5RA 2PQ6A 3G2LA 3KKKA 4Z4WA 4KL8S 4H1UA 2FEMA 4P2BA 3E5RA 3GEPA 3BE6A 4OP3A 1PZXA 1H23A 3E9NA 1MORA 5L3SA 3ADDA 3G5UA 5A0VA 1CRZA 1FU7A 3ISJA 1HETA 1VCIA 2J0EA 4XWYA 3RIEA 4FHFA 3K5HA 4EW3A 3R6DA 3ZJ5A 4WJLA 2I7DA 3QY9A 4FNAA 4QU0A 2GJSA 4HDOB 1E7YA 2XMQA 4ER3A 3NBFA 2JL1A 1Z0DA 2Q6TA 4PZ0A 2GYYA 1BJKA 3AY6A 5I7VA 2VHWA 4RHUA 3WVNA 4TKUB 4TTVA 2I99A 3AR2A 3EGIA 5ALXA 2DBVO 4P4GA 5E4FA 4XQ9A 4G0QA 1NI4B 4I36A 2VDNB 2X6WA 1K9SA 4J0DA 2NVWA 3Q7PA 3PUVA 4LJ9A 2H2DA 3GN2A 4KYTA 1RXYA 1A9XB 1KC3A 2Q9UA 3VR2D 4Q4HA 3WDMA 1I3CA 3WRWA 1RHKA 2GZ2A 3F47A 3S8EA 2HCBA 5CT9A 4RV9A 4IOKA 4MWZA 5HQ3A 4F96A 4HGRA 4IHQA 4A0GA 4OKNA 1YA6A 4F6RB 1P7CA 4L2IA 1GT91 2ZTGA 2OSBA 4R0VA 3H1GA 3BKXA 4JIGA 4UXHA 3E5MA 1QGOA 5EHZA 1BDBA 2OBRA 2BN4A 1UDAA 3C98A 3K4HA 4FXUA 4UCFA 5K1ZA 2NTYC 3L0PA 1ECJA 5TQ0A 5C8ZA 4G0UA 3DG9A 4K6KA 2I4RA 1NYLA 1Q11A 2ZZEA 3BL5A 4PU0A 3LDUA 4B2PA 4PRYA 4BNHA 4IGKA 5IKEA 1BLIA 4R0MA 1UQUA 2IZ1A 5CB6A 3U5ZB 2BZ0A 4PCLA 4PY2A 1U8CB 5HM6A 4MROA 4RFSB 1U1FA 3L5OA 2QVGA 5DYIA 5AVJA 4KBFA 1UJBA 3COVA 3RUEA 1M0EA 5DXJA 2KB0A 1H2EA 4G6ZA 4KHZA 1X1SA 3STHA 4AMZA 1LSJA 5FOWA 1NB9A 4B34A 1U9JA 4GMGA 1R6UA 1L4BA 3OJWA 2BBTA 1CUYA 2YUTA 3NIDB 1MXFA 1YV9A 4M9XA 3P2KA 3Q9LA 4NJMB 2XMZA 1YT5A 1VCNA 2OG2A 3CSSA 2R85A 3RSLA 2I67A 1M1NB 1UJ2A 2R87A 1Z2CA 4WN9B 4DCOA 5IKOA 1HLGA 2FW7A 5A3RA 3WYFA 4W63A 1XUOA 4AFNA 1TCAA 1WHTB 5JZOA 4B4DA 3SJPA 1I2CA 3JZFA 5F2NA 3KFLA 4JYCA 5ALDA 3FNEA 1VIVA 1Y6GA 1UBEA 5AXAA 4IRUB 5JIBA 5K0TA 2GDZA 4AQDA 2IY7A 4GP6A 5IMSA 1OILA 3AKYA 1L7VC 3EVTA 2WSBA 4ZDWA 4WNCA 1EFUA 1ISHA 3C6KA 4JBGA 4F9EA 3PX3A 2GSDA 3QEKA 2XBLA 2Q3LA 4XOUA 4JXXA 3DZKA 1H0SA 2YX1A 5FL3A 4HNUA 1T8WA 5EKSA 5JUWA 4H3VA 3NM4A 4E31A 1T2CA 2COUA 4EABA 3CHYA 3FPPA 1GG5A 2QAGA 1YBFA 4NBVA 1D2HA 4JT4A 3P32A 2IP1A 4AKHA 1EGVB 1ORVA 1U0LA 2C8VA 1KK3A 5C5EA 1TJNA 3CN7A 1BFUA 2GD2A 1NFQA 1SU4A 4LXQA 2QXTA 3LBNA 1H65A 3L8DA 2DHRA 1TVCA 3I01M 1IUKA 1W581 1UQTA 5FBQB 5EINA 1KZHA 1QC5A 4NATA 1NKVA 1GPNA 2HFKA 3L0SA 4JD5A 4J4HA 1DIBA 2NLOA 5J2TA 5TS2A 1KI2A 1TL7C 5B3JA 4ARZB 5CBPB 4Q66C 4J0QA 4V03A 1J0DA 2AZ4A 3LDHA 1LSSA 3DYIA 1L7RA 3P0JA 2YMMA 1SY7A 5DV9A 3AEYA 1SD5A 2Z4TA 5KTKA 3NO4A 4J8PA 5TDHA 1YR8A 1I1OA 1P9LA 1I3OA 4CMGA 5JROA 1XMPA 3PE6A 3WGNA 3B12A 4G84A 1WU8A 5J3JA 4HDKB 5DK4A 2NOAA 2VQDA 4WGGA 5BV2P 4Q4LA 3QLUC 3WWCA 4RK0A 4BB9A 4IWXA 3OTWA 1AO0A 3GVJA 4NBNA 1FBTA 1JHMA 3R6KA 1OBOA 2AE1A 5G2OA 3GIDA 4YRZA 3MLAA 1P3JA 1CP3A 3W5SA 3AP2A 1RPNA 3IQIX 4X7PA 1CVIA 3CPXA 3ICCA 3HB5X 3OZIA 2BRUA 4NZYA 5D5PA 1TF5A 2H2GA 5EHGA 3UMSA 2PUWA 3G23A 3PRJA 2YXNA 3K2EA 1J8FA 5AW8A 2O1XA 1I94B 4OAOA 5FPYA 3H2BA 1NJ5A 2I8CA 1ZI6A 3SPXA 4CDNA 1NVKA 4OLJA 3W6PA 3PZBA 3U3MA 4DIMA 5TQ2A 1MT0A 2EARA 3TQRA 2F3PA 1W6RA 4QUDA 4A26A 1OWMA 1JFLA 3EQ9A 3DWIA 1Y5NA 1E6LA 4HZIA 4M0DA 1PGQA 4CG2A 1PVVA 3LBIA 4EW2A 3OQOA 1DT5A 4S04A 1DZIA 2ZAMA 4NCNA 1ZINA 3ULKA 2EU8A 2V9PA 1O0CA 4AY6A 4CG3A 2FLKA 3K1AA 1EX7A 1NXVA 5D3ZA 3VVLA 2E4XA 2XVZA 2Q99A 3J7TA 4YA6A 4FS3A 4TVSA 3T1TA 4U7DA 1C7QA 1DJQA 3JVEA 1JEYB 3CMEB 3I6MA 4YP1A 1GSOA 1PDVA 4DMMA 3LHFA 5AHOA 4TWAA 4PNEA 3BORA 2PANA 3DOIA 3H84A 1XT6A 1EFHA 1SA0A 2C5GA 2FE1A 1I4EB 4CM4A 4E5YA 3GJ5A 4BB6A 2FPXA 5A4FS 4U0KA 5T8KC 1XMSA 1OX4A 3HV0A 2Y1LA 4UCQA 1R0YA 1JG2A 5LIRA 4RULA 1PKVA 3VYTB 4XGKA 2N1MA 4QTXA 4KWTA 3KOXA 4HNAB 1NDQA 3TOCA 3HJFA 2ISQA 3S2FA 2X6TA 3OI7A 3KEFA 3DVQX 1GU1A 5ALFA 3ZIDA 4PGOA 4YAOA 1M1ZA 4AG5A 4DIUA 1YZKA 3LT5A 3OA2A 2CLFB 2OKGA 4G81A 1OYVA 4YI3A 1KOGA 3DDYA 4Y9UA 2NTVA 3OIDA 2Q3CA 1YKFA 3AJRA 4NLLA 2XF2A 1SU6A 4K0RA 5CIQA 4CKCA 4FTWA 3I4FA 5KCZA 1X77A 3LXMA 1NBOA 3OVMA 1WG8A 2P30A 4IG9A 3USZA 5K99A 2X9QA 4HC4A 4L02A 1ZVVA 3RARA 3B8EA 1I9CA 1OYWA 3FDFA 3GGOA 3IR6A 3ZWCA 5JNWA 3ZVKA 3VMFA 4URFA 4C0XA 3Q15C 1RRPA 3LTEA 4CR6A 3H65A 1WL8A 4C88A 2PRKA 3RVLA 2OYCA 2HRQA 4YHHB 1TF7A 5EZ5A 4N0QA 1M5RA 3EQZA 1E1QD 4E32A 5HJ7A 4GXNA 2ZM6B 1N6IA 2H54A 1ZOLA 4L57A 2B4KA 4XQCA 3AR7A 1KXJA 1WY5A 1GADO 4MVJM 2D54A 2JFZA 1I6LA 5FUVA 4NYJR 2X22A 4O4JA 5MGNA 2IIPA 3AMVA 1DNPA 1TEHA 1XEFA 2SKCA 1G20E 1YU6A 1FYEA 1UKVY 3F96A 1F12A 3Q12A 3HU2A 1CC1S 5H1YA 3DL7A 4YPOA 4XAQA 5JNSA 5IJ9A 4WWVA 1U3CA 2ALJA 3OJ0A 4R01A 4EHHA 4LE1A 2HSDA 3BE4A 5DBFA 4JJIA 1O6FA 2HDHA 1GOTA 3VDQA 3BTOA 4WIAA 4E4YA 5J2UB 2X9GA 3I83A 5HS4A 2PJRA 5DBIA 4FIDA 2BTQB 2NSYA 4OYHA 5LP6A 3I9LA 3TNJA 2IP2A 3WQBA 2PV0A 4DA4A 2PQ2A 3IUYA 5AKKA 4P98A 3VRHA 3OZGA 2INGX 3K72B 2GJ4A 1ULSA 4P3YA 1I36A 3K35A 1WVIA 2VH2A 3E9MA 3KQNA 2JCVA 3H1FA 1SBHA 3C8UA 4K3VA 2PH7A 4LPKA 3A1CA 3IAS6 3PQ7A 4ND2A 3NDBB 2JASA 4CIVA 2I29A 3P2JA 1E99A 2GEJA 1WP6A 4ZQFA 3TXXA 2E21A 1K63A 4RTRA 1QK3A 1RJ9B 4L3WA 3RWMB 4E4RA 2HMUA 1E79A 3U3OA 3UJHA 4C89A 2WHXA 1ISFA 4FGWA 1DC7A 4LSWA 4YJ3F 5IDYA 4ZV7A 4FFWA 2KWIA 5EJ6A 1JFTA 4WOCA 3PJRA 4AMUA 4BQEA 4E21A 2OQVA 1N7IA 1BZYA 1RLOA 1WSBA 4J29A 4G7WA 3B2QA 4MUEA 2GDJA 4LQCA 1IJEA 4O4HA 2J7PA 2ET6A 5DLPA 4DLRA 4FUQA 4ZZ3A 5AW7A 3MWJA 2ZJ0A 1EUQA 2YMPA 4NR0A 3FTCA 1ZOPA 4DV6B 5AM0A 4IGEA 1NP7A 1UL1X 1Z5NA 1LVGA 2LKDA 5K3FB 3U7EB 2HSWA 1CHDA 3PNMA 3HUFA 2E6KA 4L28A 3V32A 3EOAI 1F17A 2NXEA 3FCAA 4BP8A 4XRGA 1NMZA 2PD4A 2PY6A 3UANA 3IO5A 4BQIA 1U9IC 1TQ6A 3AHCA 4BVAA 2O6LA 3KKQA 4Z4CA 1EGMB 2W22A 4UXJA 5JBNA 3ONNA 2Y8EA 4P33A 5YASA 1E1CA 2D0DA 3NAQA 5F1OA 1EXWA 3DW1X 4L5IA 1P0PA 5EUMA 3WSWA 1T1IA 4JBXA 4D96A 1OREA 3V7FA 5FTWA 3FB1A 1FYVA 1FJHA 1SG9A 3STVA 3KJNA 3BEDA 4OU5A 4TX1A 4AIRA 1ONOA 3O8NA 2BHLA 4RK5A 2UXCB 1JDBC 1K97A 2LD4A 3RFCA 2A58A 4DC9A 3A3YA 4Z4TA 1YK1A 2C59A 2D1YA 2TSYB 1Y5IA 3QXCA 4JT2A 3BPSA 4K6MA 1SUDA 3GLFB 1QQAA 2P35A 3OAAD 3PNOA 3M1LA 1J25A 1U2EA 1VKZA 3NHMA 5TEWA 2I2FA 3EF1A 4G65A 5DYWA 3DB1A 4UVHA 1K7FB 3BCFA 3UMMA 2C5AA 2YBEA 5T67A 3AJ9A 2H1RA 3GN1A 3JQBC 1JG7A 3KVNA 1LF0A 1M73E 1R8YA 4U7HA 3ZHUA 2F3UA 1KPHA 2RGCA 4M8LA 2Q1TA 3R5TA 4LDJA 1QOZA 1LNQA 3KS9A 3I64A 4HAXA 4D98A 3WXBA 4RCZA 5CFOA 1WY7A 1Q92A 3G9ZA 4QXAA 1JYSA 4A6EA 3T35A 5C31A 3HCNA 1ZG3A 3M4JA 4XDGA 3M1YA 4BVFA 5FWDA 1R88A 4UAUA 1EUYA 4HJXA 2QSUA 2ZRJA 3LE8A 3THXA 4ZVKA 5B2FA 1DAOA 1KKUA 1QZ3A 1A4UA 3C8HA 3ZJUA 5JJLA 4MRMA 1XXHA 4UMDA 1FSPA 4P4LA 2NO1A 2Q2WA 4J1TC 3E22A 5L6MB 5ECYA 1M2NA 3MWDA 2JN9A 4L7VA 4D8XA 4LHXA 3OQNA 2QT1A 2GZ1A 4X1IA 3QK7A 2DWOA 3JTMA 3MJTA 3TGLA 3ONUA 1J0XO 5HIIA 2ZUFA 5LR6A 2ONZA 1Z34A 2I22A 2J3EA 5IARA 4ZVLA 4D8TA 1J97A 3KQQA 3LLVA 4EJ2A 3BWXA 1Q7EA 4RA9B 4CEIB 1W25A 2C95A 2VK4A 5K0BA 4BQPA 1I18A 1Z4MA 3PGVA 2RKWA 4PO9A 3MYYA 1ZUIA 5LFAA 2JAPA 3DLIA 1UBOS 1M8KA 1UKYA 4EUKA 1E2QA 5L4LA 1K06A 4IUCS 4QQNA 3B2NA 1O0SA 3EIOA 5MGBA 3HRIA 3DBLB 3ENQA 3PHCA 5KAMA 1W8IA 2DX7A 5ALIA 4ECEA 3U7GA 1KDRA 1OHHD 5EE1A 5U4QA 1VG9B 4KWIA 1VJ0A 4KKUA 4GT1A 3N8NA 3TGWA 2Q41A 2RFLA 4MRNA 1UBKS 2VA8A 4FXOA 5IBQA 1ESDA 3JYOA 2XVYA 4OO3A 3U56A 4JWTA 6REQB 4MGZR 4HH3C 1PX2A 3NX4A 3ZGOA 2HCFA 2FJUA 4L51A 2R47A 3VKWA 2C7RA 2C78A 1B8UA 1EYZA 1P6UA 4G4SP 4BNGA 4DJAA 3GLIE 1YC2A 3HBMA 2OILA 4OSPA 4R16A 4FMCF 4F06A 1TKAA 2PS3A 1Q0HA 2O06A 1TD9A 2JD0A 4WFQA 3ZWWA 4NBWA 1YB4A 1H2FA 5TT1A 3WLEA 3QLTA 4U2KA 5GIPE 2BP7A 3ZDDA 2WHPA 3D7KA 4S24A 5FLEX 1JBKA 1URPA 2D5LA 2X42A 3D0KA 2V3WA 3FUXA 4FCVA 4GS5A 2F6RA 1MIOB 1KEPA 3ECAA 4C4AA 2PK3A 4IYRA 3G5TA 2JFXA 2PNFA 4LJ4A 4AG6A 2I65A 4ECAA 3ONDA 3D26A 1S3IA 2BFDA 2P5YA 4QU5A 2DPXA 3TBHA 4KPFC 4MW5A 3OM0A 3L43A 3H97A 4ZHQF 4OQXA 4L4UA 3DDUA 4OQNA 2ORYA 3PUWA 1OBFO 4UEWA 5E6SA 3K9LA 4ZANA 3ONYA 3GFOA 2PNJA 2PWAA 1QDLB 1IHUA 3NBMA 2HNBA 4O33A 4PTYA 1ZCFA 5D3MA 3GFGA 4GI7A 1G3RA 2RHLA 4J16C 5FUMA 3RUCA 1RM5A 2IT1A 1ODIA 1GR1A 5COAA 3HN2A 5EXPA 1ZH8A 4Z1MA 1X1CA 1DIRA 1M34A 3I23A 2HDNB 4MOWA 5IJWA 2PQ0A 3AHFA 2XXAB 4K9MA 3U4GA 3VJLA 5HQTA 2XODA 5H0IA 2XBUA 4PANA 4PXYA 4BMDA 3UMYA 1DWUA 2AKEA 1S2OA 2CXRA 2E49A 3L6DA 1XDWA 2HUPA 1WMAA 3DD5A 5GGXA 4H4EA 2WFZA 1GCOA 4MUYA 1IBKB 3NFYA 4QBTA 1JTVA 2ZDGA 2MOKA 4NCIA 2PUGA 3RSOA 1Q1EA 5K3DA 5F4JA 5FL7A 4ZCIA 2QP3A 3FF4A 3HDQA 3IV6A 1JNXX 2XUGA 4DJDC 4B7CA 3GLGB 4FZ3A 3ZPXA 1N0WA 2QMQA 5MDHA 2OHOA 4H17A 1TEZA 4CTMA 4K6HA 3LSTA 4I14A 1KO5A 5ITSA 5J23A 5JYCA 3UB3A 3HQ4O 3QKRB 4U4AA 1WSRA 3WKCA 1KH3A 3OCYA 4UHBA 1RKXA 1X38A 1S8AA 1X15A 3WQZA 4BKRA 5BXYA 5CB4B 4MTLA 1T2EA 3WLQA 3CE9A 4M21A 4P58A 4UEOA 3S99A 3GP8A 3CONA 1JN0A 1YCFA 1L7DA 1U0NA 2ATCA 5LWHA 4X71A 2QW0X 2FRXA 3F90A 4YIKA 4ZEXA 2P8SA 5ESXA 3W0LB 5LQCA 4C14A 2IBSA 5HBGA 2HV8A 3V42A 3NOVA 1J0CA 2GBLC 1CDOA 1N2GA 3LVBA 2P7HA 2OCXA 1IG0A 3G17A 3KG2A 1CUBA 1EWKA 4QT4A 3DNPA 3EEOA 1X7GA 4X93A 4EJSA 1S8FA 3D8SA 5PGMA 3K9NA 2PKQO 5I5GA 3K6RA 3NZEA 5FOVA 4BTVA 3GEHA 4CUZA 4DZZA 1S01A