1T6YA

Crystal structure of adp, amp, and fmn bound tm379
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
287
structure length
268
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
molecule tags Signaling protein,transferase
total genus 68
structure length 268
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6yA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6yA01
1TYDE 1O5TA 1OWPA 2ZP1A 4MVWA 4KKVA 2E0IA 1JGTA 4U8HA 4S1OA 3D6UA 3FY4A 2YWBA 5HG0A 1MAUA 3CLSD 3HZRA 1KQPA 1KP2A 3COWA 4MW0A 2CUZA 4Q16A 1WQ3A 1O95D 4X0EA 2QUIA 3SEZA 4EG7A 3GUZA 4MVYA 3PNBA 1WY5A 1PG2A 2J5BA 3H9BA 3UK2A 4AS1A 3SDBA 5TS2A 1T6YA 1JEEA 3ND5A 3FOCA 1EJ2A 1EUYA 3C8ZA 1V8FA 1WXIA 3L93A 1EUQA 3COYA 4DE5A 1TYCA 3CLUC 3CVUA 3AG6A 1O97D 3M5WA 4NAHA 3ZJUA 1NURA 1O96B 3NBKA 2CV0A 2IP1A 3KT8A 3MLAA 1QNFA 3RFFA 1NB9A 4MUJA 1SURA 1F7UA 1A8HA 4NDAA 3N9IA 2A1TS 1XNHA 1N2BA 3MXTA 5KWVA 1NP7A 4EG8A 1XNJA 2QJFA 1WXFA 4HJRA 1N78A 4J76A 1NZJA 1H1TA 3ND6A 4YP5A 4ZT5A 2A7XA 3IMCA 3MUEA 4MAFA 1N77A 4ZCSA 1U3DA 1J09A 4DDKA 1QRTA 3PRHA 4MUGA 2RD2A 2YXNA 4ZT7A 1N2OA 1QU3A 3RJZA 3UOWA 2X1LA 1O96A 1EFPB 2VBUA 1KH3A 2X3FA 1GAXA 2JANA 3SZGA 2CV1A 1J1ZA 2EL7A 3FDXA 3UMVA 2DR2A 2X0KA 3FNRA 1YIDA 3COVA 4MWBA 1IVSA 2AZXA 5EKDA 2QJTA 1G59A 3ND7A 5FO1A 1T6XA 1IHOA 2OQ2A 3DV2A 3ISJA 4ZCQA 5H16A 1GTRA 3P52A 4NZPA 3IH5A 1RQGA 2QTNA 1V47A 1M8PA 2XRYA 2O8VA 3FIUA 3X1JA 4ND7A 2QTMA 3CVXA 3VGJA 3IOBA 2CYBA 3RK0A 3CLUD 2V0GA 4MUHA 2DERA 2HGZA 4KPUA 1KQOA 1NUSA 1PFUA 3PXUA 1TQ8A 1YULA 2PG3A 3BL5A 4DDHA 2WQ7A 2H2AA 3AG5A 1H3FA 2VTBA 2X1MA 3AIIA 1EE1A 1JZSA 1J21A 4UZEA 2A84A 1QRUA 1GN8A 3G5AA 3Q10A 1MJHA 3N2YA 1IQRA 3ELBA 2D5BA 2IELA 3FH0A 1QU2A 2J08A 4I6EA 3QE4A 1M8KA 1P4MA 1J70A 1VBNA 1IQ0A 1K92A 1N2JA 3RBAA 2VBTA 1N2GA 3IMGA 2Z08A 1G8GA 4HK4A 3BNWA 1WKBA 1N2EA 1I6MA 1ULHA 3NBAA 1U3CA 3TZLA 3CVVA 2PFSA 1JHDA 2DUMA 4MUFA 2A1TR 4MW5A 3ZXIA 1J1UA 3H9CA 2P3MA 1K97A 4MVCA 4ZT6A 1YIAA 1WOYA 4R2LA 2BTEA 3LOQA 3IVXA 3KFLA 1KAQA 3CLTC 1LI7A 1PG0A 3OTWA 5J58A 1YUNA 1VBKA 4QBTA 1O94C 2XRZA 2CYCA 5TEWA 3H97A 3P0HA 3IVGA 1X8XA 4WSOA 1O0CA 1M8GA 4G5FA 4JFAA 2CFOA 3TZEA 3MMXA 1N08A 3VRHA 2NZ2A 3Q4GA 1CT9A 3IUBA 1YUMA 2Z09A 1WXGA 4MLPA 1I6KA 1MB9A 2R5WA 5AHWA 1ZUNA 3IDFA 4YP6A 1QTQA 3ZXSA 2I1LA 4HJXA 2RE8A 5TEVA 1BS2A 1I2DA 3INNA 3PNVA 4PBRA 1ZH0A 1IFXA 3PNYA 2CV2A 3X1MA 3G59A 4ZT2A 1NSYA 4KR9A 5J59A 4CDMA 2A86A 1S4MA 2G36A 4MW1A 3U1VA 2ZUEA 4R0NA 1N05A 3E27A 4YP7A 3ZJTA 5FO0A 2H29A 4K0RA 1PFVA 2IJGX 3UY4A 1Q15A 1WJGA 1G8HA 1NI5A 1O0BA 3SEQA 3A2KA 3IVCA 3FWKA 4ZCPA 1TFUA 3IMEA 4HPWA 3ZGZA 5A8AA 2YY5A 4KPUB 4Q93A 3CR8A 3CVYA 1M8FA 3FETA 3CLTD 1OBHA 4NATA 1Q77A 3A04A 2VTBB 5HUHA 2GKSA 4ARCA 2QUKA 1HYBA 2D54A 1OWLA 4R2MA 5FNZA 1M83A 4TS1A 3IODA 3AL0C 5LFAA 4EFKA 3I05A 3N05A 3KT3A 3KT0A 2DLCX 3F3MA 2WB2A 1KP3A 1N2HA 2GM3A 4RPIA 1F7VA 1WQ4A 1KH2A 4CT0A 4YBRA 4DLPA 2JAXA 4ND6A 1OWOA 4L2IB 1U0BB 1PFYA 1N07A 1NUTA 3CA8A 2TS1A 4OUDA 1JZQA 4FZJA 4JXZA 3L92A 5LLTA 3H99A 1UFVA 2BYTA 1YI8A 3LE8A 4J75A 2E89A 1R6TA 1N2IA 4G6ZA 4U63A 1GLNA 1KQNA 1EXDA 1JIKA 1GZUA 5IJXA 3HV0A 3H05A 3Q12A 1KH1A 2AG6A 2AKEA 3FI0A 1T9GS 1Q11A 2D13A 5DB4A 5J5AA 3CVWA 3P0JA 5H7XA 1O97C 2QJOA 4RUKA 1QRSA 2PZ8A 1T6ZA 4G5YA 3X1KA 4L2IA 5KCMA 3QTBA 4XFJA 4MVXA 3K9WA 1NUUA 4MW9A 3SZ3A 3CLRC 3HMQA 4QRDA 4PBTA 3A05A 1VL2A 1M8JA 1XNGA 1ILEA 1TEZA 4DDMA 4MUNA 4F3RA 2E21A 1LI5A 3GLVA 4MW6A 4DNXA 2YWCA 4MW7A 2A88A 1MOPA 3DLAA 1OBCA 5DEOA 1KORA 4PBSA 1OWMA 3TQIA 1OD6A 4E1AA 4MWCA 3A4IA 1Q19A 1COZA 3IUEA 1U7XA 1F4LA 3COZA 5IHXA 2DETA 2PZBA 1N1DA 5A88A 2VBSA 4K03A 1GTSA 2A1UA 2J07A 1NUQA 1FFYA 2QUJA 3NV7A 2B7LA 3OP1A 1K4MA 1KAMA 3HFJA 1F9AA 2OV4A 1OWNA 2GOYA 4P2BA 1IQUA 3TQOA 1NYLA 3JXEA 4PY2A 2CYAA 1QJCA 4A91A 3CTAA 3IOEA 3N8HA 2PZAA 3ZJVA 1KKUA 2HMAA 2DXIA 1MC1A 5HUJA 3SYTA 5TGTA 4KR6A 1TYBE 3IOCA 4QREA 4EGAA 1LW7A 3GMIA 2DPLA 3FG9A 1KR2A 4ARIA 1MAWA 4MW2A 5JBNA 1H3EA 5K0TA 4CQNA 2Z3VA 1TYAE 3CLRD 4OUDB 4ZCRA 2O5RA 5DASA 4ZT3A 3ZUGA 1JILA 1T9GR 4EG6A 1GPMA 4YMIA 1O94D 3KT6A 3DO8A 4XSVA 2C5SA 4MWEA 2CT8A 2CSXA 4MUKA 2WQ6A 4XFDA 2ZUFA 3P0IA 4JYZA 1ZJWA 2DEUA 4EG4A 1XJQA 1DNPA 4MUIA 4EG1A 1WXEA 1R6XA 5LM3A 1MB2A 4OJMX 4UZFA 1G8FA 3ZIUA 2QUHA 1PFWA 2WSIA 4MULA 1VLHA 2VXOA 5A89A 1N06A 1WXHA 1MRZA 3D6VA 4ZT4A 2EJCA 4EF6A 3CLSC 3TNJA 1D2RA 4KR7A 3SP1A 1J20A 5K0SA 3MLBA 1NB0A 1IH8A 1O95C 1Y42X 1EFVB 2JA2A 1JECA 4NAUA 1P7PA 1Q9SA 1I6LA 2HZ7A 3G6KA 4CDNA 4GRIA 1EFPA 3ILVA 1N75A 4MQ6A 4DJAA 1NUPA 1JIJA 2J09A 2VBVA 3K32A 3UC5A 3QTTA 3RHSA 3TS1A 1R6UA 5BNZA 1B6TA 1U7DA 1O6BA 2PXHA 5DK4A 4WNYA 4F4HA 3AKZA 1ZH6A 2J4DA 4I6GA 4EG5A 5KHAA 1JMVA 2A1UB 4ZCTA 5TRDA 4GU5A 3S3TA 4MUEA 1WZ2A 2A4MA 1JIIA 1EFVA 4NX2A 1MBZA 1N3LA 4MWDA 4AQ7A 2QTRA 5F23A 3RK1A 1X6VA 3HGMA 2V0CA 2PIDA 2NSYA 1M1ZA 3LCJA 3DPIA 4JZYA 4BWVA 4EG3A 1FYDA 1VBMA 3AFHA 3HL4A 4JXXA 2E18A 1IRXA 2OYNA 4I6JA 4U7JA 4MW4A 1K4KA 3FHJA 1QQTA 1H3NA 3VU8A 1JEDA 4H3SA
chains in the Genus database with same CATH superfamily
4IDBA 2DUWA 5IYNA 1SG0A 2WIJA 3SICE 1ZJ4A 2G70A 3GJYA 1V3VA 2ENWA 2ROQA 1Z0KA 4N8EA 3VR5H 4W9NC 2DHDA 4EYOA 5IZ4A 3B1WA 1FUYB 1HO3A 1JPVA 1Q1NA 5EVJA 2GD2A 4HI0E 3SGLA 4KO4S 1SUIA 4BTLA 2QL7A 4X85A 3RYIB 2WJYA 3T1TA 2X2EA 3UW3A 2YW9A 3BMNB 5BWBA 3S1SA 1JIXA 2Q5CA 4E15A 5KSWB 3AFIA 3IO5A 3OD1A 5BNIA 2AJTA 2QV7A 2N0SA 1DHTA 3P27A 4NBRA 3KUKA 4RSGA 3OQ1A 3SDBA 1NVWQ 4XUCA 5C4MA 4HAUA 5AW7A 1V8FA 3ZE8A 1G5PA 4ZJUA 3ORSA 3S5UA 3V4RA 1QHFA 3NPMA 3AM4A 2XA9A 3LC2O 4POAA 5EE9A 1XC7A 1C2TA 2WKQA 3R7NA 3RIMA 1P80A 5HFAA 3SJPA 1N6PA 2C3UA 5ELMA 4FDVA 1T2CA 3KLPX 1M0WA 4HQNA 4S1VA 4DLAA 1II8B 1KEVA 4XVHA 4K9LA 3RSFA 4ZVTA 2VTVA 4LXUA 4EHDA 2I2DA 2OM2A 5AHWA 3STVA 4O3MA 3LFUA 3NHJA 1LPMA 1VHEA 4YJHA 1N6RA 2XA1A 1C9KA 1P2TA 5K6AC 3FF4A 1OILA 4I9NA 4XASA 5L4LA 2B4TO 3UT5A 1J56A 1LV8A 3B7WA 1FL9A 2P5TB 5HRAA 1JJ2B 4MI1A 1MX9A 1YDGA 1EU1A 1MO3A 3KLMX 4PPFA 1H5UA 4WXMA 2NZWA 3LT5A 4L5BA 3IP5A 4MAFA 2GQFA 1BA2A 1P7WA 2BE7A 2RAFA 2X5KO 1PK7A 4B33A 1E7QA 3E35A 1N8NA 3RSZA 2UVPA 3UB4A 4E12A 5FWAA 1VCOA 2YXNA 1KOFA 3RWMB 3VOAA 5LQUA 3UJ9A 4Q37A 5AIBA 1B1AA 1DAFA 2I4MA 3LAWA 5ENZA 3WIOA 1MC4A 3EGXB 5AJVB 2W2XA 1XZBA 4W9MC 1ZK0A 4DY4A 1KH3A 1Q0ZA 2JANA 3H0CA 3Q3EA 2PEZA 4FE4A 1N33B 3IP8A 2A92A 2CHQA 3G5UA 3A8KA 3M6FA 2PTGA 3BSYA 5CLGA 3PENA 1P5FA 2BFAA 1Q6YA 2X23A 3IP6A 3R3SA 4GQIA 4IF4A 1XDSA 1L7MA 1YIDA 1EH5A 2CXHA 4Y2VA 5A6SB 5KWJA 3JYLA 3MW8A 4NZZA 4H77A 4GOND 1KEZA 1CS0B 4G25A 4HDQB 1XEWX 4BQNA 4WBNF 1T6XA 4ND2A 1M1NA 4D4GA 3PUXA 1L9XA 3EXHB 3FZGA 1PJ7A 2ZJ5A 2WM3A 5DW3A 1KBOA 3F46A 3KKKA 1U6IA 4P36A 1XPOA 3R0VA 1U9IC 1Y6GA 1HFJA 4JUIA 1UD8A 5JBQA 4GUDA 2IE0A 4PM4A 4Q7MB 2FRDA 4DGSA 2JIMA 4ZANA 4RXTA 5JZBA 5CLIA 3ROQA 2QR3A 1WHTB 4FQ5A 3SEJA 2Q5FA 1N5KA 2R4UA 3BIWA 3HM2A 4I1UA 3W1WA 4ARUA 4WCFA 4G1FA 1LBSA 4QU9A 3ZTTA 4IH9A 3IJEB 2V1UA 2XOXA 1P9OA 1UL1X 1QGZA 5EMNA 2WK1A 1Y8AA 2PMCA 4O5OA 3SKYA 3HKBA 5T57A 2QL9A 3DAOA 4G67A 4OHVA 2WMYA 4OH7A 4XFKA 1G8KA 2VRWA 1PE0A 1LX6A 3BMCB 3E3NA 4ZICA 1G7SA 2YVUA 2QEXB 2CF5A 3N2YA 4IUYA 4R2HA 1BOOA 5K0LA 4FB5A 4JT2A 5E9AA 3OZUA 1WDKA 4DCPA 4MV6A 4Q34A 5LMNB 2J5RA 5MGNA 1JMYA 2FWBA 1C8LA 4YAIA 2E4UA 4IXWA 4IZOA 1N2GA 1UBGA 1P74A 4P84A 2OYRA 5K3EA 5DWDA 1YFLA 2BH2A 5EZYB 4W5RA 4IDQA 1CERA 4JT9A 1QH1A 2AN5A 4B73A 2GHTA 1KVSA 3IE2A 3WXBA 2PFSA 3BGWA 3EQ6A 3C3YA 4LN1A 5LP6F 4RAQA 5LA6B 2JIZD 1L1EA 1YQUA 1N8KA 4PAMA 4Q3LA 4FQ8A 5LCXA 1IVNA 3LRPA 3HXMA 1VHJA 2P11A 2IP4A 1COWA 2ZPAA 3F5SA 3R5TA 2X5OA 4MIOA 4QU0A 3RIGA 3STHA 2O7NA 1E2PA 2BEKA 3RQSA 3H9GA 2W42A 3OTWA 2L82A 5J58A 5I7EA 1P2VA 1STOA 4NMWA 3RSOA 3V8VA 3WYDA 4BX3A 3DLBA 5IEJA 1YQEA 3TLXA 1HT3A 1H8EA 4UUBA 4BCDA 4YRAA 3KHSA 3E1GA 4CKXA 3IVGA 4D6XA 4N6OA 2C8JA 3SJBA 3CC4B 1T3TA 1TLLA 2Q0QA 4MARA 4RJIA 5E0KB 4DCMA 3QUTA 3DMPA 1D2CA 3PX7A 5IH3A 1SC9A 2OK7A 4LJRA 3U60B 5JWOA 2OAP1 4DJJA 1QF7A 1ISFA 3ZE6A 5EQTA 4ZOLB 1WXGA 4R2XA 4UU1A 4RCVA 1VXRA 1VLYA 1Z82A 3L6BA 4ZVLA 2DFNA 3UWSA 4P3YA 1QTQA 3NEJA 5AW1A 5IM4F 2Q0HA 3W5HA 1NW3A 1MJFA 2WQZA 4TQUS 3C0KA 2J9FB 2VI5A 3NXSA 4M37A 4W4TA 5IUKC 1LQ2A 5JO0A 2RE8A 1P29A 3LCMA 3BY1A 3O2NA 4PZ0A 4YASA 2ZZEA 1G42A 3CJQA 4EP1A 1E1DA 2BI7A 1MEOA 2VFAA 2R7LA 4MLZA 1UT8A 4XX0A 3DJFA 4D9FA 1OT3A 2DQ4A 3SZLA 1CUAA 3GX1A 4V2UA 2VK2A 4B46A 3G8CA 4Q4DA 4B7AA 1OZFA 4YAGA 1JEYB 5DN9A 1A27A 2OBLA 4EYKA 5K0NA 1VI2A 1XSEA 2GR9A 1RRGA 1TIKA 3PVCA 4B7CA 3V2UA 3ZPNA 4RMGA 1L5FA 1CZRA 3B38A 2M6LA 1N92A 4BRWA 4LZAA 5CNKA 3T95A 1FU8A 3WLAA 1UAAA 1BHSA 4PYQA 2HBRA 4G1VA 2PAAA 3EXFB 4FYVA 2ZIGA 4ZRMA 4MUBA 5J2UF 3IPRA 1D8TA 5I8PA 1TQ6A 5BSYA 5KS2A 5AKEA 3SNKA 1M5TA 3E7DA 1Z4IA 5JLAA 3RAJA 4AJPA 2DIEA 4X7BA 4J03A 2C5HA 1JYEA 2GNAA 4L8YA 4UXJA 3TCKA 2Z2IA 1L8AA 3DUFB 4JN6B 5JPIA 2NSDA 3OT1A 4R6WA 1TAGA 4C2BA 4PABA 4G4JA 1U8ZA 2OTLB 2QMZA 1G16A 4NWIA 1K5DA 1XEAA 1X8JA 1U5AA 1KDVA 2AHOA 4LGCA 3IODA 2HRDA 2CL0X 3E0XA 4OHYA 1V5EA 4U02A 4OGWA 2WB2A 4IV0A 1DWUA 3O3CA 4IO0A 3WGLA 2IUYA 1BD3A 3H4IA 4AMGA 4TMWA 1UBHS 3SU8A 1M2NA 2H1CA 3MJHA 3BCUA 3ZC3A 1FCJA 1RIIA 3DXXA 1AH2A 2PGJA 5AXDA 2GPSA 1Q21A 1F17A 4WAUA 4EUSA 5IG2A 1HDZA 1F48A 1R4ZA 3RFXA 3G5MA 4UTRA 1E2KA 1SQSA 3N0TA 1P9LA 3GGOA 3RO7A 3ZBTA 1RADA 2JRCA 3CZ4A 3DFFA 1LSSA 3KOYA 5COAA 2K7FA 5F7OA 3IIEA 4WLOA 2WC1A 2KWIA 1EWVA 3A4LA 3GLKA 5ALDA 3AF2A 3CY6A 4CLOB 5CDHA 3FPFA 4DV3B 3CM0A 2ZRNA 5E2BA 5C1IA 1F4VA 1PL8A 2MSDB 3OEHA 1YASA 3M2PA 4Q7JB 4D9GA 2YV4A 1VPDA 4XSHA 1IEQA 1SUWA 5K3FA 1UK9A 3RU7A 1YX2A 3C7CB 4UM9B 3UMYA 3W2TA 3IP7A 4B6PA 2FRXA 1ZDMA 2XX3A 3KZ1E 4NZOA 2XNCA 5FUBA 4EZEA 1SHZA 2QJWA 3AI1A 3WFZA 2BZ0A 1T6ZA 2VHUA 1Z8DA 3EUFA 1UKBA 1DBPA 3X1KA 4D4HA 4YUYA 2JJMA 2IS4A 3IIKA 5F4OA 3W04A 5E3HA 3QTBA 2XOKA 4XFJA 3MGGA 1RPAA 1QIDA 3D64A 4LRWA 5SY9A 1JDJA 2C7PA 3SKBA 2UYQA 4PBTA 1QR6A 2QN2A 2WJPA 2AJBA 4FFWA 4MS3A 5JD4A 1ZC3A 1T25A 1T6BY 5TQ0A 2GKOA 3JD3A 2ZXEA 4MUNA 2HDOA 4FONA 3NVMB 4HL6A 1AZTA 2OVBA 4URFA 4BAZA 1TPYA 1Q83A 1DJQA 1I4TD 3HU5A 1OLXA 2BSQA 3QE0A 2M1ZA 4L02A 4JUAA 4MNTA 3NT5A 4BNXA 1S3IA 1YA8A 2FG7C 1KORA 4KV9A 4RU1A 2GCOA 3LQRA 4C4OA 3ZE1B 1D7AA 1TXGA 1U99A 4XM1A 5REQA 4PQEA 3PXBA 3LRTA 1JFRA 2AFHA 2B30A 2WAXA 5DXJA 4OREX 3ASTA 5CH5A 3GRPA 4F21A 1ZIPA 1ZO8A 1AURA 1LVGA 1SU7A 4XR6A 2NO5A 2WSMA 1A2BA 2X13A 4U1RA 2J3LA 1K5HA 5FOTA 3VUFA 2GJRA 1TLFA 2YHIA 5COBA 3WLKX 2H51A 2QUJA 2O8CB 2VP6A 4M6WB 4NJOA 4WOKA 2FFJA 4CWAA 3WKBA 1KKMA 1ACLA 1JYFA 2JIRA 2OUKA 2ZIXB 4MROA 1LSUA 5BWLA 4XMYA 1CZUA 1RBZA 2RGYA 5TPWA 1NR5A 2GOYA 2WJZB 4KAXA 3OZFA 3GLGB 3H5VA 4KIFA 3IX7A 2LPMA 2HB6A 2JJ1A 1QVGB 4CR6A 2GERA 2XVMA 3AHEA 1BWPA 1XTZA 4LCJA 1Z4KA 2WJ3A 5BN3A 2CXTA 2CYAA 4YEJA 3WWYA 4N7JA 5JAUA 1KMQA 3OLYA 1CC1S 4HGZA 4MCAA 3IIJA 2SICE 3F4LA 1HE1C 3HWX1 3U17A 3V1NA 2HJSA 2G88A 3QKIA 4QDXA 4UHJA 3W6PA 1CEEA 4YWJA 4DIMA 3FTCA 3UVEA 3PG5A 4ZXPA 3CF4G 1NXWA 4Z99A 3S28A 3WLOA 3FNFA 3QVGB 5EYPB 4JHXA 2LXNA 4E88A 1KR2A 2C94A 4AJNA 1K6EA 3KKOA 3A3BA 1KJ8A 2XUIA 5AKGA 1E2DA 5ES3A 2NZUG 5EZ6B 4D4JA 4EFMA 5JPDA 1IZ8A 2NUBA 3F3YA 2AJDA 2LDBA 2HQRA 3UAVA 3SE7A 5HKAA 4BVJA 3QPAA 1KQ3A 2HA6A 1C14A 3DL7A 1N2SA 1M75A 5CNJA 4B76A 4KQCA 2W6QA 1DAKA 1FW8A 3PX3A 2NTEA 4IS3A 2GJ9A 3ODPA 4EY3A 2C3YA 3WB1A 1E1MA 2JDID 3SSNA 5U4XA 4BEVA 5KYGA 3NKFA 1DRJA 2KI5A 2O8BB 3STYA 2WZPP 2XYRA 2O48X 2XTAA 3FGNA 3GOHA 3ISVA 1IUPA 2ORYA 4LRUA 3UAWA 1NC1A 3AF3A 4XFDA 3WZMA 1BXZA 1KXZA 2QL5A 1VGRA 5TVGA 5EXTA 4R1PA 4OOXA 5SZIA 1R6XA 2C4KA 4CM8B 3GN1A 2R1VB 3HEBA 4FN5A 5HRCA 2IQIA 1NBMA 2V7EA 3BXFA 2L69A 1LSOA 1O0SA 3Q38A 2GEUA 3PCTA 1HUQA 5D5PA 4H35A 4G8JA 4ZAFA 3ZI7A 1U98A 1TK3A 2GVNA 1KOLA 1M34B 1PK9A 1UAYA 2QRJA 3G23A 3Q8LA 1XQ6A 4FWIB 4G8DA 1F0KA 3CLSC 1IY0A 3LXMA 3I5XA 3USZA 4KR7A 3EGIA 3ORHA 1GPKA 2FMXA 3AJEA 3C6XA 3E61A 3L1HA 3VTKA 4XAQA 2K5UA 4HWPA 4ZTBA 3VYRB 4FD3A 2QIPA 3Q8KA 4KEAA 3KPJA 4Z9YA 1T29A 2VYND 4Z7NB 5L6LB 4XPIB 1TJ3A 3IULA 4NAUA 2DLNA 2CLLB 4D9KA 1RXWA 4OOVA 1SBTA 4JWTA 3OOHA 1RHJA 1T9HA 5FTKA 2HRCA 2F1RA 1F8GA 1R9GA 2FSSA 2XUPA 2V4DA 5GONB 3RUCA 4GLJA 4GSKA 4HQKA 4AMUA 1TQ4A 1XAGA 3RIXA 3OD5A 2PQ2A 4D8UA 3WNDA 3VKVA 2CJWA 1PZNA 4FDLA 4PHTA 3OIFA 4DOMA 1D6NA 4E32A 4TKUB 2V5VA 1YR3A 4GPAA 3QTTA 3FYHA 1DFHA 2VJAA 2GSWA 2YS7A 2EL9A 4KZKA 4C4RA 5BNZA 5LQJA 2OZKA 2F3UA 2REXB 3DC7A 3MRXA 5DK4A 4IFEA 2XT9A 3Q6RA 1VYUA 4J3FA 3CP2A 5KKAA 3SEFA 3I76A 2Q5EA 3Q9NA 5KWEA 4OV6B 1CVIA 1DWOA 3ADCA 3AESB 3H8JA 4FFMA 4D80A 2R84A 4YT4A 2HA5A 3H3JA 1POXA 2ODEA 3VSEA 2HRRA 3VTZA 1D4AA 1X2EA 3B52X 5DM1A 4CMKA 3W3AD 1I1QB 3CISA 1YO6A 1GTL1 2NO7A 1X2BA 2UYOA 2RBGA 2CLKB 1T5BA 1M1ZA 2Y1FA 3F8WA 3LCJA 4J4HA 4TWBA 2EBWA 2EF1A 3LQ4A 4DPKA 3ESXA 1WOSA 2Q3CA 1JJFA 2B1JA 3GFOA 3IT2A 3HL4A 3S2UA 3U9SA 2JN9A 5A02A 1KZ4A 1YJAA 1U2PA 2PUJA 1PJ3A 1NTOA 1CQIB 1YU6A 2UUPA 4MLDA 4KRYA 5AQEA 2CXSA 4H6PA 4B3DA 1AQJA 1VA5A 1OXTA 1MAVA 3DZKA 3UBMA 1XTPA 4K5QA 3PD1A 1OH8A 4KX3A 1DT3A 3L77A 1TF7A 4AROA 3QW4B 1NNUA 1VIDA 1XZPA 4LZZA 1YZHA 2DJ5A 2VHCA 3H1TA 4R3NA 3R5FA 5A3SA 4XJTA 1MHPA 4B6OA 1KAOA 3GEBA 3NCTA 2IHUA 2RCYA 3FZEA 1P91A 3LL7A 2R3SA 2WJHA 1WQ3A 4GHWA 1NG9A 1A9TA 1LDMA 1Q20A 3EC1A 5LB4A 5AM1A 1WQ1R 2OOKA 2Y67A 4YJDA 2P2DA 3TSOA 3LKDA 4GKJB 1AA6A 2OO7A 4G1BA 1DARA 3QFFA 1GJRA 4GPZA 2FUEA 1OFUA 3ND5A 4OU4A 1EJ2A 4JS0A 2ZU6A 4OQQA 3GPLA 3K0FB 4D82A 4GI1A 1AKYA 4GUAA 3CESA 2DMRA 1C0KA 4DE5A 3C74A 5FNVA 1ZESA 5KTRA 1K8ZB 5AO9A 2BV3A 4BFYA 5EHQA 3PGKA 4Z9XA 4BYMA 5BVHB 3IB6A 3VU0A 2IP1A 3DLCA 1N3BA 4P7KA 4NQRA 1D8AA 2BJHA 4UTZA 4HVTA 2QNBA 4CM3A 3QIVA 1Y0BA 3AVTA 4WKOA 2SKCA 1JHOA 2PO5A 4CCYB 1ZWKA 2AQ8A 1WSVA 3EGDB 3EK2A 2AFIE 3SYMA 4IGAA 1ZZEA 2VWPA 1C7IA 3RRMA 4TTJA 4QNRA 4F71A 2QJFA 2PLWA 4XKVA 3RYCA 4DC0A 3CONA 4YQFA 1J8QA 1P4RA 2IV3A 2FDCA 3EA4A 2Q28A 3VOBA 1Z2EA 4H6WA 3KPWA 3U7EB 2AW3A 1TA0A 2GT1A 2X9NA 3IAAA 1OGJA 1F1JA 1RACA 1KR5A 4B2IA 2H5JA 3QNUA 4EHLA 3EYWA 4B6SA 4CQMA 2CJPA 1ENPA 4Z1MD 3U5TA 4MQFB 4EITA 2YH2A 1SKYE 1RVDA 1XTSA 1TVMA 3RJZA 5AW9A 1EFPB 1PJ6A 1QG6A 4D41A 1SG9A 1Z5PA 2J85A 2WFLB 3GPCA 3IT1A 4AKGA 4I4CA 5HX7A 3LPDA 1D9ZA 1FXWA 3ZIDA 5IFLA 3O8LA 1TO1E 2G07A 5TIIA 1QG0A 3X44A 5JRZA 2VYCA 1G59A 2VYFA 2VNHA 3W7VA 3HCBA 4I4LA 1C0LA 4P3XA 4RVOA 4BE7B 1I8TA 4C4PA 1T2EA 4NZPA 5F9FA 1M2EA 2PXCA 4P5DA 1M6VA 3UFBA 2ZQ5A 2ZQZA 1DX9A 3QV2A 5E9QA 1FNNA 4QXMA 2P4UA 4O8ZA 4X8OA 3V4FA 3EDQA 1TTPB 2DBYA 3SJZA 1U0JA 1N34B 1KDRA 3FUUA 3HA2A 3CKKA 3CCSB 4PSUA 2AR9A 3OLXA 1XAHA 4G5XA 2C2YA 1G20E 1CQWA 3FDJA 2QR5A 4YQYA 2O3JA 4OK6A 1E79A 4GKAA 1NR1A 2FHSA 3VKFA 5DHAA 5BUZA 1Z2DA 3U3DA 3C48A 3IAEA 4WHMA 3D31A 3I4CA 5BR1A 3FDIA 1TT5B 3BX1A 3DTTA 1DIHA 3ILSA 1P5ZB 1UOOA 4Y1EA 3PQCA 5D3KA 1VJGA 5GJWC 2UXCB 5LKRA 3NM4A 3INGA 2WE7A 1APBA 3ZQUA 3K0AA 1ECLA 1PI3A 4CM4B 3FYCA 3WP1B 3M82A 4YCAA 2CJXA 4KH0A 2CLSA 3CTPA 2EZ4A 4Z4WA 3RADC 5IX8A 4TRMA 3LBYA 3ORQA 4YROA 2ZJ8A 3J7TA 4BGVA 3ELUA 4L5IA 4F5WA 4KQEA 3T7EA 1KJWA 3HCRA 2WT4A 2WILA 1R16A 4C2UA 4AYWA 1LJUA 3D3WA 2HHJA 1N5DA 1ZKDA 4K46A 1PTKA 3NBAA 5SY6A 4WCVA 3DAFA 4KNYA 2VBCA 4YCDA 3RNOA 2ZPUA 2HKIA 3WYCA 1YZQA 3L4BA 1SIBE 5E4TA 1TD9A 1Z4MA 4TLMB 1RYDA 1UFQA 3QZUA 1QE0A 2HEGA 1NVDA 2GM9A 1CJTC 1P1FA 2OO5C 4ZT6A 2GTIA 4KO3S 2CD9A 4COKA 3L0IB 1UWKA 1A7UA 1THTA 3ZJVA 4REMA 1YJCA 4HWGA 3ZV5A 1XT6A 2IYXA 3I2KA 3L5KA 3VSAA 1QLJA 2EERA 4FW8A 3UWOA 5FTNA 5KMGA 1NY6A 4GKBA 3RUPA 1UMBA 4DADA 4G1EB 2PX0A 3H9QA 2PRKA 2C20A 1WEKA 1SA0A 2WUEA 1K6XA 5JYBA 3NKVA 1VM6A 2ZAIA 1X8XA 1DC8A 1M8GA 3E5RA 4B7UA 2D62A 2H8KA 2HDHA 4HGRA 4N49A 1LD3A 3ZVLA 4KQHA 2BUAA 2HA4A 3CUYA 3I2FA 3KXLA 4TWAA 1M73E 1PSDA 4V02A 3HYSA 9ATCA 1AV6A 2QGZA 2A5LA 1KYXA 3AX6A 3OQVA 4KGDA 3WMRA 5I9LA 1I6KA 1ODSA 2I66A 1SULA 2R2GA 2EOAA 3STWA 3DMTA 4EYEA 4IMRA 5FPKA 4W5NA 1J0AA 3HO6A 5E9WA 4TUYA 5CDGA 4YAEA 4E94A 2Q5QA 3DWEX 4XRGA 3E9QA 4TVBA 2GEBA 2F43A 4KJXA 2WT8A 1QO0D 1M2HA 5M5BA 2MINB 1DJNA 2QTHA 3IEKA 4ZU1X 4C04A 5LZ9A 4XLAA 1SCAA 1EE2A 3DFMA 3IJ5A 5SV2A 1DC3A 1VJ0A 1X7XA 2FR8C 2J31A 2OOSA 3R3JA 4REQA 2JJQA 4HFJA 4FFVA 4R16A 2P27A 1NVEA 4YB8A 3FBWA 4I2NA 4A15A 2NZ8A 1YTUA 5CYFA 2C0PA 4R51A 4UTXA 3UF0A 1O08A 2II6A 2RGEA 2CRVA 3BJRA 3EOBI 3L04A 3ORYA 1UMCA 1Z63A 5BN5B 1PWEA 3MA0A 2VJPA 1BMFD 1MC8A 3D6TB 2B2XA 3FOAA 1ZP6A 2GN4A 2PS0A 3LC1O 2WG1A 4KMRA 3D6MA 3TTYA 4TMZA 5LZ2A 4DY6A 4QAQA 3N5CA 2DH6A 1B6RA 4C4AA 3GJ5A 5EJAA 3DVAB 2O8EB 1HEYA 1QIHA 2KYRA 4EA7A 3VNBA 3AEKB 2X8BA 3UGQA 1IB0A 3HU1A 1HK7A 1RC8A 2H2DA 3VA7A 1J8MF 1UBJS 4RY2A 3MGBA 4FEAA 3ST7A 1FF9A 5KDDA 2B4KA 4GZ3A 3CR8A 4EARA 3BZBA 3C1TA 3RTEA 4XDZA 5BV1A 3NGXA 3CLTD 2JJ2A 3K5WA 2DYKA 4AICA 4KRFA 4UNNA 3N6VA 3EB9A 5BNFA 1I1NA 4XCVA 3T1QA 3FSEA 2XHZA 3BQNB 5DVZA 4Q05A 4Z4IA 4W1PA 1SKAA 3V2GA 2EWVA 1UQRA 2QT0A 5KC8A 3R3ZA 2ZPTX 2YYAA 2IGBA 1DDOA 4EHAA 2G08A 2NU7A 3OC0A 3W9BA 4BQPA 4DJDC 3AF6A 3L6EA 4C05A 5C52B 1VJ1A 5DTJA 3N05A 1BH6A 1CUXA 3KT0A 4PVCA 2V98A 2PYZA 2FPPB 3WMEA 2DQSA 4UOQA 5T8KC 5L3QB 4FW9A 5ED0A 4AUNA 1SHKA 3FOEC 1IULA 4DIEA 5CK5A 2FUG6 3ONFA 4DAOA 2QX9A 3S40A 3KLNA 5DTEA 4ER0A 2AZDA 3HUFA 3A9VA 4Y6GB 1GPUA 1MAHA 4L50A 2B98A 4MR9B 2PV0A 1ORTA 3SMVA 3OJWA 4GM4A 2MYTA 1QHNA 2FWMX 1QP0A 1DJPA 2I2XB 3QM1A 3F96A 4V0OA 2NU8B 3WGQA 3HR8A 3RI3A 4XLTA 1G0NA 1TJYA 1YB1A 1JEQB 3AI2A 4G5HA 4BKOA 4K88A 4BNZA 1G5TA 3AEUA 4UD6A 4ZARA 4A36A 1NQOA 3F7TA 4FCWA 4FS3A 2QSJA 1SC4A 1UC4B 1Z3CA 3A8JA 2IL1A 1R7RA 2D7DA 1TJ4A 3IUMA 5FYDA 4KOEC 2YR0A 1L5LA 3TTWA 2IBTA 1E62A 1LFDB 2G9VA 4HDSA 5LKAA 2VSNA 2AFIA 1H2BA 2AG6A 3BWVA 3FNBA 5EMLA 2VJCA 3PD7A 4YJFA 5ALQA 1VJ5A 3AT1A 4OLJA 1NPTO 4X8MA 3HBMA 3P0JA 3Q5GA 1TCAA 3E5MA 3L7CA 5CCXA 3EXEB 2F3SA 2V5AA 2PLAA 3FDZA 4P58A 4PRLA 5IN5A 3UH0A 4IY1A 4CMIB 1NXQA 2HFKA 4L2IA 4R40A 1I7PA 5KCMA 1K7YA 4ENQA 3BCSA 1FSZA 1UK6A 4TKZA 1XCPA 4YRPA 3ZE0B 4X1IB 1CB7A 2YWFA 1TGVA 4ZHSA 5J5VA 3IJPA 4QRDA 3ON5A 3JARB 1UXOA 1HBJA 3KVYA 1XNGA 1FDIA 4KC0A 2C4WA 4BMXA 4DA4A 4HAIA 1TEZA 2F1IA 2TSYB 2E85A 3N2GB 4CKBB 2F00A 1SN7A 3EMVA 3QVOA 4B80A 4ZHQB 1KJZA 4DA7A 3O2QB 3KUCA 3VUEA 2CL5A 3D2CA 1QBGA 2R85A 4ZZIA 3M6MD 3DNFA 5C7LO 1PGNA 3BWXA 1PSZA 2ZL6A 1U8CB 1L1FA 2WWVD 3AHDA 4D6YA 2P65A 1YB4A 2JFZA 2WFAA 1GNVA 1W44A 2XE6A 3HFSA 1JA1A 2WUVA 3TD9A 4DJTA 1L7XA 4EYSA 1RNLA 3S5JA 3VYWA 3WICA 4Z53A 4P6YA 3D5TA 4N5NA 5JT1A 1N1DA 5A88A 2AUNA 4RV5A 4X6LA 1RHUA 3DYBA 1TPZA 3G4SB 1SHTX 2R97A 1K63A 4S0ZA 2JHCA 1PV4A 1G20A 3U3XA 1YGYA 4LSGA 1CQZA 4MV8A 2LKDA 3UMFA 1XTIA 2JHAA 4XIIA 3UAOA 4ZYXA 1RYFA 4J0JA 1I9CA 3PDCA 1DT5A 2ATEA 1ZXXA 3KQMA 3LF1A 4C1NA 1FEZA 2JGJA 1PYOA 5KPJA 2JW5A 2PUAA 1IBCA 2Q0XA 3ZY2A 4A10A 5CITA 3D43A 1WULS 4BO8A 1GXSA 1XVAA 4JROA 1T2NA 1G3UA 4US0R 2QI9C 1ZM3A 2GH1A 2FMKA 3QX7A 4KIWA 4WY5A 1JAZA 3WMWA 2DXIA 3JVDA 3CE6A 3BRCA 1L6IA 4UAGA 1ZCJA 4LI0A 3B1FA 2VKQA 3K1AA 4EABA 4LXHA 13PKA 4EW2A 2NP6A 3TXAA 5LQSA 5EOVA 3O4JA 3D81A 3N2KB 1U2DA 2ZSUA 3B51X 1R88A 4GOJA 4JC0A 1YJ8A 2AYZA 2CC2A 2QXYA 4GPBA 4KR2A 3CPSA 4GZLA 3RSHA 2VP4A 2EX4A 2J6BA 3QXXA 1KI7A 2GI4A 2PD4A 4N7RA 4X45A 1Q6ZA 4PLZA 2PT6A 4YJ3A 2ZRFA 4D81A 3AVYA 2DWCA 1WR8A 1G5IA 2PBZA 3ETNA 4JYBA 3SC2B 2J6IA 1P7ZA 2GBLC 2PGIA 2JFNA 4CFYA 5CG2A 1YB6A 2X0RA 4X90A 1VG8A 3R20A 3HKEB 3RVKA 5JTTA 2AI1A 3VMFA 2ATXA 1ND5A 2XDQB 3PVZA 2CL6X 3MLEA 5F7ZA 3OZBA 2WQ6A 2R5FA 3P0IA 3RASA 2EQAA 5AM3A 4BLOA 1JDVA 1F3LA 1ZMBA 4ZVQA 4BBJA 3ZJ4A 1G8YA 3VVMA 1MB2A 1X70A 1T8YA 2CMKA 5J3OA 3I6ZA 4JVNA 3WDMA 1ST2A 1JG1A 1QIJA 3PX2A 2HPZA 1V8ZA 2DB3A 2O4CA 1A4XA 2QVZX 3WRYC 1RPJA 1EHYA 5EEHA 3GEPA 4JKOA 1LRJA 4UM8B 1TJNA 3TLGA 3PHGA 2VLBA 1FX0A 1I5OA 2Y1DA 2B25A 3OJFA 1JI0A 5AM4A 1MJNA 3QENA 3KG2A 4H9GA 5B5SA 1E1RD 2IU0A 2UVQA 4G0QA 4BY9E 3DYVA 4X94A 1V5WA 4JR1A 1NG1A 1W85B 5G3YA 3SHWA 5BR7A 4PG7A 1ITZA 5E4YA 2OLEA 4MGZR 4BP8A 3T1YB 1E2LA 3ISTA 5B2ZA 1RWNA 1P7PA 3FM9A 3MS7A 4HNAA 4N8DA 4PN3A 4PFJA 2G8LA 3M49A 4XZ3A 4JCCA 1N3IA 3G6KA 4IDCA 3HI4A 3U7QB 3LBFA 2HADA 4P82A 4WKBA 3VPAA 5IDYA 2ZRLA 3PXGA 4AZTA 1UM9A 2QP3A 4KSBA 1KI6B 1NUPA 4XVUA 1VL6A 3TKLA 9LDTA 4JLAA 3KR9A 4K6CA 3RD5A 1UJCA 1WMBA 5EA2A 3TOXA 4ER3A 2IV2X 2PXHA 4P4TA 3ILXA 2X76A 3UPDA 2XUJA 4OHBA 4YGYA 3LY8A 1P5JA 2NTYC 5LBUA 1YZLA 5BPFA 3DAYA 2GFIA 2O6HA 2RC5A 3ZNPA 4KLCA 3GIWA 5KSPA 4OPOA 1JB1A 3I2IA 4NX2A 1XL1A 3JRWA 2QTRA 1DBVO 2CK3A 2ZB4A 3PR3A 1KGSA 1AKMA 3BD6A 4ACBA 4M55A 4X54A 5DISB 3ZWWA 3ETEA 2NSYA 3MTAA 4D8XA 1ZFNA 3QVWA 2LWIA 4WNIA 2INGX 3AFHA 3HXQA 5JECA 3PXCX 3G6WA 1P18A 5EMJA 1OAKA 2IY9A 4YP0A 4KMSA 1B4DA 5F52A 2IS2A 4Y2TA 4Z9FA 3RS7A 2GJSA 2WSBA 3P4UA 4RNCA 2OXIA 4TSKA 4HNVA 1X14A 1K9SA 1C9JA 3WBBA 3FMGA 1YQGA 4OI2A 4E22A 2H11A 5BSEA 2ZRJA 1OWPA 1J33A 4I5IA 2CW5A 1QC5B 4X91A 1JS1X 4YJGB 1QO9A 4QFDA 1PBNA 3DO5A 4YT8A 4DQLA 1GYPA 2X8LA 3QU4A 5AI0A 4DM7A 5EERA 2YXLA 4KRXA 4DMHA 4HIZA 1SUDA 1WW3A 4HDMB 1ZCFA 4WEOA 5CDTA 1EEXB 1KQPA 4GRDA 5A0FA 4R41A 3ENNA 3V7UA 4GLFA 3VHXB 3WHLA 3D8RA 3I39X 5F3RA 1FJ2A 5TPZD 1PJZA 1LDYA 1E6UA 2HN9A 3LC7O 4ZEOA 3X3HA 1E8NA 1XE1A 2QT9A 2H54A 1RU3A 3KVNA 3EUWA 3OU2A 4CEHB 1J24A 1CPYA 1HQKA 1SEVA 4MWTA 3LO8A 2PCLA 3OQHA 3P9CA 4O1MA 3UK2A 5LYJB 3K15A 4LHXA 4XCQA 1B16A 4PX5A 2JGDB 3C39A 2W6IA 1W47A 2DCUA 1A9XB 3DF9A 4I50A 1UAGA 5KX5A 3OQBA 4C4TA 2O5EA 4DM4A 1W88A 5C18A 1B3RA 2OBXA 3VKGA 3EZLA 1ZNYA 3GFBA 4MP6A 3DHNA 1C3OB 2JGFA 4XXHA 3T7CA 5FNVF 1YR9A 5KCZA 4DIUA 3TQTA 1IDN1 2FQXA 3K05A 3A6GA 1K28D 1TADA 4RTOA 1JFVA 1XHLA 1OAOC 4OBEA 2H4HA 5AK0A 3OT5A 3X2EA 2PT9A 4R7TA 5CB4A 3D8NA 3ZK9A 2ECKA 2H5LA 3KKZA 3GGCA 2AF4C 4R83A 3RRFA 4ZRNA 2LTAA 1BYIA 4NIMA 3D2LA 5JH7B 4J76A 3TF5A 3GA7A 3F6YA 4CR8A 1P0IA 1SU8A 4YAFA 1XTTA 1N77A 3RJ5A 1TGYA 1UPTA 4E3WA 1M33A 3Q6MA 5DCUA 4E33A 3THXB 3LCVB 3CO5A 4ZI7A 3PRHA 4FX2A 4RDLA 5CTAA 5I9BA 5JWHA 5EY5B 5K3OA 3CMCO 3DP9A 4HZUA 1OLSB 2H7CA 2GEJA 2SBTA 3D8SA 4X1KB 4XEHA 1CUUA 5JYDA 4N76A 2QZ9A 3GEIA 3GT0A 2MSCB 2O1EA 4G9EA 1G6HA 1RW4A 5KNLA 4FBLA 3AM3A 1KZ9A 1RXYA 2EL7A 2R4QA 2XY4A 3J7AC 4BMOB 3PT9A 3V34A 2ZOSA 1CQJA 5FV4A 1XKQA 4JHLA 2P2NA 5HZGA 3FGPA 4HF7A 2Y1EA 3Q6QA 2G9QA 3FPBA 4YCBA 5DHPA 3DFKA 2W6JD 3I9V6 3BCFA 3BWBA 4D9MA 5E1OA 5GJCA 3PXEA 1P0FA 2XECA 1BYUA 5C34B 2DGDA 4FDMA 4YGXB 4XUEA 2ZANA 1U90A 1B8PA 3OE4A 1P8JA 3IH5A 3P0FA 4TTSA 1F06A 2GZ2A 3CPJB 3WY9A 3PXAA 1CY1A 4Y2QA 1C5KA 1CXZA 3OEWA 3W7BA 2O8VA 2HNBA 2H2WA 3FIUA 4S3MA 4X20A 1RZUA 4FOOA 3ZHUA 3RCBA 4F3TA 4QPZA 3AY3A 3E3MA 4BNVA 2W8ZA 1AQ6A 2I62A 1NN0A 1PAUA 4GBGA 4GP6A 4KO2S 5GGXA 4PLTA 4U5QA 4F3CA 1N32B 3W2EA 3AR6A 4YXWA 1U81A 3HM9A 2HX1A 4KN6A 1Z4JA 2XJ4A 4UHHA 4U7DA 2X9QA 4IFIA 2UYYA 2HWKA 2P67A 2Q2QA 4FR5A 2FCAA 5FQNA 1Y7HA 2P6UA 1V11A 5KJ1A 1AD2A 1N7GA 1DQRA 2YWEA 3OZIA 4R2JA 1SXJE 1L5HA 3Q10A 4YREA 3ZLJA 1FTYA 4NFHA 4F7DA 3R5SA 2FU5C 4PG8A 4ZVUA 5FFMA 2UUOA 3AIOA 3MK31 4UCQA 621PA 2WWYA 4TQ9A 3MG9A 4I6EA 1P1CA 3QE4A 5DNUA 1N6HA 5CGZA 5LIRA 1X13A 4FXOA 3ZHYA 5F5XA 3GV0A 3Q9SA 1XD2A 3FBGA 4KE9A 3I56B 1GQ2A 2PV7A 5LC1A 2BFEA 4D4LA 5GZ1A 3OW7A 1ZVQA 3ZDAA 3CPXA 2HI0A 1XX6A 4OPSA 4ZI2A 4QXPA 4CG1A 1T13A 4K87A 2WVHA 3V9AA 4X7MA 3VQTA 3ZHQA 4HRVA 1VKZA 5F98A 1FDOA 4E5MA 1QZXA 5BMVB 3U6BA 1RYHA 1N5RA 1TIPA 3NCHA 3PNQA 1HDRA 2EYQA 1OCEA 1T24A 2Q1WA 5D5HA 1S3FA 1KAQA 4RY8A 4BVGA 1GHTA 3BFKA 5K4AA 5B6IA 1E2HA 3H5WA 4FZ3A 4KAJA 4OQ4A 3QF4A 4LXGA 4UFOA 2F55A 1QH8B 3K9BA 1C7FA 1IXZA 1J8DA 3H5IA 4J0GA 3M4XA 3C8DA 5TEWA 3H97A 3LLCA 3AUAA 4JBXA 4MVJI 2YUTA 5ALGA 10MHA 2EW1A 1Z5WA 4KIJA 3DNPA 1A9YA 4HGYA 1M1YB 4JUDX 3SPXA 5KJ6A 4QYWA 4MWZA 1J99A 3ER9A 3CTMA 3HVJA 1BU5A 5FTLA 4PZPA 2G40A 2EFEB 3ZWYA 3U44A 3G2KA 1DJLA 2FZCA 3NGLA 5DGHA 4F2GA 5CVJA 1VHDA 4XLZA 4ESVA 3OQJA 4AK9A 3RRXA 3WQHA 3UUGA 3NTQA 4EB0A 3NDPA 1IY2A 4ARZB 5AVOA 1KAEA 2DBRA 3PCRB 3BXHA 4LKOA 4KPYA 4O25A 4TUYF 2RB5A 3B85A 3OOSA 3TXXA 4WRRA 4BEJA 4CGZA 2BBWA 2C1EA 4H0CA 3G59A 4FC6A 4KR9A 2XBMA 1GSHA 1NGSA 1WNFA 4J43A 1VL0A 4P7JA 4TTAA 2YV5A 4R9VA 3W9SA 1Y5LA 4M54A 2HIHA 4Y2HA 2YC4C 4CHGA 3AVXA 4BLQA 4OG2A 1DXOA 1HC7A 4FYWA 1DO2A 2WD9A 1SCUA 4KP7A 4ZYUA 4RCZA 2FZ4A 3A4VA 4MITA 1W9XA 1W4LA 4IIJB 3TPZA 5FULA 5FO0A 2CNWD 2NUAA 1HLPA 1ZBQA 2B1IA 4F56A 4RIEA 1NLUA 3G9QA 4YK7A 4G3XA 5D2CA 5J35A 3KQLA 3V48A 2DECA 1CR1A 4QPPA 3G68A 1WP9A 2WI8A 5EMMA 3OQMA 3DDYA 5U9CA 2CLIB 4RIGA 4JIMA 2QNRA 1FFWA 4GP7A 2BSXA 1FE8A 5KAMA 1Q17A 3OZAA 5I7OA 4EB6A 4IEFB 4L78A 4TRJA 4XJVA 1AKNA 1F1BA 2VF5X 5IKOA 3U0VA 2H85A 2PCJA 4X7FA 2Y77A 2OT3B 4WINA 4ERNA 1UD6A 3GQVA 3BH6A 3TEJA 4YECA 1YE3A 2H07A 3IP3A 3QRWA 1H1LB 2BGMA 2EC5A 3TNLA 4RWZA 4GZ5A 4ARBA 4JELA 4JXJA 5BWCA 1OKKD 3O91A 4RVDA 2C03A 2PYIA 4F86A 3BWMA 3STTA 3I2YX 5LFAA 1CUZA 4UDOA 3FPHA 1SUAA 2NO9A 4ND8A 3H86A 4UHKA 3UMJA 4E5PA 1M10A 1A97A 1XMIA 2CUTA 4Q4AB 4C14A 4QZVA 3URMA 4KW7A 4YBZA 5MGBA 1F7VA 1K5GA 3TAXA 3GRUA 2J67A 2IIPA 1BX1A 1ZD4A 1A71A 4ND6A 4JJAA 3H9EO 4L8WB 3FCXA 3QYPA 4PN7A 1DVRA 1NUTA 1P5HA 2FRVA 1A4RA 3E9MA 4FZJA 4LF4B 3U3JA 3SKXA 5J23A 1JR6A 1DTWA 2KBEA 3KEMA 1R0ZA 1RYEA 3CG4A 5LP6C 4P22A 2H1HA 2Z3ZA 4JC8A 4LJKA 3RUEA 4DRYA 2FPIB 3H4VA 2RHTA 3LE8A 4JI8B 1XRLA 3GP8A 3Q3JB 3RS2A 3OFSA 5EE5B 3RHZA 2EJWA 4QUHA 3V1YA 4H4DA 5JU6A 2BFFA 3W5VA 4U63A 1NM5A 1HRKA 3UK7A 2VHTA 5ELXA 4IRXA 2CMGA 4XQ0A 5IJXA 3UHJA 5C5CA 4BHTA 2BP7A 3Q12A 1AM4D 1CR0A 5LXTB 2Z98A 3IDFA 4EKIA 3SC3A 1UD4A 2BGRA 5KJEA 3GLTA 4C2TA 3OF3A 5CW1A 5EIOA 1NMXA 3BZUA 5BSWA 2EP7A 4IVPA 2W6CX 5C53B 1RRVA 1JALA 2DKNA 2EJVA 4KHPB 4FE3A 3K0CA 3PHCA 2CF6A 3LK7A 1IIBA 1YZFA 1ZN2A 2AI3A 2UZAA 3QV1A 3VKHA 3ASPA 1ISJA 1CULC 3OE7D 4IKPA 4QO8A 5IKEA 3HCAA 3JQGB 1GUDA 4RCYA 4QOHA 5CLFA 4MW9A 1EK5A 4LFBB 4DBVO 3UMRA 1QV6A 3I58A 3X43A 2F8SA 1VCHA 4HD8A 4GQNA 5AH0A 2RHHA 4AW9A 4DWWA 1V16B 3L8CA 4U7TB 4WA7A 4F3RA 1W7AA 5ALHA 2QTTA 5HZHA 5ILOA 2IY7A 2IZOA 3DOFA 3Q6IA 3V8MA 2G4VA 4LTDA 1WF6A 1AS2A 1KSJA 1PUIA 1QRDA 2BMDA 3RU9A 4ALIA 4B79A 1CUBA 4LHWA 3FXAA 1JEAA 3DZIA 4NABA 3T7IA 2F48A 1OD6A 5ESDA 4B3IA 1NT4A 2P7IA 3DONA 1S9HA 2WHEA 4K26A 3K6SB 1PW7A 2K2QB 1COZA 1YXMA 3COZA 4BKUA 5I4IA 1W1IA 2HLDA 4OL9A 3BPSA 4ZO9A 2VBSA 3GLHA 3RNLA 4WZLA 4QPCA 1Z18A 5E6UA 5FUQA 4RBNA 1JAIA 1RMTA 4ZAVA 1T5OA 1KAMA 1QS0B 5TC4A 1N6NA 2QPAA 1IATA 1PR9A 2JZOA 5K8UA 1Z07A 3H9UA 3CUWA 1X7ZB 2QENA 5HCNA 1C4XA 1E7RA 1YK1A 5YASA 3FUCA 3A1EA 1ZL2A 2PXXA 3ZGOA 1N6IA 3DT8A 5BQOA 1J0BA 5MFPA 2AE1A 1K8QA 2QAIA 3N8HA 4DYVA 4DV0B 2I7DA 4DCOA 5I48A 5JMPA 3CU5A 2VDVE 1NE7A 3ORRA 4FHFA 4Q21A 3WHKA 4DNOA 2HMAA 3FCYA 3O94A 5HOEA 1LLDA 5JI2E 3LLUA 1MT0A 1NJFA 4N3BA 2HOQA 1E1NA 2XUDA 3CKYA 4E1BA 2D7JA 2UZ1B 3W4JA 3CVJA 2Q7OE 2BEVB 4GWGA 4DWVA 2HSWA 1N6OA 4S05A 2J3KA 4E5YA 4TT8A 1TFRA 5MDHA 3F9RA 2FZGA 3AWIA 3OHPA 3G2MA 3R6WA 5FQOA 3F47A 3GDWA 2OTJB 2V9PA 4QOEA 4YALA 5K1ZA 5KVSA 4I9GA 3P7MA 4JJ8A 1OGYA 4IHKA 1U7OA 3U3KA 1W4RA 4LPKA 3V6LA 3OCCA 5J43A 4ZT3A 2ZU0C 1AMOA 2E6KA 1V6SA 3FKQA 3W8RA 1IVYA 3DQPA 1CUGA 5H8WA 1U2QA 5ALJA 1U3GA 2QGNA 4HXGA 4M0MA 1JBKA 4AULA 4D9HA 2QDXA 5JI3E 3L9WA 1KDOA 1T8RA 3PL5A 4RH3A 3OX1A 4R7ZA 4XSVA 5CEJA 5JNTA 1ISMA 2PYDA 1HG0A 2R2AA 2YWDA 3QNWA 5E4FA 3E0QA 4E70A 4ZK2A 3BC9A 4BX9A 2FN3A 5AI9A 2ANCA 3JYPA 4DSAA 1UKYA 1EM6A 1VPLA 2EZ9A 2WIDA 3TW8A 4EG1A 1WXEA 5JRDS 3V46A 4B3CA 2EZ8A 3RTCA 2QY6A 4JSRA 1FDVA 4DIFA 1I3LA 2O7SA 4UHEA 3TSZA 1W96A 2JCVA 2H2IA 4IG9A 1EVIA 3PC8C 1LRLA 3N3AC 1BMTA 2ZIWB 3JAKB 4IDEA 4PG5A 2R6JA 3ESDA 1Z83A 2XCOA 5JC8A 4PQGA 3QUBA 3AOEA 1L4YA 1KEUA 2ZSJA 4NBUA 4MAAA 3LBIA 3Q85A 1JWLA 3P4XA 4FOPA 4EUHA 2Q9UA 1MUUA 2OFXA 4CLRA 2FUCA 1NB0A 5J2TA 1O95C 2VWQA 2WJ4A 1WUJS 3MWLA 4G4GA 4QJ4A 1BDBA 3B2NA 1QVAA 4YPFA 5LJLA 1QF6A 3PFWO 2JIZA 4XLFA 4R5MA 5DMXA 1KO1A 1SPBS 1I6LA 3GJXC 3QOWA 5EWMB 2HZ7A 4J1QA 4ENPA 2HNKA 3KPVA 2WFZA 1YGPA 4GRIA 4NR0A 4RHCA 5EXPA 3HSSA 2XDYA 5KIAA 2VOJA 2C8VA 3HAGA 1P4AA 2BFCB 2GN1A 1LEHA 2CF4A 1RCFA 3K32A 5C32A 1ZCAA 1MHTA 5ECWA 3U3RA 4OLAA 1KMHB 1X86B 2NV6A 2YS6A 1OB5A 5AXBA 3ZOZA 2VHEA 3WMGA 1U6JA 3LPNA 5LBTA 2OXTA 3B6MA 4K8RB 4CV0A 3RH0A 2QN9A 2A1UB 4LXTA 4BGDA 1E3TA 1ZK3A 2ZKIA 4KAAA 4RSHA 5CT5A 1XTRA 1A8PA 2EFDB 3P0RA 4O4JA 4ZALA 3GFVA 4IILA 2RARA 1Z0JA 1E6MA 1JKJB 2VPIA 1FBNA 1T3HA 1V37A 2IUTA 3HA7A 1FJHA 3ZD9A 4F1JA 2ZROA 4Q12A 5CIYA 1YHNA 4M98A 2ZJ4A 1T5SA 4GAEA 2ISCA 4JXKA 1Q0SA 4J3NA 1RKQA 3DS8A 3TLAA 4A0RA 4HVCA 4QT4A 5TT1A 4G0VA 4CEJA 1RFLA 2WM2A 5BSVA 4RDHA 4F6RA 2CE7A 1OVMA 2V55B 4JB3A 4OP1A 2ZK7A 4HR7A 1M67A 2BZGA 4Y1RB 2OFWA 4URHA 1NJGA 1X42A 4OFXA 3GIDA 3KK0A 3QPDA 4LYFA 1ZVMA 3V5NA 3O03A 4LBZA 2F1OA 1QSGA 1UDXA 3OJCA 1QMPA 4LW8A 1S9DA 4NYJR 4YV7A 4HMOA 3GAZA 2GZMA 5EI5A 5KTMA 3DPSA 2XA2A 5C1OA 3COWA 2X8WA 3DV9A 3HCCA 3Q2IA 4CUJA 7GPBA 3KJHA 5FI1B 4KN5A 4AMZA 3M4JA 4FFNA 3SS8A 2YN4A 4DARA 1JW9B 4V0SA 4PWZA 4EHJA 3NBXX 3FIJA 1DZIA 4KL8S 5AKZA 3LUJA 2PJDA 3QYAA 2I9PA 1JA9A 4E5DA 1HNXB 3E58A 4GOLD 3WGGA 1XTUA 1JEEA 1IOLA 2IYTA 1H4QA 2HPVA 3I8SA 4FC7A 4JK3A 5D84A 2R6AA 4DWJA 4I50F 5KX5F 3NHRA 4BMVA 4OO3A 4WZAE 2W8BB 3AH8A 3C1AA 4AP6A 2NVUB 5ICEA 4A26A 2JFXA 3EVGA 1TF5A 4ND3A 4HWRA 4UM9D 3WC4A 4MB2A 5HRUA 3ZOKA 1VE1A 2B2NA 4TL7A 4MUJA 2AG0A 2HLPA 3CZRA 4BNDA 3I1YA 4KWCA 4PXAA 5EIHA 3TR0A 2PKQP 4D4IA 3DZCA 5DGCA 5CB4F 1NATA 2VAVA 1K6MA 4ZQGA 4LE2A 3UZUA 3AGQA 2KSQA 2QYTA 3RSCA 1XNJA 4LVOA 1PZGA 4HFNA 2PQ6A 1ADBA 4L9RA 1O54A 3DCNA 2YHBA 3DE5X 3UHPA 5JNVA 1RP1A 1VRWA 3NGMA 3SZMA 1TZKA 5FPSA 2JA1A 5T7BA 2LP4Y 2OKCA 1PEDA 2XF8A 4MUGA 3PC4A 4TSFD 2C5LA 1OI7A 3KZMA 3H3XA 1FLAA 3KWFA 2Y6UA 3LF2A 4HB0A 4B6JA 2WHYA 3K4HA 1BRTA 4U7WA 1ES9A 1I3OA 2G09A 3JATB 1VMAA 4LJSA 4RPJA 4B2PA 7MDHA 2XOEA 2X3FA 4MUMA 1GAXA 1VLJA 4U9UA 1GNQA 2B8WA 3B7GA 3C3DA 3FTFA 2WTBA 4RMHA 3WK6A 2ODWA 4HE6A 1IEVA 5DGTA 4HTAA 1NF9A 4N0QA 4Q3EA 1UBEA 6YASA 1IVSA 1YCGA 3OPOA 1TI7A 4P31A 4QHTA 4HNTA 4BP1A 3UWPA 6NULA 1IHOA 3WQZA 3ISJA 4L8JA 2J1LA 4QGFA 4QODA 4UEOA 4ZOBA 4EQ6A 1EJBA 5KQLA 3P45A 4MYRA 1WCIB 3RJTA 2IU3A 3OU7A 2C9BA 1OZAA 4WCDA 1PBTA 5CLHA 3NOXA 4B81A 1GZHB 1PT6A 1V47A 2CVPA 4TL9A 4O2AA 4A8JA 2IDZA 4FUTA 1ORVA 1PHRA 1NJ8A 1YZ3A 4HLCA 3NT2A 1Y7TA 1E6CA 4QPNA 1V1JA 2VEOA 2H7YA 2W00A 4J07A 3N1UA 1OVGA 5BT9A 1SVIA 4KPUA 3KYJB 3TMYA 1B41A 4RORA 1Z26A 2W2KA 1VMIA 4DT1B 4OVKA 1CUDA 5EKXA 1HDCA 2EARA 1TTQB 2G5GX 3AG5A 1E2BA 3W5CA 4GOOD 1Y4ZA 4U2CA 3G0CA 3HDQA 1GAQA 1QGUB 3NDIA 3QBEA 2FN4A 1A82A 4QNMA 221PA 1PDWA 2JBWA 2P62A 3NTOA 1E9CA 3BRWA 4GI2A 5HW0A 1XZNA 4D7AA 3QLUA 1IN8A 1JJBA 2OBMA 1QPGA 3VR3A 4DA9A 5ADVA 1RAEA 3GNSA 3CC8A 2D5BA 2P0AA 3VZPA 1GA1A 2Q5OA 5GINE 1P4MA 1OPXA 3IDQA 1OA1A 2FK8A 2FY8A 2C29D 4TV9A 5GOTA 4HGPA 1VTKA 2AT1A 2BFOA 1Z0ZA 3IMGA 4BMDA 1PR2A 3H19A 2PRIA 2B21A 3PA1A 4LWPA 1NASA 3WSTA 1THMA 4QUKA 2QX4A 3NJ4A 3A1SA 5C31A 1KC3A 4EO7A 3KDPA 3PLRA 3QHAA 3LVRE 3NWPA 4ETIA 6ABPA 4X1YB 2XKJE 1IBSA 2VZLA 2CDAA 2BD0A 4HH4A 2HD4A 4JAVC 4PGMA 2FGJA 1FVOA 1ZRMA 3G2QA 4L8GA 3ZHCA 5KNDA 5F9HA 2E6UX 4HMPA 2OZVA 3ETGA 1DI0A 5BN1A 4LGYA 3D26A 2EKZA 3L06A 1Q84A 1DKMA 1T1EA 1GZ6A 4GC9A 5DFAA 2FW0A 3E9ZA 2F8LA 4W8HA 5E1DA 3O8OB 2P91A 1JJIA 3OIUA 3UMGA 1L4EA 4K9PA 1HV8A 2GN8A 2OCKA 4XD7D 3TZHA 4M8KA 4UBNA 3WL3A 5FHRA 1NW5A 2XMCA 1NR7A 2NO6A 2FQYA 2PWYA 3QBVA 5EVCA 1DGQA 3AP1A 1BFKA 3I34X 2P9ZA 4QJBA 3UK0A 1PUJA 5JS6A 1QHXA 1IMJA 4IEIA 4DPLA 1Q12A 4BJ6A 1F2UA 3CP8A 4D4KA 5CDSA 4J9UE 1MC5A 1SAYA 2WABA 3CH5A 5LQRA 1N5OX 1YUMA 1WDMA 2FYTA 2Z09A 1YQDA 2XSZA 4PAGA 5H80A 3CW2A 3NANA 1T2AA 3SS7X 3C3JA 4GX0A 1A5TA 3SVZA 3MFQA 2QM0A 3PQEA 1CZNA 3CUSA 1P45A 1MA3A 4I4TA 4QU5A 4X6XA 4ZVNA 1QP7A 3GAAA 4BDTA 2CKDA 4HAXA 3IPAA 2XB4A 1OJ7A 2RH4A 2Y99A 4A8TA 5BYAA 2GNPA 4QXOA 4C21A 3NHFA 5LDHA 3AUXA 3FLMA 5ITZA 5K05A 5HIKA 5CLQA 4PC2A 2C4UA 2YFHA 1J07A 3HVIA 3SHQA 1UFKA 1YQXA 2DAPA 1YRBA 2VJMA 1YE5A 1UT5A 2OGWA 1JLHA 2ERXA 1Y4AE 3H04A 4MQMA 4OK3A 1KMMA 2R8YA 4HB4A 4OQXA 5JLJA 4MR7A 1Q5PA 2H6EA 4DMMA 4BLWA 2ODBA 4J0IA 2HSZA 5DYYA 4L9WA 1PQUA 1WUYA 3DF7A 5E7IA 3I6YA 1W52X 3AFOA 2VJLA 1UIMA 3K94A 4YRIA 3A3OA 2WD7A 1XP5A 5JZOA 1G1MA 4E09A 3KHTA 2AGVA 4G2NA 1GLGA 4K81B 4Q15A 1NVTA 2RGCA 2PH7A 2WZDA 3A3PA 4UUMA 5EJ4A 1Z06A 5JD3A 4OBBA 2QIOA 5DX1A 2VYNA 1E9BA 2Q1TA 2FRDC 2P4HX 1ZOIA 4NYJQ 4EDHA 3WGIA 2YIJA 1BDJA 4KI0A 1ORRA 5IAAA 2ODTX 2VTBB 4BUCA 1S89A 4KBYA 2ZW9A 1DUVG 3PGLA 4LHYA 4I9UA 4WCFC 4C7JA 3C3EA 4S1WA 5FLYA 1NDHA 1E3LA 1Q92A 1DX6A 1UP4A 1OX4B 2V4ZA 3GJRA 5FA5A 2P1ZA 2B0JA 5LOVA 4HZGA 2VJQA 4PNEA 5FWYA 1L4LA 4IG4A 2W2MA 1H42A 1EPUA 5DSTA 2ATIA 3WMFA 1HKHA 4P38A 3AWDA 5HXBA 2A8YA 2EDCA 1J0CA 5B37A 1XTBA 4CT0A 2DY0A 5B7NA 2I99A 4HXEB 3M33A 4OJKA 4DFDA 3WAGA 1IBMB 3K5PA 1U0BB 1UIRA 4RIFA 5DULA 3CPHA 4C88A 2CLMB 3VISA 4ZC1A 4YQZA 5BQPA 4AXBA 2XMDA 5BT8A 2Y1KA 1H9BA 5JQGB 2HQBA 2JI8A 3DDCA 4HATA 3W3AA 3EG5A 4EYQA 5AVSA 4D3ZA 1EVYA 1UBFA 1LDEA 4K28A 2PSHA 3DDOA 3IUQA 1NJ1A 1LF0A 3UJ8A 1NRWA 1LPPA 2WINI 5H1YA 3UFXB 1R4MA 5DHTA 4G6ZA 1DKPA 1XG5A 3WL8A 4AO7A 3MWKA 3WLEA 4HGOA 2BT4A 4G01B 4MQUA 2AYXA 2DWUA 3HN6A 3H11B 3THRA 3NIFB 1MB0A 3WRWA 5AFSA 1QVFB 3FI0A 3UAXA 3NDJA 3A7EA 2HJWA 3K1TA 5IVKA 1RYYA 2HK6A 1G21E 2YQ5A 3A7DA 3HZHA 5DB4A 5J5AA 3RIHA 3HB0A 5T3UA 4JLKA 4F11A 1LCIA 1O97C 4RUKA 4DNQA 5CA0A 3CO0S 4IMIB 3QX9A 3RE1A 4AG6A 1BJRE 2ZE6A 3A6KA 4CM1A 1EVEA 1OAAA 4ZA2A 3CUKA 2C9YA 1XPUA 4B7ZA 1J9GA 4J2TA 1QX4A 3ANLA 4P7FA 4R3WA 3ROKA 2O2ZA 2WMDA 4AJ9A 5CLJA 4MEBA 3KQSA 5DHRA 3WIUA 4MS1B 1NBHA 2YHAA 2I7XA 4UNRA 1R27A 1J2JA 4E2FA 1X1EA 1MPXA 3JQAB 3A05A 2HRZA 2QLLA 2O1XA 3ZV6A 3THWA 2FPKA 4CV1A 3I5UA 4H2DA 4A3SA 1T5IA 3JZAA 1J1IA 3NHUA 3Q3VA 4CMBA 3VTFA 1FTSA 3SI7A 3V1LA 1GWNA 5MN4A 3GLVA 3MS2A 5DNWA 1C9NA 4MAMA 1PJ5A 1YDEA 1RJFA 3ELDA 4C3OB 3TG8A 3HR7A 1XRQA 4Z2YA 3EPKA 3BL8A 1OWMA 1Q1BA 2QN7A 3WQBA 4DCCA 1Q7TA 1WIWA 4JJEA 3QA9A 1AS3A 2QRKA 2VBGA 1A9PA 5C9ZA 3R6DA 4IX1A 2HHAA 5G41A 1GPYA 4FINA 4NH4A 4KTVE 1NVBA 1GFZA 2J07A 2JLSA 3VFDA 2WE8A 2HA0A 2VQEB 4JI7B 4MDYA 2D00A 4JEIA 1F5SA 1K4MA 1UQUA 4C0XA 2X5NA 5IZCA 3H8WA 1BGVA 4YRSA 4JLUA 5DT2A 4LQCA 2WKPA 4LF5B 3I1JA 5EJEA 2V7WA 1CSEE 1F8FA 3CB2A 1O3YA 4Z1MA 1T5LA 4KAFA 3TQOA 1WU8A 1F20A 1ONNA 1GUAA 2OAEA 4F9GA 4LDQA 5FBLB 1FMCA 2BHSA 5J4LA 1BE0A 2R00A 3FNQA 1L1RA 3SYTA 4JUBA 1X87A 4PCUA 4UM5A 2DSTA 3ASQA 4QREA 2Y3IA 1BXRA 3I45A 5JUWA 3T1OA 3QY9A 2Q3DA 5JXWA 4N54A 4U2DA 2IRWA 2E5FA 4G4SP 4A0HA 1YJBA 4EMSA 1KD1D 5ALEA 4QOJA 4TWRA 1KHHA 4RPKA 1ESZA 1IPHA 2V4MA 3FPKA 2VHVA 4KLRA 4XWGA 3H6HA 5KDLA 3CX6A 4G2TA 4ZCRA 3UV3A 2BUCA 1Z2OX 4R05A 2NM0A 3QW2A 5BSUA 4R68A 4RVGA 2R8ZA 5I01A 1WF3A 1AXGA 4OGKA 2E4ZA 1TZJA 1ADJA 3E3LA 3G2JA 1W5SA 4UDXX 5AUPB 4DR7B 3L7OA 3RVSA 1Q95A 4AWAA 3EY4A 1ZGBA 2ZXFA 4C6TA 1D2EA 1GKUB 2DF8A 3RTAA 3L84A 3DZ8A 4JYZA 4TN1A 4G5OA 3F98A 2H4JA 2EDAA 3KB8A 3O8QA 1JF8A 1II0A 1S5PA 3TOSA 1SZJG 4ALNA 3RGGA 3P2YA 4EA8A 2NXJA 2IOYA 2Z1MA 1KMIY 1KEWA 1U9CA 3FSJX 2GXAA 2K4MA 1G8FA 2CHUA 3KE9A 4PXSA 5P21A 3ZDRA 4K86A 1S2MA 4WNAA 1WUTA 3TWOA 4Z86A 2J87A 3HFRA 3R5KA 4AT1A 2ADMA 3JCZA 3GWZA 1YU9A 1Y0YA 3ICWA 4B2LA 2W0SA 5FTMA 4EF6A 2H92A 5DSXA 2CB0A 1W8DA 3TNJA 3HDHA 3QJGA 4ER6A 4I81A 4UBKA 5I9MA 3EF1A 1WMSA 1I0ZA 3KEOA 4RKRA 1GR0A 1YC5A 3LIIA 4MV7A 2Q4RA 2YXPX 3L4KA 3P2IA 5DN6D 3A6FA 3BWDD 4V0QA 4CM8A 5G1PA 3TQRA 5IKMA 1NIPA 4XYEA 5J2TF 3WLJA 3TZBA 5CDFE 1HTTA 3MWEB 3QVXA 5ULLA 1ODCA 1GGKA 2I0FA 3GW8A 1YBAA 3CN9A 1U7TA 3QELA 5A05A 3GN2A 3PHJA 4P0TA 4M8SA 3KYCB 2J7PD 5AK3A 3PEEA 5LDDC 3GLIB 2ACVA 2B3DA 4HUQB 2H1RA 3MRTA 4B48A 5ALRA 1E3MA 3DBLB 1DBRA 3U4DA 5D6OA 2AD5A 3VX4A 4BQQA 2FPLA 1ZVJA 1G1AA 2A4KA 4PRZA 1OXKB 2Q99A 3GDHA 4L3WA 5JBIA 4QXQA 5AKXA 2PLRA 5DPMA 4EHIA 5E8JA 5FEUA 5I7VA 4D9EA 2ZR7A 4XRRA 1UPFA 4QATA 1SVKA 2OO3A 4CF3A 2FG6C 4IXMA 1ZD9A 4HS4A 4O4JF 3CRMA 3FZYA 2ZT7A 1BDHA 4PAOA 1A9QA 3UTDA 2V3CC 4C76A 4Z4CA 2PX5A 1QZZA 2YOGA 4BGIA 1JU4A 4HO1X 1R4NA 5F51A 5TR9A 3DVQX 4BTVA 4OAQA 3Q3AA 1TAHA 5EIXA 2WVGA 3MWJA 2BMFA 4A16A 1W4CA 4AP9A 4CBVA 2E18A 4Q3DA 4YFYA 1IRXA 4QBKA 3HUTA 4L6CA 2DY1A 1QO0A 1L4GA 4JC5A 5CEEA 5A5GA 2V1XA 2OQRA 2Y6VA 3G5TA 4TGLA 2QX6A 1BS1A 2D1TA 2VHJA 1JH9A 1DBWA 1PGPA 1JGTA 1XTJA 1E4EB 5AJHA 1FMTA 5ECYA 3IHWA 3KEGA 4B4UA 3P9RA 2I6QA 4PX3A 4EI8A 2B3TA 2JI6A 5H70A 2BHTA 2YJTD 1EINA 4MW0A 1Z0FA 1BMFA 4HDAA 2ONZA 3FFWA 1ZGAA 2E3JA 3B3QA 1JHYA 3FMOB 3VHRA 3GLSA 4X0EA 5HS6A 4P08A 3U4QB 1XZFA 2C0CA 5HK9A 1FP2A 1H93A 1KFEB 3CSDA 5DOVA 5KBYA 1KI2A 4JDPA 5EUMA 3AU9A 2ZYWX 2XCUA 1FP4A 1E6WA 4P5EA 4Q7KA 3C8ZA 4D43A 5KVCA 5BV2P 1TZMA 2CUKA 3KOOA 4LZOA 2BN4A 1VIMA 1Y4SA 5CT6A 1QKIA 1JR3D 3NJ8A 5ECDA 2ZZGA 5HDQA 3G85A 3ZDYB 4F5EA 5IHPA 1YKFA 2JZNA 3WSVA 5L6MB 3OCZA 4JDUA 3E9RA 1BWQA 4B8YA 3P26A 3KT8A 5CD9A 4J0EA 3Q5DA 1G21A 3SHVA 2WHXA 1I24A 1JKMA 1V4NA 2O57A 2PKRA 1GPJA 5B64A 2C9ZA 1F7UA 1G3RA 2IIQA 1IXRC 4JX8A 1QH9A 4L8FA 1P1JA 4PNHA 1DKQA 3LYHA 1JNYA 4U2EA 1Y3HA 4R69A 3LDUA 4AS2A 3CD6B 2A1TS 4GOXA 5K45A 4MDEA 5HZKA 4URUR 4CF5A 2GZSA 4IGKA 5DI3B 1EVJA 1NNI1 1WXFA 3NIDB 3QG1A 4L72A 2G1JA 2BW0A 4EBBA 1UXGA 2BGJA 1D6JA 7YASA 4YP5A 4YAWA 4B5LA 3GJQA 3OFND 4ZT5A 2HQOA 3RYHA 5AD1A 3QHPA 1HYHA 2GJAA 4NZ9A 2VVTA 2RJ3A 3ANSA 3PQDA 4IR7A 4OBWA 1G3QA 4UVEA 1ZRNA 5AVZA 4V0LA 1A4IA 1JWAB 2P9FA 5K09A 4KRGA 5HBGA 4E3ZA 4K1XA 2C54A 4RDXA 1NSFA 3E1SA 3JZMA 3HN7A 1JLLB 1QDUA 2ZXUA 2VUHB 4RELA 1M72A 3BL6A 4TN5A 3D6AA 1JYSA 1OYWA 1A69A 3T3OA 5EE3A 2OBFA 3LLVA 4CQLA 4EGQA 2X0KA 3B70A 2LCQA 4N7BA 4F4FA 1FBTA 3ZTYA 1KKLA 4KHZA 1WM1A 3GRFA 1QZTA 3AETB 4M8IA 1M7HA 1NSTA 2QTZA 1UBCA 3A8IA 1UFOA 2A3RA 3FUXA 5G53C 1PJLA 4EATA 8ADHA 3ND7A 4YRZA 3IAHA 1D0IA 2OCYC 2RMKA 4E5SA 2AOVA 4P4NA 1U31A 3AILA 3P2MA 1KIFA 5AKIA 4UD2A 3ZZUA 1R10A 3ZWQA 3TJMA 5E2AA 4WZBA 4Q47A 1NRKA 2GUWA 5DIZA 3ULKA 2C2WA 3DFUA 3MCVA 2D0PB 2ZE7A 4I99A 3PVSA 1DQNA 1SRRA 4O2AF 5ENVA 3RFCA 3IOBA 2FEKA 4QT0A 4TKMA 3VGJA 3W05A 3OLWA 4BQEA 1Y0RA 3IBCA 1NMEA 4UATA 1D2NA 1PFUA 4UVIA 3RDPA 2I6XA 1O9HA 1WSBA 1FFSA 1YC2A 1Z73A 3CEMA 3NBFA 3QKSB 2VPWA 1CUJA 2ZUVA 4P7GA 4RA9B 4PR0A 1M2VB 4CDGA 4MKXA 5K4GA 4CKWA 2X1MA 1QONA 2FVGA 1HQYE 1LA2A 1UJ4A 3VDNB 1ODFA 1IN7A 3L0DA 1BS9A 2QN6A 1YMQA 2A84A 4ZVVA 4A4DA 1QRUA 3LPCA 4AU1A 2CXNA 4CG2A 2P9BA 2C4HA 2CNNA 2OM6A 3HP1A 4Q01A 1CIPA 3R7WB 3L5OA 2VRCD 2YWJA 1GQYA 1N8SA 5EXDA 3UWDA 1L4MA 3ZS8A 1PL0A 3GJ7A 3SFZA 2OA0A 3VR6H 4TV9F 1JTFA 2BCEA 3JQ7B 1R37A 1YLOA 3QH4A 1G8GA 3R4VA 2M5SA 4HK4A 4JT8A 4D3SA 4EAAA 4H7DA 3HE3A 4K9QA 4F84A 2QTVB 2YXEA 3VHQA 5C8YA 4LI3X 3F71A 2IF0A 1J7JA 1PL6A 2CWDA 2IX9A 3V42A 1RQ7A 2GCPA 3Q87B 1GDTA 1OFIA 5BY2A 1E5XA 3PUYA 1DAPA 2HV9A 1PR0A 1EBBA 1JFLA 5LYYA 4FT4A 4CF4A 2O05A 1JE1A 4BJ3A 1OFHA 5LQNA 4CFSA 1LI7A 2KPOA 3B48A 1QR2A 3NH6A 4ZAXA 1A77A 2X85A 2WF9A 3JZIA 4MPTA 1VBKA 4ROTA 4RQUA 4TQGA 2QTFA 4YJHB 3DE2X 5J2TB 1GUBA 2FZEA 3NORA 4IZHA 4RDIA 4XLHA 1JXQA 5AN9A 1Q74A 2CFTA 3UT5B 3VZRA 4J16A 1XQYA 3HBLA 4B31A 2XE4A 4QFCA 3QEMB 3SIXA 2ZYTX 3K8QA 1RCUA 2YYZA 1TEXA 2DT5A 5HBRA 1TAQA 3PEVA 4MEAA 1X1BA 3NYQA 3NIWA 1MQ8B 3C6KA 3Q4GA 3Q8WA 4UREA 2HO5A 1SBZA 3HB7A 4N3GA 4NMHA 3UB3A 4C4XA 2BCGY 1FFEA 2V7QA 3E05A 5T4EA 1ZHFA 4FPXA 3D7KA 4WDRA 4KX5A 1Y89A 1O9GA 2V9ZA 5LQKA 3L0OA 2OP1A 4B85A 3K9CA 3B5JA 1TUIA 1B74A 4I4TF 5EJ2A 1GKIA 4KK3A 2PR7A 3D0KA 5ERYA 1G9TA 4XNFA 2OORA 1RWVA 2JD0A 2NPIA 2PGXA 4FQ7A 1H0KA 4DLZA 4IEEA 3GFSA 5I47A 1G8PA 4NTZA 5CXXA 3TRFA 3OOJA 2O14A 3ZS9A 1VQMB 1G17A 1ZA2A 1E4YA 4FSDA 4CDMA 4CPDA 1BSVA 1DIOB 3AEXA 2JLXA 1ADGA 5AJWA 1EAMA 2BEUB 3SJ7A 4RADA 3VZCA 3CC7B 1CJKC 4BAUA 1HVXA 2NT4A 5EJ8A 5FOUA 2IS6A 1JU3A 3Q0TA 4ZREA 3K8YA 3H17A 2AL7A 3IEUA 4F3NA 2L19A 3RROA 2LUOA 1XCMA 4DQVA 2NU9A 1YL7A 4J9VA 4O2LA 4OJQA 4Q48A 4HN2A 3ZWVA 1FC0A 1Z08A 2P9CA 3IAM6 4GR9A 2H0AA 4D42A 3A0UA 4AY3A 4LF6B 1SQ6A 4HPWA 4PQYA 2GZRA 2IEZA 1UEJA 2JFGA 3O92A 5KJFA 4WCFB 3FKSA 3OWHA 1BHJA 3FETA 3CUUA 2C0QA 5FJIA 4NATA 5J9FA 5HQTA 2C2ZA 3A04A 3BYZA 3QWBA 2RGUA 4RJKA 4EWLA 1VOTA 2B5WA 3U48A 2GZHA 3AVVA 2ZDHA 1YRLA 1C0EA 4CNQA 1I1OA 2P9QA 4FMBB 1U3VA 2IDKA 1JAYA 1TA4A 1LNSA 1TIBA 3FJ1A 4MH0R 2PJZA 4NBVA 4C1BA 3OCWA 3LU1A 3QKRB 2COEA 4EFKA 5LOVF 4WECA 3PI7A 4TTQA 4JOCA 5G4KA 5LZ4A 2ONYA 4HFRA 3GARA 1YMUA 1XO1A 2R62A 4I8DA 4BE9A 4XI9A 1QB7A 1N8RD 3GPIA 2Q46A 2R7AA 4IF6A 2ZTVA 1J0XO 4MYHA 1R0LA 2J8ZA 3AXTA 1JB9A 1YJNB 2ZIZA 2BGTA 3U56A 1DC7A 1QU3A 1ZK2A 2C3PA 3MWYW 2BEJA 3P9PA 1XHFA 5ICSA 2PKXA 2VDLB 3GU3A 4D25A 5KYXA 3L92A 1ZI8A 1TRKA 4BNNA 3CNHA 4G0YA 3ITKA 2EXXA 2Z2JA 4I9HA 3L4BC 4I55A 4M0UA 5IC4A 2WTMA 3DOOA 1JPJA 3MUFA 3N8DA 1B6GA 4JB8A 5BOSA 4OAPA 1ARZA 4OA5A 3ADDA 1V8PA 2QGGA 1PU2A 1GZUA 3T3GA 1E3WB 1R9MA 3DMNA 3G7SA 4HNQA 3VSDA 3IV7A 2FKNA 2E5LB 3PBKA 1YIOA 3I42A 3UG7A 1W5TA 3K92A 3VGPA 3SF8B 1P19A 2XMPA 1T4MA 1MDBA 4CKYA 1U9YA 1RAHA 2R6FA 3H75A 4FR2A 1JXOA 2C4NA 3KE8A 4HDKA 1GSOA 1Q0RA 2R7KA 4KWTA 4D74A 1GG5A 5ED4A 4EVRA 1M2JA 2GWHA 3K9FC 1XJ0A 2LIPA 5TPZA 5BUQA 1E0JA 5CA0F 2PUGA 1WMDA 5CAEA 1IWPB 4R6XA 3D3JA 3SBXA 4TZ6A 4UNSA 5K8IA 1JLRA 2Q49A 1FU4A 3BT7A 4NG5A 5IYWA 4U4AA 3RK4A 1OV4A 4HBZA 3FLBA 3HMQA 4R3UC 5F76A 1WABA 1NBWB 1M8JA 5AK4A 2HWXA 5IP5A 3PIDA 3RUHA 2HWUA 4ARAA 4OMFG 4LAFA 2C61A 1SWWA 4Z7JA 1FJXA 3MT8A 4KV7A 1QQ6A 4XX0B 1VI6A 3UGJA