1T6YA

Crystal structure of adp, amp, and fmn bound tm379
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
287
structure length
268
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
total genus 68
structure length 268
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6yA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6yA01
4OUDB 2WQ6A 1U7DA 4I6JA 3COZA 5LLTA 1JIIA 1MAWA 2VXOA 2JAXA 3N05A 4DJAA 1IFXA 3A04A 3TQIA 1N78A 2A1TS 4RUKA 1IRXA 3BL5A 1KAQA 3QE4A 2CV1A 2AG6A 1TEZA 3SZGA 1J1ZA 1A8HA 3ZXIA 1R6UA 3MUEA 1KAMA 1NI5A 4UZFA 3P0HA 5DB4A 3LOQA 3ZGZA 1QJCA 4RPIA 1QQTA 3ZUGA 2E18A 2PG3A 2DPLA 1WXEA 5KWVA 4ZT6A 2X3FA 5TEWA 1H3EA 1OWOA 5TS2A 3X1KA 1YIAA 4F4HA 4L2IB 1NURA 2CFOA 4ZCRA 2DUMA 4MUFA 1N07A 1TYBE 3UK2A 3CLSC 3KT8A 4QRDA 4ZCPA 1XNGA 1N05A 3CLTC 1J21A 3GMIA 1B6TA 1MC1A 2PFSA 1JEEA 2TS1A 3FG9A 3DLAA 4U63A 3IDFA 4YBRA 3SZ3A 1M8JA 4ND7A 1H3FA 1JECA 3CVYA 1XNHA 1KH1A 1K4MA 4HJRA 1NYLA 1T6ZA 2IP1A 4NX2A 1QRSA 4WNYA 3IOBA 2WQ7A 1ZJWA 3PNBA 1JZSA 2PZ8A 1IH8A 1U7XA 1MBZA 1JILA 1WXHA 1MRZA 1Q19A 2H2AA 3FWKA 3ND7A 4MVCA 2AZXA 4J76A 1KQNA 1Q11A 1WXGA 2HZ7A 3IMGA 1NUQA 5AHWA 1JEDA 4ND6A 5KCMA 2X1LA 3H05A 3CVXA 1QTQA 4XSVA 2ZUFA 4NDAA 1EJ2A 3FDXA 4K0RA 3AG5A 3IMCA 1GPMA 4JXXA 1N1DA 3ND6A 1N75A 1OWNA 4NATA 3M5WA 1N3LA 3A2KA 4YP6A 1NZJA 1PFYA 1IHOA 1ZH0A 2JANA 2YY5A 2BYTA 1N06A 1JGTA 2EJCA 1H1TA 1N08A 3N9IA 2YXNA 4MW1A 4A91A 2DR2A 3BNWA 1JZQA 1XJQA 4J75A 2DLCX 1QU2A 4ARIA 2IELA 2E89A 2A4MA 2CYBA 2QUIA 1K97A 1P7PA 3HFJA 2WSIA 3CA8A 1LW7A 2A86A 1WQ4A 2D13A 3H9CA 1YULA 1WZ2A 1GN8A 2D54A 5HUJA 3A4IA 3LCJA 3NBKA 1KKUA 4OJMX 4Q16A 2CV0A 1EE1A 2PIDA 3KT3A 3HV0A 4JYZA 4MW0A 2GM3A 1NB9A 3PNVA 3JXEA 1IQRA 1G8HA 4MAFA 2Z3VA 2P3MA 5A89A 5IHXA 4DNXA 5LM3A 3C8ZA 4MUIA 1KQPA 2I1LA 4YP5A 1BS2A 4CDMA 1EUQA 1MJHA 4EGAA 1HYBA 1OWLA 3FETA 1GZUA 1O97D 2JA2A 3L92A 4NZPA 2ZUEA 1S4MA 1LI7A 1X6VA 1Q15A 3GUZA 4G6ZA 1O95D 4KR6A 1N2OA 2A1UB 2R5WA 1O96A 4KKVA 3QTTA 3OP1A 4Q93A 4EG3A 3AIIA 4ZT7A 1R6XA 1KH2A 1YUMA 2NZ2A 3LE8A 3PRHA 4AQ7A 2QUHA 3NBAA 1OWPA 3INNA 2C5SA 3KFLA 4PBTA 2DERA 4ZT4A 2QJTA 1FFYA 4U8HA 5TGTA 1NUSA 4MLPA 1NUUA 1PG0A 3CLRC 4MVWA 3CLUD 3IVGA 4G5FA 2A1UA 2VBTA 4DLPA 1NB0A 1J20A 1MAUA 1WXIA 3SP1A 5F23A 1NUTA 4HK4A 4R2LA 3Q4GA 2AKEA 5TEVA 1YIDA 2YWCA 3IODA 1NP7A 4BWVA 3MMXA 4DDKA 1V8FA 1O0BA 1ILEA 1JIJA 1MOPA 1VBKA 2X1MA 5DEOA 3AFHA 3DO8A 4S1OA 4ZCQA 1QU3A 1JMVA 1SURA 4EG6A 5TRDA 1T6XA 3SDBA 3ND5A 1F4LA 1N2HA 1Q9SA 4MWDA 2A84A 1U3DA 2GKSA 3H9BA 3COYA 3ILVA 1H3NA 1WJGA 4MUHA 1WQ3A 4MW2A 3L93A 4E1AA 4F3RA 1M8KA 2A7XA 3NV7A 2QJOA 3VGJA 4EG7A 1N2GA 2CYCA 1K4KA 3K32A 2IJGX 5KHAA 4KR9A 3TQOA 3RJZA 1O5TA 1V47A 1F7UA 1Q77A 3CR8A 4R0NA 4JFAA 5LFAA 5FNZA 3TS1A 4U7JA 2QUJA 4DE5A 3N2YA 3F3MA 2DEUA 1K92A 1KP3A 3RK0A 1T9GR 2RD2A 4MWBA 1I6LA 1N2IA 1X8XA 4YP7A 1G8GA 5IJXA 1O6BA 1O0CA 2ZP1A 3AG6A 3PXUA 1TYAE 3KT0A 3H97A 3MLAA 2WB2A 2E0IA 3RFFA 1MB9A 2EL7A 2CV2A 4I6GA 3P0JA 1G8FA 1M83A 3COVA 1M1ZA 4QREA 2Z08A 2A1TR 4HJXA 2PXHA 1PFWA 3Q12A 5H16A 3HL4A 1VL2A 1NSYA 1CT9A 4XFJA 1FYDA 1GTRA 3P0IA 1ZH6A 3FOCA 3FH0A 5HG0A 1EFPA 3A05A 1TYDE 3RBAA 5K0SA 4EG8A 3K9WA 2OYNA 4NAUA 3CLSD 1OD6A 3FNRA 1M8FA 3CLTD 3IVCA 4TS1A 1LI5A 1O96B 1VLHA 1I2DA 1YUNA 4MW9A 1G59A 2G36A 2CT8A 1EFVA 1NUPA 2QTMA 4MWCA 2YWBA 3Q10A 4K03A 3ZXSA 1VBMA 1N2BA 2QTNA 3D6VA 4I6EA 4EFKA 3N8HA 4MUJA 4GRIA 1QRTA 4MWEA 1O94C 1UFVA 1EXDA 5J59A 3I05A 2CSXA 2VTBB 4X0EA 5DK4A 2D5BA 3H99A 1M8GA 1R6TA 3IMEA 5DASA 4CQNA 1U3CA 1KH3A 2QJFA 4ARCA 4CDNA 4WSOA 2J08A 3ISJA 4EF6A 1N2EA 2E21A 5H7XA 1EUYA 4ZT5A 2VBUA 3X1MA 1WOYA 4ZCTA 2XRYA 2VTBA 5HUHA 4UZEA 3VRHA 4OUDA 3UOWA 1PG2A 3CTAA 2B7LA 3RK1A 4DDHA 3G6KA 4DDMA 1GTSA 1N77A 3HGMA 3UC5A 3IOCA 2J5BA 5K0TA 2V0GA 2J07A 2HGZA 3HZRA 3MXTA 4HPWA 4MULA 1QRUA 2O5RA 3G5AA 4JZYA 1Y42X 2NSYA 1KORA 1N2JA 4MW7A 1WY5A 1T6YA 4MW4A 3TZLA 1IQ0A 1YI8A 3ELBA 1JHDA 4JXZA 4L2IA 3SEQA 2V0CA 2OV4A 2QTRA 1OBCA 1I6MA 2OQ2A 4MUEA 3TZEA 4GU5A 1DNPA 4EG4A 1GAXA 3KT6A 3RHSA 1M8PA 1JIKA 4MW6A 5EKDA 1RQGA 1O97C 3CVVA 1XNJA 2CYAA 2VBVA 4QBTA 1KQOA 1O95C 1ZUNA 3DPIA 3IH5A 1QNFA 2J09A 2O8VA 1J70A 1IQUA 2BTEA 3DV2A 3FI0A 1J09A 4MW5A 3FHJA 3CVUA 3TNJA 4EG5A 3QTBA 3MLBA 1U0BB 3HMQA 1COZA 3VU8A 2PZAA 5J58A 1EFPB 1PFUA 4KPUB 3ZJUA 4MUKA 1TYCA 1GLNA 4PBRA 4G5YA 5A8AA 1O94D 3E27A 3CVWA 4PY2A 3CLUC 4CT0A 3IOEA 4YMIA 4XFDA 2X0KA 5J5AA 3IVXA 1I6KA 1MB2A 3AKZA 3S3TA 4R2MA 1TQ8A 2H29A 3IUEA 1EFVB 3IUBA 4KPUA 4MVXA 1VBNA 3CLRD 2PZBA 2DETA 3SEZA 1F9AA 2QUKA 4KR7A 1IVSA 1P4MA 3PNYA 1D2RA 3G59A 5JBNA 1ULHA 4ZCSA 3FIUA 1PFVA 1KP2A 2HMAA 1KR2A 5A88A 4H3SA 4P2BA 5FO0A 4EG1A 1OWMA 3UMVA 3ZJTA 4PBSA 2A88A 4FZJA 4MQ6A 1TFUA 2J4DA 4MUGA 3OTWA 1F7VA 2DXIA 5BNZA 3UY4A 3X1JA 2RE8A 4ZT2A 3U1VA 3P52A 3AL0C 2Z09A 3D6UA 3ZIUA 1T9GS 3GLVA 2GOYA 2VBSA 5FO1A 2CUZA 4ZT3A 1OBHA 3FY4A 3COWA 4MUNA 1WKBA 3ZJVA 4AS1A 1J1UA 4MVYA 3SYTA 1WXFA 4NAHA 2XRZA
chains in the Genus database with same CATH superfamily
5NULA 4OUDB 1EU1A 4B7UA 4FGSA 2PCLA 1UXHA 3FJ1A 3SC4A 4FFPA 1ZNWA 1D6MA 5FD8A 1V95A 1S2NA 1P60A 1VLOA 2KLBA 4IV5A 2XOEA 3IT0A 1KJZA 3A04A 4ZV9A 1N78A 3I01M 3TTUA 3BFVA 4N54A 3QE4A 1SD2A 5CH8A 1G21E 1SBTA 1XVTA 3PFHA 2WJVA 4B35A 1NQUA 4EPWA 5KVQA 1H22A 3X2FA 2CUNA 3NH6A 4TQUS 1PJCA 2AJLI 2FSVA 2JCVA 4F45A 1I9CA 5C32A 4YECA 2BHSA 3ZWDA 4IIJB 1DMRA 3B60A 2C2HA 4NMLA 4OG2A 1XQBA 2FFRA 4R2KA 4G4JA 4XCXA 2OXFA 1RQ2A 1TU0A 3WK8A 5KWIA 3FMVA 1B26A 5KU1A 5TS2A 1ID8A 2EWVA 2ZRIA 2YYAA 3DFZA 2B82A 2UUOA 3MWDB 4DLXA 1J5XA 2ZVDA 5CR9A 1NOJA 4L8YA 5HIIA 2O19A 4Q9DA 4WY8A 1TQHA 1WWKA 1XVLA 5KX5B 1P1KA 1S02A 1C4KA 3N8KA 4H7PA 3RS5A 3AUTA 4BEJA 3MPOA 2PO7A 1RHKA 3KXIA 1XU9A 2IVFA 2Q2NA 3MWLA 4IH9A 3SJZA 1MORA 1ZUNB 3FKQA 4NYIQ 5T4HA 1BW9A 1UFRA 1N8SA 3GRZA 4H6VA 1K6EA 5CK5A 1OV6A 3S8MA 3T3NA 4OLBA 1HGXA 3RC8A 5DGHA 1V8BA 4FLFA 3G8YA 2PA0A 5FTWA 2BGWA 2HF9A 2RGEA 3FUWA 4ZVMA 4C0XA 1CF4A 3WJ7A 3OQVA 1JECA 4IDCA 3CE6A 3OMXA 4BKOA 3PT5A 1HT2E 3R76A 3ZU2A 4WIAA 4KGXA 3TSZA 3ZHYA 2Q6IA 3FNEA 4LXIA 4RZXA 1AE1A 4ESHA 2HU5A 3M0EA 1LKZA 5LB2A 5ADVA 1QRSA 2GRJA 5BSWA 5EUQB 3T1QA 2YMPA 2W8BB 4OYLA 2WMYA 2FXIA 4YAUA 3C70A 2VDQB 3JYOA 3KX2A 3QSGA 4WJLA 1DTSA 3PFKA 2ZPTX 2AI3A 4YVFA 5IUNC 1FY2A 4FJ1A 4I55F 3H9QA 1PFGA 2V8BA 1KQNA 3OVMA 1BQ3A 4DLKA 3U5TA 1OSNA 4GM1A 4GLLA 4ZALA 4HD8A 5KCMA 2R47A 4LYAA 4FOLA 4RADA 4A92A 3SXUA 3DR5A 3TQHA 3FDXA 3ECSA 3DVQX 1M66A 4JJGA 3AFMA 2Q8QA 1ORVA 1WEKA 3CUUA 3Q3VA 5EGNA 4BYGA 1CLEA 2WWTA 4Q7EA 3ELYA 4YJHA 3ZVLA 3P4YA 4DW8A 2IXBA 2ATCA 1PD1A 1N1GA 4JP1A 4OQNA 1PFYA 3DBHA 4JODA 2XB9A 1YB7A 3KZXA 3JWIA 3L7NA 4IIGA 2XZOA 4CKWA 2YY5A 1MW9X 2KI5A 3RE1A 4M38A 5BSHA 3H75A 3CY6A 1JDTA 2RJOA 4J16C 4J0IA 1T2AA 3I32A 4QL3A 5ICSA 1IBSA 1YJXA 4BN5A 4OF4A 4AIIA 5K0BA 3IALA 1RZRD 3DBRA 3LPAA 2I67A 3M1AA 1UKBA 4DB4A 4XLHA 3KB1A 4NTZA 5BR8B 1C8KA 1P17A 2EFEB 4R6WA 1K97A 2Q2WA 2ZRFA 2VK4A 5AJVB 2CMDA 1VYVA 3BF7A 4HDRA 4NR0A 3AUSA 1FFXB 3R7NA 3TB6A 4DMFA 2PZFA 1PQYA 4OHFA 1V8PA 1U2DC 4R1UA 3VO9A 4ZK2A 3OUTA 2O8DB 1A9YA 3RIMA 5GM1A 3A4IA 3WLKX 4H6WA 1P7ZA 2G72A 3O0TA 3JQRA 1G42A 1QMPA 3OJEA 2OFFA 1Y1QA 2VN8A 3G85A 3WWCA 1USKA 3IRVA 3R5JA 4NECA 1CR1A 1EE1A 4RDKA 1E2GA 1U65A 2PMDA 3WFJA 5T4FA 4EJSA 3HK2A 4RMGA 5IT5A 4GDFA 1I51A 3U4MA 4P98A 3UK6A 3HDHA 2ZJ0A 1GITA 3DB1A 3DG9A 4QDTA 3WMGA 3EJ6A 4AS3A 1P1RA 3NP9A 1Y82A 4TYPA 2CK3A 3VISA 1BE0A 3EGDB 4DLLA 3PPXA 1UBKS 3I3OA 3LZCA 5REQA 1G0OA 4CDMA 1RXVA 1ARZA 4KAFA 3HVUA 3LGSA 1P5HA 1FFSA 4YV7A 3BZUA 4UTRA 1HYBA 1UOEA 1E4YA 3QBVA 5KC9A 2PUJA 3ASYA 4CIBA 4Q3NA 2VK1A 2ZUEA 1OXKB 3C3AA 4NZPA 4NFYA 1TJ5A 4QBFA 1KZ7B 3JRWA 4MRVA 2H7YA 4EAQA 1P5FA 2JAPA 1ESZA 1NGSA 1XCOA 4GO1A 1TUBB 5K8LA 4F9GA 3RSFA 3HTXA 1D9XA 3E8SA 4DM7A 2JBHA 3I53A 3KUDA 1CQWA 1P5ZB 3EAFA 4HX5A 1R6XA 1ZD4A 3G7NA 4RVNA 4DB2A 3LE8A 5TRTA 2YN2A 5DULA 1EGHA 4HX9A 2X9LA 3PXAA 4EKEA 5K6TA 3NLLA 5BSRA 3ODPA 5FBWB 4B3HA 2HRZA 1KE2A 1QVVA 1NUSA 2AEEA 4GKAA 4ENRA 1V5EA 1YDFA 2PT5A 3EXEA 2XTJA 1K7CA 3EDYA 3RVBA 1EJBA 4WFIA 5ITVA 2X3YA 2WYUA 3B1FA 4KHZA 5EUBA 4PLWA 2IV3A 2I33A 5JAUA 1U0EA 2XLBA 1D6JA 2HLDD 1FLDA 2AOUB 3ZCUA 1NXSA 5DI3A 1L5FA 2VXYA 4HZIA 4RJTA 2QRZA 1M1XB 1ANKA 1FIUA 1Z5GA 5P21A 4BWVA 3FBTA 1QFXA 2BKXA 4NQZA 2JNWA 3BOSA 5IYRA 2JHGA 1LWNA 4HTAA 4LWQA 3W5HA 4U6QA 4AO7A 2VYCA 2XMPA 4JP8A 3MMPA 2QRVB 1Y63A 1ZMTA 4MROA 4X94A 1EK0A 1U8FO 1DO0A 3WMWA 2A57A 2HEIA 2LZ0A 3KYIB 3ND5A 4FWBA 1UMCA 2HLPA 1W93A 3INGA 5F1YA 1ELOA 4ZGNB 1W49A 2YZMA 2OO5C 4O63O 3R9IA 4EH1A 3E4CA 3WRVA 5C7YA 3V33A 3G5TA 4YO8A 2VCEA 4TZKA 3G6EB 3PJDA 3WISA 1FRQA 2H5IA 2P2ZA 4YTEA 4JJFA 1JRLA 3K9CA 1M2OA 1XRRA 5FLYA 1CYEA 1C1YA 2HADA 3EVZA 4I5GA 2QE6A 2ONZA 1UMDA 2KBEA 1LLUA 2DHCA 4B6JA 1YR6A 1QORA 4K1XA 1WABA 1M8KA 3EMDA 1GNPA 3GB9A 4JJ6A 4PCAA 3DUWA 3AKCA 2O0JA 1M2WA 3FZQA 3IIJA 4L6CA 3ZDZB 3ZCRA 2BEWB 4GNKA 1IWOA 2HGSA 4KMMA 4EO4A 1F8YA 5DHTA 2HQ1A 5IBQA 1E3WA 1K68A 1P74A 4MSUA 4RPKA 4QM6A 5TT1A 3OIFA 1A4UA 1LUAA 2YOFA 1F0KA 3SNHA 16PKA 1B42A 2J85A 2PBFA 5F4BA 3TFOA 5EIBD 5T7BA 3QXJA 4P5EA 3FPPA 1T9GR 5DU2A 1OHHA 3R0QA 5G0UA 3LQFA 1X8XA 1WXXA 3TK1A 3TTXA 5J2UA 2G09A 3SOPA 1SGWA 1RRKA 2C2WA 2QIPA 2MYUA 1GPWB 1MV8A 1IXKA 1D09A 2AFHE 2ECKA 4RO0A 2QGFA 3WNDA 1PD0A 2VAWA 3IUJA 3LU1A 3UH0A 4DIEA 3O03A 4X95A 2AYYA 3IE0A 3N3BC 3ZD8A 1YO6A 3AHIA 3ET4A 3H9GA 3ASTA 1BGXT 1Z0DA 4NARA 4D82A 4FYVA 3QNWA 3IFSA 3BQMB 3EZ9A 4X7CA 5DNAA 1OT5A 3ENQA 5DPMA 4EGJA 3ECAA 3H13A 3KVVA 1G8AA 4L0DA 3D54D 4XFJA 5C8YF 1RD4A 1L5KA 2PU7A 2YFKA 2IP4A 1ZL2A 1S3FA 1KZ9A 3FDZB 1P8JA 2QYOA 4JEHA 4ZYWA 2QBYB 2RHLA 2X0NA 5MN4A 2VYFA 3LUDA 5FWNA 3UV3A 4KFRA 3EQ9A 2F1LA 1WXWA 2P5YA 1Q0ZA 3W77A 3LQKA 2O7QA 4UE2A 3U4AA 3B7PA 4HFNA 4EG8A 3B1YA 4YR7A 2QP3A 3LZDA 5KPJA 4XGNA 3K9FC 4I46A 3IAHA 1UC8A 2QTBA 4PRZA 1MZPA 1LW6E 4HFJA 1XZAA 1ZEJA 3K2IA 1X1DA 4TS1A 5HQTA 3ZV3A 3U1BA 5HZHA 2NMVA 3BGSA 1I2DA 2UZIR 5AUNB 3FNHA 1UBHS 4Q9KA 4RORA 4YX9A 2CT8A 3WGOA 5FBQB 1GXSB 4WN9B 3TEJA 2V7VA 1D8AA 1LNZA 3TR5A 3A70A 2WV9A 4XM3A 2RAFA 1QGZA 2YWBA 3ZH2A 3EQ7A 4D1YA 3AB7A 4EARA 5FPPA 1MX9A 2L69A 4KW7A 1JLRA 4MUXA 3WK5A 2G88A 2NGRA 1OZAA 3WGIA 1PIWA 1JLLB 1NT2A 3HYTA 5CA1F 2QMZA 4QUHA 5BV2P 1Z29A 5IZCC 2I2CA 4IMPA 1KARA 2FN9A 3JARB 2MINB 4GL4A 5KNLA 4N0EA 2C3PA 1MQ9A 2B61A 1P1CA 3IT1A 4EYQA 3ZY4A 3E20A 3JCZA 3E84A 1FXWA 4X7RA 4E4RA 2A2ZA 5TR9A 2WF7A 2IH2A 1YVPA 2O7NA 4A82A 2JGEA 1KDVA 1G7CA 2FB9A 1Z7YA 2A7QA 1FU8A 3PUKA 3KSAC 3CRNA 3FFAA 4R9UC 2BBSA 3L43A 2E21A 3ER9A 4X7EA 1N7IA 1CQIA 1TGVA 1DJPA 4B84A 5JD6A 3SC2B 5AJYA 2G77B 5HKKA 3RUHA 1PJ8A 1QPGA 1KFBB 1UR5A 4IIYA 4EVQA 5CDSA 1NG1A 2JLZA 4D3XA 2QKYA 2EBUA 4PZYA 4M49A 1X1AA 3FOAA 8MHTA 1TW2A 1O2DA 1VLJA 4GOKA 2ZRBA 2EFYA 2P4HX 2GXSA 3TQFA 1IN1A 2ZIAA 1WMBA 4E5UA 5K6RA 1V11B 4ZDKA 4AJ4A 4ADSG 5CFMA 2IYVA 1KTIA 2QRHA 4DDMA 2XMQA 2GEJA 3HGMA 4N65A 2I3DA 3UB3A 4UTPA 2AH5A 5A04A 2BFBA 4W9RA 5EEHA 5K3OA 1ESCA 1YITB 2BDUA 3O3OB 4CM9A 3HGTA 5YASA 4DBZA 2BVNA 4HE6A 3GO4A 3KS9A 3UTDA 2X22A 1E3IA 1HE4A 3S1SA 1MNAA 5FR1A 4CN8A 3BD9A 4I99A 3B2NA 3GRFA 2VRNA 2BN4A 1Q92A 1GZ3A 2VFAA 4R84A 1MQSA 4EZBA 1E99A 4XB2A 3S0JA 1NVTA 2REXB 1II8B 2QN1A 3EUAA 3I37X 3MIZA 4F3NA 1ULUA 4ZMRA 2LIVA 4MW4A 4UCFA 4YLGA 3GCZA 1M2HA 5KYYB 3E9DA 3NYIA 2FZWA 1EBUA 1MU0A 2MOKA 1YJWB 2XT6A 4ZMSA 3TTWA 3SYNA 3L07A 2OOSA 2X0FA 2XB2A 4BUJA 1RE0A 2C7VA 3CPXA 2ZBQA 3H1PA 3HH8A 2CLIB 5H8WA 2FDRA 2LBPA 3KT6A 5BXYA 4WWVA 1WB9A 3K0KA 4MW6A 1CR0A 1XCPA 2PL1A 3C7DB 4DC1A 4LY9A 2VBVA 1E5VA 4Q9AA 3ZZ1A 3DDUA 4U0JA 4CV1A 4O29A 1SVKA 4QRIA 1UJ2A 4EHIA 2H1HA 2J48A 5CDUA 3GLIE 3WYNA 1QH9A 4MYHA 2VYVD 5H1YA 4L4RA 5KOYA 3ODGA 4PLGA 2H5EA 5KNDH 1G21A 3CCVB 4L85A 1OI4A 2IHZA 3BWMA 1Y4UA 3X1XA 1EFRA 3CF0A 1KEVA 2EF0A 3RNOA 2QIOA 3HBMA 4LYJA 2QM0A 4DJDC 1ZWKA 4EVSA 2V4DA 1TADA 1NASA 3AJAA 2I4OA 2C5EA 1S9HA 4B17A 4DA4A 2PKQP 1DV2A 1IK4A 1HMYA 3LC7O 4MINA 1MJNA 1W0CA 4XD2A 3ZWWA 4BNKA 2XH8A 3EDRA 3GPDG 4XUGB 4UBKA 1MG5A 4WD3A 3K73O 4C2AA 5JY1A 1QHFA 1SG6A 4B76A 4GC9A 1YVUA 4KXMA 2Q1XA 3IVAA 4ZVTA 1MB2A 2QMQA 5E1MA 3ZHCA 2RDMA 3NOXA 3UQZA 2GJAA 2PGLA 3TG8A 3VAZA 1U1CA 4UFOA 2HT1A 1Q1AA 4NZZA 3DW3X 3UUWA 3PQFA 4YV1A 5FTLA 1X8LA 2I1VB 2P1DA 2QV0A 3EZFA 2PR2A 4CQMB 5IDXA 1W88B 1NKSA 2C3YA 1T2EA 5FBZA 4F04A 1HX7A 2BDTA 2Q4TA 2DHDA 1JWBB 1LPMA 4KR7A 2WYOA 5FORA 2P9FA 2ZZKA 1FSFA 3OZ7A 3LY8A 4JQSA 5HCUA 5DN9A 3U9SA 4TVSA 1SAYA 5TMBA 3M3DA 2FK8A 5AW2A 3OETA 5HRUA 4CL8A 3ONNA 5BPHA 3MG9A 4BNYA 1Q0SA 3PC3A 2DJ5A 3I42A 1WHTA 5ALPA 1OXUA 2GZMA 5L51A 4R1LA 1CKEA 2IEIA 3AK4A 3ZJTA 1QTNA 1ZSVA 2ZYDA 1Y33E 3GJ0A 1Y1LA 3DKIA 4G65A 3LT0A 4OP7A 4B74A 4F5YA 5CFPA 2EZ8A 2ZZGA 1U7WA 4L5CA 4ZT2A 3U1VA 1TK2A 3M1LA 3CX8A 1PWZA 4IIJF 2XSZA 1VE5A 3O2SB 4G56A 2B5OA 4OLJA 5DXAA 1Q3HA 1ENZA 1V96A 2UXCB 3G05A 3U0VA 1DG9A 3DUFB 1RYHA 1ULSA 4PG7A 4RTQA 3JQ8B 4CI9A 3COWA 2JK0A 4LRWA 1WKBA 4BFWA 3WBJA 1Q7CA 3EEBA 3W0LB 5AD1A 5KEIA 2O8NA 4ER0A 4A36A 2FSPA 3SBOA 1W581 2WQ6A 3N2GA 1Z0FA 5KX5F 5DYYA 5JO0A 3PKZA 2O3SA 1ZI8A 1ZIOA 1ZZGA 3LBHA 3ZLUA 5FUMA 3PC4A 3TQIA 1K5DA 3D8HA 4X00A 1BTOA 5CYFA 2LGJA 1XEAA 2CL0X 4EEXA 1TL7C 1OBVA 5LB4A 5SY6A 1YK0A 4YAWA 1RBYA 1ZY2A 3SZGA 1BWSA 3BSFA 4FZVA 5JMTA 1R6UA 4EZIA 3CB4A 1E3TA 1QJCA 2B69A 1A97A 2QT9A 3B12A 3MD9A 3OQJA 3TOZA 4EUHA 2H1OA 2ZRDA 1YTLA 4A23A 2X3FA 4N3AA 4DBLE 5C8XA 1JAYA 2QLMA 2ZRLA 1U02A 3CS3A 1YIAA 2WNSA 3ICPA 4NP6A 3AERA 4LZNA 4UPVA 3KZ1E 1IEXA 1XL0A 4TTRA 4ZPXA 3T5BA 5JFOA 1VG1A 4J0QA 2J5RA 2GPTA 3HL0A 5BN5B 3NDPA 1VE9A 1GZHB 4YJKA 2HN9A 5BSMA 1A8SA 3PRKE 3TZKA 3ZWXA 1NHGA 4QRDA 4HV4A 4M37A 1VFPA 4OOFA 2QXUA 3CLTC 3DCJA 4GPAA 3GMIA 2Y0BA 5K4AA 1I4WA 1AN0A 2PFSA 1TJPB 4P35A 1OI3A 3AJDA 3HO6A 1PJAA 5CCEA 1NW6A 1WY7A 2FG6C 2QQFA 5AHKA 3ZJ4A 1Z0IA 1TA4A 2ZUCA 4QPZA 4E0BA 2OMEA 4WI1A 2H2GA 2YUTA 3BXOA 1PS8A 2DGDA 2AK2A 2CHFA 2HB6A 1KH1A 1SBIA 2ILVA 3MWKA 4PNHA 4K6GA 1C7RA 4L78A 4ARZB 4O3MA 2IP1A 2WILA 4DV7B 2E37A 4YMTA 3EWNA 1XIVA 2H85A 2FSFA 2VQ6A 5EHNA 3L0DA 5B7NA 4BNWA 4FB4A 1C41A 4D6PA 4Z2AA 3A2LA 1MA3A 1AIPA 1L1QA 4JI2B 1JZSA 2A9KA 1B16A 2DECA 3RWOA 4RY2A 3HCWA 3GN1A 4NC9A 5AMXA 2JHFA 2IU4A 1IL0A 1FXSA 3C3YA 3H3JA 3ICVA 3IJEB 3ZJYA 3ZVRA 5EFOA 4YQFA 3GYBA 4PQEA 2G0AA 3K8QA 1QTQA 4CMEA 1KF0A 3MINA 4MQLA 4ZQFA 1A9SA 2P30A 4C3VA 4BQNA 5L6LB 1XTSA 4YP0A 5IMBA 1AUXA 5JD5A 1DKLA 4BLRA 2H9YA 3DDSA 4ECEA 4NBTA 1F6WA 1TPZA 2XUIA 3UMBA 4DYVA 1DRVA 3TTYA 5JSKA 1CB7A 1HSZA 1O03A 1TM5E 3AF2A 1WSDA 4GRDA 4IJMA 3QBDA 1ESNA 5FTJA 2VP9A 1N57A 3HEBA 2QW1A 4ZAYA 3UT0A 3FLMA 2IPMA 5LJLA 1NN5A 1RRFA 1S3IA 2H0RA 4F06A 4MRRA 3RIEA 2EJCA 3V7NA 2YXNA 4CPDA 1CS0B 1WUJS 2V59A 1Z0JA 2DZDA 4XDYA 2IS4A 1Z6YA 2HI0A 1MRSA 2YWRA 2VK8A 1IJKA 2DULA 2ZUSA 4K6HA 4X54A 5DLEA 1I2MA 2WUDA 4YH1A 3P4UA 1HDCA 1F48A 2WEKA 3B82A 5J3JA 2F3SA 4FMPA 3ER8A 2H65A 1WORA 5AM0A 3JRNA 4RJIA 4L5IA 3V8QA 3F96A 2ZRKA 2QK4A 3P19A 3BKWA 3K31A 1FA9A 4QFCA 5PNTA 2X0DA 4ENQA 4RX1A 1TW3A 4F60A 4RZIA 2Y77A 3Q3GE 2CF4A 2CNNA 4TTAA 1WF3A 2QRKA 1TU3A 1GAWA 4RW0A 2FFHA 3Q87B 1RM0A 1JG1A 1LWOA 2AR9A 1ZD8A 3G71B 2DY0A 2NU6B 2RSLA 4Y7DA 1APBA 3DVLA 2GF9A 4MS3A 1A5BB 4HVAA 2NG1A 3UKJA 4DSZA 3HV0A 3I6MA 1RACA 4CF7A 2AI2A 3NT5A 2YS7A 4TLAA 1GIAA 1RHJA 4FQ7A 4TV8A 2WYIA 3AM3A 4F86A 1PGPA 2MYNA 2D8MA 4C05A 5D3ZA 5KJEA 1G5QA 1KQPA 1V9LA 2L17A 1OLUA 1H0RA 2A92A 1GG9A 1IZ8A 4J07A 4DWJA 1N4DA 1QE0A 4DMLA 5KDDA 1B93A 1KI7A 4RLFA 3R3SA 3RFVA 1XJWA 3C3MA 3R5XA 3K16A 1QP0A 4G4GA 1NMYA 5AW5A 1OWLA 2ZPUA 4IS2A 4D7AA 2R8YA 2RGGA 1Y8CA 2I1QA 1P44A 5F2EA 4AP9A 1G16A 3W4JA 3MA0A 2AFHA 2ZUBA 4KIWA 3FRJA 4AI6A 1LK0A 1KNXA 3I76A 2G7MC 4PO9A 3QTTA 3K6SB 3ETLA 5E9AA 2R6R1 4CCYA 3NYWA 4YAGA 1NXVA 1ZUD1 1W47A 2WINI 2Y92A 4RYLA 4C0KA 4TMKA 1TT5A 3H0KA 3WBBA 3ZWPA 3FSRA 4BZWA 4QOSA 4IJ5A 2PZKA 4WECA 4WLEA 4LE2A 4R41A 2NSHA 4DT1B 3WLQA 1OC4A 4X8OA 2GJKA 2ZJFA 3PR1A 5KTOA 3GEBA 3QF4B 1KEWA 2QJWA 2Y1WA 4IZOA 5FL7D 2FQXA 1VI2A 4NE9A 3CSSA 5TEVA 1D2AA 1UBGA 1XJ0A 1XLUA 1W73A 1WHSB 3DM5A 2YWCA 3LS2A 3PUMA 4IIHA 4Y1GA 5EA2A 2WTAA 1JQBA 4D81A 2QVBA 1UWKA 1XKXA 3PA6A 1AKQA 5IG2A 1V8FA 4JMQA 1UPTA 3W7BA 2IYFA 2X1MA 3AF0A 3VI4B 4S1OA 2GO7A 3N87A 4AF7A 3QBJA 4EFMA 1O57A 2BL4A 3DHEA 5D3MA 1LZKA 1Z2DA 2MYTA 2GPSA 2Y1XA 4CHGA 1H2WA 3LFHA 4YMUA 5F77A 2VPWA 3KTOA 3DEYX 1GZDA 2ZIUB 4A0FA 5F9HA 2HCTA 3DKRA 4KTVE 3KDPA 2O54A 4KE6A 3VDXA 4ALLA 1QPBA 3OPNA 1V25A 1SQ6A 3WTCA 4H7JA 3OCCA 4L57A 5GIOE 2OORA 1O1YA 2BH9A 3PSAA 1MFZA 3UT6A 4G1CA 1A9ZA 1YBVA 3OIVA 4UMVA 2INGX 1UOOA 3I01A 1BS1A 4U3JA 1SG0A 3R7BA 1ZJJA 1K63A 2A8YA 4UARA 1EDBA 1SBCA 1N2GA 2QU7A 4HQ0A 3VR6D 4BQPA 4D3SA 4KR9A 4F93B 5LQNA 1RWKA 3PFGA 1ESEA 1N92A 1OAOC 4MP8A 1QF6A 2O8EB 1A77A 3DE7X 4URFA 4F7WA 5JAHA 2P2GA 5JFTA 3LX5A 5CAEA 1U3UA 1EGQA 3DMYA 5E1OA 1CDOA 2D1YA 1RAHA 3FTQA 3O3CA 1KE1A 5C9ZA 4UUBA 5ARDA 3ITNA 2BEKA 4ZOLB 4JL5A 3BGOS 4YRRA 2HMYB 5MN5A 4LHXA 4JSYA 4D4MA 3AGQA 3RVNA 3H97A 1YRAA 4I4TB 1YCGA 1M6EX 2R87A 3JD4A 4NKRA 2N1MA 2YXDA 4FJ2A 4BGUA 3VA7A 4DV4B 3DULA 2EL7A 4LXUA 4Q1CA 5I4IA 5LQAA 5EJGA 3TSYA 4B4VA 1E2DA 1ECFA 1XO1A 1VP9A 2O2GA 1PQPA 2VHCA 3F78A 4DJJA 2A3NA 3UAYA 3UATA 3NHFA 3P2KA 4OPOA 5JLAA 4ALJA 4UHJA 4X8LA 5JJBA 4HGQA 3ZWAA 4II2A 2LV8A 4DCVA 5CT6A 4I9GA 1A1VA 2J9YB 3MWEA 1TA9A 5FLXA 3ONYA 4LUCA 3A26A 1XUOA 5FOWA 3DSRA 4KB5A 4XJXA 3KOWA 4PCUA 3DMHA 3MTEA 3ZC3A 1EEHA 3AOGA 1TT7A 3E9ZA 3BWYA 3L8EA 4GQAA 5DBGA 3RRZA 3ZTYA 3VQTA 3HG7A 2HSWA 2P2DA 1E2BA 1MOSA 3HB7A 4JL8A 4OREX 2Z57A 3M81A 5CDHA 3OZIA 1LZLA 2B0CA 1OFVA 4CKCA 5IM4A 4UNRA 4C4RA 3KB8A 5FYQA 3FMFA 1AHHA 1UKAA 5DHSA 4PAAA 1HDIA 1DSSG 1U0FA 1CB0A 4HGNA 4LOJA 1ZGGA 3Q6RA 4ZGQB 1KOLA 3ELWA 1JR2A 4X92A 2GA9A 1H1DA 4GF5A 4G9BA 4ABYA 4C9BA 2Y9PB 1YNOA 4Q3AA 5GJCA 1ZIDA 2Y93A 1JEOA 3CPEA 4BP1A 3D6VA 1Z6QA 1MO2A 2DUUA 2QTNA 2XVAA 4HWGA 4KO4S 1Q7BA 3GLIA 5AP9A 1AK2A 3HQ4O 4V0LA 1VE7A 4WLVA 2QLFA 2B98A 1YZQA 1ZGAA 3AKYA 1ZA2A 4JAVC 1YZTA 1NL3A 3GFRA 1W35A 1R4NB 1MNQA 1HTWA 1FJ2A 1LPOA 1AM4D 1QB8A 3C8MA 3K6JA 3AEZA 1XXHE 4X0EA 4ZO8A 4EABA 1L2TA 1M8GA 3H99A 3IMEA 4OQXA 5AICA 3U44A 2J9RA 3UMGA 2D7CA 3IIIA 4B7CA 2Y68A 4LY0A 4C14A 4CQNA 2JVJA 4NZNA 1FP6A 1OI2A 1WB4A 3ONUA 2XWQA 3U4IA 1ZVMA 4CDNA 4G25A 1ECPA 3RS4A 3L7AA 4EF6A 4QSMA 1N2EA 3HE3A 5G41A 5KNCH 4BRSA 1B8VA 3PICA 5J4VA 2UAGA 4LZWA 2QM7A 4K2HA 4NFSA 1T13A 4XI9A 2VBUA 4LNAA 1QHGA 1QANA 1CD5A 1MB3A 3UMCA 2XRYA 2VQDA 3F1LA 4QNMA 4ZWNA 4S1NA 1KHHA 5A1TA 1JJVA 1Z0UA 4UZEA 4V1CB 1JF8A 1AS2A 2AK3A 1E7RA 2Z4TA 1P81A 3FNGA 2GCNA 5KOJB 5C5DA 2X5JO 1OT3A 5DHQA 1RZRA 4HPXB 1JHPA 4GPIB 4BLSA 3OEHA 5EE0A 4ZHQA 3OA2A 1SXJC 3DAHA 1Z37A 1E77A 5DW0A 2F90A 4KIJA 1CQXA 4GGOA 2EQAA 3EN0A 1GTJ1 1ZNZA 3AM4A 5K0GA 4XOIA 4YUZA 4PIVA 1T0PA 1UXIA 3EMVA 1VRCA 4V0OA 4F6RB 1XFDA 2IYPA 1AT1A 1OVMA 2NSYA 4XOPA 3KLOA 1GL9B 5KYUA 1O9BA 2VBIA 3AVXA 4MTLA 4XIJA 4I4LA 5IK2A 1MO5A 2AUMA 4RA6B 3WSTA 4Q02A 1MB4A 4UOQA 4YREA 1KJWA 2CLDX 4FYXA 4EQZA 1RPZA 3FNQA 4IUCS 5I5GA 3VKWA 5GZ6A 2JKVA 2ZREA 1MA0A 3I04A 4UVHA 1UXGA 5EP1A 4B73A 3A9RA 1JJFA 1I6MA 1ULZA 1X1BA 3ENNA 3FGZA 5DS0A 3NTRA 2DBQA 5HCIA 3FYCA 2FUEA 2EXXA 5E3IA 3TLMA 4AF8A 6REQB 3ASZA 3T5DA 1A5SB 3L8HA 4Y2JA 1RQGA 1X1EA 2FQQA 3DMNA 3VNSA 3E9CA 4DRZA 5BMVF 3A9CA 1U6IA 1KQOA 2OGUA 2OCAA 3NEYA 4B7AA 4YS6A 1E9BA 3IKMB 3H4VA 4LJ8A 1F5NA 3A4YA 2R8PA 4MUAA 3O7WA 3HWSA 3CU5A 4OAQA 4N3GA 1XYGA 2BGLA 1Q21A 4FNMA 1U0BB 2RC6A 2JJYA 3IEPA 3LG2A 3PRYA 3S2UA 3PTAA 4D26A 4RH1A 2XYVA 4PZPA 1Z2NX 1G5PA 1TYCA 4L0QA 3UYKA 3UJ9A 3L0IB 4BO6A 1U8YA 1XCGB 4JXKA 2AX4A 4CM4A 2BEUB 3K1YA 4OFWA 1CY4A 4KNYA 5B30A 1OH8A 1VJSA 3AIOA 4B8YA 3NWBA 5H9WA 5KREA 1L5YA 4KUHA 3ZEAA 4D43A 1EWRA 2ZETA 3AP3A 2ZIVB 4TRMA 2JS7A 2C7BA 4C7BA 4C0HA 1RAEA 4G5HA 1PVDA 1VQLB 5LA6B 2ZFUA 1GQFA 3ZDXB 4Z4YA 2AXQA 4BIIA 3E2PA 4CFSA 3FTCA 4MGZR 4Z51A 2FPLA 2JAHA 3A9UA 4GYWA 2XQFA 3D5TA 4I50B 1SCDA 4HYTA 1ZD1A 1P9OA 4NLLA 3FHTA 2CDCA 3BRCA 4LSGA 5JPIA 1DWOA 1TZMA 3U40A 2OV1A 1EXMA 1FZQA 1UWCA 2J46A 1TB4A 3LUJA 1CLUA 2GEFA 1ZCAA 2YBDA 2HLDA 4MR8A 4NRDA 5JXGA 5DV9A 3G59A 1P0CA 4Z0PA 4D97A 1JIVA 1NYRA 1R9GA 1IN4A 1QIJA 1RXUA 2DQZA 4Z0NA 3RTGA 5HK8A 1TAGA 3K1AB 4HOYA 1JB9A 3U5ZB 3L7CA 3EQZA 1J0CA 2IPOA 4JP5A 4BTLA 4H3HB 4U9UA 4JYPA 4DJ5X 1QIKA 3QPCA 4ZIRA 4L9WA 4KQFA 1II9A 5JR3A 4N48A 1B3BA 4NV3A 3TIXB 1QVFB 2C54A 1JUDA 2PJUA 3M7IA 2C3OA 2WJ6A 4I9FA 4QXMA 1T4BA 5DBHX 1U99A 3V4LA 1PLJA 2FF5A 1CNFA 5B6IA 2BCGY 4UXIA 4XA8A 2XD9A 3UK7A 4E15A 5A7HA 1GNVA 2ALJA 4G26A 4NMMA 4QOJA 4Q1VA 3BVPA 5FNVB 4RE5A 1ENPA 3R7LA 2XKBA 4BV9A 1QKKA 4PC1A 2UZ4A 2RE8A 2C1EA 4MQFA 3PKJA 2AHRA 4L5YA 3BRSA 2ZJ4A 1U4NA 3QBEA 3KU4A 4GPZA 4EATA 2B9VA 2P4UA 4Y7CA 1DFGA 4DMKA 2H5JA 4RGYA 3BJEA 4IZHA 1UBTS 2CD9A 2FHPA 4F8EA 3G2HA 3BE8A 4YQZA 4NCBA 3DOFA 2C84A 4QYMA 4D3YA 4G0WA 2E4AA 3GNLA 5EZYA 1X80B 1NUHA 1JALA 1DBPA 1JG4A 2FWBA 2H2FA 4QLAA 3G9QA 4M3NA 1Q57A 2EW1A 2JAXA 5GWXA 3N05A 3GVHA 4GQIA 5D1HA 4G6IA 2M32A 1G41A 5JNLA 4K6KA 2IS1A 1KAQA 4C4XA 4C88A 5B3JC 1U80A 3HDQA 3F2IA 5K1ZA 4C4OA 2JFPA 4MO2A 3HWWA 3Q5GA 5TXGA 4BATA 4RGQA 5IKPA 2QSJA 1A8HA 1HXHA 4N9WA 3ZXIA 1X7DA 4HSEA 1NI5A 4CMCA 4EA6A 2CMHA 2D5AA 2E18A 2WJWA 5KC8A 3SXPA 2P7IA 1PT7A 5DM70 1ONOA 2PE3A 3A27A 1DKPA 1UPXA 4AFNA 1P4SA 5C8ZA 3PUJA 5ESRA 1WVMA 2PEZA 1URPA 4DJTA 4Z9YA 5IUKC 2W6JD 3USCS 4MUFA 5JNUA 4GE0A 3T9CA 4BGEA 1I18A 4DAOA 1Y1SA 3AI2A 3FWHA 5F1KA 3UAXA 1CR2A 1Q6YA 1J9GA 1ZMXA 3TZ6A 3OUUA 1TKCA 3FMIA 3JQ6A 1NW3A 1DQNA 2VRCD 1RPAA 3L7YA 4V02A 4B6QA 1O58A 4Y2TA 1WXQA 2C9YA 3QLJA 1BAPA 3CF2A 1GLVA 5JCOC 3DAGA 2FWIA 2TS1A 1PWXA 1I13A 4KLNA 1IY2A 3NGXA 2COKA 3LDFA 1QYDA 5A3JA 5KI6A 4DHWA 1S8NA 5JI3E 3KYBA 1KMIY 5KMGB 3D43A 1EWYA 2EAUA 4KV7A 3A0UA 2OBYA 3VR0A 2C2YA 3WP0A 1S89A 2GPWA 3CZMA 3UPUA 3D4OA 1P80A 1EDDA 5DYGA 2TMYA 4E21A 4YAEA 3M6VA 1E89A 2E2WA 2PVSA 4X85A 1XTRA 2WG2A 4MP3A 5SY4A 2BUAA 3UJ6A 2LCFA 4HXEB 4G41A 3UFXA 1U7XA 2VJAA 4PLPA 5EE1A 1YBHA 1MRZA 4S1WA 4WNAB 4MVCA 5AUQA 1YL7A 3VXKA 3FHOA 2PD4A 2IUTA 4J76A 4EB6A 5KSZA 1UPAA 1ZISA 4ERNA 1P7YA 2C95A 3IR5A 1X86B 1XA3A 2HF8A 3EF3A 4QXAA 1CJSA 1KYYA 1NJID 2XYRA 1LVUA 4DSOA 1CUGA 4MI3A 3IO5A 2O5EA 4OIFA 1F51E 1HH4A 1XQ9A 1LDNA 1C4XA 2FQYA 4G67A 2C78A 1K88A 2IZ6A 2QUBA 3WGHA 2CD7A 7REQB 4ZJZA 3PUVA 1XCMA 4B32A 3C3KA 3AJ9A 4PNEA 2BJVA 2GAIA 2XNKA 5FWXA 3OWOA 1PZXA 3HYCA 4V1CI 2J1LA 2P65A 1M2VB 2QD2A 4WOKA 4BVBA 5A4JA 5FEUA 3OQ1A 3IEXA 5CIWA 2L2QA 3GCWA 3SJAA 1YRWA 4PYNA 2EGGA 2JANA 3SJCA 4X91A 2J87A 3C4QA 4WY2A 5MFZA 3ZYCA 2H4XA 2UZ1A 3PDWA 1DAEA 2PJDA 5F76A 3QX9A 4XLTA 5HF8A 5JV5A 2FEPA 4KGDA 3C8HA 4ZPJA 3DNPA 5JALA 1CUEA 3RFTA 3NONA 4KL8S 1M2GA 4Q3DA 4R8RA 4AYWA 4BGVA 4CEIB 5K7SA 4KJXA 1NQOA 2MR6A 4C76A 4I2NA 5HQ3A 1BMFD 3JSAA 4PPQA 2X8WA 5E6UB 1IOWA 1XZBA 4YRSA 3DTTA 4YHBA 3AY3A 4PTZA 3W7AA 3RYIA 5CW1A 3CX4A 2H2DA 1BDMA 3BAFA 5JDIA 5L7TA 3SIWA 1O6FA 3ZX5A 4EF5A 1NMXA 1Z8DA 4OJMX 2IYSA 1NF3A 1Y6FA 3R41A 4I55A 3MAGA 4EF4A 4GEGA 1Q7RA 3W2IA 4G07A 4RHFA 5ENDA 1M6HA 2YJ4A 3K9BA 2FU5C 4GP7A 4H15A 2C2MA 1E3EA 2NUAA 2XYPA 1PYGA 2HIGA 4QXQA 5ALTA 1OIXA 3RIYA 4XWOA 3ZHXA 3Q3CA 4CIXA 1JKXA 3OICA 1UM8A 1KRXA 3FJYA 3L8YA 1LQ2A 1L5HB 4YP5A 3RUIA 4CF5A 2I76A 1BS2A 3BIOA 4X07A 4QQ8A 4JKOA 2OBTA 4BN4A 2BF4A 3RYCA 3SSAA 1I7SB 2ZSKA 1MO6A 1FMJA 3EYWA 3KR0A 2OYRA 4NCXA 5DM4A 2P2NA 2PH7A 2WD7B 3DQQA 4ZRNA 3GIWA 1NFRA 2OHHA 2Z30A 2FMTA 2J9FA 3SZLA 3MGBA 4X44A 4A5OA 2XGJA 2YMLA 2JI8A 1D5CA 4DNQA 4B7ZA 4P0TA 3OF2A 4A1OA 5CG2A 3JVDA 3OQNA 1WV1A 3QI7A 3FYHA 3UG6A 5AFSA 4CIWA 2DPHA 2RGYA 5JCZA 1FSSA 1X70A 2EKLA 2VYVA 1TZBA 4PPYA 2GLTA 3DZHA 5KVVA 4I8DA 2A14A 4Q93A 3LVBA 4LHWA 2VJQA 3PLAE 1F2VA 3MWYW 4YJGA 1KFJB 4WK6A 1UANA 3R09A 1K7SN 2HRDA 2YJZA 1F9EA 3UV7A 2DERA 1U9JA 3E70C 4Z4GA 1SC6A 3K9QO 4LECA 3FX2A 4JFRA 4Q15A 4X1KA 1UINA 5AR1A 3HVRA 2FMXA 3HDGA 1OXTA 2X2FA 3L4BA 3WGVA 3UJAA 4WXYB 2H2WA 2P3LA 2AJ8A 4WCFB 1KMHB 1RKUA 4GX2A 4JUIA 1WW3A 2UVPA 4RFSB 4UUAA 1XAGA 2W37A 3L6CA 4OXRA 5TY0A 1GRRA 1U1GA 4DIDA 3C6KA 4GQBA 5IASA 4ZJYA 4F21A 4G0OA 1D03A 1HDRA 3JAKA 1AS3A 4WZBB 3AZQA 1B6SA 5K05A 4G7XA 3PZRA 3R24A 3MHPA 2NVWA 3MWJA 1E7MA 5KUTA 2AEJA 4C22A 4P7FA 3VZDA 3QLVC 4ZCQA 4DDTA 1ND6A 4K87A 1QU3A 3KHSA 5CIQA 3RM3A 3DEJA 5C18A 1E3MA 2YDXA 2FR1A 4CQMD 4OOEA 2FLKA 4CKEB 1GFIA 4QODA 4D9EA 1T4GA 2X1HA 3ZLBA 4CVNA 3G7UA 3SHTA 4UDXX 4X64B 4UUPA 1JMKC 4R1OA 5HF5A 4ZOAA 4X97A 1NPYA 2QZZA 3H8SA 5CD1A 1WOPA 3I5MA 3ND9A 1GRQA 2D1SA 2C96A 4I4TF 2WHYA 3NWPA 5F73A 4AKGA 4YCJA 1Z12A 2VSOA 3ZBPA 3ZKWA 2MSCB 3I0ZA 5BSXA 3R7SA 3UMJA 2ZAGA 1IUPA 1YB1A 3BL8A 3CWCA 4LRSB 3LQYA 1ZVJA 3QLEA 1XXHA 5K3BA 1L5LA 2PMEA 4N9QA 1G291 2OEPA 3RAJA 5F4MA 3LC2O 1BN6A 3QLUA 3OTOB 1F7UA 2QA4B 5CT4A 1C1HA 3OJ0A 5DYIA 2AN5A 3EZXA 4NK4A 1KMQA 2V9PA 1K8YB 3GDHA 4MJ3A 3C5CA 1YKGA 3WGNA 3M6LA 1ISHA 1HT1E 4C07A 3RT7A 3CURA 1CYDA 4J91A 1CP3A 3IIEA 1G5FA 5LBUA 2EJWA 1UAYA 2BR5A 3PI6A 3TG2A 1FX1A 5GONB 2H6EA 2GD1O 4IQFA 4JIGA 1RMYA 2ZRAA 1IJEA 3ZHQA 4EQ6B 2BCJQ 2IZ1A 2GEUA 2HDWA 5CHEA 1CRPA 1L5ZA 2X8AA 3QEBZ 2NUBA 1K6IA 5U1PA 3THWA 1XVAA 3B3AA 1R9MA 4YMWA 5BUZA 4ABTA 2K7FA 4R31A 4KLAA 2Q1SA 2IUUA 1ZGZA 2VF2A 1E66A 3ZGYA 4B4UA 3DZBA 2RAUA 1AKYA 3C6BA 3LTEA 3Q12A 4J3FA 4ZCLA 1T3GA 1BROA 3RKRA 5DM60 5KU7A 5HIMA 3VU9A 1NQAO 2FRDA 5A9RA 4R01A 1BS9A 3PGA1 4P38A 4WFKA 1G6KA 4P3XA 3P0IA 1ZH6A 4JA2A 1MEOA 1BE8A 4EX7A 1KQGA 4B6SA 2DUJA 2IZ7A 3PUIA 4U9HS 2C07A 1IWPB 4B81A 5A4IS 3FAZA 2PFGA 2XRMA 2VJJA 3H4MA 3WL7A 3L1UA 4Q82A 4RQTA 1FDSA 3AIMA 3KRTA 5FUXA 4YELA 4UM7A 4DRYA 2XMSA 4H3KB 3D81A 3LCUA 3NRJA 3OUZA 1U8XX 2BMEA 4RTPA 1PS0A 2B4RO 2BGUA 4BO3A 1RPNA 3KOUA 1KGSA 4E6PA 2PUTA 2Y05A 3NHWA 2FI1A 3O73A 3NTXA 4Z49A 2OAGA 1WSBA 2PCJA 5JWRA 5K8VA 3ACBA 3BMOB 4C30A 4Q3KA 2PKCA 1HYGA 2C5GA 2OILA 1Z4PX 3CF6R 3HCFA 3MGCA 1NUPA 5ALDA 1IU9A 1DCFA 3EWIA 1C0IA 2HJGA 4LPKA 3ZNPA 1S7GA 1FYFA 4BQOA 5DO9A 5IJ9A 4XYEA 3W2FA 2SECE 2V1UA 4JJAA 2VJCA 3LP8A 4MR7A 4DSUA 4NPHA 4I6EA 1NRWA 4E5PA 1QV7A 4RHEA 1TVKA 2VA8A 1ABBA 3TDKA 3QF7A 3V1NA 1RQNA 1TEHA 4I8XA 1DMSA 1UC9A 2YTZA 3RFUA 3AFNA 3H5NA 4BLQA 2IL1A 1E4EA 2R0QC 4GMFA 1E1DA 2YZKA 3TRKA 4BB9A 1DV1A 5FPKA 4R1PA 4XM1A 2J3HA 1NIJA 3B70A 2V6JA 3IBCA 5AVSA 2GZ1A 2ATIA 3BY1A 3IQIX 2NTJA 4Y18A 4HRYA 3VNAA 3T1VA 4F0JA 1S2IA 4GIBA 5BV7A 1VHTA 4R69A 1IVYA 2GHQA 3CRW1 4UVIA 5C8YA 1RWWA 3WJ1A 1XI2A 4Q24A 1X1SA 2J45A 4P25A 2X9QA 4AUMA 1ZHOA 1M2JA 3B48A 3NBYC 3RSLA 2JCSA 3WICA 2IPLA 2WIFA 4XM0A 4RANA 2XT9A 1XRMA 4QXPA 3T95A 2IIBA 2V6BA 1OQAA 3O8LA 4Z8XA 2OV3A 3TSCA 4AYXA 4JJ4A 3PUHA 2MR5A 3ESBA 5JYCA 3RYFB 4BQRA 2GHRA 2G08A 3A4NA 3MGAA 3DQZA 4XQ9A 2DAPA 3GPCA 2R96A 2ECFA 2YJTD 4H6PA 5GV7A 2V7UA 1E5TA 1T34A 3HV2A 3QUAA 4ZGGA 1V37A 3SKYA 4LGVA 5DISB 2IHJA 2GCIA 4RBNA 4BNLA 3TB4A 2OCXA 2IS6A 3M6IA 3PHBE 1F3OA 1CDDA 2PHZA 4JZYA 1DARA 4AKSA 1KORA 2YV5A 1A9XA 3D2BA 3RC2A 1EUDA 2FDXA 1XQYA 4GYYA 4J6FA 4IDDA 4OXNA 1E6CA 3DWFA 3QKSB 1RQRA 4L4UA 1OX4A 1A4IA 4RWEA 4C5CA 1R15A 2WJGA 3B1XA 3OFND 3GGOA 1P31A 4V3BA 4BVHA 4QQKA 2IYLD 2OCDA 2I6GA 2PMWB 3FUCA 3OQ6A 3QVMA 4ZANA 2XITA 2LUOA 2NO6A 3A9WA 4JNKA 5CVTA 5EJ7A 4BVFA 2ZB2A 4IFIA 2V45A 4TV9A 2C5LA 2P9CA 1GAXA 2OD2A 4KSCA 2O2SA 1GZ6A 2IW1A 4AVZA 1JIKA 1CUAA 4V24A 1Z5OA 3C1AA 5EE9A 1X7WA 4KFTA 2CYAA 4LCJA 2FUCA 4N6OA 1VFNA 3GMTA 4YQEA 4CMHA 4D9BA 3PC6A 4HB3A 4UBNA 1D07A 2NUPA 2CNOA 2OFOA 4W7SA 1Z07A 1JH9A 1QGDA 2NVBA 4W1RA 4N5HX 1IZZA 4G0QA 1T4CA 2OHGA 3LLSA 5KINB 4RPHA 3CVUA 5CTAA 1VQKB 4UREA 5AM4A 5I7EA 3RKUA 2BZ1A 3VO1A 2P8JA 2ORIA 4DV3B 3N59A 4IYJA 3CZ4A 3E9EA 3OOWA 4RCVA 4DUZB 1JE1A 1G3QA 1WF6A 1D1QA 2PRJA 3KQWA 1KI2A 1W87A 3FPSA 5EIFA 4YT5A 1OGIA 3HNPA 1YKFA 2QMYA 1KIMA 1P7VA 4P4NA 2XD4A 2NYVA 3KUKA 3T1OA 3PF8A 3RD5A 4QQNA 4EUSA 5EKSA 3UUGA 3AU8A 5FNVF 1ECCA 2FUNB 4FDLA 3VPFA 4IXNA 1U2TA 3IUEA 1YU9A 3IUBA 3O4HA 4BE7B 1SEVA 4WXPA 3PEYA 3PCXA 4R8LA 1GG2A 1O54A 1U3VA 3ADOA 2JRLA 4FINA 2ZEJA 3ZGVA 1TLLA 1USVA 4KE9A 5IKMA 2FPGB 1TTPB 4N41A 2P9HA 5FL7A 2VZ9A 4EGQA 2RBKA 2QD1A 4QYXA 1E2EA 2QU8A 3CEJA 1IEQA 1F1BA 5DW3A 5FFNA 1P4MA 4B5KA 1Z34A 3DDWA 1KS2A 5J2TB 4P2NA 1B73A 2ZRGA 1ZM4A 4J16A 5CH5A 2FR8C 2P6PA 4R1SA 3PZBA 4MQEA 5FIUA 2NXCA 1E7YA 3GRRA 4KMRA 1SUWA 3FKSD 3ZWQA 4C0LA 1Y4DE 2P78A 1CUJA 5BR1A 2BKVA 3QMWA 3IHWA 1PTJC 2ORED 1SXJD 1TLTA 3OZAA 4JDUA 1B7GO 5LQDA 2I9KA 3IPYA 4AJOA 3MHTA 1N0HA 4MQ6A 3KQTA 1RAAA 4KFUA 1D0IA 1RTTA 2G07A 5DMHA 1HFJA 2XA1A 1R7RA 3X1JA 3QWIA 4LNHA 3DV0A 3NZEA 1JB1A 1W4RA 1N0UA 1GZVA 1U98A 5A0TA 4TKUA 2A0XA 4MRMB 4NYMR 3ZIUA 5ERXA 4F8YA 2R1ZA 3ORQA 3VAYA 1PO7A 1QCCA 3LLCA 3Q41A 1SN7A 4WEQA 2P0AA 1IB0A 1FMCA 2AUNA 2ZXIA 2W6NA 2QZ9A 3H18A 4TT3D 2Q7DA 3RVPA 4BS9A 2BFFB 5BNFA 4BFLA 4F92B 1JHAA 2C5FA 3S40A 3KXDA 5LP6B 3T99A 3NUGA 1ISGA 4TUYA 5H0IA 3ZE6A 4B3JA 4EKGA 5TMPA 4X71A 3CJRA 3F6EX 2Q1TA 4JBXA 1YJQA 4MPTA 4PAWA 3SMVA 3JZFA 4YJ2A 1Q3KA 2A1TS 4QUGA 3GGPA 1UJ6A 4S35A 5HXBA 1KC8D 3B6MA 4W8GA 5ICCA 1Q82D 1NVUQ 2AG6A 1GPAA 4KQWA 4WLOA 1BOOA 4G1MB 5KTYA 1DJQA 3ENZA 5DFAA 3KKZA 4OV6B 3PDJA 3D7SA 4DV0B 4R71A 3GQBA 4PLFA 1KAMA 1ONPA 2VVTA 4URYR 4CDGA 3HDTA 2GTPA 3K9LA 4TYMA 4YJFA 2C5BA 2M6RA 3WYAA 1UBOS 1T3HA 2Q7OE 3VBEA 1X19A 5E8JA 2A9PA 3OU6A 4EKNB 4GICA 1NSFA 1OWOA 2GAJA 3GMDA 3GUVA 4RMIA 4L2IB 1EFAA 1Z6AA 5BVHB 2CFOA 4MEJA 1VHQA 3C4JA 1I3KA 4HIZA 1X3LA 4HL6A 1DC7A 2V3CC 3CG4A 4CR7A 3GLTA 1G18A 3GEGA 4CMJA 4B43A 2I99A 3P8ZA 3CLSC 4XH9B 1YQGA 4ZCPA 1RHRA 3QFHA 4RVCA 4WH0A 3UK2A 1RWOA 2HQBA 2AE2A 1L9KA 1E2KA 4IIJA 1AUVA 1A2OA 1VLZA 3MERA 2O7RA 3BCDA 3SQOA 5AVXA 4DR1B 1NE7A 1TD9A 2YNMD 4GLOA 1E62A 3IDFA 5BYKA 3RREA 2ZSBA 3E81A 5G40A 3USZA 3KKQA 1O77A 2GZHA 9ABPA 5CCBA 1JEYA 2ZZNA 2OTCA 2JFBA 1XNHA 1Q0PA 4JLBA 4S1PA 4QOGA 4YMSA 3E22A 1C14A 4C3OB 1Z8HA 4OU4A 4TVBA 2VJNA 1OLOA 5AKJA 3D9QX 4IDEA 1OTHA 3TQCA 3TSWA 3KZNA 4DK0A 5ELLA 5KTKA 1QP7A 1AUPA 2O23A 3FFWA 1SCJA 4WOPA 4CKEA 1VQ5B 5HF9A 1RRGA 4G1VA 3CUVA 1CR4A 3GAAA 3KWJA 3EA4A 1K5HA 4Z3DA 4B48A 5ECDA 3EWSA 3W6NA 2EKDA 1H4SA 1AQ6A 3HEAA 3O90A 2G8NA 2VA9A 4C4PA 2HZ7A 2VDMB 2XDWA 4LSMA 5CTJA 3ERCA 2Y1LA 2FSIA 4XEHA 1LU9A 1DWQA 4IILA 5DT2A 3PEEA 1AXRA 5SYNA 4NDAA 3EG5A 1ECBA 4MKIA 3RVQA 1YIJB 3LQ1A 2PH3A 1ZGBA 1X74A 1MLDA 3DMFA 3LLUA 5EJFA 3UF0A 2Q5FA 1GTL1 2R1TB 8ABPA 1IK6A 3M5WA 1LPSA 3TXXA 3WZ2A 3GLFB 3UXYA 1IHOA 1SA0A 1QO0A 2PMFA 2QX8A 2VP0A 3DAOA 3DFUA 4QSHA 9LDBA 1SIOA 1XLTA 1KY2A 2D2XA 2HNBA 3EVAA 4JKIA 4D92A 4NXMB 1YU6A 4UHEA 1MHTA 4R3NA 2GF0A 3R3WA 4EHKA 4REQB 1JLHA 1N5LA 4MTCA 1JZQA 2XUGA 3IDOA 5JBIA 2DR2A 1ZCZA 4RSGA 3U3DA 2H1VA 2EFGA 1LS1A 1NMZA 3JQ9A 3KVRA 3OLCX 3PDIB 3Q8XB 1T3SA 4R2WA 4RKQA 3V7WA 3OT1A 4TL6A 4DLWA 5AM3A 5BYAA 5JXHA 5LQRA 1QRAA 1QHHA 4ZO9A 1WDTA 1Z6ZA 3PGVA 2QUIA 4GMKA 1Z74A 2BFWA 4NMWA 1XPJA 3I09A 2C8JA 3BA6A 4GGMX 3OO1A 1YDWA 4LS3A 1WQ4A 4FT2A 4JJEA 4NVRA 2Y71A 4URUR 3OM9A 3D26A 1J8VA 3X0DA 2NTNA 4MKFA 5BVGA 1P6XA 4GXQA 2CF5A 3CCQB 4TXJA 4M8KA 2ZYRA 1ODSA 3QPWA 3WFZA 5H5JA 2W2QA 4Z1MD 1EDZA 2E4VA 4IXWA 3G88A 1AS0A 1HQYE 3KWMA 1EGMB 5AKIA 4EO9A 4P2GA 4WJZA 4C43A 1T29A 1N36B 3O38A 1AKNA 4EFLA 2JCXA 2ZR8A 1LNQA 4LF9B 4QG7A 1ZN7A 2BY4A 3IO3A 2H7VA 4IWXA 1AGRA 1TTQB 2QN8A 2ZROA 5CITA 1ZLXA 4MH0R 1RI1A 1ZITA 1FFXA 3TZQA 2O9JA 4ZEVA 1JWAB 3MTQA 1TMKA 4HNRA 2ENWA 4X45A 2EATA 4LCBA 4KQMA 2O8DA 4M1WA 4JY7A 1K5PA 4TKZA 3DE1X 1OASA 3N6XA 3AILA 2YJGA 2V7PA 4DNRB 3WAKA 5EXDA 5TF4A 3PGKA 3SFTA 4UEQA 3Q2IA 4JITA 1W36C 1Q0HA 4YRCA 1R4ZA 4RF5A 3GRCA 2AJTA 2J5KA 2PAFA 1YC5A 4P34A 3ESRA 1RVV1 5DM2A 3ED5A 5HRAA 2P2YA 3DOEA 2X2PA 5FFFA 3UKDA 1QZ3A 3ETHA 3G2MA 3CCSB 3R9WA 4IUYA 1S2GA 1XKTA 3GFSA 5ADWA 2REQA 1DIRA 3TGPA 3KLNA 3KYJB 5C31A 4ZYUA 3OP1A 2ZT7A 3AIIA 2D4AA 3GFBA 4DIOA 4MS4A 1KYWA 1EQ2A 4UXJA 5EESA 1Z3CA 4UQLA 3KQQA 3DBLB 4PFJA 2FW9A 1NP6A 1O6ZA 1NNLA 2CNDA 2ZPAA 4YGXB 3ZHZA 3TBKA 3WIUA 3VO2A 3ONEA 1U3GA 1XHEA 4MLPA 5JH7B 2C00A 5LXTB 4UULA 2PUBA 3KSRA 1PJ3A 3RADC 1JVBA 3TF5A 3DMTA 1OOEA 2WF9A 3RRYA 5HILA 2VBTA 1KIAA 1QYXA 1T4DA 2XW6A 2HW8A 3H86A 1B1CA 4M8IA 5I7OA 5C8VA 4PC6A 3K0FA 3T3DA 3CC8A 5LKRA 1U1FA 3P7MA 2ZWVA 4EX6A 3GUYA 1WPCA 3GEMA 3MMXA 3YASA 3F4KA 4UUMA 4DDKA 2M98A 2XZDA 4B6RA 4RPGA 6CHYA 2ATEA 2XNCA 2Q5OA 3A6FA 3VSEA 4LBYA 4FFDA 5JJLA 8ADHA 2XDQB 3DONA 3EPRA 3DO6A 4LWZA 5CXXA 1P2TA 1T10A 5AK0A 5SZIA 1T15A 3JR7A 1JP7A 4L7VA 4M9UA 4ZTBA 1CUCA 4QBKA 5DCWA 3KVOA 2WNIA 1G8MA 3LQ6A 3Q5EA 2AOUA 3NP7A 1BQ4A 4JJKA 4M89A 3COYA 5GONF 4N7BA 4X90A 1HQCA 3KEFA 4YDRA 4AZSA 1Y9ZA 2QX4A 2X9NA 3W8DA 4B6OA 4XB1A 5FI0B 4RGBA 3BCFA 4K2AA 5EXXA 1ZRSA 3DAYA 3L4EA 4C6TB 2QRVA 3UICA 3T7KA 3GRYA 4GG1A 4IEEA 2CYCA 4RGVA 2C4VA 3GRPA 1FK8A 3JAMA 1Z63A 4R3WA 4A8PA 3V46A 4RULA 1XU7A 1UBFA 4HX2A 3A1NA 3FGNA 4Q1EA 3PPWA 3M2PA 4JMLA 4PPGA 3U9LA 4ANFA 3CESA 1EAYA 2GZDA 2WNHA 3T3IA 5HHTA 2XTZA 1QWOA 2PK3A 2PYDA 3GJ6A 2I6SA 4FNGA 2P4EA 3TD2A 3IE2A 3D0QA 1E1QD 4XSGA 5JC1A 1M6NA 4BMZA 2XZLA 1W9MA 2QTFA 1QR2A 3PSHA 2RD2A 5DHUA 1FS4A 3KPYA 1T9DA 4S24A 4NBLA 1O6BA 4AUEA 1GYQA 2Y2UA 1F3LA 4IDAA 5HMLA 1RHUA 3Q7TA 5HS4A 3QG1A 3HYNA 5ARCA 3L8CA 5LZ4A 2BEWA 2ZCJA 3IUPA 2X4IA 2OV8A 2QL6A 2FP3A 4O33A 1PSZA 3ER6A 2CDAA 2WWGA 4DK1A 2CWDA 4QEDA 4I5DA 1EK2A 1HLPA 2B2XA 1VQMB 2IYRA 2JAQA 4UNQA 2HMTA 3IPXA 5LR6A 2VEOA 1FE8A 1QGOA 1T35A 2JFZA 3QX8A 4MKXA 5JDCC 2SNIE 2I6FA 3NHZA 4RMHA 4RDJA 1ONBA 1UDRA 1XHLA 4AAYA 5KNBD 1BXRA 3HSSA 3SYKA 2E55A 3RS8A 5AI5A 4C01A 2W6JA 4C29A 2PUAA 1OI7A 2K4MA 3BFKA 5TMEA 4DG5A 4M0KA 3K1JA 2PRZA 4F2PA 3B53X 4BNZA 1IXSB 2LCQA 2XE7A 2X5NA 4HYEA 1Q14A 1M6VA 1W0KD 3NOVA 2OYNA 1T0IA 2VRCA 3CX6A 4DNFA 2C58A 3WQQA 1YS2X 3L46A 4YCDA 1O89A 2JGMA 4F6LA 4RESA 1IATA 4ZZ1A 4MA5A 3W6PA 1NY6A 2D7DA 5F9FA 3QOXA 4U00A 3FDZA 4M1MA 2WWIA 2WC1A 2II6A 3ID6C 2FXVA 1HE8B 4IJKA 2ZJ8A 3C1OA 3WJ2A 1ZR2A 1L4EA 1LDGA 5J35A 1Q0UA 1V2HE 2G9NA 4OQZA 3ETDA 3WLFA 4BKRA 1WS6A 3SXJA 1UKCA 3VYSB 1VQPB 1SXJE 4RXTA 3QITA 3V32A 2GX6A 3IBFA 1NJ5A 1PNVA 3BE4A 4QJ4A 3D5EA 3WO1A 2DLNA 2DKFA 2GBCA 4OGKA 3SKVA 1Y7LA 3CC7B 2XUDA 3IP8A 4D02A 2YY7A 1CTQA 3V1UA 4D4IA 1XRNA 2QY6A 1BJKA 3OH8A 6GPBA 1PNOA 1SVNA 1W5FA 2HIAA 1TKBA 4WN9A 1XRQA 2QTWB 1RMTA 2R7NA 4J1TC 4PYMA 3DMDA 3UAZA 3G9ZA 4GOJA 4JENA 1FQJA 3UHJA 3WYFA 3FD8A 5L3SA 1VQ6B 4R81A 3UANA 2BBWA 2P9GA 4I1YA 1TQ6A 5DGIA 2QTHA 5H7XA 1EUYA 1TE2A 4Q21A 3GJ7A 5BV0A 2ODTX 2Q28A 3PD1A 2WD8A 2WU0A 5FV4A 2H63A 5J5CA 4M9XA 1G4HA 4ZCTA 5CM8B 2W83A 4ZOQI 4CI0B 1NVDA 3E4DA 5ITZA 1V5IA 2VRWA 4RAOA 5DNCA 1F6BA 1PJ4A 2VNJA 3V1YA 3ZD6A 1EKXA 3N76A 2GYWA 3NE5B 2HPHA 4IRXA 2OHFA 3BSSA 3NBQA 3F71A 4LMBA 3ON5A 1SO8A 5A6SB 4DDHA 1E5QA 4FUQA 5K3FB 4F5ZA 4JVOA 3IHTA 1J5PA 4BWYA 1R6VA 2WB4A 3OTGA 3VPBA 4GC5A 1BMFA 1TM3E 5ECGC 4HXGA 1UDWA 4JYMA 4AKHA 5SYAA 1R4MB 1K9VF 3IERA 4RHYA 2WWRA 4CLOA 5ITSA 4IW3B 1SC9A 4OJNA 2KWIA 2MSNA 2H9IA 3ZNOA 5JYBA 3V42A 2QNBA 4G36A 4LI0A 4B6FA 5LKAA 4J9UE 9MHTA 1ACJA 2IZZA 1J1IA 4TRNA 2H54A 2YXLA 1V1RB 3ASSA 2PQ6A 1MVNA 2GCGA 2F64A 5EWLA 3EMKA 3IC5A 3KDSE 4YXFA 2FWPA 2O7SA 2QD5A 5LQKA 4H0FA 3B9RA 3KFXA 1LSJA 4UCWA 1DBIA 1SJ9A 1H23A 1FS5A 4ZZ2A 2GN9A 3OZCA 3TRHA 1P9NA 2GCOA 4LOLA 1EFUA 1FVHA 1QGED 1HTBA 4IG9A 3CZPA 1TK3A 1V4NA 4IIVA 1MX5A 2C82A 1XYVA 1EQUA 3KLPX 1M73E 4NOMA 1J33A 4FCTA 1MOQA 1II8A 1NP3A 1SOUA 2JGFA 1CQPA 3GJXC 4EJ0A 1QYIA 1OCEA 2W6QA 2C4HA 3IJ5A 3OCUA 1IUOA 4HMOA 1IM8A 4Y6RA 4EL0A 1L7PA 5J23A 3USES 5T5QA 1PV4A 5KCZA 2FPPA 1AQJA 1U3TA 4OKNA 5EFZA 2HHLA 4UTNA 1GCUA 3S99A 4HQRA 4NZYA 3E7DA 3SNKA 3TMKA 5KJCA 2QG4A 1STOA 2Q3EA 2DMRA 2PZAA 3VKGA 4KPUB 3PUXA 3DHVA 5E2IA 3QYFA 3II6X 5J2TF 5AM2A 1WNFA 3NIBA 3QVXA 2Z95A 4G5YA 3GW8A 2WVGA 4HB2A 3VVBA 1L3BA 2C2KA 2JIQA 2I3BA 1WTCA 2R00A 1RXYA 4UNSA 1L7OA 3JPWA 5A5DA 1QYCA 4ZK6A 1ESMA 1RWMA 2OP0A 2RB5A 2SKCA 4IY1A 3CZ9A 5AO9A 2VNKA 3EFOA 3U4DA 4A2WA 1EVZA 4UUNA 3VOTA 1YX2A 1GA4A 4MGKR 1VF7A 2IC5A 5FUYA 3WKEA 1AA6A 4BB0A 5G0VA 4P80A 5JSZB 1VECA 2R1VB 4YP9A 2ZBRA 3ESAA 3SIRA 2WUVA 4FP9A 3MAAC 5AW6A 3TE6A 1TIPA 3NIWA 3U09A 4X61A 4Q34A 4C3ZA 4GWLA 7MHTA 2X9GA 1QIDA 2DETA 3DWEX 2HRQA 1BOFA 4FNOA 1UMBB 5KSWB 3EPLA 1M7GA 3K0CA 1SUSA 3DFKA 2PKXA 4E7OA 2B8JA 3GXBA 5LP6F 2XCIA 3OHSX 1JAXA 2R7AA 3BHMA 4ND8B 2HMSA 4PSUA 5JWHA 2GH1A 5LZ5A 1QX4A 5FQNA 4IHJA 2HMAA 4BBAA 4A73A 3E1SA 5BMVA 3CT6A 4I1OA 1E6WA 2GPAA 3VKVA 2HWKA 4EY5A 3T7CA 1VHWA 4HAZA 1BJTA 4B4DA 3E9RA 4C04A 4FC6A 4CQMA 3LBFA 1ADBA 2NP7A 3C5WP 4ZVQA 1QP4A 3AEKA 1DDOA 3H19A 3L5KA 3O5AA 4H1HA 1E2FA 5LDGA 1ZXBA 2AGVA 2GRUA 1F2TB 4TRRA 1RWPA 4EY4A 4KLZA 4EW2A 2H4ZA 4ZTZB 2GNOA 2YR0A 2FWAA 4ISCA 5LMNB 4YV2A 2PLWA 1XD2B 2W90A 4ZEXA 4EPRA 2ZJOA 2CUZA 1L9XA 1NV8A 3C6QA 2I8CA 4W5NA 1IPEA 1OBHA 3EIFA 3ZBTA 2RB4A 2QW8A 4HH0A 1A82A 4H4CA 5KDLA 4MLCA 3ZJVA 1NPDA 1WMFA 4HH3C 3EDMA 2EC5A 3SN6A 3WQRA 4Q4CA 4QPDA 5K0JA 5K4GA 4N01A 3NM5A 4WQMA 3A9SA 4FFBA 4G9EA 1YS4A 4RM0A 5ALZA 4M7RA 5KKCA 1SG9A 1EZ4A 3WAGA 4H7HA 1QCDA 4RY0A 5EJ8A 3PHLA 3GPIA 3LI2A 3IJRA 1IMOA 1J0BA 1J4AA 1JSCA 1L4MA 1YE5A 4CW7A 1HA3A 1J1ZA 4ROTA 4UVGA 3ETGA 3JQ8A 4YCBA 1FS6A 5COQA 4OIMA 3SQWA 4DF3A 1WO8A 3U17A 5BSFA 1KEZA 2R8BA 3H6KA 1QQTA 5EMJA 4TLMB 1WXEA 1JBKA 4ARSA 1H3EA 1CUHA 1RT9A 4LOAA 2UZAA 3JQGA 3HFGA 3RVKA 1KGDA 1SWWA 2JD2A 3HSYA 3MJFA 3QIVA 2ZR9A 3I2IA 3BXXA 1Z2AA 2OZPA 1SU6A 2OTJB 2NYAA 4D79A 4EI9A 2V55B 4HSGA 3RVSA 3WG9A 2APJA 1EGAA 3EISA 1P8AA 2YY6A 3IVRA 1XMJA 3KT8A 4IIEA 4BFSA 3EEOA 2HM7A 3ONDA 4IVNA 4XUCA 2ZWPA 1XNGA 3D3WB 2JI7A 1J21A 3D1JA 3L3BA 4JR1A 1LGYA 2ZB8A 3KV3O 3WIEA 3PJGA 3F90A 4X8MA 4LDNA 1GY8A 1Q84A 1JDUA 3AY7A 2ZJBA 5ALGA 3URKA 1MJ5A 4K7JA 4E4TA 4QPCA 1M8JA 4F2GA 4HUTA 1MC4A 5C53B 3K15A 4Z9FA 3UXMA 1AOXA 2JGDB 1BMQA 1VCHA 4GSLA 5DCLA 3I5YA 1QG2A 3VPSA 5BN5A 3IHKA 2ECQA 3KXLA 4F1JA 4UTOA 4FHFA 1RAIA 4EKIA 3IOBA 4U6SA 2QWXA 1VHJA 3V4VB 5LMZA 1CJKC 3EWAA 2VZ8A 4U2CA 5M5BA 5TPWB 4NU6A 4WT7A 4DA8A 1NIPA 1QHYA 1XPRA 4P3PA 2BUCA 5BWNA 4JUBA 2ZAOA 1AKMA 3STYA 1WMAA 1ZK2A 5GZ1A 3K70B 3OW7A 3A06A 3PCRB 1DAGA 3UK0A 3W6ZA 5DX8A 2OKGA 2YUIA 2X5XA 3JWJA 5GP1A 1QJ4A 4OEHA 1DQPA 4K40A 1YHZA 5IVIA 4F6CA 1ACLA 3CVXA 5HM8A 4XSVA 3H5WA 2HT6A 3JQAD 1AKTA 1R5JA 1V6CA 2QUAA 3ZI4A 5HZAA 3KPWA 5K2OA 2JGIA 3U7FB 2JJMA 2C1ZA 4JOCA 1KVSA 5KQSA 1UAAA 2O8FB 4I5EA 5AI6A 1RP1A 2RK6A 3TJMA 4DUYB 1L1EA 1KJNA 2MDTA 2QMUA 3GHHA 3N39C 4B33A 3L2OB 5G1PA 4RE6A 4CTKA 3HNOA 2QNRA 4GFDA 2B8WA 2R25B 3BFJA 3I2HA 3N9IA 2Z1DA 2P2SA 3NRBA 4TZ6A 4YRPA 3TZHA 3BNWA 2Y1CA 4FFWA 1EPUA 3VU1A 2EP7A 1JAZA 2EP5A 4BQQA 3F5SA 2NZVG 2ODPA 3KTAA 1A1SA 4FM9A 4PZLA 2VWHA 4AUNA 5TARA 1FP4B 4ONEA 1ODJA 4D9IA 3T4PA 5LQMA 2DFNA 2F1IA 1SU8A 2JFWA 2I6UA 3OO0A 3TDNA 3WE7A 1SK9A 2P5UA 2B2CA 3DNFA 1GV1A 4KEAA 4NPCA 3T9AA 4EJSC 2A5FA 5AOVA 1Y37A 4QU9A 5DSTA 1QUFA 1Y8AA 3SD7A 2AXEA 2J4FA 2H08A 2NSDA 3C3BA 4MV3A 5AQ1A 3NATA 1P5RA 3IYLW 4OFZA 4ZCIA 2BM9A 1CS0A 4V03A 2MTBA 5HUJA 1I2AA 2FSUA 3LT2A 5DLYA 2G1AA 2G83A 3OE5A 5JAOA 3HO1A 4E5SA 3GLHB 1OW3B 2B3DA 2ZIGA 1C3EA 4FXPA 1Y0RA 3R0ZA 2XVXA 4Y0VA 3LNNA 5D01A 2PBLA 3NDBB 1REQB 2XV1A 2PU5A 4RV9A 1IJBA 3GD7A 1EUCA 1H42A 3UGJA 1DXHA 4CU2A 3K5PA 1PZGA 2Y0DA 1UKVY 4DNXA 3PJRA 1IG0A 1DAOA 1E6MA 2V7BA 4NS4A 1MXHA 2G63A 3IXQA 3TQRA 5KTTA 3GX1A 4WXEA 4H60A 3KZMA 2B99A 2JRCA 3CBQA 1YR1A 3SS9X 3T53B 2ZB4A 5JH7F 5LXTF 3NB0A 1YB5A 1ZOLA 2ARKA 3KKOA 4MDHA 5LWHA 1CHNA 1M34B 4EEKA 5J63A 3QE2A 3D59A 5AKHA 1YWGO 5HSGA 3WNCA 3KQNA 4NPAA 4WW0A 2OHJA 2ZI6A 1I30A 2XJ9A 2P9YA 3K8ZA 3UENA 7ADHA 3KHUA 3JQCA 1ZRMA 3L92A 4KXWA 1Q7TA 3RTAA 3S2SA 1IMJA 1CVIA 2EBFX 2JZCA 3FJOA 1LI7A 1QONA 2HCRA 4M55A 2OFPA 2AQKA 3SSNA 3CUTA 2XUPA 2YS6A 2GKOA 1E3LA 3V5NA 3UXHA 1HSOA 3OX1A 3W1EA 2O3QA 1N7GA 4P84A 3QUSA 4FHDA 5EP3A 5IVHA 4YAOA 2ZL5A 3QNUA 4N8EA 2JFQA 2X6RA 3FPLA 4QIHA 3GQVA 1IBKB 1YUMA 2H4WA 4BVAA 1F17A 1J8FA 1GPDG 2Z6AA 3G2IA 3KFLA 1XSEA 1CQZA 2VAPA 4J8PA 3E7FA 1CUSA 3CV3A 1LX7A 3L01A 3RVMA 2JBAB 1BGVA 2O3UA 1C3OB 4DMHA 3PUZA 3W5UA 1ZLYA 1EK6A 2BMJA 3GNSA 1EP2B 1Q1QA 4K86A 3CLRC 2FFQA 3QUTA 3LP6A 1L3CA 4ND5A 4MGHA 1UDBA 1K27A 4XFKA 5DTEA 1QQ7A 4N49A 1Z16A 2ODEA 3BCUA 3MPUA 4AZVA 4Y9TA 3UKOA 2G1UA 3IODA 2P6NA 5AUOB 2I34A 4YCCA 2YQ4A 4MHTA 2I2FA 4XMYA 3AYZB 2P68A 2JCGA 4M21A 1T1GA 5DEOA 2IYYA 1EP1B 3F6SA 2BSQA 4CG3A 2C7OA 1JMVA 2FN3A 5CYGA 3Q85A 4OL0A 4Q9NA 1DGQA 1HC7A 5CNMA 3A1TA 3QF4A 1FRNA 2DFLA 1V8ZA 3KQUA 1Q9SA 4I1IA 4M6WA 1QFSA 2IYTA 2X0JA 3WLAA 4P32A 3RGGA 3U16A 1FVFA 3KOOA 4KDRA 3FKSA 4M88A 1EK1A 1WHSA 2QXYA 4IDNA 3S1AB 1UJ5A 2G4LA 3I2JA 4J0FA 1SXJA 2AFIB 3I30X 3RS9A 4AWAA 2BFDB 3W2GA 1TOAA 4H7IA 2GKGA 1NQXA 4Q12A 2EOAA 3BD6A 1IPHA 1P0PA 2ZATA 3I1YA 5HQJA 3I9NA 4KZKA 3JQEA 3PK0A 4E2FA 4HS4A 1VLLA 3OOHA 1VKRA 4INPA 2CW5A 2P62A 5B1IA 3UHFA 4XEUA 3UPDA 4FFLA 1JXMA 2WM9B 3DDHA 1JU9A 2C2XA 2PJZA 3NTQA 4Z4IA 1YQ9A 1R0XA 3E0QA 5I4KA 3JALA 1SCIA 1DC6A 4OP3A 4PRKA 1HTTA 3LPCA 2WP0A 1ORRA 3NJ8A 4ZGBA 3KBOA 4E6EA 2IYOA 1XROA 1S0UA 2FY8A 3RK0A 8ATCA 1SULA 1YFJA 5KNDD 1LRKA 1G8GA 3AF3A 3EPKA 1W36D 4XASA 1E69A 1I2ZA 1JDPA 3ZWYA 4ODIA 3PXUA 1Z6PA 5J4LA 1JJIA 2Q2OA 2DCUA 1F12A 3MLAA 3MMNA 4RJJA 4XGKA