1T6YA

Crystal structure of adp, amp, and fmn bound tm379
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
287
structure length
268
Chain Sequence
b'VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
molecule tags Signaling protein,transferase
total genus 68
structure length 268
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6yA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6yA01
2O5RA 4HJXA 4MQ6A 4ARCA 1G8FA 1U0BB 1WOYA 4R2LA 4MUNA 1QJCA 1O95C 4EG1A 2CT8A 3PNVA 1H3EA 1O95D 1GN8A 3CLUC 3VRHA 3COYA 5JBNA 3CLUD 3FOCA 3IVGA 4G5YA 2QJOA 4NZPA 5J58A 4MUIA 1N2OA 1NUTA 2YWCA 3PNBA 2VBSA 2DETA 3ZUGA 3D6VA 1WXGA 1VBMA 1K92A 3COWA 3FETA 3IMEA 4MW5A 2QTRA 1KAQA 1M83A 1J1UA 2H2AA 5DK4A 1ZJWA 3RHSA 3AL0C 1I6MA 2PZ8A 3Q12A 1XNHA 3CLRD 2A7XA 1JZQA 3FY4A 1J21A 4KPUB 3P0JA 2WQ7A 1O6BA 4U7JA 1DNPA 3KT8A 3A4IA 3GMIA 2BTEA 4NAHA 2CYBA 4DDHA 4MUKA 1MRZA 1PFYA 1WQ4A 3G59A 4MLPA 1A8HA 4JXXA 3KT3A 3H97A 1MJHA 1SURA 3NBAA 2BYTA 2X1LA 1NZJA 3C8ZA 3FHJA 4OUDA 2V0CA 1HYBA 1WQ3A 3UC5A 1O97D 2OQ2A 4ZT3A 1IRXA 4JZYA 2QUIA 3FNRA 1I6KA 3FIUA 1T6XA 3IUEA 2VTBA 1H1TA 1U7XA 2TS1A 5TRDA 1ZUNA 2WB2A 5HG0A 1YI8A 2YY5A 3LE8A 5K0TA 3U1VA 3H99A 1U3CA 1TYCA 3X1JA 5K0SA 1N05A 4K03A 3JXEA 5EKDA 4X0EA 4RPIA 3IMCA 3TZLA 3SZ3A 3P0HA 1MBZA 1B6TA 1GAXA 1WKBA 1Q9SA 2ZUEA 2PFSA 4MW7A 1O96B 2QUHA 2NZ2A 2VBVA 2YWBA 3G6KA 1WJGA 3VGJA 4DE5A 1G59A 4ZCSA 2AKEA 4ND6A 2Z3VA 1KQOA 3LCJA 2R5WA 2D13A 1CT9A 1M8JA 2CYAA 2EL7A 2E21A 4MW0A 3OP1A 3DO8A 1OWMA 4H3SA 1O0BA 3Q10A 1GLNA 3KT0A 1JHDA 3ND5A 4R2MA 1PFUA 4NATA 3AG6A 1KH1A 1KQPA 4GRIA 1QTQA 2I1LA 4MWEA 5DEOA 1ZH6A 3MMXA 4Q16A 3PNYA 3INNA 4L2IA 2Z08A 4G6ZA 1RQGA 3NV7A 3N05A 1IHOA 4YP6A 3ZXIA 1G8GA 1EFPA 4ND7A 5TGTA 4ZT2A 1QRSA 1NYLA 4EG7A 1TYDE 3GUZA 4ZCQA 2NSYA 2AZXA 2DUMA 4WSOA 1N08A 2GM3A 1K4MA 1K97A 2HMAA 2QJTA 1EUQA 1H3FA 1P7PA 4MUHA 1I2DA 1NURA 1U7DA 3K32A 4YP5A 1FFYA 4WNYA 1PFVA 1M1ZA 3KFLA 2WQ6A 1N2HA 2CUZA 4XFJA 3ND7A 4PBTA 2XRYA 4MW2A 4ZCPA 4ZCTA 4PBSA 1JEDA 3FH0A 3CVUA 1OWNA 4ZT5A 3VU8A 2OV4A 3P52A 3IUBA 4CQNA 2J08A 2A86A 1NUSA 2JANA 4HPWA 3ISJA 3CLRC 1I6LA 2ZP1A 4MVXA 2J5BA 1KAMA 3DV2A 5AHWA 3RJZA 5A88A 2JA2A 2V0GA 1NUPA 3ZJTA 4GU5A 3HFJA 1TFUA 3RFFA 1R6TA 4DDMA 4AS1A 3CTAA 1YULA 4MW4A 3UMVA 4OUDB 4EG3A 5LFAA 2DPLA 4F3RA 2AG6A 3BL5A 1MOPA 1OWLA 1VL2A 3SYTA 4MVCA 4Q93A 3D6UA 2VTBB 2HZ7A 1MAUA 3TZEA 3ZGZA 1OBCA 2CYCA 1NI5A 1NUUA 1OD6A 3AIIA 3IOBA 2X1MA 3ELBA 1O97C 2GKSA 4DNXA 2QUKA 3HMQA 1F7VA 1X8XA 3MUEA 4NAUA 2CV2A 4EG5A 1T6ZA 1J20A 4I6JA 3MLBA 3P0IA 1JECA 3IVXA 3SDBA 4ZT4A 4XFDA 4K0RA 2P3MA 4MUFA 1N3LA 4KPUA 3DLAA 1QU3A 3BNWA 1NB0A 4J75A 3SEQA 1N06A 2RD2A 1YUMA 4AQ7A 5TEWA 1Q11A 1JMVA 1Q19A 4MW1A 4KR9A 1QRTA 3FDXA 1YIAA 2IJGX 4JFAA 2VBTA 4QBTA 3SZGA 1T6YA 3PRHA 1QNFA 1H3NA 4MW9A 2CV1A 1N2BA 5BNZA 3NBKA 1O5TA 4EG6A 4MWCA 1KR2A 5J59A 3TQOA 1EFVB 5KHAA 2IELA 5IJXA 1KH2A 1EE1A 1G8HA 1K4KA 3SEZA 1N07A 1EUYA 2QTMA 4KR6A 1LI5A 3CA8A 2A1TR 1TYAE 4G5FA 1QRUA 1MC1A 1T9GS 1D2RA 1JIKA 3ZXSA 3DPIA 1V8FA 3IODA 4PBRA 1N2JA 4XSVA 2XRZA 3MLAA 2PZAA 4L2IB 4DDKA 2B7LA 3LOQA 1MB9A 3FWKA 2Z09A 1XNGA 1IQUA 2A88A 2QUJA 2C5SA 4YBRA 2VXOA 1O96A 1UFVA 2E89A 5A89A 2PG3A 1EFPB 2G36A 3HGMA 2A1UA 1COZA 5FO0A 1TQ8A 4EFKA 2X3FA 4UZFA 4NX2A 1LI7A 3CLSD 1N75A 2J07A 2YXNA 1NB9A 1PG0A 1JILA 5H16A 1WZ2A 3AG5A 3QTTA 3F3MA 3SP1A 2X0KA 3N9IA 1EJ2A 3TS1A 4MW6A 5A8AA 1PFWA 4J76A 1JIIA 1IQ0A 1LW7A 1F4LA 1MAWA 1XJQA 4PY2A 1M8GA 1F7UA 1O94D 1TYBE 2IP1A 4MULA 4NDAA 1GPMA 3FG9A 3Q4GA 2OYNA 3L93A 1WXIA 3TNJA 4UZEA 1GTRA 4R0NA 4ZT6A 2DERA 3COVA 3AFHA 1V47A 2D5BA 1M8PA 3HV0A 3QTBA 1X6VA 4YP7A 2DLCX 2PIDA 5H7XA 2GOYA 1QU2A 3H05A 4EG8A 1Y42X 5FNZA 4EF6A 1ILEA 1IVSA 3IOCA 1NSYA 2J4DA 4MUEA 5DB4A 4CDNA 3CVVA 2CV0A 1JIJA 1TEZA 4U63A 1N2EA 3COZA 3CLTC 5KCMA 5F23A 3CLTD 4MWDA 2J09A 2A84A 3UOWA 5IHXA 1N78A 1F9AA 1J70A 1MB2A 1NP7A 5LLTA 1GZUA 3TQIA 2CFOA 1WXEA 1VBNA 2H29A 3FI0A 4EG4A 3UY4A 1IFXA 3I05A 4DJAA 3KT6A 4A91A 3A2KA 5TEVA 4BWVA 1JEEA 5HUHA 1KORA 4KR7A 1S4MA 3PXUA 4QREA 5J5AA 1WY5A 1R6UA 3ND6A 3H9BA 1U3DA 1J1ZA 1NUQA 3MXTA 4KKVA 3M5WA 2EJCA 4MVYA 1KP3A 3N2YA 3K9WA 3OTWA 3A05A 2PXHA 2DR2A 4HJRA 3RBAA 2DXIA 2RE8A 1VBKA 4MUJA 4E1AA 3IMGA 3RK0A 1KQNA 1N2GA 1KKUA 1WXHA 1OWPA 3E27A 5HUJA 1ZH0A 4OJMX 1P4MA 1OWOA 4MWBA 5DASA 2HGZA 3CR8A 2E0IA 4I6EA 2DEUA 3ZJUA 5FO1A 4ZT7A 1YIDA 4EGAA 1Q15A 1KH3A 4S1OA 1WXFA 1N2IA 1N77A 5LM3A 4JYZA 2JAXA 2QJFA 4MUGA 4DLPA 4U8HA 3CVWA 3UK2A 2ZUFA 3HZRA 4MAFA 3X1KA 2CSXA 3AKZA 1R6XA 1JZSA 1YUNA 1O0CA 1T9GR 1EXDA 2E18A 1IQRA 2A1UB 3S3TA 4RUKA 3CVXA 1OBHA 1ULHA 3HL4A 4MVWA 1VLHA 5TS2A 1GTSA 2VBUA 4F4HA 4QRDA 3IDFA 1FYDA 2A1TS 3ILVA 3CLSC 3IOEA 4FZJA 4CDMA 1EFVA 2QTNA 1BS2A 3CVYA 4JXZA 2A4MA 3IVCA 3H9CA 1IH8A 4TS1A 4P2BA 1M8KA 3X1MA 4CT0A 1KP2A 5KWVA 1JGTA 2D54A 3A04A 3IH5A 1XNJA 1O94C 3G5AA 1N1DA 1QQTA 4I6GA 2PZBA 4YMIA 4ARIA 3N8HA 2WSIA 3QE4A 1J09A 4ZCRA 3L92A 3RK1A 1PG2A 3ZIUA 4HK4A 2O8VA 3ZJVA 1Q77A 1M8FA 3GLVA
chains in the Genus database with same CATH superfamily
3KP1A 1EX1A 1I14A 1KJWA 1OUMA 1B8PA 3DBRA 3OPYA 1TT5A 2OP0A 2XUJA 3ZHCA 1REQA 2G1AA 5D51S 1XA3A 4MARA 2GWHA 5T3UA 1UT6A 4QU5A 2NXJA 4XYGA 4EHJA 1A4UA 3FUUA 4XQ9A 2KB0A 5JBNA 3GSIA 3DDZX 3LZ6A 3QWIA 4RESA 5FAXA 1E3ZA 4DCOA 3BERA 1Y82A 4KBYA 7REQA 2PUCA 5INTA 2GN4A 4UEJA 2OXIA 5J4HA 2MT9A 2PMKA 3D4BA 3BWVA 1E1RA 3KETA 1FJXA 3BDVA 4JQOA 2HDNB 5K8IA 3N74A 1CUEA 3R6TA 4AP9A 1R00A 4UFOA 3GAMA 1XXHB 4YMWA 1G6KA 2Z2IA 1VQKB 5E8JA 3TFQA 2FZKA 4U2BA 1XYYA 1M83A 1P6XA 2GCPA 4P35A 4ALMA 3L1KA 3C74A 2YXDA 5U1PA 1WCWA 2G09A 5F78A 1Z6YA 4MCHA 4PS1A 4WOKA 5GADl 2A7XA 3GJ5A 1BWRA 5DBEX 2D0DA 3WHIA 1F8FA 3HAGA 1THTA 2AXNA 3LSYA 3WOHA 1TU3A 2XNDA 3FUWA 1KI8A 2G9RA 1DUVG 3I1JA 1G6OA 5DN9A 4EVQA 4ISCA 1DZIA 2O07A 3MWGA 4ZYXA 1Y3BE 2ZRNA 3G0DA 4HAOA 4UOQA 3UMFA 1KO8A 3MWLA 3AGPA 1OLUB 3AJ8A 3PF8A 4X00A 1PZMA 3SKXA 1Y8RB 1R5OA 1NGSA 3HU5A 3VV3A 4AS3A 1I7NA 3THWB 3WAKA 4IEFB 2Z3WA 1MKYA 1L5VA 2NX2A 3QY0A 4P4GA 2XUQA 4MI1A 1NC3A 1KO5A 1MQ9A 2C2WA 1KZ6A 3F4BA 1O97D 3G2NA 2NAFA 4QYIA 3EAQA 5IBCA 5C46F 4P26A 4EY5A 1ORWA 5TY0A 3AB3A 3OCXA 5EIHA 1SR8A 2N1MA 2XA9A 4K9RA 2PBRA 5JQGB 1M9NA 2AEEA 3VZQA 3DE7X 2IH2A 4JSTA 1H5NA 1TUBA 1ZCJA 5AVUA 1QANA 2FRXA 2W2TA 5JXHA 4B0OA 2ATXA 1CJCA 4X71A 4Y2SA 2QD4A 4JUBA 1IUOA 1GYPA 2P4EA 1UBRS 4RMJA 4X07A 2IU4A 2IW1A 3CSDA 4DLUA 4QOGA 3ZWCA 4AUKA 1TYCA 3SHVA 2E2WA 4MHOA 3JXEA 4EKNB 2DFNA 4NMLA 4PE5B 4UXIA 1TL7C 3LSTA 4LDZA 4C88A 1Y9ZA 2YYZA 4MGKR 3OLCX 3WIEA 5JECA 1MBZA 1R9MA 2CXOA 2NO6A 2Q6TA 3OF2A 1GAXA 4MXDA 1NVBA 1NWCA 3SS8A 1X80B 2JFYA 4OQLA 5EFOA 1XV5A 3IFSA 4MW7A 2QX9A 2UU9B 2NIPA 4B3CA 1WL8A 4ZU3A 2J3EA 2VHEA 5P8WA 1Q95A 4QQFA 1KNQA 4DE5A 3KSZO 1BHSA 1ZHOA 2IS1A 2H1SA 2L2QA 1PJLA 3FCEA 2GI4A 3NT5A 2C5HA 2I6XA 4NL4H 2N42A 1QHIA 1QQ6A 2JFBA 5AW2A 2QT1A 3PRKE 3CCSB 2SCUA 2Y6VA 1M5RA 3PXDA 1NW7A 5DHRA 3WLFA 4YMGA 5BT8A 1II8B 1R8QA 3LY8A 2VK2A 4LQCA 5JTUA 3OPVA 1K4YA 2Q3BA 3ETGA 3ILHA 3CX7A 1EVYA 1J8FA 4PZEA 4M8IA 2I71A 1ZQ9A 2C2GA 1SMKA 2JGDB 3VU3A 1DJQA 2HJGA 1KH1A 5B3JC 3ZW9A 5L6MB 5ED4A 4XJXA 3W77A 3CFYA 4WA8A 5KHLB 1GRCA 4LMRA 2B6HA 1NOJA 2JH3A 3H8VA 4M1EA 2F1LA 1GLGA 1K9VF 1QVGB 1T8WA 1Y7HA 2ASVA 2HNBA 3K4HA 4OPMA 1BKSB 1HE8B 2BM9A 4RD0A 4I2NA 2C83A 3GAFA 4R0VA 4J3JA 3OM1A 1P61B 1VG1A 4CKEB 2HQSA 5IF3A 1BRTA 1VIYA 3GLGA 1HDXA 4PRZA 3K8YA 4LZPA 3QG5A 4AMUA 2HNAA 4K6MA 2AOTA 1LQTA 1HFJA 1ZIXA 4MVJE 5IAAA 2ZJOA 3CNOA 3R7LA 3G8YA 2Q0QA 3R5XA 4GOXA 2PUAA 6AT1A 1FTQA 5BMVA 4JT2A 1RAAA 4LY9A 3U0BA 4WKBA 1HE2A 3HSSA 4JDPA 4OFBA 1LLUA 3OE5A 3HZZA 3RFCA 3TYXA 1NR1A 1NURA 3B6KA 4WUVA 1GWNA 4D43A 4I36A 1XFAA 2IYAA 3BWDD 4RABA 1PFVA 1U0SY 1KIAA 5B6PA 2MSCB 1L5YA 4V0KA 2VH5R 3ND7A 3V1NA 4FP9A 4Q1EA 3W90A 1AGXA 1RWBA 1OIXA 1K3UB 4COKA 4QT4A 1FQKA 1LTKA 3CKLA 2GN8A 4XLFA 1YJQA 2EX4A 1DC4A 3JASA 5K0NA 3TRHA 1U2EA 3G0GA 2ETXA 2O7SA 4DMKA 1QE0A 1CIVA 1Z2CA 4Z8XA 3PR1A 2WINI 2I6GA 1ZN2A 1ONNA 3IUBA 4NDNE 1L4GA 3W2IA 4LRTB 5CYPA 4PYKA 4G1FA 4TVKA 1MJFA 4HPWA 4UVEA 2Y0PA 5D87A 2X2OA 4CG2A 1ZN9A 2FI1A 2XUGA 2RHJA 5AM2A 4J49A 4MLDA 5LQCA 2G88A 5EWMB 5SICE 1GKKA 1RHKA 4JVSB 1N7HA 2Q9UA 4G1MB 3HFJA 3M6FA 1JEYB 2ON6A 5DVZA 2AMJA 3OF3A 3TIFA 1TKAA 4DDMA 1WWKA 1CTQA 5C1DA 5IUNC 1FSZA 3EGXA 5E7IA 4C6TB 4YV2A 3JQFA 3V4VB 2RAVA 3R0IA 2CKMA 4FLMA 1V5GA 2Q5OA 1U9IA 3A6HA 4M86A 4DCTA 1J56A 1T91A 1RXSA 2NSHA 3WRWA 4IX9A 3MERA 1E4OA 2Q9CA 2XUHA 3ZZ1A 5CCBA 1FFXA 1XI2A 3DD5A 2CYCA 4IIJB 1WVGA 1W59A 2W2LD 3B7GA 5CH5A 4RQUA 2ARKA 3HMQA 5I9BA 4AG6A 4P6VF 5IYPA 2K7ZA 4IKPA 5JATA 2LTAA 5TS3A 3DE5X 3ETCA 3BKXA 4H6PA 3SLDA 1LSUA 2II6A 2Z8ZA 4KQIA 2WF9A 3RS8A 3JQCA 5C8ZA 4X8LA 3VTAA 2R1UA 4KNWA 3P8ZA 1QHFA 4YUZA 1YB7A 5IWCA 2AX3A 1NASA 5DI9A 4D0GA 3LQ6A 4BAZA 3SYMA 1XZPA 3MMSA 2Z8YA 2B2NA 4CG0A 3KKEA 1EVIA 5TSDA 1JMVA 4Y1RA 4KB5A 3RSSA 3L84A 3TVYA 4RL4A 3IT2A 4CEHB 3ZHXA 4D3XA 1CQWA 4KKSA 2JFPA 2NT3A 1QHHB 3NM6B 3ROTA 3U17A 1U0LA 3UA3A 3BT7A 3F7OA 4KGXA 1DEHA 2LWIA 5JYBA 4ARBA 2YC4C 3NG1A 4MWCA 5A5EA 1KYWA 5JR3A 4D8VA 3N3BC 3QLTA 3A7DA 3RR2A 3NM5A 5HGJA 4Y9UA 1NRIA 3UGJA 3RRXA 4LWPA 4Y6SA 1Z26A 3OIUA 1NXTA 4ND4A 4EFLA 4OHKA 5G40A 1WLYA 1N07A 5TV2A 3GRPA 2XRFA 1EUYA 2QTMA 4EHBA 1I2BA 1OSNA 1XD2A 1TYAE 1Y81A 2WWTA 3WNDA 2WKQA 3B3JA 2OBRA 2HF8A 2QEQA 3G7NA 4JB3A 1D2RA 4YQZA 1VPWA 2YW9A 4ND1A 1IBKB 4Q4JB 4AJ9A 1TJ5A 1YI2B 1KYVA 1X9IA 1H69A 2EFCB 4MITA 2C5SA 2REBA 2VXOA 2NU8B 4ZFNA 1KVTA 4QPPA 1EFPB 4Q05A 4XKWA 2X6WA 4DPKA 3AHCA 3ZDBA 5IAOA 5LSAA 5DNYB 3MTGA 3VYTB 3ZBQA 2ODPA 3P0FA 3WRYC 1QHYA 2Y99A 1E3SA 1WDMA 2ONYA 3F3MA 3C8MA 4DV3B 1VQ8B 5DCYA 2OZKA 4UE3S 1EYZA 1P5HA 2VXCA 2PXCA 3MYYA 3AVUA 1PFWA 2OESA 3HDVA 1TIPA 5EZ5A 3LXUX 3WAJA 1M1YE 4NV0A 2GSDA 1W44A 2BT4A 1IQ0A 1LW7A 4MEBA 1QUFA 1XKQA 1K8RA 1OX4B 2IP1A 2QMEA 1KARA 1KPGA 2WAAA 3L0PA 1W0CA 4QNRA 4E11A 5B37A 2XWQA 2A59A 1V8PA 2WMYA 1BHJA 2CFRA 3HVIA 3CLHA 1X42A 5K0JA 2ZI6A 4HPJB 5B6JA 2IGTA 1C1YA 3HRHA 4RTNA 1KRHA 4EA7A 4OHCA 3G2PA 5KYXB 1FF9A 4KXLA 3AI2A 2HQOA 3W06A 4W5JA 4JLVA 2PX4A 2RI6A 3DXZA 1PFQA 5AXAA 3L7JA 1D4OA 4O63O 4B85A 4N5MA 2VK8A 4NBUA 1E58A 3HB5X 4G5QA 1VQ1A 4YS6A 3UK7A 4IHJF 3H2HA 4GR5A 1N2CA 1S8NA 2IYPA 2P11A 3A9TA 2P9QA 3FYHA 3DMPA 4I4LA 4IOJA 2P4HX 2XAUA 5H4GA 3EPJA 1KI7A 2L19A 1OHHD 2GN2A 4EMTA 4CM9D 2ADOA 4BEVA 3RU7A 4YCMA 1HYQA 1U4OA 1IVSA 4DIKA 4M1TA 1V16A 4IGAA 5IN5A 5GZ6A 3I9V6 5DNEA 3S4YA 1U1EA 4DRZA 4HLCA 4HPXB 4M1YA 4QSMA 3U3MA 3NETA 2AZDA 5C7IO 1ZDMA 2E3JA 3HMKA 1UJ5A 2A84A 4J0FA 4P32A 2LGJA 4LRQA 1JBEA 3AHJA 4JC8A 5K2OA 4MS1A 4MVJD 5CVTA 3LUFA 4JY7A 3ND8A 1CQIA 4KDFA 5BVGB 3PHIA 8AT1A 1GTMA 5DS0A 2Q62A 1EVZA 2Y05A 4AL4A 2G7ZA 4X1IB 3EQ2A 3CNEA 5CURA 1ST3A 1QVWA 1W9XA 3V8VA 5K99A 1JEEA 3FWNA 3N6XA 3HR8A 4FMDF 1UP4A 3KM0A 1W0JD 5CH3A 2F1HA 1S9HA 3KEWA 2X5XA 1M0WA 1UFRA 2V4ZA 3MWEA 4LDRA 4RC9A 5EG5A 3KBBA 3RS9A 2X7JA 2Z1DA 1MC8A 2H06A 3BEDA 1NRXA 3L02A 5DO9A 3H65A 1KO7A 1MOZA 2ID8A 3C7TA 3G8BA 4MGEA 2AG8A 4CQMD 1E8DA 5MFZA 3DZBA 3IAFA 1C9EA 1Z0AA 1YZHA 4PPYA 2ZM6B 2PUEA 1O77A 3KVVA 4QDXA 1KOFA 3LT0A 4F97A 1CJMA 2GYYA 4KXUA 4ZTUB 1YZGA 4FNGA 2G9QA 2ODAA 2Q1UA 3A05A 3AW8A 3G6WA 3LUBA 1FXSA 3C43A 2PXHA 2C92A 2X23A 4OA5A 3S1AB 2HF7A 3VJRA 4DUGD 1TXGA 2Q8NA 4N9WA 2RE8A 1WPXA 3MD9A 2IUYA 5HKBA 2BEJA 3ROEA 4JB2A 2WLSA 1N2GA 3KJNA 4RY2A 1NVVQ 1WXHA 2JCBA 3R9IA 1XA0A 2JVJA 4JT4A 1GQYA 2ZJ8A 2DT5A 3ZY6A 4PR3A 1FRVA 4R2WA 4OP7A 2YHSA 3WIVA 3EPKA 1Z62A 4RD1A 1G0NA 5J40A 1PJ8A 5E6SB 4EGAA 1U9ZA 1QZUA 2FEWB 2VP2A 5JAUA 1ZA1A 1JG4A 5EMHA 3RODA 2J9YB 3FNGA 3IGFA 2IOQA 1SG0A 1O9HA 3VPBA 1RMQA 3QLVC 5G53C 3I8SA 4QM7A 5ALXA 1ZP6A 5KNCD 1K73D 5EMJA 3IEUA 2ZAYA 4GKAA 2I7VA 1BCRA 2ILVA 5EHNA 1M33A 4IZIA 1DJPA 2PBZA 3TVTA 3BFKA 3WGVA 4NG5A 3H4VA 3JYHA 3BGDA 4F4UA 2JD2A 2WT9A 1Q14A 4MGYR 3K2EA 3F47A 1II0A 4X7MA 1J2TA 2E18A 5BYBA 2OCAA 1KEEA 2WUEA 2A1UB 3AJEA 1NQAO 2WHRA 3KZXA 3ZR4B 4EDHA 4N6NA 1G64A 1ZD1A 3AUYA 2UV8A 4MB0A 5KREA 5KWEA 2PYZA 3FOEC 3AM3A 1P2VA 3CC8A 4MVWA 3H75A 3PEEA 1E5XA 3KZMA 1ZLXA 5B2EA 1WUYA 5BSEA 1QFMA 2HXSA 4DW8A 3JATA 3OJFA 1IONA 4G01B 3K5PA 4H7JA 4BLOA 2HHJA 2Q5QA 1XMXA 2XYVA 4IIFA 3TBFA 4IFBA 1HEIA 1NLMA 1S2IA 2XJ4A 2FETA 4G81A 4GZ5A 3W0LB 3X1MA 1AGYA 5EJGA 3VC7A 4JBGA 1IMOA 1D6NA 3HEAA 1QP0A 4OHPA 5DM70 1VQ6B 2H00A 3ITEA 4UOEA 2VRCD 3TMKA 1HL7A 3OZUA 4UU7A 2FE4A 3A1PA 3TPFA 1KMHA 2YC2C 1T8UA 3SVLA 4P0QB 3ZIDA 3PFNA 2AQ8A 4TMXA 1FS5A 3RM3A 3SC6A 5KPDA 4ARIA 1EWVA 3DMNA 2PPVA 1V4VA 3CTPA 2NW6A 3DAOA 1YQGA 1E2LA 2GRJA 4MTCA 1KJJA 3DE2X 3B1KA 4S2EA 4J29A 4URUR 1OHHA 4EVIA 2VNJA 2Y93A 4QTTB 4CM9A 1T5BA 3OU7A 5A5VA 1PUXA 5I8ZA 4ARCA 5DEIA 3TNYA 4U6SA 5KQSA 2NNLD 2Q7DA 3W34A 2VKTA 1U99A 1NV8A 1H0HA 4XUDA 1SCNE 3FDZA 2UYYA 4D74A 1ZKDA 5BNWA 1O8BA 5CK5A 2H3EA 2H1LA 2H54A 3UJHA 2O19A 3EC7A 4K9NA 2ZSKA 1HR0B 4HTFA 1F9EA 1P2FA 4QDJA 3I5MA 2P3LA 3E2MA 1YXMA 4S2UA 4TTAA 2H59A 4BNLA 4MUIA 4NICA 4HNRA 4BFWA 1KETA 1O6GA 1MIOB 4I9FA 5E95A 3IP6A 4X63A 5TMDA 4Z4ZA 5KX5A 2Z58A 4Q37A 1OY1A 2Q5JA 3GDGA 1CUJA 2SKDA 1FL9A 3NDPA 1W0JA 1ISGA 4HEA6 1DUIA 1K92A 4INOA 4OJTA 4YT5A 5FWAA 2ZCJA 5KMGA 2NPIA 1L5ZA 3UW3A 3H2YA 4PFJA 3WQRA 1D2GA 4HQOA 1WO8A 2G5PA 5FL3A 5K0LA 3KSMA 4P7GA 2EGGA 3LA8A 2H2AA 3UHOA 4CQMA 4RGQA 2BBWA 3L7MA 1IULA 3G5UA 2D7JA 3TTWA 2YVAA 2FR0A 2ZZMA 4QYXA 3B52X 5EWJB 3T5GA 4Z7JA 2MOKA 3E15A 4KAXA 3VXKA 2HJWA 5A0VA 2A0WA 3GP8A 7AT1A 4ZRMA 2OGSA 2GEJA 1YZVA 2ZJAA 3B60A 3BY1A 3SZLA 4DUGA 1ESNA 2OBLA 3UHJA 3TO5A 3C6XA 2DKFA 1IEWA 3CZRA 1IYZA 3EVNA 4XSGA 4YALA 3AF0A 1JLLB 4BMXA 1LBTA 1WQ4A 1UIMA 3AM5A 3VOBA 1MJHA 1ESCA 2BONA 4KQFA 4LY6A 4Q0MA 4KFCA 3ABZA 3FCXA 1GEEA 3KVOA 4J90A 5CHEA 4GBED 2QE7A 2HSWA 2DY1A 2HWKA 1UD6A 2JH8A 2O50A 4N3NA 1AKTA 3RGWS 5L45A 4G9BA 3OM0A 4L8GA 1J33A 1WQ3A 2Q6VA 3GAAA 5FI3A 2OQ2A 1S96A 5AN9A 4YV1A 1WCXA 2UYGA 3QEKA 1UAYA 4Y2QA 5ES3A 5DX1A 1SVOA 1YB1A 3FFXA 3H4IA 4OYLA 1NW4A 4P6YA 2ZBPA 2JGNA 1AKNA 3NV9A 4MJ7A 5IVDA 1UBEA 4OQNA 3Q8XB 5EYPA 5HG0A 1T3LA 3RROA 1WVIA 2FUG1 2GUGA 3CNHA 4I55F 4FHEA 4UBNA 5F3WB 2PV0A 3FUVA 1X0XA 4CIBA 3A1EA 4Y1FA 2FDCA 1CU1A 2QU8A 3WMGA 3P94A 1PL7A 1XZNA 3HN7A 2ZYWX 1EFTA 3SIWA 5HFJA 1FDOA 2NGRA 4O4HA 3OD5A 4OI4A 4XUEA 1L4MA 1NJ6A 3A3BA 1NPYA 4AJNA 1EP9A 1CK4A 2EX0A 3UGQA 4OFZA 3MHTA 3KQUA 1MDFA 3KYBA 1WMAA 2VCHA 4WESA 1Y3AA 1N9GB 1NR5A 3ZJ5A 4M99A 3K6KA 3O4IA 4NMWA 4GQAA 5G4KA 1SRRA 5CEJA 1T2UA 2P27A 3QWBA 1S4QA 3KDSE 2NV2B 4IWYA 2PS3A 1NW9B 1UKVY 3UV6A 5K0ZA 1KL7A 4WECA 1NFRA 2Q45A 3GEPA 3JQPA 3OX4A 2C5GA 4QUJA 5M34A 3WHKA 2NZVG 1DRWA 2QUBA 4MH0R 3WWOA 2M1XA 2NQ2C 4G3XA 4BX9A 1DHRA 2VRCA 3HKBB 1QGUA 2BTOA 1KKLA 1C7QA 5IUKC 4LYEA 2GNPA 1DP4A 1T4GA 4ZXFA 1L8XA 2QQFA 4P34A 1FX0A 3W6ZA 5B58C 1P2BA 2QUAA 4ID9A 2P62A 2WYUA 4RQBA 1M2VB 3NEAA 5E0KB 3UF0A 4AMYA 4AI6A 1HKHA 1G21B 1JHZA 1V3TA 2PUVA 4S05A 4LFBB 5ECWA 4DCUA 1DDOA 3KZCA 1WAMA 4Q9NA 4E14A 4GS5A 4CKCA 5TLSA 1Y89A 4XRGA 2NU9B 4K5QA 1BRMA 1YIOA 2HBQA 3VSAA 4CG1A 3DXFA 1GY8A 4PYIA 3N05A 2VEOA 4HAYA 4YI5A 4JC4A 1I33A 2OZPA 2WQZA 1CDZA 2PX2A 3C3KA 4GP9A 4MHSA 3K9LA 1P7ZA 3TZCA 4AJOA 2VBGA 4QUIA 3L4JA 1QFXA 1ZHHA 3ZZMA 1G0OA 3X0DA 1AK9A 1CZLA 4EG7A 1VOTA 1EVJA 1TZBA 1IOLA 2L42A 3GT3A 2GYUA 3TNLA 5CB4F 3DM9B 4RDLA 2A78A 5JNRA 1S2DA 3IBYA 4WSOA 3RLFA 3Q3GE 2Q2OA 4PG7A 5D86A 3TRFA 4BCCA 5EJEA 3K2IA 1JI0A 3IKVA 1HDZA 3V5NA 1E6UA 1SVUA 3ORHA 3WWZA 3NB0A 3WGTA 4OHMA 5HIKA 1P1FA 4JI2B 4PBTA 3UFBA 4POOA 2XRYA 5KC8A 4WZAA 3IBFA 2GBGA 1V3QE 1KFKB 2QYSA 3LX6A 2GAOA 1UPFA 3G13A 2PWPA 4UATA 4RTMA 1Q7EA 3EEYA 1KI1A 3K9HA 1PTJC 4RHTA 3PJGA 4CLOA 3H11B 3IEKA 2P9ZA 3QXCA 5KJEA 3E2IA 4BNXA 3CVUA 1HK7A 2JGFA 3P52A 4V24A 4G8JA 3UWDA 3O8QA 2A86A 4R83A 3DGFC 3EW9A 4U2GA 1GSAA 3TXYA 2V3VA 3KKOA 4U3JB 3ZC3A 1MAVA 4HGNA 4LVNA 4H6WA 1QGZA 1M2NA 1O6ZA 2J0UA 4I46A 3DV2A 2Y68A 5AJZA 2C5LA 4FMCF 4LK3A 4FZ5A 4OLBA 3ZE8A 4HY3A 1LLQA 1JG6A 4N5NA 1TCAA 4AKSA 2PGOA 1N1GA 1C0KA 4IDCA 4YMVA 4MO9A 4Q7MB 1P0PA 2WEKA 3ANMA 4HZGA 1SD1A 3T7EA 1SXJA 2B4KA 2QVGA 4I5IA 2QTHA 4O4LA 3K8QA 1Q1NA 3O2QB 3ZX4A 2BHNA 2WKRA 3OHMA 1E8NA 4DADA 1MMFB 2QKYA 1T3TA 1AQIA 1RJWA 3VUFA 2WT8A 1A2KC 2A2ZA 2XIJA 3HADA 3AV3A 3F8WA 3BXPA 1QVRA 3A8JA 3SX2A 3PEVA 3KB1A 3Q11A 4AQDA 4DHWA 1VTKA 2B5OA 1JNXX 2HGSA 1VYHA 2B37A 4YT2A 3QBTA 1XCJA 2G7MC 3DZIA 4HSEA 2CL7X 4L5AA 3ZU3A 1RBZA 1JA0A 5B4TA 4JI5B 3D6FA 5I7HA 1RJ9A 4HEQA 4UASA 4AAYA 1Y1KE 3N28A 4E46A 4JEUA 4EB3A 4FYMA 2FUCA 4R2JA 3RK4A 4DAOA 2RD2A 1B74A 1YDFA 3P7MA 4WASA 2XUOA 3AVYA 1IJFA 2ZUWA 4IFIA 4WZBE 1JSCA 4QO8A 1EUDB 1WCIA 3O47A 5A4KA 3HKDB 3HP1A 4BGIA 3A9CA 3B20A 3NBKA 1DUSA 4P81A 4Y98A 2DWCA 1M5UA 5CIWA 4YRTA 3O7MA 4ZV9A 3NAZA 5G1OA 4X6XA 3ZE1B 5L9AA 3HI6A 5KUTA 1ZNZA 3CRQA 3EVEA 3G7SA 2I4NA 1SHJA 3M4JA 4KE6A 3GLKA 4ZREA 2DULA 3DHYA 4F5ZA 5IJXA 3G9UA 1VM6A 4B43A 2YS7A 3QOYA 3RWOA 3SEZA 1FMTA 1XVLA 4ACBA 3W8DA 4Y6LA 1BFDA 1BGWA 3EEQA 5B6IA 4V0QA 1EDOA 2VJPA 3BORA 3KWMA 1E3JA 4P2GA 2I91A 2J3JA 3G17A 3ASYA 1RSZA 1YL6A 4RPKA 1GQFA 4CN8A 3QKSA 1NMXA 4MDEA 2OD7A 3KKLA 5KAPA 1D1QA 3GFPA 2A14A 3RWBA 3V42A 5MN6A 1XKLA 1P0CA 4LA4A 3CD6B 2PEYA 4C7BA 1B73A 2W0MA 2C5BA 2DWPA 5EE1A 1CSEE 2GS9A 2XADA 4HQ0A 4UARA 1YOVB 2JHGA 3VPGA 1SVMA 1A5SB 4PO3X 3I04A 3T9CA 3OHPA 4KXVA 4IDHA 2VYQA 4AUMA 1JALA 5IC6A 3HJTA 4F96A 5F2NA 4CEJA 2YVKA 4FKBA 4RCVA 1BYIA 1G5IA 3FNBA 2IZZA 3CBGA 3X2FA 2PX5A 3RC9A 1HFKA 3LYAA 2ZRLA 5FTNA 3QFTA 3L4BC 3BDIA 3A4TA 4OAPA 3B8HA 1CZOA 2A0XA 2H63A 2OBNA 3DVLA 4D2IA 4D81A 2XB8A 1WTAA 3WP1B 1UJ4A 4CG3A 5CB0A 1F6BA 5KOYA 2OWDA 5K6AC 2NZYA 1P17A 2BY4A 3FGNA 4CNBA 3EOAI 1ECCA 2PXAA 1ZM7A 1WXQA 4V0OA 2OCYC 2P0YA 4RKYA 4ZOLA 3WLEA 4WBNA 2JAHA 3TAHA 1JHPA 3A0RB 3E35A 2AUMA 4B31A 3AFHA 3ZY5A 1Z8NA 4AIIA 1YZ3A 3QVKA 1YJ8A 5H8WA 1P80A 4R9RA 3HNRA 2W2QA 1DKQA 1EDZA 4ZVMA 4KQJA 3KD3A 3L40A 4WBSA 3UATA 2DLCX 3RUHA 3ITKA 1EK5A 3X3HA 4H1UA 1EDBA 1QK3A 4DLZA 3EXHA 2HCTA 1Q7YD 3CINA 1PBTA 3Q5DA 3DZ8A 5H7XA 4OYYA 4ZZ1A 2GOYA 4R5HA 1H6CA 3O8NA 1J8VA 2OCXA 5DJ5A 5H5JA 1R8SA 3QEOA 4HNAA 2OBXA 1Y42X 5DM60 3PUNA 1VYVA 4L76A 4PWYA 5FUYA 4E88A 3K20A 1KAGA 3ENKA 1X74A 4EQ6B 3IR7A 3RVPA 5CLGA 4U63A 3ACBA 1R4MA 4FWIB 2ADFA 4ZDWA 2Y9MB 3NBUA 4D4JA 3G0HA 5IHXA 3KQNA 2G9UA 3F67A 4U7TB 1LJ8A 1HDOA 4RETA 2R8PA 5HJ7A 2V1XA 5LLTA 1RHMA 4MHTA 1M34E 2X1HA 2AXPA 5LBTA 3UCXA 3C3AA 4YXFA 1N6OA 1KSFX 2C03A 3BK1A 5AKXA 3G68A 5TC4A 1C29B 3LP5A 1CF4A 2JJYA 4CHTA 3PPWA 3PZBA 1AURA 4I2VA 5DBHX 1VE3A 3TLCA 3U1TA 2JGAA 5EWLA 3WLQA 3BD7A 2PKQP 5LQAA 2J9ZB 1RS0A 1E98A 2GZSA 3LZCA 4UFPA 4XVQA 1ITZA 4BVLA 2I4OA 3AV0B 4EFMA 4XX0B 3N6VA 4QPNA 1YRYE 2NYRA 5P21A 4FYIA 5T57A 3CMAB 5FCDA 3TZHA 3UG6A 2YJNA 4W6ZA 5DHPA 1VMDA 4K87A 5E7JA 5HTOA 3DV9A 3L0CA 4DLNA 3L46A 1AKQA 1U98A 3B1WA 5CA1B 2AC4A 5IXJA 3PFKA 1LRJA 1KFJB 3L0SA 4X84A 5BQFA 5AW5A 1IN6A 3IHKA 4REQB 5E7QA 4HQLA 3G9QA 3TLXA 2BKVA 1FBTA 1U0OC 3AT1A 2X3UA 2MTBA 2MINA 5KNDH 4EFDA 4O2AA 3D3EA 5F4JA 1XZLA 1PL6A 4QODA 1P1HA 3EX7C 1Y3CE 5AVRA 3QENA 3QUAA 2BFBA 5DPMA 3TGPA 2JFHA 1DQZA 1AQNA 1SZPA 4LBWA 4C4PA 3TCNA 4EP1A 1J22A 1G3IA 3B53X 2UUBB 1JAIA 5FTLA 3D54D 3FGOA 2D74A 4KEAA 2CWDA 4ZV4A 4DMGA 5LXTB 5C3MA 1TJ4A 1L3BA 4QDOA 3KWJA 3GVJA 4U8HA 3QVOA 5EOVA 2KHZA 3DFFA 1EK1A 4D9JA 2AA3A 1YQXA 1XMIA 3UB4A 5ECGC 5CITA 3UCFA 5IJWA 3UJBA 4XTRA 3MT8A 1A9QA 1KOJA 1QR2A 2CE2X 3IQFA 5CM2Z 3CX4A 3U16A 3ZV6A 2W8BA 2JZNA 4LZZA 3S3TA 5K9ZA 2RHGB 3L1VA 4HC4A 4LEIA 4LF6B 3AFNA 4R8SA 4FJ0A 4PICA 2HFJA 2QZ4A 3RVMA 5G0WA 3I9KA 3HKEA 2O2CA 3R4CA 4RYDA 2I62A 3D8UA 3VPCA 3GFTA 3IPCA 3PA8A 1H4QA 1FNCA 1A0OA 2W90A 4BDSA 5EXDA 2XNJA 1FX1A 4TXHA 2VDWA 3HJBA 2CHQA 2BM0A 2FEPA 2PL1A 3LQFA 1NXVA 3IT3A 1T0UA 3IUSA 3IRUA 2FTKE 2QAGA 4H0NA 1STOA 5L3ZA 2Q49A 2A9JA 2GCNA 2X9LA 5LP1A 2VHZA 3VU9A 5FI1B 2VZEA 3LUPA 4I5EA 1E6WA 3FBWA 3CEMA 4AMBA 5CBPB 3H5AA 4INPA 4B4DA 1FU4A 1ZBDA 4XOUA 5E3IA 4BC0A 3G05A 4L9SA 1SC6A 4N3AA 4JI8B 2HQRA 1W36B 2OZEA 3EA0A 3D7KA 3A1UA 1ZOIA 3EIFA 3RRBA 3QIAA 2JIQA 2O3UA 3MXOA 4OSPA 3CW9A 2DHDA 2MYPA 4JJFA 2AEMA 3RAPR 2CBZA 3WNZA 1ZGCA 4YTEA 5B55A 2IYUA 3VYRB 1HURA 3CVOA 3AEQA 3OLXA 4AQYB 1MX9A 1HM5A 2UZ3A 2VRNA 2WTAA 1HZJA 1TAQA 2ZAOA 3A37A 3FZNA 1FNMA 5EE5B 4HQKA 2XQVA 3AI7A 2B4RO 1H85A 4ZU1X 4HDMB 3QFFA 3JQQA 2PZGA 4MSUA 3UPUA 5CCDA 1E5LA 3GMSA 3RHZA 2VT3A 2OBFA 4LISA 4UUMA 1XEWY 4EG1A 3ASRA 2IHKA 4TMFA 3TRDA 3K15A 1FU8A 2FHPA 2VPYA 4YMSA 3M1IA 1FFAA 4BNTA 1U2RA 4NEGA 4CLDA 3U7RA 3AOEA 4I9HA 1T3ZA 3USCS 5KTNA 2ZAMA 4QFDA 2QJOA 4WTOA 4BQIA 4KRXA 2FQXA 5DGTA 1KMQA 2P2NA 3RSCA 1OKKD 2NTNA 2PUJA 4HGYA 1QKKA 1N5OX 4BU0A 5FBKA 5LZ8A 4QQNA 4DQXA 1NDQA 1MO3A 2OKCA 5K03A 3NC1C 4DJEC 3IERA 4IGKA 1MAHA 2CDRA 3NHWA 1W5FA 5LA6A 1KFEB 3JQGA 4JLSA 5B5SA 1SK9A 1PJSA 3ZGVA 1T36B 4NQRA 4CLEA 4EUHA 4NARA 5K2MA 4JXZA 2VJQA 3C6BA 2B9VA 4A0FA 3EEIA 1C0IA 1A9XB 5AUOB 1M73E 4IDPA 4II7A 4AMGA 1YA6A 2C4NA 4OMDA 3N2KA 3BILA 1IG3A 1XTUA 3LDUA 3LU1A 2IHZA 4KPUB 3KQKA 2GJPA 16PKA 1UODA 4KQXA 5J1SB 2ZRGA 2XQJA 4TMWA 3U9SA 1XMQB 2NVOA 4L72A 3MTQA 3ONWA 4DDHA 4DPMA 5ILGA 3EMDA 3FLBA 4BDTA 2BGTA 2PVSA 3CR7A 3H2JA 2XF8A 4HWOA 4FC6A 3PZRA 1XRLA 2FPKA 1ID8A 1ZR2A 2SBTA 4EJMA 1NC1A 2CVZA 4GPIB 2VWHA 4ND5A 1IB0A 4Q3EA 2E1BA 3NOVA 5C80A 4PZYA 3RU2A 4MQMA 3BB4A 3WLTA 9ABPA 1G7RA 3NC0C 4RSGA 4HFRA 2X5NA 4ZTBA 5I01A 2F9LA 4WY2A 3OCCA 3PUXA 4M1OA 2RC6A 4XIGS 2B7CA 3WK6A 4AZTA 4B9EA 1TIBA 5KHOC 2ST1A 3KHTA 1ZUNA 4IUDS 1EX9A 1M1KD 3K0BA 3WAGA 3FROA 5KYYA 4DLWA 1WDTA 1MQ8B 4OL9A 1CRWG 1IDOA 3R7SA 3EH2A 4ISBA 3S7TA 2GJ9A 2RHMA 5K0TA 5EIBC 1AB5A 1EQAA 1R0XA 3PXGA 2ZWVA 3HE3A 1XDDA 5IZ4A 2XZLA 1GGKA 2PJZA 1KDVA 1X94A 4XEHA 1IY9A 4JP5A 4KFTA 3CB4A 4D8WA 4Y2YA 3NX4A 4JBWA 3REQA 4C5AA 5JDIA 2BFOA 3EE6A 4ZMRA 1C1DB 3PNPA 1PR4A 2HT6A 4NQZA 4M87A 4CETA 1A9YA 3ORRA 1NOKA 4K6FA 1XTVA 4RZ2A 4MJ3A 1XELA 3PCRB 3PFGA 4P0TA 2FPPB 3ET4A 4LNUA 4RV4A 4WT7A 5B7GA 2YMQA 4IQGA 5DCLA 5BUCA 3RAGA 1H9CA 3N0VA 1UPUA 2D62A 2CEKA 3KBOA 1C8LA 4QUAA 2OC4A 3QPVA 4UHHA 5T6MA 1CR2A 3QU7A 1DBIA 3HA5A 1EK0A 3UAZA 2WP0A 2X8WA 3LYHA 4NFHA 5FBHA 3GLIB 3U9LA 3ETHA 4MIEA 4IICA 1VSUA 3GRRA 4R8RA 1NN3A 3L7IA 2Q21A 1HRDA 4JR1A 3UYKA 1P6QA 4AMVA 8MHTA 3AJRA 1KI4A 1VA5A 1UINA 2CMGA 3Q2IA 1BHQ1 1YR2A 3DLPX 2I8LA 1Q86D 3C3XA 3WKEA 2BEWA 1YD7A 4QOJA 1U2DA 4TZTA 2TECE 3E82A 3EFOB 2X53S 5ADUS 4ROXA 1KEZA 2W2MA 2I8CA 2FU5C 2FZWA 1GU1A 3U2QA 1OT5A 2L69A 2QJRA 4NZYA 5JDCA 1Z16A 4MVJM 2J45A 3HYCA 4RV9A 4EMSA 2D6FA 4IHKA 2R68A 4KXMA 3FPFA 3B7PA 3W5JA 1W88B 4AJ4A 3U4QB 3AERA 4UBKA 3IAM1 1V6SA 4D3DA 2Z08A 1SUPA 2YH2A 4X6UA 3FPKA 4A27A 4A6PA 3EPLA 4V02A 5K3CA 5DBGA 4TTTS 3DSRA 3URKA 4RDKA 1JIUA 2P7IA 5EKTA 4WJKB 4EZEA 1C1XB 3OWHA 1T0PA 3U7IA 3VR4D 3EDYA 5L4LA 1E18A 1RHJA 2DYKA 2PQ0A 5EP2A 3WWDA 2IV3A 1SAYA 2JB9A 3TEMA 4AVYA 4N8DA 1GGHA 2I6UA 1ZJJA 1OKKA 2JJ2D 1JG2A 3AVVA 4FOSA 2Z1NA 1J24A 3L7DA 1INLA 2WVAA 3JD3A 5JVDF 1H4VB 2DRIA 3QBDA 4XCQA 5DWVA 2QPTA 2WQ6A 1JQAA 3K92A 1KRWA 3MG9A 5FBQB 2B3DA 1FTNA 3PG5A 3B3FA 4AJEA 2XWJI 5CDFE 4NU5A 1AQUA 3T5DA 2YCLA 1V96A 3IUPA 1PGPA 4EHAA 2DFPA 3LPNA 3M6LA 2FDXA 1ZG3A 3KEGA 5E38A 1QTNA 2QAIA 1XROA 4ZVVA 3OECA 1W36C 1L7RA 4GOND 1JW9B 3BL6A 1O2DA 3IXQA 4GX5A 1P77A 1TA9A 4KE8A 4OIMA 4PO1A 1UAAA 2Z8XA 1UXHA 3ZQ4A 3VNBA 3OCWA 1P33A 2NP6A 1Z4IA 2A3RA 1JEOA 5C8YA 1F20A 3RVDA 4ZMSA 2XVYA 1E8MA 1WZ2A 3VKHA 5G41A 2OC9A 2C9CA 4R2IA 4YAUA 1CWUA 3NEJA 2CLDX 1TFUA 4BVHA 4QU0A 2GT1A 3CPJB 4X94A 4KXWA 1PZEA 1Q1ZA 1G5RA 1UWLA 2ZYDA 5E1BA 2F7SA 2UAGA 1C7ZA 1J0BA 3BAZA 2FSSA 4WA7A 3KTDA 4Q66C 1R50A 4Q47A 4PPNA 2GEDA 1YU6A 2QRPA 5FL7D 3O8RA 2FSGA 2HTFA 621PA 1I7QB 4FXPA 4LOKA 3BCSA 3YASA 1TADA 4AKEA 3TTVA 2CHGA 3CQ9A 1NATA 3OOHA 3AMVA 1J2RA 3N8GA 4AO6A 1RBQA 2YZMA 3ST7A 3G9ZA 3B89A 1NNLA 2O2XA 3QKIA 2QUKA 4QX6A 2ID4A 1ZGAA 2ZK7A 1ZW6A 2GN0A 3MUEA 4RTPA 3QVWA 5AVJA 3FLMA 2NYVA 1P9NA 4TV9F 3ZPNA 1P2GA 2AEFA 1E62A 2AN9A 2R6AA 4BV3A 9LDBA 1T6ZA 5LPNA 3QG1A 4X41A 3NXKA 5KOHA 2C61A 3HZOA 3MW8A 4AY4A 4BMSA 3WYDA 1JFFA 1PR9A 4C2BA 2OVFA 3ROZA 3HYNA 4KFSA 2DVMA 2YFYA 4A2CA 3ZCUA 3PVCA 3LIPA 4TTQA 4X45A 2P9FA 4M9CA 4MV3A 1XTZA 2R751 1HZEA 4DZRA 2OAGA 3CSUA 1E1QD 1E1CA 1X7YA 3KUUA 2NU6A 3L8HA 4KR9A 3ZWWA 4IXTA 3WYBA 4G26A 4RZIA 2D7DA 2C4VA 2I87A 2R1TA 4F2WA 4QXPA 1WB9A 1JFTA 3OPMA 3FPPA 4M53A 3DYVA 5ER9A 3I32A 1ZESA 3SDSA 1ZIPA 1SWVA 3JCZA 3C48A 4QEZA 5EJ9A 1S2GA 1IPFA 1ZLYA 1BXRB 3TQOA 3E3MA 2ZIXB 4MWTA 4KN8A 3T1QA 4LYHA 1EEXB 2IYOA 1W5BA 1AMOA 2IELA 2VYVD 3F49S 5DM0A 5AM3A 4B3TB 1TM4E 2JJ1D 3A6FA 4IDAA 3GQBB 2GD1O 3I4CA 1U0GA 1W76A 2OR3A 3OCUA 3B9PA 3RI3A 4CUKA 4UUAA 4Z4WA 1LI5A 5AKHA 3L0ZA 4PSAA 4RZ3A 1I4EB 1QVFB 5F4MA 2GEVA 1W52X 1DG1G 5E1DA 3MJRA 4HT3B 4ZEMA 1XE3A 1JIKA 4IQ0A 5ERXA 2OV3A 3WLNA 2ZPTX 3M49A 4KO8A 4M60A 2XRZA 1NJ5A 3PENA 3HU1A 4EIWA 2SNIE 3I39X 4XRRA 4Z8YA 4U5XA 2B7LA 1OC2A 2BZGA 3JD0A 2W83A 4LE0A 4J7XA 2AZ4A 2H48A 1VL5A 1Z2OX 1WRBA 3G0IA 3LPAA 3O31A 2AFIE 1YRBA 5FI0B 1RYZA 3AUSA 3VR4A 4C0KA 1UBUS 4GOLD 5IDQA 1G19A 4M1KA 4B2YA 2R6FA 3OIFA 1V6CA 3KKQA 4FE4A 3RCBA 4DMFA 2DBQA 3GPIA 1CV2A 1BMTA 2JJ2A 1NMZA 1UBTS 2CD9A 5DWQA 1X7HA 2K7FA 2XCQA 4XTCS 4JMQA 3AP1A 4KIFA 3KSUA 1RWXA 2MR5A 1XQ9A 3K2QA 2X0KA 3OKPA 4LK2A 1Z4QA 1FTSA 1FRFS 1OFUX 3H87A 1EJ2A 1B3BA 2G07A 1OI4A 2JI4A 1Q0TA 4WKOA 3STUA 1CP2A 5EP4A 4RVUA 1JKIA 5AVOA 1XTBA 3S2SA 2WE8A 4MINA 5A04A 5K8CA 3TOVA 2GO7A 4LZOA 5TF4A 5KTRA 3IOMA 3JAKB 1R4AA 4I4TA 3GRVA 3T5AA 1CVRA 1G3UA 1SCUA 3D3WA 4ZOBA 2ZTUA 2O0JA 3RYTC 4ZT6A 1U6JA 1AKRA 4DF3A 2HQBA 4TN5A 5TVGA 2J67A 3SF8B 3RYFB 5TPWB 3VR6H 2IGBA 3JZIA 3E5NA 3WDSA 2R66A 3GGSA 1YA4A 4G25A 4HAZA 2YVLA 3DW1X 3ZDXB 2R2GA 1K89A 2BKUA 3E58A 2G04A 2CXXA 2I65A 1HH4A 4FCTA 4DA4A 5AOAA 2Q1XA 1W35A 1CY0A 2MSEB 5J63A 1D9XA 3GLUA 3EAGA 4KFUA 2FA9A 1EFDN 3D5TA 3P4UA 4JJ6A 5E1OA 5GONA 5IM4F 1W87A 2WHPB 1WS6A 5A9TA 5FL7A 1SCJA 4ZKEA 3C8UA 5EVJA 3V1YA 4C05A 3HJFA 3T7TA 4A0RA 1IXZA 2KW5A 5I7RA 3MMPA 2ID9A 3H1BA 5DNWA 5DWDA 4QVGA 2ZUVA 5GVRA 2ZJZA 2X3YA 1FDIA 4O33A 3FI9A 2FSUA 1N3BA 4J9UE 2ASEA 2CRVA 3ZWOA 3U1BA 4QUZA 2VHJA 2ZYRA 3FW1A 3L8FA 4J4HA 4CFYA 4AKIA 4AT1A 1AQJA 1TLFA 2VSNA 3FBTA 4OD0A 1NAIA 1NRWA 3T7RA 3R0QA 2IS2A 3SKBA 3TF5A 1BFUA 2P78A 4D0LB 1XQ1A 2PLAA 4O6VA 1IMJA 2NO1A 2Y1DA 1YVDA 1G3MA 1JZTA 1B3RA 2KQUA 2ZSEA 4AWAA 4TMTA 4HAWA 4QJ3A 4QWMA 4LPKA 4PLYA 3NBFA 4DYDA 1K8YB 3HFGA 4KX5A 1L6RA 5DP1A 3E7WA 4A8PA 2RGRA 3A4MA 4QC2A 3FVTA 2Q41A 4ER5A 1E1QA 1EZ1A 4ZI7F 1YF3A 3BEOA 4FYJA 1W9MA 2CJWA 3P26A 3ND6A 1Q1GA 2H51A 2YXLA 2QX6A 4EA6A 1NUQA 4BNFA 1NG9A 2JATA 5I7OA 1C3XA 4QG3A 2AN5A 4WDRA 3BGOS 3LCUA 1SQSA 4LGVA 1H2RS 4PGMA 4P9SA 5HXBA 4G63A 5K09A 4Z53A 3R5FA 3BJRA 1E2UA 2PH7A 2P6RA 1XLUA 2TMDA 3LBFA 3IC5A 1N9ZA 3W5UA 1CY2A 2OXCA 3FDIA 4QG7A 4E1AA 3BMQB 2VYVA 3CT4A 3ETLA 4NV1A 1KKUA 1KQNA 1OWPA 1VIMA 2GTIA 4RJIA 3RUPA 3V6LA 1JU4A 2JJ1A 5KYUB 2F62A 3THWA 3DDOA 4B3SB 3NM4A 3IPAA 4MWBA 5EVCA 2IV2X 1SH7A 3ASPA 3L5KA 3OZAA 3IE0A 4GMFA 5EJAA 2NMVA 3HCOA 5K3SA 3V97A 1XFDA 1T43A 3QVVA 4XNFA 4S1OA 4BNHA 4X7CA 2AFHB 1N2IA 2ORYA 1RBMA 2AUNA 2WHYA 3HH8A 3NH9A 4WXPA 5FA5A 5HPYB 2CZCA 3IUMA 2ZIEA 2JAXA 4IDEA 4RENA 5B1YA 5JQGA 1NQTA 3EIOA 4CEJB 3OAAD 1T4MA 1CXZA 3OJ0A 3QVTA 1RWMA 4ZJYA 4RA9B 3MGKA 1UC8A 1HDYA 2HK8A 4PHGA 3ENZA 2OVBA 3ZKAA 3JQDA 1V39A 3SQNA 4AYTA 4C5BA 2FZGA 3SE7A 1QQAA 2PGXA 1W4AA 2CXNA 4XD7A 1GQOA 4L4XA 5DHQA 1AQLA 3SX0A 4E2ZA 2NXNA 4EABA 5A3VA 4ZO9A 1V8DA 5FUXA 1JLMA 3UHFA 3GRUA 3U81A 4HYEA 2SKCA 3ID6C 4WFJA 1LLDA 4RUKA 5JFOA 4BBPA 4C4TA 4ZV7A 3SKVA 3WRYA 4LMBA 2WT4A 4ALNA 2XODA 5BV0A 1I10A 1VCIA 3D6TB 1UMDB 2HBZA 2QROA 1FYDA 1PJ2A 3O82A 4NC9A 3WRXA 5AVWA 1OC4A 2C88A 4XORA 1EFVA 1TUEA 4XQGA 1BS2A 1VP3A 5H59A 3Q39A 3QE2A 2CLLB 4B76A 1GD1O 4X62B 4LF7B 4HNHA 3NVKI 4F8YA 4K40A 4ZPJA 3FVWA 1Y48E 2H3HA 4LOAA 2RG1A 5G3YA 1QGAA 1JGTA 3A04A 4H1TA 5A71A 3JW8A 4LYJA 1U28C 2WWYA 5GGXA 3EZ7A 1H6DA 2C58A 1II8A 3HB0A 4QE3A 1Y8ZA 4X92A 2OLJA 5K3FA 4B79A 3R6DA 2O2GA 3Q87B 1HE4A 2ZVDA 4HN9A 3VO9A 4LTNA 2GHQA 2F1KA 3I6MA 4L5JA 1P7VA 5FOQA 2WG2A 5BRJA 2DHQA 2IEIA 5GZ3A 3EZGA 4W1RA 2QGZA 2ZQ5A 1FBNA 3L92A 4GZ6A 1WHSA 3A58B 5FB3A 5GVSA 1R9GA 4IHJB 2EQ5A 1T5EA 2CDBA 4GMKA 3ZJYA 3GLVA 4ZAWA 5LVAA 4RD3A 2GD6A 3LV8A 4HMQA 3CC7B 1EJ0A 4CKEA 1IY2A 1NDHA 4YRBA 4WY5A 4WVLA 3QLJA 1ZN8A 2IYLD 4Q19A 3RS0A 1CUDA 1E9BA 2EOAA 1K27A 3QKUA 5LQDA 5C51B 1B26A 3U5TA 1OXTA 1QQBA 4M89A 3P9RA 3MB8A 4W63A 4XOIA 3N5CA 1PZHA 1DAOA 1NP6A 1FYXA 5LUAA 4Z4RA 3NXSA 5JW6A 1GRVA 1SD5A 2FRDA 2EJBA 1NYRA 4FQ8A 3OQIB 2ZTVA 3E61A 3AR3A 4MQ4A 5CT4A 2L82A 4IUCS 5HKOA 1I30A 2AYXA 1NUTA 1W7AA 2VZLA 2IXFA 2Z2JA 2ZBDA 3CCBA 3CM0A 4KQ9A 1P3Y1 1Z68A 1YB4A 2WB4A 3RRJA 3QXJA 1L4LA 3MT7A 4FMDB 1FJGB 4RM3A 3DE4X 2G1PA 5FTWA 4YAOA 4LI3X 2WNHA 1BROA 1G3QA 1LXCA 3E7XA 2C2MA 4RADA 3SSAA 3STWA 1JNYA 4CMKA 1XNHA 2F1IA 2H0QA 2Y1EA 4TLLB 2RMKA 3AX6A 1CUAA 1CUFA 2IHTA 4OHXA 4BEJA 1KZYC 2FRVA 2CLCX 3KV1A 4H27A 4W5QA 4C7VA 3F9RA 4FOOA 3RYHA 1VB5A 2V7TA 3ITNA 1BEZA 3DE0X 4MR8A 3VPDA 2X15A 1JYFA 2WJHA 4EW6A 2V6JA 3FWHA 2CYBA 4ON9A 1FXWA 1M1XB 1DRKA 5B12A 3QHAA 1B0UA 4UHCA 1X77A 4XYLA 1FYWA 4QD3A 4ZYWA 1JEYA 2HPVA 1NI3A 2PGNA 4GXNA 1KHTA 3FB4A 4WFIA 3DWGA 5CD9A 2C31A 3D43A 1ZOPA 3FHJA 5D85A 4C08A 1DC7A 3R5JA 3WA7A 1XCGB 4F5WA 3BB1A 1MOSA 2FPLA 3IP5A 4J94A 4JNCA 4R01A 5BOSB 1I2ZA 1CZKA 1M6HA 2VDKB 2B98A 3M2PA 2PLNA 3QLVA 1X7XB 1N6LA 1QF7A 3OAAA 2N46A 2SKEA 2YBEA 3CP2A 1Y5IA 2M2IA 3JYNA 3KHUA 3DH0A 3LK7A 4P4NA 4IIJA 5FUWA 5K51A 3SICE 2IXEA 4WGFA 3W79A 4XLHA 2GRAA 4PHHA 4Y6PA 4NULA 2QVLA 3TEJA 1UC5B 2WFLA 1HNNA 1ODCA 1Z5GA 3PXAA 3RQSA 4EY6A 6ABPA 3I6YA 3LS2A 3BQ9A 2WD8A 1K28D 1JJFA 3BMXA 2VPPA 2GZMA 3G1WA 4BKOA 1ZXBA 1D6MA 3TMYA 3OIGA 1DO2A 3FMPB 3QBEA 1NT4A 4D1YA 2OORA 1R0KA 5CXXA 4BTLA 1NR7A 2B4AA 3IP7A 3VU0A 1U3VA 2FZCA 3W4JA 1QF6A 3BH6A 5CUQA 5EKSA 3G2QA 3HYRA 5JMWA 2DQ4A 4CEHA 1YDHA 4JLJA 2G63A 2P6PA 2X6TA 3C15C 3VGJA 3LYLA 2D3LA 1GDHA 4IF4A 2J3DA 4WN9B 3E9RA 3S2FA 2IYVA 2G6TA 2H2DA 5TGDA 1EGQA 2EL7A 1ORVA 2ZXFA 1C4XA 3PD7A 4XM1A 1DWQA 3QM1A 2RJ3A 5FJIA 1WF3A 3KJHA 1UKYA 2AFIB 4LZJA 3TDKA 4C06A 5GIOE 3F0TA 2XNKA 3PTZA 3MJHA 4MI6A 5IAKA 2DGDA 3MTDA 1SPXA 4A82A 4LUCA 4EBFA 2GLTA 4X65B 1G41A 4CIWA 3HWX1 3UXMA 3THXA 1GP2A 1EDEA 4OI1A 1CQJB 3GPDG 1VKOA 3BICA 5LLSA 4UEWA 3J81k 4FONA 4DJDC 5AXDA 3PQ3A 5T6BA 1IE3A 4PPGA 5CX1B 3PRJA 3KWFA 4B7UA 3CG4A 3LWDA 4JKOA 5ADVA 2UZAA 3U4IA 2H7CA 2E48A 5HDBB 1RC0A 1HORA 3K1JA 4NBKA 2XEXA 4RKRA 2X0FA 1Y8CA 3LCVB 2E5WA 1VG8A 2NU8A 3NTOA 1EFPA 3KTAB 2O8CB 3PE3A 2YWDA 3PQDA 4LHYA 2BFWA 1JDTA 4HDAA 6Q21A 2XZOA 3GUZA 5DIZA 1JBKA 1OYVA 4C7MA 3CRVA 4B3HA 4HX9A 1QC5A 1PHRA 2HMAA 2D2FA 1CQPA 3E9CA 4E6EA 2IYZA 4ZAZA 1Y5RA 4BU1A 1WW8A 2FFAA 5DSZA 2WM8A 3ZVMA 1SB8A 3LPLA 1B6RA 4TKOB 2CL6X 3KFLA 4L51A 1ZMBA 2FWIA 2W4QA 3GFBA 4WWHA 4DIEA 1U11A 4R9VA 5FDFA 3M4NA 3PA2A 2CJYA 1OX4A 1F2UB 3BA6A 4E0FA 1MNQA 4LDAA 4WLVA 3ABOB 4BFLA 1SUFA 1QF9A 1Q1QA 4Y9TA 4TLMB 3I0ZA 4BVEA 2QRMA 3O1LA 1D1NA 3IO3A 4HRVA 2W6ZA 3TKAA 2X8JB 2OXEA 3TGWA 4XOPA 1SEPA 4LZLA 5KYXA 3WVNA 2JF0A 3C3EA 2QL9A 4BMOB 2Q5EA 2GERA 3W6UA 5FLXA 4JL6A 4EPYA 1JG3A 1O5IA 3IMFA 4LNAA 4C22A 2P3OA 3DG9A 3KFXA 4Q1CA 2ZP1A 3H2SA 2QMYA 2QE6A 2WF5A 2DH5A 4YP1A 5COAA 4LN1A 4BN4A 4OMCA 5AJYA 1VLVA 3EA5A 1GPBA 4GO1A 4BQFA 5BWNA 5F4ZA 4P3YA 1PD0A 4Q3BA 3DB2A 1K9SA 3H5RA 3H04A 1EUCB 4K26A 5JIBA 1IPHA 4OUDB 1H42A 4BWGA 1XN4A 5LKAA 4LAFA 4J7AA 4XQ0A 3K53A 3Q2KA 5BWBA 3DHVA 4AKGA 3OM8A 3BE5A 3EUFA 4R71A 4KWEA 2WVHA 3CRMA 1IJBA 2PIAA 1GA1A 4YELA 3CXUA 3JRNA 3KTOA 3LBHA 2X0IA 1KZ7B 3AIIA 3PVSA 3DT8A 1LNSA 4PBSA 4E51A 4I55B 4KYVA 1HDRA 1DKMA 1Q3HA 1QYIA 4C6HA 1GCIA 3ZVNA 5JD6A 1E66A 3WBJA 1WCYA 4NH0A 3IDQA 5BVGA 3IA7A 1JFRA 3DC7A 5G02A 3PEWA 1KVSA 1W85B 1YBMA 2C8LA 4X1IA 2WJIA 3UXHA 5A4MS 3WO0A 2YZNA 3FSJX 2DECA 3GZ4A 5SYMA 1JECA 4DNFA 5H3LA 2GZDA 4ZGQB 3SDBA 5LNK6 1Z22A 2D0PB 3ANSA 1HZZA 1RM5A 4BBAA 2QZJA 3FBGA 2IFTA 1PK8A 2QPOA 2R47A 3CHYA 3T3IA 1DL5A 4BNDB 4YAKA 5KJ6A 3U44B 4BP8A 4JB8A 1G63A 1TCCA 4GI1A 3SNKA 4ACAA 5JFGA 1RQLA 1YUMA 4JSRA 5JAHA 1S72B 4IBOA 4G5OA 1QRTA 4YT8A 4RIEA 5A2GA 4IHQA 1QH8B 1YV9A 4CV3A 2ZANA 4R0MA 2D2XA 3CPEA 2ZB7A 1R7RA 1T3SA 1DAMA 1PVDA 2IS6A 3LBNA 3FWZA 4JA0A 1D04A 1TE2A 2XD4A 2ZCUA 3CESA 1G6HA 4W7IA 2HMSA 2ZJFA 4K05A 4TQ9A 3SD7A 1G18A 4P83A 2JJMA 4HYQA 4LW8A 5KHAA 4BJ6A 4YMTA 1UD3A 3IAUA 3K6SA 3R4VA 3CF4A 1BTOA 1HRKA 2YS6A 4RK0A 1HVXA 4BLRA 1R3UA 4DMMA 1RLOA 1OIVA 2XD9A 5E4TA 1J2YA 2HCJB 1K7SN 1RZ3A 2QNRA 3GGDA 4CN9A 2Q4TA 3T1HB 4RDXA 3EXG1 3L0OA 1N3YA 3NHRA 4KUHA 1N8NA 3JQAB 3SIPA 4F6CA 2GA8A 3NR2A 3TVDA 3DULA 4F2GA 2NOAA 3U7JA 2VDUE 4F93B 1KYXA 1NSTA 4ZEWA 4D46A 3TQRA 4GM1A 4A6XA 3ZZTA 2QLLA 3LOQA 3UJ3X 3ZD6A 5KNLA 1NBMD 1SNYA 1YE5A 2B25A 1QO7A 4OMFG 2IX9A 3MA0A 3QKRB 1O96A 2XMCA 4ZO8A 4OU5A 2PG3A 1JIQA 3FJ1A 2QLBA 4OB6A 3PD0A 2A1UA 1F4VA 4FFPA 4TTRA 1ZISA 2ZJ6A 1GSHA 4H15A 1V11B 4YRLA 1VL8A 1N75A 5REQA 3CUWA 1ZD2P 4R9UC 3ZE9A 4A5SA 1YMVA 4OXXA 5CB4B 5THXA 1E92A 1Z56C 1ZGHA 2ORWA 4B74A 3GLHE 1C9YA 4INJA 1V37A 1YBVA 4E4TA 1Y6ZA 2ZE8A 2QRGA 1VBFA 3GJ6A 2XLCA 1XEFA 1DS6A 2PS1A 2I6TA 1QB8A 1RTTA 4RZQA 4X93A 4EB6B 1NNUA 2IT1A 5CXSA 1DB3A 2PRZA 3A3KA 4GZLA 3T34A 4B3DA 3DBHA 2BFMA 3F4LA 3VR0A 4ZYTA 1E2HA 5E6RB 3LNCA 1SVNA 2AI2A 1Y80A 2X2EA 1FS6A 3Q4GA 4X97A 1PTJA 1ODIA 1WY7A 4EEXA 2BHLA 3GLRA 5FUMA 1S01A 3ZHUA 4TKUB 2WUWE 4R51A 1TCBA 2AJDA 4HNUA 3DZDA 1QLWA 3GYBA 1GPAA 4U7FA 4CLRA 3FSRA 3D2AA 3N87A 4B81A 4BUZA 5C5IA 1ORDA 1SXQA 3NASA 4HADA 2WYIA 1H9BA 2EZTA 3ANLA 3UQZA 4YP7A 5I4IA 1H9AA 1CEYA 2KI5A 3ED1A 3CPWB 4YAWA 1RRKA 2PAAA 3M83A 5B7NA 4GNKA 1DFHA 3IQDB 1W73A 3O6VA 4W8HA 3R41A 3P9KA 2I5PO 2C7GA 1XG5A 3HKCA 3NLLA 3FNHA 5EZSA 2FLVA 1ZYUA 3R8CA 4PAQA 2BJWA 3HJUA 1XL1A 5EJFA 4BQQA 3IOCA 4FT4A 1YKGA 4RELA 4BE7B 3E5HA 1SZDA 2NLOA 4KQGA 1JIJA 2G77B 3FZEA 3V7AA 1Q17A 1QDEA 3PHCA 1N5RA 3MOGA 3FRHA 3P2EA 1C30B 4NJEA 1UXGA 2EARA 2HZBA 2POQX 3IQWA 1MB2A 1U31A 4RPHA 4Z4SA 1SKYE 1EXNA 4OH1A 4YMHA 3RVRA 4FR0A 4WNAB 3EGDB 1W75A 1P45A 1EFUA 1CFZA 1MIOA 3PRYA 5ER6A 1NW8A 1U81A 5LQJA 4HFMA 3FIJA 3UY4A 2FMXA 3V8NA 4A91A 3DOCA 1C9MA 1THGA 1NUHA 2Z98A 4KMSA 3I58A 3LBYA 3N58A 5COQA 2A33A 5CDHA 2BGJA 1W5AA 3JWHA 4JYPA 2IXTA 2WUGA 5AI0A 3RNOA 2OP1A 2XWSA 1B14A 5TRTA 1SN7A 4B6FA 1N5DA 3HZHA 3WGYA 1J23A 1WLSA 4AXXA 1ZOSA 3IILA 4MRSA 4DMHA 5LQNA 2Q1SA 1F3LA 5EWJA 2JCXA 2YV1A 1M6YA 4KLNA 1L7OA 1WMEA 2O2HA 2NP7A 2O59A 4P1ZA 1DXHA 3BCRA 5ESXA 3UJ9A 2OOSA 5CRIA 4EELA 4PC3A 2X8KA 1X39A 2OV8A 4LOJA 3WGKA 4E5VA 4NK4A 5IDYA 3FTCA 2ZIAA 3B8EA 1JG1A 3SHOA 4EX6A 4IIVA 3W6PA 1SY7A 1KIMA 1OWOA 1TQHA 2DEUA 3MK31 4NABA 3AF2A 1APBA 1R64A 3LCCA 1R3DA 1LC3A 2R60A 1RQRA 1Q15A 2HJRA 3UNXA 4B4UA 5CFQA 4J1SA 7ABPA 1RRGA 3CUEF 3I9NA 1R6BX 1U7WA 2C2ZA 2Q8PA 5ELMA 4XKJA 4EO4A 3H17A 5HTKA 1QYVA 2C0PA 3H7AA 4CMIB 4TWZA 3NVDA 2VQDA 1NBAA 4HDOB 3AF3A 4AY5A 4DOMA 2BGWA 1SKUA 1NBMA 2VPZA 4YDHB 3KQHA 1BDHA 3U4HA 3H4TA 2ZL6A 1F5NA 4DJFC 2YICA 1USVA 4XUCA 3IE1A 5DV9A 4DDUA 1S8AA 4V0RA 4EPVA 1O0CA 1WOPA 1GA4A 3I72A 2JJQA 4M21A 4WV3A 4TXMA 3U48A 1LQ2A 3V2GA 5EJ7A 3IVRA 3FKSD 3PNKA 4QIHA 1RWNA 1MU0A 1Z4LA 2E55A 3IE2A 3MLEA 3OQPA 4Q4HB 2MU1A 5JWHA 4YRSA 3NUGA 3F73A 1XCPA 4I3FA 3UENA 4KC0A 2PGIA 2IEAA 3F1LA 3L4BA 2HFKA 1OV6A 4RORA 2YZKA 4J4TA 3CLSC 3D6AA 2VZ9A 3LX4A 2XMQA 4F38A 2C04A 2OHOA 2OZLA 1EXWA 5AQEA 3CVYA 4Z3OA 1PVOA 3NTQA 4EI8A 4HCJA 1IH8A 5M7EA 5K6AA 2OTJB 3DAFA 1IN4A 1KNXA 1SG9A 3TTUA 2UDPA 3K0KA 4CT0A 4KK3A 1J49A 2O8EB 3JY6A 1LSOA 1TMOA 1I5OA 1NONA 2C9YA 3HKBA 2WU8A 3O21A 3PC4A 4A73A 5CM9C 3I34X 4UNQA 1E69A 2I4IA 2XTJA 1ONSA 1I0LA 1TZKA 4B6JA 5FP0A 2ONJA 1T4BA 4BCBA 3TX6A 3CNBA 2EW8A 2IPOA 4E22A 2QN2A 2ZBUA 1E9AA 3K9QO 4F5DA 3BQMB 2F8MA 4CF3A 5L95A 3RAEC 1UZUA 5B4UA 4M83A 5LQKA 2JFXA 3JD4A 4HTAA 1PG2A 3CXCB 1E7YA 4E5PA 3ZJVA 1PS0A 1IG0A 3F5SA 1QIHA 4TWRA 1T4DA 2OTLB 2PV7A 2M98A 2NU9A 2C4KA 2JI6A 3OD1A 4LZNA 5EIEA 3RS4A 4WWVA 5ESWA 1VA4A 1Z4PX 1CUWA 3SC2A 5C53B 2V7UA 1AGNA 3A27A 5CMLA 3WIOA 1GUYA 2RBGA 2WFAA 3P2YA 5AUPB 3DOEA 2WV9A 2JRLA 4WOCA 3F9IA 4Y2HA 3W3AD 2D4HA 4CU5A 1ZD3A 4E0BA 1T9ZA 1ZJ5A 1CVLA 3AFMA 5IK2D 1AXGA 3I3SR 3GF4A 3OEED 2VJOA 1VJRA 3LF2A 4CR6A 2F2TA 3AEXA 4CKBB 5J58A 1ST2A 3BL8A 3G2JA 3QZUA 1ATIA 2PD3A 2AD5A 3V7FA 1EWQA 1QORA 4DLBA 2VXYA 4RXMA 3T61A 3FFBA 3ZQJA 1U63A 3D7LA 5GOZA 2WP8J 1ABBA 4Y2UA 1LBHA 4TYPA 1JLSA 2I54A 2I8AA 2WA2A 2HCRA 1R0LA 1WB4A 2OO3A 1IEQA 4CI0B 1KAQA 3T53B 4KFRA 4KR2A 2P9TA 2Z9BA 1Z6XA 3INGA 3GLSA 4FFBB 2Q4EA 4N0PA 1N3IA 4EDFA 4EGSA 4PNHA 1U8YA 3F2IA 2O8BB 7MDHA 4ZVOA 3QPBA 1QPGA 1GSIA 3PVDA 1VMKA 2PE3A 4XR4A 5DBIA 1FMFA 3SM9A 2DFLA 2W58A 2FEOA 3UJAA 4BO4A 5MHTA 1KI6B 1OFVA 5J47A 2P3QA 4U3JA 2FSVA 4U7JA 2GJRA 2LCQA 4LXGA 1GT91 1X9GA 3ZQ6A 3L6RA 3T0IA 3LECA 4TTIA 1JR4A 4F84A 5A5FA 4OI0A 4I50A 1X7ZB 1DBWA 4D6YA 1FRNA 4DV6B 3UFXA 4AMZA 3A6KA 1NJGA 4E2WA 5F2OA 1SC9A 4LRWA 1KQGA 2G17A 3G1TA 1VFPA 3QYAA 1KTVA 1JQLB 1P4SA 1WNFA 2HYDA 3FLEA 4US1R 3V8QA 3T3NA 5JSUA 2QV7A 4PFQA 2QN6A 2XUKA 2QDKA 3OEWA 5FPKA 2ZIVB 4X6YA 4WW0A 3AUAA 4CJXA 4CMAA 1BE1A 2RGNC 1H1TA 4N7MA 1FFEA 1ETHA 3BH0A 3DBLB 2M6RA 2ZT6A 1P6UA 3C4QA 2GUWA 3UWPA 4OGGA 1F0YA 2B3TA 2E4ZA 3NIDB 1GILA 2XGMA 3RPEA 1UP7A 2ZDGA 1ZVQA 4NFLA 4DSOA 1H23A 4PZLA 4OQYA 4FFMA 4ODIA 4ND8B 3CH6A 3GJRA 1DXQA 3FKSA 4W9MC 3TAUA 4J6EA 2G3YA 2RC5A 3OE4A 2GKGA 3WNCA 5E8RA 3I9LA 4QRIA 4A23A 3N53A 4TTPA 1RXVA 4C78A 4KHPB 1BCSA 4RS3A 4W7SA 4KOAA 5SY4A 1RPTA 2EFYA 2A0KA 2BF4A 3EDCA 3HC7A 1SCKA 4YJ3F 2NTEA 2NZ2A 2YOFA 5FYQA 4PF1A 5FTKA 5PNTA 1CJTC 2D1FA 4MPTA 5AJVB 4CKXA 1M6EX 4KO1S 5H4HA 1WTHD 4F9EA 2O2DA 3UA4A 4CT5A 3DKRA 4HMOA 3SFZA 1EUDA 5BRNA 2D13A 4DCVA 1ZK1A 3HKDA 4EY8A 2CYAA 1K8ZB 2J7KA 1SU6A 4U2KA 4UMDA 5F2EA 5BSUA 2GILA 4MW0A 5F9FA 2UXDB 3SQXA 4RTRA 3BHIA 4RS4A 3R6LA 3GV0A 1NVMB 4KSCA 3FCOA 3X1YA 2ZBEA 2DB3A 5KNBD 2IUSA 4KVZA 1X87A 13PKA 3KT0A 3DE1X 4NCXA 3AGQA 1BMQA 4FNAA 3C87A 5E2IA 5H1YA 3OQVA 2PD4A 4JVLA 5CA0F 2F00A 4GPBA 4EY4A 1DG9A 4C14A 4X7PA 3ZE6A 5ALUA 1DC6A 1KI9A 1CYDA 2ODBA 2DBVO 4FOLA 2JAUA 4Z4IA 2RFLA 2VDNB 1RKXA 4OA8A 3VVLA 1Q1BA 1RP7A 3W3AA 3DL0A 4ZYUA 3QMPA 4LRYA 5AXCA 3ZHYA 4ZIRB 5BO5A 4DLVA 3PKZA 4EMUA 3SGLA 1AXRA 3OEEA 2QTBA 1ICIA 1QNLA 1GADO 3EY4A 1SC1A 1HQKA 2W6QA 1E4EB 4GOOD 4LFCB 3B1FA 5HK9A 4RTOA 2EERA 2ZYGA 1A7KA 3D7NA 2PT5A 4YASA 1M66A 1M1UA 2VJLA 2Z30A 3CJRA 2VUIB 3AONB 2GCOB 5E1MA 2DPXA 4XUGB 1HT2E 1YJNB 1VI5A 3NPMA 1K75A 3RV3A 3GNLA 1WV0A 2W4IA 4MV4A 3DNFA 4PAMA 2X1VA 4DFDA 5HSGA 2C4MA 2VJKA 4WNYA 2ZR0A 1EQUA 3GLHA 4QBGB 1YITB 2IHUA 1FXUA 1GAEO 3LDHA 3GNTA 3QVMA 5HOQA 2B1QA 3HCRA 1KQSB 4ZQIA 5CFMA 3OHSX 3SSNA 3HVHA 2O8DB 3AF1A 3HA7A 2VYND 3CEHA 3ZWPA 4DTIA 4YHHB 3QHPA 1Z6PA 3ZXYA 3HBMA 4QYSA 5A6VA 1JKFA 3COJA 1CDEA 3IIIA 1J5XA 2JFVA 5JUWA 5G0UA 5CDYA 2MSWA 2C4UA 1E0SA 3RDPA 2YV5A 2AG0A 3IQHX 2BRUC 1SKYB 4XM3A 1VQ4B 2H1FA 4M7PA 4BVGA 4UXHA 1U02A 3V1LA 1I1OA 4JGBA 1PQ4A 4Q9JA 4TKVA 2YMMA 4MVJH 4KH1A 2KPOA 1PEDA 4JH0A 1XK7A 3RGGA 3TINA 4X95A 4BGUA 2BI4A 4JLBA 1YI1A 2BFNA 3CC4B 3BRQA 3BE8A 1GOTA 3T9DA 2XE6A 2QRNA 4RDCA 3LNNA 1S3FA 1XDGA 2FWBA 5J2TF 1UOEA 3G71B 1OWLA 1YC5A 1ZWKA 2HRQA 2OBMA 4XJSA 3W5CA 5CFLA 1JAYA 1PIWA 4D44A 3NIWA 4MLZA 5EERA 3THOA 3LKDA 3BCDA 5D5PA 4UHJA 1HFEL 1XRQA 121PA 2EU8A 4G37A 4NV3A 3EDMA 3RG8A 4JEHA 4TT3D 4NAUA 1Z6TA 2NACA 2B69A 2RCNA 1QFJA 2OY0A 2EDCA 4Q82A 3S2EA 4ZARA 4Q9IA 2ZB3A 7GPBA 1C3OB 1Z6ZA 2ODQA 1G1MA 1K6MA 3GJ8A 4HX2A 4L4RA 5LQSA 4F46A 2I4LA 2RAFA 1US8B 3N8KA 4IDNA 4K0RA 4BO6A 3QEBZ 2FUEA 3V8BA 3VKVA 1DOHA 1T2EA 1ZW1A 3DMGA 3DLAA 1ZM9A 1TAHA 2GF9A 3FUXA 4GMGA 4MQUA 4OATA 5BR7A 2O2YA 5ECYA 3SEQA 2A5DA 4Z2AA 3C98A 3PQ4A 1YRHA 1ILWA 4XX0A 4MW1A 3CS3A 3PS9A 4PAGA 4QNMA 3U49A 2H0AA 1QV9A 4M0KA 5AIBA 1H4SA 1YIAA 1IQPA 1UZNA 3RF7A 1QONA 3EDOA 3DEIA 2YYSA 1D5CA 3MCAA 1RYYA 3UO8B 3DFMA 1UOPA 2G9NA 5KNCH 2JVIA 2BFFB 2N3ZA 2O3TA 3F3SA 4YCAA 4REQA 3JWPA 3Q0IA 4M0UA 2D59A 4CNQA 1JP7A 5KNBA 1CNEA 5GV8A 5LJIA 3MWJA 1XWFA 1E5TA 1UDXA 1ZMTA 1UBMS 4F4IA 4U02A 1QBKC 5KJCA 2X14A 3ZCRA 4D4LA 1EGHA 1G8HA 2LRHA 3O2JA 1QIMA 2DUNA 4Z0PA 2UYHA 4BMNA 1N1EA 4UHBA 1R88A 3KDAA 5HUQA 4WCVA 4RPDA 2A1TR 3ASVA 2VP0A 5HFNA 4FIZA 1UDWA 5A3RA 4S1PA 3AY7A 3IV7A 4ZK6A 1QRDA 8ABPA 4CT4B 1P8JA 1UJ6A 3HWSA 3Q6RA 5F4BA 1OPRA 3NIFB 1GVHA 4XI9A 3CX3A 4ZO4A 1M72A 2XNSA 3WE7A 2X40A 1C2YA 5C4GB 5M5BA 3S40A 4G9GA 4L9WA 4ZA2A 3KZNA 2E89A 4HP8A 4L4YA 2JHFA 2VTKA 2PR2A 2J9RA 3WWCA 2HR1A 4D26A 3IKJA 2GK7A 2EG9A 4LC1A 1TQ8A 2X3FA 4PNPA 1V2GA 1I3NA 2QTCA 3BFJA 3IEXA 2AQKA 3WKCA 2RHOA 5ALQA 4AYXA 1GDTA 2X4DA 1LGYA 3AW9A 1XHFA 4XYBA 1GFIA 5FFFA 5JCOC 5LBUA 4GF5A 2DWUA 4DL9A 1SUSA 1U7UA 3DTTA 4R3NA 4ZGWA 2G0TA 3GCZA 5BMVF 4DQKA 1B23P 2DCMA 4PYLA 1GPJA 1KXZA 2ZBRA 5JOQA 1VFNA 5IW8A 4DWJA 2XTNA 3OY2A 3BTOA 3W8EA 1TYBE 4LQDA 2O8FA 1U0RA 2VYNA 3CCMB 1RWPA 3IQXA 3MWKA 1O58A 1PJ3A 2NXWA 4ZQHA 4ZC1A 1C4WA 1K8XB 1PF7E 4OGWA 1AV6A 2OAP1 1AGRA 4UZEA 2QLJA 3QW2A 1VLZA 4IAOA 1O0SA 2PGJA 3FTQA 1RI3A 4UM8B 2X5KO 3COVA 3GJXC 4NP6A 5FORA 2RJNA 3FCSB