1T6YA

Crystal structure of adp, amp, and fmn bound tm379
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
287
structure length
268
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
molecule tags Signaling protein,transferase
molecule keywords riboflavin kinase/FMN adenylyltransferase
total genus 68
structure length 268
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6yA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6yA01
1MRZA 1N75A 1VBNA 4NAHA 1WZ2A 5IHXA 1XNJA 1M83A 2E89A 4X0EA 4CT0A 4MQ6A 2WSIA 4EG8A 5TEWA 1MAUA 4JZYA 2Z09A 1YI8A 3ELBA 1GTSA 3CVWA 3UY4A 4K03A 2DERA 2PXHA 2JAXA 2YWBA 3KT3A 3ZXIA 3LE8A 2E21A 3AKZA 5A89A 1WY5A 1NSYA 1WXFA 4ZCRA 4ARCA 1R6TA 2G36A 1BS2A 3L93A 1M1ZA 1WQ3A 1JIJA 1O5TA 3QTTA 1Q9SA 2AKEA 1G8HA 2A1UA 1F9AA 4ZCQA 3Q10A 1RQGA 2E18A 3K9WA 4MWEA 1NUUA 4HK4A 1O95D 3CLRD 4E1AA 4L2IB 4MVCA 1WJGA 5DASA 3CVVA 4XSVA 2QUJA 3IMGA 3FG9A 4EG3A 2CUZA 3CVXA 1MJHA 2DPLA 2CV0A 4OUDB 5HUJA 4MUGA 1J1UA 4ZT2A 3SDBA 1OD6A 5K0TA 4ZT5A 1H3EA 1IVSA 1U3CA 1V8FA 2A4MA 1TYDE 1NURA 3FIUA 2J4DA 1QU2A 1QU3A 1LI5A 4Q16A 1JEDA 1N3LA 1N2HA 3MLBA 3HL4A 3ZUGA 1HYBA 3KT8A 2NSYA 1PFWA 3ILVA 2HMAA 4YP5A 1GAXA 1NP7A 3G6KA 3KT0A 3CLUC 2AG6A 4QRDA 2CYAA 1N2JA 4UZEA 1O96A 3H9CA 4MVWA 4ZT3A 3X1JA 3MMXA 5H7XA 3ZIUA 1MAWA 2I1LA 4PBTA 3X1MA 3ZJUA 1TFUA 2QJFA 2D5BA 1TYCA 1YUMA 2YY5A 1JIKA 4JFAA 3RK1A 1KKUA 1NUSA 2O8VA 4EFKA 2ZUFA 3SEQA 1UFVA 3IOCA 5FNZA 3ZGZA 5KWVA 1T6ZA 3TQIA 3SZ3A 1MBZA 3HZRA 1I6MA 3ISJA 2GKSA 5HUHA 1O94D 3DLAA 1QRUA 1G8FA 2VBSA 4QREA 1XJQA 1T9GS 5J5AA 2QUHA 3GMIA 5FO1A 1IQRA 3LOQA 1WKBA 2H29A 3MLAA 1IRXA 1Q19A 3HV0A 2QUKA 3IVGA 4MUKA 3MXTA 4NAUA 2QJOA 4KR6A 2EJCA 3FWKA 5LFAA 1EJ2A 4MUIA 1OWPA 4ARIA 2B7LA 3SZGA 2YWCA 1MC1A 2PZBA 1WXGA 3INNA 4MVYA 3D6VA 4GRIA 3IMCA 3IOBA 1U3DA 4NX2A 4DNXA 1F7VA 3TS1A 1IQ0A 1O96B 1WXEA 4EF6A 3A05A 4ZT4A 2RD2A 1U0BB 1ZUNA 1KH2A 2RE8A 3KT6A 3ZXSA 4EG5A 3G59A 1IH8A 5TS2A 4YMIA 2DEUA 2P3MA 1KAQA 1J20A 1J1ZA 1B6TA 3CLTC 1JGTA 1EXDA 4MAFA 1K92A 1N2BA 1N08A 3FNRA 1KH1A 3E27A 2PIDA 2DR2A 2VBUA 2PG3A 2CSXA 1VL2A 2J08A 3PNYA 3IUEA 2VTBB 5FO0A 4J75A 2R5WA 2V0CA 1NI5A 2D13A 4MW4A 3PRHA 3DV2A 3FI0A 1WOYA 4GU5A 2GOYA 3ND7A 3M5WA 1OBHA 4MW7A 1S4MA 1GLNA 3QTBA 2DETA 4MW2A 1IFXA 2OYNA 1N77A 3TQOA 4MLPA 1KP2A 1GN8A 1JHDA 3IDFA 2CFOA 1NUTA 3FDXA 1NB9A 1O94C 4DDKA 1N78A 4R2LA 2BYTA 4H3SA 1M8PA 1ULHA 1F4LA 1K97A 2CV2A 1D2RA 1KORA 1N1DA 1VBKA 3OP1A 1QTQA 3KFLA 2DLCX 1EFVA 3A2KA 3HMQA 1PG2A 5J58A 3H9BA 3D6UA 1KQPA 1YIDA 1T6YA 1J21A 3COWA 3IVCA 3K32A 4MWBA 4DJAA 1O0CA 1M8KA 2VTBA 2QTMA 4I6EA 2CYCA 4DLPA 3CLSC 2J07A 4WSOA 2QTRA 4MUNA 1NZJA 4XFJA 2ZP1A 4I6JA 4PBRA 2PFSA 2WQ7A 2A1TR 3P52A 4EGAA 5TRDA 3GUZA 4MULA 4CDNA 2CYBA 1JIIA 3X1KA 3JXEA 3AFHA 4MW9A 1A8HA 3GLVA 3QE4A 1PFVA 3OTWA 3ZJTA 1LI7A 3ZJVA 3SYTA 2IP1A 1R6XA 1XNGA 1QRTA 5IJXA 1O97D 3UOWA 1WQ4A 1TYBE 1IHOA 4TS1A 2A1TS 3COYA 4ZT7A 2WB2A 4AS1A 3U1VA 5TEVA 3TZEA 2ZUEA 2GM3A 2QJTA 1N05A 2A86A 3PNVA 2CV1A 5KHAA 4DDMA 4BWVA 4MUEA 2X3FA 1N07A 3HGMA 1KH3A 5LM3A 1F7UA 3PXUA 4OUDA 1ZH0A 1X6VA 3CLTD 3RFFA 3SEZA 1FYDA 4I6GA 2NZ2A 5KCMA 4U8HA 2DXIA 1H1TA 3IUBA 4EG1A 1K4KA 1COZA 2HZ7A 4ZT6A 2CT8A 3BL5A 1WXIA 1H3NA 4PBSA 3AIIA 2X1LA 1OWOA 4KKVA 4MWDA 2A1UB 4F3RA 2BTEA 1V47A 3N9IA 4JXXA 1EUQA 5A88A 2X0KA 1SURA 4RPIA 1EE1A 3P0JA 3P0IA 3PNBA 4G5FA 1QQTA 4HJRA 4EG6A 1VLHA 1OWLA 1QRSA 1K4MA 1NYLA 4DE5A 1KR2A 3CTAA 1XNHA 3SP1A 5LLTA 3FOCA 3N05A 1LW7A 4A91A 4HJXA 3NV7A 2J09A 4CDMA 3BNWA 2VXOA 1QJCA 1TEZA 2QUIA 2PZ8A 4YP6A 1KAMA 1OWMA 3FETA 1J70A 1YIAA 4MW5A 3Q12A 3CVYA 4UZFA 3I05A 3AG5A 1N2IA 3C8ZA 1OWNA 3FH0A 2OQ2A 1R6UA 3CLRC 1O95C 5J59A 1QNFA 1U7XA 1P7PA 3L92A 3IODA 3IVXA 2C5SA 3H05A 2HGZA 4R2MA 2IJGX 2J5BA 3UK2A 4WNYA 2EL7A 1O6BA 1G59A 1N06A 3CLSD 3CA8A 3H99A 3ND6A 1CT9A 1Q77A 5DEOA 5DB4A 5JBNA 1JZQA 2QTNA 5K0SA 5H16A 4J76A 5DK4A 1O97C 1N2EA 4XFDA 1EFVB 2JANA 3G5AA 4RUKA 1NUQA 4ZCPA 1I6KA 2VBVA 1PFUA 1IQUA 3CLUD 2A88A 4F4HA 2AZXA 4EG4A 1DNPA 2A7XA 3N8HA 3IMEA 4CQNA 5AHWA 4U63A 1H3FA 4ZCTA 1GPMA 4PY2A 3VRHA 1JECA 1FFYA 5A8AA 1EFPA 1VBMA 3NBAA 4MWCA 4NZPA 1WXHA 1ILEA 1M8FA 3DO8A 1O0BA 4MW1A 1JZSA 3UMVA 2X1MA 2TS1A 4G6ZA 3VU8A 1NB0A 2DUMA 3P0HA 3Q4GA 4AQ7A 3COZA 3A4IA 4K0RA 4OJMX 3RK0A 1ZH6A 1MB2A 3IOEA 2O5RA 3RJZA 2Z08A 5TGTA 1Q11A 3FHJA 1YUNA 3N2YA 3MUEA 4FZJA 5BNZA 2VBTA 1TQ8A 2E0IA 3FY4A 4Q93A 4KR9A 1N2GA 4MVXA 4G5YA 1I6LA 1PFYA 3IH5A 4HPWA 4MUJA 2V0GA 1M8JA 1EFPB 5F23A 2Z3VA 2PZAA 3LCJA 4P2BA 1PG0A 4ND7A 1G8GA 4KR7A 4DDHA 2JA2A 4YP7A 4NATA 1JEEA 2WQ6A 1U7DA 3RHSA 2XRZA 1I2DA 1MOPA 4KPUB 1X8XA 1Y42X 2XRYA 4YBRA 3H97A 4MW6A 1N2OA 1TYAE 4KPUA 1OBCA 3AL0C 3DPIA 3A04A 4ZCSA 1YULA 3AG6A 2A84A 1GZUA 3VGJA 1KQOA 1KP3A 1M8GA 1JMVA 4ND6A 4S1OA 5EKDA 3S3TA 3TNJA 1Q15A 2D54A 1T9GR 3HFJA 3CVUA 3F3MA 1J09A 1NUPA 4U7JA 3COVA 5HG0A 4QBTA 2IELA 4MUFA 4JXZA 3NBKA 1EUYA 4EG7A 1GTRA 1MB9A 3UC5A 2YXNA 3TZLA 1JILA 3CR8A 1KQNA 3ND5A 3RBAA 1T6XA 4JYZA 1P4MA 4MW0A 1ZJWA 2H2AA 4MUHA 4NDAA 4L2IA 4R0NA 2OV4A
chains in the Genus database with same CATH superfamily
3OY2A 5CUQA 3Q7EA 1T6NA 1M2WA 1UCFA 1FTQA 1MKYA 1K08A 4IIJB 1KFKB 3LUAA 1I24A 1QK3A 1AK2A 3P0FA 3MILA 3RBZA 1R0SA 3SSAA 2HV8A 3TE7A 5HIKA 3U19A 4CTMA 3HRKA 4DIKA 4YMHA 3F90A 3DMTC 4II3A 1ZGCA 3RIEA 2J59A 3NYRA 1Q0LA 1P45A 3HJRA 1KWKA 1IXZA 4TRNA 5IT5A 4PGGA 1VJ1A 2CLIB 1ENOA 2AQKA 3IXMA 1G21A 1L6RA 2FU5C 1XTRA 3CRW1 4L78A 3AXSA 3TW6A 4YMSA 3V1UA 2I80A 5GJVC 2XYGA 1Z0FA 3ASZA 4UCXA 3MHPA 3H6KA 3S4YA 3DLHA 3A4TA 2ON6A 3I39X 3N0XA 4TZTA 1RADA 3K0SA 1JBEA 2NO4A 1YASA 1MAVA 1VGQA 2DUJA 4X7DA 3NTUA 1AKQA 1V9CA 3OTOB 4JXKA 2GNPA 2GRAA 1SU6A 1TT5B 5EA2A 5KVCA 1ZQ9A 1JIJA 4HNAB 5DRTA 3QTTA 4XYGA 5LDDC 5LN1A 4NEGA 1X7HA 2JJ2D 5CYPA 3QE0A 5JDIA 1EEXB 4YRQA 2O7SA 1D03A 2YZMA 1TQ6A 4D99A 1QO0D 4XRGA 1MDBA 5T64A 4A8JB 4EEXA 3OX2A 5A7FA 1A2OA 2ZTNA 4XKWA 1M9NA 2CZGA 3HXOA 4HXYA 2GPSA 3PDIA 4CWAA 5HX7A 5KOHB 3OWHA 4N49A 3OJOA 3EVCA 2XI4A 4MUGA 4B4OA 5SYNA 1NF2A 1U28C 5CXSA 3CCVB 3HBJA 3AFGA 1LVUA 1M7GA 3I5UA 3IBGA 5C8VA 4I55F 5JYBA 3N2IA 5KWJA 1K6MA 1V8FA 2VWHA 4UHFA 3IS3A 1TO2E 4EKIA 4DUPA 1YL5A 1SAYA 3LUKA 1JR2A 2J4DA 1JYFA 3GNQA 3KQVA 2Y1FA 4N3AA 5JBQA 5D3QA 5A03A 1NPTO 1N3LA 2IU4A 1YB5A 1BFDA 2FZEA 5CDFE 5HQ3A 1Z0ZA 3B1XA 4HWOA 3ZKWA 1S8FA 2CMDA 1TGVA 3QVLA 4B2YA 1ZJ5A 2AUTA 5ARDA 3TAXA 3CB4A 4DADA 1QO7A 4IAOA 1F9EA 1KAEA 5ALNA 3FZEA 1XYGA 3QA3E 2GAOA 2KM1A 2QPLA 3AQIA 1EQUA 4JBXA 2CYAA 4TMKA 5ICEA 3G0HA 4M1TA 3BGDA 5F1OA 2QR2A 1DZIA 3H9GA 3LD9A 3TQSA 4J6FA 1OB5A 1PZHA 3CWQA 1YGYA 2Q62A 3GT4A 4YRMA 1AQIA 1BHJA 3FWZA 3QPVA 2WPDD 3OCJA 4ISCA 5AK4A 1PJRA 3EWAA 4BZWA 5A62A 1B8PA 1WMEA 1BKYA 3OEWA 1MO2A 1VI2A 4GI2A 4HAUA 3VX4A 3OEYA 1X3LA 1PJ4A 1I7SB 1O87A 2QVLA 4X7BA 2RGNC 4D44A 2FVYA 3ZGZA 2B5WA 2H4JA 1OFIA 3CUSA 4EBFA 1QHGA 3TQIA 4I8IA 3L0OA 4RA6B 2QD5A 2CMFA 5AQEA 3SZ3A 4D26A 4FYHA 2A4KA 2GI4A 1YR6A 3A0UA 3VAZA 4BNLA 1UBFA 1UMCA 4E5PA 1SD5A 3DVAA 2X5OA 3LXMA 4INPA 5FNVA 4P6VF 2IS6A 3WNZA 3TCKA 2W2LA 1KK3A 1XJQA 2I6SA 5CBKA 1QSGA 2C8JA 2ZYAA 3D0QA 3L40A 3NT2A 4FGWA 221PA 2GREA 1BS9A 1K98A 3LA8A 3LOQA 1HQCA 1D7AA 2PYDA 3A6GA 1CP3A 3DOIA 1OAOC 1UC8A 3A14A 3P5BA 5I8ZA 3RRYA 1NXPA 3OFNA 1QTNA 3H18A 4XIGS 2DR3A 1T4MA 3T7EA 1JHVA 3A9UA 1ADGA 3MOGA 4OHFA 3ESXA 1T1EA 1VDZA 4OJTA 2NXNA 3BFPA 1RFGE 1W47A 5WRFA 4EJ0A 4UTNA 2B7LA 1Z0AA 1E79A 3F6YA 3CBGA 3JWPA 4TN5A 5EJGA 5CFRA 1D5WA 3E22A 1TCCA 4HEA1 1Y3IA 1GCGA 3IUJA 4FE7A 2IUYA 4IOMA 3NB0A 3JZMA 4AW9A 3DFKA 3E7XA 1BEZA 3RSFA 2W00A 1YQQA 3FBTA 4J7AA 3R6GA 4R31A 1EWVA 4FZ3A 1I51A 4OU4A 5AVKA 3WLSA 4UBLA 1O96B 4UAUA 1H2BA 5AI6A 3UJ9A 2J5RA 5MN4A 4DYDA 3CMAB 4WNCA 2ARKA 4P3KA 4C4ZA 1QF7A 2NZ8A 4OPMA 5J4LA 3TR0A 2AOUB 2OEPA 3AUSA 3W5HA 3B6EA 2XWSA 3HJHA 1IH8A 3ODGA 1XRMA 4GGPA 4GD3Q 3BCDA 1XMSA 2O2DA 3B52X 4HGRA 2VQ3A 4R3UC 3TRIA 2QW1A 4IDCA 5BUSA 2HZBA 2PA0A 2Q6VA 4UBMA 4HDKB 2PS0A 3VU3A 1F0YA 1MC5A 3SQWA 1A98A 2OAGA 2SCUA 2Z57A 3UKOA 4AQDA 1ONSA 1R64A 3K4HA 3N70A 3O9ZA 4MEJA 5JNVA 3EE6A 3N3BC 5IC6A 5KIAA 3CYFA 4PONA 2VNHA 1OX6A 4QE3A 2E5FA 3KDSE 1MRSA 1HE4A 4DQ0A 3A6ZA 2P0AA 2JKZA 5IBRA 4E1VA 4X91A 3ZZ1A 1L4NA 4FMDB 1XZNA 4YMLA 1U2GA 2HQSA 1OJLA 4AJHA 5LXTB 2V0CA 3IKJA 2M6RA 3OQJA 5KOIA 2VPWA 4EYOA 2IXGA 3LOUA 2BHRA 4AY2A 2J0UB 2YHSA 5KVQA 1ANKA 3PRJA 1IAVA 5L7WA 1XU4A 3S27A 1UFQA 1F2TA 1JSZA 2EJBA 1IMOA 4XQFA 4HZUB 3EEIA 1INLA 3R9KA 4OIMA 3JQBC 1XDUA 3B1JA 4MIKA 5EWJB 3D5TA 3KJQA 5AVRA 3K9QO 3EVBA 2WWIA 1CUYA 3WYNA 2BEVB 3PPVA 5BWMA 3CJRA 3WNQA 3FNBA 1GZ4A 1P5HA 4PSCA 5G3YA 3O93A 2FFJA 3RUEA 1MA0A 4WK4B 1N78A 4F72A 4MDYA 3W2HA 2PAFA 3H4TA 1Z0DA 1EHYA 3HVIA 4Y6OA 5AH0A 2ZUBA 3CJQA 4W82A 4Y2XA 1BSVA 3CX7A 1Y1LA 4LN1A 4EA8A 5IBCA 2DU8A 2FEOA 2IHKA 2IW3A 2DFTA 1Q84A 3PC6A 4MPPA 5DP1A 3V7AA 4J29A 4D46A 1A2QA 3FYHA 2VF8A 3OCXA 2IITA 1ZBQA 2J46A 5IUNC 1DG3A 3WI7A 5C7OO 5JZVA 2P4HX 2QGZA 1MEEA 1RWQA 3G9QA 4RSRA 5FYQA 2EIHA 4GSLA 4ED9A 1YWGO 3PFIA 2Y66A 3SBDA 3WOVA 4IIBA 5I48A 2HFKA 1A9YA 2EWWA 1I9CA 3ITDA 2YRXA 3OCCA 3S2YA 4EVSA 3G5UA 2VTBA 3W5IA 5A5VA 3WYDA 2X23A 3HLYA 1MO6A 2O5VA 3B7PA 4L50A 1A8SA 2AXEA 2JCXA 2OB1A 4FN5A 4KDFA 1S2OA 1VLLA 4XFJA 4A82A 5IXYA 3BC1A 4AF8A 3BC9A 1DFHA 3MSXA 4FJ0A 4MR8B 1ZSYA 5DTIA 4HE5A 3KKZA 2FW1A 4EYKA 5KTNA 3IPYA 5DWQA 2RHOA 2NTJA 4G2TA 4O33A 2Z1MA 3X1KA 2WJVA 3EVEA 3NYIA 1R12A 3SBOA 3CCMB 8AT1A 1WO8A 4HR7A 1KFEB 1G9SA 1JHQA 1I10A 3DMHA 3O1JC 4Q5IA 4ZA2A 1R4NA 3SHTA 3ZZMA 5ITZA 1A8HA 1CYDA 4RZUA 2Z2KA 3GF4A 4WLFA 4DBVO 1E2EA 1N1EA 1OKKD 3ED1A 3PDHA 4LI0A 4RHTA 1R5OA 1UQTA 3A3PA 4WNAA 5T4BA 3RTDA 4KQHA 2YXPX 2Q1TA 1O97D 1SHZA 2N75A 3Q3VA 1RCUA 5F77A 1FJXA 4P2NA 1EKXA 4MGKR 2H4HA 1NJ5A 2CFSA 4JAVC 1BG6A 1ZL2A 3G0IA 4JLSA 4M0MA 2XTZA 1QFMA 4OP3A 5DHAA 5F5XA 1KBQA 4KFSA 3KKQA 3BORA 3BOSA 4B4KA 3R0XA 5J2UA 3D3NA 5TQJA 5C8ZA 2WYVA 2A86A 5EHXA 2Q1YA 5TS3A 2W0MA 3IHWA 1QIJA 4D9FA 2QM3A 3OZUA 5IF9A 1NZFA 2MSEB 2OVFA 1X2EA 1MO5A 4PN3A 2QN6A 3H2JA 3EGEA 5IT0A 3G1WA 4JLAA 3G71B 1JUDA 3MELA 3OPYI 5AYVA 2VS1A 3OAAA 2HTFA 4EB6A 4N0DA 5L46A 3BM5A 5IDYA 3H9NA 1EM8B 1YJBA 2Y8EA 3DA8A 3LDAA 3HXLA 4BQNA 4LJAA 4Y1FA 5JEEA 4N40A 2NZXA 2XNDA 2FRDC 2QVXX 3JRNA 5CIWA 4KAXA 1O5IA 1OGJA 1NM5A 2J9FB 1ZN8A 4DG9A 2O8FA 1X8JA 1GGMA 3HY3A 5LD2B 4AKHA 4RM3A 2Z43A 5CB6A 4F3RA 3T3MB 3ADOA 3MTGA 4IGIA 4QUGA 5HBRA 5JTUA 3JASA 1AZLA 4J43A 3BRWA 1EDDA 1R9GA 1UJCA 4FFOA 5EVCA 4DQUA 3NUZA 1A27A 1YH3A 1ADCA 1YRYE 2PXAA 4A8PA 3C8DA 1DC7A 2A0WA 4G5FA 1GFWA 1D2AA 2ACWA 4YQFA 4XR9A 2MINB 1JHPA 3SEFA 5I9IA 1U2ZA 1CRPA 3PIDA 2A0KA 2XCLA 3FVQA 1RLMA 5A1TA 3RUFA 3C8MA 1POWA 3F9CA 4ETIA 1Z6GA 1LW7A 2DTXA 1ZMTA 2J09A 2V31A 2AR9A 1N32B 1CUSA 1A0OA 1TA0A 3CX8A 1DAPA 1HK7A 2VNIA 4PXYA 5PGMA 1WU8A 1SFRA 1V26A 1HQKA 3G8BA 1QJCA 4EJ6A 5EIOA 2D3TA 3G0OA 3K1YA 1CJUC 1KAMA 5KPJA 2BMFA 4P32A 4ZHQF 5JROA 2YHIB 5E9WA 1ZKDA 8ADHA 3CPWB 3W4JA 5IWCA 2LPMA 2AC7A 2WTNA 2GPJA 4KXYA 3ICWA 3ASYA 1UUFA 3K9CA 3J7TA 3WY9A 2WKSA 3ORYA 2HA2A 3SD7A 3RRMA 2DB3A 3DAHA 2P9FA 4BJ6A 1LSUA 1P60A 1PYOA 2GVZC 3UJ7A 5JZOA 5C1IA 1YHZA 1O6BA 1ZXLA 4I81A 1Z7BA 2ONKA 1QWOA 4IGAA 2ZRNA 4CCAA 3RRFA 1DC3A 1MTZA 3NHBA 3D7RA 1ZD2P 4G89A 4QXPA 4XJVA 4IKEA 4Z0NA 4EGCB 1YXMA 4YT8A 1Y4ZA 1WZNA 1J5PA 3FCEA 3EVGA 1YITB 4J76A 5DK4A 4EECA 1TM2A 3U60B 1FMJA 4FHCA 4Z0PA 3T3EA 1R2QA 4DEVA 5B7GA 4DMHA 2X9NA 1EBUA 3HWRA 1XP8A 3W3AD 2A9JA 1AGYA 2JK1A 4GF5A 4LJ9A 4B17A 4LOAA 5HMMA 3ZVLA 2EJVA 3DEYX 4J90A 4C29A 3AFIA 2BZ0A 3PGXA 2A88A 1ORDA 3ORRA 5EIAA 2BDUA 1KY2A 4EPWA 1W30A 3P26A 1I5RA 1U0FA 5ENZA 4J3NA 2BGGA 1NL3A 4FCCA 4RPHA 3E1GA 2AYYA 4AS2A 3ABRB 4QU0A 4JQZA 4PSUA 3IMEA 4EARA 3O9VA 2RGGA 2I8LA 3QV1A 3VKVA 2PX2A 4HDCA 3A6HA 4LF8B 4QQ8A 4P4TA 1C50A 1IU9A 1VP9A 3ZPNA 4DY6A 1E62A 2JL1A 3LBIA 3RS0A 4BNYA 5BWNA 2FVGA 2P6NA 3KVRA 4Y9TA 5AESA 1N2SA 1PO7A 2WUFA 4TYQA 3R24A 2VH2A 3H4IA 1KD1D 3AFNA 3WIUA 4NJEA 3UT6A 1XFOA 3PEYA 1EIWA 2W2KB 4R0MA 3BRSA 5SZKB 1YK1A 2FJUA 2J7PA 2AG1A 3DHVA 5B53A 1Z7WA 4YPOA 2OP0A 3U81A 2P2ZA 1DT5A 1A9XB 2HADA 1M6VB 5MGNA 1R00A 3ZGYA 3CW9A 3VDXA 4DTIA 1K68A 1PJLA 5ILQA 3FN4A 4YAWA 4WNIA 3QVVA 4KMRA 4P5EA 4CMGA 1KYVA 2OUIA 4BNZA 1HYGA 4DIOA 5A0VA 5EQFA 2UXDB 4WV3A 1IWOA 3IJ5A 3AP2A 5CVCA 1DIAA 4HQRA 2H5LA 1EK2A 2P9ZA 4MKXA 3B1ZA 4DSOA 1NN3A 4BO9A 1MOPA 5F2EA 1M76A 2G28A 1X8XA 2VO1A 2PSHA 3DQPA 2E1PA 3E5MA 3GBSA 4S35A 3TOVA 3VO8A 2HF8A 2OZVA 3NDRA 4CFYA 4LHWA 4QJ4A 3I6BA 4KPUA 2O14A 2NU8A 4KQKA 3W77A 2ZZNA 1FFEA 2EJUA 3IMFA 4YAKA 2ZE6A 4IHJF 2RG7A 2R79A 2MIIA 3UJAA 2PKEA 2AD5A 3S3TA 4ND6A 1ITZA 1M66A 3HVRA 3I0ZA 1IUPA 1F2DA 1ZGHA 3UTDA 1P0QA 2ZXFA 4EB3A 2OSVA 4KR3A 2FSHA 1PS9A 4QODA 4C07A 1SG6A 1AU9A 1J9EA 1WCV1 2V1XA 1E69A 1Z2PX 2JGIA 2EEZA 2OBMA 4W6QA 4ZO7A 2OXEA 2VF7A 1U7HA 1JIXA 3MXOA 4Z2YA 4BKRA 3E7PA 5IJ9A 1T0HB 4BQSA 3H7IA 1UDXA 4YI5A 3UAOA 4BWFB 4QDTA 1PLKA 2RBKA 1NOJA 2XUIA 3I4LA 1ZJWA 2OAP1 5FFFA 2ZVDA 1K27A 3FUCA 4RFLA 2I4TA 4ARUA 1SCNE 2GR9A 4U00A 1QX4A 1M6VA 2D9RA 1TB4A 1L3BA 4B7AA 1WZ2A 3PA1A 2A9RA 2FN3A 4XQCA 4D4MA 1QF6A 2CF5A 1KMHA 1FJHA 2XCUA 4JKOA 3RC9A 4C89A 4UM9B 4P08A 1P80A 1YBVA 2P9BA 3OOYA 3R0JA 1TVKB 4NPCA 3L6BA 5HJEA 4OI0A 3HCFA 5TEWA 3SVLA 1FQWA 1C4XA 2ATEA 2RHRA 4JT8A 1HDEA 3ADBA 1MUUA 5BR7A 4KV7A 3PHGA 4PS1A 4K03A 1O03A 2G06A 1Z37A 1DQSA 2HU5A 5ECGC 1EDEA 4H1HA 2CZQA 3TXAA 2BSQA 1FSGA 1DEOA 1M1KD 3V2IA 1V3TA 2PUAA 3W04A 2R6ZA 3X1DA 1WY5A 3EB9A 3PICA 3AQ4A 1J6UA 3E23A 4KDEA 3R7LA 2QWXA 2RGNA 4NK4A 4DVJA 1PR3A 3DMGA 1HDGO 2HDOA 1ZD5A 3R7BA 4D45A 5IT9A 2QK4A 3K0FA 4NPHA 2BCJQ 1ZOSA 5C0OE 1KQFA 3CH5A 2PH1A 3JVVA 1Y7TA 2WILA 2PQ0A 3KQOA 5JI2E 3F5SA 1GAQA 4D25A 2P30A 3SSNA 4CM3A 2EFHB 2O7RA 5GZ1A 4TMXA 4QO8A 1DXQA 1ATIA 2V7QA 4YRGA 1Z5PA 2C4KA 2Y2UA 3Q3GE 4RGYA 1ADBA 3MWKA 4E21A 5KEIA 2W7TA 1LKZA 1OLSA 4DHWA 2XCSB 2H1CA 5DASA 3DDSA 1OB0A 1CZKA 2VK8A 2ORYA 3FG9A 3BZBA 1MJHA 2PH7A 3V32A 1B76A 1CK4A 1MFPA 1RYEA 3MF4A 4U3JB 2CV0A 1XZFA 2YVAA 2HRRA 4BTVA 3I0MA 4QHTA 2ZQ5A 5LBTA 1OILA 1TTPB 2P1RA 2FW6A 3SX0A 1I4OA 2J3LA 3R40A 4JC4A 4M38A 3RY8A 1A9RA 4R54A 4HZIA 1NU8A 2FGKA 2G1UA 4O2LA 4B31A 5H3CA 4FEYA 5JNRA 3ZE0B 4GXRA 4JK3A 1SC9A 1TK3A 4HPXB 1CIPA 2VSNA 2VQSA 2C31A 2PS3A 4PYNA 3UC9A 2JLVA 1YB1A 2WJHA 3L0PA 1QYXA 1NP7A 5KKAA 1FK8A 4M7OA 4BP8A 3CW8X 5DT2A 3I2JA 3RU2A 3R41A 1FJGB 4MIEA 4QJ5A 5SY9A 3BWCA 3Q1LA 4C3UA 3BQ9A 1E1LA 2DFLA 4IXDA 3ZCXA 1V43A 2YVUA 1FDIA 1W581 3G17A 4KIJA 1QOPB 5AN9A 1MOZA 4BMDA 4D82A 3AZQA 5AKJA 1QYDA 2XUKA 4FGJA 4N0QA 3SK0A 1TF5A 2ONYA 1M10A 2UUPA 2I1LA 4N12A 3VX3A 1JBKA 5I3ZA 4KMOA 2ZJ6A 2PE3A 4BNNA 2NO0A 2ZWVA 3A2NA 3GVXA 2VT3A 4RZHA 4CL2A 1KO8A 3HJCA 2P41A 1XRQA 3JU4A 3O7MA 4JELA 3I30X 2Y1KA 3BJEA 4HADA 4K6MA 1VQ7B 1OTXA 3UJPA 4CI0B 3IOCA 4H15A 2CLEB 2EF1A 2PUVA 2XSZA 5L95A 3WHPA 1GGFA 3VU9A 3WLMA 3AX6A 5LQUA 1IPHA 1MBZA 3HZRA 1II9A 1XTSA 2YXEA 4KQIA 5ALEA 5EQTA 4C01A 4EPTA 3R5HA 3F7MA 2HGSA 2O8FB 3HYTA 4MQBA 4MV6A 2B3TA 1UKAA 3FR8A 5TQ2B 3VI3B 4XWAA 4EKGA 2PGNA 1M7BA 3QEKA 1M67A 1YKSA 1A5AB 2I3AA 3EISA 5CH5A 4YYEA 2JVKA 3K3PA 2R6CA 4P6YA 3A9WA 4FKZA 3RSZA 3VC2A 5JCJD 3LTNC 2JLYA 4KACA 2G70A 2X8JA 3O3MB 3WXBA 1TMGE 3GY0A 1E3XA 4IG4A 3V1LA 4V2IA 4YT4A 3IEKA 2LV8A 2HN9A 3ANNA 2OORC 5INTA 1EVZA 2GD6A 4RABA 5LFAA 3FPJA 3AHEA 1CHDA 4C0QC 1ZIYA 2QTGA 4IDNA 4JVLA 3A35A 5JAHA 1HG1A 5EJ4A 3ZV5A 1IN6A 3QUSA 3AEKA 1F4VA 1JHAA 3WTCA 4I36A 1ODJA 5JW6A 4FXOA 3MRVA 3IKLA 2DBYA 1GV0A 3LM8A 1RRKA 4X7CA 4KQ9A 4D0SA 4NX2A 5IC5A 3VPCA 2YNMA 4C78A 4ECAA 1PSWA 3TM5A 4PZLA 3GP3A 5B2ZA 1XK7A 3FYSA 3DTVA 2XZOA 5GJCA 2AW3A 4JBYA 1OU0A 1GQ2A 3I9KA 3HZZA 3EQ2A 4MYHA 3GRAA 3QOYA 3WLOA 4C04A 2WAMA 5ALQA 1DQYA 4OJQA 1AN9A 3WGLA 5TS2A 1W0JA 3TJRA 1D1NA 1E2KA 3DE0X 3E7FA 2BFMA 3P96A 4KTTE 2Y4OA 3VGPA 2E4ZA 2JHFA 2W70A 2GASA 5DBOA 3V2HA 4GNKA 4O59O 2XKKA 5F4JA 3O4GA 3WZLA 1QB8A 1OZHA 1X14A 4DUZB 3KHSA 4NARA 4YAEA 4JU8A 5IDWA 1T9DA 4ZVMA 4G0WA 2FQYA 5K0EA 3HJFA 4REOA 1NBEA 3FBGA 2A0YA 2QZZA 1ZDMA 3IUEA 1U98A 1ZW1A 3V4OA 5L6LB 1BEUB 2LBPA 2BGIA 2JGEA 1EE9A 4ZOEA 4J75A 2ZB4A 3A9TA 3O83A 5KAPA 5BYJA 4FGLA 1NNI1 2PO5A 4U02A 1RM5A 4F21A 1Y63A 3P0EA 4G36A 4UMDA 1SXGA 3AB7A 1PQUA 1DWPA 4F2GA 4NBNA 3ZDZB 1OXKB 1X80B 5HUQA 1FDUA 3EBPA 1QR6A 4FEEA 4MKFA 4YWHA 4ME6A 1CV2A 1DV2A 1WOYA 4W5HA 2IYSA 1YI1A 2DJ5A 3GDGA 1WMAA 3M5WA 3P9KA 2OGZA 1Q0UA 4FT2A 2IPOA 1K6EA 2ID9A 2X4LA 3BXHA 3NANA 1QPGA 4MW2A 2O8NA 4MGYR 1DAEA 3DE7X 5T4HA 2EKLA 3LYHA 2GDJA 4OQ4A 3F6BX 3W2FA 2HXSA 5KYXA 2XXAA 4ADSG 4RH0A 1M1YE 4HMQA 4HTFA 1NKSA 3PA2A 3IXLA 3L41A 4OHVA 4ZQCB 5KWIA 1CXZA 3ETLA 3D64A 1ACMA 4HB0A 1JA0A 4RX1A 5F4MA 1ETHA 4HZUA 4EG8A 4K5QA 3I62A 2ZK7A 1G6OA 5GV7A 2WF6A 1KJNA 1M75A 3F5MA 4H7DA 4YRDA 2GB4A 5AKKA 1IPFA 1BRMA 2QQFA 4AJNA 4EMUA 2LKCA 3TLXA 4MV5A 1EHIA 1G8YA 2FY8A 4IDGA 1NDHA 4FS8A 3MJEA 3KC2A 4OBBA 1YIDA 1J21A 2VJAA 4KRFA 1G4AE 1Z63A 2AFHE 4FXPA 1EJBA 1VFNA 2Q5IA 3KKNA 2QM7A 2CYCA 2ILVA 5DW3A 3JQGA 2Q5OA 3M3PA 2GNOA 4X8OA 1UJ6A 1KETA 3CQ9A 3ODPA 4I6JA 2ZYRA 2Q49A 3PG5A 2SCUB 3QMMA 3TZLA 4DIUA 4EUHA 2VPPA 1NONA 3VHXA 3SNKA 5H5JA 4ID3A 2BRUC 1HE3A 1WD5A 2EW8A 1Z0UA 4WT7A 4I14A 2PXXA 4M22A 1OFUA 3PFWO 5EY5B 1NRJB 1SKAA 2ZRJA 5F4ZA 3ZHVA 1E9SA 4LPSA 4JIMA 2ZZKA 3FZNA 3PXXA 1IIBA 1UD6A 2GM4A 3VR1A 2AEEA 4UAJA 1U7UA 3U0VA 4YRAA 4D57A 1AKWA 1VOTA 3PZBA 1LXCA 3C6MA 1R8JA 1USWA 3BE5A 2R6DA 3CH6A 4O8ZA 1B7GO 4YJ3F 4ZV9A 2IP1A 3SYTA 4X90A 1NQXA 1XNGA 2NTNA 2WIFA 2ZB2A 4Y0VA 3U7JA 4A8TA 3UOWA 2HBYA 2W4MA 2QTHA 1XQ9A 3LRXA 4KIFA 4J4TA 4WKCA 3U1VA 4H27A 2KX7A 5LA6A 2EBUA 2PQ2A 2E1BA 1JB9A 4Q7MB 2GEJA 1K8ZB 1TKRA 3WICA 4QNRA 4ZKDA 4BLPA 2XZTA 1W2GA 1WHSA 3ONVA 1VZ2A 4R7TA 4D81A 4YLYA 2EP8A 3CC8A 3T0FA 4X93A 3WK8A 1NW3A 3JRXA 2JFZA 2VYFA 1ORIA 2IDZA 3U9SA 4L16A 2JI7A 3AI7A 3N2GB 3RS2A 5E9QA 3DAOA 5JMOA 2DY0A 2ILTA 3VYWA 4YO7A 4G5OA 3ZCVA 5HQTA 1VHQA 3UPDA 2XIJA 4PZDA 1PIWA 5AIAA 3PHCA 5ALSA 3K1TA 3DQQA 3TPZA 4XGKA 4F0JA 3GRZA 2WNHA 2E4UA 1LK7A 3MGKA 3ONDA 4NDNE 3F1KA 4NZZA 2HMYB 4G65A 3GGJA 1RJFA 2P0YA 5C3MA 1ESZA 4P1ZA 2VRWA 5LUAA 2XWPA 3LDFA 3M1LA 1UXHA 4RFSA 2YJ5A 3KETA 3SYMA 1ETUA 2ETVA 1H5NA 2VP0A 1WOPA 1K89A 5AW4A 3PD1A 3ZE8A 1NA5A 1ZGZA 4YJGA 1X74A 4Y2JA 2AUNA 4OBWA 3PJFA 4N18A 5JVDF 2WU1A 5D51S 1SN7A 4PYQA 2OUKA 3PXAA 2PUHA 3QVJA 2FV8A 3DT6A 3IEXA 3OW2B 1W5FA 3KB6A 4OHKA 3U7IA 4Z4QA 1YUBA 2AV6A 4LCBA 4LF6B 1C0PA 3UANA 3RJ9A 5E6RB 1PBNA 2FKAA 1Z3CA 4WXEA 2XMBA 4G2NA 2R3SA 3UATA 4IY1A 5HZKA 3IKMB 1Z5UA 2B8TA 4UM9D 4JR2A 3HDHA 2AQIA 3THWB 1G8PA 3B2EA 4CF7A 1B1AA 1P0CA 3QIVA 3W4KA 1JKXA 1E3LA 1K3UB 4QXAA 3ZBUA 3KOWA 4ONEA 3M6MD 1HT2E 2GK7A 4Z4IA 1SVWA 2ZSFA 2JDID 3FETA 2NN3C 2XMDA 5JTTA 3IQWA 1JP7A 5LDGA 4RSGA 4P0PB 1NSTA 1IL0A 1I0LA 1BGXT 3K8ZA 1I4EB 2PA3A 2RGDA 3EODA 2DLNA 1JI0A 3VOAA 5IJAA 2HU2A 3U56A 2HM7A 1Y1RA 1GOTA 2AJ8A 2Z9BA 3R4VA 3QNUA 4H35A 1PJ8A 5DHSA 1DO8A 4YBZA 1E64A 5GIPE 4UOQA 1WVMA 5IBQA 1TNDA 2B21A 1OSNA 1W1UA 4X05A 2JGDA 3D54D 3V4VB 1NTOA 1WP6A 4WE3A 2JEZA 3ASVA 2EG9A 3I9MA 3MEQA 5JBNA 1Q0HA 1ZI8A 2QTNA 3M3HA 4G07A 4KXUA 2LTAA 5HFNA 2QMYA 3BA6A 1SUWA 3JZAA 3SHFA 4Q7KA 3CY6A 4QNNA 1YB6A 1E2PA 3HKDB 3LFUA 3ESQA 1LPBB 4J0KA 1NPDA 1RFLA 1XHEA 3Q88A 3QLJA 2DF8A 1KJWA 3IQGX 2HXYA 4IX1A 1ECBA 4MINA 4MPDA 4NBRA 5AJXA 1VJRA 1U3GA 1VGRA 1ZAKA 2W2LD 3C1TA 1OLUB 3QW4B 1U0LA 3QBTA 4I4TB 4NIMA 4JQOA 5LKAA 5T7BA 1Y4UA 5DZSA 3FMGA 1A8UA 5DPMA 1IBSA 3UCEA 3WTBA 5JC8A 2YINC 3D3KA 4ZYXA 2HA5A 1E92A 1R5NA 1Y9DA 4XVRA 2B4TO 2P4QA 3AZPA 3N8HA 4YJKA 3UUWA 1QHYA 3B2NA 4MJ7A 1WBDA 1RYBA 4Q3OA 1P4AA 3T1VA 2ECQA 2H06A 4MWOA 1YS4A 4TMVA 3FA2A 1BCSB 1EDZA 3FPHA 4FHFA 4C6TA 3A3GA 3CH7A 2RAPA 4BTLA 3CPXA 1W85B 3T4PA 1QH9A 3HE3A 5JNUA 1KI2A 2IVZA 1FDVA 1M2EA 1OCEA 2OY0A 1B2RA 1J8QA 2QQ0A 3W9SA 4F6CA 3C7KA 4YELA 4WDRA 2OKCA 1BC5A 2RHTA 1C29B 1GUZA 3BFJA 1NVFA 3IOEA 4JOBA 4M1EA 3T1OA 2O7VA 1JDNA 1YZKA 4Y0NA 4OB7A 2G9RA 2H7VA 3QWAA 4E70A 1A9TA 1IOZA 4KLNA 1F12A 3HB0A 4HGNA 5EPOA 2ATXA 4CM4B 4F56A 4QM6A 5T3UA 4XH9B 5FUBA 3RF7A 1KARA 1FLNA 4LHZA 1Z0JA 4UTXA 5F2NA 3LCJA 1NVWQ 2BR4A 1XZQA 1IRIA 2N42A 2ABWA 3VR6A 1N0WA 1W5BA 3JU3A 3NC1C 1J8MF 4YQEA 4EAAA 5HXBA 4FMCB 2BFWA 4XN0A 2XHEA 3BCRA 3WGYA 5B3JC 1U7DA 3IA2A 1UWLA 1BH2A 1R18A 3B3FA 1VI5A 2XKJE 1GG9A 5JS8A 4WFQA 1GG2A 1GPKA 3PC8A 1MN6A 3A04A 4O3MA 5GONB 1FP2A 4KE6A 5FOTA 2O8DB 2K2WA 2WAYA 1JVNA 2Q2NA 3C45A 1HNNA 3CEHA 3KZNA 3MJDA 3OUTA 4NEHB 1J9ZA 2ERCA 2ACVA 3WHIA 1B23P 1FA9A 1CE8A 1XD2B 1Y6RA 2GD0A 2BHLA 2OCIA 3LIPA 4MUYA 2KYRA 4KI0A 2FMUA 3EASA 5BQOA 3U7HB 4MUFA 4W4TA 4ZOCA 1DJMA 3GLKA 4XJTA 3EZFA 1D2EA 3IDQA 4HB2A 2GF2A 4PX9A 1ZCZA 4BB5A 3GSIA 2AWNA 2YUTA 1T6XA 2EKBA 1QLJA 4LHXA 3ZTWA 4BAUA 4NCIA 2Z4RA 4W8OA 3F47A 4I5IA 2AXNA 4IJMA 5AOVA 5AVOA 3VV3A 3LXUX 5BR1A 3WL8A 1D1QA 2JVJA 3U09A 4YCJA 2P4SA 3UCFA 1OZFA 1G291 3PI6A 1LSSA 1UD3A 3BD8A 1SXJA 1ENYA 2BI8A 3LJKA 4Z9YA 1E9CA 4H17A 5C53B 4KQJA 4HAYA 2OBBA 2PPVA 1OA0A 3DKPA 3OIUA 3JYOA 1HMYA 4K9NA 1S01A 4FGUA 1YI8A 1LSJA 5D00A 2NQ8A 4GOMD 3PDCA 4E2WA 4NOJA 4AKIA 1HH4A 5TDHA 2DT5A 2JAXA 5FHQA 3BB1A 4WIAA 1AHIA 5NULA 4IXMA 5BSMA 3DKIA 1AK1A 4CCWA 4CKYA 1OLXB 2GA9A 3NC0C 4YJ3B 2BMJA 1G0OA 3RV3A 1OREA 4J9VA 4Z9AA 3JAWB 4F11A 5AI9A 1ORWA 3CZPA 5G53C 2NADA 1E3IA 2AQ8A 2MSLA 4U2DA 5ISMA 2PL5A 4Z3OA 4LS3A 2C98A 2AN1A 3B53X 4U39A 1CVLA 2OGUA 3PNMA 3PX2A 2GJ4A 1CVRA 3I2GA 4LJKA 2CNLA 3D43A 3CEAA 1AZSC 1PGQA 2ZSHA 4HX9A 4JCOA 1VCHA 1VLVA 1E2IA 2AXQA 1JHMA 3P9IA 3CVOA 3ACDA 4G9BA 1O95D 4TL7A 1DU4A 3KQUA 3BCHA 4E1AA 3ZY3A 4WXRA 5EGNA 1DI0A 2XYPA 1SJ9A 1EXWA 3MAJA 5IARA 1UBJS 3WRXA 3RU3A 4KH0A 5LMZA 2CJPA 3M82A 4FUQA 2BM8A 5EPUA 3P32A 1G60A 2QSZA 3GNSA 3GLIB 1PV2A 1GL7A 2F9LA 2O4CA 4P54A 4PRLA 3WADA 1U8ZA 4ZT2A 5HUJA 1ZGGA 5BYBA 3TUIC 1KEEA 1NX6A 1PL0A 1XZDA 2Z2ZA 4ZVLA 4I99A 3V76A 4A3SA 4EF4A 4FCWA 4YRRA 4AVYA 4PNEA 4Y9RA 5DHFA 4ZVSA 1IYZA 5B37A 3ZCPA 3RCBA 5J1SB 4NAVA 2XDQA 4ZK6A 4NSNA 1N2HA 3BSFA 3N8DA 3QVOA 1E60A 3GIWA 1FUKA 5JFTA 5E1MA 4C0WA 4URFA 4GC9A 3KV1A 2VRCD 4IQFA 3GG9A 3NP7A 2OKGA 3EXHA 3D3EA 3CUYA 3FVTA 3DC7A 3O38A 4MVJI 3DDZX 1BA3A 2CXQA 3CE6A 3PL5A 4IKOA 4NZOA 4IP0A 2NM0A 5DHPA 5H82A 4E5SA 1VSBA 4IO0A 2LP4Y 4Y18A 4C08A 3U39A 2O8CA 1K9VF 5H68A 5FJJA 3HYNA 1H2XA 3W6UA 4B7XA 1MZVA 2GHRA 2XF8A 4WVLA 1TPYA 3VNRA 3I64A 4AZTA 4OJYA 4M9UA 3IP7A 3FNEA 4F9FA 3NEAA 1BDHA 5KYNA 1C7RA 1IJKA 5ELMA 1DL5A 2GSWA 5CVEA 3M6WA 3TXYA 1W0JD 1LCIA 1TYCA 3Q3EA 4GOLD 5E0KB 1DADA 3FUUA 3RW9A 4ZICA 1OI2A 1Q7YD 2A9QA 2VF2A 2IVFA 3HKCA 5IDQA 3OP4A 4QVGA 3WGJA 3QFTA 2R1TA 1N7HA 1QX3A 4QDKA 1CUIA 4AKGA 1PNOA 3F1LA 4OAOA 5FRDA 2YRFA 4B40A 3L1JA 4PEVA 2GRUA 4ZWNA 4WZZA 3EAQA 1YLOA 3IUSA 1BXZA 4MAMA 3AUXA 4XQEA 3BFVA 1EBFA 1M6HA 5C4IA 5FPKA 1YU6A 1SHTX 1TE2A 2VBSA 1E1MA 1RE0A 1S2MA 4DZZA 1C2YA 1UEIA 4QGFA 1AGXA 1TRKA 2X6WA 3M0EA 2WD9A 5KQGA 1IQRA 2ZYUX 3I2FA 2ZDQA 3BWDD 3PS9A 3AKEA 3DLCA 1OYYA 4GMDA 1PQWA 5AW3A 2WJ4A 2YYYA 3O75A 3AINA 2AIRA 3QQ5A 4LC0A 4DXHA 4E2ZA 1G20A 2NZWA 1LBEA 2R6AA 1GCUA 3A0RB 4ZZ0A 4KR6A 2B7CA 1ZGAA 4FFMA 2M1XA 2P1ZA 3CG0A 4ZVRA 4HNVA 3CP8A 3HGTA 5KTRA 2QXTA 4MUIA 3NIDB 5FTNA 2BH2A 4YIHA 2GPWA 4BKOA 2XZPA 2AI3A 3QWFA 4EOGA 4DWJA 3PEUA 3EZXA 4RD4A 2BJHA 2RGWA 1Y33E 3BA1A 4PW0A 1WMSA 2I5PO 2XTNA 4UCQA 1OXMA 4P1VA 2BKVA 2OFWA 1UZAA 3FJYA 4I46A 2I9PA 4M98A 4OA8A 4D0RA 3KEWA 5K7SA 2O8BB 1UM9B 4LX8A 3WDLA 4C3ZA 4C21A 3TS1A 1WW3A 4P92A 2EFEB 1E0AA 1DTWA 3VPAA 4EHKA 3KD3A 3QRWA 5TE9A 2RE8A 2CJXA 1BGVA 3DEJA 4Y1RA 4OSEA 4AURA 2JLQA 3PPXA 3EW7A 1I33A 16PKA 1YACA 4OYLA 1WWKA 3LBHA 2ZR0A 4RBNA 1W87A 3W6OA 1XAIA 4PG8A 1AKRA 1RRGA 4FFPA 1ZI9A 4IHJA 4XB1A 5A9SB 3HKEA 1OIWA 3GJXC 4BMXA 1OVMA 2JHAA 4PR0A 3JZDA 5IUJC 1HVXA 4C2AA 2QB5A 1DRKA 3QNMA 2REOA 5FHRA 1JN0A 3B70A 3RAPR 4YV0A 1PUJA 1TJYA 3M9WA 4B3IA 4D6XA 5J4HA 5EUQB 1Y6ZA 2GESA 2BSXA 2V96A 2H2IA 3TW4A 5LBUA 3TZBA 4BMPB 4H2DA 1JQAA 1ST2A 2AOUA 2YCLA 3K4PA 4IG9A 2BFCB 1C3XA 4KN6A 4CKCA 1DAMA 1RWWA 2GLTA 3BL6A 4Q00A 2OG2A 3PRHA 4JH0A 2EERA 1XXHB 2JBAB 2V5UA 3IB3A 1J22A 1W0CA 1G16A 3RSGA 4BQEA 5B12A 3HUEA 4TVKA 1G5IA 3LHSA 5C32A 4F91B 1SEVA 3HM9A 4KKUA 4ZOLA 1U9IC 2ECPA 1EX9A 1VMKA 4GS5A 4QQKA 2DKNA 5F52A 2PL9A 2NUAB 4P2GA 1JFRA 3DNMA 1E3WA 3WWYA 4WWHA 2OYNA 3VA7A 1XLTC 4FFVA 1JB1A 1P3Y1 3AIMA 3EOZA 4W1SA 2Z3ZA 5DTEA 3AM3A 3GLTA 4OHRA 4MI9A 4C7OB 1P2VA 5JHGB 2VJIA 2ZJ3A 2BFPA 4KKSA 2BYTA 4Q47A 4OK3A 1ULHA 2QJRA 3TOXA 1FEZA 1KYYA 2FQXA 1G8MA 2IUEA 1L5RA 3VUFA 4G1EB 5E4JA 3ZDBA 1V5VA 4L9WA 2IE8A 4P25A 1P31A 3OP1A 4KPFC 2VL7A 2OCKA 1B1CA 2ORED 2FDCA 3TW0A 4DLAA 1VB3A 2C9YA 2VUHB 1KA9H 1FIUA 4BO8A 2DJIA 4MUMA 5CFNA 4BC1A 3H9BA 3KV3O 3D6UA 1I18A 2C2HA 3GNLA 3K1AA 1WDLA 2F8LA 3LT0A 4R7GA 1EMDA 3SFTA 4DCOA 5CYOA 1V41E 1Z7GA 2Y6VA 3RFCA 3HG7A 3L7AA 2PKYX 2P7IA 2G04A 4Q6BA 1CRZA 2GSDA 3K6RA 1IK4A 3L7DA 2PUTA 3IR5A 5IN4A 3LH5A 4WAUA 2ZP1A 1RWPA 3GN1A 1CP2A 4CN8A 4I1PA 1QHEA 2HAEA 5AP9A 5GOTA 4GBJA 4JP1A 2XGMA 3OPXA 3U2QA 5JALA 4XASA 4BY9E 4JR0A 3K71B 4B33A 3MIZA 4ZOLF 3TVYA 1SB8A 5H83A 2ZWAA 3PDUA 4GKBA 4QLAA 3GU3A 1EP1B 4MS1B 2Z6QA 3TOSA 3B89A 3TINA 2IA5A 1AKUA 3MLEA 5KNCD 2HYIC 1NW8A 3FJOA 2B20A 2W8BB 4F3KA 1RXWA 4LISA 4OQNA 2EZ8A 2C07A 3Q39A 2PTHA 1E7RA 4E13A 1QDUA 3ACCA 2Z8XA 3OEEA 2NSJA 3KQPA 3DBLA 4BWGA 5JQGB 4ND1A 1YS1X 1RXUA 2VPTA 3R7NA 1KVTA 1YOBA 2AF3C 1QV9A 1F1BA 1NVDA 4V0LA 2A1TS 2WAAA 3HRIA 2BFEB 3SOPA 2VT6A 2PN1A 1M34A 3GROA 4FMDF 2CCGA 1HKUA 1WR8A 3PNVA 3T38A 1ZSNA 1DAGA 3AVPA 1QVWA 4M8KA 2Q6LA 4X3PA 4Y67A 2FW0A 4JB0A 5DIFA 2W2PA 1UOEA 2IHTA 3NOOA 3VHLB 1SUDA 3C98A 3OPOA 3OHMA 4RJLA 1P81A 2O2GA 2P9EA 1XTUA 4RKFA 4C7XA 1CR1A 4M60A 3ITEA 3G8CA 2D1YA 2FWJA 1H6BA 1G8KA 2Q5FA 1GPDG 3VKHA 1N5RA 3OLQA 1KOGA 2OR3A 2J5XA 1AM4D 3SQLA 4AJ1A 2DBZA 3OG9A 3UMMA 3QOWA 5J2TF 5A06A 3RSOA 4XLLA 1I2AA 3K30A 2BMVA 3AIIA 2AC4A 1L7QA 4N7MA 2WHPA 5GIOE 2VBFA 1QYVA 2TECE 5E6TA 2O1EA 4EKDA 1IHXA 4M9ZA 2FEMA 4R8MA 4C4YA 4HNAA 4MS4B 4DAOA 2EKDA 2HSEA 1EB9A 2QMHA 3GGDA 5BXYA 2W58A 3BHIA 3TFOA 4Z7QB 4ZYUA 1HPLA 4YC7A 3ZHTA 1BQ4A 5FBKA 7MDHA 1OXVA 4O4HB 1E2GA 1VLHA 3OIFA 5CLFA 1XZJA 3FDZB 1XNHA 2CF4A 3ZNOA 4BLRA 1FDWA 1D8AA 2ZZMA 1E58A 2K5UA 2XUPA 3ISVA 5A4JA 1WBJB 4ZC8A 3GP8A 5IU6A 4F1KA 4C14A 2BGJA 2R8OA 3DWIA 4G4GA 4DWWA 5BORA 3AHFA 5K2OA 4DLNA 4DQXA 4HTAA 1TEZA 2P4EA 1GN9A 2Y0EA 2LRHA 5L7YA 1EFUA 4FDTA 4ZHQB 4IJVA 4FNGA 2BFFB 4OQEA 5FUYA 4LFCB 4GKKB 3GI1A 1HBJA 3H65A 1FUEA 5AVQA 3BYZA 2R9VA 4Q9JA 1NY5A 2GA8A 2ZTLA 4DANA 5A3SA 2OLJA 4BNVA 2CHGA 3L92A 5IXJA 3KJIA 2OZLA 1M54A 4K05A 4JYBA 2IYYA 2E3JA 3EAGA 3GGOA 1Z4NA 1UMDB 4R2MA 2QLJA 1J56A 3TL3A 2I99A 3F2IA 1SHUX 2W5UA 4JJZA 1JR3D 1XBTA 3SXUB 1ZHFA 2B99A 1A7AA 4U5XA 1RI2A 4JVSB 3UWMA 4RULA 1G38A 2BFDB 4P7GA 3IURA 4WRRA 3EVFA 1W59A 4TLLB 4AD8A 2C2BA 1A9QA 4PPGA 1NI4B 3OM1A 5B57C 1FNSA 1QGDA 2BOVA 2OQIA 5IKOA 3K0FB 3R3SA 4XWGA 4EYGA 2Q29A 2CFRA 8OHMA 2HWWA 4L5CA 4R5MA 2OZEA 2IV2X 2HHHB 5JAUA 2JDIA 3ZGOA 2DQSA 2JANA 4RD1A 3G5AA 3FCSB 1RI1A 1XDWA 3ABSB 2ZT8A 2FWAA 1B3RA 3GUVA 2A9FA 2CE7A 4MX8A 2IFTA 5JJIA 2QE7D 3O26A 2FVXA 4TYWA 3HR7A 4QBHA 3ANMA 1AOXA 4NOLA 3O1HB 1F0KA 1NJ2A 4K3VA 3WHKA 2PMDA 1P2FA 4UDOA 4EUKA 5KS2A 2AN5A 2QGGA 3KDPA 4HLDA 5REQA 2YV3A 2CLFB 3TRHA 1M2OB 1XAHA 3OPQA 4TTIA 2ZL6A 3RD5A 3K0AA 2REXB 2IF2A 4ZCTA 2REBA 4URZR 5DBGA 1VPEA 1WW8A 2XMPA 2K4MA 4GZ3A 1EFPA 5B3JA 1OXBB 3NBAA 2DUWA 1AO3A 1TU3A 2IP2A 2QTVB 5K3SA 3ZIAA 3A3OA 3TIGA 3WB2A 4EF5A 3QUAA 4IMPA 2X1MA 4KIGA 4CM8A 4UTRA 2YIVX 3BK1A 3G13A 4R3WA 2GBGA 4LSMA 3QIAA 3IKTA 3COZA 4RO0A 1POXA 2ZRHA 3I72A 3VYSB 1LBQA 3N7TA 3U3OA 4E12A 2B6HA 1AA9A 2E49A 2WM2A 3HY6A 3LFTA 4G37A 5ELLA 2GK6A 3N2YA 3NAGA 3W5DA 3USCS 2MHCA 4XYMA 4UDNA 3QKRB 3JAKA 5FBZA 1SHKA 3V97A 2VWQA 4XR6A 1FP7A 1L4UA 1M1NB 2KMLA 2C0PA 1ZISA 2O3QA 5EXSA 3OJLA 4XVCA 2V0GA 2VJPA 3LW7A 2PZGA 5FWXA 2XDYA 1GTZA 4TRMA 4XKJA 2BE9A 4TMYA 1H65A 4BMVA 1L7OA 1HNZB 4JYAB 2QPOA 2B5OA 3UWDA 1UK6A 3ZDRA 3EHEA 2JGKA 3CZRA 2BGWA 4DW8A 4CEJB 1CF2O 1X1BA 1KOFA 2HHAA 3H5WA 1IPEA 3JWEA 3P0RA 3K9GA 1YZYA 4GNRA 2V3WA 2ZUTA 1GFSA 1K88A 1RWXA 2HK6A 3KB1A 4EFLA 3GRVA 4GO1A 4Q01A 4QRHA 5MN6A 3H97A 5HP4A 4YWJA 4N82A 3UF0A 1R0KA 3QU9A 4IL5A 4XJXA 1AMOA 2L2QA 2DAPA 3L8YA 2MSWA 1KQOA 3DBLB 5FAXA 3VGJA 2Q9UA 1FMTA 4ER0A 3ICQB 1C4OA 3TWOA 3H87A 1VF7A 3WO1A 4BV2A 4ESVA 2VJYA 2PUCA 4CFZA 5AFSA 1FNCA 5AQ1A 5IM4A 3UQZA 1CULC 4EMTA 2CC2A 2QG4A 2Q9BA 2A57A 4CMAA 3EXG2 4QFMA 4N01A 2BGTA 2C2GA 3GFRA 1ISJA 4RTRA 1CX9B 1EXMA 1AUPA 2AOXA 2DRIA 2ZT7A 3GA5A 4HDMA 4TYNA 2CXOA 3VPHA 3K0EA 1A9XA 2FSPA 1NMEA 2YXNA 3GJ7A 3GVCA 1Q5PA 1T9BA 4XMYA 1U0EA 3F98A 3FYUC 1NKVA 1YDFA 2ENWA 4WOBA 3RM3A 3TZCA 4LSWA 3ND5A 5FLYA 1MX3A 1QG2A 2ZYTX 1NN1A 1XDSA 2ZPAA 4LW8A 2CNWD 3BXZA 4H1TA 4NE2A 4URYR 1NVGA 1YDEA 1JRLA 2C4HA 4Q21A 4ZYYA 4L2IA 3QKRA 4MYRA 5KOJA 1H6AA 3F73A 1EGMB 1N75A 3QVGB 1NLMA 2CW5A 1UBEA 1UJ5A 4UCWA 5JD4A 2G07A 5F3WB 2Q7OE 4ES6A 1FYFA 5KSYA 2GZAA 1G9TA 4ND3A 3HM2A 4MQ6A 2OHJA 4RCYA 4Z4TA 2P90A 2G0AA 4EA9A 2GETA 3KK0A 3SHWA 2HJGA 1FRVA 1SXJD 1PS8A 2IZ1A 4DJTA 1A4IA 2FN9A 2O4UX 4NS4A 2YJ4A 2NZUG 1LLCA 1PV1A 4H4DA 5B4VA 2C54A 2IEGA 3H0EA 5KSOA 3KAJA 3HXQA 2E21A 3DAGA 1X19A 1UD2A 3L84A 5B1SA 1TL7C 1KRHA 3FSEA 1O4WA 3CUEF 3NG1A 4RORA 3L93A 3AERA 2CMGA 1K5PA 1HI9A 1J06A 1TM7E 2P6OA 3ZCRA 1O08A 2HY7A 1OB2A 4G5HA 1B0AA 3KQYA 1V5GA 2F3TA 4QT4A 3FUXA 1O8BA 4ZCQA 2FMXA 2NWQA 5EHNA 4HAWA 3LG2A 3HCPA 3RVOA 2OB2A 4IUCS 1ST3A 2Q9AA 4GZLA 4ZREA 3U5TA 3ZWWA 4B3TB 3GLQA 5J5CA 5ELXA 4NICA 4CI9A 1M0SA 4UKDA 1FC0A 2FWIA 3U49A 1LWOA 2OFXA 4II2A 1LTKA 1ISIA 1II8A 1BNCA 1SZCA 2WINI 3N2KA 1CQJA 4ARVA 1D2HA 2P9HA 1IXSB 1L2TA 1OTHA 1XOIA 1UPFA 2X0NA 3K9NA 1J1UA 2EFGA 1FYWA 5ESDA 3U9TA 2ATIA 3M5PA 5LQCA 3ASUA 1WPGA 2DPHA 4P83A 3GH3A 4MV8A 2FF5A 2QLTA 2AH5A 2GN2A 3E1SA 4AUNA 2OC9A 2VJKA 1R5JA 3P9ZA 1XO1A 3HFSA 1QU3A 3OJEA 2K7ZA 4X7FA 3DKKA 4PLHA 4ZGGA 2V7QD 4DT1A 1SD2A 2IPXA 3ZUGA 3ND9A 5KZMB 1I14A 1QV7A 1SCQA 4ZQIA 2P75A 1PKXA 3JYLA 4KLCA 1J0AA 4YP5A 1WSBA 4IZ6A 1N2XA 2HDWA 3VI4B 4BNFA 4LQDA 4DC0A 5IX8A 4BXOB 3ZIAD 1G98A 2UUAB 2ODBA 4Y2UA 2ZE8A 1TQDA 1L5ZA 1N2JA 3DTYA 4RJIA 4UZEA 1VKHA 3UTCA 1G63A 5TVGA 5EIBD 1T8TA 5I45A 4FB4A 4LIPD 5JARA 1U65A 2SHKA 2MDTA 4B74A 3WE7A 5JSZA 1VQ8B 2I7DA 4Q1VA 2A30A 4G97A 1W4CA 4ZVVA 4G0MA 1MQ8B 1PT9A 2HRCA 1HE5A 3CKYA 3LBYA 4EELA 2O2IA 3RS9A 2R8EA 3E9MA 1GRRA 4C43A 1EUCA 1FF9A 3DAYA 5JE8A 3GVKA 1T2AA 2A5YB 3PWTA 4K6FA 1Q3KA 3DEAA 3A1UA 3TO5A 3ZU3A 1N3YA 3GBPA 1SRRA 3SEQA 1GTMA 1FX0B 3FAKA 5DULA 2EXXA 3IHTA 3GMSA 3OM8A 4MIYA 5EIWA 1TUEA 2ZSBA 3ISJA 2H8KA 4CMIB 1WUTA 2WHPB 2X5KO 5C7IO 4MRAA 4J2OA 3LY9A 1DIHA 1ONNA 1XRNA 3Q9UA 3V7FA 1QRUA 3IJPA 4XGIA 5IHPA 2UUCB 1FQOA 2B1IA 2W2TA 3LGAA 3HWX1 4N6GA 2NVOA 2G8NA 1IHMA 5AI8A 3LQFA 3TX6A 4K9LA 1SKQA 1P6XA 1EFHA 3Q8MA 1Z5NA 1B15A 1X7DA 3EIXA 1TT7A 2B82A 2RFLA 3ZVNA 3N39C 5ICSA 1OTYA 4DK1A 1PJ3A 2X42A 1D3AA 1VL5A 2PZFA 2O0JA 2WKQA 5KTPA 5LYJB 1C3LA 4GUAA 4MRVA 4PZAA 4RZSA 1CR6A 4L5AA 4AJLA 1L7NA 3CNHA 1A4XA 1OXTA 2AG5A 1LEHA 2BONA 1QRDA 1NULA 2VJBA 3NNDA 4NAUA 1PTKA 4ESOA 5BN3A 3ZZTA 4TN1A 3K9LA 1EP3B 2GPAA 4YAJA 4EUNA 1E59A 3WL5A 4BNIA 3NAMA 1TQHA 1EQ2A 4PZ0A 3INNA 2R96A 3GLFA 2C9OA 1JFSA 4LQ4A 3QH4A 3AB8A 3RGWS 2O3JA 1IBRA 4GRIA 2BV3A 2NVBA 2NG1A 1JU4A 2DPGA 4IXTA 1VHOA 1LBHA 1T4CB 3PKIA 2GTPA 1P4RA 5ITVA 1QQ6A 2XKAA 1O3YA 1OY1A 4LWPA 5LIRA 4U7FA 3WLPA 5DBEX 4DV0B 4JYCA 1WW2A 4EW6A 5MDHA 5FT9A 3EXHB 1V25A 4LFBB 3WKEA 3OWOA 4Q1EA 4KO8A 4EWLA 2JH3A 4B6EA 1B6TA 1MOSA 3OZFA 4GYJA 5AVYA 1E9DA 1EAYA 2B6NA 2NW6A 4O4JF 2VKTA 4PYLA 5A3JA 1R3UA 2OD7A 3RYFA 5KOYA 5KC8A 1BVRA 4IJ6A 3GDWA 5CB4F 1KH1A 3ROMA 2WLTA 4DBLC 2EJTA 1KE2A 4XTCS 1UXOA 4LTDA 3Q8KA 3NORA 2DR2A 3D9QX 1IAQA 2BCEA 3IP3A 3NHLA 5KNDH 4XOTA 1J2EA 2EC5A 3CF4A 2O0LA 3WJ7A 1PQPA 4NS1A 4DMCA 2QRGA 3ZDYB 3RTEA 1C30A 3MSCA 3OI7A 1XA3A 4YASA 1A7JA 1A3CA 2ZI7A 3LC0A 1J2UA 1L4LA 3O91A 2Y0CA 5DLYA 3AH8A 4XVQA 3AJEA 2VYNA 4B6RA 2YZKA 3MS2A 5DYGA 4GU5A 4IINA 1QB7A 2XB9A 3EWNA 3CISA 5G0WA 1FQKA 1QE3A 1T5HX 1PL7A 2AUMA 3QX8A 2VJNA 3FTNA 4PIPA 4RHEA 4KQXA 3MWJA 4P86A 2F90A 3BILA 4GGOA 4Q3EA 4RCVA 3JQRA 4FYMA 5CGZA 5B7QA 1IFXA 4M9SA 4RS3A 3VNAA 3VPXA 3DF9A 2YY7A 3IR7A 2DFDA 1M6YA 1L8XA 1Z2OX 4ER7A 4JL5A 1E1DA 4INAA 3QNWA 5B55A 5KYXB 3TGPA 2QPTA 5E4YA 2FPLA 4KBFA 4FYKA 3OWXA 5EHIA 1GQFA 1L0BA 2WM9B 2QRVB 3OECA 2I1VB 3N3AC 3UBTA 4DCNA 1KPHA 4WKGA 2WWTA 2HWUA 3AF1A 4EMSA 1QE5A 2BDTA 5CJPA 4D8UA 3PCRB 1LLQA 1GYQA 2Z30A 4XLAA 2ZZGA 3G2QA 3K32A 2VNJA 721PA 2QKYA 1ABBA 3RARA 4IIVA 3UGTA 4M99A 3QW2A 3RTCA 1CF4A 3BCUA 4DSNA 4ETMA 3EIFA 1UOOA 5IVKA 1G5PA 1E8DA 5JAIA 2HW8A 1RU3A 2R68A 4KXWA 1VLYA 1BH6A 2CSUA 4NZYA 3V2UA 1UC9A 4JYPA 1K5GA 2RHMA 4PCUA 2VP4A 3HKEB 3WFJA 4QUEA 2C7BA 1XKXA 2ZPTX 4HWSA 4JEUA 3G79A 5HMLA 3V3KA 2EW1A 1HOXA 3OIYA 1PGNA 3KWLA 4CDNA 4RTPA 1GRVA 1E4YA 1P4JA 1ZU4A 1O8CA 1V3QE 4XIFA 3JXEA 1HUQA 5LPNA 2RGAA 3UFXA 2I1QA 4N3NA 1EFDN 2EDCA 1JDBC 2DVMA 1R37A 1VJ5A 2P3OA 3FHLA 5H4HA 3T9EA 1XD2A 3PXEA 4LVUA 4P93A 4P53A 4PPFA 2IX9A 5CDGA 5DI3A 1TVCA 4PNHA 4FWTA 1DXOA 2ZVJA 5FPYA 1JQKA 3SYRA 1ZXBA 3Q41A 1Z0KA 1V95A 2X0DA 2P7HA 1NXVA 3DZCA 3N8IA 3TPFA 5LNK6 1AQYA 5GV8A 4IDQA 1LDEA 3K2BA 5EKSA 3SX4A 1ESEA 1PL8A 4Q12A 1G2QA 3CPSA 5DBHX 3E03A 2WKWA 3REGA 4NYJR 5F73A 1O0SA 2ZU0C 1QF9A 4O2AA 5HDQA 4J16C 5LLDA 1NJ8A 1PR6A 1YJ8A 2ZZEA 2F1KA 1DS6A 4AUKA 4BQRA 4MQEB 1NLUA 1P0FA 3DV0A 1E9FA 3KQSA 2X3FA 3WA6A 3BWYA 4HAIA 4WKOA 5JS7A 1D8TA 1RAFA 2P8SA 3TTWA 1WB9A 3LU1A 4M1ZA 4XEHA 4LGYA 2AMLA 2R60A 2Y77A 4R8KA 4Z4SA 5EUCA 2P0EA 2VCHA 1MABB 4LY9A 1GZHB 4Q4HA 3FAZA 5KYUA 4AY3A 4CM4A 5EJEA 3HC7A 1M2VB 1JH8A 1XEXB 2L42A 3QLVA 1Z62A 1RBQA 2G4VA 1YZHA 2O2XA 3CWCA 3KVOA 1QWSA 3I55B 4GHWA 3TQCA 5C18A 2I03A 4F60A 3DFUA 4ICIA 4YDSA 5K4HA 4WD3A 1C4KA 4FR0A 4LYDA 4U0KA 2ZYVX 3GFQA 1ZI6A 4ZD6A 3AF0A 3FD8A 4JXXA 7MHTA 3I6ZA 4ZAYA 4Q03A 1Z4QA 2GJKA 4D0NA 2DWOA 1JG6A 2HL6A 5I7VA 2R1TB 2QX9A 1QMGA 3EIQA 3P0JA 5KYWB 4DDUA 1Z18A 3FJ1A 3ILXA 4H0NA 5EERA 1I80A 1JDZA 1GA1A 1NN5A 4Z4FA 4UPEA 4QGSA 5KU7A 1T8RA 1ZEMA 4R2XA 3UCXA 5A4DA 3CEMA 1QVRA 5NLLA 3DE2X 2FEXA 1QFJA 1PWXA 1ZZGA 3GYGA 2O1SA 2EDAA 1T8UA 3ICPA 4NE7A 4J16A 5MF6A 2C7RA 4Q1CA 2DYIA 2VRCA 2QTZA 3FMIA 2ZBFA 4RPCA 1DAFA 4MKZA 4I4TA 2O8CB 1XJ0A 2W4IA 4CW7A 4NBWA 2XDAA 2LVBA 4KW7A 2IYUA 4FM9A 4FZRA 4IGEA 3KXKA 1D1TA 2IOFA 1Y8AA 3DO6A 5LZ8A 2Q4RA 3GLGE 3V2GA 4C3OB 4Q4JA 4KOEC 1VB5A 2G1KA 5TV2A 4IS3A 2WD8A 1R6UA 3MJSA 1JALA 3DHNA 4Z9BA 4YJ2A 2M2IA 1PHPA 5AW9A 1G8AA 5C8YB 3LYLA 4RELA 3GD5A 5KYVA 2W0SA 4CL3A 2IJGX 5F9HA 2JGDB 3NM5A 5CXXA 4IDHA 4WNYA 5H81A 3DLIA 2WHQA 4X54A 3T9FA 3NEYA 3L4SO 1G59A 4DBLE 2IBSA 2JFFA 3M8KA 4P4UA 3CLSD 4E0BA 5IMSA 1W6RA 3GLHE 1AHPA 5DB4A 4MQMA 3E9EA 4PG4A 4AYXA 4HEJA 1GNRA 3BWMA 1DOAA 5K3CA 2BE7A 1O97C 3RSCA 3HU3A 4LF4B 1AUQA 3ENZA 5CH3A 3ZVKA 1AV7A 3KKOA 4ZTZB 5E6SA 4GE0A 2LZ0A 2NO1A 3NTVA 4R6XA 3DZIA 5JZMA 1NUQA 3WSVA 5K8VA 4TWBA 4UE6A 4AF7A 2JVIA 1Q1ZA 4TRJA 3EFEA 2HK7A 5TPWB 1U0TA 6REQB 1GKLA 1KYTA 4Q48A 5BMVF 2EF0A 3SMQA 2Z58A 4LGVA 2RGEA 4MXDA 4OHXA 3N2NA 5FOUA 4ZYZA 1YR7A 3OKFA 5BWOA 1Z47A 3WLEA 5IDXA 4ENVA 4A36A 4BQIA 1C81A 3MTDA 4LY6A 3B6ZA 2C2WA 4M1MA 5T3YA 2XMZA 1SBNE 3R7FA 5C1OA 1Q2XA 1HV8A 1WXHA 1UPCA 2VQDA 4DZTA 1JDVA 1HORA 1COWD 1YCGA 4CV0A 3TQRA 2TS1A 4IIJA 2B2XA 5ENVA 3V55A 3VDQA 4OMFG 2HA6A 3MN1A 3KR1A 2ZWIA 2PLFA 2A5JA 3LVFO 3TQFA 3L1VA 3IERA 1Z3IX 2IPNA 5FV7A 3IQXA 4B7UA 3U7FB 2AXPA 1OAKA 4R3NA 4HNHA 5CB4B 2V6IA 3BT7A 4FZJA 4FCTA 2JLZA 3U3JA 2NVUA 3T7KA 5JSQA 1Y9ZA 3AZOA 4KR9A 2DFVA 1N2GA 3GRCA 1WULS 3NFRA 2KW5A 1PFYA 4HKTA 4UUQA 3Q0IA 5JIBA 3C5HA 3IJEB 1ECCA 4YYZA 4D41A 1W75A 2QZJA 4XONA 3F78A 4TLMB 1UXIA 4C0AC 3B51X 3KTAA 3KVYA 1R0WA 2WFMA 5JLAA 1Y6GA 5K4AA 3IC5A 2Q0HA 3L9WA 2OAEA 2C8LA 3NHZA 1W52X 4B3RB 2ZR7A 4W99A 3RUPA 3GWZA 4QEKA 3BSYA 1TF7A 4MKRA 3ENWA 4KI7A 5EE1A 1BZYA 3I45A 1Q1EA 1YRWA 4J3FA 4NXNB 5B7NA 2QXYA 4XL9A 1ZINA 5T8KA 4G0NA 4CODB 3PDWA 3LA6A 4ZZ1A 3UFXB 4JBHA 2A84A 4RWEA 4IV5A 4HS4A 4X0CA 3VRHA 4UOZA 4TZ6A 1TJNA 4P33A 1GGKA 3FM9A 5I01A 2C5HA 2DKOA 4X1OA 5K0CA 3U48A 1ISSA 3CCCA 5ALTA 4NHEA 4MKHA 1TJ3A 5AVXA 1QH1B 4E5VA 5HKOA 1DT3A 2RHJA 1KR5A 3ZE7A 1WKCA 3I2HA 3MB8A 4OXRA 5ER9A 3WL7A 3VU1A 5LBIA 2VDNB 4RY0A 5F51A 2WWWA 2JBWA 3L46A 1JPUA 3UT5B 3VJLA 3AUKA 5CBPA 3COJA 4BO1A 3IRVA 3TL6A 4G0UA 4DLUA 1IEWA 3EPLA 2DECA 2O9JA 1A4UA 4GBMA 3DDOA 4GIBA 3Q2OA 1YZUA 5EEGA 1RM0A 2WC1A 1N25A 4F6LA 1C0LA 3D6AA 1G3UA 2C3MA 3RSQA 1WCWA 3GPDG 5FQOA 3RIHA 4ROTA 3SSOA 2WEKA 3ZJYA 5CA1B 1MRZA 1HLGA 5ALVA 5KSPA 5IHXA 1EWTA 5ALIA 2E4XA 2QSYA 2QRVA 3QLEA 3D59A 1V8DA 4M7PA 1ECGA 1Z07A 2PBZA 4IDFA 4D9JA 3EUWA 3VISA 3WRXC 5C35A 2ZXHA 2C1EA 2HQOA 2IY7A 4PCLA 3UY4A 3ZGLA 5CJJA 3PUNA 4C7KA 1DAHA 4C6TB 3ZBTA 3M9XA 4DEXA 1J25A 3G7UA 3NNNA 1W5AA 4J49A 4L51A 1V16B 3BMOB 5B3AA 4CR7A 3G6WA 1YS6A 2QD3A 4ZO8A 3KT3A 3I3OA 1FUUA 2FE4A 4IOJA 1JR3A 3FNHA 4XSHA 3SS9X 4TVBA 1T3GA 3VR3D 2PMEA 3QE9Y 2G5CA 2CLKB 1N7JA 3QBEA 4JDUA 5E2BA 3R3YA 2GZSA 1KC8D 2WSSD 2JJ1D 2VYQA 4DCCA 3ZE6A 4YJFA 1W9HA 4DLTA 2R1VA 4MDHA 3AF2A 5HDBB 1VE9A 3ESYA 3KB2A 5JCOA 4EBBA 2HBQA 4AJIA 1URPA 1F9AA 1ESMA 2R62A 4NENB 3WQRA 1C1XB 2XMGA 3GEIA 2WUGA 2B92A 2AVNA 3G9TA 2O48X 4YN3A 5I7HA 4L3WA 4XLTA 4EJSB 1X80A 1HYEA 5EYPB 1RPZA 1PDOA 3VZDA 4NMXB 2HF7A 3OEED 3TDKA 3P2OA 3C4JA 4B83A 2CCJA 2W2QA 5DWDA 4GL4A 3D6HA 3S2ZA 1CUJA 1JNXX 3AU8A 4UHDA 1DMSA 1PEKE 1P39A 3UIEA 2I6XA 4M9QA 2D0OB 1MNAA 3P9CA 4IJUA 4KL8S 5EP4A 2A4MA 3FIUA 1Z5ZA 3WQBA 3O3OB 4FQ5A 3U44B 3HWSA 1E2QA 4WPGA 5KTSA 1LH0A 4HATA 2I91A 5FI3A 3HVHA 3LQYA 4GFDA 3T12A 1X38A 2J87A 3I5AA 3KLBA 1GPBA 2V7WA 3TLYA 4L57A 2X53S 4HQFA 5AXCA 1LF0A 2IOQA 4UFNA 4V0KA 4ZEMA 4GLFA 1R0XA 4B43A 4Q18A 2AG6A 3VFDA 4L5BA 3AM4A 1MB4A 4X07A 1XAJA 2GAJA 2JFPA 2ZS7A 3O8BA 4QTXA 5CTAA 4MVWA 1RJWA 4BUZA 2PWZA 2WF7A 4JLNA 5A2GA 2XVAA 3DCYA 2BEWB 1CB7A 1EHCA 2P9CA 2PX4A 3RIMA 2ODPA 4Y3UA 4CV1A 2NMVA 3E8MA 3EXIA 2PKXA 1BXRB 2GT1A 3OZBA 3ROEA 3ZIUA 5BVHB 4DS3A 5C80A 3BXGA 4NJMB 3AEKB 3R0QA 2VDWA 3OO0A 1YRQA 1RXCA 2D2VA 5LYJA 4X1YA 1AH2A 4ZI7F 2OL4A 4RXTA 1JIKA 1H85A 3KSBC 4M9XA 1Q7BA 3WMEA 4PNZA 3DR3A 3E4DA 4MUBA 1EFAA 3MOSA 1E4OA 2K7FA 4RXMA 3OIWA 1M2VA 4BN0A 5F12A 4N41A 4RLSA 4XQ9A 4R8LA 3WSWA 1QQAA 4AVZA 2PKQO 4F3NA 2CJWB 3C6KA 1RJEA 1ZSVA 3BJMA 2ECOA 3I2KA 1JDSA 3OIGA 5TF0A 1N6LA 2JD1A 1JEOA 1FFXB 1NX9A 2FFRA 3PVZA 3WNVA 4NYIQ 5A4KA 2WWVD 4MYUA 3LT5A 4TV8F 4UVHA 1F4PA 1T0PA 5TQ2A 4G25A 3ETJA 4LXHA 3ZQ4A 2BTOA 5JNSA 1XEWX 2AFIE 1NVKA 1LS1A 3OM9A 4WXYB 1RJ9A 1YFKA 1OQAA 1BWSA 2H29A 3I8OA 5ES3A 1L8AA 5EJAA 4DEYA 5BWBA 2OHHA 2ODTX 1FXWA 1RAGA 2ZSIA 4MIOA 3T5TA 4GP7A 1AO0A 4JI0B 4QXRA 3W8FA 3T7DA 2X1VA 3JYQA 1QQ5A 3U6BA 3QX3A 2C4TA 1VKZA 2ZSJA 3GJTA 1UFOA 3FOAA 1YE8A 3V4FA 2ZTSA 3ENQA 3WBFA 4RDXA 4BPBA 1RHMA 4RTNA 1PVOA 1EFLA 4CN9A 1EGAA 1RYYA 3G49A 3WYBA 3PQFA 2LCQA 2HUPA 1FXUA 3U80A 1K0FA 1GT6A 1PYGA 4BRSA 2GZRA 1MC1A 1O9GA 4NE9A 4D97A 3L7NA 1U04A 5KJFA 4BVJA 3C85A 3A36A 2ZJFA 2H5IA 5LYJF 4MWZA 3ZTYA 4P8RA 4H7KA 1LFAA 3SJ7A 3GRFA 3WZMA 4I55B 4DNXA 4QOGA 3RYTC 1IOVA 4LX0A 4NLLA 1WOSA 3FZQA 1PJQA 1VJDA 2BFAA 1NQWA 4CMBA 4XIIA 1Q0ZA 3ZE1B 4EX7A 1M2KA 1KH2A 1R66A 3BIWA 3NXSA 4NCAA 3THOA 4EKNB 5GGYA 2TRSB 3UJDA 6ABPA 2DEUA 1DTSA 1RR6A 2YDXA 2FMKA 1KAOA 2MSNA 3HO8A 4Z86A 2BF7A 2X1HA 1LNQA 1N2BA 4JI6B 4H1WA 3EXFB 2YZGA 3FNRA 1YQTA 3FZYA 4NYIR 1GDHA 4LPKA 3PFHA 3Q6NA 1MTOA 4H6WA 5IH3A 2PG3A 3V8RA 4MWTA 3SS8A 4MZXA 3BD7A 4FYPA 2B3DA 2J08A 5AXDA 4QNMA 3Q8XB 3OT1B 4AYTA 2W6MA 5IAOA 2C95A 1OF1A 1I9GA 1PHRA 3DOFA 3I28A 4FC7A 5FULA 2ZJ7A 3PC3A 1K06A 2JLCA 2Y1EA 4KUHA 4LBYA 1NBOA 2PMCA 2IPAB 4YA6A 4YQYA 2CVQA 5FTMA 5JADA 1R27A 2Q4BA 3A6FA 4UXIA 4DNRB 3AGQA 3C5VA 5EWLA 2XQVA 3K70C 4P3IA 1J5XA 1YZVA 1B73A 2RHGB 3A4YA 3LP6A 5LUBA 1DP4A 3CMCO 5HZGA 3ZWAA 3A7DA 5D6OA 2G9NA 2KLHA 2XD4A 4QAQA 1YZGA 2XGOA 2AX4A 4TT3D 1W88A 1WUJS 2FTKE 2YMMA 4UMFA 3KUUA 4MYDA 2PGXA 1VXOA 3TQOA 4QJ3A 4J0FA 2HK8A 3LXXA 2AC2A 1U5BB 3C3PA 2H4ZA 3EGDA 3TBFA 2NPOA 1IK6A 1CZNA 5TQ0B 2FG6C 2XGGA 4BRWA 1D2NA 2HT1A 3LSTA 1KI3A 1CKEA 1C30B 3EDYA 5I5EA 4LBWA 3HFGA 3I53A 1DHTA 1CQWA 1UKEA 1VBKA 4IRXA 4UEWA 3UUEA 1UMBA 3WLKX 2OYSA 4I8DA 3KFLA 3R09A 4E5DA 4DJJA 3KEFA 1EFVA 3QVGA 2JIOA 4RIFA 1LW6E 2FR8A 3ROPA 4DCPA 1NE7A 4E46A 3IV7A 4I9HA 3BX1A 4HCJA 1T5DX 4TRRA 2R6JA 4UU8A 1XFAA 2VQFB 1UKZA 3R3XA 4GPAA 1GUYA 3O73A 1G4HA 2QTMA 1UJNA 3HMKA 3KL2A 1PG5A 4KWHA 3UM9A 1Y5NA 1FNDA 1GA4A 1M5UA 3B9QA 4E94A 4EG0A 1H0RA 2VDPB 1J33A 4I9GA 4MV0A 5CVDA 4V38A 1G7CA 2OTCA 3O8OA 3RDPA 5EQJB 1XF1A 2JLBA 3DOCA 3IEIA 5FKJA 3PCTA 4DMMA 1T5LA 2D2EA 3TK1A 4L73A 5IJ9B 3ZHRA 4WCFC 1KZLA 2FNAA 3KU4A 4J2TA 4PLWA 2Q5EA 5DF1A 1Y6FA 3ZV4A 4YUZA 2CHEA 4RAOA 3JAMA 5I4BA 3OBBA 5ALWA 1P9LA 5IM4F 2AQHA 4QYXA 3K70D 1XXHE 2R2GA 4ZZ3A 3OPYA 2CB0A 2XODA 1RM4A 3C6YA 3VNBA 2OHGA 3GYBA 2QE7A 1KC1A 1Z4KA 3FPSA 5I9NA 2J3QA 3EDOA 3GELA 1NQ5A 2D62A 1CBUA 1FFHA 4RVCA 1XLVA 4TS1A 3SCZA 1E77A 3COYA 3NOQA 2I0FA 4ZXFA 3SXJA 2H1IA 3S7TA 4BNMA 3IOMA 2C94A 5JSFA 4Q82A 4MA0A 4CF3A 1BMFD 2ODEA 1U0OC 10MHA 3URMA