2X3UA

Ferredoxin-nadp reductase mutant with tyr 303 replaced by phe (y303f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Role of Specific Residues in Coenzyme Binding, Charge-Transfer Complex Formation, and Catalysis in Anabaena Ferredoxin Nadp(+)-Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 86
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2x3uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2x3uA02
1CNEA 1DG1G 4RD3A 3ZZTA 3CB4A 1A8PA 2OK7A 3E20A 4ZGQB 4AF7A 3JQQA 4Y9RA 2YWEA 1VQ7B 3W2HA 1VQ9B 3CMAB 1FRQA 4FWTA 1BX1A 4YAOA 1VQ4B 2PIAA 3CCUB 3LYUA 4FK8A 1QUFA 4TMVA 4TMXA 3JQPA 3CXCB 1TVCA 4RD1A 3U2QA 1JJ2B 3U6KA 1YJNB 1FDRA 2C78A 4ACBA 3OJWA 1YHQB 2GQFA 1R5OA 5JBQA 4M53A 1S72B 1DDIA 1VQMB 2OTLB 1VQ6B 3AVTA 1B23P 1D1NA 1GVHA 3FPKA 2YWFA 3WXMA 2DEUA 4ZCLA 3ZBTA 1J9ZA 4TMZA 2YWHA 2BPOA 3OZUA 3CMEB 4ACAA 3B82A 1YI2B 5TY0A 1JA1A 1KK1A 3LO8A 5AN9A 2B7BA 3G4SB 3I55B 5GV8A 4P3YA 4MYTA 4BPRA 1FNMA 1KRHA 3VO2A 1NDHA 2VNJA 1F60A 1AMOA 4AF6A 1EFCA 1EP3B 1BQEA 4NCNA 2BVNA 3WNDA 1K8AD 2QTZA 3E1YE 1ZM4A 3OZVA 3CC7B 1H85A 3CCVB 1Q82D 3CCLB 1QG0A 1B2RA 1K73D 3WY9A 1H42A 3AVYA 1ZM2A 3SJZA 1QFYA 4PC2A 4LBWA 1QFJA 1G7TA 3MMPA 1VQ8B 2HMAA 4LBVA 1ZUNB 1IJFA 4YAFA 3CCSB 3OW2B 3W2GA 4TN1A 4QHYA 4ZCMA 1FNCA 1N0UA 4DQKA 1E62A 2ZITA 2GPJA 4R71A 3CD6B 3CC4B 2PMDA 4TMWA 1JNYA 2EFGA 5TR9A 3W2FA 5TV2A 4UAJA 1W34A 4RCYA 1YITB 2DERA 1KK2A 1EXMA 4RD6A 3WBKA 1W35A 3W5HA 1CQXA 5EMNA 1WDTA 2HDNB 3CRZA 2QN6A 1KTVA 2QA4B 3U6BA 3ZC3A 2BGIA 2VYQA 3LVBA 1NJID 1VQOB 1QH0A 4YAUA 2QMUA 4ZCIA 2CNDA 1VQNB 5H59A 5KSWB 2VNKA 4B44A 1ZM3A 4B43A 2X3UA 5H5JA 3G71B 3QE2A 4QFMA 1KD1D 3VNVA 1QGAA 2VNIA 2XNJA 3WNCA 3CCJB 3LRXA 1SM4A 3CCMB 4RD4A 4ZV4A 4PC3A 3W2IA 1QFZA 1OGIA 4YHBA 1W87A 3CCQB 3AVWA 1EP2B 4M2LA 2QEXB 5HXBA 3VO1A 1GAWA 4RD2A 2BMWA 1U2RA 2BM1A 2BN4A 1QGYA 4NBSA 1G7RA 1TUIA 2VZLA 1GJRA 2CRVA 1QVFB 4PC7A 3WNBA 1N8RD 2D74A 1JB9A 1EWYA 4Y9UA 1Q86D 3W5UA 3I1FA 4G5GA 4G1VA 3MCAA 1G7CA 2B7CA 1EFTA 1KK3A 2YWGA 1TTTA 3CC2B 1FNDA 3MHPA 4Q7JB 4RD0A 4B47A 4B4DA 3AGPA 2QTLA 3A1FA 1SKQA 1W2BB 4PGOA 3WYAA 1R5BA 4J0QA 4PC1A 1VQ5B 2C77A 1ZM9A 2J7KA 4WQMA 4M1KA 3ZBUA 3G6EB 4RCZA 2VNHA 3VMFA 3AVUA 2E1RA 4TMTA 1BJKA 4H9GA 3QFCA 4P6VF 4ZGNB 4F7DA 2BGJA 2RC6A 4AC9A 1DDGA 1HA3A 1Q7YD 1IJEA 1GR1A 1E63A 3CCRB 1VQPB 3QFRA 2OK8A 1I7PA 5GV7A 1ELOA 4HE5A 2EIXA 3AVXA 1QUEA 4G1BA 1K9MD 4FN5A 2BV3A 3P26A 1DARA 3P27A 3QFSA 1QVGB 3PENA 1M1KD 2DCUA 3OJXA 4EH1A 4C43A 1M90D 3CCEB 3ZZ0A 1FRNA 1XB2A 4M4SA 4N3GA 3W2EA 3I56B 1OB5A 2XEXA 1OB2A 1UMKA 2BM0A 1G7SA 1AIPA 1QX4A 1EP1B 1KJZA 4YAWA 3JQRA 1VQKB 1E64A 3B78A 3AGQA 3FJOA 1D8TA 3ES9A 2B5OA 1YIJB 1FNBA 3CPWB 4LC0A 4YALA 2PLFA 1KK0A 3AVVA 2XNCA 2BF4A 1Q81D 1TLLA 2RC5A 1GAQA 2FX3A 1N0VC 2R6HA 1JA0A 4N3NA 2DETA 2NPFA 5DSZA 4Y7CA 1CNFA 1F20A 2QDXA 2BSAA 4HE6A 4PC6A 1YJWB 1XE1A 2HCJB 3WBJA 4U9UA 5THXA 3ZZUA 4RJLA 1D2EA 4B3XA 4DQLA 1GO2A 3B8HA 1VQLB 3QFTA 1R5NA 2AHOA 3QSYA 1KC8D 4M0LA 4B48A 3CW2A 3W5VA 4LBYA 1S0UA 3J81k 1QGZA 4MYUA 1YJ9B 1IB0A 4C0SA 3OZWA 4LBZA 1KQSB 2OTJB 1BX0A 5FA6A 1EFUA 3V76A 2DY1A 3VNUA 4K1XA 4IW3B 1OGJA
chains in the Genus database with same CATH superfamily
1GNRA 3N86A 4IGFA 5H9VA 1UXJA 1V2GA 2BGWA 2OVFA 5AKZA 2WBLC 2YXDA 3WMXA 3AHCA 5LNK6 1HO3A 1W5FA 1XLUA 1KO7A 5KB3A 3BBLA 4ARBA 2Q3FA 5M34A 3PQ3A 4ZCRA 1RMYA 3T9FA 5HF5A 1Z88A 4I9GA 3V8MA 1ZITA 4DYHA 4G0VA 3GT4A 3CF4A 4UD6A 4ZAFA 5JXJA 3T3EA 3BWVA 2X2FA 5I48A 5AVQA 1EFLA 4Y6PA 3JQQA 3PGLA 5ELXA 3MA0A 1WUIS 4RPJA 1E77A 1E20A 1IN8A 1TAGA 3V2IA 1QF9A 3CPSA 1GSAA 2X7HA 2VF7A 1OVMA 2FDCA 3E5NA 1NSTA 2CW5A 3HADA 4KBGA 4UE2A 4CLRA 1AKEA 3D8HA 2J48A 5AK0A 3VU9A 4FK8A 2GSDA 3P9XA 1Q15A 1FP4A 4I50F 2TMYA 4DA7A 4YDQA 3B6JA 5TRDA 1LRKA 5BV7A 5F1KA 1TEVA 2EJWA 5TVKA 1S2DA 3N7TA 2IXGA 3M9XA 1PFYA 3OA2A 4EG5A 2ZSUA 3OU7A 2IHVA 2JBHA 4U2FA 4BQRA 4DKXA 3ORQA 1E4VA 3OIVA 1CZKA 5EMLA 1OXXK 4YPVA 4JX8A 4CM5A 1YRBA 3UUFA 4E2XA 1XRJA 2CXSA 2GN0A 2NUPA 3SX4A 3PE6A 1ZD9A 5CTJA 1Z83A 3ML1A 3RCBA 5LXTA 3D4LA 3O3NB 5GJCA 4RXUA 4ZDJA 4C0XA 1NW7A 5EHGA 4G0UA 4NENB 1WPQA 1JDSA 1XMOB 1Z26A 4Q1DA 1RZVA 2X9NA 1CY4A 2BRUC 1ZH8A 2FSFA 1EXNA 3FIUA 1ZK2A 2G9ZA 2WI8A 4ZT6A 4JSRA 5JBIA 3VR4H 3ZBTA 4FX5A 3NPAA 4M9RA 1J9ZA 4YMUA 3EHEA 3JSAA 3CKKA 5COBA 4Q24A 4Y0VA 1ICEA 3TZHA 3BWXA 1OASA 4KWHA 2B4KA 4YROA 2CXRA 3F67A 3OEEA 5DBGA 2OD2A 1ISFA 5HIKA 3GAAA 1EZ1A 3AYXB 4RM2A 2Q6VA 5EI5A 3ND8A 5CCXA 5AN9A 1WSAA 2E37A 4AT1A 1WCXA 2NMVA 5KTMA 3WMWA 3FF4A 1VJCA 1P75A 2GZ3A 4H1UA 1ZD8A 4MLZA 4O2AB 1M2HA 4UDNA 3STHA 5BMVF 2VNJA 4RTQA 5GINE 1G5QA 3NYQA 2W11A 1VL5A 3E27A 4W1SA 1E9RA 1B6GA 1TXGA 2NQ2C 3IAFA 2CNWD 3DMTA 4F93B 1DAFA 4BNVA 1B15A 1UBKS 4DDHA 1ZD3A 3SYLA 3UW1A 4PQEA 5IM4A 4N7BA 3GH1A 4XUEA 4NZZA 4B7AA 1TO2E 1QP0A 2PV7A 3HR4A 1G1MA 1SIBE 4IVNA 1PW7A 2VP3A 3ZE7A 3GG9A 1N77A 1M2NA 3BICA 4PTYA 5D5HA 2WNHA 2LUOA 1Y5NA 2UZ1B 4DPKA 1Z47A 2PGOA 1K73D 3K94A 4FR5A 4G67A 1QIFA 4R2HA 2GEDA 5DGDA 1P7VA 5CEEA 2AC7A 3P8ZA 3NQ41 3EIOA 4XUGB 5AQEA 2JAUA 4EI9A 2Z6BD 3B6ZA 4JNCA 1P31A 2JZNA 4OATA 2CXTA 1A9RA 3TLGB 1KXJA 1KZHA 4PHHA 4EB6B 3NDPA 4G7WA 1RRVA 8MHTA 3TW0A 1GLVA 3DT8A 2VJBA 2Y0DA 4PRYA 1QDUA 4NOJA 4XX1A 5DTIA 1R6TA 5EIHA 3MWEB 5DBHX 3TL6A 4D0RA 3ETNA 1TZCA 1EVQA 5DP1A 1GTSA 1KI2A 5TQ2B 4PYMA 4NEGA 4ZCMA 1KJIA 5A03A 3FPHA 3K1AB 4HDSA 3A6FA 5FV7A 1T9HA 3VC3A 1E0AA 1KBZA 2PEZA 3U7HB 1BXRA 4DSZA 1U3FA 1U3WA 5A6SB 4ITUA 1DEOA 3GA7A 2ZM6B 4YECA 1GZHB 5KNBA 4FB4A 3L6BA 1Z2PX 2EW8A 5CCDA 4B7XA 1P2GA 1QU2A 3DFIA 1H5UA 1Y8AA 2X8AA 1K1EA 1JJ7A 1QE5A 3H2YA 3RC1A 4PO3X 4BMPB 4TMWA 3S40A 2BBTA 3ONUA 1JMKC 3Q3VA 5HZHA 4DR7B 3KSZO 4ZDIA 1EB9A 3MBIA 3BMOB 2Q50A 4XQFA 2C9CA 1PL8A 1YMVA 3GLIB 2QEQA 1XCPA 3OOWA 1D2HA 1M2KA 4GXTA 5JHGB 2BFWA 4YP1A 3KWMA 2Z8XA 1TM2A 2G4LA 1NPYA 1ODIA 1XQXA 1WCIB 2RGNA 4FONA 1ISRA 3FUCA 4G2NA 3W5HA 2OV1A 4JUDX 3W6ZA 4ZWNA 5B12A 3DMDA 4I3GA 4DWWA 2WTXA 1NW4A 4AJKA 1R7RA 4OY3A 1IMJA 1BKYA 5HFAA 1A98A 1GQOA 3DP7A 3DCYA 2Q7XA 3NDJA 2C98A 2XB9A 2XKKA 2IXEA 3ISXA 2IX9A 1USKA 2J85A 4LTMA 4ZYVA 4WEOA 1MABB 4PLTA 4ALKA 3LP6A 4PCLA 3KVOA 1Y6QA 3O03A 5H4HA 1YR3A 2P35A 1GXSB 1JHMA 2QI9F 4LGMA 4YAUA 3KUXA 2ZTMA 4MUMA 5AT1A 3VHQA 4FMBB 1AN9A 1NVEA 3F7MA 2V6IA 2ECFA 4HQ6A 5D1NA 2P69A 3GIDA 1PDVA 2H7CA 5IUKC 1HNWB 1GL7A 3ADPA 4XD2A 1VB3A 5GJVC 3SYTA 4GZ3A 3PNYA 1OZHA 2GN6A 2QG9A 1EDBA 4N9QA 4E5NA 4B34A 3P9PA 3PXDA 3HYCA 1T36B 3R9XA 5IC5A 4JUBA 3TSZA 2BISA 3KYBA 3QTTA 3E3AA 3GGDA 1CLUA 2V7UA 2AFIB 4AROA 1JEOA 4JLSA 2FZLA 1AKUA 1W49A 4B3RB 5IYZF 4I4TB 2WA1A 3QEMA 3FPBA 4G5YA 2AI2A 4GHWA 1YH3A 3TSAA 1KDYA 1L4GA 3GJZA 2V4DA 4KFRA 4IXDA 2WAXA 2EIHA 4WADA 4Z7QB 1OGIA 3FVVA 1IC6A 2J4CA 2YJTD 3EVAA 3TPZA 1XIVA 3GZNB 4AY4A 5C4IA 3ELUA 1XBTA 2Q0XA 2D7CA 3HB9A 4HQKA 4O0MA 4DWOA 2ZVPX 3SU8A 4W1QA 4WASA 5HIAA 4XTCS 4OMFG 4PNPA 3IOBA 4IX9A 5CX4A 2PD4A 3TLKA 3QHQA 2R1ZA 2WVAA 1MT0A 3C2QA 3LYLA 2FF5A 4LW8A 5FBQB 1EWQA 2CLIB 3EGEA 1D2AA 4TV8F 2ZJZA 4UBKA 3LF2A 3TZBA 1N57A 2XUIA 3PEEA 1GRQA 1JXQA 3BNWA 4H08A 4HZUB 4TKLA 4D0NA 5FO1A 2V7TA 1E5XA 2R84A 1YJCA 3HJUA 4I1VA 3T4XA 1TECE 1WXHA 4FZRA 3VBCA 4BFYA 4B3IA 1EK2A 3UPUA 2AUMA 3A4MA 1FK8A 3DAYA 1XXHA 2V1XA 3D7MA 3GI1A 3O4RA 1XVUA 1XLTC 1PYDA 1OFTA 3A9SA 5LD2B 1V16A 3EPHA 5LWHA 1UDRA 5K3SA 3JYNA 4KUEA 4QU9A 4ASUD 3D6UA 2WWHA 3GDHA 2A86A 4AB1A 3PCRB 3UNXA 1ABBA 1L8QA 3DE5X 4G6ZA 4R1OA 5HKBA 3WQBA 1VSQA 1JDBB 3IOYA 4I5DA 4BMCA 2JGJA 2OCKA 4OAQA 4WL0A 2G8NA 3KLBA 2QNIA 2V4ZA 3CV3A 3R9IA 5BXYA 1L5FA 1DBIA 1SXJC 3ELWA 3PEYA 2D74A 3STWA 3ISTA 2KLBA 3PDUA 2DWQA 1Q86D 3O8CA 4DB4A 5JIBA 3GEEA 2PMWB 4O4IF 4EUSA 3TQFA 4CMIB 1F9AA 3CF2A 5HEKA 2PLWA 1MR3F 3A2NA 1KY4A 2YN2A 4MW4A 4G1VA 3MCAA 1CUYA 1D5WA 1WMAA 2A4MA 3SQLA 4B76A 1MHTA 1V3VA 2EDAA 4FDAA 1QYXA 3QVGA 4R05A 1NBHA 4Q7JB 5DM60 5BSEA 1GAEO 1C5KA 3OT1B 1UOQA 4GW3A 1GPAA 3I8XA 5I9MA 2FQ1A 3BULA 3T4EA 2FVXA 2E4XA 2O7RA 2XKAA 5AI0A 5JVDB 4EAAA 3G2QA 3P7MA 1C9YA 3QVJA 4JH0A 2FMFA 3A1FA 1P5ZB 4LRUA 4QXOA 3HN7A 3DNPA 1E7SA 4LYEA 1XCLA 1B3RA 2AHRA 1IG3A 1GTZA 2J6IA 2P90A 1PWEA 2I03A 1A8QA 4QO7A 3BCFA 2EYQA 3P5BA 4PC1A 4HJRA 1RKUA 1C7IA 4ZVRA 3VX3A 1NBME 1WTHD 2W9XA 3VVLA 2EAUA 1ADGA 4IF4A 3AVUA 1PQPA 4JQCA 2BEUA 4N8DA 3L8FA 3UAZA 1ORDA 2WIKA 4HHEA 4MGIR 4NBLA 4P12A 4PXAA 3COVA 3CBGA 3EPJA 3D7KA 4C4ZA 6ADHA 3ESAA 4Z4UA 4C3OB 4BUJA 3WWDA 2D59A 2IIBA 3LECA 3K9BA 2ZUWA 2Z8YA 4L6CA 4B32A 2V97A 2OM6A 1E3WB 4CKXA 4YJFA 3VV2A 5L4NA 3F6SA 2D5BA 4QM6A 5F21A 3KKKA 4MO9A 1QCZA 1V48A 4RHFA 4MWOA 4MUBA 3G13A 3IP6A 4FGLA 4I14A 1ISSA 5EHNA 1JDUA 2IF0A 3BE4A 7REQB 2Y67A 1N8KA 4XE5A 4PHTA 3LUCA 2UYQA 2WTAA 3BRQA 3AWIA 4PN7A 1NQTA 4JK3A 1WU8A 5KMGB 4Y2RA 2NU9B 1KP2A 5J59A 1TJNA 3QU9A 1RPTA 1W85A 4PYQA 2YMMA 1ORVA 1U8FO 5AI8A 5JG7A 3SEQA 5JS6A 1LNSA 1H6DA 1X7ZA 3DUFB 3EXIA 4GZ6A 4OU5A 4NOMA 4UATA 3L4KA 2PR2A 3H05A 3QX3A 2XMDA 1YCGA 4JJFA 1MJ5A 3EBLA 3GMDA 4KCGA 4N5IX 1KQNA 2VVTA 2B94A 3QXJA 1WF6A 1M8PA 4ZVKA 1HVXA 1CK4A 1ZNZA 3PNSA 3WBBA 5MN6A 3FDFA 3K05A 4QO8A 2IHJA 1PR6A 4FMCF 4DCGA 5IG2A 2BFFB 2BM0A 1LBIA 3GRPA 1P8JA 2JFQA 1MOZA 3DZFA 3IIEA 2AJTA 4EFLA 5BN4B 2JEOA 3HYLA 5G41A 3HCOA 3ASRA 3GHYA 5HK8A 1PJSA 4F86A 1GKYA 1R0KA 3DDSA 4EYSA 4HXFB 5EKXA 1BVUA 3EC1A 4NHEA 5TPWA 3STTA 4EMSA 5H80A 2J5KA 1D8TA 2ZSDA 2PAFA 2R97A 4R2LA 4FFVA 1IG0A 1E2HA 1P1CA 1OI3A 2YR0A 1T5DX 3HUUA 3T54A 4LGYA 3PX2A 3ICWA 2FNAA 4Z4TA 4IRMA 3WLHA 4CKWB 1Z4PX 2DE0X 4AW9A 1SUIA 4PANA 2W83A 3S27A 4DILA 4F21A 2XF2A 4MPRA 4IEFB 4XWAA 2C2BA 2GJKA 4DDMA 1ID8A 3D0KA 2IY7A 1ZINA 2YZ7A 2XT0A 4F4CA 4Q48A 1IHUA 1H9AA 3J7TA 3O75A 4RK0A 1U02A 4B84A 4MWBA 2P9EA 1LBSA 5E1BA 2H1SA 2AMVA 2OBXA 1K0FA 3L8ZA 2LE0A 1AC5A 2R6HA 2I4IA 1YE5A 3MS4A 4OA5A 1Z2EA 4HMPA 4PYLA 5HF6A 4Q66C 1D8AA 1HL3A 3L7DA 4ARZB 1JU4A 3I37X 4UCXA 3LXXA 2B1JA 4DEVA 1SKMA 1Q44A 1TO1E 1XE3A 5DSZA 1H2YA 1OA0A 4AJEA 2HT1A 2CHUA 1I1QB 2G72A 3FF1A 2II6A 1S89A 2MIIA 4YJ3F 4ATNA 3COJA 3QLJA 3KR2A 3WIOA 1BE6A 1XZAA 1Z33A 1XA0A 4FDTA 4EHHA 1UWLA 1F20A 4I50B 3QU4A 1GZDA 1JW9B 1XRMA 2QV7A 3ZNPA 4Q7EA 1JEYA 3IIIA 3OUUA 2BMEA 2O59A 1NUPA 3B9PA 5ALIA 5LB4A 1M1NA 1SQFA 2I6FA 4TS9A 3WC4A 4OJQA 1KMQA 2YWXA 2P6MA 3OWOA 3ABOB 4AY5A 3PPIA 2Q1WA 4LCJA 2JLXA 3Q7QA 2NZVG 2QUBA 2SCUB 1GGHA 2GLXA 2VHVA 1UD6A 3FTFA 5TEVA 1W4LA 3U16A 2GCOB 4P4TA 2WIGA 4WN3A 3S8YA 1MV8A 2EP7A 3PCXA 3QF4A 5FKJA 1OFVA 2OEPA 1XFOA 3FFTA 3O4FA 4KQCA 3L77A 1R5NA 1Y7TA 4O33A 5KQSA 3EPLA 4M1SA 5DBFA 3AV0B 4L6IA 2ZYHA 3W78A 4CIYA 3P5SA 3G9TA 3ABRB 1MH1A 1M1ZA 1PSDA 2XAUA 3KFXA 4HGOA 1XOIA 3SLDA 4M83A 3MOIA 1Q3HA 2PWPA 3I6ZA 2NXCA 4CKEB 1W0JA 3EAFA 1RMTA 1K6EA 5CD9A 5JSUA 1JHDA 4RH1A 3V7YA 4ZMBA 2HSJA 1IZ8A 2B82A 2QRNA 4MCIA 1QZXA 1QGZA 3KXKA 2FMIA 5BMVB 3LQ2A 4RM3A 1N2EA 4CI9A 1GRVA 2PUEA 1SVIA 3CPEA 2J4FA 4LBZA 4JLWA 4Q9LA 2MMGA 3JQDA 5E2IA 2UVPA 4ZRDA 5KSZA 5DWDA 1EFUA 3ESZA 4LI3X 2AEEA 2C2OA 4E4TA 4RLHA 3K71B 4MMZB 3ABZA 1VHLA 2JH8A 2R8RA 1WA5A 4HZIA 3T0GA 3VHLB 4HV4A 1T1RA 4MZXA 3OQIA 4MV6A 5HZBA 1TYCA 3RE1A 4AI6A 2FFHA 4AU1A 5J58A 1KS9A 4AZWA 4F85A 4A1FA 5C5DA 5TARA 5HKOA 4MROA 1MXHA 4CBVA 2XZOA 3SCZA 1FFBA 2ZSEA 4JKYA 3T7EA 1U2GC 4CM9A 1B43A 2DP4E 4KIFA 3U0VA 3DV0A 3FDXA 4YCLA 2PA0A 3T35A 4F5WA 1EBFA 1P4JA 2HJVA 2JANA 3R6LA 1UH5A 1KL7A 1K3UB 3U7RA 2XOEA 3FOWA 3PVCA 3W06A 3OE1A 1NT2A 4YUAA 2JD1A 1GPBA 5CA1A 5A5VA 1JR3A 4CFSA 4TTVA 3TRHA 4NCBA 5IMSA 4X93A 3RBVA 4R8MA 4UULA 1U81A 1UJ2A 2QOEA 5FUWA 3OSZA 1YVPA 2WWYA 3MJSA 3MTEA 4NPHA 5IDQA 3PS9A 2B2NA 1IXKA 4KQWA 3OFNA 3CNBA 1IM8A 3ESRA 5LCXA 4OA8A 2QE7A 2GCNA 3G8YA 1F2DA 2VYVD 3LM8A 3D1VA 4HWTA 3A58B 1I5EA 3VZPA 2QXUA 1DGQA 3HJAA 3EZ7A 1T34A 5DN6A 5ULLA 1U1CA 1RQLA 2AG6A 2C78A 1TKRA 4MGZR 1SB9A 2V5UA 1M6VA 4G8DA 1T8UA 2Q1YA 3GJ0A 2ZT5A 1QRDA 3PC4A 2RJNA 5CG1A 1L4KA 3PJFA 4M7OA 5FA8A 1VZ2A 1ENZA 4M46A 3ROZA 5IS2A 1II0A 1J7KA 5REQA 3OUZA 1V41E 3M8KA 4I1OA 3ZCTA 4DLUA 1WBBA 2HDOA 5I7HA 4BO2A 1FYFA 1M2VB 1UC5B 1SVMA 3MELA 4QGAA 5JCOA 4BKPA 5EMJA 4KG7A 1AO3A 3OEHD 1YVUA 1ZR2A 2PUGA 4U9HS 3R8FA 5U1PA 2YWHA 2GRJA 2I8CA 2Q3DA 3LHSA 1JHAA 4N6OA 1YKGA 4X44A 3NIWA 1VHTA 4ZAZA 3UB2A 4YP7A 3IBSA 1F1BA 3HFRA 2V6GA 2CB9A 3RVLA 3A6GA 4HPJB 2QD1A 2PY6A 2YC2C 1T8WA 2Q4DA 1WCV1 4I1IA 1Z5PA 5F76A 3R6WA 1N0WA 4KGDA 3HBAA 4QGHA 1P72A 4QPPA 3RSZA 4B4UA 2OM2A 1XU7A 2DQ4A 4RE6A 5TVGA 4IV8A 4ZKEA 4AJ9A 2C5EA 3OX3A 4UHCA 1Z7GA 1WKCA 2G3YA 4YDRA 3QW4B 3WK5A 3F6PA 2NW6A 3PNBA 1EDOA 4IYRA 1E43A 2QSUA 4EOGA 4E1BA 4XLTA 2FFAA 2IHYA 2QUIA 1QG0A 3LY8A 1OLSB 2XYRA 1D04A 3HN2A 2VAXA 2P2LA 2B83A 4MITA 5IYZB 3O0DA 4TMYA 1C1XA 3PI7A 3SBEA 2OGTA 3IKLA 1XVTA 2C3MA 4DMMA 1TA9A 4EI2A 1KWGA 4M1MA 2QK4A 4YAIA 1HKHA 5G0WA 4HNTA 4Y18A 3K9CA 4LOAA 2AS0A 2FGKA 4CM8A 1BEUB 2IHKA 5L7WA 1MGPA 1AV7A 4W7IA 3TGPA 3PEWA 4LNHA 4G0ZA 4JOSA 3JRWA 1MX9A 3WJ1A 4B9AA 3CCSB 3NHUA 5D6NA 4RZUA 1DO8A 2I7TA 3E8XA 1GGNA 3R3ZA 5F2KA 3W7AA 2QTVA 3HLTA 4EWLA 2O9JA 3AUXA 3UHOA 3MPUA 4FOLA 1FSZA 4L57A 4TV8B 2CUNA 2ETXA 2GEKA 3ZPNA 5C1BA 1VHWA 2IOYA 1J8MF 4L02A 4GLFA 3UB3A 4H0FA 4QU0A 4GS5A 4D9EA 3Q8WA 2QP4A 2QWXA 1QR6A 2I2DA 2IPXA 1YB2A 2VJAA 3BL8A 3ZWCA 4BP3A 5LKAA 4RTRA 4FW8A 1T9KA 2G28A 3KZ1E 1O96A 1E6LA 1FYDA 1WNFA 1CQJA 2PS9A 3W7BA 3AI1A 1K68A 2I71A 2O7NA 1IZ0A 3HR8A 4HNSA 4TRRA 2PR7A 4C1NA 1DXQA 3QENA 5BP7A 4QQRA 3C5EA 3MJDA 2NPIA 4WBSA 3K09C 1S1CA 3AR7A 3HZOA 4IDHA 3VR1A 3CCCA 1MFPA 1X0VA 1Y9DA 4B6GA 4DIOA 1N2XA 4DNPA 3OQJA 3A9CA 1GU0A 4N4AA 3O6VA 4HYYA 3JU4A 3K72B 3SE7A 2RCNA 3ZE0B 2G9VA 1HRKA 1PYGA 1WOOA 2WHQA 4X24A 3ZLJA 3WAJA 4OPOA 1IDN1 4O4LA 4AZSA 2E6UX 4O4IB 5K0NA 5LSAA 3E7WA 2D3LA 3ZC3A 2VTVA 5BUSA 5MF6A 4CMCA 4AP6A 3PLAE 1CQIA 1F5SA 4IDQA 2VYQA 3DXFA 4DMHA 2Z9CA 2Z2XA 4HDCA 2I6QA 4RJTA 1A5SB 1WSDA 3KWFA 4GLJA 4PYKA 2VF4X 4IEIA 5IAKA 3RVDA 1A2BA 5CX1B 2DYIA 1CIJA 2FLKA 5KQLA 4JIMA 3R7DA 1IN5A 1C8KA 2XH8A 3LS2A 4R3WA 3WNVA 1QX3A 2BMJA 3NGXA 5FFNA 4BUCA 2C54A 3QX9A 3OT4A 1PS9A 2AD1A 5TDHA 4CM4A 4DSTA 1VQNB 2G9QA 2RCYA 3GEGA 2I0FA 3RO7A 1OLUB 5H59A 2W42A 2P65A 1LF0A 3HS3A 2ORWA 5T6MA 4MRRA 3D8RA 2Y2UA 4H4CA 1DC3A 2YV2A 4J03A 4E5DA 3GJ4A 1KAOA 2XHEA 5JSQA 1Y5LA 1NBMD 2ICAA 3QPCA 4TROA 4C5BA 1P1KA 4NIMA 2WHYA 3TLCA 4FJ1A 3F49S 2Y99A 1Y89A 1DO2A 4AWXA 4RD4A 4ZV4A 2Z4RA 1R6UA 3MTIA 4U5XA 2GNPA 1I4DD 5KNLA 3PHLA 1P1BA 1X0XA 3QVOA 2V6JA 2COKA 3F9CA 3ROPA 3Q38A 4A2CA 5JAIA 2M1XA 2BM9A 1Z73A 2PD3A 3VQTA 4BX9A 1QCCA 2A1IA 3FDZB 2RB4A 1VMEA 3HI4A 3WISA 1H2HA 1X92A 3NX4A 5F7OA 1KMMA 4Z54A 5KNBH 2WYOA 4PXYA 3KPWA 4RO0A 3H65A 3II6X 3MMXA 2VTEA 3WLPA 4M2LA 5BV8A 3NBMA 3DBLA 4RJ2A 1G9XA 2EJCA 2WA2A 1GLNA 1ES9A 5DXFA 5F3WB 3NJRA 1CIVA 4WNAB 4XJSA 2CK3D 2XE6A 3EEQA 3WOHA 2NV2B 1R8SA 4V38A 4A2WA 4F46A 1KIFA 1VL0A 1NMXA 4FFDA 1LFAA 3IPRA 3TUZC 2R1TB 2P6RA 3BZUA 2AEMA 3CN7A 4MQFA 4YDSA 2NPOA 2FW7A 4WWVA 3P0FA 4CVNA 3BMCB 2YQ4A 1HDRA 4G56A 2FQWA 5AKGA 1N2CB 2P3QA 4CL2A 1VHJA 1JKFA 3OOSA 1KRXA 1W47A 3ONEA 1CR6A 2DR2A 2X15A 1MQ8B 1RRFA 2O8BA 1OFUA 2AKEA 2GHQA 3SYNA 5JNWA 4JWKA 1P7ZA 3KJFA 1SVKA 4WZLA 2PRZA 5HK9A 1STOA 3OJ0A 3FR8A 4FMCB 4WDQA 5IM5A 3WNBA 4MOWA 4P58A 3I04M 1G3IA 4EIWA 2C2HA 4MB2A 3O4GA 3GP3A 3HJHA 1C7ZA 1GP2A 1LKZA 3L7MA 1R0BA 5J2TF 1YVEI 2W6JA 4BZZA 4D99A 1G21B 1UZMA 2FE4A 1VE5A 4JKIA 4RQAA 4KFCA 4EATA 1JT9A 5E9JA 3MPOA 3PZRA 5KC9A 2YWGA 1GAXA 5ICMA 3FVTA 4BB9A 4IJUA 1OB0A 1UQUA 1V3QE 4Q1EA 3R2JA 1CUIA 2I62A 3QY9A 4CF6A 3I0MA 1LVUA 5DSTA 3FAKA 1L5SA 1T6YA 3R3UA 4LXIA 2H48A 5BR1A 5CFZA 6CHYA 3RAEC 3R0XA 1SCDA 2G0NA 2VBVA 2Q2NA 2R6FA 1G5TA 3NYIA 5IXSA 1KAGA 1CQPA 3HEBA 1WNTA 4ZAGA 1IBCA 2GTPA 9GPBA 3WYAA 1WTAA 3PC7A 5HE9A 1U0FA 1Z18A 1Z15A 3L4BA 3ZHZA 1E1DA 1ZIPA 4O25A 3TD9A 1NUHA 4C3ZA 5KYWB 3RWOA 1Q1EA 3UHAA 4YPOA 5DWVA 1H1DA 3B2NA 4JWTA 4MP3A 5JZ9A 4E5YA 1L5WA 1M2GA 3EARA 3E9NA 4QJ5A 3LWNA 3TG2A 3DBVO 4MA5A 5B7QA 2ZAOA 1SEVA 3DE4X 1QIHA 1BGWA 4KODA 3DKRA 5AKHA 4BJ1A 1QIDA 1XQ1A 1F0KA 4XN3A 1C50A 1QH1A 2V7VA 3MWFA 4Y2YA 3TTYA 2XUZA 3A37A 4JCOA 1NU6A 1EVEA 4KKSA 2QVYX 2ZR7A 3PA6A 3KEGA 3NT5A 1A96A 1P5JA 1X80A 2O1XA 2V7QD 3O82A 4N76A 3RFCA 2ZIEA 3KYDA 4H1WA 4FFOA 2HRDA 2HIMA 4WZZA 5EINA 5JLJA 4EFKA 3NBQA 2EIXA 4WECA 5FTNA 3GRCA 1YO6A 1WHTB 3DLTA 4GSKA 4JOCA 4DRZA 2V65A 3H2HA 1K7SN 3H5VA 3ICQB 3GLTA 3G1UA 2XVZA 2WWFA 4MCJA 2EFEB 5B3JA 4D74A 2HQSA 4BGDA 4IXNA 2KW5A 5BT9A 5EWMB 4BV2A 5KAPA 5BWNA 5LP6F 3QFSA 4OI4A 1ZH4A 4ID9A 3IEVA 4ZN6A 4BFWA 4PPYA 4O08A 1PUXA 3BXFA 3ZGVA 2ZI4A 3O8LA 2WHEA 3REGA 2VIIA 1ZH2A 3IQZA 1JZQA 1RDFA 4ZGGA 2RKWA 2IXFA 2XMRA 3MJHA 5DXJA 1ULAA 3QELB 3RAGA 4D3ZA 5FP0A 3NHAA 4K28A 4OBXA 4UU8A 1FFEA 1VJDA 1PL7A 2ODEA 2GSWA 4G63A 5HJEA 4Q9HA 3IKJA 1JWAB 3TIFA 3U7JA 1NLUA 3UPDA 1KGDA 1ZL0A 2G1JA 3A1SA 1QE0A 3ROQA 4D80A 3PVSA 2IYZA 3KPYA 4UBJA 2GHIA 3WKBA 4ZOAA 1C3OB 4OIMA 2BEKA 3GU3A 3L1VA 2I6GA 2JNWA 1E6MA 1PTJC 3SSMA 2JLYA 4XW2A 3UICA 1XWFA 4UCFA 4TRNA 3WIVA 4XCQA 1ZIDA 2GLTA 2KPOA 3IAHA 3L0OA 3ND7A 4KO3S 1YA8A 4MVYA 2JHGA 2P9HA 3G88A 1I3OA 4R2WA 4JEIA 4RELA 4YA6A 5TQ0B 3PX7A 4LF4B 3S81A 3G8BA 4ENVA 1SC1A 5L3SB 4OLHA 1I8DA 2WOJA 1H4TA 3DDCA 3W5JA 2EZ9A 2J0UA 5K51A 5I7EA 5DOVA 5HNKA 1RLOA 1VI5A 3Q0EA 4EJ0A 2OCXA 4KK3A 1EDZA 3N8KA 2LWIA 3IFSA 3GLHA 1EGQA 3RT7A 1G6OA 4GKKB 1I6LA 4TKZA 3PXBA 4PNEA 3BWDD 5LDHA 1HBJA 1DAGA 2HXSA 3OJCA 1TQ4A 1CUEA 3GD7A 1ODJA 2RD2A 1Z35A 3WLEA 1IBMB 1SZPA 1PJ5A 3FFXA 1HDOA 5CIQA 3WFIA 4LYJA 3L01A 4OQQA 5T8KA 2J3IA 2PYDA 5FI1B 2RI1A 1UEXC 2HB6A 1H2XA 3LCCA 3WB0A 2ZZQA 3EG9B 1BS2A 3LWZA 1T10A 1CUDA 1ZU4A 2G25A 3MC1A 1GQFA 3CO0S 4G5QA 4N5LA 4KPGA 1FFYA 4FEEA 4XEUA 2QLFA 1C41A 5AW1A 4FNAA 3NHFA 4CCYB 1ECPA 1WBJB 2H5JA 5IXJA 4GWGA 4EQ6A 1ETUA 3LA6A 4K86A 5HFJA 2QDXA 5GM1A 4OFWA 1G3RA 1HLFA 4D9MA 2D1TA 5IANA 1W75A 3LT5A 1VLLA 4D6YA 5A04A 4KFSA 2RGEA 3DDHA 4B31A 1BSVA 3NHWA 2FG5A 4FHZA 5E3JA 3I6YA 1C30A 3ASUA 1SU8A 3LGXA 2GTIA 3FCSB 3M7IA 3OBIA 4E13A 2WUVA 4FOPA 3V34A 2H54A 4FFMA 4QULA 5EJ9A 3K1TA 4QT0A 3AXSA 1RXYA 1U99A 3CW9A 5BVGB 4JV5B 5KTRA 4B3XA 4DQLA 1QF7A 1UQTA 2GA9A 2O14A 1J2TA 3NHYA 3TDNA 5HZGA 1J7JA 1K66A 2F6RA 1B6RA 1RRCA 3R8XA 3U0BA 2HFJA 3QFTA 4YJ2F 2V5VA 3H86A 5KX5B 4EJSC 1NN3A 1Y3CE 1FEZA 2W48A 4TL6A 2W2TA 1WOYA 1FW8A 4TL7A 4K9OA 1E8DA 2HA6A 1L1FA 2R751 2QW8A 3VOBA 1E8MA 3U44B 1TKAA 1MOSA 5DISB 2CBGA 1E2JA 1L5KA 1U0NA 3VUFA 2ECOA 1KMCA 3AB3A 1SC3A 4IFIA 3S2SA 4YWJA 4AURA 1ZXBA 3J81k 2XCQA 3LDGA 3ICVA 2X0RA 3G0IA 1PVVA 4PG5A 5FPQA 4BNNA 1PFUA 4XLCA 3ZZNA 4X20A 2GJ8A 3K5WA 1BX0A 1E4YA 4GL4A 1DELA 4PYRA 5L4SA 3NDBB 2ZDQA 1RQXA 3NBYC 3QVLA 2PVCA 4QYIA 1QZTA 2XNKA 4IDEA 4ZI3A 4O4HF 3D0QA 1U8UA 3HEMA 1BC5A 1JEDA 4U7JA 4XIJA 3PUMA 4ZOLA 1BW9B 1DRUA 4ZZ0A 1CQZA 5DOZA 1Y9ZA 3IERA 5CYPA 1JIKA 2GJSA 5HG0A 1DAMA 3PGMA 2V6MA 1V0EA 2SKDA 2FXVA 1U6IA 3FWPA 2OK7A 4NJMA 1HLGA 4QL3A 5FNVA 5A6VA 2ZR9A 3QWIA 1IULA 1NXQA 1XROA 5HPYB 3O26A 1LCIA 1UD3A 2IVZA 2ZT7A 4DM7A 2FW1A 2P7IA 2DWCA 5DLQC 4EABA 4PG4A 2NYAA 4TL9A 2FMKA 3CLRD 3UG6A 1JKXA 1GQQA 3AU9A 3AF1A 4FWTA 1L7QA 3B2QA 5FORA 4A6EA 1X7YB 5J4LA 3AO0B 1CJMA 2M32A 4DXHA 2DR3A 2VAPA 5AVYA 5IT4A 2XNDD 2OV4A 1L5HB 1E9FA 2BZSA 1Y6JA 1EEXB 1YNOA 4X3OA 1YBMA 1JQAA 1RRPA 3DW1X 3ESQA 2YOHA 4MVJD 4WZ6A 3UCFA 5C5IA 4WKGA 2Y6VA 3T3DA 3OJOA 3S44A 4C0HA 3IA7A 5HCNA 1P2UA 4IICA 1BMDA 3GWZA 1KO1A 4UQLA 4PIPA 1VLQA 3LK7A 3DW3X 4RVFA 521PA 3GLGE 2HNKA 1XHLA 3R20A 1AA6A 4HYEA 1TQHA 3U3ZA 3UQYS 3I1JA 5JRJA 3NUGA 4YRBA 4EMTA 3K4PA 4AMVA 3EN0A 3EW7A 1R4MA 5B64A 3W5BA 1E3MA 3DKKA 2ZDGA 4DMGA 5JXWA 4BNFA 1WETA 1AKYA 3FLAA 1R9JA 3QPBA 1DQZA 1UDAA 2G5PA 4O8CA 4EA8A 4EYQA 3Q3AA 4F2WA 4E5MA 3KKMA 4WXYB 3ZTWA 1PFQA 3GV0A 5L95A 2EXXA 2LP4Y 4FKMA 3HH8A 3JRXA 4AWBA 2X7JA 1NNLA 3QPDA 3T3HA 1G59A 4BFSA 4LSGA 3FPKA 2BUBA 3TNDA 4RIHA 3G7UA 1IZZA 3R3XA 1Z36A 2H1OA 1PRYA 1ABFA 3NKLA 1V1RB 2QRLA 3GX1A 3RTEA 4CCSA 2VJMB 1BQ4A 3NBZC 2VBSA 2WWIA 4QBHA 1XAGA 1UMCB 4O02B 4ACAA 2PU5A 2NVUA 4YVFA 2RGRA 4WZBE 1KK1A 1OCEA 1VPEA 4JT9A 1QBGA 2OWDA 4K9RA 4K9PA 3GUYA 2QL9A 4RDLA 1EHCA 4M8NE 1FNMA 2IZ0A 5D3MA 1KRHA 3S0JA 5ALRA 4F4JA 5H81A 4B4WA 4RESA 1ULSA 2AQ8A 3LTNC 3OZFA 4ENTA 2EERA 2NTYC 1IRIA 1BN7A 3SBXA 3SSNA 5CFNA 4KHPB 1NWHA 3SQXA 3ILXA 4ECAA 4MIEA 1DAKA 3KLOA 1QRSA 1AG9A 4G85A 2J3QA 3DZJA 3FWNA 4CI0B 1KY2A 1HZZC 2AOVA 3DONA 4ID3A 4S24A 4FYVA 2Q07A 5A5GA 2V55B 1G6KA 2IPOA 3IT0A 2HA2A 4I81A 3BQ9A 3GCWA 4QDUA 5DGIA 1E7QA 3MJVA 4EVIA 5KAMA 1HEUA 4IJQA 1E94E 4F1WA 1S9DA 1VB5A 1CVRA 1O6FA 2JGRA 5KHAA 4UHEA 3BTVA 1ESCA 2EL7A 4PZAA 1H42A 1IWBB 4P3NA 2WWTA 1IYZA 3IVGA 2HEGA 2QAJA 2YN4A 3HYSA 2QZJA 1Z0FA 3P9IA 4RADA 5A0FA 3RRBA 1UCFA 1GL3A 3K53A 5K3AA 3BL6A 4WA8A 2B2CA 4J3FA 4WTOA 4I6JA 3MMPA 5G0UA 4DEYA 2V3WA 2AKYA 3GMIA 3OQPA 1X1CA 1ZISA 1EQAA 3NHJA 4FMDB 3W2GA 2D62A 5EZYF 3LC0A 5FBRB 5I5EA 2FLWA 2ZYIA 4ARSA 3GBSA 4TOIA 1N6LA 2P3OA 1ULUA 1SQ5A 4BEWA 1GG8A 4ND8B 2C61A 3WOVA 1XDGA 2WKWA 1E62A 4BYMA 4JI2B 3ZVKA 2ZYSA 3OQBA 2H0QA 4U2EA 5JNLA 1CULC 1DAOA 4UUPA 1WCYA 5K8CA 5MGNA 1YQXA 4CKCA 3QRWA 4XDZA 3IPLA 2QD5A 5ISMA 2YS6A 3IV6A 2BFDB 2IUYA 4RULA 2ZWPA 2OA0A 4BMSA 1XQWA 5GONF 3AESA 1RBMA 5JNTA 3BGDA 3QEKA 2FWIA 4UAJA 4CT0A 1PR9A 1U7OA 2MSKA 3JYOA 1DI0A 1G8AA 1ODKA 1R8JA 4MS3A 4YXWA 3ZE8A 2GKOA 2XVAA 2K2WA 3BUSA 2AMLA 2FKAA 2P9BA 4MWTA 1JMVA 1S4QA 4Y1GA 4F91B 3IGFA 1W36D 1JPUA 4Y1RA 1QNFA 1CQXA 4QOSA 1ZU5A 4D0GA 4NG5A 4E5VA 3UV7A 3QA9A 3PWTA 1M6EX 3HDQA 1CG6A 4L4ZA 4OP3A 2E4VA 3RRMA 4QRHA 3ZKWB 3WHLA 5J2TB 2GBPA 4EHBA 1TRKA 3K73O 2ZL7A 1JLRA 3E8SA 2LZJA 4RDKA 2IIPA 4A2QA 3UUGA 3GG2A 2ZTSA 2ZRMA 3LL7A 4PCAA 4O2BF 3RVRA 1V4NA 4G0OA 4RK6A 3DS8A 3KWJA 2ONCA 1X2BA 3DZCA 3P2MA 3DWGA 3QK7A 1UC8A 4FCTA 2BKXA 4UARA 4B3GA 1ZQ1A 2LRHA 4FNMA 1T5EA 1JIQA 1PZNA 2IYNA 4L7VA 3GT0A 3M2PA 3EEYA 2PUJA 2CNDA 4UZFA 2DKFA 2FR0A 1PJLA 2O20A 3E1SA 3EVTA 5AH0A 5AXBA 1IATA 3ZV6A 5JT1A 1MKYA 3C3XA 3CHYA 3GAFA 2WJAA 3O92A 3B5EA 2Y1DA 2E21A 4B8WA 3VNVA 4YT8A 2V03A 4RQTA 3ZWQA 4RNDB 3PNKA 4V0NA 2I6TA 1OI7A 2J1LA 4OQFA 4X91A 1WORA 1FFSA 1EZ4A 1U1GA 2GZRA 5AI4A 2IV3A 4KYUA 3DLCA 4OOSA 2P6NA 4DNRB 3TW8A 1QV7A 2NLOA 3KYCA 1RKQA 2BTQB 5A3RA 1A7AA 1XHFA 1R64A 3KT6A 1YLOA 4KR9A 4RPBA 1P0IA 1Y1QA 3EFOB 5JS2A 5ESXA 3MWJA 2E49A 1C8BA 1QG4A 2NNLD 1EA7A 4LJ4A 3UBMA 1XLTA 2JFXA 5B36A 3THSA 4QM7A 1W87A 1KU0A 1A4XA 3K35A 3UJAA 3NG1A 2NUAB 2ZJYA 1T0BA 3F5FA 3HR7A 1TJ3A 2FUCA 4I5FA 2VXOA 4LGCA 3X1ZA 1OFGA 2OBLA 1EP2B 3KU1A 1VZ3A 3IAS6 3GB9A 3CZMA 2XTAA 3OQ6A 3EOBI 2QPOA 3BKXA 2Y1CA 3FTNA 4HH4A 4TZKA 1ISMA 2Y2VA 2ZE7A 5AJZA 3SK0A 1FDTA 4F4HA 1T0PA 1I9CA 5HXBA 4XWOA 2EJVA 3WZMA 4R9VA 2DBYA 2OXFA 4OXNA 1O58A 2Q21A 1SBIA 4LUCA 5M04A 1ODSA 1M1XB 4E3WA 2XLBA 5C7LO 2WYRA 1PEYA 4ZQEA 1XFDA 3G0DA 5L4LA 1ESMA 3NATA 4XVCA 2H1RA 1QGYA 3AFOA 3DMGA 3EK2A 4QUBA 4POOA 1D6SA 1UFRA 4QEKA 1BVYF 2UYYA 4I1UA 4JJ7A 5JAQA 2IZ7A 1RWPA 1X70A 3QKTA 3IILA 2A3RA 4MQ5A 4TYNA 5KOIA 2ZW9A 2GKGA 2JASA 4NMLA 4W7SA 2WW8A 4JFAA 3UWSA 1O6BA 2EJBA 2P9FA 1NJGA 5KWSA 4JHXA 4N41A 4G84A 3FZEA 3OU2A 4GRIA 4NR0A 3Q8LA 3D4OA 2YVLA 2FN9A 1MJGM 3FAZA 2BEVB 1VSTA 3CC8A 4KXWA 1V39A 1YHZA 3EIXA 3GLFA 2VPXA 1F6BA 1DCMA 3A1WA 2J3EA 5B4TA 1YR2A 2BJWA 2IX3A 3D2CA 5D51S 1W0CA 3WK8A 2ZVJA 2V98A 3W5UA 1BU5A 1ULBA 1C7JA 2WUWE 6PFKA 5KNDD 1K8QA 4NQZA 3QOFA 3HJTA 3KQVA 4BO3A 3PXUA 4G9EA 3SYMA 3DTVD 1QJCA 3EOAI 1EFTA 1XEAA 3WZ2A 4YP5A 3TXXA 2PZEA 4BBPA 4D4IA 4D5GA 2RG7A 1S4MA 1FS5A 1FNDA 2OV3A 1O8BA 3EQ7A 3D3EA 3DNFA 2A9JA 4L15A 4OGWA 4CF5A 1F2TA 4NZPA 1K8YB 4AS1A 5CB0A 3VYVA 4JYPA 3JV7A 4B4DA 2FSPA 1Z5GA 3OM1A 5JHHB 4XIFA 1KU6A 1R74A 4BBAA 2VCHA 2MSCB 3LHIA 4O0LA 6NULA 5CPBA 3M34A 1FFHA 3HN6A 2WNSA 3JWPA 1TM4E 1YQDA 5JCPA 2XCIA 4YEJA 5ICSA 4RVHA 3O21A 1O87A 4UU0A 1PD1A 4KR2A 4AO8A 4IP0A 4JVSB 3FVWA 5AKKA 4HUTA 2AFRA 4F3RA 3COWA 3I62A 2QLBA 3A1DA 3G6EB 3PQFA 4TN5A 3UOAB 4CM6A 3GRFA 2WYHA 5C3UA 4DBLE 4TMTA 1LX6A 2REQB 2UU9B 3AW9A 4NU0A 4ZGNB 3KT3A 4Q18A 2HMUA 2I4RA 4CXMA 1XMXA 4QARA 4B83A 4A5OA 3MLBA 3NVKI 2XVYA 3L92A 4AIRA 5K3BA 5J3OA 3KKZA 2EKBA 1L7BA 3KVNA 3H83A 3PDCA 4TUYF 4U4AA 1KI9A 3N0VA 1L5NA 5HIIA 2JHFA 4M9QA 1IJKA 3PFBA 5LN1A 4L5BA 4HEHA 2YXLA 4W5TA 4JI1B 4AKIA 4RTKA 4JLUA 5TSDA 2KLHA 4GYWA 4EW1A 1ATZA 1GITA 4FCWA 1E1KA 4RA6A 4POAA 4EGAA 4M1WA 3MW8A 1SUSA 2XYGA 4V0KA 3WIEA 3HO6A 5C8YF 4CWAA 4HE5A 3CMMA 4YELA 3HKEB 2OQVA 5BSFA 2OORC 4BIIA 2QRMA 3T1HB 1WBDA 4DIEA 2X5KO 1ND5A 1W93A 3E5RA 4AQ7A 3EGIA 4WWHA 4LDNA 3N76A 4GOND 1ZW6A 3TOZA 2H31A 3LCJA 4GZ5A 3RNOA 1XL0A 1LLQA 2OL4A 2WF7A 1KI6B 2FFBA 3NKVA 2JLRA 3ZHTA 3OIDA 4EF6A 4IVQA 4JJEA 2R60A 4OX9B 4QG3A 1GDHA 1M6YA 1MTZA 4ZVVA 3REQB 4GDFA 2XXAB 4NMXB 4ZJPA 1XZEA 1T3SA 2G83A 4EY3A 1Q57A 5FLYA 4FE4A 1VPWA 1KA9H 1B76A 2IXDA 1KYYA 2HGSA 4PRLA 4RLSA 2VRWA 2WJ6A 5GAJA 5AVXA 1UQRA 1YC5A 3CGGA 3MUFA 2FTKE 2DXIA 3H1EA 1EAYA 2DFKB 4M49A 5K2MA 1J24A 3AQ4A 2QYOA 3OLWA 4URVR 2ZL5A 1MX3A 1YZQA 5FAKA 5FT9A 2OMEA 3V00A 3Q1KA 2Q4OA 4F3KA 1CUUA 3UN1A 1QMPA 1UT5A 2YXNA 2QP9X 4PGGA 3NTRA 3T0IA 2HXYA 4G4GA 621PA 3DOIA 3G8AA 4LZAA 1UM9B 3TG8A 2QPAA 3EWAA 4O2AA 3ENVA 3BCRA 4GD3Q 4KDFA 3UKJA 3V33A 1BVHA 2H00A 4EHLA 2YUIA 4BS9A 1T1IA 2D1SA 2V0GA 4D25A 2AX4A 3DO8A 1ZA2A 3TLEA 4O4HB 1WHSB 1JXMA 1F0PA 4RPGA 1U0OC 1UKCA 4AL4A 4XLEA 3BYZA 3CN9A 1EUCB 3L0DA 4H2DA 1T9AA 3LLUA 4QGGA 5AXAA 4JEHA 2GM4A 2I7DA 3H5OA 4HJXA 1UOPA 2V31A 2Y4NA 4IV0A 3VTZA 4A8PA 4HGQA 4L28A 4DCUA 2UZ1A 2CWDA 2FMTA 1NF2A 3LJKA 1BDIA 1KY3A 5I9LA 3RS5A 2JCXA 1NJ1A 3ESBA 1J07A 1NNSA 1Q74A 4XONA 1GUYA 2WYVA 4KQFA 4MB0A 4MTCA 1WP6A 1BU8A 1HYEA 1TADA 5IX8A 1M7GA 4HFMA 3TGWA 3JQAD 3TLGA 4EB6A 1TZBA 2Y0BA 1QS0B 2QRVB 1OHHA 4ER0A 3AW8A 1YDGA 4R31A 5JDCC 4IMJB 3MTJA 1QIMA 1OZAA 2X19A 4D44A 3MWEA 1ZW1A 3Q98A 1TYDE 3QKRA 4PU0A 3EMKA 4QBTA 4R1NA 2VLIA 1KOLA 1JDJA 4HT3B 3GPLA 2YWDA 2GPTA 5ECGC 5TQ2A 5ADWA 4INAA 1YDHA 3K1AA 4GI5A 4D45A 2WSSA 4KP7A 3TEJA 1RE0A 2AYXA 3V8NA 1CEQA 1RC1A 3AIOA 4TWRA 4C7OB 4BGUA 5A6SA 1KARA 1U3DA 3E7DA 5AVZA 1OLOA 5FA5A 1NTRA 3LUJA 5FWAA 2VKQA 4R0MA 2R8YA 1HE3A 3AFMA 2Q6TA 3KEOA 3PRJA 4RMNA 1ZGCA 4TVSA 1CU1A 4C3UA 1ONSA 1WOSA 3UOGA 1ZS9A 3WL7A 1O8CA 1T25A 2C00A 3B1FA 5AM5A 4ECEA 3ER9A 2XZDA 1HC7A 4KLRA 3C43A 2PGNA 4X8MA 3OPMA 2Q4RA 2ZGVA 5LZ5A 1OU0A 1ZUWA 2XUDA 1Z4LA 1WUKS 1AOXA 4GL2A 4A0SA 2BOVA 2QTBA 5IULC 1ZNWA 3CLUC 1M72A 3PF9A 2I3ZA 4Q4HB 3TZ6A 1WCIA 2FPIB 3FKQA 4Y1FA 1FP2A 3I1IA 5A4JA 4L73A 3GRRA 2WKQA 2I2CA 2V9PA 4H6XA 3V1LA 3H8SA 2QLNA 2PQ0A 3CRVA 3AOEA 2GCEA 3S99A 4CTMA 1R9NA 3EYWA 2CL5A 1JI0A 3H99A 4N54A 5D84A 4YQFA 1W4AA 4B79A 4CJXA 5JMTA 1QGDA 3IBGA 4KQEA 5CB4F 2IH2A 1YJ5A 2R00C 4BO1A 1S3FA 1MABA 4UMDA 1RKBA 3ZZ1A 3X1JA 3K9FC 3HDVA 1JV2B 2GM5A 2OXEA 2XI4A 4KQJA 3GJ7A 1DBSA 2PTHA 4LYHA 4PPGA 3IE0A 1GXSA 5C37A 1HDYA 2G4VA 3U4GA 2F90A 1K7CA 4I1YA 4PAQA 1Q0HA 4XFDA 4BNDA 1G41A 1P0PA 3JYPA 4PO9A 4E3ZA 4W5HA 3T51B 2AC4A 1VYTA 3RRNA 2BGKA 3LSYA 3Q2OA 3U4CA 4U2GA 4HRVA 1QHIA 3Q7IA 2GDZA 1P4SA 1T36A 2CXQA 4DCOA 4RZ3A 2VZ8A 5ECWA 1UFOA 1DAIA 1Z0JA 3A4YA 3LX5A 3GCGA 3OE7A 1EQ2A 2FRXA 1Z82A 1WV0A 1JBKA 2AFIA 3NHRA 4K6HA 4RD3A 1Z7WA 1A2OA 2GESA 2IYFA 3LPAA 3ZXIA 1FPQA 2QD2A 2HAEA 2OOKA 2ZJAA 3M9LA 4I4TA 3S2ZA 2NSHA 2PS3A 4ZEMA 1QV6A 3ZWWA 4RS4A 3IRVA 1Z6TA 2ET6A 5JQGB 1RYEA 3TTXA 4ZGQB 5HDQA 1ZESA 3NHKA 1RMQA 2N1MA 2ADMA 1YAHA 1X1SA 3GZNA 2VBUA 2QVCA 3QBJA 1ECJA 1KH3A 5IVHA 3C8UA 4OGGA 5JNRA 1M2OB 1GGEA 2PSDA 2VFAA 4IIJF 5EZYB 3UKOA 3SXUB 3WQQA 2VDOB 1BCSB 1SB8A 3IEPA 1PJBA 1W46A 3ZD8A 1U0SY 1HTBA 2EFCB 3MJFA 4XEHA 4Z1OA 2F1KA 1ORHA 1AKVA 5G0SA 1NVGA 2QF7A 1UBUS 2AL7A 2EARA 3KYJB 3UC9A 4E2ZA 4CT4B 1MD9A 1TA4A 1T0JB 3BAFA 3E9MA 5AW7A 4RIIA 1P7WA 3DV2A 5DM0A 4PG8A 1KO4A 3L8DA 4LWPA 3DOUA 5GONB 2KBEA 3COPA 3Q8MA 5KQGA 3AK4A 3CJTA 3UMCA 1DIGA 3K4HA 1AXRA 1NUUA 1QP8A 3EXHC 4LEIA 2FWNA 5CTAA 1JFRA 2HM7A 2VOEA 3DFMA 3VU0A 3K70C 1DPGA 1DIBA 1TJ4A 2EQBA 1TMGE 3ISJA 3BRSA 1AD2A 1N0HA 3AF4A 2C2YA 4GGMX 1U90A 5CBPB 5CDTA 2JI7A 3IXQA 1F7UA 4PPNA 3LRTA 4LRWA 3RFUA 2XMZA 1PHPA 3FUVA 1GFSA 5JJIA 1YOVA 1VQ6B 3EAQA 4GLBA 3RREA 1P17A 3ZWNA 3F3YA 4KSYA 5D3KA 2C3UA 5FFFA 3ZV7A 4J2HA 4MV5A 3C97A 2XDWA 5H3CA 3ZDEA 1G291 1L7AA 1SMKA 4N7MA 4L76A 4YNBA 9ATCA 2JJ2D 2QROA 5K20A 1A4IA 4CW7A 1BHQ1 2VDUE 5BQFA 1XVVA 1Q1ZA 3PWSA 4Y2XA 1F8XA 2Q2WA 4MEJA 2BI7A 4CMIA 4PZEA 4NCJA 2Z3ZA 5CT9A 1I9GA 3LKZA 3QV1A 5KVVA 3EBPA 2UUOA 5AQ1A 4IHJF 3FNFA 2FMHA 4G4JA 1H2AS 2K87A 3BD6A 4RFVA 3TGLA 1AU9A 3F4BA 3IP7A 1HLPA 1HZJA 3OEWA 5K0JA 2F48A 1H5NA 3ZYZA 5AKXA 2PL9A 4QOHA 1HGXA 5DI3A 3RFXA 2PUBA 3WKEA 1M8GA 4YAEA 2VP2A 4URFA 5JWOA 5JROA 3OT1A 3WLKX 5KYNA 3FHCB 4CUJA 3I5XA 3HVRA 2FG6C 3C7AA 5JOQA 3HI6A 4L51A 2E85A 5JVDA 1VG0B 1TPZA 4G0MA 2OC9A 4Y6GB 5EHIA 3ULKA 3ZU3A 2DT8A 2GCIA 1ECCA 1UAGA 3GXBA 2XB8A 3FI0A 3JVDA 4ZVSA 5FWXB 3PJEA 2JGDB 2DBVO 3S2EA 5ESDA 1YB5A 2IP1A 1W44A 1Q9SA 1IE3A 1UEJA 2Q5EA 4M38A 3GWGA 4Q05A 4H6WA 3V8PA 4FQ5A 3QJYA 2QYTA 1Q22A 2G08A 5CLFA 2X6RA 3A9VA 3OZDA 1UBSB 2BKUA 5JD4A 2L2QA 2CJXA 5DYNA 3RHTA 3SJZA 1RNLA 1LLUA 1YU9A 1FLDA 2LCIA 3KHTA 1GPYA 2HT6A 3FR7A 4HH1A 1V6SA 3WGTA 1PQYA 3A6PC 2I65A 3PTAA 4BWGA 4KPUB 2OMKA 4R1SA 4X61A 1E3WA 3K5IA 2ZREA 3CZQA 4RWEA 3EQZA 3KZXA 5EN4A 5EP1A 4QHYA 1FDVA 1JFFB 4Y2VA 5DE3A 1ZOOA 5KVSA 3TSOA 4G4SP 2I67A 1EE2A 1TYZA 2WJ4A 2Z0MA 3H6KA 3PQ5A 7REQA 4Z4QA 3ER6A 5FPPA 3MWGA 1XGKA 4R69A 2VHYA 4OQDA 3BSSA 4DFDA 2ZITA 2QW0X 4LRQA 1DUVG 2QM0A 3IHKA 3KL2A 4ZAXA 2CVZA 2FUEA 4P33A 2NU9A 2Z9DA 4BNHA 4EHAA 1V3TA 4N82A 4H7PA 3B6EA 4IS3A 3LQYA 4KO8A 2AXNA 4KWEA 5ALLA 1P80A 2H1IA 3BXHA 1TM7E 3T1VA 5TV2A 3AR9A 1WXDA 3ZEAA 1PJ4A 3DUFA 4KX3A 2HJGA 1YB1A 2CXPA 3CEJA 2ODAA 3ESCA 4C7BA 2AQHA 4CMEC 1KK2A 2X6QA 3HTXA 2HCFA 1DBWA 4P2GA 4COKA 3AHIA 3DOFA 2X6TA 3SEJA 5EKUA 2VSNA 1PS8A 1ZX1A 3PQ2A 4H16A 5DBEX 2VK1A 5KEIA 5E38A 5T4FA 1R4AA 1OT3A 2G7MC 2DHQA 2NVOA 2BFFA 2JVJA 1JF8A 4J49A 4TLEA 2YMPA 4CM7A 5I45A 3RYIB 5E3HA 5J4YA 4CCWA 4L3VA 4A0GA 4EGFA 4V1CA 2OP1A 1MC4A 5ALNA 5BN4A 4IDFA 4KQIA 2E4ZA 4XGRA 5FFMA 1F1JA 4BLQA 2A9KA 1GPMA 3KTDA 421PA 4D9NA 4PYJA 3ZWDA 4PYNA 1SCIA 4OHXA 1WVIA 5KKAA 2FEXA 3HCAA 1CF9A 3AM1A 1XP5A 2VXCA 4HWRA 1E69A 2JS7A 2A57A 4TS3A 1RHRA 2WDZA 3U62A 4CKWA 1U7DA 4I8IA 4WI1A 1HZEA 2CHFA 1T8PA 1BMFD 1PLJA 3E84A 3O9VA 4N7JA 3W4KA 4YLGA 4IX1A 2X4DA 2P9QA 5GGYA 3LVQE 5I5GA 4WCFC 3IIKA 4OOEA 2ZAIA 1ZM3A 5KVCA 5FOXA 4BRSA 3FYTA 1GQRA 3WXBA 1TGYA 4HB4A 3RQIA 4LJ5A 1XXHE 1T9GS 4CTJA 2BYTA 3CE6A 2JHPA 4YAGA 2DPGA 2WUGA 4NWIA 5ALTA 1BJRE 5JZMA 1IN6A 4HDNB 4I5EA 2XNJA 5BV1A 2VR1A 2NXNA 3JPWA 4M0CA 4QRIA 5H3HA 3S1LA 1XU9A 1SQ0A 2VZ9A 4QDKA 1SM4A 2ZRQA 1RHKA 3FZYA 4PZ0A 4XCVA 3WGQA 4HTAA 1DKMA 2COUA 3QPUA 3WYFA 4YT2A 4PAWA 4RHTA 3THXB 2VCYA 5K0LA 1R16A 1ZCFA 3R3JA 3UAYA 1D03A 1SULA 1YGYA 3UK2A 1GUBA 5DW0A 1WMSA 1ZCJA 5J23A 3MWKA 5JTTA 4TUYB 3C6BA 1UFKA 3CCQB 4G9GA 5ETJA 2C5AA 2Q0HA 4JROA 1WL8A 4YIKA 3GDGA 1U28A 2D3TA 4K6KA 4QUKA 3VYTB 1H3NA 3O83A 4HQNA 4I50A 1E3DA 3ZHBA 4UOEA 5K7SA 1UXGA 3E7XA 5C8YB 1OAKA 4N47A 5EJAA 3OFJA 5A3JA 2Y1KA 2TMDA 2QX9A 4QXPA 3DF7A 4AQYB 1HWYA 3KLNA 4CG3A 3IKVA 2V4UA 2W71A 5BUCA 2CVPA 1GAWA 3PUVA 2HSEA 3T1YB 2VS1A 2E7ZA 5IM4F 4Y6QA 4X1KB 1P2SA 2ZPUA 4PW0A 5FV4A 2XGJA 2SCUA 3R41A 2HSGA 3P9RA 4N0EA 3D9QX 4KSCA 2ZU6A 4OHWA 2I87A 1NXPA 3OVMA 3FSJX 1A8UA 1S8OA 2A5FA 1SY7A 2AN9A 2GCOA 2ZE8A 2ZRFA 3EVGA 3KUCA 4R98A 5HKLA 1C0EA 1EQUA 1S7GA 4CN8A 1K4MA 1RPJA 3KXDA 4HNHA 3CISA 1P2DA 1XZCA 1SXJD 3GPCA 4CG0A 3PQ6A 2PH5A 4JB3A 3FTQA 5IARA 4WW0A 3IUBA 1PE0A 1RWQA 4FEGA 2B36A 1UMBB 4N9WA 1J8QA 4CKEA 4HVTA 3ET5A 2ZANA 4HBZA 4P8RA 1G2IA 1UC9A 4YEDA 2XCTB 1IONA 2GAOA 1I7SB 2NVBA 4A92A 2ERXA 1YR8A 4GFDA 5BMVA 4TLDA 1EE9A 5IBCA 3OFVA 2O7QA 4KIWA 5FBVB 2BKVA 2WZCA 3OC6A 1CUGA 4L2IB 4MNTA 4WH0A 1QQBA 2H57A 1XEXB 2OHXA 4EPXA 4DR2B 1GHTA 5AJVB 4QQ8A 1KEUA 3QTLA 3FLEA 4OUDA 4ZU3A 3ZQ4A 3BEOA 2CDAA 1GZ7A 2Q5IA 3H13A 4U7FA 4OFZA 4FDLA 2AF4C 2VQ6A 4OHOA 4PYIA 1NQXA 3DF9A 2FB9A 3UENA 3L5KA 2H65A 5K0EA 3O8OA 2FQQA 1YDMA 3EIHA 1U0GA 4KHZA 1WXXA 1EVIA 3G5MA 5A71A 4AJ1A 2J9ZB 3PPXA 1RC8A 2ZU0C 1V96A 3AG5A 5BSHA 3V48A 4BY9E 3A6HA 2EKDA 2QMYA 2ZRNA 3C3YA 3KRTA 2ATCA 1Z2CA 1PGOA 2YHBA 4ZYYA 5JW6A 4RPKA 1MIHA 2QZPA 1XRSB 2V6BA 1SZCA 4JVLA 4Y1EA 3SQOA 4BOYA 5HW0A 3RR2A 4BNJA 1QAQA 3E9QA 1V5VA 3OOEA 4AULA 4U3JB 1UF9A 4KQXA 1UKZA 2QN8A 4DV3B 1WUTA 2X58A 3OO1A 4JODA 4EG3A 4QBIA 2FEMA 3PE3A 4LDPA 3A10A 4OHZA 5IJXA 1BLIA 1BH6A 4R2XA 3ZNOA 3IKTA 3R3SA 4F9TA 3C39A 5KCMA 2HJ9A 3I2FA 4JC0A 4XSGA 3QFRA 3QWBA 4KJXA 1VIDA 1I7PA 4ZT7A 3VR0A 4ALMA 5LFAA 2PBLA 1AH2A 1FMCA 1Y9AA 3CT6A 4URWR 3H9QA 4RPCA 2QQFA 1NRWA 4CEJB 5K3FB 3OZGA 1QB7A 1LA2A 2H9IA 4YMVA 1FRZA 2Z04A 2LV8A 1YZKA 3G1WA 3ND9A 3ADDA 1JWBB 3T53B 4XFKA 1XI2A 2W6PA 2V74B 3UMVA 4A5SA 3D7RA 3PPWA 1O9HA 1V5EA 4ZCQA 3G17A 3DYBA 2FDXA 2FPPB 3I04A 4J7UA 3M1LA 1I51A 3EEBA 1Q12A 1XZLA 3HY4A 1REQB 1PK9A 3D5QA 5EHQA 1DNPA 3UJ9A 5D87A 3BC9A 3F9IA 3T38A 4G4SO 1M2VA 5GTDA 3OJXA 1DC4A 2C1EA 3IUMA 4WFKA 3TB6A 1G4UR 3V7NA 5EXEA 1GCAA 4N3GA 1R37A 5DF1A 3DAPA 1FRVA 1B16A 3BXOA 3QBEA 2JJMA 3RC2A 1OB2A 3JWEA 5CB4B 4EEZA 1Z22A 3M6FA 4EGSA 2F1OA 1CRLA 5JECA 1QX4A 2Q3JA 3R7BA 1IOZA 3JD0A 1RM4A 4JP2A 1DE0A 3D59A 4CKYA 4LHSA 4V0QA 4JC4A 2B99A 4YV7A 3M9WA 1E64A 1OIWA 3ENQA 3B78A 3U7QB 1RAAA 3U5ZB 1YIJB 3QIAA 1YZYA 5JMPA 2CJWB 4LX0A 5DX8A 5EMHA 1KJ9A 2GARA 2QLLA 1KC1A 3D8UA 3EW9A 4K9LA 1FTNA 4KEAA 2ZI5A 2E4AA 5FF9A 1ZI9A 5IBRA 2CVQA 5DMHA 5IAJA 2BDTA 2NZ2A 1NVFA 4MWCA 1U31A 2HNBA 4AVZA 1L7OA 4NBVA 1ISGA 2VUUA 3AF3A 3AHJA 3BORA 3BRWD 3BWMA 4LDQA 3ZCVA 5EJMA 3MIZA 4YO7A 5KYGA 1OLSA 2XAAA 2VHUA 4ILKA 4QOEA 2VJQA 4NG4A 1Q81D 4LF5B 2X6XA 1O4WA 4RMIA 1RKVA 2OGZA 3P2EA 5L3VA 5AFSA 2DRIA 2V7GA 3SF8B 2FX3A 2BM8A 2CSUA 4WFJA 3NV7A 3DMFA 4YRKA 1ZNXA 3FJ1A 1LDGA 2DETA 4Y9DA 4P92A 3W5IA 4IIJB 3HVJA 4Q9AA 2PE3A 1GZ4A 4X6YA 3N6VA 3TAHA 4BO8A 5FDFA 4PLYA 1S2IA 3QWAA 5DYGA 3K0CC 4L8LA 1UMDB 1KOJA 2XIJA 3D7LA 3TO5A 5KTKA 4BBZA 3SDSA 3L41A 5ARDA 1ULZA 3V9PA 2OHFA 1GDDA 2WU4A 1CNFA 1QCYA 1GPDG 4G8BA 4TV8A 1IHOA 1QO0A 1E60A 1HDXA 4V0LA 4BXOB 3GO4A 4QPCA 3I39X 2D1RA 2H0RA 2FH5B 1T1EA 3G49A 3GLRA 4KXMA 5PGMA 1ZK4A 2FSVC 3R6JA 4BFXA 3JAMA 2WD8A 4A2PA 3GOHA 1Q1GA 3V5NA 1I3CA 2ESRA 3A3PA 1JG7A 3CW8X 2V9ZA 4R8SA 3GEPA 2DOGA 1BWQA 1LY1A 1KI3A 3GN1A 4D41A 2F4VB 2QQEA 4G07A 3BOSA 1D2EA 1E89A 1W73A 2ZETA 4MUHA 4QXRA 5AO9A 1AV6A 3CUUA 1NGSA 3Q0TA 2FDRA 4GP6A 4HLCA 4JJKA 1LDYA 3OZEA 4N5MA 5EJ5A 5C53B 4FXUA 2VF8A 4PR3A 1C80A 1TO6A 4O2LA 1WKVA 3H0KA 2WTUA 2W2PA 3W0LB 1EMDA 3JQBC 4FXOA 1TCAA 5A02A 4E0BA 3NAZA 2B1QA 4N01A 3BB4A 4O4IA 4RTJA 1Y7PA 2WIJA 2WWVD 3WGIA 1FYVA 5JTUA 2R1VB 1BDBA 3A8TA 1T91A 4IHJB 3UJ7A 2QYHA 3W2TA 1RD4A 2CZGA 2EQAA 4H7KA 1F48A 3S3TA 1T6ZA 1JR3E 3CG0A 4KQHA 1DUIA 4ZCSA 1EFDN 1U94A 2QUAA 4CUKA 3PA1A 5JXHA 1VE7A 4WA7A 4M0UA 4GKJB 3B9RA 1Z8NA 2J31A 1N7GA 2JCGA 4GOJA 1SXIA 2AXPA 1X7XB 2IYAA 2KWIA 3N9IA 4G0QA 4M86A 2R25B 4N5HX 4C05A 4HFJA 4DUGA 5ICCA 3KETA 3ZHCA 3BS4A 3CLKA 3SIWA 3HFJA 3RHZA 5JSYA 4I3HA 3A35A 3RVNA 2LW7A 2C4TA 1VCNA 2FZCA 3C4VA 4MIOA 1N2BA 4EL5A 1LZLA 1Z2DA 5KDOA 2IGBA 3ZWOA 4DQUA 1YZUA 4RBNA 4DL9A 3HBNA 3C3MA 4B73A 1SCUB 3N2YA 3IHWA 3MK31 3FVQA 4OOFA 2CF5A 3OJFA 5KOJB 2BR3A 1AGPA 2IYQA 2UXDB 2MINB 2E87A 1Z2AA 1ONOA 3CKYA 3MIIA 5HVNA 4MDFA 4AJ2A 1KBOA 1A2QA 3V97A 1AKQA 3A14A 1IDOA 2FQXA 2VP0A 3B52X 3E05A 1VI6A 2C9ZA 5B2FA 5JCJA 5SY4A 2KHZA 1WZNA 3K6SB 1CY6A 2AJ8A 4NHOA 1Z7EA 3STVA 821PA 2WABA 1U3VA 2VJPA 1A97A 4JC8A 3FCUB 2QB5A 1GYRA 3R9WA 3JTMA 3TRDA 1CDZA 1V7QA 1XCGB 3GNQA 4H3SA 4KLNA 5H83A 4EA7A 4U39A 2DWPA 3LCVB 2QXYA 5CJJA 4U9IS 3DH0A 3I3SR 1SCJA 4DDUA 1KC3A 2B8TA 2F3RA 3CRNA 4KPEC 4WNAA 3DE2X 3M6AA 3PTZA 3QXXA 2RB5A 1RQGA 4J1TA 4NFYA 4E4RA 1L8LA 1MP0A 1DKPA 2R1TA 3D6FA 1VE6A 3IO5A 4P4UA 4TYYA 4RVDA 5EIEA 1K3TA 5JALA 4FHEA 3RVJA 3BMCA 3AKZA 2RAVA 3L7IA 1FZTA 1YE3A 1N2CA 1YJNB 1FDRA 1O08A 1CR2A 2XMQA 3GFBA 3OOHA 1VSVA 1K8XB 1K06A 4W1PA 4AMYA 4EDFA 2R62A 3ASQA 1KGSA 2HWYA 1NKTA 4U00A 5E6TA 5EJIA 3O90A 3IP5A 1R9MA 4WZAB 4YBRA 3QKUA 2OTLB 1FL9A 3WJ2A 4IEEA 2R11A 3O95A 3MLAA 2FP3A 2R6R1 1D1NA 1F4PA 2VZ0A 5LKRA 2JLVA 4LHWA 5KYXA 1E2FA 4X45A 1CUBA 3AI3A 1P0QA 2WVGA 3SP1A 1V8BA 4D9HA 4R8VA 5BSGA 1PTKA 5HRUA 2GS9A 1JZTA 1DIRA 1USGA 4YLYA 2BCJQ 4IWXA 2JAXA 2QZZA 4N5DA 1G21A 1YI2B 4U7HA 3ZIDA 1VG1A 2VK8A 3TM4A 2A9FA 2L18A 2ZJ7A 1O03A 1T3HA 2ODBA 2B7BA 1K9VF 3PJGA 1NVMB 1AZWA 3I55B 4BEJA 5K0SA 1QFXA 4PVCA 2ZRGA 1CX9B 3ZVLA 5IK2A 3BD9A 3KZOA 1GNPA 4XASA 5C80A 4EPWA 4KQ9A 1SR8A 1N32B 4D9FA 5HM6A 4DNOA 4W8OA 1VHDA 2FW8A 3G89A 4GXNA 4QD3A 1PF7E 3R3YA 4HVLA 4P3XA 2W2QA 4IKPA 1B8VA 1I4LD 1KYVA 2NUPB 1ZD2P 3ZJ5A 3U13A 1YIOA 4BVHA 1G3MA 3O1JC 1Z62A 3A9UA 4EZIA 1Z5ZA 1W8DA 3UV3A 3A8IA 3AH8A 2DBQA 1A04A 2C8LA 3IC5A 5KYWA 4XD7D 5JO0A 2UV8A 3EFBA 5A4DA 2IOQA 1AHHA 5D3QA 3PIRA 3CVXA 4OP7A 1RP7A 4FSHA 4LJ8A 5I7SA 4QYXA 2QTFA 3PB3A 1B2LA 1ZM2A 5FL7A 3ZGOA 3OCZA 2G06A 4HEQA 1XDZA 4LRYA 3I2HA 2Q62A 1EUDB 2OXTA 4DHEA 4QLOA 3I6BA 1CHNA 2PYZA 4IIDA 1SVWA 2HMAA 1YNSA 2AOTB 2XUPA 3FNQA 1R50A 2BKEA 3G6WA 3AJ8A 3H9EO 3VAAA 3BGSA 2J67A 3IXMA 4H1TA 4IG9A 5A89A 4R1TA 3V55A 3ZX4A 2VDMB 5EQJB 3HGMA 3CWCA 4F5EA 3VZDA 3AM4A 3M4NA 4OIFA 4C88A 1XCBA 1XTZA 1YRHA 1LW6E 2QT0A 1JAIA 1EXWA 4Q4JB 3RAPR 2JD0A 4EHIA 3DOCA 3GA0A 5BSKA 2R65A 3D6HA 1E9SA 4M7RA 5HJ7A 2GPJA 2IU3A 2VBIA 3KHKA 1PDOA 1WHTA 4XZ3A 1KYZA 3BXEA 1CBUA 5AESA 1G20B 1R6AA 5TEWA 4A0QA 2PZKA 4YXFA 2PMDA 4G36A 1Z75A 3FNHA 4FFPA 3GVHA 2WWWA 4V3CA 3WMFA 4DA4A 1M0TA 5EWMA 3L4JA 1VPDA 4DE5A 3G68A 2RBGA 1TUBA 5CA0F 3JW8A 3ZVMA 3OO0A 1S2OA 4ND6A 3KLPX 4V0RA 5EXTA 3WGHA 2C3OA 3RSCA 4Q4DA 2ZUTA 4EYEA 3WV4A 3OQHA 2PKRA 4LNUB 4I1SA 1KJNA 4IIVA 1RWXA 2Z2IA 4I55F 4KIGA 4F1KA 1VJ1A 1E9DA 3R23A 4UAVA 5JZVA 4ZIRB 1VBKA 4JLKA 1NFRA 3IUYA 3R7FA 4QOJA 4KGXA 1N36B 3U6BA 2C1ZA 5CA1F 4MGHA 5EE9A 3TJRA 1J90A 3CONA 2WPNA 4D3SA 1Z9BA 3DHNA 3R24A 1I4EB 2CLSA 2ECQA 4PM4A 4U7WA 3QITA 3U81A 4BTEA 2XNHA 1ID1A 2WSLA 1IUKA 1QVVA 1UDWA 1YA6A 3RLIA 1AXEA 2H8GA 2I6UA 3MG9A 4JEUA 1Z56C 2HWUA 4LJYA 5JNVA 2ZJ2A 3GT7A 2AOWA 3P0HA 3T5AA 1AKTA 4A73A 2IDKA 3WE7A 3K92A 2GCGA 1TMKA 2QA5A 5TQ0A 1BROA 2GPYA 4L08A 3UO8B 1EHIA 1PT6A 3N8GA 4YT5A 1NG9A 5L3SA 1D07A 2LR0A 4L8WB 3AF2A 5AUQA 2J5XA 1HG0A 1A69A 4H7DA 4PX5A 4DC1A 3IPXA 2J07A 4KWIA 1GT91 1ZBDA 5HILA 3BK1A 2HW8A 1KETA 1L4EA 2OAP1 3RSQA 5E6SB 5FUXA 4AZ3B 3HWSA 4HS9A 5EJ6A 1DG9A 4X6XA 2CLCX 3CCJB 3SE0A 4OQYA 4YMIA 5BOSA 3STYA 3JYLA 5E8JA 4YV2A 3SLRA 4UXIA 4WKCA 1XPRA 3PD1A 2EKZA 2XQIA 3AR4A 4GE3A 3TKAA 2ZIZA 1QSGA 4IJVA 2G04A 2XT9A 3P4XA 4BFVA 1Z34A 1WY5A 3MOGA 2WSBA 3SLGA 3NE5B 1SOWA 2P67A 2PZFA 3KSBC 3F97A 1UJ5A 4MKIA 1V43A 3KVYA 5AVOA 4DA6A 4IIXA 1GTRA 1SD1A 5EGNA 1JKJB 1IHDA 4MEBA 1I2MA 2WG1A 1NFQA 3T41A 1OV6A 2HHAA 2YXPX 3CH4B 5G1OA 2YJZA 3TKYA 1BD3A 4YMGA 3RSOA 1T9GR 2QUJA 1ZRMA 2VHXA 3VISA 1NP3A 1TM3E 4ZV7A 3ABQB 5HUHA 5MGBA 4FFSA 1I32A 3N3BC 1TA0A 4TV9F 1AUXA 4UTRA 3VTAA 1FFXB 2CLOB 1I33A 3DM9B 2GASA 2OXCA 1H65A 3N8HA 3NEJA 4OHFA 3RADC 3BWYA 4CGZA 4BX3A 4FNOA 2HPVA 2P79A 5D86A 3AP2A 2WAOA 2G82A 3MB8A 3RC9A 5BVGA 1DWUA 1XD9A 3VX4A 1UKBA 1Z6QA 4OHBA 4CQMB 3BAZA 1JEAA 3A6DA 1BEEA 3IV7A 3A4IA 3X1YA 2C4KA 4P3PA 1N2SA 1SKYB 3HU1A 2R8OA 1NASA 3ZU5A 3GNLA 3VGPA 5KX5A 1E66A 2R8BA 1EFHA 4HN4B 1JL3A 2AGVA 3G7SA 5IEBA 3SSAA 2JGKA 2V5AA 3TDMA 1PGNA 2BR4A 3VR6D 7YASA 3SX0A 3U44A 1PZMA 2ZSIA 3ETEA 2V0NA 5DTRA 4CF4A 3QFFA 1J2EA 1EUZA 1YASA 2Z3WA 2ZIWB 2IHBA 1XTTA 4XUDA 1SQ6A 4DWJA 3R44A 4C2TA 2A35A 3EAGA 3LK6A 2X0DA 4IMPA 4KYIB 4MV1A 5L7TA 1XO1A 4PBSA 4HIZA 3ONDA 2WQZA 1H6BA 3INRA 2R66A 1AY0A 3L0YA 1R0WA 4OXRA 1NUTA 3Q88A 4DCNA 3DFKA 1VMDA 1FC0A 2OKGA 3CEHA 1H0KA 4JR0A 4AKSA 1SVSA 4E11A 4P84A 4UNRA 8ABPA 2DM6A 3OQOA 3NU1A 4RABA 3PHCA 3QU2A 1XXHB 1W88B 1U2TA 3KQUA 2FA9A 3UJBA 4MTLA 5JFGA 4NBRA 1JX6A 4NE9A 1XNJA 4NBWA 4YO8A 5IVDA 4MQLA 4JYBA 3TJMA 1BW9A 1J70A 1DJOA 2CHEA 2QTLA 1X2EA 3ZDZB 4GI1A 4C89A 3IUNA 1V1JA 2X5NA 4FFWA 4ER6A 1ECGA 4XJVA 4IMIB 3HB7A 2OKCA 3C8ZA 2Q3BA 1ZSVA 1EK0A 1VE9A 2OORA 3GQVA 5G40A 1A95A 1L0BA 2J7KA 3AY0A 4UUOA 2Q8NA 1VECA 1UKEA 1PK8A 3JS5A 3GVKA 1BFKA 1VKRA 2RHJA 3N58A 4QXQA 4LWZA 3VPFA 1J8FA 4J0FA 4O4LF 4FGSA 3PXGA 4IDPA 1AURA 1DV1A 2A0FA 1D4AA 2R47A 4R54A 1X7YA 4D4HA 2Q3HA 3BBPA 1HT1E 1Q16A 4NDNE 5T64A 3ZK8A 2JF0A 3ME5A 1E2LA 3HSSA 1L5HA 3OIWA 1IJEA 2C2XA 3EGDB 1UD4A 3C5CA 3TAXA 2LGJA 4B4VA 3LBIA 3QVGB 3H0CA 3F8SA 3RU2A 2XMGA 1K86A 1WPXA 2F1IA 5JLAA 3SZGA 2IS6A 2XD4A 4MP8A 5AI9A 3UH0A 2W70A 3NGMA 3T9AA 4A7PA 3WQSB 4X85A 1J0DA 2DUJA 4OHKA 2R4TA 4BKUA 1T5HX 2SKEA 3FYUC 2AQKA 3ZV5A 5ITWA 1YIDA 1XA3A 1I2ZA 2EWMA 2J9XB 3TL3A 1CY0A 1T5TA 3P26A 2EBWA 4YJHB 3P27A 1NYRA 1L5OA 1ZYUA 5E95A 1HDGO 3U7FB 2UVDA 4RIFA 5JAOA 3WSVA 1JDTA 4OFXA 5FYDA 5AVKA 1MJGA 1ZQ9A 1DEHA 2CWWA 2HZ7A 2QY6A 2ZSHA 3CRMA 4KXFB 4OUKX 3U1VA 2B5WA 3JQCA 3UGKA 3E81A 4E1VA 1QTQA 3GLHE 2H59A 1E0JA 3PJDA 3KALA 1M7BA 5LQMA 1UBMS 3EZYA 2D2VA 4F8YA 4NVRA 2EF0A 3GVJA 4XYMA 3N8IA 4B2IA 1V1RA 2W6OA 1YMUA 2VJMA 3ZHQA 5EIBD 2X1MA 2O6HA 4MSUA 3HJCA 5EMKA 3WV5A 3CKMA 4IH4A 2HUPA 3RNLA 3RS7A 4AMZA 4YJFB 3SHOA 3IP3A 4UM9D 1E61A