2X3UA

Ferredoxin-nadp reductase mutant with tyr 303 replaced by phe (y303f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Role of Specific Residues in Coenzyme Binding, Charge-Transfer Complex Formation, and Catalysis in Anabaena Ferredoxin Nadp(+)-Reductase.
pubmed doi rcsb
source organism Anabaena sp.
total genus 86
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2x3uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2x3uA02
1FNDA 1BJKA 1QFYA 4M53A 4Q7JB 1ZM2A 1Q82D 3QFCA 2BGJA 2PLFA 4F7DA 3U2QA 3E20A 1E64A 4LBZA 1ZUNB 1B23P 1VQ4B 1JA1A 4AF6A 4EH1A 4R71A 1R5NA 1VQ8B 2B5OA 2QN6A 2QEXB 1GAWA 3G71B 4TMTA 4HE5A 1QG0A 1EP2B 5JBQA 4B48A 3JQRA 4PC7A 1QGAA 2BM0A 3W2IA 1M1KD 3AGQA 1D2EA 3ZBTA 4U9UA 1AMOA 3LRXA 1EFTA 1SM4A 3CCUB 3W2FA 2VNJA 2BGIA 2BMWA 4YAFA 5HXBA 1EFUA 4H9GA 4N3GA 3MHPA 1W35A 2CRVA 2PIAA 4QFMA 3MCAA 4RD2A 4PC6A 2AHOA 2PMDA 2YWHA 4HE6A 3W5HA 4PC2A 3CMAB 3QSYA 1GJRA 1VQNB 2CNDA 2DCUA 4RD0A 4YAOA 4J0QA 3CCMB 1AIPA 3JQQA 4ZCLA 4ZV4A 1I7PA 1EP1B 1QFZA 3LYUA 3JQPA 2YWEA 1VQMB 1TLLA 4G5GA 1J9ZA 5TY0A 1QFJA 1NJID 3QE2A 1GVHA 3VMFA 3WXMA 1TUIA 1JJ2B 3VNUA 2FX3A 1EFCA 1FRNA 2C77A 1OB2A 1VQ9B 2GQFA 4B3XA 1JA0A 1W87A 4LBYA 3ZZTA 2RC5A 2C78A 4BPRA 1VQ5B 2QDXA 3WNCA 4N3NA 3CCLB 4Y9UA 4M0LA 1YIJB 3AVYA 4PC1A 2BF4A 2B7BA 4ZGQB 1IJFA 4RCZA 1W2BB 4ACBA 1F60A 3OZWA 1NDHA 1BX1A 4M2LA 4B47A 2BPOA 1ZM4A 4TN1A 1YJNB 1K73D 3ZZ0A 2B7CA 3W2EA 3E1YE 3WBKA 1H42A 3B82A 1QVGB 2DERA 4RCYA 4Y7CA 5H5JA 4RJLA 1QVFB 3AVVA 2QTZA 3I55B 5TV2A 2VNKA 4Y9RA 2QA4B 4RD1A 1IJEA 3I1FA 4PC3A 4ZCMA 3MMPA 3U6KA 3G6EB 3WYAA 1YITB 3A1FA 1HA3A 1FNMA 1KTVA 3WNBA 3U6BA 3V76A 3CPWB 2XNCA 3AGPA 3ZBUA 3OJXA 2BVNA 3VNVA 3B78A 2VZLA 2HDNB 1XB2A 5THXA 4FN5A 4RD6A 1FNCA 1FRQA 1QUFA 1G7SA 1OGJA 2BSAA 3QFSA 1JNYA 2VNHA 1S0UA 4MYTA 2EIXA 4TMXA 4AC9A 1QGZA 3I56B 1YJ9B 1K8AD 1KQSB 1QX4A 4RD3A 3QFRA 1ELOA 1K9MD 4RD4A 4TMVA 3OZUA 1F20A 3CCSB 1QH0A 1QUEA 1KK2A 3VO2A 4G1BA 1KK0A 3CC4B 1UMKA 2YWGA 1DDIA 4C0SA 5EMNA 1VQ6B 2VYQA 3WNDA 3CD6B 2OK7A 1FDRA 1H85A 3P27A 5FA6A 1CNFA 5DSZA 4WQMA 1Q86D 4YHBA 4YAUA 2YWFA 4ACAA 1E63A 1ZM9A 3ZC3A 1EP3B 2QTLA 1W34A 4YALA 1M90D 3W5UA 1VQPB 1XE1A 4LC0A 2OTLB 4M1KA 4PGOA 2ZITA 3WBJA 4ZGNB 4G1VA 1G7CA 3AVUA 3FPKA 2EFGA 4MYUA 1DDGA 4B44A 1Q7YD 1JB9A 3ZZUA 3B8HA 1KC8D 3CMEB 3OZVA 4DQLA 4ZCIA 1N8RD 1Q81D 1WDTA 2D74A 1TVCA 4P3YA 2OTJB 3CCQB 4LBVA 1ZM3A 2VNIA 1EXMA 1QGYA 3AVTA 2HMAA 4TMZA 4LBWA 3LVBA 1G7TA 1BQEA 4B43A 1EWYA 4B4DA 3LO8A 3CRZA 1VQLB 3WY9A 1KK3A 4AF7A 5AN9A 4K1XA 1R5OA 1G7RA 3OW2B 1S72B 1FNBA 1KK1A 1D8TA 2DEUA 3CC2B 3AVXA 1VQOB 3QFTA 1R5BA 3CCEB 2QMUA 4NBSA 3W2HA 4YAWA 1YI2B 5GV8A 2BV3A 3P26A 1A8PA 3CB4A 1GO2A 1OGIA 4QHYA 1D1NA 2BM1A 1B2RA 1DG1G 1GAQA 3CCJB 1IB0A 4FWTA 3SJZA 3G4SB 2XEXA 1YHQB 3AVWA 2DETA 3FJOA 4DQKA 1VQ7B 1KJZA 4TMWA 2R6HA 3CCRB 1SKQA 5KSWB 2HCJB 1BX0A 1CQXA 2XNJA 3W2GA 4C43A 5GV7A 3CCVB 4UAJA 3W5VA 1OB5A 3CW2A 3PENA 3CXCB 2RC6A 4IW3B 5H59A 1CNEA 4NCNA 3VO1A 3OJWA 3J81k 1VQKB 1GR1A 1U2RA 1N0UA 2GPJA 5TR9A 1KRHA 4FK8A 2E1RA 1YJWB 4P6VF 2NPFA 2DY1A 2X3UA 1N0VC 1TTTA 2J7KA 1E62A 3ES9A 2BN4A 1DARA 3CC7B 2OK8A 4M4SA 1KD1D
chains in the Genus database with same CATH superfamily
3OZGA 1LC0A 4HNHA 3KQUA 1QDEA 4MW2A 3A10A 5AXDA 4DXHA 3V1UA 1D1QA 2WM2A 3KWLA 4RZ2A 2POQX 5FADA 1G3UA 2C5FA 1ZM2A 1F5NA 1US8A 2PTHA 4FXPA 4KLCA 4PX2A 2IV7A 3RG8A 3SNKA 4PIMA 2FQWA 4PRZA 2B2CA 2ZI7A 3EXG2 3TFQA 2G8LA 3KJNA 1C7RA 3K1AB 2YN2A 3PLAE 4U2DA 4AUKA 4EBFA 1E64A 1FMLA 5LLSA 3UK0A 4QT0A 5HPYB 1RJFA 2P3OA 4G81A 4FSHA 3UPTA 3P9CA 4BV2A 3T3MB 4G5RA 1RLOA 1X8KA 2GJPA 5KW9A 3EGXA 1QFXA 4EGFA 1TZBA 1PNOA 2PQ6A 2F3TA 4DJTA 1QIIA 3JQ8A 1KU6A 3DHVA 3P20A 4DEXA 4XLZA 3IIMA 13PKA 1T4CA 3G8YA 2N0SA 1V47A 1GARA 2H7VA 2QVXX 1Z68A 4BFUA 4AP6A 4DNQA 2AYZA 3C8ZA 4L8WB 1H1LA 3IP6A 3A3GA 1UMDB 2I3AA 4HE5A 3VPCA 3BE4A 3PNOA 1XA3A 5SYMA 1CY1A 1AZTA 3H18A 2TECE 2P79A 4KWIA 3LQEA 3PFHA 1QGAA 4AZ3B 1U9JA 1HT0A 2D0PB 2BFOA 3NQ41 4C4SA 5EHGA 2YBEA 3I9NA 1TA9A 3IT0A 4C6HA 1EEHA 3FTQA 1V3QE 1MJGM 3A6LA 3AM4A 4J76A 3VYVA 4ZAYA 2FCRA 4TYQA 4X1KA 4CLRB 5I7HA 3PDCA 1RZVA 4QEKA 1D2NA 2QVBA 2Z9CA 5HDQA 4JI1B 4V3BA 1CUBA 1EUCB 1E7WA 1QLWA 3W2FA 4GI1A 1N2HA 1VL8A 4XM0A 5D6OA 3LJKA 2F3QA 5J40A 5J58A 3M9WA 2Y92A 1EQ2A 1Z22A 4FIDA 2ZULA 2FWRA 1AXRA 3DTTA 4NDZA 3NONA 4S1OA 5DM4A 2X0EA 4D9JA 2OD2A 3EISA 4DABA 4OP7A 5CA0F 1JQKA 1FC0A 3CE6A 4K6OA 2BIFA 2VDKB 3RFUA 4FILA 4II7A 1OV6A 3FPEA 1A98A 3X1XA 1P4AA 2PLWA 2AN9A 1ZD9A 1YF3A 3EDRA 1QH9A 2QK4A 1M6HA 4PZUA 4WY2A 4QUJA 1ESNA 2MMCA 3CCFA 4UW9A 5BYBA 4DMHA 3PEUA 3QOWA 4KQFA 3UMRA 3I53A 2P9QA 4KPFC 3ZUGA 1OI7A 3VYSB 4CDRA 2X4LA 1AXEA 5T3YA 1JHQA 4B6EA 4EUNA 4MQMA 2ZIXA 2D3WA 2AD1A 2V03A 3DVQX 3L7BA 3IPYA 2D4AA 1OLSB 4UMFA 3E82A 4GSLA 4P3KA 4UQPA 3AWDA 1GPDG 2ZXHA 1Z2DA 4LRXA 3WMEA 3ZTWA 2ONKA 1Q1EA 2IHBA 2ZK7A 1AGXA 3TEJA 1AHPA 1TYAE 1RVV1 1EP1B 5PNTA 4R6WA 1PK8A 5F4JA 4Q05A 1RT9A 3G17A 3MILA 5LQDA 1NDQA 2L0XA 1X74A 1WEHA 2O19A 1JSXA 1EUDB 3JVUA 3HUTA 2NXNA 3HCOA 2CBZA 4Y1EA 3WIVA 2DBQA 4ZYLA 3L7CA 4MW0A 3HVUA 4UE3S 4KN5A 4RTLA 2E1BA 3OTHA 2OHIA 3LQFA 2WUDA 4XARA 3UAOA 2AW3A 3KDPA 4Q3EA 5CX1A 3AHFA 3VPGA 4BX8A 4ZI7B 2WE7A 2C77A 2O23A 1B6GA 2J9YB 4XW2A 4EF5A 4X3CA 5IVHA 1H69A 2RH9B 1Y7LA 3DUFA 1VLYA 1CS4C 1RRKA 3DKKA 1OILA 4KPEC 3ZZTA 1NNUA 3H5TA 2C4UA 3QM1A 1ENZA 3V2GA 1YFJA 1W49A 5KAMA 4UM9D 1W36C 1ISRA 1OJ7A 2QPAA 4KX5A 4L2IA 4C4ZA 4JA0A 1O4VA 9ABPA 2C61A 1K0FA 4I2VA 3NB0A 5FUVA 4EZEA 3I52A 5HMLA 4FJ0A 1EDDA 2ZL6A 2F3SA 3OVMA 1JHPA 3PCTA 3R77A 4HL6A 3TRIA 1CDZA 1K7SN 5EINA 3HUDA 5FJJA 4XRGA 3TW8A 1JEJA 2Z9DA 3MMSA 2WU8A 1TXGA 4V0MA 4TZTA 3S2SA 3WLTA 3UOWA 4R7ZA 1RHKA 1GAJA 4RGVA 5KNDH 4YMGA 1V6SA 4B6PA 5FDFA 2ZBFA 2YCLA 3V1KA 4HLUA 1ZITA 1SR8A 3EA5A 3O26A 2F48A 3EGEA 1QIEA 5TGDA 1Z83A 4L72A 3U80A 5CB4F 4LOJA 1E4EB 5TRTA 3PDIB 4BFCA 3WBKA 3UB4A 2HH9A 1C4OA 4NU8X 3Q6NA 2Q41A 3H9GA 4TRMA 4Z7QB 1C3EA 2VHTA 3OO0A 2A0WA 2J1LA 2OVBA 5H5JA 4D8UA 4EBBA 2Q3BA 2DFVA 1QNLA 4ZO8A 5HIAA 1C7IA 4QEZA 4U7HA 3D6MA 5LMNB 2HLPA 3K0CA 4HSGA 4BASA 3ZW7A 1YQUA 2GPBA 1Q0LA 3JALA 1F7VA 2YWJA 3IKVA 4RK6A 4CMEC 4E22A 4C7KA 2IU6A 3E27A 3I04A 3NLLA 4LTDA 1CR1A 3E61A 1AOXA 3GZNA 4GLLA 4Q6BA 5IABA 1IUNA 4HI0E 3OPQA 3R0ZA 5H70A 4EMTA 3L1HA 1WUJS 2JDIA 1P2DA 3K20A 4OHVA 4DLRA 2N75A 4DAEA 3EAGA 1DXHA 4Z3DA 1W75A 3IUBA 2V4UA 4TSFA 4AJNA 1S8OA 4IQ8A 3WAJA 3BHMA 1TUEA 4MQBA 1G8GA 1G4HA 3VI4B 4EA8A 4TT8A 4KAXA 3AQ4A 4J75A 3AUSA 3CTPA 1OLXB 3NNSA 3GRRA 4HXYA 5IM5A 2ASVA 2CFCA 2QLJA 1JNXX 1YD7A 1ID1A 2J67A 2MMGA 3HN7A 1MOSA 4YO7A 2G40A 4Q1AA 3C3WA 3T3EA 3ZBUA 4WNCA 3QVKA 4DTCA 2PR7A 3CZ5A 5ALJA 2Q1TA 1TCAA 4C0KA 3UTDA 7REQA 1YR2A 2R1UA 2V8OA 3FB4A 4LCEA 1Y7HA 3TVYA 4YAJA 3K6SA 1KZ9A 2HFKA 4B84A 3KZXA 3F0TA 4AS2A 5I45A 4G63A 1H1DA 2IZ7A 3ZJ4A 5K0GA 4IS2A 2E6UX 3PGMA 4DMMA 1O0CA 3HR8A 4PR3A 2IYWA 2I62A 5B2ZA 4BB0A 1Z5GA 2QTNA 3G8BA 4RSMA 3ROTA 4MVXA 2QLLA 5BYJA 3ZIDA 1P3Y1 4UUMA 3TCNA 4R1TA 3CLUD 1TL7C 3R09A 4LVOA 2C4KA 4QZVA 1P4MA 2IHZA 3MLAA 5CBKA 4A7PA 2XA9A 4XX0B 3GLFB 4OYYA 2C84A 4LIPD 3SJCA 5HJ5A 4DTIA 3MGAA 3O8CA 3QRWA 5BURA 1J56A 3VU8A 4MYTA 1I7QB 1GGJA 1RACA 3BIOA 2PWBA 4RADA 5EA2A 2XDAA 1J0BA 5KYNA 2QM3A 4LJLA 3E22A 2H57A 3P97A 3STUA 4B46A 3TLXA 1UP4A 4ZODA 1TRKA 1QGZA 2ZQYA 5A89A 2P5UA 3E9QA 4P7FA 3K09A 1QHEA 2WV7A 3TGLA 1MXFA 2K7FA 3RSGA 1S1MA 3RIYA 1EJBA 1RXWA 1ZI9A 1AC5A 2D2IA 4UPDA 1RMYA 1YAJA 3OKXA 2YY5A 3NHRA 3RVOA 4QUAA 3GV0A 4QWMA 2CL0X 4Y2HA 1VIDA 5DN9A 3KQNA 2H0QA 3GJ6A 1ATZA 5FO1A 2WKQA 2VHJA 4BLQA 1BYUA 2EEZA 4GR4A 4CMKA 1DMSA 4TMVA 4J0HA 3M70A 4N3BA 3UJDA 2MSCB 1Q44A 5EESA 2CWDA 4V0NA 3TPCA 3GLHB 2IGTA 1T2EA 4XIYA 5FTMA 4IWYA 3LAWA 3UW1A 3ZZMA 4XD7A 4Q4JA 5EPUA 4JITA 1B0ZA 1TEVA 1CUVA 2W2TA 1T8WA 1Z73A 3IOMA 4FSXA 2FPPB 4WUVA 4B0PA 3UHPA 4EGQA 2JLVA 1U2TA 3P27A 1T15A 2NZUG 3D8NA 1RRPA 3SZMA 3U1TA 2R8ZA 3U3RA 1XXHE 2C2YA 4FE7A 1G5HA 3IPRA 3TL3A 2Q29A 1H9AA 1Y34E 1EHIA 4YDHB 4CEJA 5KQSA 1ULBA 2DPMA 2CC2A 5EWJB 3E5MA 2YWFA 2Q5EA 4MUGA 3WGKA 1M54A 4WCFB 1P2UA 2C9DA 4OQFA 3LNCA 4OGLA 1AY0A 3M9LA 5COQA 2G0NA 1L4LA 3IB6A 3KZKA 2PBLA 1DG9A 3LIIA 4YALA 2D54A 3GJTA 3F5MA 1BH6A 621PA 1UBEA 5CH5A 1VHQA 2ZVQX 1ICIA 1NVFA 3UK7A 4EW1A 1Q1ZA 4W8GA 5K3EA 1DJLA 4AICA 1KKMA 5KNBA 3VR4H 4A6DA 3DLIA 4K9MA 2HA4A 4ZGNB 2QVZX 3CG0A 5BWBA 3PPVA 2Q5OA 4IVRA 3TTUA 3FROA 2PRZA 4HXGA 1VP3A 5D2CA 3UMBA 2VN8A 2A67A 3G1UA 4DR7B 1PN3A 4AVZA 4UKDA 4UASA 2CEAA 1OH8A 3N53A 1RP1A 3NIWA 1KMIY 3CF4G 3F6BX 2WJGA 3OUZA 4XWWA 4Q16A 3EZ2A 2AX3A 5DNYB 3OO1A 2NVUA 3P9PA 3X44A 2ZIAA 1NPTO 1G1AA 1XD9A 1I7SB 4J4TA 3F6SA 2QSYA 3OHMA 1RXVA 4JJ7A 2YIVX 2ZT8A 3CG4A 4NAUA 3TOSA 4Z4FA 4F5ZA 4XGQA 4ZV9A 2QEQA 1HT2E 1KO5A 1PI3A 1TM2A 5IANA 4Z1OA 2OO7A 3FWZA 1G41A 1MUUA 1SZPA 1T3GA 1VMIA 2IBSA 1DAEA 3E2PA 2JGDA 2AOXA 1ISMA 1USUA 1IUPA 3E9EA 3QVTA 1R3UA 2Q4EA 2CXRA 4LG1A 2FW6A 4KWHA 1W2GA 4OAOA 3W78A 5FUMA 5CNKA 2QD4A 1PO7A 2V7EA 4EB6A 4V1CA 3BC9A 2FG6C 3INYA 4ICIA 1N5KA 2G76A 3L0CA 4PAGA 1E4YA 1PX2A 3TLKA 5C52B 4UTOA 1L5KA 1K6JA 2GLUA 1O0BA 2O5CA 2JHFA 5K3OA 5A7HA 2FJ0A 4L8JA 2OO3A 3ZJYA 5KYUB 4YN3A 1PZHA 1JYEA 1BDMA 2Z4RA 3G9QA 4ND2A 4IHJB 3NRJA 5JR3A 4LF5B 1E96A 3U3ZA 4NCXA 2DUMA 3GT7A 2AF3C 4OH7A 4RULA 3A36A 1LRJA 4QYSA 5C5EA 3SOZA 4JXZA 3DV0B 1TJ3A 1XA4A 1Z0UA 2VJQA 1KNXA 4EUFA 4G36A 4DA0A 2EWVA 3S1AA 2GJ9A 2O2XA 3D8UA 4ZAGA 5ECWA 1NN3A 1PVDA 3ZGLA 4JI4B 4NBSA 1J9EA 1GNSA 1O7JA 2ZP1A 1JXMA 1CUIA 1L4UA 3LDUA 3NE5B 2AZTA 1GO2A 3DO8A 5HTOA 2GZDA 4EK9A 2DPHA 4JUIA 1H0KA 1GKIA 4U6SA 2IPXA 1GRRA 1D4OA 1OX4B 1WLSA 1T5LA 1VJDA 1X42A 3AB7A 3B6JA 3IMEA 4QQNA 1J90A 1VI5A 2Z6QA 4LF9B 2I3DA 4FFBA 2CZGA 1DC4A 2I2DA 2XWBF 3ETJA 5ETJA 4JLSA 3UN1A 4EY8A 3TTYA 5EPOA 1UJMA 1ZC3A 1UPBA 4ZA2A 3UMVA 2WM8A 2F64A 1SXQA 3I32A 5CX4A 1DRUA 5ARBA 4LNUB 3R9XB 2GTIA 1ESEA 1XMVA 3PRYA 5CYOA 3TS1A 5GVSA 4TMWA 3T1YB 1C7QA 1QH8B 4ZVRA 4UQLA 1B8PA 3LTEA 2XUIA 1DEAA 1U28A 1UBUS 3CNOA 1RQNA 1XQ6A 2WHPB 3ZY4A 2XWQA 4ID9A 1W25A 2REOA 1DV1A 2KB0A 3NAMA 1M2JA 3PC2A 1YB1A 4HDKB 4E4YA 1AO0A 3DTVD 4UUPA 3M3HA 1UM9B 2FHPA 2HJSA 2ZJZA 1E6KA 3CLKA 4R2XA 5CW2A 4ZRDA 5K20A 3KOYA 1SWVA 4ZQEA 1OB5A 3LWNA 1T0UA 2PZMA 4JH0A 4N3AA 3V3KA 2XNDD 4YS6A 3T4UA 4L4XA 1M8FA 1C4XA 4UOQA 4D9KA 1MQ8B 1EQUA 2NTEA 5AUQA 1TW2A 2B9VA 2ICAA 2OKGA 3MWJA 3QELB 3V97A 2IZOA 4Q18A 3CZCA 2H4JA 3FJ1A 3FX2A 3QXXA 5B58T 1XWIA 1B8VA 4OHXA 4F1JA 3L4EA 2A0UA 3OIUA 5CCEA 1QHIA 3GLIE 3KAQA 1QYXA 1M72A 3PEEA 2Y6UA 3PWKA 5TR9A 4INAA 3ZD8A 2C94A 4MWTA 4AZVA 2RD2A 1RWNA 4C9BA 4WMLA 4HN9A 3RV3A 3QP9A 4WZTA 2M6KA 3G79A 3S29A 2ZUEA 5AUOB 1LKZA 2W6JD 3PFKA 5K6TA 1V8PA 3ZVLA 1PT5A 3G02A 4NJOA 4PGAA 4PAOA 4Q7MB 4U5QA 3KR0A 2P9EA 4QTZA 5EXSA 3EDQA 3HA2A 1TTPB 4LDJA 2X5OA 5ALFA 4IDHA 2V5UA 3LHKA 2YZ7A 4HKTA 1JHZA 1VKZA 1Z6QA 3VYUB 1R1DA 4BVFA 3UICA 1W0CA 4FQ5A 3E0QA 4AP9A 4FHFA 2XUKA 2RAVA 4G3XA 2H9IA 4RS3A 1USIA 1ZH6A 3PIIA 4GZLA 4LYGA 2ZAGA 1B16A 1M1XB 5LB4A 1E4VA 5AW2A 4XPIB 2ZJ4A 1BXRB 3CNLA 4EHDA 4P4UA 1EWKA 1OZ0A 3KCNA 4W1PA 1EXVA 1L5OA 1BSVA 2ADOA 4Z99A 3D4OA 1KI1A 1ULTA 4YJGB 3FUWA 3NCTA 1WW2A 1AS2A 3VU9B 4J91A 2PE5A 3I2FA 1SCBA 1EX1A 1VQ4B 5I7AA 3S2UA 4DPKA 3CEMA 2PE3A 3WJ2A 2FMXA 5AW9A 4EG7A 4BY9E 1U94A 2M1ZA 3I4LA 1G21B 3ONVA 3PJFA 1GWNA 1HZEA 3C87A 4LV8B 4R71A 4OY3A 1PSDA 1I6WA 3KTOA 2AD5A 4S12A 2HQBA 5HEKA 3EXHB 3IUNA 4LN1A 2QN6A 2HI0A 1K5HA 1D2HA 2D1RA 1LDGA 3GRKA 2CE7A 3TSAA 2CUZA 1BPLA 1KMQA 3H7IA 2C2WA 1ZN7A 4NFHA 1PU2A 2IIVA 4YRDA 4NMLA 1Y5LA 2AW5A 4C6TB 1AB6A 3WDKA 4LDQA 1NLFA 3LKZA 1R0WA 1Y6QA 4G86A 4O08A 2BMVA 1VRCA 1HT1E 1J00A 3JU4A 2EEPA 3VDMA 2XZOA 1QB8A 1R6XA 3AV0B 3OQIA 4KAFA 4DV4B 4BQSA 4HV4A 4EW6A 1M1KD 2QUZA 3IELA 1MO6A 3DYBA 3TNYA 1WX1A 4PHHA 4HFMA 1Y3FE 1TM4E 5I4CA 4UUQA 2PPLA 2XUQA 4K3VA 4WW0A 1A88A 3Q8LA 1C3XA 3UBMA 1EUYA 3B12A 3EE6A 2WAMA 3OLCX 2V9PA 2EFYA 1LWOA 5H16A 2VNJA 1RABA 3E7XA 3GRUA 1WXEA 4Q4LA 3ZY6A 1CEEA 2QP4A 5CMLA 5JCOA 3AU9A 3N5KA 4JBIA 1JVBA 3DD1A 1OFHA 5EJMA 4JI8B 4QFMA 3O93A 5LBTA 2FEWB 1GGKA 1MRSA 2P1RA 5AOBA 2B6HA 4R9NA 1QOZA 1QO7A 4PC2A 3WRVA 4WIAA 1KO4A 1CDDA 3K6KA 5DH9A 1T4BA 3VC1A 4BKPA 2EFCB 2VP0A 5ECDA 1FTWA 4F1WA 3AW9A 5AUPB 3PLNA 3ZKWB 3LQRA 1KYQA 3VA7A 1U6IA 3IBYA 1EHYA 2FR1A 4PRKA 2D2FA 4R1OA 2AQIA 2Y1EA 4IUYA 5J2TA 1XKXA 3D31A 3TUIC 4XORA 1QVVA 2GKGA 2Z5VA 3E3NA 1OUMA 3Q9SA 1I8DA 3A8KA 1JKXA 3R9WA 1WZIA 1Y7TA 3K0CC 3DHWC 4MA5A 4EA9A 3I09A 2E5WA 2VDMB 4G6ZA 3R3YA 4FGKA 1E5DA 2RBGA 1ORRA 2A9RA 4C4PA 3QX7A 2RDMA 3DZHA 1YIOA 1PT6A 2D59A 1UKCA 4DLLA 3I5UA 1AA9A 2YY7A 4TYMA 2IDZA 3WHPA 2YJGA 4UPVA 3ZGYA 1N5DA 1F06A 4PX9A 3UK2A 1N25A 1T8RA 3F6YA 3HP7A 3HVIA 1E32A 1XQBA 2RGNA 1B8OA 1ENPA 3Q3IA 1CUEA 1SOVA 1TMOA 2WUWE 2J3KA 4RE6A 5DTMA 1V7PC 4DHEA 5JJIA 2Z6UA 4INPA 5JADA 1ZX1A 4WXMA 5BO5A 4Q93A 4X05A 1JMYA 1U99A 4KQ2A 2WF8A 4I4CA 4ZPXA 2Q0XA 2I6TA 1NKTA 1CY4A 2W8ZA 4TXJA 2O5EA 4GO1A 2IU0A 4H35A 4IIHA 4OF4A 4ER7A 4WA8A 1VCIA 4WV3A 2QJWA 4O0LA 5DHRA 3ZQ6A 2NP7A 2V6MA 1KE2A 2I1LA 1Z33A 3EJWA 4MW1A 2V7QA 2UZAA 4TKOB 2NZJA 4IMJB 2FVXA 4JKOA 1S9HA 4N3NA 2DPXA 5F76A 1PDVA 3SG0A 3ITDA 2JK1A 2P75A 4KL8S 4FWIB 3PVSA 4HB4A 2WD8A 4KQKA 5K4AA 4QARA 2OKCA 4FYMA 1UDAA 2B61A 3PA2A 3VPXA 2BF4A 3F9CA 4LGMA 4DZZA 2B9EA 4Y0NA 1CERA 3Q5GA 3ZE0B 1RBZA 2JC3A 4KC0A 3DG9A 3QQPA 3EW7A 3QEOA 4B83A 1XN1A 2XT6A 2FGKA 1M75A 2EOAA 3O4HA 1SCQA 1E1LA 5KNCD 2BFFB 4F5EA 2F9LA 5DOVA 1XELA 4B47A 1E7QA 4BKMA 1E77A 4ZANA 3JWPA 1K73D 1FP2A 1KOJA 2Q1YA 3JCZA 3PR1A 4BLVA 4LRTB 4E1VA 2EKQA 2XZDA 1MBZA 4ZHQF 3X1ZA 3G0OA 4I14A 4D9EA 1Z8FA 1QAOA 1BEEA 3DLCA 2QYTA 4GE3A 1DWOA 2JLSA 4LQDA 1QIMA 3TKAA 3VHQA 3K09C 4BRWA 5I9NA 3MPUA 4NEQA 1CB7A 4C76A 2ZBVA 3IAEA 3GT3A 1ODJA 5JEDA 5E0KB 1UD2A 1NYLA 3HBFA 2J3IA 4URXR 2RE8A 4R1PA 1EWVA 1Z2NX 2AQKA 1WV0A 1DO2A 2IYYA 2JBHA 3IVCA 4HZUA 1G63A 4J1SA 3BA1A 2XXAB 1Z2CA 1SUSA 3CLUC 2ZYHA 3ZXIA 4DQVA 3ETNA 4CI9A 1JKJB 3WWPA 3WNZA 3LOPA 5GONA 2FZKA 1DELA 2J5QA 2B30A 2JFQA 5JYDA 3G6EB 3AKYA 4P31A 4Y3UA 3I64A 4I4IA 3GCZA 4KXVA 5FR1A 1YITB 1K4KA 4ZVQA 3RJZA 1AQNA 4PBSA 4YRSA 4CCSA 2PT5A 5I9BA 1MOPA 1U3WA 1VKOA 3K2QA 3MJHA 4L95C 4FBLA 4MGIR 3WIBA 5A5FA 3KLPX 4RKEA 1IE3A 1NQTA 1SD5A 1SB8A 2J59A 3P0IA 3PXCX 3GIDA 4GM4A 3TL6A 2NQTA 3DC7A 2GRAA 3WZ2A 4C4RA 1WORA 4DM7A 4DOMA 2Q3FA 3DVAB 3I1IA 4ZYVA 2F4NA 1IXKA 3UGJA 3NXSA 1TC2A 3D8HA 4YUVA 3U5TA 4UUBA 4ZQFA 2C5EA 5KZMB 3NTRA 5DGTA 4ZVNA 5LMZA 1XOIA 1JDTA 3F46A 1GZUA 4M87A 5I3CA 1UPFA 4MS1A 3SBOA 5I8PA 1MMFB 1I18A 3PJGA 3SQNA 1J1IA 3MJDA 2HDNB 4LNHA 4TS3A 5FBHA 3JQ7A 3A8JA 3GIRA 3AHJA 4NYMR 4RK4A 1F1BA 3OPYB 3AUFA 2GSDA 4J0EA 2PXHA 4KBYA 4M55A 4WLFA 4E07A 3VH3A 3A6ZA 2RK4A 4G0PA 2KSQA 4KIFA 4QHSA 5ARCA 2XUAA 4IXWA 2G0AA 1U0TA 4IVNA 1AS0A 4Z86A 4UJ3A 3SY8A 3WGMA 1V11B 2JI6A 4LOHA 1SKUA 1VE9A 1PWYE 2C3PA 2G25A 3HA3A 3ZU4A 4YEDA 4H17A 3LFUA 5EMJA 3S8MA 1QV7A 1VPEA 4BQNA 3CUTA 5EJ5A 1TTHA 3CMMA 1GLNA 3A1TA 3RIXA 4DKXA 3PQCA 2CE2X 2GN6A 1C30B 4ZKDA 5BP7A 1Z34A 5DHSA 4F3YA 3TINA 4Q4HB 3IHLA 2FP4A 1A69A 2A33A 2AKAB 4DCPA 2I2FA 5GZ1A 1KEEB 3ZHZA 4TWZA 1KNQA 4DV3B 3LY5A 4Y2UA 3ZLTA 3SR3A 3Q3AA 3TSZA 3N76A 3KXIA 3T1OA 1LA2A 2XAUA 1QC5A 1TEXA 2SKCA 4RH0A 4J9VA 3OHPA 4X8OA 1A7JA 1XVIA 4LOAA 1XG5A 3FTDA 4PCUA 5LQMA 1U0JA 1U7OA 2L82A 3VO2A 3DOFA 2XYRA 4QJBA 2PFGA 4QNRA 3HDHA 2OBTA 1RXCA 2VSNA 2Z2KA 3TQCA 2AS0A 2CT8A 3BXOA 2ZYVX 3TZBA 4IFEA 2E4YA 3A3YA 1NN0A 1I8TA 5E9JA 1GD1O 3W6UA 2M5SA 4V2UA 4QWWA 2O8VA 3SQMA 2NV2B 4Y2XA 1L5WA 1QIHA 5TJ9A 3CD6B 2NUAB 3ZR4B 6YASA 2WJ6A 3WMGA 2ZBGA 3LFTA 3ICQB 1QHSA 4BNWA 4C3OB 4WQMA 4NE2A 1JHDA 1U0FA 5LD2C 1LVUA 3GRVA 4MYRA 5B7GA 2ZGVA 4X1IA 3EEQA 4YAUA 4M46A 4G1EB 5I9SA 2XMRA 1E2DA 5A05A 3H9NA 3ASQA 1P0FA 2Z4TA 2Q9BA 2GK3A 4KXYA 2R3SA 2XB8A 3SYTA 1A9ZA 3EGOA 3HSYA 3V32A 3WWEA 2ONYA 4LY6A 4NR0A 4YRLA 1CZUA 4BLRA 3UAZA 2GM3A 3S81A 3Q0EA 4JYMA 2VZ8A 2O5VA 3GLTA 4P82A 3DBHA 4J9UE 1I3LA 1A2KC 1GR0A 1UZAA 3UJ8A 4DUGA 3PNSA 2O50A 4F3CA 1LRLA 3CWCA 1W8DA 3OJOA 2FWAA 3FNBA 3WHIA 2XCQA 1MAAA 4BIMA 1QG6A 4N6NA 1BFKA 1KU0A 4KKTA 1JIQA 3ZGXA 2OCLA 3ZLBA 5JD6A 5DYTA 2J9ZB 4P36A 5K2OA 3AEUB 4POOA 1O6BA 4TTVA 1QF6A 3RT9A 3TJZA 3TQSA 4X61A 3DVLA 2PY6A 5A3QA 2PX5A 3MTAA 4LC1A 1V1MA 1YR7A 1MPXA 5C0OE 4MZDA 1UKYA 3Q3CA 5FI0B 1WDTA 1U28C 2IX9A 2OTJB 2VNAA 3ESYA 4FYHA 4IOLA 4ZP1A 1NW3A 2VDWA 1PW5A 1OASA 1VXOA 2QN9A 3I61A 3ORQA 4Q24A 2IF2A 2RGYA 1U9CA 3ITEA 3THWA 1DWQA 3KB2A 2PUCA 2G4LA 5GONF 4ZOLB 1EK0A 4OFBA 5T5QA 4MI3A 1P2FA 5B64A 2I29A 3ED5A 3O3CA 4UNQA 4LJ4A 2GKSA 2WAXA 1HDRA 2V74B 5TMPA 2ZCJA 3OF3A 1UPXA 5K5EA 3ILYA 4R2IA 1QH1A 1I80A 3NC1C 1RYZA 1OV4A 3HCBA 1RS0A 5C4IA 3TLJA 2FMHA 1FE8A 3FDIA 3TQOA 1E60A 3Q3EA 5JSZA 4BN5A 2E37A 3NUGA 2Y71A 4RQBA 3H87A 1L4HA 2W8BB 4JROA 2OGZA 2QL7A 5EWMA 2WA1A 4D9NA 4IIVA 1SVOA 1I5EA 1CEYA 3M6MD 5T67A 2ODTX 3IS3A 3IQDB 1K7XB 4JX9A 4H7JA 4QDOA 1JR3A 2P5TB 4MR8B 1EZ4A 2ZSBA 3GA5A 4BEBA 5BSFA 5KOHB 1IZ8A 4BO5A 1R5BA 3CR8A 4IIDA 4JJZA 1PG0A 4J43A 1TGYA 4UVEA 4N5MA 3NEJA 4ZVKA 3RYFB 3CCEB 1P7VA 1SC6A 2JBWA 2ZTMA 4ML3A 4WEQA 1MCZA 1M76A 1W9HA 4X5OA 2JLBA 1QCCA 4W5QA 4HDSA 3S2ZA 4L8LA 5KWIA 1WQ4A 3OM1A 3VYWA 1YB5A 3P2IA 3MUOA 3WE7A 4AROA 1MOQA 5JXIA 5AXAA 3KM0A 2BM1A 3SIWA 4Q4CA 3GL9A 1E1YA 4NV3A 1ETUA 4JL8A 1EA5A 3NR2A 3AFNA 2ZTUA 3N2YA 3FZYA 4R69A 4X7BA 4GOOD 3A4VA 1FSGA 1YHQB 5ICMA 3C43A 3D7KA 2I1VB 3GJ4A 3N0VA 3SF8B 1SELA 3F3MA 4G84A 2DETA 5DE3A 5FJIA 1WULS 1P1BA 4H6WA 3RU2A 3TLZA 5KMGA 1N4AA 4JLKA 1DO0A 2QZZA 2W6MA 2WYWA 5AM4A 2B4YA 1JE1A 4AZTA 1AKYA 1II9A 1U7HA 4F6RA 5A1TA 4NCAA 3IA2A 3HB9A 1UDCA 2HV9A 4OLFA 4RFSB 3WFZA 3WMWA 1EFVA 5L6MB 5AW1A 5DTEA 3ZWQA 1XTKA 4Y2QA 3KQLA 1DIGA 5KTRA 1N77A 4P3NA 4NENA 4BFWA 5CCDA 2HCJB 4XR4A 4YJKA 4DEYA 3F2IA 1SXPA 3F96A 1Z63A 2RGGA 3L06A 4C0HA 4DMUB 4P58A 3GPLA 3FGPA 1X38A 3A1DA 4CV3A 1QYIA 1AQIA 1X80B 3HLKA 1YBFA 3IAAA 3A06A 1D6SA 2A1IA 3CBQA 3MJEA 2Q2VA 4GGMX 4FE4A 4UAJA 1SCAA 4MO9A 4WACA 4QBIA 4ZIRB 4Y1RA 1XCPA 5JNWA 1YRBA 1EU1A 1J8FA 3K1JA 1AHNA 5H59A 3VPSA 4BP8A 4ANFA 5J1SB 2VBGA 2NNLD 2VWQA 1QQ5A 1W2HA 2FPXA 1N0HA 1WS6A 4RIEA 1DAKA 5JVDB 5DHAA 4FCCA 4QO7A 4TVKA 4MAFA 1HXHA 1MH9A 3EC1A 1ST2A 4Z0PA 2JFPA 3ZNPA 4ZAVA 3RRJA 3I72A 1DQSA 4BTVA 3KQKA 4RIHA 3ZNQA 2CVZA 2DVMA 3GDWA 2ZZKA 1BHO1 5JCOC 1PIWA 3NHKA 3KTAB 3DKVA 1KO8A 2PZGA 4O4JB 5JG7A 4TLMB 4YV2A 1LDBA 1VIAA 2Q3CA 4DY6A 4YIHA 1Q3HA 3IKTA 5BNZA 1J2UA 3GH3A 5DZSA 2OCYC 1EFDN 1DJPA 4NJMA 2H4HA 2HGSA 4Y6SA 4BVBA 4M99A 3H4MA 2JGJA 1H5QA 2XGSA 5AW8A 1OH6A 4YI5A 4PEVA 4BDSA 3DLPX 1RRGA 1XMPA 5BMVB 5A3RA 4K1LA 4ZD6A 4LV5B 2QB5A 2P9GA 4ID3A 3DBRB 3CUUA 5EVCA 2G08A 4JNKA 2Z6BD 1ZUNA 4ALNA 4BX2A 4QO8A 3OG9A 3M0EA 4S1NA 4XEUA 4BEWA 4LY3A 2XGOA 2ZB4A 3IIIA 1QS0B 4JP1A 4KJXA 4G0UA 3DDOA 1NTOA 3VR1A 4US0R 4HBGA 3AL0C 3TX6A 4I8DA 5EAIA 3JQAD 3ICWA 4RM0A 2X77A 3OJFA 4UHFA 1XP5A 3ZQJA 1KH3A 3UGQA 4Q1EA 5I9MA 3JRNA 4DJ5X 2H7XA 1BOOA 1VC2A 2WUFA 3L05A 4UATA 5BN3A 5JEEA 2DKOA 2PUEA 3DLBA 2EP8A 3WO0A 1ZCAA 1O54A 4J4HA 3RKRA 4I4TA 1D8AA 5LN1A 3P7MA 4MWSA 1Y42X 2IQIA 4HNSA 4ZKEA 1FDWA 2HF7A 2K5UA 1WPQA 2D8AA 1Y3CE 1LVHA 2BHRA 2RGNC 3CLTD 2BEKA 3RB8A 4A0FA 4BQFA 4E2FA 1MX1A 2IEZA 4Z4TA 5EOVA 1P91A 3LLUA 5ALWA 2Y2UA 1HDCA 4OBBA 2JS7A 1E5QA 3BWDD 3SCZA 3TJRA 1NQOA 1QF7A 2I2XB 2GM5A 2YQ5A 3KO8A 1M34E 4H1UA 4L8YA 3LKDA 3AUUA 2XE4A 1UT8A 3TG2A 2IUYA 1ZESA 4IVPA 4E09A 3FETA 3LOQA 4WI1A 1B3BA 1JDNA 4A03A 1UD8A 1BS1A 1SAYA 5TS2A 5C8DA 2Q9CA 2TRSB 4HWSA 4B75A 4LWPA 4NQZA 1FB5A 3OCXA 1Q0TA 2OILA 3MTBA 3SYKA 2ZSUA 5IJWA 3THRA 2ZROA 4YUZA 3VBEA 2NXCA 2OQRA 1ZXBA 4IWXA 4LV6A 4HEQA 4CTMA 4WLOA 4M7OA 3OLXA 5AFSA 3EAQA 2XYGA 3I9MA 2B4TO 1Q0SA 3ZDCA 3OCUA 4M0UA 3BRQA 4YQEA 4ZO4A 2J30A 3OJCA 5FI1B 3RBVA 2A86A 4I50A 4DW8A 1UMCB 1PKXA 1BWRA 3ZKAA 2HPVA 2PO7A 2CDBA 3A4YA 4KYUA 2NZYA 1ISSA 4BGVA 1RYHA 4CVNA 1N8NA 2J5BA 4XQCA 3WB0A 1MRNA 1RRVA 1MKYA 2QXTA 4QGBA 2CNDA 2AQHA 5REQA 4BMSA 5FWXB 5E0OA 4Z3OA 2AC2A 2G77B 1DKOA 3SAJA 1VPWA 4Y6PA 1Q15A 3EXIB 3K9FC 2OLKA 1G8JA 3D02A 2ETVA 1RWBA 4R2JA 1I1HA 4ZCLA 2B35A 5DXAA 2NO9A 4Q01A 4RA6B 3DCJA 2WZQA 2ZTGA 3OEYA 2BEJA 1N1EA 1ONBA 3GGSA 1AMNA 5CA1A 2PGLA 3SOPA 2XOKA 1ZMBA 3GEEA 1VQMB 1LBIA 2IU4A 1TYEB 2QROA 1J9ZA 2D5AA 3GDOA 1WHSA 2C2ZA 3D8BA 3AY3A 2BFAA 5TLSA 3EHEA 1NJID 3O8OA 3A70A 1AKNA 3WHLA 1W9MA 3TZLA 1CR0A 3GRZA 1B26A 1G9SA 4IDNA 1JAYA 4JFRA 1W4LA 2FRDA 3X2SA 2HCBA 3FDZB 1O96B 1R9JA 3IEIA 1JWAB 1QU3A 1TA4A 1VHDA 1NATA 3D7LA 4NU5A 5KYYB 4C7BA 3KTDA 2CXQA 5KHAA 3CHYA 1JG4A 4ZALA 2ZUFA 3CJQA 3O9ZA 1SVIA 4DIEA 3UA3A 1YCGA 3ASUA 3PDJA 1JA0A 4NBRA 4A23A 2W90A 1U3GA 4RM2A 4EZBA 2HD4A 4OV6B 1WXHA 3Q7RA 1H8EA 2C78A 2GCOB 2VDJA 3CR7A 4JUCA 4OMDA 3TXAA 3DEJA 4DNFA 3F73A 2PKYX 4DMCA 4ER0A 4HUTA 3MJFA 4O5OA 4F93B 1RQPA 1XTSA 1F17A 1M2GA 3QEKA 4L9RA 4BUCA 1VYVA 4UCWA 1GN8A 3GFQA 3HKCA 1ZD8A 2AR7A 2DQSA 2IA5A 3DL2A 5I7EA 4RO0A 1Q2UA 1R0YA 2GO7A 2YRFA 4FKBA 2O7VA 1YIJB 1H6DA 1V8OA 2HLDD 1XYVA 3E3OA 1B41A 1WV1A 3KU4A 3LX6A 3PEVA 3PQDA 1YJ8A 1E0AA 4K26A 4LOLA 2ON6A 1RYNA 3WJAA 1UXGA 1JILA 4RCZA 3O92A 2Q1XA 4JNCA 3IO3A 2SCUA 2Q6VA 4REQB 1QDUA 2J5RA 1NDHA 3I4FA 3KZVA 4U39A 3ENWA 2ZZFA 1T5SA 3OLQA 2PS3A 1XZEA 4LRSB 3RV4A 2ILTA 5F1OA 4BAGA 1ZOPA 3HVHA 3ZK7A 4BZZA 1BCSA 2Q2QA 2ZBRA 2FVGA 1RWVA 1H2YA 5CDGA 1DBIA 3QF4B 1K92A 3MINA 1DSSG 2IYVA 1Z9BA 3A4LA 2Q99A 2GFQA 4KVZA 5TDHA 3QVVA 4HSEA 3HWX1 2CNWA 3NWOA 1NXXA 1WPRA 4J0IA 4XYEA 3RD5A 1QRAA 3E53A 5JZBA 3FMPB 5D01A 5HCUA 1SQ0A 2QAGA 2IZ5A 2WVAA 3KZCA 1EEXB 1QXSA 2Q1UA 5FYDA 3SJAA 3TWOA 2BJHA 3DMGA 5JZVA 3B52X 3BB4A 4KRYA 1E3MA 1SEVA 2Z98A 1W5SA 2B78A 3HJBA 3MGCA 3WMRA 2CMGA 4M88A 1PSZA 4HAVA 1BW9B 4G67A 5C9ZA 1P6QA 2Z1DA 4I4TF 3V4OA 4CCYA 3H2KA 1OFUA 2UYYA 2X22A 3H42B 4TYPA 4F2DA 3ZJTA 5ECGC 1C8KA 1XK6A 2VPTA 3L82B 2I3GA 2P91A 1HR0B 3BSYA 1A4XA 3N7UA 1FFBA 5CLJA 1E59A 4P4SA 2QLNA 3MNFA 3DE3X 4GR5A 3PJEA 1E1RA 5JAHA 1D03A 2JLWA 1VDZA 1EWRA 1BKSB 4K40A 1JLHA 2BY4A 1TUGA 2WSLA 1PNQA 2P27A 5CVCA 4JI2B 1ZOLA 3R5JA 1LNQA 1XMXA 1HKUA 3MHTA 3PUJA 2ZIUB 1TJPB 2ARKA 5C8YB 2UYQA 2GGSA 2HMTA 1IY8A 2VRCD 4NRDA 4CF3A 2GEJA 1ODKA 3BAFA 4J4BA 3L07A 4HK4A 3RFFA 1I30A 1X6VA 4FN5A 1P4JA 2O0MA 1ZXXA 2WM9B 4RD6A 1UBMS 3D0QA 3D2CA 1FNCA 1X92A 3GD7A 3K4HA 3KZ1E 3GVKA 3I76A 3NKVA 5K3SA 1E6LA 3IAS6 3O8LA 3WLOA 1RZRA 3Q1LA 2I4LA 3QNMA 3D3JA 3CJTA 4MPJA 3T9DA 4E3ZA 1YU6A 2VPYA 1E4OA 4JI0B 2HSDA 5DU2A 4A26A 2GBLA 2PX0A 3CNHA 3HHPA 3G5LA 4I50F 2VI5A 5J3OA 4J03A 4FGSA 1Z38A 1W581 2HA5A 1YHNA 1F6BA 3JU3A 1N92A 3A2MA 3IAS1 1GZHB 2A57A 3IRUA 3PWTA 4I08A 4JODA 9LDTA 4BNNA 3HGTA 4MVJG 2YIDA 3ZNOA 3NM4A 2HMWA 5AVKA 3CZQA 4HG2A 5AT1A 1RAGA 3CM0A 3L6OO 1AQJA 4UTNA 3CRQA 2CFSA 3NWEA 5EXEA 2R6CA 3R24A 1NVBA 1KGSA 4UBJA 3J7AC 3BB1A 1IN6A 5ALKA 4HVLA 2VRCA 4MDEA 4RKFA 5AI6A 3UHJA 4Q00A 1FDSA 1VCNA 2A30A 2Y05A 4UMEA 1D1PA 4HT3B 4RD3A 4YUYA 5J47A 1XVLA 2C4HA 4TPKA 3OFJA 4EJSB 3DO5A 4EI9A 3WYBA 2AWOA 1L5YA 1QHHB 1XTQA 3AIMA 3GVCA 3ZOKA 1I32A 3LBAA 5CA1F 1UKBA 1TA0A 1NRKA 2C04A 1BMDA 1IHOA 2YMLA 5IASA 4RKYA 4OIFA 3NHUA 3T7JA 1QF9A 1KHTA 1BQ3A 3PKIA 5EPEA 4QUZA 3HYLA 4UVDA 3SZGA 5G1NA 4DY4A 1CIVA 1GL9B 3EIHA 5J23A 1QRRA 1L4YA 2DCMA 4L9AA 3DAOA 4WLEA 5JQGB 3ZE1B 2D7JA 3IP9A 1Q0UA 4YP9A 1TQ4A 1K3FA 1ES9A 2AUMA 3NRCA 2BFCB 1AKTA 3UWPA 1DHTA 4FMDB 2GD1O 4NBTA 1DQPA 2QRGA 5FA6A 3CEPB 3UXMA 3MAGA 1ODCA 2BKLA 3NT2A 3ZD9A 2AJLI 3RKSA 2XQKA 2ID7A 1G6HA 3ONFA 4ODIA 1UMBA 4AY5A 5AVTA 2ORVA 1UAYA 1H8HD 4YHBA 1TF5A 1R6DA 4Q1BA 2IS6A 2OG2A 2JLZA 1N0IA 2RBKA 4B45A 4WN3A 5H1YA 4B74A 3QV2A 2C4MA 2H2DA 3KQPA 3PCXA 1WUKS 4FI3F 2Q28A 3FYDA 4KN8A 2OWEA 5BWCA 1O77A 4M76B 2AXNA 1N2SA 3I6BA 3PGA1 2WTUA 4HNGA 5EIFA 3WYEA 5EERA 3VYRB 1QYDA 4H7IA 3RT7A 1V5GA 4DJEC 3Q5DA 5BSUA 3NYWA 3JWJA 1W1UA 5CDFE 2QM8A 2VPXA 3V7UA 3CNBA 4ARZA 1NQAO 4A2QA 1Z4IA 3MRXA 4Q1DA 3BHNA 3DBLB 2WKWA 3CF0A 3VVMA 1E99A 4XDYA 2XCOA 4QOSA 4AJ2A 4FYKA 2VF5X 1PJ6A 5AKHA 2ZI3A 3OPXA 4EPWA 4TZKA 3V33A 3HXLA 1QYWA 1ZGCA 4GMFA 4NCJA 1WP6A 2CCGA 1H8HA 3R44A 4WDRA 4ON9A 3PF9A 4DRZA 3B8HA 1Y3IA 2I3BA 2IYUA 2VHYA 4WKOA 4A1OA 3CMEB 1N8RD 5A0VA 5KB3A 2VYVD 5EQJB 3FSEA 3K1ZA 4B3DA 1YKGA 5B6PA 3OH8A 4Q03A 3R6JA 4Y9TA 1HE5A 4DIFA 3RUEA 2PBFA 4BMNA 4DNOA 4JLJA 4ZOBA 2JD2A 4AN4A 1GU7A 1BDIA 2P62A 2X0IA 3GVPA 4KRFA 2H8GA 1VL6A 1IOVA 1NUUA 2FPOA 3EEOA 4WDQA 1ENOA 1YB2A 4O4IA 1BQ4A 1JIKA 2J3JA 2VP3A 1IG0A 2LZJA 2ZS8A 3ESZA 3RS5A 4BC0A 4CKBA 1FJXA 1G7TA 2C0QA 1WIWA 2XNHA 2CJWB 3BK2A 1Z6TA 3DL7A 1EWYA 4RHEA 2XMDA 4YJ3B 1LPNA 2PO5A 3FSJX 1GAXA 1MQ9A 2IU3A 5IX8A 1RPZA 4XN0A 1YHZA 3FSGD 4CTNA 5KTOA 3U16A 4HNRA 3CRZA 1AURA 2NU7B 1T5DX 3BEOA 5E95A 3B20A 1DPGA 2POCA 4HAYA 5DWDA 4H4CA 3DAHA 1UEXC 5TIIA 1FFXA 4R54A 4OA8A 3KEQA 2NU9B 5L46A 2Z09A 4CHTA 2Z2XA 4ENSA 2LZ0A 2BUAA 4IDEA 3KD3A 1E7RA 1XAJA 5DN6A 1KHHA 1B15A 1XCBA 3DWFA 2K6GA 1KI8A 1KK1A 2HEGA 2FFAA 2P69A 1HEUA 1C0EA 4IFIA 5FOSA 4KQ6A 5FPYA 4ES6A 2G7MC 4OMUA 5HIIA 3HQ4O 1WTAA 1GYPA 3I5MA 4WBNA 4BO8A 2RHOA 1P5JA 3L1UA 2NXWA 3PSHA 3QNUA 5DHUA 3MTIA 1RYDA 3L6CA 4D9GA 3L92A 1EX6A 3IV6A 4HNUA 4Z9XA 3OOWA 3SKVA 6REQB 1VJSA 5CFLA 1D1TA 3STYA 1G60A 3UWDA 1VI2A 4GOKA 2FDCA 3QUBA 4Q3LA 3CV3A 3OZCA 3TMKA 2CYCA 2WIBA 2HDWA 3DC2A 1U3DA 3QLVA 1H2HA 2GASA 2UVQA 1C7JA 1KZGB 2FFBA 2WA2A 3DOJA 1OGYA 3WLPA 3HU3A 3CZ4A 2X6XA 5AM5A 3TRFA 4XVHA 2GPNA 1JHVA 3JPWA 4QQFA 1GPAA 2VZ9A 4BB9A 5E9WA 1H9CA 1L4GA 4WFKA 1SBIA 4RENA 5BSEA 4HPJB 2VFAA 4CPDA 1RM5A 5C7IO 2VQDA 4E5KA 1RYBA 2G1UA 2IBMA 3T1VA 1OWMA 2WFZA 4P3OA 1IHUA 1NTRA 2DHCA 4I4LA 4RHUA 1ISFA 1KAMA 1Y9EA 2OCXA 3DF7A 1YK0A 2LV8A 1IULA 2N9UA 3LY9A 5FWAA 1ZIDA 3ZHYA 1KOFA 2H52A 3LGXA 4NMXB 4RORA 2I6GA 1JBQA 3M1AA 5HCNA 4C0AC 3FPJA 3FCYA 1KORA 3ISTA 4G8DA 4OU5A 3VR2D 5BR1A 4HLNA 4XOPA 3C3DA 2HM7A 2JLCA 3DWIA 3OAAD 2VHEA 4GP6A 4ISBA 4Z9FA 5DTJA 5KYKA 4GPTA 3ZVRA 4YDRA 3CXCB 2RONA 2V0CA 2Y0CA 4OI2A 3QKSB 2DMRA 5JMPA 2PH7A 1B0UA 3G9TA 1NQWA 2VF2A 3TKLA 3TOXA 4OATA 1NXTA 5IHPA 4OFXA 2FPIB 1S4MA 3WLHA 3DEYX 4B09A 4NG4A 5FCDA 4DNRB 2GPJA 2Q5JA 1UJ4A 2Z8XA 4ZEWA 4C4OA 5D6NA 4KO8A 3UUFA 5CLIA 3OESA 4WOCA 3V8RA 3PQ3A 3D3QA 1PJ8A 1P1RA 3MOIA 2YJ4A 1SC1A 4U3JA 4DARA 2EJTA 5IK2D 1R6AA 4II2A 3CLTC 3O8QB 4KI0A 1REQA 2J9XB 3PQ8A 3QOFA 4K9NA 5KJ6A 3BFVA 3INNA 3O90A 4WK2B 1Q83A 2M6LA 5JHGB 5I7VA 2R44A 3VVBA 1CUZA 3I9KA 4MKFA 3X1KA 5A03A 4EGCB 1V37A 1UFQA 3TCXB 1LDMA 3MWFA 4IGIA 3GLQA 4IYJA 5LQRA 4U2CA 3B1YA 1HNXB 2E2WA 2DXIA 2A0KA 1OIVA 5BRAA 1KP9A 1U4OA 3OF2A 2C42A 2MT9A 1A82A 4GOND 5A9TA 3SQLA 2OZKA 3HXKA 3U17A 1TO2E 5JISA 3LUKA 4AMGA 5M2QA 5AR1A 1V8BA 3QHQA 2OSVA 3OD1A 4JB3A 1P72A 2L19A 4OAQA 4RSRA 2F3RA 1K8XB 3U48A 2GARA 4TVBA 2ZAYA 4BB6A 2DP4E 2BMDA 2DG2A 1SUDA 1N8TA 4R5MA 4OKIA 5E6RA 5IFLA 5CRIA 4DB2A 1VE3A 4X85A 3ZBPA 1BS9A 1PJSA 2AOTA 2X7JA 2G07A 3OU2A 4FMPA 4JA2A 4MA4A 5EP2A 4AG3A 3EW9A 4C7OB 4MGKR 3RAGA 1OXKB 2ZYIA 4YJDA 3B1ZA 4AX4A 1ZIOA 1R5NA 1T3HA 2FRDC 2GPSA 1OBCA 3N70A 4DQ0A 1P7CA 5D3QA 1IH8A 3A1NA 4DIMA 4MR9A 3B3GA 4S2EA 2R6GA 2FSIA 2HHCA 1KC3A 1RVDA 1Y9DA 4JEUA 3I2YX 4D97A 4G0XA 1PWZA 3AL3A 2ZBPA 4X00A 4BQPA 4O4IF 2YRXA 4FSDA 4I5DA 4CN9A 3LQ4A 1QVAA 1N6RA 3H17A 4YVFA 4G2NA 4AJIA 5AOAA 1RYEA 2YWXA 1IBMB 2O8DA 3BL6A 1POWA 3GQBB 2PN1A 2OUIA 1RI3A 4K9KA 1S8FA 3UXEA 1MPTA 3OLZA 1IK4A 1CR2A 1P74A 4FI3C 3EQZA 1UZUA 4FFRA 3R76A 4WZZA 2O6HA 3ZBTA 4D98A 1XD2A 1A5AB 4JUBA 2R1TB 3G2OA 1U31A 1ZICA 2DBRA 5FA8A 3VTFA 2WT9A 4PQYA 3ZDFA 2NXEA 5KX5A 4JZKA 1JDZA 4ROXA 1QMGA 2VSOA 1YZKA 4WLVA 4ZTUB 1R0LA 2PV7A 5AKGA 3N8DA 1W29A 5A4IS 2WE8A 1F2UA 1PR2A 3OCVA 4C21A 5C2JB 3WRXA 1A4UA 4NQRA 1P73A 2I1QA 3R5FA 4R0VA 2YWHA 4RM3A 3VQTA 5K99A 1OTHA 2DQ4A 5JH7F 1MU0A 5B6IA 1NIJA 2ZBQA 5FUXA 4BRSA 3OEEA 4E5SA 4DLBA 3E3LA 4FVTA 3QEBZ 2IPNA 3N5CA 2VPQA 4C3VA 1NG9A 1O03A 2NZVG 2GK6A 1R6UA 1CUGA 2FWMX 2FQQA 2H2IA 2LBPA 5DW0A 2FG7C 5BSHA 3SYLA 3PG5A 3NALA 1CQJB 1JYSA 3HCWA 4MH0R 5EJ9A 1TF2A 2XTJA 3PRKE 1UP6A 2Q8QA 2QE7D 3SEJA 3PHHA 2QAGC 4KIJA 3ANMA 4NCHA 4PVCA 3WLAA 5JRZA 1L4NA 3TZ6A 2VT3A 1LQTA 1LNZA 3M3PA 5DCYA 3DO6A 2X14A 3TKYA 4DG8A 5HGXA 3H11B 3UW3A 2LCQA 1A76A 2IXBA 5KIAA 3V4RA 4X65B 4D0SA 1ORIA 3KR2A 4DBZA 5LBIA 1MEJA 5JSHA 5JTTA 5SZKB 4YUAA 2Q7XA 3WB9A 4KAJA 3BDVA 4XDGA 2AXQA 4K9DA 3AR9A 3NVMB 2IEIA 1BWSA 3P0FA 4ZK6A 5CHYA 1J7JA 3CPJB 1NVEA 1EVJA 2IK8A 2ZB8A 4IUDS 3RYHB 3A1SA 2R25B 1OYWA 2VYND 3MERA 1HNZB 1FRNA 1QCZA 4B32A 2O3JA 4PHTA 5KDOA 1ACMA 1K6MA 1UBKS 3ELDA 3NI2A 4UHHA 4EKIA 4OUDA 1KYZA 3JYQA 4CEIB 1RXSA 2QE7A 2C98A 1TX4B 4RLQA 4R7GA 2H7CA 5CG2A 3T5BA 4U2BA 2EG5A 5F4ZA 2ZJFA 3VHLB 1RJ9B 1CP3A 1YDFA 2WMNB 3O8BA 4N7JA 4PTLA 3ZLUA 1ID8A 4TS9A 1NU8A 5C80A 3D26A 3ONDA 4TRJA 1X7WA 2GWHA 2MR6A 4OSOA 5T8KA 5IH3A 2VBVA 2FF5A 4MR7B 1BDBA 3GZTB 1BU5A 4DLVA 5B5SA 2WQ6A 2C83A 2XGGA 2DOGA 1NR5A 4LYJA 3S3TA 4KP7A 4RKWA 2D2EA 3SMVA 2BGTA 2HK7A 4PW0A 1WQ3A 2PMCA 3EIXA 4L0QA 1V8ZA 4X7EA 2IHUA 5C1BA 1ULHA 5HDBB 2YHIA 4ZEXA 5E8RA 5DULA 5FIUA 2GBLC 4FGUA 5BR7A 4YO8A 2DECA 1ODTC 5B1IA 3UUGA 2VYNA 3WGIA 4LMPA 5AW6A 3EH1A 2XV1A 3K4QA 5JPDA 5KU7A 1O9BA 2IRWA 4FBMA 3SSOA 3W04A 1VCHA 3RRXA 3WKBA 4DCJA 1S5PA 1GTSA 1M74A 4DA7A 3EXFB 4N8SA 1LCIA 3D7SA 1M7BA 2WICA 2AFHA 2R6DA 3WGZA 5JFOA 1EG2A 1XNQB 3QMVA 5KJEA 3RANA 1MT0A 4CUZA 1S8NA 3QJ5A 3U7EB 4U6NA 5COBA 4BKQA 2A5YB 4ND8B 5DBGA 1F8YA 5CAEB 4RUKA 1NI4A 3G7NA 2NSDA 3H9UA 1L5NA 3HR4A 4Q3AA 4U2KA 2GA9A 4QDZA 2QA4B 5KNDA 1NVDA 5JOQA 1JX6A 1XCGB 3I62A 5GMOA 3LNNA 2A9KA 2WEKA 5JBNA 3RC3A 4EVRA 2FLVA 4CKEB 3W5AA 3WYAA 2Z43A 3B7PA 3CXRA 1PJRA 3BGWA 4B2LA 1UBJS 1XTTA 3FCUB 4F3TA 1AKMA 4NPHA 4MMXB 1N6NA 4YRTA 4Q7QA 5K0SA 5CDTA 1XL1A 2P6PA 3R3ZA 4FCTA 3JPYA 1PKEA 4WA7A 1WSDA 4WZAE 3T3GA 3H5IA 2CDCA 1Y8CA 1FFAA 1N9ZA 2E0IA 2FCAA 3WGLA 4PLFA 4YRFA 1TCBA 3QKRA 1NJGA 1C3LA 1NI3A 1IL0A 3HTXA 3SJPA 1FX0A 3TW0A 2YY6A 3PKZA 3DAPA 1NR7A 5F1PA 4BNUA 2WD9A 1HETA 2WZBA 2YJTD 4JC8A 4KGVA 4TKUB 4YP5A 3WGOA 5DHFA 2ZUSA 4NOJA 4D1YA 3JZMA 3TRKA 1SG0A 2YL2A 4JJIA 3CLVA 4F21A 1JEYA 4N5NA 2H1RA 3ZGZA 2XBMA 1AUPA 1ZCBA 3OQBA 5JC8A 3H2ZA 2EFDB 3QKWA 4OVKA 4Y6OA 1X19A 5ALLA 5BQ3A 3DBOB 3H8JA 3A9CA 4CF7A 3H83A 5FNVA 1FFDA 5KX5F 1CUSA 5LXTB 1ONSA 4PHCA 5BN4B 4EVSA 3AUJB 1RKQA 1ZGGA 1J1UA 4P7BA 3KAKA 2ZI5A 1IIBA 2Q4RA 4ROTA 3ZDAA 3V4FA 3ZHQA 4N5LA 2VAXA 1L5RA 4QUGA 5LA6A 5JS1A 4BFSA 2P41A 2P5SA 2XSZD 1X7ZA 2F1HA 2RHMA 4WEOA 4HDMA 5CT6A 5KTNA 3L8HA 1ECLA 2QGZA 3IXMA 3R3XA 1N5LA 1VKJA 4BC1A 5BN5A 1GPYA 2F6RA 4UDYX 5B4VA 1W94A 4BVKA 2G17A 5HKOA 5IN4A 2FSHA 3BH7A 1XEAA 3MA0A 1RAEA 4FOTA 2XMBA 3TSOA 3DLHA 2FQYA 3IP5A 3C7TA 3QKUA 1YJ9B 1HF3A 1KYVA 3QGMA 3CLRD 5IRCD 2A0XA 4AFNA 3OF5A 2A92A 4JLUA 2NU8B 3LCMA 4KITB 2TS1A 5DI3B 1ULUA 1Y6FA 3MTJA 1GQ2A 1X39A 3A1WA 1CZKA 1RMTA 1SZJG 1T8SA 4JT8A 3T7SA 4ZYUA 2V5VA 4DV1B 4HAIA 1OB0A 4ZQCB 2D00A 1TC1A 1X8JA 2P7IA 3NNDA 5EHNA 1YS6A 3SZOA 2QTWB 4XYLA 1KQNA 1JJVA 4LMBA 4EPYA 4H60A 4CMIB 1ORHA 4J2TA 5CVJA 2RAPA 1VCMA 3AHHA 1Z4LA 4MQFB 4AO7A 2G0TA 2OHGA 4ZHQB 2BSQA 1J1ZA 1DDIA 1K6XA 3HJGA 3KLMX 4JV5B 1VQ6B 1M5TA 3G2QA 3HFJA 1CZLA 1PQ4A 3IEKA 2DHDA 3HM2A 4HB0A 4WVLA 4IIEA 5IDYA 1VPDA 3TB4A 4L73A 1SBTA 2FA9A 2IOFA 3UAYA 1WZ2A 1K4YA 4YMLA 2ZUWA 1FPQA 4JOQA 2YMPA 1L7EA 1USGA 1YR6A 3HKDB 4WCVA 2G70A 3I2JA 1E63A 1Y8AA 2REQB 2ZYGA 3OTIA 4YJFB 4OXKA 3O1LA 1XFOA 5B30A 1YDEA 4FN4A 1O8CA 1ZG3A 3ZY2A 1FQOA 3JQGA 1ZD1A 1X9GA 2P9HA 1J09A 4IZHA 3VR4D 3VZSA 5DP2A 1IEVA 1CW2B 3D7RA 1A5BB 2W22A 3UC5A 1T0HB 4HWGA 3KXKA 4FFNA 1R50A 1YZNA 2P8JA 4HUQB 1P19A 5ALOA 3M89A 5IEBA 2J9RA 3CZ9A 4QOEA 4JI6B 1B74A 2ZU6A 3ZWBA 3BKXA 3QLVC 4L1KA 4URWR 5FWYA 2JJ2A 4I1OA 4MJ3A 2CVHA 2JCXA 3R3UA 4TVOA 3HFRA 4AP5A 4LDAA 3FPKA 3O1IC 1U02A 1JTEA 1X1DA 1USKA 2RH8A 1OCEA 3K0EA 1OU4A 2OZLA 3FZNA 3QF7A 5AXCA 4B44A 1PJCA 2DUJA 5TQ2A 2OORA 1P1FA 2Q45A 4BZQA 5ES3A 3ZDYB 4RLZA 1NQXA 2UYCA 5HF5A 4CTJA 3RTCA 4TOIA 5C3UA 4QBTA 1WCIB 2WFAA 2AEJA 4MTLA 4RL6A 1Y4AE 4LTMA 1GGFA 4G7XA 2LVBA 3EFEA 3PC7A 4JHLA 1TZMA 2HHAA 2JGMA 3VR4A 4P3YA 1R16A 2PA0A 3E3AA 3I4CA 1ZGZA 4HX2A 1JDPA 1DI0A 5IC4A 2BUBA 4LWZA 3H75A 3PEFA 4Z7JA 1ECGA 5KREA 3CX4A 3AHGA 3R7BA 3VPAA 4QRHA 4ILKA 1NW8A 2O54A 5DBFA 3QVJA 1HFKA 4RPBA 3NP9A 3UHFA 1Y80A 1G5RA 2G9QA 2WV9A 3V2UA 4XLFA 1VECA 4EF4A 3A7DA 1DRKA 3DE5X 1P1HA 1PV2A 3F6PA 1NP7A 1OI4A 4R98A 1PQWA 2P30A 3IDAA 2C7RA 5EXPA 1I94B 3QXJA 1VQLB 4J6FA 3T0GA 1I4OA 3HCEA 2OBXA 1CF4A 1P4HA 2OQVA 1J39A 1ZGAA 1P8JA 3A3OA 3N58A 4U2GA 5DGCA 5CXUA 1PUIA 4FLMA 3IE0A 2I7CA 1Z5UA 1JPNA 1OT3A 4MX8A 3L0OA 4UTPA 1G0OA 2AMJA 3T3NA 2ORYA 4BCDA 4L5AA 4P35A 1KVRA 1E3DA 4R3WA 5AXBA 4NS4A 2ZJ7A 1MVOA 4Z4QA 3T3DA 2H0RA 3BXXA 1YVUA 2VDRB 2WSIA 1PEYA 4KB5A 5FNVF 2E55A 3UT6A 4XKVA 3BNWA 1XU4A 2A5FA 4RHXA 3RO7A 5L51A 4YONB 5H0IA 1DG1G 3H84A 4R0NA 3DOCA 3IUYA 2RGUA 3RC2A 4GXRA 1AZSC 5LA6F 5DEOA 1YJXA 1VJRA 3VNQA 4WZBB 3EUEA 1W85A 4UEQA 4B81A 3TGWA 5BNTA 4NEGA 3FTPA 3OZSA 3W1VA 3DFUA 2R6R1 4I1UA 3WL6A 1RXUA 3WK8A 4IG9A 2D62A 1NAHA 3H9BA 1KJZA 1A4RA 1P61B 3NFRA 4G1UC 5SY9A 4EHIA 3N2GB 3GC6A 4MW6A 3CO0S 4CF4A 3B6MA 5IUNC 3QYAA 2EKPA 1R74A 4GXQA 1ZO8A 3E9NA 1KZ7B 4MUNA 3K32A 2ANBA 2LR0A 3N7AA 4TS4A 1KAHA 3G9ZA 4H4DA 3QWBA 3EIUA 4IQFA 2AJ8A 1GY8A 4R40A 2OYRA 3R5KA 3MWEB 4WCFA 1WPXA 2YVQA 1EZZA 4Y98A 3H5WA 1WDMA 4OYLA 3OFKA 3ZQ4A 4H7KA 5BVHA 1ZEJA 3PHJA 3LUFA 1WXFA 1X3SA 3O2SB 4X8LA 5J35A 1DINA 1XWWA 3ONUA 3QWAA 1QTNA 3PA1A 3AV3A 5B12A 2G1AA 5AJWA 1JMKC 4AQYB 3LECA 1CQPA 1HZZA 1SUEA 1WHTB 3C6KA 1DUVG 1E2LA 3DNFA 3QFHA 5T3UA 4HATA 3QPDA 1QNFA 5B1DA 2LCFA 4ZYTA 2CMKA 3H0EA 3FNFA 1SEPA 3V5NA 5L4LA 5FKJA 4PCVA 1FSZA 2QE6A 4H0CA 5KU1A 2X19A 2ZETA 3BILA 1UAAA 3W4JA 1CY8A 2RKWA 1SVWA 3NGMA 4INOA 2EW1A 4MS4B 4X91A 3PUHA 1H2EA 4D74A 3ZGVA 1PYDA 2HHJA 2AFRA 4TUYB 3JVDA 5BY2A 1Q0RA 5KYUA 4Z2AA 2BMEA 5KBYA 1A9XB 3WRXC 2WWIA 2P4QA 2QVCA 3GW8A 3P2JA 4L3OA 4REOA 4ABYA 4MS3B 3DAFA 3PUYA 5G0VA 4OLAA 1WM1A 2QRPA 2WTAA 3OU7A 2BN4A 3ORYA 3SS7X 3UT5A 2R62A 5AVWA 3WK4A 1LLDA 4DSZA 2V8BA 4F8JA 1JFLA 4R8KA 2XCSB 5AK0A 4U1RA 2FF7A 1QVWA 1LI7A 2OXEA 3KZNA 4IUBS 5ESDA 4AN0A 2PXCA 2BW0A 2IOHA 3BWVA 4Y6LA 4I9GA 1JDVA 4WFIA 4DNPA 5LMCA 1IN5A 2UZ1A 3AP1A 1N2JA 1XHFA 4CM7A 4W1RA 2XUOA 4WNAB 2I80A 2CDRA 3GARA 1Q1QA 3EF0A 4G5QA 4AZ0B 1FLVA 2UYOA 1MN6A 3OIYA 1JLMA 3IHWA 1I2ZA 5CB8A 1XAGA 3NPMA 4IBOA 2E48A 1Y1KE 3CF4A 1P3JA 2WIGA 4HQNA 5EE0A 5G0TA 1MZPA 4GX0A 4GVPA 1JDBB 4MKXA 1WXDA 1SXJB 3I6IA 3OT4A 4K28A 2A2ZA 3RBZA 3ZCXA 3I0NA 4M89A 3ETLA 3RR2A 3SBXA 1GZ4A 3ME5A 2SNIE 3ZU5A 5EJ7A 2I67A 1WXXA 2AJDA 3B1FA 1RDFA 3Q6IA 2QEXB 3DDZX 4FQ7A 2AT1A 2ERYA 2EZTA 3DV0A 3NBQA 2JFBA 4MAAA 2XRYA 4PZCA 1P5HA 3G85A 1E1QA 2O1WA 4PRLA 4JEHA 4ZDJA 1ZAYA 2W7TA 4QM6A 3EA0A 3VO9A 4YY3B 3O8RA 3THOA 4NULA 3HMQA 4FZ5A 4D82A 1EP2B 1JUDA 3CEHA 3GBVA 2X3FA 1Y8QA 3H16A 5BQPA 1W88B 2D2XA 1PBTA 2FV8A 1G8KA 3I42A 3SZUA 1W76A 1E8MA 5HZGA 5AQEA 4DREA 2F3UA 2VP9A 3IHKA 4YB8A 2W2NA 2NPOA 1CY2A 2HYIC 1J2JA 4UU0A 2FFHA 5T8KC 3F74A 4G23A 3W6ZA 2BELA 4CYMA 7MHTA 4M8IA 3RTGA 3H5AA 1AN9A 4TS1A 2ZE5A 3K0FB 5BMOA 1EPUA 1P6XA 3C97A 2HXGA 2OAP1 1S96A 2WOJA 3QBEA 4CUKA 1WAMA 2VA9A 2R7NA 4L8VA 4CETA 2GRUA 1EFUA 4G01B 4WERA 3RHTA 1C7FA 1O2DA 4GWLA 1FW6A 3KEWA 1MXHA 3JRWA 1LD3A 2MIIA 4OEHA 3QLEA 4CUJA 4H27A 1IEXA 1QH8A 1YRWA 3JYHA 3L1IA 4Q7EA 5AW3A 3I1YA 4L4ZA 3HA7A 1P62B 1XZMA 1WOSA 2H4YA 3LYAA 4I8XA 4JVLA 3AY7A 2I6FA 1YQQA 3INRA 2DCUA 5JCXA 4HGRA 1HMPA 2J0UA 3WWZA 4V0OA 5I7OA 3GR6A 4B76A 1Y4DE 1D5WA 4LQLA 2EXXA 1QSGA 2JFGA 2QD5A 3LT5A 2RGAA 4OBXA 5E7JA 1GGVA 4RHYA 2OT3B 4TQ9A 3NHYA 2H1OA 2AI3A 3UG6A 2UXBB 3O3NB 3RS4A 3I3SR 4Q19A 1I2DA 4C07A 1PJ4A 3KT3A 3RVJA 5IKMA 3FLEA 3I2KA 1CJVC 3HBNA 4PLTA 4YTEA 5G0SA 1CLUA 4O1MA 1JXAA 4ZV4A 5E1OA 2RI1A 3W8DA 2I6XA 1U1FA 1QFZA 2PMBA 1GU0A 2VK8A 2P9TA 4BMOB 2OZPA 1LB1B 1Z0SA 1DCMA 5FFMA 1FFYA 4KO2S 3S2IA 1S1CA 3O8DA 1UIRA 5BSVA 4BV9A 4L9WA 2ZM5A 4R8LA 4JOSA 5KJCA 1XNRB 1NUAA 1QBGA 5IP5A 4HS4A 3C5VA 2PGJA 1M67A 1G0NA 3HE3A 5LZ5A 1YZQA 4CKCB 2Q4TA 5JMOA 5LU9A 3BK1A 1P80A 3TBFA 2I7DA 1O6CA 3BZUA 4RH1A 1B00A 2Y1OA 4GC5A 4QG7A 5T41A 2OL4A 1V8FA 3B9QA 3K16A 3CS3A 2QTHA 1PZNA 1KYTA 2FRXA 4G1CA 5F3WB 2YZGA 5FI3A 1SHTX 1ZJJA 2EATA 3QMMA 3LPLA 2XCLA 4TKMA 2C03A 1ZOSA 4LAFA 4GPAA 5BRNA 2FPGB 4UJ5A 2W6IA 1BOFA 1QZUA 2XUHA 1SBHA 3IPXA 1P44A 3QE4A 4IF4A 3KOOA 1UKAA 5JY1A 2FQXA 3F67A 3UJ6A 4EX7A 5AVXA 2ZJYA 4DRYA 3PGJA 5KSOA 1EVLA 4CL3A 1B0PA 1MIOA 4P83A 1K5GA 2R2GA 4LRYA 2XIJA 4IO1A 3ZIAA 1D2GA 3JAWA 1X7DA 1II8A 2CHFA 2BF7A 1ECFA 1MB3A 1W73A 2LKDA 1S3FA 2H00A 3H5LA 1DO8A 1DKLA 3EXEB 3R4CA 4M2LA 1GCIA 4Z1MD 2NOAA 2XUJA 1S2OA 3ZWXA 1RCTE 2EX4A 1R8YA 5B36A 2ANCA 1M33A 3ZEAA 3RH0A 2H17A 1JTFA 3GK3A 1TT5A 1E3QA 1NVUQ 3QH4A 4KRXA 5BQXA 4U7DA 1JIUA 1FTYA 2IUTA 3A1EA 5FUQA 2FW8A 2WKRA 1H42A 4KQGA 5E9QA 3JASA 4X7PA 5TQ0B 4TQAA 3V42A 3W6OA 1D6JA 3IALA 4DSAA 2AH5A 4RJLA 4UHBA 2II6A 1BTOA 1LU9A 2ZSDA 2XMQA 1C1YA 1CQZA 1DCKA 1XVAA 1MA3A 1YKSA 2ZYUX 3QLJA 4C6TA 3N3BC 3VSDA 5DNUA 1N6PA 4Y9RA 3DZFA 3KPWA 3KWFA 4GYYA 4YJ2A 3CSDA 2NAFA 4JL5A 5E6UA 1RM3A 4GI2A 4KE7A 3DJFA 3CVUA 2WF9A 1RQGA 2IIQA 2WYHA 4MB6A 2X15A 3TXYA 2WG1A 2WP8J 1PFUA 2G1JA 2HRDA 3C3CA 5JRDS 4EB0A 2PSHA 4Z1MA 1NONA 1E2JA 1M1ZA 1M1UA 2QP9X 4Q9NA 4MV4A 1TFUA 3PNPA 3USCS 5B7QA 3EF3A 1B7GO 1NW7A 3H1TA 3HPQA 2W0SA 1R0BA 3RODA 4DUZB 1IZYA 1XXLA 4OL0A 3PA6A 2QRVB 4UZSA 3JX9A 1KSFX 2CKMA 4IIYA 1X7XB 3CLRC 5AWFC 2CJXA 4F4HA 3BMQB 1QHNA 1I3NA 5IYQA 4P86A 4B3IA 5JAZA 3GGOA 4AU1A 5B3AA 3GGJA 2V45A 4F2GA 3GP8A 1SVKA 2UUPA 1QGUA 3JWEA 5G4KA 1QTQA 2WAYA 2BVNA 3JY6A 4RC9A 3N0XA 5D84A 3C1OA 3VKUA 1VYUA 5T57A 4KDCA 2SHKA 1B6RA 1CU1A 2FRVA 3DZIA 4NICA 2Q5QA 3R7DA 3TD2A 3TO5A 4DDWA 3P0JA 1F2VA 4FCVA 2FFJA 1WNFA 1D7AA 2RK6A 4JLVA 1F1JA 5K51A 3R7NA 2EJVA 7ADHA 1ZC4A 2YVKA 2AZXA 1RP7A 2ZXIA 4D41A 4OU4A 1KGDA 3A9SA 4GOXA 4M0DA 4PYKA 4X44A 1JNYA 3H2SA 4RF5A 1FTNA 1IXRC 1GRQA 1UJCA 1U2DC 3KPYA 2PFKA 2AG8A 3MB8A 1XQYA 4GI5A 5FWDA 3U3XA 1GZSA 4P2GA 1FDVA 1UEIA 4C4YA 2R1ZA 2EIXA 3K2EA 4KDFA 1JRLA 1C2TA 2OORC 1CSEE 2YV5A 2Z0MA 1SZCA 1HQCA 3JR3A 4FOPA 4IF6A 4B9EA 3OE5A 2RGEA 3R0IA 4IINA 3WGNA 3AFOA 1DWPA 2ZIWB 3NBFA 1SBNE 1CJKC 1YNOA 3E9RA 1Q19A 1GUBA 3OIVA 4V02A 4H3HB 2XX3A 3T5PA 1GTZA 1RC0A 2IYPA 3OY7A 1W19A 4I3GA 4RDKA 5BV7A 1C9KA 5KOJB 3PLRA 1E1CB 1Q7CA 2ESRA 4IXMA 3ROZA 1TYCA 1I1OA 2WVGA 3DT9A 5AJVB 2Q62A 4G0VA 1JFFA 2FFQA 3V8QA 2GVDC 2XB6A 1R6VA 2XMPA 3BS4A 3MIZA 3OKFA 4RK7A 4UBMA 1ZH2A 4BL5A 3HCPA 3K70C 3A31A 4DWOA 4JHXA 1EFKA 1KK2A 2I33A 2BE7A 1NNI1 4FW8A 5DV9A 5ERGB 5FORA 4D7AA 3RASA 2HT6A 2VEDA 2XUPA 4ESEA 2KQUA 4A5SA 4XLHA 3CC4B 3MXTA 2VDPB 3OZIA 4KXMA 4Q1CA 2J3HA 1QZ3A 4BZWA 4EG1A 3I5AA 3CUWA 5EMNA 3AF5A 3Q9LA 4QXRA 3K8QA 2AVDA 4ZJUA 3UQYS 1GXSB 1KKUA 1E79D 2MJLA 3QVGB 4Q4DA 4LDZA 4I1IA 1BMQA 2P2CA 4W4TA 1RWKA 3TH5A 1XKTA 3VHXB 2WPDA 4GZMA 4PLGA 5T4HA 3BQNB 3D4BA 3R0JA 2QGGA 5JE8A 2BFFA 2GAIA 3WQSB 1Q7EA 4DR6B 1MVLA 2HA2A 4MITA 2ONJA 5HQTA 2YWDA 1GPNA 2ZZGA 2FW9A 1L8XA 3L6UA 1G8SA 2X8JB 1FNSA 2YHAA 4O0MA 4UDNA 4QQKA 4XJSA 3U9TA 4ETNA 3BTVA 5IJ0A 2XB2A 2QU7A 3CRRA 4IXNA 4M1OA 4N54A 4KFUA 4I6JA 2AFIA 4BNFA 4O2RA 2GKOA 1LPBB 3BE8A 3FUVA 2XE8A 4QGGA 5J2UA 3K1TA 3LUCA 3ROKA 4PYRA 4W7IA 2R4QA 5FV7A 1JHYA 1WOMA 3NRBA 3W7VA 1Z2AA 1E79A 4DBLC 1HORA 3S1SA 2IOFK 3O4FA 4E5PA 5CD9A 5LOVB 4C4TA 4OBWA 3U39A 1L7DA 1FLNA 2CLIB 4F86A 1SGWA 2EFGA 4KSCA 1HDXA 1M2VB 3NG1A 3PI6A 3EVBA 4BXOB 4BO1A 4IXTA 5J4VA 4X6LA 2Y2VA 3OP1A 2KBEA 2YV3A 4C0JA 3CZAA 4NI5A 2PT6A 3UENA 3W5DA 1YQWA 2BI7A 1NPDA 2DH5A 3OTWA 4TTTS 4ALKA 2IX3A 2C5BA 1TK3A 1P6UA 3DOEA 3DEZA 3DDWA 3HVJA 3KT6A 4O2BB 3HC7A 1OKKD 2FNAA 4O4LB 5JAQA 1F0YA 2E1PA 2ZR9A 4CM9D 3AERA 4V39A 1AS3A 5BSRA 3DMTA 3VKFA 2X1VA 1OH7A 1P0PA 2OM6A 2VNIA 4YJ2F 2GJKA 2QDKA 2ZJBA 3MWYW 5G3ZA 1WB9A 4WCFC 3IBTA 1Z16A 4NBUA 2J0SA 1VTKA 1QK3A 2G36A 2ZG6A 4IJVA 4PE5B 5GOZA 3EQ6A 5EQFA 4YAKA 4UZUA 5D3MA 1OMOA 2XWJI 2BTQB 2R5NA 3RYCB 2TMDA 3TAHA 1R4ZA 4M9CA 1GPUA 3LP6A 4BP3A 3F3SA 2DFNA 1HZZC 2VAWA 4I55A 4DDTA 3THXA 4CKZA 2V6JA 1X9IA 2G82A 5DGHA 1HNNA 4RKQA 1RC8A 5CB0A 4C2TA 3JAKA 1L8QA 4KKSA 4LZZA 3TIFA 1C3OB 2WWTA 2G6BA 1R8SA 1G3QA 4WZ6A 1Z0FA 4OO3A 4TV9A 4ZI2A 2BHTA 4HRAA 3OW2B 4LX8A 2OVFA 3D5EA 1ODLA 4MUFA 3FVTA 3PL5A 3HYTA 4URFA 2WD7A 2ZWMA 1FDIA 4GPD1 4DM3A 3CC2B 1UANA 1M1YE 3OLVA 4NKRA 1PLLA 2Z5FA 1WSBA 1MB4A 5EXDA 2JFYA 1Q0HA 1NF9A 2ECQA 2XHEA 2ZRIA 2ZWOA 4EEXA 1G66A 2F67A 1U0RA 1XO1A 3FBGA 3G23A 4L15A 3B3QA 3NT5A 5IG2A 1EVYA 1Z75A 4WVFA 3P4YA 4M7RA 1VZ2A 2QIPA 4YXWA 2MHCA 1WB4A 2EF1A 1JB1A 1UQUA 2X6RA 4AY2A 5AI9A 3NBKA 2VXBA 3OTQA 1SUAA 3SJZA 4PNEA 3M4JA 1PR9A 4JYCA 2P6RA 2DJIA 3AU8A 2HREA 2VUHB 4HAUA 4NTZA 1TMKA 4PSAA 1LQUA 2P8SA 4HD8A 3KOMA 5BV2P 1EFAA 1RR6A 3DEFA 2NUTB 4AQDA 4DVGA 3K8ZA 2ZSFA 1YA6A 1N2EA 2DLCX 2QSUA 3FYCA 2VP2A 2GZSA 1WMEA 2I2CA 3B1XA 3ZE8A 4DXDA 1JYFA 1DBRA 2JH8A 3TD9A 3OFND 1GSOA 1LTKA 1NSYA 1OPXA 3KQMA 1VHEA 3PNQA 4D4MA 4EHAA 1Y5IA 3G0HA 3A9TA 4P2BA 3ZI7A 1P5FA 3JARB 1YQDA 3T53B 1JJBA 2A58A 3LY7A 3AUKA 5TPWB 4ENRA 3GRCA 3SFVA 3NTXA 4GOJA 4MKIA 3ZE9A 4W5RA 2HW8A 1FMFA 4MRSA 1SVMA 1BG6A 2NU6A 4XX1A 2PWZA 1FS4A 1NL3A