2X3UA

Ferredoxin-nadp reductase mutant with tyr 303 replaced by phe (y303f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of Specific Residues in Coenzyme Binding, Charge-Transfer Complex Formation, and Catalysis in Anabaena Ferredoxin Nadp(+)-Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 86
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2x3uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2x3uA02
3CCRB 1U2RA 3VMFA 4AC9A 1TLLA 1R5BA 1Q86D 2VNKA 1IB0A 5THXA 2DY1A 1F20A 1VQ7B 1YIJB 2QTLA 2QEXB 1WDTA 4FK8A 1QUFA 2D74A 3CCLB 2YWHA 3MCAA 3AVUA 3WNDA 2XEXA 1G7CA 1W2BB 3ZBTA 1EFTA 1Q81D 4N3GA 1YHQB 1CQXA 1BJKA 1EWYA 1VQ4B 1JNYA 4DQKA 3U6KA 3OW2B 3LRXA 2RC5A 1B2RA 4ACBA 2QA4B 1FNMA 1GO2A 1ELOA 2RC6A 1K8AD 4YAFA 4G1BA 1QUEA 2OK8A 1XB2A 2OK7A 3A1FA 1A8PA 2EIXA 2E1RA 3LVBA 2BV3A 1G7TA 1JJ2B 1W34A 1KJZA 5H5JA 1VQ5B 5KSWB 1KK0A 4U9UA 5EMNA 4M0LA 3CMAB 1VQOB 1R5NA 2CRVA 1M90D 3AVTA 4RD3A 1EP2B 1BX1A 3CB4A 3E1YE 1Q82D 1VQ8B 4PC1A 2HCJB 1FNCA 2GQFA 1VQ6B 3OZWA 1G7RA 4C0SA 4RD4A 1EXMA 2PIAA 3OJXA 1QVGB 4ZGNB 3VNVA 2OTLB 1EP3B 1FNDA 4TMVA 4BPRA 3OZVA 1AIPA 2DERA 1G7SA 1KD1D 4F7DA 4HE6A 1NDHA 2BMWA 3E20A 3CCQB 2BM1A 4TMZA 2PMDA 3WBJA 5AN9A 4UAJA 3I56B 1GJRA 2VNJA 3AVVA 3V76A 3W2GA 3PENA 4RJLA 3JQRA 4AF7A 1KK2A 3B8HA 2EFGA 1E64A 4LBVA 4C43A 1QFJA 1BX0A 1XE1A 1HA3A 1YITB 3AVWA 1JA1A 1KRHA 2OTJB 4ZCIA 1KK1A 1YJ9B 2X3UA 1GR1A 1K9MD 3G71B 1E63A 5TR9A 4M2LA 1GAQA 4RD2A 4HE5A 1QGAA 2QDXA 2BF4A 1TUIA 3U2QA 4DQLA 4FWTA 1VQNB 2R6HA 2QMUA 3WNBA 4YALA 4NCNA 1ZM4A 4Q7JB 4G5GA 2XNCA 5DSZA 2DETA 1QGYA 3P27A 2B7CA 2BSAA 4N3NA 3ZC3A 2HMAA 2YWEA 3AVXA 1VQMB 5HXBA 1DG1G 1M1KD 1NJID 3J81k 1QX4A 1IJFA 5GV8A 2GPJA 4IW3B 1QFYA 4YAWA 1OB2A 3CRZA 4PC7A 3CCVB 1UMKA 1SKQA 4P6VF 1S72B 3QFRA 4B43A 2NPFA 4PC6A 1JB9A 4P3YA 3W2IA 1YJNB 1FDRA 1D2EA 1TVCA 4ZGQB 1OB5A 3OJWA 1H42A 3AGPA 3I55B 4LBWA 5TV2A 1QFZA 3B78A 4QFMA 4YAUA 4ZV4A 1OGIA 2YWGA 5JBQA 1I7PA 1EP1B 2QTZA 4MYUA 3AGQA 4PC2A 1AMOA 3MMPA 2BPOA 2VNHA 3QFCA 1YJWB 3JQQA 1FRQA 1QGZA 2BN4A 3JQPA 2C78A 3QSYA 2YWFA 3CC2B 3U6BA 2CNDA 1JA0A 3CXCB 5H59A 2BGJA 2FX3A 3B82A 4TMTA 4LBYA 4MYTA 3W2HA 1F60A 2QN6A 1FNBA 3QFTA 1ZM9A 1DDIA 4M4SA 1J9ZA 4PC3A 4RD1A 1ZM2A 4WQMA 1VQKB 2VZLA 1GAWA 3W2FA 4Y9UA 2VNIA 4H9GA 2DCUA 2AHOA 1W87A 3AVYA 5TY0A 3CCMB 1B23P 1ZM3A 3CD6B 1R5OA 1N0VC 2B7BA 1QH0A 4YHBA 1SM4A 3CCEB 1VQLB 4Y7CA 2BVNA 1DARA 4RCYA 4LC0A 1H85A 1QVFB 4ACAA 4NBSA 1D1NA 1CNEA 1N0UA 2B5OA 4K1XA 3CW2A 1E62A 4RD0A 5GV7A 2XNJA 1D8TA 3LYUA 4YAOA 3QFSA 2C77A 1EFUA 4ZCMA 3CCSB 3P26A 1TTTA 3ZZ0A 1K73D 4TN1A 3WXMA 1FRNA 1KC8D 3I1FA 2DEUA 2BGIA 4B44A 1VQPB 4RCZA 1GVHA 3VO1A 3LO8A 3ZBUA 4M1KA 3MHPA 3CPWB 3CCJB 4RD6A 4R71A 3WYAA 1IJEA 1BQEA 3G4SB 1DDGA 4PGOA 1S0UA 4TMXA 4B47A 4LBZA 1Q7YD 4M53A 4EH1A 3OZUA 3CCUB 3VNUA 1VQ9B 3WY9A 4J0QA 2J7KA 4B3XA 3CC4B 3W5UA 3ZZUA 1N8RD 1EFCA 1KQSB 1OGJA 2PLFA 2HDNB 1CNFA 3QE2A 3WBKA 2ZITA 3G6EB 3CMEB 4B48A 1W35A 3FJOA 1QG0A 1ZUNB 3VO2A 3SJZA 2VYQA 4FN5A 1YI2B 4AF6A 2BM0A 4B4DA 4TMWA 3W5HA 4QHYA 5FA6A 1KK3A 3WNCA 4Y9RA 3ZZTA 3W5VA 3CC7B 3FPKA 4G1VA 1KTVA 3ES9A 4ZCLA 3W2EA
chains in the Genus database with same CATH superfamily
2IP1A 4ERNA 4MA4A 3ZY2A 2A84A 3OLXA 1YB7A 4WZKA 3ELDA 3NHLA 3QM1A 1KEEA 3HUDA 2W11A 2YY5A 3ESXA 4WFJA 5B30A 1KDYA 5CBKA 2FHSA 1YFZA 4C5CA 1G1AA 2JGMA 2PV7A 3PUZA 1H2ZA 1BC5A 2O1SA 4LHZA 4LJ5A 2UU9B 3TSCA 3AUTA 3BY2A 4PZZA 1J90A 3EXFA 1SZJG 1FFXA 3I2HA 3MINA 4BMSA 2AZXA 1UWLA 4Z9XA 5HIKA 1JBKA 1Z8FA 4ZRNA 2H1FA 3CV3A 3DF7A 2I9KA 1FX1A 2YXPX 2VF5X 3JQ7A 3S40A 5DTEA 1D6NA 3ISJA 1RHQA 3H5OA 4AMYA 2OC4A 5DCWA 1ZVVA 4EG7A 5FFNA 1JYEA 2F59A 3GDWA 4EAAA 5JISA 4PINA 4XDZA 2G1KA 4KGXA 1SOAA 4LV6A 3W4JA 1CDEA 4EKYA 4OP3A 5DHRA 4PZ9A 2AMFA 2EF0A 3BIFA 2WR8A 3AR2A 4KXVA 1EFPA 4MPPA 5JVDF 1J7JA 4G5OA 4HDCA 4J6EA 2WIFA 1ACMA 3DMFA 4MEBA 5LN1A 1YOVB 2B4RO 1ST3A 1SUIA 4CTNA 3U7HB 1VKNA 1LS6A 2HA0A 3GMTA 4U2CA 1F4VA 3UH0A 1I7NA 3NJRA 2P6UA 1QORA 2O3QA 1JKMA 2HUNA 4AZWA 2WWTA 2X5NA 2QM7A 1N36B 3LS2A 5BWBA 1MDBA 2AEMA 3LPMA 1E3WA 4G4JA 5HNKA 4JITA 3LVBA 3UH1A 2W7TA 3BJIC 4J91A 2OAQ1 1T2EA 2GPTA 4HLCA 4JI4B 1D2MA 4CGZA 4C0QC 4MI9A 3TB4A 1VSUA 1UR5A 4BLUA 3CUYA 4BMZA 5HP4A 2G63A 1XZFA 3V8NA 3AZPA 4KPUA 2AE1A 2VOEA 2X6YA 5JTTA 1UPAA 2QRNA 1E1YA 2EW8A 2I22A 1WP6A 2Z9DA 2XKJE 3CEHA 4MVJH 3GD5A 5KTTA 3L6BA 4EA7A 1A4IA 4M0LA 3FKQA 2E1BA 5K3BA 1W73A 3R40A 3R9WA 2OAEA 3EDMA 1S89A 1KQPA 3V4VB 3ETHA 3FSEA 1JHVA 2EKQA 3WOHA 2FSVC 1EPUA 1MF7A 1T4BA 2DTEA 3RU3A 3DTNA 4RD3A 4FMDF 8GPBA 1RAFA 2XOKD 5LZ7A 4DANA 2CJWB 2DM6A 4ILKA 2YQ5A 3BBLA 1VE6A 4A6XA 1BX1A 5E7MA 4ZO6A 1K3UB 5I47A 2YC2C 2XNKA 2Y2UA 4TZKA 1VL2A 2Z5GA 2M5SA 2QRQA 4R8MA 4P3OA 1C1YA 2R1UA 3IEVA 4G67A 4WDQA 3BK2A 3BD8A 1M0SA 1NXVA 2JN9A 3AUAA 2J6HA 3BGIA 3DDWA 3TW6A 4C0AC 1G7RA 1TJ4A 3B2QA 5AUQA 5AVJA 4EI8A 1ZR4A 5DEIA 3EA5A 5BUQA 4F92B 2JD0A 2PIAA 5SYMA 4EUNA 3NBQA 2CJYA 2CXOA 4R2JA 1OBCA 3I4CA 2PGLA 5SY9A 3ZD8A 4GX1A 2XUZA 3O2QB 3U0VA 2NZYA 5HVNA 3GL9A 5EESA 2NXNA 3H1GA 4LDAA 3VC1A 3WGHA 3KJXA 1NQ5A 4D3DA 2JD2A 1JILA 3L0DA 4E08A 1J0DA 3FSRA 4OXRA 1P1CA 4B6JA 3PFBA 5D6NA 3EEBA 5DGXA 1T6NA 2XQJA 1OASA 1NSFA 3IOBA 4OV6B 4ER5A 5F3RA 1UJCA 2QPTA 1NJ8A 3QP9A 3GOHA 3PFFA 5LA6A 1WAMA 4E1BA 3CUTA 4OI4A 4IX9A 5K3EA 1BGVA 1E2FA 3A6HA 2VBFA 3K9CA 1MIOB 3NORA 4Z3KA 4JLSA 2J4DA 2ZIUB 1N33B 1Y7LA 1IEWA 2ZR9A 1Q3HA 1M2GA 4QTUB 3E3OA 1PL0A 1UK7A 2OCDA 3I34X 4YPOA 4FEEA 4RZXA 3KHTA 4C43A 1QFJA 1A2KC 4JP8A 3K6JA 1DKOA 1SHTX 3H11A 2W8BB 3QKRB 5FPYA 1XF1A 5K0NA 3TLAA 1Z5UA 1ZFNA 3GFPA 3SE0A 2HCRA 3TINA 4BNGA 4AKGA 4I55A 3GLGB 1RI4A 3F2VA 2G4VA 2GHTA 3H4IA 4EBFA 2AFHE 1ECJA 3Q41A 1M2VB 4IKEA 1T0IA 3FYUA 3DE0X 3SF8A 4DWJA 4PYJA 2NZVG 3LAWA 1MC5A 3UJ6A 1P31A 3V2IA 3TW4A 4OYHA 4EKGA 5HZBA 1UANA 2IOFA 5JASA 1EJ0A 5G41A 3OJCA 5JEEA 1MXFA 4MPRA 3W7BA 2ZLBA 1FPMA 4K26A 1YIDA 3RREA 3DGEC 4IJKA 4GQBA 3ZBQA 3BXFA 4YBZA 4W5JA 2H16A 4Z4ZA 1LFDB 3FA2A 3OSZA 1K9VF 2YTZA 1IOVA 3HUTA 4KPUB 5MN4A 5LU8A 4Z3OA 1TLFA 1OXKB 4CUZA 2QE6A 4FD3A 3OUZA 1U11A 1TUIA 4OXNA 1X80A 1XNGA 1P75A 3HVUA 3KQLA 1MZPA 4CUKA 4B4UA 3EIFA 1O9HA 1QYVA 2PS1A 3MAGA 1V2HE 1U1EA 2CVZA 4REQB 2KSQA 1ODKA 3T9EA 4W7HA 4XEUA 3SZRA 3D3WA 1HT1E 3L6UA 3S27A 5EIWA 2VP2A 2VJIA 5F1PA 3V3TA 4ZT7A 4EYSA 3L5OA 4KI0A 4N5LA 5DBFA 1HLFA 1TD9A 2VP9A 1H69A 1E4VA 5LCXA 2PEZA 5CJPA 4IDGA 3Q6MA 3NAQA 3F9IA 1AHNA 5CJJA 5F7JA 4II2A 3H05A 2EW2A 4N0PA 2JZNA 3V1TC 5HRCA 1MKYA 1S7GA 2O57A 3H84A 3DB2A 3NOOA 3QVXA 1QHHA 3BHMA 4V1CI 2DBQA 1JU9A 3BREA 4Y6OA 3FI0A 4IW3B 1OB2A 4O4HB 3QNMA 3SX2A 3K0SA 3GPDG 1C80A 5I3CA 5CU7A 2BGKA 2V74B 1UFKA 2M1ZA 4J4HA 3V1KA 1AKRA 1LV8A 2ERCA 1XN4A 5M7EA 3FD8A 3I30X 4BXOB 3VYTB 3H8JA 3L6EA 5H3LA 4B43A 4OYLA 4CFYA 1SUPA 4H7FA 2DUJA 3TZBA 1LQUA 3DVAB 1FDRA 1JL3A 5G0TA 4QPZA 2A94A 4P4UA 2PZBA 5JSZB 4DFDA 1ZH2A 1IY1A 1TUGA 4HDMB 1EZ4A 4O2AA 5HWSA 3LLMA 3OPOA 1YRQA 3B70A 1GEGA 4KDEA 5EIOA 5FLKA 3WDSA 1R8SA 1R12A 3LT1A 5KVQA 3IP9A 5CFPA 3MB5A 2WTUA 4I1PA 2E18A 2R6JA 3SY8A 1NTOA 1Y5NA 1KAQA 3C4VA 3UWOA 1NAHA 1JT9A 3I5AA 3QPAA 1NVWQ 5F98A 1TPYA 1NUQA 5FUMA 4UFNA 121PA 1R0LA 5BSHA 4JMQA 2ZSAA 3OJOA 4C0JA 5D3MA 3HSKA 2Q62A 4CE6A 2XCUA 4ENVA 1O2DA 1KPIA 1SMKA 1EVIA 1V8ZA 1HTBA 2XQFA 2NN3C 1YR9A 3RIXA 4RF4A 5K3SA 5HQ3B 5JHHB 1YHYA 4PNEA 4CGYA 3JQDA 4NSNA 2V6JA 3P2IA 3E23A 3E9EA 1LPSA 1ZMRA 4G2NA 1Y8RA 1Z4LA 4L8LA 2X40A 3PX3A 3U3XA 1F4PA 1WWKA 1RP1A 5I7OA 1Y5IA 1S9HA 4O4JB 4GPBA 2AQIA 1KI6A 2RFLA 4YY3B 1ECPA 3FZEA 4AG6A 4CEIB 4OOVA 2GCNA 3DHYA 3VFDA 5F73A 1V45E 5CX1A 1B6SA 2GZDA 4G5RA 3R6GA 1JHYA 1PNTA 2IU4A 2Q41A 3ORRA 3E4CA 3SYNA 4YLGA 4C06A 5E0KB 1T1GA 3KJZA 1R6DA 1US8B 1FLAA 1YS9A 2R2AA 2RSLA 1G3MA 2KS6A 1HE3A 2I4LA 1SKBA 3FFXA 1NJ5A 2ZVDA 3FLBA 2P8JA 2HRBA 1JSCA 2Z43A 3P32A 1Q6ZA 1SRRA 2VH2A 1JIJA 1YCFA 4RPBA 3CCFA 2GA8A 4P54A 2QRVB 3KQMA 1ENZA 4ZOBA 3RR2A 3RVKA 3AUJB 5IFKA 1QH1A 3GB9A 2ZR0A 1U3TA 2NYUA 1V7PC 1KI2A 1YJXA 4JC4A 3E3MA 4KWEA 4OA5A 4RD1A 2X19A 4O4LB 4P34A 5JD4A 5T7BA 5BN3B 3SFVA 2J4FA 1UEJA 1JG1A 1Y1PA 5ALMA 1TKCA 1YC2A 1JDPA 3KJQA 4BZQA 2J08A 4UXIA 1KAGA 1AQUA 1POXA 1ZK2A 3GZJA 1P4AA 3KEOA 4J76A 4M7PA 2REQA 4QTYA 1YCDA 1SD1A 1GCOA 2Y0BA 3FCOA 3LK7A 3M6LA 5AW3A 4V1CB 3SPXA 3WDLA 5JU6A 5DM70 1CJSA 4B3RB 1R7RA 3O8QA 2EJTA 3ZH9B 1G8AA 3GVCA 2CNBA 2Q2NA 1SCQA 1PS8A 5AKEA 3PC6A 1BAPA 1WRBA 4P4SA 4LMRA 3IA7A 1B8UA 3CCMB 2PPVA 2ORVA 4C07A 4PLTA 3BB4A 1WSAA 1E9CA 3WYEA 1RRMA 5H4GA 4MUXA 3OE7A 3E5HA 1TRHA 4M8LA 1QQ6A 1FW6A 1VPLA 3RUCA 5BMVF 5J4KA 1FRZA 4A8PA 2C00A 3WLJA 3RFUA 1HDGO 1E0AA 3OTGA 1JT2A 3AU9A 1YXMA 1SFRA 2XKBA 3BVPA 2PR7A 1EEXB 3NNSA 4MAFA 1H0RA 4KR7A 2HXGA 4GLBA 4N3BA 4HNAA 3EIUA 4UAGA 4CM6A 2Q0SA 2IS2A 4UAUA 3GRKA 4U7DA 3LUGA 5GOZA 3BN3A 1DAFA 3HB4X 3V4OA 1SUWA 3JWPA 5CB4A 1PJAA 5CFLA 4TM8A 1FK8A 2ZIEA 2PSEA 1V5FA 1W0CA 2QX8A 5LP6C 3IMEA 3OPYB 1SUAA 1P2FA 2QP3A 2P0EA 3BX1A 1H2XA 3FHTA 2B5OA 2BEUB 1VLYA 1N1MA 4EOGA 3BM5A 2VP4A 2IHTA 3O83A 3P2JA 4K46A 4AJ2A 4E6PA 4EP1A 5KNBH 4AQYB 3HP7A 3AB7A 2B5WA 4PSAA 5KOHB 3GNSA 4ED9A 3K09A 2VOJA 3NTQA 5FAXA 4WZLA 5EJFA 1Q16A 5HZAA 3F3MA 5HM8A 2F55A 2QPAA 2V0GA 3NBZC 4R2WA 1C1XA 1U2DC 2Q07A 4E33A 2Z8ZA 1YZQA 1ZQ9A 1W5AA 2EG5A 1MR3F 3EUFA 2CC2A 1ZH6A 1BVYF 5E9WA 4DEVA 2X3FA 3DMGA 4INPA 1OX4B 4MKIA 3HWSA 1CFJA 1V4VA 2PMEA 5H9WA 1EFUA 5A5EA 1JSZA 4OI2A 3KXIA 2HU8A 4H7IA 4IFBA 1ONPA 1W96A 2IDMA 3OQNA 3T5DA 2GI4A 2PPLA 5FI3A 4CM8A 2NIPA 5KSOA 1ISMA 2B30A 3R0QA 5KYYA 2C1XA 4M0EA 2J9FA 4XB2A 1NY6A 3DBHA 4CV2A 4JV5B 1CD5A 1GGKA 2C98A 4FYKA 4LJ8A 1M2KA 5BNIA 1RAHA 3PRHA 4HB3A 4NJMA 3EE6A 2OYCA 2YHSA 3OJLA 3T8YA 2D2IA 4KN9S 2ZB4A 1RT9A 1QNFA 1IC6A 2DVMA 1IHDA 4OYYA 3EZ2A 2Q5OA 3BZBA 3VA7A 3I9V6 4LF5B 4HO1X 1GIAA 1MZVA 3DTVB 4MULA 3VMMA 4N41A 2QM3A 2H5EA 1XLUA 1N25A 1BQEA 1TAUA 1XMSA 2A30A 2G9NA 1LV7A 1PTJA 4OQMA 2JGDB 2V54A 3RSFA 1U8FO 4Q1BA 5CH3A 2G36A 4LWQA 3MLEA 3WTBA 4RH0A 3R4CA 4HLUC 4B47A 1E7RA 4O2BA 2O7VA 2ECKA 3PFKA 5K8VA 1GZDA 3C87A 3K2BA 1VQ9B 2WYHA 3MWKA 1PWEA 2HLDD 4RAQA 5LYJB 1NN5A 4PTYA 2PY6A 5ALDA 3VBCA 3SS9X 1B6TA 1NP3A 4ZALA 5BW6B 3SC2B 5F4ZA 4DPKA 5A7GA 2ZAYA 1G4HA 3RJTA 3T3PB 2FR1A 3ZE9A 1X1TA 1KI3A 2FW8A 3L06A 1ZSVA 4G4SP 1HX7A 4H7EA 4KWCA 4Z9AA 4QKQA 1NMEA 5TF4A 1D1TA 3JQFA 4O3FA 4DMFA 1MO4A 1RXEA 1XTVA 2X8WA 3BSFA 3MB8A 2PL9A 4JQSA 5J4VA 2PA0A 3RJ9A 3V55A 3FDIA 2PLFA 1VL6A 3QOYA 2HDNB 5AKYA 3FWPA 1XPRA 5AJZA 1OTYA 3BDAA 4IIEA 4WXHA 1I1HA 1B0UA 2CLHB 1JAZA 3RRMA 1YR8A 3FJOA 2XVXA 2BHNA 2CV2A 3IOYA 4JSYA 4NK5A 3NC4A 1CK4A 4UBLA 2PX8A 3LQEA 1M1YE 1KMHB 4AF6A 4GI1A 4BO4A 1SBQA 3B9QA 4QHYA 1E1CA 4YVFA 3AU8A 4RNCA 3CCBA 4I5IA 3DBRA 3T1VA 3ZWQA 1QZXA 3D7MA 5L3ZA 3PUKA 3UJ7A 3D3EA 5SY4A 1A72A 4M36A 4YX9A 1ODIA 3E9YA 3C5WP 3DTTA 3PHIA 2GCEA 3JVIA 4OREX 3ZGYA 2Z6AA 4WOPA 1F8FA 2G7MC 3GC6A 4NE9A 1BFKA 2QMHA 6GPBA 1V47A 2JIPA 4PNPA 4FZRA 4G4IA 4K9MA 5D3ZA 2G5PA 3ZV6A 3E0XA 4L0DA 1FFWA 4JELA 3I8XA 3ZCPA 2YDYA 1Q86D 3VX3A 4ZQEA 2VDLB 2A0WA 4RESA 1D03A 1AURA 3NIDB 1QWSA 2RHTA 3F46A 4MQFB 4LYFA 4GPD1 4NATA 4OL0A 3LRPA 4QBKA 3SEZA 4QD3A 4XWOA 1C9JA 5KMGB 3OQIB 4UOZA 1PKXA 3WFJA 1YIJB 4FVTA 4IV5A 4Y2RA 5DGCA 3WWEA 4FWIB 3LKZA 3UN1A 4U7FA 4K9RA 1LCIA 2QEXB 3PR1A 2PT7A 3QWAA 5SV2A 1NSYA 5EERA 3YASA 1Z6QA 2HSGA 1FQOA 3B3FA 3I0NA 2C88A 4TTSA 5IVKA 2BTEA 1T0HB 4OSEA 5AJHA 1VHOA 2FW7A 2EBHX 2FOIA 4G0NA 1I4WA 3A3OA 4CYMA 4EJ2A 1JFFA 4EJ0A 5AUNB 4RLHA 4QQFA 1XZJA 1QONA 4PBRA 3I3OA 4YCBA 3JARB 4ALKA 1OZFA 2P4QA 5ALVA 2ZRIA 1R4NB 1E6MA 4CU5A 4F5WA 1WETA 2BEVA 4DR4B 4V0OA 3ZXYA 4BJ1A 1BJKA 1CIJA 3OPMA 1U2PA 1DKNA 3DMTC 3G23A 3RYTC 4DA8A 2WU3A 3U6KA 1BNCA 4BNFA 4CIWA 3KQHA 1BYUA 2JCXA 2ODWA 2XTMA 3BHJA 4L0CA 4NECA 1GO2A 1XXLA 3S2EA 4IFIA 3RC3A 3HPQA 1D09A 1G6KA 3I9OA 1PFKA 2H7YA 4RPJA 3QIVA 5IARA 3VVCA 3SU8A 5J1TB 5CA1F 1PJTA 2OK7A 1QIFA 3R6TA 3IQFA 1RZVA 2GN9A 3D7RA 1RZ3A 1USKA 2IDKA 4I1SA 4ZEWA 3K30A 1P1FA 5JAQA 2PL5A 2P41A 3HADA 1WXQA 2Z3ZA 2TS1A 1TEZA 3OETA 1DC5A 4LVOA 5IJ9B 1RQ2A 3NU1A 1BDJA 3Q8WA 1VQ5B 3DE6X 1NPDA 1H65A 4L95C 3UB4A 1UAYA 4MRNA 1RWWA 4RVDA 1JNXX 2C4KA 3PDWA 2GD0A 4R2XA 4D96A 3ZWKA 3WLSA 2D3NA 1NR5A 1R5NA 1SHZA 3QXJA 3ORFA 4G1UC 4GGOA 4HAZA 4MEJA 2IV3A 2JFNA 2QJRA 3GUHA 3HRKA 1IM5A 1Y9EA 1JKJB 1NVBA 2FG6C 4Y9TA 5T8KC 5LL6P 4WLFA 3FMIA 2OORA 1I2BA 3RWMB 4G37A 1IY2A 1J0CA 1OLSB 2ZPTX 3KKZA 5F7OA 1WHSB 1LPAB 1XC7A 3JQGA 3MBIA 1JV2B 3JZAA 3RY8A 3NWJA 2AYYA 5BNTA 3ZDCA 3UW3A 4LI3X 3NBKA 2B6HA 3MQ4A 4E13A 4X7DA 3MGGA 2FUEA 3OEHD 4BFSA 1HDZA 3FCAA 1IN6A 1SCDA 4DMHA 4E6EA 3SJBA 1MRNA 1G5HA 2RB5A 5FH9A 4I9UA 4KQ1A 4UTOA 1XZDA 2FQ1A 3PC8C 4HP8A 3B7WA 1UKCA 5AKKA 1DXYA 5ECDA 4CT5A 1R8XA 5C1PA 5LZ2A 1GGFA 3EZYA 3TRJA 2EZUA 3KQTA 1UQRA 3A6EA 3AP2A 3EZ6A 5GONF 2JFQA 5BMVB 1KD1D 4R8KA 5ALNA 2KW5A 1Q0ZA 3AL0C 2I4RA 5F2KA 3MOGA 4PG7A 2P6NA 2RH5A 2FFRA 2YWDA 2KHZA 4W4TA 2C7RA 2QMYA 4D41A 2XB4A 2AN9A 1OFUA 1PWYE 4O33A 5KU1A 2HLNA 2MHCA 3N0VA 5JS2A 2OP1A 2BFDA 1GJRA 2V55B 3ASSA 3A4NA 1GNPA 3RUAA 1A5SB 1I4DD 2R8OA 1DXOA 2WOOA 1SC3A 4MZXA 3UUFA 4EHFA 1K06A 2ATIA 1X7DA 3EAQA 1JRLA 1W9MA 3PD0A 4AF7A 2WHQA 1DFIA 4ESVA 3B8HA 2P3MA 1XOIA 2FTKE 4IG4A 3GJTA 4E5PA 2WD7B 2AVDA 3ZE7A 1C0LA 2F9LA 4W9MC 1DIBA 1N32B 1LVUA 1COWD 1TJNA 4Q37A 1ESZA 1FSZA 1TDJA 4ZOLF 1MFPA 3JYQA 4LW8A 3WBBA 1RLIA 2E4AA 2QA5A 1OT5A 5TGDA 4IHJF 4B85A 4LDRA 3ZTYA 4YMVA 4QUAA 4PU0A 1QE5A 3HI4A 4UBNA 3WE7A 1YJ9B 1ISGA 2JI7A 1J97A 1NJ2A 1XZEA 1T1RA 4M88A 2C9MA 7REQB 1PTKA 1X1AA 2Q29A 4LSZA 2EL9A 4AZ3B 2RGGA 3DKVA 4PX3A 1GZ7A 1CNMA 4X00A 3KHSA 4O4HA 4D98A 2JGLA 3JVDA 2IW3A 3K2QA 1Z0ZA 4OA8A 5E4YA 1YF3A 3G1TA 4GOLD 5A3VA 4OO3A 3SZUA 4DHWA 1PZGA 2WW8A 4DY6A 3NG1A 4YI5A 3RAGA 5HSGA 1DU4A 1T9GS 2HU5A 3E7PA 4BGUA 3G0HA 1M3SA 4EFKA 1YQ9A 3L3BA 1JR3E 5B5SA 1I1OA 3O7WA 1EFRD 1F0KA 3K0BA 3NCHA 3EH2A 1KEZA 3CGWA 1N6LA 1SHJA 4TVBA 1UMCB 3BMCB 1M2VA 2JA2A 4JC0A 2AK2A 3NXSA 4RJIA 3PGLA 4MVWA 5HK8A 3V7UA 1FNNA 2DPLA 4IJWA 4IHAA 1ZM4A 5D2CA 1CR2A 3IDOA 3OFKA 5G1NA 2D7DA 2C4UA 2XNCA 1U7WA 2X8JB 4PLWA 3GLQA 3ONFA 5LWQA 4BECA 4XKJA 3RRYA 1CUFA 2IS6A 3ROZA 2O8FB 2AN3A 3LJKA 4I0WB 4NMLA 1CQIB 3CISA 3GJ5A 3K9HA 4MIYA 4DJEC 2Y0EA 3W34A 3GJYA 1QGOA 3K0FB 4CIBA 2C7QA 2GS9A 2DTDA 2O48X 2WHPB 4UUOA 1YZGA 2HYDA 4W9NC 4X41A 4XRRA 1RHKA 4RH1A 5KSPA 1Q0LA 3RUFA 1YI1A 1YJ8A 2MU1A 3K9BA 3V4ZA 1Z2OX 3EISA 1A82A 2WWIA 2ZE8A 3OKCA 3RRFA 4DLVA 3RUPA 5K2OA 1Z6YA 3HGQA 2RE8A 4HWKA 3GRVA 3CNLA 3GEPA 3MSCA 5TT0A 3U44A 4BKPA 3LDUA 5ALXA 3T7DA 6CHYA 5AJYA 3ELBA 4TLMB 5MGNA 4KYUA 3JALB 1VIVA 2EG9A 2X5XA 3NNNA 5J2TB 1NT2A 4A6PA 4XQEA 2NVUB 2B8JA 1FRFS 1X7YB 1Y8QB 3ISTA 3PUWA 2J0UB 1LF5A 3V34A 5AVVA 3UIEA 3HO6A 1H3EA 1BDBA 1JR3D 5JNSA 3A3GA 3HO1A 4ZQGA 2FW0A 3ZY4A 5JJCA 3RVDA 5KKCA 3UMCA 3UTDA 1VPTA 2CCGA 2FSHA 1Z0KA 1E5VA 2JLQA 3H1PA 1J1IA 2F1OA 1IUOA 2OSBA 2WJ6A 3QMMA 1O89A 3NS7A 1ZWKA 2GLTA 3ONWA 4GECA 4LYAA 2Y4NA 1Q21A 4EX6A 4HZGA 4LTMA 3FJ1A 5LQSA 3TG8A 2DECA 4M99A 2PH5A 4E0FA 5JBQA 1M6HA 3QXXA 3AL2A 4C01A 1B3RA 4DT1B 1RZRD 1FX0A 2QKYA 4PCLA 3X3HA 2NU9A 2V65A 3PDJA 2QQEA 4LJ4A 1DB3A 3GQBA 3MT0A 3MT8A 2R97A 1WP4A 4XR6A 2BFNA 1XU9A 3KPVA 4D9BA 4IEEA 2H1CA 1P2TA 4MPDA 4C6TA 1Q12A 2J0VA 4KO1S 3VNSA 3QBEA 4KAXA 3ROGA 5KW9A 1JH8A 4KQFA 5A4KA 1W5TA 4IFEA 4OGWA 3NDIA 3RTDA 4C2TA 5JRDS 4G24A 1F2UA 1IEXA 2JJ2A 3GEIA 4E11A 4TS9A 1TA0A 2PD6A 4R84A 3B5EA 2QT1A 4QUDA 3CP2A 2ZTVA 5J4LA 4KLCA 4J3FA 1IG3A 1NRXA 4FCTA 4XVUA 4GLLA 2BFDB 4FS8A 4G5QA 2EFYA 2CDRA 2WSBA 4L5IA 1LDYA 1SULA 2QUJA 4Q15A 2MT9A 1CY6A 5C1DA 4CLOA 1ZVQA 2FX5A 4X1IA 2X2FA 2PUBA 1GKUB 1Y4DE 2FPPA 2RGBA 1U0GA 3AFOA 1SU8A 3L7YA 4NS1A 1ZICA 5DNDA 3OLYA 1NVVQ 1RHUA 1XN1A 4QRDA 4UTXA 5DO9A 2Y1GA 2L0XA 4AK9A 3M3PA 1J99A 5HYVA 3HR7A 4TZTA 2GNPA 1X7ZA 4GKBA 5JYEA 1WCIB 4JSRA 4KQ9A 3L2OB 2J5RA 3ROEA 2HRQA 1TCUA 3LUDA 4FEAA 2Q5JA 3N8DA 1CLEA 3RIEA 3TLEA 4E5MA 5AW5A 2BDTA 3FN4A 4OU4A 4L4UA 3ADCA 4MGKR 1GNVA 3MTJA 1IY0A 2WICA 3LKDA 3UT5A 2BFEA 4GG1A 4I2NA 4RIHA 4RKWA 1NFRA 1QIIA 1KDTA 3EXHB 2ZBUA 1N2ZA 2IZOA 3F1LA 2X9NA 2NV4A 2FK8A 2VNAA 1XLWA 1NV9A 1O5OA 2XTZA 3OTIA 1ZIOA 5JCOC 1JG7A 2BI4A 3H13A 3QELB 5JCOA 4CHGA 5I8PA 4JK3A 3SG0A 2WDPA 3WQHA 4R0MA 3AVYA 3NBUA 4A8TA 1FLNA 1MB9A 1UK6A 5CJ2A 3CR8A 5GZ6A 1KZHA 3DZJA 4LOKA 5CA1B 2SECE 2V7UA 2AL7A 3WSVA 4EYQA 1KBZA 2H4YA 3EFEA 4M0MA 5K3AA 2O5CA 3EC7A 4BVEA 2H54A 1R5OA 1LF0A 4XWKA 5KKNB 4P4SB 1AZWA 3K53A 4M9ZA 4OIFA 2WIJA 1C81A 2X7HA 4PYOA 4YRZA 3ZLJA 1AK9A 4A6DA 1PEYA 2DKFA 2OO3A 1DG3A 4MQ4A 2X2PA 3HV2A 3IOMA 3ZHCA 1LGYA 4I9FA 2O6HA 2QI9C 3FCUB 4Z53A 2HDWA 1ONOA 4ZCPA 4RTLA 3CBGA 3O2JA 1ZJ6A 1AXGA 4DNXA 4RYLA 2XUJA 1CNEA 1MV8A 4JUIA 5B2FA 3FOZA 4POAA 4MRPA 3AJ8A 3MPOA 5JXWA 1NL3A 1V7QA 1SUSA 3B1ZA 4LPSA 2NACA 3U17A 2JLUA 1BU5A 5KWIA 1CUWA 2CD9A 3H8WA 4QUJA 4F4IA 4R9SA 3ZNQA 4DCUA 3A7DA 4RD0A 1OFUX 3IA2A 2JJQA 2A9JA 1E2JA 1SCUB 3ZW8A 1T91A 1H5QA 4IICA 4O1IA 2UXDB 1L4YA 1N06A 1OAAA 2L2QA 1NJSA 3KAKA 4KWTA 4XXHA 5CPFA 1KFJB 4OM8A 3SK0A 1PE0A 3LO5A 1L4LA 3EBLA 3OWHA 2E21A 5FV7A 2FPRA 5AW4A 4B4OA 1DAKA 4BO1A 2GRAA 1A9TA 1D7OA 1V2GA 4DQDA 1JTEA 5KB3A 1BPLA 1JWAB 2BGNA 4XX0A 2GETA 2R11A 3PXAA 4I4CA 2XMDA 1WD5A 2P4UA 4FW8A 4P31A 5FL3A 1T2VA 3PVDA 3UQYS 3AF3A 1QVRA 3GJ7A 4YYZA 1VCOA 1NG9A 3GUYA 4I4TF 1JA9A 2VWGA 4IJMA 1Z5NA 2Y66A 4ZVNA 1D0VA 4MGYR 1P4GA 2WMNB 1UDXA 3BORA 3W8FA 2VCEA 1YB4A 1H2FA 3P0RA 4QXPA 1IOLA 3GVLA 2NVWA 4MR8A 5HIIA 4DB2A 4OJYA 5DT9A 2D1SA 1TTPB 2Z2JA 4E07A 1KL7A 3P0EA 4J3JA 5JH7F 1KJWA 1PFUA 3HB1A 2X0EA 3RFVA 5KQGA 1GUDA 2RBEA 4LYDA 2DT8A 4J2HA 1YVRA 3CRNA 4R1PA 4ZOLB 4WEOA 4L57A 3QMWA 2VHQA 1DT3A 1TIBA 3NGMA 4QUHA 4ARVA 5IX8A 3HXQA 4MYRA 4OI1A 3B2EA 2VHZA 1YO6A 2VJLA 3HCDA 2H0RA 3ITNA 4LBZA 3ND7A 4IDBA 5JBNA 1JKFA 5BUZA 1FTWA 4D3XA 4UARA 3W3AD 3O5AA 2VF8A 4DCTA 1LW7A 1Z73A 1CJCA 2FRXA 4HX2A 2CXTA 1MAHA 4M49A 3TD9A 3BUSA 4MICA 4W82A 3B53X 3P8ZA 3WMGA 4MS3B 3FUWA 1XT6A 3BZUA 3IE1A 5T3YA 2V98A 4A6EA 4OFWA 4ZVKA 3RM3A 4RZIA 4AJKA 3FLEA 4YEJA 1L7XA 3PJDA 3N8IA 3FPEA 4RS3A 2X0JA 4L85A 1NBOA 3ZKWA 2EJCA 1HTWA 2PFSA 2ZBFA 5FNVA 3GJRA 3EXEB 3UK2A 3AHCA 1PV4A 1FU7A 1C9NA 2HF7A 4R7GA 1CYDA 3P0JA 5CFRA 2PLNA 4R6WA 4QO8A 4ZRMA 1YDMA 4MYDA 2C2XA 5I9TA 3LF2A 2AN4A 2O19A 1II0A 4RFSB 4TMFA 4BS9A 5I7FA 2D6FA 4FFWA 4B48A 3CTAA 1ZD4A 2VP0A 3NWPA 3PYXA 4FSDA 4CMHA 2K6GA 3F7MA 3R8CA 2NOAA 4OHBA 1D1PA 4MH0R 3WG9A 1N9GA 5F1KA 3TGWA 4KLNA 4DLAA 5HRUA 1JVBA 1OXUA 5JTUA 4TMWA 1O6GA 5JANA 3RNLA 1BZYA 2OHVA 3K9WA 1QU3A 3SXJA 1P3DA 5E9AA 4JLUA 4BO5A 4ZCRA 3UXMA 2R00A 4B34A 1U9JA 3L4JA 4ETNA 5HCUA 1T4MA 1KH1A 4BL5A 4G1VA 1JXAA 2QOEA 3W2EA 2XUKA 1SC4A 1SBHA 2BCGY 3D7KA 3K5PA 2WAXA 3Q3JB 3R0JA 5KQMA 1GTZA 2P77A 3GRYA 3HY6A 3MCWA 4PXAA 5A4IS 2QVBA 4UZEA 1R0CA 2BDUA 1P2SA 2Q9BA 3BIOA 3UTCA 1MW8X 1T0BA 4XM2A 1SCBA 2Q2QA 2IUYA 2BLNA 2XSZD 5HJ5A 1N5JA 1OVMA 1TMYA 3NATA 5AHRA 4RHXA 3B1FA 5IU6A 3IKMB 4QVGA 5JSYA 3GIRA 1Z34A 4N03A 1R18A 3DAHA 3HBMA 5KX5B 1PUJA 2KBFA 3P20A 1ZW6A 5EIBC 3BWVA 2P78A 3AVOA 3L8YA 4XD2A 3T53B 2I3GA 3BZWA 2WG0A 3CO0S 1UAAA 2BMDA 2IXBA 2KWIA 5CP8A 3CCLB 2Z98A 2SNIE 3DCYA 4OH7A 4QPCA 1IZZA 3RBXA 3UT5B 1N2BA 2JIRA 3D0RA 4YR7A 4FGLA 5BRAA 1RJ9B 3GH3A 4RA6A 2FPIB 2HFJA 4X90A 4E2FA 2WSMA 3X1WA 5L7TA 2P4HX 2PK3A 4N0MA 4DF3A 3VR4A 5EOVA 2YMQA 1EEHA 1WMSA 4YCCA 3WIUA 2GKGA 1H0KA 4YRAA 2JIQA 1OXVA 1RRPA 3CLUD 2ACVA 2AYZA 1Q81D 1G6OA 3KZCA 2RI6A 1PEDA 3C1TA 3BERA 4RGBA 2DJ5A 1LDGA 1NGSA 2ZSBA 5AT1A 3RS7A 4Z49A 5JFOA 1NB0A 3NM6B 4M83A 2FF7A 4QO7A 4XLAA 1JNYA 2ZOSA 2I33A 3WMXA 5JMOA 4UUMA 5C53B 4BO9A 3DV0A 3IKTA 4PS1A 1CJTC 1GPMA 3O4FA 4TRJA 1AV6A 4TXLA 3VDQA 4X3OA 1QOZA 2CMKA 2J09A 3P2EA 3F2IA 2OQVA 2UZ1B 1YJBA 4EHAA 5BPHA 5CB4B 1FBTA 2PH3A 5E38A 1L7RA 1UC5B 4KXLA 4HF7A 4AFNA 1U8UA 1DAOA 4FFLA 1I5EA 1JEDA 4Y7DA 3GBSA 4Z0NA 5IVHA 1EIZA 1F38A 1O4WA 3FPFA 3OZ7A 4M9QA 2G5GX 1E8DA 5CAEB 2EKZA 3IUSA 1YDGA 2J0SA 2QSUA 3MTDA 5DHSA 4HAIA 3RVSA 1XKLA 1M6WA 3PFCA 1U8TA 5ANRB 1XVVA 3ISVA 4DV3B 1WY5A 4Q1DA 3EDYA 4G65A 3SKVA 4LOIA 4M86A 1CJBA 3PIDA 1IIRA 1N75A 3T61A 4B17A 5L45A 5IM5A 1GPDG 3IAFA 4P4TA 4TWRA 5JS7A 1OBOA 2H5JA 2ZI5A 3O75A 3STTA 4NXMB 1E77A 3U26A 1GU7A 3QKIA 4XVRA 5KC8A 4JAVC 3GT4A 4QDKA 4UCFA 3TAXA 1QF6A 4HI0E 1O97D 5AHWA 2WM9B 1C0EA 3OFND 3BD9A 3ELWA 4F3CA 1JUDA 2IXDA 1KORA 2GQFA 2FU5C 2CF4A 1E2PA 3GG2A 4KQXA 2IU3A 3QBJA 1GXSA 4FZVA 521PA 1L5QA 3W06A 2DUWA 1N7HA 4H4EA 4YFVA 3EUWA 3JU3A 3WKDA 4BEWA 3IIIA 1KJJA 2P90A 3EYWA 4MUHA 3EJ6A 4RK7A 4YJKA 3VZBA 3W78A 4E94A 1Y8QA 3I92A 3UW1A 4E1VA 1B41A 2NVUA 3HNOA 3OOCA 1P60A 1WTCA 4JHLA 2RGUA 2X0FA 1FNDA 3VZRA 5EPEA 1I94B 4Q19A 3KB8A 3W3AH 2CL0X 1CY8A 1YZFA 3F4BA 3LL4A 2H48A 1QH1B 2ZUBA 5CEJA 1AHPA 1PGPA 3PEFA 3PKZA 2Z6VA 2QRLA 3KEQA 3PNVA 3CNNA 2ZREA 2ZP1A 1MBZA 1SU6A 1L5ZA 1ABBA 1Z7YA 2RD2A 1PR4A 3PJEA 4RKYA 2BMWA 1E9FA 3MERA 3MELA 1RMYA 3OPYI 4UMFA 5SYNA 2GVZC 3WA7A 1RJDA 4ZI5A 4WXYB 2E4XA 4QEKA 4QOEA 3VYSB 3ZHXA 3SC6A 3Q88A 1G8GA 4R40A 3BTOA 2VBUA 1N2CB 8OHMA 5K05A 5ITZB 4JR0A 1IN7A 2VBIA 4II7A 2ZYAA 4BNDA 1KI1A 3ZWWA 3E8SA 3V8QA 5IT4A 3OKAA 1Y8CA 2BZSA 2R8EA 3H87A 3HABA 4M0KA 3BBPA 1PZEA 3LTEA 4Q93A 1DO8A 2XCOA 3AIMA 4DCJA 1L5VA 3MN1A 2G25A 4EGSA 1JQAA 4NV1A 2IGTA 2IUEA 3EQ7A 5J2TF 2FZGA 1TMGE 3TLCA 4FFDA 4MR7B 1QAMA 3LOPA 1EAYA 1CUAA 1JLLA 2VNSA 5K8TA 3H2JA 3M2PA 4QJ5A 4CR6A 5K0EA 2OZLB 4RZHA 2FFHA 2G7ZA 4XYBA 1BKYA 4Q9LA 3ANNA 4J03A 1JTFA 4MJXA 5NULA 3PUNA 2VATA 4FFPA 1KE1A 4BN5A 5L6MB 4CZ2A 5JSUA 3SKXA 2HNKA 1Z36A 3VR3A 4L28A 3NFYA 1WXFA 2ZYGA 3LFTA 5DHAA 3SR3A 3KSAC 1O1YA 4K6GA 2B82A 3EWNA 1NW7A 3BA6A 2FXIA 2OFWA 1CVLA 3FY4A 3RRJA 1U9CA 3PR2B 4RF5A 4RH3A 1FQJA 4YONB 1VZ2A 1U5AA 1EFLA 2AOTA 1U81A 1QE0A 4LZZA 3QA3E 2HB6A 4KL8S 2VDWA 3BXEA 3WLOA 2NSHA 4F4JA 4IUDS 4R2HA 1XZKA 2IXEA 1ZK4A 3UA4A 2B8WA 1EG2A 2IC5A 3M1YA 5AESA 5KQLA 4O8ZA 2HLDA 3KALA 5LKRA 3EGDA 3F8SA 2P7HA 1CRLA 4MVJF 2RJOA 5DSZA 4PG8A 3V00A 3HKDA 5AM0A 3UK1A 1NVVR 3C6XA 4TXNA 3P27A 1GCAA 1NW6A 4HMPA 4HS9A 1TU0A 1ZHFA 3OD5A 5BXYA 2IYNA 3GLUA 1IG0A 3AQ4A 1YIOA 4RV9A 5C35A 3TXYA 1XAIA 3RU9A 3NP7A 3GY0A 4X5OA 3TRKA 2GPJA 5FTMA 1QFYA 2CWDA 2IYZA 1A8IA 1QPZA 3PR3A 1M8KA 1T9GR 4IOKA 1W47A 2FSGA 3NGLA 5IF3A 4RMHA 1L7QA 1SKQA 2HC9A 3FGPA 5KDDA 4ZDKA 1DZIA 4OJKA 2FWPA 4BP1A 2EFJA 1SEVA 1E3ZA 1DFGA 3H7IA 1ZITA 3MQFA 4C0BA 1WZNA 2B7LA 4JN6B 5HQTA 1A1VA 3RVJA 4S2UA 5PGMA 1NI3A 4JI0B 2BAGA 3ENZA 4BIMA 3FOEC 1NDUA 3KQUA 2I7VA 2XBMA 1OIVA 1T4CB 2N9UA 1BLIA 2FG5A 1MORA 4HRAA 1NJ6A 1DRJA 2GPBA 3QU4A 4CCYB 3S1AA 2PMFA 1KXJA 1C29B 1F2TB 2VUSA 2XUGA 5DYYA 2PJRA 2WZPP 2QRZA 2W6MA 5E8JA 3TGLA 4NARA 3TI7A 3G6WA 1NASA 3ZV5A 3AUFA 1NR1A 2AZMA 4J7UA 2QR5A 1QS0A 4OP7A 2ENUA 3SC4A 1ZIDA 3FFTA 3L8DA 5JBIA 3BD6A 1J22A 4E7PA 5JAPA 1XAJA 4DCGA 2VAWA 1T25A 4EUSA 4GOOD 1X1DA 4DWOA 1MIHA 2I55A 4G9BA 5K4HA 1KC1A 1PO7A 1WMFA 2WFMA 1JSXA 1U0OC 2GA9A 3WB2A 3TUZC 3JAKA 5DK4A 4NKRA 4Z4WA 4IRUB 1J8FA 3JQQA 4UULA 3GGOA 1LNSA 3OA2A 3KT8A 4NNPA 4FT2A 3I1JA 5C1OA 2IYLD 3UMSA 1L1RA 1K4MA 3C7CB 4B75A 3NC0C 2RGXA 2G28A 3MMZA 5IWAB 3DMNA 2D3WA 4QDTA 3DDSA 4MUGA 4QRHA 2UUBB 2RGCA 1JFVA 2VI5A 5LA6B 3OJEA 4KGDA 4DLTA 3JPWA 4DMKA 3N75A 1Z0SA 1M6VB 4R41A 3CVUA 2EP8A 2J3IA 1FTSA 1JLRA 2IEBA 1G21B 3EY9A 3NBAA 4G2TA 3BJMA 4V3CA 1L5HA 5AH0A 4KOEC 2GAOA 1V0JA 4CV1A 4W1RA 1U3WA 3S5JA 5KTYA 2R1TA 1T8UA 2IZZA 4RJKA 3U1TA 1XRRA 5FBQB 1WQ3A 5F5NA 3EPJA 3CLRC 1N2OA 1QQ7A 3L8MA 3E5NA 4TLCA 1X2EA 3K0AB 3RIHA 2ZQZA 1PU2A 1ECLA 3U4GA 4XN0A 1HQKA 2OESA 2BELA 4JP5A 3RSQA 1A50B 4CL2A 1EWVA 3HV0A 3UAVA 1C50A 4IMIB 5B1DA 4QU9A 2FPUA 3OHPA 2DQYA 1XVIA 4F9GA 1CUUA 4RHFA 5IBQA 2Z2KA 5JQGA 2O52A 3STUA 1Y7PA 3OX1A 5C80A 5DGHA 1EVYA 3JYPA 3EF1A 2HO5A 2JB9A 3L1IA 1PBTA 4C0KA 1HDRA 2ODEA 3OEWA 5HM6A 2QTVB 1IBMB 4DN6A 4QATA 4C89A 3TVTA 1U4NA 2NUAB 5CM9C 2NADA 3NHRA 4I7EA 5TY0A 1A76A 3VZSA 3TLZA 2EWWA 5F35A 1M72A 2G04A 1DTEA 1GL9B 4YDSA 2HU2A 1K9SA 4PRKA 5HIJA 1SBYA 4LF8B 1TKRA 3T38A 5D7NA 1YU6A 3DQQA 2F3PA 1QH9A 2MMGA 1WB5A 3K1AB 2YV2A 1I13A 4U39A 3UHFA 4LECA 4D02A 2G6TA 2G9VA 3MJRA 4ZQIA 4Y2UA 4C4YA 4B3SB 3I2FA 5E2BA 3S70A 3QJGA 3STWA 3R0VA 1PJCA 2QTNA 1J20A 2IOYA 4TTRA 4BO8A 4EW3A 4CTMA 5HZHA 2TMGA 3DDHA 4Y9DA 2G88A 1LDMA 2FN8A 3DBRB 2XUHA 3HL0A 2P75A 2N0SA 5AKGA 1EM6A 5TQVA 4F6RA 1YCHA 1U0EA 1N0UA 2B2XA 1V48A 2P6PA 3I2IA 3KPUA 4JIGA 1G5IA 4CQMB 4LOLA 3RYIB 4D79A 1VHJA 2VP6A 2KBEA 1R37A 1E3EA 3JW8A 4K2AA 1Q44A 2JFWA 1Q19A 3URMA 1J0BA 3IHTA 3LGAA 1I1QB 3ZJUA 4JYCA 1PK9A 1W46A 1Z0AA 5ITVA 2J41A 4DNTB 4X06A 4YMLA 2FEMA 2V8BA 4DCNA 5BWLA 3ANMA 5ULLA 4BRZA 2G70A 2NYAA 3QFSA 1HYGA 3CONA 1SIBE 3O4IA 4TLAA 2VUIB 3K70B 3BXXA 3PGA1 3IBFA 4EPYA 1LC0A 2CMGA 4WLOA 4XJTA 3OO0A 2WY2D 3TO5A 4JROA 1CF4A 3RC2A 3DR5A 1X2BA 3PNYA 1QQ5A 4EAQA 1OAKA 4QVJA 2NV0A 2BFCA 3K92A 5TVGA 1IBKB 4FYIA 1ULUA 1FFCA 4W5WA 2Y1CA 5G40A 821PA 1CTQA 4RCZA 3QUQA 5IBPA 2GREA 5F4JA 4LISA 1AG9A 1QGUA 1BD4A 4QA9A 2JFUA 1BA2A 3WLHA 2FK7A 4JJAA 3MWFA 1EXDA 1C3VA 1G3IA 1O77A 3HACA 1PL7A 1J8YF 4R69A 3M3DA 5LMZA 2FNAA 4UEWA 2VQSA 4N7RA 3LUJA 1J09A 2VYCA 1LZKA 2IYSA 2W58A 4RSMA 1XZIA 1RKUA 2BUAA 2FI1A 2X76A 2ZRDA 3HCWA 1Y9DA 3NASA 1YK0A 3O1HB 5CA0B 1VYUA 1IM8A 5ELXA 1Q7YD 3BL6A 4HEA1 1E1QD 3L46A 5CMLA 3DBHB 4U3JB 4XL9A 4RJ2A 5I4BA 2X9LA 1W52X 2RJ3A 3EA0A 3F67A 3I2KA 2M6KA 3Q2OA 3BE4A 1CUYA 3I2YX 4QTZA 4B3TB 1UKBA 3ZU2A 5J3OA 2HJSA 4IVNA 3TSAA 4M76B 4MV1A 4LX8A 1OPXA 1Y4ZA 1ND6A 2V3CC 2GWHA 1NBWB 3QF4A 5FOQA 3R5JA 5AUOB 2ZUVA 4G5YA 3ZZNA 5JQGB 2J9GA 4CM4A 1P1BA 1KERA 2ZTSA 5AXBA 5IJWA 3I72A 2Y1KA 3D31A 1ZSYA 2HUPA 5KYXA 2ASEA 1EM8A 2FPLA 2X9VA 3P71T 1KQSB 1Z2AA 2FWAA 3PA8A 5DX0A 4ZARA 3USZA 3UQZA 2GTPA 4RACA 3TTWA 4BFTA 1KZ9A 4C22A 4E51A 4NV3A 1L6RA 4DAOA 1SQFA 3S2SA 4WCFB 4AZ3A 4A2CA 1T5OA 3TR5A 5BORA 3L6RA 1VJDA 1OFVA 1LI7A 3X1ZA 4A73A 3VO2A 2Q6LA 2O7RA 2IIQA 3G9QA 4RTSA 2J1LA 2WU0A 3GRCA 4O2BF 4HDRB 4MS4B 3VKVA 4OG2A 4PX5A 1RPZA 2JGRA 3BWCA 4AO7A 3U48A 4H2DA 4GKJB 1HBJA 3KLBA 1ISPA 1FLVA 1PT7A 3L4BC 4C7JA 3EX7C 2OYRA 2Y27A 3IE2A 3NUZA 2PZGA 1GUYA 4F8YA 3WKCA 4HWPA 3NWOA 3ST7A 4HNUA 1E2BA 4JJ8A 4BMOB 4C3VA 4TV9F 2NU8A 1LI5A 5ALPA 4NJEA 1TW3A 2WQZA 3DAGA 3QV2A 4UATA 3OZGA 3LL7A 3RU7A 1U8AA 2OCYC 2P0YA 2AX3A 5FJIA 2PZJA 2SICE 4KQHA 5HF9A 1E2QA 1TLLA 2X4DA 2CXSA 1KYXA 4LE2A 4GYYA 4ZDWA 2HBYA 3H16A 4GPIB 4ZYYA 2CK3A 1NQTA 2XCQA 1DUVG 1BW9A 4TWZA 1CR1A 2UYHA 2WK1A 2A0XA 1DCMA 3HVIA 3PIIA 2AJCA 5BSYA 1K6EA 1W48A 2ZL5A 4R2LA 3EVGA 3BJZA 1JP7A 1WUHS 1ULTA 2F1IA 4FGUA 3PEVA 4HQRA 1BDIA 1AS2A 4XFKA 5IC5A 2IXFA 4N18A 2P4EA 4UKDA 1CZLA 3OT4A 1H5UA 1ESMA 2Z30A 3I01A 4H3KB 4AKEA 2IZ7A 1MNQA 1YAHA 1Q50A 2P2NA 2QD4A 5TMDA 2QL7A 1Z5PA 4E3WA 1P62B 2G1UA 3D6JA 2V7GA 5BQXA 4FNGA 4DSAA 1N5OX 8ATCA 1K8QA 5KPDA 1BXRA 3ZBTA 4BFWA 5B7PA 2YNMC 2I1LA 1K88A 4X1KB 2REXB 1PFVA 3HJBA 3O82A 4CIAA 3F78A 2BR3A 1FFAA 4FZJA 2AT1A 2QRGA 1IRIA 4TTAA 3TX6A 4HDRA 4MS4A 3VZDA 2QF7A 2I0FA 2ZS7A 5C46F 2PVSA 4HPJB 4L1KA 4BRWA 1FTNA 1JJAA 4KRFA 5FDFA 5BSMA 3EDOA 3UAXA 1ZJJA 1XZHA 4U8HA 2NV2B 2X1LA 2RC6A 1SG6A 2OY0A 3IB3A 3LGXA 5F9FA 4YAFA 2BFBA 3AUKA 3PPIA 3ZWMA 2LIVA 1Y1TA 1FXWF 3HA7A 4MR9B 5D5HA 4Z7JA 3ZY3A 3EWAA 1XB2A 2GEJA 2A5LA 3DAOA 4TKVA 2RK6A 3A1FA 3ESRA 4CM4B 4JJIA 2RHCA 3JRNA 4B4VA 5C18A 3ZDAA 1FMFA 2HDOA 2IUTA 1VB5A 2OYNA 3PWTA 4FUQA 3W2TA 1O95C 5JEDA 2B78A 1QGED 3MJTA 3U3ZA 1SUBA 3RRZA 1KQGA 3HCRA 4EA6A 4F96A 2OD7A 4I5GA 1KK0A 1GOTA 3EVNA 4C03A 1H4QA 1S2IA 4R01A 3B12A 1ZBDA 3I6MA 1XVLA 2I6QA 2C97A 1IUKA 4F5ZA 1B6GA 1SPBS 1U8ZA 1YNSA 1NQWA 1KJNA 3AZQA 1QBKC 2OHJA 4B9AA 1PR3A 4RQBA 4YAEA 2FRVA 5KPJA 3RYFB 4TMYA 1VQ8B 1ZO8A 1O3YA 1HMYA 1QV6A 2ZJBA 1R10A 1BFUA 4N5MA 4WFKA 4G0ZA 4ZTBA 1FFHA 2FQYA 1R0RE 1W8DA 3HNPA 2GCOB 4BO2A 2RKWA 1FFSA 4D0GA 1Z5VA 4S1PA 1A7KA 3PICA 1U3GA 1ZU4A 1JXMA 2DBYA 2VRBA 2XQVA 4IDNA 4P0PB 2NGRA 3OTWA 1QZTA 2LCFA 5C51B 4YH1A 2HWKA 3DVAA 1GFZA 3DB1A 4BRSA 1F9EA 2Z3WA 4E2XA 4MMZB 1D2NA 3AJ9A 3I04A 1LBTA 1QHEA 2JH8A 2R85A 4LSMA 4P8RA 5FBWB 3R6DA 2EW1A 1P44A 1W94A 4DV2B 2C04A 3K31A 4Q3EA 4AYXA 2XRMA 2OAGA 3DXFA 4ZOEA 3UAZA 4MR7A 2PZKA 3MNFA 3JALA 4Q0MA 4RVUA 1DV1A 3ZWYA 3DZGA 1BCRB 3O4RA 4DR2B 3G79A 4F84A 1PT5A 4M8IA 3HBJA 3V4LA 3MWDB 1SIOA 1ZCJA 4GS5A 4KODA 4WVFA 5EG5A 2BTQA 3PNOA 1XKTA 2H52A 1JHQA 4HDSB 4QVAA 3A1SA 4JC5A 1HORA 3LQ6A 1W6RA 3K70D 1XFOA 1DZ3A 1JEEA 2JS7A 1DHRA 5IEBA 3WL4A 3QVGA 1KR2A 1MH1A 3WJ7A 4E5SA 1RPAA 1L5NA 1OX5A 1NJGA 3ETLA 3GJZA 2ID9A 3VTFA 3JV7A 1UMBB 2Z4SA 1VLLA 3FR7A 1NXXA 2VEDA 4REQA 3CVVA 3W8EA 3OZCA 4YV7A 1NVXQ 2G40A 1MO6A 3LGSA 5BNZA 4JB2A 1A8HA 3AR4A 3G8YA 1CB0A 3PQ2A 1PZNA 1SN7A 1WV0A 3AWDA 2PL3A 3ZHUA 1YITB 2ZIXA 4NULA 1XQ6A 3PHLA 1PUIA 1YB1A 1W76A 3RS4A 4I5EA 3V2UA 2O0JA 2REOA 4ARSA 4ZVUA 1Y80A 3LZCA 3UGKA 3WYDA 5ARCA 3K1AA 2ODQA 4NYMR 4AWAA 3B85A 1DJMA 4LOHA 2AFVA 3HP4A 4ISBA 4QFBA 3SIRA 4O3MA 1TTQB 2BZ1A 1BOOA 3OQVA 4LDZA 2CHUA 1Z62A 5D5QA 2FZLA 4QYWA 1EFDN 2XGSA 1B15A 5IYZF 3D59A 4GL2A 4N3AA 2NTVA 2VAPA 3VH4A 4IRXA 3SI7A 3W4IA 4BHTA 4YUYA 1A77A 3QU5A 4DK1A 2H1VA 2PMBA 4HX5A 5I7AA 1M9NA 5KYWA 2HH9A 5COBA 2GZSA 1U28C 5CLQA 3LHIA 1ABFA 1Z35A 3PDIA 3A8IA 4NCIA 2QMUA 4GQNA 2Q5FA 4WBXC 3WNBA 3BC1A 3HN7A 1QKKA 1GRQA 1Z6XA 3MBOA 3FUCA 3OOJA 4G5GA 4OIMA 4WUVA 4GHWA 2EQAA 3FNIA 1EBBA 2ZZGA 1DT5A 4PAQA 3BA1A 5IYZB 1JZQA 3R3VA 1MRZA 1CUSA 2OV6A 3GXOA 2DF8A 3O73A 4HDSA 1ECGA 3E7DA 1G8MA 4H7JA 4IOLA 3QUCA 2YWEA 2ZRNA 5EGSA 4MNTA 1MJNA 4Z9BA 2ICAA 3QHQA 3LNCA 1R3UA 3I5UA 1KBOA 4KQJA 5A6SA 1BKSB 3J81k 1BCRA 1I3OA 1KGDA 3MS4A 3A1EA 5I9BA 4DE5A 5GV8A 2JD1A 2WHEA 4KXMA 4RHCA 3GLRA 5DP2A 4IJVA 4IUYA 2O8BA 4PC7A 4CNQA 3GA0A 1EFHA 1I01A 4MTLA 1DEAA 4XARA 2OGWA 3WO0A 5AVWA 1ICEA 4HLUA 3AG6A 3C6QA 2VPZA 4J43A 1VKHA 5E3HA 2Q45A 2JVIA 3P4UA 3ENVA 1JB1A 1U2QA 1UXKA 2BGLA 3HU1A 3ND9A 3P2MA 4NYMQ 4Q4DA 3W8DA 4LJSA 4C7OB 1XZQA 3CVOA 2EZ9A 2Z1DA 4Z4RA 4Y30A 3A9TA 5DM2A 1VG0B 4WK2B 1A88A 1RS0A 2ZSHA 4N76A 4Y2PA 1JHMA 4HXEB 2C3UA 1EVJA 2Y77A 1ZVJA 2C83A 3G1UA 4G6ZA 4IPTA 4ZAYA 4DABA 1CUXA 2I4IA 1GPYA 4BNLA 5CVUA 2BGWA 1CW2B 4DCVA 4M9XA 1Z4JA 5DHPA 5BT9A 3IBYA 1XQ9A 1FC0A 1Y5RA 3DUWA 3JRWA 4P32A 3IAHA 4WY8A 4MHTA 4P86A 3HJRA 2COKA 5L4SA 2BFBB 3VR0A 5FEUA 5ECWA 3M7IA 1SG0A 2PGDA 3B52X 2I29A 4H1VA 1R4MA 3QUBA 1SXJB 4HGOA 4QX6A 3SJUA 1PSDA 2QZ4A 4RLSA 4CCSA 2Q0QA 4JBYA 1FYDA 2YJGA 3HEMA 2G71A 2H1RA 4YACA 1WOOA 1FRQA 1QGZA 4PIPA 4URHA 2H31A 3VYUB 3CGGA 4YXFA 5G3YA 4Y2JA 5AOVA 4BDTA 5GVRA 5A3RA 4RTRA 4OB8A 4G36A 2N1BA 2Z2XA 2X23A 3N7TA 4LXXA 1S2GA 3SQDA 4MROA 4D99A 1YI8A 3MGKA 4LVCA 1ACJA 1RBYA 2Q2VA 4KQGA 4O1HA 3GGGA 3R3JA 2CZCA 4EY4A 3OC0A 4YJ3B 5DNYB 3U7GA 3GFVA 1Z4PX 3QBDA 3V1YA 3CIFA 4QYMA 3WHPA 4OUKX 3EJWA 1Z0DA 4V03A 1TU3A 1Z6TA 3CSUA 3FDXA 1SBIA 4M1WA 1N8SA 1DKQA 1FMJA 2GM5A 2V7QD 1XZGA 2JK1A 3MJDA 4JB8A 4KLZA 1H0HA 2HK8A 4HYYA 4KQMA 4PQRA 4ZAVA 3RG2A 4DGQA 5I48A 1XHFA 1GTRA 2NQ2C 5CDUA 4P2NA 1H6AA 1CDDA 3W2HA 2ZULA 3IPXA 3AHGA 4I1IA 2QT9A 1Z12A 4KXXA 1OV4A 3T6KA 3MGBA 1ONBA 1M2HA 1NKTA 4HADA 3WSTA 5C32A 3GCDA 4L15A 1EMDA 4LY6A 4N8SA 1Z75A 3IPAA 3JD4A 2CFRA 2H2HA 2UUOA 3ZGOA 5A71A 3HKCA 5EJ9A 3TXXA 2R62A 3ER8A 1YSCA 3ZI0A 3K9GA 2OXIA 4D0RA 4AICA 3K5WA 1U31A 1QMGA 1WXIA 1Z5GA 3ACCA 1SO8A 2J5KA 2VTVA 3SFTA 4D44A 1VECA 4FYYA 2B8TA 5C8VA 4CMGA 4EEKA 2C7OA 2XZDA 3A1NA 4MXDA 1CEXA 2A9OA 5LKAA 4DUGD 4PLYA 4KPYA 4FM9A 2C5EA 2NSYA 1O4VA 1JIIA 1BGWA 4QQ8A 2BFOA 3SHOA 2BEJA 1Q2UA 3WGTA 1CUJA 1FP4B 3DE7X 4Y18A 4B87A 1EIWA 3EAGA 1PG2A 2CVFA 4H15A 5BR8B 2ZXUA 5DXFA 4BU0A 5HE8A 3DZHA 2F00A 2DCUA 1WKVA 2O2HA 2H8KA 3NJ8A 3SSMA 3A36A 3BXZA 3TBFA 1UBCA 4QUGA 1G4UR 1GQQA 4UQOA 1ZEJA 2GERA 1YX2A 2QPOA 3QENA 5F7XA 4AKHA 2H57A 1ZI6A 3IEXA 4LGYA 1Q7GA 1R6XA 2VJKA 3AXTA 1HNWB 3Q8XB 4KWIA 3P9ZA 4MQBA 4D82A 5E4FA 1TO1E 4OY3A 4P82A 3W77A 4TTTS 1U7TA 1UPXA 1GNRA 2OOSA 2GUGA 4MWZA 2GT1A 3G3EA 5KQPA 2C1EA 3LPLA 2YZKA 4MW4A 3V33A 4KFCA 5C31A 4A0QA 3ENQA 1S2NA 4JGIA 1KSJA 3NT2A 3U9SA 1H85A 5C7OO 2F2TA 1BJTA 4AJOA 3QU7A 1IY8A 4Q5IA 1SUCA 3HE3A 1VE3A 3T9AA 1RTKA 2JLBA 2UYQA 3L8EA 3DOEA 3HCCA 2ENWA 1M8FA 2WU4A 1E1DA 2VFAA 2BP7B 1AV7A 2OLKA 3QX8A 4N9QA 4WOJA 5G2OA 3TVDA 4UE2A 1K0UA 5DMXA 4H16A 5I8WA 1MQAA 1E43A 3JQEA 4C29A 1S6YA 2XITA 3VDRA 3F0TA 3NLLA 1OU4A 2VT6A 4UTVA 4B9EA 5CNJA 4UVEA 1DRWA 4YPVA 2HZ7A 4WXMA 3ZE0B 2OAP1 4AJ4A 4PEVA 4DPMA 4ZHSA 4O2LA 5K01A 2XDQA 3BSSA 3ETJA 1RI1A 4D4HA 4KO4S 3H42B 1YACA 4IH4A 2XD9A 2JLSA 2N42A 3C98A 1G55A 4PE5B 1CDZA 1U2ZA 2G1JA 2YJTD 3RUHA 4D46A 1Y1QA 1UDRA 3OTOB 2APJA 2CKDA 1ISFA 5A9SB 1QMPA 1YKSA 4TRMA 2QIOA 3UCXA 4YCJA 5KS2A 1B76A 4Q3LA 2ERXA 4D0LB 4PXYA 4YRQA 4XOTA 1FU8A 2OBMA 1IHYA 1NVKA 4WNAA 2QLBA 1U3UA 2XTJA 3IQZA 3IIEA 2GWRA 1G5TA 2Q5IA 2YBEA 2WHXA 4JQOA 3ED5A 4QG7A 5ETJA 1KO7A 2I2XB 3TMKA 3KQYA 1R66A 4F6LA 3KV3O 5LLSA 2PJDA 2H4XA 2D54A 3Q3VA 4RXMA 1NM5A 2BEKA 2ADOA 1NBAA 3Q5GA 5T57A 3D1VA 2C2ZA 4PZLA 1X7WB 1XQVA 2ROQA 4CDRA 3ABOB 1UUFA 2Y9MB 1DDGA 2XADA 1V6SA 1M75A 2ZJ5A 4HRYA 4B74A 1X3SA 4JENA 1P73A 3H5RA 1NIPA 2YHIA 5JJ5A 1KKLA 3UFBA 2J4CA 3OHSX 3ETNA 3G9ZA 5TPWA 2QPLA 3RNOA 4G0MA 3C3PA 4OOXA 5F51A 3HCNA 1GDDA 1S1MA 3KTAA 3OZEA 3CVYA 4CLOB 3UCFA 5HW0A 2FPGB 2P62A 4Q7KA 1HNXB 3JX9A 4YI3A 1KHHA 1X7WA 2PLAA 1UC8A 3FPLA 4BV8A 5ALFA 3O2SB 4P5PA 2CLLB 4HDAA 4JFAA 2FWRA 2J8ZA 4EO9A 4HUTA 3W90A 4KNWA 5BN4B 3UUEA 3W5UA 1R0WA 2GQ0A 2V4ZA 4B8ZA 4O1MA 2J32A 4CM7A 2IBSA 3CH5A 1CPYA 1ENPA 2YWBA 3RVQA 2O8DA 4TQUS 1B7GO 2WOJA 3TNJA 3RC7A 4B6OA 2UZAA 3CMEB 1EVQA 4EFLA 2DPXA 1AT1A 1RYMA 2FWBA 2WE7A 1USVA 4C4ZA 1G16A 2J3MA 2G9QA 2GH1A 4PAGA 4RPKA 3C8MA 1IBRA 1RM4A 5B57C 4OP2A 5LZ8A 2AJLI 1JZSA 4C9BA 4PZ0A 1W85B 5FA6A 2VJMA 4Y6QA 5KYUB 1H2HA 2WIGA 4PG4A 3W5VA 3V8MA 1E4OA 4F4HA 1M1YB 4Z4CA 4QVIA 4RDKA 1BEUB 421PA 1TCAA 1QJ4A 5FWDA 1N9KA 3R24A 1B1AA 3PDHA 3ZQKA 3LHFA 3TFQA 3GLHA 4LJAA 2R6ZA 3GJQA 1DKLA 3GXBA 3KC2A 1K08A 4KPFC 1WF6A 3H2BA 4HQ6A 3RLFA 1U2RA 1R3DA 4CVNA 1ZVMA 5AI5A 3WGNA 1RXIA 5NLLA 5DN9A 2AFIA 1E0KA 3KELA 3LCUA 4GMXA 4EW2A 1FQWA 2OM2A 1W4AA 3DKRA 1G17A 3GZ4A 1TEVA 3N58A 3Q3EA 5B1YA 5HPYB 1WMBA 1HQDA 4MB6A 4R16A 4ZU3A 4QTXA 3TM5A 3BNWA 5HIAA 2A0YA 4MUFA 2PWAA 4BQIA 3MWJA 1KPGA 1CUBA 5J5CA 1T0PA 4M22A 2FLVA 1A5TA 2PAFA 4NMWA 1CSEE 5B58T 2QTLA 2I91A 1GUFA 3CF4G 2D06A 1M6VA 4PO1A 4XW2A 1GV0A 1RAIA 3B8EA 4XUCA 1ZD5A 2WQ7A 2HN9A 4YV0A 1VJ0A 4ZT2A 1GLVA 2IPOA 3PXDA 2R44A 4ZVRA 4ZZIA 4Q9JA 3DTYA 3WISA 5EIXA 4DRXA 5BWMA 3M9LA 4LJYA 4CKYA 2MIIA 2YCBA 2XGMA 4OPSA 2E1PA 1JDTA 1AY0A 1EFTA 2IEDA 2DJIA 2O2XA 2ZU6A 4X71A 2GCOA 2Z9BA 3AHDA 3I83A 1XLTA 2AG8A 1XZLA 3A4YA 3E03A 2NO4A 2OV1A 1S2MA 2WMOB 1YFJA 2FOXA 2WFLB 1I24A 2E4ZA 5B1IA 1OY1A 3FTCA 3S8EA 1TD1A 1RPJA 2ZR7A 4P3KA 5IDVA 1B2RA 4KREA 3FVQA 4H6PA 3TQFA 1AO0A 3W1EA 4IH9A 3P5SA 3VU9A 3ILSA 5KVSA 1AGRA 2FB9A 3GYGA 3HU5A 3RF7A 3TDMA 4XDGA 4CQLA 5FI5A 3ESQA 4F2HA 4D3SA 3PS9A 3TIFA 4IDOA 3DLBA 1VQ1A 3FPSA 4N5IX 3U1BA 1B0AA 2P9YA 3A31A 2Q4EA 1F0PA 3OQJA 5H3CA 5BNFA 1WXHA 4ES6A 3G88A 5FKJA 2QAGA 2ODPA 2PR2A 2YX1A 3IQWA 3HKCB 5GY7A 1Z68A 2F3TA 3QVMA 4NU0A 3D0QA 5FFFA 1KJZA 1NBME 1UK8A 4GM1A 4MVCA 2QYSA 5BV0A 4MV4A 1U0JA 3DXXA 1NVGA 2QSYA 3HKBB 4QHSA 4XWYA 5E3IA 5TXGA 1J2RA 1YUBA 3HB0A 3RTBA 2P65A 4WBNF 2CNNA 4LYGA 3PYMA 4XWTA 1XLTC 3QBVA 1Z08A 2IE8A 1MQ9A 1XR3A 1DJLA 1HFEL 1U7UA 4FIZA 4FPXA 1BDMA 4UJ5A 4GL4A 4D4MA 4EX7A 2JL1A 3BT7A 1FYWA 4K6CA 2GCPA 1X8LA 3IAAA 3O8RA 2IS1A 1J8QA 4AG5A 1QS0B 2QRUA 4TYNA 4P38A 3TMYA 5LU9A 1Q82D 1ZYUA 3AP1A 4KIFA 1XRQA 5F33A 1V5EA 1X9IA 2QSJA 3JATB 1T3ZA 3HG7A 3JQ9C 5CCXA 3EIOA 5E6RB 4FGWA 2GYWA 1ECFA 3S8MA 2VQEB 1T2NA 3KTFA 4QU8A 2A9RA 3U3OA 3FMPB 1L1EA 1RFGE 3OKFA 5JWHA 5C5IA 2OBBA 4AUKA 1FYFA 1XTUA 3G5TA 4P93A 2QJOA 4WK6A 4XH9B 2R2GA 2BFWA 2CDCA 1GNQA 1EXMA 2JAUA 4FSXA 4NH4A 1FP2A 2SCUB 3EXIA 5LA6F 1U90A 3QBTA 3OJXA 4J0FA 4FB5A 5KNLA 1YRLA 4ZGNB 1DOHA 3TJZA 1V16B 1VGQA 1I9CA 4EFMA 2YFHA 3EF3A 5D3MB 1Z4IA 4HDMA 4BCBA 1OWOA 5LB4A 4B5LA 3UA3A 2E4UA 1FSGA 5JRZA 4QARA 3D6TB 4F2DA 3L02A 3A6PC 3OCYA 1E79A 1ZG3A 5AI4A 3VNRA 1VZ3A 3ND5A 4MJ7A 3P2YA 2B1RA 1NDHA 3AXSA 2AZ4A 1AQNA 3PFWO 3GVKA 1K7YA 3EZLA 3P4YA 3DPSA 3V1NA 4EHNA 3VR5D 3REQB 2IXGA 2FH5B 4B3CA 4UAJA 2Q3JA 2QZSA 5AIBA 1NYTA 3SDZA 2RHJA 3LQ2A 4GMKA 2N46A 3V76A 1TMOA 2XNSA 5EHIA 4D4LA 2XR1A 4AY4A 1R00A 4MYSA 4ECAA 4UM9D 4DR3B 4PAMA 4JR1A 2XCTB 3GFSA 4C7OA 4ZOCA 5CH8A 1LPMA 2JATA 3I12A 4S1WA 2R1VA 5BVHA 4KB5A 3VUEA 5KNDH 1J0AA 2NU8B 2JJ2D 3AUXA 2F43A 1X9GA 1YHNA 3A3YA 2C3MA 2HHLA 4GKAA 1DPGA 4MRSA 1VIDA 2O8BB 4QXMA 3NKLA 1NRWA 2RHWA 3HO8A 2OCKA 4H6VA 4J94A 4YMTA 3T3NA 3EIWA 3EFHA 4I6JA 3SZ3A 4JLDA 4FX5A 3NM4A 4OX9B 2OTJB 3P9CA 1D2CA 4CQNA 2GFQA 3G05A 2J5QA 5FNZA 4Y6SA 1GAXA 1VHQA 1JALA 1PT9A 1WP9A 1L4MA 2E4WA 2A5YB 3IESA 1X7XB 1K9MD 3X1KA 3GDGA 2VK8A 1G19A 4LZPA 3G71B 4FMCF 5A7FA 4LOAA 4C0HA 5TRTA 5A4JA 2ZB3A 2X1MA 2O7QA 4L27A 2CDAA 2PUJA 1RACA 5EMLA 1LPBB 4N4AA 4Z99A 1AX9A 2C2WA 2C0CA 3K5HA 4Q3KA 5KYXB 5FLXA 1NN0A 4TOIA 1A9SA 1LLDA 5BQ3A 1G5PA 3JATA 1JI0A 1Q74A 2G8LA 2W6OA 3CN7A 3H97A 3PDIB 4LC1A 5DP1A 5ES3A 4EGCB 5DYIA 5I7UA 2GEKA 1KDOA 2B99A 1ENYA 2IRWA 1UBTS 1EA5A 3F6YA 4DIFA 1CY4A 2FZKA 2OV3A 4ISCA 4YP1A 2CE7A 8ABPA 3W0LB 1NNUA 2YIDA 3B1XA 2VBVA 1PAUA 1KFBB 2FAXA 3IULA 3LUHA 3FPPA 3QLTA 5COQA 3OQ6A 5C8YA 3ZY6A 4ESHA 4HGNA 2BFEB 4J90A 1NM5C 4QBFA 2C5HA 3R0IA 1VCIA 1G0OA 2AKAB 3DMDA 3QGMA 3OW7A 4UPDA 1MJ5A 1ZAKA 2VA9A 3IDFA 3L6CA 5ICCA 3GLIB 1Y0BA 2W8BA 3HB7A 1UFVA 3HBLA 1QRDA 5BQ5A 3VM6A 4Q7LA 4KJXA 4ASUD 3THYB 4EJSC 2ZKLA 4CF4A 1DBWA 1E0SA 1QM5A 2R6DA 3COSA 1Q3KA 3G0GA 4MKHA 4TSKA 3S3TA 2AI2A 3PL1A 1GFIA 4N6OA 1T3GA 5IK2A 2WYRA 1L5OA 1M1NA 1T29A 3CF2A 3MIZA 3SF8B 4WVLA 4TVOA 3HDQA 4XOIA 1REQB 7YASA 3CZ5A 1L5GB 1HYEA 5CD1A 3U9LA 3CT4A 2OUKA 1KP3A 3AWIA 3I9MA 1WCYA 3E5MA 3M81A 2J6BA 3H11B 3QKRA 4P4NA 2DFKB 3B6JA 4Y8VA 4CNBA 3NW9A 2WSIA 3RS5A 5EVJA 1ATIA 4L8WB 1WVMA 4ZJZA 1VSQA 1XTPA 5EZYA 5C34B 5AKLA 1YU9A 3ZLTA 3FJYA 3EMBA 4LQCA 4P3YA 2I67A 6YASA 4WZZA 4XKWA 3FTPA 4FGKA 2K2QB 3A6ZA 5DASA 4ID3A 3VX4A 4OHFA 4LWOA 2YW2A 3TKAA 4C21A 1SG9A 1DAIA 2BTOA 3KM0A 3UENA 4ZJYA 5ED0A 2I1VB 2VPIA 5LDHA 2P69A 2B21A 1QP4A 3D3KA 3PQ5A 5ESDA 1DJNA 2D1TA 2OZEA 4CL0A 3L1JA 1E2GA 1QHYA 1TFUA 2FW9A 3WB9A 3EEOA 3TZLA 2WJIA 4QOIA 3REFA 3PBKA 3PNQA 4EABA 2QK4A 3V32A 1I7PA 2HQ1A 1BHQ1 2BUCA 2ZUSA 3V3KA 4AJPA 2WF8A 4AJIA 3QXSA 2ID7A 3FYUC 4KAAA 1Z39A 3UB3A 4X7FA 4B8YA 4PC2A 1NOIA 3D6UA 2VH1A 3MQ2A 4FYPA 5AOCA 1NQXA 2PZMA 3U9TA 1XSEA 4C6SA 1KARA 3V1MA 1XVTA 3BMOA 4F6CA 1QCYA 5B3AA 1AOXA 3U60B 3BIJA 1DOAA 2WB2A 1YR7A 2VF7A 4CDGA 4FEYA 1SR8A 4LZNA 1ODCA 5ICFA 3LD9A 1H6DA 4JOSA 5TJ9A 3UJPA 1PT8A 4FYVA 4M1OA 2CHVA 1KSGA 2ANCA 2DFTA 5HCNA 2Y0DA 1FTYA 2J0UA 3NVAA 4XLZA 7GPBA 4EHJA 4C4RA 3U6BA 5HEKA 1VJRA 3A04A 4FMCB 3BD7A 3WHKA 4ARIA 4D26A 4MW7A 2ZPUA 2GF0A 3KZMA 4DQ0A 1JIXA 4ER0A 5K8UA 1H8HD 4DPLA 2WSSA 2OBXA 5CTAA 5DKFA 3RQIA 3P9YA 1U3CA 1GZ6A 1QO0A 5AMXA 3ZVMA 1MX3A 3CWZA 3W9YA 2FN7A 3KVVA 4U9IS 4EHHA 1MFZA 1UPCA 2AXNA 1B8NA 4N7JA 2O2IA 3SOZA 4HGZA 1VE1A 1L4NA 3OFJA 5KEIA 5AK0A 2ZBVA 2ONKA 1JR6A 2B0JA 1V35A 4OTZA 3WGGA 3NOVA 1P2UA 4QOGA 4TWJA 5E8RA 2C4WA 3TTUA 5BN1A 4US0R 3DS8A 4NU8X 2IIBA 2VLIA 3G5UA 1VQKB 2DWUA 4KNYA 4NOLA 3PUXA 2B1QA 2JAOA 2QU8A 2VA8A 1CR4A 2YY6A 1VYHA 3FTDA 5G0WA 3SJAA 4FNMA 4BB6A 3EODA 3STXA 3ELUA 4D4JA 2DPHA 3SR4A 3RUDA 1MXHA 1RJ9A 4RA6B 4RHUA 1AZLA 3CM0A 3FB4A 4LF9B 1ZINA 5JCXA 3BXOA 3K32A 4IDAA 1A2OA 5CB4F 4P26A 1RXUA 2GGSA 2WF5A 3SM3A 1TIPA 1K27A 2GZMA 2YN0A 3KCQA 4EL0A 4GIBA 3RW9A 4YECA 4HGRA 4L4XA 1P0MA 1P2VA 3V1UA 1YV9A 3G2MA 2JA1A 3L7AA 4IRMA 1UPTA 3UJDA 3WLPA 1EFPB 1F3LA 2D00A 4BX9A 3RS3A 1TJPB 4RFSA 1K1EA 4RFVA 4JLJA 5K6AC 1VKJA 3CJQA 2X6RA 1N0VC 1VMAA 2JGDA 3GT7A 3EF0A 3HUEA 4INZA 2FVYA 5AM2A 5KWSA 5LPNA 5KOIA 3N0WA 4FT4A 4LHWA 4MARA 5H16A 1W59A 3S5UA 5DYNA 2XUDA 1YZYA 5G02A 3K20A 3L8GA 1A2QA 3A9WA 3G2PA 3LQKA 3DTVA 2OBTA 2DRIA 3E70C 1NF2A 2GASA 1DVRA 4NFLA 4WWHA 3U4CA 2NPIA 1B43A 3DCNA 3ZXSA 3OOHA 5IKEA 4GP6A 1LB1B 4DJTA 1IATA 4LC0A 3Q4GA 1TA4A 5IWCA 3TBKA 2GFHA 1IVSA 3EVDA 3IEIA 4NIMA 2WIDA 3CNBA 1QC5A 3E7XA 3M6IA 3C43A 1L5FA 3MRVA 2VAMA 2Z6BD 1V4BA 3RC1A 4F8JA 5GZ1A 3UKDA 1L4HA 2I6UA 3PTLA 4A0RA 3WGUA 5JZOA 5EYPB 1MOPA 1EDEA 1LPOA 5DF1A 2QGFA 3TZHA 4CM8B 4RTQA 2HEIA 1OH6A 1JEYB 4KR9A 2IDJA 2IHKA 5GV7A 2XNJA 2JCYA 2JHGA 2NO1A 2YC4C 3I9LA 3JD3A 2ATVA 2E49A 3LYUA 4JCCA 5CK4A 2FLWA 1WSBA 3T4EA 2VJBA 2XMPA 4MQEA 2GAJA 4BY9E 2A78A 3Q6RA 3F6SA 3C5EA 3E3NA 3PRKE 2GZ2A 4UCQA 2OFFA 4TTJA 4NU6A 4QPNA 3TYXA 5SZHB 5GADl 3QVOA 1JIQA 4OH1A 2Q1WA 3JQ9A 5BRJA 2Q4BA 3K5IA 2YV1A 5HFJA 3VR4D 4TN1A 1M5UA 3L6OO 4HAOA 2FF5A 3IQIX 3MOSA 4XM1A 2I3BA 4O2RA 4U7WA 3QKTA 4DA7A 3P9PA 2J48A 3C8UA 1GM5A 1I9GA 3L84A 4TWAA 3CUEF 4AX4A 3A4VA 4QXOA 4XLTA 2V1XA 1YDWA 1Q1ZA 3OM1A 1ADCA 3MMXA 4BMVA 4IMRA 3VDXA 4MUYA 2QW1A 3H83A 3NHPA 3ODGA 4JI3B 3L0PA 3BRWA 2VEOA 1R9NA 3DVLA 4S3MA 4AS2A 2XBUA 4NESA 2O2GA 2E9SA 5ALHA 5HCIA 5JAOA 3JAMA 4TUYF 3E53A 4AIIA 4JB3A 1ZQ1A 3E2PA 4D6XA 4DNQA 1MHTA 1JHOA 5KJFA 2VQFB 1W36C 2YFYA 1PZXA 3E84A 3CG0A 3CKLA 2W43A 1NONA 4WWV