2X3UA

Ferredoxin-nadp reductase mutant with tyr 303 replaced by phe (y303f)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Role of Specific Residues in Coenzyme Binding, Charge-Transfer Complex Formation, and Catalysis in Anabaena Ferredoxin Nadp(+)-Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 86
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2x3uA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2x3uA02
1OGIA 1QVFB 2B5OA 3CC4B 4LBYA 4ZCMA 1FNBA 1ZM2A 2DEUA 1JJ2B 4YAUA 1SM4A 4RD0A 1I7PA 1GAWA 4AF7A 3ZZ0A 1DDIA 1YJ9B 1EWYA 1W87A 1Q81D 2DY1A 1KD1D 1CQXA 1FNCA 1ZM3A 2XNJA 1NDHA 2B7CA 4HE6A 2BN4A 1QVGB 4PC1A 3CPWB 3CMAB 1QGZA 4TMZA 1VQ6B 2QTLA 4YAOA 2EFGA 2VNHA 3AGQA 2DCUA 2QDXA 3AVVA 4ZV4A 1YIJB 4TN1A 4FK8A 2HDNB 5GV7A 3VNVA 4Q7JB 1BX1A 1YHQB 1K9MD 4G1BA 1ELOA 1TLLA 2BV3A 1KK2A 4TMWA 2VNIA 4B4DA 1UMKA 3G6EB 1B2RA 3FPKA 2J7KA 1KTVA 1BQEA 3CCEB 3ZZUA 1GO2A 1XE1A 4UAJA 3CW2A 1ZM9A 4ACAA 1IJEA 3I55B 4RD3A 1N8RD 2VZLA 1VQ9B 2BVNA 1AMOA 5EMNA 5KSWB 1M90D 1JB9A 2OTJB 1QGAA 4G1VA 3V76A 4PC6A 1JA1A 3WNCA 2E1RA 3JQQA 1VQPB 4B48A 1VQKB 2QA4B 2QN6A 5TV2A 3G4SB 2ZITA 3CCMB 1K8AD 4RD1A 1EFTA 1R5OA 3ZBUA 3OZUA 3W2GA 4YAFA 1Q82D 1F60A 1M1KD 1U2RA 4NBSA 1QH0A 1VQMB 2OTLB 3CCQB 1TUIA 4LC0A 1GAQA 4ZCLA 1KK0A 2BMWA 1GJRA 1BJKA 1EP1B 3W2EA 1QGYA 1EFCA 1S72B 4ACBA 2CRVA 1TTTA 1S0UA 2BM0A 1E62A 1VQ8B 5TY0A 2RC6A 2C77A 3W5HA 2DERA 4RJLA 5THXA 4G5GA 2VNKA 1KJZA 2RC5A 3AVTA 3U2QA 1ZUNB 1A8PA 1F20A 1KRHA 1R5NA 1D2EA 1KK3A 1YJNB 5H5JA 2BM1A 4RCYA 3E20A 3AVXA 4ZGNB 4M2LA 1AIPA 1CNFA 2OK8A 2YWHA 2FX3A 2BGJA 3B78A 4YHBA 4HE5A 5TR9A 4ZGQB 3AGPA 1ZM4A 2BSAA 2PMDA 2OK7A 1E63A 3CC7B 3I56B 4PC7A 1KK1A 3WBKA 3ES9A 2D74A 1FNDA 1SKQA 1GVHA 3JQPA 2DETA 1BX0A 4TMXA 4R71A 4IW3B 4B44A 3SJZA 4RCZA 5H59A 3CRZA 1N0VC 4AF6A 3WY9A 3G71B 1FNMA 1D8TA 1QUEA 2EIXA 1YITB 3CMEB 1G7TA 4U9UA 1FDRA 1EP2B 3CCUB 3OZWA 1QFYA 4P3YA 3I1FA 3W2FA 1OB2A 3LYUA 3PENA 1EP3B 3WBJA 3CD6B 2GPJA 3AVUA 3B82A 3ZBTA 4RD4A 3ZC3A 1K73D 3A1FA 4B3XA 1VQLB 1R5BA 2VYQA 5HXBA 3QFTA 4LBVA 3U6KA 1IJFA 4M53A 4FN5A 1QG0A 3ZZTA 4YAWA 2AHOA 1OGJA 1CNEA 5JBQA 4F7DA 3CB4A 1Q7YD 1YJWB 4B47A 4DQKA 4TMVA 3OJWA 1W2BB 3JQRA 3B8HA 4YALA 5DSZA 3J81k 4M0LA 3OJXA 4P6VF 2PIAA 1QFZA 4MYUA 4B43A 3CCRB 3CCVB 1KC8D 2YWFA 4QHYA 5FA6A 2GQFA 3CCJB 3QFRA 3CXCB 1HA3A 2VNJA 2YWGA 3P26A 3E1YE 2C78A 4EH1A 4N3GA 3VO2A 4N3NA 3QFSA 1FRQA 2R6HA 3P27A 3CCSB 2B7BA 1G7RA 3VO1A 4NCNA 2X3UA 1TVCA 3W5VA 1VQ7B 3U6BA 3OZVA 1DDGA 4TMTA 1GR1A 1YI2B 2BF4A 4LBZA 3VMFA 5AN9A 2YWEA 4BPRA 4C43A 4C0SA 2BGIA 2NPFA 1QUFA 3QFCA 3AVYA 3LVBA 1H85A 1NJID 4RD6A 1JNYA 3WYAA 1IB0A 1EFUA 1H42A 4Y9RA 3OW2B 3AVWA 1B23P 2HMAA 1DARA 1W35A 1QX4A 4M1KA 3QSYA 3LRXA 1N0UA 3MMPA 1XB2A 4WQMA 4J0QA 4FWTA 1OB5A 1G7SA 3W5UA 4K1XA 4Y7CA 1Q86D 4M4SA 1VQ5B 2QMUA 1EXMA 3LO8A 1G7CA 4LBWA 2CNDA 1E64A 1VQNB 3CC2B 4PGOA 5GV8A 1DG1G 4AC9A 4PC3A 1W34A 3WXMA 1KQSB 1VQ4B 3W2HA 4H9GA 4QFMA 2QEXB 1FRNA 1J9ZA 3W2IA 3CCLB 4RD2A 3MHPA 2XEXA 1JA0A 1VQOB 3MCAA 2PLFA 2QTZA 4Y9UA 3QE2A 3VNUA 3WNDA 3FJOA 2HCJB 2XNCA 4MYTA 4DQLA 4PC2A 3WNBA 1QFJA 1WDTA 1D1NA 2BPOA 4ZCIA
chains in the Genus database with same CATH superfamily
4XH9B 1JHVA 1CLUA 4M76B 2MR5A 5AK4A 3EWIA 3H1FA 5L3QA 2YYAA 2FWRA 4ECEA 1TZKA 4PAAA 1BQ3A 3BB3A 1RE1A 1OX4B 5KOHB 3S5JA 2A9JA 4EFLA 3ZDEA 4DGSA 3ETHA 4H1WA 3NAMA 4TKZA 3JZAA 3EAFA 4EZIA 4ENRA 3DMPA 4WK4B 1GYQA 3EOAI 4NXMB 1N6OA 2FDRA 2JEOA 2V7QD 1G42A 3FZQA 4IICA 3K9BA 3NWPA 5IS2A 5IASA 1QZZA 3L7DA 3MAAC 4XVHA 3V7UA 1T9DA 3OMXA 3BCUA 1JI0A 4KGXA 3D8UA 5IUNC 2P68A 5G0SA 1NOJA 2J32A 3MK31 5IPFA 1VLZA 2W6JA 1FTNA 1ZN7A 3QYJA 2M6KA 1KD1D 1Z16A 1L6IA 1L2TA 1THTA 2H4XA 1UPTA 4IQ4A 1GUAA 1RC1A 2C88A 1NQAO 2WWFA 3K6RA 4RS3A 3TKLA 1AV6A 3EIXA 2QPLA 3KJIA 3OLQA 1R4AA 3UJ7A 4DS3A 2Q6LA 1SOVA 4FMBB 2A94A 2P7HA 1NDHA 4FYMA 4KQEA 1Y8RA 3JRNA 4QUBA 2Q46A 3PK0A 1F2UA 3PZBA 1N1DA 1Z5UA 2X0JA 1K8ZB 1O5IA 3RU9A 3CLHA 3BX1A 1ZMRA 4YHHB 4LDNA 4CR8A 5KUTA 1UXOA 4AAYA 4NEQA 4BFLA 4MVJF 3ICVA 2RE8A 4ZCQA 4OGKA 1VLOA 1MXHA 3L07A 2GMWA 1X7HA 4BVHA 4YV1A 1GNQA 1L8QA 1Q1NA 1T5SA 2H63A 3TFOA 5A5GA 2OO7A 3WIUA 5ALFA 4X0CA 2C1EA 3I1JA 5CIWA 5K0TA 4FI3C 4BTVA 1Q7EA 4NICA 2Q2VA 3CJTA 1GPWB 3ZV3A 3AUKA 3IUBA 5AUPB 3WHLA 1MVLA 5SZIA 3GLIA 1DC4A 2RH5A 3HPQA 3OMLA 3AY3A 4NZNA 2JF0A 2QDKA 2GJSA 4GOND 5AH0A 2DFLA 3QEOA 4MICA 4WBNB 1UD2A 2H7XA 2HK6A 2XMZA 4RYLA 4BN4A 3ZDQA 2XQIA 2QRJA 3GA7A 3CONA 3K7EA 3VYTB 4X7FA 2C0QA 3EGOA 3ABZA 3HA5A 3KJXA 3GFFA 5MGNA 3P0RA 5TS2A 2O7NA 2ZT7A 3W9BA 2ZIVB 4B17A 5AVXA 4D41A 1TQDA 1Q7CA 2EIHA 3ELDA 2WWGA 3H3FA 5TX7A 1VYUA 3WGIA 4E2WA 4QEDA 1PAUA 4HEHA 3WLFA 2PJZA 3AJAA 1FX0B 4BAGA 1AK9A 2CLEB 4KWEA 1N8RD 2DBRA 1JDUA 1IQ0A 4PZDA 3UOWA 2BVNA 3WSTA 1JV2B 4YCBA 2C20A 1FP6A 2WD7B 2V7VA 4KZPA 1M90D 2IPNA 3D4IA 1EFDN 4FOSA 1Y8QB 4GBGA 3WFZA 1C2YA 3FLMA 4HQ6A 4MQFA 4FYJA 3P0FA 4QRIA 4YRDA 2EZTA 2R8XA 5T4HA 3PEFA 1UQRA 4AN1A 4D99A 5EUBA 1Z6YA 5KYXB 2BP7A 4JCCA 4KNYA 3BKXA 2Y05A 3EVBA 1G21A 3KUUA 4N82A 1YZKA 4U8GA 4CJXA 2GSWA 3F7NA 3L8GA 4KAJA 1U8TA 4R3UC 2IYEA 1NW3A 1Z13A 1TJPB 1ZBQA 3FYUA 4REMA 2B4TO 4DCUA 5DB4A 2L69A 3D8RA 4OHZA 5FPTA 5HF6A 4BO0A 3IAM6 3EVZA 1IHMA 5DGXA 1XZJA 1MDBA 1R16A 3DUWA 2VF2A 5AVQA 2WTXA 4X1KA 1JDNA 3H4VA 1FU4A 3KG2A 3V9AA 4E6PA 5GJBA 3GRZA 1KAHA 3ZBUA 4WEQA 3OZUA 2A1TR 1XP8A 2BEVB 4KU4A 4MPTA 3NBUA 1VRWA 2CVQA 3GT0A 2ZTHA 1J9GA 4RPJA 4X7DA 4UHFA 2IBMA 4FR0A 1Z73A 2IY9A 5AWFC 1P2GA 4IHQA 2O8NA 1IMJA 1PZFA 1WMEA 3W5SA 1X3SA 1IQUA 1U3VA 1VL6A 1K8YB 2WJYA 3JZMA 3OOJA 4IOLA 1RTKA 1N3LA 1XN1A 2H4HA 3BRWA 1K7XB 2Z2XA 5JU6A 4C7VA 1ZC4A 5CT6A 2BMDA 4O4LA 4NU8X 3ADPA 1QO0D 3H65A 1WORA 1VQMB 1Y4SA 4RKWA 3A27A 2Y1LA 4CM8A 1G59A 2PG3A 2YZ7A 3QTBA 5F51A 3W4JA 1VDZA 4LC0A 1NN0A 2FWMX 2A5FA 2V03A 3GEDA 1NXXA 4QOEA 1KK0A 1DBIA 4CKBA 2ZAMA 3KPVA 4R3WA 2W6CX 3CO5A 5D87A 1SB9A 3VU9B 4C3UA 1P5JA 2Q4TA 3ECAA 4G0UA 3OHSX 4IX1A 4EEXA 1PG5A 1YB2A 3RAEC 4LHEA 4BEWA 2P6MA 1B43A 1UC5B 3ZS9A 1TTTA 1ACJA 1FRFS 3B1ZA 3EF1A 1W4CA 4YUZA 2QVCA 3TCXB 4RNCA 4BV2A 2IUFA 3OE5A 4UCXA 5DO9A 2DB3A 3HWSA 2DERA 1MEOA 2E37A 3DE7X 2H3HA 4PHFA 5FTNA 3WMEA 5A4AA 4QPNA 2VUUA 4C05A 3BTVA 2HLNA 2FVXA 5IKEA 3D7SA 2Y3IA 3BRCA 1XU7A 3A2KA 2EW1A 5CFLA 4O25A 1AGRA 1X80A 5A71A 3Q15C 1DG3A 4UDYX 4LDAA 4EP1A 4QRHA 3GCWA 3GY0A 1EWVA 4HMQA 2IH4A 4DZZA 4CU5A 3FGNA 1MAUA 3D3EA 4PZCA 3Q10A 1FXSA 2ZRKA 1UD8A 5LC1A 1O94C 3T99A 4IKEA 4AZWA 2C04A 4ZANA 5IVHA 3DZGA 2D2VA 4YHBA 5A4KA 1PFWA 1Y6JA 3JZDA 2O8FB 5HUQA 4P8RA 2NSYA 3I83A 2IUUA 3VOBA 3ZOZA 2AG1A 1IY9A 3FOBA 1UK6A 1VHQA 1ZJJA 4L0DA 1TEZA 3O2JA 3AP1A 3GLFE 4RETA 1VLMA 2L17A 2SNIE 3HACA 3NWOA 5F64A 5EJ8A 1NVDA 1QV7A 3WMFA 3GQBA 1QG2A 4V3BA 1FEZA 2BZ0A 3FPBA 4Q16A 3ZCSA 4FLFA 1W0KD 1E9BA 4CFSA 4EA8A 2XZPA 1DFIA 4M54A 4MAAA 4A8TA 3H2YA 5IFLA 1IMOA 4DKJA 1KZ1A 2BM9A 2Y6VA 3VKWA 4CCSA 2BFPA 5EJ7A 1DC7A 2VH5R 5M2QA 2RHGB 3IIKA 2DTXA 4RZQA 3LQ2A 1GPKA 5CYGA 5EIEA 4RMNA 2YIVX 2LV8A 5G4KB 5E6TA 1EP9A 4GC5A 5B37A 5K01A 1K5PA 5CR9A 1SUAA 1D8TA 1YE3A 1E60A 1II9A 4E21A 1IY8A 1E9VA 1LXCA 3HBNA 1G55A 1YK0A 4UU8A 1AKEA 1X9GA 2ZWOA 2Y71A 2OGZA 5CG2A 5CH5A 1QOQB 1EWQA 2BI7A 4I99A 3CUWA 4FJ2A 5E1BA 5G2OA 3GRUA 4ZC1A 4C5AA 4DRXB 1NXVA 4R81A 3MJEA 4PZAA 4QATA 4HVAA 5WRFA 2ZI3A 3DYIA 1SJ9A 4J9VA 4Y2SA 4IP0A 1OB2A 3BFPA 1UBSB 3S2ZA 4F5EA 1NV9A 4U5XA 1Q95A 3VC3A 3U3KA 4OFWA 3UAVA 4X63A 1FB5A 2YASA 2QJRA 1KSJA 4FOTA 2JL1A 4R3NA 7YASA 3HK2A 2YOFA 3B82A 5IZCA 3VV2A 2EATA 1B74A 3AFHA 4KR9A 1KZGB 1GPH1 1MC4A 2HY7A 1Y5MA 3CPSA 3GEMA 3JZFA 3OOSA 3PCRB 4XFJA 4AMVA 4UE3S 3F6PA 1Q16A 3JQCA 3NV7A 5EAIA 5BMVB 4NH4A 2QD4A 4PSUA 5DBHX 1XBTA 5FAXA 1R5BA 3EDYA 3OZEA 3EQ7A 2WB4A 1Z5PA 1Z4NA 4U4AA 4X20B 1ZH0A 2C99A 2NQ2C 8AT1A 1XZDA 4CLEA 3R6WA 1P4AA 1GQSA 5JYBA 1I3CA 5GP1A 1T9AA 2A88A 5DZSA 3RTAA 4ALIA 4D3YA 1F2UB 4IQGA 2NP7A 1P7PA 1HURA 3JQFA 1T4MA 3M9WA 3WMWA 2JZCA 1HT1E 1ZK3A 2W37A 4UVDA 1IZ8A 1FUKA 1I0LA 2ZVDA 4R5HA 3RDPA 5B6PA 3ZDXB 3HJFA 4QC2A 5EHZA 1F7VA 1JHZA 3CB4A 2CGEA 4X7CA 3UB4A 3DL0A 3SSNA 3IKTA 1YBFA 1XKLA 2YYSA 5A0FA 2Q3EA 1CZOA 2BI8A 2GZ1A 3A6GA 2F3RA 2YV1A 3D43A 3QWAA 1Z6GA 4L0QA 4QSMA 5SZKB 5LNK1 3GLIB 3BIFA 3L6OO 3MMZA 3RU3A 3VVBA 2GA9A 3USCS 3FXAA 1PFQA 5A4MS 1ZQ1A 2J3HA 4LECA 4LI3X 4LXGA 2E87A 5LYYA 5CB4A 1U1FA 3CCRB 5I4BA 4AF8A 2I4TA 4ENSA 1HR0B 2YWFA 2ONZA 2HRBA 3ERCA 4QHYA 3RS7A 2WJ4A 4JBYA 1YHZA 1VPWA 4BO8A 4FBGA 3PHIA 5FTLA 1T8SA 1PL8A 2RHLA 4RADA 4M1QA 3LY5A 1PJ4A 1EG2A 3R3HA 4D9HA 1M5UA 1JDVA 4MP3A 1KJWA 4F3TA 2O8DA 1MAHA 1KI2A 3ITEA 3C6ZA 4Z4WA 1CFZA 2OY0A 1XMSA 2H0AA 2WVAA 2R6HA 4ND5A 3TTTA 1PO7A 3NWJA 1P5RA 2FAXA 4JWTA 1EFRA 1HXHA 1ML4A 3N05A 1WLSA 4TYWA 3H2JA 3TLKA 1U0OC 3NJ8A 2X3UA 3X1JA 1UODA 5JOQA 5ANRB 1VQ7B 2G4CA 4DG9A 1CULC 4LRXA 3BXFA 3FWKA 5C80A 3NHBA 1AH2A 4UMEA 3ZGVA 5LQSA 5D7NA 1P77A 4ITVA 1UBHS 2WJVA 1FS5A 2Y4OA 4XLHA 1HDOA 1LS6A 1E69A 2HZBA 2ODTX 3DHVA 2JLYA 4LBZA 2GUGA 1TGYA 1Y1PA 3IDSA 3K31A 2YXPX 1GSHA 1XXHB 1GV0A 1FQKA 2AOXA 3DMGA 3O95A 3TW4A 3HR8A 1MD9A 5AXBA 4LXTA 2DHCA 4WXEA 4LOAA 1T5EA 1T0UA 3LVBA 4ZRNA 1TU4A 4UHJA 4E0FA 1NJID 1LSSA 2BTOA 4EUNA 3H4TA 1JNYA 2VUHB 1V5VA 4KR7A 3IO3A 2W6PA 4GI7A 2CL6X 1UINA 3C3EA 3LQ4A 2OFFA 5L4LA 4ISBA 4S1NA 3CVYA 3PUNA 3B9QA 1SK9A 3O0TA 4O5OA 4UUAA 2BBOA 5A88A 3AVOA 1OV6A 4HHEA 5HK9A 3HKCB 2XNDA 2A59A 1P0CA 1VGQA 2CJXA 2CZCA 2GK4A 2GM5A 1OTHA 2OXEA 3L8MA 4JJAA 1M1YE 1VIVA 4PO9A 3T1QA 3K0CA 1R50A 3MMXA 4L4ZA 1H0KA 5AYVA 4RABA 1I36A 3GUZA 4L72A 4U3JA 1AOXA 1ZGJA 4WZBE 2BELA 1EDDA 4EG8A 4CKBB 4NZZA 4B80A 1T1IA 2GI4A 2J6IA 4IZHA 4Z86A 2HPVA 5DM4A 1G7SA 1NKSA 2ZI7A 1NBAA 3QIVA 4XIYA 2X4LA 3UH0A 4YUAA 5BSUA 2I34A 3VJLA 4EFDA 3WKBA 3K5HA 4U6NA 4MUHA 4WZ6A 3IR7A 5LZ5A 3MERA 3ZHZA 1GLNA 1FPQA 1R0RE 1RRPA 1SXJA 2OECA 3CNQS 4JUIA 2ZIUB 4Q37A 3QPAA 1RM3A 2XADA 3WK5A 5IYZB 3DZKA 1CIJA 4MA0A 4RVSA 4UVIA 3FHLA 5AHKA 1MAVA 3QPDA 4RLSA 3ZVNA 4ZYLA 3ZGZA 4WGFA 1QPZA 2Q29A 5EMKA 4DY6A 3GPCA 2ZUSA 4UQPA 1MU0A 1RJWA 1P75A 1R88A 4PGOA 3I9NA 3FHJA 4EFMA 1K86A 2AXPA 3I37X 3VNBA 2VDPB 1A9OA 1GPUA 3AU8A 2V1XA 3VYRB 4UZFA 5TPWA 4L28A 4IZIA 3UBTA 1K66A 1NRIA 1U7TA 4KBGA 4LJLA 5D5PA 5DNWA 2JS7A 2CW5A 2V97A 3TKYA 3TNDA 4IRXA 4Z9XA 4QFMA 1CRQA 1I2DA 1U9IA 2FG5A 2G09A 3W2IA 1VCIA 2Y4NA 4FUTA 3H2GA 1SHTX 4N5NA 2REQA 3DL2A 1OILA 2JI4A 2UUPA 2ORIA 3H9BA 4XDHA 1P60A 2FW6A 4KQ9A 2J5KA 5AM2A 4OP3A 3NCHA 4HNAA 4PG6A 2HHHB 1CUSA 4GP6A 1BO6A 4ZI2A 2J30A 2POQX 2QROA 4NCKA 4D5EA 5KOHA 3N2EA 4F3RA 3EZ6A 3GQBB 1Y1QA 2GYYA 4RFVA 1KP9A 4CR6A 2MOKA 1Q21A 4C4ZA 1VHJA 3GLVA 1VOTA 2VJJA 2F62A 4IKPA 1JGTA 4LY6A 2GCGA 1K08A 2WVHA 4MHSA 4WPGA 2P6PA 3LC0A 1BD3A 2VYVD 2WQ6A 2NNLD 1RTTA 2IU3A 3THYB 5BQ3A 3OEHA 3HXOA 2CYAA 3DE6X 1WHSA 4MVJG 3FAKA 3NHFA 4X1IA 2ZZMA 4J7XA 3JX9A 4F9EA 5I7OA 2J6HA 4BE4A 3FMPB 4GLOA 5HR5A 1HC7A 1OFGA 2V9ZA 3NHLA 3KYDA 5EG5A 5ULLA 2CK3D 1OFUX 2BUBA 2QRHA 4HFMA 4NFLA 1NQOA 4ZD6A 3U39A 1AF4A 1EM8A 4IIJB 3TZLA 1BFUA 1T5LA 1Y37A 4IIUA 1KYYA 2HX1A 3FIUA 4P2BA 4RZHA 4Y6PA 1FRVA 2VWHA 3FI0A 3SQWA 1VYHA 5LKAA 4UBLA 2CXXA 3O26A 5JRJA 2C7OA 2G07A 5EMLA 1RKQA 2J87A 3TB6A 5AW0A 4MV5A 2QE7A 4YFYA 1RJ9A 3DP9A 5ALEA 3JQ8B 1GQRA 3ELBA 2XSZD 4QHTA 2ZL5A 2HT1A 1EGMB 2QVYX 3WLNA 4ON9A 2ACVA 3ZTYA 4M1EA 1OH7A 1KS2A 4UW9A 1L6RA 3GDWA 2FJPA 2DY1A 5KJCA 4XIGS 1UJCA 3S44A 3LLMA 1GYRA 4BMXA 4RZ3A 1VRVA 2PX2A 3FUUA 4EEKA 1U6KA 4YAEA 1RZ3A 3WWDA 2IY7A 3BSYA 1GV1A 2C2GA 3HYRA 3VHXA 1W4AA 3VU8A 1Q7RA 3EXG2 5FPPA 1GFZA 2I91A 4A8JA 3T54A 3AV0B 3KQYA 4ZT4A 1YB5A 4LVCA 3PIRA 3CPWB 1B0ZA 4P38A 5CM9C 3MT0A 3WI7A 1VQ6B 1ZGHA 2SHKA 3K4QA 4BFSA 2HBYA 4Y2RA 3ADCA 3SP1A 5JR3A 2WHQA 1JHYA 4TLDA 1EK0A 1J97A 4PRKA 1FMFA 1XZHA 1VFPA 5A3VA 1E2EA 4XA8A 2WF7A 4BIMA 3V80A 1RRKA 5KREA 4ZXPA 4GR5A 1E61A 5SV2A 1DBQA 2RB5A 1KR5A 5THQA 1DUVG 1ELOA 1FNNA 5FBLB 2C0PA 1KMMA 3ETCA 3RYTC 4YC7A 1X8XA 4WK0B 5DISB 2F64A 1P1JA 3R8FA 2D59A 1R8XA 1MHTA 3TFQA 1FZTA 2SKCA 4EJFA 1ZL0A 3KFXA 1DJNA 4TLAA 2BE7A 3PNKA 4CNBA 3JZIA 2O3QA 4QGHA 1CUZA 5AVTA 3EXHC 3RVSA 4QNMA 2R97A 4CF5A 1J90A 4IVQA 2G17A 3I52A 2Q0HA 4KIJA 4EY5A 1E6CA 2PUWA 4B2LA 4RD3A 1PD1A 4EA6A 4MMZB 2NZWA 1DQZA 2ZLBA 1WUHS 3GOQA 1YFKA 4HP8A 2XMRA 3OT5A 2J1LA 2ZAIA 1RRFA 4GWKA 3DQQA 4HXYA 1V3VA 3EG5A 4OJQA 1BG6A 1L5GB 4EITA 4H7DA 4EPWA 2O8DB 3JVDA 2EQ5A 3B13B 3PSHA 1K1EA 2Z2IA 3IERA 1JFTA 2R1ZA 2ADFA 2W2MA 3ENNA 3UG7A 2ESRA 4BMSA 3VSEA 3OWHA 2A58A 3IP8A 3WNCA 4HY3A 1G291 2ROQA 4KKXB 3U81A 4BB6A 1CF4A 1NT4A 3V4FA 3G82C 1SXGA 5EZSA 2W6IA 2X14A 2BSXA 3N2ZB 3JTMA 3T7IA 3BMQB 3GYGA 2Q7XA 3D31A 1G63A 2VAVA 4NOJA 4N0DA 5K6AA 5SYAA 2XQFA 4WUTA 1K9VF 5FOQA 2ZZNA 1J00A 5HF5A 1L7XA 5E8RA 3V8PA 5A03A 5K6TA 1WLYA 1ECFA 2AR9A 2R48A 2PKEA 4MKXA 1HWYA 1W4BA 4C3OB 5BRJA 3D6FA 5D84A 1Q82D 5I4IA 3TEJA 2IZ5A 1TQ2A 1Y1RA 4XIJA 5CITA 1KA9H 3CHYA 1FU7A 2WKWA 1LGYA 4MTLA 2J3LA 1SELA 3CIFA 3QBJA 5KTPA 1FUUA 5TQ0A 4ETIA 4AWAA 4KFTA 1NJSA 3P2YA 3BH0A 3VR1A 3RARA 4R1SA 4Z4RA 1P7WA 4N5HX 3KEMA 4OJKA 1N6PA 1K2WA 4DPKA 4ILKA 2A1UA 3O4FA 3AFIA 2B94A 3OFND 2WWRA 2IWHA 5JPIA 1WP4A 1DP4A 2R7LA 5JATA 5JC1A 1E3ZA 2B5VA 4RESA 3UHJA 1JDZA 1UXKA 2FN3A 1ZPDA 5CDFE 1U1DA 3WL4A 2YVLA 4TQGA 4AKIA 1O0SA 1T2CA 3B3GA 4U3JB 2NT3A 2D1SA 4G0XA 3JQ7A 1PNQA 4DMRA 3BCDA 4S2EA 3I12A 2G83A 3B6IA 3K5IA 4X1YA 2JI6A 3KT3A 5HMMA 5U4QA 3DDNA 4GBMA 7ABPA 3WADA 3AF4A 3F90A 2WICA 4FGJA 5JCPA 2VJQA 3STWA 5IMBA 2LKCA 1JWAB 2QEQA 3CLSC 4IDHA 3J80A 2RC6A 4NSNA 4QV2A 2RD2A 4R98A 1L7VC 3CPEA 1SXJB 4BQQA 5J2TA 4YY3B 1V3TA 4DIBA 1NE2A 4MGYR 1BCRA 4J29A 4TRMA 2IKQA 1P2SA 4DA9A 1P2TA 5FV4A 3V00A 2X0NA 3LF1A 4FFBA 2FMKA 4EUSA 3PQDA 5IHPA 4Z9FA 2X2EA 5C5CA 1KRHA 3SLKA 4WAUA 4COOA 5JWOA 1LTQA 5A4JA 3D5TA 3IILA 3RBAA 4P2NA 2AYZA 1I9CA 1HDGO 3VC1A 2GM3A 5JQGA 1O87A 4ER0A 2M6LA 1RIFA 3DFUA 5HGJA 1J25A 1D09A 1R0KA 3MCVA 2NO6A 1UANA 1XL0A 821PA 2WUDA 3VTKA 3MWKA 2E7ZA 5FWNA 3KLOA 3CV3A 2G67A 3L3BA 1JIXA 4CIAA 1PTKA 1RYZA 2C4VA 3OJLA 5LA6B 4G3XA 2RAVA 1ACMA 2YYYA 5BSXA 4HS4A 3WLQA 3P52A 1L5WA 1R0WA 2B3TA 4HNAB 4Y2YA 1TD1A 3I56B 5LD2B 4KBFA 2ZRJA 4B5LA 5C34B 1AKQA 3B1VA 3ZDAA 3M2TA 4HLCA 1YR6A 2R25B 3LC7O 4MUBA 4NS4A 5EP3A 1H8EA 2D62A 2LDBA 1OYYA 2G8NA 2NO1A 3O8QA 1Q12A 2D74A 2Y1EA 4IRUB 2L82A 3P2OA 4JYBA 4MP6A 4OHPA 5BMOA 5HZMA 1A82A 1G4HA 1NLZA 2IPXA 3EIHA 4X65B 1CSEE 1BA2A 1NGSA 2WD9A 2VZ9A 1X7YB 3FOFC 3FMFA 1OIXA 3CZ5A 3VAAA 2HA5A 3T61A 5CXQA 2NUTA 5C18A 1NBMA 1WHSB 1Z2PX 2IIPA 3GSIA 2WHRA 4HRXA 4RL4A 3NXKA 1YOVB 4X1IB 2I6FA 3NASA 4HWSA 1YQTA 5TQ2A 2AFVA 4DLLA 3L8HA 4ZICA 4BB5A 1X2EA 1HZZC 2FMXA 5JMTA 3KYDB 1TUBA 5FI5A 3VR4A 4ZI5A 13PKA 2MDTA 1QWOA 3MD9A 1U6JA 1YQQA 2JHAA 4TYQA 3DBOB 3RK4A 1PJTA 1WPCA 1P0MA 1QP0A 5ITSA 1RBZA 4LJ7A 4CETA 1EXWA 3I9JA 2Q1TA 5ABPA 1XKXA 1XCPA 1FCJA 1HM5A 1EP3B 3QWFA 4GW3A 3U9LA 5AM1A 4ZPXA 4BVEA 1U28A 4RIGA 1KQNA 4DBLC 4UTOA 4JX9A 4JKOA 4CL8A 3BHIA 5DHQA 5GJWC 4AI6A 4B6RA 3H13A 1GZUA 1EJ6A 3CG4A 4M8KA 4ZQBA 1JLRA 2A84A 2G72A 2JH3A 4V1CA 1RPZA 4D0RA 2XCRB 1XI2A 4MNTA 1YR8A 3PIIA 3DMRA 4TLEA 5JQGF 1MOSA 3OG9A 4LVNA 4WLNA 1FDIA 1KBQA 1OAAA 5CB6A 2ZSAA 1DCKA 3PFHA 3RVJA 4D0LB 4A8JB 1X13A 4E5MA 4LSMA 2PWZA 4KTVE 2X58A 4P0PB 4MZXA 8GPBA 3K0AB 1Z0FA 1CZLA 1SWVA 1QGOA 4LCBA 4ZO6A 3TQSA 2FHPA 2VWGA 1BLIA 4QYXA 3SU8A 3UXYA 5ECDA 3GJQA 5I7UA 4PO1A 3COSA 2D9RA 1VCNA 1I2ZA 3GLUA 1TA0A 4EAAA 1T5HX 4IDGA 2QNIA 3KDAA 4WKBA 3ZI7A 2OP0A 3EZLA 2WEKA 4B84A 2B21A 1T4DA 2QYTA 4HLUA 1UKBA 2G9VA 2P2DA 3EYAA 5CTJA 3WLTA 3IPXA 1NN5A 2PGLA 4DQVA 4HD8A 3SC3A 1GKLA 1U8FO 1YDMA 2FDCA 4L16A 2CUZA 4JGGA 4YBRA 3RVDA 1L7NA 1VIAA 1WTHD 4B40A 3GLGA 4R41A 3J81k 1I7DA 4M0LA 4W1SA 3WK9A 4J4HA 4BMZA 2Y6UA 3PC8C 1V4BA 1U8XX 3KEWA 1EWRA 3E15A 4UD6A 3RFFA 5ADVA 4L8LA 2DIEA 1T10A 4MR8A 5CK4A 2VDQB 3TVYA 4X84A 3FPEA 4FJ0A 1USGA 5DE3A 2GR9A 4JJ8A 4CU2A 4Y18A 4YXFA 5FA6A 4KTTE 2HAEA 2IYXA 2EFHB 3E5HA 1E9RA 3CXCB 1II0A 2X53S 4KITB 2MYNA 2OVBA 1QFXA 3NKLA 1RYNA 1S2OA 3PGA1 1CETA 4XFKA 4CEJB 1AKMA 2XRMA 4C07A 4D4MA 3LCUA 1V25A 3EH2A 3LXMA 4DMUB 1R8SA 1YB4A 3P27A 2NQTA 3CCSB 3MQ2A 3ENZA 3WAGA 5DCLA 3BMOA 3E0XA 4D3XA 3AKYA 2PT9A 3KJEA 5EQFA 4TL9A 1DXOA 2V0CA 5K3CA 4UPEA 3A0RB 5IABA 2PQ2A 1CY8A 1XRJA 5F1PA 4QTYA 1ORTA 3PYLA 1D0IA 3A6JA 1AUQA 1W9XA 3QLUA 1GG9A 2HF9A 3MJRA 3HCNA 3KFVA 4I1RA 1YIAA 2M32A 1ESNA 2HRQA 1GP2A 3OBIA 2MMGA 2YCLA 3V6LA 1Z8DA 2BF4A 4I8XA 1QONA 2HPAA 3KQQA 3EPKA 1XQ9A 2C96A 5C8XA 3UJ8A 3WA6A 2YWEA 1WDMA 5AVOA 4BQRA 1TJ4A 2DFTA 1R4MA 2BGIA 3FPFA 2VDRB 1BSVA 3SHOA 1GNLA 2W8ZA 4W5OA 4CEIB 5CLGA 3AVYA 2D1FA 4DNRB 2E4AA 2WYHA 3E5RA 4K88A 4WBSA 2GBLC 2I71A 2O2IA 2Y9PB 4MUYA 4MWBA 4EX7A 1PJRA 5TQ0B 3N8IA 5BSGA 5JJKA 2NW6A 3VYVA 4M0EA 1EFUA 1A7JA 1MIOA 2DTDA 2EWWA 4Y9RA 4LF6B 2WJJA 3G2OA 4YRSA 3UMMA 3OW2B 4EDFA 3VR6A 4KRXA 3RKUA 4RVDA 3FGZA 1OASA 3EQ6A 5T3YA 2OHOA 4EJ2A 3EEOA 1ZKDA 2FEKA 4R9VA 3T0IA 5LP1A 1NNLA 4QJBA 5CBPA 4PXAA 3NANA 3T1TA 1T2FA 4G0PA 2CT8A 2IU4A 1Z36A 4XJTA 3P7MA 3K09C 4WOBA 4XKWA 3E84A 3OT1B 3ZWBA 4H08A 3CG0A 1FXWA 3AI1A 3TRDA 1QPBA 3RASA 3WRWA 2ZB3A 3JQ7B 3HR7A 3R3UA 2JGDA 4DJEC 3ZNPA 1ZG3A 1MX1A 2I78A 2Z98A 3I2KA 4CHTA 2XA1A 3CNOA 3C5EA 3PQFA 4RPCA 2YH2A 4GM4A 4RZSA 1O8CA 4X1YB 1L1RA 3SZOA 3ZXSA 2PEZA 3G0OA 3SXPA 4DMFA 3T0FA 4IDAA 5B2EA 5AI0A 4L27A 1Z3IX 1VQ5B 2BR3A 4WWHA 3WRXA 4E4TA 2ZVQX 2AXEA 1RQ2A 2EERA 4M38A 1P1FA 4FD3A 2XZLA 5J2TB 3QI7A 3DCIA 2QYOA 1RMQA 2AK2A 1D6JA 2PGDA 4IJKA 3OW7A 1BCRB 1H2ZA 2Y1WA 1EK5A 4Q7KA 1P19A 1VLQA 2ACWA 3NRBA 4LBWA 4LYGA 2FRDC 1TJYA 2O14A 1W0JA 1IOLA 1G8SA 3IAS1 3ISVA 4J0FA 1JXOA 1SUBA 4BWVA 1EFPA 5CNJA 2QJFA 4HRVA 4LK2A 2ZJAA 2PLWA 1CP2A 5EXTA 1T5TA 2WR8A 3Q38A 1DO0A 4MW2A 5DM2A 4JJZA 5DW0A 1IHOA 4PC3A 1JLMA 2B0JA 2XMPA 3QKSB 2IEDA 1C4KA 3GVLA 4G0QA 3RREA 4CCYA 3S1AB 2ZIXA 4BBAA 3KBOA 5JQGB 2FX5A 3ZGOA 2QSUA 3CF4G 4JQOA 1GRQA 1MB0A 2WZCA 4QGAA 5KVSA 2C5SA 3B12A 4R8LA 2AOUA 4K9MA 4KXLA 4X0EA 3RFVA 1VBKA 3DBVO 3DZBA 4B8ZA 4DWVA 5T6MA 2JHFA 1AZLA 2VF8A 3KVRA 4YJ3B 4EVRA 5EPOA 4RD2A 3KQUA 4X3CA 3MHPA 4B45A 4JU8A 4J7AA 4AQDA 3E22A 4KODA 2C84A 3VNSA 1UDWA 1NR7A 3LXXA 2XUKA 3OAAA 4WZZA 1G1AA 1VMIA 3MCAA 4LVOA 2HMUA 1UEJA 2PSJA 3NB0A 5HKAA 4GZMA 5GIOE 1XQ6A 1OB0A 1FFSA 3DBRB 3O8QB 3KKZA 2XD9A 4KIUA 4AUKA 4F7WA 4KDFA 4F60A 5JH7A 2PD4A 1MORA 2IIBA 1KHHA 2I4OA 5F3WB 4XYBA 5KPJA 4H6VA 1P4MA 4PHTA 4RTPA 1ZI9A 4ZOAA 3QJYA 2XH8A 2DY0A 3CRNA 3QY9A 2Z1DA 4ER6A 5LSAA 1JMYA 3IE1A 1M1ZA 1XF9A 1GGEA 2J9FB 2F17A 2VWQA 4NHOA 3UMFA 3AF5A 3VFDA 2WSSA 1NKTA 1WX1A 1WDTA 3M1LA 1KDYA 4BP8A 1TC2A 3GJ0A 5FNZA 3IEIA 4QU5A 4FMDF 1OBCA 1XK6A 2VBFA 3TTXA 4LWPA 1VC2A 3BE8A 5KHLB 1A7AA 2J5XA 4EHBA 4U2DA 4P0QB 1Y8AA 2FW1A 3GJ5A 4F96A 3QYAA 1XDWA 3AUUA 4S2UA 3G0BA 3N3AC 4P1ZA 4XZ3A 2JGAA 3G9TA 3I0MA 2QIPA 3C6BA 4QL3A 2DLCX 2Q5HA 1AGPA 5H3CA 2I2FA 1TI7A 4CI9A 4F5YA 1JDTA 4HJXA 4B3SB 3CCBA 3G8DA 2BFFA 1G6HA 1XZFA 5JSUA 4P1VA 5CHEA 1Z8NA 3JD0A 4HH4A 5GONA 3QNUA 4EO9A 3DO8A 1IHPA 2QAGA 4XJXA 1V11A 5A5EA 1C8BA 2HQOA 4FLMA 5EERA 4V1CB 1JU9A 3DDWA 3A1SA 5BUQA 1YRWA 4XWOA 1N7IA 1W75A 4OHKA 7ADHA 4RHFA 4AS3A 4KJZA 5K45A 1U0EA 2ECQA 3QEKA 3PRHA 5L53A 1FY2A 4X6LA 1P81A 2F3UA 3CLUC 1Q1GA 4ZAGA 2NPOA 5CT9A 4D96A 4PY2A 2BN4A 2IYYA 2TECE 4E2ZA 4KIFA 1RBMA 2UV8A 1YZ3A 3PIDA 3EGXB 4CDRA 3C5HA 1SFRA 3ND7A 4PFSA 1PGNA 2PSHA 2CE2X 1Y5NA 1N0HA 3JD1A 4I3FA 4TTVA 1XFAA 2UAGA 2UUCB 2JCBA 2BEKA 1XYVA 2ZU6A 3BREA 3NH6A 3RIMA 4KEAA 2E2WA 4JA0A 1KXJA 4ND8A 3BMCA 4RQBA 4ZV4A 2NT4A 4X41A 1H2WA 1TZ2A 3FZGA 1F9EA 1VG0B 3K16A 3W9YA 3ESCA 3G2IA 4X61A 1K9MD 5ADUS 1NE7A 3NH9A 4XWWA 2CJFA 5EHQA 1VRCA 2C4HA 2RSLA 2V6MA 1JH9A 2AF3C 1WTAA 3ZY4A 5JPCA 3DLTA 5H70A 4GZ3A 4KPEC 2VRNA 4OLAA 5M3BA 5HIIA 2VNIA 5F12A 5JJCA 2JHGA 1M7HA 2OHGA 1G18A 1TCAA 1PYDA 1U7OA 4CZ2A 5TJ9A 2HMYB 4I3HA 2IX3A 1PGQA 3KSZO 4HAVA 4US2R 3IR6A 1XTJA 4FS8A 1Z4QA 2C5FA 5K0JA 1P62B 2FG7C 2NZVG 4JLWA 4NHEA 1N5KA 3A26A 1JVNA 1NW9B 1R6AA 3V1KA 2VBUA 3HWWA 1H22A 2MSWA 1ZW1A 2N75A 2A0UA 1K28D 3NRCA 3R8XA 5JSZB 3V48A 1KAGA 2V98A 4X92A 1F1JA 2NNWB 3JAKB 4JVOA 4Q9HA 4CR7A 1NLUA 3LOUA 4QJ3A 1T8TA 3O1HB 4LQCA 1F0NA 1OBFO 2YVKA 4B79A 1Z0SA 4H2DA 3WYGA 1P1RA 2VSFA 1B16A 2I62A 5CXUA 2FP3A 3ULKA 2FUG1 1KO8A 3ZWVA 3JWJA 4NNJA 2H1FA 3BMOB 3MNFA 3TYXA 4ENWA 5I7HA 4NBVA 2QM8A 4NAHA 1I2AA 4LTNA 4OM7A 1I5RA 4WASA 2EGGA 1LQ2A 3Q7RA 4LNHA 4HPWA 4PQGA 4FGWA 4JZKA 1Q9SA 2WAYA 7REQA 2MWMA 2PZMA 3H04A 5IVPA 2HQRA 1S9DA 1F9AA 2Z83A 1FMJA 1MTOA 3URMA 4BKMA 4BO2A 4I14A 1IE3A 4J6FA 1K8QA 3PWTA 2O2JA 1R4MB 3B6JA 4S0ZA 1A88A 3V1MA 3CVXA 1CUUA 2F9LA 1AE1A 1YXMA 2J4DA 3VU3A 2HCBA 2OORA 4LOHA 1MV8A 2Q3DA 3RI3A 5C7LO 1SOUA 3HI6A 3MWEA 5EP4A 3T4PA 4UQLA 1J5XA 3ILVA 1VBFA 4FYYA 1MIOB 1LI7A 4QXRA 4ALMA 1XLTC 1P1CA 2X5NA 3R6DA 2WKSA 1YNSA 2P4EA 2ODBA 1C0LA 3KL9A 1C4OA 4EMTA 4KL8S 5EIXA 4B3CA 2B6HA 1ORWA 1F5NA 5AFSA 3CCQB 1NQ5A 3KK0A 4N7RA 1X8JA 4DLBA 5JRZA 1E20A 4RTQA 1E5DA 3PUJA 4R51A 5BSTA 3GPIA 3K9CA 5L51A 2YHSA 5AK3A 5DVZA 1JHAA 4E94A 3A2MA 3KSRA 1MC5A 4LF8B 4ZU3A 2V7UA 3NTVA 2JGDB 5BW4A 3GVXA 4E6EA 4F0JA 1OYVA 5J5CA 1AZTA 3F7OA 4K0KB 3G1WA 4GLJA 4B75A 3VKHA 1A69A 4AICA 3DPIA 1DJLA 3RR2A 3FFAA 5C53B 2O5VA 2ZCUA 3A0UA 2DSNA 2GA8A 4LXUA 4U7FA 3OPNA 1TAGA 1UJ4A 4WKGA 2GZDA 1VMDA 5KNBA 1HY3A 1K0FA 1SVUA 1X1TA 3HY4A 3O90A 3P32A 1A5ZA 4S1OA 1CVLA 1ODSA 3UMRA 3H5RA 4G5GA 3MT9A 4NBKA 5GOZA 1DGQA 4FNOA 3R5XA 5TPZD 1PIWA 4TVOA 5MFPA 4KG7A 3AR4A 3TNFA 5KTMA 1AY0A 3EGWA 2RC5A 2B69A 2VYNA 4DLXA 4WX2B 1A8PA 2CXQA 1R4NB 5DN6D 1EFPB 1GDHA 4Q4LA 1R5NA 1Q7TA 1WSWA 4BV9A 5EC8A 5I45A 4G65A 3E5MA 4OXRA 1YJNB 3LLSA 3OHMA 3UMJA 2V7TA 1J8QA 4KLZA 4ZK6A 3PRJA 2PZEA 3LXUX 1V8ZA 4Z51A 5JSFA 5K8VA 4I9NA 1I10A 2AFIA 4XLLA 4KBYA 3GD5A 1C7JA 5EJ4A 1GNRA 3REQA 1OAOC 4XLEA 1EVQA 1O7JA 2E9SA 2AOUB 4R6XA 2WSIA 4OXIA 1P6QA 2JHPA 4AY2A 3TAUA 1NIPA 3L7BA 4RQAA 5AJZA 3ZNQA 2VTEA 3V8NA 5IYZA 4ARAA 4ED9A 2OD7A 3RQSA 5JRDS 3CC7B 4CMHA 3E22B 3H1EA 3LOQA 4C4AA 2CL0X 4P3XA 2DUJA 3TI7A 3JYLA 3VJKA 5JS6A 1Z7GA 4ARZA 4QO8A 4J1QA 1A9YA 1KK1A 1RC8A 3DE3X 4GI3A 2OQIA 4JOCA 2P8SA 2QAIA 4LZPA 1NI5A 2JH8A 4YV7A 4EPRA 2VXBA 4BNWA 1TEHA 1V7QA 1SKQA 1I51A 1O9BA 2OWEA 2VDWA 5FPSA 2ZT6A 1M2NA 3T5DA 4FXUA 5C1OA 3DAFA 1T3SA 3V8BA 1GTZA 2AE1A 3QUSA 3REGA 4RLQA 1MVNA 3KCNA 3BBLA 4IOMA 3TSYA 3H2BA 4FFLA 1SH7A 4LRTB 3VA7A 4OHXA 1G5HA 2OQRA 3C5WP 4AIRA 4OQPA 1DUIA 1MJNA 1XMIA 4NULA 2KPOA 1OWOA 3D26A 2JCSA 4MI1A 4ZQGA 4B2IA 1KJYA 4BNVA 4XOIA 4DSTA 3JR3A 4MIYA 3AVQA 1NONA 4JASB 4KB5A 4FHZA 4CUJA 1R0BA 3JD2A 3KUXA 5AD1A 3FCSB 4RKYA 2WF8A 1U9CA 4CGYA 1A98A 1EP2B 3MMNA 5CCBA 2ZRLA 3FNQA 2YV5A 3JU3A 1JR6A 5D00A 4XNFA 5EE9A 1ULSA 4PG4A 3NOVA 3QLVA 3TLAA 4A10A 2X7XA 2VK1A 2X2FA 4W9MC 1DKMA 3FHCB 4OGLA 3EFHA 2BFFB 2JGNA 3ZDZB 5LOVB 5KSPA 3D4PA 1WVIA 2EQBA 4U7GA 3U62A 3ZW7A 2Q8QA 3ZBTA 3IBFA 3GT4A 5IARA 5IULC 4ESEA 2BKEA 1T9ZA 1V11B 2DPHA 4AJHA 2D5LA 1H4VB 3ITKA 3U5TA 4MQ5A 3NHJA 3OC0A 4FB5A 1QE3A 3RSOA 3VSDA 4ZYYA 1R1DA 3DEYX 3A1FA 4RDHA 3STVA 4BGVA 5EINA 5K3DA 4F11A 4D9CA 4OBBA 2YY7A 3OPQA 3MTQA 4M1WA 5ED0A 1MG0A 4IDNA 4YV2A 5KTYA 4FEGA 4K6OA 2VI5A 1SHZA 5C1DA 3LLUA 3R75A 3O8CA 2X1MA 1IJFA 3OZ7A 3PCTA 4PINA 3ZUPA 3FKSA 2C2WA 3CNBA 1EX9A 1KMNA 3A36A 1WUJS 3OQ6A 1KJQA 4MHOA 5IAEA 2QVZX 3V4PB 4L78A 3ZV7A 4QVKA 4ND8B 3BMCB 3GN2A 3H16A 4X6XA 4MW1A 2VOEA 2YQ4A 1ZISA 4M0PA 5DU2A 5K4AA 3SCZA 2P3SA 2GAAA 3R5FA 2RGNA 3VH3A 4D81A 1ADFA 3NHMA 1EHYA 5BV7A 3C3BA 2Q3HA 1N2IA 2RB4A 3FETA 4LPKA 5DEIA 2D1QA 2LPMA 3COYA 1B73A 5KJ1A 3D6TB 1HOXA 2QSYA 3PNYA 1P80A 2W71A 3WLHA 4KKTA 4A6DA 1E0DA 2ZBUA 1CZUA 5DRYA 1WXIA 2DH5A 2GLXA 3OJXA 3L4BC 3V4OA 3SXUA 1QG4A 4P6VF 1YL5A 2ZK7A 3A9UA 3GBVA 5AKGA 1A1VA 1EUCA 1XHFA 3PHBE 5EZ5A 3HXQA 1NVFA 1DSSG 1FVFA 1RBQA 3S2YA 3QMPA 1WJGA 2HYDA 2VC2B 1VSBA 3ELWA 3MN1A 3N0RA 4PQEA 4W5JA 3WX0A 1JE1A 4F85A 1KMHA 4BMDA 3ZWOA 3GJZA 3OE1A 1NMSA 4OQFA 2HW8A 3TVDA 4A0GA 1AHHA 1AO3A 5TF4A 1SVKA 2FEXA 3WIEA 2ZE7A 2D3WA 3NHKA 2BKXA 4Y6GB 2D0DA 2FUG6 3TS1A 1OR8A 4BNJA 5T41A 4BQPA 1KQFA 1WPXA 2JBWA 4H0NA 1Z33A 2HQSA 3G0GA 1LCIA 2DUUA 1YCGA 4MZDA 4NVRA 4R1MA 2H7CA 1QRAA 2G5PA 2O6LA 3VTFA 4J90A 1PR5A 3L7IA 3UV3A 2IS4A 1LS1A 2B34A 3CLUD 1YFZA 2Y1CA 2I4RA 5C46F 4P22A 1WXEA 2ATXA 4LGCA 4I55F 3H6KA 4XB6B 2JVJA 1YDGA 1DAKA 3N39C 3UJAA 3ESQA 1EXVA 3STHA 2TMKA 1AK2A 4LQ4A 4UC0A 3P45A 4Q4HA 4OBXA 4BDTA 5JD6A 5KTRA 1U2PA 2YVAA 4BKOA 1UMBB 1Z5VA 3SEAA 7REQB 3I5YA 3PTAA 3CS3A 1L7BA 4CN9A 3SK0A 3TBFA 4G37A 2JFOA 2WT8A 3GELA 3PXUA 4M60A 4RTMA 2PSDA 2WA2A 3WL6A 4C43A 1JYSA 1MX9A 1VA5A 3NNSA 1N7GA 3Q5EA 4JJKA 1FTQA 4PTLA 5A9TA 4CE6A 2JA1A 5BV2P 1UT8A 4CF4A 2JC3A 4R8RA 4UTNA 1EAMA 5M5BA 2AEFA 3UMYA 3DFZA 3EEIA 1GL3A 4OP2A 1AHIA 4Z0PA 3QYPA 3ECSA 4NU5A 2G1KA 1G4AE 2X7JA 4ZVUA 1VMAA 1KXZA 3HP4A 1IUKA 4IHKA 1ND6A 1WUYA 2W7TA 1PI3A 1LBHA 5EY5B 1Z0DA 4AYXA 1C3LA 3V55A 4J3NA 4DHWA 1VJGA 4TKVA 2AN9A 1P2VA 1OC4A 2NOAA 4ZDIA 4Z4SA 3B3FA 2JGIA 3KAJA 3NLLA 4AVYA 5JEEA 2Q6IA 1G8HA 3IQDB 1S8NA 4ZAYA 1L5NA 3TEFA 5HXAA 3U4HA 3ELUA 3ZI4A 1L5MA 3UPTA 2HDOA 4E15A 1NT2A 2X7HA 4LDZA 1KEWA 1KQPA 1RCUA 2NV6A 4GQBA 1RHJA 4U63A 2QLBA 1I1HA 3OJOA 3PQ4A 3M9XA 4CDMA 4O3MA 4KI0A 2Q7DA 4HSEA 4XWAA 4L4SA 1E98A 2CXRA 5BPHA 3EMBA 3ICCA 1S2GA 2IEGA 1XU9A 1O95A 1SVMA 2Q0XA 1KYTA 1ZS9A 3K2QA 1JLHA 4MEBA 1EUQA 2QXYA 3EE6A 5G1NA 4ZI7F 5F1OA 5BQFA 2F8SA 2TS1A 4JP3A 4XXHA 4C6HA 4X93A 3VVLA 3FB1A 3NEJA 4YMGA 3DMDA 1UIMA 1ZXBA 3VPFA 5B4UA 3ESBA 3A9CA 2IXBA 3H97A 1CDOA 1XAIA 2A4KA 3KZXA 1NVGA 2YXEA 3OF2A 2R1VA 1X38A 4NARA 3HV0A 4YEJA 3EZ2A 5TARA 1GCIA 1YS4A 2DR3A 4YMVA 3OPYA 4O2BA 4MUKA 2X9VA 3KLPX 3BICA 4UFNA 4R2XA 3LU1A 3RVMA 2I2BA 5AO9A 3MS2A 2XGOA 4MA5A 4ZOEA 1L4LA 1H65A 1SD2A 5B6IA 3NUQA 4JQCA 1RKBA 4CT4B 4F9TA 2Q1WA 1VGVA 4GX0A 3SKXA 2LW7A 3EVDA 1FSFA 1Y9JA 2RGDA 5KVCA 1BE0A 2PYDA 4F9GA 3WXMA 2HPHA 4BEJA 4L02A 3SQXA 1SCAA 1X1BA 2WG1A 4H3KB 4JH0A 4E09A 4OMDA 4ZV7A 3H5OA 4EX6A 1IXRC 2UZ4A 5LBUA 3VZRA 3GARA 2Q1SA 5B36A 2WE7A 5KQPA 1U0BB 1V7PC 2YXLA 1YAHA 2DKFA 4R1QA 3R7SA 3VO8A 4CW7A 3CCLB 4BPBA 4QJ5A 5IT0A 3V8VA 2QTTA 4KK4A 4AJ2A 4YX9A 3QOWA 4B3IA 5GIPE 4GAEA 4AQYB 3AB7A 2D7JA 2DGDA 1GTVA 1XZAA 3L0YA 4PWYA 4EMSA 2I55A 4YRKA 5CAEA 3W6OA 3BB4A 1U2QA 2KMLA 3FJOA 3V2UA 3LHFA 1N32B 2CDNA 1FW6A 2XMCA 3FYHA 2V8OA 2VDWB 2Y99A 4EW6A 1K3TA 1DI0A 2B82A 3QVUA 1KSFX 1BHJA 2FHSA 4YRZA 5FUMA 2Q21A 4KQWA 5HRAA 1RRCA 3FCYA 2WIBA 3BC9A 1S3FA 3HNOA 5CLFA 3LDAA 4YMHA 2FPKA 2X4IA 5ALPA 1Z39A 3FRIA 1OW3B 3ZNNA 1YBVA 5E38A 4N18A 1KFCB 2GJ8A 2XT0A 2QD2A 3L1IA 4XQ0A 2UXBB 5F33A 3UFXB 1BGWA 3ROGA 3P97A 2R87A 5HIKA 2WLTA 4NENB 3KEOA 3V8QA 4DIFA 2IS2A 4G5OA 4LBYA 1CUHA 1KR2A 4Q7LA 2ISQA 4P93A 4BLTA 2H00A 1M8KA 2Z9CA 1YZTA 2GCPA 2GKOA 2D5IA 4M6WA 1RZUA 3HCOA 4PZZA 1D4AA 1T9HA 1CY7A 1FLNA 2CNKA 2PV0A 5TT0A 3T34A 1CUVA 3G88A 3ZCVA 4XKVA 3ZK9A 4AG6A 1X8KA 2YDXA 1JDBB 2QW1A 4OG2A 4QYIA 4RMGA 1U80A 3DG9A 5IK2D 3PQ3A 4BMNA 3TAHA 2CJYA 5CD1A 2GFIA 3H5IA 1LTKA 3QVXA 4IOJA 3PX2A 3BCHA 4LMBA 1TYZA 3GLRA 2FCAA 4YV0A 5IM4F 3LX6A 1TT5A 1KZLA 1CUEA 2AUMA 1SU6A 1UFRA 1UWLA 5I9TA 5JASA 1IY1A 2I33A 2YHUA 4DSAA 2YUTA 1ZOLA 3ROPA 1T25A 1JQDA 4BGUA 4BKUA 4HJRA 4HE6A 2MSCB 3NHWA 4Q4AA 2O57A 2PRSA 3A3GA 1QS0A 2KLBA 3GFPA 2K2QB 4U7DA 1QU2A 2EG9A 4Z7OB 3FMOB 3DC7A 1R9GA 1HLPA 4RM0A 4JR1A 2JJ1A 5EXSA 1KZ9A 2O23A 4GUAA 4EZEA 4GMHA 5DSXA 1NJGA 1ZJ6A 3EGDA 3PC3A 4G4SO 4RGYA 4EJSC 5ICMA 5KSOA 4Q7JB 1DNPA 4XONA 2NSDA 4G1BA 2J0SA 1TKRA 4PO8A 4JR2A 3NFRA 4XYMA 2COEA 4N0PA 2OAP1 1PKEA 1FNSA 3EK2A 1L5QA 1GDDA 3KR2A 1NVBA 3R5TA 3EEFA 5AR1A 3RF6A 4RHYA 3IT2A 4OB7A 1DFGA 4URFA 2P2SA 2C8LA 2PVCA 1QQ7A 3HEMA 3TQCA 4BYGA 4JI4B 1UMKA 2FOIA 4NYJR 3TZ6A 4I4TF 3OH8A 4M9QA 1PFUA 3DTVD 3FB4A 2UZ0A 5JMOA 3P9KA 2J41A 2GH1A 2IYUA 5K05A 4HWOA 4O59O 4WLFA 1ABEA 1CJTC 1EVKA 2FZVA 3C15C 3L7OA 4BQIA 2XVZA 1FJXA 2PMWB 4E2XA 3GLHA 3RPEA 3W9SA 4GZ5A 4RULA 3LKBA 1E2FA 5E1MA 5TF0A 4B2PA 2DRIA 4CVNA 1HORA 4CI0B 2C7VA 1BWRA 2TMGA 1NUSA 4MV0A 5I9MA 1VQ9B 2H1SA 3THXA 4QZVA 4KDEA 4MRPA 1FYDA 1N5MA 1IHUA 4WZTA 1YQGA 5JWHA 2FEPA 2WMYA 1YZGA 3WB0A 1NG9A 1ZUNA 3N0VA 5HA5A 4PGFA 3S8YA 3ACBA 3CCCA 1M73E 2ZXIA 1QZUA 3FCAA 2X15A 3LO5A 5D01A 2HC9A 1ISFA 1ZCAA 5AVKA 1KE1A 1A96A 2ACEA 2GBFA 3HN7A 3L6UA 4FSXA 4JVNA 4RKRA 1C50A 3X2EA 5HJ7A 3PCXA 5KWIA 1KO1A 1J22A 2AJDA 5TMPA 2FPUA 1WEHA 2EJVA 5JCJA 5J4VA 4RQTA 3KAPA 4OO3A 4G8DA 1VQKB 4C04A 5JY6A 3K1JA 1T6YA 1S3IA 2WF6A 4RMIA 3P9YA 3GLTA 4RGQA 1E9EA 1E3TA 3KOOA 1K7YA 4UAUA 3WGNA 3BS4A 1AQLA 4TS9A 5T8KA 1SXHA 2BCJQ 2DTEA 2QN6A 3PFWO 4PQRA 2JVKA 2TYSB 5FWYA 2NU7A 4F12A 3WG9A 2CDBA 3D3JA 4YONB 5U9CA 2OXCA 3E4DA 4UEJA 4BLQA 1T3TA 2G5CA 4TQAA 3K5WA 2AZMA 2ONCA 2B25A 2Q0SA 5AVUA 3IYLW 2V7QA 5AKJA 1X92A 2OBNA 3ZBQA 4CKEA 4EKNB 1F60A 4MS3A 4DSOA 1GCOA 3UK7A 4JEMA 2QBYA 4MW4A 4DV7B 5I9SA 3ECCA 2ZT5A 2K5UA 2IF2A 4TL7A 4Z3KA 2PFKA 3DHEA 4IILA 4B6SA 3RSZA 1YFLA 1V8FA 1E89A 1IHDA 2H48A 3D6VA 2VUIB 3N7UA 2IPOA 5E0KB 1YFJA 2GWHA 3F6EX 4WH0A 4TKVB 2ADOA 2R5FA 2G25A 2BFEB 3FYDA 2RMKA 5EZYF 3KWFA 1A2QA 1U0JA 3A6HA 1TX4B 3DT6A 2I87A 4V3CA 1YASA 5J63A 4DLNA 3EX7C 4FGZA 2UUOA 3KTAA 1O58A 1R6XA 1L8XA 4B4OA 3ROKA 4DM4A 4NZ9A 2W2XA 3AHHA 3RVKA 1LBQA 2JBAA 4TQ9A 4QU0A 1NF2A 3RQIA 3EY9A 4DG5A 4CTMA 4YMLA 3DAHA 3NDPA 2DHDA 4BNLA 4AG5A 1RFGE 1SQFA 3QF4A 1KEEB 2A3NA 2I4IA 3FFBA 5AVYA 1LWOA 1XZMA 4YGXB 4MB0A 1JAZA 2OHIA 3KJQA 1PGJA 4BNUA 2EZUA 4HO1X 2C97A 1UP4A 5FFFA 4KMRA 3C8ZA 3GEGA 2CRVA 1VTKA 4KQIA 1QKKA 1G6OA 1KKLA 4ZGBA 4JV5B 4YAIA 3PGMA 1JA9A 1VL5A 3R7DA 1DKNA 2IPAB 5FR2A 4DADA 5HOEA 5I7SA 3A3OA 5AW2A 2I3AA 4LYEA 4BX8A 3H1TA 1J8YF 2OHFA 5I9NA 2R1VB 2M5SA 4W9NA 1E2KA 1TJ3A 1Y0RA 2AQ8A 3RS9A 4U6SA 3DBHA 3OIGA 4ZYUA 2MINA 2OFXA 1DEOA 3O1IC 4FDVA 4HEA1 1L4KA 2V4MA 2WDZA 3II6X 3OEED 5LZ8A 3GLFA 4TRJA 3Q3AA 4B3BA 1LPMA 1R15A 2FW8A 2WKQA 5ENDA 1E1KA 3ONYA 1X7WA 3GX1A 3JWPA 4WERA 4YP5A 2V6IA 1FIUA 2Q3JA 2P8JA 1P5FA 4JBWA 3IEPA 2IX9A 5IT9A 1TQHA 5FTKA 4Z8XA 3CR7A 4WW0A 1K27A 5JLAA 1ESZA 3SFVA 2DR0A 3KQVA 1T0IA 4UJ5A 3CSUA 5H80A 4M2LA 2FZWA 1AIPA 3E2MA 4GPIB 4H4CA 4MH0R 4BO7A 3M33A 4YI5A 3BE4A 4FW9A 2RGAA 4R4JA 2NM0A 1LLUA 3T3OA 4XM1A 3A10A 2Q2QA 1I1QB 1ZM4A 2JCXA 1I9GA 3PXGA 1FMLA 3G0CA 1KBZA 1GAJA 1J06A 1UPUA 4WVFA 4G09A 2ATVA 4KE8A 3IV9A 4NG5A 4ALJA 5B2ZA 3NDBB 2WU4A 1KIMA 2ZUBA 4HOYA 5E4FA 3I2HA 1N5RA 3MTIA 5BVHA 2PZLA 1FNDA 4MLDA 4TX1A 2WF9A 4JC5A 4OHBA 3BD7A 4YMSA 4NBRA 3TH5A 4CF3A 1U0LA 3CT4A 2PKQP 1TYAE 1MA3A 3HHEA 5CX1A 4BZWA 4V38A 2ZTVA 3I2GA 4O4IA 2OO5C 4A82A 3BTUA 3SJZA 4EJMA 2VJPA 5ARBA 3RGGA 3GJXC 4ADSG 3JATB 4OYLA 1Z2OX 2GHIA 3P1JA 4I4IA 4UBIA 5G0UA 1T36A 2PQMA 2YUIA 3UCXA 2DT8A 3FE2A 2I2CA 3KSUA 5EEGA 2BLLA 4JJFA 4RZUA 3LT5A 1R7RA 4FUQA 3L79A 4KLNA 4BNYA 4UE2A 4EYEA 2ZSUA 2FPXA 2FWIA 2H8KA 4KUEA 4Q4JA 4AKEA 1G0OA 1UBRS 2M2IA 4CBVA 4GYYA 3OZWA 5IC6A 4HQKA 4PXSA 1UAYA 5KOJB 3O7WA 3QVKA 4HVLA 1L7OA 2D3LA 1G8MA 1UP7A 2OC4A 2OV2A 3L82B 2D1RA 3JQAB 3C24A 2WDPA 4JP1A 2G82A 2W90A 2P6UA 2VP6A 2EG5A 3MTGA 3UC5A 3OCZA 3A1CA 1OXBB 4HDCA 4PYIA 4QYIB 2ODEA 2X8JA 2AHRA 1Z0UA 1M0TA 4MYHA 5D1NA 1YVPA 5HS6A 3FTQA 5B58C 5FOXA 1P1HA 4K3VA 1QR2A 4L2IA 1NUAA 4LA4A 4Y9SA 5A5FA 3QPWA 1TT5B 2AK3A 3H2SA 4AROA 5FEMA 4F5ZA 3WGVA 2O6HA 4NECA 2GAJA 5FOTA 1AO0A 1U9JA 2OCLA 3I92A 3HUUA 3OECA 4AJJA 4M86A 4QXOA 2EU8A 2GK6A 4MRMB 3RWBA 1HNZB 1QS0B 3CEMA 3TWOA 4BNMA 1XEFA 2LCIA 2WV9A 1Z0ZA 1L4EA 4OLHA 1Z08A 4DZRA 1HE4A 1YS7A 4ZAXA 3U6KA 1V7ZA 4M53A 2VK8A 3EGIA 4F84A 4HWRA 1R3DA 2Z58A 1UFOA 1FQWA 1OGJA 2DFNA 2YRWA 3HZHA 3IIMA 3T41A 3Q3CA 4OCZA 3T7SA 2PGOA 4P53A 4BRUA 1Q7YD 3K0CC 3ZGLA 1QLHA 5GADl 4PV7A 4L1KA 2J45A 4OQXA 3COWA 3UQYS 2PT5A 4C78A 5JYCA 3I04M 1NVVQ 5J4KA 2PXHA 3EPLA 2Q9CA 3RD5A 3CUKA 3VV3A 3INGA 1FW8A 2QTRA 2WIAA 2AXQA 2CZQA 5TNXA 4QUKA 4R6WA 2G7ZA 2YNMC 1B1AA 2P4SA 2Z6BD 2FQYA 3OE4A 4R9UC 1VJTA 4MYUA 1YD7A 1MO6A 2GFHA 1CUXA 3MTJA 4ND2A 1FFCA 3ANLA 3A3NA 3NEPX 1P3DA 3E81A 3ZV5A 3WO1A 3CTPA 4AYTA 5CFZA 3R1IA 4LYAA 4C7JA 1XDDA 1W5TA 2ZJ0A 3OKXA 2WA1A 2HCFA 1GKKA 5DHPA 4CDNA 2VYFA 3L04A 4RPDA 3FF4A 2HQ1A 3NBKA 5FWDA 3THXB 2A0WA 4G5HA 4MA4A 4PIMA 4A1OA 5IKPA 2AJTA 1J8VA 5BV0A 1BE1A 1W0KA 2ZI9A 3CW8X 1XJQA 4DWOA 4N3GA 3GW8A 4L73A 1DWUA 2QD3A 1LI4A 3DNPA 3NHRA 1A8SA 1KJJA 3IQZA 4PW0A 2IHKA 4NH0A 2F43A 4RXUA 5AQ1A 4D3SA 4RK7A 3O91A 1PWEA 1SNYA 2ISSD 4XQFA 4GX5A 3GFQA 4PAQA 4HLDA 4F8YA 2PZAA 1CW2B 3QV2A 2QGFA 3ZCRA 1MT0A 1Z6XA 3O92A 4M9ZA 1QIMA 5KW9A 1DWQA 4Z3DA 3WWOA 3U7IA 4P4SB 5LL6P 1V0EA 5JJLA 1TLFA 3OZVA 2OV8A 5JAMA 4IH4A 5CM8B 1GR1A 3UM9A 4GLLA 1E96A 2PD3A 1SUSA 1RYEA 4A0RA 2KBFA 4Q7QA 1RACA 2O5EA 3A32A 1CK4A 1HYEA 1KERA 1LX7A 2NU7B 3BY1A 1T6NA 4U2GA 4WDRA 1MABA 1RKVA 5AJVB 3TTUA 2ZPUA 2FPIA 1OE0A 5ELLA 4B8YA 3DQPA 5GJVC 1E7QA 3CMCO 3CBQA 3FWHA 4NAVA 4JYZA 3O1LA 1SQSA 4FQ7A 2PY6A 5H3HA 3WOHA 3UGTA 4PAMA 3RAPR 2VTBA 4CKEB 2AG6A 4F1JA 2P75A 1YVUA 5JHGB 4KHPB 1A9QA 1JZSA 2EJWA 1XCOA 3ABRB 1G3RA 4PRLA 4EYOA 4GXTA 1E5VA 2VJLA 3E4CA 3KR9A 3WGGA 3KAQA 2NYUA 3EEBA 4P4NA 1V5GA 1G20A 1ISJA 1GUDA 2B35A 2FSGA 2X42A 4RV9A 5JNLA 2YN4A 1KIAA 4Q93A 3IMEA 2XWQA 4C4SA 3S2EA 1EHIA 1DARA 1FL9A 1QBKC 4G0OA 2MSDB 3KTAB 3GOHA 4ZODA 2J5BA 3K20A 4G25A 4DVJA 3C6XA 4M0CA 1QQBA 4QM6A 2HMTA 2AT1A 2JBAB 1STOA 4OK3A 3TTWA 3COPA 4I81A 3I62A 3O8DA 1AJEA 2B2NA 4D26A 4RDCA 4MR7B 2WE8A 2EOAA 3ESDA 1U0HC 5EXPA 1N2JA 1QOPB 5ES3A 2CVZA 1EK2A 1RRVA 1U8UA 4N5IX 1N2ZA 4EHDA 1T4GA 5CCDA 2AUNA 4DR1B 3EXIB 3SVLA 2ZZGA 1GZ6A 3IQEA 1U4OA 1G7CA 1UF9A 4P82A 3BL5A 3CR3C 5KJ6A 4EHAA 1ZVQA 1M1XB 2IYWA 1TZCA 2HU5A 3C0KA 1TMKA 3IEKA 3C39A 4GYKA 3DBHB 4MULA 4E33A 2MINB 3VDNB 4BNDB 3S8MA 3GLFB 5CVTA 1UK8A 3CPHA 3TD9A 2CNDA 4GZLA 1DAPA 2NX2A 1E64A 4I3GA 3CZPA 3E18A 2WP8J 3W06A 4DNTB 1X7WB 5JISA 2C4TA 1WOMA 4GE0A 2GCIA 1TZMA 2ZJ5A 4CT5A 4EY7A 2IYLD 2I3GA 3HGQA 3LT4A 3NUGA 2GKSA 3AY6A 4OKIA 4YIKA 2ZJOA 2HMWA 2C58A 1H8HD 4YQEA 3C43A 3IUQA 3G2JA 1HEIA 3INTA 3PC4A 4FT4A 1W93A 4XMYA 1EHCA 1JFVA 1V1JA 2YFHA 1ZW6A 1ORDA 1EGAA 4OQLA 3V3TA 4FX5A 1G3UA 4Z7QB 2GBIA 4OYRA 1RWXA 5H4GA 5DOZA 3I2IA 1N2GA 1NVUQ 3KIPA 2H18A 1KGDA 4ZT2A 4GYJA 1NN1A 2YINC 2PYIA 4BDSA 2P1DA 3U7FB 2V45A 2WTUA 3E35A 3HDQA 1PBNA 3RB8A 1FDUA 3OPXA 5EWJB 3RO7A 5B1YA 1E3DA 1G21E 2FNAA 3MFQA 1MBZA 1RW4A 2XAUA 4MYTA 4KV7A 4Y30A 5SZJA 3R5KA 4DIEA 5JDCC 5CX1B 4UNIA 2ZZEA 1M2OA 1T8UA 3OKFA 3OM0A 1P7CA 1ODIA 5FUBA 3EDMA 2X4GA 2QRUA 4B81A 3OU2A 2AYYA 4OHRA 3USES 4WESA 1SQ0A 1XALA 1NULA 1PK8A 2ZJ2A 2ZW9A 3E9EA 1TMYA 4Y6QA 3SE7A 2KX7A 1OTXA 2C61A 2WUGA 3VSAA 2EP5A 5HBRA 1QQ6A 4IXNA 1T36B 1ZOSA 3BJEA 3S68A 4CQLB 1ES9A 3A4YA 1JECA 1VKJA 4WECA 2ZCVA 1P1IA 3KOWA 1JI3A 3OOHA 4NJEA 3F6RA 3HCAA 3KWMA 3C3YA 1AN9A 5KYWA 1RQRA 3I23A 1IZ0A 3F96A 1U0SY 2OYNA 3GVHA 1CR6A 4RXTA 1D2NA 3NT5A 4P3IA 5ALTA 3LHSA 1G60A 4WEOA 3UPDA 3PKZA 4PZ0A 4PE5B 3GZNB 4KPUB 3GJSA 2FR8C 3H9JA 4GUDA 1NAHA 1YZQA 5IYWA 4FD2A 1FTYA 3FR8A 1NW5A 2VPYA 5DYYA 1J8MF 3TJZA 3L0SA 1U7UA 2OLJA 4ZT5A 2O2YA 1HF3A 4PZ9A 2O2EA 2ERXA 2D0OB 2JLCA 3C98A 3DAGA 1HYHA 1DKLA 2O7QA 2WU3A 1J2TA 3IOEA 1NVAA 3VMMA 3KT0A 4LW8A 2PH3A 4OQEA 4L2IB 3OZRA 1ODCA 4FYWA 3LGAA 3R4CA 1NQVA 1JEEA 1PFYA 1XZQA 1XTSA 4KN6A 4M8IA 3TLZA 3ZJUA 4X7EA 2WJHA 3G6WA 2EJBA 4ROXA 2V5AA 3O3CA 2ACKA 5BSKA 4KXXA 3WIOA 3U60B 1H1DA 3DNFA 1IAQA 1NY6A 3BXGA 3I28A 4PYNA 5KYGA 5NULA 4JGBA 5ILQA 3LUHA 1KY5A 2YOGA 1ZX1A 5EIAA 2ZYSA 4XLZA 1LK5A 5BN5A 1O3YA 4HVTA 4IH9A 4MW7A 4U7HA 4A73A 3BF8A 4CL2A 3RRJA 1NVXQ 3AVVA 5KNDH 1H0SA 4Z53A 4RJJA 1GNVA 1E1LA 4CM4A 2FFQA 4XWKA 1VKZA 4DCPA 1YTLA 3E8MA 5BYBA 3CCFA 3RUFA 3MLBA 4CKWA 2PJUA 4YMTA 4AQ7A 4EAQA 4XTCS 4RGVA 1XEAA 3DHWC 2F8TA 1IJBA 1PJ3A 4M22A 3GCGA 3EHEA 2H4WA 5KAMA 3IRUA 3RUEA 4B4DA 2X85A 4MWDA 1B14A 3G6EB 2H17A 4DV0B 2PUBA 3CE9A 3E9CA 3KWLA 4B35A 1O4VA 1DT3A 2G8LA 1JDJA 1YBHA 4BO4A 2C4WA 2FPPA 2HRZA 1W25A 4NDNE 1R0XA 3I30X 2CLIB 3M81A 4UPDA 5EKUA 3FZNA 4XCVA 1EFRD 1CJSA 1B8UA 1NC3A 2VUTA 4RVGA 2OGUA 3CW2A 3AKDA 1A77A 1A9ZA 1FP2A 1GNPA 2Z8YM 3DZFA 1JTEA 1KJNA 1ULTA 5IH7A 2WM8A 1M0EA 3HBFA 4LF7B 3FNFA 1HYGA 2RK6A 3KHUA 3IUMA 4MVWA 2H1RA 4TV9A 3W4KA 3F9RA 1PNRA 3JQBC 5ALIA 5AI9A 1KI9A 1Y7HA 4CT0A 3LDUA 3OIWA 4QT0A 1XDZA 4OM8A 3JS5A 3QV1A 2BEUA 4RM3A 4DBVO 1EB8A 4L5YA 4U00A 3VJMA 2A0YA 5AW5A 2IOQA 5FLXA 2F43B 2VYVA 3KV3O 1F5SA 4I9GA 3B3AA 2BRUC 3VTZA 1CXZA 2R1TA 1PT8A 3IUSA 3UXMA 4YLYA 4RY0A 1YU6A 2OA0A 5K0SA 3FDXA 4TZTA 1RM5A 3U4DA 3SNKA 2YHIA 2AN1A 1L8AA 1GU7A 3DFIA 4LY3A 1N9GB 1Z82A 4EECA 5IEJA 1M6VA 3IEMA 2QW0X 2QLFA 2I2WA 2ZZFA 3GXBA 2CK3A 3P0JA 1LRJA 2JJQA 4CIYA 1IH8A 3N28A 4Q0MA 4F45A 5LYJB 5AHXA 4DV4B 1GQ2A 1M1YB 1JS1X 4GECA 3T5AA 1G1MA 3JVEA 3OTHA 3UJ3X 1FDOA 1MABB 2ZYIA 2XNDD 3SJUA 2QY6A 1QGDA 4KGZA 2FPIB 1KNXA 1ECGA 4ZVKA 3P9IA 2C2XA 3RSQA 4Q12A 4BLSA 1T13A 4B7AA 4Z54A 1GQOA 3K35A 4AY6A 4CMAA 1KGSA 2GERA 4JXZA 5ER6A 4NFYA 2ZVPX 2VTBB 2QTNA 1DLJA 2XSZA 1E4VA 2YW2A 3DVLA 1O94A 5FL3A 2ZULA 3WLJA 4A15A 4OFXA 1GU1A 1HFWA 2G77B 2YNMD 3WK4A 1LDEA 3P4YA 1VHDA 2V1UA 1ZA1A 3ROZA 2WYUA 2ZDGA 4QREA 1GZ3A 2K7ZA 2MJLA 2DLDA 2QUZA 5J3JA 5JSYA 1BJRE 2AB0A 3AXTA 1PRYA 1CC1S 5ES4B 2PX6A 3GCZA 1YZYA 3CEPB 2JIQA 3U56A 5TGTA 2PKXA 4QOJA 3HKEB 4QGBA 4YMUA 4AULA 4YGYA 4A03A 1S2LA 2BF7A 2ZE5A 1OA0A 1UJMA 4LSWA 4WCDA 1W96A 3LCJA 4HYEA 4G4GA 1TPZA 2FY8A 2RH8A 3DFMA 3VNAA 2CHVA 3IUNA 5IANA 3I4LA 5DNVA 2NWQA 3F98A 3QXSA 4XX0B 4B4KA 2GF0A 2PKWA 1WO8A 3N8NA 2GN1A 5HDQA 2CFRA 3K8OE 2EDCA 2J33A 3AC0A 2BGTA 4NEGA 1TF5A 1DWPA 2NZXA 3FA2A 1LJ8A 1NTOA 3E53A 4RJLA 1YJCA 1JFFA 1HFEL 1THGA 3H1PA 3JWGA 1U4SA 2Q5QA 2PS3A 2W6MA 1L4MA 1Z5OA 2I5PO 3Q7IA 4D9JA 3H6HA 4NL4H 1DLIA 4KLCA 1JW9B 1G3QA 2O7RA 2HSWA 2R7AA 4Y7DA 5JCOC 3DP7A 2VPZA 4DLWA 2C7BA 2CWWA 3O0DA 3R7AA 4Q3NA 4ER3A 1ZMXA 4N4AA 4KXUA 3GZTB 1VPLA 3OUUA 4C03A 1NBWB 3IVAA 4TKUA 3EUAA 4BTLA 3C41J 1H69A 2QYHA 3K1AA 3CTAA 2QZZA 3I09A 1H5NA 4IFBA 3A8TA 3E20A 2R96A 3HXKA 1A2BA 3LL7A 4OAOA 2PRYA 3HXTA 5JAIA 3QKRB 2OK8A 2VAWA 2Q99A 4NCHA 2QMHA 4OUDA 5JO0A 4ER7A 2AOVA 4ZCPA 5HGXA 4GMKA 2CSUA 5C8ZA 1QVVA 4O2AF 4JI6B 2H1WA 2RHWA 5GTDA 1U11A 4KR3A 4RELA 3HJTA 2VK2A 4C08A 4L5CA 3STYA 5JSKA 2AG0A 2WG2A 4B3RB 4E5YA 1IWOA 4KQXA 3OM8A 1T9GR 5C1BA 4B3MB 4F4FA 1LDYA 1U31A 5AT1A 5DYWA 2OZLA 2I2DA 3JQPA 2DETA 2P4HX 2D00A 1II8B 3ZU5A 3ZGYA 4G8CA 3GFBA 1DIBA 1FS6A 3DQZA 5A4FS 2HL6A 4FONA 3IJEB 1D5WA 3V2IA 1Q0UA 1P6UA 3O9VA 4D4GA 3N58A 5LBIA 2HGSA 2MSEB 1LFAA 1ZGAA 3DEIA 3ANMA 1FFGA 1UXJA 3E1GA 4AWXA 4DABA 2JIRA 2OV6A 3O9MA 4ENVA 5A0VA 4IFIA 4YJGA 2G06A 3H7AA 2CKMA 2Y93A 3GHHA 4GOMD 1HT3A 2RGBA 1YMUA 3G23A 1SD1A 3NATA 4IDOA 2HV8A 3N87A 4NJEB 3KKEA 5DGCA 3ILSA 3A9TA 1U8CB 1P39A 1U2EA 2GPBA 3C8DA 5AJHA 2FW7A 3ZEAA 4WXPA 1YONA 3OFNA 1VIDA 3KB2A 2ZRQA 2P78A 5GVRA 1KO4A 1PD0A 2CDAA 4C0HA 1YT5A 1I1NA 3AW9A 2Q5LA 1B6GA 2K87A 3AI2A 2FUKA 3AX6A 3CD6B 4UZUA 1BFDA 1Y4DE 3I3SR 4QYTA 3S2SA 2OCBA 1UBJS 5E2IA 5JZSA 2ZM6B 3TXAA 3TEMA 3PGXA 4XGRA 2AW3A 4PLZA 3U5ZB 4RD4A 4DAOA 4WFQA 3HDGA 3BGVA 4JT4A 1QKJA 2I3BA 2ADMA 2HCRA 2ZSBA 2LNDA 3CZAA 4IR7A 3MOIA 4AUEA 3F4BA 1E2QA 1A9SA 2VNAA 3G9QA 3VPHA 3I58A 5CDSA 4P5DA 5AHRA 5HZBA 4AK9A 4ZJPA 4ZOLF 3AIMA 5CPBA 1LNZA 2VA8A 2XTNA 1LF0A 4B4VA 4QLBA 4NOLA 1AQYA 4W4TA 3JQ6A 3LUFA 2ZXFA 5BPFA 4PRZA 4E22A 2WRZA 1UDBA 4V03A 1GGKA 4TUYA 4MW0A 5IBRA 2PAAA 2ZJBA 4HV4A 4LDPA 1P1KA 3FD8A 4CWAA 5IYQA 5D5QA 2C7PA 3VDQA 2GCNA 2WZPP 3G9XA 5I7WA 1LRLA 1SCDA 1Z0JA 2GJPA 1Z2EA 2XA9A 3KLBA 1RI2A 3DL7A 4MUFA 2CFTA 3MZ0A 4AX4A 4CM4B 1SQGA 1T8YA 2PBZA 2PGNA 1Y3FE 1LBIA 3DLHA 2GZ3A 3FOAA 2ICAA 5ERYA 2L2QA 4XRRA 5K8IA 1A7KA 2HF7A 2ZYDA 4XN0A 1O2DA 1FF9A 3F74A 3I0ZA 3MUOA 3OE7D 4J3JA 4TTAA 3PNBA 4XUDA 3VPXA 3B8HA 3X2FA 2M1ZA 1B93A 1I0IA 3LQRA 3ZQ6A 1KPIA 5A4IS 2D7DA 3LPAA 3K2EA 3VQTA 5C9ZA 5K9ZA 4TYYA 3SLDA 4X5OA 2VT7A 1IEXA 1W6UA 3E7WA 4Q9IA 2FPPB 4WL0A 2V4UA 2EF0A 2VBCA 2Z8XA 2RCYA 5CVVA 4ZEWA 5B3JC 5KMGA 4LFCB 2F00A 2P9BA 2ZPAA 1ZNYA 3B38A 3EWNA 4G67A 4TVBA 4IJMA 2Z6UA 1PYGA 3WQRA 2WYVA 3THWA 3JWIA 1MP0A 1EK1A 3C3PA 3M1IA 4N0QA 5IAGA 2FMUA 2M9MA 4ZYVA 1HA3A 5AUOB 1ZOIA 4TV9B 3NYWA 3LF2A 4LGVA 4B33A 4NEHB 5J47A 2KM1A 2EX4A 2HA0A 3RU2A 2ZM5A 2JLUA 4CLOB 2NTEA 2C78A 3PG5A 5GWXA 3IOYA 3L40A 3ZHOA 3MRXA 3NGLA 3OQBA 3ROEA 3CKLA 3N3BC 2OESA 3EXEA 3KXIA 2B4KA 4NZPA 3GJ4A 3MYYA 4HDNA 4A5SA 4M0DA 3GLQA 1UT5A 3DF9A 3N2KA 5ALOA 1DQYA 2WJPA 4RKQA 4HNUA 4X95A 2YHIB 3KKOA 5LXTF 3TLJA 4HZIA 3IC5A 4JLVA 1GPBA 1E8NA 5JMWA 1M6VB 1VPDA 1B6RA 3ZLBA 4IDBA 1DDGA 3RRYA 3ZW8A 2BGRA 1MCZA 4D46A 2UKDA 3AR7A 4HDSA 4JR0A 1BWQA 5EVCA 4DIDA 4O4JA 1QF7A 4XM0A 4Y2HA 2C2KA 4NU6A 4DCMA 1MPTA 3GAAA 2OP1A 1YUNA 1AV7A 3EUEA 2AC7A 2RHBA 4R8MA 2ID9A 4J0DA 2AR0A 1WU7A 2MSNA 3KUKA 5AKEA 3LQKA 3P2JA 3PZRA 1UBNA 4US1R 3TG2A 2UUAB 4LNUB 4BEBA 1TW3A 1GDTA 4OXYA 2QI9C 3TZCA 1UKEA 1BH2A 1GA4A 2VHYA 3I5AA 1JX6A 4M87A 4MW9A 3VZBA 4P33A 3W8RA 2DF8A 4AJIA 1ZJYA 2FWAA 2Y1GA 2X5XA 3OO1A 3RYFA 3ZW9A 1WMSA 3I42A 1IB0A 1BS1A 3CT6A 3PFBA 2G28A 2YZGA 3HADA 3GAMA 4EG5A 4IIYA 5C1IA 3ZPNA 3KL4A 3FDJA 5CUQA 4JLOA 4N7JA 1N3YA 1QLJA 2LCFA 3ORQA 1GCUA 1K6JA 4KYVA 4LE0A 3BWEA 3G3EA 2HD4A 4NQZA 2ZDQA 5IP5A